1XCWA

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xcwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xcwA01
1JZ6A 3M46A 2YA0A 2OSXA 4Y7EA 2VOTA 1MW1A 2ZUSA 1JI2A 3CUJA 3QHNA 2CXGA 2VZUA 3W27A 3U7BA 3D4ZA 3WNKA 3QR3A 1J12A 1J0HA 2F7RA 2XJ7A 4AD0A 3TV8A 2YLLA 4GQRA 3PZVA 2VR5A 1TUXA 1V3IA 1VENA 2X8RA 2JFEX 2BVDA 2WHLA 3CUHA 2XVGA 4D6FA 2X09A 3LPFA 1W91A 2BHUA 3ARVA 4ATLA 3WDPP 5I6SA 1J0ZA 3SCPA 1EXPA 1PIGA 1JYWA 1KTBA 2VT0A 3ZM8A 2AAAA 3UCQA 1R86A 3SCSA 3DX2A 1XSJA 4BA0A 3L4ZA 2DQXA 1TQUA 1W9VA 2XTKA 4XZWA 3GH4A 4PSRA 1BYDA 3F5LA 4AEFA 1SFSA 1VEOA 2VI0A 3VPLA 4H8VA 2G8ZA 3CHFA 2VZTA 3BUIA 4HPHA 3OZPA 3PZTA 2YDRA 3BGAA 1MFVA 4BF7A 2ZXBA 1ZS2A 4Q7NA 1GPFA 3WQWA 4WKFA 1R46A 3DYPA 1WDSA 1A47A 1C8QA 3EMQA 5ABEA 8A3HA 3NDZA 1WZLA 1E15A 3A4AA 4HTYA 3PZNA 4W7UA 3BUBA 3IJ9A 3D3AA 3NCOA 3WF0A 2G3IA 2UY2A 5JUVA 3W6LA 1CDGA 3VSUA 3VD4A 2ZWZA 5A6JA 1JAKA 4ACZB 2ZUMA 4IM4A 3VVGA 1BG9A 1P6WA 3BVVA 3ZR6A 1H4PA 1JZ5A 3AMLA 3WH8A 4UQEA 1PPIA 3HN3A 1V02E 3RDKA 1EO7A 3HMCA 2EACA 4NZFA 1KBKA 2VCAA 1VB9A 3MMUA 4U3CA 4TVCA 4RL3A 3EDDA 2V3EA 4QLJA 2JF6A 4V27A 2DT0A 4E2OA 2QLYA 4XUYA 1UD5A 3CO4A 2J7HA 1MW3A 4XV0A 3MKKA 4LQ1A 3GDBA 3GTNA 1AQMA 3N15A 3WF3A 3EBVA 5A8OA 2BNJA 2WPGA 4W8LA 1VEPA 2G3JA 4E4PA 4EKJA 1NP2A 5CSYA 1M7XA 4J7RA 1J18A 3AMDA 1VJSA 1O7AA 1D7FA 3H53A 4AZIA 1HXJA 4QLKA 1E55A 4PUEA 1KXQA 2VL4A 1BTCA 3AMKA 1MYRA 4CCEA 2GDUA 3PTQA 1V3MA 1W9DM 1OIMA 4FMVA 4PYSA 4EAMA 1OIFA 3WELA 1UD4A 5LA1A 3VD3A 1L0PA 7A3HA 1QI4A 1HWWA 2DSWA 1O7DC 1GVYA 2CBUA 4B3LA 2F2HA 1CWYA 4J3XA 5E0FA 5CG0A 3GXTA 1VRXA 3AFBA 1WPCA 4ZE4A 2C8NA 2J78A 2PWDA 1VFOA 3F4VA 4BZYA 2PBOA 4WKHA 3VX1A 4D6IA 4W7VA 4CCDA 4H41A 1SYTA 4W93A 1KQYA 3D5HA 4TTGA 1GNXA 5A69A 2D24A 5AC4A 1QI0A 3B9EA 1XRVA 4HZ7A 2ZUWA 2XUCA 3VIPA 5CLWA 4KRUA 1UR4A 4TXEA 1V3HA 3VM7A 2VO5A 5M17A 2ESCA 3N12A 2WK2A 3RM9A 4E8DA 2VVSA 3ARRA 4GZEA 1FP8A 1R34A 2XM1A 4D1IA 5AYIA 2D0FA 1LL4A 3WDHA 3WDIA 2W67A 3DYMA 1G5AA 1CECA 3ZT6A 1PS3A 1C92A 1MVYA 4TVUA 1E6RA 4D71A 5HDRA 2ALWA 5A8QA 5CGMA 3CZJA 5CSUA 1WP6A 2WBKA 1B3ZA 3U7VA 4BQ2A 3CHEA 4CD7A 2CPUA 3SUTA 2HISA 4QFUA 2BXZA 1U33A 1TZ7A 1JD7A 2F7OA 2VRQA 3AHTA 1JGIA 1W1VA 2J25A 1IT0A 2WAGA 5M5DA 3KL5A 1PAMA 3CZSA 1PX8A 1GOOA 5JBEA 3MMWA 2PWGA 1OWQA 3LXCA 2J8FA 1V0LA 3W37A 3AIVA 3VD5A 4JCLA 4AMXA 5DF0A 2DPEA 2QMJA 4NXSA 3LXAA 2GSJA 4YPJA 5JBFA 2VMFA 5HXMA 2FDMA 3MUIA 1UD3A 3THDA 3NYDA 3BCDA 1R85A 1TFVA 2E0PA 3DX4A 5FKYA 3BVXA 2IGTA 1C93A 3BMWA 1UR9A 2YFOA 4V2XA 1KXHA 2ZXDA 2GJXA 2J8GA 2X1IA 2QMKA 4S3KA 1EA9C 4MB3A 3SUWA 3OZOA 3MUZ1 4IISA 2YBTA 3L4WA 3DDGA 3EYPA 3PTMA 4PTMA 1UWTA 4DWSB 1EDGA 1BGGA 3OLEA 4HOXA 5A6KA 1BVNP 2DSVA 3WMSA 4P8VA 3PHAA 5DEZA 3LPOA 2NT1A 4ZFMA 3CGTA 3ALGA 1G9HA 3U5UA 1RH9A 4CGTA 3N18A 3KL3A 1PX4A 3VIFA 5E09A 4NZJA 3IK2A 3VIKA 4JKLA 3N1AA 4IPLA 2GFTA 2CBJA 4W5ZA 4U3AA 3ZJKA 5A2BA 2ZUUA 2VUYA 2EO7A 1BQCA 3A6OA 4JKKA 1Y7VA 4JFTA 4U2ZA 1CXLA 3ARPA 3BC9A 4FF5A 1B31A 4JFUA 1FOBA 1J9YA 4JFWA 3AIUA 4AISA 4TTUA 2WMHA 2VX7A 1MW2A 3M07A 2D3LA 1F4AA 3NIYA 2VVNA 3A22A 2XGBA 3LXBA 3EDKA 1HJXA 4MJ4A 3WD4A 3GXIA 2PF0A 1VF8A 1UR1A 3AS3A 1WZKA 4H7VA 4NX0A 4QP0A 1KWGA 3VKKA 3KL0A 3MV01 1E6NA 5A6BA 4CN1A 4ML4A 3PZGA 2EADA 3PZOA 3WF4A 2EEXA 3W25A 3SUUA 3F5KA 4DO4A 1UWRA 3ZO9A 5FCZA 2PC8A 1W3LA 2EXOA 2YDSA 3VGFA 3AIRA 1V3KA 2EPOA 2EABA 3BLBA 1HL8A 3GBDA 3CTTA 1SR0A 3S5YA 3APGA 1JNDA 3ALFA 1HIZA 3VIGA 1DWJM 1GQIA 2V5DA 3NDYA 1QBAA 5A8PA 5HPCA 3VNYA 3WH9A 4J28A 4ZXLA 1OINA 1EO5A 2VZOA 1GONA 1JAEA 2PWEA 3IJ7A 3UG5A 4ACYA 3B9DA 4D6HA 2VNCA 3AJ7A 4LXFA 4UFKA 3WH5A 2CERA 1T0OA 4QAWA 1ZBVA 1H5VA 4OOUA 1W9XA 1V08A 3CHCA 2JF7A 3AIEA 2J7FA 3A4XA 2GJXB 2WWDA 2JEQA 3EJUA 1C90A 3FAWA 4TUFA 2WANA 4GXPA 1HVQA 4JFSA 2JIEA 1IV8A 1UH2A 5TD4A 1UD8A 3KLKA 2CBIA 2J77A 3LRMA 2FE0A 4J3UA 2WWCA 2WMIB 3HZ3A 3KEHA 1FH9A 3BVWA 4HU8A 4GO8A 1AQHA 1L8NA 3I3BA 4PMQA 1UOKA 1GW1A 3K8KA 1XC6A 1TCMA 1ZJAA 3AS0A 3CMJA 5D9PA 3W38A 1GZJA 2WMKA 1FA2A 5C71A 4BS0A 3VIHA 3VOCA 3N9KA 2ZUVA 1TQTA 1W9UA 4PMNA 1E6SM 4HPGA 2Y5EA 5LYRA 2C7FA 3W28A 1W1PA 4CU7A 1QX1A 4D6GA 1WZMA 4HOWA 3AIBA 4U5IA 3HG2A 5BCAA 1JI1A 3ZT7A 1UA3A 7CGTA 1W3KA 5IXEA 3SCQA 5ECUA 1JFXA 1PZ3A 3A21A 2TAAA 1CGWA 1LQ0A 1UKPA 1UKSA 1QBBA 3OIHA 4UQBA 1M03A 1BGAA 1UR2A 1E73M 2WMJA 1B30A 2XSAA 2V38A 3PZUA 5CXPA 4ATDA 3T0AA 2FHBA 2WYSA 4EK7A 2J4GA 2X0YA 3SCWA 4ZENA 3WNLA 3VGGA 1BPLB 4J3TA 2MANA 5D9MA 2WW5A 2FGLA 2VX6A 2NT0A 4PMYA 3W4RA 1HKJA 2BFGA 2E8ZA 2XWDA 5EMYA 2G3MA 4AMWA 4PMOA 1HP5A 1WNOA 3VX0A 3IANA 1QI2A 2RGMA 3QHOA 3CLWA 1EDTA 3W26A 1GUVA 4W7WA 2YL6A 4URIA 4AZHA 1ZBWA 4JKMA 2CKRA 1BYCA 1CGVA 3WQVA 1CXKA 1ISVA 3UEQA 1LG2A 1E4LA 4FNSA 2YL5A 2CHNA 1TG7A 5AY7A 3THCA 4MNKA 1QI3A 4UCFA 5I24A 1MXDA 3ARXA 4GPNA 3GXNA 1PEZA 3QHMA 1JYNA 2OYLA 2QHAA 2Z1KA 1ZBCA 4WIWA 1H1NA 2WVVB 3CUIA 1W1YA 1XSKA 1E5JA 3CZGA 4M29A 1R8LA 1W9BM 3BAKA 2ZX9A 5M03A 2QF8A 4UFIA 2W61A 3BAWA 1B2YA 2D2OA 1KTCA 4AZCA 3L4VA 5CLTA 3NSMA 5E1QA 3IAQA 4MDOA 3CH9A 4AYGA 1E9LA 3WDJA 4MPKA 1E6PA 4PMVA 3HU7A 4L4OA 3PZMA 1CGXA 3CBWA 5I5RA 1V6WA 2A3BA 4IUGA 3ARSA 2J74A 3VINA 3POCA 4W8BA 2NW0A 1JDAA 1CGUA 1H09A 3VDHA 1UQZA 3AXHA 3WMCA 4P7LA 5D9OA 1MQRA 1VIWA 1B3WA 4CD4A 2YFNA 2CYGA 1GJUA 4EE9A 4CN4A 4A4AA 5A94A 1JZ3A 4JAWA 5A8MA 1JF6A 2O9OA 2F1BA 2W5FA 2VQTA 3RJXA 1WB0A 3VD7A 3GNRA 1DEDA 1GHRA 4B3KA 5JBDA 4MB5A 4UOJA 1J10A 4F79A 4UQDA 1YQ2A 1KR0A 3FY1A 2BXYA 3CZNA 3AHYA 4W5UA 1CZ1A 2XVKA 3GNPA 3I3DA 1TVPA 1C3FA 3W6MA 4GI9A 4UFJA 3L4UA 3NUKA 1C7SA 2WZEA 1LL6A 1HJVA 4N0RA 4ZEPA 2WCAA 4F8XA 4F9JA 4J3SA 3EJRA 2BVTA 1TVNA 2WHJA 2BHZA 5GPRA 1NARA 4MB1A 3VU2A 2DEPA 3A3HA 3II1A 3OLDA 3GZAA 4DWSD 4S3JA 1JDCA 4UQ9A 4NRSA 4CKQA 2XIIA 3WF1A 4DO6A 2WNWA 2X2YA 3W53A 3K1DA 3WNOA 3AZSA 1UQYA 1BYBA 1V6VA 1HVXA 2YDQA 3GH5A 3WEOA 2QPUA 1H41A 3DYOA 2FYVA 1PX3A 2OW6A 3DHUA 3RMEA 2BHYA 1W3JA 1A3HA 1OCQA 4J3VA 5D9NA 3EJPA 1SZNA 1BHGA 1B9ZA 1K6AA 3AS2A 3RJYA 4CUCA 3CZKA 1CLXA 5BROA 3S6TA 4GIAA 4MDPA 2XN2A 3DC0A 3UR7A 3W0KA 1HKIA 3AHXA 1C7TA 1QNSA 3PBGA 4X0NA 1QNRA 5E6YA 4FNTA 4DUWA 2D0HA 1JDDA 1EOKA 5E9AA 2CESA 4CU6A 3N13A 1K9EA 3L4YA 3G6MA 2ZX7A 4E8CA 4GZIA 2FH6A 2W66A 1ITXA 1UH3A 4FNPA 3MS8A 1UASA 2X2IA 1XCXA 1AVAA 3SCUA 4PMUA 2W91A 2WZHA 2O9PA 3H54A 4DM2A 3BH4A 4PMZA 4H04A 3WSUA 2WSPA 1HJWA 1JF5A 1BF2A 4D6JA 1NWRA 5A1AA 3S5ZA 3W82A 4TVDA 1DWGM 4AZCB 4B9YA 3PTKA 2WCSA 4AYSA 2DIJA 2JALA 1G94A 3WQ4A 4KMQA 4TX6A 1E1EA 2IXVA 2Z1SA 2WVSA 4M80A 1GOIA 4PSPA 1NWTA 5DO8A 3AMGA 5FD0A 2WKGA 1TA3B 2GJPA 3GM8A 1CYGA 2XVLA 3WD2A 2OWWA 1DHKA 3T0DA 4CVUA 1JD9A 1UKQA 1ISYA 3J7HA 2A3HA 4NI3A 1H0IA 4H8UA 2D22A 3WNPA 2EQDA 3VSVA 1MQPA 1NH6A 2EPNA 1OD8A 4UZUA 1FP9A 5A6SA 7TAAA 2X2HA 1J0IA 1ISWA 1BFNA 4LYRA 4W85A 1E5NA 4AZGA 2NSXA 5EBAA 4AY1A 4M8UA 2OYMA 1Q4NX 1UWIA 2XVNA 2YJQA 4QLLA 1KXVA 4IPNB 3WH7A 1CIUA 4AMCA 1EQPA 1CNVA 3MO4A 1H49A 2VR4A 3AZTA 3WDRA 1O6IA 2OWXA 3ARUA 1QW8A 2D0GA 2UY5A 1H3GA 1YHTA 3OB8A 1Q6CA 1ZBKA 1V3LA 4HA1A 3H55A 1XCWA 1QOXA 1E4IA 4UFMA 2WHKA 5EFDA 2E9LA 1QVBA 4ATWA 4W88A 3SCOA 1OGGA 5FIPA 3E1F1 4LYQA 2VURA 2E9MA 4PMXA 2F8QA 3VGDA 2PBGA 1N82A 3WQ6A 2IUZA 4U31A 2YKKA 4FLOA 4PMRA 1ZL1A 1TQSA 3PZQA 2IXUA 3KLLA 3BLPX 3WD3A 2F7PA 3DX3A 2Y8KA 3OLIA 4B16A 3GH7A 4PTWA 5LA2A 1ISZA 5JIPA 2E4TA 1E56A 2XG9A 5D4YA 2EJ1A 1WE5A 1GQKA 2XFRA 2WHMA 4AZ5A 3OLGA 3WQ8A 2O9TA 1MXGA 5BXSA 5I77A 2O9RA 1VFUA 4L4PA 4MNMA 2WVUA 1B3VA 1XV8A 4XB3A 1JZ8A 2C0HA 3AIWA 3WBAA 1I1WA 3WFZA 2V3DA 2Y24A 1K9FA 5F7UA 1GOQA 4KRTA 1DWIM 2XWEA 4OGZA 3TTSA 2G4FA 1DP0A 4Q22A 3VMOA 1U30A 3K4AA 2YOCA 3WEMA 3IGUA 4Z2LA 2A3CA 3TTOA 1FFRA 1H11A 3O2LA 1UA7A 5A6MA 2J7GA 3B9AA 1VAHA 3BUPA 3WN6A 1V0NA 2AOSA 3ZSSA 3T2OA 5E70A 1US3A 1LLOA 2OWCA 3AXXA 1HNYA 1OT2A 3BXWA 3MU7A 1UZ4A 2DT1A 4DM1A 2XSBA 3FHAA 1Q6FA 1MW0A 3VDCA 2B31A 2WM0A 1HKMA 1M04A 2EPMX 4UOQA 3ARQA 2XIBA 4NRRA 1WKYA 2CEQA 2VRKA 1LWHA 1QWNA 3GBEA 1NM9A 3EJSA 1BYAA 1VFMA 4AD3A 4AD2A 3EJTA 2W62A 2VCCA 3WUBA 3SUSA 4CU8A 3PZ9A 4RE2A 1G0CA 1XHGA 3ARWA 3OG2A 1U2YA 2V3GA 3ARYA 4BQ4A 2GK1B 1IZJA 1HL9A 1K9DA 5HBFA 1HJUA 3GXPA 3T2PA 3QOMA 4FK9A 4MB4A 2WSKA 3U57A 5BXTA 4XZBA 1OGBA 3POHA 1CTNA 1RD6A 1XSIA 3WD0A 3B8SA 3BCFA 1E6ZA 1QW9A 3SCNA 1US2A 1X6NA 4UFHA 3LRLA 1R7AA 1WCGA 5ABGA 3CV5A 4OIFA 4AIOA 1UWSA 1V6XA 2AMGA 1VFFA 1W1TA 2WC3A 2J79A 4FNRA 3T0BA 3FHQA 3WUFA 3BMVA 2DH2A 2XFFA 5I0DA 2GK1A 5BYWA 3S2CA 3AHZA 3FAXA 1G01A 1OT1A 4B9ZA 1TQVA 4W89A 3RM8A 2ZE0A 2WLYA 3MUY1 5I78A 4PBGA 2ZUNA 4HMDA 2A3EA 4JIEA 1ECEA 2VC9A 4ACZA 3DX0A 1BAGA 1EHNA 2VZSA 4OUEA 4RE4A 4GINA 3A4WA 1GJWA 2PWFA 4AZ7A 2O92A 3CUFA 8CGTA 2JIWA 3A24A 2ZXQA 1W9PA 4H8HA 3BVUA 3AYSA 3BAXA 1JZ2A 4AXNA 3K8LA 1TA3A 2ZICA 3PZIA 4MADA 1TMQA 3AYRA 1E43A 3GXDA 1Q6EA 4MAZA 4P8WA 2FH8A 3K4DA 4D6CA 3WY3A 3CZLA 5A6AA 3AQUA 1VBRA 4DWSA 2JEPA 3UETA 3VNZA 4JFVA 2WB5A 3VIJA 4HZ6A 5CPQA 4AEEA 5ABFA 2EPKX 4JZ5A 5C70A 5I79A 2XM2A 1DWFM 2Y8VA 4Z2KA 1WAWA 1I1XA 1E40A 1E71M 4AZ6A 2WMFA 2Y2WA 4CD5A 1R33A 3K46A 1NWSA 1OBAA 4JL1A 1KCKA 2UY4A 2XVPA 1KR1A 3HG3A 1HXKA 1X6LA 2F18A 4DWSC 3VIIA 4KH2A 1NOFA 2VQUA 2YL9A 4J3WA 1OSEA 3PN8A 1VBUA 1CPUA 3ZMRA 4AZBA 4N42A 2YLAA 3LX9A 3TTQA 4M56A 5IHRA 4MNLA 3DDFA 3MSGA 3AICA 2CNCA 2BS9A 2J62A 5IFTA 4MTVA 4UQAA 1R7OA 1E3ZA 1JFHA 1W32A 5M3WA 3SURA 1XYFA 3N17A 3AS1A 3CIVA 5CPTA 3WNNA 4Z2JA 1CXIA 1HJQA 2DIEA 3GYCA 3MSDA 4PCTA 4MJ2A 2OSWA 2VX4A 1ZB5A 1WDPA 4LGXA 4LYPA 4X9YA 1LWJA 3BSHA 4TOQA 1X1NA 4W87A 3WMBA 1FHLA 1HJSA 2GUYA 1CXFA 2VZVA 4R5EA 4UNIA 5ABHA 1RP9A 3WDQA 4QDMA 3UG4A 4OKDA 2WZIA 4YHGA 3ARTA 3L2LA 4FLQA 3OGSA 2J7DA 2DH3A 2WMGA 5BXPA 6CGTA 1E6XM 3VILA 3ZJ8A 3GXFA 1HF6A 1CGTA 3AOFA 2FGZA 5E0CA 3D52A 3BUQA 4BCEA 2OLHA 4WLCA 2E40A 5A8NA 1KGXA 4MNJA 5C8BB 1W2VA 3VMNA 4DUVA 1KXTA 1PZ2A 4CCCA 3TTYA 1EOMA 1HN1A 1KCLA 3SUVA 2EAEA 1JXJA 4LPCA 4LX4A 1JL8A 4JCMA 4NF7A 4GO9A 4V28A 5A6LA 3LRKA 3RPMA 1LG1A 4W8AA 4KWUA 1GORA 3A23A 2YA2A 3WF2A 3ZOAA 2W63A 1BG4A 2DGAA 1D3CA 4HA3A 1WO2A 3EDEA 5GNYA 4GZJA 2XN1A 1J0YA 1UZ1A 4D6DA 3VGHA 1Q6DA 5FOOA 4CD8A 3RM4A 1XGZA 3WBEA 1C8YA 3NSNA 3UERA 3VTRA 3WUEA 4HMCA 5CGTA 5IDIA 3LPGA 3D4YA 4EANA 3VIMA 1GQLA 4PUDA 3G6LA 3BVTA 1H2JA 1PBGA 3BLKA 4AIEA 1SMDA 3A5VA 3TONA 1GOWA 1VEMA 3ZT5A 1M53A 4WKAA 4JHOA 3AZRA 4PTVA 2J47A 4NSBA 5AC5A 5I23A 4FLSA 2UY3A 1NP0A 1JXKA 3T2QA 1TQWA 2FHCA 3BAYA 1UWUA 2YBUA 3K8MA 2D20A 4PRWA 1FHDA 2ZIDA 1JIBA 5FL1A 2E8YA 4WJXA 3ZQ9A 3UESA 5HNNA 4PMDA 1IZKA 1UR8A 2J7CA 2PB1A 4MAVA 4AD4A 2J75A 6TAAA 3M7SA 5GQBA 4OJYA 1VJZA 2YA1A 4D1JA 3A47A 1J0KA 4C7FA 2OW7A 3GNOA 4KGJA 3WIJA 2E3ZA 2WMIA 2EPLX 3F5JA 1HTYA 2WC4A 3WY4A 4WSJA 4AW7A 2ZXAA 2DDXA 2WKLA 5IFPA 3CZEA 2ZUTA 3HG4A 2CITA 4K68A 4HZ8A 1JG9A 3VGEA 4WF7A 4FNUA 3UG3A 1MFUA 3BSGA 4CN6A 1K9TA 3HJEA 1DTUA 6A3HA 2WVTA 3NSXA 4GKLA 5I3DA 4PTXA 3LPPA 1NQ6A 5HOSA 1ISXA 3D50A 2UWFA 2XGIA 1CLVA 3WL1A 3CMGA 1KWKA 5A2AA 4GQQA 1WDRA 4DUXA 3CHDA 5DMYA 2Y4SA 2VTFA 5HPOA 3WY2A 5KEZA 2WBGA 5A3HA 1EQCA 3VDAA 1EHAA 1KB3A 4J27A 4C7GA 1OGSA 3HG5A 4GI8A 2CKSA 1UYQA 1H0GA 3WNMA 5E6ZA 1HT6A 4F66A 2BY2A 2D23A 1UKOA 1E0VA 4NZCA 1KGUA 5A95A 1EH9A 3EDJA 3DECA 3KE0A 1UD2A 1ITCA 4WSKA 1ZJBA 2VX5A 3T08A 4OOZA 4Z2IA 2OSYA 2BY1A 3CUGA 3T09A 3SCTA 1J01A 2ZWYA 2VJXA 3MI6A 4A3YA 2FHFA 2VRJA 4RE3A 3AISA 1R75A 3L4TA 2GVYA 2XYLA 1KBBA 3WY1A 4FNQA 2BY3A 3EJQA 3M6DA 3EMZA 2WCGA 1KFWA 4U5KA 4JL2A 9CGTA 2G41A 2XN0A 4QCFA 1LJYA 3I3EA 2F61A 1Q6GA 1XH2A 3WENA 1G1YA 3D51A 3MANA 5I2UA 1QNQA 4UTFA 3VSTA 4NXKA 3FW6A 3TP4A 2DSUA 3ECQA 1B1YA 3OGVA 2DSKA 1LL7A 1ZU8A 1UD6A 1EIBA 4CD6A 4P7NA 3ZSTA 5KZ6A 3EMCA 1GCYA 1S46A 2G3NA 2RGLA 4UFLA 2QV4A 3BAJA 2PI6A 4ZXOA 1B3YA 4QCEA 1E72M 3OA5A 1E6QM 1UH4A 2HVMA 2D73A 1RPKA 4HU0A 3ARZA 3W81A 3VD9A 4HA4A 1F4HA 4YN5A 5CJ5A 2OYKA 1SMAA 5D8WA 4CVWA 4YHEA 4GI6A 5DT5A 1UUQA 2WC7A 3VGBA 3VM5A 1OB0A 5CZKA 5A2CA 5DFAA 1B3XA 1DWAM 1HX0A 5LA0A 2X2JA 3ZJ6A 1JYVA 2ZOXA 2A3AA 2YL8A 1LF1A 2XFYA 3TA9A 2WXDM 4BQ3A 3U5YA 1WZAA 4OBSA 3CPUA 4W84A 3CC1A 2CETA 3AI0A 4P8UA 1D2KA 1FFQA 4A3HA 2E9BA 3VO0A 2BY0A 1QWUA 1OD0A 3GXMA 2GDVA 5BRPA 4M24A 2J7BA 1QNPA 4FLRA 4U33A 4JHZA 1B0IA 4TX8A 3W29A 3EDFA 3FNDA 1GOMA 4BQ5A 1BSIA 3FN9A 4M82A 3SEPA 1NOUA 5GNXA 5BWFA 3ZIZA 2W92A 1FH8A 1QPKA 1QNOA 1V6YA 1XYZA 2F7QA 5GNZA 5DT7A 1V0MA 2W4XA 3MV11 4UR9A 4UZSA 4ZE5A 5CPSA 1QHZA 3KZSA 1J11A 1E3XA 2QPSA 3OBAA 1XD0A 3DX1A 4OZOA 3RIKA 1RP8A 1JNEA 1GVIA 3UR8A 1R87A 3RILA 3CZ8A 4PCSA 1HKKA 3L2MA 2VCBA 1ODZA 3WQ5A 3MUAA 2J7EA 2XPKA 4HP5A 4M1RA 4P7RA 1XH0A 1EGZA 1OM0A 3TOPA 2WVVA 1DWHM 5FL0A 5ABFB 1HP4A 4W86A 3AXIA 2V5CA 5EB8A 3RO8A 2X05A 3RCNA 1GQJA 1E4MM 1XD1A 5JIWA 3FXYA 4R27A 4HMEA 3VUPA 3OGRA 1FH7A 1R47A 1JYXA 3MMDA 3ZJ7A 4KGLA 4XX6A 4P7OA 1JZ4A 1C8XA 2CIPA 1JZ7A 2Q8XA 1E0XA 1E4NA 3W24A 1CENA 2BVYA 3WD1A 1CXEA 3WEZA 1BLIA 1XH1A 3BUDA 4AD5A 1CGYA 1V02A 3AHVA 3VIOA 4OBRA 3WUGA 4F9DA 3AROA 4M81A 1CXHA 1V03A 3O9NA 5BRQA 4AD1A 2DSZA 3SCVA 5IHSA 3N11A 4Z2HA 2XHYA 4PEEA 2V3FA 1E70M 1UHVA 2D1ZA 4C7DA 3SIMA 2DT3A 1PIFA 3ZR5A 1W2PA 3BAIA 1V6UA 1UWQA 5EFFA 2PWHA 1W3HA 1EDQA 2X0HA 2ZX8A 2GJRA 2ZX5A 3KWXA 2EBNA 3WKZA 3AIQA 3VDBA 1MQQA 1AMYA 1WDQA 4AC1X 1NWUA 3AMCA 1QI5A 1GHSA 1NOWA 3WH6A 1GOKA 1M01A 3IJ8A 3SCRA 5CQ1A 4DO5A 1E0WA 1QHOA 1BVZA 3DHPA 1MWOA 1AQ0A 4H2CA 3JUGA 1KQZA 3O6AA 4X0VA 4D72A 4PN2A 1UR0A 3WL0A 4Z2GA 1PJ9A 2YIHA 2ZX6A 4HOZA 5D8ZA 5AYBA 1J0JA 3WFLA 1ODUA 1QHPA 1CBGA 2BV9A 4AIUA 4D6EA 5BXRA 3IAPA 4P7QA 2D3NA 1V3JA 1C91A 4UQCA 2JE8A 5A6BD 1I75A 4UOZA 3QOKA 1TR1A 4AWEA 3VMPA 3N04A 4B15A 1E1FA 2CHOA 3QGVA 4P8XA 2F1AA 1V0KA 3LMYA 1UKTA 2CBVA 2CCRA 1Z32X 4U2YA 3L4XA 3NJ3A 1ESWA 1TE1A 1KGWA 1B90A 2DT2A 4WK9A 1CEOA 1UG6A 2WLZA
chains in the Genus database with same CATH superfamily
4YLBA 1JUFB 2EF9A 2EH7H 2MJWA 3M46A 2VGFA 1MJ8H 2DWEB 3AG4B 1GZQA 2WXHA 5B1KA 3PL6D 1KM3A 1R3IL 1FWGC 1RZPA 2YOAA 1JPSH 3QWOA 4G9FA 5EKYA 2TODA 3W7EA 2BP1A 4BEQA 5D72L 1XH3A 3O3AB 2C9VA 4IHOB 5EF0A 2CUHA 4H1LB 4HGMA 5IHUH 1J12A 1J0HA 1ES0B 3H9YA 2P5WD 3QEUB 4AV4A 1XL9A 1Q1PA 2X1QA 4MJ6B 1SPQA 3PZVA 1MJ7L 3K5XA 3RFZA 2VR5A 1V3IA 2X8RA 3QHZL 3WQCA 1DQWA 2X0UA 5C0CB 4HUXA 4FEZA 1SYSA 3RX7A 4CLMA 1UOZA 2Z1BA 4PGDA 2ISWA 5F6IC 1RSCA 3QUYB 2AL2A 1ETB1 4RAVB 2Z6IA 5AHFA 5F7HA 1TQCB 4YHZL 1ZDSA 4XCEB 2AQOA 4H9XA 1KBGH 3SBQA 1NJJA 1WBJA 1J0ZA 1UXMA 1AL7A 4X98A 4R7JA 3DO4A 2IDQA 4UNLA 2XICA 5F93C 4YPGA 3QXAB 1I7RB 1EXPA 1YBQB 4FADA 1KTBA 5FLVA 2VT0A 1Q9WA 1NCTA 3B1UA 3FB7B 3ZZQA 1VYRA 1JV2B 1PAZA 2PYFA 4JKNA 1YYMH 5LGYA 3A0OA 3CHQA 4ZI8A 4XZ4A 1AG1O 2PF8A 4N6FA 4HQQL 1SHWA 3QNXA 1Q0YL 2RBLA 1NBVH 5K93A 3AWEA 1CLOL 4AENB 4H9TA 1A25A 1FZOB 3RKDD 2VC2L 1VFLA 4IH3A 1JPST 1XMWA 4I13B 4LLQB 1TMHA 3G5YB 4BA0A 3L4ZA 4LNRA 1KJ3H 3W0WB 3WE6A 5JW4M 1KUMA 2DQXA 1DLHA 3F7YA 1E9OA 2V5RA 3N55A 4KUCF 4KV5E 2ISDA 2OI9B 2OYPA 4AEFA 1OWRM 1BYDA 1BBDH 3S96B 3L45A 3VPLA 4U1KA 2B77A 3QRGH 3U1PA 5HYJB 2O61B 2X7VA 2VZTA 4H6KA 4XAZA 2XZCL 1LRQA 2YDRA 4WO4B 2QSCH 4GP5B 4G6MH 4WFGE 2CKBA 4ABWA 3LQGA 5DQ9B 1YPIA 1RUMH 2HDJA 4M4PA 1YPZB 4ZMQA 5E8EB 1SVZA 5GGRB 3CFUA 3MJ9L 1AZUA 1RVKA 2B8OT 2WJDA 1M9SA 4GXMA 1C8QA 3EMQA 3HI5H 4K39A 2RQEA 4QJ3B 3MRDA 3UEZA 1MCBA 5H2BA 2GSGB 4HTYA 4W7UA 1GZQB 3NCJH 2WO5A 2YW3A 5D2TA 4LSSH 1K85A 3NCOA 1AYOA 3W88A 3WLWC 4K07A 5TE4H 2UY2A 4KCTA 1B3OA 2NY3C 4Q9RH 5JUVA 2FNBA 2H7WA 4YO0B 1S3HA 2Z4TA 3U0PB 3MRFA 1D8WA 4MXVE 5F0PB 3R25A 2M1KA 3VD4A 3UZXA 1N3NB 2DIAA 1K8IB 1QYGL 2KKQA 3VQ1C 5TDNA 4KDVA 3ZR6A 2DQJH 4JNXA 2O5XL 5EBWB 2KT6A 4ODSH 4CC1A 3P60A 4UQEA 1Q8MA 3SKNB 4XCNA 2FMOA 3HN3A 3AU6A 1P5UB 3VRIB 5HQMA 4GXVH 3BZGA 4GC3A 3L5WA 4N7QA 4ADTA 4FTVA 1VB9A 1PDYA 3JV4B 1U92B 2XFXB 4PY8I 4Q2ZA 5MENA 5FOOA 4NLHA 5SV3A 3C2SA 4X9HA 4RL3A 5D7IA 3K74B 2WZTA 3IFNH 1JV2A 2V7HA 3JYCA 4FC3E 3ATDA 1FRGH 3MAWA 5DD3H 4A66A 4BGLA 3W84A 3YPIA 2NR6C 2DT0A 3PGFL 4PP1C 3VXSE 3P62A 3QRFM 2QLYA 4TULH 4XUYA 2Q8BL 1FLRL 1KGIA 1UD5A 4HS3A 3FYIB 5FA4A 2Y7DA 3CO4A 1YY9D 1RMFH 3H24A 2VITB 3LM3A 4NKDB 1MW3A 4N2MA 4XNMB 1ID2A 1A14L 4AG4H 4PUBL 1BD0A 4W9TA 1WKFA 3GDBA 3GTNA 5FEPA 5G4MA 4W4OC 4WEBL 3S5NA 4C60A 5MHSD 1VFAA 5A8OA 2NY6B 1I8AA 5C0DB 1AXSB 3S97C 4XO6A 3HE6C 5GGUB 1SVDA 1A1MA 2A6DB 4LUTA 4H88L 2BNJA 4O1AA 4KTEL 1SBSL 4KWOA 4XD4A 5E2VH 3NZ1A 4RNJA 4EKJA 3H85A 1KB5A 3KXFD 3B5TA 1F6KA 1VPQA 1NP2A 3G5XB 4FG2A 3WUWA 3KRUA 5M1TA 1GH7A 4I3RH 4J7RA 1J18A 4EN3C 2HX9A 4YLCA 3FTGB 3ULUL 2C3GA 2BRRH 5G4EA 4MX7B 3WFCL 1FIGL 2MEJB 1W80A 3KBWA 2ZKMX 4JDEA 4E42B 5EIIA 3B8VA 3QEQE 1VBHA 4MDJA 2VL4A 1JK9B 3WIHL 5D1ZC 4NOBA 1BVLA 3NQFA 1GYCA 4YWSA 2OXNA 2WNZA 1P4LA 1Q0XL 1P5UC 3BWAB 4QD2E 4UIKH 1N6QL 3RE0A 2NX9A 5FEZA 3PGFH 6REQA 1TPB1 2BCMA 1AIZA 1OE2A 2B39A 3VQ2C 3VU1A 4DKDC 5CSSA 1KTLA 2ITEA 1S7UA 4HJEA 1T21B 1EJTC 2B9BA 2HE8A 4R97B 4PYSA 3TJLA 1ZE3C 1U8QB 1UD4A 4RMRA 5ISZE 5AC8A 1G7MB 2ADIB 1L0PA 2ZAGA 1NA8A 4HSCX 2PE4A 4PUMA 4AB4A 3N25A 1HWWA 3CH0A 4BRVA 4F48A 1L6ZA 2NCEA 3LS4H 4ZX6A 2B59B 3F12A 3B2XA 1G7HA 5IBLD 2OCFD 2DSWA 1O7DC 4IDLA 5AOZA 2CBUA 1OZTG 3DVGB 4LLWB 3BN9C 1N10A 1PTAA 4FRWA 1U92A 3DEQA 1CWYA 1UEMA 1WBXA 3BPCB 4JREB 5E0FA 4OU3A 4PJ7F 3GXTA 4YH6A 4B5ZA 3OJGA 1B4KA 3JWOH 4WD0A 1ZENA 4MWAC 2PWDA 3Q2VA 1VFOA 2VXQA 4I9JA 1IBYA 3TR2A 2R2HA 3GMQB 3WQGA 3ZFHA 3L9RA 1FIGH 5E5MB 3QFJA 4W7VA 1LYQA 2VITA 4P9MH 5F3BB 1ONWA 1SYTA 2B4CL 2BC4B 2OX5A 5T1KB 1XCFA 1GGCH 4OLZL 1E5BA 1RPQA 4AJWA 3RWJA 3PUGA 4O17A 1KQYA 5C07E 4DQOL 4D9LL 2O5YH 4GSUA 3S6OA 1YEFL 4PS8A 5L2KD 2YAMA 3B9EA 1QI0A 5IF0A 3QGAC 3W7JA 1HH6A 1IC0A 4PJ8D 1IC7L 5T1LB 2YUZA 1RUPH 4OIIH 3O6FC 3SCMA 4UBDC 3ATYA 2CO2A 1MWAB 1WIPA 4K23L 4A8IA 5SX4H 1OTSD 4XCFH 1ID5I 4KRUA 3WUWB 4NQSB 4Z8FL 1J1PL 5FM5O 4TXEA 2CJ3A 2FWLB 2J7LA 3C60B 4BFFA 4XCEA 1V3HA 1TE6A 2V2CA 4BKLA 4YDVA 2ZZ1A 3K30A 4KIRA 4B2DA 5F0MB 4E8DA 4XN9A 3IE4A 1DANU 1NCDL 3ARRA 3LB6C 5DVMA 3T3MB 5DQPA 3GLEA 1D7CA 4ONFH 3FN0L 4OM1H 3PQYA 5JXQA 4PI0A 1THFD 4POUB 4PJ9A 1W3IA 2Z1XA 3U9PH 3U7WH 4OFKA 4HPNA 5IIEB 3ABRA 5AYIA 3DHMA 1KJMA 3DJTA 3VWKC 4UQ2A 3U4BH 1FFTB 3MB9A 1DVUA 2W67A 2EUZA 4HD5A 3LM7A 4Z7QE 2RFXA 2X4PA 4Y1AD 1NICA 1PS3A 2EH7L 3H9HB 2VDRL 5F7EL 4U6HA 2V0AA 5T8IA 1MVYA 2JK5B 5DRWB 5EU6A 3MUJA 3C2EA 5D1QC 4FR1A 4LC8A 4YU1A 1G7MA 2ADIA 2W81C 1ADWA 5C0AB 3C08H 1PSKL 4DKFL 3HFTA 5BMFL 3E8UL 4KK8D 3QUXD 5IOPA 2HFEB 4IMGA 2J8HA 1B54A 3O6KH 4Y1AB 1T1WA 4UM8A 1P7QA 1ZS8A 1QPQA 4QBXA 3V1PA 1A6AA 1YXDA 3CHEA 3J2PA 2WJ7A 1VHCA 4CD7A 5A5WA 4JAMB 4NWTH 5EN3A 2CPUA 2E25A 4BJHA 2WOQA 5DS8B 4F7TB 3T0VA 3ZY7A 2IQAB 3QQ3A 1PKLA 3D39E 1KKOA 2QDEA 1SQMA 4PLNC 2R2HB 4QROA 4MQXC 1W1VA 2ZBTA 4RNFA 4BJLA 1CGSL 5M5DA 3UJSA 4P5TC 1MCIA 1UOVA 2HJLA 3RIAF 4PH6A 1FNFA 5IVXA 7FABH 1PX8A 3Q8EA 4QYOA 1EK3A 4YHOL 5GJTL 5FL1A 2CHDA 1AE6H 2CBMA 3QULB 1TFPA 4OCLC 2VW7A 5TFSL 3RZWA 2ZWLT 3S4SA 4YDZA 1ED3B 5D6DA 3VFUB 1FVEB 5FC9A 2AZUA 3VD5A 4AMXA 4J2XA 5DD6A 2MOVA 1YNLH 3ZYZA 2CR0A 2V8LA 2VLLB 2YBRB 4GS7C 1KRMA 1XLDA 5HMFA 5FFLA 2FMNA 1HDMB 4JR9L 5I1HL 5E8DH 3H9SA 1WC7A 43C9A 2VMFA 1MJUH 2FDMA 2J8UA 2AQSA 3UX9B 3CFMA 4BFIB 1TTRA 3Q58A 1OG0A 4QXVA 3NYDA 1Q65A 2NY6D 1BZQK 3RI5F 4HYWA 3TIDA 3VRLF 2CDEA 1TFVA 5IREA 2WPBA 3I6GA 4MHBA 3I50L 5AHIA 4W9JC 5ANMB 1WA0X 1HTIA 1BZ8A 4HSQA 2POZA 5FKYA 2ID5A 3BMWA 1UR9A 4RFOL 1W2KT 1A5LC 3V52L 4OF3A 3GFYA 5F7WC 3RNKA 4PW9A 3KLHD 3T9PA 2FSEA 3N43F 4MX7A 4HBKA 4K94C 3GRWH 1LEGA 4I88A 3TWBA 3WLLA 4ENEC 4UIMB 3RY6C 2YBTA 3I6KA 4NENB 1HSBB 5TQ2H 5H8UA 2H9GB 4IK6A 1AZCA 2ODHA 2VH5L 3KGUA 4Z77B 5LVEA 1FUNA 3GO1L 5LGJA 4L18A 1UT2A 1UWTA 1QTPA 1VFHA 1T2QH 2VEGA 4ZS7H 1IWAA 4MY9A 2XIDA 4UTWA 2C1OB 3SN6N 1PZDA 1VYPX 5ECVA 4YDJA 4N0YH 2R29L 4C56A 5C0AE 1E5YA 2K6ZA 1K3UA 3SDXF 2DSVA 4JHWL 2EDWA 4O02H 3F2CA 1KTLB 5C0DA 3VA6A 1YMMB 4G8IA 2Q10A 2NT1A 1DJWA 4V1DD 1EFXA 1EZLA 4ZFMA 3RG6A 4AGQA 1G9HA 1DIOA 2X12A 4IRJD 4CNIB 1YSOA 1XEUA 2GVGA 3P61A 3ZRSA 1XGPB 1F7BA 5FO8A 2QYGA 3LCHA 4IFRA 3KBFA 1A4MA 5T1JA 1I3RB 4JFEE 2FPTA 4XAKE 4CGTA 3PJLA 3GAYA 3S9ZA 5LXEA 1RZ8A 1PX4A 4TO8A 1KT2B 1QO3B 3SBRA 1RSFA 2WKJA 2Q20A 4JX5A 3VIFA 4UMCA 3VKJA 5KETA 3F4NA 3R8BB 1NDZA 2I85A 2Z64C 4JQXA 4Z1DA 4PR4A 1HCZA 2VAJA 3IK2A 3LQMA 3VUSA 4RMUA 3LCFA 4JKLA 1PKOA 1PLCA 2XTJC 4K4KA 2FJHA 4OZHE 3N1AA 4RFOH 5HMEA 1I7ZB 5T1KD 3T6ZA 2CBJA 4W5ZA 3VXUE 1H51A 2AQQA 2VUYA 4EPEC 4JFED 5HVHB 2PLKA 43CAA 3GS4A 1YNYA 5TDOB 1EMTH 4I1RA 1JK8B 3C3NA 1NCUA 3HUJB 2OU4A 2PCFA 4L9XA 3V55A 3M88A 2MCPH 2IW0A 2FCBA 4HNNA 4FF5A 3MLZH 1RJYA 2JKIS 3WX7A 4R4NC 3W7HA 4JFZL 2LLLA 2FBOJ 4IMKC 3V10A 1T8QA 1F1AA 3QYQA 4JFUA 4R2GC 1HNFA 1KGJA 4ZMTA 4DAFA 5CEZL 2XIQA 5TGBA 4X5WA 4C6DA 2KH2B 4AVHA 4LMQI 4Y4FA 4KTEH 1E6JL 1RCYA 4HXAL 1MCFA 3MREB 3TVMB 1RQHA 2VOMA 3W7IA 1F4AA 2Z0UA 1P4IL 3BEWB 3DVIA 4YDVB 5F89A 4LAOA 3E6HA 4I3RL 3WLBA 1FHGA 2DQUL 2B7OA 4DVBA 3LXBA 1ZV9A 1FG2A 2WLNA 4JO1H 3S4SG 4B3ZA 3MROA 3T3PE 4TQPA 3RPIB 4RPPA 2YK1H 5AG8A 1SJDA 4N2DA 3BKCL 3L65A 5EZOL 3QR2A 1X4ZA 1PS9A 2A6JB 2WXOA 3G6DL 4NX0A 2PDHA 5TBOA 1RIHH 4FI6A 4CMHC 3VFGH 2XETA 1CFQA 3KL0A 4P3DA 4YVPA 1JZDC 3SHSA 4O02A 1YYAA 5A6BA 5G1MA 3PXJA 3BVNA 4H2AA 1AJZA 5IB3A 1T7LA 4LVGA 4XH2A 5I26A 4NNXB 5LBSA 4UCGA 3LKRB 4C6IA 1IGFL 2YLKA 5IFHH 3NL5A 4MAUH 3PZOA 5DK3A 3OEXA 4AEIL 4GX8A 3H2OA 3RN6A 1F2XK 3TAKA 1FWJC 1FYTA 3KH4A 4DO4A 4OCWH 5IZ7A 1UATA 5FCZA 2PC8A 5EPMA 2DMGA 1T2JA 3OG4B 3FDGA 1W3LA 3G04A 1KJ2A 4Q7IA 4BUGA 5H1WA 2LFEA 3V7AG 2YDSA 5IFJB 2YPLB 1E90A 3TQKA 4G2DA 3HB3B 2YGYA 1V3KA 2EH8H 1HL8A 4M7LH 4BCYA 5ID1A 4DBDA 1T3FA 1FFNA 3DVNB 4EEEA 2ARJQ 3CEPA 1L9NA 4APXB 2UZYB 4I89A 4NJAH 3SOBL 3SDAC 4B9JA 2O7QA 3ALFA 2DWXA 3ESPA 1XUUA 4KDWA 1IIHA 3K1KC 5J1AB 1BYOA 4RA0C 4EOWH 4J5VA 2V5DA 3RMJA 3C8KB 1F4WH 5E6RB 1DFBL 3ZL4H 3MYOA 1QRNE 2HPOA 4K71B 3FGCA 2NSMA 1F1DA 4OJCA 3VNYA 1QFUL 4NDMB 3QNZB 3UXDA 4HWNA 3BLIA 3OKKA 4AUYA 4YVVA 1EO5A 2HRLA 1N2RA 2Z93B 3MNWB 3HAEB 3IJ7A 4LCWE 3ECUA 3V9EA 4EJ1C 3GSMA 1ICPA 1R3LB 3BPNC 1MH5A 3WBDA 2AGKA 2JJVA 1S3TC 4UFKA 1JE6A 3EGXB 5CILL 3E2SA 4OLVH 5DD0L 2CERA 1T0OA 1NGPL 3CEUA 4QAWA 4RSVA 4LO9A 2CLOA 1TV4A 4OOUA 3ABLB 4IIQA 1W9XA 5ERWB 2ZXCA 4G8GD 4NNYA 1WGVA 3L3HA 5FA3B 1AO7E 2R94A 1U2HA 1U8OB 3AIEA 3OG3A 3MV8E 2J7FA 1VH7A 3FQXB 4JRWA 4N26A 4U3SA 3U4EA 2VUNA 4K7YA 2WWDA 1P5BA 5GS0C 4KJWC 1G1KA 1SGKA 3AU1A 4G3YH 1FO0A 2AS5M 2AV1B 5DYFA 4XWOC 4B9GA 4L1BA 3C86A 1YY9C 4M7LL 1AH1A 2L4OA 2Q3AA 3WO3B 5TQLA 4GXPA 4JFSA 4CKVX 4CILA 5D7JD 4HUNB 2JIEA 2VR9A 4FKKA 5JHLL 3NXFA 2JLLA 1IFHH 4K3GA 1W17A 1FC1A 2AGTA 3U9WA 3RX4A 4LRIA 4M8RA 1OC6A 3QZ6A 4Q6IB 2OBGA 1S7VA 2X4UB 3PJSB 3DGGA 1CCWB 3GNNA 4WI2A 3Q01A 4RZKA 5GZOD 3KLKA 2CBIA 7XIMA 4EN3B 4G42A 2BZCA 4WWOA 1KM6A 3HC3H 3D69A 1KLFB 3V4VA 4LPWA 4EE2A 4XT1C 1S1PA 1W6LA 5ABAA 3RAJL 2XN9D 3HZ3A 1C9DA 3CK0H 3BVWA 1QUPA 5JW4R 1KNWA 4HJIA 1YDYA 1A5FL 4GUGA 4KEZA 4OD1H 4A67A 1WLHA 1R19A 4GBUA 4KKLD 3IGFA 1AQHA 1TJ0A 4PMQA 5DGRA 4K2SA 3K8KA 1XC6A 4P2QE 3WMQA 2XPYA 1XIIA 1N64L 4ZFOL 5F9OH 3UA3A 4KZEL 3T1FB 5FGSA 1TZIB 2YARA 2C3XA 3PG2A 4ODUA 4U05A 4FHKA 5F7FA 2CRIA 5C71A 4CJ1A 3TFKD 3KGTA 2PURA 3VVVA 5BW7C 4HUXB 3PCYA 2QCDB 2C4FU 4ABVA 2NNFA 2WIIA 1FNSL 2KERA 3N9KA 4J8RB 1TQTA 2RAGA 4YFEA 3IVKB 4GFSA 43CAB 3O15A 4NQCE 3M43A 5HDQL 4XPBL 1A1NB 4HIXL 2FFCA 4MA7H 4Y9PA 3QYCA 1W1PA 5SWSE 2C9XA 3S37L 3GPSA 3DHFA 1SMOA 3NSCA 3LMJL 1L9OA 2QPDB 4PJ9C 3ABSA 2RH9A 3HGRA 4S38A 4HOWA 3HG2A 3QUYD 3KPMA 4HBCL 1CFMA 3AVEA 5SWZE 5I1EH 4LEOB 4Y5XA 5AB3A 1H15A 3ZTNH 2ZPKL 5D96C 1RSYA 4POCA 3ZDXF 4QDWA 2X28A 3ARFC 7CGTA 2C3VA 5FUCC 1RVFL 2ADGA 4CADA 3BUTA 1JPMA 3PULA 1JFXA 1PZ3A 3A21A 3VKAA 5AW9B 1CICB 3K3QA 1LQ0A 4X7TA 2ED9A 2APSA 4P2RD 3O6FA 5J89A 1T5XB 1RUQH 4BZ1L 5HYQB 1G6RH 2FZMA 4RJEA 5IVOA 5FW7A 2NY3B 2NX3A 4LC6A 3TO2A 1BGAA 4O52A 3SDDA 2V9DA 1E73M 2A4EA 2HK1A 2WMJA 5E8OB 1OGAE 4HC1L 5C0JB 3PZUA 5CXPA 1J2WA 3GIVA 2BSCA 4PY7A 3SE4A 2FWSA 2IADB 3I9GH 4X9FA 3ZDWA 1EX5A 2C19A 3HJZA 2DKSA 2WYIA 3KLAA 2WTRA 4D2NA 1O4UA 3SCWA 1MFBL 1NLBH 2C9QA 2WZ6A 3WNLA 3VGGA 1JUEA 4ZENA 3TQPA 1NUDA 4JHWH 4R4ND 1MFCL 4P9HC 5J12C 2GG1A 1E0TA 5H2BB 2VDHA 4J3TA 3B0YA 2E28A 2VX6A 3CSPA 4JS3A 3KGRA 3RTQA 1KCRH 3NZSA 4MZ3A 2XBTA 3TC3A 1J5SA 5K1JA 1AR1D 1HKJA 2BNQB 4DJED 3V9CA 4KEMA 2UY7B 1E8WA 1GZ1A 3QCUL 1RZGB 5EMYA 3QW9A 2AKZA 3GU2A 1D6VH 4WFED 3VFOA 4MJ5B 4D9QE 2OK0L 2G9HA 3OHIA 3MDWA 3ZVHA 4YHPB 3FU3A 4NT6B 4X6BA 4L4TB 3FO2B 4JM2B 1EJOH 1RH8A 3ULVC 2Z1VA 1UBSA 6XIAA 3CJPA 3IANA 4G6FD 1QI2A 4FQ1L 4L3EA 5I16B 3QHOA 4NAFA 3NOIA 5DC9B 2DUXA 2N7AA 3VOIA 1KCWA 1EP1A 1M6UA 1EJWC 1KCXA 2AQ1A 2OMVB 3QXWA 4KROB 2YL6A 5JVLA 2NSQA 4AZHA 5BVPL 3I6TA 2XFXA 3G5WA 4K9EL 3WFEH 3LKQA 5AOIA 1CGVA 3R43A 1EJ8A 5EUOF 3ZDXE 1KBJA 1YX1A 4S3BA 4ILSA 4AM0Q 1ECQA 2DY2A 4CC4A 3OPUA 3SOTA 1RALA 1HHHA 3D0AA 4PWHA 1VPXA 3BH8A 3NQMA 5FM8A 4YMZA 2CBQA 4A8RA 2YL5A 5AY7A 4F7CA 1D3GA 4MNKA 3MLTA 2JCCA 2K7PA 2OMZA 2JFCA 3D5OF 4KHXL 4NC0B 2J44A 4XNAA 2OJPA 1F4YH 3WJJC 2OAAA 1JYNA 2Y5JA 3EYFA 1AZRA 2Z1KA 4ZUTB 5KSAA 1Y07A 2BVUA 5D7SL 1T5KA 3KLHC 2G30A 5SWUA 1NFPA 2HMIC 3ZHDA 1PDKB 4Z5RB 2DYPB 2F54D 3FUJA 3LQAL 3KWTA 3CZGA 3WAJA 1PYFA 3A12A 2X1UA 3D3FA 5CAYB 1JNLL 1IFGA 4NO0B 3BAKA 4XMPL 5JQ6H 3BN9D 3R5EA 3ZM8A 1ZLSL 3M45A 5BMWA 5JOFB 2NMSA 3N2OA 4FQXA 3GB7B 2PW2A 4N85A 2WJZA 4O16A 4LBEA 3BAWA 4LV9A 5D71H 4X42A 3KYKH 4RRPM 1JPFA 3P3TA 1RR2A 3RNQB 3I6LE 3EXJA 3I6EA 3L4VA 4AZCA 4OCYL 4FI7A 3MCLL 3BPLC 4XN8A 2Z31A 2WQUA 2DI7A 3JVFC 4L3CA 4MDOA 1GJIA 1BGXL 1KEGL 5G4NA 4DLMA 3TBTB 4HHAA 5BS0E 2OCCB 1KFBA 1Y0EA 4LT9A 2H8PB 3NQAA 5EO9B 4GP8B 1N5YL 3P30H 4P5TD 4PMVA 5HYEA 3KPSB 4AJVA 5GS2H 5HYIA 1ZGLM 4GA8A 4PGLA 3FZUD 1CGXA 3CBWA 2UV8G 3GJFA 4ZZ9A 1ND0A 3HBQA 4OI9A 1MRFL 3VFMA 1AKJA 1YNKL 3OKEA 4Z3GA 4MY8A 4HCDA 1V6WA 2HTKD 2EJAA 4FB7A 3L3JA 3ARSA 3QIBC 3UR2A 1GJPA 1JHTA 3RL1B 2XU2A 4L2YA 1KCVL 3X3GH 1A65A 4BFGA 2LT9A 4W8BA 4AU0A 1BFTA 3FPYA 2YPLE 3QVAA 4O5LH 5F4SA 4IQJA 3OKLB 5GIRB 3N6YA 2DOCA 3QQ4A 5D9OA 3UGXA 3JWOL 1B3WA 5LNRA 1RK1B 3PV7A 2J12B 2YFNA 1EAPA 4X4ZA 1XYAA 2CYGA 3KX6A 4GHRA 4UTHA 4A4AA 5E6IC 3SDAB 3V0AC 2QDVA 2Z24A 1KIQA 1R5WA 2FZ8A 5A94A 4GRMA 2ZP0T 2X1PA 4BDVB 2APVA 2B4CH 3UTZB 2F1BA 3BSZL 3HVNA 4G72B 3ZLHA 2ROXA 1S2TA 4XKMA 4HKZA 1LDPL 3UABA 5FAGA 5KVGE 3NGJA 1TZIA 4KUZL 2CO7B 2HKFH 2OFQA 4HV8A 4P2OA 4PRHA 4XAYA 3BP6A 2NQHA 3RHWK 5IHZB 1GHRA 3NR0A 1MWAH 2DBJA 4RGOH 2P8PB 3HBLA 4UOJA 1FL5A 2WXLA 3G1YA 5HHQA 3EOYG 3U6WA 1Z5LA 4QCIB 2OSLA 2FZNA 3QZAA 1E7VA 4J3OF 1BDYA 3BOFA 5D4HA 1JFQH 3EF7A 3NQDA 1AGDA 1MREL 4OCSH 4WRLA 5KYYB 4N8VG 4XQ6A 2PFHA 4W5UA 5EC2A 4AVNA 4E8GA 3GVQA 4EX4A 2XVKA 4X3ZA 3GNPA 2P88A 4WFHE 4G9FD 3CWOX 3MA7B 3N14A 3I2CH 4HU3A 3CDCA 3EYVA 3W6MA 3VI4A 2HKHL 1ME7A 1I9RL 1FWAC 4ODVL 4UFJA 4P23C 1WBYB 4HK5A 1GPOL 1PZCA 2AEWA 1QWHA 2YKLH 5CJBA 3SRHA 3ZYOA 1AY1L 1X39A 2A6KB 3O9WA 1BXUA 1MCHA 2HCZX 2ZZUT 1QNIA 4RFNB 3E2QA 3TYZA 3AT8A 1F61A 3ITLA 3B3BA 2UY7A 4IRJA 2CJTA 3RFZC 2BVTA 2VDRH 4HUMB 5F7EH 2DQIL 5GPRA 4DF1A 1IGWA 3LU2A 3HC2A 2V6AA 4WCYH 4X6FA 1VLWA 2QJDA 3LI1A 1XR8A 5E5LA 1NPJA 2A9BA 1MUJA 5F4WA 2GCYA 2OFJA 3OLDA 2CA3A 3ORJA 3ORWA 3TK7A 4S3JA 4L9LC 1JDCA 2K0RA 4UQ9A 1NLDH 4NRSA 2Z91A 4XCCH 1G4EA 3CWGA 3DIVA 3P3YA 3P3UA 1NDVA 3H7LA 2DIBA 2WNWA 1ICSA 2YCKX 5D05A 5GSRA 4G9DB 5LBSH 3BFOA 5EOTA 4AKPA 1V51A 2IC2A 1NBZA 3NQEA 3ZWSA 3PNWA 4MD5A 3WNOA 1G69A 4H9ZA 2BK8A 4IKKA 1FQ9C 4RWYL 1D2OA 3EYUH 4M7SA 1HVXA 2YDQA 3GH5A 4QTHB 2XDHA 5BXFB 2FKPA 2XDFA 2QPUA 5DJ6A 4AQOA 1GHFL 4PMFA 1ITBB 4KVNL 3IBOA 3RKDC 1PX3A 5DD6B 5HVGB 4QKTA 4YHKL 2NW3A 3BRGC 2YKLL 1PF3A 3GSOA 3U9IA 4M1CD 2R0KL 2YSSA 3ZLQC 1ZUAX 4DXXA 5DT1H 5ILTH 1MELA 3LZ3A 1YQVL 3WLQA 3ZYIA 1XISA 1IR2A 4QRAA 3JUZA 3FT1A 3IJQA 4MMZA 4NN6B 2X4TB 1S2AA 2Y2YA 2ANUA 3NCCB 3NQBA 1G4RA 4B9IA 1EX1A 2R82A 5BROA 4C6BA 1TWDA 2EEDA 3R94A 3S6TA 5RUBA 1IT9H 3RWDA 4MDPA 5J13C 4Q8UA 4HT3A 1AQDA 3HE6D 5HGAB 1F2JA 3NZRA 4NIRA 3S35L 3UR7A 2HVKA 1HKIA 3DOSA 1KV5A 3FJ6A 1KBIA 4YHLL 3AHXA 1S3KH 3WJLC 2P3ZA 1QNRA 3QA3A 1EXHA 2XWCA 4YDKH 2QQKH 1O9ZA 1SDYA 2H9GA 4HPOL 4DUWA 2GQAA 1QNVA 5HQLA 4YDLB 1TWWA 3CVHB 4CU6A 2OP4L 1IO4C 3UD6A 4DFIA 3TEXA 4YAQA 5I1AA 3DGCR 5B1AB 3L4YA 3G6MA 1QEWB 1JHLL 4K3DL 4GAFB 4E8CA 4OM1L 1T2QL 5B8CB 1G0XA 1QEXA 2HPMA 2FH6A 3IJHA 1S7SB 3WTTA 4DKEL 3KWWA 4OW6A 1TYGA 4HIIB 3N2XA 1PZSA 1ZOXA 2OEKA 4AIBA 1SZEA 1MNUH 4ETQB 1XG4A 4PBEA 1UASA 1QBLH 2X2IA 4IU3A 3FSVA 4TSAL 4XKYB 3SO3C 4XX1G 3N1GC 1KB9J 2PGRA 2WB7A 4B9KC 4P99A 3MLRH 1GTEA 5JO5B 2WZHA 4HCHA 3SCUA 2ESVE 3QCVH 3NO1A 1DVTA 4KWVA 3QXTA 4DM2A 4N9CA 2F5BH 4MKTA 3FQNA 3C2OA 4JNZA 3EX6A 3X11B 3RR4A 3TCLB 1BBDL 1JF5A 3HRPA 4XMWA 1Z66A 3H70A 1TCDA 3S5ZA 4TVDA 3B9KB 2BRQA 1DWGM 4LCWD 4AZCB 3ZKNC 2WXPA 1OPGH 5JW4N 2H0JA 4AYSA 2JALA 1OK4A 1G94A 3UC0L 3U0WH 3O3DA 3WQ4A 1J5DA 3N85H 3B6SB 3ZTDC 3RI5K 2BCKB 2EKSA 2EDYA 2ZCLL 5F72S 5AEAA 4UMAA 2F53D 2ATMA 3QHFL 5AD0B 4FL4C 3SGJC 1GOIA 2GSMB 4NZTH 4XPGH 1X5AA 3VXTB 1IVTA 1NWTA 1W0MA 3NQ2A 4K8RL 3TESA 1T6MA 1YDPA 2W0FA 3H7RA 3PBMA 1TA3B 5FD0A 1OCOB 3GM8A 3MV9A 2DKMA 2XVLA 3WD2A 3M0JA 5I1CL 4BWTA 4W9GC 4XPAL 1RCXB 4WY0B 2ZG1A 2FLBT 4H0LC 5DUMH 5AB2A 5B8CC 3C0JA 4QJ1A 3SPIA 3W85A 5T33L 4UU9B 5I09A 1QU4A 3LBMA 4FP1A 1G7UA 3M5YA 1X4XA 5A3ID 2RGSA 1H0IA 3CMFA 2X6UA 3S8HA 3C5ZC 3V0VA 1DQQB 4HB7A 1WT5C 2CNZA 3DBXA 1G9MC 3CFNA 3VXOA 1EZUA 4AX7A 2C9UA 1SN0A 1NKGA 2WJFA 3L9CA 4LSPL 4N1CA 2LE9A 4GXVL 3B7UX 2EPNA 3RL2B 4Y8DC 5FF7A 4YTTA 1M41A 2X2HA 1J0IA 1T6BX 4IPIA 4Z8FH 3H42H 1ISWA 2DLIA 3MLUH 1BFNA 4JTAA 4B5TA 1E5NA 5AKTA 2EC8A 4XNDA 2NSXA 2IO5A 1WCQA 2UWEA 4Y4KD 3NZGA 2XWJA 2FVKA 4GMEA 4XGZA 5EA0H 4F27A 4U10A 3HBPA 3S2MA 1AAJA 1KLUB 1YEFH 3RTQC 4IGHA 3PL6B 4PY8J 4U4IA 1T83A 1FZOA 2FATH 3W56A 1UW9A 4IPNB 3IDXL 2WY3B 5I8EB 4RDQF 1ZVNA 2KL6A 1CIUA 3QV8A 1NMCC 1PKYA 2GOKA 4LF2A 1PCXA 3CIQA 5JPMA 1H49A 3FFCE 4IQLA 1GPFA 2PP3A 4JM2D 1BD2A 5H37H 3R4IA 3LHPL 5KBKA 3ARUA 4KBXA 4BZ2H 2WBJC 1A6ZA 2UY5A 2ALDA 2JMRA 1XBRA 3IDMB 2IQTA 2JJUA 2Z1WA 1XWYA 1ZBKA 2WINA 3P2TA 1NCWH 2Y25A 2JV6A 4XP9H 4FQPA 3BLOA 3QYMA 1E4IA 5TNVA 4UFMA 4U1IB 2J8UE 2FBRA 2IH1A 1CVRA 1QVBA 4MSSA 3IFPB 2W0FB 3DGDA 4OFQA 4UTMA 2Z93A 1N2RB 1XH3B 1ZPUA 3J8F7 2RA1A 1BQHB 3MNWA 4AGMA 1DE6A 5FIPA 3BZ4B 2JIXB 3QHTC 4ERIA 2TRSA 4Z0BH 1SLUA 2BVEA 1KYOK 3ZE1E 2NY4B 5IMKB 3B0XA 2E9MA 1YEHL 4MMZB 3FYPA 3FNKA 3D07A 4UBDD 3OVQA 4U31A 1K8DA 1GOFA 4HUKB 5EZLA 4O2EA 1VLIA 2AXGB 2YYUA 4LP4A 2Z28A 5GGSA 4IOIB 3FBKA 1DBJL 3NDZE 4M5SA 5AZUA 4NERA 2VE6A 3BLPX 1B9KA 3KBJA 3CBKB 4EF3A 4JQAA 4WEVX 1A1OA 1OAXL 1PD0A 5HVHC 4XCNB 4CAGA 3V36A 3OLIA 3VE0A 3QCVL 4FQQA 1BG1A 4H40A 5K4XA 1QYGH 1X7QB 3FULA 5BW7A 1GQKA 1OSZB 1EO8H 3PHSA 3VFCA 1EDHA 3OLGA 4AZ5A 4IK7A 1WEJH 4BK5C 5C7VA 1J8HA 2WZ0A 4WI6A 3ZDZE 1P4IH 3WQ8A 2OMTA 1NIUA 1MXGA 4E6MA 3PJSA 3FIGA 3FTVA 4P5MB 1HEJC 2WVUA 2VDQL 4OSUH 1QWGA 1RK6A 2OV0A 2Y36H 1MN4A 3IJHB 4A2GA 1T99A 4U4BA 4UIOA 1K4GA 3B7SA 3L3IB 4R4FL 5BOPA 1A0EA 3RWFB 3Q8CA 1GVRA 4LHUB 5LDUA 2OL3B 5ESAB 1KFLA 4S1SL 3KZPA 5CKAA 4LAZA 3ULVE 1JN6A 3CZFA 2JKTM 5JW3H 1LQ2A 1BD2B 4LLAA 4R84A 1TWIA 5DQ9A 2HVKB 1RUPL 4OIIL 1Q72H 1GS8A 3QIUC 4MAUL 4PJIF 4W6WB 4ZO7A 1DWIM 3HZYB 1REQB 3V7MA 2NQLA 1FFPA 3DRTB 4LRIC 4FXLA 5KYWA 1U30A 2A77L 4OJEH 4XVJH 1A6UH 2YOCA 2LLEA 5T8GA 1Q0EA 1GXEA 1S7QA 1L7IL 3BAEH 4XHQA 4CA4A 1DQUA 3WCYA 4EI5D 3QDGB 2G2RA 3O2LA 5A6MA 3A6BL 4Z7AA 3QDME 1M65A 3DIFA 2R4SH 1V0NA 5ACLA 2X2GA 2DJUA 1S9YB 3ZSSA 5L2JA 2ZSVB 5DJAA 5E70A 2HSAA 4EUPB 4LVHC 5LCVA 1OF8A 3WL9B 1FL3A 3KPRA 1LUCB 3AXXA 3DSNB 3MHUA 1ZVSB 4IMKA 1NF7A 4HCRA 4ZD3H 1IGCH 2OR2A 3E0LA 4RV8A 3CZUB 1BAWA 2Y1ZA 1ZTXL 1FPTL 4A6YL 3H6OA 1HNYA 1OT2A 1OEPA 3BXWA 2IAMA 4GAAA 4EI6B 1A0QH 1PGRB 4DM1A 4MIMA 2D4DA 3FDWA 2XA3A 3FHAA 4FHJA 3VQMA 1NFGA 4BXVA 4JGJA 3HMWL 2P26A 3LZRA 4JM2F 3ROOA 3MLSL 2ESVB 1UC4A 2BNUB 4GKZA 2MCPL 3ZKQD 5CILH 3NA8A 4EZJA 1DVQA 2ZVIA 2V5LA 3ID7A 3SE3A 1MRDL 2KZKA 5I18H 4YNGA 1SYVA 1PCSA 2CEQA 5EBGA 2AABL 2PTWA 3GKZA 3NPSB 1ZIAA 2EINB 2ZUQC 4KX8A 2NNAA 1SJCA 4AD2A 2W62A 3L17A 3VXTA 4C54A 4ZQMA 5D93B 3ULSB 4Z78B 5SWQB 3MWCA 1E4WH 3W39A 2P5WB 5EL1A 1KTKE 3QDMD 2DTML 4XXWA 4YL4A 4DEPB 5I02A 1EPFA 1KCBA 1PKQA 3PGCA 3VYPA 3PZ9A 1XHGA 2XXGA 3HG1D 2IV8A 3VG9C 1BJ1J 3BWWA 3E2VA 3BG3A 5CC3A 2JWYA 4Z0JA 3KBHE 3BEVA 4PB3A 3MXVL 1R5VA 3LH8A 3TV3L 4O4VA 3G3DA 3QUHA 2OQHA 3ARYA 4P59H 3KCWA 1QFWH 5DHXB 4L4TD 4LDCA 1EFZA 1IZJA 1WQVT 4U6TA 1HL9A 1KB5B 4L5FE 5DO2C 2NLIA 1UWYA 4O0KA 12E8L 3UPCA 1RV8A 1GZGA 3T6XA 3CXOA 1A7PH 1URLA 4G7RB 4JFEA 3E5PA 3OAZK 4RLIA 2P48B 3P0YL 2A7RA 4KROD 3RY6A 3PBUA 5AYXA 3EOUA 2C91A 4FXSA 3VWKB 2W38A 2I7SA 2QQNL 3FU5A 4MB4A 4UQ2B 4AEIH 1Z7AA 4HDIA 4Z08A 3HZMB 4KBPA 3U57A 3WS6C 4XZBA 5C07D 3B37A 5I1LB 5FYKL 4ELMA 4WI7A 1XG3A 1X1OA 2PKDA 1MCJA 2FEDC 2HUEA 1BX2A 3PQYB 1MCKA 3B8SA 3EH5B 32C2B 3PWLB 4UINH 4X7FC 5JQHC 2PDWA 1WVZA 3DX5A 3QPEA 3BGMB 4UFHA 1ZT4A 1M7DB 2WLKA 3MNVA 2NY7H 2Q5BA 3L9BA 1ZAGA 2EXYD 3H4XA 3VFWA 4TR9A 4DPQA 3RA7L 3CV5A 3C2FA 4FG6D 3S5SA 4QSHA 4Z1AA 4CVXA 4OIFA 3WIFA 4OHQA 1KXQE 2BWGA 4AIOA 3KS0J 3C09B 2ATAA 1HZYA 2R29H 2IANA 1RZFH 4KRMB 4MNGA 1FWBC 1G1OA 4WJ5A 2GYSA 4I0PA 1NIFA 1KN4H 2AMGA 3N42B 3NN8A 4OV6F 5IW1B 1AXTH 1X9QA 4ECNA 2BNUA 4GKZB 5I6KA 3K6SB 1PV8A 3T0BA 3LLDA 3PLYA 3MRKB 4GH3A 4WY0F 1NTHA 3WUFA 3U46B 2KI6A 3T3ME 4XODA 4PLJC 4P5TA 5I0DA 3TN0B 1A1OB 1G7VA 3N0AA 4UDUA 1ZY9A 4R4BB 1DQMH 5DCEA 3QULA 4U1LB 1OT1A 2CDFA 1H5BC 2R23A 5TH2A 3O6KL 3SD5A 5C86A 4GAYB 5JXAH 3PAUA 3NVQA 4PS3A 4V1DA 5EOCJ 5C6PB 4S3DA 4EN3D 3NA9H 1PKQB 5KVEH 1OAZH 3DFTA 1AXIB 1V7ML 1F4WL 4CMMA 1U21A 1Z3RA 1YTKA 3S3CB 2YR1A 5HINA 1SOSA 4Y9BA 1CFNB 1HAUA 5I3JA 1V7YA 1ZV2A 1UXSA 3ZKMD 4DZHA 1W72L 3BICA 1HINH 2IGFL 1MZHA 4PCYA 2GGHA 1MCWM 2VFHA 5ELIA 3CDGB 3UGEA 2NX5D 4QXGL 5B3NA 5I19H 4OZIE 3ESUF 3DX0A 4NO3A 1XINA 5FI8A 1JWUB 1N8ZA 1I1RA 2VZSA 4CEUC 4GINA 3SPVB 5DZJA 1MCEA 7FABL 4MYXA 5D96B 5C9WA 2Y5TB 2P5EE 4NZRH 3KPNB 1YC8A 4BGDA 4M5ZH 3MTXA 4QXTA 3CV1A 3DTXA 4PN6A 3HFYA 4GG8A 5KMYA 1NMBH 1X7IA 3BVUA 2ODIA 3U25A 3AYSA 1CE6A 4EBQL 4QWWD 5LN8A 1A64A 5C0QA 5IB3B 4S3GA 2QFRA 4L3ED 4MADA 3MLYH 2X42A 2MQGA 4JGDA 2Z1PA 3MZTA 3SPCA 2ZTJA 3ZHFA 4M6NL 4ZUUA 2L7UA 4MAZA 4M5YL 4LYKA 1O5XA 1OYAA 3VXSD 1BMWA 2Z4QB 4JY5H 1WIUA 3VXRA 3R12A 1MI5A 5FO2A 1R5IB 4PS4H 4D6CA 1KIPB 5I8OL 4XMUA 3AQUA 1HSBA 4WEUD 2H32B 2LAAA 2TRHA 1Z6KA 3KPPA 2AKRA 1FA4A 1H1YA 5LGJB 4HNCA 3VOHA 2CO6A 5DEFA 1DLHB 3F7YB 3VFGL 1NDTA 2VDKB 4PRAA 3R8HA 3MV9E 3UYPB 1TSRA 3LENA 3UETA 3VNZA 3NTYA 3TO4C 3VFVB 4HZ6A 4AEEA 5KBDA 3BO8B 3MGOA 3D3VA 3HS8A 1S7TA 4G6KH 4AUUA 4LNVA 4ACTA 1QTSA 1FBIL 3ELAT 4JPIA 2XM2A 3OJMB 1FWNA 3O9WD 1FFPB 2YWZA 3DRTA 3U9PL 2GL5A 4HBQA 1VBJA 3L5XH 2AERT 5KJ4A 1TVDA 2Y6SD 3M5XA 2ICWA 1PZBA 3RWEB 3Q9QA 2R2EB 3C9NA 4F2BA 4UTTA 1TKWA 1NWSA 4Z1YA 3NT0A 1MZZA 5GRJL 5HHQB 1BQ5A 3MI2A 2ZE3A 1KCKA 1EJRC 1IE5A 3T04D 1MWAL 5L8JB 2R24A 3A4DA 4Q6IC 3L5AA 3FFCB 2D2CC 1IKFH 4HFUL 4HISA 3GIPA 1BAFL 1WEJL 5C0FA 3H3PL 1ED3A 4XN2A 1F4XH 1VSCA 1IC4L 1KGCE 1GTHA 2YAPA 1CI1A 2MMXA 1W0VB 1B0RB 5J11B 1O75A 3LERA 1UXWA 4D9RD 3P14A 2JI1A 5DRNB 2Z8VC 4YIWA 5KVFL 2Q3RA 1OSEA 2VXVL 1VBUA 4IYKA 1U3JA 4N1EA 1QHQA 2PTVA 1LDCA 3LMJH 2EHHA 4K6AA 1J88A 5HQEA 1X6UA 4G8EA 1JV5B 3GUTA 2NY7L 1W8EA 2CLFA 2YD8A 4V15A 4RAUA 4JPKL 1MG2C 1XWVA 4KKRA 3GC2A 4O2FA 1H3VA 3C3UA 2Y7QB 2UYLB 1URZA 4KNQA 2HFFA 1TIUA 4UQAA 4H6QA 2BINA 4XHJD 3VWKA 2QCLA 4EAYA 4F2TA 2ATPA 3RWHA 3OMZA 4GX9A 4PGEB 3WNNA 1HIML 3N43B 5EUOE 1WHOA 3K4WA 4AK2A 1C5CL 3GYCA 1F18A 2DIEA 2WNGA 4LEBA 4MJ2A 2H1XA 3C5JB 1HILA 4NN7C 1TRDA 4GW4A 3TN0C 4RQQA 2X4OA 4HJUA 4ODBD 2VX4A 2RCSH 5ABZA 3CQ0A 3PNWB 4MD5B 4PRAB 2IAMD 3P4NB 3DMMD 1LWJA 1SOXA 4Y8AA 5KSBF 3VRLE 4JIRA 3T81A 2CHRA 2EDOA 4H25A 2ZRYA 4HNTA 2PP7A 5DDHA 1Y65A 3UTSD 4CVXB 3QJHB 1HJSA 3S1XA 2O4EA 4UNIA 1RP9A 3WDQA 1JNNH 4AAJA 4BFAA 1MAML 1KYFA 4Y9EA 4S23A 2W88A 1G0YR 2WWMD 4YHGA 1U8CA 4ZUVB 3FTSA 1WJ3A 3IMBA 4FLQA 4RRPA 2CIIA 5EO1B 4HX1A 5JHDA 2J66A 2VELA 2P5EB 2DH3A 1LDSA 5IQ9A 5IQ7L 4X4YA 4ELMB 1E6XM 2ZONA 3VILA 3NABH 5HNUA 3GXFA 5GS0H 2Q02A 1RJLB 3A13A 3RXZA 5HWNA 3AOFA 2NVCA 1YPFA 3LD8C 3OXRA 4RETB 4G80A 4WWKC 5KJ7E 4OV5B 3O1NA 5A8NA 1GAFH 1XO8A 1GR7A 4Y16A 4ICMA 1F45A 2QQQA 1HXMB 2Y6ZA 5ESVB 1BSLA 3HKZA 3ICJA 2CKBL 4YFLF 2NQ9A 2FX7L 3AT0A 3DVFA 4DUVA 3L1EA 1EC8A 2F2KA 2EC9U 2VDPH 1CD1A 3LHZA 1PZ2A 5KS9F 3TTYA 4PRBB 2ICEB 1TWSA 3B0PA 2WLLA 2DB8A 4L1SA 4LF3A 3G9VA 1UCWA 4JRFA 2F38A 3HR5A 1ZHLB 1X5LA 4JY5L 3FV9A 3SUVA 1INQB 2NQDA 3MO1A 1P0KA 4JZNB 1WBHA 1L6GA 3I85A 3SW6A 5JOPE 3BDBA 2BDNH 4NNCA 4LKCB 1WDAA 3DVGA 1GSMA 4LLWA 3B8IA 4JEJA 3MODH 1JHLH 1KFKA 3GZ3A 1FN4A 1T6VN 1I8JA 4V28A 3WJYA 1UVQA 4KKAC 4TRPL 4RIRA 3S6CA 3LRKA 3N9GH 4G7SB 4P2QD 5A6LA 1NY1A 4PV8B 5ECJE 1LG1A 1RLCL 1TJRA 3PB0A 4L64A 2VSDA 2V37A 4LVFA 2A74A 2GZXA 3EPNA 3A23A 1HHJA 4M6OH 6FABH 1J8VA 4Z95L 3M47A 3EDEA 4XIMA 2Y7LA 4WUUD 2QVKA 5AW4B 4LCSA 2CO3A 3LQAH 3QY8A 1J0YA 1PU0A 3KM1A 3CJJA 1I9JH 3FN3A 2KC0A 4P04A 3DK2A 5DHYB 4NNXA 2O5ZL 1AZ2A 2V63A 2WMFA 4Q4KA 3PB2A 3ZL1A 1A3RL 2HLEB 3UMNA 1F90L 1RAKA 3P9LA 3WFDL 3DKJA 1DXFA 4RK8A 3STPA 4C65A 4CD8A 4Q52A 4PP2A 2AQPA 5CIPA 3SCMB 3RM4A 4B5XA 4K38A 4N28A 3WUEA 2DZAA 3FTGA 3B6SA 3VTRA 2HG0A 4HGWA 4HMCA 4QT5B 5CGTA 2P24A 2J8UF 5IDIA 4RX4D 1ZT1A 3HAEH 5LBSL 3D4YA 3D85B 4AXKA 4EANA 4QHKJ 4AQ1A 4UBPC 1KBGL 3BANA 3EGSA 2XH7A 1BGXH 1AJ7L 4O5LL 4PB4A 1SJVA 1WDWA 2XJLA 3SADA 5T1MA 5CBAB 2WUBL 3TNBA 4J2MA 1OGPA 1MUMA 3BLKA 4TUKH 1B4JH 1R24B 3A5VA 3P1VA 4AIEA 2IQ9H 3VXRB 5B21A 1ZPLA 1M4KA 4LUIA 1DOSA 1KB5L 2RAMA 2I25N 4I0CC 3B05A 4UXDA 3OR7B 4QWWC 3I02B 4LBUA 2XA8L 1G7HB 1UWGH 5E4AA 5EU7C 1USQA 5LAPA 4PTVA 2OA9A 4H4NA 1SLVA 5IBUB 5C0AA 4URTB 3S9DB 1ZLDA 4FLSA 4LEOA 5AC5A 1NP0A 1MVUB 1JXKA 2VR3A 5GGTA 1EHLL 1C16B 4NRXA 4KI5C 4BCZA 3BAYA 5ESQB 2J1KA 3ARGC 3UA4A 4Y89A 4O58L 2VKZG 5ACZB 2V0TA 4DPCX 2W9LA 1FWXA 3ECVA 3JV4A 3ZE2B 4CL7A 1ZFJA 1MREH 3TA4D 3HE7C 3NPWA 3R4RA 3C0QA 2CU9A 5E5UB 1OTUC 2ZIDA 5KBNC 1G6CA 1YXYA 5AB9A 1TPFA 4NHCL 3ZKMC 1KZYA 3PL6A 3C2AL 1J93A 5HNNA 1CFTB 3FT4A 3NJJA 4RBPK 4TNGA 3U1SH 4C6JA 4H3DA 1I9RH 2J7CA 3B34A 4KKCD 4Z7OE 1NUFA 5I15H 1F0LA 1A9EA 4OZHA 5LIKX 2ATPB 2CPCA 1U95B 4RGOL 1FP5A 1AZNA 4Y4KB 4OZIB 5CAKA 3UP8A 3U0HA 1FJ1B 2MNJB 2HT2C 1TMLA 3MV8B 2QHRL 4W4NA 3Q6FA 3NABL 4WHDA 3MYPA 3LQZB 4QJ5B 4F7MB 1GGIH 2EPLX 1JPSL 5EC1B 2BLEA 1BM3H 4R7OA 1JV5A 4HG4K 4WSJA 4OD3H 3BQ5A 2GJ6E 2BS71 4DBWA 4NN7B 2IFFL 1MOEA 2WBWB 1DKWA 3SKMA 3HV8A 2FX7H 3CZEA 3IFPA 3KJ6L 1DYZA 2ZUTA 3SKJL 3ZDZF 3BPWA 4QG6A 1FFOA 1HYRC 5DJDA 3P8JA 1EJVC 5JU6A 4HZ8A 4DEUA 1JG9A 1JVLA 4I4WA 5FEXA 4XN5A 1WUEA 3ZW3A 5DMIH 3SQOL 3U0TA 4CEXC 2EXYC 1N4XL 4FNUA 4WF7A 1MFUA 5KTEL 3FFSA 4ZXBB 4LNCA 1G7IB 4O51A 4PWIA 2P5ED 5D9SB 1OXYA 2E27L 3IEBA 3SRFA 1KCUH 3HJEA 3IFLH 4XVSH 3IIPA 4J4PA 1DTUA 3DJZA 5AHEA 2YZ1A 1FSKB 1IKFL 4HFUH 4AY0A 2O6EA 3NXLA 1NQ6A 4PTXA 4D3CL 1ISXA 2IALB 4ZXBD 1WA3A 3AXMA 1J96A 3CN0A 1A14H 2P7TB 1E9IA 4IIFA 1JCTA 5E00B 4PJCA 3MXWH 2M8XA 3PWUA 1JGUL 3MRRA 5E8NB 1A5MC 2CMRL 2EP6A 4QITA 2V81A 1LO5A 4W9CC 1HCFX 1NMCB 3VFRA 2JB5L 2H32H 3CHDA 5TIMA 1WAPA 1WS7A 1O7VA 1QFHA 1J8HB 1GGBL 1S1RA 4S3CA 2Y4SA 4NJKA 2VTFA 3WY2A 5KEZA 2OWCA 4DO7A 3FSAA 1D5MA 3VDAA 1V6XA 5CBEA 1F76A 5ETUB 1EHAA 3SPJA 1FHNA 1KB3A 2QGEA 3A4FA 3HG5A 1NGXB 1Z5YD 3VH8B 1PG7H 2VIRB 4DW2H 5DA0B 1KCSH 2X6AA 2IPFA 3WNMA 2K78A 3T2LA 1DDHB 4FXRA 1VPOL 2WQ8A 4F66A 2BY2A 1IGTA 3P11H 4M7JL 3KCJA 4IHCA 4ALDA 4EPKA 1FJ1A 1OWWA 4XG1A 1EH9A 5KITA 3DECA 3K5RA 1JCLA 1GK8A 1XLKA 9XIMA 4GVGA 2X4QB 2Y06L 3Q8AA 4PJ7A 3WQEA 1VCGA 4X9BA 1YPZF 4FP8H 3FH7A 5E4OA 5F1KC 4WTXA 4E5XG 4HU4A 4HLEA 4NKIL 5IMMB 2VX5A 1JGEA 5DTFB 3V4PA 4D7BA 5D70L 4QYAA 4OOZA 4UTAH 4N2HA 2DI8A 4L3EE 2GHZA 4QAIA 2BY1A 4L23A 3V6ZA 1ASPA 3K6OA 2XYBA 4DGYL 1TU2A 4P2OD 1NWOA 1LD9A 2ZWYA 4PRHD 3SJNA 1OB1B 2FHFA 2JCWA 4Y5VC 2JB5H 1L9RA 4N8PA 2YCLA 4FQXB 3PG9A 1U9KA 3ENLA 5GZNA 5DELA 3NFNA 4MNQD 9RUBA 3US9A 1KBBA 2HV5A 3MRQA 1SRDA 1G7IA 4KVCL 4O8AA 5CLXA 3ZMEA 4FNQA 1OFDA 2PZNA 5C09E 2BY3A 1LT8A 3TWAA 3OW1A 1K5NA 3M6DA 4Y16D 4WHCA 3OBEA 4GSDH 4JEGB 3DUHA 2AZAA 3PDDA 4GMTL 4JL2A 9CGTA 3FA3A 3WKYA 5KVMC 7TIMA 5J11C 5EDXA 3LMZA 1LEGB 4N4YB 4HG4J 4IIHA 4OLZH 2ITDA 1KO0A 4G7VH 2F53E 5C0BB 3WXWH 4GRWE 2P80A 2R9HD 4GRLB 3D51A 5BXFA 3SZ8A 4C1LA 1DL7L 2UZIH 4OFIA 3RUGB 3L6FB 1KMGA 4LY4A 4TV5A 3TYFB 3HZVA 1W5NA 4GE8A 1BFOA 4HJ1A 3VSTA 4LDEB 1A6AB 4JO2L 3OZ9H 4DN4H 1UM5H 5AL8A 5E08L 2F9RA 2WOYA 3GTXA 4JFXA 5INCA 2AMUA 1RK0A 3UZYA 5CJOH 3OF6D 3RO6A 3BI9X 4H8WC 1MJJA 5E7FA 1GGIL 3EAKA 3BFWA 3WTXA 1AW2A 2VN5A 4MKSA 4P7NA 4XIAA 2DWEA 3PGCB 2GSHA 1GCYA 2NY6C 1IQ8A 4UFLA 2QV4A 4ZXOA 1C12A 2UV3A 4GRMB 1T3FB 1VERA 2OR9L 1XRTA 5H91A 2QUMA 5AWNL 4Y19A 1BWLA 1UH4A 4Z76B 5K1NA 1ZLWK 6PCYA 3TZVA 4DJFA 4G5ZH