1R3RA

Uroporphyrinogen decarboxylase with mutation d86n
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSNILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen Decarboxylase
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 126
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3rA00
3GW3A 1JPKA 3PPGA 1R3YA 1R3TA 1JPIA 1U1JA 3GVVA 3PPCA 4QQUA 1XDJA 4L64A 2NQ5A 3BQ6A 2INFA 1R3QA 3RPDA 1R3WA 1XR2A 4AY7A 1R3VA 3BQ5A 3GW0A 4L5ZA 3T0CA 1YPXA 1U22A 2Q71A 2Q6ZA 1R3RA 1UROA 2EJAA 3GVQA 1T7LA 1JPHA 4ZTYA 1R3SA 4ZTXA 3GVRA 3L7RA 4EXQA 3PPHA 1XPGA 1J93A 4L61A 4WSHA 1U1HA 4L6HA 4L65A 3GVWA 1U1UA 3PPFA 4AY8A 3CYVA 4L6OA 4ZR8A
chains in the Genus database with same CATH superfamily
1GVOA 1EYWA 4CVUA 5K3VA 3IARA 4MWAC 2PD5A 1B0IA 5I06A 5D2TA 2WHKA 2QLYA 3W1PA 4GWEA 2WC7A 3QRHA 2B0MA 3QYQA 1L9WA 1TV3A 1LQ2A 1QOPA 4Z2IA 4GUIA 1WO2A 2ISDA 3C0SA 1ZSXA 2WM0A 2E8ZA 2YBVA 3A22A 3T0DA 2YB4A 1EJWC 2BY0A 2YXGA 3NQ6A 4B5UA 2IXVA 3SGUA 3S42A 3E2SA 3UP8A 1UQZA 4IGHA 1LL4A 4W88A 3KCLA 1ECEA 2GVLA 1EA0A 1Y5WA 3VDBA 3FNDA 4ATLA 1C9DA 1SMAA 1S46A 2CZFA 1BQGA 1LRTA 3CASA 2ZUVA 3THCA 5I03A 4UTWA 4Q3MA 1DWHM 3ARXA 1UUOA 4FR6A 1Q2RA 4G2DA 4FOUA 2J6VA 1VC4A 3UR2A 3A4AA 2VYOA 5D30A 3W9ZA 3PF3A 4AZCB 1LBFA 3R58A 1L6YA 1HQTA 1HXJA 1XIIA 1XW8A 5EMMA 4PR4A 3TV8A 2D0HA 3NNTA 4P61A 2ZVRA 4IMGA 3ZWSA 3CUGA 3EWUA 4IXHA 3PJXA 5J8LA 4JTKA 1JZ8A 2EGZA 2I56A 4AW7A 3UPMA 3NDYA 2YB1A 5C9RA 1KBIA 2DT1A 4OQVA 3MO4A 1J79A 3AQUA 3DHUA 2NV1A 2VZOA 1JYVA 2PPGA 4JBRA 3MYPA 1WUFA 4YPJA 5LNWA 2R14A 4QG8A 3N29A 2DVXA 5C5YA 1R7AA 3WDPP 3IIZA 3IUHA 5EL1A 4ZE5A 3T2OA 3NSXA 3VKJA 3M0LA 4FK9A 1OG0A 4GYJA 2XH4A 4XZ9A 3ARTA 4R33A 3CTLA 4FPSA 1S5WA 2ZRYA 1BF2A 2ZX6A 1F9CA 3CH0A 5CJNA 3MUCA 2HWGA 4GNJA 4XAYA 4F40A 3MP5A 4TIMA 2QCFA 1I60A 4OUEA 1XPGA 3DI0A 4AVFA 1UKOA 3SQLA 1IT0A 4MAZA 3NL6A 1ECQA 3PUEA 3SB0A 3TN4A 4E4FA 3VNMA 1S5MA 3OGSA 3QPEA 1RCXB 3TOPA 1QCWA 3NPXA 4NZ4A 3BICA 3R79A 2PWUA 4RDZA 3LSBA 4F0MA 1YRRA 4CQCA 2A7NA 2CLLA 4Z2LA 2VEIA 2W6RA 5CZKA 1OEPA 4JHMA 3TIMA 2I16A 3E5BA 3USBA 1XIMA 3MTWA 4LUJA 3RU8X 1GQLA 2VT0A 3MSGA 2QJJA 5IHSA 3MU7A 3OA5A 1QW7A 1JZ2A 1R2TA 4ES4A 3R7MA 4IUOA 2X2YA 1RLCL 3VE9A 3NUKA 2BASA 3T0CA 5HWNA 3VX0A 1E9YB 1FWWA 4MZ1A 3LBCA 1PHQA 3B04A 4J1OA 3QYSA 4DVOA 3QR0A 1XCFA 3GIYA 1OABA 2WZTA 4MZ8A 2VGFA 4BI5A 3F4CA 3W1TA 4Z17A 1EF2A 5T8GA 1UP0A 3LX9A 1G1YA 3UWYA 3RR4A 4IUGA 2AGKA 4M80A 3BCDA 5GPRA 2ONEA 3VZXA 1S5NA 3W84A 1IEQA 4QEHA 3LBOA 2ZA3A 3LTYA 2X0HA 1LOQA 4K3ZA 1CGXA 2VI0A 1QW8A 1IR2A 1NF0A 3PSVA 1BVWA 2WO5A 3CMFA 1KW1A 3R89A 3VMPA 3W82A 3DGRA 3AMCA 3K46A 1F3EA 3BUVA 5C2CA 1ISXA 3OW1A 3WQFA 7REQA 3JRKA 2XVLA 4O18A 5I3GA 4UTTC 2JALA 5DF0A 1OGGA 4IHCA 8TIMA 2VEMA 2YL6A 4ZE4A 3ATYA 3G1XA 1LWJA 4ZA0A 4ZO8A 4US5A 4YTRA 2LLEA 3WD4A 1K8YA 4AUBA 4D72A 2EQDA 2NQ5A 1LDCA 2PFHA 1GOQA 4H7CA 2OX4A 2QT3A 4PC8A 1JQXA 2ANUA 5DQPA 4M82A 1KCKA 1UZHA 1UC5A 1SMDA 3PWGA 2QHAA 4IMFA 5FEXA 4GZ7A 5HQLA 3HGSA 3O6AA 4BHYA 1UZ1A 2NX3A 4DLFA 3F2CA 2ISWA 4O1BA 3OG3A 3KRBA 4RZBA 1XYFA 5LZLA 4OWGA 1IQ8A 3F03K 2PDPA 2PDJA 3UJ2A 3ZM8A 3P6LA 3AROA 1DXIA 2CLMA 2XU2A 3NXFA 1S1RA 4AWUA 4CEXC 4GXMA 2QS8A 1SO6A 4XSMA 2WMIA 4GNKB 2WHMA 4DJED 1B5TA 3H7RA 4IPNB 1Q63A 3V5CA 2VUNA 1G94A 3U5UA 4FMVA 1YPFA 1W5QA 4LBUA 5F1UA 4ACYA 3WUBA 3S9IA 2FGBA 4M24A 1TPC1 2PBOA 1QK2A 1GZJA 5CC7A 3GHRA 3AXKA 3VOIA 2EKGA 3WD2A 1X1NA 4Q8TA 3E2RA 3KVMA 4K7YA 4U4MA 2O9RA 4ZCWA 4DYKA 4EWJA 3MKKA 3DCPA 1DVJA 5C70A 1JPMA 2REQA 1EEPA 1RJQA 4Q22A 1Y7VA 2ZUWA 1PZ0A 4C6NA 4WXZA 1WP6A 3GTHA 4GKLA 4AD1A 1B57A 4UUIA 2GDUA 1MXDA 2BDQA 4CQ9A 3LA4A 2JKPA 1SU5A 2ZXBA 2V0TA 1RLDA 2FTYA 4UMBA 5F1VA 2Z1SA 3C2FA 2D3NA 3EWYA 5FF4A 1GHSA 2PDUA 5I3FA 1KC7A 4D6DA 3S0CA 1P43A 2GVJA 3I7RA 2QZRA 3TMLA 1ML1A 1F3WA 3P93A 4LX4A 4MDPA 1XGDA 1QASA 3A3XA 3QLLA 1IEXA 4AFYA 4LCSA 3N34A 2Y0FA 3W2KA 2WWCA 1B3YA 2WK2A 1EO5A 1OADA 4PRTA 2J7GA 2BVWA 3N3MA 1R38A 1M5WA 2IS7A 1JDCA 2A85A 3B3DA 4H8UA 1UR3M 5I5RA 3BLDA 4I3GA 3N11A 3WH8A 1GNXA 4P7QA 3HURA 1Y5XA 1ONRA 2PC8A 4MWAB 1RBAA 4X0VA 2Y70A 2KX9A 5DELA 1ONXA 3QBUA 1UR8A 1TIWA 1OC6A 1RPKA 2DSKA 2O55A 4IIEA 2DZTA 3P7YA 1CLXA 1W6TA 3T08A 2XVKA 5F2IA 3DKLA 4WJXA 2CEQA 1KBBA 2V3DA 1EX5A 2VQUA 4B9ZA 4O1CA 3S1VA 1XLLA 1P0KA 1VJZA 1VR6A 4BFAA 1MRAA 2PEVA 3URNA 3CPGA 4EK7A 3W7QA 2XG9A 3VZYA 1A3HA 3SQMA 3KCJA 4GYPA 3MZNA 3VIPA 5A6MA 1H1YA 2DDXA 4V2XA 3E2VA 3ITCA 3W7GA 1XGZA 3PULA 5CZSA 3ZWTA 4KQNA 3HZ3A 3VKBA 2OODA 3L0GA 3MVIA 1PZ1A 2PCEA 2XN0A 4EXQA 3RM8A 5D02A 3R1ZA 3WLTA 1MZHA 4Q33A 2WMGA 3WN6A 1YKWA 4EAMA 2QUUA 1E56A 2ZVIA 3WH9A 4H9TA 1FVPA 5CXPA 3MDUA 1JZ3A 3NR0A 3MV11 3PB0A 3UY8A 1XSKA 1KA9F 2R9RA 4W5UA 5HJLA 3PPFA 4S3DA 3LCGA 4S3EA 4IT1A 4Q4MA 1J10A 3FOKA 5D8ZA 1N55A 4G7EA 2RDUA 2RAGA 2TRSA 3WJXA 1JDDA 1NOUA 2RUSA 2CPUA 3STGA 3VGGA 3QY6A 3QZ6A 4L1GA 2VFFA 4PBFA 3C2YA 1DWJM 3QTGA 1W54A 1AZ2A 3TYBA 2D22A 6TAAA 2JGQA 4KEMA 3KRSA 5DRCA 3TYZA 3K4AA 2QW5A 2WVUA 3E9AA 1NTHA 5B80A 2EF9A 1AK5A 3OZMA 3PZQA 2G96A 4PTXA 3WD0A 2QUNA 4FLQA 3PWIA 2XIBA 1CDGA 3E49A 2GZXA 2DZPA 1CLVA 3CQJA 4CNUA 4ZO9A 3ICJA 1NF7A 3QFEA 2XJ7A 3TJLA 4BR1A 3FXGA 4G6CA 5BYWA 2NLYA 1U5HA 4IICA 4P8XA 2X2GA 1K9TA 1Q6QA 4O1FA 3AIRA 5G1MA 2P0IA 1PAMA 2DUXA 2GGEA 1MUMA 4LV4A 1I9CB 3AZRA 3QV6A 1EHNA 3DENA 4MJ4A 3NYDA 4QE4A 3RAOA 3WFAA 4F48A 5A6SA 2DH2A 5DBTA 2OYMA 1LUCB 3WLOA 3S6OA 1LL7A 4XD3A 1J0KA 4NJKA 2WBGA 1QFEA 4NP7A 4KEZA 4YMZA 4PMVA 1C9WA 1WNOA 4X9YA 3QKEA 2CBIA 2W92A 3WNPA 3C2VA 4V28A 4EWND 4PZVA 4Q4SA 5AHFA 5AKQA 3W1XA 3ARWA 4C7DA 5AC6A 3C52A 1IZKA 2QPUA 4AZCA 1QNSA 4Q32A 2FVKA 2HK1A 3MUAA 4ZQPA 5KITA 3STCA 1MEHA 1TUFA 4N4QA 4ZQOA 2GL5A 2BVDA 4LUIA 2Y24A 1PVNA 4RDWA 1QNQA 4NNBA 2WHLA 4R7JA 4GI4A 1E0VA 2DGAA 3HGJA 4GO8A 3LM7A 4D6IA 4A21A 1P0EA 1MW2A 3FSTA 4I5RA 3OZYA 3K5XA 2Z7KA 3C2RA 4UTJA 3FYYA 4K36A 3WBYA 3LD5A 3TN5A 4WJ8A 3UBPC 5C0QA 3IIOA 4L9ZA 3AYVA 2OXNA 3CK5A 2YDQA 3B0YA 4CGTA 1HJVA 1QPKA 2CETA 3D5HA 1RUSA 3TYEA 3RILA 4MHBA 1K7EA 3WCZA 2JE8A 3UWEA 3AJ7A 3CV6A 3S3GA 2AL1A 1CLKA 2HBVA 1SO5A 2NQHA 3PK7A 2NQ9A 4M1RA 3RLVA 1GZGA 1ODZA 2EEXA 3T81A 3K8LA 3LLFA 4C1LA 1XLCA 3P0XA 1EWEA 3WDRA 1ZRQA 4DAFA 2AMXA 2R1KA 4ZXOA 5I3JA 2RDTA 1H51A 2OT1A 3WH7A 4ZB2A 3CL8A 1QO5A 4GE8A 4DJFA 3VOCA 3UW6A 1FKWA 1H7OA 5AC5A 1ZCCA 1QI5A 5FI8A 1LF1A 2A2IA 1UA3A 1Q8JA 3EOUA 5BNKA 5ABTA 6PTDA 5M2FX 2DT0A 4FNUA 5CGTA 5EFFA 4GXPA 2QJGA 1HO4A 3TNBA 4S39A 3W25A 5FF7A 4BKNA 2CKSA 3LHYA 3U0HA 2NQZA 3WMBA 3DGBA 1PYFA 1V0MA 1O60A 4UTKA 4UB9A 5CG0A 2DW6A 3IJDA 2QV5A 3LGEA 4JQ3A 1QPNA 3SFKA 4GO9A 3N25A 3L4VA 3W7DA 1JDEA 1P0BA 1E9LA 2E9BA 3TZNA 2HSAA 4H19A 3KP0A 2QF8A 4MM1A 3CAWA 1WA3A 2V5DA 2BV9A 2WC3A 2D0FA 1Z89A 2J4GA 3QPYA 1JXJA 1E4NA 1E55A 1KLZA 1SQ7A 1LG1A 5LSMA 1FWNA 2XVNA 4IMDA 2VX7A 4KETA 2VOTA 5FESA 2H3BA 4YN5A 4N0RA 1O5RA 4LANA 4P7LA 1KXHA 2FPVA 1KRBC 1GTEA 4FHAA 5JU6A 1TJRA 3HQ1A 3UGVA 3HFYA 4XAZA 1OFDA 3WK1A 1DIDA 2C19A 3EKLA 1XHGA 3F2BA 1YQ2A 1XRSA 3GG0A 4LY4A 3ZR4A 3MUZ1 4WGHA 4UQAA 2CZ5A 3RITA 1V6TA 1UB3A 3O05A 1NVMA 3TTQA 4D8LA 4HMNA 4EACA 4MYAA 4JTEA 1Q2SA 4M6QA 2HXTA 3SIMA 4ZQNA 4MYXA 1UKPA 2XFWA 2JF7A 3LERA 3FY1A 3VUPA 3I3EA 2ZXQA 1GW1A 4ZB5A 4JL1A 2DU2A 1JDFA 1F3TA 2OG9A 3WG6A 2W66A 5EFDA 4R3UA 1CGUA 3II1A 1B9ZA 3M0JA 5EB8A 4O13A 1TA3B 2PURA 4DI9A 4IIGA 1JPKA 4MNJA 3EXTA 3PBGA 3T07A 1XRTA 4XVEA 1O5KA 3NZGA 3LTPA 3OB8A 4FF5A 1XG3A 3WEMA 1GW9A 1EXPA 3KOZA 3CQHA 4PCFA 3V5OA 4PH6A 1J18A 4YVXA 4B2DA 3VINA 5AC8A 4GD0A 1BKHA 4XK2A 4O11A 3S1XA 1W2VA 3H6OA 1VJSA 2CLPA 1B4EA 1GONA 2A6LA 4UOJA 1XS2A 2DP3A 4IGMA 4A3RA 4LBSA 4K38A 3IIXA 3R0KA 2DIJA 4Z08A 4IIFA 1I2QA 3MUIA 4JDBA 4H4IA 3JS3A 5DRIA 1HVQA 4ZQRA 2R1PA 5TAOA 2PZNA 3BPWA 3ARZA 1DTNA 1MW0A 4MY1A 4JFWA 1VF8A 3T2QA 3G3DA 4LB4A 3DG6A 4Q8QA 2ZADA 1F74A 3VKAA 4V1YA 2Z25A 4IG2A 2QDHA 2B7NA 3MVTA 1NWTA 1R0MA 4WSKA 1X38A 9RUBA 4YXGA 3LRMA 1FWDC 1UBPC 1M65A 4I5XA 2R6OA 3OOQA 4GGHA 3TCSA 3G1HA 2AKMA 4MKSA 3SY8A 4TX6A 4XUGA 4M0XA 1XWYA 1Y0EA 2HISA 1EP2A 3AFBA 1GPWA 1U1JA 3R4IA 5G1YA 2HZGA 1S2AA 2WVVB 3I6RA 3CV2A 2UV8G 4HZ6A 5DFAA 3VM5A 1PDYA 2V5BA 1C8QA 1HJUA 1SZFA 3MPGA 1UKSA 2GQ9A 3GTNA 1DWFM 3CYVA 3FJ6A 2VENA 3STFA 5FL1A 2DZAA 3W7KA 3I4KA 4JKMA 4O4WA 3PTKA 1G69A 1YPXA 4CUCA 3WQGA 3O15A 2G4FA 5LIKX 5LXEA 3VIFA 4LVBA 1FWJC 3STEA 1EJRC 3PN8A 4JFSA 3KWSA 1W91A 3DU0A 1ZB5A 1LLWA 2VURA 1B9BA 2PUZA 3MI2A 5IM51 3IK4A 3BJFA 4MWAA 3UZWA 3M41A 3FVMA 2EPOA 5A8NA 4HA0A 2JKEA 2H8ZA 2F61A 1V3JA 1SO3A 4O8RA 3WYZA 5A94A 1EDQA 2NX9A 3NYZA 5BOFA 2TPSA 1RBOB 2BGSA 2D23A 4NKCA 1DIOA 2GYIA 1KBKA 1WBHA 3WJSA 2FZBA 5AB3A 4O0KA 3STPA 3BLOA 5M1TA 3DKJA 4NYUA 1DQWA 1KM5A 3AIUA 2QCMA 5I3HA 3M6YA 3WH6A 5H8UA 4Q8NA 2QCCA 1U1UA 2ZZ5A 2H3DA 1YTEA 3VUSA 1E40A 1R47A 4PUMA 2G41A 1QAPA 4J4KA 2J9ZA 4NZ3A 2AMGA 2FJUB 1WKDA 1CNVA 2HE8A 4QDPA 4W85A 1PKYA 3KRZA 3T0AA 4TR9A 2WZEA 4JTHA 5XIAA 4FLRA 1GKRA 4G56A 3MKVA 1IV8A 2VDGA 3M44A 1RA0A 4JFVA 4CN4A 2F8QA 1TV4A 5AZ1A 2DZVA 3N9RA 3MV01 4WKAA 1TQJA 2X1TA 5HQMA 2PDCA 2ZCGA 3N6QA 4K39A 3VD4A 1TZZA 3ABSA 2WMHA 4L4MA 2WHJA 4QJ1A 4AZ5A 3MS8A 4DXXA 4AHOA 5ABGA 2X16A 4Y9MA 4M6UA 1CXHA 1V3LA 3PJTA 4LH8A 3DFQA 1RVKA 2Q02A 4A3UA 5FJUA 1UA7A 1MQPA 1V08A 3MSRA 1CGWA 2WCSA 4HMDA 5EYWA 4C6BA 3UR7A 4AAJA 3SN0A 2ZTKA 1QR7A 3DH7A 3VGDA 1EX1A 1LBMA 1RD6A 4FAMA 4NYYA 2B7QA 1J5TA 3OBEA 4LV9A 4YL2A 4TO8A 1XC6A 3LOTA 3G0UA 2NUXA 3CHEA 3OBKA 3FX4A 1FA2A 4Q4KA 2A79A 5MKGB 1H3GA 1G6CA 2I9UA 1JYNA 1VAHA 3ES7A 4Y6GA 2ZZ3A 5I3DA 2GQAA 3B0VC 2Y6ZA 4H01A 3KS5A 1QXLA 2YX0A 4YCPA 3H23A 1A0DA 3D0CA 4C1KA 3FHAA 1NFGA 1XUZA 1UD3A 1SZNA 4LS2A 3BMXA 1BD0A 2XSBA 4NJIA 1K70A 3RRAA 5FACA 3WX7A 3IJLA 5D03A 1JCLA 4HPNA 1LUCA 1Z48A 3S5OA 3VCCA 3QR3A 3BJSA 3BW2A 3EX4A 1RQEA 2QULA 3LNPA 4DIAA 1QI0A 5IHRA 2E5DA 4RZ5A 4WVXA 3ALGA 4QIUA 2NVAA 2A5HA 2WANA 1ZALA 4GISA 4EX4A 3SCWA 2ZDSA 3SY5A 1VLIA 4EPEC 3RPMA 2WMFA 3HPZA 3EA1A 1SZEA 3S5NA 2CYGA 1C91A 3WNMA 4HNNA 2DT2A 1BG4A 1TRDA 3WNLA 4H6RA 3LV5A 3MMUA 3IRDA 1H0GA 4DWSD 3EYPA 4PBGA 2ZQ0A 4YTSA 2PGFA 2G3JA 4JX6A 3UJFA 3VU2A 1S3TC 1PUDA 3PR2A 1E4IA 3A24A 4GY1A 2JBMA 2NUYA 4X61A 2G3MA 3CUZA 2NWSA 2J47A 3TQVA 2DSWA 1DKWA 3T1GA 3E0VA 3OPSA 4UZUA 4HZ8A 4IQJA 4GI6A 5EKYA 3LHWA 1ZJBA 2A6NA 2GDQA 4G5DA 2FPTA 3G1FA 4F8XA 3EDKA 5E1QA 2QIIA 4ZOEA 4ZOAA 5HPOA 2QCGA 3WENA 2F2KA 3E2QA 4I7UA 2H90A 1FH9A 3NVTA 1GZ1A 2P0OA 4UTTA 2FHBA 3WQWA 3QMRA 1KFLA 3TW7A 1XSIA 2DZBA 3TKFA 2XPKA 3WLSA 4AZ7A 2NZLA 1M01A 3K4WA 1D8CA 4M51A 4UQEA 4HN4A 3BG3A 2OT0A 2QDEA 3S4TA 2PLKA 3HPAA 4B5SA 2QMKA 3QSRA 3O7UA 1TZ7A 5LA2A 3VFLA 2CBUA 2MUCA 2ZA1A 4M8UA 1L6SA 5A6BA 4AWEA 2XYLA 4NASA 1R9YA 4GCXA 1AW5A 5C9XA 2EG7A 3S2MA 1ZUAX 2DQWA 2E8YA 4IFKB 4JFUA 4GGBA 3GFZA 3MP4A 4N6EA 2Q3OA 4E8DA 3WUEA 3UR8A 1XSJA 1DJXA 4J40A 1QW9A 3KE0A 4HK5A 4HZMA 2GQ3A 4F0HA 3HPXA 4B5NA 2CZDA 3QV7A 3PWAA 1OFAA 2Z00A 1XC4A 4UNLA 3LV6A 1R87A 3WELA 3GUWA 3GFXA 3SCVA 3KUMA 1MUCA 4E2VA 4RUBA 1T6MA 1IZJA 2E1DA 4L80A 1G7VA 1TV7A 2FPYA 2CZEA 4AG0A 4F0LA 5CLTA 1HJXA 3P14A 1Q66A 3CQIA 3BGGA 1I2NA 4WSJA 1HT6A 2GK1B 3DECA 3QW4B 4M1BA 4QG6A 4CVWA 2BB0A 2ZZ4A 1A0EA 3A3HA 3FKRA 2XGZA 1PZ3A 1MDLA 3W7EA 4IL2A 3S6TA 4JTAA 2WW5A 1H50A 4ASTA 1GVFA 2VGIA 3B05A 3TYAA 2JQXA 4Z2GA 3LXAA 1WX0A 2DW7A 5AYBA 1BLIA 2Q01A 1P7TB 3RFAA 5C6MA 2E6AA 1HW6A 3TWAA 1THFD 3POHA 1W8GA 1FWGC 2J74A 3KP1A 1CXKA 3E0WA 3VD9A 1HJWA 3NOYA 1LM1A 1B3ZA 2J24A 2B7OA 1W1VA 3VC6A 4MUPA 4C5ZA 1TPEA 4LAZA 4HA3A 1V03A 2IXUA 4EPBC 1CECA 2VXNA 3S5ZA 3UR5A 1NFPA 3FYOA 4IOTA 3GNDA 2V2CA 3L21A 1E6SM 3TH6A 1LQAA 1PTAA 4G1KA 1X97A 2GDVA 2VELA 1V7AA 3ARUA 4FIQA 4MG4A 3W38A 2QUVA 3PTDA 2VZTA 4ORMA 1FDJA 4IP5A 3M6DA 1VZWA 1NM9A 5CSUA 4BEQA 1TA3A 4OGZA 2GGJA 1UPMB 1JZ5A 2W9MA 1AW2A 2PDKA 1BXBA 3GY1A 1RVGA 4JYFA 4L56A 3R10A 1WCGA 1BG9A 3AO0A 4O0QA 4BJHA 1BHGA 4KRZA 2CIPA 3QY8A 1PKLA 1DWAM 1GT8A 4PBEA 3TN6A 3WEOA 1UD5A 1Q4NX 4JX4A 1UW9A 1ADOA 3GH7A 3UG4A 2VQTA 4IISA 3NQ2A 3BCFA 5LIXX 4DO7A 3W7IA 4QSHA 3TVAA 3FHQA 4O4VA 1M41A 1V77A 4LXFA 3ZZ1A 3NQ8A 3WFLA 3JVAA 1EH9A 5CG7A 2FZNA 1H1ZA 2OZ0A 3M5ZA 1HGYA 1LP6A 1VFMA 3MMWA 3O9NA 2GVEA 4NX5A 1Y5VA 3AIWA 2ZUSA 2QCNA 2AL2A 4XX6A 3IIPA 3RHGA 1H7XA 3ARYA 1FWIC 1JUEA 4KCWA 4HNVA 1XFBA 3LRKA 2E5CA 4S23A 1IEIA 3RPDA 5A8OA 1TPVA 3BV7A 3OVQA 2V5CA 3C2OA 4BCEA 3PUDA 3TYUA 3NM1A 5H1WA 3RX4A 2ZXAA 1JNEA 3MANA 1VYSX 2C1GA 3VCNA 4LW7A 1M04A 4H9YA 5ABFB 2YXXA 4JYDA 3BLIA 2WVVA 4JTRA 3CH9A 2HDJA 4ML4A 3GDMA 4J7RA 3AI0A 1M7PA 4LPCA 4PTNA 4GA8A 4XAGA 1MFUA 4BEUA 4JTIA 4LVDA 4UWMA 1BPLB 1RAKA 2VDIA 1U83A 3CQ0A 4KKXA 3P61A 3MI6A 4AZGA 3W2UA 2P76A 1K6WA 3E1F1 3THUA 1A3XA 4HA4A 1S2VA 2NT0A 2IKIA 4GRSA 3RCMA 1T40A 4W87A 5A2CA 1OC7A 1B4KA 3Q45A 3UYCA 3GW3A 4CQBA 3EEZA 3GBDA 3UXLA 4JS3A 1KD0A 3WMLA 3DXIA 3L0NA 4J3XA 6ENLA 2X1RA 3PZMA 1F07A 1P48A 3PZIA 2Z2UA 4IIDA 4NRRA 1BWKA 1FWBC 1OF6A 1QI4A 3WL1A 3N15A 3FXYA 3QC3A 1WXZA 2AGTA 4EOUA 2PZ0A 3I4EA 1I0DA 1OSEA 1EFZA 1DJQA 1CB2A 2HEJA 5DT5A 3LSCA 1TG7A 1ZPTA 1RCQA 5HNUA 1I6NA 4NXSA 4FOJA 3AU6A 1RQBA 4RX0A 3CUXA 2X7WA 1RHCA 3CS2A 1TCDA 1EGZA 3K2GA 1EPXA 5D8WA 4K8GA 1GQNA 2ISFA 2VZSA 5AHEA 1J0HA 3VA8A 1VP5A 5CC3A 1S5TA 3PFMA 4LUTA 3S9ZA 1KRAC 2QAFA 1CXEA 1B1YA 2OYKA 3VGHA 3IK2A 4DBUA 2OSYA 3A64A 3TSBA 4NI3A 2FYMA 3ZLFA 1E72M 4HZ7A 4L65A 2YCJA 3SEPA 3UWZA 1QPOA 4LEFA 4FNTA 2BHYA 4XZNX 2DFAA 4CN1A 4QQUA 5HUOA 4PCTA 1CCWB 3W6YA 1FCUA 3TYCA 1W9DM 3UD6A 4RCXA 1UR1A 2ALDA 1ISZA 2VOMA 2P3EA 4WEVX 5CPOA 4HNUA 3WMCA 5C9WA 3LB0A 4C6LA 1XRFA 4XZMX 2I17A 4QXIA 4PSPA 5E6YA 4JTQA 4ADUA 1G7UA 3GZAA 1YW1A 2YCLB 2ACSA 3PG9A 1NWSA 3NG3A 4RR4A 5FJJA 1JAEA 4AYGA 3KCOA 3SADA 1VIZA 5C55A 4QE5A 5IRPA 3RJXA 1C8VA 1AQFA 3OQEA 3NQAA 3UG8A 3GXIA 5L6UA 2OX1A 2Z1BA 1AL7A 4O16A 3O0FA 4PB4A 3ITLA 4A8LA 1KV5A 5JBDA 2Y89A 2F6UA 2WWDA 1U22A 3J7HA 1YDNA 3LDVA 3S46A 5MKGA 5BRQA 4M29A 4ZFMA 2QQ6A 4AHPA 5HMSA 1A53A 3P80A 1UR9A 3FJNA 3RLUA 5L9FA 1NQKA 3MW7A 3GU9A 2NQJA 2PSNA 1E6PA 3GNRA 3W2NA 1M7JA 3W7OA 1IGSA 2EO7A 7ODCA 3VAVA 2NX1A 3NA8A 2XM1A 1I8JA 4QJ3B 1N8FA 5K4ZA 3REQB 1BGAA 4UR9A 1D3GA 2QJMA 2OJPA 2WKGA 3CC1A 1W3TA 2GUBA 3QQWA 4EPKA 4D6CA 4Q8UA 4WJEA 3UZJA 3GC5A 1QHPA 3NZRA 2CLOA 4U33A 2HV5A 3MCOA 4JTJA 3CTTA 1Z7AA 4PL2A 2RGMA 2ZZ7A 4WDWA 1FCVA 4QRNA 1TE1A 4Q4QA 5DT7A 3B97A 3LI0A 5LIWX 2X1UA 4INFA 3WDQA 2Y7EA 5HINA 4N9CA 4LOCA 3SURA 3TONA 3UZYA 3VI2A 1V7YA 2FFCA 4O1EA 1HVXA 4HOWA 2AQVA 3U48A 3ZLHA 3GAKA 3SRDA 4C7FA 1EBHA 2VTFA 1M9HA 3TN3A 3CIVA 1KCLA 4IPPA 2W27A 2ZX8A 1C8XA 1O66A 4H6QA 4QJ5B 1JRBA 3IIVA 2PGWA 3MCMA 5KMYA 1TPFA 5EMJA 1BVNP 2O9TA 4H7ZA 4PSRA 1PBGA 2V3GA 1I75A 1GHRA 1MXSA 4KW2A 4M3PA 1GKQA 4IJCA 1WPCA 4LJ3A 5M3WA 3IV3A 3BURA 3S1UA 1NP0A 2WAGA 2Q71A 1IXOA 1TPDA 4QROA 4JYEA 1JPHA 1UMYA 2POTA 4S3KA 5CZJA 3ZR6A 3ZSTA 4URIA 2CKRA 1YXCA 2ODOA 4XZLX 4XD6A 1YE4A 1A4MA 1WDPA 1UWRA 2OGJA 3NVDA 5CBJA 3FEMA 3EGJA 1J2BA 1SFJA 4ATWA 1OYAA 2I57A 1UUQA 4IFKA 1N7KA 4BQ4A 4NL1A 2VD9A 4E2DA 4IQLA 2RKXA 2Y7DA 2PCQA 3AS0A 2FVLA 2JK2A 1FWTA 2F6XA 2PWDA 1R9XA 3A3WA 4FXRA 2HJPA 3CAVA 4K37A 4J28A 3VDGA 2CERA 1VCGA 4CCEA 1KXTA 3SFWA 2PAJA 3PPHA 3QQ0A 1EOKA 2YCEA 2VGBA 4C6JA 1XP3A 1AD4A 4F0RA 3VIIA 4FZIA 4KGLA 1WXYA 3A12A 2GVYA 5I07A 2E28A 2Z29A 2BG5A 3H2MA 8A3HA 3NFUA 1UP2A 1MZRA 1XPYA 1JQVA 4P8UA 2CLIA 4MOZA 1REQA 1RXOB 4GYFA 1ME8A 2GK1A 1EWDA 4CQAA 2CLHA 3QGKC 4W93A 3B9DA 3PY2A 1T99A 3R6IA 2NQLA 2YA0A 2HROA 3ZT7A 4RW5A 4PB5A 4GFIA 1W3HA 5HOSA 2XVPA 5CGMA 1XIHA 3EDFA 4F0SA 2L5HA 2GJPA 3MUY1 4TOQA 1P7TA 4M5PA 3M0YA 4JR5A 5LYRA 1E0WA 3DDMA 4ZODA 3UJEA 5JUVA 4UTLA 1J0YA 1H7NA 2VX4A 4KPLA 1PX8A 3JW7A 2YIHA 2WV8A 1NQ6A 2RDWA 3O1NA 5GNYA 3CYJA 4JCLA 4AXKA 2E77A 3OLGA 5HMFA 4DBSA 3QGAC 1SSGA 1EC8A 5IBXC 4GXWA 4L6HA 1VFLA 3HU7A 3IV8A 1GVQA 3WSUA 2YA2A 4DUWA 1VCFA 2FB3A 1FH8A 1OVDA 1JYWA 4L6DA 1G4EA 4DBDA 2C6QA 4RK8A 1E3XA 2PD9A 4GI9A 2XH0A 3V0SA 3URQA 5ECUA 1VJIA 3IGXA 1KM3A 3WJZA 1W1B1 1BYDA 4RXFA 3EEGA 5ABEA 5AYIA 3USZA 4WGXA 2GUYA 5A6AA 3HBLA 2ZUMA 4Y9NA 5TQLA 1E5JA 1JCXA 4LEQA 4J5NA 3KTCA 4IPJA 1EDGA 3AMLA 4OFCA 3W88A 3DG7A 2ZC1A 3RGTA 4WY0A 5FF0A 3NURA 4AX6A 4XISA 4KEUA 4B15A 1ZBKA 3CB3A 4P8WA 5HQEA 2B7PA 2CCRA 3FA5A 4P7RA 4WSHA 2W79A 3VXGA 4WD0A 4UFIA 2YPIA 2GJRA 3OHMB 4TXEA 1WDDA 3FW6A 3GM8A 4C6QA 3BLKA 4IIHA 1FH7A 3UVIA 5LNRA 2A3EA 4B92A 1RA5A 5LA1A 1K9DA 1UASA 2X09A 2NV9A 3HG4A 4GIEA 4TX9A 4YLWA 2PWVA 3AOFA 3T78A 3OEXA 4R9OA 2E25A 5IFTA 3TTYA 5BROA 1FWRA 1RV8A 2ESCA 5CQ1A 1KR0A 4L7ZA 4AZHA 2XIJA 4LAUA 3ZVHB 3SO7A 2Q8XA 3QHNA 2VZVA 4DY1A 4IFRA 1KXVA 1IEWA 3CQKA 1FQ0A 4FNQA 1JR1A 4QAIA 2INEA 4RE2A 3NQVA 4RDYA 4NI8A 3IJQA 1XIBA 1R7OA 3WJWA 1F61A 4H9UA 3KWXA 3G1AA 3KZPA 3DI1A 1W31A 2G5WA 4QDMA 3ALFA 5LNSA 1N2VA 3RUBL 5KTLA 3U3HA 4ICMA 3VOJA 2EJ1A 4BQ5A 1FWAC 3CJPA 2OLSA 4GY0A 3M0IA 2WMKA 4E5TA 1ADDA 3TR2A 2D3LA 3VIJA 3KL0A 3Q2DA 4KERA 1PZ2A 1V02A 1LROA 3LG3A 3NEVA 2D24A 2QYGA 4DXKA 4F2BA 4B5WA 4Q8VA 4ADSA 5MHBA 3BGJA 2VRQA 2X8RA 2EBNA 4US6A 5TF0A 4M56A 5EMKA 1A0CA 4F0KA 1E73M 3AYTA 1QMLA 1J6PA 1ICPA 3S83A 1XIEA 3LGDA 4Z1AA 3LCWA 4KWSA 2WCGA 3EBVA 5DANA 1O1HA 2R94A 4LAMA 3DFTA 3PVFA 4OBTA 3V1HA 4HOXA 1OT1A 3TQ0A 3UY7A 5CC5A 5A8GA 1C29A 2D73A 5I0DA 1YTKA 1CTNA 1GUVA 4QCEA 3EZ4A 1O94A 4F9DA 4PMYA 3UPWA 1XIDA 1TWIA 4R53A 3TA9A 3HQOA 2HMCA 3JZUA 4XZHA 1LT7A 5DBUA 1XD0A 2OKTA 5EMLA 1Z44A 3VE7A 2EPMX 3N2BA 3H24A 4GY7A 5H8MA 3AC0A 2FZ8A 2DJXA 2KZHA 3GR7A 9XIAA 4J3UA 1V93A 3GR8A 1QWKA 1GOIA 3N2OA 3RDKA 3KFTA 1QK0A 2J7FA 1VHNA 4HYWA 1I1WA 3DYOA 2WSRA 2CBJA 1H60A 3A47A 2VCAA 3GDTA 2VRJA 3L67A 4V1XA 2OQYA 1GQIA 3B9EA 2YZRA 3FJLA 3C4UA 3G3MA 2GQ8A 4J35A 1UWAA 1XL9A 3ARSA 3CWOX 3N9SA 2CHOA 1X8FA 4LUYA 3VPLA 3E5PA 1KM1A 2V3FA 1OF8A 2YFOA 2VC6A 3M5VA 4Z1DA 1U5VA 4ATDA 4K2SA 5IDIA 1CENA 3PAJA 3PP7A 1GG0A 1YDOA 3BMVA 3L12A 1J4EA 2PDIA 3N4AA 1YHTA 3LRLA 1CXLA 2YCLA 3AYSA 5AVHA 1PIIA 4AEOA 3QV8A 4RV3A 5CSSA 5F2MA 4FLOA 4IZGA 1FHLA 1OB0A 1TWWA 1AJ2A 3GDLA 2YW3A 4DJDD 1TWZA 3B9AA 4LALA 3ANUA 1H0IA 1GK8A 3I3BA 4J3SA 4FIRA 1EQCA 1EP1A 4JTGA 4KT2A 3GG1A 3NQ7A 1HJSA 4LS0A 4GK8A 1OM0A 3KAOA 5AFDA 1SSDA 3W7HA 4A2RA 3SSJA 1L6FA 4AY8A 5CPQA 3CU2A 3PBUA 4H83A 3THAA 1OX4A 4AD3A 4FXSA 1QTWA 3HMCA 2NLIA 1UUMA 4O1AA 5TNVA 3KLKA 1ISVA 1Q13A 4HNLA 1EJSC 2VEFA 1DE6A 2OU4A 1FCBA 1XM3A 4A05A 1GVIA 3AMKA 4BF7A 3GK0A 1JPDX 1PIFA 4ZEPA 4J3WA 3H4WA 3GC4A 1VIWA 1PB0A 4L61A 2X40A 1K3UA 3AUOA 3REQA 3H26A 3KBSA 5C7HA 3GVVA 4CU6A 5C7VA 4MJZA 3VZZA 2E1WA 1P4CA 4JL2A 3H53A 4G8TA 3SUWA 3PZVA 3PSWA 5DXYA 2J77A 1KGXA 2J9YA 4TUFA 3MCNA 1X39A 1ZAHA 1ZTVA 2KAUC 1Q6CA 1JFXA 2W63A 1A5KC 3BZJA 1YXYA 1R3VA 1OZQA 3T4CA 3QXBA 3UZXA 1EBGA 2DSZA 1XF0A 2JEQA 3GZ3A 4W4QA 1GYLA 1PX4A 3T6CA 1LOLA 4PUKA 2VX6A 5CJMA 3UU0A 3OYZA 4PMNA 4C90A 1D7KA 1SZRA 3IUDA 1H2JA 1TWSA 2FZ9A 2E0PA 3OVRA 4XD5A 4MB1A 5T26A 1PIGA 5A6LA 5C54A 4GINA 2B31A 1N82A 1AJZA 4C6FA 4DELA 1WE5A 1WXJA 4R27A 1EOMA 2GWGA 2V9DA 2PDFA 3ARQA 2ABBA 1JGIA 1LORA 1F4AA 2C1IA 4LC6A 2UY5A 1QNRA 3SZ8A 1ADSA 4Q6XA 3NXLA 5G2IA 2EHHA 4ZOCA 1YNQA 3G0XA 4XUYA 3F4NA 3CZLA 2DSUA 1W1TA 4PE8A 2DUAA 4Y9AA 2R1MA 4HOZA 3S8HA 1XH2A 3I65A 2DIKA 2FGZA 2RJGA 2WKJA 1OCQA 3LK6A 5A2BA 1GQKA 1TV8A 4XVDA 5HPCA 3W71A 3M4HA 3OTRA 2DH3A 1QDSA 4U5IA 3LCXA 2A3CA 1LZOA 1JCNA 1EJ7L 4HTYA 1Q6EA 4GBDA 4O57A 3N18A 3B8UA 1HL9A 1VB9A 2BOFX 4HPGA 3OBAA 2X0SA 3AHYA 3TWBA 4R7OA 3QFWA 1Q7ZA 2E6FA 4O15A 3TJXA 2Z1VA 1FFQA 4ZVJA 3U2OA 4MKVA 3GYEA 3W26A 1XH0A 1W17A 5E5CA 2P10A 1UCWA 4GZIA 1R2RA 3KDOA 1PCKA 1UBSA 2HNHA 1Q45A 2J66A 3SJNA 4B90A 3TCEA 1ESWA 4GI8A 4AZIA 3TXZA 4L6OA 4GJIA 3VNLA 4R85A 3B8SA 4MTVA 2GJLA 9XIMA 1J0ZA 4E3VA 4KFPA 3CUHA 2EPLX 2CLFA 3L5LA 4XTDA 4J2PA 1E6XM 3TLQA 2V3EA 3CXOA 4Q8PA 3S2NA 1RQHA 4UFKA 1J9YA 3TE9A 4HNOA 3T55A 1IT8A 2WVSA 3UEQA 5FA5A 4OIFA 2D2JA 4TVDA 1M7OA 3S47A 3SUUA 4IJRA 3SIZA 5ABHA 1BVZA 3BW3A 5HK4A 4DBWA 3CAQA 1F7BA 2Y7FA 3H4XA 2QR6A 3U5YA 3RO6A 1FY6A 3UXKA 3QZAA 5B7YA 3WQ4A 1FDYA 3LM3A 4AMCA 2G95A 3KHDA 1UG6A 3VMNA 3KBWA 3NDZA 2D1ZA 4CU8A 1CW2A 3OLEA 4C1NB 4QLJA 3W7CA 5F4WA 1ZBWA 1L6GA 2XHYA 1RJPA 3HPFA 3CLMA 5E93A 1DJWA 4LWWA 1QI3A 3M0KA 4NRSA 3NOEA 2WVTA 2PS2A 3BSGA 3WH5A 4J3TA 2IQDA 3GVGA 2FDSA 1FXQA 3WQCA 4C65A 1UD6A 3BZGA 4BQ3A 2O7SA 4LYPA 2PF0A 2C71A 3SW6A 1B90A 1SJAA 4O54A 4ONVA 2W5FA 3AHTA 2R24A 4DM2A 3W53A 3WBWA 3BH4A 1UP3A 1JG9A 3G6LA 3NGFA 3UXIA 5KZMA 4NU7A 4B5TA 3WZ0E 3WLQA 4US5D 3W76A 4J27A 4TV6A 1KCXA 4N42A 3GC2A 1LWHA 3AYRA 4LNYA 3ANVA 4CKQA 4KESA 1WV2A 1PTDA 1HTIA 4IM4A 4HVXA 1ZFJA 1DHKA 1T0OA 2BSLA 3W29A 1ZP3A 1KNWA 2H8XA 1NOFA 1XXXA 1R3WA 3LLXA 4KCVA 1E15A 2P8BA 4WZHA 1EJTC 4XIMA 1EZWA 4PODA 5EBUA 2WPGA 3T42A 4GVGA 3CEPA 4FS9A 3W22A 3ITVA 3R0UA 2HRWA 3G77A 1ZJAA 3EOOA 2CXEA 1BKSA 3KZSA 1T5AA 2NXGA 3CBWA 2YLLA 5I2UA 1GOOA 3M43A 4DO6A 4NIRA 3AXIA 1ZCOA 4HP5A 4W7WA 3VKDA 2DSVA 1IGWA 3KVLA 5C2XA 4LUSB 2V63A 5CZTA 4LVAA 1RY8A 1TPB1 3WNKA 3OZPA 2J13A 2OLAA 5G4EA 5G4WA 3FVDA 4MY9A 1XLBA 4AD2A 3EX3A 3G1SA 2FQIA 2YLAA 4AD0A 1IT7A 3ZVHA 1JGMA 3NPVA 3DESA 4F9JA 1IXPA 3SCUA 3RO8A 3D46A 3VD5A 2YYTA 1HNYA 1R86A 2OYLA 1AA1B 4D6EA 1BXNA 1VBRA 1UYQA 4DJEC 2B81A 4W84A 4EF9A 4XZBA 4WY0F 1DJNA 5HA7A 1W1YA 3W87A 4B91A 3W7JA 4RL3A 3SQSA 3KOWA 4PUJA 3W28A 2XIIA 1DORA 4W7VA 4RW3A 3ZJ7A 3UPBA 4GKTA 2ATSA 4GBUA 2BMBA 2DZWA 3A5VA 1UD2A 3B0UX 3LCHA 3DFPA 3N2CA 3OYXA 3VFCA 2IUZA 4MJ2A 2XFRA 5M03A 3GTIA 1JYXA 3FKKA 1PKNA 3QTPA 4DB7A 3BLFA 1MO0A 2XISA 4EPDC 1XLGA 4PEEA 3QHMA 3V1PA 1W5NA 2XINA 5HMDA 2BWGA 5K2ZA 3LEPA 4PMUA 3IGUA 1KO0A 3R11A 5BMXA 1MQRA 1LTDA 3IVUA 3R8RA 4IG2B 5AN7A 3C8FA 1OHLA 3OJGA 3QM3A 4PMRA 4AIOA 2E5BA 3HO8A 1XCXA 2VEKA 2WJEA 5A6TC 4BI7A 3T8QA 1Y8BA 1BGGA 3OQ8A 3AXMA 2PDQA 4HSNA 1H7PA 3TJIA 4UXDA 2PF8A 5LNUA 3HM7A 4L64A 2XSAA 1V6XA 3VM7A 1UD4A 2PTDA 3BOXA 5JXQA 3QMTA 2DORA 3BOFA 1V0NA 5G1TA 3ISIX 2IKHA 2YZ5A 1QNOA 4HK7A 4AF0B 3WQEA 2WNZA 4AIUA 1TJ0A 1NDYA 3QLDA 4HCDA 3QJAA 2IKJA 1SFTA 4QNEA 1UPPA 4HB7A 3P84A 4PCSA 3A4XA 4JIIX 5E70A 4D1IA 4BS0A 2Y2WA 1B2YA 3MP3A 1CB7B 1CZ1A 5M17A 3VX1A 3VOGA 2PI6A 2TYSA 3H54A 4QLKA 3N6HA 3SCRA 2V2DA 1HP4A 1XX1A 5I24A 2ACRA 5FL0A 2BP1A 5FJTA 1OC5A 5IXEA 2OLHA 9CGTA 1DIEA 1GVSA 3QHOA 2G97A 1SZGA 1X1ZA 2OWXA 1Z3NA 2OO0A 3ID7A 4Y90A 3PG8A 1V5XA 1CIUA 4NX0A 4XKMA 1S1PA 4XG1A 4ZQMA 1XDLA 3BQ5A 2CW6A 1M6JA 3B0XA 1XYMA 1R3RA 4KWUA 5GJPA 4EXBA 3KL3A 1U5JA 4OOZA 1RY0A 3M7SA 4QEEA 3U4FA 1KFWA 3NJ3A 3EDEA 1SFSA 1T8QA 4CNSA 1YDYA 4QISA 3RN6A 4MNKA 3WBXA 4R9XA 1UZDA 3DEQA 4BWLC 1LG2A 3PC0A 1EHAA 3U7BA 4DUOA 1MEIA 1L2QA 2H9AB 1XCWA 1KRCC 4FX8A 1PWMA 1O4UA 1SPQA 5CSRA 1QPRA 2QCDA 3BL3A 3ARVA 1Z42A 4C60A 1IWPA 1DIKA 1SUXA 3IPWA 1TX0A 1K8CA 3G6MA 3WDJA 5F4XA 4GHRA 3GAYA 1XQLA 4KFOA 2WZMA 1F8MA 2OZ3A 4KRUA 4W86A 3PPGA 4IXXA 1P5BA 3B8DA 5FAJA 3NPWA 1AMKA 4DPPA 4PTWA 2OCZA 3E12A 5ENLA 2QPSA 1MRQA 4QITA 5SWUA 2OZTA 4P5UA 1W3IA 2WSYA 5BRBA 2WC4A 4OVXA 1KFBA 4OKDA 1BTMA 5FF3A 3L2LA 1E51A 4LBRA 3WNNA 4C6OA 2YYUA 4IMEA 5A95A 2DV0A 3E6EA 3CWHA 3WF4A 2VWSA 1PV8A 4HN8A 5DXXA 1ICSA 4L1WA 1QOQA 4NZ5A 1Q6DA 5BW6A 2F38A 3JZEA 4X2RA 1MW1A 4LVFA 2OQLA 4MMWA 4MPKA 2VRKA 2XFFA 2O92A 4NXKA 1FWEC 3K13A 1B30A 3PBMA 3QOMA 4UMCA 1VFTA 2YCIX 4BI6A 3EWWA 3W83A 4JAWA 4ERIA 2XWDA 4WLCA 4H8VA 1OGSA 4XKYB 2Y7GA 2FHCA 3I7SA 2VDHA 3HB9A 4C5YA 4AVOA 3QOKA 2DQXA 4C6IA 1OFRA 5LKYA 3PZ9A 3ZJ8A 3WJYA 3IJ7A 4OBRA 3ERPA 4MZYA 2ATMA 3ZMRA 1NWRA 4KWWA 3W2LA 3N2MA 1T8XA 1TJ1A 3HG5A 3W75A 1V3IA 4V33A 3ZFHA 3T0BA 5DEZA 1AFSA 4IQEA 4UBPC 2VCBA 2X30A 2YDAA 4K6AA 2O4MA 4ECLA 4QBXA 3LCIA 1EC9A 1L0PA 3LHTA 2Z27A 2QPXA 1VHCA 4HD5A 3SN1A 1AH4A 3MDWA 3PZNA 4QS6A 5I09A 3RX3A 3R94A 4N02A 4GPNA 4UC5A 3BLLA 5IBXA 4WDTA 5LGXA 2Y85A 1XIFA 4EXAA 3LN3A 3CZ8A 2J8GA 3EDJA 4JX5A 1S5VA 3ZSSA 3VABA 2O9PA 3I6EA 3KL5A 3M16A 4OECA 5BXPA 2QAPA 2WJDA 2BS9A 3MJMA 3O6DA 1C7SA 4DM1A 3OG2A 3N19B 3H8AA 4DJFD 1W9XA 5FIPA 2VEPA 4DX3A 6XIAA 1DV7A 3FA3A 4E3TA 3TC7A 2FFIA 2ZRUA 2J7HA 4M7SA 4YTUA 4GQGA 2QCHA 2VFEA 3AICA 1OX5A 2E7FA 3P81A 4MLRA 4JPGA 3GXMA 3GG7A 5DO8A 1JAKA 3GFYA 1GJWA 1W5OA 3MMDA 2CWXA 4M6VA 4KIEA 4U2ZA 4EE9A 4JHZA 3GKAA 2G50A 1GG1A 2IPWA 2NT1A 3AHVA 5D38A 1ALDA 5JH1A 4GQQA 5LIUX 4JIRA 1GYNA 2J7BA 2QIWA 5IOBA 2QUTA 4MWAE 3P3BA 3V4BA 3THQA 1WZLA 1Y65A 4PUEA 3POCA 3SRHA 5D2VA 4IPLA 1DWGM 4GX8A 2PTZA 1OWQA 5HNRA 3DYMA 1S3HA 2VJXA 4PUUA 4I6VA 1W37A 4XWUA 3P82A 2OEKA 2HS6A 1KM2A 2C18A 1A50A 1TPUA 5CSYA 4EAYA 3ME3A 4C1NA 3WLIA 3QR1A 2RHGA 3MB9A 2TAAA 2W62A 1WOAA 3N17A 2C0HA 1QBBA 3V35A 4X9SA 1ITQA 1PCWA 1I45A 1UWQA 4RE3A 4V27A 4DNMA 3CV1A 3UESA 3GWQA 5BCAA 3KBVA 3SSZA 3UZ5A 3NQEA 4PMOA 5T9BG 4PGLA 4WR3A 1V3KA 3MYOA 5CBIA 1WAWA 3H2FA 4Q8OA 2FZDA 5BRPA 3Q65A 1QT1A 4FNSA 1GGOA 4HMCA 4I9MA 1T96A 2CESA 3VKKA 4MSSA 1JRCA 3CIXA 2ZRZA 4GUHA 4PMXA 1JI1A 3VDCA 4X2PA 1A4LA 4TX8A 4H8NA 5CKSA 1VFOA 3N4EA 5F2GA 4AWSA 1ME7A 3PUGA 3SY1A 3IANA 1PS9A 4E0CA 2ABAA 3T9PA 3V75A 2C0AA 1TVPA 4Z1CA 3GG8A 5PTDA 2XM2A 4FNRA 3D3FA 2ZICA 1YTDA 1V79A 1VEPA 1W9BM 1UWUA 4WHBA 4H9VA 3AU2A 5FSEC 1F6PA 3VIKA 4B2DD 2WLYA 1OFQA 3BSHA 1FFRA 2PU1A 7TIMA 4V15A 4JIEA 3INPA 3ZIZA 3FGCA 4IQDA 3BJTA 1F05A 3H55A 5LA0A 4HNCA 1Z6KA 2FH6A 3WK2A 4WRHA 3UWUA 4LUSA 3W0KA 3W7NA 4JCMA 4A29A 3LCLA 3QMSA 3R2GA 2GSJA 1XLHA 4HTBA 1E0XA 1UWIA 2WJFA 4L1XA 4B3KA 4TMBA 4OV9A 4L4PA 3LLDA 3VC5A 1RD5A 2Y62A 4KGJA 2FIQA 3H7VA 4IH3A 1X6NA 4EVZA 1VYPX 3QVQA 3MWAA 4RE0A 4IP7A 4JQAA 3WFZA 2IPGA 4JNZA 4OTKA 1D7FA 4PA8A 3SAZA 2PBGA 1TYGA 2PLCA 2G8ZA 2WPBA 4GZEA 3LMYA 3B03A 2AQWA 3KHJA 1NWUA 4QNWA 3OGVA 3GH5A 5T91A 1G5AA 1XBZA 4UOZA 3DZ1A 1JUKA 3L68A 3GXPA 3CMJA 1NELA 1OY0A 1ZJIA 3TJ4A 4CEUC 2ZBTA 2RDXA 3H2OA 3WQOA 1ZZMA 3SCQA 3ES8A 5AY7A 4A6GA 2GJXB 3NQBA 5FSDC 4JTDA 3EA2A 2CNCA 4D6FA 1E4MM 4CU7A 1IZCA 1I2OA 3D47A 3KEHA 2ISSA 4YVVA 2XZ9A 4A3YA 4U5KA 5DCDA 1JDAA 3PB2A 2AL2B 1BYCA 2Y63A 1NFBA 2PTXA 5E9XA 1OK4A 1UMLA 2AAMA 5DMLA 4UTHA 1H5VA 5HNTA 2NVCA 1BAGA 3FCPA 2Q8LA 3BV4A 2BOEX 2IW0A 1D8WA 2ZTJA 5B7ZA 3DHDA 4P8VA 2YKKA 3DFNA 3MO7A 1Q85A 3M64A 3WMSA 4XIAA 3P5YA 1H61A 3RXZA 1JCJA 5CEWA 4KWVA 2EG8A 3EOLA 3W1QA 2V69A 3IGHX 4KS0A 4MWAD 2RFGA 1GVEA 3T7VA 4JY9A 1ONEA 5BMWA 1GWJA 2J79A 3R8GA 4A8IA 2VX5A 5TD4A 3L23A 3COTA 1MI3A 4AF0A 4DWDA 2QDDA 5JBEA 3WBAA 3CZEA 4R7WA 2C15A 1KFCA 3BOLA 1M68A 4C7GA 3S2CA 4M19A 3MSYA 3QV9A 4AZBA 8XIAA 4GVFA 3LPGA 1EC7A 1WZMA 2Y5EA 1ZNNA 3C0QA 1DQXA 1CXIA 3TQPA 2Z6IA 1W56A 2QEZA 1X7FA 3GDBA 3CZJA 1IXNA 2QVHA 3BK0A 5K9XA 2ASHA 3WLJA 4Z2KA 4E6MA 3F5JA 3WQVA 2Z4GA 3VGEA 2J25A 1E43A 1A5CA 1TMHA 3AXHA 3E96A 1R30A 3RR1A 5C71A 5D09A 4UQBA 2WBKA 3CM4A 4HT3A 3KOFA 3UERA 4WXYA 1NARA 3AHXA 4E2BA 3KBJA 1PSCA 3SBFA 5XINA 1F6KA 3WLMA 3UGRA 2YL8A 3LENA 2QJHA 3HF3A 3AIBA 3DFOA 5AHLA 1L8NA 3BAXA 1XUUA 1TREA 3FJ4A 3K8MA 4LUTB 2ZFAA 2H9AA 1VBHA 3T05A 1VQTA 2Q6ZA 3T4WA 2WJZA 3NL5A 4E2OA 2ISVA 4FSAA 1GKPA 4IIBA 4PRWA 4R5EA 3B8TA 3GQYA 2XH2A 1F3XA 5EMUA 2OGYA 3BCJA 5HANA 5AYXA 1TTIA 2C91A 1UOZA 4RLIA 4TTUA 1OYBA 3GIPA 1Z41A 3T40A 3O63A 4NUWA 2GJNA 3MBFA 1W1PA 4JOMA 2C16A 4GOAA 1JZ6A 1TO3A 3LQGA 5HAOA 3N04A 2X1SA 5D2YA 4FLSA 4Q8MA 3RNDA 2HVOA 1SR9A 3ZJ6A 5G2HA 4ZGYA 2TMDA 3H4GA 1NJJA 3W01A 1WDSA 3UVAA 1H41A 2HK0A 4QGCA 1MMFA 4YTQA 3W24A 1BF6A 1XDJA 4GC4A 4PMZA 1MEWA 2C14A 1JULA 1JZ7A 3UJRA 3L4TA 4CNTA 1XH1A 5H2ZA 2CITA 3V0UA 1Q6GA 4W9TA 1OYCA 3WQ5A 1JF5A 1OZMA 3I68A 4K8HA 4N7QA 3F5LA 1VKFA 4S3CA 4IWWA 5F7UA 4Q4PA 3OGRA 2OEMA 3FA4A 3M0VA 1G9HA 4MUZA 1H49A 1UH4A 4ML9A 4NNAA 4ZQCA 3NZPA 4XKYA 4EANA 5AYYA 3KM8A 2UY2A 2P5NA 1A5OC 2YJQA 1E1CB 1TV5A 3UXAA 5A8PA 1O68A 3W27A 1FP8A 1NY1A 1TTJA 1EGVA 3R0DA 3PFRA 4GC3A 2BZNA 1WZKA 2PP1A 4NAFA 4JQ1A 5XIMA 1A49A 3W7MA 2G4JA 5A6KA 5CPLA 4W8BA 5J5RA 4MB4A 3ONBA 2R82A 2CLKA 2HPMA 1U33A 4NJGA 4TV5A 1QJWA 1FRBA 3IVSA 3WLLA 3LZ3A 2VL4A 5REQB 4DWSC 1GJPA 2WKLA 4YCOA 4LTSA 5AC7A 3QC0A 1W0MA 2GFTA 2IMRA 3P2VA 3LBMA 1QNPA 2FTPA 3C0LA 1N8WA 3IEBA 4QR6A 3ITOA 3UNDA 2F6KA 3GKFA 4AD4A 3FAXA 2I9EA 5LHEA 2R1NA 4ZR8A 5FKYA 2Z1XA 2FMNA 1DOSA 3EMZA 4Y9PA 3QN3A 4XBSA 1WKEA 3SDOA 2YXOA 2XN2A 1Z8AA 4FP1A 3M0MA 3CO8A 5A6BD 3VMOA 3S9YA 2CFFA 4QG9A 1PL9A 1DE5A 3MZ2A 3U2CA 2P1FA 1P6BA 1RK6A 1JFHA 2OO6A 1E9ZB 3N13A 3EXRA 1U30A 3LPFA 3U9IA 1KFJA 1XD1A 3LXCA 3W4RA 2ZX9A 1BTCA 1EA9C 4D71A 2BNJA 3DOPA 1GYMA 2YL5A 4OU1A 4FR1A 3GXTA 4PB3A 1UQYA 2VC5A 4QCFA 4DHGA 1JIBA 2V82A 4MFEA 2F9RA 3CL7A 4GG9A 3W70A 4ZENA 4RNIA 1XLDA 1HO1A 2E6YA 4UTFA 4RPPA 1QVBA 1AQ0A 2WLZA 1UH2A 5FEWA 1OFEA 2BBFA 3C0JA 3TTOA 4ZO6A 4ZFCA 1W2PA 3GXFA 3LHVA 1BRLB 2WZHA 3U57A 3WKZA 1TTQA 2G3NA 1QWGA 4AMAA 8CGTA 3MMTA 3LHZA 4J3VA 2BGQA 1POKA 3TAKA 3LYEA 2CLEA 4CD4A 3EKZA 4CD6A 3XINA 3P67A 3M07A 4HU4A 1ZS2A 1J11A 3MA8A 4HJWA 4CD5A 4HCHA 1I2RA 2I5IA 3ZR5A 4N9DA 3O3RA 1TB3A 4B3ZA 4WKHA 2WSPA 1UZ4A 3TX9A 4AZ6A 1VGAA 4B5VA 2ZRVA 2IQTA 3G1DA 4DJEA 3V18A 5CPNA 2Z26A 4UR8A 3GB6A 3EWCA 5FAGA 3NAVA 3S1WA 3UWWA 1UOKA 2A7RA 1WDRA 3W7RA 1GJUA 2SFPA 3CGTA 3HV8A 4QE1A 1TMLA 3M0ZA 1V8EA 4REQA 1WQ5A 1F5ZA 2A3AA 1K7FA 4E4UA 3ZJKA 4M7TA 3F7JA 4B3LA 4HU8A 1PTGA 1XIGA 1JCYA 3M7WA 3IAPA 1OQFA 3QGVA 5LGZA 2CHRA 2VNCA 4WX2A 2ACQA 2BY3A 3UWQA 1HIZA 4NJJA 3N3TA 1REQB 3PPCA 1OFPA 1XRVA 2FMOA 4Y7EA 3BQ6A 2HE5A 3ENLA 3AIEA 3HQNA 3WK3A 1W3NA 3RCNA 1XISA 1POJA 2XIOA 4JTUA 2ZRWA 3PAOA 4PMQA 3VGFA 1E6ZA 3FV9A 3VO0A 1GVYA 1DJIA 3G1RA 4DF1A 1MW3A 3TFXA 1SFLA 1UC4A 2QMJA 2A3BA 2BGNE 1VLWA 4HYVA 4GYKA 3BG9A 2W4XA 1EIBA 4ZSUA 5J04A 3MSDA 1ME9A 3LXBA 3SCOA 5FOOA 3MHUA 3NZ1A 2X1IA 4I8DA 2PGEA 5F4SA 2I7GA 4DYEA 1T41A 5HBFA 2VR5A 1DP0A 1TWDA 3H12A 4JNYA 2Z1WA 3NM3A 1XIJA 1KKRA 2PRHA 2ALRA 3TTSA 3ITGA 5CH9A 1NSJA 2UZ9A 2CC0A 3A21A 2VR4A 3G1YA 4Q7BA 4ROQA 4O52A 5EU9A 1MFVA 4J2MA 3A9IA 1VYRA 2O9OA 3H22A 1LQ0A 4I9AA 3A13A 1H11A 3AXXA 3URBA 5KZEA 3TMQA 4NY2A 1JF6A 3APTA 2FB2A 1TPH1 1E9IA 1BYAA 2ZZ2A 1J12A 5K7JA 2EPHA 2FZMA 2WMJA 4KH2A 5I77A 2FKPA 3EWZA 4QLLA 5A69A 3C86A 4PFMA 4AY1A 3WQPA 4JXCA 4ZTYA 2HQAA 4HU0A 1KB3A 3U4AA 4GQ0A 5BWFA 3OIHA 2VO5A 3PZOA 5CGQA 4O10A 3W23A 3V36A 3MT1A 1RJRA 2I5GA 2GJXA 4WY0B 3WDHA 1R8LA 2VVSA 3CZGA 1AUSL 1WOBA 1YLVA 4S38A 2V2HA 2W3ZA 4PUWA 1YADA 3LMZA 1US0A 4JDYA 3UT0A 3GRIA 2HVMA 3A9BA 4BWLA 3KVKA 4OV4A 2D2OA 1B3XA 3L0KA 8XIMA 3NDOA 5E0FA 3F2DA 3FLUA 3MKCA 3CMGA 3WF2A 4BZYA 1VCVA 2XVGA 5BOOA 1TRIA 4DZAA 4JN6A 5IDZA 3WLNA 4LRTA 1EXBA 4U31A 1AD1A 3SGGA 2V8ZA 5JIPA 2ZUNA 2OTDA 1F6YA 3BSMA 3A6OA 4M6PA 4WQ6A 3WLPA 2INZA 2O7QA 2PODA 1HKWA 1RK5A 1Q6RA 3FS2A 1QHOA 2DT3A 3DERA 4L4OA 4D8AA 1VEOA 1TE6A 4BF5A 3TZFA 1OGBA 4NF7A 3SI9A 1KTCA 3AHZA 2OR2A 2VD8A 2YSWA 3NSNA 1LRQA 5AHNA 4E8GA 4AYSA 1AJ0A 3W1LA 3EAUA 4NSBA 1L6WA 4U3CA 5RUBA 1B54A 2ZOXA 1OBAA 3EPOA 2V30A 2I1OA 1C3FA 1JPIA 2YW4A 1QU4A 4HMEA 1X96A 4HGXA 1CBGA 1YPIA 4CN6A 1ZBVA 2VFGA 3AJXA 4AY7A 3PBWA 1HZYA 1MUWA 3OVPA 4QTGA 1RBLA 4NZCA 1X7IA 4FX6M 3F4VA 1EEXA 3R8HA 1FDZA 3PBVA 3H2NA 1KQYA 1K1DA 2FJKA 1F2JA 4C6PA 1B3VA 5E0CA 4YWSA 3C2EA 3KOXA 3B8WA 3H21A 3L4WA 1DL3A 4ZTXA 3P62A 3M9YA 2QNEA 4H3DA 1DXFA 1PDZA 4F4RA 4RPQA 2G0WA 1UWSA 1E0UA 3UWVA 3BGAA 2R1LA 3QF0A 2BVYA 1SM9A 7XIMA 1LCOA 1XKYA 4L9YA 1EB3A 1OK6A 4YS1A 3RM4A 3GVRA 2BVTA 4AX7A 1FKXA 5KETA 3NQDA 3ARRA 3IGSA 5E6ZA 4EF8A 4AB4A 1Q7MA 3NO1A 4DF0A 3I7QA 5BXTA 2WQDA 2DIEA 3Q37A 2Y8KA 3UFYA 4DEFA 4KRTA 5BU6A 1QO2A 1S39A 2J62A 1VFSA 3NIYA 2AAAA 3CV7A 1K4HA 3B40A 4DWSB 4KEVA 3AIVA 2JEPA 1HL8A 4IMAA 1QPQA 1RZMA 1ZL1A 3IJIA 4IX0A 2PDNA 3LHUA 1TIMA 3CNYA 1TPWA 3GNXA 4DUVA 2QUMA 2C79A 4MY8A 1XQKA 3FDKA 2V5LA 5JVLA 3E3HA 3UG5A 1WAUA 3SRKA 3HFTA 3URAA 5GNZA 1FXPA 3OLIA 2ZE3A 1P6CA 1LLOA 3W7PA 2XWEA 1TJPA 4NZJA 3N2TA 2Y4SA 5KEZA 1LBLA 3S6DA 4UFLA 1CGYA 4ICNA 2PMQA 1HFBA 4RZ6A 1XLFA 3LPPA 1W3JA 1OJXA 2GGIA 2FGLA 4UIOA 3WQDA 1H63A 3IVTA 1WKFA 4FX7A 2NVDA 2VEGA 4JICA 1XLMA 5GVJA 2PLMA 3EDDA 3PM6A 3MY9A 3DBPA 4Z0SA 2GOKA 2DZXA 2E4TA 3OP2A 4JIHA 4JN8A 2WNWA 3QSTA 3VNIA 2RH9A 4I9JA 4GIAA 1FX6A 2DJLA 5A6JA 4N9BA 1OX4B 4FEZA 4R34A 2RGLA 4QSFA 4CNOA 2R8WA 1Z69A 1RP8A 1G4TA 2WSQA 5I02A 3VGBA 2Z28A 3K4DA 4PMDA 3ZQ9A 4E4PA 4UNIA 2Y5JA 5D32A 3L4YA 3EOEA 4D8ZA 1E1CA 3TA6A 1H7WA 3AAMA 4NAEB 4JEJA 4YYFA 1F4HA 2HBXA 2D20A 4LVGA 4MLJA 3CHCA 2ZZ6A 4MDOA 3NQGA 1MNZA 2G3FA 1OFOA 2UY4A 1GVRA 4F2TA 1OCJA 3VOHA 4RKAA 3KX6A 4BK9A 3ABXA 2NV2A 1J01A 1NH6A 3CUJA 3L4ZA 5U7SA 1IEVA 4H7VA 2F7FA 1PEZA 3FIGA 5D2WA 2OWCA 1WUEA 3PZTA 4Y9OA 5REQA 5AECA 3T8LA 4PTVA 4DO4A 4XSLA 1VRDA 1S2CA 3ONCA 3BLPX 2PWEA 1DXEA 1KXQA 2FTWA 4PCPA 5A3HA 3H2AA 3WBEA 1VFHA 2EKCA 2BY1A 3K1GA 4DYJA 3PNZA 4HHLA 1WB0A 3QEZA 1JCMP 4YNGA 1QBAA 1GTHA 3I10A 1D2KA 1DJGA 1YX1A 1PKMA 4NHVA 2D69A 3IAQA 4C6KA 4DAIA 5K4XA 4DZ5A 2DVUA 1H4PA 3MWCA 3JUGA 4IP4A 1CWYA 3IJ8A 3NL2A 1QUMA 2P8CA 3VCRA 2D0GA 1ISYA 4KCUA 4D6JA 3PTMA 4JY8A 1TX2A 4TVCA 2GWNA 4ENLA 1V02E 5G2WA 3T0TA 2PWFA 3HTWA 2ZUTA 1JCTA 1BFNA 1R2SA 4A22A 1CPUA 5AHMA 3FK4A 1DPMA 3GHSA 5CCZA 4AHQA 1A5LC 3U2EA 3KRUA 3BG5A 1H1NA 3BO9A 2WSKA 1PWLA 3CUIA 2QCEA 1V6VA 5C9UA 3L2IA 1BRLA 3GNPA 1HN1A 3IJ9A 4XTIA 1FHUA 4MGGA 3HG2A 2GUUA 5FCZA 3PANA 3TXVA 4XBJA 5TBOA 5HNNA 1KTNA 2ZYFA 3NZQA 1SO4A 4ORIA 1GOKA 1BWVA 1J6OA 2OMAA 4GZJA 3NCOA 1FWSA 1XYLA 3ZXWA 1FBAA 3PZUA 4S3FA 3VIGA 4MAVA 2ZC8A 4L4LA 5DMNA 3VOFA 3EWDA 1ZY9A 3W6MA 1KGWA 3EKGA 1D3CA 4H6KA 1ZAJA 1O12A 3H7UA 3PJUA 5DN1A 2AOSA 3GNOA 1MWOA 3AWOA 1DYSA 1K4GA 4LGXA 3TEVA 3P60A 2OOFA 4X60A 2B4GA 2W0UA 3S1GA 1VBJA 1AMYA 1P1MA 4Q7NA 1LLZA 3LS9A 2A1YA 4ICCX 3RLGA 3VILA 1YE6A 5AZ0A 1E1EA 1J2WA 4UTMA 4O0ZA 1ICQA 1G67A 3N73A 4XZWA 2WQPA 5JBFA 1YNYA 4TU1A 2HPIA 4AISA 4XB3A 4ZMGA 1FP9A 4HHPA 1E4LA 2Z1KA 3O2LA 3PBYA 2OVLA 1VRXA 4YJ5A 4WDUA 1FHVA 3SGZA 3CEUA 1FWHC 1ZP4A 4OUIA 1V6UA 3O0KA 4O8AA 2AKZA 4CCZA 2GSHA 4ERGA 1DWIM 2IKGA 3E74A 3AIQA 2QKFA 2PTYA 1AZ1A 4GVIA 1S38A 3GS6A 4A8NA 4Z0JA 1S2TA 4YIWA 3WQ8A 1GPFA 1TZ9A 4DPQA 2GVGA 1B3WA 3TYDA 2QGYA 3NWRA 4M81A 3SCSA 2JIEA 2HVNA 3W1MA 4ACZB 5T9CE 4FB7A 3WD3A 2X42A 3KBMA 1PHWA 2CWNA 3M0HA 3M1ZA 3LZ5A 4Q7IA 1SW3A 5FF2A 1H62A 5HJXA 3TAOA 2TODA 4S3GA 4FA3A 1DJHA 2J9XA 4GIRA 3V5FA 4XZIA 2C8NA 3N6JA 1W1ZA 3UZZA 2DZUA 1CEOA 5G4HC 3C3UA 4XO6A 4UFHA 1VPXA 3YPIA 2PA6A 3L7RA 1EDTA 1Q6OA 1KM6A 1DBTA 3WQ6A 3CHDA 4CD7A 2D2GA 4K1GA 4AD5A 3O06A 3DYPA 1IF2A 3W02A 3WL0A 1X6UA 4UCGA 1C8YA 2PDHA 2ZDRA 4LYRA 1YDVA 1HG3A 5HWJA 3S2LA 5AYZA 4FNPA 4W7UA 3GU2A 3GXDA 4K68A 2NXIA 4PTDA 4O28A 3BAJA 2ICSA 3JR2A 1HKVA 1W32A 4HA1A 3CIWA 1IHIA 3QH2A 4QJ4B 4F66A 5D9PA 4H1ZA 3SCPA 2Y8UA 3GW0A 4LCRA 4D6HA 3U8GA 4PULA 3HJZA 4JIQA 4ZOBA 1KRMA 4HNTA 5AOUA 3HA1A 4AQLA 1K9EA 2OSXA 4I7WA 3RF9A 1FUYA 1OIMA 3BTNA 1UKQA 4IGSA 4YYCA 3G0SA 3KLLA 1C93A 2PDLA 4JEQA 3P8IA 5A1AA 3GU1A 3LY0A 4RE4A 1EIXA 4RZ4A 3Q58A 3B8VA 4UTUA 4A35A 1E70M 3VD7A 3BXWA 1E3ZA 1R3TA 4NG3A 1EJXC 3O07A 4YU1A 2CHNA 1VH7A 4CD8A 4B5XA 4EIVA 3W1UA 4NILA 1CGVA 3WF3A 4UMAA 1AL8A 1UROA 1AG1O 3ZOAA 2V6AA 3WF1A 1U1HA 3V16A 2YFNA 5D33A 4N9EA 1QI2A 3A4JA 3ABOA 3H2CA 1CXFA 5K9CA 3AZSA 1AW1A 4OJYA 1SGJA 3VNYA 5EMYA 3FDGA 1FWCC 3WLKX 3EPMA 3QKZA 2VC9A 4AEEA 4TMCA 1IXQA 2QJNA 1UKTA 4H41A 4Q4OA 5HUPA 2JGYA 4P7OA 4PMJA 5E0KA 5BWAA 1Z32X 2H6RA 5BOEA 3A4WA 4W8LA 3TC3A 5C8BB 5HXMA 4O17A 1VS1A 1Q4WA 1XLKA 4UQ9A 4LY8A 1EJVC 3KS6A 4ZB0A 1PPIA 3XISA 3OLDA 4LAKA 3VNZA 2XN1A 1X6LA 2XGBA 4K1WA 2Q3RA 2W91A 1MSSA 2BTMA 3GBEA 1SYTA 3U7VA 4MB5A 3ARPA 1J96A 1E6QM 2XFYA 4W8AA 1HP5A 5HMEA 1K8ZA 3CAKA 1H09A 2X0YA 1X1OA 1OCNA 4AC7C 1VD6A 4HSOA 4WDXA 1ODUA 1G0CA 5GQBA 4MKNA 1XI3A 4ILSA 4S3JA 2IPJA 5D04C 3AUJA 4JN7A 3WUGA 3DUGA 3MI3A 2X7VA 5CPSA 1XBXA 2ZE0A 3AMDA 2UBPC 1XG4A 4QAWA 4C6CA 3EWXA 3S5SA 3OIXA 5JIWA 1SW7A 1UR4A 4DWSA 1JZ4A 4H8HA 3GE7A 2P88A 4BF9A 4FXFA 1V4YA 5H91A 1I1XA 1O5XA 1L2UA 3DHPA 3GTXA 4XBKA 4XO7A 1TR1A 1IR1A 1YIXA 5DMYA 2EPNA 4G9PA 3AMGA 4UQDA 5KZDA 1OIFA 1HJQA 3G18A 4DJDC 1TFVA 3BARA 3C8NA 2QDGA 3F4DA 3TR9A 4UFJA 4JTLA 4AIBA 3HN3A 3ZT5A 4HQVA 5CJ5A 2OKOA 5CAKA 2HXUA 4GJ1A 1K77A 3EPNA 4H04A 4JIPA 3QZEA 1EGMA 1UIOA 3ABQA 3RCYA 2J7DA 3DFYA 4DNHA 3TOYA 3A23A 3LUTA 1SJBA 2YA1A 3GTFA 3NQMA 2V81A 2FH8A 3OZOA 1GQJA 4TQTA 3P5ZA 4CCCA 4GVHA 4O19A 4CLMA 1TKKA 2ZX5A 3W1NA 4UNKA 2VVNA 1V51A 3RJYA 4Q8WA 1JL8A 2QCDB 2YR1A 4MVAA 4A2SA 5HR6A 3RYSA 2PGRA 2PU0A 1LJYA 1NOWA 4GQBA 4OZOA 2Q8ZA 1O6IA 4JZ5A 1G4PA 1RALA 4D6GA 4GLEA 4NAEA 4O1DA 1GEQA 3VIOA 3NL3A 3R12A 1RP9A 3VVGA 2UY3A 3P8JA 4NZFA 2J6XA 6TIMA 4UTIA 1W5MA 4IF2A 4CNPA 3RM9A 3DFSA 1LRNA 1T7LA 4MF4A 4RNFA 4AIEA 5BXSA 1E5NA 3AZTA 3R25A 2C13A 3DN5A 1TUXA 4UQCA 4L9XA 3GYCA 4DUXA 5LNVA 5EBAA 2MNRA 3OODA 3ORWA 4TVUA 5HR7A 4DN1A 2J7EA 3BDKA 2WOQA 3VD3A 5BU9A 5KINA 2HTMA 1GOWA 2JKAA 1A3WA 4KIRA 3NO5A 3HGRA 3TLLA 1OD0A 1LT8A 3HMJG 1KFKA 1J0JA 4LS1A 4UTWC 3K1DA 3W3OA 4HPJA 1A5UA 4DBEA 3CUFA 3JU2A 3GO2A 1K7XA 4O50A 1K02A 3G5EA 1TMQA 1W3LA 1TVLA 3TW9A 1B31A 3I3DA 1S2UA 2WZIA 1UWTA 1W9UA 4GIYA 3HJEA 4NNCA 3UXDA 3UETA 2PE4A 5D05A 5FJIA 1M3UA 3SUTA 1EYEA 1EUNA 3TU9A 4YTTA 5CLWA 1ISWA 3BWWA 3FN9A 4Z1YA 1NAL1 4FI4A 1BXCA 5MF5A 1AH3A 2ZXDA 1CT5A 2OQHA 1SW0A 1QHZA 3KVJA 2RJHA 7CGTA 1M7XA 3HG3A 4EKJA 3EB2A 1ZBCA 1G4SA 3VIMA 3ATZA 5GNXA 1LL6A 1ZU8A 5DLCA 1JI2A 2DUZA 4X22A 2BXZA 5D2XA 3HPSA 1J0IA 3FFSA 2A4AA 4PUNA 5CZ0A 3NPUA 2P3ZA 3TROA 4AVNA 4E8CA 1UJPA 4ZL1A 2HCVA 5I23A 3N4FA 1XKJA 2Z0IA 3GDKA 2J8TA 2TSYA 1ZENA 5A8QA 4N6FA 2WNQA 3FEQA 2QV4A 4UFMA 1DHPA 1ZJHA 2J88A 1PE1A 2POZA 1CI1A 4GQRA 1YBQB 3W6LA 4I90A 3DG3A 1HGWA 1IWBA 3PHAA 4HSHA 3APGA 2EAWA 3G2GA 6XIMA 3BAKA 4N4PA 3BW4A 1MNSA 4F79A 2WNNA 3GHTA 3CT2A 3UCDA 1KBLA 3U2ZA 1WBJA 5I3KA 4PN2A 1ONWA 1KKOA 3FYPA 3SUVA 3IJ6A 1Q3NA 2ADAA 2PDMA 4YHGA 3S2JA 3BC9A 3TSMA 3U6WA 1SR0A 1NU5A 5DCEA 4KFNA 3DC0A 3E0LA 1R85A 3IS4A 3VTRA 4CCDA 1C90A 5JMUA 1KV8A 1VFFA 1HUVA 3WIJA 2OELA 3VYLA 4RNJA 1XYBA 1ELSA 3THDA 1VFUA 2FVMA 3ITYA 4AU0A 1TELA 3L65A 1DQUA 1BYBA 2VP8A 2ZUUA 4K7VA 4HK6A 2XUCA 1M53A 4UCFA 1YXDA 4F3HA 3GD6A 1WYIA 4LT9A 3FSUA 2ZWZA 4S3BA 1W5PA 4GNVA 2OWWA 2CBVA 2Y5SA 1NDZA 3EA3A 2JIWA 4LC8A 5LIYX 7TAAA 2QJIA 2PP0A 4D2JA 3HIJA 1O7AA 2XDFA 3N14A 3VK5A 3W73A 4EP8C 3GVWA 3TSDA 5EY5A 2ZX7A 2OFJA 3RG6A 2NSOA 4O14A 3BVJA 4HCLA 4MJMA 3O8AA 3ZO9A 1XINA 3EB3A 1HKMA 4U28A 3AALA 1J8VA 2BOGX 1EF3A 1OD8A 1ZLPA 3QY7A 1A5SA 3AISA 2YDSA 3ABRA 3ZS4A 3O6CA 2E9MA 1CGTA 4ACZA 1US3A 3SN4A 3PS7A 2V5KA 3HOJA 2INFA 2NXHA 1EPVA 1R46A 4JGDA 1IIHA 3OO2A 4JKKA 4IX2A 3UQNA 1BQCA 4WOQA 1UIPA 3W37A 3EX6A 4FF7A 4AWTA 1WDQA 5U4NA 4B4HA 3M46A 1FCQA 4B4FA 2A21A 4Y8FA 1PYMA 3VIHA 1R3YA 5LHFA 1ZHAA 3APYA 4LYKA 4PUDA 1E71M 2NW0A 2DY3A 1C92A 3GSMA 1JUBA 1R5YA 2XTKA 4GUFA 4NJHA 1KTBA 2J27A 3UCCA 1J5SA 4S2BA 4H00A 3C56A 3UG3A 2VKZG 4O53A 4Q6JA 5DY3A 2EG6A 3ELFA 8RUCA 1UJQA 1HKIA 1FHDA 4GFSA 1OG6A 5DX7A 2NSXA 3M5XA 4H9ZA 4JHOA 4PEKA 1CYGA 4ROPA 4FXJA 4J9JA 2J7CA 4R88A 4S3AA 3TDFA 2Y1HA 3LNMA 2Y88A 3GDRA 3Q94A 5D9MA 3TTEA 1JNDA 3C5QA 2BY2A 4I7VA 3LQLA 4JTFA 5IFPA 1UR0A 1VBUA 2NWRA 2ON3A 5FJPA 4BA0A 2Y61A 2GLKA 3FGCB 3KTSA 3RIKA 1EQPA 1JD9A 1EO7A 1B3OA 2QGHA 2PRMA 2Z6JA 1O5QA 4HBKA 4QDWA 4WK9A 2Z7GA 2A3HA 3B9OA 4ZZ9A 2P53A 3T44A 3SRFA 1DJYA 1EZ2A 3N2XA 4GH3A 2ZIDA 3G8RA 1G01A 1AQHA 4HKPA 1KWKA 3RMJA 4HHHA 5TIMA 4PYSA 1R9ZA 4ZBCA 3F4WA 3C61A 4WUIA 5HWMA 3G22A 1OX6A 4HIBA 1EKOA 4GJJA 1E6RA 3DAQA 5GJMA 1QRQA 3IUIA 5AHIA 4IFOA 3SECA 4ERAA 1I2PA 1KM0A 3SM0A 5E9AA 1AVAA 6CGTA 1XLIA 2GPTA 2OSWA 4OHQA 4LFYA 3CZKA 1PXGA 3E0FA 4X0NA 4DI8A 4JTTA 1VEMA 4PL1A 6REQB 4Z1BA 4D9PA 4JFTA 1OINA 2IQ0A 3TC6A 2ZRXA 5I00A 3G8EA 4RNHA 4IMCA 3WUFA 1EJUC 4Y96A 3M47A 1XYCA 1RH9A 4IJBA 4UOQA 3KBNA 1FTXA 3RMEA 1QATA 2VR2A 5D9NA 5A8MA 2VZUA 3DC8A 1PO9A 4DLMA 2P50A 1BWLA 3SCTA 2ZWYA 1LOSA 2I5QA 3RRXA 5CPTA 4RV8A 1XGEA 2E40A 3M0XA 1JD7A 1I4NA 4AC1X 1RR2A 4K8EA 4H6EA 1M1BA 3T2PA 4AH7A 1Q65A 1TVNA 3G24A 1UD8A 3AWNA 2EJAA 1R3SA 3DHFA 3W2MA 4C6EA 4JQ4A 2E68A 3WO8A 3MUXA 2CZVA 1XDMA 1F8IA 4MFDA 2OB3A 2BFGA 2IPFA 1A5BA 2XH7A 4QFUA 4KMQA 4OE7A 5I7GA 4DQWA 3BAWA 1TCMA 3CPRA 2BHUA 2ZA2A 4QHRA 2PDBA 4MNMA 3VNDA 4Q4RA 1NDVA 4A3QA 4MADA 2J78A 4PFHA 2E3ZA 4H2CA 1XICA 3WD1A 1D3HA 1EL3A 3M5YA 3R43A 3NO3A 4JKLA 5DY2A 3EMQA 4Z42C 4XAPA 2J75A 2PDWA 4FO4A 4A4AA 3QQ1A 5C2GA 3QW3A 3DIPA 3L66A 1KGUA 1BEUA 2BHZA 3A5FA 2BX7A 4RJEA 1IE7C 1N8IA 1Q8AA 1TJ2A 3AS2A 4HPHA 3B4UA 3UNTA 1I0BA 4GYPC 4QM1A 1A80A 1GORA 3OU8A 2VWTA 4CNNA 1XJBA 4QQ3A 2X41A 4O12A 3UCQA 1A47A 2A0NA 2HS8A 5A5WA 4S2CA 2R91A 4U2YA 4ALDA 4DRSA 2V67A 2A7PA 5ECVA 2PB1A 1XFCA 2OPJA 4F2UA 4G7FA 4HJFA 3EWBX 4YWIA 4GUJA 1KM4A 4D1JA 2MANA 3Q67A 3NTYA 3P74A 5LXXA 4GX9A 2CXGA 3ITXA 3EXSA 1Q6FA 3H2EA 3OVGA 3S5YA 4IL0A 1JEZA 1E0TA 2GOUA 5G5IA 3WLRA 1HX0A 3RLHA 1PX3A 1V6YA 5JH2A 2QVNA 2Z2BA 3W74A 5D37A 1OFBA 4GCAA 3I6TA 5EA9A 1A5MC 4XD4A 1KQZA 1P1XA 4GUGA 1YYAA 5FEZA 5AC4A 2DEPA 1GOXA 3NQCA 2G37A 5EGRA 3WDIA 1EUAA 1ENUA 1TV2A 2VHLA 4J3ZA 4DXVA 2BLEA 3DBNA 3LPOA 3BLEA 3WLHA 4E38A 4FALA 3W1AA 1VBGA 3G1VA 3ECQA 1E6NA 4XAFA 4QX4A 5F2LA 5KSWA 1XR2A 3W86A 3KXQA 2YOCA 4BQ2A 1TR9A 3CHFA 4AXNA 1Q6LA 4W89A 1MVYA 3UJSA 4LF2A 1SVDA 1ITCA 1VPYA