1SO3A

Crystal structure of h136a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
214
structure length
214
Chain Sequence
SLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYARSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
total genus 85
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so3A00
1PCKA 1JCMP 1SZFA 4Y9AA 2AGKA 4PTNA 3BV4A 3E02A 3O1NA 3UWYA 4MZ8A 1KFKA 3CEUA 5CZJA 1KFEA 2YYTA 2QCLA 2GJNA 5KINA 4RZ5A 4IMGA 3M47A 4ORMA 1MXSA 3PUDA 2H8ZA 3I7QA 2CLIA 4LVFA 2VFHA 2HMCA 1X1OA 3TAKA 1KTNA 4JX5A 3FFSA 2DJLA 4I7VA 3DBPA 1EA0A 4Q4KA 2GJLA 3G8RA 1DVJA 3A24A 2PC4A 4Z1BA 1RV8A 3EWZA 4M7SA 5HUPA 4A21A 5H91A 1YLVA 4ICNA 4I7UA 3D0CA 2CLFA 1M6JA 3GDLA 3P5YA 4QISA 3NM3A 1DOSA 1I4NA 2JK2A 3HIJA 3S5ZA 1P5BA 3EXTA 3QM3A 4Z08A 2NXIA 3LB0A 1G4EA 3GDTA 1SFJA 3PY2A 4O18A 3W1QA 3IVUA 2ZRYA 3TV8A 4FB7A 1BKSA 1YDNA 4IUOA 5E0KA 2B4GA 5EBUA 4HPXA 3W7HA 1RQEA 2DZXA 1P0NA 4LVDA 1FCBA 4K37A 4L4MA 3NO5A 5F2MA 1VYSX 3KFTA 2C18A 3A9IA 3DAQA 1YXDA 2VFGA 5LSMA 3F03K 1B57A 4FHAA 2ALDA 3FKKA 1EPXA 2BWGA 4QJ1A 2H90A 1KBIA 5CPNA 5HNRA 4NX0A 1KV8A 3S1UA 2ZZ3A 3C2RA 4H6KA 1FCVA 1OX6A 1CX9A 5D2VA 3TNOA 3W1PA 4AHPA 5AHIA 1Z44A 2DJXA 4DF2A 5LGZA 3MBFA 4HIBA 3TR2A 3W7RA 2B7PA 4O19A 3O6YX 1TIMA 4OQVA 2FQIA 4BWLA 4AXKA 4DO5A 2ZRZA 3EXSA 3NPWA 3KRZA 4RZ4A 1SU5A 4DXVA 3FJ6A 1LRNA 3RLVA 1SW0A 1KLYA 1SPQA 4ADTA 3SGZA 3T55A 3N14A 4ZZ9A 5C5YA 3NQMA 1OYBA 4WUIA 3TFCA 3JS3A 1NF0A 4JY8A 2XN0A 2E6DA 1S3HA 3WJSA 2VFEA 3LBCA 2QJHA 1GVQA 2Y7FA 1R30A 1BWKA 2A21A 5BMWA 2B7QA 3TXVA 2QJGA 5BMXA 2VEIA 3S0CA 1R47A 4O15A 1GT8A 3S6DA 5AN7A 3O07A 2YW4A 3O15A 3UWWA 2ATSA 3ATYA 4RXGA 3R2GA 2F7FA 5HULA 3MI6A 3GNDA 3L65A 4UFJA 3EKZA 3N2MA 3DKJA 3ZS4A 3WK3A 4FXSA 1W3NA 2ZZ1A 3W7JA 1WYIA 4AF0A 1M5WA 4N9BA 4CLMA 3TW7A 5AYYA 3OVPA 3TROA 5LNVA 3UXAA 2CLHA 3QJAA 3CWNA 4GXMA 4HNUA 3IEBA 3W3OA 4ML9A 1GZGA 2NX1A 3ZWTA 3S9YA 5G1YA 1GTEA 4JTJA 1TV5A 2DZPA 3G1DA 4PCFA 3GZ3A 1OG0A 2Y88A 2P10A 1ZFJA 2VEMA 1Q6LA 4WY0F 3GYEA 3W7GA 4LV4A 3G22A 2ZQ0A 4BI7A 3BK0A 3NQ2A 1GYNA 3P8IA 3W1AA 1HUVA 2E5BA 3W72A 3QSRA 4TO8A 1QPNA 2TMDA 3S5OA 3LI0A 1F73A 1XC4A 1GWJA 3PB0A 2QDGA 4IMDA 2HS8A 5L9FA 3G1FA 2WJZA 4JTIA 1NVMA 1OFAA 1TTIA 4O57A 3FOKA 5I3IA 2YFNA 4GBUA 4Y8FA 4A2SA 2Z0IA 4ZVJA 1OFPA 3CU2A 4E0CA 3M43A 1JCLA 4P2VA 4Z0SA 1ZCOA 3BG9A 1ZY9A 3TQVA 3CPRA 5HJLA 3S1WA 5I3GA 2QCHA 4HSOA 4IPJA 5D2YA 1QOPA 3SGUA 5C55A 1VCVA 4JTHA 4DPPA 1TJRA 4TU1A 2PCQA 3PB2A 5EKYA 3SI9A 3W7PA 3P60A 1QWGA 4LS1A 3KVKA 3S8HA 3UWQA 2Y85A 3EEGA 2A2IA 1FWWA 1H7NA 3B06A 5FF4A 2NV2A 3NXFA 2ZZ4A 1XM3A 3LM7A 3NA8A 1Q6RA 5BNKA 1TRDA 3P62A 4RXFA 2QAPA 4IOTA 1QDSA 3CWOX 4E2BA 1B4EA 3MMTA 3R89A 3TFXA 1TPVA 3G1VA 3INPA 4M6VA 2OZ0A 3IIVA 1EWEA 3S5NA 4K38A 4LC8A 1G4PA 2TYSA 5FESA 4W9TA 3RK8A 2E1DA 1TSIA 4FNRA 4K36A 5BOOA 1CI1A 1TTPA 1DJNA 4OWGA 3EWYA 5DLCA 1CW2A 1UJPA 4BR1A 3ATZA 1L2UA 1WX0A 3HMJG 2ZZ7A 4G1KA 1WAUA 2CLLA 4MLJA 3GXTA 3C3NA 2VFDA 1W0MA 4PH6A 4DO6A 2J24A 3GLCA 1XBVA 3QQ0A 3MHGA 3T40A 3IRDA 1OHLA 3OBKA 3LCWA 4DQWA 1VYRA 3B4UA 4O1CA 1A5AA 4X22A 4AB4A 1VHCA 4QNWA 1JVNA 3G1SA 1WBHA 3C2VA 3DFPA 1QO5A 2QEZA 3CIWA 5LHFA 1KFBA 4XBKA 4GNJA 4JTFA 1VGAA 2QCMA 1BEUA 2A6NA 5T26A 5E93A 4JYEA 3W1UA 3NZRA 1EUNA 1TV7A 3TH6A 1AW2A 4KFNA 2W0UA 1VC4A 3NQCA 3PUOA 3L68A 3WJZA 1FCUA 4PEKA 3TSMA 2VEPA 1AW1A 3W86A 1HO1A 5A8GA 1XUZA 3W2UA 1AL7A 4UFKA 4NUWA 4YXGA 2H3BA 2Y70A 1KM3A 3M5VA 1GG0A 3EXRA 3PSWA 4NXSA 5HR6A 1TPC1 1DQWA 1GQNA 1SR9A 4Z1AA 3G1AA 1LYXA 2GQ9A 2C3ZA 2QR6A 3W22A 1H7WA 3TC7A 2NX3A 2WV8A 3STGA 2PRLA 3M6YA 3B0VC 3R5EA 3NPXA 1ZJIA 3LLDA 2GVLA 1G7UA 3RFAA 5DCDA 1O95A 4JTTA 4NZJA 5K2ZA 3KRUA 1N8FA 2C13A 2G5WA 4YMZA 4CQ9A 1H50A 1WBJA 3QW4B 3ABRA 1C9DA 1EWDA 1EP1A 5D02A 3W23A 1W1ZA 2VELA 1A5CA 3GKAA 2IQTA 5D05A 1SUXA 3FYPA 2KZHA 3KAOA 3V1PA 3QPZA 1LP6A 2VC6A 5CSSA 1JCXA 2A6LA 3TU9A 2G96A 3PBYA 3QH2A 1OF8A 4O4VA 1PIIA 3UPBA 4RZ6A 2VKZG 3JRKA 3L5AA 3NDOA 2W6RA 1EEPA 3C8FA 3E96A 4ORIA 2YDAA 2JGQA 2ZRWA 5C2XA 2GUUA 3OEXA 2V82A 3CM4A 3LCGA 3SW6A 5FI8A 1TTJA 2HS6A 3C2FA 3P7YA 4MYAA 3UPWA 4O1AA 2A85A 4UC5A 5HQEA 1XI3A 8TIMA 4O1DA 3W7MA 3I68A 4CCEA 1TPH1 3P84A 3BO9A 3NL6A 4CCCA 5U7SA 2C14A 2DZVA 2NZLA 3G18A 3LLFA 3STFA 3T78A 4I9AA 4JTSA 1AMKA 2YR1A 2C0AA 2PE4A 3LV5A 1FBAA 3A23A 1KM4A 2QAFA 3PG9A 3P81A 1O4UA 3TX9A 3EWXA 3PS7A 1OYCA 3QQ1A 3LXCA 3SFKA 1JUEA 3HBLA 1IIHA 1I45A 5CZTA 4UIOA 4TMBA 3LHVA 4BI6A 3NQEA 1ZNNA 2Z6JA 2V5BA 3CC1A 4UTTA 3HOJA 3LOTA 5LNUA 3MP3A 3GXNA 1F76A 3USBA 1TPWA 3O05A 2A4AA 4O0KA 5HR7A 4UTIA 4MZYA 1ME7A 5K3VA 3BGGA 3G0SA 3GDMA 3DKLA 4X3ZA 4BK9A 3Q2DA 2JKEA 2YW3A 2E6YA 2QCNA 3STEA 1FDYA 1JR1A 2ZYFA 1UBSA 3N73A 1S5TA 3PM6A 1VJIA 2X1RA 1AL8A 1TTQA 2B7NA 5DBUA 5HUOA 4C1LA 4UTWC 1GVFA 3K30A 1J2WA 3C52A 5F4WA 1G67A 4CQ8A 4O16A 4TR9A 4RJEA 3IGUA 3KVJA 3VI2A 4OBTA 1HL2A 3DHDA 1KM6A 1I2OA 3CB8A 1J5TA 2J9ZA 4XKYB 1SZNA 4Q32A 4N4QA 2BXVA 2D73A 4IXXA 4AF0B 1AG1O 2WSYA 1FDJA 1TYGA 3EX1A 4ZQNA 2YXGA 3WJWA 3W73A 5IBXC 1H7RA 1QCWA 3TW6A 4AEOA 2FIQA 2QCDA 3MP4A 4O0ZA 2OX1A 1GOXA 4O28A 3FKRA 3CTLA 3TKFA 3W7CA 5LGXA 2NUXA 5FEXA 3NGJA 4YCOA 3HGOA 1K8XA 3TMLA 1K7EA 3DHFA 3N34A 4O8RA 1E51A 3M44A 3U6WA 1B9BA 1H5YA 2ATMA 4JD4A 1UUOA 3W7OA 3W74A 5H2ZA 1ONRA 3HO8A 3PBUA 5CGQA 1FWNA 1PVNA 4GUIA 3W1NA 4R7JA 1DHPA 2Y7EA 3GB6A 2CLMA 2TPSA 5CG7A 1GJPA 4O1BA 4LTSA 4ZQMA 3W7KA 1XBXA 2JGYA 4NJGA 5F1UA 4BWLC 3IIZA 2QCCA 5FEPA 2I9EA 3CIXA 4NNAA 3RNDA 3W1LA 2OJPA 3DH7A 4IQLA 1XL9A 3VCRA 4QM1A 2DORA 4ADSA 5TQLA 4WD0A 3LHUA 4FX8A 3IV3A 3MYOA 2QUVA 2YYUA 4A22A 3PC0A 1GVRA 3BW3A 4NJIA 1OFDA 3NVTA 4M19A 3CLMA 4DF0A 1RQBA 1R2RA 1A5SA 4ZQPA 1RVGA 1Y0EA 2YCEA 1P0KA 3QC3A 4CNNA 1SFLA 3QYQA 1TCDA 1VCGA 3NQVA 2NWSA 3L67A 2RDTA 5F2LA 3O6DA 4CQAA 3O06A 1BWLA 2Y63A 1OJXA 2C6QA 3P67A 1IIGA 1H62A 2G97A 3ANYA 1ADOA 1QR7A 2ZZ6A 4LNYA 4ZQOA 4MLRA 3NM1A 1SO4A 2CLOA 1SSGA 1G4TA 4FNTA 3GDKA 4AWUA 4JXCA 3W87A 4DPQA 1TPUA 3G1YA 3EKLA 2Y61A 1X7FA 3LXBA 2ZRVA 3OA3A 2P1FA 4NJJA 3TE9A 3W71A 2Y6ZA 1QFEA 1A5BA 2X1SA 4JTEA 4A29A 1GYLA 2J27A 3ELFA 1RZMA 1QPOA 3QMSA 4IWWA 1JCYA 4FO4A 3TJLA 3WJYA 5KTLA 5D2TA 2ISSA 5G2WA 1P4CA 1TQXA 3W2JA 2QDHA 2C15A 2YPIA 4NU7A 4XKYA 1KM2A 3Q94A 4GUHA 4XZ9A 1IXNA 4KWWA 4UTUA 4FF7A 4RR4A 5TBOA 3P61A 4UFIA 3M5ZA 2VENA 3QMRA 5K4XA 4MY9A 1A53A 2WSRA 2I1OA 1W54A 4PL2A 3MO7A 1PS9A 3W2LA 4JYFA 3A22A 3BG5A 3NPVA 4O10A 3VE9A 2EHHA 4DBDA 4NVTA 3T44A 3FJLA 5LNRA 1F6KA 4I7WA 3N3MA 1H1ZA 3FS2A 4EVZA 1IXQA 3VNDA 2ZCGA 5K4ZA 4ZL1A 4MYXA 1ZHAA 3B0PA 4NQ1A 4Y90A 1K8ZA 2FPTA 3OVQA 5AOUA 3TIMA 1U5JA 1YDOA 3ZFHA 1SZGA 5LHEA 2ZRUA 4Q33A 4JNMA 4IMFA 3LHYA 2BSLA 2QCFA 1LBMA 4OT7A 1VS1A 4U28A 1S5VA 5G4WA 4MJZA 3NOEA 4Z0JA 1T96A 3N9RA 3P82A 1LOLA 1ALDA 3P8JA 1LOQA 4RCXA 3O16A 5D38A 4BFAA 3DU0A 1QPRA 2DZWA 2JKPA 4UFLA 1K3UA 5CSRA 3G24A 3PF3A 1LBFA 2B7OA 2WOQA 4O17A 3TUUA 3LDVA 1D9EA 3PVFA 3UZ5A 4DEFA 1VR6A 2ISWA 2X1UA 2A0NA 3MHFA 1XDMA 1RQHA 3R12A 2Q8ZA 2CZ5A 2O7QA 4UTTC 4IJBA 2QF7A 3MJYA 3O8AA 4AHOA 3TSDA 3Q58A 4FNUA 5E1QA 1JCJA 3W9ZA 1HG3A 1K8YA 3I7SA 5AC8A 3M9YA 4MFDA 1KW1A 3UD6A 3DFQA 3M5YA 3DXIA 1KFLA 1TJPA 5D09A 2EKCA 3PUEA 3BLFA 4JGDA 3DZ1A 3A5VA 4ALDA 2V5LA 5HWJA 2VXNA 3GIYA 3NQAA 1L6SA 4FNSA 1YTEA 5D03A 1QAPA 4UTWA 1ZAJA 4OV4A 1JQVA 3C0JA 3GX9A 2A7RA 5AHEA 1LCOA 1XCFA 3CQ0A 3C2OA 3TQKA 4LVAA 3TCEA 3KRSA 1JCNA 3EX3A 3DFOA 3W1TA 4ZMGA 3I6RA 1H1YA 3LCLA 4KKXA 2X30A 3LV6A 5FF2A 1TREA 1GVSA 2XN1A 4RLIA 2CFFA 1MZHA 4UTKA 1H60A 1A50A 1HO4A 1EP2A 3FYOA 3M7WA 3MWAA 3BGJA 4MZ1A 2H8XA 1X8FA 2Z2UA 3HF3A 4BI5A 1OYAA 3UY7A 1K7XA 2C19A 3NR0A 1H7OA 3SECA 3HPZA 4UCGA 5EYWA 2Y62A 3P74A 4HNTA 5D37A 5EA9A 5DXYA 3N19B 4XWUA 4RKAA 1DL3A 3L0KA 3B04A 3FLUA 2ZBTA 4LWWA 5AHLA 4HNVA 2ZTKA 3S5YA 1C29A 4HKPA 2F84A 4MKNA 3EWBX 4JTLA 1K03A 4HSNA 5J5DA 4TX9A 4WOZA 2BX7A 3MI2A 3QF0A 4MVAA 1H7PA 1FWRA 2RDWA 5DCEA 1LORA 2FPVA 5BRBA 1F2JA 4AWTA 4PODA 4WQ6A 1G6CA 1AW5A 1WOAA 3NQDA 2R14A 3QEZA 4JN6A 2LLEA 3PULA 4LUIA 1QNVA 5KITA 3RF9A 4GUGA 3W7NA 3NAVA 4UFHA 1M7PA 4LC6A 4IPIA 2V81A 5F2IA 1WOBA 5CPLA 4HT3A 3TQ0A 4MY8A 2Y7DA 3L0NA 1H7XA 3F4WA 3PBWA 3B05A 3FA5A 2BZNA 5K7JA 4WX2A 1XUUA 2NX9A 1TPDA 1XKYA 1I2PA 1SO3A 1VH7A 1KA9F 4XUGA 5G4EA 1YTDA 1W37A 2QCEA 1DQXA 2DZTA 1THFD 4BF9A 3E9AA 4DBEA 2EPHA 4KFPA 4O13A 5FF0A 5K9XA 5F2GA 1YXYA 4AH7A 4JICA 1Z42A 5D33A 1MSSA 1T0OA 4UXDA 3SZ8A 4UTJA 4AAJA 5BW6A 1C8VA 3LGEA 1F5ZA 2ISVA 3A5FA 3FEMA 1LOSA 2BLEA 3HG3A 4NX5A 1ICPA 1PHWA 1DKWA 1MEWA 1JRBA 2YZRA 1R2SA 3GAKA 3VE7A 4QNEA 4K7YA 1ICQA 3QRHA 3NQFA 4HPJA 3H54A 1N7KA 1OX4B 2DP3A 3BVJA 5FF3A 3HGSA 3PG8A 4L4LA 1IXPA 2J9XA 3C56A 3W1MA 2Z1BA 1X6UA 1SSDA 3W84A 4NNCA 1G4SA 5DCBA 3W7LA 3NG3A 4UNKA 2DU2A 3C61A 1G7VA 4N9EA 3VKJA 4MFEA 4O4WA 2NWRA 3SSJA 3ABSA 4LVGA 1FQ0A 3F4NA 2FB2A 4AWSA 4JEQA 4UUIA 1IF2A 1GPWA 3GK0A 5G5IA 1KFJA 2V2HA 2QUTA 4UMBA 5D30A 5I3HA 1N55A 3KHJA 1HFBA 4N2YA 1TQJA 3R8RA 2CU0A 3C2EA 4GJ1A 4R33A 3SY5A 3U8GA 4O54A 3LHWA 3BW4A 4LRTA 3QFEA 2PURA 4DELA 2GOUA 1HTIA 4C1KA 7TIMA 3LTPA 3TAOA 1LRTA 2X16A 4YCPA 2QCGA 5I3JA 3AO0A 3G3DA 5AHNA 4NXKA 3TDFA 1TPEA 4Y96A 2Q3RA 3GDRA 4LRSA 4JIPA 1UB3A 2FTPA 2DZSA 2R94A 1GEQA 2GVJA 3QZEA 3LCHA 5LNSA 3TMQA 2RDUA 3L66A 1M7OA 5C54A 3JR2A 1XFBA 1W5OA 4YLWA 2VEKA 4O52A 3H53A 1T8XA 4JX4A 3NNTA 6TIMA 3R13A 2WQPA 3LRLA 1VRDA 4GWEA 4NZFA 1KTCA 4FX6M 1GTHA 2AAMA 2GVGA 2P0OA 3HG2A 1OK4A 4EF9A 4WY0B 1Z41A 4XTIA 3KOFA 3S1VA 3HQ1A 1DBTA 1FWTA 1W3TA 1T99A 1UUMA 4IMCA 4M6PA 5U4NA 2A7NA 4N9CA 3PWAA 3DFTA 3MUXA 3W6YA 4NT0A 3GVGA 1PV8A 4JY9A 1NF7A 3ABQA 3BLIA 3ZWSA 2AQWA 3BPWA 3W70A 1H61A 2R8WA 3RMJA 1V5XA 3PSVA 4FIQA 4JR5A 1F7BA 1IGSA 4WY0A 3I65A 5D2XA 4JS3A 4XQ6A 1L6WA 2FFCA 3W1RA 2NXGA 4JTKA 4O50A 1Q6OA 4MJMA 3MI3A 4NJHA 1XXXA 2CZFA 1H63A 1IXOA 3EX4A 2YFOA 1V7YA 2C1HA 4PC8A 3THQA 1L9WA 4YL2A 4K6AA 1LROA 3SIZA 4RV8A 4R34A 4S1FA 1K7FA 3QW3A 1I8JA 1NSJA 4FNPA 1OFQA 4PA8A 2ZA1A 2FLIA 2QCDB 3WK1A 3G0UA 2V9DA 1SO6A 1Q3NA 4WZHA 3LCIA 3B0UX 2QJIA 2E09A 5CZ0A 4N6FA 4A2RA 1OFOA 1W5QA 3LCFA 3MBDA 1OX4A 1WDWA 1Z48A 1FY6A 1VLWA 1TRIA 2DZUA 2BTMA 1PL9A 3OVRA 1BTMA 1OK6A 2G95A 5K9CA 3KX6A 1OABA 3PR2A 4IXHA 1JRCA 1K02A 1WV2A 3O6CA 4GUJA 2FJKA 4FX7A 1W56A 3KVMA 5F1VA 3NQ6A 2X1TA 4K8HA 5EPDA 5ABTA 3GR8A 3T4CA 3EB2A 3G3MA 2JBMA 3HB9A 3EWUA 1MEIA 4WJEA 4Z1CA 3RLUA 5KSWA 4N4PA 1X1ZA 3M0ZA 3DGRA 2CZDA 4O53A 3P5ZA 2CZEA 1TO3A 3KVLA 2W79A 2ABAA 5AYXA 4IX0A 1F05A 4E38A 1QO2A 1I2QA 4RX0A 3NL3A 2X2GA 3HG5A 3GKFA 1F74A 3BLEA 4YWIA 2NLIA 4KFOA 4CNPA 5LKYA 3NQ7A 1OFRA 2V2CA 2FPYA 4LS0A 1PHQA 3LTSA 3GXPA 4UR8A 4JTUA 2ZDRA 1PE1A 3L0GA 3PAJA 3GAYA 5D04C 3W76A 5LNWA 2I14A 1FXQA 5DY2A 1VLIA 4M7TA 1OF6A 1KM0A 1QPQA 1EX5A 2QKFA 2ZA3A 4UMAA 1LDCA 2E68A 3UY8A 2WSQA 1Q6QA 2GPTA 3UWVA 2JKAA 1KV5A 5DN1A 3WFAA 2ZTJA 4KWVA 1JUBA 4GUFA 5DELA 3UZJA 3TA6A 1TB3A 2E6FA 5A5WA 2J9YA 3LCXA 5I3KA 3A21A 3W83A 3I7RA 1B3OA 2H6RA 2J88A 4EWND 1B4KA 5AC7A 1O5XA 2TRSA 4D2JA 4WOQA 1KM5A 1LM1A 3LERA 3OIXA 2V2DA 1J4EA 4ZQRA 1O60A 1KFCA 4XBSA 2B0MA 4O14A 4JDYA 3P80A 5C6MA 3CT7A 5F4SA 3IVTA 3W7EA 4QSHA 1EIXA 3OHIA 3H55A 4GRSA 2PRHA 3HGJA 1VHNA 3DFSA 4M5PA 4LUJA 5IBXA 2EAWA 3THAA 5FEWA 4HNNA 1NFBA 2Z6IA 3NL5A 3EWWA 1DV7A 5I3FA 1JJKA 4QQ3A 2EF9A 5TIMA 1SW3A 3WK0A 4DO4A 4GFSA 3OG3A 4HN4A 1OVDA 2ZZ5A 2UV8G 1ME8A 4JIQA 5FF7A 1W8SA 1OFEA 3IGXA 5AHMA 2ABBA 3FIGA 5DXXA 5AB3A 1TV8A 4MOZA 1XBYA 5KZDA 2E6AA 3LTYA 5GVJA 4MUZA 1UASA 3WK2A 3ABOA 1KTBA 4MY1A 3UWZA 1ICSA 2RHGA 5G2IA 4ONVA 2Q3OA 2XN2A 4NJKA 5AC6A 2RKXA 2C16A 2E77A 3VFLA 3LHTA 3BARA 2E5CA 3U2OA 4MIMA 4HHPA 3ZR4A 2GQ8A 3W88A 2HTMA 1FCQA 4JX6A 3E12A 3STCA 3E0IA 4K39A 3W2KA 4OE7A 1MO0A 2ZRXA 4O11A 3F1QA 2E5DA 1H51A 3NPUA 4H3DA 4NNBA 3B03A 1W5NA 3MHUA 1RR2A 1YXCA 3UYCA 4Z1DA 3TC6A 1FXPA 3TJXA 1W5MA 3L5LA 3WJXA 1L6YA 1UCWA 1MEHA 4UR7A 1Q45A 3DENA 3UNDA 2VOMA 3QSTA 2CLKA 3W7DA 1FX6A 1W5PA 1VCFA 4S2BA 1D3HA 1YADA 2XFWA 3MW7A 3G1XA 4H4IA 4S2CA 2J6XA 2O7SA 3EX2A 3HJZA 1W3IA 3YPIA 2ZA2A 4LOCA 4X2RA 4GC4A 4PFMA 2NV1A 2OT0A 2CLEA 4FEZA 1P1XA 3Q37A 1VQTA 2Y89A 4EF8A 3W1XA 5HMSA 4X9SA 2NXHA 5EMUA 4JYDA 2HSAA 2WO5A 4LV9A 1SZEA 2WKJA 2TSYA 3W7IA 2WNZA 5CZSA 5FEZA 5KZMA 2VFIA 1PCWA 1NAL1 2H3DA 3LHZA 1SW7A 1TPB1 3SR7A 3M41A 3NQGA 2FDSA 2V8ZA 1GG1A 4WXYA 1YPFA 3W85A 4IMEA 1VYPX 2VFFA 3BW2A 2YGYA 3G1HA 3KXQA 3O63A 2A1YA 3AJXA 2V30A 3HPXA 4LY8A 4N02A 3L21A 3MP5A 1EUAA 5HINA 3HPSA 3TXZA 4O12A 1S5WA 1KBJA 3LRMA 3DI0A 3W2MA 3C4UA 1LZOA 1LLWA 3M5XA 2ZZ2A 3B8DA 1W31A 4XTDA 5KMYA 4TIMA 1QMLA 1LBLA 3LX9A 3W2NA 4WXZA 5L6UA 5F4XA 5EY5A 4FXRA 3NZ1A 3L5MA 3DI1A 3HGRA 4UFMA 3CEPA 3UWUA 4EIVA 4U4MA 5CPMA 1ME9A 2CWNA 3N9SA 2OT1A 1EP3A 4IX2A 4A3UA 4DF1A 3N2XA 3IIOA 4AVFA 3GNNA 3BG3A 4AMAA 4ADUA 1I2NA 4M6QA 1ZAHA 4N9DA 4QIUA 2A7PA 2OMAA 2WPBA 4RK8A 5MHBA 1U83A 3QPYA 1JULA 4P61A 3L9CA 4TMCA 4LT9A 4LS2A 4OV9A 1EB3A 2RH9A 4OGZA 5HWMA 3HG4A 2RFGA 1F6PA 2YX0A 4R53A 5CKSA 3T7VA 3IIPA 4IGHA 4POCA 5G1TA 1LLZA 2PRMA 3W7QA 3NEVA 4J9JA 4EOUA 4B5NA 5LZLA 1TMHA 1VPXA 1FWSA 5IM51 5K9DA 5AYZA 1WQ5A 4PL1A 1JUKA 3IIXA 4GE8A 1SO5A 1NEYA 1R46A 3SJ3A 3LRKA 5SWUA 1AK5A 2R91A 1RPXA 3DFNA 3IVSA 4OU1A 5D2WA 3LXAA 3G0XA 1DORA 2GQAA 3W75A 1D3GA 4FIRA 2OCZA 3M1ZA 5D32A 2WNQA 5AHFA 3TK7A 2V0TA 1JQXA 3GR7A 1DJQA 4UTMA 4K7VA 4AHQA 1GVOA 1R2TA 1XDLA 4UTLA 4UNLA 5AFDA 3G8EA 1ZALA 1FUYA 1LRQA 2FB3A 4UMCA 3M16A 5KZEA 1QOQA 4UTHA 4JDBA 3UQNA 1WA3A 2ZFAA 1I2RA 1KLZA 3V75A 4CCDA 4QAIA 1TPFA 2Y7GA 5J5RA 1ZENA 1YTKA 1OX5A 4JTGA 3TSBA 3RU6A 3S1XA 1YDVA 4QITA 3CHVA 1FDZA 1XBZA 1O94A 5EL1A 5DBTA 4OHQA 3C6CA 4MPQA 1G69A 3E49A 3UXDA 5CPOA 1ZAIA 4Y6GA 2A5HA 1RD5A 3W07A 2EGZA 4LVBA 5DY3A 1KM1A 4K8EA 4LU0A 4N6EA 1ML1A 1SQ7A 3LBMA 3NYZA 3LI1A 2YSWA 3MYPA 1O5KA 3NL2A 1OFBA 2QUUA 1YPIA 3L2IA 3NQ8A 3S42A 4CNOA 4FNQA 1WXJA 1YYAA 2CW6A 4E2DA 2NUYA 3QMTA 2Q8LA 1LTDA 6ALDA 4LW7A 2WNNA 3IGSA 3PBVA 5G2HA 4ZQCA 2NUWA 1VZWA 3EX6A 5HWNA
chains in the Genus database with same CATH superfamily
3A12A 4PTNA 3E02A 6ENLA 1KFKA 1WKDA 1NQ6A 4CUCA 1XHGA 4D8AA 2YYTA 3U4AA 1V7AA 4AD4A 1EBHA 2OR2A 2YBVA 1D2KA 3BCFA 4IMGA 5I07A 4G56A 2J74A 3I7QA 3GHRA 4I8YA 1X1OA 4YJ5A 4JX5A 3LPGA 3N4EA 1EA0A 2XIMA 3A24A 4Z1BA 3FYYA 4KRUA 4IIEA 4QHRA 4QTGA 1PXGA 3D0CA 1ZUAX 2J75A 3CAWA 4PMZA 5D8ZA 3VCCA 1CTNA 1PDYA 5DO8A 2J8GA 1P5BA 4Z08A 2NXIA 1ITXA 4OOZA 2ZOXA 1D7KA 3BLDA 3OPSA 3SUWA 1SFJA 2ZRYA 3OZYA 1X6NA 1BYDA 5E0KA 2B4GA 1RQEA 3KZSA 4C7DA 2NSOA 4L4MA 2P53A 3EA1A 3DAQA 3REQB 3DIPA 3GU1A 4FHAA 1B57A 1GHRA 3SAZA 2O55A 1X6LA 4NX0A 3NZGA 4MKSA 1W9VA 1E9IA 4WEVX 2XSAA 1OX6A 1CX9A 1TJ0A 3W1PA 1RALA 3N6HA 4AHPA 4PB3A 2ZX5A 5BCAA 1A5MC 1UD6A 1Z44A 5LGZA 3R0DA 3TR2A 4O19A 3O6YX 3O2LA 1J93A 3KCLA 4DO5A 3UJEA 3AHTA 4Z2LA 1M65A 3O0FA 3FJ6A 1LRNA 4HMEA 1T8QA 4XAGA 4X0NA 1Q85A 1ADSA 3S9IA 1BPLB 4ZZ9A 1J0IA 5HNTA 2ZWYA 3JS3A 1CENA 3FDKA 4F48A 2FH6A 2ZE0A 1JAEA 1S3HA 4WLCA 3ITTA 3MSYA 1BWKA 4PTDA 2INFA 5BMWA 1VEOA 2B7QA 3TXVA 1BG4A 1R47A 4ZO9A 1NQKA 4HMCA 3O07A 2ATSA 3ATYA 2MNRA 5BOFA 3VIOA 5HULA 4QDPA 3WK3A 3VX1A 2ZZ1A 5KEZA 1OZQA 3GC5A 3QR0A 7A3HA 4KPLA 5AYYA 1OD0A 2DV0A 5TAOA 3OVPA 2XGBA 3UXAA 2CLHA 2FVMA 2A3EA 3ALFA 2A3AA 1TG7A 4H8VA 4ML9A 2EPLX 2BMBA 4DM1A 3ZWTA 3B4YA 5G1YA 3S9YA 3GNRA 1VFMA 2E8YA 4KWSA 2WZIA 3GZ3A 1OG0A 2Y88A 1ZFJA 3RCNA 2OVLA 4KESA 3GH4A 2AKZA 3G22A 1QW8A 4PMJA 3AWOA 2C1IA 2Z28A 3AZRA 1GYNA 8XIAA 3W1AA 5HXMA 1HUVA 3ERPA 3B9AA 3OYXA 3LI0A 3WDQA 5A8QA 4LB4A 1MI3A 4HU4A 3PB0A 5AZ0A 4AD2A 2QDGA 2NQLA 3LYEA 1UKQA 4ZCWA 5C2GA 3OO2A 2O4MA 3WD3A 1E6ZA 4C6CA 3ES8A 1JCLA 4P2VA 3BG9A 4JTQA 4NZ5A 5I3GA 2QCHA 3SGUA 1QOPA 2VZTA 2V68A 1TJRA 2P88A 2ZX6A 2I9UA 3DG3A 1REQA 3P60A 4LS1A 3S8HA 3MV01 4DO7A 3IANA 5DMNA 3CHFA 4C6QA 2E9MA 3B0YA 3LM7A 5BNKA 1NDVA 1NP2A 1TRDA 2X1IA 2QAPA 4LF2A 4DNHA 3CWOX 4E2BA 3R89A 3G1VA 4DYJA 1F3EA 4M6VA 3S5NA 4K38A 1FWJC 4LC8A 4S3AA 1MUCA 3RK8A 4O1EA 4K36A 1AD1A 4JNZA 3T9PA 1HNYA 5A6AA 3H2NA 3VNYA 5DLCA 4XZBA 2OSWA 3ATZA 2MUCA 2PD9A 3GXTA 2MANA 3Q67A 5BZAA 1FH9A 5T8GA 4PH6A 5MF5A 4DO6A 3DDMA 3CAVA 3T40A 4TTGA 4L6HA 1OHLA 4GYPC 5EBAA 5LIUX 3W28A 2RGMA 1VEPA 2XVGA 3U9IA 1V0KA 1JVNA 4C6JA 4R7OA 1Q6CA 3K8LA 1AJZA 5A2BA 5LHFA 1KFBA 4XBKA 2HPMA 2VEGA 3W1UA 1QRQA 1TV7A 4H1ZA 2ZVRA 4DN1A 3WJZA 1OG6A 1VBRA 2WVVA 3TYEA 1AW1A 3I6TA 2PLJA 1HO1A 4H2CA 4H8HA 5M3WA 2YKKA 4GYFA 4ILSA 5EMYA 2Z1KA 3GQYA 3VX0A 3PSWA 4EP8C 3E0WA 1TPC1 4CD6A 1DQWA 1GQNA 3L12A 3VD5A 4CN6A 2GQ9A 3W22A 1H7WA 2WV8A 3PTQA 3STGA 1JZ3A 4QXIA 3B0VC 3HQPA 4XSLA 2OGJA 1JXJA 1UJQA 1XCXA 1O95A 1Y5WA 5K2ZA 3BMVA 3KRUA 2C13A 4PR4A 4YMZA 3DHUA 3W23A 3AUJA 5B7ZA 3M64A 1A5CA 2YXOA 3WLIA 4P7QA 1TWDA 4H9ZA 3QPZA 5CG0A 4GD0A 5A3HA 3QH2A 4UQBA 2P3EA 2JIEA 1JYVA 2G4FA 5BOEA 4IL0A 2VKZG 3JRKA 3CMJA 5CSUA 2W6RA 4AISA 3I4KA 2JGQA 4D6GA 3PTKA 2ACQA 2V82A 3UR5A 3AS0A 3LCGA 5FI8A 2HS6A 5A6BD 4UC5A 5HQEA 8TIMA 4A8NA 3W7MA 2XZ7A 4IUGA 2ISFA 4NRRA 3G18A 3LLFA 3T78A 3RPTA 3CJPA 1AMKA 1DXEA 4EPEC 1K70A 1VRXA 3PG9A 4PCSA 1W32A 2PODA 1O4UA 3EWXA 1P48A 3QQ1A 1IWAA 3LXCA 3SFKA 4WDTA 5CZTA 1DXFA 4UIOA 3LHVA 1FWHC 2FHCA 2V5BA 2W9MA 3D6NA 3MP3A 1F76A 4O0KA 4MZYA 5K3VA 4X3ZA 4IF2A 2OEKA 3P93A 4DJED 3M0VA 2QCNA 1RJPA 3BAIA 4GVHA 4R9OA 4TV5A 4AQLA 1JR1A 4LCSA 1VJIA 1CGUA 2X1RA 4QJ5B 3RAOA 5FJTA 4C1LA 1F9CA 3L7RA 1UMYA 1XF0A 1FOBA 5F4WA 3QBUA 1QT1A 4O16A 3BTNA 1FWBC 2PLKA 1EF3A 3IGUA 1QW7A 4PUMA 5XIMA 3ARYA 3FV9A 3APGA 4U5IA 3CB8A 3VOGA 4AG0A 1J5TA 4ENLA 2YB4A 3FNDA 1HJQA 5TF0A 3UFYA 2BXVA 4IXXA 1GQKA 2WSYA 1UR4A 3EMCA 4OBSA 4XSMA 4PMNA 1RXOB 1GOXA 3W7CA 4AY1A 4JFUA 1F3TA 4C6EA 3MUAA 4B92A 2Q6ZA 3WDHA 1CNVA 3DG6A 4DWSA 3TMLA 3DUGA 5I06A 4JD4A 1IYXA 3W74A 3ME3A 5H2ZA 1FWNA 3W1NA 2OSYA 4E2VA 1E1CB 1GJPA 4O1BA 1XSKA 3ZT6A 4NJGA 1LLOA 2YXXA 5F1UA 3CXOA 2VX7A 3WQVA 1HZYA 1XL9A 4QM1A 2DORA 1C8XA 5TQLA 1J0HA 2PWEA 4WD0A 4RNFA 4RDVA 2ON3A 3F2CA 3MYOA 2XSXA 3TN6A 2Y5JA 4NJIA 1F07A 4GZ7A 2PDWA 3NVTA 5B80A 5CPSA 3H70A 3AIUA 5XINA 3N9KA 4M19A 3CLMA 4LSBA 3L4TA 2GFTA 1Y0EA 3ZT7A 2ZC1A 4Z2KA 3QC3A 2GJPA 2FGZA 1V0LA 2RDTA 2OPJA 3O6DA 4I90A 1B30A 3R7MA 1IIGA 1KCZA 3WBWA 2BHZA 1YPXA 2ZUVA 4MLRA 3RCYA 1G4TA 3SEPA 3H2OA 4XZIA 4DPQA 4PTMA 3ARPA 3EKLA 3QHMA 3KLKA 1X7FA 1A4MA 3TE9A 3W71A 2Y6ZA 1QFEA 4GH3A 4AD0A 2X1SA 2VWTA 4IWWA 3HU7A 4PUJA 2ISSA 1UH4A 4DWSC 3W2JA 2C15A 3OODA 3UYIA 1E6SM 4XZ9A 1C7TA 1OD8A 1UIPA 4B3KA 1GHSA 1XGEA 2RGLA 1EA9C 3IARA 4GJJA 4XZLX 3UEQA 2WSRA 1W54A 4JQ2A 4H9MA 4PL2A 3MO7A 2YLLA 1PS9A 4G8TA 4Q8WA 1U1JA 3A22A 3T0DA 3NPVA 2RJHA 3VE9A 4DBDA 3AFBA 3TYUA 1PYMA 1XYAA 3N3MA 1HKIA 4WF7A 5K4ZA 2ZCGA 1OGGA 4PUNA 4N0RA 2AOSA 4PTWA 2TODA 4P7OA 3URNA 4S3KA 6TAAA 2NQZA 1JGMA 4LGXA 1U5JA 3VKBA 2ZRUA 3VILA 3B0XA 1LQ2A 2Z1SA 3EMZA 1I0DA 5CLTA 1EIBA 1PEZA 1VS1A 4BQ5A 5BU6A 3UJFA 3GTHA 5G4WA 1GVEA 2QVNA 1YIXA 1T96A 3AWNA 4KF1A 1LOQA 3WQDA 4P8VA 3GVVA 4LALA 5BXTA 3LGGA 3CGTA 1EYWA 5CSRA 3G24A 3RLHA 5DMYA 1LBFA 5D9OA 3CBWA 2WOQA 2DZAA 2XVNA 2VX6A 2PDHA 1JG9A 3ZMRA 2X1UA 4HNOA 2XVKA 2CZ5A 4UTTC 1W1VA 1EHAA 5HDRA 1AJ2A 1KW1A 4S3DA 4D6HA 3M5YA 1PAMA 3THDA 3R4IA 3GIYA 4IFKB 1XYBA 3E2SA 1YTEA 1FA2A 4IIHA 4UTWA 3MY9A 4OV4A 4FA3A 3AMLA 1JQVA 1DIEA 4GIRA 3WYZA 2GUBA 5AHEA 1XCFA 4IIDA 5IXEA 4C6NA 3FVMA 4M1RA 2ESCA 4WHBA 4RDYA 2PDMA 2IXUA 3PBMA 3TN3A 3SCWA 2E0PA 5D8WA 3LCLA 4KKXA 3LMYA 1TV2A 3U7BA 1TREA 1GVSA 6PTDA 5CBBA 1GJWA 4DLMA 3SUVA 3E2VA 4F0LA 1A50A 1HO4A 1EP2A 4XV0A 3M7WA 3BQ6A 2Z2UA 3HF3A 4JHOA 1Q4NX 1YX1A 4KEVA 3SECA 4S3GA 4UCGA 4BJHA 3NVDA 4R3UA 3TN5A 5DXYA 5CC7A 1DL3A 1MMFA 4J4KA 3L0KA 3B04A 4LWWA 4HNVA 4GY7A 4HTBA 1NWUA 4AEEA 4HSNA 1Z8AA 4WOZA 4DUXA 4Q7BA 3MI2A 2ODOA 2YJQA 3SADA 2RDWA 3WMBA 5BRBA 4AWTA 4PODA 3MUZ1 1G6CA 3VDBA 1AW5A 1G9HA 2VQTA 2Q71A 1XISA 3QEZA 3JUGA 3OQ8A 3WO8A 4LUIA 1R6WA 1S1RA 4C6LA 2NV9A 1RLDA 3VNJA 3CV6A 4UFHA 4IPIA 2OU4A 3L0NA 4C1NB 3OGRA 1CPUA 4XZHA 2NX9A 3VIJA 1RCOB 4XUGA 1YTDA 4MMWA 2IW0A 1GONA 2YCJA 2QCEA 3U5UA 4BF9A 3GHTA 3LPPA 5F2GA 3TJ4A 4AH7A 3N18A 4LH8A 3N13A 4JICA 1T0OA 5JQ9A 1GVIA 2PDIA 3MKCA 1CDGA 4AAJA 1C8VA 1UR3M 1PTDA 4S3JA 2AL1A 3P2VA 3QLLA 2QMKA 3V5OA 3WFZA 2NSXA 2F2KA 1XLJA 1LL4A 1JPDX 1CLXA 5BRPA 2YZRA 3GG0A 5G1MA 2PTDA 3OLEA 1ICQA 4K7YA 3NQFA 1FWCC 2J79A 1N7KA 4DX3A 5I0DA 1Y5XA 3W84A 1SSDA 1QTWA 1TA3A 4UNKA 1XR2A 2X7WA 4N9EA 3GVWA 3ZSSA 2NWRA 3SSJA 1FWEC 2WCAA 1PKNA 2EG6A 4UBPC 2FB2A 4JEQA 2ZKMX 1IR1A 2BG5A 1QASA 1TQJA 4N2YA 3R8RA 2DH3A 2CU0A 1SGJA 3T0AA 3U8GA 3SRHA 4QE4A 3QFEA 4I6VA 4DELA 4ERGA 4R88A 2DVTA 1W1IE 4Q8PA 4Q8TA 1HN1A 2DUXA 3BE7A 5D4YA 2QCGA 5I3JA 1GOKA 3JVAA 4NXKA 4LRSA 4GI9A 4U2ZA 4TV6A 1KBKA 1WNOA 1UZHA 4S3FA 3WIJA 4QR6A 3CV1A 3TMQA 4XK2A 3JR2A 2WQDA 5I78A 1YBQA 2PDQA 4O52A 3H53A 1E15A 5AYIA 4LBSA 1EDTA 3WUEA 3R13A 2WQPA 1VRDA 4NZFA 1P1MA 4FX6M 2E25A 2GVGA 1P7TB 2WW5A 3BZGA 3QGVA 4FLOA 3OW1A 3OLGA 3KOFA 4J27A 4XIAA 4AUBA 1ISYA 4M6PA 3GSMA 4ZO8A 5U4NA 2A7NA 3PWAA 4YIWA 5CBJA 2WK2A 4DHGA 1QBBA 4NT0A 5A6TC 1C92A 2Z00A 2Z7KA 1FWDC 3ABQA 3BLIA 4CEUC 2Z1VA 3ZWSA 2QT3A 3TA9A 2AQWA 3BPWA 3NCOA 3W70A 1H61A 1OSEA 4B16A 5KETA 1VD6A 3LNPA 2G3IA 4JR5A 3EOOA 1F7BA 4MB4A 2G50A 4J3VA 3OVGA 1PX8A 2NXGA 4JTKA 4V28A 3L4WA 4PZVA 4MJMA 3MI3A 1XXXA 2CZFA 2VD9A 1IXOA 1DXIA 2C1HA 4YL2A 3H8AA 3SRFA 3QW3A 1NSJA 2DPEA 2ZA1A 3HZ3A 4KEZA 3G0UA 2ZVIA 2QJIA 1V79A 3VIHA 3CV7A 5CZ0A 2WHMA 4YWSA 2A3HA 3WN6A 2RJGA 2Z1WA 1Z48A 1VFLA 1TRIA 3OU8A 2BTMA 3LK6A 3VOFA 1EBGA 5T91A 1I0BA 4UOJA 1JNEA 4HJFA 3SUTA 2G95A 4X60A 4GJIA 5HK4A 1Y65A 1L0PA 1XV8A 4IXHA 1K02A 2OO6A 1UPMB 1FHLA 3O6CA 2VD8A 1QBAA 1VBGA 4FX7A 1H0IA 5I03A 4PSRA 5EPDA 3GW3A 3KBWA 1Y7VA 3ISIX 3CZJA 5KSWA 3RLUA 3BXWA 4W88A 2V5CA 2DSUA 1X1ZA 2PTZA 4ZFMA 1BRLB 1TO3A 2QGYA 2W79A 3QR3A 1MVYA 5DQPA 1Q6DA 4RX0A 2F6XA 2X2GA 3UR8A 1QNRA 4HA1A 3BLEA 3VINA 2VGIA 2HXUA 3F4VA 3GXIA 3UJRA 3N3TA 2BOGX 2V2CA 1GEHA 2OZ3A 1A49A 2PDUA 3GXPA 3GAYA 4GGHA 5DY2A 4M7TA 1OF6A 1KM0A 1OC6A 4LB3A 3F7JA 1BYBA 4HHMA 2QKFA 1RH9A 1FKXA 1YDYA 3UWVA 1KV5A 5DN1A 3WFAA 1UWSA 4GUFA 5A8OA 3VM7A 3ITXA 4LANA 2EJAA 5A5WA 4CNTA 1OY0A 2BGSA 3PP7A 5I3KA 3A21A 3W83A 2J88A 4PUUA 5AC7A 1O5XA 5HANA 4DJEC 2D0HA 5C9WA 2PI6A 3WH7A 4QRNA 3OIXA 3EZ4A 2VR4A 1O60A 1I60A 1KFCA 1XPYA 4O14A 4UNIA 1JDCA 3P80A 4UQEA 2CCRA 3TP4A 3W7EA 3CWHA 4N42A 4QSHA 1F6YA 2GDUA 3ZJKA 2PA6A 1GQIA 4AZHA 3MSRA 4LUJA 3BOXA 5CBIA 2ZX8A 4OKDA 3N1AA 1J0ZA 3NL5A 4DUWA 1XLKA 5I3FA 4K1WA 3IWPA 4QQ3A 4Y9NA 2EF9A 3NUKA 1UC4A 4AWEA 4HN4A 2ZZ5A 4JIQA 5FF7A 1W8SA 1OFEA 3IGXA 1CXIA 5AHMA 4PGLA 1GJUA 1PUDA 3FIGA 3VD4A 5AB3A 3PNUA 2ACRA 1WXZA 1NP0A 3VNZA 3LTYA 4MUZA 1KTBA 1TJ1A 3BWWA 4ASTA 5CPTA 1Q4WA 2ZX9A 1FVPA 4QSFA 4XO6A 4Q7IA 3CASA 3LHTA 3QTPA 3V1HA 5GNZA 4HTYA 2Y8UA 1DWHM 2DFAA 4JIRA 2GQ8A 4DJFC 1XRTA 3CZGA 3W2KA 2QIIA 5HBFA 1WP6A 2QJMA 4O11A 3F1QA 2E5DA 3TC3A 1QI3A 3TOPA 4HPHA 3E2QA 2HPIA 4AC1X 1YXCA 1XGZA 3THCA 3NIYA 3WF0A 2Y8VA 3TJXA 3LGDA 1WE5A 5E6ZA 5LIYX 1UCWA 1MEHA 3WFLA 2Z24A 2VOMA 3QSTA 3W7DA 3K4DA 3VXGA 4OJYA 3MTWA 3MW7A 1YADA 4MDOA 4QG8A 2FDMA 3V5FA 3QC0A 2DIKA 1PZ2A 4L4PA 1WZMA 2OT0A 2CLEA 3P0WA 4FEZA 1VQTA 2Y89A 3ZT5A 1XQKA 2WMIA 4EF8A 5HMSA 4X9SA 3ARWA 3OBAA 1SZEA 3RYSA 9XIAA 3KZPA 1JD7A 3W7IA 3QLDA 2NVDA 1TMQA 1P7TA 2OLHA 1SW7A 2GSEA 2WKGA 3T05A 5H8PA 1GG1A 4QJ3B 1MRAA 3KBVA 1EC7A 1YPFA 4IMEA 2P3ZA 1VYPX 4R27A 5FSDC 3GVQA 2YGYA 3G1HA 3AJXA 2DH2A 3HPXA 4J35A 2E8ZA 3MP5A 1EUAA 3ANVA 2W62A 2OGYA 2VP8A 4IJRA 2EBNA 3DI0A 2G41A 3NSNA 3M5XA 2ZZ2A 2FVLA 4XTDA 4Z2HA 5KMYA 4TIMA 1N2VA 1DPMA 4ZFCA 2YL5A 3RITA 4XVEA 5L6UA 2VX4A 1QNOA 1WKFA 2WYSA 2D24A 4NZ4A 4YHEA 4A35A 1XSJA 3KE0A 4IZGA 1BD0A 4E5TA 1TX2A 4EPBC 4MGGA 3L4YA 3IIOA 4AVFA 2Y0FA 4HMNA 4ADUA 1I2NA 1ZAHA 4P8WA 2WMFA 1E70M 2WWCA 3QPYA 5CQ1A 3UZZA 3RJYA 4WCJA 1ECEA 1TJ2A 4XD5A 4LS2A 4URIA 3OLDA 2RH9A 3CV2A 1MW1A 3IIPA 2XWDA 1K9TA 2BY2A 1DTUA 4GC3A 1X97A 4QG9A 3UR7A 4IHCA 3V5CA 3AROA 5AYZA 3TVAA 5DT7A 2B81A 4M3PA 4PL1A 1EO7A 1MYRA 4XZWA 4KGLA 3QFWA 1M01A 3IIXA 1NEYA 1WB0A 3U3HA 2ACSA 1SFTA 1ZS2A 1BVWA 4WKAA 3A3XA 5BRQA 2DT0A 2GYIA 2WBKA 1P0EA 1V6WA 4R7WA 1SJDA 3QY8A 4JFTA 2OOGA 2D2JA 3A4XA 4Q4RA 4CD5A 4DUVA 2GQAA 3MWCA 3PHAA 3R79A 1D3GA 4FIRA 3M1ZA 5D32A 1HGYA 1JQXA 3GR7A 4UTMA 4MPKA 3AU6A 4HCHA 1OC7A 1ZSXA 1FUYA 4H19A 3ITYA 3J7HA 2VDGA 2FB3A 4DNMA 3M16A 3R25A 1QOQA 4UTHA 1E1CA 3UQNA 2ZFAA 3CUIA 5A6BA 5DRIA 1ZJBA 3I10A 1YTKA 4LYPA 1PKYA 1BG9A 3GWQA 2BVTA 2ZUNA 2IPGA 1A0DA 4GYJA 4B15A 1YDVA 4QITA 5C9ZA 4AZIA 4MPQA 2WMGA 1ZAIA 2PWUA 2QGHA 2J66A 4GACA 3WL1A 4DXKA 1QI4A 4PTVA 5DY3A 4B3LA 5BWFA 4XKMA 4LU0A 2YSWA 1DJWA 4EKJA 3WLLA 1YPIA 3L2IA 5BROA 3P14A 2DQWA 2OZ8A 3S42A 3EOUA 4CNOA 3A9BA 2NUYA 1LTDA 4Z1YA 2G4JA 4EANA 1POKA 2NUWA 4RDZA 3EPOA 1PCKA 3V16A 4F9JA 1XDJA 4F0SA 2AGKA 3UCDA 2D22A 3O1NA 5RUBA 3CO4A 4FPSA 5A8MA 1O68A 3O7UA 4P7NA 5CZJA 2VCCA 5F7UA 1KFEA 2PDLA 1MZRA 4RZ5A 4F2BA 3GC4A 1MNSA 1I1XA 5CLWA 2VFHA 2HMCA 2D2GA 3PNZA 3UERA 1O5RA 3W0KA 2DJLA 1BXBA 4I7VA 1BAGA 3DBPA 3FJNA 1W9XA 3SQSA 3EWZA 4M7SA 1JI2A 5H91A 1WO2A 2FZDA 4Q7NA 4KCUA 2CLFA 1ITCA 3H7VA 5FL0A 2A3BA 2VUNA 1WDRA 1EZWA 4TX8A 3S5ZA 3EXTA 1U1UA 3QM3A 3CL7A 1UQYA 3GD6A 1L2QA 3GDTA 3PY2A 3KBJA 3UVAA 4ZOBA 1UIOA 1YDNA 4JN8A 4IUOA 3BLLA 1PIGA 4HB7A 4M51A 1W3HA 4M0XA 3W7HA 4D6CA 1P0NA 4BHYA 4B90A 3A9IA 2J25A 4V1XA 2FKPA 1E3XA 1SZRA 3FKKA 2P8CA 5M2FX 1EJXC 4QJ1A 2H90A 3WDRA 5HNRA 4ACYA 3MDUA 4GA8A 4REQB 2EPNA 2EEXA 4H6KA 1FCVA 7CGTA 4J3UA 4E8DA 1EGVA 2CERA 3PJWA 8CGTA 1KGWA 3EPNA 2QVHA 2DJXA 3MBFA 3W7RA 4CN1A 1TIMA 4OQVA 4ECLA 3URQA 2FQIA 2WHJA 4BWLA 1BVZA 1P43A 5GJNA 3L4XA 3KRZA 4RZ4A 1TKKA 3AUOA 1R9ZA 2PDKA 1SPQA 5HJYA 3HQOA 1CT5A 2BHYA 3T55A 4RNJA 3GG7A 5C5YA 3NQMA 1OYBA 1SJBA 2OEJA 2IKGA 3TN4A 2XN0A 3WJSA 1UR8A 1R30A 4J3SA 4MF4A 5FKYA 2A21A 1VBJA 5BMXA 1NJJA 3S6DA 3UWWA 2WM0A 1ONXA 2QNEA 4GI8A 1OIMA 5G4HC 3N6JA 1B90A 2PWGA 3QVQA 1A4LA 1GW1A 3EKZA 4NAFA 4FXSA 1E0UA 3AICA 1UZDA 3H26A 3AAMA 3BLOA 4YTUA 1CXEA 5E5CA 4CLMA 2OYMA 3TW7A 4D71A 3T81A 2WNWA 1LT8A 2IS7A 1XIEA 1O5QA 3IEBA 1NM9A 2NX1A 4Q6XA 3RUBL 1GTEA 4JTJA 1TV5A 2CPUA 3EKGA 2BODX 2P10A 2WVUA 3M46A 3GTNA 1Q6LA 2HXTA 1NDWA 4HZ6A 2ZQ0A 3NZQA 4HZMA 1LL6A 3RX2A 3P8IA 3UA4A 4ROPA 3T2OA 2TMDA 1RY0A 2ZUWA 1EEXA 3GU9A 1XC4A 1GWJA 2YCIX 1QATA 2OKOA 3WF3A 1V3IA 2GGHA 3VTRA 4PULA 1H4PA 1LJYA 4AIEA 3G1FA 5B7YA 1OFAA 3FOKA 1BHGA 3UGVA 5I3IA 5KZ6A 2YFNA 1O1HA 4Y8FA 3LLXA 5CAKA 1H09A 3WMCA 1V08A 4J2MA 4ZVJA 3KDNA 3Q4DA 5A69A 1QK2A 3CU2A 3M43A 2PTWA 4LF1A 4Z0SA 4CGTA 1ZCOA 3VIPA 3EGJA 3BLPX 2AQVA 4HSOA 5D2YA 5C55A 4IP4A 4GKLA 3TR9A 2PCQA 3SI9A 1WAWA 3W7PA 1QWGA 3KVKA 5CJ5A 3C0QA 2Y85A 3EEGA 1EL3A 3I3DA 2NV2A 3NXFA 1TUFA 3NA8A 1XM3A 3ABZA 2RAGA 1BYAA 3HV9A 3P62A 4GNVA 4JQAA 4IOTA 4JFVA 5EMKA 1B4EA 3MMTA 3TFXA 3WLPA 2XHYA 4PRRA 3INPA 5GNYA 3WQEA 2OZ0A 4D6IA 4FXFA 2TYSA 1TSIA 2AL2B 3C86A 1KRAC 5JH2A 1TTPA 5LA1A 4OWGA 3VGHA 1CW2A 1ZRQA 5CH9A 3C2YA 3HFTA 1E4MM 3UXKA 2ZZ7A 1WDQA 4G5DA 2PDNA 4G1KA 4W7WA 1KCLA 3QV8A 3ARVA 4IQJA 5FJJA 3MUY1 4PN2A 1J5SA 2J24A 3D3AA 4MDPA 1XBVA 4EPKA 2HE5A 3OBKA 8XIMA 1A5AA 3PTDA 1PSCA 1TE6A 3PPGA 2E67A 3MUIA 3QN3A 4LAOA 1WBHA 3C2VA 4WJ8A 5H8MA 2CBUA 1VGAA 1BEUA 5E93A 1HJSA 4JYEA 3NZRA 4F0HA 1Q2RA 1AW2A 4ROQA 3NQCA 3PUOA 3L68A 3SDOA 5A2CA 2IUZA 1Z6KA 3M6DA 3EWCA 3LMZA 1QHOA 3G6LA 2Z29A 3TYCA 3W2UA 3V36A 2PB1A 3LD5A 3VNLA 1KM3A 3M5VA 1Z9AA 3EXRA 1M9HA 2HNEA 2HK1A 4MM1A 2VC9A 2F6UA 3EOSA 4NXSA 4WJXA 5LIKX 3WF1A 4B3ZA 1SR9A 3BV7A 3G1AA 2QR6A 3VD9A 3VVGA 4GBDA 2FVKA 2GVLA 4GIEA 1EQCA 3BICA 1G7UA 5DCDA 5C2CA 4JTTA 4NZJA 2REQA 2RDXA 2FGLA 1H50A 3O0KA 1L6FA 1C9DA 3WX7A 4KH2A 4DAIA 5D02A 2V3GA 1EZ2A 1XIGA 2IQTA 2QPXA 3G77A 3FYPA 1R8LA 3AIEA 1XLIA 2YDQA 2A6LA 4ZE4A 3DERA 1KB3A 3PZNA 2G96A 3PBYA 3CT2A 2WZEA 1PIIA 3UPBA 1TWSA 2QPUA 2QZRA 2ICSA 4LAZA 2WHLA 4QGCA 3H23A 3C8FA 3E96A 2QMJA 2JFEX 4UR9A 3N4FA 2ZRWA 4AMCA 5C2XA 1E4NA 2VTFA 1VBUA 3SW6A 1TTJA 3P7YA 4BCEA 1XI3A 3S5SA 4CCEA 5U7SA 2GGGA 3O3RA 2QW5A 5DF0A 1JPMA 2HDJA 2YR1A 6XIMA 3A23A 1KM4A 2VURA 2VCBA 1JUEA 2HBXA 3HBLA 4X63A 3M0YA 3WL0A 4YYCA 1GOOA 2Z6JA 4UTTA 1M1BA 4WR3A 3HOJA 1C7SA 5LNUA 4DJEA 1B3VA 3O05A 1KGXA 4WDUA 4UTIA 4BK9A 2FMOA 4TX6A 3HURA 3CMFA 5BYWA 2V3DA 3EAUA 2E6YA 5IDIA 1WDSA 1FDYA 1XLCA 1ITQA 4C90A 1MQPA 3WQ4A 2BFGA 1UBSA 4RL3A 3SUUA 3PM6A 3E38A 5HUOA 2VGGA 4UTWC 3P3BA 4B5WA 1Q5MA 1J01A 4FZIA 3WH8A 3GXDA 3KVJA 3N4AA 3VI2A 1HL2A 2WZHA 3DHDA 1KM6A 1I2OA 4MB3A 4DXXA 2PWFA 4MADA 1SVDA 4XKYB 4Q32A 4P8XA 2CHOA 4LJ3A 3WBXA 4N4QA 4AZCB 1AG1O 3KOYA 4FSAA 3EX1A 4ZB2A 2F2HA 1ODUA 5HPCA 5IBXC 2XJ7A 2QCDA 3GM8A 3MP4A 3TKFA 5LGXA 2NUXA 5FEXA 1AZ1A 3NGJA 5AZ1A 2EPOA 4PB4A 3EBVA 3GUGA 2X41A 4PRWA 1UC5A 3K1DA 1B9BA 1H5YA 2ATMA 3W7OA 1UWQA 5CGQA 3E74A 1PVNA 1DHPA 2Y7EA 1UQZA 3GB6A 2CEQA 1E0VA 2PMQA 4LTSA 1WDPA 3FVDA 4ZQMA 3W7KA 1XBXA 3PAOA 1ITUA 2YZ5A 2GK1A 5HMEA 2QLYA 3A13A 3IIZA 2QCCA 2I9EA 3SIMA 4NY2A 2PLMA 1QI2A 2WLZA 2WJDA 1KD0A 1XLMA 3IV3A 3BAXA 1X8CA 4A22A 1VFOA 1W1YA 2YOCA 4GX8A 1KXHA 5DEZA 3HTWA 1QHZA 1EPVA 1RQBA 1A5SA 3BQ5A 3KTSA 4ZQPA 4E4UA 4MWAC 5AKQA 2QV4A 2C7FA 3BSGA 1PIFA 3WNKA 2XYLA 3WMLA 1E4LA 2X42A 3GZAA 4FR1A 1XG3A 1V93A 2G97A 5A6KA 3ID7A 2RUSA 5CXPA 3NM1A 2CLOA 3GDKA 1K6AA 3ZLGA 1ADDA 3ZSTA 3DESA 2Y61A 3NFUA 1XG4A 1MW0A 1NDYA 1RP8A 4NJJA 1VFFA 4JTEA 4A29A 1QPOA 1D7FA 1CXHA 3EYPA 3TJLA 1JZ7A 5D2TA 5G2WA 3MSGA 1TQXA 2YPIA 2HISA 4XKYA 5C0QA 4BKNA 4F4RA 3CHDA 2OSXA 3AHYA 5I24A 4H8UA 4DIAA 4A3HA 2HEJA 1U1HA 5TBOA 4DJDD 4H83A 2VENA 4MNKA 4UOZA 1SJCA 3QMRA 1X38A 5K4XA 2HRWA 5JUVA 4M1BA 1TELA 3W2LA 1QI0A 1US0A 2WLYA 4BQ4A 3BG5A 3CB3A 1G0CA 1DJXA 1SFSA 3OQEA 5LNRA 4I7WA 4LBRA 1H1ZA 4EVZA 5LXEA 4JIHA 3R94A 4ZL1A 2I56A 2QQ6A 4NQ1A 2Y4SA 4CNSA 4DYKA 1U5HA 1QU4A 4Q33A 2Q01A 1XD0A 2XTKA 1IHIA 3LHYA 2NLYA 2BSLA 1UP2A 2SFPA 3K8MA 4KQNA 3URAA 3UA3A 4FOJA 2VRQA 1Q6GA 4Y9OA 4KCWA 4MJZA 3NOEA 2X40A 1SMDA 1C9WA 4HQVA 4IL2A 4L65A 3AMKA 3N9RA 1FH7A 2X05A 1LOLA 1V3JA 1ALDA 3P8JA 3LU2A 5D38A 1AMYA 1QPRA 5I6SA 2DZWA 4UFLA 4YTSA 4IPLA 4DM2A 2Z7GA 4O17A 1TWZA 2PWVA 3GTFA 2CXEA 1RQHA 1A5NC 2ZUSA 4XISA 3VU2A 2XIQA 2O7QA 2NQ9A 2QF7A 2BV9A 3O8AA 3TSDA 1OT2A 1HG3A 1QJWA 3I7SA 4G7EB 3M9YA 4X2PA 3DFQA 1KFLA 1TJPA 5D09A 3I6EA 1ISWA 2BB0A 2EG7A 1E43A 3KWXA 3A5VA 3R1ZA 4ALDA 2V38A 5HWJA 1W91A 4GMEA 2VXNA 3NQAA 1L6SA 1YNYA 5FACA 4FNSA 1X1NA 4JNYA 1XX1A 4HYWA 5D03A 3ITOA 1I6NA 1ZAJA 3GR4A 5LIWX 2A7RA 4S3EA 4U3AA 3CQ0A 3C2OA 4BQ2A 4LVAA 1V6YA 3KRSA 1JCNA 3EX3A 3DFOA 3TJIA 1F4HA 1E1EA 1MXGA 3FAXA 2X30A 2R1PA 5FF2A 3TOYA 1R3SA 4XD4A 4HU8A 6XIAA 4F3HA 1HKKA 1MZHA 4UTKA 2JALA 4CU6A 3QGKC 3H21A 1M03A 1RK6A 3FYOA 3MWAA 1JI1A 3GXFA 1JDFA 5I02A 3EB4A 4BI5A 3UY7A 3NR0A 1H7OA 1N8WA 3HPZA 2CITA 5EYWA 4KW2A 5D37A 4W7UA 5EA9A 3N19B 1S39A 4XWUA 1UA7A 3G1RA 2ZBTA 2O9PA 2ZTKA 3S5YA 1US3A 3DG7A 2F84A 2VM8A 3EWBX 2Y5SA 4AIBA 3IRSA 3BANA 4XB3A 2BX7A 4MVAA 4CKQA 1H7PA 4BS0A 1A80A 1J79A 3CUFA 3N29A 1WCGA 2A79A 2FMNA 1WOAA 3NQDA 2QF8A 1WPCA 3K4WA 4JN6A 5FL1A 2LLEA 3AYRA 3PULA 3CS2A 4GOAA 4Q8UA 4PTXA 3RF9A 3ITGA 4V27A 3VK5A 5CPLA 2PWDA 2X7VA 1J6PA 2Y7DA 3TLLA 3THUA 3B05A 3FA5A 4NYYA 1TVNA 1TX0A 2E28A 1I2PA 5IFTA 1VH7A 4NHVA 1DQXA 3CNYA 4MNJA 2EPHA 4KFPA 3UG4A 2VGBA 1YXYA 2J4GA 3CHEA 4ZEPA 2FTWA 5D33A 4CVWA 3SZ8A 1RUSA 2INZA 3IUHA 4XO7A 1F5ZA 3QGAC 4LUTA 1E5JA 4H2HA 3FEMA 2ZXQA 4HOXA 4FOUA 7ENLA 4AY8A 2CBJA 3GC2A 4NX5A 1ICPA 1PHWA 1A3HA 2GUYA 3GAKA 3ZO9A 4ZO7A 4QNEA 3SN1A 3QRHA 4JEJA 3H54A 2DP3A 3PG8A 3UU0A 3WENA 4NIRA 3W1MA 1VFHA 5CPQA 3N25A 4NNCA 4Z17A 3W7LA 4QEHA 4P8UA 2O4QA 1KXVA 3OBEA 4Y9MA 4EX4A 4Q3MA 3ZLFA 1XIDA 4F40A 1XRVA 4S3CA 5LXXA 3RGTA 3NURA 3F4NA 4RE0A 2WWDA 5CC5A 5G5IA 2C79A 4AW7A 1KFJA 8RUCA 2QUTA 4JCMA 4W4QA 5D30A 3I3EA 4WDWA 3C2EA 2WC3A 4PUEA 4R33A 3GVRA 3BW4A 4LRTA 2XDFA 1HTIA 7TIMA 3PZIA 1LRTA 3ZVHB 2WMIB 1U30A 4YCPA 2WSKA 5AHNA 4ACZA 3ONBA 3GDRA 4GH1A 3SCSA 1UB3A 3QXBA 5FA5A 3UETA 4C6PA 2DZSA 4DYEA 2DSZA 4L9YA 5I23A 3L66A 2O56A 1S2VA 4LY4A 2OWWA 4AXNA 4GISA 4TQTA 1XFBA 1W5OA 4YYFA 1E3ZA 1T8XA 4LAMA 1CBGA 1GOQA 1QWKA 6TIMA 3IUDA 5JU6A 1KTCA 4QS5A 1MFUA 1K4HA 1GTHA 1K77A 2AAMA 3HG2A 1M7JA 1Z41A 4PUWA 1XLAA 4AX7A 5E9XA 3HQ1A 2YL6A 1UUMA 1QUMA 2VJXA 4IMCA 1KRCC 3WELA 3MCNA 2OXNA 3W6YA 1E56A 4JCLA 1GK8A 2ZXAA 4ZODA 5EU9A 4YVXA 3AISA 1GOIA 1DWIM 1KCXA 1A0EA 3TWAA 1XSIA 2R8WA 3RMJA 4B2DD 3PSVA 5T9BG 4W8BA 1AQMA 1K8CA 1DJZA 4WY0A 5D2XA 4XQ6A 2FFCA 2PDFA 2DY3A 3CL6A 4IFOA 1H63A 3EX4A 3EB3A 1Z69A 4PC8A 3PJUA 4K6AA 3SIZA 1XYFA 1K7FA 3UR2A 4DJDA 1I8JA 1HVQA 1SO6A 1OGSA 2J7EA 3B0UX 4DJFD 4N6FA 4A2RA 1W5QA 4BY3A 1K4GA 1KR0A 4HA4A 4F8XA 1VLWA 1E9ZB 2DZUA 4L6DA 1V6UA 1PL9A 3WD4A 2X8RA 1OK6A 1VB9A 4KRZA 2PU1A 3KRBA 3GE7A 1OABA 4EXAA 3PR2A 3B8IA 1G1YA 2FJKA 1W56A 2J7DA 3LG3A 2DZBA 4MWAE 5ABTA 3NSMA 4WIWA 3EWUA 1S1PA 3APYA 3ITLA 5DMMA 2CZDA 2GDQA 1AQFA 4QCFA 2ABAA 2O9RA 2Y24A 2BVYA 4W85A 4IX0A 4E38A 1QO2A 3H2MA 1GOWA 1NTHA 1A5UA 3N15A 4K68A 2P0IA 3E0FA 4YWIA 3AC0A 4CNPA 2BOEX 5LKYA 1RSCA 1OFRA 3WH6A 2WHKA 1CXKA 3CUJA 1NH6A 4HPGA 1PE1A 3L0GA 3PAJA 5D04C 3JW7A 2I14A 4KRTA 4GQBA 6CGTA 3H22A 4W8LA 1QPQA 4AZ5A 1EX5A 2OLAA 2VDHA 1LDCA 1BRLA 1ISXA 3IUIA 2DSWA 3B8SA 1JDDA 2ZTJA 4D6EA 1JUBA 2FHBA 3T6CA 2QJNA 3UZJA 2Y1HA 3FW6A 4DAFA 2J9YA 1AVAA 4H6QA 2PDXA 3TTQA 5FJOA 4J5NA 4CQBA 4HK7A 3CLWA 4LYKA 1E9YB 3BJSA 5FOOA 3HN3A 1OZMA 5HJXA 2HJPA 2V2DA 4XBSA 3S83A 4JDYA 6REQB 3CT7A 4F0RA 3IJLA 3IVTA 4Z42C 3OHIA 3DFSA 4L9ZA 2WANA 3THAA 1P0DA 1R3VA 3VIIA 3P6LA 1UR2A 3EWWA 5FAJA 2EPMX 4QQUA 3ENLA 3RO8A 1K9FA 4HNLA 3N2TA 2Z25A 4GFSA 3RN6A 2CXGA 2H9AA 2UV8G 1ME8A 3V7PA 3GH7A 1MWOA 1TV8A 1XBYA 3FXYA 4F2UA 1H5VA 1FWFC 2PP0A 4ICCX 3WK2A 3RX4A 1XH2A 3ABOA 4CVUA 4WDXA 4A6GA 2AMGA 1UKOA 2HQAA 1PWMA 2XN2A 1HJVA 1IZCA 2RKXA 2C16A 2E77A 4RW5A 1ZJAA 1UZ1A 2CKRA 1BXNA 3ZR4A 2ZIDA 2HTMA 1FCQA 3S46A 3E0IA 2XIIA 3STCA 1BLIA 4K39A 3CAKA 4L1XA 3C8NA 3DC8A 2CNCA 4C5ZA 1DIOA 2IQ0A 1E0WA 4Z1DA 3TC6A 3VZXA 1W5MA 1KXQA 3L5LA 3WJXA 4GG9A 3BUVA 1L6YA 1XKJA 4NL1A 5FJPA 3SGGA 3UNDA 3KOWA 3H12A 3VC5A 1W5PA 1VCFA 2VZOA 4H4IA 3CZ8A 3EX2A 5HQMA 1W3IA 4UB9A 1XIHA 1PTAA 3M07A 5E70A 4GC4A 1W1A1 3BAWA 1P1XA 3Q37A 2HWGA 3HFYA 1PZ1A 2PGRA 2W5FA 3RXZA 1JCTA 4OOUA 2W66A 5EMUA 4B9ZA 2WO5A 3PZGA 2ZXBA 2BP1A 1RY8A 2FHFA 4RNHA 2WKJA 2TSYA 4Q8VA 4HU3A 5GNXA 2VFIA 2FZNA 1NDZA 3LHZA 1TPB1 3GNXA 3M0HA 3KCJA 3N04A 3NQGA 2FDSA 3LZ3A 3W27A 4ZTYA 1CLKA 1O1ZA 1R87A 4QP0A 1WUFA 4ZE5A 2V69A 3W85A 5CZKA 4IICA 2VFFA 3QTGA 4PMDA 1BTCA 5HINA 3BSHA 4O12A 3UBPC 3LEPA 1J12A 1LL7A 3CMGA 3F4DA 1KBJA 2KAUC 3LRMA 3FAWA 3SY1A 3VKKA 3PZUA 3C4UA 3EA3A 1LZOA 3F5JA 3B8DA 1LBLA 5AYBA 3SN0A 3B9OA 3RPDA 2PU0A 2GGEA 3UWUA 4U4MA 3UG5A 5C9XA 2CWNA 2XM2A 3SQMA 1EP3A 1E6NA 2J13A 4DF1A 2PSNA 2YBTA 2CLPA 2P76A 3B3DA 5HNNA 1OBAA 2AAAA 2OMAA 3FHQA 1HIZA 1BKHA 1T41A 1EJVC 1G94A 1U83A 3MA8A 1YBQB 2JEPA 4DWSB 1JULA 3WG6A 2DUAA 1UKPA 4PE8A 4MB1A 1R85A 3KOXA 4GIAA 1ESWA 2RFGA 2D0GA 4F0KA 1LQ0A 2QULA 4R53A 3QY7A 2WVSA 2L5HA 4IGHA 4IQEA 4POCA 3W7QA 1LLZA 5CJMA 3TWBA 4F79A 1VPXA 4PFHA 5IM51 1UWTA 4YU1A 3ZOAA 3TTYA 2R9RA 2D2HA 4GHRA 4GI6A 6REQA 4IIBA 1SO5A 2FJUB 2VZUA 3LRKA 3UJ2A 2E9BA 1AH4A 1AK5A 3DN5A 3F5KA 1E4IA 3DFNA 3AOFA 3T4WA 1AZ2A 4OU1A 2WMHA 2W92A 4TOQA 4C6KA 3EMQA 3W24A 3WDPP 3G0XA 1YHTA 3NTYA 1Q8JA 3M0XA 2WNQA 1HQTA 1ZBKA 2V0TA 5CJNA 4YPJA 4IIFA 3WSUA 4DVOA 1H2JA 4Y8EA 3REQA 4HYRA 1XDLA 2OWCA 4ZSTA 1EDGA 3KL5A 4JDBA 4D8ZA 2PZ0A 2YCKX 4AEFA 4CCDA 1XIMA 5DFAA 1DWAM 4N7QA 3DFHA 4JTGA 1XIIA 4C6MA 3PZMA 3S1XA 1JGIA 2GK1B 4DRSA 3CHVA 5DBTA 4EE9A 4OHQA 3E49A 3UXDA 5CPOA 1EOMA 2DW6A 1OCQA 5D9NA 2A5HA 1AJ0A 2A3LA 4KWUA 5DRCA 4K8EA 3CTTA 3F5LA 3B40A 3LI1A 3NYZA 1F8MA 1OC5A 3MYPA 3ZIZA 1OFBA 1NWTA 3GDBA 3VABA 1HX0A 3DHPA 1ZP4A 3U2EA 3AIQA 1YYAA 2Q8LA 1W3LA 4ZQCA 1VPQA 4H6RA 3EX6A 5HWNA 1ZL1A 3LPOA 4L56A 1FHVA 3I4EA 1OT1A 3FSTA 2GGJA 3SCNA 1G5AA 1MDLA 3SRDA 1MUMA 2XFYA 3DECA 4PMVA 1BQCA 2GJNA 1K1DA 3WBEA 1X98A 4IGMA 3M47A 3WLSA 4YTQA 2H8ZA 4LVFA 2YBUA 1JF5A 3TAKA 2WJEA 1UP0A 3FFSA 4Q4KA 2GJLA 3G8RA 1DVJA 3EDEA 2YDSA 2PC4A 1UKTA 4LCQA 4AIUA 3RRXA 1DJYA 1FH8A 4GY1A 5HUPA 5A6SA 1YLVA 4ICNA 9RUBA 2I16A 4PBFA 1DOSA 1I4NA 3MCOA 2AL2A 1I1WA 4B5UA 1G4EA 2DSKA 3HQNA 3TV8A 1BKSA 5EBUA 3K8KA 3MMUA 4HPXA 3WF4A 2DZXA 2ZUMA 4LVDA 1FCBA 4C6DA 4K37A 3W53A 2P8BA 4E6MA 2WB5A 3L4UA 5F2MA 1VYSX 3T08A 3KFTA 4ZR8A 4FK9A 2J7BA 3KP1A 4D72A 5JIWA 1YXDA 2VNCA 2VFGA 2ALDA 3EA2A 1EPXA 2HVNA 2Q8XA 2BWGA 2BY0A 4AX6A 3R11A 1BWVA 1RCXB 2ZZ3A 2WAGA 3C2RA 3CUGA 4GVFA 3WEMA 1HXJA 3TNOA 3TZNA 4WGHA 1Q66A 2DQXA 5AHIA 4DF2A 1FTXA 4HIBA 3WUGA 2B7PA 1OCNA 3H2EA 1QOXA 4AXKA 2VZSA 3LBOA 1Q7MA 3W37A 2ZRZA 3AHZA 4EAYA 4DXVA 1U5VA 3G6MA 3RLVA 1SW0A 1KLYA 2G3FA 5CSYA 3EDFA 3F2BA 3Q45A 4ADTA 3SGZA 2XGZA 4HHLA 2GWGA 4NRSA 4WUIA 3TFCA 4KGJA 3WUBA 4PCNA 1MRQA 2XIOA 4JY8A 4AVNA 4MB5A 2VMFA 3VGBA 2CBIA 3LBCA 4HK5A 1KBBA 2Y7FA 1X96A 4JPGA 3L4ZA 2OTDA 3BMXA 3S0CA 1TZ7A 4D9PA 3LM3A 4O15A 1GT8A 1RJQA 5AN7A 1FWGC 1XQLA 1V3KA 3TYZA 3VUSA 3MI6A 3N2MA 3ZS4A 4CU7A 3IJ9A 1W3NA 1WYIA 1VKFA 1XGDA 1X39A 3LA4A 4AF0A 4KIRA 3VNKA 4N9BA 4KERA 3KWSA 1H0GA 3TROA 5LNVA 3CWNA 4M6UA 3ARQA 4HU0A 9CGTA 2I5GA 4GO8A 4A8LA 1AQHA 2WJFA 5E9AA 1YW1A 3G1DA 1V51A 4RV3A 5M03A 4I9JA 4B5XA 3H24A 4WY0F 5E0FA 3W7GA 3QKEA 4LV4A 1CXLA 3MMWA 3BK0A 1ZQ5A 3WY1A 2VDIA 1N82A 3RX3A 3R10A 2E5BA 3W72A 3QSRA 4TO8A 1QPNA 3S5OA 1F73A 4AFYA 2XG9A 3U2CA 1CZ1A 1EKOA 2WJZA 4JTIA 1J0JA 1IQ8A 4O57A 4C91A 2XZ9A 5A8NA 1XLDA 4GBUA 4A2SA 2Z0IA 1A3WA 3B97A 1DP0A 4OBRA 1S5NA 2NT0A 1B3YA 4QAWA 3TQVA 3MVIA 1R9YA 1U22A 2PD5A 3S1WA 3ZR6A 5A6LA 4JTHA 4Q4MA 4BEQA 3B8TA 4TU1A 2EJ1A 1ONWA 3PB2A 1XS2A 3VC6A 3UWQA 2D2OA 1IEXA 4GABA 4ZA0A 3EDJA 2A2IA 5FF4A 5BXSA 1Q6RA 1B3XA 4XUYA 4AD5A 1H41A 3NXLA 1TPVA 5HMFA 3IIVA 3MKKA 1XRFA 4B5VA 1GNXA 1G4PA 4W9TA 5FSEC 2E1DA 4FNRA 3D3FA 5BOOA 4AC7C 3AXMA 3FY1A 3EWYA 5GJPA 1UJPA 4XD3A 4BR1A 5XIAA 3HMJG 4HJWA 4AD3A 3LY0A 4EAMA 1WAUA 3W26A 1R0MA 5JIPA 1W0MA 2JEQA 3GLCA 3QQ0A 1B1YA 2DEPA 3IRDA 2H9AB 3LCWA 2F61A 3SCVA 1VYRA 4X22A 4AB4A 1VHCA 2XFFA 1V03A 4TVUA 5EB8A 5FJRA 1QO5A 3CIWA 3U48A 3MCMA 4GNJA 4G7EA 1M41A 1RAKA 5T26A 3NJ3A 1TIWA 1EUNA 3TH6A 3WMSA 5BXPA 4KFNA 4CN4A 4KCTA 4HZ8A 1FCUA 4I6KA 4PEKA 4HOZA 2GLKA 3TSMA 1XIBA 3KW3A 2NQJA 4AD1A 3W86A 1QNSA 5A8GA 1XUZA 2PDJA 2PF0A 1AL7A 4NYUA 4NUWA 4YXGA 5FIPA 4QLJA 1R38A 2CETA 3VGGA 1HT6A 3RIKA 1W9DM 4KCVA 4GVGA 5BWAA 1F3XA 3H2AA 4WGXA 4Z1AA 1LYXA 3UJSA 2C3ZA 2PPGA 2UY3A 3H4XA 2PRLA 3SJNA 3M6YA 4K3ZA 1Z3NA 3LLDA 2GGIA 5DX7A 1VIZA 1ZBVA 2ZXDA 4CQ9A 4C6FA 1WBJA 4ZXOA 3ABRA 1EWDA 2BVWA 1S3TC 3WKZA 1SUXA 4NAEB 2O92A 3GTIA 1LP6A 3WLHA 1JCXA 1XYLA 1JZ6A 3S2NA 4H7CA 1OF8A 4O4VA 1J0YA 3DYMA 4ZGYA 4HNCA 4RZ6A 2GOKA 4LX4A 3L5AA 1CGVA 2FH8A 3NDOA 1E9LA 3KBNA 4QX4A 4ORIA 4IGNA 3NDYA 2GUUA 5CGTA 4F66A 1GOMA 3C2FA 3UPWA 4O1AA 2NT1A 3IJ7A 4X61A 4O1DA 1TPH1 3P84A 3BO9A 2DIEA 2C14A 2DZVA 3UPMA 3UCQA 3STFA 3VUPA 1FWAC 4I9AA 1V02E 2C0AA 3DOPA 3LV5A 3WNNA 2QAFA 2V5DA 2W67A 3MJMA 4A3QA 3W25A 3TX9A 3PS7A 5M1TA 3WEOA 1GCYA 2F6KA 3GIPA 1IEWA 1UBPC 4CU8A 2R82A 1IIHA 3HM7A 5AC5A 3R8GA 4BI6A 1X7IA 3NQEA 1ZNNA 4GIYA 3GXNA 2PP3A 4J7RA 2PFHA 1CYGA 3USBA 1JDAA 3OTRA 2A4AA 3G0SA 2ZUTA 2VVSA 2R6OA 3Q2DA 4GQGA 3AALA 4ZENA 3AIRA 4R9XA 2YW3A 4QG6A 3UG8A 2VHLA 3STEA 1PZ3A 2ZYFA 1DE5A 5FJUA 3S2CA 2C0HA 2ZC8A 3M0KA 1S5TA 5GJMA 1TTQA 3JZEA 4WKHA 1FFRA 5DBUA 5A6JA 1NFPA 3M0JA 1GVFA 5T9CE 4TVDA 1J2WA 3C52A 4NP7A 2DT3A 4ICMA 3BAJA 4XAFA 3GUWA 4RJEA 4OBTA 3WDIA 2DVUA 4JBRA 3QOKA 2WC4A 2J9ZA 3GU2A 1HF6A 1JD9A 1SZNA 3MV11 1XLFA 3SCTA 2D73A 3VDGA 3L2LA 4AF0B 1TYGA 1IE7C 1NFGA 3QZ6A 4WSHA 2BXYA 4ZQNA 1JZ2A 3BOFA 3S6TA 3WJWA 1DHKA 3W73A 1H7RA 1QCWA 4AEOA 2FYMA 1D3CA 4YCOA 3HGOA 5E09A 3CQHA 1K7EA 3N34A 4O8RA 1RA5A 3U6WA 1US2A 1KGUA 1T6MA 4MNMA 4NF7A 1ONRA 4GO9A 4ZB0A 3PBUA 4GUIA 3VYLA 2TPSA 3PUGA 4U10A 4OIFA 3GXMA 4BWLC 2WM1A 3DX5A 5AY7A 4NNAA 2OJPA 3DH7A 4B5TA 2GSJA 1OGBA 2G3JA 4PYSA 2YYUA 3PC0A 4CQCA 3W01A 1GVRA 3RM4A 3BW3A 1P6BA 1OFDA 1YRRA 1Z89A 2WKLA 3GG8A 4A8RA 4DF0A 4JFSA 1R2RA 4IP5A 4CCZA 4NG3A 3TZFA 3VZYA 2YCEA 1SFLA 3AYVA 1TCDA 3NQVA 3B9NA 2NWSA 3L67A 5F2LA 3CQIA 3AZTA 4W89A 4CQAA 3B9EA 4Z2IA 3O06A 3OP2A 1T7LA 2C6QA 3P67A 5AC4A 1H62A 1QR7A 2ZZ6A 4LNYA 4ZQOA 1GKQA 4FNTA 3E2RA 4YTRA 4JXCA 1JYNA 3W87A 1Q7ZA 3VPLA 2XH0A 4UOQA 3OA3A 2P1FA 4WVXA 4TVCA 3ELFA 1KQZA 1RZMA 3KTCA 1JPKA 1W1B1 3TYAA 3WJYA 2J7CA 5BXRA 5KTLA 3AXIA 4J3WA 3BCJA 1CB2A 1KM2A 3Q94A 4W86A 1Y8BA 4GUHA 1IXNA 4KWWA 4UTUA 4FF7A 3W02A 3FCPA 1XYZA 3A6OA 4GQQA 1EFZA 4RR4A 3D47A 1RPKA 5I7GA 3OA5A 3M5ZA 1MUWA 4MY9A 3VMPA 2PDBA 4IQDA 3CQKA 3BSMA 4O10A 4GVIA 2EHHA 1TZ9A 4D8LA 4JTDA 1F6KA 3FS2A 1HP4A 1IXQA 3VNDA 1E0XA 1XLLA 2PCEA 3PBGA 2NW0A 1UA3A 1ZHAA 3B0PA 4Y90A 1E6XM 1K8ZA 1AODA 3N2BA 3ZJ6A 1FWIC 1O12A 2Q09A 3OVQA 5AOUA 1EC9A 3TIMA 3ZFHA 4IFRA 4IMFA 2QCFA 1LBMA 2G8ZA 2ISDA 1IR2A 3QZAA 1CWYA 1V77A 2X09A 1S5VA 4Z0JA 4LCRA 2O9TA 1YNPA 1EJTC 3PK7A 4RCXA 2PEVA 4BFAA 1EX1A 4QBXA 2XVLA 2JKPA 1XYCA 1DEDA