1SO3A

Crystal structure of h136a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
214
structure length
214
Chain Sequence
SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYARSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so3A00
1W5OA 4PL2A 1F6PA 2X1UA 3F4WA 3W7EA 1NEYA 1D9EA 3EWUA 4QNWA 1F73A 3LV5A 2ZZ4A 5K9DA 3W83A 1OX4B 3EX2A 3W88A 4JTUA 1W1ZA 4O18A 4WX2A 3ELFA 2JBMA 2GVJA 2QCNA 4TR9A 2Z2UA 3CTLA 5LNVA 5C55A 4FHAA 3Q94A 1F5ZA 1CX9A 3NQCA 1GOXA 3DFQA 1B9BA 3DHDA 2E77A 3L65A 2R8WA 3FA5A 3TW7A 3S5ZA 5DY3A 3C8FA 3TC7A 3S1XA 1BWKA 3LHWA 3GKAA 3QFEA 1JUBA 2ZTJA 1VJIA 4JIPA 2F84A 3MYPA 4FX8A 5F4WA 4P2VA 5A5WA 1FWRA 1AL7A 3GAKA 4H4IA 4Z1BA 1JCLA 5G4EA 3WK2A 1KM2A 4POCA 2CZFA 3DFOA 3LXAA 5BMWA 3F1QA 2V9DA 2JGQA 4Y96A 1SPQA 4LTSA 4DF1A 3W7IA 2YFOA 2GUUA 3QJAA 1EWDA 2GQ8A 1H60A 4RXFA 1SSDA 1TB3A 3T40A 3W3OA 1Z42A 2X30A 4JX6A 4L4MA 1ME8A 1VCGA 1W5MA 2ZTKA 3IRDA 5C2XA 5AC7A 2E68A 3LTYA 3CM4A 2QCGA 2ZZ2A 4R33A 4NJGA 1M7OA 3P62A 1GYNA 2Y89A 3PUDA 1RVGA 2RDWA 1W0MA 2G5WA 1GZGA 2DU2A 1KV8A 4YMZA 1F6KA 4BI6A 2QCEA 3W7RA 5FF7A 2PRMA 2WJZA 1PCKA 3NL6A 1H50A 4TU1A 3BG9A 1XXXA 3TW6A 3NQ8A 1BKSA 2Y63A 3FYPA 1N55A 5E0KA 1B3OA 4MYXA 1FWNA 2Y6ZA 3UPBA 4HHPA 1N8FA 3B0VC 1S5TA 3L9CA 3O1NA 3W7JA 3WK0A 4I7UA 2Y70A 4AMAA 3W1XA 4DELA 2NXHA 3DGRA 1TIMA 2JKPA 3G0UA 3B8DA 3BPWA 2C18A 4UFIA 3EKLA 1SO5A 4ML9A 1H7XA 4YXGA 3BW2A 2YW4A 2NV2A 3PG8A 4AB4A 3CB8A 3A24A 3GYEA 3NPUA 1PHWA 3U8GA 2ZA1A 4CNPA 4IUOA 3UZJA 3T4CA 2ISVA 1K8YA 4E0CA 4FXRA 1O5XA 4RZ4A 3LHVA 3N73A 5DBUA 4NJHA 1K7EA 3C2OA 4PA8A 3E12A 1TJRA 3PM6A 4MLJA 4XBSA 3FS2A 3SR7A 1XUUA 3GX9A 3TXZA 4N6EA 5IM51 3PBVA 4H6KA 3P81A 3OEXA 4N4PA 4RR4A 4E38A 4Z1AA 1UBSA 1TPWA 3B0PA 3W73A 5DXYA 4LV4A 3UPWA 1KBIA 3W9ZA 4EIVA 4MKNA 5DBTA 4UTKA 1ZY9A 3KVKA 1VYSX 4HKPA 3MHUA 2QDHA 3WJSA 4Z0JA 1W3IA 1QR7A 5KINA 3EWXA 1G4SA 1SUXA 2TPSA 3QEZA 1I2PA 5D05A 1JR1A 1MEIA 5AC6A 3NQMA 4NZFA 2NWRA 2QUTA 3M5YA 4M5PA 3L0GA 3M0ZA 5CPMA 2A6NA 2R14A 1TPEA 3HB9A 1GT8A 3HG2A 1W5QA 2OCZA 2LLEA 1FBAA 1JCYA 3TDFA 3BW3A 1HO1A 4NXSA 2C6QA 4JIQA 3TUUA 1KFBA 3HG5A 3FKRA 3VCRA 4E2DA 3LBCA 3PAJA 4U4MA 2Y7DA 2V5BA 1H51A 2DZPA 2P0OA 4XWUA 4AH7A 1C29A 1TCDA 4AWUA 2VOMA 2J6XA 5K4ZA 3QSTA 4JTKA 1S3HA 4UFKA 5L9FA 5CPOA 1O60A 3LX9A 3R8RA 1OJXA 1LLWA 5DN1A 1G4TA 2H8ZA 5KZEA 3PUEA 4MUZA 1QPQA 1LBFA 3GR7A 3HOJA 1YDVA 4Y90A 1W54A 4RK8A 3TROA 4JX4A 3HO8A 1OFBA 3SW6A 3NQGA 3MBDA 3LHZA 3W23A 4DPQA 3TA6A 1I45A 2ALDA 3STGA 1WX0A 4Z1DA 2A0NA 2EF9A 5LGZA 5FEZA 4ZQNA 5FF3A 3BARA 3GXPA 3QH2A 4RZ6A 1Z44A 1GYLA 4FNPA 2BWGA 3NG3A 3CEPA 2PRLA 4IMFA 2A6LA 5D04C 4AXKA 1PCWA 4HSOA 3GR8A 2GJLA 1JQVA 4FNUA 1VHNA 3TCEA 1FX6A 1KTBA 4LT9A 3IGSA 1TTPA 3R5EA 4OQVA 2ZCGA 1QFEA 1M5WA 3QPZA 3UQNA 1ME7A 1THFD 4N9DA 1X8FA 1NVMA 2E6FA 3DZ1A 3GDKA 4JEQA 5K3VA 4N9BA 4JTJA 1EPXA 3W75A 4JTGA 2V8ZA 4O57A 1HFBA 2X1RA 4OV4A 1PV8A 4H3DA 4R53A 3TKFA 3A23A 3NOEA 4U28A 4IXXA 3L68A 3W2KA 1F76A 1ZFJA 2CW6A 4HPXA 4MFEA 2ZDRA 4Y9AA 4MLRA 4LV9A 1SQ7A 1LDCA 1YXYA 3IIXA 5ABTA 5L6UA 2CFFA 1L6SA 3UNDA 2EHHA 1H62A 2E5CA 8TIMA 2FJKA 3HGRA 3C2FA 1ICQA 1TPUA 2ATSA 1LRTA 1LOLA 2BTMA 4JGDA 2PURA 1L6WA 1JCNA 3PVFA 1GVOA 3B05A 5EL1A 3Q58A 2H90A 2WPBA 3LCWA 1NF7A 1K03A 5EBUA 2CLFA 3W7KA 4MY9A 5IBXC 3LTPA 4AWSA 3LCLA 3QW4B 3LI0A 1VYRA 1BTMA 3I65A 4FO4A 3GXTA 3S5NA 3C2EA 4X9SA 3LHUA 2O7SA 4M7SA 1Q6LA 2CLLA 2DZWA 3ZWSA 3TQVA 2Z6IA 2Q3RA 2H8XA 4LW7A 4OU1A 4ZQMA 3R2GA 1DBTA 1R2TA 3W71A 5I3IA 1YADA 4BK9A 3C4UA 3C3NA 3FIGA 3OVPA 4GC4A 3LLFA 3W7HA 4XTIA 4FX7A 1GVRA 3KVJA 5HUOA 3IEBA 3L5LA 4ZQCA 3EX1A 2PE4A 4LUJA 5G4WA 3G1DA 4TMCA 3R13A 1A5SA 4EF9A 4N2YA 1W5PA 3C6CA 3HPZA 4MVAA 2VFGA 2PRHA 3EWZA 3I6RA 1WDWA 4C1KA 3IGUA 1LTDA 1YPIA 1OFEA 1FWSA 5EMUA 3NL5A 2OMAA 3EWYA 2ZZ3A 2ZBTA 3N14A 1XUZA 1FUYA 1AW2A 4NNCA 4RZ5A 3LCHA 4WD0A 3NQDA 1SSGA 1FQ0A 1XKYA 2HS8A 5U4NA 4FF7A 4LS2A 2ZRWA 3PG9A 2B7NA 1MEWA 4UFMA 3GVGA 2J9XA 3TJLA 2C19A 1TPDA 1OG0A 3E9AA 4PL1A 4HNTA 1K7XA 2VEKA 5HJLA 1ZENA 4O10A 3JRKA 4UXDA 1KFEA 2VFDA 3LCIA 2WNQA 1TTIA 2YYTA 1H61A 4CQ8A 1RD5A 1XM3A 3E02A 1UCWA 3FOKA 3G1VA 5CSSA 3W7MA 5AYZA 5FEXA 2Z1BA 1A5CA 1EP1A 4JYFA 3USBA 2NUYA 4IPIA 1TTQA 1LYXA 1WA3A 3P60A 3P67A 4JTSA 3ABQA 5D2VA 4O52A 3PR2A 4O0ZA 1H7OA 2OJPA 3KX6A 4ADUA 3UXDA 3S0CA 5EKYA 4N6FA 3FJLA 1H1YA 5FF2A 1OX4A 2W6RA 1OYBA 3DI0A 3UZ5A 3BG5A 3GB6A 3CU2A 3OIXA 3L66A 5TIMA 3MHGA 5KZMA 4JDBA 2HS6A 3STFA 1DJQA 1KFKA 1ML1A 4QJ1A 1IXPA 2QDGA 5MHBA 1VC4A 3M44A 1Q6OA 5LNSA 5FEWA 2BXVA 2WSYA 5C54A 4O4VA 2YGYA 1JCMP 1WBHA 1H7PA 2EPHA 3SZ8A 4UMCA 4J9JA 5DELA 1H1ZA 2FPVA 3KRUA 4NJKA 3GNNA 1KM0A 1EEPA 2CZDA 2ZYFA 5LHFA 1K8XA 4K36A 2NXIA 1VYPX 4JDYA 5TBOA 1J5TA 2VFFA 1C9DA 1SZFA 3C2VA 5I3FA 4ZL1A 4PODA 4NJIA 1W3NA 1X6UA 1B4EA 1YDOA 4K37A 3GZ3A 3A5VA 4PC8A 3F03K 2R94A 3W07A 2TRSA 3IIOA 1FWTA 3S5YA 4O50A 1XBYA 2HMCA 3N2XA 5BRBA 2X1SA 4UTTA 3L0NA 1ONRA 2ZZ5A 3G3MA 1T0OA 2ISSA 1YYAA 2E6DA 1TSIA 4I9AA 4IX0A 1IXQA 5I3GA 2I9EA 4UTIA 2E1DA 4MOZA 1LRQA 4WY0A 3DAQA 3LTSA 3O06A 3LCGA 2UV8G 5K2ZA 5HR7A 3CWNA 3RLVA 4LUIA 4A2RA 3B0UX 3HGSA 4W9TA 1IGSA 3G0XA 3C61A 4O15A 4AF0B 3LM7A 2CU0A 1O5KA 1DQXA 2QKFA 3HPSA 5A8GA 2VFIA 4K39A 5AHNA 4TIMA 2FIQA 4UTHA 1O95A 2G96A 4BI5A 1ADOA 1AG1O 1OYCA 2CLMA 3N9SA 4HNUA 5EPDA 1HTIA 1OX5A 3DHFA 5CZJA 3W72A 4C1LA 3RNDA 1L6YA 4LVAA 1JRCA 1KFLA 3HG3A 2OT0A 3VI2A 1KTCA 4M7TA 5J5RA 3S1VA 3W2NA 4QQ3A 5LNRA 1JCXA 1H5YA 1JJKA 2H3BA 3TMLA 3NQ7A 4DO6A 2PCQA 2NZLA 4WUIA 2DJLA 1GG1A 1I4NA 3MJYA 7TIMA 4ORIA 1GJPA 2V2HA 1OFDA 4N4QA 1Q45A 2E5BA 4M19A 1X7FA 2ZRVA 5D37A 4UCGA 1GPWA 3P84A 1H63A 2GVLA 4Y6GA 3W6YA 5LKYA 3S8HA 3DU0A 3M41A 2FDSA 4YLWA 3LDVA 4JTHA 1D3HA 1IF2A 2CZEA 4IMDA 1FY6A 2YZRA 1W37A 5HWMA 3GIYA 5G5IA 3H53A 1V5XA 1XDMA 4WY0B 4XBKA 3W2JA 3LRLA 3L67A 2ZRUA 5KMYA 5I3HA 4FXSA 1ICPA 1TQXA 2A85A 2GQAA 4QSHA 3CIWA 2NLIA 1QWGA 3ABSA 2PC4A 4UFLA 5AYYA 1EB3A 4PFMA 1KTNA 1PVNA 3W2MA 1TREA 1ZAIA 2Q3OA 5BOOA 3R12A 4HNNA 4LNYA 1QO2A 4CCDA 3BLFA 3DBPA 2A1YA 3FFSA 1T96A 1LBLA 2ZZ7A 3W1AA 5CPNA 3PBYA 2WNNA 1O4UA 1TV7A 1KFJA 1JULA 3UWZA 3INPA 4LS0A 2JKEA 3I7RA 3QPYA 1WBJA 1PS9A 3UY8A 2NXGA 4UFJA 2B7OA 1A5AA 1LOQA 2HSAA 1M7PA 1A5BA 4JS3A 1GG0A 1QO5A 4EF8A 1OF6A 3NM1A 1VRDA 1A53A 1K8ZA 3TNOA 4YCOA 4A2SA 3WJWA 2YSWA 3SGZA 4UNLA 4O8RA 4UTWA 1AK5A 3ATYA 3JS3A 2QCCA 5HWJA 4R34A 2QAPA 1BEUA 1SZGA 3GXNA 4GUHA 1OFOA 5DXXA 2G97A 3KVMA 5K9CA 4G1KA 2W0UA 3QF0A 4ADSA 5D2YA 3LBMA 2QCMA 3L0KA 1OYAA 4O53A 2ZQ0A 3TIMA 4KFNA 2VEPA 3G1FA 1QAPA 3ANYA 1ALDA 2ATMA 3NL2A 4DEFA 4I7WA 1KLZA 4CQAA 4O11A 2J27A 1XL9A 1ZHAA 3MMTA 1U83A 5D03A 4O54A 1T8XA 3E49A 3ABOA 4HIBA 1OVDA 3C2RA 4NZJA 1YPFA 3E0IA 4UNKA 1SW3A 2NX1A 1QPOA 5LZLA 3PSWA 1H7NA 4S2CA 4BFAA 2WSQA 3SI9A 4QNEA 4LWWA 3LB0A 1OK6A 1TO3A 3QC3A 3EX6A 4KFOA 4JTEA 1F74A 3SFKA 5SWUA 3PS7A 2V82A 1VH7A 3N19B 3NZ1A 4OBTA 4XQ6A 4HSNA 3IV3A 1DKWA 1DVJA 2WV8A 3MO7A 1TPVA 3M16A 1S5VA 4MY8A 4XUGA 3KRZA 2VXNA 1WQ5A 3NDOA 3NM3A 2FLIA 3TXVA 5G1TA 4AVFA 4MZ1A 1X1OA 5D2WA 5KZDA 1TPC1 3W2UA 4DQWA 1R46A 1HO4A 4O1DA 4DO5A 4RV8A 5HR6A 3BGGA 1Z41A 2DZSA 3EWWA 4FIRA 4O16A 3CWOX 3FEMA 2Y7FA 4HPJA 4UMBA 3C56A 4UTUA 3NQVA 1TPB1 4IMEA 4IX2A 2V81A 1QDSA 4JY8A 4HT3A 3VE7A 4RJEA 5D30A 4UFHA 2YCEA 5AB3A 5G2HA 3BVJA 4O14A 2VKZG 1UUMA 1IXOA 2RFGA 2GJNA 4Y8FA 3NPXA 1X1ZA 6TIMA 3TSBA 2G95A 3M5XA 1N7KA 3A5FA 4ZQRA 4FIQA 1HG3A 1G67A 3DFSA 3G1XA 3O07A 4K6AA 5DLCA 2HTMA 3QQ0A 3TQKA 4FX6M 3MI2A 1SZNA 3GDMA 2J9YA 2RKXA 3UWWA 1SFLA 1PL9A 1CW2A 3LRKA 3KVLA 3N9RA 3EKZA 3L2IA 2ZRZA 5F2LA 3KHJA 3QQ1A 3T78A 3UY7A 4AHOA 3CEUA 1L9WA 3W1MA 1JRBA 3IVUA 1VLWA 3UXAA 4AAJA 4UMAA 2Q8LA 5D2TA 1GTHA 3W85A 5BMXA 4LC8A 1F2JA 4ZZ9A 4OHQA 2CLHA 3O6YX 3MP5A 3M5ZA 1R2RA 1SW0A 3S9YA 3PC0A 2A7PA 2VC6A 4K38A 1GVFA 3C52A 3NQEA 5D09A 1FDYA 3W7NA 1VPXA 2TMDA 5GVJA 1NFBA 3TC6A 2Y7GA 5LNWA 2C0AA 2A21A 2GVGA 3B04A 3MWAA 4XKYA 4JTFA 5CZTA 3EXSA 1OK4A 4JXCA 3TSMA 3PBUA 2I14A 1M6JA 1AW5A 3OHIA 4ZMGA 1P4CA 5D32A 3NO5A 4QITA 3F4NA 1RZMA 2FQIA 5D02A 1LCOA 2C13A 4K7VA 2BSLA 3STCA 3V1PA 3T44A 4X22A 5FI8A 4RXGA 4LRSA 5F4SA 1VS1A 4A22A 3CHVA 3M7WA 3BLIA 3LLDA 1KM3A 4IWWA 3UWYA 1LBMA 3WJZA 3ZWTA 4MIMA 5K7JA 1IIHA 3VFLA 2C16A 3VE9A 3MI6A 1FCBA 1CI1A 1H7RA 2X2GA 4LRTA 1KBJA 1BWLA 5LGXA 1P5BA 3LHYA 3W87A 1VQTA 4BWLC 3H55A 1QOPA 2VFEA 3UWVA 3P7YA 4JY9A 2OT1A 3LXBA 1XBXA 1EX5A 3TU9A 1DOSA 3HBLA 5G2IA 1MO0A 4QAIA 2I1OA 3G8RA 3W1UA 5HWNA 4E2BA 4L4LA 1K3UA 3W7CA 3CPRA 3PBWA 2BZNA 1FCQA 1KLYA 4X3ZA 1LRNA 5C6MA 2QCHA 1GTEA 3KOFA 1VZWA 3HGJA 3RMJA 3G8EA 2DZTA 3LCXA 3TAOA 2YDAA 2C3ZA 1JQXA 3SSJA 4N02A 4LC6A 2J88A 3HF3A 1WYIA 4XKYB 4Q4KA 3VKJA 2QCDA 2W79A 4QIUA 1OX6A 1Q6QA 4PH6A 3KXQA 4WZHA 1LZOA 1JCJA 3QMTA 2ISWA 3HQ1A 4AWTA 3B06A 1XBVA 2WSRA 1KV5A 1SO4A 2E5DA 3M9YA 3G1HA 3EX3A 3HIJA 1W31A 1TYGA 3D0CA 1GVQA 2WQPA 4DBEA 4ORMA 2QAFA 3P8JA 5FESA 3Q2DA 3NL3A 3MW7A 3MP4A 1QMLA 3IIVA 3TX9A 4GXMA 2XN0A 4GUFA 4LVDA 4ALDA 1I2RA 3ZR4A 4O13A 3PB0A 3W7LA 1XI3A 4AF0A 1B57A 3JR2A 3KFTA 1EIXA 1TJPA 3E96A 4XTDA 2CZ5A 1TPH1 1VCVA 3CC1A 1EWEA 5FF4A 1Q3NA 3G0SA 1I2OA 3NVTA 2EKCA 4JYEA 3NQ2A 1NAL1 1Y0EA 3I7SA 3W7OA 4YL2A 5C5YA 4IJBA 4S1FA 1LM1A 3BLEA 3IVTA 4NT0A 2DP3A 2B7QA 1QCWA 5AHMA 1MSSA 1KA9F 3CLMA 4A29A 1FXQA 3NQAA 3STEA 5D2XA 1LORA 3IVSA 1O94A 4IOTA 1WXJA 1TTJA 2Y7EA 4FNQA 3C0JA 1R47A 3TAKA 2QCDB 1VLIA 5HULA 3G1YA 1YXCA 4JTLA 1RQBA 3LV6A 4K8EA 2QF7A 3MP3A 1GVSA 4LS1A 1LLZA 3DFNA 4RCXA 4XZ9A 5DCDA 4ICNA 4YWIA 4GNJA 1R2SA 1Q6RA 2QEZA 3AO0A 3NR0A 4JTTA 4IGHA 2RH9A 2XN1A 3CT7A 5T26A 2Z6JA 4CNOA 1YLVA 4WXYA 4Z0SA 3O6CA 2P1FA 3L21A 2WNZA 4MY1A 3W86A 1VHCA 5AHFA 4AHQA 1KFCA 1QNVA 5HQEA 3S1UA 3NPWA 2VEIA 1ZAHA 2OZ0A 4ZVJA 3WJXA 2JK2A 3SGUA 3W2LA 4R7JA 3W7QA 5TQLA 4MZYA 2VEMA 1U5JA 1K02A 1J2WA 3U6WA 2ABAA 1FCVA 4WOZA 4JR5A 4JN6A 2DORA 3PSVA 1SO6A 1G69A 2FB2A 2ZZ1A 3ABRA 4DF0A 5F1UA 2Q8ZA 1AL8A 1I2QA 3W70A 3YPIA 3GDRA 1JVNA 4KKXA 1TRDA 3O15A 5LNUA 1R30A 4O1CA 3NQFA 4DBDA 4LU0A 2ABBA 1ZJIA 2YW3A 4MZ8A 3TV8A 2C15A 2FB3A 1LP6A 4FNSA 4O12A 1FDJA 2X1TA 3ZFHA 3EB2A 3W7GA 3N3MA 4HN4A 1QOQA 1FDZA 4ADTA 5AN7A 3OBKA 4AHPA 3NQ6A 2QCFA 5DCBA 1OF8A 1IIGA 1TRIA 1DJNA 2RDTA 5CZ0A 4MYAA 3O63A 1EP3A 3DXIA 2E6YA 2V2DA 1I8JA 5EA9A 3A22A 5AYXA 2WOQA 2ZFAA 1WAUA 3S6DA 4NX0A 2Y85A 3Q37A 4DF2A 1P1XA 5I3KA 1UJPA 1G4PA 3TJXA 3MYOA 2QJIA 2YXGA 1G4EA 5IBXA 4LVFA 3TFXA 1YTKA 1F7BA 1SFJA 2YPIA 4QISA 3WK1A 2QJHA 4YCPA 3FLUA 2V2CA 1RPXA 5CKSA 3TH6A 4EVZA 3N34A 4NX5A 5I3JA 3FKKA 1VR6A 5CG7A 1NF0A 4DO4A 3QM3A 3P74A 4O28A 3HPXA 2Z0IA 2BLEA 3EXRA 4OE7A 3W22A 3S5OA 3W7PA 1SR9A 2J24A 3ATZA 3LCFA 4GJ1A 4UR8A 1OFRA 1RR2A 3PF3A 5KTLA 5LSMA 2ZRYA 3BGJA 3PB2A 3NXFA 1DL3A 4JYDA 5FEPA 1TPFA 3P82A 1FXPA 3CIXA 2QJGA 4IPJA 4A21A 5FF0A 3AJXA 4RLIA 5DCEA 3UWUA 3W1TA 2A7RA 2R91A 1VCFA 2YX0A 3SY5A 3WFAA 1TMHA 1T99A 3L5AA 1KM1A 5F1VA 4A3UA 4BWLA 3GLCA 3V75A 1LOSA 4LOCA 5CGQA 4GWEA 3QRHA 1A50A 2QUVA 4NU7A 4JD4A 3BG3A 2V5LA 4UUIA 3KAOA 1D3GA 3G3DA 4JTIA 2C1HA 4AEOA 4BI7A 3W84A 1B4KA 1OHLA 1W8SA 2YR1A 2KZHA 3PULA 3EWBX 3A21A 5J5DA 3L5MA 2V0TA 3TQ0A 4QM1A 3SECA 3N2MA 2A2IA 5F4XA 4S2BA 5EYWA 3GKFA 3O16A 3UD6A 2EGZA 3NGJA 3TK7A 3T55A 1SW7A 3CQ0A 1UASA 1OFAA 3G1AA 5HINA 1P0NA 2QUUA 1KM4A 1XC4A 3DKJA 5CPLA 5H2ZA 1TV8A 5AFDA 3OA3A 3UYCA 4O17A 1DORA 4K7YA 4CQ9A 4ONVA 1DHPA 4UR7A 3O6DA 2QR6A 1XFBA 4KWVA 1ICSA 4NXKA 4PCFA 4GUIA 4OGZA 2WO5A 4D2JA 2TYSA 4OWGA 1PIIA 4O19A 3W7DA 1EUAA 5D33A 1OFPA 4UIOA 2XN2A 2E6AA 3RLUA 2GQ9A 1RQHA 5HNRA 2CLKA 3W1PA 1XCFA 2BX7A 3LERA 4UTTC 3O8AA 4HNVA 3RU6A 3DFPA 3TR2A 2NX9A 1YDNA 4ZQPA 4O4WA 5G1YA 3HJZA 4CCCA 3THQA 1RQEA 3OVRA 3P8IA 3EEGA 3BW4A 3W1QA 2EAWA 3UWQA 2C14A 4Q33A 3PUOA 5HMSA 4M6VA 3W1LA 2NV1A 3NYZA 4GUJA 1C8VA 3I7QA 4EOUA 2DZUA 1HUVA 3PY2A 4TO8A 1UUOA 3T7VA 3G1SA 3IIPA 1ZNNA 1OABA 1G7UA 2YYUA 2B7PA 2GPTA 2VFHA 4MJZA 4OV9A 1PE1A 4UTMA 1ME9A 2A4AA 3QYQA 3RK8A 4DPPA 1EA0A 1ZCOA 4JNMA 4NNBA 3LOTA 2J9ZA 2B4GA 3HGOA 5CSRA 3K30A 5AC8A 3THAA 1QPNA 4IMGA 2NUWA 2Y88A 3R89A 4WY0F 3S1WA 1KM6A 1DV7A 2H6RA 3LGEA 4KFPA 3OG3A 4GBUA 4WXZA 2GOUA 4WJEA 4LY8A 1JUKA 4FEZA 2JGYA 5KSWA 1W3TA 3DH7A 1SZEA 2DZXA 5U7SA 3KRSA 5E93A 4WOQA 1XDLA 3DENA 5F2GA 4GFSA 1H7WA 3W74A 3M1ZA 1KM5A 5AHLA 3S42A 3M43A 3PWAA 4FNRA 2RDUA 2Y62A 4PEKA 5H91A 1L2UA 3MBFA 2WKJA 2NUXA 1V7YA 3GK0A 1F05A 3P80A 3FYOA 2TSYA 3P5YA 3P61A 5AOUA 1QPRA 4O0KA 5K9XA 5F2MA 4ZQOA 1NSJA 2DJXA 2DZVA 2RHGA 3TFCA 3W1RA 3DKLA 1HL2A 3I68A 2FFCA 4GE8A 3NZRA 3WJYA 2CLIA 3B03A 5LHEA 3LRMA 1EUNA 4LVBA 1YXDA 3HMJG 3NEVA 1MZHA 3QMSA 3GDTA 1J4EA 2F7FA 1TQJA 3P5ZA 3LI1A 1G7VA 5D38A 2CLEA 5E1QA 1WV2A 4B5NA 2B0MA 1ZAJA 2VELA 1LROA 1ZALA 5EY5A 3GNDA 2YFNA 1FCUA 1FWWA 1PHQA 4BR1A 2XFWA 4UC5A 3EX4A 5KITA 1G6CA 3TMQA 2ZA3A 3TE9A 4N9CA 4BF9A 2FPTA 2NX3A 4O1BA 6ALDA 4CLMA 4UTWC 3ZS4A 3BV4A 5K4XA 2IQTA 1S5WA 4CCEA 1AMKA 4M6PA 4MFDA 3QSRA 2ZA2A 2FPYA 4GUGA 4JICA 3BO9A 2QCLA 2CLOA 3QZEA 5BW6A 2ZZ6A 4IQLA 4NUWA 4X2RA 4NJJA 2FTPA 5AHIA 1SU5A 3M6YA 4I7VA 2P10A 1AW1A 1K7FA 3NNTA 4Q32A 3H54A 3SIZA 4OT7A 3NPVA 3M5VA 2D73A 3MUXA 5CZSA 1GEQA 1EP2A 2H3DA 3GAYA 1RV8A 3G24A 2Y61A 1XBZA 4TX9A 4FNTA 2JKAA 4EWND 3SJ3A 3O05A 3EXTA 1KW1A 4TMBA 1DQWA 1OFQA 1I2NA 5F2IA 3G22A 2VENA 4N9EA 3DI1A 4K8HA 3U2OA 4LVGA 4KWWA 3BK0A 4M6QA 1IXNA 1VGAA 3IIZA 5AHEA 4IXHA 4UTLA 2NWSA 4NNAA 4DXVA 4JX5A 1YTEA 4MPQA 1P0KA 3IGXA 4IMCA 3G18A 3LXCA 3A9IA 4P61A 3RFAA 1YTDA 1E51A 3GDLA 3DFTA 3QMRA 1JUEA 2AAMA 3NA8A 3W76A 4MJMA 3VNDA 2ZRXA 3W1NA 5G2WA 1WOAA 4O1AA 1TV5A 4FB7A 4Z08A 4RX0A 1GQNA 4UTJA 3LHTA 1WOBA 2O7QA 2OX1A 3OVQA 1GWJA 3FJ6A 4NQ1A 3TSDA 2V30A 4WQ6A 5HUPA 1W56A 1W5NA 2A5HA 4Z1CA 3M47A 3HG4A 2E09A 3WK3A 1MXSA 2CWNA 4RKAA 4PTNA 3MHFA 1UB3A 3NAVA 1SO3A 3MI3A 1MEHA 3RF9A 4CNNA 4NVTA 4GRSA 5DY2A 5BNKA 1Z48A 3B4UA 2X16A 2AGKA 3QW3A 2A7NA 2AQWA
chains in the Genus database with same CATH superfamily
2PF8A 3W7EA 5I5RA 4PMRA 3EWUA 1D9EA 1F73A 3LV5A 5K9DA 4HA1A 3W88A 4FLSA 4WX2A 1IGWA 2AL1A 2QCNA 4HZ6A 4Z2JA 5BRQA 1DXFA 3RAOA 3NQCA 2F2HA 1B9BA 4PULA 3FA5A 1GGOA 5DY3A 1EGVA 1UZ4A 2YL9A 2DUXA 1VJIA 4F66A 1U22A 1F6YA 2VX6A 2WHMA 1FWRA 3E74A 4CCZA 3SCWA 4POCA 2CZFA 3LXAA 3F1QA 3N12A 4KH2A 4B5SA 3QV6A 1HKJA 2GDUA 2ZUSA 2BHZA 4KCWA 3SCRA 4L4MA 1RK6A 4Q8OA 3CM4A 2ACUA 4HCLA 4M0XA 3WF1A 4RDZA 5HMFA 3PUDA 1GYNA 3EBVA 4AD1A 2RDWA 2G5WA 1MVYA 5FJUA 5I03A 3GH7A 3GS6A 3OLGA 4BI6A 2BY1A 3MT1A 5FF7A 2PRMA 2CKRA 1H50A 4KRUA 2Y24A 4WK9A 3W53A 2HROA 1FRBA 1N55A 1QU4A 4MYXA 3A4WA 1FWNA 4ATLA 3L9CA 3W7JA 3WY1A 1WKYA 4J4KA 3WCZA 3FV9A 3BLLA 4HTYA 4P5UA 3GO2A 2ODOA 3PZQA 3BW2A 1HVQA 5AKQA 3PG8A 4AB4A 3A24A 3GYEA 2ZVRA 4IUOA 4GFIA 3GU2A 5E0FA 1K8YA 4E0CA 3GVRA 4A05A 3WH9A 4WGHA 4RZ4A 5DBUA 5JMUA 1CWYA 1R3RA 4NJHA 3RJXA 5C8BB 2C0HA 2FZBA 2OXNA 3N4EA 2WCSA 3MSGA 1XUUA 1WPCA 3HMCA 5IM51 3AHTA 1VFOA 4E38A 4Z1AA 3WEOA 2PEVA 5AY7A 4L9YA 7REQA 4CVUA 1GVEA 2BGSA 2WMJA 2XM2A 1RY0A 3AIEA 5FJIA 2VOTA 4UTKA 1VYSX 3WJSA 2DIJA 1VAHA 2CZVA 4Z0JA 1QR7A 2UZ9A 3GG8A 5KINA 4WKFA 2OZ3A 3P6LA 7A3HA 5IFTA 1YX1A 4D6IA 5CPMA 2R14A 1W5QA 4JTQA 3OB8A 3NO1A 1E70M 4MB1A 2OCZA 4XD6A 3OLEA 2LLEA 2DUZA 1AMYA 3TDFA 3TUUA 1KFBA 2QHAA 3FKRA 1TA3A 2Y7DA 3QR1A 2FHCA 1W3LA 4LYPA 4DWSC 2VOMA 2J6XA 3UJSA 5K4ZA 3B8VA 1LT7A 4ZE4A 1EDTA 1S3HA 3F2DA 4UFKA 3LX9A 3W29A 1JPKA 1RUSA 2H8ZA 4M82A 2INZA 5CBJA 1HW6A 3GR7A 7REQB 3HOJA 1XYCA 4HYRA 3CHEA 4JX4A 3HO8A 4U10A 4PUKA 3B3DA 3MUAA 9XIMA 3MBDA 4FLRA 2YCIX 3LHZA 3TTQA 3DGBA 1VFHA 5FEZA 3KTCA 1TJ1A 3VGBA 2A3LA 3M0XA 2VTFA 4FNPA 4LXFA 3FK4A 3NG3A 2PRLA 3CUJA 5E5CA 3UU0A 5D04C 1OADA 1KBKA 1PCWA 4HSOA 3GR8A 2GJLA 4JTAA 4LGXA 2PDKA 3T0CA 3TCEA 1FX6A 4LT9A 3ZT6A 3DIPA 2DT0A 4OQVA 2Q6ZA 2E1WA 1M5WA 1ME7A 2BBFA 3CV7A 3DZ1A 3GDKA 4YJ5A 4XD3A 3LG3A 3W75A 2X1RA 3C86A 1PV8A 4AY8A 4K1WA 1FWHC 1LQAA 4XV0A 4HPXA 4YTQA 3WEMA 1TVLA 4GXPA 2VR2A 4W93A 4Q4SA 1H62A 2W9MA 4JIRA 3HGRA 4C6EA 1ICQA 1VEMA 3PJTA 1XPYA 1Z69A 4YU1A 1JCNA 3PVFA 1OT1A 3WLPA 2BGQA 2CIPA 4GBDA 5EBUA 4US5D 3R10A 1Q66A 1E9LA 5A8NA 4RV3A 3LI0A 3AHZA 1BQGA 5BXPA 2J7BA 4QTGA 3OGRA 3UF9A 4X9SA 3SUVA 2QJNA 3VDAA 3ZWSA 1V3IA 3N9KA 4ERGA 4WDTA 3W00A 1LT8A 3RCNA 5DT7A 3GHTA 4ZQMA 1DBTA 1MNSA 1QI2A 1R2TA 5I3IA 4X63A 2WMGA 4BF7A 4AD2A 1RALA 3FIGA 2WLYA 4GC4A 1LG1A 3W7HA 2W5FA 3SAZA 1GVRA 1UA7A 4S3EA 1T40A 4ZQCA 4DI8A 1KWKA 3G1DA 4C91A 4LUSA 3M46A 1W5PA 1S2WA 5IXEA 2VFGA 1CNVA 1X6NA 4ZSUA 2YCKX 4XISA 4C1KA 3IGUA 1LTDA 1YPIA 1MDRA 2XVGA 5EMUA 2VGGA 2ZZ3A 3L12A 2XIIA 1XUZA 3LCHA 4WD0A 1FQ0A 4TVCA 4FF7A 3WX7A 3S3GA 1CGWA 1NQKA 1TPDA 4J3XA 3CZLA 5HJLA 1H3GA 3AZRA 2ZADA 3FJNA 2WNQA 3FSTA 1TTIA 3N2TA 5LXXA 4Q8PA 4YIWA 2OGYA 1TUXA 1JI1A 3G1VA 4HP5A 4AZCB 2Z1BA 3LK6A 2NVCA 4EKJA 2NUYA 2XVKA 1NFPA 1Q7ZA 1EGMA 3CNYA 1LYXA 1RLDA 1B0IA 4NZ1A 2QVHA 4GZEA 2OJPA 1XHGA 3S0CA 5EKYA 2HRWA 1XGZA 4N6FA 3NZGA 2IQ0A 4LUSB 3FJLA 1H1YA 2VDHA 3DG6A 4JBRA 1OYBA 1WKEA 3BG5A 3U5YA 2GK1A 3OIXA 3WLOA 5H6HA 5KZMA 1M68A 2YDRA 2V68A 2D23A 2D2JA 3DYMA 1KFKA 4H9MA 1XP3A 2UY4A 1UIPA 3FDGA 4YVPA 3WBXA 4MNMA 2WSYA 2IKHA 2DGAA 3DDMA 1EX1A 4ZOEA 2EPHA 4IGMA 3K8KA 2FPVA 1FWGC 3CXOA 3UZWA 3QC0A 4OTKA 5D9OA 4Z2IA 5ABEA 1GOKA 4R3UA 2NXIA 1RY8A 3NURA 4HOXA 2OSWA 4BHYA 2OELA 4JDYA 3FAXA 1C9DA 1XLBA 4GYFA 4J5NA 4ZL1A 1W3NA 1X6UA 4E8CA 3UETA 1GOIA 3KCJA 3AU6A 1D8WA 4RE2A 3GZ3A 3KLKA 3F03K 1HVXA 2W62A 3UR2A 2X1SA 5HQMA 2JQXA 1W9PA 1HP4A 2YCLB 4IX0A 4NRRA 4AZ7A 1XH2A 3AS2A 2E1DA 2Z4GA 1LRQA 5ABHA 2J4GA 1JGIA 4UZUA 2D2GA 4A2RA 1U1UA 2F6KA 3C61A 3LZ5A 2ZX6A 4H9ZA 1O5KA 2FIQA 3V3WA 4DNMA 2VHLA 2WZEA 3WUEA 4M8UA 1O12A 3N9SA 1EJRC 2WKGA 3VFCA 1HTIA 2HWGA 3DHFA 5CZJA 3RNDA 3ES7A 3EB3A 1KFLA 2OT0A 2WC3A 1JCXA 3FNDA 4LEFA 2CPUA 3TC3A 5CPQA 3VKAA 5TNVA 3SIMA 1U33A 2P76A 1I4NA 7TIMA 1KC7A 4GVHA 1SZRA 2VC5A 3V18A 1Q45A 4DAIA 3EDKA 5FJJA 1H63A 2GVLA 2QDDA 6TAAA 4AD5A 4I5RA 1D3HA 4HCDA 2P8CA 2YZRA 3S2NA 4HU0A 3S5SA 5G5IA 2V6AA 3H53A 1XDMA 3FSUA 1V0LA 3W26A 3W2JA 3LRLA 3SQSA 4NILA 1IYXA 4M56A 4R5EA 2GDQA 1XLKA 1QWGA 2PC4A 1JDFA 2PFHA 1EB3A 4LYKA 2FVMA 2OOFA 3W2MA 5BOOA 4W87A 4CCDA 1PYFA 4I9JA 1LBLA 1CXHA 3W1AA 5CPNA 4H9YA 4DUXA 4L6DA 2WNNA 1O4UA 1KFJA 3INPA 5LIYX 4LH8A 2JKEA 1E6SM 1UWSA 2OZ8A 4WEVX 1PEZA 2PUZA 3QHOA 1HGYA 4GC3A 4J40A 2WYSA 2HSAA 4OOUA 2W61A 4JS3A 1PZ1A 1QO5A 3SY8A 1W3JA 4IJRA 5FA5A 1K8ZA 3S83A 3SGZA 2F61A 4NI8A 1X39A 4O8RA 2NQHA 4TX8A 2AMXA 2VEFA 3GY1A 1HJQA 3VZYA 3URBA 4NAFA 1PX4A 2QAPA 1GVYA 3LU2A 4LF1A 4ZGYA 1MMFA 4ZENA 1SZGA 4GUHA 1OFOA 3SURA 3UPMA 1E55A 5K9CA 4G1KA 2W0UA 3IS4A 3QF0A 4ADSA 1DJZA 5D2YA 3L0KA 1PO9A 2ZQ0A 4QE5A 1QAPA 4C6NA 4XX6A 1ALDA 4DEFA 1BAGA 3WBEA 1HZYA 4HPHA 4AWEA 3GNXA 2J27A 1XL9A 1ZHAA 3N13A 5D03A 2VGBA 1IHIA 4D8LA 1KRCC 4HIBA 4HOWA 4NZJA 4LFYA 4UNKA 1SW3A 3XINA 3EPNA 1O5RA 4JQ1A 2WSQA 4P8WA 1OK6A 1DYSA 4IIFA 2IKJA 3QC3A 1ODZA 4JTEA 1C8YA 3SFKA 5SWUA 4YHEA 3H2MA 1A5NC 1J6OA 1DVJA 2WV8A 3DHPA 4GKTA 2Z00A 2VYOA 1WQ5A 1UR4A 1OINA 4WDWA 4L4OA 2A3HA 4H8HA 1HP5A 1TPC1 1ZCCA 2BNJA 2PDBA 3A9BA 4RV8A 2PU0A 2DZSA 2E9MA 2GLKA 3CWOX 4UMBA 4UOZA 4UTUA 3NQVA 4IX2A 2V81A 3KP1A 4MM1A 5D30A 4F2UA 5G2HA 3RM9A 2J66A 2R9RA 4H2CA 2VKZG 4O14A 1O66A 1UUMA 1IXOA 2PWUA 3ABZA 3H2OA 3NPXA 2YKKA 3TSBA 3Q4DA 2G95A 4GH3A 3M5XA 4LYQA 5KEZA 1G67A 3BUVA 4FX6M 3MI2A 2EG8A 2NT0A 4JL1A 2J9YA 4MWAE 2Z1KA 3T1GA 1SFLA 4KIEA 1J9YA 1CW2A 1HKVA 2X41A 4E4PA 2G3FA 1F9CA 3EKZA 3L2IA 2ZRZA 3T78A 3EAUA 2G3IA 3CEUA 5M2FX 3UXAA 2X1IA 2Q8LA 2IKIA 3AXMA 2CKSA 3VA8A 5EMYA 4ZZ9A 3M0IA 4DB7A 3GXFA 2CLHA 3DYOA 5DMNA 4WDXA 1P0EA 2A7PA 2VC6A 4K38A 4EP8C 1XIHA 3PFRA 4PTXA 1EYWA 3C52A 4EPKA 3I3EA 1FDYA 3FGCA 1V6YA 1XIIA 4HNOA 3E0FA 2Y7GA 1L8PA 2XZ9A 1SJDA 2PCEA 5FL0A 2GVGA 1AZ2A 3KCOA 3S2CA 1M1BA 4XKYA 4DZHA 3A3WA 2MUCA 4JXCA 3II1A 3TSMA 1SYTA 4Z2KA 4CU7A 2CHRA 5C9WA 5D32A 2ZXDA 3MZNA 3NO5A 2C7FA 5CJMA 3F4NA 1RZMA 2C13A 3VGFA 4AX6A 3OYZA 1PAMA 3OW1A 4X22A 4RXGA 1PZ2A 1RAKA 1LWHA 5F4SA 2GZXA 3M7WA 1D7KA 3NQBA 4EAYA 3M0VA 5C9UA 3VFLA 3VE9A 5HPCA 4S39A 3MI6A 1MXGA 4NZ5A 3DESA 4LRTA 4BWLC 3OVGA 1UOKA 3SM0A 1JYWA 1EX5A 5G2IA 3B8WA 3VIPA 4QAIA 3GC2A 4E2BA 3W7CA 1ITCA 3U48A 1KLYA 5JH1A 3BOLA 4GZJA 2UY5A 1LRNA 3TA9A 2QCHA 1BSIA 3FGCB 4F9DA 5AYIA 3G8EA 2HCVA 2DZTA 4P7RA 3LCXA 1TCMA 4G9PA 1JQXA 3SSJA 2FZDA 4TXEA 5KETA 4H9XA 1T6MA 3HF3A 4XKYB 1FWEC 5DRIA 4QIUA 3TEVA 2DSKA 3E0LA 2OO0A 2VZSA 2VT0A 3VOCA 3HV9A 2WSRA 1UC4A 5F7UA 3B8TA 2ZX5A 4C6FA 3IJDA 3MA8A 3ITOA 5MKGA 2J13A 4ORMA 3W82A 2HVMA 3ZSSA 3HURA 1QHOA 2XH2A 4FA3A 4QXIA 4UQDA 4GOAA 4AIEA 1QMLA 1DJHA 2OWXA 4J2PA 4HHHA 2XN0A 4LUYA 2WJFA 1UUQA 3IJLA 1E6ZA 4M80A 3V5CA 1O7AA 3WH7A 1M65A 1EIXA 1KWGA 5I77A 2CZ5A 4JQ3A 1VCVA 2BOFX 1EWEA 3CC1A 3SRHA 1P6BA 3RPTA 2EKCA 3CZKA 4LAZA 3MKVA 3WH5A 3W7OA 2QLYA 5CSYA 4K68A 4DWSA 1EXBA 3IAPA 4RUBA 5AHMA 1ZGDA 4E2OA 4IFRA 1FXQA 5D2XA 2V5CA 1LORA 1RP9A 1O94A 2I5QA 3RUBL 3G1YA 2VD9A 1YXCA 3VK5A 4J28A 1RQBA 3LV6A 3CMJA 1XLLA 3BAWA 4LS1A 3M0JA 1XYLA 3DFNA 3TZNA 1RCXB 3GSMA 3T05A 4JQ4A 2ZKMX 3S2LA 2XDFA 1LUCA 3CK5A 1EO7A 3NR0A 1CGXA 3CPGA 3CT7A 3UJFA 1E1CB 4WSKA 3O6CA 2P1FA 3W86A 1VHCA 4AZIA 1UD5A 4GJIA 4GJJA 5HQEA 3F2BA 2AKZA 3NPWA 3PTKA 1ELSA 4ZSTA 1UKTA 2R1MA 1HX0A 2GSHA 3ZJ6A 4HA0A 1DIKA 3SGUA 5EBAA 1XICA 3W7QA 5TQLA 2VEMA 1U5JA 1K02A 3SCPA 1RJPA 3SRDA 3U6WA 5CC3A 2ABAA 1FCVA 4WOZA 2DORA 3WNKA 1G69A 4INFA 2ZZ1A 3ABRA 5F1UA 1AL8A 2OYLA 4DWSB 3BZJA 1MW1A 4YVVA 4JOMA 3GDRA 4QEHA 1R30A 3SDOA 3FVDA 2YW3A 3LUTA 1VRXA 1LP6A 1EJVC 1TG7A 1FDJA 4BF5A 4HN4A 4J3TA 5EMMA 3DUGA 1FDZA 4ADTA 4AHPA 3NQ6A 3K8MA 2C79A 2BB0A 3O63A 4N7QA 4OZOA 2I57A 3WNNA 4EE9A 1S2VA 3MMWA 4FR6A 4X0VA 5I3KA 4BQ4A 2EJ1A 3BCJA 4Y9MA 1G4PA 2DVXA 3MYOA 2QJIA 1Q5MA 4NRSA 5DT5A 2V67A 5M5DA 2BG5A 1F7BA 5AZ1A 1UYQA 4GGBA 4UTFA 1P6WA 4H7ZA 3S2MA 4YCPA 4JIHA 1NDVA 1DTUA 1C93A 3GE7A 3FVMA 3ZMRA 3FKKA 1VR6A 2W3ZA 4D6EA 2QJMA 2BVWA 1PZ3A 4O28A 3HPXA 1TKKA 3GIQA 2JF6A 1XYZA 4W7UA 4H9UA 4WJ8A 4OE7A 3ARPA 3UWEA 4AZHA 3ATZA 3H2EA 4MADA 4AU0A 1R38A 2REQA 3BE7A 1OFRA 1B31A 4DN1A 2I17A 1WO2A 1S46A 2ZUWA 3CIXA 2QJGA 1XIBA 3GIPA 4A21A 4J3WA 3WFAA 4JL2A 2E7FA 2EPOA 3MDWA 2HBVA 3AYRA 1ECEA 5CJ5A 3KAOA 2EEXA 3FHAA 4GVIA 2C1HA 4DHGA 2QT3A 4XZWA 4OKDA 2YR1A 3PULA 1CCWB 3RXZA 1NQ6A 2J7DA 1OZQA 4QG8A 2V0TA 4QM1A 5F4XA 4S2BA 3HPAA 4KF1A 3UD6A 3GYCA 3C8NA 1PKYA 1XIMA 1JAKA 4NKCA 3AIRA 1XYAA 4QDMA 3E2RA 1OFAA 3R8HA 3LMYA 1L6FA 2NQZA 5BOFA 3DKJA 3OZPA 5A8QA 4W88A 1YNPA 1UD6A 4A3YA 1ZS2A 4L64A 1DQUA 2REQB 3C5QA 4I9MA 5A6BA 2SFPA 2QV4A 1P0DA 3WMSA 2QR6A 1XFBA 1ICSA 4NXKA 1KR1A 3CMFA 6PTDA 4D2JA 4OWGA 3ICJA 3O6AA 4O19A 3W7DA 1EF3A 3BLPX 3GH5A 4ACYA 2E6AA 5BCAA 1UQYA 3PTDA 4R27A 2GQ9A 3KOXA 1RLCL 1YDNA 1EJWC 1CEOA 1AQHA 3VMPA 4JCMA 1YE4A 1TMLA 1RQEA 3THQA 3P8IA 3EEGA 3BW4A 3UWQA 4GIAA 4US6A 1JFHA 3VO0A 3PNUA 4GUJA 4W8AA 3I7QA 4TV5A 4EOUA 1DXIA 2V5KA 5HK4A 1OC7A 1CDGA 3CYVA 3PY2A 1IT8A 4TO8A 3CJPA 1XG4A 1OABA 3COTA 1G7UA 4R88A 5ECUA 3WQPA 3BJSA 4UTMA 4JPGA 3QYQA 1YRRA 3WDIA 1EA0A 2J25A 3WN6A 3JZUA 1U5HA 3K30A 4U33A 3THAA 4IMGA 3R89A 1MZRA 1REQB 1C8XA 5HDRA 4GBUA 3MPGA 4WXZA 2YDSA 2XHYA 3E0VA 6REQB 4FEZA 1W3TA 5I3DA 3WLLA 1JZ3A 2DZXA 3QY7A 5DO8A 1VFSA 5U7SA 7CGTA 3KRSA 2VGFA 1MUCA 3T6CA 3DENA 2IPWA 3K4AA 5C2GA 3S42A 3MV11 5CGTA 4C6JA 2RDUA 3KOZA 1KBLA 3MBFA 3ZIZA 2I56A 2WKJA 4IISA 1JF5A 1F05A 5IFPA 1ISVA 2QNEA 2YZ5A 4IIHA 3CUZA 4UB9A 1NSJA 2DJXA 3TFCA 3VD5A 1KFWA 4XO7A 1A80A 1E9IA 2FFCA 4S3DA 4F0MA 3NZRA 3WJYA 1GQJA 1B9ZA 2WJEA 5LHEA 3LRMA 3C0QA 3ERPA 2I16A 3DHUA 3GNOA 4PBFA 1RA0A 3HMJG 3GTHA 1HKKA 3AMDA 3QFWA 2AAAA 3U57A 3WIJA 4CVWA 5JXQA 3P5ZA 2X8RA 1P48A 2BVDA 4B5NA 1MYRA 2VCAA 2VELA 4C6KA 2GVYA 4GZ7A 1HXJA 1ZJAA 3OU8A 1FWWA 4WKHA 3LD5A 2ZUNA 2XFWA 4UC5A 2GJXB 3NWRA 5KITA 4IFOA 3L4XA 3TMQA 3KL3A 2ZA3A 4ZFCA 2DFAA 1MW0A 4BF9A 2PDNA 4OIFA 3ONBA 4UR9A 3BURA 3PHAA 3BV4A 2EBNA 4F0KA 2EJAA 3L4YA 4M1RA 4B16A 1UH4A 5K4XA 1V08A 5HNNA 3NUKA 1AMKA 1DWAM 2ZA2A 4JICA 1BWVA 2GWGA 1C3FA 1QUMA 4XAYA 4DJFA 5BW6A 1O1ZA 2FMOA 4IQLA 4NJJA 2FTPA 3A4JA 1QNOA 4H8UA 3NNTA 4Q32A 4Y7EA 3ZXWA 1CECA 3M5VA 3K2GA 5XINA 2Y61A 2BVTA 1XBZA 2EQDA 4FNTA 4KWSA 2WZMA 1QRQA 1EH9A 3UFYA 4CQDA 1C9WA 5F2IA 2QIIA 3G22A 4N9EA 3PJUA 4KWWA 5BYWA 1TV3A 3UR5A 3WLRA 3QKEA 1UP3A 3AMCA 4UTLA 4B3ZA 3EMCA 3WQWA 3T81A 2C8NA 4MPQA 1P0KA 1UR0A 3IGXA 2WAGA 3LXCA 4I6VA 3RO6A 5I2UA 2Z2AA 3N11A 4ENLA 4S3AA 2YBUA 3BZGA 3DFTA 4NZ4A 1C90A 1GJWA 1E6RA 1JUEA 3NA8A 2PDLA 3W1NA 2GUYA 5G2WA 1WOAA 4IPLA 1KCXA 3P0WA 4Z08A 1JFXA 2DV0A 3WQEA 4EACA 1GQNA 2OEJA 3LHTA 1WOBA 2O7QA 5LIXX 4GZIA 4RNFA 1S5NA 2HE8A 4WQ6A 5HUPA 2VI0A 3SY1A 2X2YA 2AQOA 1H0GA 1J0ZA 2J74A 1E73M 3IARA 4RKAA 4PTNA 4IGNA 3E2VA 3Q67A 3UVAA 4CNNA 4NVTA 2X16A 3ZT7A 1E6PA 2XSAA 1VFLA 4ASTA 4PL2A 1EFZA 1V6XA 2X1UA 3W4RA 1NEYA 1GKQA 3CL8A 3SRKA 2ZDSA 2ZZ4A 3BC9A 3WQ6A 4AXNA 4AW7A 4ATWA 1EJXC 2JBMA 4JQAA 1XGEA 5C7HA 3OBAA 3AYVA 1US2A 4FHAA 1XRSA 3QLDA 2QULA 2V3DA 2CC0A 1N8IA 3G6MA 1QBBA 3RG6A 3TW7A 3VNMA 4P8XA 4B91A 5DRCA 2WVUA 4A8NA 3GKAA 4ERIA 4FX8A 5F4WA 4ZTXA 1AL7A 4H4IA 4Z1BA 1KM2A 5BMWA 1HQTA 3SUTA 1NELA 2V9DA 3BJTA 3EPOA 4LTSA 4DF1A 3WLJA 2YFOA 4IP5A 4KQNA 3GUGA 3R25A 4RXFA 1SSDA 1T5AA 4L1XA 1Z42A 1S2AA 2X30A 3GVWA 1ME8A 3QTGA 1B54A 3IRDA 5AC7A 2VURA 3LTYA 2Z1SA 2QCGA 5JBFA 1Z32X 1BVWA 3UGRA 1G0CA 2AGTA 1M7OA 3P62A 2Y89A 1MRAA 1RVGA 3IWPA 6ENLA 1W0MA 4PYSA 1GZGA 9RUBA 3Q65A 2QCEA 1E15A 2ZOXA 4PMOA 1FVPA 2WJZA 4R7OA 1PCKA 1KCZA 1XLIA 4TU1A 3K13A 3ME3A 3N2OA 3BG9A 5I06A 3TW6A 4M3PA 5A1AA 3NQ8A 1BKSA 4XIAA 2Y63A 3FYPA 5E0KA 5T8GA 1IWPA 2O56A 1UKSA 4E4UA 2ZUTA 3EZ4A 1UP0A 4HHPA 1N8FA 3O1NA 2XIJA 3LM3A 4XG1A 2OZTA 4DELA 2NXHA 3TTOA 1A3XA 3TTSA 3WQCA 4LCQA 4AIBA 2YW4A 2D0FA 1O1HA 2NV2A 3CB8A 3MB9A 2OLHA 3NPUA 3U8GA 3AYTA 2D3NA 3UZJA 2ISVA 3LHVA 3N73A 3UESA 2XINA 3V16A 1TZZA 3FXGA 4PA8A 4I9TA 4GYPC 4CNSA 3LA4A 4MLJA 3SR7A 4N6EA 3P81A 4RDVA 5CZKA 1S5MA 3BWWA 1TPWA 3B0PA 4WDUA 4AY1A 1RCOB 4EIVA 3XISA 4G8TA 4HKPA 3MHUA 2CLPA 1LJYA 2X40A 1W3IA 1AA1B 3F2CA 5DANA 4MUPA 5I7GA 1R3YA 1MEIA 1CGUA 5AC6A 2VWSA 3NQMA 2PLJA 2HXUA 1MW3A 1MQRA 1GT8A 3HG2A 2Z25A 4AZGA 1HJWA 3NZPA 3DC8A 3PPHA 2PD5A 3FEQA 3BANA 1FBAA 1TVPA 4NXSA 4CU8A 3KUMA 2J6VA 1BYDA 3HG5A 2HEJA 4U4MA 3AISA 2JEPA 1NDWA 2DZPA 2WBGA 1KXVA 3RR1A 4IIGA 1E71M 4RE3A 4PB4A 1C29A 1UA3A 3CV1A 1ZBCA 1ADSA 2QMKA 3AIWA 5PTDA 4JEJA 1X6LA 5BZAA 1YMYA 5CPOA 3F7JA 1MFUA 1OJXA 1LLWA 2P53A 4PRTA 2XUCA 2Y8KA 3PUEA 4G56A 1X1NA 1XG3A 1QPQA 1EC7A 2JFEX 4NY2A 4MAZA 1C7TA 3OO2A 3NQGA 2PTWA 3W23A 1Q85A 1W6TA 4CD7A 4DPQA 5GPRA 3TA6A 1XLCA 1I45A 2ALDA 4ZCWA 3FAWA 3STGA 2A0NA 3AXHA 2EF9A 4A3QA 4Q4QA 1F4AA 3LEPA 5J04A 3GXPA 1JGMA 4RZ6A 2XISA 3WG6A 2YBTA 3CEPA 4PCTA 2Z7GA 2A6LA 3NIYA 5JIWA 4AXKA 4V1YA 1TVNA 1LG2A 3LPGA 3H23A 1W1VA 3N2CA 1GVIA 4ZO6A 1E4IA 3QPZA 1KNWA 3ARQA 4N9DA 3XIMA 1NVMA 1XIDA 1DHKA 1JZ8A 5K3VA 4DBUA 2HBXA 3T09A 2YA2A 1EPXA 1U1JA 4IHCA 4JTGA 4W7VA 2V8ZA 1BF2A 1HFBA 1G5AA 4IFKB 4OV4A 3TKFA 1UC5A 3NOEA 4WCJA 3L68A 4L80A 3W2KA 2HVNA 1F76A 3C0LA 4FPSA 4FAMA 5E6ZA 3H26A 4CEUC 5CJNA 2W91A 4MNJA 1QOXA 4MFEA 4Y9AA 8XIMA 4LV9A 3USZA 3H4XA 4IIDA 1LDCA 1YXYA 3IJ8A 3AMLA 1E72M 5L6UA 3B0XA 2CFFA 3UNDA 2EHHA 4UQCA 2R1LA 3FN9A 1MUMA 1H0IA 2BMBA 8TIMA 2XH7A 3KBJA 2DT2A 5LA0A 1TPUA 2PBGA 1I1WA 3P93A 5JVLA 5FJTA 1L6WA 4L6OA 1NOUA 4QJ5B 4FXFA 3WFZA 1W9BM 2WVVA 2H90A 2WPBA 3BGAA 1NF7A 2CLFA 4JTRA 3W7KA 3LTPA 4AWSA 3LCLA 4DBSA 4FO4A 3OZYA 4G7FA 3S5NA 2ZE3A 4HK6A 1Q6LA 1ZLPA 2DZWA 1RHCA 5E9AA 2Z6IA 3WH6A 4B5TA 4LW7A 1E56A 3T2OA 1PWLA 3CHDA 5D9PA 4EK7A 4H8NA 1EC8A 3OVPA 3LLFA 2WZHA 3WNMA 4FX7A 4IMAA 5HUOA 3L5LA 3EX1A 4KPLA 3BCFA 1A5SA 4KEVA 4EF9A 4D1JA 5A6TC 3M0MA 2VJXA 1VP5A 4E8DA 4KCUA 3ZLGA 3I6RA 4AD3A 1D2KA 4XKMA 1M53A 4QS6A 3NL5A 4FF5A 2OMAA 4XVDA 3TOPA 4TVDA 4K3ZA 3EWYA 4D6HA 2HK1A 2VO5A 4B9YA 1FUYA 4RZ5A 5HMDA 1SSGA 4RW3A 2D20A 3RO8A 5U4NA 1G01A 2CEQA 2WVVB 2ZRWA 4LS2A 2BOEX 3ECQA 5H8PA 3T0AA 1UZ1A 1H49A 2O9TA 2J9XA 3TJLA 3EPMA 2PLCA 3RX2A 2VEKA 1RK5A 4O10A 4WHBA 2R1KA 1KFEA 3LCIA 1V03A 4GO8A 1H61A 3IPWA 3RIKA 1RD5A 3KOYA 3E02A 1V93A 5CSSA 4KWOA 3F4DA 3H4GA 3TWBA 1R3VA 4JYFA 2NQ9A 4ZR8A 3A64A 1TTQA 3CUHA 3P67A 4JTSA 5D2VA 3UGVA 3PR2A 1F07A 1MXDA 2GJRA 3I4KA 4ADUA 3WEZA 5FJRA 1XRFA 4V33A 3W01A 3GDBA 1QVBA 3AUOA 2VD8A 3OZMA 5AECA 1OX4A 1BXNA 3AS3A 2UY3A 2A3EA 3TYDA 1H1NA 2ZUUA 3CU2A 3W6LA 4L9ZA 1W9UA 3MWCA 1MWOA 4JDBA 2HS6A 2VWTA 2OOGA 1AD1A 1ONXA 5E6YA 2WJDA 1IXPA 3LGGA 1PUDA 1JDDA 3H2FA 3M44A 5FEWA 4ATDA 4O4VA 1OWQA 4UQ9A 5FIPA 3H2CA 4UMCA 4J9JA 1ZL1A 3VC6A 1I0BA 1H1ZA 3WF4A 3KRUA 4LUTA 3WLKX 5JUVA 1EGZA 3A13A 1VYPX 4V1XA 1SVDA 3WQ8A 4BEQA 5TBOA 4LCRA 1J11A 1J5TA 2NQLA 2VFFA 3C2VA 4WIWA 1HJUA 4NF7A 5I3FA 1ISZA 4NJIA 3VUSA 2D1ZA 2DVUA 3QVQA 1E6XM 4PC8A 5LIUX 3CH9A 1E0XA 4O50A 4LCSA 1SFTA 4U2YA 2HMCA 3AWNA 1FWIC 4J3UA 1JYVA 1XW8A 4GINA 4TX6A 5BOEA 1ONRA 1J18A 2ISSA 1YYAA 3NCOA 1A5OC 1TSIA 4I9AA 2QDEA 1VBGA 1IXQA 1ISXA 3EOUA 5I3GA 2WLZA 2I9EA 4MOZA 1YW1A 3FYYA 3GW3A 2YCJA 3LTSA 3VIOA 3O06A 4AVOA 3LCGA 3CWNA 4LUIA 1FHLA 4W9TA 3VNJA 3UZZA 2OLAA 4NP7A 3LM7A 2DPEA 2QKFA 5A8GA 2G96A 5IHSA 1JEZA 2GUBA 2ICSA 1OYCA 3VGEA 3CAKA 1EPVA 3PUGA 1V8EA 4C1LA 1K6AA 1KTCA 2F6UA 3V35A 5J5RA 4QQ3A 2W92A 4WUIA 2DQWA 2DJLA 3WO8A 1LL4A 1GG1A 1P1MA 4ORIA 3VOGA 2XIQA 1OFDA 4N4QA 1X7FA 2ZRVA 3UXKA 1GPWA 3VTRA 5TD4A 5GNXA 3DU0A 1KGWA 1XS2A 2VZOA 5HWMA 3GIYA 1V5XA 1NWUA 2MANA 2Z1VA 3L67A 4DLMA 5I3HA 1GQIA 3DFHA 1GQKA 4QSHA 2EG7A 3SUSA 3UZYA 4UFLA 3TZFA 4FOJA 4C90A 4PFMA 4WGXA 1PVNA 1EF2A 1TREA 2DIEA 2Q3OA 3CO4A 3R12A 4IH3A 4GY7A 4B5VA 3DBPA 4LPCA 4KESA 2A1YA 1KBBA 4ZOAA 1NWRA 3PBMA 3PBYA 1IE7C 4XAZA 2V38A 1AD4A 1E0WA 2JF7A 3VNKA 4D1IA 4HNCA 1W9XA 4UFJA 4C1NA 3O2LA 5A6AA 3IK2A 4BKNA 1A5AA 5CEWA 3KBNA 4QEEA 2OYMA 2VRJA 1A5BA 1W17A 1GCYA 3BMVA 2VCCA 1GG0A 3EYPA 4EF8A 4ZB0A 2EPLX 1VRDA 2OR2A 4AX7A 3TNOA 4GQRA 4GA8A 4UNLA 1AK5A 3ATYA 3PZOA 3JS3A 2HISA 5HWJA 3OTRA 1ZZMA 1T7LA 3CGTA 3TYEA 3OQ8A 3R1ZA 4ACZB 4Z2LA 2E3ZA 3WLTA 3LBMA 3LMZA 2J47A 3TIMA 3B9NA 2VVSA 4HZMA 3G1FA 3H7VA 3S9ZA 3ANYA 2Y5SA 1EA9C 3NL2A 2BXYA 3NSXA 4I7WA 1KLZA 1L0PA 1B3XA 1OGBA 1J0IA 5I02A 1U83A 4B4FA 1OD8A 4L1GA 1NWTA 3C2RA 4L56A 3VIHA 2NX1A 5FACA 5LZLA 4H6EA 4Q6XA 3PSWA 5BU6A 3GC5A 4S2CA 4YVXA 1UW9A 3SI9A 4LWWA 1TO3A 2RDXA 2KX9A 4Y9PA 3U0HA 1UPPA 4K2SA 1A0EA 2B31A 1KXQA 1N2VA 4ZO8A 1VH7A 3R7MA 3GTFA 4EPEC 4IPNB 5E70A 3NGFA 1J0KA 1D8CA 3MO7A 5CAHA 2AL2A 1S5VA 4MY8A 2VXNA 1V0MA 3NM3A 2FLIA 1VD6A 5G1TA 1JCTA 4QR6A 4CEXC 4DQWA 1R46A 4MB5A 7ODCA 4ZB2A 1TR1A 1Z41A 3UCCA 4DAFA 4FIRA 5A6KA 4IM4A 4HB7A 2V3FA 1TPB1 1QDSA 3VE7A 4RJEA 3CZJA 2YCEA 2EPMX 4PB5A 2ADAA 2RFGA 1KR0A 5E9XA 6TIMA 2Z1XA 2GGEA 3A5FA 4ZQRA 3MJMA 1V0KA 3VC5A 3E1F1 4FIQA 1HG3A 3DFSA 4K6AA 3G1XA 4QHRA 1QXLA 2HTMA 3GU1A 3R0UA 3TQKA 3MUY1 1C92A 2BP1A 3WDHA 4A35A 1F8IA 1HKIA 3ANUA 1PL9A 4PN2A 1DIOA 2NSOA 3KVLA 1P6CA 3UY7A 1EDQA 1Q6CA 2OWCA 3V7PA 4HMCA 3W1MA 4US5A 1CTNA 1VLWA 2AL2B 5CCZA 4AAJA 4UMAA 3VYLA 4NIRA 1Y7VA 2CBJA 1I9CB 5MF5A 2YXXA 4JFWA 4LC8A 2ZIDA 2CWXA 4NL1A 1WDSA 3TW9A 3VIMA 2W63A 3O6YX 3MP5A 1SW0A 4J35A 2J7FA 1J0HA 2W67A 1N8WA 3BAXA 2PP1A 4KIRA 1B2YA 3UJ2A 1SJCA 1VPXA 4GI9A 3N15A 4GACA 1R9ZA 2DH2A 2Q09A 4DUWA 5HBFA 1FH7A 1WE5A 1F3WA 4C6CA 1W3HA 3MWAA 2WM1A 4PUDA 3AOFA 3EXSA 1OK4A 3PBUA 3CO8A 4ZTYA 1AW5A 3OHIA 1E43A 1WKFA 5TAOA 3ARTA 3V1PA 4DX3A 2BSLA 4UQEA 1EXPA 2P50A 1EBGA 2WWCA 5REQB 1I1XA 4A22A 4IWWA 1KM3A 1LBMA 3MUCA 5K7JA 1IIHA 2D3LA 2V5DA 2PZNA 4LQ1A 3VD3A 1CXEA 4E6MA 1P5BA 3H55A 1QOPA 4LBSA 3AALA 2V3GA 2OT1A 4E5TA 3LXBA 4C65A 1OGGA 4GI4A 1JD9A 3BLKA 2Q02A 3G8RA 3W1UA 4Y8EA 2C91A 5FSDC 1K3UA 1OCBA 3PBWA 4RL3A 2BZNA 1US0A 2XFRA 3KOFA 1KKRA 2XG9A 1Q2RA 4KCTA 1U2YA 2ONEA 2PDGA 3TAOA 1K4GA 1F4HA 3B9AA 2W27A 1XLDA 4HYVA 3VKJA 1OX6A 4PH6A 3KXQA 4WZHA 4BS0A 1LZOA 3ARVA 1JCJA 1EZ2A 4AEEA 3TYAA 1TUFA 4AWTA 1ECQA 5M3WA 3TQPA 4PEEA 3RILA 4QP0A 2C1GA 4QCFA 1SO4A 1E0VA 3M9YA 5E09A 3EX3A 3HIJA 3D0CA 1GVQA 2H9AA 4JN8A 3IRSA 2O9PA 3AS1A 2R1PA 3P8JA 5FESA 3Q2DA 3NL3A 4PUMA 4Q8MA 1XLMA 1EHNA 2NVAA 1VBHA 4JNYA 4GXMA 4GUFA 2G50A 2XU2A 4D8ZA 1Q7QA 4O13A 3ZR6A 4AF0A 1TJPA 4XTDA 3L7RA 1BG9A 3G0SA 3NVTA 1AJZA 4LBRA 4Q8VA 3CHFA 1KXHA 1NAL1 2GQ3A 4Q7NA 1A49A 4IJBA 4S1FA 3BLEA 3RU8X 5I09A 4NT0A 2WHKA 3GBEA 1NH6A 4RE0A 4REQA 5B7ZA 3STEA 3TYBA 3B8UA 1J93A 3IVSA 1RP8A 1TE6A 4IOTA 1WXJA 3UW6A 3C0JA 3TAKA 1VLIA 3LSBA 1K6WA 3MP3A 3BJFA 4RNHA 2V63A 3RM8A 4YNGA 2NW0A 1LLZA 4MWAB 1WZAA 4YWIA 1Z3NA 1A5KC 1MRQA 1R2SA 1V0NA 2ZICA 1Q6RA 2H9AB 3AO0A 4JTTA 2YDQA 4CNOA 3IACA 2Z6JA 3KS6A 1E5NA 3LGDA 2WWDA 4WXYA 3L21A 2V5JA 4MY1A 3EOLA 3TP4A 1QNVA 5E0CA 4PUNA 4LEQA 4C6LA 1ZAHA 2PWDA 1XLEA 5BXTA 4ZVJA 3WQFA 4MPKA 1XWYA 4MDOA 4R7JA 3O7UA 4MZYA 2VR4A 4KMQA 3H4WA 1ZJBA 2HDJA 3QLLA 3WUFA 5EMLA 4HBKA 5AVNA 5EMKA 1JVNA 1TRDA 6CGTA 3PJWA 1ZJIA 3CS2A 4MZ8A 4FNSA 3UXLA 1S2CA 1TZ7A 3I4EA 2GOKA 3VOIA 2BVYA 1ESWA 2PP3A 2Z29A 4G7EB 3OBKA 5HJYA 2QCFA 2BDQA 7PTDA 1OF8A 3AHXA 1IIGA 5RUBA 4I8DA 2RDTA 4Y9OA 3V5OA 3ITTA 1E9YB 1TWSA 2CBUA 2DDXA 3VCNA 3C0SA 1EQPA 3B8SA 4M24A 3SCQA 4UCFA 1I8JA 4YS1A 5EA9A 5H8MA 5AYXA 3VGGA 2WOQA 2ZFAA 3S6DA 2Y85A 1O6IA 3ANVA 2WANA 3TJXA 1CZ1A 4F2TA 3W0KA 1ZJHA 3CASA 4UOJA 1YTKA 1UROA 1Q63A 4PRWA 3BOFA 4JKKA 3OZOA 1EBHA 4QISA 3FLUA 4RZBA 2CBIA 3TH6A 3N34A 4NX5A 1CGYA 1UR8A 5I3JA 4P7NA 3WUBA 5HXMA 3QM3A 3U7VA 4I5XA 3EXRA 3S5OA 3KTSA 3W7PA 1BYAA 4BA0A 1R0MA 3WMBA 3HTWA 1XFCA 4GJ1A 4BCEA 1RR2A 1DP0A 5BWAA 5A6SA 2PDHA 4NZCA 2J8GA 3P82A 1FXPA 1JD7A 4IPJA 1R9YA 3H7UA 5FF0A 3AJXA 2A7RA 1F61A 2XSXA 3SY5A 1TMHA 4A3UA 5M17A 4LOCA 1VPYA 3BMXA 2QUVA 4JD4A 4QE4A 1S39A 3LENA 4J1OA 1EJTC 3G3DA 4BI7A 1V3HA 3W84A 4GNVA 1B4KA 1W8SA 3UJEA 3EWBX 3UBPC 1M7XA 2F9RA 1RPKA 4LX4A 1VEOA 5J5DA 3TQ0A 5CBBA 2A2IA 3OGVA 2WMFA 1POKA 4ZOCA 3TK7A 3LN3A 3T55A 4KW2A 1SW7A 3CQ0A 4D9PA 1Y65A 1WZLA 3G1AA 2QUUA 4NYUA 4Q4MA 5C9XA 5CPLA 5AFDA 3OA3A 4EXAA 1QK2A 1XSKA 2WK2A 4O17A 4K7YA 3SRFA 4CQ9A 4ONVA 1DHPA 4UR7A 3SCUA 3THUA 3DX5A 3O6DA 4UNIA 3E0WA 4PCFA 4GUIA 1KQYA 1WUFA 3SCNA 1A0CA 1PIGA 2TYSA 1SM9A 3T4WA 3WSUA 4AY7A 1OFPA 4UIOA 4FK9A 1E3XA 2XN2A 3CHCA 5HNRA 3QHNA 1CXFA 3TYZA 3SFWA 4PGLA 4UTTC 3LYEA 4HNVA 3RU6A 3TR2A 2WMKA 1E4NA 5FL1A 4N0RA 4L6HA 1PKLA 4F48A 3OVRA 4LBUA 4XB3A 2EAWA 4HA4A 4Q33A 3PUOA 4PTDA 1A5UA 2VMFA 2WMIA 4URIA 4FI4A 1FP9A 1YE6A 2J8FA 4Z42C 1HUVA 2AOSA 3T7VA 1S1PA 2YYUA 2GPTA 2VFHA 4MJZA 2Y2WA 3QOKA 4AEFA 1PE1A 1W9VA 4DPPA 5A8PA 3K1DA 1ZB5A 1HGWA 2HJPA 4NNBA 3ZO9A 1TA3B 4W8BA 4XD4A 2J9ZA 2B4GA 3HGOA 1B3WA 3QXBA 5CSRA 2PLKA 1QPNA 2NSXA 2NUWA 3UA3A 4WY0F 2PS2A 3S1WA 3MTWA 1JDEA 2JGYA 2I9UA 4IP4A 5KSWA 3OGSA 1SZEA 4WKAA 1US3A 5E93A 3V4BA 2XZ7A 3QGVA 5F2GA 1PPIA 3ARUA 4GFSA 1H7WA 2ZUMA 3W74A 3CZ8A 1XV8A 2PD9A 3M43A 4FNRA 3AHYA 1KCKA 4GX8A 4MKSA 5LXEA 4CNUA 2GL5A 1A3WA 4KCVA 1UR2A 3GK0A 3L4UA 4DI9A 3FYOA 2TSYA 3P5YA 3J7HA 1K9FA 3P61A 4O0KA 4ZQOA 1SMAA 3GFXA 3WQ4A 4QCEA 1VB9A 1X8CA 2ACSA 4V15A 2J7GA 2CLIA 4LVBA 3D46A 1I60A 4V2XA 2OB3A 4DZ5A 3GDTA 2GJPA 3TYCA 3V0SA 1OD0A 8XIAA 2Y0FA 2PGEA 3RLGA 3MU7A 1G7VA 1CLXA 4X2PA 5E1QA 1WV2A 1E1EA 4GIRA 2NLYA 1R3QA 2XH4A 3T07A 4BR1A 1XSJA 4JKMA 1MUWA 1G6CA 1OC5A 5A2AA 4O1BA 3VIFA 6ALDA 4CLMA 3R0KA 3APYA 2BHYA 3ZS4A 5HATA 2DUAA 3EDFA 1K9EA 5CC5A 4CCEA 2AQVA 4M6PA 4KS0A 4MTVA 1XQKA 2FPYA 3A3HA 4GUGA 1W9DM 2QCLA 3N6JA 3QZEA 3QR3A 2ZZ6A 3UG8A 1PBGA 4D6DA 1EJSC 2YL6A 4S23A 1QNRA 1FHUA 3KHDA 1H11A 1PX8A 4I7VA 1DIEA 1Q8AA 1X96A 2VZTA 3ZSTA 3DECA 2VNCA 3H54A 3JVAA 2X42A 4OT7A 2D73A 3MUXA 3WNOA 1EP2A 2H3DA 2G0WA 4TX9A 1ISYA 2JKAA 4YYCA 3O05A 4W7WA 1HJVA 1BRLA 3UCQA 4AUBA 1POJA 1JL8A 4TMBA 3WD0A 3GHRA 1I2NA 1X38A 3VILA 4LVGA 1Q65A 4XAGA 3VOJA 1IXNA 3IIZA 4IXHA 2YB1A 1R9XA 4NNAA 4DXVA 4CD8A 1YTEA 1ZBWA 3MVTA 3G18A 3M0HA 1YTDA 4C6QA 1D3CA 1K77A 1WCGA 3W76A 2YL8A 1DWIM 4Q7IA 3VNDA 2ZRXA 3N4FA 5FSEC 4GVGA 4UTJA 4JCLA 3FJ6A 4HHMA 1EHAA 4NQ1A 2V30A 1S3TC 1NDYA 1JZ6A 2A5HA 4J3ZA 4Z1CA 3HG4A 3WK3A 3R79A 3P3BA 2PF0A 1UB3A 1SO3A 3MI3A 4QS5A 4ZOBA 4CN6A 1UWRA 3B4UA 4XIMA 2A7NA 1W5OA 3HQPA 1VPQA 4QNWA 4G1NA 1RJRA 3NSNA 1RH9A 4DJEC 3EX2A 4JTUA 3QV8A 4O18A 3ELFA 2G4FA 3T0TA 2GVJA 4L7ZA 4TR9A 2WPGA 2Z2UA 3CTLA 2NQ5A 2GK1B 5C55A 5A6JA 2YLAA 3Q94A 3QQWA 3BAKA 1F5ZA 2E0PA 4XSMA 3DFQA 3DHDA 5DMLA 2E77A 2FZMA 3L65A 3FX4A 2XIOA 5I23A 1S1RA 4MAVA 3C8FA 1OIMA 4MJ4A 3LHWA 3QFEA 2WSPA 1WDPA 2F84A 3GFZA 4P2VA 5C0QA 3H2AA 4M6UA 3GAKA 1GPFA 1CLKA 1QW9A 3WK2A 3DFOA 4OUEA 5HOSA 4Y96A 1SPQA 3W7IA 3LZ3A 3ZLFA 2GUUA 3RYSA 4LANA 3B8IA 3ITCA 2GQ8A 1TB3A 3T40A 4PMZA 2D22A 4JX6A 3HQNA 2E68A 3IJ6A 2ZZ2A 4IUGA 1NP0A 1LWJA 1M41A 3E2SA 4J3VA 4YMZA 5ENLA 2GSJA 2ZUVA 2OX4A 5T9CE 2FMNA 1JZ7A 1VIWA 3NL6A 5JBEA 4D6JA 3BXWA 3MSDA 4FZIA 4YTSA 3QY8A 1CB2A 3MKCA 2Y8UA 5IDIA 4JTCA 3B0VC 4Q22A 3FJ4A 4DXXA 4I7UA 2Y70A 4AMAA 3JU2A 3W1XA 2Q01A 3SN4A 1UBPC 1TIMA 3G0UA 2EPNA 2OSYA 3B8DA 3W6MA 4TUFA 3BPWA 2C18A 4UFIA 3EKLA 2EG6A 1G1YA 2A79A 2QGYA 4ML9A 4YXGA 1VFMA 2IMRA 4GGHA 3WDRA 4HJWA 1XLAA 1YQ2A 3GFYA 2QIWA 2XYLA 3CLWA 3AXXA 4U5IA 4JHOA 2ALRA 3T4CA 2QUNA 4K8GA 4FXRA 1KGXA 1O5XA 4ZXLA 1RSCA 3FA3A 5HQLA 3CL6A 4LB4A 1HNYA 3B0YA 3CQKA 1B5TA 1K7EA 2G4JA 3PM6A 3FS2A 3B9OA 1HKWA 3TXZA 1LF1A 1JF6A 4H6KA 2OVLA 3OEXA 4RR4A 1UBSA 2J75A 1GQLA 1NARA 1DTNA 3W73A 3NOYA 1J5SA 3FA4A 5DXYA 1KBIA 3UPWA 3K4DA 3RPMA 2J78A 4A4AA 4MKNA 5DBTA 4LB3A 3KVKA 2QDHA 1QHZA 4QFUA 2YOCA 3EWXA 3GNPA 1G4SA 5D05A 1I2PA 4NZFA 3BCDA 1Q7MA 1CIUA 3HJEA 3BV7A 3M0ZA 3TOYA 1YNYA 1TPEA 1UG6A 4ROPA 1JCYA 3BW3A 2DVTA 4MF4A 4E2DA 4IIBA 3LBCA 2V5BA 2P0OA 5A2BA 3VINA 4JFTA 3GR4A 4XWUA 1UKPA 3PZNA 4BQ3A 2ZXQA 3NVDA 1TCDA 3N17A 2DW7A 1UZHA 5JU6A 3R43A 1VJSA 4IT1A 4XVEA 4AFYA 2FTWA 1O60A 3R8RA 3D5HA 2BXZA 4PZVA 3HA1A 3CIVA 1BTCA 1G4TA 2G41A 1FOBA 4LAMA 3CV2A 4YHGA 3EB4A 2ACQA 4AIOA 4A8LA 1W54A 4RK8A 4L4PA 4B2DA 3TROA 1BKHA 1E3ZA 1QI5A 4NYYA 3RHGA 1JXJA 2IUZA 4Z1DA 3ZVHA 5LGZA 4ZQNA 1VFUA 3P0XA 4NAFB 1UOZA 4PUEA 3GU9A 1Z44A 3TLQA 3H7RA 1JXKA 3GRIA 5D8WA 3PP7A 1DE5A 1ZQ5A 3GUWA 3WLIA 1JQVA 1IWBA 4PRRA 1DIDA 3GTIA 3FXYA 4H01A 4H7VA 3T0BA 1TTPA 3HN3A 2VUNA 1F8MA 3HU7A 4CN4A 1THFD 5HJXA 2E6FA 3GG7A 3ZYZA 1P0BA 5C9RA 1GEHA 4JZ5A 4JTJA 3MQTA 1DE6A 1Q2SA 3WD4A 4H3DA 3A23A 4DJDD 1ZFJA 2CW6A 2Z28A 4C6MA 3N18A 5B7YA 2ZDRA 1SFSA 5CLTA 4MNKA 3A12A 3CV6A 2O4MA 3IIXA 1QBAA 4DYJA 1G9HA 3AJ7A 1L6SA 1OY0A 3RM4A 2E5CA 2FJKA 3APTA 3C2FA 3SCSA 2FYMA 2PURA 4AMCA 3G5EA 3B05A 4JHMA 1XGDA 4XO6A 5EL1A 3Q58A 3LCWA 1K03A 3U2EA 1A5LC 4DUVA 4MY9A 2FFIA 1DWHM 1H09A 1OM0A 3QW4B 1GORA 1BTMA 3SN0A 5CXPA 3C2EA 4HZ8A 1V6TA 3LHUA 4D6GA 4D72A 5LA2A 2O7SA 4M7SA 3THDA 5I24A 5EFFA 3TQVA 3I3BA 2H8XA 2XFYA 3ZJKA 3AICA 1XLGA 1XH1A 1YADA 4KERA 4BK9A 2F8QA 3C3NA 1KKOA 3H2NA 2FVKA 3KVJA 1O68A 1BG4A 2E40A 2PE4A 2BFGA 3VDGA 1AJ2A 2YXOA 4TMCA 3R13A 2P0IA 3MCMA 3C6CA 1OG6A 4MVAA 2PRHA 3EWZA 1OFEA 1FWSA 1EC9A 1ZBKA 3T2QA 4W5ZA 1HT6A 4JIEA 3CAQA 1XKYA 5JBDA 5DX7A 2HS8A 4WR3A 4FLQA 2NQJA 2B7NA 2XIMA 4GQBA 1KQZA 1B1YA 3ABXA 3QHMA 4YTUA 1OG0A 5A8OA 1EDGA 1OCJA 3ZM8A 1ZENA 4UXDA 2OLSA 2CHNA 1F3EA 4GCAA 2FJUB 2YYTA 4CQ8A 2BY0A 3MUIA 1QASA 4CD4A 1UCWA 2DSUA 3FOKA 2DZBA 1AH3A 3W7MA 4GQ0A 3ZVIA 1EP1A 3USBA 4IPIA 5EB8A 4DLFA 3QBUA 2XGZA 4I3GA 2QMJA 1WA3A 1CXIA 4O52A 5CG0A 4O0ZA 2VEGA 1H7OA 3UXDA 4RPQA 4QLKA 7XIMA 4HMEA 1LLOA 3KOWA 5FF2A 2W6RA 4AIUA 1V02A 3E2QA 3UZ5A 3MY9A 2ZX8A 1QW7A 3IUDA 3MV01 3LLXA 3OBEA 3SBFA 3MHGA 3SGGA 4JN7A 2WC7A 4B15A 3BQ5A 3STFA 2INEA 1ML1A 2QDGA 5MHBA 1Q6OA 4L65A 3OLIA 3R4IA 1WBHA 3CH0A 1H7PA 3SZ8A 3N29A 4NJKA 1TR9A 1EEPA 1KM0A 3F4CA 3GNNA 3ITLA 5DEZA 5FAJA 5LHFA 3DBNA 1BVNP 1K8XA 3GHUA 2ZVIA 3DC0A 1SZFA 4PMVA 4PODA 3BDKA 1B4EA 1Q4NX 3WL0A 5AC5A 3ARWA 4KEMA 4Q8UA 4K37A 3A5VA 3W07A 2WCGA 2TRSA 3IIOA 1FWTA 1GZJA 1E1FA 2RJGA 1XBYA 1UR9A 4UTTA 3L0NA 2XWDA 1T0OA 3VDBA 3IUHA 1LL6A 3KL5A 4KRTA 5MKGB 4UTIA 3G1RA 4LAUA 4BY3A 4WY0A 3VVGA 5JH2A 1J12A 5GNYA 1XLFA 1HL8A 2EO7A 5K2ZA 5HR7A 3RLVA 3EMQA 1IGSA 3HPSA 4K39A 5AHNA 4TIMA 4UTHA 3ZLHA 3NXLA 2J77A 3C3UA 4HNUA 5EPDA 1OX5A 5CPSA 1L6YA 2WQDA 1JRCA 3HG3A 1GNXA 2D24A 3S1VA 5LNRA 1H5YA 1FWDC 2PCQA 2NZLA 1G94A 5IHRA 1L2QA 2QXWA 3VNIA 5FOOA 2PBOA 3W27A 3AAMA 3URAA 2PDJA 1VBRA 5JQ9A 3P84A 5LKYA 1XLHA 3WD1A 3M41A 4YLWA 3LDVA 1JNDA 2CZEA 3KBSA 4IMDA 4AD4A 4BQ2A 3PZTA 4TTUA 2Y8VA 3PJXA 3ITVA 1LUCB 3PPFA 4WY0B 4XBKA 2ACRA 3ZQ9A 1HIZA 4NZ3A 2ZRUA 3QV9A 4GQQA 2XTKA 4PTWA 1TQXA 1IEQA 5EFDA 3CIWA 4JIIX 2NLIA 5AYYA 3VZZA 4Q8WA 3VDHA 5DF0A 3FY1A 4AVNA 1LQ0A 2XSBA 3VCCA 1T96A 3FDKA 1WNOA 1RBOB 2ZX7A 2HNHA 4HQVA 3MC5A 4Q3MA 1JULA 3WYZA 3UWZA 3I7RA 3QPYA 1PS9A 2DQXA 3L4VA 2NXGA 4W5UA 3GG0A 2PLMA 2B7OA 3OOQA 1UMLA 1M7PA 1IQ8A 4KEUA 1UKQA 4H8VA 2GGIA 3NM1A 1TZ9A 3OQEA 4YCOA 3WJWA 4EWJA 1TJ2A 1M01A 4QQUA 2OYKA 1Q6DA 2QCCA 4BZYA 4E3VA 4R34A 2UY2A 1FTXA 3DG3A 3NYDA 1BEUA 2GGHA 2OU4A 2BV9A 4C6IA 4YPJA 1MQPA 5DXXA 1GK8A 5BWFA 2G97A 3CAVA