2V38A

Family 5 endoglucanase cel5a from bacillus agaradhaerens in complex with cellobio-derived noeuromycin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
301
structure length
301
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
molecule tags Hydrolase
source organism Bacillus agaradhaerens
publication title D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases
rcsb
total genus 122
structure length 301
sequence length 301
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2v38A00
1HKKA 3CHEA 5BXTA 2DSWA 1BYDA 3UETA 4FLRA 4FLOA 1JFHA 1JNEA 2WM0A 4JAWA 3AMLA 3SCSA 1H41A 4W84A 1JZ4A 1CGXA 5A6AA 2VQUA 5AY7A 5FKYA 2VURA 2WCAA 2WMJA 4QLJA 5KEZA 1BHGA 1CGUA 2G41A 1GOWA 3ZJ6A 4W5UA 5BXSA 1VRXA 4UFLA 3N1AA 1XHGA 2OSXA 1M7XA 4PMUA 4B9YA 4PMVA 2CNCA 4HPHA 3SUTA 3L4VA 4UCFA 3N11A 4BA0A 2XM1A 5CGTA 2E9BA 3GH7A 3F4VA 3KL0A 4AD1A 4ACZA 1KBBA 2BVDA 4PCSA 2WMFA 5AC4A 2WCSA 2XM2A 4JIEA 4TVUA 1E9LA 3II1A 1XD0A 2WBKA 3ARVA 3AXHA 4W86A 3W25A 5EB8A 1BLIA 3SCQA 1TUXA 4AY1A 3FNDA 4PN2A 4U2ZA 1B2YA 1C8QA 1HIZA 1H5VA 5GNXA 4J3SA 1JG9A 4F9DA 1BTCA 1OWQA 4CD4A 3OZPA 2IUZA 5JIPA 2Y2WA 2VL4A 4ATWA 2W92A 2WMGA 1MFVA 1MQRA 1E40A 1PZ3A 2D0HA 3AYRA 2DQXA 3HN3A 1UZ1A 2YKKA 1JL8A 3L4TA 3POCA 2D23A 2PWEA 3WH6A 3VIKA 2O9PA 2YLAA 4P8XA 1RPKA 1KQYA 4V2XA 2NT0A 4DUXA 1XC6A 2GFTA 4JFWA 4UNIA 1JGIA 1V6YA 4CD5A 1BAGA 3SCPA 1TCMA 3BAYA 2WVVB 1BVZA 1U33A 4IISA 4U5IA 5CPQA 3VGDA 1OINA 3ARYA 4UQCA 1DEDA 4XB3A 2BVYA 4Z2LA 1KXHA 2VZTA 2WXDM 3W82A 1VJZA 2XGIA 2G3JA 2AAAA 5A2BA 1UA3A 3W26A 1B0IA 4PTXA 3W4RA 1GOQA 3VX1A 3SUUA 3SUVA 3BC9A 2WHMA 3KL3A 1UHVA 4HMDA 1W1TA 6CGTA 3N15A 2WMIA 3AHXA 4J7RA 1UWQA 1UWIA 1BSIA 1UZ4A 4MDOA 4MB4A 1CXHA 4UFJA 4GZIA 1FA2A 4H2CA 4ZXLA 5ECUA 3GM8A 1M03A 2XWEA 3PZGA 1FH9A 3CHDA 2YDQA 3ZQ9A 5FOOA 3OLEA 1NP0A 1J10A 2OWXA 1TG7A 3T2OA 5A8QA 2CITA 1US3A 1BVNP 2DGAA 3AHZA 3BCDA 2GDUA 1E0VA 1KB3A 4KMQA 1ISZA 1PX3A 2DIJA 3UEQA 1KGXA 4AD3A 4D1JA 5I6SA 1W91A 4X9YA 3WNOA 1G0CA 4DM2A 1IZJA 4GKLA 1E5NA 1UA7A 3WF2A 1PZ2A 1XH2A 3FAWA 1QI2A 3WQ4A 3BMWA 2DSUA 4H41A 3WMCA 1V0NA 1TR1A 2VT0A 1QNSA 1XV8A 4TOQA 4OOZA 3G6MA 1PEZA 1R86A 4WKFA 1ISVA 1E4NA 1E4IA 3BAIA 1V02E 2E8YA 2WHJA 1GOKA 4GI8A 3NYDA 5BRPA 3DYOA 3UCQA 3LPFA 1H2JA 3NSNA 7A3HA 3MUAA 4QDMA 2WMIB 2ZX5A 4UFIA 4AW7A 4AD0A 5A8OA 1JI1A 1GVYA 3HU7A 3WKZA 1QW8A 3EDFA 1UKPA 1BF2A 3WMSA 3OGVA 4U2YA 5KZ6A 4M24A 1HL9A 5D8ZA 5A8NA 4MTVA 2O9RA 2D1ZA 2G8ZA 2A3CA 2W61A 3W27A 4UQ9A 1J01A 2YBTA 1E43A 1UD5A 3VM7A 2BY2A 4CCCA 1L8NA 3EMCA 5CPSA 2YA2A 3PZQA 3RO8A 3N9KA 1ESWA 1CLXA 2W4XA 4W88A 4RE3A 2X8RA 3WDIA 2A3EA 1LJYA 1W9BM 2O9TA 3ALGA 3VDBA 3CGTA 5HBFA 5CGMA 5A1AA 1GQLA 1B3VA 3CPUA 5IFTA 3VVGA 4ML4A 1M01A 1WB0A 3QGVA 1OGGA 4MAVA 3QOMA 1CENA 2PBGA 1HJVA 5TD4A 5CLWA 1ZJAA 3MMDA 1J0YA 2J79A 4BQ4A 3BAXA 1E6XM 2BXZA 2J7EA 1BGAA 3EDEA 1I1XA 1TVPA 2ZUNA 3W6MA 4H8VA 2W62A 1D2KA 1OSEA 2C7FA 1KXQA 1CGYA 3U57A 4W93A 3WUBA 3VNZA 4BZYA 3WDQA 1QBAA 4AZBA 2WVVA 2J47A 2XWDA 3ZR6A 3N18A 3WD3A 1WKYA 4P8WA 2A3AA 3WNKA 3ZSTA 1SMAA 1VF8A 5D9MA 4W7UA 1LG2A 3UG3A 1CGWA 1MQPA 1WPCA 2E40A 1FP8A 1EXPA 4QLKA 2WKGA 5ABFA 3LPOA 3OBAA 1CXIA 4BF7A 4KH2A 1X1NA 2ZXQA 2JE8A 3MSDA 2CKRA 3WH9A 1TA3B 1C91A 3BLKA 2ZX6A 5A6LA 9CGTA 2DT2A 2VMFA 1J0ZA 3GBEA 3DC0A 3AZSA 3PTQA 1LLOA 3VGGA 1W1PA 2V3DA 2VZUA 4L4PA 3WNPA 1EOKA 1QHZA 1CDGA 5HPOA 1E6PA 1UR1A 2WNWA 2W91A 1JDAA 4PMNA 4OZOA 1JYNA 4HOXA 1XCXA 2EPOA 3WMBA 3RJYA 2D24A 2WLYA 2ZXDA 5CSUA 3WQVA 3GXDA 3WL0A 3GYCA 3ZIZA 3PZTA 1JZ3A 1IV8A 4Z2HA 1YQ2A 3WNNA 2GJXB 4AZ5A 2J25A 4URIA 3VILA 4PUDA 2YL6A 3FN9A 1K6AA 3AHTA 4CD7A 3SCVA 4IPLA 1HJSA 4NF7A 1ZL1A 2YL9A 4M82A 1TZ7A 2VCBA 1OGSA 4P8UA 5A8MA 2CBJA 3AISA 1HP5A 3BGAA 3SURA 4ACZB 3KWXA 4MPKA 1H0GA 1QPKA 4QCEA 2WC3A 3AXIA 2XVLA 1JXJA 2ZUVA 3WF4A 3SEPA 3SCOA 3W53A 1HKMA 1IT0A 2CKSA 1J0HA 5I79A 1ITXA 3APGA 4Q22A 1W32A 1WZMA 2W63A 1HVQA 2WHLA 2ZICA 1EHNA 5AC5A 3OLGA 1HXJA 1VEPA 2VRQA 3ZO9A 4MNMA 4M29A 4P7LA 2GVYA 2BY1A 3WELA 3WDHA 1EDTA 2ZXAA 1MW1A 2GJXA 2J7GA 3VMOA 1TE1A 3A6OA 2OSYA 3NSMA 3L4XA 3UERA 4LYRA 3CZ8A 3ZOAA 3IAQA 2ZWZA 3L4WA 5E70A 3M07A 1YHTA 5E0FA 1J0KA 2WANA 3WQ6A 2C8NA 1B31A 5A6MA 1W2PA 4KGJA 4PUEA 2X05A 2XHYA 1I75A 5FD0A 3WDPP 1BG9A 1FP9A 2YDSA 3OZOA 1HNYA 4LPCA 1VFOA 3RDKA 1WE5A 5LYRA 4PTVA 3T0BA 1W9DM 2WCGA 1M53A 4FLQA 1SR0A 3UG4A 4CN6A 2CEQA 4GI9A 4CU8A 4PEEA 4B16A 2ZUWA 7TAAA 1WP6A 1V6XA 2CHOA 1JD7A 1NOUA 1ZBCA 3AS0A 1U2YA 2PWGA 2VZOA 3WD4A 3W24A 3QHOA 4IPNB 2GDVA 5AYBA 2D22A 3U5UA 4E4PA 3THCA 4HP5A 1JAEA 2J78A 1E1EA 2PWHA 1C7TA 3B9DA 4W8LA 1MFUA 2ZX7A 1EGZA 2D3NA 2YL8A 1U30A 1WO2A 5BYWA 5JBFA 3B9EA 2PI6A 1Q6CA 2QV4A 1EQPA 2WVUA 3NDYA 5CPTA 3CO4A 1CXLA 4HOWA 4C7GA 4A3YA 1JXKA 3ARZA 3F5JA 2WAGA 1FFQA 1JZ8A 2WC7A 4TX6A 3N13A 3SIMA 4X0VA 4PBGA 1V6VA 2VC9A 4AIUA 5EFDA 3OG2A 1V3KA 1OBAA 1MVYA 2VNCA 4P7NA 4JL1A 4CGTA 5F7UA 3ZM8A 2DSKA 3WQ5A 3VGFA 3WH7A 4M1RA 3MO4A 5AYIA 2XG9A 5I3DA 4W5ZA 2AMGA 3TOPA 5ABFB 3AI0A 4QFUA 3VOCA 3F5LA 4LXFA 3SCTA 3AZTA 3NJ3A 1UR2A 3CLWA 1W1VA 3QOKA 1CEOA 1UYQA 3WH5A 2HVMA 1V02A 3AIBA 3OGSA 7CGTA 1VB9A 1E72M 3CHCA 1HJUA 2WYSA 5A6KA 1ITCA 3VO0A 2O9OA 2WVSA 4AEFA 3CUJA 2VRKA 2J4GA 2XVKA 4PMDA 5EMYA 2W5FA 1Q6DA 4Z2IA 3AIQA 3PTMA 4OIFA 8A3HA 3AS1A 2E4TA 1E71M 4AZ7A 3VKKA 2MANA 4JKKA 4W8AA 2YL5A 4H04A 2XFFA 3KL5A 3O9NA 2BHZA 4IUGA 1NH6A 3CZJA 3VD5A 1LL7A 2UY3A 3B8SA 1VBRA 1JDCA 1AQMA 3SCWA 1VFMA 3WFZA 1HN1A 2JEPA 3VINA 1UR9A 2OYMA 4D6DA 1Q6GA 1HT6A 4OOUA 1FH7A 1HJXA 4X0NA 4ATLA 3B9AA 1GOMA 1E4MM 2DH2A 4MJ4A 2DT0A 3LMYA 3CUGA 3AQUA 4A3HA 2NSXA 3J7HA 4S3JA 3K4DA 1GCYA 4CN4A 3QHNA 3S2CA 4WSKA 2FH6A 3AROA 4BQ2A 1B30A 3N17A 3ZT6A 3M46A 3EMZA 4TVDA 2BHYA 1WCGA 4WKHA 4J3TA 1XRVA 1E6QM 1B3ZA 3EDDA 2VTFA 2JF6A 3WEMA 1QHPA 3SCUA 2WB5A 4CUCA 2OYKA 1CXKA 4UOQA 3BCFA 5M03A 1CIUA 1QNQA 5ABGA 3IJ8A 3AIEA 3RM8A 1Q6FA 4YN5A 1CNVA 1LWJA 3WF3A 2CIPA 1PX8A 4CN1A 4MJ2A 3CZGA 2YBUA 4Y7EA 1W9VA 4GQQA 5E9AA 3AMKA 2D0GA 4MB1A 4HA1A 3K4AA 2V3FA 3K1DA 2OWCA 3ARRA 3L4ZA 3OB8A 3NDZA 5CZKA 1ZJBA 1JYWA 3O6AA 3VX0A 3VDCA 5IXEA 2DEPA 2VX4A 3KEHA 1KXVA 1VIWA 2IXVA 3WD0A 4U3AA 3IK2A 3BMVA 4HA4A 1CWYA 3TA9A 4D6CA 4PRWA 3VM5A 4P7QA 2WZIA 3GXMA 1LL6A 1C8YA 4AD4A 1BYAA 1K9EA 4AIEA 5ABHA 2EJ1A 1E6SM 3T0DA 3AOFA 4U5KA 4WIWA 4V27A 1DHKA 1UWRA 1WDQA 1NP2A 1UD3A 1SYTA 4AD5A 2XFRA 3WEOA 2D0FA 4WJXA 1JYVA 4WSJA 2X0YA 5CLTA 2X09A 3DHUA 1W9UA 3DYMA 1N82A 1B3XA 1VEMA 2DIEA 2JIEA 1UKOA 3AJ7A 3TTOA 1EDGA 2G4FA 2J77A 2RGLA 2ZUTA 4D6JA 1KR1A 4PMOA 3VGHA 3WUGA 3VIGA 2FHCA 2ZXBA 3BAKA 4JFUA 4EANA 1GJUA 1D7FA 3NIYA 1NWUA 5A6BA 1R8LA 1CZ1A 4MB3A 1KCLA 5IDIA 3MMWA 2ZOXA 5M5DA 4LX4A 2OYLA 2AOSA 2BY3A 4M56A 2D2OA 3A4XA 1ISYA 2WC4A 5JBDA 2JFEX 4ZE5A 2CXGA 3M6DA 2GJPA 1GOIA 1BQCA 4U3CA 4D71A 1H49A 1Q4NX 4UQBA 2XUCA 1HKIA 5BXPA 1C7SA 1O7AA 1SMDA 3CUFA 1FHDA 1KR0A 1C92A 2QLYA 2V5CA 1KGWA 4EE9A 2FDMA 3VDHA 3BAJA 1H3GA 4QAWA 4QCFA 4R27A 1TFVA 1QNOA 2D20A 5DEZA 2RGMA 1R87A 4ZENA 1QNPA 3GH4A 2WWDA 4U33A 1F4AA 3ZJKA 4KRUA 1G01A 4XZWA 1V08A 4TXEA 4CVWA 5DT5A 1UG6A 5DT7A 4B3LA 1OT2A 1E0XA 4W89A 1XH1A 5LA1A 4QLLA 3L4YA 2WZHA 4AWEA 1JZ7A 4D6IA 4P7RA 3RJXA 1R85A 1EO7A 4LYQA 1E55A 1CTNA 4DUWA 4PTWA 4HU0A 1EH9A 1KBKA 1QI5A 3ZSSA 2WK2A 3PHAA 1LQ0A 2J7DA 2VX7A 3BXWA 1C93A 3ARPA 2WMHA 4U31A 1AVAA 4GINA 3VUPA 2Y4SA 2UY4A 2CPUA 3W81A 1ZBKA 4UZSA 5I2UA 3W6LA 2E0PA 3W0KA 1KWGA 1L0PA 1UR4A 2Y8VA 1B1YA 2BHUA 1A3HA 1MWOA 2CHNA 1PBGA 2EBNA 2G3IA 1GQIA 2YA0A 1V6WA 4DWSD 1QW9A 2F2HA 3TTYA 4AZIA 5A6JA 4XZBA 1QOXA 1ZBWA 2VCAA 2A3BA 3IJ7A 3WUFA 1J9YA 1W1YA 2J7BA 4C7DA 3WIJA 4BQ3A 1HP4A 1XSIA 4ZFMA 5ABEA 4TVCA 4LQ1A 3I3EA 4N42A 4ACYA 1V0KA 3FHAA 1HX0A 2BXYA 2WVTA 5E09A 3K46A 3HJEA 1GZJA 1ECEA 5DO8A 1E3ZA 4HZ8A 1BPLB 2F61A 3T0AA 3VMPA 1GQJA 2WWCA 3AHVA 2VZSA 1OIFA 4JKMA 5A6BD 4D6HA 2FHFA 4B15A 5GNYA 5M17A 1VFUA 4CCEA 1JDDA 1OIMA 1UH4A 2GJRA 3CIVA 2Q8XA 1RD6A 3VIJA 3I3DA 3WBEA 3FAXA 3WD1A 3PTKA 3AMGA 4P7OA 5D9NA 1B9ZA 3ARXA 3GXFA 1JZ6A 1SFSA 2VX6A 1TVNA 1WDRA 2W66A 4BQ5A 4F8XA 3FY1A 2E9LA 1PAMA 4CD8A 2YA1A 1V3JA 1TMQA 1EO5A 1K9TA 4XX6A 1XYFA 4S3KA 1OD8A 4PTMA 1OT1A 3TTSA 3SUWA 4QP0A 3OA5A 1LWHA 5GNZA 4F9JA 4GPNA 1Y7VA 2VCCA 1GUVA 1UR0A 4GO9A 5DF0A 1UH2A 1HVXA 5DFAA 3IJ9A 4PMQA 2BS9A 3ARUA 2ZWYA 4EAMA 1GHSA 3FW6A 4UFHA 1D3CA 3JUGA 1JIBA 3MKKA 4RE4A 3T2QA 4KGLA 4UTFA 1QNRA 1ISWA 4UOZA 4K68A 4E2OA 1E3XA 4Z2KA 3SCNA 3W28A 3UR8A 5IHSA 1QI4A 1NARA 3SUSA 1XYZA 3CMJA 1E6NA 4J27A 3T08A 1WAWA 3VIOA 4JHOA 3THDA 5IHRA 1ZBVA 4FLSA 2XGBA 1MW3A 2J8FA 4JFVA 3BLPX 3AS2A 4OUEA 3AIWA 3ALFA 1PIGA 3FHQA 2WW5A 3VD3A 2X0HA 4B9ZA 3ZT5A 2XIIA 5CG0A 2VZVA 6A3HA 4ZE4A 1QBBA 3GTNA 3PN8A 4AIOA 4DWSA 8CGTA 1CBGA 2DT1A 4YHEA 4GIAA 5HOSA 2PF0A 1NOWA 4ZXOA 1DWGM 5E0CA 5E6ZA 2G3MA 1E6RA 4AZCB 3CBWA 3AMDA 5I78A 3WNMA 1UUQA 1CLVA 1GW1A 5C71A 6TAAA 1RP9A 5JIWA 2WSPA 2VR5A 4UR9A 2VUYA 1KQZA 3W29A 3GNRA 2WZEA 1V3MA 1O6IA 3OLDA 5A95A 1JZ2A 1JFXA 4D6GA 5E6YA 2QPSA 1W3KA 3POHA 4RL3A 5GQBA 4OJYA 1LG1A 2IXUA 1G1YA 2VVSA 3PZ9A 3K8MA 2EPNA 5I24A 3KZSA 2F8QA 1UD6A 4DWSB 2WKLA 4HZ7A 3A47A 3VTRA 4Z2JA 1V6UA 3TTQA 4B3KA 3LPGA 2V5DA 1V3HA 1XH0A 4JZ5A 3AIUA 3KE0A 2DSVA 1NQ6A 2J75A 2WPGA 5FL0A 1BYBA 1W9PA 3EYPA 1FOBA 1OB0A 2DSZA 2BFGA 1VJSA 1XGZA 4LYPA 1GQKA 4CU7A 1GHRA 4NRSA 3U7BA 4OKDA 1H09A 4Z2GA 3VD7A 3EMQA 3MUIA 4JCMA 4W8BA 3BSHA 4WLCA 4UFKA 2TAAA 1MW0A 3WNLA 1PIFA 5CXPA 4FMVA 3EDKA 4CKQA 4GO8A 2ZE0A 2VVNA 1CPUA 3GH5A 1ZB5A 3DYPA 2A3HA 2PB1A 2GK1A 3VIPA 1GOOA 1E4LA 1V3LA 4HZ6A 2D3LA 5A69A 2ZUSA 5D4YA 1OM0A 1UD8A 2Y24A 2VQTA 4AYSA 3A3HA 1UQZA 1PX4A 2J7HA 4FF5A 1LL4A 3ZMRA 1MW2A 2JIWA 4MNJA 1H11A 2YOCA 1UKSA 1WZAA 2XTKA 4UQDA 1JAKA 4FK9A 4D1IA 1JF6A 5EBAA 4JFSA 4EKJA 4PMRA 2OLHA 3AYSA 1UWSA 1JZ5A 3WF0A 5FCZA 3VGEA 1E56A 1S46A 4L4OA 4YPJA 1V0LA 3AHYA 2ZX9A 2UWFA 1UKQA 1J11A 3AXXA 2YLLA 5BRQA 1R7AA 4E8CA 2EPMX 4MNKA 1MXDA 3VGBA 3D5HA 4Q7NA 5JUVA 3G6LA 1BFNA 3WF1A 2EPLX 2X2YA 3O2LA 1CXFA 3IANA 3M7SA 2Y5EA 1QHOA 2EXOA 1VBUA 4TTGA 1CGVA 2XSBA 4JCLA 4CU6A 3AMCA 2FH8A 2J7CA 3L2MA 2J62A 1HL8A 3RPMA 4AZGA 5I23A 4PSPA 2VR4A 2QPUA 2CESA 5CSYA 2E8ZA 4H7VA 1UQYA 4EK7A 2XVNA 2EO7A 1ISXA 3WDJA 5HNNA 1C90A 1H4PA 2XIBA 3RMEA 2QF8A 2CERA 5D8WA 1ODUA 1J18A 4J28A 3W38A 3WL1A 3T2PA 1WZKA 3N04A 4H8UA 2VJXA 3AZRA 3DECA 4GQRA 2DT3A 3QHMA 1JF5A 4TX8A 1VENA 3TP4A 5I77A 4NI3A 3GNPA 4MNLA 2WSKA 4W7WA 1UH3A 4AXNA 3HMCA 3IAPA 4W85A 3AIRA 2UY5A 5CQ1A 2Z1KA 4MDPA 4J3VA 2ESCA 2FGLA 4CVUA 2VRJA 1UOKA 2XSAA 3WFLA 2XJ7A 4JL2A 5D9PA 2CBVA 1AQ0A 4AEEA 3TONA 1JYXA 5I0DA 2FHBA 2VO5A 4HMEA 5HDRA 3L2LA 3ZJ8A 5M3WA 3NCOA 1E0WA 2J8GA 4E8DA 4M81A 1W3LA 3VD9A 3UG5A 5BXRA 1Z32X 3CHFA 1CXEA 1EIBA 1UD2A 3AFBA 3ARWA 1UKTA 4V28A 3I3BA 4TTUA 1HF6A 2YJQA 1KFWA 1JNDA 1VFFA 4BCEA 3S6TA 1W9XA 3WN6A 2NT1A 3NSXA 5A94A 2X1IA 2J74A 1EA9C 5IFPA 5FL1A 3MUZ1 2DDXA 3CMGA 5BCAA 2BNJA 1ODZA 5EFFA 4ZEPA 1E15A 2CCRA 2CETA 1RP8A 4HMCA 3RCNA 1XD1A 3VIHA 2EPKX 1JD9A 4AZCA 3CZKA 5HXMA 1KXTA 3VD4A 1J0JA 2GK1B 4TUFA 4XV0A 3WBAA 4P8VA 1LF1A 1E1FA 4GZEA 3VU2A 4HPGA 1JI2A 1H1NA 3D3AA 1NWRA 3U5YA 3L4UA 4J3WA 3VIMA 3K8KA 1K9FA 3AS3A 3T09A 5LA0A 1M04A 4AISA 1A47A 1UR8A 5FIPA 3GDBA 1E5JA 2J7FA 3WQ8A 4HA3A 3ECQA 3GXIA 3CUIA 1DWJM 1EDQA 1UD4A 4LGXA 4YHGA 4D72A 3VDAA 1QI0A 3MS8A 2JEQA 3LPPA 1V0MA 2UY2A 3WDRA 2O92A 4JKLA 2WHKA 2YIHA 4HOZA 3VNYA 1EQCA 2WLZA 3FXYA 5A3HA 4PMYA 1NWSA 3CZLA 1K9DA 4UOJA 4UQAA 4J3XA 1B3WA 2OSWA 1W2VA 3A4AA 4DWSC 5HPCA 3PZMA 2VI0A 4PYSA 3PZNA 3AIVA 3VPLA 1PJ9A 4GI6A 3UESA 1WZLA 2ZIDA 3AICA 2QHAA 1HJWA 3WUEA 3U7VA 1GNXA 4JHZA 1KCKA 1P6WA 4MAZA 4KRTA 4WKAA 3WH8A 5CJ5A 1UWUA 1OCQA 4OBSA 1FHLA 4J3UA 4GXPA 1BYCA 3A4WA 1US2A 3MUY1 3OLIA 3PZIA 1MXGA 1V03A 2DPEA 1FFRA 1XCWA 4KWUA 1KWKA 1QI3A 1DTUA 1AQHA 3PZUA 4PCTA 2XVPA 3CZEA 2ZUUA 4AZ6A 2FGZA 1H0IA 2WBGA 1GVIA 3RM4A 3SCRA 2QMKA 2ZUMA 3WSUA 2OWWA 3MMUA 1CYGA 4AMCA 1VEOA 4DM1A 4M8UA 4UZUA 4W7VA 5JBEA 3MV01 3K8LA 3ARSA 2V3GA 4PMXA 4PSRA 4RE2A 1MYRA 4WF7A 2YDRA 5A8PA 5LA2A 1G5AA 4MB5A 1C8XA 1DWAM 3BAWA 1EOMA 1G94A 3ZT7A 2E9MA 2V38A 2B31A 4N0RA 3OGRA 2G3NA 1W3HA 3BSGA 3UR7A 2PWDA 3GZAA 3MV11 3WENA 1J12A 4M80A 1V3IA 4ATDA 1NM9A 2EEXA 2BV9A 4UQEA 2E3ZA 2VOTA 3BH4A 1EHAA 3RIKA 3DHPA 3QR3A 3W37A 3EBVA 1E73M 1ZU8A 4R5EA 4PMZA 4AD2A 1DWFM 1CGTA 5C70A 4W87A 1VAHA 4CD6A 5A2CA 1J0IA 2PBOA 4CCDA 2CBUA 5BROA 3GNOA 1FH8A 3NUKA 1B3YA 1QVBA 1GORA 3MANA 3GBDA 2EQDA 4D6FA 3CTTA 1DWHM 1MQQA 3EDJA 2BVTA 2XYLA 1WNOA 1IZKA 1R7OA 5A6SA 3PZOA 1DWIM 5GPRA 1GPFA 1GONA 5C8BB 2WMKA 4D6EA 1W3JA 1XSJA 1NWTA 3RILA 1ZS2A 1C3FA 2DH3A 1OD0A 1RH9A 3OIHA 1AMYA 1OGBA 3WD2A 4HU8A 4H8HA 2JALA 1PPIA 3CH9A 5D9OA 3VIIA 3PBGA 1NOFA 1BGGA 3CUHA 4AC1X 2JF7A 2W67A 2NW0A 4WK9A 1E70M 1I1WA 1CECA 2GSJA 1F4HA 4BS0A 3WQWA 2C0HA 3VMNA 1HKJA 4HTYA 2GUYA 2XPKA 2Y8KA 1X6LA 1DP0A 5DMYA 2PC8A 4OBRA 4NRRA 3PZVA 4UFMA 1GJWA 1BG4A 3E1F1 1X6NA 1UWTA 1WDPA 4JFTA 1G9HA 5BWFA 2HISA 2CYGA 3VIFA 3ZR5A 2BY0A 2ZX8A 4C7FA 1XSKA 2CBIA 1Q6EA 2VX5A 4AZHA 4NSBA 4IM4A 1KGUA 3MU7A 2PWFA 2QMJA 2V3EA 4GZJA 4XUYA 1HJQA 1TA3A 2XVGA 4F79A 3MSGA 3RM9A 3WEZA 1B90A 4A4AA 3ARTA 3F5KA 3ARQA 3ZJ7A 4DUVA 5I5RA 3WY1A 2XFYA 1WDSA 4F66A 1E6ZA 4MADA 3N12A 2Z1SA 4NZCA 5A2AA
chains in the Genus database with same CATH superfamily
1YIXA 1CB2A 3EOSA 3W22A 2DSWA 4FLOA 1JFHA 4Z1AA 1AW2A 3AMLA 3EKZA 5FSEC 1QK0A 3A3WA 1KLZA 2F6XA 4XK2A 1CGXA 3QQWA 2QIWA 3WQCA 5AY7A 5PTDA 2WCAA 4QLJA 1XLIA 4DRSA 2A4AA 5BXSA 4G8TA 2C3ZA 3N1AA 1TV7A 1XHGA 4NVTA 5FI8A 4H9XA 4PMVA 2CNCA 1V51A 4U10A 1C8VA 3B0VC 3N11A 3CT2A 3BJTA 3TC6A 1R3VA 3F4VA 1P7TB 4AD1A 3R43A 4MF4A 2WCSA 5H91A 4RNHA 3G1YA 3WQFA 3LERA 4MWAA 2E5BA 2WBKA 3ARVA 3N2BA 2AQVA 3THUA 3IGUA 1H50A 5EB8A 2XH2A 1TUXA 1GG1A 3FNDA 4PN2A 2NUYA 4Y9NA 3LQGA 1L6FA 3ZLFA 5GNXA 1GKRA 1FBAA 2R6OA 4Q8NA 3UWZA 3YPIA 1M6JA 2VXNA 3PWAA 1K8CA 3OZPA 4A22A 5JIPA 2VL4A 3JVAA 3MDWA 3LX9A 1W5MA 1WXZA 2D0HA 5GVJA 4QJ1A 3HURA 4C5ZA 3L4TA 3POCA 2D23A 1M5WA 1UIPA 4YCPA 2OQYA 2NT0A 4ZO8A 5CC5A 2J6VA 2P8CA 2KZHA 3SCPA 2WVVB 3W1UA 1XLBA 4Q8UA 2WZMA 5HUPA 2DY3A 2FPTA 4XB3A 3P3BA 3FJNA 4MWAD 3TYAA 3OBEA 1UA3A 1B0IA 3GZ3A 3W4RA 3VX1A 3SUUA 3E5BA 3UGRA 4IOTA 4HMDA 1W1TA 3H70A 1DE5A 4IJCA 2ZQ0A 1CXHA 4GZIA 4FXRA 4H2CA 3GM8A 1M03A 4MY1A 1FH9A 4PUJA 2E28A 4GYPC 2PDPA 3BCDA 4KMQA 1PX3A 2DIJA 5EGRA 5HANA 1TIMA 2W9MA 1W91A 3WNOA 1G0CA 3LB0A 3EX3A 4XISA 1QI2A 3Q65A 4JQ3A 2R1NA 2ZZ5A 4OV4A 4TOQA 1H7WA 3PFMA 3F7JA 3OG3A 2A3LA 5D02A 4FNPA 3WBXA 4WKFA 5EU9A 1E4IA 3BAIA 1V02E 1GQNA 1YTDA 2QEZA 3GU2A 5AHIA 3TAKA 3UCQA 7A3HA 1FRBA 2UV8G 3SQMA 2WMIB 4YNGA 2ZX5A 3P67A 1XYMA 1OX4A 1YXYA 1I60A 3APTA 5C9UA 3T7VA 5HR6A 1DIEA 3EDFA 1UKPA 3OGVA 3R0KA 5A8NA 3AXKA 1PZ1A 1DQWA 3CUXA 4OGZA 1ZCOA 1Q8JA 3W27A 5AFDA 4O0KA 1TUFA 4CCCA 5DCBA 1REQB 1L8NA 3EMCA 3RUBL 1I9CB 4O50A 3R94A 4W88A 4BY3A 1R9YA 2O9TA 3ALGA 5CGMA 3SZ8A 4XD5A 3VVGA 1F8IA 3RRAA 4K8GA 1M01A 1DV7A 1OGGA 2NZLA 5DXYA 4ASTA 2VEKA 3S4TA 4AWUA 2PBGA 1GVRA 3HPXA 3T9PA 4HSNA 1AH3A 1ZFJA 3PK7A 2JBMA 3W76A 3VYLA 3NQFA 2J7EA 4NZ1A 5LNVA 1I1XA 2ZUNA 3E74A 4I5RA 4IGMA 4ES4A 2ZA3A 2HCVA 1O5KA 2DJLA 5JH2A 1OFRA 3TU9A 1QAPA 3KOXA 3IV3A 3WDQA 1QBAA 4CQCA 4EPDC 3EPOA 3WD3A 1CLKA 2A3AA 4XTIA 3UWQA 1YEYA 4O0QA 3T55A 1R9ZA 4W7UA 1O12A 3BICA 3WLIA 2VD9A 1MQPA 4GH1A 4QLKA 2ACUA 2JE8A 2HNEA 3P61A 3URNA 5BZAA 4OUIA 4MZYA 1H5YA 4ML9A 3AZSA 3PTQA 1W1PA 2V3DA 3GTIA 1UMLA 1Z44A 3EA3A 4L4PA 1QHZA 4BWLA 4IH3A 2BASA 1UR1A 1ZPTA 1EB3A 2WNWA 5JQ9A 2ZRWA 1UOZA 4PMNA 2Z6IA 2EPOA 5FJRA 3F1QA 2WLYA 1NFGA 1ZP3A 2EJAA 4G1NA 3UXKA 3WL0A 3T6CA 3WJXA 3GYCA 3ZIZA 1QATA 3PZTA 3FDGA 1IV8A 4Z2HA 3W7PA 3LZ5A 4K38A 1GVQA 5G1TA 2IPGA 2NXHA 1HO4A 1SW0A 1EC9A 1K6AA 4OV9A 1B54A 4L6DA 5EBUA 1HJSA 1ZL1A 2YL9A 4P8UA 1W3TA 5TNVA 3NYZA 2CBJA 3F4WA 1HP5A 1H61A 2RFGA 1TPVA 4GXWA 4ACZB 1QPKA 4QCEA 1OZQA 2WC3A 1JXJA 2PP0A 3QLDA 3SN0A 2ZUVA 2V8ZA 1XDJA 2DORA 4GGBA 1J0HA 3SBFA 4AWTA 2PDLA 4J2MA 3WLMA 3CQJA 4Q22A 1W32A 4FOKA 3HPFA 2ISFA 1T0OA 4M29A 4XQ6A 2GVYA 3VXGA 1VYSX 4YU1A 3H2CA 3WELA 1EDTA 2ZXAA 3LTSA 2NV9A 1TE1A 2OSYA 2QJGA 2ICSA 3IAQA 3FXGA 3PG9A 5E70A 3NO1A 1YHTA 1J0KA 5HJLA 2C8NA 1REQA 5A6MA 3QY7A 4KGJA 2X05A 3KS5A 2XHYA 5FD0A 3WDPP 1BG9A 3BV4A 1JCLA 1R6WA 4GCAA 3MP3A 2LLEA 4CQBA 2PEVA 3RDKA 2NVDA 5D2TA 3RU8X 1M53A 1K8ZA 1VYRA 1SR0A 1BWLA 3UG4A 2XU2A 4PCNA 3SN4A 4GNVA 3UD6A 3T78A 2R1MA 2ZRVA 2CZFA 4HK7A 2VZOA 3W24A 2EGZA 5L9FA 5F2MA 2D22A 3U5UA 3MZNA 3PPFA 2J78A 2PWHA 3UG8A 2HWGA 2YL8A 4ONVA 1WO2A 4ADTA 2XH0A 2QV4A 4IG2B 1TTQA 5FAGA 2ZADA 3FYYA 4PMJA 1RQEA 1CXLA 4HOWA 3NQDA 4Q33A 4M51A 3HPZA 1JXKA 2P5NA 1JZ8A 2WC7A 3N13A 1XJBA 1IEQA 3C2VA 2VC9A 2Z1BA 4LC8A 3OG2A 3MMTA 4P7NA 4AVOA 4JL1A 3WJSA 4AB4A 4DJFC 3R89A 4EF8A 2J9ZA 5G4EA 3WQ5A 4GOAA 1IR1A 4A2SA 4W5ZA 2AMGA 3CPRA 3T81A 5LXEA 1K70A 4IXHA 3AI0A 4QFUA 3F5LA 2PODA 3SFWA 3SCTA 3AZTA 3NJ3A 1UR2A 1XRSA 3A12A 5I3KA 1QOQA 3CC1A 3FLUA 2VFGA 3OGSA 1WA3A 2GVGA 1OYAA 2PURA 4QE5A 4IQEA 4YWIA 5EMYA 1Q6DA 2PLJA 3E0FA 3AS1A 4AZ7A 2OGJA 4LALA 1LUCA 2ALDA 3B4YA 4H04A 3O9NA 3KLLA 2BSLA 3S1WA 1H7OA 3W74A 1LL7A 4X9SA 2G0WA 2UY3A 1I2QA 2NQZA 2CLIA 3L2IA 3GB6A 1YX1A 1VFMA 4PFMA 1R38A 1QRQA 1HN1A 3NVDA 3VINA 3OVPA 3F03K 1UR9A 1SJCA 2QXWA 1W5QA 1Q6GA 4OOUA 1HJXA 4X0NA 4ATLA 3UWWA 3B9AA 1GOMA 2DH2A 2DT0A 3AQUA 3H2NA 4QJ5B 3K4DA 4L6OA 4RCXA 3GQYA 3EA1A 2DVUA 4QSHA 4YTQA 5F2LA 2PP3A 3IRDA 4BQ2A 4UBPC 1B30A 3IIVA 2YW4A 4RKAA 5CC3A 4RW5A 1IEVA 3FX4A 1TVLA 4LRSA 1JRCA 1YLVA 4G5DA 2WB5A 5I00A 3GFXA 5AC8A 4CUCA 4Z0JA 2ZZ6A 5ABGA 3B05A 1PKLA 5FJUA 3QM3A 3H7VA 4KRZA 4L64A 1J96A 4YN5A 4M19A 1JEZA 5DRCA 3STGA 4WJ8A 4MJ2A 1W9VA 1Q3NA 1XUZA 2CW6A 2OX1A 3HB9A 4HNNA 3OEXA 4MB1A 3VCCA 2YB1A 2QAPA 3TA6A 4LVFA 1JYWA 3VDCA 3QC3A 3KEHA 1OC5A 1WAUA 3UJ2A 3P8IA 3NQMA 3WD0A 4U3AA 4JR5A 2ZRZA 1CWYA 5CH9A 3W7OA 3WQDA 3N3TA 3QRHA 4QM1A 3E0VA 3LCHA 4EACA 4PRWA 4LEQA 2WZIA 3GXMA 2PDNA 4XSMA 1BYAA 1QWKA 3NZGA 3UCCA 4DLFA 3AOFA 1C9DA 3O0KA 4C1NA 1NP2A 3R8HA 1GZGA 3TN4A 1AG1O 4WSJA 4H6EA 5J8LA 7ENLA 1W9UA 2DZSA 3DYMA 4HYVA 2JIEA 5I02A 1EDGA 2OPJA 2RGLA 2NQ9A 2ZUTA 5EMLA 3CUZA 1PO9A 1BRLB 2ZXBA 1RZMA 3G1VA 4EWJA 3BAKA 5CC6A 1UIOA 3NA8A 4JFUA 3QV8A 4JTQA 1GJUA 4EANA 1D7FA 3NIYA 5A6BA 1R8LA 1CZ1A 2FLIA 2YCEA 2EG6A 4HHHA 3W2KA 1KCLA 3MMWA 4LX4A 2OYLA 2AOSA 2DU2A 4M56A 2D2OA 3OQ8A 4DJDD 3P74A 1ISYA 1ME7A 2ZCGA 1O1HA 4AC7C 3DDMA 4O1EA 4ZE5A 2CXGA 1CI1A 1BQCA 1Q4NX 3GDKA 2XUCA 2X1SA 1Q45A 4HD5A 5BXPA 2P53A 3W1RA 4WCJA 2HE8A 3MYOA 2QAFA 4UUIA 3W7IA 1VCVA 2V5CA 1KGWA 2R8WA 5D2WA 4GVFA 4YL2A 1L2UA 4DI8A 4GLEA 2ZFAA 4DNHA 4U33A 2E7FA 4I7VA 1V08A 1DIOA 4TXEA 1H62A 2OU4A 3HQ1A 3S3GA 3W7MA 5LSMA 1GVEA 5CBIA 2WOQA 4W89A 4IFRA 1XH1A 5LA1A 3NQ2A 1QDSA 5CEWA 3P93A 4E8GA 2QCCA 2Q3OA 3DI0A 2A7RA 5C2XA 2GSHA 5HNTA 4K39A 3EXSA 2GQ3A 4HU0A 1P6CA 3ZSSA 3R5EA 3CTLA 1OCJA 5EKYA 3V75A 2VX7A 4KEVA 3W72A 3BXWA 2WMHA 2V69A 1ONEA 3SB0A 4FP1A 1AVAA 2YGYA 3OVGA 1XXXA 2J9XA 1RY8A 2CPUA 2GGGA 4UZSA 3DFTA 1EYEA 1ZZMA 3UJFA 5CBBA 3ENLA 1I45A 4JIRA 1KWGA 3RU6A 1L0PA 1UR4A 3VI2A 2OB3A 3IVSA 3AYTA 3R79A 1S2WA 3KS6A 3S1XA 3S5SA 3HF3A 1V6WA 4DWSD 4AZIA 3EB3A 1I2RA 2QCDB 1U22A 3IJ7A 3TLLA 2A6NA 4HK6A 3WUFA 3WBWA 3WYZA 3PUGA 1J9YA 1XIJA 4BQ3A 1XSIA 3QY6A 4DB7A 4DEFA 3CWNA 2ABBA 2PD9A 4BK9A 2Y85A 1BWVA 1U5VA 3WK0A 4UTJA 1GZJA 4GWEA 4CNUA 3TNOA 2OT0A 2VWSA 3MCNA 5BWAA 1BPLB 2F61A 4UTTA 2WWCA 1SW7A 2VZSA 4JKMA 3AALA 1AJZA 3H2FA 3SSZA 1RY0A 2WNNA 3I3DA 4YS1A 3WD1A 3PTKA 4P7OA 5D9NA 3GXFA 3UU0A 4X2PA 3G3DA 5C6MA 1W3NA 5D03A 1D3HA 2W66A 4C1NB 4I9JA 1FWAC 1KV5A 3EPMA 5KSWA 3NURA 1OT1A 4R85A 1Q7ZA 1X97A 2PDBA 3DOPA 5BOFA 3OA5A 2HE5A 4GPNA 2VCCA 3ABQA 2EF9A 1XKYA 2Z27A 4O4VA 1GUVA 3UNDA 3AC0A 4LBUA 3TJXA 5DFAA 3PUOA 3INPA 1KV8A 4US5A 4C6PA 3FW6A 3BCJA 2JQXA 3JUGA 5D04C 1JIBA 1QNRA 2XIOA 4ZO9A 2QYGA 1QPRA 1SZGA 4B91A 4IIFA 4MKSA 3W28A 3UR8A 4KCWA 1QI4A 3UVIA 4DO5A 1HL2A 2RUSA 1M9HA 4RZ5A 1WAWA 4JEJA 1N2VA 4RR4A 5E5CA 1TV8A 5IHRA 1RAKA 1ZBVA 1RQHA 1ZY9A 3TW6A 4FLSA 4WOQA 5LNUA 1KTNA 3AIWA 2ZZ3A 4FNTA 1H7PA 1PIGA 1TWZA 4KETA 2X0HA 4B9ZA 3ZT5A 2XIIA 3E2SA 2W6RA 3A4JA 4HK5A 4ZE4A 1QBBA 3GTNA 2V9DA 1ADSA 2BX7A 4AIOA 4CNOA 3CWHA 4DWSA 1LYXA 3W07A 1R3TA 2DT1A 4KWWA 4ZXOA 1DJNA 1DWGM 5E0CA 5FF0A 2BVWA 3SRDA 2G3MA 2PTZA 3TVAA 3APYA 3CBWA 1K1DA 1FKXA 4DQWA 3AMDA 5I78A 4LVBA 1UUQA 1CLVA 4F2UA 6TAAA 3GUGA 1RP9A 1UJQA 1YBQB 4LY4A 3KOYA 2CU0A 3I4EA 2MUCA 3I7QA 4UR9A 4XIMA 3GIPA 2AL2A 2P0IA 4CQ8A 4IG2A 1XIEA 2ZC1A 3FGCB 3V36A 1V3MA 1DXEA 1O6IA 3FEMA 4JTRA 2W79A 4XG1A 3B0UX 3POHA 4UR8A 1UMYA 4Q8PA 1B57A 1EZ2A 1G1YA 2VVSA 3PZ9A 4K36A 3LK6A 3K8MA 5I24A 3KZSA 4FXSA 2IQ0A 1PXGA 1FWBC 4A8IA 4WZHA 3HQOA 4HZ7A 3VTRA 1V6UA 1P0KA 2V5DA 1KC7A 3VNLA 3I65A 4XD4A 3KE0A 4O15A 2DSVA 2WPGA 1OG0A 3TYDA 5G4HC 3EYPA 2DSZA 4WDWA 3R12A 1GQKA 4OKDA 1H09A 1AW5A 1FXQA 4GY7A 4YTTA 4KWVA 2I5QA 2G5WA 3FSUA 1NDVA 3VD7A 4FX7A 3RLUA 2VGGA 2Z2BA 4JCMA 4W8BA 3SI9A 4DI9A 2R1PA 4OTKA 2TAAA 4LRTA 1R3WA 3PPGA 3I7SA 3EDKA 4FMVA 4CKQA 3C3NA 4GO8A 2ZE0A 1QNVA 2W3ZA 1CPUA 1DJHA 5I3JA 2PB1A 4HSHA 5F1VA 3UNTA 2D3LA 3LYEA 2H9AB 1H60A 1UD8A 2Y24A 1XBZA 4YVPA 1HG3A 4FXFA 4AYSA 3A3HA 1UQZA 1SQ7A 2TODA 3CV7A 3EXTA 3ABRA 3E02A 3DFYA 5EPDA 1UKSA 4X22A 1WZAA 4WD0A 1XG4A 2XH4A 2XTKA 1QMLA 3U2OA 3BLOA 2CZ5A 5T9BG 3DFQA 3C0SA 3MWCA 1JF6A 4JFSA 4EKJA 3GSMA 3CL7A 1JZ5A 3V4BA 1LCOA 4Z1CA 3OHIA 1UC5A 4NJHA 4YPJA 1V0LA 3PBYA 3HMJG 2Y7GA 1J11A 3PPHA 2YLLA 1FDJA 5BRQA 4E8CA 3W2LA 3VGBA 3SY1A 3FYOA 8TIMA 5JUVA 2ZBTA 3TKFA 3WF1A 2CLPA 2X2YA 2Q6ZA 5LGZA 6PTDA 3W1TA 4WY0A 4AF0B 2EXOA 3E2QA 3ORWA 3QV6A 1RCQA 2VFEA 4TTGA 1CGVA 2XSBA 2OVLA 2GUBA 5AC7A 4KEZA 2J7CA 2J62A 1L6WA 3LBCA 3RPMA 5DCEA 4JTAA 2VR4A 3CXOA 3KVMA 4N9EA 3FVDA 4H7VA 4H3DA 3TJIA 3LHUA 1UQYA 2CZVA 4EK7A 3G1SA 2EG8A 1ISXA 2G4JA 1UB3A 3N4AA 1C90A 2XIBA 3RMEA 4D8LA 2QF8A 1J18A 1W5NA 4J28A 3WL1A 3PAJA 3VOIA 1WZKA 3EWCA 4H8UA 2R1LA 2VJXA 3GU9A 1NEYA 1Q2SA 4XKYB 1OFDA 3W7JA 3DFPA 2A5HA 5I77A 3IGXA 4MNLA 1UH3A 4WRHA 4AXNA 1GEQA 2ZZ4A 5HAOA 3VOGA 1H7XA 3E0IA 4J3VA 1HGWA 2QCNA 2GOKA 4R53A 1M7PA 1XLLA 3U2EA 3M44A 4Q6XA 2HS8A 1W1ZA 3W2MA 2XJ7A 3W86A 2JKEA 2J88A 2H8XA 1YNQA 3GFZA 3WO8A 4IMGA 2VO5A 3ES7A 2WJEA 3QF0A 4BFAA 4HNCA 1EFZA 1I0DA 3TCEA 4M81A 2XN0A 2JGQA 1V79A 3HFYA 1GYMA 5K9XA 3TXZA 5IRPA 3G1XA 1A5AA 2YJQA 4RXGA 4LOCA 4EOUA 3RXZA 4NYUA 1AA1B 2NT1A 2XIMA 3NSXA 3EEZA 5FEZA 3ABOA 2BNJA 4G9PA 3KRZA 2CCRA 1XS2A 3PFRA 3AWNA 1JD9A 1A4LA 3CZKA 3C2RA 1J0JA 4EF9A 5REQA 4K7YA 1E1FA 4GZEA 1W0MA 4MGGA 3VU2A 4HPGA 1H1NA 1NWRA 4A8LA 2HVNA 3K8KA 3T09A 1F2JA 4B5SA 2ZTKA 1A47A 1IT7A 3RGTA 2GVEA 5JXQA 1VQTA 4WJEA 3BLLA 3ELFA 2DZTA 2YYUA 3KLKA 1DWJM 1EDQA 4UWMA 3MS8A 2O56A 1I4NA 2JEQA 1WV2A 1DJQA 1V0MA 2XIJA 4JKLA 1VPQA 1EQCA 3CV2A 4PMYA 1NWSA 3VKDA 4AYGA 3FJ4A 4UQAA 4LUSB 5AYYA 5K4ZA 1W2VA 3H4XA 3A4AA 2IQTA 3DBNA 2WV8A 4KQNA 4B5VA 5HPCA 4I7UA 4PYSA 4C65A 3UESA 2HJPA 1HJWA 3WUEA 3U7VA 4DIAA 1GNXA 3GU1A 3SGGA 4EPKA 5D2XA 3V1PA 5CJ5A 1F61A 5M2FX 1JPKA 1FHLA 3EB4A 2GLKA 4DJDC 1W37A 1BYCA 1US2A 3U2ZA 4AF0A 1V03A 1ZJHA 4NZFA 3F4DA 3NO3A 3W1AA 2OFJA 2QNEA 3TNBA 3T8LA 5EA9A 1UZDA 3Q45A 2VKZG 2ZUUA 3CMFA 2WBGA 3SCRA 3PULA 4UTUA 2H9AA 2X1UA 4ZVJA 1XUUA 4BKNA 3E0WA 4AFYA 1VEOA 3ANUA 4M8UA 3MKCA 3MV01 2POTA 4PMXA 3DESA 4PSRA 1OJXA 1X39A 1MYRA 4NG3A 4RDWA 2NV2A 4GHRA 3ZT7A 2ATMA 3GIYA 3A21A 4ZQOA 4N0RA 2G3NA 1HW6A 4UTLA 3GDMA 4HNTA 1WOBA 3SFKA 3PANA 3BSGA 3M5YA 1M7OA 4M80A 4XKMA 3DC8A 4LUTB 5KZDA 1U1JA 1X7FA 3S8HA 4UQEA 2E3ZA 3TFXA 4XAGA 1TPWA 3DXIA 3W37A 3VFCA 1G4TA 1DWFM 4OE7A 4W87A 2OQLA 4CCDA 5FEXA 3SAZA 4J3ZA 5H6HA 3V5OA 3QGAC 2P3EA 2E67A 1FH8A 2O0TA 2WJFA 1B3YA 1OX6A 2J66A 3EDJA 1H63A 1MQQA 1M68A 2B0MA 2BVTA 3PAOA 1IZKA 3TWAA 1T7LA 2B81A 3PZOA 2IS7A 5GPRA 2WMKA 5LIUX 4D6EA 1FWHC 5JU6A 1XSJA 1SJDA 1RV8A 1C3FA 3OP2A 1OD0A 3BSMA 1T8XA 3XINA 4LYKA 2JK2A 2PTWA 3WFAA 3ICJA 5D9OA 1OHLA 1SFJA 1BGGA 2CLFA 3NQ8A 3H4WA 3CUHA 4AC1X 1M3UA 3CHVA 1F4HA 2V82A 3EB2A 2C0HA 1K4GA 4YVXA 5I09A 4RZ6A 3USZA 4GI4A 3V0UA 4QROA 4CCZA 3AU2A 2PC8A 1BG4A 2C16A 1X6NA 3LHYA 3JZEA 5DY2A 1XYLA 4KT2A 1G9HA 1U1UA 1MNZA 2PAJA 1P4CA 3BW3A 2CYGA 3L7RA 2CBIA 2VX5A 1XIHA 4HTBA 1XLDA 1L8PA 7ODCA 1KRAC 4A35A 5FACA 1TA3A 4F79A 2V6AA 3MSGA 4NI8A 4ZB0A 4IJRA 3ARTA 1KNWA 2OG9A 4DUVA 2C0AA 5XIMA 3W84A 1E6ZA 3NGFA 1D3GA 3LQLA 4MADA 3H8AA 4NY2A 1D7KA 2V2CA 2EKCA 3CHEA 4I8DA 1XBXA 3LHTA 4JAWA 3VE9A 5TQLA 3SCSA 4AEOA 2Y88A 4IX0A 4JYFA 3M43A 5A6AA 3DEQA 1VLWA 2Z1XA 1RA0A 1BHGA 1CGUA 3UBPC 3W3OA 1O60A 1R2TA 1GOWA 1KM0A 1VRXA 4UFLA 1AD4A 4PMUA 4B9YA 3DGRA 4HPHA 3L68A 4XAYA 3SUTA 4UCFA 2O55A 1KFJA 5GJPA 2FZMA 2DIKA 2HBXA 3KL0A 2WMFA 5AC4A 3RR4A 2PA6A 3H2OA 3A9IA 3MSRA 3AXHA 4JD4A 3OJGA 3VNJA 1BLIA 3SCQA 3W87A 5D2VA 4AY1A 1PB0A 1B2YA 1C8QA 3N4EA 1HIZA 4GJIA 1H5VA 2J8TA 3FKRA 1TSIA 1BTCA 2Z29A 2Y2WA 1RJPA 3NTYA 4G7EA 4I5XA 4ATWA 2W92A 4ORIA 4AHPA 4RNIA 4D9PA 3HN3A 3BWWA 2YKKA 3MI3A 3MUXA 2PWEA 4B5TA 5FF2A 4V2XA 1GVFA 4DUXA 1XC6A 2AGTA 3DIPA 4UNIA 4CD5A 1V6YA 4WDTA 1BVZA 5CPQA 1TX0A 3IPWA 4Z2LA 3OVRA 1VJZA 3MJMA 2XGIA 2B7PA 4H6QA 2IQDA 4LEFA 4LAMA 4NP7A 4AU0A 2NVAA 4ZOBA 4O11A 3QJAA 3N15A 3AHXA 3ZS4A 3MW7A 1UZ4A 1BSIA 1BQGA 1Q7QA 3OIXA 4L56A 3GVRA 3GNDA 4PEKA 3PZGA 1TRDA 3CHDA 1AH4A 2YDQA 3ZQ9A 3REQB 3OLEA 1RPXA 2OWXA 5CSRA 3T2OA 2YBVA 1US3A 4A3QA 5H8MA 2P3ZA 2VR2A 1LP6A 3NOEA 1OF8A 1FWTA 1LT7A 4GKLA 1E5NA 1UA7A 3WF2A 1XH2A 3ISIX 1ZALA 1OCBA 3BMWA 2A79A 1MUWA 4M0XA 4LUTA 4DY1A 2VT0A 1SO3A 4RDVA 3HG4A 4OOZA 3G6MA 1PEZA 3UFYA 4WHBA 1R86A 3BGJA 3B03A 4XBJA 1FHVA 3CEUA 3DKLA 1ISVA 3B40A 4GI8A 1XF0A 2F9RA 4AW7A 4PL1A 4YTUA 1V5XA 3HU7A 4L1GA 3WKZA 2PWVA 1K77A 1QW8A 1FY6A 5AB3A 1BF2A 3UW6A 3RMJA 2QKFA 2ISVA 4TIMA 2G8ZA 2A3CA 1MEHA 2YBTA 1DE6A 3GIQA 4QHRA 3N2CA 4Q7IA 3KOWA 1Y8BA 3RG6A 5MF5A 3M0KA 5CPSA 1IR2A 3TSBA 5C54A 2W4XA 1CLXA 1LTDA 4RE3A 3WDIA 4L80A 4GUHA 2GGIA 2P10A 4PCFA 4YXGA 1LJYA 1W9BM 4ZSUA 1KBIA 1B3VA 4FIRA 1QU4A 3GHUA 5IFTA 3B8WA 3HG5A 2E77A 1WUFA 4ZOEA 3EAUA 4C6EA 4ENLA 3SJ3A 4NUWA 1VP5A 3GK0A 1HJVA 2ON3A 3E2VA 5TD4A 5CLWA 3MSYA 3RLVA 3IRSA 3ITYA 3BAXA 3L65A 1XG3A 4E2VA 2VGFA 2X7VA 1BGAA 3EDEA 3FYPA 1TVPA 3W6MA 2HS6A 3NZPA 4Y6GA 4Y8EA 1GOXA 2C7FA 1KXQA 3WUBA 4LVAA 3GAYA 2CFFA 2ZRXA 3CK5A 4AZBA 2J47A 2XWDA 3ZR6A 5CKSA 3UR5A 3W7HA 5D9MA 3H2AA 2QVHA 3VNMA 4Q8WA 1F07A 1WPCA 3UXIA 1F9CA 1FP8A 1ZTVA 5C2GA 4QS6A 5ABFA 3GO2A 1ELSA 3CH0A 4E4FA 3MSDA 5FAJA 2CKRA 3WH9A 5LZLA 9CGTA 4JQAA 4ERGA 3DC0A 3F4CA 3VGGA 4EPBC 1NF7A 3MY9A 1E6PA 2PLCA 2CLMA 3VNDA 2OT1A 1ZJIA 4HOXA 4HQVA 3RJYA 1Q6OA 4XZNX 4AH7A 5CSUA 3O8AA 1YDOA 2XZ7A 1YE6A 4WSHA 3P5ZA 1R0MA 2FVMA 3RRXA 1A5CA 1SO4A 3W73A 5FF4A 1IWAA 3WNNA 3SM0A 4RNFA 3VILA 3ID7A 5DMMA 1LBFA 3NM3A 3AHTA 1Q5MA 1Q6QA 4IPLA 4NF7A 4KESA 3VNIA 1TZ7A 3TR9A 3AISA 3BGAA 3SO7A 3SURA 4O18A 1H0GA 5KITA 1B9BA 2YDAA 3WF4A 3GC4A 2C91A 4H9ZA 3W53A 1HKMA 3F2CA 1ZLPA 2CKSA 1PCKA 3GXPA 1GW9A 3IJLA 3QZEA 5I79A 2GQ8A 3FA4A 5J04A 1FWNA 4GJJA 5HMFA 4X60A 1WZMA 2W63A 4MUPA 1EHNA 3WZ0E 5G1YA 3OLGA 4MZ1A 3HA1A 3I6TA 3L0NA 1DXIA 2GWNA 3ZO9A 5G4WA 1UASA 3O3RA 5CAKA 4HHPA 3WDHA 3VMOA 4YCOA 3PUDA 3TN6A 3ZOAA 4DF0A 2ZWZA 5E0FA 2MNRA 1TPH1 1AZ1A 3MO7A 1XIIA 3B04A 2OMAA 4GIEA 4PBFA 3OZOA 1BXBA 2ODOA 4CQ9A 4PFHA 3DAQA 3AO0A 3QV7A 4JEQA 3UCDA 1XPYA 4IPJA 4R33A 4CN6A 2CEQA 4GI9A 4PEEA 4B16A 2ZUWA 7TAAA 1WP6A 2FZDA 5DXXA 3MB9A 2YCJA 3WD4A 4IPNB 1W17A 4O8AA 4HP5A 1E1EA 4JTKA 1R9XA 1Q6CA 3BLIA 1EC7A 2VFHA 3RLHA 3PB0A 3QZAA 4L61A 5CPTA 4IXXA 3BMXA 4A3YA 3KHJA 3TN5A 2VFIA 4GYPA 3WK3A 3SIMA 4X0VA 3WMLA 2PRHA 1W8GA 1V3KA 3D6NA 4OECA 1OBAA 5EY5A 1MVYA 4GMEA 1XDMA 3ZM8A 2AQOA 2DSKA 4QDPA 1UBSA 2ACRA 4KF1A 3VGFA 1Q63A 3TOPA 3BJSA 1FWCC 3VOCA 5HNUA 4LXFA 1B4EA 3QC0A 1BRLA 1CEOA 2XH7A 5C2CA 7XIMA 2HVMA 3LTPA 1VB9A 1HJUA 1ITCA 2VM8A 3VO0A 1QXLA 3R13A 2VRKA 2XVKA 1ONXA 4Z2IA 4UTWC 3PTMA 4OIFA 4KEMA 4Q4RA 1OVDA 5AVHA 3W02A 3PBMA 4JKKA 3T4CA 4W8AA 4DBSA 1B3OA 3P0WA 4CNNA 4OFCA 2Z1VA 4UMCA 1Z42A 4NXSA 1OABA 3LHWA 3RO6A 1W6TA 3TSMA 3B8SA 1VBRA 1JDCA 4QS5A 2D73A 3SCWA 1O5XA 2Y7EA 5U4NA 2WSQA 1XLEA 2PLKA 4QR6A 2ZZ2A 3KCJA 4E4UA 1SZNA 1HT6A 2EG7A 1EJUC 1E4MM 5HNRA 3QTPA 4A3HA 1L2QA 1XLGA 3LLXA 2J9YA 3QHNA 2I57A 3TOYA 5CZJA 3L67A 1FWGC 3AROA 1R3QA 1AMKA 4ICCX 3N17A 2OKOA 3E0LA 1SGJA 3CT7A 3PNZA 3L66A 4GIRA 5KMYA 5B7YA 3M46A 4LFYA 4WKHA 1XRVA 2QGYA 2VTFA 1WUEA 3FK4A 3SCUA 4HPJA 2ZC8A 3C52A 1DKWA 3BCFA 1CIUA 1QNQA 3IJ8A 3AIEA 4UCGA 1KRMA 1SZFA 3ITXA 3V16A 4M5PA 1TWIA 4LTSA 4GYFA 1VIZA 1K7XA 3TQPA 3LG3A 1CNVA 1LWJA 4PRTA 3NAVA 3WF3A 2CIPA 1EYWA 1PX8A 3N2MA 4ALDA 1EJSC 3CZGA 1FWFC 2QQ6A 4QXIA 4ZL1A 5E9AA 3F2DA 1G4PA 4HA1A 2NX3A 3K4AA 3GFYA 4UR7A 2FFIA 5BW6A 5CZKA 1DJXA 1ZJBA 1TZZA 2YYTA 1JCXA 4FPSA 5IBXA 3I68A 4B5NA 2IXVA 1KBJA 4JIPA 1QO2A 3IK2A 3BMVA 4HA4A 3M41A 3ATYA 3N2XA 1VFTA 3UWUA 1PTGA 3KBSA 1E9YB 1NTHA 4J2PA 3N2OA 2X40A 4DXXA 1Y0EA 4MFDA 3VKJA 3HG3A 5E0KA 3H55A 4V27A 1DHKA 4XUGA 1IQ8A 2PDMA 2QCLA 3E96A 4AD5A 4U28A 4MHBA 2Y6ZA 3P82A 4WJXA 2NXGA 1S3HA 4ROQA 5CLTA 2I9UA 2X09A 2P8BA 3DHUA 1B3XA 1EPVA 1VEMA 4C1KA 1UKOA 2QJJA 3AJ7A 4DXVA 4R7JA 2X16A 4LS0A 3W7DA 3E6EA 3WUGA 3KXQA 3VIGA 1ME9A 4GABA 1S2TA 5HQLA 2OQHA 4FB7A 5IDIA 1W31A 4C6NA 2ZOXA 5M5DA 2BY3A 4Z0SA 3A4XA 1XIDA 1QTWA 4Q8VA 4K8HA 3TX9A 2BP1A 4DF1A 3GY1A 2JFEX 2BGQA 2BOEX 2ATSA 3M6DA 5FJOA 3N9SA 4U3CA 4D71A 2XIQA 1SZRA 1S38A 5CBJA 1C7SA 1SMDA 3CUFA 4EP8C 1ADDA 2VFDA 2YR1A 4EIVA 4BF9A 3IV8A 1H3GA 1SW3A 4RDYA 4R27A 5G2WA 5DEZA 2RGMA 3GH4A 1MNSA 4L1XA 4KRUA 4R7WA 1VYPX 4CVWA 3SRFA 4JTIA 3STPA 3MP4A 4N7QA 1QFEA 3C2FA 2X7WA 3WLLA 1J2BA 2VOMA 1E0XA 4IP5A 5AOUA 3LM7A 1IWPA 5HULA 1KM1A 3DG6A 3VCRA 1ONWA 2ONEA 3W00A 8XIAA 2RDTA 1CTNA 1NAL1 3LUTA 1EH9A 1KBKA 1QI5A 2AQWA 1F6PA 4IPPA 4ZODA 5FEPA 1LQ0A 1J93A 1F3EA 2C13A 2J7DA 2TYSA 3ARPA 1GJPA 3GTHA 4GINA 4NU7A 2WJDA 9XIMA 1BVWA 3KVJA 2JKPA 1F05A 3NQGA 3W6LA 1K8XA 2E0PA 2Q71A 4M6VA 3W0KA 2YXXA 2VYOA 3NL6A 1A3WA 2Y8VA 3M0JA 3HV9A 4GC4A 2EBNA 1QO5A 2GGEA 3DKJA 1FWWA 2G3IA 4KFNA 5T26A 2F2HA 4JYEA 3ZR4A 3Q58A 4XZBA 1Z89A 2VCAA 1RBLA 2CLHA 1LQ2A 1IIHA 4GC3A 2J7BA 2QIIA 4C7DA 4IIBA 3IIXA 1H7RA 4G7FA 4H9MA 2XGZA 3WK2A 3T44A 3FHAA 5E09A 3K46A 3HJEA 4S3GA 4FXJA 2NQHA 3W83A 3AHVA 4O1CA 1OZMA 1OIFA 2FHFA 2Z00A 4GBDA 4ORMA 5GNYA 4QISA 3TW7A 1OIMA 2WKJA 4JY8A 4G1KA 3M0LA 3WBEA 2A2IA 3B8TA 3FAXA 3UF9A 3AMGA 5HMDA 4C6CA 3QZ6A 3ARXA 1X1OA 1JZ6A 2VX6A 2I5IA 1TVNA 5D30A 3L9CA 3FY1A 2R24A 1PAMA 2BB0A 4OVXA 4UXDA 4CD8A 1QOPA 3C86A 4IIGA 4LS2A 4KFOA 4GA8A 1P43A 4XX6A 4S3KA 2OZ0A 4PTMA 3TTSA 3SUWA 1YNPA 2C6QA 3T07A 1LWHA 2QPXA 4F9JA 1BWKA 4HU4A 5K9DA 3VC6A 3SQSA 1UR0A 5DF0A 1UH2A 4TMCA 3IJ9A 5FA5A 3QPYA 3FOKA 1P7TA 3ARUA 2ZWYA 4IMAA 2DW6A 3VKBA 2I7GA 3U8GA 5J5DA 1YXDA 3MKKA 4RE4A 1ISWA 1EKOA 3GNXA 3WLNA 4E2OA 4JDBA 1C9WA 5CJNA 4N9DA 2PMQA 3N6QA 4GXMA 4ZB2A 5IHSA 3IJQA 1YXCA 4FF7A 3SUSA 3SQLA 1O66A 4DJFD 3M0MA 2A85A 2ZRYA 3IARA 2J8FA 1LRTA 3BLPX 3STEA 1YPFA 4OUEA 3ALFA 4MG4A 5B7ZA 3W85A 1RQBA 3FHQA 2WW5A 2V81A 3VD3A 2EPHA 3EGJA 3RX2A 1PKYA 3WQPA 1MXSA 3RCMA 4X63A 1RA5A 4HJFA 1CBGA 3QPZA 4P5UA 4AG0A 1UUOA 4YHEA 4FNUA 1VKFA 4IT1A 1XI3A 1EBGA 1W1A1 4IFKB 1E6RA 4LUYA 3BOLA 1SSGA 4HCHA 3M4HA 3G18A 2PFHA 3VNKA 2FZ8A 3KM8A 5JIWA 2WSPA 4GG9A 1X98A 4C6DA 4I6KA 1KQZA 3MI6A 1PL9A 5D37A 3W29A 3GNRA 5CC7A 5H8UA 2YZRA 1HZYA 3P81A 4QITA 3I10A 2ZYFA 5A95A 5E6YA 4LF2A 2EHHA 2B7OA 5GQBA 4OJYA 2X0SA 3NQBA 3A64A 3OZYA 4WUIA 4IICA 3EWWA 3PPCA 4M6PA 3RPTA 4C6KA 1YNYA 3TCSA 2GQ9A 4R34A 4M1BA 2C19A 3W23A 4JTSA 3U9IA 4F3HA 1IEWA 3P84A 1W3IA 4REQA 2C14A 4P61A 2VDGA 3AIUA 3SY8A 3F2BA 4MUZA 1FOBA 2INFA 1VJSA 1Q2RA 1GHRA 3CL6A 4GVIA 2IKIA 1V93A 1SU5A 4XZ9A 2V68A 3IIPA 1I2PA 3S9ZA 2DUZA 4AX7A 3BSHA 2PDHA 3W2UA 1PIFA 5CXPA 4DZHA 1QPOA 1OY0A 3NVTA 3EPNA 1Z7AA 1ZB5A 2A3HA 2QDGA 3COTA 4NJIA 4XSLA 1E4LA 1V3LA 4NJJA 2GUUA 3CNYA 5A69A 3QVQA 2QCMA 1PX4A 2WSYA 2J7HA 1LL4A 1MW2A 3V1HA 1S2CA 2H3BA 2PLMA 1OF6A 4NZ5A 2YOCA 3HPSA 3GD6A 3ONBA 1NELA 4RNJA 4CEXC 2Y70A 3IIOA 3I6RA 5LIWX 3DHDA 4L1WA 3BG5A 4B5XA 2OLHA 3RR1A 5FCZA 3M0HA 3CQ0A 1S1PA 3KP0A 1UP0A 5A8GA 1FKWA 2ZX9A 3VC5A 1XLAA 2VC7A 4Q6JA 1NJJA 4R9XA 1UPPA 1EWDA 1MXDA 5B80A 3AJXA 1F3WA 3M7WA 5FJIA 2BWGA 1JVNA 4JN6A 1TTPA 4JIHA 1XINA 3IANA 4PGLA 2Y5EA 1AZ2A 1QHOA 1I6NA 5AHEA 4JCLA 3Q37A 3I4KA 3L2MA 4IIHA 4I6VA 2REQB 2XSXA 5I23A 4JPGA 4F0KA 3B8UA 4PSPA 4NKCA 2XINA 2QCGA 3TTEA 3LXBA 3G77A 2EO7A 3MHFA 4PB5A 1X7IA 3ZVHB 3IGHX 3OW1A 3GS6A 2WM1A 3CAVA 1Q66A 4WDXA 1XRTA 3W38A 1DQUA 2E5DA 2CXEA 3T2PA 3N04A 3LENA 3DECA 4QBXA 1JF5A 1HFBA 3CLMA 3UPBA 2PRLA 2VELA 4LNYA 4N9CA 3FKKA 4JQ2A 4ZO6A 4NI3A 2HNHA 1W56A 3GNPA 4F0SA 4IUOA 3IAPA 1ML1A 3AIRA 1LROA 2UY5A 2Z1KA 2ZZ1A 2V2HA 3ZXWA 4FI4A 2PTXA 3ES8A 1GVOA 2NV1A 3KDNA 1YADA 2Y7DA 2D2GA 1UOKA 4BF5A 3WFLA 2F6KA 2POZA 1EL3A 3UY7A 5T91A 3EOOA 2BOFX 2V63A 2FHBA 4MY9A 2F6UA 3KHDA 4HMEA 1PKNA 2Y62A 3NCOA 3LXAA 4S2CA 5H2ZA 3VD9A 3UG5A 3EX6A 4J1OA 3WLQA 3CHFA 2Z6JA 1CXEA 2GYIA 2NVCA 4KFPA 1UKTA 4V28A 5CG7A 3P0XA 2OZ8A 1P0DA 4FIQA 3VK5A 1W9XA 3WN6A 2X1IA 4B3ZA 5G2IA 3IIZA 5FL1A 2DDXA 1LOLA 3CMGA 3L5AA 5BCAA 1ODZA 2VUNA 4ZEPA 1E15A 1TR9A 2BGNE 1SUXA 3RCNA 2IPWA 4UTHA 1WKEA 4AZCA 5HXMA 4DVOA 1NY1A 5GJMA 5HQEA 4P8VA 3TK7A 1JDEA 1LF1A 2HVOA 3PY2A 1YTKA 1LDCA 3Q94A 1EUNA 1OYBA 4LAKA 4XO7A 4B5UA 3D3AA 3UQNA 3U5YA 3VIMA 4DN1A 4B4HA 4DJEC 3MTWA 4A8NA 4AISA 3A5VA 3W1XA 3KZPA 3N73A 4A29A 3ECQA 1TPB1 3G22A 4YHGA 4F2TA 4LGXA 1OFBA 3HM7A 3VDAA 4D72A 3OODA 3LPPA 3EX2A 1F8MA 1PYFA 3S5OA 1YE4A 4Q4PA 5AZ1A 2WLZA 5A3HA 3TWBA 3CZLA 4UOJA 1T99A 4J3XA 1B3WA 2VENA 1OFPA 1MMFA 3MBFA 4DBWA 1NVMA 3PZNA 3AIVA 1PJ9A 4GI6A 4ADUA 4G7EB 1XFCA 1KRCC 3MZ2A 2C1GA 2NWSA 1UPMB 2TPSA 2V5JA 3S2NA 3XISA 2NXIA 4KRTA 4XKYA 4GISA 1UWUA 4OBSA 3LLFA 2FYMA 4J3UA 6ALDA 4GXPA 2GVJA 4DHGA 3SY5A 4N02A 3MUY1 1FDYA 4MIMA 2QJMA 3U48A 3PG8A 1FFRA 4KWUA 3B8IA 1KO0A 3WLPA 3PZUA 1BXNA 3ME3A 1A53A 4RZBA 1TCDA 4Y9AA 4AZ6A 3UJSA 3WSUA 2OWWA 3MMUA 4AMCA 3NZRA 3ZVHA 2GJLA 3K8LA 3SRKA 3ARSA 2V3GA 4DJED 4HSOA 5HA7A 5A8PA 1G5AA 3CM4A 1C8XA 4MB5A 1EOMA 1JQVA 1DJIA 3VAVA 1I2NA 1OYCA 2E9MA 1I8JA 4M6UA 1W3HA 3W2JA 3GZAA 3MV11 2X1RA 5G5IA 1J12A 4N6FA 4PH6A 2C15A 3C4UA 2FMOA 1NM9A 3ZWTA 3PM6A 2BV9A 1WDDA 3TSDA 2A1YA 3BH4A 2FTYA 2HSAA 2FPYA 5BU6A 3L0GA 2ACQA 2V5LA 2V0TA 4JS3A 3TXVA 4PMZA 2ZKMX 5C70A 2CBUA 5I7GA 3NPWA 3GNOA 4XAFA 1J5TA 4F0RA 4GE8A 3MANA 3GBDA 4DF2A 4Z1YA 3N29A 3H23A 3S5ZA 1WNOA 1EJRC 1R7OA 5A6SA 4OQVA 2L5HA 3MA8A 1DWIM 1E9ZB 2I16A 5AC6A 1AW1A 3H54A 2TSYA 4IGNA 3OIHA 1OGBA 3F4NA 4HU8A 4H8HA 4S3AA 2JALA 1F7BA 3W7EA 3CH9A 3EWDA 4JNMA 4JQ4A 2VD8A 4O12A 1FCVA 1A50A 3T0TA 2NW0A 4A05A 1XL9A 4R3UA 1R30A 2I14A 4HN4A 4NNBA 2H3DA 7TIMA 3VMNA 1HKJA 3H6OA 1EP2A 3MI2A 2GUYA 1UWAA 1X6LA 1DP0A 4HPNA 5I03A 3R2GA 4NRRA 1ZGDA 1GJWA 2OCZA 3PBWA 1VPYA 4ZQMA 3A9BA 5BWFA 2QJHA 1MI3A 4FALA 3VIFA 2BY0A 2Y61A 4XZHA 3CJPA 1YPXA 2QMJA 4JQ1A 1L9WA 1Y5WA 3PWIA 4A3UA 1HJQA 3C56A 2PGEA 3RM9A 3WEZA 2YXOA 3ABXA 5AHMA 4O1AA 1JCJA 3ARQA 1Y65A 5I5RA 4QDWA 3DFOA 1EJ7L 1WDSA 2YX0A 4F66A 1EIXA 5DX7A 3S9YA 1GG0A 2YB4A 3WK1A 3N12A 2Z1SA 3H24A 4NZCA 2BXVA 3QFWA 1HKKA 2YCLB 1TJRA 1LZOA 3UETA 3BZJA 5CZ0A 3NGJA 2WM0A 1H41A 2E1DA 1S2VA 1KA9F 4I7WA 1U83A 3HOJA 3QGKC 3LMZA 4HCDA 4QNWA 5FKYA 2VURA 3V7PA 5KEZA 2G41A 1IXNA 3ZJ6A 4W5UA 4ICNA 1LM1A 2BTMA 3JZUA 2Y5JA 2G97A 3EWXA 3GKFA 4BA0A 3G2GA 4NAEB 2XM1A 3DFSA 3KX6A 5CGTA 4H1ZA 2E9BA 4ACZA 3U0HA 3JR2A 2BVDA 3CV6A 3GXNA 1ZSXA 4JIEA 2XM2A 5TIMA 4EAYA 2PTDA 1KM5A 1WXJA 5KZEA 2CC0A 4L9XA 4Q8QA 4K6AA 4W86A 3W25A 1E0TA 4GQBA 1BKHA 3LBMA 5A5WA 4U2ZA 4YLWA 3B9OA 4XAZA 2QULA 2HPIA 3TV8A 4OWGA 4JN7A 4QJ4B 4F9DA 1QWGA 1NIUA 4FX8A 4JOMA 4CD4A 3QSRA 4B92A 2G96A 4HZMA 1F6KA 4CNTA 1G6CA 2WMGA 2BMBA 3UPMA 2O7SA 1MQRA 1E40A 1PZ3A 1S5MA 4INFA 4PUMA 1UZ1A 5C9ZA 1EBHA 2H6RA 3KTXA 4GY1A 2YLAA 4P8XA 1RPKA 1KFEA 1XFBA 4KERA 2VDHA 1EF2A 3BAYA 4U5IA 1QR7A 3VGDA 2QCEA 3ARYA 1DEDA 2UZ9A 4Y9PA 2A6LA 2G3JA 3R7MA 1D8CA 4M3PA 5A2BA 3QV9A 5DBUA 3MQTA 1GOQA 2QDDA 3SUVA 1EJXC 5ABTA 6CGTA 3MC5A 3A23A 3N6HA 3ATZA 4ERAA 1B4KA 4MB4A 3GTFA 4UFJA 2PU1A 1R5YA 1DIKA 1FA2A 4B90A 4ZXLA 5ECUA 5EYWA 3BURA 2XWEA 2GDQA 5FOOA 3N14A 1P0NA 2J6XA 1NP0A 1DVJA 2CITA 4LAZA 1BVNP 2GDUA 1E0VA 1KB3A 1TWWA 3UEQA 3RLGA 3UZ5A 4X9YA 4W4QA 2VEIA 3USBA 4DO6A 1SZEA 3FAWA 2Y7FA 3WQ4A 3GUWA 1PVNA 2DSUA 3ZLGA 1TR1A 1QNSA 2DZVA 1XV8A 3LHVA 4XBSA 5FJTA 4JTJA 1IGSA 3SRHA 5DANA 3G1FA 2E8YA 3NYDA 2JGYA 3DYOA 3LPFA 1H2JA 3NSNA 1X1ZA 3P60A 4PRRA 3QW3A 4NT0A 2V67A 2OR2A 4AD0A 5A8OA 1OCNA 1JI1A 2XDFA 1L6SA 3B8DA 1OK4A 2CZDA 4MKVA 4NL1A 4GUIA 4U2YA 3HTWA 4MTVA 3DFNA 6XIMA 2O9RA 2D1ZA 3P80A 4UQ9A 3S2JA 3GWQA 4XZIA 4RE0A 1E43A 2BY2A 3E2RA 3NOYA 1VCGA 3PBUA 5FF3A 4HPXA 3PJTA 3SSJA 3PZQA 4HNLA 1UP3A 3RO8A 3N9KA 1ESWA 2RDXA 2X8RA 3TQKA 2A3EA 2DZWA 3CGTA 3KWSA 1AFSA 5F4XA 3KRBA 1EEXA 2Y89A 3R4IA 4IP4A 4JN8A 4ML4A 4XWUA 1U1HA 4MAVA 3QOMA 1CENA 5TF0A 4H9YA 1ZJAA 3MMDA 4AQLA 4DJFA 4BI6A 1ALDA 4XO6A 4BQ4A 3V3WA 4D2JA 4N6EA 2BXZA 4QEEA 3MHGA 4H4IA 3NL5A 3T0CA 1KW1A 1CGYA 3B9NA 4LUIA 3PB2A 3U57A 3DBPA 2Y5SA 4BZYA 3FS2A 1KFBA 1X96A 4C1LA 4ZTYA 2DZPA 5D33A 2X42A 3NDOA 4P8WA 4PTDA 4JTCA 1K4HA 3ZSTA 1VF8A 1LG2A 4UIOA 5F2GA 4Q3MA 4GKTA 2RDUA 2BDQA 1EXPA 2Z7GA 4WXZA 1OX5A 2WKGA 3LPOA 3OBAA 1WBJA 1CXIA 4BF7A 2V2DA 4KH2A 1X1NA 2ZXQA 1LBLA 3KCLA 1TA3B 5A6LA 3UVAA 5HJYA 5E1QA 5I3GA 1J0ZA 3GBEA 1A5BA 2P76A 1LLOA 4ZQRA 2VZUA 4Y2WA 1RVKA 1EOKA 3THQA 1CDGA 5HPOA 2FTPA 1OFEA 3VZYA 3W6YA 4FR6A 1EP1A 1JYNA 3V18A 3GW3A 3WMBA 3OHMB 2D24A 2ZXDA 3WQVA 3GXDA 5BMXA 3PP7A 1DXFA 3GVGA 2X30A 2GJXB 2VEPA 2AKZA 3VABA 4URIA 4PUDA 4XAPA 3FN9A 3AXMA 3FFSA 1NQKA 5CAHA 4CD7A 3WBYA 2VCBA 1OGSA 2Z7KA 7REQA 3FVMA 3AUJA 4MVAA 4B2DA 1KM3A 2ZVRA 2FZNA 5EMMA 1ZENA 2XVLA 4H6RA 3ZLHA 3CV1A 3H7RA 4M7TA 1GVSA 3BTNA 3SCOA 1YKWA 1IT0A 1BEUA 1SO5A 1W5OA 1Z3NA 2WHLA 1VBJA 3M9YA 1XIMA 1EWEA 1HXJA 2VRQA 4NX5A 4AWSA 4HA0A 4MNMA 1AK5A 1UUMA 3XIMA 4P7LA 3H7UA 1TYGA 3ERPA 2J7GA 2R14A 3A6OA 4H7ZA 4UTKA 3L4XA 3UERA 1M7JA 1XIGA 4TQTA 2P50A 1KFCA 2ZE3A 3M0IA 3M07A 3WQ6A 1PCWA 1W2PA 1RUSA 3M0VA 4NJGA 3EWUA 4K37A 1QJWA 1WE5A 4PTVA 4KIRA 1FWRA 1FQ0A 2WCGA 3R1ZA 4FLQA 4O53A 4BJHA 4CU8A 1IXPA 1EX5A 2Z1WA 2CHOA 1JD7A 1NOUA 1KCZA 3AS0A 1O68A 4XBKA 3G1DA 3UZXA 1EPXA 2GDVA 4E4PA 2R91A 4NXKA 3BUVA 3THCA 3GC2A 1C7TA 5E9XA 3B9DA 4W8LA 4CQAA 2ZX7A 2D3NA 2QCHA 2YSWA 3N6JA 5BYWA 4UMBA 5JBFA 3B9EA 1RSCA 5ENLA 1EQPA 3PTDA 3SADA 1AL8A 5AHFA 3CO4A 4O57A 3QFEA 1W1B1 4PUUA 4C7GA 1XLFA 4RJEA 4QQUA 3A13A 3F5JA 5EMUA 2WAGA 4JICA 1TV3A 4ZA0A 1V6VA 1J5SA 3S2MA 2Z4GA 4PE8A 4ZBCA 5FEWA 1VPXA 4CGTA 1XLHA 1PTAA 5F7UA 4NZ3A 1XC4A 4M1RA 3MO4A 5AYIA 5I3DA 1TO3A 5ABFB 1PV8A 3HG2A 2OJPA 3CLWA 3MBDA 4RDZA 1W1VA 3QOKA 5J5RA 1Z41A 1QCWA 3WH5A 1GK8A 2G3FA 7CGTA 1E72M 2WYSA 5A6KA 4AEFA 3CUJA 1VCFA 4PMDA 1NF0A 2PDJA 3RX4A 3AIQA 8A3HA 4MPQA 4O14A 3VKKA 4FNQA 1VR6A 2INEA 2YL5A 1XRFA 1A3XA 2XFFA 5AKQA 1FWJC 2BHZA 2HPMA 3C2OA 1NH6A 3UYCA 1Q4WA 1H7NA 1HKVA 2WSRA 2FMNA 1EJTC 1AQMA 1CW2A 3LV5A 4NAFB 3M5VA 1K7EA 4O8RA 1JUBA 3WFZA 1RK6A 1GZ1A 3PSWA 4BWLC 3M0ZA 2E6FA 4D6DA 3A5FA 1FH7A 4FZIA 2PRMA 3W9ZA 4MJ4A 3LMYA 2CLEA 1XGEA 3CQHA 3G24A 4S3JA 3KBNA 3S2CA 4WSKA 3WLTA 3GVQA 4I9AA 1I0BA 3DG3A 4AY7A 3DG7A 1EF3A 2EAWA 1X38A 4Z08A 3VFLA 2BHYA 3W75A 4J3TA 4GCXA 4V15A 3WEMA 1V8EA 2FIQA 2PPGA 2OYKA 2GOUA 2Q02A 3S46A 1TIWA 3W88A 1KKRA 2RH9A 1LQAA 4ICMA 4KS0A 3PUEA 1XQKA 4W9TA 4GX9A 4N4QA 3KRSA 3UA4A 4JTDA 4PL2A 4CN1A 2YBUA 4HKPA 4AXKA 5I06A 2D0GA 3ZVIA 4Y9OA 3TLQA 4IGSA 2V3FA 3K1DA 1MEIA 2REQA 3E9AA 2OWCA 1VFLA 5I3FA 3ARRA 1A5MC 1S5WA 1F6YA 3O6AA 3GLCA 5IXEA 2DZBA 3KVLA 2VX4A 1P1MA 1VIWA 3EWYA 3L5MA 1M65A 4DPPA 4RX0A 3LSCA 3S6OA 3OOQA 4PZVA 1LRQA 3VM5A 1LL6A 4AD4A 2C18A 3QTGA 1K9EA 2WO5A 5ABHA 3NPXA 4L6HA 4DYJA 1Z8AA 4U5KA 2A7PA 1UWRA 5F4SA 3WJYA 3BL3A 3WEOA 1TELA 3GKAA 1JYVA 3SDOA 1NFBA 1QW7A 4MSSA 3M1ZA 5AECA 2FZBA 3W1MA 3H4GA 3SN1A 1N82A 2W27A 1PWLA 2OODA 2VGBA 1IHIA 2H90A 3TTOA 4PB4A 4H9UA 2VFFA 1FTXA 1IEXA 3VGHA 2FHCA 3TYUA 1NWUA 5LIYX 4MB3A 2GJNA 4F0LA 3BZGA 1AH0A 1TTJA 2PSNA 1ZQ5A 4C6MA 4QIUA 1ZHAA 3GHSA 2WC4A 3GR8A 2WJZA 5JBDA 8RUCA 4J4KA 3CYJA 2GJPA 4F0MA 1GOIA 1KTBA 2E25A 5F2IA 3K5XA 1H49A 1EC8A 4O17A 1IIGA 2H8ZA 3NZ1A 4MMWA 1IXQA 3S5NA 2NQJA 5HWNA 4Q7BA 1UP2A 1KR0A 4ZGYA 3LRLA 2QUNA 4MZ8A 4PC8A 5CPOA 2QLYA 3A22A 3W1NA 1JCNA 2FDMA 4REQB 4MJZA 4I90A 4IFOA 3N3MA 4LCRA 4QCFA 3NNTA 5IOBA 1TFVA 1QNOA 2D20A 4ZENA 1R87A 2ZVIA 1F4AA 2NLIA 2XISA 4YYFA 1WQ5A 1G01A 4XZWA 4LWWA 4QGCA 5FJJA 5DRIA 5D32A 4EXAA 1MZHA 1TWDA 5L6UA 3N4FA 1PDYA 1OT2A 1XYCA 1RBAA 2VGIA 1MRQA 1XICA 3T42A 1UZHA 4AWEA 1JZ7A 4Q4OA 4P7RA 4O1DA 3RJXA 1R85A 4LYQA 1JULA 1JRBA 3S2LA 4H6KA 1P0BA 4WOZA 1N8IA 4AUBA 3PHAA 1C93A 2B7NA 1KM6A 2X1TA 2Y4SA 1TV5A 3KUMA 1Z6KA 3PC0A 2Z28A 3QQ0A 2BHUA 1Z9AA 1P0EA 5LKYA 1A3HA 1MWOA 2CHNA 1PBGA 2KX9A 3UWVA 1GQIA 2YA0A 4FOJA 1QW9A 3KBMA 1TQJA 5A6JA 4M7SA 5AYZA 1BF6A 1W1YA 2ISSA 2PCEA 4DZAA 4TVCA 3I3EA 1E1CB 2RHGA 4ACYA 3P2VA 5D05A 1V0KA 2BXYA 1ZAIA 5DO8A 1E3ZA 2V5KA 4HZ8A 3VMPA 1GQJA 3C6CA 1S39A 1DJYA 4D6HA 5M17A 1VFUA 1T41A 1JDDA 1RD5A 4GFIA 4QQ3A 2GJRA