1SO3A

Crystal structure of h136a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
214
structure length
214
Chain Sequence
b'SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYARSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 85
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so3A00
1YTEA 4PTNA 3NQ8A 4UTTC 2CWNA 4N4QA 4JIPA 1YTDA 4Y8FA 4CCEA 3LXCA 1B3OA 1B57A 4HPXA 2J27A 2ZRUA 3LXBA 2H90A 4MUZA 3NZRA 4O16A 3TROA 1MEHA 1NF7A 4NU7A 3M7WA 1O60A 2Y6ZA 3QYQA 3NR0A 4JN6A 2V82A 1D9EA 5CPOA 2RDWA 4FB7A 3R12A 1JCYA 2V2CA 5K2ZA 3W2UA 3NQVA 2C15A 3S8HA 2QJGA 3R89A 1ICSA 3EWZA 5I3HA 1MO0A 5BMWA 3NQMA 5AFDA 4RJEA 3STGA 3E96A 2CLLA 3GXTA 2Y7EA 3VI2A 5H2ZA 2G5WA 2W6RA 1LLWA 2UV8G 3FYPA 4NJHA 5LSMA 3W7PA 4YCOA 3N34A 1MSSA 2ZZ5A 4K8EA 1TPDA 2ZTKA 2Y7DA 1DOSA 4JYDA 4IQLA 3PUOA 2NXIA 2VFGA 4MY1A 3WK2A 1V7YA 4RX0A 5FF0A 3EX4A 1DL3A 4BI7A 3W1PA 1TTIA 3W7IA 3PB0A 4RR4A 5DBUA 1OF6A 3KRSA 3NO5A 3TFCA 2OMAA 3FKKA 2J24A 4UNLA 1M6JA 3O6CA 5TIMA 1ONRA 4Q32A 3MI6A 1N7KA 4UTHA 1A5AA 5D38A 4X3ZA 1KTCA 2BSLA 4HNNA 3CEPA 3HIJA 2DZUA 1KLYA 1SFLA 4FNQA 3G1SA 3KVMA 2QCEA 4K7YA 1DHPA 4XTIA 5AHIA 1FX6A 3OVRA 1HFBA 3EX6A 3IGSA 1W5QA 4JY8A 1OFEA 5AHMA 1Z48A 3TV8A 3LHYA 3E49A 4FXRA 5D2TA 4JDBA 1QOQA 1GVQA 4FX8A 3BLIA 2QEZA 3W7MA 2WPBA 4QNWA 4DPPA 1KM1A 4IMDA 3W9ZA 1C8VA 4QJ1A 2WV8A 4U4MA 3NQAA 5AHFA 1RV8A 1ZCOA 2FFCA 3LX9A 3JS3A 2E5CA 1VS1A 1JRBA 4HSOA 3EX3A 2PRLA 3ZS4A 3WK3A 1XC4A 3L66A 3G1XA 1GTEA 5KINA 2A4AA 4PODA 5HJLA 5BRBA 1BTMA 1XBVA 4Z1BA 5F2MA 4UTKA 1X7FA 1ZAIA 3DGRA 3UZ5A 1D3HA 4ZVJA 1K7EA 4M5PA 1KFCA 2A0NA 3PBVA 2EF9A 4K39A 1RD5A 3CU2A 2Q3OA 1QO5A 2C0AA 4IPIA 1FWNA 1K7FA 4Q33A 2E77A 4WY0B 1VCGA 1JR1A 3W86A 2A21A 3L65A 3M16A 5G5IA 1AL7A 1OK4A 5HWMA 1G69A 2CU0A 4NJJA 5KZEA 1XKYA 2VEMA 3TSDA 3W76A 1TPFA 4A22A 1Q6OA 3S5OA 2C13A 4O10A 3TH6A 4M6QA 1GT8A 4UFMA 3IEBA 4Y96A 3JRKA 1W8SA 2QCNA 3ATYA 4NNAA 1YPFA 5I3KA 2ZZ6A 1VYRA 2Z0IA 1G4TA 3OHIA 3W7JA 1AW1A 1OX6A 4JX4A 3QQ0A 5AOUA 1W3IA 3OA3A 3LBCA 4ADSA 3F4WA 4NZJA 3V1PA 3NQ2A 3LCWA 4LS0A 3OEXA 1IIHA 2A7NA 5DN1A 4MPQA 1OFOA 3C2OA 2GVGA 1KBIA 1W5MA 3KOFA 1JCJA 5AC7A 4LRTA 3I7QA 4FNSA 3L2IA 3LTSA 3M6YA 4KWVA 1GTHA 4O4WA 1OVDA 2ZTJA 3O1NA 1EPXA 1B4KA 3G8EA 4FEZA 3TUUA 1TMHA 3FLUA 1KM5A 3U8GA 3N19B 4CQAA 1P4CA 4DQWA 4H4IA 4ORMA 3W6YA 3PULA 3LBMA 4YXGA 2GOUA 4E2DA 4FNUA 1W5PA 1F7BA 3A21A 2J9ZA 1LOSA 1GVRA 4O1CA 5FEXA 3U6WA 3RFAA 3DFNA 1OFBA 1GOXA 1NAL1 5KTLA 1ZENA 2XN2A 4HHPA 2YR1A 4WQ6A 3N3MA 3N14A 3HF3A 2VOMA 2E6FA 1TPVA 3C6CA 4MKNA 5D05A 3A23A 4LS2A 2VC6A 1OFQA 3L5MA 3DFQA 3SFKA 4KFNA 3H55A 1AL8A 3I68A 2QR6A 3O6DA 3P67A 1PHWA 4HNVA 1Q45A 4N9BA 4MZ1A 2D73A 1KM4A 1EX5A 3EXRA 3DU0A 3TU9A 4KWWA 5AN7A 2CZ5A 3IIPA 5DBTA 2C3ZA 4LVDA 4ICNA 2Q3RA 1GG1A 3G0SA 5F1VA 4IPJA 2PURA 2VKZG 1LROA 3G1AA 4W9TA 4JTSA 2NX9A 1JCNA 3RNDA 3UWYA 2O7SA 1DJQA 2ATMA 2GVJA 3NQDA 4N6EA 4MJMA 3VE9A 3BG5A 4M7SA 4WY0F 1VJIA 2QCHA 4A2SA 1ALDA 4GUHA 5D2YA 3G0XA 1XCFA 1SSGA 2GPTA 4UFIA 5LNRA 4IWWA 2HMCA 5GVJA 4JX6A 1L6WA 1IXQA 3SJ3A 1ME7A 2NUXA 2V5BA 3PAJA 1XUZA 4DO4A 1BWLA 2C18A 5G2WA 7TIMA 1HG3A 2P10A 4BWLC 4Z1AA 5DY2A 1L6SA 3R8RA 1RQBA 4IX2A 4MYAA 3BGGA 3QFEA 3TAOA 4ADUA 3MMTA 3UY7A 3G18A 4UFKA 1G6CA 4QSHA 2X16A 2R91A 3KVKA 4RV8A 3PSVA 5LGXA 3E9AA 4ZQPA 4FHAA 2OX1A 3UWVA 4DO5A 2QCLA 3DI1A 3PB2A 1WYIA 1TRDA 3GAKA 5HWJA 1TYGA 2QAFA 3S1VA 3EKZA 1H62A 2WNQA 4GE8A 1LLZA 3S1UA 1IXOA 2QCDB 3O6YX 1XM3A 2QCFA 2BTMA 3IIOA 3LCFA 2Y63A 2GJNA 3NL6A 3W71A 3W1LA 1OX5A 4DF1A 5D09A 3RMJA 3STFA 3RU6A 3LXAA 4K37A 3W1RA 3W2LA 1EUNA 3S1WA 1WBJA 1QOPA 5D04C 2F84A 4NX0A 3SSJA 2ZCGA 5A8GA 2E6DA 5LZLA 2JGQA 1H61A 3I7RA 4K38A 3LV5A 1TV5A 3MP3A 2CFFA 3UXDA 3NZ1A 1UASA 2A2IA 3LDVA 2DZSA 4QNEA 4UTWA 4Y90A 1P0NA 5FI8A 3TR2A 2RHGA 5G2HA 1MXSA 2H8XA 4K7VA 1G7VA 4LVBA 3LHZA 3CWOX 1EP3A 1I2RA 2A1YA 3QM3A 4YL2A 5DCDA 5TBOA 2ZFAA 5LGZA 2DORA 1QWGA 3UY8A 3P8IA 4CNPA 3BV4A 4RZ5A 1B4EA 3DI0A 3MI3A 1CX9A 1Q6LA 3E02A 5HUPA 3L5AA 4QISA 5TQLA 5G2IA 1DKWA 1OABA 1S5WA 3L21A 1K8YA 3AJXA 4UMBA 4IX0A 2P0OA 1UBSA 4FNRA 2W79A 3EWUA 4N9EA 4HNUA 1YXCA 3ABQA 5G4EA 4O12A 2CW6A 3GDLA 2BWGA 1OFRA 4GRSA 2P1FA 4M6PA 3OG3A 1PCKA 3BW4A 4ZQOA 1ZFJA 4NXKA 3W7OA 4O1BA 2Z2UA 1ZALA 3LCIA 2H3BA 4KFOA 3P60A 5CSSA 2Y88A 3FJ6A 3P84A 3A22A 4N02A 4PA8A 1KFBA 4HNTA 2ZRVA 5HWNA 4EIVA 1VH7A 5K9XA 4WOQA 4MYXA 4AHQA 2X2GA 3HG5A 1FCUA 3Q94A 3SY5A 1TQJA 4WXZA 3G0UA 5DLCA 1KA9F 4Q4KA 3UWUA 3L0NA 3B04A 4MIMA 2JKEA 3GIYA 4JY9A 3E12A 4O13A 1YDVA 3S5ZA 4I9AA 3IIXA 3GNDA 3VCRA 2YW4A 3VKJA 4O1DA 3W84A 1O94A 1W31A 1FXQA 1H60A 3G3DA 1FQ0A 3W1UA 4M7TA 1LYXA 3FIGA 2TPSA 4O52A 3T55A 3UWZA 2CZDA 3M44A 2CLKA 2A6LA 3NQ7A 4YWIA 1O95A 3K30A 1LRNA 4R7JA 3L0KA 3TW6A 3C2VA 3CC1A 3LHUA 3GYEA 3HPZA 3GLCA 3MYPA 2Z1BA 1LBMA 1HO4A 5D33A 1QO2A 2Y85A 3TQKA 3GX9A 3M5VA 1WBHA 4LVAA 5C5YA 2JK2A 4AAJA 3F03K 3W7RA 2X1UA 2NXHA 3MYOA 5CSRA 5DY3A 3TC7A 3NM1A 3LHWA 3C8FA 1R2TA 3LLFA 3W1MA 5F4WA 1TV7A 1SW7A 1QPNA 3P8JA 2NX1A 2V8ZA 3PBUA 3Q2DA 1SQ7A 1WDWA 4ORIA 1OX4A 4N9DA 4JXCA 2GQ9A 2VEIA 4MY9A 5LNWA 3OIXA 1LM1A 1G4EA 4RCXA 1I2QA 3S9YA 5T26A 3LV6A 3PR2A 1LTDA 1KFJA 1H7NA 4O11A 1ME8A 1ZNNA 1RZMA 3QC3A 3KRUA 1GG0A 2ZRWA 1F05A 2RDTA 2BLEA 4LVFA 4GUFA 1SW0A 4NNBA 2V5LA 3L9CA 4ZQRA 3DH7A 3C61A 4FIRA 1K03A 1K8ZA 4H6KA 4IMGA 2WQPA 1J2WA 1QNVA 2NX3A 2CLEA 4GNJA 3CPRA 3W70A 3MHFA 4L4LA 1MEIA 3L67A 4OWGA 3LTPA 2YPIA 3PBWA 3STCA 4BK9A 3TK7A 2Y7GA 1YXYA 3BW3A 4ZQMA 1VGAA 3WFAA 5HR7A 1YYAA 3M47A 1ZY9A 1SPQA 3BK0A 1PVNA 1ZAHA 3QEZA 2TRSA 3BPWA 4XZ9A 2CZFA 1R2RA 2FPTA 5LHFA 3CT7A 2GJLA 2J9XA 4O50A 3W23A 3HGRA 1QPQA 4NXSA 1F73A 3O07A 4AXKA 5G1TA 3W2NA 4ZL1A 2FB3A 1XFBA 5A5WA 3FOKA 2FIQA 1H7OA 4X2RA 4JTLA 2VFHA 2ZYFA 2ABBA 2WSYA 5I3GA 4LV9A 3O05A 8TIMA 3FEMA 4AMAA 3BVJA 4JTHA 1I2NA 1VYPX 4EF8A 3C2RA 4BR1A 1QCWA 1RVGA 3EKLA 4UTIA 3H53A 1FDJA 2JKPA 2OZ0A 2EKCA 4A3UA 5G4WA 2PE4A 3I6RA 1JCLA 4RXGA 2G97A 3GDRA 3T44A 1KTBA 2BXVA 1WV2A 3G1HA 4I7WA 1J4EA 1KM0A 3S5YA 3P62A 3NQFA 3UNDA 3LRMA 3O15A 2DJLA 1EEPA 1JUBA 4MOZA 3ELFA 1XI3A 3IVSA 1W54A 2W0UA 3CIXA 4EVZA 4FX7A 5LNUA 1X6UA 5BNKA 2FQIA 5CZTA 3MW7A 3EWWA 4QITA 2A6NA 4ZMGA 1SU5A 4AHOA 1F5ZA 4S1FA 3L68A 1C9DA 4GWEA 3TAKA 5KZMA 3T78A 2E5BA 2FDSA 4JYFA 1K7XA 2ZA1A 5D2WA 1TTJA 3BG9A 5D2VA 3O16A 4NUWA 5HUOA 3W83A 4IGHA 3T7VA 3W1XA 1O5KA 4UC5A 5ABTA 3LRKA 3W7NA 1ME9A 5FF4A 1FUYA 2HS8A 3BG3A 1FWTA 4A29A 1YDOA 2DZPA 3ABRA 2R14A 4LUJA 4C1KA 3QSRA 3FA5A 3TCEA 1D3GA 1OF8A 1W3TA 3STEA 1XBXA 4WUIA 3QW4B 3NNTA 5F1UA 1EB3A 3C52A 2Q8ZA 2HTMA 2ZA3A 1H7PA 3C0JA 4ML9A 1W37A 4A21A 4GXMA 1F76A 2RH9A 1HO1A 5DCEA 1OFDA 4ZQCA 1FCQA 3G1FA 4R34A 2WSQA 4UTLA 4G1KA 4LNYA 1W3NA 2B7QA 4IJBA 3SIZA 3W85A 3G1YA 1OFPA 5DCBA 4LT9A 1SW3A 5LKYA 2J88A 1N8FA 3PUEA 1SZNA 3DFOA 4X22A 5I3IA 4O15A 1TO3A 1TIMA 3NL2A 4FF7A 1VQTA 4RZ4A 3GXNA 3W1QA 3BGJA 3FKRA 2CLFA 3EXTA 1UUMA 2J6XA 1IXNA 3W74A 4GUJA 3GR7A 3W7EA 3DBPA 1TTPA 1RQEA 1PIIA 5U4NA 4PCFA 3PY2A 4JGDA 3PC0A 3THAA 2GQAA 3N2XA 3NPUA 1GJPA 3HG2A 3TDFA 2Y61A 4Z1CA 4UMCA 1VLWA 2NWRA 3PBYA 2A85A 4GBUA 3HG3A 2V9DA 3H54A 3EXSA 3IGXA 3TKFA 3W7DA 3L0GA 1JQVA 2C19A 4DO6A 3N73A 2NWSA 2GVLA 2XN0A 1ZAJA 1YPIA 4BI5A 4GC4A 2WNNA 1JUKA 2ZZ2A 3LCXA 2AGKA 1LBLA 3GKFA 1S5VA 3LCHA 3W72A 2YW3A 2E6AA 1CI1A 4O17A 3LCGA 2QF7A 3P61A 4AB4A 4Z08A 4YMZA 3A5VA 3PWAA 3V75A 2ZZ3A 1OX4B 4YLWA 1FWWA 1SFJA 1H50A 1TSIA 3OVQA 2ZZ7A 4FIQA 3HOJA 3NPVA 4WZHA 4TR9A 4Y9AA 5BMXA 4ADTA 3KAOA 3MBFA 1I2PA 1G4PA 3GZ3A 3BLEA 4OBTA 5DXYA 4CCDA 1FBAA 5BW6A 3DHFA 5SWUA 4UNKA 2B4GA 1KLZA 1VC4A 3WJSA 4BWLA 4UFHA 2A5HA 5FEPA 5D30A 3CLMA 3NQ6A 4H3DA 2DZWA 1S5TA 3KVJA 2NV1A 2TMDA 4Y6GA 1R47A 4UTMA 5J5RA 5KSWA 3W7GA 5HMSA 1QMLA 3RF9A 3W07A 3M5XA 3IV3A 1KTNA 4MVAA 1PE1A 3D0CA 2HS6A 2R94A 2ZA2A 1VHNA 3UXAA 1OYAA 3FFSA 4OE7A 3SGUA 1TREA 2JGYA 2C1HA 4I7UA 4E2BA 1AW2A 3DFTA 3N2MA 1LP6A 3QRHA 1ICQA 3LTYA 2ZDRA 5F2GA 3TW7A 3QW3A 1ML1A 5EPDA 2ATSA 3GDTA 4HKPA 3EWXA 4RZ6A 4AF0A 3F1QA 4MZ8A 1GVFA 1YTKA 2V0TA 2WNZA 3HBLA 4CNNA 3W87A 5FF7A 1U5JA 4DXVA 1H1ZA 3I7SA 3QH2A 4KKXA 2O7QA 1WQ5A 1OHLA 1ADOA 2YX0A 2DZXA 2PC4A 1WXJA 3RK8A 1AW5A 4O1AA 3W1NA 1DJNA 4N9CA 1LOQA 2YFNA 1N55A 1QR7A 4AWTA 3ANYA 3B8DA 1AK5A 1WOAA 4JTUA 1SSDA 3GK0A 3C56A 3M0ZA 4NZFA 5C6MA 3B4UA 3O8AA 1HTIA 4UMAA 5AHNA 3HGOA 3A24A 3B0UX 2ZZ4A 3MI2A 3MUXA 3NYZA 4RXFA 3QPZA 1I4NA 1RPXA 1UCWA 3O63A 3W7QA 3TE9A 4O0ZA 3TMLA 2XN1A 3QF0A 4JTJA 3CTLA 2B7PA 4CQ8A 4JYEA 3WK0A 3CB8A 4LV4A 1I2OA 4TMCA 2IQTA 4FO4A 1TV8A 5D37A 2BX7A 3S5NA 1XBYA 2X1RA 3FS2A 4JTIA 3QSTA 3C2FA 3QQ1A 3EB2A 3IGUA 1QFEA 2CLMA 3TC6A 2TYSA 4OV9A 3LGEA 4TU1A 4TIMA 1DQXA 1A50A 1I45A 4HT3A 3CM4A 1GYLA 1K3UA 2GUUA 1Z41A 4IUOA 5C55A 3TJXA 1NFBA 1V5XA 4OT7A 1EA0A 1TRIA 1P5BA 4NT0A 3THQA 1HL2A 3LHTA 3TMQA 2YZRA 5AC8A 3JR2A 2VEPA 3NL3A 4XUGA 4LUIA 3NQEA 3ABSA 3WK1A 3TXVA 4O0KA 3N9SA 4MFEA 2X1SA 1P0KA 2WO5A 2CLIA 3ZWTA 1EWDA 2E6YA 2J9YA 4CNOA 3T4CA 1KV8A 4QIUA 4NJGA 3SI9A 1H5YA 1TB3A 1GEQA 1XDLA 4MY8A 1E51A 5EBUA 5AYZA 4UIOA 2B0MA 5HINA 5HR6A 2YDAA 4CLMA 1IIGA 3NVTA 4L4MA 5HULA 2Z6IA 3P81A 1W5NA 2QCMA 4DF2A 4JR5A 1P1XA 3O06A 1JRCA 2VXNA 1VLIA 1T8XA 3FJLA 3B0VC 1QAPA 1B9BA 4YCPA 4JTTA 3G1DA 3QZEA 3IIVA 4UR7A 4C1LA 5FF2A 3P80A 3P5YA 1FY6A 1EUAA 2QKFA 5CZJA 5KMYA 1NSJA 3TIMA 3GB6A 2PCQA 2HSAA 4S2BA 1FDZA 4ALDA 1VPXA 4HPJA 1H1YA 3W22A 2JBMA 2VELA 4XQ6A 1A5BA 4K8HA 3L5LA 3RLUA 3VE7A 1ZJIA 1KFKA 2EHHA 4UTUA 4IMFA 1KFLA 1YXDA 5D02A 3HB9A 2DU2A 1O5XA 3R5EA 1VCVA 2H8ZA 3GDMA 1KM3A 2FLIA 2V2HA 3PUDA 1PL9A 3NDOA 3MO7A 2V2DA 2OJPA 1TJRA 4FNTA 4UUIA 1LCOA 5U7SA 2LLEA 4X9SA 5L6UA 2RKXA 3AO0A 2QCGA 2DP3A 3KX6A 4M19A 1KM6A 4UTJA 3GDKA 4LWWA 1SUXA 3R2GA 4U28A 2H6RA 3NQCA 1A53A 1GVOA 3TJLA 3M43A 2WJZA 4JTGA 2ISVA 1MZHA 1FCVA 4N2YA 4AWUA 4RLIA 1O4UA 1L6YA 4AVFA 3KXQA 2QUVA 3UD6A 1OJXA 3NPWA 4UFLA 2RFGA 2AQWA 1A5CA 1YDNA 3GXPA 5LNSA 3KRZA 1FXPA 2QUTA 4D2JA 1Q6QA 1XXXA 1WOBA 4NVTA 1FWSA 3HGJA 1SZFA 5LHEA 4ZQNA 3IVTA 4UCGA 1OK6A 1YADA 4OHQA 4O54A 1WA3A 4JS3A 4O14A 2QJHA 3BO9A 5I3FA 3UPWA 4ZZ9A 5IBXA 2G96A 1GVSA 2FPYA 1G4SA 1QDSA 1JCMP 3B03A 1LRQA 2JKAA 1OG0A 2ABAA 2FTPA 3C4UA 5E0KA 4DF0A 4Z0JA 5EYWA 4J9JA 1JULA 2V30A 5IBXC 5K9CA 3SZ8A 3CIWA 4MLRA 5C54A 1OFAA 1EIXA 2DZVA 2QDGA 3EWBX 3EX2A 4AF0B 4BFAA 1SO4A 3KFTA 1G7UA 4AHPA 3HG4A 1MEWA 1OYBA 3IRDA 2CLOA 5AHLA 2E68A 2VFFA 1TPEA 3EX1A 3SGZA 3CEUA 4E38A 5CZ0A 2ZRZA 1H63A 1K02A 3B05A 4NX5A 1TTQA 3TX9A 1H7WA 3W2KA 1NVMA 3BARA 3DFSA 1VHCA 4Z0SA 2QCDA 1WAUA 5CGQA 2WKJA 4PEKA 4DPQA 4N4PA 1GZGA 4GFSA 1X8FA 1FDYA 3B0PA 4IXHA 4CCCA 1LZOA 3P74A 4FNPA 2ZBTA 3W7HA 4OQVA 3NG3A 2YFOA 3PG9A 5KZDA 2I9EA 5D2XA 4M6VA 4LC6A 1IF2A 4NJKA 4R33A 2G95A 3Q37A 3QMSA 4WOZA 3IVUA 4K6AA 3DZ1A 4EWND 4IOTA 5H91A 1UUOA 1XUUA 3M5YA 3M41A 4DBEA 1LDCA 3LOTA 4AWSA 4JD4A 4MJZA 3UPBA 1AG1O 4TO8A 3QMTA 3DKLA 4LTSA 1TPWA 2ISSA 1I8JA 4JICA 5AC6A 5EA9A 1EP1A 1F6PA 2KZHA 2ZRXA 3A5FA 4LU0A 1M7PA 5CG7A 2BZNA 3CWNA 1T96A 4BF9A 2OT1A 3ZR4A 3WJZA 4XTDA 3LB0A 3W1TA 4PL2A 3NXFA 3DHDA 2CZEA 3ZWSA 5J5DA 4GUIA 3U2OA 3DXIA 4XKYA 4N6FA 4LS1A 3UQNA 1M7OA 4JEQA 2YSWA 5LNVA 3TXZA 3BW2A 3OVPA 3G1VA 3UWWA 1M5WA 3LHVA 4LW7A 4O18A 1H7XA 1SZGA 2EGZA 4LC8A 3LI1A 4AEOA 3PG8A 2AAMA 4FXSA 1TPC1 3LI0A 3CHVA 1H51A 4OGZA 3UWQA 3PM6A 4O19A 5AYYA 3EWYA 1F74A 5F2IA 1L2UA 1W56A 1TJPA 3LLDA 4A2RA 5CKSA 3UZJA 1GWJA 3GAYA 3ZFHA 2WOQA 1EWEA 2E1DA 1W0MA 1A5SA 2ALDA 3HJZA 1R30A 5CPMA 2NZLA 1ICPA 2ISWA 5K4ZA 1NF0A 4K36A 2PRMA 4NNCA 3FYOA 4GUGA 1EP2A 1K8XA 1THFD 4O8RA 3EEGA 1GYNA 5I3JA 2WSRA 3MWAA 3WJYA 3Q58A 3C3NA 3P7YA 1IGSA 3LRLA 4LVGA 3MHGA 3NEVA 3SR7A 2Y70A 1DQWA 2A7PA 1QPRA 1S3HA 5CPLA 5HQEA 1PCWA 3I65A 4DEFA 3WJWA 1ZHAA 2VENA 5D32A 6TIMA 2EPHA 4UXDA 4UR8A 1L9WA 3GR8A 4HN4A 2FB2A 4KFPA 1DBTA 1Z44A 3IIZA 4JTFA 4DELA 2OCZA 2C16A 2C6QA 3CQ0A 1VZWA 1LRTA 1GPWA 3HPXA 3TA6A 1W5OA 4UFJA 1G67A 3GKAA 3PF3A 4IMEA 4P2VA 3W75A 1UB3A 1R2SA 5AHEA 1X1OA 2VFDA 1JCXA 1JVNA 3BLFA 4LY8A 3NGJA 3G8RA 4IXXA 1VRDA 2ZZ1A 2FPVA 3WJXA 3TSMA 4LOCA 1RQHA 4B5NA 3NM3A 5DXXA 2F7FA 4PC8A 1Q3NA 3MBDA 4RKAA 1X1ZA 1DV7A 1PV8A 3M5ZA 4BI6A 4OU1A 4ONVA 2C14A 2Y62A 3NL5A 4JDYA 1Y0EA 3N9RA 3HO8A 2Z6JA 4EOUA 1TPB1 3G3MA 3PS7A 4XBKA 3VFLA 4MFDA 5EMUA 2YYUA 1KM2A 5E1QA 3GNNA 2I1OA 2B7NA 3HQ1A 5EY5A 1LOLA 1F2JA 4MZYA 2B7OA 5C2XA 3TFXA 1W1ZA 2VEKA 4FX6M 1YLVA 5HNRA 4PFMA 5F4SA 2QDHA 5BOOA 2QJIA 4PH6A 3QMRA 3TNOA 4POCA 1J5TA 1SO5A 3W2MA 3GVGA 4O53A 3S6DA 5FEWA 1XBZA 4XBSA 1PS9A 3NAVA 4CQ9A 2V81A 1KBJA 1WX0A 4MLJA 3W2JA 4JTKA 4OV4A 3C2EA 4O57A 4EF9A 2X30A 3ABOA 4XWUA 2NXGA 4PL1A 1DVJA 3OBKA 2QAPA 2YCEA 5KITA 4JNMA 1OYCA 1KFEA 2OT0A 5FEZA 3SECA 2RDUA 3R13A 3DENA 3TQVA 1VR6A 5CPNA 1T0OA 3W3OA 4TX9A 5K7JA 2DZTA 4JX5A 2DJXA 1RR2A 1U83A 3S0CA 1Z42A 2CLHA 3VNDA 2ZQ0A 1GQNA 4IMCA 4Z1DA 3NA8A 5FF3A 4GJ1A 1JUEA 2QCCA 2A7RA 4NQ1A 1VCFA 2I14A 4O28A 4JIQA 4QM1A 4WD0A 4RK8A 1SO3A 2VFEA 4WX2A 3LM7A 2ZRYA 1FWRA 1H7RA 3M1ZA 5AYXA 4I7VA 1TPH1 1KV5A 1BEUA 3RLVA 3QJAA 3W7KA 5K9DA 2H3DA 1SZEA 2FJKA 2X1TA 3PVFA 4O4VA 1JQXA 2E09A 4WJEA 2NLIA 3MP4A 3W73A 4HSNA 5EKYA 4WXYA 1XDMA 1R46A 3MP5A 4WY0A 1FCBA 3LERA 3F4NA 1IXPA 4UTWC 3NOEA 3W7LA 3B06A 5F4XA 3DAQA 3G24A 3HGSA 5E93A 3YPIA 1QPOA 1KW1A 5AB3A 5K4XA 2YYTA 1VYSX 3SW6A 4XKYB 4HIBA 4LRSA 1LORA 4DBDA 1CW2A 1DORA 1TCDA 4JTEA 4P61A 1BKSA 4S2CA 2NUWA 4TMBA 3HMJG 2Q8LA 1F6KA 5D03A 2GQ8A 2TSYA 1Q6RA 3MJYA 1HUVA 2XFWA 3E0IA 3KHJA 3HPSA 3UYCA 4NJIA 2NV2A 5L9FA 1BWKA 5F2LA 3T40A 6ALDA 3PSWA 3INPA 1TPUA 1T99A 3P5ZA 3LCLA 5MHBA 2Y7FA 5IM51 5FESA 2QUUA 3M9YA 2YGYA 1PHQA 1SO6A 3KVLA 5CZSA 1NEYA 3MHUA 2E5DA 3G22A 5EL1A 3QPYA 3TSBA 1XL9A 2NUYA 3A9IA 3NPXA 3W88A 3S42A 2YXGA 3DKJA 2EAWA 4QQ3A 3TQ0A 5K3VA 1LBFA 3USBA 4R53A 5DELA 2VFIA 1JJKA 3ATZA 3NQGA 4AH7A 2Y89A 3W7CA 1SR9A 1TQXA 3W1AA 1UJPA 2R8WA 4UTTA 1AMKA 2PRHA 4E0CA 5G1YA 4QAIA 3S1XA 1C29A 3DFPA 3P82A
chains in the Genus database with same CATH superfamily
3NO1A 1MRAA 5JXQA 4BCEA 4PTNA 2HZGA 2VDGA 4HA1A 3WLNA 4C65A 4JIPA 1W2PA 1GVIA 4B5TA 2WZMA 2J27A 4Q8UA 1L8NA 2FGBA 4UBPC 4PB5A 1K6WA 2OWXA 4NU7A 3WQ5A 1O60A 2XINA 3QYQA 3FW6A 1ODZA 4DBSA 2F6UA 2V82A 1D9EA 4DZHA 3MUIA 1JCYA 2V2CA 4JFTA 5EBAA 5K2ZA 3K13A 3D46A 4U31A 2QJGA 2Q09A 1ICSA 3R89A 3O0KA 2VYOA 4LF1A 5H2ZA 4LEQA 3W27A 3SIMA 3S2LA 1A3XA 4NJHA 3W7PA 3N34A 4YYCA 2QV5A 4EXQA 4K8EA 4FAMA 4JYDA 4S23A 3PUOA 4B3KA 1RA5A 2OOFA 2WAGA 3EX4A 3RLGA 4MDOA 4BI7A 3W1PA 1KQZA 5DBUA 4I8DA 4F2UA 3NO5A 5HNTA 2VQTA 2OMAA 3FKKA 4DBUA 4UNLA 3ZM8A 2E28A 3V5FA 1A5AA 4ICMA 3E2VA 3CAQA 2BSLA 3WEMA 4PE8A 2XDFA 1UKTA 1M04A 3EDKA 4X0NA 3MMDA 1J0IA 1Q63A 2QUNA 1IHIA 5C71A 3EX6A 3H21A 3IGSA 4LALA 1JIBA 3LHYA 3WMSA 3MQTA 4MNKA 2EPMX 1GVQA 3XIMA 5B80A 1ODUA 3VNKA 2QEZA 2PTYA 4QNWA 1L0PA 4IMDA 4XIAA 4NIRA 4QJ1A 3EBVA 4WDWA 3SCRA 3DESA 3IGHX 1ZCOA 2FFCA 2CESA 3TJIA 1VS1A 1B3YA 2JEPA 1EO7A 1VB9A 2OLSA 3WK3A 1G01A 1XC4A 2PDQA 3VTRA 1LUCA 2J7CA 3AU6A 3G1XA 5EB8A 1T8QA 5E6ZA 1BTMA 1XBVA 1H09A 1ZAIA 3DGRA 3VABA 4YVPA 1K7EA 1NIUA 4M5PA 2YL8A 3OQ8A 1KFCA 3PBVA 2DDXA 2XIMA 1TE6A 3IJLA 3V4BA 2C0AA 2INFA 1A5KC 4KF1A 4Q33A 4XUYA 3WQPA 4WY0B 4ZEPA 2IS7A 5G5IA 1AL7A 2P50A 4ROQA 4NJJA 5KZEA 4GYPC 1KQYA 3W76A 4H8UA 1QW8A 2C13A 5C70A 3REQB 2ZE0A 3CPGA 3TH6A 5D9OA 4M6QA 1UD3A 1UPMB 2J62A 2QMKA 3JRKA 3OYXA 3AHXA 3UCDA 1SJAA 4Y2WA 3FV9A 3IK4A 3QXBA 5FOOA 4Q4OA 2WCSA 2ZZ6A 3WL1A 2Z0IA 1N8WA 1JYNA 1G4TA 1V3MA 1V0LA 3OHIA 1E0WA 3R10A 1AW1A 1SVDA 3WLHA 5I06A 1A5LC 4ADSA 2P0IA 2CETA 3LG3A 3V1PA 3T2OA 3NQ2A 4JTRA 4HOXA 4AVNA 3VNYA 3SADA 1XQKA 2ZUWA 3R8HA 2V63A 4UQ9A 2VWSA 3WD3A 1U33A 4GMEA 3UJRA 3FX4A 1JCJA 4DI8A 4LRTA 3U7BA 3UPMA 4PSRA 4URIA 1V0KA 1R3QA 1GTHA 5GQBA 1BRLB 2QQ6A 1B4KA 4CN4A 1E1EA 1TMHA 1S46A 2JFEX 3N19B 1P4CA 4DQWA 3PULA 5FJPA 4D6GA 2PTZA 1HJUA 2ADAA 3TOYA 1YKWA 4FNUA 4C6BA 3A21A 4BQ5A 2J9ZA 1VFTA 5DMMA 1FWCC 4LBSA 2FZMA 3RFAA 2G3IA 1NAL1 4MB4A 4PYSA 5BWFA 1VJZA 2YA0A 2YR1A 3CV6A 4AZBA 3N14A 3HF3A 4ZFCA 5D05A 3VXGA 1V6XA 4XVDA 3U57A 3M0YA 4LS2A 3K1GA 3V5OA 7REQA 3GNXA 4MSSA 4DWSC 1JGMA 1QNSA 3VGFA 3DIPA 3SRDA 1V0MA 2GL5A 3QHMA 2A3EA 1S2AA 4KS0A 1B3XA 4HNVA 2Y1HA 4U3CA 1EX5A 3GVVA 4KWWA 5PTDA 4F3HA 4QLJA 4LBUA 2E1WA 2QMJA 3HM7A 3LU2A 2XVLA 5EMKA 3G0SA 1GOIA 4TVUA 2PWUA 1D8WA 4HPGA 1XIJA 2ZXBA 1PAMA 1DWFM 1UHVA 3VD4A 3G1AA 4AIBA 3UWYA 1AQHA 2ATMA 2VGIA 1ITQA 1XCXA 2I5GA 4M7SA 4JL2A 2QCHA 4HMCA 2V5DA 1UC5A 1MFUA 4JX6A 4L9XA 1TWDA 2V5BA 1YE6A 3UGRA 1LQAA 1QRQA 4D6DA 1L6SA 1RQBA 4IX2A 3BGGA 3ZLGA 4ADUA 4AIEA 4L64A 3O0FA 3UY7A 4QJ3B 3FDKA 1UZ1A 2BY1A 4RV8A 1ZP4A 3S2MA 3WBAA 4OBRA 4FHAA 1B31A 4BQ3A 4DO5A 1WYIA 1U1JA 3TYUA 1TRDA 1TWSA 3I6EA 2HK0A 1IXOA 2AGTA 2NVAA 1XM3A 3O6YX 2QCFA 2G3MA 4YTUA 1Q6EA 3IANA 2OYKA 3W71A 3RPTA 4DF1A 2P3ZA 1EHAA 4ZOBA 2OYMA 1X38A 3SDOA 1WBJA 2XM2A 2WHMA 5D04C 2ZCGA 4GY1A 3ID7A 1C91A 2Q01A 4WSKA 1QBBA 3GFXA 1Q2RA 3CYJA 1XX1A 4I6VA 1XIMA 1DWHM 2YA1A 3LV5A 4W85A 3H2OA 3BAJA 1BVZA 3UXDA 2YL9A 4PCPA 2DZSA 4QNEA 2GGIA 4Y90A 1A5OC 3AWNA 1G7VA 4ZO8A 3SQSA 2A1YA 2QHAA 5TBOA 1NU5A 2PWEA 2ZFAA 1IV8A 5FAJA 1HJWA 3BV4A 4RZ5A 1B4EA 1QI4A 2PGWA 5G2IA 3S9IA 1EQCA 1GOWA 1PO9A 1GHSA 1BLIA 2J7BA 4XD4A 2P0OA 1UBSA 4HNUA 4L9ZA 2OZTA 1MW0A 3DYPA 2QGHA 3GH4A 4PUUA 4KWSA 4IP7A 5GJMA 4ZQOA 3AYTA 2W62A 4MWAD 4O1BA 3VNZA 2H3BA 2BODX 3AZRA 3FJ6A 3P84A 3A22A 4PA8A 3U5UA 1CLKA 5H8MA 4P7NA 4HNTA 2PDNA 1CXIA 1XINA 4IP5A 2BNJA 5BRQA 2HROA 3E0WA 4NASA 1ONEA 4WOQA 1F3XA 1P1MA 4AHQA 3WNOA 3W26A 3UG4A 4BQ2A 3WD2A 5DLCA 4XAYA 2GJXA 2WMIA 4GINA 2VZSA 4MIMA 2CERA 2VCAA 3TZFA 3GIYA 4AG0A 3VGBA 1UH2A 3GNDA 4H01A 1NELA 2OO0A 3SY1A 4O1DA 3G3DA 3A6OA 1FQ0A 3UR5A 3WQDA 4N42A 3FIGA 3WLPA 2VR2A 2OODA 1DXIA 1VFSA 4TTGA 5LA1A 1PKNA 4W8AA 2VD9A 1JDFA 4W84A 1P6BA 1KXQA 3DG6A 3K30A 1U1UA 4H8HA 3M0IA 1DQUA 5G4HC 5CSUA 4GCAA 1OD0A 1HO4A 3TQKA 3TZNA 1WBHA 2JK2A 3EB3A 2XFRA 2XU2A 1CB2A 2X1UA 4H83A 1BYCA 2NXHA 5DY3A 3UERA 5KZ6A 3LHWA 9XIMA 2IMRA 3WNPA 3AIWA 5F4WA 5XINA 3TYDA 3GZAA 3KBMA 3DN5A 2FZBA 2JIEA 3PBUA 2VO5A 1W9XA 2GQ9A 2VEIA 3GO2A 5H1WA 1G4EA 4W4QA 1I2QA 3POHA 3PP7A 4UOJA 3QN3A 4HK7A 1LTDA 3QC3A 3KRUA 4CN1A 2DT0A 2RDTA 4MF4A 4LVFA 2X0YA 1SW0A 2WWDA 4NNBA 2J8FA 3L9CA 1QI5A 3OG2A 1Q85A 3QQWA 4FIRA 4H6KA 3RU8X 3W70A 1MEIA 1MDLA 3LTPA 1S38A 3UJSA 4B5VA 2YPIA 4IIEA 3BAYA 1OCQA 3A4AA 1GPFA 3WFAA 3N6JA 4IPLA 4Q4SA 1SPQA 1XW8A 1PVNA 1RCXB 2DH2A 3QEZA 3S6OA 5HPOA 4DWSD 5HK4A 4XZ9A 3UCQA 4F40A 5LHFA 1JNDA 3QVQA 4U5KA 1RCQA 4O50A 3RCMA 3W23A 3HGRA 3UYIA 4L1GA 1IEXA 3D6NA 5LXEA 1AUSL 3CZJA 4RDVA 2FIQA 2DUZA 2WCAA 2ZWYA 3FHQA 4JTLA 5AZ0A 3R0DA 2WSYA 1VPQA 5FACA 3CMGA 3OLIA 4GH3A 4AMAA 5I02A 4FS9A 1JDEA 1I2NA 2DSVA 3NSMA 1QCWA 4UTIA 2OZ0A 2EKCA 4KRUA 1IEQA 2E0PA 1YHTA 4CEXC 1JCLA 4RXGA 1JXJA 3WELA 2BXVA 2OOGA 1KM0A 3S5YA 1ISWA 3NQFA 4CD5A 4J4KA 3O15A 3SJNA 3P2VA 2PGEA 4MOZA 1AA1B 1XI3A 1IE7C 1W54A 1TV2A 4DZAA 1S2VA 3I4EA 5B7YA 5CZTA 3MW7A 1EJXC 3EWWA 3A9BA 2A6NA 4AHOA 1F5ZA 4S1FA 3SRHA 3DUGA 5M5DA 1NDZA 5KZMA 3AALA 2E5BA 3QBUA 2ZA1A 3PTKA 4HU4A 3W83A 3T7VA 5D8WA 1K9TA 4LEFA 5ABTA 5DRIA 2HS8A 6CGTA 3VGDA 1YDOA 2DZPA 4ZXOA 2J7EA 2Z25A 4M51A 1J0HA 1D3GA 4ES4A 3VIFA 1XSKA 2E25A 1OIMA 4LJ3A 1XLEA 1FWIC 1YNQA 2FZ8A 1C90A 5F1UA 1EB3A 1Q6GA 3C0JA 3PWGA 1OCBA 3CLWA 4GZEA 1F76A 4PULA 3WQGA 3ZLHA 1OFDA 4R34A 4PBFA 2WSQA 4UTLA 3V16A 1CXFA 1HJVA 1IZJA 1W3NA 4S3GA 3GVQA 3P0XA 1OFPA 3IARA 5DCBA 1VD6A 1VPYA 5LKYA 4JIEA 1RBAA 3GU2A 4ACZB 3OJGA 1TIMA 4FF7A 1DWAM 3FKRA 1QW7A 5G1MA 1E0UA 1IXNA 3W7EA 4R5EA 1PIIA 3AXKA 2PD9A 4PCFA 4JGDA 3THAA 4IQDA 2OEJA 1GJPA 3HG2A 2BB0A 3VKCA 2Y61A 4KEZA 4N7QA 4HGXA 3PBYA 2A85A 4GBUA 4NI3A 3HG3A 4NKCA 2RJHA 3FDGA 5HMDA 4XAFA 3VD9A 3H54A 3IGXA 3URQA 2ZXDA 3W7DA 3L0GA 1TG7A 2C19A 4U10A 2XN0A 4Y7EA 3KM8A 4LUYA 4GC4A 2WNNA 2ZZ2A 3KEHA 3LCXA 3LCHA 2E6AA 2FH6A 2UY5A 1NWTA 3GG8A 1C7TA 3V75A 2FHCA 3NGFA 1OX4B 1CZ1A 3DX5A 4FLOA 2BOFX 4XD5A 3NPVA 1F9CA 4WZHA 1LQ2A 2DT3A 4TR9A 1TA3A 4H9TA 1GOMA 1I2PA 1G4PA 1K70A 2A79A 5LIYX 3V7PA 2I57A 1FBAA 5BW6A 2GYIA 3UR2A 5CLWA 3AJ7A 1KLZA 1VC4A 4BWLA 5FEPA 3EMQA 4H3DA 4PMXA 1JPMA 1RJPA 4RPQA 3KVJA 3SM0A 1XP3A 4UTMA 1QMLA 3M5XA 4O0QA 1W17A 3D0CA 4FR1A 2R94A 3SGUA 1TJ0A 1IR2A 1OB0A 3QRHA 3AXXA 1H0IA 3TW7A 1MW1A 4C7DA 3L4XA 4J1OA 2ATSA 4HKPA 3F1QA 3P93A 4KIRA 1QATA 1GVFA 1HW6A 4D1JA 1PZ1A 1RPKA 2PMQA 3ALGA 2E8ZA 5FAGA 4B4HA 4DXVA 1UWSA 3I7SA 5EMMA 4K2SA 3USZA 1UJQA 1WQ5A 4KMQA 1E6RA 3IACA 2JIWA 1LUCB 3ZIZA 3HPAA 3RK8A 4R88A 4O1AA 3W1NA 1DJNA 4N9CA 1A5MC 1LOQA 4NY2A 3OOQA 4ZTXA 5HANA 1AK5A 4FXFA 1WOAA 1XSJA 1TV4A 3PBMA 3E6EA 1M41A 5AHNA 1XYAA 6XIMA 1UP0A 3UXLA 4B5UA 4GQQA 2A3HA 2GWNA 3MUXA 3WH6A 3FK4A 4IG2A 4EP8C 1F61A 4RNJA 2J77A 1UR4A 1QVBA 1TR9A 5FD0A 2XN1A 4JTJA 3CTLA 2B7PA 3AIVA 3H2NA 4CQ8A 2J47A 3G5EA 3OGVA 2BX7A 4C6FA 3EOOA 2Q6ZA 4KESA 3S5NA 4ZOAA 1XBYA 3FS2A 4GVFA 4LXFA 1GEHA 2OLHA 3WH7A 4S3AA 3VAVA 2CLMA 2TYSA 4TU1A 4CQDA 3RAOA 1DQXA 4LAKA 5AECA 4HVXA 5BOFA 2PTDA 3CM4A 3M4HA 1K3UA 4RDWA 4X60A 4HU0A 3TJXA 1V5XA 1H5VA 2E9MA 4H7CA 2YDSA 1TRIA 3LHTA 3SUTA 5FSDC 2VEPA 3ALFA 3TEVA 4PBEA 4MFEA 2X1SA 5FIPA 4WLCA 3BE7A 1EWDA 1ADSA 2INEA 3ITTA 4HHLA 2XH2A 2J9YA 2XISA 2NVDA 4A35A 4QIUA 1KFWA 1E5NA 1RY8A 4PR4A 1XDLA 1MXDA 5EBUA 1FWBC 5HINA 4F0HA 2YDAA 1IIGA 5H8PA 3WNMA 4FA3A 1SMAA 3AHTA 2Z6IA 8RUCA 1DJGA 2QCMA 3KBNA 2V69A 4GOAA 1F07A 4WSJA 3FJLA 2ZADA 4YCPA 4JTTA 4D9PA 3IIVA 3MCMA 4JKKA 3O2LA 4GQRA 1EUAA 3UXIA 1NSJA 4S2BA 1FDZA 3PTDA 7TAAA 3CV2A 1CIUA 1YMYA 2XSXA 3CHEA 3VE7A 1KFKA 1Q7ZA 4FLQA 4L5ZA 1EH9A 3N1AA 3MZ2A 3S2CA 3AXHA 3HB9A 1UYQA 1O5XA 4HYWA 1VBRA 1VCVA 2H8ZA 3E2SA 3KBSA 2FLIA 4S3FA 3O6AA 5HNNA 2V2DA 1VEOA 2VTFA 2QF8A 4FNTA 4UUIA 5DANA 4XZMX 1K9DA 5L6UA 4H8NA 2DP3A 3KX6A 2C71A 1KM6A 4HTYA 4NG3A 1M3UA 4GKTA 3GDKA 4UTJA 1XLCA 3R2GA 3CQHA 3NQCA 1ZSXA 4HZ6A 3BICA 2IKGA 1XKJA 4AWUA 4AVFA 2QUVA 3SFWA 3CZEA 2WHKA 3M0LA 3U9IA 1W32A 3P3BA 3FNDA 2BP1A 3AISA 4WDTA 5LNSA 2VNCA 4D2JA 1V6YA 1V8EA 1WOBA 2WBGA 1E0XA 2NLYA 1J12A 1REQB 4J3VA 1HKWA 4QDWA 4UCGA 3H7UA 2D2OA 4LANA 3UJ2A 4JS3A 2QJHA 3Q65A 1FKXA 3IAPA 5HQMA 1Q65A 1JAEA 4GHRA 3ZJ7A 2OX4A 4ICCX 3UPWA 1DJXA 3N9KA 4ZZ9A 3GBEA 1G4SA 1QDSA 2YOCA 1ELSA 2FHFA 2ISFA 2HEJA 1E4LA 2YA2A 4J9JA 1KCZA 2OWCA 3L7RA 1W3JA 2GDUA 2ZXQA 1NWSA 5ABEA 1EIXA 3BCDA 3EWBX 4BFAA 4JIRA 1R9XA 1OGBA 3WLKX 1MEWA 1OYBA 3IRDA 3WL0A 1NOFA 3WDQA 2Y0FA 2VFFA 4HZ7A 1K02A 4NX5A 5DT7A 3W2KA 2F2KA 2ASHA 4KWUA 3BLPX 1SFTA 2D2GA 4PEKA 3NSNA 4DPQA 1GZGA 4GFSA 3HPFA 3ENLA 1X8FA 3K8MA 1TVNA 4CCCA 3OZMA 3P74A 4FNPA 4QG9A 3W7HA 3NG3A 5KZDA 5D2XA 1IF2A 4NJKA 3GC5A 2ZUUA 3QMSA 4RE2A 3CQIA 4F4RA 3EYPA 3PZIA 3DZ1A 4QXIA 4JBRA 4HMEA 3M41A 3EPMA 3LOTA 5BRPA 1MZRA 3QMTA 3WUBA 3SUSA 4D6IA 1JL8A 1E6ZA 1F8IA 3DG7A 3PPGA 5AC6A 5EA9A 1W8GA 1XICA 1M7PA 2BZNA 3MO4A 3SAZA 2EPKX 4J2MA 1TCMA 4P7OA 3QHNA 3LB0A 3W1TA 2VGGA 3H8AA 5LXXA 3NXFA 3ZWSA 2WVSA 4GUIA 1HGWA 3CO8A 3IAQA 1SJBA 2YSWA 3MDUA 4YNGA 3CGTA 2VX6A 4IL2A 1M5WA 3ZT6A 3VGEA 4DWDA 5ECUA 4JIIX 2EGZA 3LI1A 2FFIA 1R9ZA 2AAMA 5A8QA 3DFYA 1JG9A 3EWYA 5LIUX 1AQFA 3H7VA 3WF1A 1LQ0A 3QGAC 1W56A 2UBPC 4WRHA 3LLDA 2OSWA 2WVUA 4AD3A 1UQYA 1V3LA 2GJXB 3AICA 2WMIB 1W0MA 1VIWA 1GUVA 2P53A 3AUOA 1ICPA 2ISWA 1KB3A 3CK5A 1EIBA 1EP2A 5A2AA 1OZQA 1HQTA 1EC8A 3GTHA 4PUNA 1ZCCA 1CGVA 3LSBA 4UZSA 1GOKA 5TD4A 1EJRC 3RJYA 2XGBA 3LRLA 2A7PA 4TX8A 1FWGC 3R1ZA 1XD0A 1PCWA 2FZ9A 2NT1A 5CLTA 3WJWA 3T09A 4ZOEA 2VENA 5J8LA 4UR8A 2FB2A 2WANA 1Z44A 3IIZA 2D3NA 4JTFA 4CQBA 1DP0A 4QCFA 2BDQA 3BSMA 1HL9A 3WBEA 4IL0A 4P2VA 3W75A 3N04A 2J13A 1JVNA 1UZDA 2V38A 1EJ7L 5C2GA 4W7UA 3N13A 3WJXA 4G7EB 3UZZA 3UXKA 1I1WA 1P0EA 2OXNA 5DXXA 4AZ7A 4U2YA 4MGGA 1TJ1A 5E09A 3MBDA 1X1ZA 1DV7A 3KCOA 4OU1A 4ONVA 1I0DA 2E9LA 3N9RA 3WLQA 3WNLA 2Z6JA 4ZTYA 4EOUA 1TPB1 1QASA 1Z32X 4AYGA 2IXVA 4AD2A 2ZUVA 2OZ3A 2W63A 3M0JA 4F48A 2R82A 4LYPA 1UWIA 4DI9A 3GNNA 2I1OA 2B7NA 5F7UA 1LOLA 2DT1A 5FSEC 3V18A 1EYWA 4PSPA 2PGRA 1Z69A 3CUZA 2O4MA 3EMZA 2FVKA 4QX4A 3LN3A 3QMRA 1HXJA 4POCA 4AX6A 2BGQA 2BXYA 3GVGA 5HJXA 4O53A 3S6DA 3HZ3A 2PI6A 4XBSA 3KDNA 3EA1A 4PTDA 4CQ9A 2V5JA 4OV4A 4Q6XA 4EF9A 3ABOA 2NXGA 3GM8A 4V28A 2QAPA 5KITA 3BSHA 4C6KA 1KFEA 2OT0A 3L4UA 2W3ZA 3SECA 2RDUA 3R13A 1EXBA 3TQVA 1ISZA 1EF3A 2I9UA 5A6MA 4PUDA 1AH4A 1BQGA 1U22A 2PWFA 5CPNA 3W3OA 4TX9A 3KW3A 5K7JA 1FP8A 1U83A 2WZTA 1T6MA 4H9XA 4XD3A 3KDOA 2VX4A 4Z1DA 3PZTA 4GJ1A 1UQZA 2D22A 4O28A 1JNEA 3GY1A 2HPMA 4QM1A 4WD0A 5E70A 2VFEA 3FYYA 5CPTA 3QV9A 3WF0A 3M1ZA 1WDQA 2PDBA 3T08A 1VP5A 1SZEA 3VZZA 2FJKA 3PVFA 4RNIA 5HAOA 2NLIA 1XYCA 4C5ZA 4HSNA 1E1CB 9CGTA 3AROA 3TWAA 1XDMA 3VDBA 3LERA 1IXPA 3NOEA 1RSCA 3LNMA 3DAQA 2YB4A 2XSBA 2RDXA 1X96A 2YYTA 1XH1A 4LRSA 2GSJA 3VA8A 2WJFA 2XVKA 1TCDA 1WZKA 5REQA 3HMJG 2G4JA 2Q8LA 2OTDA 4FOUA 4AD1A 1IWAA 2GQ8A 1HUVA 1XIIA 4PZVA 5BCAA 4AU0A 2X8RA 4DX3A 3IV8A 5DMLA 3T40A 3INPA 1FWEC 2OGYA 3LCLA 2DPEA 3VIPA 1E43A 1E9YB 1E71M 4NZ3A 2QZRA 2YGYA 4AEEA 2G41A 4DRSA 4A3HA 3GHUA 2VVSA 4HQVA 2GK1A 3KS5A 5CZKA 1KXVA 3QPYA 2PDLA 1ONXA 1XL9A 1GK8A 3W88A 2EAWA 4F66A 1DTNA 3USBA 4R53A 4AH7A 2VFIA 3ATZA 3K46A 1F3EA 2Y89A 3RXZA 1JI1A 3W1AA 2R8WA 1HJQA 1CXKA 2ACQA 3RITA 4E0CA 3CT2A 3DG3A 3AS2A 3E2RA 1YTDA 2HE8A 3SSZA 4CCEA 1X39A 3MU7A 1B3OA 1NWRA 3VUSA 1US2A 5IFPA 2FDMA 1W1B1 3TQPA 1HKVA 4Q6JA 3TTYA 5CPOA 2RDWA 4FB7A 1FH8A 4MADA 4Z17A 4GIRA 4HCHA 2C15A 4IIHA 3TP4A 4ZFMA 5T9BG 3RR1A 2F2HA 3STGA 3BAWA 4GZJA 1TA3B 3E96A 4J3XA 3C0QA 5AYBA 3DEQA 2VL4A 2W6RA 3CQJA 3GUGA 1LLWA 5DFAA 3WFLA 2UV8G 3FYPA 1TPDA 2ZTKA 4WKAA 1DOSA 1DWJM 1GW9A 2NXIA 3ZVIA 2VFGA 3G6MA 4GI8A 2UZ9A 1ECQA 2A3LA 1WDRA 1OF6A 1MYRA 2VX7A 2J24A 1Q7MA 4JOMA 4UTHA 3TTQA 3UCCA 1E56A 3FCPA 5D38A 3M46A 3GTXA 4X3ZA 4AY7A 3MSRA 2D23A 2CYGA 4HNNA 3HIJA 5FL0A 1RP9A 1F6YA 1KLYA 4GIYA 3KVMA 1DHPA 4XTIA 3II1A 3OVRA 2C79A 3W24A 2D3LA 4JY8A 1PX3A 4H9UA 1VBGA 4NAFA 2IUZA 3TV8A 4TXEA 4GI6A 5EMYA 1L6GA 4JDBA 3VZXA 5J04A 3NZGA 4DAFA 3AS0A 1ISYA 4CNTA 1Q8AA 1B54A 1CT5A 4MWAA 2BOEX 2WPBA 3MS8A 3TOPA 1KM1A 3W9ZA 3W28A 2Y5EA 3AZTA 2XM1A 4ZODA 4AISA 2VGBA 2WVVA 1UWQA 1RV8A 3LX9A 3JS3A 4FLRA 4PTMA 5AVNA 5BXPA 2DZBA 1SFSA 3EX3A 4CNSA 4LH8A 1UG6A 1MNZA 1ZJAA 4QROA 3L66A 1OEPA 4PODA 3ITYA 1HT6A 2CXGA 5F2MA 5BXTA 1Q5MA 4K68A 1VIZA 3QC0A 2BVTA 2PBOA 1RD5A 1QO5A 3WH8A 1KWGA 1K7FA 4GYPA 2E77A 2WQDA 1VCGA 1XR2A 2A21A 3EOUA 1HX0A 5HWMA 1OK4A 2WK2A 2AMGA 4IZGA 5M1TA 2TAAA 2HPIA 1Q6OA 4D8LA 4O10A 3TC3A 1WKDA 2G3JA 1GT8A 4L4OA 1JPDX 3VKAA 4Y96A 5BOEA 2WM0A 3U2CA 2XVPA 2QCNA 3ATYA 3BAIA 4J3WA 1YPFA 4PBGA 2XWEA 2ZX6A 2GJRA 2GDVA 2PU1A 1NM9A 4G1NA 3W7JA 4JX4A 4L65A 3QQ0A 3BUVA 1XLAA 3LZ5A 1DXEA 4NZJA 1S1RA 1CDGA 1P43A 4LS0A 3GH5A 3OEXA 3W6LA 1IIHA 1E6NA 4MPQA 2GVGA 3H12A 2OYLA 4FNSA 4IIDA 3M6YA 4KWVA 2GOKA 4O4WA 5JBDA 4DB7A 3SY8A 4FEZA 4B5XA 3FLUA 1C8YA 3U8GA 4H4IA 3BLOA 4ORMA 3W6YA 4YXGA 4HNOA 1OT1A 3UJFA 4TX6A 5KETA 3TA9A 4C6QA 2DSZA 4OOZA 1GVRA 4O1CA 3U6WA 3C5QA 1UR0A 3OLGA 3DFNA 1NJJA 3QZAA 4HHPA 2HRWA 1R8LA 3ARVA 4AD0A 3WF4A 1JZ4A 3QLDA 4DWSA 4IQEA 3C6CA 2D69A 3ARXA 3A23A 1BQCA 4ZE4A 1QK0A 5T9CE 1V6TA 3SCUA 3RGTA 3UEQA 4PGLA 1HVXA 4B91A 1LL7A 4KFNA 4S39A 3I68A 2QR6A 3P67A 4N9BA 2VVNA 4MZ1A 2D73A 4GO8A 3LY0A 3EXRA 3R4IA 5E0FA 5AN7A 2VC9A 3IIPA 3AI0A 5DBTA 1CENA 3KZPA 6A3HA 1AJZA 4M29A 1QT1A 4GQBA 5C0QA 1OC6A 3MB9A 4RDZA 2PURA 2VKZG 3IS4A 5HQLA 1RK5A 4W9TA 3RNDA 4X63A 3VE9A 3BG5A 1VJIA 4H9ZA 1ALDA 1F4HA 3NZQA 4GUHA 1P6CA 3S46A 1XCFA 5GPRA 3ARPA 1SSGA 3BJFA 5LNRA 4IWWA 5CAKA 1TJ2A 3CMJA 1UKPA 1ME7A 3G77A 4AY8A 4HA4A 3QTGA 4IGNA 4S3DA 1H3GA 1XC6A 2C1IA 5M03A 4BWLC 2V5CA 3SURA 5DY2A 2VD8A 3BTNA 2V3GA 3G18A 2PDKA 1BG4A 4PCTA 1RK6A 2X16A 5LGXA 3PSVA 1TWIA 1QHPA 1B30A 1WZLA 4W89A 4TTUA 1DTUA 2HBXA 2D1ZA 3KE0A 3LUTA 3UWVA 2QCLA 5B7ZA 3PB2A 4HJFA 4CUCA 3GFZA 1TYGA 2QAFA 3S1VA 1FH7A 3EKZA 3EDJA 2DUAA 1KR1A 1EBGA 3QFWA 3AMLA 3S1UA 1LT7A 5GJPA 3IIOA 4AZIA 3GXFA 2GJNA 3MT1A 1OX5A 5D09A 3RMJA 3LXAA 3W1RA 3G6LA 3S1WA 1BSIA 1GKRA 2F84A 4S38A 4DLFA 1R3VA 1QXLA 1Z9AA 1DYSA 3NCOA 3I7RA 1CCWB 1HF6A 3JUGA 4CQCA 3V0TA 4CU8A 4YTTA 4A3RA 5IFTA 4UTWA 2J8TA 3F5LA 5FI8A 1M01A 2RHGA 4RZBA 5G2HA 4K7VA 4LVBA 4HD5A 3CWOX 1I2RA 1YRRA 1VEMA 4K1GA 1JDCA 4YL2A 3LENA 3CHFA 2I17A 1XD1A 3POCA 2V3FA 3DI0A 3MI3A 1Q6LA 3SUVA 4DLMA 4E4PA 5HUPA 3L5AA 4QISA 3NO3A 1GQJA 2XH4A 1FWJC 3WN6A 2CBJA 1S5WA 1PIGA 1K8YA 2W79A 3EWUA 4N9EA 1YXCA 3NUKA 3ABQA 3SRFA 4AD5A 2BWGA 2PZ0A 1OFRA 4GRSA 5BXRA 5IDIA 2P1FA 4M6PA 3OG3A 2GVYA 1PCKA 4NXKA 2Z2UA 2QS8A 1ZALA 2XH7A 4KFOA 2QDDA 5CSSA 5EU9A 3RMEA 5ENLA 1KFBA 4AWEA 4YJ5A 4J35A 1OSEA 1EA9C 3AU2A 5HPCA 1VH7A 3T0AA 4P8WA 5CC3A 1W1A1 1C7SA 1WB0A 3GXMA 2AQOA 4MYXA 1UWAA 3HJEA 4PMDA 1WCGA 3G0UA 4IPNB 1ZBVA 1FP9A 1HIZA 3SRKA 1A4LA 4GXWA 4KIEA 4OVXA 5JH2A 3E12A 4O13A 3K8LA 5FJIA 1YDVA 3S5ZA 4I9AA 3IIXA 2YW4A 3L12A 1TMQA 3W84A 1J5SA 1FXQA 5FKYA 1CGUA 3W1UA 1AJ0A 2OVLA 4O52A 3UWZA 3NDYA 2CLKA 4IMAA 3S47A 1NDYA 4GVGA 3VIIA 5CC7A 3SQLA 3NQ7A 1NH6A 2VGFA 1LRNA 4RE3A 3C2VA 3IJ8A 3L4YA 3FA4A 3GYEA 4JZ5A 4IQJA 1LBMA 1QO2A 3GX9A 1XIBA 5C5YA 1BWVA 3W7RA 3MYOA 5CSRA 3NM1A 4LGXA 4BZYA 3D3FA 3N12A 1SW7A 3P8JA 2XH0A 3PZ9A 1GVYA 2JALA 3GHTA 1R0MA 2WLYA 3EOLA 1Q2SA 5LNWA 1A0CA 4P8VA 3S9YA 2BMBA 3LV6A 1QI2A 4O11A 1KFJA 4IFKA 3WENA 1DWGM 4DNMA 3T81A 2ZRWA 2ONEA 1YE4A 1VFMA 1EJUC 4GZIA 5I7GA 1TE1A 2V5LA 3B0XA 2X7VA 5T91A 4I9JA 4Q8MA 3TCSA 1VBJA 5CPQA 3AWOA 4GNJA 2DQXA 1UR1A 3MHFA 1JZ7A 2BHYA 1TMLA 3STCA 4W86A 3TK7A 1YXYA 3BW3A 1VGAA 2EXOA 4GABA 1PBGA 3BZGA 4H8VA 3LA4A 1ZY9A 3BK0A 1ZAHA 2WW5A 4INFA 4W5UA 3QR1A 3R58A 2J9XA 3WKZA 3UR8A 2VWTA 3ES8A 4ZB0A 3O07A 5G1TA 2QJNA 3AYSA 3W2NA 4ZL1A 4PUWA 1XFBA 3AZSA 1S2UA 3ABXA 1H7OA 1U1HA 4X2RA 1Z89A 4GIAA 4A3YA 3R8GA 1XRFA 4PTWA 3FEMA 2WYSA 4EF8A 3C2RA 4BR1A 3ARYA 1RVGA 4RE0A 2Y4SA 3PTMA 3CB3A 3I6RA 3ZT7A 2G97A 1S39A 3E2QA 1ZS2A 1WV2A 4E2VA 1GNXA 4KRZA 3VKDA 3LRMA 4J3TA 4UZUA 1R38A 4M0XA 1KO0A 4QS6A 2W0UA 3P0WA 1PSCA 4FXJA 5LNUA 3R6IA 3RX2A 1SM9A 4BF7A 1XLBA 5CJ5A 3PFRA 1KGUA 3RCNA 4RPPA 4C91A 4QITA 2J7GA 3UG3A 5DMYA 3TN6A 1UD2A 4JQ4A 4DJDD 1WP6A 2D24A 7XIMA 1EBHA 3THCA 1BGAA 3BG9A 4KWOA 5D2VA 1C92A 3O16A 4V1YA 3AHVA 4W5ZA 3PZUA 5DQPA 5REQB 3LRKA 5EMLA 5FF4A 1FUYA 1FWDC 1FWTA 4A29A 4HYVA 2DIKA 3EGJA 3FA5A 4AYSA 3LQGA 2W66A 4DY1A 3STEA 4PN2A 4WUIA 3EZ4A 4PUMA 3QW4B 2PDUA 3C8NA 4GGBA 2HTMA 4JPGA 3ZT5A 1H7PA 1EGZA 1W37A 2E40A 4A21A 3WBWA 4GXMA 4DVOA 2YLAA 1I6NA 2KX9A 3BOLA 2DW7A 3DECA 2RJGA 1ZPTA 4PMNA 3BLDA 4F0SA 4K3ZA 5FJOA 5C9RA 1IT8A 4REQA 1FHUA 2WNWA 4LNYA 4Y8EA 4EANA 5C2CA 4US6A 3SIZA 3W85A 3G1YA 4QE1A 3WQFA 2PDPA 4LT9A 4Q8VA 4NYYA 1TWZA 1MWOA 2J88A 4X0VA 4YPJA 1US3A 3RCYA 5I3IA 4Q8OA 4O15A 1PPIA 1OADA 3GG7A 3GXNA 3CS2A 3W1QA 3BGJA 3E3HA 1A0EA 3DC0A 3GR7A 4XD6A 1WAWA 1HP5A 3LPOA 1TTPA 1WUEA 4MM1A 5ABGA 1TWWA 4EPKA 3H2FA 2GQAA 4IM4A 1UC4A 3TDFA 4Z1CA 2G50A 4UMCA 1VLWA 2NWRA 4TVCA 4FI4A 1V6VA 2V9DA 3TKFA 3MUAA 3VZYA 1JQVA 3KBJA 4DO6A 3N73A 2GVLA 4BI5A 1GW1A 3WNNA 2FTWA 4YU1A 1EEXA 1J6PA 3GKFA 1EO5A 4GX9A 2CZVA 1TUFA 1S5NA 1KGXA 4Z08A 4YMZA 3CH9A 1SFJA 2PBGA 3KS6A 4AVOA 4D6HA 1CB7B 3TYBA 2PLCA 5BMXA 3KAOA 1H4PA 1Z3NA 3DYMA 3WFZA 1US0A 3AMDA 3BLEA 1KC7A 4KETA 2C1GA 3DHFA 3OU8A 1KXHA 2O56A 1V0NA 5ABFB 5A69A 4KH2A 3WJSA 3WLIA 1TIWA 2A5HA 4ROPA 3UVAA 2OU4A 2XYLA 2P8BA 1Z7AA 1R3RA 4XZIA 3ZR6A 1XRVA 2NV1A 4XB3A 3JVAA 2QLYA 2V67A 5KSWA 3W7GA 5HMSA 1XLLA 4NAFB 3FEQA 3LNPA 2J25A 4C6MA 3T0CA 4JHOA 4QEHA 3UXAA 2BVDA 4OE7A 1TREA 1AW2A 1DXFA 3N2MA 1LP6A 2P8CA 4B5WA 3VNMA 3LTYA 3GC2A 4UB9A 3ZJ6A 4F0KA 3SUWA 4R7OA 2DW6A 2DVTA 2XIQA 3FHAA 2WVVB 1YTKA 5JMUA 2WNZA 3GNPA 4CNNA 3W87A 5FF7A 2DGAA 2ICSA 3WMCA 4XZBA 4PCSA 2W5FA 1H1ZA 1RJRA 3QH2A 2O7QA 3KWSA 1ADOA 1QHZA 2FGLA 1G0CA 1IZCA 1QR7A 3ANYA 3B8DA 1L2QA 4F2BA 3GK0A 1NOUA 3C56A 5C6MA 1HTIA 3FXYA 1XLJA 1Q66A 2XSAA 3RO6A 7A3HA 3B0UX 2ZZ4A 3MI2A 3GYCA 4ZENA 5AVHA 3ZJKA 4RXFA 1I4NA 1RPXA 1HKKA 1UCWA 2VT0A 1M53A 4FK9A 1G1YA 6ENLA 3W7QA 4PUJA 4O0ZA 3TMLA 1JZ5A 3CB8A 4LV4A 4TMCA 1BXNA 3TYAA 1V77A 4LX4A 1OC5A 1DIDA 4J3ZA 4JTQA 4TOQA 1PKYA 1QFEA 3CAVA 3TC6A 3VIMA 3LGEA 1CYGA 3K1DA 4HT3A 2A3BA 2GUUA 1Z41A 3WNKA 3RIKA 5C55A 1WNOA 1EA0A 4M6UA 3N15A 4NT0A 3THQA 4Z2JA 5AC8A 4HCDA 4XUGA 2QUMA 3URAA 2YDQA 3NQEA 1E15A 4AZCA 2BASA 2OLAA 4TUFA 3APGA 1BSLA 3NSXA 1QU4A 2E6YA 4J40A 3MUY1 2D0HA 4CNOA 1H5YA 1GEQA 1BGGA 4GPNA 4UIOA 1K9FA 3RM4A 2WSPA 3N6QA 5HR6A 1PJ9A 3NVTA 3S3GA 5I5RA 3P81A 4LF2A 4WKHA 3O06A 1JRCA 2VXNA 3B0VC 4ML4A 2PDFA 2C8NA 1B9BA 4Y9OA 3G1DA 2F8QA 3CUIA 1W2VA 4PTVA 5C8BB 2NT0A 3C86A 3PNZA 3GB6A 3OGSA 1JFHA 1MQPA 2H9AA 3W22A 2ZC1A 2VELA 4XQ6A 1A5BA 3PZVA 4K8HA 3L5LA 2J78A 2NQ9A 6REQB 1X7IA 1XLMA 3FVMA 4IMFA 4MUPA 3LBOA 3ERPA 3R5EA 3TN3A 2XTKA 1KM3A 4WVXA 2GDQA 2V2HA 3AMGA 3UR7A 6XIAA 2OSYA 1PL9A 3MO7A 1KRMA 1J9YA 2DFAA 1LCOA 5U7SA 4C1NA 1LJYA 2QCGA 1AJ2A 1B3ZA 4G6CA 4LWWA 3T0TA 4U28A 4ECLA 3B97A 1GVOA 5I3DA 5IHSA 3M43A 4JFUA 4IT1A 2ISVA 1MZHA 4KCWA 1GJWA 2CC0A 3NPWA 1NQKA 3BMWA 1YDNA 3GXPA 3ONBA 4JNZA 3G1RA 1FXPA 2QUTA 1Q6QA 1XXXA 3GE7A 3PZQA 4R7WA 2CXEA 3IVTA 5RUBA 4M80A 4OHQA 2DH3A 3M07A 1O68A 1WA3A 5D8ZA 3O7UA 2VUNA 3SO7A 4XO7A 3GSMA 1CEOA 1MDRA 1GVSA 1V3JA 1ZB5A 2FPYA 5HJYA 4LAMA 3B03A 5BYWA 3IJ7A 2ZIDA 1OG0A 2ABAA 3C4UA 4Z0JA 1JULA 4H7ZA 1QNRA 3SZ8A 4MLRA 5C54A 1A5NC 4O8AA 1P7TB 4AF0B 3KFTA 1S2TA 1OBAA 4WSHA 4WHBA 4L61A 1I60A 1K4HA 3Q45A 2Y8UA 2CLOA 1CECA 5AHLA 4Z2GA 1RALA 3EX1A 3SGZA 1Q8JA 3IK2A 2ZRZA 3B05A 1BVNP 1TTQA 2E8YA 1DJHA 4MWAC 3BARA 3DFSA 3BMVA 2GGHA 5I77A 3I3BA 4N4PA 1AZ1A 4OUIA 4C6PA 3VOCA 1FDYA 3H23A 4IXHA 4IUGA 1UD8A 1E55A 1EZ2A 1NFGA 3VNJA 2ZWZA 2G3NA 3J7HA 3M0XA 3F5JA 1BF2A 1Q6FA 3HA1A 2I9EA 1OD8A 2YKKA 4HMNA 2X40A 2Z1XA 3H6OA 2G95A 3Q37A 3FSUA 2BS9A 5I03A 3BANA 3M0HA 4EWND 4C6JA 2Z2AA 1UUOA 3C2YA 1XUUA 3MCOA 4ZO7A 4XSMA 1Q4NX 4JD4A 1G94A 3UPBA 2VM8A 1AG1O 3DKLA 1TPWA 2ISSA 3TTEA 1FFRA 2GSEA 3OVGA 3ZLFA 4JCLA 1GYMA 2KZHA 2X2YA 3A5FA 1PIFA 4LU0A 1AH3A 1XS2A 5CG7A 1YBQA 2J74A 3UBPC 4NYUA 2ZUNA 5HOSA 3WJZA 4QLLA 4JQAA 3ARQA 2X09A 5CPSA 3SGGA 1EC7A 2CZEA 3KZSA 2DVXA 3U2OA 4N6FA 3PZMA 5LNVA 3BZJA 2PF8A 2YJQA 3BW2A 1SZGA 2V5KA 2WZEA 2UY2A 3N11A 5DT5A 1E6XM 1YW1A 3CHVA 3GIQA 4WKFA 4H9MA 5F2IA 4B9YA 2J79A 4PRTA 4E8DA 1J6OA 2PF0A 1CXEA 1GWJA 3GAYA 5I00A 2E1DA 2ALDA 1JI2A 3B0YA 4L80A 4Q4PA 4YTRA 2X0HA 3ARRA 1R30A 1QBAA 2NZLA 1EGVA 4K36A 1CGXA 4GUGA 4C7GA 1GKQA 3VK5A 1THFD 3DHUA 3UF9A 3EEGA 4F79A 3V36A 2WSRA 5TF0A 4DNHA 3C3NA 3P7YA 5C7VA 4LVGA 3MHGA 3NEVA 1UD6A 1PDZA 1S3HA 2VRJA 1K77A 4GG9A 2D2JA 6TIMA 4Z2IA 1A4MA 3GR8A 1BPLB 4B3LA 2PODA 2C16A 2C6QA 9XIAA 3SN1A 3ANUA 3CQ0A 1VZWA 2OG9A 4D8AA 3BJTA 2BHZA 1LRTA 1GPWA 3TA6A 1W5OA 2VMFA 3GKAA 2ACSA 4GI9A 1R2SA 1JCXA 4LUTA 2R1KA 3NGJA 1R3WA 4JTAA 2PWVA 5HXMA 4MTVA 3QOMA 1JZ6A 1E1FA 1RQHA 4B5NA 2F7FA 1ZGDA 2C7FA 2EJ1A 1Q3NA 3SQMA 4IFKB 4KEUA 2VEFA 4EWJA 3D3AA 3VD7A 3M5ZA 3K8KA 4BI6A 2FTYA 2Y62A 3NL5A 1Y0EA 3CYVA 3CL6A 2OELA 4O1FA 1QI3A 4G56A 1IEWA 3MY9A 4RL3A 1GQKA 1I0BA 3A3WA 5EMUA 4MG4A 1XRTA 4FP1A 3B8WA 1R87A 1J0ZA 4WIWA 4MZYA 1PUDA 5C2XA 3TFXA 4NI8A 4RV3A 3BLKA 5HNRA 2VRQA 3MANA 4PFMA 2QDHA 5BOOA 1GOOA 2FZDA 1G5AA 4DXKA 3CO4A 3ITXA 1UMYA 4ZR8A 5FEWA 4ATWA 4IPPA 3OZOA 2F61A 4MLJA 3W2JA 3EPOA 3WH5A 3LMYA 4XWUA 1TVLA 1GZJA 4PL1A 4E3TA 3OBKA 4IISA 1XG3A 4F9DA 2YCEA 4JNMA 4P8UA 5CGTA 3LGDA 3NYDA 3DENA 2WKLA 3KTSA 3UW6A 3ZQ9A 4KEVA 1X6NA 3RM8A 4F0RA 3AIQA 3OBAA 3C3UA 3S0CA 3CZKA 1EZWA 2WZHA 2CLHA 1GQNA 3VU2A 2R9RA 3NA8A 2Y8VA 5MKGB 2QCCA 2A7RA 2PDIA 1VCFA 8XIMA 3K5XA 4WX2A 3PAOA 1FWRA 1H7RA 5AYXA 4I7VA 1TPH1 1FOBA 3W7KA 5D4YA 5I09A 3H4XA 3VDHA 2SFPA 1JQXA 3APTA 2E09A 4WJEA 3UNTA 1W1IE 5EKYA 3W73A 2XZ9A 3WDPP 4WY0A 4JHZA 2BHUA 3NOYA 5CC6A 4HK5A 4UTWC 4QAWA 3S4TA 3W7LA 2UY4A 5E93A 1OM0A 1ZU8A 2XVGA 3YPIA 5K4XA 1VYSX 3SW6A 1FH9A 3REQA 4XKYB 3BMXA 1LORA 4A8IA 1DIEA 1CW2A 4P61A 3PUGA 1BKSA 3MV11 4DUVA 3H70A 5D03A 2J7DA 1BYBA 2XFWA 3KHJA 1O1HA 2WC7A 4W7VA 5L9FA 5F2LA 1KBBA 5BWAA 1RVKA 3LPGA 1TPUA 3FA3A 1T99A 2VHLA 1IWPA 3DC8A 2Z1SA 5MHBA 2YLLA 2Y7FA 4PMUA 2XIJA 1DHKA 3M9YA 3KLKA 2OFJA 1PHQA 5CZSA 2E5DA 1QWKA 3FVDA 1XHGA 3RM9A 3A9IA 1V02E 4WJ8A 1BRLA 2PAJA 3OP2A 1DWIM 1LBFA 3W7CA 1SR9A 4F0LA 1TQXA 1EDGA 3MTWA 3RPDA 4QAIA 3S1XA 3P82A 1IEVA 2VQUA 4KEMA 2XHYA 2Z1KA 2PDGA 4N4QA 2YB1A 3WLLA 3VUPA 4XG1A 1B57A 4XAPA 3A3HA 3S2JA 4NL1A 3TJ4A 2ZRUA 2H90A 4MUZA 3NZRA 1MEHA 8A3HA 3IJDA 2O4QA 2Y6ZA 1V51A 3NR0A 4JN6A 3N2CA 3EEZA 3SCNA 3R12A 4W7WA 5CSYA 3L4WA 3W2UA 4RW5A 3CTTA 2I5IA 3S8HA 5GNYA 5I3HA 1PKMA 4GYKA 3ZMRA 1K8CA 5AFDA 3VC5A 5I78A 4TVDA 3GXTA 2CLLA 2CEQA 3TYEA 4IJRA 5LSMA 4XZWA 5AZ1A 4FLSA 1MSSA 4M24A 2Y7DA 3BDKA 1JD7A 1N82A 4QFUA 1EGMA 1ZBWA 2IPWA 5FF0A 4UQEA 1DL3A 3PB0A 1Y5XA 2IPFA 1S2WA 3KRSA 3TFCA 3T42A 2WMGA 2Z24A 3O6CA 1ONRA 2F38A 3MI6A 1N7KA 4DYJA 2ZUSA 1KTCA 3CEPA 2BVYA 1LWHA 1UR2A 2DZUA 4M8UA 4FNQA 3M64A 2QCEA 4K7YA 4H1ZA 1FHLA 1FX6A 2WSKA 1O6IA 1PKLA 3B8UA 3ABZA 1HFBA 4IJCA 3ITOA 1BAGA 4DJFC 1XF0A 1Z48A 3M0MA 2FGZA 4D6CA 3KOZA 5CEWA 3ZVHA 4C6CA 5D2TA 4PMZA 3PJUA 1YQ2A 3KWXA 3BLIA 5D9PA 3U2ZA 5LIKX 3VMOA 3EMCA 4OOUA 4NAEA 5LIXX 3T0DA 3N4EA 3WDJA 4XAGA 2WV8A 4EPDC 3GNOA 3NQAA 5AHFA 2G3FA 3KP0A 1R85A 1HJXA 1HGYA 2GLKA 1KCXA 1CGTA 1J01A 2DIEA 4HSOA 1EOMA 2PRLA 4EXAA 1H11A 2GGJA 2E7FA 1E4NA 4E3VA 2VCBA 5BRBA 4Z1BA 4MNMA 1X7FA 1D3HA 4ZVJA 3QR3A 2A0NA 2HXTA 4K39A 3T4WA 3KOXA 1P48A 3CU2A 2Q3OA 4ZSUA 4L6DA 1UD5A 4IPIA 1FWNA 3AS1A 3UGVA 4B90A 1FVPA 3LD5A 4H2CA 3W86A 4KCTA 4JEJA 5A6SA 1G69A 2CU0A 1B5TA 1XKYA 3TSDA 4B92A 1TPFA 4A22A 3S5OA 3PNUA 1XG4A 1JPIA 1W8SA 2O55A 4NNAA 2EBNA 3HMCA 1VYRA 4AZCB 2FHBA 4FZIA 3VIHA 1OX6A 1UKQA 5AOUA 3M6DA 1MQRA 1DPMA 3MWCA 3F4WA 4FPSA 2WM1A 2VDHA 1B1YA 2PP0A 3TTSA 4OJYA 4DJED 1XIGA 1OFOA 1XYBA 3C2OA 1W5MA 3H2EA 4M1RA 2WMFA 4AIOA 3LTSA 3BQ6A 1BYDA 1PX8A 4AUBA 5AY7A 3E38A 2ZTJA 3VGHA 3O1NA 1EPXA 3URBA 3ICJA 3TUUA 3G8EA 3WBYA 1RD6A 3OTRA 1KM5A 4CQAA 1A49A 3LBMA 3OLDA 1BF6A 3SCPA 2Y8KA 1C8QA 5EFDA 4E2DA 2H9AB 1H0GA 4QTGA 4GLEA 4LAUA 1P0BA 1F7BA 4H6QA 3T0BA 2VZOA 3I4KA 3MZNA 4XIMA 1NARA 2P76A 2EQDA 1GOXA 5KTLA 1ZENA 4Q7BA 1OCJA 3RUBL 2HJPA 4S3EA 4WQ6A 3N3MA 3GHSA 3KP1A 5HA7A 2VOMA 2E6FA 5H6HA 8CGTA 2HISA 1TPVA 2DSUA 4KGJA 1E72M 5CBBA 2VC6A 2WJEA 2QT3A 3L5MA 2FKPA 3DFQA 4PMYA 3SFKA 2R1NA 2X42A 3W0KA 2WKGA 3O6DA 4FOKA 3VPLA 1GQIA 1POKA 4C90A 5A8OA 3DU0A 3TU9A 1ZUAX 3TTOA 1ZBKA 1ONWA 1D7FA 5HMEA 2C3ZA 4P8XA 3AYVA 2YXXA 4NSBA 4ICNA 4H6EA 5F1VA 4IPJA 3BAKA 1DEDA 2CCRA 1LROA 2ZUTA 2BY0A 4MB5A 2BV9A 2AL1A 1JCNA 2NX9A 5GNXA 4MAZA 1DJQA 2GVJA 3F5KA 4L1XA 3WMLA 4A2SA 5D2YA 3G0XA 1HKIA 2PTXA 1WDSA 4UFIA 1F3WA 1W1VA 3SJ3A 3U2EA 1BVWA 4DJDA 4QHRA 2C18A 1EC9A 4XAZA 2WMHA 2P10A 4YVVA 4LB4A 3R8RA 4MYAA 3S2NA 4HP5A 3UA3A 4UFKA 2VC7A 1PYFA 1F3TA 4QSHA 2R91A 4S3JA 3E9AA 3NURA 4ZQPA 3RRAA 3HV9A 2G4FA 3NIYA 5A8MA 3DI1A 1VBHA 3U0HA 3GAKA 5HWJA 5A1AA 3TYZA 4GE8A 3WQ8A 2OPJA 1MMFA 1LF1A 3LCFA 1DJZA 1XPGA 3NL6A 2QULA 3GFYA 3CUFA 3VINA 4K37A 1EUNA 4E2OA 1QOPA 1WPCA 4G5DA 4GXPA 4NX0A 3SSJA 2CKSA 2W9MA 3FSTA 1KNWA 5A8GA 1DE5A 3H2AA 5LZLA 1Q13A 1SR0A 4K38A 4H7VA 1VKFA 2J4GA 2PTWA 1AQ0A 3LDVA 3STPA 1M7JA 1P0NA 3TR2A 1MXSA 2VOTA 1W91A 3KRBA 3ZYZA 4BA0A 3LHZA 2VEGA 4AFYA 4JHMA 1YBQB 4FF5A 4LCQA 1VENA 3IPWA 1D3CA 2P5NA 1QW9A 1QWGA 1TZ7A 1R9YA 3DDMA 1XCWA 3HU7A 2PGFA 3E1F1 2WC4A 1CX9A 3TR9A 4DJFD 2CNCA 1E3ZA 4QLKA 5TQLA 3I10A 4AX7A 1DKWA 3L21A 3VOHA 1W3HA 3AJXA 4IX0A 4A8RA 2MANA 4FNRA 1FA2A 3SCOA 5A3HA 5G4EA 4O12A 4IGSA 1SZRA 7CGTA 1NY1A 2CLPA 4BEUA 5LA0A 2WBKA 4RE4A 3O9NA 2P88A 1ZFJA 3W7OA 3ZOAA 3LCIA 3P60A 1R5YA 2Y88A 3N2TA 3WYZA 1IQ8A 4Q8PA 4CGTA 5HWNA 4EIVA 4HHHA 2QJMA 4G2DA 3LSCA 1HNYA 3L4TA 5K9XA 1VF8A 1QNQA 4GBDA 4OBSA 1WXZA 3V5CA 1VAHA 3KL5A 1J0JA 3AIUA 4ILSA 1NFPA 1S1PA 2WXDM 1XLGA 4GZ7A 3VOJA 1I75A 2YCLA 1H49A 2JKEA 4Y9MA 4JY9A 5FJRA 2EKGA 1JAKA 3GVWA 4QJ4B 2V6AA 3PFMA 3VKJA 3IUDA 1O94A 3B8TA 4IIBA 1RJQA 3FAWA 3BSGA 3PZNA 2CZDA 3M44A 5GJNA 5AC5A 3ES7A 3ARWA 4YWIA 3A13A 1UP3A 2JE8A 7REQB 4LUTB 2GGGA 2GWGA 5I23A 2ZVRA 3HPZA 4Y9NA 2AL2A 2Z1BA 1RY0A 1U30A 5D33A 4MJ4A 2Y85A 3RN6A 4QRNA 3GXIA 1PZ3A 3TC7A 5A94A 4KQNA 4UQAA 4MJ2A 1R2TA 2QYGA 3PPFA 4EXBA 2NX1A 3C0SA 1SQ7A 1Q6DA 3E74A 1OX4A 1OY0A 3OB8A 4MY9A 3KL3A 3K4DA 4RCXA 1RUSA 1DJWA 4PUEA 3WG6A 4JKMA 1XYLA 1O66A 2BBFA 1BTCA 1RZMA 3WX7A 2DSWA 1W9UA 3T8LA 1F05A 1AODA 3FY1A 5BU6A 2BLEA 4GUFA 4V2XA 1EDQA 4IF2A 4I6KA 4ZQRA 1K03A 2NW0A 4IMGA 2WQPA 4AC1X 1YIXA 1QNVA 2NX3A 2CLEA 4OWGA 3L67A 3R0UA 4BK9A 1E9LA 1F4AA 5C9ZA 2Y7GA 4ZQMA 2J75A 5AYIA 1YYAA 3M47A 4B15A 3EDEA 4XSLA 1LL6A 4AQLA 3BPWA 2FPTA 2GJLA 3H2CA 1OG6A 4NXSA 4AXKA 3N17A 2FB3A 1M65A 1XISA 4GIEA 2ZYFA 2ABBA 5I3GA 4LV9A 1YPXA 2ZX9A 8TIMA 3CPUA 4DO7A 4NZCA 3VD3A 1VYPX 4JTDA 2YIHA 3H53A 2JKPA 4A3UA 2AAAA 5G4WA 3VNLA 2DSKA 3OQEA 6TAAA 3P62A 4GC3A 3UNDA 3QKZA 4YN5A 1QHOA 2XIBA 3W25A 1A5UA 2JF6A 4IIFA 1OQFA 1JUBA 2RUSA 3CIXA 4EVZA 1GZ1A 1NP2A