3OBEA

Crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
286
Chain Sequence
IPATDAVSSATAGKKMGLQTYSLGQELLQDMPNGLNRLAKAGYTDLEIFGYREDTGKFGDYTTFIASKDYKKMVDDAGLRISSSHLTPSLREYTKENMPKFDEFWKKATDIHAELGVSCMVQPSLPRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKAGEKPEPKGTYIEELFLKNTDPDKVMFELDVYWAVMGQQDPVEWMENYPNRFKLLHIKDRWIIGDSGMMNFPNIFKKAYEIGILGYYVELEGDKKGRTQFEGVEKSAAYLQAAPFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
molecule keywords Sugar phosphate isomerase/epimerase
total genus 97
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3obeA00
1XIBA 4GJJA 2HK0A 4YTUA 3P6LA 3KBMA 1XP3A 1XIDA 3CNYA 3KCOA 4US6A 1XYBA 4XKMA 2J6VA 3UVAA 5AVNA 1DE6A 4K1GA 4QE1A 1XYAA 3M0YA 3CWHA 5B7YA 3CQIA 3U3HA 1XIMA 1MNZA 2I57A 9XIAA 5TNVA 4HNOA 3NGFA 4A8LA 4XIAA 3KBJA 5I7GA 4QE4A 4ZB0A 3VNLA 3ITYA 3C0SA 6XIMA 1K77A 8XIAA 1A0DA 2Q02A 3C0QA 1YX1A 3BZGA 4J4KA 4A8IA 4ZB5A 3WQOA 3M0XA 3KWSA 1BXCA 1XIFA 3CQJA 1TZ9A 4QE5A 3IUDA 1XLDA 2OU4A 5FA5A 3ITVA 4X60A 7XIMA 1XLKA 3AYVA 1O1HA 4HGXA 3KTCA 5B80A 3M0MA 4E3VA 1A0CA 4GJIA 3DBNA 3VYLA 1D8WA 1I60A 2ZDSA 4EACA 5H1WA 4GQBA 1XICA 5XIMA 3QZAA 4A8RA 5H6HA 1S5MA 1XLGA 4DVOA 1XIIA 3XISA 1XIJA 3VNJA 1XYMA 3M0LA 3L23A 2HCVA 2XINA 1XYCA 2NQ9A 3ITXA 3IUIA 2ZVRA 4XSMA 4X61A 3AALA 4PGLA 3UA4A 3ITTA 3M0HA 4YTSA 2HK1A 1XLHA 1BXBA 4EAYA 5XINA 1XLCA 1XISA 2GVEA 2QULA 1I6NA 5B7ZA 1XLLA 4XIMA 2QUMA 1CLKA 3LMZA 1MUWA 5EMMA 1XLMA 1XLFA 1DXIA 3UXIA 3XIMA 4Q7IA 4QEHA 2G0WA 3JU2A 4K3ZA 2GUBA 1QT1A 1S5NA 3KBVA 3CQHA 4KW2A 4ZB2A 5AVHA 4ZBCA 3TVAA 5C9ZA 4YTQA 4X63A 4OVXA 3VNMA 4GLEA 8XIMA 3C0LA 2XIMA 3QC0A 5EMLA 1QTWA 2I56A 3KBWA 3ITLA 3P14A 2NQHA 1DIEA 3VNIA 4G56A 5J8LA 1A0EA 1XIGA 4DUOA 1DIDA 4YTRA 1XYLA 2NQJA 4QDWA 1XIHA 3U0HA 1XLBA 3FVMA 5EMKA 3TC3A 6XIAA 3QYSA 3CQKA 4QDPA 4W4QA 3XINA 3GNXA 3QXBA 1XLIA 2G4JA 2GLKA 3VNKA 1XINA 2QUNA 3BANA 3KBNA 3AYTA 4XSLA 4A8NA 1GW9A 1QUMA 3BZJA 1XLAA 3BDKA 5EMJA 4HHLA 2XISA 3KCJA 9XIMA 4PFHA 4QEEA 4YTTA 2QW5A 1DE5A 2X7WA 3DX5A 3KBSA 1XIEA 2X7VA 5XIAA 1XLJA 3KCLA 3OBEA 3UU0A 4HHMA 3UA3A 1XLEA 3N4AA 1OADA 4LNCA 3AAMA 3ITOA 3IUHA 3M0VA 4XISA 2GYIA 3BWWA
chains in the Genus database with same CATH superfamily
3VOFA 1UMLA 1MQQA 1ZALA 3WLOA 3FHQA 1J93A 5FI8A 3NQCA 1EJVC 4PMUA 2A79A 2ZADA 1YIXA 1BWVA 1DWGM 4ATDA 1EXBA 2BFGA 3WQOA 2DZPA 3QRHA 2ZUVA 1CGUA 1XLKA 3VD7A 2ALRA 4NZ5A 4MY9A 2BVTA 3P0XA 2QVHA 1XW8A 4BJHA 3W1TA 3MS8A 3QHNA 3EOLA 4M24A 3NO5A 4B4FA 1GPFA 2FZ9A 3GC2A 3LXCA 3VCRA 5FF0A 3IIZA 1J4EA 1DWAM 1XDMA 4EPEC 3C2VA 3CU2A 2X1TA 1W1IE 3RUBL 4P8VA 1LLOA 2REQB 2Y2WA 1IZJA 3H24A 2WNWA 1M1BA 1PS9A 2Z29A 2IKHA 2PUZA 3T09A 3W4RA 1KFKA 3CL7A 1DIEA 3PBVA 3NYDA 3HA1A 7TAAA 3SI9A 2V6AA 5D05A 2YL8A 3N2CA 4Q8QA 4CD7A 1WE5A 1XLIA 1GTEA 3NDYA 3W7GA 3O2LA 4Q4SA 4Q8WA 3ZM8A 3TUUA 3L5MA 2C1HA 3E2RA 3TYDA 3R94A 3L65A 4D2JA 5MHBA 5JVLA 3W6YA 4PEKA 3G0UA 1X7FA 2FDSA 5FJPA 3P8JA 4C1NB 1K8ZA 1CLVA 9XIAA 1IWAA 4PYSA 1T96A 1MFUA 2ASHA 2GUYA 2ISSA 4NNCA 3UG8A 1E6ZA 3UY7A 3ZQ9A 4J3ZA 4RZ6A 3SCNA 2CU0A 2J4GA 1YBQB 3A4XA 5EYWA 2PRLA 3QTGA 3NCOA 4C6CA 4ILSA 3FSUA 2VUNA 2DUAA 2GWNA 1RP9A 4BF5A 1CGVA 1Q2RA 4GYPC 2OKOA 1YE4A 1LLWA 3LLDA 4ACZA 1GYLA 5AZ0A 3TWAA 3UY8A 4HT3A 1IXNA 2X2YA 1QK2A 4AIBA 2VKZG 1MUWA 2YDAA 1JG9A 5D38A 5LGXA 1KM2A 2I14A 5HANA 4TV5A 1KFBA 3KX6A 2CESA 4JFWA 4O12A 1SMAA 3DU0A 1H1NA 2A6LA 2OOGA 3FEQA 3S2JA 2TODA 3BSMA 3QYSA 1GVYA 2J74A 3W71A 5E9AA 3SN4A 2QUNA 4PMZA 2F84A 4AUBA 1G9HA 1DIOA 3EOSA 3H4XA 4FSAA 5I5RA 2X41A 4I7UA 1TE1A 3CUIA 4CD6A 1NELA 3ITOA 4IMEA 3CZEA 3C0JA 2W67A 3CNYA 4WSHA 1EDTA 1E0UA 3KVKA 1C9DA 1FFQA 1AODA 3M5XA 1F8IA 3NTYA 4KWWA 1PTGA 4Q4OA 4URIA 3V5OA 3KTCA 4O13A 3W1AA 1SQ7A 4KERA 4JTRA 5AFDA 4JGDA 1MXGA 4QP0A 3B03A 1VZWA 2DZWA 4FOKA 3SUTA 3FW6A 3UJEA 1F8MA 3N29A 3SQMA 1ZU8A 2NV2A 3S83A 3LBMA 4EOUA 1Q6LA 1TRIA 5FJJA 4MPQA 3TLQA 4ICCX 4HK7A 3E5PA 1Q5MA 3GR8A 2WHJA 2E4TA 3SY1A 3WMCA 1I6NA 2CZ5A 3O06A 1EJTC 4N4PA 3VILA 3BLKA 2Z1KA 2J8FA 3TCEA 2QR6A 4HVXA 2X16A 4LVAA 4LUTA 2WVUA 3H2AA 1EP3A 1F61A 2RUSA 2YKKA 2CWNA 4LY8A 2ZRXA 1PPIA 2H8ZA 1JZ8A 3GHSA 3CC1A 5I23A 2E5DA 3JR2A 4JQ4A 4US5A 1GQIA 2MNRA 4WLCA 1BSIA 1J2BA 3GIQA 2H90A 1J18A 4MHBA 3WNMA 4O17A 1PEZA 4N6FA 5DCDA 3QQ0A 4FXRA 3TJXA 2R1LA 4NZCA 2J47A 4GX9A 4MM1A 2HE8A 3AS1A 3C56A 1XP3A 3TQ0A 2FTPA 3WLPA 4HMEA 1XWYA 4XKMA 2GPTA 4F2BA 3QKZA 4CQDA 4I7VA 4UNLA 4JAWA 3Q94A 4XWUA 5A6JA 1OQFA 1J6OA 4ZO6A 1ZJAA 1V3IA 4LVFA 1H7OA 4G7EB 3VAVA 2QDEA 1B3OA 3KL0A 4LVDA 2EPHA 3RFAA 4IMAA 1RQHA 2HVOA 2VFGA 1KM0A 1QPNA 2Q09A 2ZZ2A 3FXYA 3TAKA 1W32A 1W3HA 2VQTA 1OC5A 1T8QA 1F7BA 3ZZ1A 3EB3A 4EIVA 4FF5A 3HPAA 3R8GA 4FIQA 4IPJA 2WWDA 4UQDA 1JZ5A 3E0FA 2E3ZA 3CQHA 1V03A 2PDLA 1R9YA 1RPXA 2A3CA 4UTWA 4CNUA 3NURA 3STFA 3PN8A 4LNYA 1TPUA 1DIDA 5ABEA 1QNVA 4DO6A 1DV7A 3FKKA 1PX4A 1QO2A 3HMCA 2YPIA 4BWLA 1UP2A 2GK1A 1LP6A 3LCIA 5FACA 4MJZA 4GO8A 2Q3RA 3GFXA 5BXTA 2V9DA 3BG9A 5BXRA 2DZVA 4AQLA 4FF7A 5TAOA 3G22A 3OVPA 4C1NA 1TV3A 4WGXA 3GH4A 2C0AA 1KXTA 2FDMA 2OOFA 2V69A 4HJWA 4KCTA 5FF2A 1RSCA 2VO5A 5K3VA 5CZKA 4XB3A 3A22A 3HU7A 3BV7A 3CWNA 3EZ4A 3V0UA 3VIPA 5E6ZA 4CN1A 2BMBA 4LU0A 4BQ4A 4JIIX 1OGBA 3T05A 4GOAA 1REQA 2B7NA 2G95A 1SZNA 3NDZA 1BQCA 3RK8A 3B9DA 1FKXA 3QZEA 2HZGA 1Q7QA 4H7VA 3WLTA 3MI6A 3JW7A 5I3JA 3SCPA 4GK8A 5C2XA 4UTHA 1OHLA 3F4DA 2DW6A 4INFA 2BNJA 3FAWA 4ZB2A 3CMFA 1LROA 5DT7A 3OPSA 4D6HA 3O63A 3PUEA 4WZHA 3C61A 3DYMA 1MRQA 1KNWA 1UWTA 1MW2A 4HHPA 1JZ2A 4QGCA 2GJXA 2NQJA 4NI8A 2R1MA 4DO5A 4PTNA 3AROA 1L9WA 1JULA 3NQAA 3RLUA 5A6TC 1C91A 2AMGA 3U2ZA 3QGVA 1BAGA 4YPJA 2Y5EA 4N4QA 2OX4A 3A4JA 1VFOA 2DUXA 3WJSA 1FWBC 4C6IA 3PZNA 1DPMA 1GOQA 2TYSA 5FCZA 5CC3A 1JGMA 4IGMA 1GVRA 4RXFA 3W86A 5CBIA 3NQ8A 5F1VA 1A5SA 2OU4A 3M4HA 5FJRA 4JPGA 3BSHA 1X8CA 1K7FA 2DEPA 3W1QA 1TWDA 2G96A 5G5IA 1VYPX 5CAHA 3HPXA 1HO4A 4WD0A 3WSUA 4QAWA 4JTFA 4JOMA 2JEQA 1NDYA 3ORWA 2JFEX 2YCKX 2TPSA 5HNTA 2QDHA 1WB0A 3UJ2A 4MZYA 3BAYA 3FX4A 3URBA 1S5TA 4OFCA 3GTHA 3N9SA 1WX0A 3A24A 2WHMA 4MJ2A 3DGRA 3OEXA 1XLFA 4L4LA 3OLDA 4JNYA 8XIMA 4QROA 2P0OA 1Q66A 4HYWA 1LQ2A 1ZNNA 5J8LA 4V33A 2XHYA 1UR9A 1UWAA 5AHFA 4NJIA 3SCUA 5HPCA 4AB4A 3NUKA 2PDUA 1E72M 3H2OA 5IFTA 3W85A 4K8HA 4UTMA 4Z0JA 3QY6A 3T7VA 4R53A 2TAAA 3K8KA 1JRCA 3KTXA 3QPYA 2PF0A 2VCCA 3RPTA 3CV2A 4BI5A 3CZGA 4OQVA 3WQ4A 3W1RA 1TPDA 2CERA 3SW6A 4F0HA 3WQ6A 3M0VA 4YTUA 2BVYA 1TQJA 3MHUA 2W9MA 2WJFA 4RE3A 4Q4MA 3GTIA 3CQIA 3TWBA 3H12A 2PDHA 2X1IA 1QO5A 3M46A 4P61A 3O15A 2WLZA 3WDJA 2QPSA 2FKPA 4WOQA 1G7VA 4JTLA 3PJUA 4H6QA 1UD6A 1DWHM 1ZP3A 3B8SA 2VL4A 3MB9A 5F4WA 4IQJA 5A2AA 3FSTA 1V8EA 4M7TA 3H22A 1S5MA 2EG6A 4P5UA 3NQBA 5DFAA 3M0LA 4C5YA 4DF2A 4F66A 2ZTJA 5C9UA 4RNJA 1JCTA 3U2CA 1UUQA 2A7PA 2QPXA 4WCJA 2XWDA 4H8HA 4K68A 4GA8A 1SM9A 2PLJA 1JUBA 1Y5WA 4L5ZA 4PUMA 3WMBA 4M5PA 1ICPA 3TOPA 1RLDA 1F9CA 3N17A 2GVYA 5J5RA 1UKOA 3LB0A 2CLEA 1AQFA 3MPGA 5CPOA 3S5OA 3IV8A 1UPMB 4G7FA 3CPGA 3B0VC 4W7VA 5G2HA 3LZ3A 1W9XA 5AYBA 4LUSB 5CC7A 1YDNA 1WUEA 2J7FA 4UTUA 1ZBVA 3OGRA 1U33A 5C5YA 1KXQA 5CC5A 2WQPA 1D8CA 2QF8A 3IAQA 2ZXDA 3VNKA 2VZTA 2ZRYA 3CH9A 5IBXC 5AN7A 3QR3A 3DFNA 5D9NA 2QJNA 3AMLA 1HJXA 2F6UA 3VMOA 3MDUA 5AYXA 5LGZA 3VNLA 1E73M 1R3QA 3B0XA 3TXZA 2PBGA 2B0MA 3U4FA 5HMFA 3LSBA 5M03A 2XH0A 1PUDA 3AQUA 1LOQA 1O7AA 4M6PA 1KV5A 1OCJA 1HW6A 1EKOA 4GKTA 1UKTA 1HX0A 1QHZA 3R8RA 2HMCA 3LCHA 1JJKA 1EOMA 3W9ZA 1MFVA 4JFUA 5BWFA 4NI3A 4WDTA 1XLGA 1D7FA 1FA2A 4NX5A 2EGZA 4Q3MA 1W9VA 1VQTA 1PWLA 2CW6A 1QPOA 5CBJA 2H8XA 4FNRA 2ZX6A 2DSKA 4CU8A 4ZO7A 3WLMA 2ZQ0A 3LYEA 2RDXA 1DXIA 5FJIA 2BX7A 3ISIX 2HV5A 1V7YA 4L7ZA 3BAIA 3MUIA 1LL6A 3O05A 1DIKA 1EWEA 4LQ1A 5C9WA 1NJJA 4YTRA 3E0WA 1KCZA 2V5KA 4KKXA 4K7VA 5HULA 3QLLA 4JNZA 4REQA 2G50A 4XVEA 1RLCL 2Y6ZA 2YCJA 4XTIA 4IICA 1F76A 3USZA 1K9TA 1JD7A 3QQ1A 2OT1A 3THUA 3B9NA 4IGHA 1M01A 5G2WA 3UZXA 3PG8A 3FY1A 3PUGA 3P84A 3RJXA 3H2NA 5D2XA 2CZFA 1L6SA 4OE7A 4PUEA 4CQCA 2INZA 1ZPTA 1SW7A 3TK7A 1IXPA 3CO8A 4OJYA 3UR2A 2R8WA 2JEPA 4JX5A 2RGLA 1QBAA 5ECVA 2QDDA 1HKMA 1TX2A 2V5CA 3LQLA 4DF0A 1UR8A 3ZT7A 3N3TA 4XK2A 5BOEA 1DJHA 1HJQA 5JUVA 1O95A 5I3IA 2BTMA 2Y7EA 4JR5A 4XBSA 3HV8A 3LGGA 1X96A 1VPQA 1CLKA 3MSGA 4OUIA 2AAMA 1TYGA 3QVQA 2VYOA 5CJNA 3GZAA 4WXZA 1EJWC 2XIMA 4ZQOA 3S0CA 5DEZA 3ATZA 1ZFJA 4AHPA 3CHEA 5LHEA 1Q63A 5DBTA 3GX9A 1R3SA 4M56A 3AZRA 4DJFD 4FOJA 2VGFA 3P74A 4XKYA 3STPA 2CLLA 4EPDC 1HL9A 1JD9A 1TJPA 3SQSA 3UR7A 1QOQA 3NG3A 3N25A 4RPQA 1VP5A 3H7VA 3HG4A 1W0MA 1DE5A 4GKLA 1DHKA 5XIAA 4MZ1A 1X6LA 1OYCA 4AMCA 3QR0A 5K2ZA 2VWTA 1SZRA 5H91A 2AQVA 2GWGA 3AWNA 2NVCA 5LIYX 5I7GA 4ZB0A 4WJXA 3OZMA 1WZKA 3RX2A 1V93A 1RVGA 4ZOBA 3G8EA 5DRCA 3ONBA 4C91A 3G8RA 4KCWA 5KZ6A 3NIYA 3ARZA 3S1UA 1S39A 1ADSA 3VD5A 1I2OA 3EDKA 2GSHA 5XIMA 4QISA 2V5JA 1OYAA 4PR4A 1A47A 2XINA 4LS2A 2A3BA 2VOMA 2W5FA 2XN1A 1LRNA 1S5WA 2F7FA 4M6VA 3EOEA 4RNHA 2AGKA 1IEVA 2EAWA 4MIMA 4AZCB 2GUBA 3W1LA 2WANA 4HJFA 2OGYA 5CKSA 3FJLA 2Y5JA 5C9XA 4ZENA 1H61A 1DTNA 4JIRA 2GJNA 4D9PA 1UBSA 1V3MA 1G94A 2VX5A 1A5KC 2JKPA 2YYUA 3I4KA 1UWUA 2VZSA 3U6WA 4UTFA 3SSZA 1K9DA 4Z2IA 4MAZA 1EBHA 2PDPA 3Q2DA 3RM4A 2FZ8A 3G1DA 3BK0A 1K9EA 1S2AA 3HPSA 2Q8LA 3TJLA 3AU6A 3EMQA 1XQKA 3NO1A 5CH9A 2EXOA 1KR1A 3MWAA 1TPH1 4JYDA 3FJ6A 6XIMA 2FMNA 1ZY9A 2P76A 4QFUA 4QQUA 4PTMA 2Y89A 3NL3A 2E9MA 1OFPA 5EFDA 4EKJA 3G0SA 1BGAA 2PDMA 2VGBA 1GJUA 2PDXA 1FWAC 3AISA 2FZNA 3TC6A 3BQ6A 1FWGC 1OGSA 3QV6A 4JIQA 2XSAA 1Z41A 1A3WA 3G3MA 1LYXA 1E71M 1TPEA 5C70A 3U7VA 4QJ1A 3VGFA 1J0KA 1RJPA 3U2EA 3QGAC 5BU9A 3QV9A 1UOKA 1WAUA 4HCDA 4GQGA 4EE9A 3EWBX 1OCNA 4NZJA 3DGBA 4TVCA 3C0LA 1ZLPA 1E4NA 1EEXA 2YW3A 4F48A 4O52A 5A8GA 4DZIA 5FEPA 4BQ2A 4DELA 1TR9A 3VX0A 4QDWA 1AK5A 3REQB 1WXJA 4MOZA 4AX7A 3L4TA 4HNLA 3UWZA 3CAVA 3TU9A 3TFCA 3W81A 3K1GA 4AF0A 4TOQA 2G4JA 3GNDA 1XINA 2XN2A 3RNDA 3WZ0E 2VEIA 3IV3A 3E3HA 1O6IA 3PF3A 1SMDA 4Z2KA 4YLWA 4I6VA 2BVDA 1SJBA 2QJHA 2NWSA 3BICA 4IPPA 2O0TA 5DBUA 1S1RA 4NXSA 5HNRA 3AXXA 5K9DA 1XGEA 1XV8A 1QPKA 2Z6IA 5BU6A 5A94A 1RJQA 4O16A 2P1FA 3FA5A 3APYA 4KIEA 3GXTA 4W8AA 5FA5A 1W3TA 4IISA 2YXGA 3GR7A 1VYRA 1E6RA 3I4EA 4NUWA 1M7JA 4EANA 1KFJA 3MQTA 5CZSA 3IK4A 4HU0A 4UQCA 4CD4A 5CAKA 1BYBA 5JMUA 3SCQA 7ODCA 4YL2A 4OBRA 2R9RA 3M7WA 1TWZA 3DENA 4KW2A 5CLWA 2YDQA 1B3YA 3B9EA 3CH0A 5T26A 1RD6A 4A29A 4IIBA 2X8RA 4S3KA 3W29A 3MCNA 5IHRA 3O9NA 4PSRA 2IQDA 1JPMA 1E0TA 3GVRA 3SJ3A 1B57A 4PE8A 2OPJA 4ZO8A 2IW0A 3DHUA 2PE4A 3FV9A 2NQLA 5ABFA 2WJDA 1KV8A 3RPDA 1JYNA 3WF2A 4ZFCA 2J24A 3RLHA 3M0KA 3T0TA 3OYXA 4AD1A 1SJAA 3MJMA 1SVDA 1SFLA 2A4AA 4YTTA 3TROA 3SRDA 2BGNE 3S9ZA 3BCDA 4ZSUA 4XZNX 1TWSA 1R38A 5KZDA 4GNJA 1AFSA 1EO7A 1OFDA 4KBXA 1GOKA 4Q7BA 3UGVA 1E6NA 1UYQA 3PUOA 4AZBA 2P8BA 1ONRA 3CMJA 3F2BA 1BVNP 2JF7A 2XVPA 4WX2A 2ABBA 1JI1A 1W5QA 1WCGA 1ME8A 2OFJA 4Q8MA 1JCJA 3F7JA 1K1DA 2F6KA 5D9MA 4M6QA 3W7NA 2CXGA 3VCCA 1HVXA 3TH6A 3M41A 2BY3A 3RF9A 3GXIA 3HTWA 2GJRA 4CNTA 5ABFB 4NJJA 3DZ1A 3WK2A 1EHNA 4DAFA 2WZEA 2WSYA 3CMGA 2I56A 4ZOEA 5FJUA 1EA0A 4ZCWA 3SN0A 2QUUA 2QCFA 2OWXA 4RE4A 2XFFA 4JCLA 4GY7A 3ERPA 1YPFA 2D24A 2C19A 2VR2A 4AWEA 5E0FA 3VIFA 3VZYA 3PTKA 5HXMA 3BOLA 2R6OA 3QM3A 2GQ8A 5HJXA 2X0YA 4N7QA 3G0XA 3VTRA 4AHQA 4C6EA 2V3EA 1BYCA 3CWHA 4AIOA 3WNKA 5KEZA 3TLLA 3HFTA 4HA3A 3Q65A 5EY5A 4PMOA 2MUCA 3KWSA 4L6HA 3ZXWA 1X8FA 3M0MA 3H4GA 4GC4A 4QTGA 2HVNA 2OGJA 4V2XA 2ZDSA 1WPCA 3GBEA 1LQ0A 1K4HA 4C6NA 3OBAA 3WLIA 3QZAA 1LBFA 4B9YA 4AD3A 5DO8A 4RV3A 2OWCA 1WO2A 2GFTA 3EKLA 1MQRA 2PZNA 3IUIA 3VU2A 5A6AA 1PKLA 4GH3A 4AZ5A 5DQPA 2IQ0A 1DL3A 2QULA 3QHMA 2C15A 2VC6A 5B7ZA 2F61A 1GOWA 4LAZA 1U30A 4OGZA 3SQLA 4BEUA 4Y9AA 5D9PA 2XYLA 2FFCA 2VEFA 3G1AA 2OZTA 2IQTA 3M0ZA 1LRTA 3VE7A 1I2RA 4GQRA 4Z2LA 3AU2A 4NX0A 2KAUC 2XG9A 5A8QA 2ZYFA 2L5HA 1GOMA 3CQKA 1MUMA 4AEEA 1W9BM 1ZL1A 4JD4A 4M7SA 4DEFA 3PBUA 4RNIA 3BANA 3A5FA 3C2EA 5G1YA 4LRSA 4YWSA 2ZE3A 4PMJA 2CHOA 4I5XA 1K7XA 1P7TB 1B31A 4C6KA 3GTXA 4DWSA 4LEFA 3II1A 4Z42C 5I07A 3BLOA 2OMAA 5D2YA 1QJWA 4RW3A 3HGSA 1US2A 2DSVA 2F2KA 2PTWA 6A3HA 3K4DA 3RLGA 4GC3A 5HPOA 4CD5A 3V0TA 1X1OA 3LQGA 4WKAA 4DPPA 1UZDA 1OWQA 4NASA 4UTJA 1O1HA 3PPCA 5B80A 3B8TA 1BTCA 3SN1A 4I9MA 5A6MA 1GG0A 2INFA 1QVBA 3B8IA 4UTTC 5M1TA 2YZ5A 1S5VA 1Z89A 4KWSA 2FZMA 3N2BA 1EZWA 3S9IA 1TKKA 1UW9A 3GH5A 2G0WA 3B9OA 3U57A 3SUSA 4M19A 3VVGA 5JH1A 3MKCA 2BOEX 3NPXA 2QIIA 1FCVA 2V5DA 1XIHA 2WSKA 2PDFA 1W9DM 5DMYA 1FWFC 2A85A 3ZVHB 4R7JA 3MMWA 3W74A 5FSDC 4KGJA 3SJNA 4OKDA 4KQNA 1XBVA 3MHGA 3NM3A 2ZUMA 2GGEA 4H01A 3F2CA 4A22A 2ZZ3A 1TTPA 2WBGA 3DIPA 3IUHA 2RFGA 3KOXA 5DCBA 1NOWA 3N2MA 4JTCA 1M7PA 3W22A 2OSXA 3AXHA 5HK4A 4BF7A 4AEFA 3TN4A 4UNKA 3BGJA 5TNVA 1SZFA 3VOGA 4LS1A 4W84A 4MY1A 2G3IA 1TV2A 1O5QA 2PLCA 4ZB5A 1G4SA 4CNNA 1AQHA 1MW3A 3ZR5A 4ZE4A 1DORA 1UP3A 2Z4GA 1CNVA 3VXGA 5T9BG 1M03A 3OLEA 4MWAD 4KRTA 4QG9A 2QDGA 2PPGA 1VBJA 4L6DA 4H8VA 4WQ6A 3N4EA 3MBFA 1Q6OA 1AH3A 1Q13A 3NZPA 1XISA 1ZS2A 4DJEC 4M8UA 2DP3A 3GS6A 1KFWA 1UD3A 4P7RA 3TQKA 3UCDA 1CW2A 2IPJA 3KLLA 2PEVA 4AZIA 1GVIA 4ERIA 2QIWA 4IMGA 5LNVA 3HG2A 4QG8A 1F6PA 3KVMA 1P4CA 3LPOA 1S3HA 4DI8A 4C65A 2RAGA 3V16A 1LBMA 2BZNA 3GU9A 3LRLA 3Q45A 1UOZA 3ZR4A 4XAFA 1U1UA 5L6UA 1BYAA 1OC7A 1WDRA 1BYDA 4P7QA 2VWSA 3SFWA 4D1IA 5HATA 3SCWA 1CGWA 4GCAA 2CHNA 4IP4A 1C8VA 2HK0A 3I6RA 3SY8A 3I6TA 4ZXLA 5FF3A 5C71A 1T40A 3FGCB 2NV9A 1V79A 3E2SA 4IGNA 2C0HA 1NOFA 1G4EA 3WUFA 1YX1A 1X39A 4AW7A 3M0XA 3MZ2A 3HJEA 1S2TA 5KZMA 4TVUA 5CGMA 4D6GA 4CNPA 1LLZA 1RV8A 2CYGA 1C9WA 4FNTA 3VIKA 3IIPA 1X7IA 2XZ9A 4H9VA 3GC4A 3WO8A 2XIJA 3T55A 4AISA 4X0VA 1KRAC 5FSEC 3IGUA 3M5VA 4K39A 4UZUA 2VZUA 4KMQA 3RO6A 1A4MA 1V6XA 4MB5A 2X2GA 1RY8A 1S5NA 3KBVA 3NL6A 2VVSA 2EF9A 4U5KA 5C9ZA 3G2GA 3T0AA 5HQMA 1QI5A 1NEYA 5A8NA 1UH2A 1V0KA 4CD8A 3MO7A 4X22A 1QPRA 3U5UA 2O7SA 2YOCA 3WNOA 3PZGA 4PCFA 3M47A 1UIOA 2YGYA 3LZ5A 2KX9A 4JTUA 4PFHA 1GCYA 1LF1A 2I9EA 1RXOB 4LY4A 3A5VA 3ARVA 3ZLHA 4B16A 4GRSA 5KINA 3PPFA 2Q8XA 4UQ9A 3P6LA 4POCA 1HUVA 5JBFA 3VKBA 3FJNA 4ADUA 4XAPA 3VNZA 2QCDB 4JTEA 4Y9OA 4NYUA 1JI2A 3CAWA 5C6MA 3L9CA 4DJDD 4CCCA 1NDVA 2OYKA 1SSGA 1WZMA 4NG3A 2JBMA 2QXWA 3PUDA 1E6QM 1UD4A 3QPEA 3G3DA 4FNPA 3HIJA 4ACYA 5HQEA 4YS1A 4DWDA 5A69A 2CC0A 2PP1A 4Q8PA 2E25A 4A2SA 1FVPA 3UXDA 1DP0A 1UKPA 1PVNA 3VM7A 3AIBA 2GSJA 3SUUA 3RCNA 4IUGA 2OELA 3M5YA 4XO6A 3GQYA 2PDKA 3WBWA 1R85A 2Z1WA 1FCQA 3FEMA 4IF2A 1HVQA 2ZZ4A 1P1XA 1GVQA 1WP6A 2OLHA 1ITCA 3IANA 3CHVA 4UMBA 4XAYA 2PURA 4A8NA 1NOUA 4DM1A 3GR4A 2PA6A 2Y62A 4B2DA 2YA2A 4DWSB 3W73A 4QEEA 3W0KA 3HPFA 3F1QA 1WXYA 3CUZA 1H7XA 3UW6A 2CEQA 4EPBC 1JUEA 4AD2A 1TPC1 3AS2A 1KWKA 1KQZA 3ZVIA 3RXZA 3V3WA 5MF5A 1XD0A 2FQIA 2J6VA 3GY1A 4Y96A 3W27A 2OZ0A 2WJZA 4MPKA 2ZA1A 3NGFA 1XC6A 1KGWA 1GKPA 2WZTA 3D46A 5CPSA 2XWEA 4A8IA 3WY1A 3E9AA 1E1EA 2XFWA 2W66A 1SO5A 1WKYA 2BXYA 1QNPA 1IWPA 1XICA 1HN1A 5A8MA 4A21A 3WENA 5M3WA 4F40A 1YDVA 4GNVA 4DYKA 3UG5A 1Q6GA 5K9CA 4MFDA 3C2RA 2ZCGA 4XVDA 4C1KA 3ITTA 2FHCA 4AD0A 2PF8A 1E6XM 4DRSA 4H83A 4QAIA 1ESWA 1GYNA 1ECEA 2NV1A 1Q6CA 2ZXQA 3LPGA 4TX9A 1W37A 3E1F1 4X9YA 3UXIA 4N6EA 4ZEPA 3WEOA 2E5BA 5C55A 3DFOA 4IJRA 4IQDA 3H6OA 4KEZA 1MZHA 4L6OA 3R1ZA 3IJLA 2WPBA 4PL1A 2V2DA 5CZJA 3PZOA 2DJXA 3IJ7A 1C8XA 2D1ZA 4N9DA 3PTQA 1VLIA 3B4YA 2YX0A 5LIXX 3B9AA 4FEZA 3GNPA 1LM1A 2CBIA 4AZGA 1CECA 2WW5A 4S3CA 1A5UA 1ZRQA 1GQNA 3L5AA 3DUGA 3QY7A 1TG7A 1ADOA 3VGDA 4GI9A 3H2CA 3V7PA 4AWSA 3TTEA 4U28A 1XJBA 1P1MA 3KZPA 3A47A 2VR5A 1UIPA 1R5YA 2VZVA 3IJDA 3RO8A 2Q02A 2PTDA 1Q65A 3TQPA 1TZ9A 1UD2A 2ZUTA 4ZA0A 3LM3A 4LYPA 2A2IA 1OD0A 1TCMA 3T07A 3UXAA 1XIJA 2CFFA 1F07A 1AJZA 1V08A 3GKFA 3MUXA 4H8NA 3IRDA 2XTKA 1XCWA 3PZQA 3UPWA 3MMUA 4LVBA 3GVGA 1HO1A 2QV4A 2ZWYA 1YNPA 3PJTA 4C6FA 4KT2A 3CIWA 4FALA 4GX8A 3N4FA 3WDHA 1XBYA 2QGHA 1GZ1A 2E7FA 2UY5A 4B5XA 2WXDM 4JEQA 5AHIA 3UJRA 4AD5A 3WK0A 1H1ZA 1GHSA 4PUJA 4WVXA 1TRDA 2C8NA 1NQKA 3R89A 2E9LA 4DM2A 1OEPA 2HJPA 4C6MA 3RRXA 3SIZA 2J9YA 3UPBA 2VGGA 2E9BA 1M5WA 1HGWA 3BWWA 4Y9MA 1D2KA 2NVAA 4EX4A 1B3WA 1L6GA 3WLQA 4J3UA 1D7KA 3NZRA 2DH2A 4LV9A 5REQB 3LTPA 1E1CB 1VJSA 1GKRA 3AS0A 3OA3A 4PTDA 2VC5A 2F38A 2GOKA 1OVDA 4PB5A 1G69A 3DFQA 5EFFA 1KWGA 3IAPA 3BUVA 3W3OA 3TKFA 1W5OA 4QDMA 4C6LA 1TWIA 4GUJA 1H3GA 2UY4A 3LPPA 2EHHA 3PB0A 1KLZA 4K36A 3VMPA 1HKWA 3I6EA 4DO4A 1K9FA 3SB0A 4MVAA 3PK7A 3VKJA 2D69A 1GOIA 4JTSA 2V3DA 7TIMA 3G1HA 1J0YA 4KCVA 3OYZA 1JAKA 1JPHA 3S5SA 3WH9A 4KCUA 2P10A 5M17A 5CPLA 2VGIA 4AHOA 2ALDA 1FHLA 2BY2A 4D6CA 3BURA 4QM1A 4LEQA 4WOZA 4F0KA 3S9YA 2WB5A 3T0CA 4DXXA 3M0JA 1DJXA 4BHYA 2VEGA 4JDYA 1R46A 3DHFA 1V6VA 4B3KA 3WFLA 4QJ5B 4G9PA 3WQ5A 4FA3A 1UPPA 3WQGA 3TW9A 3C2YA 1HL2A 1MWOA 3O3RA 3MYPA 4I5RA 2ESCA 4I9TA 2VQUA 1IEIA 4J28A 2ZRVA 4MKVA 2XPKA 4O8RA 5D8ZA 4H04A 3O0FA 2RJGA 2QAFA 1RCXB 1J10A 4Q22A 2CBJA 2D2GA 4A3RA 4C6DA 2WLYA 2P0IA 1C90A 3TFXA 1OFAA 3EXRA 3J7HA 3N12A 3GHTA 3EA1A 1F2JA 4LUIA 1JYWA 3L66A 1TREA 2CZDA 2CZVA 5XINA 1VPXA 5TQLA 1EC7A 2VD8A 2CETA 3TA6A 3THAA 4OTKA 2PWFA 1X97A 3UBPC 4KFNA 5D33A 4C1LA 4OV4A 3GDBA 1ICSA 4PULA 1A53A 4QJ4B 2WM0A 1BVZA 1OJXA 4XD3A 3WUEA 3EX3A 5I00A 3NR0A 3VC6A 4PB4A 4NJGA 3VKDA 1B1YA 4W4QA 4L1WA 1OFRA 1VENA 3G1VA 3UWQA 5CEWA 4C6QA 1NY1A 2D0HA 5PTDA 3BZJA 2PDNA 5CGQA 3Q37A 3BJSA 1EBGA 1T41A 2GJXB 4MNLA 1E15A 1KCXA 1ISWA 2WC3A 3WF0A 3ANUA 4K8GA 2UY3A 2Z25A 3LI0A 2C18A 1RQEA 5EBUA 1JZ7A 2PDBA 5FL0A 2XVKA 5CGTA 4O54A 4X0NA 1KC7A 4N42A 4PMRA 3TV8A 3EDFA 4ZO9A 3DERA 3DHDA 3O16A 4XZIA 3SCVA 1LWIA 4JQ2A 3L7RA 3NFUA 3WH7A 3M6DA 4HB7A 3SCRA 2X05A 1DVJA 3DFHA 5H6HA 3W7KA 2HQAA 3T08A 1CGXA 4R27A 3S47A 3UERA 3VZXA 3LERA 4HHHA 1FRBA 1MDRA 2ZXAA 1Y5VA 5FKYA 4O8AA 1HXJA 4E5TA 3PTMA 3GAKA 1YRRA 4FOUA 4GMEA 4JX6A 1B0IA 4LBSA 2QCLA 1A80A 4R33A 5D04C 4H41A 1DJGA 1QHPA 3AIUA 3AMGA 4M29A 3ZLGA 2V67A 3APGA 1P43A 1U2YA 2CKSA 2RJHA 5EMKA 3W7OA 2V5LA 1ONXA 2FYMA 3W37A 1CXLA 3V5CA 2GLKA 2FPVA 3G1RA 1KM6A 4Y9NA 1F3EA 6ENLA 2VEKA 2WC7A 3NSMA 4DX3A 4WEVX 3BLEA 3BMXA 1Z69A 2EG8A 3AAMA 3HZ3A 2F8QA 2YA1A 2E77A 6PTDA 4KGLA 3M07A 3GWQA 3NQ6A 4K1GA 3CASA 3M0YA 4HNOA 4WUIA 1QRQA 3W23A 2QJMA 4TUFA 1ALDA 4S2BA 2E09A 3LTSA 4BK9A 1UWQA 1FXQA 4UC5A 1GGOA 4A6GA 3EBVA 3NAVA 2V8ZA 3TYBA 3IRSA 3ABSA 3SCTA 3LY0A 4FPSA 3VFCA 3UQNA 1TE6A 3MJYA 4DUXA 2PBOA 5BMXA 4IX2A 3QPZA 1LORA 2WOQA 1W1TA 4JTIA 1SGJA 1X98A 3NPUA 4V1YA 4ZODA 3ARYA 5E0KA 1BXNA 5CJMA 2GSEA 3CHCA 2ZX9A 3G1FA 1ZSXA 4FX6M 1PIFA 1W31A 2J6XA 3ZIZA 3EX4A 3LHZA 4YYCA 1PKMA 3R25A 1Y7VA 1UASA 1SPQA 3PSWA 4KEVA 3UXKA 5CPTA 3XINA 2PWVA 4Y90A 4D1JA 1WQ5A 1GZGA 5E5CA 3L4XA 3DI0A 3GUGA 1OCBA 4Y6GA 1OIFA 4F3HA 2GDVA 3ATYA 1LTDA 3QLDA 3LHVA 5U4NA 1DKWA 3KE0A 2X0SA 4WJ8A 2QCGA 1PCWA 4UFJA 3GZ3A 1TJ0A 1EZ2A 5FEXA 4PMVA 2EPNA 5I77A 3W2LA 1RR2A 5AC7A 1A4LA 1SW3A 3TA9A 1PV8A 1O5XA 3TP4A 4U2YA 1GK8A 5FL1A 1ODUA 2FVLA 2W92A 4PMYA 3WFZA 1H7WA 1GNXA 3VYLA 3BLLA 5CBBA 2W6RA 3VIGA 3TTOA 4XTDA 3AMDA 3AIQA 5D9OA 1R9ZA 3ITXA 4ES4A 2HK1A 4JX4A 4XZ9A 1AL7A 1Q85A 2POZA 3TDFA 3QKEA 3BSGA 4PCPA 2JQXA 3LRKA 1CDGA 1Z44A 3CUFA 1NARA 2HBVA 3W70A 3A12A 4XZBA 3LU2A 2OSWA 1TV4A 4PSPA 2JIWA 3W26A 2ZWZA 5AHEA 3MMDA 1AH0A 3EA2A 3S1GA 4E2BA 3LV5A 5F4XA 2CITA 4GWEA 4J35A 5E9XA 2WNQA 3AHXA 3KBNA 3GB6A 2J25A 1G6CA 5HMDA 5D2VA 2J77A 5KZEA 2DPEA 3W25A 3KCLA 4LAUA 2PC8A 4TMCA 3ALGA 1F6KA 4GXPA 4GZJA 4DBEA 1Q6RA 3AIWA 1XYBA 4XAGA 2G97A 1DJIA 4OBTA 1TQXA 2PGWA 2Z6JA 1U1JA 2HDJA 1IEWA 3PS7A 3S8HA 2VNCA 2QJIA 3WBEA 4PMQA 1AD4A 2YBVA 2Y8KA 1XXXA 4I5UA 4AC7C 4B91A 4Y2WA 3QQWA 1M3UA 1TPWA 4GIRA 3PZMA 1RZMA 2PWGA 2UY2A 3BG3A 2VENA 4O0KA 1V02E 3MSDA 3O6AA 1L0PA 3OW1A 4F2TA 4UQAA 3CZ8A 3TJIA 1SU5A 3WDRA 1FDJA 3NXFA 3AHVA 3BARA 3ZWSA 4G1NA 3F5JA 3VMNA 4LF1A 2UWFA 3R79A 4MSSA 4D72A 3IGSA 3QGKC 1FKWA 3KBWA 3OZYA 4Q4KA 2NQHA 1SJCA 2P8CA 4W5ZA 3MI3A 4MG4A 3SIMA 4HOZA 4TO8A 2VT0A 3L68A 3AI0A 2G37A 5JXQA 2DIJA 4M80A 3RDKA 1A5NC 3H54A 1IT8A 3OQ8A 3W7DA 1MEWA 3UR8A 1WZAA 5DLCA 3A9IA 3CJPA 1OFEA 1B9ZA 1HJSA 4V27A 3FS2A 1C7SA 1P6WA 1RCQA 3AICA 1GG1A 1Y8BA 2PP3A 1NU5A 1UWRA 3RYSA 3U5YA 1HF6A 3TR2A 1K7EA 3DEQA 3SUWA 3N11A 1VS1A 5BOFA 4G5DA 2DVUA 2XGIA 4TMBA 2BB0A 2XM1A 4GFIA 4GH1A 1ZUAX 3NM1A 5HOSA 3IJ6A 1R2TA 1PSCA 4NYYA 1VRXA 4WY0A 4A05A 4WDWA 3RGTA 2W91A 1KXVA 2EJ1A 4QITA 1VCVA 1BEUA 3W00A 1UQYA 1W9UA 1AW5A 1V77A 4I9JA 4J7RA 1B90A 4XUGA 3WEMA 4Y8EA 2QUTA 3ZLFA 2JGYA 3QR1A 4AY7A 1QHOA 4KESA 1TZ7A 2PWUA 4H6EA 3CZLA 1EF3A 4IG2A 2VD9A 3G18A 4LV4A 4DPQA 3DYOA 3RCMA 2V68A 4CQ9A 1OF8A 1ICQA 4DYJA 2INEA 2O7QA 3ARRA 5ENLA 1UR2A 5D32A 5AECA 3HF3A 3LSCA 2WSQA 2VFHA 3NVDA 3UF9A 4AH7A 2QF7A 2OZ8A 3H70A 1PL9A 3ARQA 1AZ1A 1LWJA 4DUWA 4I3GA 5TD4A 4AIEA 2ACUA 4AFYA 1ISVA 3KCOA 2OVLA 1SUXA 4CEUC 2LLEA 2J62A 4DIAA 3PM6A 1EIBA 4UR7A 4E38A 3BO9A 2YW4A 2Q8ZA 2ZRWA 4NY2A 4NZ4A 1EUAA 1W2PA 5EB8A 3URQA 4GIEA 2VZOA 3IACA 4HNUA 2J75A 3WD3A 3MU7A 1VRDA 5KSWA 3S6OA 1OG0A 1KB3A 1H50A 2J7HA 3D3AA 1P0NA 3LNMA 1XDLA 1QNQA 3N2XA 2ZX8A 1UCWA 1WBHA 2VEMA 3MP3A 1E4LA 4RDYA 4JIPA 2XVNA 4YHEA 4LCSA 3ZJKA 1LQAA 3UFYA 1AD1A 3OQEA 3JU2A 1QT1A 5JIWA 5AVHA 5HAOA 3V75A 3SCSA 4S3BA 4A35A 1SW0A 5D03A 1FH7A 5HWMA 3CUGA 4GVFA 2R91A 4Q4RA 3QMRA 2EEXA 4FNUA 4G7EA 1EGVA 2CPUA 5T8GA 3NSXA 4HPXA 3KDOA 1HKVA 2A7RA 1FP9A 4U2ZA 4MYXA 4OOZA 2YCLB 3GNRA 2QCCA 1TJ2A 5BYWA 3UP8A 1O4UA 1QI4A 3IVSA 4AD4A 4J3TA 1QXLA 2CLPA 1IV8A 5D37A 4LYQA 4N0RA 4FP1A 1IZKA 2XGBA 3KBMA 2QHAA 4E4FA 4HNVA 2WHLA 4BKNA 3T4WA 1S2UA 5C2CA 3CWOX 4DY1A 1U1HA 4ACZB 4A8LA 4NIRA 3CGTA 3THQA 2FH8A 3S1VA 5F4SA 1A0DA 1X6NA 4ATLA 4I7WA 5BMWA 2DSWA 2V3GA 3E0VA 1H7PA 4ZZ9A 3LS9A 3L2MA 4HZ8A 1TTQA 3NDOA 4GVGA 2AQOA 3W7CA 3GG1A 1R87A 4NP7A 3VIIA 4R9XA 3HQNA 2FH6A 3G1YA 1LL7A 3VDBA 1ME7A 2PODA 4PCSA 4H00A 1KXHA 5E0CA 3GNOA 4H9TA 3WH5A 4F2UA 1ZJBA 2FFIA 1G7UA 4IPLA 1LOSA 5JBDA 3L4VA 5EL1A 3GTFA 2XFRA 5T9CE 1RHCA 2O56A 2C7FA 2E28A 5E6YA 5GJNA 2Z7GA 3UJFA 2QAPA 3I3DA 3JVAA 1L6FA 1FCUA 1J79A 4JBRA 1QTWA 2WZIA 1KLYA 3BQ5A 3WIJA 3HN3A 5HJYA 4V28A 3H26A 1XIGA 3BW2A 4BQ3A 4W87A 5CXPA 2CLMA 3CBWA 4XZHA 1HP5A 1XRTA 2ICSA 5K7JA 5HMSA 3NQMA 3S3GA 4WR3A 1F6YA 1S46A 1R3VA 4DQWA 3TTYA 1XLJA 3R4IA 4HZ6A 3DFTA 3D6NA 1V3HA 3G5EA 2O4MA 4LNCA 3LHUA 1FUYA 2X1UA 5DMLA 5FEZA 3VKAA 1WZLA 4UTIA 3T81A 4UMAA 4W9TA 1S2VA 1EHAA 1UR1A 4I6KA 4KIRA 4DHGA 3C0QA 2H3BA 2ISDA 1CYGA 1ADDA 1UZ1A 1XLDA 1XPGA 2POTA 3OU8A 3B0UX 1YE6A 4NAEA 3EWYA 1AJ0A 3G1XA 5G1TA 2RKXA 1IWBA 3F03K 4ZOCA 1VCFA 4RZ4A 3E0IA 1YHTA 4F8XA 1VEOA 1T0OA 3T40A 2PMQA 3BW4A 3BMVA 1CXHA 3CAQA 5A2BA 2QMKA 3LLXA 4CKQA 4LPCA 2H6RA 4GBDA 3NPVA 4R9OA 1R47A 4NL1A 4ZSTA 1UR0A 2WSPA 1G4TA 4Z1YA 4REQB 4CLMA 5HWNA 3B05A 4U10A 3WJYA 4PMNA 4O53A 4QXIA 2Z00A 5LIWX 1KKRA 2Y0FA 3BAWA 2QMJA 2WMHA 4O1CA 5C7VA 2NWRA 2G3JA 4L64A 1QUMA 2YB1A 3CLWA 1US0A 3GXFA 3GFZA 4IP5A 1IGSA 2HPIA 3PFMA 4YU1A 3WK1A 3M5ZA 1OYBA 3ZOAA 4BA0A 2AL2A 4L4OA 4IM4A 2XGZA 1SZGA 4DJFA 3PVFA 3UETA 2HWGA 1GHRA 4WXYA 2WCGA 3KHDA 4O1BA 5GNZA 2DORA 1N82A 4J2PA 1FWCC 3OVGA 2VFEA 1TWWA 3MSRA 5LKYA 3BAXA 3CUXA 7XIMA 4NF7A 2P88A 4GFSA 1BLIA 2WPGA 2BODX 4W88A 5CG0A 2E6AA 2IXVA 3P3BA 3TONA 5F1UA 1WBJA 4HPHA 4R3UA 1O94A 2Y70A 4MB3A 1Y65A 3HGOA 2XH4A 1H7RA 1XLHA 3L4WA 1SFTA 1IIHA 4XIMA 2YSWA 4RL3A 1H4PA 5BXPA 3A21A 4C7FA 4LCQA 4HA1A 1WKDA 3S2MA 1ZJHA 3AXKA 3IEBA 3N19B 3CZJA 1JF5A 1JZ4A 3FFSA 1JQXA 3VA8A 3EPMA 4IIDA 1OX4B 1C3FA 4MZ8A 5CZ0A 1HJUA 3GHRA 3UEQA 3N14A 3RG6A 1F05A 3QBUA 4YN5A 2DZAA 4O50A 5H8MA 4XSLA 4ZQNA 2Z7KA 1WDQA 3FNDA 2CIPA 4B15A 3H2EA 2VVNA 3TTQA 2GYIA 3WLKX 4IPIA 3WNPA 3RR4A 3SDOA 3I68A 1TMLA 4FR6A 4Q8OA 4LWWA 1PAMA 2Y7FA 5AYIA 2Y63A 3KUMA 3PAOA 3W02A 3RAOA 5K4ZA 1XHGA 4MF4A 1E4IA 3NGJA 1K8XA 5KETA 1JCLA 5AHMA 2BXVA 3T1GA 3C2OA 4MJMA 4RW5A 2GVGA 2DZBA 2HNEA 1H09A 1I0DA 4HD5A 1WXZA 3EX1A 4TVDA 1H49A 4KS0A 4K38A 3GH7A 1Z42A 3P81A 3VFLA 5IDIA 1IZCA 2X09A 2NUXA 1KM5A 3STGA 1ZTVA 3LOTA 1XUUA 5IBXA 1CZ1A 1H51A 3NQFA 5LZLA 4FZIA 1ONWA 2ZC8A 3LDVA 1RALA 4PTXA 4D6JA 1H41A 1EIXA 1JXKA 5I3GA 3VOHA 1BQGA 3VIOA 2FTYA 4ERGA 4LUTB 1W5PA 2DUZA 3G6LA 4GY1A 4LUJA 3SEPA 4IIFA 3JS3A 1KQYA 4HMCA 1H62A 3MTWA 1JCMP 2Z2BA 2WMGA 3ITCA 4DBSA 1M7XA 3BMWA 3E12A 3BTNA 1GQKA 3PZIA 3WJXA 3KXQA 1KTCA 1UR3M 1E1FA 2V2HA 3UWWA 2IKJA 1E43A 3OBEA 3LG3A 3WBYA 2E6FA 3G1SA 3TYAA 1UA7A 3UZ5A 2FTWA 3RLVA 1X38A 2W61A 2EKCA 1K8CA 3HO8A 4EPKA 5AC5A 5AC4A 3AIEA 2WJEA 1JPIA 3UYIA 4WIWA 1JFXA 3WQFA 1OY0A 2I5QA 3UNTA 2DT3A 3VCNA 4C5ZA 2CLFA 4OBSA 3MVIA 4H8UA 5F2GA 3OG2A 3SSJA 3G6MA 1W1VA 4H7CA 5LNWA 1YXDA 4IIEA 4O1AA 3T2QA 2DW7A 2WC4A 4J3XA 4S1FA 2GL5A 4QCEA 2ATSA 3N9KA 4S38A 1RVKA 4RDWA 4JEJA 5CQ1A 1FWRA 1Q7ZA 1V6UA 2IXUA 3KRUA 3FCPA 4ORMA 1HL8A 1RA5A 3NEHA 3F5LA 3LD5A 4LTSA 4C7GA 3VK5A 2ZZ7A 5AY7A 3KFTA 2NVDA 2PLKA 5IFPA 4K7YA 1NWTA 3BLIA 1IEXA 2GUUA 4ASTA 3KEHA 1XLAA 1PTAA 3V5FA 4HHLA 2VX4A 4MADA 4NKCA 1XDJA 2NXHA 4MNJA 5ABTA 3B8WA 2GQ9A 4QS6A 3GXDA 2PGFA 1V0LA 1YTKA 4R5EA 3GAYA 2GZXA 5HR7A 1LZOA 4LXFA 4QE4A 3LHYA 4E2DA 2PS2A 3WDQA 3H2FA 3P80A 5ABGA 4C6PA 1W3NA 2OLAA 1S1PA 4B90A 1QW8A 1FH8A 4FX7A 1J0JA 1VFTA 2J88A 4JTHA 2J13A 1W1ZA 1VEMA 2ODOA 5HNNA 2BHYA 2B7OA 1LG2A 1P5BA 2C13A 2DIEA 3CPUA 3L2LA 2CZEA 2OQYA 2IPGA 3VNYA 4L56A 3T0BA 1OFQA 3NQEA 4FS9A 4DXKA 3DN5A 4S3JA 1ZQ5A 1M41A 2WVTA 1EX1A 3FVDA 3P62A 1TJRA 2HTMA 4GLEA 5TIMA 5FJOA 3W88A 4ECLA 5AHLA 2EPMX 1XFCA 1EYEA 4TX6A 4J9JA 2X40A 3R0DA 4EXAA 3I10A 1J01A 1MXDA 4QLKA 1FOBA 4O15A 3I3EA 2QJGA 4JTKA 4AZ6A 4U5IA 3AO0A 3C8NA 5FJTA 4QLJA 5BNKA 1G0CA 3CB3A 3VGEA 1KW1A 1H2JA 3BLDA 2PCEA 2HS6A 3CV6A 2AKMA 8CGTA 4MWAA 2EPLX 4GIYA 4XIAA 3B3DA 3BCFA 4DZAA 4OOUA 1AMKA 3E49A 3MUZ1 4UCGA 1XSIA 4XD5A 1TUXA 3MC5A 4S39A 4QG6A 1SYTA 1OT2A 3TZFA 1EPXA 5MKGB 4JTJA 3PBYA 4JICA 5CSYA 1VH7A 5G1MA 4GI6A 4YVVA 5LA1A 2G5WA 3LRMA 2JE8A 1LWHA 2PTXA 1L8PA 2Y85A 4YJ5A 3IIVA 2DZSA 3HQOA 3ZJ8A 2R94A 4GACA 3KRZA 3MUAA 2XH7A 3A4AA 3TNOA 1RK5A 1GZJA 1PZ2A 3TAOA 4IH3A 4XZMX 1JNDA 3WQ8A 3S5ZA 1QNSA 5A3HA 3CPRA 1S3TC 5DMNA 3RU8X 5A95A 3GLCA 4MLRA 2ISWA 3TEVA 1NDWA 1A0EA 1UJQA 1KRMA 4MB4A 3LA4A 4CQ8A 2E6DA 3WD4A 5EA9A 4AY1A 2OO0A 3HBLA 4AWUA 4S3DA 4JTAA 1NTHA 4Q4PA 4F4RA 1EUNA 1ODZA 4N2YA 2QQ6A 3WUGA 2FPYA 3QW3A 3T0DA 3CUHA 1UJPA 3U8GA 3QZ6A 4JCMA 1YNQA 2PAJA 5DCEA 1GYMA 3ITGA 3KCJA 1V3JA 5REQA 2QW5A 5JU6A 2EJAA 1HP4A 3AMKA 2NUWA 2AAAA 2XIBA 4WKFA 1Q3NA 3OJGA 4XV0A 3LBCA 4B3LA 2YB4A 2NT0A 4IX0A 5A5WA 3P61A 3WKZA 1JRBA 1F73A 3OODA 3V18A 3ARXA 3F4NA 4L4PA 2CWXA 1UQZA 1EXPA 2BOFX 4NU7A 3ES8A 1DWJM 2Q3OA 3EDDA 4P2VA 3TSMA 4W7WA 2F9RA 2X0HA 3UVIA 2O55A 3EWZA 4R85A 4NNAA 4NRRA 4ZQPA 4J27A 4J5NA 3HPZA 3P93A 1UROA 4QNEA 4LX4A 1BSLA 2FB2A 3TYUA 2EBNA 3LMYA 1IE7C 1RBLA 3AMCA 4J40A 3AALA 1C8QA 3OOQA 1V7AA 3MT1A 3GU2A 4IGSA 4BEQA 4LW7A 3O8AA 1FY6A 3HG3A 5FF4A 4W93A 1EA9C 1VIWA 2IUZA 4U3AA 5H8UA 4BR1A 4N02A 4GPNA 3NL5A 4E4PA 4Z1CA 1DJWA 3GXNA 2WV8A 4P8WA 1OK4A 4MB1A 3CB8A 3LCGA 1JYVA 1PX3A 3O6YX 2HISA 1NH6A 4LB4A 5LNRA 3EPOA 4D6DA 2DFAA 1XKYA 1J9YA 3QV8A 4GINA 2YLLA 3GUWA 5HMEA 1JEZA 2J7CA 2X1SA 3EOOA 3C8FA 3KBSA 5ABHA 2OZ3A 4QNWA 2Y8UA 5I0DA 2R1PA 2GGIA 2I17A 1OADA 1TPVA 4HNNA 4QSHA 1OINA 1BKSA 4TTUA 3WNNA 3EPNA 3WYZA 1J8VA 1Z7AA 1LL4A 2R82A 1KCLA 3RJYA 1XSKA 4OU1A 4W7UA 3QC3A 1U5HA 4IUOA 1ZP4A 3UWEA 4Z08A 4ENLA 1MMFA 4QSFA 3UZYA 2PFHA 5EBAA 3K4AA 1YLVA 1QW9A 4UTLA 5KMYA 2ZC1A 3NZQA 1N7KA 2FZDA 3PG9A 3U9IA 3WD1A 1I60A 2ZFAA 5A2CA 4DVOA 2WCAA 2XVLA 4OZOA 4W85A 2GGJA 4KWUA 3R7MA 1Z3NA 4GJ1A 1TJ1A 2HPMA 3EKGA 1N55A 3AIRA 4UFIA 2WWCA 5DELA 2YZRA 3TC7A 2JGQA 4YWIA 4GYJA 4GUHA 3R8HA 2ZUNA 1EDGA 3VC5A 4GE8A 3EAUA 1TIWA 1J2WA 4H9YA 3CT7A 2FJKA 4L4MA 3BOFA 2Q71A 1FWEC 5GJPA 1EC8A 4M1RA 1WOAA 3KZSA 1DJNA 1PTDA 3OTRA 2ACQA 2DH3A 4HU3A 3NNTA 3QXBA 4W8LA 1KFEA 3REQA 4CNSA 4GYKA 2CLKA 2ZZ1A 2MANA 2BHZA 1D3HA 1AL8A 3ES7A 2NX3A 1I9CB 1AW1A 5IM51 2PDYA 3FYPA 3ZJ7A 4ZOAA 1BRLA 1REQB 3M6YA 4Q6JA 4E2OA 3MP4A 3UCCA 3GRIA 8XIAA 4J4KA 1XBZA 1H5VA 3PPGA 3SGUA 2EPOA 1ELSA 1EP2A 4LS0A 1E3ZA 5HUOA 2PTYA 3VIJA 1PO9A 1VKFA 6REQA 4CEXC 3MV01 1KM1A 4RJEA 4EACA 1V3LA 4ZQRA 3SZ8A 1SZEA 1VD6A 3QF0A 6REQB 1PYFA 4Q8NA 1Z32X 1J0IA 2JK2A 1GWJA 3GVQA 3N15A 1UR4A 1AH4A 3LCXA 3A4WA 1J5TA 1DJYA 1FHUA 3C86A 1HT6A 4YTSA 3F5KA 4WJEA 1UKQA 3IVUA 1W8GA 3MVTA 1GONA 3V35A 2E1WA 4QR6A 3CHFA 3CXOA 4TX8A 4UMCA 3ZT6A 1R7OA 3UYCA 3ZMRA 3KM8A 2E5CA 4XBJA 2QS8A 5GNXA 1NVMA 4NT0A 2QLYA 1K6AA 3NQDA 4E2VA 4LAKA 4J3VA 4DI9A 1JDCA 3UD6A 4DB7A 4NAFA 2VDGA 1I8JA 4RKAA 5C2GA 5AC8A 2JALA 3IS4A 3S6DA 3DAQA 2QNEA 3FOKA 4WGHA 1M7OA 3OP2A 2RH9A 4BFAA 3TTSA 3GXMA 3KS5A 4JHOA 3UU0A 7REQA 2WSRA 4CUCA 2ZUUA 3OVQA 3GYEA 3WLSA 1W3LA 2IS7A 1P7TA 1XH1A 2O9RA 3UZJA 4HTBA 3BCJA 1SR9A 3QFEA 4L61A 3W2MA 2C14A 5ECUA 3W75A 4D6EA 3DH7A 2ZKMX 4TQTA 3HV9A 3VDGA 2WNZA 3K30A 3W24A 3CIVA 1XL9A 1J96A 1SJDA 4UR8A 3MZNA 1QWKA 4A8RA 4LAMA 1FBAA 1HG3A 4HPNA 4K37A 1CTNA 3TW6A 4PGLA 2H3DA 3HURA 4Q8TA 1TZZA 1B3XA 3M44A 4F0RA 1Q2SA 1QR7A 2QUMA 3MWCA 1VAHA 2Z28A 4TU1A 2DT1A 3UWUA 2ISVA 4YTQA 4A4AA 5EMLA 1AMYA 1B4EA 2NX9A 1E40A 3RILA 2WO5A 4NRSA 1HFBA 5A6BD 1QATA 1XYLA 1E3XA 3LK6A 1UD5A 2DY3A 2P53A 3R58A 2QUVA 3SRKA 5JIPA 2ABAA 3AYTA 4S3AA 1EGZA 1TVNA 3IJ8A 3N04A 1XG3A 4AZHA 2PWDA 1GEQA 1UZ4A 5CLTA 3TSDA 4H9XA 2OKTA 3FDKA 3THDA 3P60A 3K8MA 1UB3A 4BI6A 3W7IA 2ZA3A 3OIHA 1WKFA 3EDJA 2NXGA 3R10A 3CV7A 4X9SA 3BZGA 2YXXA 3MP5A 1CGYA 2J7GA 4FK9A 4AXKA 3STCA 3NQGA 1CENA 4IZGA 3KP1A 2GQ3A 4O57A 1XYMA 3WF1A 3FIGA 2Z2UA 1OD8A 2Y5SA 1XD1A 3HQ1A 3M0HA 2BV9A 5JBEA 3R6IA 4IFKB 4M1BA 2J27A 1W6TA 5GJMA 1MO0A 4KWVA 3DFPA 5LNUA 3AYRA 4GGHA 5EMMA 2D2OA 2Y7GA 3A9BA 1TMQA 3KHJA 1ITUA 2G3NA 1E9LA 4OV9A 2C71A 4MYAA 4DWSD 1ZBCA 3GDLA 4KRZA 5F2MA 2VM8A 4PTVA 4GXMA 3DFYA 1NQ6A 3W1NA 4DNHA 1KR0A 2D22A 3KVLA 4M3PA 4JIHA 4X2PA 2OJPA 4OT7A 2PDQA 1SFSA 5CCZA 1KM4A 2C6QA 3MDWA 3Q67A 4Q8VA 5EMYA 4G1KA 1FX6A 4PRWA 2Y61A 1I45A 4UTWC 1VR6A 4Y7EA 3BXWA 3DKJA 3MHFA 1XFBA 2JKAA 1YTEA 2DSZA 3O1NA 4KPLA 2TSYA 2WNNA 3MKKA 1R30A 4ZGYA 2VC9A 1W2VA 1UA3A 4YXGA 1BXCA 4JKLA 2XU2A 1VIZA 3CTLA 4X3ZA 3W6MA 4LF2A 1NWRA 2PGEA 1Q8JA 4GISA 1A0CA 1H0GA 1EYWA 4R88A 3IARA 3PULA 3QSTA 3ZFHA 1HZYA 4HNCA 1X1ZA 4QRNA 2J79A 3N6HA 3IJQA 3UA4A 1NWSA 3INPA 4KFPA 4PEEA 4TV6A 3ABXA 4UNIA 4DN1A 4JL2A 5RUBA 2VOTA 4ML4A 4H7ZA 3V0SA 1JUKA 3W07A 1ZJIA 2OSYA 2Z27A 3IIXA 4WF7A 2GOUA 5EKYA 1RA0A 5LIKX 2JKEA 4DUOA 4LC6A 2VDHA 1PWMA 3QTPA 1HKJA 4MNMA 5LA0A 3TX9A 4MTVA 4A3YA 2IMRA 1Q6QA 2QVNA 3CV1A 2VMFA 1AZ2A 4YIWA 4MMWA 3DX5A 1JCYA 1ZZMA 3N18A 4TR9A 4PUNA 2BVWA 1PJ9A 5I2UA 1M6JA 3FDGA 3NZ1A 4MFEA 4NJHA 2OR2A 1V5XA 3ME3A 1XG4A 2ZOXA 4BY3A 4DYEA 4B5VA 4GI8A 2EPKX 1XYAA 4O4WA 5DN1A 1OZQA 2DGAA 3KDNA 1A5MC 1B9BA 1RBOB 3DBPA 2P3ZA 4AU0A 4UFLA 1UH3A 2ZE0A 1SO3A 3RN6A 3EB4A 4XBKA 3TMLA 4C60A 3EGJA 3MI2A 2J7EA 1R3YA 3MSYA 1AQMA 1XCXA 1AJ2A 5D2WA 1RY0A 3B8UA 3I3BA 5LHFA 3BW3A 1FWJC 2A1YA 5JQ9A 2ZBTA 3WD0A 1QNRA 2CLIA 3FKRA 3CEUA 4X2RA 2BG5A 4UOQA 4A3UA 2DVTA 3GG7A 1YBQA 3AXIA 4WY0F 1W91A 3SBFA 1BKHA 3LBOA 4H9UA 2C91A 3LN3A 3VE9A 4N9EA 2OCZA 4CNOA 3ITLA 1TA3B 3P5ZA 4GG9A 1DBTA 2V3FA 1QDSA 3BJTA 3UWYA 1ZAIA 3W2NA 2BASA 1JR1A 3QJAA 5FAGA 4HPGA 1XYFA 3BOXA 5GVJA 4Q32A 1HIZA 1YPIA 1UUOA 2XSBA 1PHQA 1M9HA 2PU0A 3DG3A 5BXSA 1UP0A 3GW3A 1YYAA 4R34A 3PP7A 3PHAA 2Q01A 2PWHA 4LYKA 4JQAA 1V6WA 4KEUA 4PFMA 3VO0A 3TYEA 1DWIM 2PDGA 4H2HA 3IWPA 1F3TA 5G4HC 1FP8A 1K6WA 5AB3A 2BY0A 2QZRA 3ZR6A 3N2OA 5AC6A 3OG3A 4A3HA 4HZMA 3MMTA 3PZUA 3L23A 4MKSA 1JVNA 3K46A 3AC0A 5CPNA 2ZVRA 2QCEA 3PBMA 3QV7A 2E8YA 1BXBA 4YCOA 2QGYA 2XUCA 1ZBWA 3I65A 5CG7A 3R5EA 8RUCA 1F3XA 1SO4A 2QYGA 2OODA 2E40A 2J66A 3LCFA 3UGRA 3DYPA 1QK0A 4XZLX 4JS3A 4HK5A 4ZBCA 4M0XA 4AMAA 3ENLA 4UUIA 2QCMA 1VFFA 2VJXA 1OG6A 2BP1A 2DZXA 4DJDC 1EGMA 3E5BA 3PB2A 3BLFA 7CGTA 1JFHA 1MNSA 4D8LA 1PIGA 4G2DA 4U31A 3KP0A 4N9CA 1XKJA 2Y24A 2D3LA 4OUEA 3PPHA 1CPUA 4DLMA 2HEJA 3W2UA 4UFMA 2E68A 1R3TA 3HB9A 1EL3A 2NSXA 1WA3A 2A6NA 4KEMA 1FTXA 1WOBA 5DY3A 1U5VA 2VXNA 4NXKA 1BD0A 4HQVA 1DQWA 5E09A 3W7RA 2VR4A 4DJFC 1KGUA 5HBFA 1JCNA 3P7YA 1XR2A 1VC4A 3W1PA 1HKIA 2D2HA 2GJPA 3HJZA 3O6DA 3EWXA 3CEPA 3PSVA 4XKYB 1JIBA 3W1UA 4CCDA 4FXJA 4HNTA 2OG9A 4HA4A 4O0QA 4AZCA 2VUYA 4XQ6A 3LPFA 2YA0A 4Z2JA 7REQB 4NZ1A 1ML1A 3WBXA 4GVHA 3QC0A 2XVGA 3C4UA 3D5HA 4M51A 1A5CA 5CPQA 3QH2A 2PI6A 4E8GA 2YCIX 1ISYA 3EEZA 4R7OA 1O68A 2B31A 3OGVA 4JKKA 5I78A 2FHBA 3TQVA 1EQCA 4BZYA 4ADSA 4A2RA 2QV5A 3B4UA 4CN4A 5BRPA 3B04A 1B2YA 4EAMA 2PWEA 3R11A 3PBGA 3L67A 4I90A 5IDZA 3DG7A 1U83A 3D0CA 4AC1X 5GPRA 2WKJA 3BH4A 4RE2A 3GVWA 1XRFA 2A3LA 3RPMA 1QCWA 1GVEA 4DLFA 2PRHA 3K2GA 3FGCA 4HCHA 1R2RA 2BSLA 1L6YA 4PUDA 3LXBA 3TIMA 4PODA 3BE7A 3ELFA 3DBNA 4CCEA 1LDCA 3IGXA 3VDCA 1LG1A 3ZO9A 2GDQA 3VNDA 2V5BA 1YKWA 5FF7A 4YVPA 1IT0A 3KS6A 1XUZA 4IL2A 2NQ9A 1JXJA 2FGLA 2JIEA 4AEOA 3NEVA 1EJRC 4BS0A 3NOYA 4ADTA 1K3UA 3LENA 1XLMA 1MEIA 1MEHA 3COTA 2FJUB 1CIUA 3F2DA 4FXFA 5DRIA 1YDYA 3CK5A 4L9XA 2EQDA 3UR5A 1BVWA 1TV8A 4AZ7A 1V6TA 4F9JA 1W3JA 2D3NA 3L0NA 3MBDA 3S46A 1QOXA 3LGDA 2VFIA 4J1OA 2VX7A 1TA3A 4YVXA 2XM2A 3DI1A 1EC9A 3DOPA 4AX6A 2HBXA 3WCZA 5A6LA 1R3RA 2BXZA 3VABA 4JYFA 4GXWA 3FHAA 4HP5A 4Z0SA 4FB7A 3BLPX 4O0ZA 3W6LA 2YDSA 4Q7NA 3RHGA 2R1NA 3W7QA 5AOUA 3N2TA 4XISA 4LJ3A 4CN6A 1JCXA 3ABZA 1FXPA 3V1HA 3WNLA 2RGMA 4GUGA 1RBAA 3RM9A 1HJWA 1IYXA 2WMJA 7ENLA 4CGTA 4W89A 4DJDA 1HJVA 4RR4A 1ME9A 2XZ7A 2NQ5A 1GORA 2OEKA 2VRQA 2O9TA 4CCZA 2ZIDA 2ZX5A 4QJ3B 1VBGA 9CGTA 1CEOA 3BVJA 2XJ7A 1E0VA 4UXDA 2C1IA 4FLOA 2YXOA 3WF4A 1MVYA 3WDPP 5F7UA 3S1XA 6TAAA 1R9XA 1RQBA 4DZ5A 3W38A 4S2CA 3U48A 2HNHA 5C0QA 2I5GA 4DUVA 5G4WA 1XCFA 3W76A 1PXGA 4RE0A 3B0PA 2WMIA 1I2PA 3SR7A 2PB1A 4JFVA 2I5IA 1J6PA 3BV4A 1TB3A 2FLIA 2OT0A 3L21A 3WLHA 3AZSA 3H23A 2WZMA 2PSNA 3QMTA 3AFBA 3VPLA 4DBWA 2YJQA 1H63A 1C92A 5U7SA 4HSOA 3RX4A 1GW9A 3ICJA 1E9ZB 2Z26A 1AUSL 3EOUA 4H2CA 4IQEA 3FA3A 2OLSA 4MWAE 2X7VA 1FH9A 1CBGA 3UA3A 2QPUA 1GQJA 3FJ4A 1KTBA 3GG0A 1O12A 2D23A 1M65A 1EQPA 3FN9A 1XIBA 5J5DA 2Q6ZA 5H8PA 3LHWA 3L12A 4GVIA 2I57A 2BBFA 3WDIA 3DDMA 3BAKA 4QE5A 3BJFA 4IT1A 3ITVA 3DKLA 2YDRA 2QCNA 3N6QA 1GT8A 3GD6A 1V3KA 1D3CA 5EMUA 5I09A 3EB2A 4PB3A 4C90A 3CHDA 2A3EA 1ISZA 3QOMA 3C5QA 3VDHA 3GC5A 3LHTA 1ECQA 3NJ3A 4NAFB 1IF2A 1VYSX 4K3ZA 1ZB5A 1ITQA 3VIHA 2IKIA 3RRAA 1JDFA 1JYXA 4AVOA 1PDYA 1W1YA 2DIKA 3RMJA 3CM4A 1VF8A 4F0LA 1J12A 2G4FA 1UD8A 2J78A 4AF0B 3SGZA 1ZCOA 3CLMA 3ARTA 3AOFA 4MGGA 2J9ZA 1T6MA 1M53A 4UCFA 1DXEA 2EG7A 3E2QA 4OHQA 4AYGA 4RXGA 6CGTA 3EMZA 4F79A 3BL3A 4MDOA 4LBRA 1P6BA 3PTDA 4EXQA 1XLEA 1NAL1 1PHWA 4UOZA 1N8IA 1MYRA 1JPDX 4ROQA 3OBKA 5I79A 3LEPA 4RDZA 4JTDA 2Z2AA 1KBJA 4ZTYA 5AYYA 4IP7A 2PDCA 1XGDA 4PTWA 1IHIA 4GIAA 2GGGA 5G2IA 1CI1A 3R43A 2X30A 3GU1A 1IXQA 1BPLB 1I0BA 4BQ5A 2PU1A 4HGXA 3CUJA 3VD9A 1H5YA 1HGYA 3XISA 3L0KA 3WQDA 3S2NA 2WMFA 2DT0A 3N9RA 1MDLA 4G8TA 2WVVA 1EJXC 2GJLA 3B40A 5AYZA 2GVJA 4MNKA 3KOYA 3GBDA 2I9UA 3MO4A 4KFOA 4JTTA 4FIRA 1SFJA 4QEHA 2ZVIA 4R7WA 2FMOA 4LSBA 3AUOA 4JTQA 3POHA 3ABQA 3VNIA 3SM0A 5CSRA 1XS2A 4J3SA 1Q7MA 4PUKA 4XD6A 5TF0A 3RU6A 2OYMA 3ONCA 4Q33A 2W79A 4GZIA 3W53A 4NHVA 2AL1A 2HXTA 2J7DA 3AJXA 1L6WA 5EGRA 4FNQA 5AKQA 3A3WA 1OC6A 3A64A 3ZJ6A 1DQUA 4HOWA 1XIEA 3MV11 4GQQA 5FOOA 5FEWA 2Z1BA 3FYYA 1EF2A 3T8QA 4U3CA 3APTA 1RD5A 2GGHA 5DXXA 1E55A 4O1FA 4DJED 3GDRA 4HSHA 4B5SA 2ZX7A 3E2VA 5LXXA 1XIFA 2V63A 1MRAA 3N34A 2A3HA 3GFYA 3VZZA 1G01A 4V1XA 1OFOA 3FA4A 2E0PA 3GDKA 3PZ9A 3HGJA 2FPTA 4B9ZA 4US5D 3ZS4A 1TO3A 1V51A 1CXIA 2Y7DA 2VURA 3D3FA 1VFSA 1U22A 3BG5A 4RZBA 1G5AA 4FLRA 1XGZA 1XLCA 3TMQA 3H8AA 3F4WA 4B5WA 3GIPA 1OGGA 5DMMA 1KKOA 2R14A 3W7MA 1I2QA 1XRSA 2I16A 3MUCA 3U2OA 3PAJA 2VCAA 4RV8A 3WG6A 1RP8A 2FZBA 1POKA 2HS8A 1K8YA 4JYEA 1PKYA 1TPFA 4RPPA 3OIXA 4YNGA 3S2LA 1XH0A 3BC9A 3OO2A 3NOEA 3HGRA 1R8LA 1OX6A 1PIIA 2ISFA 2ZA2A 3NZGA 4HU4A 5EMJA 1JGIA 3G77A 1Q8AA 3PC0A 1OSEA 1PYMA 4PC8A 1K02A 3WELA 2VRJA 1XIDA 3R2GA 4IJCA 3UVAA 1W1B1 3SCOA 5J04A 4HA0A 2I1OA 3KOFA 5C7HA 2O9PA 2W3ZA 1K77A 5I3KA 4KF1A 1KRCC 1W3IA 3NQ2A 3LLFA 3NWRA 1WV2A 4NZ3A 5CSSA 4XX6A 5JH2A 1DXFA 3PWIA 4C7DA 3DXIA 3VUSA 1RK6A 1Q6DA 4ROPA 1A5OC 4ATWA 3CYJA 2V82A 3SURA 3W2KA 2G3MA 4EAYA 5SWUA 3STEA 4FO4A 4B4HA 1GOXA 3DECA 4JIEA 4C6OA 3URAA 4U4MA 2BS9A 3I7RA 3RX3A 7PTDA 1F74A 1HNYA 3LGEA 4E0CA 4MJ4A 1T8XA 2CBVA 1VCGA 2YCLA 4UR9A 1C8YA 3MY9A 4GCXA 4NSBA 4PL2A 2WVVB 2FGZA 1NIUA 1E4MM 1I4NA 1B54A 4UFHA 5IRPA 1R6WA 3H55A 5DXYA 2VC7A 4ORIA 4KRUA 1NP2A 1SO6A 4GY0A 2REQA 4W5UA 4TXEA 4P8UA 1KBBA 3T78A 3WMSA 3UWVA 3OVRA 2RDWA 4LB3A 4LGXA 4QQ3A 2WVSA 2IPFA 3CYVA 2XFYA 3OZOA 2HVMA 1E5NA 1W5NA 2VCBA 2ZRUA 4L1GA 1CGTA 4BCEA 3K13A 2PCQA 2PD9A 4RLIA 3AHTA 2DU2A 4RDVA 1G67A 4NNBA 5D8WA 4D8AA 4DNMA 4IOTA 1I2NA 1OBAA 1KD0A 2BY1A 2AL2B 3AYVA 1XPYA 3W87A 2YFNA 3ARWA 3GVVA 1R86A 4PCTA 2WK2A 1FWWA 4GBUA 5DT5A 3PBWA 1UWSA 4JZ5A 2FVKA 4MWAC 4WRHA 4B5NA 5K4XA 2ZRZA 3ABRA 1TFVA 4E8CA 3M43A 4KWOA 1K03A 3T2PA 4HIBA 4ONVA 1YXYA 5E70A 3LCWA 4ALDA 1JQVA 4E3TA 1AVAA 4RZ5A 2VTFA 3UESA 2UZ9A 1IR2A 4H19A 1V6YA 3GE7A 3N73A 1ZAJA 1EO5A 1ZBKA 4G56A 3VUPA 3CS2A 2VDIA 3QMSA 4WDXA 1LJYA 1OT1A 4ZMGA 1R0MA 3IIOA 3AJ7A 4LC8A 2VX6A 4HYRA 4L80A 2VHLA 3M1ZA 1I75A 3M9YA 1PKNA 1FWTA 2RHGA 2PP0A 1PB0A 5FAJA 3VOCA 4QHRA 3T44A 1KM3A 1NFPA 3AIVA 3SECA 1BFNA 3UG4A 2AOSA 4Q6XA 1UBPC 1FFRA 4PBGA 3H21A 3HQPA 4M82A 1X1NA 2WKLA 4HN8A 1E56A 3ALFA 1TVLA 8A3HA 3PFRA 4UBPC 4J2MA 2YLAA 4IFRA 3ITYA 1PZ3A 3ZSTA 2NT1A 3ARSA 1C93A 1ZCCA 2DDXA 4QIUA 3WD2A 3P82A 4IFKA 4CVWA 3PJXA 1V02A 2V2CA 2BGSA 3WQCA 4HYVA 4HU8A 5T91A 1TV7A 3NPWA 1JF6A 3WLNA 5D02A 2YIHA 1R2SA 4XD4A 4HPJA 3UXLA 1P0KA 1XYCA 1GOOA 1QI2A 2HSAA 5C8BB 5I03A 2D20A 1E9YB 1C29A 2C79A 2PD5A 1NDZA 1JZ6A 5MKGA 1IEQA 1XI3A 4CVUA 3W7HA 1DQXA 3NQ7A 3RMEA 5E1QA 4HCLA 3NYZA 4S3EA 3OA5A 1PBGA 2G41A 5CJ5A 5DY2A 2PLMA 4WDUA 2FB3A 3T6CA 1NF7A 2IPWA 3W84A 3E74A 2NW0A 1E1CA 1K4GA 3EMCA 2W0UA 1IQ8A 4YHGA 4FR1A 2VI0A 3CL8A 4E6MA 2CLOA 4ZL1A 3G24A 3A23A 4AY8A 3GDMA 1NM9A 4FLSA 3VD3A 3JUGA 4JTGA 4Y9PA 3UCQA 1V0MA 4XG1A 4O4VA 3N4AA 4JY8A 1QW7A 5BW6A 1L2QA 2E67A 1FHVA 1FQ0A 2NLYA 1AW2A 5HQLA 4H4IA 4PBFA 4UQBA 2ZDRA 4WSJA 3EWUA 1T7LA 1VFHA 4FXSA 5E93A 2YBUA 3C0SA 3EKZA 1GUVA 3TYZA 2ADAA 5CPMA 2AMXA 1P0EA 4O14A 4HN4A 2PTZA 1L8NA 3CT2A 1JL8A 5A6BA 3SO7A 3SAZA 1XQLA 2EO7A 2WHKA 2F6XA 1WUFA 4PH6A 4WY0B 2VFDA 3IK2A 1KBKA 4S23A 4PCNA 1TVPA 4K6AA 1V4YA 3QFWA 3KVJA 3C3UA 3VM5A 4F0SA 1B4KA 4KETA 5CZTA 1A50A 3NO3A 3TJ4A 5C9RA 1CXKA 3B8DA 3PNZA 1X6UA 1MZRA 1ZGDA 7A3HA 5GNYA 1VHNA 2CLHA 3EYPA 1BG9A 3PWAA 1LOLA 3AWOA 3KW3A 3RM8A 2ZXBA 1OX4A 2C1GA 4LUSA 2B81A 4TIMA 1DEDA 1OX5A 2OEJA 5I3DA 2ATMA 1FWIC 4N9BA 3E0LA 3T2OA 2FIQA 2PGRA 2DSUA 4S3FA 1Z6KA 4O1EA 1QWGA 3OGSA 2YCEA 4D8ZA 1XYZA 4P8XA 1WAWA 1E0WA 3VGHA 4H6RA 1F4HA 3I7SA 1QPQA 4UOJA 5TBOA 1FWHC 4PZVA 1W17A 4B92A 3SFKA 4UWMA 4LVGA 4IJBA 3DG6A 3WH8A 4P7NA 5DANA 4O11A 1W1PA 4L9YA 2X1RA 3L0GA 3Q58A 4AWTA 1GEHA 3DFSA 1PZ0A 2YBTA 3EXTA 2O4QA 5D09A 5FIPA 4OECA 1W1A1 1B3ZA 4KH2A 5A6KA 3UZZA 3TN6A 2WBKA 1NWUA 3QOKA 1OF6A 1NP0A 2J8TA 3BGGA 4C6JA 2BWGA 1PE1A 2WYSA 1DJZA 1LCOA 2DZTA 1YXCA 3KLKA 1FHDA 1WDSA 3KRSA 1XM3A 5F2LA 9XIMA 3EWDA 3FK4A 1N8WA 1H60A 1T5AA 1Y0EA 3E02A 2DV0A 3W1MA 2PZ0A 3EA3A 1IT7A 1OCQA 3BGAA 4H6KA 1QOPA 3U3HA 2OYLA 3KBJA 5IHSA 3TE9A 4JFSA 3MCOA 4DAIA 3UG3A 1CT5A 1KO0A 1E5JA 3ECQA 3IUDA 2VP8A 4RUBA 3TXVA 1LUCA 4WSKA 4EWJA 4QBXA 3TW7A 1VBUA 4BWLC 3GYCA 3CTTA 2O92A 4CU7A 3ZVHA 4WHBA 3KAOA 2HCVA 3H7RA 3QYQA 1IGWA 1L2UA 1XLLA 4PRRA 2XH2A 2W63A 5D2TA 3B97A 4NZFA 3WK3A 2NQZA 3M7SA 1Q45A 2FVMA 2C16A 1KBLA 1FCBA 2W27A 5A8PA 3O6CA 1CLXA 1ENUA 1UC5A 3WBAA 1FDYA 2HE5A 2PC4A 1AA1B 3K1DA 2XN0A 3AHYA 1ISXA 3O0KA 1WNOA 1RJRA 3THCA 4P7LA 4GNKB 3WJZA 3PANA 3WL0A 1KBIA 1D9EA 5I02A 2XISA 4BI7A 4Z2HA 1QU4A 3QHOA 2R24A 4LYRA 2A21A 4DO7A 2V81A 3SGGA 2VEPA 5I06A 1B3VA 1A5LC 1JNEA 1PX8A 4HSNA 1SSDA 1J0HA 1DE6A 4QE1A 2DT2A 1US3A 3DESA 5D30A 3E38A 3GM8A 1IIGA 4H9MA 3M16A 3VDAA 5L9FA 1QFEA 3ANYA 4ZR8A 1UC4A 3CQJA 3WLLA 4X60A 1RH9A 1UHVA 4DWSC 5M5DA 2J9XA 2ZTKA 1WKEA 3N13A 1H7NA 1D8WA 3IGHX 6TIMA 3ID7A 2XIQA 2WAGA 1JDDA 1RUSA 1VGAA 4W86A 2VRKA 1DJQA 4WK9A 2OQHA 2A3AA 3MCMA 3CIXA 3T4CA 3SRFA 5M2FX 1VFUA 2YFOA 3C6CA 2WMIB 2TRSA 3B06A 4Z1AA 1NFBA 4H9ZA 4O18A 2QJJA 5I3FA 1A3HA 1CB2A 2HXUA 2YL5A 2ZUWA 3RCYA 3Q4DA 4OVXA 1WDDA 5AZ1A 3WLRA 1P0BA 5BWAA 1E0XA 1TR1A 1V0NA 1Q4NX 3TC3A 3TOYA 1GPWA 5HWJA 5H2ZA 1F4AA 4PMDA 1IR1A 4NJKA 3DC0A 4V15A 2G3FA 1CXEA 4QLLA 4FHAA 1O5KA 4GABA 2QEZA 2OB3A 1FWDC 4I9AA 3L4YA 1CWYA 1AG1O 3P2VA 3NL2A 1F3WA 1YW1A 4PUWA 5I24A 2GDUA 4B5UA 4E4UA 3H7UA 3RITA 3W2JA 3H2MA 4AVNA 3I7QA 1XIMA 3S6TA 2R1KA 3C2FA 2BOGX 3GTNA 3S1WA 4J3WA 4PBEA 1O5RA 3DHPA 4IQLA 4IL0A 5LA2A 1ZHAA 3NQVA 4B2DD 5K9XA 2D0FA 1S38A 4LBUA 1A5AA 2QCDA 3VKCA 2XIOA 2B7PA 3ZSSA 4AVFA 4JQ1A 2GVEA 3YPIA 2F2HA 4FNSA 3S4TA 1ITXA 2P50A 4RCXA 2Z1VA 4DZHA 5LXEA 1YQ2A 4ZQMA 3P14A 3MUY1 3KWXA 3R12A 1XC4A 4Z1DA 1NSJA 1GJPA 5KTLA 2Z1XA 1E70M 4D71A 3UPMA 2UV8G 5BRBA 2V30A 3LXAA 4QDPA 3DCPA 3MA8A 1O1ZA 3F4VA 1M04A 2Z24A 5A1AA 4IIHA 3GW0A 4GUIA 3W83A 1NF0A 4YYFA 1UG6A 1I1XA 3W1XA 3WX7A 3HM7A 1QMLA 1HTIA 1JDEA 1GKQA 1BF6A 4LT9A 3R13A 3LV6A 1XBXA 5EPDA 1E51A 4B5TA 4GQ0A 5CC6A 1MNZA 2GQAA 1U5JA 1CX9A 1E6PA 1EP1A 4IG2B 1G1YA 3FYOA 4LOCA 3W7JA 3E6EA 3H53A