1XCWA

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xcwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xcwA01
3WQ8A 4JAWA 3EJPA 1CDGA 4JL2A 1BGGA 4HP5A 1PEZA 1XYZA 3A4WA 1ZS2A 3II1A 4Z2HA 3I3EA 4B16A 1HWWA 2V38A 4W89A 1J0ZA 1H09A 1Q6EA 3IJ7A 3WNNA 4NRSA 2A3CA 4UOQA 1EQPA 1EGZA 4ZENA 4ZE5A 1W3HA 2RGMA 4P7RA 2FH6A 4JFSA 3SCNA 1KQYA 3VX0A 3EMQA 3MMDA 1QI4A 4U2ZA 2EPOA 1QBBA 1WB0A 2J4GA 3SCQA 1DHKA 3CIVA 1HX0A 2IUZA 4AMWA 1HKKA 5FL1A 2F7OA 3HU7A 1DWFM 1LG2A 3U7VA 2CHNA 4B3KA 3EDKA 1I75A 5E0CA 3CUFA 4MADA 2WZHA 1R47A 3AMDA 1TMQA 1JYXA 2Y4SA 4QLLA 9CGTA 5DO8A 1OCQA 2VRJA 1GQKA 4PMYA 3F5LA 1C8XA 4UFIA 5A8OA 3IAPA 4X9YA 5TD4A 3GH7A 2E4TA 3MU7A 4PMDA 2DT0A 4UOJA 2J7BA 1TQTA 4U5KA 5A2CA 1UKTA 2J74A 2FHCA 2VR4A 2NSXA 2CCRA 5AYIA 3MSGA 5ABEA 2J7GA 3WUBA 1E55A 2EEXA 5KEZA 3WUFA 3T08A 5JBEA 2YL6A 2ALWA 4EK7A 1ECEA 1E5NA 2YOCA 1G0CA 4JZ5A 4JKLA 2CIPA 4AIUA 1GQLA 3LPOA 2A3HA 2AMGA 2WBKA 4D6IA 4UFJA 4AMXA 1LLOA 2CITA 2EPNA 4TX8A 3ZT6A 3ZT7A 2RGLA 3QOMA 1CGUA 4GI9A 4B9YA 1G94A 1KXHA 2D0GA 4YN5A 1GW1A 4E8DA 1EHNA 2OSYA 4S3JA 1TQVA 2J47A 1DTUA 1HN1A 3GH4A 4IPLA 4M80A 4Q7NA 2QLYA 2VRQA 3DX3A 3SCRA 2A3AA 4LYQA 1BGAA 1UR0A 3BUDA 2EPLX 1VRXA 1NWRA 1U33A 1UKSA 3BCFA 1UWIA 2IGTA 5CQ1A 5A2AA 2XYLA 1QI3A 4AIOA 2GSJA 3VKKA 1BLIA 3IJ9A 4M82A 2JIEA 2V5CA 2VO5A 3BSGA 1BF2A 1UWSA 3PZVA 4DUVA 4BQ3A 1J0YA 3PTQA 1X6NA 2XFRA 2HVMA 4CCCA 1HTYA 2BY0A 1HJXA 3WMBA 5E9AA 4ZFMA 2J78A 4W7VA 3THDA 1SYTA 3VTRA 1JZ5A 3ZT5A 2VTFA 4PUDA 1C91A 1BTCA 1JZ7A 5HBFA 1EXPA 4YPJA 4R5EA 1TG7A 4OOUA 1VEMA 4CCDA 4AZ7A 1JI1A 3HJEA 3M46A 1JZ8A 3UETA 3T0AA 3N04A 3GBDA 3WD0A 5JIWA 1JNDA 3DHPA 4JIEA 2JALA 3OA5A 2DQXA 4TX6A 2Y8VA 3WY3A 2FHBA 2FYVA 3PZTA 3I3BA 2XSBA 2V3DA 3OLGA 3PZOA 2VVNA 5AYBA 2F2HA 1H5VA 4Z2JA 3RPMA 4AXNA 1HL8A 1QVBA 3AMCA 3UG4A 4PTXA 3A4AA 4CD5A 1NWTA 1AQ0A 1SZNA 4UCFA 1E5JA 5BWFA 2XSAA 1GOOA 4DO5A 1E3ZA 1E56A 5A8QA 5DMYA 1UH4A 3K46A 2G41A 5ABFB 1WNOA 1OGSA 3WBAA 3WF3A 1HKIA 3FHQA 3ARXA 4WKAA 1XRVA 1XC6A 1VB9A 1J9YA 4PMVA 1V6VA 1DEDA 3MMWA 2FGZA 4WKHA 5ECUA 1JXJA 3WH7A 2WANA 3VGGA 2QF8A 1GONA 1O6IA 3BVTA 1RD6A 2PF0A 2IXVA 3K4AA 4PTVA 4FLOA 3GM8A 3VNYA 3DX1A 3NCOA 1YQ2A 2IXUA 1JF6A 3EJUA 1QHPA 2OSXA 3LPPA 3CZKA 1V0KA 1GJWA 4W5ZA 4W7WA 1QHOA 1R87A 2YDQA 4JHZA 1QW9A 4PBGA 5D8WA 3CGTA 3GNOA 4LXFA 4AZBA 4J3WA 4J28A 2BHYA 2WXDM 1HL9A 1UG6A 1E70M 3CV5A 3LX9A 3LXBA 1US2A 3VGFA 5DT5A 3DDFA 5A6AA 2F8QA 3BC9A 4UFMA 1IV8A 5GNZA 1CZ1A 1ZBWA 2ZX9A 4OKDA 4AEFA 1GQIA 1XHGA 2JFEX 4FLQA 4NXKA 3N13A 1B31A 3O9NA 1D2KA 4U2YA 3PZQA 4HA3A 1ZB5A 1E4IA 2VZSA 3K8LA 2ZUNA 3VO0A 1B3XA 2UWFA 1WE5A 2WPGA 5I78A 3WNMA 1E15A 1QNRA 4JFTA 3W0KA 2DEPA 1U2YA 2YA2A 2XVLA 3WEOA 4HPHA 3LXAA 4OIFA 1UH3A 1H41A 4MAZA 2UY3A 3VIIA 1BPLB 2PWFA 1Q6DA 3WQ5A 3EDEA 4CN6A 2VX4A 3DYMA 4MDOA 1RP8A 1EA9C 8CGTA 2QPUA 4RE3A 1PZ2A 2VNCA 4TUFA 1ISXA 3IJ8A 2GUYA 3O2LA 1LL6A 5C70A 4TXEA 4W88A 3A5VA 4GKLA 3HG4A 3O6AA 3W6LA 2ZX5A 3DC0A 4AZIA 1ZJAA 3BAWA 4AC1X 4MB4A 2Y2WA 1C7TA 5I5RA 2O92A 3VD5A 1UA3A 2VVSA 5CPTA 3A47A 1JYWA 2XVNA 5M17A 2XUCA 3CZ8A 2PB1A 4HOWA 5A8MA 3ZQ9A 3K1DA 3BGAA 3D4ZA 3CZNA 3SCUA 4AD1A 3H54A 3AIEA 3SCWA 1HNYA 1C3FA 4UQBA 1UD6A 1Q4NX 4NRRA 3WY4A 4GZJA 1OSEA 1TVNA 2VZTA 1SMAA 5A6SA 2WCGA 4U3AA 3BVVA 1QI2A 4HTYA 3LXCA 4M1RA 3PZUA 2F1AA 1H1NA 1AMYA 2XG9A 1CXLA 5CPSA 4UFLA 5A3HA 1JD7A 2ESCA 1B30A 3SIMA 1XV8A 2WVVA 1B3WA 3ARWA 1SFSA 3B9DA 4JCLA 2Y8KA 4A4AA 2UY2A 3RM8A 3ZIZA 1W9VA 1E0WA 5BXTA 5A6BA 4AWEA 1E3XA 1UZ1A 1NQ6A 4FNPA 2QMKA 2CYGA 3GZAA 2EBNA 3HN3A 4AEEA 2DSWA 3RM4A 4GO9A 5HXMA 3IGUA 3UR7A 1KR1A 3N18A 3ZJ7A 5AC5A 1UD3A 2F7QA 2PC8A 1W91A 1Q6CA 2DSKA 5LA2A 3QOKA 4TTGA 3EJQA 1NARA 4NSBA 1UD4A 2PBOA 5AC4A 1EH9A 1UKOA 2ZXDA 2O9TA 3UG5A 3TP4A 5JUVA 2WHKA 4W85A 2PWDA 2EJ1A 2J7CA 5I2UA 3PBGA 5A6JA 3SCVA 3APGA 3CMGA 1ISYA 1E73M 5EFFA 1W9BM 4WJXA 2Z1KA 1PIFA 1ITCA 3WF1A 4UQCA 4D72A 3NYDA 3ZOAA 2YJQA 1W1PA 4IM4A 2X2JA 5IHRA 1N82A 1UHVA 3FW6A 3WF0A 2ZXAA 4N0RA 2V3EA 2ZUSA 4D6DA 1JF5A 3EMCA 2VR5A 1R46A 1QX1A 1V3KA 3NDYA 5D9MA 3SCTA 2VT0A 3TTSA 3MUAA 1R86A 2YDSA 1C8QA 3VD3A 4BZYA 2GK1A 2W63A 4JHOA 3A6OA 1V02A 4UQ9A 3NSXA 4AD2A 3WL0A 4GINA 3FXYA 4D71A 2ZUWA 4DM1A 2YKKA 4J3UA 2VMFA 4PTWA 2JF7A 3FAWA 1HF6A 2E9LA 2V3GA 3CUIA 1R85A 5CXPA 4OBRA 2BVTA 1J18A 3AS2A 1FFRA 2CBVA 4H2CA 3BLBA 3GXPA 4U33A 1ODUA 3VSTA 3AROA 3QHOA 3L4YA 3W29A 3PZ9A 1NOUA 2OYLA 5E1QA 3AIRA 4XZBA 1FHLA 2DSZA 3WH6A 3ZMRA 1UYQA 3LMYA 1U30A 2EO7A 1WZLA 3WMSA 3L2LA 4AZGA 3AMGA 2F1BA 3JUGA 1W9XA 2D24A 4FNUA 1GHSA 3UR8A 1JXKA 2CESA 2ZUUA 2ZX8A 3H53A 1FA2A 1JFXA 4W87A 1V02E 1EHAA 4MNKA 3AXIA 1D3CA 3A23A 3DHUA 4HA4A 1LL7A 3VD4A 3L4ZA 4AZ5A 1KCKA 3OIHA 1XH1A 5A95A 1J0JA 5BXSA 2VQTA 1CENA 1CGWA 2XN2A 4DO4A 5CGTA 1QHZA 4A3HA 2CBJA 3KZSA 3K4DA 3AHYA 3VGEA 3KE0A 4GZEA 4NZCA 3G6LA 4LYPA 1TA3A 3EBVA 4UOZA 1H0GA 7A3HA 3RJYA 3WDIA 3CUJA 4MJ2A 4AZCA 1NWUA 1PAMA 2BY1A 2JE8A 2WCAA 4HMDA 3A4XA 1ZJBA 1V3MA 1WZAA 1BHGA 2QHAA 3KL5A 3KWXA 3WDQA 1V6WA 2D3LA 1VBRA 4BQ4A 5A6MA 1BSIA 2WCSA 4CD6A 3WELA 4CN1A 5DFAA 3FNDA 3MUZ1 1E40A 3MUIA 1XH0A 1V3JA 4S3KA 3DDGA 1TQWA 4PRWA 4TVUA 5E0FA 1JD9A 2VCBA 3A3HA 3GNPA 1HXKA 4BS0A 1MW3A 4CGTA 2W4XA 2G4FA 3N12A 1C8YA 2QV4A 4QLJA 4E8CA 3EDJA 3MMUA 3AXHA 4H7VA 3VU2A 1OINA 2PWGA 3VIMA 2VC9A 2BY3A 1B9ZA 3N17A 1D7FA 1WZKA 2JEQA 3HG2A 1VFFA 1J10A 4DUXA 4PCTA 4JFWA 1H49A 5ABHA 5I0DA 6CGTA 3VIFA 1TQUA 4BCEA 4DUWA 3AJ7A 4DWSA 3L4VA 3RMEA 1HT6A 1VJZA 1F4HA 4U3CA 2YL9A 3IANA 3L2MA 4RE2A 1UQYA 3MKKA 4C7FA 2J25A 2G3NA 3VIHA 2OW6A 4CD7A 3NDZA 2F61A 4UR9A 1JDCA 4ATDA 2DH2A 1WCGA 3VIJA 3WEZA 2ZE0A 3TA9A 1Z32X 3AIWA 3M7SA 5GNYA 2DPEA 2WVVB 4TVCA 2EAEA 2FDMA 3GXIA 3VMOA 4TOQA 4CD4A 1GPFA 1J0IA 3RDKA 3EJSA 5CSUA 1EO5A 5IFPA 2V5DA 2ZUMA 1GZJA 4F9DA 3BCDA 1CPUA 3A24A 1CLXA 1KBKA 3WH8A 4P7OA 4HZ6A 3OBAA 1US3A 3GXDA 4P8VA 2OW7A 3EMZA 3W4RA 1WDRA 3OLDA 1UR8A 4CKQA 1QNQA 1UD2A 3F4VA 1VJSA 3B8SA 3AOFA 3AQUA 4KRTA 3U7BA 1IZJA 1W3JA 1M01A 3B9EA 1EIBA 4OZOA 1VFUA 5IFTA 1WDQA 4GZIA 3ZR6A 3S5YA 5GNXA 1NH6A 1B90A 3LRMA 3GNRA 3WDPP 3ECQA 2WM0A 5IDIA 3W27A 1MXDA 3LRKA 1JGIA 1GORA 1HVXA 5BROA 3ZJ8A 1RP9A 3MSDA 1ZBCA 2BVDA 5HNNA 2XN0A 5FD0A 2EACA 2WC3A 4RE4A 3PTMA 1JAEA 1O7AA 1NOFA 1E4LA 1IT0A 1J11A 1E6XM 2DIJA 4UFKA 3FAXA 3W24A 4AW7A 2GJXB 3RCNA 3T2OA 2GK1B 1UOKA 4HPGA 4B9ZA 8A3HA 3AHZA 2ZX7A 2J8GA 4QFUA 3WNKA 4D6CA 1TQSA 1R7AA 3EJTA 1TR1A 1UR4A 3BUIA 4EAMA 2J62A 1ZBVA 1K9FA 2EPMX 3POCA 2WMHA 4WIWA 1B1YA 3ZSTA 5F7UA 2YL5A 3D4YA 4GO8A 1O7DC 1C7SA 3SURA 1MQPA 4AZ6A 1W32A 1K9DA 3MV01 1R75A 1OGGA 1XYFA 1TVPA 3ARRA 1VBUA 4PSRA 2PI6A 5E09A 1BYBA 2XM2A 1G5AA 1CXKA 2DT1A 3DX4A 5CJ5A 2WVUA 4M81A 1TE1A 4Z2GA 2A3BA 2X09A 1HJSA 3VDHA 2W67A 2XTKA 1XD0A 4PTMA 3W81A 3FN9A 1CLVA 4WSKA 3U5UA 2CNCA 2O9PA 3AS0A 4AY1A 4CVUA 1EOMA 2CETA 4H41A 1MQQA 1EDQA 2VRKA 4ATLA 1BFNA 3WF2A 2VZVA 4GI6A 5I77A 1ISVA 3L4UA 2DGAA 1V0LA 3SUTA 3MS8A 3J7HA 1CEOA 3L4TA 1GJUA 3NJ3A 1KQZA 4J3SA 1FH9A 3WN6A 1H2JA 1QI5A 1NWSA 2X0HA 5I3DA 4NI3A 1TA3B 4P8XA 5I23A 3DYPA 2B31A 3WD1A 2EABA 1B3YA 5EFDA 3BAKA 5IHSA 3GXMA 2X2IA 2VX6A 2Q8XA 1JDAA 2DT2A 1MQRA 3EJRA 2OWCA 2VQUA 4NXSA 1TFVA 4L4OA 4KRUA 4IPNB 1LL4A 3M6DA 4DWSC 2CHOA 1M04A 1KBBA 2MANA 1JYNA 1WO2A 4OGZA 4ACZA 2W61A 4LQ1A 4C7DA 3VIOA 1V6YA 3BVWA 1E6QM 3GXNA 3AHTA 3T2QA 1E0VA 2XPKA 4KWUA 3UEQA 1QOXA 3S5ZA 1GVYA 4IISA 2BV9A 1EDTA 3AMKA 1B3VA 5D9OA 2CBIA 3FY1A 4DM2A 2E8ZA 1UASA 2E8YA 5I79A 4Z2LA 2WMJA 1GOWA 1E1EA 4FK9A 3AXXA 3NSMA 4D6EA 3D3AA 2ZUTA 2AOSA 2BHZA 2J79A 4DWSB 3CHEA 1A3HA 5DF0A 4OBSA 3AHVA 5FL0A 5JBFA 2WHJA 1L0PA 1OWQA 3DECA 3VIKA 3AIVA 3TV8A 3CO4A 5EMYA 1ZBKA 3WQ6A 4CUCA 4B15A 2WMFA 1W2PA 2WVTA 4N42A 2O9RA 5CLWA 4V2XA 5IXEA 3VNZA 5A8NA 4M8UA 1GOKA 3CMJA 1MYRA 1SR0A 2DDXA 2VCAA 1W3KA 5JIPA 1B2YA 4HMCA 4Y7EA 1QNSA 1VEOA 4K68A 5A6KA 2W66A 5CG0A 4MB3A 4EANA 4X0NA 3H55A 1Y7VA 4LPCA 1T0OA 4CVWA 1KWKA 3WY1A 4EKJA 2D3NA 3D50A 3AIQA 5CGMA 3VIGA 2XVPA 4HZ8A 2X8RA 2NT0A 3BSHA 1LWJA 4CU6A 1KCLA 2UY4A 1PX3A 3RM9A 1CGXA 2NT1A 1RPKA 4CN4A 2WK2A 4MJ4A 3WQWA 4PUEA 3UESA 2E40A 5FCZA 5ABGA 1J01A 4JKMA 2E9BA 2UY5A 4OUEA 5A69A 3VSVA 2XGBA 1PBGA 1BQCA 3WUGA 4H8UA 2WYSA 3AHXA 2D0HA 1GVIA 5D4YA 3OB8A 1QW8A 3OLEA 6A3HA 2WLYA 4UTFA 2WKGA 1K6AA 2XJ7A 2OSWA 1BYAA 1BG4A 2X2YA 4F79A 3PZMA 1BAGA 2YDRA 1CGTA 1J0HA 2DH3A 4HMEA 3SCOA 4D6HA 1E6SM 3CH9A 2YA1A 4P7QA 4LX4A 3ALFA 3ARQA 4PEEA 1XSJA 4P7NA 3BVXA 1ZL1A 2V3FA 4C7GA 2ZUVA 1UKQA 4NZJA 2DSVA 4WSJA 3VM5A 3LRLA 1AVAA 3NIYA 2WKLA 2YBTA 1KWGA 3PZIA 3AI0A 4URIA 4KGLA 3THCA 4B3LA 1QWUA 3OZOA 3WY2A 1ISZA 3U5YA 2A3EA 4PMXA 1WP6A 3ZM8A 4H8HA 2WVSA 3UCQA 1R34A 1JYVA 3TOPA 1OM0A 3PN8A 3VDAA 4QCFA 5ABFA 2PBGA 2WSPA 1QI0A 2WWDA 3AICA 4ML4A 4U5IA 4F8XA 1GQJA 3OZPA 2PWEA 4J3XA 3IK2A 1CXHA 3WNOA 3BXWA 1UD5A 4L4PA 1JZ2A 2F7PA 4QLKA 3VIPA 2J75A 4D1IA 5D9PA 3VDCA 3KL0A 1BVZA 2XM1A 1KFWA 5D8ZA 3CPUA 3PHAA 1UR9A 1V03A 2GVYA 4HU8A 2WMGA 4QCEA 2XIIA 3BLKA 3ARUA 3RIKA 1ZU8A 2X0YA 1BVNP 4MNMA 1V3HA 1DWAM 4W84A 4CU8A 3GTNA 3AS3A 3HG5A 2E9MA 3MUY1 4UQEA 1DWGM 1ESWA 4HU0A 1UWUA 2G3IA 1GNXA 1ODZA 3WDJA 1PS3A 2HISA 3CZLA 5M5DA 1HVQA 3GDBA 4AD5A 2GJRA 4FLRA 3GBEA 1CTNA 4AMCA 4H8VA 1RH9A 3VINA 3W26A 3BAXA 1I1XA 5JBDA 2WLZA 3T2PA 4E2OA 1WAWA 3WEMA 2C8NA 3N9KA 3LPGA 4UZUA 3OG2A 5A94A 4DO6A 1FP9A 4CCEA 3WIJA 3BAIA 2ZXQA 2G3MA 2VCCA 1HIZA 2YFNA 3DX0A 3VD7A 3AIUA 3BUQA 3D52A 4MPKA 1H3GA 2ZOXA 5C8BB 3S6TA 1UR2A 4M24A 1NM9A 1HJWA 3BAJA 3MO4A 4WK9A 2OYKA 3D51A 1V6UA 3MV11 1E6NA 2VZUA 4X0VA 4YHGA 1OBAA 2WMIA 3VDBA 2CEQA 2Z1SA 4P8UA 1GUVA 3VUPA 3K8KA 2EPKX 4FF5A 3CZGA 3HG3A 2CERA 1UUQA 2ZWYA 1XCXA 3KEHA 5CLTA 4MB1A 7TAAA 1MW0A 3EYPA 3SUWA 3K8MA 1FOBA 1HP4A 4XZWA 3HZ3A 4U31A 5FOOA 4ACZB 5BRQA 1ISWA 1OB0A 1TZ7A 1E9LA 1KGWA 3G6MA 1FH8A 2ZICA 1FHDA 2BS9A 2D73A 3L4WA 5I6SA 3W38A 3WNPA 2WW5A 4PMQA 3WKZA 2CXGA 3I3DA 5A8PA 3D5HA 4W7UA 2JEPA 5CSYA 1LJYA 1E0XA 3NUKA 1QPKA 5LYRA 5E70A 1OGBA 4KH2A 1UWTA 4M56A 1LQ0A 2J7EA 1J0KA 2WWCA 3POHA 3A22A 3TTOA 1G9HA 3CZJA 1QWNA 2F7RA 3WMCA 4HOZA 4AYGA 1JZ3A 4FNTA 3SUUA 3RO8A 1XH2A 1MFUA 1JI2A 2JIWA 4CD8A 4WF7A 4J3VA 1VENA 4Q22A 2ZIDA 2WBGA 4JL1A 1QBAA 1KTCA 4XB3A 3ARYA 2X05A 1JAKA 1QNPA 1CXEA 2VUYA 3VGDA 1S46A 1HXJA 3TTQA 2O9OA 1MFVA 4LYRA 4YHEA 3SUSA 5A6BD 2XWEA 4ACYA 4J7RA 4GXPA 3VVGA 3VOCA 4AIEA 2JF6A 1E4NA 5BXPA 2CBUA 4BQ2A 4KGJA 1OIMA 1WZMA 4R27A 5C71A 2EQDA 4D6GA 4PMUA 5M3WA 1GOMA 1B3ZA 3PZGA 1JZ6A 5I24A 1LWHA 4P7LA 3F5JA 4PMRA 3SCPA 5HPCA 1L8NA 1J12A 1CNVA 3WDRA 3PZNA 4TVDA 2WAGA 3N11A 4NX0A 4W86A 3SCSA 2XVGA 2XFYA 1HJVA 3AYRA 4MNLA 1WDSA 3AZSA 3W6MA 1CWYA 1VFOA 4AYSA 2WHMA 2D20A 1LF1A 2GFTA 4AD4A 1R8LA 2ZWZA 3WH9A 2XWDA 1DWIM 4FLSA 1DP0A 2VL4A 3AIBA 1ITXA 5HOSA 4H04A 4FNQA 4GQQA 3WSUA 3AS1A 4FNRA 2AAAA 6TAAA 5CZKA 1K9EA 5GPRA 3HMCA 4F66A 1C92A 2NW0A 4RL3A 2VX7A 1CIUA 1V08A 4M29A 2QPSA 4GIAA 1GOQA 1M7XA 4E4PA 3VSUA 1KXQA 2VZOA 1E6RA 4PSPA 4A3YA 1IZKA 1KGUA 2WNWA 1H4PA 2W62A 1MVYA 3AYSA 3FHAA 3ZJKA 2CKRA 5D9NA 3EDFA 3QHMA 1BYCA 2J7FA 2WHLA 3VMNA 5DT7A 3MI6A 1KXTA 2GJPA 4XV0A 2G8ZA 3VMPA 3LPFA 1XSIA 2XGIA 1NP0A 5GQBA 2YLLA 1V3IA 2OLHA 1W3LA 4AD0A 5A2BA 1BYDA 3ARSA 2VX5A 2WB5A 2PWHA 1OT1A 1GOIA 1X6LA 1V6XA 1JFHA 4UFHA 2VJXA 4ZE4A 5A6LA 1G1YA 3VGHA 1HJQA 2WC4A 2G3JA 3F5KA 3WQ4A 3AISA 3ZO9A 3BLPX 1AQHA 4MDPA 3TTYA 1I1WA 2J7DA 2E0PA 4FMVA 3KLLA 4UQAA 4ATWA 2C0HA 1JL8A 4HZ7A 3CTTA 2W5FA 3BMWA 1WPCA 1CECA 3W53A 4WLCA 3N15A 3NSNA 3AZRA 1V0NA 3KL3A 1JIBA 2WSKA 1UD8A 4BA0A 2FE0A 2BY2A 1W9UA 2FH8A 3OGRA 1PPIA 1UA7A 4UQDA 3DYOA 1VEPA 1CXIA 2WZIA 3N1AA 4GQRA 3T09A 5BYWA 3TONA 4KMQA 4QP0A 1UKPA 2EADA 2FGLA 3A21A 2BXYA 3VGBA 3BUBA 1MXGA 1EOKA 3MANA 4HOXA 1HP5A 3OGVA 2YA0A 1WKYA 2BNJA 2OWWA 2XHYA 2F18A 3UERA 4AZCB 1MWOA 1R7OA 3CC1A 3VPLA 2VURA 2WZEA 1LG1A 4CU7A 2Y5EA 2EXOA 1CGVA 1PX8A 3RJXA 4JFVA 1H0IA 3W25A 4NZFA 2YLAA 3WNLA 3CBWA 4PMOA 3VILA 2GDVA 2D0FA 4QAWA 1R33A 2WMIB 2X2HA 2BVYA 1KR0A 4Z2IA 1G01A 1H11A 1OD8A 5HPOA 1E4MM 3WFLA 5BXRA 1EDGA 3AFBA 2X1IA 4UNIA 2J7HA 1V3LA 1PJ9A 3L4XA 3WD2A 1W9PA 2GDUA 3CHCA 1JG9A 3DX2A 1Q6FA 3GYCA 1VIWA 1C93A 4V27A 4P8WA 2XN1A 4JFUA 7CGTA 2DT3A 1NP2A 5A1AA 2E3ZA 2BXZA 3WENA 1NOWA 3W28A 5M03A 1JNEA 3CZEA 1FFQA 1JZ4A 2OYMA 1W9DM 2D2OA 3E1F1 3CZSA 2ZX6A 1VAHA 1KXVA 1XSKA 4GPNA 3WBEA 3VM7A 4PN2A 4D6FA 4DWSD 4OOZA 4XUYA 1GHRA 4OJYA 1E6ZA 3WUEA 4QDMA 1BG9A 4F9JA 3SEPA 4PMNA 3WL1A 4W8AA 1MW2A 3BH4A 2XFFA 1A47A 3GH5A 1JDDA 2D1ZA 1XD1A 3M07A 3VX1A 4IUGA 2VI0A 4BQ5A 5KZ6A 1E6PA 4V28A 3T0DA 2D23A 3CHDA 4TTUA 2DSUA 3CUHA 2J8FA 1UQZA 3OGSA 3ARPA 3ZJ6A 5BCAA 1V0MA 2TAAA 3SUVA 4Z2KA 4W8LA 2YIHA 3WD4A 3ALGA 3AZTA 1OIFA 3GXTA 3PTKA 2J77A 1PZ3A 3W82A 1EO7A 4ZXOA 3U57A 1E72M 4MTVA 1XGZA 1DWJM 4JCMA 1KB3A 4MAVA 4W93A 2CKSA 5BRPA 5LA1A 1EQCA 4GI8A 3EDDA 3OLIA 1PIGA 4W5UA 1FH7A 1B0IA 4ZEPA 4JKKA 1FP8A 1M03A 5LA0A 1HJUA 3ARTA 3CLWA 2W91A 2D22A 4ZXLA 4PMZA 3RILA 1HKJA 3ZSSA 3BAYA 1PX4A 3WF4A 1P6WA 3WH5A 1W2VA 4W8BA 3ARVA 3CUGA 3T0BA 3KLKA 1W1TA 4EE9A 5E6ZA 3QHNA 3WFZA 4PYSA 1CXFA 2CPUA 1KGXA 5AY7A 1HKMA 4PCSA 3WD3A 1UWRA 2OWXA 4AISA 3AMLA 3BUPA 1TCMA 1K9TA 5FKYA 1SMDA 3QGVA 5EBAA 1UR1A 2XVKA 4NF7A 4AZHA 3S2CA 3VD9A 3CHFA 4WKFA 1OD0A 2W92A 2GJXA 1Q6GA 1DWHM 5CPQA 4BF7A 4FNSA 1UWQA 2BHUA 2QMJA 3ZR5A 3W37A 4AD3A 5EB8A 4J3TA 1E1FA 1GCYA 5FIPA 4D6JA 2YBUA 1VFMA 1XCWA 1QNOA 1E43A 3QR3A 3WQVA 1TUXA 1VF8A 1KTBA 5E6YA 4MB5A 1UH2A 4HA1A 4D1JA 1YHTA 3BMVA 4MNJA 5DEZA 4UZSA 4J27A 2XIBA 3UG3A 4XX6A 2WC7A 2WMKA 1UZ4A 3GXFA 3BVUA 2BFGA 1X1NA 3ARZA 5HDRA 1CYGA 3WDHA 1F4AA 1CBGA 1C90A 1CGYA 2C7FA 3IAQA 1WDPA 1E71M 2YL8A 1W1YA 1AQMA 2ZXBA 1MW1A 2Y24A 3B9AA 2FHFA 4LGXA 1M53A 1W1VA 2YFOA 2VOTA 1OT2A 2DIEA
chains in the Genus database with same CATH superfamily
3DERA 5T3XH 1OHLA 1QLEB 1VS1A 4JYEA 4CA4A 4B16A 4PJ8A 1XBXA 3AG2B 4H88L 3QO0A 4I88A 4W70A 1AW5A 5IESL 1SF3A 2J4GA 4ZAKB 4RZ4A 1DHKA 3QW4B 3UWEA 5HDWA 2EIBA 2IUZA 2UY7A 4AMWA 4ELMF 1I1RA 4JQAA 1LG2A 3BE1H 5DRNA 5C6WH 3QLLA 4XBJA 1MUWA 1SOXA 3IDNA 1Q6QA 4PMYA 5XIMA 3GMMB 3DOSB 5TD4A 3GH7A 4NKIH 3VI2A 4CAGA 3MRFA 2VDPB 5FO2A 2VR4A 3NH7L 4YVUA 4GAAA 1E2VA 4I0PA 2H2PC 43CAB 1QMUA 2ALWA 1ECEA 4G9FE 5JLZA 5KYYB 1ZCRA 5EF3A 4FKKA 3BZFA 4L29B 1VHNA 3NESA 3THML 4B9YA 1B4KA 1MUJB 4IKLA 2PSNA 2OMVA 1ADOA 1VRXA 2NXIA 1U33A 3CQFA 1JGUL 1TQXA 1O7SA 4QF1A 3IJ9A 4BFEA 5FV1L 3W74A 5A2FA 4M6UA 1A1MA 4PRIE 4BQ3A 4F33A 2HVMA 4GSXA 2X41A 2V5MA 4PJGE 4WAFA 4RE0A 5D1QA 3NTCL 3LGEA 1BVKA 4ANKA 3BARA 1FVDA 2VQ1B 2A9BA 3D3VB 3GBDA 4JZJA 3SE8L 1N2VA 4KUZL 4WWKC 4L64A 2J1KA 2B7PA 1P2CB 4LQFL 1HL5A 3UBHA 4X4XB 2RQ8A 4HH9A 2EUZA 5EEUA 3FTGB 4OY9A 3TZVB 2J6XA 5CIPA 4PTUB 3RWHA 3HG0A 2OXNA 3NZ8A 3C5QA 4X3ZA 5AW6B 5AVXB 5CJOH 1EQWA 1S9WB 2WN2A 3U4EA 2J9XA 5ECUA 2WANA 2QF8A 1QWHA 4MS8D 4D9QD 3C09B 2C1IA 1MCBA 4K55A 4PJ8C 2B1OA 3GAKA 3V8CA 1SFJA 1YTDA 3ETBJ 3S47A 5EEZA 4AZBA 1XR9A 1EVUA 5HUOA 3HNSL 1UEMA 3DVGA 4NQCA 5DT5A 3KG5A 3S97C 5FYKL 1CZ1A 1UP0A 2X44D 4NKOA 4HCHA 2B0SL 4NQDD 5IM51 1DVSA 1E15A 3H9HA 4MGXA 4XAFA 5FO7B 1HYSD 1ACYL 4YE0A 3NOIA 5JH1A 4XVOA 3DYMA 4I0PC 3LEYL 3E3HA 4PYHA 5EBLA 3WQGA 5IR1A 4HF5H 4WNJA 1S9YA 5HDOA 2O5XH 4TXEA 2GW5A 3PF3A 1AGCB 3CB3A 4CQCA 3BD4A 3ZW3A 2HFGH 4B3VA 2H6UA 1C7TA 2ZWNA 2IANB 1BXNA 2O92A 3NIFE 1NCAL 4C1KA 4ES8A 2GJZB 2VDKH 3VCRA 3IMUA 3K1DA 43C9A 2EC8A 1EKOA 2G3FA 3EBAA 3MRCA 5CEZL 3PLYA 2YB4A 2HFTA 2JCCB 1KCXA 5EO1B 4UQ3B 1LOLA 4Y8EA 4U1HB 1MNUH 3PZUA 3TSDA 5AKSA 4HDIA 2IVFC 3W83A 1PTGA 4ZQKB 4MHHG 1B3WA 2NQ5A 4FQHB 1KY7A 3KBWA 2H26A 1IQWH 5AVTB 2IBZY 3C5ZB 3OVRA 3FGCB 1PDZA 5IFJA 3RVVC 4JZJC 1MCEA 1HFBA 1W91A 5JOFB 1ZTXH 3BZ5A 3IFPB 1Q0XL 5AC4A 4HUCA 1G7MA 2VWEE 3KLHD 3TBYB 3LKSB 3HIJA 4C47A 3S6CA 4HHHA 1CG9B 4LLDB 4Y9PA 1HSBA 4WJXA 3MODH 1J79A 3AUVA 3EYQC 1EJRC 3QIBA 4U7KA 2ZOLB 3O4OB 5CZ0A 4F8PA 2VE6B 4DXVA 4QG6A 2V2XA 4P23C 4A6YH 2FKPA 1U1UA 4CL7A 3IRZA 4DKEH 1WBYA 2EDWA 1DSYA 4PJ5A 3QF0A 5C2XA 2J66A 1GPOL 4GINA 4NL1A 2IXQA 2X1UA 2OO6A 3QXTA 2FATH 4DGIH 2HVJA 3FAWA 1W17A 1M71B 3UO1H 1KM3A 1JWUA 3EYFB 3N1GC 5EC2B 3E0VA 3P3TA 4ZUVA 3BLBA 3GXPA 3QQNA 4EPKA 3CLEH 1AGFB 1ZVYA 4YU1A 1XGPB 1GC1C 5AG8A 2QCDB 5F88B 3KCLA 3OF6D 3BKMH 4KAQH 3DRQB 2GGGA 4ODXB 2ZX8A 4Q6KA 2W0PA 5DJ8B 1F58L 4R5VA 3W1MA 3ZZQA 3OMZA 4GSRA 2X0SA 5CR1A 1HFUA 4IP4A 4OZHA 1ASPA 5DO2C 1CGWA 5LJYH 1NL0H 3QFGA 2Z31B 4HNUA 4X5XA 1ZT1B 5DQPA 4H20L 1P7TB 4GUQA 3W7DA 2R0LL 1FFOB 5L9DL 4HFUL 2V2TB 4D9QE 4KESA 5IROA 5I6MA 2DJSA 1ZA6A 2B4CL 2VJ8A 3VACA 2A77L 4LPTA 4BZ2H 4S3KA 2JELH 2WMPA 5F1KC 2P49B 3UYRL 4N9CA 4OB5H 4KV5E 2VCBA 2G2RB 4TQTA 4XOCA 2IPWA 1O7DE 1IXOA 2O0TA 2OTUA 5JIIA 1YE6A 1EBHA 4G7RB 4X8JB 4NQDE 4MD5A 4OCWL 3HGJA 5JIHA 2OLAA 3IFOB 5IVXE 4GBUA 3U9WA 3VIHA 2OW6A 3ZUNC 2OEJA 4PGZA 5HYSA 2B2XH 2PR4L 4UTBL 5DUJA 3VIJA 5CCZA 2MCAA 1V8HA 3D34A 4EI0A 3ASWA 3ILPA 3DUSA 2OMXA 3S5LG 3LM3A 1S7VA 4WD0A 3QIBC 3LZLA 5TAOA 3TBSA 3O3BA 3BUTA 3QFJD 3BMXA 2JKPA 4KJWD 1IC4L 2WXMA 3R7QA 3HPZA 5G1MA 4JFOA 2I56A 3ABLB 3P5YA 5I26A 5MEQA 1RUKH 4B92A 2BXVA 1RZ7L 1S7XB 3GO1L 1QACA 1IZJA 1WS7A 2B14A 5KVMC 3ZDZF 5BO0D 3OR6B 1GYWA 5GGSA 2CWRA 2FK9A 3F7PC 1FNFA 2H0EA 4J3OC 4QHNA 2CDFA 2TSBA 5K1NA 3LRKA 1VYPX 2BOEX 3HTWA 3NQ6A 4O02H 1R6WA 3V4BA 4NU7A 1I8IA 3GTIA 1IT0A 4UTIA 3R19A 1SFLA 2P5NA 5I6XB 4Q6YA 4LCYA 4AJYV 3RY4A 1TQSA 1INDH 2BSRA 2VSDA 4OCSL 1LO4H 1T8QA 3ZSTA 2BSTB 3QT2A 1CU4H 4K3ZA 3IJYB 1AE6L 4YHZH 1RZGA 5JPMA 5D2NB 3W2LA 3T8MA 3L0NA 3RTLA 5CILL 3AS0A 3RCMA 5TPWL 2V2WA 4OGYH 3WF2A 2AXFB 3T3MF 3C08L 1T04A 4MQXC 5F1NB 4XNMA 1GVQA 1XTMA 1N18A 1R5VA 3US0A 1MCKA 4OIIL 5I3KA 1G6VK 1NC4B 4WCYH 3BIKB 1I9JL 4HKXB 3DYPA 2EABA 2NQJA 2X9ZA 3KPRD 4Z1YA 2BS71 3MA8A 3VWJB 5JMOC 2WBWB 2X0WA 3KOFA 2Y62A 5CGBA 3QZBA 3O8XB 1A0QH 4N8VG 1OQFA 3AU6A 3ZX1A 5T3XE 1NBVL 2BP1A 3HS9A 4LUSA 3EB2A 2UZ9A 4BBWA 3NFSH 4EX4A 1A3ZA 3VXQA 4BD4A 1BX2A 2WMJA 3RA7L 3DU0A 4PJIF 1CK0H 4WEBL 1A3HA 1FX6A 1PUDA 3C2FA 2JFCA 3LKNA 5KVEL 1F76A 2UXTA 4G3YL 3BQ6A 5EMYA 5I9QC 4N24A 4XHJC 1IC5L 4JDTL 2I60L 5H2BA 1MYRA 3TYZA 3DSNB 1QNSA 2H32A 3FQNB 4G9DB 5CG0A 2OI9C 1KWKA 1GYUA 4F4RA 4OT1L 5CGMA 2XVPA 1REQA 4GAYB 1R1CA 4O58L 3RKPA 4FX5A 4A2LA 1OAUL 2MHAB 4J2PA 4PUEA 1PCSA 3C75A 5B7FA 1GOXA 1HH6B 4LASH 1K72A 4PJDF 1J8HD 1U3JA 3RX8A 5J0BA 1OIOA 4LCUB 2DWDA 4TSCH 4XO8A 3QNFA 4DZ8A 2W9DH 3UYPA 2DH3A 3US9A 3GSNH 4FFVC 3N2BA 1JGEA 4TSAH 3NCEB 1ZL1A 5FA3B 2WXRA 2OMUA 2DQCL 2W0UA 2R1WB 4I0CC 3P81A 4NNXA 4PD4J 3QFJE 1UJ3A 4C83A 1DXIA 1C8PA 1HOEA 5JPMC 4PMXA 1KCZA 1CB2A 4XP9H 3N2MA 1N67A 1OSPH 1OM0A 2FIRT 3U4BH 1GGBL 4WU7B 4Q4PA 3I75A 2UZYB 4GRWH 5GHWL 2NSMA 1CFMA 1EAOA 1UD5A 1PLGL 1JZEA 4FMKA 1CW2A 3KL0A 1OZQA 4PB9L 5LN8A 1KFWA 5D8ZA 1A5FH 5SX5K 3ARUA 1NGPL 3NPSC 2XA8H 1T0NA 5B4MD 2V7HA 4ES9A 2QIIA 3LQAC 1DIOA 3P3RA 2AXJA 3QG6B 1ITBB 3ZHFA 1ODZA 3WDJA 2HISA 3DHDA 5ESVA 4X5WA 4YLWA 2WLZA 1VR6A 3D33A 3HTLX 1NFGA 1I7TB 1WAWA 5IMKA 1J9TA 5ACLA 2XCMC 3QJTB 4D8ZA 1GC1H 3BKJH 2YC1B 4Q8WA 4LOUD 5E6RB 3S6TA 1R2SA 1HAWA 3BP6B 2F9BT 2VZUA 4X0VA 1SM3H 2ITFA 3W86A 3V4VL 1ADQL 2HJFB 2EXYD 4ZNEE 4UBDC 4YPGB 2GVGA 3KNBA 4ACZB 2H1XA 1OB0A 1E9LA 1FWCC 3OX8A 2DQJH 4RW3A 2O5ZH 1VGKA 2NUWA 5I02A 2E68A 4HBQA 3EHBC 1ORSA 5ANHA 2P5PA 1G9HA 1KELH 1XCTB 3QMRA 4JS3A 1WWCA 2D7OA 3KPRE 1RK0A 3NA4A 1D8WA 2TPSA 3REQB 2DWXA 4L3AA 3SE3A 5KSAD 4PWEA 4U1SA 1BAFH 4AIEA 5BXPA 2EDNA 4R27A 2Q6WA 1LOSA 1TWWA 4JO5A 2Z4QA 3N9GL 4JAMA 3SCPA 4X7FC 1X5LA 3V4PB 4R7LA 4HYWA 3MV9D 4J2QA 1A7RH 1CDIA 3JXAA 4K9EL 4J8RB 4PJEE 4WFFD 2R7EA 3T1FA 2WHMA 3MRBA 1TPFA 3FTXA 4K7PY 2Z9TA 3MN8A 2WJEA 3O8AA 1FG9C 1JVNA 1OV8A 2I5GA 4ZRGA 5BRBA 2BTMA 3BEWB 3HMCA 2DUZA 2DZUA 4PJBB 2UY6B 1M05A 1OTUD 1N7ML 3C8HA 2WO2B 2A73A 3GC4A 4I90A 5C0GB 2P88A 4F40A 1KGUA 2V2CA 3IETA 1H4PA 2CKRA 5FYJU 5KVFH 1UM5H 1N6QL 1FVCB 5CPLA 3B2XA 3H2CA 2KMWA 1C5CH 3W2DH 1UJPA 5L6YH 4O18A 1NP0A 2P43B 4J3OH 1J8HE 4P2RA 2QZ5A 1F90H 2OK0H 3PJWA 2GSGA 1QAWA 4UFHA 1BFOA 4YDIL 4GXUN 5HI4C 4MJ5A 1XB6A 3R7RA 4BSVB 1AMXA 3F7KA 5F6HI 3B2MA 4Y9EA 1JL8A 3V0EA 5IOPA 2ZZ1A 1YUKB 4D0CB 4F5CE 2FE0A 4ZFQA 2G5UA 4H9YA 3U46B 5H2ZA 1CXIA 1M6OB 1EOKA 3ES8A 4G2AA 4PJ8D 4HPOH 2XHYA 4GMSH 5LDUA 1KGIA 2B15A 2WZEA 5I30H 1X7SA 1HKLH 3CASA 2VN3A 4Z2IA 1YJDC 3HI1A 3BOVA 2WO4A 4J6IA 3DETD 3HA1A 1W16A 3T8VA 4AXWB 1DKWA 1HEJC 2GDUA 2CO6A 4ASTA 3ZGIA 1JG9A 3WCZA 4NSKB 5FKPA 3MTXA 4B90A 1JNEA 3SE3C 1HHHB 1YQVL 5E08L 1BM3H 1JZ4A 4YZFF 3A67L 1WAAE 1EBGA 5I8CB 3NZHL 4HW6A 3R4DA 3EFOA 5GGTH 3WBEA 3VM7A 7REQA 4LSRH 1N3NB 4NJAH 1IBHA 3JYCA 5LWYH 3F7JA 3KJ6H 5D93B 5CSBA 3SYCA 4PMNA 2YPLA 1DYZA 3GH5A 1EJVC 5EYWA 1I4FB 4I5RA 1LT8A 5FI8A 3VABA 5C0RH 3DESA 1Q1JH 5G2HA 2Q8BH 1GRWA 2FT6A 1WUZA 3CNYA 3PTKA 1NKRA 4GMEA 3FFCA 4Y9CA 2EE3A 4YCOA 2X7VA 4QCIB 1DWJM 5FIEA 3UPCA 4XN1A 3FQUA 4XNZC 1EQCA 5AW9B 4BFAA 4L3CA 1XQ4A 4GYBA 2FUTA 4MZ8A 2BJMH 2HN7A 5D1QD 4JKKA 5FEBA 3MVTA 1X4ZA 5EN2A 4BH8B 5AYUL 1OTSC 4UTJA 2DJUA 4ETQB 1PZBA 4PGJA 4JPWL 1S5MA 2R23B 3T0BA 4H00A 3TMQA 1KGXA 3MV7A 4NLAA 4GAGH 3Q3GB 1ZY9A 4BFIB 3D06A 2J88A 1MEXH 1ICTA 2PCQA 3TFKC 5E4EB 3T8XB 5A2JH 5CSRA 5HAOA 2GJXA 1Q6GA 3GUWA 3B1UA 3TT3L 2X4NB 4HIEA 3RWDB 2PXYB 5FIPA 3KLDA 4PJXF 1B3JA 3CBRA 5A7EA 4Y1SA 3QR3A 4R90L 1OAYH 4W9KC 4NZRL 4WFFE 1UH2A 3W07A 3JU2A 1HH9B 2JKIS 4OZIA 4S39A 4OSUL 1B57A 1EZ2A 3C5JB 3GMNA 4HNOA 5C5YA 1BWLA 2ZTKA 4MMZA 4KKPA 4CMMB 4PJ7F 1E0OB 1SRDA 3LV3B 2XETA 4L9XA 1KIPA 4LAOA 1MW1A 3PJTA 1OT2A 2QKIA 2QZQA 4D94A 1MWAA 1CDGA 4MVBC 4R34A 1CFNA 3GM0A 5C6PB 2FYYA 4JANB 1XYZA 1U8PA 3KZ8A 3ZGHA 4OLWH 4W89A 1J0ZA 4MXQD 3WNNA 2P8CA 4R4NC 4C56D 1I3RA 4WU5B 1KQYA 1QI4A 2YLKA 1IFHH 3LQAH 4YHPA 3CIVA 3PDOB 4FXFA 4OJEH 5FL1A 3RL2B 2PCFB 3BPNC 1RR2A 3O6FB 4Q0XL 3CUFA 3T71A 3EJCA 2IALA 3OODA 1RHHB 4GRLD 1F4XH 4ZUUA 4A3RA 4PGDA 5DZAA 1U8MA 4M7TA 4ZQNA 2IH9A 5HHOB 1HWHB 3GMQA 1NEZB 1TJHL 3ARBB 2BZDA 1N55A 1YY9C 4M1DH 4S0SD 1AGBA 1BM7A 4GBXA 4W81A 1E8ZA 4O50A 5I76A 1W0WB 4MCYA 1A66A 2OSYA 1TQVA 1MDAA 3P82A 4M80A 3A4DA 4EDWH 1SXNA 1JGLL 1U5HA 1UXWA 5DSCB 3W7LA 3K80A 3LSOA 3GKWH 4NAMA 4LPVA 5ID1B 4DUVA 1HZKA 3K13A 5IW1B 4TUJB 4BXSV 3M7FB 1Z7JA 1O68A 2WLJA 4PUDA 1AJZA 3LUTA 4BRVA 4B0MB 3F7VB 4NO3B 1X6UA 3HJEA 4QG9A 3M46A 3UETA 3QIBD 2B39A 4NPYA 1NMBL 5AZUA 1B4JL 3E6FA 1QWGA 4DN3H 1JEZA 1A9EA 4GCXA 1UZDA 3CFKA 1QVBA 5I06A 3IAGC 1LROA 3E2VA 1YCSA 1A5BA 5DLLA 1DIEA 1AQ0A 3VW3H 4PR4A 4AG4H 5IHZB 3V0VB 4MMZC 4DO5A 1J5IA 4O1DA 2GSIA 2G41A 5D1QE 4F7TA 1IR2A 3MJMA 3EXSA 4FA3A 2WPBA 3MUGB 4N0FA 2QKIC 3QWRA 1BYOA 4KEUA 3QQ9D 3G24A 4L4VA 1AIFB 3DFYA 3EJUA 1CCZA 1QHPA 3LPPA 4N8UA 1V0KA 3DGBA 2X4QB 5EUKB 3QPQD 4JHZA 4PBGA 5D8WA 3S2MA 1F42A 4KRPB 3RWCA 4NZUH 3WFBH 2P48B 4B5UA 5TE6H 1HL9A 1KBWA 2Z91B 3AJXA 4NAFA 1NEUA 1RJLB 1N19A 4U6XA 3BC9A 4X9FA 2E59A 1KCUL 4GRWE 2QPDB 1CE6B 2ZP0T 3KJ4C 1BQGA 4TNEA 4YUEH 4B60A 2PNDA 1UR3M 3SIZA 1ZFJA 2YA2A 3IJHA 1CC3A 3BKCL 3N34A 5IF0B 4S0TD 5IROD 1IYXA 5CD5C 3JVGA 1FZMA 1RP8A 4UT9A 1QNIA 3CDCA 4EOUA 3O2LA 4RAUB 3TK7A 3FT4A 5BOJA 4OCXH 2GDQA 3VCLB 4QDWA 1G9ML 4IPJA 1XIJA 4MPQA 3N91A 1XXXA 3GI9L 3CHQA 4K3JH 4QIRA 4IGBD 4RGNB 3UTTA 2XFWA 4Y4KD 1N8WA 1BEYH 1P43A 3HPSA 1UD6A 4GOSA 4Q9RL 1GA2A 4DVBB 1TVNA 4A29A 1SMAA 1YJDH 5G1YA 4U4IA 4JTSA 1UA6L 4X61A 4TNVK 3ECVA 3KZPA 1IGYB 3HBZA 4FYTA 4WFED 1SO4A 3IXAA 5CMAB 5EL1A 1EGMA 5T3XL 4YEEA 1LDPH 4DQAA 3KAAA 1ZSHA 3RFAA 2CKBH 4WHCA 4E9YA 3CH1A 3VUAA 4CC4A 3VTTA 2LABA 2PGFA 5DD5H 3PPGA 4DX3A 1ETZA 3N18A 3ZJ7A 2BVOB 1NARA 3TOYA 2O6CA 5IMLB 2YEZB 3WGUB 2R8SL 1L2QA 3T0VA 3CMGA 1BYPA 1VCFA 2L3BA 5AW2B 5ITFB 1VPXA 3H85A 4FEIA 4IM4A 1TZAA 2GJNA 5TQ2H 2DN7A 3KVLA 3DXAA 2RJGA 4XPTH 3UZVA 1UZGA 4PJCF 1YNTB 3PAZA 5CG7A 1GWJA 5CBIA 2PABA 4XPAL 3LH9A 3LQGA 2DM2A 5DS2A 4P2AA 1OVDA 1QXLA 4NKQB 2CAKA 3G1FA 4FFVD 3AWNA 2ZAIA 2ICWJ 5CINH 3ENLA 5LXVA 1S6NA 4H8PA 1ODUA 3PZ9A 3Q8BA 4WQ6A 2YYTA 1G84A 2DSZA 5EWIH 4G1KA 3DOIA 1XAKA 4FMFA 2AI0H 1T1YB 1AR1C 1IVTA 2WZAA 3UYCA 1VCVA 1DFBL 4PJ5E 5D1ZB 4Z17A 2ZYSA 3UZQB 2I9TA 3N42B 3CIAA 3JVGC 1LL7A 4KJYB 5KTEH 1Y1DA 7PTDA 5BXSA 3ARFB 4KROD 3K5XA 2CBJA 5E9DB 4Z3TA 4NZCA 4X9IA 2JJTA 3M1BA 1F2XK 1ZJBA 3MX0B 4G8IA 1WBXB 2PTWA 4K71B 3C52A 2VFDA 2D9CA 1XUZA 1SW7A 1BSIA 4AVHA 3FN0H 2BNQA 3RGVB 4DJDA 2AAMA 1A3LL 5EU6D 5H94A 1ZP3A 3GNPA 4NC1C 5MEOB 4ZX6A 3IUIA 1YPZF 5G5DB 4UMBA 4HJ0D 4OZHE 2VDIA 3I50H 4O2EB 2Y1VA 1OINA 2PWGA 3BEVB 2F7FA 2PUQT 2PUZA 3QN3A 1J10A 2NZLA 4UDTB 1G1CA 4MOZA 3DFSA 3AJ7A 3DJRA 2Z28A 5AW7B 1G9NC 1FH2A 4RE2A 1T1WB 1TKWA 2NQDA 3UJJH 1TENA 4LVNB 4PY8J 2KLSA 2QDEA 1CT8A 3NIGB 4HSNA 3CFEB 5B7YA 4WUIA 3CXHJ 2DPEA 3WLKX 1Z9LA 3ERXA 1YUHB 4X6CF 2O6PA 2WWNA 2H3NA 4YHML 1PG7H 3TDFA 2QFPA 4EN3B 1RY0A 1QSVA 4KITB 1IAII 2A4AA 4S1DC 1FNGA 4IFOA 5HYQA 4XAWH 5FK9B 1X5IA 5ERWB 1QNQA 2O5XL 3L2IA 3KLAA 2DQTH 2HFGL 3U3HA 5GNXA 2QHRH 1B90A 4REQB 2IJ0C 4YFLF 1MXDA 4RR4A 2I32A 5IHLB 2NY4C 1HVXA 3ZJ8A 4HX1A 2EJAA 1IM3B 3D0VB 4M4PA 4A6YA 5FM4A 1SYVB 1RJZA 3HNTH 3BHBA 5E5MB 4HK3N 1MNUL 4N8CH 2BRRH 1FRGH 3EXRA 3MP4A 3KGSA 4IK6A 1WWBX 2ON3A 1SZRA 4QFUA 1U8IB 3FUHA 4QT5B 4XVTH 1VP5A 3SOBL 1INQB 2HH0H 4W68A 4KZDH 1C7SA 4DBWA 1C12B 3GIYA 1W32A 5L4JA 3VFSA 2C4FU 4O17A 1LEGA 3OWEA 2C4FT 3P2BA 2VC2B 2IO5A 1EXGA 1ZTXL 3PFQA 2JJTC 5C08B 5TF1H 5C0QA 1NIEA 3E9AA 2VITB 1J9QA 1M7OA 3S88H 1H19A 1J1XH 3MODL 1R3KA 2A6DB 3QDAA 1QTYT 1GKOA 4QJ5B 4B9IA 3OAYH 4GQGA 4XXWA 4Y8DC 4DJDC 1H6UA 1RHFA 5HDBE 4DK6A 1R3SA 4KK6D 1OPGL 4DXKA 1ASQA 3LKOB 2ACQA 1EEUA 1NCBH 4FJYA 1T2QH 4DKEL 8FABB 4G1EA 4G9FD 5IHSA 3NQFA 3FT2B 3FL7A 2VX6A 4HHGA 2D7TH 2IPGA 4BZ2A 1UJQA 4PFEA 3D25B 5T1KA 3GNMH 1JYNA 3KS6A 1OY3B 1WO2A 5J1SC 4M3PA 1JPGB 4RPQA 2KDYA 4LLVA 5EUOF 1DZ0A 2V5JA 3ZUCA 3I02B 2X5PA 2VQ4A 1QPRA 1N26A 3L3GA 4U0RB 1QOXA 4R83A 5HVGB 2ZVRA 4DM2A 1OO2A 1KEGL 1E1EA 2V8ZA 3BKML 4KAQL 4UV7H 4ZX3A 1TFHA 4KRMB 2Z2UA 1AXTL 3KM8A 5EMMA 3MTWA 4PG2A 4PYGA 5AALA 1RU9L 3WQ6A 4ICXA 4UM8B 3CXDH 4YDZA 5EU6E 2HBXA 4JO8A 1DQMH 4Y4FA 4ZO8A 4UQ2A 4ALDA 3KPMB 1GS8A 2D3NA 2TRHA 4LS2A 3RG6A 4GYKA 2ICEB 3MC0A 5JORB 1CGXA 1MCWW 3GINA 4JKMA 2CWNA 4XZ9A 2GGEA 3CH8A 2A38A 4JRYB 3RDJA 5FYKU 1S5HB 3QC6X 5TH2B 5G4EA 2EKGA 1K4DB 1CGTA 2X4UA 3SZKC 4Z7WA 3CVHH 1N68A 4O02A 3DBXB 3OB0K 2JIXA 4ML9A 4KCWA 4NZJA 4NPKA 2EE0A 5TDNA 1F4YH 4RQQA 5KBKA 2B2XL 1HNFA 4YDVB 5KVGH 4OAWA 2GGIA 1OTSD 3ZM8A 2WVSA 2IAAC 4V1DB 3G5ZA 3NGJA 3QUZB 4P2RD 3T2NH 5M95B 4D1IA 1Z9PA 4WO4A 3VFGH 5DLMH 1Q7QA 3TFKD 3GG7A 2JWYA 4B7IA 3SDXA 4RNJA 2WXFA 2CIIA 2YGNA 3WJXA 2ALAA 3UAAA 4JFXB 3GAYA 3QWOB 3N3MA 3PAOA 4ZTPH 2ATKB 3UL4A 2X88A 4JE4B 3GZKA 4NYYA 5EG6C 1LMKA 4AMCA 1PVHA 4H8VA 1HKVA 5CBEA 4HSCX 3BAXA 5CKAA 3R1GH 2QCHA 3MQTA 4YOKA 4AVJA 5GRXG 5KZCB 3D52A 4OKVB 4BSWB 2XV2A 3MP5A 1NM9A 1YLBB 5LNVA 4ZO6A 2OYKA 3S1GA 3S3JA 2Z1PA 1E6NA 1I9CB 1IAKA 4P06A 2CEQA 4F58H 1HHJA 1H5YA 2YGOA 1NQKA 1LO4L 1ZLEA 3VFMB 3PWUA 4UT9H 1A1OA 3GSVB 1J2BA 1O1ZA 4HQVA 4YHYB 2EEAA 1TLMA 1QA9A 4PG2C 4GNVA 1V8EA 1VADB 3IEBA 5CEXB 4R85A 3TEUA 3W38A 3WNPA 4ZO9A 4F0LA 4Y5YB 4Y4FC 4AT6A 3MP3A 5FM8A 2WSYA 2VN4A 1QPKA 3MRJA 1GHFH 4MRBA 2QDGA 4HZLB 1MSSA 4Z7IA 3SN4A 3NZRA 3H3BC 4NQXA 4OGYL 4F0KA 2YPLD 2I27N 3SYQA 1H7WA 3UWYA 2WJ5A 4JKWA 1WC7A 2DQMA 5AVHA 2EF9A 4JL1A 3RG1C 4ZMTA 2XPGA 3GRIA 5EDXA 1KRCC 1XISA 1HXJA 2O9OA 2WQRA 4YHEA 3LDVA 1MFCL 2GVEA 3HFYA 1L9OA 3GU2A 1DE4B 1MJJA 4QRTB 2FQFA 3EJYC 4D6GA 1RCXB 1G9NH 1J9CT 2B59A 1U92B 3R0UA 4D0BB 3WDRA 2WKOF 3DK0A 1LTDA 4HHPA 1WGVA 2EIJB 4K39A 1A0QL 2XHNA 5TK4A 1WDSA 3E02A 3QRGL 4JBRA 5IQ7H 4L1TA 2HTLC 3O9WB 4Q7IA 4ZODA 3TV3L 3GSNA 3OO2A 2K6WA 2PPDA 4H04A 4A8NA 3MRNB 4FNRA 4CILA 5MI0C 3TEZA 3HVDA 2AAAA 4NN6C 1CK0L 2JF1A 2PPEA 4JZNB 3BWSA 3G6AB 1KRAC 4GBDA 2HPIA 4WO4C 2AV1B 1QFUL 2AJSL 4KKBD 4S11A 4Z7OF 3BCJA 1JZIA 3VYNA 4HQQH 3IFLH 4JM2B 1LUCA 2Q3AA 2OLHA 3KPOB 5D7IF 2Y7EA 1L5GB 4PJ9D 5M1TA 3FF8A 3RWGA 4P23A 5D32A 4OD1H 2ANUA 1BD2A 1RJRA 2K1MA 1WPCA 4JJOA 3TNOA 1MAKA 1V0NA 3BX7C 5KJ4A 4IIQC 4BA0A 2J21A 5HK4A 4TSCL 2IDCA 4JFPA 1VFAA 2AC0A 5IK3B 5HJDA 5CU5A 4LVHB 4FOKA 3R0NA 4DELA 1FFPB 4J8QA 4HHWA 4TSAL 1L6PA 2WTRB 3GU9A 2AJZB 4P2RE 3P0XA 4ZB5A 4A67A 1I2RA 2IF7A 5IW3A 4XP6H 1ETJA 3HZMB 3F12B 1ZS8B 4YL4A 4PTTA 1J05A 4WJ5B 5GRUL 4XOEA 3CYVA 4NZFA 1KR0A 1H11A 4XP9L 4DF2A 1OSPL 2PCPB 3SIKA 1SJCA 5C97A 1IIKA 1V3LA 4ZQTA 1DUYA 2C3VA 5TDOB 3FO0H 1AKJD 1NP2A 1GVOA 2I26N 3DV4A 2XA8L 3HJZA 4F3FA 3QXAB 1X96A 1TJRA 5DRWA 1KEMH 1MFDH 1JTTA 4GPNA 1OYCA 5F9WB 4OFQA 4QDMA 4GBXD 2YXFA 3ARDD 4HUNB 2PRLA 2FZBA 3NSJA 3FRPA 3NCWA 2ISVA 3T0DA 3WN5B 4KWWA 4GE8A 1GC1L 2DQDH 3BP7B 3CAFA 3FULA 4Y9AA 3SQBA 2NZ1A 3T05A 1WBZB 4WI3A 2FJFB 1SZEA 1PZ3A 1M6UA 5CJBA 3M16A 4MAVA 2N56A 1A9BA 1UMLA 4WXYA 5FB8A 3HZYA 5EOCH 3L13A 4JN6A 2QZRA 3E2RA 2YPLE 2DQJL 1EJOL 3FK4A 1JHKH 1SJMA 3UROR 3HHSB 1NM4A 1HOCA 1FYTA 3DMMA 2BP8A 5HYIA 1IBGH 3ZN6A 5DJAA 4A39A 2BRQA 4LRIA 1K9TA 3UYIA 4TLSA 5HYJA 5AZ2L 2Q10A 1P6CA 4UDUA 4RV8A 2X1SA 3RWFA 3K2MC 1EBAA 3AYTA 4XZ4A 5LXGH 3LB6D 1QNOA 4JFFB 1GOHA 4YLCA 1BAFL 1RJYB 5E6YA 1I6NA 3TQVA 1K4CB 3QWRD 4L4VD 2OMTB 2XIBA 4G82A 5CS7A 2I9LB 4WW2F 3ZDYE 3PXHA 2GQHA 2XT1B 4QMEA 1N2RB 3WJWA 1P1XA 2E56A 2VDQB 3CUZA 4GO6B 1OP9A 2CJ3A 5CGYC 1I8JA 3V0SA 4PP2B 5T3XD 4JL2A 1E5BA 4XCNB 2EC9U 3FYOA 2EC9T 2XWJB 2VIRB 2M1KA 3QJVB 1KSRA 3O2VH 4MA7L 4NWTL 1N0LB 3JR2A 5LZLA 1HW6A 3SYPA 1W5NA 1FL6A 2O56A 3EF7A 2QJDA 4HV8B 3A3XA 1HX0A 1UM5L 3CXFA 1C5CL 1V55B 3W2DL 2WCPA 4IJ3C 5L6YL 4YXKH 2CHNA 3MRPB 4HS3B 2WQUA 3B8WA 4YGVB 4B91A 5DO8A 4MBOA 3KHDA 3SY0B 3FFDB 4X9YA 1FDJA 2E4TA 3FSOA 4PMDA 4DJMA 5CSZB 3UTTD 3MBWA 3ZE2F 4K1WA 5KTLA 4GUPA 3OKMA 2R6OA 5GGTA 5PAZA 2CU9A 2YOCA 3WCYA 2HYMA 2ZT9C 3LPOA 3H1ZA 3S83A 3Q5OA 2HT3C 5DR5L 3E2SA 2HT4C 2Q86A 3PS6A 3VD0A 3ZT6A 4IHBA 5IP4A 4YN5A 5HWJA 3MBDA 2QLYA 4LC8A 3H12A 1FGVL 4LYQA 2V8LA 1SHSA 3JZYA 4Q58C 4HPOL 3CEUA 1TMLA 1NWRA 4PW3A 4QTHA 5J12C 3GWJA 3DOHA 4LU5L 1UWIA 4NZ4A 4DN1A 4BDVB 1SOKA 3WBDA 3KDOA 3UVAA 2EDKA 2V5CA 5I30L 3ZLHA 4DBEA 2A21A 3DMMC 4HD9A 3D4CA 1J0YA 1X6NA 5BVJA 4ADSA 1SVBA 1ZVSB 2XFRA 2IQ9H 1A4JB 4AM0B 4GG8A 2BY0A 4B4FA 4GGBA 4LRIC 3IDMB 1EX0A 2DW7A 1EZLA 3MU3A 6FABL 3RR1A 4FRWA 1HSAA 2MNWA 4IKNA 3CAVA 1RIUL 1JNDA 1GMEA 3TCLB 1QPQA 3C0LA 3DXAD 1IKOP 3VG0H 1BXCA 2HJLA 4LKXB 2XSBA 4LSRL 3W7EA 1XGTB 1PNCA 5LWYL 2VEIA 2DM3A 4Y2LA 2NUPA 1YKWA 3DO4A 2NY5C 2QUTA 2HTKC 2PP9A 4XWGL 4AQEB 2FO4B 4JPQA 1TZGL 1Q1JL 5F8RC 2BX5A 7ENLA 4PWJA 4KKNA 1DEDA 3RLUA 1RZJC 4J1OA 4WHTA 4RZCB 1OAXL 5KN5B 4KVNH 1M7IA 5EKYA 2CHXA 4HCFA 3NCOA 4Q8UA 2OSXA 3WLBB 3QS3A 5EO0B 4W5ZA 3VXTA 4LAQH 4HJ1A 2CLEA 4NENB 1AZNA 3SDOA 3LX9A 3QCUH 4F9PA 2IC2A 3EPOA 4TTDD 4KXZI 3NCMA 5C0EB 1OGTB 3P0YH 3HS8A 4U7MA 1QWKA 1XIWB 2EVJA 3PBYA 2JB6B 32C2A 1D2KA 4GAGL 2VZSA 1LM8V 4N0CC 1SU5A 1MEXL 4IFKB 4L4VE 4P2QA 3MI2A 1TTCA 3ANUA 5D71L 4G6AC 1VESA 2DD8L 1IWBA 2FX8L 2DZAA 2BNQD 4Y5XA 5ECVA 4Y19D 2G9KA 1X5ZA 2K9UA 2YO3A 3V5HA 3G5YA 1Y18B 3U2EA 4U3SB 1NFBA 2GJ6B 2IH3A 4BK9A 3SKUD 2QTVA 1XGRA 4N2MA 1LQSR 1HQTA 2GC7C 3CZ8A 2YUXA 3BUYA 1WYIA 7PAZA 4U3HA 1J1OL 4XNXH 5HMDA 1G0DA 4KEZA 5HSFA 1LO0H 1S5IL 3PHQA 5KSBF 3LXCA 2G50A 4FYSA 3WTTA 5JIMA 1IM9B 2LVCA 3NVDA 4DPBX 4LU0A 2KC0A 1YNKL 4XP1H 4QRAA 4OLWL 5D30A 2V8MA 4PPTA 3G08B 1RK7A 2JK5A 4U49A 2YSSA 4MLIA 1CFTB 2RALA 1QT1A 2DS4A 1TVLA 5E8DH 4ERSL 2XIJA 3LQAL 2GTQA 3UTTE 5JDJA 1PZ1A 3FA5A 3A0OA 4GG6F 3HPLA 2E47A 3KYOB 1T7ZA 3LHTA 4JCWA 3NFPB 2K3HA 4NC1E 2JXMB 1F4XL 3KXFD 4JDZA 3GC5A 1W9BM 5F7LB 5JIDA 1PIFA 3IIPA 4NLHA 5I5IA 4YXLL 1BZ9B 4JYDA 1N82A 3JVAA 1ZTMA 4AH2A 2VR5A 3S96A 4YSUA 1BQSA 2XH4A 4WY0F 4KXBA 1J5OH 3CDFA 3NEXA 4TSBH 1AD9B 4IRJA 1UUSA 4OH2A 1KGJA 4EDWL 4D71A 2E27H 4F3HA 1JPFB 3W1TA 3QO1B 1RSFA 1RZIA 4F9PC 4JIQA 2ZTBA 4OE7A 3NFUA 2VDMB 3P67A 1H51A 2ISSA 4OR1A 3EF4A 4OJFL 3DXAE 5IJVB 4P3WA 2E28A 4FOJA 1DBKH 1BQHB 2V5SA 1UFGA 4ZVJA 4P3DB 3RFRA 2OYPA 3ENEA 1ZHKA 4Y5XC 5DEGB 2A0NA 1AACA 4GP4B 4FQPA 4HXBH 2XQYA 4LHUB 4DN3L 4XH2A 2AQTA 4ZDHA 2YYUA 1S9VB 3LEXB 4XMKL 6XIMA 1E9ZB 2C9UA 2ABAA 2EDQA 4NHUA 1WEJH 3VW3L 1V6WA 1KFAH 4CD6A 1E9OA 1OFQA 5BOEA 1G7LA 2WXQA 1TU2B 4X9BA 4TVUA 4ZW8A 4M7ZC 1JD9A 1XRFA 5I1LA 5ILTH 3W7KA 1CFQB 4RIRA 3NN8B 3EYOB 3U4FA 3FB5B 4I9XA 4G42A 3KBNA 4JX0A 2WV3A 2GEQA 4YLBA 4LBAA 3MJGX 5I0DA 1ML1A 2PLCA 3QFDA 3VIFA 4YSPA 1P4LB 4NUPA 3L4VA 3M1OA 5TE6L 2YL9A 4L8CA 4WX2A 4I1NB 3V5FA 1OK0A 1NDWA 1PZ0A 3DRTB 4LBUA 4YSCA 3GMRB 2Y0SA 2BNQE 2MOGA 2PR9A 1FFTB 4Y19E 1JPMA 3TA9A 4YUEL 2ZA2A 5JXAL 4HGXA 2CKBA 4MZ3A 3N2JA 2R39A 5FFGA 3QORB 2H2PD 2JI3A 2I9EA 1HCVA 4XMVA 3EB4A 5M7QA 1P4IH 4ZPVB 3OBAA 5E6IB 2YPKA 4NYLA 4DNLA 4FAMA 3SKNB 2Q7AA 2YD2A 3QARA 1EIBA 4EI5A 4IG2B 2ICSA 4WJG3 3LZNA 4IRJC 3WDPP 4K3JL 4Y2WA 1D7BA 1LE9B 4HUUB 1BEYL 1FVEA 4LPYA 5I1IL 5T1DL 2AJVH 4KQ4L 2XKUA 2XRAH 5FD0A 3NZSA 2IFFL 3E74A 5AAPA 1E4LA 2N7SA 2Z4TA 3QJXA 1TJ2A 2AAVA 1ZTXE 2GPZA 4B9ZA 4HIBA 3PP4L 5F6IC 1NBZA 1TPXC 3POCA 4PE8A 5K9KB 4OGAC 1AZZC 3T6CA 4CADA 4CW1B 4Z1CA 3KXFE 4RVBA 4WWKD 1MQPA 1Z44A 3UJTL 2NV1A 1EJFA 5DD5L 3SGEI 2R1KA 4OV4A 2CK0H 4Z76A 5E09A 1BYBA 5C09A 1CXKA 4GFIA 3S35L 5DVPA 4BZ1A 2NY5H 4ORGB 2O9PA 4LT9A 2YUWA 2VRKA 5L2JB 1SMOA 1TTAA 4NEHB 2HVBA 1OG0A 3CFBA 1RZJH 4UOW0 2FZ9A 3AU1A 4WEVX 5FLUA 1TYGA 4CSPA 4JK0D 3QY6A 5KMYA 1TKKA 3W7JA 3TN3A 3RY6A 4M5TA 4ODUA 1YC8A 2Y8UA 2H7WA 2IADB 3EJRA 1RQHA 5DQ9B 1KTLB 1K03A 3BVNB 4IPNB 4JB9L 3D0AA 4ROPA 1P5UB 3OVPA 4I9JA 4JKPL 5EIIA 5I71C 3WIHH 4LQ1A 5CINL 5CSSA 2EE6A 3VIOA 4ALAC 3QG7L 4FFZH 3RRXA 5D70L 5GGVH 4KWUA 4YE4H 3VFTB 1QSFA 5BPPA 2Z2BA 3GHUA 4PRIB 1G0XA 3MLXH 1JUKA 2J1ZA 1VBGA 4PJGB 1R3LA 4I0PD 1H50A 4YDLC 1W8GA 4F2ME 3GFZA 3VH8B 1CURA 4QX4A 3ZZ1A 3QDGA 3VXMA 4PJAA 1RVFH 1ET5A 1X7QA 5IW6B 1D5ZB 2WLMA 3G5XA 1BIIB 1XKJA 4N5EC 2GIXA 4S1QL 1NJJA 2GQAA 5ABTA 2OVLA 3RPIB 3U83A 1GOKA 3CMJA 1B2YA 4EI5C 4HKJB 5DXYA 2DZVA 4O10A 1R3YA 1S3HA 5DJXA 3C56A 5HYFA 1M42A 4KWOA 1T5WB 2NX1A 3MYPA 5I1AA 3FN0L 4M61B 3D2TA 3X2QB 2MCPH 3KDMA 1XO8A 4P0DA 4CMHB 4Z7UB 4NVTA 4QRPA 1ZA3A 2P53A 2WYSA 1JDEA 3C61A 2D0HA 4NDMA 5T91A 3VQMA 3WS3A 1ZWIA 1A7NH 3KGRA 3VJ6A 3EGXB 2DZPA 4QXTB 2HZGA 2PDGA 3MRKB 3ZMEA 3RVVD 1HO1A 4DW2L 3N73A 1XSJA 2FO1A 3R10A 1E67A 1EJWC 4X98B 2ZZ6A 3EX4A 1AVAA 5KZMA 2WKLA 3FRPG 3QZWA 3UJJL 1T03L 3PZIA 4GXWA 1UWEH 2HRGA 4KKLC 3OQ8A 3MFFA 5DZ9A 3N0AA 3EYQD 4ML4A 1XH3B 4TMBA 2UV8G 1R9FA 2EVIA 1BVZA 2JQAA 3PHAA 1FWGC 2WYHA 4P23D 4Z7WE 4QCEA 3S9IA 1B0RB 1CYWA 2FCBA 3O45B 4XAWL 2Y5JA 3EJZC 2R0WH 1GIGL 4HLJA 3MUY1 3SQRA 2DQTL 1C29A 1ONQA 3RY6C 4LSTH 1OYAA 2XKSA 3QPXH 2QHRL 3TA3A 3PL6B 3NIFB 3VINA 3S37H 4NQCD 4WW1A 1XYLA 4FTVA 3ZKXB 3N9KA 2YFNA 2LTQB 3HPFA 1UR2A 4N8CL 3C9NB 3I6SA 1R9YA 5C8JA 1W37A 3DKLA 3C6LC 3SDXE 2J88L 4LGRB 1QUNA 1ZV2A 4J3OG 1T1ZA 2AGTA 3CZGA 5T1JA 5LHFA 3QQ3B 4KZDL 5DO2D 3K8MA 4NG3A 3WNIA 3PM6A 5I1HL 3H9ZA 3MLWL 1JWSA 3D5HA 4ZSOA 4YIWA 1LJYA 4TNVF 3KCOA 5J13B 3DGCR 5ICYB 3M8OL 3H0TA 1J1XL 3TTOA 4LMQI 1P84K 3C86A 4I7WA 1G69A 4AYGA 2ZCHL 3SADA 4JN7A 1DL7H 2ATSA 3HN8A 1LP9A 1MFUA 5D5MF 4U7SA 1ETA1 1WCBB 2IEPA 1NIBA 1MWAL 1NCBL 1EERB 3ETTA 4ZS7H 4QNPF 5IEKB 1FHVA 3SUSA 1NIFA 1FE8H 1SSGA 3VOCA 2AQOA 3UXAA 2B77A 2XX0A 1NBYB 2LAGB 2ARJB 5FFLA 4PJHF 1NFDF 1LWHA 5FGBA 4P7LA 1IJNA 1ZGLB 3ITGA 1WISA 1CNVA 1BQUA 3GNML 5T5NG 5EF2A 2CO2A 2X4RB 5ADPL 4K1GA 3B6SB 1VFOA 1QRQA 3NVQA 3EOUA 3AQXA 1JCXA 2FPYA 3CUXA 1RURH 3U1QA 3CVHA 1ITXA 3WD5H 1FYTD 3PIQB 1EWEA 5D96B 5AFDA 4BFRA 4MA8H 4QYOA 5GPRA 4U1NA 4E4FA 4ZQOA 3ZTJH 2BGQA 3OKDB 4C4KT 5HYSG 4ZSTA 5HYJD 3NSFA 2VZOA 1TV2A 1E6RA 1T2XA 2ITCB 3L08A 1CTMA 2CGZA 3FHAA 4PJ5D 2H8ZA 3L67A 4XMPH 2ADGB 3IV3A 1DQML 2KH2B 1KULA 4J3OD 3H4FA 3L2NA 1ROWA 5H35B 3PG2A 3I85A 3TA3C 2WB5A 2GITA 3KCWA 2DLGA 4GH3A 1CDHA 4ZE4A 2OXGB 2XXMB 2G3JA 3ZO9A 1HZYA 4MDPA 3QMSA 4UQAA 2AGJH 3F64A 4O1FA 3MRIA 4F0HA 1CLYH 1OCJA 4F8LA 1IAMA 1JIBA 1PKNA 2PDWA 2QSTA 5A43C 3K71A 3FFOA 3MGTB 3TCTA 4FF7A 3GTTA 4KMQA 4ODTH 4NQDB 1IEWA 3PWLA 2OWWA 2F18A 1RMFL 3MW7A 3CUPA 3B3DA 3CPLB 5IVXB 2FWUA 4ZMZA 5KVGL 4QRUA 3CU7A 1BD2E 2YLAA 1BG1A 2D0FA 4QAWA 1JK8A 3MGOB 1OD8A 4MQXD 4H2AA 1W56A 3K4WA 3LCIA 3C6CA 4HN4A 3SAZA 2XYCA 1GZ1A 4B4HA 2D7QA 1RCQA 1MMFA 5AVSB 4QHLB 3P02A 5DLML 3FT9A 3Q6FA 7CGTA 3GFYA 4NQCE 2E3ZA 4G6AD 2P3ZA 1SLVA 1GOGA 3UJIH 4X7SH 3RFZB 1W80A 4ZTPL 4N9DA 4PN2A 2HPTA 5C9WA 2QGHA 4XUYA 3N50A 2DWYA 3HGOA 3FJTA 3QEQA 4RFNC 3WL1A 3AZUA 3PUCA 5FGBC 4W9DC 2YWYA 3N14A 4ALAH 4LF3A 3RU8H 2D23A 1IARB 2DSUA 3H26A 1I2QA 2K4AA 3UGEA 1GEHA 2BNRA 4G8TA 3VFPB 1G4EA 1G7HB 1EF3A 1XGZA 2LOEA 5BMFH 1O6TA 4J1UA 2Q7NA 4UT9L 3BE1L 1B0IA 25C8H 4XHJD 5CH9A 1FP8A 3R0DA 3VI4A 3CLWA 3UMTA 3A4FA 1HKJA 3BAYA 4OF3A 1N6VA 4U1GB 3QYQA 4NKIL 1GPWA 3WFZA 3P74A 1CXFA 5AY7A 2Q76B 1BECA 5DYOB 4PWHA 4PCSA 3WD3A 4PRNB 2OWXA 2D7PA 3QGVA 5EU5A 4AZHA 4NZ3A 3OKEA 1WCQA 5JPNA 2C1GA 1C5DB 5DN1A 5DUMH 2WNNA 2DPKA 2O30A 5F96H 4JTDA 1O66A 1DVXA 4Z1PA 5DXWA 1XCWA 3ZVVA 3LKRB 1KXTB 1I7UB 4JGMA 3T6WA 1SHXA 4J27A 1DVYA 1H3PH 1FYTE 1BXBA 5TFSH 3WE6A 1UZ4A 2BVPB 3UA4A 1B0WA 2DM7A 1ZCOA 2GGHA 5HYJE 3ZE1E 4ADUA 4BZ1H 1CVSC 3FQYA 4N9OB 3VFCA 2PMQA 3ZTJG 1QZ1A 5KVFE 5FWRA 1F11A 1JWMA 1S2WA 5DRXB 1DQLH 3SDDA 3R06A 3FU0A 3WAJA 4DFIA 1ZRUA 4WDTA 2ZD0A 2X87A 2DLEA 4JMXA 1P0SE 3LN5B 5C0IA 3HQOA 1SF5A 1I8KA 5F1OB 3L7EA 4U2ZA 4JTJA 5KUMA 1F5ZA 4LY8A 4B27A 4O51A 4XIMA 1HKKA 3AALA 1MCPH 4KNQA 4P05A 3B9KA 1MCIA 1RJCA 1FVPA 5CJOL 4QLLA 4JPIB 1TQCC 1GQKA 4M3KB 5A8OA 3LQZB 2H5UA 5KSVB 1KIUA 1TQTA 1ZT4B 4RNRA 1UP3A 3GG1A 3ZLGA 5ANMA 2WBKA 2O55A 4D6IA 2F58H 4A1RA 5FKAA 4UBDD 5DFVC 2XQYG 2Z8WC 1KV5A 1PS9A 4QHPA 2DV0A 3PWPA 3D0LA 3R2GA 5BRZA 2INEA 3W76A 4LE8A 4DO7A 4UIMA 3IVUA 1XXFC 5DQJB 3V75A 1AGDA 3MLUH 3T6VA 1TJ1A 1K2DA 2EXTA 2HCVA 2B9BA 4X9GA 2VLLA 3EHBD 2Y69B 2VEPA 4ADIA 2ZUXA 1TPC1 4QWWC 1M56B 3QFJB 4KQ3H 2WB1A 3URAA 1UOZA 3LV5A 3PZVA 3QQ4A 1PLBA 1UZ6E 5BMXA 1H7XA 4ZFMA 3KWWA 4HF5L 2YBVA 5JPNC 2EUWA 4EIUA 2P26A 4CCDA 1BZQK 4CNNA 2QUVA 4PCYA 1I4NA 1ED3B 3W2NA 3T0AA 2APXA 1F3DJ 2YN3A 4AX3A 5K9OA 2JSFA 2CHZA 3IJQA 2VDKL 4EXAA 4G7VH 4GRMA 1XYCA 4YHKH 3D46A 2FYMA 5L8LB 2FHBA 3OHXC 3QSTA 3WFHB 4F0RA 4G6KH 1J5TA 2NY6C 1L6FA 5E95B 2CWXA 4N9GA 4Y2OB 4LEFA 4JIRA 1E5JA 2A9AA 2FJGB 4IRJD 4GJ1A 2G60H 1THCA 1BSLA 2XSAA 3MRHB 5AVQB 1DO5A 2HWZH 2DQDL 1XRVA 1NPJA 1D7CA 2GB2A 3DO7A 4Z08A 5AOUA 1IQWL 3BN3B 3F6LA 5IJBC 2PF0A 5DS8A 2IXVA 3MMEB 3NJMA 4Q4OA 3BGGA 4UR8A 1KOAA 3EFFA 3SDDC 4A2DA 2W9EH 4XVDA 3GG0A 3QGKC 2V7NA 5CJMA 5HATA 2NW3B 2GWGA 4HALA 2VGIA 5SWUA 4CQ8A 3S2LA 1XF4B 2BHYA 4TVPH 5D1ZI 2EIEA 4K3GA 1YLVA 2GGJA 5GNZA 1JHKL 2EVHA 4XNQA 5I6LA 1XHGA 4XKYB 5DCBA 4IHCA 3O9NA 5FUOH 3B9KC 3BI9X 3BGFB 4XZNX 4APXB 2K45A 1JUEA 3AB0B 5FOBA 2C1OA 5HI4D 1IBGL 3G6JF 2DWEA 3CDYA 2XVLA 3M0MA 4A6YL 3LXAA 3S5LB 4MAZA 3OG4B 5D9SB 3GDLA 1K85A 3KPRB 2C3ZA 3X3GH 3S3GA 1IT8A 1TZHB 2FATL 4DGIL 3UO1L 3Q0HA 1ZJAA 3RLVA 4F0MA 1DQQB 1UA3A 3A47A 3R18A 1D8CA 3QAQA 5HVWA 4HTBA 3LQLA 3CLEL 2ZC1A 3MLZH 2BNUA 1XYBA 4ERIA 4KUCF 5CLZA 5DWUH 4P2QE 4TF4A 1FWDC 1LL1A 3NAVA 3KYKH 1WKFA 4PJEB 4QEGA 3DX6B 3D18A 3REWA 2NQZA 2Z7ZA 3EOBB 4LCCA 4H9UA 1NL0L 4TL5A 4JCLA 3N6HA 4F8TA 3MUXA 4MJMA 4FNPA 2KZKA 3GZAA 3VCNA 5REQA 2ZYFA 1PL9A 5EIIG 3SB0A 3UDWC 2G96A 4OZFB 3LB0A 2YARA 2F9RA 2I85A 3DFQA 3JVFC 2WM1A 5JUVA 4BZ2L 2JELL 5A6JA 4WUKH 1J8HB 2PTTA 4OB5L 4LLQA 2J5LC 4EI5D 1GGCH 1KZQA 1EC7A 3NYDA 3NDOA 2WV8A 1KJ3H 3VC6A 3SHSA 2A3TA 2HMIC 1GZGA 4LEEA 1I2PA 2Z92B 1X5XA 2YDSA 3CV7A 1L9PA 2Z7UA 1EYEA 4BZYA 1ZGLP 4M8VA 4HYVA 4TPRH 3F03K 3NSXA 4H44C 4AD2A 4IEFA 3WL0A 2VFEA 4KI1A 4MD0A 1FZKA 5IHWA 4DZBB 1FFRA 4PUUA 2FQIA 1UW9A 3GNXA 4N8VB 2VD9A 5C09D 3RUGF 3LS9A 3S42A 3FQTA 1D5BA 4KU1A 2IQ9L 4M5SA 1HIMH 2CE6A 5F7DA 2CESA 1FA2A 1RUKL 4P5KB 4E3VA 2EICA 4MNKA 4WXZA 2DY3A 2BSCA 1S7QA 5I15H 3HMJG 4AK2A 4YN3A 3FC8A 1MG2C 3QZWG 3NSDA 4LAJH 1MQKH 1D5MB 4O02L 4LYPA 4P3CH 3EA1A 3WJSA 4TIMA 2G2NA 2JE8A 2WCAA 3K81A 4MBRA 1D7KA 3UPRB 3VZYA 3TMLA 3U4KA 3WDQA 2OR2A 5A6MA 2RDXA 1W31A 4IIQA 1SYSB 1FQ0A 3KH4A 3GIVB 3WLNA 5E1AA 2PE4A 1INDL 1PO9A 4N2NA 4NT6A 3HJ0A 4MVBD 1MW3A 4YTRA 5ISZA 1RZQA 5HGBB 1RLDA 1CU4L 4R4ND 4AZUA 3B5GA 4LCCC 4KO6A 3VIMA 3R7MA 1QSEA 1QSFD 5C0NC 1H49A 3V6BR 4LAQL 4YHZL 4YAQA 4AYID 4RXFA 4LUYA 1QVOB 3QCUL 3QJFB 1DN2A 4UZGA 3DUUA 3RGBA 4RCXA 1YSOA 3NDZA 5I82A 4P59H 1MNNA 5FF6A 4KOCA 4S3FA 4FL4B 2Z25A 4X2RA 5KSAB 3T9PA 4TVCA 4Z0JA 2VISA 4WCYL 5IQ9A 1TV7A 3UNDA 3REVB 1Y6MR 3EJSA 1F6FB 5AL8A 3DURA 2R2EA 2FMNA 2WJ7A 1YY9D 5IBUG 1CLXA 3FFCD 3PB0A 2OW7A 2GUUA 1A80A 3F3HA 1JCMP 3MV9B 1XYAA 1VJSA 3QVAA 2FVKA 4BJLA 2V5KA 5ES4B 4DAGH 1QLFB 2R0ZH 4GW1B 4LLMB 3LRMA 3TLRA 5F3BA 4INFA 2WM0A 1E9PB 4NQ1A 4GKNA 4XR8C 1F3RB 5LHDA 1PKLA 4XNXL 3NFSL 1YECH 2ENSA 4I2XA 3PWVA 1DFXA 1KDJA 3UC0H 2DBLH 3MV7D 5T9BG 2XV0A 4Z77B 4D9LH 1TQBC 3MROB 2P44B 1J11A 4R3UA 1V79A 2E46A 3F5WA