3FKKA

Structure of l-2-keto-3-deoxyarabonate dehydratase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
TPRHRGIFPVVPTTFADTGDLDLASQKRAVDFMIDAGSDGLCILANFSEQFAITDDERDVLTRTILEHVAGRVPVIVTTSHYSTQVCAARSLRAQQLGAAMVMAMPPYHGATFRVPEAQIFEFYARVSDAIAIPIMVQDAPASGTALSAPFLARMAREIEQVAYFKIETPGAANKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGGFPDGIRPILEAWREGRHDDAYARYQAWLPLINHENRQSGILTAKALMREGGVIASERPRHPMPELHPDTRAELLAIARRLDPLVLRWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-2-keto-3-deoxyarabonate dehydratase
publication title Structural analysis of L -2-keto-3-deoxyarabonate dehydratase an enzyme involved in an alternative bacterial pathway of L-arabinose metabolism in complex with pyruvate
rcsb
source organism Azospirillum brasilense
total genus 105
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.2.1.43: 2-dehydro-3-deoxy-L-arabinonate dehydratase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fkkA00
3L68A 4K8HA 5HR7A 5LKYA 1TPWA 2GJNA 3BLFA 4LVAA 2OMAA 4K39A 1TREA 4UTLA 3HB9A 2E6AA 2H8ZA 3CEPA 1S5WA 1EB3A 3G1VA 2JKPA 2GPTA 2ZRUA 1Q6RA 4O12A 1VCFA 1LRNA 4K37A 4GJ1A 3M6YA 4A21A 2IQTA 1R47A 2JK2A 1DQXA 1OYAA 2QAFA 1G4EA 1TQXA 3VI2A 4LVDA 4TR9A 4UTKA 3NL3A 1LROA 3T4CA 4C1KA 2CZFA 4O14A 1OF6A 3MYOA 2OCZA 1I4NA 3NQDA 1S5TA 1TMHA 2YPIA 2YFNA 3EEGA 3NQ7A 3NQEA 3RU6A 1YYAA 3A9IA 1MEHA 5CZSA 3SZ8A 1W0MA 2DJXA 1QFEA 4WX2A 1XBYA 1XBVA 2I1OA 1LTDA 3MYPA 5LGXA 2ZA3A 2ZRXA 4X9SA 1JUKA 4Q4KA 3LXBA 2O7QA 1KBJA 1OF8A 1W56A 3SIZA 3C52A 4NNBA 3U2OA 1LBMA 3W1LA 3QSRA 3ABSA 4U28A 1P5BA 2A1YA 3S9YA 3O05A 1JCNA 4JGDA 4NX0A 1A53A 3BLIA 3M7WA 4CLMA 2XN1A 3PM6A 2P1FA 4K7VA 3W7KA 3L66A 3NAVA 3NVTA 3O6DA 3T40A 4LC8A 3BPWA 3T78A 4QJ1A 2HMCA 3SFKA 3EWZA 2C1HA 2QUTA 4GUIA 5AHEA 1WX0A 4A29A 1F05A 3M0ZA 2E68A 1IXOA 4NJJA 1R2RA 4HNTA 3N9SA 2WSYA 1OFPA 3MP5A 1GJPA 3W7NA 3B06A 4AF0A 1OFBA 4Z0JA 2ZRYA 4UFHA 2NWRA 5KZDA 4NZJA 3PSVA 4XZ9A 4ZQMA 1Z41A 5TQLA 1UUOA 3LCHA 5F2GA 2A6NA 3RMJA 4JIPA 4O16A 3E49A 3OEXA 3BG5A 1QO2A 1XBXA 3PWAA 3PUDA 3BW2A 1K8XA 3V1PA 1H63A 4OGZA 2J88A 2DZWA 3NYZA 1A5SA 1XM3A 2QAPA 3GNNA 2RDTA 3PBUA 2VFGA 1OJXA 2VEKA 5DXYA 3RFAA 3MHFA 1MEWA 4PL2A 3GVGA 4DO6A 2VC6A 2ZTJA 1R2TA 3STEA 5AC6A 4BWLA 3GR8A 3HOJA 1J2WA 4N6EA 1W5QA 4UNKA 1L2UA 5KINA 2CZDA 3BW3A 1TTPA 1G4TA 3W86A 2JGQA 3ATZA 1DKWA 3L0GA 1SR9A 3QRHA 2Y70A 4PTNA 3TFCA 4IJBA 4RKAA 3NXFA 4HSOA 1R46A 1NSJA 1VZWA 3QPYA 3TU9A 2CW6A 4TX9A 4BFAA 1I2RA 5HWMA 1O4UA 3W7QA 1VJIA 1ZY9A 1N8FA 1FWRA 2QKFA 4JX4A 3C8FA 1Z42A 1SSGA 3GIYA 1W5OA 3LCIA 1FCQA 5CPMA 1FQ0A 2V5BA 1UCWA 3SW6A 5EL1A 2G5WA 4LS0A 3FYPA 1OX4A 2YR1A 5IBXC 4HN4A 4WY0A 3WJYA 2NWSA 3NQ6A 2PRMA 2V5LA 3G3MA 3HG4A 3R2GA 5F1UA 3C61A 4YCOA 3MHGA 4CQAA 1CW2A 3TH6A 4LVGA 4CNNA 4IX0A 2EGZA 3W1MA 3CHVA 4I7UA 2H8XA 3LTPA 1VS1A 5C6MA 3NQMA 3UD6A 3GDMA 3CIXA 4UTWA 3LHUA 1TO3A 3GDRA 1GVQA 1VHNA 4DBEA 4LS1A 2DZPA 2E6DA 3KXQA 5DLCA 5K9CA 2CLHA 2GVGA 4GUJA 1FCBA 5G1YA 1SZNA 4FNTA 3WK2A 2ZZ2A 2FDSA 5C2XA 5DY2A 1JCJA 3DAQA 2GUUA 3TMQA 3UPWA 4MZ1A 2O7SA 4Z1CA 5CGQA 1ICPA 5BOOA 2VENA 1BWLA 1LOLA 4JTKA 1UUMA 3NM3A 1O94A 3QQ1A 4NQ1A 4KFOA 3ABRA 2QDHA 3QMTA 2WOQA 5AYXA 2GOUA 5K2ZA 3S8HA 3UZ5A 1VYRA 1ICQA 1YDNA 1TTQA 3P5YA 5D2XA 1SU5A 4NX5A 4UR7A 4M7TA 5BMXA 5DCEA 2ZQ0A 4AHPA 4IMEA 1QDSA 1OK4A 3QMSA 2C13A 4GXMA 4DBDA 3A22A 5AHNA 4FIRA 3EKLA 3GB6A 1LZOA 1TRIA 1PS9A 5LHFA 3MI2A 4JTLA 4MLJA 5BRBA 3G24A 4JYEA 5FF7A 2NX9A 3UWQA 2HTMA 4WQ6A 2G96A 2QCDA 5KZEA 4MFDA 4AVFA 2BLEA 1CI1A 1WXJA 3TJLA 3B0UX 1FDJA 4WXYA 5AYZA 5F4WA 2R94A 1IIHA 4IMDA 4JTSA 4NNAA 3GDKA 3DFSA 3WK0A 1VH7A 4O1DA 1KM6A 4Z08A 3A5FA 2P0OA 1FWNA 1K7FA 1WAUA 1AK5A 1D9EA 1H62A 2OJPA 4QM1A 4CCEA 1SO3A 3DFTA 1HG3A 2Y62A 4N4PA 3VFLA 3S1XA 3USBA 5D37A 3NQGA 4FNRA 1Q6LA 2ABBA 5AYYA 2RHGA 3FA5A 3RLVA 3I65A 5U7SA 4MPQA 3VNDA 2HS6A 3FS2A 3OA3A 2ZRVA 1WOBA 2OX1A 4S1FA 4EF8A 3TE9A 1FXQA 2CU0A 3IGXA 2QCEA 4IX2A 3PSWA 3DKLA 4O1CA 3W85A 1KFKA 4ZQPA 5G5IA 1RQEA 1GVOA 4LTSA 4RXFA 2Y7FA 1C29A 1TYGA 1EEPA 5FF4A 5EA9A 3E96A 2DJLA 5E1QA 3T55A 5TIMA 1VLIA 2DZVA 4EIVA 3DHDA 1P1XA 3KRZA 3G1SA 3DFNA 1KW1A 5K9DA 1X1ZA 3MO7A 4X2RA 1FCUA 3H54A 3DFPA 1G6CA 3C56A 3Q2DA 1I2OA 1GTEA 1SSDA 1EIXA 4NU7A 1BTMA 3TQ0A 3N73A 4CCDA 1BKSA 4QQ3A 1JUBA 3LV6A 2QCFA 2NV1A 3DI0A 2NUYA 1LBLA 4RR4A 5G2HA 1FCVA 1THFD 4OQVA 3RNDA 1ICSA 4PL1A 4JTFA 3PG8A 1FY6A 4JX6A 3KVKA 1W8SA 2QJHA 3K30A 3B05A 1H60A 4WD0A 3H53A 3IVTA 1LDCA 4NJGA 2CWNA 3QMRA 5HUOA 1TV8A 5AFDA 4LVFA 2TMDA 5KSWA 3W7MA 3SECA 3R89A 2NUWA 3U6WA 3PR2A 3UPBA 3GAYA 5D05A 5LNUA 2E6YA 4YMZA 4IXHA 3C4UA 1JRBA 1MSSA 2X2GA 1MZHA 1V5XA 3O15A 2FLIA 3WK3A 2EHHA 2Y63A 2F84A 4ONVA 5AHMA 3W76A 4GFSA 5EYWA 4FB7A 1H7PA 3A5VA 3F1QA 3UY8A 5LNRA 1VC4A 4JEQA 3I7SA 4JD4A 4H6KA 3LM7A 4IPJA 1ZFJA 1JRCA 1QNVA 1L6SA 2Q3OA 1SO6A 3LHVA 1ZAHA 5AHIA 1KV5A 1WDWA 1G7VA 5C55A 4JYDA 4BR1A 2YXGA 2B7OA 2AGKA 2F7FA 1LP6A 1P4CA 3T7VA 3HPZA 1G7UA 2V30A 1K8YA 4FX8A 1YXDA 2YDAA 1KM5A 1ONRA 4GWEA 2VFHA 3V75A 3ELFA 3QSTA 3NQ8A 4RLIA 3F03K 1N55A 3W72A 4IMGA 1EPXA 4ZQCA 3UZJA 4DO5A 1NF0A 5FI8A 2FIQA 2PC4A 4JTIA 2B7PA 2QJIA 1XCFA 1DBTA 2EF9A 2A21A 2ABAA 3UWUA 3M43A 4TIMA 1ALDA 4P2VA 3MP3A 5LZLA 1F6PA 1IXPA 3EWXA 3IIZA 4K38A 4E2DA 1YDOA 2C19A 4OBTA 1B9BA 4LS2A 4POCA 2J27A 4ADUA 4I7VA 1PE1A 4IQLA 1VCGA 4AHOA 4LW7A 1W5NA 2CLOA 1TPUA 5L9FA 5L6UA 1TPH1 3O1NA 1XDMA 1AW2A 4A3UA 3D0CA 5CZTA 4EF9A 4WOQA 5DN1A 1H61A 1SQ7A 1G4PA 3P5ZA 3C6CA 1W37A 4JXCA 1QR7A 3W73A 4DPPA 1X8FA 1QWGA 2Y7EA 3UQNA 4JR5A 4H3DA 3HO8A 2VEIA 2D73A 2J24A 3M5VA 1KA9F 4O0KA 1Y0EA 2EPHA 3QZEA 4QNWA 3B0PA 3LERA 3LTYA 4ADTA 5G4EA 2JGYA 4OWGA 4AMAA 1YTKA 3P62A 5HNRA 1UJPA 3FKRA 3FLUA 2Z6IA 3UNDA 3NNTA 1HUVA 1OFDA 5CPNA 2B7NA 3STCA 3VCRA 5KITA 1BEUA 3PUOA 4AWSA 4IMFA 2WQPA 4GNJA 4LRSA 5F2MA 2ZDRA 4O19A 3HG5A 4FO4A 4M6PA 2CFFA 3SGUA 2VFIA 5G2WA 3IIPA 1SZGA 2QCHA 1Q6QA 3CT7A 4MY9A 8TIMA 3HF3A 4RCXA 3EWYA 4FIQA 1YXCA 2Y88A 3L0NA 3A23A 3EXTA 1S3HA 2YGYA 2C3ZA 5GVJA 2FPVA 3CB8A 4Z1AA 1VQTA 4XTIA 1I8JA 2ZYFA 2CLFA 2DZTA 2HS8A 3B4UA 1L6WA 4WUIA 1ME7A 4C1LA 2C6QA 4EWND 3LCGA 3KOFA 2ISVA 4UC5A 3TQVA 2OT0A 3TAOA 3W7HA 1BWKA 3C3NA 2QCLA 2HSAA 1F7BA 3LDVA 3TW7A 3DBPA 2QUVA 3MBFA 4Z1BA 3W7IA 1KFLA 4FNSA 4YLWA 3FYOA 4MJMA 1J4EA 3NOEA 3M5YA 3N9RA 3LXCA 3HG2A 3LRMA 4S2CA 2GVLA 2E77A 3IIVA 4O4WA 3HGJA 1XC4A 2JBMA 4X22A 1W5PA 2WSQA 3L9CA 2C0AA 1DHPA 4GUGA 1Q45A 3KVLA 1LOSA 3CIWA 2VXNA 3QC3A 1XL9A 1PCWA 2FTPA 3WJSA 5AB3A 5FF3A 2ZA1A 4MJZA 3S5ZA 2W79A 1NVMA 3KX6A 1YTEA 1TQJA 3BGGA 1T0OA 4UFJA 1VCVA 3L65A 1TPEA 2X16A 2PRHA 3BV4A 1FDYA 3E9AA 3TKFA 1QAPA 1C9DA 1H7OA 3NGJA 5MHBA 3CM4A 4NNCA 4NJIA 3GR7A 1O5XA 1F2JA 3GZ3A 4DO4A 1TRDA 1XBZA 4J9JA 2WPBA 2PURA 5F1VA 1IIGA 3G1YA 4ORMA 3L5LA 4O1AA 4A2SA 3CPRA 3HGOA 4ADSA 4CQ8A 3G22A 1RQHA 4MFEA 3N2MA 4XQ6A 1MEIA 5DELA 1SO4A 4RV8A 1ZALA 1GVSA 2Q8LA 4DF2A 2VEMA 4IXXA 5AN7A 2BSLA 4BK9A 3AJXA 3L67A 2NLIA 4S2BA 5H91A 1B4KA 3FFSA 3QYQA 4XKYB 2CLKA 4KWVA 1P0NA 5C5YA 4LV9A 2VEPA 3IVUA 3KRSA 4UFKA 5HJLA 4N9CA 2Y89A 5HQEA 4XBKA 5CSRA 4DQWA 3EX4A 1W3NA 1GYLA 1PHQA 1W3IA 4N4QA 1ME8A 1QOQA 4BWLC 3P7YA 4EVZA 5D2WA 3LI1A 4LC6A 1LLZA 1NFBA 3DFOA 3W23A 3MWAA 1XI3A 4N9BA 4QNEA 3L21A 1OVDA 3E12A 4PH6A 3ANYA 4HPJA 3TROA 1RVGA 1LCOA 3C2OA 4MUZA 1X1OA 4Y6GA 4IMCA 1QO5A 2GVJA 5D04C 1VHCA 1F73A 3M44A 4Q33A 2Y7DA 5C54A 4DXVA 3C2EA 2DZXA 1H7NA 2FFCA 2BWGA 1TTIA 4O28A 1IXQA 1QMLA 1AMKA 1R2SA 4K8EA 2ZZ3A 3GKFA 4NJKA 1PVNA 1EX5A 4JTTA 2WNNA 3MJYA 2CLEA 3HMJG 3DHFA 4UMBA 4RZ6A 5EMUA 1KFCA 4LV4A 3SR7A 5DXXA 1G69A 2X30A 4PA8A 3FKKA 2XN0A 3MW7A 3TQKA 4XWUA 4D2JA 3LCWA 3O07A 5D38A 3C2FA 1TPC1 4O17A 4O57A 2ZFAA 3W7PA 2WSRA 3Q37A 3RLUA 1SW3A 4IOTA 4MYXA 4K6AA 4M19A 5F4SA 3P84A 4UTWC 4HKPA 3STGA 1Z44A 4UCGA 4HIBA 4GUFA 4E38A 1FUYA 4PEKA 1RV8A 5KZMA 3STFA 1Q3NA 2DZSA 4AB4A 3MHUA 3THAA 3G18A 1KV8A 3HQ1A 1ZAIA 2GQAA 3UWVA 4DF1A 1JCMP 1ZAJA 1PV8A 2OZ0A 4GRSA 4FXSA 2VFEA 1WV2A 4L4MA 3EWWA 5HULA 4JNMA 4IPIA 3KVMA 1QCWA 4WXZA 1JQXA 1FWTA 2WO5A 5EBUA 1JCXA 1YPFA 3PB2A 3WFAA 1PL9A 1V7YA 3M16A 4O10A 1OYCA 5U4NA 3BGJA 1OABA 5EY5A 3P60A 1SW0A 3W87A 1TPVA 3W1QA 1YPIA 3QPZA 5EKYA 5LHEA 1JCLA 1QOPA 1KM3A 2LLEA 1W54A 2E6FA 3W83A 3KAOA 3PBVA 5D03A 4DPQA 2H3DA 3AO0A 4HNNA 1ZENA 2R14A 1A5AA 2QF7A 5FEPA 3R8RA 3CWNA 3QJAA 2ATMA 3QH2A 4JY9A 3NG3A 1AW1A 3W7OA 2YCEA 5G4WA 3N34A 2A6LA 1D3GA 5KMYA 1E51A 3ZWTA 3S0CA 3OBKA 4NZFA 3TC6A 3FJ6A 3OVRA 4M6QA 1P0KA 1VRDA 2NV2A 2QEZA 3EX3A 3N2XA 2QJGA 1KFEA 4UMAA 3G8EA 3DH7A 5CPOA 1D3HA 2DU2A 3KRUA 4HHPA 4TMBA 2CLLA 2ALDA 3NPWA 4GC4A 3EWUA 4QIUA 4BI7A 1VLWA 4MZ8A 5LNVA 3G3DA 4RXGA 4UTIA 1H7XA 3BO9A 2WV8A 4KFNA 1B57A 1JULA 1OFRA 1DJNA 1IF2A 3CC1A 3N14A 2RDUA 2VFFA 1K03A 2B7QA 2Y7GA 2YZRA 3H55A 2Q3RA 2RFGA 1OFOA 5I3FA 1W31A 3NZ1A 5T26A 2KZHA 5DBUA 1A5CA 4BI5A 5I3JA 3I7QA 4PFMA 3LHYA 2WJZA 1WA3A 4LU0A 5CKSA 5J5DA 3JR2A 1OFEA 3INPA 4Y8FA 2V82A 4PODA 4TU1A 1GWJA 3BG3A 2XN2A 2Y85A 2Z6JA 3LX9A 3P8JA 1H50A 4M5PA 4UXDA 3TUUA 2A7NA 4RZ5A 3IIXA 4CQ9A 3W7CA 3HBLA 2Y6ZA 3FOKA 2VKZG 3ZWSA 3G0XA 3P82A 2QCCA 1IGSA 2E5DA 3HGSA 2VFDA 4UTJA 1TTJA 3C0JA 4OV9A 4IGHA 5D30A 3HIJA 1TPB1 2ZRWA 2Z1BA 1KTBA 4Y9AA 3LXAA 1GVRA 4RK8A 3R5EA 3CQ0A 1RR2A 5ABTA 1GZGA 2BTMA 2ZCGA 3W2MA 3W3OA 1Q6OA 2TYSA 2QCGA 2V2CA 3TNOA 3NPUA 4MIMA 3S1VA 3LRLA 3UWYA 3NEVA 4LRTA 1QPRA 5CSSA 4EOUA 2DP3A 1OX4B 4XUGA 2QDGA 4WY0B 3ZFHA 3PAJA 3M47A 2WNZA 3NDOA 2A85A 3WK1A 2ZZ7A 5H2ZA 1ZHAA 4JTUA 2CZ5A 4MVAA 1QPOA 3ATYA 1K7XA 3HGRA 2P10A 1RZMA 5A5WA 4XKYA 1EWEA 3MUXA 3S5OA 2RKXA 4LNYA 2X1UA 3NR0A 2ZZ1A 3TSDA 1KM2A 3WJXA 2V8ZA 3TAKA 3PF3A 4UFMA 5HUPA 1DL3A 2ZZ6A 4RZ4A 4K7YA 5HR6A 5E0KA 2J9YA 3O16A 4QITA 4IWWA 5LNWA 1RQBA 4JN6A 3GXPA 1LBFA 1SFJA 1TJRA 1JUEA 1A5BA 4O1BA 5G1TA 4ZZ9A 1GG0A 1A50A 1XDLA 4B5NA 1JVNA 3QF0A 3W7EA 1NAL1 3NZRA 1OK6A 2XFWA 4YWIA 3KHJA 3W88A 3G1XA 5G2IA 1ME9A 4WOZA 2V81A 3M5ZA 1WOAA 4UR8A 3LBMA 4MKNA 4HPXA 5F4XA 3UXAA 3W70A 3B04A 4E2BA 1TPFA 5D32A 5LSMA 1TV7A 4JTJA 3WJWA 2C16A 1KTNA 1W1ZA 1EWDA 2ZZ5A 3TC7A 4H4IA 3I68A 4YXGA 4OE7A 2WNQA 3ZS4A 2QCDB 2ZA2A 3TW6A 1L6YA 4LOCA 4W9TA 3W71A 4NVTA 4UFLA 2JKEA 1WBHA 3PBYA 4DF0A 1J5TA 4OT7A 2ISSA 4QISA 3B03A 3PVFA 3W7JA 3E02A 1H7RA 4FX6M 5FEXA 4OHQA 1DOSA 5D09A 3IGSA 2ZZ4A 3GXNA 3GXTA 4NXSA 3BK0A 1FDZA 3PG9A 5F2LA 3S42A 1KM0A 4O0ZA 3F4WA 4LUJA 4NXKA 4HT3A 3VE7A 2V2DA 3I6RA 4HSNA 5D2VA 1KTCA 3DU0A 5J5RA 3O6CA 4XTDA 3QW4B 3W2UA 3EX6A 4NT0A 2A0NA 2H3BA 3TMLA 1DV7A 5DY3A 3L0KA 4HNUA 5D02A 1KLYA 3G0UA 2DORA 1W5MA 3PUEA 1TIMA 3S6DA 4AAJA 3P61A 1LM1A 3NQFA 3LLDA 5HWJA 2V0TA 3SY5A 6ALDA 4PCFA 2C18A 2QUUA 3QEZA 3UWZA 4ML9A 4MY1A 2YFOA 4TO8A 2EKCA 1PCKA 1MO0A 2V2HA 4MYAA 1UBSA 2NXGA 3G8RA 1YDVA 1W3TA 1YXYA 4UUIA 3W2JA 3M1ZA 1M6JA 1CX9A 4UTMA 4MZYA 1K3UA 3IIOA 1K8ZA 3WJZA 3FIGA 2TSYA 1RD5A 4ZVJA 2AAMA 3NQVA 3P67A 1LRQA 3W7LA 4UNLA 1LORA 4O15A 3S1UA 1JR1A 1HTIA 2J6XA 3NL6A 3W84A 3O6YX 3NO5A 3NPVA 3QFEA 1GTHA 1FBAA 5D2TA 2FJKA 4KWWA 3VKJA 1H1YA 7TIMA 1GPWA 5K4XA 6TIMA 5I3HA 3W1XA 3NM1A 4IUOA 3CWOX 3CEUA 1TSIA 1GQNA 5BW6A 3KFTA 4X3ZA 1X6UA 1I45A 1XKYA 1LRTA 4QSHA 3A24A 1UB3A 5FEZA 3W1RA 3W7DA 2E09A 4FNUA 4RX0A 4UTTA 2G97A 1SZEA 4UTHA 5E93A 1EP2A 3B8DA 2ATSA 4ICNA 2V9DA 4BF9A 2AQWA 5BNKA 3EB2A 2YYTA 2H90A 2Z2UA 3TCEA 2YW3A 3FEMA 3HG3A 2BX7A 2GQ8A 3ZR4A 4JDYA 2PRLA 1OYBA 3MI6A 4I9AA 3I7RA 3W7GA 2A7RA 3IRDA 3IVSA 2ISWA 4JYFA 3QW3A 4UTTC 2FQIA 2BXVA 4YL2A 5FEWA 4FXRA 2I9EA 1VYPX 1L9WA 4PC8A 4AH7A 1EP1A 4AWTA 2E5BA 3W1TA 1EUAA 2FPYA 1O95A 1WQ5A 3L5AA 3SJ3A 3E0IA 1F74A 3TX9A 3P8IA 4FEZA 3VE9A 4N9DA 3TJXA 2RH9A 3LRKA 3PB0A 1KFJA 2QR6A 3TSMA 3TDFA 4N9EA 4CCCA 3GK0A 3L5MA 4N02A 3BVJA 1Z48A 3JRKA 4Q32A 3W07A 5HWNA 3LGEA 1SZFA 2I14A 3S1WA 1KLZA 1SUXA 5IBXA 1F5ZA 3O63A 3W1NA 3MBDA 4WZHA 1KFBA 3A21A 1LLWA 4ALDA 3NQAA 1I2PA 2W0UA 4FX7A 3W9ZA 3TXZA 4JS3A 2B4GA 1T99A 3LI0A 4JDBA 2NXHA 4UMCA 1EA0A 2R8WA 3PBWA 3G1HA 1FXPA 5DCBA 1DVJA 1GEQA 4JTEA 3CTLA 4Y90A 3EX1A 4K36A 1EP3A 2RDWA 3LHWA 1OX6A 1DJQA 5CZJA 1VGAA 4ZQNA 3IEBA 2X1RA 1ZCOA 4FNPA 2YW4A 1XUZA 5TBOA 3W1PA 1T8XA 1GYNA 3TIMA 3GNDA 3PY2A 1C8VA 3TSBA 2B0MA 4FNQA 3W2LA 3PS7A 2OT1A 3LCLA 4O50A 1GT8A 5EPDA 1JCYA 3NL2A 3N3MA 5CPLA 3GAKA 2ZBTA 2CLMA 2NX3A 3M5XA 1H7WA 1NEYA 2C15A 1VPXA 3IGUA 1SO5A 2A5HA 3OIXA 4ORIA 4L4LA 5I3GA 1KM1A 2J9XA 1GG1A 1ML1A 5I3IA 2YSWA 1I2QA 3W2NA 3MMTA 1AW5A 3MI3A 1F6KA 1XUUA 3P80A 4N6FA 1T96A 5AC8A 1VYSX 3EWBX 1LOQA 2UV8G 4NJHA 1DQWA 3OG3A 5LNSA 1M7PA 4ZQOA 1HFBA 3W1AA 3S5NA 1ZJIA 2TPSA 1R30A 1TPDA 3SGZA 4NUWA 4P61A 2EAWA 3HJZA 5I3KA 3W1UA 3DGRA 4GUHA 4G1KA 2X1SA 5K9XA 2NXIA 3F4NA 2Z0IA 1KM4A 4O13A 2A2IA 5DBTA 4O8RA 5CG7A 4CNOA 5K4ZA 2H6RA 4LVBA 3ABOA 4O18A 4GE8A 4R7JA 4O53A 3Q94A 4JICA 1PIIA 4BI6A 4OU1A 3UWWA 1H51A 2A4AA 5HMSA 2R91A 5FF2A 5D2YA 4ZL1A 3G0SA 1YADA 1SFLA 3TXVA 2GJLA 3BLEA 3NPXA 3KVJA 4Z0SA 4QAIA 3RK8A 5KTLA 5HINA 1OG0A 2JKAA 3LCFA 3LOTA 1AL7A 1YTDA 1N7KA 4Z1DA 1HO1A 1GVFA 1MXSA 3DENA 1B4EA 4UFIA 3OHIA 3W6YA 4JTGA 4U4MA 1B3OA 5DCDA 1TB3A 2A7PA 2BZNA 3ABQA 3N19B 4AF0B 4O4VA 4DELA 3TK7A 4LY8A 1G67A 5AC7A 4KKXA 5IM51 3O8AA 3LCXA 2PCQA 3FJLA 3TR2A 4E0CA 3TV8A 2DZUA 3CLMA 4FHAA 3NL5A 3TFXA 2FB2A 4MOZA 1WYIA 3SSJA 3C2VA 1FWWA 4UIOA 1HO4A 1TCDA 2ZRZA 3QM3A 3HPSA 4WY0F 2ZTKA 4LT9A 4AHQA 4GBUA 3M9YA 4R34A 4M6VA 2VELA 4FF7A 5BMWA 3BARA 3W22A 4JY8A 3UY7A 1K7EA 3MP4A 3OVPA 4DEFA 3LHTA 1FX6A 5AHFA 1YLVA 3DFQA 2Y61A 4CNPA 1JQVA 3U8GA 2X1TA 2VOMA 4ZMGA 3M41A 3TA6A 1OFAA 3QQ0A 2G95A 1EUNA 3G1FA 2QCMA 4O54A 2YX0A 5AHLA 1XFBA 3EKZA 1VR6A 3DXIA 3DZ1A 3GLCA 3B0VC 3W74A 1SPQA 1M7OA 1JJKA 1SW7A 5A8GA 5K7JA 4M7SA 1WBJA 3T44A 1KBIA 3Q58A 3DKJA 1QPNA 1QPQA 1OFQA 3BW4A 3LBCA 3LLFA 5F2IA 4KFPA 4A22A 2FB3A 3LTSA 2FPTA 3GDTA 5FESA 4N2YA 3P74A 1U5JA 3UYCA 4TMCA 3C2RA 1LYXA 4MLRA 3JS3A 2W6RA 3GYEA 1G4SA 5K3VA 2PE4A 1FWSA 4R33A 2CZEA 1X7FA 3DI1A 3RF9A 3R13A 1UASA 4Y96A 3EXRA 3W75A 3LB0A 3HPXA 3EX2A 1TJPA 1AL8A 4R53A 2CLIA 1H1ZA 1OHLA 2E1DA 3S5YA 3CU2A 1IXNA 4AWUA 1U83A 3EXSA 3GX9A 5D33A 4HNVA 4AXKA 3P81A 1O5KA 5LGZA 4O11A 4YCPA 2E5CA 3PC0A 4MY8A 4UTUA 5CZ0A 3G1AA 1I2NA 2NUXA 3NQCA 1NF7A 1K02A 2J9ZA 4AEOA 4LWWA 3LHZA 3O06A 1AG1O 3GDLA 3OVQA 1H5YA 3NQ2A 1TV5A 3LV5A 1XXXA 3R12A 4ZQRA 4OV4A 4JTHA 4O52A 3G1DA 2GQ9A 1S5VA 5SWUA 2YYUA 4JIQA 3PULA 4RJEA 3THQA 1GOXA 3BG9A 1RPXA 1O60A 1ZNNA 4WJEA 5FF0A 3UXDA 3L2IA 1ADOA 5AOUA 4A2RA 2Q8ZA 3SI9A 2NX1A 4LUIA 1PHWA 1M5WA 3YPIA 3W2KA 2C14A 2WKJA 2QCNA 1HL2A 1DORA 1F76A 4I7WA 1OX5A 4XBSA 2TRSA 3GKAA 4JX5A 3W7RA 3IV3A 3NA8A 2NZLA
chains in the Genus database with same CATH superfamily
1PX8A 5LKYA 4UTLA 3HB9A 3MSRA 1BYDA 1EB3A 3B40A 3ITTA 4P8UA 3MKVA 1OT2A 4K8GA 3ZR6A 4K37A 4GJ1A 2IQTA 2JK2A 3LY0A 1E9YB 1G4EA 1JPKA 1KRAC 2G3JA 4C1KA 1PIFA 2WMGA 4O14A 2PDGA 2OU4A 3NQDA 1S5TA 4W87A 3EEGA 2DVTA 3T0CA 4QCEA 2ASHA 4ILSA 2ZX8A 1QFEA 3SRFA 1V93A 1FWFC 4C7DA 1E4LA 1DE6A 2G41A 4KCVA 1BKHA 1LTDA 2QZRA 1XCXA 2ZRXA 4Q4KA 1FWGC 2DSZA 1WKDA 1OC6A 3CV2A 4H8VA 2YB1A 3SIZA 3C52A 3U2OA 1LBMA 3QSRA 4HOXA 1UKPA 1R3VA 2YDRA 2A1YA 3S9YA 4PUUA 1DJIA 1JCNA 2BXZA 4ATDA 1A53A 3M7WA 4CLMA 2F38A 4Z42C 1JGIA 4OKDA 3MKKA 4LC8A 4HJWA 3SB0A 2FTYA 8RUCA 1WDRA 3EWZA 4GPNA 4DNHA 1WX0A 4EE9A 3BLDA 2E68A 1IXOA 3MP5A 2WCAA 4PMJA 2ZRYA 4JN8A 2DPEA 3AXXA 1BYCA 4FLOA 3PSVA 4DVOA 4IFKA 1VB9A 3LCHA 5F2GA 4JKKA 5EGRA 1CXFA 2W4XA 3LN3A 1XBXA 3PWAA 1P7TB 2F2KA 4FOJA 3TONA 1HP5A 2DZWA 1TUFA 1J0HA 3GNOA 4H83A 5BRPA 3CK5A 3PBUA 4BZYA 2VFGA 3BH4A 2VEKA 3WLKX 3S2CA 1MEWA 4PL2A 4DO6A 2VC6A 2ZTJA 1ISVA 2ANUA 3QXBA 4BWLA 3H2NA 2IPFA 3VOIA 3CWHA 4N6EA 5B7ZA 2OODA 1W5QA 3BOFA 3M64A 3IUDA 4UQEA 1XLMA 4ZOCA 4MMWA 1TTPA 1G4TA 3ATZA 3REQB 4JQAA 3MMDA 4PTNA 4MWAA 1U1UA 4RNFA 3DFHA 4Z1YA 2YXOA 1R46A 4ZFCA 4BHYA 1DWJM 3UVAA 3WZ0E 4BFAA 1S5NA 1XW8A 2C79A 1ZY9A 3M0XA 1D8CA 4R88A 1GVIA 3STPA 3C8FA 5A6TC 2QLYA 5FJTA 3ARSA 1B3ZA 1FCQA 1R5YA 4M81A 2D20A 3ECQA 1UD3A 1NARA 4WY0A 4JPGA 3WJYA 2PWHA 3G3MA 2V5LA 5F1UA 1EJTC 1E3XA 4JEJA 2VR2A 1ZJHA 4LVGA 1KWGA 3VNJA 1BVWA 3UJEA 3UD6A 1GVQA 2GGJA 4QHRA 2E6DA 2CLHA 4A6GA 2JF7A 1SZNA 3WUFA 5DY2A 1JCJA 4AVOA 2WYSA 1EC7A 2O7SA 3SQLA 5BOOA 1BWLA 4W8LA 1HVQA 3QQ1A 5AZ0A 1E73M 3EMCA 3ABRA 2QDHA 3QMTA 1K6WA 3OO2A 2W92A 4J35A 3UZ5A 2DGAA 1TX2A 1YDNA 4BEUA 3WDRA 5CXPA 3AZSA 1F4AA 1SU5A 2CNCA 1NOWA 3N13A 2PODA 4QFUA 5BMXA 4TUFA 4AHPA 3QMSA 4DBDA 4ATLA 3WQFA 4GI4A 2A3AA 3GB6A 5FF7A 3CGTA 2HTMA 4WQ6A 2BHZA 4C6QA 2BLEA 1WXJA 4WXYA 2NSXA 5F4WA 4IMDA 3FXGA 4GNVA 3LZ3A 2WVVA 1EJ7L 3CYVA 3MWCA 4QG6A 1KRCC 2HBXA 3MVIA 1KM6A 2VEFA 3A5FA 2P0OA 1PKLA 2J8GA 1SO3A 2I17A 3L2LA 3MUZ1 4LBUA 4Y8EA 4FNRA 4LAZA 3WH9A 1Q6LA 3I65A 5JQ9A 3PWIA 3BAWA 2ZRVA 4S1FA 1QUMA 5CPTA 5LIXX 4IX2A 2FTWA 3WF3A 4ZQPA 5G5IA 1RQEA 3EB4A 3R25A 1PIGA 2PCEA 4CU8A 4O0QA 4XVEA 1PXGA 2DZVA 4EIVA 3DHDA 3KRZA 2VGBA 1XLBA 3IJDA 3FW6A 4PB5A 3DFNA 4S3GA 1KW1A 4L9XA 5H8UA 2CKRA 3MO7A 4X2RA 1FCUA 2CZVA 1I2OA 1SSDA 4GG9A 4HU4A 1EIXA 1M03A 3PTQA 1AZ1A 1BTMA 4XZNX 3TQ0A 4BF5A 3CUIA 1IYXA 4GKLA 3BLPX 4CNUA 1PWMA 2NUYA 3SCWA 1HJVA 3ISIX 2J7EA 3SCRA 1FCVA 1XQKA 4PL1A 1PZ3A 4WCJA 4JX6A 3T81A 2FHFA 3BSGA 4WD0A 1EFZA 3BMXA 1UZ4A 4WR3A 1VBUA 1W1A1 3SQMA 3B8IA 2TMDA 1A3HA 3QGAC 3W7MA 3PTKA 2NUWA 4TOQA 3UPBA 3GAYA 5D05A 4V2XA 4YMZA 3C4UA 1OD0A 4L6HA 3VKCA 2X2GA 3CL7A 1MZHA 3UFYA 3RM9A 3VNKA 4J3SA 2EHHA 3RILA 1I6NA 5EYWA 3UY8A 3E0FA 4QLLA 1MW0A 4JAWA 2GGIA 1E0UA 1JRCA 1S2CA 2Q3OA 3LHVA 2ZUNA 1E40A 2XVGA 3D3FA 1DIEA 2D0HA 3SY1A 4H8UA 3ZT5A 1EXBA 4C6DA 1ONXA 3VZZA 4C1NB 4FX8A 1ONRA 1RPKA 3V5OA 5T8GA 3VIMA 1S2UA 3NQ8A 3QSTA 3F03K 4ZO8A 3W72A 5I09A 5JH2A 4DO5A 4F9JA 2IKJA 4PMYA 2QQ6A 3L4TA 2PC4A 4JN7A 3OGRA 3WQEA 3WEOA 3ZQ9A 4DB7A 3RR1A 1IZKA 1Q65A 4O8AA 1RJPA 1T7LA 2G3IA 1S1RA 3KBWA 3M43A 4TIMA 4KCUA 4P2VA 4XD3A 4LEFA 3LPPA 4PB3A 4RE2A 2OYKA 5CEWA 3PZMA 4E2DA 1YDOA 5GNXA 3PJTA 3ZT6A 4WVXA 4X0NA 3G1RA 3L7RA 4GYPA 1EDQA 1VCGA 1NDYA 1TPUA 4K68A 1VIWA 1AW2A 1X98A 1YE4A 3D0CA 2PI6A 5DN1A 1H61A 4LX4A 4JXCA 4E8GA 4DPPA 2F2HA 4P7OA 1XLJA 4JR5A 3T0DA 2XFYA 3SSZA 3T0TA 3O7UA 4FZIA 3M5VA 4O0KA 4LPCA 3WLLA 4QNWA 4YVVA 4MNKA 2G4JA 1UR9A 3LTYA 4OWGA 4AMAA 1YTKA 3ITYA 2OEKA 3V5CA 1HUVA 4ES4A 4TTGA 3VCRA 1I0DA 3AMKA 3URAA 4GIYA 4X63A 2ZDRA 1UUQA 4HJFA 4O19A 4CD4A 1V6XA 4M6PA 2CFFA 4LJ3A 3O9NA 3OQ8A 2QCHA 1F8IA 4CN6A 4JFWA 3GBDA 4J27A 4L9ZA 3EWYA 4F0SA 1YXCA 1E71M 1ZU8A 4JKMA 3RX2A 1TIWA 3ZVHB 3WKZA 1I8JA 3VYLA 4DN1A 2HS8A 4IQEA 1L6WA 1ME7A 4GFIA 4C1LA 4JIEA 5DO8A 4UZSA 3WDHA 4UC5A 4YTUA 1XH0A 3C3NA 1F7BA 3LDVA 1A0DA 4Q8NA 3MBFA 4Z1BA 3VD5A 3LENA 3W7IA 1KFLA 3LSBA 4FNSA 3BJFA 4YLWA 3A64A 3FYOA 2BB0A 1UWUA 3N9RA 2A3CA 3OTRA 3LRMA 2WVUA 1KKRA 2OWWA 2GVLA 2E77A 4UR9A 3HGJA 3G6LA 2XGZA 2CESA 4I5UA 2ZXBA 2WSQA 2PDMA 4HA4A 2PWFA 4ZCWA 1POKA 1ZUAX 2IQDA 3QC3A 4CCZA 1VJZA 1YEYA 3WJSA 5FF3A 1XFCA 3NURA 1TZZA 1V7AA 3LBOA 2X40A 3TWBA 3CXOA 4UFJA 4H2CA 2CETA 4DJFA 1H3GA 3BV4A 5G1MA 4AEEA 3V3WA 3Q67A 3O0FA 2GGGA 4H7VA 4J5NA 4NZCA 3E2QA 3NCOA 2NLYA 3AXKA 1BHGA 3CBWA 2WPBA 4DM2A 1IIGA 1HL8A 1REQA 1OT1A 1S38A 3GC4A 3SUVA 1QI3A 2YA0A 4S3JA 4HHMA 1MUWA 3T8LA 4GI9A 4QLJA 3ABXA 1E1EA 1GW9A 1XLDA 3U4FA 2AL2B 1WE5A 1TV3A 1S2AA 1OCJA 5HA7A 2W5FA 1GVSA 1R9YA 3BAJA 1MXDA 3MPGA 3VU2A 2Q8LA 2BSLA 4BK9A 1EX1A 3AJXA 3L67A 2J75A 5H91A 4OECA 3ANUA 3DHPA 4OVXA 3UA4A 3H26A 5D8WA 5HK4A 4KWVA 3KBVA 3CAVA 5ABEA 4JQ1A 4N0RA 1HJQA 1UZDA 3KRSA 2PDUA 3VCNA 3MMUA 4LB3A 3GH7A 4DQWA 3EX4A 4PFHA 1W3NA 1QI0A 1GYLA 3EMZA 1W3IA 5BXPA 4BWLC 5D2WA 3LI1A 3DFOA 3MWAA 1XI3A 4N9BA 1EYEA 3E12A 3KWSA 3GWQA 2BY2A 3TROA 3C2OA 3NIYA 4KQNA 1QO5A 5D04C 3U0HA 3M44A 4EXAA 4KGJA 3QVQA 4MWAC 5C54A 3C2EA 2DZXA 1LJYA 2Y5SA 4HYVA 2PBGA 4ACYA 3HQNA 4K8EA 2ZZ3A 3GKFA 1MXGA 3PZTA 4JTTA 5E09A 2GL5A 5EMUA 4ZSUA 2ZVRA 1G69A 3O3RA 5FJJA 3FKKA 1C92A 2IKHA 3TQKA 4DYKA 1FH7A 3LCWA 2PDLA 3O07A 2A3HA 4G9PA 4L6OA 3IAPA 1H49A 1BF6A 2QV5A 5REQB 3SCQA 2WSRA 2V67A 2XUCA 4BQ4A 1SW3A 4IOTA 3OIHA 4K6AA 5F4SA 3P84A 1RSCA 4RPPA 4XKMA 4UCGA 4HIBA 3NXLA 4E38A 1OGBA 2ACQA 2FFIA 4AEFA 1FUYA 1KD0A 1E1CB 5KZMA 3STFA 2DZSA 3P14A 4MWAE 2OGJA 2OZ0A 4L4MA 4E5TA 1R38A 2Y1HA 2Z1XA 1KO0A 1FWTA 2WO5A 3RMEA 1PL9A 1PZ0A 4DUWA 1XKJA 1SJAA 2F6KA 1A80A 3BGJA 3EPNA 4E3VA 3VD9A 1B5TA 3W87A 3W1QA 3CUFA 3KL0A 3EWDA 1Z69A 3QPZA 2Y8VA 5LHEA 1JCLA 1KM3A 3WMCA 1W54A 3HN3A 5D03A 4AMCA 2H3DA 4IPNB 1A5AA 4F3HA 5FEPA 3BZJA 3OGVA 3R8RA 5AC4A 1XS2A 3QH2A 3M0IA 3E38A 2D2OA 2GJPA 3LMZA 3NJ3A 1WXYA 2WZEA 1E51A 3H22A 4NZFA 2GDUA 3SCPA 4M6QA 1VRDA 2NV2A 2OFJA 3N2XA 2FJUB 5CAKA 4XAFA 1D3HA 3RX3A 1PUDA 4HSHA 3OLIA 2IPWA 3O2LA 2BG5A 1MZRA 1XG4A 5XIAA 4KFNA 3E5BA 4LYKA 1DJNA 1XRFA 5AYBA 3CC1A 1GQKA 2XWEA 5BOFA 4D6FA 1OFOA 3EKGA 3S9IA 1J9YA 5CC3A 1A5CA 4BI5A 3AYVA 1AVAA 4C6CA 3UWEA 2XIJA 4C6PA 3INPA 4PODA 4GQ0A 3C2YA 1X1NA 1GWJA 3MCOA 4Q8WA 1HKWA 2XN2A 3W25A 3LX9A 1O66A 3V0UA 3SGGA 4XSLA 2ACRA 3FCPA 4RZ5A 3WBAA 3VC5A 5IHRA 4MJ2A 1QW7A 5E70A 1BRLA 1WKFA 4AX7A 4EANA 3EPMA 3PANA 3LQLA 1GOOA 2DDXA 2CKSA 1SR0A 2VFDA 3MT1A 3C0JA 1W9PA 4GYFA 5AY7A 4WKFA 3DIPA 4DUVA 2W3ZA 1W2PA 3HIJA 1TPB1 3RU8X 3SURA 4L1GA 3TYEA 1KTBA 3AFBA 3GXFA 1BVZA 2ZADA 5ABTA 2PA6A 3AXMA 1XIFA 4AD0A 3W3OA 4S3DA 2QMKA 1Q6OA 3VX1A 2TYSA 2P5NA 2V2CA 1CZ1A 3NEVA 4LRTA 1D7KA 1DJXA 1OX4B 2WCSA 1TG7A 3QOKA 1S2TA 3M47A 3WK1A 1UBPC 3BSHA 4JTUA 4MVAA 1GPFA 1QPOA 1K4HA 2P10A 4AZ7A 1RZMA 1EWEA 1G9HA 1ZTVA 2RKXA 4LNYA 2X1UA 1YNPA 2J8FA 3TAKA 5HUPA 2OZTA 1LT8A 1XIHA 1W9BM 5HR6A 3ARTA 1BQGA 2PF0A 1MQPA 2HNHA 2GJXA 3QHNA 1R6WA 1SFJA 1TJRA 4D6HA 4O1BA 5CGTA 1J11A 4PMZA 1P0DA 4B5NA 4AZGA 2PP0A 5I79A 3W7EA 3VCCA 1NAL1 1QJWA 2I9UA 4LAOA 3G1XA 2ZE0A 2V81A 1WOAA 4MKNA 5F4XA 2VRKA 3W70A 1JFHA 4B2DD 4KRZA 4E2BA 1TPFA 4Q4QA 1HZYA 3WJWA 1ONWA 2XIBA 3XISA 3TC7A 2ZC1A 1JPMA 4L7ZA 3CMGA 4OE7A 3IARA 1R3SA 2XWDA 2QCDB 5HOSA 3BWWA 3TW6A 1CLKA 4R9OA 1A49A 1WBHA 3VK5A 4XUYA 4DF0A 2R1PA 4NY2A 2FGLA 4QISA 5M3WA 1Q4WA 3W7JA 1WP6A 5FEXA 4MKSA 5E0FA 4OHQA 3IGSA 2FZBA 2ZZ4A 3GXTA 4NXSA 3GIPA 2QW5A 1OIFA 3LSCA 3S42A 3F4WA 3SBFA 4HT3A 3I6RA 5D2VA 2VEGA 1KTCA 4REQB 3RPMA 1LG2A 1XIBA 1EOKA 1QRQA 1JDFA 3L12A 4GGHA 1DV7A 3L0KA 4HNUA 5D02A 3B9OA 2DORA 1FHLA 3S6DA 3P61A 1LM1A 1PAMA 3LLDA 3WNLA 4LGXA 3SY5A 3Q4DA 4KF1A 1WUEA 1JPIA 4PCFA 4ROPA 5A8QA 2QUUA 2EBNA 3RPDA 3KBMA 1GVEA 1PCKA 3VNZA 4MYAA 4UQCA 3BCFA 3VA8A 1LT7A 1HNYA 5C9ZA 4IM4A 3ARPA 1M6JA 1CX9A 4UTMA 1HGWA 4PMQA 3HU7A 3IIOA 5HMEA 3WJZA 1W3HA 3P0XA 2AAMA 1UMYA 1LRQA 2XVKA 3II1A 4O15A 2DSWA 4FMVA 2J6XA 1LL7A 5FIPA 2XSAA 4UCFA 2FJKA 4F0RA 4H8NA 1H41A 4LB4A 7TIMA 5K4XA 4HZ7A 5I3HA 2PF8A 3NM1A 1VPYA 2EXOA 4KCTA 3APYA 5BYWA 4XO7A 3UR5A 1AH4A 1J0JA 3KFTA 3GH4A 1HKKA 1XLGA 1XKYA 1LRTA 2OYMA 5FEZA 3W1RA 4JL1A 5I02A 3UW6A 1I1WA 2E09A 4UTTA 3KRBA 3B97A 2G97A 3EOOA 1SZEA 1A4LA 3NOYA 4WEVX 3MVTA 4L80A 4UTHA 4IIFA 3MCMA 4ICNA 1B3YA 2V9DA 1NH6A 2E9BA 4QJ5B 4EP8C 1SM9A 4JIHA 4CD7A 2PWUA 3FEMA 3HG3A 3WO8A 5MKGA 3SN1A 3E0VA 2PRLA 1OYBA 2A7RA 2ISWA 1CEOA 2UWFA 4AWEA 1KRMA 3B8SA 2BXVA 1RK6A 4Q8VA 4PC8A 4EPDC 1EP1A 2FPYA 4Q4RA 4Y2WA 3SJ3A 5JIPA 2REQA 1F74A 3TX9A 4HVXA 1CENA 3P8IA 7A3HA 1GHRA 1IZCA 4GINA 3C3UA 3GD6A 4XSMA 3TJXA 3T8QA 3LRKA 3K4DA 3TDFA 4HYRA 4N9EA 4Y9OA 4CCCA 4N02A 1ITQA 1SZFA 1BD0A 4ZTYA 1KLZA 4QP0A 1F5ZA 3KZSA 4QQUA 2YJQA 3W1NA 4WZHA 4YU1A 1KFBA 2AMGA 2RDXA 3A21A 1LLWA 4ALDA 2W0UA 3AIWA 4PTDA 3B8TA 3WEMA 3V1HA 1YDYA 4ICCX 2I5QA 3C0LA 3VD4A 4MAZA 4UMCA 1EA0A 4WGHA 2PDQA 2R8WA 5LIKX 1EH9A 2VMFA 2IKGA 2E1WA 1FWCC 4Y90A 1W1B1 4D71A 3EX1A 3W82A 1RY8A 5CZJA 3KL5A 3LD5A 4XAZA 1R7OA 2X1RA 2Z4GA 4Q8QA 3R7MA 1XUZA 5TBOA 3W1PA 1Z6KA 1T8XA 4H9MA 1GYNA 3TIMA 4A4AA 3GNDA 3PY2A 1EIBA 4FNQA 3W2LA 3G2GA 2VQUA 4V28A 4WSHA 3WUGA 5CPLA 3URNA 2P88A 2ZBTA 3WD3A 2CLMA 3M5XA 1VPXA 5IDIA 1SO5A 2GWGA 1XQLA 5JH1A 3V7PA 5I3GA 1KM1A 5JBDA 1GG1A 3FAWA 4N6FA 1SYTA 1UWSA 4IHCA 4NRSA 4F79A 2UV8G 1DPMA 3I3EA 4H7ZA 2I16A 1DQWA 7PTDA 1AQFA 3OG3A 2Q6ZA 4HD5A 3TQPA 1RALA 1LL6A 1ZJIA 1A5KC 1TPDA 3HMCA 3SGZA 2PDNA 3HJZA 4IH3A 3DGRA 3CYJA 4GUHA 4G1KA 5ABGA 2NXIA 2VM8A 2Z0IA 1WZMA 4O13A 2V3DA 1JF6A 2Z2AA 1P48A 4O8RA 4DLMA 3S4TA 1AD4A 4S39A 3TTQA 2H6RA 2ZWYA 4A3YA 3NSNA 1B0IA 1LG1A 2L5HA 3AYSA 2BS9A 3UGRA 4M0XA 1UWAA 2A4AA 3GG8A 3R0UA 4M1BA 1M1BA 3N3TA 2E9MA 3UR7A 3QTPA 1SFLA 4QAIA 4Z0SA 5I23A 3RK8A 4A8LA 3B9DA 3CZGA 1EYWA 1NQKA 2JKAA 3LOTA 2J7CA 1AL7A 1MXSA 4JIRA 3CV6A 4UFIA 3OHIA 4I5RA 1AJ2A 4JTGA 3NGFA 2XFRA 2ESCA 5I77A 4C6JA 1O5QA 3C86A 5AC7A 4KKXA 1VEOA 4BY3A 4QEHA 5M1TA 3TR2A 3C0SA 3EYPA 1QNSA 3TV8A 3E2SA 3NL5A 2V5DA 3TFXA 4MOZA 2ZDSA 1LWHA 1C93A 4UIOA 1HKMA 5JXQA 3IPWA 3FXYA 1JZ2A 1A5NC 3A4WA 3M9YA 1GKPA 4R34A 3ZZ1A 2YBTA 3H7VA 1RLCL 2A3EA 2VJXA 3UY7A 3GVWA 1A5LC 1K7EA 4Q3MA 1M7JA 3WFLA 4YVXA 4DEFA 3FSUA 3DFQA 2Y61A 2E8ZA 4QEEA 1JQVA 2RJHA 2VOMA 3KUMA 4ZMGA 3M41A 1OFAA 3QQ0A 4OZOA 2G95A 2Y24A 2WJDA 1EUNA 3G1FA 4S3BA 2QCMA 3QKEA 4MWAB 1M65A 3EKZA 1JPHA 4JCLA 3W74A 1SPQA 3B0VC 1SW7A 4M7SA 2VX4A 5E5CA 1X39A 5BCAA 3S5SA 1QPNA 2J25A 1VD6A 4E4FA 3OU8A 3H7UA 3VIGA 1A0CA 1KXQA 2XHYA 1X7IA 4KWUA 3SCUA 2NQHA 3LLFA 3OQEA 3GSMA 4GD0A 1TMQA 4P7NA 3VGDA 4C6IA 3GDTA 4P7QA 3ZMRA 1XYMA 1UR3M 3AMLA 4N2YA 4TMCA 1LYXA 2GK1A 4MLRA 3GYEA 1WPCA 1O7AA 3LNMA 4FLRA 1JDAA 1GEHA 1C90A 9CGTA 2G0WA 1GQLA 1DQUA 3R1ZA 2D1ZA 2VD9A 3RF9A 3R13A 4HMCA 3EXRA 3W75A 3RXZA 3WQDA 4M56A 1TJPA 4R53A 1BPLB 4MM1A 1H1ZA 1OHLA 3RM4A 3GYCA 3WD1A 3APTA 1PDYA 2Z1KA 1P0BA 3S5YA 1IXNA 3BL3A 3EXSA 3GX9A 4Y9MA 4PRRA 3GNXA 1O1HA 1CGXA 1O5KA 3HQOA 4P8WA 4RW3A 4O11A 3IUIA 1XIEA 1XHGA 3AHZA 1XJBA 1I2NA 3AU2A 4KGLA 3NQCA 1B30A 1L8PA 1AQ0A 4AEOA 4ZENA 3AXHA 3FN9A 4V1XA 3OVQA 2DVUA 3R6IA 1TV5A 4S23A 3B8VA 4ZQRA 3RIKA 2RJGA 1V77A 2EEXA 3S46A 2YYUA 3PULA 3THQA 1GOXA 3BG9A 1E0XA 3UZZA 1JYXA 4F4RA 2WLYA 4A2RA 3SI9A 1RCQA 4CU6A 1PHWA 3YPIA 2OTDA 2YL8A 8XIAA 1W3KA 2WKJA 3WF4A 1F76A 2V3EA 2Z7GA 3GKAA 2X09A 4JX5A 4L6DA 4KRUA 4GQRA 4K8HA 5HR7A 1ITXA 2KX9A 2GJNA 3L4YA 5ABFA 3CIVA 4K39A 2J7FA 1S5WA 1KR1A 3P93A 1E3ZA 2ZRUA 3LPFA 3MZ2A 1TA3A 2XGBA 1UIPA 4DI8A 4US5D 5I78A 4ATWA 4M1RA 2XSBA 4LVDA 2CZFA 1OF6A 2QULA 1US2A 2FZDA 3TA9A 2DW6A 2OCZA 1TMHA 2HE8A 2YFNA 3NQ7A 3RU6A 4KESA 1SJBA 4J3UA 4D6CA 1F61A 2VC7A 3ZR5A 1EKOA 1W0MA 2R9RA 3UXKA 2WB5A 2W91A 1XBVA 2V69A 4GJIA 4HA3A 1FH8A 3PZVA 1T40A 3EMQA 3VDHA 2PWGA 4Q8TA 1VKFA 1ONEA 1XICA 3RO8A 1KBJA 1W56A 1Y5WA 1PTAA 3GHUA 2J74A 4UB9A 3TOYA 4PUJA 1SJDA 4RPQA 2VNCA 3QFWA 4KEVA 3W53A 5EFFA 4XZHA 3RRXA 4IQDA 2P1FA 3W7KA 3L66A 2PDXA 3H2EA 3CUGA 3NAVA 3POCA 3T40A 3BPWA 4QJ1A 4I9TA 5A6BD 1ADDA 4A29A 3M0ZA 1R2RA 4HNTA 1GKQA 2XSXA 3W7NA 4AF0A 3BE7A 4Z0JA 3VNYA 1Y8BA 1K70A 3VINA 1QK2A 4Q8PA 2D0FA 4S3AA 4CEXC 1R3RA 3G5EA 2WC3A 4O16A 2OLSA 1QO2A 3U4AA 4AC7C 1K8XA 4CQBA 1IEXA 2J88A 2D3LA 1RXOB 1NWRA 3LG3A 2PB1A 5C0QA 1A5SA 1XM3A 3SCSA 2VX7A 4AXNA 1S5MA 3PNUA 2QAPA 2CERA 4HTBA 1AJZA 3E74A 1V3KA 2J7BA 1R85A 3H12A 5DXYA 3GVGA 5CC6A 3STEA 3N6JA 3GR8A 1V6UA 2HVMA 1WDSA 3K8LA 4QJ3B 4GVFA 2EPNA 1YBQA 2QT3A 3BJTA 1SR9A 3QRHA 2PDPA 4R7WA 3T07A 2XH7A 2NSOA 1VZWA 3QPYA 1JAEA 4LBRA 1MW1A 3VDCA 5CG0A 1I2RA 1O4UA 3VPLA 2BY3A 1VJIA 1N8FA 4IICA 2OKTA 2QKFA 3N15A 3LCIA 5CPMA 2V5BA 2AGTA 1J0KA 3K1DA 6TAAA 3PZUA 3SW6A 5EL1A 5C7VA 5JBFA 2G5WA 4KWOA 4LCSA 4LS0A 2NQ9A 2YR1A 3CH9A 1POJA 4RL3A 3R2GA 3NQ6A 3UCDA 1AH3A 1JI1A 1UWQA 2OZ8A 1TFVA 4CNNA 4IX0A 2EGZA 2DIKA 3W1MA 1XIGA 4B5WA 3VZXA 5C6MA 2WANA 5E9AA 3NQMA 3W37A 3U9IA 1HKIA 1TO3A 4DBEA 4AU0A 3S9ZA 1B3XA 3VNLA 2FZ9A 2GVGA 4M6UA 5I5RA 3MKCA 1UZHA 3WK2A 3DAQA 3HV8A 2GUUA 3TMQA 3WFZA 3SUUA 3EPOA 1ICPA 1LOLA 4JTKA 1UUMA 4G56A 3S2MA 1EHNA 4KFOA 2V3GA 1VEMA 4OUIA 1DXEA 7XIMA 2AAAA 1ICQA 2BOGX 4FOKA 3P5YA 4M7TA 5DCEA 2WMIA 2A3BA 4IMEA 3MV01 1QDSA 1OK4A 5CSUA 2VT0A 2R1KA 2XVLA 3A22A 1MDLA 5AHNA 3KBSA 4M51A 4FIRA 2XM1A 1VFHA 3MI2A 2WHKA 1M53A 3G24A 4GMEA 5EMMA 1VENA 4KETA 1CI1A 1R3YA 3DYOA 3QBUA 3L2MA 2OWXA 2R94A 1Y5XA 2O9RA 3AICA 3GDKA 3DFSA 4H04A 4ZODA 4Z08A 1FWNA 1AK5A 1D9EA 1H62A 3DFTA 1HG3A 2Y62A 3XINA 1U5HA 3S1XA 1X96A 3USBA 2YOCA 4FP1A 3AIRA 2RHGA 4W84A 3RLVA 2P8CA 2QMJA 2GOKA 3OA3A 1FXQA 1K9TA 2CU0A 3CJPA 3IGXA 2QCEA 2QIIA 4O1CA 1I0BA 1RLDA 3NWRA 4RXFA 1C29A 2WZIA 3UJRA 3B8UA 5LYRA 5FF4A 5EA9A 4DWSD 4B3LA 3MUAA 4PUWA 3O6AA 3LMYA 1VLIA 4GY0A 4OTKA 4Q4MA 1P1XA 2EPOA 3G1SA 4K1GA 2XH2A 2X2YA 4IG2B 3H54A 4LAKA 1G6CA 4MB1A 3C56A 3GC5A 3TN4A 3H2MA 4UWMA 4EXBA 1EA9C 4IFRA 4IL2A 1E6ZA 3VKAA 2P0IA 3N2BA 1KQZA 1OADA 4QQ3A 1UYQA 2QCFA 3UPMA 1J6PA 1THFD 2QF8A 4OQVA 1ICSA 1S3TC 3GG7A 1XYZA 3KVKA 2X0YA 2QJHA 3FAXA 2YBVA 2PUZA 3A4JA 1CGVA 3QMRA 1HXJA 1TV8A 5FJOA 2EO7A 4XZBA 3U6WA 1L6FA 3PR2A 3R94A 4IXHA 3UXLA 3OYZA 1XRVA 4H41A 4G7EA 2FZMA 1MSSA 3PHAA 4WIWA 4P7LA 3PN8A 2FLIA 3BAYA 2GDQA 3WK3A 3POHA 2Y63A 3AISA 1R86A 1LQAA 4EKJA 2QXWA 2OZ3A 4GFSA 3A5VA 3F1QA 4FXFA 4NZ3A 4NI3A 5CPQA 3NTYA 1AA1B 3CHFA 4JD4A 3E1F1 3LM7A 4IPJA 1ZFJA 1QNVA 2B81A 3AUOA 4A3RA 3AWNA 4J28A 3SRDA 1ZAHA 4UQ9A 5AHIA 1KV5A 1EZ2A 2DQXA 1G7VA 5C55A 3SM0A 2YL6A 3ZSTA 4DI9A 4JYDA 5IDZA 2YXGA 2B7OA 3ICJA 2PTZA 1WZLA 4H1ZA 3I3BA 2JE8A 1NFPA 1US3A 2F7FA 3TLLA 1BFNA 1MQRA 3T7VA 2W61A 3H4GA 1K8YA 4KW2A 5C71A 1KM5A 4GWEA 3ELFA 4RLIA 1N55A 4JNZA 1G01A 1UD5A 5PTDA 1QATA 1EPXA 4ZQCA 2VC9A 2J8TA 2B7PA 1DBTA 2CHNA 2Z25A 4Q7NA 2D0GA 4NILA 4XBJA 4RNJA 4I6KA 1F6PA 3TC3A 1IXPA 3EWXA 5EB8A 4Z2IA 4B3ZA 1NELA 2C19A 2PLCA 1B9BA 4LS2A 5KZ6A 3MCNA 1NWSA 3FDGA 2J27A 1BXNA 3I10A 1KBLA 1PE1A 4IQLA 4AHOA 2O9PA 2QS8A 2PDYA 1TPH1 1S1PA 4NASA 4PUDA 1XDMA 1OEPA 3GIQA 3PZIA 1IT0A 1JD9A 3ARRA 9XIAA 5HJXA 1G4PA 5DT7A 3C6CA 1W37A 1QR7A 1QWGA 4ZXOA 4YTTA 3RCYA 2G3MA 2VEIA 2D73A 1YQ2A 2DZAA 1KA9F 4QR6A 2ZX5A 2WNWA 3B0PA 3LERA 1XD1A 3AIUA 2JGYA 4PB4A 3P62A 3FKRA 3UNDA 1J10A 3AROA 2VVSA 1OFDA 5KITA 2B7NA 3STCA 1BYBA 4IMFA 2WQPA 4LRSA 3TYBA 5HPCA 4XD5A 1U33A 4PUNA 1QNPA 3U3HA 1ISWA 5G2WA 3PAOA 1SZGA 4XX6A 4A8NA 4H01A 2QVHA 4MY9A 3CT7A 3HF3A 4RCXA 3E0LA 3SADA 3WLNA 5C2GA 1D7FA 3VNIA 3L0NA 3F4DA 1W1YA 3VVGA 1W32A 3EXTA 1S3HA 2FPVA 1VQTA 3F2DA 5DT5A 4MNJA 3PTMA 2CLFA 1R8LA 1M3UA 4WK9A 3WLMA 3UGVA 3KOFA 3JVAA 3KCJA 3ARVA 3TLQA 4NYYA 3QV6A 2YDSA 2O92A 3KTXA 3VTRA 1J4EA 2IS7A 1HJUA 1E5JA 3NOEA 3LXCA 1FA2A 3HG2A 2QUNA 3DC0A 4S2CA 4XB3A 3IIVA 4D6IA 1XC4A 3BQ5A 3EDEA 1W5PA 2C0AA 3CZJA 4GUGA 1BRLB 2E7FA 2WVTA 1LOSA 1NFGA 2QDEA 2J79A 3CIWA 2F9RA 2FTPA 4QDMA 1UR1A 1NVMA 3KX6A 3H23A 1YTEA 1U1HA 4EK7A 1T0OA 5A95A 5HNTA 3F7JA 1UP3A 1ZGDA 3E9AA 1C9DA 5HANA 4NJIA 1O5XA 4P5UA 5T91A 5A94A 4DO4A 3CZLA 4JKLA 1XBZA 3H70A 2JFEX 2C1GA 1BSIA 5F1VA 1CCWB 3JZEA 3L5LA 4O1AA 3URBA 3T2PA 3CPRA 3Q65A 2Y4SA 4US5A 3HM7A 1CB2A 2INZA 4PBGA 4W5ZA 1RQHA 2GZXA 1WB0A 3W26A 3KP1A 3N2MA 1MDRA 2GQ3A 1BXBA 2G50A 2WM1A 1XV8A 4BQ2A 3T0AA 3GVRA 3K8MA 4S2BA 4LALA 1B4KA 1JAKA 4QBXA 3QYQA 1GYMA 3KS5A 1AQHA 5A6SA 5C5YA 5CJ5A 3LNPA 4KIRA 3IVUA 1U30A 4UFKA 5HJLA 1EF2A 2Y89A 4P7RA 1J0YA 4L4PA 4Z2HA 5A2CA 4GX8A 4EVZA 4I8DA 1PYMA 4XD6A 1LLZA 1NFBA 1TR9A 3L21A 1OVDA 4PH6A 4X60A 4HPJA 3QV7A 2WBKA 4MUZA 1VP5A 5E0CA 1X1OA 4Y6GA 3VOGA 1TX0A 4Q33A 4DJEA 2ADAA 2Y7DA 4DXVA 3UT0A 4XG1A 2QVNA 4O28A 1X8CA 1JYNA 3SCTA 1Q63A 1VFLA 1T5AA 1UR2A 1P6BA 4WSJA 4JHMA 4UMBA 4UOZA 2W9MA 3KOXA 4LV4A 3SR7A 4PA8A 3AU6A 2RGMA 1A3WA 2XN0A 4NAFA 4DAIA 4YTRA 4AZHA 3T09A 3EZ4A 3SUSA 2F6UA 3R4IA 4JNYA 4NF7A 1TVPA 4AZ5A 3C2FA 1TPC1 5LA0A 4GA8A 2ZFAA 1XIDA 1LL4A 4B5SA 4F0HA 3IJ6A 4MYXA 4DJDA 2E0PA 1F07A 2HV5A 2P53A 4KEZA 2CBIA 2VZVA 1DWHM 4PEKA 3N1AA 4A05A 2FMNA 1Q3NA 4F66A 1RD6A 1ZAIA 3UWVA 3MJMA 5LIUX 4DF1A 4NAEB 1CDGA 3ZXWA 1WV2A 3HTWA 3A3XA 4MG4A 4KPLA 4ZTXA 4QE4A 3KVMA 2WMKA 4Z2GA 1QCWA 4HQVA 4ZA0A 3MQTA 4GHRA 1YPFA 4DZ5A 3WFAA 1V7YA 3M16A 4ZB2A 2ZE3A 5JIWA 5A1AA 1MRQA 1TPVA 1WCGA 4JTRA 1YPIA 4B5XA 4OOUA 5E6ZA 3DFYA 1QOPA 1HQTA 4F2BA 2LLEA 3GHTA 3KAOA 1QW8A 4N7QA 1JZ6A 3M0HA 1WAWA 2QF7A 3NDYA 3NG3A 2WKGA 1GNXA 1V8EA 4CNSA 5G4WA 2A6LA 3HPAA 1KFWA 3ZWTA 3S0CA 5EMYA 4IIDA 4F2UA 3OZYA 2QJGA 4GNKB 3DH7A 5CPOA 2PTXA 4TMBA 2CLLA 4BI7A 5ECUA 4MZ8A 5LNVA 3G3DA 4I9MA 3LPOA 1QASA 1NTHA 4UTIA 4JTCA 2VC5A 3BO9A 4WRHA 1B57A 2DVXA 1ZL1A 1IF2A 1EJSC 3DECA 2B7QA 2Y7GA 3H55A 5A6MA 2Q3RA 2RFGA 1PDZA 5I3FA 1RY0A 1WKYA 3NZ1A 2KZHA 1E4IA 4YS1A 1OZQA 3RPTA 3MU7A 2VDGA 2VTFA 2NVCA 3LHYA 2WJZA 5J04A 1GHSA 3KS6A 5CKSA 1QHPA 3PZOA 3GXMA 2I5GA 1YKWA 3ERPA 3V4BA 3BG3A 2Y85A 2J47A 1FWHC 3RDKA 3IJ9A 3TUUA 3AMCA 3AYRA 4H9YA 3AS0A 5TAOA 4CQ9A 1L8NA 1VPQA 3GW3A 5A6JA 3BMWA 1DIDA 3G0XA 4AY7A 1IGSA 1GQIA 2E5DA 3HGSA 1K6AA 4UTJA 1TTJA 1UR4A 4IGHA 4E6MA 2DH2A 1YNYA 5EMKA 2J77A 1QU4A 2ZRWA 1M68A 2Z1BA 1MMFA 3V35A 1CXIA 4RK8A 3R5EA 1UIOA 1RR2A 4MUPA 3ITXA 1P7TA 1W1VA 1G0CA 4TVCA 2QCGA 1ELSA 1XYCA 3TNOA 5HDRA 3S1VA 1TMLA 4UBPC 3MSGA 2DP3A 2Y8KA 4XUGA 2QDGA 3VILA 1QHOA 1J6OA 1PTDA 2PSNA 3NDOA 2ZZ7A 1ZHAA 3BLKA 4LEQA 3WQCA 5I06A 1JZ5A 3ATYA 3B9NA 3M07A 2Q02A 2PDIA 4LAMA 4WGXA 3MANA 4XKYA 3VGHA 3MUXA 5DMNA 4H9ZA 4R27A 1XD0A 1PSCA 3SDOA 3REQA 3C0QA 1KM2A 3TSDA 3N12A 4PGLA 3D3AA 1ZQ5A 3PF3A 3WL0A 3MY9A 1JZ7A 3EOSA 4W93A 4ZO7A 5LNWA 1A5UA 3Q45A 3EB3A 1F8MA 1LBFA 2ZUMA 4GO9A 4RV3A 1CNVA 4MGGA 1US0A 2FH8A 3UESA 2BXYA 1L0PA 3KLKA 2HE5A 1PX4A 4NRRA 3M5ZA 4DHGA 3LBMA 2EPKX 3ENLA 3KE0A 4HP5A 2NQZA 4OOZA 3HFTA 1UKTA 1KTNA 1EWDA 2ZZ5A 4H4IA 7REQA 4YXGA 3QV8A 1L6YA 1MW2A 4H8HA 1B3VA 3W71A 2IQ0A 4DO7A 4R9XA 1J5TA 2ISSA 4GX9A 4CEUC 3PVFA 4RE3A 4DJFD 5D09A 4PUEA 3BK0A 3COTA 3FEQA 1UWRA 3PG9A 3DX5A 1ZLPA 1DTNA 4M3PA 3MC5A 3UR2A 1FWDC 4QS5A 3DU0A 4Q6JA 2GJRA 1W9VA 5J5RA 3O6CA 4XTDA 2UY5A 1DP0A 3GXIA 4IF2A 2A0NA 5IFTA 4B16A 3W0KA 2X05A 3G0UA 1CGTA 2QIWA 2GLKA 4AZIA 4XAYA 3NQFA 4GCAA 3GM8A 3BUVA 2C18A 3KTSA 4TO8A 4H19A 3H2AA 3DYPA 4IIBA 5D9PA 3G8RA 4UUIA 1XWYA 1RUSA 1XC6A 1K3UA 2TSYA 1NDVA 2EPLX 1E0VA 1V0NA 1ZZMA 5A2AA 1V3MA 1LORA 1EXPA 2D69A 1H09A 1PBGA 2OWCA 2GUBA 4EPEC 3E6EA 3KHDA 1ZSXA 4WLCA 2IPGA 1UQYA 4YYCA 3NPVA 3QFEA 3WENA 4NYUA 3ARQA 1UH2A 3VKJA 4HZMA 4DX3A 6ENLA 1GK8A 2H9AB 3CWOX 3VFCA 1TSIA 4HK6A 5BW6A 1I45A 1O1ZA 1VFSA 2DV0A 1A3XA 1YRRA 3AYTA 5E93A 2ATSA 4BF9A 3CHEA 2AQWA 4RZBA 2WZMA 5BNKA 4BQ5A 4CGTA 3D46A 2H90A 4KRTA 5CLTA 2GK1B 3CQHA 5FD0A 2I7GA 3AZRA 1X6NA 3I7RA 3W7GA 3PJUA 3IRDA 3IVSA 4JYFA 4GABA 4JOMA 2AQVA 4IQJA 2ZXAA 1UROA 4YL2A 3A4XA 3W24A 4FXRA 2I9EA 3D5HA 4AQLA 4AIOA 4AH7A 1R7AA 2BVWA 2UZ9A 2E5BA 4K2SA 4FS9A 1EUAA 3W1TA 1O95A 2DT1A 4WSKA 2RAGA 3ZJ7A 3TN3A 3VE9A 4LYQA 4C5YA 7ENLA 2RH9A 2QR6A 1JEZA 1FOBA 3TWAA 1RCXB 4G8TA 3W07A 4GZEA 2X8RA 2IXUA 3AHYA 3TTSA 3S1WA 5IBXA 3WLJA 1XISA 1N82A 4V1YA 3OBEA 1I2PA 3WQ4A 3V0SA 1T99A 3HA1A 4JDBA 4XZWA 1ZBWA 1FXPA 1H2JA 2HRWA 3BAXA 4KS0A 1E0TA 4JTEA 4X61A 3WMBA 3SCNA 2XJ7A 2RDWA 2Z1WA 3LHWA 3VXGA 1FRBA 3BURA 3GNPA 3KTCA 1DWAM 3GR4A 4MHBA 2YW4A 2WWDA 4J3XA 3WLTA 3LU2A 2PZNA 1C8VA 3TSBA 4H6EA 4NP7A 1XG3A 1V3JA 4O50A 5EPDA 1GOIA 3NL2A 3VDGA 5ABFB 2NV9A 1E0WA 3WF1A 5BXRA 2PLMA 2A5HA 4L4LA 1IE7C 4BCEA 2VR5A 1TA3B 1I2QA 1E72M 3DDMA 4LUSA 4AUBA 3MI3A 3OODA 1XUUA 4J2PA 1HT6A 1VYSX 2VVNA 3EWBX 4HTYA 2J78A 5CGMA 4YIWA 1KGWA 4XAGA 4ZQOA 4IGSA 4HCDA 4DYEA 3T42A 2TPSA 2DIJA 1Y65A 4NUWA 1ESWA 4P61A 2EAWA 3BGAA 5H8PA 3GTNA 2JIEA 2HQAA 3DC8A 4ERGA 4XAPA 3CPUA 3RAOA 9XIMA 4S38A 4Q4PA 4YYFA 3T2QA 1KM4A 1DXIA 3VABA 1JZ3A 1W9UA 3AS1A 5CG7A 3W38A 1CYGA 4AW7A 3LPGA 2VCBA 2XDFA 3DG7A 4UOJA 1FWEC 4X2PA 4O53A 4AIEA 1Z8AA 4JICA 4HK5A 3S1GA 4BI6A 5CJNA 2G3FA 3UWWA 1Q6DA 3PJXA 4MB5A 4NKCA 4KCWA 1AODA 2R91A 4JQ3A 4ZL1A 3G0SA 3WLRA 2GJLA 4B91A 3NPXA 3LCFA 2OQYA 4H6RA 1HO1A 1XLIA 1GVFA 3DENA 1B4EA 2WJEA 1ODUA 4U4MA 1VFOA 3ZVHA 2INEA 2A7PA 2ZX9A 2C91A 4AF0B 4Z2KA 2QPSA 3P6LA 3N2CA 3TK7A 2OYLA 5I0DA 1G67A 4NG3A 2X0HA 2DZUA 5ECVA 3PZ9A 3C2VA 5HNNA 1FWWA 1XSKA 1HO4A 1ADSA 2DSUA 2Z1SA 4WY0F 1QBBA 4HGXA 1EOMA 4M6VA 1KRBC 2E67A 1WNOA 3CAQA 3TN6A 2GVYA 2VELA 4FF7A 4U3CA 3BARA 1LWJA 1OQFA 1HW6A 4JY8A 1OCBA 3OJGA 2FVLA 1FX6A 2E25A 1YLVA 4CQDA 3RYSA 1KGUA 1TV2A 1HL9A 2PPGA 4PULA 1B31A 3TA6A 1YBQB 1A5MC 3VOFA 3UJFA 1O5RA 4PCSA 1XFBA 1VR6A 3DXIA 3SJNA 3DZ1A 3TTEA 3WLSA 1GW1A 1JJKA 4FPSA 1WBJA 4XK2A 1JGMA 1MI3A 4QTGA 3UZWA 1KXVA 4R5EA 4A22A 1J2BA 2FPTA 2IMRA 1TCMA 4NIRA 1PJ9A 3U2EA 1W2VA 2YZ5A 3GO2A 3KW3A 1B90A 3JS3A 1G4SA 1GOKA 5K3VA 2CZEA 2WJFA 3UCCA 3DI1A 3AIVA 1J12A 1TELA 1U22A 1X6LA 4W5UA 4P8VA 3LB0A 3ARXA 4EACA 1FHVA 1YW1A 4KMQA 3NVDA 4DZIA 3CQJA 4OUEA 2E1DA 1UQZA 3CU2A 1E6QM 4QS6A 4Y9NA 3LYEA 3IJQA 4DWSC 3I4EA 3T08A 3PC0A 3APGA 2PEVA 3G1AA 4HPGA 3M4HA 4MDOA 3LQGA 2J9ZA 3RR4A 2BBFA 1AG1O 1H5YA 3NQ2A 1ITCA 5CJMA 1GJWA 1XXXA 5EBAA 2NQ5A 4O52A 3G1DA 3CHCA 3WLQA 4RJEA 2EG6A 3GXDA 1O60A 1ISZA 1TVLA 4WJEA 3QV9A 4G2DA 1OWQA 2X41A 2YCLA 1K9DA 2Q8ZA 4AYGA 4LUIA 1M5WA 2GVEA 4J7RA 1UZ1A 3CV7A 4C7GA 1DORA 4I7WA 5CQ1A 2BHYA 1OY0A 3W7RA 3IV3A 4R85A 3OBAA 3NA8A 1XX1A 2CC0A 1YHTA 3WMLA 5G4HC 2OPJA 3KOWA 4LVAA 2OMAA 4OBRA 5ABHA 4RNHA 2CLPA 1NJJA 3G1VA 2JKPA 5LA2A 3A47A 5IOBA 1Q6RA 4O12A 1VCFA 1LRNA 3JU2A 4LF2A 2OSWA 1R47A 3W6MA 3H7RA 2QAFA 1TQXA 4TR9A 4UTKA 4GKTA 2ZUTA 3T4CA 5HBFA 1KCXA 3BCDA 3WQPA 1I4NA 1JL8A 2PDWA 3NQEA 4Q8OA 3U2CA 3WQ6A 1YYAA 3A9IA 4IPLA 4WKAA 3TVAA 4AG0A 3UCQA 1W3JA 1FWIC 1XBYA 4NHVA 2I1OA 1AQMA 2X7WA 3F4VA 1QPKA 3WLHA 2ZA3A 4X9SA 3W02A 2QPXA 4KEMA 2VI0A 5BU6A 2YCIX 3LXBA 1R9XA 1HP4A 2O7QA 5EU9A 1OF8A 4NNBA 3W1LA 4L5ZA 1FP8A 4U28A 4ACZA 1P5BA 4IUGA 4JQ4A 3O05A 3WYZA 4NX0A 2YXXA 3S6TA 1TE6A 1W9XA 4AC1X 1Z32X 2GYIA 4HOWA 1W9DM 1QI5A 3OW1A 1J18A 4WDTA 3NVTA 3ARZA 3T78A 3CMFA 2HMCA 3GY1A 3M0YA 3R58A 3SFKA 1SMDA 1W1PA 3GNRA 3H2OA 4G7EB 3TYUA 1OINA 1C7TA 1JCTA 2PGEA 2WMJA 1UP0A 3N9SA 1OFPA 1NM9A 1GJPA 5IRPA 1OFBA 2VRQA 3MZNA 1EHAA 5TQLA 1UUOA 4JIPA 1UC4A 1TV4A 3ARYA 3BG5A 4J4KA 3PUDA 4GY1A 4D8LA 3V1PA 1SGJA 1H63A 4HA1A 4OGZA 3R8GA 3VD3A 3BLOA 2VR4A 1M04A 3SUTA 4J1OA 3LS9A 3B0XA 2FGBA 3EOLA 1OJXA 1EGMA 4PRTA 3K4WA 5AC6A 2BGSA 5H8MA 3XIMA 3HOJA 1J2WA 4LXFA 6REQA 4UNKA 4W8BA 3NYDA 5KINA 1DJZA 2YIHA 1JDCA 1TVNA 4WKHA 3BW3A 1CXKA 2VHLA 3W86A 7TAAA 2JGQA 1DKWA 2Y70A 3FNDA 5CBJA 2GSEA 4IJBA 2Z2BA 4PUKA 4RKAA 3RITA 3NXFA 1NSJA 1OM0A 4A3HA 1PYFA 4PMNA 3TU9A 2CW6A 2XVNA 4TX9A 3UG3A 3ALFA 1JZ8A 3NUKA 4PUMA 2XZ9A 2WWCA 1FWRA 1Z42A 1E1FA 3M0VA 3VGGA 3GIYA 1W5OA 4PSPA 5BXSA 1UD2A 4QROA 4W7WA 3LK6A 3FYPA 1OX4A 5IBXC 4HN4A 5A3HA 4M29A 2IW0A 4J2MA 2PRMA 3MHGA 4PRWA 4CQAA 1CW2A 1QVBA 5FACA 3DG3A 1ENUA 3L4VA 1B9ZA 2J13A 3LTPA 1VS1A 4XIAA 4UTWA 2DIEA 3LHUA 3GDRA 4FALA 2DZPA 3KXQA 4JHZA 5DLCA 4RDWA 5K9CA 1AH0A 1DJHA 8CGTA 4GUJA 3VKBA 1FCBA 4FNTA 2ZZ2A 5C2XA 2Q09A 5CGQA 2VENA 5EFDA 4HZ6A 4ZXLA 4B5TA 4G1NA 3D6NA 4S3KA 2WOQA 3S8HA 3IAQA 3K46A 3VNMA 1FWAC 1TTQA 4OBSA 2PTWA 4ENLA 5D2XA 5H6HA 1R3WA 4UR7A 4TTUA 2OLAA 2VGGA 1PKNA 3N25A 2ZQ0A 2CXEA 4GXMA 2C13A 2MNRA 3DBNA 3B0YA 3WNMA 1TRIA 3S2LA 4JTLA 4CD6A 6A3HA 5BRBA 4GIAA 1L6GA 3UWQA 2G96A 3GVVA 2BODX 2QCDA 1CGYA 4MFDA 1R0MA 3B0UX 1FDJA 4Z17A 2HK0A 4U33A 4A3QA 4JTSA 1SVDA 1RK5A 2VUYA 4GOAA 2I5IA 1RVKA 2V3FA 2WC7A 4NNAA 3TYCA 2BVTA 2WMHA 1AUSL 5DMYA 3WK0A 3WBXA 3AIQA 4AFYA 2PAJA 3QLLA 1CWYA 3PWGA 3QZ6A 4REQA 5C9XA 3VFLA 3NQGA 1MW3A 2QNEA 5AYYA 5I2UA 4MPQA 3VNDA 2HS6A 1GUVA 1EF3A 1WOBA 3WH8A 4EF8A 3TE9A 3SCOA 4RNIA 1YMYA 3DKLA 3W85A 3RJYA 1KFKA 4O1EA 1GVOA 4EWJA 1TYGA 1EEPA 1ZBKA 5E1QA 3T55A 4KBXA 5TIMA 4LUTA 3WQOA 1Q6EA 2OQLA 3VIIA 1QWKA 2WPGA 4KWSA 3PFRA 3PPHA 1GTEA 1EO5A 5XIMA 4ZB0A 3RX4A 4NU7A 1GKRA 1ODZA 4QLKA 3TYAA 1UD6A 4Q4SA 1BKSA 1JUBA 3OYXA 4GXPA 3DI0A 1OB0A 3MO4A 4RR4A 3WF2A 3QR0A 4JTFA 1XRTA 4LNCA 4OJYA 3K30A 3B05A 3H53A 1LDCA 1JD7A 5RUBA 4NJGA 3TYDA 4J40A 3WEZA 2QUMA 4F0KA 3CUHA 5AVHA 1KKOA 1RP8A 3VMNA 1EGZA 3M0MA 5TNVA 4DWDA 3I6TA 5A6AA 3CZ8A 2CXGA 4AD5A 4BJHA 1P0EA 2HXUA 3EOEA 3ITVA 3O15A 1EZWA 3H21A 2ZXQA 1SFSA 3EGJA 2F84A 4ONVA 5AHMA 3W76A 2FMOA 2QPUA 2D22A 1QOXA 4S3FA 1H7PA 3URQA 3WNOA 1VC4A 3H2FA 3I7SA 4C6NA 3T6CA 2AL1A 6PTDA 2VZTA 3KL3A 3AHXA 3H6OA 1L6SA 4GC3A 1A4MA 1XR2A 2QHAA 1WDWA 4GQBA 4QCFA 4BR1A 2PP1A 1XPGA 3WLPA 4D8ZA 1GGOA 2AGKA 5LXEA 3EA1A 3QQWA 5FJRA 1G7UA 2V30A 1X38A 3GTXA 2NVAA 1R3TA 2FHCA 2VFHA 4F0LA 3V75A 1LF1A 3LEPA 4IMGA 3UZJA 2UBPC 1NF0A 4HHHA 3EA2A 2Y5EA 5FA5A 4JTIA 3DG6A 4WJXA 2QJIA 4UZUA 1F3WA 2EF9A 5J8LA 3ALGA 2A21A 1JYVA 3UWUA 3ITCA 3MP3A 2EKGA 5LZLA 1LLOA 1V3HA 3IIZA 4C6FA 3KM8A 1IGWA 4L1WA 1AJ0A 1QK0A 4ADUA 4I7VA 3C8NA 4LW7A 2CLOA 1JXKA 4GH3A 3UVIA 5L6UA 5L9FA 3OLEA 1ZP4A 1DJWA 1LUCB 2XFFA 2QYGA 8A3HA 1D2KA 4A3UA 1TZ9A 5CZTA 4EF9A 4LY4A 3W73A 1X8FA 3MTWA 3TP4A 2Y7EA 1BWVA 4FOUA 4CKQA 3UQNA 3HO8A 4OFCA 2PMQA 2ZUWA 3CO8A 4B90A 4GYPC 3DCPA 3F2BA 4I8YA 3QZEA 1YNQA 2G37A 3ZM8A 3PPGA 2Y0FA 3LA4A 2QJMA 1GZJA 4ADTA 4EAYA 3MA8A 1UA3A 2ZIDA 5HNRA 3ES8A 1UJPA 2BFGA 3FLUA 3WL1A 3RN6A 2PGWA 4E2OA 3PZQA 1ZP3A 2E40A 2CITA 4Q22A 1Z9AA 4FO4A 3F4CA 4HU8A 1O68A 2VFIA 1Q7MA 1E6RA 3IIPA 1AD1A 5C2CA 4PTVA 1VFTA 4LUYA 4HK7A 1E70M 8TIMA 3VMOA 3P2VA 4FIQA 1BAGA 2Y88A 3H24A 4AIUA 3S83A 1P43A 5GVJA 3CB8A 3LZ5A 4XTIA 3T4WA 2ZYFA 2DZTA 2Z26A 2C6QA 1UOZA 4EWND 3B8WA 4U31A 2OEMA 4Q8MA 5BWFA 3TQVA 2OT0A 3TAOA 3W7HA 1FWJC 3K2GA 3BOLA 5FAGA 5CC5A 3DBPA 3R79A 4J3WA 3M5YA 3RCMA 4N42A 2VDHA 2XINA 3L4WA 1KXTA 4O4WA 3SIMA 1VFMA 2JBMA 4X22A 3L9CA 4Q7BA 3KVLA 5AZ1A 3TN5A 3VUSA 1JI2A 1PCWA 2PFHA 1GZ1A 2DH3A 2ZA1A 4MJZA 2QGYA 1GOWA 3S5ZA 2W79A 4FA3A 3IJIA 1OCQA 7ODCA 1MWOA 1VCVA 3L65A 1TPEA 2X16A 3ARWA 2PRHA 1FDYA 3TKFA 1QAPA 1H7OA 1SJCA 3NGJA 3MS8A 3CM4A 1ZCCA 1V51A 4IGNA 3KOZA 1JG9A 3WNNA 3C5QA 3GE7A 2HXTA 1DWGM 2P3ZA 3DOPA 4J9JA 3MUIA 4HPNA 2DUAA 2PURA 3G1YA 4FK9A 4ZOAA 1P1MA 4PMOA 4A2SA 2A79A 4DJFC 1GJUA 4XQ6A 1UP2A 1MEIA 3N4AA 5DELA 1SO4A 2PC8A 4RV8A 3PK7