1R3RA

Uroporphyrinogen decarboxylase with mutation d86n
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSNILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen Decarboxylase
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3rA00
4L65A 1U1JA 1R3RA 3GVVA 4WSHA 1JPHA 3L7RA 1R3YA 1U1UA 3GVWA 3PPCA 1JPKA 2NQ5A 1R3QA 4AY8A 2Q71A 3PPGA 4ZTXA 1JPIA 2Q6ZA 3BQ6A 4L64A 4ZR8A 1YPXA 1R3VA 4EXQA 1R3SA 3GW3A 1R3TA 3PPFA 3PPHA 4AY7A 1R3WA 1XDJA 3CYVA 3RPDA 3T0CA 4L5ZA 1U22A 4L6OA 2EJAA 1J93A 1XPGA 1XR2A 1UROA 4ZTYA 4L61A 3GVRA 3GVQA 1T7LA 1U1HA 3BQ5A 3GW0A 4QQUA 2INFA 4L6HA
chains in the Genus database with same CATH superfamily
3M6DA 1YXCA 3KDNA 2ACSA 3KEHA 1XGEA 3L4ZA 2BY0A 1DE6A 2Z28A 1NWRA 7XIMA 2YXXA 4G7FA 3GDLA 4IICA 2R91A 1QO2A 4DO5A 4WEVX 1TMQA 5D03A 2WCSA 4C90A 4IX0A 3Q94A 2ZIDA 4PTMA 3IVUA 4Z1AA 2EG7A 3WDIA 4F9DA 1UD5A 3UF9A 3E49A 4Z1BA 4XKYA 3EOSA 3IUHA 3T44A 3A21A 2B7NA 4LSBA 3EA2A 4UWMA 2Z1SA 3E5PA 1XUZA 3VM7A 1W56A 3A5FA 1Z48A 4YCPA 4UB9A 1JQXA 1Q6LA 2DZUA 4DNHA 1IGSA 3MVIA 3W23A 4MB5A 2BMBA 5HNUA 1ZCCA 5HJYA 2PCEA 2PP0A 3BQ6A 2FPYA 4QSFA 4UTLA 1S2WA 6CGTA 3NO3A 4IPPA 3VKDA 2P0OA 1D8CA 2QJNA 2GLKA 2DH3A 1SZNA 3E0WA 1QMLA 5CPMA 3L2LA 1V3KA 4DZIA 3HQNA 3MMDA 1IWBA 4UMAA 5AZ0A 1ONXA 2D1ZA 2ICSA 2Z2UA 4ZB5A 5KETA 1XIEA 3HPAA 3MB9A 1UB3A 4Q8QA 1XQKA 2JKEA 1EGMA 2QCDA 1UR0A 2BY2A 1IV8A 4H1ZA 4AMCA 4D6GA 2P10A 2X7VA 4Z0SA 4JBRA 4IIFA 3U57A 4RZ5A 2OODA 1TO3A 3FDKA 4NJJA 1CNVA 2ZTKA 3AYRA 3N9RA 4PTDA 4CNPA 2R24A 1BXNA 3VNZA 1UBPC 1JXJA 3PR2A 3B0YA 3W7GA 1HGYA 1TSIA 2XIBA 3AI0A 3RX3A 1ADOA 4OHQA 4RE4A 1KM4A 1J6OA 1UUMA 1KQZA 3TK7A 8CGTA 3L5LA 2W66A 1AD1A 2CKRA 3VOHA 1CXKA 3HG5A 2O4QA 4GVGA 1SGJA 3G8EA 2CEQA 3LZ5A 5JUVA 3BMVA 1UZDA 4C6JA 1JUBA 1X8CA 3UXLA 3DOPA 4BEUA 1K8ZA 1FRBA 3VABA 2BY3A 4GYPC 2FGBA 2CLMA 3FAWA 3CBWA 1XBZA 3TQKA 6REQB 2GVLA 3L12A 1W37A 4HOZA 4UTKA 3F03K 3PJWA 1U22A 3COTA 2ALDA 2UY2A 4P8VA 3W2JA 1ZNNA 3MBDA 1QWKA 4UQ9A 1C7TA 2GGIA 4Z2JA 1IEXA 4M0XA 5CAKA 1Z69A 1XLJA 1ZZMA 1UP2A 2XINA 5M3WA 4TTUA 3LMZA 3WD3A 1PSCA 1JGIA 1N8WA 1MXDA 1VJSA 5A1AA 3TTOA 3DH7A 3OOQA 3B9EA 4CNNA 4QDMA 2C91A 4LC6A 2BLEA 2VVNA 1NDZA 2HPMA 4Q7NA 3QY8A 6TIMA 1XKYA 2GDQA 2E40A 3MHUA 3MSDA 4LCRA 4IMGA 3E2RA 4PN2A 3G3DA 2R1LA 2PP3A 3H4XA 3S6OA 2WCAA 4F2UA 2QPUA 5E0CA 2PLMA 2A85A 3DHPA 3KLLA 4HK6A 1BQGA 1NVMA 2VHLA 2PA6A 2BY1A 3O8AA 4DWSC 2V5KA 1YLVA 3DFQA 3S1UA 2VZUA 2OLAA 1V6XA 1OX6A 3DZ1A 1ONWA 2QXWA 4O1BA 4Q4KA 5T9BG 4DYJA 3GRIA 5HOSA 4HA0A 4I9TA 2ADAA 1J18A 5JH1A 4RV8A 3B0VC 1KLZA 4C6DA 4C7DA 3CWHA 3SFKA 2VFIA 1GKQA 4JTJA 1QI2A 4KBXA 3M0LA 4NX5A 3L4VA 3NSXA 1XRTA 4C6EA 4E8CA 1EX1A 3FV9A 1LT7A 1H62A 1N7KA 2V2HA 5A8MA 4DJEA 3OVGA 1AMYA 3LXBA 1UH3A 3DCPA 3LPFA 1G5AA 3P3BA 2GOUA 4PMXA 4BI6A 2ZC8A 4GIRA 1CT5A 1VQTA 1ZUAX 4IMAA 3RNDA 3FY1A 2FQIA 3VKKA 1YKWA 2VNCA 1B31A 2BBFA 4O57A 4XAGA 1QHZA 5A6MA 5LNUA 2Y70A 3TZFA 4GK8A 4KWOA 4HNVA 1SYTA 1KBIA 5LNSA 5LA1A 1XH2A 1LOSA 3AXXA 4LVAA 3FVMA 2ZC1A 4HK5A 4IP4A 3QMSA 4ERAA 4K6AA 1GHRA 4RDVA 4AW7A 3T08A 2PDNA 3QHMA 1WV2A 1KBBA 4K8EA 3HTWA 3DYMA 1Q2RA 1B2YA 4AIUA 1LF1A 3V5FA 2E5CA 2NZLA 5DXYA 3WL0A 3WNKA 3BPWA 2ZZ2A 5EMLA 4KCUA 3CB3A 3GY1A 4L6OA 5E6YA 2OVLA 5I3DA 1CYGA 4IP5A 3VNDA 4M82A 2AL2A 4GO8A 3TTEA 3QN3A 1WDSA 2ZVIA 1WUFA 2PEVA 4QGCA 1YPXA 3HF3A 4V15A 1TKKA 1E9LA 2NXGA 4M19A 4B5NA 5IBXA 4Y9OA 3SM0A 3P84A 3S2CA 4CQ8A 4EKJA 4MAVA 5TIMA 1XL9A 4H6RA 2QIIA 1K8YA 2C71A 5I09A 2I9EA 5EKYA 1FWWA 3HGJA 3NXLA 3SI9A 3W85A 5IFTA 3ALGA 3C86A 4BK9A 1W2PA 1FX6A 1TA3A 1UD3A 4LBRA 1LL4A 1QNVA 1WKEA 1KW1A 2BVYA 1WAUA 4RXFA 1XLDA 1MUWA 1T41A 3W6LA 3VOJA 4ZB0A 3BDKA 2J62A 3CHFA 3LPGA 1W91A 2TAAA 2I7GA 1YHTA 3M0MA 1GJPA 1ML1A 2CLHA 3P2VA 1JR1A 4WHBA 1K9EA 4B4FA 4LX4A 2ZX8A 2AMGA 2DJXA 4XISA 3NO1A 3R0KA 4J3VA 3IJ6A 1CB7B 1G4SA 2O92A 4QEHA 5GQBA 2X40A 1DHPA 2HSAA 1VFMA 2PTDA 3SCTA 5K2ZA 4LV4A 4H7VA 5T8GA 5HUOA 4AZHA 3GG0A 2J9YA 4BF5A 2C15A 3GFXA 1O60A 3VYLA 2OT1A 1REQB 1CEOA 2ACUA 4K7YA 1E0XA 3EX2A 3CEPA 2D2OA 2XZ9A 4RW5A 5A6AA 1MMFA 1DXFA 4HA1A 2G50A 3RPDA 1FCQA 3T8LA 1LLOA 5FJJA 3MUIA 5ABFB 1OWQA 3V36A 2E9LA 3ITOA 4F0LA 3M6YA 1X1ZA 4H19A 4NKCA 3SB0A 2OOGA 1RVGA 3W1XA 3VIJA 1K9DA 3CLMA 2GGHA 3C8FA 4EWJA 4MYXA 4R9OA 5DN1A 4MNLA 4H9UA 3IIOA 3UZ5A 1JFXA 4Q4RA 5G2WA 3K5XA 1EEPA 1ITUA 4RDZA 3FSUA 1GW1A 2A3LA 3TYEA 3KRSA 2GVGA 1WUEA 4H9XA 1G69A 2J13A 3KP1A 4ECLA 5CSSA 3KL3A 3TXVA 1B3OA 5ENLA 4HTBA 4CN4A 4GKLA 4F9JA 3IGHX 3OTRA 4A21A 4I8YA 4IIGA 3N9KA 1KFJA 4C1LA 3WO8A 1EZ2A 5EFDA 2V8ZA 1EUNA 2YBVA 1EGZA 5DCEA 1O66A 4AVNA 4B92A 3F4CA 3O0KA 4GRSA 5AB3A 3EMCA 3NJ3A 4MJ2A 3S1GA 3THCA 2HE5A 5FJUA 3BCDA 5B7ZA 1PEZA 4FK9A 1DXIA 1C90A 2FZBA 4YVVA 3F4WA 2NQZA 3FHQA 1EJRC 1FKWA 4PEKA 3MBFA 4CN6A 1TJPA 1O5XA 1E3XA 2DVXA 2VC6A 4GH1A 4UTIA 3DBNA 1KFWA 2CERA 3GIYA 2QF8A 1D3CA 3SRHA 1UKTA 3KW3A 3KCLA 3ZLHA 4OWGA 2WVVB 4HJFA 4NJKA 1R30A 4IGMA 3QY7A 1KBKA 2VC7A 1LL6A 4IJCA 4LAMA 1Z8AA 2KAUC 3ARQA 3W2MA 2XVNA 3HN3A 3OQEA 1X38A 2C19A 4YL2A 4DM2A 2QMKA 3E02A 4PTNA 4U33A 3S2JA 3FYOA 3FKRA 2VUNA 4H9YA 1N2VA 1WDPA 1RHCA 3PZGA 2CLEA 3J7HA 1PIFA 4TQTA 3WBAA 2X7WA 2ZX5A 1R8LA 4J3XA 4W7WA 1W6TA 5ABHA 3LEPA 5KSWA 2CWNA 2R14A 2AAAA 4AWUA 1G4EA 3OGSA 1RALA 1CXFA 1ZBCA 1MW1A 2J7FA 4GCXA 1H60A 3T6CA 4PSRA 2E5DA 1LQ0A 4P5UA 4O12A 3GDTA 2AQVA 4XUGA 2DT0A 2XG9A 3O06A 2DT1A 5HA7A 3R12A 4JKKA 1CB2A 1PHQA 2EXOA 1I8JA 3O7UA 1UH4A 1W9UA 3CU2A 4HOWA 4GVFA 1EJWC 1WDWA 4R34A 4X0NA 2NWSA 1Q13A 4ZOAA 3BSMA 3FCPA 4KFOA 3S5OA 3B9NA 4W86A 1XD0A 1VBRA 3I6TA 2YFOA 3RYSA 3U9IA 3SSJA 2UY5A 1UZ1A 3M4HA 2E25A 4A4AA 3LBCA 4JCLA 2J27A 4NJHA 2WM1A 2JKAA 4GNJA 3R0UA 3LOTA 3VZZA 3CTLA 4GQGA 3VNLA 3M5ZA 1MNSA 1FVPA 1KWGA 1E6ZA 2PGFA 3LV6A 3QGKC 3CEUA 3SCRA 2C0AA 3CQHA 3W3OA 3DFYA 3WEOA 1TVLA 3T1GA 3WJWA 3DGBA 3O6AA 4DUWA 3TDFA 4LF2A 2WAGA 4HNCA 4C6IA 4EF8A 1UMLA 3G8RA 3VNJA 1E6RA 1MEHA 5DEZA 2F8QA 3OLEA 2E6YA 4L4OA 4NYUA 2X1RA 3WF4A 2INZA 3QR1A 1B4EA 1UQYA 2ZZ4A 4AB4A 1PKMA 4C7GA 4LAUA 5FJRA 4RPPA 4WKAA 1I2PA 5I77A 1Q7QA 5D2TA 4C60A 3UEQA 3PSWA 3C56A 4G7EB 3FEMA 1Q45A 2PCQA 3RGTA 3UWUA 4EACA 1W8SA 4DAIA 1B3WA 4FNSA 4C1NB 1VB9A 4YXGA 3NPVA 3IJ8A 2HRWA 5AC5A 1US2A 1Z6KA 3AWOA 3NQ8A 4IFKA 1OT2A 3RIKA 4DPQA 4S1FA 1K6WA 1WB0A 1LWJA 3I4KA 2Z1XA 1CX9A 1JPIA 1J11A 2RGMA 3S5SA 1QATA 4XD5A 3O63A 1DTUA 3EA1A 2QGYA 5GVJA 4WDXA 4WZHA 2AGTA 1T5AA 3GR8A 3M0VA 3LHYA 2V63A 2J9ZA 2VO5A 4DJFC 2VJXA 3DX5A 4A3RA 5C7VA 3CV6A 3W0KA 3LHTA 1PXGA 4U2YA 2DEPA 3JUGA 3LXAA 3M41A 4CGTA 2E8ZA 1CXEA 3OW1A 3T2OA 4ATWA 4OOUA 1DJGA 3WUBA 1VHNA 3AS0A 4TV5A 3I3BA 1JQVA 4GA8A 4EPBC 4K1GA 2IW0A 3MZ2A 4GBDA 4NAFB 3NOEA 5FEZA 4NZ4A 4DWSA 4TOQA 3A64A 4GI9A 3U3HA 1ZLPA 3E74A 3VX0A 4K38A 1OC6A 5I24A 1DIKA 3VIOA 3GW3A 4XZIA 2B7PA 3PC0A 1IXPA 2XIIA 3W1QA 1PTAA 2VEKA 2QLYA 2ZUWA 4GH3A 4JZ5A 3BO9A 4AC7C 3QEZA 1GKPA 4OECA 3RMJA 2BP1A 1YXDA 1Z44A 1W54A 2P3ZA 2X16A 1LP6A 4FNPA 3BG9A 3S8HA 1XS2A 3N12A 3H4GA 2CXGA 3UWEA 1C9DA 4QFUA 1CXLA 4MMWA 5G2HA 4M5PA 4Y8EA 4OQVA 3S2MA 2CZVA 2O7QA 2VL4A 1JDFA 4FO4A 2BGQA 4G7EA 3NOYA 1DIOA 3VIHA 4L6HA 3S1WA 1X96A 5IM51 5CBJA 4C6PA 3DGRA 4HHPA 3EWXA 3BOFA 4JIHA 1B54A 4JOMA 5HR6A 4O54A 4YTRA 2OWXA 4RDYA 1XFCA 4E4UA 1LWHA 1GPWA 2C1IA 4XV0A 3PZOA 4BF7A 5JXQA 4J3ZA 2OGJA 2HVMA 2Q3OA 2IQ0A 2FZ8A 4DBDA 1BWKA 4Z0JA 3NL3A 1ESWA 3UG3A 4HHMA 4Q6JA 1P0KA 1RA0A 3CIVA 1ZBVA 3NR0A 4H9ZA 1ZAHA 4Y8FA 4C65A 4AIEA 2CU0A 1W1B1 4Q4MA 1KGWA 2VFFA 4CCEA 3CLWA 1O7AA 5AHFA 4ZFCA 1KC7A 4HNTA 2X1IA 1BQCA 2REQA 4LWWA 1PAMA 4JTCA 1RQHA 4W89A 3KLKA 4NU7A 1H5VA 1JI1A 3SUVA 4OBTA 3VOIA 1O1HA 1BRLB 4ZMGA 1PVNA 1TPWA 1GVEA 1A5AA 3GFYA 5E9XA 4K3ZA 1Q7ZA 4WQ6A 4B2DD 3WX7A 2QUTA 1K7XA 1J10A 3NL6A 4MJ4A 3SIMA 4GE8A 1ONRA 2FTWA 2DZTA 4O19A 3A5VA 4G8TA 3DEQA 2WBKA 1S5NA 5DMLA 4AHQA 3IV8A 4Q8VA 3T0CA 2V30A 3EDFA 3W76A 2A7PA 3WLIA 3TJXA 1XC4A 2V3FA 1GOWA 1A0EA 3U4FA 3F7JA 3BL3A 3TLLA 1GOXA 2VDGA 3GUGA 1V6WA 3VD4A 5HNTA 1OHLA 3O9NA 4XZHA 2FGLA 4HSOA 1YTKA 3CV1A 2VFEA 3VZXA 2XTKA 2Z6IA 2WKGA 3UZZA 3NQCA 3R0DA 3SBFA 4PZVA 4LVDA 4B5TA 1XIIA 1XBXA 3W7MA 1F7BA 1GEHA 5T91A 3GZ3A 3B40A 3VFLA 4P8UA 1CGYA 3CUJA 4ZQNA 5A6BD 3GBDA 2OJPA 3Q4DA 3N13A 2QJMA 5AHMA 4KWUA 3SGZA 1H7NA 3CZGA 4WK9A 3VE7A 1QNRA 4XSLA 3GXIA 5F2MA 3RHGA 4AZCA 4LXFA 3IJIA 1EBHA 1QBAA 3MTWA 1BRLA 2NX3A 2CBIA 2FMOA 1KM6A 3TQVA 1R3RA 3E3HA 1WZMA 4FSAA 3G1RA 3N2TA 4JNYA 1JZ4A 4REQB 3PN8A 5E5CA 4U3CA 2DSUA 3C61A 4FNRA 4UNKA 2YYTA 1HF6A 2ZX9A 1DP0A 4DY1A 4XZWA 4W87A 1QK2A 4UOQA 4U5IA 4H8VA 2D24A 1NY1A 5H8PA 1EQCA 2FZMA 2A3EA 3WLNA 3LQLA 4ZQCA 5IDZA 3GXNA 2VX6A 4J3SA 3UPWA 4NVTA 1UZHA 1WOAA 4D6HA 3KS6A 1F6KA 5XIAA 2ZOXA 1KFKA 4HYWA 4RR4A 2J9XA 3ELFA 4AEEA 3V1PA 1A53A 1WXJA 1SUXA 3HPSA 1Q8AA 3YPIA 1F8MA 1UR2A 4GFIA 5J04A 1V51A 2VCCA 3NL2A 2J7DA 5JH2A 4QDPA 3W7RA 3S83A 4I90A 3I3EA 1FWDC 4W7VA 1WPCA 3VNKA 3LLXA 2PPGA 4QITA 3AU2A 4HMCA 4MB3A 3NPUA 4HZ6A 5CQ1A 2GK1B 1KBLA 2AAMA 3IJLA 2R1MA 4I7UA 1VFFA 1R3SA 2DH2A 3DHDA 3H54A 4BQ3A 5HPCA 4OBRA 5A3HA 3KOXA 3H2MA 4D6EA 2GJNA 1UJQA 1Z42A 3HG4A 2G3FA 3A9BA 1CBGA 3MVTA 1E51A 3ZIZA 3WLRA 3IEBA 2YW3A 2ISDA 3NA8A 4GUIA 2PWHA 3VD3A 1GTHA 3NGJA 2CLOA 4ZCWA 4X60A 1XLFA 3N2BA 2PE4A 3S5YA 1VD6A 2IQDA 3MCOA 3L5AA 4LAKA 5D04C 2J7GA 1W9XA 3GS6A 2IUZA 1XLBA 3DI1A 2YCJA 4J3WA 3UZYA 3DYPA 2PS2A 3PPCA 2MUCA 3MPGA 2DSVA 4HPGA 5I5RA 3BAYA 4J28A 2Y8UA 2YSWA 3BV7A 3NL5A 2V5LA 4Q33A 2F9RA 4IQDA 5AYYA 1TV5A 1OEPA 4NZ1A 4F0KA 1UPMB 2AQWA 4LEFA 4F79A 2F2KA 5BOOA 5HAOA 3UGVA 1I75A 1LROA 3C6CA 3EPNA 4MFEA 5D09A 3WMSA 1S39A 3DFHA 1HUVA 3M07A 2HE8A 3N04A 1U2YA 1XBYA 1GZ1A 3MSGA 2NW0A 3IUIA 3L65A 4O16A 1Q8JA 2NSOA 3BLEA 3BV4A 1E5JA 4JIIX 3BJTA 3MJYA 3V4BA 4PMYA 2PU1A 4NILA 4HSHA 3TJLA 1LOQA 3FA3A 3O15A 1TYGA 2F6KA 2PDCA 1U83A 1LDCA 3SUUA 4ZTYA 1SSGA 2VRJA 3WK3A 3GTXA 2VEGA 2WMJA 2HJPA 5CPTA 1AD4A 1E56A 2CHRA 5PTDA 4HU8A 1E4LA 4WSJA 3LK6A 1TTPA 3ATZA 2V2CA 1FWTA 3O0FA 1J93A 1GGOA 3RUBL 1L6FA 2DP3A 4US6A 3WYZA 2ZZ5A 2VGGA 3EPOA 3WBXA 3PBMA 4HPXA 4MFDA 4PMUA 1JZ3A 3BCJA 4MY8A 2GUYA 1SZEA 4DI9A 1US0A 3IARA 4IUOA 3LXCA 5FI8A 3HU7A 4IIBA 3G2GA 3W74A 1UKSA 2CC0A 3BAWA 4DX3A 4XBJA 2Q09A 4F8XA 1NF0A 1H51A 5AOUA 3MWAA 4S3BA 2HVOA 2Z1WA 5HQMA 4JEJA 2V81A 5F4WA 2YZRA 3W9ZA 1TJ1A 3VIFA 3THUA 2PWDA 2BX7A 1KWKA 2OOFA 4JY9A 1RJQA 1ZP3A 4QM1A 1LZOA 3HV8A 1T8XA 5MKGB 4O15A 4JQ3A 3EX6A 1KR0A 3R11A 4DELA 1OYAA 4X9YA 3NVDA 5LA2A 1EA9C 1F3XA 3BJFA 4BF9A 4ES4A 1MQPA 3OG3A 3BANA 4IQLA 2J24A 3RLVA 1FBAA 3IGSA 1OCBA 3KBVA 4C6BA 1PE1A 2CZFA 3VI2A 2BVDA 1WBHA 3LA4A 2FVMA 4B5SA 4QX4A 1XQLA 1SMAA 3L0KA 3VCCA 1E15A 1A80A 3PAOA 5LZLA 3OB8A 3S46A 4QISA 2FKPA 3TLQA 1OK4A 2IS7A 3VIKA 3M43A 5BMWA 1EXBA 1Q66A 4HCLA 2A6NA 1EJUC 3B8IA 1ZTVA 3WQ6A 3EOEA 1FH9A 3K46A 3LRKA 3H55A 1TMLA 4O18A 1LLZA 3BLOA 5K9XA 1KRAC 4M6UA 4YYFA 2QJHA 3MMUA 1XLGA 4UOJA 4DBUA 1E0WA 1C7SA 3GX9A 1W3IA 1QVBA 3CUGA 1OFBA 4GQBA 4UQDA 2X0YA 4CCDA 1E4NA 3G3MA 1NWUA 3ABZA 4PRTA 1E6NA 4WDTA 3MKKA 1TCMA 2A1YA 3GUWA 2QVHA 3D3FA 3HA1A 2NUWA 3TR2A 3UU0A 3LD5A 1MZRA 3WUFA 4K36A 3BLPX 3MUAA 2V3GA 1R85A 3RX4A 5MKGA 1XYBA 2QUUA 2ANUA 4G9PA 4ORMA 4F2TA 5GNYA 1IHIA 3WD1A 4GX9A 3QSRA 2CHOA 4RUBA 3ZVIA 4QJ4B 4GQRA 3B0XA 2PRLA 4GD0A 3WQDA 4OUIA 2OWWA 3U4AA 4NIRA 1PTGA 3AIRA 1NAL1 4IXXA 4N9CA 2X42A 1ZENA 3WF1A 4MM1A 4QP0A 4CD5A 3QFWA 4ERIA 3G77A 2NWRA 3W7LA 2Z1VA 3UESA 1PZ1A 3I6RA 4Q22A 2P53A 2FH8A 4P61A 1JG9A 2J47A 1GPFA 4W84A 4XIMA 3D0CA 2XHYA 2Y5JA 3AHVA 4E4PA 2BHYA 4FR6A 3SY5A 4ZO6A 1QI5A 1UR4A 1OFAA 1H41A 1JZ6A 2P3EA 4LCQA 2VXNA 1MQQA 1A4LA 3B8WA 3IPWA 5F2LA 1OX4B 5EYWA 1P0NA 4DBWA 2E28A 1HFBA 1OIFA 4JTLA 1NQ6A 1VF8A 1XCWA 1EO5A 1DWGM 4UZUA 1XH1A 3PZVA 4I5RA 1K7EA 3N1AA 4GVIA 2PTYA 3L4UA 3N2OA 4KF1A 1IT0A 1Q6QA 4GQ0A 2FZ9A 2ZRXA 1E55A 1BF2A 4LRTA 1F3WA 3EB3A 2E77A 1TG7A 5CZKA 1H61A 3F5KA 2ODOA 3U7BA 4PUMA 1GZGA 1UWTA 1P1XA 1PZ2A 4CU6A 4N9EA 2HNEA 4D6CA 4PTXA 1UBSA 1F5ZA 3EXRA 1V6TA 4RPQA 1ZAIA 1XISA 2EJ1A 3MZNA 1GQKA 1T96A 5JBDA 3USZA 3URNA 5FAGA 4KMQA 3ABRA 2C3ZA 4LVGA 8A3HA 5A8OA 5H6HA 5FSDC 3SQMA 1SM9A 1BHGA 2CETA 3T09A 4BEQA 2WYSA 1J79A 1FXQA 1QWGA 3M0HA 4JTFA 3N25A 1H0GA 4EWND 2VGFA 4QE1A 5A94A 5C9UA 3CV2A 3HM7A 1P6BA 1JAEA 1V5XA 1IT7A 5EU9A 4GO9A 1OCJA 5FD0A 2F2HA 2H9AA 3NURA 2VD8A 2PWFA 3WEZA 3T0DA 1KCZA 3B4YA 5EB8A 3QV6A 1FWGC 1KXTA 3NM1A 2V6AA 4HU4A 5H8MA 1OX4A 5I3KA 1M68A 2HK0A 3M0KA 4H04A 1TTQA 2B4GA 3ZXWA 3ORWA 1H1YA 3PBYA 1P5BA 4X2PA 1LUCB 1EH9A 1JCMP 4JIEA 1M41A 1Z41A 3U5YA 4O10A 1GQNA 1E70M 3B8UA 3NDYA 3HOJA 3CQJA 1M1BA 1WDRA 2QS8A 4UUIA 2WSPA 3N18A 1V7AA 4H8UA 1L6GA 3M16A 1OX5A 7ENLA 2Z00A 5IFPA 1V4YA 4ENLA 2VQUA 1IR2A 2YYUA 1BVWA 4EP8C 5H2ZA 4FZIA 2BB0A 1FDJA 3KHJA 5HWJA 6PTDA 4L1XA 3DG7A 3P93A 1AZ2A 4IIEA 1S2VA 1FKXA 1XV8A 4ROPA 2HNHA 3GDRA 1AA1B 4M7TA 1M7OA 4UBPC 1RCQA 3SY1A 3BLDA 3QW3A 3C0JA 2OLSA 2G0WA 4GYJA 1YPFA 5DMNA 3QY6A 2VWSA 4I5XA 2CBJA 4E0CA 4UQEA 3ARVA 4NJIA 4IIDA 4MY9A 3JR2A 1KV8A 1K8XA 3K4DA 4GJIA 3THAA 3CUFA 1NIUA 1ALDA 3WQOA 4KT2A 4XZ9A 1XW8A 1KRCC 1TFVA 1VEOA 1BSIA 4BS0A 3PTDA 4FLOA 2PGWA 4K7VA 6TAAA 4WSHA 1PB0A 3CHEA 4IF2A 3EOOA 3ENLA 1ONEA 4G6CA 2NV9A 2CZEA 2HS6A 1JCJA 3AXIA 1A5OC 1DVJA 3TCEA 4Q4SA 2INEA 1ZSXA 1YADA 3ZZ1A 1JNDA 3EWWA 3N2XA 1ME9A 4CQCA 2IXUA 1HKJA 4ZL1A 1S2AA 3TTSA 4JNZA 1FWEC 2VENA 1W9BM 3SO7A 2AGKA 5BWFA 3WDHA 3SN4A 4B5WA 4HCHA 2XWDA 3ZSSA 3S3GA 3Q45A 4KFPA 1QU4A 4N0RA 4LUYA 3RO8A 1HIZA 1RZMA 3P0WA 4EIVA 1KD0A 3V0UA 5KZEA 2W67A 2I16A 3T2PA 3GH5A 3TAKA 1FHUA 4Q8OA 2E6DA 3M0IA 1SJBA 3QFEA 1G0CA 2FMNA 2ZICA 3E1F1 3BQ5A 2A7NA 4CEXC 2CBVA 2AOSA 3W53A 5DLCA 1TPVA 4YHEA 1GW9A 3RPMA 2VR4A 2ZWYA 5REQA 2D2HA 4WKFA 4LYRA 1L9WA 4B2DA 4N4QA 1VFLA 3QC0A 3GH7A 4EAMA 1W1IE 1A5SA 1NF7A 2VFGA 1QNSA 2CWXA 3VMOA 1PX3A 2VR2A 4MLRA 3OA3A 4TX9A 3AAMA 2R94A 3W6YA 4JFTA 2VZTA 1TVPA 3OG2A 2UBPC 3LPPA 3AUOA 4NX0A 2ZUTA 3OBAA 1EGVA 2GFTA 1MRQA 3WD4A 2ATSA 2WZEA 3BAIA 1P1MA 4DLFA 4WLCA 3CYJA 3AS2A 4M6VA 2EGZA 3P60A 1QT1A 4B91A 1PBGA 5D2XA 5IRPA 3AFBA 1UOZA 5JIWA 1OCNA 4WJEA 1W5OA 2QHAA 3VNMA 3G22A 4W8LA 3VC6A 1E73M 2NUXA 4P7QA 1FP8A 4XD6A 5CAHA 4GUJA 1OYCA 3ZWSA 3NPWA 4B3KA 3EDKA 2RFGA 4AY8A 2BODX 2IPWA 1PDZA 3FJ6A 3UT0A 2ZUNA 3K30A 4CD8A 1H7RA 3GYEA 2CIPA 2IMRA 1C29A 5A6BA 4BWLA 4I9JA 2EPOA 4UTTA 2WNQA 3VGDA 1ITCA 3EWDA 5CZJA 1GG0A 5FIPA 3RU8X 4POCA 4L6DA 1TPC1 2P8CA 3V7PA 2DUZA 5G1MA 2INFA 1WA3A 3K1DA 1UJPA 1BFNA 2NUYA 3FVDA 3UJEA 2J7CA 1DPMA 1XSIA 1GG1A 4JTUA 1XIHA 2PZNA 2VX7A 3SIZA 2D0HA 4WDUA 1JGMA 2EEXA 3AU6A 1FOBA 4IPIA 1MW3A 4DPPA 3NQBA 5G1TA 3M5VA 4EXBA 1GYNA 5D8WA 3QOMA 1XLMA 5BRQA 3HPXA 3VKCA 4LUTB 4OTKA 5BW6A 4ZVJA 3U0HA 4QNWA 5TNVA 4XKMA 7PTDA 1TRDA 4CKQA 1WYIA 4M80A 1U33A 4MLJA 3WN6A 4UQCA 4PUDA 5E0FA 3EXSA 4JQAA 2V38A 3T7VA 3VVGA 2XH7A 4DAFA 3CL7A 4XBSA 3E0VA 3EDEA 5IXEA 5D37A 2AMXA 3IRSA 1OC7A 3LM7A 3WSUA 2QV4A 4JNMA 2I5IA 3QGAC 1K4HA 2KZHA 1Q7MA 1FCBA 2YBTA 1VKFA 5FCZA 1UP3A 1WBJA 1O4UA 5C8BB 1WQ5A 2DZBA 4XZLX 2DQWA 3S6DA 1P7TB 1HJQA 2OTDA 1R3VA 3WLKX 2YIHA 1RPXA 2IKJA 1SMDA 1WX0A 1T0OA 1S5VA 5J5DA 3OLIA 4GIYA 5EMJA 3QTPA 4HU0A 3R7MA 2XIOA 3ZR6A 1AZ1A 4PULA 3QQ0A 4DZ5A 4JFSA 3CWOX 3FK4A 2ZBTA 2DW7A 3G1DA 2O0TA 2FYMA 4DJED 5H91A 1IXQA 4C6MA 2IPFA 5I3JA 5DRIA 2FFCA 1Q6GA 3LHWA 2RUSA 2C18A 3TU9A 4N6EA 4NASA 2ESCA 2QJGA 3I4EA 2WVSA 1DWFM 1B9ZA 3KTSA 4HOXA 4JQ2A 1KM5A 1DJYA 3PG8A 4JS3A 4QSHA 3W88A 3DUGA 4NAEA 4BFAA 4QDWA 3AALA 2X30A 1HO4A 5CG0A 2EG6A 4NT0A 1FHLA 4AX7A 2A3HA 4LUTA 2F84A 4FEZA 2YL6A 3GG8A 3MCNA 1Z32X 4P7LA 1E9YB 5CJMA 1V79A 3LSCA 2NLYA 4OKDA 2IPJA 1XCXA 4DZAA 1KXVA 2FTPA 3QM3A 3PF3A 1HKWA 1TV2A 1DXEA 1V0LA 5BROA 1V3HA 1V08A 1WXZA 4L4MA 1IWAA 3DYOA 1DQWA 3OPSA 4GVHA 2Y5EA 3EPMA 1UWAA 4NSBA 3GDKA 4E2BA 3EMQA 1MXGA 4UCGA 3N4AA 2W79A 4LUSB 3GDMA 4W85A 4AD1A 4XTIA 9XIMA 2GSJA 4WCJA 2VC5A 1KTNA 5XINA 4TX6A 4FAMA 3VCNA 5F4SA 1CDGA 2IXVA 2TMDA 1QNOA 1PZ0A 1UASA 1G1YA 3DXIA 3AJ7A 3GTNA 2OO0A 5FAJA 4IGSA 3VAVA 2PDYA 3DBPA 2NQHA 4RZ4A 3ZR4A 3ZMRA 3CQIA 1Z3NA 2Y8VA 3V75A 1ZRQA 3WQPA 1XIGA 1DBTA 4B9ZA 1V6VA 1BWLA 1FWCC 1SW0A 1GVYA 3PFMA 3SDOA 5TD4A 2DZSA 4UQBA 4H8HA 3AIEA 1TZZA 4ZFMA 1YE4A 2DIJA 2YZ5A 4MNJA 3MYOA 1WZLA 3MSRA 4NNAA 4MVAA 2JGYA 4FS9A 1Q4NX 4AISA 4D6JA 5F1UA 4IMFA 3EYPA 4Z2LA 1DORA 1QASA 3ZS4A 4FX6M 3PBVA 4Y6GA 4HYRA 4YWSA 3RM8A 3UG5A 5I3FA 1W3TA 1I45A 2DPEA 3WUGA 4MKNA 1ZBWA 4OE7A 3HZ3A 2GVEA 1F76A 1MI3A 1J6PA 4CD4A 1M3UA 3GNXA 5KZ6A 1G7VA 1Q3NA 3PB0A 4PL2A 3TA6A 1V3JA 4LYPA 4D9PA 3PJXA 3WF0A 1CZ1A 4J4KA 4UCFA 4PMJA 4DO7A 2V5DA 1JYVA 4HPJA 4S38A 4R7JA 5AC7A 1AH4A 4S3DA 1R0MA 2YOCA 3C2FA 3VIIA 2BS9A 2E67A 1X1NA 1R46A 4Z2IA 4H6QA 3CV7A 4IGNA 3M47A 3REQB 3QTGA 1FWRA 1SJCA 3EXTA 3T78A 2QCEA 1ZHAA 2OB3A 4A22A 3DESA 3ES8A 1FWJC 4F48A 1LOLA 1JULA 4Z17A 1EL3A 2V68A 1QNPA 3A9IA 2RJGA 3ZJ6A 3IIPA 3VDBA 2J4GA 2P8BA 2CLKA 1J0HA 1MQRA 1JCXA 1ISWA 1M53A 1W32A 2FDSA 2YBUA 4QCFA 3VGEA 5FJTA 4DJEC 1RP9A 1OGSA 3OA5A 1PO9A 3GLCA 3N14A 5BYWA 4J3TA 3P5YA 1XIFA 4FXFA 1XRFA 3A13A 1S5WA 4O1FA 1W3LA 2XPKA 4H9MA 1ZJHA 5CGMA 5HANA 2RDWA 3P80A 3TROA 4C91A 4JX5A 5I78A 4O50A 4MZ1A 4IG2B 4QLLA 4JYEA 2YDRA 4NZCA 5M03A 2VX4A 5A95A 2GVJA 3UWVA 1YX1A 3ARYA 3LCIA 2HXUA 3P7YA 3NAVA 4LS1A 4UMCA 3N6HA 3LI1A 4FMVA 2WMIA 4MGGA 4O4VA 1GQJA 2DVUA 3WNPA 1HL9A 2Z7GA 1NM9A 3L68A 1JDCA 3WELA 1TR9A 2PWUA 1VFHA 3Q67A 1MDRA 1XWYA 3C2EA 4GFSA 4DXXA 4JTIA 1J4EA 3T2QA 4GGHA 5DBUA 5DCDA 5CEWA 1ADDA 3V35A 2QR6A 1C8XA 1WO2A 7TIMA 3QC3A 4UNIA 1IXNA 2ZXBA 1AW5A 2QJIA 2JIEA 4J7RA 2Z4GA 1RV8A 3W84A 5C9WA 3C52A 1DV7A 4MDOA 1ZL1A 4MDPA 5IBXC 4IQEA 1GYLA 1M03A 3HJZA 3PUDA 3IACA 2WO5A 3VXGA 4U10A 4NG3A 5EA9A 2PDWA 3CAWA 4AH7A 4P7RA 1GOMA 3BCFA 1P43A 1E43A 1S38A 1VBUA 4DRSA 4AYSA 3WK1A 3TE9A 4E2OA 1XCFA 4MZ8A 4V28A 4PCNA 4XWUA 3S9YA 3TYDA 5F2GA 3TWAA 4N42A 1EZWA 1PUDA 4KRUA 1FWNA 2AQOA 2O56A 1SZRA 4FOKA 3B9OA 5FF4A 5C9ZA 5FEPA 3UPBA 1O95A 2HROA 1UH2A 3W7DA 9XIAA 3NZPA 3WH9A 4PB4A 3WJXA 4W88A 4XG1A 3RM4A 4HSNA 4QS6A 4DF1A 2BXZA 1FWHC 3FYPA 3U2OA 2BV9A 3OODA 2EPKX 1IWPA 1SQ7A 1YIXA 2ZYFA 3L4YA 3RFAA 4RDWA 5B7YA 3W86A 1R3TA 1YBQA 3QLDA 2VX5A 3KM8A 1BAGA 5F2IA 4D1JA 3KRZA 4YPJA 3RJYA 4L7ZA 3VTRA 3GFZA 4LPCA 3BZJA 2JEPA 2QUNA 5M17A 3W22A 4IZGA 4GNVA 3AS3A 3QR3A 1P6CA 4H41A 3SCOA 4HZMA 1L8PA 3MO4A 3TFXA 4GXWA 4JD4A 2QULA 1D3GA 1ITXA 3WK0A 2ZWZA 3H21A 5I02A 3LHUA 4J1OA 3T0BA 3A6OA 1FTXA 3UD6A 2XZ7A 3UWYA 2HCVA 2XM2A 4AEFA 1JZ2A 3QF0A 1XDMA 4LQ1A 5ABGA 4Q32A 2BXYA 3HGOA 4O52A 1WNOA 1VYSX 3W26A 1DE5A 4W8BA 2ZDRA 4TVCA 1OCQA 4IT1A 2PWVA 2WKJA 4YN5A 3N34A 3L7RA 3SCWA 4KERA 3AHYA 3F4NA 4QE4A 5LXEA 2XN1A 2HMCA 2PC4A 1CLVA 1QFEA 3KBJA 4S3CA 2ZUVA 3GC2A 3BLLA 3ZT7A 4KPLA 1Q6RA 5DBTA 1XLCA 1MXSA 3EKGA 4BJHA 1UPPA 4R53A 1EOMA 1KFLA 1CWYA 3AZTA 1JCLA 5J5RA 4C6FA 4HNOA 4JN7A 1CENA 2BOEX 2PC8A 3UCQA 4AD0A 4NNBA 4INFA 4HNNA 3QHOA 4Q3MA 3P82A 1XUUA 1Q6EA 1OZQA 2VMFA 5HBFA 3L21A 3RILA 3RF9A 4E8DA 3TOPA 3L4WA 3A23A 2G4JA 4L64A 1M01A 1QHOA 3KE0A 5D02A 3G6LA 2WSKA 5E6ZA 3NDZA 3UVAA 5EBAA 3S1VA 1R2TA 1VCFA 3NEHA 4X2RA 3WQ5A 2WWCA 2FLIA 3ZVHB 1ME8A 1K1DA 2OYMA 3UJFA 4NZ5A 3WMBA 4QIUA 2WJFA 1MDLA 2BSLA 1PCWA 4NRSA 2C14A 3ECQA 3UPMA 2PF0A 1P0BA 1XD1A 3R1ZA 4N9BA 3ITVA 1E5NA 3N3TA 1O5QA 3CPRA 3NGFA 3WJSA 3VNYA 1HT6A 2J8TA 4YJ5A 3ARXA 5FF3A 3BOLA 1DJNA 3M44A 3RMEA 3TUUA 3DKJA 3OBKA 2QGHA 4U5KA 1POKA 5HATA 4JPGA 1MUCA 1N82A 4GLEA 2EPMX 1JCYA 4HQVA 2G3JA 1X8FA 3CHCA 4PTWA 3LU2A 1YPIA 1GOKA 1XI3A 5CZTA 1W31A 2QCNA 3AMLA 2X1SA 3D5HA 2L5HA 2F6UA 1GZJA 4GUGA 4S3JA 3LDVA 3RJXA 3H70A 3PTQA 7REQA 4WJXA 3UWZA 1W8GA 5GJMA 4K2SA 1EXPA 4H7CA 2DVTA 3WMLA 3UQNA 1P6WA 2HISA 3RRXA 3VIPA 2ZXAA 3LCHA 4Q4QA 2UY3A 2A3BA 5D33A 1V7YA 3LERA 3PSVA 4NHVA 4JTHA 1Q5MA 1HW6A 3SCNA 2CPUA 4Q8NA 4D72A 2VGBA 4AXKA 1XM3A 1DQXA 3SSZA 4JN8A 3KP0A 5DY3A 1XYFA 1LRNA 3TJ4A 1CIUA 2J8FA 1A5BA 2A7RA 3WEMA 5TAOA 3KVMA 2YA0A 1HG3A 1POJA 3CQ0A 4IL2A 4Q8MA 4GI6A 1DHKA 5DO8A 2BGSA 3UP8A 2WMKA 4UFMA 3G6MA 2OZTA 4R33A 4C6KA 4LBUA 3UXDA 1U1UA 2Z6JA 3LGDA 4AZBA 3T81A 2VR5A 4CEUC 4A3QA 2D2JA 5EL1A 1AW1A 3BSGA 2PDMA 3MUZ1 1F73A 3WLTA 3HFTA 3NDOA 1EB3A 1M7JA 3P6LA 4ROQA 2XVPA 4UXDA 4XB3A 1JL8A 1JPMA 3WQ4A 3W24A 1CCWB 4KH2A 2WANA 3WZ0E 3AJXA 1TQJA 4C6NA 2OZ3A 5CJNA 4CQAA 1QPOA 4O4WA 4ICCX 1Q6DA 2EJAA 4NP7A 3TTYA 4O17A 4O8AA 3VMPA 3SJ3A 3WDPP 1ISXA 1D7FA 3MS8A 2X2YA 5CG7A 1NOFA 3DENA 3DIPA 1TREA 4GJJA 4V2XA 4IMEA 4I6KA 2VFDA 3AICA 2QYGA 5C2CA 2PLKA 2QV5A 1HJXA 4LY4A 4LYKA 3CPUA 2OU4A 4TO8A 3CT7A 1W3HA 1RH9A 3F4DA 5FEXA 3KVJA 3W1RA 4AVFA 1SFLA 3E2QA 2J8GA 1J12A 4ZQOA 1QW9A 4S3KA 3WFZA 4HKPA 1R5YA 5U7SA 3ERPA 3URQA 1HJVA 4GIEA 2JKPA 2PODA 2O55A 3LSBA 3LUTA 3AXKA 3WY1A 4EPEC 4ZOBA 1G4TA 3WLSA 4XIAA 1OFDA 1V6UA 2JF7A 3C2VA 3EX4A 4DIAA 5IHRA 4CUCA 3WH7A 2ISSA 4NUWA 4CU7A 3NNTA 3C8NA 2PI6A 4KETA 3KL0A 5K3VA 2Y1HA 4GY7A 1IIGA 5SWUA 1U1HA 9RUBA 3MUXA 3KAOA 4DUXA 4MPKA 3P81A 3VX1A 3ARSA 3W00A 1J96A 4BA0A 4ADSA 4JFVA 3WQGA 3W1MA 2PDPA 2MNRA 2VELA 4OGZA 1E1FA 1KFEA 4I5UA 3KCOA 7A3HA 3HB9A 1E6XM 2Q8ZA 3S5ZA 3B8VA 2V5CA 4BR1A 3G1SA 3GR4A 3WLQA 1TE6A 4JX6A 3UXIA 5HR7A 3VGFA 2NVCA 3AWNA 4A8NA 4C6OA 6REQA 1W1TA 3FGCB 1SZGA 3I7QA 4ZGYA 2D3NA 4O28A 1U5HA 4ZO9A 3UR2A 4BCEA 3MUCA 4ACZB 1K9FA 3CUZA 1PHWA 3AZRA 3WNMA 2R82A 1ZJBA 2HK1A 4PL1A 3WL1A 2BTMA 4PRRA 3SRFA 1XGDA 1ECQA 4N7QA 3R25A 1V0KA 3VCRA 3OVRA 3AIWA 1EHAA 1QNQA 2ASHA 3DDMA 4YVPA 5D38A 1JF5A 1YE6A 2VKZG 5D4YA 5I23A 1XDJA 5A2AA 4A29A 1UWUA 2XWEA 1XSKA 4ZO7A 4DHGA 4TV6A 5C2GA 3TXZA 1G94A 3ONCA 3II1A 2GSHA 1RA5A 1L8NA 2NQ9A 1DJXA 4GZJA 4NJGA 3BARA 2TODA 1UR8A 1MVYA 5AVHA 3THQA 4JTEA 1FHDA 2QCHA 3IRDA 3CHDA 4JR5A 3RG6A 4B5XA 4CNSA 3BAJA 4LGXA 1KCKA 3PVFA 1DOSA 3SRKA 2YCLB 2FPVA 5CLWA 3ABSA 3DFPA 4JGDA 3A22A 4QBXA 2J6VA 4W93A 3KXQA 3S2LA 2J78A 3OGVA 3TC7A 2ZRVA 3WLLA 3R10A 3QZ6A 1LT8A 4UTUA 1AQ0A 3EKZA 3H2OA 3R79A 4MUPA 1X39A 4GGBA 1FCVA 2DZAA 3KBSA 5I2UA 3POHA 8TIMA 3K1GA 2TSYA 1VENA 2E09A 1JUKA 3V3WA 3XISA 3B4UA 1OFRA 3GK0A 3AHTA 3VOGA 3CT2A 1EYWA 2W63A 2QQ6A 1IEWA 4A2SA 4RE2A 2Z25A 4H6KA 3B3DA 1GUVA 3LRMA 2FJUB 4FOUA 4LT9A 2E6AA 1VFTA 3IV3A 4PMOA 4K37A 3ITLA 3ARTA 4XO6A 1EC8A 4GY0A 2RHGA 4WY0B 3OBEA 3LV5A 2DFAA 3WIJA 4F40A 1W3KA 2C16A 3H2FA 3W7OA 1IEQA 2X1UA 4AF0B 5J8LA 3CL6A 3GU1A 1F6PA 2OR2A 4WY0F 4PEEA 1L2QA 2QEZA 3VKJA 3NQFA 3IS4A 3FHAA 3GIQA 3LRLA 3L2MA 2ZVRA 3ES7A 1JZ7A 3HV9A 1NDWA 1J0YA 4DZHA 4IXHA 5CSYA 1BPLB 2PRMA 2IKHA 3L0NA 2ZA1A 3S9IA 1SJAA 5BXPA 1TJ0A 1GVFA 1N55A 1XFBA 3W1PA 4HJWA 3KOWA 5AECA 4L1GA 2KX9A 2YW4A 4H6EA 1MEIA 3H2CA 3SCVA 1XGZA 3M0ZA 2PTXA 2FZDA 5DELA 4AZIA 3PZIA 1QPNA 3ITTA 3CQKA 1M04A 1RY8A 1UZ4A 1RLCL 3W75A 3LHVA 4OIFA 3H7UA 1PL9A 3PZTA 1TZ7A 3SN0A 1OINA 3TWBA 4AD4A 2O9OA 2QDGA 4M29A 2IPGA 2PLJA 3N6JA 4H2HA 4LOCA 3EA3A 4O8RA 4US5D 1QW7A 3E9AA 3D47A 1NDVA 5LIKX 4LF1A 1R9XA 3LCFA 4HMDA 1EJTC 2DORA 2G4FA 1F4HA 3S5NA 4NI8A 3CJPA 3EWUA 1PKYA 2DT3A 3ZR5A 1X6UA 3K2GA 3LPOA 4R9XA 3SECA 5CC5A 4Q8UA 1ODZA 3ZJ7A 1E72M 1G6CA 1QK0A 4WGXA 4JCMA 1FWFC 4UQAA 1R38A 3LHZA 3CZJA 3O6YX 3EAUA 5A6KA 3MV01 3N19B 2FGZA 4FNUA 3K4WA 5FJPA 3NWRA 2QPSA 2Y5SA 4QE5A 4D71A 1SO3A 3BVJA 4WUIA 1W0MA 2WVTA 3EX1A 5M1TA 3W02A 1TIWA 1I60A 2H90A 3S6TA 3QQWA 1BVNP 1I0DA 1TV3A 1VH7A 1CTNA 5C6MA 2O9RA 3C2OA 1CPUA 1REQA 1I4NA 3DI0A 1QRQA 4A8LA 1YEYA 4ZEPA 3GD6A 1QPQA 1ADSA 3TR9A 4K8GA 3F1QA 5DT5A 3C4UA 1TCDA 3W70A 1ME7A 2YPIA 5ABFA 1CXHA 5I3HA 2A4AA 3BTNA 3FSTA 1PKLA 1ITQA 3STPA 1U30A 3H12A 4GOAA 4D8LA 1TV4A 3TV8A 2GUBA 2YLAA 2VEMA 4R27A 4MKSA 1E0TA 3DFNA 3G1YA 1WCGA 3SQSA 3U7VA 2OSXA 1RBLA 1TTIA 3ZM8A 4FXJA 3OYZA 4KGJA 3M0JA 2FVLA 4KEVA 1R9ZA 4P8WA 2VTFA 3B0UX 1TWSA 3VNIA 2I57A 1H3GA 2Z27A 1L6SA 1BG9A 1FA2A 4ZXOA 4CD6A 5AN7A 4C6QA 1NP0A 1EDTA 1WDQA 2VVSA 3OLGA 1TJRA 4MF4A 4U4MA 3QPEA 3QXBA 1KO0A 2NQLA 2DW6A 1JZ8A 5CJ5A 3PZUA 4K1WA 1YRRA 3KBWA 5I03A 1IT8A 2IQTA 5LIYX 4I7WA 5GPRA 2QCLA 3P67A 3BMXA 1OSEA 3UXKA 1AQFA 3I3DA 4F66A 3GKAA 2QW5A 4DBSA 2VDHA 3D6NA 1JCNA 3H7RA 3TN5A 3LLDA 3A4JA 2BGNE 4B15A 4NF7A 1A3WA 1XR2A 4PSPA 3BW4A 2GJXB 3E0IA 3BGGA 4IX2A 5HJXA 1EEXA 5TQLA 3LCGA 1GVQA 1XLLA 3UG8A 4AWSA 4UTJA 3APGA 5F1VA 1XG4A 2GL5A 4QHRA 2WVVA 4AWEA 2QT3A 1IR1A 1XX1A 3ONBA 2VRQA 3ICJA 4LS2A 3L23A 2DGAA 2CLIA 1EP1A 4HD5A 4XK2A 4QQ3A 2H3DA 4KCVA 2I1OA 1H63A 2F38A 5CGTA 5BMXA 2YL8A 3HG3A 4AUBA 1AH3A 1UOKA 3NQ6A 1SZFA 4MY1A 3B03A 2OWCA 3MCMA 4WSKA 3EBVA 3CZ8A 1RVKA 1VBJA 3AYTA 2ZTJA 3BMWA 1WDDA 2BHZA 4Z1YA 4A3YA 3UERA 3KBNA 3E5BA 5HPOA 2YCIX 1TUXA 4QRNA 2YB4A 4LANA 1ECEA 2A3AA 1VFUA 2QAPA 2W91A 1J5TA 2EKGA 1LBLA 3EMZA 4ZZ9A 3M7WA 3TSMA 4HT3A 3S4TA 1TPEA 2QVNA 1H7WA 2PSNA 4MZYA 2NXIA 3EDJA 3TYCA 1Q6CA 3DN5A 4NI3A 3W2LA 2CKSA 3QOKA 5I06A 3UWQA 4ZQMA 3S9ZA 2QCMA 3C0LA 1UHVA 3LCLA 5AKQA 4Y9NA 1RQBA 4OVXA 4PMQA 1OFPA 4GUHA 3UWWA 5M2FX 3W72A 2P88A 3H22A 3U2ZA 3IJ9A 4NRRA 1OC5A 3W7HA 2VGIA 3GH4A 2AKMA 4C5YA 5EGRA 1RD6A 3IWPA 3RPTA 1DIDA 2G3MA 1ZBKA 3KWXA 4LAZA 5A8QA 1KR1A 4Y9AA 4B16A 3JZEA 4ZTXA 5M5DA 1MFVA 2D0FA 3PZMA 2NV2A 3O16A 1KGUA 2G96A 5T9CE 4WDWA 1TJ2A 3KOZA 3WQ8A 1PJ9A 5BRBA 3ATYA 3RLGA 1NWTA 2QNEA 3IUDA 1UW9A 4IFRA 4M81A 1WOBA 3NXFA 1XRSA 4UZSA 3HGSA 1ZGDA 4JDBA 5E0KA 3UNDA 5CC7A 3N6QA 4MNMA 1IZJA 4XTDA 4XUYA 4QTGA 3W71A 1KCLA 5BWAA 4F0SA 3VFCA 3N4FA 2FIQA 4W9TA 1GCYA 2WLYA 4C1NA 1Z7AA 1RD5A 5GNXA 4YHGA 3JRKA 3VDHA 2G8ZA 1ZS2A 3UVIA 1CXIA 3FN9A 2E3ZA 1SPQA 4M6QA 2VFHA 4V1YA 2E6FA 5C54A 2WJEA 1YTDA 1JD9A 4K39A 3WLJA 2ZX6A 1S1PA 2XISA 3B8TA 2XFRA 4PCFA 5EPDA 3OGRA 4JTQA 3DFSA 4H7ZA 4OBSA 2JEQA 4RW3A 3CZEA 3WCZA 4LCSA 1QHPA 3MKCA 3VDGA 4ERGA 1TTJA 3GG1A 4FX7A 2AL1A 4H3DA 1IEVA 1K03A 4FB7A 3ZJ8A 3AQUA 3QSTA 1R47A 3F2BA 2YDSA 4BI7A 4E38A 4XKYB 2RDXA 1KB3A 3UG4A 1C3FA 1GQIA 3OEXA 3GNDA 4NAFA 1VBGA 3I7RA 1AQHA 1DTNA 3GHTA 3PTKA 3Q2DA 4JTDA 5CZSA 5KMYA 2WPBA 1JPHA 4RNIA 1K9TA 3PWAA 2Q01A 4YNGA 3A4XA 4RNFA 1K7FA 1UD4A 3RITA 1I1WA 4PUWA 4IM4A 5DF0A 1XICA 1VZWA 4XVDA 1Q6FA 3IAQA 2DSWA 3JS3A 2G3IA 1VYRA 2PDBA 3GW0A 4UIOA 2J6XA 1B1YA 3IK2A 1HP4A 4JYDA 4QAWA 1S5MA 3FEQA 2V0TA 3BG3A 4PMZA 3UY7A 1B90A 2WC7A 4BHYA 3MSYA 2EHHA 1F3TA 3Q65A 1RK5A 4RNHA 5I00A 1Z89A 4UC5A 4XQ6A 4MNKA 2QCDB 3AMGA 1LRQA 1PX8A 2Q71A 4LB4A 3T4WA 4KKXA 4JICA 4QEEA 4E3VA 3KZPA 5DX7A 5FOOA 4LUJA 4C1KA 5I0DA 3MMTA 2HDJA 3BW2A 4S2CA 1ZALA 4YLWA 1HNYA 3IIXA 4F2BA 4HU3A 2B0MA 1UA3A 1JPKA 4LEQA 5EFFA 3L4XA 5FEWA 4KCTA 4YTTA 4W7UA 5KZDA 3TYZA 4OV9A 1HL2A 2HEJA 1E9IA 4L61A 4QQUA 4S3GA 1XSJA 2HS8A 3H53A 4GYFA 1SJDA 1JDEA 3C2YA 3UJ2A 1DJHA 3LZ3A 5D2WA 3BGAA 5A6TC 5DANA 1FDZA 2DU2A 1TVNA 2FDMA 4L5ZA 4MAZA 2QF7A 4HNLA 3TW6A 1TB3A 3T07A 4AU0A 3D3AA 4TXEA 1Y65A 2YFNA 2WVUA 1SO4A 1XRVA 4JDYA 4UTFA 2UY4A 1UIOA 2VZSA 3KCJA 1UROA 2XU2A 4FNTA 3RR4A 2XVGA 4GKTA 1K6AA 3SUWA 1F05A 1GK8A 2ON3A 2PRHA 1AJ2A 4F0HA 4DWDA 1VLWA 1WP6A 4ICNA 2V5JA 2W0UA 1SR9A 4QJ3B 3SGUA 3WMCA 2W27A 4DYEA 1H5YA 1YNYA 3PTMA 1H7PA 3VGGA 3H2AA 2PZ0A 2XM1A 4BI5A 4RCXA 4H2CA 2YX0A 4YU1A 4NQ1A 4D8AA 2EPNA 3W28A 4GC3A 2WV8A 4RE0A 2G37A 4MWAE 3T0TA 4JXCA 2FZNA 1NSJA 2Y88A 2OEMA 1QI4A 4FA3A 3QV7A 1CGUA 4L4PA 1HKVA 3U8GA 1E1EA 3MO7A 3ABXA 3KZSA 3UGRA 4OU1A 3T05A 1HKMA 5L6UA 2H3BA 2VD9A 1PWMA 5A8PA 1QW8A 2TRSA 3LG3A 4JKLA 3VD7A 3SEPA 1RP8A 3CHVA 1IZCA 1WXYA 2YB1A 1E1CB 3WG6A 3A4AA 2NSXA 4ONVA 4UR8A 1YXYA 2PF8A 2R1PA 4KW2A 3DECA 4GCAA 3V5OA 2XGIA 1F2JA 2GYIA 2WOQA 2W92A 1B4KA 4Z1CA 4DVOA 1W3NA 4PC8A 1R2RA 3BLFA 3VOCA 2VCBA 4REQA 3T4CA 1FWAC 1JRCA 1A5CA 3NZQA 1DQUA 4G1KA 1R9YA 2ZADA 4O0ZA 1GORA 3PFRA 1H50A 1LCOA 4PE8A 3GSMA 4GI4A 5I79A 3UNTA 3Q37A 2RH9A 2WWDA 2NT0A 2GQ9A 5DFAA 2PDXA 1K8CA 2DSZA 1EBGA 4WRHA 3O05A 1L6YA 2Y7DA 3WH5A 1JDAA 6XIMA 4U2ZA 3PBUA 5CCZA 5AC8A 4GABA 1AJZA 3EX3A 2XJ7A 2GPTA 2WW5A 5HXMA 3JVAA 2C1GA 2Y4SA 4M24A 4CCCA 2QKFA 3KRBA 4EXAA 2GGGA 3RAOA 3OHIA 4FALA 3EZ4A 3PBGA 2XVKA 3KOFA 1EJ7L 4MKVA 2GQ3A 2GK1A 1X6NA 1RLDA 2O9TA 3CZKA 3GAYA 4LU0A 2OG9A 3W7CA 3H2NA 1KXHA 1TWDA 4ZO8A 2AL2B 1EKOA 1GJWA 2WZMA 3LCWA 5I7GA 1BXBA 4MWAB 5LYRA 1VCGA 1T40A 4L80A 3AXHA 1T7LA 4EE9A 2Z26A 1E1CA 5EBUA 1AUSL 3NZGA 1GNXA 2ZKMX 4DQWA 1EFZA 4MOZA 4BWLC 2R1KA 3I65A 4UTTC 4R7WA 4RJEA 3HO8A 2Q8XA 1TA3B 2V5BA 1GYMA 2W3ZA 2WKLA 3V0SA 3AZSA 4WOQA 3TW7A 2VEFA 3QW4B 3ID7A 1Y7VA 4I8DA 2D2GA 1ZY9A 3NO5A 4JX4A 4LS0A 3EB2A 4XAFA 5G2IA 2Z2BA 4J9JA 3VE9A 3QKEA 3GXPA 2WK2A 1C8YA 2J25A 4HMEA 3B9AA 1PIGA 1UR3M 2GWGA 1CGWA 3WLMA 3BURA 1VEPA 2GGEA 3IVSA 2BVTA 5K7JA 4GJ1A 1HJUA 5TBOA 2X0SA 3CTTA 4B4HA 3I10A 2FPTA 3GXDA 3MI6A 3W1NA 4V1XA 1KQYA 1HGWA 4UTWA 3ZFHA 4IH3A 2XDFA 1F6YA 2WBGA 1VPYA 2A3CA 4PUEA 4US5A 1R6WA 3FXGA 3V1HA 3MC5A 2P50A 1RAKA 3W27A 1L2UA 2RGLA 3NYZA 4AYGA 2ATMA 2W6RA 2ZZ6A 3W7PA 4HMNA 4PA8A 1M9HA 4AZ7A 2C6QA 1VRDA 2ABAA 1HJSA 4RK8A 5ECVA 2A79A 2VEIA 3OIXA 2CZDA 1MRAA 3QHNA 2NVAA 1V77A 4MWAA 2OX1A 3U2EA 4GZ7A 2WLZA 4LFYA 5CC6A 3AYSA 4H9VA 3BE7A 1OG6A 3LGEA 5JVLA 1TPUA 1VP5A 3ABOA 4PBFA 3WQCA 4YVXA 3A3HA 1Q63A 1M7XA 2NT1A 1LQAA 5RUBA 1KM2A 4ATLA 4FLRA 2DZPA 3UR5A 4LC8A 3W37A 1RXOB 4JTGA 3HQOA 1EIBA 1JVNA 3HGRA 3FW6A 3HPZA 1RUSA 5H1WA 4DYKA 3EEGA 3ANUA 3TJIA 4L65A 1A5KC 1L0PA 3LM3A 3ZLGA 4FPSA 5CSUA 2XN0A 3P5ZA 4W5ZA 4TU1A 3SADA 1EF3A 2JALA 3LY0A 4YS1A 1ZFJA 3HQPA 4AMAA 4UOZA 3ARPA 4IQJA 1HL8A 4AD5A 4QJ1A 3A12A 1W5PA 3L66A 1CGVA 3KDOA 5K4ZA 2BXVA 3AIUA 1F07A 1J8VA 4CD7A 1GT8A 3ALFA 3WQEA 1DEDA 1SO6A 2R6OA 3PZNA 1E6SM 1PYFA 3LMYA 1XYLA 3APTA 2NQ5A 3T40A 4J2PA 4MHBA 3SFWA 3WJYA 3EKLA 3NQ2A 1BKSA 4IP7A 3G24A 3R94A 1GQLA 5KITA 4KEMA 1YYAA 3C3NA 5B80A 2Z2AA 4NXKA 3MDWA 3VA8A 1QXLA 1ZJAA 4QG9A 2OT0A 1UUQA 3G1HA 3DU0A 4GC4A 1Y5WA 1C9WA 1PS9A 4WXZA 5A6SA 2E9BA 5E09A 2WQDA 3CIXA 5IOBA 3OZYA 3VD9A 2CZ5A 5A6JA 3R43A 1XXXA 3GXFA 1LM1A 3RO6A 4JEQA 2POZA 2Y7FA 4QG6A 3GVQA 4K68A 3LTYA 5FL0A 1I0BA 5JQ9A 1RPKA 5CSRA 5AYZA 3E0LA 1F61A 3PG9A 4NL1A 4URIA 1GONA 3UCDA 4UTMA 2Z29A 1UCWA 1LLWA 3R89A 3DHFA 1KKRA 3INPA 2BDQA 1JNEA 2HTMA 4EPKA 3DFTA 5FSEC 5D9PA 1J0KA 5C70A 2J75A 3USBA 4JKMA 2TYSA 2Y2WA 3EOUA 2FTYA 2XIJA 1XH0A 2P5NA 3SUTA 2ZE3A 1X97A 4KGLA 4CVWA 4CLMA 4DJFD 3CYVA 4CNTA 5C9XA 4ATDA 2W62A 1OF6A 1RCOB 4JTKA 1G01A 1V3MA 4FXSA 2HVNA 3E0FA 4DUOA 3UYIA 4HIBA 1EIXA 2EG8A 3TYAA 4DEFA 3TONA 2NVDA 2OKOA 4D6FA 3MQTA 1DL3A 1W9VA 2VOTA 3GDBA 4AXNA 4R88A 1S5TA 3MUY1 3GR7A 4AHPA 3NQDA 2C0HA 3CAVA 3ZO9A 2OO6A 1PKNA 2P76A 3DFOA 4V27A 1X6LA 3R8HA 3QRHA 3N3MA 1TX0A 2WZTA 1R2SA 4GQQA 1TV7A 1YDOA 1NTHA 1VJIA 2VUYA 1YMYA 2BG5A 3N4EA 1AK5A 4LNYA 4RE3A 5H8UA 2YCKX 5K9DA 1M7PA 3PAJA 2CHNA 4IISA 2OXNA 1ELSA 3NFUA 2F6XA 3W81A 2QZRA 1G7UA 5FKYA 3L5MA 2Z7KA 3FAXA 1SO5A 2WQPA 1YTEA 2XGBA 3ITCA 4XX6A 3FLUA 3DAQA 4QROA 1Y8BA 1TE1A 1MEWA 4HGXA 4XZNX 3B06A 3QGVA 1GOQA 1Y0EA 4A3HA 3QYQA 2ZQ0A 1JDDA 4IFKB 1XYAA 3KHDA 4HBKA 2FB3A 3GXMA 2WNNA 8RUCA 1FH7A 4S39A 3UY8A 2WMHA 3EOLA 4MJZA 3IGXA 4NZFA 4YTUA 2O4MA 4IWWA 1GOOA 3MU7A 1R3YA 1IEIA 5F4XA 2UZ9A 1AL7A 3D46A 3JZUA 4CQDA 1O5RA 2WHJA 1OVDA 2RAGA 3VZYA 3TIMA 4DUVA 4YMZA 2VRKA 2A6LA 3OIHA 5A8GA 3KTCA 2Q02A 2C8NA 4B3LA 2NX1A 4BY3A 4JIQA 1NDYA 4IMDA 3W25A 4B5VA 2POTA 3ARZA 3GTIA 3O1NA 1UP0A 3FYYA 2WHLA 4Z2GA 3UZJA 4E8GA 1XIBA 3HMJG 4IGHA 4L1WA 2R9RA 3WFAA 5C71A 1GVOA 3A3WA 4DWSB 1LBMA 3PZ9A 2C7FA 1FWSA 5C7HA 1EX5A 4JL2A 1AH0A 1UMYA 1XYCA 4BZYA 2J7EA 1A50A 5AZ1A 2WZHA 1O94A 4ZE5A 3SCQA 4H4IA 1HN1A 5G5IA 4WOZA 1KLYA 4B9YA 4L9ZA 2OLHA 1LORA 3PPFA 3PHAA 3CZLA 3WF2A 1S2UA 3GC4A 1LUCA 2WJZA 3S42A 4XAPA 4GYPA 4D6DA 3W87A 3STCA 4JHMA 2YXOA 4X22A 4X63A 3G1AA 3KL5A 5C0QA 3V5CA 1NFGA 1ICPA 3L0GA 4FOJA 1UWRA 1J01A 2Z1KA 4GUFA 5K9CA 1I2QA 1SFJA 2C79A 2YL9A 4H01A 3VOFA 1UWQA 1WKDA 3BUVA 4AZGA 5KTLA 3SGGA 3G1XA 3ZQ9A 3TC3A 3W2KA 4FNQA 3GYCA 5D30A 4FLQA 1B3VA 4WX2A 5D9MA 3TSDA 3MP3A 5ABEA 2XH4A 2CFFA 3N2CA 2GJLA 1B0IA 2B31A 3U6WA 2PDIA 1BYDA 3F2DA 3NM3A 3RCYA 4W4QA 1UUOA 1U1JA 5BXSA 4M1RA 2VEPA 1H7XA 2CCRA 2PBGA 2NV1A 4HZ7A 1ZB5A 1JAKA 4D2JA 1ZU8A 6A3HA 1VEMA 3GKFA 1HX0A 1KXQA 4LAOA 4HCDA 4M3PA 1EOKA 2ISWA 4S3FA 3G5EA 3OO2A 3ITGA 1KTCA 1NFPA 2REQB 4K8HA 1V0NA 2PUZA 3RDKA 3WDJA 2IKIA 2WMFA 3GC5A 3R8GA 4IPJA 1MFUA 4FIRA 4XBKA 3UR8A 2PDFA 1CLXA 2GGJA 3UR7A 1BTMA 3LNMA 2ZZ7A 3M64A 3IIZA 2Z0IA 5LNRA 5HMFA 1A5UA 2RJHA 1XJBA 4KCWA 4HPNA 2HV5A 1EDGA 4QG8A 4LB3A 4KWWA 3RM9A 1LTDA 4A3UA 3QYSA 4CNOA 3V18A 1DJWA 3AUJA 2E5BA 2QIWA 4A8RA 2RDTA 1ZJIA 1EC9A 1PV8A 4KQNA 4CN1A 1FHVA 4E6MA 4I9MA 2XVLA 1V8EA 2OEKA 4QLJA 1J2WA 2ZZ3A 1A5MC 4AD3A 1XLAA 4NZJA 4V33A 4PMRA 3WKZA 1MSSA 1ZCOA 4IPLA 2NXHA 4UFKA 3FJ4A 1XBVA 5IHSA 3WD0A 1VC4A 2PBOA 4QLKA 3LI0A 4RKAA 5AVNA 5HWMA 4P7NA 4DJDD 2QPXA 3XINA 4CQ9A 1XG3A 1GVSA 3H8AA 4Y90A 3I7SA 3TN4A 2C1HA 3GBEA 4ML9A 1VHCA 1DWAM 3PANA 4I3GA 1NJJA 2ZXDA 3CUIA 5CPLA 3SCSA 2VM8A 3M5YA 2A5HA 3WLOA 2CLPA 1Y5VA 2G3NA 3RR1A 4ZOCA 4M7SA 4X61A 1GHSA 2FHFA 4XVEA 3FOKA 4P7OA 3W7QA 1OD0A 3BG5A 4AZCB 4PMNA 1DWJM 3ZWTA 2ACQA 2PD5A 1EQPA 3WH8A 5U4NA 1UYQA 3ARUA 5D05A 1QJWA 2ZUUA 3VMNA 3GU2A 4R3UA 1U5JA 3NZRA 1AW2A 4P2VA 2CW6A 4I9AA 1CI1A 3G1VA 2YL5A 1H0IA 3R5EA 4UFIA 5BXRA 4PODA 4H00A 1GEQA 4XAZA 5AYBA 4JHOA 2ZA2A 5BOEA 1RY0A 1UD8A 4QR6A 4GXPA 5AHLA 4Q8PA 4E4FA 4C7FA 3GM8A 3UXAA 2Y61A 3CO4A 2Y62A 1OGGA 4Q8TA 1D3HA 2LLEA 4JFUA 2Y7GA 2OELA 2CYGA 1M5WA 4EANA 1E6PA 2AKZA 4WD0A 3IJ7A 1LWIA 1UR1A 1BG4A 2VCAA 2V69A 4IJBA 1RCXB 3ZT5A 4X3ZA 1E9ZB 2F7FA 3BLKA 3QLLA 5HQLA 5HJLA 4MB4A 2D20A 3AC0A 3HIJA 5CPQA 3BJSA 3MYPA 1J2BA 3RK8A 4WJ8A 1W1A1 5HMSA 3W38A 3GVGA 3VM5A 3VDCA 2GJRA 5G1YA 1Q65A 2EBNA 1HP5A 4LRSA 2ZUMA 3TNOA 1IQ8A 3BC9A 4CQBA 3CIWA 3O07A 5XIMA 2PU0A 2J88A 1O6IA 5E9AA 2YKKA 3VU2A 3H7VA 4DNMA 1PTDA 3I6EA 4YIWA 4PH6A 3WUEA 3CUHA 1LJYA 5GJNA 3AMDA 2QDHA 3BAKA 1G9HA 3N15A 2PWEA 4KEZA 1TWIA 2X0HA 2GZXA 4JTSA 2OYLA 2I5QA 1S2TA 2DZVA 1JFHA 3B8DA 4GNKB 2GDUA 3GQYA 2E8YA 1QBBA 3AMCA 1CGXA 4LJ3A 2HPIA 4ASTA 3RCMA 1EPVA 1P7TA 3HFYA 3PS7A 2X09A 5E70A 5I6SA 4J3UA 1EC7A 3C5QA 2B7OA 3CL8A 1EWDA 4AZ5A 2JF6A 4PR4A 1D2KA 3STGA 4PBEA 2DQXA 2VZVA 5KZMA 2W5FA 3P8IA 3DHUA 1AFSA 3ZT6A 1OQFA 1XLHA 2G95A 3DG3A 3FXYA 3URBA 3TC6A 5BOFA 3H26A 1EO7A 3QJAA 3MDUA 3TTQA 3UBPC 4KFNA 1OIMA 3R4IA 1O5KA 3BSHA 4AX6A 3SAZA 4Q4PA 2XSBA 3G0UA 3TZNA 1YDYA 1WAWA 2V3DA 2OMAA 4X0VA 2PAJA 1G67A 1R3QA 1F3EA 3WBEA 1GKRA 1H1ZA 4WXYA 1QDSA 1WE5A 1H1NA 2PDLA 4Z42C 1XC6A 3L4TA 5JU6A 3UJRA 3TQPA 4DJDC 5HMEA 2Y89A 1H7OA 1AL8A 3GIPA 2XFYA 3VC5A 2UV8G 3CMGA 3P0XA 4C6LA 4PB3A 4KWSA 2Y24A 3NYDA 4CNUA 2TPSA 5A8NA 1QOXA 1OG0A 1YNPA 1HVQA 4E2VA 2PDUA 4XD3A 3RU6A 3E96A 3TP4A 1B9BA 1MZHA 3PUOA 4O1EA 5HNRA 2ABBA 2ONEA 1OADA 1UWSA 3B04A 4ZQPA 4XO7A 1XPYA 3EEZA 4KRZA 4N2YA 4EXQA 1T8QA 8XIMA 1KCXA 2DIEA 4LUSA 5JMUA 3W1UA 4JQ1A 4QCEA 3WNLA 1OM0A 1K3UA 3LTSA 2C13A 4M1BA 1BKHA 3ZJKA 4UNLA 1TPB1 2FVKA 1RQEA 2XH2A 3EB4A 3QMRA 1XIMA 4M56A 4GIAA 1W1YA 4KEUA 1EP3A 1TWWA 3G18A 3B8SA 3W07A 1ZAJA 3N29A 4ML4A 3GHSA 2UWFA 1B3YA 1E0UA 4TR9A 4Y2WA 4L56A 4F0RA 3RRAA 3TMQA 2V82A 1OK6A 4RZBA 3E12A 3O6DA 4ZB2A 4AEOA 1NELA 3OJGA 4ZXLA 2DY3A 2PB1A 3MWCA 1G4PA 3CMJA 1HQTA 3KBMA 3WK2A 5D9OA 1JI2A 3CS2A 4A35A 3O3RA 4I6VA 4JTRA 5ABTA 5EMMA 4ORIA 3OQ8A 1PZ3A 2QDDA 5HK4A 3CAKA 3IANA 3NG3A 4LVFA 2EAWA 1VYPX 3C0QA 4AQLA 2BZNA 1BYBA 1DJZA 1HJWA 4IHCA 2EO7A 4PCPA 1Q2SA 3AIVA 3ARWA 4ZENA 2Y7EA 3ZYZA 3DC8A 3H2EA 3FJNA 5HULA 3LCXA 1H2JA 4TUFA 1S3TC 1P0EA 1VGAA 4NXSA 4J40A 3OZMA 2HBXA 3FJLA 2QCFA 5C2XA 3GZAA 2JFEX 3CH9A 1J0JA 4ZBCA 1BTCA 1YDVA 5LHFA 1OFEA 2QUMA 1RK6A 3G0SA 3UJSA 2OGYA 1QPRA 1N8IA 3R13A 4PUNA 2NLIA 1UA7A 3REQA 2ISFA 3NQVA 4LV9A 1RSCA 3GVWA 4UFLA 3VUSA 1E71M 5DQPA 5LXXA 3CPGA 2XIQA 5HINA 3AMKA 1X98A 1XF0A 4GWEA 3W1TA 3VGHA 3MI2A 3W1LA 1XLKA 3CWNA 4HPHA 3W7JA 3TFCA 1C93A 4ZOEA 3GTHA 3CMFA 4G5DA 4RX0A 3IIVA 1A3HA 2BOGX 5D32A 4ZODA 3LBOA 2ZRUA 4TIMA 1HZYA 5HUPA 1VLIA 3QV8A 1O1ZA 2E68A 4Y9PA 2JK2A 3EGJA 5CKSA 2CESA 1C8QA 2PGRA 2BWGA 4XSMA 1QI0A 3SY8A 3EDDA 3STEA 3KFTA 2PDKA 2PP1A 4CVUA 5A69A 4MYAA 3GAKA 2I5GA 4G2DA 1YNQA 5CXPA 5GNZA 2DT2A 4MSSA 4DJFA 1ENUA 1UIPA 4IG2A 1NQKA 4JTTA 3WQFA 3AOFA 3K8LA 3RN6A 3FDGA 4ALDA 3CH0A 1BGAA 1EJSC 1C92A 1E0VA 4L9XA 3HPFA 4E2DA 3IVTA 4GZIA 1GJUA 3VGBA 2SFPA 2H6RA 4HN4A 1XLIA 4GG9A 4PBGA 1JJKA 3S47A 3ITYA 2WC4A 2WCGA 4TTGA 4ACYA 2PWGA 4JFWA 4YCOA 2J77A 1XPGA 1QUMA 7ODCA 1QO5A 3UFYA 1J5SA 3B0PA 4GX8A 2WZIA 4LALA 2YLLA 1W17A 2GQ8A 3W7IA 4DF0A 1FY6A 1SSDA 3AHXA 5CBIA 2DUXA 1OY0A 4KWVA 4Z2HA 3STFA 4IIHA 1CGTA 3AS1A 4TMBA 3CM4A 3N9SA 3GVRA 4HYVA 4XZBA 5G4HC 3MKVA 4NYYA 2WM0A 4LNCA 2YR1A 4HVXA 3W83A 4FF5A 1VFOA 4IFOA 1NWSA 5CPSA 1FH8A 1PDYA 3O2LA 4I7VA 3TQ0A 4IOTA 2CBUA 2PGEA 3W4RA 5CPNA 4J35A 1PIIA 3OZPA 5DXXA 2XIMA 3BW3A 3ME3A 1JZ5A 2GVYA 3SRDA 3VIMA 2DV0A 4XZMX 2XN2A 4HZ8A 4ZA0A 2H9AB 5D2VA 1HO1A 2G41A 2R8WA 2PFHA 3K8KA 2PDQA 1AJ0A 1WKFA 2JGQA 3V16A 2WNZA 3SURA 2VOMA 1LQ2A 1FXPA 3XIMA 1DJQA 1JRBA 4RV3A 1O12A 5GJPA 1A0DA 1J9YA 4JY8A 4TVDA 4HP5A 4B5UA 5HMDA 1V03A 5LIUX 2XYLA 5D9NA 6ENLA 5DY2A 1OD8A 3FX4A 2Q8LA 1AVAA 4L4LA 3AIQA 3TYUA 3WQWA 1GVIA 4G56A 4AIOA 3HURA 3IAPA 4R5EA 2J79A 1S1RA 1EP2A 1A3XA 1EJVC 1KTBA 3NQ7A 1A47A 3CXOA 3K13A 4O1CA 2EQDA 1R87A 4D1IA 3C0SA 3SCUA 3VK5A 5A2BA 2PLCA 4Q7BA 5EY5A 3S0CA 3WJZA 4PCTA 3PNZA 3LS9A 5L9FA 4LTSA 1UC4A 1BWVA 5BXTA 2HZGA 2NX9A 3GWQA 3WQVA 1EYEA 3NQMA 4BQ4A 2RDUA 1SR0A 1MYRA 1E4MM 2QJJA 3RCNA 2CLFA 1OABA 3MHFA 4HA3A 4Z1DA 4JHZA 2FH6A 4EK7A 2QCGA 1MW2A 2VC9A 1BEUA 3PK7A 4F3HA 4N02A 4DM1A 2Z24A 3EWBX 4O0QA 5BNKA 2I56A 2X1TA 4M8UA 1ICQA 5LA0A 2Q6ZA 1LYXA 4PCSA 3EWCA 4HN8A 3WLHA 3WBWA 4B3ZA 2QUVA 1R3WA 1US3A 1EPXA 4WR3A 2XH0A 3N2MA 3UZXA 4J27A 4NY2A 1EUAA 3UCCA 3THDA 2VURA 3QPYA 1RBAA 3LQGA 3F2CA 2ZUSA 3MMWA 3OVQA 1IE7C 3H24A 3TMLA 1LBFA 3K8MA 4GY1A 1NU5A 1H09A 1DKWA 4H9TA 4PUKA 1UD2A 5BU6A 3QMTA 2ZFAA 1TR1A 1UR9A 4Q4OA 2YXGA 1TPDA 1XHGA 1TUFA 4QS5A 5AY7A 2PURA 3U48A 1D7KA 1V0MA 3ZVHA 1BGGA 4ICMA 2WB5A 2XGZA 4AG0A 3QZAA 1VPXA 3TKFA 2OPJA 3NEVA 4PFHA 4FLSA 3NZ1A 4EPDC 1MWOA 3AO0A 4WIWA 2H8ZA 5I3GA 1S2CA 3TYBA 3PY2A 3W2NA 4N4PA 3HMCA 2D0GA 2PDHA 4KIRA 5REQB 1ZPTA 4CCZA 1GVRA 1KA9F 4XAYA 4D8ZA 1H49A 3BAXA 4UR7A 5AFDA 2BFGA 1YQ2A 2DJLA 4FIQA 2X05A 2YCEA 2WHKA 3EWYA 5KINA 1VRXA 3KUMA 3TH6A 3HBLA 2E0PA 3NPXA 1ZQ5A 1V6YA 1J0ZA 3KTXA 3C2RA 4O1AA 1JIBA 3W7NA 2ZCGA 3M5XA 5A6LA 1W5MA 3PPHA 3T9PA 3V0TA 3EWZA 2PTZA 2WMGA 1JEZA 2I9UA 5AYXA 3KRUA 2GOKA 3LTPA 1B5TA 3WH6A 4RZ6A 3M1ZA 4A2RA 4DB7A 5AHNA 4UFHA 2ZDSA 4O53A 3BK0A 1FFRA 3NQEA 2E4TA 4DJDA 3P61A 4Y9MA 3M46A 4H83A 5DRCA 1KRBC 3CO8A 4KIEA 3LB0A 3F4VA 1W1ZA 1L6WA 1OBAA 1XKJA 3TCSA 4YTQA 3SN1A 2A21A 1OT1A 4JAWA 2WC3A 4KS0A 1KNWA 1K4GA 5EMYA 3UYCA 3GU9A 2ZA3A 4YTSA 1N8FA 3R2GA 2EKCA 3LGGA 1IXOA 1KM1A 3N73A 3WENA 3AXMA 2WNWA 4DBEA 3RLUA 3CASA 3ITXA 3N11A 2PTWA 2I17A 3FNDA 3JW7A 2H8XA 3WBYA 1JF6A 5TF0A 1CECA 2E1DA 2OSWA 3MP4A 2GWNA 3SQLA 1IIHA 3AROA 1F9CA 2CITA 3DC0A 1THFD 3GE7A 5DMMA 3VKAA 1ISZA 2GQAA 3ARRA 4D6IA 4RL3A 1T99A 1XDLA 4QNEA 3M7SA 1BLIA 1BXCA 1ISYA 6ALDA 3R8RA 4GACA 3MY9A 3VUPA 2O7SA 5AYIA 1W9DM 3A4WA 4LH8A 3FA4A 1P48A 1XINA 5LGZA 1WKYA 4GMEA 4JYFA 2CLLA 1P0DA 6XIAA 2V9DA 3FFSA 2FJKA 1XP3A 3CNYA 3RLHA 5LNVA 1DWIM 1B30A 1HTIA 3C3UA 3M0XA 5BCAA 5JBFA 1F74A 4M51A 4HTYA 1A5NC 4ILSA 3KVKA 3PB2A 3LN3A 2MANA 1NARA 3GNPA 4NZ3A 4ZSTA 3CB8A 1X7IA 1VPQA 1W1PA 3PJUA 2G5WA 5JBEA 4MADA 3TX9A 1GOIA 4J2MA 5LNWA 5DT7A 1I9CB 2W9MA 4IPNB 3URAA 3TA9A 5KEZA 3PUEA 2GJPA 1UKOA 1R86A 4QAIA 1MUMA 2D73A 3ANYA 2XSXA 3TW9A 4XD4A 1KGXA 4AWTA 1X7FA 3T0AA 3PWIA 3RX2A 4UR9A 4AY7A 4ZE4A 3PM6A 3T42A 4UTHA 3L2IA 4Y7EA 3IJDA 4N6FA 3TAOA 4NAEB 1IYXA 1VAHA 5AHIA 3P14A 4LYQA 1T6MA 1QI3A 3G0XA 1AQMA 2HXTA 1F4AA 1I6NA 1H11A 4OUEA 3GHRA 4R7OA 4E3TA 3OZOA 4WGHA 3TEVA 2OCZA 4M6PA 1RJPA 4AIBA 3FGCA 4LBSA 2ACRA 1JPDX 3R6IA 2V67A 3UETA 4MG4A 1JYNA 3SJNA 3MT1A 3GO2A 3R58A 4ACZA 4R85A 1QOPA 1X1OA 3LNPA 2DZWA 2J66A 2YA2A 4A8IA 5CBBA 1B3ZA 2RKXA 1KFCA 4GXMA 3LX9A 4LVBA 3SZ8A 3MP5A 3B05A 4ZQRA 8XIAA 1VR6A 1LL7A 2CXEA 5DCBA 1VFSA 2OSYA 3HJEA 1FWBC 3CC1A 4PRWA 2D23A 5FJOA 2GUUA 3E38A 3GNRA 5MF5A 5FL1A 4MTVA 3ABQA 2EPLX 4ZSUA 5HWNA 3OHMB 3OP2A 1V93A 2HBVA 1B3XA 4LUIA 1V02E 2JBMA 1NFBA 4OJYA 4H8NA 3S2NA 5FJIA 1EA0A 4L9YA 3U2CA 1TPFA 3W7KA 2J7BA 1RJRA 2V2DA 4DLMA 2QDEA 3IK4A 2DUAA 2YCLA 1TV8A 4UMBA 1BF6A 1Y5XA 2XUCA 1DIEA 5CC3A 1KM3A 3NSMA 1M65A 1OB0A 4PTVA 7CGTA 2E7FA 1CLKA 4CU8A 3KX6A 3B9DA 1K02A 4OOZA 2A2IA 3GNOA 2WSQA 2OQLA 2E9MA 2OZ0A 3H4WA 4GZEA 1AG1O 3PUGA 1AODA 3HG2A 2HQAA 5G4EA 3T8QA 2P1FA 4PGLA 1MNZA 5ECUA 3LENA 3FS2A 4WF7A 5AHEA 4Q6XA 5D8ZA 3O6CA 5HDRA 2VYOA 4JIRA 3F5JA 2W4XA 1I2NA 1F8IA 3NSNA 3GTFA 3TN6A 3W7EA 1KM0A 1W2VA 4FI4A 3SW6A 2R1NA 1W9PA 2Q3RA 3IJQA 3MI3A 4FP1A 1E4IA 3Q58A 2YDQA 2FHBA 4WY0A 3UW6A 1Q4WA 5C55A 1LG1A 2GDVA 3MA8A 5F7UA 4WVXA 4GBUA 2YGYA 4GYKA 1HKKA 3L67A 1Z9AA 2PDGA 4TVUA 3S1XA 4AF0A 4MWAD 1TELA 1FDYA 2J74A 1SW7A 2XSAA 2OX4A 4OZOA 4QXIA 4PB5A 4HHLA 4KRTA 5HNNA 3ISIX 3E6EA 1W5NA 1PWLA 4X9SA 1C8VA 4O1DA 4YYCA 1XYMA 4Y96A 3E2SA 3P8JA 1Q6OA