1R3RA

Uroporphyrinogen decarboxylase with mutation d86n
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSNILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uroporphyrinogen Decarboxylase
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3rA00
3GVVA 3GW3A 1JPHA 4ZTYA 1U22A 1R3SA 4ZTXA 3GVWA 1YPXA 2INFA 4L61A 1R3YA 2Q71A 3PPCA 3L7RA 3PPFA 1XPGA 1R3RA 1T7LA 1J93A 4L65A 1JPIA 1U1UA 3GVRA 2Q6ZA 3BQ5A 4L6HA 2NQ5A 3CYVA 3GVQA 1R3WA 1XDJA 4L64A 3PPGA 1UROA 4AY8A 4WSHA 4L6OA 3RPDA 3PPHA 4L5ZA 4AY7A 1R3VA 4ZR8A 4EXQA 4QQUA 1XR2A 3BQ6A 3T0CA 3GW0A 1JPKA 1R3QA 1U1JA 2EJAA 1U1HA 1R3TA
chains in the Genus database with same CATH superfamily
3NXFA 1N8IA 3ABZA 4D8AA 4MOZA 3M7SA 2IKIA 4MTVA 2V2HA 3ARZA 3UWZA 4JTQA 1TWSA 3B8SA 2NSOA 1J8VA 5C0QA 3C2YA 2YPIA 3RXZA 1VYRA 1F5ZA 3WLRA 3E74A 3G22A 4GJJA 4LYRA 5CC5A 1B30A 1H2JA 1H5YA 1JDDA 4M8UA 3FYPA 4K36A 5H6HA 4QG9A 1BAGA 4LT9A 4UFIA 3DBPA 3TYBA 5C9WA 1MWOA 1AH0A 4W5ZA 4O13A 1S1RA 1KBKA 3BPWA 3NDOA 1IT7A 4Z2KA 4O8AA 4C7DA 2NUYA 3W1QA 1KFJA 2CLIA 2GJRA 3TTOA 5G4WA 4D6EA 3GDBA 1QPOA 1W54A 4GUIA 1A0DA 1LG2A 3BJFA 2VFEA 1RQEA 2WSRA 3B8DA 2UBPC 1E6PA 1SO4A 4IJRA 3TV8A 3PZIA 4GZ7A 1RUSA 4DJDA 4LPCA 3N3TA 3ARXA 4C6BA 2Q6ZA 1Q6QA 1I2NA 3RJYA 1V6WA 4EANA 3CUHA 1GGOA 2XH0A 2E6DA 1NSJA 3KVKA 3BURA 2GGHA 1JCLA 2E6YA 4KT2A 5H8MA 3TFCA 3R10A 4HNLA 1BWKA 4PB4A 5IM51 3UCQA 3PPCA 3HOJA 4WSJA 5I07A 3SURA 2POZA 1A80A 3EOSA 2RGMA 4PTVA 1EEXA 4S3CA 2F61A 3N11A 4P8XA 1S5VA 4YYCA 3GKAA 1BWVA 1WA3A 4ZCWA 5D04C 3H26A 4LYPA 2W5FA 5HPOA 1Q6RA 3EMCA 3WK2A 3DH7A 2ZTJA 4GO8A 4GOAA 6TAAA 1WAWA 2OMAA 1EGMA 3LPPA 1FWAC 3S5OA 3AS1A 3N25A 4ZZ9A 3BAXA 3BAKA 1Q85A 2Z2UA 2JE8A 5EMKA 1YBQA 3GFZA 2C91A 4UBPC 3VC6A 5D8ZA 2WVVA 4CCCA 2RH9A 2FZMA 3R89A 1QHZA 2QJMA 3UYCA 1VGAA 5K7JA 1M41A 4XIMA 2OU4A 4AWUA 2YZRA 2Y1HA 4KWOA 1I45A 1NFGA 3HQ1A 4D1IA 3H54A 3NPVA 3U2ZA 5M5DA 4FIRA 3WQWA 2G97A 1PHWA 1C7SA 1V0NA 3VDBA 4LFYA 1ONXA 2GUYA 1PZ3A 4UFLA 4GJIA 1XCXA 5ABGA 1F9CA 1FHLA 1RY0A 4A22A 5IBXA 4ADSA 1RBLA 2J62A 4M56A 4E8CA 2PDNA 5CC6A 1J18A 3GW3A 4RX0A 1X39A 2VD8A 4KFNA 3W6LA 4UTTC 5KZDA 4XKMA 3L2MA 3V7PA 2V30A 3CYVA 2V2DA 5MKGB 2NQ9A 4EF8A 3KXQA 2W61A 2OVLA 5U4NA 4ACYA 2ZZ1A 2D1ZA 2ZC8A 3ITYA 2WNZA 4JY9A 5A6SA 3PJXA 3L21A 5LYRA 3IJDA 3G1RA 5BRQA 3VGGA 4RZ5A 1DTUA 5JBFA 1OCJA 2BGSA 5DMYA 4TVCA 4QITA 3TCSA 3RPMA 1B3YA 4JDBA 3N4AA 2UY5A 3KVJA 4WGXA 3L0NA 1UIOA 1R3RA 1T7LA 3W71A 1OABA 1U1UA 2DVXA 3HMCA 2DY3A 1DL3A 2BSLA 4M6PA 1X38A 1CXLA 4XUYA 1ITCA 3BSMA 4IG2B 3EDEA 3AUOA 1SQ7A 2XFFA 1U1HA 4V28A 5LGZA 5FJPA 2ZCGA 5F2MA 3NQAA 1JZ7A 2BY0A 1LG1A 1V3IA 3OA3A 1RCOB 9CGTA 2X1UA 1PKYA 2FHCA 3N14A 1AQFA 3TYDA 4UTKA 1KLYA 3DYMA 3T2PA 1GTEA 5G4EA 3NCOA 3GE7A 3MSGA 1W3KA 3BICA 1TVLA 1EH9A 4XUGA 3K4DA 1WZMA 2ISSA 1VEMA 1XLJA 3WLSA 1RLCL 2YDQA 4W9TA 2EAWA 5JBDA 4AB4A 4DYJA 2HE5A 4AY7A 2RUSA 3GIQA 5JMUA 4FZIA 3WIJA 2HV5A 3DDMA 4JIEA 3H2AA 1XBXA 2CLMA 1HP5A 4ZTXA 2QXWA 7PTDA 1TG7A 4N7QA 4M81A 4H9TA 3GTFA 3GDKA 2QMKA 3PSWA 2F38A 1XDLA 1UA3A 3LQLA 4UTFA 3UYIA 4PUJA 2C14A 2P0IA 1Z41A 1PX8A 3OEXA 2Q8LA 3Q37A 1HX0A 2VTFA 4Q32A 4HA0A 3BDKA 4AZ7A 3BVJA 3ARSA 4C1KA 1B4KA 5D2VA 4RE2A 3G1XA 1R3TA 3S6TA 5IRPA 5L9FA 5HWMA 1V0KA 1QBAA 5KZEA 1KM4A 4MFDA 3TA9A 3W29A 4W93A 3MBDA 1W1TA 1R2SA 2WWCA 3MW7A 3NEHA 4LV9A 3YPIA 1NOWA 3LNMA 3L9CA 2ZZ6A 7A3HA 4UC5A 2ZX7A 3AU6A 1HJWA 2DVUA 4PN2A 2XGIA 3BW4A 2PGFA 1OHLA 2XFYA 2WVUA 4MIMA 2E0PA 4MJ4A 4XZ9A 2REQA 1XC6A 1OY0A 1XKYA 1FQ0A 3ITCA 1M7XA 1PE1A 4E8DA 4LALA 2VNCA 4CNTA 4FNQA 2DUAA 4KETA 1DWGM 5BRBA 4H04A 5CZ0A 1CYGA 4LCRA 1IGSA 2IUZA 5LIWX 4BY3A 2QQ6A 2E8YA 4UTWC 3MCNA 4JS3A 4H6KA 4PL1A 1KCKA 2E1WA 2YXXA 3GNXA 5E0FA 2DT3A 1KWKA 5HQEA 1KFWA 2PEVA 4AVFA 4HYVA 3ONCA 3IUDA 3W23A 3U4AA 3WJZA 2CBUA 1KB3A 2WZTA 5FSEC 4H8NA 3FAWA 4GQ0A 1FWRA 3AMGA 2XSAA 3VIIA 1A5BA 4CN1A 3FYYA 4DF0A 3TX9A 2Q3OA 1JJKA 1VD6A 4PMJA 1OB0A 5H1WA 1KM3A 1YNQA 3ZVHA 3A6OA 3RO6A 1HKKA 4DWSC 1D7FA 1JDFA 3R8HA 1HT6A 5CZSA 2DZSA 9XIMA 1S5MA 3L2LA 4PB3A 5CGQA 1AH4A 4EACA 4GX9A 3UCDA 4Q4SA 1WKDA 1E55A 1E4MM 3MJMA 1ZY9A 4HJWA 4WIWA 1R38A 5D30A 1KRBC 3S3GA 2R9RA 3GG8A 4HU3A 1UOKA 4GUGA 4JX5A 5IDZA 2Y0FA 3PY2A 1IEWA 4CGTA 5M17A 1EYEA 1VR6A 4RE4A 3ALGA 2GUBA 2ISDA 3EOLA 4QEHA 4L7ZA 4JEQA 2QCDB 3KW3A 4MYXA 1V51A 2OOGA 3UZYA 4V2XA 1GHRA 2ACSA 4NAFB 2AL1A 2Q02A 4CKQA 4BF9A 3K8MA 1EX1A 4PEKA 3NA8A 2C16A 4J1OA 1JIBA 2VZUA 4FR6A 4D6GA 2BP1A 5E70A 1Q6DA 2SFPA 1YDVA 2J4GA 2HE8A 2EPMX 1JI1A 1M7OA 4K37A 2QUUA 2WJFA 3RCYA 1GORA 4Z1AA 4Q8PA 3LHYA 4QAIA 1M9HA 4UTUA 4B4HA 3BQ5A 1HJXA 6CGTA 4LYKA 4IL0A 3ABSA 2V63A 4LVDA 4X2RA 4QS6A 1J5TA 2ZRYA 2G3IA 3FIGA 1GZJA 3AHTA 1V6YA 1R6WA 1GKPA 1UP2A 2X2YA 4HHMA 4I9MA 3CGTA 1TCMA 1F7BA 3GVGA 3RJXA 4KF1A 1QHOA 1EO5A 2GQAA 2QUMA 2YFOA 4ZMGA 3OVGA 4IIHA 2DDXA 5M1TA 1YMYA 1DV7A 4DJED 3CUFA 3SUWA 2W3ZA 3HQNA 4QRNA 5CPTA 2Z1WA 4DB7A 3IJ9A 4JGDA 4BZYA 8XIAA 4HOZA 2NZLA 1QATA 4W84A 3VNMA 2EHHA 2RDUA 3PUDA 3T05A 4O57A 3UERA 2DFAA 1A5AA 2TRSA 1QPRA 3C56A 1G9HA 3VE9A 3CTTA 2D2JA 4XD3A 3AMDA 4R9XA 4J3TA 4ZOEA 2HXTA 4GGBA 3URNA 1V5XA 1UH3A 2QCFA 3TJLA 5IDIA 2DJLA 2V5DA 1KFLA 1XLIA 1RQHA 5KZMA 3LHWA 1F4AA 4O52A 5A6LA 3KAOA 3GU9A 2VZOA 2FDMA 4B16A 3OLGA 5IOBA 2PZ0A 4Q8VA 5LA2A 1NEYA 5AHEA 1BTMA 3SCSA 3LV6A 4Q8MA 4BF7A 1XUUA 3EDFA 4AYGA 1WE5A 3TTEA 2PURA 1AD1A 4K68A 3M0YA 1O60A 4H7CA 3APGA 3N17A 1G7VA 4L65A 1IR1A 1ZFJA 3LHVA 4WD0A 5FJOA 3OLIA 3WF3A 5T9BG 3S2NA 4ACZB 1Z8AA 3M6DA 4X0NA 1XR2A 3RX2A 2HSAA 2A3CA 4UTTA 3C2RA 4I5UA 2QCEA 3WX7A 3W7LA 1SSDA 3T40A 3W2MA 3PWAA 2WBKA 1DIDA 4D6DA 4H8UA 5E9XA 3BMWA 2A4AA 1BRLA 2UWFA 1TZZA 4CU7A 4YTQA 1S2TA 3GH4A 4JL2A 1AW5A 4JOMA 2W67A 2PDFA 4JTLA 3WQPA 3E5PA 3TQKA 3QSRA 1EIXA 2CXGA 4RR4A 3WDRA 2R94A 1W9PA 2XJ7A 3UPBA 1HW6A 3T0BA 5JVLA 4HNOA 5K3VA 3W83A 3B0UX 3RX3A 3UJRA 5LNRA 2RFGA 1EA0A 3CQJA 4J3SA 1I0DA 4RZ4A 4DO5A 2WM0A 3K4AA 4WJ8A 4UQDA 2DQXA 2DW7A 3AMKA 3CQIA 1KNWA 3NZQA 4MYAA 3G1AA 4X2PA 3QW4B 2BDQA 4ZO8A 2VEMA 1UR3M 3A21A 1V3MA 5CG7A 3CAVA 1SZRA 3PSVA 3GG1A 5I77A 2Z26A 3NQCA 3ZMRA 1HP4A 3B03A 4BEUA 1XIIA 1ISYA 3WLTA 1BYCA 1QNVA 3E12A 4M3PA 1HL8A 5DFAA 3FCPA 5H8PA 1NH6A 3FJNA 2EG7A 4D1JA 2O9PA 1B9ZA 3VKCA 1LL7A 1W1B1 1KWGA 1E1CA 4OUIA 3AROA 2Z27A 3B8IA 1H0GA 4YS1A 2XFWA 1GTHA 5DEZA 3RF9A 5GNZA 4JTDA 5I3GA 2OSXA 3U7VA 2QGHA 2E40A 4AZGA 2PWGA 1JI2A 3N15A 1L0PA 2ON3A 3B40A 5CC3A 4CNUA 3U0HA 1SSGA 2VZSA 1R5YA 5EPDA 3MSDA 3QV6A 3W7DA 2QCCA 2WZIA 1HJSA 4GJ1A 3B0YA 1QXLA 3HPZA 2GYIA 4WY0B 5BW6A 3SRFA 1JR1A 2ZUUA 5AZ0A 5IFPA 1NVMA 4P2VA 5E6YA 4C6NA 1V77A 3K13A 3GZAA 1PXGA 1ONRA 3A24A 4I6KA 4C6CA 1O95A 4AWSA 4YN5A 6PTDA 4E8GA 4L4LA 1T99A 3AIRA 3G6LA 1EC7A 1QPQA 4IP5A 3ARYA 4LS1A 3E2QA 4NX5A 4QM1A 3ARWA 1WKEA 1TUFA 3DG6A 4HT3A 3BWWA 1XG4A 3AICA 1SU5A 3SGUA 3VC5A 2NX1A 3T1GA 3AYSA 1JPKA 2DEPA 3PBVA 3ZS4A 5DY3A 2WSPA 7ODCA 3V1PA 1Q63A 4FI4A 2X0SA 3TC6A 4OIFA 1BWLA 4N9DA 4AZBA 3NOYA 5HOSA 2G5WA 3U5UA 4DJDD 1GQKA 4PCTA 2QJGA 2AGTA 1FHDA 6REQA 1CX9A 1W56A 4KFPA 2E68A 1RCXB 3NQMA 5H8UA 4M7TA 3ZR5A 3W85A 1UZHA 5XINA 4QDWA 2G96A 5EU9A 5EYWA 3B06A 3B0XA 5AYYA 1JCMP 4A2SA 2FVMA 3C2OA 3OYXA 3UW6A 4J2MA 3WYZA 3SIMA 4MMWA 2GSJA 5IHSA 4LVAA 3SCUA 4W8LA 3F5JA 1HUVA 2V6AA 3W7HA 4IGHA 4KH2A 2FHBA 3MKVA 3GXIA 1ICSA 4C7GA 3WF4A 1V79A 3H8AA 1UBSA 1XLEA 3R79A 5BYWA 4JFUA 2V9DA 3EX2A 3UZWA 5CC7A 1HL2A 4U33A 4H9VA 4ZEPA 1R87A 1Y5VA 3VYLA 3GTIA 2PGRA 5MHBA 1G4EA 1D3CA 3WQ6A 2WC3A 3UJFA 5K4ZA 2RJGA 3TQ0A 1U33A 4U10A 4YL2A 2WM1A 4JTUA 3PPHA 3QR3A 2OSWA 4GI9A 4IMCA 3CL6A 4DWSA 5ABTA 1GG1A 3TP4A 4IMEA 3WD3A 1EHAA 1TV5A 2CYGA 3TWBA 1WYIA 2CERA 3C6CA 5I79A 5D05A 4LC6A 3RLHA 5C71A 1ZBVA 2GL5A 1ZS2A 3N2XA 4CCDA 4WSKA 1V6XA 3LTYA 2HNEA 5DX7A 1K1DA 4QE5A 4A29A 3SN4A 3N13A 1XUZA 2CLFA 2IKHA 4NNBA 5DQPA 1KM6A 1W0MA 4EXBA 3RU8X 3A3HA 4REQB 4L6OA 3VOHA 1X6UA 4DVOA 4D6JA 4GVGA 4Z2GA 4CQ9A 3GR8A 3PNUA 1FVPA 2J66A 4IJBA 5C9ZA 2ISFA 2PBGA 1AMKA 3CH0A 3XISA 2B7QA 4BWLC 2AL2B 4MNJA 4F3HA 1QBBA 3CHVA 4L80A 2E6AA 3LCHA 4ZL1A 1L6FA 3RMEA 3FAXA 3TE9A 3KS6A 4ALDA 4Q7NA 4AZCB 3A4WA 4NAEB 3IAQA 3TNBA 1R3YA 3STPA 3JVAA 1X96A 3GFXA 3NQGA 4O1BA 3EXTA 4RJEA 1XDJA 4E2VA 3VE7A 4KCUA 4AG0A 2XH4A 4GACA 4B3ZA 4DO6A 1W9DM 3BAWA 4UCFA 3S2LA 4B2DA 3EDDA 1DE6A 3AS0A 3URAA 5A95A 1X7FA 5REQB 1IF2A 4EP8C 1ISXA 2WZEA 4ZOBA 4NJKA 1NU5A 3KBWA 2VT0A 1AD4A 1OFBA 3CO8A 4JNMA 1IR2A 2ICSA 1JCXA 2WBGA 3KUMA 3PJUA 1FRBA 1NF7A 4DBWA 1K8CA 3W2UA 1VBJA 1ZENA 2QPSA 3HMJG 3SCOA 1HJUA 4XZWA 4UQEA 4GKTA 1H63A 3O0KA 4PRRA 2Z25A 3DFSA 2ZUTA 4KS0A 3CIWA 4S3KA 4WY0F 4ZR8A 4AD0A 2VWTA 3S0CA 4S3JA 2ABBA 5F1UA 2CXEA 1W1IE 6ENLA 1G94A 3L4TA 4QLJA 3NUKA 1VPQA 2R1MA 3M64A 1LZOA 5T9CE 3DFPA 1GKQA 3B4YA 4RW5A 4WHBA 3STGA 3A3XA 1X97A 4GK8A 2OLAA 3HO8A 3DEQA 4UNIA 1HGYA 3VZXA 2F84A 3SJ3A 3FDGA 3FK4A 1I8JA 2IPGA 1NWSA 2GQ8A 2OO0A 1VFHA 4PGLA 1SR9A 1CGWA 4KKXA 1LT8A 4OBSA 3AXXA 3MY9A 2IKJA 1DE5A 2PWVA 4UFKA 2FQIA 3CEUA 3PZMA 3VNDA 3P8IA 2NVDA 3KRUA 1ZAJA 1UG6A 1XRTA 2XIJA 3CPUA 1CGVA 2CHOA 4NZ3A 1AZ1A 1XFBA 1WQ5A 2E25A 4XZHA 4R85A 2Z7GA 4IXHA 4URIA 4D72A 1RJRA 2CLLA 1D9EA 4QJ4B 1POKA 3RM8A 1IEXA 2Y24A 1JVNA 1C8QA 2BLEA 1R9ZA 3GVWA 3LTSA 1WO2A 3TTQA 4W8BA 2PB1A 3EWBX 2P5NA 1B3ZA 4TU1A 2VHLA 3VOCA 2ZTKA 1O68A 3EA3A 1FX6A 2Z1VA 2V0TA 1YPIA 3W1RA 2ZUMA 3N1AA 1GT8A 3T0AA 2YSWA 1W6TA 3HFTA 2J7GA 4LANA 1OVDA 4IQEA 3HBLA 3WLIA 3LSBA 3CHDA 3GX9A 1CXHA 2Z29A 2OYKA 4FXRA 3V16A 1I0BA 2OYLA 1WX0A 1S2AA 2CETA 4ZODA 3E1F1 4IXXA 4EXQA 3DOPA 2QV4A 4HTBA 5D2YA 1KGWA 4AHQA 4M5PA 5HULA 1PJ9A 4H7VA 3STFA 4BI6A 5DCEA 5DMNA 4O1DA 1LF1A 2A85A 3LXAA 2HEJA 4N2YA 1XISA 3JS3A 3OHIA 4BQ2A 1JD7A 3RRXA 3U48A 3ITLA 5LIXX 2WLZA 4MAVA 3P74A 5D32A 1FWHC 1DHKA 5KEZA 1ZZMA 1MUWA 4JAWA 3H7RA 1JAEA 2CLPA 3EDKA 3S5YA 3UT0A 1V3HA 4Z1YA 3A4JA 3RGTA 2QAFA 3LMYA 1MW2A 1XIGA 4QISA 3ARVA 3H2MA 3KRBA 2DQWA 4B15A 1GZ1A 4ML9A 4A3YA 1JNEA 2ZE3A 2NXIA 1Q6CA 1GNXA 4W85A 3XIMA 5A5WA 5DN1A 1WKFA 2WHMA 1EC9A 5GNYA 1MXSA 5C55A 1AMYA 4S3BA 3XINA 3ENLA 1RBOB 3FEMA 3UGVA 4XX6A 4DBDA 2OXNA 1FOBA 5AYXA 1TTPA 1E9IA 4HK5A 4XISA 3TN3A 5EB8A 1FY6A 1E40A 1W5PA 3LCWA 3M43A 4UNKA 3AIUA 3I6EA 1V3JA 4CQBA 4MWAE 2X42A 1Y7VA 1LBFA 2DIJA 3P84A 1JZ2A 1MUCA 3NO5A 1WOBA 1UKTA 2CPUA 3S2MA 2XN1A 1BYAA 3VKJA 4GHRA 4DM1A 2EPKX 3QFEA 4NNAA 4S2BA 2TPSA 3BLEA 3CASA 1K9DA 3DKJA 2JF7A 3Q45A 1VEPA 4HZ6A 3PPGA 2KAUC 3O8AA 4EK7A 2PP0A 3ARQA 2AQOA 4PMQA 3FKRA 3TJXA 3SGGA 3LXCA 3OIXA 3W73A 3UVIA 1CB7B 5FJUA 1E4NA 2GVYA 1QNOA 4LH8A 5C9RA 2H90A 4MKSA 4P8UA 3NL6A 6XIMA 5LXXA 4Y90A 4RXFA 8XIMA 3PBMA 2XYLA 3O2LA 3ATZA 1KFBA 4LCSA 4O0ZA 3H4WA 2VFDA 1OF6A 3NQBA 4E3VA 2GDUA 3GH5A 5I3DA 2IKGA 3L5LA 1DHPA 1E70M 1PVNA 3THCA 2OELA 4Y9MA 1J0KA 2BY3A 2D0GA 2PWEA 3NYDA 4UQ9A 1VRXA 3EGJA 2J7DA 1LRTA 5I00A 2BG5A 2ZZ2A 3CJPA 4NQ1A 1VZWA 2Y7GA 3PZNA 4QFUA 3OPSA 5CJMA 1UP3A 1HTIA 2B7NA 4JNZA 1P0EA 1I1WA 2J77A 4IQJA 4ERIA 2NW0A 5TBOA 2Y8VA 5B7ZA 3KWSA 3VIKA 3QV8A 1ICPA 3CWHA 1UD3A 4EAMA 1G69A 2VI0A 3UBPC 1ZGDA 1VJIA 2EF9A 2XVKA 4HSOA 1RP9A 4PUUA 3RPDA 2E6FA 1H3GA 4J9JA 1QVBA 3MHGA 1JXJA 2J79A 4MDOA 1LT7A 5BXRA 4UIOA 2ZRZA 2UV8G 2V2CA 3GHTA 4IGMA 5IHRA 1J0YA 4ML4A 1E43A 1QO2A 3GXDA 3ZLHA 2VZTA 4D6FA 2OZTA 2WPGA 1BLIA 2VVSA 4H83A 1X7IA 1PHQA 4FEZA 2Y7FA 2PMQA 2FKPA 3W2JA 1KKRA 2EO7A 2A6LA 1V4YA 4CU6A 4FO4A 3O6CA 3VVGA 2BOEX 2GJXB 2XSBA 2PUZA 1JDEA 3T81A 3NZGA 2J9XA 1EDQA 4GYFA 4JR5A 5ENLA 1AW2A 4AY8A 2ZQ0A 1SR0A 4FNTA 1CENA 3UPMA 3RDKA 1OG0A 3CO4A 3G0UA 4OJYA 4IP7A 2X1TA 2I1OA 2ACQA 1XCWA 2VP8A 3ZVIA 2J9YA 3HPXA 2YCLB 1U5VA 5D03A 3NQ6A 4U31A 4LAKA 5LIUX 2YW3A 2FJUB 4C6PA 3VDAA 3VMNA 3FHAA 3SJNA 5CLTA 3EX4A 4D8ZA 5I3FA 1WZKA 4LCQA 4MVAA 1H0IA 1X1NA 1MI3A 4Y6GA 2PD9A 2H3BA 4BWLA 4WKFA 4H9XA 4Q6JA 3UY8A 4MAZA 1GVYA 4I8YA 2CKRA 4LVGA 2OLHA 1XG3A 2ZUWA 3QEZA 2J24A 2X1SA 3LENA 1MNSA 2YL6A 1MEWA 3R0UA 3M44A 3P67A 3QMSA 5I0DA 3CZ8A 3S1UA 2G95A 4IF2A 4WJEA 1EP2A 3UG5A 3E2SA 1Z3NA 3O63A 3H7VA 2QHAA 3OU8A 2ACRA 2VEGA 1RP8A 2O7SA 3BZGA 3DESA 4Q6XA 1A3HA 1TJ2A 3W7KA 1S2WA 2XGBA 4F0LA 4HZ7A 1JUEA 3U57A 4HB7A 2YIHA 1R3VA 1LOLA 2DZTA 4LXFA 1KFEA 4US6A 4D2JA 1E4IA 3TR2A 3LERA 5FJIA 2PLCA 1EQPA 1HQTA 1OIFA 3N12A 3CC1A 2P3ZA 4EPEC 1VPYA 1GOOA 1X1OA 3DERA 3WQ8A 2QGYA 2X30A 5HR7A 4EPDC 4TIMA 1VENA 1UR2A 4X61A 1GQIA 2YLAA 3IIZA 2YXGA 2C3ZA 3C2VA 1ZJHA 3WK0A 1UD6A 2WWDA 4Q4KA 1WV2A 1J11A 1M65A 5U7SA 1W9XA 3MI2A 2ZUVA 4ZXLA 1V02E 1YXDA 1HVQA 3EMZA 3H7UA 4RK8A 3W7OA 2PDWA 1JRCA 2PDYA 1EZ2A 1SJBA 3LUTA 4RZBA 4XIAA 1EDTA 2X09A 1O5XA 2AGKA 1QI3A 4JQ3A 1D3HA 3H23A 3BG9A 3OGSA 4XV0A 4B91A 1QHPA 3KBVA 1OYBA 3GBDA 3R94A 3B9NA 4OWGA 4XK2A 1SVDA 1IEIA 1LWIA 2B0MA 4YTSA 2PDBA 5CPLA 3MVIA 1NP2A 4B5SA 5CZTA 3WUEA 1RV8A 2XH2A 3CL8A 3V5CA 4KGLA 1TE1A 5DO8A 1TYGA 2JF6A 1FKWA 3OG2A 1R3SA 3T7VA 1P6BA 3DFOA 1KCLA 4KIEA 4UQBA 1UJQA 3GDMA 1TSIA 5MF5A 1PKMA 3SW6A 4AY1A 1TPWA 4CNOA 1JULA 4HKPA 3OQEA 2C0HA 2C71A 3KP0A 4W7WA 1V3LA 4TMCA 2YGYA 4IIFA 1IZCA 1GVFA 1XRVA 1JXKA 3CZJA 3ZWTA 2IXUA 1AZ2A 3VI2A 4JQ4A 2BB0A 2CBIA 4KQNA 1SFSA 3LBMA 1M7JA 3L5MA 3WCZA 3L4ZA 3RHGA 1VFFA 3I3DA 2EQDA 4JTEA 4IPLA 1H7PA 4K8EA 4PTDA 1EOKA 4C7FA 1DYSA 3RLUA 1QJWA 1OX4B 1U83A 2WNWA 1S2CA 3TJIA 4YHGA 1OFEA 4C60A 2OG9A 1GVRA 5K9XA 4FPSA 1QU4A 1R3QA 3U7BA 1E9ZB 1XKJA 3P62A 4W7VA 3RYSA 2YJQA 3BG5A 1RR2A 2NWRA 1SW0A 4W5UA 5DMMA 4Y9NA 1HKMA 3FEQA 4GISA 3APTA 1MMFA 2J8GA 2E77A 1I9CB 3P3BA 3W72A 4I3GA 2V68A 3GK0A 4KEVA 2ZVIA 4XG1A 4GIRA 3K1DA 4LJ3A 1O4UA 2GQ9A 4Y9OA 3OYZA 2XIBA 3MHUA 4RPPA 4MY1A 3SR7A 4HA1A 1EJTC 3UJSA 3PR2A 3FY1A 4QE4A 4Y8FA 3IGHX 1AL7A 2UY2A 3TXZA 5C7HA 1H1ZA 2OFJA 1A0CA 2OT1A 4XAZA 2ONEA 1B54A 3W1MA 4CNPA 4DLFA 1AJZA 3JRKA 1UA7A 1KBLA 3AHXA 2WPBA 3N9RA 4EXAA 1YYAA 4LU0A 4A3HA 4PUNA 1GYNA 5F4WA 3L65A 5A8OA 1WDPA 1UP0A 4JHMA 2AKMA 4DZ5A 3EBVA 3GY1A 4MADA 1YDNA 3VINA 2O0TA 4O28A 4MWAA 1TWWA 1OK4A 3HG4A 4DZIA 4HHLA 3IIPA 1K8ZA 3WD2A 3S4TA 1I2PA 2B31A 3T8QA 1UKQA 3N6QA 4UCGA 2FH8A 3SCWA 4BI5A 1W1ZA 2E9MA 2X41A 4JFWA 4QS5A 3GYCA 5M2FX 1VJZA 3UVAA 1FWNA 5MKGA 1MW0A 2HVNA 3MCOA 4GZEA 1FFRA 4L4MA 3KVLA 3QPYA 3CNYA 5HJYA 1CGUA 1E0VA 3TK7A 3LK6A 4LV4A 3G6MA 1DBTA 3G1VA 3KBNA 2GSEA 3A12A 2B7OA 1EGZA 4S3EA 2ZA1A 4DUXA 5LZLA 3PUEA 2BVTA 3PBWA 4JTSA 3HG2A 4F9DA 2YCEA 3POCA 1HJVA 2V3GA 5LKYA 4EKJA 5LNVA 3C3UA 1SO3A 1POJA 4Z0JA 3RK8A 1H5VA 4Y96A 5I3HA 3L7RA 4UTLA 5BXTA 1T96A 4IG2A 4DXXA 5JU6A 1Q2RA 3GBEA 4LBUA 1WDRA 3CPRA 3KBMA 1T8XA 3UD6A 4ZO7A 1X6LA 4LRTA 1SUXA 2ALDA 2OB3A 3NJ3A 2QF7A 5DY2A 1J0HA 5EMMA 3VUPA 5AHNA 4FA3A 2BHYA 4DJFA 1PPIA 2CKSA 1WBHA 1UR1A 5FAGA 3RRAA 3I6TA 3M5XA 3FSTA 4YU1A 4HZ8A 1KQZA 3KL5A 5HWJA 3GG7A 4Z2LA 2JEPA 3FJLA 4ASTA 2WVVB 3PN8A 1RXOB 4G8TA 4UOQA 5FCZA 3HJEA 4W4QA 3SCTA 3E96A 4JIIX 4U5KA 4WXYA 2P53A 3W75A 1CLXA 1WAUA 4KBXA 1ZUAX 4O15A 2XHYA 4A8RA 4Q3MA 5EL1A 3PZ9A 2H6RA 4CU8A 1LM1A 7ENLA 4IPIA 2FGLA 1WKYA 4R33A 2PCEA 1EBHA 4KPLA 2JQXA 5LHFA 4FMVA 2BFGA 1C8YA 3M46A 4GWEA 3VX0A 1IXQA 5CPNA 3IWPA 5F2IA 4C6DA 4BFAA 1VBRA 3DX5A 3ABRA 2PFHA 3LBOA 4D8LA 4HNUA 3AUJA 1DQUA 3MBFA 3QC3A 1LBMA 1EQCA 1R3WA 3NG3A 1DWAM 4QQ3A 3UXAA 5AC6A 1PV8A 4BK9A 4H8HA 3FVMA 1QNQA 2ASHA 3SFWA 2AQVA 3SI9A 5I5RA 3FW6A 1VFMA 3ZLFA 1OFAA 2ZA3A 1OIMA 2CZ5A 3HGJA 1YDOA 1G4SA 1TREA 1XF0A 1YRRA 2Z00A 5F2LA 1OFPA 2FIQA 2R82A 4JTRA 4TMBA 1Q4NX 1FP9A 4GXWA 4QDMA 1UROA 1ZCCA 2TSYA 3UG4A 4WVXA 1QAPA 4IIEA 3E49A 3OZOA 3EEZA 3HF3A 3UESA 4GI4A 3W7CA 4JYEA 3ANYA 3LS9A 1FUYA 1JDCA 4OZOA 3O06A 3RN6A 2WVSA 3P61A 3LRLA 1KFCA 2XPKA 4NXKA 3W70A 1V8EA 5G1YA 4LB4A 3ZFHA 2WCSA 3GXNA 2VX6A 2E5DA 3OGRA 3WBXA 3WBAA 1VYSX 1TWZA 2GZXA 2GVGA 4CEUC 1VHNA 3QQ0A 5AC5A 1BKSA 2WV8A 5LGXA 5BOEA 3HV9A 1F6KA 3GS6A 4JFVA 3GNOA 4IGNA 2OQYA 4U3CA 4JTIA 1NF0A 2QJIA 2PD5A 4DAIA 2AMGA 3D3FA 1PYFA 4OE7A 4F0SA 4AF0B 5JH2A 2ISVA 2X1RA 3DYOA 3VOGA 1R47A 4C90A 3TWAA 4KWWA 3HG5A 4NZFA 4QQUA 2TMDA 2YX0A 1FXPA 4FK9A 3RCMA 1LL6A 3SM0A 1W8GA 1P0BA 4Z2JA 2VXNA 2WNNA 5GQBA 1IXPA 1UWTA 3MV11 1KGXA 1DEDA 3T2QA 3R11A 1A3WA 1DXEA 3F4VA 1Z7AA 1I60A 3N2MA 2CC0A 4U2YA 3D5HA 3U9IA 3GR7A 3VIJA 3CZKA 3MSRA 1Z48A 1XGEA 2WSKA 2NQJA 1GVSA 2GLKA 3LCFA 1AVAA 3H2NA 3MKKA 5HMDA 2V3FA 1JF6A 4PCFA 1QO5A 4OV4A 2QCDA 2VENA 2OZ0A 4IMGA 1JYVA 3IIOA 4S38A 3W7JA 1P43A 2VUYA 3W7QA 2ZXDA 3A9IA 4LTSA 3OIHA 3DFQA 1SM9A 4DELA 2JBMA 4YJ5A 4HNNA 1OCQA 3NVTA 3STCA 1OC5A 3HIJA 2XN0A 1PX3A 1ADDA 2BODX 4PMXA 4R88A 3VNKA 2J8FA 2NV9A 3TJ4A 2VFHA 2E28A 3UZ5A 3QGAC 2NUXA 3WBWA 2HS8A 2QULA 1OC7A 3T42A 5I3KA 4Q33A 2PGWA 3VMPA 3W38A 3WNMA 4A8NA 4D6CA 1W32A 2J9ZA 5FF3A 3CV6A 4AIOA 3WLPA 2ZIDA 1FCVA 1IYXA 1ZAIA 4IIDA 2J7HA 4PRTA 1KR1A 3V5FA 4PUWA 1V6UA 3WD4A 1EP1A 4IT1A 5HATA 4E38A 1ME9A 3QRHA 4Q4RA 4P7OA 4F9JA 4AIBA 4ZA0A 1SW3A 3AXHA 2DIKA 1Q6FA 1RA5A 1CZ1A 2P10A 3CK5A 3PZVA 4O1EA 3WQGA 1VJSA 2AAMA 2VX5A 3R6IA 1HN1A 3S42A 2EKGA 2XU2A 3P60A 3WD1A 4UWMA 1EHNA 1FCUA 3W1TA 1YLVA 3GB6A 4CQDA 3UXKA 5J5DA 5CPOA 2PDGA 2Z24A 2WANA 4GE8A 4ICNA 4JKKA 3A5FA 3PJTA 1KXVA 2XVPA 2WMKA 1JEZA 2FYMA 1XLLA 2VVNA 3BLIA 3PWGA 5M3WA 2GQ3A 3NGJA 4ZQNA 5BOFA 3WY1A 3SCVA 4YTUA 5G2IA 4GX8A 2VYOA 3EKLA 1JZ3A 3VIHA 1P0KA 1XBZA 5T26A 3B97A 3GRIA 5FF0A 3VNZA 4IFOA 1U5HA 1SMDA 3E3HA 3W02A 2JIWA 1GVEA 3TR9A 2QMJA 1IEVA 5CBJA 4NG3A 1ITXA 1HKJA 2RKXA 4ZSUA 1K02A 4RLIA 4I9TA 3RR4A 1FWDC 3SY8A 1DORA 4AD5A 3COTA 1IIGA 3Q58A 1UASA 3NNTA 2VC5A 4GVHA 2YL8A 3LM3A 3HQOA 3NDZA 3A47A 3PK7A 4ACZA 4O16A 1UZ4A 4HU8A 3NR0A 1UUQA 3PM6A 3TMLA 1BFNA 2W66A 2YA2A 4DIAA 3LI1A 3EXRA 4XVEA 3OA5A 1W37A 1Y8BA 2PGEA 1KV8A 3CL7A 4XD5A 4G2DA 5D2WA 4NIRA 3LN3A 2W0UA 3TROA 1GKRA 5HQLA 3APYA 3F4CA 2B4GA 2PDCA 3WLJA 4YNGA 3ZYZA 4LS2A 4JHOA 3PBUA 1DP0A 2C15A 2CITA 1ZTVA 3GXTA 3WFAA 5BU6A 3TN6A 1XYFA 4GG9A 2G3NA 1UZ1A 4OBRA 4XTIA 1Q6LA 1NOUA 4ENLA 3GD6A 1TV3A 5KINA 2E9BA 2A3AA 3LZ5A 3KCOA 3QZEA 3L4YA 5TIMA 1TV2A 5HANA 4GNVA 3FGCB 1UUOA 5A3HA 4HHPA 1BYBA 1OFQA 3FA4A 3O6YX 3GTXA 1LYXA 4B9YA 1W91A 4UR8A 1OX6A 2HVMA 3N3MA 2XN2A 3C2FA 5D9PA 4B5NA 5CSSA 3UG8A 1EB3A 3URQA 2D2GA 1QK2A 3AYVA 2NV2A 1IZJA 3LDVA 1UPPA 1JFHA 5C7VA 5E6ZA 3UGRA 1PIIA 2WKJA 4O18A 3SCRA 2YOCA 1T41A 3MCMA 1IHIA 2W62A 4MB5A 3REQB 1W17A 4F66A 4X22A 2OWCA 1QR7A 3E38A 4ECLA 3EZ4A 1H41A 3T0DA 4NRRA 2YYTA 1A4MA 2ZX9A 5ABEA 3V3WA 1K9FA 4LUIA 4INFA 2Y88A 2RDTA 3NEVA 2QIIA 5KITA 4AAJA 3MHFA 4E2OA 1GYMA 3E0FA 5HUOA 5CJ5A 3M5VA 4YWIA 4UQCA 4G7EB 3WJWA 2P0OA 4LEFA 3TOYA 4DBEA 1DJZA 1EJUC 1Q6EA 1LWHA 3LX9A 3IUHA 4RDVA 1X8CA 3EWUA 1NP0A 4NXSA 3VUSA 1Z69A 3CZEA 3W7MA 2GVJA 2V5JA 1K3UA 3I4EA 3WLLA 3PB2A 4WY0A 2WCAA 3TLQA 1IEQA 3GWQA 2QVHA 1KRAC 4GGHA 5A1AA 3UCCA 4YMZA 3LI0A 1IZKA 2OWXA 3NQEA 2JGQA 3L0GA 3EKZA 4Y2WA 2D23A 1XLMA 4O50A 1XYBA 5LA0A 4GC4A 1PWMA 1I2RA 2PC8A 5HUPA 3TYZA 2P1FA 2Y89A 3MSYA 2X05A 2YBVA 1W1YA 1KV5A 2BWGA 2XUCA 4G1NA 1ONWA 1R9YA 4NNCA 1W8SA 2H9AB 1XM3A 1FFQA 4TUFA 3GH7A 1ZSXA 2KZHA 4UFJA 3L4WA 2NLIA 1YTKA 3R13A 1KCZA 4Z2HA 1L9WA 4EOUA 1W3NA 3NIYA 4R5EA 1WNOA 3Q65A 1TTJA 2YKKA 4IPJA 5I03A 3FFSA 3VKAA 4A3UA 4LAOA 1QT1A 1P6WA 2ZUSA 1VIWA 4WF7A 5JBEA 3CM4A 1DWIM 2WYSA 3GYEA 1C92A 1Q4WA 1TB3A 3L2IA 1OF8A 4LNCA 4R7OA 2VRQA 2XWDA 4AW7A 1UH2A 4LNYA 1UBPC 3BW2A 3W6MA 3HA1A 4AMCA 3VIGA 3BGGA 1OGSA 3ITVA 2OGJA 2GJLA 1TPVA 3W74A 4I8DA 3AYTA 4OV9A 1U1JA 1F8IA 3IIVA 2P3EA 2Y5JA 3G18A 4ZOCA 1SZEA 3QLLA 4US5A 3HV8A 3LPGA 4PFHA 4IWWA 3WNNA 5J04A 4LVFA 1EP3A 1O1HA 2P8CA 1J6OA 5GJMA 4AEEA 2UY3A 4FLOA 2PP3A 3LHZA 1PZ0A 2QPXA 2E5BA 2NX9A 4AX7A 3ATYA 4AZ5A 5CJNA 3BZJA 1XS2A 2Y5SA 3QV7A 5C54A 5EA9A 4DZAA 1M68A 3V36A 1JYWA 3CUXA 2BXVA 2FZBA 2Z1BA 3PVFA 4K8GA 4Y9PA 3JU2A 3AAMA 3UG3A 1E3XA 2XIOA 4LY8A 2IXVA 3DU0A 2WJDA 4F2TA 4DYEA 2Z2AA 1KM5A 1H09A 3ISIX 4JIPA 1AW1A 1C8VA 1LQ2A 4WKAA 4WRHA 5I23A 4GCAA 2E4TA 2Q8XA 2J7EA 4H19A 1V0LA 1XBYA 2A7NA 2PU1A 3OO2A 4EPBC 2BTMA 3V1HA 4ZB0A 3ES8A 1ECQA 4D6IA 1KR0A 3VOIA 4AWTA 1GZGA 4MWAD 2NVCA 4A2RA 3B0VC 4RDZA 4HN4A 3B9AA 1RVKA 1S2VA 3EYPA 1XIBA 3DC8A 4LC8A 1V08A 1KM1A 2CLHA 5D33A 2I9UA 3DC0A 3WK3A 3WDIA 2XVLA 2ZC1A 4N42A 3RM9A 1WXJA 1LCOA 1J0ZA 3GNDA 3NTYA 1NARA 2ANUA 2CBJA 5CPQA 1TX0A 1W3TA 3AXMA 1EKOA 3TAOA 1XCFA 4AZCA 3S9ZA 2DZBA 3PB0A 3R0DA 1YTDA 4NAEA 3CB8A 4L64A 2JK2A 4L56A 3GUWA 3P14A 3PG8A 4C6KA 6REQB 3DXIA 3LLFA 2BVYA 1OCBA 1F07A 3A9BA 1RPXA 3W27A 4GBUA 1LDCA 3USZA 1CT5A 3MUIA 2FJKA 3MTWA 2GJPA 3TMQA 2XINA 4GMEA 4NYUA 4CUCA 1PL9A 4MDPA 5REQA 1M3UA 2Z2BA 3SUVA 1TE6A 4DX3A 3QPZA 4Q8OA 3KBJA 2OLSA 3LD5A 3DENA 3OW1A 4HIBA 4D9PA 4O0QA 3WH9A 4F4RA 4GBDA 5CPMA 4AU0A 1N8FA 4DJFD 1Z42A 2IPWA 3M1ZA 5AYIA 1NQKA 3WBYA 2G4JA 3NSMA 1LJYA 4IMFA 3VM5A 1KLZA 1CW2A 3QF0A 4BR1A 1CXFA 2JKPA 3WDQA 2OEKA 3WH8A 2PTWA 2V81A 4CVUA 1E56A 1IXNA 3AU2A 3W1UA 2ZYFA 2VC7A 3FJ6A 4IZGA 1KTBA 2PE4A 3LY0A 5BU9A 3UJ2A 1PTDA 2J6VA 1HNYA 3AXIA 2VC9A 4CD8A 1TWDA 3DBNA 3GO2A 4NF7A 1R85A 3WLHA 5I02A 4MM1A 1YE6A 1YXYA 1K7XA 3M4HA 4W89A 2WHKA 1HO4A 4P5UA 4NJGA 1Q13A 2DSWA 2Z0IA 4JTJA 1WXZA 2VX4A 1W1PA 5DMLA 1EZWA 4JQ2A 2EGZA 1F3EA 3CHCA 2FGBA 5T91A 5LHEA 4FXJA 2OEJA 2PU0A 3SN0A 1WP6A 8CGTA 1DTNA 2ZWZA 2GDVA 4JN8A 1F74A 3M0XA 1MYRA 1BGGA 1GJPA 1W3LA 5TD4A 2NQHA 3B3DA 1Q2SA 4QLKA 1LLOA 2HQAA 1DJXA 3RILA 4HNTA 3KTCA 2E1DA 1ZCOA 4U2ZA 3R8RA 3KLLA 3HZ3A 4MJZA 3LCXA 3VOJA 1CGXA 3AIEA 3C4UA 5IXEA 4O19A 3DGBA 2VFIA 3TSMA 3T55A 4YYFA 3ZSTA 1BHGA 1PX4A 2CIPA 1TPFA 1WDWA 1UZDA 2FMOA 3EX3A 3QM3A 3GW0A 2EJAA 3ZJ6A 3GHRA 1KXQA 2EKCA 1XJBA 2WB5A 1A5CA 4L9YA 4FXFA 3LHUA 1XXXA 1XYLA 3W53A 4AWEA 2YB4A 3WNKA 3MMUA 2PRLA 1A4LA 3E2RA 3IV8A 2MANA 2QR6A 4GIEA 1CLVA 3RIKA 3G3DA 4UMBA 4Q7IA 2IQTA 3RM4A 3TYEA 4O54A 1JRBA 1TQJA 5AHMA 2XM2A 5A6TC 2JKAA 3FYOA 2WQDA 1G6CA 1UWQA 4J28A 2J25A 4Z1BA 1UD4A 4YCPA 3IK2A 5BNKA 3WQ4A 3OBKA 4ZENA 3MA8A 4DYKA 1DJIA 1SYTA 4ATWA 4QAWA 5A94A 2J47A 4J3VA 4HHHA 3WK1A 1OCNA 7REQB 2O9TA 4PMNA 1EC8A 3CAQA 4JTTA 3WBEA 3IS4A 3PF3A 1BTCA 4AZIA 1EL3A 3O6DA 1CBGA 4RXGA 2ZDSA 2YR1A 3WQOA 3AZTA 3DG7A 3QPEA 5C8BB 1THFD 4ILSA 2UZ9A 3DFYA 4DPPA 1FDJA 2W4XA 3FX4A 1YEYA 1GG0A 4NUWA 1JPMA 2DPEA 5IFTA 2WLYA 2PDPA 3GNNA 1XV8A 3IACA 3C5QA 1OSEA 2E8ZA 3OLDA 2Z1SA 1AQMA 4PCPA 3FJ4A 1VRDA 1DOSA 1RAKA 1UOZA 2NT1A 3U8GA 4KCVA 1RD6A 2VQUA 2YB1A 1VF8A 4PMYA 2FPTA 3O7UA 3ZR6A 4WK9A 5FJRA 3PZTA 2G8ZA 3OZPA 2PRHA 4OFCA 4GYPC 1FWBC 3UXDA 4E4UA 1ADOA 3DECA 3LU2A 3SSZA 4AEOA 1Q8JA 4NSBA 3W25A 4A21A 4AD1A 4DO4A 3EMQA 4QJ1A 2PWHA 1SGJA 4O12A 5I06A 4AIEA 3LV5A 4G7FA 3RPTA 3W28A 4CEXC 4WDTA 1DQWA 2OQLA 3VFCA 4JD4A 3AWNA 3B4UA 3EPNA 1M03A 3JZEA 3LZ3A 1S38A 4LQ1A 1CNVA 3ARPA 2W92A 3BGJA 3WJYA 4BEQA 2WMJA 3MMWA 1SZGA 1QOQA 1W5OA 3DIPA 4QNWA 2QNEA 4O8RA 4QX4A 3F4NA 3KCJA 3O16A 4DJDC 2Z28A 1DWJM 3AJ7A 1TIWA 2VDIA 3KLKA 1OGGA 1MEIA 3GLCA 4K1WA 4QP0A 3OZMA 1WOAA 2PDUA 3EWYA 1LQ0A 4ERGA 4YCOA 2FTWA 5K9CA 5AZ1A 3LQGA 4L61A 3N29A 3WH7A 4AHPA 5CXPA 5AHLA 1PEZA 2X40A 4KWVA 4J3UA 4MY9A 4GNKB 3PZGA 1REQA 3MI3A 2QPUA 4IQLA 6TIMA 3FS2A 5CZJA 5C5YA 1LLZA 3BGAA 4JX4A 3IJIA 1GOKA 4JIHA 2V5KA 2X0HA 3H55A 1XSJA 3QTGA 3W7EA 3QYQA 4EWJA 1VHCA 1JCJA 2ZZ5A 1R7AA 1XLCA 4LAMA 4C5YA 4LSBA 3ITOA 3IGSA 1FWTA 2I7GA 1CDGA 4HPNA 4ICMA 1QNSA 2EG6A 2F2KA 4PE8A 4JPGA 1UQYA 3OBEA 2V82A 3QHOA 3A5VA 1O6IA 2PWFA 2QZRA 3O0FA 4N9EA 1JL8A 1CEOA 3NO3A 1US3A 2DZAA 4H6RA 1LOSA 5FL1A 1V6VA 2V69A 4FB7A 4GZIA 4HU4A 1PUDA 4FSAA 3DFHA 2ZKMX 1ZLPA 5KZ6A 3QSTA 3DI0A 5K4XA 4P61A 3IK4A 3RITA 3C0LA 3QBUA 1W9VA 4KEZA 2HBXA 1F6YA 3VD7A 4DNMA 3GG0A 2XZ9A 3LG3A 3GKFA 1LRQA 3TONA 3F2BA 1GVOA 1XI3A 2YBUA 1M1BA 3TVAA 3PPFA 1YW1A 1LRNA 4DAFA 3K46A 3ICJA 3BLOA 5CSRA 4NILA 2GJXA 4HK6A 2A5HA 4RNIA 3BH4A 5I3IA 3KTXA 1K4GA 1O12A 3BC9A 3VAVA 2C6QA 4IP4A 2Y63A 3QQWA 5DXYA 4TV6A 4KEUA 4RZ6A 1JPDX 5DANA 2PTZA 2PF0A 1LWJA 2FPYA 4UB9A 3M0ZA 1TJ0A 2FLIA 3NGFA 4U3AA 3UNTA 4JL1A 5KMYA 2WMFA 1X98A 2YCLA 4H41A 5HR6A 4JKLA 3BSHA 1V3KA 1OFRA 5HWNA 1PCKA 2W63A 3N4FA 1QI5A 3KRSA 1E3ZA 4PH6A 4HMCA 4BQ4A 3LB0A 3NM3A 4ZFCA 3VIPA 2Z6IA 1BQCA 3HM7A 3PTDA 4OHQA 1FWEC 1C91A 1ML1A 2YDRA 4XO7A 4Q4QA 3VNYA 1CXIA 2INEA 2WAGA 4C1NB 3K5XA 1D8WA 3KDNA 2PA6A 1YXCA 4JHZA 1E5JA 1XYCA 3GNPA 5AVHA 3Q94A 4XB3A 5HBFA 5EFDA 2OX4A 2QAPA 4YTRA 3WO8A 2R1NA 4H9UA 4IUOA 3KM8A 4F0KA 3S9IA 4JICA 4HA3A 4S3AA 3WMSA 1RH9A 3GM8A 1OT1A 3BG3A 1Y5XA 1RK5A 4XTDA 1L8NA 2C0AA 3SADA 4IISA 1PZ1A 3CAWA 3AXKA 1K8XA 4CNNA 3VCRA 1A5OC 1PDYA 3NSNA 3N9KA 4CNSA 2D3LA 2ESCA 3TDFA 4P7LA 3NL5A 1UWSA 1SO6A 3M0LA 3QH2A 3WSUA 1TJRA 3CHEA 1KXTA 4XVDA 1PWLA 3VK5A 1TTIA 3M0MA 4POCA 3PZQA 5DRIA 3I3EA 4JYFA 4WZHA 3SECA 5ECUA 1EWEA 2D0HA 1OZMA 3KP1A 4WGHA 2QCNA 3G5EA 4GABA 2WC7A 3W7PA 4C6FA 1V7YA 2NV1A 3NXLA 4GD0A 1XPYA 1HKVA 2J74A 4L9ZA 4PODA 1W9UA 1UWRA 2HISA 5LNWA 3PBGA 2HCVA 2CFFA 4H4IA 1LUCB 4QG6A 4ES4A 3GR4A 3ITTA 3UJEA 2VQTA 3KS5A 3L0KA 4ORMA 4LBRA 2DZUA 4MJ2A 1ZALA 4PA8A 1PYMA 1XGDA 1PKNA 5A6BA 4F0MA 1E0TA 3KVMA 1WUEA 4H2CA 1NOFA 4ADTA 1KTNA 3NQVA 3G0SA 4V1YA 2BHZA 4LEQA 2R1LA 2Y8KA 5AOUA 4F48A 2EPNA 3C8FA 2PZNA 3EX6A 3W1PA 4AH7A 1Z89A 3FVDA 3TKFA 3ITXA 1BXBA 2DH3A 4Z08A 1KO0A 3QOKA 5CH9A 3EA2A 2J27A 5H2ZA 1A5MC 2EPLX 5C2GA 4QSHA 1XFCA 5EY5A 1EIBA 1A0EA 1UC4A 1AUSL 3TW9A 1XICA 1XYMA 3QKZA 3OVPA 3CAKA 5CEWA 4K3ZA 1EF3A 1ZJBA 2AAAA 3ABQA 1TCDA 2HS6A 2ZDRA 1PTAA 1C93A 4HD5A 3GAKA 5EFFA 4PRWA 3QZAA 2BGQA 4IICA 4AD4A 1G4PA 5HMEA 4C6MA 5G1MA 4MF4A 2XWEA 4M0XA 3RCNA 3WUGA 4JTAA 4ERAA 4DRSA 3CT7A 1QPKA 2V5LA 4HMEA 1QTWA 1LQAA 1IXOA 1NFPA 4C6IA 5BXSA 1OX4A 3KHJA 2WSQA 4TOQA 4UTWA 2WO5A 4FAMA 2YDAA 3T0TA 4P7RA 1VCFA 3MP3A 5FKYA 2BZNA 4US5D 2V3EA 3BCDA 3GNRA 1PS9A 4LW7A 5CQ1A 1HXJA 3VZZA 4J3XA 3WUFA 3RLGA 4HYWA 2HK1A 3U6WA 3SY1A 4M1BA 3SY5A 3VGHA 1Q6GA 1F6PA 3N2TA 5L6UA 3W7NA 3R4IA 1ITUA 3W84A 2IQ0A 2BXYA 4WLCA 2QCMA 5DT7A 3LEPA 3O05A 1X8FA 1XLAA 4MZ8A 2VZVA 4WCJA 5C2CA 4I6VA 3DUGA 2C1HA 3DHPA 3H21A 3VKKA 1A5KC 3PHAA 3QGVA 3P82A 3W24A 1XIJA 1ZJIA 2QLYA 2C1IA 3T0CA 8TIMA 2D69A 4GQBA 1NQ6A 3EX1A 3NVDA 3OTRA 4GPNA 3F1QA 1A5UA 3W26A 5ABHA 1TMLA 1OG6A 4O1FA 4B90A 3V0TA 2W9MA 3SCPA 3VTRA 4JXCA 3CWNA 1UR9A 3F03K 5D9NA 1ZU8A 5JUVA 2PDMA 1S2UA 5TNVA 2EXOA 4WKHA 4NVTA 4S3DA 2D0FA 3D46A 4GYPA 1HO1A 4IFKB 4XKYB 3O9NA 2PC4A 5A2BA 5LXEA 3MT1A 4DO7A 1WUFA 3ECQA 4WOZA 5D2TA 4LF2A 1BSLA 4GNJA 5A6KA 1XYAA 1LLWA 4O1CA 1GONA 3MUCA 4NY2A 2CESA 4JNYA 1D8CA 4NHVA 4PTWA 4PYSA 1OYCA 2H3DA 4GRSA 4QDPA 1FHUA 3ZT7A 3EOUA 3SEPA 3GXPA 5HNUA 1OFDA 1VH7A 3W88A 4UR9A 3MC5A 5FJJA 1JZ6A 4K8HA 2Q71A 1I75A 1RK6A 3QC0A 3BXWA 1AJ0A 4YVVA 3S6DA 1AJ2A 2CU0A 3HFYA 1K8YA 4RCXA 1YX1A 4HJFA 4E4PA 3OOQA 3M7WA 1QCWA 1LOQA 2FZ8A 4A4AA 3W37A 4W87A 3STEA 1XYZA 3T4WA 2XDFA 2VFGA 3GXMA 3IEBA 3PTMA 1R86A 3B04A 4J3ZA 2BOGX 3G0XA 1C29A 1TVPA 3BK0A 2Y61A 1X1ZA 3BOLA 3EOOA 2BXZA 3FV9A 1FBAA 3CYJA 3OJGA 1BD0A 4FALA 4JTGA 3N2OA 5ABFB 5D09A 1W31A 1YPXA 2XGZA 1E4LA 4AHOA 3SAZA 1Q7ZA 3ARTA 3NL3A 3NQDA 2JGYA 4W7UA 4S23A 1XLBA 1TPUA 2NXGA 3GTHA 2FFCA 3HTWA 3UZJA 1LP6A 1UKPA 4EVZA 3GIPA 2P76A 4X9YA 3HPSA 3CUJA 1EXBA 1GVIA 4UFMA 4E2BA 2QJHA 1FWFC 1CTNA 1S5NA 2DP3A 4X9SA 3G1DA 4OVXA 2CLEA 3A23A 4MUPA 3S1VA 1JZ5A 2E5CA 3CUZA 4KW2A 5HNTA 2NT0A 3F5LA 3WZ0E 1GK8A 3TEVA 3R8GA 5E0CA 5HA7A 3QW3A 1ZHAA 1XLDA 1A3XA 1GW1A 3DAQA 4PSPA 1P5BA 2G50A 2VDHA 4F0HA 1ICQA 3CV7A 3N9SA 3E0WA 1J79A 1OZQA 1QWKA 1OWQA 1M53A 5LSMA 1IE7C 1TPEA 1EEPA 1OM0A 2PP1A 3WQVA 5EMYA 5FEZA 2WMIB 4FNUA 4MWAB 2GWGA 4WJXA 4S3FA 1B5TA 1XLGA 4FOUA 5AKQA 2FDSA 1ELSA 2J13A 3V0SA 2INZA 2QUTA 4LY4A 2NQ5A 4M80A 5CSUA 1H7NA 4GYJA 2ODOA 2VUNA 1C90A 1OADA 3WJXA 4NKCA 4JDYA 3D3AA 2JKEA 4ZE5A 2WOQA 3SCQA 1GOXA 2FB3A 2HZGA 3LA4A 3N34A 3QR1A 1EJVC 5C9UA 3C3NA 2WZHA 3KHDA 1QASA 1MXDA 3FA5A 1MUMA 1VP5A 2DZWA 1JQXA 3KE0A 3K4WA 2E09A 2Y85A 1DJYA 5AYBA 1RQBA 4AXKA 1BG4A 1FKXA 4U28A 2DZVA 3AS2A 4FLQA 2KX9A 4P7QA 6A3HA 4QROA 2WVTA 3LSCA 2HROA 2Z7KA 3QFWA 3QY6A 3SUTA 1V93A 3BCFA 3LLDA 3FLUA 3KOXA 4OECA 4X60A 1DJWA 3D47A 4LYQA 5DF0A 2J7CA 2R1PA 1W5NA 4IIBA 4UMAA 1K7FA 1XIFA 4PCNA 3SGZA 3AMCA 4HA4A 5D02A 1VBUA 4IH3A 4F8XA 2XIIA 2R6OA 4FF5A 1MEHA 1WXYA 4AF0A 4BF5A 1EA9C 3A64A 3SUSA 1HGWA 5F7UA 2FZNA 1E51A 3WJSA 5CLWA 2I57A 2FZ9A 3T9PA 2FB2A 3GZ3A 1DQXA 1JDAA 3KZSA 2PI6A 2WKLA 1YNPA 3BSGA 5DCDA 1AQHA 2Y8UA 5E0KA 3AS3A 1GOWA 3WUBA 5G2WA 3BOXA 1G01A 1UMLA 1XLFA 1SJCA 2V5CA 4PTXA 4PULA 3P7YA 1J96A 3GHSA 2VGGA 4NX0A 4G9PA 1CXEA 2YXOA 3W2NA 4YPJA 1H60A 3R5EA 5BRPA 3CV2A 1J2WA 3U3HA 3IJ6A 2HVOA 4RE3A 3GU2A 2PPGA 3E0IA 4PEEA 5G4HC 1ONEA 1Z9AA 3MUZ1 3OHMB 1E0XA 2XH7A 4UTMA 3NQ8A 1UH4A 5FEWA 2GUUA 4MB4A 5FA5A 1U5JA 3G24A 4PBFA 1RSCA 1G0CA 3URBA 4EE9A 3KOWA 4UZSA 2YW4A 1ZBKA 4PB5A 5LNSA 1W9BM 4LUTB 3PFRA 1KQYA 3S5NA 1Z44A 3BANA 5D37A 1XBVA 3SQMA 4H6EA 3EB4A 4RW3A 4QNEA 4H2HA 3BJSA 1A49A 3BJTA 4ZSTA 1XRFA 1OBAA 3B8TA 1J12A 1Q3NA 3ZT6A 2VEIA 3I7QA 3S83A 1DIEA 2VWSA 2GK1B 3W2LA 1KTCA 2QYGA 3VD4A 4N6FA 5JIWA 2A3EA 2OSYA 1ZJAA 5KSWA 3INPA 3PG9A 4WR3A 1UR0A 2YFNA 3GC2A 1J01A 2ZUNA 4PR4A 5BMXA 3G8EA 3MWAA 4ATLA 3OVRA 4O11A 4JTHA 4QGCA 2D20A 1XD1A 4KWUA 3MKCA 3E9AA 1B3VA 3VOFA 1YHTA 4KERA 1DJGA 1XLHA 4FNPA 3F5KA 2ZRXA 4PL2A 1XD0A 4AD2A 1A53A 1WBJA 1B9BA 2BVDA 4TVDA 3KFTA 1UKSA 3LMZA 1QRQA 1TPB1 2I9EA 3C61A 3SRKA 3I7RA 3DFNA 3UQNA 4ZO9A 1E72M 1GEQA 1JCYA 3F7JA 1W5MA 3WL0A 2DGAA 2VM8A 4HVXA 3T08A 5F4SA 3AQUA 4MJMA 4DBSA 5A8QA 5RUBA 3NDYA 1XW8A 3EWWA 4Z0SA 1TMHA 3NWRA 4H00A 2O7QA 1RA0A 3AIVA 4BA0A 1V03A 4YWSA 2DUZA 4Q7BA 4UR7A 1S46A 1MFUA 1F76A 1P7TB 4WEVX 5B7YA 5ECVA 2XIMA 1YADA 4ATDA 2F2HA 1NDZA 3TN5A 9XIAA 2BASA 4FX6M 4AFYA 4OOUA 1VFTA 2ZZ7A 3M0KA 1O7AA 3ORWA 3MV01 2CZEA 4MUZA 4KFOA 2CNCA 5FOOA 4L1XA 2QF8A 2EG8A 1QOXA 1B1YA 3H24A 4M1RA 3W82A 4OTKA 2W27A 1H49A 3M0JA 1UPMB 2QDHA 3CMFA 2XISA 1TA3A 3L4VA 3JR2A 3UR2A 3EWCA 5DLCA 4K7VA 2TYSA 1D2KA 1KRMA 1ITQA 2WCGA 4KRUA 4JQAA 2C1GA 3VABA 1K9TA 7TAAA 2VEPA 2D2HA 4E3TA 5A2CA 2QCGA 3NPWA 1Q8AA 2XIQA 2ZICA 3RAOA 1IWBA 3BL3A 5DRCA 1PO9A 2X1IA 3SQSA 4WDUA 1F2JA 5PTDA 3E2VA 3QXBA 2Y5EA 3L23A 1N55A 3LCLA 4XAPA 3U2CA 1VB9A 3LPOA 3M07A 4HCDA 1UKOA 2PCQA 4MGGA 3T4CA 2ZX6A 3VZYA 3FGCA 4TXEA 1GWJA 5HNNA 4K1GA 1KM0A 4HPXA 4N4PA 1JQVA 4HNCA 1EJWC 3ID7A 4DZHA 3D6NA 1JGMA 3I3BA 5CAHA 1GPWA 1JZ4A 3ZIZA 4DXVA 3ZLGA 1ECEA 3POHA 4XZLX 1VIZA 1XSIA 2D2OA 1MW1A 3DHDA 3I6RA 4LUSB 2FPVA 1PTGA 4A8IA 5A69A 4CVWA 3REQA 1SFTA 1UD8A 2HNHA 4A3QA 4LWWA 3CPGA 5FL0A 4AIUA 1QNRA 1A47A 1D7KA 4LOCA 3NO1A 3WEZA 1UC5A 4HMNA 3LCGA 3AALA 1Z6KA 3IAPA 2PLKA 1BG9A 3NZ1A 4CCEA 3BLDA 2ISWA 3IGUA 5A2AA 4G7EA 5XIMA 3W01A 2QEZA 2VMFA 1LL4A 4GCXA 3TW7A 1GJWA 4XWUA 3VGEA 2Y7DA 2DJXA 4HK7A 3WF0A 5F2GA 4LUJA 2VGFA 1J9YA 4CCZA 2P8BA 2HJPA 3HU7A 3AMLA 3QTPA 4IOTA 2ZADA 4RV8A 4DBUA 4E0CA 3OP2A 1ZQ5A 1BF6A 2GDQA 2YCKX 3THAA 2ZXAA 5A6BD 4Q4PA 2YDSA 3T8LA 4B4FA 3C0JA 3THDA 3TNOA 3DG3A 3NPXA 2WJZA 3N2CA 2ZZ4A 4EAYA 4LRSA 1TFVA 4B92A 1TVNA 2YBTA 3G1SA 3WNPA 1B3OA 3EPOA 2PDQA 1KBJA 2ZBTA 1AA1B 3MJYA 3Q67A 3NOEA 2EBNA 1BSIA 1F3XA 2OT0A 2H9AA 3NZPA 4GQRA 2DSZA 2ATSA 2BVWA 3W7GA 1DJHA 3SBFA 4GY0A 3TC7A 1UIPA 3F4DA 4HZMA 4DLMA 2V5BA 5LIKX 5FAJA 3W1XA 4J27A 4WSHA 3C0QA 1XH0A 1CWYA 1C3FA 4TX9A 3EB2A 2QDEA 4YLWA 3ERPA 1CECA 4Q4OA 3W1LA 3QLDA 3QQ1A 3I10A 4FOJA 1FH7A 3BV4A 2HRWA 1ZP3A 3WG6A 4EIVA 1OGBA 3GXFA 3DKLA 3LGDA 1VQTA 4CD7A 2PWDA 4R34A 5LNUA 3N6HA 2GVLA 3LRMA 5LA1A 1P4CA 1UUMA 3QY8A 3UR7A 5CGTA 3NM1A 3B9EA 4J4KA 3QYSA 1I2OA 1PCWA 2GJNA 1QW8A 2OPJA 2DIEA 4GFSA 1XC4A 5K9DA 1A5NC 3NQ7A 4MLRA 4UQAA 1R30A 3VO0A 3VXGA 3WF1A 4OOZA 3MYPA 3NSXA 4J40A 1BQGA 1SO5A 5I24A 1NTHA 1RHCA 1DIOA 2QDGA 5FF4A 5D4YA 1CLKA 4FX8A 2D3NA 5FF7A 3TZFA 1SZNA 4Y8EA 2X7VA 4IMAA 3TLLA 5FEPA 3S8HA 3M0HA 1NJJA 3BLFA 4WXZA 4XAGA 2X2GA 3WL1A 1ZPTA 5A8NA 4AZHA 3AZSA 2F6UA 3BAJA 3BAIA 3CBWA 1P48A 3IVSA 3TYCA 3KZPA 4I7UA 3CH9A 3R7MA 5LIYX 4PUEA 2JIEA 4DWSD 4PCSA 3TU9A 4TTUA 3S2CA 3OZYA 4NP7A 3EWZA 1JAKA 4HOWA 3WQ5A 4RDWA 4W88A 3ZR4A 1Q7QA 4L4PA 2FFIA 3H4XA 4ZQCA 1O5KA 6XIAA 3WH5A 3WQFA 4K38A 4ZFMA 3QV9A 3SZ8A 3WFZA 3GDRA 3IVTA 5BMWA 1P0NA 3WELA 1PBGA 4EWND 1GYLA 3TN4A 4QJ3B 1FH8A 3WQCA 4M51A 3PS7A 3G1FA 3UA3A 4HN8A 4PTMA 4C1LA 4R7JA 3M41A 3VIFA 4L6HA 1S1PA 1QMLA 5TAOA 1QW9A 2GFTA 3FOKA 2XG9A 1E6ZA 2ZZ3A 1BXCA 4NZ4A 2ACUA 4CLMA 3IIXA 2PLJA 4MNMA 4PSRA 1K70A 3VKDA 3TOPA 2EEXA 1UW9A 1KGUA 3LM7A 3PAJA 3MO4A 4AD3A 3AIBA 2LLEA 1VFOA 4J35A 4ROPA 3HG3A 3MWCA 4A05A 3S9YA 1E73M 1AFSA 3UWVA 5CAKA 1HF6A 1OK6A 4UZUA 3EPMA 1EBGA 2QIWA 2R24A 2BY1A 1EF2A 3VD5A 3K1GA 3HQPA 5I6SA 2DVTA 3M0IA 3HGRA 5EBUA 1XINA 3KL0A 1H11A 4N02A 1SJDA 2BHUA 3QMRA 4B2DD 3MI6A 3ITGA 4U4MA 1VYPX 8A3HA 1AH3A 4GXPA 2DSKA 3E02A 5AB3A 2BMBA 2AOSA 1MNZA 3MYOA 2GGEA 4DF2A 4Q8TA 2VR5A 1OFOA 1WDDA 4HSHA 2PBOA 4DWDA 3B8VA 1YIXA 1IT0A 1VBGA 3P8JA 3WLOA 3UETA 1SPQA 2A2IA 2B81A 3BE7A 5FEXA 3PAOA 4I7WA 5C2XA 1GQLA 3CUGA 3FXYA 2YA0A 2Y6ZA 2C18A 2WHLA 1UWIA 2EPOA 3VDCA 1HJQA 3IRDA 2G41A 3CB3A 4MB3A 1FCQA 4GC3A 3HPAA 2IPJA 4BHYA 3IRSA 2NUWA 1YBQB 2QV5A 5A6MA 3TTSA 3L4UA 3AZRA 2I5QA 4GIAA 2I16A 3BTNA 3JUGA 2GSHA 1B31A 4KCWA 1EUAA 1ZRQA 2GOKA 1KM2A 1K4HA 2VCBA 2VRKA 3VD9A 4O10A 2A3BA 3BUVA 4XO6A 3PC0A 5HJLA 2AKZA 4ADUA 1Z32X 3FA3A 3B9DA 1NY1A 2RHGA 3K30A 3PWIA 3R1ZA 2FTPA 3OVQA 1T5AA 2OTDA 3P5YA 3GUGA 4UTHA 2AQWA 2VKZG 4C5ZA 4JX6A 1OC6A 2GPTA 2JEQA 1ISZA 5CBIA 1HG3A 4HQVA 3V35A 3LTPA 4PUMA 2V3DA 1CB2A 1MZHA 4QE1A 1ISWA 1NWRA 3LHTA 3E0LA 2CCRA 1B90A 1O5QA 3CTLA 4LBSA 3N6JA 2X7WA 1CGTA 5J5RA 4FLSA 4DUWA 2NLYA 3UZXA 2NVAA 5HAOA 3HPFA 4PMVA 4ZO6A 3UNDA 5G2HA 2Y4SA 4ZQRA 4HOXA 3M5YA 1UR8A 4ZVJA 3CV1A 4B3KA 1QI0A 4H3DA 3W07A 3EOEA 1VCVA 3W7IA 3E0VA 4HPGA 4NZCA 1GQNA 1BVWA 3AWOA 1HVXA 2CLOA 3UPWA 2PDLA 4O0KA 5E5CA 3RX4A 1YQ2A 2I56A 1KA9F 1I2QA 2VOMA 4TR9A 2J7FA 4W86A 3QHNA 2BNJA 5A8MA 4UUIA 1RZMA 3VILA 1S5TA 1TELA 1MO0A 1TZ7A 1X6NA 1M7PA 1TIMA 1W3JA 4LF1A 2BX7A 1YNYA 4X3ZA 3W7RA 1NDVA 1JCNA 2Z1KA 2O4MA 2OYMA 3FDKA 4PMOA 4DHGA 3S2JA 3P0XA 4GFIA 1MQPA 3KX6A 1I4NA 2VCCA 5HQMA 5FSDC 3GU1A 5EBAA 1H51A 1FWIC 4AXNA 2VR2A 2YLLA 7REQA 3U4FA 4HGXA 3CHFA 4KCTA 1VBHA 1LTDA 1W1VA 3S5ZA 5AFDA 4K2SA 1B57A 4B5TA 5I09A 1TKKA 3KWXA 4OUEA 1FWGC 2PRMA 3DHUA 2E67A 1JYXA 4LX4A 1SZFA 5GVJA 4GQGA 1TV4A 4AYSA 2PWUA 2I5GA 4WOQA 4X0VA 2ZXBA 5AC7A 4YXGA 1K7EA 4UTIA 5AHFA 3EWDA 3E6EA 1WZLA 2IS7A 3QMTA 1VFSA 3F2DA 2QT3A 4W8AA 3VCNA 4XSMA 1J0JA 4JTKA 1U30A 1TPC1 4QIUA 3IJ7A 2O4QA 3WFLA 1TWIA 2V38A 1TV8A 2C19A 4AVNA 4GY1A 2R14A 4GLEA 4V33A 1E0WA 4Z1DA 1B4EA 1FDZA 1G5AA 2O9RA 3OLEA 1FP8A 4BKNA 4C6OA 2PTYA 1GQJA 4H1ZA 4PZVA 4FF7A 1GPFA 1R8LA 5I2UA 2Q3RA 4PMRA 7XIMA 3GFYA 2W79A 4DN1A 5D8WA 1E9YB 2I17A 1JF5A 1GVQA 2OX1A 5JXQA 4R53A 1N8WA 4MG4A 1PAMA 4NAFA 1F61A 2QCLA 1ME8A 1EDGA 4A3RA 3CLWA 4ORIA 2CZVA 2A7RA 1QOPA 3BMVA 2PF8A 2GVEA 4A8LA 1OYAA 3OODA 3R0KA 2REQB 1OD0A 2ALRA 3V5OA 1KFKA 1UWAA 2QDDA 1VLIA 3UXIA 4QXIA 3MANA 1KBIA 4QCFA 4WQ6A 1CIUA 3TYUA 4PFMA 5CBBA 4U5IA 3M16A 1L6SA 2I14A 2QUVA 3EXSA 4ZQOA 3Q2DA 1B3XA 5DCBA 1TMQA 3MPGA 3GVRA 3USBA 7TIMA 4FP1A 1Q45A 1NWUA 3A4AA 4NI3A 3ABXA 3G2GA 4M7SA 1M01A 2OEMA 2J75A 4JCLA 3U2OA 3RU6A 1FXQA 1VEOA 2CEQA 3SSJA 3K2GA 1KW1A 4V1XA 3PULA 4B5WA 1E6QM 3BARA 4NZ5A 3MUXA 4V15A 1TPDA 3ZM8A 3VDHA 3TQPA 5CKSA 2VC6A 3J7HA 3PZUA 4M24A 3HN3A 1G1YA 4UFHA 3BMXA 4JN7A 2L5HA 4DNHA 4DQWA 3DHFA 3HURA 3QGKC 1XIDA 1L2QA 3QOMA 4GUFA 1XQKA 1BPLB 3MS8A 5A6AA 3AI0A 2XM1A 5M03A 3ZVHB 4JEJA 5J8LA 1DVJA 3QKEA 3N18A 3QY7A 1IT8A 1M6JA 2Y7EA 2DT1A 1F4HA 1L6WA 4HU0A 2ZFAA 1HKWA 1F8MA 1F3WA 4X63A 4CD6A 3EWXA 3H12A 4KRTA 5KETA 4RNFA 3ABOA 2A0NA 3N2BA 2VDGA 3ES7A 4O53A 2HPMA 4HCLA 4XSLA 3S46A 4BQ5A 3F2CA 1EJXC 1BVZA 4R9OA 3TSDA 4CD5A 1WPCA 4Q4MA 3WDPP 1BEUA 1PB0A 2OCZA 3M0VA 1B0IA 3RFAA 1TJ1A 1JCTA 4MWAC 1F73A 4AISA 3VPLA 3TXVA 2QUNA 3CQKA 3BO9A 4I90A 2WC4A 1XH2A 2Q09A 3VIMA 1AQ0A 4OBTA 2HMCA 5GNXA 4HP5A 1KC7A 3WKZA 3PTKA 3VDGA 3U2EA 1IQ8A 3H4GA 4L4OA 3AIQA 3UFYA 4O4WA 1WDQA 3ZJ7A 4NRSA 3UWUA 4MPKA 2VX7A 1WZAA 3BLPX 1R46A 5BROA 1L6GA 5C9XA 5I7GA 1RBAA 1JUBA 3BW3A 1PSCA 4F2BA 1E1FA 3P2VA 4M29A 4N0RA 4TV5A 3KOFA 4JTFA 1E71M 3SB0A 2Z4GA 3T2OA 5AECA 5HINA 1OT2A 2ZX5A 3WMBA 2Z1XA 4M82A 2XTKA 1ZAHA 2DU2A 2A1YA 3R58A 3VGFA 4ZGYA 2E3ZA 3G1YA 3SO7A 3WQEA 4EPKA 5E93A 1ZB5A 4FX7A 1EO7A 1US0A 4B5VA 1REQB 1OEPA 2O92A 1R2RA 1V6TA 3VCCA 4C1NA 5E9AA 3TW6A 3VKBA 2VFFA 4R27A 1H7XA 1UCWA 4UOJA 2RJHA 3WLNA 2PODA 2WMGA 4LB3A 4DUOA 4MKVA 4ZTYA 1UR4A 3GAYA 3MZNA 4DJFC 2A3HA 3PUGA 4JIRA 3WH6A 2ZVRA 5I78A 3AHZA 3EAUA 4ZB2A 1N7KA 4LGXA 4GUJA 3CZLA 4AZ6A 4IHCA 2VGIA 1PIGA 5FI8A 4CN4A 1B2YA 4GI6A 2VEKA 3SIZA 3RUBL 3ANVA 1J5SA 4H01A 4NJHA 1TRDA 2NX3A 3WENA 2NQLA 3O1NA 5XIAA 1J10A 1TJPA 1JYNA 1A5SA 3S47A 1FWCC 3ZJ8A 1AODA 3ZZ1A 3O07A 4WDWA 4MLJA 1FHVA 4PMUA 1BF2A 1KD0A 1W1A1 2Q01A 1C9DA 4NZ1A 2FH6A 4JQ1A 1OJXA 4Q8UA 2BS9A 4J7RA 1JFXA 1TRIA 4JFTA 5HJXA 1K6WA 3RG6A 2UY4A 3C8NA 4G1KA 2NWSA 3H70A 3DCPA 2OKOA 3O3RA 4MKNA 1G67A 1UWUA 3CZGA 4G6CA 5HNRA 3MUAA 4IIGA 1J4EA 1NM9A 2HDJA 4C6JA 2PDJA 4IFRA 3IUIA 2NXHA 2FHFA 3JZUA 2Y2WA 2X16A 3R25A 2ADAA 1RCQA 3H2FA 1PZ2A 1O5RA 5CPSA 3VGBA 5EGRA 5AYZA 4TTGA 1EPVA 2HBVA 4YHEA 5DT5A 5CGMA 3WDHA 3BLLA 3L66A 2GGGA 4C6EA 7CGTA 4IMDA 1EX5A 1LUCA 1F3TA 4ZQPA 3R2GA 5H91A 4A35A 1DWFM 4FNRA 2X0YA 1XIMA 2XVGA 2J7BA 4MFEA 2D22A 2C8NA 1TZ9A 4PMZA 3GDLA 1L6YA 3BLKA 4YVPA 2YCJA 2FMNA 5FD0A 1XGZA 1ODZA 1BRLB 4F40A 4BS0A 3B0PA 3P93A 2G0WA 3WQDA 1XHGA 1R2TA 1XX1A 4DM2A 4IJCA 5GJNA 3MMTA 2BOFX 1BVNP 1S39A 4L6DA 1OQFA 2ZRWA 2FTYA 1U2YA 4IUGA 1FWJC 3ZWSA 2D73A 4KRZA 3LNPA 3LOTA 3IANA 3CS2A 5F4XA 1N2VA 2YCIX 1K77A 2R8WA 1VLWA 3PNZA 4HTYA 2QCHA 4AMAA 3MDWA 4MY8A 3WLKX 3VMOA 1RVGA 1MXGA 1MQRA 4H6QA 1RLDA 1KXHA 1H7OA 4I5XA 2VO5A 4HPJA 4S3GA 3SRHA 3ZO9A 1SFJA 3W86A 3H2EA 3DI1A 2P88A 3SDOA 4B5UA 4ZE4A 4CN6A 3ELFA 3A3WA 2GOUA 1UHVA 3T09A 5FESA 3GC5A 4HCHA 3W00A 3CMJA 3NYZA 2YA1A 2B7PA 3GVQA 1VAHA 4B5XA 1E1CB 2A3LA 1I6NA 3VX1A 3B05A 2OO6A 3VD3A 3NQFA 3I4KA 2CBVA 2OGYA 3ZSSA 1LORA 1E5NA 2C13A 3DGRA 3AYRA 3ZOAA 2XVNA 5BZAA 5CG0A 4XZNX 3PP7A 2XSXA 3W87A 5SWUA 3HGSA 3P5ZA 3G77A 3ZJKA 2DORA 4GXMA 3TAKA 2J6XA 3LPFA 5DXXA 1GUVA 3EKGA 1MFVA 3MVTA 1Q6OA 1RALA 1HIZA 1FTXA 1P0DA 4N6EA 4I9AA 4GVFA 1QK0A 3W2KA 4F79A 4Z42C 3ONBA 4DXKA 2HPIA 1BKHA 4HMDA 4O1AA 4ZXOA 3TYAA 1R9XA 3WLQA 4AX6A 1CI1A 4IPNB 1IV8A 1VPXA 1OX5A 2CHNA 1S5WA 2F9RA 2NSXA 4C6LA 2CWXA 5CCZA 1UD2A 2R1KA 3LXBA 3W76A 1ZBCA 3S1XA 3UWQA 3VA8A 3AIWA 4Y7EA 5D9OA 1Q7MA 4DY1A 4EF9A 3IV3A 4S2CA 1W5QA 3CLMA 4IFKA 2YZ5A 4XKYA 4XBKA 3GIYA 4REQA 4NASA 1KRCC 3FNDA 1H4PA 3H53A 3AHVA 5E09A 4I5RA 4QBXA 4RNJA 4UTJA 2YYUA 4XZBA 3THUA 2C7FA 1DJQA 2AL2A 4GYKA 4E6MA 4GINA 3UY7A 5FF2A 3LCIA 1C8XA 1JZ8A 4QHRA 1Y65A 3CIXA 3KOYA 1CCWB 1JD9A 3IJLA 1SFLA 2CZDA 4JZ5A 4IL2A 3UWWA 2CZFA 3FSUA 3VIOA 5G1TA 3E5BA 1XWYA 3NZRA 5AVNA 4DI8A 1CXKA 1BXNA 3WMCA 3AISA 3QJAA 4GIYA 4RUBA 3VM7A 5BOOA 4N9BA 4S1FA 5D2XA 1EUNA 2AMXA 4K39A 2DH2A 2O9OA 5JIPA 4G5DA 1P1XA 3FXGA 5DBUA 2E7FA 2FGZA 5JQ9A 3BOFA 1Q5MA 4HBKA 4NI8A 4TX8A 4DJEC 3ZQ9A 4GH1A 2RDXA 1RJQA 3B8WA 4R7WA 1GJUA 3ARRA 4AEFA 5ABFA 3PZOA 3H2OA 3TZNA 1E6RA 1EJRC 2TODA 1AL8A 2QVNA 3IVUA 3OG3A 4Q22A 1WCGA 3KEHA 3N04A 3UP8A 2VD9A 4GUHA 2H8XA 4EX4A 4DWSB 4L1WA 2CHRA 3THQA 2DZPA 1L2UA 3LBCA 3PBYA 3W3OA 4TO8A 1XSKA 3WEOA 3TTYA 3WEMA 4XZIA 1FH9A 1XLKA 2G37A 1EOMA 3TUUA 1ODUA 1JPIA 4BCEA 2DZXA 2G3JA 1GOMA 3F4WA 5C6MA 3L67A 4WX2A 4XD4A 2E9LA 1GCYA 2OKTA 2FVLA 1MVYA 3I68A 2OZ8A 4Z2IA 3TFXA 3GDTA 1C9WA 1ME7A 1H7RA 4XD6A 1KKOA 4FIQA 4RV3A 4XAFA 2WMIA 2NQZA 5BXPA 3VNJA 3W4RA 3VNIA 2Z6JA 3CQHA 5TF0A 3UWYA 4PMDA 1AG1O 3A4XA 1H62A 4H9ZA 4QR6A 5BWAA 3CQ0A 4FXSA 4QJ5B 3N4EA 4KESA 4P7NA 5AY7A 1IWAA 1U22A 4RKAA 2HWGA 2GGIA 1NAL1 4M6QA 5TQLA 4OU1A 4GKLA 3PJWA 4Q8NA 1O94A 4Y9AA 4AUBA 3W22A 4JYDA 4Q8WA 3EDJA 1KBBA 4JCMA 4N4QA 3W1AA 4YTTA 3NFUA 4JBRA 5I3JA 3M5ZA 3PTQA 3T07A 1PKLA 3LLXA 2QS8A 5CSYA 3EA1A 2WSYA 2PS2A 2C79A 4GQQA 1IWPA 3TSBA 2TAAA 1Q65A 9RUBA 1SW7A 4QG8A 2I5IA 4CQAA 3IGXA 2RGLA 3UA4A 4YVXA 3S5SA 2BGNE 4K7YA 3WNLA 1E0UA 3CIVA 3EB3A 4RPQA 1T8QA 4MPQA 3LGGA 3GHUA 2HK0A 1MDLA 3SN1A 1XH1A 4C91A 4E5TA 4FNSA 3RO8A 1DIKA 5FJTA 1Q66A 4I9JA 3V18A 1DPMA 1GOQA 4L5ZA 3VGDA 4BQ3A 1K9EA 2A79A 2WZMA 2F6KA 3D0CA 5DBTA 2VOTA 2PAJA 2PDKA 4XZMX 3KOZA 1FDYA 3TH6A 1O1ZA 5HPCA 4NZJA 1LROA 1GEHA 4PBGA 1NDWA 3GC4A 1MSSA 1G7UA 4NU7A 5F1VA 4ONVA 1MZRA 2PTDA 2X8RA 2CW6A 1TR9A 1DXIA 2VGBA 1H50A 2Q8ZA 4TVUA 4WUIA 5KTLA 4JY8A 1H1YA 2YL5A 1J2BA 2VL4A 3P81A 3AO0A 2Y62A 4FHAA 3MUY1 1GOIA 4D71A 1GW9A 2XFRA 4MSSA 2HXUA 1TV7A 3SCNA 5HMSA 2OOFA 2A6NA 1Y0EA 4UOZA 1IGWA 2V8ZA 2WXDM 1VKFA 3C86A 2ZWYA 4ZB5A 4H8VA 4HPHA 3LRKA 3T44A 2P50A 1A50A 3C0SA 1US2A 1BGAA 2IPFA 1YKWA 3CWOX 3T78A 2ZA2A 3TC3A 1R7OA 4WDXA 3S1WA 2F6XA 1MRQA 4AQLA 2D24A 3II1A 2ZRUA 1E6SM 1SJAA 3CXOA 3LGEA 2ZX8A 3DYPA 4YIWA 2ATMA 4A6GA 1GHSA 4ZBCA 2QW5A 1H61A 1G4TA 2OR2A 4C65A 1MRAA 3WDJA 3V75A 1YTEA 1MQQA 1HFBA 1T0OA 1TTQA 1TPH1 2J8TA 4AC7C 4LUTA 3QN3A 3K8KA 2G3FA 1H7WA 5A8PA 1XL9A 4ICCX 4KGJA 4NL1A 4NYYA 2W91A <