3OBEA

Crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
286
Chain Sequence
IPATDAVSSATAGKKMGLQTYSLGQELLQDMPNGLNRLAKAGYTDLEIFGYREDTGKFGDYTTFIASKDYKKMVDDAGLRISSSHLTPSLREYTKENMPKFDEFWKKATDIHAELGVSCMVQPSLPRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKAGEKPEPKGTYIEELFLKNTDPDKVMFELDVYWAVMGQQDPVEWMENYPNRFKLLHIKDRWIIGDSGMMNFPNIFKKAYEIGILGYYVELEGDKKGRTQFEGVEKSAAYLQAAPFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
molecule keywords Sugar phosphate isomerase/epimerase
total genus 97
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3obeA00
3CQHA 1XISA 3DX5A 3P14A 3U3HA 3XINA 1QT1A 3JU2A 2I56A 3KBJA 3IUHA 1XLKA 1XIEA 2I57A 4YTUA 4QE1A 1XINA 2Q02A 3KWSA 4HNOA 1QTWA 5B80A 1OADA 1XIMA 3KBNA 5EMKA 5C9ZA 1MUWA 1XIIA 2QUNA 3N4AA 4LNCA 4ZB0A 3QYSA 5B7ZA 4A8RA 1D8WA 3CQKA 2GUBA 1GW9A 9XIMA 4J4KA 3KCOA 3L23A 4YTQA 4GJIA 3M0YA 4EAYA 4EACA 3CQJA 2HCVA 1CLKA 1I60A 3XISA 3ITVA 3ITYA 1XP3A 2J6VA 9XIAA 3IUIA 3IUDA 1XLGA 4HGXA 1XLMA 2QULA 4XKMA 4HHLA 1DIEA 3AYVA 4YTSA 4K3ZA 3M0HA 1XYLA 3KBSA 3UXIA 4XSMA 1K77A 3TC3A 2GLKA 2QUMA 3FVMA 2NQ9A 1XIJA 1XIBA 1QUMA 3UVAA 3C0QA 1XYAA 4QEHA 3AAMA 5XINA 5B7YA 6XIMA 4X63A 1DIDA 2ZVRA 5TNVA 5H1WA 3DBNA 1XLHA 4DVOA 4Q7IA 3VNIA 2GVEA 2ZDSA 3M0VA 1XYMA 1XIGA 4DUOA 3AALA 4A8LA 3LMZA 3KBMA 4E3VA 1A0CA 2XISA 3QC0A 5EMLA 2GYIA 1XLDA 4QE4A 1BXCA 3UU0A 2QW5A 5AVHA 4K1GA 1DE5A 2NQHA 3ITXA 4QDWA 4XIAA 3VNLA 1DXIA 1DE6A 1XIFA 3VNJA 2XINA 5XIMA 1S5NA 4W4QA 3CQIA 1XLAA 3AYTA 1BXBA 2X7VA 4HHMA 1XLJA 2HK1A 3VNMA 3C0SA 4GLEA 2G4JA 3CWHA 1XLCA 4YTTA 3BWWA 1I6NA 3ITOA 4GQBA 3KBVA 4PFHA 4ZBCA 1S5MA 1XLBA 2XIMA 3TVAA 4QEEA 1XLEA 3GNXA 3P6LA 4OVXA 3NGFA 3KCJA 5FA5A 1A0DA 4A8NA 2G0WA 3QXBA 1XLFA 1XLIA 3VNKA 3VYLA 3BZJA 1YX1A 2X7WA 4ZB2A 5AVNA 3M0MA 4A8IA 5EMMA 3BZGA 5H6HA 3BANA 4X60A 1O1HA 5XIAA 2HK0A 3OBEA 5EMJA 3M0XA 4KW2A 3C0LA 2OU4A 4XSLA 4QE5A 3ITTA 3ITLA 1XYCA 1A0EA 8XIMA 5I7GA 5J8LA 2NQJA 4X61A 6XIAA 1XIHA 1XYBA 3XIMA 3UA4A 1MNZA 3UA3A 3M0LA 3KCLA 4US6A 4G56A 3BDKA 4XISA 3U0HA 1XLLA 3CNYA 3QZAA 4QDPA 3WQOA 4ZB5A 4XIMA 4PGLA 3KTCA 7XIMA 1XICA 1XIDA 1TZ9A 4GJJA 4YTRA 8XIAA 3KBWA
chains in the Genus database with same CATH superfamily
4Q3MA 3TWBA 3ABSA 4C6DA 2D0HA 2GQ8A 4PTVA 1JYXA 3RO6A 1UMLA 3MMDA 1HKKA 1XIIA 3IACA 3BE7A 4PRWA 2X2YA 1SR0A 4J4KA 3TSMA 3LLDA 1FFQA 3CT7A 3W22A 4LBUA 5H8PA 4C7DA 2PU0A 1BWVA 3SCQA 1Q2SA 4E8DA 1HVQA 1E6ZA 1P0KA 2GGHA 3EX6A 5AHIA 3THDA 3R1ZA 3NG3A 1VPXA 3OVQA 3STPA 1QAPA 2XJ7A 2XH7A 3APYA 5A95A 2FH6A 5CPLA 4PCTA 1W1VA 4GGBA 5F4SA 2OEMA 1FP9A 4MIMA 2DVXA 4L80A 3I6RA 2Z25A 2V5KA 2WVTA 3DG7A 2NVDA 2DORA 2D3NA 1S2AA 2POTA 1V0NA 3GS6A 2YB4A 4L6OA 1JD9A 1PV8A 1SO4A 3VNDA 1EBGA 5T9BG 4CD7A 3G1FA 4ZBCA 1GG0A 1S5MA 1T8XA 5ENLA 2VGGA 3NGFA 3KCJA 3QMTA 2X41A 3K4WA 1IXQA 3PG9A 3M0XA 3TQPA 1UOKA 3F4CA 3ZLHA 3SCUA 3CB3A 4I9AA 4FXFA 5C70A 3GXPA 3M44A 5DCBA 2ZOXA 1WKYA 4MNKA 4MAVA 1I4NA 4YJ5A 3GX9A 1QFEA 4WDTA 2OGYA 1R3WA 5FESA 3ZJ6A 4G7FA 4AVFA 4M6PA 3VX0A 3W7OA 4M80A 3VINA 3GR7A 2HVNA 3PNZA 3W2MA 1A47A 4P2VA 1IT8A 1TPC1 5CCZA 3PBUA 4EACA 1WCGA 4B4HA 1M7PA 1RSCA 3WBEA 4FSAA 4RUBA 3H7VA 3SY8A 3UW6A 2NQ9A 5AC6A 3U2EA 4C60A 3GDBA 4AWSA 1TX2A 2J24A 2A0NA 3VNYA 1RAKA 1OY0A 1WQ5A 1E9ZB 5KZMA 3DHDA 5CJMA 2OSWA 1JPDX 1AZ2A 5FD0A 1JDFA 3HJZA 1M41A 1L2QA 4UMAA 3UZWA 1GZJA 2ISFA 3BW3A 1YYAA 4NY2A 3TYEA 3UERA 2DSWA 3O2LA 3GNXA 3TA9A 3H26A 2PP1A 4J2PA 2POZA 6CGTA 3I6TA 2J7GA 2KZHA 1O1HA 4Q8PA 1DIKA 3O6CA 3CHCA 4CCEA 1TA3A 1UASA 1A0EA 4NJHA 2FH8A 4MNLA 2QS8A 4NG3A 2VGFA 3TOPA 2DT1A 1Q7MA 3PN8A 3QZAA 3RU8X 5FL0A 3DFSA 2F6UA 3CLMA 5I3JA 3I4KA 3ARZA 4YIWA 2YCLA 2ZA1A 1TPDA 4PCPA 1I8JA 3GXMA 1IF2A 2OEJA 4Q8WA 2A1YA 4PTWA 2PB1A 2OXNA 3LI1A 1YDOA 2OZ8A 4RW3A 3L5MA 4JY9A 2OMAA 5FJUA 3GVGA 4AXKA 2QMJA 4QFUA 1K9FA 4WCJA 2EHHA 3C5QA 4AIOA 1OCJA 4YTSA 3UJRA 2O55A 5I3GA 1B3VA 4C6PA 1W54A 5ECUA 3O6YX 1JIBA 4F2BA 1TQXA 4PB3A 4LSBA 2XFYA 3FJ4A 1W17A 4JX5A 3W7CA 2C91A 1A3HA 4B3KA 2CLKA 4R33A 3SCRA 1FWHC 4NL1A 2QGYA 4LUJA 2NLIA 4BEUA 1HX0A 1SU5A 3WD4A 4GUJA 2UY5A 3VM5A 3TP4A 2QCGA 1XFCA 1PZ3A 3PR2A 5DEZA 4NYUA 2SFPA 2VEPA 3UWVA 4DM1A 2H8XA 2KX9A 4HMEA 2WWCA 1QW9A 1UWIA 3MYPA 3T40A 4O17A 4BCEA 4K38A 1I1XA 1Q45A 4O8RA 3TAOA 4YHEA 3VMOA 2BSLA 3HMJG 1QNOA 4UFMA 2ZCGA 2QF8A 3AS0A 2ADAA 4PBEA 1SO6A 4PSRA 3P0XA 1JDAA 4NF7A 4HNLA 3MBDA 3GC4A 3ENLA 1LLWA 1PYMA 4XZNX 3WF2A 4JR5A 3M0KA 4C1KA 5DCEA 3DFPA 3LHZA 2CBIA 5C5YA 2YDQA 3Q2DA 3HN3A 4I9MA 2CWNA 3VE7A 3WQVA 5AC5A 3UVAA 4FR1A 4OIFA 5CC3A 5XINA 2I14A 2F61A 1GOIA 2CZVA 3WF0A 3LQLA 3I7RA 3UP8A 3EAUA 4LVAA 2UWFA 3R10A 3TKFA 5AVHA 1HKMA 4E3TA 1HT6A 1NWTA 1XJBA 5SWUA 3ONBA 3V35A 1B3YA 1XLCA 1XRVA 3EXTA 2R8WA 3CV2A 4E4PA 4IPPA 2AAAA 3P5ZA 5IHSA 2VEGA 3E12A 3W2KA 1UR0A 4HK5A 2V63A 4H1ZA 3GZ3A 3Q4DA 1K8YA 4RNJA 4QRNA 3V0TA 3ZLFA 3C0LA 1KNWA 4AZCA 4EPEC 1OX5A 2PDXA 2VGBA 4ZB5A 4S3JA 1G1YA 3GTFA 3LGGA 5FI8A 4A2RA 1REQB 2YDSA 4DXXA 2P53A 5BXTA 1UYQA 2XH2A 1NQ6A 1GKQA 3WDJA 4GMEA 1PZ0A 2NV1A 3EMQA 1VHCA 4Z1YA 1QW7A 3AHZA 3V0UA 2VO5A 3AUJA 3JS3A 3W7NA 1H7OA 2IKIA 4NT0A 3P7YA 5K4ZA 2BB0A 1OWQA 3IV3A 2VRQA 4N7QA 3GNRA 4O1EA 5HNTA 1F3WA 2WKGA 4G8TA 1GTEA 2XH4A 3B4UA 4HPNA 2VCCA 2HQAA 3VFLA 2QXWA 4ZXLA 3T0BA 4H8HA 2QAPA 3TONA 1EF3A 4DJDC 4D6DA 4GY7A 3C8FA 1E0VA 1F2JA 5I3KA 4EAMA 1IXPA 1G01A 4JFSA 3QR0A 1J01A 2PLMA 3KE0A 3H7RA 1JGIA 3ES7A 3VOCA 7TIMA 5DLCA 5AECA 3MJMA 2Z4GA 3ICJA 4EXBA 3DFQA 3UGVA 4ONVA 3CIXA 2NWSA 2VEMA 4IMAA 3FAXA 3OODA 3MO4A 3ALGA 4ZQNA 4MF4A 5AVNA 2OX1A 4LANA 4PMZA 3CAWA 2O9OA 2PD5A 3CUFA 3PBMA 1PAMA 2JBMA 3PBWA 2D2JA 1O68A 2ZXDA 1L9WA 2Z1KA 3AJ7A 2WLYA 3GC2A 4QROA 1MNZA 4JL2A 3BAIA 2NX3A 1QO5A 3VMPA 4LYQA 4RX0A 3PZUA 4QLJA 3WELA 4JTKA 2Y5SA 4QGCA 4J27A 3BAXA 2FVMA 3A4WA 2PWVA 4KQNA 4GYPA 5C8BB 5J5DA 3VGFA 1YBQA 1W5PA 2PDGA 3KVKA 1KKOA 5C7VA 2QUVA 2ZKMX 2B7QA 1R6WA 3ATYA 4BI5A 2FZNA 3KM8A 3VDBA 1QXLA 3OTRA 1OIFA 3QGKC 3UYCA 3SIMA 1GVSA 3VNIA 1GEQA 3GFZA 2BXYA 3MI6A 4PUMA 3LMZA 4ZR8A 2J6XA 4IXHA 5BMWA 3UNDA 1KM0A 5G5IA 4G7EB 5D32A 1LG1A 3DFYA 4H9TA 4PA8A 3LTPA 4U10A 3WBWA 2G97A 4KBXA 4HZMA 3VK5A 2CLHA 4HA4A 4OBRA 3RCMA 4F0SA 4QEEA 4IJBA 4HNTA 4OECA 3GE7A 3NSNA 3W2LA 1H0GA 1XH0A 3R11A 2BY1A 2FDMA 4GNVA 4N9BA 4Y8FA 2JF7A 2AAMA 2CZFA 4M29A 1TTJA 3ANUA 3KVJA 4J5NA 3O1NA 4RPQA 4OWGA 3T7VA 5AZ1A 3QRHA 1WZKA 1E0WA 1MVYA 1TQJA 1BFNA 4HIBA 1XGZA 4QE1A 3VOFA 5B80A 3AO0A 4Q4MA 3WQ8A 4GCAA 1LT8A 2QUTA 1W1ZA 3TW6A 4NJKA 3QHOA 5EMYA 4EANA 3NZRA 3M5ZA 4TVDA 2UY4A 4Z2IA 5CPQA 3FY1A 4HGXA 4S3CA 4JL1A 5FEWA 1UIPA 2PDKA 1H61A 2BGSA 4HA3A 1BGAA 1RY0A 4LS2A 1BVWA 2F2KA 2V9DA 4CNTA 3EXRA 3EYPA 2WZHA 2KAUC 3DFOA 4HPGA 4AW7A 3W1NA 2ZTKA 2BHZA 2YCLB 2R1MA 1DQXA 4A8LA 3NQCA 3W24A 3SN4A 5CG0A 1FHVA 4NI8A 3WSUA 3C56A 1OB0A 5I77A 1ECEA 3HF3A 7CGTA 2AKMA 2XDFA 1V7AA 3W2NA 1HGWA 1L6WA 3QKZA 5G1TA 1ITXA 3M7WA 3T09A 1LL7A 1E6XM 1WDDA 5A8PA 1KRAC 3W1LA 1T40A 1OQFA 1R86A 4GIAA 5TBOA 1LRQA 2G3FA 3W53A 1GYNA 1GOKA 3N2XA 4JTIA 3AZTA 1UPMB 3BAWA 2YXOA 2X2GA 1JZ3A 5DCDA 2OKTA 1X39A 3LCWA 1Z3NA 3GNOA 1ZP3A 3OZPA 2D69A 1N8IA 3GO2A 3QV9A 4YTRA 3ABOA 3IVSA 4H7VA 3C4UA 3OGVA 1UR8A 3MKKA 3MSDA 2FB2A 1W3NA 2PRMA 2WSKA 1U1HA 4PMDA 3U6WA 3G1RA 2DP3A 3T8QA 1JZ7A 4ZOCA 2EBNA 3VXGA 2Z0IA 4IP4A 4Z1CA 1XIJA 1GW1A 1LWIA 4V2XA 1V4YA 4FF7A 5T8GA 3SEPA 5JBFA 1QJWA 1XYMA 1W9XA 1XC6A 1QASA 4CEXC 4ZGYA 4GZEA 4AMCA 1UC5A 4XG1A 2ZXAA 3MANA 3BH4A 5D2TA 3VNLA 2WHLA 1QWGA 1UR9A 4W86A 4H41A 4DM2A 2OYMA 1B3OA 1Q6FA 1X1ZA 1OVDA 2OEKA 2NSOA 2INFA 3F2BA 1G7VA 2E6FA 1ISXA 2RHGA 1IR1A 2G37A 4JQAA 5LXEA 4UQAA 7A3HA 2BWGA 3G6MA 1DWIM 3E0VA 1LT7A 2RJHA 1JAEA 2Y8VA 5FKYA 3LB0A 1QNSA 3ID7A 3R4IA 4ZO9A 4QJ5B 5KITA 3BVJA 4PMOA 1MDLA 5LA1A 1M53A 1TO3A 5GJNA 4CNPA 1TJ0A 3TEVA 2E40A 1TWWA 3PFRA 4JN7A 5IDIA 3NL2A 4JIIX 1JR1A 4BJHA 5DQPA 2E6DA 3M0IA 1TJPA 3T44A 1XSIA 4LAMA 2BBFA 2J6VA 1UZ1A 5GNXA 4XTIA 1VEMA 2PLJA 1VFSA 2HTMA 2DW6A 5I07A 3UG3A 4L4LA 2DJLA 5CSYA 4GUHA 3LEPA 1HJSA 4DJED 2UV8G 4ZVJA 5JMUA 3U2CA 4E3VA 3MA8A 4C6IA 2NV2A 1P0EA 2O7QA 3UWWA 3WBXA 2EXOA 5CXPA 5LHFA 3ORWA 1HFBA 3CZKA 1EX1A 2I9EA 4MWAB 1EQPA 1UD4A 3TZFA 3EB2A 1QHZA 1LQAA 2VC9A 1VBGA 1UJQA 3ABRA 4Z1DA 1ELSA 1VLWA 4MKVA 1GNXA 4KESA 3STEA 1EZ2A 4JQ4A 5J5RA 4HZ8A 1KBBA 3O06A 3B97A 3WNMA 4XBJA 2WO5A 3AQUA 1V3HA 1PWLA 1OK6A 3K2GA 2WWDA 1XISA 3DG3A 4FZIA 4JIPA 3R8HA 3LD5A 5KETA 1J0IA 1KFKA 1R87A 4UUIA 2YYTA 5HK4A 4GA8A 4L65A 4GNJA 2FMNA 4NJGA 1V02E 2FPVA 1V03A 1H1YA 1YE6A 3AS1A 3N2MA 3CO4A 4N42A 1G9HA 3EB3A 3TMQA 2JKEA 1W1TA 4KFPA 5KINA 1VRXA 1W9UA 1R3SA 3GG8A 3M0JA 5CJ5A 2PF8A 3ARRA 2FLIA 1TYGA 3MHGA 4QAWA 4ACZA 1TCMA 3I3EA 4W7VA 4M81A 5F2MA 4XKYB 4QP0A 3DZ1A 3EPOA 2L5HA 2PDYA 3IARA 1A5SA 2J62A 4KETA 5D33A 2PDQA 4YHGA 4XV0A 4AYSA 1FX6A 2VM8A 2GVYA 2NUWA 2ISSA 3T2OA 5FA5A 1D3GA 1XF0A 1ITQA 4JTJA 3M5XA 1J0KA 1W56A 4DF0A 3UCCA 1VGAA 2OVLA 4J40A 3QN3A 3WJSA 3K4DA 3AXIA 4MADA 1GJPA 3AIQA 4ADUA 6REQA 2CHRA 1PTAA 3R2GA 1VF8A 1MZRA 2F9RA 3TSBA 4R7JA 5AZ0A 3UA4A 3G1DA 3ZZ1A 4G7EA 3AWNA 5BRBA 3BXWA 3LZ3A 3OBAA 1ISYA 3NA8A 3P14A 2IKJA 3PAJA 2QKFA 1W8GA 1ZBVA 3CH9A 2Q8LA 4NAFB 4IMCA 2GUBA 4TUFA 2WANA 1DJNA 2OQLA 3H2OA 2DH3A 5DT5A 1TMHA 3VO0A 3W26A 1Q13A 3GB6A 1REQA 3LA4A 2E4TA 2GUYA 2WZTA 4PTXA 2WPBA 2F6KA 3QEZA 3HZ3A 4L7ZA 3CEPA 3NQDA 1CEOA 1LL6A 2G95A 1GCYA 2V8ZA 1LOQA 1MEWA 1EWDA 4MZ1A 3S8HA 1V3IA 4WOQA 3VU2A 1E72M 4G1KA 4DJDA 4AFYA 3OZOA 2DQXA 4IPIA 1V77A 3CL8A 3W1RA 3ZLGA 4AVNA 3VNMA 4ZODA 3C0SA 4HJWA 1U2YA 4V1XA 1TPUA 1XRSA 3UPBA 3OU8A 1VB9A 5AN7A 5BOFA 3AMGA 4MYAA 3FOKA 4XZHA 1YHTA 1EB3A 1OG0A 3FCPA 3GW3A 3SFWA 3QGAC 2ZWYA 5FJIA 1TG7A 1O5RA 1W1IE 3IIXA 3FS2A 1S5WA 4M7TA 2GJPA 4O19A 3CO8A 4H8UA 1B5TA 4UFLA 2OB3A 4QIUA 4A22A 1ESWA 5I09A 1PWMA 5JUVA 3WQFA 1TCDA 4BR1A 1NAL1 3FK4A 3LBMA 3PUDA 2PTDA 2VZUA 3SRHA 3UT0A 3CAQA 1PUDA 3QHNA 4W88A 3BMVA 1G4SA 1F6YA 3PNUA 3BLFA 1OFQA 3FA3A 3I3BA 5FJJA 1YXCA 4PUEA 3C2EA 4WJ8A 1Q6GA 3AIRA 3N17A 1PJ9A 1V3JA 3ZT7A 2PDFA 3VIIA 1AZ1A 1DQWA 4LYKA 4CN4A 5TQLA 1E3ZA 1VP5A 3IRSA 2OO6A 1V8EA 2PF0A 1FRBA 2BY2A 3KLKA 1QOPA 1JDCA 3C3UA 3OA5A 1UWAA 5CPOA 3L2IA 2EAWA 3BLDA 1Y65A 3O7UA 4HOZA 2MANA 4IWWA 4B9ZA 2QZRA 1BXBA 1M1BA 3HGJA 4GH3A 4BQ4A 2VX6A 2I17A 3H21A 2GVGA 4JIRA 1XLEA 5M1TA 3QM3A 2B81A 3N19B 2NV9A 1FWJC 4C5ZA 5HMDA 3OLIA 2GVJA 1NF7A 3GZAA 3U2OA 1KM4A 3II1A 3N1AA 1Q4WA 3QV6A 1IIHA 3BICA 2AL2B 1HUVA 3KRZA 2WHKA 1GGOA 3LM7A 1V6WA 5HINA 2X30A 2INEA 2RH9A 1BYDA 4MMWA 1KLZA 1FWTA 4E2BA 4DJFD 2XVPA 2CWXA 1OG6A 3LG3A 4UTIA 1ZJHA 4O10A 1OM0A 3W7DA 4M3PA 4HTBA 3GDRA 2W63A 1KWKA 5IFPA 2P1FA 1HJQA 5D38A 4LCSA 4UBPC 2VX7A 1UWQA 1GWJA 2R14A 1B9BA 1OSEA 1L0PA 1J4EA 1SVDA 2VTFA 3T1GA 3ZO9A 3LDVA 4F9JA 1E6PA 3LOTA 1KXVA 5D4YA 2JQXA 4W7UA 1JYWA 3NIYA 2GVEA 5I24A 3HPAA 4ML4A 2YL5A 3UPMA 1E0TA 3WX7A 4LALA 1OGBA 4GFIA 5CPSA 1S2CA 1BXCA 1E73M 4LVBA 1DXFA 4WKFA 4GVFA 2YBVA 3KEHA 4Z2JA 3VAVA 2W61A 1CCWB 3CQIA 1ADSA 3M07A 4P8WA 1S1RA 3NQMA 2YL8A 2DPEA 1JCNA 3BLIA 2FVLA 4JTEA 4QSHA 2RUSA 4AUBA 3TUUA 4JKLA 1KV8A 3M0MA 3N9RA 4FHAA 4Z0SA 1R7AA 1IEVA 4L1WA 4RK8A 3WQEA 4XSLA 4UR9A 5E6YA 5A8NA 1PVNA 1R2TA 1OF8A 2PDCA 3UEQA 2J78A 3DUGA 3WDQA 1XLLA 4LV4A 2WOQA 1K4HA 3F5LA 3G22A 3KRUA 3KFTA 3W86A 4ZL1A 3WCZA 3U4FA 3DCPA 2WM1A 3PVFA 3QYSA 4QNEA 4B5SA 3E6EA 1IWPA 5C54A 1PL9A 4W8LA 4IP5A 5H8MA 1EHNA 3MQTA 5DRIA 1JNDA 5BNKA 3IWPA 3DESA 4CU6A 2ZRWA 1KM1A 3BMWA 4F3HA 1ZSXA 3G0XA 2E8YA 3VE9A 4GXMA 4JFVA 3DGBA 1V3LA 5F1UA 4JIQA 2J9ZA 3T08A 1I0BA 1BTCA 3DAQA 3QFWA 1VR6A 4QG6A 3ERPA 2VVNA 1F3TA 3ZS4A 4PRRA 3N14A 4O50A 2ZRYA 2XSAA 1HG3A 3A12A 1EJWC 3SM0A 2UY3A 2WB5A 1HNYA 3QR3A 2C0HA 1JZ5A 4WHBA 1NWSA 4AMAA 3G1YA 1UKSA 3NQ8A 4NILA 4IMGA 1ZENA 1OYBA 2A4AA 3EBVA 1AODA 1ZJBA 3H6OA 3VMNA 3MJYA 3GU1A 4E0CA 5A6SA 4NSBA 1JNEA 2GWNA 4QCEA 3N3TA 3NM1A 4IG2A 2Q01A 3PBVA 3H2EA 3V5OA 4Q8QA 4AC7C 1KTNA 3NSMA 2ZE3A 4GO9A 2R94A 4NI3A 2CLFA 5L6UA 1AVAA 3V16A 4GQGA 1QNQA 4AF0A 3EWXA 2X1UA 3PF3A 3LCHA 1E40A 3WF3A 1G7UA 4AZ6A 2OTDA 1UWSA 3QSTA 3RHGA 5HNRA 3PZGA 2XSBA 5HJYA 2Q6ZA 1OFBA 3IGUA 4NZ5A 2YB1A 3NSXA 1F73A 1Z48A 3VIHA 1VCGA 4U3CA 3T0TA 2BTMA 2NWRA 4EWJA 4H9UA 4XAGA 3F2DA 1PXGA 2NX9A 4Y9OA 3K8LA 3STCA 1GYLA 3OVGA 4MKNA 3M5YA 4P7OA 3LHVA 1O66A 1TKKA 5HMSA 4L4OA 5H2ZA 1AK5A 3PTQA 1TPEA 2PEVA 3GU2A 3AUOA 1YIXA 3FEMA 2HE8A 3TR2A 4IUOA 3GAKA 4DJEC 1Q65A 4V28A 1TR9A 3VZYA 4Q8MA 1M65A 4GXWA 3KOYA 3U4AA 5FJRA 3NAVA 1QDSA 3OEXA 4MWAA 1AL7A 3P8JA 3HTWA 2V69A 2OU4A 2Z1SA 3PTKA 1F8MA 3QVQA 3WNPA 1A5OC 1IXOA 3ARPA 4B5NA 4DPPA 4TX8A 2OZ0A 3SGZA 5HQMA 3T42A 2PRLA 4QG8A 4ZFCA 5D2YA 1G4PA 3W83A 4WGXA 1LYXA 4RR4A 2OPJA 3GNDA 3RR1A 4MJMA 1MQQA 2Q02A 1T6MA 5D2VA 3QY8A 1HL8A 3TYCA 2ZWZA 2WHJA 4M6QA 4TMBA 3RPTA 3APGA 5HR7A 3IS4A 3MZ2A 2VDHA 9CGTA 2XIIA 1VFOA 3G1HA 4JEJA 1I2RA 1H7XA 1US3A 1F7BA 3WDIA 1UROA 1NJJA 4ZOBA 4HU8A 4IQLA 1GORA 4RCXA 2CLMA 3C0QA 4PMVA 4RZ6A 4YYFA 1M01A 2PDIA 2V2CA 4RE3A 4IFOA 4B2DA 1MW1A 5IFTA 3IIOA 3IIVA 4XZBA 1WOAA 1XH1A 2BVYA 3SCTA 1JCXA 3GQYA 4TIMA 3B4YA 4IMFA 4Z2KA 3SUTA 1XIFA 4LEFA 2J27A 1RA0A 3IGHX 4JAWA 1K1DA 1ME7A 4UR7A 6A3HA 3GDTA 2WK2A 2WMJA 2A3LA 2G0WA 3GNPA 3WJZA 1PEZA 4RXGA 3DERA 2Z1BA 1O5QA 4KW2A 3V5FA 1ICPA 4DRSA 2GOUA 2GQ9A 2A85A 3EOUA 4IOTA 4CLMA 5I5RA 1IEWA 4BQ5A 4M56A 3QBUA 4PGLA 4GJJA 2O9PA 4GKTA 6REQB 3L68A 1ECQA 4QLLA 4NVTA 3WLLA 1TX0A 1SO5A 3PJWA 4O4VA 3PB2A 3A21A 3B3DA 2J79A 1XGDA 3RPDA 3BARA 2V3DA 2QVNA 1E6SM 2Y0FA 3BCDA 3RU6A 2WNQA 2AL2A 5A6TC 1UA7A 1GVQA 3RCNA 3M0HA 4YU1A 2YBUA 2X09A 5J04A 1HIZA 3O0FA 3N2BA 2ZVRA 1J0JA 4I5XA 3GAYA 1QU4A 1XG4A 3PBGA 2ACQA 2FZDA 1QOQA 3SSZA 4ENLA 4NZ3A 1FH7A 4U33A 4JTUA 2ZA2A 1ZP4A 4XX6A 2R91A 1QO2A 2FTWA 4AZGA 4GUIA 1UH4A 4HMNA 3P6LA 1RJPA 2E5DA 1YTEA 4J3ZA 2WHMA 3E0FA 3K5XA 3WNNA 2HVOA 5FF7A 4UIOA 4DJDD 4DO4A 1B1YA 3S5ZA 2W27A 7ENLA 4DO7A 1EXPA 4OBTA 2RDXA 3W81A 4IX0A 3UXAA 2ZA3A 1TUXA 3H53A 1BG9A 2H6RA 3QTGA 1TPVA 2QDDA 4AZHA 2PPGA 3B40A 3WEMA 1QPRA 2GFTA 3AHTA 2YCKX 1LJYA 4P8VA 3H54A 1NQKA 1EOMA 2Z7KA 3N34A 2FGZA 1W37A 1DEDA 4KT2A 4K39A 3S1XA 1WX0A 5AC4A 2VRJA 4F8XA 3BSHA 3W3OA 1CPUA 1QBBA 2D3LA 1M68A 3WD1A 2VZOA 3NL3A 3PTDA 1BSIA 2E6AA 3G5EA 4HU0A 2HPIA 3EDKA 1S3HA 3TXZA 3BL3A 4J1OA 5I3DA 3HGRA 3IJ8A 1MWOA 1WV2A 3O05A 2YZRA 2A21A 2J7HA 4PUDA 3MPGA 2IQ0A 4B4FA 3ES8A 3HGSA 3CBWA 2ACRA 3GNNA 2MNRA 4REQA 3CH0A 2YFOA 1D8CA 3EOLA 3TVAA 1C8QA 2XIMA 1KO0A 3F4VA 2J8FA 2AL1A 2Q3RA 4JX6A 1E1FA 4D6CA 1WXZA 2CLLA 4HCHA 3VUPA 2D24A 1ISZA 2BGQA 1W91A 4REQB 1VQTA 4BFAA 1S39A 3JRKA 2NQJA 2ZX6A 4UTUA 3NEVA 1EYEA 3EGJA 4HYVA 4GVIA 5M2FX 5AFDA 4ZE4A 3UF9A 5AC7A 1SM9A 2Y89A 2YFNA 2GZXA 4Q4PA 3G2GA 2NUYA 4DWSC 5C9RA 4YTUA 1J6PA 2Y1HA 3GDLA 5D09A 2PDHA 3RGTA 2J7CA 3C2YA 1YW1A 1PCKA 4JTCA 4IIGA 2HXTA 2EQDA 3LM3A 3VI2A 1X96A 4KF1A 5FF3A 3MKCA 3P2VA 3E96A 3TC6A 1K6AA 2HEJA 4ZO7A 4ATWA 3F2CA 1W5QA 3RX3A 2R1PA 3FFSA 2PWFA 1T8QA 3LK6A 3IGXA 4O1CA 4RLIA 3QY6A 4XD5A 3WLIA 1JL8A 5IBXC 1AQFA 2EPOA 4CU8A 3IK2A 1GONA 4AY8A 1RJRA 1HKWA 3CU2A 1J2BA 2Y85A 4DZAA 4FNUA 3RCYA 1TWZA 1W32A 4BQ2A 1W6TA 1OHLA 2A3CA 1WUEA 4MJ2A 4UTMA 3HOJA 1WO2A 5LGZA 3CYVA 3FIGA 1MYRA 4NRRA 3BCFA 1D3HA 4CN1A 4EXAA 4E6MA 4OUIA 5EMJA 3CV7A 3RR4A 5A6MA 4Y9AA 5G2WA 3JVAA 3LS9A 4AF0B 3ITLA 3G18A 5DBTA 2DZPA 2PP3A 5GQBA 2FFIA 3S5NA 3BC9A 4XBSA 2IPGA 4H2CA 2W4XA 2YDAA 3MSYA 3GXIA 2FQIA 4S38A 4IFKB 2CLOA 1XW8A 4UFHA 4RDVA 3CZJA 4ROPA 4BWLA 3OQ8A 2JEQA 5PTDA 3JU2A 2ZIDA 5CPTA 1JYVA 1HO4A 2X0SA 3WH6A 1EP3A 1K6WA 5BU9A 1VIWA 3WLNA 3LBOA 4H9YA 3ARWA 1ZB5A 3L23A 3SY5A 4EPBC 5AY7A 3DN5A 2PZ0A 4FAMA 4S2BA 5HR6A 2BY0A 3N04A 1E71M 4P7QA 3UGRA 2YOCA 2FHFA 3UZXA 1TELA 4CQDA 4POCA 2ONEA 4AEEA 4IPNB 3UWZA 3A64A 3WN6A 1LOLA 3N18A 2WCAA 3T8LA 5ABTA 3AIUA 3VIGA 4K1GA 2Y61A 3TYBA 2C6QA 2PE4A 4WQ6A 1ZTVA 5BXSA 3F4DA 4RZ5A 1WKDA 4F0KA 4K37A 3S2CA 3WLKX 1ADOA 3MP5A 3MUY1 1VBHA 4O15A 4LXFA 4IISA 3VKBA 3U8GA 1JQVA 3OGRA 2Z27A 3RFAA 2QJNA 5C9XA 4GBDA 4A29A 1NFPA 3A5VA 4JGDA 3GC5A 1FWDC 1VYPX 3BGAA 5K4XA 5K7JA 3DYMA 2XPKA 4GO8A 1QR7A 4D6HA 3GKFA 2PP0A 2ZRVA 3M0LA 1TV3A 4RE0A 2PDWA 1C7TA 3E38A 1H41A 3HQPA 1DJXA 3VIKA 3RLUA 3EX2A 3TW9A 2YSWA 2FZ9A 4UZUA 2I56A 1ONXA 2OGJA 3PSWA 3WIJA 5DN1A 2FPYA 3UBPC 3W85A 1VBRA 1B90A 2EO7A 4IX2A 4LVGA 4HYRA 1ZLPA 1EPXA 3RLHA 4GOAA 4EOUA 4M82A 5GNYA 2XSXA 2CLPA 3WJXA 4Q6XA 5BROA 3HG3A 5FIPA 4J3SA 2NQLA 3L4YA 4D72A 1FWWA 3VC6A 1R9XA 2ESCA 5LNRA 4V33A 4B5TA 3NDZA 3G3MA 3NYDA 5AB3A 1UD2A 1VCFA 4KH2A 1QI3A 1NARA 3FJNA 1XYZA 4I8YA 2YA2A 4C1NB 2IQTA 3IJIA 2X1IA 4JNYA 3F4WA 1E56A 1RVGA 4MOZA 4KFOA 1V6TA 3LPPA 4AYGA 5EFDA 4OGZA 5CSSA 1CLVA 4H6QA 3VKKA 3PANA 3FGCB 3GHSA 5JIWA 1LTDA 1QI5A 2BGNE 4IQEA 3TX9A 4A4AA 2RDUA 1YX1A 3L0GA 3OYZA 4WF7A 4JNMA 2FGBA 3H70A 4MDPA 3PZIA 1DBTA 2GSEA 5M5DA 1QNPA 2ACSA 3V18A 1Q6CA 2DU2A 3MDWA 3EWWA 1U5HA 3KCLA 5EY5A 3TN4A 3P80A 4QX4A 7XIMA 3UZJA 2QCEA 1TZ9A 3P81A 3BK0A 5ABFA 5M03A 2QF7A 4NRSA 3DBPA 2C15A 5CSRA 2WJEA 3S1WA 4JZ5A 3SUUA 2EF9A 2WSYA 4DWSD 4L56A 5HWMA 3EDDA 2WQPA 4U5IA 4JN6A 4C6BA 3WBYA 4KEUA 4LB3A 1X98A 2W66A 4JBRA 4JTSA 5CZKA 3LLFA 1WXJA 2VZVA 1DIDA 3DBNA 2FHBA 3W25A 3EX3A 2YDRA 3KBMA 4MGGA 3S0CA 3WMCA 1TFVA 3NGJA 2OO0A 5DMYA 4FA3A 5HWNA 1U5JA 3VFCA 2IPJA 4XIAA 4LX4A 2ACUA 2F84A 1XG3A 4NU7A 3G1AA 3WYZA 1BAGA 2WMIA 3S5SA 4QJ4B 5KEZA 3R13A 3U5YA 5A1AA 1IZJA 1I75A 4J3VA 1X6NA 3PUOA 2QPSA 3CS2A 3WD3A 4JNZA 1FKWA 2WMGA 1JDEA 1RA5A 4LF1A 3LXCA 4HN4A 4KWSA 3FV9A 1UWUA 4AZ5A 1YRRA 3H2MA 1TZZA 3NUKA 4PCNA 5CEWA 1JXKA 1OJXA 4S3GA 3SB0A 3SW6A 4FF5A 3U2ZA 2VZTA 4C6JA 1P1MA 1QWKA 1UR2A 5AYZA 1Q6LA 1W2VA 3B0VC 3AXKA 1DJGA 5U4NA 3G77A 2NXGA 1MW3A 4RDZA 3MI2A 2EEXA 4TMCA 4XAPA 1W9BM 1M3UA 2CESA 2QPXA 1JGMA 1NH6A 2PD9A 1AG1O 3U57A 3NXFA 1GKRA 4AG0A 4AEFA 2MUCA 4HU3A 4DUOA 4PBFA 2P3EA 4Q8NA 1KFJA 4UXDA 3IJ7A 1WBJA 4ICMA 3N2CA 1HL2A 4X3ZA 4M1RA 1L8PA 4DWSA 2W9MA 2E25A 1A4LA 1THFD 2XU2A 2E8ZA 4RJEA 3VDAA 1XM3A 5DELA 4B15A 2QV5A 3FDGA 3B0YA 3NQGA 2YR1A 2QNEA 3HV8A 1UBSA 1OGGA 4S23A 4IL0A 4E4UA 3UG5A 1BYCA 5HMEA 2NXIA 4CN6A 2O92A 3EPNA 4L4MA 5CPNA 3V36A 4DBUA 1V02A 2BXZA 2V2HA 4TX6A 4H9MA 1JZ4A 3LV6A 1FWBC 2OYKA 4O28A 2PBGA 4OQVA 1V6YA 4J9JA 4LVFA 1JFHA 4IMDA 3WENA 4X9YA 2PDMA 4S3FA 1UZDA 2F38A 1KM6A 3CL7A 4N2YA 1H50A 3ALFA 3PTMA 4Z42C 1A80A 1TVNA 3P5YA 1OYCA 4PB4A 3GXFA 4L6DA 3RMJA 3LQGA 3M47A 3LRLA 4K3ZA 3EDFA 2DZXA 3ZSSA 1XD1A 5LNVA 3BG9A 3CHFA 1EZWA 2X16A 5GNZA 4ZQPA 3TCSA 1XYAA 2E3ZA 1J5SA 3UR7A 2WXDM 3W71A 5L9FA 3VKJA 1OZQA 3A22A 3TAKA 2BXVA 3GH7A 1FWGC 2NSXA 1UQYA 4WUIA 1J10A 3CZEA 4EX4A 1DQUA 2Z1XA 4DPQA 2EPMX 4UQ9A 3LU2A 3TFXA 4DO6A 2ZZ6A 3IVTA 3BCJA 3NCOA 3I10A 2J8TA 4XO6A 1AW2A 3ZQ9A 1QOXA 2Y6ZA 4GLEA 2FGLA 7PTDA 4XZWA 4MWAE 4IHCA 4PTDA 1W1YA 4HP5A 3LV5A 1ALDA 3NPVA 2VMFA 2TYSA 2Q09A 3LGDA 1CXFA 3HBLA 3EWZA 4FOUA 4IZGA 3SY1A 3TC7A 5DFAA 4WJXA 4H00A 1IIGA 1Y5WA 4WY0B 4YNGA 1H7PA 4FNSA 1B3WA 1A53A 3WFZA 4J3XA 4XVEA 8TIMA 3M43A 3LZ5A 1EX5A 5I0DA 1XINA 1XIMA 3HG2A 4CVUA 3QQ0A 1XRTA 4ALDA 4GI6A 1J11A 1CZ1A 1KR0A 3GVVA 4FEZA 4DB7A 3MW7A 1WAUA 2QULA 1DJWA 1BXNA 3M0ZA 3TIMA 1R46A 2UY2A 4Q7BA 4CNUA 4UTWC 2GDQA 2JF6A 4JQ3A 4A35A 2ZXBA 4I7VA 4FI4A 1EEPA 1ZAHA 1TWDA 1ME9A 2GJXA 3EOOA 4NZ1A 1TRDA 4OZOA 1ZALA 3D46A 4IL2A 3FYYA 2QLYA 4R9OA 4UQEA 2WZIA 2NQHA 4GRSA 4HB7A 1QI0A 2JK2A 3BQ6A 4CQ8A 3W88A 1A5UA 4CD8A 3N9SA 2VDIA 3TQ0A 2Y70A 1T0OA 1AMKA 2PWUA 2W5FA 3N3MA 1FHLA 1EP1A 1GZ1A 1EJRC 4KGLA 2OSXA 1OT1A 2WBKA 5LA2A 2A7PA 1H4PA 4E2DA 1F4AA 1Q3NA 1D7KA 1A50A 1RP8A 1E4NA 2YA1A 3GBEA 4IH3A 4CQAA 1EGZA 1W9VA 3UR2A 2D23A 3T4WA 3L4TA 4NIRA 3WLQA 1C93A 3ARUA 2AMXA 1ZNNA 3N73A 4NNBA 4I6KA 3AJXA 1AD1A 3TW7A 4GINA 4MY9A 3VGHA 4H01A 4M7SA 5G1YA 2ZADA 3WF1A 1OX4B 3THUA 7REQB 3IUIA 1VFLA 1R3TA 2BHYA 1PB0A 1VPYA 3M9YA 4X22A 2OJPA 4PB5A 1QRQA 3SCOA 4EF8A 1PDZA 3BPWA 1UKQA 1AH3A 2VL4A 1KW1A 2VCAA 3PPGA 3SRKA 1QI4A 3SJ3A 3VD4A 3W1TA 3TJXA 2C0AA 1TE6A 1V51A 1YTKA 1E0UA 3MV01 4C1LA 2G8ZA 4ERGA 3CMGA 3H7UA 4H9XA 3WY1A 3M4HA 5DY2A 3BG5A 2W67A 1X1NA 3K4AA 3H2FA 4L9ZA 4UMCA 3EDJA 4KCWA 1QW8A 5CAHA 6XIAA 1CIUA 1DWGM 2IMRA 3R58A 5G2IA 4AIUA 1E4LA 2O56A 3TQVA 3R8RA 5K9CA 3N15A 1EIBA 3W1XA 2QCMA 3A4JA 4HSOA 1XGEA 3B05A 3BV7A 5BU6A 2ZRZA 2PCEA 3QHMA 1J9YA 4EIVA 4LNYA 2A7NA 3S5YA 3AWOA 4KGJA 2VEFA 5FJPA 5ABGA 1BHGA 4Y96A 4GUGA 4Q4QA 1V3MA 4K7VA 1FWSA 3DIPA 4MB5A 3TLLA 4EWND 1XYLA 1J93A 3LN3A 1N8FA 1GZGA 4JIHA 1OCQA 2OSYA 4KCUA 3VDGA 1A5AA 3SCSA 3GHTA 1RD5A 3DHFA 1WBHA 5F2GA 1B4KA 1Y7VA 3CV6A 4AIBA 2X42A 4O12A 1Q2RA 4YCPA 1IGSA 4QDWA 3N6HA 2H9AA 2ZUTA 4WJEA 3DYPA 1SSGA 4KIEA 3WUFA 2TRSA 4M24A 4HYWA 3VUSA 1X6UA 1SFJA 1SW3A 3B0XA 4RPPA 4D8LA 4O18A 1T96A 3WJYA 1S2WA 1BVZA 1E0XA 2HWGA 4XAFA 1X8FA 5K9DA 3EEGA 1F3XA 3BANA 4RL3A 2XVKA 3NEHA 1OC5A 3PM6A 5HA7A 2HRWA 4ROQA 3ECQA 2XIQA 4NHVA 2ZZ1A 1CGWA 1MUMA 2QDGA 8XIAA 4MWAD 1K9DA 3LXAA 3HPFA 5FL1A 5LA0A 1AUSL 4DBDA 3EZ4A 4PYSA 2J88A 2QUUA 4AZ7A 2J7EA 3EX4A 3ARTA 2OT0A 2JEPA 1P7TB 4AEOA 4MKSA 1SMAA 1LL4A 1UWRA 3SN0A 3VOHA 4JXCA 1VKFA 4GWEA 3CZGA 1UH3A 3EKLA 5HXMA 1UR4A 4ORMA 3G3DA 4JIEA 1R3YA 2PTZA 4H6EA 1XQLA 2DDXA 1X38A 2YKKA 1Q4NX 4Y90A 3K1GA 1YKWA 2PGEA 1FCQA 3N13A 3GIQA 5H1WA 5HMFA 3O6AA 4AWEA 4XUYA 2E67A 1FWAC 3V75A 3PULA 3WLSA 4BF9A 1SW7A 1AW5A 2VRKA 2VFHA 2ABAA 4QHRA 1XLDA 2GYIA 3WFAA 1SSDA 4B2DD 3WD0A 1JCTA 2IXVA 3KX6A 1OFAA 2WKJA 2PODA 3TLQA 2OZTA 3AC0A 1KKRA 2ZRUA 4PUUA 4UOZA 5HPCA 4FR6A 4OFCA 3DI1A 1XBXA 3BUVA 1XBVA 1P0DA 1IHIA 4HNCA 3HURA 2ZUUA 3MUZ1 1SFSA 4NQ1A 1PX8A 4IIEA 2ZUWA 1V6UA 1HJXA 4H2HA 4WKAA 4UTLA 1ZS2A 4BS0A 2YCJA 3QFEA 5C2CA 4AH7A 1CI1A 3VZZA 4DEFA 4QDPA 2PTYA 1NELA 4IQJA 3W70A 1PHQA 1GQJA 2GGJA 2DSZA 4L1XA 4S2CA 1DWFM 3W87A 1T99A 4FX8A 4CVWA 4GYPC 1KM3A 3DHPA 3PPFA 3DDMA 1KGWA 4Z1BA 4Q6JA 3H4WA 3N9KA 4N6EA 3L21A 3W6MA 3O07A 1EJTC 3MMUA 2QQ6A 1L6SA 1YPXA 4O1FA 4UTHA 1OINA 3OG2A 4PMYA 4S39A 1K3UA 3AMDA 1SZEA 3CQ0A 2ZYFA 5IBXA 2PBOA 3PJTA 1WDWA 3H2CA 2A6NA 2XGIA 4K8EA 4KEZA 1MEIA 4GK8A 3C8NA 4EE9A 3P60A 1H51A 1BKSA 3ZR4A 1JDDA 4FS9A 2DQWA 3FHQA 4JDBA 3RUBL 2Y4SA 4HN8A 2WSRA 1S3TC 3K13A 2IQDA 1V5XA 2FZMA 1BEUA 5DMNA 3GRIA 3A5FA 1EH9A 1ZU8A 2Y8UA 1E1CA 2I1OA 4KPLA 3UZYA 4X61A 5DF0A 4G56A 3CUHA 3Q65A 4KERA 3EXSA 3P8IA 1SFLA 3HIJA 1TV4A 4AWUA 1YLVA 1MUWA 4OOUA 1KM2A 2DZAA 2E7FA 4QDMA 1F9CA 1E9LA 3V1HA 2WM0A 1VFMA 1B9ZA 3B06A 2GK1A 3KS5A 4F0LA 4LUTB 4H7ZA 1CLXA 1JCJA 1RQBA 4HJFA 2J75A 2PC8A 4UTJA 1AL8A 3UFYA 4OT7A 3BLKA 5CGMA 2WJZA 3W75A 4Q7IA 4WR3A 1DP0A 4ATLA 4A6GA 3CM4A 3QTPA 1O60A 1K9EA 2CEQA 3UZZA 2BX7A 1W3HA 1SJBA 2GJRA 2HDJA 2VWSA 1HN1A 2A3HA 3VX1A 3NWRA 2XWDA 3AYTA 4HHMA 4NX5A 2A79A 3KTSA 3OB8A 3TSDA 3RJYA 1YXDA 1E3XA 3QLLA 1D9EA 1ZRQA 3MVTA 2Z2BA 1NDVA 4LW7A 4AAJA 4WGHA 3UESA 5LXXA 2YPIA 4X0VA 4WIWA 3ITTA 2B7NA 5LYRA 2QJGA 1J6OA 4IPLA 1M03A 2BODX 1H1ZA 4R88A 2ZUSA 2Z00A 4H9ZA 5AKQA 1I45A 5AC8A 8XIMA 1UZHA 2BFGA 4M8UA 4LUSA 1B31A 4JTHA 1W1B1 2XVGA 3W23A 3GH4A 3E1F1 1BVNP 2IKHA 4YWSA 4CD6A 1RJQA 2ZX9A 1CXKA 3RIKA 5C7HA 2A3BA 1CGVA 2PDBA 5LZLA 1TMLA 1KRCC 3STGA 3IJ9A 1POJA 2DSVA 1WPCA 2DJXA 2DSKA 3TTYA 3VKDA 3MCNA 1QNVA 4AHQA 1TV8A 4TOQA 2ASHA 3W7QA 3Q58A 3HFTA 2PGWA 2W3ZA 1BYBA 1KFEA 4NZ4A 3HG4A 3LNMA 3W6LA 3L4WA 1EDTA 3NDYA 3NFUA 2RAGA 1S5NA 4Q4OA 2NVAA 4LRTA 2ZBTA 2Z24A 4CCDA 2Y62A 3WK0A 3WQPA 1K8ZA 2VI0A 4I90A 4I9JA 5IHRA 3LTYA 2FIQA 1YQ2A 5F7UA 5DBUA 1VFTA 2Z6IA 4XD3A 3AHYA 3WNOA 4PMUA 4HNUA 4NKCA 2VFFA 1RR2A 2HVMA 3AYRA 3QW3A 2QCDB 2Q8ZA 2OWWA 1MFUA 3CWNA 2O7SA 3TMLA 5E9AA 1U5VA 3ZWTA 2DFAA 3B0PA 2OQYA 1JYNA 4RV3A 3VGEA 4XWUA 4UB9A 1KD0A 1VFHA 3LHWA 5M17A 1MFVA 1I2PA 3IK4A 4K7YA 3K8KA 4A3QA 1Z8AA 3UJEA 1XD0A 1WE5A 1W3JA 3CHEA 3WLOA 1W0MA 4PC8A 3C6CA 3AZSA 3FHAA 2A5HA 3P61A 1IEXA 6TAAA 3BSMA 4GX9A 4ZTXA 2EG7A 4FNQA 4IFRA 4H6RA 4QG9A 3MMTA 5LNWA 5GPRA 4DVOA 4GISA 1AQHA 3REQB 4F2UA 3SCPA 4I5RA 2BNJA 4AB4A 4JTTA 3VIOA 4V1YA 4KFNA 1E15A 1E1EA 1UUOA 2J74A 3ZYZA 2TMDA 1KXQA 5JXQA 4GPNA 1P7TA 1XL9A 1XPGA 1C7SA 1MDRA 2G41A 3DKJA 3K1DA 2WQDA 3KAOA 1KR1A 1GT8A 2VX5A 3L12A 3FKKA 3PZTA 1GVRA 3GXNA 4AHPA 1EGVA 3QMRA 1GG1A 3M64A 1CGUA 1VJIA 2BLEA 2VR2A 2VOMA 1V08A 4IGNA 1FY6A 4ZB2A 3TNBA 2Y7EA 2NT1A 5HNNA 2D0GA 4DF1A 3RILA 1VIZA 2BVDA 4O0QA 3D5HA 3BJTA 3KL3A 2VT0A 1IR2A 3W76A 4GYJA 4N6FA 3GVQA 4AIEA 1HQTA 3O63A 4XIMA 1XPYA 1NSJA 4DJEA 1PS9A 4D1JA 3IUHA 3WQ4A 3CEUA 1CXEA 2VGIA 1IEQA 4PUWA 3TK7A 1ZJAA 1E70M 4FLQA 2J8GA 2R1LA 1SO3A 3I4EA 4RE2A 1FWNA 2WNNA 4YPJA 1GJWA 1JQXA 1R9ZA 1CLKA 4IJRA 2Y7FA 3LERA 1KA9F 1F74A 1S38A 3N12A 1L2UA 3CMFA 4XD4A 5EA9A 3UNTA 2YCEA 2PGRA 3LSBA 1J96A 1CDGA 5AYYA 3T0DA 4XAYA 2V67A 3QPYA 2BG5A 4HT3A 3ARQA 2ON3A 2C13A 5CLWA 1H11A 2PWDA 3ITXA 3IJLA 4Y9MA 5EKYA 1BWLA 1SJAA 3ARYA 4ZMGA 2VKZG 1NOUA 4XZMX 3VVGA 5ECVA 5FOOA 1LBMA 2GSJA 2C16A 3QXBA 1VEPA 4I7UA 3F5JA 1ZZMA 1B57A 2WZEA 4H3DA 5CBIA 1J0HA 3TCEA 2FZBA 3P93A 4UNIA 4E8GA 4UTKA 2Z26A 3WDHA 1M5WA 2P5NA 1GK8A 3GTXA 4PL2A 3CAKA 3MY9A 2NUXA 3WQ5A 3U3HA 1EO7A 4HOXA 1XLKA 4W84A 3B9AA 2I57A 4KKXA 6PTDA 1ADDA 1SPQA 2W6RA 1VHNA 3UXLA 3N4AA 4B3LA 1F6PA 1Y5XA 1TJ1A 1US2A 4EAYA 1CYGA 5CZ0A 3TDFA 2OX4A 1TPFA 3TR9A 3DC0A 4L5ZA 3QV7A 3R5EA 3AYVA 3R6IA 3W7MA 4UCFA 2ISDA 1OABA 5EGRA 1K77A 2QUMA 1JI2A 2BASA 2VR4A 2FKPA 1Q7ZA 2PFHA 2J47A 4FK9A 3B9EA 4RE4A 4ZA0A 2VELA 1IZKA 2VD9A 1J8VA 1XXXA 2E9LA 1J79A 5I3IA 4HSNA 3U48A 2A6LA 1P0BA 3PJXA 2OWXA 3NQ6A 3FSUA 3T81A 4FO4A 4AISA 1BWKA 2QV4A 4BEQA 5C55A 1MXDA 1TWSA 1IYXA 4NZCA 1DTNA 5A8OA 3H4GA 1YDYA 3CUIA 2CBJA 1DHPA 3KDOA 3BJSA 3MUAA 1F3EA 2Z29A 4N4QA 4AWTA 1IT7A 5FJOA 4UOJA 3VGGA 1VH7A 3O3RA 5K3VA 4QTGA 2NVCA 1OFRA 1FQ0A 1GVIA 4Z1AA 4PTMA 1UD3A 1Q63A 2B0MA 1NTHA 3PPCA 3Q45A 1A5BA 1KQYA 4ILSA 1A5MC 3BG3A 1KRMA 1DVJA 2WMHA 4E2OA 3CQKA 5HDRA 4DELA 2RDTA 1ZL1A 4PUJA 4GG9A 1VLIA 3GDMA 4C6LA 4IGSA 3HGOA 9XIAA 1XP3A 1E5JA 2PDJA 3SBFA 1EL3A 1N8WA 3AMLA 4TO8A 2O4MA 5D9OA 3C52A 5E9XA 1UOZA 4BHYA 1VBUA 4IM4A 4MTVA 5LSMA 1SMDA 4JDYA 1PZ2A 2ALDA 1ME8A 3M1ZA 1NU5A 3NDOA 3PWAA 2GSHA 1WZLA 2Z1WA 2VENA 2YJQA 2V38A 2X05A 1EGMA 3KOFA 2VWTA 1MI3A 2JALA 4GVGA 4K6AA 4WY0A 3SSJA 3SQLA 5AYXA 1B2YA 2HBVA 3R0KA 3CK5A 2WC7A 1GPWA 4UFKA 4ADTA 3E2VA 5D9PA 1A4MA 1BQGA 1XIHA 2VEIA 2VDGA 1CT5A 3ZJ8A 1UMYA 5IXEA 2RDWA 4JQ2A 2FTPA 1G67A 1GTHA 3EKZA 5GJPA 1IGWA 1MMFA 3WH9A 1LUCB 1P6CA 3W27A 3EDEA 3L67A 4CEUC 3PZMA 4FMVA 4DQWA 1PDYA 1XFBA 3P82A 2IPFA 3S42A 3GG1A 1Z32X 3CXOA 1Q66A 1XWYA 1CGYA 1AJ0A 1LQ0A 5CGTA 3H24A 1G94A 3MV11 4HBKA 4I3GA 1RY8A 1E9YB 5AHLA 1I2NA 4ACYA 2GLKA 5A2CA 5I78A 4O54A 2CLIA 4LYPA 3CHVA 3BOLA 3GM8A 2CZ5A 4AD1A 1JCYA 1I2OA 3NM3A 3ZIZA 2YXGA 2DUZA 5C9UA 3CLWA 1RV8A 3T05A 2NT0A 3NNTA 4GZJA 2G4JA 1JFXA 3H12A 4XB3A 4F48A 1UH2A 4ZOAA 4Z0JA 3B8IA 1Q85A 2Z1VA 3VPLA 3WH5A 3W07A 2PZNA 1KFLA 1S46A 4NNAA 3AIBA 4RW5A 3SUWA 4CKQA 4HHHA 3CTLA 5CBJA 5K2ZA 2CU0A 3I7QA 3OW1A 2BP1A 2ZZ3A 1R85A 2EJAA 4LCQA 4O13A 2DZBA 3W7KA 4LCRA 5FSDC 2ZX8A 3FLUA 1L6GA 1S2UA 2H9AB 4MAZA 3PZNA 1C29A 1OX4A 1CGTA 1J2WA 3KS6A 3TROA 1LP6A 1NWRA 2AOSA 4JTRA 2VVSA 3CZ8A 3M41A 4Y8EA 4GJIA 4TX9A 4F9DA 2DZSA 4Q22A 3DU0A 3QQ1A 4UTFA 1WP6A 5I6SA 3MTWA 4CNNA 4URIA 1CBGA 1TRIA 3FA5A 4FLSA 4LGXA 4G6CA 1XSKA 1VYSX 1XBYA 1CECA 3KDNA 1Z89A 4TU1A 3ARXA 3QLDA 2PWHA 3VD9A 5CSUA 4PH6A 2H90A 4ZO6A 3QC0A 4R7WA 4HD5A 4GQRA 3H22A 1CTNA 9RUBA 4FXRA 1UD8A 1UZ4A 3OLGA 1OK4A 2WJDA 4DI8A 2XGZA 2XIBA 4WSJA 3NYZA 4GQBA 1TREA 4FXSA 1TVLA 1FXPA 2P0OA 4TTGA 1P5BA 4QQUA 2XN2A 4K36A 1K7XA 4Q8UA 2HMCA 3C2RA 4KWWA 4GYFA 2VQTA 2Y88A 4X60A 4GZIA 3CUZA 1BD0A 4W89A 1C3FA 4WXYA 2ZFAA 3INPA 4KMQA 3NL6A 5I7GA 2ZUNA 1RQEA 2CKSA 1ONRA 3BDKA 1UCWA 1H5YA 2I7GA 4D2JA 3VOGA 4GQ0A 5EFFA 1E4IA 5CH9A 1WZAA 4E5TA 2W79A 4LY8A 1O5KA 3TH6A 1VFUA 3KWSA 3UWUA 1OADA 2V3EA 2X1TA 1O4UA 3VCCA 3W72A 1E6NA 1LBFA 2EPKX 5E0KA 1EJSC 1PBGA 3AFBA 3NQFA 3S1GA 4GGHA 3ZT6A 1FH9A 1KGUA 3TJLA 4XK2A 1KCLA 1CNVA 4TV6A 3TU9A 2IPWA 1E6QM 2WC3A 3MBFA 1A5LC 1B4EA 4S3DA 3FKRA 3OHMB 1JPHA 4DLMA 2DGAA 3FN9A 1TTQA 4DN1A 3MZNA 3PPHA 4QSFA 5LGXA 2EPNA 2CIPA 3W2UA 1R2RA 3LLXA 3FYPA 1B3ZA 4ZSUA 8RUCA 4CCCA 3CWHA 4WOZA 4UFIA 2CYGA 2E09A 4MVAA 4V27A 2ZC8A 1H7RA 1NF0A 3FEQA 1XV8A 1RVKA 1YEYA 1ICSA 4FX7A 3VM7A 1ITUA 4A8IA 1FHDA 4CD4A 1X8CA 1ZHAA 3ABZA 3APTA 1OD0A 3E9AA 1HL9A 1ICQA 1ZJIA 4LVDA 4J7RA 3RMEA 4NAEA 4IXXA 4EPDC 3BOFA 3M7SA 3NQBA 2CLEA 4KCVA 2BV9A 1HGYA 5EMKA 1W9PA 3O9NA 4KRUA 4B92A 1V6XA 4HMDA 4GBUA 3DYOA 4R34A 1UKOA 4NAEB 1JCMP 2ALRA 1US0A 2I5GA 4DLFA 1A5NC 1RBLA 5B7ZA 3MT1A 1PKLA 4TQTA 1SQ7A 1TUFA 1E4MM 4HHLA 1FP8A 3RLGA 1HO1A 1B0IA 1C8VA 1N55A 3BOXA 5ABHA 2CZEA 3ZJ7A 3WFLA 2B7OA 3VNZA 4NX0A 1KBJA 4C6FA 5CZTA 2HPMA 3MB9A 4AZIA 2NXHA 4KWUA 4PODA 4YLWA 4UR8A 5F1VA 1RPXA 3NZPA 1PYFA 2Q8XA 3W7IA 3PK7A 5LIWX 2CZDA 2B7PA 5AHNA 4IMEA 3URNA 5TF0A 2J25A 3GR4A 4YN5A 1K03A 3LI0A 3R25A 5KMYA 4HA0A 3LX9A 1XR2A 4JTGA 2E68A 4JTAA 2CHNA 3A9IA 4FXJA 3VA8A 1DJQA 4HSHA 4D6JA 1QHOA 2QYGA 2J66A 4CUCA 4LOCA 1XCWA 2JFEX 4JTQA 4C7FA 3OLDA 3S6TA 1NY1A 3L2LA 5DRCA 2PDPA 4DBWA 2ZICA 4JHZA 4HPHA 3CUJA 4M5PA 4IPJA 3HQNA 4RDWA 6TIMA 1AA1B 3USBA 2RGMA 4MG4A 3W01A 3UQNA 5BXRA 1GOXA 1Q8AA 3RX4A 5HWJA 4MFEA 1UG6A 3LENA 1DYSA 3LXBA 4CQCA 2PDNA 4HK6A 2GPTA 4LUIA 2XHYA 1QTWA 5F4XA 3NQEA 5EBUA 5HATA 1QBAA 2ZVIA 3WBAA 1W3TA 1SZGA 5FEZA 1TPH1 3GSMA 5D04C 3NZGA 1V0KA 1N7KA 4IJCA 3E5PA 3HQ1A 3T2PA 1GQLA 3HPZA 4MWAC 4LT9A 1EQCA 2PTWA 5C2XA 4FNPA 2R6OA 5A6BA 5G2HA 3L4VA 3VD3A 1TPWA 1P6WA 1XIGA 1F76A 2HSAA 1U33A 2I5QA 1WXYA 5A94A 1D2KA 1W9DM 3FJ6A 1DJYA 1DXIA 3LCLA 4BI6A 1OC6A 5A69A 5EMUA 2WMKA 3ITCA 4PCFA 3S9ZA 2FTYA 2OOFA 1P0NA 4N9CA 3DFTA 3KBVA 1SR9A 2CFFA 3WJWA 1I9CB 1BF2A 5CGQA 1OFPA 4GZ7A 3IAQA 3A3HA 4JTFA 1LROA 4TXEA 4JQ1A 3PZ9A 1E6RA 3RG6A 4MJZA 3O15A 3VOIA 4ZQOA 4DNMA 4RNIA 3THAA 3L4UA 3KTCA 2VNCA 1HXJA 1YPFA 7ODCA 2QCHA 2F2HA 4LAZA 5HPOA 4W85A 1EPVA 4K1WA 2CITA 4A8RA 2FJKA 1UUQA 2I9UA 1UW9A 4YL2A 4KRZA 1EA0A 2NX1A 2QR6A 3UXDA 2RGLA 4IGHA 3C61A 4O16A 3BMXA 4P8UA 3FA4A 3L4ZA 4IICA 4XSMA 1QUMA 5E70A 2VZSA 2FJUB 4MB1A 1XUZA 4JX4A 3HPSA 4DO5A 4DUWA 3JW7A 2PI6A 1FXQA 4WY0F 2AQVA 3B0UX 3NQ7A 3GYCA 1PTDA 2QW5A 1LWHA 5HJXA 2E1DA 1UD6A 5LHEA 1HZYA 4UTTA 3ANVA 3OIXA 3PZOA 3ZR5A 1XLAA 3AISA 4Z17A 2B4GA 2X7VA 2VP8A 2HK1A 4DZ5A 3NQ2A 1JPMA 1GOWA 2NW0A 4YMZA 1C9WA 3O0KA 3WQGA 2YW3A 4LU0A 1MZHA 3VYLA 3P67A 2E6YA 1GUVA 3UD6A 1E51A 5EMMA 1H60A 3PJUA 1O12A 5A6BD 1PIFA 5LNUA 4HCDA 5A8MA 4R53A 2CXGA 4C6NA 1OCNA 3TFCA 4QE5A 1FA2A 2V30A 2GGEA 1W2PA 2P10A 4R85A 3UETA 4TV5A 1Z42A 2QT3A 3FNDA 4I9TA 3F1QA 2QEZA 3AROA 4OKDA 1P48A 5T91A 3PWIA 2YXXA 1T5AA 3S4TA 3XINA 4LAOA 1O5XA 3SCVA 2XG9A 4ORIA 2FB3A 2DUAA 3MUIA 5E1QA 5KZ6A 3M0YA 3L0NA 3PS7A 2OG9A 2GL5A 3ITVA 3ITYA 1UJPA 5DXYA 2QJIA 2WVUA 4RDYA 3OZYA 1CXIA 1KTBA 3V5CA 3COTA 5DMMA 4E38A 4GY0A 4D6GA 4LAUA 2DW7A 3H8AA 1H49A 3SADA 1SW0A 3RAOA 4AD3A 1MXGA 2C79A 2PAJA 4KEVA 5JQ9A 2F6XA 2BOGX 2ZZ7A 5EMLA 4BK9A 3SECA 3MVIA 1LDCA 3S47A 5LKYA 3RM8A 3GDKA 4W9TA 5H8UA 3PAOA 4N0RA 3MHUA 4U28A 4L64A 5D8ZA 4J2MA 4M1BA 3IJDA 5M3WA 4DYJA 4ZXOA 5D05A 4DXKA 2ZX5A 4XZIA 1JD7A 3TN6A 1LLOA 1LZOA 1JJKA 1WKEA 3ARSA 2CBVA 4PEEA 1AQMA 1J0YA 3VCNA 5XIAA 1FCUA 1K4GA 4F4RA 3NQAA 3BAKA 2C3ZA 1XYBA 1ZAIA 1VJZA 3EPMA 1NOWA 2O9TA 3CPUA 2PLCA 3QOKA 5G4HC 3Q94A 1EBHA 3QZEA 1ZCCA 2WJFA 3B8TA 2VOTA 1J5TA 4KWOA 1Z69A 1EWEA 3NPWA 1S1PA 3IPWA 2GJLA 2V81A 4GD0A 1XSJA 1QPQA 3FVDA 4JHMA 1FHUA 3B8DA 3P84A 5FAJA 4AZCB 1VFFA 2CERA 2F8QA 2NLYA 1C92A 4B5WA 3A47A 5I00A 1W3KA 1FWFC 3F4NA 2VR5A 3MMWA 3WQDA 3DFNA 3HA1A 3NPUA 4GUFA 2WSPA 2DZTA 2V82A 4CNSA 3H23A 1EF2A 3BLOA 3EX1A 2F7FA 4I5UA 1DJHA 4A05A 2E9MA 2DZWA 3T0CA 3SI9A 3L0KA 4LYRA 2O4QA 3TN3A 1VC4A 5BRQA 2WSQA 3SURA 2Y5JA 3I7SA 2WC4A 3ME3A 3AHVA 4GKLA 3Q37A 4W87A 1EA9C 4DI9A 4TR9A 5D2WA 3TYZA 3EA2A 5E09A 5D03A 2GJNA 1O6IA 2DIJA 2XUCA 1OFOA 3LCFA 4D6EA 2J7DA 1W3LA 3SRFA 3MO7A 3HJEA 1LM1A 3VCRA 3C0JA 4P7LA 1WYIA 1PO9A 5T9CE 4YCOA 3VD5A 4GQQA 3PP7A 4B5UA 2DVUA 3T2QA 1MQRA 4US5A 1UR1A 4R7OA 5BOEA 3MUXA 2QUNA 3M46A 2Z7GA 3PG8A 5BZAA 3WQWA 3EKGA 3PB0A 1FWCC 1RH9A 1KV5A 4ZQMA 1YNPA 1G4TA 3AMCA 2V5JA 1TB3A 2X1SA 3USZA 2WBGA 2WVSA 5TNVA 4XTDA 1KC7A 4D6IA 5EB8A 5E0CA 1KRBC 1HJUA 4Y9NA 1YTDA 1NIUA 3OZMA 4ZQCA 1V93A 5D30A 3DFHA 4QR6A 4QE4A 1GPFA 3ZT5A 4K8GA 2YLLA 4C91A 4NAFA 4LBRA 2GVLA 1OZMA 4QQ3A 5BMXA 3OJGA 4MM1A 1YBQB 4IIFA 3DEQA 5CZJA 3HPXA 8CGTA 5G1MA 4UNLA 3S2LA 3TXVA 4JY8A 5C9WA 2G3NA 3W73A 1JCLA 1RK5A 1W3IA 2WLZA 3OLEA 2V3FA 1Q5MA 3JR2A 2YA0A 1JG9A 3B8SA 4QISA 5CC6A 4ICCX 1Z41A 2Y63A 5I3FA 3R7MA 2ATMA 3UA3A 3KOWA 3WUBA 1DORA 4LFYA 2A7RA 2C1GA 1CB7B 3LCGA 3GVWA 3NJ3A 2E5BA 1WNOA 3CASA 2G3JA 3QOMA 5H91A 3W02A 3WK1A 3BW4A 4H83A 3GTIA 3MC5A 1JRCA 1U83A 2YX0A 2NQ5A 1OFEA 4MSSA 4UC5A 3A3XA 3W1UA 1F4HA 2FHCA 3TZNA 4W5UA 3OVPA 3P62A 1VAHA 3G0UA 1I60A 3ZJKA 1OC7A 5JIPA 3IUDA 4N9EA 4ASTA 5HANA 2P8BA 3TTSA 2O9RA 3K46A 3THCA 4H8VA 3MKVA 1AD4A 1POKA 4H7CA 3ZWSA 3CJPA 4I7WA 3H55A 1UP0A 4BF7A 3GIPA 4B3ZA 3EWCA 3FX4A 4F0RA 1DOSA 4J3UA 2XISA 1A3XA 1H2JA 1H5VA 2DIEA 3EWBX 4AD0A 4JFUA 5A6JA 3WH7A 5EU9A 2UBPC 1D3CA 1B54A 3QPZA 4E8CA 1KXTA 3M6DA 3LPGA 3UR5A 3LCXA 1NDYA 2R24A 1HKVA 4JEQA 4NXKA 3EEZA 3ITOA 1YADA 1SZFA 3WEOA 2ZE0A 3QY7A 3MI3A 4GC3A 2QHAA 3TQKA 3L4XA 3OVRA 7REQA 3SQMA 3A3WA 1KGXA 4C90A 1ZQ5A 4MY1A 1VENA 3UPWA 1JZ2A 1TJRA 4ZSTA 1DL3A 4LPCA 1JULA 2C1IA 4L4PA 2C18A 2ZC1A 3A24A 3AHXA 4C6OA 4QLKA 1TR1A 4FALA 1QMLA 4KRTA 1JF6A 1AQ0A 3D3AA 3S9IA 3L66A 2AKZA 4JICA 1CXHA 2W92A 5JH2A 4IQDA 4HKPA 3KLLA 5FSEC 4RV8A 2BOEX 3RITA 2VFGA 3SO7A 4B5XA 1DIOA 2AQOA 4ZTYA 1HVXA 3E74A 2A3EA 2DZUA 5B7YA 1LORA 1IWBA 3VKCA 1P1XA 3LHTA 4LS0A 4JPGA 3SAZA 3W28A 3ZSTA 4F79A 3QMSA 4PZVA 4QBXA 3UWQA 1YMYA 4LC8A 5F2IA 1PZ1A 1T7LA 4MPQA 5I79A 3PZVA 3MP4A 1QK2A 3VDCA 4XQ6A 2J4GA 4KIRA 1W5NA 4YVVA 4QXIA 2H3DA 2XFRA 5MKGA 4G1NA 1A5CA 1JF5A 5A3HA 2ISWA 2HXUA 1FH8A 2VC7A 3BQ5A 1DHKA 2XIOA 4M6UA 1VJSA 4ZOEA 5HAOA 4O11A 4F66A 4JFTA 2IXUA 3UR8A 5A6LA 1KLYA 1PHWA 4CCZA 3PWGA 5I2UA 1DJZA 1GOQA 4US6A 4C65A 4MB4A 1M9HA 2WNZA 1JPKA 4OE7A 5TD4A 1EC7A 1HW6A 3ATZA 3DGRA 2ZQ0A 3D6NA 3NOYA 1OFDA 3GLCA 2WVVA 3A9BA 4JD4A 5KZDA 4CGTA 2EGZA 3M6YA 3WLPA 2PC4A 9XIMA 1O7AA 3UCDA 1H7NA 1J12A 1CX9A 3S1VA 2D2OA 3CT2A 3MSGA 1XLGA 4TTUA 2VJXA 5LNSA 2XM1A 1PSCA 1N2VA 4A3HA 4V15A 2WZMA 3ZM8A 5D2XA 5FEXA 5D9MA 3WQCA 4DAIA 1MXSA 4AU0A 2D22A 1TZ7A 3S3GA 4LTSA 4GFSA 1BRLB 1CGXA 1DE6A 5CAKA 4DY1A 4ERAA 5DXXA 2XZ7A 1JEZA 4D71A 5BYWA 3W1MA 5CBBA 3O8AA 4AY1A 1KCKA 5HNUA 3KOXA 1BRLA 2CXEA 3JUGA 4O1AA 3VGDA 3W1PA 1GQNA 1X1OA 1P4CA 4BQ3A 3GY1A 4PUNA 4WDUA 5DT7A 3B9NA 3K30A 2OQHA 1V6VA 1XC4A 2J7BA 1FOBA 2QJMA 3XIMA 3OPSA 3CUXA 1F05A 3ISIX 2PLKA 4S3KA 3URBA 1TVPA 3R0DA 5FF2A 2Z2AA 1IQ8A 2QAFA 2QJJA 3RYSA 1XIEA 2NQZA 3BLLA 4LWWA 1NWUA 2VHLA 1SZRA 3KOZA 4O14A 3W2JA 4XUGA 2ZUVA 1W31A 2I5IA 1W5MA 3CQJA 4UFJA 1PIIA 3QJAA 2D1ZA 1CENA 1PE1A 4MB3A 1OF6A 5MKGB 3GTNA 4UTWA 4W93A 1WDPA 4PBGA 1TMQA 3DH7A 3WMLA 4AY7A 3NR0A 3UVIA 3RX2A 2AMGA 1V3KA 1EXBA 3WMSA 3DI0A 4OUEA 4PSPA 3N25A 1PKNA 5A8QA 2QVHA 1E9IA 4HZ7A 5XIMA 1EJVC 4B9YA 1K8XA 4JCLA 3AICA 3WL1A 1X97A 3UWEA 1MO0A 4FNRA 4BKNA 3JZUA 3N29A 5EBAA 1ZY9A 1XLIA 3C2OA 1PCWA 3GWQA 3IJQA 1B3XA 4PMNA 4KCTA 4Y2WA 1JPIA 2D2GA 2GGIA 5A8GA 1JRBA 1EO5A 4DXVA 4U5KA 3PUGA 1U30A 1MRAA 1Z6KA 1R7OA 4MHBA 4MJ4A 3M16A 4R27A 4ACZB 1WOBA 1H09A 3WQOA 3H2AA 3IIPA 2VFEA 3AI0A 3CAVA 4JTDA 3KRBA 4P5UA 3FXYA 2ABBA 4ZQRA 2GDUA 2HE5A 3GVRA 4N9DA 3NPXA 3I65A 4OHQA 2QDEA 3CPRA 1UPPA 5CLTA 5HQLA 2CETA 2PCQA 3WK3A 1XKYA 4DWDA 4O4WA 3WNLA 3QF0A 2VD8A 5A2BA 2D2HA 1BYAA 2ZDSA 2DUXA 2FVKA 1TSIA 4LY4A 4FLRA 3P0WA 3TV8A 1E55A 2PUZA 2CKRA 4R3UA 2PWEA 1ISVA 5A2AA 2YZ5A 4NZJA 3UCQA 3H2NA 4G9PA 2DT0A 1SZNA 2V3GA 1M6JA 1XLJA 2C7FA 3QH2A 3W6YA 4Q33A 5C6MA 3E0WA 1PPIA 3DENA 4MYXA 4XZ9A 3NTYA 2JGQA 3AXMA 3NVDA 1JXJA 5CJNA 3VIFA 4C6MA 4DBSA 4NJJA 5E93A 2J7FA 2X40A 4UQCA 5J8LA 5AHMA 1QPOA 4UQBA 1EEXA 1JI1A 3CNYA 3MHFA 4Q8OA 3KBWA 1LF1A 4G2DA 1F8IA 4Q7NA 2PU1A 5CPMA 5G4WA 4JHOA 4S1FA 1SJDA 1NDZA 3MU7A 4WEVX 4MLJA 3B8UA 4LUYA 3WZ0E 2DZVA 3CL6A 3SUSA 1XRFA 3T07A 4D8AA 1PIGA 3R89A 3CHDA 2EJ1A 1S2TA 4JTLA 1LOSA 2DH2A 3L2MA 3W7PA 1UB3A 3BTNA 2BOFX 3AU2A 3E02A 4H9VA 1DIEA 3T78A 2CPUA 2JE8A 3MSRA 2V6AA 3KBSA 2R1NA 1F61A 4OV4A 1DWJM 4GX8A 1ISWA 3AMKA 2ODOA 2R82A 2GQAA 3OBKA 3IVUA 3SR7A 4PL1A 2XYLA 2V0TA 2Y7GA 3QYQA 1BQCA 1QHPA 3PY2A 2OT1A 4OOZA 1R3QA 2PSNA 3LUTA 3VOJA 2XINA 3V7PA 2O0TA 4GIYA 5AYIA 5F2LA 1TPB1 5JU6A 2TSYA 1VBJA 4RZ4A 3WUEA 4MNMA 1QATA 2WPGA 4MZYA 3URQA 4ZEPA 4X2RA 3UYIA 1GHRA 3MWAA 2R1KA 3DOPA 4LH8A 4XVDA 4Y9PA 4OBSA 4B16A 3QZ6A 3T6CA 4XISA 3O6DA 4PFMA 4GVHA 4ML9A 3S2MA 4AX7A 3BJFA 2PDLA 4LBSA 1FCVA 3WEZA 2WV8A 3EOSA 4Q32A 3WDRA 2ISVA 1X6LA 3GKAA 4PMQA 1OBAA 2C1HA 2IUZA 3PFMA 5ABFB 1X7IA 4QJ3B 2NZLA 4A21A 4DUXA 3GUGA 3UJFA 4QCFA 1XLMA 4BWLC 4TVCA 4JKMA 4XKMA 2ZXQA 2VXNA 4AZBA 2BZNA 2OLAA 4PE8A 5JBDA 4J28A 3HB9A 1VS1A 1A49A 1RP9A 4DZIA 1XX1A 4AC1X 5I06A 3UJ2A 2QDHA 3KP1A 4U2YA 4OV9A 3NO3A 4LV9A 3ONCA 2DIKA 4DX3A 1UIOA 3JZEA 1K7EA 3VNJA 2QCLA 4MFDA 3BLEA 4GI4A 3R8GA 2CNCA 4YTTA 2HISA 3IEBA 3WLHA 2OWCA 1LBLA 1WDSA 2OELA 3SJNA 3VNKA 3BZJA 1JUEA 3T4CA 2IW0A 3HV9A 4FP1A 3U7VA 2B31A 1ZPTA 2YL6A 5LIKX 1FBAA 4IF2A 1LCOA 3S46A 4WXZA 1XDJA 2A2IA 4QNWA 2IKGA 4W8BA 1RCOB 4LEQA 3T0AA 2REQA 3REQA 1DXEA 2XN1A 1OIMA 4P7NA 4B5VA 1KCZA 3W1QA 5F4WA 3W1AA 1PKMA 4OU1A 5CKSA 4K8HA 4HNVA 1U22A 4XD6A 3BAJA 4HPXA 1Q6QA 2Q3OA 2UZ9A 1L6FA 5AHEA 2EKGA 2QJHA 3FGCA 1XQKA 4UMBA 1WZMA 3GG0A 3B9DA 5TAOA 3WLJA 5BRPA 4G5DA 4QITA 3TWAA 4X63A 3DKLA 3C86A 1RPKA 3OIHA 4US5D 1XKJA 3STFA 5CC5A 2Y8KA 3VZXA 3PZQA 4M6VA 1YNQA 3RRXA 2EG8A 1FDJA 1J18A 2A3AA 3UG8A 2WW5A 4YYCA 1IE7C 4GXPA 5REQB 2RKXA 3E0LA 2P8CA 4HTYA 1K7FA 1GEHA 1V7YA 3L9CA 1FDZA 4MNJA 1KXHA 3G8RA 3WNKA 1MW0A 1QNRA 4C7GA 3DC8A 3WQ6A 2YL9A 1KFBA 4W8AA 3RM9A 2DV0A 2G96A 3EMCA 2OLHA 3T9PA 1HKIA 2TPSA 3PBYA 4KS0A 3WH8A 2XIJA 3CPGA 5IOBA 3RXZA 2FYMA 4O0ZA 1XIDA 3KWXA 2XM2A 3G0SA 4ZE5A 1NP2A 4AD5A 1ITCA 2X0YA 1B30A 4FOKA 1O1ZA 3TJIA 1M7JA 2VUNA 3ZVIA 1SYTA 4X0NA 2FDSA 4MZ8A 2OLSA 4HA1A 4RXFA 5D02A 4HHPA 3LY0A 1NM9A 2YCIX 1WAWA 4YXGA 1ZCOA 3UJSA 3QSRA 4L61A 2EKCA 2HS6A 3V3WA 4IFKA 3BSGA 4HU4A 3U5UA 4ERIA 2JGYA 3PUEA 5BXPA 4W7WA 1A0CA 5HUPA 1L6YA 3ZFHA 1G69A 1M04A 1X7FA 4NJIA 2QCCA 2HV5A 4EP8C 4K68A 5KSWA 3LNPA 3CV1A 3GXDA 3E2RA 3TN5A 2XVLA 3AZRA 2Q71A 5GVJA 4C6CA 2C14A 1NFBA 1XLFA 2BDQA 3KVMA 4S3AA 1ZBCA 1BF6A 1KQZA 3OGSA 1C8YA 3GH5A 2IS7A 4LB4A 3MYOA 4J35A 4GJ1A 5CC7A 3IGSA 4LS1A 4UNKA 1XI3A 3FDKA 3M5VA 4C6KA 3KZSA 1FVPA 1YNYA 1HKJA 2G3MA 1UP2A 4O8AA 5DANA 3H4XA 2OR2A 4HZ6A 1RK6A 2G5WA 4YVPA 2WKLA 1RBOB 4UCGA 2ZTJA 2Y5EA 3WL0A 1G4EA 3VGBA 5E6ZA 1F07A 3WG6A 2CCRA 2RFGA 4WKHA 2VFDA 2XZ9A 3HM7A 4IG2B 1SUXA 1XCFA 4DJFC 2YYUA 3SZ8A 1MRQA 1TV5A 4NNCA 2PWGA 4KEMA 3G1XA 1UWTA 3L5LA 3NO1A 5LIUX 1Q6DA 5C71A 1OGSA 5IM51 1I2QA 3NO5A 4QS5A 3SUVA 4QS6A 4N4PA 4WSHA 1TWIA 2VC6A 3IAPA 3TA6A 1FUYA 3VKAA 1I1WA 3KHJA 3BO9A 4EF9A 2CHOA 1R38A 4TVUA 3W9ZA 3BWWA 4O1DA 4OVXA 3THQA 3QQWA 1DJIA 3LHYA 3QGVA 4A3UA 3A6OA 3ZVHA 1JVNA 5FACA 4JN8A 2J9YA 4CD5A 1T41A 3N4EA 4IGMA 1Q7QA 1GOOA 3S1UA 3S5OA 3KXQA 5E5CA 1NDWA 4FNTA 4XKYA 3BAYA 3ZVHB 5D8WA 1BPLB 1XICA 2INZA 2JKAA 4O57A 5HOSA 4JKKA 3VIPA 1Q6OA 1G5AA 3IIZA 2XGBA 4LNCA 4DJFA 3RM4A 8A3HA 2BY3A 3BGJA 3TE9A 1VRDA 4GH1A 3QW4B 4EXQA 4C1NA 2GWGA 2PDUA 2QMKA 1NFGA 3TTOA 3AS3A 1HP5A 4YWIA 1R30A 3TYUA 1XYFA 1WUFA 3OA3A 2AGKA 2FPTA 3N2TA 4EVZA 1EIXA 3O16A 3TYAA 4NXSA 4GABA 1H62A 4GHRA 3VD7A 2ZZ5A 3DXIA 4F0HA 4U31A 4GNKB 3GHRA 3RN6A 3W7RA 3KZPA 4IUGA 4MY8A 3KL5A 1Q8JA 3WK2A 1EUAA 2AGTA 1JAKA 4NP7A 2BVWA 1PX3A 3KRSA 3FJLA 3CTTA 3OHIA 3R12A 1Q6EA 4AXNA 1V0MA 4WRHA 4FPSA 1GQKA 3F03K 3POHA 3NL5A 1ODZA 2XN0A 1OEPA 3GXTA 4M51A 1FWRA 3I3DA 3SDOA 1AFSA 2GJXB 4GE8A 2XFFA 3MWCA 1KFCA 3I6EA 1QVBA 1OYAA 2VEKA 1HJVA 3QV8A 4S3EA 2ZZ4A 4AHOA 2VCBA 1EDGA 1KFWA 4XO7A 4PMXA 4O53A 3WD2A 2ANUA 2DSUA 4IP7A 4BF5A 2HZGA 1WDRA 1WA3A 2Y7DA 5CZSA 1KB3A 2EPHA 4GYKA 1K70A 5C0QA 5FF4A 3RLVA 4DYEA 3AIEA 1XLHA 3VABA 2BMBA 3G1VA 4X2PA 1YE4A 1RCXB 4AX6A 1M7XA 3F7JA 3IJ6A 1AMYA 3LMYA 2WMIB 3IRDA 1V0LA 4YS1A 3A4XA 3MCMA 3BLPX 4INFA 2QIWA 4WDXA 3UU0A 2QGHA 1YDVA 2BHUA 4E4FA 2WVVB 3CIVA 3W7GA 3CIWA 4NYYA 3HG5A 3GG7A 3OG3A 1SGJA 1EHAA 4U2ZA 4OJYA 1QCWA 1UA3A 2VFIA 4LUSB 4DNHA 4GY1A 1I6NA 3RO8A 2CW6A 3SQSA 5I23A 3QR1A 3A13A 5CQ1A 1NOFA 1S5VA 2J9XA 1AJ2A 4OTKA 3D3FA 3UY7A 3LGEA 1IXNA 1LQ2A 4UQDA 4MPKA 5IRPA 2REQB 1BSLA 3W00A 1AJZA 3G24A 1AH0A 4H6KA 3NVTA 4EPKA 2VUYA 1PX4A 3T55A 2WYSA 3ABQA 4HNNA 3FXGA 3C3NA 1UP3A 2GOKA 3BURA 2P3ZA 4WK9A 3AS2A 1MNSA 4DF2A 4JCMA 2WNWA 3LTSA 5AYBA 5D37A 3OP2A 1NVMA 1A5KC 2YBTA 1VD6A 4S3BA 1GVEA 1NEYA 1IV8A 3VC5A 1RXOB 1R2SA 4U3AA 3NURA 3KCOA 4UWMA 1NP0A 4ATDA 1AH4A 3MP3A 3GU9A 2D0FA 4FIQA 3W82A 1DTUA 2X1RA 1RQHA 3RPMA 3RNDA 3N2OA 1XIBA 3UZ5A 4L6HA 3MCOA 4Y7EA 1AW1A 1UC4A 4C6QA 1TIMA 3KHDA 2G3IA 3AALA 1GVYA 1TA3B 3BGGA 2OOGA 3DG6A 3PC0A 5I3HA 2XWEA 3ZXWA 5A5WA 1EJXC 3SCWA 3P3BA 4MUZA 1C9DA 3LRMA 5HUOA 1FTXA 1RLCL 1RLDA 4RZBA 3SGGA 3B8VA 1YXYA 4UZSA 4CNOA 1A0DA 3VILA 4A8NA 5T26A 4DUVA 2DT3A 5TIMA 4H8NA 1KTCA 1XS2A 4A3YA 4WSKA 1RD6A 4Q8VA 1XBZA 3Q67A 1DWHM 3RF9A 1VPQA 3E3HA 2QIIA 1IT0A 4R5EA