1XCWA

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xcwA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xcwA01
2XSAA 4FNPA 1XH1A 4NF7A 1V0NA 3L2MA 4OGZA 2XVNA 3E1F1 1B0IA 3LXBA 3SUWA 4U5KA 4EAMA 3A5VA 4HZ6A 3T0DA 3BAYA 2ZX6A 1TFVA 2ZICA 1KXVA 1B90A 4M1RA 1BAGA 2W66A 1OB0A 3WMBA 3O9NA 4PMZA 1H0IA 4PCSA 5CLWA 4J3SA 3TTQA 1V0KA 1PX3A 3LXCA 4JL1A 2E8YA 2JE8A 2NT1A 4LQ1A 2PWHA 5BROA 2EPNA 1J0KA 2CNCA 5D4YA 4FNSA 3CZ8A 3WY3A 3EJQA 3WD1A 2F2HA 1UYQA 3SCWA 3GXDA 1I1WA 2IXVA 1CBGA 1OCQA 2C7FA 3ARPA 3VOCA 2ZWZA 4E4PA 3MV01 2O9RA 2ZXAA 1TR1A 3ZT7A 4B3LA 1NOWA 1EO7A 4PMUA 1TQWA 3AHZA 1CWYA 3AXXA 4ZEPA 3B9EA 3EDKA 3BMVA 1N82A 3ARTA 4PTWA 1QOXA 1TA3A 2OSYA 1OSEA 1EO5A 2XTKA 2VC9A 3AROA 3KZSA 2XVLA 1GOQA 2WKGA 2OW6A 1J0YA 1H09A 2OWCA 1CENA 4HMDA 2ZE0A 1XC6A 5AYBA 2J8FA 1CDGA 4M81A 5HPOA 4UFJA 4NRSA 1TQSA 1E5JA 4JHOA 4C7FA 1K6AA 2WHMA 2ZUUA 1BVZA 3RCNA 3SCTA 4U3CA 4LYPA 5BRQA 4EKJA 1ISVA 4UQDA 2VZTA 2XJ7A 4NI3A 1UWTA 1R33A 3CUHA 4LGXA 1NP0A 2CESA 1WZMA 5FL0A 4J3UA 4KGJA 4AW7A 1BSIA 1HX0A 1VFOA 1KBKA 4FMVA 3OZPA 1XH2A 3WH8A 1TQTA 4L4OA 2VX7A 1V02A 4Z2IA 2OW7A 3VIHA 1W9VA 4AISA 5CGMA 2B31A 4UQ9A 3WD0A 2FH6A 2PBGA 4MDPA 1GJUA 2XPKA 1OD8A 1G94A 1KTCA 2J25A 3EJUA 1V02E 3SIMA 1LL4A 3VSTA 2DT1A 2CIPA 1OM0A 1JYVA 2VURA 3AS1A 1GORA 4EE9A 4H7VA 3GZAA 1FHLA 3WY1A 4DWSB 1VEMA 2G8ZA 4X0NA 2DSWA 3S2CA 4NRRA 2V38A 1WZAA 4Z2GA 1GW1A 5TD4A 1WO2A 4CCDA 5BXTA 4PTXA 4E2OA 3HU7A 4JHZA 2HISA 1UD5A 2J7FA 4TX8A 1OGBA 4TXEA 3QGVA 2CBVA 2O9OA 1K9EA 2VOTA 5D9OA 3ARRA 5D9MA 1UH4A 5A8PA 3S5YA 3AXIA 3LPOA 4HPGA 2YKKA 2IXUA 4WKAA 1ESWA 1Q6DA 4S3KA 1R86A 3CHCA 1XV8A 4MB4A 1G9HA 4W88A 3D3AA 1NQ6A 1JZ8A 3QHNA 3EMZA 2XG9A 4GQRA 5AC4A 1T0OA 2OWXA 3WL1A 4QLKA 1UH3A 2DGAA 2F8QA 4OOUA 1TQVA 3W24A 3VNYA 2FE0A 3W4RA 2YL5A 2CERA 2WZIA 2WMHA 4IPLA 2DPEA 4PEEA 3FAWA 2WVSA 1LL6A 4M24A 3WY4A 2XFRA 3VD4A 3VPLA 2QMJA 3A21A 5GNYA 3F5KA 4CU6A 4TTGA 3GNOA 1W32A 1KR0A 2CBJA 1U2YA 1P6WA 3QOKA 1E4MM 1MWOA 3A6OA 2Y24A 1UR1A 5I3DA 4RE4A 4W7WA 1XRVA 1G1YA 4NXKA 2F1BA 2O9PA 3RM4A 3ZJ8A 1BFNA 3AS3A 2JEQA 4MTVA 3BVWA 1HKIA 1EHNA 1OIFA 3UETA 2YJQA 4JFVA 1HF6A 2EPKX 3ZOAA 2VJXA 3SCNA 3NUKA 2Z1KA 3BLKA 1ZJAA 1UR4A 3WDHA 4OBRA 2Y5EA 4TUFA 3W28A 4FNUA 1HJUA 2WNWA 1GZJA 3RPMA 1O7AA 1GJWA 1KGXA 2DSVA 3WH7A 4XUYA 4W93A 1R47A 3QHMA 4GI8A 3ARYA 1C90A 5GNXA 2EQDA 2WC7A 1B3WA 1BQCA 4CKQA 3AHVA 1UQZA 1O7DC 4MNKA 3KE0A 2WMGA 4U2ZA 4JKMA 3THDA 4HU0A 1UKTA 4UQEA 1VJZA 3RJXA 3CUJA 1J9YA 3M7SA 3TTOA 2D23A 1YQ2A 1JXJA 3ZSTA 5IFPA 1LLOA 5DMYA 1UZ1A 4CCEA 3BC9A 1FH8A 1UD2A 2J62A 1BVNP 3K8LA 1FOBA 2WYSA 1MYRA 4PMYA 4DUVA 1KCLA 1M04A 3ZM8A 1MQQA 4WLCA 1OD0A 5EMYA 2FGLA 1K9DA 3RO8A 1XGZA 2DEPA 3MU7A 3ZJKA 2WC4A 1JYNA 2FHBA 4AC1X 1V0MA 4W8BA 3WNLA 5JBDA 4QLLA 1XSKA 1CLVA 3IAPA 4NZFA 5DFAA 4TTUA 3TTYA 4UFMA 2CHNA 1U33A 3BAKA 1NWSA 1QW8A 1TVPA 3VDCA 2CHOA 3VIGA 2CETA 2WVVA 4XX6A 2ZOXA 4CVWA 5A94A 3EDJA 1G01A 1E55A 1PEZA 1JZ4A 3BAIA 1VB9A 4U3AA 3WFZA 1GOMA 1Q6FA 1NWTA 3OLDA 2W61A 1GQLA 1LG1A 3HMCA 5E6ZA 3CZJA 1B9ZA 1QBAA 1HL8A 2WVVB 4P8VA 1C91A 2JF6A 2YIHA 1QX1A 1LWJA 1HJQA 3CC1A 4AZHA 1VEOA 3CMJA 2WMKA 4JL2A 1W3KA 3RDKA 6TAAA 3M07A 3DX4A 4OKDA 1E71M 4W8AA 1GHRA 5IHRA 1CXKA 2YDQA 3TP4A 5HBFA 1NWRA 5CQ1A 3MUZ1 1HL9A 4DM2A 3CUFA 3WUEA 3T2OA 4DO4A 2V3GA 4CN4A 1AQMA 7TAAA 4V27A 1UASA 1US2A 4HP5A 1WP6A 2YDRA 4W85A 3S6TA 5IDIA 4FF5A 2F61A 3I3EA 1UOKA 3VINA 5I24A 2DSZA 4YN5A 4DWSA 4ACZA 4C7GA 3AIBA 2BHZA 4QCFA 3PTKA 1KWGA 2W62A 1MXGA 1J01A 4DM1A 3OB8A 1VEPA 4L4PA 1XD1A 2DSKA 1MVYA 1QI5A 1OBAA 2XFYA 4JAWA 5HXMA 4Y7EA 3B9DA 2WM0A 3DYMA 1ZB5A 3T09A 1RPKA 2DDXA 3MV11 3ARVA 1JYWA 4QDMA 2DIJA 4V28A 5BXPA 5C8BB 1MW0A 3UG5A 1B31A 2QF8A 4JFTA 2XN2A 1W2VA 3WY2A 1E0WA 3F4VA 3ZIZA 2GJPA 4H41A 4D6IA 1UR8A 4PSPA 2DT3A 2VCAA 3OA5A 1BYDA 3VX0A 1FH7A 5D8ZA 3GXTA 5I23A 5A2BA 4FLQA 2ZUMA 1V6XA 5LA0A 3OG2A 3UERA 1DWGM 1GOIA 1J12A 3UR8A 2JF7A 1HJVA 4UQAA 3OGSA 4WJXA 2BY0A 2DH3A 1UZ4A 3VD5A 4HU8A 3VKKA 1JZ2A 2XVPA 2ZX5A 1W2PA 4KGLA 2WBKA 4FLOA 2BVTA 2D22A 4AD3A 3UEQA 3BUQA 1BGAA 4M29A 1E70M 2ZUNA 4NX0A 3AHTA 1ZL1A 3FW6A 2VRKA 5FKYA 3ECQA 5FOOA 5A3HA 1PBGA 1S46A 3EJPA 3D50A 3N18A 2WHKA 4TVCA 4ACZB 1GVYA 3BSGA 1W1YA 2CYGA 3AIQA 3GXNA 1RH9A 1H11A 4ZXLA 1GOOA 3F5JA 1DEDA 4HOXA 1W9DM 4KRTA 4TVUA 3WKZA 3TOPA 5E70A 1W9PA 4U2YA 2YLLA 4XB3A 1OT2A 4AD4A 3VX1A 3WDQA 2GVYA 4BQ3A 1QNRA 3VIOA 4DUWA 1C7SA 3W37A 4Z2LA 3VGDA 4GO8A 1UWUA 4P7OA 2OYLA 1CNVA 1B30A 1JIBA 2ZIDA 2VNCA 1MW2A 3D51A 4JCMA 4OUEA 1WPCA 4W84A 1HJSA 2ZXQA 4J28A 3GH4A 4P7LA 5IXEA 3WD4A 3W53A 3IJ8A 5JIWA 1W1PA 3N04A 2EO7A 3CZLA 4A3HA 3PBGA 1JYXA 1CYGA 2GUYA 3PZVA 4PMDA 1R8LA 3WH9A 2CKRA 1ODZA 4LXFA 1W9UA 3WQ5A 3WQ8A 2UY4A 2DT0A 1IT0A 1E56A 3DC0A 5A8MA 3H54A 1J10A 1E3XA 1E5NA 1JL8A 1B3YA 3CIVA 2FHCA 1GNXA 4J27A 3BAJA 3WUBA 1QNSA 1E6RA 3VIIA 3OLGA 4BF7A 3K46A 1E4IA 1ECEA 1RP8A 2WANA 1E6ZA 2A3EA 5M17A 4MNMA 1ZJBA 1L0PA 1R7OA 4P7NA 5CSYA 1E4NA 4MJ4A 1AVAA 3VMPA 3H55A 5I2UA 4GKLA 3WF4A 1W3LA 5D9PA 2WK2A 4UQBA 3SUVA 1CIUA 1JGIA 5CJ5A 3GDBA 4M82A 1XSJA 1MW3A 2E0PA 3W0KA 1E1EA 1I1XA 4ATWA 3EJTA 2BNJA 5CXPA 1E43A 2WXDM 1BYCA 1DWJM 1HKJA 2ZWYA 2VMFA 3ARQA 5M03A 3U57A 2EPLX 5CG0A 1UR2A 3GH7A 1EOKA 3RILA 1X6LA 3HG2A 1DHKA 2Z1SA 1FA2A 3LPFA 2WCGA 2J8GA 6A3HA 4AZIA 4URIA 2WPGA 4DUXA 1PZ3A 5A6KA 3UG4A 3AIUA 3THCA 3CLWA 3L4YA 3MUIA 4ATDA 2XWEA 3UG3A 2NW0A 4F9JA 4AWEA 1UR9A 3G6LA 5AC5A 1C8QA 3PN8A 2XN0A 3SUUA 3UESA 3EYPA 3PZQA 1XHGA 3D52A 1E6NA 1R34A 3BUIA 2VZVA 1KB3A 4Z2KA 3WQVA 3AMGA 5E1QA 1V6UA 2ZX9A 4D71A 3WH5A 1YHTA 4WKFA 5A6SA 4AXNA 1BHGA 1ISXA 3BLBA 1JF6A 3GNPA 1OT1A 1L8NA 3VGEA 4QCEA 3CMGA 2YFOA 1C8YA 4H8VA 4CU8A 2VCBA 1JNEA 1H0GA 1G0CA 1QNPA 4ZENA 3MMDA 3NIYA 2VL4A 2VZOA 2BVYA 4W5ZA 1E6QM 3UR7A 4BZYA 1E4LA 1FP9A 4PBGA 4A3YA 1XCWA 5A6BD 1CGTA 2D0HA 4WKHA 1C3FA 2RGLA 1C92A 4AIUA 3SCVA 1ITCA 2XGIA 4PMRA 1PX4A 2VVNA 2BXYA 3WIJA 2V5DA 5A6BA 1QI2A 3AIVA 4CVUA 5CPQA 4D1JA 4H8HA 3RIKA 3DDGA 3A3HA 3OGRA 2YL8A 2VX5A 4FNRA 3IJ7A 1HN1A 1W91A 3KWXA 3CUGA 5A95A 3CHDA 1ISWA 1K9TA 5C70A 2GFTA 1J18A 1QI3A 2VR4A 4J7RA 2BS9A 3RMEA 1JAKA 5GQBA 2CCRA 4NZJA 3L4VA 1DTUA 2XIBA 3DX1A 2PWDA 3U5YA 4K68A 1E6XM 4V2XA 2VTFA 5E0FA 1LG2A 1WB0A 2WSPA 1EQPA 4UZSA 2JIEA 3KL0A 3K8KA 2XHYA 1BPLB 2J4GA 2DQXA 3W81A 3GBDA 5IFTA 1QI0A 1V3IA 1UKQA 5EBAA 1HVQA 2CPUA 3AYRA 1PS3A 4UOZA 4P8XA 1GVIA 1EDQA 2CEQA 4Q7NA 3WD3A 3PHAA 2EAEA 4PTVA 1V6WA 1WAWA 5JIPA 2CBUA 1E1FA 2OYMA 3SCRA 2VCCA 2G41A 2W92A 1D3CA 1HXJA 1HIZA 3WDPP 4F66A 1DWIM 3OZOA 1AQ0A 1JNDA 1CGWA 1KCKA 3HN3A 1WDQA 5LA1A 3L2LA 4NSBA 2W91A 4MPKA 2WHLA 3L4ZA 4Z2JA 1JI1A 2VX4A 2EACA 3DX0A 3AIRA 4CGTA 2GJXB 5E0CA 3FXYA 2E9MA 3D4YA 3WH6A 1NOUA 3VD3A 4PTMA 1J0HA 1HP5A 2W4XA 1AQHA 5A8QA 2FGZA 5HOSA 2ZX8A 4GZIA 2OYKA 3PZTA 2D73A 2X2JA 1UKPA 3NSXA 2XYLA 4JZ5A 3MSGA 2ZUWA 5ABGA 3FHAA 4MNLA 2X0YA 1UWIA 4CD6A 2BY1A 1BTCA 1O6IA 4HOWA 1HWWA 2BXZA 1TCMA 3SCQA 4C7DA 3VM7A 4H2CA 3ARUA 3DYOA 3CV5A 3VIPA 1DP0A 1WCGA 5F7UA 4PSRA 4B9ZA 1EQCA 1Z32X 2D2OA 3LRMA 3O6AA 3K4AA 1W3HA 3W6LA 1JD9A 3W25A 3POCA 1GQJA 2PWEA 4RL3A 1W9XA 1ZBWA 3MUAA 1XH0A 2WMIB 4PUDA 3PTMA 1VFFA 2XIIA 3WSUA 3EBVA 2V3DA 3H53A 8CGTA 1CEOA 1SMDA 1QHZA 5CLTA 2J74A 4ATLA 2F7RA 5D8WA 4RE3A 1QNOA 2WMIA 3PZOA 1ITXA 1H1NA 4UQCA 4A4AA 2Y2WA 1FP8A 3B9AA 4BQ5A 1GQKA 2NT0A 3B8SA 4BQ4A 3WMSA 3QHOA 3AHXA 3OLIA 3NJ3A 2IGTA 4DWSD 3VMOA 3GTNA 1FFQA 2Y8KA 3NYDA 1J0JA 3L4WA 1BGGA 3SUTA 1BYAA 3WF3A 3GM8A 1E73M 5EB8A 4HA3A 4F8XA 3GXIA 2PWFA 4H8UA 3A22A 3ZR5A 1LL7A 2HVMA 4HA1A 4PMNA 5I79A 2Q8XA 4XZWA 1VBUA 1JD7A 1UD6A 2WMJA 1HKMA 1XSIA 2PWGA 4Z2HA 1UHVA 3BGAA 3ZT6A 1HTYA 2ALWA 1KBBA 4LYRA 4P7RA 3WNPA 1J11A 3TA9A 3G6MA 1LJYA 1KXHA 3GXPA 2VZSA 4CN1A 2YA0A 1ZU8A 1F4AA 3IGUA 1WDSA 1V3HA 4PMVA 4HZ7A 3BUDA 1X6NA 1Q6CA 3BVUA 3PZMA 4NZCA 1R85A 1CXEA 1OIMA 3WQWA 5A6AA 2PBOA 1OGSA 2WAGA 4YHGA 2CXGA 1NH6A 4R5EA 2DT2A 3CZSA 1D2KA 4MB1A 3GNRA 5BWFA 2V3FA 3TTSA 4HMEA 1EH9A 1QBBA 4PYSA 4PN2A 1NP2A 2G3IA 3EMQA 5BXRA 2Y8VA 1V3MA 3VDHA 3AS0A 3U7VA 1QPKA 3ARXA 3KL3A 1IZKA 1PAMA 1E6SM 2EEXA 2A3BA 4D72A 2BY2A 3T2QA 5E9AA 3WENA 1V08A 2XGBA 2YDSA 1EXPA 4H04A 3GXFA 1M01A 3WFLA 2C8NA 4AZBA 2J77A 3SEPA 1UQYA 5A8NA 2WLYA 4UOQA 4GQQA 4X9YA 9CGTA 1BG4A 1WDPA 1HP4A 3LMYA 3ZMRA 1PPIA 2J47A 1KXQA 1JI2A 3MANA 1DWHM 1C7TA 4AD5A 4IPNB 3VDBA 3ZT5A 2W67A 3WELA 3ZR6A 3AZTA 1W1VA 3WF0A 4KH2A 1ODUA 3LRLA 2F7QA 3VIFA 4Q22A 3TV8A 3BVTA 2WZHA 1VIWA 4UFKA 4U31A 1NM9A 4CN6A 1KGUA 3ZQ9A 2X0HA 3DHUA 4N42A 4MJ2A 2Y4SA 5ABHA 4FLSA 2BV9A 4UFHA 3N1AA 1M03A 5BYWA 3RM9A 1CGXA 3K4DA 1IZJA 4JFSA 3ZJ6A 2O92A 5A6LA 4W86A 4WIWA 3WQ6A 3ZJ7A 4HZ8A 1CZ1A 1TUXA 3F5LA 4OOZA 2D3NA 4QP0A 3U5UA 1H2JA 5FL1A 3AICA 2J79A 2XVKA 3GBEA 3MO4A 3NCOA 3CZKA 5ECUA 4W7UA 2CBIA 2WHJA 2BVDA 1QW9A 2XM2A 1CTNA 2PC8A 3WBEA 4UFIA 2J7CA 3T0BA 4UNIA 5LYRA 3VGGA 1NOFA 1LF1A 1JDDA 2GK1B 4CCCA 4AYGA 1UD4A 1JDAA 1VJSA 2BHYA 3W26A 2QV4A 3L4TA 1E0VA 2J7GA 1CXHA 2DIEA 4PMXA 3MUY1 5FIPA 1I75A 1J0IA 3ZO9A 3W27A 3SUSA 2UY2A 1R46A 3VUPA 3TONA 4MNJA 2F7OA 3GXMA 2X05A 2VQTA 2JIWA 1GHSA 1GPFA 3ARWA 2X2HA 4W8LA 3ALFA 1JDCA 4FNQA 4GZJA 1UH2A 2W5FA 5JBEA 4LX4A 2D0GA 2JALA 4CD7A 3MKKA 3A4XA 2YFNA 5GPRA 3SCPA 3MI6A 4B3KA 3LPGA 3PZIA 1M53A 3CTTA 1RD6A 1JFHA 4AEEA 2FDMA 4GPNA 2A3CA 1HVXA 4QFUA 3O2LA 1EDGA 4MB3A 1UD8A 2WZEA 5BRPA 4LPCA 1A47A 1MFUA 3HJEA 2XFFA 1WZLA 3QOMA 5JUVA 2WW5A 1B3ZA 2WWDA 1JF5A 2F1AA 4JFUA 2JEPA 2AAAA 1JZ6A 3GH5A 5ABEA 1KTBA 4BA0A 2E9BA 1E15A 2VZUA 3BXWA 5DO8A 1QI4A 4ZFMA 1V3LA 1QWUA 1VBRA 1V3KA 3KEHA 5CSUA 1TE1A 3A4AA 1JG9A 2VO5A 3AS2A 1IV8A 4ACYA 1H3GA 4GINA 1W1TA 3MSDA 2MANA 4JKLA 2W63A 1OWQA 2WBGA 3A23A 4FNTA 5BCAA 1KQZA 1J0ZA 1H4PA 2WLZA 3LX9A 1A3HA 2V3EA 2EABA 3WNMA 3WEOA 1GQIA 2VUYA 2VI0A 5DF0A 1KGWA 4EK7A 1OINA 2D3LA 5HPCA 1UWQA 1MQRA 2EADA 3A24A 4MDOA 1PIFA 2BHUA 1UG6A 1D7FA 1XYZA 3PZ9A 3PZUA 1EHAA 2ZXDA 2OLHA 1UKSA 1GUVA 1MQPA 2BFGA 1UA3A 4WK9A 1CGYA 1CXLA 3I3DA 1QHOA 2GJRA 2DSUA 2YL6A 3N12A 4AMCA 3AMCA 1V6YA 4XZBA 2J7DA 3WL0A 3BVVA 3WDRA 1UKOA 3LXAA 1E6PA 3AIWA 3CHFA 3N17A 3II1A 3DX3A 2ZUSA 4E8CA 2WCAA 5E09A 4IM4A 2E4TA 1UR0A 3EDEA 3WNKA 4OJYA 3DDFA 4D6FA 5A6MA 3ALGA 4AD0A 5CZKA 4GXPA 1HT6A 4JKKA 3M6DA 3HZ3A 1WKYA 1WNOA 4IISA 4M8UA 3AISA 2X8RA 5A2AA 1HXKA 5CPSA 3AI0A 4P8UA 5A8OA 4WF7A 3GYCA 6CGTA 2XWDA 4U5IA 1H41A 5LA2A 5KZ6A 1VRXA 1UA7A 2ZUTA 2NSXA 1VF8A 5A6JA 3A4WA 3AMLA 2WCSA 3WNOA 2E8ZA 4UFLA 3KLKA 2ZX7A 4J3TA 4AIEA 1B3XA 1R87A 2VQUA 5C71A 2ZUVA 2EPOA 4BQ2A 5HDRA 2E9LA 4WSJA 5AY7A 3VILA 3OGVA 4PUEA 2PB1A 3VSUA 3D5HA 4TX6A 4YPJA 4B15A 4KWUA 2F18A 1QVBA 1H5VA 3N9KA 2QMKA 4DWSC 3BCFA 2WB5A 4HOZA 3SURA 1ISZA 1V3JA 3BAWA 2X2YA 5I6SA 1WDRA 1CXFA 1MFVA 2UY5A 1BYBA 2F7PA 1NWUA 2OWWA 2UWFA 2J78A 5CPTA 4GZEA 2TAAA 4MAZA 2X09A 4FLRA 2G4FA 2IUZA 3OLEA 3S5ZA 4UCFA 3WEZA 3VGBA 1R75A 1Q4NX 1CECA 3VDAA 2YA2A 1SYTA 4J3WA 4ZXOA 4JIEA 1XCXA 4D6EA 1DWAM 4GI9A 5I77A 4J3XA 1K9FA 2J7HA 3N11A 3IJ9A 2XSBA 1E0XA 4M80A 1H49A 1V03A 3N13A 1XYFA 1TMQA 1ZBVA 3D4ZA 3FN9A 3WBAA 2AOSA 3I3BA 1X1NA 2GSJA 3APGA 1F4HA 4X0VA 4GO9A 1QWNA 3VU2A 3EJSA 1BF2A 2ZXBA 2AMGA 3BMWA 3FHQA 3J7HA 3NSMA 3AMKA 3VNZA 2VRJA 2JFEX 2EXOA 3AJ7A 1Q6EA 5A2CA 1UWRA 3M46A 5A69A 1TZ7A 4QLJA 1TVNA 4AZ6A 3VGFA 2GK1A 2OSWA 2WVUA 2QHAA 1KFWA 3PZNA 1C93A 4UZUA 2QPSA 3W82A 1CPUA 2PF0A 1JXKA 5DT5A 3ARSA 2ESCA 2GDVA 2D20A 2XM1A 5FCZA 2CKSA 1EGZA 3AQUA 1VAHA 1EA9C 1SZNA 5EFDA 4B9YA 3VGHA 1U30A 2D1ZA 3MMUA 3SCSA 4UTFA 2WKLA 2WMFA 4D6CA 2A3HA 3W6MA 1E9LA 3BAXA 3MMWA 1JFXA 1WE5A 4OIFA 2G3MA 1KXTA 4D6GA 1E3ZA 3DX2A 3KLLA 4P7QA 2YBUA 3BVXA 2YA1A 4GIAA 5FD0A 3A47A 3AXHA 3HG3A 3OIHA 3VVGA 2C0HA 3W29A 3BH4A 4J3VA 1NARA 5EFFA 2PI6A 4AZCA 3SCUA 1B1YA 4D6DA 3WN6A 4AEFA 3BSHA 2UY3A 2YLAA 3WMCA 1TG7A 3AZRA 3LRKA 3EMCA 1SMAA 4AZ7A 1HKKA 3NDZA 2EJ1A 3AYSA 3CO4A 5AYIA 4D6JA 3EJRA 1W9BM 1C8XA 1DWFM 1MW1A 2YL9A 3K8MA 4AD1A 3OBAA 1G5AA 3CUIA 3W38A 1ZBKA 5M5DA 3DECA 5GNZA 2WSKA 1FFRA 4HA4A 1BLIA 5CGTA 1QHPA 1Y7VA 1OGGA 3PZGA 3QR3A 2RGMA 3AOFA 4JCLA 3WUGA 1GCYA 1SR0A 4DO5A 4GI6A 3CZNA 5HNNA 3LPPA 2FHFA 4W89A 4ML4A 2G3NA 3IANA 4LYQA 1CLXA 3K1DA 1B3VA 1ZS2A 4QAWA 1GOKA 1V0LA 2VRQA 2J7BA 3N15A 3FNDA 1JZ3A 1HJXA 1FH9A 4WSKA 4NXSA 2J7EA 1QNQA 7CGTA 1PIGA 2X2IA 3EDFA 1AMYA 3ARZA 2E3ZA 4MB5A 1CGVA 3AIEA 4CD5A 4F9DA 1HJWA 3BUPA 3AZSA 3WF2A 1XD0A 1W3JA 3MS8A 4TVDA 1WZKA 3WQ4A 1GONA 2VX6A 3WF1A 4MAVA 3VM5A 3UCQA 2OSXA 3DYPA 4M56A 3FY1A 2D0FA 4E8DA 3BCDA 2J75A 4BCEA 3ZSSA 4UR9A 1E72M 3CH9A 4R27A 4B16A 4AMWA 4KRUA 4D1IA 4XV0A 2WC3A 4RE2A 1ISYA 2VR5A 5ABFA 1E40A 5E6YA 3RM8A 5DEZA 3WDIA 5IHSA 2E40A 3CZGA 3IK2A 1EIBA 2WVTA 3BLPX 2QPUA 1V6VA 2WWCA 2X1IA 4TOQA 1PJ9A 3L4UA 3T0AA 1KWKA 3T2PA 3IAQA 4HPHA 3WEMA 3VTRA 4AD2A 2FH8A 3AMDA 3HG4A 3FAXA 4AIOA 4AZ5A 4W5UA 1CGUA 1HNYA 1KR1A 1EOMA 1R7AA 2FYVA 4DO6A 3SCOA 1CXIA 4OZOA 3RJYA 1MXDA 4YHEA 3CHEA 3NDYA 2D24A 4BS0A 4AYSA 2CITA 4HTYA 4W7VA 4UOJA 1UD3A 4PCTA 3DHPA 1US3A 5I0DA 5JBFA 3L4XA 4JFWA 5D9NA 3CPUA 3JUGA 4P8WA 4PMOA 5M3WA 2YOCA 1ZBCA 4F79A 1B2YA 1EDTA 8A3HA 3U7BA 2YBTA 3WUFA 3WNNA 4W87A 5DT7A 2EPMX 7A3HA 3CZEA 3VIJA 3VMNA 3VSVA 4MADA 3CGTA 4HMCA 4S3JA 4KMQA 3VIMA 1JAEA 4D6HA 5I5RA 1SFSA 1JZ5A 3WD2A 3HG5A 4N0RA 3PTQA 1GOWA 2XVGA 4IUGA 1LQ0A 3EDDA 5I78A 4ZE4A 4FK9A 4CD8A 4AMXA 2DH2A 4PRWA 4AY1A 4EANA 2VT0A 4CUCA 3VO0A 5ABFB 2BY3A 1PZ2A 3T08A 1PX8A 1VENA 1RP9A 3NSNA 4PMQA 2V5CA 2VVSA 2QLYA 1FHDA 2GJXA 1M7XA 4U33A 3VD9A 1KQYA 1BG9A 2G3JA 4CU7A 1LWHA 3WDJA 4ZE5A 1Q6GA 1TA3B 4CD4A 3VIKA 2GDUA 1VFMA 3POHA 2XUCA 3BUBA 1JZ7A 3KL5A 4AZCB 2A3AA 4AZGA 5KEZA 3CBWA 1TQUA 3AFBA 2EBNA 3AHYA 5A1AA 4OBSA 1VFUA 3VD7A 1UWSA 2O9TA 2XN1A 5BXSA 1UUQA
chains in the Genus database with same CATH superfamily
2VLLB 1BRLB 5HYQB 2XSAA 4FNPA 3Q2LA 5IW1B 4NF7A 5EULV 3SPIA 5DCEA 3BP5A 4OT1L 3LXBA 5IQ9B 1I31A 3FU7B 4K4KA 5D72L 5FA3B 3SYCA 4P5TB 1LRTA 4YQXL 4F7KA 3NIGB 4L5FE 2QIIA 1IIHA 2WV8A 3AUJA 1DQVA 3UTZA 1V7ML 4F33B 1GYUA 1KLGB 3R89A 3A5VA 4LY4A 3TTEA 3APDA 3HLAA 1D6VH 4H6QA 5EEWA 2ACUA 2CO2A 2ZX6A 3AFLA 3BWSA 4S1DD 3ABZA 4F92B 1OGAD 2WW8A 2ZICA 4GAYA 4OJEH 4QXTA 5EIIG 1ZRQA 3IFLH 5G55A 5MF5A 2CDFA 4LF2A 1B90A 2W66A 1OANA 2PP9A 1Q4WA 2JWYA 1XIIA 4TSAL 2O7QA 1HILB 2NXYD 3K6OA 5JYMA 1H0IA 1JMXA 3E3QE 4MD4A 4JY6A 4LHJB 3SN0A 4ZW8A 4XNYL 2CZ5A 3TXZA 2BWIA 2HBVA 1K6QL 2XSXA 4ELMA 4A55A 3DOHA 4JL1A 3NTCL 1DDHB 1TMLA 3N43F 4BEUA 2YBRA 3SRDA 4HZMA 3P60A 4J3OH 3W7JA 4L29B 2CNCA 3L65A 3WL9A 1T03L 2D2HA 2CCLA 3L9RB 4XXCA 5FA4A 3QDGB 2H6OA 1IBYA 5HK4A 5IP4A 3WY3A 3OPUA 1HO4A 3LI0A 2W88A 3SGKA 5T91A 2F2HA 3NURA 3FYEB 1JV5A 3E6HA 5CSZA 5IVXE 4ENEC 1R0AL 1EJUC 1KTNA 1HK6A 2Z0UA 3CNKA 1VGEH 1I1WA 2C71A 4N25A 2IXVA 2HT3C 4Z3IA 4M9PA 1OCQA 3MSPA 4GUIA 2YD2A 4Y4KC 1PGRB 2BW4A 1L6GA 4P5SA 4HXAH 1LT8A 2VFGA 3MBEB 4UV4L 2Y9RT 1QNZL 4GG6A 1A0EA 1JJUA 2ZWZA 5EORL 1VYPX 1IEWA 3MV01 4IMLA 3VH8A 3SSZA 1TQCB 1K5NB 1YECL 4IJ3C 4WKZA 5JR1H 2VC6A 3KPOB 3NWRA 4H9ZA 3LNDA 4UQIM 3ZT7A 5E9DE 3CB8A 2WMIB 4IOFD 4US6A 3B7UX 3TC6A 2FYYA 5CSZB 5L9DH 1AW1A 1N6VA 5CAKA 5CZRA 2VDHA 4KQ0A 3F03K 4LFYA 4GW4A 3B9EA 3EDKA 2OCZA 4ZQCA 2GT9A 1N82A 3QEQB 1T6WA 1GQNA 2BNRA 4LNVA 1CCWB 3NJHA 1YA5A 1TJGL 1K2DB 4I2XA 3BVJA 2VDLH 7PCYA 2XTKA 2Y8UA 3AROA 1WGVA 3KZSA 2XVLA 4ZXBA 1AI1L 1D5ZA 2AJVL 1GOQA 3EJCA 2OW6A 1YN6A 1J0YA 3UJFA 5FW6A 4M3JA 1CENA 3NM1A 2YAHA 2ZE0A 5IJBC 3T1WA 4KK6C 3RL2B 2J8FA 1CDGA 3K2UH 1U8IA 4KTEL 4UFJA 3A6BL 2ZXGA 4R90H 2OMUB 3KZPA 3UO1H 5EU6D 1DQLL 1TQSA 4NZRH 5JIIA 3ISRA 1REQA 3ZDXE 2ZUUA 1OM3L 1OHLA 3RGTA 5DJAA 3KPLA 1JNHA 2ARJQ 3PAVA 3SDAD 4XNZC 5IBLC 5LQBH 5ERWA 2WJZA 3RXZA 1MJJA 3WKPA 1MRFL 3SKOA 1M68A 4NQTA 1OP5K 5HI5C 2DZVA 1KJVB 4H8QA 4JVUA 2VZTA 4PJDA 4R7DB 4ZW5A 3GLDA 2P5WB 3MVSA 2O4MA 3U30B 1F6AB 1IQDA 4WO4B 4L5FH 3KM2A 5E8DH 5IQ9A 4NP7A 2O5XH 1DBAH 4YHOH 4LGXA 2H8XA 1NLBH 3ERXA 3H3BC 2ENQA 3W87A 3RNQA 3ZE2B 1T66D 3KPLB 3MZTA 2Q6WA 1RVKA 1KRMA 1HX0A 3VXSB 1VFOA 1TRIA 2XN9E 1A5MC 4R5TA 3P6LA 1EFXD 3N4FA 2ETWA 1SLVA 2AGKA 2P5WA 1AJ7H 3OZPA 3C86A 2NCEA 1RUKL 2ED8A 4NDMB 3N9SA 3VFRA 4YMZA 2WQSA 4KKXA 4NZTL 2J8HA 3P4MB 1BZ9A 4LAQL 2OW7A 3WS6A 1BF5A 1X98A 3R8HA 3VIHA 1W9VA 1XF3A 5CGMA 3TYBA 4EPKA 4AITA 1JRHH 5AOZA 1KCSH 4F7EB 3B8VA 2FH6A 3AITA 1SOQA 2Y1HA 1YEKH 5E4AA 1GJUA 4RW5A 2DIKA 5CP3A 3QMRA 3UR5A 4ZO7A 1G94A 2NY5H 2J25A 2ATAA 3AU2A 4Y5VA 1PL3A 1CD0A 4KQ3H 1MRQA 1P9MA 3NEOA 1ZY9A 4RMVA 5AL8A 3QCUH 4N86A 3VSTA 3P4MA 3FDGA 3VOHA 2VQ4A 3LSOB 4MY8A 2DTML 5ICYA 2P7TA 3QIWA 1JPDX 5DQPA 4JHVA 3WUWG 1H3XA 1S3KL 3APYA 4IU3B 3AS1A 3VNLA 3ABXA 1R3KB 3FH8A 3WXVH 4TMBA 4LSUL 4POZC 4R97C 1BQRA 3NVDA 3RIAF 3LOTA 4BKNA 4DWSB 2XY1A 3PJLA 5T3ZL 1ZE3C 1MAML 1WRFA 3U30C 1J5OH 4GG6B 2DSWA 1TZ8A 4PW4A 5BV7B 3H7LA 5JW4Q 2CUIA 2OMTA 4GEJA 4XXDA 4G7EA 3RWDB 1I8LA 3HE7C 4Z78B 3GUTA 4P4KC 4LDLB 5BXTA 4E2OA 3HU7A 4TL5A 1UD5A 1R3JA 1AZ2A 2F19L 4WRHA 2C9AA 1KBLA 4QXGH 2CUHA 2O4QA 4KRMB 4B2DD 2X89A 4AZ8B 4TXEA 1YNTB 3BARA 3VKBA 4FYTA 5K9DA 4FULA 2X6VA 1PTGA 2O9OA 1UH4A 3JTBA 4IRJD 5FUZH 1T89C 4FQLH 4UT6A 3AXIA 4K5OA 1L7TL 1M1SA 2WLIA 3HQOA 4Z78A 1PE1A 5DRNB 2C5DC 1Q1JL 2YKKA 5E99L 2E9GA 1BXVA 3VKDA 2EDFA 2WBJB 7ODCA 1I8MA 4K3JL 2ZUYA 2JKSA 5LN8A 4S3KA 1R86A 4RGOH 3HZMA 1H3TA 1S7WA 5C08A 2R1NA 3QI9B 4Y5XB 5IWLC 5CJQH 3I74A 4UILH 3DMMB 3UDWC 2FLMA 2QZQA 2A7NA 1NQ6A 4PJIB 5TJWK 1A7QH 1GKEA 3LKRB 1EYWA 3EMZA 1M05A 4GQRA 2OL3L 1H3VA 2Z0IA 15C8L 1T0OA 2OWXA 5HVHC 2J12B 3T6VA 4JM2F 2F8QA 2I9EA 1GGCH 3D7PA 3M47A 4GABA 3VNYA 4JHMA 4OOUA 1XW8A 2QNEA 3L3OB 2NQ5A 2KZ1B 3D85D 1TQCC 3O2VH 3NFSL 2V7NA 3O3DA 5D04C 4KIEA 1I8MB 3EBIA 1QLEL 1TVDA 2F0CA 3VYNA 4APXA 5FO8A 1FHGA 2TSAA 2ZYFA 3RRXA 3MKGA 4H13C 4X6FA 2ACQA 3EAKA 2UV3A 3BAEH 1LL6A 4N02A 2K6ZA 4YSCA 5AHEA 2CDGB 3KPRB 3NA9H 3WY4A 3GIQA 3JV5A 4YXKH 2XFRA 4U1JA 5HUPA 2VFFA 1WBHA 4AQOA 2R8SL 3CBRA 5FUOH 3QPKA 2QFRA 3I10A 4ZQNA 3NZGA 1S8DA 1T2QL 3QYCA 4P06A 2CM5A 3VTMA 4DCQA 1JCXA 5GNYA 4EWND 5JHDD 3W9DB 4O2CB 2VN3A 4XNYH 2CBJA 1U2YA 5SV4A 2G3FA 1O0VA 1Z5YD 4M7KH 2XU2A 3DARA 4NEHB 1KACB 4I0PC 4PJDE 5GGSA 4I8DA 1I53A 2X4NB 3DJSA 4JG5A 5I1GL 1LWIA 2CC0A 4XAZA 3S3SA 3WHXB 3FUFA 1OE1A 3P62A 1I1AA 4WUKH 3NL2A 3W1AA 4Y16D 3ZJ8A 1GOHA 4XC1L 4N2NA 2D2GA 2NDGA 2OV0A 3FH5A 1FORH 1ND0A 4PJBB 5C92A 1MFMA 2JEQA 2L5HA 1S8DB 2PDNA 3BVWA 4O2EA 4WI5A 3R4DA 4KK8C 3RQ3A 1EF2A 3L12A 4LEOB 5B3JE 2HYMA 2MTPA 1T5KA 5G4EA 3UETA 3UNTA 2PPAA 5BZDB 2R9RA 4TO8A 2X4SA 2EPKX 1O7DE 4U1NB 2ISDA 3IPEA 2APWA 3LHYA 2ZSWA 4LLMA 4OCYH 1DKWA 3UU0A 3WDHA 1E7UA 4HUVB 1WSST 2VEMA 4LSRL 2WNWA 1MPAL 3RPMA 3EYOB 3LCYA 2J88A 4NNCA 1YEFL 5AVXB 5C8JB 3ZBMA 4X3ZA 1C16B 2F53D 5DRWB 3GDMA 3W7GA 3FZUD 4RDYA 1KBVA 3TN6A 3VZXA 3CHOA 2ZCGA 1IAKA 2DSVA 2Y5TA 4ZS7L 3WH7A 2R0ZL 2MTAA 2NNRA 1A6VL 2AFNA 2O30A 3C8HA 3QHMA 2VHLA 3G04B 2W0FA 3PWPB 1XF5A 5GNXA 4B27A 3BHBA 2WC7A 2A4AA 3UGVA 5DK0B 1MWAB 3I9PA 4IJ3B 4HHPA 2R1WA 4NLAA 1NSNH 2VLKA 1KCVH 3NH7H 1C9WA 4LHUA 4LAMA 1UT2A 2IF7A 2ISVA 3GQYA 4PB0H 4YDKL 2DLFH 3QH2A 3QTGA 1WBYA 5JMOC 1UKTA 4ICCX 3GBNL 4UQEA 5DLLA 1YECH 5JR1L 1FCVA 1OADA 2RJHA 3CUJA 1FF5A 3M7SA 4Y9AA 1SUXA 4PWKA 3FCSB 1YQ2A 2FDSA 1DSWA 3F7VB 4ETQA 4OT7A 2JKEA 3VXPA 1AXSA 1HCVA 1JV2B 4HGWB 4YXLH 5J11C 1MRFH 2FTYA 1QWKA 1TELA 2XZAL 4M5SA 1WHOA 3VFMB 4RAUA 4NZ4A 4KXZI 3RA7L 1FNFA 5IEKA 3H9SD 4JHAL 1X8CA 1FOBA 3K8LA 4WHTA 3GC3A 3UXIA 3ATYA 3FFDA 3G8RA 3DGGB 4G72B 3D07A 4WWKC 5BW7A 1M04A 4JQ3A 5BRZA 3P3RA 1MQQA 3NCMA 4XWGL 1OD0A 4BKLB 3VUSA 4XIMA 1UC5A 2JTYA 4NUGH 2NX5A 3CQIA 1XF2B 2QTEA 1J87A 4N8CL 3WNLA 2YQ2A 1SM3L 4W8BA 3SKNB 3LVEA 4IOIB 3IAPA 1ADWA 2YR1A 4NZFA 1FDLL 2PMZA 3OC8A 5DFAA 1FWWA 3UBHA 4TTUA 3IE4A 1UQSB 3EJYC 4R26L 2AABH 3VQLA 1SU5A 2BOEX 5D72H 4Z5RA 1T6VN 3VI4E 4FS0A 1MQKL 1QBLL 5HY9A 1EXGA 2JNZA 1L9MA 2AGJL 4JM4H 3I02A 1TV4A 1IGYA 4NL1A 2ORBH 5E6SB 3TAOA 1KYAA 3DI0A 2K6YA 4AEIL 1UCWA 4HKZB 4LAOA 2X4NA 1EAQA 1QW8A 4BUGA 4LE8A 4GRLD 2VLRA 3HKZA 4OSUH 3RYMA 1XGPA 4CEXC 3H8AA 3FT3A 3VIGA 2Q02A 3MV9E 4P46B 1R2RA 3P93A 3RF9A 3P3TA 1BOGB 4UYPA 3WV0A 2GQ8A 5AW7B 1NFIA 2R1MA 2GK0A 3F58L 4OZGB 3EDJA 4EF3A 1VLXA 4GW5B 1PEZA 2FSDA 2MOQA 4L8BB 4F9LA 2C1IA 2D7TL 3QFEA 5E8OA 4JR5A 1VB9A 3MJ9L 3WFZA 2P3YA 3PGFL 2XN9D 1O1HA 5LO7A 2YPLB 2OZTA 3R0UA 1UWYA 3IU4H 5LIXX 3SYPA 3MJMA 4U1NA 2VXTL 1C08B 1ZT1A 3OLDA 3UWYA 5CPOA 1DVYA 3V9FA 3HMCA 3KRUA 2VDML 3CZJA 4OM0L 3CN3A 4GBDA 1HL8A 2WVVB 4ONGL 1C91A 3UFYA 2Q3ZA 4ZTXA 3O9WB 4ODVH 5AHIA 3BE7A 5AC7A 5B1AB 1HJQA 2VMDA 3N25A 1IGJB 5KSAD 3VXSD 1VEOA 4AZHA 2FFCA 4GYKA 5JW4R 2PR4L 2DIBA 5MP6H 1EBHA 5JW4M 4HU3A 2LFGA 1PLCA 2UZIL 3MC0A 4OKDA 4PJGE 1YEJH 3ZYJA 2QCGA 4ROQA 3QUMB 4JY5L 2BVEA 1QTSA 5AQ0A 2BGNE 5DUPL 2YDQA 3WTTA 3ME3A 5CQ1A 1GSKA 3C2AH 1FFPA 5F6IC 1QNZH 2VDOH 4A3RA 1NC4D 4U1SB 4YUEH 1CURA 3VH8G 3N34A 2OLSA 1L7TH 1G6RH 4DO4A 2R1WB 1OCBA 2R56L 4JDYA 7TAAA 2A99A 3IDXL 1RULH 1Q7ZA 2HV5A 4PMJA 3ZXWA 5B8CC 2V4LA 3GAYA 1MAMH 4HP5A 3WJLC 3GT6A 2YAQA 4Q2ZA 3S96B 4AC2A 3FPXA 4Q8QA 2EXTA 3IS1X 4N2AA 4UIMA 1T03H 5IDIA 3CIAA 3N55A 3BWAA 5DUJA 4L1TA 4K5PA 1UOKA 4HWUA 4YN5A 5KMYA 3CWGA 2QS8A 4DP8X 4DWSA 3FCTB 1UEMA 4KNUA 2WQXA 3VXMB 2VDQH 3AIBA 4G8EA 4DELA 2WSQA 1QLEH 3WFCL 1J01A 4K9EH 3V1HA 3J8F7 2W8CA 3LVTA 3OB8A 3U4EA 4OF8A 2CZEA 1S2EA 2OEMA 1LQSR 1RZ8A 4N2MA 5AW8B 1ONQA 3EPMA 3MBXL 4RRPA 2FUQA 4PTTA 4BKLA 5CLYA 3DYMA 4DEWA 1ZB5A 3E0IA 3ARVA 2HVKA 1XF2A 1GYAA 1KB9K 1J1XH 2WIMA 4PLKC 5FYLE 5LAPA 5ICZA 4K1GA 1A5NC 1JYWA 5IHUL 5KVEL 2Q87A 2HX7A 3SKNA 1IAOB 3AC0A 4NYLB 2GJ6D 3STLB 4EVZA 5BXPA 5T1KD 4NAFA 3BE1L 5L2KA 1UEYA 4PRTA 2QF8A 4Z7UF 3JT0A 4JFTA 1PG7L 5HR7A 2FSEA 1T21A 4YBLB 1HEJC 2VEGA 1E0WA 3F4VA 2UZYA 5KSBE 4XPGH 4XO3A 5CCGE 3URQA 3MLXH 4D6IA 1NIBA 1IAOA 5J8LA 3COOA 4XZ9A 4Z7OE 3SJVA 4RCXA 5CMAA 3P0YH 1Z1WA 2VCAA 1RMFH 3ROLA 4C56E 3TYZA 3UXDA 3H1ZA 4EDWH 2OFQA 2Y06H 3R0NA 1HYSD 3TSDA 4W70A 3M5VA 1OAJA 3QJFA 4ZOCA 4KZDL 3PJNA 4AU0A 3V5DA 3LV6A 4DLFA 3K91A 4LSRH 1ML1A 1TX2A 5KZDA 5B7EA 1MUJB 3JYBA 3GO1H 4HAGA 4Z3FA 3VWJB 5HGBA 1RPXA 3OG2A 2B1AH 2NMSA 4MJJA 3UERA 4XKMA 4PS4L 3FU8A 4P57B 1GT8A 2LV4A 1J12A 3UR8A 2JF7A 3GUWA 2ZOOA 1QMUA 3IDMA 3L5IA 3MTXA 4XMLH 1GHFL 4ZS6D 1IWBA 3MRPB 4GG6F 3LY6A 3H42L 2GIYA 4HU8A 1UZ4A 3QDHA 4HHAA 3KWUA 3WXVL 3ABLB 3FGCA 3VKKA 2Q09A 1M4KA 1S2WA 1YQVH 1NGXA 4KGLA 3V5OA 4UM9A 2WTRB 3D2UD 1DO6A 4ZB0A 2LOEA 4ECNA 1AD9B 3I6LE 4I4WB 5L2JB 1NCGA 3S5SA 4AD3A 3S0CA 1PZCA 1BECA 4S0TD 2GAZB 1RIUL 1AZRA 1POJA 4N5ED 5EMUA 5IBXC 5B1JA 1OO2A 4MQ7B 3TH3T 1LRNA 4H8WC 2F19H 2ZT9C 2NCMA 1OV8A 1BVOA 2CLKA 5HINA 4HA0A 2FB4L 4X9IA 3WEXB 3FGCB 3VI4A 2WXPA 5D33A 3BYYA 3T0CA 3WO3B 3AB0C 3LEVL 1J5IA 4HNTA 4B96A 2V69A 3W86A 3BWAB 3EJPA 4AHPA 4MD5A 2NZLA 3MXWL 3ULVF 2WHKA 3WAKA 5GGSY 4ZFOA 3DVNB 1LO2L 3FCTA 1L0XA 3QK0A 1GVYA 1IE4A 2WNNA 3TR9A 4K94H 1FNHA 2CGYA 4K3JH 1U58A 2L04A 4NNPL 5K93A 1S9VB 4BUHA 4EX4A 4LLVA 2BNQD 4EACA 3FU9A 5I66A 1UUMA 3CEUA 4JFPA 1UB6A 1N5AB 2OKTA 1RH9A 3WEXA 3RVVD 1U8LB 5JA8B 1H11A 5E7FA 2X4UA 3NQEA 4P05A 3ZE2F 3NFPA 5CPMA 4W6WB 1A4KB 2G9KA 1DEDA 1Z2KA 2PXYB 2YS4A 2KX9A 1OAYH 3B3DA 4KRTA 3DWTA 4AYID 3U2ZA 3A0OA 3IMBA 2VLKB 3GMLA 3ARDD 4LHUB 1W9PA 1OGPA 2VEKA 4UCGA 3CK5A 3ATFA 4PY7B 3PL6A 4RMTA 5C86A 2P8BA 3YPIA 2V17L 2DKSA 2CK0H 3JVGA 4MD0A 2CMRH 3N41F 1OT2A 4JFPB 4XB3A 4Y9FA 1D9EA 5FUZL 1EPXA 3EZJB 4AD4A 1I1AD 1QA9B 1S9WA 2RCSH 5AOKA 4PWFA 3VX1A 3CLEH 2ZCKL 1G7MB 1GSMA 2FNWA 1KV8A 1SGJA 1U1JA 2R8SH 1AO7B 3EPNA 3TZVB 5AN7A 1Q1JH 4G6AD 1XFBA 1UWGL 2GVYA 3IFNL 4XCYA 2GG1A 4R8WL 3TN0C 4DUWA 1C7SA 3U1SH 1LHZA 4MASA 4PJ8C 5JHDA 4GO8A 2EECA 2X42A 4JO1H 4HXBL 2NX9A 3UTSB 2HRGA 1AC6A 3FL7A 4MD0B 3P4NB 4AYEC 1R3QA 2O72A 4OLUL 4G1EA 1L5GA 2LABA 2H3XC 4PVLA 2CLOA 4XZNX 3VE0B 3UZEA 1TNMA 4GLEA 1IIGA 1RPUA 1UB3A 3MU3A 1XUZA 3VGAB 2ZZ4A 3HOJA 2AJYL 2VQ1A 1YEIL 4QE4A 1EDHA 2ZQKA 5GHWH 4GUOA 1MUJA 1H7XA 3GH4A 2VDKH 5IJVB 5AB1A 3T6XA 3WD4A 5EU3A 5IXEA 3IJ8A 2PYFB 1W1PA 2EO7A 2PPDA 4QHNA 3US9A 3PBGA 3UL4A 3MNDA 1EJ7L 1YEJL 5I15H 3R12A 1F00I 2VISB 5EN2A 1OSYA 4MA1C 2UX6A 4XHJC 3SDCC 1NBVL 4YHYB 3IU3B 5D7LA 4AYBA 1EJXC 3O0FA 2D7TH 2WYIA 4LXFA 4M48L 3ZWSA 3TW7A 3IF1A 4UUJB 3QHFL 2J71A 4B91A 1NL0H 3IPFA 5ITFA 2DT0A 3TBBA 2XTJE 4JDZB 1DZ0A 4LNRB 4EBQL 1S1RA 4M6UA 1HXMA 3RWFA 2ZAGA 2H2PC 3OL2A 4GP5B 3VFGH 4NM8L 3N3MA 2R0ZH 4W9CC 5EZIL 1A1NA 3LS5L 5LGHH 3H54A 1J10A 1E3XA 3NIFF 1NUFA 1HOCB 1B3YA 3E2RA 4JIQA 2FHCA 3NK3A 3NK4A 4YVVA 3STEA 5LNSA 4XTRD 1A3QA 1CK0H 3N43B 1E6RA 2GTQA 1GGYA 2CZNA 1NMAL 4FQCL 4WENB 4BF7A 3WFCH 3BLIA 1WKDA 4JFED 4KETA 4NG3A 2A3EA 3OVQA 4WI6A 2DLFL 3FX4A 3TCXA 2FVKA 4P7NA 5CSYA 1E4NA 4MJ4A 1TXKA 3VRLF 5T5FL 4EIZC 3SIZA 2WQUA 5FK9B 3SDDB 3FQRB 4UMAA 4PJ5B 5DFVD 5D7EA 5IM7B 1W3LA 3INPA 5MEPB 4HH9A 4ZFZB 3IFPB 3N3EA 4XCNA 4LQFH 4QDGA 2J24A 3WIFA 3MBWA 4LVBA 1CIUA 5ELIA 5CJ5A 3P2BA 1CE1H 4L4TE 4M4PA 2ALDA 1MW3A 5D6DC 3C5JB 1SHXA 4QRRA 3BJFA 1E1EA 3LGDA 4ATWA 3G5VA 3HQNA 3EJTA 2M1KA 3NO1A 1YCSA 1VFBA 4OD3H 1CICC 5FK9A 1SJXA 2BNJA 1DEEA 2JB6A 4IIQB 4LVEA 2ERJC 4NVTA 3W2JA 1GG1A 3EH4B 3DK2A 3IFPA 2WYHA 4XCNB 4JG1H 2COQA 3MP5A 3H2FA 2AJZB 3N73A 3NN8A 4OY9A 2APXA 3V0FA 4YDKH 3FKKA 4FOKA 5M03A 3O3AA 3U57A 1G7MA 3CC5B 5TH2A 2EPLX 4FXGC 3MZ2A 3P3BA 4Q4SA 3TZVA 3RILA 1X6LA 1EHLL 3KTCA 3HG2A 1DHKA 2EIMB 3SDOA 3T0ED 1D5BB 3JQOB 4F5CE 3XINA 1A5OC 3DO3A 4BZ2H 3RKDD 4LLDB 1BXAA 2DW5A 4J6RH 2AJSH 5H2BA 1FUNA 3SPVB 1PZ3A 4I5UA 2R2HB 1YEGL 3IN2A 4NQEB 2RH9A 1QRNE 3SKMA 2VXUH 3F2LA 3MLVH 4HC1L 4A63A 3GVWA 2QHRL 3B3IA 1FFOA 1WWBX 2IQAB 5D2LB 2IMRA 3FSUA 4ATDA 4MUPA 2WZ0A 5GRVL 2HTLC 5CSBA 2XWEA 1BX2B 1CYXA 1F3WA 4QDPA 3UQNA 3QWQB 2VKZG 2DBLH 1D5BA 5AB3A 3LCFA 5JOFB 4Y4FB 3W7IA 3UMNA 1ZAHA 3AT0A 3QQ1A 1EJ8A 5K9OA 1JCLA 3PGFH 5E23A 5AFAA 4BRVA 1RIHL 1K8YA 1G7PA 1DJXA 1LDCA 4WSHA 5AC5A 2QVMA 3UESA 2KKQA 3SJ3A 3BH9A 1BFOB 5E00B 3K6IA 5EN2B 4YHZH 4ZW6A 1A49A 2ON3A 1NC2A 4PD4J 4OM0H 4ZUSB 2HPTA 5D1QB 2V81A 3IDJA 3WSQH 4NX5A 4FI6A 1OCWL 4TLTA 1QUMA 2VDNH 4I7UA 4O1AA 1GK8A 1J6PA 2QGBA 3D2TA 4MNQA 3S2NA 4FKKA 3RNQB 2EF9A 2R2EA 3RZCB 2HCZX 1MKFA 5FWQA 4WEMB 1BTMA 5DRCA 3HGRA 4D71A 5AKSA 5DEFA 3WH5A 4NJHA 5IHZB 4TNEA 5A6SA 1QPPA 4K5NA 2PW2B 2X6UA 4AXNA 1P5VB 4PJCE 3RWIB 4WI0A 1NCBH 4YBLC 3QV9A 3JZ7A 1W1IE 5DT1L 2Z92A 3E6FB 4R84A 1RCOB 4KRPD 1L8NA 4QCEA 1B0WA 1I7UB 3ZDZE 4K9JA 5TK4A 1BZDA 2YFOA 5AKRA 2G2RA 5FOJA 4ZDHA 1NCOA 2HLFD 1E8ZA 5SWSB 3LENA 1OB1B 4GVIA 6PCYA 3IU4L 4JX6A 4OU1A 5AYYA 1LYQA 1QFOA 2YSTA 4LRNL 5FYLD 2QL1A 4GLRI 3Q2WA 4IBVA 3GGWB 3NCJH 4KJQC 1IEXA 1LK2A 1HE8A 3HZVB 1WUEA 1ADQH 3H2OA 4ZENA 1CW2A 1TCRB 5EMJA 2FLBT 1S39A 4W5ZA 4LC8A 2CCVA 3MLWH 2A3LA 3UR7A 5T5FA 4DZ8A 3WKML 3GVVA 3LZRA 3MDUA 2IAMC 3C60B 1KFAH 1D5XB 1M6OA 2ICEC 4YL4A 3EZ8A 4LPWA 5ICYB 3DXAA 1QSFA 4YTQA 4ZDHB 5SWSA 1NAMH 2G2RB 3HHMA 4LB3A 3VW3H 3R6IA 5D5MA 3S35X 3W7QA 3WZ0E 1WLHA 4C83A 2MCAA 1DDTA 2BNRB 4MWFB 1ZLDA 4MLIA 1K2DA 4I2XB 4PI0A 1IM9B 1ITCA 2XKNA 3H9SB 1Z8AA 2DUZA 5I19H 1QWHA 2BXYA 3GMMA 3V0SA 2OMTB 3VD1A 4XVSL 5KYUA 2V5DA 4PBFA 4DJDD 2FATL 5TPWL 3AIVA 1PUDA 4F0LA 4UT9H 2OEJA 2VLJE 3MUCA 4DF1A 2NR6D 4XXCC 4KK5C 2PE4A 1JNLH 3FOMA 3RU6A 4LFHG 4US5A 3F4WA 4QOKD 3QWRA 32C2B 4HEPG 1BPVA 1KNOB 1LE5A 4HNVA 3PR2A 4GQZA 3MV7B 3CSPA 1FWFC 4CQDA 2DY3A 1GVRA 5EHFA 4OT1H 2HLAB 5D2XA 2IO5A 3T4AA 4A6YB 5HJXA 4ZSOA 3G77A 5C70A 2IOIA 3FVMA 2VSMB 1UPPA 4Z7VE 1J18A 5AHNA 3KJ6H 5AZ2H 2X4OB 4FXKA 1KEGL 1DBJL 4J7RA 1PDKA 3RMJA 3ARDA 2QR0A 4E9TA 5GGTH 1ZPTA 2IQAA 1KM3A 2MIZA 4AV4A 5B38A 3HPSA 2YPKA 4JS7A 3L4VA 2RCSL 4NKCA 2XIBA 4CKVX 5I15L 1BYNA 1U8PA 3L81A 3MYJB 4FTVA 4KROB 2DI7A 5I1KL 2FJFB 4JIRA 2VZ3A 1J1OL 1LOQA 2D7OA 2NY7H 1H9DA 1C1EH 3Q58A 1LO5B 2NUTB 3N9GH 4XZIA 2PPCA 4ZRGA 2MCPL 2VTFA 5JW3H 3MRHA 5FO8B 2MCG1 1LG2A 3MLRH 1WB0A 1KELL 4NDMA 2BERA 3I50H 5L7XL 3D39A 4XKYB 4D8ZA 1LTXA 3Q8CA 4Q9QH 2YD6A 3TJEH 2K3TA 3K0YA 4UZSA 2XHYA 3RLVA 1I1FA 1I1RA 1MJ7L 4XO9A 4AH7A 3VNDA 1OOAA 5IBTH 2C1GA 2DQXA 4IMGA 3NCYS 3ITOA 4K8RD 3RWGA 1D8CA 2I7GA 5IEHA 2VDRL 1LO5A 4Y4HC 2AXGA 1LK3H 2PW2A 3FH7A 1UBPC 2ISFA 4TV3A 5IW1A 1OX6A 1LILA 1XR2A 2CJTA 2CPUA 3BP5B 4HJIA 4EXPX 4IKLA 4OUUB 1LEKB 2ZTJA 3AYRA 2Z92B 2R0WL 3E6FA 4TQHA 2OMNA 4Z7NE 3GSMA 4P8XA 3L5WA 4UMSA 4EDWL 4OGYH 2WXKA 4ANKA 3QEGH 3CL7A 4QROA 3DTXA 1NCUA 4FTVE 1H1YA 3K6DA 5I06A 2VDKB 4O2EB 4F8NA 1ENUA 2FWUA 4LMQE 4GH7B 2IQ9L 5TBOA 1FWAC 1CBVH 2VMJA 4HG4K 2OYMA 3PFRA 3MCOA 4YDLC 5FW8A 4HKJA 2NV1A 4DZ8B 3GU9A 4DAIA 1XQKA 3BUYA 1QSVA 3T0XA 1HXJA 1QK0A 2B4CL 3ULUC 3II2A 3WDPP 1ACYL 2AJXH 2HT2D 3FBKA 4DP5X 2MHAB 2YD1A 4P23A 3LQZA 5ECGA 3VXRB 1MRAA 4U3XA 4JRYB 3CSYA 2EKSB 1SJAA 4D8AA 5LNVA 2JBMA 4W1TA 3G24A 2WNKA 3PWPD 4OVUA 1UWEL 3KS5A 4IJTA 5EBLA 4X9HA 4MPKA 2WHLA 3AU1B 2BNQA 3EF4A 3L9RA 3MWCA 3LZQA 1U83A 3K72A 4GXUM 3GZOA 3E80A 3UMTA 5LGYA 3MKCA 2DEXX 3AIRA 5GS0D 4CGTA 1OG0A 3H2EA 5E0CA 2CUMA 3HR5A 3MRLA 4J2QA 1SY6A 4OM1H 4Y8EA 2HT3D 4HQQH 1NOUA 2VFDA 4J35A 3BGFC 3TVMC 4UT7L 2AJSL 1J0HA 3GD1C 4R7XA 4LSQH 4UMGA 4QJ5B 2LAAA 5HI4C 2W4XA 2H9AA 4O51A 3R7RA 1XUUA 1L3NA 4PCKA 4N0UE 2WTPA 1A8ZA 4WKZB 4HJGA 4FTDA 4PJFA 4L9XA 2ZX8A 4NNBA 4EQ2A 3B7YA 2NLJA 5CCZA 3CU7A 4GZIA 2DDQL 3MUGB 4LT9A 4QY8B 3CAFA 3ECVA 1F6FB 1URZA 2PUZA 2G4JA 3TCEA 3MP3A 4BQ8A 4JZ5A 1BYOA 2AQNA 3C5JA 3KPRA 4CVXB 2EZ0C 1YTEA 3NQFA 5AENA 1JS4A 3RTQB 2KZBA 3EXRA 1MCWW 2EDOA 4PYGA 4TOYH 3LI1A 3L1GA 4WY0B 2GFBA 4QRTA 1CQYA 1BTCA 1Y07A 2LFEA 3UJTH 1O6IA 4HOWA 4AC7C 3OJVC 5IKCB 4A3QA 3SCQA 3D39B 1P7QB 4KJYB 2WYTA 4MFHA 3GD6A 1ZANL 3ARUA 1WCQA 4Y8DC 5B1KA 2PABA 1PZSA 2XTJB 2ZOTA 2QHRH 3SDYH 3CK0L 2E9IA 4H00A 4RKAA 3VC6A 2DWDB 4PJHA 2ITFA 5IGXL 1GEHA 3OGCA 3SFWA 4MNQE 1HCYA 1DQJA 5GS0L 1ZENA 3EFFB 4M7LL 1Z32X 4DFHA 2D2OA 4YLBA 2G97A 3O6AA 4HCDA 4LNYA 1W3HA 1XM3A 3QSRA 4F40A 3W25A 3B8WA 3POCA 3DVIA 2R0LH 2X4SB 1IQDB 4CJ0A 5JIDA 3ZZQA 4LRNH 3MUAA 1CFBA 1XH0A 4KKBD 4N0FA 1UA6L 1XGPB 3C8DA 1T1XA 2XIIA 4YHZL 3W00A 3X1BA 3HAEA 1IYXA 2V3DA 2AJYH 1O94A 4Z8FL 1DBTA 2C9SA 2GK0B 1DJNA 1F7BA 1EFZA 1XLHA 1LQAA 1V7MH 3PGCB 4XMPL 3VXRE 1QHZA 1PLAA 3PWAA 5DJ0B 4L8BA 2ZRWA 3SECA 3URBA 4C58B 5AVVB 1RZJL 1BFOA 2VERA 5E00A 1H0DB 4LB8A 4EQ3A 4FABL 3H4WA 4F4RA 3N5AA 4ZUSA 1XLAA 4DN4L 1QOPA 2X12A 2Y62A 3HNSL 2WMIA 3HC3L 2Q8LA 1SHWA 4ES4A 3SGZA 4P2RD 2UZ9A 3SN4A 1EAJA 4UINL 1LEGB 4I1NB 4UQCA 4NQVB 4F5CA 1W3TA 3ZLFA 1B5TA 3KPMA 1JOIA 3V0VA 3EPOA 4BF9A 3B9AA 2E9JA 3BXNB 4Y2WA 3CUPB 1AO7E 2Y69B 1D9KA 3ZDXF 3K0WA 4MXVE 3W1UA 5EBLB 2TYSA 1OM9A 3QT2A 5EEXA 1PHWA 4HK0B 2QKSA 4KJWC 1HCFX 5CJQL 3IUIA 4KQNA 3DV6A 2ZYRA 3E3QC 3QJUB 4MAYC 4PRIE 3ZPDA 1OEPA 2P24B 3EX2A 2W0UA 4XVDA 4HMNA 4QGYA 5AZ1A 4DWSD 4Z1AA 3IIPA 3TN0A 4NT6A 3VMOA 4Q6IC 4PRHD 1CFQA 3ZVHB 4YS1A 3HN8A 2Y8KA 1FFQA 4NFBA 4NJGA 1J0JA 3O2WL 3UBXA 3DKHA 1BGGA 2Y63A 3SUTA 1BYAA 3R58A 4RAUB 5BQ7B 4HUCA 4TLKA 3QN3A 4JFHE 1NCNA 4V1DB 4PRAB 5EZJA 4WHTB 2A77H 4GUHA 4K2SA 1TPVA 4QXUL 5TDPA 1NCHA 2X4PA 1L2QA 4NZRL 1GOFA 1AZBA 1FNGB 4H8UA 4KKNA 1FVPA 5CILL 3IBOA 1D7KA 1B88A 1TJMA 2NNAA 3CU1A 4QRAA 3STFA 3C5QA 1SN0A 4KFPA 4HD5A 1RZ7L 2B8OT 2YXFA 1LL7A 3RWEA 4OZHA 3PIQB 3V4PA 1NIDA 1W3IA 2PRHA 1GW6A 4ZQTA 3HBLA 4PMNA 3U3HA 2DLGA 2ADJB 3QE5A 3G1AA 1K5NA 3GDRA 5KYUB 4YDMA 3T9WA 5KS9B 1MWAL 4JTFA 5EL1A 4Z0JA 1DBAL 1UD6A 2WMJA 4FF9A 5F6HJ 2C4XA 1ONQB 2P28B 1HKMA 2A38A 2RFXB 1XSIA 1DQML 3I02B 1UHVA 3AAZB 3QPZA 2Y85A 5IR1A 5EBUA 2PP8A 1WCBB 3W1PA 3Q8EA 5D1ZA 4F8TA 2ALWA 2VLRB 1DBJH 3HI5L 2ZRUA 4LUTA 5JUEH 4RV8A 1KBBA 1OD7A 2ABBA 3TZNA 4LP8A 3WNPA 1QR1B 4P7RA 3QEQE 3TA9A 1TITA 2G2PA 5IMKA 4NN7C 4A7UA 1WC7A 4AYFB 3GXPA 1BD2E 2ZP8A 1R19A 4RE0A 3WSQL 3ZTNL 4AT6B 2MPAH 3WK2A 1F4AA 3OZ9L 3NSDA 2UVFA 1W5PA 3QQ9D 3HQ1A 1CIDA 1N59B 1PDKB 3EUDA 1V3HA 4HZ7A 5BV7H 1PCSA 3T81A 1MPAH 4NZCA 3ESMA 1U5VA 2DF3A 3SBWA 4DWHA 4S1SL 1X5GA 1KCZA 3I50L 5L7XH 3BT0A 1SF5A 3FDWA 4JGNA 3PWJA 1XRTA 5IMKB 2R15A 5GJSL 3QPQD 2PBOA 5DT1H 1AA1B 2XH2A 1NJ9A 1OVDA 3P74A 1SYVB 3BD3A 2PF8A 4O2CA 1KMGA 3DGCR 3HNVL 3MJGX 2BVQA 1NH6A 4JOMA 3GSUA 4N1CA 4OCSH 3RPBA 2DM4A 3MMEB 3EFOA 3RPDA 3RLUA 4TNGA 4WUIA 3FQXB 3MRQB 1ZLEA 5FYLL 2J20A 5J06A 4R96B 5F89A 2QCNA 3DBNA 2X4TB 4QTIH 5E2UL 2H3BA 4GMTL 1BEYL 4A2DA 3ABQA 3NQ7A 2J4WL 4J4PA 4RDQF 4WEEA 3RKPA 3WGUB 3T3PE 3T05A 5BWFA 2NNXA 4MA7L 5F0PB 4J4KA 1DUYB 1AR1B 2BSRB 5E4EC 4FQ1H 3FQYA 5CJ8A 1GYNA 2EXWC 2CRMA 1FZJA 1NP2A 5L2JA 4KEZA 3EB2A 2YKLH 4NZUL 3XISA 2AXGB 2OTPA 3DJZA 4AC4A 3AWNA 5HNRA 1YNTF 5DHVH 2KI6A 2QLVB 3QUGA 3RX9A 3UACA 1XLDA 3D18B 3HS9A 3WQCA 1IZKA 3NQDA 1KM6A 2NY5L 1V05A 2EEXA 2A3BA 4X9GA 2X4TA 3L2IA 3T2QA 3PDDA 5CC7A 4AQ1C 2VN5A 3R8RA 4OFYD 1RFDL 3Q0HA 2OTUB 2OTWA 4NT6B 4XBGA 4F7EA 1V08A 3DKLA 4AVHA 1TWSA 1Y1UA 1B9BA 1DL7L 3RTQD 2FATH 5DTFB 1WHPA 3N4AA 1C16A 5DRWA 3GXFA 3NIGE 5J0BA 3WFLA 3T6CA 1OL0A 4QNWA 4RETB 3CXHK 3EX6A 3NPUA 5CZ0A 4AZBA 4JFHD 4HYVA 4YSDA 1UQYA 3MVTA 5A8NA 3I85A 2WLYA 3CFQA 2DQFB 5ABGA 1KPRA 3DFSA 1CTMA 1T22B 4GQQA 1GZPB 4JM2A 1HKWA 4PODA 3IMVA 2ZRXA 4QO1A 2R2BB 3L3JA 3P8JA 1ZV2A 1BVLA 3O6LH 3X12A 1KJMB 2ROYA 1PPIA 1Y18B 1KXQA 2I26N 3F6JA 4MAUL 1YY8B 3L16A 5AW5B 3NFNB 2BNUA 4B5ZA 3UPWA 4G7VL 2GSGA 2VXQL 4G7EB 2QAPA 2QSTA 2GTWB 4FI7A 2QVKA 3ZT5A 2W67A 4O13A 1O5PA 1QRNB 1NCIA 1G4RA 2CWRA 3GMNA 5I6OA 4ZMQA 4ZPTB 1G7VA 1OFAA 1W8SA 4HB7A 1U3YA 4LEQA 4JM0A 4GIYA 2PYED 3WJLA 3FUJA 3KPNA 1UZHA 2PAJA 4Q22A 2OK0L 1W56A 4P2RA 4PJ5D 4MBRA 2VGGA 1VP5A 5TE4L 3N50A 5C7XH 3DENA 2EICA 4CNNA 4JFQA 1DE6A 3HOGA 2WZHA 3Q48A 1BQUA 3BQ5A 2VAAB 2EYTB 1D9KD 4TVPE 4U31A 5E4OA 5KVGH 1NM9A 4NBZB 5IIEB 3P8IA 4IJCA 1IBFA 4R9OA 3PREA 5EOCJ 4ALAC 3G6DL 2OKOA 4MJ2A 1GKPA 3F7JA 3QZNA 3JWOL 1KFCA 2X30A 5F7HA 2YD4A 4XO7A 2DUXA 3QJFB 1J93A 4L1SA 4M7ZB 3UAJC 2NX5B 4FLSA 1FORL 1DN0A 2YSSA 4IU2A 1CLZH 5C0BB 5EEUA 4LUYA 1FI8C 4QS5A 3OX8A 3G22A 3S1UA 5I2IA 4K3EH 3VWJA 3DZ1A 4DYEA 3ZDZF 4J40A 5CD3A 5BYWA 3LKRA 1OCJA 4IPJA 1LK3L 1WUNT 3Q9PA 4YXGA 1ZHKB 4GKNB 1BVKA 5C3LD 5LNEA 2OMAA 4N9BA 3ZJ6A 2O92A 4W86A 4WIWA 3ZJ7A 3WQ6A 3L3OA 4XD3A 4QRBA 4X42A 3C2AL 1EIXA 4DAGL 2BVQB 3D3VD 4TQEH 3MSYA 3N6JA 2CJUL 4P46D 4HKZA 3W0WE 1QASA 4NO3A 3ZYZA 4GX9A 4CQBA 4KJYA 5C5YA 4HJ0D 1E4XI 4O02A 1YKWA 1VFAB 3MLRL 4L3FA 2RGSA 4P4KB 1OALA 3ZRFC 1H2JA 1S1PA 3AICA 3KVJA 3QYQA 1LZOA 2J79A 3MO4A 4P49A 3NCOA 1WS8A 4OZGA 2W65A 4KFMA 3CZKA 1BP3B 4Z1PA 4UR7A 1E5ZA 3BPNB 5CM1A 3HC0A 2X6AA 2CBIA 3TESA 2Z93A 3C6SA 2VWTA 3O45B 4LF3A 4N2FA 3O1NA 4EIGB 5F2IA 4UFIA 4XP1L 2J7CA 3UJSA 3TBTB 3PXJA 1ZGLB 2VR3A 5T8IA 1H50A 3D0LA 5LNRA 1XSOA 3C5ZD 1BGXL 3SAZA 4ODXB 4GS7C 1NSNL 1JDDA 1QVOB 2PTZA 1AHWA 4L1BA 4AYGA 1K4GA 2KZHA 5H8PA 1JDAA 1VJSA 2XNAA 1ND0B 4J3OG 4RBPK 2ICWA 5BJTB 3W5NA 4JTQA 2W65B 2CW6A 5DD3H 3PGCA 4XTDA 4OF3A 1DJSA 4JHWL 1YXDA 3GSRB 2ZA1A 4FXKC 3VRIA 4KKZA 4JFDD 5E8EB 2GUOA 5HDBB 3A67H 4PJAF 4FFTA 1T41A 3VXTB 2VFIA 4CADB 3AJXA 3SGEI 2XZAH 3MNVA 3VUPA 1ZLSH 4LVAA 4QKXB 1EX1A 1JGEB 2AQ2A 4YMPA 3PPHA 5T3ZE 4V11A 2B4CH 3D4GA 3GXMA 1TENA 3BH8B 4MCYB 3GR8A 2X05A 4CNOA 1GZGA 3L3GB 1S7VA 3WLHA 2P8PB 5F1NB 1AFVH 1P5UC 1GHSA 3LS4L 4REQA 3L3KA 2YCKX 2IEPA 4LSVH 1VF5C 5I74B 1GPFA 4PY7A 3IACA 4W8LA 1W72H 3MZNA 4K8EA 2QQNL 5EOCL 4E9WA 4NUGL 5CN2A 2GQAA 1KCVL 3NH7L 4N0CC 2VC2H 4NWUL 2DUAA 2W5FA 4CADA 1B4JL 1OK4A 2JALA 3MNVB 4W9JC 3CLMA 3VXMD 3W88A 4QTGA 5CHNA 1KF9B 1JGEA 1QOKA 3U83A 3UP6A 2YFNA 1WFOA 3ATAA 5IFJA 1TTGA 2WB1A 2WXHA 5T3XL 2E7BA 2F8XC 1BMGA 3US1A 4PG9A 4HQQL 3QQWA 2YZ8A 4ADUA 4N8VB 2W80C 1IXPA 2OMWB 5F9WC 1CD1B 3RJQB 4C4BA 3EYQC 2J5LC 4KY1L 3TQKA 1OY3B 2JB6B 3M1BA 1OE2A 4C6NA 1M53A 5HJLA 4C1NA 3UABA 4KXCA 4LAUA 2Y5SA 2EVIA 3S5NA 4HUMB 3NN8B 4CNIA 1PY0A 1R3IH 3UPCA 1E4WL 2TRHA 4F3FB 3OQEA 3F7VA 1HVXA 1Q8JA 1MNNA 1PSCA 1BWLA 5GS0C 3STZB 2CLVA 5GS0H 3C4UA 4LDEB 4E41B 3X14B 4U1IA 5BVPL 2DZTA 1AQKL 1UD8A 1UZ8A 3GK8H 3QNFA 5DD0H 4LPCA 2R0LL 5C0AD 1R3TA 2PLTA 3VKJA 2JIXD 3NJLA 1UVQA 1WZLA 3QOMA 4F2MB 2HAZA 1WISA 2Y6ZA 4KPHL 5C9KA 5K5YA 1N0XH 1RQBA 4JFUA 2JEPA 4KZEH 1XWYA 3VA2C 3LLDA 2AAAA 1NA8A 4B50A 3CASA 5CSRA 2QDWA 1X7SA 3DX8A 4ODVL 2APFA 4G1MA 5TDNA 4G8FA 1PVHA 4TUKL 4PP1C 4XE0A 4OLXL 4DN3L 5JOFA 5AKQA 3UPMA 3BXWA 2YAFA 3CN4A 5JHLH 4KXZH 3FQUB 1QI4A 2DORA 4IMEA 3TT1H 3M7WA 3PF3A 3L8QA 4GO6B 3HC3H 5ISZE 1JTPA 2XA8H 1HL2A 2OBGA 3BRGC 4KX9A 4BK5C 3MODL 4HEME 1TIWA 4Z08A 2X6MA 4B9IA 2TMDA 3D85A 4YE4L 3A4AA 1OFQA 5FJIA 6PTDA 1BBJA 1GPOH 3P2DA 3U0TA 3U7YH 1EP1A 2YC1A 5D03A 4EP8C 4ES8A 3ULVE 1PG7W 3MREB 2Z1XA 5ANMB 2I1OA 5GISH 3KPRE 3WXWL 4BZ1L 5E2UH 4F80A 1N8OE 5I1DA 4A2EA 2ZRYA 3T9PA 4ZMWA 1YX1A 3A23A 3QVQA 3HN5A 2NYKA 2DJLA 3VRIB 1S7XA 4JGDA 3MMEA 5C6TH 2GVGA 5HYIA 2HFFA 2YUVA 3ABSA 1THCA 3AVEA 3FQXA 3MRQA 3O6LL 1OE3A 2WLZA 1H4PA 4GC3A 3LX9A 4I9MA 2P5PA 3BPLB 1OB1A 2R7EA 4JRXD 3WS3B 2YQGA 5BS0D 1GQIA 2VR7A 1AD9A 4I4WA 5DF0A 3L7EA 3LDBB 4MS8D 5AW1B 1AD0B 2A9NH 2HG0A 2CK0L 2J1KA 1UWQA 4C4KO 1F5WA 1MQRA 2HJKB 4PGEA 4I3RH 3FEQA 4MDOA 1ZHBA 1A1OA 4Q7DA 4Q14A 1M7JA 4UTWC 5I02A 3EOOA 1ECYA 1M6OB 1MCBA 1LUCB 2IAMD 3PZUA 1QSFB 4Y2DA 1S7QB 3MY9A 3S2JA 4HWNA 3DLQR 4Z7VB 4ERSH 1J8HA 4J8RA 5KVEH 2BFGA 2QCDB 1CGYA 3N19B 2AV7A 4MWFA 3I3DA 4AWSA 2YD9A 3T04D 2WKJA 4HSOA 2WZ5A 5H2ZA 3GSNL 1ZT4A 3UTPD 4BFNA 4AMCA 1SOSA 4XVOA 3AMCA 3QQ0A 2CKBB 1RIVL 2DEYX 3HE7D 4AVKA 1F5ZA 4LL4A 5DZAA 3QR1A 4BI6A 4Q2ZB 1ZTVA 4ZQOA 3W7CA 5I8CB 3LKPA 3FF7A 4Z7VA 4LV4A 3AIWA 4U1LB 1X7QA 3NFPB 1YTKA 1KKOA 3N17A 4Z6AT 5MEOB 4F3FA 4HNOA 4P4KD 2GWNA 3BD4A 4Z95H 4ZAKD 4E42A 5E5CA 1CF8H 2CLVB 3QCTH 4XZMX 2I7OA 2P5WD 2DQWA 4PUNA 1LP6A 4E2BA 5HA7A 1KV7A 1X5HA 3T4AB 1UR0A 1YNYA 3GJFK 3WNKA 1GZHC 2CJUH 5F2LA 1CQKA 1HUVA 2W81C 3HHSB 5A6MA 4YTRA 2G9HB 2YZRA 4XO5A 1TWZA 1FCUA 1EJTC 2AL1A 2Y1ZA 3JV6A 2BSSB 2YGNA 3L7RA 2PTYA 4YGVB 4LJ3A 4NN5C 5FM4A 5KBKA 4RJEA 2YGPA 3JWOH 2A0LD 4LLUA 4JKKA 1UWXK 3FCUB 1OFOA 1WKYA 1D9KC 1MRCH 2FJFA 1CLZL 4RGNB 3Q3GB 2GHZA 3S35L 1MLCA 4AWTA 3AISA 4BZ2A 5TE6H 4H20H 4FA6A 3G3LA 2X8RA 5A2AA 3A4EA 4OV5A 3AI0A 1GS7A 2ARJA 3VOFA 1AH4A 4P8UA 4GYBA 5JZ7D 3QORC 1UXWA 2VWSA 1KGYE 2FGWH 3WJMA 4NGHH 4MLSA 1L6SA 1VRXA 3TX9A 5C2CA 2IDSA 2NSXA 3LOWA 5BUPA 3QFJD 4QRPA 4H0LC 3AMLA 2V8ZA 3A4WA 4HK3J 2VL5A 3LTSA 5DBUA 2DMKA 4L9YA 4PLOB 4D2JA 3WNOA 3B6SB 7FABL 2E8ZA 3LM7A 5I5JA 1NGZA 2PTVA 4J3TA 1JPGA 3PWUA 5E8NB 4Z0BH 2Q76A 4M3PA 1IXOA 1R87A 3IKCA 4KVCL 1GYMA 2ZZ1A 3QY8A 4LEXL 4GUJA 2ZUVA 1T4KB 4GHRA 4H88H 1I2PA 5DRXB 5FEWA 1XGQA 1TZOA 5C07D 3AGWA 1GY1A 5IFHL 3ABOA 1KTLA 1AR1C 1KYFA 3I75A 2VC2B 1XLGA 2HFEB 3QEZA 3VILA 2C16A 2ZQ0A 5IQOA 2QV2A 2JLLA 4GFTB 3LTYA 4C60A 4H0GA 2PB1A 3VXUA 4KKQA 2YLKA 4AQZA 4NKQB 2PRMA 2X70A 2NY0B 4TVPD 3GBLA 3HC0B 1YQVL 2F18A 4DW2H 1ME8A 2Y70A 5DLML 1A4JA 43C9A 2Z93B 2QMKA 3C6SB 4YVNA 1JXFA 1H5VA 3UZZA 3O0LA 4N5UA 1Z9NA 3UBGA 3D6GA 3OJGA 4AHQA 4OZGF 1ISZA 1V3JA 2JI1A 4W4OC 1DQWA 5CLZA 1FRGH 1L9RA 1XH3A 2F53A 1KTLB 4JFDE 1AGEA 1EJ6A 2X2YA 1XR8B 5BZXA 4ZW3A 5IMMB 1QFWI 1JCNA 2ACSA 4PL2A 5CJMA 4XQ6A 1BQLL 3MOAH 3BW4A 3HE6C 1MNSA 2A6NA 4W9HC 2EGZA 3ZKQD 1XGRB 4KK5D 4KESA 5HYEA 3C8KA 1KLYA 1BYBA 2F7PA 5J6HA 1NWUA 4X0KB 4YO0B 1F1AA 3ZYIA 1LO2H 3IDGA 4XP9L 3U46B 5KETA 5F9OL 3IPWA 4PWHA 2TAAA 4RX4A 3MRBB 3W72A 3I6TA 1F1GA 1YIXA 1VCBC 2F53B 3FS9A 1R24A 1TJXA 4FLRA 2QELA 2PZ0A 2IAMA 3U1SL 5JIKA 3VFTB 2QYGA 3PULA 4HGXA 4MSWA 3VFUB 1JWMB 1A7OH 3ASWA 1DCEA 3AACA 4PBVC 1ZLUH 3ULVC 5J89A 2QHLA 1Q4NX 3B8UA 3RAOA 1WXYA 4HJGB 2V9RA 4H25B 2A74C 3L3KB 2C9RA 2QZRA 1OF8A 5I66B 4G42A 2E59A 3EO1A 1O9VA 3FRUA 5EU6E 5GGRB 4AKPA 1JUFB 1F05A 3BCJA 4GI9A 3MZGB 4EOUA 5EIVA 2H41A 3X2QB 4CDGC 3QJSB 1XBYA 4AAJA 4FXFA 2A5HA 2XSBA 3FQ1A 4HF5H 1V03A 1FXQA 2O5ZH 5SV3A 1CLOL 3KG5A 5CGYC 1E9IA 1QCWA 2VKXA 1P0SE 3CLEL 3QUZC 1SJVA 1ZBVA 5GVJA 1J9QA 5CKSA 1UR3M 3LA4A 1NIFA 4TQEL 4QLRA 2BHFA 2PO6C 1Q90A 3ZLHA 2AOSA 1AZNA 3I3BA 4KF1A 2BTMA 1OW0C 3X3GL 1U4EA 1A5BA 3WIIL 4MKTA 4AG0A 3EJSA 2QCFA 4G7RB 4FA7B 5DWPA 3BQUC 3EX1A 2AMGA 1NFDA 5LXGL 1XBDA 5KANG 3STZA 1J5SA 2AEOA 3BMWA 3ARDC 5FGBC 1CT8A 3HUJA 3J7HA 4PGBB 2P5NA 3NCCB 4FQQB 4GKOA 4L3EA 4JUSA 1C5CH 4XB8A 4EO5A 1WAAA 3LCLA 3PY2A 1X5MA 2BO0A 1DQJB 1HL4A 2VRJA 2F8VA 4G6KH 3W2LA 3EFFA 3MRMB 4XP1H 1KCBA 2EXOA 3P0VL 4G1EB 5FV1L 3MCMA 5E9XA 5FO2A 1Q6EA 1NMAH 3NCBB 2OQYA 4XBJA 1GIGH 2H8PA 3OKKB 1O6SA 5FA3A 1TZ7A 3L5LA 4QLJA 5F2FA 1TTPA 2SEBB 3LZOA 3SKJL 4J23A 3T3ME 3UTQA 3U36B 2GK1A 2JLPA 3QW3A 4URTB 3D0VA 1GYLA 3B0XA 2E7CA 2WB7A 1YJDL 4GUCA 1UACH 3W82A 1C93A 3A67L 4Z7OF 4FC3E 3HRZB 1A4JB 4PJAE 1U3HD 5C2XA 5EIIA 3S1XA 4PG2C 4NQEE 4YJ5A 4XG1A 1E6JL 3OAYH 3OODA 3MRIB 2D20A 4K39A 1I7RA 3K6FA 3V55A 3UTQB 1UYWH 3SOBH 3B8IA 4WX2A 1OAQL 4W9GC 3G0XA 3B9NA 1O9ZA 4QHUA 3FYOA 2EDWA 1D5IL 4XP4H 1SXAA 1TCRA 3BAXA 5SWZB 3ZL2A 1HYRC 1WE5A 1FWRA 4WFED 1OYCA 1P84K 2AAMA 3KRBA 1KTJA 4KRPC 5I5IA 1J9CT 3CXOA 3WD5H 3V9CA 4JKNA 5D71L 4BIKA 3GYEA