3OBEA

Crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
286
Chain Sequence
IPATDAVSSATAGKKMGLQTYSLGQELLQDMPNGLNRLAKAGYTDLEIFGYREDTGKFGDYTTFIASKDYKKMVDDAGLRISSSHLTPSLREYTKENMPKFDEFWKKATDIHAELGVSCMVQPSLPRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKAGEKPEPKGTYIEELFLKNTDPDKVMFELDVYWAVMGQQDPVEWMENYPNRFKLLHIKDRWIIGDSGMMNFPNIFKKAYEIGILGYYVELEGDKKGRTQFEGVEKSAAYLQAAPFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar phosphate isomerase/epimerase
publication title Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
total genus 97
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3obeA00
1DE6A 3WQOA 4GJJA 4GLEA 3M0XA 1XIEA 4QE4A 3VNMA 4K1GA 3M0YA 3DX5A 1XP3A 4Q7IA 2I57A 3AYTA 3P6LA 1XLCA 3KWSA 1XIFA 4EACA 1I60A 5TNVA 3QC0A 2X7VA 1XLDA 1YX1A 2X7WA 2XIMA 4ZB5A 2OU4A 4QDWA 6XIMA 1XLMA 2G0WA 1XIDA 4YTUA 4X60A 8XIAA 4HGXA 3N4AA 4KW2A 2GVEA 1XLKA 2XINA 4XSLA 4QDPA 3KCJA 3UU0A 3ITOA 4HHLA 1XIBA 3ITYA 4YTTA 3ITXA 3KTCA 4OVXA 1XIMA 1XIHA 5XINA 3M0LA 5EMLA 3BDKA 2NQ9A 3VNKA 1GW9A 2J6VA 1D8WA 4PFHA 1DXIA 1XYLA 3JU2A 4YTRA 3U0HA 3KCLA 3CQJA 4XISA 4X63A 3TC3A 1XYBA 3ITVA 1XYCA 4A8LA 4QE5A 1S5NA 4J4KA 3GNXA 3BWWA 3AAMA 1XICA 1XIGA 5H1WA 3C0LA 3QYSA 3XISA 3CWHA 3BANA 3UVAA 4E3VA 7XIMA 2XISA 3DBNA 3IUDA 1XIIA 5XIAA 1XINA 3OBEA 4ZB0A 3IUIA 4HHMA 9XIMA 1XLBA 3L23A 3M0HA 5XIMA 9XIAA 3AALA 1MNZA 1A0EA 3C0QA 4QEHA 4ZB2A 2QW5A 4A8RA 1A0CA 4GQBA 4W4QA 2HCVA 1XIJA 5EMJA 2QULA 3UXIA 2QUNA 4GJIA 8XIMA 1TZ9A 2GLKA 1DE5A 3LMZA 4G56A 1A0DA 1S5MA 1XLFA 2Q02A 1QT1A 3QZAA 4ZBCA 3BZGA 4K3ZA 1XLJA 4EAYA 3CQIA 1O1HA 1XISA 3KBNA 3UA4A 4XIMA 5B7ZA 1QUMA 5H6HA 3KBSA 4XIAA 1K77A 4XKMA 3NGFA 1BXCA 1DIDA 3BZJA 1OADA 4YTSA 1XLHA 3P14A 5B80A 2G4JA 3IUHA 4PGLA 5FA5A 3XINA 5B7YA 2HK1A 5AVNA 1BXBA 2ZDSA 3CNYA 5J8LA 4DUOA 2NQJA 2I56A 3KBWA 4X61A 1XLLA 1XLEA 3KBVA 3UA3A 5C9ZA 1I6NA 4XSMA 2GYIA 5EMKA 4YTQA 1XYAA 3KBMA 3CQKA 3KCOA 4QEEA 4A8NA 3ITLA 3VYLA 1XLGA 3ITTA 3VNJA 2ZVRA 1XYMA 3KBJA 3M0MA 4DVOA 2NQHA 1XLAA 4US6A 3M0VA 3AYVA 2GUBA 5EMMA 5I7GA 3VNIA 3XIMA 1XLIA 4HNOA 4LNCA 3VNLA 4A8IA 6XIAA 2HK0A 2QUMA 3CQHA 1CLKA 3FVMA 1QTWA 5AVHA 3U3HA 3C0SA 3TVAA 4QE1A 3QXBA 1DIEA 1MUWA
chains in the Genus database with same CATH superfamily
4EP8C 2R91A 2WMIA 2GDUA 4KH2A 2WM1A 1G94A 2OMAA 4K8GA 1TPUA 4Y9AA 1WKEA 4CNOA 3TW9A 3VFCA 1QNOA 1LP6A 1K70A 1JYXA 2XINA 4W9TA 4IFKB 3M43A 3MSGA 4OUEA 2YBVA 1KCKA 2ZZ2A 6ALDA 3B9OA 3EWBX 3VILA 4IG2A 2YA0A 4E3VA 3QY6A 4WSHA 4FLRA 1UWUA 2X1UA 4C1KA 3W7QA 4WF7A 1GJUA 4US5A 2P5NA 4P61A 1MMFA 4D8ZA 4IIBA 1MNZA 4Q8QA 3WLSA 1E56A 2PDHA 3HPZA 1HO1A 1H60A 3VO0A 3PP7A 1IXNA 1DIOA 2DJXA 1JDCA 1OFRA 5AZ0A 4B5TA 4GACA 2WVVA 4ZFCA 3HQOA 3QQ0A 1IIHA 3I4KA 2ZZ6A 2ZUVA 4HOWA 3WH6A 2Y0FA 2I9UA 1EC7A 1XLEA 1XYFA 4DUWA 3N29A 2VEGA 3VTRA 2FPVA 3L5LA 3LPPA 1SM9A 1EB3A 3CQ0A 3U4FA 3WL1A 4AAJA 4LWWA 1UC4A 2H90A 3VE9A 4ERIA 4UXDA 4IMEA 1TIWA 3KDOA 3B8SA 5HAOA 1I2RA 3STGA 5M1TA 4FXJA 2JE8A 4WDTA 4P7QA 1V7AA 2PE4A 3WF2A 4LVDA 4UZSA 4LTSA 2FGLA 3KOZA 4C6KA 3WH7A 4QCFA 2Y7FA 4UBPC 4KETA 3WMLA 4WY0F 1QDSA 4S23A 4EOUA 3PAOA 2O4MA 1EGZA 2XFFA 5EFFA 1W1IE 5D9OA 5I03A 4O57A 5BOFA 3L23A 4HNVA 1ME7A 4UTJA 1Q7MA 1NFGA 3NEHA 4W7VA 3R8GA 3ABZA 2W62A 5I5RA 1DJWA 3QEZA 1OD0A 3C61A 4OHQA 2P3ZA 4QP0A 1M1BA 3ARSA 3H4XA 5JIPA 1W1B1 4HJWA 3B9AA 2OYMA 3BG5A 5HA7A 3H22A 5CZSA 1EP1A 3TQPA 5B7YA 3L0GA 2ISDA 3ABSA 3BAXA 2OR2A 3WF3A 3JW7A 4QJ3B 3NOEA 4TTGA 1Q3NA 3M9YA 1LG2A 1RH9A 2J8TA 3UJ2A 3L2MA 4HN4A 3UCQA 3TC7A 1ZNNA 3LTYA 1WBHA 4RW3A 2VGGA 4GY0A 1OCNA 3WEOA 2PUZA 2HVOA 4Y2WA 3TOYA 4JQAA 4JL1A 2W66A 4JTQA 5FEWA 4EF8A 2OGJA 3B3DA 1O5QA 3CM4A 4ZZ9A 5JQ9A 3H53A 5FF3A 2WKLA 3UJFA 2ZRZA 3H2EA 4Y8EA 5BU6A 3T4WA 3HGRA 2PB1A 2OWXA 2X42A 3GUWA 1BF6A 4ORIA 1Y7VA 4IP5A 3BWWA 1HP4A 3DI1A 2CXEA 2HNHA 3AMCA 2CESA 3GR7A 4O18A 3BSHA 3TOPA 4UQDA 1UQYA 3N6HA 4LCRA 1XI3A 3VABA 4JKKA 4L6HA 1XIJA 3RCYA 4BWLC 1KM6A 1QRQA 4GGHA 3MPGA 2DORA 4QLKA 3UZXA 3NZQA 3S1WA 3PN8A 3UBPC 3UNTA 3KZSA 4YTSA 4G1KA 1ZAIA 2QQ6A 3LBMA 3PK7A 3W1MA 7CGTA 4TMCA 4LYRA 1WKDA 4DBSA 1WUEA 2GGHA 1P0BA 3C8NA 3NURA 4FALA 3VNLA 4A8IA 1TA3A 3W86A 1K9TA 1TKKA 5FESA 5K4XA 1PWMA 2VT0A 2E28A 3TQVA 2OX4A 5TD4A 1IXPA 1SZRA 3WLHA 3WQEA 1HFBA 4M8UA 2BTMA 3T0AA 2EF9A 2C0AA 3M0YA 1FWIC 4JX6A 2PLCA 4U3AA 2DVXA 2QEZA 3IIZA 3NA8A 4GIYA 3KL5A 4H6RA 3ZWSA 1HKWA 3BMVA 4OIFA 4H3DA 2Y61A 4WHBA 2BXVA 2CLIA 2Q3RA 4IMGA 4DWSD 2LLEA 3L4YA 3DYMA 2WVSA 2P53A 2CITA 1KBIA 1MZRA 4AWUA 2C14A 4JZ5A 1FKXA 1B90A 4TV6A 4QNEA 3DFOA 3E9AA 4HZMA 1UZDA 2PAJA 1TJPA 1LBFA 2FDSA 4XAYA 2XSXA 3IAPA 1RQHA 1MO0A 4UTWC 1CXFA 2WVTA 3NXFA 4MF4A 4XG1A 3LB0A 1MQQA 4F8XA 3NAVA 2BDQA 2WCAA 3QZAA 1W3NA 3BZGA 1EWDA 5HQLA 1JGMA 2QUUA 4LB4A 2Q09A 4FI4A 4BF5A 4H9XA 4E38A 2HEJA 1EXBA 1OEPA 3GXIA 1B3YA 2NV2A 3WDIA 3GHUA 2ALRA 3LLFA 1VBRA 1NDVA 4E2OA 4IGNA 3PWIA 1OX6A 3NVDA 1GVSA 3ISIX 3TE9A 2Y6ZA 4IICA 4H7ZA 2J7EA 2VX5A 1HJVA 1XBZA 3UEQA 2ZUTA 4JL2A 3EXTA 3FVMA 1XRVA 3UR8A 5EY5A 1HZYA 3AS1A 4YL2A 2IQDA 1FRBA 3MA8A 4LH8A 5BMWA 1UOKA 2FGZA 4WCJA 4NXKA 4DX3A 3MSYA 2Z2BA 3PPGA 1I60A 2PF8A 1H7WA 2XIMA 4YWSA 1QW7A 1IR1A 1R9YA 4CLMA 2G37A 4GUJA 4P7RA 1HGYA 3CUIA 3UCDA 4F0RA 3C0JA 5EMLA 5A2CA 2VFGA 4M5PA 4YTRA 2NLIA 3B8DA 5AHIA 3SFKA 1IWPA 3F2BA 2IQ0A 3K8LA 5ECUA 2OZTA 1W54A 1GEQA 3LYEA 1V51A 2OEKA 3PNZA 3WQ4A 3W7RA 4AWEA 4GQBA 3TYCA 3POHA 1JZ3A 8XIMA 5D04C 2IPGA 1Q8AA 3AUJA 3THAA 1SMDA 1XH1A 3VIGA 1XISA 3MY9A 3NCOA 2FQIA 2C15A 2AL1A 3TSMA 3U2ZA 3R8HA 4NAFB 1WXYA 1LWJA 1F8IA 3W7KA 3ARRA 3LGGA 3NQAA 4MJ2A 2G96A 5HQEA 3W1XA 4INFA 4JEQA 4B5SA 1CEOA 4US6A 3CT7A 3R0DA 3ZVHA 1IEVA 4UFHA 1X8CA 3CAQA 2Q71A 4L9YA 4G7EB 2VZSA 1HX0A 4XD3A 5LIUX 4JGDA 1YXYA 2TODA 4NASA 1O12A 1L0PA 3IGUA 3LU2A 2FLIA 1FCUA 4HHLA 2FZ9A 3QLLA 4JCLA 5CC3A 4I9AA 1FWRA 1A4LA 1AL8A 6CGTA 3L4UA 5HR7A 1L6YA 3T8LA 3G0UA 3B0UX 3NZPA 5FEZA 3N3TA 1JZ6A 2RDXA 3QYSA 1ODUA 1X38A 4WRHA 3L2IA 4DBDA 4O8RA 4WKAA 4NAEA 4AVFA 1KWKA 2X1SA 1JAKA 3S2JA 1PSCA 3DFTA 2YFNA 4R7OA 3ZWTA 2FPTA 1C92A 3QPYA 2WZEA 4W8BA 3WQFA 1RK6A 1F5ZA 4Z2IA 3T4CA 2ZUNA 3ELFA 3O2LA 4M56A 5G1YA 5L6UA 4LUJA 5C2GA 4MKSA 1IEIA 3B0XA 1Q2RA 1XHGA 1QI5A 1DXEA 1JF6A 4ERGA 3ARUA 1V6UA 3RX4A 2WZIA 2JBMA 2VZVA 2REQB 4FS9A 4K38A 3LG3A 4BFAA 3CGTA 4NT0A 5TAOA 2X2YA 4LQ1A 3EOOA 1XLIA 3MDUA 1TV7A 5EFDA 4J3WA 1E40A 1DORA 3LV6A 1XL9A 2AOSA 4UFLA 2XU2A 3VGBA 2VFHA 1U5HA 4Q4KA 1SW7A 3EYPA 3GE7A 3H2NA 3VZZA 1CPUA 2ZRXA 3TYUA 3NQ8A 4M7SA 3V3WA 1W5OA 4FP1A 3WQDA 3WLJA 1GVFA 2D2GA 3WLPA 3M1ZA 2E68A 1RJQA 5FOOA 1L6FA 2ISSA 2VRKA 3KAOA 3JR2A 1ISVA 2DH2A 1CWYA 3GR4A 3TK7A 3TV8A 3C0LA 1BTMA 3K2GA 5GJPA 2HJPA 4HHMA 3F4DA 3OQEA 5GPRA 4D1JA 1SSDA 1R2RA 2XM1A 4B3KA 4O19A 3VIOA 1TSIA 4HB7A 3CHVA 5AFDA 2F2KA 3OB8A 3NL6A 1MFVA 2J75A 3C4UA 4FNSA 4E6MA 3OOQA 5DT7A 5B7ZA 2ZX6A 1ZCCA 4KQNA 4KEZA 1R0MA 4FR1A 3BCDA 3VCRA 5FA5A 2WOQA 1E0TA 4GWEA 4J3VA 2XN2A 1X8FA 5CZJA 1XJBA 1EKOA 3VKJA 3W7HA 4H6QA 1OCQA 1ZPTA 1HF6A 4C7GA 3QSTA 1MXDA 4LAUA 3SQMA 3B8VA 1BSIA 4W5ZA 3MMDA 5AECA 2ZADA 1LL7A 1KFEA 2A7NA 4W88A 2NX1A 4UCFA 1XBXA 2DZWA 1T96A 3NZGA 1XLMA 3BW4A 1UKSA 2WNQA 3GVWA 4MUPA 2D22A 1RAKA 4PTVA 2QF7A 3QZ6A 3R94A 1M01A 2X0YA 1PE1A 2OKOA 3CB8A 3O8AA 5G4EA 1NFPA 1PEZA 4CNTA 4XUYA 3C2YA 3FEMA 2PRLA 1UKQA 1XIGA 5LGXA 3L5AA 4J5NA 1FHVA 1UD2A 3ZSTA 1KM3A 2JF7A 3HG3A 3PBMA 3LS9A 1IGSA 5TF0A 4ML9A 1JZ5A 1VCGA 1G69A 2YW4A 3RJYA 1ELSA 3DUGA 1WXJA 3IJ8A 3MVIA 1MXGA 1S5MA 2A85A 5HMDA 5C8BB 5E9XA 1R46A 1CENA 2OB3A 3LCWA 4JNMA 2C18A 4XIMA 5HOSA 3MWCA 1K9DA 3GSMA 3GWQA 1LCOA 1V5XA 1KD0A 1GKRA 3LHYA 1CGYA 4PUUA 3MMUA 2ZDSA 1NVMA 1D3HA 3DFHA 4RDWA 3IJLA 2NQ5A 3VKKA 2Y2WA 3SCNA 1AG1O 2XPKA 3SUVA 4KKXA 3SW6A 4H7VA 5DY3A 6TIMA 2YCEA 1E4NA 4MTVA 5LGZA 3WUEA 4MFEA 1LRQA 4GVIA 2E40A 4GOAA 4JTRA 4RW5A 3AWOA 5BXSA 3AWNA 1GWJA 3MCMA 3VD7A 1EEPA 1I2OA 2Y8UA 1W3JA 2VCBA 3AQUA 1E6XM 4MOZA 4EWJA 1W37A 2VKZG 2DU2A 4DJFD 4EF9A 5I09A 1J79A 5C0QA 5CLTA 3BLEA 4NP7A 3FSUA 1TZZA 2HS6A 3BMWA 3OLGA 1KXQA 3TUUA 1K7XA 4H8UA 1VAHA 1PZ0A 1UC5A 3B9EA 3BDKA 3JU2A 4IPNB 4ZL1A 2GVYA 1WAUA 1QI2A 3AXIA 2YZ5A 4NJGA 3OTRA 3G18A 4A22A 1EH9A 1FHUA 5FJPA 4DI9A 3E3HA 5E93A 4A3YA 3R2GA 1F3EA 1QW9A 1R3VA 4P8UA 4AZCA 1XINA 2YPIA 1H41A 1VJZA 4UTKA 4S3KA 1PKNA 2WSKA 3H70A 1EDTA 3EKZA 3TKFA 4DPQA 4QQ3A 1W2PA 1E5NA 2FZMA 4LYQA 2YX0A 1QNQA 3ZLHA 4CEUC 1R38A 5A5WA 1LWHA 1LT7A 3URAA 5EL1A 2GK1B 3CASA 4EXAA 3E96A 4O28A 1AFSA 4CU6A 8CGTA 5GVJA 3VDHA 1DQUA 4JIQA 1P4CA 5I79A 2YB4A 5MF5A 1DXFA 3M5VA 1HL9A 4U5IA 3KCOA 4CEXC 3T0TA 5AZ1A 4N2YA 1JCNA 1G6CA 3HV8A 3QOMA 4GISA 2FDMA 3WCZA 2GVJA 2WVUA 3CT2A 1VFFA 1J96A 4RZBA 3B8WA 5CZKA 2D2HA 3USBA 4PCFA 5D9MA 4GJJA 2JK2A 4EPDC 1TV2A 6A3HA 5ABHA 3EWZA 3GDLA 2OJPA 3RN6A 3SCUA 3OLEA 4GE8A 1V3KA 1V8EA 3BAKA 1BLIA 4B5UA 1UR9A 1H61A 4PUJA 3BLDA 3DHFA 4XBKA 1KFBA 5HNRA 1GPWA 4FX8A 3RCNA 3UWWA 2VTFA 1VH7A 3DAQA 3EDFA 3NQDA 5CPQA 1JXKA 1IF2A 4TXEA 4H6EA 3AIEA 4UFIA 2VNCA 4U3CA 3A3WA 3VFLA 3G8RA 3AXMA 3WG6A 3FSTA 1NDWA 3RRXA 3EOEA 5M17A 2R1LA 4HU8A 1UP2A 3GFYA 1QI0A 1R3QA 2BY0A 1F6YA 3UNDA 4CUCA 2ICSA 4M80A 5AC6A 2HDJA 3E0VA 3NYDA 1KRCC 3FJ6A 5PTDA 4I90A 3WSUA 4BI5A 4MNKA 3KBWA 3NQ7A 1XV8A 5A8OA 4DWSB 3W1PA 2OZ0A 4D6IA 1PAMA 1G1YA 2DZXA 4HZ8A 3UPWA 1WAWA 4F0SA 1R9ZA 3TYDA 3KX6A 5AVHA 1R3TA 4R88A 4D8LA 1XIEA 3MU7A 1ECEA 2DT2A 4EVZA 4LUSA 2W9MA 4CU7A 3NR0A 6XIMA 1N8FA 1UASA 3KVKA 4KW2A 1G67A 3N17A 3GNPA 2Q3OA 2QCFA 2D3LA 1RPKA 1TELA 5HWNA 2P0OA 3W2NA 4LCQA 4FA3A 1H7NA 4CU8A 4XZIA 3MP3A 3WMSA 3HB9A 4R34A 1XW8A 2AMXA 3UXKA 3WD4A 3GXTA 1QAPA 1XX1A 4IIGA 3CUZA 2Y88A 2TSYA 3LHVA 1TJ0A 1TZ9A 1XS2A 2NV9A 2B31A 1GOOA 5FJIA 2J8GA 1JNEA 2PTWA 4FXRA 3GD6A 1FCQA 4QHRA 5H8UA 4IPPA 3IJ9A 2PTZA 4AVOA 2E6AA 2WHLA 2O9TA 2VD9A 5CPOA 4PB5A 4P5UA 3LCLA 1QOQA 4I9MA 3W7IA 4DM1A 4WOQA 2GJNA 3MI2A 5A2AA 3PAJA 1FWHC 3EPNA 3M5ZA 1ZU8A 2OZ8A 3LXBA 4MDPA 2QF8A 3MZ2A 1EDQA 3WBXA 3S1GA 3NEVA 2WSYA 4PSRA 1LT8A 4REQA 3STPA 3DBPA 4QDWA 3BW3A 1E0UA 4KCVA 3TYEA 1JIBA 1MZHA 4B15A 3LHTA 1B54A 1E1EA 1Q4WA 1GW9A 2DQWA 2YBTA 3VKDA 4PFHA 3GXPA 1JCLA 4GKLA 3KWXA 3W7OA 4J4KA 2WMKA 5FF7A 3IGXA 2DJLA 3LA4A 3L21A 3N6QA 1A53A 1LOSA 1K03A 2GSJA 1UR4A 1LF1A 4XX6A 5D2XA 2H9AB 4IHCA 2L5HA 5DT5A 1JZ7A 4AIUA 3BV4A 3NL2A 3S5OA 2D69A 2OOFA 1AQFA 2X40A 4O13A 1ITQA 3PPHA 5LIKX 4Q22A 5JH1A 1YMYA 2CKSA 5REQB 2P88A 1PO9A 3GAYA 4Z0SA 1VP5A 1R85A 1EX5A 4ZO7A 4AZ5A 4IISA 3IS4A 4KWOA 3XINA 2Z1WA 3F4CA 3WQ6A 3AZRA 3KBVA 1EEXA 2J4GA 4MLRA 3VXGA 2JKPA 2VUYA 5F2IA 4GABA 4WJXA 1H1NA 2CETA 3GFZA 3KHDA 1ZAJA 7REQA 4XBSA 4ZOAA 1I2NA 1MEIA 4Y96A 1W3KA 3A13A 3W27A 1GGOA 4WGHA 1YBQA 2FHFA 1U33A 4RNJA 3GXDA 1AW1A 2BLEA 3BLIA 2XVLA 3L4WA 3N04A 4FSAA 1XIDA 2YL6A 3VINA 4ZQOA 1XLKA 3I6EA 4WDXA 4Q4RA 3EAUA 4RL3A 2PDGA 4Q4QA 3R5EA 3IRSA 4CQDA 5TBOA 3CIXA 1CDGA 4TX9A 3GNXA 3N4FA 1VJSA 4DO4A 5A95A 1P43A 5GNYA 3DBNA 5C9WA 4LUYA 4LRSA 1IT7A 3WFAA 3PZMA 2QGHA 3DG3A 1J0KA 4L7ZA 2QJGA 3WNMA 1YTEA 1ALDA 5HUPA 4WXYA 3U5UA 1DVJA 4L9XA 2PDNA 3W3OA 1EO7A 2R14A 4PB3A 1QUMA 1IQ8A 2WB5A 4O10A 1XDMA 1XBYA 4F40A 3R0KA 3I4EA 1HG3A 1UCWA 2QCHA 3OBAA 2PC4A 2GYIA 2E5CA 3G8EA 4YTQA 5LHEA 4UTHA 1VQTA 3REQA 4WY0A 2HXTA 1F74A 1UH2A 3UP8A 5I7GA 2WWCA 2Y5SA 1GYMA 3GTNA 3FXGA 4IMCA 5I3KA 2WKGA 5MKGA 2NLYA 1JNDA 1TZ7A 3OVGA 1E15A 2YL5A 3BW2A 2PTYA 2E67A 5DQPA 2EPHA 3W28A 5C9XA 4JIHA 3GDKA 3UQNA 2NSOA 2OU4A 4D6HA 1DWFM 1A5BA 3ALGA 1M9HA 2NXIA 3P5ZA 2Y70A 3FDGA 4DB7A 1CTNA 4MWAD 4OVXA 1XIMA 2C91A 2D3NA 2KAUC 3HGOA 2PWHA 3SBFA 1YNPA 3I6RA 5IDIA 1FY6A 5HMFA 4NQ1A 3TC3A 3SGGA 3IJIA 1ZENA 5LA2A 1V3IA 2DSKA 1SJDA 3UVAA 3TW6A 3TXVA 2POTA 1QWKA 5C71A 3GG8A 4POCA 1HW6A 2VUNA 1TMQA 1W9UA 1TPFA 1TYGA 2OKTA 3KDNA 3AMKA 1I75A 1EQPA 1A0DA 1MNSA 6ENLA 1R87A 3MV11 5DMYA 2WMHA 1W9DM 2J7BA 4MUZA 3V5FA 4IPLA 4MJMA 1A5LC 3EWXA 3M6YA 3SY5A 3TWBA 3P2VA 4V28A 1HGWA 1R3RA 3VOJA 5A6LA 3TQ0A 3LTSA 4OV4A 4CNPA 4Q8NA 3LRMA 5K7JA 1B31A 4FK9A 3FHAA 4HU0A 3VYLA 1KLYA 2RKXA 1AUSL 4B5VA 1IXOA 1NEYA 2BHUA 1UHVA 4C1LA 3PB2A 4WZHA 4L4PA 1QWGA 4IP7A 1UZ4A 1LOLA 3MP4A 1YPFA 4DEFA 4ZQPA 4PL2A 1A5MC 4GUGA 2WHMA 5FJTA 5K4ZA 1DJZA 3DKLA 4F0MA 1FWEC 4K8EA 3TONA 1CXKA 3CMJA 3VDBA 2XIOA 4O0QA 4PTMA 3M5XA 3P81A 5BXRA 4IQLA 4GQ0A 3ZR5A 1OK4A 5LA0A 5DBUA 4ICNA 2ANUA 5IHSA 3NQMA 2H8ZA 1BPLB 5AOUA 5D8WA 4JFSA 1OT1A 1GEHA 3OEXA 4US5D 5F4XA 2BS9A 1BQCA 3BOLA 3GDTA 4I8YA 3B04A 3ZYZA 1QOPA 1JDAA 1EGVA 3B4YA 2GDVA 1ZY9A 1XPYA 3UXIA 2E1WA 1P7TB 4E3TA 4UTIA 1DE5A 3T08A 1WKFA 3V0TA 4AW7A 1CX9A 3D47A 2E77A 4FAMA 4UQ9A 1R2SA 3F4NA 3EKGA 1DL3A 4GI6A 1WNOA 4JHMA 1WBJA 1E1CA 3R1ZA 1F3WA 2YL8A 3VU2A 1N55A 3FAWA 4ORMA 3KVMA 1K6WA 1OINA 5KMYA 1C9DA 3KZPA 3L4ZA 1VIWA 2WANA 3IARA 1OGSA 1E6RA 1P0DA 2B7NA 4LV9A 2ZE0A 3Q58A 4FNRA 3L5MA 4K1GA 4R85A 2NUXA 1OSEA 4NZ3A 1RQEA 4AD3A 3LV5A 3PTQA 1G01A 3CO8A 2FPYA 2V3DA 2GVEA 3B8UA 1RY8A 1ML1A 3U6WA 4WOZA 5GNXA 3QRHA 4IH3A 5FJUA 5A8GA 4DIAA 1SMAA 1R9XA 4AX6A 1EXPA 5E9AA 1LBMA 3RG6A 2G4FA 3WQ8A 4GYKA 5JBDA 4L61A 3HN3A 5A6JA 2A2IA 3U2CA 5IDZA 4BS0A 3PFRA 1M03A 2PA6A 3UXLA 1W1A1 3QR0A 5TIMA 1KBBA 3L4XA 1GOIA 4O15A 1XLJA 3THUA 3PZ9A 5BYWA 5K3VA 2GPTA 5E70A 1TPB1 2DZUA 5HINA 5IOBA 3IEBA 1PS9A 5A6BA 1IV8A 4L5ZA 3T1GA 3C8FA 3BK0A 3B40A 3R12A 3AXHA 4LF1A 2DZBA 3AS3A 1MEWA 3WFLA 2EEXA 2HS8A 2VEFA 1XLGA 1O5KA 4ZTXA 3TN6A 2GL5A 3C3UA 2ZOXA 1C91A 3OODA 4NVTA 1W17A 3UWZA 3N2TA 5D9NA 3TQKA 4UOZA 3MS8A 3CAVA 1JZ2A 3UPBA 3M0ZA 1H4PA 4EE9A 2GGGA 2X16A 1IEXA 5DX7A 4Q6JA 4JICA 4TV5A 1KM1A 1VPYA 4JPGA 2INFA 4D6CA 4X60A 3N4AA 2VC9A 3S4TA 3MI3A 1XSIA 2ODOA 1LJYA 3LQGA 4AEFA 3NQBA 4IFRA 1F7BA 3SCSA 2G8ZA 3LUTA 4QR6A 1AK5A 2DZAA 1TTJA 1YXCA 3O0FA 3O6YX 2XH7A 3RM8A 2VRQA 2Z28A 3U48A 3RLGA 5CSSA 4EKJA 3FK4A 3LLXA 1QXLA 1ZFJA 4CN1A 1Q6FA 1JULA 2VEPA 3PG9A 3O07A 1O4UA 2WNNA 2QCDA 4AD5A 1BYDA 3SSZA 3MSDA 3H7UA 2Z1BA 4GUHA 5C2CA 1ZJBA 4DJEA 3HA1A 3O15A 1E9IA 1K7FA 3TROA 3B0PA 3W2JA 2AL2B 1K02A 3S47A 4U2YA 3S5SA 2YXGA 3NWRA 4RNHA 3E49A 3LSBA 2GSHA 4W8LA 3U2OA 3P8IA 4QBXA 2IKHA 1ICSA 2BMBA 2X41A 3TYBA 2OQLA 3BV7A 4WQ6A 3TVAA 3T0DA 1M04A 3FCPA 5AHFA 1VEOA 1KFWA 1V6WA 3KOXA 2QJHA 3SIZA 1BWVA 4XZBA 4FPSA 1A80A 3HIJA 4TVUA 2Q6ZA 2QVNA 4E4UA 5I07A 3WYZA 4MIMA 3SUSA 1IGWA 4L4MA 3EX1A 4GPNA 1UKPA 2IS7A 3ITOA 4Z2LA 3OIXA 4GIAA 1TR1A 1ZHAA 3G1HA 2DP3A 1DPMA 5CAHA 5LXEA 2J7FA 3L9CA 4H4IA 1FH9A 1I1WA 3PM6A 2XWEA 1O5RA 2C13A 2SFPA 1HT6A 3HZ3A 2VVNA 2JQXA 3IRDA 1KQZA 1OFBA 2Y8KA 4O11A 3NYZA 3KTXA 2BNJA 1ZGDA 4N9BA 1YTDA 4XD5A 3F1QA 1LQAA 5DLCA 1RVGA 3ZZ1A 3CHCA 1SFLA 3NUKA 2DT3A 2GJXA 4FB7A 2X1RA 5F1UA 2CCRA 2G4JA 4X0VA 3G1RA 3IIPA 1QR7A 3T7VA 2DT1A 3MW7A 4HOXA 3ZSSA 4B4FA 1HO4A 3IANA 3RILA 3G1AA 2CLKA 3I7SA 2RDTA 1MWOA 4A3QA 3G1XA 4PMYA 4NY2A 5G5IA 4LB3A 2EG8A 4FOKA 1J5SA 3H2AA 4FHAA 3THCA 3UJRA 2BVDA 3CL7A 1UH4A 2GQ8A 5A8MA 4FOUA 3H7RA 4HGXA 4OWGA 2ADAA 3BSGA 4JIEA 2BVYA 2WMFA 1OIMA 4OJYA 3M0LA 4M1RA 4N9CA 5BNKA 2R24A 3EDDA 4MMWA 2PP0A 4MNMA 5DFAA 2YYUA 3PJXA 3H8AA 4GCXA 4L1XA 4I6KA 1NARA 3KRZA 3AYRA 5H1WA 2RGLA 3KOFA 4RPQA 3URNA 1UMYA 5JXQA 1S2WA 1TTQA 4HKPA 2PU1A 4ADTA 4R5EA 3I65A 4IL0A 2CLEA 1NFBA 1BFNA 2PD5A 4DBUA 5I2UA 2F6UA 2PDCA 2ABBA 1LROA 3P0WA 4DI8A 3LXAA 5IBXC 1FWSA 3WNKA 4LPCA 3MJYA 1KO0A 2I56A 2ASHA 4DF0A 1EL3A 4GG9A 1UWAA 3THDA 2QYGA 5FEXA 4NJHA 4H7CA 3XIMA 3GS6A 5ABGA 2IKIA 1TV4A 2BP1A 3OG2A 2VX4A 1EA0A 2WCSA 1GNXA 3FLUA 3FX4A 2PDBA 5DMLA 2W27A 4C6LA 4FMVA 2VO5A 3FA3A 3TLQA 3A9BA 2I57A 2J27A 3QC0A 1MEHA 4FNQA 3GH7A 3KOWA 3ZT5A 5D02A 2AAMA 5CJ5A 4UTLA 1XFBA 5AB3A 4LW7A 1XRTA 1O7AA 1KFLA 3UWEA 4RDZA 1JDEA 2QV4A 5J5RA 4NG3A 4AXKA 4OT7A 3PZIA 1P5BA 4CQAA 5KZEA 1XUZA 2NWSA 2BASA 4N6EA 3MVTA 1Y5WA 4YLWA 1VENA 4TU1A 3WNPA 5I3GA 3WK3A 3EOLA 2DVTA 3BQ5A 1VHCA 4XWUA 5KZDA 2PWVA 1GVRA 3RLUA 3QGAC 1WZAA 2J25A 3G1FA 1CXLA 1FXQA 1XG3A 2XIBA 1P0KA 1KM4A 3QZEA 1TPDA 1CCWB 4MWAB 1PCWA 4JIPA 1QFEA 3NZRA 3CUFA 3A22A 5I77A 1EP2A 4YU1A 3HM7A 4RDVA 2ZXBA 1K8YA 3ZMRA 2WK2A 2AKZA 1XH2A 3VUSA 5EMUA 4EK7A 3GU2A 3CB3A 2RJHA 3S42A 4JY8A 2YCLB 4O17A 2DW7A 1K8ZA 2FKPA 2B7PA 4IGHA 1F3XA 3PS7A 1Q6RA 3UW6A 5A6KA 4AC7C 5KEZA 4AZHA 1FWJC 4ATWA 3AYTA 3KXQA 1PX8A 3S6TA 5C7VA 1XIFA 1TFVA 3V18A 2WPBA 1DEDA 4V2XA 1VPXA 4C91A 1A5NC 1M7JA 3TTEA 3K1GA 3E2RA 1R3YA 1TJ2A 4DJDA 3ATYA 3T0CA 2OYLA 4OGZA 1JQVA 1XYCA 4B9YA 3TNBA 4GI4A 2XN1A 4KWWA 5XIMA 1V6TA 4PFMA 1ZBVA 4UNKA 3SI9A 1A0CA 1FCVA 2FHBA 2WMIB 1ICPA 2PP1A 4L1GA 3KVLA 4GC4A 3K46A 1KNWA 3AIWA 4KFOA 4R53A 1DJIA 2NT0A 4IMDA 4O53A 2A79A 3CZJA 1P0NA 3NQVA 3T8QA 2Y7EA 2HK1A 3QMRA 1C90A 4P2VA 2PGRA 3BQ6A 4BKNA 1YRRA 3M64A 3TYZA 1QO2A 4IG2B 1KRBC 3IAQA 1NOWA 3L12A 3WENA 1EYWA 1VYPX 2IW0A 4KEUA 2J7CA 1TMHA 3ATZA 3GFXA 3NQFA 1T0OA 2YDRA 4TQTA 4GLEA 1JUKA 4D72A 3ZXWA 3EKLA 2ZC1A 1CGTA 1TRDA 1B3ZA 2Y89A 1XXXA 2XH0A 4ICCX 1NP0A 4UR8A 3EWWA 1TQXA 3TJLA 2RJGA 3LX9A 1TV3A 5KINA 3UPMA 2ZVIA 3SGUA 1A47A 1C8XA 3CUXA 1V6VA 2CW6A 1POJA 3V5CA 5HMSA 3H55A 1CLVA 1M65A 3FFSA 2FIQA 3VCNA 1V7YA 2ZQ0A 3PJWA 1WOAA 2WAGA 1Z69A 2CLMA 1P6WA 4NAFA 2XGIA 1Q6LA 5I23A 1CZ1A 1VFMA 1QNSA 1H11A 3W7PA 4XKMA 2CYGA 3T09A 3WUBA 1XRFA 4A4AA 1GTEA 2CPUA 4ROQA 3S5ZA 5AYIA 1E6NA 4AU0A 3RMEA 1XYAA 4A8NA 1A5CA 1ISYA 1VS1A 1UUMA 4X2RA 3TFXA 3TJ4A 1QTWA 5DF0A 3U2EA 1S1RA 1UG6A 1R30A 1GZGA 2WZHA 3SN0A 1C8YA 3QPZA 5EBUA 3GY1A 3AU2A 3UY7A 3QMSA 2CWNA 3DHUA 3KP0A 1Z6KA 1XD0A 2GJRA 2YKKA 1WP6A 1DWJM 2VOMA 3NVTA 2QVHA 1FTXA 4Q32A 3DECA 5DCDA 4CCEA 3GVVA 4C6CA 1VZWA 3EDKA 1CXIA 2ZIDA 1KTBA 5I02A 2RH9A 4GO9A 3W9ZA 4CN4A 1DKWA 3N2XA 5SWUA 3NO3A 4X22A 1YHTA 4M1BA 5BCAA 1P1XA 2QULA 1H0IA 3LMZA 2FZ8A 3BGJA 4H83A 4AMAA 2R1KA 3GTHA 4TIMA 5CC7A 7TAAA 1B30A 4AYSA 1RVKA 4XD4A 3VPLA 3DN5A 3MMWA 2VWSA 1KBKA 4PR4A 3G1DA 2NQJA 1FWWA 3CHEA 3CTTA 3AROA 4FIQA 2X05A 4EXBA 4KF1A 2DEPA 1SUXA 4DWSC 1UIPA 3OHMB 2Q8XA 3VIIA 1T8QA 3WJSA 2OLAA 1AZ2A 2Q01A 1V0KA 2UY2A 2V67A 4PC8A 3SRKA 2PFHA 3E0LA 1RA5A 3G77A 5F4SA 3M6DA 1U83A 3VOGA 3GUGA 1OCBA 1JF5A 3MUZ1 2ACQA 4N4PA 1PWLA 4LEQA 3CUHA 3WK0A 3GHTA 1MDLA 3VIFA 1PBGA 2EPLX 3PANA 3TTQA 5C70A 1O60A 2VX6A 1H09A 1EBHA 2WHKA 4PMXA 4YCPA 5EPDA 1YNYA 3PZNA 3T44A 1TA3B 3ARXA 4OECA 3OZMA 4O0ZA 5H8PA 4IF2A 1TPVA 9XIAA 3VD4A 2E9BA 4WX2A 3UXDA 1FWFC 3UWUA 2QCMA 3SCWA 3APTA 4KWVA 1BVZA 1B4KA 1UA7A 2UWFA 1GOQA 1BAGA 3S9YA 1W91A 5A8NA 1US0A 2VCCA 1SO6A 2PLMA 4WXZA 1EJRC 3DERA 3K5XA 1XLHA 4XV0A 1TUXA 2I5GA 4J9JA 3IIVA 3CS2A 1TPH1 5H2ZA 1JL8A 1KKOA 1SZEA 1ZP4A 2Z7KA 4RJEA 4MY8A 4ES4A 2EKGA 1UJPA 3JVAA 2JKAA 1UA3A 1TWWA 3U8GA 1OYAA 4UZUA 3IV8A 1CXEA 2G41A 1A5OC 1EQCA 2HXUA 4Q8OA 4B3ZA 1LOQA 1VIZA 3PFMA 3E5PA 1F6PA 4D9PA 3UR5A 3W00A 3KE0A 1W9XA 1US3A 1LRNA 5D03A 4W89A 3QH2A 3V7PA 1OX5A 2B4GA 2ACUA 3VOFA 4K39A 4NX0A 3RR1A 4RZ6A 4NX5A 3VGEA 3VMOA 1P6BA 4OQVA 2OTDA 3SCQA 1Q4NX 4IIHA 1E4LA 4RK8A 1SO3A 1KB3A 1YDYA 2WYSA 1JPMA 4M29A 4QJ1A 2A7PA 2VX7A 2ZRYA 1UD4A 2FZNA 3WF0A 4B92A 4MLJA 1QHPA 2R82A 2D20A 3W23A 1UH3A 1O94A 3R25A 3GM8A 4G9PA 1Q6OA 2YCKX 5DELA 4KCWA 3EDJA 3LOTA 2NW0A 4O1FA 1OY0A 4IQJA 1SYTA 4AISA 1KM0A 1UBSA 4XIAA 2GQ3A 5ABEA 2YW3A 1SZFA 3ZO9A 2ACRA 2ZXAA 5FSDC 3AC0A 4H00A 4V27A 5I6SA 3W85A 1W3HA 3B9NA 5B80A 1D8CA 4N0RA 3KRUA 4H19A 4NXSA 1R6WA 4CCCA 4BY3A 4M6QA 1PIGA 4L64A 1AW5A 1FWGC 5G1TA 4HCDA 5C5YA 1T40A 2PP3A 1QCWA 3AIRA 4PE8A 5E0KA 1JRCA 1KTNA 2OLSA 4RE4A 5DCEA 4MGGA 1OFOA 4RX0A 3ITCA 2PU0A 3H54A 1SO5A 1ZBCA 2XVKA 2Z00A 3WBAA 1JJKA 4BJHA 5HBFA 1CGWA 3F5JA 3A4WA 1V6XA 2HBVA 3W2MA 2E3ZA 4DLMA 1W2VA 4JTGA 4E0CA 3VNKA 3UYIA 5AYYA 4PCTA 3N19B 1HVQA 3EB4A 3E38A 3PNUA 5LIWX 4F9DA 1AD1A 3FYPA 3PVFA 3W1RA 3ZVHB 4PA8A 3VM7A 4QJ4B 1HQTA 4P8WA 2J77A 1M41A 1EP3A 5CH9A 2E8ZA 4DYEA 4GUFA 2OYKA 3QV7A 5IRPA 2QT3A 3SN4A 2X0HA 3SUTA 1P0EA 1J12A 4C1NA 3TN5A 3KL3A 3MYPA 3RGTA 3M16A 3WNOA 2GQAA 1BEUA 2CZEA 2ZDRA 4BQ3A 2QMJA 4CD5A 1JGIA 1VFLA 3LNMA 4R3UA 3O9NA 2GGEA 3B06A 1VC4A 5CSRA 2PTXA 1VFTA 4AY7A 3ARWA 3QTPA 2ATMA 3TTOA 1L6GA 3CQKA 1VPQA 1C7TA 5E09A 5A6SA 2Q8ZA 1PJ9A 4NNCA 1TVLA 3M0MA 1BVNP 3OGVA 3PB0A 4TO8A 3Q2DA 1JFXA 1KKRA 4M51A 4NAEB 2XDFA 1KWGA 3EZ4A 2BBFA 4A35A 2VFDA 3GVGA 4R9OA 1SZNA 4FLSA 4AXNA 2J9ZA 4ZVJA 5E5CA 1T8XA 4I6VA 1RLCL 3FY1A 4WEVX 4K7YA 1QPRA 2PMQA 4AEEA 1KXVA 4YTTA 1IIGA 3W75A 2VR5A 4Y6GA 2O7SA 4D6DA 1G4SA 3QVQA 1L8NA 3LRKA 3QR1A 4DXVA 2QDEA 4OUIA 1VB9A 4XZWA 1HJSA 3RLHA 4JBRA 1LLWA 4QAWA 3CWHA 3BPWA 3DFSA 1XIIA 4IPJA 1S5WA 4D2JA 1J5TA 3UG5A 3DDMA 5A8PA 4S3DA 3IV3A 9RUBA 1WDRA 4LBRA 1KQYA 3W37A 1LBLA 1C7SA 4KCTA 1FHLA 4RXGA 1HP5A 3BVJA 3DC0A 2QCNA 4ERAA 3HOJA 4JTAA 1I2PA 1GOWA 5BWFA 2EAWA 1UKOA 4MVAA 2ATSA 1CGVA 4JQ4A 3WBEA 4LSBA 3W01A 3N34A 3N14A 4G2DA 1EHNA 1OFDA 5CLWA 4GBUA 4PEEA 2NQHA 3LCIA 3MB9A 1YDOA 3WY1A 2FTYA 4Y9PA 2BXZA 2ISWA 4W7UA 4QS5A 1UR2A 4WUIA 1WDPA 3NG3A 2Z2UA 5LNWA 1V4YA 3LRLA 1JYNA 4UMCA 2G0WA 1A3HA 1ITCA 3NZ1A 4P7LA 3IGSA 1Q6QA 3M41A 3ID7A 3PJTA 3N9RA 2EKCA 2A3HA 3EXRA 4I3GA 5HUOA 1EC8A 3HFTA 1I2QA 3AAMA 1QPOA 1UD5A 1WDSA 2XVGA 2WLYA 4PTDA 5XIAA 2V2CA 1XRSA 4IIDA 1ZS2A 3OA5A 5I24A 3TU9A 3GTFA 4HK5A 3LM3A 4P7NA 3QMTA 1QHOA 1LZOA 2WNWA 3RITA 5A8QA 1UWSA 2FYMA 3Q94A 1E3ZA 4DYKA 1JZ4A 1ME9A 4DJFC 3HPFA 1WUFA 1EFZA 4PBGA 2BOEX 1RUSA 3MHFA 3QC3A 4I7WA 2D73A 1Z32X 3A21A 1Q6DA 2ON3A 1LL6A 3H2FA 5EMKA 2POZA 4QEEA 3KBMA 1XYMA 1SJAA 2XSAA 1XPGA 3M0KA 1NQKA 2R94A 3DEQA 2QCLA 3HTWA 4NRSA 1XQKA 1OABA 3SN1A 2O9PA 5M03A 2Z6JA 1PIFA 3OQ8A 4LUTA 1PPIA 3KVJA 2HQAA 5EYWA 2PWGA 2ALDA 4BK9A 4FOJA 1XLCA 4IFOA 1YYAA 3FYYA 4AC1X 1R86A 4EXQA 3WBWA 1R7OA 1JUBA 5JBEA 1Q2SA 3FYOA 3SO7A 1U5VA 3W7MA 4JY9A 4R33A 2YJQA 5CPLA 5M5DA 3AMGA 3H4GA 4LJ3A 3GTIA 4JFVA 1GW1A 5CPTA 3VA8A 3ME3A 2WQDA 5CBJA 5I3JA 3S6DA 1GONA 1WDQA 2V2DA 4MZYA 3EA2A 1GOMA 4GI9A 1BD0A 3WF4A 1MUMA 2D0FA 3E2VA 4GJ1A 4OV9A 2YLLA 3KW3A 1D2KA 2Z25A 3NQCA 3A24A 2IPFA 1LUCB 5H6HA 3W7CA 2FMNA 2E4TA 5F2MA 4URIA 1UR0A 3GG1A 4HK6A 1DIDA 3A4JA 2Z1KA 2NT1A 5AYZA 3EMQA 3WJXA 3WDRA 3SFWA 2ZX9A 4ECLA 3VOCA 1ZTVA 3HJEA 4L80A 2FTPA 1E4IA 1ZBKA 1DWAM 5CJNA 4AZCB 1VRDA 4H8HA 1KRAC 2ZC8A 3B97A 2BGNE 1QO5A 4XO7A 1D3CA 4S3BA 1OHLA 5AC7A 3AXKA 3EX4A 1E3XA 3QHNA 3DX5A 2GGJA 1NDZA 2G3FA 2BVWA 3C86A 3VK5A 2CERA 3A12A 4GXWA 4FLOA 3VDAA 2PRMA 4OZOA 1UYQA 3MMTA 3W83A 3WH9A 4Z08A 5LIYX 2VP8A 3N9SA 5G2WA 4N7QA 4ZTYA 4DQWA 1XYLA 3AMDA 5E0CA 1ONRA 4D8AA 3OVRA 4UQCA 2V5CA 2ISFA 4JCMA 3INPA 1GQJA 3TNOA 4M82A 3W22A 2ZE3A 5AHEA 3V1PA 4KEMA 1MW1A 4GIRA 3R58A 1WDWA 3GZAA 3W6LA 1X1NA 3S2NA 3GHSA 3LBOA 3ABOA 3TEVA 3CXOA 4GH3A 2W63A 5A6BD 1DJHA 2ZFAA 3DHPA 1YW1A 1XC4A 3PTMA 3V35A 4DO7A 3QM3A 1TREA 2A6NA 3N3MA 4DXXA 3S6OA 2BODX 1Q8JA 1YDVA 4Z42C 3GXMA 5DBTA 1ENUA 1RK5A 2PLJA 3T6CA 4J3XA 2VR2A 4FO4A 2XG9A 3TN3A 1W1PA 3W26A 3IPWA 1G5AA 3PBUA 3VDCA 4JQ3A 1UD3A 3V0UA 5HWMA 2D0GA 1DWGM 3U3HA 3WF1A 5HULA 4L6OA 4QTGA 2VEIA 3UZJA 1V0LA 5HNTA 1W8SA 2VXNA 3RPDA 4FNTA 5BRPA 3GU1A 3BSMA 3GC4A 3MWAA 1J11A 1S1PA 2D23A 4DO5A 1U1HA 4WSKA 2YDSA 1X39A 3ARPA 3AJXA 3D5HA 4F9JA 1UIOA 4PUNA 2ZA2A 2VJXA 2J6XA 5CG0A 1W8GA 3N18A 5K9XA 1D8WA 1M53A 1U1JA 2V82A 2QDDA 3FS2A 3CHFA 3N2OA 1EOKA 2OXNA 4AF0A 2PDXA 3LCFA 3K30A 2OZ3A 1AJ0A 1V79A 2WBKA 4UTTC 2HRWA 4J2MA 3FJNA 4DUVA 2CEQA 4FX6M 1UJQA 4DJED 4C6PA 6REQA 3WQVA 1W1ZA 1EZWA 4LUSB 4KFPA 3HG4A 4IX0A 4G56A 4GQQA 3WQWA 1XCFA 1KLZA 4EAYA 3E02A 3ORWA 1GT8A 1PKMA 1Q45A 3NO5A 1YQ2A 3WLNA 3H23A 2GUYA 4MJ4A 4RCXA 3A3HA 1SSGA 1POKA 5AVNA 1PHQA 4HNLA 3EWUA 1CIUA 4P8VA 3GBEA 4BQ4A 1A49A 2X09A 3FJLA 2V0TA 3W07A 3RX3A 1CB2A 3N13A 4AZ7A 3O0KA 1QPNA 2C3ZA 3BICA 5LZLA 2X1IA 3MI6A 3V36A 4DAIA 1W5PA 2WNZA 2VC7A 1UOZA 5H8MA 3CC1A 4M0XA 1V08A 4PRTA 1RCOB 1J2WA 1DP0A 1YX1A 2IKJA 2DVUA 3AHXA 4I7VA 3CZ8A 1I9CB 5FJRA 4AG0A 3SRFA 4RXFA 2WO5A 3O6AA 1HL8A 2PWEA 1YPXA 1LG1A 2IMRA 3DG6A 4QCEA 1OC7A 1UPMB 3W7LA 2WW5A 4MB1A 1S5NA 1P7TA 1V77A 1W32A 1TIMA 3VX1A 2OT1A 5JBFA 1FH7A 3JRKA 2F7FA 1TVPA 3SZ8A 1EHAA 2OVLA 4F2TA 5I06A 2QW5A 3WBYA 3GG0A 1E71M 3LLDA 2HMCA 3H26A 2W0UA 2OELA 4BQ2A 2CHOA 3AZTA 4PTNA 4REQB 4ADUA 4K3ZA 4BZYA 4JX5A 2WSRA 4N6FA 3KUMA 3G2GA 3UERA 3SJNA 1OB0A 5F1VA 1BXCA 1YNQA 5DXYA 1UZHA 1RQBA 1UWQA 2PDYA 4Q4MA 3Q45A 3B9DA 4X61A 3LI0A 1HTIA 4KGLA 3BAYA 4Q4PA 4RZ4A 3NL3A 1RP9A 1G4TA 3E1F1 3AYVA 1A5AA 3LCGA 3VC6A 3WNNA 3N2MA 6XIAA 2YA2A 1W0MA 4TVCA 4HCHA 2G97A 3ANUA 2VEKA 2ZICA 1N8IA 1JYVA 2NZLA 3F2DA 3COTA 4PUDA 3RR4A 3ZVIA 2QAFA 3NSXA 2EO7A 3MUXA 4Q3MA 4I9JA 1W6TA 4RNIA 3E2SA 4UC5A 1QPQA 3I68A 4HK7A 3JZEA 4FNUA 4DZ5A 4GK8A 4BQ5A 2DPEA 4GXPA 2E8YA 3U0HA 3IK4A 2GWGA 3LQLA 4S3AA 2OEJA 4E2VA 4JTSA 3MUIA 1AQMA 1TB3A 3CV6A 1ZL1A 5E1QA 7REQB 1BKHA 1KBLA 4Q8VA 3TJXA 9XIMA 4ATLA 2BVTA 3VGFA 2C71A 2HPIA 1XGDA 4O50A 3MZNA 4LVFA 4UTUA 3M7SA 3VD3A 1JI1A 1YBQB 4PULA 1D9EA 4MZ1A 2EQDA 3DXIA 2ZKMX 3STCA 4BEUA 5DRCA 4XAZA 4MKNA 3FA4A 4M3PA 1GKQA 1ISWA 1XLLA 1OGBA 4MWAC 3CPGA 3UJSA 2DZSA 2QJJA 5LA1A 2J24A 3NQ2A 1BQGA 5HDRA 3W1NA 4ZO8A 4PH6A 1NDYA 5LNVA 4BWLA 4QE4A 1FDYA 3VNMA 3ARVA 4YCOA 2I7GA 4ICMA 4S1FA 3BJSA 3OYZA 3CH9A 1V0MA 3H2MA 1PYFA 3CPUA 4ZB5A 3E12A 1J93A 4P7OA 5LNUA 3AIUA 1T6MA 4H9UA 4NUWA 4PB4A 1VFUA 4RE2A 2Y62A 1Q6GA 3Q4DA 4JIRA 4B5XA 3AOFA 2RFGA 1F3TA 1JI2A 4N9DA 1DTNA 3WEZA 4C6BA 2DH3A 1BRLA 2OOGA 3GIPA 4RR4A 4A6GA 1XSKA 3REQB 4WY0B 4B2DA 3TX9A 1MSSA 1XCXA 4AH7A 3WZ0E 4S38A 4Q6XA 3O05A 4BI6A 4NKCA 4UTFA 5MKGB 3ERPA 1OFPA 1KBJA 1AMKA 2B7QA 3AJ7A 2NWRA 1HKMA 1R7AA 2Z26A 3WUFA 2P1FA 1TV5A 3ANVA 4WJEA 1WZMA 4WIWA 3LPGA 2DDXA 2XM2A 4LANA 3MKVA 5JU6A 3TIMA 3PWGA 4Q33A 4ONVA 2VDGA 4H2CA 2CBJA 1RP8A 2NSXA 5CKSA 2XZ7A 3N15A 2W79A 3DG7A 4F79A 1H7XA 3C52A 2XGBA 1OFAA 4AVNA 1ZUAX 3O63A 3CV7A 1TJRA 3OGSA 2WV8A 4JN7A 1ONXA 3SEPA 1GQKA 1E0VA 3T81A 3OYXA 3U5YA 4XO6A 4UTWA 3HQPA 2YLAA 5DEZA 1AD4A 2O56A 3MT1A 3OP2A 4YVPA 3PPCA 3PHAA 2QXWA 1J01A 3BG3A 3L67A 3R4IA 5A1AA 5AHMA 4UTTA 3QHMA 1ICQA 3UU0A 2E0PA 3WK2A 4DJDD 3R11A 2C1GA 3QN3A 3FN9A 2DFAA 3ENLA 2F38A 3TW7A 2VFEA 2V38A 1CBGA 1UZ1A 3R10A 1K1DA 2HISA 3OLIA 3ABXA 2FFCA 4PMJA 4ZA0A 3AALA 3WJYA 3DH7A 3KM8A 2E7FA 2PWDA 1H49A 4NZ4A 5D37A 2YXOA 5BU9A 4N42A 3I7RA 3C5QA 3NPUA 4FF7A 3L65A 3BAWA 3CEUA 1HUVA 5F7UA 4QXIA 4DLFA 3PJUA 5JMUA 1WPCA 3NDYA 1UP0A 5KSWA 4QSFA 1XKYA 4WJ8A 1Y65A 1RJRA 5HNNA 4HNNA 2A7RA 2MNRA 3ITLA 3RDKA 2ABAA 4IMAA 4AY8A 4RV3A 3LGDA 2ACSA 1TPC1 4R7JA 5HATA 4Z2KA 2DUAA 2P0IA 3SRHA 4AIBA 1ZCOA 1L9WA 1S2TA 4O1BA 4QE1A 4IWWA 4FNPA 5FSEC 1OYCA 4MNJA 1BVWA 1GVQA 1S39A 4JN8A 3QW3A 4KWSA 1RY0A 2WQPA 1OZMA 3LCXA 2NUYA 2Z1VA 4MZ8A 4RUBA 4ALDA 4NNAA 1Y8BA 4C6DA 3QW4B 4ZOBA 1TWDA 4QX4A 2YIHA 2V81A 1XCWA 3P74A 3AIQA 1M6JA 1BSLA 4YN5A 3KCLA 4B5WA 2QCCA 3UWYA 3SCOA 1FWCC 2R6OA 4UQEA 1O95A 3SQSA 3AHZA 2MANA 3FIGA 4G6CA 5ABFA 3L2LA 4H9VA 5I3HA 1E9YB 3SB0A 3C0QA 1CECA 4F4RA 4LYPA 1GORA 3BE7A 1W56A 2V3EA 4EAMA 3FHQA 4JOMA 1RALA 2HBXA 5A2BA 3SURA 4C6JA 4TX8A 3W25A 3QTGA 1BXNA 5U7SA 4RPPA 2Y85A 5IM51 3B0YA 4OKDA 2AGTA 4LOCA 3LK6A 3U4AA 3VIPA 3CUGA 4HMNA 1H62A 5JUVA 3C6CA 4GKTA 1OBAA 4HZ7A 3W6YA 1Z89A 5EU9A 3VNIA 2QDGA 4JTTA 2JGQA 1GG0A 3VI2A 3T2PA 3UR2A 1S5VA 5FL1A 2DSWA 1CXHA 1FOBA 2ZX7A 4K6AA 1JQXA 1EJUC 3WLLA 1OWQA 3KLKA 1EUAA 3ARYA 3TMLA 4JTJA 3GU9A 2VHLA 3S0CA 1UWIA 2VDIA 3W53A 3MCNA 3MV01 1KR1A 4QDMA 4O12A 5I3IA 2D24A 1WQ5A 1HVXA 4OE7A 3NSMA 2BWGA 2J9XA 3AS2A 4ZFMA 2VZTA 4X63A 3DZ1A 1XYBA 4WGXA 1A50A 4UFKA 2CLFA 3CWOX 3UCCA 5AC5A 4ZCWA 4WKFA 1BG4A 3RM4A 4FEZA 3AHVA 2AQWA 4N9EA 4O16A 4W86A 1PX4A 3ABQA 2G3MA 1TCDA 3TTYA 2PI6A 1EIBA 2NXGA 2WHJA 1JCTA 2VYOA 4GVFA 4V15A 2C8NA 2Y7DA 3WIJA 4PBFA 3E74A 4GZEA 3STEA 1S46A 2EBNA 1NWSA 2HVMA 4AHPA 4HHHA 3APYA 2V5LA 3RPMA 1V6YA 4Y8FA 3GLCA 2A1YA 4KESA 1TRIA 5C9ZA 3UYCA 1PKLA 1RV8A 5C2XA 5CG7A 2CXGA 2B0MA 2ZCGA 2D2OA 3DHDA 2X0SA 2O0TA 1R47A 3H6OA 3W4RA 4LX4A 1EJWC 2HVNA 2OO6A 2QCDB 1ADDA 5FEPA 1HJUA 1OK6A 5HPCA 1E70M 3N4EA 2NVAA 4V1XA 4GFSA 3IIOA 3KWSA 3CWNA 1KXTA 1OQFA 1TTIA 2XGZA 1WYIA 3TAKA 1NWTA 1FDZA 1ECQA 4AY1A 3QJAA 1CLXA 4HA4A 4HHPA 3ITYA 3DI0A 4PCSA 2CLPA 3EOUA 3QFWA 2PDPA 3QR3A 3FOKA 2HV5A 1KTCA 2X8RA 1A4MA 1JCXA 4K8HA 3UG3A 3GB6A 1R3SA 1SZGA 3ES8A 4PEKA 4QQUA 5GJMA 3UESA 1CYGA 3P80A 3VDGA 1A5SA 4E4PA 5J04A 3EMCA 6TAAA 2PZNA 4JFWA 5D4YA 1FXPA 2GLKA 4CD6A 2DSVA 3VCCA 4KEVA 4DYJA 3MUAA 1O1HA 5FL0A 1WO2A 4BEQA 4GZIA 4DELA 4PMZA 3CHDA 2RHGA 5D33A 1BTCA 2A5HA 4GYPC 4AIEA 3S9ZA 2W6RA 1JUEA 2WPGA 3DFQA 4ZXLA 1H1ZA 2PTDA 3O6CA 4J3TA 2CLLA 1MFUA 4GMEA 4HPGA 1JZ8A 3RNDA 3BLOA 4CVUA 4XTDA 2DY3A 3USZA 3WD1A 3MDWA 3LERA 3W71A 3C2FA 3RRAA 3ZIZA 1OC6A 4KERA 4H04A 3S83A 2CBVA 4OBSA 3VIKA 3PC0A 3BUVA 1TG7A 4HQVA 4QRNA 5K9DA 1TQJA 2PC8A 2XUCA 1I1XA 3B0VC 2GJXB 4KS0A 4GX9A 2BX7A 1E0XA 3C2VA 4EPEC 3TCSA 2QPUA 5E6YA 2TAAA 5CPSA 3VIMA 3SAZA 2CIPA 1MW3A 4HSNA 1JEZA 3WD2A 4JQ2A 5D8ZA 1K6AA 4JTLA 3CV1A 4LC8A 1XG4A 1J6OA 1NF7A 4O4VA 1W9BM 1KCXA 4XAGA 4NNBA 4OOZA 4WKHA 3UFYA 1SR9A 2DT0A 3OVQA 2I9EA 4B9ZA 3BG9A 1JRBA 4LFYA 4AEOA 1DBTA 3E0FA 1Q7QA 3HQ1A 5D2VA 4HMCA 3S3GA 1AJZA 4IJBA 3IUHA 1REQA 1QPKA 3LN3A 4J35A 5J8LA 1LWIA 1UD8A 5TQLA 4O54A 1JDDA 1HL2A 4C60A 1F61A 2PCEA 3V0SA 1KW1A 1FBAA 3RXZA 1DV7A 3C2EA 1QU4A 4ZQNA 1S2UA 2DSZA 1SFJA 2XN0A 4LBSA 4Y7EA 1AQHA 4XUGA 2PZ0A 4PBEA 3UY8A 1KGWA 1J2BA 2VI0A 1MVYA 3NM1A 3BC9A 1AQ0A 4MJZA 3S2MA 4GNVA 2YYTA 1TX2A 1RCXB 5FACA 1WKYA 3ZFHA 1V3JA 1F73A 3AIVA 1HN1A 1IZJA 2IUZA 3EX6A 3O6DA 2VELA 1RCQA 4I8DA 3GX9A 4UWMA 4Q8PA 3S5NA 3TR9A 3ZR4A 4XISA 2WC4A 1EYEA 2OSXA 3CO4A 4QLJA 3UZ5A 1RR2A 1IWAA 1FWDC 5EB8A 3XISA 2EPKX 3BANA 1FQ0A 4E8CA 3BARA 4CD4A 3W6MA 5GJNA 4GFIA 2P8CA 1PB0A 3VOHA 4ZXOA 3HFYA 3OG3A 1XC6A 1MW2A 1GQLA 3LY0A 2IQTA 3EX3A 2VZUA 5BROA 3P84A 3R79A 3LD5A 3LBCA 1OX4A 3K4DA 3KBNA 2W4XA 3L4TA 2XFWA 4MNLA 3MP5A 2CKRA 2QGYA 4PGLA 4J3UA 1ZSXA 3WLIA 5A94A 2I5QA 1YXDA 2E09A 4U33A 3GO2A 1ZJHA 3WK1A 2QCGA 4QG6A 4A3RA 3L66A 4B3LA 5HMEA 4N4QA 1H63A 1FWNA 4G5DA 3LCHA 2CWXA 2VD8A 2W91A 1OM0A 4Z1CA 1EF2A 3CTLA 4W84A 3WN6A 4M6VA 4O4WA 4H8NA 5BOOA 4AD0A 3RAOA 3RJXA 7A3HA 3TC6A 4GRSA 3G22A 2BV9A 1W3IA 2A4AA 2E25A 3G3MA 3PZVA 3O1NA 2PDFA 4JXCA 2YSWA 2ISVA 3GNDA 4HCLA 1DWHM 1QBAA 1FWAC 4H2HA 3WD0A 1EF3A 5FF0A 3WQGA 4AB4A 4ZODA 2V69A 4ML4A 2A3AA 4BI7A 4MM1A 3AISA 2CZFA 1GZJA 2E5BA 4Z1DA 4HNUA 3QKEA 3ZR6A 1VLIA 1K8CA 3EEZA 4C7DA 3IVSA 2J9YA 2VENA 1B1YA 4L1WA 2E6FA 3TA6A 1GJPA 4MHBA 4IGSA 3BZJA 4X3ZA 4PCPA 3DC8A 1I45A 4PL1A 4YXGA 1E9ZB 1RD5A 4NU7A 4UMAA 2IXUA 3RPTA 1VJIA 4CN6A 1NOFA 3EA3A 1LLZA 3TJIA 1KCLA 4ZE5A 2VMFA 5BRQA 1ZRQA 1GVYA 1AODA 3M0VA 2FVKA 1DJNA 4YWIA 4DNMA 2QIIA 1GVIA 1GVEA 1H51A 4XVEA 2HNEA 1MXSA 1QK2A 4H01A 4H6KA 1MRQA 4O1DA 1X1OA 4K2SA 3WQOA 3M0XA 3MJMA 1TMLA 1OJXA 5I78A 1PIIA 4TOQA 4OFCA 5DO8A 1E55A 1WV2A 4JD4A 3SQLA 5MHBA 3W1UA 5T9CE 1BF2A 3ICJA 3I3DA 3VC5A 2V9DA 3G0XA 1E5JA 4CNUA 1TUFA 3TN4A 2HPMA 2WMGA 4UR9A 3B8IA 4JR5A 3VD5A 3NM3A 2X30A 5D32A 4MPKA 4LAZA 1EWEA 3W87A 1VFSA 4IZGA 3S1UA 1EPXA 3MKCA 5KETA 1I0BA 1AH4A 1D3GA 1GZ1A 2VQTA 3YPIA 3VGGA 5KZ6A 1VD6A 3W2KA 4FXSA 4IGMA 3WMBA 1K4GA 5CBIA 3ZLFA 4QEHA 4GYPA 3M46A 3R6IA 1G4EA 2EPMX 1MDRA 1U22A 5CZTA 3K13A 1V02A 3PY2A 2V63A 4CCZA 4KBXA 4AHQA 1X97A 3GNNA 4Y9MA 3H21A 3MYOA 3URQA 3AUOA 5AY7A 1W9PA 3BAJA 5A69A 3LPOA 3I10A 2Z1XA 4UMBA 4XKYA 3PZGA 3FGCB 2JFEX 1N7KA 1FH8A 4LALA 4XVDA 3GXFA 4RE3A 1Z9AA 1JVNA 4QFUA 5LXXA 2B7OA 1M7PA 2BOFX 2OG9A 8A3HA 2O55A 1XP3A 3P6LA 2HTMA 3U7VA 5HJLA 2PWFA 4YTUA 2IPJA 2XZ9A 3MCOA 4XQ6A 4UUIA 3UJEA 3AFBA 3KTCA 4X2PA 3RMJA 4XK2A 4YVVA 1BYBA 1J8VA 5IFTA 2BOGX 1JR1A 1DIKA 3W76A 3CK5A 1OF8A 2OWWA 2NX9A 4P8XA 3C2OA 1JPKA 3EPMA 3PUEA 5K2ZA 4F66A 3BXWA 1NJJA 1PKYA 1XFCA 1P48A 2HCVA 3MUCA 3AZSA 1FP9A 2P8BA 2XH4A 3S9IA 1XDJA 2GSEA 2AGKA 1B3XA 1K7EA 2HE8A 3ZJ6A 3OBKA 3W2LA 2ZUWA 3DYPA 1YEYA 3MBFA 4PTXA 1NWUA 1UKTA 4CD8A 2QIWA 2AMGA 2HZGA 1E9LA 1AJ2A 3FXYA 1RBLA 2RUSA 2ZRWA 1QI3A 3SM0A 4QIUA 1YE6A 1T41A 2J7HA 4O14A 1NP2A 3CZEA 1NOUA 1F4HA 3UR7A 3OLDA 3NGJA 3WQCA 2GJPA 3WLTA 4YHEA 1RJPA 4LVBA 4WVXA 3UWQA 1LYXA 4OU1A 3H2OA 3TR2A 4JYFA 3M44A 4ACZA 2YDQA 1VF8A 1Z8AA 3HF3A 1PZ3A 2JF6A 4J3ZA 3EWYA 1X96A 2CZ5A 3T78A 4AFYA 3H12A 3LZ5A 2VR4A 1M68A 4W93A 1W5MA 4S3CA 3DESA 3TCEA 4M24A 3KHJA 1ODZA 3MBDA 5CZ0A 4WR3A 4S3EA 4FX7A 1J0JA 2BY1A 1TX0A 3QFEA 3UZZA 3AMLA 1G7UA 1CI1A 3NPXA 4HA1A 5BMXA 4KCUA 5FJOA 2VGIA 2OQYA 3WLQA 1XSJA 4EANA 3P67A 1KR0A 2EHHA 3D3FA 4BF7A 4M7TA 4MWAE 2QPXA 2BSLA 3W7EA 1SJCA 3A3XA 4QG9A 2Z1SA 4MY9A 1QW8A 3J7HA 1W3TA 1SU5A 4IFKA 1HIZA 4HMDA 5FD0A 2BGSA 4E4FA 3POCA 1H5YA 1QMLA 2ZUMA 1QNRA 5LHFA 3NSNA 3ARQA 4U28A 3HJZA 2J47A 4M6PA 4K7VA 3RFAA 3VD9A 1T99A 4JTKA 2V68A 3LGEA 2YXXA 1TWSA 1OFQA 4JTHA 1U5JA 4LBUA 2NQZA 3DGRA 2IKGA 4RDYA 1VGAA 5BWAA 1O5XA 1Q66A 4DWDA 3RIKA 4JX4A 1KFKA 3IVTA 2VZOA 2BY3A 3UETA 3HGSA 4YNGA 1J10A 1Q6EA 1YIXA 3O06A 5DANA 3A23A 1OZQA 1W1VA 3B03A 3MANA 5I0DA 5DCBA 4FLQA 1N8WA 2ZZ4A 4HTBA 4Z17A 4GNKB 4F3HA 3GTXA 2CHNA 2JALA 5G2IA 2WLZA 1L8PA 4O0KA 1EIXA 1F2JA 3A6OA 1XD1A 1EC9A 4E2BA 1V3MA 1KM5A 4ADSA 4GX8A 1W5QA 1SW3A 3VKBA 4CNNA 1DQWA 1DWIM 3GH5A 3PPFA 1QK0A 2F2HA 4HT3A 2GDQA 4ZE4A 3CLWA 3UG8A 3EMZA 1BXBA 2DZTA 3UA3A 4E2DA 2OX1A 3AXXA 1M7XA 2YA1A 3WLRA 2VEMA 4KIRA 3W7GA 3PUGA 1QHZA 3M0JA 2R1NA 4IP4A 1EDGA 4IJRA 4X0NA 2QHAA 1DIEA 4J2PA 4PUEA 4LS1A 4W85A 4YIWA 2J88A 3LPFA 4Q8MA 1GHSA 1XLDA 2CBUA 1H7RA 1GK8A 1THFD 1JYWA 2PDQA 4IUOA 2W3ZA 3KCJA 2WSQA 1B3VA 4C6FA 5M2FX 4QS6A 1OFEA 1AH3A 2EG7A 2Z27A 3VUPA 2QJIA 4DUXA 4JHZA 3UVIA 4C90A 4L56A 1LUCA 2HROA 3F03K 4B91A 1ZAHA 3DGBA 1A0EA 3SCTA 3K4WA 3TZFA 4AHOA 5CPNA 4PMRA 2O92A 4GJIA 2PRHA 1E51A 4W5UA 2G3IA 3W7NA 2YZRA 3PSWA 3TMQA 5C6MA 3VKAA 3FKRA 3BMXA 1AA1B 4IPIA 3DCPA 1GUVA 3DFPA 2GGIA 4HZ6A 4MAVA 1RBAA 2XYLA 4AYGA 1KGUA 2PDMA 2V5DA 1PCKA 3ZJKA 5RUBA 2J7DA 3PBWA 1ZBWA 3FEQA 4IJCA 4V33A 5LSMA 1HJWA 3BGGA 4GYFA 2GOKA 1QATA 3GIYA 3KBJA 3A64A 4Q8TA 2OODA 4DRSA 1H3GA 5D2WA 3S1XA 1NWRA 1K4HA 1UWRA 2YDAA 4S2CA 4YPJA 3AICA 3EDEA 5BXPA 1K3UA 5I3FA 5DXXA 4C1NB 1FVPA 1O66A 3B4UA 3HQNA 4IL2A 3O7UA 4QDPA 3W1LA 2RAGA 4E8DA 3LTPA 2FFIA 2XFRA 1JD7A 3OGRA 2VGFA 2YFOA 3SCRA 4D1IA 2BGQA 3EPOA 4NJKA 4B5NA 3UGRA 4GUIA 3EWDA 2NXHA 2INEA 2QDHA 4WSJA 4OBRA 5CC5A 4YYCA 5T8GA 1C9WA 2W67A 4XB3A 2XIJA 1NTHA 4LV4A 3I7QA 1R5YA 3P8JA 3ARZA 4PYSA 2PLKA 1XLFA 2ZZ1A 2J7GA 1BKSA 3WJWA 5F2GA 3PR2A 1KA9F 4C6QA 1UUQA 1FWBC 1I4NA 4XAFA 5CEWA 3JUGA 4LF2A 4OBTA 3HPSA 1XR2A 3GXNA 3EB3A 1LQ2A 5C9RA 5FI8A 1ZQ5A 3S5YA 2PS2A 2BXYA 1UBPC 3N73A 3GC2A 4IT1A 4NZFA 4QNWA 3STFA 4BF9A 1US2A 4ZSUA 3WLMA 2QV5A 1L6SA 1T5AA 4XZ9A 2QUTA 1KFCA 3Q65A 3CH0A 2GVLA 4E5TA 3P3BA 3T07A 3WDPP 4GZJA 3DOPA 3MQTA 3W02A 4UTMA 2DGAA 1ISXA 2HSAA 1G7VA 4AMCA 2DZPA 2FH8A 4B2DD 3V1HA 3ECQA 2YCIX 1VRXA 5JVLA 1QBBA 4H41A 2UY3A 1AVAA 4EX4A 4IQDA 4DY1A 4LC6A 2EPNA 3M0HA 2QNEA 3DIPA 4J1OA 1VYSX 3HMJG 1UQZA 3EBVA 4G7FA 6PTDA 1E0WA 1SW0A 4L6DA 1KM2A 4CQCA 3NDZA 2OLHA 4MB4A 4U31A 2B81A 1CNVA 3CLMA 2YBUA 2O4QA 3P5YA 2V3GA 2KX9A 3Q37A 4DN1A 1F07A 3TSBA 4D6GA 3BOXA 2RDUA 1F4AA 1ZALA 3F7JA 3CJPA 3C56A 3OZOA 4TR9A 2P3EA 1CGUA 4X9SA 3T2QA 4A05A 5CGTA 2ZVRA 3IIXA 1A5UA 2I5IA 2WVVB 4F48A 4ZSTA 3G24A 1I8JA 5LNSA 2C6QA 1TE1A 5HWJA 4B90A 1IHIA 4JNYA 1VFHA 4ZOEA 1ADOA 4J28A 4EIVA 3LDVA 3OPSA 2BHZA 3I6TA 2GUUA 3SDOA 3N2BA 4PN2A 3VMPA 2OT0A 3V16A 3ZQ9A 1SFTA 1RBOB 4Q8UA 4DF1A 3E5BA 2PPGA 4W8AA 1DJQA 2CC0A 1CT5A 2J6VA 4J7RA 3CQJA 3WDHA 3HGJA 4A29A 1PTDA 1LL4A 1UWTA 2CU0A 5CC6A 2ZZ5A 2VL4A 4S3JA 2C1HA 3LMYA 5CQ1A 1E6PA 3W1AA 4DZHA 3W7JA 4LUTB 1ZB5A 2EJAA 4G7EA 1J0HA 1HKKA 3ZLGA 4QISA 1XYZA 3IVUA 4XAPA 2OSWA 4JIIX 3HPXA 2XHYA 2PDKA 4FXFA 3LEPA 2QZRA 4MB5A 5KZMA 3VM5A 3SY1A 1V02E 4GHRA 3EOSA 3IJ6A 3DFYA 3GDBA 3OW1A 1Z7AA 2GUBA 3N6JA 3OZPA 1EOMA 4I5RA 4XZNX 4NJJA 4Y90A 1S3HA 4HYVA 2FVLA 2QCEA 3PG8A 4AQLA 1NQ6A 4RNFA 2A3CA 2FHCA 4F2UA 1PTGA 4JTUA 3F5LA 3GIQA 4ATDA 1RSCA 3AIBA 1SQ7A 2Z24A 3V4BA 4MDOA 1E72M 3JZUA 1QJWA 4ZQCA 1NU5A 3KS6A 2FVMA 2AAAA 3CEPA 7ENLA 3BOFA 2TYSA 5HPOA 2E5DA 5IBXA 3IACA 1RLDA 4DAFA 1L2UA 1UROA 5KTLA 3C2RA 1MQRA 3DYOA 3RO6A 3BCFA 1V3LA 5C9UA 4W87A 1Q63A 4A8LA 4L4OA 4HN8A 5ENLA 1V03A 1JPIA 2REQA 3W2UA 1VCFA 1O1ZA 4U2ZA 3SY8A 2H8XA 4WLCA 3OBEA 1Z48A 2CZDA 2JKEA 4LNYA 4O1AA 4AIOA 2Z7GA 1K9EA 3CIWA 5H91A 4HNCA 1MW0A 2PGFA 4XZHA 5AHNA 2PDWA 3U9IA 1N2VA 2WMJA 2C16A 3PBGA 3FVDA 4GZ7A 4KRTA 3S46A 4ACYA 3KRSA 3KBSA 4O1CA 1KXHA 2F8QA 2NVCA 4ZENA 3FW6A 2FJUB 3GYEA 4Z2GA 4PMUA 2EPOA 5GNZA 4GD0A 4XSMA 2J62A 1DQXA 3PTKA 2Q8LA 2EJ1A 4MKVA 4JKMA 4HP5A 1GHRA 1BWKA 3PBVA 1ME8A 2XIQA 3NFUA 2V3FA 5L9FA 3LHZA 5GQBA 1S2AA 3QXBA 3E0IA 3FNDA 3VNZA 2UV8G 4LRTA 1EJTC 3BAIA 1HJXA 4UQBA 4HA3A 2X2GA 3CYVA 2OQHA 5FJJA 1EJ7L 1AH0A 4DJEC 3QV6A 4KIEA 3UGVA 5BRBA 4A3UA 2XVPA 2FB2A 7TIMA 4DZIA 3WEMA 4PTWA 4HSHA 1KV8A 1G4PA 3HURA 2EXOA 1B3WA 1PUDA 1WA3A 3EEGA 2F61A 3W1QA 3F4VA 3GVQA 1VYRA 1GQIA 1TTPA 1B3OA 1VBJA 3RU6A 2Z29A 1IYXA 3TLLA 1JCJA 3BLFA 4CQBA 1Y5VA 4V1YA 2PDUA 4YMZA 1CGXA 1I0DA 4H9YA 4QM1A 1Q5MA 1H50A 2DZVA 2FZBA 4PZVA 4CGTA 1EO5A 4NYYA 2ZRVA 4ASTA 3TAOA 2A3LA 4HTYA 1OADA 2QKFA 3GH4A 3GDMA 4C65A 1TVNA 3ZT7A 3ITGA 3N2CA 4A2SA 2FMOA 1WDDA 3H4WA 4PMDA 4F0HA 3ITTA 4AF0B 1WZKA 1O68A 1XLAA 4MFDA 3GNOA 2Y63A 4UR7A 3GQYA 1KFJA 3GR8A 3NOYA 3WD3A 3CIVA 1OIFA 2UY5A 6REQB 5M3WA 4LAKA 4IUGA 3HG5A 3KEHA 3LHUA 3EXSA 1IZCA 2ZBTA 4DZAA 4ILSA 2A0NA 5F4WA 4K36A 1T7LA 1V3HA 2E6DA 8TIMA 4F2BA 3T55A 3NJ3A 4A21A 1X6LA 1BYAA 4GGBA 4DF2A 4ZR8A 3TH6A 1J18A 1W1YA 3ITXA 4HJFA 3SIMA 2P76A 3IJQA 4GVHA 3CMFA 3FKKA 2FGBA 4MADA 1OG6A 1XBVA 1EPVA 3OIHA 3VX0A 2WZMA 2P10A 1ZLPA 1R3WA 1AW2A 3LENA 4Q4SA 3PULA 5A6TC 4K37A 3WNLA 2MUCA 2V5BA 4GI8A 1UR3M 3MHUA 3OHIA 1CW2A 1K8XA 3NDOA 4CQ9A 4UQAA 3TYAA 3CL8A 1ADSA 4I5XA 4QG8A 5HQMA 5FAGA 2AQVA 1NELA 2Y7GA 1F6KA 2H6RA 3CYJA 3UD6A 5CSUA 2F84A 1J6PA 2V8ZA 5HNUA 2QR6A 1NAL1 1U2YA 5KITA 2A3BA 2GOUA 1Z42A 4KT2A 3K8KA 1PXGA 2ZX8A 1X7IA 2I14A 3MUY1 1ZJAA 3CQHA 4CD7A 1G0CA 1ESWA 1MUWA 3MC5A 1IZKA 4Q7IA 4AD1A 1WXZA 4IQEA 1P6CA 5ECVA 4H8VA 1B0IA 2YB1A 1SVDA 2H3BA 8XIAA 4AZGA 3NIYA 3PSVA 1FCBA 2GK1A 4JN6A 3URBA 2GFTA 2NQ9A 3AI0A 4JTDA 4AWSA 4TMBA 4UFJA 2VURA 3GYCA 4K68A 2G3NA 1DJGA 2INZA 2PGEA 4BA0A 5J5DA 4R27A 3TTSA 4LAMA 3ALFA 4LUIA 3S2LA 3NXLA 3JS3A 3TA9A 4AUBA 1XLBA 3W82A 4D6JA 5HK4A 1WCGA 4J27A 1OF6A 1Y0EA 2QUNA 4RV8A 4KRZA 5FKYA 1QT1A 4HSOA 1O6IA 3ZT6A 2D2JA 1BYCA 3N11A 1E6QM 4H9TA 3PZTA 4LY8A 3G6MA 2R8WA 1G9HA 2ESCA 4DO6A 3I3BA 3RCMA 1LDCA 3WKZA 4JTFA 3UWVA 4C6MA 4Z2JA 1PZ2A 3T9PA 1IEQA 3UZYA 2VC5A 1OT2A 2WC7A 2A21A 1HKJA 5D2YA 3A47A 1VKFA 2OEMA 2QUMA 1CLKA 3S1VA 4QSHA 2VGBA 1XQLA 1MRAA 4IOTA 1DE6A 1N82A 3TFCA 1LM1A 3SR7A 4BHYA 4JFTA 1FP8A 2PURA 2Y5EA 3PBYA 2C19A 2I1OA 5HXMA 1WB0A 3RF9A 4HPNA 3FJ4A 3OJGA 2FB3A 1YADA 2V30A 2PDIA 3VGHA 1E4MM 4GNJA 1IE7C 8RUCA 1S38A 3TWAA 4JYEA 1PDYA 4LVGA 4DWSA 2WCGA 3G1YA 3BTNA 4WDUA 3WQ5A 3MO4A 4AX7A 2XISA 3MHGA 4JTEA 3PTDA 2YR1A 1LQ0A 3W38A 1X6UA 2XFYA 4PRWA 4HVXA 3E2QA 4S2BA 3HV9A 2CZVA 1JFHA 2OGYA 1D7FA 2JGYA 3M07A 3PZUA 1YPIA 3HU7A 5IHRA 1Z44A 3S2CA 4YHGA 1ONEA 4LS0A 4GBDA 3IWPA 1BRLB 4GO8A 3TDFA 4DJDC 4DBWA 4CVWA 3TP4A 4AZBA 3CZLA 2PF0A 5FIPA 3LXCA 2ZWZA 3O16A 1NF0A 3QKZA 1FUYA 2DIKA 2YOCA 4HU4A 3THQA 2VM8A 2VFIA 3DKJA 4LS2A 1W9VA 2WKJA 2FTWA 4HYRA 5I00A 5LIXX 3GC5A 2ZTKA 3P7YA 3R89A 3T05A 4W7WA 5AKQA 3T0BA 1HXJA 2V5KA 1WX0A 2OCZA 2DW6A 3M7WA 5JIWA 1GTHA 3BJTA 3C3NA 4JTCA 3ITVA 4QE5A 3CU2A 5CXPA 3L0NA 1H1YA 3UF9A 3OU8A 5T91A 1ZJIA 2TRSA 4TTUA 3IUDA 1KV5A 4MPQA 5G1MA 3IUIA 3ABRA 1QVBA 1RD6A 3HPAA 4K1WA 1B57A 1U1UA 2D0HA 2NVDA 1PX3A 3WFZA 3BH4A 3D46A 3W1TA 1OC5A 1M3UA 4GC3A 4HMEA 3L4VA 3W24A 2WXDM 4JTIA 1GKPA 2UY4A 4GQRA 1KGXA 3CZGA 3UA4A 1PZ1A 3OO2A 4YJ5A 3N12A 4PUMA 5G2HA 1E73M 1W31A 3CL6A 1VFOA 4NSBA 1NSJA 3II1A 4KMQA 2ZUUA 3L68A 3N9KA 4NHVA 5CSYA 1VR6A 2R1PA 3LSCA 2XWDA 1FKWA 3EWCA 4PMVA 2XIIA 3NQEA 4I7UA 2C0HA 3VGDA 4JDBA 2CFFA 1F05A 4C6NA 2GVGA 4XTIA 2J79A 1VBHA 2J13A 1WE5A 2DSUA 3W88A 1EJXC 3EX2A 3H24A 1A3XA 3L0KA 2H9AA 1VCVA 4Z1AA 2QS8A 4JHOA 4KFNA 3WH8A 4RE0A 4IXXA 1F8MA 4GIEA 4AD4A 4Z0JA 5REQA 1X6NA 4XSLA 1U30A 2BHYA 1C8QA 3O3RA 5CJMA 5U4NA 3R7MA 4KWUA 3TSDA 5FF4A 2O7QA 2W92A 1QNPA 2E6YA 5D38A 3D0CA 4X9YA 3QHOA 3PF3A 2Y1HA 4GYJA 3N25A 4NRRA 2WJEA 4C6IA 5EBAA 4NJIA 3BLKA 4LEFA 3PUDA 1J0YA 1IT0A 1RZMA 4DNHA 1TWZA 4JFUA 2Q02A 3QF0A 4ZQRA 3VMNA 4E8GA 2QAPA 3NQGA 2UBPC 1ZZMA 1AZ1A 1S3TC 4TUFA 4MYAA 2WJDA 2RDWA 3GVRA 1OVDA 3B05A 2QLYA 3RLVA 2G3JA 2KZHA 3NQ6A 2GZXA 1DTUA 1TJ1A 2AKMA 3WJZA 5ABFB 4JNZA 3RUBL 4ZO6A 5A3HA 3NL5A 3FA5A 4U10A 4D71A 1S2CA 3IJDA 1EZ2A 2E1DA 2QUVA 3W0KA 2BZNA 3QPEA 4PSPA 3UZWA 2VQUA 3WLOA 9CGTA 1SR0A 2CLOA 1FFRA 2FZDA 1LORA 3GW0A 2G50A 4UIOA 1F9CA 1VEMA 3QGVA 4LU0A 3ES7A 1ITXA 1GJWA 2NUWA 4EPKA 4Q7NA 2DQXA 2XSBA 3T42A 1TV8A 3GKAA 3G0SA 3GNRA 4UOJA 3R0UA 4H9MA 2PGWA 1PV8A 1OYBA 4A8RA 4Z1YA 2XTKA 1IWBA 1H5VA 4UFMA 5LNRA 2ZA1A 1XH0A 5HJXA 2OO0A 1UP3A 3HO8A 3WH5A 5FF2A 4ZOCA 1IXQA 4DHGA 5EGRA 1TPWA 1XM3A 1M5WA 3QQWA 1ISZA 2GQ9A 5EKYA 3BGAA 3VAVA 3W70A 4L9ZA 1W1TA 2A3EA 4Y9NA 1LRTA 1SPQA 4YYFA 4DUOA 2FH6A 3ONBA 2NV1A 1OD8A 1I6NA 1JPDX 3AU6A 2F6KA 2NX3A 1Y5XA 3KOYA 3KP1A 5DMNA 4QROA 2V2HA 4G8TA 5EMMA 4JKLA 4PUKA 3CV2A 3ZJ7A 2VCAA 4XZMX 2VWTA 5LYRA 3ARTA 1HJQA 1M7OA 2QJNA 3PUOA 1UUOA 4UNLA 1RHCA 3QYQA 2WZTA 1DHPA 4ZO9A 4S39A 4O52A 1UB3A 4XBJA 1PDZA 2X7WA 3OA3A 1HKIA 1MUCA 4R9XA 2ZUSA