1XCWA

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xcwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xcwA01
4TTGA 4DO5A 4ZFMA 4MB4A 4MB3A 4W5UA 1G1YA 2ZICA 1R8LA 3SUWA 1WZAA 4AD1A 5GNXA 1Q4NX 3NDZA 1E5NA 2JEQA 4J3SA 4P8XA 2VR4A 2FE0A 1WAWA 1W1PA 1PIFA 1R85A 4N42A 2O9RA 4HA1A 1XH1A 1O6IA 1HKIA 2XVLA 5CGTA 2F7RA 2YLAA 4AYSA 2WPGA 1NARA 4J27A 1NOFA 1CENA 1B1YA 3HMCA 4DM1A 1GHRA 1J0IA 3FHAA 1WDSA 3IANA 3W28A 5DFAA 4V27A 2V38A 2YA1A 2GJPA 4W87A 1WZMA 3ARVA 4HMDA 1J0HA 1HNYA 4JIEA 3GNPA 1MQPA 5HPCA 5FL1A 1UD6A 5CQ1A 2BHZA 4GI8A 4UZSA 1FFQA 2BNJA 1CWYA 1EHAA 5C70A 1A3HA 1HJVA 3VNYA 2FH6A 1OB0A 1D7FA 2UY3A 3BC9A 4MTVA 1GQJA 3WY2A 4A4AA 3VIHA 1LJYA 5I24A 1NWSA 3HJEA 2D73A 3S6TA 3BGAA 1VENA 2PBGA 4W7UA 3BVXA 1V0LA 4MAZA 1LL6A 2DIEA 3VU2A 4GI9A 1E56A 3EMCA 3UETA 1CGUA 3K8MA 3ARYA 2EACA 5GQBA 3WF1A 3CBWA 1XRVA 4OKDA 3F5KA 3A21A 5ABFB 4F66A 2X2IA 4AYGA 3MSGA 2XHYA 5BROA 4DUVA 4HOZA 3LXBA 1UD3A 3S2CA 1HJQA 1OBAA 3VM5A 3F4VA 1MW3A 1UH4A 1BTCA 1G5AA 1L0PA 3BUDA 3MUZ1 1OT1A 2VQUA 4JAWA 1UOKA 4J3UA 4NRSA 2J7HA 4C7DA 2IXUA 5BYWA 5BXTA 1E4IA 3NSXA 3NDYA 5E9AA 2WVTA 4TXEA 1W9UA 4GQQA 2IXVA 1XH0A 4DO4A 4GO8A 3WQ5A 1UA7A 1W2PA 1UR1A 3D3AA 1HJUA 1Q6GA 3AIVA 2VNCA 5EMYA 2GUYA 5I5RA 3O6AA 2VR5A 3A4WA 4J3XA 1VBRA 3AROA 3KZSA 6A3HA 2X09A 1YQ2A 1JF6A 4ZXLA 1DWIM 2XVPA 3W38A 4TX8A 2WHKA 1TUXA 4PSPA 4DWSB 4FNRA 2YLLA 1UH2A 4OUEA 3ARUA 2RGMA 1E6NA 1OINA 3GXDA 1QVBA 5FCZA 3QHNA 1EDGA 3F5JA 2BV9A 4MNKA 4MNLA 2WLZA 2W4XA 3BCFA 2YL9A 3MU7A 3SCOA 1HN1A 1CXEA 2E4TA 3AHXA 3M46A 4CD4A 2BXYA 4JFWA 3WH8A 1K9DA 1JYXA 4AZBA 1HXKA 2W92A 1PPIA 4F9DA 3GTNA 3K1DA 5M5DA 5D4YA 4MJ4A 1R34A 1EH9A 3BCDA 3QGVA 3BAWA 3OGVA 1JZ7A 3K4AA 2CERA 3NCOA 1XC6A 2VRJA 3ARXA 4AC1X 1UWRA 1PBGA 2CKRA 3CC1A 2PI6A 4D6FA 1HWWA 1KQYA 2ZXQA 2WVSA 1H1NA 3UG3A 1JYNA 3S5ZA 3IJ8A 2FYVA 3E1F1 2FGLA 1WPCA 4OZOA 4OIFA 2DH2A 3NJ3A 1TQVA 3U57A 1Q6DA 1EDTA 1V0MA 3CUIA 4XX6A 2BS9A 1W91A 2VJXA 1US3A 4TVUA 3MUY1 2YFOA 3LRMA 4AEEA 4JFVA 1JZ2A 3T0AA 3CZGA 4L4PA 3KLLA 2ZOXA 4D1JA 3VGGA 5BRPA 5FD0A 2XWDA 1J01A 2O92A 3AQUA 3N13A 1H4PA 1ISYA 4PMQA 1H2JA 3W81A 1LG1A 1I1WA 2XGBA 3W29A 3N15A 3VDAA 3KL0A 2O9PA 3WNNA 3EJQA 3HU7A 1E72M 3U5YA 5A8NA 3OZOA 4PTXA 3PTMA 3WD2A 4FNPA 2CIPA 1JXKA 1E1EA 1HP4A 4IUGA 1UR0A 4C7GA 4GO9A 1Q6EA 2OYLA 3TTYA 2YBTA 1ZU8A 1MFUA 2XVNA 5DEZA 1V6VA 1E5JA 3VIKA 1QHOA 1HKMA 3MUAA 2WZEA 2Z1SA 4MJ2A 1V02A 4M56A 4W89A 4AZHA 4W5ZA 2D24A 4LGXA 4UOQA 4TX6A 3THDA 3TP4A 2YL6A 3GNRA 2PWEA 5CSUA 4JKLA 5CJ5A 1O7AA 1VEPA 1TQUA 5BXRA 2GK1B 1KB3A 1BGGA 5FOOA 5E70A 1HIZA 1FP9A 1UWTA 3AI0A 1V6YA 1E6QM 1C7TA 1H5VA 4LPCA 4U33A 1VF8A 2EADA 2X2JA 4U31A 2VCCA 2AOSA 1CGYA 1GUVA 3WUEA 3L4ZA 2C8NA 3WMSA 3CLWA 3WNOA 1SYTA 2Y8VA 3LRKA 4AZ5A 4CN6A 1UG6A 4E8DA 1N82A 1JG9A 4CKQA 3WMCA 1MXGA 2XYLA 2WB5A 3WSUA 1TVPA 1C92A 1DP0A 3SCNA 3ZM8A 1EGZA 2XFYA 2NT1A 1R46A 1KR1A 2GJRA 3EJUA 3SUSA 3EDDA 4C7FA 3CUHA 7TAAA 5A6AA 5IHRA 3AHZA 3DX2A 4PMDA 3BLKA 1JZ4A 1UYQA 1XH2A 5I23A 5IDIA 4WSJA 3AIRA 3U7BA 3MS8A 2WVVB 3FXYA 5JBFA 1HL8A 5GNZA 1JZ6A 3WDQA 1HKJA 1GONA 2E9LA 3SCQA 2C7FA 4UFLA 1E6RA 2FHFA 3CZLA 4R27A 2ZX5A 3VDHA 3EJTA 4NI3A 2ZWZA 2CNCA 2YOCA 1E15A 2ZUMA 4B15A 2Y5EA 4XZWA 5ABHA 4PMNA 3WH9A 1BYCA 3AISA 5CLTA 3NSMA 3ECQA 1RPKA 4P7NA 2BHYA 4GINA 1US2A 4PMXA 3ZR6A 3WUGA 1JF5A 3VKKA 5JUVA 1QI5A 1AVAA 4F9JA 1OIFA 3GXPA 3VIGA 2CITA 3BSGA 3BVWA 3VDBA 1UH3A 4PTMA 2DSZA 2VUYA 3WL1A 3RM9A 1QHPA 1CXIA 4LYQA 1QI0A 2D0FA 3ZJKA 2ZX6A 3WF2A 3OGRA 1UD5A 2PB1A 3W24A 2VVSA 4WJXA 2F7OA 4PSRA 3BVUA 3U5UA 3CHFA 2F61A 1MW2A 2HVMA 5I79A 4ACZA 3DHPA 2VQTA 1VEOA 3CH9A 4QFUA 1V3JA 2VC9A 1QNSA 2XTKA 1CEOA 3HZ3A 4U2ZA 1QW9A 5JBDA 1ZJBA 1QI3A 1BPLB 1TFVA 1XHGA 3GH5A 4UCFA 1G9HA 4UOJA 1BYDA 3ARRA 3W37A 4JHZA 4WKAA 4DO6A 2A3CA 1VRXA 3WNPA 4FLRA 4JFSA 3WFZA 3JUGA 1LLOA 1PX3A 1ZL1A 2J4GA 3CZNA 1WO2A 1GQIA 1ZS2A 1AMYA 3SUVA 1UKOA 3W26A 1BQCA 2J25A 1JFXA 1PX8A 1W32A 3SEPA 2GDVA 3N9KA 1PAMA 4EANA 1XSKA 3PZ9A 2W66A 1ZBKA 1A47A 3MSDA 3L4WA 2W91A 1GOKA 5CPTA 1O7DC 5D9MA 1CXHA 3DYPA 1LWJA 1LF1A 4IISA 1E40A 3GZAA 1B3XA 2YDSA 4R5EA 4PRWA 1SFSA 2GJXB 2G4FA 5D8ZA 3W53A 2CYGA 1UQZA 4FLQA 3NSNA 1B3YA 1TR1A 2VX6A 4EK7A 2O9TA 5BWFA 3N1AA 4HZ6A 2DSWA 3CO4A 1E55A 1LWHA 2D23A 2NW0A 4HOXA 5AY7A 1SMAA 3VDCA 1WNOA 3AMGA 3K46A 1M53A 1Y7VA 1DTUA 1KXTA 3WDIA 3B9DA 3WNMA 4AEFA 2PWDA 1TA3B 3U7VA 2IUZA 3MMDA 3VD5A 2WLYA 1QW8A 5A8PA 4NXSA 1T0OA 4CD7A 3AHTA 1OT2A 2OYKA 1UWSA 5A8MA 3IGUA 1UR4A 1SZNA 5JIPA 2FGZA 1VBUA 2YL5A 4J28A 1JFHA 3DX4A 1GJWA 1CLVA 2BVYA 4WK9A 1B3ZA 3VIMA 1PEZA 3ARZA 3W6LA 1GORA 4LXFA 1ISVA 5CPQA 3L2MA 4WLCA 3F5LA 4W88A 5AYIA 3WMBA 3ZSTA 2DPEA 3POHA 2BY0A 3T09A 3OZPA 4LYRA 3FNDA 1XCWA 3CUJA 1MFVA 1WP6A 4W85A 5A3HA 2JIEA 3A22A 3UG4A 4MDOA 3N18A 3AIBA 4S3JA 1JXJA 1EIBA 5BXSA 5CGMA 2O9OA 3VGBA 3CHEA 4RE2A 1C90A 2XSBA 5GPRA 4D72A 1W1YA 2VZSA 1QNPA 3PZMA 3DC0A 2CHOA 2EEXA 3AOFA 3KL5A 1UZ4A 1R47A 3II1A 1KR0A 3M7SA 5IXEA 1DWAM 4D6HA 4OBSA 3CPUA 4PUEA 1ZB5A 3AZTA 4AWEA 4M82A 2WMGA 2YA2A 3VD3A 7A3HA 1QI2A 4UQDA 2JF6A 5M17A 4AD3A 1IZKA 1E6XM 2QMJA 3VIFA 4HTYA 2PF0A 4B9YA 1ODUA 4FLSA 5ECUA 1C3FA 2JALA 4KRUA 4FNUA 1EQPA 3AICA 1BAGA 1V03A 4ATLA 3D5HA 2YFNA 3D50A 4P7LA 3NUKA 4D6IA 2WK2A 2AMGA 4U5IA 5A94A 3ZJ7A 2Y8KA 4GKLA 1EQCA 2CHNA 1E4LA 8CGTA 3SCUA 3ARPA 3DHUA 4J3VA 3WEOA 3VD7A 4ZEPA 2EPMX 1IZJA 1CNVA 1LG2A 4LX4A 3GBEA 1CDGA 1NM9A 1CYGA 4XV0A 1NWUA 1UD8A 2ZX9A 1W2VA 1JI1A 2WYSA 5CZKA 3O9NA 1JYWA 1BYAA 4PMUA 2NSXA 4YN5A 2JEPA 3LXCA 1ZBWA 2D3NA 4UFIA 3L4YA 5IHSA 4MADA 2ZXDA 2YBUA 4DUXA 4CVUA 4GIAA 2GFTA 3UR7A 3D51A 3CMJA 4RE3A 5HOSA 3WDHA 4GI6A 3VO0A 3VIIA 3LX9A 2XVGA 3PZVA 3HG4A 3AIQA 3BXWA 1B3WA 1CLXA 5AC4A 3VX1A 4PMYA 5TD4A 1ISWA 2XN1A 4M1RA 3BAKA 4OGZA 2E9BA 1OIMA 1E4NA 3A6OA 2BVTA 3WD0A 1PX4A 2CCRA 3WH5A 3PZGA 3RPMA 1ZBVA 1TMQA 3OA5A 5FL0A 3BAIA 3WENA 1FFRA 1PZ3A 3SCTA 4GZJA 2CBIA 4UQCA 2DT1A 4Y7EA 3GBDA 2QPSA 2CXGA 4BQ2A 1B0IA 1HVQA 2E3ZA 4W7VA 2Y2WA 3ZR5A 3AS3A 4BQ4A 1JNDA 1HTYA 1VIWA 1BF2A 3BLPX 4U5KA 5FIPA 4JKMA 3RJYA 4RL3A 1JIBA 4BQ3A 2BXZA 3GXMA 3PZNA 1FH7A 2WW5A 3ZJ6A 4W8AA 4Z2LA 1VFMA 2JF7A 3CZ8A 4D6EA 1EXPA 4CU7A 1FOBA 1R86A 4ML4A 4WSKA 4WKFA 1KXHA 1HX0A 3WUFA 3RILA 4P7RA 1E43A 1NWRA 2ZUSA 3TTSA 4H8VA 3IAPA 2VCAA 3K8LA 2CESA 1GPFA 1JZ5A 2XIIA 4TUFA 1HF6A 5F7UA 2VX7A 3MV01 2ZUTA 1QI4A 1GOOA 4H41A 1QX1A 2ZUWA 1J0ZA 2VX5A 3OG2A 4FNTA 2V3GA 1IT0A 1R7OA 2V3FA 4L4OA 5ABFA 2VOTA 3H54A 3WY1A 3MANA 1H09A 1E73M 1FP8A 4LYPA 3WN6A 2EABA 2TAAA 4QLLA 4HMCA 2ALWA 1FHLA 2CBVA 2WANA 1QOXA 2WBKA 3GXNA 2EQDA 5DT7A 5KEZA 3POCA 1R33A 2BVDA 2DSVA 5BXPA 1XSJA 1B2YA 1EDQA 4E4PA 3VD4A 4XUYA 2E8ZA 4KGJA 3FW6A 4AZCB 1UHVA 3WY4A 1QWNA 3ZIZA 4EAMA 3L4UA 1NP0A 2EPOA 5A1AA 2VZTA 9CGTA 4Q22A 2XPKA 1H3GA 1KCKA 4KH2A 3BAJA 2WC7A 5AC5A 5CXPA 3CZJA 5A8OA 2IGTA 5A6LA 3VD9A 4U3AA 2X05A 3MO4A 5D8WA 5JIWA 4J3WA 1W9VA 3EJSA 4UQEA 2DQXA 2WCAA 4BF7A 4AMWA 3WNKA 3A47A 4DWSA 1TE1A 2X8RA 3EMQA 4UOZA 1HXJA 3ARSA 1K9TA 1C8QA 1XCXA 4AD0A 2UY4A 3KL3A 2WSPA 4V2XA 1DWFM 4NX0A 1QNOA 3K4DA 4HPHA 5CLWA 3CZKA 1ESWA 1K9EA 3BUIA 1Z32X 1E1FA 3WBAA 2CBUA 3DDFA 3SUUA 1XSIA 1K6AA 3D4YA 2PWFA 3SCRA 3W0KA 4QDMA 1FH9A 3SIMA 4U2YA 1E6ZA 1EHNA 3BAXA 4X0NA 3PZOA 2GVYA 4AISA 3AYRA 3GYCA 1H49A 3VSTA 2OSWA 3LRLA 1GHSA 1W9DM 1GOWA 1VJZA 1ECEA 1HJXA 2J78A 2XSAA 3MMWA 2XWEA 1H41A 3PZUA 3AYSA 1WDRA 3UR8A 3LXAA 2WBGA 5E6ZA 5ABGA 1W9XA 2FH8A 4CD8A 3KLKA 2VZVA 3RMEA 2OLHA 1EO5A 3SURA 1UASA 1CZ1A 2WHLA 2W67A 3W6MA 2DT2A 5A2AA 3IK2A 2WKLA 1MVYA 2J7FA 4XZBA 3MUIA 3WQ8A 1F4HA 1NOUA 1QPKA 1J18A 1X6NA 1K9FA 4QLKA 3WUBA 2GDUA 4CN4A 2OW7A 3AIEA 4OOUA 5E0FA 4KMQA 1RH9A 3WF3A 4CU8A 5A6KA 3VILA 1E3XA 1D3CA 2OSXA 1GVIA 2YIHA 4P8WA 1C8YA 3BMVA 1QBBA 5I6SA 3AHYA 3W82A 6TAAA 3SCWA 3N12A 3WF0A 3VVGA 4JKKA 1NWTA 1UD4A 2BY1A 4B9ZA 4D6GA 1NOWA 4D1IA 3A23A 3T2OA 3O2LA 4W8LA 3CHDA 2D20A 2XJ7A 1E6SM 2VRQA 2WCGA 4CCEA 2J7EA 1KWKA 3A3HA 3CMGA 1CGTA 2WAGA 3W27A 4Z2GA 2E40A 3LMYA 1X1NA 1I75A 4HMEA 1RP9A 1R7AA 2J74A 3ARQA 3VGFA 1H0IA 1TQTA 3S5YA 1JYVA 3CGTA 1DWJM 1XV8A 2JFEX 1V08A 4GPNA 3RM8A 3WBEA 3AS1A 4FNQA 3T0DA 2F2HA 1CGVA 1JD9A 1CXKA 3IJ7A 1NH6A 3GDBA 2EJ1A 2WZIA 1UA3A 2B31A 4D6JA 1B31A 3MV11 4BQ5A 2WMIB 2GK1A 1VAHA 5I0DA 5I78A 1UWIA 1BGAA 4W93A 1RP8A 1W9PA 5BRQA 4AXNA 1M04A 4H8UA 3AIUA 3AMDA 1KXVA 1CXFA 2D3LA 3D4ZA 3T0BA 4URIA 1Q6FA 3I3BA 1PZ2A 1GW1A 2WMFA 3GXFA 1UD2A 4UFHA 2D22A 3SCPA 1VEMA 1DEDA 3AS0A 2QLYA 1W3JA 2XFRA 2J77A 5E0CA 2YDRA 3L2LA 4AIUA 3EYPA 2W61A 4WF7A 4CD5A 1OWQA 3EJPA 3RIKA 1GCYA 1GVYA 3DX3A 1DWHM 2WHMA 1KGXA 2WVVA 4M80A 4AZ7A 2J62A 2XM1A 3KWXA 2DSUA 3EJRA 3VGDA 2XGIA 1SR0A 3EDFA 3ALFA 3ARTA 1JI2A 3VPLA 3SCSA 4E2OA 3T08A 1B9ZA 4CCCA 1QWUA 4CN1A 1G0CA 3AXIA 4AW7A 1E9LA 3QHOA 3WNLA 1OGSA 4ZENA 3W25A 4ZE5A 3WQWA 3I3DA 4PTWA 5HBFA 1W3LA 3L4TA 1EOMA 3APGA 4AZGA 3CUFA 4EE9A 2C0HA 1WZKA 3RO8A 4DWSD 3GH7A 4M8UA 2CETA 5HXMA 1BG4A 4BA0A 3AXXA 2G3JA 4AIEA 2UWFA 3DDGA 3ZT7A 2VVNA 3ZJ8A 3FAXA 4H04A 2WMIA 1HJWA 1UUQA 3BAYA 2X0HA 1ISXA 4PBGA 3OIHA 2VURA 4JCMA 2J8GA 4W86A 1BVNP 2OWCA 4EKJA 3HG3A 3NYDA 4B3LA 1UKQA 4HZ7A 4A3YA 1V6WA 1J11A 1JDCA 1P6WA 3VX0A 2XM2A 3OLEA 2VCBA 1QBAA 3VIPA 5A2CA 4GZIA 2YDQA 4JHOA 3BVTA 3WD3A 4H2CA 1GOIA 5HDRA 2G3IA 3ZSSA 1QHZA 1BFNA 2W62A 1WDPA 3DECA 1TG7A 3CV5A 3OLDA 4P8VA 4GQRA 4PUDA 4CCDA 5C8BB 3ZMRA 2EXOA 4LQ1A 1XD0A 5LA1A 4AMXA 4AD5A 5C71A 2ZX8A 1MXDA 3BLBA 3AZSA 3GXIA 2GJXA 3WL0A 4HP5A 2VI0A 5A6JA 1E4MM 4K68A 3QOMA 1OD0A 1EO7A 3WFLA 2QV4A 4PCTA 3WF4A 3RCNA 3AHVA 2Y4SA 3L4XA 1PS3A 5M3WA 3LPOA 1VFUA 4AIOA 4MAVA 2JIWA 2ZIDA 2X1IA 3H55A 1AQMA 4UQAA 2OWWA 2DIJA 3BUBA 1TA3A 1HVXA 4ATDA 1W3KA 2CEQA 3BSHA 3TOPA 2YJQA 4WKHA 1NP2A 2WMHA 2E9MA 2A3EA 1RD6A 4PN2A 4MB5A 3KEHA 2UY5A 4Z2HA 4HOWA 4BS0A 5EB8A 3EBVA 3VOCA 2VO5A 4H8HA 1LQ0A 4NRRA 1KCLA 4PMZA 2WZHA 4QCEA 3FAWA 4IPLA 1HKKA 4M29A 4OOZA 5FKYA 1U30A 4P7QA 3CZSA 4HA4A 1KFWA 2ESCA 4BZYA 5A6BD 1JL8A 2D0GA 4YPJA 3QOKA 4PMVA 2WMKA 3I3EA 5EFFA 3ZQ9A 1W9BM 3OGSA 2WWDA 2Y24A 4S3KA 1BYBA 5A95A 3VGEA 1V6UA 3CZEA 5GNYA 1WCGA 4AZ6A 4X0VA 1KTBA 4AD2A 4UTFA 3AXHA 2NT0A 1ITCA 4PCSA 2V5DA 6CGTA 2EBNA 3WDRA 1CXLA 4XB3A 3EDJA 2PBOA 1JD7A 1F4AA 3CIVA 1CTNA 2BY3A 3BUQA 1UZ1A 1EOKA 2QPUA 2PWGA 3DX0A 5E09A 2VMFA 3MMUA 3THCA 1OD8A 3CUGA 1VJSA 1B90A 4QAWA 1FH8A 5EFDA 3VIJA 1GQKA 1E0XA 2XG9A 5DF0A 1AQ0A 1UR9A 3B8SA 1PIGA 3OLIA 1JAKA 4CUCA 1GJUA 5IFTA 1JGIA 3WELA 4J3TA 1M03A 1BSIA 4NF7A 1HJSA 1E0VA 3VMNA 1MW1A 1V3IA 4UQBA 1WDQA 3G6LA 1Q6CA 1V0KA 4KGLA 2D0HA 2AAAA 2G3NA 2X2YA 4H7VA 1AQHA 5M03A 4OBRA 2QHAA 3VSVA 4ZE4A 2A3HA 4M24A 1ZBCA 3PN8A 4JL1A 5JBEA 4J7RA 3WQ4A 2EPKX 1CGXA 3EMZA 4ATWA 1JAEA 2HISA 4YHEA 3GXTA 1D2KA 3HG2A 2ZXAA 5I77A 3WH7A 3D52A 4N0RA 3L4VA 1M01A 2OSYA 1C91A 4UFKA 3WDJA 2J8FA 4FK9A 3EDEA 3VM7A 2Z1KA 4PEEA 2DGAA 2WNWA 1XYFA 1JDAA 1UKSA 1TQWA 4KRTA 1HL9A 2J75A 2OYMA 3PHAA 4JFTA 1W1VA 2XN0A 1G94A 2VTFA 1KXQA 4PYSA 1TVNA 4ACYA 5BCAA 2FHBA 4UFMA 1QNRA 5D9NA 1X6LA 4X9YA 5CSYA 2BHUA 2WMJA 2WWCA 1V3MA 2CPUA 3UG5A 3OBAA 2A3AA 3VUPA 2UY2A 2VT0A 3BVVA 2VRKA 2CBJA 3BUPA 4GZEA 2V5CA 4W7WA 4AD4A 4D71A 3HN3A 3DX1A 4JL2A 3VSUA 3ZT5A 3A24A 1UR8A 4M81A 2YL8A 4TVCA 3AFBA 3QR3A 1TZ7A 2ZE0A 2MANA 2F8QA 1QNQA 4CGTA 3WY3A 4W84A 2XIBA 4AZIA 1E6PA 3LPPA 4MPKA 1XD1A 3UERA 2ZUNA 1I1XA 2ZX7A 2DH3A 3A4XA 3WDPP 3UESA 4OJYA 2DSKA 1IV8A 1GQLA 3WEZA 4HU8A 3UCQA 3N17A 1C93A 4B3KA 3KE0A 3MKKA 5HNNA 3DYOA 1BHGA 3NIYA 1CPUA 2ZWYA 4KWUA 3PTKA 2PC8A 1VFFA 2VZOA 7CGTA 5AYBA 5HPOA 3DYMA 3TTOA 3ZT6A 3TONA 3QHMA 4HU0A 3VMPA 1J0KA 1GOQA 1JNEA 1ODZA 1JZ3A 1GZJA 3AJ7A 2DDXA 2J7DA 1ZJAA 2VX4A 1CGWA 1C8XA 1ISZA 2W63A 2YA0A 4TTUA 1WE5A 4QCFA 1LL4A 5DO8A 4A3HA 3WIJA 8A3HA 2F1AA 1J0JA 3TA9A 1VB9A 2WC3A 4AMCA 1UKPA 1V02E 4AY1A 2DT3A 1KGWA 4F79A 3ARWA 2OWXA 1E70M 2ZUVA 3FHQA 3OB8A 4E8CA 1L8NA 3VMOA 3PBGA 4ACZB 4BCEA 5E1QA 4MDPA 4YHGA 1DHKA 1UKTA 4UZUA 2ZUUA 5A8QA 4DWSC 5IFPA 2DEPA 3HG5A 3PTQA 1G01A 5D9OA 2WKGA 1U2YA 2CKSA 1JZ8A 1H11A 4AZCA 1U33A 1V0NA 5A69A 4UNIA 2XN2A 1KBKA 1KGUA 3TV8A 3T2PA 2E8YA 5D9PA 5DMYA 3WQ6A 1WZLA 1WB0A 4NSBA 1XGZA 3CTTA 4DM2A 2QMKA 2J79A 1V3KA 2VL4A 3W4RA 1MW0A 4IPNB 1MQRA 1PJ9A 1OGGA 3RM4A 5ABEA 4B16A 4MB1A 4FF5A 2F7QA 3WD4A 4CD6A 2J7GA 1TCMA 1ITXA 3SUTA 2G8ZA 5LYRA 1E0WA 4QLJA 1CBGA 3AS2A 5CG0A 1S46A 3AMKA 2VZUA 2BFGA 2J7BA 4TOQA 3WEMA 4RE4A 3B9AA 5KZ6A 2F18A 3PZQA 3AMLA 4F8XA 4HPGA 5A6BA 4W8BA 4ZXOA 2FDMA 2YKKA 3ZOAA 1YHTA 3PZTA 1FA2A 3VIOA 5EBAA 4UQ9A 2G41A 3VGHA 1MWOA 4CVWA 4P8UA 3GH4A 1UWQA 2D1ZA 4UFJA 4NZJA 1BLIA 2WHJA 1SMDA 3VNZA 3FN9A 1C7SA 3GNOA 1OGBA 3IJ9A 4FLOA 1CECA 4Z2JA 3VINA 3AZRA 5I2UA 4JZ5A 2J47A 2QF8A 3WKZA 3A4AA 2X0YA 3WH6A 5A6SA 1UQYA 1DWGM 1MYRA 5E6YA 2J7CA 4FMVA 4NZCA 3N04A 1J0YA 4PMRA 3G6MA 3FY1A 4PTVA 2WCSA 1B30A 1BG9A 2BY2A 1W3HA 4MNJA 3GM8A 1CIUA 1W1TA 2DT0A 3A5VA 2F7PA 1GOMA 2EPNA 2WM0A 1M7XA 3OLGA 1TQSA 3UEQA 4D6CA 1NQ6A 4Q7NA 3PZIA 1MQQA 1KWGA 2EO7A 3TTQA 3AMCA 1UR2A 4GXPA 4Z2IA 2WVUA 2F1BA 4DUWA 3AIWA 2JE8A 1OM0A 2WXDM 1R75A 5A2BA 3LPGA 2D2OA 2XVKA 3M07A 3VTRA 3T2QA 5A6MA 1BVZA 1J12A 1E71M 4HZ8A 1OCQA 5LA2A 1HT6A 4MNMA 1OSEA 4HA3A 1KTCA 3RDKA 4CU6A 1GNXA 2XUCA 1J10A 1FHDA 4UR9A 1V3HA 3N11A 2G3MA 1XYZA 4JCLA 3EDKA 3B9EA 3BH4A 4NXKA 1V6XA 1KBBA 4IM4A 2XFFA 4WIWA 4Z2KA 4QP0A 2FHCA 4PMOA 1B3VA 3WD1A 1HP5A 1WKYA 2V3DA 4FNSA 2ZXBA 2W5FA 2PWHA 3K8KA 2EPLX 2OW6A 2V3EA 4V28A 2EAEA 3LPFA 1V3LA 3ALGA 1KQZA 2E0PA 1R87A 4D6DA 1VFOA 2WC4A 1J9YA 2X2HA 3RJXA 1JDDA 5DT5A 3WQVA 3H53A 1E3ZA 1LL7A 3J7HA 5LA0A 3CHCA 2GSJA 3BMWA 1UWUA 4NZFA 2Q8XA 3SCVA 3MI6A 2WSKA 4P7OA 3ZO9A 2RGLA 3M6DA 4U3CA 3IAQA 2A3BA 4JFUA 1EA9C 1H0GA 5I3DA 5CPSA 4TVDA
chains in the Genus database with same CATH superfamily
2CU0A 1OD9A 5ID1A 3RFAA 3FS9A 3R2GA 3QWOA 4DTGH 4Z0XA 3LV3A 4GI4A 5KYXA 1KM4A 3NDZA 3LHUA 1S7QA 1HWGB 3BJLA 4QITA 2CMRH 1KM6A 4M51A 1SGJA 3PUUA 2XVLA 2O7SA 1NARA 2E27H 3RWJB 4AH2B 1P4LB 5FGRA 2H1LM 2EO9A 5AFAA 4BFBD 4LAQL 4WUKL 4KZ0A 4ELME 3P73A 2BHZA 1SY6A 2BP8A 4R7NA 1LVEA 2YPLD 3FPXA 1D7KA 5E51A 4N3TA 1OB0A 3HURA 2BOGX 5INCA 5DSCB 1ZLWK 2DLEA 5D2LA 1NWSA 2ZYRA 2DIEA 3VU2A 4FA7B 5F1VA 3MXVH 3STZA 4H6RA 4CNTA 2FLRT 1KLFA 3TCSA 2WXHA 2HWGA 3HI1B 1QR1B 3MSGA 3W7NA 1LE9B 4RA0C 1DUYA 1UD3A 1XAUA 3VXPA 5CF3A 3R58A 3B2UD 3NRQA 1QABA 3W75A 1Y18B 2NMSA 2KZHA 1FZOA 1INQA 4UQ2A 4FE9A 1KDJA 3GTXA 4TXEA 1TZHB 3ARED 4GQQA 5AD0B 4DQWA 3C8NA 3ZTCC 4ONGL 3WBYA 4AVFA 3A4WA 1U2HA 2N0MA 2Y6SC 4WU5A 4KKLD 3A0OA 4UTCA 3CL7A 3LKOA 4CJ1A 3W38A 1D5IH 5J8OA 3GMLB 3C6CA 5B80A 3GI9L 3W9EB 4HIXH 3MLZL 4MNLA 3MX0A 3VGAC 1ZLUH 3TAOA 1TITA 4OSUL 3WJSA 3DKJA 1AP2B 1FDLL 4Y7MA 2GYSA 2Z35B 4ZYKA 4LAMA 2HG0A 3MRKA 1F5WA 1Z0MA 3QGVA 1T1WB 4KZEL 4AEOA 4YDLC 4OF7A 1UWRA 1HQTA 4ZQOA 5MKGB 2ZCGA 2WXMA 2V5KA 1BECA 1TQVA 1F8IA 3VFCA 1W91A 1SDDB 3GSRA 5B3JE 2EDNA 1WUEA 3MUY1 4TTDD 3L5MA 3JWDL 4GUGA 1OSPH 2ZCLH 4L8CA 2V5YA 4PMQA 3OKEA 1I1WA 4LASH 4MQXC 3NFSH 4PRTA 4MSWA 3HU7A 4A04A 2NY4D 4G1EA 2OXGB 3C2SA 1E4HA 5D1ZB 2VWEC 3SPCA 4F9LC 2DICA 4YYCA 3CV2A 5AVUB 2Z1SA 3VD2A 4Y6GA 2YRZA 3NEOA 4OLZL 2GUBA 5L2KD 4OZFG 1VEPA 2YAQA 1YJDC 1JUEA 3U0HA 3KRSA 5F9JA 1VF8A 4R2GB 2FSEA 2GOUA 1FDYA 2Z7UA 1X1OA 1JPGA 5C09D 3ZVHB 4D7BA 1NAML 4ZA0A 1V27A 4DJDC 3MRMB 1B4LA 3THMH 1C92A 1POJA 1KB5A 3EDDA 2AABH 2CK2A 5AOLA 7TAAA 4A68A 1I9JH 4QF1B 3QW9A 3AHZA 3NRFA 4YE0A 3V5OA 3S83A 4RX4D 2X89A 5E6IC 1JPST 5EUKA 4NJ9H 5EPDA 1JZ6A 5GNZA 3U9UB 1GONA 1HH9B 1PY0A 3KUMA 3OG4B 5GZOD 2ZX5A 1IM3B 4YHIB 3LN3A 4Z7QB 3FEMA 3R0MA 1QI5A 3CDZB 3CLFL 1FNHA 3TYEA 1E9YB 3DBSA 2AMXA 1UJTA 4PLJD 3Q0HA 4ETYA 1UVQB 4RAVB 5TE6L 1QI0A 1R0MA 3ML8A 3MFFB 1T2QL 3BVUA 4UNUA 2VITB 2HVMA 5I79A 4FSAA 5L7XL 3CH9A 2VC9A 3W83A 1U5VA 1CEOA 4LHUA 4EXQA 1I2PA 3LYEA 5EO1B 3QC3A 2FECL 3TBYB 4OD3L 3O0KA 2X6AA 1YNYA 5D1XA 1LLOA 3E7JA 5AVRB 5E99L 1OAUH 4X60A 3PTDA 4ZR8A 3L3KB 4IRZL 3NH7L 4MCNA 3QUZC 4PJDF 3BLIA 4ONFL 5C2GA 4TMPA 1MCPL 4BYHA 4X7SL 1GOKA 5CPTA 1EGJH 4ELMB 4M4PA 4N9GA 4GRLC 3W53A 3BN9D 2CLMA 1WA2X 3H8AA 1GAFL 1JUFA 2WSQA 3K4WA 2E5DA 4M48H 1J8HE 3RCYA 2P47B 3OXRB 1DTUA 2AQPA 3R06A 1MAJA 2PWDA 1FIGL 3BANA 3W2UA 3VD5A 1OF8A 1ZTMA 3ZZSA 4A63A 2YRPA 1T5WA 1UFUA 5E8PA 3VU1A 3BG3A 1DEEA 4NHUB 3M5ZA 4UTLA 4WK9A 3GIQA 3UTSE 3FFDA 3ZR4A 3LIZA 5AHLA 1GGBL 3UJIH 1ZAGA 2Q8AH 2R91A 3ITVA 2C9RA 5DMLA 1XCWA 1P7BA 3H2CA 5FAGA 4AU0A 3UAEA 4IOFC 2QQQA 4MVBC 4WO4D 3W0WE 5DRWA 3EO0B 4NVTA 1QFUH 4D72A 4ZK8A 3W9DA 1I1AD 4DF2A 1A6TB 3HNVH 4KEZA 4UINH 6ALDA 1KR0A 3RPTA 1NMCC 3PQYD 5FEPA 1A4LA 4E3VA 3B2DC 5ICXA 4OJFL 1FGVL 3KS0J 4AWEA 1Y1DA 3GYEA 1WUFA 4BEIA 4BFEA 3FOKA 4MA8H 4KRUA 5H94A 3SQLA 2R9HD 1F7BA 5K4ZA 3CAFA 3VQ1C 1IZJA 4YGAB 4LX4A 2ZKYA 1D7BA 3DX5A 1NM9A 5F6IB 1W2VA 1N7MH 3G3DA 1J87A 3CHVA 4PJ9D 2GK0A 2EVGA 2DL2A 4X9HA 3SGKA 1XF3B 1ZBWA 4WJG3 4UM9B 2QDVA 3K2UH 2IEPA 4Z23A 1TCRA 3DROA 3OGCB 2QHLA 3R8RA 1AW1A 2D7OA 3FU7B 3VX1A 3TO4C 4QRTB 1CFNA 3HR5A 4RMTA 3WD0A 4MRBA 2H6PA 3EYFB 1YMMA 1KLGB 2QCHA 4KIRA 1JNNH 2W0FA 1FJ1A 2CDGA 2FDBP 1H1YA 3QW3A 2VWTA 4Y9GA 3L17A 5BQ7B 1PDYA 2JV6A 4OD2B 1SLUA 2R39A 3QC5X 2ESVD 4DAFA 1GVSA 3MODH 4RL3A 3WK1A 1GR7A 1Y1UA 3GXMA 4XNQB 3L7EA 3FJ4A 3S2MA 4J3OC 3HIZA 5GGUA 3WUFA 2KS0A 3NCYS 4G56A 4KY1L 4HWZA 3O3DB 1S2EA 3WI9A 1VC4A 2K3TA 1K8YA 4BH8A 5E8NA 3CVIL 1JNHB 1L9RA 5ABFA 1W6TA 4LF1A 4TS6A 2BMBA 2FBOJ 4K5OA 2CRYA 4M61B 1FHLA 4O02H 3QVQA 3C0SA 4E2DA 5I8KH 3OPUA 2I5IA 2FUTA 3G6AA 5FF6A 1GOHA 3M17A 4H00A 3QXAA 3BV4A 1IBHA 3NQDA 3WIIH 4B2DD 3SYAA 4YDKH 2A6JA 2OEKA 5JIWA 2P24B 3C09C 4PUKA 1SVBA 4N4PA 3C2AL 3HEIB 4QRUB 5L8KB 5EC2B 3CO8A 4MUZA 4A67A 1IM9D 2R4RL 1Q4WA 4PH6A 3FKUS 3FTSA 4WEBH 4QUOA 2EH8L 1GHSA 1VHCA 3L7FB 2PMQA 3SDCB 4G6MH 3SSGA 5HYIA 5LGHL 5FA3B 4PWFA 3RWHB 1SM3H 4HIIB 1UATA 1R3TA 2NNFA 4EACA 2JJSA 4I9XA 2OXHA 3RNQA 1X5MA 5CZXD 3PDOA 4MMXB 4KI5F 1EEQA 1KFGA 4GRMA 4JE0A 4BWLA 4XVUC 2DVTA 4GIEA 3QWRD 4Z7VE 4NNYB 4Z3TA 6TAAA 3T4YA 3WTTA 1J8HB 5E9XA 4I8YA 4HJIA 4ZUTA 2OSLA 4YR6A 1U3HD 4OLUH 3ABKB 1R0AH 5CKSA 1S1RA 3UJJH 3FQRA 3UAJC 1EWDA 2JB5H 3D0AA 3UTSB 3CWHA 2EDJA 2Z31B 1AQFA 1KY7A 3IWVA 3FCGA 3MNZA 3D2UA 4TV5A 4ENZA 4RIRB 3DIDA 3QAZC 1B57A 3GHBL 3G8EA 5DVLA 1IJNA 3W0WB 4RAUA 4UTAA 3AMDA 2G9HB 4ZUWB 2EDQA 1Q6FA 1XR8B 4YQXH 1A1NA 3VXQA 3N2JA 3WX7A 4JAMB 3IDYC 1P0SE 4K37A 4PHZA 1XXFC 4RA3A 1NA8A 1FWTA 3EJPA 1AZVA 3BTNA 1J5OL 4H9ZA 1KGXA 3CFQA 4ZAKA 4Z08A 3OL2A 5AKRA 5IG7A 3MRQB 4OLYL 3B3IB 4S3CA 1S8DB 4X42A 2JIXD 2YSWA 3W7CA 4QX4A 3DRTB 3W25A 2B0SL 3VFSA 2WTRA 3ARDA 3QPEA 5LXEA 3RO8A 2OMYB 1EX1A 1J5SA 5HXMA 3MWAA 4OZFH 2AGKA 3QQ0A 3V0JA 4KUZH 4JRXA 4APQA 3C2FA 2GCYB 4M93B 2CBTA 4FOJA 1HYSC 2EDRA 4F92B 3RPBA 3SE4A 3VXRE 3IDIB 3U1SH 4W86A 4GG8A 4P57B 3HG3A 4NI8A 4Y1AD 1Q2SA 5IQ9A 1QBAA 1JMXA 3VIPA 3D12B 4BCZA 2VLJA 5L6YH 2YR3A 4X6BB 1N5YH 1ES0B 5GGQL 4MD4A 4ZO6A 2KLTA 4K9EC 4YSEA 4GQRA 1EMTH 5L8JB 4PR4A 2EE0A 1QSFD 2CUMA 3PWUB 1IAMA 4X2PA 1UM4H 3S37L 5IKCB 5I8EB 1L5GB 2VLRA 3D3VD 4XCEA 5GZNA 3NPWA 3SDAC 1TA3A 5FKPB 1U91A 3BYTA 3GRWH 1LOLA 2Q87A 2RALA 2Y70A 3RXZA 1XGPB 4UUIA 5KSAA 5BO1L 4PMZA 1HKLH 3IJHB 4Y9FA 2FZBA 2ESCA 1J1XL 4ELKB 4HWBA 4A2EA 1JGEA 2FO8A 4YPJA 5FX3A 3DDMA 3NFPB 4UB0H 5GNYA 4AZ6A 3VC5A 2G30A 3T6QC 1KTBA 3E49A 4PBWD 3BIKB 3DFOA 2WIIB 3LKRB 4XP5L 2C9XA 3B9KD 4NWUH 1IGTB 5I18L 4JTRA 3QDAA 2X4UA 1EOKA 3UPBA 2QPUA 2PWGA 2ZBTA 4PLKD 2JKEA 3FZUC 4ZUSA 1W37A 1B90A 4Z7AA 1JBJA 2H9AB 4FXTA 4UTTC 1GJUA 3SGZA 5LNUA 2A1WH 4PGCB 3GFUA 3SJVD 2XRAL 4KZDL 3TO2B 3FCPA 2XZQL 3UJFA 4APXA 3QF0A 1Q6CA 3GMOA 2IDSA 4H1LG 4L4VA 3GK0A 4PTDA 4BDVB 3V5CA 4FF9A 3VSVA 3ZPDA 1MHPH 3V7AG 5F89A 2DB8A 3WHXA 2Z6JA 1FUYA 3S1XA 1BA9A 3HG2A 3DRQB 3WE6B 3QG7H 1OE2A 4ICWA 2KZWA 2DGAA 1E2VA 2WNWA 1IGFL 4YAQA 1T7LA 3PHAA 2KC0A 1UWEH 4HUNB 3MTWA 1HFUA 1Q9LA 1A6PA 4JQ4A 1KBJA 2WZPD 1F11A 5EZOH 3HC3L 2QADC 1GZPA 3LS5L 4Z7VB 2WJDA 4X4YA 5FCUL 4CEXC 4PI0A 4OECA 3JQOB 1XF1A 2NWRA 3E2HB 5IMKB 5E4OA 2DUAA 3UERA 1U42A 1JZIA 3NEVA 4Y2LA 3TEXA 1IEIA 5HGAB 1IV8A 1OVZA 1C93A 5FW6A 5BS0E 4K9EL 2DTMH 3FFOA 4Y9MA 5EPMA 1DVFC 4I7UA 3HG1A 3QA3B 1UW9A 3QUMH 3FRPG 3MLXH 1PKQA 3OGOE 3T9PA 5I1HH 3H7BB 3FB8B 2DD8L 2N3JA 3V52H 3TCLA 1DUZB 4TTUA 5D7JA 4J8RA 4IX2A 5J5EA 3HE6B 1J6PA 3F5WB 3LBOA 2BSCA 3PWLB 3QIUB 3DTUB 1TO5A 2E7LC 1A4KA 5HYSG 2C16A 3UZQA 5C7HA 3CFJA 4QDPA 2YWZA 3EXTA 1RMFH 1JWSA 2IBGA 4UNIA 4P4RB 3IE9A 3SOBL 2A21A 3SO5A 2F74A 5LAXB 4YSCA 4H25B 1Q3NA 1A9VA 5ABEA 4TL5A 1ZSHA 3KPQA 1IC5H 4PIRF 5C08A 2AFNA 3S9ZA 5F7EL 2K0RA 2CG9X 5LYRA 2CU9A 4ISVB 1I8LC 1EF3A 3AS2A 5CG0A 1DQDH 3QEHB 1RLCL 3EG9A 6XIMA 3UABA 4AFYA 2X0SA 1GMIA 2FJGB 3HS0B 3GKWH 2CMRL 2FDMA 1X4YA 1K8ZA 3BJ91 5KVMC 2E27L 2WZ5A 2D1ZA 5AFDA 3VNZA 4NDMA 3GYRA 3IAGC 3GNOA 5T3ZH 5C0IB 3K1GA 2LU5A 1T0NA 3MREB 2TRYA 3A4AA 2X0YA 2X2UA 4HTBA 4OW6A 1Q66A 1ID2A 5HHOE 2V82A 2WWOA 4IJBA 1B30A 2DQWA 3BJTA 4FKHA 1C9WA 3A5VA 1CLZH 1MQQA 3MO1A 3MXVL 4IT1A 3BGFB 4XBEL 1PS9A 5CC3A 3N3TA 3QUXA 2VKZG 1YNLH 2BRRL 4P9MH 5I30L 3CFNA 4JRYD 3QULA 2GVGA 3EH5B 3NPVA 3AXMA 3SADA 4QEEA 3SI9A 1AJZA 3D06A 4Y19E 4LVHB 1ZPUA 3QQXA 4A8LA 4Z2KA 4I9AA 4M3JA 4IGBB 5E1HB 3TYUA 4JM4L 4IGHA 3ZKND 1O68A 1YYLH 5C0BE 4PB9L 3LPFA 5T5FL 1F3DJ 1AKPA 3JTSA 2AEOA 5JIQA 1D5IL 1JDDA 3DG7A 1J93A 3CHCA 3MUJA 5B1CA 2WZTA 2VMDA 1LXMA 1TJHL 2AXFA 1NJ9B 1IL1A 4JFUA 4LT7A 3GFXA 4TMCA 1U8HA 4MZIA 4NFBA 2H1PL 5HI3C 1DSYA 5J12C 2EDKA 1FGNL 4Y16B 2VXTL 3DSNA 5C6MA 5ICYA 1R8LA 5IJCC 2V30A 1E5NA 3T81A 3ZFHA 4KX8A 1WAWA 1R9FA 3H26A 1UADC 4I3RH 2EUXA 3NQEA 3BT0A 1BQUA 3CVBA 3DX6B 5AN7A 2VDMB 3IETA 1QO3A 4DCQB 4DM1A 4BZ1A 2ZRWA 2LFGA 4OT1L 2QHRH 2Z92B 1KM0A 1XIIA 1A5BA 5FB8B 4JZOA 5DMGC 2ZCLL 2ERJB 3LN4A 1T66D 3Q1SH 5CEZE 2KYIA 2J5LB 1Q8JA 3QZ6A 5KJ4A 3FPYA 4FXGB 3TBSA 5GJMA 3NFSL 4IRSD 4ORGA 3QI9B 1OAYH 2VXSH 3BVXA 4IBTA 3TWCL 1GJIA 2AGJH 3SPHA 1T4KA 1KELL 2H3KA 5IB5A 4JFPB 4K38A 5BROA 5HGBB 1E0OB 4NN5C 1U8OA 2GJZA 1OBAA 3VG9C 3WEXA 4JQIH 4R85A 1OT1A 4PU2A 2QJIA 1F4YL 5J9PA 3RX5A 5TBOA 1F1DA 3ASOB 1LO3H 4A55A 2YLHA 5E9AA 2WVTA 2O55A 2XA8L 4HVXA 5DI8A 2B81A 5EULV 5BS0B 4BSVA 3VI3A 1IGIH 4D9LL 3KZSA 4FR6A 4RGNC 2AXHA 3THML 3H9SD 2APBA 5HAOA 2AABL 1I9JL 4O2EB 4MWFB 2EDDA 3HOGA 4K23H 4UTKA 1R3JA 5J3HD 2WKOA 1NFDA 4U3XA 5C7ZA 2FWSA 4K5NA 3BCFA 1R3IL 2OKTA 3SGDH 5FO9B 3ZDZF 2V63A 3ME3A 4MJ4A 1RY7B 4LPUA 1SXNA 4HK6A 4WHDA 3MA7B 1ETJA 4MZYA 4XIAA 5EUOE 2Y3AA 1BQSA 3V4VA 3JBG7 5IW6A 1P0EA 3W02A 2L04A 4MMYA 1G69A 4TVUA 3SKUD 1LEGB 3CZGA 3GO1H 2ZOXA 3I84A 5BRPA 5FD0A 1BXVA 3DVNB 4PR5B 1XICA 4DO7A 5PCYA 4US5A 3ME0B 2CO6A 1CX9A 5TF0A 3W81A 3DUSB 1P84J 4G7FA 3MLUH 2FR4A 4O54A 4ZZFA 1IJ9A 5DJAB 4DBEA 5JHLL 4LMQI 4Z5RA 3EB2A 1XF5A 3QV6A 3QQ3B 3O9WB 1KPUB 1YY9D 1D5XA 3MJ9H 1EERB 1EGJL 4HPYH 5GS0D 3SDXE 3QEGL 3DJSA 5HHOB 4M6UA 2YL6A 1QVOB 2GOKA 5CJ5A 2VDRL 4H2AA 2BP5M 1TJGH 4DVRH 4PODA 4CDHA 1F61A 3LH8A 2NLIA 2W65A 3DESA 3MV7E 1SLXA 1H5VA 3U7YL 2F19L 4RNHA 4A2RA 4WUUD 2G37A 1O9VA 3NZHL 3NZ8A 3VFWB 2YEVB 4MHHG 3WMSA 3RUGE 5KS9F 3LRKA 4O16A 4MAYA 5F7NC 4RMRA 1UXMA 4XTIA 4GB9A 3LKSB 3BP4B 4C6LA 3U82B 1TVPA 4QRBA 3BVJA 5GJTL 5AAMC 1VGAA 2NT1A 4Y19B 3UJIL 1CLYL 3TJHC 3UCRA 5EHFA 3EKZA 4DHLA 4YHLL 3G5WA 4H1LH 4AL8H 4WSJA 43CAB 2F54A 7XIMA 3ZTNH 1JXDA 1FO0L 3CZLA 5AC7A 2AMUA 5C0BB 4Z7UE 1EEZB 3KPRE 5IWLC 1FKWA 1U58B 3TAKA 3HNVL 3KW8A 1VBJA 4UINL 2NV9A 1PZBA 3ZR6A 1FBAA 3GXPA 4OCYL 3KBEA 3UPAA 3P81A 5AVNA 2IMMA 1IE5A 2GHZA 1TT6A 2D3VA 1CLCA 1V55B 1XUUA 4F33A 1VP5A 1XEUA 3TSBA 4MA8L 3F65A 4NUMA 4G7EA 3T1FB 1QUNA 1MEXL 3S6DA 3DI0A 2VQTA 3OVGA 4R7JA 4MX7B 3DFTA 2H1XA 4OCNC 4XXCA 4QAIA 3RWCB 2H45A 2OR9H 4R0LA 4IOTA 2IQ9H 4FFVC 3T0CA 5I5IA 4U1LB 1ESOA 4QRSB 2GJ6A 3M86A 4PRBA 4NZ8A 4G82A 4NP7A 2CJUL 3WJLA 4PGDB 4XAZA 4MXWH 3TU9A 1XSKA 4WEUD 2PXYB 1QRNE 2W91A 3LTPA 5D4IA 4OCXH 1UQZA 1YX1A 3BZ4A 2FGBA 2YPIA 1RERA 3Q2VA 4HZ6A 3BRGC 1LWHA 1JNNL 1VYRA 1VYSX 3JV4B 1IEXA 3VDCA 1UUOA 3JVAA 1G7HA 3U7VA 3QNZB 2ACRA 1VBGA 3SN6N 1IBGL 1Q7QA 4OFYD 2XISA 3KYOB 5F7AA 1XXDC 3MODL 1S7SA 4KFZC 3GUTB 3LN5B 2WZ0A 4X0KA 4W88A 5AYIA 1G4RA 2CE6A 4O5LH 3ARBA 1FVCA 1X5XA 1AKJB 4K71B 4MDOA 2XU2A 4V1XA 3M0LA 1JXJA 3FDWA 2WSRA 3ARGC 5IVXF 1KGCD 4J2QA 5G4EA 1NCWH 2XXCB 5IV2A 5IOBA 1RLBA 1Z5HA 4HSOA 3NA9H 4O02L 3P11L 1ASPA 2VXNA 1Z7AA 3HBZA 2XZZA 3T0EC 4EUPA 5I8KL 1BFTA 4AD3A 1T5AA 3VIFA 2ID5A 1KY6A 3H4GA 4PJFF 3N1GC 2EYRB 2ZYSA 1TYGA 2CZEA 5C8JB 1WFIA 4JK0D 2QR0B 4LVAA 3D50A 3WIIL 4YDKL 4AQ8C 1GVFA 2Y8KA 4C5ZA 1EX0A 3DHUA 4YS4A 4ZEPA 4P5KA 3PJTA 1CDGA 4XX1G 1A5NC 5HHNB 5E8DH 1XBRA 1PLGH 5EUOB 5C5YA 1W6WA 4ICMA 5MP6H 2NSXA 3SDDD 3BT2H 1HXMB 4DGVL 4IJRA 3JXAA 1WC7B 2GFTA 4QR7A 1NINA 2QJHA 4DF0A 1CLXA 4JFFE 3EX6A 4Y5XB 5EU4B 5D32A 3WH5A 2BNQE 4X9FA 2VGBA 4ZMQA 3H0TB 1SM3L 4GZJA 3VWKB 1LORA 3GBDA 2P1YA 4YZFF 3FJNA 4FI4A 1PNCA 2B4CH 1XWYA 2CWXA 5GS2D 5DJ0A 4CQAA 4N2LA 1HS6A 2JF7A 1EXPA 1U8MA 3SDXB 3BPLB 1Q0XL 4JGUA 4WNJA 3U6WA 4UQ3B 2YJLA 4IIEA 4HJ0D 3MV7B 2XDHA 5E08L 4ZTOH 1ZK9A 4P2OA 4KWOA 2XPGB 2WOYA 4JXCA 3WLRA 2ZUWA 1NGWA 1HCZA 3RUGB 2RH9A 2V3GA 1ID5I 1BF6A 3UPRA 3UJJL 4FQIL 4AV4A 4GIYA 1N6UA 2DZXA 5TGBB 2OPJA 4HMCA 4LY4A 2VSCA 2G5WA 3MRIA 1AH0A 3MBFA 3RA7L 4W9GC 1GXEA 1R33A 4CSZA 1M1XB 2J43A 4W4OC 1C5CL 3UW6A 3AT9A 2Z91B 4P23B 3TBTA 2EUZA 3VKAA 3IDXH 1IAII 3DX8B 1X8CA 4LOVA 3BFWA 1VERA 4OV9A 5E9DA 3VA2C 2Q01A 4HBCH 2NZ9D 3WFHA 1UUSA 1CG9B 3RE0A 3BIBX 4MJMA 4YQXL 3KPRB 5CXPA 3RZCA 3VD9A 4L65A 1WBZB 3QIWB 3UNDA 4DWSA 4GUPB 2X8RA 1YTKA 1LK2B 4Y4FB 4JTSA 3PWPA 4HAKA 3C6LB 1DWFM 4Y2NA 1J86A 2IPUG 3N9RA 2ZCKL 5JW3L 4I77H 2XINA 1VJIA 3QHZL 3TFXA 3A67L 2E7HA 2PO6C 2OSWA 3R18A 4UT6A 1YTEA 1RK6A 5F0PB 3SSJA 2XWZA 3US0A 2LLLA 2COVD 4AXWA 1ALDA 1WDRA 3UR8A 3KLKA 5K9KB 4DP9X 3BQVA 3FK4A 2W67A 3O8XB 2ZXEB 3TZVC 4KUZL 1BYNA 1UC5A 4J23A 3V3WA 1QRNB 5AOMA 3IVTA 1LRNA 2AXJA 2OSXA 2Y0SA 3X3FL 2JKTM 1PKLA 3NJFA 1R2TA 4NKIH 5A5WA 2V7HA 2I16A 3DUUB 2HJPA 4F7MA 5M2FX 2YZ5A 2XN9B 5C0CA 4H40A 2VH5L 4OZIF 1NUGA 2Y7LA 3CMGA 3RR1A 4XP9L 3T05A 3LZQA 3F01A 3QDJA 1V5JA 4KMTH 1UQSB 1EFQA 1TQTA 3E9TA 3EJYC 5F9WC 2YPLE 4TNVK 2WZIA 4TSBH 1IXQA 2DVXA 1KCXA 3W76A 1F3RB 1GVQA 5F7YC 3GRWL 5D72H 2DQHL 1CXFA 1UZ6F 3NSYA 4M6OL 4E5XB 2FFCA 3B8TA 3WSQH 4BHUA 1HKLL 1DEDA 2X1QA 1TWWA 2IWEA 2P9RA 3H6JA 1MRCH 3TBWA 1MZZA 4CD5A 3VFGH 2K4AA 2W80C 3DX3A 2WHMA 3SN0A 1E27B 4QDWA 1G9NH 5GGSB 4NWUL 1QWUA 1B5TA 4PV9B 3S0PA 4QSHA 1WUZA 2AJ3A 4PH8A 1X6UA 4AZGA 2JKLA 2WLMA 1FNAA 1IB5A 2J1KA 1GIGH 2VXVH 1BG4A 2A1WL 2BMKB 1ZAJA 2RTTA 2YPVH 3TF7C 5IFAL 2VMCA 3O11B 1WDAA 4O1CA 4AGMA 3FAXA 3C2OA 3GG7A 2UZIH 1LT7A 3CWNA 4JFFB 1CVSC 5IB3B 3Q65A 1J5IA 3DV6A 1MHPL 2ADAA 1N8WA 4PRDB 3QHFL 1KC7A 1E2ZA 3GJFK 3ET9F 4NKDA 4ODWA 1BZ7A 4GZIA 2B9AA 4LLQA 4EI5B 2HZGA 3UO1H 5HDRA 1S9WA 3G04B 1SN5A 3WHE1 3N9GL 5AOIA 1VF5C 3AT0A 2QUMA 5E7FA 1WF5A 1PJWA 1S3RA 4F8TA 2A4AA 4YBLC 1XGYH 3TOYA 3T6WA 2Q3OA 3S5LA 4D7PA 1R3WA 1AJ7H 3JRKA 3ESUF 4O4YH 1XGQA 3FO0L 5K9QG 2AJZB 1R3SA 2PU0A 4HG4J 3A9IA 1LBLA 2OQJB 3TSDA 2OWWA 4DYJA 1T20A 3FQ4A 2NXYD 5F1KC 2Z4TA 5CR1A 3VOCA 2R0LH 2ZZ1A 4GYBA 5IROA 4H8HA 2CKBB 4GMSH 1T1ZB 3UZVA 1NIBA 1ET7A 4WWPA 3EUUA 3FTUA 5L2KE 1N8IA 5DLLA 3MJ7A 4JRLA 2DL9A 2DTML 3QJRB 3MBEA 4PMVA 2WMKA 3VFNB 3W88A 2Y24A 3QVAA 3ATDA 2IFFH 4NRYA 2AW2A 1ZJHA 2CBMA 4Z7OE 4GXVH 4UUJA 4HJSA 4UTFA 1A14L 3VOGA 3UAAA 1TIUA 2D31B 4ONOA 2EVIA 3K2IA 5C09E 4MVAA 3DX0A 3THCA 1XIWD 5ESQB 3OVQA 1A49A 4M1GL 4XCCH 3GHTA 4CBPA 1MFBH 3UTZA 5I1AB 2OJPA 5KVDE 5J04A 3C0LA 3SBRA 3OXSB 4AE0A 4G8GE 2Z4QA 4GBDA 1IGYA 2IQAB 5FUZH 5I3HA 3G6DH 3ZTJG 5C0QA 5C9KA 1MCQA 5H8UA 1OTUC 3OJDA 5IJKA 4JTEA 1P1MA 4DGUA 1XRSA 3RNKB 3ZTDC 5HGHA 1IC5L 4FABH 4HSNA 1ML1A 3NQ8A 2PDXA 1C91A 3LRSA 3EWXA 3D9AH 5E2UL 2FZ3B 3T78A 4XVSL 2WBJD 1HL9A 4LLMA 3GKWL 3QJTB 3V0DA 2WLNA 4PB4A 2CPUA 3UZWA 5FYLL 4AIZB 3V4BA 3L3IA 1HHIA 4H88H 4TV6A 3RNDA 2UZYA 1FRGH 2R23A 43C9B 1ILUA 3L4CA 2LHAA 3OKKA 1UR8A 4H9VA 1JPSH 4JGJA 3BE7A 5AAPA 2XIBA 4AZIA 4DY1A 4MUPA 5KSWA 4JY9A 3FU6A 3UESA 1MRAA 1CLZL 4HU8A 4B9PA 2TRSA 3MXWL 3M5VA 3B03A 3N3EA 1IGMH 5CSZA 1OE1A 5HPOA 3HMWH 3YPIA 4IGMA 2K78A 1SJAA 4RFEA 5BMWA 3K6IA 4GUCA 4JOMA 3AJ7A 4QR6A 4IFKA 3B56A 2HLFC 3RWEB 1A7NH 3UYCA 3FYEB 8A3HA 3TA9A 2YXOA 3ML9A 5I19H 4LEOB 3OB8A 3GRGA 2EICA 1OG0A 1K7EA 3JTBA 1QZNA 5BUGA 2BVQB 4B5ZA 4FEIA 1EUUA 2PDFA 5IBTH 2RHEA 1ZPLA 4Q4QA 4F0MA 2CK0H 2QMKA 4GISA 2VL4A 3ASNB 2RFXB 3RUBL 1C16B 1LDSA 3GIYA 4FF5A 3VCRA 5HHXH 2DM4A 1X96A 3K0YA 1C1EH 3PQYE 5DRXA 4YSQA 4NNXA 2G8ZA 3KLHD 1FWIC 1PHWA 1KCRH 5K9OB 3F85A 4AZ8B 5KZ6A 2R8SH 3OHMB 3EFDL 5DJYA 2DWSA 1F3TA 2YKKA 3V7MA 1WIOA 5AHEA 2A5HA 3KOYA 3H8NA 3K0WA 4LGPB 2EYSA 2WOQA 2E6AA 4E0RB 4LSTL 4OM0H 4GYJA 2QHRL 3RPIA 4Q52A 1C7SA 4A6YB 4ODUB 3L3OA 3EEGA 5DJ6B 3REVB 5FR3A 2GJJA 4HK3J 1UQYA 4YE4H 4PGBB 5JPNA 1YY8A 5T91A 1QR7A 1Z6KA 5AVTB 2B20A 1ROCA 4ZOCA 1F3WA 1YAZA 1OAYL 1WITA 4L1GA 4YNYA 3AMCA 2J4WH 2X1SA 1V7NH 2ITDA 2G60L 5SWZD 1YPZF 2NY4B 1E71M 2IWKA 3UGEA 2BLFA 3SY6A 4ASTA 3QDMD 2DZSA 3IN0A 2ESVE 5E00B 5GSRA 4GAYB 2CRMA 4DP2X 2QKFA 5DRIA 4DOHE 4NN7C 1M6JA 1US0A 2VN3A 3B0YA 4RLIA 3Q5TA 3SY5A 2ZRVA 5L2KB 4GKOA 1I0DA 3VYPA 3EXJA 5L0QC 4Z7OB 3RJXA 1FFPA 4JD4A 3UTOA 5DT5A 1E3ZA 2GSJA 4Y5YA 1TZOA 5GIRA 5C09B 2XYCA 6PCYA 4H7ZA 4S0TD 1TUFA 1CFQA 4GG6F 4NP4L 4AGQA 4K3DL 3DBXA 2Q10A 2ZICA 3EYVB 1KIRB 5CBBA 4FQ2L 1Q4NX 3UTTA 1WYJA 3MRLB 1OF0A 3D33A 1X7IA 4YGVA 4MS8C 4G8GB 5D2NE 1EJUC 4ZTYA 1O6IA 1EGMA 1OF2B 4HYVA 5FJOA 3QKZA 3HV9A 1YJDL 1H6TA 5B39B 5JOPD 2NCEA 1OG6A 4E42B 4TQTA 3PL6C 4TSAH 2GQAA 2BNJA 1UZDA 2D9CA 1IFGA 1A5FH 2DWDA 3O6LH 3S4SB 2YD8A 3IM1A 3TVMC 4M9PA 3O3AB 5L4MA 2NV1A 5I5JA 3TW6A 4NJJA 3OWRA 3S88H 3MRFA 3MJ9L 2VN6A 3C0QA 4DFHA 4QRPA 2HVBA 4F66A 2W88A 4FR1A 3EZ8A 4JFED 2YAHA 5SWSD 1OM9A 1QSED 3E1ZA 5BXFB 1KG0B 4JICA 3AU6A 4HCFA 3EGDB 3D85A 2KAUC 3F7RA 4IRZA 5HWMA 2FWOB 4YJZL 2VLKD 3HNSH 5EMYA 1NUDA 2B77A 1SJDA 3RIAK 2X4NB 2RQ8A 4TX8A 3RB5A 4EWJA 1JTPA 5HDWA 4XMKH 3SN1A 4U1SA 4PRHD 3MLTA 4FL4B 2OELA 2XH0A 3QHNA 1KN2H 5CCKL 4XMLH 1OAKL 1Z0NA 3GZOA 1TV3A 4PJBF 3FBQA 1RALA 4OVVA 2Y5QA 4XNYH 1TWDA 4Q8BA 2A6DB 4LIQE 5D6DA 1ORSB 3TWBA 5IW3A 2BPBA 1E4WL 3GTNA 1T7YA 2PP7A 3L9YA 4F5CA 4WO4B 3SD5A 4ZPTA 5DHYA 4F9LA 1P4IH 4U6TA 3PK7A 1I1AB 2HMIC 4LBRA 3SPIA 4UIMB 3V5KA 5AWNL 1EC9A 3S7GA 3PQYB 1M7DB 2JI1A 1P6CA 4HEME 3CVHH 9PCYA 4TNGA 2B4CC 3RTQA 5CGBA 1QFWM 1WOBA 1VZGA 2ZNWA 2OR9L 3VDAA 4Q8TA 4FXKB 3EJQA 3U5YA 5G5DB 4OI8A 3UCDA 1WZ1H 4F4RA 3FDGA 3AWNA 5GISH 2OYLA 3IKCA 1MFUA 1M4KA 1QYGH 2BSLA 3EA3A 1V6VA 2DZTA 1KGYE 2ZSWB 2O5NA 4PJ9B 5E6IA 2NX5A 1V02A 4YTUA 3FOMB 2AS5M 4HUWB 4OCXL 3RRQA 5LXGH 2XWJA 5EN2A 4D2NA 3ZVVA 2PWEA 1LLWA 1W72B 4GGBA 3BHBB 4Q4PA 3EJZC 5AVZB 4ORIA 4IGSA 5E70A 5FOJA 3X11A 5T8IA 4OLXH 1CLKA 1FH2A 3BFOA 3DWTA 4Y1AE 3DO7A 2UZXA 4PJ7A 1R3VA 1ZGLP 4ENEC 4DEFA 5FFOA 3ZKXC 5A16A 4XN1A 2WWMC 4XCFH 3IT8D 1G9EA 2OQLA 1N5AB 3EF4A 2ESVB 3JV6A 2B39A 3TROA 2ICWI 1KZQA 4CBZA 4DOHB 4M1CC 3BLKA 5J6HA 5I23A 4MGXA 1QSFE 4YLBA 5KJRH 2WMPB 4E68A 2YZRA 3ZTJH 1XF2A 2XZ9A 4JDEB 1XL4A 3J8F7 5EEXA 4UXDA 3VDHA 4PY8I 3D3VE 3IUDA 1MG3C 2ZUMA 1UBSA 1KGJA 3NJVA 2WLLB 1NCGA 2GTZB 4P7NA 1U3JA 3V0UA 1TPWA 1TWSA 4GK8A 3QUZA 5GSVB 2SODB 3LHPH 4FYQA 3A4FA 1Q9KB 1FPTH 3MCMA 1V7MH 1TVDA 2ZXGA 1FYTA 3TQ0A 3SKMB 2ZX6A 2VISA 4N2GA 2V2WB 1UD5A 1UUNA 4V2CB 2KL6A 3BWSA 4D9PA 1RPQA 4IHOA 1P53A 2JKRM 2VQ1A 3CFUA 4Y8AA 3BZGA 1LYQA 5I07A 1ZJBA 1XBZA 4OT7A 1F1GA 5D2NB 1M68A 2V9TA 3E6EA 1HAUA 4V11A 3OQ3B 1PLGL 1KFAH 3KCPA 4EOWH 2V33A 4I5UA 1UZ8B 1OFRA 1WTGT 5D9MA 2VXQA 4IRJA 3SJVE 1QUPA 3TPUB 1UACH 2CLVB 2QXWA 4U4MA 1IM9B 1E55A 3GHRA 1RH8A 5HYQA 3B9DA 3LENA 2Q86B 3MA8A 2OYKA 1RR2A 5EIIB 3CH1A 1S7TB 1FL5A 2YL5A 4AI7A 1GGUA 1YC8A 1CLVA 5AC6A 1YEHH 4RW5A 2HRPH 4W6XB 4QNPF 5HWJA 2FDSA 3POHA 5CUSH 4NQ1A 2H0FA 4YLWA 4W85A 3HPXA 3PE9A 4ZTOL 3MCNA 1A80A 4XNDA 4PYHA 4AQEB 4ZDHB 1DVZA 1TTBA 4B0MM 3MACH 3KM1A 1AHWC 3N44B 3P8JA 1F56A 3B5GA 4P5RA 2NUPB 1U3HB 1G9NC 3VFLA 4D6HA 3W7OA 4PUEA 4O0ZA 2FD6H 4X7EC 5DK2A 1YYAA 2YCIX 3TO4A 1K6QH 1FL3A 1E6XM 1NIFA 4YZWA 2X89D 2HXAA 5ECUA 4RPPA 1S9XB 4X6EB 4ZT1A 2JALA 1EQPA 2LLGA 3NDOA 4N9BA 5E4EC 1RVGA 1TPVA 5AW1B 3VXGA 5BMFL 4FRWA 1OL0A 4JM2B 4O15A 3FUIA 3WEOA 4MLJA 3T8VA 3E6FA 3GVGA 1LG2A 6XIAA 1Q1JL 1ZT4B 4LKCA 5AUMB 1BXAA 4S3DA 3KLDA 1NCDL 1GH7A 3RGVA 2APXA 4A7TA 5D8JH 1W5OA 1YDVA 4F58H 1HSBB 4PJHF 3PHOA 5FLVA 5FS5A 4FTVD 4AT6B 1AGFA 2CKNA 4N8VG 5SX5K 2B5IB 1J79A 4M1RA 1VFLA 2I24N 4PRIA 3G08A 3MLSH 3ECWA 4LHUD 3OA5A 1LZOA 1GTHA 4ZUUB 1M71A 3WENA 2ZOKA 1E9QA 2PW1B 3KLQA 5CSSA 3CVCA 2WQ8A 2CXGA 2JIXB 4JPVL 5D1XD 5IM7B 2E3ZA 3O6KL 4ONHA 1K7FA 3Q06A 3NK3A 1GYLA 4JKMA 2VERN 1TPEA 3NTYA 1L7TL 1WG3A 1RAKA 4D6EA 3LKPB 1U3YA 4Z76B 4LRIA 4ANKA 3QJHA 4NKIL 4TQ8A 3T77B 1NWRA 3S42A 2BB0A 3WUZA 1Y0EA 2VCAA 4PGJA 3PJXA 3AJXA 4G59C 5F7FA 2IALB 4JO4H 4Y1AB 4KOCA 3D09A 1DR9A 4ZXBC 4H41A 3MYZA 3T6CA 5C0NC 2FNBA 1VKXA 2A73B 4XOBA 1TENA 4IQHA 1DO5A 4LALA 2WBKA 3FUDA 4TSBL 2BVDA 1UG9A 2OJZH 4AUUA 1QSFB 3M88A 1KTDA 3CM4A 3ZIZA 5A1AA 5D72L 3ZZ1A 3WFDH 4JFYA 3WO8A 3D3VB 1WBYB 3IS0X 4KH2A 2HNHA 4L8BB 1X7QA 1XF4B 3IXAA 2Q0ZX 4WW1A 1FG9C 2DN7A 2WCAA 3MDJA 4QY8A 2EVHA 1DVYA 1ZK5A 4JANB 1CS6A 4UOZA 2REQA 4QXWA 3VFGL 4PUNA 1KFKA 3CZKA 1U4EA 5CIPH 1K9EA 3EX4A 2CBUA 3NCEB 4OFCA 1R3HA 5IK3B 5DXYA 3TN0D 2E46A 1GL4B 5HQMA 1FH9A 1MZYA 4E9SA 1F3JA 1T7WA 3HFTA 3C52A 5AKSA 2QPXA 1YEEL 1Q9WB 1VJZA 4ZMYA 2NYYC 4ZX4A 2N01B 4OZHF 2FZ8A 3UX9B 3BISA 3QO0A 3B06A 3B9KB 5KBKA 4WZ9A 2VXVL 4LDCA 4KK8C 2YPVL 3IK2A 4XPBL 4WOZA 1JULA 1MF2H 1X6NA 3BLOA 5DO2D 32C2A 4YSOA 1KB9K 2DMKA 1G7MB 1XLFA 3WF3A 1U92B 3SJVB 4EI6A 1BZEA 3CU2A 3UWWA 5I09A 5H1WA 3IXTB 1JRHH 4NQSA 3DH7A 3FO2B 3INUH 1WFNA 4TPRH 5DHVB 3FQYA 4Q4SA 3GMMA 3UO1L 4IXHA 2VRQA 4KK9C 1NOAA 4NZ4A 2NY2C 4KWSA 5LUMA 4BQCA 4DTGL 2J1ZA 3QS3A 3WUWA 3ZDXF 1X1NA 1B3IA 1I75A 1YDNA 3BW4A 1JWUA 2NOYA 1AK5A 1H0IA 2BNRD 1XGYL 1YCSA 3IJ7A 3DURB 1QLEB 3VXRB 2YGQA 2LTQB 2GSIB 1FZJA 3RU8X 3ZLHA 3ZQWA 1QRQA 3WK3A 4WTZA 1NIAA 3GFZA 2OCCB 4FMKA 1W9PA 1LROA 1NIEA 3FQTB 5ESVA 4I6KA 2VAAB 3ZDWA 2VE6A 4QDGA 2PCXA 4GEJA 5FDWB 2R0LL 4H13C 5MERB 1DVJA 1AD0B 4GNKB 2WMFA 1EKOA 2E5BA 1Y0LB 4B7IA 4X50A 1AG0A 4JJHA 1RCXB 1S5WA 3KGRA 4Q9BA 4PJ8C 5A40E 5E0CA 5B21A 5HVFB 2IH3A 4K2UH 2WV3A 3GTVA 3QNXB 4X98B 2D4FA 5A6TC 3S35X 2YXFA 1ZP4A 3CNKA 1S39A 5A7BA 4FXLA 4NPJA 1JCTA 2WNKA 2GBVA 2AQSA 3FYOA 1CFSB 3H9SE 2QGYA 4WI9A 2C3VA 3LNHA 4PTWA 1HQRB 1O7VA 1ADSA 3B34A 1TV4A 1GGOA 3CUFA 5L9DH 1XINA 2E9IA 2Y9RT 2ZC8A 3N1QC 4I2XE 4RXGA 4XBPA 2P46B 2C9PA 3DX7A 5FUZL 3G6DL 2J8GA 2OWCA 3TX4A 3GMNB 4OAWA 4Q4IA 4DP1X 3VX0A 4U1MA 4FABL 1WFJA 1LP9E 3HZMB 4PJXA 4UTWC 4HIXL 2EC8A 4HSQA 3D9AL 3NA4A 2EC9U 1AH4A 4P8VA 1Y6MR 5L4JA 5KJ7E 4KV5E 4LP5A 4JFHD 1FY6A 2DDQH 4MJZA 4GNVA 3UEZA 3AZSA 1JZEA 3HE7C 2QEJA 1A2YA 4FI8A 3WF4A 4A3QA 5E94B 1ZTXE 3KOFA 5ADOH 4HFWA 4FG4A 2RD0A 4U1GB 1XIJA 4E4UA 4JTQA 3HHRB 3QR2A 3SE9H 4S2SA 1OSPL 1GS6X 1JEZA 5I1DB 2EDEA 1UWGH 4KC3B 1SJVA 1DQKA 4LASL 4LLUA 3M5XA 2H3DA 2PDIA 2DW6A 3WLWC 2P3EA 1QAPA 1VZHA 3RIFF 3U25A 3CFCH 2RFGA 1P48A 3D2UD 1GYVA 4MCYB 4YIQB 5GS1A 5HINA 3HMWL 4WUUE 3KTXA 3FT3A 3F12A 4I18C 4QE1A 5E2WH 1BOGB 4A38A 2M26A 2WWKO 5E09A 1XX1A 1BVKB 3SW6A 1QLRB 1DL3A 2N1KA 4LEBA 4U10A 4XKYA 1JGIA 4S0HA 5LNDA 5B38B 3OQEA 4C59B 4FG6D 5IBTL 1WDQA 3U36B 2ODHA 4UWMA 4XPAH 2QHAA 1YEFH 3OR6B 4EVNB 5E5MB 3UJTH 4LVGA 1CT5A 5HHXL 1YNTF 1C1EL 3H21A 2DQFA 3XISA 3GR8A 5T5FA 3ARDD 2K8QA 1ZHLA 4NJ9L 1KCRL 4NKOA 3SBQA 3KW3A 1JDAA 4K7PX 4XN5A 4APQD 3NL5A 1SXAA 3EO1A 4FQXA 1QNRA 5D9NA 3TTEA 1A8ZA 2AKMA 3CSPA 1AGDB 1ZLVK 2M83A 2AKRA 2DOCA 4HS6B 4W7WA 3R25A 3H4HA 4ALAH 1KT2B 1NFKA 3QXUA 4FJZA 3EYSH 1ZUAX 2OMTA 3C5JB 2VLJD 2F8QA 4U6HA 4FQPA 4CGTA 3WY3A 4YE4L 4P4KA 3C60B 4ZMGA 3EB3A 4NOFA 4FIRA 1CD0A 3L3JB 3FB5A 2RB8A 5MEOB 3ZKMD 1K3UA 4AYBA 3TWAA 4IRSB 1OAUL 2UUDK 3HB3D 2XTJC 5U4NA 3RFZA 4RV3A 4MJJA 4YH6A 3O3RA 2NTSP 2VLRD 4HX1B 1RV6X 4X6DF 4PCYA 5F9OH 5GZND 3QHMA 2DZAA 1K02A 5GJNA 1I8LA 2VM9A 3GHSA 3ZKQD 3GC2A 4AQOA 1ZWIA 2EUWA 4NNPH 1F6KA 4PI2A 5T3XH 2DT3A 2E7CA 1OFDA 4M48L 1WXYA 3M9YA 4UNKA 2NY3C 1LO4H 2Z0BA 3RURA 4BCEA 3P2BA 3CFDA 1FNSH 2GFBB 3F8UB 1FVPA 3HG5A 3E38A 2W3ZA 4BHUI 5A69A 4XNAA 1YNQA 3FU9A 5I76B 4GSQA 1KGCE 3WQ6A 4L1HA 2FQEA 4I3SH 1VGKA 5JXQA 1N8ZA 3RWFA 3H9SB 2Q8AL 3F83A 4EZKA 4C55A 3NPZB 3P4LA 2FEDC 3AXKA 4X8XA 4KJPC 3TJLA 4NZTH 4RE4A 4LFYA 3RVTC 4I2XB 5EC1B 1QFUL 2IV9A 5EU5B 1O12A 1YHTA 3PHQA 2HLEB 3ZE1E 5EBAA 2QR6A 4HUMB 3RVXC 4L4VD 4MNGA 1NEZG 2N59A 4HLZG 2Z26A 2WHJA 4MMWA 4POCA 3DJ9A 1SMDA 3KVDD 1UPPA 3H2EA 4C1NA 1LP9B 4Q8NA 4FLOA 1CF8H 3MLPA 1PDKB 5JA8B 4TSAL 4JHVA 1SO3A 1JVNA 1PAZA 1A1OB 4FFTA 4PMRA 3JWNE 1A5FL 5HI5D 1F0LA 2XQBH 1N6QH 2BY2A 1CBVH 3LQZA 3M1OA 4YEEA 2XQYK 3NWRA 1A7PH 3L9RA 4NQQA 4KJWC 4FZIA 1M7XA 4H3DA 1N7ML 1RLWA 3MP3A 1FWAC 4JO5A 3WLNA 2VO8A 4PGEB 1OM0A 4PRPD 4R3SB 3FJLA 1V8HA 2EHHA 3EX3A 4HGKC 1BVZA 3C2YA 3K2UL 1IAKA 4LCCB 1OCQA 1RUSA 4GY1A 2YD4A 2OJEA 1E9PA 3DJZA 1BOYA 1RK1B 4AEIH 5H6HA 4HNUA 5TAOA 2XFFA 1KXVC 5DJ8A 5F72S 2E6DA 3UMNA 1PKNA 1CDUA 4LLYB 5KAQF 3HRPA 2FB4H 1YAIA 3U9WA 1XR9A 4C4BA 4GVGA 1RY0A 1OY3B 5HDQH 2WC4A 4WUUB 2MCG1 1DJZA 1DQTA 3WAJA 1RZKH 1T40A 3IGXA 4XMKL 1KLUB 3OYXA 3MPGA 1QNIA 1XBXA 2XC8A 3TL5A 4NQVB 3VOIA 1TKWB 3EWDA 2YAPA 1MCOH 1EA9C 3M41A 2D69A 4M1BA 3M0XA 3QYQA 3IJYA 2V5JA 4NQXA 4D0CB 1S7RA 1UB6B 1BAFH 1HQ4A 3QBTB 1BLNA 2MKWA 1MHCA 5I7GA 3W7MA 4TUOB 1XH1A 4IIBA 3RJDA 3P4OB 4AYSA 2A83B 4BWWA 4G7SB 3LUTA 1DLFH 1FO0A 2GGIA 2NXZC 2XXGA 3KEDA 1X1ZA 4H26B 4AB4A 2WB1A 5FCSH 1GEHA 4GACA 4YOKA 3LHWA 1YSOA 2I26N 4HCLA 1UD6A 1FFQA 4HETA 4XZLX 2J88A 1HHKB 3CX5J 2V37A 1TV7A 4L4TD 3R8HA 5I8CB 4LL9A 4KK6D 4YDZA 1RFDH 2WIMA 1D7FA 2D2CC 3S8WA 4XAFA 4IJTA 3RDTA 1K7XA 1SOQA 5J1AB 4NUGH 1YMYA 4U6VH 2X2IA 3W56A 3SO7A 3PWJA 4HNNA 1OGTB 2PLKA 3W7LA 1L9PA 6ENLA 4WEBL 3PSVA 1UOKA 1XX9C 3UFYA 1S5HB 4ZB5A 4LPYA 1D5BB 5DK0B 3VFMA 5BYWA 4G6ML 3HLAB 4R90H 2CHDA 3MV8A 2XV0A 1FNGB 3TH4T 1P7TA 5IUCA 2CM5A 1UA7A 3HFMH 2CUHA 3D3AA 2DKMA 5DQ9A 2O0TA 2CGYA 3UACA 1JWMB 1IQDB 2NZ1A 1X5FA 4OF8A 1KIQB 4A8IA 3NZGA 3O6YX 2YQGA 4W9CC 2OO0A 4KXDA 4C6QA 4HKPA 5HHQA 1BPVA 4E41A 4WNQA 3UTPD 3QCTH 5FV2A 3V0WH 1JPHA 3G6JE 4YL4A 3N50A 2WLZA 4RH4A 1F18A 1H5BB 3FO1A 4L8SC 2ZT9C 4OLUL 3KLAA 1R0AL 3ARXA 4EDXB 3S5NA 1TB3A 4G2AA 1JZHA 1O5KA 3LHPL 2JB5L 3UG3A 1V7ML 2FYVA 2FGLA 4PB0H 1XCQA 2GT9A 1KIUB 3B8WA 3JVFC 1Z9MA 1UB5B 2OQHA 4G7RB 3SN4A 1E9IA 4HSHA 5AB3A 3WO4B 2PYFA 3IJQA 4PJAF 4HUKB 4Z7UB 1BXNA 3FCSB 3N0AA 3K6FA 3CUZA 5HR7A 2P8LB 3ZE1B 4GSRA 1J2BA 4IHCA 2MH4A 5EGRA 1KFAL 1PKYA 3VXTA 2X1WL 2PCPB 3BQUC 3NR0A 1ZU8A 2CBQA 5JPMB 1EIXA 2J8HA 4OZGF 3EB4A 4JN7A 2YXVA 2ZKMX 3MUAA 1VCFA 2LT9A 3SDDB 5A2IH 4LGXA 4RMSA 4NYYA 2N7SA 4GCAA 2AEWA 5IHBA 1D9KD 4LEEA 5HNRA 4HN4A 1DN0A 4YHKH 1F42A 3FQ1A 3QO1A 4NO2A 2CNYA 4GBUA 3EBGA 4TNFA 1LE5A 1NMAH 1MVUB 4MWAD 4O13A 1WK0A 4N0YH 2C14A 1EFXB 3IYLW 2WB5A 5HMSA 2PABA 2INEA 1YEHL 2WHVA 3ZM8A 1KTNA 1AIFB 3SUSA 3OKLA 2HRPL 3U1SL 3CUHA 4ZJ9A 4X8GA 3GJFB 5E9NA 3U0TA 4PJIA 4CADA 2BWQA 2WVVB 3DVGB 3U1PA 3T4AA 5L6YL 4S1DD 1MFCH 3FTGB 3NIFE 5B22A 5G2WA 1NGYB 2MEJB 3NIDE 4R27A 1N5YL 3KPLB 1EZ2A 1FFTB 2CNCA 2VABA 3UYPB 4B15A 3LSOB 5CLTA 1EMTL 3P77A 2BHYA 4Q8UA 4MLIA 1HK6A 5JUVA 1FZKB 3BW2A 3VIGA 4OJDH 4NY2A 4PTMA 2FD6L 2GDQA 4FHAA 4IIQB 1QHPA 4FOKA 3WS6A 4LL4A 1UM4L 2CLEA 2FQIA 1KEGH 3OGRA 2X1UA 3W9ZA 3BOVA 3TCTA 5KAQG 3BH8A 3AB0C 2NXIA 4JHAH 3ARFA 1E28A 3ZU8A 4U1NA 4LEFA 4JHZA 1AO7A 3ZRSA 4PP1C 1TR7A 5D8JL 2WXNA 4AHPA 1SVCP 2DV6A 3NQKA 1F6AA 3PXHA 2WXLA 2XV2A 1PX8A 2GDVA 2HT2D 1PTDA 4UB0L 5I17B 3VTMA 3FEQA 4A7VA 3GLZA 3GBLA 5IVZA 1NC2A 4IL0A 5EIVA 1B3XA 3HA1A 2VEKA 1I8KA 3W1UA 5D8ZA 2CYGA 1T22B 4HUXA 2MQGA 2PTTB 5C3LD 5LN4A 2NQDA 1Q5MA 1FC2D 2H6UA 4O2CB 4HKJB 1DBAH 2IDFA 1SMAA 4PTTA 3NT0A 2XZCH 1M53A 1KXTA 3VFVA 5FWRA 4XO6A 4MPQA 3QORD 2XKUA 4WI0A 1SZNA 1H9DA 3T0EA 2AJSH 2XH4A 3N19B 5HUOA 5G2HA 3DGBA 2OQYA 4X5XA 1B3ZA 3PIQA 5JHDA 1PZ5A 2CLOA 2GL5A 4F7EB 4LYRA 3VXUA 3HIJA 4F15B 2BNQB 3KNBA 1MI5D 5EZLA 4ZNEA 3N18A 5E8OA 2QSVA 2ENPA 4JO4L 3QG7L 2FECI 1HHGA 4I3GA 1KJMA 5A2JH 3LV5A 4TYUA 1RBAA 4XBGA 4MAYD 1UWEL 4EIZC 2AJUH 4NJIA 5EZOL 3NQBA 4OBSA 2XDFA 3H9ZA 1VCAA 4N5ED 4M82A 2JF6A 3HPAA 2DJUA 1BFSA 1T1XA 3G6JB 3WTYA 4HLZH 1RA0A 1CD9B 2F54D 2F53D 3GEWB 4JFOB 2BINA 1A5SA 4KZCA 5DRZA 4NLHA 5D7KD 1EQCA 2VKXA 4B4FA 3ARPA 3QFJA 3HUJF 3EWYA 3AXLB 5FO7A 1CYGA 1DLHB 4M62H 2LU7A 1J5HA 3ES6B 4UR8A 3A6CH 4GKZA 4PCKA 4CVUA 1IGSA 4OIIH 6FABH 3FQWA 2XVGA 3PZVA 1RSYA 3GUFA 3LB6D 1Z3NA 3RVUD 3QUML 5TD4A 2Q7AA 4GYKA 3LHTA 1KIPA 3MLXL 5I28A 3IJEB 2CCRA 5I1HL 2YKLH 4GKNB 2PYED 3V52L 1WX0A 3BW3A 3E6HA 5HP5A 4N9DA 1UXLA 5DU7A 1YBQA 4W7VA