3OBEA

Crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
286
Chain Sequence
IPATDAVSSATAGKKMGLQTYSLGQELLQDMPNGLNRLAKAGYTDLEIFGYREDTGKFGDYTTFIASKDYKKMVDDAGLRISSSHLTPSLREYTKENMPKFDEFWKKATDIHAELGVSCMVQPSLPRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKAGEKPEPKGTYIEELFLKNTDPDKVMFELDVYWAVMGQQDPVEWMENYPNRFKLLHIKDRWIIGDSGMMNFPNIFKKAYEIGILGYYVELEGDKKGRTQFEGVEKSAAYLQAAPFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Sugar phosphate isomerase/epimerase
publication title Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 97
structure length 286
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3obeA00
2ZDSA 5H6HA 5EMJA 4ZB0A 4QEEA 3UA3A 3CQIA 3KBSA 2I57A 2Q02A 5XIAA 4K3ZA 9XIAA 1XLEA 3U0HA 2XIMA 2QULA 3KTCA 3XIMA 3ITOA 3VNLA 3VNMA 3UU0A 3DBNA 1MUWA 1XIIA 1XLCA 4G56A 4XIMA 5J8LA 4KW2A 5XINA 3BWWA 1XLMA 4HGXA 4QDWA 3AAMA 3M0VA 4XSMA 1XYLA 3BZJA 4PFHA 4K1GA 1XLAA 3BANA 4A8IA 3QZAA 1DE6A 3ITXA 8XIMA 3KCOA 1XLLA 1XLKA 4DUOA 3VYLA 1K77A 1OADA 1XLIA 3C0SA 3P6LA 1TZ9A 3CQJA 4GJIA 3TC3A 3AYVA 1XLJA 1A0EA 2HCVA 3ITLA 3XINA 1XIEA 1CLKA 1DXIA 7XIMA 3C0QA 3LMZA 4QEHA 1YX1A 5B7ZA 1XICA 1XLDA 1XYMA 3AALA 1DE5A 1DIDA 3AYTA 5TNVA 2QW5A 3OBEA 2HK0A 5FA5A 1O1HA 3C0LA 2G4JA 4J4KA 4QE1A 3UXIA 4PGLA 5EMMA 2XINA 3IUIA 3VNJA 3KWSA 1XYCA 3N4AA 1MNZA 2J6VA 1I6NA 2NQHA 4YTTA 3L23A 3M0YA 1XLBA 3TVAA 3NGFA 6XIMA 4QDPA 6XIAA 3DX5A 4DVOA 2OU4A 3JU2A 5H1WA 3P14A 3IUHA 2GLKA 3VNKA 1XINA 1XP3A 2XISA 1XIFA 4EACA 1XIBA 3CQKA 4YTSA 2NQ9A 4XSLA 9XIMA 2NQJA 3KBMA 3KCJA 1D8WA 4X63A 1XIMA 3ITVA 3VNIA 2HK1A 1XIHA 2X7WA 3KCLA 3ITTA 3QXBA 3KBJA 3M0XA 1I60A 5I7GA 4XISA 2GUBA 1DIEA 3QYSA 3KBWA 3IUDA 4US6A 1S5MA 4OVXA 4W4QA 4ZB2A 5EMKA 4XIAA 4YTRA 5EMLA 2I56A 3ITYA 3UVAA 4E3VA 3XISA 4A8NA 5B80A 5AVHA 4YTUA 1S5NA 1BXCA 3M0MA 4HNOA 4QE5A 2QUNA 1XYBA 2QUMA 5AVNA 4HHMA 4A8RA 4ZBCA 1XLFA 4EAYA 3BDKA 4Q7IA 3U3HA 3GNXA 1QTWA 1QUMA 2X7VA 3FVMA 4QE4A 2GYIA 3QC0A 1XISA 4X61A 1XLGA 3KBNA 3M0HA 4GQBA 5XIMA 3CNYA 4X60A 1XYAA 4HHLA 5B7YA 5C9ZA 1A0DA 1A0CA 1XLHA 4GLEA 2ZVRA 1BXBA 1XIGA 4GJJA 3KBVA 3CWHA 1XIDA 2G0WA 4ZB5A 3BZGA 4XKMA 8XIAA 1QT1A 3UA4A 2GVEA 3CQHA 4YTQA 1XIJA 1GW9A 4LNCA 4A8LA 3M0LA 3WQOA
chains in the Genus database with same CATH superfamily
4HSNA 1W3IA 3DYOA 5FIPA 2CLLA 3A22A 5MF5A 4IMFA 4E8GA 3VNLA 4K36A 2YOCA 1EHAA 3G3MA 3DFTA 1XG4A 5DEZA 1OC5A 2XWDA 4O1BA 2YBTA 1XYLA 2F7FA 4A8IA 1VC4A 3L68A 3SCVA 2GGGA 1VJIA 3E2QA 5F7UA 3GB6A 2GWNA 1V6VA 3GIYA 2XJ7A 1OC7A 5HUOA 4NASA 4AF0B 1UPMB 3W1LA 1XCFA 3WK2A 2J7GA 3ITCA 3T2OA 1I45A 3EBVA 4Z0SA 2J6VA 3BLDA 2XH4A 3AS3A 3AIEA 3AZRA 1ODUA 1PKYA 4UTWA 4U31A 3SCUA 3TXVA 4NU7A 5KZMA 1HVQA 1CGWA 3HQ1A 3R0UA 3EB3A 1E6SM 3UXDA 1WE5A 1FWNA 3OU8A 2IPWA 3D3FA 1X6NA 3CTLA 4ZMGA 1O4UA 4HYWA 1PVNA 2WNZA 1R9ZA 3PBWA 2EKGA 3JVAA 1ITQA 3UR5A 4QQUA 1KKOA 3LEPA 4HCHA 1HP4A 4OOUA 3GVWA 5G4HC 2OQLA 2GL5A 3QW4B 3OGRA 3WLLA 3ZVHB 1HJXA 2DVUA 3UPBA 3ZVHA 3LG3A 3BJTA 4PRRA 3NQ7A 5J8LA 2DEPA 1W3NA 3M6YA 3B4UA 4BI7A 4KCVA 1BG9A 2RGLA 4JBRA 4JTFA 5GVJA 3TDFA 4C6OA 4ZQPA 1W2VA 3BLEA 3G1HA 2YLAA 1D2KA 3E02A 2X1SA 4AQLA 4BQ3A 3MP5A 5E1QA 3TQVA 1OCBA 3L23A 3NZGA 4Z1BA 3THUA 3LHVA 1QCWA 1Y7VA 5EMYA 1M6JA 3Q2DA 3EA3A 4M8UA 3WNKA 1Y5XA 4BQ4A 3W38A 1FH8A 1MO0A 1JZ4A 4LQ1A 4EK7A 1MVYA 2WNNA 3IJ8A 2C91A 4LVBA 3MC5A 4EXBA 1I2RA 5KTLA 3FGCB 3W4RA 4URIA 4DJED 2GSHA 1D3CA 1VLIA 2BDQA 3LZ3A 4WD0A 2VGBA 4TO8A 2YIHA 1ADSA 1WDWA 2V81A 3C2FA 2FPVA 4QE4A 2OSYA 4HD5A 1NU5A 5LA1A 3R58A 1B3VA 4M81A 4MUZA 4HMDA 2MNRA 2OG9A 4GKTA 5I07A 1AJ2A 3W1XA 5H6HA 1TV5A 3KBSA 1LOLA 4WX2A 2Y0FA 4FA3A 1LF1A 3N2MA 2HE8A 4HA3A 3IRDA 4HNUA 3E12A 1GVOA 4GVIA 1O5RA 3BZJA 1H5VA 5FJJA 2PLJA 4QAIA 3LYEA 1XF0A 3COTA 3TE9A 4G1NA 3GZAA 4B5XA 5TIMA 3PULA 3PZGA 2GSEA 3GAKA 3DZ1A 1PZ3A 3VD9A 5G1MA 1GW1A 1AH3A 4DLFA 3WLTA 3M1ZA 2IS7A 1PKNA 2FZ9A 1UR8A 5FESA 3RN6A 3PP7A 4GACA 4JQ2A 1DJQA 5CC6A 3EWDA 1E5NA 2BZNA 4C5ZA 2C1HA 1G4EA 2D2OA 3NQCA 4KS0A 4OVXA 3O6AA 4U5IA 2HVOA 3LGGA 2OWWA 1FP9A 1V7YA 2RKXA 2QQ6A 4Y9MA 1UD4A 1V02E 5ECUA 4KPLA 1PZ0A 3MI2A 1E6RA 4ZBCA 2Q09A 3PAJA 4JNYA 2INZA 2DP3A 3W71A 3W2MA 3WMSA 2EQDA 3FA3A 3GUWA 2XVPA 5D30A 4W7WA 1JUEA 3KRSA 1W1VA 3PPGA 3SFKA 4GX8A 4JTAA 1TG7A 3NSMA 3OA5A 2NT1A 4PMRA 4D6FA 1GOOA 1V51A 4ZB0A 4MM1A 1U5VA 1HKJA 4AYSA 1DJZA 4Q4KA 3S1UA 2J9YA 1Z48A 5REQA 3TSBA 1UD2A 1GVYA 2WCAA 1CBGA 2UWFA 4K1GA 4Y96A 3ITXA 1KXQA 2QCDB 3IJLA 3WENA 1XSKA 2AQWA 3POCA 3ZT7A 1F07A 2QCDA 2QJMA 1DWIM 3OLGA 3G1AA 4YL2A 4GG9A 1QW9A 3R0KA 3U7VA 2D0GA 5B7ZA 4JTKA 1LLWA 3VMOA 4OHQA 1QI4A 3BTNA 3TQKA 2HK0A 2ALRA 1OABA 4GC3A 3IUIA 2Q8LA 2CBVA 3SR7A 4AXKA 4FIRA 4OE7A 4GOAA 3EX2A 1BF6A 1O12A 2H9AA 1QPQA 1OGSA 3FHQA 1GOMA 4BWLA 5TAOA 2BHZA 4D6EA 2QAPA 4XAFA 4HU0A 3N18A 1PEZA 4EPBC 3P2VA 3MWCA 3GU2A 2XGIA 4FLQA 2GJXB 1JULA 3LK6A 4R53A 4YTUA 3OYZA 1PIFA 2GVLA 4LTSA 3TQPA 4C7FA 1OGBA 3IIOA 3O6YX 2VEFA 2WWCA 1UUMA 3RCMA 1C90A 2VYOA 3APTA 2BOGX 4X60A 3L67A 3UD6A 1XLHA 5DQPA 4Z2IA 4NI8A 4NY2A 3WQOA 3R89A 2FVLA 5HWNA 2BVWA 5C55A 4NZ4A 2IQDA 4EOUA 4UUIA 4JTRA 5HUPA 2RJGA 3AAMA 3AMCA 5E70A 1J10A 3W07A 1V0MA 4RUBA 4C6JA 4FI4A 1HO4A 3KDOA 1GYNA 1G9HA 1EA0A 3IARA 2PTYA 4EE9A 3N3TA 1VPXA 3SAZA 2QKFA 3NOEA 4FNRA 5F4WA 2XIQA 2Z2AA 2V5DA 3AS1A 3UWVA 4OBSA 5CZSA 3O8AA 3HF3A 3CAVA 4IMAA 4HU8A 1UKSA 2OCZA 2ZX6A 1Q7QA 4RV8A 2H6RA 1DXFA 3NIYA 1LWHA 2PB1A 2PLKA 3PAOA 1GK8A 3EMCA 5DBUA 3VD3A 2ISVA 4LVGA 3W7DA 4X0VA 5AFDA 1K7EA 3EA2A 3FYYA 4E4UA 4Z1YA 2Y70A 3ATZA 4EPDC 3UXKA 3HZ3A 1UD3A 3RPTA 3W6YA 2X09A 2NX3A 5A8GA 1XKYA 1JCNA 1P5BA 4MZ1A 4JQ1A 4QRNA 2DZVA 4CD5A 3Q94A 2P3EA 3NQGA 3ALFA 4A6GA 4Y2WA 5DMLA 1KTCA 2E8ZA 1YXCA 2XH0A 4WKFA 3QV7A 4AWSA 5ABFB 3WD2A 5ABFA 4AD3A 2Q6ZA 1WXJA 1A5CA 1KM0A 4MJMA 1E0UA 3AWOA 2CFFA 1V79A 5AECA 4NSBA 5CPMA 1JFHA 2ZC8A 3QPZA 3CQJA 3BLIA 1O95A 3F4VA 4J3WA 5TQLA 2WMFA 5HAOA 3N19B 4Z1AA 1XCXA 1YX1A 1HKIA 4O19A 4LOCA 1JGMA 4C1NA 3NG3A 1TPC1 3WFZA 3NA8A 4FSAA 3M46A 4QX4A 1K02A 3PTMA 3PG8A 2CKRA 3KW3A 4G1KA 2VX7A 4LBUA 3PSVA 2X1TA 4KFNA 5AC7A 3TR2A 1Q6QA 2GDVA 3AMGA 4AIOA 1GZJA 4HIBA 3CEUA 2XM1A 2ZA3A 2Y5JA 3ZJKA 5B80A 1OBAA 3ITGA 1CENA 1Z9AA 1FUYA 4NX0A 4TVDA 3OTRA 1NWRA 3BK0A 4C60A 2ZZ3A 3P5ZA 1W1B1 2XPKA 3FNDA 4L5ZA 1AODA 4BF9A 4LYQA 3A4AA 1J2WA 3II1A 3G1VA 4XZWA 2WNQA 3YPIA 1EZ2A 3R8GA 2B7NA 2V2CA 4GI6A 4CQAA 5LNRA 2HSAA 1KQYA 3B0UX 3ABQA 1OIMA 3AHTA 4PUUA 2O7SA 2AKZA 1JCJA 4U4MA 3W7RA 3WQWA 3MMWA 2QPUA 5AHIA 1IEXA 2A3EA 2RAGA 2A7RA 4N4PA 3HG3A 3PNZA 4WJEA 3WH6A 1U1UA 1DJGA 3K46A 1P6CA 2DSWA 2NLYA 4UTFA 2ZXDA 4TV6A 2VI0A 3PJXA 1H1YA 3LXBA 4QAWA 4AWUA 3QJAA 3EMZA 2ZA1A 6XIAA 3NXLA 1HL2A 2ZX7A 1M3UA 3CYVA 3WNOA 1OFQA 4JZ5A 3CJPA 1E6PA 4LCQA 2PTWA 3QYSA 1TWWA 3CIXA 4XWUA 4PB3A 4K8GA 1V6WA 3G8RA 2GJNA 1JEZA 3WF0A 1I4NA 4Z2JA 3CL6A 3PSWA 5CC5A 2ZUNA 4ORIA 1B31A 2W62A 4HA0A 2DZTA 2ZXAA 2QNEA 2OZ8A 1B3XA 5CBBA 1JZ8A 4JQAA 3DG6A 2YX0A 3CWHA 7REQB 4K39A 3WDHA 1QOPA 1FQ0A 3UA4A 4NIRA 3UCDA 3P84A 1D3GA 3H12A 4Z17A 1UKOA 2RDWA 2AL2A 4MB5A 1K8ZA 3SCTA 2A4AA 4N6EA 1VYRA 4GYKA 3RPDA 2CESA 4DWDA 1H2JA 1GCYA 4PFHA 3L4UA 4NJKA 3NDYA 2QDDA 3W23A 2WWDA 4NXSA 5M1TA 3FW6A 3WBYA 1JI1A 3N14A 5E9AA 1FX6A 4GUHA 5BMWA 3W00A 5M03A 3UXIA 1KM6A 4RV3A 2Z0IA 1JJKA 2J7BA 1SU5A 1W32A 4XZMX 3VFLA 3SURA 5F1VA 1TPB1 6REQB 2UBPC 2NQ9A 4J35A 4ERGA 2YDQA 1XCWA 3MP3A 4RL3A 1IGWA 3V1HA 3L7RA 4A35A 1W5OA 2WVUA 3LHZA 4PMUA 2PGRA 3TW9A 1ENUA 3N3MA 1RVKA 2X2YA 4U10A 3AIWA 4Q7IA 1E71M 4F66A 4BI6A 3BSMA 3P0WA 1QUMA 3WEOA 2ZZ6A 3KWXA 3Q45A 4Q7BA 3RLUA 3CHFA 4NX5A 1KM4A 3CUHA 4C6CA 3KBVA 5TBOA 4G2DA 2GVEA 1F9CA 3IIXA 3QPEA 3EB2A 3HURA 2NT0A 4EXQA 2NZLA 2PDQA 4HA4A 1JQVA 4I90A 4FO4A 4ZXLA 1HKVA 4DBUA 3AOFA 1MMFA 1RA5A 1CECA 2ZVIA 3TN6A 3H54A 4MF4A 3AZSA 1W3LA 5IRPA 3CUFA 3LCWA 1OF8A 3CIVA 2NSOA 4AEFA 4WJXA 1TO3A 2J7FA 3A3HA 1DE5A 4DUVA 1XSIA 4NJHA 4UCFA 3C2RA 1W5MA 4D6HA 3Q4DA 1RY0A 1ADDA 2GUYA 2TMDA 4P5UA 1FP8A 1KV5A 1PX8A 2PURA 4W84A 4IQDA 4DVOA 4L61A 4O28A 1LOQA 1C3FA 4IQLA 2L5HA 2HNHA 3ITTA 4Q6XA 1Q63A 3TCEA 4DPQA 2GVGA 1HNYA 1YNQA 3SSZA 2X8RA 2EXOA 2QCNA 4H8NA 3B9AA 1S2AA 2F8QA 2OWXA 2YXXA 2ZE3A 3OLEA 5IM51 1UJPA 4N9CA 3EWBX 4V15A 3NCOA 1NH6A 3L2IA 1XUZA 3GKAA 3PTDA 4NYYA 3IGSA 3UZ5A 5LXEA 1FWHC 3W27A 5BROA 3W37A 2FHCA 4S3EA 2D0HA 1OCQA 4PCTA 3WZ0E 4G9PA 2AGKA 1ZTVA 1TV8A 3ZXWA 4W85A 3V1PA 3EXTA 4GXPA 1W3KA 1MUWA 2FDMA 2WC3A 2DVTA 1JAKA 4HKPA 4EF8A 3M0VA 5JUVA 3V5FA 2C79A 2VGIA 2WMIB 1QXLA 4J3SA 1EC8A 1QU4A 2WMIA 4K7YA 4BEUA 3S4TA 3OW1A 4XAYA 3LPFA 3KP0A 1WYIA 2A6NA 4UXDA 5FJPA 3V4BA 3RLGA 1DIDA 3AYTA 4OBRA 4NHVA 1QO2A 3EX4A 3RLHA 3TN5A 5HXMA 5IFPA 4OUEA 1W17A 1G4PA 2PDKA 1QNSA 1LTDA 4QJ1A 4B91A 4WZHA 1A5MC 2W6RA 3KBMA 4RXFA 3G0SA 2X7WA 4KGLA 1MUMA 3BPWA 3UJRA 1ZFJA 3M5ZA 3UWWA 1L0PA 4I5UA 1O68A 5EFFA 2Q3RA 3INPA 3MV11 3AU2A 3NPVA 3H8AA 5I0DA 3NUKA 2AMXA 3FDGA 4J27A 2HXTA 3BMWA 1GONA 4CNUA 1TTPA 1PCKA 5FF7A 3TA6A 1O94A 2GWGA 3WYZA 3ES8A 3H26A 1XH0A 3PZMA 4ZODA 1SUXA 6ENLA 3UYCA 4GCXA 1HIZA 1SFTA 1VFOA 2WMHA 4AW7A 1OG6A 3CB3A 1Q6RA 1KFJA 3ZLHA 3EKZA 3KS5A 1VIZA 3F4WA 1EJTC 3QBUA 1S5VA 4PZVA 3IIPA 1FCQA 4HPXA 5GJMA 2NXGA 5CJNA 3M5XA 1MDLA 2XG9A 3RR1A 1YBQB 2FTYA 1MSSA 3AISA 3L4WA 4LRTA 1T41A 1AJ0A 2YL5A 1WA3A 2J6XA 3OBEA 2FHBA 4H1ZA 1Q4NX 2X05A 5ABEA 3VNJA 7PTDA 1MNZA 3IPWA 4GC4A 3L4YA 2E0PA 2XGZA 3P93A 1WDSA 1LDCA 4HCDA 3SCPA 1JPKA 2EHHA 3BAIA 5LIWX 2WSKA 4UOQA 4OU1A 2ZCGA 2PDFA 1DWHM 1KGWA 4U3CA 3AC0A 1BXNA 1A50A 3QZEA 3EWXA 3QPYA 1YDVA 3W84A 5I78A 1H0GA 3M0MA 5CCZA 3AWNA 3N2XA 5HNNA 3W7KA 2NWSA 3NZQA 1VGAA 3BG5A 4IOTA 4GUFA 4P7RA 2QJNA 4TMBA 2J27A 1PZ2A 5C9ZA 4ERAA 2J13A 2V3DA 4MAVA 1DJNA 1HUVA 4JCLA 4XAPA 4Q4OA 1XDJA 2ASHA 4F0LA 5E9XA 4IM4A 3ECQA 4Y7EA 2WAGA 3PB0A 3AXIA 3UZXA 4CD8A 3ZQ9A 3WK1A 1IR1A 3LPOA 4O57A 4D6DA 5HR7A 3N2TA 3LRKA 1G5AA 4HNNA 3N6HA 1F2JA 3UZZA 1RQEA 1PBGA 1Q6EA 5EA9A 1NFBA 3LM3A 1Q65A 3QSRA 1XYFA 2QIWA 3TAOA 1JYXA 3W22A 1K7FA 4UFLA 1SFLA 4JHOA 3KOZA 3TXZA 1CX9A 4L1XA 1KKRA 4MKNA 2NQHA 4YTTA 1VBHA 2OZ3A 3VC6A 3NO5A 4TIMA 1TCDA 1TTIA 2HJPA 2VEPA 3PBYA 2Q8ZA 1C8VA 5FEXA 2GQ9A 4Q8OA 2NQJA 1S3TC 5EL1A 5C9XA 2ZX8A 2PP3A 2HK1A 4MB1A 3M0XA 1QMLA 4HOZA 3SUVA 1W37A 2REQA 3IVTA 3TTQA 9CGTA 4RXGA 1TTJA 5C9WA 2WZEA 1OFEA 3HFYA 3UR8A 1EDGA 2J7CA 3GXIA 1RJQA 5BOFA 3W6LA 2H8ZA 2P53A 1JCMP 3GG7A 3RFAA 3W86A 3L2LA 1HG3A 3HB9A 2JKEA 3DFQA 3CLWA 2D3NA 3B8TA 1KGXA 4LAMA 5XIMA 4G8TA 3VDBA 3E96A 1LJYA 2VT0A 3AXHA 4GWEA 3WBXA 5CGQA 1CEOA 3LTPA 1KLZA 5EPDA 4DYEA 5HDRA 1I2OA 5A8PA 2ZDSA 1XBYA 3WQVA 1QFEA 1A5LC 4AAJA 2WVSA 2VMFA 3GH5A 2XH2A 3CV6A 4LB4A 3QV9A 1OC6A 3UQNA 3DH7A 3N9KA 1IZCA 2C16A 3M07A 1GVQA 2XVLA 1ITXA 2YCJA 1BFNA 3AMDA 3KOFA 3LCIA 3VIKA 4YN5A 5DANA 3QHOA 5TNVA 4S39A 4QS6A 1DKWA 3VE9A 4KEVA 3NL3A 3TQ0A 1N82A 1AMYA 1J0ZA 2I5GA 5A8OA 3WNMA 1PHWA 5HATA 4RW3A 1OHLA 3VE7A 4I9AA 3C61A 1KRBC 1UC4A 2QMKA 3HPXA 3MVIA 1XRFA 3ALGA 1K4HA 4W86A 3AU6A 3NO1A 1XBVA 3G6MA 3MSGA 4O52A 4QHRA 3M0KA 1PDYA 1HGWA 2VZTA 5I06A 5H2ZA 1E1FA 3TFCA 3QOKA 4DNMA 3HPFA 1CI1A 2DFAA 3APGA 1QNVA 2B0MA 4XBSA 1XW8A 3LU2A 1TELA 4O16A 1I1XA 2DJXA 1JF6A 1F3TA 1Z41A 4GQBA 5CG7A 4UFIA 3KTSA 1ESWA 2EPLX 2YL8A 4QS5A 4CU8A 3B40A 5C54A 3FYPA 1EO7A 4C5YA 5DN1A 2E3ZA 5E0CA 3SUTA 3M0LA 4KQNA 4DJDC 3GAYA 3GR8A 3F2CA 1P48A 1CIUA 4NQ1A 2ZA2A 3SZ8A 4B15A 2ZUWA 4HOWA 4DM2A 1KA9F 2V3FA 3ZR6A 4DZHA 1DXIA 4BY3A 1PTDA 3HV8A 4RE2A 1W1PA 3CTTA 4JTTA 3ZSSA 3TYAA 2QS8A 1JR1A 4DJFD 3GXDA 4KMQA 3EEZA 1R6WA 2GVJA 3ENLA 4JTLA 3UCCA 1VEPA 1FRBA 4PMOA 3TC7A 4YJ5A 4M5PA 1SO6A 1NM9A 4MHBA 2PZ0A 2G3MA 2VC5A 1X8FA 2J24A 3VMNA 5F2LA 2GQ8A 1KBJA 1RR2A 5JIWA 4I8DA 1UWIA 3H22A 2R82A 4OOZA 3WDRA 3V16A 2P5NA 1LQAA 4LF1A 1E3ZA 1MFUA 1XX1A 4R7OA 4HVXA 1TV7A 5AVNA 3N6QA 1S2VA 3UR2A 3MCMA 2ATSA 2FDSA 3LGEA 4C6KA 3H55A 3CUJA 3R8HA 1I8JA 1BTCA 2VDIA 7TAAA 5HMDA 3W53A 2VUYA 3W76A 3ISIX 4KCTA 5HR6A 3MMUA 1E0XA 1GQJA 3T2QA 3HG2A 3I6RA 1EGZA 4FNPA 2GUUA 1GPWA 2Q8XA 1UR1A 2FIQA 3QGAC 4NZ3A 2J9XA 4JS3A 4WJ8A 1JGIA 1TJRA 2YB4A 1VYPX 1PX4A 4R33A 4ZQNA 4AD2A 1XIEA 2DT1A 1EO5A 2YXOA 4TOQA 3WF4A 4WOQA 1H09A 3NVDA 1RJPA 1W2PA 1C8YA 3QTGA 2EPKX 3IAQA 4D8ZA 4AZ7A 2O9RA 4LAKA 2WC7A 4GRSA 2YW4A 1EKOA 3GNNA 2VRKA 3LOTA 5HNUA 4QCEA 4ADSA 4JQ3A 5FI8A 3GTFA 3C2VA 1RALA 5D03A 5DXXA 3V0SA 3L0KA 1DJXA 4YMZA 3T07A 2PZNA 1BXCA 4HSHA 4XQ6A 3G0UA 2ZUTA 3U5UA 2YZRA 4OWGA 3S9IA 3GNXA 3NYZA 4KT2A 3QC0A 3CWOX 5I3IA 1ZLPA 3KBNA 4PBGA 2A3BA 3TSMA 5AC6A 4ZENA 3IIVA 1BXBA 1JAEA 3NZRA 3BAKA 4NAEA 4M6VA 4CEXC 1GQIA 2WMGA 2DUXA 3RHGA 2QV5A 3OZYA 5HQEA 5A5WA 3C86A 1ZALA 5FL1A 1HQTA 3NPWA 2P0IA 3U0HA 2XIMA 1IT0A 3CK5A 4PMNA 5DLCA 6TAAA 1H7WA 3CO4A 3TR9A 3LTYA 1PS9A 1SPQA 3WELA 2WM0A 3MYOA 3K8MA 4M29A 3W70A 1YNPA 3E1F1 4YWSA 1AJZA 2HNEA 3L12A 3FYOA 3ZMRA 3GNPA 2F38A 1REQB 5C7VA 1FY6A 2YDRA 5FSEC 3ZS4A 3UGRA 2VFGA 4PSPA 2JKAA 3RO6A 3DFHA 2VX5A 2BV9A 1A3XA 1H7RA 3K2GA 3MI6A 2PDHA 3L2MA 4A22A 2DSVA 4O15A 1B9ZA 1EEXA 2ZDRA 3PHAA 1GEQA 5G4WA 1IWBA 4M6UA 1OT1A 4O12A 4JYFA 2ALDA 4MLJA 2CERA 3HMJG 3GXTA 1W6TA 3CAWA 1UH2A 2A7PA 2QUNA 2ZX5A 4ROPA 4P7OA 3QKEA 1IR2A 3O1NA 4BJHA 3HBLA 4TX9A 1EDTA 4JIEA 4F8XA 1ZJIA 3SQMA 1BGAA 3A3XA 5M2FX 1W3JA 3LXAA 2Y88A 4NKCA 1B9BA 1NY1A 4LUTB 3GDRA 4L4MA 1JUBA 4Q4PA 3UA3A 1UPPA 3W7OA 1NWUA 3WFLA 3AIVA 1PE1A 4GIEA 3BQ6A 2VR2A 3N04A 1XLCA 2F9RA 4JEJA 4DRSA 4WDTA 5FF0A 1R30A 2PDMA 2EJAA 3J7HA 3M0IA 1YDNA 3SY8A 3KCOA 1CXKA 1UWTA 2BG5A 1TB3A 1EOKA 4C91A 3T42A 4F40A 3MW7A 4AD1A 4DXXA 3RMEA 2V6AA 3TV8A 5A8MA 3BJFA 1LOSA 4P8UA 4UTTA 4HNCA 2B7QA 5A2CA 3GH4A 3F7JA 3JRKA 2A5HA 4JICA 4JY8A 3EOSA 4RNIA 3N2BA 5I3JA 3THQA 4RZ6A 3QEZA 5AY7A 3T4WA 2X16A 2C1GA 1F8IA 1Y5VA 3GDKA 1J0IA 5HK4A 5TD4A 3B05A 3CM4A 1BKSA 2BSLA 1E1EA 4QBXA 4YVPA 2X2GA 1MDRA 2NUYA 3LA4A 3P0XA 5G1YA 3AIUA 5BYWA 3SO7A 1UR3M 4B2DA 4D1IA 4F9JA 1JUKA 3SB0A 6CGTA 5DMMA 3AHXA 1SO4A 4DF2A 4HK6A 4US5A 1FHDA 4JHZA 2EJ1A 3LHUA 1RP9A 1QT1A 2HVMA 3GHTA 4ZQCA 4S3JA 1GOKA 1U1HA 2X30A 1W9UA 1UR9A 2DORA 3KTCA 3VKCA 1W9BM 4EWJA 1TPEA 1RLCL 4FK9A 2CW6A 2ZICA 1H7NA 1JNEA 3I7QA 1X1ZA 3WJXA 4HMNA 4ZOBA 3CU2A 1X38A 3VDAA 4YHEA 4Y8EA 4QIUA 3W1QA 4NNCA 2HZGA 1V6YA 5I79A 4O54A 4AH7A 2O7QA 1G69A 1OZMA 4LBSA 4JTCA 3OQ8A 3ARXA 3OODA 4B5UA 3B8IA 4WKHA 5JBEA 4H7VA 1H0IA 3A4JA 4J7RA 2YCIX 2R24A 4AD0A 1RBOB 1ZENA 3FKKA 3PFMA 3CL8A 4UR9A 2ACRA 4GA8A 3T8LA 4FNSA 2E1DA 3WF3A 1SR0A 4DHGA 3VKJA 3NQBA 1GORA 4A8RA 1P0DA 4XV0A 3VMPA 3SN1A 5HMSA 5BOOA 5E6ZA 1G1YA 4FNQA 1V08A 2WPGA 1ELSA 3GIQA 2WJDA 1MYRA 1TZZA 4RR4A 2QCFA 1DOSA 4B92A 4BR1A 4JKMA 1QWKA 1X6LA 4DY1A 2YBVA 1VP5A 3PR2A 5XIAA 1L6SA 3IRSA 4GQQA 1IEWA 3NM3A 2UY3A 4JDBA 4H8HA 5IOBA 2QV4A 1H7PA 4UOJA 3FV9A 4BKNA 3RIKA 3S6TA 2EGZA 2B4GA 1JDDA 2F6KA 4Z08A 1KXHA 1C9DA 4E2BA 3GW0A 1RQBA 1V8EA 2VWSA 1M03A 2WJFA 3CZLA 5HANA 3GG8A 4RZ4A 3TJXA 1VLWA 3PUGA 4E0CA 1E40A 1ICSA 5IBXC 6A3HA 4IJCA 4JIQA 3ABSA 2BBFA 1T8QA 1G94A 3R25A 2WVTA 3A5FA 3IGXA 2YL9A 1VBRA 1W5NA 4UMAA 3TW6A 1MI3A 3KVLA 4UTLA 4PCNA 1EQPA 3VCCA 1I2PA 4QM1A 2VX6A 1MXGA 4DI8A 4HP5A 4IICA 2CIPA 2YDSA 3KOXA 2I9UA 4JR5A 3ARQA 1KD0A 3FA5A 1US3A 3PZVA 2R94A 1WDPA 2O92A 1TCMA 1V6TA 3IWPA 4NVTA 1UP0A 2G0WA 1UMYA 3VD7A 2W5FA 3IS4A 2ZX9A 2ZZ1A 2QMJA 1ME8A 2CLIA 4H2HA 4DWSD 1ONWA 1XWYA 2ZE0A 5CGMA 1IT8A 4WGXA 1EJSC 1WBHA 3BAJA 3CEPA 4NRRA 1VYSX 3NWRA 3I7SA 1BVZA 3EDJA 3WQPA 1I9CB 4IPPA 1YPXA 3DXIA 1J93A 3MMDA 3CPGA 3STPA 3WD0A 1HW6A 1QWGA 4Q4SA 4JX4A 1EYEA 1TPUA 2OX4A 4GY1A 4ZOAA 1E6XM 2ON3A 1V5XA 1J96A 4NI3A 1E6NA 3TTOA 4ECLA 2YXGA 2PDJA 3BW2A 3NEHA 1CXHA 1E9YB 2RDTA 4EACA 3S5OA 4DAIA 4E4FA 3KCJA 1V3HA 2PRLA 1KCXA 1YADA 3OHMB 2PU0A 4P8WA 2Y8UA 4L64A 4YVVA 2XSXA 4LYKA 2WLZA 5A1AA 3ZJ8A 1WXZA 2YSWA 1DQXA 3U2EA 1QBBA 1A5SA 1QATA 4ACYA 2Z1KA 3KVKA 3UWEA 2OLSA 2PBGA 3WN6A 4B9YA 1H60A 4OJYA 5A2AA 1EQCA 1P0BA 5MKGA 3ELFA 1H41A 2DQXA 3LB0A 2OT1A 2BFGA 4XZ9A 3E3HA 5AN7A 2CPUA 5A6AA 3E0FA 3VNYA 3UFYA 3KRBA 1TMQA 2HEJA 4YS1A 1ZAIA 3RPMA 2MUCA 2XFWA 1OJXA 2GGJA 1Q45A 3KM8A 5H91A 3BLOA 3G2GA 4IGNA 1THFD 4QLJA 3T9PA 3MANA 1UKPA 3SSJA 4PB5A 3JW7A 4UTWC 1EJVC 3WBEA 4MWAD 4WEVX 4LVDA 4K8EA 3PS7A 1E0TA 1NDWA 2CHRA 3B8WA 4P7LA 4LV4A 5D09A 5L9FA 1RBAA 3KRZA 1VBUA 1QI3A 3WK3A 3M0YA 1YIXA 4EANA 4JX5A 4R9XA 4P61A 1WZAA 1XIBA 1W56A 1XPYA 2VHLA 1LP6A 1CB2A 3QZ6A 3WNPA 1BAGA 1FH7A 1CYGA 3WJYA 2XZ7A 1H51A 1P6BA 5BWAA 5JVLA 1LROA 4CU6A 3IJ9A 2I16A 3AYSA 3EPOA 2EG6A 3H2CA 4XTDA 1ZS2A 1R3RA 1H50A 3CO8A 1VAHA 3W26A 3D0CA 4I9JA 2V5KA 4IGHA 2RH9A 4AVFA 1G67A 2CZFA 1AL7A 3LGDA 1XLGA 3RXZA 1TQXA 3DFOA 2EEXA 2PDCA 1JRBA 3GBEA 3T55A 2IKHA 4WLCA 4XKMA 1KBLA 4GE8A 1GGOA 2VOTA 4M6QA 3NYDA 4LNCA 4MAZA 4QSFA 4DYKA 3C6CA 3H53A 1OG0A 2PEVA 3TK7A 3CZEA 3MUIA 3LPPA 2HMCA 5CPNA 4PTMA 1Q7MA 4Q4MA 1SZFA 3DC8A 1IGSA 3TN4A 1XLKA 2J7DA 3U6WA 4E5TA 3W1AA 1FWAC 1HJVA 4IX2A 4IPNB 1XFCA 1CGVA 4NL1A 3USZA 3DHUA 3FIGA 4BFAA 4MB3A 1E4IA 1A49A 2OGYA 3WEZA 1QHPA 1JPDX 3WLRA 1B3WA 2OKTA 1WUEA 1F3XA 3VNIA 5LZLA 1FDJA 4QROA 3TA9A 3BG3A 3A4XA 3M6DA 4D2JA 1J6OA 2YYUA 5IFTA 3RMJA 2BVYA 1BGGA 4OIFA 2CLFA 3IJDA 4AHQA 3H23A 1EUNA 5T8GA 1U5HA 1TWDA 4D8AA 1EFZA 1UYQA 2C18A 1O7AA 1JQXA 1OD8A 4S3KA 1FXPA 2PC4A 4JDYA 1DWFM 2HRWA 1YHTA 3MCOA 1VQTA 5HPCA 3KL5A 3VVGA 3HGJA 4Z2GA 1TA3A 2XGBA 4HHHA 4MDPA 4FX7A 4O1AA 3O15A 3S1GA 2VCCA 3W7EA 5CH9A 3HA1A 4MZYA 1EP3A 4FPSA 3VXGA 4JKKA 1OSEA 4DWSB 3PWAA 2GK1B 1B4EA 4AZGA 3HJEA 3BVJA 1IE7C 4NZJA 2GK1A 3M9YA 4DAFA 1SM9A 3GK0A 4HJFA 3GYEA 3AS2A 3QHMA 4J3UA 1NELA 3UG4A 1UD5A 1L9WA 4HZ8A 1T99A 2VTFA 1EEPA 2YL6A 4CQ8A 1LBFA 4H01A 4GUGA 3BUVA 1J0JA 1ZJHA 2FYMA 1RY8A 2A0NA 4IMDA 2WJEA 3FOKA 4UFHA 1YXYA 4FR1A 4JTJA 3O6CA 3PB2A 3R10A 3NQMA 4QGCA 1PSCA 2FJUB 3E6EA 4BZYA 2R6OA 1L6GA 2RGMA 3NEVA 1A80A 1H4PA 3TZFA 4AUBA 4ZQRA 4LGXA 3H2EA 3HOJA 4EXAA 2FFIA 4QG9A 1XQKA 4ZL1A 3CV1A 1GG0A 3EOLA 1O5KA 2H3DA 3MU7A 1RH9A 1EOMA 3A6OA 3AYRA 2OVLA 3C8FA 1QPNA 1XIIA 4FMVA 5D04C 1UOZA 3FDKA 2PPGA 2BHUA 4R34A 4BWLC 1KR0A 4LAOA 3O0KA 1AMKA 4OKDA 3AICA 4WIWA 2XU2A 2DH3A 2GGIA 3CUGA 1Y8BA 2ZTKA 1B90A 4MWAB 3FS2A 4DNHA 2JK2A 4MWAA 4PMDA 3UNTA 4N9DA 4S2BA 3NZPA 4IMEA 1EX1A 1ZRQA 2PODA 1TJ2A 4KETA 5DBTA 1OYAA 1KRCC 3D46A 4XUYA 2P3ZA 3TLLA 1P6WA 5FJUA 2V3EA 4B16A 2W92A 2PFHA 4JTDA 1FWFC 4ATDA 3QC3A 1WDDA 4IZGA 1NOWA 4Z0JA 3THCA 3O05A 2ZWYA 4M7SA 1UMLA 4C7DA 5C70A 4EX4A 4IFKA 2D2HA 3GVRA 4YWIA 5HNTA 2CBUA 1LL7A 4G7EA 2W4XA 2V8ZA 5D38A 1EP1A 4LEFA 1K03A 1TVLA 2FQIA 1Q6OA 1GHRA 3AJ7A 3M7WA 3QMRA 2Z1VA 1KWGA 5T9CE 1IT7A 1H62A 1EL3A 1E6QM 4U28A 5PTDA 3U5YA 3PNUA 1EWDA 1GTHA 5LHFA 3QQWA 2GOKA 4KKXA 4H9TA 1V93A 2BXZA 5A6LA 4AZ6A 3BLLA 1X98A 4FX6M 3NQVA 3FFSA 2ZRXA 3BW4A 3C4UA 1SVDA 3S2CA 3GZ3A 5AYYA 3G22A 1HL8A 2HISA 3QR1A 6ALDA 3PUOA 1LRTA 4KF1A 3R11A 4QQ3A 2WC4A 1B30A 2XVKA 3GVGA 2PDUA 4DJEC 1BG4A 5GPRA 4JTUA 3IJQA 4QDMA 4ZFMA 2CITA 3CS2A 1UQZA 4GH1A 2O56A 3M44A 2D20A 5AVHA 5F4XA 3SN4A 1OK4A 2OKOA 3GS6A 2V69A 4WK9A 2XM2A 1GZGA 3UJSA 4GGHA 2EPOA 3WLHA 1AG1O 1D3HA 8TIMA 4DIAA 2YCKX 4RDWA 2V30A 1RPXA 3QY7A 4QNWA 4IIHA 3VNZA 3CASA 2PTXA 3DHDA 3LY0A 3BOFA 4KFOA 1J01A 4TTGA 4O1FA 4DBDA 4FLOA 3TUUA 3L5LA 3O7UA 3K1GA 5GNZA 3B0XA 1XI3A 3CV2A 3NNTA 1IIGA 1EJRC 4H8UA 5G1TA 3TTYA 5FKYA 4GD0A 2O0TA 2Y62A 1NFGA 3UESA 4UOZA 3U4AA 2BB0A 4A2RA 4UTIA 4HBKA 4F2BA 2NQLA 2W91A 3CZ8A 2G41A 2IUZA 3B06A 4UFKA 3TN3A 4Z1CA 2DIEA 1DWJM 4WGHA 1FOBA 3G1DA 4XUGA 1LBLA 3FA4A 1YTEA 1U33A 3HPZA 4XD4A 3BGAA 4QLLA 3ARRA 1IQ8A 4LVFA 2FFCA 4OECA 3LN3A 1SO3A 5CZTA 5LNSA 5AC4A 1ODZA 3W2KA 4Y9PA 1L2QA 3ZIZA 3LV6A 3TOPA 4KWUA 3VA8A 3SECA 3W2NA 3CLMA 3S1XA 4PCFA 3GDBA 5B7YA 1X8CA 1FFQA 1RCXB 3TYDA 3CHEA 3DHPA 3DOPA 3SY5A 3WUEA 3C3UA 3UT0A 1U83A 3B3DA 1TMLA 3MJYA 4CQ9A 1IXOA 5CSYA 2W67A 4HMCA 4CN6A 5A6BD 3GYCA 2Z28A 5K9XA 2AMGA 1EP2A 3RU8X 1K8CA 2INFA 4AFYA 3A4WA 4FF5A 2BVTA 4PA8A 2J79A 3SUUA 2O9PA 1L6FA 1LG2A 1FWWA 1YDYA 5U7SA 4K7VA 5E09A 3HQPA 2WSYA 3WD3A 2E7FA 2DZWA 4AC1X 2C0AA 2DSKA 3AXXA 1GEHA 3EZ4A 2DSZA 1VEOA 4TU1A 1M7XA 3WNLA 3KHJA 4MPKA 1GJWA 3I4EA 3VAVA 3SUSA 1EZWA 1AL8A 1S2UA 1GVEA 1IEVA 3ARSA 1JIBA 3PWIA 1NARA 2IQTA 3PZTA 3KUMA 2G95A 3AO0A 3ABOA 4AX7A 1FVPA 4HNTA 4CVWA 3W7CA 4R85A 5JQ9A 4RNJA 3LNPA 3JUGA 1R3TA 1ZCOA 3WF1A 4AMAA 4RE0A 1VHCA 1H1ZA 4V28A 3NR0A 2E6YA 2VO5A 3U3HA 4B4HA 1PKMA 4GK8A 1PKLA 2E9BA 4PSRA 5E5CA 4QXIA 2DZBA 4UTMA 1ISVA 2CXGA 5IHRA 3HU7A 4HZMA 2GSJA 1TRIA 1PAMA 1KFEA 4ZB5A 1OFPA 3WQGA 4IP5A 1JD9A 1EBHA 2BMBA 5SWUA 3EXSA 2ADAA 2E77A 2ZRWA 4PMYA 3NAVA 2HQAA 3GTNA 3PUEA 2JQXA 3W24A 2V67A 4GXWA 3P80A 1E56A 1W0MA 4O8RA 2Y8VA 1YKWA 5FF4A 2NUWA 4K68A 3LLXA 4JEQA 1ONRA 3N29A 1DPMA 3E5BA 3WJSA 4Y9NA 3FSUA 2Z7GA 3SCSA 1NEYA 3A5VA 2QJJA 5LSMA 1PCWA 4CD7A 4OZOA 5LGXA 2X0SA 3QXBA 1OT2A 3FJNA 4F0SA 1XH2A 1OX5A 1RXOB 4PRWA 4Q33A 1XXXA 3STCA 3ITYA 1VD6A 3W7MA 4AZBA 3F4CA 1P43A 2JF6A 1BVWA 1HKWA 3BOLA 1T7LA 2HTMA 4ALDA 4ZTYA 3I3EA 1PDZA 1N8FA 2CNCA 4GQGA 1F74A 4MSSA 1X7IA 3ZSTA 1E15A 1Q8AA 3IAPA 4GI8A 1QI2A 3PZUA 4U2YA 2G8ZA 1V02A 4HHPA 3O63A 1A0CA 3PUDA 3TWBA 1E6ZA 3PF3A 1V0NA 4S38A 2ZRZA 3LHTA 4ORMA 4XZLX 1C7TA 1FWIC 3WK0A 2CU0A 3FCPA 4AIBA 4JYEA 4DBWA 1TIMA 2XIBA 1E4NA 5A6SA 5D8ZA 3BAYA 2C6QA 1JDEA 2C8NA 3GBDA 1EHNA 1KXVA 4GZEA 1XLMA 3L65A 2E6DA 1LORA 1DIKA 2YA0A 3E9AA 1KB3A 4H6QA 3CGTA 4JFTA 2A3LA 1V4YA 2H90A 5M17A 4Q4RA 3T78A 2Y85A 4LSBA 5CC7A 4E8DA 2CYGA 1QK2A 3A13A 1TPDA 1T8XA 3P8IA 2QW5A 5FEWA 1OZQA 5FL0A 3I6EA 1UR4A 4DM1A 4FOJA 3H7RA 4NZFA 1B57A 1A5KC 3AZTA 1U30A 2EBNA 4A3QA 1QNPA 1JI2A 1YTDA 2ZUMA 4NYUA 4YCPA 3FN9A 5A6MA 3L4XA 3A64A 1FWEC 1JD7A 2V5JA 3ITVA 3A21A 4K2SA 4DLMA 3TLQA 1ADOA 5K4XA 1F7BA 2B7PA 2ZBTA 1AW2A 4F0MA 2VL4A 1S1RA 4TX6A 3VILA 4XAGA 2JBMA 2PDPA 3FSTA 4QE5A 4IUGA 3N73A 4ML4A 2TPSA 4IF2A 4S3FA 2QPXA 3TKFA 3LNMA 1H7XA 4K6AA 2X7VA 4RDYA 1E0WA 1EJXC 3B8VA 5C7HA 2GQAA 2WHMA 3L4TA 3HPAA 1GT8A 3R1ZA 1CGUA 4H9MA 3QFEA 3TC6A 1BYAA 5EMJA 2W9MA 4IIBA 3CQIA 2WHKA 4IH3A 5D05A 1LCOA 3SDOA 1WZKA 2Z7KA 4HN8A 2HS8A 1V03A 4W89A 3MUXA 1S3HA 4RCXA 1RZMA 1ZBVA 3BO9A 1QNOA 1NQKA 4M0XA 2O9OA 3H4WA 3IV8A 3VIHA 3S2JA 1FA2A 2VVSA 5CZ0A 3DN5A 3PBGA 4XX6A 2I5QA 2ZUSA 1HX0A 1E1CA 3ARZA 3C0LA 3CWNA 4HNVA 4QFUA 3QTPA 3W7QA 2P1FA 5A6BA 1X7FA 3OB8A 1VFHA 2P10A 4K37A 4K8HA 1AQHA 4C6LA 2XFRA 2QCGA 3QGKC 2PTZA 1PL9A 4IX0A 4S3CA 4X63A 3W7LA 3NL6A 3CL7A 1D9EA 3LZ5A 1FCVA 3DGRA 3URAA 3P61A 1M7JA 4OQVA 2OYKA 2Z29A 4GYJA 3BQ5A 4U3AA 4GNKB 4PYSA 3ZT5A 3RO8A 1UJQA 5REQB 3M47A 4S2CA 3QMSA 3N9RA 2AL1A 3UR7A 3E74A 1XH1A 4IXXA 4WDWA 3IVUA 4TUFA 4WSHA 4XBJA 1A5OC 4A2SA 4GH3A 5C2XA 3BW3A 2I57A 3QR3A 3JZUA 1NDZA 5IHSA 4QDWA 3M0JA 2C71A 2H9AB 2ESCA 1AQMA 3VYLA 1XR2A 2OQYA 3NQ8A 3TJIA 4NAFA 2WYSA 4PCPA 3AFBA 3ARPA 3KAOA 3M7SA 2I5IA 4QLKA 2E5BA 2G5WA 3REQB 4MG4A 1IZJA 2OOGA 2VRQA 2FZ8A 1RA0A 3REQA 3ZO9A 4IPJA 4LEQA 2WSPA 1Z89A 4ATWA 1W31A 4I6KA 5AYIA 3VOFA 2EKCA 4ZSTA 5CLTA 1ISWA 3NGFA 2QCCA 3TZNA 1QHOA 1QJWA 3LQLA 2GLKA 3S0CA 1C92A 3EX3A 3VO0A 3MA8A 4O14A 1W9VA 4E4PA 1A53A 3G1XA 1U1JA 1ITCA 2JE8A 3SI9A 4NJJA 1ZNNA 4DO4A 3AHYA 5JH1A 1UROA 4DJDA 1K9FA 5IXEA 3PANA 3W1MA 3LXCA 1RCOB 3BLKA 1J9YA 3E2SA 4Q8VA 4GHRA 1WO2A 4RPQA 3GQYA 3WL1A 3DI0A 3EWYA 2A3AA 2J66A 1RP8A 3AMKA 4I9MA 1X6UA 2I1OA 1PX3A 4JQ4A 2ZYFA 3S8HA 3PWGA 2QULA 3WF2A 1KM2A 4GISA 3ICJA 4ADTA 1DHPA 3FXYA 1PTAA 3AIRA 1E9IA 1R2RA 1D8CA 4ZVJA 2GQ3A 2KZHA 1M1BA 2DT0A 4DUWA 3LMZA 3GC4A 2Y5SA 3C2YA 1SJCA 3GRIA 1N7KA 1K8YA 3H2FA 4MGGA 1Y5WA 5AB3A 4DYJA 4R5EA 4J1OA 4IQEA 3A12A 2Y24A 4H6RA 1QK0A 4BEQA 1MZHA 4MOZA 2OU4A 3QY6A 2WBGA 5IDIA 3CQKA 3S9YA 5CJ5A 3N6JA 5EY5A 4P8XA 3VM5A 4ZOCA 4Q4QA 5HINA 2H3BA 2DT3A 4DELA 1P0KA 3WJZA 3SM0A 1ZB5A 3UW6A 3LS9A 4ZB2A 4L56A 2WCGA 4AYGA 5D2WA 3G77A 3UXAA 4GMEA 4U33A 4XZHA 2G3NA 3H24A 3HM7A 2JALA 3WEMA 1KV8A 3W2UA 1VENA 4BK9A 5DXYA 1HT6A 4XK2A 4DO5A 4H2CA 1XIDA 1R7AA 3JR2A 3BL3A 1SYTA 4G5DA 2XFYA 3S2LA 1TYGA 1TVNA 4Q8TA 4IPLA 3VPLA 2WXDM 1QNRA 5CBJA 3AHVA 5D33A 4C1NB 4AY8A 4GUIA 4L6OA 1MEIA 2YJQA 3LHYA 3RCNA 2VURA 3OP2A 4HN4A 2OMAA 1UD6A 4PODA 2BY2A 4RKAA 4O0QA 3MV01 3T4CA 2OFJA 2VC9A 1NP2A 3TYEA 1ISZA 3NVTA 5I6SA 3UG5A 3RX4A 1EXPA 3STGA 3E2RA 2V0TA 3MJMA 3G18A 4HPHA 3O6DA 1R3QA 3MUZ1 3WY1A 1W1TA 5LYRA 1EGVA 3W7GA 2YKKA 4UTJA 4M51A 2Y6ZA 3UETA 6XIMA 1OINA 3MTWA 4PR4A 4Q6JA 2YBUA 1HJWA 4RPPA 2FZNA 5D2TA 4XKYA 5IDZA 5MHBA 2W79A 5BOEA 5HNRA 5I3DA 2NLIA 3GXMA 3V3WA 1DTUA 4W7VA 2BGQA 5DY3A 1ME9A 1H11A 5BNKA 4JXCA 4GYPC 4PEKA 3MBDA 4GZIA 3VOIA 3O07A 1XSJA 1ZAJA 4HOXA 1AH0A 2QPSA 4HHLA 4LXFA 2GDUA 4PCSA 3B9DA 4JNMA 4W88A 1R3SA 8XIAA 3KVMA 5HA7A 4UNLA 2GVYA 3U2CA 1ZCCA 3NQDA 1MXDA 9XIAA 4PBFA 2O9TA 2CBIA 1NTHA 2NX9A 3F2DA 1Z8AA 2ATMA 2D73A 4B5SA 5JBFA 8XIMA 3R94A 4H9YA 2R8WA 3R7MA 3OGSA 2HBXA 1GVFA 3M41A 4IP4A 4QEHA 1BYBA 5CPQA 3HTWA 2VXNA 2WNWA 1PYFA 4GZJA 1KFKA 2OSWA 2GOUA 1EWEA 3NO3A 3LCFA 1FXQA 1B54A 1A5BA 4H83A 3H2NA 3W25A 1UW9A 2FGBA 3EAUA 3GLCA 3HPSA 2AAAA 1QW7A 4GVFA 3ATYA 1C91A 4Z2KA 2CHNA 4GQRA 1S1PA 4X2PA 1LZOA 3MYPA 2CKSA 4P8VA 1GOXA 3GE7A 5HULA 5CQ1A 4GYFA 4E3VA 1SSGA 2AL2B 4LANA 3D5HA 2GDQA 4PC8A 2WZMA 1ZL1A 1J6PA 2J8TA 2PA6A 3IANA 5F2MA 4AY1A 5DY2A 1YTKA 3ARVA 1WX0A 3BCDA 2IXUA 4LB3A 1YQ2A 4JIHA 2ZFAA 4HK7A 1VF8A 3MP4A 3AS0A 4INFA 3QGVA 1V7AA 1V3JA 1K9EA 2PWHA 5AHFA 4CEUC 4UTUA 2Y63A 2Y7GA 3EPNA 3VGDA 4DB7A 1NF0A 2DVXA 4HA1A 1PWMA 3GHRA 4QTGA 5AYZA 1GNXA 1V6UA 1RAKA 3WFAA 3E0IA 1G7UA 1QOQA 1A0EA 2ODOA 5ECVA 3CV7A 1RV8A 4ZO8A 4F79A 3ARYA 2VM8A 4B5TA 4X22A 1QW8A 5LNVA 4GNJA 1H49A 1F6YA 1N8WA 5HOSA 4RX0A 3NL5A 1UZDA 1HJUA 1MQQA 2PDBA 1R2TA 3W87A 3EYPA 1BF2A 4UFJA 1D8WA 1X39A 2OEJA 1EA9C 1QPRA 3KCLA 4AIEA 3GXPA 1L6WA 3DYPA 4AG0A 1LWJA 4W4QA 4RLIA 1DWGM 5AYXA 4LUIA 1WKEA 2CZEA 3RU6A 4LC6A 3GUGA 7CGTA 4IL0A 3U48A 4C1LA 2PDWA 1S2TA 5JU6A 3LMYA 2WVVA 3CAKA 4CLMA 1R8LA 3GVQA 4KEMA 2YB1A 3B97A 3MO7A 1MWOA 3DFPA 1CGTA 3RM8A 4YU1A 1W9DM 3S83A 1MZRA 2ACQA 3KZSA 5EBAA 4L9XA 4S1FA 1H63A 2GJRA 4UNIA 3EOUA 3SCWA 1UD8A 3VDHA 4TTUA 2J47A 3GU9A 2DV0A 3LBMA 3NQAA 2XVGA 2NV9A 5D2YA 4PN2A 3B03A 3B8DA 3R0DA 4BS0A 2EF9A 4AZIA 1TZ9A 3WUFA 4M19A 4U5KA 3NPUA 1LUCA 2CXEA 4ZE4A 4GQ0A 3VD4A 1JPIA 1F4AA 4W7UA 4O0KA 1XLDA 3I4KA 4ZXOA 3CH0A 4AZCA 3OVGA 3SBFA 1GOWA 1S5TA 4P7NA 4N0RA 3GKFA 4QNEA 3CZGA 1BQCA 4IT1A 2OO0A 4Q8PA 2PWVA 2PAJA 1JZ5A 5DT5A 2JGYA 4GO9A 1H3GA 5KZDA 4MWAE 4O1EA 2DT2A 1A5AA 3W7PA 4CNOA 1Q2RA 4HTYA 1TMHA 4D6GA 4QG8A 4W8BA 3WLPA 1S5MA 2NV2A 5JBDA 4R27A 1KBIA 2OPJA 4UQEA 1PB0A 2QYGA 1CWYA 4XO6A 3VGBA 3M16A 4NZ5A 4YNGA 3RYSA 3R4IA 2XN0A 4NF7A 4B3LA 3W7IA 4RJEA 1EH9A 1EF3A 3C0JA 3DBPA 2ZC1A 4GLEA 4GJJA 4LF2A 1WXYA 4GY0A 4RK8A 1KW1A 4FHAA 2RHGA 4DBSA 2J88A 3W1NA 3CUZA 3OZPA 4IPIA 3T40A 1ZHAA 2P0OA 3OGVA 1ML1A 1ALDA 3TH6A 5IBXA 2PUZA 5I23A 2O4QA 2J4GA 1GTEA 2H8XA 4LYPA 4DJFC 1VFTA 3BAXA 8CGTA 2OEMA 1F61A 4OFCA 4FOKA 4EF9A 4IJBA 3RILA 3P5YA 1E3XA 4GUJA 2DGAA 3C2OA 5K9DA 3M5YA 2AGTA 2VZVA 3QN3A 4MY1A 3LENA 2DUAA 1ZBKA 4DZ5A 1XIFA 4YTSA 1RLDA 4GCAA 1TSIA 2YZ5A 4KBXA 3KBJA 2QJGA 1RUSA 2P88A 2E09A 3KL0A 5L6UA 5ABTA 1R3VA 4H9ZA 2PDXA 3NPXA 4YTRA 3W01A 3H2AA 4W93A 2V3GA 3CUXA 1Q8JA 1EC7A 5CPLA 5LKYA 2ZXBA 3F5JA 1KCKA 5FSDC 1OCNA 5H8PA 1K4GA 1Q66A 1ZUAX 1NF7A 4A3YA 1B4KA 3V7PA 3KLKA 4C6BA 2WJZA 3NZ1A 2OZTA 1WB0A 1XKJA 2FGLA 3GXNA 1SZRA 4FLSA 4PE8A 1RSCA 2YA1A 2FB3A 2GJPA 4P2VA 8RUCA 3OIHA 3FJ4A 3I7RA 3U4FA 1GW9A 3R5EA 2QJIA 1W1YA 3BV4A 3DEQA 1R0MA 2OEKA 2QCLA 2SFPA 1YW1A 2YPIA 3MS8A 7ODCA 2WV8A 2YLLA 3KOWA 4AXNA 1JVNA 1FDZA 3KLLA 4CU7A 4FALA 4CQCA 2WO5A 1A5NC 1DXEA 4AISA 2QDGA 1DE6A 4G7FA 1FHLA 3G1SA 4I3GA 2QEZA 3WQDA 3BCFA 5CAKA 1ZAHA 3NJ3A 1GJUA 4ZO9A 3CC1A 2QIIA 2VX4A 5EMMA 5T91A 2CBJA 3TAKA 4OT7A 1F3EA 5A69A 4CQDA 2JGQA 1TR9A 4R9OA 1Q7ZA 1RK6A 1C8QA 1VBJA 4V27A 1JFXA 4DO6A 5DT7A 3G1FA 3W7HA 3WQ5A 2VVNA 3KE0A 2QGHA 4V33A 5I3FA 3SW6A 5D9OA 2RJHA 4AF0A 5C71A 3W28A 1FKXA 3CH9A 4ICCX 3WQ6A 1LWIA 1D7KA 5BXTA 3THDA 4CN4A 1XHGA 4KRTA 3WUGA 2E68A 1B1YA 2V5BA 3IVSA 4O53A 4MY9A 2PMQA 4DEFA 1BTMA 4B3KA 1XDMA 4I5XA 4WKAA 3AMLA 1HJSA 3D47A 3KTXA 4UQ9A 3S2MA 3U2ZA 4XZIA 3N25A 5DCDA 1UQYA 2BY3A 3WL0A 2P76A 2QAFA 3CYJA 3DI1A 4H7CA 4ICNA 4N7QA 1XBXA 2KAUC 2NQZA 5EKYA 2G37A 1NSJA 1M65A 2BXYA 2F6UA 4KIRA 2GFTA 1XLLA 3SIMA 1UIPA 4BCEA 2OODA 4I7UA 3WSUA 2VGGA 1XLJA 2HCVA 2REQB 2VZUA 3BLPX 1XYMA 1UC5A 1PUDA 5D9MA 4ACZB 3N1AA 3WH7A 1CXEA 3M64A 2Q71A 3ARUA 1WV2A 4GZ7A 3W88A 4ACZA 5G2IA 3N4AA 4W5UA 4FX8A 1J79A 3BOXA 4GXMA 5CZKA 4UC5A 4LW7A 3GX9A 2QVHA 1FFRA 1XIMA 3R2GA 5A6JA 5D2XA 4DX3A 5CAHA 1M5WA 1IZKA 1W54A 1GYMA 3LCHA 4XVDA 2YFOA 4J9JA 1NWSA 1C93A 3T44A 1NWTA 3GXFA 4HMEA 3L4VA 2HWGA 4EAYA 2E9LA 4KRZA 1CNVA 4TVCA 1WP6A 1E43A 1R9YA 2Y8KA 1GQNA 5CZJA 3WQ4A 2PF0A 3PTKA 4IGMA 3Q58A 2VQUA 3VKKA 1R87A 1GJPA 2VJXA 3FGCA 1UIOA 2PLMA 2VWTA 3LRLA 4BHYA 3CMGA 3LCLA 3PVFA 4GI9A 1K9DA 4CCCA 2DUZA 2G3IA 3WMCA 3WDPP 3DBNA 1E4LA 3QSTA 2R1PA 2V82A 3MUY1 4GNVA 2B31A 5K2ZA 1XLAA 1W9XA 1TKKA 2DZAA 4CKQA 4PUKA 2A3HA 3GFXA 3CXOA 4Q32A 1RJRA 1QO5A 4J3XA 2UZ9A 2WCSA 3PZQA 5EYWA 4M3PA 5LXXA 1OD0A 3H2MA 4MUPA 2WW5A 4QG6A 4B9ZA 1K70A 3A9BA 1TUFA 3ARTA 5KETA 1OWQA 2PWFA 1VEMA 3NOYA 4O4VA 4LS2A 4LUJA 5BCAA 1XYZA 4M1BA 4L65A 1ZBCA 1OF6A 1O1ZA 1KFLA 3TIMA 3RGTA 2VZOA 3V18A 4MYAA 3W6MA 2DW7A 5G4EA 3R43A 2QLYA 1OM0A 1XDLA 1PIGA 3VIMA 3RLVA 4DUXA 4ILSA 4LBRA 2XTKA 1WCGA 1SMDA 3G8EA 1XISA 3SQLA 5JMUA 5I3KA 1Q5MA 1ZBWA 4DF1A 1XIJA 1DYSA 4ZSUA 5D8WA 1Z44A 1OVDA 2J8GA 3TX9A 1PHQA 3WQFA 1JDAA 3ONBA 4UB9A 4ATLA 3KS6A 4YXGA 3BGGA 1F8MA 2V38A 1QHZA 4N2YA 2Y4SA 3NTYA 2NUXA 1TREA 4JTEA 5EFDA 1AW5A 4PTWA 4B2DD 3QVQA 2QXWA 3P74A 4EP8C 2CWNA 3PZ9A 3AALA 4UR7A 1XQLA 1O1HA 1AZ2A 1IIHA 1RD5A 1YDOA 3WNNA 5U4NA 4A3RA 4Y6GA 4US5D 1I6NA 1XLBA 4C7GA 4AD5A 4PUNA 3TU9A 3VDGA 3ZFHA 2Y2WA 1OY0A 3E49A 3VIJA 4AZHA 3ANUA 5H8MA 5HBFA 4REQB 5BRQA 3STEA 1G4SA 4MFEA 4H41A 1KRAC 3T2PA 5K9CA 4REQA 1BYDA 3UWUA 3T0DA 1BWKA 2P8BA 2QR6A 4S23A 3SRFA 2ZOXA 4BI5A 3KXQA 1J18A 1KBBA 1UWUA 2ISSA 1KBKA 3W0KA 3FAXA 4KCUA 3OBAA 4KH2A 4MKSA 3RJXA 4WR3A 2GPTA 5BU6A 3B0PA 5C0QA 1UKTA 2AQVA 2NXHA 3H7UA 3DU0A 3ES7A 1XGEA 5GNYA 3EXRA 3N12A 1TJ0A 1SJDA 3NSNA 5G5IA 3R79A 4Y90A 2Z6JA 4LUYA 2GJXA 4MB4A 1L2UA 3BV7A 3LTSA 4F3HA 1VCVA 3W2JA 3VD5A 3P67A 3GDTA 2ISFA 4NNAA 5KSWA 4HU4A 1EPXA 1ECEA 1L8PA 3CT7A 4C6DA 3VGFA 3TEVA 3LV5A 1DJHA 3VZXA 2PWGA 4PTVA 2BGNE 5M5DA 3IEBA 2XSBA 1J11A 1R38A 2PDYA 1LRNA 2BGSA 4F9DA 1HZYA 2VUNA 4H3DA 1ZQ5A 5DCBA 1TZ7A 1GVSA 1ZU8A 1K6AA 1YE6A 4C6FA 5D9PA 2OSXA 4IMCA 1JF5A 1VFLA 1CLVA 3P81A 2QDHA 4O11A 1OFRA 3VX1A 1GVIA 4JN7A 3EGJA 4FR6A 2NXIA 4XISA 3E0WA 4NAEB 1ZJAA 3UWQA 2Z2UA 3CPUA 2OT0A 1V0LA 1U5JA 3UJFA 1DWAM 3GD6A 1VIWA 3QKZA 1DEDA 2ZQ0A 3VDCA 3TOYA 4HPNA 3OEXA 1KR1A 4GINA 4NNBA 3UJ2A 5K7JA 4EKJA 1GPFA 3RRXA 4BA0A 1J2BA 4NZ1A 3GIPA 3WCZA 3UWZA 1D7FA 4L6HA 4DWSC 2D2GA 2PGFA 4QITA 3FXGA 2VR5A 4B4FA 3B8UA 1XRVA 5AYBA 4EAMA 2ANUA 3AUJA 5BRPA 3SY1A 2HV5A 4K3ZA 2PDGA 1KM5A 3VGGA 3MKKA 4RNHA 7TIMA 3E5PA 2AQOA 1POJA 1YYAA 1Q6DA 1NDYA 5H8UA 2HROA 1AW1A 4DJEA 3NSXA 1B3ZA 4DN1A 1B2YA 3V0UA 4GJIA 3TC3A 3B9OA 1TV2A 3E2VA 4GIYA 1XPGA 4ZTXA 4KRUA 3TWAA 4WCJA 5HMEA 2ZXQA 4GBDA 4HQVA 4QJ4B 3S1VA 4FS9A 4GGBA 1FKWA 2LLEA 3O0FA 2DJLA 1JG9A 1KTBA 3GNOA 2RDUA 3UVIA 3DX5A 3K30A 1LL6A 1JPMA 1NOFA 1UASA 3C56A 1FWRA 1O6IA 3Q37A 1AUSL 2W66A 1WAUA 3KBWA 1J12A 1S39A 4QR6A 4FXFA 5CSSA 1X96A 3UXLA 1CDGA 5LHEA 3OHIA 4YVXA 4Q22A 1HP5A 4PUEA 1DV7A 3OZMA 4MY8A 5CSUA 1GG1A 2HE5A 2OXNA 3A24A 4DQWA 5C9UA 1IXQA 3L21A 3ZVIA 1MNSA 2QGYA 3KEHA 4IHCA 4AX6A 3BAWA 1YEYA 3C3NA 1VS1A 3S47A 2AOSA 2ZVRA 1WNOA 1TIWA 1F3WA 3PK7A 2DIJA 2VCAA 4MWAC 2J78A 4GVHA 5BXSA 1W1ZA 3K4AA 4UZSA 2ZZ4A 2WMKA 1WPCA 1I2NA 2OJPA 1ECQA 3SQSA 3WLNA 3TJ4A 3ZYZA 3IGHX 3P8JA 3ZZ1A 3LSCA 5I09A 3QH2A 1A5UA 2Y7DA 3OO2A 1IF2A 3MDUA 1W3HA 2G3FA 3DHFA 3C2EA 3DFNA 1GUVA 2FJKA 1W91A 1XL9A 3KWSA 2VNCA 3N34A 1E9ZB 1B3YA 1GKRA 4ES4A 1TFVA 5KZ6A 2OYLA 1W8GA 1N2VA 4GO8A 2PLCA 3B9EA 4IIGA 4AWTA 2Z26A 2X1UA 3BC9A 2DSUA 1SJBA 3W7JA 3LX9A 4MPQA 3DG7A 3RK8A 2DW6A 1A4MA 1EIXA 3VU2A 3XISA 5FJTA 5CSRA 2WANA 3PJUA 1EYWA 4IGSA 1X1OA 4Y9OA 1O60A 3MZ2A 4HYRA 3W72A 2JFEX 3K4WA 1K1DA 3GFYA 4C6EA 1TE6A 5I24A 1W9PA 4X2RA 4XO7A 1G7VA 3SJNA 4XAZA 3QV6A 3AHZA 2IKJA 2TODA 3C8NA 1V3MA 3HGRA 3GW3A 3WLJA 4XD6A 2E1WA 1TVPA 2CWXA 4WY0B 4W5ZA 4MJZA 4L6DA 4L4PA 1R85A 4LRSA 4WY0A 5BXRA 3T08A 1QRQA 2ZUUA 4HGXA 3V5CA 2QHAA 1XGZA 5G2WA 4JN6A 4ML9A 1FBAA 4H6KA 4J3VA 1XLIA 4PMQA 4MNKA 5LGZA 1LG1A 3V75A 1KTNA 5FEZA 7REQA 3E0LA 2XIJA 4H04A 7XIMA 1ITUA 3JS3A 5HMFA 2HDJA 5CC3A 3PBUA 3F5KA 2I17A 2FHFA 4ZO6A 4N6FA 3MSRA 4CVUA 3DESA 1GQKA 2OTDA 1SW7A 3W75A 2XISA 3EDDA 4Z2LA 1E0VA 1OX4B 3OOQA 3N11A 2FMNA 1G0CA 1OX4A 2PP1A 5BRBA 3UCQA 1UZHA 3FKRA 4D6IA 2ZUVA 1CGYA 3T0BA 2ZRUA 4IISA 1YE4A 3IACA 2PU1A 2VFHA 1C7SA 3MB9A 4UQAA 3L0NA 3WIJA 1QPOA 6REQA 2PCEA 4WF7A 1QTWA 4HZ6A 4CNPA 3EWWA 3TCSA 1UBSA 3QW3A 1ME7A 4EWND 5T26A 4LCSA 1US0A 2Z24A 1UUQA 3UF9A 1SO5A 1OCJA 1HKKA 2VOMA 3WH8A 5LIXX 2A85A 1K3UA 2ZKMX 2VELA 1TV3A 3QR0A 1GVRA 1UH4A 5AHMA 2WSRA 3SEPA 2YDAA 1PZ1A 3F4DA 4L9ZA 3G3DA 1H61A 2BHYA 1G01A 1RVGA 2NVDA 4PUMA 1CXIA 3KHDA 1K9TA 4RW5A 2WKGA 3O9NA 2D24A 1HFBA 5C8BB 2QDEA 3RG6A 3MY9A 2CZ5A 2BX7A 3H4GA 2ZWZA 4HJWA 3AROA 3GH7A 9XIMA 1ZPTA 2X0YA 4S3GA 1KFWA 1QI0A 3OVPA 1R2SA 2ABBA 4JL1A 1W8SA 5LIUX 1Q3NA 4YLWA 3BSHA 1KWKA 1AD1A 4JCMA 3R13A 1E4MM 3SGUA 3NQ2A 3USBA 5EB8A 3PPHA 2IKIA 3MI3A 3I3BA 4AMCA 4CGTA 2CLOA 5CLWA 3O2LA 4NUWA 3RF9A 1Y65A 1QOXA 3M0HA 3TYZA 2PTDA 3VIIA 4E38A 1AH4A 3G0XA 2C14A 3KZPA 3BSGA 3IJIA 3P60A 4NILA 1J0YA 2F2KA 3KP1A 2Y7EA 2D22A 1FHVA 4C6PA 1W1A1 4DPPA 3BMXA 2YCEA 4F4RA 3OVRA 3FVDA 1UWRA 4XSMA 3NURA 2XIOA 4JY9A 4UMCA 2DZSA 3F2BA 3FEQA 2HS6A 1VRDA 1OQFA 4ROQA 3GG1A 5F1UA 3M43A 3L9CA 3MT1A 4IG2B 1JZ6A 4LX4A 5E0KA 2R1MA 4IG2A 5A3HA 1JNDA 1XICA 3UZYA 5DFAA 3DKLA 1XYCA 2OYMA 1VFMA 3IV3A 2DPEA 3AIBA 5MKGB 1SZGA 3NDZA 4IIEA 2BNJA 5D9NA 1JRCA 2VEKA 1YMYA 1ZZMA 2DZPA 3M0ZA 4ZR8A 4HB7A 5I3GA 4X9YA 2J74A 1OFBA 3HG4A 3O06A 1WZLA 4L1GA 1TPFA 1VCGA 3VFCA 2A2IA 3UY7A 5C5YA 1WQ5A 3CPRA 2IPFA 4JFSA 1F05A 1KFCA 2CHOA 1EBGA 1VFSA 3CMFA 3HMCA 3HFTA 5CGTA 1V6XA 4LAZA 1Z6KA 2PWEA 4LYRA 3VTRA 4F2UA 3VNDA 4L1WA 4O1DA 3TMQA 1LT8A 2Q01A 1WAWA 5AHEA 4WY0F 1LQ2A 3NXFA 2CCRA 2PDLA 3FJLA 1CGXA 1XJBA 3W81A 3AUOA 2X1IA 3ITOA 2BOFX 1J8VA 4PMVA 1DL3A 3URBA 4GIRA 4OBTA 4AEEA 3SFWA 3H6OA 3DDMA 4N9BA 4P7QA 3SRHA 3LHWA 4BQ2A 4KWWA 4AB4A 1F73A 2E5CA 1SW0A 1UA3A 3T7VA 3UNDA 2X42A 1VPQA 3JU2A 2PBOA 3S5NA 4LJ3A 3VOJA 2AKMA 3NL2A 5DX7A 2RFGA 1NAL1 4LFYA 2JIEA 3UEQA 3ZLFA 4B5NA 8A3HA 1JYWA 3W02A 1YBQA 2XZ9A 3U9IA 4FNUA 4N02A 1KC7A 2J7EA 3R12A 3RCYA 3SUWA 5DF0A 3SIZA 1EX5A 2GJLA 2BWGA 5DO8A 4KEUA 4PUJA 4HNOA 5JXQA 3PC0A 1PO9A 1XYBA 2OLAA 4HHMA 1YNYA 4MDOA 1CXFA 4JIRA 2XSAA 1M7OA 4DZAA 1BKHA 2D3LA 5ENLA 1XV8A 1E9LA 1JL8A 3DC0A 3NQ6A 2F84A 1S38A 3T6CA 2A1YA 4QEEA 4J2MA 2PCQA 4AD4A 2E4TA 4LCRA 2E67A 2PC8A 2FH8A 3SADA 5D37A 2NVCA 4A21A 2Z1SA 1VB9A 4WUIA 4CQBA 1UG6A 2DZXA 4Q8WA 1RCQA 3GNRA 5J04A 1R46A 2FH6A 1AFSA 1OIFA 3RX2A 5M3WA 1GZ1A 3UWYA 2Y1HA 5K4ZA 4H8VA 3OVQA 1POKA 1JYNA 4XBKA 3URQA 2DQWA 5BMXA 2QVNA 3TYCA 3JZEA 4O13A 1MW2A 1BWVA 1DP0A 3ORWA 4UQDA 3T8QA 2HXUA 2R1NA 5FJIA 3LSBA 1PXGA 1FWBC 2OELA 4XD3A 2WHJA 4TXEA 1PV8A 3H21A 4JD4A 5EMKA 4OV4A 2VEIA 1R86A 1MW1A 1SQ7A 5LA0A 2OOFA 4ZZ9A 1UCWA 4FEZA 4H4IA 5J5DA 1TA3B 3S2NA 1MRQA 3EWZA 2FZDA 3TJLA 1E70M 2ACSA 3UP8A 1VBGA 3NQEA 1SFJA 4RE4A 3EWUA 5BW6A 2V2HA 1XYAA 3A23A 3T0TA 2CETA 4AVNA 4JIIX 4OV9A 2IKGA 3DYMA 2AAMA 4IIFA 5BU9A 2E25A 3CHVA 1WKYA 3HGSA 1MEHA 1J5SA 5JH2A 1RPKA 4TVUA 1MEWA 3IK4A 5XINA 5BWFA 3BWWA 1LT7A 3RUBL 4LPCA 2PGWA 4C6IA 3Q67A 5A95A 2O4MA 2VZSA 2HPIA 1CB7B 2PD5A 2GGEA 1ICQA 4JKLA 1SFSA 2BVDA 2BODX 4GFIA 3TFXA 1UUOA 1NOUA 2WHLA 3QQ1A 1TQJA 3KRUA 4PMXA 4XTIA 3P82A 4NJGA 4D72A 5KINA 2X40A 1OFDA 2DU2A 1M7PA 4Q7NA 3C52A 1R47A 3GU1A 3N15A 2Z2BA 3MUAA 1X97A 3P14A 4NJIA 4F48A 1CPUA 3B0YA 3QLLA 3EOEA 4UCGA 3UJEA 1XIHA 5C2GA 3MKVA 2JKPA 1U22A 4TQTA 1IWPA 2QJHA 1TV4A 2PI6A 2PP0A 2WKLA 4A05A 3DECA 2I56A 5K3VA 3EWCA 5A2BA 1BRLB 1DVJA 1W5QA 1BRLA 4MNLA 4L4LA 2Z27A 2WOQA 1XC4A 2HVNA 1E51A 1IWAA 4D9PA 3L66A 4IUOA 5CEWA 3EA1A 4UQCA 3BH4A 7A3HA 1N8IA 1LBMA 4QISA 3I3DA 3WDJA 1P0EA 3D6NA 3NDOA 3VOCA 2IMRA 3ARWA 1R7OA 4X0NA 3CZKA 3WH5A 1TX0A 2BY0A 2W3ZA 4RZBA 5HPOA 2OLHA 4PULA 4ZQOA 3P3BA 1BHGA 2NW0A 3ZJ6A 2QF7A 2W27A 2TSYA 2A79A 2CEQA 3WMLA 3VZYA 3C0SA 5DCEA 2G3JA 3CMJA 4WDXA 4ZA0A 1VJZA 1JXJA 1SMAA 3EB4A 1M04A 3SJ3A 1DQWA 1DQUA 2PGEA 1ISYA 3CBWA 2VD9A 3RNDA 4DI9A 5AOUA 3GR7A 4E2DA 2B81A 3AIQA 2HBVA 1CTNA 4GYPA 1R3YA 4IFOA 3SRKA 2A21A 1J5TA 2PWUA 4IFKB 2PD9A 3VKAA 4G7EB 3IUHA 3MWAA 4AVOA 4HPJA 3ANVA 2BP1A 2VEMA 4LS1A 2YCLB 3RM4A 3UYIA 2YCLA 3L4ZA 3ZOAA 3K8KA 1H7OA 3AI0A 4RDVA 2BS9A 4S3AA 3OLDA 3M5VA 4MJ4A 5DELA 5D4YA 2PE4A 3IJ6A 3TONA 3V5OA 1DJIA 2BTMA 4C6QA 3CIWA 4IL2A 1ONEA 1KO0A 4GFSA 1BPLB 1B5TA 1CZ1A 1YRRA 3WG6A 1QASA 1BQGA 4M82A 5GJNA 5DMYA 5EMUA 2Q3OA 1UWSA 3W1PA 2DY3A 1OGGA 1TTQA 4KERA 1EXBA 1BVNP 1UR2A 2ZRYA 4Y9AA 2E6AA 4L9YA 1SJAA 3SGZA 2VFDA 4CCZA 2R9RA 3UZJA 3DERA 4EPKA 3URNA 3DG3A 2F61A 1TR1A 4Q3MA 4QE1A 4HK5A 4YCOA 4PUWA 4NT0A 3W73A 5E6YA 1EGMA 3VKBA 2VQTA 2W0UA 4JTIA 5AZ1A 3OYXA 2V63A 5C6MA 5CBIA 2XN2A 3ZJ7A 3AQUA 4Z1DA 1QI5A 3DCPA 3KL3A 1OYCA 4H7ZA 3ZWSA 2GUBA 5CJMA 3D3AA 1JDFA 4KGJA 2VEGA 1S5WA 5BZAA 5AKQA 4JIPA 4XIAA 3MSDA 4CNSA 2VRJA 2BOEX 2JEQA 4OTKA 2V5CA 4MZ8A 5C9RA 4J2PA 4IMGA 4YYFA 4FF7A 5AC8A 1HKMA 3EDEA 5LNUA 1HN1A 3ANYA 4FAMA 3V36A 3V35A 3GDMA 1HF6A 1L6YA 1SZNA 3OA3A 1AD4A 1YPIA 5FF2A 2ZTJA 1T0OA 4IQJA 1A0DA 1QAPA 3T0CA 3PFRA 4YTQA 4LWWA 1FWTA 1I0BA 2F6XA 2JEPA 4L7ZA 2IW0A 3EKLA 3VNMA 3HJZA 4NP7A 4RE3A 2EPNA 1CLXA 3S1WA 4ZE5A 4LY8A 3GVVA 2ZRVA 2POTA 2E8YA 3GR4A 1EB3A 3AJXA 5LA2A 4WVXA 1DIOA 2Z6IA 1BWLA 1KCLA 2PF8A 4WSKA 3PBMA 1QNQA 4I9TA 2EO7A 4W8LA 4J4KA 2PRHA 4CCDA 1TRDA 5D2VA 3WBWA 1M53A 2OWCA 1KCZA 5C2CA 3LPGA 2J7HA 4XSLA 3LM7A 2WQDA 4HU3A 4QP0A 4TR9A 1EF2A 3S6DA 4C90A 5GQBA 1CCWB 2NV1A 4LT9A 3EPMA 1REQA 4UWMA 2WM1A 3O3RA 4GI4A 3ZR4A 2V2DA 2QCMA 1SZEA 1E55A 2X1RA 2YA2A 3DFSA 2FPYA 1RK5A 4O17A 6TIMA 3LCGA 4B5WA 4WQ6A 4O4WA 4KFPA 4XZBA 1M68A 3LDVA 2Y5EA 2TAAA 1FCUA 1TE1A 4D6JA 3CQHA 3ABRA 3VI2A 1IV8A 1F4HA 2D23A 3CAQA 2VCBA 3WQEA 4PUDA 2E40A 3U57A 4R7JA 4B5VA 3PG9A 1NDVA 2ONEA 4CNTA 1VZWA 1JDCA 1V77A 1K77A 2FTWA 2V9DA 3OQEA 4KESA 2CC0A 3AYVA 5A6TC 4C6NA 3E0VA 1DHKA 4UNKA 3W7NA 4JGDA 4LUTA 2VDHA 4C6MA 4Z2HA 3WBAA 1EIBA 2VFEA 3C0QA 4YYCA 4FZIA 2FMOA 2W63A 1SSDA 4S3DA 5HQLA 3EDFA 3UPWA 1E73M 4O10A 1A3HA 4PH6A 3RRAA 1GHSA 3I68A 2ZIDA 3VNKA 5EU9A 1XP3A 1WZMA 1UZ4A 2FVMA 1JZ7A 3PPCA 2VD8A 1KNWA 2IXVA 2DIKA 1Q6LA 2XH7A 4GABA 4XVEA 1E72M 1WOAA 3IUDA 4ZEPA 1HXJA 3GC2A 1ISXA 2EG8A 4MADA 3G1YA 3EEGA 4MMWA 3W1RA 3MKCA 5AHNA 3GNDA 5HJXA 3VC5A 3B8SA 3S42A 1VCFA 1GKQA 1Q13A 3TYBA 4DJFA 4WXYA 3PPFA 2VP8A 4HZ7A 1XIGA 1PYMA 3GFZA 2IPGA 3ME3A 1RBLA 3NM1A 3WLMA 3WQ8A 1K7XA 3GG0A 4X3ZA 4K38A 2D69A 1XD1A 4MJ2A 9RUBA 4LVAA 3WLOA 3K5XA 1JXKA 4E2OA 4DJDD 3LLFA 4NG3A 3F1QA 1OADA 2C1IA 3P6LA 3NQFA 1V3LA 3FHAA 4JFUA 4LC8A 4PBEA 3KFTA 1V3KA 5E0FA 3ZM8A 5F2GA 4FXJA 4O18A 4PB4A 2X0HA 4V2XA 2YW3A 4MVAA 1CT5A 1JPHA 5AC5A 1JYVA 4J28A 4IJRA 1W3TA 3R6IA 3MCNA 3MSYA 5A8QA 1ZGDA 4ZOEA 3AXKA 5I5RA 3MUCA 5I7GA 2FTPA 2V68A 4CD4A 2GGHA 2G97A 2D0FA 1IXNA 4W8AA 3LRMA 4HPGA 4JFWA 4GX9A 2ISWA 3L5MA 4PEEA 1JCXA 3ZWTA 4LV9A 2P50A 3POHA 3QF0A 4H00A 2POZA 2WB5A 3OG2A 4UR8A 5HQMA 3E38A 3VIOA 3G24A 1GWJA 2EPHA 3QFWA 5TF0A 4GVGA 1ONXA 1JCTA 2I9EA 4FIQA 3BLFA 2TYSA 2JIWA 2EG7A 2Z1BA 5CG0A 3GTXA 4G56A 4M56A 2WKJA 2TRSA 1R5YA 4C1KA 1UBPC 3ZLGA 1P1XA 1AQ0A 1V0KA 1TWIA 4IIDA 2NSXA 1ZJBA 3WKZA 2UV8G 3QYQA 5FD0A 1FWCC 1AA1B 5CPSA 1XRTA 3ONCA 2XVNA 2JF7A 3HV9A 3V0TA 5I3HA 3AXMA 5FA5A 2G4JA 4UTKA 4YPJA 1OX6A 2J8FA 3TVAA 3PZIA 1U2YA 4WRHA 4AY7A 4PL2A 4F2TA 3RAOA 3LBCA 2OGJA 1EJWC 4KWOA 4A3HA 2O55A 4Z42C 5J5RA 4Q8QA 4V1XA 3BURA 2VKZG 4JFVA 1DORA 1TWZA 2QUMA 1TPVA 2DDXA 1BYCA 4J3ZA 4FB7A 3A47A 3GC5A 4MFDA 1GQLA 3ABXA 1RHCA 3CQ0A 1O66A 3CB8A 1P0NA 4W87A 4A3UA 4UTHA 1B0IA 4RZ5A 2XFFA 2XN1A 1Q85A 4KCWA 2BY1A 1LM1A 1RQHA 1UH3A 5KZEA 1TUXA 5T9BG 1UB3A 1VPYA 1E1CB 2FVKA 2CLKA 3GY1A 5I77A 4XIMA 3PJTA 4KWVA 1QBAA 1NIUA 1GKPA 4JPGA 2QT3A 3QLDA 3ID7A 4ZO7A 3SCRA 4H9XA 4S3BA 1BSLA 2PRMA 4NZCA 3W2LA 3QRHA 1IEIA 1MFVA 3LCXA 3KX6A 1FWDC 4WHBA 3FJ6A 3BICA 5A6KA 2NVAA 3I6TA 5FACA 2RDXA 4W9TA 3GM8A 5FCZA 3UPMA 3WLKX 3NGJA 1XG3A 2PSNA 1I60A 3QOMA 3P7YA 2W61A 4US6A 5CPOA 1FWSA 3VUSA 4JTHA 3VINA 3UVAA 2D1ZA 1MRAA 3K1DA 3FK4A 2CZVA 4QJ5B 4NXKA 1YLVA 2RUSA 4XD5A 1PIIA 1XLFA 2P8CA 2VDGA 3B4YA 4MYXA 3UY8A 5ABHA 4X61A 3A9IA 3VGEA 3WDIA 4JTGA 3CNYA 1A47A 2I14A 4NAFB 4I7WA 1WDQA 1LYXA 3DKJA 3RITA 4L4OA 1F5ZA 4ZGYA 5AZ0A 4F0HA 1VFUA 4A8LA 4EIVA 1W1IE 1Y0EA 5AHLA 4DXKA 2J62A 1I1WA 2Q02A 3QM3A 4HSOA 2A7NA 3S5SA 3WLSA 3SCQA 1US2A 1EJ7L 3QQ0A 4KW2A 4XZNX 5JIPA 1J0HA 4YHGA 3TTEA 4HCLA 4A4AA 4PL1A 3LD5A 4ADUA 4QSHA 3CZJA 4JOMA 4M80A 4HNLA 2WBKA 1UOKA 3P62A 4ZFCA 1XC6A 2OQHA 3I65A 1AK5A 4Q8MA 4BF7A 4JHMA 2OB3A 2QCEA 3F4NA 4MLRA 3UBPC 2FB2A 4IWWA 1Q2SA 1LQ0A 5H1WA 4IXHA 1DJWA 2WMJA 1FCBA 2Y89A 3PZNA 1EPVA 1XD0A 4JAWA 4D6CA 5HWJA 5F4SA 4MNMA 4QJ3B 1DJYA 2EPMX 4ASTA 4LNYA