2V38A

Family 5 endoglucanase cel5a from bacillus agaradhaerens in complex with cellobio-derived noeuromycin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
301
structure length
301
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases
rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 122
structure length 301
sequence length 301
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2v38A00
2UY4A 3L2LA 3IJ7A 4B9ZA 2PBGA 4NRRA 4PYSA 5AY7A 3VKKA 3VIJA 4UQCA 2DT1A 1PBGA 1CXLA 3VIPA 4DUVA 3GNPA 1R8LA 3RDKA 4JFUA 4OBRA 4NZCA 4B3KA 4W5UA 1OBAA 4UFKA 2CYGA 3N1AA 3MMWA 3OZOA 1EQPA 1JD7A 4D6IA 1EDQA 3PTQA 1GJUA 4NRSA 5D9MA 3GM8A 1CZ1A 2WW5A 3LPGA 5C8BB 1JNEA 3HMCA 2OWCA 3HN3A 5CGMA 3WEZA 2X1IA 4ZXLA 1JL8A 4KWUA 3AZRA 3U5YA 3AYSA 3NYDA 1R87A 1M04A 4F9DA 3WFZA 2D3LA 2QMKA 4PTVA 2BXYA 2WVUA 1VAHA 2XIIA 2QLYA 3ZQ9A 4QCEA 4Z2HA 4X0NA 1UKOA 1ZL1A 3THCA 1KBKA 1TMQA 1ZU8A 1BG4A 3CHEA 5M5DA 3CLWA 3CUHA 3AXHA 5C70A 4JHOA 3BSHA 4CD7A 1G9HA 1DP0A 1G94A 4MAZA 4W8BA 1B0IA 4RE4A 5DF0A 5AC5A 3UCQA 5A6KA 3AQUA 3GZAA 4FMVA 1W2VA 4HZ8A 2XG9A 3SUSA 3BAKA 2MANA 2VCAA 3I3BA 2EPLX 4IPNB 1UWRA 3IAQA 1OB0A 3VO0A 1TG7A 4J3WA 3VIGA 3VU2A 2V3DA 1WDQA 2BY0A 3FXYA 3GXIA 3W29A 1XHGA 3BAWA 3VD7A 2OYKA 3MMDA 4F66A 4QLLA 3WUGA 3A4AA 1GVIA 1UR0A 4WK9A 2VZVA 2XSBA 4PEEA 3TP4A 5IHSA 2PWHA 3WQVA 1W9DM 1EOMA 2YJQA 2ZWZA 1J10A 2CETA 1WAWA 4DM2A 1VEPA 2F61A 1V3LA 4KGLA 4AC1X 3TTSA 4JFVA 2J8FA 2WCGA 1HJQA 1UWSA 2GJXB 3IANA 3AIQA 3ZT6A 3VGEA 3W6MA 5M03A 3GXMA 4S3KA 4YN5A 5A6LA 1VJSA 1KXQA 3K4AA 3N04A 4CD8A 4V27A 3A4XA 5I77A 3EBVA 2WCAA 4GINA 4CU7A 1WDPA 3BSGA 4E8CA 1OIMA 4D72A 1ITCA 1US2A 4V2XA 1FH8A 1V3KA 2FHBA 1KWKA 2V5CA 2BVTA 3AOFA 4DWSA 5GNZA 3T0AA 4GKLA 1H49A 4BA0A 1PIGA 3WEOA 1VBUA 4D6CA 3SCOA 2WVSA 1MQPA 2OSXA 3LPOA 2BS9A 3PZNA 1RPKA 3W37A 3MSDA 3OGVA 1JZ6A 5EBAA 5A6BA 3I3EA 4UQAA 1FA2A 3WDPP 1ZJAA 2QPUA 4AEFA 1KQZA 3VIFA 2X2YA 1L8NA 4N42A 1W3JA 3WSUA 2UY3A 4KMQA 4CN1A 1FFQA 4W5ZA 2ZUVA 5JUVA 1E43A 1JZ3A 1OT2A 4H41A 6TAAA 4EANA 1KQYA 1B9ZA 3RIKA 3VIHA 4OZOA 2D23A 1V3MA 4WKHA 3PZ9A 4GZEA 4P8XA 4CU6A 3M46A 1BYDA 1VFFA 5AYBA 3BLKA 1DWGM 1DWFM 5ABHA 3WF2A 1NP2A 6A3HA 1GW1A 1IT0A 2ZOXA 3L4XA 2DSWA 2Z1KA 4NSBA 3PZMA 3GH7A 3SCRA 4WKAA 4AD4A 4KH2A 3CUIA 4KRUA 3WQ5A 2ZWYA 5AYIA 1E56A 4HA1A 3TTQA 4U5IA 3AMDA 4AY1A 2O9RA 4CGTA 4BQ5A 4HOZA 1XSIA 2J7HA 2RGLA 2QMJA 1XGZA 2WZIA 1BVNP 3L4VA 3POHA 3WEMA 4PMVA 2V3EA 1J0JA 2ZUMA 3CIVA 3VILA 2V5DA 2XFRA 1MQQA 2VX5A 3ARWA 3WNOA 5EMYA 2WXDM 3NSXA 3FN9A 1E6NA 2CITA 2J47A 5CXPA 2WLZA 3W82A 1E6QM 3WF0A 3CUJA 1WZKA 3WUFA 2JIWA 4ATWA 4DWSD 5HBFA 3NIYA 1R7AA 3W81A 3WL1A 2PWEA 2YDSA 3APGA 5CGTA 4J3VA 3TTOA 1G5AA 2VRQA 3CMJA 1VFUA 4FLSA 3BH4A 1H4PA 2VOTA 1CDGA 3QGVA 3MO4A 1C7TA 2ZE0A 1R7OA 3RPMA 1WZAA 1E6XM 3OG2A 1JFHA 1VFMA 2VR5A 5D4YA 2JALA 2BY1A 4YPJA 1E3XA 1HL8A 2XM2A 3ARUA 4R5EA 5LYRA 3DC0A 1YHTA 2WWDA 4UZUA 1CBGA 1H5VA 3OGSA 4FLOA 1E55A 1V6UA 3ZJ8A 1UWTA 1M53A 1W1PA 3EMCA 1I1XA 2IUZA 1CXEA 5CQ1A 5AC4A 1Q6CA 4J7RA 3F4VA 1B31A 4DWSC 1H0GA 3CO4A 4L4PA 2W5FA 3SCTA 3U57A 1DEDA 3A4WA 1OINA 1HKJA 1E5JA 3NJ3A 2XSAA 1QOXA 1UOKA 4EK7A 4TUFA 2J7EA 4MJ2A 2E8ZA 2BVYA 3AMLA 4R27A 1B3YA 3WBAA 1JGIA 3B9EA 3M6DA 4P8UA 5A6AA 1ESWA 1IZJA 3WH6A 1KB3A 2DIJA 2J74A 2EO7A 3W53A 2WSKA 5HPCA 4KGJA 2ZUWA 4PMUA 3WELA 1G1YA 2UWFA 1BTCA 3SUVA 3CH9A 2D0HA 1W9PA 2JEPA 4NI3A 3SCUA 4PN2A 1BPLB 3AROA 2ZUUA 3AIVA 3VNZA 4S3JA 2V3FA 1NOWA 4D6FA 1HJSA 2GSJA 5F7UA 2EXOA 4JKKA 1JF6A 4BQ3A 2D0FA 5JBFA 1OGSA 2DDXA 2XGBA 4V28A 3ZM8A 4WSJA 3UR8A 4F79A 8CGTA 1TA3A 2YLLA 3FNDA 4ACZA 1V02A 1CXHA 2YLAA 1HT6A 3BCDA 2YOCA 4D1JA 5A2CA 2J7CA 5BXRA 3WH7A 2ZX5A 3IJ9A 4LPCA 4W87A 1E72M 2HISA 5D8ZA 3WH5A 1QI3A 5I23A 4EKJA 2OSYA 2WMJA 3NDZA 4JFWA 1GZJA 4D6HA 2WSPA 4H8VA 4U31A 3RO8A 4PMYA 1E4LA 4AZCA 3KL5A 3AIWA 3U7BA 2J4GA 2Y24A 3AFBA 3WFLA 1C8YA 2IXUA 1PX3A 1KR0A 3DHPA 1WB0A 2ZUNA 1JZ4A 2E9BA 3S6TA 5D8WA 1WDRA 3VGDA 1XH0A 4H8UA 2J78A 1GOWA 4HZ7A 3AS2A 2O9PA 1NOUA 4AMCA 3W4RA 1KBBA 3FW6A 1RP8A 5A6JA 2XFFA 3VDCA 3VOCA 2XWEA 4MNLA 4OJYA 3JUGA 3AXXA 4HP5A 4Z2IA 4P7NA 3VDAA 3N9KA 2W63A 1UR4A 4W89A 2PWFA 1XSKA 3SUTA 1F4HA 2EEXA 4AZGA 4CUCA 3M7SA 3TOPA 1BF2A 3KZSA 1EDTA 1J9YA 3N18A 3N12A 4M8UA 4AIOA 1KXHA 3B9AA 4F9JA 1J11A 2VURA 2WBKA 1CEOA 3AHXA 4ZEPA 4D6GA 2V38A 2NSXA 3PTMA 3ZJKA 1H1NA 3U7VA 4M56A 2E4TA 2QPSA 3PZQA 2X09A 1GQLA 1LF1A 1CGYA 2JIEA 4LXFA 4J27A 3KL0A 1NWSA 2X8RA 3WL0A 1X6NA 5A8MA 5A8QA 4EE9A 2CBJA 1UYQA 1JYWA 4UOQA 1H41A 3CUFA 3SUWA 4XZWA 4ATDA 2DT0A 5FIPA 4AD3A 1KXVA 3IJ8A 3ARQA 2GDVA 4AIUA 1ISZA 4AZ7A 3IK2A 3L4YA 4GPNA 4IUGA 5I3DA 1O7AA 5CZKA 1QNOA 3AZTA 4M1RA 5I24A 5BCAA 2E0PA 1MW0A 2VX6A 1K6AA 1MQRA 3U5UA 2XFYA 1AQMA 3CHCA 5EFFA 2J8GA 1Q6EA 4UZSA 4UR9A 2VL4A 3WH9A 2VRJA 3GXDA 2WC7A 5LA1A 4JCMA 3UERA 4Z2GA 1JZ5A 1PX4A 4XX6A 4XB3A 2A3BA 4QLJA 3VPLA 4GI8A 4OOUA 2W67A 1UKQA 4AD0A 2D22A 5D9OA 2YDQA 4JFTA 1ECEA 3SCQA 5HPOA 5FD0A 3AS0A 1TVPA 2EPOA 2XPKA 2Q8XA 1VFOA 4WIWA 3LMYA 2W92A 4U2YA 1GONA 1UR1A 2W4XA 1KGWA 3KWXA 2A3CA 2DSZA 2FGLA 3UG3A 1GOKA 3OZPA 2VZSA 2WNWA 1MFVA 5IXEA 5E09A 3T2QA 3ZJ6A 1BAGA 3AI0A 2CPUA 1DWHM 1B2YA 1N82A 3VINA 3L4TA 1TUXA 2CBUA 3SCPA 1KGXA 2J7DA 1OWQA 1TVNA 3SUUA 3ZOAA 2VZTA 1FHLA 1HXJA 5I79A 4HOWA 1AMYA 3WY1A 2WAGA 2YL8A 5A6SA 3VD9A 4BZYA 3NUKA 4W8LA 2WC4A 1G0CA 1MW2A 4E4PA 2VO5A 2DIEA 4GI9A 1ZBWA 3AIUA 4B15A 4RL3A 4B9YA 1H2JA 2GK1B 2WMFA 3AYRA 4JIEA 3THDA 3PTKA 4MB5A 3T2OA 3FY1A 3M07A 2ZIDA 3PBGA 4D6EA 1QI5A 1V6XA 4U3AA 3CZEA 1K9FA 1W3LA 1SR0A 1CLVA 2Z1SA 4PTWA 1GHRA 3O2LA 3WF4A 4JKLA 1VEMA 4UQEA 1GHSA 2XVKA 2WCSA 4C7FA 2RGMA 2IXVA 3DHUA 1H11A 1XC6A 5BXTA 1OGGA 1EO5A 4A3HA 1W9XA 4MB4A 3AMKA 1UA7A 1XD1A 4MDPA 4Y7EA 4CD5A 1UD2A 2VQTA 3WD4A 3A3HA 4LGXA 1HVQA 1W3KA 1HJUA 1QBBA 3B9DA 4JFSA 4MB3A 4FLRA 2JE8A 1XRVA 1E0VA 1BYBA 1BYCA 3VUPA 1B3WA 5CJ5A 5TD4A 4D6DA 4YHEA 3MANA 2YL9A 2DSVA 2Y4SA 3MUY1 3K8KA 1E6PA 4J3XA 3OBAA 4CD6A 4TOQA 3SIMA 4U5KA 1UZ4A 3EDFA 5GQBA 2J62A 3UESA 4HU0A 3RM8A 3E1F1 1BGAA 3T08A 4UFHA 4PRWA 3WNPA 5DMYA 2CEQA 5A69A 3UG5A 2JF7A 2J25A 3VGGA 1EO7A 3D3AA 3ALGA 1PIFA 2YA2A 1HP5A 1B30A 4JAWA 4F8XA 3VMNA 4GQRA 4ZXOA 1JXJA 1ZB5A 4EAMA 4DUWA 3WUBA 1JIBA 3ECQA 2YL6A 3QOMA 3MS8A 3WD0A 4H7VA 4P7RA 4Z2KA 1GOMA 3FAWA 1OGBA 3EYPA 2DPEA 2WYSA 3AIBA 5LA2A 3EDEA 7CGTA 5ABEA 4OIFA 1CTNA 4ACYA 4M81A 1TZ7A 4W7VA 1UUQA 4AZ5A 2VCBA 2PB1A 4WKFA 2OSWA 4GIAA 2YBTA 3CTTA 5CG0A 1EA9C 3OLIA 4AZCB 2FGZA 1DWAM 1QHOA 1GQKA 3VIOA 1PZ3A 3ZJ7A 1QW9A 4D1IA 1QNPA 3PZVA 4JL2A 3WF1A 3T0DA 2ZXDA 5DT5A 3OB8A 1CPUA 5FCZA 1FP9A 1E15A 4PBGA 4XV0A 5DO8A 2A3EA 3CPUA 2Y8VA 1MFUA 1H3GA 1TCMA 2EJ1A 5HNNA 1C91A 5IFPA 3T2PA 1W1TA 1JAEA 3ARPA 3N11A 4QAWA 2FHCA 1PJ9A 2HVMA 3QHOA 5E0CA 4CKQA 1W1YA 4TX8A 1UG6A 4CU8A 1K9DA 1MW3A 3EMZA 1C93A 1V6WA 1XCWA 1DTUA 3SEPA 1Z32X 1LL4A 3WMSA 1CNVA 1GJWA 4XUYA 1ISXA 1BHGA 4MNMA 3AMGA 3A6OA 5CLWA 1VBRA 2WKLA 5A8PA 3KEHA 2WZHA 5FL1A 1E6ZA 3WDQA 2YDRA 1Q4NX 2WHLA 1B3ZA 4MADA 4CCCA 3PZTA 1I75A 2CIPA 2VNCA 5C71A 4M24A 3W27A 4QP0A 2NT1A 3ZMRA 1NWTA 2PF0A 1UWUA 1ITXA 1BLIA 1UD4A 3WDIA 3K8MA 4UOZA 1P6WA 1JZ8A 1QHPA 2YL5A 1M01A 3VIIA 4CD4A 1U33A 2PC8A 2FDMA 2WZEA 3ZT7A 3HU7A 2WVVA 3VMPA 4QLKA 4URIA 1RD6A 3VGHA 4L4OA 1WCGA 2J77A 1MW1A 1SMAA 3VD4A 1GCYA 2VRKA 2DSKA 2CNCA 2ZICA 1Q6FA 2GJXA 3ZSTA 1V3HA 1H0IA 1ISYA 4ATLA 2ZXQA 4W7UA 1CXFA 3ZO9A 1ODUA 3T09A 5D9NA 2BHYA 3CZKA 5ABFA 3BAXA 3TA9A 1HL9A 1QVBA 3MMUA 1M7XA 3K1DA 2X05A 8A3HA 1J0ZA 1E0XA 1UH4A 3AMCA 2GFTA 2VMFA 3ZR5A 4C7DA 5BYWA 5CSUA 1V02E 2D24A 1UD8A 3VGFA 2C8NA 4UFJA 1UQYA 2WK2A 4AEEA 4P8VA 4LYQA 3WBEA 3DECA 4QDMA 4A3YA 1QI2A 3MU7A 3VMOA 4CVWA 1JNDA 1LL6A 2VUYA 3RCNA 1BVZA 2WC3A 1BGGA 1XYZA 2B31A 5I2UA 3ARZA 1V6YA 2O92A 2V3GA 1QI4A 4MNKA 2E8YA 4MPKA 1QNRA 1CGWA 2XGIA 5LA0A 1E5NA 4N0RA 1OIFA 4H04A 4W85A 4W86A 4HMDA 3ZT5A 4UFMA 3VX1A 1M03A 3OLGA 1LJYA 1LWHA 1CGTA 3S2CA 1UHVA 3UG4A 5BROA 1R86A 1CGUA 5E70A 3WQ8A 1V3JA 3CBWA 5CPTA 3WMCA 4OKDA 1JYNA 1US3A 1UR9A 3TTYA 4U2ZA 2BY2A 3BMWA 2PI6A 3F5KA 2JEQA 5HXMA 4IISA 3WD2A 1WPCA 4J3UA 4BS0A 2ZX6A 3AHYA 3OLDA 2F2HA 3UR7A 3AISA 3AZSA 1J0YA 3MSGA 4IPLA 4DWSB 1FOBA 5A2AA 4BQ4A 1J18A 3I3DA 1JI1A 4TVCA 5M3WA 2BY3A 3GYCA 1LLOA 1LQ0A 2AAAA 4RE2A 1W3HA 2BVDA 1OD0A 3WENA 1NM9A 4P7OA 1ZBVA 2OYMA 1D3CA 3VDHA 3GTNA 4X9YA 4CN4A 4UQBA 1KCLA 2WKGA 1JYXA 1Q6GA 2BHUA 4HPGA 1CENA 2BFGA 1GOIA 2NW0A 3GH4A 1PAMA 1LL7A 2VT0A 1EIBA 2FHFA 5JIWA 1DHKA 2O9TA 4RE3A 4PSPA 1LWJA 2VC9A 2XVPA 1KFWA 3GDBA 2YA0A 3W28A 4J3SA 1JF5A 2DGAA 3RJYA 1VF8A 1XSJA 5JIPA 2WM0A 1D7FA 1W1VA 3PN8A 4C7GA 3OA5A 1JZ7A 5GNYA 1AQ0A 1KWGA 5BWFA 1FP8A 1JYVA 2WVTA 4HA3A 2AMGA 4P7LA 4UTFA 2X0HA 4BCEA 2UY2A 3LPPA 1JDCA 1MYRA 1OCQA 1RH9A 1JFXA 1HX0A 1ODZA 4PTMA 2VR4A 3N17A 1QBAA 3SCVA 4PMDA 1HF6A 2CESA 4PCTA 2EQDA 2VTFA 1ISVA 1EOKA 4E8DA 4CVUA 3F5JA 2WHJA 1QNQA 3VTRA 1JG9A 1PZ2A 4HMEA 5A3HA 3RILA 1BFNA 1NH6A 2J7BA 2G4FA 2GVYA 2W62A 1UZ1A 4U33A 1J0HA 3G6LA 1PX8A 4PUEA 4W84A 3GXFA 1DWIM 3MUAA 1FH9A 2WHMA 1F4AA 3SURA 3QR3A 1E9LA 4PMOA 2XJ7A 2ZXBA 4GI6A 3WNKA 2E9MA 5E0FA 1E1EA 3L4WA 3W0KA 1E71M 3WD1A 1CGXA 2WMGA 1E4IA 1QPKA 2C7FA 4ZENA 1E0WA 3VGBA 2D1ZA 2XVGA 4J3TA 2EPKX 2D2OA 1HKMA 4DM1A 1NWRA 4AWEA 4AW7A 1MXDA 4AZBA 4UQ9A 3ALFA 2XYLA 3K46A 2PWDA 3BC9A 2CKRA 4UQDA 2ZUTA 3K4DA 1BYAA 3EMQA 4QCFA 2XVNA 1WNOA 1QI0A 4HU8A 3TONA 2EPNA 3L4UA 2G3NA 4U3CA 1UKTA 3GNOA 3MV11 3DYMA 3EDKA 1JAKA 2EBNA 1VRXA 2G3IA 1HIZA 4TXEA 4ML4A 3PZGA 1J01A 2OLHA 4FK9A 3QHNA 1V03A 1W9VA 1C90A 3NSMA 3VIMA 4BF7A 3AHVA 3RMEA 2VVSA 2WVVB 3T0BA 3WDHA 7TAAA 1NARA 1E6SM 1K9EA 1HP4A 3FAXA 3QOKA 4H8HA 1V3IA 2WMIA 3WQ4A 2E40A 2XWDA 3HJEA 2NT0A 3WH8A 3WN6A 4BQ2A 2DT2A 4PMRA 4A4AA 1V6VA 4CCDA 2BNJA 3BAJA 1HNYA 3VDBA 1WP6A 1B1YA 1MWOA 3BXWA 3GNRA 4Z2JA 3WMBA 1ZJBA 1V0KA 3WF3A 4PMNA 2DH3A 4PTXA 5ABFB 3OIHA 1E73M 2G3JA 1MXGA 3W24A 1VB9A 1XH1A 2TAAA 2Y5EA 3AIRA 1IV8A 1W9BM 3CZGA 4MAVA 5A2BA 1JD9A 1H09A 4TVDA 3WD3A 3MUZ1 3W38A 1VEOA 3ARYA 1SYTA 2D20A 3WQ6A 1U30A 1EHNA 1OM0A 5BXSA 2YA1A 2A3AA 4W8AA 3AHZA 3POCA 1DWJM 5CSYA 2XUCA 1UH3A 3WKZA 2CCRA 1EXPA 1TA3B 1ZBCA 4ACZB 2VJXA 1UWQA 2DH2A 4MNJA 2EPMX 1SFSA 2CBVA 1KXTA 4PSRA 4W93A 2D3NA 2ZXAA 1NQ6A 4MDOA 3VD5A 1CECA 1J12A 3CZLA 3ZR6A 1CWYA 4E2OA 4MB1A 1C3FA 1CLXA 4K68A 2WPGA 5A8NA 5CLTA 4JCLA 2XM1A 4OUEA 3KL3A 4WJXA 9CGTA 4TX6A 1I1WA 2CERA 3WNNA 3VM7A 1IZKA 1RP9A 3B8SA 1WZLA 1B3VA 1QNSA 2E3ZA 1SMDA 2AOSA 5D9PA 1QHZA 1GPFA 3AS3A 3AIEA 1VJZA 3NDYA 2Y2WA 1OD8A 4GZJA 4JZ5A 1TFVA 3WNMA 4NF7A 2XIBA 1CIUA 2GUYA 1GORA 4X0VA 1EGZA 4Z2LA 2XTKA 4D71A 3WNLA 1HKIA 1D2KA 4HOXA 4PCSA 4HTYA 2G8ZA 4TTUA 4OOZA 1MVYA 2QHAA 4GO9A 1FFRA 2VX4A 3NCOA 3VM5A 2E9LA 4CCEA 1KGUA 1GOQA 1G01A 4AZIA 2G41A 1HJVA 3OLEA 4PUDA 1HJWA 1W2PA 2CXGA 5HOSA 1UD6A 1E40A 4M80A 4W7WA 1E3ZA 1TE1A 5A95A 1KR1A 1XCXA 3WIJA 3AS1A 4ZE4A 5E6YA 3W25A 1W9UA 3BLPX 1TR1A 4P7QA 3W26A 3ZIZA 4AXNA 4MJ4A 2CHNA 5ECUA 3K8LA 3KE0A 2WLYA 1WZMA 2FH8A 1WKYA 2DQXA 1CYGA 4D6JA 4UCFA 2VZUA 1OSEA 5IDIA 5CPSA 3FHQA 1Q6DA 1J0KA 2DSUA 1GUVA 1FHDA 4CN6A 1E1FA 4YHGA 3SCNA 3WDJA 1K9TA 3ARSA 2D0GA 3CZJA 3ARVA 1LG2A 1GQIA 2VQUA 3MKKA 1BQCA 1EDGA 1EQCA 1JXKA 1EH9A 3OGRA 1W91A 2CKSA 1GNXA 1V0NA 1E4MM 2G3MA 3NSNA 3O9NA 2GK1A 5HDRA 4M82A 3RM4A 4AZHA 4GZIA 3EDJA 2DEPA 4DUXA 2A3HA 1CGVA 1WE5A 5A6BD 3LPFA 5IFTA 4ZE5A 3CUGA 1XYFA 2QF8A 4UNIA 3PZUA 1U2YA 4AYSA 1JZ2A 2JF6A 5BXPA 2GJRA 1GOOA 4B3LA 3L2MA 5KEZA 5I5RA 3RM9A 1JDDA 5I78A 2O9OA 1HKKA 1KCKA 3ARRA 3QHMA 4ZFMA 2ESCA 2WANA 3DYPA 5DT7A 5EB8A 4LYRA 4QFUA 2WWCA 3RJXA 4M29A 2YKKA 1EHAA 1XH2A 4Q7NA 1QW8A 4P8WA 2X0YA 2ZX7A 1ZS2A 4PMXA 4HZ6A 2ZUSA 1B90A 3GBEA 1PEZA 2WMHA 3AJ7A 1BG9A 4AIEA 4TVUA 5GPRA 1ZBKA 2OYLA 2WMKA 1BSIA 5A1AA 4UFIA 1VENA 1V08A 2VI0A 5BRPA 1S46A 5GNXA 1C92A 2CBIA 6CGTA 1HJXA 3ARXA 3VVGA 2J7FA 3GH5A 4GQQA 5A8OA 2VCCA 3BCFA 2F8QA 3UEQA 1C8QA 3D5HA 3ZSSA 4TTGA 1GVYA 1CXKA 5E9AA 4KRTA 4AISA 1L0PA 2YIHA 4H2CA 3CZ8A 3CHFA 5A94A 1XV8A 3CGTA 1UQZA 3N15A 3O6AA 3WQWA 5FL0A 1GQJA 1J0IA 3ARTA 5JBEA 5DFAA 2VZOA 1PPIA 4PMZA 5KZ6A 2ZX8A 2W91A 2ZX9A 3AICA 4AD2A 3MUIA 1R85A 1YQ2A 5FOOA 2BV9A 3WDRA 3VX0A 1Y7VA 1JI2A 1HN1A 3SCWA 4HPHA 3L4ZA 1WDSA 2XVLA 5E6ZA 7A3HA 3A47A 1WO2A 3VNYA 1C8XA 1HVXA 1O6IA 2J79A 2YBUA 5EFDA 3WUEA 1B3XA 4LX4A 4GXPA 1FH7A 2VVNA 1VIWA 3GBDA 1E4NA 4GO8A 4J28A 2WMIB 1AQHA 2Y8KA 4AD5A 4LQ1A 4Q22A 4JL1A 4WLCA 2OWWA 2BXZA 2W61A 1UD3A 5M17A 1V0LA 3N13A 4B16A 3VIKA 3UETA 4W88A 4WF7A 5BRQA 2OWXA 4HA4A 5DEZA 5A6MA 3F5LA 2WHKA 4UOJA 4HMCA 1XD0A 3IAPA 2PWGA 1AVAA 1V0MA 4FLQA 3BMVA 4OBSA 5I6SA 3SCSA 2JFEX 1UKSA 1UKPA 1JDAA 2CHOA 4JHZA 1E6RA 1A3HA 1A47A 1C7SA 1ISWA 4XZBA 2DT3A 4JKMA 4MTVA 2PBOA 2J7GA 3EDDA 1CXIA 3MV01 4AZ6A 2UY5A 5FKYA 5ABGA 1NOFA 1UWIA 3PZOA 3II1A 1LG1A 2WBGA 2GDUA 3PZIA 4PMQA 3VD3A 3CHDA 3CMGA 3BAIA 2J75A 1UR2A 1UA3A 1E70M 3J7HA 2WB5A 3DYOA 1NP0A 1X1NA 1OT1A 1UD5A 5IHRA 1UH2A 1NWUA 3PHAA 5JBDA 4FF5A 3AHTA 3AXIA 4IM4A 4AD1A 5I0DA 3G6MA 3FHAA 4WSKA 2GJPA 3BAYA 4UFLA 2XHYA 3W6LA 4LYPA 2C0HA 3BGAA 2BHZA 5CPQA 1W32A 1X6LA 2FH6A 2W66A 2VX7A 1UR8A 2QV4A
chains in the Genus database with same CATH superfamily
2UY4A 3PUDA 1ZP4A 3IGSA 3IVUA 2Z2UA 5AY7A 3VKKA 1U5HA 3W7EA 3UQNA 4ZFCA 1PBGA 3BDKA 1CT5A 2NLYA 3M64A 3I7QA 1R8LA 4OBRA 4NZCA 3RO6A 4ZB2A 4B3KA 4Z17A 3MMWA 2X40A 3C8FA 3OZOA 1JD7A 4G7EB 3PTQA 3S5YA 1GJUA 1SO5A 1FWBC 2WW5A 3LPGA 1JNEA 2C1GA 1TMLA 2OZ8A 5CBIA 3IJQA 3AZRA 4Q4QA 3UZWA 1R87A 3SW6A 2OX4A 4AF0A 3L0KA 1LM1A 3Q2DA 2BXYA 1T41A 1XIGA 2QZRA 1H7WA 1VAHA 3ZQ9A 4Z2HA 4X0NA 4S3BA 3CYVA 1A5AA 1SO6A 3CLWA 1BRLA 4PA8A 4EXQA 4S3DA 1P0KA 1DP0A 3CMFA 4W8BA 1LZOA 2GOKA 1KBLA 4RDYA 5A6KA 3GZAA 4FMVA 1XQLA 3GUGA 4HZ8A 2XG9A 1EX5A 1ZAJA 3BAKA 3MHFA 2MANA 2VCAA 3GTIA 1K7EA 2GSEA 3P0WA 5CH9A 3VO0A 1TG7A 4FR6A 1DQUA 2PLMA 3VIGA 5C54A 2V3DA 1WDQA 1F73A 2ZZ7A 2ISSA 3N3MA 3GE7A 4R33A 2BGNE 1KKRA 2INFA 4KIEA 3WUGA 3A4AA 1GVIA 4DBSA 5EMKA 4R85A 1MXSA 2VZVA 2XSBA 4PEEA 5IHSA 4RNIA 1W9DM 1J10A 1WAWA 1UCWA 3UWQA 3EWXA 3KDOA 4WY0B 1F5ZA 4YXGA 1VEPA 1V3LA 4Q4MA 4QNWA 4PUJA 1UWSA 4C65A 3TX9A 3LB0A 3IANA 2G50A 3AIQA 4PULA 3W6MA 1I6NA 4S3KA 3TMLA 5A6LA 4GBDA 4Y9OA 5EKYA 1RUSA 5I77A 2QCEA 2WCAA 2PDXA 1EP2A 4CNNA 1IGSA 4IXHA 1US2A 1FH8A 1V3KA 3V0UA 2FHBA 3EOEA 1ZP3A 4DWSA 3HGJA 3CQIA 5LNVA 1PIGA 2NXHA 1NY1A 3ABZA 3SCOA 1IWBA 3TN3A 1TJ1A 1QASA 1MQPA 4JIHA 2BS9A 1EL3A 1OYAA 2HZGA 3TV8A 1G6CA 1FXPA 3W37A 3MSDA 4GUGA 1JZ6A 4JYEA 1LUCA 5B7YA 1FA2A 3BZJA 3KRZA 1KQZA 2H90A 5TF0A 3VIFA 4NP7A 7REQA 3PK7A 3ZVHB 1RLCL 3LG3A 2BWGA 1AZ1A 4HTBA 3BV7A 2ADAA 1ADSA 4RV3A 2QCMA 4L6DA 4AVNA 1B9ZA 2Z00A 4CNPA 4OZOA 2D23A 4WKHA 2YDAA 4YYFA 1Q6LA 4GZEA 4CU6A 1BYDA 3LTPA 5C6MA 1DWGM 1XDJA 1NP2A 1GW1A 4NT0A 4NSBA 2Z1KA 1WXJA 3ELFA 4N4QA 3OZYA 2IPFA 2AQVA 1NIUA 3IJDA 5AYIA 4OWGA 5D2TA 4AY1A 1L2UA 3DFSA 3QF0A 2FJUB 3PWIA 4IFKB 2WZIA 2RDTA 4A2RA 1GEHA 1CLKA 3TW7A 4O12A 3FYPA 3DERA 1MZHA 2V5DA 2NQ9A 3OHIA 4S2CA 1WX0A 1JUEA 3WNOA 5EMYA 1XIMA 1UZDA 2J8TA 2G37A 3I4EA 4HNTA 2Q8LA 4B2DA 3U2EA 3RYSA 1E6NA 2WLZA 2H9AA 4Q4RA 2O0TA 3PFRA 3VOJA 2XINA 3M4HA 3IGXA 2QDGA 1WZKA 3WUFA 3GWQA 3ENLA 2JBMA 4O1AA 4ATWA 4DWSD 4DJDD 4I7UA 1XLIA 4G2DA 1KCZA 2PGEA 1IIHA 5CGTA 1MDLA 2HVNA 2PRHA 5HANA 3QV9A 4YVXA 3CMJA 3G0SA 1VFUA 1MEIA 4GVHA 1V77A 1Q6OA 4RDWA 4MYAA 1WZAA 2J6XA 3ATYA 1E6XM 3OG2A 3TQVA 9RUBA 1D9EA 2VR5A 3LHVA 4KETA 4GYJA 2YB4A 4LUTB 4GACA 4WXZA 2XM2A 4IXXA 1YHTA 1YRRA 1U5JA 2WWDA 4QG6A 4XD5A 4NJJA 3BOXA 2DJXA 5G4HC 2VEKA 1I1XA 1GZ1A 4J7RA 3N6JA 3QKZA 3NURA 3CO4A 3U6WA 4NX5A 1VLWA 1DEDA 4QS6A 3S6OA 3WLNA 4PL1A 1E5JA 1S5WA 3WG6A 3VOFA 4UTWA 4TUFA 1UUMA 4MJ2A 3TEVA 2E8ZA 1MZRA 1XP3A 3QMSA 5U4NA 2C15A 3Q65A 2GVJA 2Z4GA 3WELA 5I3HA 3BO9A 1Q66A 1EJVC 3VABA 3B3DA 4DPPA 3E74A 4NI3A 2WJDA 4PN2A 4ZA0A 5FESA 1XDLA 4E3VA 3S8HA 2EXOA 4JKKA 3KVLA 2YW3A 4BQ3A 3QGAC 2D0FA 1OX6A 2YGYA 3ZM8A 4WSJA 2XN2A 1E9YB 1K4HA 3UR8A 1I45A 4AQLA 1SU5A 5JMUA 2D73A 1M65A 4FNPA 4Q6XA 2YOCA 4JTUA 4UXDA 4Q6JA 3SY1A 4C60A 4B91A 5H1WA 2BOEX 1UWAA 1XR2A 4O14A 4OT7A 3DFYA 3WCZA 4DBDA 5J5RA 3WH5A 1R2SA 4NUWA 4A35A 2OSYA 3ZWTA 3RU6A 3JZUA 5C9WA 2WMJA 4JFWA 4HPNA 4U31A 3RO8A 1S1PA 3KL5A 3QSTA 3W00A 2MUCA 3UFYA 3GFZA 3U7BA 3LERA 3QV8A 2FZ9A 3AFBA 1FWRA 1BD0A 1C8YA 3QJAA 2IXUA 4Z1DA 4KWWA 4LT9A 2Q09A 4R7WA 3DHPA 5D8WA 1DHPA 1XH0A 1MRQA 4H8UA 1GOWA 3AS2A 2O9PA 4AMCA 5FJPA 3GIQA 3THQA 5A6JA 4Q8PA 3VDCA 3C56A 4L4LA 3KCOA 4OJYA 3JUGA 1UOZA 3AXXA 1KV5A 4FIRA 3VDAA 1A3XA 2YFNA 1UC5A 3H4GA 3HPXA 2PWFA 4PTNA 2TRSA 5HUOA 4RPPA 3N18A 4M8UA 1GZGA 3GHRA 4S3GA 2PDIA 3H8AA 5G5IA 2VP8A 3TR9A 3LHWA 1KXHA 4F9JA 2VURA 1F9CA 4JEQA 3OPSA 5CAKA 3W71A 3ZJKA 2QJJA 4O0ZA 3U0HA 4AX6A 2X09A 3ITTA 4J27A 3KL0A 4L4MA 4GI4A 1KLYA 8XIMA 2X8RA 1X6NA 3OVPA 4EE9A 2Q71A 4ATDA 1XJBA 1KXVA 4FF7A 4ZB0A 4LALA 3IJ8A 2DUZA 4Z1CA 4HK7A 1EZ2A 4H2HA 1ISZA 4AZ7A 5D09A 4JQ4A 1PWMA 3L4YA 5I3DA 4W9TA 3G0XA 5E0KA 2OEMA 4NNCA 3M0HA 3K4WA 1MQRA 3U5UA 3W9ZA 3RMJA 4A8NA 4C91A 4S3CA 5DCEA 4BF9A 1AQMA 3AALA 3NQ8A 2AAMA 5LGZA 3KBVA 2PDYA 4UZSA 2VL4A 5I3GA 5LA1A 2UV8G 3UERA 3P5ZA 5U7SA 1JZ5A 4XX6A 4XB3A 4RXGA 4I9AA 3GC2A 3VPLA 2B0MA 4OOUA 2W67A 2HEJA 4JXCA 4JFTA 3RGTA 1TVPA 2EPOA 4JTDA 4A2SA 4UMAA 3UZYA 3A5VA 2W92A 4U2YA 1UR1A 2OX1A 4IICA 3UP8A 3V1PA 2DSZA 1AW2A 3OZPA 7TIMA 1IEXA 1MFVA 2WNWA 4XISA 4FZIA 2V2CA 2VC6A 1A49A 3GVWA 2PCEA 4H9MA 1N82A 4Q7IA 3GD6A 3L4TA 1TUXA 1Y8BA 3WLPA 3CO8A 3C52A 3NDOA 3HG3A 1EGVA 3TVAA 1EC8A 3PNUA 4WOQA 4DZ5A 2VZTA 1FHLA 1AMYA 2BLEA 3WY1A 1TWDA 3NUKA 4W8LA 4DJFA 4JTQA 4E4PA 2X2GA 4I8YA 3E2SA 2GK1B 1UMLA 2FQIA 4IF2A 2C14A 1S3TC 3T2OA 4O1FA 2ZIDA 4HA0A 3OQEA 4D6EA 1QI5A 3PWGA 4U3AA 3HBLA 3W7HA 2PU1A 1W3LA 2JKEA 2V0TA 1SR0A 2QIWA 1PB0A 2CZFA 2PP0A 1LORA 3OBKA 4JKLA 1CI1A 3BJTA 2PDWA 4AHQA 3LS9A 1QK2A 2XVKA 3N2TA 3T1GA 1W1IE 5CG7A 3IUDA 1EO5A 3S46A 5C5YA 2OJPA 4XBKA 2FZ8A 3ERPA 3W1UA 4LUIA 1UA7A 3RCMA 4EPEC 1UD2A 4HN4A 3DX5A 5GJPA 2ZADA 1V7AA 2JE8A 4FNUA 1W1ZA 2IKIA 1SW7A 2I9UA 1EZWA 5K2ZA 1B3WA 2CC0A 5TD4A 1R3QA 1S5NA 3NQ7A 1FHVA 3G1VA 2DSVA 3OODA 1IEIA 1DIKA 3LCFA 4U5KA 1UZ4A 3EDFA 1H7OA 5GQBA 3UESA 3RM8A 3E1F1 3CU2A 3M43A 4LVDA 3T08A 3ZLGA 4PRWA 2CEQA 5A69A 4LC6A 4QDWA 4HHPA 2J25A 4UTLA 3SZ8A 2CLIA 5CBBA 5FF2A 1EIXA 1TUFA 2HE8A 3VGGA 1W3TA 1EO7A 4AWSA 3IVTA 2QCHA 4XKYB 3EKZA 2P3EA 1ZY9A 4F8XA 5KINA 4GQRA 4HHHA 1FTXA 3WUBA 1GOXA 2CLEA 5DMNA 3E2QA 4UWMA 3WD0A 4P7RA 4Z2KA 3FAWA 3EYPA 4US6A 2Y7DA 5ABEA 4ACYA 4W7VA 4A8RA 4NZFA 3RR4A 1H7RA 1I2PA 3PWAA 4PRRA 5CG0A 4DJFD 4AZCB 3IGHX 1G4PA 4RKAA 3UU0A 1GQKA 1B9BA 4JX4A 4LUYA 3KCLA 2I5IA 3MJMA 2PTZA 2RJGA 2CZEA 1OF6A 4D1IA 4ZGYA 3I68A 1FWJC 2F6UA 3T0DA 2OLAA 5DT5A 4E38A 5FCZA 3SB0A 4RJEA 4XAPA 1PE1A 1VR6A 1GVOA 4Z1BA 3GDMA 2A3EA 2IPJA 3P93A 3OQ8A 2Y8VA 2RHGA 1GKQA 2QV5A 4B5UA 4O19A 1CX9A 4H6QA 3P2VA 3HQ1A 4AEOA 1MUWA 4X63A 4QAWA 1S2AA 2HVMA 3Q4DA 5AC7A 3S2MA 3M47A 3ITLA 1X8CA 3EMZA 3O63A 3EOUA 4ADUA 2Y8UA 3I7SA 1XCWA 3LHTA 4DZIA 1A5BA 3SEPA 1ZUAX 2DZWA 1GJWA 4O4WA 2PGRA 2FTPA 1VBRA 1PKLA 4BI5A 1W37A 2YDRA 3N3TA 4CCCA 2VNCA 3ZLFA 3G22A 3ZMRA 2ANUA 4GKTA 2VWTA 1L2QA 1ITXA 4QE4A 2ISWA 3UXAA 2Z2AA 5MKGA 1P6WA 3WMLA 4HNUA 4B5SA 5HMEA 2YL5A 1M01A 1SGJA 1YX1A 1GPWA 6TIMA 4DJDC 3VCNA 3ZT7A 4BWLC 3W1LA 3VMPA 4QLKA 1TTJA 1RD6A 4GX9A 4L4OA 2C79A 1ICPA 2NSOA 4UTJA 1SMAA 5BNKA 1VCVA 2CNCA 3DG6A 3I6RA 4O8RA 3VC6A 4FNQA 4O18A 3GTXA 1W0MA 1AG1O 4AF0B 1XBYA 2BHYA 2BODX 3KRUA 3CZKA 4GCAA 3CAKA 5I03A 1FBAA 1HL9A 1QVBA 4E4FA 5CC5A 3MMUA 1M7XA 5AN7A 1DORA 3W02A 4N9BA 1E0XA 2QCGA 2GFTA 2VMFA 4WY0F 5BYWA 3RLHA 4FI4A 5K9XA 2NQJA 4UFJA 3WLIA 1NF0A 4GQ0A 4P8VA 4UR8A 4LYQA 4QDMA 4A3YA 1QI2A 3VMOA 3FVDA 3I65A 1WOBA 2VUYA 2ZC8A 3TU9A 3DFQA 5I2UA 5HA7A 3O0FA 2E8YA 4MPKA 1QNRA 2PP3A 4ES4A 1PCWA 3H2AA 4FSAA 4K39A 3KXQA 3V1HA 5LA0A 2YXGA 4N0RA 3G1RA 2QIIA 4KWOA 4W85A 3L2IA 1XLLA 2Z27A 4LFYA 1M03A 3UVIA 1CGTA 2DZXA 2E6YA 1R86A 3QZ6A 1CGUA 5E70A 2DQWA 1H7NA 5DRCA 2ZA1A 3N29A 4OKDA 1YKWA 1US3A 9XIAA 1GYMA 3V18A 1XG4A 3DZ1A 5HXMA 3ITVA 3TN6A 1TRDA 3R5EA 2OO0A 4MKNA 5BMWA 1BVWA 2F2HA 3UR7A 3G1XA 2QDDA 3V5OA 4WDUA 1MRAA 3SADA 4DWSB 2R1KA 4O0QA 1FOBA 1EC9A 4TVCA 2VFEA 4XIMA 1PS9A 5M3WA 4I6VA 2Y5JA 3IARA 2BY3A 3LGDA 4AB4A 1OC6A 2HS6A 1NM9A 4P7OA 2VXNA 4IIGA 3WZ0E 3PB2A 1PXGA 3GTNA 2A4AA 4IMEA 5M2FX 2WKGA 1DV7A 1Q6GA 4HPGA 3ZFHA 1NFGA 1CENA 2YYUA 2FPVA 2NW0A 1PAMA 2ZA2A 2A3LA 3TQ0A 1EIBA 4AVFA 1DHKA 2O9TA 3GAKA 1C8VA 3GDBA 2PTXA 5EGRA 2F7FA 3SI9A 3UWUA 2DGAA 1KTNA 3BQ6A 3M6YA 2AMXA 3GYEA 2OKTA 1W1VA 1RAKA 5BWFA 1R46A 3UPBA 1JYVA 4P7LA 5BOEA 4PCFA 2Y63A 3PFMA 3PM6A 4BCEA 2Q8ZA 3LPPA 1MEHA 3T78A 2PDJA 1R9YA 1MYRA 3WJWA 2ICSA 1RH9A 1D8CA 3RX3A 1I9CB 4S23A 3W7MA 2Q3RA 4QJ4B 4QTGA 2YZRA 3T7VA 3LTYA 3OG3A 4WDXA 4Q4KA 2RKXA 3A3XA 2ALDA 1BFNA 3RILA 3W7DA 4C1LA 3MKCA 2GVYA 1QWKA 2W62A 1Q3NA 2UZ9A 1XKJA 3WBWA 4FR1A 3QBUA 3WLQA 2E9MA 1RVGA 3BE7A 5E0FA 2I1OA 3L4WA 2I7GA 1W1A1 4LVGA 1J6OA 4JYDA 3Q67A 4JTLA 1QPKA 3YPIA 1J4EA 2C7FA 4ZENA 4L61A 2V5KA 2D1ZA 1F8MA 2EPKX 4Q8MA 1AD4A 4DM1A 5D37A 1DIDA 5G1TA 1B5TA 4AW7A 4ZB5A 3PJWA 1IQ8A 2XYLA 3RAOA 4EXBA 2NXGA 4UQDA 2PF8A 2FKPA 1XDMA 3STGA 1TTIA 1V4YA 3EMQA 2XVNA 3T8LA 3TONA 5CSRA 4U3CA 1UKTA 4IMDA 1IF2A 3GNOA 3MV11 3TYCA 4KF1A 4H83A 2EBNA 1VRXA 3H55A 1J01A 2OLHA 3NQ6A 1C90A 3NSMA 1WDDA 4XD6A 4XAYA 3AHVA 4IP4A 3T0BA 3LXAA 1E6SM 1VBGA 1VJIA 2YXXA 2WMIA 3HG5A 2E40A 3MZ2A 1A5KC 1Q13A 3G1HA 3WN6A 4BQ2A 2BNJA 2R1PA 1G7VA 1B1YA 3GNRA 1N8IA 1QOPA 3WMBA 3VZYA 3GS6A 3USZA 3VCRA 1QU4A 4DB7A 3AC0A 2G3JA 3I6TA 3AIRA 4DYKA 3H12A 2ZDRA 4WDWA 5CPMA 3GG7A 2PMQA 3XINA 1JD9A 3WQEA 2DZBA 3W38A 1TV3A 1VEOA 1SYTA 1U30A 2QEZA 1EHNA 2ZRUA 1OM0A 5BXSA 1E1CA 2YA1A 4PFHA 2BB0A 4W8AA 5CSYA 1UH3A 3WKZA 3NL3A 3MWCA 1SFSA 4JN6A 2OU4A 4ICMA 4LUSB 1X39A 2FZDA 3BOLA 1X7FA 1KFBA 1FCQA 4GFSA 1C3FA 2WPGA 5CLTA 3WLKX 4RPQA 2QGHA 4HPJA 4OUEA 2NX9A 4GMEA 3PF3A 4IJCA 2NVCA 5DY3A 3PR2A 1EFZA 2AOSA 5D9PA 3AIEA 1KC7A 2G3FA 1S2WA 4DF1A 2XIBA 1O68A 3FSTA 3PSVA 4BY3A 3S9YA 2BGQA 2PU0A 1OQFA 3ITOA 1P6CA 4ICCX 2NV1A 1D2KA 4UBPC 3K1GA 2G97A 5AHEA 5D03A 3UVAA 3T4WA 2VX4A 3WK0A 3VM5A 1TB3A 2E7FA 4FOUA 1T40A 4DJED 3CQ0A 1G01A 2Y7GA 4AZIA 4PUDA 1HJWA 3WQGA 1E3ZA 1KR1A 1FWTA 3AS1A 2IQTA 3BLPX 5T91A 1PYMA 4M6VA 1JPMA 3TWBA 3GR7A 5D2XA 2BP1A 1WZMA 1YDYA 4UCFA 5D2YA 5AHNA 4NZJA 1Q65A 3GW3A 3UF9A 1GUVA 4ZQCA 4CN6A 4YHGA 3SCNA 1K9TA 4XK2A 3MKKA 5IDZA 2R8WA 3FOKA 1TJ2A 4C6BA 4L56A 1EQCA 1WXYA 4F0KA 1GNXA 2FPTA 1QATA 3NSNA 3NPVA 3DBNA 1PUDA 1TIMA 3EOSA 3RM4A 2FYMA 3EDJA 5CAHA 1CGVA 2Y1HA 2ATSA 3QFWA 1YTKA 1BWLA 2RDXA 3PZUA 4JR5A 2JF6A 1GVEA 3VZXA 1GOOA 2DUAA 4MIMA 5I5RA 1JDDA 4ZTYA 1BTMA 1HKKA 3QHMA 1Z48A 3HFYA 2WANA 5DT7A 1XLAA 3K30A 4MOZA 3B4UA 4WR3A 3RPTA 1EHAA 1XH2A 1QW8A 3NQBA 2CXEA 3TH6A 3F4DA 1J8VA 4PUKA 4AIEA 5GPRA 4JTFA 1BSIA 4BFAA 2Y5SA 1C92A 5EL1A 3ARXA 3VVGA 5F2GA 3B0YA 1TV5A 4QQUA 4ZOEA 3DKJA 3QQ0A 4P2VA 2VCCA 3L68A 4YLWA 4LRSA 5CZSA 2F8QA 2ONEA 1SZNA 3D5HA 1R3TA 1M7JA 1A5CA 4C6LA 1US0A 2YIHA 4KEZA 3CGTA 2SFPA 5DXXA 3KOYA 5JBEA 4GJIA 2VZOA 4N6FA 1OFQA 5AVHA 4PMZA 2KZHA 4XO7A 2FPYA 3AICA 3MUIA 2ZZ4A 4WJ8A 1J93A 1ADDA 5FOOA 2BV9A 3LCXA 1Y7VA 3A9BA 4RW3A 2OQHA 3L4ZA 1UW9A 2PLCA 1NVMA 1RJQA 1EPVA 2XVLA 2OZTA 7A3HA 4ZQPA 3VNYA 1HVXA 5EFDA 1B3XA 2B7OA 3REQA 4GVIA 4K7YA 2VVNA 3P60A 3DCPA 1H1ZA 2Y8KA 3NOYA 1IXPA 2HE5A 3LI1A 2PDFA 4IQLA 1P5BA 2OWWA 2BXZA 3UA3A 5M17A 3N13A 4YJ5A 3VIKA 4W88A 5BRQA 5A6MA 1K8YA 2NLIA 3OTRA 2OG9A 4UOJA 3UCCA 1Y5WA 3ISIX 5D32A 4DXKA 3BMVA 5I6SA 3FJNA 2QDEA 1UKPA 4JHZA 1SO3A 4ZQNA 5E9XA 4XZBA 4MTVA 2PBOA 2J7GA 3BVJA 1CXIA 2XSXA 2UY5A 1Q8JA 3HV9A 1LG1A 3M41A 3PZIA 3VD3A 1TV2A 3EKGA 2NWSA 2OZ3A 3B04A 4HU3A 2ZCGA 3L23A 1DJNA 3N4FA 4K2SA 3FA3A 4Y8FA 4AAJA 4MUPA 3OA3A 5AFDA 1R38A 5IHRA 1NWUA 5C9RA 3AHTA 4FF5A 4AD1A 5I0DA 3NQMA 4AVOA 2B4GA 3FHAA 3BG5A 3V35A 1MI3A 2GJPA 2XHYA 3TCEA 3W6LA 3V0TA 2BHZA 2ACSA 2QR6A 1XI3A 1GW9A 2V5BA 5A8GA 2RUSA 4B9ZA 3W23A 3O06A 3KUMA 2G95A 4NRRA 4KCTA 4KCUA 2DT1A 1CXLA 4DUVA 1VZWA 3GNPA 4HK5A 3RDKA 2Z26A 3TKFA 3QKEA 2X1RA 4W5UA 1OBAA 4IP7A 3JRKA 3N1AA 5FAJA 3QR1A 1T99A 1EDQA 3SQMA 2X7WA 5EMLA 1XRFA 4M19A 4NAEB 1XUUA 3ANUA 4NJKA 4HGXA 3HMCA 3HN3A 4ZO9A 5CGMA 2X1IA 4KWUA 5BZAA 5IBXC 3U5YA 4ZTXA 2QULA 2IPWA 5C2CA 1U1HA 1XXXA 2HTMA 1YDOA 3NYDA 1M04A 4F9DA 3WFZA 4JQ3A 2D3LA 2QMKA 3S2NA 4PTVA 2WVUA 2QLYA 1IEVA 4QCEA 3TW6A 1Z9AA 1OYBA 4FHAA 1KBKA 1TMQA 1RBLA 3GK0A 4AIBA 4XAGA 1OCJA 5M5DA 3CUHA 3AXHA 3S6DA 5C70A 3NO5A 1B0IA 4H1ZA 3UCQA 5L6UA 2ZRWA 3CT2A 1ENUA 1OABA 2P10A 5KETA 3IAQA 2NUXA 1FVPA 4HYWA 3GKAA 5SWUA 2Y7FA 1VBJA 5I3IA 2GZXA 3FXYA 3GXIA 1XHGA 4BEQA 5TIMA 5CPNA 7ODCA 3BAWA 5RUBA 3MSYA 1JPDX 3L9CA 3SFWA 1NF7A 1J2WA 3HA1A 3KW3A 1UR0A 4KIRA 4IIBA 4DELA 1GVSA 3F03K 3WQVA 4C6MA 3GNNA 1EOMA 4C6CA 2ZWZA 4R7OA 5TQLA 4F0HA 2VC7A 4ORMA 2F61A 1K77A 4LB3A 2F6KA 1VPQA 2IKHA 1HJQA 4KKXA 5D04C 2OO6A 2VFFA 1M68A 3VAVA 3S9ZA 4YN5A 4UNLA 1H63A 3LYEA 3FVMA 4JY9A 3N04A 3A4XA 4CU7A 1UZHA 4HIBA 4ILSA 3LRLA 3KOFA 4UIOA 3INPA 3MI2A 4FP1A 3E2RA 3KHJA 4GZ7A 3NG3A 2V5CA 4EOUA 1OY0A 1VC4A 5GNZA 2HRWA 3LU2A 2DIKA 4BA0A 3V5FA 1XIIA 4D6CA 3W87A 3NM3A 2WVSA 3W7NA 4Z08A 3P5YA 5I07A 1RPKA 3OGVA 5A6BA 3I3EA 4UQAA 1SJBA 3WDPP 1ZJAA 2QPUA 4AEFA 3RFAA 1LRNA 5EU9A 4X9SA 2QGYA 3C2RA 2PLJA 2UY3A 3MI6A 1W8SA 4JNZA 3LX9A 3ANVA 3LZ3A 1E43A 4FX6M 3H2FA 5HMDA 4GQBA 3NEVA 3TDFA 3C2FA 1QK0A 3G8EA 1XIBA 4LW7A 2YR1A 4DXVA 4IMFA 3PZ9A 4P8XA 5KSWA 4NIRA 1DWFM 2A7NA 1OFDA 3PPGA 5ABHA 1YBQA 3L4XA 1GQNA 2QW5A 3PZMA 3G1SA 1QUMA 3SCRA 4G9PA 1AQFA 1UPMB 4AD4A 4KH2A 3E2VA 2GYIA 2NVAA 3TTQA 4U5IA 3AMDA 3DI0A 3KP1A 2O9RA 1ZNNA 4CGTA 1OC7A 3AWOA 1XGDA 4MPQA 1XSIA 2V82A 4LAZA 2YYTA 1OG0A 3M1ZA 1ZZMA 1BVNP 3L4VA 1P0EA 3T07A 3BW3A 1TPDA 4YTUA 4GC3A 3CIVA 1I2NA 1QO5A 3M44A 2XFRA 1LTDA 3NYZA 1GTHA 2VX5A 1T5AA 5LIUX 1RY8A 3GXNA 2WXDM 1XYMA 1WKFA 3FN9A 4OHQA 2CITA 5CXPA 1Y65A 3BZGA 3BJSA 2AL1A 4DJEC 3B8TA 2YCLB 5KZMA 3TYDA 1S3HA 4XD4A 1FDZA 1KV8A 4OGZA 5XINA 3WL1A 2PWEA 1TV4A 3APGA 4J3VA 1G5AA 2VRQA 2VOTA 3M5XA 1C7TA 3W2MA 4NXKA 3ES8A 3RPMA 4QXIA 1JFHA 2ZZ1A 3UJFA 4YPJA 1E3XA 4G1NA 3ARUA 4R5EA 4Q8VA 2OQYA 1VPYA 3W7CA 2QCFA 1AL7A 3HJZA 4FLOA 1E55A 3ABSA 4NAFA 4V33A 4YVVA 3QGKC 3VA8A 1W1PA 3EMCA 4Y9MA 1POKA 1CXEA 2ZDSA 3THUA 1Q6CA 2ZZ2A 1A53A 3NO3A 1H0GA 1DVJA 4L4PA 3SCTA 3GFXA 1OINA 3GDTA 3NJ3A 2XSAA 1VYPX 5TAOA 1UOKA 4EK7A 4CEXC 2J7EA 2WSYA 1B3YA 4QEHA 3B9EA 5A6AA 2DUXA 3W75A 1IZJA 1KB3A 1JEZA 3TZFA 2DVXA 1ITUA 3H7RA 5HPCA 4KGJA 3S1VA 3GHSA 3GIYA 4PMUA 3P84A 1LOLA 5EBUA 4HCHA 3SUVA 4O10A 3CH9A 2V30A 1O1HA 4ZOCA 3HPAA 1YXCA 3TW9A 3AROA 3VNZA 2PDUA 1VCGA 4GE8A 2V3FA 1NOWA 1AH4A 1KFCA 3CB8A 3QW4B 3PUEA 2GSJA 1AFSA 3DI1A 1J6PA 2Z6JA 3VNLA 2XGBA 4FX7A 4V28A 3QY7A 3UXDA 5CPOA 1GVRA 1TA3A 4ACZA 5G4WA 1V02A 2YLAA 4A3QA 3BCDA 3QRHA 2WPBA 1KRAC 3QPYA 3RRAA 3U2OA 3KBMA 5FJRA 4C6FA 2ZX5A 3BV4A 5FF0A 1C9WA 3IJ9A 3SRDA 1UJPA 4LPCA 2CU0A 1YADA 4W87A 4IP5A 5D8ZA 4IZGA 1QI3A 3NAVA 5I23A 2OODA 4EKJA 3P8IA 4AHOA 3NDZA 1GZJA 1ZTVA 1EJXC 3HZ3A 4C6QA 3HMJG 5TBOA 1XPGA 3PVFA 4C6EA 5I00A 1GEQA 4FX8A 1JZ4A 3WK2A 1RJRA 2Z7GA 2J78A 2CHRA 5K4ZA 1RP8A 1RCOB 1PKMA 3O0KA 4MNLA 3UWVA 4LAKA 3OW1A 3B8DA 3N9KA 3NQAA 3TOPA 3LLXA 4UTIA 1EDTA 1J9YA 3LI0A 3N12A 3HPZA 3KBJA 4JGDA 1LQAA 5C0QA 3N6QA 3W07A 3URAA 4H9UA 1VKFA 2DU2A 1CEOA 4RW5A 2V38A 2EG6A 2NSXA 4MF4A 5AHIA 4M56A 2QPSA 1MUMA 5ECVA 4XKMA 1GQLA 1LF1A 2V6AA 1CGYA 4OFCA 4DN1A 3S9IA 3TQKA 3WL0A 1UYQA 1Q7MA 1H41A 3N19B 3SSZA 1JPIA 4C6KA 4UNKA 4LVBA 5KZDA 2YCIX 3GHUA 4JTRA 2A6NA 3M0JA 2FIQA 2GDVA 3CS2A 1DIOA 4JTHA 4AIUA 3IK2A 2HXTA 3A64A 5LNRA 5BU6A 1TELA 1WUFA 4RNFA 1QNOA 3AZTA 1NEYA 1FWFC 2E0PA 2Z1BA 2BZNA 4ERGA 2OVLA 2JKAA 4ZSTA 3KOXA 1ZHAA 3DDMA 2AL2A 3WH9A 4L65A 3DIPA 1RY0A 5H2ZA 2VRJA 5CC6A 2WC7A 4JCMA 3IJ6A 2VYOA 2A3BA 4QLJA 3FX4A 4GI8A 2R1LA 2XIOA 1HTIA 3GW0A 2POTA 3AUJA 3VNDA 1QR7A 3SJ3A 1TO3A 5HPOA 3S1GA 2XPKA 2Q8XA 5LXEA 4WIWA 1GONA 5JH2A 2E6DA 1GOKA 3NL2A 2VZSA 3R25A 1TYGA 3K5XA 1WKEA 3WLJA 3JVAA 4LRTA 1BAGA 2CPUA 1DWHM 3NQEA 4OE7A 3VINA 2PURA 3SY8A 4AC7C 4AUBA 1TVNA 3ZOAA 3GU1A 3LHZA 5A6SA 4I9MA 1K8CA 1MW2A 2ISVA 2DIEA 5BU9A 1ZBWA 3FK4A 1XIJA 2VDHA 4RL3A 4R53A 3AYRA 4PGLA 3THDA 4JPGA 4MB5A 3GVRA 3FY1A 3PBGA 1TPFA 5DLCA 3T42A 3CZEA 1K9FA 1EB3A 2F84A 3TYUA 5D2VA 5CJMA 3ME3A 2Y6ZA 1DOSA 2IXVA 1KM4A 3DHUA 1H11A 2H8XA 1KBJA 1XC6A 5BXTA 4IUOA 1Z7AA 3TAOA 1KFKA 4O11A 1NDYA 4Z0SA 1XD1A 1A4LA 4GUFA 4FXSA 2VQTA 3A3HA 4LGXA 1W3KA 1QBBA 3B9DA 2I9EA 2Z2BA 1H61A 4ZOBA 2WSQA 3FYOA 3W2NA 3QXBA 4YHEA 4K8GA 1EC7A 3EZ4A 1IYXA 2YL9A 3WK1A 3B97A 3TLLA 5K9CA 3PJTA 4WGXA 4DLMA 3B8VA 2J62A 4HU0A 1BGAA 4A3UA 4KPLA 4UFHA 3WNPA 2ZZ6A 4V1YA 2F6XA 2JF7A 1XPYA 3BUVA 1XX1A 1AJ0A 2GQAA 3BQ5A 1B30A 1R3RA 4JAWA 3VMNA 4ZXOA 1JXJA 2H8ZA 3VKDA 4HYRA 3TYAA 2RFGA 3ECQA 2YL6A 4XVEA 3MS8A 3SN4A 4H7VA 1GOMA 2VDIA 1OGBA 4U4MA 3TWAA 2WYSA 3AIBA 3UXLA 3FJLA 4JTTA 2FGBA 1O4UA 2P8CA 4DEFA 4JDYA 1PTDA 2BTMA 5C7HA 4L5ZA 1KFJA 1N8WA 3REQB 1EUNA 1OFEA 5H8MA 1QHOA 1W5QA 1X1OA 1MSSA 2ZRZA 3M0YA 3WF1A 2WQDA 2ZXDA 4PCNA 3W7KA 1LROA 1CPUA 5DRIA 4PBGA 5FI8A 5BOFA 3PG8A 4XV0A 2R1NA 5DO8A 2E1WA 3FXGA 2GUBA 1A80A 4WDTA 4ZZ9A 1TCMA 5HNNA 1C91A 4L9XA 4YTRA 4AHPA 3GB6A 3W7RA 1JAEA 3PNZA 4GFIA 3U3HA 1PJ9A 5HULA 5E0CA 1NU5A 1UG6A 1LLWA 4CU8A 3LNMA 3TJXA 4JYFA 1EYEA 2NQHA 1V6WA 1DTUA 1Z32X 4CNTA 1LL4A 3QZEA 4N2YA 2RDUA 4X60A 3H70A 4MNMA 2PDKA 3AMGA 4C1KA 4J2PA 3EWYA 2WKLA 3E0LA 3O3RA 5EYWA 4F2TA 1Q4NX 4MWAA 5DQPA 3P3BA 2WHLA 1QJWA 1B3ZA 4X2RA 3PZTA 3QFEA 1JULA 1EJTC 2E28A 3KVJA 5XIMA 3IWPA 4PRTA 1RQBA 4M24A 1CW2A 3SO7A 3MHUA 3IIZA 3T6CA 4QP0A 1NWTA 3MY9A 1UWUA 3WDIA 3PAOA 4QISA 1YPFA 2P1FA 2XDFA 1JZ8A 4Y9PA 3LD5A 2XISA 3WQPA 4R88A 3VIIA 4DZAA 4GH3A 2WZEA 2WVVA 3H53A 3PUGA 3HTWA 5F1VA 3QM3A 1T96A 4WUIA 3ABXA 4DX3A 1YYAA 4M7TA 1HQTA 1Q6FA 2V8ZA 4ATLA 4K38A 3UGRA 2ZXQA 1UIPA 3KRSA 4W7UA 1UIOA 2Y70A 3ZO9A 1ODUA 1F3WA 3NA8A 5ENLA 4PEKA 4B4FA 1DJZA 3TNOA 5ABFA 1JCLA 3TSMA 1NTHA 3CPGA 1W5OA 4IIHA 4DRSA 3GKFA 4NNBA 1QTWA 1ME8A 3TLQA 1DXEA 2Y85A 1J0ZA 3MT1A 3B06A 4TU1A 1R6WA 5FA5A 1UD8A 3GFYA 3UJEA 2WK2A 2FZMA 4AEEA 3H2NA 2CLLA 3WBEA 4CVWA 3GNDA 1F74A 5IM51 4POCA 2P5NA 3OP2A 1XBXA 2QCNA 1DKWA 3M5YA 5KTLA 1REQA 1XYZA 2XZ7A 3ARZA 4C6JA 1V6YA 1RXOB 4ICNA 3L66A 5JQ9A 1K8ZA 1AODA 4RZBA 1CGWA 3MZNA 5I02A 1E5NA 4ADSA 4YIWA 3A24A 4W86A 3UY7A 1XINA 3VX1A 2V5LA 4LYKA 4QSFA 4HSNA 1UUOA 3GRIA 5BROA 3MWAA 4NJIA 4AYGA 1MNZA 3N4AA 4JX6A 1CB2A 3WQ8A 1RLDA 3EXSA 3CBWA 2R24A 3HGOA 2NVDA 1KFEA 1UR9A 4ZQMA 5EMJA 3E38A 3F5KA 3R12A 2VEPA 2FJKA 4LY4A 1JQXA 1I8JA 2WNZA 3WD2A 1WPCA 4BS0A 2IMRA 5AECA 4QNEA 1J0YA 4S38A 1BXCA 3MSGA 2FTYA 3W2UA 2CFFA 4LOCA 2FMNA 3LM7A 1LQ0A 2VM8A 4RE2A 1GG0A 5HJXA 4KWSA 4OV4A 1OD0A 3JW7A 4TIMA 3UPMA 2X0SA 1Y5XA 4ZODA 2Z7KA 4CEUC 3VDHA 4X9YA 1JCNA 4D2JA 3KWSA 3RXZA 4CN4A 1KCLA 1WUEA 1QFEA 2E09A 1JYXA 3M9YA 3F2CA 2BFGA 2WKJA 1LWIA 3W7LA 3Q37A 3R89A 2REQA 3MHGA 4M6QA 2FHFA 2FZBA 3NXLA 4RE3A 3CQJA 4EIVA 2VC9A 2EKCA 2I16A 2XVPA 1XLJA 3W28A 3BLDA 5DMLA 4J3SA 4K37A 2E6AA 4ZSUA 4G5DA 3WLHA 3CAWA 4WJEA 3RJYA 1VF8A 2ACRA 3G18A 3D47A 3T8QA 2AQWA 3LSCA 4QM1A 3OA5A 3ITXA 1RV8A 4F3HA 2X42A 1JZ7A 5GNYA 3L67A 4Q8UA 4UTFA 3OYXA 2V2HA 4ONVA 4UTTC 1JDCA 3CB3A 4F0SA 1YMYA 3AU6A 3M0MA 1ODZA 4FS9A 3IRSA 1XBZA 3N17A 4QDPA 4KEUA 4PCTA 2VTFA 1ISVA 2FFCA 4CVUA 4Z42C 3W22A 3B9OA 4XUGA 1PZ2A 5A3HA 4BI7A 1YXDA 1NH6A 1IWAA 1SZRA 1SPQA 2G4FA 1UZ1A 3BLOA 2ZRXA 4KBXA 1PX8A 4LAUA 2HK0A 4W84A 3GXFA 5AOUA 3NGJA 2AQOA 3QR3A 4PMOA 2XJ7A 4GI6A 3WNKA 3S83A 3H21A 4IGMA 4YTSA 4GYPA 1RD5A 1Z44A 4YWIA 2J66A 1E71M 3LN3A 3WD1A 4KERA 1CGXA 3F1QA 4MG4A 1IXOA 4QG8A 4D8ZA 1I4NA 4ZVJA 1HKMA 4AWEA 4QHRA 4AZBA 4JX5A 4YVPA 3UWZA 4UQ9A 4IQJA 3ALFA 3R8RA 3W1MA 3K46A 3BC9A 4O16A 4WXYA 3UJRA 2CKRA 5HATA 4JTGA 3W70A 4PB5A 3S2LA 3MBDA 1NFBA 3L4UA 5CEWA 1PZ0A 2G3NA 1AK5A 4K8EA 3MYPA 1XLHA 3DYMA 4JS3A 4NAFB 3STEA 3IS4A 1ZCCA 4XO6A 3AUOA 1CCWB 4ML4A 4FK9A 5DCBA 2PD9A 4EX4A 3MC5A 2A6LA 3CQKA 3RMEA 2VVSA 1I2QA 1HP4A 3QOKA 4CQAA 1TWSA 1XQKA 1V3IA 4PZVA 3KBSA 3KHDA 3VI2A 4D8AA 1A0EA 2DT2A 4PMRA 1EJRC 2PPGA 3IRDA 3VDBA 5AHLA 3B9NA 4Z2JA 3W3OA 2YBVA 3NNTA 5HINA 2B7QA 1EP1A 2DH3A 3CL7A 3OIHA 1E73M 1MXGA 1KM2A 3XIMA 1Z8AA 4IPPA 2BMBA 1W9BM 3BTNA 4MAVA 4YTTA 4NNAA 3OZMA 3MUZ1 5FJUA 2D20A 4RDVA 3WQ6A 3QLLA 5C2XA 3AHZA 2JGQA 4HPXA 3ZVIA 1LOSA 1ME9A 1EXPA 1TA3B 4GUIA 4ACZB 4JN8A 4F0RA 5AB3A 2PDNA 2VJXA 4RCXA 4I3GA 1UWQA 5BRBA 4IL0A 2CBVA 3P80A 3W72A 2D3NA 4B5TA 4MSSA 3KVKA 4EPKA 3DGRA 3A13A 1DYSA 3WJYA 1CWYA 4E2OA 4H9TA 4MB1A 2VFGA 1CLXA 2QS8A 3PP7A 3UNDA 5A8NA 2NWRA 9CGTA 1A0CA 1OF8A 4TQTA 3IJLA 4N4PA 4J3ZA 4PUNA 1B3VA 3QY8A 3AS3A 1VJZA 1VCFA 2QNEA 4I7WA 3GXTA 4D71A 4NXSA 3WNLA 1TIWA 1ZAIA 4QJ1A 2AGKA 3NQDA 1TJPA 5DXYA 4PCSA 1MVYA 2QHAA 4GWEA 4CCEA 4ZO8A 3MB9A 4G7EA 3SGUA 4C1NB 3EWCA 2ZTKA 4S2BA 1F8IA 3N25A 1K1DA 2CXGA 3BLIA 5HOSA 2O7QA 4Q4SA 2WJZA 5J04A 1XCXA 5E6YA 2V5JA 1TR1A 3P62A 3W26A 1YNQA 4MJ4A 1S2CA 1IZCA 2PSNA 3DG3A 3EB3A 5ECUA 3GVQA 2VWSA 3O05A 4US5A 2WLYA 3PB0A 2VZUA 1T0OA 1OSEA 1TTQA 4GG9A 1J0KA 2DSUA 4HK6A 1T6MA 4M5PA 4YNGA 1FHDA 2HK1A 1X6UA 4C5YA 3WDJA 3RHGA 1PKNA 2IQDA 1FKWA 3ARVA 1LG2A 3G1FA 3IIPA 1VFLA 1Q63A 1NQKA 1JRBA 3Q58A 1ZSXA 4KQNA 4DAFA 2OQLA 2QUNA 2V9DA 2CKSA 3CAVA 2VGGA 3CQHA 1UR3M 3P74A 1JUKA 4JIIX 3VOIA 4L1WA 2G3MA 3MW7A 4M82A 1R3SA 4AZHA 2DEPA 3KP0A 3MA8A 2XH0A 5IFTA 3H54A 3CUGA 1LDCA 1XYFA 2R14A 4UNIA 2AL2B 1U2YA 4AYSA 3QPZA 4LAMA 5F4XA 4B3LA 5B80A 3RM9A 4LV4A 4ML9A 1ZENA 4GBUA 4WY0A 3UNTA 1JR1A 2CLMA 2O9OA 2NX3A 1KCKA 1L6WA 2ESCA 4QFUA 4Z1YA 3QVQA 3ZYZA 2YKKA 3IVSA 1VBHA 2XN1A 4Q7NA 2ZUSA 3GUWA 1B90A 3GBEA 1KA9F 1LOQA 4C5ZA 3ICJA 1B4EA 2ALRA 3WQDA 2OYLA 1XICA 2WMKA 3SN1A 3VDGA 1LRTA 4UFIA 2VI0A 3DHDA 1KFLA 4YTQA 1H60A 6CGTA 1PV8A 1HJXA 4W4QA 1R3VA 4YCOA 2J7FA 4MVAA 1F07A 4RX0A 4C6PA 3ITCA 3SRFA 1B3OA 4LEFA 1C8QA 1EEXA 4MYXA 5FACA 1KD0A 4TTGA 2QUUA 3EWUA 1Q6RA 4GYKA 5E9AA 1ICSA 3CUZA 4IMGA 3TNBA 4B4HA 1XYCA 4US5D 3CK5A 3SR7A 4FXJA 4EVZA 4AWUA 1XLBA 3H2MA 3W7PA 5H91A 2ZX9A 4B2DD 1XLMA 1R85A 2WNNA 3CEPA 3WDRA 4HHLA 4HPHA 4EPDC 2B81A 3BPWA 4FEZA 1HFBA 2F2KA 2GWNA 4RK8A 1KTCA 1O6IA 2J79A 5KZEA 1U1UA 1FH7A 1VIWA 4E2DA 3PBWA 2VC5A 4A8LA 1E4NA 3T4CA 1X38A 4GO8A 4J28A 4MLRA 4BHYA 1AQHA 3VNMA 2GGJA 3LEPA 1EP3A 2VUNA 4Q22A 1E0UA 2W61A 3RLUA 4HNCA 3UETA 4HA4A 4IFKA 1JRCA 1SW3A 4IWWA 1GJPA 1XD0A 3WJSA 1P0BA 3LXBA 4RE0A 3SCSA 1TREA 3BOFA 4XZHA 1IHIA 1DJIA 3CASA 1JDAA 3RN6A 3GR4A 4GJ1A 3FIGA 1C7SA 3BJFA 2DT3A 5CC3A 2ABAA 2CZDA 1P7TA 3HG2A 1AJZA 3TYBA 2J6VA 1NOFA 3DFOA 1XCFA 2ZVIA 3CHDA 3CMGA 3KS6A 3P7YA 3STPA 1TZ9A 3RITA 3LM3A 2ZRVA 4WOZA 1K03A 1M7OA 3AXMA 5D02A 3PHAA 4IM4A 4M6UA 1ZPTA 2FVKA 2QCCA 4WSKA 2GQ9A 3LCGA 1AA1B 4LYPA 2C0HA 4H9YA 3A23A 3CV1A 2TMDA 3VUSA 1RZMA 3SRHA 4DO6A 1W31A 3N2OA 2VX7A 4E3TA 1UR8A 2QV4A 2GL5A 3T40A 1XRSA 3H2CA 1FCBA 2QQ6A 3L2LA 3R11A 4AX7A 3IJ7A 4DIAA 1IR1A 4PYSA 1PKYA 3VIJA 3W88A 1YE4A 3M0ZA 3VIPA 1A5SA 4HT3A 2C0AA 1P4CA 3SRKA 1YLVA 1YNPA 4UFKA 2CYGA 2PRMA 1PL9A 1EQPA 4D6IA 1VYRA 4NRSA 4JY8A 1RA5A 1Z41A 3UW6A 3GQYA 5AC6A 4ZXLA 1JL8A 2VEFA 1E9ZB 3UG8A 4Y2WA 3V3WA 3ZWSA 1F3EA 4PODA 1TTPA 3A12A 2OPJA 4QJ3B 4G8TA 3THCA 2JK2A 3EB2A 1BG4A 3BGGA 3LENA 5CZ0A 1VQTA 4IMCA 4OTKA 3UJSA 2ZZ5A 2O4QA 2HPMA 1LBLA 3APYA 3R79A 1AH0A 4RE4A 5DF0A 4LVFA 5AC5A 5HAOA 2GOUA 1QO2A 1SVDA 3U2CA 1I0BA 2XFWA 3I3BA 2EPLX 1VYSX 4IPNB 1UWRA 4C6DA 4LNCA 1OB0A 4J3WA 4EPBC 3WO8A 1P1XA 3QSRA 3NVDA 4YYCA 1KW1A 4L1XA 1PZ1A 1YIXA 4NL1A 3N4EA 4LU0A 3VD7A 2OYKA 4LV9A 4F66A 3IV8A 3G1YA 4QLLA 1QPNA 4IFRA 4PTDA 1PDYA 4S1FA 2PWUA 3QTGA 3CIWA 4D9PA 3LSBA 4DM2A 4LY8A 3TJLA 3A21A 1FCUA 3T0TA 2J8FA 4O1DA 2ON3A 1I2OA 1SZFA 3ZT6A 3VGEA 5M03A 1X97A 3S47A 4NX0A 1VJSA 1ZJHA 1AD1A 4YU1A 3K4AA 3OIXA 4ENLA 1EBGA 3EBVA 4GINA 1WDPA 4E8CA 3DEQA 4D72A 1RK5A 4V2XA 1PYFA 4EF9A 4F2BA 3UZZA 1H49A 4LBUA 4ERAA 4KFNA 2PCQA 3UT0A 4HZMA 3WLTA 1DE6A 4XG1A 1DQXA 3DC8A 3M0LA 2OSXA 3HGSA 3LPOA 5C9ZA 3PZNA 3EX2A 1PHWA 1G69A 1REQB 5DY2A 5EBAA 2X7VA 1DXFA 2X2YA 1L8NA 4F4RA 4N42A 3MP4A 1W3JA 1LRQA 1F61A 6XIMA 5TNVA 1FWEC 4W5ZA 3M0VA 2ZUVA 5JUVA 3OHMB 3U9IA 4KESA 4QG9A 4H41A 6TAAA 5PTDA 1F3XA 1PIIA 2ACUA 1KQYA 3PC0A 3QPEA 4YS1A 3RLVA 3S1WA 1V3MA 3H2EA 4H3DA 1LT7A 4E4UA 3M46A 8TIMA 1VFFA 5AYBA 3BLKA 1A5NC 3I7RA 3WF2A 3W1TA 6A3HA 3MQTA 1LYXA 2ZOXA 3PSWA 3B0XA 1SW0A 2DSWA 1A4MA 2PE4A 4JTCA 3HB9A 3PPCA 3C2EA 3GH7A 4TMCA 4GIEA 4WKAA 3E0FA 3CUIA 3HG4A 4EF8A 3WQ5A 2ZWYA 4HA1A 2QCLA 4B5NA 2P3ZA 4DF2A 3UCDA 3OOQA 2J7HA 2RGLA 4M51A 3R94A 1XBVA 1XGZA 3FLUA 1W17A 1UMYA 4PMVA 1F05A 4XZLX 1J0JA 2ZUMA 1XM3A 1M41A 1P0DA 3S1XA 3KAOA 3UWEA 3KRBA 1RCQA 2IS7A 2J47A 4IJRA 5DBTA 3VKJA 3HQPA 4NVTA 1E6QM 3WF0A 3CUJA 3TJ4A 4HSHA 1W6TA 2JIWA 3QYQA 4IIFA 4JQ2A 5HBFA 3FGCB 5H8UA 4DWDA 3NIYA 3ATZA 4EP8C 5M1TA 3BH4A 3W6YA 1H4PA 1CDGA 3QGVA 3QN3A 3TSDA 2JQXA 3I4KA 2ZE0A 1R7OA 4FALA 2P8BA 1N55A 2VR2A 5FAGA 2JALA 3WK3A 2DY3A 2BY1A 3SQLA 3PULA 5CC7A 5LYRA 1K70A 2CLKA 2FLIA 5AKQA 1OK6A 4UZUA 3SN0A 1ME7A 4K1WA 4WQ6A 2PDLA 3SIZA 2ZYFA 1V6UA 1K6WA 4QE1A 3W7QA 4IHCA 3DHFA 5AC4A 3IEBA 3F4VA 4PBEA 4DO4A 4DWSC 1UB3A 3OYZA 5JU6A 3EWZA 3W2LA 1NELA 2W5FA 3CAQA 4LCQA 1D7KA 2HSAA 1I2RA 1R9ZA 1QOXA 3W01A 4DY1A 1TPVA 1JGIA 3HV8A 2EO7A 3W53A 2WSKA 1SFLA 4IL2A 4MFEA 2QUMA 2ZUWA 4GHRA 4LH8A 3B40A 1G1YA 2OT1A 3BWWA 4JEJA 2D0HA 2BG5A 3SCUA 2JEPA 1BPLB 3AIVA 4KRZA 3IIXA 4GIYA 4D6FA 2MNRA 4FIQA 1HJSA 3B0PA 5CGQA 1W5PA 4WEVX 4MJMA 1BRLB 1OGSA 2DDXA 5T9BG 5G2HA 4HCDA 3T0CA 1THFD 8CGTA 5I09A 3HURA 4L9YA 3WLLA 2YLLA 3B05A 3HGRA 1CXHA 3CT7A 1HT6A 3G24A 4D1JA 2J7CA 5BXRA 3WH7A 4Y8EA 5A5WA 1TCDA 3G2GA 2HISA 3SGZA 3DAQA 1BWKA 3LCWA 3S42A 2CWXA 2PWVA 4JTKA 3CNYA 1S5TA 2FDSA 1OCBA 4H8VA 1WKDA 2PLKA 3NPUA 4PMYA 1E4LA 4AZCA 4GQGA 3NQCA 3VOHA 3L0NA 3SJNA 2D2JA 2J4GA 1N7KA 1WDWA 1OHLA 1DE5A 4L9ZA 1WB0A 3WYZA 3PBYA 3W2KA 3VGDA 1W1B1 4MGGA 3V36A 2Z1WA 1NOUA 3FW6A 3FFSA 4M7SA 4XVDA 1OC5A 3VOCA 1YTDA 2XIMA 1MEWA 1RJPA 1RA0A 3TZNA 4HP5A 3VXGA 4Z2IA 1DPMA 4P7NA 1TWIA 2W63A 2Z0IA 2BOFX 2EEXA 3DBPA 2E5CA 1FQ0A 4AZGA 4NYUA 3V5CA 1BF2A 4KWVA 3KZSA 2W0UA 2PRLA 2P76A 3URBA 4AIOA 1L6GA 5DN1A 4RNHA 1J11A 3NZRA 3W84A 1IT8A 2WBKA 4ZEPA 4D6GA 3PTMA 3HF3A 1LUCB 1JDFA 2E4TA 3PZQA 2JIEA 2KAUC 4CLMA 1IXNA 4MY9A 4Y9NA 7REQB 3GDLA 5A8QA 4IH3A 3SUWA 5FIPA 3LCIA 1XGEA 1Q7QA 1PVNA 1T8QA 1SJAA 1ZFJA 5BMXA 4PR4A 3E12A 4GPNA 4IUGA 4UTWC 1O7AA 5CZKA 3R0KA 4PUMA 4M1RA 4G56A 4S39A 2VX6A 3EWDA 3GVGA 1XKYA 3KM8A 5HJLA 3CHCA 2A7RA 3WLSA 3IUIA 3UYCA 4E2VA 2XIQA 5HUPA 2QVNA 1JCJA 3GXDA 4GVGA 3MO7A 4Z2GA 3USBA 4LNYA 3W73A 2OTDA 1VRDA 2GGIA 1OFBA 1ADOA 2YDQA 1ECEA 3SCQA 3JU2A 3AS0A 1IEQA 1VFOA 3LMYA 4DBEA 1S39A 1PO9A 2W4XA 4E0CA 4PUWA 3V4BA 1WBJA 2FGLA 3NZ1A 3M16A 3MSRA 4LS2A 2J9YA 5IXEA 5K3VA 3PPHA 3CUXA 3S5NA 1ML1A 4HYVA 3T2QA 2PZ0A 4GGBA 2H9AB 4O13A 3GG1A 1B2YA 3SCPA 3WLOA 1KGXA 2V69A 4JHMA 1OWQA 3LLFA 3LLDA 3F2DA 4HOWA 1DQWA 4HMNA 4KFOA 2WAGA 2J24A 3VD9A 4BZYA 3R0DA 2P88A 3GSMA 4GI9A 5CJNA 4K7VA 1RK6A 3UR2A 4IX0A 4B9YA 3H7VA 3C0LA 4JIEA 3P14A 4WCJA 2V81A 4WGHA 4Q3MA 1XYBA 3M07A 2VEGA 1V6XA 2GSHA 4NI8A 1CLVA 6PTDA 1NDWA 4X61A 1ONEA 2IQ0A 1FWAC 1XC4A 3N9RA 1GHRA 3O2LA 2QAFA 3VCCA 2QJIA 4ASTA 3E5PA 1VEMA 4FA3A 4GYFA 4KEMA 4UQEA 2WCSA 2VKZG 3SSJA 2RGMA 3AU2A 4C7FA 4CNSA 5IOBA 2X41A 3QW3A 4UC5A 5CBJA 1L9WA 3A5FA 1OGGA 4MB4A 3RUBL 2OEKA 1RBOB 5LIXX 2EPHA 4MDPA 3L21A 4Y7EA 4CD5A 3VC5A 1FWWA 1QPQA 3ID7A 4MY8A 4XZ9A 1HVQA 1HJUA 3FA4A 1AMKA 3HQNA 4MB3A 4J5NA 3IIVA 2RJHA 4DJDA 4MZ1A 3ZR4A 1XRVA 4J4KA 4BWLA 5E93A 2GVGA 1BYBA 3MKVA 1XFBA 5AYXA 5CJ5A 2GVLA 2Q3OA 5DBUA 4JQ1A 1G4SA 2Y4SA 3K8KA 1E6PA 3OBAA 4JN7A 1EJSC 3MPGA 1XIFA 4LBRA 4CQBA 3B4YA 2BXVA 2C19A 3N2MA 4E8GA 2D2HA 3E5BA 1JCMP 3D3AA 4DXXA 2PDMA 3ALGA 1HP5A 4IQEA 4G7FA 1ONRA 1V51A 3L5MA 4EAMA 1GT8A 2WSRA 2ASHA 4KCVA 4S3FA 1EJUC 4REQA 1OFOA 4B5VA 4GY1A 5HNRA 4RV8A 4OIFA 1CTNA 3LCLA 4AZ5A 1TZ7A 1UUQA 2VCBA 4WKFA 3N9SA 4O28A 2YBTA 1IGWA 3CTTA 1JVNA 1DWAM 2Z29A 1PZ3A 3ZJ7A 3FJ6A 1QW9A 4LTSA 3UY8A 1IIGA 1QNPA 4JL2A 3EEGA 4CNUA 4BR1A 3OB8A 1E15A 1QRQA 3BW2A 1TPH1 4GC4A 1FWCC 2YCEA 2BOGX 3TTEA 4I5UA 2VDGA 3NQGA 3KCJA 3R6IA 5B7ZA 5HWJA 4XWUA 5HQMA 1MFUA 1H3GA 2EJ1A 4H8NA 2R9RA 1P1MA 5IFPA 3T2PA 4PFMA 3M0KA 2A85A 3ARPA 4F0LA 4DJFC 3WQOA 1P7TB 4CKQA 4JD4A 3KFTA 2KX9A 3EXRA 1K9DA 1YPXA 1MW3A 1A5MC 4TV5A 4DF0A 3TUUA 4X3ZA 4UMCA 5D30A 4XUYA 1GYNA 1BHGA 2QXWA 1QNVA 4AWTA 3WJZA 3KEHA 5FL1A 3WDQA 5LNUA 1H5YA 3BG9A 1I75A 2CIPA 4FNSA 1Q5MA 3AXKA 1K3UA 4INFA 4DO7A 3E9AA 2PF0A 3K8MA 4UOZA 3I10A 2HS8A 3TQPA 1QHPA 1JPKA 2W9MA 2WOQA 5I06A 1U33A 4F48A 2PC8A 1H50A 3HU7A 4QR6A 5I7GA 4L80A 3EOLA 5K4XA 2DSKA 4Q8NA 2GGHA 4RXFA 1EF2A 2BDQA 5T26A 2GJXA 4I5RA 2PGFA 3U8GA 3W76A 1D8WA 2ZQ0A 3QV7A 2NV2A 5D9NA 4QE5A 3BAXA 3TA9A 1AUSL 4OECA 1YTEA 1HGYA 2HDJA 3QC3A 1ZCOA 3AMCA 1X98A 3ZR5A 3GTFA 4C7DA 5CSUA 1V02E 1Q2SA 2C8NA 5AZ0A 1O95A 1UQYA 3U4AA 1KM3A 3MU7A 1R9XA 3PANA 1JNDA 2OT0A 1LL6A 2CZ5A 2X30A 1PSCA