1SO3A

Crystal structure of h136a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
214
structure length
214
Chain Sequence
SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYARSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
total genus 85
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so3A00
1LZOA 4N9BA 2ZTKA 3UWVA 1BTMA 4IWWA 1FCVA 1G67A 1DQXA 1ICPA 1LOSA 1KFLA 3DFSA 1O94A 3S8HA 1YXCA 3M16A 3ABOA 2H8ZA 3I7RA 1YTEA 3DXIA 3LOTA 5HUPA 4RLIA 4LC8A 1GVRA 1W5NA 4U4MA 4CNOA 3B04A 5K9DA 3UPBA 3NA8A 3M47A 1F76A 5CZSA 4MUZA 3MWAA 5DY2A 5DLCA 2BWGA 5E93A 2DZXA 4BF9A 1GTEA 4UMAA 3L21A 3MW7A 3DH7A 3SR7A 1VYPX 1RQBA 1H7XA 3DAQA 1L6YA 2BZNA 4XBKA 1HO4A 3QW3A 4O1DA 3OVRA 1QPNA 2ATMA 5AC7A 3GNDA 2V5LA 4M6VA 2OX1A 4FNRA 3ZWSA 3B05A 3AO0A 4Y6GA 4MY1A 3P62A 2JGQA 1FWSA 4ORMA 5I3HA 1XCFA 2YX0A 4XQ6A 3HJZA 1EA0A 1SO4A 5LGXA 4O0ZA 3LCFA 3IGUA 3TAOA 3PWAA 1FDYA 3IIXA 1EB3A 4UFKA 4HNNA 1VHCA 3NO5A 3L0NA 4NVTA 3C8FA 5EL1A 1DJNA 3NZRA 2OJPA 4OWGA 3SI9A 1NF7A 2D73A 4N6EA 4O19A 4I7UA 3BGJA 1F05A 3M0ZA 1JCNA 2CWNA 1R2RA 1IXOA 3UY7A 5HULA 5D2YA 3DFOA 5FEPA 3G1SA 4IXHA 5G4WA 4UFMA 4PL1A 1OFPA 2CU0A 1SO5A 3O6YX 3N9RA 1GQNA 4O11A 5A8GA 3I7QA 3UQNA 1QOPA 3GR7A 5IM51 3BLEA 4Z1AA 1VJIA 2J9YA 2G97A 3R2GA 3I65A 2CLKA 4EVZA 3BGGA 1OX4B 4EOUA 1ME9A 3BG3A 3W71A 1EX5A 4UTTC 3GB6A 5HNRA 3NQCA 4MVAA 3KVMA 4FNTA 1PE1A 4Y90A 2WPBA 3GK0A 3M5VA 4JYDA 3W1TA 3W7CA 1VR6A 5ABTA 2NV1A 4O54A 1SW0A 1DJQA 1W3TA 1Q45A 4JTHA 1T96A 3IVUA 3GAKA 4O13A 4GUGA 2VFGA 2C18A 2GQAA 2GQ8A 3W83A 2RH9A 1R2TA 1M5WA 1SUXA 3T40A 5T26A 3MI2A 1KA9F 4TMCA 4Z0JA 4TR9A 4FF7A 4S1FA 3O63A 4MPQA 4AHPA 4HIBA 1QPOA 1HO1A 4X3ZA 4QM1A 4WQ6A 5U7SA 3E0IA 4PTNA 1FXPA 2ABBA 3P5YA 4Y9AA 3NEVA 2CLOA 3W7LA 2PRLA 1FDJA 3IIOA 2Y7EA 1GWJA 4IMFA 2ZA3A 4YMZA 1LRQA 4NJKA 2X2GA 2OT1A 3QEZA 4K8HA 3NYZA 1Z42A 1H1YA 2YFOA 4AWUA 3KHJA 4CLMA 4BK9A 4MY8A 3EWUA 1Z44A 4FNSA 3W1XA 2ZRUA 5K4ZA 3LX9A 4XKYB 4POCA 2YYUA 5EY5A 2R8WA 1HTIA 3QMTA 3CWNA 1AW5A 4TO8A 2ALDA 3W1LA 4CNPA 1K02A 3BLIA 2GUUA 3HPXA 4XKYA 4FNQA 2I9EA 4AMAA 1JCXA 1A5SA 2RFGA 1OK6A 3M41A 2BSLA 5DY3A 2TRSA 3USBA 4Z0SA 2WSQA 1SO6A 3HG3A 2X1TA 4OGZA 3LI1A 2PE4A 3O16A 5TBOA 3K30A 3W1QA 1KM3A 4K38A 3NL6A 2KZHA 2ZZ1A 3QW4B 1GG1A 3SJ3A 4JN6A 1MEIA 3W07A 4LVAA 2FJKA 3LHUA 3LCLA 1OFQA 3P81A 1VZWA 3L9CA 3H54A 4RZ6A 1L9WA 3GXPA 3LHZA 2VC6A 3RK8A 1UUMA 4S2CA 1F7BA 3BW3A 4A21A 3LTPA 1MO0A 1HUVA 1OFDA 2CZFA 3SGUA 4NNAA 2JK2A 3HF3A 1VLIA 1YADA 4ORIA 3DFTA 1W37A 2R94A 3C56A 4LC6A 4LT9A 3NPXA 3PULA 3QPZA 4ZVJA 2VEMA 3DHDA 3W2UA 1N7KA 1VLWA 4QISA 2GPTA 2DZTA 4UTKA 1TV5A 3W7EA 2Y88A 1H5YA 5F4WA 2A6LA 2X30A 1Q6QA 1PIIA 3IV3A 3WK1A 1UCWA 3KVKA 3QMRA 5KINA 3N2XA 3LTYA 5LZLA 3NQGA 3TQVA 2NWSA 2A85A 3W74A 2TYSA 4JTIA 2J88A 4G1KA 1T0OA 2F84A 3LHVA 4OBTA 1G4PA 3W76A 4I7VA 1OFEA 2QUTA 1A5AA 1R47A 2DZVA 1I2NA 3LCWA 2JBMA 3DZ1A 3LXCA 5IBXA 3P8JA 1SQ7A 3EWYA 2TSYA 3I6RA 3QZEA 3PVFA 4GWEA 3HGJA 1OK4A 1LROA 1VCGA 1SSDA 1S3HA 5C54A 3W9ZA 1GVSA 1I2OA 2QUUA 4XBSA 5DCEA 4A3UA 1OFAA 2A2IA 4FX8A 3SZ8A 4JICA 2OT0A 3GYEA 3V75A 4ZQNA 3EEGA 1I2PA 1LBLA 1UJPA 1NVMA 1QFEA 1XBVA 3GDKA 4UTLA 5CZTA 1TMHA 4FHAA 4XZ9A 5I3JA 1TTPA 5LNRA 3HMJG 5G1TA 1ZAHA 4JY8A 4O10A 4NZFA 1GEQA 3O06A 3FYPA 2I14A 2JKPA 1JCJA 1QPQA 2ISSA 4IMGA 2G96A 3WK2A 1S5VA 1MZHA 4HHPA 1WBJA 1IIHA 3CC1A 4FEZA 2JKEA 2YW3A 3WK3A 2G5WA 2Y7DA 4ADSA 2V9DA 4LU0A 2ZRYA 3L2IA 5F1VA 2BXVA 2C14A 1SFJA 1TB3A 4A22A 3GVGA 4JX4A 2E5DA 2C19A 3HGRA 3TMLA 4ZZ9A 1BWKA 4UR7A 1XUZA 1A53A 3LLFA 4LTSA 4MKNA 3VE9A 2YXGA 1VQTA 3G3DA 1IGSA 3I7SA 1L2UA 3B0VC 4BFAA 2ZCGA 3FIGA 5FEXA 4CQ8A 4ML9A 4E2DA 3SFKA 5L9FA 5L6UA 1QOQA 2NXGA 3FLUA 1IXNA 3S1UA 4LS2A 1QR7A 1RPXA 3TW7A 2V8ZA 5FESA 3B0PA 5TIMA 3W7KA 4DXVA 5C55A 4MLJA 5AYZA 1XBZA 2FLIA 4FO4A 1K8XA 3W2NA 1WBHA 5FF7A 4BI5A 4WD0A 2EF9A 2DZPA 2J6XA 1XBXA 3P8IA 3RNDA 5E0KA 3SIZA 3N73A 5BW6A 5K4XA 3W2JA 3NL5A 4JTEA 3W7QA 4DF1A 1LRNA 2ZQ0A 4O1CA 3TK7A 4CCDA 3NQ7A 3GNNA 2VKZG 2YZRA 3UXAA 4YXGA 1KFCA 4AHOA 3EB2A 2ZA1A 3UD6A 3TW6A 3NQ2A 2QJHA 4TMBA 1DORA 3W75A 1RZMA 2O7QA 5AFDA 2P1FA 3UZJA 1H61A 1EP2A 3W7HA 1MEWA 2F7FA 5D04C 1TPH1 1QMLA 5LGZA 4GE8A 4EWND 4O52A 4QITA 4ZQMA 2GVJA 1SW7A 4MFDA 4HPXA 5CPNA 1VS1A 4O53A 4QNEA 5K9CA 1H50A 1KTNA 1W5OA 2HS8A 4JTKA 3EWBX 3Q94A 4NX0A 5EKYA 4X9SA 3RLVA 4XUGA 1KV5A 3QSRA 3PG8A 3RF9A 1WX0A 2EGZA 3KXQA 3RMJA 3L0KA 4CQ9A 4NJJA 1TREA 5AB3A 3NXFA 1QWGA 2X1RA 1FBAA 4IGHA 1EPXA 3LHWA 4AAJA 3TH6A 1H60A 5C6MA 5LNVA 1HL2A 1W3NA 4MZYA 2VXNA 3G1VA 3MBFA 4UTMA 2NWRA 2Y7FA 3ATYA 3CLMA 3FOKA 1OYCA 1ML1A 5A5WA 4FB7A 1K8YA 3LBMA 4W9TA 1I2RA 2XN1A 3NNTA 5DELA 4AHQA 1Z48A 4XTIA 4CQAA 3OVQA 3HG5A 1QCWA 2Q8LA 1JRCA 1KFEA 1F5ZA 5DBUA 4ZQOA 3G24A 3IIZA 1ZAIA 2A0NA 1FCBA 3EXTA 4OV4A 3HOJA 5CPMA 4NU7A 3THQA 3TFCA 1XL9A 4DEFA 3OG3A 3QF0A 2VEKA 3KVJA 1TQXA 4UFJA 2NUWA 1PHQA 3W7MA 2A7RA 2VFHA 3HG2A 1TIMA 1DL3A 3NG3A 4R53A 3DFQA 3GKFA 1KM4A 3W7NA 4CCCA 2H6RA 1B9BA 3CU2A 4GRSA 3WJXA 3GKAA 2FQIA 1UASA 4KWVA 4RZ4A 2JGYA 3EXRA 3EWZA 1GVQA 3EX3A 2QCNA 5I3KA 1LLZA 1P1XA 2YFNA 5HR7A 1J4EA 1AMKA 3EKZA 3HIJA 3QQ1A 3PC0A 4FIRA 2E6FA 5F2LA 5CPLA 5G2WA 3A21A 4GXMA 4FXRA 2RDTA 4PC8A 4DBEA 4R7JA 2E77A 1WOAA 1KLZA 3E12A 4P61A 2ISVA 5K2ZA 3B0UX 1OJXA 2NX9A 4LS1A 2H3DA 1LBMA 1XM3A 1JCYA 2Q3RA 1IXPA 3BVJA 3LV5A 3UYCA 5D02A 4RV8A 3I68A 3E02A 3H55A 1FQ0A 3QSTA 1P5BA 3W85A 1CI1A 1B57A 3MO7A 5U4NA 2A5HA 4M7TA 3LDVA 4MLRA 1YDVA 1H1ZA 2Z6IA 5BRBA 3TC6A 1KLYA 4K6AA 4ZMGA 3O05A 2DJXA 1KM1A 1H51A 3BG5A 3QC3A 4WOZA 3LI0A 1X8FA 3N34A 1DHPA 2FB3A 1FWTA 1TPDA 2QCDB 4LOCA 1XDMA 4NT0A 2E68A 4LS0A 1W5QA 3KRZA 5AN7A 1I2QA 4IPJA 1SZFA 3W1UA 2AGKA 3GDTA 2EKCA 4DF2A 1GZGA 4WY0A 3PBYA 3OHIA 1WV2A 4AWSA 1CW2A 4M19A 5AC6A 1WQ5A 2A6NA 4UIOA 3NVTA 1WAUA 1TPVA 3S42A 1H7OA 2ZBTA 4X22A 1X6UA 2A21A 4JTUA 3A9IA 4MZ1A 5BOOA 2QJGA 3B06A 3MI3A 4WY0B 5BMWA 2BX7A 4PA8A 1JULA 4LVDA 1DKWA 5J5DA 1YLVA 3W7PA 1JCLA 3ABSA 5HINA 1KTCA 4J9JA 1GTHA 1MSSA 5D2VA 2FFCA 5K9XA 3GIYA 1AG1O 2YDAA 3BW4A 3GR8A 3C0JA 4K39A 1AW1A 1C29A 3IVSA 2C13A 1JJKA 3MP4A 2QCGA 1RVGA 5FI8A 4NJIA 1QPRA 1N55A 3G0XA 1TPC1 3L68A 3NQVA 3CPRA 2NXIA 4MJZA 3LXAA 3OBKA 4HNVA 1TYGA 4QNWA 3TKFA 1PL9A 1CX9A 5SWUA 2BLEA 1KM2A 4GUHA 1ONRA 2YCEA 4UTHA 1DBTA 1FWWA 4P2VA 1M6JA 4WXZA 3Q2DA 4BWLC 4GUJA 1X1OA 2Q8ZA 3G1FA 3MMTA 3ZFHA 1K03A 3LM7A 3UWYA 4A29A 3S9YA 3U6WA 4YL2A 2WKJA 3UWZA 5LNWA 3F4NA 3O8AA 4YWIA 2V82A 4WXYA 4NUWA 4Y96A 3M1ZA 4LV9A 1ZFJA 4OHQA 1O95A 3HBLA 1OX5A 1F73A 2Y70A 4RX0A 3O6CA 4H4IA 1QAPA 2V5BA 4LY8A 1I8JA 3W1AA 3ABQA 5AHMA 4N9CA 4N4QA 3BO9A 4NQ1A 3U8GA 5CSSA 4A2SA 4KFPA 5I3FA 4NNBA 1B3OA 1K7XA 5E1QA 7TIMA 2V2CA 5DN1A 1LTDA 4MY9A 2XN0A 3M7WA 4DO4A 1Q6RA 3TA6A 4NX5A 3HPZA 3TQKA 4O15A 4HPJA 3M44A 3R89A 4LV4A 5EA9A 3R5EA 2VEPA 3P67A 4XWUA 3LXBA 4GUFA 4UFIA 1SZNA 3TSBA 2RKXA 3S0CA 5G1YA 1KV8A 3WJZA 3GZ3A 4EF9A 1OG0A 3C2VA 3A5VA 1OF8A 5D03A 1TPWA 3CWOX 1KFKA 1KFBA 2Y7GA 1TJRA 2ZZ4A 1K7EA 2X1UA 3NZ1A 1OFBA 3QQ0A 2GJNA 2QDHA 4BR1A 2ZYFA 2CLLA 3EX1A 2VFEA 2GVGA 1TRIA 4Z1BA 3LERA 4MJMA 3INPA 1LRTA 3STEA 3DBPA 3NL2A 5KZDA 1FWNA 4LVFA 3L5AA 5LHEA 4O1BA 1GG0A 2QDGA 3G18A 4OV9A 2J27A 3EX6A 1VRDA 5D30A 2WNZA 3W3OA 1FWRA 4LRSA 3LLDA 3DKLA 2YW4A 1SZEA 3LHYA 1XFBA 3TAKA 1KBJA 1EWDA 4R33A 3PR2A 1TQJA 5AHFA 3B8DA 3TUUA 3PB2A 3MBDA 4HKPA 4NXSA 1AL7A 3O07A 4NXKA 4PFMA 3F03K 3E96A 3LTSA 4BI6A 2VELA 2ZFAA 1H7NA 3PB0A 1BKSA 2FPYA 1ALDA 1O60A 1WA3A 3DGRA 3MJYA 4HNUA 5D2XA 1OHLA 3DU0A 4GNJA 1E51A 1Z41A 3GAYA 1DQWA 4KFOA 1ZHAA 3PF3A 4TX9A 1T99A 1YYAA 3HO8A 3LRMA 1VHNA 1Q3NA 2G95A 3UNDA 3W72A 4FX7A 1KM0A 2Z6JA 2ZZ2A 1F6KA 2NX1A 2A4AA 2NX3A 3A5FA 5HMSA 1SR9A 3PBUA 1BEUA 2QCHA 3P5ZA 5G2HA 3W86A 3BLFA 1SW3A 5D33A 2RDWA 3PAJA 2Y62A 3W7IA 2QEZA 3GDMA 1W5MA 5DXXA 1OFRA 3C6CA 4PL2A 3P60A 2FDSA 2CLHA 4CCEA 3GXNA 2WOQA 2DORA 4RXGA 1LOQA 1JR1A 1JQXA 2QJIA 4E2BA 1H62A 3GDRA 3ANYA 4QAIA 4AF0B 1FCUA 3UZ5A 5AHLA 2NUXA 2DZSA 1TTQA 2ZRXA 2WNNA 2ZZ5A 4S2BA 5CGQA 4MYXA 1AW2A 1IXQA 2NXHA 3HPSA 3UXDA 2CLFA 3MYOA 1W54A 4JR5A 4IX2A 3P61A 4L4MA 4K7VA 1FUYA 5FF3A 1W3IA 5D32A 1L6WA 1JUEA 2PC4A 4AWTA 3W88A 3TDFA 3DENA 1OX4A 1H7PA 3R8RA 1YPFA 1IIGA 1LM1A 1QO2A 3LCHA 3W1NA 4PCFA 3Q58A 2PCQA 1VC4A 3HGSA 1U83A 1XI3A 2E5BA 1ZCOA 3W23A 1RQEA 1TPB1 5K3VA 4M7SA 1YXYA 4ZQCA 2E09A 1TSIA 1DVJA 2QUVA 3SW6A 3QRHA 4FIQA 4JTFA 3S1WA 3P82A 4QQ3A 5FF4A 2RHGA 3QH2A 3LRLA 1SZGA 3WJSA 4MOZA 1JUKA 2IQTA 1FY6A 1GYLA 1GPWA 5HUOA 4JGDA 2YR1A 2A7NA 5G5IA 3T7VA 4UNLA 1LOLA 3PY2A 2ATSA 4IMEA 3TC7A 3EWWA 5LSMA 2B0MA 2V30A 4C1LA 3RFAA 3PG9A 3VI2A 3O15A 3W73A 3WJWA 3R13A 2QAFA 3TX9A 2Y61A 5H91A 2HSAA 3BK0A 1RQHA 3NQMA 3VNDA 4AVFA 2Z2UA 3T78A 2WSRA 1ZNNA 4R34A 5AOUA 2PURA 2VFIA 3TROA 4ALDA 5D05A 1P0NA 2TMDA 4Q33A 2X1SA 3T4CA 3WK0A 4GC4A 3S1VA 4ICNA 4WJEA 5DCBA 4O50A 3M9YA 2Y63A 1O5KA 4DQWA 3B03A 3ABRA 3NQ8A 2QCFA 4KKXA 3JRKA 4E38A 5F2IA 1D9EA 3UPWA 3SGZA 1U5JA 2B7QA 1W31A 3FKKA 3EX2A 5D2TA 3KFTA 3KX6A 5F4SA 1NEYA 3T44A 3KRUA 2CZEA 5BMXA 1TV7A 4AF0A 1V5XA 4MIMA 5CPOA 5LKYA 2B7OA 4PEKA 1C9DA 5F1UA 5FEZA 1MEHA 3JS3A 4NJGA 4UTWA 2QCDA 4MZ8A 4JX6A 3W2KA 5HJLA 3G1XA 1YTKA 2X16A 4UTWC 2OCZA 1ICSA 4L4LA 1VCVA 4N2YA 3G1YA 4HT3A 1FCQA 5CG7A 2B7PA 3P7YA 1JQVA 5KTLA 3IVTA 5D09A 3G8EA 5MHBA 1LYXA 2NV2A 3E49A 1GOXA 3O6DA 1O4UA 2C3ZA 4DF0A 2NZLA 1OVDA 2YPIA 1VH7A 3TFXA 1FX6A 5I3GA 3M5ZA 1R30A 2QCMA 3CHVA 1JVNA 4N02A 4ZL1A 4O4WA 2B7NA 1G4EA 4O0KA 5FF2A 4LVBA 3Q37A 3TMQA 3TSMA 1OFOA 1GJPA 4QSHA 4IOTA 4DBDA 3E9AA 1C8VA 1K8ZA 3NPUA 1PHWA 3NPVA 3P74A 3CEUA 2FTPA 1A5CA 2C0AA 4AB4A 2Z1BA 1XBYA 2ZZ7A 4DPQA 1PV8A 1F74A 5D37A 2JKAA 3P80A 2ABAA 3W70A 3MHGA 2DP3A 2E6AA 3W2LA 5HWNA 3DI0A 2ZRZA 3TSDA 3ZS4A 1YTDA 5EBUA 3OEXA 1EIXA 3EXSA 3W7JA 4FXSA 2TPSA 2R91A 3C52A 1NFBA 3W7RA 2QCLA 2O7SA 4ZQRA 5AHIA 4JDYA 3FEMA 5AC8A 1AL8A 3PUOA 3S5NA 1G6CA 1YDOA 2QCCA 5H2ZA 3C61A 1LP6A 3GDLA 2W0UA 2GJLA 4O28A 3FS2A 5LNSA 3P84A 4MFEA 4RJEA 1GT8A 2Y6ZA 3HGOA 1K3UA 2J9ZA 1KM6A 2VENA 2ZA2A 5C2XA 1EWEA 2ZDRA 4WY0F 3N19B 1Y0EA 1UUOA 5CKSA 4Z1DA 3IIPA 2H3BA 3CQ0A 1QDSA 3IEBA 4OU1A 1RV8A 4Z1CA 4EIVA 1O5XA 5F2MA 2Y89A 1P0KA 4C1KA 1UB3A 3PSVA 4JEQA 3FJ6A 3G1AA 4GUIA 2WJZA 1S5WA 1Q6OA 4NZJA 4E0CA 5G2IA 4N9DA 1ZALA 3NQ6A 2CW6A 2Q3OA 3LGEA 4MYAA 4LVGA 1EEPA 4LRTA 3PUEA 3LHTA 3G1HA 2FIQA 2HMCA 5K7JA 3FKRA 4IX0A 3VFLA 4JYEA 1YDNA 1L6SA 1IF2A 4IPIA 4JYFA 2YYTA 1SPQA 1TJPA 4WX2A 3BG9A 4K36A 4M6QA 1PCKA 3STGA 3W7GA 4KFNA 3L67A 2A7PA 2EHHA 5BNKA 2DZUA 1BWLA 3TE9A 4M6PA 3TXVA 4O17A 2FPVA 4UR8A 2GQ9A 4IXXA 3C2OA 4NNCA 5HQEA 3T55A 2W6RA 5CSRA 3C3NA 4RCXA 2BTMA 1NSJA 4O1AA 5TQLA 3CM4A 3BW2A 5F4XA 2QF7A 3WFAA 1I4NA 3KAOA 4K8EA 5D2WA 1SO3A 2GVLA 1X7FA 3NPWA 4JIPA 2DZWA 4UTIA 1ZENA 1N8FA 4K37A 4UMBA 1LBFA 3N14A 3N9SA 4IMCA 2YGYA 5HWMA 3W6YA 1JUBA 4LNYA 3DHFA 3LRKA 1FXQA 4HSNA 2WV8A 4IUOA 1GVOA 3NOEA 3SECA 3TCEA 1EP1A 2ZTJA 3IGSA 2J9XA 4H3DA 4Q4KA 3NAVA 3C4UA 4JNMA 4O18A 4QIUA 3QYQA 3HG4A 1W1ZA 3B4UA 3BARA 1H7RA 1KTBA 1OYAA 3QM3A 4O57A 5KSWA 4FNUA 3NR0A 4DELA 1G4TA 1D3GA 4JXCA 3RU6A 3TV8A 6ALDA 3C2EA 2ZZ6A 2C1HA 3EWXA 3ZR4A 1XDLA 4GBUA 1W8SA 1EP3A 1D3HA 2QCEA 3S6DA 2RDUA 2Z0IA 3V1PA 3NL3A 2E1DA 1FDZA 3C2FA 3D0CA 4GJ1A 1J5TA 1ICQA 3S1XA 3OVPA 4FNPA 1ZJIA 3UWQA 5LNUA 3N2MA 3TR2A 4O16A 5KZEA 3W2MA 2DJLA 3O1NA 4CNNA 3PSWA 1LLWA 1TPUA 3G1DA 2OZ0A 4OE7A 4WUIA 5AHNA 3R12A 1VCFA 4Q32A 2E5CA 2C15A 3IRDA 3N3MA 5F2GA 5FF0A 4O12A 5DXYA 3MHUA 3PUDA 3IGXA 3W1PA 3MYPA 1Q6LA 3CEPA 4JX5A 2DU2A 3VE7A 2J24A 2GOUA 2CZ5A 5AYXA 1K7FA 1TTJA 1JCMP 1ZAJA 4YCOA 3BV4A 4RZ5A 1B4KA 2E6YA 1TTIA 2UV8G 1F6PA 3TJXA 1H7WA 3GX9A 5IBXC 3PM6A 1ADOA 1XKYA 4JY9A 1ME7A 3F4WA 5D38A 2ZZ3A 1UBSA 3KVLA 3L5MA 3W7DA 2R14A 3G0SA 4JDBA 1A5BA 1TV8A 3S5YA 2YSWA 1YXDA 3M43A 1WOBA 2CFFA 3A22A 4GFSA 3FFSA 1KW1A 4O8RA 3M6YA 3RLUA 3NQEA 3F1QA 3KOFA 2AAMA 2ISWA 3TU9A 2XFWA 2QR6A 6TIMA 3EKLA 4UFLA 2EAWA 1R2SA 1LORA 4M5PA 1G69A 2CLIA 1WXJA 1YPIA 4OT7A 1S5TA 3QMSA 2XN2A 2WQPA 4JTGA 4IJBA 1DOSA 4KWWA 2FB2A 4JS3A 1KM5A 1XXXA 3QPYA 3UY8A 1LDCA 1M7PA 2LLEA 3PS7A 1A50A 4TIMA 1PVNA 5AYYA 3TNOA 5C5YA 5KZMA 1DV7A 4FX6M 1TPFA 1R46A 4ADTA 2CLEA 2C6QA 2HTMA 4QJ1A 1TRDA 1W5PA 3IIVA 2PRHA 1OX6A 2W79A 3MHFA 2ZRVA 1OYBA 3NGJA 5EPDA 4XTDA 3ATZA 2V0TA 4LUIA 2V81A 3W22A 4K7YA 3WJYA 2VFDA 2CLMA 3M5XA 1ZY9A 1XC4A 4RXFA 3DFNA 1PCWA 1TCDA 2P10A 3SY5A 3THAA 8TIMA 4AH7A 4H6KA 4UFHA 1TPEA 3G3MA 1GVFA 5CZ0A 3TXZA 1OF6A 1LCOA 3PBWA 4ZQPA 4AEOA 4UC5A 4BI7A 3G0UA 3EX4A 3TQ0A 3NQDA 1I45A 1XUUA 3AJXA 5J5RA 3GXTA 4YLWA 1G7VA 3L5LA 3DFPA 3HQ1A 3MP3A 5GVJA 3VKJA 4LW7A 2ZRWA 2OMAA 1SU5A 3CB8A 4HNTA 1VGAA 4UTJA 3W7OA 1KBIA 3NM3A 3L66A 3FYOA 4RK8A 2V2HA 1GYNA 4IQLA 4RR4A 4UMCA 4DO5A 3JR2A 1QO5A 1V7YA 4HSOA 1JRBA 1X1ZA 3OIXA 4O14A 4N6FA 3LCIA 1RR2A 1W56A 2NLIA 4WOQA 1SFLA 3M5YA 1H63A 4A2RA 4ONVA 3ELFA 3YPIA 5HR6A 3STFA 1EUNA 2C16A 2Y85A 1AK5A 2B4GA 3W1MA 4JTTA 4UCGA 1ME8A 4LWWA 3L0GA 1HG3A 1THFD 3ZWTA 3H53A 3G8RA 4X2RA 4JTJA 1W0MA 4B5NA 4WZHA 3HB9A 3TIMA 3UWWA 5LHFA 3CIXA 3MUXA 4UUIA 2NUYA 2VOMA 5G4EA 4OQVA 2QAPA 3NDOA 3DKJA 3G22A 1PS9A 3SSJA 4I9AA 4JTLA 3CT7A 4Z08A 4UTTA 4JIQA 3NM1A 4EF8A 4DPPA 3LB0A 2H8XA 3PBVA 5DCDA 3A24A 3W84A 3S5OA 1VPXA 4N4PA 2H90A 1RD5A 3L65A 1NAL1 2HS6A 3STCA 4RKAA 3LV6A 4N9EA 1TO3A 1F2JA 3OA3A 1J2WA 2I1OA 3CTLA 3C2RA 1KFJA 5KITA 4O4VA 2EPHA 5HWJA 4JTSA 2WNQA 1OABA 3W1RA 1B4EA 1SSGA 2V2DA 4TU1A 2FPTA 2CZDA 5AHEA 1QNVA 3FJLA 3KRSA 3LCGA 3S5ZA 2P0OA 4ADUA 1VYRA 3VCRA 2WO5A 3DI1A 4D2JA 4YCPA 4UNKA 5EMUA 1P4CA 3W87A 3QJAA 5I3IA 4PODA 4NJHA 3QFEA 5KMYA 1NF0A 1WDWA 2E6DA 2VEIA 4Y8FA 4UXDA 4BWLA 5CZJA 4AXKA 4HN4A 4U28A 5EYWA 4JD4A 2AQWA 1T8XA 5FEWA 2WSYA 4IMDA 4I7WA 3MP5A 3LCXA 5DBTA 3LBCA 1M7OA 2QKFA 3U2OA 2PRMA 3A23A 1MXSA 1VYSX 4DO6A 3BPWA 3NQAA 1WYIA 4PH6A 3FA5A 3MI6A 1G4SA 3NQFA 1HFBA 1G7UA 2A1YA 3CIWA 3GLCA 3UWUA 2VFFA 4LUJA 3TJLA 4UTUA 1EUAA
chains in the Genus database with same CATH superfamily
1PDYA 4N9BA 4K1GA 1BTMA 4IWWA 3SUUA 2OU4A 2H9AA 1WKFA 3WLSA 1KFLA 3DBNA 3AALA 3HPFA 1O94A 1N2VA 4JQAA 2H8ZA 4J2PA 1XLKA 2I5GA 2WW5A 4O1FA 1W5NA 4KRTA 4BJHA 1RY0A 3B04A 5K9DA 1XIGA 3B0XA 3GTIA 3M47A 1KFWA 1F76A 2BWGA 1PUDA 1OT1A 3KBWA 1H7XA 3JU2A 2BZNA 2YDSA 4XBKA 1HO4A 3WNKA 1CIUA 3W26A 1XIJA 4MF4A 4DN1A 4M6VA 1JDEA 1SR0A 3WQWA 3AO0A 4ORMA 1FKXA 2JGQA 3WZ0E 2QV4A 2YX0A 4Z2GA 4EPDC 1EA0A 2NV9A 3R58A 3SN1A 4CNSA 4YHEA 1FDYA 3IIXA 4UFKA 4GYJA 4IIFA 1DJNA 1E6RA 3CGTA 4OWGA 4J5NA 2VL4A 5G4HC 5A95A 4XKMA 1NF7A 1W1YA 4N6EA 4O19A 1PIGA 2GDUA 1UC4A 3M0ZA 1JCNA 1IXOA 3UY7A 5HULA 5D2YA 4DXXA 5G4WA 3VIOA 2FVMA 2CU0A 2F61A 3AU6A 3O6YX 1GCYA 3FY1A 1PZ1A 4GLEA 2FZMA 3N29A 1NU5A 3QGAC 4I5RA 3GR7A 2V6AA 1IR2A 3COTA 1OSEA 2DUAA 2CLKA 4C1NA 4EOUA 3BG3A 1EX5A 3GB6A 1QATA 5HNRA 1R3SA 4IHCA 3KVMA 3WD3A 4BQ4A 3VA8A 3GK0A 3B4YA 2BVTA 6XIMA 4ZFMA 3R25A 1VR6A 2YXOA 2NV1A 3R10A 4O54A 5REQA 1T96A 3GAKA 2VFGA 1Q7ZA 3UVIA 2X0SA 4Z0JA 4TR9A 1BD0A 4UCFA 4HIBA 1HO1A 4IG2B 4WQ6A 2PWFA 2ABBA 4GACA 3T8QA 4JAWA 4Y9AA 3CH0A 4Q8QA 4W8LA 3ZIZA 4JKMA 2WVTA 3W24A 3EMZA 2ZA3A 2W66A 3E2VA 4ROQA 3CQKA 3P3BA 4K8HA 3NYZA 2YFOA 4AWUA 2VZOA 1EJRC 4BK9A 3EWUA 4HMEA 3VYLA 4NY2A 2IPFA 2PLKA 2OQHA 3KDOA 4IISA 3TCSA 3QY6A 4I6VA 5EY5A 3CQHA 4BQ5A 3H2MA 3CWNA 1P6WA 4TO8A 2VUNA 4JFSA 1WZMA 4REQA 3E1F1 4GJIA 2R1NA 2GUUA 3KS5A 1FHVA 3I4EA 4GXPA 1UPPA 4OFCA 4S3EA 1JCXA 3N6JA 3VGEA 5DY3A 4AVNA 3OPSA 3N1AA 1J10A 4Z0SA 3ZJ6A 3W29A 4U10A 1SO6A 3HG3A 2X1TA 4YVXA 4OGZA 3BLDA 3PJXA 4KWUA 3VGBA 1GG1A 1PDZA 4JN6A 3W0KA 5HJXA 3P81A 4HJWA 2XVLA 5IOBA 4RZ6A 3ARSA 5CH9A 2FKPA 3LHZA 2PTXA 3IAPA 1V02A 3RK8A 2PC8A 1F7BA 3BW3A 4A21A 3UU0A 1OFDA 1HUVA 4HN8A 3SGUA 1DPMA 1W37A 1O68A 1EFZA 4LNCA 1KR0A 1W3KA 2VT0A 4BF5A 1OGGA 4LC6A 3D3FA 1HJXA 3DHDA 1VFOA 4OVXA 4BKNA 1N7KA 3BAKA 4W4QA 2CERA 3M6DA 1TV5A 3CB3A 1WZKA 3IJ6A 3MUAA 4FXJA 1AD4A 1VPQA 1UCWA 3KVKA 3LPGA 1TFVA 3NQGA 4KS0A 4XBJA 2NWSA 4JTIA 3SN0A 1GKQA 2J88A 3K8LA 1J12A 5A6BA 3LHVA 1G4PA 4KW2A 2WK2A 1OFEA 3L4UA 2QUTA 5D9MA 2CKSA 4RNHA 2OELA 3LNMA 1UA7A 5A3HA 3DZ1A 2DH3A 4AW7A 1FHLA 5XIAA 2TSYA 3V36A 3PVFA 3LENA 1S3HA 4K8GA 1X6NA 1GVSA 2QUUA 4XBSA 3VX1A 4DZAA 4JFVA 1IT8A 4Q4RA 1U5VA 1K1DA 4ZQNA 3CHEA 5BOFA 3WO8A 3U5YA 3WG6A 1LBLA 2V63A 2E25A 2EPOA 4WKHA 3TR9A 2ZVIA 1MUCA 5DFAA 3JUGA 3WIJA 1TMHA 3OOQA 2D1ZA 4NZFA 2J13A 3FYPA 2WPGA 1A3HA 1TG7A 1GVEA 3O0KA 3RAOA 3AMLA 1WBJA 4FEZA 4P7QA 2YW3A 1XLMA 4PUEA 4F2TA 1TA3B 2ZRYA 3L2IA 5F1VA 2BXVA 2CITA 1SFJA 4US6A 4GOAA 4A22A 2QJMA 1Y65A 1JPHA 3KCOA 3HGRA 1E0WA 2QLYA 4N0RA 2WJFA 3M0MA 1T41A 2CNCA 3CUFA 4CQ8A 3FIGA 2V5JA 4ERGA 4E2DA 1GGOA 1XSJA 2NXGA 2INZA 3Q45A 1QR7A 3TW7A 5FESA 1XYZA 4LX4A 3W7KA 2FLIA 2YIHA 4KCUA 1MI3A 4BI5A 2JIEA 4WD0A 2F6KA 2Y0FA 3SIZA 4TOQA 4EPBC 4HMCA 1Y5VA 3A3XA 3NL5A 3W7QA 3TK7A 3ITOA 2EQDA 2VKZG 3IRSA 5AKQA 3N13A 3BGAA 3EB2A 3IUDA 3WUBA 2ZA1A 5F7UA 4PCPA 3RILA 3TW6A 4TMBA 1BKHA 4GQQA 1TE6A 1K8CA 2PCEA 1E71M 5AFDA 2P1FA 4OIFA 2DT2A 1EP2A 4PMNA 1MEWA 4B4HA 2F7FA 2DIEA 1JPMA 1DWAM 3ENLA 4YPJA 2GVJA 2J7HA 3E2SA 2AQOA 1VS1A 4CN6A 4NYUA 1PTGA 2OWXA 1EJVC 3HQNA 2VX6A 2YA0A 3SN4A 2VDGA 3KOXA 1UWAA 3Q94A 3BLLA 3BOFA 3FYYA 3KHDA 3WLQA 2Z26A 5A6BD 5HPOA 4HHMA 3WF0A 4CD4A 3L0KA 1UOZA 5AB3A 1QWGA 2J7DA 2WVVB 3VGGA 1FBAA 4IGHA 3N11A 3LHWA 2P8CA 1XX1A 4A8LA 1H60A 3FSTA 3VFCA 4MZYA 3G1VA 4PR4A 3MBFA 4MAVA 4GH1A 1FKWA 1OYCA 1ML1A 4GX9A 1K8YA 1V51A 2HVOA 3UG5A 5D8WA 1MWOA 1Z48A 3GDBA 1CT5A 1V3IA 3B8WA 3OVQA 1IHIA 1JXJA 1QCWA 1KFEA 3T9PA 3G24A 1PWMA 4NILA 4OV4A 5GJPA 4XG1A 5E0CA 3HOJA 5CPMA 6A3HA 3TFCA 1XL9A 4S3JA 4KEVA 3VUSA 4LXFA 3WCZA 3QF0A 4A8RA 2IQ0A 3LGDA 2W3ZA 5I02A 1KM4A 1B9BA 2OODA 4GRSA 4C6QA 3AMKA 3WJXA 1DTUA 4AXNA 4RZ4A 2JGYA 1VRXA 3RM4A 4AX6A 4DB7A 5I3KA 1P1XA 1AMKA 3I4KA 4E5TA 4ZO6A 2E6FA 2PDYA 5CPLA 5G2WA 3A21A 3CPUA 2E77A 4B15A 3RITA 3CYVA 1WOAA 3OG2A 5FJTA 2F2KA 1DJHA 4CU7A 5K2ZA 4LYPA 4E4PA 1U1JA 1JFXA 4PRWA 1DJIA 2ACRA 2H3DA 3CV2A 1JCYA 2Q3RA 2VHLA 2O4MA 1IXPA 1PTAA 2BVYA 2AKMA 3UYCA 1NOUA 2BVDA 1OB0A 2VEGA 3W27A 1FQ0A 1FTXA 3KCLA 3W85A 4OOUA 5U4NA 2A5HA 3TJIA 4K6AA 4PMXA 3R79A 1V77A 2DJXA 1KWGA 1KM1A 1TR1A 4Z42C 1H51A 1TKKA 1CLKA 4QCFA 3S83A 3A4XA 1X8FA 1RBOB 1F8MA 4NT0A 3S2NA 3E3HA 5AN7A 1I2QA 1V4YA 4IPJA 3EEZA 4FPSA 3B8IA 1CB7B 1OCNA 3WLIA 1C9WA 1EGMA 4WY0A 3OHIA 4YTTA 1WQ5A 5EMLA 3HA1A 3NVTA 1L0PA 3S42A 3QZ6A 4ATLA 4AUBA 4JTUA 3A9IA 4B3KA 1NELA 1UWRA 2VGFA 1JCLA 2OSWA 4GQBA 4GVHA 3RCMA 1AG1O 4ASTA 1JJKA 3M0LA 3GUGA 3EGJA 3WDQA 4NJIA 1T40A 5IDZA 1K6AA 3L68A 4RW3A 2NXIA 1XLGA 1U5HA 1FP8A 2VZVA 4UWMA 1KM2A 1ONRA 3THCA 1UWTA 3FW6A 3UT0A 1M6JA 3FJ4A 2BY1A 2QDDA 1S46A 3ZFHA 3VK5A 4A29A 4JNZA 2ANUA 1QRQA 4YL2A 2WKJA 3GBEA 3RU8X 5LNWA 3O8AA 4YWIA 1E15A 3M1ZA 1F73A 1O66A 1GOIA 2VX5A 4KESA 1QAPA 5ABEA 2EG6A 4MWAA 2IMRA 1R8LA 4ML4A 3WDRA 3BO9A 5CSSA 1XYBA 2Z2AA 3TOYA 4NNBA 1B3OA 1K7XA 5EMKA 7TIMA 3M7WA 4R27A 2ALRA 2OLSA 4AD1A 3BAJA 3SRKA 4AX7A 4Z2LA 4O15A 3M44A 3U4FA 3PZGA 4M0XA 4GUFA 1RK5A 1SZNA 4XK2A 2YB4A 3VOFA 1CGTA 3S0CA 3BQ5A 3W6MA 4RDVA 4GY0A 3VINA 5D03A 3AZTA 1KFKA 2RGLA 1PIFA 4EPKA 3RIKA 1S2VA 1PX4A 1B1YA 2QDHA 3WD4A 3EX1A 1IV8A 3LERA 3STEA 5B80A 3DBPA 5KZDA 1FWNA 4AZ6A 4O1BA 1GG0A 3FXYA 3OB8A 3BCDA 4OV9A 1QK2A 1HP4A 4C6NA 5D30A 4KRZA 1WDRA 4S23A 3W3OA 2HRWA 1FWRA 1EO5A 3VIGA 2C91A 4H9VA 1SZEA 1XFBA 2YXXA 2ZXBA 1A4LA 3AHZA 3PB2A 1ITCA 5DEZA 1ZGDA 2C79A 1I1XA 3ZVHB 4DNHA 5DQPA 4PFMA 4LEFA 1EKOA 1T7LA 4DLFA 1NWUA 2ZFAA 1UR2A 5ENLA 3M0VA 1WA3A 1UD3A 4HNUA 4O1EA 2PZNA 1E51A 1Z41A 1EJ7L 3S2MA 1YNYA 4XD5A 4PSRA 1QNRA 4A3RA 2O9OA 1DJXA 1T99A 1YYAA 2DSKA 2QPUA 3UNDA 3AFBA 3WD1A 2X41A 3THDA 1F6KA 2A4AA 3A5FA 1SR9A 3T0TA 3P5ZA 5G2HA 4I9TA 2F38A 3AS0A 4DYKA 3GDMA 1QVBA 1W5MA 1Q6EA 2FDSA 4CEUC 2A3CA 1UD2A 2WOQA 3LK6A 4ERAA 3VIJA 1JQXA 3H2OA 2NT1A 3ANYA 4IFOA 2ZDSA 3U5UA 4AF0B 3WDIA 1E9IA 1JCTA 9XIAA 2ZRXA 2WNNA 3WMSA 1E9LA 4DJDC 5TNVA 3MYOA 1W54A 3RM8A 4JR5A 1PYFA 4L4MA 1HZYA 1FUYA 4D6DA 2BNJA 2RAGA 3W88A 4IT1A 3R8RA 4KBXA 1E5NA 1YPFA 1IIGA 3L2MA 3W1NA 4MTVA 3Q58A 1DE5A 3HGSA 2EKGA 4PMUA 3W23A 4CQDA 3GH5A 1J8VA 3C2YA 3EOEA 4ZQCA 1TSIA 2D20A 2Z7GA 3SW6A 3WEMA 1EZ2A 2J75A 3QRHA 4QQ3A 4IIGA 5FSEC 3WJSA 4MB5A 3EBVA 4LQ1A 4JGDA 3PAOA 2VVSA 1TWWA 4J4KA 4UNLA 3HU7A 1ZL1A 3PZTA 1UD8A 2B0MA 3HMCA 4MPKA 2V30A 4V33A 4C1LA 3ITGA 2FVKA 2ISFA 5H91A 1H41A 2GSJA 5C8BB 3BK0A 3U0HA 3ALGA 4JQ1A 1RQHA 1TX0A 3NQMA 1H4PA 4AVFA 4AIUA 1WO2A 2JIWA 1PPIA 2AL2B 1JD7A 3ZT5A 5GNYA 1BXBA 1MFUA 1N82A 2VFIA 1P0NA 2TMDA 1S2WA 3ZLFA 3T4CA 3SCNA 1RLCL 2CBVA 4BY3A 1ZS2A 2INEA 2ZADA 2Z1XA 3NQ8A 5H8PA 1XYMA 3OBAA 3VGHA 3VDBA 1B90A 3JRKA 4E38A 3B9EA 2B7QA 4MNLA 5EBAA 3FKKA 5D2TA 3M0YA 3KX6A 1NEYA 4L64A 3RR4A 3KRUA 4ZOBA 5I0DA 4TUFA 1V5XA 1QOXA 1G5AA 1Q4WA 2B7OA 1C9DA 5F1UA 4TVUA 4QXIA 1MEHA 3TA9A 5M17A 2Z1WA 3SB0A 3G1XA 1FOBA 1YTKA 2Z1VA 5LYRA 2OCZA 2OEKA 4L4LA 2A3AA 1VCVA 4N2YA 1KRAC 1E6ZA 1FCQA 3H7UA 3P7YA 1NWRA 3PPCA 5CC7A 4PN2A 3IVTA 1ZJHA 2BG5A 4C60A 1BVWA 3T0CA 1O4UA 1X98A 1EC9A 1MRQA 2CHRA 3SJNA 1OVDA 3LPOA 4BHYA 3CUGA 2YPIA 4FP1A 4CVWA 1JVNA 2VD8A 3S47A 4N02A 1E4NA 1DWJM 2B7NA 4L6OA 2IPJA 1AH4A 2EO7A 3DN5A 2ZUNA 1Q8JA 4ZCWA 3FEQA 2PP0A 1Q8AA 4PEEA 4S3DA 4AD4A 1PX8A 4TTUA 3KTCA 4W88A 1PHWA 3NPVA 3FGCA 1JEZA 1TUXA 4C7GA 3GD6A 2VC9A 1OD8A 4R9XA 1GUVA 4DPQA 3BAWA 1F74A 1CXIA 1J0YA 1XR2A 3M0HA 5BU9A 2WAGA 2AOSA 2DP3A 4ENLA 3W2LA 1FH9A 4CD8A 1XIFA 1C93A 1YTDA 2XWEA 1K4HA 3DECA 2GFTA 2J7BA 2R91A 3Q4DA 3KP1A 5I07A 4PCTA 2O7SA 5I06A 1P6CA 4QE5A 1YDOA 1LP6A 2GJLA 4QS6A 4O28A 2CESA 2VDHA 3UCCA 5CSYA 5C2GA 3AXMA 3AROA 4GI6A 3WH7A 4DWSA 2GSHA 2GYIA 2VENA 2W27A 5BOEA 4HMNA 5C2CA 1EWEA 4CD6A 1Y0EA 3GU9A 3IJQA 2FHFA 1PX3A 2DIJA 1QDSA 2OWWA 4EIVA 1O5XA 2E67A 1XRSA 1UB3A 4JEQA 2XM1A 2WJZA 1EJUC 3S2CA 1NWTA 4FLOA 4PTDA 3VMOA 2L5HA 1RY8A 2YOCA 1B3VA 5G2IA 1EOKA 3L4TA 2QW5A 3M7SA 3IANA 1A0EA 1PSCA 3LHTA 5K7JA 2HMCA 2O4QA 4GCXA 2X05A 4IX0A 3RLHA 3VFLA 1L6SA 4IPIA 2CBJA 2YYTA 1K9EA 4M6QA 1PCKA 3VMPA 3BXWA 5A94A 2XGIA 4QDMA 1BWLA 1C7SA 3LD5A 4QG9A 4AY8A 5LA1A 1NDZA 1PKNA 3KS6A 4U31A 2WZMA 2WBKA 3N4FA 1UD5A 5DX7A 4EANA 1UZ1A 1JZ2A 2BTMA 4X2PA 1V02E 3ARYA 2QF7A 3B8SA 4IF2A 3KAOA 1DEDA 1SO3A 3OGVA 1V3KA 1J96A 1FFQA 2DDXA 3A3HA 4HBKA 2HVMA 1J2BA 3LPFA 4GZ7A 1N8FA 2DY3A 2UBPC 4V2XA 4L80A 3VDHA 3TYDA 3N14A 2JEQA 3WBXA 2G37A 2YGYA 5HWMA 2F6XA 4HSNA 2WV8A 1G1YA 2XFRA 2FZNA 2ONEA 1Z89A 2ZTJA 3IGSA 2CZVA 3NAVA 3C4UA 4JNMA 3S46A 1DWIM 1W1ZA 3BARA 4O57A 4XSMA 1MDRA 1VF8A 2BXYA 4JXCA 3BUVA 4WGHA 2ZZ6A 4NZ4A 5DMMA 1W8SA 1B3XA 2QCEA 2RDUA 4Z2JA 3NL3A 3KRBA 2E1DA 1FDZA 5M2FX 3K13A 1J5TA 4FNPA 4L61A 2WKGA 4MADA 4V27A 3N2MA 1VEOA 5KZEA 3QV7A 3SCTA 4P8UA 4ROPA 4MWAD 4CNNA 3KL0A 4OE7A 1BRLA 3LN3A 4JBRA 1VCFA 2E5CA 2C15A 4XO7A 3LU2A 1E6XM 1GW1A 5FF0A 3GXDA 4LY4A 3T42A 3NGFA 3UR8A 4I8YA 4IL2A 4JFUA 1Q6LA 3CEPA 4JX5A 3DYOA 2DU2A 1C90A 3FN9A 2CZ5A 3D46A 1TTJA 2VUYA 5JVLA 3BV4A 4A6GA 4RZ5A 2E6YA 3SUTA 2UV8G 5IBXC 3CHDA 1ME7A 3F4WA 3ME3A 5D38A 2X2YA 2EEXA 3L5MA 1KXTA 1WB0A 3UG3A 3G0SA 2J79A 2QHAA 2FH8A 1IE7C 4E6MA 3WLRA 2CC0A 3VD9A 4UFLA 3A12A 4M5PA 3FX4A 1RLDA 3GFXA 3RO6A 5B7YA 1YPIA 4HTYA 3AIRA 3DCPA 3QMSA 1R3QA 1VBHA 2QT3A 4U33A 2XN2A 1ZZMA 4JTGA 3T6CA 4IJBA 4ZE4A 4KWWA 3CV1A 3EA1A 1XXXA 1EYEA 2PD5A 3UY8A 4TXEA 3RJYA 2LLEA 3PFMA 3QHNA 2X42A 3SRHA 3H8AA 3CLWA 3EZ4A 5AC4A 1DV7A 1XCXA 3BH4A 3WKZA 1NQKA 2C6QA 2YL8A 1ZJBA 1FWFC 3IIVA 2PRHA 3VDGA 4PBFA 2ZRVA 1OYBA 1LWIA 4K3ZA 4J35A 4GA8A 4M80A 3K1DA 4TX8A 1IGWA 1ZY9A 2I9UA 3DFNA 4LF1A 2VZTA 1TCDA 4CNUA 4AH7A 4QGCA 1V3LA 3VOJA 4Q8UA 1GKPA 4H6KA 4UFHA 1TPEA 3WF2A 3TXZA 2WCGA 1LCOA 3PBWA 2OZ8A 4ZQPA 4AEOA 1OIMA 2FFIA 3H70A 3IPWA 4PTWA 3QOKA 1I45A 4JIHA 5J5RA 4YLWA 1Q6DA 3HQ1A 5GVJA 4LW7A 4MB4A 4HK6A 1JZ3A 1SU5A 3CB8A 1VGAA 1QHZA 1JI1A 3W7OA 2R1PA 4FS9A 3K1GA 3CV6A 1TCMA 3WUFA 3N3TA 4RR4A 4UMCA 2ZUMA 2DSZA 1RALA 1SGJA 3MWCA 2NLIA 4WOQA 3VVGA 2PDCA 3AC0A 3M5YA 3STPA 1J0HA 5HR6A 2PDLA 2OQLA 3QQWA 1Q4NX 1UWUA 3DFYA 1PJ9A 4W8BA 4LUSA 4AZBA 5A8QA 1HG3A 3FCPA 2J7GA 3G8RA 4X2RA 4B5NA 4L4PA 4AD3A 4UUIA 2WQDA 4OQVA 4G9PA 1IQ8A 2QAPA 3DKJA 4D6CA 3N04A 3SSJA 4I9AA 4JTLA 4UOJA 3PJWA 4MB3A 4UTTA 3V7PA 1P7TA 3RLGA 4EF8A 1GOKA 1AZ1A 3BE7A 2G3NA 4H00A 1OIFA 4DPPA 3PBVA 1PWLA 3ORWA 1JI2A 1YE6A 5DCDA 2J25A 1CLVA 4KERA 3A24A 3VTRA 2BHYA 1VEMA 1QI3A 1VPXA 3LV6A 1F2JA 3NUKA 3DX5A 1A0CA 4ZB2A 2ZX7A 4J1OA 2FPTA 1QNVA 1S2AA 3S5ZA 3VKDA 1HT6A 3GG1A 2P0OA 1UZHA 1EYWA 3B9AA 3Q67A 3VCRA 4MJ2A 4W84A 1DWGM 1P4CA 3WENA 5I3IA 2QMJA 3WN6A 1UROA 5KMYA 4QDWA 4UXDA 4A35A 4HN4A 3DEQA 3KBSA 1P0DA 2BGNE 4YU1A 4Y9NA 3FA4A 1YDYA 1SMDA 5DBTA 1FWDC 1M7OA 3OZPA 3U2OA 2WMFA 1U2YA 3UNTA 3BPWA 1WYIA 3ONCA 4PH6A 3BLPX 3FA5A 3NQFA 3AHVA 1MDLA 3KWXA 3GLCA 1TUFA 2XJ7A 5CAKA 4GNVA 1A80A 4UTUA 1LZOA 1W9UA 2ZTKA 4IZGA 3UWVA 3EOLA 1FCVA 3GC5A 2EPMX 1XJBA 1DQXA 1YHTA 4UTFA 5DMYA 2BGQA 2PDBA 4RUBA 4RNFA 3S8HA 1DE6A 3TN4A 2FYMA 3M16A 5AVNA 3ABZA 2R1KA 2FMNA 4QROA 4MUZA 5DY2A 3AHXA 5E93A 1R86A 4JIIX 1GTEA 1KKOA 4GZEA 2WWCA 3ZT7A 3FJNA 1B3ZA 1UKPA 3ITYA 3L21A 4S3KA 3SR7A 1VYPX 1CTNA 3WBYA 1KCXA 2QV5A 1R3RA 4OECA 1W1A1 3QW3A 1KBLA 4LBSA 4P7NA 4GY1A 2V5LA 3T08A 1POKA 2OX1A 4FNRA 1CGXA 3NO3A 5E9AA 2HPMA 3B05A 3A64A 4AG0A 1UP0A 1R3TA 3UGRA 1XCFA 4ILSA 1M03A 4B91A 1BG4A 3IGUA 4H8UA 3PWAA 3AS2A 1EB3A 5CXPA 4H8HA 5EU9A 4OJYA 3L0NA 2BS9A 3NZRA 4PGLA 3SI9A 1JF5A 3ARZA 1JDAA 3BGJA 4MNJA 2ZX5A 2I57A 1OCJA 4IQJA 2GK1A 1VPYA 3GNXA 4F0KA 1A47A 3DFOA 3IARA 4IXHA 3UP8A 1WUEA 1H09A 3ZLGA 3ZJ8A 2HE5A 3HJEA 1GQNA 1V08A 3GVQA 4O11A 1I0BA 4G56A 1LJYA 5IM51 4Z1AA 4PZVA 2G97A 3R2GA 3FHQA 2ZUUA 1YNPA 3GFZA 4EVZA 4DAIA 1ME9A 3B40A 4UTTC 1NDYA 4FF5A 4V15A 4B92A 4AVOA 5C9ZA 2GJRA 4HK5A 4GNKB 3CH9A 2CLPA 2WPBA 2C1IA 3M5VA 3O3RA 4UQCA 3RX2A 3W1TA 3ES7A 3S9ZA 1WKDA 5HMEA 4W7VA 3ZQ9A 5E09A 4QR6A 1SW0A 3WSUA 4R88A 3SCQA 3KM8A 2C18A 1FP9A 2GQAA 2GQ8A 1SUXA 2QZRA 3W6LA 3WQPA 3MI2A 4TMCA 3F2DA 3AXIA 4AHPA 4P5UA 1QPOA 4X3ZA 2A3LA 1EC8A 4ZOAA 2HZGA 3W7LA 1MMFA 1GWJA 4IMFA 1AZ2A 4YMZA 4M6UA 1R0MA 2YLLA 4LBRA 4NJKA 2X2GA 4I9JA 1H1YA 4ZXOA 1AQHA 4MY8A 3HTWA 2BBFA 1OG6A 2DQXA 1ONXA 4FNSA 1JIBA 2D3LA 2WZTA 3VUPA 3W1XA 5K4ZA 1VFTA 3WQCA 3GIQA 4XKYB 2YYUA 3MKKA 2DQWA 2R8WA 4AQLA 3FA3A 2BDQA 2I7GA 2ALDA 1ZBKA 3BLIA 3B8TA 2XIOA 2PDWA 3HPXA 4XAPA 3QOMA 4LEQA 4MM1A 3R7MA 1TELA 1A5SA 2RFGA 3M41A 3ARVA 1J9YA 2AKZA 2Z1KA 4I6KA 2TRSA 3USBA 4E4FA 2PB1A 4EP8C 4L4OA 2C7FA 1CLXA 2OSXA 2P50A 2GJPA 5HNUA 5BCAA 3K30A 1XYCA 2OXNA 3W1QA 3NL6A 2KZHA 2ZZ1A 3QW4B 2PDMA 1OD0A 1RHCA 3W07A 1KWKA 4HK7A 3LCLA 1OFQA 1VZWA 3L9CA 2CBIA 1DXFA 2FHBA 3RX3A 1CGVA 1TV4A 1UUMA 2PU1A 4RV3A 3QTPA 4QEHA 1S1RA 1MO0A 1YADA 2R94A 1BQCA 3C56A 3PULA 2YCIX 1VFSA 1TZZA 2WMKA 1WZLA 3VIIA 1ONWA 2GPTA 2PODA 1H5YA 4BZYA 1JPIA 5H8MA 2X30A 2O55A 3UGVA 4DM1A 3WK1A 1TJ1A 4GHRA 3QMRA 1E0VA 3VD3A 3LTYA 3GH7A 3TQVA 1M3UA 3OU8A 3GXIA 2BODX 4Y8EA 3APTA 4MDOA 4HNCA 1T0OA 4OBTA 3P93A 1P48A 4J7RA 1F3WA 1R47A 2DZVA 5LA0A 2OO6A 4WCJA 2EBNA 3I6RA 1NARA 3C0QA 4GWEA 1A49A 2QVHA 4GPNA 4QTGA 3LUTA 3F4VA 4NAEA 2HK1A 2D22A 1XWYA 1XC6A 2HXTA 2QUMA 4Q8VA 1QI2A 1OFAA 2HK0A 5J8LA 2R1LA 2OT0A 3GSMA 4HSHA 6ENLA 5E6YA 1ZBCA 2VDIA 5CEWA 3APYA 1OWQA 3EEGA 1I2PA 4BA0A 4L5ZA 1S5NA 1F07A 2X8RA 1RUSA 1ZQ5A 2XGBA 1Q66A 1V7AA 5CZTA 2VRQA 1JXKA 1ZAHA 4JY8A 4LAOA 3AUOA 4J3ZA 4AIOA 2I14A 1JCJA 3H21A 2G96A 4HU8A 3WQEA 3CC1A 2JKEA 2OLAA 3C5QA 3ES8A 4MMWA 1UKOA 3WQ8A 2BOGX 4ADSA 4IIHA 3IACA 3UCDA 4IJCA 4JX4A 2E5DA 2VEFA 2C19A 3XISA 3VGDA 3MV01 4JHZA 1C8YA 5FOOA 2YXGA 4D71A 3EWDA 3G3DA 3FV9A 4BFAA 2ZCGA 3IV8A 1RCQA 5L6UA 1QOQA 2GUBA 4HYWA 1S2UA 3UJ2A 3E0LA 2FZ8A 2E4TA 1S39A 3B0PA 3ARUA 2VTFA 4DXVA 4MLJA 3P0WA 3AUJA 4JQ4A 3WDJA 1JZ4A 2EF9A 2J6XA 2POZA 3N73A 4MGGA 4HNLA 3W2JA 2CHOA 4JTEA 4DF1A 3AWNA 5EFFA 2PWUA 1WAWA 4US5D 1R9XA 3NQ7A 3ZR6A 3WX7A 1O7AA 4W7WA 2YZRA 4YXGA 1KFCA 1R7OA 4BEUA 2VR4A 3UD6A 4AFYA 1ONEA 2I5IA 3VABA 3UWEA 2D3NA 1E1CA 1RZMA 1YEYA 5LIKX 3W7HA 5D04C 2WMGA 1QMLA 5LGZA 3EDEA 4GE8A 4O52A 4QITA 4ZQMA 3MB9A 4Z17A 2AMGA 5CPNA 4B5TA 5K9CA 3DGBA 2HS8A 1K77A 3VZXA 5EKYA 1ISWA 3RLVA 3RF9A 2EGZA 3HM7A 4QLLA 3IAQA 1IEIA 1JL8A 1VD6A 4NZCA 4JKKA 1Z8AA 1EDGA 5HNNA 5C6MA 5LNVA 1W3NA 2QF8A 2NWRA 3FOKA 2R24A 5A5WA 3P14A 4ZEPA 3PZOA 3IWPA 3N2CA 3N17A 3LG3A 4CQAA 4ICMA 1J01A 3TTQA 3VGFA 1NFGA 4MWAE 2Q8LA 1PZ2A 3I3BA 3MSGA 1E55A 4WF7A 1OINA 1MVYA 3EXTA 2NQ5A 1QI5A 4NU7A 5AVHA 5GPRA 5I09A 3OG3A 4JN7A 1F61A 1HP5A 1TIMA 1DL3A 1O1ZA 4R53A 3W7NA 1ECQA 2FQIA 1UASA 3KDNA 1GVQA 4MSSA 4DJEC 2QCNA 2HNHA 2YFNA 5E6ZA 5EFDA 3QQ1A 3PC0A 1J79A 3VD5A 3A9BA 5F2LA 1REQB 4GXMA 4FXRA 4PC8A 4R7JA 5HDRA 3IJ7A 1QASA 2ISVA 1WDSA 3GUWA 3R11A 1OJXA 4C7FA 2NX9A 4LS1A 4M29A 2E0PA 4QQUA 3AZRA 3BVJA 5FAGA 2GQ3A 2X7VA 4RV8A 1BRLB 1U22A 3E02A 3H55A 1AQFA 3QSTA 1P5BA 1B57A 2A3EA 3LDVA 1H1ZA 1W8GA 4DNMA 3AYTA 5BRBA 3TC6A 3MMDA 2V5CA 4ZMGA 2E7FA 3O05A 2FZDA 1ODZA 1EHNA 4NZ1A 5A2AA 4C90A 4FMVA 3BG5A 3L4XA 1VIWA 1EQPA 1HKWA 3N34A 1DHPA 1E4MM 4EACA 1TPDA 1JNDA 2FGZA 4B3ZA 3AYSA 1E40A 2PP1A 4LS0A 1SZFA 3IGHX 4X60A 5HANA 4PRTA 1YE4A 4AEFA 3WDPP 4FA3A 3KL5A 3ZMRA 2A6NA 1WAUA 3DFHA 4PE8A 1H7OA 2WMIA 2ZBTA 5C7VA 1BAGA 1X6UA 2QJGA 2RDXA 3MI3A 4Q6XA 5BMWA 6REQB 5A6SA 4ZO8A 1CCWB 1DKWA 4OBRA 1GQKA 1G0CA 3XIMA 2GK1B 1ITUA 1KTCA 6XIAA 1MSSA 1RH9A 2FFCA 2JQXA 3GIYA 3BMWA 3MY9A 1IEWA 2OOFA 4P8XA 1C29A 2C13A 3FVMA 1M7JA 3MP4A 2QCGA 3CV7A 5CPSA 2OPJA 5FI8A 2HXUA 2DW7A 4AC7C 2O56A 7TAAA 1E56A 3PP7A 3NQVA 3CPRA 3N4EA 3LXAA 1V3HA 3WL1A 3MU7A 1TYGA 4QNWA 3TKFA 1PL9A 3V3WA 1E6NA 2BLEA 1TVLA 1OADA 4CGTA 3OVGA 1XLHA 4PBGA 2YCEA 1FWWA 2YL6A 4LH8A 3TLLA 3KLKA 4QHRA 3BICA 2VZUA 4GUJA 1X1OA 2Q8ZA 3USZA 2GWGA 2DSWA 4W7UA 4HNOA 2Q01A 3G1RA 2J6VA 4HZ6A 3UWZA 4WIWA 2V82A 1EGVA 1O95A 3IUHA 2D2HA 3V1HA 1XGEA 1I8JA 1A5OC 4FR6A 3ABQA 1J6PA 4KT2A 4NQ1A 3U8GA 2VC7A 4A2SA 2J47A 2RJGA 3J7HA 2V2CA 5DN1A 4MY9A 1BQGA 2UWFA 3GQYA 3TA6A 3GIPA 3HPZA 3TQKA 1X1NA 3I3EA 3M0IA 4I8DA 4XAZA 4GI9A 4CKQA 1JYWA 1XHGA 1L8NA 3P67A 4XWUA 3LXBA 1UR8A 4UFIA 5I6SA 1WXYA 1JGMA 3L4VA 2MNRA 3NDZA 3CIVA 2WHLA 3WJZA 3GZ3A 4JFTA 4EF9A 1ZRQA 3GW0A 4UBPC 2WMJA 2FJUB 1OF8A 1TPWA 3CWOX 1AMYA 2O9PA 1VBGA 3GH4A 1K7EA 2X1UA 2GGEA 2GJNA 3UJEA 2ZYFA 3MC5A 1OBAA 2GVGA 4Z1BA 3INPA 3OYZA 1U1UA 3L5AA 2XUCA 2QDGA 2J27A 2B31A 1OM0A 5C9XA 4ZTYA 4D8LA 2NQHA 4LRSA 2WLZA 2VQTA 1PTDA 4D6HA 3DKLA 3CUJA 4DWSD 3CAVA 1JAKA 4CD5A 3REQB 1KBJA 1EWDA 3HV8A 1SJCA 3VOHA 3R43A 2Z27A 1UWSA 5EGRA 3MBDA 4DRSA 1AL7A 2NVDA 4HPNA 3PB0A 3VCNA 1ALDA 3DGRA 4RDZA 4CUCA 4XZWA 2PMQA 3OBEA 2ZUWA 3DYPA 3ECQA 4JTQA 3RPMA 3BMVA 2JALA 2CXEA 3SCUA 4KFOA 7XIMA 1VENA 4TX9A 4IUGA 1B0IA 3GHSA 1Q3NA 4FX7A 1KM0A 2ZZ2A 2NX1A 3EPNA 2J8TA 4KGJA 4J27A 1DIKA 3RN6A 3W86A 3ZJ7A 3BLFA 2Y62A 3W7IA 2QEZA 4CVUA 4EE9A 4QBXA 4PL2A 3P60A 3WLLA 4YWSA 2E3ZA 3CTTA 1LOQA 3GHTA 2W9MA 2QJIA 2PGFA 4E2BA 1H62A 4QAIA 2PP3A 3W37A 3E0WA 5A8MA 2NUXA 3FDGA 4AZ5A 4QDPA 4HPHA 3HPSA 1KXHA 3PZNA 2CIPA 4QAWA 4IX2A 1W3IA 5D32A 2HV5A 3WLPA 1KXQA 3TDFA 3DENA 1OX4A 1W3LA 3OYXA 1LM1A 1QO2A 4PUMA 3TLQA 1O1HA 3PWIA 3ISIX 1VC4A 3H23A 1U83A 2E5BA 3NOYA 2ZE3A 1NQ6A 3BLOA 5K3VA 4M7SA 2BVWA 2E09A 5I78A 4AZ7A 4CD7A 4MUPA 1DVJA 1NP2A 1P43A 1CXFA 5FF4A 3RGTA 4GYKA 4R7OA 3LRLA 3E2QA 1TMQA 2Q71A 4MOZA 3TC3A 4C6PA 1HJWA 1GPWA 5HUOA 3LZ5A 2A7NA 1LOLA 2WANA 2ATSA 2WHMA 3T1GA 3TC7A 3BJTA 5LSMA 1KD0A 5DO8A 4OTKA 1JPKA 4F2UA 3O15A 4HZ7A 3WELA 4A8NA 3R13A 4R3UA 3TX9A 2Y61A 1H5VA 2VP8A 5IDIA 2R82A 3HQPA 1MQPA 3T78A 4IIDA 5EMJA 3E2RA 2FDMA 4HZ8A 3JZUA 2PDPA 3CQJA 1FHDA 4W85A 2IKHA 4ALDA 5D05A 2WM1A 3EB3A 4IMAA 1XH2A 2XM2A 3U7VA 4GC4A 4PMQA 3S1VA 4ICNA 2ZICA 4EWJA 2CHNA 2ZC1A 4O50A 4HOZA 1QT1A 3W81A 1P6BA 1SMAA 3MUZ1 2ZXQA 3HN3A 3B03A 3ABRA 1GOMA 1KQZA 4NIRA 4Q22A 3UPWA 4GMEA 2OEJA 5F4SA 1F8IA 1GJWA 2CZEA 5BMXA 3GY1A 1NWSA 1PKLA 5DRIA 2J66A 2RUSA 3GHUA 3LEPA 1TV7A 4LUTB 4AF0A 4MIMA 1TVNA 1FVPA 2D69A 3GG7A 3JS3A 1VJZA 2QCDA 4NAFB 4JX6A 3AICA 1VBUA 3MT1A 5HJLA 1EZWA 4UTWC 1ICSA 4E2OA 4HT3A 1X8CA 4R7WA 2B7PA 4L1GA 5CBIA 4JKLA 5KTLA 2PLJA 4DJFD 5DT5A 3H4XA 3XINA 2NV2A 1NIUA 1GOXA 2ZUVA 1K6WA 3O6DA 5BRQA 2C3ZA 3S4TA 3QBUA 3WQGA 1JFHA 4JTAA 3ABXA 2NQJA 1ELSA 1IT0A 3ANVA 3DG6A 1FX6A 3AWOA 5C9RA 1R30A 3CHVA 2QIWA 4PYSA 1FRBA 1HVXA 1RAKA 3UZWA 3T4WA 3Q37A 3M64A 5M5DA 3TSMA 4IP7A 1OFOA 3CZGA 1XYFA 3E9AA 5BROA 1HIZA 1K8ZA 2XZ9A 1A5CA 4Y9OA 4AB4A 4QLJA 4HJFA 2PEVA 1ZU8A 5BXTA 3ZOAA 3TYCA 2JKAA 3TYBA 3LLXA 2GJXA 3W70A 3PPFA 1SVDA 2E6AA 3MZ2A 4RE4A 3OQ8A 2ZRZA 2Y5SA 1AJZA 2P3EA 5AC5A 3C52A 4PMVA 1J5SA 1A5NC 2ZUSA 3EKGA 2QCLA 4ZOCA 3FEMA 3PUOA 4LALA 2BFGA 3C61A 1CGYA 2EG7A 1V3MA 4MFEA 1KB3A 3EA3A 1GT8A 3HGOA 5ABFB 1K3UA 2J9ZA 1EQCA 4H9MA 1QHPA 1UMYA 2ZA2A 4HA1A 2P76A 1QU4A 3N19B 4ZODA 2DSVA 4Z1DA 3IIPA 4LAZA 3FHAA 3CQ0A 3NZPA 5FJRA 4DZHA 1QW7A 2Z29A 5F2MA 2Y89A 1JYNA 1W17A 1EOMA 5AECA 3GU1A 3K4AA 3PSVA 4FOJA 5HMDA 2R9RA 5BRPA 3CPGA 4D6JA 4MG4A 2R6OA 5C70A 1AFSA 4X0VA 3CUHA 2P88A 4CQCA 4E0CA 1CENA 1A3XA 5FJIA 3ITTA 4MYAA 3RUBL 3VKBA 3BSHA 3DUGA 1TIWA 2WSPA 1A5MC 2OYMA 4WX2A 1TJPA 3BG9A 4K36A 3W7GA 1MZRA 2A7PA 4GO8A 2ASHA 5BNKA 4DXKA 4QSFA 4M6PA 3TXVA 2EJAA 2CETA 3C2OA 1IT7A 1BXNA 3A47A 4DBWA 2W6RA 3UZXA 3SIMA 1LQ0A 1NSJA 5TQLA 3CM4A 3WBEA 4O8AA 3KOZA 6PTDA 1I4NA 3UW6A 3MCNA 4YTQA 3M0JA 2GVYA 2GGIA 4JIPA 3M0XA 2PWGA 4AIEA 4H9TA 5HMFA 4UMBA 1LBFA 3N9SA 4IG2A 3ZT6A 2W63A 2ZXDA 3W6YA 1XLIA 4LNYA 3LRKA 1FXQA 3P6LA 1UHVA 1BF6A 3S6TA 3NOEA 2WCSA 5I00A 2J9XA 5A1AA 1Z7AA 1TJ0A 1MW3A 4O18A 4QIUA 3QYQA 3HG4A 3B4UA 1OYAA 2DEPA 3BL3A 4WR3A 1G4TA 4OZOA 3R0UA 3BCFA 3EPOA 3EWXA 3RRAA 4DI8A 1C3FA 4L9ZA 2WHJA 3VO0A 2O9TA 1E0XA 2C8NA 3CO8A 1H3GA 1GQJA 3QGVA 3V1PA 3V18A 4QP0A 3C2FA 5I79A 1BLIA 1UP3A 3QR1A 1V3JA 2WJEA 1ZJIA 5LNUA 4CNTA 3TR2A 4ZFCA 3WY1A 2DPEA 2XIJA 3N2OA 3W2MA 1V79A 1B31A 3O1NA 3PSWA 1RP8A 2WKLA 5AHNA 2OZ0A 3G1DA 2E40A 3QY8A 3WH8A 3PZVA 1V0KA 3R94A 5TD4A 1IZJA 1BWVA 4O12A 1F4HA 1H0IA 4H7ZA 5DT7A 4WLCA 5DXYA 1MUMA 4XD6A 2VCBA 3IGXA 2OQYA 5JBDA 3FAXA 3PZIA 3OGSA 4M1RA 4F48A 2J24A 2GOUA 3QHMA 4EXQA 1K7FA 3CL8A 1J18A 4YCOA 3PUGA 1H7WA 1KBKA 3GX9A 4JY9A 2ZZ3A 3W7DA 2MANA 3SSZA 2QDEA 3S5YA 4GH3A 1YXDA 5CZKA 5HOSA 3RLUA 1Q63A 3NQEA 2BMBA 2QR6A 4JIEA 6TIMA 1XPGA 3NFUA 5ABFA 1UBPC 1R2SA 2WMIB 3WQ6A 1S5TA 4F2BA 4NF7A 2WQPA 4DWDA 2VO5A 1Z6KA 3L7RA 4JS3A 4MNMA 4M81A 4F79A 2G4JA 3IK2A 1EGZA 5TAOA 5C5YA 3TNOA 2Y5EA 3ZM8A 4FX6M 1A5LC 1CYGA 1ECEA 2CLEA 1ZB5A 4GI8A 4QJ1A 2W79A 4QE4A 3T0AA 4Q8WA 3RJXA 5FCZA 5LIWX 4XTDA 3ATZA 5T8GA 3W22A 4K7YA 3WJYA 2VFDA 2OG9A 3M5XA 3AIQA 2XIBA 1FH7A 2W62A 5CG0A 3H4WA 4GFIA 3MUIA 5FA5A 3PZQA 3U57A 3G3MA 1OF6A 2WJDA 1S38A 1NP0A 1EO7A 1E1FA 4BI7A 5A8NA 4DBSA 3VIHA 3AJXA 3AXKA 3QHOA 4WDWA 1W1PA 1BGGA 1X39A 4J28A 3L5LA 3DFPA 1H49A 3NO1A 4U3AA 3MP3A 3L4YA 2GVEA 4UTJA 3WLKX 5E5CA 4RK8A 1XCWA 3BSMA 1V6WA 3ZZ1A 4PUKA 1QNPA 3S5SA 1H63A 3VNLA 3TONA 3ELFA 3STFA 1EUNA 4QEEA 2YA2A 1AK5A 1HKKA 3W1MA 3R4IA 4UCGA 1V6UA 4F0RA 3L0GA 1UH3A 3ZWTA 1K9TA 4GVGA 3H53A 2I17A 4PMRA 2CBUA 3UWWA 5LHFA 3CIXA 5CJNA 5G4EA 1JDDA 3GW3A 2WBGA 3MJMA 3TP4A 4NZ3A 3WFZA 3T2OA 3CT7A 5HA7A 3APGA 4Z08A 5EMMA 3W02A 1IZKA 4V1XA 3NM1A 4EPEC 2H8XA 2D2JA 2PA6A 1WDPA 5DANA 4KEMA 5CQ1A 3W84A 1HJQA 3KBNA 4TVCA 2HS6A 5HPCA 4N9EA 3VKKA 1FA2A 5LIUX 5CGTA 3C2RA 2OZ3A 4O4VA 5G1MA 3S2JA 4JTSA 1OABA 3W1RA 3D47A 2EG8A 1DJZA 1JZ5A 4W93A 1XP3A 4TU1A 2X09A 3QZAA 3KRSA 3LCGA 1V8EA 3EOUA 3CBWA 4GYFA 3W01A 3L23A 4PULA 4CU6A 3U7BA 4UNKA 4PODA 3CZ8A 3TZFA 3NWRA 1NF0A 2E6DA 2VEIA 4Y8FA 5CZJA 2ICSA 4U28A 2PUZA 4S3BA 5FEWA 2WSYA 3FAWA 2PRMA 3JW7A 1MXSA 4H04A 1GW9A 1VYSX 3TEVA 2DT0A 3NQAA 1XISA 2NVAA 3MI6A 3WLHA 2H9AB 1WXZA 1G7UA 4X9YA 2PTZA 2VFFA 3TJLA 4C6JA 1RP9A 1HVQA 4ACZA 1P7TB 2J7FA 2Z24A 4HA3A 1W1VA 1G67A 1LOSA 2WSKA 2JE8A 4MJ4A 1YXCA 3ZXWA 1FWEC 3TNBA 3DXIA 4DJFA 5CAHA 5HUPA 4Q4SA 3EDJA 4LC8A 1GVRA 4CNOA 8XIMA 4UQAA 4ZSTA 3UPBA 4HHHA 3NA8A 4PTMA 4CN1A 5JBEA 5CZSA 2YBUA 5DLCA 3POCA 4BF9A 4H6EA 1CECA 2DUXA 1RQBA 3SCSA 4K68A 4MB1A 3LMYA 1L6YA 5JXQA 1H2JA 3U2CA 4I5XA 3IJ9A 2ATMA 3GNDA 4I3GA 3ZWSA 1G01A 3DERA 3EAUA 4Y6GA 4JTCA 4MY1A 3OO2A 4XQ6A 4DLMA 3UEQA 2X40A 3SQLA 1SO4A 4XV0A 4O0ZA 3RM9A 3GM8A 3LCFA 3QR0A 3PANA 5FAJA 1TE1A 3N9KA 4DM2A 4HNNA 1VHCA 3SCVA 3NO5A 2HVNA 4H2CA 2OJPA 2J7EA 1JYVA 3U3HA 1I60A 2D73A 1OGSA 4Q7NA 2CWNA 3E0VA 4QX4A 6CGTA 3NEHA 2DZBA 4W5UA 3SM0A 5A6LA 3AIUA 1QW9A 4UFMA 1OFPA 3PPGA 1E0TA 1UG6A 3VDCA 2VOTA 2WC4A 2VI0A 5HXMA 3UQNA 1QOPA 1QUMA 4IICA 2ACSA 1VJIA 3WL0A 4JTDA 3I65A 3BGGA 1OX4B 4RL3A 3BJFA 4ZBCA 4J3SA 2B81A 3NQCA 2D2GA 4Y90A 3OGRA 2PFHA 4JYDA 3W7CA 1DIDA 4MWAB 3WMCA 1DJQA 1W3TA 1E3ZA 1YPXA 3K4DA 1Q45A 1CWYA 4JTHA 4O13A 4GUGA 1RD6A 3W83A 1R2TA 1ODUA 3T40A 1YBQA 1KA9F 3ICJA 3CAWA 1J6OA 4FF7A 3WD2A 4HGXA 4S1FA 4MPQA 3RPTA 4QM1A 3CHFA 4NASA 4YTSA 5U7SA 2WZIA 2Y8KA 5GNXA 3E0IA 3P5YA 3NEVA 1K70A 3V0UA 5A2BA 4C6MA 2HE8A 2V38A 2PRLA 3QVQA 3TTSA 2XH7A 4JPGA 3IIOA 2Y7EA 3GZAA 3BDKA 4KF1A 3UJSA 2J7CA 2G0WA 2C71A 4FOKA 1V93A 4RDYA 1Z42A 3TYAA 3KHJA 3C0SA 3N6HA 3A6OA 4P7LA 1S3TC 2ZRUA 3SO7A 4D1JA 4POCA 3CUIA 4EK7A 3AMDA 4KWSA 4HVXA 3QMTA 4FZIA 4IH3A 1AW5A 3WLJA 2OEMA 1PXGA 3U2EA 2PTWA 4CNPA 4XZBA 3EOSA 4ZXLA 1W1IE 1ZPTA 1BYBA 3N25A 4FNQA 2I9EA 4AMAA 1OK6A 2WYSA 1YBQB 1UKSA 1WUFA 5A6KA 1JPDX 3LI1A 3O16A 3UFYA 3OJGA 1W3HA 1KM3A 3SEPA 4TTGA 5D9PA 5FJUA 3PNUA 4GIYA 3DC8A 1TMLA 2FJKA 2BY0A 1WDQA 1GHSA 2YCJA 2XH2A 3BCJA 3GXPA 4AY7A 1NDWA 2P3ZA 4JFWA 1AD1A 2CZFA 4A8IA 1VFUA 3HF3A 4PB3A 3KLLA 3EDKA 4ORIA 1RBLA 1LL4A 1XLDA 1DWFM 3TYZA 4LT9A 3NPXA 3QPZA 3B9NA 3CXOA 3W2UA 3IJ8A 4TVDA 1E43A 1VLWA 5DMNA 2DZTA 4J3XA 4V1YA 3W7EA 3WMBA 1ZUAX 5F4WA 1XLAA 3IV3A 5KINA 3N2XA 1BG9A 3VIMA 4TV5A 2TYSA 4IFKA 4JIRA 1CXKA 4XD4A 4G1KA 1NOFA 3W76A 3VD7A 1I2NA 2YB1A 4B3LA 2XHYA 1W9VA 3LCWA 1CXHA 3AMGA 4ICCX 4NI3A 3LXCA 5IBXA 5EB8A 3EWYA 1J93A 2DT3A 4MHBA 1OK4A 2XVGA 1LROA 1VCGA 3QV9A 1I2OA 3SY8A 4ZO7A 1NFPA 4GD0A 4A3UA 1UIPA 2A2IA 4FX8A 5LIYX 6TAAA 1XKJA 3GYEA 3GVWA 3K4WA 2UY5A 1H11A 1TWDA 2YZ5A 1UJPA 1NVMA 5PTDA 4BEQA 5FJOA 2OYKA 3GDKA 1BTCA 4UTLA 1DJGA 3LS9A 1J0ZA 1IEVA 4A05A 5I3JA 1TTPA 3HMJG 3SDOA 5G1TA 4JN8A 4O10A 2V3DA 1GNXA 1QWKA 4KWOA 2JKPA 3UERA 1KCKA 1WP6A 2XU2A 2ISSA 2DW6A 4HHPA 1IIHA 2OGJA 1M9HA 4J2MA 2VCCA 3PHAA 3MSYA 2UY4A 1VBJA 2C14A 1TB3A 5JIPA 4X61A 3TMLA 4ZZ9A 4KEUA 4UR7A 4W89A 2YCLB 1A53A 3LLFA 4UQ9A 3F7JA 1VQTA 4HTBA 2BASA 3B0VC 3G6LA 4H9YA 5FEXA 4ML9A 5L9FA 2X7WA 2VQUA 2VWSA 1RK6A 2GZXA 3AIEA 3S1UA 3ZJKA 3SRFA 2FZ9A 1AJ0A 3WQFA 4H6RA 5TIMA 3B97A 4PUNA 1XBZA 1WBHA 5FF7A 1QBBA 2D2OA 4GISA 2DZPA 5E0FA 4C6OA 3SURA 3P8IA 4FALA 5E0KA 5BW6A 5K4XA 1GOWA 1EL3A 1LRNA 4CCDA 1Y8BA 3GNNA 1B30A 3UXAA 4AY1A 4AHOA 4Q7IA 4E3VA 4F3HA 4Q8PA 2QJHA 5CGMA 1DORA 2HBXA 3C86A 3SCRA 1UH2A 3SQMA 3UZJA 1H61A 1CNVA 3AHTA 2ZOXA 1VP5A 2VRJA 4LAKA 1TPH1 2PGEA 1SW7A 4MFDA 2QXWA 5ECUA 3CAKA 2Y8VA 1JYXA 2IW0A 1KTNA 1W5OA 4URIA 4IQEA 1W9DM 1B54A 3C8NA 2QULA 4E3TA 4IGMA 1K4GA 4NX0A 3WNOA 3QSRA 1Q7QA 3GTNA 3KXQA 4NJJA 4L7ZA 4LF2A 1TREA 2NLYA 3ZSSA 3K8KA 3NXFA 2XSBA 4H6QA 4KCVA 2X1RA 4EXBA 4PTXA 4XSLA 3R0KA 1YKWA 4HCHA 3TH6A 4AZCA 5MF5A 2WNWA 1HL2A 1US2A 3UBPC 4GJJA 4UTMA 2Y7FA 2QIIA 3ATYA 1HN1A 4FB7A 4W9TA 4NRRA 1I2RA 2XN1A 3MMUA 3NNTA 5DELA 1QI4A 3SUWA 1XIEA 3HG5A 5RUBA 2Z25A 2V5KA 1JRCA 1F5ZA 2A3HA 3GC2A 5DBUA 4GKLA 4DYJA 1FCBA 4DJDD 1AA1B 4GIRA 3THQA 4PRRA 3NYDA 1CGUA 1LF1A 3BZJA 3W4RA 3IK4A 3KVJA 1BF2A 3MSRA 1A5UA 1TQXA 4DZIA 1PHQA 2VFHA 3DFQA 4KWVA 3EXRA 2VX4A 3WH6A 4V28A 1C8XA 3RXZA 1HGYA 4HP5A 3UG8A 3UCQA 1LLZA 1U30A 5HR7A 1J4EA 1A4MA 3EKZA 5ABHA 4NAEB 2RDTA 4DBEA 5IXEA 1W3JA 3KBVA 2PTDA 2NT0A 4P61A 3WYZA 4UB9A 1LT7A 4RW5A 1XIIA 4REQB 1ITXA 4JEJA 1XM3A 4JQ2A 5KETA 3V5OA 1M04A 2XINA 5D02A 1VIZA 3GHRA 3I68A 5LXXA 3O7UA 1CI1A 1QBAA 4AD2A 4G7FA 4MLRA 1R3WA 1ISVA 1QHOA 5DRCA 1PYMA 2HDJA 1VJSA 4HYVA 2PDJA 5T91A 5T9CE 3LI0A 2WWDA 1ISYA 1FWTA 2QCDB 4LOCA 1XDMA 1YRRA 3AXXA 4GGBA 4HCLA 3B9DA 2AGKA 3GDTA 3W1UA 3HFYA 2EKCA 3GU2A 4DF2A 3VKCA 1WV2A 4AWSA 1CW2A 4M19A 1TWSA 5M1TA 4UIOA 2YLAA 3WUGA 3LPPA 1SJBA 4X22A 5LA2A 2A21A 4K2SA 3RMEA 1HL8A 4WY0B 2BX7A 1B2YA 2V3EA 4PA8A 4EKJA 1F4AA 4JTRA 1Q65A 4LVDA 1XRVA 1MW1A 3IUIA 3W7PA 2D24A 2ACUA 3ITXA 3ABSA 4J9JA 1OCBA 5D2VA 1XRTA 3PK7A 2YDAA 3BW4A 4Q8OA 3GR8A 3C0JA 4NG3A 3DG7A 3UVAA 2PDHA 1CBGA 3E5PA 2PTYA 3UZZA 9RUBA 4C5YA 3OBKA 4HNVA 5SWUA 2FTYA 1P0EA 3L2LA 4UTHA 1DBTA 2NSOA 1XG4A 1KQYA 3F5JA 4WXZA 3LSCA 4HHLA 3TYUA 1VB9A 3NXLA 3G1FA 4JL1A 2IPWA 3MMTA 4WSJA 1PZ3A 5D4YA 5GJNA 3VM5A 3LQLA 3LM7A 3UWYA 1UC5A 2OO0A 1V0LA 5B7ZA 3U6WA 2J8GA 3H2FA 1E6QM 4WXYA 4Y96A 2IUZA 4LV9A 1ZFJA 4AD0A 1OX5A 4H4IA 4LYRA 3VM7A 2V5BA 4HMDA 4LY8A 5GQBA 1KR1A 1OC6A 4G7EA 3WQDA 5AHMA 5KZ6A 4N9CA 2Z2BA 1ISZA 4KFPA 5I3FA 5E1QA 4H9ZA 1LTDA 4G5DA 3BAXA 4H8NA 4GKTA 1Q6RA 3GFYA 4NX5A 1HX0A 1ZSXA 3A13A 4IFRA 4HA4A 3MS8A 1D7FA 4LV4A 4DJFC 2VCAA 4B90A