1XCWA

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xcwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xcwA01
1HXKA 3WUEA 1CGTA 4BQ4A 2W91A 1FOBA 4ZE4A 5F7UA 2XPKA 1O7AA 5IHSA 1E3ZA 3PN8A 3SCRA 4MNLA 2D73A 1H0IA 2Y8VA 3KE0A 4JZ5A 1GQLA 1QBBA 3UR7A 1GZJA 5JUVA 2BXZA 2VZTA 3CC1A 4Z2HA 4JHZA 4P7RA 3A4AA 1EOKA 4RE2A 2A3EA 3L4YA 1PPIA 3TTSA 1CGVA 1BTCA 2DIEA 4PMQA 1JZ2A 2DQXA 3I3DA 3WD1A 1TVNA 2A3BA 2GFTA 1W3HA 4IPLA 3IJ8A 4XV0A 3ZJ7A 3CH9A 3GZAA 4OKDA 2EXOA 4PTWA 3ARRA 3NYDA 1BFNA 3K46A 2XN2A 1JGIA 3OLIA 2Y8KA 4GXPA 5BROA 2D3NA 1AQHA 1B30A 4UFLA 2CKSA 3IK2A 3VD5A 4N42A 1NP0A 4DUWA 1SZNA 2J7GA 2QHAA 3WNOA 2DSZA 2XVGA 1LL6A 1ESWA 3VVGA 4XZWA 4P7LA 2XVPA 4D6HA 4NSBA 4U2YA 3D4YA 3F5LA 1MW3A 4J3XA 3PZUA 2WK2A 2CESA 4F9JA 3GDBA 4YHEA 2D0HA 3BUQA 2J25A 1HNYA 1NWUA 4ZFMA 3OZOA 2GK1B 3A23A 1J11A 1B3WA 3UG5A 1BG9A 2XN0A 1E5NA 2DDXA 2ZUUA 2VTFA 3SCQA 1VRXA 1E71M 5EFFA 2QV4A 5E0FA 5CZKA 1GJWA 4K68A 3OLDA 3EDKA 2VL4A 1WZKA 3BLBA 1XC6A 3HG4A 4HA3A 3D5HA 3DX0A 2NT0A 1QPKA 3PBGA 2VX6A 2AMGA 3CUIA 3L4VA 2OYLA 4HPGA 4B16A 2J78A 4NRSA 2VQUA 2FH6A 1Q6GA 3WBEA 5A95A 3PTQA 5ECUA 1FFQA 4FLRA 2WMJA 8A3HA 2XG9A 4GKLA 1TMQA 3THDA 3GM8A 1H09A 3GTNA 3D51A 2WVVB 3DX2A 3HJEA 1GOIA 3W4RA 4GO8A 1B0IA 1VB9A 3L2LA 2DT2A 4W8LA 4H8UA 4U2ZA 3DYMA 1JZ4A 5EB8A 2QMJA 1GORA 2VX4A 1V6XA 4GZJA 1OBAA 2EBNA 1QX1A 5D9MA 1CXEA 3VGGA 4GO9A 4JL1A 3BMWA 2CCRA 2JIWA 3WMCA 1CZ1A 4ATLA 3HU7A 4H04A 5D8ZA 3MO4A 1NQ6A 1W3KA 1X6LA 2WHJA 2GVYA 3AS1A 2Y4SA 3MMWA 4HOXA 3AMCA 1ZJAA 4AZCA 1XH1A 3QGVA 1HKIA 1FHDA 1V3HA 2ZXBA 1B3YA 3ARZA 3WNNA 1FHLA 4XX6A 1C7TA 2C8NA 2VMFA 4M24A 3VILA 4MJ2A 4WKFA 5JIPA 4MAZA 5FKYA 1CLVA 4S3JA 2WMIB 1G1YA 2IXVA 3ZOAA 2A3AA 2DSKA 5CSYA 1JXKA 4GQQA 3QHNA 1FFRA 4D1JA 1V08A 4D1IA 4HZ8A 5GNYA 2ZX7A 4ZE5A 3DDFA 1KR0A 2ZX6A 3POCA 4CGTA 3ARSA 1UWSA 1QI0A 2RGLA 4PBGA 4QAWA 2F1AA 5DMYA 5A69A 1GUVA 2EEXA 3S6TA 1LWHA 3DDGA 3VIHA 4UOZA 1UH4A 1VBRA 2VCAA 3LPGA 3ARYA 2XWEA 5A8PA 5A6AA 2JF6A 3D4ZA 1NH6A 4GPNA 1E72M 1NM9A 4OOZA 2CIPA 4AEEA 4P8VA 1UR8A 4D6EA 4HP5A 4DM1A 5A6SA 3GXFA 3BCDA 4WSJA 2XSAA 3VMNA 1IT0A 4P8WA 3WF2A 1I75A 3CZNA 3BSGA 4JKKA 3BVUA 1R86A 4CVUA 5CJ5A 4JHOA 2XVNA 1XH0A 3AXIA 2XHYA 2YJQA 3N12A 4ACZB 1C8QA 1MFVA 3RM8A 4OBRA 3LPFA 5HOSA 3SCVA 4W7UA 2ZUNA 2D22A 2WCAA 3A4WA 1KXHA 1FA2A 1G01A 4M81A 1WDPA 3MS8A 2D0FA 5DEZA 3SCWA 1Q6CA 4AY1A 3VX1A 3ZT6A 4BS0A 2PC8A 3HG2A 4AW7A 4AMWA 4F9DA 2EPMX 2BY0A 3VD3A 2YDSA 1K9EA 4UFHA 1BGGA 3WH8A 1R85A 3K8MA 1CXLA 1NWTA 1CXIA 4AXNA 3VTRA 3A21A 3WQ8A 2D23A 1EHNA 5GNXA 3CGTA 4XB3A 1EDGA 3SCNA 5DFAA 2YL8A 1LF1A 1EOMA 1DWHM 4GI6A 3VD4A 3U5YA 2VR5A 1FP9A 5LA0A 3KWXA 4WJXA 3IGUA 1UZ4A 3BVXA 4DM2A 3CV5A 4AZGA 1V3IA 1J0ZA 1MQQA 3GBEA 3KZSA 3QR3A 1UH2A 3EDFA 3GXMA 1KTCA 1UR4A 1H2JA 2BHYA 1R33A 4UQDA 3M6DA 3MMUA 5AYBA 3AJ7A 3AZTA 3SURA 1W9XA 2BHZA 1H41A 1VEOA 1UG6A 1H49A 1C92A 4AD2A 3WD2A 1L8NA 1JI2A 4UQAA 1HX0A 1W2PA 3BAJA 3VNZA 1R34A 1MQPA 1BGAA 1CGUA 1HIZA 5I24A 3WNLA 2J8GA 3M7SA 3BAWA 5D8WA 1JXJA 3VM5A 3W82A 3TTYA 1VFUA 3LXAA 4MDPA 2J79A 4CCDA 1KTBA 1JYWA 2HISA 1J10A 1K9FA 2CETA 4CU8A 1AVAA 2WMFA 2V5DA 4QLLA 3WBAA 2IGTA 2PWDA 4TTUA 2V3DA 4PCSA 4ATDA 1E56A 1HP4A 1TVPA 3EMQA 3EJPA 2X09A 3ZT5A 2DT1A 3RMEA 4X9YA 3WH7A 4X0NA 1GQKA 3VX0A 2ZOXA 4UTFA 3KL3A 4WLCA 3SEPA 5A2CA 1XD0A 2PWGA 4D6GA 8CGTA 3U7VA 2G4FA 3BXWA 5CXPA 2XSBA 2ZXAA 4TX6A 2PWEA 4ML4A 1KGUA 2YOCA 4PMDA 3T09A 2VZUA 3WY1A 1CNVA 1HVQA 3CHFA 3CBWA 3RJXA 4LQ1A 4HZ6A 3WQWA 1ISWA 4CUCA 2XFFA 1JI1A 4W8BA 1TFVA 5C71A 1PIGA 5CPTA 1E1EA 2V3EA 4PRWA 1E0XA 1UD5A 2VZSA 5A6BA 3NSMA 2TAAA 1XHGA 3OB8A 3O2LA 4UFKA 5E6YA 2ZICA 2EJ1A 1KR1A 3JUGA 3K4DA 4AZBA 2ZIDA 1M04A 1C8YA 1HKMA 4J3TA 1E40A 3CZJA 4LPCA 5BXPA 1B2YA 1DWAM 3MSGA 3W6MA 2YBTA 1ZJBA 1BYBA 4GINA 1US3A 3HZ3A 1TE1A 1OSEA 3CZGA 2XM2A 3CZEA 3DHUA 3ARWA 1VFFA 2WLYA 2WWCA 1ITCA 4AEFA 1E6ZA 4L4PA 2CXGA 1FH9A 5CQ1A 1UHVA 1UKPA 1SMAA 2YLLA 3WH6A 3CLWA 1CECA 3VGHA 1RH9A 2G3NA 1H3GA 4MB1A 1JF6A 2EQDA 3VMPA 5JBFA 1PX3A 1EQCA 1UR9A 3BLKA 3MMDA 1DWIM 4P8XA 3T0AA 4PSRA 4HMCA 5HBFA 3ZM8A 2J7EA 1XYFA 2CNCA 2G3IA 1V0NA 1OIMA 3ARVA 3CHDA 2OWCA 4D6DA 1VFMA 4IISA 1QWUA 1I1XA 2YA0A 3AHYA 1XSKA 3PHAA 4W87A 1LG2A 3WELA 4AZCB 1XV8A 4FLQA 5M5DA 1JG9A 3SCSA 2A3HA 4UOQA 3PZOA 1E70M 1Q6EA 3GYCA 3N11A 5FOOA 5IXEA 1RPKA 2QPSA 1R47A 3VSUA 1TQUA 5CLTA 1EO5A 2DH3A 4MB5A 1KQZA 1VJZA 1QOXA 1PJ9A 5A8MA 3AS2A 2J8FA 4PTVA 4DWSC 2FGZA 1HTYA 4EAMA 3RJYA 3PZQA 1R75A 3N1AA 3VGEA 4W7WA 1ZS2A 3SCPA 7CGTA 4D71A 2ZUTA 1J18A 1E6PA 2CBJA 1QNPA 4W7VA 3WY3A 2VQTA 1QBAA 1XRVA 3PZTA 5FCZA 1M01A 4L4OA 5BRPA 2YA1A 1SFSA 3T0DA 4NZFA 3NCOA 1UWRA 2VOTA 4NZCA 1MXGA 1J0IA 5CG0A 1QWNA 1JD9A 4PMVA 2C0HA 1B9ZA 4MTVA 3T0BA 1BLIA 4NXKA 4KRTA 3PZGA 4UFMA 4MNJA 1W9PA 3VDAA 1TQTA 4QLKA 4GZIA 3L4TA 4FNPA 2VURA 3RCNA 4AISA 1UD8A 3AYSA 5TD4A 4M56A 2XGIA 4W84A 3ZIZA 3VDCA 3CUGA 3EBVA 1B3ZA 2X8RA 3ARPA 2E4TA 1U30A 4PMXA 1QHZA 2XJ7A 2NT1A 3ARXA 4A3YA 1CGYA 2ZUMA 3W81A 4U3CA 1UOKA 3WKZA 1C91A 3RM9A 3K8LA 3W37A 2PB1A 4J28A 3U5UA 5ABFA 2V3GA 1KGWA 4E2OA 4AD3A 3AHTA 4AIEA 2EADA 3AOFA 1UA3A 4KH2A 1NOUA 3A22A 3MUY1 2J7DA 3BMVA 4CD4A 1JYVA 2O9RA 1KCLA 4HOZA 3VMOA 1CWYA 1YHTA 2CKRA 1NWRA 1US2A 3OBAA 2BHUA 2QF8A 1WZAA 4J3WA 1EO7A 3EDDA 3VM7A 3AS3A 1JIBA 1R87A 5A2AA 2JALA 5D9NA 1Y7VA 4TX8A 1CXKA 4JFSA 4B9YA 1D3CA 5M3WA 3PZ9A 1ISYA 2GSJA 1M03A 1IV8A 1WDQA 1U33A 4AD5A 3WMSA 2UY4A 1VBUA 3FXYA 3GNRA 5E70A 1CYGA 3AXHA 4DUXA 2WYSA 1QW9A 2IUZA 4LXFA 1JZ3A 2BNJA 3ARTA 4OUEA 3EMCA 1V6YA 4UZSA 2D0GA 4JAWA 2VRJA 4U5KA 1SMDA 4NF7A 4AMCA 1C8XA 4P7OA 1DHKA 1E0WA 2YDQA 2XUCA 4CU6A 3WY4A 2EAEA 4JCMA 1HJXA 1W91A 4A4AA 3VSTA 1MVYA 2ZXQA 4NZJA 5A1AA 4ZENA 3FN9A 4J7RA 1HJVA 3BCFA 1J0HA 2GJRA 1JDCA 3AIQA 3WN6A 1P6WA 1LG1A 4CCCA 2E9LA 4R27A 4H2CA 3GH7A 4OOUA 5HNNA 3WNPA 1UUQA 3NDZA 1JNEA 4XUYA 1J0KA 4BQ5A 2CITA 4PSPA 4MAVA 3M46A 2VR4A 3CMGA 3SUVA 4PCTA 2G41A 4LYQA 5LYRA 3SIMA 2WPGA 3T2QA 2W4XA 1WE5A 1UWIA 1CEOA 3N15A 2DSUA 3CTTA 2J77A 2XGBA 5LA2A 5I3DA 1KQYA 4UNIA 5BXRA 4MNKA 4ZEPA 4KMQA 1K6AA 2Z1SA 3AIRA 5CGMA 5A6BD 2YDRA 4M8UA 3DYPA 4AC1X 2VCBA 1W1VA 3KEHA 1UWUA 2FDMA 3UR8A 1EA9C 5I77A 1AMYA 2AOSA 5IHRA 2WMHA 1WPCA 2JIEA 4E4PA 4JKLA 4BQ3A 2X05A 4PN2A 2ZWZA 3ECQA 3VIOA 4GIAA 1HJQA 3WEMA 1J01A 3VO0A 5EFDA 3W0KA 3ZSSA 1W1PA 2ZUWA 1VJSA 2J75A 2E40A 3TP4A 3CUFA 2WNWA 5FD0A 4IPNB 3EJSA 3WUFA 3GNPA 3EYPA 1GVYA 4QCFA 1CGXA 3BGAA 4V2XA 1MXDA 2WW5A 2X2JA 3RIKA 3K1DA 2Y2WA 1GOOA 1J0JA 4W86A 2E8YA 3A3HA 3PZIA 4CN4A 3WFZA 1VF8A 4TOQA 1QHOA 2BXYA 3ZR5A 1E6SM 3DX3A 1BHGA 1ZL1A 1HT6A 2ZXDA 3W25A 1VEMA 1NOFA 1ZU8A 2XVKA 5HDRA 1W9UA 1V6UA 4DWSA 3QHOA 2WCGA 3VIFA 3ZT7A 5IFPA 3IAPA 3VGBA 4D72A 5IDIA 1ZB5A 2ZUVA 1SR0A 1G5AA 2WC7A 3GXIA 4W8AA 3AYRA 5ABHA 3VSVA 1XD1A 5HXMA 1UASA 2CERA 1BF2A 4QLJA 2WBKA 2WVUA 2B31A 3N9KA 4JL2A 3WH5A 3UG3A 5CPQA 1JD7A 2DT0A 2J47A 2WB5A 3ZSTA 1GOMA 3SUSA 3GXTA 3LXBA 3WUBA 3F4VA 2GDUA 4B3LA 2WANA 3T08A 4IM4A 5I0DA 1B3XA 3THCA 2XFYA 1E6QM 3OLGA 3D50A 3NSNA 3L4XA 3AROA 5BYWA 5CLWA 2WZIA 3J7HA 2ZE0A 1AQMA 3TTQA 1KBBA 3OLEA 5A94A 1V6WA 3RPMA 4J3VA 4AD4A 4DO5A 2PWFA 3M07A 5A8OA 3WDRA 3OGRA 3VDHA 2WAGA 2O9OA 3AICA 3W26A 1OCQA 3O9NA 1DTUA 3AZRA 4RL3A 1JAKA 5FL0A 1GJUA 4D6IA 4PYSA 3SUUA 3WD4A 4EK7A 4B9ZA 3BSHA 4HU0A 3NDYA 1CTNA 3WEZA 1PZ2A 3TTOA 3ALGA 5ABFB 1E43A 1XCXA 2W61A 2VUYA 2VZVA 2FHBA 1UD2A 1W3LA 2VT0A 1EDTA 1CIUA 3EJRA 4P7NA 3CZKA 1UKOA 3LPPA 3GH4A 1UR1A 3W24A 2W67A 1UZ1A 3N13A 1R46A 4AYGA 2BFGA 3CPUA 3NSXA 4GI8A 2WWDA 4EANA 3CO4A 3UEQA 2HVMA 4Z2GA 1WCGA 1LL7A 3TONA 3RILA 3VIIA 3FHAA 2YIHA 1VENA 4ATWA 4CVWA 1Q6FA 4E8DA 1WNOA 4AIOA 5ABEA 3BAYA 4B15A 2RGMA 1M53A 2OYMA 1W32A 4W93A 4D6FA 2FE0A 2NSXA 4UQEA 3WENA 1TQSA 3G6MA 1HF6A 1HN1A 1GPFA 5M03A 4AZ7A 2MANA 2WVVA 4X0VA 2VRKA 3DX1A 1JZ6A 4LX4A 3LX9A 5JBEA 3BUPA 3AMGA 4CD8A 3FNDA 1QNSA 3W29A 1B31A 4UR9A 4GI9A 2VZOA 5A6MA 1XSJA 4MB4A 2WZHA 4Y7EA 3K8KA 3AXXA 2PBOA 4PMYA 5D9PA 2WHLA 4WSKA 2EABA 1JFXA 2BVYA 3H55A 3K4AA 3GXPA 4RE4A 3ALFA 2CHNA 1UA7A 5C70A 1C90A 2ZX9A 1DP0A 4HU8A 3BUBA 2BS9A 2GUYA 1E4LA 3EDEA 4A3HA 2QMKA 4AD0A 2EACA 1CXHA 1WZMA 1G9HA 2J7BA 3VIPA 4Z2IA 4J3UA 3VKKA 3VIMA 3LXCA 2Z1KA 3QOMA 2DSWA 3B8SA 3WDJA 3GXDA 4S3KA 2OWWA 2PI6A 1WAWA 3ZO9A 3UERA 3FW6A 4FNUA 4Z2LA 2VJXA 1XYZA 3FAWA 2OW7A 4JFWA 3VDBA 5A8NA 3AIWA 2WLZA 2AAAA 3UETA 3VIKA 2FH8A 1UQYA 1BPLB 1E15A 2QPUA 1G0CA 2VNCA 4J27A 3NUKA 4JIEA 4Z2JA 5EMYA 2A3CA 4MADA 4PMRA 2VRQA 4V27A 5DF0A 1KCKA 3PZMA 2E9BA 5E09A 4PTMA 4QDMA 1ZBVA 2G8ZA 1GW1A 2CEQA 1ODZA 1ZBWA 1WB0A 4NXSA 2X0HA 3AIVA 1GQIA 4DO6A 1XGZA 1ZBKA 2V3FA 2WKLA 3A4XA 4FMVA 4UOJA 1R8LA 3WF4A 1PAMA 2G3JA 4CCEA 1UH3A 4U31A 3PTMA 1SYTA 2DEPA 7TAAA 2D20A 2GJXA 3W27A 3HN3A 3UG4A 4QCEA 2O9TA 4AZ5A 1C93A 3MUIA 1HKKA 1QI3A 4ZXOA 1OD8A 3WQ5A 1OGGA 2E9MA 1DWGM 1UD4A 1V3KA 2JFEX 1UKQA 3PZVA 4BF7A 1C3FA 2Y24A 5D9OA 1TQWA 5A2BA 3MKKA 2GDVA 3BVVA 2CBVA 1E6NA 4LYRA 3WD3A 4F79A 4BQ2A 1W9DM 4MJ4A 1QVBA 2DT3A 3VOCA 2O92A 3L2MA 3OA5A 2PBGA 3WNMA 3ARQA 3PTKA 4M1RA 3BAXA 3AS0A 1E9LA 4XZBA 4F8XA 3DX4A 1EH9A 5I2UA 3ARUA 2F18A 5I23A 2XYLA 4PMNA 1CLXA 5A6KA 1W3JA 1FP8A 4QFUA 5C8BB 1BVNP 4QP0A 5HPCA 3CMJA 3FAXA 3VU2A 2XWDA 2JEQA 3W38A 1K9DA 1B3VA 4CKQA 1TQVA 3MANA 1F4HA 2WMKA 1BYAA 5I78A 1W1TA 5KZ6A 3AHXA 3AMLA 2F8QA 2VI0A 2F2HA 1N82A 1V0KA 4HPHA 1TA3A 4KWUA 3AHVA 1QNRA 5E0CA 5A3HA 1GHSA 3IJ7A 5CSUA 4C7GA 1QW8A 3HMCA 4MDOA 2WCSA 1OIFA 4UQCA 1OT2A 5I5RA 3ZJ8A 3ZJKA 2D2OA 1H5VA 1A3HA 2OWXA 2YL6A 3KLKA 4JCLA 4W88A 3T2OA 1V02A 2BY3A 4YHGA 4Z2KA 3AZSA 3BVTA 1OM0A 3SCTA 1EIBA 4HOWA 3KL5A 3CUHA 4HMEA 4OBSA 2D3LA 3A5VA 4MB3A 3WDPP 1OWQA 3BC9A 1HL8A 3GH5A 3TA9A 1QI2A 4UQBA 5I6SA 1WP6A 4CD7A 5CPSA 3HG5A 1V0MA 3AIUA 3MUAA 3OG2A 1DWFM 3NJ3A 4P8UA 1E0VA 3DHPA 1NARA 3CZLA 1V03A 1V3LA 2YFOA 3BUDA 4OZOA 2EPNA 1JFHA 3I3EA 3WF0A 2F7OA 4UFJA 4AMXA 3AMKA 1WO2A 6CGTA 2J62A 1ISZA 3ZMRA 1PX8A 4TVUA 3AISA 3AIBA 1GQJA 1J9YA 2WC4A 3SCUA 4UCFA 1MQRA 1OGSA 1EXPA 4C7DA 1UKTA 1UWTA 1CBGA 3BUIA 2BVTA 3WD0A 4W5UA 2WVTA 4PTXA 1CGWA 3WL1A 1HVXA 3H54A 3II1A 1B1YA 1NWSA 4W5ZA 4WIWA 2YKKA 1E4IA 1Q4NX 3BAIA 1E6XM 4AWEA 1VEPA 4DUVA 3N18A 2UWFA 4W85A 1HJWA 3W28A 5E6ZA 1BVZA 2QLYA 2X2YA 2VX7A 1PS3A 2VVSA 3WDIA 2W92A 1OGBA 1WDSA 4AZHA 1MWOA 1MW0A 2YFNA 2WC3A 1J12A 3N04A 1GNXA 5ABGA 1D2KA 4D6CA 4FK9A 2G3MA 2F61A 2J7FA 1E55A 2CBUA 1QHPA 3KL0A 5E9AA 1KWGA 1PZ3A 1OINA 3MUZ1 5CGTA 1EQPA 2F1BA 1OD0A 5M17A 1HXJA 2OYKA 2BVDA 1YQ2A 2DH2A 1KB3A 3CZ8A 1PX4A 2WHMA 5JIWA 1TUXA 3VINA 1T0OA 1UKSA 2BY2A 3UESA 1JL8A 1OT1A 3FY1A 1QI4A 2YL9A 3WNKA 3AMDA 2YLAA 4AYSA 2X2HA 2XTKA 2JEPA 5BXSA 3BVWA 3N17A 4P7QA 2WZEA 3WH9A 3MI6A 1PBGA 3EJUA 3MV11 3DYOA 3E1F1 2E8ZA 2WSKA 3LRKA 3LRLA 3VGDA 5BCAA 1BG4A 2WSPA 1X1NA 4FLOA 3O6AA 3CHCA 1E6RA 1G94A 1GOKA 1BQCA 2WMGA 5AC5A 5IFTA 2ZX5A 4YPJA 2YBUA 1R7OA 4B3KA 3LMYA 2DPEA 2WKGA 3WMBA 1CPUA 3OZPA 4CD5A 1RD6A 2YA2A 3OGVA 1V0LA 1V3MA 5LA1A 1WDRA 1TG7A 3EMZA 1ISXA 1BYCA 1JZ8A 4BZYA 2VX5A 3VNYA 5BWFA 1UWQA 4AZ6A 4H41A 2WXDM 2XFRA 4J3SA 3KLLA 3D52A 3VIGA 4CN6A 1GOQA 4TVCA 3A6OA 1LL4A 1V3JA 2FHFA 2GJXB 2W63A 4PUDA 1FH7A 4CN1A 5DT5A 2VC9A 4FNQA 2OW6A 3WF1A 2Y5EA 3W53A 3AI0A 1PIFA 4KGLA 4WF7A 2UY3A 6TAAA 2J4GA 4TTGA 4HMDA 4Q7NA 5AC4A 4NRRA 4UFIA 2D1ZA 3APGA 3HG3A 2V38A 4Q22A 1BAGA 3TV8A 2EPOA 1QNQA 2UY5A 5EBAA 4JFUA 1HJUA 1X6NA 1E73M 2DIJA 3EDJA 4TUFA 1LJYA 1KXQA 2VCCA 3CUJA 5I79A 5BXTA 1W9BM 3GNOA 2W5FA 4U3AA 3RM4A 2NW0A 4CD6A 3S5ZA 1A47A 2W62A 1GVIA 4U5IA 2WM0A 2IXUA 1UR0A 1E1FA 4JFTA 1ODUA 4H8VA 1ITXA 2XIBA 1H11A 2X1IA 4D6JA 4TVDA 2J74A 2PWHA 4URIA 1TZ7A 4WKHA 1VIWA 3LPOA 7A3HA 2ESCA 1E3XA 1Z32X 1CENA 5DT7A 1JAEA 1MW2A 2XM1A 2FGLA 3QHMA 2CBIA 4W89A 3WQVA 3G6LA 4BCEA 1C7SA 2OLHA 3MSDA 1TA3B 1KBKA 3B9EA 3W6LA 1UD3A 1XCWA 3H53A 1RP8A 1ISVA 3AIEA 4IUGA 2GK1A 1BSIA 1CDGA 4AIUA 5KEZA 3IAQA 9CGTA 3DC0A 1NOWA 3WQ6A 1W1YA 1W9VA 4FF5A 1KXVA 4FLSA 1DEDA 1QI5A 3VD7A 2F7PA 5GNZA 4GZEA 4JFVA 3WQ4A 1KGXA 4OJYA 3CHEA 3IJ9A 1JYXA 3DECA 1Q6DA 4M82A 4MPKA 1TR1A 1JZ7A 1MYRA 4OGZA 4H8HA 5A6JA 4F66A 3OGSA 1VAHA 1M7XA 3QOKA 3SUTA 1UQZA 1UR2A 3VIJA 3RDKA 1E4NA 3GBDA 4PMUA 4RE3A 4LYPA 2F7RA 4DO4A 3LRMA 1ZBCA 3EJQA 1E4MM 1HKJA 1WKYA 2W66A 4OIFA 4UQ9A 3AFBA 1JNDA 1S46A 3CIVA 1EHAA 4M29A 1EGZA 4R5EA 4CU7A 1O7DC 4GQRA 2Q8XA 2BY1A 3ZR6A 4FNSA 1FH8A 5AYIA 1HL9A 4HZ7A 4EE9A 5AY7A 4PEEA 4ZXLA 4AZIA 3A47A 3F5KA 5HPOA 1E5JA 4AD1A 2XVLA 1DWJM 5A8QA 2CPUA 1NP2A 3WDQA 5GPRA 1QNOA 1GONA 2EPKX 1KFWA 5BRQA 4KRUA 2F7QA 2ZWYA 2XIIA 5A6LA 2EO7A 4PUEA 3MU7A 3VUPA 1H4PA 1MW1A 3I3BA 3NIYA 1B90A 3FHQA 1HJSA 4KGJA 1UYQA 4JKMA 2DSVA 4PMZA 3VPLA 3WIJA 3ZQ9A 1J0YA 3AHZA 4H7VA 2E0PA 1JZ5A 2OSYA 2ZX8A 3UCQA 1XSIA 3BLPX 1KWKA 2FHCA 1IZJA 3L4WA 1D7FA 1RP9A 2CHOA 3B9DA 3S5YA 1JDDA 3AQUA 3RO8A 2V5CA 1MFUA 2WMIA 1TCMA 1W2VA 4UZUA 3POHA 1UD6A 5DO8A 5E1QA 4FNTA 2D24A 1JDAA 1O6IA 2WVSA 1ECEA 2J7CA 3WDHA 3L4ZA 1HP5A 3S2CA 3T2PA 1HWWA 1LQ0A 1LWJA 3GXNA 2ALWA 1V02E 3WUGA 5FIPA 1H1NA 4HA1A 3F5JA 2PF0A 4HTYA 4C7FA 2J7HA 4MNMA 3ZJ6A 3TOPA 1LLOA 3U57A 1JF5A 2YL5A 2O9PA 4E8CA 2VVNA 3A24A 4NX0A 1R7AA 4PMOA 3IANA 4ACYA 5JBDA 2DGAA 1I1WA 1KXTA 4BA0A 4N0RA 4LGXA 1XH2A 1L0PA 1BYDA 3OIHA 4TXEA 2JF7A 4NI3A 3SUWA 1V6VA 2C7FA 2VO5A 1VFOA 3BH4A 4WKAA 2CYGA 3B9AA 2OSWA 3U7BA 3WL0A 1JYNA 3L4UA 2GJPA 5GQBA 1GOWA 3BAKA 2FYVA 4M80A 3WF3A 4FNRA 4DWSD 1AQ0A 3CZSA 2JE8A 3PZNA 2ZUSA 3WEOA 4U33A 5D4YA 4ACZA 1CXFA 3WFLA 4DWSB 2BV9A 3MV01 3EJTA 1U2YA 1IZKA 4WK9A 3VD9A 2UY2A 1OB0A 5FL1A 3WY2A 2OSXA 6A3HA 4YN5A 1H0GA 3D3AA 1GHRA 4HA4A 2X0YA 3SCOA 2E3ZA 1PEZA 1WZLA 4EKJA 1GCYA 2X2IA 2WBGA 3WSUA 2XN1A 1K9TA 2EPLX 2WHKA 4V28A 1F4AA 1EDQA 3VGFA
chains in the Genus database with same CATH superfamily
4WEMB 3OX8B 3WUEA 3EHBD 1EUUA 1Q1JH 4NKOB 3HS8A 1H0IA 2KMWA 4ONGL 1OHZA 2W27A 5E0KA 5L2JB 3F62A 2NY3D 2JCCA 1IM9A 1URIA 1S2TA 4PMQA 2CRMA 1XDTT 4UILL 1TVNA 43CAA 4FQCH 3ZIMA 3M0LA 5E7FA 3ZUCA 1B0WA 5D37A 2VMCA 1PWLA 2BK8A 2XTJB 2NY4B 5BROA 2E7FA 3TT3L 1NP0A 5HGAA 1N0XH 2H6PA 2HWGA 3FL7A 2YUVA 4MVAA 2UX6A 4MCYB 1ZTXH 1SDAB 4JMNA 4PMJA 5FK9A 2D0HA 4UTWC 4DT2A 4RPQA 1E4WH 4XRCB 5E5MB 2KPWA 2OMZB 3GJEB 3W84A 2M26A 1BG9A 3EOAB 5LNUA 3BLBA 4LSRH 4G8EA 4CC1A 4LB8A 1QPKA 2WZPD 4ISVB 3FO2B 3QZPA 4WJ5A 1IFGA 1GGBH 2FH6A 2ADFH 3PPHA 2X40A 3GS7A 3HE7D 1S7XA 5JPNA 2CRZA 3GNDA 5CBJA 3HJEA 4PVNA 1Z0NA 1F07A 1IM3A 3ONCA 2OELA 3TQ0A 1JNNL 2VHLA 1Z0MA 2OJZL 4PJGF 1LROA 4JLRA 1S5IH 4Q6IA 5JA9A 1X38A 5C0QA 3FU5A 3QM3A 2LAGB 1F8MA 4U4IA 1CXEA 3VGGA 4AH7A 4A7UA 4GSXA 4X83A 4JUSA 1NSNL 1XMEB 1KZYA 3QIUD 2VZ1A 2IQAA 4E5XG 1ITUA 1ZJAA 1HKIA 1JGLL 2EXTA 5GGSY 1QPQA 3QCUH 3FQ2A 4XKMA 1O5QA 4IKIA 4O16A 2A4AA 4G6KH 5GS1C 4M00A 3HI6L 1XCFA 3DUGA 1IGJB 3JWDH 1X96A 2BSEA 4GC3A 2AC0A 3SY1A 4LCCB 3S35H 3KS6A 3PHOB 1T3FA 1TZIA 3CSPA 4GP5B 3RG6A 5CN3A 5TFSL 4KI5D 3BUTA 4G72B 3IGAB 5FJRA 1NM9A 1U8MB 2VLKB 1ZUAX 3CYVA 4XTRD 4PWEA 4YS1A 5KSUA 3N5AA 4Z08A 4I2XE 1W1ZA 4G9FD 4XVUD 3T81A 1OOWA 1DDTA 5C9XA 1H15B 1YC7A 1EAPA 1E3FA 1BGGA 3BEWA 5FFGA 5J6GA 3LGEA 4AITA 3HN8A 5JW3L 1FHVA 1CT8B 1MEXH 4AY8A 1ECQA 5FV1L 2D7TH 4R0LA 2VAAA 3LEVH 2CLZA 3IGUA 1BVOA 4IGBC 4Z3GA 4JJ5B 3D85B 3ASWA 1IEXA 2J9YA 3L3KB 2YGOA 2FATL 3K13A 5ANMA 3DN5A 1W16A 4IRJD 4F7CA 4MY9A 3HI5H 3OEXA 3VOGA 3K5RA 3U6RB 3UY8A 2WZTA 4UQAA 1VCVA 1JFQH 3M0IA 3BAJA 1BGAA 1F58H 4FABH 3TYAA 4UTWA 3VM5A 3FUMA 3NVDA 3KVDD 5C0AB 4LKXB 2ZOWA 3DIDA 3LNGA 3DX6B 3DVNB 4FOJA 3NPZB 1I1CA 5I0YA 4YHYB 3FF8A 3FFCB 3PWLB 5CHNA 1R0AL 3U4EA 4WLCA 8CGTA 4MIMA 3P11L 3ZZQA 5HI3C 4BZ1L 4IEFA 3RUGB 1FDZA 1I60A 3T09A 5J3HD 3SO3C 2GPZA 5JH1A 3HNVH 2XFFA 3KLDA 4G2DA 1QRKA 5C71A 3WQOA 1D8WA 3BCJA 2C3HA 1Z66A 4PH6A 4ES4A 2GPTA 1C8YA 1NGYA 2Z7YA 3SE4A 1ZGLB 3CZJA 3CFJA 2YBTA 1OSEA 1HKWA 1QWGA 5C07B 3ZLHA 3OBKA 1Z41A 1E9YB 3S1UA 3RVUC 1U8KB 4Z76B 3WH6A 1OAZH 5C0BE 5E95B 4IIHA 3CFCL 3FU7B 3KG5A 2MHAB 5SV4A 2G5RA 1DQQB 5F89B 5IGXL 4PD4K 5DD3L 1RVKA 2XU9A 4FLQA 1LOSA 3U2SA 5INDA 3GYCA 4BA8A 2QV5A 1RPKA 2WXOA 4FADA 4MB5A 2VKXA 1KENH 2JB6A 3FQ4A 3MRQA 1BM3H 4ZMXA 1IE5A 4PTNA 4EAMA 1XIHA 3UCCA 1G7QB 4L18A 3E0FA 4UTAH 2ENYA 3T6CA 5LQBH 3NCXA 2EC9T 4PULA 3LHUA 1PYWA 1AQKH 4FOUA 1XFBA 2A7RA 1T1WB 3LDVA 3IJSA 5DJCA 3T0EC 5G1TA 4P5UA 5EO0A 1B2WH 3UAJC 2CLMA 2QAFA 2EUVA 4KXCA 1DJGA 2DQUH 5L88H 2JQZA 2Q09A 3SO7A 4RAVA 3RM9A 1F3DH 1JCTA 4O5LH 2OS7A 4XTDA 3BW2A 4UINH 2ADYA 3CB8A 1AHWB 4XMUA 2V8LA 1SQMA 4RNRB 1R87A 5GZOC 4UR7A 1KGJA 3L1OH 3GSXB 4XH2A 4MMXA 2HJPA 1JCMP 5IFAL 1B0RB 4DI8A 4I90A 4X4XA 1QFEA 4S0HA 1U6AL 2NRDA 2B59B 5ALCH 3PAZA 3V0WH 3MCG1 2EAEA 1C12A 4JG1H 4LRIA 4GPVA 4X7CC 3KPRB 4R3SB 2HVJA 3FQRA 3O8XC 5B4MD 4KFNA 5AUMB 3VXSB 4TNVF 1L0QA 4JZJA 2NQZA 1DJHA 4K7FA 1B6UA 3BVDB 1JNEA 4UNUA 4DOHE 2CWXA 3WHE0 3QYSA 5TBOA 3CLEH 4HFUH 2GC7C 1MDAA 5GRJL 4GG6F 3C5XA 5LYRA 5ERWB 4AYEC 4C91A 4DTGH 1PS9A 3TW7A 4ODSH 2I14A 4HQQL 3Q0HA 4LC6A 5BXRA 2ISVA 4JDEA 3KVKA 2Z1SA 4Z1PA 4O1AA 2H32H 1HYSC 3CH1B 4K8RH 3NJVA 4TOYH 3BWUC 2OZ0A 4H9MA 3D2UA 4XE0A 3IPEA 4FQ2H 4YO0B 1FTXA 4U6VH 3EJZC 2E40A 2BSRA 2F58H 4IDJL 2G97A 3QEQE 2N7BA 3WUFA 4LAZA 5SWSB 4B5VA 3O3BB 3TVMD 4F7KA 2IWGA 2HB0A 4QRPD 2DQTH 1MIEL 5J11B 4N2BA 4DN1A 1HT6A 1OGPA 4ZTYA 5IVXF 1AGEA 4XAPA 1XX9C 4PUBH 3F4DA 2X4SA 3G04B 3PGDA 5FYLE 3ZVVA 4HIHB 2LU7A 3LZOA 2B7OA 3QWQB 4IL2A 4HUMB 4M1DL 4O8AA 1C08A 2B31A 5DQDH 3BP5A 4KNTA 3L5LA 4JFDE 3LIZH 3QNZA 2QCNA 3UA3A 4DVRL 2P3EA 3C86A 2RB8A 3QAZC 2PYED 4FP1A 4HUXB 3WIFA 1NCDH 3T0EA 2H3NB 4AH2B 4QOKE 3UNTA 4L0YA 1P2CB 5IB1B 4HIJB 1HZHH 1COBA 1V6WA 3RPMA 4JNYA 3ASOB 5LXGH 2ZVIA 4XMLH 2PC4A 3MJ8A 4PA8A 4D6IA 5EEVA 2DP3A 4FQPA 2JCCB 4HKBB 2P4AB 4WNQA 5I74B 4UTBH 1PZ2A 4IHCA 4NZUH 5ABFB 4PBFA 4X0KB 2B77A 4KS0A 1OX4A 1HHIB 2CKBL 1OE1A 3LNFA 4BKTC 1NIEA 3FCPA 1AQFA 2BSDA 3FFDA 2X6VA 1TETL 1V27A 4O10A 3OM3B 5E5RB 3LPPA 5IROD 1UR1A 5HGAB 1FFPB 2H6PB 4YBLC 2HSAA 4GI8A 3QIBD 4ODWA 4MBRA 4NWTH 3T65A 3CO4A 2W80C 5FK9B 3TA3C 4ATWA 2DQIH 4QGYA 4G1MB 4AVOA 1GR7A 4L4TA 2FE0A 3O8XA 3FOMB 1NM4A 1A3LH 2ID5A 2ALRA 4GVIA 4WHTA 5CP3H 1R17A 2XRAH 1JZ6A 5DQPA 2F6KA 3QDAA 1WYIA 4Q8UA 1MUCA 3P9MA 5E1AA 3ZHFA 3Q2DA 3G18A 1S9YB 1VCBC 5JPNB 4LEFA 2J4WL 1IM3B 3C6LC 3TQPA 2ENSA 1EL3A 3SY0B 1NFIB 5BOOA 4M1GL 4JLRB 4Q6IB 4PB0H 4DKFL 3NZUA 5CMAB 2X4NB 4B53A 4L3ED 3TIMA 3CN2A 5DURB 3GXDA 1WV2A 3USBA 5HDBB 1NY1A 2IQAB 4Z3JA 1E15A 1FIEA 3SBRA 1KIPA 3CSTA 3KBHE 4S1RL 2ZC1A 1AH1A 1X7IA 1QO3A 1JK9A 4YWIA 1ZBVA 4BCXA 5F9AC 3CWNA 3SODB 4TXVB 3A4XA 1INDL 2WKJA 1TYRA 4Y4HA 2LHAA 2FWSA 4U31A 1TZIB 1DQLL 4QHRA 2YD1A 4X4MA 2FJFA 2OZ4A 2R0LL 4AZ5A 3ZGIA 4LEBA 1JRHH 1QI3A 1FWFC 3GTIA 2ZAIA 3OXRA 4J1UA 4DK3A 4E42B 5HYJA 2P9RA 3X1BA 3NDZE 2DMBA 4MFEA 1ZLVH 1CVSC 2TSBA 4MHHI 3K2IA 1YECH 4FFZA 5B39B 3H56A 4NQED 3NIGF 5KSUB 4D8ZA 1KCRH 2R51A 4FC3E 4KI5F 5AL8A 1KBLA 2Z27A 1NWOA 1E9LA 3PJUA 5I6OA 4GP8B 4E41B 1OARH 2N4IA 1AYOA 4DJED 3KHDA 3GFZA 3S2LA 4DUOA 3GHEL 4OD3L 3L5XL 1EAPB 3BEWB 1RJLB 2N0MA 5J6GB 1TQVA 3TW9A 1N82A 1DQVA 1IVTA 2PLJA 1AC6A 4MSSA 5I3JA 1OCJA 2VAAB 5LBSA 1EMTL 2CLZB 3ZJ8A 1A3HA 4ZBCA 4G6MH 4AVHA 3JSSA 4O58H 4HUNB 2DM7A 1AXSA 6ALDA 3AZSA 1F6KA 4L6DA 2D3LA 4OLZL 4H44C 5ANMB 1TV4A 1OWQA 4YLQT 3NSCA 3JV5A 4U3SA 5FGSA 4AQ1A 1UZ6F 4P8UA 5T33L 4FXSA 3V9CA 1OTUC 2AXJA 1JFHA 3HRZC 4WI9A 3EOYG 5KSWA 2O0TA 3VW3H 2WTPA 3UCRA 1J9YA 2SFPA 3E8UL 4C7DA 1UWTA 5CHNB 5IK3A 4GNVA 3U4EB 4IYKA 1R4XA 1VEPA 4ORGA 4I18C 4W85A 1NDVA 4IEFB 4G9PA 2WNZA 4ONHA 4ZD3L 1PO9A 3GPSA 3V6OC 1IGMH 3C6LA 1J87A 2YPVH 1KCZA 3PHQB 2Y36H 4IJBA 4GGBA 3I6TA 1JXDA 1NGYB 2CBUA 3CFJB 3PDOA 2GQ8A 3G5EA 2R56L 1AUSL 1VKFA 3BAEL 1NOAA 4FG0A 2HSIA 3KAOA 4OSUL 1QFPA 5FYKL 3ITTA 1KB3A 2R69L 4F58H 2W94A 3D0LB 4OFDA 2QULA 4QRQA 3WNKA 4R4ND 2GL5A 3R8HA 3WSQH 5HWJA 4XWOC 3WFHB 2WZEA 4S0TD 1TZHA 5GS1B 1ZJHA 2E8ZA 2WSKA 3VGDA 4HIXL 3ZE1B 5C8JA 2AXFB 3FCGA 5INDB 1R7OA 4HWZA 3OGVA 1MQ8A 1TR9A 2ZTBA 2JB6B 3OR6B 3MRQB 2ZADA 3JZEA 4B9IA 3DHJA 1YNPA 4J3SA 3ME3A 1LO0L 1CF8H 1PL3A 3BXNA 4YFEA 1I85A 2OJ1A 3JWNG 4CN1A 3D3VE 3HOGA 5D1ZC 3MMTA 1PYWB 3BE1L 2OW6A 3CWGA 3B2UC 1A7OH 5MF5A 4Q7NA 4YUEH 2IGLA 4PUJA 4G7SB 4HU4A 4I3SH 3NCEB 3IJSB 2UY5A 4NPJA 5KANI 2NDFA 4TUFA 4FOMA 1TLKA 3RFZC 5F2MA 5EO0B 1GMIA 1PKLA 2R8SL 3RM4A 2NW0A 4F5CE 2WNGA 4LSQH 4U5IA 4YDKL 1UR0A 4A66A 1ODUA 4DIXA 3PQYA 4X8JB 5CCKL 4DN3H 3S8HA 1E3XA 1VIZA 2H2SD 4LCRA 5ID0B 4WGKA 2FGLA 4IGBB 3ZKXC 4JGJA 3I68A 2IEPA 4WTXA 2H9GA 3FXIC 4GSDH 1E9ZB 1UD3A 4IQHA 4BELD 1CDGA 3RI5K 1BXBA 1W1YA 1W9VA 5F9WC 1RBLA 4XH2B 3G1SA 4MMXB 1MAML 3P4NA 1A4AA 1CD9B 2B7DT 4LGRB 4AAJA 3QPXL 3FT4B 1QPNA 1YTKA 4YTRA 4X4XB 4AWSA 4HWBL 1VAHA 3SUTA 3VIJA 3E3QC 3HVNA 3LKSA 4G43A 3CL6A 3TYDA 4PMUA 3CLMA 5I1GH 2C1OA 4LYPA 2W66A 3IVTA 1VJIA 3U0WL 1X5FA 2HVJB 4GQRA 4FNSA 2FYYB 3QUZC 4JZJB 4I18A 1KG0A 1R3JB 1V54B 4K7FB 1FUYA 4I85A 2GBTA 4LP4A 4WV1A 5DJXA 4Z7WB 3SO3B 5T1LD 1A5SA 2EO7A 3V6OA 1F8TH 4WO0A 4C6CA 1ZCOA 1OK4A 4GH7B 4YHNA 5LO7A 3S3DB 5IFHH 3HE6D 1T8XA 4Y9GA 3RL2B 3M5VA 3UJTL 3VOJA 1IE7C 1NSJA 4LVNC 4JDEB 3AQUA 3RO8A 1HGYA 1MFUA 1W2VA 1FPTH 4UZUA 4MPQA 3APMA 4GRWH 3UTQA 3D2UB 4GIRA 1NU5A 2A6IA 5ES4B 4HA1A 3BW9A 1UPMB 4OZFG 2HPMA 12E8H 4HC1H 1S1PA 3EYSL 4WFHE 2R29A 2YAOA 4IQEA 1NQKA 1I1WA 2CCVA 2ZWSA 1JZFA 3WL9A 3OIHA 5DVLA 1V6VA 4CW1A 1KZQA 1FH5H 4E9SA 1FQ9C 2F15A 4V2BA 2MCAA 1AGDB 1TTGA 4G8TA 5KMYA 1MSSA 5LGHH 3SPIA 3K0YA 3PZNA 3WFLA 3DJTA 4OV4A 4U6XA 1G0DA 2NXHA 1OZQA 2Z6FA 3CIXA 2X4SB 2RQEA 2I5QA 4FP8L 1TKKA 1KF9B 4YN5A 4K3JH 1SXCA 1T66C 5C9RA 4OUOA 1MOEA 4UANA 4M3HA 1X8FA 2WMPA 1C08B 4P5MA 1SO3A 4FEIA 2XFXA 1BWVA 1BBJA 1EDQA 1V8EA 3VGFA 2A7PA 3ABMB 3VZXA 3BOLA 1OCCB 5IHSA 3MRGA 4XCEA 4Z5RA 3WIFB 1QBBA 3T0EB 4B50A 3BKJH 1REQA 3RVXD 4P7RA 3RFZA 4LOUD 2G3ZA 3RCYA 1K1DA 4AL8L 5E24E 2KL6A 5BMFH 3ZDZF 1W3HA 2XTJC 3E96A 2O5XL 2NY4C 3GZAA 3MJ8B 3IMVA 1VGAA 1DSWA 1TX0A 1VADB 3OAUL 2YO3A 3NVQA 2D3NA 3L2NA 2CKSA 4LHUD 4QNWA 3SQRA 3CFTA 5B38G 3H2EA 2CLRA 1BLNA 1OX4B 2RDTA 1RQ5A 3PZUA 1QBMH 3FFDB 1NIDA 2NX5D 3GNML 3DFPA 1AXIB 1UM6L 1AZVA 3O0FA 3L23A 1SY6A 3BJLA 2ZJSH 4M8QA 3BPCA 3R8BB 1ES0A 2FZ3B 5GZNA 3GDCA 2VL4A 5LB1A 3N6QA 4MAUH 4PJFF 1P0EA 4OU3A 4OCXL 5E5LA 3ARGC 2OYLA 1XR8B 4GMTL 4L4TB 3ENEA 3O8XB 3DMMD 2YPLA 3AGVA 1CB2A 4RMWA 4Y89A 3U6XA 4QXVA 1XBYA 5D2NC 3GM8A 4WI0B 3EXRA 1BFOA 3H9SA 4YAQA 2BDNH 2R2EA 4AL8C 3ESUF 2AXWA 2DWTA 5DR5H 2VXTL 4FF9A 2I57A 3OKDA 4XP6H 4KUZH 1MCPH 2CCRA 4KF1A 3MACL 4G42A 1A5OC 4TKWA 4HCFA 1XYMA 4AZCA 2JGQA 2IIJA 1V4YA 2UV8G 4OQ1A 5CEWA 2UZXB 5JZ7D 3HG1E 5HD8D 3MO1A 3H2AA 1AR1B 4H2AA 1O1ZA 2IXVA 1AL8A 3DEQA 1JXKA 2E3VA 4GQQA 2HK0A 4LCCC 3DWTA 4D1JA 1HZYA 4DJFD 3O0LA 1U4FA 1T0MB 3GIVB 4QAWA 1KIPB 1KCVL 4LVEA 4POYA 3M5ZA 1QO3B 3PF2A 1JK9B 3MLYL 5B1KA 5CJQH 3UWUA 3NEVA 2Y9RT 4QE4A 1P6CA 4XC1H 4JQIL 4GPNA 5D7IE 1RJYA 1GW9A 5K4XA 1UR8A 3GXFA 3VU1A 5FW8A 2OMUA 1N64H 2FJFB 1TYEB 4QKXB 2VM3A 3RM8A 1EHKB 3BHBA 4S1SH 4GO6B 4J1UB 2IH9A 2WZ6A 3MP4A 3IDIA 3NJMA 3ENLA 5HDWA 5D7JC 3ZT6A 4QQUA 1GTEA 3KYKL 1FGVH 4DESA 4G5ZH 2WWOA 4O52A 3SQOL 2C3XA 3UBPC 1LWRA 4LCWE 3EFDH 3KWVA 4PJ7A 1NWTA 3LKNB 5AVQB 2FPVA 2I1OA 3N44F 1EXUB 4C6NA 4FQIH 4LBUA 1P4LA 4UV4L 4NYUA 3KYOA 1MCRA 4W6XB 1OVZA 2P5EA 4YXKH 3LBCA 3GSNH 3HZMA 1FP9A 5LA0A 5HNUA 4LSPL 4H20H 4N86A 3H3KA 1UR4A 4AUUA 1QU4A 3M6DA 4A6GA 1UVQA 4JY6A 4R5VA 3STFA 3NJIA 2WNQA 1TKWB 2YEZA 1AXSB 2B1OA 1JVLA 1XB8A 2H1PH 4ECNA 4ELME 3EAUA 1TLMA 1JYWA 1SZGA 4CNOA 3IIZA 4YWGL 4YSEA 4AQ1B 4LCIH 4I9XA 5EZJA 1V7NL 3TA3B 1UWXH 2GJZA 1GQKA 4XXDA 3VX0A 3GS4A 4RRPA 3ARGA 3GHPA 2ZOXA 3S5SA 3F7QA 1DQIA 4PTTA 4C56E 5I0XA 2PWGA 1XD0A 4DPBX 3K30A 1L9PA 4TX6A 1T40A 3FTUA 4GRWE 2EDFA 4R2GD 3CVCA 5IK3B 2EE3A 1QW7A 3IDNA 4R88A 1OCWL 3GJFK 4ORGB 1ETZA 7ENLA 1E9OA 4IMKA 3IDMA 5F2GA 1XBZA 1BRLA 4ONHB 4DGYL 1T0NA 5EUOF 3N85L 4GKSA 5AKSA 1RZ8A 1D7CA 4OV9A 3C6LB 4G8GA 4WCYL 3TO4D 2WLYA 4FS9A 1PYFA 3CFQA 4X4YB 4F37K 2Y1YA 4PWFA 3CLWA 2JJTC 5DJDA 4P2OD 3HC4H 3F7LA 5KUKA 5ISZD 4DAGL 5B7YA 2CKBB 4XB7A 3MCLH 2IDQA 3O9WC 3GUFA 2JELL 2V6HA 5AW6B 5L9DL 2ARJB 3WELA 1ET5A 3PZOA 5IFJA 3G5WA 4QRQB 4PCKA 2NSMA 4PJDF 3A67H 1PNCA 4JDZA 1TZHB 1PJ9A 3AS2A 3QUXD 2J8FA 3A3YB 1EGJA 4KKBD 4QHKI 5C8JB 3PWPE 7CGTA 2AK1L 3MLUL 1T89C 4HWZB 2DBLH 2NY1C 1CZ8H 2J44A 1R9XA 1P0NA 3S37L 1BD0A 3BKML 4ZSOE 3Q06A 1GWJA 3LLXA 3AC0A 1GTHA 4PGDA 4NZCA 1EVUA 1RURL 3ZLFA 4ZW5A 2ZKHH 5FCSH 3CAWA 2QS8A 5GISL 1OP5K 5IV2A 1AFSA 3BXNB 1I0BA 4NC1E 3DVGA 5D7JA 4AISA 3B05A 3M9YA 2GJNA 3UWYA 1PQZB 3W2DL 2ZZ2A 1WUFA 1M05B 4MMZA 3L12A 5EIIG 4QHLA 1ZA3A 2PP8A 3NQ7A 1JV2A 3MV9E 1UA3A 4XXCA 3RWEA 2J7DA 1TJIL 1CWYA 2YUZA 4PRHA 4FYQA 1BXXA 2PLTA 5D7KD 4ZS7H 3PQYB 5HR7A 4WY7H 1TIUA 5E6UB 4RZ5A 4AD5A 3MRCA 5KVFL 2HE5A 2H9GB 5ACZA 2GGIA 4KTYA 4NKDA 2JK5A 3R0KA 3KAAA 2D7PA 2MMXA 1XLHA 2X10A 3DX7B 2QCEA 2XPYA 2FTYA 3QJTB 5LGYA 4AMCA 3P4NB 4NL1A 4IH3A 2A38A 3WY4A 1MRCH 1SZFA 4JCMA 3VSTA 4GUCA 2A6KB 4XNUL 3QLLA 7FABH 4MJIE 4ERSL 2BOBA 4NUMA 4OI8A 2C9AA 1GYAA 1EIXA 3QVQA 3QJXA 3SUVA 1JERA 4BI6A 3MJ7A 4G1EA 4KVCL 3T2QA 3GMRA 4I18B 1QUPA 1KG0B 1FRGL 1DQML 5DJXB 5B1JC 3PG8A 1B3JA 4MRBA 2OL3A 5D7EA 2BERA 4M8UA 4RZKA 4AC1X 1YEGH 4YHNB 5I26A 2V5JA 5IHRA 4LQFH 1WPCA 2J6EH 2F5BH 2JJTA 4PGBA 1NCAH 2IBGA 2FX9H 3GHTA 4IPJA 5J6HA 1U8JA 4D8AA 4FA3A 4XODA 5AZUA 3H85A 4YVUA 2IXQA 4LPUA 1PD1A 4MAYA 3I50L 3UTQB 3A3HA 2J56A 3GU1A 5J11C 2A6IB 2F2KA 3QXAB 3JVGA 2HKAA 1KV3A 4MFDA 2KX9A 1IAKA 3ZT7A 2PXYC 3QRGH 4CW1B 2Y7OA 4J8RA 2AJYL 1QO5A 1DE4A 2DTMH 3FGCA 4YEFA 3AWGA 4GAJL 5CEZH 3BN3B 3ZYIA 4U6XB 2J47A 2ARWA 4F0RA 3ZSTA 2WXFA 2MRYA 3FCUB 3JT0A 3DSFL 3D8MA 1CU4L 4N87A 4Q97A 2XFXB 5D1ZB 4X98A 3TTQA 1BBJB 3N41B 3M1CA 4GACA 5FUCE 4PJAA 2OQHA 3MRGB 1B3OA 3ZKMC 4Z5RB 4O51B 1GJUA 3OIXA 3RFZB 3VXRA 3OXSA 4R26H 5AVSB 3SDAA 5LKYA 4NQVA 2NV2A 4OD2A 5H8DA 4KKCD 1T1YB 4WW2F 1BJ1H 2M1KA 2WUBL 4Y4FD 3LQZA 3CZKA 5FIEA 1HH6A 1RUSA 1BD2D 2B1AH 3UC2A 4AYFA 2XWTB 1R46A 2JI1A 3TFBA 4B96A 1UC5A 5AAPA 2CLRB 1BLNB 4QGTA 2I16A 5F9WB 3TNOA 3B1UA 2VC5A 4P2QE 3CNKA 4JQAA 1FYTD 3BAYA 2JKTM 4OTXL 2EDYA 4D6FA 3QXDA 4HWUA 2NSXA 4M8QB 1Z48A 2FVMA 3BPCB 1ES0B 3QR1A 4KITB 4X0VA 4OCSH 4PRIB 5EN2A 3GEWB 4HEPA 3AMGA 4PRPE 2YD8A 5IB5A 4HF5H 2YPLB 3QUZB 3CXOA 1K4CA 3ALFA 1F11B 4IBSA 4AMKH 4F2BA 2Q1EA 1BFOB 5D9SA 5B3JE 2E59A 5SX4I 2BS9A 3T8LA 2VC7A 2NDGA 3H9SB 2DM3A 4YAQB 4XMWA 3SGEH 4A39A 2VDOB 1AACA 2APBA 3NIDE 4Z2IA 2MIZA 3FB8A 4OLYH 3OKDB 4LVNB 5KYUB 2AAAA 2R23A 1T22A 4QITA 1HHKA 4EUPH 1EUTA 2QVIA 4J4PD 2DWYA 1F00I 3HRPA 5L2KD 2HFGL 4MYPA 3Q8AA 3ET9F 3VQMA 2X0HA 2WQAA 2Z1PA 3G1YA 5F6HJ 2R24A 1AO7A 1UH3A 4S1FA 2Y7QB 5EOCH 1RKRA 3W27A 4P4KA 9PCYA 3MUIA 3KOWA 5FHAL 3EO9L 1RZ7L 4K3EL 2GJJA 2J6VA 2VABA 4NM4L 1FLRH 3K5XA 1QFWI 4FFYH 2A9MH 2OMUB 4F79A 4MJ4A 1BZ7B 1TXKA 5H4ZA 3VOCA 5CPOA 1XXXA 4M1RA 1FWCC 2YW3A 4ADJA 1DVJA 3GIQA 5I23A 3IDIB 3ULUF 1O5PA 2OU4A 1DCEA 3HQ1A 1BZOA 4R7DA 5MEQA 2NNXA 3U2JA 4JY5L 1TTQA 4CJ0A 5HYEA 4DXKA 4PJ7B 1F4HA 1KKOA 2G0WA 5FYJL 3O6FD 3UO1L 4LSSH 1I3VA 3R7MA 4R0LC 4DX3A 5E0CA 1P4LB 2GVJA 2M8XA 2P5EB 1NUDA 3UTSA 4JUTA 3HZMB 2PWUA 4UQ2A 4HQVA 3TQVA 5GGRY 4LKCA 4NKIL 5FM5O 3KLHC 3Q6GL 1IXOA 1EIBA 5F1UA 3WEXA 1UVQB 3LZFL 4DPQA 4JY6B 3NFUA 5ICYA 4JHWH 3TA9A 1K8DB 4KK8D 1XDLA 3BLDA 2RD0A 2FTAA 4YSUA 2Q3XA 2YEZB 1V3LA 4PUKA 1JMXA 1R3IH 5DBUA 2BNRA 3E7JA 1SHWA 1YN6A 3D39B 3L1FA 2Q3RA 3ZMRA 4X9FA 2CLFA 4NQCB 3I75B 1EXPA 2J66A 1AY1H 1F5ZA 5EZJB 4A2RA 4QJ3B 1RV8A 3DXAB 2GJZB 3JTSB 4XXDB 4JG0H 3ARGB 3NZ8A 1RUQL 1LGVA 4KT2A 3W28A 5D72L 2QLYA 5KSBE 2GK0A 1CBVL 3ORWA 5D2NB 3IE9A 3QZOA 4ODXA 3IMBA 5DD0H 4RGNC 3SE4C 1E9OB 5CAKA 2AITA 1U8OA 5DT1H 4U1NB 2W60A 1GA2A 3PWUB 2PCFA 1BRLB 1T0NB 2ENQA 1RZ8B 4OCWL 1YPXA 4JY9A 1YYLH 3CZ8A 1VPYA 3MKCA 1UA6L 3LBMA 1WFTA 3CLFL 5KS9F 5DJDB 3FY1A 3FUFA 4KK6D 3AMDA 1AI1H 4QY8A 3BVWA 1X5JA 3VRIA 4H8WC 3E1F1 3NTCL 1ET7A 4UNLA 2WSPA 4FLOA 5DLML 2GT9A 5IFJB 2WKGA 2H3KA 1THFD 4PJIA 1UT1A 4Y1TA 4JDZB 3PM6A 1I8IA 5GSRB 4BZYA 4L9DA 4H0HB 1XLEA 2HG5A 4AM0Q 3H4FA 2Z1VA 3D52A 5MHSD 2FKPA 1GJPA 4I7UA 2W63A 5HYQB 3FCTA 1LO5A 1HHHA 4PGDB 3HC0B 5TE4H 1EWDA 2BIIA 4HMDA 2P8CA 4J3OF 4PJBF 2CZVA 1F2JA 1ADSA 1F61A 5IV2B 1X8CA 2EPOA 3DVGB 5LZLA 5D7JB 2NX1A 2R94A 4X42A 5EDXA 2NZ9D 2YPIA 1CGSL 5AYXA 3MSRA 1A47A 1XZWA 5LNWA 3VE9A 2WSYA 4AQAA 4MMZB 5DJZA 4V1YA 4QHLB 1ZA3B 1VIWA 1JV2B 2JNZA 3RWEB 5D2LA 4FQXD 5E5UB 4N8UA 1XFPA 3ZE2E 3WQVA 5AYUL 4LHUG 4PRHB 1NCWL 3KZ8A 3H53A 1XCWA 1ZLSH 1ISVA 1RIUH 4RXGA 4MMXC 3DC0A 4JO2L 1UCBH 4ZO9A 2PDQA 1YRKA 4M7JL 1FVCA 2AHIA 4BUGA 4O50A 3MRCB 2DWEA 4P48A 3WQ4A 5ACZB 4NKDB 2JK5B 4XN9A 5C9JB 1P69B 3AG4B 2QVMA 1OAUL 5A6JA 2ERJC 2Y69B 4J9JA 1A9EA 3GBDA 4GFSA 4LRIC 3HE7A 4Z3FA 4DO4A 1FZMA 1U8NA 1ZA6A 1XCQA 1EGZA 1YN7A 1GQNA 4JZJC 4JTEA 3RKDD 5AY7A 4KI1A 1MAKA 4AD1A 5BNKA 1J2WA 4JTAA 1JHKL 1RULL 3N2MA 3VXMD 4L8DA 3S6CA 1TR7A 2P5WD 3B97A 1XF4A 3E6FA 1H4PA 2FDSA 2AW2A 4HJJH 4DW2H 4MNHB 3MJ7B 5A40E 3VPLA 3GMRB 1JZ5A 2X1TA 2YMOA 4ZB5A 3WTTA 1SFJA 1K2DA 2OL3B 3U9IA 4DP8X 1R3SA 2UYLA 1MI3A 5DMMA 3QHZH 4UDTA 2D24A 4UB0H 4HJWA 2VDML 1LTXA 3T2PA 1HWWA 4PGBB 2ZOUA 5JDSA 3IN0A 1H1NA 5J6HB 3KXFE 3HQOA 2DS4A 1EJUC 2DBJA 2IAND 3O9WB 5GJSH 4BM7A 5FHBL 1IBYA 2KKQA 4MAYB 3OTRA 1KXTA 3VA8A 4TXEA 3SUWA 3HMJG 1NEUA 2CYGA 1KN4L 3QB7C 4FNRA 4RBPK 4IFRA 2EYTB 2JE8A 5KVDL 1DDHB 2R0ZL 1IAKB 5JXQA 1IZKA 3RKPA 2YCIX 3L17A 2ZCHH 3WK0A 1HQ4B 4BSVA 2I9LB 3JTBA 3QKEA 1DIEA 2VP8A 1JWUA 1DE4B 2NY1B 3FGCB 3DC8A 5BZZA 1JRHI 3CT2A 1S2CA 1L6FA 4I9AA 1CURA 4PL2A 2Y89A 1HXKA 2CXEA 3UYIA 4ZE4A 5GRXG 2ZYFA 5DJYA 3T8VA 3NAAL 1AHMA 1Q45A 2E27H 3P2BA 4BRJA 4JFXA 5EFIA 4O02H 2O5YH 1ZTXE 3GLDA 4JKPL 4X98B 4IMGA 1TE6A 1VCGA 4UT7L 3L4YA 3CDCA 3TTSA 2E7DA 4BJHA 3GK8H 4IRJA 3CH9A 4XBEL 2MKWA 4OKDA 3LVEA 4JQ1A 4XPBH 2EXWC 3VXRB 1F8IA 2HK1A 4UFLA 3OXSB 4OF6A 4NPKA 1JQVA 3SDAB 3TA6A 1XBXA 2YD4A 4NQVB 3D18B 3LM7A 3VUSA 1PD6A 4OD2B 2HCZX 1QLRA 1S2VA 3NZPA 2CESA 2WQXA 1Z3GL 3LQZB 5DFWH 5AYTA 4OZIF 4WHBA 4AYFB 3VXTA 3ILDA 1UYWH 1W72A 3B5GA 2JLLA 2NMSA 1PCWA 2NY0C 3SCQA 2PD5A 1NVMA 5E94B 1SU5A 3HA1A 4FFVC 5CBBA 3WLLA 5FO9A 4HPGA 2ILLA 3BKCH 3IXTA 3T77A 5DMIL 3FFOA 2EKGA 4Q4RA 3QXDB 4Z7OB 3L7RA 2O30A 1IT9H 3EWUA 4TQTA 2OZ4L 3VOIA 3UVAA 3TN6A 2R1YB 4H1ZA 3IF1A 5T5FH 5EN2B 2VDNH 5BS0A 3B4YA 2XA3A 2QMJA 4WUUD 4DO7A 5IB5B 3AB0B 4MJZA 3BKYH 3HQPA 4FFZL 1IC0A 5IJCC 1I9JL 3UGXA 4XZNX 1K4CB 1POJA 3HR5B 1NQBA 1QX1A 3BMWA 5D9SB 3WMCA 4O1DA 4H04A 1K3IA 1W3KA 3ATBA 3BK0A 2WHJA 2RJGA 1YNLL 2Y4SA 2Z3FA 4XD5A 5CP7A 4M6NL 4L9LA 2XSKA 3ATZA 2MFNA 1E7VA 4ALDA 1AR1C 3FB8B 4G1NA 1JUKA 1AC0A 5D1XD 3QHFL 4MJ2A 1W6TA 3FRPG 5T8IA 3W7CA 4MAZA 4G6CA 4S3JA 2YWZA 3MLWH 3MV8D 2BP1A 3VFGL 2R59A 1MLBB 2R23B 4ZE5A 4RIRA 5LBSL 2YZ1A 1U92A 3VNLA 3KGSA 3IIOA 2F1AA 4OGYL 1HHKB 1RV6X 3WLTA 3CK0H 3HUJF 3BLEA 4J3OG 4DJMA 4PREA 2AGTA 3D4ZA 3SFKA 3BN9D 1E72M 4Y4HC 1U3JA 4P8VA 3GLAA 2PXYB 1NCHA 3AQYA 2BP0A 1NUFA 1AO7B 1R86A 1DVZA 4JY4B 4P4KB 3RG1C 3ARDA 1RUAL 4PP2A 3LYEA 5CZSA 1QNZL 2VABB 1G01A 1WDPA 3GS0A 1FIGL 5F93C 3FTZA 1KFBA 3W9ZA 3MNDA 3RNDA 1NGXA 3WH8A 1CXIA 1GCFA 4BK5A 4AXNA 3FJ6A 1G0XA 2LU4A 5C0ND 4L56A 3S5LA 1BQHA 5K9QI 1GG0A 5SWZA 1UURA 2RH0A 3TWAA 4R7DB 4BFNA 3FO0L 4A2SA 5FFOA 4E9YA 4DM2A 4AZGA 2DLFH 3GF8A 4TV5A 4E3VA 2ZKYA 1IM9B 1MFAL 1Z9MA 1W5MA 1P6AB 4UQDA 4OJCA 3VXUA 1BMZA 4G9DA 1FWJC 43CAB 2EYRA 5CGBA 3UTSB 1FNFA 3FSUA 5D30A 4UQ2B 5DS1A 3W7LA 4AD2A 4LKCB 3QC3A 4LSTH 3J2PA 4KY1L 1W2PA 3S4SA 2V5KA 3T4CA 2J8GA 4V1DE 3M7SA 1GZHC 1JXJA 4Z7UF 3TTYA 5D96B 1W15A 1M1BA 4CCDA 2HISA 3KJ6H 3X3GL 4AQ1C 1AK5A 2FZ8A 4AV0A 3QH2A 4JR5A 4PTUA 2AQWA 5E4AA 3KPSD 2CUMA 3UCDA 4L1GA 3F3HA 5AVTB 3ZT5A 3L48A 5LIXX 2BNRB 2FIKA 4X6FA 4DEPC 3MRLA 1YN6B 4GNJA 3NJJA 3MPCA 2CGRH 2VFEA 4ROPA 3P3YA 1IQWL 3M8OH 2UWEA 4JBSA 3QI9D 3CHQA 3ALXA 4CUCA 4G8EB 4EZKA 4JPKH 1PKOA 5F96H 1PIGA 3CS2A 4WJ5B 2PW2A 1L6YA 3NZ8B 1OTTD 3OB8A 3O6YX 1IBDA 3PUGA 3DENA 2X38A 1S7XB 2GK0B 1L5GA 4GXFA 5HMDA 5DELA 3CL7A 2D2HA 3DHUA 1ITCA 1BWWA 2CXGA 2BXVA 1QPRA 1ORQA 3VGHA 2JIXD 1DBMH 1U8OB 3TVMA 2W60B 4MJMA 2PCFB 1DWIM 4K7YA 4GQ9L 1TZ9A 5DJ0A 1IC7H 1YEFH 4X5PA 1XVSA 1BZ8A 2F53D 3T3ME 2Y61A 2OX1A 3GR8A 3SJVE 3TJIA 2H6UA 3G5XA 2D2CC 3UAAA 5FOOA 1XR2A 2QPSA 4QY8B 2CU9A 2DH3A 3VRIB 4KKZA 1OFOA 3Q8CA 1JQXA 1KLFA 2FFIA 4QRAA 1QK2A 4EPBC 3H2MA 1IGCH 2Q02A 1ZIBA 1T3FB 4PJIB 4B5XA 3AXKA 1I8IB 2YAPA 5BRPA 2WXNA 4JTKA 2VOTA 1J0IA 2HG5B 3TZNA 3QXUA 3HNSL 5FWQA 3R4RA 2Q71A 4LVHC 5FF6A 3G8EA 3T0BA 1I85C 4XO6A 3KXQA 5FUZH 5IUSA 2Z8RA 2XGIA 4W84A 3CQPA 3VDCA 3V5KA 3QZWG 1QAPA 1ADWA 4OFYA 2B0SL 2XJ7A 1HS6A 4U3CA 2WZMA 4XAKD 3DGBA 3NZSA 4AD3A 4GB9A 4AK2A 1M6OA 2P1FA 4DI9A 3TIEA 4AJ0A 3EDDA 4R0LB 3S5NA 5IROA 3S6OA 1NGPH 5DJZB 5DC0A 5I1JH 3GI8L 5D2LB 1IV8A 5LNEA 4ILDA 3WMSA 3LQAC 3RWGA 4OU1A 3DX9A 1GZHA 4TN9A 4F7CB 1M68A 2VRJA 2CK0H 3E9AA 1E0WA 1F6PA 5IG7A 4TV3A 2R29L 4N6RA 2DWEB 4JRYE 1HJVA 2XIOA 4KPLA 2W65A 2G2PA 4AVKA 4XPAH 3RK8A 1T7ZA 3MRPA 1VYRA 1IAIL 1A9EB 4NUQA 4QXGH 2R0KH 1FZMB 1U8NB 1F3TA 5J56B 2FB2A 1XCQB 3RX3A 1YN7B 1YC8A 1WFMA 5TK2A 1B4JH 1MJUL 4WV1C 2WO5A 3S35X 4NSKA 4L8DB 4UDUA 3T0CA 1XF4B 3E6FB 3RN6A 3DZ1A 5GJNA 3FXGA 4TLUA 2NVAA 4HNCA 1FHGA 4RGNB 3ECQA 5LDSA 1K2DB 4KKLD 4F57L 3TP4A 4WGVB 5I1KL 4XVJH 2DQJH 1TTIA 2UYLB 3MWCA 3S46A 1F7BA 3TCSA 2EG8A 5D1QD 1U2HA 2BM3A 1JZIA 1VACA 4WQ6A 1WFOA 3DESA 2NUXA 3KDPB 3RNKA 2I56A 1R5WA 4WK2B 1KXTB 4B9FA 3GZPA 3U2SB 3PFMA 4L64A 1PWMA 1YE4A 3QA3A 1L3NA 3B6SA 2CM5A 4KEZA 2WN3A 4NQEA 1G9EA 1SY6L 4AE0A 1SF3A 1WCQA 1F3XA 2OI9C 4BSVB 3E3HA 1I2RA 1JWUB 4QI3A 4K8GA 3T08A 3C6SA 3M0HA 1WOAA 3VGAC 4WTQA 2GBAA 5KAQG 4DPRA 4ZPVA 5BYWA 2FBJH 2ODHA 3J7HA 4M6OH 4DNLA 1TTRA 3EZ4A 2OCZA 1P7TA 2PWFA 1EZLA 5DJCB 3V0TA 4R7WA 2PTTA 2X4OA 4JFXB 5LGKA 1PW3A 2FLIA 5DUPH 1JAKA 5DYOA 3EJCA 4PYSA 1BGXL 2Q8BL 1PFOA 2VDOL 3B7SA 4AUYA 1BIIA 2VEKA 4HU0A 4HYWA 6XIAA 4RAVB 2YKLL 3RHGA 4K3ZA 2VUYA 1J8SA 1I8AA 1NBVH 5T26A 1PZCA 5I1DA 4ZW7A 1N67A 2AQ1A 4QXTA 4PWJA 4D9QE 3P02A 2PCQA 4K1GA 4PYGA 3RWCA 2ETWA 3THUA 1KBGH 2YAMA 3D69A 4EANA 1E4XL 5AZ2L 1GW6A 5HYIA 4I7WA 5EKYA 4AIOA 1PDKA 1X9RA 4OB5H 5D70H 2RGMA 3VXTB 4TL5A 4UQEA 3MB9A 1CMOA 3FJ4A 2UXFA 5GZNC 5M03A 2ERJB 1YJDH 4IGNA 1C12B 4R5XA 2AQTA 4DWDA 3G6JA 5I6LA 1B31A 3FQRB 4KZCA 5FO9B 3SADA 3IXTB 1IC5H 4YEEA 4A55A 4U4BA 5FF3A 4DFHA 1YMMD 4ICMA 4XPFL 2F74A 3QSKB 1VZGA 3H55A 3OSVA 2CHNA 3GTVA 3OKEA 4S38A 3LH8A 3IF1B 3EFOA 4HU8A 5DRCA 5BS0B 3EDEA 5K2ZA 1LUCA 4MJ5A 4C58B 2ZT9C 1TWZA 1HIMH 2DSWA 5KZDA 1PKYA 5CIPH 1JGEA 2PI6A 2CHXA 4XTIA 4MNQE 4ALAH 3VDBA 4XVSH 3LCLA 2VUNA 5E2VH 5TK4A 3COOA 2NZIA 1QFOA 4GABA 3HV9A 5CP7B 4E8GA 3HTWA 4L9LB 1FWGC 3A3XA 4M3PA 1FY6A 3DDMA 1SN2A 4PMRA 4IK7A 2BSRB 3H12A 1Q1PA 2G8ZA 1F90H 2HH0H 3VYLA 4DP1X 1WB0A 4A8LA 1CI3M 1TPVA 4RIRB 4FX5A 1U92B 4WHYG 4Q8VA 3BZEA 1T8QA 4Y8EA 1IKFH 3UMTA 1VP5A 3HAEA 2A4EA 3MI2A 1AGEB 4XPTL 1MPAL 1B4RA 1KB5H 4GXUM 4BXVA 4PJEE 5D9OA 2BP0B 3PGDB 3DGGA 3H6JA 1EO8H 5TF1L 2CBVA 4WXYA 2HLFC 4OJFH 3FT9A 4ABWA 4WFGE 4IUOA 3BP5B 4UBPC 3ARDB 3QNZB 4PP2B 1IEAA 5I2UA 3KPQA 4P4RA 5EORL 1GYNA 1Y6KR 3GNXA 4RGMB 5DFVC 15C8H 1DSFL 2XWDA 3QPQD 4NUPA 3DRTA 3RA7L 1ICPA 2YW4A 5BOFA 2DQMA 2VGBA 5AW5B 5KZ6A 3AHXA 1BQHB 5SWZB 2VDMB 5CSUA 1YNYA 5EMLA 4W9EC 2WCSA 2B7NA 4KAQL 1A6UL 3ZK0A 1NIAA 2OYPA 1V02A 2YCLA 3RVVC 1SW0A 4WNQB 1YDYA 3LMJH 4LANA 4RCXA 4DVBA 3VXUB 3LLFA 4G9DB 4MS6A 4AJWA 2PDHA 3IS0X 3H4WA 2WINA 2C71A 1DWFM 2WXKA 1UZHA 4XO8A 3S1XA 1UJQA 1F1DA 1JBJA 3VAVA 5HI5C 4XP4L 3TYGH 1A2YA 4X9IA 1HK6A 5LIKX 3HKFA 5H4YA 2CR3A 4ODWB 1TJHL 3T65B 4PTUB 2NY0B 1EGJL 4YNYA 5DLCA 3R7QA 5ITBL 3ZLQC 4X6FB 5T1LA 3MRLB 5KW9L 1GKEA 4PLKD 2V69A 2X4RA 4MQSB 2INEA 1HJWA 3BD5A 3U2IA 5E6ZA 4BCZA 3SQMA 4WHTB 1LK2A 2AEPH 3LKPA 1QK0A 4FTVD 5CUSL 4X8GA 2I26N 1WWAX 4P57A 3UXIA 5D6DA 4P46D 5C5YA 3P9MB 5E1AB 5JHDA 2AXGA 4IMKC 3PJTA 4D94A 4E5XA 3OAYK 3C2YA 1RJQA 4GE8A 3C2RA 4ZGYA 1MQKH 1L5GB 4ZXBD 3W86A 5JOPE 3LS5L 1FKWA 1DYZA 1UUOA 3WFBH 2Q76A 4EO5A 1P0KA 1T0OA 1ORQB 3Q48A 2DYSB 5L4IA 4OLUL 2YLAA 3R8QA 2ABBA 5C0RH 5BXSA 3ULVF 4O0ZA 4F93B 5D5ME 4UR8A 5IB2A 5DJ0B 3LRKA 2C9QA 3H7BA 1OFRA 5AC5A 2BCKA 4YPJA 4LVFA 3JRKA 4OT1H 5CJXA 3P54A 1Z89A 5IWLA 4NERA 5KITA 2YYUA 3HC2A 1QWHA 5LA1A 2LW3A 5BRZE 3ZXWA 2UZYA 5CZXC 2CJUL 3ULUD 3QWRA 4JO1L 3VNYA 3BZDA 1ED3A 3IDXL 4Y4HB 4XE5B 3VIGA 1B4TA 5AAWC 4G6AD 2VC9A 4H7ZA 3OXRB 1O95A 3W11C 2OR7A 3B04A 5HYJB 3ZLGA 4FJ6A 5FF6B 4NDMA 5K5YA 1YO4A 3MRMA 3GIPA 3KHOA 3APGA 4LDEB 3IUHA 4IDLA 1J9TA 3NDOA 2ZCLH 2Y70A 1E73M 2DIJA 1ZVHA 5F7FA 2HPOA 3TEZA 5HJDA 2WJZA 5FCUH 3R19A 1TB3A 1E28A 4QWWD 2J5WA 1N2VA 4MMZC 5CBIA 4IIDA 3QQDA 2XIBA 3GT6A 3OKOA 1J5DA 3ZZSA 2OL3L 4TVDA 2ZD0A 4XXCC 2PWHA 4NCC1 4M6VA 4ES8A 4LSUH 5HULA 5FA4A 1KBKA 1M6OB 1H0DA 1RP8A 2SODB 3TIEB 1P4BL 1I7UA 5I30L 2OMNA 2CH8A 3G5ZA 3IAQA 4ENZA 3KBVA 5DMGC 3OWEA 4FF5A 3HIZA 2FL5A 3EF7A 3HZKA 5GNZA 3RWGB 1M5WA 3NGFA 3M16A 1XEUA 5I03A 1KFCA 3DX9B 1W1A1 4AHQA 3HHSA 3DECA 4W9CC 1PU0A 3QPEA 3H6OA 4U3SB 1AE6H 1S7WA 3ANUA 5F72S 1I1AA 1NUNB 5IG7B 3O07A 3LV3A 1AXTH 3MA9L 4UQ9A 4ZO6A 1S46A 3Q1SH 5SX5H 2GBUA 4R5EA 4DEPB 5KYWA 2W65B 5H37G 3PRZA 4AZIA 3VCLA 4PJCA 2XYCA 3F5KA 3H42L 5HPOA 2VUKA 1X44A 3QZAA 5I2IA 1IGFH 2QCFA 2ZWYA 2A0LC 2GC4C 1MWAH 3CVHH 1QRQA 3MR9A 4NBXB 2RCSH 4H7VA 2NXGA 2O56A 3L45A 4UDUB 1D7FA 1RP9A 3LHTA 3BQUA 4OCYH 4X2RA 2W9LA 4Z0BL 5DMLA 2HT2D 1F02I 4AK1A 3MHUA 4MUZA 4X5RA 3PDOB 5AVXB 3EX6A 3TOPA 2YL5A 4J4KA 4XWGL 3BJ91 1HDMA 4PMOA 3EXLA 4MAYC 3CVIH 1VSCA 4QM1A 4LGXA 3UP6A 1TT6A 3WQEA 1ESOA 2JF7A 4NI3A 1UWGL 2RALA 1F3JA 5E99H 4JPGA 3JVGC 1FLTX 1I2PA 2GJPA 4ZOBA 3EKLA 3OA3A 2CZEA 1AQ0A 4J3OD 4WVXA 1OT4A 4EIVA 2E7MA 3X1NA 3W7IA 3TCEA 3RNKB 1R5WB 3BESR 1XPGA 1TJPA 3LOTA 1YDPA 4TVPD 3P77A 4KCTA 5AAWA 2W81C 1B4LA 4GUGA 3B6SB 1X4YA 1O0VA 4IQJA 1PEZA 1TENA 3GO2A 3EUUA 4MKVA 2P8PA 2HTLC 4LVHB 5GVJA 4O0QA 1EXBA 3VG9B 4NIRA 3C6SB 4X6DE 1AAJA 2I60L 1P1ZA 4ZPVB 3GW0A 4MD4A 3PV7A 1ZAJA 2QCHA 1P7TB 2J20A 1Z9SA 4LLVA 4A7SA 4GXUN 1G7JA 2PTTB 3GWJA 4HXAL 4FZ8L 4XV0A 3FB6A 5T3ZD 4KVNL 1JPKA 4FQLH 1RAMA 5DYOB 3OLIA 1WQ5A 3LQMA 3SDAC 2DMKA 1BIIB 4HWEH 3MYJA 4LDOB 2QHAA 3WNOA 2E76C 2QEJA 4HSNA 3UJEA 1VHPA 5AYZA 2XNAA 2IV8A 4OWGA 3HZVA 2CLPA 5EEZA 3GDBA 5I1DB 1J1OH 3SY5A 3QFGA 3STLA 3D69B 3FH7A 1ONQA 3FQNA 4ONFH 2ZUUA 4W9KC 1DL3A 4UMBA 1U3YA 3OLDA 2LLNA 4HKZA 3SW6A 3EYVA 3UAEA 1PDKB 4ZI8A 4C1KA 2Z6IA 3WMPA 2VQUA 4DF2A 1PLCA 3KRSA 1G1OA 3WLMA 1HKFA 1RAKA 3LKSB 4G43B 2C1OB 4AJYV 4NNPL 3G6JB 2EE0A 3IWUA 4R84A 4W8LA 1JZ4A 3AB0C 4QSHA 3TCTA 2AGJH 2F74B 4DCQA 3VVVA 4WV1B 3UGUA 5D9MA 1L6GA 2FO4A 1LM8V 2Q3OA 3UW6A 3EFOB 5IW3A 1J8VA 4OY9A 4NP7A 3PU7A 1J7VR 3PWIA 1MDLA 1LEIA 1B3YA 3PGFL 1X7TA 1C7TA 2O4EA 2DW6A 5AD0A 4KKNA 1MCEA 2XYBA 3HMXA 2H3DA 1J1PH 4N0YH 3ZE0B 2QJMA 2PO6C 4X6CF 4ODUA 3NCBB 4H2HA 5C2CA 1WAUA 3BW9B 1U8HA 1CX9A 1LWHA 3QYNA 3T05A 4WWNA 4Y7MA 4LCUA 4M6QA 5EU5A 1W8GA 3C5ZD 1NBZA 1J5TA 1E27A 4PVLA 5EY5A 3WL9B 4AEEA 5A6SA 1CLZL 3VD1A 4P4KC 1H3PH 4I7ZC 3HAEB 4ZQPA 3PBUA 3HPJA 1TV2A 1A1MA 3BVNA 4PW9A 3IJIA 4N2GA 2HXTA 3BPWA 3US9A 1YUKB 3OPZH 1XLLA 2WLHA 2OI9B 5I6MA 4IMCA 1MFNA 2KQMA 4AZUA 2WMPB 4P5MB 2QADD 3VGAB 2DWSA 1IEAB 5CD5C 1BM7A 2E5CA 4P4RB 2W6RA 1IU1A 4XCEB 1QSEE 1YPIA 3QFJE 4QS5A 2VR5A 3P8IA 1REQB 4UV7L 3DRTB 4TO8A 4X5XA 1RPXA 4O2EA 5T91A 1QASA 2E6YA 2PUQT 3MMUA 2JXMA 2ZG3A 1H41A 1TPWA 4N8CL 2A4ZA 4NRXA 4RDWA 3U4BL 3LEYH 1CGUA 5D96C 3S97C 3NN8A 1ZY9A 1VFUA 4DVBB 1YNTF 3O4LE 2OTWA 1YEEL 2COVD 4F4RA 4I5BA 4XAYA 5EMKA 3FU0A 3DI2B 4E2BA 1D2OA 3QY6A 1Q3NA 3NQCA 2DY3A 5DD5H 2X2GA 4UNKA 4HAKA 5CXPA 2H0PA 2ZAHA 3THMH 2TRYA 3GKZA 2OSLA 3RJXA 5E1IA 2HPTA 4R4BA 2V9UA 4TQEH 4IU3A 4NJIA 2JMRA 4Q7DA 1E1EA 4MZ8A 4XNZC 4LFYA 5I15L 2ZICA 4R7LA 3T07A 1LK2B 4A2FA 3TEVA 3V4PH 4P57B 3JZUA 1BYBA 3DOSA 4ZNEE 3CWOX 5JHDB 4JFQA 4OM1H 2R2EB 4A2GA 1G84A 1TRDA 4WAFA 5ENLA 1JPST 4HMCA 5C0FA 4GG8A 4FCAA 1R2SA 2C91A 4G42B 3ABOA 2PO6A 3K2MC 3VWKA 4AZCB 1GZPA 4E9QA 4F2MA 1MY7A 3MO1B 3O2WL 4MYXA 1CL7H 1QOXA 5IB2B 2X9XA 1YPZF 1HILA 5CINL 4JMXA 5CGQA 4W7WA 2QSTA 4D71A 4M19A 2BCKB 4LARL 4WGWB 4FS0A 4XN8A 1HXYA 4P9HL 3OVQA 5L6UA 4UTCA 2XU2A 4OTKA 2MCMA 1M01A 3NSFA 3GDMA 3UBFA 4P9MH 1ED3B 1RJYB 4HS8L 3V0SA 2C0HA 1A5NC 2C4FU 4BCYA 4X61A 1TJ1A 2FB4L 4QLKA 3L4TA 1KB9J 1KCBA 1UD8A 1XINA 2CLEA 4QG8A 3BHBB 3GBNH 4XISA 3ARPA 5GJMA 4Q8PA 4WI2A 2DJXA 4NDMB 4A3YA 2ZF9A 3MRMB 2F54A 4FQ1L 2CR0A 2PB1A 2V3GA 5C9UA 1FWBC 1UZ8A 4ZX4A 3BMVA 1KC5H 1HU8A 5CPNA 1WKFA 1E28B 4HNTA 4PW3A 2BHUA 3KYOB 4Y4FA 1HINL 1NEYA 4L0PB 2EJAA 3L5JA 3F4WA 4F0LA 1BD2A 3U4AA 3OKOB 1WGVA 2W9DH 4JFSA 4PBXA 4A68A 1NBYA 4M48L 3O63A 2Z26A 2UY4A 4XVTH 4GG6A 2JJWA 3TJEL 3CUZA 1H0DB 1I7UB 1NMCB 1BQKA 4LXFA 1QSFE 1W0VA 3G5ZB 4P9HC 2FPYA 1W80A 4H5SA 4LL1A 4H8WL