1R3RA

Uroporphyrinogen decarboxylase with mutation d86n
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSNILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tetrapyrrole coordination by uroporphyrinogen decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen Decarboxylase
total genus 126
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1r3rA00
1R3RA 2Q6ZA 1R3WA 3GVQA 3GW0A 3PPHA 1R3YA 4EXQA 1JPKA 1T7LA 3GVWA 4L5ZA 1R3VA 4WSHA 1JPHA 3L7RA 3BQ6A 4L6HA 3GVVA 3PPGA 4L64A 4L65A 1U22A 3BQ5A 3GW3A 1U1UA 4L61A 1YPXA 2EJAA 3GVRA 1U1HA 1XDJA 2NQ5A 4AY8A 1JPIA 4AY7A 4ZR8A 3CYVA 4L6OA 4ZTXA 2Q71A 1J93A 3PPCA 1R3QA 4QQUA 1XR2A 3RPDA 4ZTYA 1XPGA 1R3SA 1R3TA 2INFA 1UROA 1U1JA 3PPFA 3T0CA
chains in the Genus database with same CATH superfamily
1UUMA 1TE1A 3SCTA 1V6XA 4Q4PA 3ITTA 1O6IA 1FCUA 3FGCA 1UWUA 3L2LA 1W17A 3H12A 1OX5A 3NSXA 1QATA 4BR1A 4MUZA 5CG7A 3MCMA 2VI0A 2R1PA 3GX9A 3OVPA 4M80A 4ATWA 4GQQA 5DT7A 2NXIA 1HL9A 4S38A 4JTUA 3DYOA 3MHUA 3NM3A 4F48A 4I6VA 3N15A 4XG1A 2OYLA 1OEPA 2XPKA 1RK5A 3MSDA 2FB3A 4ZSTA 3N9RA 1OBAA 3SCNA 1XKYA 4AIEA 1ECEA 1TPWA 5D32A 3E49A 3GBDA 2E4TA 2YCEA 3I65A 1RJQA 5H1WA 3EX6A 1BAGA 3VIHA 1ZU8A 3S9ZA 5EFDA 1F2JA 1JFHA 3A4XA 3HMJG 2GJXA 1H61A 3MY9A 3W7NA 2BSLA 4ES4A 1EL3A 4RZBA 4FALA 1AG1O 2YKKA 2OEJA 4US5A 3VM5A 3WQOA 1XC4A 2BVYA 3CWOX 5FF4A 3E2QA 4YTTA 2PURA 2Z1VA 2C71A 2ZWZA 3TYZA 4F3HA 1TZ9A 1O94A 3KBJA 1TB3A 1MUWA 3CS2A 3W07A 1K1DA 3WUEA 4JY8A 1CB2A 1HGYA 2CLLA 1UWIA 1B3VA 4IL2A 5DCDA 1CXIA 3H53A 3W75A 3C3UA 4B3ZA 4YN5A 5H6HA 1Q6EA 2BOGX 1TWDA 2CKRA 4GCXA 4ACYA 2CLIA 3W38A 5I5RA 5HJXA 4H9ZA 3CJPA 1F4AA 3G77A 3QQ0A 2YCKX 1Q6QA 3C52A 1KR0A 4IJBA 4DI8A 3NVTA 1IZCA 1CLVA 3JW7A 1NU5A 2EPHA 3BGAA 1HVXA 4N42A 2BVTA 2GQ3A 3H54A 3SY1A 4H8UA 1SO5A 3HJEA 5C71A 2WHMA 3A22A 3E0IA 3P0XA 2QCNA 4D72A 3RAOA 4KWVA 1AODA 5CEWA 2JF6A 4PMRA 3IANA 2OJPA 1H7PA 5MKGA 1GORA 1I9CB 1WCGA 1W2PA 5HATA 1GVOA 2QDEA 2G50A 4DBDA 4OU1A 1EYWA 3FAWA 3C2FA 2OYMA 3ZSSA 4X3ZA 3UG8A 4PL2A 4DM1A 5DFAA 2FIQA 2GUYA 2IW0A 4Q22A 2INFA 4KESA 3HM7A 1GVIA 1QTWA 3ZJ8A 3BMWA 3WBAA 1EOMA 4IFRA 1HG3A 1OZMA 3NNTA 4AD5A 4C91A 4NY2A 2RKXA 3KBWA 1DHKA 3R94A 4XSMA 4W5UA 5GVJA 3J7HA 3M0JA 3CIXA 1H5YA 5ABTA 3W2LA 4JGDA 1XIDA 4PSPA 3H2MA 4XK2A 1REQA 4GINA 3BAKA 2XFFA 4LQ1A 4N9CA 3P5ZA 1XDJA 1QPKA 1W6TA 3MKVA 3G8RA 1E0VA 2V2CA 1BG4A 2ZZ1A 3CQJA 2GVGA 5A95A 2F84A 4WZHA 3S2JA 3MO7A 1NARA 2GOKA 4D6JA 7REQB 3MUXA 3TW9A 4L9XA 5F1VA 3B8SA 3BLDA 3PTKA 4GZ7A 1LLOA 2YZRA 3G2GA 3N4AA 4GJJA 3EDJA 4F2BA 4ZMGA 3A24A 3V7PA 1RQBA 1KQYA 2Y8UA 2WKGA 4O0QA 5FJRA 4QDMA 3SJ3A 3H7RA 1ZHAA 1RCOB 4N9DA 4O57A 2WAGA 3T4CA 1UD2A 3IJ8A 3WLRA 2ESCA 3UWEA 1W3IA 1I0DA 1FHVA 4B5VA 2O9TA 3KVJA 1WA3A 2XFYA 2XIIA 2PB1A 3UPWA 2FMNA 4A8LA 2D3NA 8RUCA 4U3CA 4FF5A 3T2OA 5TAOA 4ZL1A 1L9WA 4LJ3A 4GMEA 4GIEA 2CHOA 3EPMA 1FKWA 2QCLA 4TO8A 4HK6A 5LNUA 2PA6A 4JX6A 1JDEA 1GVFA 4S3EA 4O1CA 1KD0A 3P2VA 2PDQA 1CXFA 4UTJA 4NX0A 5D30A 1Q85A 4L1XA 2E77A 4HPGA 2ZADA 4DZHA 1EA0A 4QXIA 2PRHA 4AZHA 4UMAA 2QS8A 2GFTA 1H60A 2QW5A 1Q13A 3N2MA 4MZ8A 3L4VA 3BCFA 3VU2A 2Y89A 3UJFA 2GK1B 3H7UA 1QHOA 1YDYA 4JCLA 4DBWA 4IFKA 3FNDA 4HYWA 3UPBA 1LT7A 1VD6A 1OABA 2ACUA 1EZWA 3MHFA 1ICSA 2QZRA 3TJXA 1HF6A 2WCAA 2WHLA 4C1KA 1H0GA 3WQ5A 3AXXA 5FL0A 2GVEA 2O9OA 3PJXA 3QFWA 4ZE5A 4EF9A 4JTTA 5I3JA 1L8PA 3DYPA 2ZWYA 4G7EB 4YVPA 1BQCA 2PBGA 1Z42A 1J93A 1E0WA 1YEYA 4PUMA 4C7DA 1HVQA 2AKZA 1PB0A 5HANA 1TX2A 2YYTA 3K4AA 1T7LA 2OWXA 4R7OA 1A5NC 1PDZA 1QDSA 3PY2A 5AYIA 4N6EA 4EE9A 2OSYA 1E71M 1MXSA 3R11A 1UHVA 5FJIA 4JDBA 1H41A 4LGXA 3DAQA 3R8RA 2JKPA 1K9FA 4R5EA 3AAMA 5U7SA 3N14A 3CB3A 3H2OA 4JAWA 2D0GA 5A8MA 3VK5A 3VD9A 2PD9A 3PG9A 5FACA 3ES7A 1UWSA 3PAJA 4FX8A 4PRTA 1Q7MA 2JGYA 3HOJA 1KFBA 3OLGA 1I2QA 1IGSA 3U5YA 2WZHA 3RCNA 3G1AA 3M0VA 4DAIA 4H2HA 4S3BA 1XLBA 2ATSA 3L68A 4CVUA 4A8NA 3HMCA 3ITVA 3GY1A 4JN8A 3VKCA 3TV8A 3V0SA 3APYA 1R3RA 3M6YA 4Y8FA 2DSKA 3L5LA 4ALDA 1J6OA 1W5PA 3GVVA 4O10A 2XTKA 1GYMA 3CT2A 1SZGA 3LCXA 3F4NA 2WQDA 1SFJA 3QH2A 4MFDA 1EJXC 2ZBTA 3ALFA 3W53A 2J27A 1YDVA 3OO2A 3DCPA 1LCOA 3R5EA 2J8GA 3KWSA 4JIHA 2H3DA 1JCXA 1FVPA 1TMLA 2X1IA 3KL0A 3WX7A 2ZZ5A 4QJ3B 3OZYA 4B9YA 2QPXA 1QW7A 3QYSA 1OADA 1VRDA 4XZLX 5LIUX 4UTIA 4H4IA 3ARZA 5KZ6A 2VD9A 3WLMA 3K8MA 1QPQA 3RX4A 5CLWA 1LTDA 3G1FA 1J5SA 2OVLA 3BQ5A 2F2KA 4A4AA 3AXMA 1HP4A 3TSMA 2FDSA 3DERA 2OLHA 3WNLA 2XVGA 3DENA 3N18A 5CG0A 3OGSA 4JL2A 3CZGA 4IMAA 4A8RA 4WGXA 2PEVA 1VJZA 4L64A 4JS3A 3WQPA 1MRAA 3VA8A 2GZXA 3AQUA 4O53A 1TJPA 2JK2A 4L6OA 5F7UA 1T8QA 3C2VA 4Z1YA 3TOYA 1FWAC 3UEQA 3WLPA 4EOUA 1LL4A 2P53A 4D9PA 1OC6A 1AZ1A 4J3ZA 4F2TA 4P8WA 2V5BA 1W8SA 3EOEA 1HKKA 4UQCA 3WNOA 2QDHA 3IV8A 4JQ4A 4AY7A 2FKPA 1YKWA 1DJXA 3IVTA 3VNYA 1SR9A 4AVNA 4K8EA 2ZZ6A 2C0AA 1NP2A 1W9BM 3UERA 3A3XA 1OT2A 1XP3A 4DO7A 3TH6A 2O7SA 3KS5A 1W1ZA 4DJDC 1T5AA 4FMVA 4KT2A 4JN7A 2PRMA 3PZTA 2XH7A 3I7SA 1KKOA 4TV5A 4B5NA 1A5KC 3RCMA 3O9NA 1TE6A 3FN9A 1VFMA 3QSRA 5GJPA 1TV8A 1BPLB 4GCAA 1ME8A 1XI3A 3ATYA 3P67A 4UCGA 4IWWA 1OK6A 3R2GA 1ZALA 5JXQA 1NOUA 1TJ2A 2Q01A 2XH4A 4DM2A 1ZQ5A 2X1UA 5A6BA 3GDKA 4KW2A 2OELA 3IJIA 5AVHA 1NVMA 3GLCA 3K30A 1IEIA 3QF0A 1OFEA 4O0ZA 1UROA 4FI4A 5FJOA 3DBPA 4GNJA 4RKAA 1FFRA 1LORA 3TR2A 1VPYA 3RFAA 4YHGA 1NFPA 4DBSA 4IQEA 1K8YA 3QPEA 4WDWA 1J0ZA 1Z8AA 4WHBA 1P1MA 1UC4A 3GKFA 1VBJA 5LNSA 2G3FA 4XAFA 1HN1A 5C6MA 4PMZA 4YVVA 1M53A 2QULA 1W37A 2WPGA 5D33A 4DO6A 1PDYA 4LVGA 1QASA 1YTKA 3DFHA 3HGJA 2WC7A 4HNOA 5C9RA 1TYGA 3T9PA 1XHGA 3CUHA 3WKZA 4PTDA 3DU0A 3OA3A 5M3WA 4KGJA 3MSYA 4ILSA 2EO7A 1BWKA 4MAVA 5JIWA 2W27A 3I3DA 3PUOA 5EGRA 3BG3A 4URIA 1X96A 4AVOA 1EHAA 3AHTA 4NJGA 3LNMA 4GZIA 3CL8A 3GVWA 1L6GA 1IIGA 2PDBA 3SUSA 3WF1A 3HTWA 5ABHA 4KCTA 2BODX 1R30A 2V5DA 3VOCA 1Q65A 2NX1A 5DXYA 3CTLA 3FAXA 1OG6A 2PTYA 3O6DA 2FDMA 8A3HA 4J5NA 3UJRA 4QG9A 4LAZA 3Q45A 4Q3MA 3B04A 3AUJA 1IXNA 1BVNP 3MBFA 2E25A 2P0OA 4HA4A 4ROQA 3RU8X 4E3VA 1PJ9A 4J3UA 3OB8A 3TX9A 1Z6KA 3DESA 3T0CA 1PEZA 1TZZA 4RPPA 1HJQA 1A53A 2HVOA 3TZFA 1TWIA 3NGJA 2QUTA 1YXDA 5KZMA 1EJSC 4L65A 3UR5A 3QKEA 2QXWA 4Z2IA 4YHEA 4A22A 4DJFA 1EB3A 4JZ5A 4NRRA 4N4PA 1ZB5A 4ZOBA 4GXWA 1TTPA 2VFGA 4NZ1A 5H91A 5HXMA 1EJRC 4N02A 3DFTA 3PN8A 1TPDA 3LCLA 3F7JA 1G7UA 3JVAA 4AY8A 4TIMA 5FOOA 1FHDA 1PL9A 5A3HA 4OBRA 3WUGA 1XICA 3WK0A 4JPGA 4IGNA 3VILA 3VIFA 1IEQA 1W1TA 3UWQA 3L4TA 3TSBA 3W1PA 3AYVA 1PX8A 4IGSA 3WFZA 3VGHA 4HU3A 3F2CA 5XIMA 5DY2A 4QX4A 4GJIA 3UGRA 2PGFA 3D3FA 4IZGA 3NOYA 3EB4A 3CHVA 4PTXA 3HV8A 9CGTA 3SGZA 3FYYA 2Y6ZA 2O9PA 2VCCA 2CBIA 1TJ0A 4ZB5A 3RK8A 1VJIA 3LZ3A 1MMFA 3A23A 4P8UA 2AMXA 4C60A 2XJ7A 2NW0A 3N04A 1A5LC 3REQA 4X63A 3I4KA 4FLRA 1Q4WA 2ZTKA 2XN0A 1IEXA 4Q4QA 3NFUA 2P8BA 3VFCA 2Y5SA 1GG1A 2W4XA 3LEPA 3VMOA 2C91A 1FUYA 1X7FA 4PUNA 3K4WA 1PXGA 1I2OA 2E28A 3TC6A 3B0VC 1NQKA 2VGIA 3U7VA 3HG3A 3TAKA 4TQTA 3GUWA 3QC3A 1QXLA 3HB9A 5LHEA 2LLEA 2B7NA 3U48A 1GZ1A 1B30A 4LWWA 1RXOB 1W91A 3ES8A 4MNJA 4LYQA 5D05A 4KERA 1UJQA 4RR4A 4GO9A 1O68A 1H0IA 3TROA 4AD4A 4MHBA 4DXXA 4H9TA 5LGZA 2YJQA 4BI5A 2BB0A 1E1CA 3KDOA 4UQEA 4I9JA 3VKBA 2RH9A 3WH7A 3ZWTA 3VFLA 3ZZ1A 1UR2A 1UKQA 2QUVA 1U5VA 5AC8A 1TQXA 3SQSA 4UTFA 1A47A 4QDWA 3LSCA 4K68A 3RM8A 2GGEA 3VDCA 4NU7A 3MP5A 5HBFA 1SMDA 1GQKA 1Q6LA 4W85A 1QUMA 2P88A 3PJWA 2RDXA 3P5YA 4CGTA 1RUSA 1EHNA 4AMAA 4S2BA 3W6MA 2ZRVA 5AHNA 3TIMA 5CSSA 2VFIA 2KZHA 3QVQA 3SSJA 3L0GA 2Q09A 3VZZA 1HQTA 1TWZA 2R1MA 3UY8A 4EF8A 2VDHA 4GUGA 2GLKA 1OF6A 3NZ1A 3U0HA 3QY7A 5H8UA 4JTEA 2G4JA 3CV6A 3LB0A 4H19A 2WHKA 4IIHA 1PCWA 4UTMA 1TPUA 1KRBC 2CLFA 5FKYA 1PE1A 3FK4A 4R27A 2FH8A 2XM2A 1X7IA 3H55A 4QFUA 3M0ZA 2TPSA 5C70A 4JQ3A 3VOGA 1E1CB 2G0WA 4W93A 4V1XA 1UR8A 3AMKA 4BF9A 3H6OA 3SECA 2JALA 3M0MA 2ZUNA 2QVNA 4NASA 2OMAA 5HOSA 5T9CE 3N2CA 4JFSA 3N29A 2P10A 1C93A 3DI0A 2PWDA 3PK7A 3R43A 4U5IA 1C8VA 1V6UA 5I3IA 2VRQA 5KSWA 1BTCA 2TSYA 1DJZA 3M1ZA 1W9UA 3TEVA 2V81A 1KV8A 2G3NA 1JG9A 3CASA 3ARTA 3LPFA 2CKSA 1RPXA 1PKMA 4MY8A 3N3MA 1NFBA 9XIAA 3C4UA 5D2TA 4M6VA 1DJWA 2YCLB 2NV1A 2W62A 1XS2A 2Z1XA 3UA3A 4HHMA 2ZZ3A 1GHSA 1AJ2A 3WDHA 5C2XA 2QLYA 3AHVA 5CH9A 3ITGA 5EMMA 1KFJA 2PP3A 3WLOA 4ZENA 4AZBA 3NXFA 4CQBA 4M56A 5G4HC 3W9ZA 4DO4A 1MEHA 1CXEA 3TTEA 1PIGA 2I5IA 1XV8A 4F79A 4PSRA 1ONEA 5D37A 2BMBA 1LBLA 5HNTA 2ZX8A 1JUKA 4L1GA 4HIBA 4FP1A 1EJWC 2VCBA 4JHOA 5IHSA 2BZNA 4H8HA 1E40A 2HSAA 1FOBA 3AXIA 1V4YA 1S2VA 4ZZ9A 3EX1A 4Q33A 6CGTA 2CLMA 4FIRA 4DYEA 3FJLA 1YPIA 3F4VA 1PCKA 1YIXA 4MNMA 1PTGA 1FWFC 4GZEA 3ALGA 3WNNA 2TRSA 4FXSA 1E6QM 1Y5XA 3TW6A 3LRKA 1IHIA 2OO6A 2ISWA 4PL1A 4Q8TA 3ITCA 4W84A 1YDNA 3FIGA 2V5LA 3W2UA 3EDFA 3B0XA 3E6EA 3CGTA 3SR7A 4XO6A 4A21A 2BTMA 1V6VA 4UTWA 4WSKA 3RPTA 5FL1A 5IHRA 4CN6A 4YLWA 5B80A 1FHUA 2VENA 3QZEA 3M5VA 1Q8AA 4L7ZA 3WDPP 1B90A 1SFSA 2ZRZA 3VZYA 3T6CA 1NP0A 3TTOA 2V8ZA 3THAA 2Z7GA 4ZVJA 4IG2B 4IICA 1P43A 1V5XA 4KEMA 3NQAA 3EOOA 4JTHA 3N9SA 2ZKMX 3NO5A 2D2GA 6REQB 5L9FA 2XIMA 5M17A 1S5VA 2OPJA 4C90A 3ABQA 4NHVA 3L65A 1X6UA 3S6OA 4ZOEA 3ZJ6A 4AW7A 3AS1A 3ENLA 3AU2A 4ZB0A 2WVSA 3HBLA 3VIPA 1WKEA 3H2EA 3MW7A 1E72M 4H6KA 2WWCA 5DANA 3G3MA 4EPBC 4HOXA 1SW0A 3OYZA 3VOHA 3VOJA 2C6QA 2V2DA 1HGWA 2D0FA 3CPUA 2X2GA 4Z2KA 5BXSA 1AD4A 4AD3A 3GUGA 1Q45A 3AHZA 1U5HA 3W7MA 1E0XA 4BWLA 3JZUA 4W7VA 4E6MA 7ODCA 5FJJA 2OX4A 3NSMA 1DWFM 2HVMA 2QCCA 1CLXA 2PWVA 1K7XA 5CGTA 3G1RA 4BQ5A 4GH1A 1P0DA 1OX4B 4RE2A 3VKAA 1JQXA 2CZEA 4E2OA 1PX3A 2EJAA 2ZRXA 1CGXA 4PUDA 2DZBA 1B9BA 1EDQA 3G1HA 1DWAM 1SO4A 3VOFA 2HXUA 3LBOA 3USZA 4S3AA 2R14A 3TONA 3O63A 3VC6A 3W82A 4G7EA 3BGGA 3HQNA 3P62A 2PGEA 1LT8A 2IKIA 1DXIA 4AZ6A 4W86A 3QV6A 4V1YA 1H1YA 4FXFA 3IJDA 1A0DA 1L0PA 4GGBA 1R87A 4HTYA 1VCVA 2ZUVA 2WW5A 2CERA 1BYAA 2ODOA 2H90A 2DP3A 2A3HA 1O1ZA 5L6UA 3BOFA 1UUOA 4RZ5A 4U31A 3QY8A 4QJ4B 3UR8A 4J35A 3M5YA 1V77A 3C6CA 3N6HA 3QGAC 4RZ4A 2W5FA 4M5PA 2AL2B 3W81A 4Q8MA 3VCCA 4FSAA 3THQA 2QDGA 3GHUA 1TJ1A 2EXOA 2OT0A 3AWOA 3WJSA 4YS1A 3A13A 3ITXA 1OGGA 3MUIA 4OE7A 3TMLA 3BW3A 1E4NA 4KETA 4R34A 3L5AA 3O07A 3SB0A 3W1NA 2VVNA 1HNYA 3L4WA 3LXAA 2Z6JA 3AUOA 3OGRA 2XH0A 3JU2A 1ZBKA 2P8CA 3TC7A 4J3XA 4S3KA 3EMQA 1KTBA 2R6OA 2ISSA 3R10A 3WNPA 1FP9A 4FEZA 4LAUA 1V93A 3NOEA 4DJDA 2ZZ2A 2IPWA 4TVCA 2YFNA 3TP4A 1W3LA 4HVXA 4GFSA 4JXCA 5C9ZA 4OUEA 1EOKA 1ICPA 2WKJA 3KWXA 1IE7C 2V2HA 4CN4A 2PDPA 3LN3A 4PCTA 4Z1AA 5IXEA 3TAOA 3DC8A 4DWSD 1IXPA 4GRSA 2AMGA 3CWNA 4PUEA 4ZR8A 1PV8A 3QSTA 1MWOA 3NUKA 3SN0A 3BOXA 3KP0A 1ODUA 3UPMA 2FTPA 1CGYA 4NAFA 3SY5A 5C2CA 3KDNA 3W02A 2C14A 3T0BA 3WLIA 3IRSA 3RO8A 2INZA 3PS7A 2YFOA 5T9BG 1Z3NA 1CYGA 4ZA0A 2J8FA 5A6LA 3RCYA 2BGSA 3GZ3A 4L6DA 3WD3A 1P48A 5BRPA 1EIXA 1HJWA 2Q6ZA 4V28A 1WDWA 1BWLA 3CO8A 2FZMA 3LSBA 1FRBA 3LENA 1W2VA 3GW3A 2VZVA 4AHOA 4NKCA 2OKOA 3R7MA 5JVLA 1LZOA 4OV4A 3QJAA 4KIRA 2V3GA 3GZAA 5I09A 1V7AA 3WLSA 4O0KA 5TD4A 1C90A 4O52A 3RO6A 1EX5A 1IR1A 5A69A 4FF7A 1FHLA 1JZ6A 2REQB 2RFGA 4UR9A 3WMCA 2Z4GA 2J9YA 5C7HA 1OK4A 1O12A 4M6QA 3UR7A 2G3MA 3LCWA 1Z7AA 4H6QA 1XUZA 3G0UA 4Z42C 2D69A 5FA5A 3PZVA 3WF4A 3HG4A 3MDUA 4FX7A 4GYPC 4LBSA 2ALDA 4B9ZA 3S1XA 1W5NA 1OYAA 3AMGA 1E70M 8TIMA 4O1BA 1NM9A 3R89A 2F38A 2C7FA 2J7EA 3H2NA 1UB3A 4X22A 3MI6A 1OZQA 2Y7EA 2KX9A 2NWSA 2WSKA 3PFRA 5D2VA 5A8PA 4GG9A 1WBHA 3QEZA 2WXDM 5E5CA 1H7WA 5FESA 2CHNA 3UYCA 5CZJA 2BDQA 4XTDA 4IP5A 3IGSA 3IJ7A 4IPIA 4IG2A 1KV5A 4DXVA 2WVTA 3BWWA 4QEEA 4GK8A 4ML9A 1ONWA 1QNQA 1BYDA 2PFHA 3PZOA 2GSJA 4FNSA 3K1DA 2E67A 5I3DA 1UR3M 4MKSA 1QOPA 1RPKA 4K39A 2EPNA 3C2EA 2OSWA 3KM8A 3PR2A 4PULA 3ARYA 3W7PA 3GTNA 5ABFA 3B4YA 4MSSA 4XZ9A 1PYMA 1DE6A 2VC6A 4PA8A 5A1AA 4HNVA 4LBUA 3DFNA 2R1NA 4L6HA 3ARPA 4X9SA 3N1AA 1U83A 5D8WA 3QR3A 4FR1A 2V9DA 1WNOA 4PCSA 3PG8A 1XH2A 3P81A 5HAOA 1LOSA 3MCOA 3BAXA 1TFVA 4LYKA 4C6PA 3RJYA 4ZQNA 3EKLA 3GXIA 3W27A 3G22A 3OBKA 1HX0A 2E5BA 3AIBA 3OLEA 3V5FA 1JGIA 1KM2A 1MW2A 3KAOA 1A5UA 1VGAA 3FYOA 3KBMA 3QOKA 2CITA 5HJYA 4Q8OA 3BAYA 2POTA 4BF7A 4FOKA 4GQ0A 3CHCA 4NP7A 3FY1A 4C5ZA 3ABZA 2PC4A 2VXNA 3O15A 3AU6A 3IIOA 2O92A 2GK1A 1G9HA 4HNNA 5I77A 5T91A 2E68A 1U1HA 2CETA 1MEIA 4DQWA 3H4XA 2J6VA 1SO3A 2GJLA 2HPMA 3N13A 1XL9A 1QHPA 2ZA2A 3VVGA 1UD8A 4WQ6A 3G0XA 1VFSA 3B4UA 2DSWA 1JPHA 2B7PA 3FEMA 1UZ4A 3C0JA 3VGFA 3HFTA 1V3JA 4C6NA 3JUGA 5I02A 1V0MA 4FNTA 4PBGA 1TWWA 1XXXA 4YMZA 3NQCA 3SW6A 4D1IA 3L9CA 2OR2A 3GXNA 1E6PA 1E73M 4RW3A 3PB0A 3U57A 3MDWA 1QNVA 3T07A 3F5LA 3M6DA 3DH7A 1K8XA 4UC5A 1GOWA 1N2VA 4PN2A 3QGVA 1XCXA 1OX4A 1HKVA 1FWHC 1R3WA 3GE7A 4KQNA 5HINA 3QHMA 3TFXA 1DHPA 3LM3A 4Z2GA 4MIMA 2L5HA 3N9KA 3MCNA 1QU4A 1TREA 1RSCA 1MDRA 1I8JA 2Q3OA 2UY4A 2WO5A 3W7KA 4PUUA 3IV3A 4H00A 1XLIA 4HMNA 1ISZA 2Y62A 2J79A 1G4PA 5HWJA 2ZVRA 1R38A 2MNRA 5K3VA 1WDPA 4Z1CA 3EPOA 3K8LA 1CXLA 4PMXA 1KTCA 1H7XA 4HN4A 1XFBA 4G8TA 3K13A 4GXPA 3SCOA 1V6TA 4ERGA 3CO4A 1GQJA 4RNJA 3UF9A 1KXHA 3PVFA 4L4LA 2W3ZA 4X0NA 1TA3B 3NTYA 1ADDA 3RRAA 3TTQA 4TU1A 1V3HA 1GW1A 5I00A 1JZ7A 3PZMA 4H8NA 3PP7A 4RW5A 2VX7A 4C5YA 4B16A 1XGZA 3I4EA 1A3XA 3GTHA 2VWTA 2E1DA 3GWQA 3EWYA 1GJWA 2EF9A 3HO8A 1EEXA 2G5WA 5ABGA 1UBSA 2ZUWA 4WJEA 4IL0A 3BJTA 4KPLA 4C6LA 5C9WA 1A80A 3HIJA 4UWMA 3ABSA 5EKYA 4D8AA 3C8FA 3DHPA 5DO8A 1Y8BA 1T96A 1RVGA 1XJBA 4Q6XA 1A5MC 1F6KA 2H8ZA 2DT2A 2QEZA 3W23A 5FIPA 2ZIDA 3GBEA 5G2IA 1MUCA 3UXLA 1QMLA 3MJYA 1SM9A 3IIPA 1ISWA 1J5TA 3W0KA 3STCA 3GTFA 3APGA 1ZP4A 4JCMA 2DZSA 3LGEA 3VIIA 3TZNA 3I7QA 3QYQA 5KMYA 3LQLA 4QE5A 2GQ9A 3N2XA 2DV0A 3BJSA 3S5NA 2AL1A 1MO0A 1AMKA 3ANYA 3C3NA 3BARA 3NQGA 1JRBA 1BEUA 3KVMA 1V02A 4UMBA 4GY7A 5J5DA 3VGDA 1R0MA 1JAKA 2CLEA 5I03A 4A3HA 1JZ4A 2D2JA 5DEZA 1H1ZA 2ADAA 3V1HA 1KCZA 1XIFA 4B15A 2ACSA 1UR0A 3LCGA 3QXBA 5HJLA 1KA9F 5CJNA 4XO7A 3M4HA 1T41A 1PS9A 4WCJA 2PWGA 3T09A 1ONRA 2VFFA 2XM1A 4ADUA 4MOZA 3AI0A 3RX3A 3BMVA 4JEJA 4WR3A 1FCBA 1OSEA 3QLLA 4JNMA 3WYZA 4NAFB 3SBFA 1R2TA 1YNYA 4M29A 3WG6A 2HVNA 4ACZB 1VFTA 3SQMA 4V2XA 4AWUA 3U5UA 4I6KA 4GVGA 4DNMA 3UZXA 3GG1A 3P93A 2OYKA 3PAOA 2IMRA 3OYXA 1A4MA 1MRQA 3QC0A 1XF0A 1HXJA 1QHZA 2C15A 1Z9AA 1GHRA 4JTGA 2I9UA 4HHHA 1CGUA 3GDTA 4EPEC 1XIBA 1X6NA 4XD5A 2ZA3A 1DIEA 1Y65A 1UJPA 1FH9A 5CBJA 3S2LA 3WQ6A 5EMUA 3GR8A 3EEGA 1J2WA 4NZCA 2CZVA 3C5QA 4U3AA 1EWDA 2ZE3A 4FO4A 1LLZA 2DSZA 3RDKA 4IMCA 2WMIA 4DJED 3FSUA 3N4FA 1Q6DA 2G4FA 1K02A 2PZNA 4JNZA 2HS8A 3S1VA 1BTMA 4DZIA 1W31A 3V18A 3KL3A 1EJUC 3BLPX 4CNOA 4NG3A 4LXFA 5A6JA 2EPKX 3W1TA 4R88A 4KGLA 4L61A 4QJ1A 3LTSA 5BOFA 3CYVA 2E6DA 1IZKA 3MC5A 2DUAA 1K7FA 1EJTC 2GDQA 2DIKA 4B5TA 4OBSA 2FTYA 4WF7A 3NQEA 2J75A 4V27A 1JRCA 4MWAC 3CNYA 5M5DA 3IIZA 4GLEA 4CNSA 4IM4A 2V5CA 4F0LA 4C1LA 4UB9A 5AZ0A 5C0QA 2QF7A 4K3ZA 1UPMB 1UWTA 1UR9A 2CW6A 2PLMA 4XIMA 3A5FA 1V8EA 1Q5MA 1JZ8A 1E0TA 1E0UA 2VOMA 4UFHA 3AIUA 2GYIA 3MWCA 1RAKA 3FGCB 3QZ6A 2Y1HA 5CGQA 4UTTC 3GXTA 3L4YA 3S5SA 2X0YA 2PDFA 3ZS4A 3TJIA 1JI1A 4QNWA 2VDIA 2ZDRA 3PWIA 4ERAA 4CD8A 4E8CA 1ODZA 2J77A 3M0LA 2I56A 4HPHA 2YB1A 3GRIA 3VIKA 4HNTA 3U3HA 1L6SA 1QAPA 4B4HA 4HA3A 3LV6A 2NX9A 4L1WA 3O7UA 1HKIA 2GQAA 4LC6A 2ZUMA 3R0UA 3EA2A 3A21A 3QPYA 5DY3A 1PTAA 3PULA 7XIMA 1EBHA 3LMZA 5T26A 3ITYA 1UKOA 1FCQA 3DECA 2VMFA 1HJUA 2DW6A 3N6JA 5E93A 2QIWA 3IUIA 4EX4A 2Y5JA 4D2JA 4NQ1A 3P7YA 4GYKA 1RR2A 4UQDA 4ZGYA 1AQFA 3DZ1A 3R6IA 3WZ0E 3PUDA 3N19B 4S3FA 3NZQA 1A50A 1WXZA 4DEFA 2DSUA 4PMJA 2E6YA 3ARQA 4OOUA 2E5CA 1EF3A 4CD4A 4P7LA 3UVAA 1XYCA 4XAGA 1OFBA 1MSSA 4JTSA 3V5OA 2PP0A 4XWUA 3WO8A 4HHPA 4PODA 4MPQA 4RE4A 3E2VA 4M82A 1Z69A 1AA1B 4HPXA 1H50A 4QSFA 1HFBA 5LA0A 3BV4A 1VCFA 4Z2HA 1PVNA 4JTDA 2EG7A 4LRSA 4LUSA 3U4FA 3A4JA 3W7EA 2ZX7A 3XINA 4UOJA 2J7HA 3S46A 3SGGA 1U5JA 3E74A 3K5XA 2QT3A 3GHSA 3T2QA 5FAJA 4ZCWA 3LQGA 4GQRA 1YE4A 4POCA 1OCNA 5FI8A 3H2AA 1OD0A 2WMFA 3MUZ1 1XQLA 1DJYA 5RUBA 4NXSA 1O5RA 1DVJA 1XRVA 3KEHA 1BRLA 2ALRA 4E2VA 3ANVA 1RQHA 1XIGA 1UZDA 3SM0A 4JFTA 3NZPA 2D0HA 4M3PA 3OEXA 4IFKB 2DT3A 1HJXA 3EDKA 3T81A 1W3KA 3UBPC 3WH6A 3LOTA 1ZZMA 2J8TA 1RALA 3SCSA 5LA1A 4DF0A 1X8CA 1VEMA 3MS8A 1G01A 3II1A 3ABRA 1HJSA 4ZOCA 4ZQCA 2V30A 4EWJA 3A64A 2WK2A 1OY0A 3TFCA 3LXBA 3E96A 5D8ZA 2HISA 3NQ7A 3PZUA 3FJ4A 4HB7A 4UIOA 1J9YA 3W85A 2R9RA 1MQQA 2J9ZA 1B3WA 2FGLA 3GXPA 4I5UA 4I8DA 4LSBA 4QDPA 4K7YA 2WMHA 4ZXLA 1F3EA 4MTVA 4KMQA 5AYZA 1ZTVA 4BHYA 2RAGA 3PNZA 5A6AA 4I9TA 5CPMA 1XG4A 1X97A 4S2CA 3BQ6A 2PDUA 3MZNA 2V6AA 2VGBA 1ADSA 3ZT5A 4S3DA 1KLZA 2ZZ4A 3MSRA 1XCWA 3RR4A 3UCDA 4QCFA 3WIJA 3DG3A 1V3LA 3UCCA 1J12A 1PYFA 1F61A 1OB0A 2HK0A 3LERA 9XIMA 2XSAA 1JCTA 1UG6A 2VEFA 5A8GA 5LXEA 1PKNA 3PBWA 3TU9A 4WY0B 1WZLA 3U4AA 1P6CA 4QG8A 3OLIA 4U33A 4K7VA 4C6CA 3KS6A 3C0LA 2PUZA 2VNCA 4AEFA 1SW7A 3SIMA 1TELA 4YCPA 1C9WA 5AHLA 1G4EA 4H7ZA 1ZBVA 4NIRA 4R3UA 2R1LA 4RLIA 3LTYA 2XFWA 2DH2A 1XIIA 4YCOA 3ARRA 3N73A 1JFXA 3BLKA 1UR4A 1UMLA 2WCGA 4QAWA 5EL1A 4DWSB 4PCPA 3I6EA 3W26A 2WV8A 5AVNA 3WL1A 3MSGA 2DZAA 3L4ZA 2B81A 2PDXA 1WZKA 2TODA 1A5OC 4AIUA 1MFUA 1ELSA 1R46A 1R3VA 3CIVA 1SFLA 1AMYA 1YHTA 1W1PA 4PRRA 4F0MA 3G8EA 1LQ0A 1RLCL 2VC5A 3M41A 4LC8A 1O5QA 2C79A 2Z1SA 1LJYA 1KM5A 3AISA 1M68A 4NZFA 4GBUA 4MAZA 3USBA 5CGMA 3ZFHA 2I5QA 4X2RA 1XIMA 2X8RA 3TN5A 1M41A 1QK0A 3MV01 5CQ1A 3OVQA 3T1GA 3EWBX 4UZSA 2HZGA 3OIXA 1MZRA 2BS9A 4B91A 3UWWA 3ONCA 1KRMA 3SRDA 1P5BA 4NJIA 2ZZ7A 1BVWA 1LYXA 4YWSA 2PWFA 4N9BA 1UQYA 4CD7A 4B3KA 2HTMA 3TSDA 4IT1A 2Z29A 2PDKA 3MT1A 1R7AA 5CPLA 5AYBA 3WF3A 3T8QA 1SSGA 3R13A 1SVDA 1SFTA 4OV9A 1ITXA 3M46A 3HURA 4GC4A 4GZJA 1DBTA 2Y2WA 4I5RA 3B9AA 4YIWA 2XVKA 3T55A 3W7JA 2DORA 4W88A 1ZAJA 2VWSA 1RZMA 1TRDA 3ZT7A 5K2ZA 4GQGA 1KXQA 1D3HA 1A5SA 1TZ7A 3P61A 2FHFA 1ML1A 3QRHA 1UZ1A 1S2WA 2J7CA 3UG5A 3QGKC 5HQLA 3CQKA 4MNLA 1X1NA 3SN4A 2YL5A 4E3TA 5BRBA 3NA8A 4GUFA 5GQBA 5BWAA 3SAZA 3SI9A 3G1XA 3T42A 5IBXC 2QV5A 4PGLA 4FXRA 3CMJA 2PWUA 2F6XA 2OCZA 2FPVA 2OEMA 1NWSA 2DW7A 1GT8A 3TDFA 3THDA 5DMLA 2FPTA 2Y7GA 5D9OA 3QBUA 4C6QA 1MQRA 1P4CA 2CLHA 3SN1A 2Z24A 3LYEA 3N3TA 2A21A 1U30A 4J3VA 4NRSA 3LPGA 4ZSUA 4ML4A 3TA9A 4CQDA 2FZ9A 5DF0A 1EO7A 3TQKA 2EPMX 4XX6A 4Q7NA 2J13A 3IWPA 2VZUA 4XD6A 3AS0A 4WDTA 3WD4A 2P5NA 4MKVA 4O1AA 5DX7A 1JD9A 3QV7A 3VYLA 6ALDA 2A6LA 1C9DA 1AFSA 1FTXA 3DUGA 2RHGA 1GOIA 3Q94A 1HKMA 1TUFA 2E6FA 4IIEA 2OSXA 4Q8QA 2PZ0A 5EBAA 4HMCA 1GVSA 2ZDSA 4DF2A 3W84A 3KOWA 4G6CA 5HUOA 1FWDC 2J88A 2H9AA 3RGTA 4BQ4A 4L4PA 4RL3A 4BF5A 5FD0A 2FB2A 4U2YA 4EK7A 4QLJA 3RMEA 1LBFA 2QJHA 4INFA 1MDLA 4CNPA 3FXGA 3ME3A 2A79A 2EKGA 1CW2A 2G3IA 5HNUA 2WZEA 4WXZA 3O3RA 3N2OA 2IPGA 3BURA 1R3QA 4JTRA 1PZ0A 2F9RA 1TCDA 1DPMA 6PTDA 1DL3A 1UOKA 3O16A 2PLKA 3EA1A 2C13A 4MWAA 2A2IA 2DEPA 2AOSA 3MWAA 4AWEA 2PRLA 3XISA 3M7WA 5HWMA 2X7VA 4CU6A 2X30A 4J7RA 3GXMA 1O4UA 5G1MA 3GG0A 3PBUA 4LVDA 3G1VA 4P7NA 3W1UA 1GWJA 4H9XA 3G18A 4KBXA 4BK9A 3CPGA 3CWHA 1BF6A 3MUY1 2WZMA 1R6WA 4LYPA 1ZUAX 1XLJA 4LY8A 2AGKA 1C8XA 2O7QA 3GAKA 4PB5A 4W9TA 5MKGB 3ARVA 4GIYA 1Q6OA 1XQKA 3V0TA 3IGXA 3WQGA 1N8FA 4JIPA 4DRSA 1BYCA 3PPFA 2QUUA 1CBGA 1Z48A 2WMIB 4GKTA 4BKNA 2GVYA 2HXTA 4REQA 2QMKA 2VEPA 1BD0A 2W0UA 3LD5A 1DOSA 1REQB 3LLDA 1AQMA 4GNKB 3HQ1A 1QCWA 4D1JA 1LM1A 2W92A 2J7FA 1HL2A 2X40A 5EU9A 2WSRA 1XX1A 4JYDA 3STPA 2DJXA 2Z2UA 1S39A 2W9MA 3AALA 3WLLA 2OGJA 3EMCA 1JQVA 5GJNA 3RLHA 3WF0A 3OZMA 4HD5A 2NSOA 2RDUA 3BJFA 1W32A 2WANA 4AVFA 3LPOA 2OB3A 3EXRA 4BJHA 1WO2A 1GPWA 4R33A 1QVBA 3EWDA 3WNMA 3B8VA 1AQHA 2XHYA 4RDZA 1Q6CA 4XSLA 4LB3A 2FZBA 5CPQA 4O18A 5CZTA 4F0KA 4DUOA 1B0IA 1ZCOA 2ONEA 3C2RA 3P0WA 1BLIA 3SSZA 4A3QA 3MYPA 2QCEA 3DKJA 3WH8A 2Z26A 3GTIA 1EDTA 1D3CA 1H7RA 4IMGA 4PE8A 2PU0A 5F1UA 4LNCA 3NL3A 3GVQA 2INEA 3V36A 2CESA 5TQLA 1RV8A 2QCDA 1TVPA 5GJMA 1E6ZA 2YSWA 1W9XA 4MADA 1KQZA 4J3TA 3QR0A 3W3OA 3BL3A 5FEZA 4WJ8A 2PPGA 2QNEA 2HV5A 4XBJA 4GYFA 3ZJKA 1E6XM 3RX2A 1XLHA 1NF0A 3BUVA 3A12A 2P76A 2Y5EA 1MYRA 4FNRA 2YA1A 1GVRA 2QJMA 3KFTA 5ABFB 1IXQA 1JPKA 4QSHA 1UH2A 3VD7A 5GNYA 2XVNA 2PDGA 3ARWA 3FKKA 3WCZA 1DIKA 3SCPA 3NL5A 1T8XA 2VKZG 1D7FA 2W79A 1W9DM 2BBFA 4ERIA 1QPRA 1LG2A 1FWRA 4WK9A 4WSJA 2YDAA 4WKHA 4HJWA 1R9YA 3GNNA 4AX6A 1NDWA 5HR6A 3OPSA 4KWUA 5E6ZA 4K1GA 4C1NB 2E0PA 3LPPA 5EMJA 1IT7A 3MJMA 3QKZA 2W66A 1SW3A 4PZVA 5CCZA 1XKJA 2HNEA 3BICA 3WLJA 1LL6A 4B5UA 2Q02A 3PTQA 4A2SA 3WFLA 5IFPA 1UYQA 1OVDA 2FPYA 4GIAA 3W1AA 1I60A 3A9BA 1J18A 1TVNA 2GSHA 2GVLA 3TW7A 3MTWA 1RP9A 3W2MA 1V51A 3G6MA 2QDDA 3N6QA 1K6AA 1S2AA 4W8LA 3RU6A 4PBFA 3WEMA 4CCDA 1XBVA 4WDXA 1ISYA 5K7JA 1DKWA 1D3GA 3E2RA 2F61A 3B0UX 4XZHA 3M0IA 3BGJA 3B06A 5KEZA 3HFYA 2REQA 4ASTA 2WMGA 4JKLA 1SZFA 4MNKA 2FYMA 4Y2WA 3TN3A 3N12A 3MMWA 3UJ2A 1XD0A 4YU1A 1I75A 1O60A 5F4WA 4AF0A 1J0KA 2QJJA 3O0FA 1BGGA 2PLJA 1FWIC 8XIMA 2GWGA 4I90A 1MW1A 1R86A 1GZGA 2YDSA 3UG4A 3GIPA 2ABBA 2GDVA 2Z28A 1WPCA 2FQIA 3PTMA 2ZXQA 4CQCA 3GSMA 1RP8A 2WYSA 4M1RA 4M81A 5U4NA 4UR7A 2X0SA 1BXNA 1EXBA 2Y0FA 3SIZA 3SQLA 3MANA 1UD5A 2D3LA 3T44A 3EWZA 3VNLA 1RD5A 2YXXA 2YLLA 1ME9A 1YPXA 4HP5A 2Z2AA 2A85A 2CC0A 1UMYA 1XBXA 3DOPA 4NNBA 4HA0A 4PR4A 2CIPA 2YGYA 4N4QA 2PTXA 3H26A 1J96A 2J66A 3UR2A 1WKYA 1I45A 5HNNA 3RIKA 3A5VA 3TA6A 3BLLA 4WY0F 4DJDD 1UH4A 4FB7A 4F9DA 3K1GA 1B3YA 2X41A 4XKMA 4B92A 4JHZA 4GD0A 5BRQA 1KGWA 5CPSA 4DVOA 3B05A 1QNRA 5C7VA 1AW5A 1ESWA 2NZLA 5TNVA 5IFTA 1V3IA 4FA3A 3U2EA 1HO4A 1BHGA 4C1NA 1KM1A 2R91A 3CV7A 5MF5A 3OOQA 5FSDC 3CLWA 1T40A 2OLAA 1FWBC 4XVEA 1L6WA 1VZWA 1D2KA 1G5AA 5DBUA 1E15A 1E5NA 1HKWA 3HPAA 4W89A 3BVJA 3IJ6A 3S2NA 3VAVA 4DWSC 4ZO7A 1LWHA 4IFOA 1FWNA 4LAOA 3EWCA 2GUUA 3C8NA 1YXYA 3M16A 4UZUA 1OFQA 3URNA 3GIYA 3UWZA 3O05A 5TIMA 4CNNA 2NLIA 3SDOA 2DSVA 3NQVA 4AXNA 2HDJA 1VP5A 2ZC8A 5HMSA 3AS3A 4RE0A 3W4RA 4H6EA 1I0BA 1Z41A 2W6RA 3MVTA 4M6PA 3WK3A 2HPIA 5ENLA 3OIHA 2VM8A 4LCRA 3O06A 3SCWA 4DJEA 4WGHA 1WBJA 1V03A 3NO1A 3MV11 2DUXA 4ORIA 3WEOA 1MUMA 2PGRA 4K37A 1M9HA 4WX2A 3ECQA 5HPCA 3GVGA 3WLQA 3ZLHA 2UY2A 3L23A 4S39A 1A5BA 2G95A 4YWIA 4PMYA 4NZ5A 1J4EA 2GJNA 1QW8A 5GNZA 1H3GA 3SRHA 2HMCA 4ZO8A 2P3EA 1QI3A 2BHUA 5G1YA 5I3KA 3IGHX 3NXLA 3EOSA 4O11A 1GOXA 4HSNA 3WLNA 2Z7KA 1KFEA 3A4WA 1VF8A 1GOKA 1S2UA 2C18A 3AYRA 2HROA 2WNZA 5CZ0A 3CZLA 5LGXA 3G1SA 1P1XA 3OG3A 1PKLA 1ZJBA 3V35A 1R7OA 1WAWA 4MUPA 4DI9A 3KOXA 4J9JA 1PHWA 1G4SA 1NF7A 3C56A 1TPEA 1YXCA 1AJZA 4YXGA 4RZ6A 3VM7A 4YPJA 2Y7DA 3CV1A 1QOQA 1K4HA 3RM4A 4MM1A 3Q37A 1H63A 2RGMA 4D6HA 2EPOA 1SU5A 3D3AA 1JXKA 1WXJA 1ME7A 1RVKA 3WNKA 4C6MA 4DYJA 1EXPA 3KBNA 1MW3A 2PP1A 1UD3A 3AHXA 3S1GA 1T6MA 1NJJA 2GJXB 5FEPA 5CJMA 5EY5A 3KW3A 3KRBA 3RLVA 1TMHA 3LLFA 3QV9A 2BXYA 3VIGA 1F73A 3LHUA 5CC7A 4CLMA 4DWSA 1SUXA 1GQNA 3MBDA 1QWKA 3AHYA 3CMFA 3QTGA 3TC3A 5DRIA 1MEWA 3TWBA 1H7OA 4AXKA 1N55A 1G4TA 5BZAA 3MI2A 4OQVA 3RR1A 4ICNA 5A6BD 1UKTA 1I1XA 4TTGA 4PTVA 3OTRA 2OTDA 3C2OA 2XG9A 3AMLA 1I2NA 1WE5A 2OWWA 3NL2A 5M03A 3CUXA 5G2WA 4D6CA 4RJEA 2X09A 3PF3A 4DPQA 3WL0A 5HA7A 1ZGDA 5CPOA 3N4EA 2JBMA 3UXKA 1TMQA 5EA9A 5F2MA 4R7JA 4B5WA 3DHUA 3U8GA 4V33A 3QZAA 3A47A 3HGSA 4G7FA 4Y9PA 4AFYA 1O5XA 1BXCA 3M7SA 3URAA 1GOQA 1DIOA 1EZ2A 1AD1A 1OIFA 4RUBA 5D38A 2XIOA 1GUVA 2Y61A 1LDCA 1KBBA 3KVKA 4UCFA 4AD2A 3VIOA 2B4GA 4XD4A 5HMFA 3UU0A 1ITUA 3B40A 3IIVA 3IARA 5C9XA 1CPUA 4DBEA 1ZL1A 4Y9NA 2J4GA 4EPDC 4WEVX 3THUA 3PSWA 4I7WA 1FA2A 3UWVA 1GNXA 4AX7A 1F6PA 2W67A 3CUGA 4GY0A 1Q7QA 4RV8A 4AC7C 4A2RA 4Q4KA 1UWAA 4M6UA 3HJZA 3W73A 1E9LA 1GG0A 1KM6A 4KCUA 2D22A 1GVYA 3NSNA 4OWGA 4DX3A 4DXKA 3QN3A 1PKYA 2Y4SA 4QE1A 3FDKA 3W71A 3PTDA 4LTSA 2BFGA 3U2OA 4WXYA 2Z2BA 1TQJA 4GFIA 2VX4A 5CBIA 5FJTA 1M7JA 1UP3A 2OG9A 4KF1A 2NQLA 3GNOA 3EKZA 4GVFA 3MB9A 3KCJA 3BW2A 1GVQA 1PSCA 1OM0A 2YX0A 3VNKA 4AD0A 3QLDA 4O50A 1E3ZA 4CEUC 3OHMB 2ZRWA 1PWLA 4TOQA 3KTCA 3SCQA 1J2BA 1AL8A 1ZY9A 3TQPA 3ANUA 4IX2A 3ELFA 4YTRA 1CENA 4GVIA 5FAGA 4EANA 1Q63A 3BZGA 3O1NA 4R85A 3AO0A 3D46A 3W86A 3R12A 5I79A 4LVBA 4CVWA 3GFXA 4O14A 4Q4SA 4D6IA 3O0KA 3K4DA 3GDMA 1ENUA 2VUNA 1XRFA 1F9CA 3NYDA 1IT8A 1K6WA 3LY0A 4IMFA 3HGRA 1DQXA 2BASA 3BAWA 3CL6A 5D9PA 2QUMA 5BOEA 3LG3A 5EYWA 3GC5A 2UV8G 4JY9A 4NJJA 3NDOA 2J62A 2BVDA 1NOFA 3GG7A 2G96A 3WMSA 1DORA 1VFLA 4I8YA 1HZYA 2PDYA 3AS2A 3BANA 1X1OA 4Q7IA 3NQMA 3RLGA 2HJPA 4PTMA 1JD7A 3FSTA 2HRWA 1R9XA 2FVLA 1W9VA 2X42A 4NI3A 3FJ6A 4UFMA 2YCLA 3PM6A 2I14A 1MFVA 4ZE4A 3BO9A 2WVVA 2XGIA 4QCEA 3N2TA 1VLIA 3WFAA 3FOKA 2OFJA 3URQA 3GTXA 5K4ZA 1S38A 3PPHA 3F5JA 4PRWA 1FP8A 1FDYA 1US2A 4AIBA 2D24A 3ERPA 4Q8VA 2BP1A 1VBGA 1EX1A 3LNPA 5I2UA 4E0CA 3PHAA 5HULA 4RDYA 3VI2A 4XKYA 1AQ0A 2I9EA 3TMQA 4QTGA 2ZTJA 3B3DA 3D6NA 4H41A 2DIJA 4R9OA 3S9YA 2YDQA 4CU8A 4EIVA 4Y9OA 4ZXOA 1VFFA 3JS3A 2V69A 3FV9A 5LSMA 1OINA 4IIGA 3P74A 2WBKA 1CB7B 3ATZA 1E4MM 2NQZA 1E1EA 3PZQA 1E6RA 4YYFA 3HPFA 4I9AA 4PTNA 2PCQA 1QPOA 4CD5A 1RK6A 2XWDA 2IQ0A 4ATDA 4HSOA 3AOFA 2ACQA 1IWAA 3LHVA 7ENLA 1QI0A 2OQLA 4HMEA 1XPGA 2DZXA 4JFWA 3INPA 1F3TA 3T05A 5FJUA 3LX9A 2ISVA 4DN1A 3A3HA 3IPWA 4Y8EA 2Q8XA 3NPVA 3F2DA 5EFFA 3E0WA 4JTJA 1VFHA 3WELA 2XUCA 4TX9A 2VR2A 2ZA1A 4UTTA 4I7VA 1WZMA 1TUXA 2Z1WA 3CHEA 4L80A 4PCFA 1VFOA 2OODA 5CBBA 2OZTA 3QQWA 2F8QA 1TIMA 5AZ1A 1D7KA 5LNRA 3NEVA 3W24A 5LIWX 1Y0EA 4LH8A 1S5MA 2YBVA 1WOBA 2DJLA 3XIMA 4K1WA 3M0KA 3W76A 3GM8A 2BY3A 1R47A 2FFCA 1TTQA 4M1BA 2ISFA 3B9EA 3N25A 1EA9C 4KEUA 2NX3A 3DG6A 1B54A 3NPWA 2JEQA 2ZC1A 3HPSA 3MI3A 1W9PA 3MU7A 1SZRA 3B9DA 3ZYZA 1LOQA 2BNJA 3SGUA 2NT1A 1XDMA 1WDRA 3TYAA 3ZLGA 4D6EA 4REQB 2YR1A 2B0MA 2D1ZA 5H8MA 1XSIA 2QHAA 1UOZA 2V38A 3KVLA 2WJFA 1ZRQA 4J2MA 4LUTB 3F5KA 1AW1A 4GI9A 3V5CA 2ZFAA 1FXQA 3HN3A 3DBNA 4XZWA 3AJ7A 3KRSA 4DJEC 1RA5A 4H2CA 4NX5A 4CCZA 1I2PA 1AVAA 3EB3A 5A2BA 3TQ0A 1L2UA 5D2XA 3UZZA 3P60A 1F76A 5EMKA 1GQLA 1CXHA 1K70A 3IJQA 4NILA 4DLFA 3EX3A 2Y8KA 5A8NA 2HBVA 1H4PA 2ZRYA 2YCIX 1VPQA 3EMZA 3OZPA 4MLRA 1UH3A 4MVAA 1HO1A 1SYTA 2VEMA 5BMXA 3A9IA 5DMYA 4IMDA 5DT5A 3RITA 3S5ZA 2WLZA 4OVXA 1FWGC 3TR9A 1JCJA 3SCRA 1E6NA 3M44A 3LCFA 4AD1A 4N6FA 4FNQA 2HBXA 3RILA 2YBTA 3EGJA 1DEDA 4DUWA 3N34A 4CNUA 5A94A 3ZQ9A 3N2BA 4GA8A 2E1WA 3WD0A 3AIQA 1PZ2A 1JR1A 5CZSA 4F8XA 4A6GA 4WIWA 5G2HA 1KWGA 5CSUA 3VINA 2XIBA 4ZFMA 3CPRA 3M47A 2CLOA 1XWYA 4O54A 4E2BA 1NAL1 2XDFA 1DTNA 3EZ4A 2NQJA 4DO5A 1JGMA 3BE7A 3ZVHB 3GU9A 1FWTA 4A3YA 4C6FA 2YW4A 3GFYA 1HIZA 4KWSA 3WQ4A 3POCA 3L2IA 1MQPA 3UWYA 1KLYA 2PDNA 3ARUA 5E1QA 2VFEA 1OFOA 5KZDA 2GOUA 4HZMA 1PIIA 2WB5A 3A4AA 4A35A 2GGGA 4WOZA 3CEPA 4QE4A 2VR5A 1T0OA 3GNXA 3W00A 2FMOA 3DFYA 3C0SA 2JF7A 5I7GA 3WDRA 3E5BA 1J01A 3F4WA 3W2NA 4AZCB 3KBVA 1FWCC 3W74A 5LKYA 3IS4A 1XLAA 2OZ3A 4IIFA 3F1QA 4PB4A 1LBMA 4XUGA 1ZP3A 2VGFA 2YB4A 4AZCA 3K8KA 4LY4A 9RUBA 4DZ5A 1UC5A 3TXVA 7CGTA 1QW9A 3EWXA 3PUEA 2QR6A 3VDHA 2VQTA 4Z0JA 2E9MA 2OOGA 4DB7A 2IKJA 3ITOA 1SQ7A 3ZWSA 1F3WA 1ZSXA 3RYSA 4P5UA 3EX2A 1TPH1 3ZT6A 3VMNA 1NDZA 3H23A 3W83A 3LHTA 3PBMA 2Q3RA 2HWGA 2QAPA 5F4SA 4NYYA 1YBQA 3FA3A 2IXVA 4I9MA 1E9IA 1S5WA 3WQVA 3C61A 2WZIA 3D5HA 4NJHA 4Q6JA 3G1DA 4YL2A 3CTTA 1GJPA 4MZYA 1QO5A 4XAPA 1JPMA 4LUJA 3E0FA 2PTZA 4M24A 4EAYA 1GTEA 1NWRA 4XBKA 3KCLA 5HWNA 4UOZA 2AGTA 3KE0A 3W7CA 1UIPA 3P84A 2C1GA 2WNNA 4WD0A 4JHMA 5CC6A 6REQA 3KHDA 1KBLA 1VS1A 4JX5A 4ZODA 3NCOA 5CPNA 4HT3A 1H5VA 4ZBCA 1GYNA 1KO0A 1VFUA 4OHQA 3BW4A 1YNQA 3EA3A 3LRMA 1N8IA 1KB3A 2Y88A 1KGXA 1QT1A 3B8WA 4FK9A 3EBVA 2ANUA 5DRCA 1LRTA 3GH5A 4LS2A 2Y63A 2OGYA 2PBOA 2ZICA 1BGAA 2XH2A 5XIAA 4EKJA 3KBSA 3PJTA 2ICSA 2I5GA 2X1TA 1EP1A 2DQWA 3SFWA 3E0VA 2XGBA 5BU6A 1IWBA 3UCQA 1K77A 3T7VA 3HZ3A 2C1HA 3BAIA 6XIAA 4BA0A 2YOCA 2XVLA 4S3CA 4AEEA 1BWVA 4H7CA 4CU7A 3U2CA 3RPDA 4IUGA 3L21A 5K4XA 1WP6A 1IR2A 4IGHA 5ECUA 1VBHA 2V3EA 1WDDA 1B4EA 4IIBA 1U22A 4W8BA 4GGHA 5FSEC 3CHDA 4RXGA 3W1XA 3UXAA 3L0NA 1EWEA 1UCWA 1U1JA 3WD1A 2WPBA 2VZTA 3DDMA 3OODA 4H9YA 4NAEA 2X05A 1NWUA 1EH9A 3CZJA 1AL7A 1VJSA 1EJVC 1ADOA 1VBRA 4R53A 3SZ8A 5LIXX 2GWNA 2V3DA 2J6XA 4S1FA 2GGJA 1EBGA 2QYGA 3VKJA 3PC0A 3WLKX 1XYAA 3W2JA 4IPPA 3UZJA 5AHMA 3W7GA 3LHYA 1M1BA 4IMEA 4Y90A 4KH2A 4QHRA 3DFSA 2J74A 1US3A 4Q8UA 3R58A 4OT7A 3TKFA 3KXQA 2DVXA 3PPCA 3W7HA 4HJFA 2A7NA 4L4OA 4Z17A 2ZE0A 5AC6A 3WQDA 2CCRA 1I1WA 3FEQA 3UYIA 2YLAA 4Z1DA 4XD3A 5IRPA 2NVCA 1TPC1 2J78A 2VYOA 3O6YX 2PF8A 3CUZA 2JFEX 2F2HA 3CL7A 1H1NA 4QAIA 4QQ3A 2OT1A 1IV8A 3UQNA 3DEQA 4O4WA 4RNIA 2VT0A 2FGZA 2RJHA 5ABEA 5REQB 2W63A 3CK5A 4D71A 3S8HA 3V4BA 2D2HA 2WNWA 6A3HA 1OHLA 3BV7A 4P8XA 3W01A 3TVAA 3R8GA 1CGWA 1S3HA 5E9XA 4F66A 1TA3A 1IYXA 1BRLB 3W1QA 3NPUA 2DVTA 4KRUA 1P7TA 3NWRA 1M01A 3RF9A 3SRFA 1JEZA 2YZ5A 1LUCB 4WKFA 3L4UA 2AAAA 3R25A 4AWTA 3V1PA 4XKYB 1A3WA 1FDZA 4UQ9A 4GABA 1TR1A 2XVPA 4O28A 5IM51 3GDRA 3HPXA 3IAQA 3F2BA 1J6PA 2FZDA 3TOPA 1OC5A 3IJ9A 2CYGA 2OO0A 4JQAA 3MO4A 4HCDA 1IZJA 1QBAA 1W3TA 2WM1A 1V7YA 1KTNA 3VKDA 1CT5A 2EPLX 4DLMA 2BOEX 2QUNA 3IIXA 1XLLA 1OG0A 3ZIZA 1THFD 5I24A 1ISVA 3FX4A 2VUYA 1UWQA 1ICQA 1D8WA 4U4MA 4GACA 4TX8A 1UA7A 4GOAA 2VP8A 4K38A 1QNOA 5HQEA 2DZPA 3BXWA 1OX6A 3H24A 2R1KA 3NPXA 1DIDA 1RY0A 3ZVHA 3VUSA 4P7OA 3GW0A 1CECA 1K03A 4GHRA 4JIRA 4PMQA 1DQUA 3ARSA 4IOTA 4PC8A 3GC2A 4O12A 5JBFA 3OGVA 1J0JA 2PDWA 5HPOA 3PWAA 5D9NA 2Q71A 3OU8A 2MANA 4HK5A 1WDQA 2V63A 3AMDA 1JDDA 1ZENA 2XSBA 3ZR4A 1OJXA 1KCLA 4GBDA 1O7AA 4HYRA 4MB1A 4QRNA 3KZSA 1P0EA 1JPIA 1XCFA 1IF2A 1LROA 2IUZA 4Q8WA 4BEUA 1AH0A 1J0IA 1GVEA 4WDUA 4U10A 1NOWA 2QAFA 1XLKA 4PMNA 4MFEA 4NZ3A 1R3YA 1W5MA 3MKKA 2D20A 2J7BA 1GOOA 3QQ1A 1S1PA 2C1IA 3HG2A 3POHA 2XFRA 3OP2A 4AWSA 3GQYA 2FHCA 3DN5A 1NWTA 1FQ0A 3LRLA 5HDRA 5D2WA 4LPCA 3MP4A 4G56A 4TVDA 3CAWA 3BK0A 3ZXWA 3GG8A 2QCFA 4HCLA 1YRRA 2J9XA 1CGTA 2FZNA 4ZB2A 1BQGA 3CV2A 4PEEA 2I1OA 5AOUA 3T8LA 4OKDA 3TN4A 2GGHA 3CH0A 4ORMA 4AHPA 1WQ5A 3CEUA 4FLOA 4G1KA 1L2QA 4JFUA 2E9LA 2PSNA 4GQBA 2V0TA 1OFRA 3GB6A 4B2DD 4WVXA 3HGOA 1ZAIA 1KRCC 1HW6A 2ABAA 2PDJA 4ROPA 2VZOA 1XUUA 3W6YA 2OZ8A 2A7PA 4ONVA 1M04A 5AECA 5JUVA 3LTPA 4MJMA 4IJRA 4FAMA 1GW9A 2BOFX 3R0KA 4KCVA 4IQDA 5E09A 1HP5A 3T0AA 4M0XA 1UKPA 4XQ6A 4A3RA 2QPSA 4JKKA 4W5ZA 1EP2A 4HNUA 1A49A 1IIHA 2HCVA 4HQVA 4ZO6A 3G5EA 1DJNA 5JBDA 3RNDA 1JZ3A 1JI2A 1OF8A 1OFAA 4GUHA 4PEKA 1OGBA 4U28A 2Y85A 3EX4A 3I68A 4JX4A 2BGQA 2Z0IA 2YL6A 1C91A 4JNYA 4Z2LA 4K2SA 1OYCA 1W1A1 2ATMA 4DJFC 4UTLA 1S2TA 3S9IA 3CXOA 2WNQA 3WQWA 4OZOA 1LG1A 1C29A 1PUDA 3STGA 2IPFA 4MGGA 2PCEA 4B3LA 3GC4A 1ZLPA 5CXPA 2PWEA 1CLKA 1DTUA 2WBGA 2PI6A 2RDWA 1TKKA 4WRHA 1VR6A 4QQUA 3DFQA 3WLTA 1V3MA 1K8CA 1VIZA 8CGTA 1QWGA 3IVSA 1BG9A 4MJ4A 4NI8A 4MPKA 3WUBA 2ASHA 2NVAA 1OFPA 4WJXA 5IDIA 3IVUA 1E5JA 4LVAA 4OECA 3MMDA 3NM1A 2G41A 2WVVB 1WZAA 3FLUA 2JQXA 1Q4NX 4UUIA 1VHNA 2Y7FA 4DELA 3KLLA 2NUYA 2Z00A 1UASA 1W1VA 4UMCA 4C6JA 3SFKA 3SEPA 3VX1A 1XH1A 1FWJC 3AXHA 4QP0A 3DHDA 3Q4DA 5AC4A 3TTYA 1KBJA 1JZ5A 1RBLA 1JZ2A 5FEXA 3L2MA 3CUFA 4XZBA 2FLIA 5C5YA 2PD5A 3QR1A 5BOOA 4F9JA 3DI1A 1N7KA 1TR9A 1JJKA 5H2ZA 3AZSA 3VE7A 1F8MA 2A3AA 2ZUUA 4P7RA 4LCQA 2QMJA 5B7YA 3FJNA 4RDVA 3P80A 3LI1A 1JYVA 1JCNA 1SZNA 2NQ9A 4B2DA 4BFAA 3TNOA 5DBTA 3PPGA 4YNGA 1RCQA 1NFGA 2PMQA 1BVZA 2R24A 3NYZA 2G97A 2HE5A 1X98A 2V3FA 4O1FA 1LQAA 4MMWA 5A6MA 4NXKA 5C9UA 3V16A 1E51A 5I23A 2PC8A 5K9CA 3D47A 3WDIA 3S1WA 3NURA 1PWMA 5EMYA 1MNZA 5C8BB 4LFYA 1TPB1 4FZIA 1X39A 2OEKA 1K9DA 1M3UA 4KIEA 5G1TA 4MZ1A 4Q32A 3EEZA 4NF7A 3W7IA 3UETA 3U2ZA 2F6UA 4H04A 5A8QA 5C55A 4HK7A 4JIEA 1KW1A 5AHIA 1VLWA 1WDSA 1B3ZA 1EO5A 3VTRA 1DV7A 5I3HA 2I16A 2C19A 3CAVA 4LF2A 4OGZA 4ZQMA 2PDCA 3NO3A 2WMJA 5AC5A 4GPNA 1JYXA 1P0BA 4WUIA 1XRTA 4O13A 4BI7A 1R2RA 4EACA 4Q4MA 2QJIA 3BSGA 4RPQA 1UBPC 4YTUA 4GE8A 4JN6A 4UOQA 1XSJA 5EB8A 1UWRA 2X1SA 4JD4A 1YTDA 2WOQA 2NQHA 2PS2A 3ONBA 3L4XA 3E3HA 3FFSA 4W7WA 3BSMA 1T99A 5G5IA 3WMBA 4UNKA 2X0HA 1KFCA 2E5DA 3R0DA 4IJCA 3OQ8A 4HMDA 1RH9A 2A1YA 1B57A 3UJEA 2VELA 4ZO9A 3V3WA 1YW1A 4GKLA 1BF2A 3WF2A 4E4FA 3TYEA 5DCBA 1XGDA 3KOYA 4UTKA 1B31A 1PX4A 3MMTA 2PF0A 2QJNA 5BMWA 5HMEA 1EF2A 3IEBA 5EPDA 3UZYA 3S6TA 1RHCA 1GPFA 1DP0A 1C3FA 3WBWA 3UY7A 3VABA 3RLUA 3BG5A 4L9ZA 2ON3A 3L7RA 3FW6A 4NL1A 1TG7A 1JYWA 3K46A 1V02E 5REQA 4P61A 1DXEA 3PJUA 3CB8A 3CQIA 4UNLA 4KS0A 4L4MA 4QJ5B 4YYCA 2NLYA 4FNUA 5EMLA 2GL5A 3BDKA 3G3DA 3VD3A 3LA4A 2AQVA 5FF0A 3LGDA 3HU7A 3FA5A 1E1FA 1W1B1 2VGGA 1RJRA 3R1ZA 2HS6A 3H70A 1XGEA 5DQPA 1JYNA 5DMMA 4TUFA 4C6KA 4ZQPA 5SWUA 1M03A 1YLVA 1FXPA 1IGWA 4IXHA 1XD1A 4QBXA 3STEA 2PDIA 3W7LA 1N8WA 1EIBA 3AXKA 1XSKA 1EQPA 3CC1A 4CCCA 1GKPA 3LDVA 4XTIA 3EB2A 1ZS2A 1WAUA 1XW8A 3G6LA 1IWPA 2ZOXA 4XB3A 1F3XA 3ABXA 3EYPA 3MHGA 3SO7A 1V79A 4Z08A 2ZQ0A 2NSXA 2J24A 3S47A 1K7EA 3HA1A 4QS6A 3WQCA 2A6NA 4AQLA 2EQDA 3WSUA 3C0QA 2YW3A 4OUIA 1VCGA 3E0LA 2PDMA 2VRJA 1NSJA 4DPPA 1BYBA 3A3WA 4AF0B 1TWSA 1E56A 2HK1A 2OLSA 4C65A 3QMRA 2CXEA 2Z27A 1EQCA 1MI3A 3HF3A 1OCJA 1A0EA 3LI0A 1KBKA 3GH4A 1KRAC 2VC7A 3IUDA 4O17A 4G1NA 4ICCX 3SRKA 4GC3A 1V3KA 2NUXA 1VHCA 1XC6A 2VDGA 1W1IE 3VXGA 3L66A 3AIRA 3BTNA 1JUBA 3KLKA 3M0YA 4ZFCA 4B4FA 1HUVA 1JNEA 4C6DA 1WV2A 3S4TA 1KFKA 4JYFA 3TXZA 2CZ5A 4IF2A 4K6AA 2A3EA 5KITA 1EGZA 1US0A 1OC7A 1NH6A 3QMTA 4HU8A 4MWAE 4X61A 5AC7A 5A8OA 4JYEA 3QY6A 1MNSA 1DWJM 4DHGA 3PANA 1JNDA 2FJKA 2IQDA 4KRTA 2FJUB 3LCHA 2CLPA 1VYPX 2GJPA 3QW4B 3AMCA 3O8AA 4LT9A 1KR1A 2D2OA 3EXTA 3RXZA 2GGIA 4NVTA 1HL8A 1M7OA 1BSIA 2JKEA 2Z6IA 2RJGA 4TVUA 3B0YA 1Q6RA 1TJRA 3PUGA 3KCOA 2AQOA 4QITA 3NGFA 3S2MA 3HPZA 4LUIA 5DLCA 3S5OA 3W7QA 3GHTA 5CLTA 4Q4RA 2WC3A 4AC1X 1SO6A 1M6JA 2CNCA 1CI1A 3BPWA 1ZPTA 4O8RA 5CPTA 4AYSA 3H4WA 1PZ1A 5A6TC 2O0TA 3EKGA 2VR4A 5BW6A 1SJAA 4HZ7A 2A4AA 1EC8A 1GEQA 5LNVA 4KCWA 4RXFA 2EKCA 2X1RA 3UG3A 2E8ZA 4DNHA 4M19A 1QI2A 3B8UA 3OLDA 2X16A 4GISA 1QNSA 2Y24A 4Q7BA 4B5XA 5TBOA 2ZCGA 3JR2A 2ZXBA 4XAYA 1P0KA 4A8IA 3FVDA 1Q8JA 4UFJA 3ZLFA 3SUUA 5LIKX 1XINA 4N7QA 4WLCA 4NZJA 1FWSA 5FCZA 3CM4A 3W29A 3UT0A 1EGMA 3LU2A 1EC7A 2EHHA 2XISA 4MB4A 1OT1A 2H6RA 4DUXA 3TNBA 1K9EA 1PO9A 1DJGA 4PB3A 3WD2A 7A3HA 3CZ8A 3P8IA 1BKHA 3RMJA 1H51A 3ZOAA 2EAWA 3LGGA 2YL8A 4F0HA 2YL9A 2YDRA 5JH2A 3SJNA 5D04C 4LCSA 3FVMA 1MXGA 5AHEA 3LUTA 3FCPA 4MJ2A 1X1ZA 2CFFA 2PTWA 1CTNA 3W2KA 1RQEA 4FS9A 3SUTA 4D6DA 2H9AB 1YBQB 2IQTA 4IP7A 3KTSA 4QGCA 2V5KA 2OQYA 4O1DA 1LP6A 5FJPA 3TE9A 3TYDA 4LUYA 4QM1A 3D0CA 4YJ5A 2GVJA 2IS7A 3CMGA 3TTSA 2OXNA 1X6LA 4GNVA 3FXYA 4W7UA 2EBNA 2BV9A 2R8WA 2DT1A 5E6YA 4IIDA 3W7RA 3FYPA 4H1ZA 4TR9A 3UD6A 1OCQA 4ZTXA 4F0RA 1UD6A 3WJWA 1DJHA 2FVKA 1A0CA 2QKFA 4G9PA 3B97A 4J3SA 5A2AA 3SCUA 2YYUA 5PTDA 1CGVA 1VEPA 3TYBA 2QCDB 3VNJA 4BS0A 3TWAA 3UXDA 4R9XA 2UY3A 4NJKA 3GYCA 4GYJA 3EXSA 3T78A 3VGEA 2P50A 2Q8LA 4FHAA 1Z89A 4XUYA 2OZ0A 1OIMA 3WUFA 3QFEA 4E4PA 4CQ8A 3UWUA 1QI4A 3CZKA 1W3NA 4CNTA 1POKA 3BSHA 4BCEA 1JDAA 2EEXA 4HNCA 4HBKA 3VDBA 1E4IA 3ZR6A 3WDJA 1Q6FA 4D6GA 4B90A 2NXGA 4BEQA 2C3ZA 3MYOA 1LUCA 3OBAA 1EKOA 4QISA 3LMYA 5DN1A 1W5OA 4LANA 4WSHA 3NG3A 5LIYX 2H3BA 4IISA 1P7TB 4A3UA 3FA4A 1E4LA 4IPJA 3QPZA 5E9AA 1UP2A 3RM9A 1TV4A 1XISA 2HQAA 2VO5A 2PDLA 2XZ9A 6TAAA 2QGHA 3HQPA 4FNPA 3EDEA 4TMBA 1ZJHA 3VOIA 1WXYA 4XZMX 5BCAA 2UWFA 4IGMA 1QK2A 1TVLA 1BSLA 2A3BA 3TYCA 4HU0A 3WH5A 1S5NA 4TV6A 4W87A 2GJRA 4M7TA 5HK4A 3M07A 1FBAA 3CUJA 4UTWC 3YPIA 2EG6A 1KBIA 3JZEA 2I57A 2W91A 1HKJA 3N11A 2VFHA 3H4GA 3P8JA 2QF8A 1UA3A 3WBYA 4J4KA 5HNRA 2X7WA 4NZ4A 4K8GA 1B3XA 2E09A 3MQTA 1VAHA 1JAEA 3GO2A 1J11A 1W56A 1B2YA 3W22A 2DZWA 2JIWA 4Y6GA 4GVHA 3BZJA 1KCXA 2WSQA 2DPEA 2UBPC 4LRTA 3IK2A 3F4DA 3ZJ7A 3EWUA 3WJYA 1DE5A 1F74A 3AWNA 2ZX9A 4DWDA 5FEWA 1JVNA 4O4VA 3B9OA 1K3UA 2BXVA 3IK4A 1CX9A 1SJCA 2DGAA 3O6CA 3UW6A 2YXGA 5AYYA 1S2CA 1ITCA 2R94A 3KUMA 1H62A 7PTDA 1QO2A 2DZUA 4CCEA 5J04A 1GCYA 5CJ5A 3VMPA 2ZX6A 2QCHA 2XU2A 4LUTA 3WJXA 1XYFA 3F4CA 4A29A 2RUSA 2RGLA 1GQIA 1ZJAA 4AG0A 4E8DA 3MUCA 1AJ0A 2DY3A 4LB4A 3UZ5A 3I3BA 1E55A 4BI6A 4ZEPA 1W5QA 1XG3A 4ICMA 4HSHA 1BKSA 1JUEA 3BLIA 3URBA 4JIIX 4D8LA 5JH1A 3DFOA 5BXPA 5HQMA 3KTXA 4KWWA 1Q2RA 3VCNA 1O5KA 5LZLA 3DXIA 1XYMA 2DIEA 4AHQA 1VH7A 3VIMA 3R79A 4M7SA 1ZAHA 3BCJA 1D9EA 4XVDA 4V15A 4BWLC 5BWFA 2UY5A 3LS9A 4JBRA 3T08A 4ENLA 5JU6A 2WM0A 5HUPA 4QEHA 4IH3A 2ZXAA 1G7VA 1MZHA 1YE6A 2Q8ZA 1JDCA 3NQ6A 1EPXA 2A5HA 3IRDA 2JKAA 1RLDA 5I06A 3U7BA 1KFLA 2Y8VA 1QR7A 1O66A 2OQHA 2D23A 3VNIA 4LEFA 3GDLA 1Y7VA 4J2PA 3VX0A 4F4RA 1ZFJA 3BLEA 2G3JA 1JCLA 3G0SA 3NQBA 4GI8A 4MF4A 1EYEA 1YTEA 4OTKA 1SMAA 3GK0A 1GKQA 1S46A 2TMDA 1KM3A 1TRIA 3BAJA 3CYJA 4XIAA 4LVFA 3AIVA 1S1RA 4F0SA 3DFPA 1YADA 1B3OA 2BLEA 4GYPA 4HGXA 3ZO9A 4LU0A 3MA8A 2XINA 1CWYA 1WKDA 3T40A 5F2GA 3WDQA 1W3HA 3NR0A 1R5YA 2VRKA 1RD6A 3DC0A 5FF3A 3ZR5A 3CH9A 3NQ8A 6ENLA 3E5PA 1TIWA 1UKSA 1WOAA 3CHFA 2PLCA 3Q67A 1GGOA 1GK8A 3MVIA 4AUBA 1W54A 3FHAA 2QJGA 1E43A 3HG5A 3P14A 4E2DA 4NNAA 4AMCA 5I0DA 2X2YA 4HPJA 4X0VA 3AJXA 3UA4A 4K8HA 4CQ9A 3TCSA 1O95A 3F03K 3PZIA 1MXDA 5GNXA 3VD5A 5EBUA 1Q7ZA 2XIQA 3DIPA 3GDBA 5K9XA 1TTJA 2VL4A 4EP8C 2YA0A 3ID7A 1ITQA 4UBPC 2BVWA 2V67A 4HTBA 1WB0A 3NQ2A 4DZAA 1C7SA 3GIQA 3ZMRA 1I4NA 4M51A 1CEOA 4FOUA 2TAAA 2XSXA 4C7GA 1POJA 2OU4A 3BCDA 5CC3A 3ABOA 4DBUA 4AB4A 2JIEA 3S6DA 3H22A 3TCEA 3TQVA 1H7NA 3VIJA 1JL8A 1AH4A 2DU2A 4E38A 2CLKA 3QOMA 4HU4A 3T4WA 3GAYA 3FDGA 3PBVA 1FY6A 2ISDA 5AHFA 5KINA 1GYLA 4C6OA 2Z1BA 5AKQA 4Y7EA 1NDVA 4LV4A 4ADTA 1NDYA 3AIEA 2YIHA 2J7GA 3QV8A 3SURA 3ZSTA 4QNEA 4PH6A 4CD6A 4IP4A 3B8IA 4DUVA 3WBEA 2I7GA 1S3TC 2NUWA 3KZPA 1Z44A 1V0NA 1JF5A 4FOJA 3QM3A 1M7PA 3PBGA 1FWEC 1VPXA 2OOFA 4M8UA 5BXRA 4MKNA 3WH9A 3I6TA 4N2YA 3U9IA 2NV2A 4CUCA 2ZX5A 1QNPA 3TK7A 1VEOA 2ACRA 4GY1A 2IXUA 2PU1A 4RX0A 3NQFA 5DCEA 4RNHA 1KCKA 3H2FA 1JIBA 3H8AA 2WVUA 2F6KA 1UW9A 4IXXA 4UTUA 2ZUTA 1Q3NA 1H11A 2VVSA 2DUZA 4RE3A 2IKHA 4ECLA 2OWCA 2CPUA 2AL2A 4E5TA 3VPLA 4O19A 1FWWA 2YPIA 3DX5A 4FX6M 4PMDA 4S3GA 3VNZA 3UZWA 3NDYA 1XLFA 1V0KA 3LLXA 1RY8A 1XLEA 2G8ZA 5H8PA 1F05A 2VURA 3I7RA 1M7XA 3WN6A 1PHQA 4OOZA 4TXEA 1A4LA 4Z2JA 5AY7A 3WMLA 2XYLA 1R9ZA 1NELA 2B31A 4PMVA 4FLQA 2Z1KA 3VGBA 1IEVA 1AZ2A 4GUJA 5G4EA 2ZXDA 1UIOA 3IACA 1V0LA 2P1FA 3OW1A 1AK5A 4PUKA 1P0NA 4OJYA 3DYMA 4UQAA 4J40A 4Y9MA 5DXXA 3UVIA 4KFOA 1R3TA 3GXFA 3ZVIA 3VGGA 1IT0A 4BZYA 3CAQA 4WKAA 2WSYA 1LLWA 2HEJA 3GKAA 3RRXA 3GNDA 1ZNNA 3S5YA 3H2CA 5A6SA 1F5ZA 4ACZA 1XIJA 3BH4A 4GUIA 1G0CA 5C54A 4CN1A 7TAAA 1C8YA 2ZVIA 3SADA 4N0RA 4KRZA 3AIWA 4AZGA 3PBYA 5KTLA 5HR7A 4UXDA 5F4XA 3CLMA 1OCBA 5MHBA 3LBMA 4FIQA 5IBXA 1PPIA 4JEQA 4PYSA 4F40A 1J79A 3COTA 3KOZA 4GJ1A 1KM4A 5FF7A 4NT0A 5CAHA 3E12A 3OHIA 1B9ZA 3IUHA 1X38A 4HA1A 1C92A 2O56A 1UPPA 2BXZA 5LYRA 2KAUC 3PWGA 1VC4A 3BLFA 1TPFA 1YX1A 3EOUA 1KM0A 4PUJA 4QROA 3GS6A 2XGZA 2C0HA 2FZ8A 1N82A 2V68A 3DGBA 3UJSA 3W6LA 3NIYA 2WHJA 4UFKA 1UQZA 1AH3A 1XYLA 1XYBA 3OBEA 3WK1A 4LF1A 3V75A 3OVRA 4PUWA 5JBEA 4J3WA 3W88A 2PGWA 4ADSA 1SPQA 1XBZA 4RV3A 1UD4A 5G4WA 1OGSA 2WZTA 3LK6A 2MUCA 4KWOA 3P3BA 4JL1A 1W1YA 3RPMA 4JQ1A 1EPVA 2O9RA 3KX6A 5JIPA 4IQLA 3M9YA 4EAMA 1XLMA 3VD4A 2B7QA 3LXCA 4L56A 2BG5A 3M64A 1WX0A 1KC7A 4PCNA 1GOMA 3W1MA 1XYZA 1EEPA 4HZ8A 4Y96A 3VDGA 2DH3A 3GVRA 3NVDA 3PB2A 1L6YA 1XRSA 1SJDA 4UR8A 3GHRA 3W70A 1C7TA 1XH0A 4NNCA 2O55A 3FS2A 2OKTA 1CDGA 1NTHA 1S5TA 4IUOA 5CSRA 2YXOA 1UUQA 4W8AA 1K8ZA 1QOXA 4J1OA 5CSYA 5J8LA 3GD6A 1FX6A 3PNUA 3KHJA 1YQ2A 4HOWA 1R3SA 3OA5A 1SR0A 2R82A 4QR6A 3VCRA 4KFNA 1J0HA 3AC0A 3BMXA 4JTKA 4LEQA 4WOQA 3UGVA 1VYRA 2P0IA 3AROA 3KOFA 4P7QA 3VO0A 2TYSA 1FKXA 1XPYA 4LBRA 1A5CA 4HYVA 4TX6A 4N9EA 1LL7A 1SZEA 1UZHA 4EVZA 1GJUA 4HKPA 1ONXA 4JR5A 1FCVA 1QI5A 2Z25A 2CZFA 5AB3A 1VBUA 1TX0A 5F2IA 4GX8A 2QPUA 1ECQA 4O16A 1KXTA 4LYRA 5B7ZA 2A3LA 4UFIA 3ISIX 4C7FA 3CQ0A 4UQBA 5KETA 2E9BA 1LWJA 1F7BA 4US5D 1CZ1A 4Y9AA 3SUWA 4O1EA 1PBGA 1LOLA 1IEWA 3VZXA 3L5MA 2XN1A 5LHFA 3CIWA 4S23A 7TIMA 2NQ5A 3B9NA 1V6YA 1G6CA 2E7FA 5M1TA 2DT0A 3O6AA 3H21A 4GI6A 4Q8NA 4TMCA 3C86A 3OZOA 2BY0A 2WCSA 4GO8A 3L67A 3STFA 5I3FA 3NZRA 3V0UA 5I6SA 4LW7A 5TF0A 4H6RA 3THCA 3LHWA 1JDFA 5BU9A 3LBCA 1Q6GA 2WJZA 3UXIA 2XIJA 2PWHA 4UNIA 2C8NA 1UP0A 4KFPA 2VFDA 1VRXA 3W28A 4H8VA 3T2PA 1A5AA 4YTSA 1DWIM 1YPFA 2PTDA 3T0TA 1WUEA 4MDOA 3EAUA 1G69A 4ZOAA 5E0FA 3N17A 2E40A 3PSVA 4MDPA 3S2CA 1WYIA 4G2DA 1FDJA 1XLDA 4A05A 4MJZA 3KL5A 1DJQA 5LXXA 3AYTA 3GNRA 3UNDA 5T8GA 5IDZA 4QLKA 1J10A 3VUPA 3CQHA 2QGYA 2GUBA 5C2GA 2O4MA 3ARXA 3W7DA 3DKLA 1X8FA 3GFZA 2HNHA 4IPLA 5E0CA 4CQAA 2PE4A 3E02A 1FH7A 4JICA 3GNPA 3SUVA 4QG6A 3LZ5A 3JRKA 3NAVA 4U5KA 1QPNA 1VIWA 2VEKA 2G37A 1SGJA 2GDUA 1V08A 3OQEA 4RNFA 1ALDA 4NSBA 1EP3A 1E6SM 3QW3A 4KEZA 4ZQRA 4ZTYA 4H7VA 3NEHA 1P6WA 5CAKA 4Z0SA 2DZTA 4I7UA 1R2SA 1TSIA 4LUSB 4HN8A 3EDDA 1JF6A 4K36A 4GH3A 4LAKA 3UFYA 4HHLA 2EJ1A 3R8HA 3G24A 2NT0A 2A0NA 4BY3A 2NVDA 4DYKA 2PAJA 5A2CA 2P3ZA 1CIUA 1LRQA 1KGUA 3L0KA 1NQ6A 3GR4A 1F8IA 4Q8PA 1O1HA 4HOZA 1Q66A 3RJXA 3PZGA 3AZRA 4DAFA 2VX5A 1NEYA 3M43A 5KZEA 4FR6A 2WWDA 3WBXA 3DG7A 4GWEA 4GX9A 5I3GA 3SCVA 5E0KA 5LA2A 1CNVA 2WMKA 4MB5A 4NYUA 4P8VA 3G1YA 1JCMP 1ZCCA 2VQUA 4PTWA 2F7FA 1DJIA 1PZ3A 3VNMA 1PAMA 3NL6A 2CHRA 1FH8A 4QIUA 1RJPA 3E38A 5GPRA 4JDYA 5AYXA 1R8LA 2V5JA 4Q4OA 4EXBA 3E9AA 1ZJIA 3BG9A 2ZYFA 3TJLA 3EWWA 4L5ZA 3GH7A 2CU0A 1K4GA 1G1YA 4WY0A 5A5WA 1BXBA 1JCYA 2NV9A 4LX4A 4H9VA 2A3CA 3LM7A 3MMUA 1P6BA 4H01A 5I07A 4ZQOA 3KRZA 1QRQA 4BQ3A 2VC9A