2V38A

Family 5 endoglucanase cel5a from bacillus agaradhaerens in complex with cellobio-derived noeuromycin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
301
structure length
301
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases
rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 122
structure length 301
sequence length 301
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2007-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2v38A00
2DSVA 2CCRA 1L0PA 3FN9A 4AIEA 3M07A 1KBBA 5TD4A 1B0IA 1S46A 3WBAA 1G0CA 2WVUA 5I24A 4QCEA 1DWAM 1F4HA 1V02A 4HP5A 3POCA 3SUTA 2PWHA 1E6ZA 2WCAA 2IXUA 3WF4A 1CGXA 1UR0A 3DECA 3PN8A 2GJXB 3N17A 1KXQA 4E4PA 1R87A 3N9KA 1UA7A 3ZMRA 5A2CA 4AIUA 1E5NA 1LG1A 2WAGA 3QR3A 1D7FA 4HA1A 3AFBA 1M01A 3SURA 3FAXA 5A2BA 1OB0A 3NSMA 4HZ6A 2Y2WA 4HA4A 2RGLA 1NH6A 1H0GA 4RL3A 1GW1A 4PTWA 2D0HA 2ZX8A 3WF1A 3B9DA 4W8AA 1E6XM 3WUBA 4DWSD 3ZSTA 2ZUSA 2VQUA 3CHEA 4OUEA 1MW0A 4DUXA 3WQVA 3F5KA 2PBOA 4UCFA 1J18A 2J77A 1V6XA 2XGBA 4PMYA 1IT0A 4U2YA 4WF7A 1MQPA 1UQYA 4RE2A 1VFFA 4J3WA 2UY5A 3AHYA 1C7TA 1NOUA 2JF6A 1ZL1A 5DMYA 5A6KA 2JIEA 3AIRA 3GTNA 2WXDM 4J3UA 3ZOAA 3WUGA 2DT3A 4EK7A 1QW9A 1NP2A 3EDDA 4PMRA 2YL6A 1JNDA 3W4RA 1HIZA 3WQ5A 2WMFA 1TE1A 2OYLA 1PZ2A 1US2A 2X05A 4BZYA 1OT2A 1PX3A 1C91A 3WIJA 3TP4A 1BYBA 5I77A 4XB3A 2F2HA 3OZOA 2PWFA 5D8ZA 1WB0A 1JNEA 1QI5A 3AROA 3RMEA 4H8UA 3WFLA 4HMDA 1OWQA 5D9OA 4PMQA 3WH6A 3PTMA 4UZUA 5IHSA 1OCQA 3VGHA 3GH5A 3U5YA 3UG5A 3WNMA 4W93A 1HP5A 3L4ZA 2ZXAA 2ZXBA 3EDJA 3A4AA 2BY2A 4ZENA 3K1DA 1ISWA 2WMJA 5CSUA 5A94A 5IDIA 5I2UA 1HKIA 2Y5EA 2YA2A 4N0RA 1UA3A 1XSIA 3AMGA 3VDAA 3RPMA 1QI4A 1LL4A 3VDHA 1TG7A 4AZ7A 2ESCA 2VJXA 2XIBA 4F79A 4H8HA 2CERA 3GBDA 2J79A 4AZGA 5ABFB 1V3LA 3VMOA 2BY0A 2WMIB 1TA3B 4PN2A 1EOMA 2JFEX 4Z2KA 4PUEA 3OLGA 3MO4A 2V5DA 4JCLA 3F5JA 3CHCA 3AMDA 2CBJA 4B3KA 3ZR5A 4HPHA 4JIEA 1B30A 3PZGA 2W67A 2ZWZA 2J7BA 4W5ZA 1E6QM 4NI3A 3AZSA 1CDGA 4U33A 8CGTA 5KEZA 3ZQ9A 4P8VA 3M7SA 1UZ4A 2Z1SA 1YQ2A 1Y7VA 1VBRA 1BQCA 1NWUA 3ZJ7A 2E4TA 1GOQA 1JI1A 8A3HA 1R86A 2VX5A 4PMDA 4FLRA 2AAAA 2J4GA 1OD8A 4ZXLA 7A3HA 3SCNA 1E4MM 4EANA 1QW8A 1CGTA 5DT5A 4U31A 4PRWA 2G8ZA 5CLWA 1ISZA 4D6GA 1AQMA 4UQCA 3MUAA 3VIGA 3WMCA 1EO5A 4PMOA 3W37A 4U2ZA 1V6UA 5ABEA 2TAAA 2XWEA 3N18A 1ZBKA 3AQUA 4L4PA 1FH9A 2W4XA 1JYXA 1V3MA 4R27A 2BY3A 4TX6A 2BVYA 4PMXA 3D3AA 3VGGA 1J01A 1J11A 3GNOA 1LF1A 1LLOA 2J7EA 3AMCA 3PTKA 4HA3A 2WMHA 3VNZA 4TVCA 3POHA 5ABHA 4URIA 4PCSA 3OIHA 1C8QA 3PHAA 1AQ0A 2O9OA 4W8LA 4EE9A 3CTTA 3AIBA 3GDBA 3VIOA 5FIPA 4M80A 1XYFA 4YN5A 2J7FA 3TTSA 3WH8A 3WENA 1WZMA 4D1IA 3CMGA 1JD7A 3G6MA 1BYCA 3BMVA 2FGLA 1VF8A 2VZTA 3MMUA 4D71A 4QLLA 1OIFA 4NRSA 4Z2JA 3DYOA 2ZWYA 3N11A 3T08A 3OGSA 4WJXA 1ODZA 3VMPA 5A6MA 5CG0A 5HPOA 2WC7A 3DYPA 3GH4A 4AY1A 5CPSA 3VIPA 3OBAA 2DSWA 4P8UA 4J28A 4AZ5A 5LA0A 1SMAA 2VZOA 1HN1A 3FAWA 4W86A 4A3YA 5CGMA 3VDCA 1DTUA 1UD3A 1KWKA 4PCTA 1XCXA 1HXJA 1KCLA 2D24A 1V0LA 3WUFA 3EBVA 5GNZA 3ZSSA 2PI6A 4D72A 5EBAA 3CUJA 4Y7EA 3TA9A 4CD8A 4BQ3A 3PZOA 1X6LA 3FHAA 4DWSB 1GHSA 4DWSC 1ZJBA 1XYZA 1GQKA 1JZ7A 5EFFA 4HOXA 4QLJA 1NWTA 1TFVA 2UY3A 4M29A 2ZUTA 1JI2A 4AWEA 1I1WA 4D6JA 2IUZA 1ESWA 4M56A 2FHCA 4ZE4A 3AS1A 2E9LA 4QP0A 3T2OA 1FA2A 5LYRA 4V2XA 1US3A 2VRJA 3VM7A 3AIWA 4B15A 1HJUA 4PSRA 4UQAA 2WLZA 5FD0A 3VILA 5I79A 3W38A 1B31A 1WZLA 2E9MA 1ZB5A 2DT0A 1UWSA 4AD4A 3AHTA 1XCWA 1Q6FA 1BVZA 2PBGA 3WFZA 1EDGA 1PX4A 4J3SA 3NIYA 1CZ1A 3QOMA 3VGFA 2WM0A 1HKKA 3AS3A 2XWDA 1QHPA 4W7VA 4M1RA 5BXPA 1FHDA 1KXVA 1FP8A 1E6PA 2BNJA 4B16A 3WF3A 2IXVA 4CGTA 3GXMA 1W3KA 1WKYA 3WY1A 5DO8A 2WVTA 1B3YA 2D3LA 2ZXDA 1TR1A 2OWWA 5CQ1A 3EMZA 2BHZA 1CXEA 4H2CA 1MYRA 7TAAA 4LYQA 4JKLA 4W89A 3W25A 1JFHA 3CPUA 1UHVA 1CGYA 2VMFA 1VJSA 1SMDA 3PZIA 3KZSA 1W9VA 1JL8A 1NM9A 5BXRA 1EH9A 1UH4A 4Q22A 3DYMA 3MSGA 1JXKA 3PZTA 3VD4A 1E4LA 2XYLA 2BHUA 3DHUA 1UG6A 1NARA 1J9YA 2J7DA 1ODUA 4H04A 4D6CA 4CCCA 3WH5A 3OZPA 3CZLA 2YA1A 2WHKA 3AI0A 1E1EA 2C8NA 1XSKA 3UG3A 5C71A 4GINA 1CXFA 2J78A 4CVWA 3DC0A 2OWXA 2E3ZA 2XVGA 1BF2A 3GZAA 1UR2A 2CKRA 3MS8A 3L2LA 1UKPA 4NZCA 4K68A 2PWEA 2VVNA 3CZGA 3RM4A 3AXHA 1XV8A 2FDMA 2E8YA 1KBKA 3ARXA 1I75A 4GI6A 2J75A 1KQZA 3UEQA 2EXOA 5BXSA 3W28A 5HNNA 2WSPA 4AISA 1EQPA 1FHLA 2ZE0A 4KH2A 4CVUA 3DHPA 3WF0A 4HTYA 4UNIA 2OSWA 3NDZA 3T09A 4M8UA 2EPMX 2G3NA 4OIFA 1XH1A 1H0IA 2CYGA 1KB3A 2EQDA 3BSHA 3NJ3A 4OJYA 4BA0A 1DWFM 5A6BA 3ZT6A 3W0KA 1VEPA 4UFJA 2DIEA 1WE5A 1KXHA 2XM2A 3PZQA 4AYSA 4GPNA 3ARRA 1UYQA 2EBNA 5GQBA 1R7OA 3UR7A 4BQ4A 1VENA 1PIFA 3MUZ1 3WMBA 2WCGA 2ZUVA 1HVQA 2VZUA 4CD6A 3WD4A 2DSKA 2DSUA 5CGTA 2QF8A 4CU6A 3LPGA 4QLKA 1V0NA 2YA0A 2HISA 2WKGA 3FXYA 3GXDA 1QNOA 4YHEA 2CIPA 1E4NA 4WKFA 4PMZA 1OIMA 4YPJA 3GYCA 3SIMA 5C70A 5IHRA 1V0KA 1HL9A 2GJPA 2VZVA 2ZUMA 5I0DA 3VKKA 4ACZB 4Z2LA 4PTXA 1W1TA 2VOTA 2V3FA 5HXMA 2QLYA 1UH2A 4HZ8A 3WNPA 3VIHA 4BQ5A 2JE8A 5GPRA 1CGVA 4W87A 5A8MA 3EDEA 3WF2A 2DT2A 1A3HA 1GPFA 1VEMA 1PZ3A 4D1JA 4MPKA 3RO8A 3EDFA 2ZICA 1BYDA 5C8BB 2XFFA 3GNRA 1HJWA 1WCGA 2V5CA 3WD0A 2WC3A 3EDKA 3N15A 2CNCA 1J12A 1B3VA 2JEPA 2QPUA 3N04A 1GORA 1JD9A 1MW1A 4L4OA 1WPCA 5BWFA 4AC1X 2WMKA 3K4AA 1H2JA 1CLXA 4D6DA 4JL2A 3VU2A 3BAXA 2VUYA 1LJYA 1J10A 1ZBWA 1CEOA 2DQXA 1C8YA 4WIWA 4D6HA 1HJSA 1SR0A 4CU7A 1BLIA 5D9MA 4Z2GA 1ZJAA 3LPPA 2J74A 4PMVA 1JIBA 1E4IA 1GOKA 1VFOA 4MTVA 4AD0A 4M81A 2VRQA 4AZIA 2XVLA 1QBAA 2PWGA 4FK9A 4TOQA 2J7HA 4F9DA 1BFNA 2XG9A 2XTKA 3TTOA 3GNPA 1H1NA 2WK2A 4V27A 7CGTA 4JZ5A 2J62A 2ZIDA 3T0DA 2FGZA 2VVSA 3WDPP 2F8QA 3NSNA 2Y4SA 3TTYA 1I1XA 3SUWA 2W62A 2XVPA 1UD4A 4KWUA 1WZKA 4D6FA 1WAWA 3MMWA 3ZJ6A 1JDCA 2JF7A 1E6NA 2AMGA 5GNYA 3WKZA 3BAJA 2JALA 5FKYA 4IPLA 1CBGA 3WNKA 2CETA 4B3LA 1CXIA 1DHKA 3OLIA 1EDQA 1ZBCA 2BXYA 3CZJA 4NSBA 4N42A 3NCOA 1W2VA 5A8NA 1HKMA 1M03A 1W9PA 2X8RA 1JYNA 3G6LA 2YDRA 1MFUA 5CSYA 4MADA 1KXTA 3IJ9A 4AD1A 1BHGA 1J0IA 1H11A 2ZUWA 3AIQA 3VX0A 2W91A 2OLHA 3AJ7A 1C8XA 4MDOA 3A6OA 1C3FA 5JIPA 1AMYA 1E9LA 2WW5A 1V6YA 4WKAA 5BCAA 4TVDA 3VGBA 1B90A 4BQ2A 2X0HA 3BAIA 5DF0A 4UZSA 2QHAA 1UD6A 3VIIA 4OOUA 3CH9A 2BFGA 3BCDA 3WH7A 1MFVA 1H09A 4LQ1A 5BROA 2EJ1A 1MVYA 4JAWA 1E73M 1GOMA 3RDKA 4PTMA 4IISA 1TVNA 4KMQA 2VR5A 4UOZA 1W1YA 1O7AA 4GO8A 3WSUA 1EOKA 3HJEA 1VIWA 1VFMA 2VC9A 1XGZA 1QHZA 1TCMA 1TVPA 4JHZA 3VIKA 3QOKA 2VR4A 4JFTA 2X2YA 1HNYA 2G3MA 3VTRA 1W2PA 2PC8A 2WCSA 1YHTA 1KGXA 2V38A 2ZX6A 1W3LA 4BCEA 6A3HA 1RPKA 4W7UA 1M7XA 1QI3A 3S2CA 4AEFA 1JXJA 3AMKA 1CGUA 4ATWA 1QNRA 2XUCA 2EPKX 1AQHA 3J7HA 5A2AA 1J0KA 2YLLA 4HZ7A 3GXIA 3TOPA 1QHOA 1LL6A 3W82A 3SCOA 2WZEA 3GBEA 1QBBA 1B3WA 1V6WA 2JIWA 1UWQA 2E8ZA 4MB1A 1E72M 2W66A 4CCEA 5EMYA 2WPGA 5JBDA 1UD5A 3WQ4A 2DPEA 4IPNB 5AYIA 2X0YA 3CZKA 1JZ3A 1WDQA 2DEPA 5CPQA 2A3EA 4P7OA 2V3EA 4GI8A 3UCQA 2GK1A 1LWHA 2YLAA 3I3BA 3VINA 3VD9A 2CESA 1J0JA 3IJ7A 4ATDA 1JAEA 3RIKA 1B3XA 3EMQA 4BF7A 3K46A 5A1AA 1K9FA 1VRXA 3T0AA 3WDIA 3QHOA 4Z2IA 1V08A 2WBKA 4UQDA 5DEZA 3AZTA 5DFAA 3ECQA 3VNYA 1E1FA 4DM1A 2D20A 3MMDA 3U5UA 1UOKA 3KWXA 1GOOA 3ARTA 2FHBA 3ZR6A 4MJ2A 2EPNA 2VT0A 4PMNA 2O92A 5A6AA 3VD3A 4FF5A 4X0NA 4WSJA 2XSAA 1QNPA 3W6MA 1NOFA 4GZIA 1PAMA 1H49A 5E09A 1LG2A 3WNOA 3U7BA 1BG9A 2VCAA 1WDPA 3IAPA 1KQYA 2YL8A 4MNLA 3AMLA 1MQQA 3AXIA 3ARZA 1V6VA 5A8PA 5JUVA 4KGJA 1JYVA 3PTQA 4AZCA 1EO7A 1CYGA 1KWGA 3SCQA 3THDA 2G3IA 1JF5A 2GFTA 2GJRA 2XHYA 2VTFA 1GJWA 4RE4A 1PEZA 3PZ9A 1DWIM 3RILA 1HVXA 4JL1A 3N13A 1X6NA 4QAWA 1XC6A 1RP9A 2Y8VA 4E2OA 2XGIA 5BRPA 1UD8A 4LYRA 4CD5A 5M5DA 1UWIA 1NWSA 3NDYA 1V3KA 3CUIA 4MAZA 1G01A 3L4XA 4UFHA 1GONA 1UH3A 2OSXA 3RCNA 1EDTA 4AXNA 4F8XA 5FL1A 4ACYA 1Q6GA 3WMSA 1CXLA 4A4AA 4JKKA 2EEXA 3ZIZA 3VM5A 5HPCA 2BHYA 2J7CA 2WB5A 4HOZA 3A47A 5AC4A 5A69A 3O2LA 2ZOXA 4CU8A 3B9EA 3SCRA 1AVAA 2D0FA 3TONA 1Q6DA 2VX7A 2QV4A 2WLYA 1ZBVA 3W6LA 1HJQA 4W84A 2FHFA 4UOJA 1ISVA 2ZX9A 1UKQA 2Q8XA 4MB4A 4TUFA 4U5IA 4U5KA 1WZAA 3M6DA 2BY1A 3SCPA 2D3NA 2Z1KA 1HJXA 1HKJA 5AYBA 1UQZA 1B2YA 2GDVA 3AHXA 1J0YA 3N1AA 3HMCA 3M46A 1MW2A 4MJ4A 3RM9A 4XX6A 1K6AA 2D0GA 1TUXA 4AEEA 5I6SA 1JYWA 2OWCA 1NWRA 3BLPX 1D2KA 1U33A 5FOOA 5JBFA 3WDJA 1D3CA 3MV01 3EMCA 4WSKA 1V3JA 4UFIA 3AHZA 1QPKA 5D8WA 3BAWA 1Z32X 4GXPA 2CKSA 3ARSA 2XJ7A 1C93A 4LPCA 2Y24A 2XM1A 5GNXA 1ITXA 5D9NA 4CD7A 3PZMA 1GOWA 4FMVA 4BS0A 3IAQA 1H4PA 3BC9A 3VX1A 1B1YA 5A6SA 2W61A 1JFXA 4GZEA 1UKOA 1W9BM 2CBVA 2YDQA 4GIAA 4KRUA 1B3ZA 2VNCA 4UFMA 3VIFA 3CUGA 1K9DA 3QHMA 3VGEA 4OKDA 2CPUA 2VCCA 2WWCA 3WD2A 5CLTA 3AHVA 2GJXA 2CBIA 3AIUA 1GNXA 1XRVA 4KGLA 3L4VA 4D6EA 3II1A 4MDPA 1UD2A 3RM8A 1X1NA 3FNDA 2DGAA 2DT1A 1OGGA 4RE3A 1H5VA 3BH4A 4J27A 4PBGA 2C7FA 4R5EA 1F4AA 3RJYA 3AS0A 5E0CA 1GUVA 3CUHA 3UR8A 3AYRA 4UTFA 5A6JA 1P6WA 2HVMA 4PSPA 1R85A 2EO7A 1Q4NX 2WKLA 4FLQA 4V28A 4WLCA 2YDSA 3AZRA 3WEMA 3N12A 1G9HA 2VZSA 1XD0A 4JFUA 2NW0A 4ZFMA 3KL0A 4S3KA 1OT1A 2E40A 1VJZA 1IZKA 3AICA 3MKKA 4A3HA 4OBRA 3KL3A 3THCA 2CBUA 4U3CA 2GSJA 3ZM8A 2G41A 5IFPA 1BPLB 4FLOA 2G3JA 4AD2A 2DSZA 2WANA 2WNWA 1C92A 1R7AA 5AY7A 1CENA 1V3HA 4UR9A 3RJXA 2B31A 3JUGA 1IV8A 1DP0A 4PEEA 3E1F1 2WMGA 2VI0A 1UWUA 2ZX5A 4TX8A 1OBAA 1UR4A 1QVBA 3FW6A 2VX6A 2VRKA 3LMYA 2G4FA 1G94A 4B9YA 3KE0A 3OGVA 3VD7A 3CO4A 1JZ5A 1GQIA 5ABGA 3VIJA 4CKQA 3O6AA 1J0ZA 1W9XA 3LPFA 2F61A 4AZHA 2GUYA 1HF6A 3W24A 1CGWA 3D5HA 1UWTA 1ZS2A 3WQ6A 5M03A 1TMQA 3WNLA 2QMJA 1DWGM 1XH2A 1KFWA 2XPKA 2DH3A 3ARYA 3MSDA 5HDRA 4LXFA 2X09A 3B9AA 1FP9A 3UERA 1U2YA 4JFWA 4TTGA 3VGDA 5ABFA 1B9ZA 1QNQA 2WMIA 1W91A 1TA3A 4MNJA 5LA2A 1CXKA 2VO5A 4MNMA 3AISA 4TXEA 1UR9A 1SFSA 2A3AA 4LYPA 4PUDA 4S3JA 1OGSA 1JZ6A 5D9PA 3VDBA 2ZUUA 3CMJA 1LQ0A 4UQEA 4X9YA 2PB1A 3GH7A 5DT7A 4J3TA 4CD4A 3UESA 5EFDA 1HX0A 1JZ2A 1E6SM 1KGWA 1W9DM 4P7LA 5CZKA 1GHRA 3IANA 1WO2A 3BGAA 2BS9A 1CNVA 3PBGA 1GZJA 1E43A 1CLVA 1Q6EA 3ZT7A 2BVDA 2WHJA 2EPOA 1DWJM 1E3XA 1HJVA 3VO0A 1C90A 1W3JA 3AYSA 1EHNA 2OYMA 4X0VA 1OD0A 3CZ8A 2GVYA 2OYKA 1V03A 1E0XA 4JCMA 2XIIA 3KL5A 1BGGA 3MV11 2XSBA 1W1VA 5E9AA 2WVSA 1U30A 2WVVA 1OM0A 3MUIA 6TAAA 2XFRA 3AIVA 1J0HA 1BAGA 4AD5A 3SUVA 4AZBA 1JGIA 2V3GA 2WZIA 1W1PA 3K8MA 3VOCA 5E70A 4ZXOA 4Z2HA 3BXWA 3SCUA 1GQLA 2A3CA 1FH7A 5KZ6A 4TTUA 4DM2A 4JFSA 3OGRA 4HU8A 5A8QA 1E15A 1GVYA 3BSGA 1H41A 1UR1A 4GO9A 4CN4A 5FCZA 1WP6A 3BLKA 4UQBA 4C7DA 1DEDA 1UZ1A 2PF0A 1UKSA 1QI2A 3VIMA 1PX8A 5LA1A 4NRRA 3GXFA 3CHDA 3PZVA 3L2MA 2MANA 1E0WA 1GOIA 1BTCA 3OB8A 3FHQA 3LPOA 1EHAA 3T0BA 3SCVA 1G1YA 2XFYA 3W53A 3IJ8A 4H41A 4CN1A 1JZ8A 1G5AA 3WEZA 1MW3A 1GQJA 2WZHA 4CN6A 1VAHA 2BXZA 3U57A 3GM8A 3NSXA 2GDUA 2YBTA 9CGTA 1PBGA 3EYPA 4P7RA 4HMEA 3TTQA 3WH9A 1MXGA 2DDXA 5I78A 1JG9A 4TVUA 1V0MA 4E8CA 2VX4A 2J47A 4MNKA 3AOFA 1L8NA 4HMCA 4OOZA 4W7WA 2WVVB 3ZJ8A 4DWSA 1LWJA 1UUQA 1HL8A 3A4WA 2CHNA 2D1ZA 3VPLA 4WKHA 3PZUA 4HU0A 3B8SA 5E6YA 5CXPA 4Q7NA 2J7GA 4UFLA 1E3ZA 2FH6A 3ARVA 3BCFA 4J3VA 3ARWA 4OZOA 5BYWA 3OLDA 4PYSA 4XZWA 1WNOA 1QNSA 3WN6A 4ATLA 4W85A 4XZBA 5A3HA 1BYAA 2WSKA 3SCWA 3APGA 2CITA 3WNNA 2ZX7A 3I3DA 3T2QA 3NUKA 3OA5A 3CUFA 4DUVA 4M24A 3L4TA 2Y8KA 1FH8A 3K8KA 1SYTA 2QMKA 3AIEA 3MANA 3F4VA 3ARQA 1XSJA 1XH0A 2WBGA 2W92A 4HOWA 5A8OA 1LL7A 2NSXA 5A6BD 4ML4A 2VCBA 3A3HA 1E56A 2A3HA 3ZJKA 1BSIA 1KR1A 1PJ9A 1HP4A 1K9EA 2YOCA 1IZJA 3WQWA 2XVKA 3ARUA 4W88A 2AOSA 5IXEA 3FY1A 4AMCA 1JZ4A 2VQTA 1CTNA 3VMNA 3QHNA 2UWFA 4M82A 3WL1A 5IFTA 4GI9A 1CPUA 1E40A 2VURA 4MB5A 1K9TA 3WDQA 1GJUA 3ALFA 2BV9A 4D6IA 1Q6CA 1EA9C 3K8LA 4EAMA 4GQRA 2ZXQA 2E0PA 1UKTA 3UETA 3W29A 4P7QA 1WDSA 3WUEA 3SEPA 5D4YA 4W8BA 4NF7A 3L4YA 1EQCA 2E9BA 4J3XA 5M17A 1R8LA 2GK1B 1NP0A 4IUGA 1A47A 4JHOA 2WYSA 2YL5A 3ALGA 3BAKA 2WWDA 2CHOA 1XHGA 1EGZA 3AXXA 3U7VA 3UG4A 2O9TA 3QGVA 3SUSA 4EKJA 3HN3A 2A3BA 5ECUA 1V3IA 3HU7A 3CIVA 2DIJA 5A6LA 1M53A 5HBFA 5AC5A 3SUUA 3CGTA 3CBWA 2PWDA 4OBSA 3F5LA 5E6ZA 2UY4A 4XV0A 2VL4A 1E71M 3MUY1 3WBEA 1NQ6A 3W27A 1W9UA 4F66A 2O9RA 1UR8A 3A4XA 2CXGA 4LX4A 1C7SA 1E55A 2YBUA 1BG4A 2YKKA 4QFUA 1VEOA 1GCYA 2J25A 3CZEA 2W5FA 1KR0A 3WELA 3BAYA 3WD3A 1FFQA 5M3WA 3SCSA 1FFRA 2C0HA 3ZO9A 3MU7A 4DUWA 1TZ7A 2J8FA 2WHLA 1CWYA 5FL0A 4ZEPA 3L4WA 1DWHM 3BMWA 1W32A 2WHMA 1E6RA 3S6TA 1EIBA 3I3EA 1ISXA 1OSEA 3ARPA 1GVIA 3K4DA 2DH2A 1CECA 1UWRA 3NYDA 4GQQA 1E0VA 4AZCB 2WC4A 4P8XA 1JDDA 2ZUNA 4CUCA 3W81A 3WQ8A 5E0FA 1O6IA 4UQ9A 4YHGA 4QDMA 3L4UA 3WL0A 1V02E 5HOSA 2RGMA 4LGXA 1JAKA 2D2OA 4HPGA 4GKLA 5BXTA 4PTVA 5CPTA 2CEQA 3CHFA 2UY2A 1KGUA 1NOWA 2BVTA 3T2PA 1WDRA 3KEHA 1BVNP 3OLEA 1ZU8A 3VD5A 2YL9A 1MWOA 5JBEA 2X1IA 4KRTA 2NT1A 1ISYA 4XUYA 4QCFA 1E5JA 3CLWA 3VUPA 4J7RA 3WEOA 4GZJA 1JF6A 4H8VA 3O9NA 4JFVA 4AZ6A 3SCTA 2J8GA 4AIOA 2YIHA 4CCDA 1W3HA 2YJQA 1HT6A 4MB3A 3WD1A 1RD6A 4ACZA 5F7UA 1QOXA 5BRQA 3IK2A 4ZE5A 1ITCA 4C7GA 5JIWA 1CXHA 3WDRA 2D22A 1PPIA 4E8DA 2D23A 3WDHA 1FOBA 4P7NA 2JEQA 4IM4A 1VB9A 2OSYA 1VFUA 1VBUA 2W63A 2V3DA 4FLSA 4AD3A 4P8WA 4B9ZA 4JKMA 2EPLX 4WK9A 1H3GA 2FH8A 2NT0A 4PMUA 4F9JA 3OG2A 5EB8A 4AW7A 5CJ5A 4MAVA 3PZNA 2O9PA 1BGAA 4C7FA 1MQRA 3VVGA 1ECEA 3W26A 1RP8A 1PIGA 4U3AA 4UOQA 1OINA 4UFKA 3ZT5A 1RH9A 2XVNA 4H7VA 1M04A 1CIUA 1XD1A 3AS2A 5A95A 1EXPA 4W5UA 1MXDA 5I3DA 1QI0A 5I23A 1OGBA 2QPSA 6CGTA 1KCKA 5I5RA 1N82A 1JDAA 1E70M
chains in the Genus database with same CATH superfamily
4UIOA 3QMTA 2FVMA 2A0NA 3A13A 3H7VA 3FK4A 5TD4A 3EA2A 4MWAE 4B5SA 3EA3A 2FLIA 5I24A 1F4HA 2YGYA 2DVUA 3POCA 3ITCA 1OFRA 1QW7A 4JTLA 6ALDA 4IXXA 3GKFA 3JRKA 1CGXA 2PDNA 1A49A 4CLMA 2GJXB 1QO5A 1R87A 3N9KA 1KRBC 4AIUA 1LG1A 1B57A 1POJA 3QR3A 3V1HA 5EBUA 5LIUX 2P0IA 3HGSA 3SURA 1TWZA 3NSMA 5H8UA 5C9RA 1NH6A 4UTUA 2P53A 1TJ0A 3LN3A 4PTWA 3MI3A 1UMYA 2VELA 3MKCA 2Y85A 1MW0A 4DUXA 2WJZA 3F5KA 1B5TA 1EPVA 4UCFA 4HT3A 2WNZA 2JKAA 1EEPA 1VFHA 1NOUA 2XFWA 4IHCA 3T4CA 2JF6A 2YR1A 3P60A 1ZL1A 2QNEA 5DMYA 2R1NA 2ZZ1A 3DFSA 3GTNA 3ZOAA 3CL7A 2DT3A 4EK7A 1OF6A 3GTIA 3IRDA 2C13A 1YE6A 1JNDA 1HIZA 1JCLA 1UWAA 4JTHA 2FFIA 3HQNA 2OYLA 1LOLA 3LTYA 2BGNE 4ZOEA 1US2A 3CJPA 4BZYA 2EKCA 4S2CA 4ZTXA 4HPNA 5DX7A 3W1QA 3QF0A 3REQB 1THFD 3KX6A 5D8ZA 4XZIA 4C6NA 4QISA 3UXDA 1H5YA 2DZWA 2AQOA 3AROA 3DX5A 4H8UA 3WH6A 4DNMA 3PTMA 5CC7A 3IIXA 3G1FA 3GH5A 4PTDA 3LERA 2FMOA 4MFDA 2ZXAA 2ZXBA 3EAUA 4YLWA 2QEZA 3B8TA 3DI1A 3EDJA 4A22A 5CSUA 3WX7A 3HQ1A 5KSWA 3LBOA 1I8JA 3AU2A 5DMLA 2FVKA 1WQ5A 3RX3A 1XJBA 3UR2A 3W70A 4PUNA 4JR5A 2VJXA 4O10A 2CERA 3BV7A 3KW3A 2QVHA 3VNLA 2BY0A 2WMIB 3G77A 3W7IA 1TA3B 4PN2A 2JFEX 4O1BA 3MO4A 2V5DA 2AQVA 1MDRA 3CHCA 4IMCA 3URBA 1VR6A 3SQSA 1Z41A 3WJSA 3C3NA 3TNBA 4HPHA 4QIUA 1Q66A 4O18A 3PZGA 3H70A 1P0EA 1E6QM 2XSXA 1QWKA 1XIDA 3R43A 4U33A 2H6RA 4P8VA 4EOUA 2QVNA 5T9CE 2Z1SA 2X1UA 1YRRA 1NWUA 1GOQA 1JI1A 3THQA 8A3HA 2Q09A 2V68A 2AAAA 1BKHA 1YBQB 3SCNA 1JCTA 1TWSA 3BLFA 3NQCA 5DT5A 2G8ZA 3IGUA 5CLWA 1M9HA 1AQMA 3GG7A 3KRUA 2NZLA 3WMCA 3PG9A 5ABEA 4CEUC 2XWEA 3UY8A 3AQUA 3BO9A 1FH9A 1YW1A 1BSLA 1JQXA 3GXNA 1V3MA 1W5QA 4R27A 1WUEA 3S2NA 1S5TA 1EWEA 3W71A 1LF1A 3AMCA 1HO4A 3IWPA 3VNZA 4TVCA 2NQLA 1SM9A 4W4QA 4URIA 4PCSA 2PGWA 1R0MA 4UTKA 1VH7A 2VHLA 1FWJC 7XIMA 3PHAA 4US6A 4YCOA 4W8LA 4IQLA 4EE9A 4O0KA 3AIBA 3PB2A 2Z29A 4M80A 2BTMA 1Z6KA 3WH8A 3D0CA 1WZMA 1VPXA 4YXGA 3G6MA 4J40A 1PHWA 4HCDA 2PD5A 4O4WA 2VZTA 3MMUA 1GVOA 1OIFA 3N3TA 5EGRA 4Z2JA 4HHPA 1ZLPA 4C6PA 3OGSA 4WJXA 1X96A 1F6YA 4C6OA 3SN4A 1MEIA 4N2YA 4LC6A 3C0JA 3ITOA 5A6MA 3QV7A 3U0HA 5CPSA 1REQA 4P8UA 2NLYA 4J28A 2VZOA 4Q8WA 4MJMA 4W86A 3BE7A 4D9PA 1KWKA 1XCXA 3SAZA 1HXJA 1KCLA 1SFTA 1JDEA 3BLDA 4CD8A 2X40A 4BQ3A 5PTDA 2PDGA 1OFPA 3FHAA 1GHSA 4B5TA 2ACRA 3BG5A 3MZ2A 3TW6A 1K8ZA 2XU2A 1XYZA 3A22A 5BOOA 1LT7A 1TFVA 2ZUTA 4QQ3A 3SGZA 2C15A 3T42A 3UPMA 3DESA 1PKLA 2IUZA 2FHCA 2Q01A 3EKGA 4JDYA 2E9LA 2FPYA 5LYRA 3OJGA 4V2XA 3JU2A 4PSRA 4UQAA 3Q58A 2PDHA 1DXFA 3A21A 3TYAA 1TREA 2CZ5A 3XINA 3LHTA 1KBIA 3I7RA 3IIZA 4ICNA 2GUBA 1ZB5A 1PSCA 3BQ6A 5HMEA 4IMEA 1O5KA 1GVQA 3DGRA 1QFEA 1WA3A 4WOZA 1XCWA 1Q6FA 4GD0A 3DAQA 3WFZA 4GLEA 1PX4A 4J3SA 3NIYA 3QOMA 5ECVA 3KRZA 5BXPA 1J4EA 2W0UA 4B16A 4D8LA 3WY1A 2WVTA 1B3YA 2ZXDA 1TR1A 4XD4A 4DX3A 5CQ1A 4W89A 2NX1A 4K1GA 1KM2A 3UNDA 2PDBA 2VMFA 1W54A 3FYYA 4MSSA 3KZSA 1JL8A 3T05A 2PS2A 2R94A 1BXNA 1TMHA 4KRZA 4TMBA 3VD4A 3RUBL 5D09A 1E4LA 2XYLA 3LHVA 2BHUA 1OCNA 1UG6A 3O0FA 4S3CA 5CSRA 1ODUA 4S3EA 4Q7BA 4H04A 4CCCA 3OZPA 2WNNA 3RR4A 1TKKA 2QPXA 4NY2A 1XSKA 4HPXA 3BICA 1CXFA 2J78A 4LF2A 1XRTA 4DAFA 2E28A 2XVGA 4N9BA 3TXVA 3B8VA 2EKGA 3MW7A 4JYFA 1UR2A 3L2LA 4IOTA 2RAGA 3UNTA 4F2TA 4LV4A 4ORIA 1OK4A 1AD4A 3RM4A 1KBKA 3ARXA 3GXPA 4S1FA 2J75A 3TJLA 1KQZA 5G5IA 4I9JA 5BXSA 2WSPA 4S3BA 1EQPA 1FHLA 4MUPA 4R34A 4HTYA 3T09A 1OZMA 1WYIA 1WOBA 2EQDA 1KB3A 1GKRA 3NOEA 3W0KA 3KRBA 4GPNA 4C1LA 3R94A 1RBLA 5GQBA 1S38A 3E49A 3KOYA 3EX4A 3WMBA 3NL2A 2WCGA 1UR3M 2DJXA 3U4AA 2X1TA 2OMAA 3WD4A 4C6EA 2DSUA 3LPGA 1V0NA 1O12A 5I3KA 4C5YA 1KM0A 1QPQA 3GXDA 1TV8A 1EKOA 4LCRA 3GW3A 4WKFA 2HCVA 4UTMA 5C70A 2ACQA 3MP5A 4AHPA 4ZFCA 4FA3A 4PTXA 2VOTA 2V3FA 4ZOCA 5CZJA 3VIHA 4BQ5A 2E67A 4O4VA 3EDEA 3WF2A 1VEMA 1IIHA 4POCA 1EGVA 2ZICA 4YVVA 3UWYA 3I4EA 1HJWA 2HBXA 3VC5A 3WD0A 1R38A 3N15A 4NX0A 4ZCWA 2PDFA 3UWWA 2DORA 2IKHA 1GORA 3CASA 4B91A 1EC9A 1OYAA 4XKYA 4WQ6A 5TBOA 1XLFA 4UMCA 3EGJA 4QG8A 2PUZA 4D6DA 1ONWA 1W6TA 1ZBWA 3WK2A 3W1TA 1C8YA 4D6HA 2OEJA 1HJSA 3MZNA 2BWGA 1W0MA 4CU7A 2ALDA 3LPPA 4HSHA 1W8SA 4N7QA 4EPKA 1K3UA 1K7FA 1GOKA 1OX6A 4AZIA 3KHJA 1QBAA 5I06A 4UNKA 3CMFA 4F9DA 5FF0A 1BFNA 3N6QA 1L2QA 2WK2A 1YDYA 1P7TB 5K9XA 2QCHA 2ZIDA 4EX4A 2VVSA 3WDPP 3QSTA 4R85A 3NSNA 3LYEA 1I1XA 3SUWA 3A64A 4PUJA 1CW2A 1UD4A 4KWUA 3IEBA 2GQ8A 3MMWA 3ZJ6A 1XKJA 3P7YA 3NXFA 1E6NA 4K6AA 1M6JA 3BAJA 3VKBA 5JH1A 5FKYA 1CBGA 3CLMA 2CETA 3I7SA 1CXIA 1DHKA 3OLIA 1R3SA 2AGKA 4K38A 1OX4A 1H50A 3WLIA 2QJJA 4PB3A 1W2VA 5CPNA 1HKMA 1JYNA 1MFUA 3UR5A 5CSYA 1QDSA 3H2NA 1EX1A 3RF9A 1KXTA 4QHRA 2ZUWA 5AB3A 3VX0A 1JQVA 1C8XA 1XR2A 3A6OA 3VNJA 5KETA 1C3FA 1V6YA 1FKXA 4TVDA 3T8QA 5DF0A 3MT1A 4UZSA 1A4LA 2BFGA 1RSCA 3KP1A 3WH7A 1H09A 3ZWTA 4ADTA 3IVSA 1MVYA 4JAWA 4NZ3A 3C2VA 1GOMA 2PTWA 3HG5A 1O60A 4GISA 4IISA 1RJPA 1GYNA 3C8FA 1O7AA 1EOKA 1XGZA 1YXDA 1TVPA 3HV8A 3R6IA 4JHZA 3VIKA 3VDGA 4JFTA 3UWEA 4ZVJA 1HNYA 3GIQA 2PC8A 3OYZA 3RX4A 3S9YA 1YHTA 4HA0A 5HR6A 2V38A 2ZX6A 1W3LA 1OYBA 2YDAA 1TV4A 4HQVA 4O1AA 4JEQA 4OFCA 5BMXA 4W7UA 1M7XA 3N4AA 3WBWA 1QI3A 2ZZ5A 2Z7GA 3AMKA 2F6UA 1CGUA 4PCPA 4ATWA 1QNRA 2XUCA 3LD5A 5DCBA 2KZHA 3TOPA 5DBTA 3PM6A 2ZYFA 1R3YA 3PY2A 3NVDA 1R3RA 4RE0A 4YYCA 4JTSA 1DQWA 4FR6A 3M0XA 3C86A 3T7VA 1B3WA 1V6WA 2FYMA 1H7NA 2H3BA 4PRRA 5EMYA 3WQ4A 4IPNB 4UTHA 2OU4A 4KFOA 4H7CA 3CZKA 1JZ3A 5CPQA 1WUFA 4IX0A 4I3GA 2GK1A 5J5DA 3PWAA 1FHVA 4JTRA 2CESA 4ZB0A 1DIKA 4EWJA 4ZOAA 1K9FA 4MJZA 1VRXA 3WDIA 3QHOA 1RJRA 4HZMA 4Z2IA 2WBKA 4UQDA 1A4MA 3VOGA 5DEZA 3AZTA 5DFAA 2D20A 3MMDA 3KWXA 4HHLA 4XZNX 3Q45A 1F7BA 3ARTA 3OVPA 3VKCA 3ZR6A 5BMWA 2VT0A 2NV1A 2BBFA 2Z6JA 4Q8TA 3LQLA 5CJMA 4WSJA 1KKOA 2XSAA 3M0HA 3P67A 4H9TA 3MDUA 1NF0A 1A80A 3FA3A 1PAMA 3QW4B 5E09A 2QAPA 1WDPA 3MCMA 3KAOA 1KQYA 1XPGA 5XINA 3W75A 4QTGA 2GVEA 1JYVA 4DO6A 1KWGA 3THDA 1C29A 1JF5A 3OIXA 1IXQA 1GJWA 1PEZA 1NDZA 2POZA 4RE4A 4Y9OA 3MMTA 3ITGA 2VOMA 4JN8A 1A5KC 3GU9A 2IMRA 4PUKA 3W1PA 2QJGA 3MHFA 2Y5JA 4E2OA 4H1ZA 5BRPA 5M5DA 2NWRA 3LXCA 1NWSA 3USZA 5I3FA 2VDHA 1FWHC 5DY3A 1OC5A 3F4DA 5HJYA 4GVFA 2OSXA 3RCNA 1Z7AA 3OTRA 3VI2A 3N2XA 3WMSA 1CXLA 2X30A 3RITA 4GKTA 5G2WA 3VM5A 2J7CA 4CU8A 1PUDA 3B9EA 3SCRA 1AVAA 1TV2A 3SY5A 3R0KA 4N02A 2VX7A 2QV4A 2WLYA 3UCCA 1UPMB 4XBKA 3W86A 4Q8VA 2NUXA 5D04C 1VCVA 1VCGA 4JIIX 1KCXA 2CFFA 3G1RA 1JJKA 4A2RA 1UKQA 3GR4A 2MUCA 4TUFA 2BY1A 3SCPA 2Q6ZA 1HJXA 4OHQA 4IG2A 1W8GA 1MW2A 1EZWA 2P5NA 3TOYA 2PLMA 2I17A 4DXKA 3HV9A 1DJIA 2DJLA 5CJNA 1U33A 5JBFA 3S2JA 4WSKA 3BLEA 4UFIA 2QDEA 3AHZA 4RR4A 4FNPA 1AL7A 3H7RA 3C0LA 5CG7A 2Y24A 2XM1A 4IP7A 4LEQA 3LGDA 3W72A 4RXFA 4DF0A 3FGCA 4L6DA 1KM1A 1H4PA 2VD9A 4KCWA 3RCYA 1SFLA 3VX1A 5ENLA 3BZGA 4Q4OA 2W61A 1JFXA 1W9BM 3SQLA 4UFMA 1B3ZA 1P43A 3QHMA 1Q7ZA 1XW8A 2PC4A 2CPUA 4R33A 1M7OA 1PTGA 1K02A 4HYRA 4B4HA 3FNDA 2O4MA 2HS6A 2AKZA 1OGGA 1F3WA 1I0BA 5FSEC 1JULA 1F4AA 3AS0A 3NQGA 4MFEA 1GUVA 1GK8A 3CUHA 4UTFA 4ICMA 3GLCA 4LUJA 3SJ3A 4QDPA 2EO7A 2GQ9A 4NYYA 3B04A 2WKLA 4V28A 2KX9A 4WLCA 3P3BA 3BLOA 2E6AA 2Z1VA 1XD0A 1UOZA 1YTDA 2GOKA 3M43A 1LP6A 5DLCA 3U4FA 3AICA 4WY0F 2QT3A 4OBRA 3GC4A 3E5PA 3CEUA 3WMLA 1LRQA 1XBYA 4R7JA 2DSZA 2WNWA 4LANA 1IR2A 1FDZA 3E5BA 3U6WA 2VEGA 1V3HA 4UR9A 3RJXA 2ZC1A 4WGHA 1TCDA 2B31A 3JUGA 5HULA 1J6OA 1IV8A 3HURA 1GKQA 1XDMA 2V63A 3PJWA 1UWUA 4TX8A 1A5SA 2QW5A 2V5KA 4RDWA 3FW6A 4IIEA 2VRKA 1AUSL 3QGAC 1ZP3A 2I5QA 3KE0A 3CO8A 3OGVA 3CO4A 4JTUA 1JZ5A 4GE8A 1SW7A 1RQEA 5U4NA 4MLRA 4BI6A 1J0ZA 3FYPA 5J5RA 4AZHA 2GUYA 1UIOA 3JZUA 4KEMA 2BG5A 3L0GA 1CGWA 3WQ6A 5M03A 4N9EA 1TMQA 3W1RA 4XVEA 3LHZA 2GGHA 2XZ9A 2XPKA 2PDPA 3MSDA 4M1BA 3E0LA 1VFTA 5I00A 1KA9F 1L6SA 1F3XA 4FHAA 1U2YA 3VGDA 5ABFA 4F0HA 1OADA 1W91A 4UMAA 2Z2UA 1CXKA 2VO5A 3CV6A 3FXGA 4MNMA 3AISA 1SFSA 4LYPA 4S38A 3CT7A 5K9CA 2Q8LA 4FS9A 4Y6GA 1LZOA 4YTTA 1TRDA 4UQEA 4Q8QA 1QNVA 4YWSA 2I56A 1E6SM 3ES7A 4NUWA 3LRKA 4GQ0A 1PTDA 1TSIA 2FFCA 4US5D 3MSYA 1KTNA 3PBGA 4IIHA 1GZJA 1E43A 2HBVA 4HMNA 3ID7A 2GL5A 4UBPC 2EPOA 1Z3NA 2IPGA 3FIGA 5AKQA 2XIOA 4JEJA 3HO8A 1A5NC 3H2CA 3LSBA 3TCEA 1AD1A 1V03A 2Z25A 3CV1A 3MC5A 3RX2A 2XIIA 1T6MA 5C54A 1XIJA 3K5XA 1ONRA 3WQFA 4RV3A 3IJLA 5DXXA 4M19A 1JGIA 2WZIA 3K8MA 2QIWA 4WUIA 3PBUA 4H83A 3PJUA 2Q3RA 3FSTA 4Y96A 4GUJA 1XIHA 2B7PA 4CEXC 5KZ6A 3QMRA 3LXAA 4JFSA 4E6MA 4GJ1A 4HU8A 3CQJA 5A8QA 1E15A 1H41A 3LNMA 5FCZA 4CN4A 4UQBA 2HE5A 3FFSA 1DEDA 1UZ1A 1QI2A 1PX8A 5LA1A 4NRRA 1R3QA 3UZZA 3VCCA 3FHQA 3LPOA 4L1XA 2G95A 5HK4A 4YTUA 2HMCA 3NAVA 3QYSA 3QFEA 4HNNA 4IJCA 3IJ8A 4DQWA 1G5AA 4EF9A 4MGGA 4L9ZA 4NT0A 1VAHA 2BXZA 3FJNA 3GM8A 4QGCA 3RAOA 4BKNA 3NL6A 2VFHA 1PYMA 5CEWA 3F4WA 3WH9A 4WDXA 1ONXA 3M0MA 4RNHA 2VX4A 1SZNA 1U5VA 2PDWA 1J5TA 2WVVB 4FNTA 1LWJA 3NDOA 5AVNA 2D1ZA 3PZUA 4MZ1A 2CLOA 4Q7NA 2J7GA 3OYXA 1E3ZA 3F4NA 3M0VA 3OLDA 3M7WA 3S9IA 3WN6A 4XZBA 3NZPA 4N4PA 3W1LA 2J13A 5BZAA 3WNNA 3TQVA 3I3DA 4DO5A 3OA5A 1IXNA 3CUFA 1WXZA 5C7VA 4P61A 2Y7DA 3URAA 1X6UA 1A3XA 5LHFA 1SYTA 1T99A 3F4VA 4HOWA 4V1XA 3R5EA 1TB3A 1TJ1A 3SFWA 5A6BD 3A3HA 2A3HA 4L1WA 1W1A1 4NVTA 1KR1A 1PJ9A 2DUZA 3C6CA 2AOSA 1AZ1A 3SRHA 3WL1A 1PL9A 3C2RA 4MB5A 3KZPA 3TR2A 4ZQOA 2OZ0A 5JVLA 4HU3A 4C1NA 1AMKA 2ZXQA 1FCUA 4AY8A 2E0PA 4ERGA 4P7QA 1WDSA 3WUEA 1XS2A 3LCHA 3B0XA 4RNFA 4NF7A 1JCMP 3GNXA 1XLKA 4GY0A 4AEOA 2E9BA 1SJAA 1NP0A 4IUGA 1A5UA 5AVHA 2EGZA 4WZHA 3VXGA 4JHOA 2WYSA 3BAKA 1K77A 3VK5A 3AXXA 3U7VA 3HN3A 1XIGA 2YPIA 1JUEA 1WBHA 3SUUA 4LAZA 4R88A 3CBWA 1DJYA 4OBSA 7ODCA 1R3WA 4O57A 5E6ZA 2UY4A 4JIHA 4HNOA 2WSYA 4XV0A 4LVGA 3MBDA 1NQ6A 4QNEA 3A4XA 2A6LA 3PPHA 3LV5A 2CXGA 3BCJA 4QFUA 2YKKA 1GCYA 2QAFA 2PDYA 3W1UA 4CQDA 3WD3A 3QQ0A 1AW5A 2A2IA 4QQUA 3U2OA 2C0HA 3MU7A 2Q8ZA 5LNRA 1TZ7A 1CWYA 5AHEA 3L4WA 4K37A 1PZ0A 3BMWA 3SI9A 3ANVA 1E6RA 1LM1A 3P5YA 3I3EA 5HWMA 2WQPA 2OR2A 1F07A 2DH2A 4GQQA 2YX0A 1ZTVA 2NSOA 4AZCB 3E0IA 3MWAA 1JDDA 2V8ZA 3N14A 5E0FA 1YYAA 3KLLA 5EY5A 3UG8A 3N34A 3F2DA 1BWKA 1KV8A 4PR4A 1W3IA 5CPTA 3CHFA 2UY2A 2V5JA 1F73A 1LUCB 3QSRA 3TJ4A 1MNSA 1WDRA 3T2PA 4HTBA 3NEHA 1ZU8A 3LENA 3NURA 2NVDA 4MY9A 4KRTA 2NT1A 2X1SA 3BURA 1L6GA 4J7RA 4B5WA 1JF6A 1YPIA 4UCGA 4A8RA 3O9NA 5HUPA 1TZ9A 1ITQA 4F2BA 2YIHA 2QCDB 4CCDA 4ADUA 2YJQA 5DELA 1HT6A 4WXZA 2HXUA 4ACZA 5IM51 1T40A 5F7UA 1QOXA 3IK2A 4NZ5A 1XF0A 4QRNA 4XWUA 2D22A 4ZO9A 3UPWA 3QZ6A 3GKAA 2PWVA 3GC2A 3UZWA 3LUTA 3G0XA 4AH7A 4IM4A 3W84A 1GW9A 1VBUA 4QE5A 1LWIA 4KETA 3GQYA 1XINA 1ME7A 3PJXA 4PMUA 1FWSA 3A3XA 5EB8A 2A4AA 4AW7A 5CJ5A 3W7QA 1TTIA 1AODA 4NJKA 2ZADA 1FWWA 1TPWA 1O5XA 4C7FA 1UJQA 1PIGA 4U3AA 1GWJA 1OINA 4L6OA 2PDLA 2I1OA 3ZT5A 4G2DA 4WDWA 1M04A 1QPRA 1XD1A 1TPVA 3AS2A 3IGXA 4IL0A 1MXDA 5D33A 1OGBA 3TXZA 4FX8A 2YCLA 3ITVA 3N6HA 3RMJA 3DEQA 5I5RA 3F03K 3QM3A 1BKSA 3HB9A 4AHOA 1XWYA 2NUWA 4FO4A 4HHHA 1S46A 1SZEA 2ADAA 1G4EA 4QCEA 1DWAM 1WBJA 3QV9A 4IPJA 1V02A 2P76A 1OCJA 4HP5A 4QE4A 3SUTA 4C91A 3MA8A 4HB7A 2WCAA 1W3TA 3TFXA 2IXUA 1GTEA 5JQ9A 5AN7A 3STGA 1P48A 1UA7A 2DZUA 2PRLA 3OP2A 3DGBA 5A2CA 1E5NA 2PSNA 1F3EA 1D7FA 3TH6A 2X41A 1M01A 4XAGA 3V35A 1VKFA 1VS1A 5AYZA 3TE9A 1H0GA 4RL3A 1GW1A 4AUBA 4TV5A 3W76A 4IP4A 1LBMA 3B9DA 1GQNA 1FCQA 1E6XM 2WOQA 3TNOA 1G6CA 4ENLA 2VQUA 3CHEA 4OUEA 3E2QA 4HKPA 4JNYA 4IT1A 4AQLA 2J77A 1V6XA 2XGBA 4U2YA 5H6HA 3BDKA 3U3HA 1CI1A 4J2PA 4WF7A 1MQPA 4WDTA 3HPFA 1ZGDA 4J3WA 3AHYA 2FQIA 3IVTA 5F2MA 3KVJA 5IOBA 2JIEA 4J3UA 4I8YA 1W56A 1KLZA 4CNSA 4BK9A 3NO1A 5FF3A 4R7WA 2QDHA 4K39A 4BEQA 5LGZA 3QBUA 3WQ5A 1DJGA 1RY8A 1SW0A 1PZ2A 4TV6A 3EPMA 3M5VA 5AC7A 3TP4A 3OZMA 3FEMA 4JTTA 2F2HA 2PWFA 3GHTA 1TUFA 4LV9A 3L5AA 2PDCA 3FKRA 3RMEA 3WFLA 4HMDA 2J9YA 4QG6A 4PMQA 3ISIX 3W2JA 3KP0A 1FCBA 4EAYA 1ZQ5A 3S8HA 1OCQA 4MWAA 1DKWA 1DIOA 3O0KA 1HP5A 1K8CA 1E0TA 1ISWA 1FKWA 4Q6XA 2WMJA 5IDZA 3VABA 2Z1XA 3ENLA 1VBGA 2YA2A 4N0RA 5AHMA 1TG7A 7ENLA 2ZRXA 3IACA 4F79A 1YXYA 1EF2A 4AZGA 3SFKA 3ABZA 3TW9A 1EJWC 3CQIA 4DHGA 4AU0A 4Z2KA 3KXQA 1PKYA 4WVXA 3SY8A 3AMDA 2XIMA 2BVWA 2CBJA 3KDOA 5I3GA 3ZR5A 4JIEA 4I6VA 1B30A 1XM3A 3LTSA 4O14A 1LROA 4M7SA 4FSAA 2W67A 2QYGA 3T78A 4NI3A 3AZSA 8CGTA 4ZMGA 1UP3A 5KEZA 3M7SA 1UZ4A 1E1CA 3OVRA 1Y7VA 2UBPC 1AW2A 4FLRA 2CLMA 4LC8A 4PODA 1SSDA 2J4GA 4GMEA 1OD8A 2PF8A 1OJXA 4YVPA 3CNYA 4CQ9A 1TO3A 1S39A 2OLAA 1HUVA 2RDXA 4H6EA 4E38A 1CGTA 3BLIA 3S2MA 3VFCA 1TWDA 4PRWA 4DNHA 3BOXA 4LB3A 1ISZA 5JH2A 9RUBA 1EJ7L 2BOGX 4AHQA 4H9MA 3QZEA 1Q2RA 1S2CA 2V2DA 4UR8A 3TAKA 2C0AA 2RDTA 1Q6OA 3T40A 1K8YA 3AWNA 2W4XA 5FJRA 1JYXA 5LHEA 2BVYA 3C2FA 3H23A 1EBHA 3D3AA 3PANA 1F3TA 4Y9MA 2J7EA 3V75A 2WMHA 2B7QA 4LUYA 3POHA 5ABHA 4FP1A 3HIJA 1S2UA 1R3VA 4JTIA 4KEUA 1XC4A 4IGSA 4RZ6A 2Z2AA 4REQB 2Z6IA 4JX4A 4ZO8A 3CTTA 2ZDSA 4FEZA 4LAUA 4UTWC 5CGQA 1A0EA 1PV8A 4G7EB 4YN5A 5HMSA 4FXRA 4YNGA 4NIRA 4Z1AA 3BMVA 4Y8FA 3UWZA 3JR2A 4QLLA 1TMLA 4NRSA 2FTPA 4W9TA 3DYOA 1YDOA 3QKEA 4RK8A 2REQA 5GJPA 3GDMA 1KRMA 1ODZA 3C2EA 3VMPA 3KBJA 6ENLA 3S3GA 2ODOA 3GH4A 3VKDA 3WJZA 4ZO6A 1QXLA 4LALA 3I6TA 2EG8A 4EWND 2QDGA 4A3YA 1XFBA 1DTUA 1UD3A 3PB0A 1DQXA 1V0LA 3EBVA 2J27A 5GNZA 3FEQA 3GU1A 1VFSA 3ZWSA 1ZCOA 4A2SA 4HOXA 2UY3A 4M29A 4UXDA 2I14A 1M7PA 3TSMA 4A29A 2QUVA 3ITTA 4AWEA 3GTFA 3N2BA 1I1WA 4D6JA 1ESWA 4NNBA 4QP0A 4U28A 4Q7IA 1UBSA 1US3A 1DQUA 1IHIA 2ZRWA 3CL8A 1SUXA 4X61A 4MUZA 3OEXA 5FD0A 5C7HA 5I79A 5B7ZA 3W38A 2ISSA 2E9MA 4X9SA 3TCSA 3NOYA 2FB3A 1UWSA 4AD4A 2Z24A 3CQHA 3NNTA 2CLLA 3LGGA 2NV9A 1I2PA 1CZ1A 3VGFA 1FWRA 1HKKA 2XWDA 4W7VA 2PDJA 4L4LA 3CTLA 3LA4A 3P8IA 1KXVA 2BNJA 3MUCA 5A8GA 3V7PA 3ITXA 3O6CA 1WKYA 1BVWA 3SW6A 3GO2A 2AKMA 4WY0B 4AF0A 1W37A 3GTXA 3GVWA 2JGQA 2CLIA 2Y1HA 3CC1A 1MYRA 1LBFA 2TODA 2G4JA 1JFHA 4AVNA 1UHVA 2OZ8A 1J8VA 3P0WA 1I60A 1SMDA 3TVAA 1V93A 3PZIA 1NM9A 1EH9A 3DH7A 1SVDA 2HNHA 3MSGA 5CSSA 1PCWA 1JXKA 2E25A 3THAA 4OBTA 1V7YA 4CNUA 3DHUA 3TROA 1NARA 1IWAA 4D6CA 3WH5A 2WHKA 2C8NA 5C71A 1C9WA 2F2KA 4CVWA 2OWXA 4X2PA 4GQGA 1Z42A 3P84A 3GZAA 1KRAC 2B0MA 1ZALA 4GVIA 3S5ZA 2VVNA 3NXLA 3M5YA 3ZVHA 1XIBA 3AXHA 3HGOA 2W3ZA 2OEKA 4GIRA 2E8YA 1XXXA 3W2LA 3UD6A 5HNNA 1XLMA 3WF0A 3WBYA 3DG3A 4H9ZA 2QUTA 2EPMX 2G3NA 1XH1A 1DL3A 2C18A 3TIMA 1H0IA 3NJ3A 3BSHA 3W1AA 4LUTA 4G8TA 4QXIA 2OQLA 1G7UA 4AVOA 4JD4A 4UFJA 2HTMA 7PTDA 2DIEA 4JN6A 3DZ1A 4JNMA 4NJJA 2EBNA 3E3HA 2CWNA 1VENA 2XIJA 3UP8A 1RA5A 4TIMA 1W17A 1HVQA 2VZUA 2DSKA 1I2NA 5CGTA 1Q6RA 2EJAA 4QLKA 4X22A 4NAEA 3FXYA 1UCWA 1QNOA 2XIQA 4IZGA 1C8VA 5C55A 2PGRA 2CIPA 5IHRA 3PBMA 4AXKA 1XUUA 2VZVA 3CAVA 3R8GA 3VKKA 4Z2LA 2BSLA 2P8BA 1U83A 4A21A 4HZ8A 2JE8A 3M9YA 1TQXA 3BK0A 4GH3A 2R14A 2DT2A 1A3HA 1X98A 2VYOA 3DFTA 3GAKA 4HYWA 3RO8A 6TIMA 1BYDA 3URQA 2XFFA 1K6WA 1YTKA 1IEXA 3C4UA 1WCGA 2V5CA 2WC3A 1W5OA 4EXAA 3EDKA 2C3ZA 1B3VA 4TX9A 2QPUA 2PE4A 2YXGA 3RLUA 1JD9A 4KF1A 5BWFA 4AC1X 6PTDA 2R1PA 1H2JA 4EXBA 1VRDA 2ZZ3A 1JPIA 3S5NA 1LJYA 5LZLA 3DFNA 1J10A 1ZUAX 3MB9A 2V9DA 1CX9A 3RRAA 5D9MA 5HWNA 2I5GA 1ZJAA 1VFOA 4AD0A 1KM4A 1DORA 4M81A 2XVLA 2GZXA 2GGJA 1V6TA 4FI4A 2QCFA 9XIAA 3GNPA 2E1WA 1H1NA 1BF6A 1VCFA 3IIOA 3T0DA 2FGZA 1ME9A 2QXWA 2F8QA 3FKKA 2ACSA 4DLFA 2CZFA 2W62A 2XVPA 3OOQA 2GVLA 3A23A 1X7FA 4MG4A 3WKZA 4A8NA 4LF1A 3S5SA 1FVPA 3I6EA 4B3LA 3IGSA 2NQJA 1F9CA 1UB3A 5EMMA 3B0YA 3S1XA 3ZXWA 1ZBCA 2Z1WA 3EOEA 3VOIA 2E6FA 3UWUA 4NSBA 4N42A 3NCOA 1M03A 1W9PA 2Y5SA 3OVQA 5K7JA 5C2XA 1DJNA 3IJ9A 3ZLGA 4MY1A 1H11A 3QH2A 3ZVIA 1F8IA 3S2LA 3AJ7A 4GX8A 1HKWA 3W7JA 3M16A 4GG9A 3S0CA 3MQTA 4G9PA 1TV3A 4RXGA 4WKAA 2A7PA 3UXKA 3O6DA 3VIIA 3QGKC 1H63A 3BJTA 4O1FA 4QX4A 1MFVA 3EOOA 4LQ1A 5BROA 1YADA 4XAYA 3UYIA 3PNZA 4PZVA 4KMQA 2VR5A 2XH7A 3UGRA 3CHVA 4UWMA 1VIWA 3HJEA 5HANA 2CW6A 3QOKA 4NAFB 4OQVA 4E3VA 1FWAC 1UW9A 1R2RA 1J2WA 6A3HA 3BTNA 3H2OA 3RLVA 1ECQA 3S2CA 3H6OA 3UZJA 2QJIA 1POKA 3CYJA 3UFYA 1AQHA 3VOJA 1D7KA 4HZ7A 3BW2A 1NTHA 4H19A 3GXIA 1QHOA 3Q4DA 1LL6A 2L5HA 1EP2A 2WZEA 3GBEA 4S23A 4Z42C 3P62A 3E2SA 1QBBA 4DJED 3S6DA 1GVEA 3L0KA 1UWQA 2E8ZA 4CCEA 3SIZA 2DPEA 5FEWA 3EOSA 3STCA 4XSMA 4HNVA 4DBUA 4HSOA 3UZYA 3W7CA 2A3EA 4B2DA 4P7OA 3T55A 4O52A 3NZ1A 1TWIA 4GI8A 4Z1BA 4AG0A 3AALA 1LWHA 4I8DA 3NPVA 2YLAA 4YU1A 1J93A 3GFYA 1J0JA 3S1VA 1JAEA 4LUSA 3QTPA 2ZA2A 4BF7A 1IXPA 4O54A 1QATA 5A1AA 4KCVA 3O6YX 3OBKA 1MRQA 2ZFAA 2PDUA 3ECQA 4FZIA 3MDWA 3VNYA 1UOKA 3KVMA 3A12A 3QRHA 4HGXA 3F7JA 1XIMA 2EPNA 1VBHA 4PMNA 1O5RA 5A6AA 4JTEA 4FIQA 3P8JA 5KZDA 3RG6A 3W02A 1IEIA 2BP1A 8XIAA 3CWNA 4DF2A 1NOFA 4AYGA 1RA0A 4GZIA 1TR9A 3N25A 1GG1A 1VC4A 1LG2A 3M41A 3AO0A 3FS2A 3M5XA 4YL2A 2J24A 3GWQA 1JCNA 2VGIA 3IJIA 4M7TA 2PEVA 5A8PA 2UV8G 3PTQA 1EO7A 3VOFA 4QEHA 2DFAA 1FX6A 2G3IA 4IL2A 2A21A 2VTFA 3RILA 1XRFA 1HVXA 1S5VA 1L2UA 3KBSA 4JL1A 2X7VA 4A8LA 4QAWA 1Q45A 2IPWA 1UWIA 1V3KA 1QK0A 4JTAA 2XN2A 1G01A 2ANUA 4J2MA 4NZ4A 1EDTA 4IMDA 4IPPA 5CPMA 3NO3A 1XYLA 5FL1A 4ACYA 1Q6GA 2WM1A 5LXEA 3EA1A 3GVRA 3O3RA 3WQPA 2EEXA 4FNQA 4AC7C 5HPCA 2BHYA 3N19B 5A69A 5DQPA 2QCMA 5T91A 1DVJA 2D0FA 2YFNA 3W9ZA 3BV4A 4O0QA 1NFBA 1HJQA 1AH0A 3QJAA 1REQB 4UOJA 4ES4A 4GWEA 5MHBA 2R8WA 4UC5A 3ITLA 2C1IA 2HPMA 5AOUA 2HJPA 5BU9A 5C9UA 4JYEA 2Q8XA 1MEHA 1SO3A 4MB4A 4U5KA 1VPQA 4S39A 3DDMA 2D3NA 5LIYX 4AWSA 2I16A 1UQZA 1J0YA 5K9DA 2TSYA 3PNUA 2AGTA 4XX6A 1K6AA 2D0GA 1JYWA 4HCLA 4GUGA 3IIVA 1IR1A 4OWGA 3EMCA 5HJXA 2Z2BA 1R9XA 1SPQA 1V3JA 2ZC8A 2OX1A 4GXPA 3O06A 3G1YA 3RHGA 4LPCA 5GNXA 1ITXA 1TIMA 4AMAA 4H6RA 4NHVA 5D9NA 3PZMA 1GOWA 2DY3A 3LBCA 2HZGA 4BFAA 3IAQA 4O0ZA 5A6SA 2DW6A 3TMQA 4GIAA 2J9ZA 3VIFA 4NQ1A 3SRKA 1VPYA 3VGEA 4OKDA 3UJSA 2WWCA 1QOQA 4LRTA 5FEPA 1GTHA 3WD2A 3AU6A 3AHVA 4R9XA 5K3VA 4GGBA 4DB7A 1ZPTA 5CBBA 1GNXA 4K8GA 3II1A 1UD2A 3RM8A 6XIAA 3PWGA 2E7FA 3I4KA 4J3ZA 2PU0A 2DGAA 4ILSA 3O8AA 3Q67A 1AW1A 4PBGA 2C7FA 1L6WA 3RJYA 1E9ZB 4HK6A 2PMQA 4QM1A 4EXQA 5KMYA 4LNCA 3UR8A 3CUZA 3W7DA 5A6JA 3EKLA 2HVMA 3STPA 1T8QA 1R85A 4PSPA 3WLMA 2O7SA 1Q4NX 4LVAA 3Q94A 4FLQA 5DMNA 4MKNA 3AZRA 5HR7A 3L5LA 3GUGA 1N2VA 4DJEC 4HNCA 4TU1A 2VZSA 2JK2A 4AIBA 1DOSA 4JFUA 4ZFMA 3EWDA 3KL0A 1IZKA 3D3FA 4MOZA 1OVDA 1JCYA 3PTDA 3BARA 3MKKA 2C79A 3KS5A 5DCDA 3RYSA 3TEVA 2CBUA 3W7LA 3ZM8A 5FF7A 4FLOA 3S9ZA 3LGEA 3TLLA 2R1LA 2ABAA 1VD6A 4AX7A 5H2ZA 2QZRA 5F2LA 1KTBA 3LX9A 1Q4WA 5AY7A 4IMFA 4OGZA 4N6EA 3S4TA 2WJEA 3WLQA 2GGIA 1DP0A 4PEEA 1XICA 2GGEA 3M1ZA 1QVBA 5D30A 5AZ1A 2IW0A 2G4FA 3KTXA 3VD7A 3N73A 4C6DA 4JDBA 4PUMA 2GLKA 4JQ2A 8XIMA 1E51A 7TIMA 2F61A 3NPXA 4B2DD 3D5HA 4MZYA 2ISVA 3EB4A 1ZS2A 4RDZA 3HJZA 4X60A 2UZ9A 2QMJA 1DWGM 2HEJA 3QR0A 3KBMA 4GUHA 3W7EA 2D2GA 3BUVA 2DZBA 2PP1A 3PK7A 1EJRC 4HN4A 3UERA 1F74A 4RDYA 5FAJA 4C6FA 3LZ5A 4TTGA 3GXTA 3PVFA 1ZHAA 2PURA 3YPIA 1LRNA 1B9ZA 3RU6A 4S3AA 3IS4A 3CV7A 2A3AA 5HWJA 4S3JA 3ABSA 2FIQA 1JZ6A 3B40A 1M7JA 5D9PA 3VDBA 3CMJA 1Q8JA 5CC3A 3CXOA 3GC5A 2PB1A 5DT7A 4J3TA 4CD4A 2Z26A 3H21A 3G1SA 1DYSA 5EFDA 2VFGA 1PO9A 3NEVA 3MBFA 6REQA 3IUHA 3W7PA 5FEXA 1MUMA 2OB3A 4K36A 4IQJA 1WO2A 3V1PA 3BGAA 3GDKA 1Q6EA 2BVDA 1XRSA 4PULA 3AYSA 4XKYB 3TZFA 1EHNA 1J6PA 3W2MA 5G1TA 1OD0A 3CZ8A 2QS8A 1K8XA 2FPTA 4EF8A 2RH9A 3D6NA 3KL5A 5E9AA 4AWTA 2CU0A 1U30A 2WVVA 2DUXA 6TAAA 1RBOB 1KFJA 1BEUA 1VZWA 3S1WA 4AD5A 4LBRA 4IFKB 2V3GA 3VOCA 3AYVA 2PD9A 4ZXOA 3R2GA 4C6MA 2GPTA 3I7QA 3HTWA 4KQNA 1MRAA 4FNRA 1GQLA 1FH7A 1DTNA 1EP3A 3NO5A 4IUOA 2WSQA 5HMFA 1UR1A 4GO9A 5EL1A 1V7AA 4H00A 2VEIA 4JX5A 1G4TA 4JIRA 4H2HA 3CHDA 3L2MA 3MSRA 1E0WA 3R0DA 4E5TA 4YTRA 2ZBTA 1BTCA 3FLUA 4CNNA 1EHAA 4RX0A 1NY1A 3SCVA 2I5IA 4BHYA 1G1YA 3CPRA 4F4RA 1Q6QA 1OX4B 3WEZA 1MW3A 4DBEA 3TUUA 1ME8A 4B90A 4KEZA 3U57A 1IXOA 3NSXA 2GDUA 1QO2A 1NDVA 4P7RA 3FYOA 5EPDA 1MXGA 4R9OA 2X2GA 3WQOA 2OX4A 2YCJA 2J47A 3M0JA 1L8NA 4HMCA 4DWSA 1HL8A 1YMYA 1HW6A 3H2AA 3VPLA 2RUSA 3IJ6A 3B8SA 5E6YA 5T26A 5CXPA 4PL1A 4C6JA 1UUOA 4MVAA 1A3WA 2INEA 1A5BA 5BYWA 3G3MA 1WNOA 3LMZA 4W85A 2HXTA 4EACA 2WSKA 3APGA 2O7QA 1JRCA 3N29A 1QMLA 1XIIA 3W2NA 3SECA 1FH8A 5D05A 4B3ZA 1KM6A 1S1PA 1VYPX 5HUOA 3ARQA 1XSJA 3QYQA 3HPSA 3KCOA 5A8OA 5FI8A 4LAOA 4NNAA 2QDDA 4NASA 3G1DA 4ML4A 2YCIX 3I68A 3ZJKA 1BSIA 3DFHA 3TKFA 1HP4A 2YOCA 2OCZA 5REQA 1IZJA 3T1GA 2XVKA 3ARUA 3FVMA 4W88A 3H4WA 3LHUA 4LCSA 1JZ4A 1CTNA 3VMNA 3NPUA 3PAOA 5CPLA 4Y8EA 4GI9A 3IVUA 1OFOA 1E40A 1H51A 4AB4A 3WDQA 1D8CA 1NDWA 1GJUA 4EAMA 4A6GA 4QS5A 4I5UA 5CKSA 5D4YA 5IBXC 4IMAA 1US0A 7REQB 2I7GA 3L4YA 3QLLA 3H22A 3N4EA 5M17A 4DO7A 4J3XA 2GK1B 5G4EA 1A47A 4DELA 2DU2A 3ALGA 1NF7A 3UXAA 3B0UX 3FA4A 2OOFA 2O9TA 3SUSA 2A3BA 5ECUA 1V3IA 1OG6A 3CIVA 2DIJA 1OF8A 3E2VA 5HBFA 3A5VA 3CT2A 3Q37A 3CS2A 2PWDA 4GCXA 5FJOA 3BL3A 3IUIA 4PTNA 1L9WA 2RFGA 2G0WA 3WFAA 3WBEA 3W85A 1W9UA 5EMJA 3DHDA 3URNA 2J6XA 2V67A 4LX4A 3V0TA 2YBUA 4ZODA 4G7FA 2J25A 1TX2A 1K70A 2TRSA 3SCSA 1Q13A 1FFRA 3ZO9A 2NX3A 4IXHA 2J8FA 5FL0A 5LXXA 4ZEPA 1MDLA 3PP7A 1ML1A 1OFQA 4GYPC 3R79A 4KCTA 3ARPA 2BX7A 2BOFX 1CECA 1UWRA 5E0KA 3NYDA 4DYJA 3O05A 2E68A 2ZRZA 2A1YA 1S5NA 2AL2A 4J4KA 3FSUA 3W81A 3WQ8A 5BWAA 2PZNA 4UQ9A 1R9ZA 4YHGA 4QDMA 4MIMA 2RGMA 3OQEA 3BOLA 1JAKA 4NZJA 2LLEA 4XO7A 1PYFA 4Q8OA 1SR9A 1DXEA 4RNJA 3QQWA 2BVTA 3KEHA 3PPGA 1BVNP 1XX1A 4Z0JA 4GXWA 3VD5A 2YL9A 5JBEA 3LG3A 4XUYA 2Y7FA 4UTTA 3WEOA 4JFVA 4HCHA 3SCTA 5ABTA 5MKGA 5TIMA 3TSDA 3OZYA 3TLQA 1JUBA 1LCOA 4K8EA 5BRQA 5I03A 4DZIA 3S1UA 1RV8A 3WDRA 2EG6A 3VNIA 3K1GA 2XN0A 4QSHA 4NXSA 4E8DA 1PVNA 4P7NA 1FY6A 2JEQA 1VB9A 2OSYA 1VFUA 2W63A 1OFDA 1RVKA 4WSHA 4AD3A 3W23A 4JKMA 4AWUA 2EPLX 2FVLA 4WK9A 4HNTA 2FH8A 4QG9A 1PIIA 4I9AA 1W3NA 4O12A 3A9IA 4F9JA 1I4NA 3OG2A 1R9YA 4IG2B 4KWSA 3FV9A 4H9YA 4P5UA 4PL2A 2O9PA 1N8IA 2ZKMX 2ZRVA 5D03A 3W26A 3E2RA 3GU2A 2GSEA 5L9FA 1CIUA 3HF3A 2YB1A 3MP4A 4FIRA 5A95A 1EXPA 4W5UA 1XLJA 1GVFA 4H7ZA 2QPSA 1JVNA 3N2CA 1KCKA 4LTSA 3MCOA 2POTA 1YPXA 3A3WA 1N82A 4M3PA 3M4HA 2PP3A 1E70M 2A79A 2HDJA 1L0PA 3N9RA 3FN9A 3M07A 1KBBA 3WLKX 3FGCB 3O07A 4ZL1A 1S5MA 3WBAA 5KITA 4DPPA 1G0CA 1A0CA 2PLJA 4OT7A 1ICSA 4C6IA 3U2ZA 2R9RA 1Q2SA 4GC4A 3TYEA 1E6ZA 3VE9A 1KC7A 2G50A 5EKYA 3WF4A 1Z8AA 1EBGA 4E4PA 3ZMRA 4F40A 3IIPA 3LLXA 4KW2A 3NTYA 1KM3A 4R3UA 2GDQA 2PLKA 1ZRQA 4HA1A 4Z17A 5A2BA 2H9AA 1OB0A 4HZ6A 2Y2WA 4HA4A 2RGLA 4XTDA 4F2UA 2D0HA 4UB9A 3WF1A 2Y8UA 4LY4A 4DWSD 4EPEC 3ZSTA 2ZUSA 4JOMA 4O19A 4NKCA 2H3DA 4GY1A 1LQAA 2GVGA 1YEYA 1W5MA 1IT0A 3OG3A 4RE2A 1VFFA 1WXYA 1C7TA 3UWQA 4HNUA 3AUJA 1FRBA 3PPFA 4DUOA 5A6KA 3AIRA 3DHFA 2WXDM 3WUGA 1CT5A 3GK0A 3N2TA 3JS3A 1NP2A 4GHRA 2G5WA 3EDDA 3INPA 3MKVA 3O63A 2WMFA 1TE1A 5E93A 5IRPA 3TN4A 2PRMA 2E5CA 4UTLA 1HQTA 1P0KA 4ZQMA 2OELA 4E4FA 3U8GA 3TDFA 1PX3A 3SGUA 3HQOA 5I77A 3DN5A 3B97A 4WX2A 1WB0A 1JNEA 2H8ZA 4JY9A 2X7WA 5HMDA 1QI5A 1UZDA 1OWQA 5D9OA 5CH9A 2Q3OA 4ADSA 5IHSA 3VGHA 4JS3A 2ZE3A 1SJCA 3UG5A 3WNMA 4W93A 1K03A 2BY2A 4JTCA 4ZENA 2EF9A 1X1ZA 1SFJA 2OPJA 4ROPA 5I2UA 3VNKA 5J04A 1HKIA 2Y5EA 3N9SA 1UA3A 3AMGA 4BI5A 3VDAA 3EPOA 2V0TA 4Y90A 4Y9NA 1QOPA 3P2VA 5D32A 4H8HA 3GBDA 2J79A 3GRIA 2NWSA 5ABFB 5TAOA 1V3LA 3VMOA 3TSBA 4WGXA 2X42A 1T41A 1YIXA 2R1MA 2VC7A 4PUEA 1GPWA 5H8PA 3OLGA 2A3LA 2P0OA 1HL2A 1YNYA 4JCLA 4B5XA 5C0QA 3ZLHA 4DVOA 5I09A 4B3KA 1IGSA 1PCKA 4K8HA 4WXYA 1F8MA 1VIZA 1NFPA 2ZWZA 3G1XA 2J7BA 4W5ZA 1CDGA 2QV5A 4I7WA 4UR7A 1SU5A 1YQ2A 1VBRA 1BQCA 4RZBA 1R86A 1FHUA 2FZNA 1TJRA 3VE7A 3G0UA 3QXBA 5EMKA 1S5WA 4ZXLA 1E4MM 1DBTA 4GYJA 2PWUA 2R1KA 4Z1YA 1VGAA 4QBXA 4N9CA 2CXEA 4IFRA 4D6GA 1ZZMA 1QAPA 2O4QA 1WV2A 4FXFA 4PMOA 3W37A 1V6UA 2ZZ7A 2JQXA 1EL3A 1VQTA 1ELSA 1U1UA 1V77A 2PAJA 4L4PA 4YVXA 4C6LA 4Q4KA 3LHYA 3CU2A 3SY1A 1BXBA 1I2RA 1UP2A 3VGGA 2GVJA 1J11A 3GNOA 1M3UA 3B0VC 4UUIA 1LLOA 4HA3A 1S2TA 1RR2A 1ZSXA 1A0DA 3GSMA 1V5XA 3UCDA 1G4PA 1GZGA 2G37A 5L6UA 3VIOA 5CBJA 5FIPA 2J7FA 3WENA 3MY9A 4XAPA 4D1IA 3CMGA 1JD7A 4DEFA 4QJ4B 1LRTA 1BYCA 2FGLA 3L65A 1VF8A 4D71A 1UP0A 4IP5A 1IZCA 4DJFA 4Q8PA 3QTGA 2ZWYA 3UJ2A 2A7RA 3N11A 4HSNA 4H6QA 2PDIA 2E5BA 3PJTA 5CG0A 2WC7A 5HPOA 3DYPA 2D73A 3BJSA 3VIPA 4DYKA 1OEPA 2OEMA 3W22A 3F2BA 1V51A 2INFA 4AZ5A 5LA0A 2CZEA 1HN1A 2Y6ZA 3HG3A 2OXNA 5G2HA 3LHWA 4V15A 3TAOA 4US5A 3WUFA 1DJWA 3C2OA 2PZ0A 2F6XA 3CUJA 3PZOA 1X6LA 3MYPA 3WG6A 4DWSC 1HGWA 3G2GA 3BSMA 1JZ7A 3KBVA 2NXHA 5EFFA 1GGOA 4QLJA 1EC7A 4ZQCA 1RLDA 4IX2A 4QAIA 2PRHA 2I9UA 1X39A 3GG8A 4M56A 1XLGA 1FUYA 1KTCA 5JMUA 1FA2A 1SZRA 3LCIA 2CWXA 4QEEA 3VM7A 3AIWA 4B15A 3H12A 4KFPA 4C6KA 2WLZA 1WKFA 3VILA 4B5NA 4Q4RA 1WZLA 2OGJA 1A5CA 2XH0A 2B7OA 2DT0A 2QUUA 2PP0A 5F2GA 1GT8A 4XKMA 4JXCA 1BVZA 3T8LA 5FJPA 1EDGA 4Z0SA 4IJRA 4YWIA 4QJ1A 2GGGA 3AS3A 4M6PA 2EG7A 1QHPA 4DXVA 3EXSA 3LCFA 4RPQA 2PTYA 1FHDA 1FP8A 1E6PA 1IIGA 4GOAA 2IXVA 4YJ5A 3GXMA 4CGTA 1K4GA 2F7FA 2OJPA 4C1NB 4H3DA 2V2HA 2TMDA 3EMZA 4H2CA 4LYQA 4JKLA 4MKVA 3W25A 5B80A 2P88A 1K1DA 1H60A 5DANA 3CPUA 4ZSUA 1FDYA 1JPDX 1CGYA 3CAKA 3HMJG 4Q32A 1UH4A 1H7PA 1GZ1A 5D38A 3DYMA 2Q02A 2QCCA 1SQ7A 3PULA 4NG3A 3TR9A 1J9YA 1VBJA 3ONCA 2J7DA 5AHNA 1FWBC 2OGYA 4GX9A 2P50A 3W01A 3SN1A 2YA1A 3AI0A 1E1EA 4K2SA 3UG3A 2CLKA 3KM8A 4GINA 4H9VA 4H9UA 2E3ZA 2QCNA 1SO6A 5T8GA 3CUXA 3MS8A 2CKRA 1UKPA 4NZCA 1TE6A 3EEZA 4K68A 1OFBA 2PWEA 3CZGA 3ANYA 4H8NA 1XV8A 1S2WA 1B4KA 3QPYA 3N2MA 4GI6A 3LV6A 1U1HA 3F1QA 1S2VA 1ZJHA 2HVOA 3W28A 3EWYA 2ZE0A 2Z4GA 3B05A 2VD8A 3DHPA 4UNIA 4ZOBA 1Q7QA 3QMSA 4M8UA 4OIFA 1OABA 3FVDA 1ZAHA 1DWFM 5A6BA 1MEWA 3ZT6A 1VEPA 2Z27A 1B9BA 3NQ2A 2ZVRA 1KXHA 2XM2A 2IPJA 3PZQA 4JNZA 4XUGA 5HA7A 4LVBA 1QK2A 2HVNA 3V0UA 3KCLA 4LAKA 1R7OA 3UR7A 3MUZ1 4QS6A 3ABRA 1U1JA 4PA8A 4CU6A 3LBMA 3EWCA 2YA0A 3SRFA 2WKGA 4ZSTA 1XUZA 4XZLX 3LNPA 3XIMA 4UTTC 2ZA3A 1OIMA 2YYUA 3GYCA 3TTEA 3SIMA 1V0KA 1HL9A 1BRLA 1GKPA 1NU5A 2VM8A 4A3QA 4ACZB 3OODA 4J9JA 4LS1A 1O68A 2QLYA 2C1GA 3AYTA 4LU0A 2HE8A 5GJMA 5GPRA 1CGVA 1GPFA 1PZ3A 4LYKA 2ISDA 2DP3A 4O50A 3EDFA 1OC6A 2E09A 1Y5WA 4HBKA 2H8XA 4NYUA 3GNRA 3B03A 1NSJA 1AJ0A 3DBPA 3COTA 3MTWA 1J12A 1FWGC 4LVFA 3EXRA 1Q7MA 3NWRA 1MW1A 4L4OA 3HFTA 4IGNA 2V82A 2YYTA 2BZNA 2WMKA 3VAVA 3K4AA 4QSFA 1B4EA 4KT2A 3HPAA 2B7NA 3BAXA 2QULA 5BU6A 3GD6A 2PTXA 3OO2A 1OCBA 3WLRA 3NGFA 3L5MA 3DKJA 2ZQ0A 1NJJA 2YCLB 4R7OA 1BLIA 2J74A 1W5NA 4PMVA 1KFLA 1E4IA 4MTVA 4G6CA 2ZZ2A 1FWNA 3ANUA 3QVQA 3S1GA 2PWGA 2Y7GA 4FK9A 5C6MA 1QASA 2XG9A 2XTKA 3TTOA 4DJFD 4KKXA 3APTA 4V27A 4NAFA 1SJDA 4JYDA 1FXPA 1KO0A 3ATYA 1AFSA 4HJFA 3TTYA 3HM7A 2Y4SA 2PLCA 2OO6A 2PTZA 4HD5A 1WZKA 1WAWA 3P6LA 4JTDA 4PE8A 1JDCA 2XDFA 5HINA 2AMGA 2JALA 3QR1A 3WNKA 1TJ2A 2A85A 3LS9A 4PFHA 3PUDA 3ZZ1A 1EDQA 4FB7A 2BXYA 2I57A 4GBDA 4DBWA 4JICA 5KZEA 1KM5A 1MZRA 1LYXA 4WDUA 2YDRA 2VEPA 4F3HA 4HYVA 1GYLA 1BHGA 1J0IA 4X3ZA 4GNVA 2W91A 2OLHA 3GHUA 3NL5A 3G1AA 2WW5A 3UPBA 3LSCA 3GG0A 4M6VA 2QHAA 3KWSA 1KFEA 5LGXA 3E0VA 1VLWA 4A8IA 5HQEA 2OOGA 4UOZA 3ONBA 4GO8A 3WSUA 2A6NA 1VFMA 2VC9A 4UTWA 2X2YA 4MLJA 2G3MA 3GHSA 2I9EA 3VTRA 2FMNA 2R6OA 3WJWA 2FJKA 1KGXA 3NQ6A 4BCEA 2YSWA 4JTQA 1QR7A 3TC7A 3SB0A 3QQ1A 1OK6A 4IICA 4AEFA 4C5ZA 1H1YA 4MWAB 2F9RA 5CZSA 1MUCA 3UJFA 5A2AA 4MM1A 2YLLA 4DYEA 1TX0A 4ICCX 1ZP4A 1A50A 4MF4A 4FOKA 3RLGA 3B8UA 2E5DA 1TWWA 1IEQA 4G56A 2FTYA 2JIWA 4V33A 4MB1A 2W66A 4C6QA 2WPGA 3P82A 2ALRA 3U48A 5JBDA 2FKPA 4DPQA 3H24A 1IWPA 1M65A 5GJNA 2DEPA 1RQBA 2JGYA 2PU1A 1NIUA 1PKMA 1D9EA 1AL8A 3DFOA 3TJXA 3VUSA 5AFDA 3HPZA 4Q33A 3VFLA 3KTCA 3VD9A 5CCZA 4GRSA 1XLHA 4MZ8A 4DO4A 4ATDA 3RIKA 1XLAA 2ZZ6A 3EMQA 3ZLFA 3UT0A 4EPDC 2GUUA 1RK6A 1QPNA 3K46A 4KBXA 3SQMA 3T0AA 4E0CA 3GIPA 4KIEA 4GUIA 3TJIA 1XISA 4NILA 1E1CB 1GOOA 2FHBA 4GA8A 1DE5A 2HWGA 3W88A 4MJ2A 3HBLA 4MYAA 5FEZA 3SSJA 3VD3A 2GWGA 4XD6A 1X8FA 3LRMA 3KLKA 2PDXA 1ZNNA 3W6MA 2HSAA 3U7BA 3UZ5A 3TMLA 3TA6A 1BG9A 1T8XA 3IAPA 3IV3A 1PS9A 5AYYA 4Q8MA 1EJUC 4MNLA 3AMLA 1Z48A 4A3RA 2TYSA 3AXIA 2CLEA 3HPXA 1RUSA 4GFSA 4IJBA 1CYGA 1NAL1 5G1YA 3SCQA 1XLLA 4UNLA 2GFTA 2GJRA 4O1DA 3H4XA 1BQGA 3PZ9A 4H6KA 3Q2DA 4GJIA 3N13A 1P1MA 3WLPA 1RP9A 1UD8A 4LYRA 4MHBA 4CD5A 4GNKB 2E1DA 2VEKA 4PRTA 3CUIA 4MAZA 3NQVA 1UROA 3B9OA 3SGGA 1K7XA 4AXNA 4DXXA 3I6RA 5A6TC 4A4AA 4JKKA 3TYCA