6PTDA

Phosphatidylinositol-specific phospholipase c mutant h32l
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTLDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 98
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 6ptdA00
1DJWA 1ZCCA 1DJGA 4RW3A 1PTGA 2OR2A 5T9BG 1T8QA 3L12A 1DJZA 3EA1A 3H4XA 3RLGA 4I9MA 1O1ZA 4F2TA 3CH0A 2P76A 4F2UA 2PTDA 3H4WA 4I9JA 1YDYA 4I8YA 4RW5A 3RLHA 1DJYA 1T6MA 7PTDA 4QJ5B 3MZ2A 3V18A 2OOGA 4GNKB 3PTDA 3EA3A 4I9TA 4Q6XA 6PTDA 3I10A 1DJXA 4R7OA 4PTDA 2ZKMX 3NO3A 3KS6A 3QR1A 4OECA 2F9RA 2PLCA 3EA2A 2OTDA 3QR0A 3KS5A 4F2BA 1PTDA 5T91A 2FJUB 1DJHA 1DJIA 5T9CE 1QATA 3OHMB 1VD6A 3V16A 4S3GA 3V1HA 2O55A 4QJ3B 1AODA 4RV3A 2PZ0A 1XX1A 5PTDA 4QJ4B 1V8EA 3QVQA 2ISDA 4I90A 1QASA 1GYMA
chains in the Genus database with same CATH superfamily
2EKCA 3TIMA 4MKSA 4NYUA 4AMAA 1US0A 4K8HA 3KOWA 3C2YA 2JK2A 4FXSA 4HA4A 4PCFA 5AOUA 2GL5A 5BCAA 3RG6A 3E74A 3E0FA 4FLRA 3SFWA 1XLGA 4XO6A 4IFKA 3VNDA 4IH3A 3URNA 1LM1A 8XIAA 1CWYA 3AI0A 3MP4A 3SQMA 3AXXA 1S38A 3DGBA 4Z2KA 4A4AA 1OX5A 4R7JA 3MHFA 3VKKA 1NVMA 2W62A 1K70A 3SCUA 2XZ7A 2J7HA 3WJWA 5BOFA 1XXXA 3TU9A 1NOWA 3OEXA 2ABBA 3VD9A 3BCFA 3NPWA 3TQPA 2PDFA 4UIOA 3A64A 3K4WA 1WDWA 3G22A 3CMJA 1QR7A 2JGYA 1F8IA 2DSWA 4US6A 1QPNA 4G7FA 1V02A 2QMJA 2VEKA 3CQJA 3LQGA 2KX9A 4BQ2A 3R0DA 2E6DA 2P8BA 3KL3A 5KZ6A 1KFLA 1S2CA 1I75A 1W3HA 2PTXA 4GIAA 3W81A 3KVKA 3EGJA 1L9WA 2Z00A 1I8JA 2HVNA 4DXVA 2Q8LA 4GX9A 4I90A 4AW7A 2IQTA 3CYJA 2POTA 3EXTA 4C7GA 1W5OA 3LBMA 4GO8A 5I2UA 1K8CA 5G4HC 3CZEA 4W8AA 4GVHA 2DJLA 2J88A 4N0RA 4HPNA 1VAHA 3ZVHA 3T1GA 2PU1A 1OFRA 1XCFA 5CPQA 5AYZA 4DF1A 1W1ZA 1QNRA 2RHGA 1ZB5A 2J27A 4WOQA 2FMNA 2HISA 1IEXA 4IUOA 3KDNA 2Y5JA 3P0WA 1XIJA 3B8DA 2UV8G 2WNZA 2FTPA 5DANA 1H7WA 3JRKA 1AMYA 1LWJA 3LCGA 4K1WA 1JZ4A 2ATSA 2QPUA 2CYGA 4J3UA 4FNTA 3VNIA 2REQB 3H7RA 4NJKA 2CIPA 4DNHA 4HMNA 4P8UA 3C56A 3GVVA 2MANA 4R9OA 1N82A 2WKLA 3TFXA 5BZAA 1A5KC 4XVDA 1VLWA 3K2GA 1RJRA 5G4WA 1ZLPA 5JH2A 1X7IA 3VE7A 5H2ZA 3CBWA 1UWSA 3L66A 1Q6QA 1C9DA 2VGBA 3HMCA 1JL8A 4NZJA 2PGEA 1CEOA 1AH4A 5C9UA 4JTTA 4B5SA 3PWGA 1W3TA 2Q71A 1F05A 2PGFA 1WV2A 3IK2A 3QHOA 4JS3A 1KO0A 4LQ1A 4D72A 1JDFA 3N6JA 1JYWA 4R85A 1K3UA 3W76A 2PDJA 5HK4A 1WZMA 2V3EA 3QPEA 4BFAA 5A3HA 1R30A 5L9FA 3ABOA 3WJSA 2A7PA 5AHEA 3TQVA 3MUXA 3DG3A 2CLEA 3H4WA 4AX7A 4JHMA 5FF4A 4UTHA 2C0HA 4WY0B 2A7RA 4K1GA 5FF0A 3FYPA 3T8QA 4K8EA 5HNNA 3KM8A 1SM9A 1SU5A 2FDMA 5CJNA 2F2KA 2IKJA 5A6BA 4W4QA 2PRLA 4GZJA 3KS6A 4UQBA 3UJRA 2CLHA 5T91A 4HTYA 4Y2WA 1QDSA 3GYEA 4L65A 4CCEA 3UNTA 3AJXA 5DMNA 3BLOA 1QPKA 1QTWA 5HR7A 1Q65A 4ERAA 2EPHA 2A3BA 1H7RA 3LXCA 1E71M 3B3DA 3ITVA 5A2CA 3ITOA 1QNSA 2WB5A 4GQGA 3VZZA 2F6XA 1CB2A 1A5OC 3ERPA 2QPSA 4CGTA 3PC0A 2Z1BA 1XD0A 2NV1A 4RW3A 3QFWA 4PH6A 1FOBA 1R7AA 1AG1O 1LRNA 2J78A 4PA8A 3GIYA 3PBVA 1EC7A 1GQNA 3GDLA 3RAOA 1PZ3A 2J62A 1GQKA 1GOWA 3B97A 4B91A 4RE2A 4ZENA 3N04A 2ZZ7A 3CWHA 3GXMA 1PWMA 5I07A 2XVLA 3VMOA 3KTSA 3BLEA 4YHEA 3D47A 5LYRA 3NL6A 5F2LA 3QR3A 2AL2B 2J9YA 4D9PA 2PFHA 4ICNA 5LHFA 3RCYA 3AZTA 4LU0A 4PUWA 5I3HA 4UQ9A 4Z1BA 3PP7A 4Q6XA 1PX4A 5CZJA 3BAKA 4X0VA 2E5DA 3RRAA 2XSXA 5IRPA 1HJQA 4MPKA 2V67A 2VNCA 4IPIA 5EMUA 4P8VA 3VDAA 1TYGA 5T9CE 1NOFA 1QNOA 1OQFA 1MVYA 2PTZA 1QPQA 3NQMA 4IF2A 1GTHA 3SB0A 3L5AA 3O2LA 4E5TA 3WQGA 4DZAA 3QPYA 3EKGA 3WNPA 1B5TA 1EX5A 5TD4A 3NO1A 3E02A 2GDVA 4RXFA 4O1EA 3F4NA 4YLWA 3LU2A 2ODOA 4DLFA 3FN9A 3DECA 4O0QA 1QCWA 3MP5A 1ZCCA 3DYPA 3DI1A 2Y8KA 3P3BA 5FL0A 2PWGA 4A3HA 1NFGA 2J24A 3W1RA 3RRXA 2ZRXA 4RCXA 1LQ2A 2VC6A 4H8NA 3GSMA 3A23A 4L4OA 2YW3A 3NWRA 2YL9A 3KTXA 3K8KA 2ZFAA 1JPKA 4HNTA 2G3IA 4O28A 1LOQA 1EJWC 3PUOA 1LG2A 4AD5A 1QHPA 4C60A 4I9JA 1IZJA 1MXDA 1HL8A 4TVCA 2PDXA 3WDQA 3NOYA 4Q7BA 4PTWA 2ICSA 3PTDA 1LYXA 3M16A 3FX4A 4KFPA 4UQEA 3TW6A 3WLSA 3TXZA 5FJPA 4C6EA 1EBGA 3VIPA 3SECA 1WE5A 2XH0A 4U5KA 5JXQA 3EWYA 1AH0A 2EAWA 1UOZA 4QG6A 1GTEA 3CJPA 1EC9A 3LTYA 2V5DA 1MW0A 1M3UA 1KXVA 4HSOA 6ENLA 4PCTA 5AN7A 5JBDA 3C52A 3SM0A 4G1NA 2QF7A 4GGBA 4J35A 2VMFA 2NX3A 4HNUA 4WSHA 4EPKA 1HVXA 1JZ6A 3U5YA 4XK2A 1K8YA 1MQQA 1CCWB 3FJ6A 2PDLA 3B4YA 3S1UA 4UOJA 1LF1A 1GG0A 3C2EA 1E6PA 4HNLA 4M5PA 1AL7A 1PEZA 3GZ3A 1BYBA 4UOZA 4F2TA 2E40A 4TR9A 1KKRA 4C6NA 2AGTA 3O7UA 2E9MA 4PMOA 1OD0A 2VEFA 4C7FA 3T44A 4PULA 2PA6A 4O19A 1J5SA 4J7RA 5CPSA 4MADA 5ENLA 1E70M 1G9HA 1RK6A 2G3FA 3E3HA 3WK2A 2IUZA 1O7AA 5D2VA 5EMJA 2Y61A 3PZMA 4LAOA 4PMZA 3O9NA 3HPAA 3ATYA 3O0FA 3G77A 4P8XA 4S3AA 2FIQA 2XIIA 3OHMB 5ECUA 3WNMA 2ZZ4A 1QI3A 5DCDA 1MRAA 1C9WA 5HAOA 1EP1A 3BPWA 1DIDA 2XSBA 3TTSA 3S5SA 2Z6IA 1FWRA 2QT3A 1TX2A 1WYIA 3MHGA 4RNIA 1GVIA 5AVNA 4US5D 4XD4A 4EPEC 3OZMA 4RDVA 4PUNA 1B3VA 1UKQA 1KQZA 2Y5SA 2W6RA 4NI8A 1I4NA 3Q94A 1E43A 3IEBA 5JBFA 4GNVA 2QUMA 3CB3A 4NNAA 4ZZ9A 2D20A 3MU7A 4M29A 1HGYA 3M0XA 1BFNA 3F4VA 3SJ3A 5T8GA 4JEQA 5TAOA 4Q4MA 5K9XA 3ZJ6A 4HT3A 3UXDA 3B8VA 3BDKA 3W2NA 3VMNA 4ORMA 4XVEA 3VC6A 3TC3A 4D2JA 2VEIA 3V1PA 2DUAA 4WDUA 4LEQA 3MUAA 3QQWA 2CITA 2CLLA 4BI7A 1DIKA 1UR2A 4IWWA 1EFZA 4HOWA 1DJHA 2HV5A 1HG3A 3OJGA 3IGSA 2RGLA 2ZA2A 4Y9NA 2OKTA 1BHGA 1BGGA 3M7SA 2I7GA 5CXPA 2PURA 3SN4A 1T5AA 3EX2A 4DBDA 2BV9A 4I7VA 1X1ZA 5F4XA 2AMGA 4QQ3A 4DWSB 3EMZA 1E4LA 1SGJA 3ITCA 1EGVA 3KVLA 1TMQA 4A21A 1VRXA 4MWAB 3SCOA 3GNRA 1HKIA 1K9EA 3ZSTA 3MV01 5BRPA 3HMJG 5D37A 1W0MA 3O8AA 3N4FA 4NZ3A 1YE6A 4PCNA 2WOQA 3Q65A 4ERIA 4S3CA 3IGHX 4DBUA 5I78A 1FH8A 1DE5A 3ARXA 2FH6A 2TSYA 4CNNA 3UYIA 5FI8A 3W2MA 4BWLC 2J7DA 1JPDX 2QUNA 3SY1A 1KC7A 4GCAA 1PHWA 4WSJA 5EMLA 1F6KA 1ENUA 1TUFA 4PB5A 2A3CA 3ZYZA 4C6KA 1MW1A 1KR1A 3KBMA 1YLVA 1OC6A 3UWZA 1WZKA 1Q63A 1FHVA 1EGZA 2V82A 5FF7A 2QZRA 1V02E 3I4KA 3W7QA 2NVAA 4L9ZA 4M19A 1V3HA 3VMPA 5XIAA 1NWRA 3EOOA 3IJ8A 2YB1A 3DHDA 1KCLA 3KL0A 3K5XA 3XIMA 1LLZA 4W9TA 4BQ5A 2CKSA 3F2CA 3ENLA 4I7UA 3CMGA 4FHAA 2OLHA 4X9YA 2YCIX 4RPPA 1A5LC 1XIEA 4R9XA 4F0HA 5M03A 2IW0A 3OLGA 1C93A 3QF0A 3ELFA 4I7WA 1ADSA 2Z28A 1QWKA 1MQPA 5IM51 1KR0A 1VPQA 2O0TA 3UESA 2CETA 4Q4QA 4Z17A 3LY0A 4DJDD 4AAJA 2QUUA 3GRIA 3FIGA 1GORA 1A4LA 1XYFA 3TJLA 1TG7A 2WANA 3CPRA 3DFNA 4PBGA 1TREA 3VX1A 2LLEA 1NF0A 3CT7A 1IEWA 3PK7A 4JCLA 3WL1A 4CCDA 1T6MA 1IGWA 1GPFA 1JQVA 4MIMA 1KD0A 4PUJA 4DWDA 1U2YA 1GGOA 4JBRA 2GWNA 3IUHA 3S9IA 3KP0A 4ZODA 2GJNA 3UR2A 2AKZA 3E5PA 1W1B1 3OVPA 3VM5A 3WF0A 3ARUA 4PN2A 2VX6A 1UZ1A 2PUZA 1TJ2A 4JKKA 1XLFA 3H70A 3CL6A 1HGWA 4YVXA 1MI3A 2H8XA 1SYTA 4QCEA 2Z7KA 1S1PA 1GZJA 1NWSA 1CX9A 2DFAA 2G3NA 3K13A 3G1AA 3GZAA 2VC9A 4O50A 1TMLA 2X42A 2PD9A 3URBA 3E5BA 4PTXA 4IT1A 3PS7A 2REQA 2O9OA 3GX9A 3A3XA 4E8DA 3NZGA 1E6XM 3MANA 2YLLA 3AU2A 3GR7A 3W70A 3S9ZA 4HPGA 3SEPA 1FCBA 2CC0A 2C79A 2Q3OA 3SAZA 3DESA 3F5KA 4XUGA 2DH2A 4MNKA 2QKFA 2V2CA 4E2VA 3Q4DA 1WAWA 3WLKX 3TWBA 2X1UA 3OO2A 1UP0A 2EPKX 5LIUX 3ITYA 4NY2A 2ZUNA 3WDJA 3SCSA 5HMEA 5DMYA 2X8RA 4H6RA 4PSRA 2G97A 3A13A 1ZGDA 3WLMA 3FA5A 2W66A 4JIEA 3I6RA 3QOMA 4H83A 5GPRA 2WJEA 2NV9A 4FX7A 3V1HA 2J13A 1Y5WA 2E25A 1W6TA 4DPPA 1GOMA 1VJZA 3T2PA 4DJFA 3G3DA 4GIRA 2JALA 3U6WA 1VC4A 4GBDA 1N2VA 4WY0A 4RZBA 3MDUA 3VDBA 3GBDA 5G1MA 3PNUA 3WFLA 1NM9A 2DQXA 1J6PA 1R7OA 1R87A 2A5HA 1UWIA 4IIFA 4XAYA 4E4FA 4KKXA 1HP5A 5KINA 1AA1B 3ZT7A 4HZ8A 2NQHA 2HVMA 4UUIA 1DE6A 2EG7A 5DRCA 4UCFA 3G8RA 1QK0A 4DXXA 1S5MA 1XRFA 1E6RA 1DWJM 3TLQA 2Q8ZA 1PAMA 1VHCA 2I5GA 3MW7A 1Z41A 2CLMA 2R9RA 3CXOA 1UYQA 2FDSA 3CZ8A 1XKJA 2BNJA 1RJPA 3IV8A 1YDYA 4GY7A 1A0EA 4OBRA 1UR9A 1TA3B 1W1IE 2FH8A 5AZ1A 3ARSA 4JL2A 4LWWA 3MMTA 3I10A 4JTFA 4W85A 2QJGA 2WMGA 4FR6A 4K7YA 2ZE3A 2VZSA 5RUBA 1M6JA 2RDWA 2G96A 3F7JA 3EOLA 3ARVA 3BAWA 2XIOA 4JTEA 3REQB 3HGOA 3W24A 1F07A 1XGZA 1F8MA 2G41A 2AL2A 4MY8A 3C2VA 1LL6A 1RUSA 1BTCA 4B92A 1JPHA 4BF5A 1MZHA 3AS1A 3UR5A 1XCXA 1QU4A 1W5MA 3ANUA 1MEIA 3PZ9A 2VKZG 3WJYA 4GXPA 1LL7A 2HJPA 5AYBA 4Z08A 1TELA 3A6OA 4FIQA 4K68A 1EF2A 2W9MA 4HJWA 1TZZA 3ARPA 4JTUA 2VEGA 1W1PA 1V3JA 3V0TA 4ML4A 1VFFA 2XWEA 2ZE0A 1O68A 3RHGA 2NWSA 1HL9A 3FJLA 3LZ5A 1GJWA 3BANA 2NSXA 1MUWA 3RDKA 4YTRA 1YIXA 3UCDA 1N7KA 3S3GA 4WXZA 4AHOA 4ZOEA 1FH7A 2I5IA 3TYCA 3SBFA 4M8UA 1DQWA 1K4HA 1OFPA 3HU7A 4IP7A 3OYXA 3KRSA 1NFPA 3MWCA 4NAFA 3C4UA 3TE9A 7ENLA 4KWWA 2XGBA 1ZPTA 1KBBA 3TTOA 3IIXA 3IK4A 2BGNE 5I02A 1L0PA 4RE4A 1FWGC 1UWAA 4BEUA 1BTMA 1O5QA 1X98A 3M43A 4KCTA 5CZSA 3OYZA 1EO5A 4UTTC 4LTSA 2E09A 2PWVA 4HZ7A 1P6CA 4A3YA 5LXEA 2EPOA 1BKHA 1ISVA 4H41A 4QNWA 2J74A 1H2JA 4NXKA 1XINA 1B54A 4QROA 2E4TA 4KWVA 4L80A 3GO2A 4WDTA 1FKWA 4OT7A 3RR1A 1E4NA 2P3EA 3O0KA 5U4NA 4YVVA 4RNHA 1RHCA 1THFD 1BWLA 3DH7A 3W7JA 2FTYA 2UY4A 2ABAA 3M5XA 4G5DA 3UZWA 4V2XA 2CW6A 1UD6A 4DAFA 3IRDA 5IXEA 1TVNA 3H7UA 2QCFA 4XBSA 3NDZA 3VZXA 4GZIA 4PSPA 1S2UA 1ISXA 5DEZA 1ESWA 2HDJA 4N6FA 3QPZA 4QAWA 4E4PA 3PTKA 1VFMA 1XYCA 3HN3A 1SUXA 3NQEA 1NEYA 3GW3A 3WF4A 3VIFA 3R11A 1ZJBA 3W3OA 1KA9F 4KFOA 4A8RA 1EWDA 4QSFA 4CN1A 4FNQA 2GJLA 3VCRA 4D1JA 2WSKA 3EDFA 4OZOA 3FLUA 3P61A 1DJXA 3W00A 3CHDA 2IPFA 3M0JA 2E77A 3KRUA 4E2OA 3NVDA 4RV8A 4XTDA 1UASA 3QR0A 3CO4A 1WPCA 2CXGA 4NZ5A 1FWJC 4HNVA 1Z42A 3QTGA 3P6LA 1ZTVA 3TMLA 1S1RA 4LYRA 3KBSA 4H7CA 3N1AA 1U33A 3NIYA 4NIRA 5DT5A 3KOXA 1ZNNA 1NARA 1JDEA 1F4HA 3LLFA 2OGYA 1GHRA 2YA2A 3W7DA 1KKOA 1LLOA 4MM1A 4TV5A 2WQDA 2XGIA 4IUGA 1GKRA 1XSJA 4X2PA 3ES8A 3SSJA 3G1SA 4LUYA 3FAWA 3KOZA 1MW2A 2ZTKA 1VCVA 1DPMA 1DWFM 1DOSA 4W88A 3QFEA 3O6AA 3MKCA 4S3EA 1US2A 1P1XA 1JNDA 1M41A 4AZIA 5CZKA 1OFBA 3VUPA 1K7EA 6REQB 4J3SA 4ZCWA 4JTHA 3P8JA 3AIWA 2YBTA 2PDQA 3TYUA 4A2RA 4JYEA 5KEZA 1ZBCA 4RW5A 2IQ0A 4WGHA 4LY4A 3ZLGA 4IXXA 2BXYA 2FPVA 2NUWA 4XAFA 3VI2A 2VQTA 1EB3A 4B3ZA 3CUHA 1GVSA 4MYAA 4OV4A 2VRQA 3GVWA 4AWSA 1BD0A 4HYVA 2OTDA 2X0HA 3DOPA 3VKAA 5LHEA 4PMRA 4C6MA 2WKJA 4GBUA 2RAGA 2QCDB 3ZS4A 2P88A 1RVGA 1CI1A 4DBSA 5A6LA 3UCCA 2NXGA 3LM7A 5D9NA 1WXYA 2Z2BA 2BVYA 2WHLA 3W38A 4UNKA 3P80A 1PUDA 3DCPA 3TOPA 4DLMA 1UQYA 2I9UA 3TYAA 1KRAC 1JUBA 2W5FA 3GUWA 4NVTA 2V3GA 1FVPA 3F2DA 3T9PA 5HATA 1QVBA 1L6GA 3M0KA 3PJWA 3FDKA 2GQ8A 4CD4A 2INFA 1NH6A 4QITA 1A50A 2VZTA 1JZ2A 1QW9A 2AAMA 3M9YA 1EYEA 1RD5A 1OWQA 3L4TA 2YJQA 1ZP4A 3BURA 3V5FA 1DWIM 4IGSA 3GE7A 4DWSA 2OT0A 1V0NA 3NL5A 3AHZA 2QCCA 4MWAA 1EJUC 4QLJA 3VOGA 1ME7A 2QCMA 3QRHA 1IZKA 1LRTA 2P53A 3N2MA 3GHRA 3AS2A 4BKNA 4GH1A 5CPOA 2BSLA 1ZCOA 3L21A 3T40A 2PDIA 4HPXA 1KTNA 4QE4A 4ZFCA 1OZQA 3TJIA 5GNXA 4IFOA 1O60A 2GQ3A 2E5CA 4MVAA 1OX4B 3KL5A 3KVMA 1YX1A 2DZXA 4KT2A 3DFYA 1DJIA 3I65A 2PDUA 3GXFA 4X0NA 3H24A 3OGSA 1Y8BA 1K6WA 1Q45A 3LTSA 4B3KA 3DZ1A 3WMLA 4XZLX 3S1WA 3NQAA 3IJDA 4N9DA 6ALDA 4LAUA 2P0IA 3O3RA 1RA5A 1JCLA 3DXIA 3HQ1A 2E1WA 5ABFB 2CBJA 1Z7AA 1OGGA 1SZGA 2JF6A 1VPXA 2Z29A 3TDFA 1Z69A 3EBVA 3L0GA 1YYAA 2PGRA 3P60A 4A35A 3EA1A 4EXQA 1O5KA 1PIIA 3WBAA 3GFXA 5FSDC 3O06A 2W79A 2WWCA 3KLKA 2OKOA 3WY1A 1FCVA 2WLYA 4PMVA 1JIBA 3MVTA 1R85A 2QVNA 4CD6A 2H9AA 2OX1A 4F0SA 1H49A 3NCOA 4P2VA 5JUVA 5GQBA 2F84A 3TR9A 3S9YA 4MB4A 4LAZA 1UJPA 1AZ2A 4RPQA 3MUIA 1I1XA 3UVIA 5AY7A 4XUYA 1QHOA 2OOGA 4JTQA 3E2RA 4WVXA 2WHKA 3HPSA 4LUIA 3W2UA 1V0KA 2WVUA 2P50A 3QSRA 3NO3A 1RLCL 3SRHA 3ISIX 3FAXA 1QI4A 4IMFA 3KZPA 4C65A 3MSGA 2WBKA 2FZDA 1RSCA 3WMSA 4GQQA 3W7GA 5E6ZA 3IGXA 3LXBA 2BS9A 3ARZA 3WDIA 1HFBA 4QEEA 4XD5A 3LQLA 4CQCA 4PTNA 2CBIA 1XYMA 1I2OA 2O9RA 4P7OA 2A0NA 2ZUUA 1GVOA 3ITGA 1T8QA 4RJEA 1OX6A 3QC3A 3SSZA 3MSRA 4Z1CA 5BWFA 4HZ6A 2V5LA 4WUIA 2DORA 1TRIA 1FFQA 1MO0A 1E6NA 3A22A 5FJOA 3N11A 1TPDA 3W1PA 1P5BA 1W31A 4ZVJA 1VFUA 1G7VA 2YSWA 4JDYA 4MJ4A 3GDRA 3PWIA 3LHVA 1XBXA 2WZEA 2ZRWA 2PTWA 1DXFA 3GAYA 2VHLA 3T09A 4HKPA 2J9ZA 4JY9A 3DU0A 4Q4PA 3CPUA 2WLZA 4NX0A 5E5CA 2WC7A 2D24A 1R46A 2V38A 3B03A 2C3ZA 4XG1A 1W3KA 1XBZA 3AYRA 4DYEA 1NJJA 2IPJA 3MYOA 4H9VA 1A53A 1KFCA 2L5HA 2V3DA 3AFBA 4LYKA 3H2NA 1XIHA 3GKAA 3PJUA 2HE5A 3S6OA 5DBUA 5LIXX 5FSEC 2J9XA 1K8ZA 4RDYA 1X96A 1E4IA 4LVGA 4IHCA 3RO6A 2I57A 4IFRA 3W7NA 2TYSA 1BXCA 2ZX9A 5F4WA 4P61A 4G2DA 1T8XA 2FB2A 1SJDA 3KVJA 3UG3A 3CUFA 2YA0A 4HA0A 4L1WA 1HJVA 2C0AA 2CHNA 4XZ9A 4PR4A 4BZYA 2QCEA 4KH2A 4YTUA 1ZAHA 5EGRA 3GTIA 1XV8A 3L4VA 3U2CA 4QG9A 3ARYA 4JIPA 3WCZA 4AG0A 5FEXA 4IISA 4LT9A 2NT1A 2YPIA 4R88A 1WDRA 3FKKA 1NQ6A 1DV7A 3A5VA 2IKHA 1SO6A 2I17A 2PMQA 2WWDA 4IM4A 3BJFA 8XIMA 1FHLA 3BSGA 5HUOA 1UCWA 1BSIA 4S39A 1PKYA 4AZBA 2VWTA 3WLNA 3O16A 1PTAA 2XFWA 3AYVA 2Y24A 3PB2A 4FXJA 4ZB5A 1K6AA 1H7NA 5LSMA 1RXOB 1UJQA 3FOKA 1IXQA 5FA5A 2AQOA 4GVIA 3R8HA 4JY8A 2FVKA 1R9YA 1UH2A 1FA2A 5DMLA 3DFPA 4XBKA 3TA6A 3FSTA 2RKXA 3MWAA 4G8TA 1AQMA 4KIRA 4K2SA 2J47A 5LIWX 3LBCA 1TA3A 1POKA 3LERA 2H8ZA 4CVUA 3MSDA 1EP3A 4UFHA 2VX5A 3ARTA 1W8SA 2Z4GA 4HD5A 4O17A 3NL3A 3IJ7A 5I3JA 4Q8WA 2P10A 3KCJA 5M5DA 3GNDA 4WCJA 4KWOA 1E9IA 1T96A 5A8PA 4OJYA 2FVLA 3REQA 3CV6A 1IQ8A 5C2GA 3HIJA 5H6HA 4C91A 4OV9A 2E6AA 4WKHA 3H7VA 2HWGA 4DEFA 3GD6A 4GGHA 3QYQA 2PC4A 2XG9A 1UD3A 1XIGA 3G0XA 4KCVA 3AXMA 4B90A 3AHXA 3TN4A 1JDCA 3UWVA 4L4PA 2BY2A 4F66A 2OLSA 1U5HA 3TH6A 1HW6A 2XN2A 3WBWA 3B06A 4C6LA 3K8MA 3HA1A 3CMFA 1CNVA 1FTXA 1CXLA 1RH9A 1PHQA 3SIZA 2E8ZA 5I0DA 5E09A 3DBNA 3EA2A 1QWGA 4S23A 1YRRA 4FR1A 3G1HA 4CNUA 1V3KA 3S2JA 1XI3A 1YADA 1AH3A 1E73M 4Z42C 2GUUA 2UY3A 1VBHA 3IV3A 5HQMA 6XIAA 4GG9A 1Y65A 3BUVA 2JEPA 1J0ZA 5BXTA 2VR5A 1JAEA 1JZ7A 5FJRA 4H2CA 4UOQA 3UQNA 1KW1A 1TTPA 2PLJA 3N4AA 3TSMA 2ISFA 4EF9A 2C13A 2FJKA 1DWHM 2HEJA 1FWWA 1TJ1A 1TQJA 3WH8A 4AD0A 4EX4A 1TV5A 3TZNA 3RX4A 1VCGA 1JG9A 1LWHA 2XHYA 3RJXA 2CLPA 1MW3A 1K77A 3CH0A 2EJ1A 2Z26A 4E0CA 5AC6A 1TZ9A 2PCEA 4XIAA 2V2DA 4IIDA 3HQOA 3VTRA 3M07A 5A6BD 4C6OA 1C8XA 3LK6A 2I5QA 3HB9A 1FCQA 4F9DA 1MXSA 1IT0A 1J93A 4OQVA 2B7QA 3F4WA 4MJ2A 4QAIA 4L7ZA 8CGTA 3HO8A 1M01A 3NXLA 2PDWA 4A8NA 1OD8A 3C61A 3QW3A 4URIA 1W9XA 1VFTA 4HMCA 4ERGA 4H7ZA 2FPTA 3FGCA 2J7GA 2GSHA 5I7GA 1M65A 3AMLA 1SJAA 2C7FA 1ZU8A 3NXFA 1KLZA 3B0XA 1CXIA 3A4WA 4QE1A 5L6UA 1NDZA 2QDEA 4JN8A 4NJHA 2DZVA 3THDA 1IF2A 1W54A 2WO5A 2WVTA 4EXBA 2AAAA 4Z2LA 5CBBA 2XVNA 3VIIA 3QQ0A 3KEHA 2ON3A 4F79A 3OB8A 2XJ7A 4LOCA 4GX8A 1JGIA 1DQXA 4LV9A 1TPVA 3MBDA 3LSBA 1QK2A 3DYOA 3RIKA 1HT6A 4RUBA 4DBWA 2ZUMA 2I14A 1M9HA 3UG8A 2OJPA 4GVGA 2J77A 2Y85A 4HK7A 3V3WA 1E9YB 1HKKA 1W1VA 1ISZA 3LYEA 5FIPA 3N6QA 1QXLA 3MC5A 3T2QA 3WF2A 3PBUA 4JNZA 4MHBA 1CYGA 4ADSA 2NT0A 2FLIA 3OP2A 4DHGA 4EP8C 1RCOB 2VCCA 4DO7A 4M80A 4NJJA 3PJXA 1P1MA 1QO2A 1ICSA 1UKSA 3GC2A 5DRIA 3H53A 1ZFJA 3QY7A 1A5SA 2B7PA 2NLYA 4C90A 1A80A 4UTFA 2GUYA 1UWTA 5D9PA 4E6MA 3AQUA 2Y2WA 1HQTA 1OYAA 2YW4A 6REQA 3P7YA 4GCXA 4LXFA 1XRVA 2YDQA 3W26A 3RXZA 5I3FA 4RL3A 5HANA 1HIZA 1OEPA 3M5VA 1W3NA 1UD8A 1JFXA 4FF5A 3TR2A 4AVNA 5A6SA 1LP6A 3L4ZA 4JIHA 3B9EA 3EB4A 1K9TA 1IXNA 1PPIA 3VIOA 4A8LA 1DTNA 2UBPC 3BL3A 3ABXA 1RY8A 2XZ9A 5AYYA 2OSYA 1WDSA 2FZNA 1NF7A 4FOJA 2HE8A 3KBNA 3M64A 5DLCA 3VOHA 1HO4A 3H23A 1OM0A 1PX3A 3RN6A 3PZQA 4D6FA 3BH4A 1D2KA 4GXMA 3W53A 4L64A 1OB0A 2E9LA 1A5UA 1XLHA 3T78A 3V0SA 4CD8A 3RK8A 1NU5A 2Y7GA 2QCDA 3PNZA 4GWEA 3DG7A 3IVSA 2QEZA 2FB3A 3VDCA 1PIGA 1U22A 1XLJA 5CBJA 3LLXA 1OSEA 4S1FA 1B3WA 1ZJIA 3G1VA 1EA0A 5CSSA 3QH2A 3CASA 2QIWA 4L5ZA 1AQHA 4CCCA 3N2XA 3WLLA 2PDKA 1ZJAA 2YL5A 1QBBA 2WSYA 2NVDA 3S5OA 3GFYA 1H1ZA 2VCAA 2Y5EA 2FZBA 3GDBA 3PWAA 3QKEA 4MUZA 1FY6A 3NQ2A 3V5CA 1XR2A 5C54A 2VUNA 1Q7ZA 1FWSA 1BF2A 4QDPA 3W1UA 3UW6A 4AXNA 4LRSA 2CZFA 3CWOX 2PF8A 1NIUA 3IANA 3W88A 3SR7A 3E0VA 3GIPA 5D2XA 3FKRA 4K8GA 3IVUA 4WLCA 2CLOA 3GC5A 4DQWA 2IS7A 1AUSL 1F3XA 2EBNA 3W7CA 1LBLA 4S38A 3W7KA 4AD1A 3ZXWA 3Q45A 3QMRA 2XISA 1TQXA 1U1UA 4KGLA 3RCMA 1HN1A 4AQLA 3SQLA 4IPLA 1XISA 4H9MA 1M1BA 2WMJA 5F2IA 1OX4A 3GTHA 4O1AA 4YYCA 3QZAA 1B0IA 4O18A 1WCGA 2Z25A 1F2JA 2E0PA 4N2YA 2DIKA 4DO4A 4N02A 4LSBA 2WC3A 7A3HA 4NF7A 3ARWA 4ROQA 4AX6A 2PSNA 2YXXA 3APTA 3W72A 1WKDA 3A4XA 4LW7A 1YBQB 2RJGA 2Y4SA 1O4UA 2X1TA 2CESA 1XIIA 3HGJA 1O5RA 4IQDA 3W83A 5G1YA 1TRDA 4N9CA 3R89A 5EBAA 1SQ7A 4O4WA 1EO7A 3I7SA 4D71A 3PZUA 1ITUA 4L4MA 1KM6A 3TAKA 4LNYA 2WQPA 2C1GA 1IEQA 1FWAC 3HZ3A 3ZT5A 2AOSA 1ZZMA 4ASTA 5EPDA 1NWUA 3HPFA 1G67A 2FJUB 3BG3A 3GVGA 4A3RA 5CJ5A 1TPFA 5H1WA 2KAUC 4MNJA 3UF9A 3WQWA 4PRTA 3G1RA 3F5JA 4UMCA 3CUZA 2CXEA 4EPBC 4HA1A 4XKYB 1TTIA 1IYXA 1YNPA 3GG0A 4Y7EA 1S5NA 1GKQA 1FWNA 1R5YA 3AIQA 1KCXA 3W1AA 2B0MA 1PTGA 3R94A 1H1YA 1LQAA 3VGBA 1AFSA 2X1SA 3L2IA 4REQB 5E0KA 4ZO6A 1FDJA 4XAPA 1V6XA 1H7PA 4M51A 3B0UX 1A0DA 5EKYA 1XYZA 3A3HA 1YKWA 3GTXA 4ZSUA 4Z2HA 2B31A 3UZ5A 3SIMA 2DT2A 3BW3A 2XFRA 3PZGA 4JIQA 3NQ6A 4NYYA 2FHCA 1CB7B 1ZS2A 2R1KA 1AZ1A 1DHPA 4BWLA 5A6TC 2E68A 3H54A 3KBVA 4LVDA 5M17A 1XDJA 2BVTA 4GNKB 1XYAA 4J3XA 4O53A 3BLDA 4ZL1A 3WNLA 1T99A 1QBAA 5LA2A 4L6OA 3VGGA 4UR7A 1TV7A 3UA4A 1VRDA 3CS2A 4GK8A 3IWPA 5HNTA 4WOZA 3DDMA 1V03A 4S3GA 3VC5A 3ID7A 3TTEA 9CGTA 3JVAA 4INFA 2VC7A 3ZIZA 2D73A 3TNBA 3V4BA 3O6DA 3G0SA 1XCWA 3W87A 1ZQ5A 1F61A 4FNSA 3W9ZA 4AZ7A 4D6HA 3N2TA 2YLAA 5GJMA 1JZ5A 6A3HA 1LZOA 4CEXC 3RFAA 3LCFA 4PE8A 5TIMA 2J75A 1FHDA 4RZ4A 3W7HA 1DJZA 1SPQA 1H61A 1JNEA 1FH9A 2BGSA 4GI8A 1EC8A 2PCQA 4X63A 4I6KA 3TWAA 1TV3A 3GQYA 4OKDA 6TIMA 3CU2A 2RH9A 3OG2A 1POJA 1I0BA 3LI0A 4E38A 1TJ0A 3A4AA 3BW2A 1F5ZA 4YS1A 2DVTA 2Y62A 1YEYA 4JTRA 3WZ0E 5DFAA 3CUJA 3ES7A 1CDGA 5CZ0A 3IVTA 1H5VA 1XC6A 4YTTA 2OVLA 1GVEA 1VBUA 3W84A 3CYVA 1XBYA 2DZAA 4WJXA 1CW2A 1GQJA 4PFMA 2I9EA 2VD9A 4HQVA 4U31A 3FJNA 1DJNA 3QGVA 1IZCA 3UZJA 3ABZA 4OE7A 3NQFA 2HQAA 1S2TA 3CK5A 4HHPA 1AK5A 4B15A 3AMCA 1BRLB 1RVKA 4F0RA 4GMEA 1UZDA 2FQIA 3TSDA 1VJIA 5FJIA 2NQ5A 4ECLA 1E0TA 3FXYA 3H12A 5ABGA 4YPJA 1NDYA 2ZRYA 1R3VA 4YN5A 3DKLA 2D0FA 1SZFA 1K8XA 2ADAA 2PDHA 4ALDA 3BG9A 3QW4B 3F4DA 4HPJA 1E55A 4I9AA 2PPGA 1ECQA 2QJJA 4DJEC 3IIZA 4C6PA 1A49A 2WM1A 4L6DA 3BGJA 4GI6A 2HBXA 2CEQA 3UXKA 1W9BM 1E3ZA 4PMJA 4NNBA 3CC1A 1B90A 3ARRA 2XM1A 4RXGA 2NUYA 1XWYA 1B3ZA 1F6PA 5AHFA 4QEHA 2EHHA 1EJ7L 3I68A 1KQYA 4FOUA 4OUEA 1C91A 1BAGA 3PN8A 3KUMA 5I3KA 3NQ8A 2X09A 4GJJA 3G6MA 2Q09A 3AIBA 3LS9A 1MEHA 4ATDA 3P62A 1KFBA 2V2HA 3TFCA 5H8MA 1BG9A 1O5XA 3FHQA 3J7HA 3BLLA 1E0XA 4M0XA 3S5NA 4UTWC 2Z1SA 4QR6A 1F73A 3LB0A 1D8WA 1QMLA 2OG9A 4KMQA 1E4MM 4CU6A 3PFMA 3GNNA 4DY1A 3CZGA 4HOZA 1EDQA 3K30A 4JTLA 1XM3A 4U10A 1RR2A 2VL4A 1G4SA 4MLJA 3MV11 3QOKA 1P0DA 1S46A 3TN3A 4U2YA 2Y7EA 3E96A 3WD4A 1U1JA 3GXNA 1UKTA 3WIJA 5I3GA 4LJ3A 5FOOA 4Q33A 1LRQA 3EOSA 5C9RA 4A22A 2HPMA 1SR9A 2EO7A 3A9IA 3H2EA 3AMGA 3WBEA 1EJXC 5CCZA 4GH3A 2G0WA 5JU6A 4K38A 1QOQA 1JDAA 1YDVA 1OC5A 3EKZA 4UFKA 3VOJA 3R25A 1XF0A 3UNDA 1R86A 3W7OA 5FAGA 1E1FA 4D6JA 2RGMA 5MKGA 3RLVA 1E5NA 1DEDA 2XINA 3WNNA 2VFGA 4K7VA 4DJFD 4JYFA 3A9BA 3GU2A 1UUQA 4H8VA 1US3A 1L6SA 2VTFA 4M6VA 2DW7A 1LT8A 1TJRA 3FHAA 2ZRUA 3UWQA 3TTQA 2Y7FA 3WUEA 5DELA 1FWEC 4NL1A 4AXKA 4FLOA 4IG2B 3NSMA 1E6QM 3W6LA 3QLLA 2VGIA 4KEMA 3UXIA 3C5QA 1VIWA 1R38A 4IQJA 4V28A 3MMWA 5DF0A 1JCJA 4TVUA 4JFTA 2QULA 1ECEA 3PULA 1MQRA 4LS2A 3FK4A 4WY0F 4ZXLA 3BAYA 1XGDA 1J01A 5EU9A 1VEMA 5IFPA 1GT8A 1XDMA 3MPGA 1EHAA 3EDKA 3DENA 2JKPA 3NPXA 1HJWA 2OYMA 1DHKA 2NWRA 3I7QA 5JQ9A 2PEVA 3KW3A 1TPH1 2BMBA 1TVPA 3PBMA 4HNNA 3KX6A 3WFAA 4LCRA 1V3LA 1YPIA 1VFHA 5M2FX 1G69A 2J25A 3WLTA 4GUGA 4TXEA 9XIAA 4FPSA 4QS6A 3D3AA 3GXTA 2ZX7A 3NYZA 4HN8A 3QTPA 3PAJA 3W1TA 5C55A 2ATMA 1EOKA 3C6CA 4JIIX 1PCWA 4Q7NA 5HDRA 3WQ6A 4PTDA 2A7NA 4J1OA 3GTNA 2ALRA 3S6TA 4BA0A 1CGTA 2OEJA 3MJYA 1H3GA 1Q2SA 3BOFA 3PTQA 2PF0A 4H19A 3TP4A 3VUSA 5J5DA 2VRKA 2X30A 3PBYA 4UTTA 4Y9PA 3S2CA 2VC5A 4O52A 2PI6A 2ZQ0A 1MEWA 3EPOA 4RV3A 4ZTYA 1ADOA 2ISSA 1Q6OA 2PP3A 1T0OA 5C2CA 3EDEA 1DXIA 3R0KA 3NZPA 3LNPA 1CGYA 2PC8A 1W91A 3G5EA 2GZXA 1J8VA 3C86A 1KXHA 4EK7A 2ASHA 4TU1A 2ALDA 5HULA 4Z0SA 4GUIA 4DBEA 3V0UA 1PDZA 2GFTA 3K4AA 1IT7A 1SO3A 1V5XA 1TWZA 4Q8NA 4D6GA 1FX6A 3OQ8A 3EEZA 1RY0A 2IXUA 4CLMA 1J0JA 3BJTA 5I03A 2AL1A 1A3HA 2HBVA 5AKQA 3T0BA 3UJEA 1XHGA 4FLQA 1NY1A 2I1OA 2ZC8A 3RCNA 2IQDA 4I9TA 1SJBA 1X1NA 3UBPC 1M5WA 1RQBA 4CVWA 3NTYA 3BQ6A 4UNLA 3W7EA 1R0MA 2DSKA 2O4MA 2QUVA 1XQKA 3KS5A 5JH1A 1U5JA 3IJ6A 1AW5A 5I79A 1I9CB 5E9XA 3DC0A 2VDIA 5I5RA 1XLKA 2RFGA 1H7XA 5LA1A 3GG8A 4BF7A 3KZSA 1ONRA 4U4MA 4MNLA 1ICPA 4Q8QA 5IDZA 3JR2A 4N4PA 2X40A 4LBUA 4O11A 1VFSA 5AHIA 4TIMA 3WBYA 3VO0A 2JKEA 1ZBKA 2ONEA 3TTYA 1Z9AA 1VBGA 1RCQA 3T08A 4GKTA 3SQSA 3BC9A 3H6OA 4GC3A 3L23A 4KWSA 1VBRA 3ONBA 3WK0A 2R1PA 3T0TA 4G9PA 3WQ5A 2WNNA 1XIMA 4OBTA 3ZR6A 3S0CA 4YYFA 2A3LA 2J7BA 2HSAA 3MP3A 3IJ9A 1AQFA 1BLIA 3OGRA 1S2AA 4QG8A 4EOUA 3PY2A 3G3MA 4OHQA 4Y8EA 1JCMP 4WJ8A 3DI0A 3THUA 5CC7A 4MAZA 2WM0A 2WXDM 4UTLA 3VNKA 4NRSA 3LZ3A 1GEHA 1A5CA 1U83A 2ZIDA 1HZYA 2PWHA 3U48A 4PB3A 5F7UA 4EXAA 2IXVA 4N6EA 3GHUA 4Q8TA 2X0YA 1ZHAA 3SGUA 2FMOA 3HPZA 1NELA 1VB9A 1H4PA 2P3ZA 1VD6A 2Z1VA 4QLLA 1XRTA 1WKEA 3EX4A 5C70A 3C8NA 2BOFX 3CAQA 4E4UA 4CNPA 1WZAA 1YBQA 3S1XA 4KWUA 3AS0A 4HU3A 4ZB0A 3M47A 5BRQA 1J12A 2CKRA 3WH5A 1G0CA 4EWJA 3I7RA 1ODUA 3T81A 4UXDA 4IFKB 2VFFA 4JQAA 4HCLA 3UG5A 4CQDA 1BVZA 3GNOA 4XV0A 3TC7A 4RK8A 4S3FA 3NOEA 1TE1A 1D9EA 2VM8A 5JMUA 2E6YA 4HHHA 5FJJA 1J0KA 4TMCA 3ZR4A 3W07A 1RD6A 3W0KA 4HHLA 3QKZA 3PM6A 2Z24A 4IP4A 4PEKA 4Q22A 4TX8A 2WK2A 3KWSA 5E93A 4E2BA 3WUGA 3HV8A 1VR6A 2V30A 2D2HA 2XIJA 1GUVA 1V08A 4MZ8A 1LG1A 1KB3A 1L6FA 1J96A 7XIMA 1JDDA 4O0KA 3NVTA 4JFWA 3M0YA 3N6HA 5EFDA 3EWBX 5K4ZA 4UMAA 3U2ZA 1A5BA 1H0IA 1ONEA 4REQA 1GYLA 1XH2A 2J7CA 3LPOA 3WQPA 5MF5A 5K2ZA 5HPCA 4DZHA 3VGFA 2R82A 4ADTA 2G8ZA 1IIHA 1EJVC 1D7FA 2XGZA 4Q4SA 1WB0A 3S83A 4TTUA 1UWQA 3UR7A 4QBXA 1BVWA 4LUSB 1SZRA 4J3VA 3B9NA 4N4QA 3PSWA 3CEUA 3P74A 3B8IA 4GIEA 4C1NB 4H9YA 3B0VC 1AJ0A 2A21A 3NUKA 4KFNA 1RCXB 1OG6A 4GJIA 1E9ZB 5AECA 4HB7A 4XZNX 4LGXA 1OT2A 1XIDA 3CQ0A 3GLCA 3UA3A 4QJ1A 3CHFA 4PBFA 3DIPA 4GPNA 3IS4A 4PCPA 4DWSD 1ICQA 4J3ZA 1UC4A 3VKDA 4IMEA 5BXSA 3T55A 4F3HA 5HWMA 1T7LA 3NQBA 1GEQA 1JUKA 4MWAD 4P7QA 3USZA 3RUBL 1K4GA 1QI0A 2Q01A 4X3ZA 5C5YA 1R9XA 1EXPA 4WGXA 3LGDA 3LD5A 4OIFA 3JUGA 4X22A 1K03A 2Y8VA 1GNXA 4P7LA 4H01A 5CZTA 4Y9OA 3CIXA 3FVMA 5BRBA 5HJXA 5C9XA 1XJBA 3DAQA 4U3AA 4WQ6A 2BX7A 4XZIA 2ACSA 5HWNA 1XLLA 1HKWA 5A94A 2QDGA 3DERA 1WA3A 2YCEA 3RGTA 1U30A 1JYXA 3SCVA 1OIMA 4LAKA 2G5WA 3QY8A 1H51A 1KBLA 1GWJA 4W7VA 2XUCA 2QGHA 1A47A 3DFHA 2GGGA 1E6ZA 1W3IA 3ATZA 3TC6A 2JBMA 2PE4A 4FA3A 4GQRA 2E1DA 5ABTA 3WLJA 3W1LA 1TCDA 2E5BA 2YCLB 3VNYA 4ZBCA 1VH7A 1B4EA 1OIFA 3L67A 3GH5A 4J28A 2Y70A 1EDTA 3CHEA 1M04A 2Y7DA 4DVOA 1LROA 1EZWA 2VENA 5T9BG 4KCUA 4UQCA 2PZNA 4B5NA 3WH7A 4H6EA 2VOMA 3DUGA 3A3WA 3EWWA 1W1TA 5IHRA 3LCXA 1LOLA 5F1VA 4NJIA 3T05A 3T6CA 2OODA 4GYPC 1VHNA 1F74A 2V0TA 1LUCB 3RPTA 3P93A 4UTMA 2X1RA 4W8LA 4QDMA 4NX5A 3CZLA 3GK0A 3R0UA 1MFVA 2W92A 1MDRA 4GFIA 1UP2A 1K9DA 3G1FA 4GIYA 1ZENA 4GY0A 5G2HA 3PUGA 4AWUA 2G95A 3CHCA 4MY9A 3RM9A 5A2BA 5KSWA 2R94A 4H8UA 2E67A 2QLYA 3HFTA 5IDIA 1TZ7A 1JI1A 2C8NA 4FXRA 1TWIA 2D0GA 4U33A 1JEZA 4BR1A 2BTMA 1IXPA 3TKFA 1OY0A 2A2IA 4GO9A 1MMFA 1HP4A 3F03K 5JIPA 3WUFA 3R13A 5HMSA 1TPEA 1UR8A 1B3OA 3IGUA 1BXBA 4JL1A 3ZZ1A 4JTJA 2VX4A 3VNMA 1XKYA 1KM4A 2O92A 5DO8A 3TLLA 5CC6A 1Z32X 1YTEA 4LYQA 3SCRA 4JQ2A 4ZO7A 1R3WA 2GVEA 4B3LA 5J8LA 1G4PA 1UZHA 2CBUA 4X61A 3SRDA 5AFDA 1PKLA 1W32A 3N2OA 4GE8A 5ECVA 4K37A 1JYVA 1Q3NA 4F8XA 3PTMA 4XO7A 1ODZA 3HJZA 3S1GA 3FA4A 2V63A 1W5NA 4O0ZA 3WH6A 4W89A 3URQA 2D69A 1MXGA 5ABHA 1B9ZA 2H6RA 2D23A 3RO8A 2ANUA 4A3UA 2YB4A 5M1TA 4K6AA 1OHLA 3VDGA 1X6NA 3EAUA 1Q6LA 1XYBA 4FX6M 4QJ5B 1KFEA 1JPMA 2J66A 3EA3A 1YDNA 2VJXA 3I3BA 5CGTA 4FZIA 2JEQA 5MHBA 2XH7A 1QOXA 3UT0A 3W29A 1TIMA 1UZ4A 5DX7A 1Z44A 4W87A 1GYNA 5A8GA 3ANYA 1P7TB 3UJSA 1EH9A 2DQWA 1PKNA 3WBXA 5E70A 5HA7A 4DO5A 2QJIA 2UZ9A 1EYWA 4DM1A 5LNSA 7ODCA 3RJYA 4DYJA 4B5XA 4CQAA 3UCQA 4H7VA 4IMGA 3E1F1 1VF8A 1XLIA 5DXXA 3UXAA 4JX6A 4IIEA 3TEVA 1DJGA 3E49A 3VGDA 3KOFA 3TN6A 4L1GA 4IX0A 4JYDA 1F3WA 2HMCA 2C71A 1Z89A 3DN5A 4RE0A 4H3DA 4OOUA 3CWNA 4UFMA 4R53A 3CIVA 4LS1A 4D6IA 3JW7A 3WQFA 2WMHA 4Y9AA 4LH8A 1A4MA 2OYLA 4IG2A 3KBWA 3V7PA 3FEQA 4Z1DA 3LGGA 4FALA 2VWSA 2O7SA 1XQLA 4LF2A 2ZADA 4BK9A 3VIHA 3AALA 3GXIA 3TQ0A 4AC7C 4YVPA 2ZXAA 2BY0A 2V5BA 1DP0A 4ACZB 2QUTA 1C29A 2EG6A 1XYLA 2WSRA 3PANA 4AYSA 2BVDA 3HGRA 2ZC1A 3HF3A 6XIMA 2Y88A 2FGLA 2W27A 4O14A 4JQ4A 4UCGA 4C5ZA 2WKGA 3APYA 4GRSA 1E51A 1EJSC 2WJFA 3DHPA 2WMFA 3MUCA 1TWSA 1QI5A 7TIMA 3SY5A 4B5WA 2ZUTA 5A8OA 1W17A 2W0UA 5A8MA 4B9ZA 4O16A 5LA0A 5A95A 4DRSA 1P6BA 3UPMA 4O15A 3R1ZA 1Z3NA 4DUVA 2OT1A 3A47A 4KRTA 4O12A 1GK8A 2VD8A 2YYUA 5F2GA 1X8CA 1WKFA 1W1YA 4C1KA 1EXBA 2W61A 3O6CA 3LCLA 1KRMA 1AQ0A 4PMQA 1DQUA 3BLPX 2OB3A 3U4AA 5GNZA 4RLIA 4Q8VA 1DL3A 1KRCC 1G5AA 2JKAA 3KTCA 1ZAJA 3BV4A 4AVOA 4XSLA 1NTHA 2HVOA 3ZWTA 1I6NA 3F4CA 3AOFA 1XD1A 4YXGA 4IMDA 3F5LA 6PTDA 4I5RA 3VA8A 3EPNA 2ZKMX 4LVFA 4CN4A 5HPOA 2G4FA 5I77A 2I16A 4AD2A 1QUMA 3QZEA 1W3LA 5EB8A 3HURA 4XAZA 1P43A 3WEOA 3OGVA 4JQ3A 5A6KA 4NQ1A 1D3GA 4PL1A 1IT8A 3N19B 4BJHA 1TFVA 3ALFA 5AHNA 5I6SA 3FDGA 4FOKA 3R8RA 4TTGA 1SO4A 1R3RA 3VGHA 2ZA1A 1Q4WA 3GBEA 4B5UA 3VPLA 3G1XA 5A8QA 1O1HA 1MUCA 3B0PA 3M46A 3UETA 3S42A 2E3ZA 1UWUA 1RLDA 1GJUA 1Y0EA 3RMEA 3HBLA 1BPLB 3KDOA 1EEXA 3SCNA 4YCOA 2WVSA 3T7VA 5FEWA 3WD1A 3W1MA 1I0DA 2XWDA 4OUIA 3LV6A 1LOSA 4H6QA 3PPHA 4JNMA 3KLLA 4H1ZA 4NZCA 1V4YA 4WX2A 3UP8A 1X6UA 1CLVA 3QZ6A 4Y9MA 4PMYA 1FHUA 3LA4A 1HX0A 1A3XA 3NPVA 1SZNA 3T4CA 2ZOXA 5HNRA 1EHNA 1JCNA 2X2YA 3H22A 4NUWA 4UC5A 5KMYA 3CUGA 3WQEA 3FA3A 2VQUA 4DZ5A 4ZSTA 1TSIA 2B7NA 7REQB 1TR9A 2PDGA 5I3DA 5GJNA 5D2WA 1PCKA 5IBXC 1GCYA 1BYCA 5EMMA 1ISWA 4UTJA 1HUVA 3VNJA 3Q67A 4RR4A 1AD1A 3B8SA 3MI3A 3QMTA 2ZDSA 4OBSA 5XIMA 4PMXA 2D1ZA 5AB3A 5BW6A 3U5UA 4D8AA 1C90A 3TJXA 4BY3A 2Y8UA 3WSUA 3E38A 3F1QA 3VKBA 1OF8A 2WNQA 3L12A 5IFTA 3OZPA 5EMKA 1FWFC 1H50A 5FESA 3PAOA 5A6AA 3SJNA 2CLFA 3O63A 2FGBA 1SFLA 4PUUA 1Y5VA 3GR4A 3LV5A 3I6TA 1UC5A 2V81A 1E40A 2YDAA 2WJDA 3N12A 3UY7A 4AEOA 4Q32A 5LGZA 3MCNA 1VFOA 1W3JA 5CPMA 4F9JA 3AS3A 4F2UA 1P0EA 2EPMX 4D8ZA 4D6DA 1PYMA 2CWXA 4N9EA 3DEQA 4WK9A 3UGVA 3PBGA 4W5ZA 7TAAA 4DYKA 3AIUA 7PTDA 3WENA 4CNSA 1EBHA 3IJQA 2QGYA 3IIVA 3JU2A 3CQHA 4AEEA 2F2HA 4JPGA 3U7BA 1QOPA 4WF7A 1RPKA 2ZUVA 5XINA 3PG8A 3VIGA 3HV9A 5F2MA 1ZP3A 4RX0A 1PVNA 3USBA 1AVAA 4FO4A 2YKKA 1G6CA 1ONWA 4GZ7A 4MYXA 3MVIA 3RNDA 2FTWA 1E1EA 3GTFA 1J2BA 2RUSA 5BXRA 1MZRA 1FWTA 1E9LA 3BMVA 5AC5A 1QASA 1QAPA 2B4GA 4R33A 1BYDA 3G24A 2VXNA 1WUEA 1KGXA 3NQVA 3G6LA 5HBFA 4MY1A 2OFJA 1SVDA 2VURA 3OHIA 1F3EA 5DXYA 4AU0A 3PZTA 4QISA 4H9XA 1OJXA 1RBLA 3W27A 4I6VA 5CAHA 4EAYA 3B40A 3G18A 4YHGA 1I45A 4LUSA 2XIQA 4AZ5A 4ORIA 3BK0A 1NP0A 2GK1B 2PTDA 2PBGA 5CGQA 2PGWA 4IPNB 4V15A 3W2KA 1X1OA 1WX0A 4C1NA 4U2ZA 1E72M 1TTQA 4H04A 3RLHA 1ITCA 1HVQA 1GOXA 2YBVA 4LRTA 4NSBA 3ONCA 3NQGA 3BARA 2YA1A 4W86A 4N42A 3FSUA 4A6GA 1UA3A 4S3KA 2ZA3A 4DUWA 3OBEA 5HWJA 5DN1A 4GQBA 1R3TA 1WXZA 3QJAA 2H3DA 3CZJA 4L4LA 2FFIA 1I1WA 3GVQA 3B9OA 1J2WA 1CGUA 4AEFA 4B2DA 4TMBA 4Z1AA 1XLEA 2QCHA 3VK5A 4ZXOA 3LOTA 1XX1A 3O1NA 4C7DA 2VZOA 3C2OA 2Z27A 3R7MA 1QPOA 4DELA 1YXCA 4LCSA 1EJTC 2PRMA 2XM2A 3PZOA 2QV5A 1EEPA 3P2VA 2ZXQA 3GDTA 3EPMA 4PTVA 5I23A 1UBSA 4PUKA 1MDLA 2EG8A 1EDGA 4GNJA 4C6JA 2VEPA 1Q5MA 3S2LA 3W2LA 5CPNA 1W5QA 3ZWSA 2UY5A 4DJDC 3FYYA 3HG5A 2EQDA 1OK4A 4MB5A 4Q3MA 1B2YA 4H9ZA 2RDXA 1JGMA 3G0UA 5F1UA 5HJYA 3KXQA 2OQYA 4JN7A 4O8RA 2YCLA 3M0VA 1W8GA 1OCJA 1UKOA 3CLWA 1P6WA 2VGFA 3LBOA 1B31A 3EWZA 3AROA 4LVAA 2YX0A 2BDQA 3C2RA 4BEQA 5LIYX 2WZTA 3STGA 4X60A 4CD5A 3OA5A 3W22A 3LRMA 4KETA 4DZIA 3CV1A 3MJMA 3V5OA 4PL2A 3GIQA 1H09A 2DVUA 2WZIA 2D3LA 1CT5A 2IKGA 1IE7C 1GVYA 3G1YA 1EP2A 3GXPA 4R5EA 3SW6A 1E5JA 1GOOA 3H2CA 4G7EB 3RYSA 1LUCA 4FEZA 3WNKA 3ZT6A 3SI9A 4LY8A 3E6EA 1ZY9A 5G5IA 1HTIA 3IJIA 1SW0A 2IKIA 5HMFA 3DHFA 3LN3A 4R27A 2ZDRA 2WV8A 1K9FA 1MFUA 2A1YA 2J7FA 5LNVA 8TIMA 1QI2A 1EIXA 5EY5A 3QLDA 4IPJA 5D2YA 3ITXA 2ZXBA 4HK5A 4RZ6A 3V36A 3MTWA 3QM3A 2GSJA 4C5YA 1L2QA 3EMQA 3R58A 4UZSA 3AZRA 3WX7A 2OO0A 1FWHC 4EE9A 1XLDA 2DV0A 2PDPA 2XFYA 5LNUA 2VOTA 2WPBA 2AKMA 2CBVA 1XG4A 2QDDA 3WDHA 1JF5A 1G94A 1JAKA 3AO0A 3GH4A 5M3WA 3B9DA 4IGMA 2FHFA 3OQEA 4HSHA 1Q13A 3S5ZA 3U0HA 2CFFA 2J7EA 5GNYA 3AHVA 2DDXA 4HP5A 5A5WA 3LHZA 4TQTA 2BOGX 2O4QA 4UR9A 3NJ3A 1E3XA 4GINA 3WL0A 1PZ2A 3DX5A 4QGCA 3M5ZA 1R47A 3VOFA 2WBGA 2XN1A 5CEWA 3WMCA 5FKYA 3UWUA 2VZUA 1CXKA 3NGJA 1J6OA 1WP6A 1KCZA 3HG4A 2PB1A 1EOMA 2H3BA 3R2GA 4OTKA 3BG5A 4JQ1A 3WG6A 4TV6A 3SRFA 5BMXA 3W71A 4JHOA 3ITLA 4L61A 1AODA 2GVLA 2VT0A 1CTNA 2ZUWA 1L8PA 2INZA 3WLHA 1OG0A 3SUSA 3FS2A 2QMKA 4LB3A 4XX6A 5FF3A 3NA8A 1ONXA 3QMSA 1DTUA 3C3NA 2FGZA 2OZ0A 5DCBA 1YTDA 5LNWA 4PRWA 1CECA 4GKLA 1BGAA 5FL1A 1V6TA 2WZMA 1PZ0A 4GQ0A 1EPVA 1YW1A 3U57A 1P7TA 4NAFB 2PLMA 4NRRA 4TO8A 3MCOA 1V0MA 5H8UA 2C6QA 3GKFA 5EYWA 2VFEA 3UG4A 2J6XA 3TOYA 2ZZ2A 1WQ5A 2DT3A 4W8BA 4M6UA 5TF0A 1AW1A 5EMYA 3SO7A 3SCPA 1OZMA 2A4AA 3TYDA 2R1MA 4DJEA 3POCA 1FP8A 3AHTA 4JD4A 2XIBA 4JNYA 4S2BA 3PB0A 4E8GA 2W67A 3N73A 4M6PA 1EIBA 4JAWA 5LZLA 3NQ7A 2NQZA 4IQLA 3C0QA 2Y1HA 3UPWA 5I24A 3EWCA 1JYNA 3S2NA 4MTVA 1MSSA 2GGHA 2V69A 3DFSA 3N3MA 2QCLA 3M1ZA 2R91A 4EANA 2PDCA 2P5NA 3W74A 2FZMA 4F40A 1UMYA 1H0GA 2B7OA 1RP9A 1KNWA 2DY3A 4Z2GA 3LHUA 2PLKA 3B9AA 4Q8OA 1JPIA 3T4WA 5DY3A 1EUNA 2BGQA 4QP0A 4LX4A 1J0YA 4IICA 1UG6A 1ME8A 3WD2A 2GSEA 2CU0A 4UTWA 3VDHA 4PCSA 4BF9A 2E8YA 1HF6A 4IXHA 3VD7A 3SCQA 4ACZA 5HINA 2DUZA 5HJLA 4CQ9A 2QQ6A 2NLIA 3K46A 5FF2A 2V5JA 1XLBA 2BWGA 3EOEA 2DZWA 4V1XA 2BXZA 1QW7A 3BCDA 4I3GA 3C3UA 3EWDA 4G6CA 3RU8X 3TCEA 4GABA 3ME3A 4PODA 2WMKA 3U7VA 2VFHA 2P0OA 3TXVA 4TUFA 1ZL1A 3WKZA 4CU7A 1A3WA 5BU6A 1K02A 3S46A 1RPXA 8A3HA 2DSUA 3MZ2A 3FW6A 1E0UA 3CTTA 2DZTA 4RNJA 4GZEA 1E0VA 3GDMA 3M4HA 1M7PA 3BE7A 3DG6A 2ZBTA 4HK6A 4B16A 2Y89A 3WLQA 2EEXA 2Y63A 1JZ3A 1J5TA 2X0SA 4HN4A 1WDQA 4WRHA 4R3UA 3TX9A 4P7NA 5CH9A 4E8CA 2O56A 1AL8A 4CNTA 1H7OA 5A69A 4YTSA 3BWWA 2AGKA 3PUEA 3U3HA 4Z0JA 1EUAA 4QIUA 3ZLHA 3KHJA 3RX2A 5CKSA 2J79A 3EEGA 1OINA 4JHZA 4KRZA 2ZUSA 1H63A 2A79A 2Q02A 1WAUA 3WLIA 3UJFA 3BV7A 1OFAA 3CGTA 1GOQA 4GY1A 3BAJA 3KRZA 1YPFA 3WFZA 4PBEA 3VGEA 4J3WA 2R14A 4LANA 3AXHA 3W7MA 1J9YA 1DJQA 3QHNA 4XZWA 4MPQA 2G3JA 3P67A 2XSAA 5CJMA 4ZQCA 3HM7A 1HJXA 3NPUA 3MBFA 2NQJA 2GGEA 3EWXA 3FNDA 4IL0A 1WDPA 2INEA 5A6MA 5GJPA 1TPWA 3BLFA 2DVXA 3ECQA 4S3DA 2DT0A 3NSXA 4I5XA 3PSVA 1D3HA 2W63A 4WIWA 3TYEA 4KS0A 3WJZA 2PRHA 3EB2A 1HKVA 1XFCA 2QAFA 3PR2A 4J2PA 4HOXA 3C0SA 3M7WA 3MI6A 1NSJA 3CPGA 4UB9A 1IR2A 4HMEA 1XBVA 1IHIA 2PZ0A 4O10A 3OVQA 2YZRA 3W86A 5K9DA 3E2QA 4JTCA 4JGDA 1TO3A 1R9ZA 4MOZA 1IEIA 4K3ZA 1O6IA 4IJCA 3DYMA 5D30A 3OLIA 3C2FA 4EIVA 1L6YA 3MUY1 3W7IA 5DY2A 1H5YA 3VIKA 4GJ1A 4CUCA 3CAVA 4UFLA 4HSNA 1TV2A 3LI1A 7REQA 1BXNA 1E1CB 4LC6A 1X38A 4IL2A 1R3QA 1KTCA 1J11A 3AIEA 3LENA 4F4RA 5C7VA 3E0WA 2XPKA 4CD7A 1IWAA 3EDDA 1XFBA 2AQVA 4M1RA 1VEOA 1RZMA 2QJHA 4ZA0A 5HNUA 3AAMA 4GLEA 3BAXA 5AYIA 2WW5A 4B4HA 5C7HA 3H8AA 4GXWA 1VBJA 3INPA 4GOAA 1QHZA 4JX5A 3URAA 1TIWA 1QNPA 4HU8A 1QFEA 3FCPA 4PYSA 3QGAC 5C71A 3I3DA 4ZO9A 4AY8A 1OFDA 3VIMA 1V93A 3N9KA 2CZVA 5H8PA 1JXKA 4O1DA 3TW7A 3HFYA 3WD3A 2VP8A 4P7RA 2ZZ5A 2DSVA 1IR1A 3K8LA 2HS6A 1XUUA 4R7WA 3OIXA 4QX4A 1IIGA 1ZSXA 2BLEA 3GR8A 1C8QA 1KFKA 5BWAA 4O1FA 3BOLA 2X7WA 1F4AA 1D8CA 3NR0A 3P5ZA 1Q2RA 1XW8A 3TN5A 2GJRA 2IPWA 3DFTA 1V51A 4MFEA 2OR2A 4ZGYA 3T07A 3WF3A 2VVSA 4C6QA 1KLYA 3KE0A 4F0LA 3T42A 2RJHA 1JCTA 1ME9A 1CLKA 2HXUA 3W85A 2H9AB 1KM0A 1E6SM 3EYPA 4I5UA 3VCNA 3P81A 2J8TA 1GKPA 2GOKA 4QDWA 2XTKA 5D8ZA 3XINA 1V7AA 2J8FA 3W82A 4NZ1A 1X7FA 3AXKA 5HOSA 3F2BA 3QQ1A 3SRKA 1B4KA 4HCDA 4HU4A 4I8YA 4MDPA 3EOUA 2J6VA 3W23A 1WZLA 9XIMA 2ZVRA 4FK9A 1LJYA 1YQ2A 1XG3A 4QE5A 3WEMA 2V6AA 2GLKA 1FDZA 2CWNA 1JF6A 4FX8A 1TWWA 2CZDA 3U4FA 1UQZA 1CLXA 3NGFA 4OECA 2GYIA 3QGKC 3P82A 1PTDA 5TNVA 1HJSA 1ELSA 4Q4KA 2OO6A 2ISWA 4XIMA 2C18A 3LHTA 2YXOA 1XRSA 1Z48A 1A0CA 5CPLA 3ZR5A 3CUXA 4H4IA 4O1BA 2GK1A 1WBJA 2GUBA 3M6YA 2CHRA 2CZ5A 3CL8A 2BFGA 5KZMA 9RUBA 2JQXA 2QAPA 1BKSA 3R8GA 4EWND 2YBUA 4WHBA 1TTJA 2GQ9A 2GOUA 3HTWA 1E56A 4IIGA 4PUDA 1DXEA 3VILA 1ITXA 1TWDA 3IPWA 1W37A 3ZOAA 4ENLA 1OT1A 4JFVA 4C6IA 3GWQA 2ZX6A 3W2JA 4AHQA 4IOTA 5E6YA 4PUMA 3L5LA 3R10A 3APGA 4NZ4A 3OZYA 3RLGA 4S2CA 4LV4A 1TX0A 1LORA 2MUCA 1PDYA 5I09A 4NJGA 4U5IA 2A3AA 3L5MA 4MJZA 1HO1A 4IP5A 4HMDA 4PRRA 2H90A 2A3HA 4KQNA 4FMVA 3VVGA 3OPSA 1DBTA 2PP1A 2QNEA 4OVXA 1X6LA 4KW2A 3AMDA 3CO8A 1JVNA 1EKOA 3H2AA 2Y0FA 2OEMA 3OVGA 1YNYA 1JRCA 2ZXDA 4Q8UA 3ZLFA 2YXGA 2OZTA 5B80A 1YXDA 4AYGA 4K39A 3SGGA 2IMRA 4XAGA 5GVJA 4HJFA 2NXIA 3VZYA 3ORWA 1Q66A 3N2CA 4H8HA 1LLWA 4JIRA 2GVJA 4QSHA 2F8QA 2FVMA 1H11A 3M41A 5D32A 5C0QA 4J27A 2JF7A 3KHDA 1A5NC 2VO5A 3PPGA 1W1A1 1SMDA 4L6HA 3SFKA 3PBWA 3H2FA 2Q6ZA 4HPHA 5BYWA 3MYPA 1XUZA 4MUPA 2Y6ZA 1QW8A 3QV7A 3R5EA 3HJEA 1JULA 1UR3M 2C91A 2W91A 3EX1A 3ITTA 1XL9A 2HTMA 4TX6A 2VGGA 4G7EA 3VD3A 5DCEA 1DWGM 2CERA 3AJ7A 2OWCA 5CSUA 4ZE4A 3W7RA 1TR1A 1XGEA 3GAKA 1EPXA 4HTBA 1TB3A 2AMXA 2BG5A 1UPPA 1GJPA 5I06A 3BSHA 3CTLA 3N3TA 2TAAA 3E0IA 2R1LA 4AVFA 4FNUA 4QLKA 5D8WA 4ZTXA 2DT1A 2ZWYA 5CG0A 1NWTA 3V18A 1V3IA 3FEMA 4LBSA 2QS8A 3BSMA 1SFJA 3NQDA 3CZKA 4DPQA 3NAVA 4MAVA 1ZJHA 2G4JA 4QTGA 3OBAA 1I2NA 1JI2A 4NI3A 3LMYA 3MHUA 4W84A 4U28A 2R6OA 4IX2A 4XD6A 4HNOA 5E9AA 2SFPA 5HR6A 1B1YA 3WMBA 3L68A 3QV6A 2WSQA 3H2MA 2Z2UA 3OZOA 3L4UA 3PJTA 2G50A 4IPPA 2VDHA 2C1IA 4F0MA 3LHYA 4DAIA 3IAQA 5KZDA 4J5NA 1GZ1A 2Q3RA 4MGGA 2NZLA 3EB3A 2HK1A 1SJCA 3P14A 4P8WA 4ROPA 2QJMA 4HYRA 3OOQA 2YL6A 2OX4A 3CQIA 4WKAA 3R12A 1D3CA 5AC4A 5E0FA 1QRQA 3K1GA 1PV8A 4TOQA 3A4JA 5HQLA 4HBKA 3UWEA 1R8LA 4UFIA 1QT1A 2WCAA 1FUYA 4DN1A 1Q7QA 3TMQA 2Z2AA 2NUXA 4TVDA 2ZX5A 4AWTA 3W37A 3UXLA 4AF0B 5CBIA 4GYPA 3L9CA 1PL9A 2WSPA 3WQVA 1M7JA 3R79A 2VX7A 4AHPA 3NZQA 4Z1YA 4ZQNA 5D33A 4H00A 1TMHA 1SR0A 2VEMA 5FJTA 4BS0A 3G2GA 2XVKA 5DQPA 1Q85A 2A85A 1Q6RA 3WYZA 4KPLA 3U9IA 2WC4A 4ZEPA 3LLDA 5H91A 1QATA 4AZ6A 3V16A 4J4KA 5G4EA 4FLSA 3KOYA 1KV8A 5CQ1A 4D6CA 2CHOA 1XIFA 2OWXA 3OLDA 1FWCC 4LBRA 1Q6FA 2DJXA 1RALA 1H41A 1Q6CA 1FWDC 1PO9A 4IMCA 2YOCA 4GISA 3A24A 3BLKA 4HU0A 5EBUA 5FEPA 1PIFA 2NX1A 3SN0A 1BYAA 4QQUA 4G1KA 2NSOA 3CV2A 3Q2DA 5AHLA 2ACRA 3AIVA 4ML9A 4A8IA 3AMKA 2D0HA 4I9MA 5C9ZA 5ABFA 3AYSA 1UD5A 3N4EA 3THCA 1EWEA 2PTYA 3UWWA 4AIBA 2D2OA 3UYCA 3RITA 3MSYA 1X39A 1S2VA 5FJUA 1HKMA 1CPUA 3BGGA 3CAKA 2PP0A 2CLIA 1OGBA 4GUJA 2WPGA 1DJYA 2OZ3A 3FGCB 3WLPA 4NT0A 2VYOA 1ALDA 1UB3A 4C6CA 3S2MA 3BOXA 4N7QA 3QV8A 3TK7A 3CUIA 3VM7A 3ZJKA 1MNZA 3UZYA 3CIWA 1S2WA 3SURA 4KF1A 4GC4A 1I2RA 1OFOA 2EPNA 3HQPA 1LTDA 2XIMA 1IEVA 1RA0A 2TMDA 2XDFA 1VEPA 3VIJA 1EF3A 4Q4OA 4B9YA 4ZQMA 5LIKX 3PPFA 1UPMB 4UTIA 4UFJA 3SGZA 3NNTA 4LUTB 1UBPC 1GYMA 3BMXA 4KESA 3NEVA 2DUXA 4AIUA 3WEZA 5CAKA 3AU6A 1D7KA 5E1QA 3O6YX 3VU2A 1TPB1 1H1NA 4O13A 2ZZ6A 5K3VA 4AZCB 3P84A 4JFSA 3SDOA 3N17A 1CXEA 1G1YA 2ZZ3A 1UWRA 4AZHA 2ZICA 3QY6A 1RBAA 3UZXA 4YWIA 4LF1A 3B04A 3THQA 3AZSA 3WLOA 5C8BB 3FFSA 1YE4A 4AIOA 2DEPA 4B5VA 3S47A 3WO8A 2YCJA 3SN1A 2WVVB 4EAMA 4MKVA 5EA9A 2TODA 1MNSA 3SY8A 1B57A 1I60A 3LM3A 2PODA 3L0NA 2DIEA 2VFDA 2DIJA 1KWGA 4JTAA 1VENA 1UHVA 3TYBA 1V79A 3AYTA 1O95A 3EKLA 4QXIA 3HOJA 2PLCA 4RKAA 3WK1A 4I8DA 3T2OA 4F2BA 4AIEA 4JTGA 3M0ZA 4DNMA 5ABEA 5KITA 4ZE5A 1UUOA 3E9AA 3BLIA 3A5FA 1IXOA 1NQKA 2NVCA 2XFFA 1QPRA 5G2WA 1KBJA 3S1VA 4KRUA 4MKNA 3PF3A 3QYSA 3RLUA 2J8GA 4O57A 4WXYA 2HCVA 4YMZA 1YDOA 3RPDA 4KBXA 2WMIB 4ZOCA 5U7SA 2DGAA 3ALGA 1F76A 1V7YA 2R24A 3CL7A 5AC8A 1IWPA 1JR1A 3NM3A 3A21A 3ABQA 2OMAA 3QC0A 3M5YA 3IRSA 1OCQA 2CPUA 5D05A 4YCPA 2VZVA 4QNEA 2WCGA 4LUJA 4G56A 1CIUA 1WKYA 4AH7A 1UOKA 2CZEA 1AJZA 2VVNA 3AISA 3MKVA 3B8UA 3CT2A 5C6MA 1KFWA 4HHMA 1PSCA 2C19A 2XVPA 4H2HA 3RX3A 1VCFA 2GVYA 1XLCA 3G8EA 1DKWA 3JZEA 1E1CA 4UZUA 3IAPA 4GUHA 4UNIA 4ZQPA 5J5RA 1S5TA 2ZX8A 4XTIA 4DX3A 3QEZA 1TKKA 4MDOA 3BAIA 1W2VA 4EKJA 3PUDA 3CQKA 2PD5A 1XPGA 2O7QA 3IIPA 4JX4A 4POCA 4MF4A 1RQHA 3T0DA 5D9MA 4PMNA 1R2TA 4Y96A 2BHYA 3O05A 1YPXA 3NDOA 3KBJA 4BI5A 2O9TA 2O9PA 1V6YA 2XH2A 2PWDA 3CHVA 4B4FA 4FF7A 4OGZA 1B9BA 5EL1A 3HG3A 1JFHA 5T26A 1QJWA 3L4XA 1AD4A 4GA8A 1C7SA 3MY9A 1C7TA 5HXMA 1ZUAX 2FKPA 3EXRA 3LDVA 2X05A 3VOIA 3WQCA 1VS1A 3FVDA 2OLAA 2J4GA 1K7FA 3RM8A 1JCXA 4JTIA 4DI8A 1EQCA 2YDRA 2F38A 3AWNA 4XZMX 2RDUA 4WDXA 3OLEA 3OU8A 2VR4A 3D3FA 4BQ4A 2FZ8A 1CENA 4WKFA 1PKMA 3WELA 1UR4A 4OFCA 3L4WA 4H6KA 3LMZA 2DZUA 3VABA 5JIWA 1LWIA 4KIEA 3UJ2A 3TV8A 5K7JA 2EPLX 4CQBA 3U2EA 1XDLA 1UUMA 2PS2A 3NDYA 1UMLA 1K1DA 4JR5A 1BWVA 3NEHA 4D8LA 4WEVX 1ZBWA 1GW9A 3N34A 3NZ1A 3TSBA 4QM1A 2TPSA 3WK3A 4QJ4B 5IBXA 1GHSA 3TW9A 1REQB 4MZYA 4MNMA 3OODA 5B7YA 1SSDA 2Z1KA 2C15A 1XICA 1TE6A 5KTLA 4DUOA 3TA9A 4J2MA 1BEUA 2OU4A 4LPCA 4R34A 4ZOAA 3HPXA 4LAMA 1Z6KA 2ZZ1A 2VFIA 1RP8A 1W56A 3GS6A 2JIEA 4AISA 3H4XA 2BOEX 3XISA 1LT7A 1ZALA 4QHRA 4RDZA 3WQDA 4XWUA 2MNRA 2FZ9A 2YGYA 2DPEA 2FPYA 3W6MA 4ZR8A 4US5A 3D0CA 3OTRA 1UA7A 1W5PA 4PMUA 2DZBA 2AQWA 1L6WA 3GNPA 3MB9A 4KCWA 4WSKA 1VKFA 2QDHA 1GVFA 1Y7VA 4UWMA 1P0NA 1WOAA 4Y90A 4F0KA 1P4CA 6CGTA 2BZNA 2V68A 1OYCA 4ICMA 4WJEA 2A6LA 4R7OA 3K4DA 5C9WA 3AC0A 1M7OA 1HKJA 2OQLA 2F9RA 4RE3A 1JRBA 2R1NA 2OZ8A 1EL3A 2IPGA 1XP3A 3SUUA 1DYSA 4FNRA 2QCGA 1F7BA 4UQDA 3LSCA 4H9TA 4XB3A 2WJZA 4BI6A 3BQ5A 4RNFA 3A12A 1PBGA 1CGXA 1UD2A 3ANVA 3AUJA 5HUPA 3S5YA 4S3BA 2NQLA 3UR8A 4XZBA 2VCBA 3UERA 1C92A 4ZQRA 4ADUA 1OBAA 4UTUA 3KCLA 1M7XA 1WNOA 4YIWA 1RAKA 4LALA 1PYFA 1HXJA 1G4EA 1R2RA 3NQCA 2QR6A 3LCHA 3T0AA 4GHRA 4WR3A 1T40A 1TUXA 2RDTA 3P8IA 4J3TA 3EMCA 3FXGA 4PB4A 3WD0A 3MZNA 3COTA 3AIRA 1CGWA 1I2PA 4HNCA 2OPJA 3NL2A 4GI9A 3VKJA 3C0LA 2EKGA 3T8LA 1J0IA 4NAEB 4DO6A 3AWOA 3TNOA 4YJ5A 4CQ8A 4MLRA 2HPIA 2GWGA 4CEUC 2GDUA 3I3EA 3C0JA 4Q8MA 3E12A 4DUXA 4XSMA 3H2OA 1JD9A 3BVJA 5K4XA 4HVXA 2GQAA 1XSIA 3AHYA 3N9RA 3POHA 4HIBA 4L9XA 1UD4A 4PMDA 4M24A 2ZYFA 4JDBA 4LNCA 1QNVA 4P5UA 1P48A 3D46A 2VR2A 1RV8A 4MSSA 3ZVIA 4ZO8A 4O8AA 4X9SA 3K1DA 3W4RA 2D22A 1A5MC 3B8TA 3VKCA 5I00A 3O15A 4AY7A 3R4IA 1N55A 2GGJA 2OEKA 1EJRC 2GJXB 2C1HA 1TV8A 4U3CA 1VYPX 1LQ0A 3NO5A 4ZOBA 4FNPA 2VUYA 5REQB 3E2SA 4DF2A 1WO2A 4EF8A 2BODX 1H60A 1L8NA 4CKQA 3M0LA 3VFLA 1KGUA 5LNRA 3AUOA 1JUEA 2E7FA 3GG7A 3UY8A 2ACUA 3SUWA 3B0YA 3BCJA 1NAL1 1E0WA 1O94A 1K7XA 3DHUA 3H21A 1B3XA 3W28A 3N18A 3M0IA 4PC8A 4NNCA 2OELA 3STCA 3L4YA 3VAVA 3STFA 1XPYA 2I56A 2G3MA 2QHAA 2Z6JA 2POZA 3MO7A 4DJDA 1DORA 3Q37A 4AZGA 3CEPA 4L9YA 3ABSA 1M68A 1SO5A 4WZHA 1F3TA 3N25A 1IGSA 1FCUA 1OGSA 3B8WA 3GDKA 1PXGA 5HQEA 5FD0A 1M03A 3GC4A 3PZVA 4D6EA 1UH3A 1KBIA 4LB4A 1V77A 3LGEA 1P0KA 5DBTA 5A2AA 4B2DD 2X2GA 1Q7MA 1GG1A 3N15A 1VZWA 3NZRA 3TVAA 5TBOA 3ZFHA 1JXJA 2D2JA 4KERA 3AXIA 1IWBA 4JKMA 1KWKA 2JE8A 1PE1A 4QJ3B 1PJ9A 3GY1A 4W7UA 4AF0A 3W1NA 4WDWA 2OCZA 5D09A 3EZ4A 4AD4A 4LC8A 4XD3A 4AB4A 1CGVA 3DFQA 3MS8A 3PHAA 4IGHA 1DJWA 4ATLA 1OCNA 4DI9A 4Q4RA 2BP1A 4C1LA 5G2IA 3GXDA 1UR0A 2DH3A 4LS0A 3KP1A 2QIIA 3KRBA 5CG7A 3RPMA 3D6NA 3CB8A 4WD0A 3H4GA 3LPGA 3JZUA 5E0CA 4YL2A 3LCIA 3FV9A 5CSRA 1OFEA 5JBEA 5MKGB 3GUGA 1W9VA 3GFZA 5BNKA 1VJSA 4DB7A 4GACA 1WXJA 1VP5A 2Q8XA 3HGSA 4L56A 3V75A 3ZO9A 1JJKA 1RJQA 2V9DA 2QJNA 1U1HA 5D2TA 1FXQA 3ZM8A 1XLMA 1DIOA 1FP9A 4LCQA 4XZHA 3VINA 3ICJA 2QCNA 3VE9A 3RILA 4Y6GA 2NW0A 3GYCA 3L2LA 4AUBA 1KRBC 3TUUA 1Q4NX 3PZNA 1F9CA 1YTKA 3LX9A 4ZB2A 3WLRA 8RUCA 2PU0A 4Z2JA 4O4VA 1Q6EA 1QO5A 3P0XA 1J0HA 4AFYA 5BXPA 3WQ4A 2ESCA 3DFOA 2YDSA 3QV9A 4AMCA 1T41A 2R8WA 2WHJA 1YHTA 4IJBA 3MCMA 4M81A 4N9BA 1XS2A 1Q8JA 4AD3A 2VELA 4XKYA 4FAMA 1DVJA 3W1XA 2EGZA 4LFYA 2JGQA 4QRNA 4DIAA 4ZFMA 3IUIA 1A5AA 7CGTA 3OW1A 3KAOA 5TQLA 3UZZA 2BBFA 3BICA 3KCOA 4GI4A 3BGAA 2BVWA 1UROA 1MRQA 1XH0A 1KM2A 1BSLA 2BY3A 1CBGA 1XLAA 3N9SA 3NURA 2PBOA 3SUTA 3IACA 3NFUA 1S3HA 2BHZA 4LUTA 4TX9A 2E6FA 4DM2A 1DIEA 1KM3A 4W93A 5FCZA 5AZ0A 3S8HA 1ML1A 3O07A 3ZQ9A 5KETA 3N14A 2PDYA 1R3YA 2V3FA 4AZCA 5JVLA 2YIHA 1VLIA 4M6QA 3W73A 3TROA 1FKXA 1OYBA 1C8VA 4DJFC 4J9JA 1GOIA 4ICCX 3ZVHB 1W9DM 3DC8A 3GU9A 2QPXA 1XIBA 1ADDA 4FS9A 3MA8A 3RR4A 4M7SA 5BOEA 2G37A 3V35A 2WVVA 3ZJ8A 1VFLA 1VGAA 4XQ6A 4HGXA 2PAJA 3RU6A 3NM1A 4NZFA 2KZHA 4O1CA 4UR8A 4V1YA 2YCKX 3WH9A 3QHMA 3P5YA 3EXSA 3L7RA 4D1IA 3W1QA 4GFSA 2C16A 2Z1WA 1J10A 2W3ZA 4ATWA 2HRWA 1WOBA 1GPWA 4NASA 4A2SA 2QV4A 4CN6A 1E15A 5DT7A 4XKMA 3STPA 1GQIA 1GOKA 4DJED 1TVLA 3R6IA 5AVHA 2PWEA 3G1DA 4JCMA 2OGJA 1UP3A 2P8CA 3E0LA 3B4UA 1KXQA 1UH4A 1QNQA 1R2SA 1VPYA 4RZ5A 3N29A 3BMWA 4JICA 2BXVA 4RDWA 5AC7A 4IIBA 4KGJA 2DU2A 1S5VA 5CLTA 3SCTA 2WMIA 1IV8A 1BF6A 2OXNA 1HJUA 4GYFA 3IJLA 4CCZA 4C6DA 2X41A 1HL2A 4BHYA 3WN6A 2BB0A 2F6UA 1JZ8A 4ES4A 4B5TA 1FBAA 2F6KA 1YXYA 2CNCA 2ZRVA 3LPFA 4MWAE 1NFBA 2NXHA 2WNWA 1N8WA 4JXCA 3RMJA 1Q6GA 3L2MA 2PWUA 2WCSA 4FSAA 2GGIA 3PZIA 2QVHA 3H26A 2GJPA 1SW3A 2YFNA 3TCSA 3M44A 1KM5A 4YNGA 1LCOA 5J04A 2HNEA 5D38A 3VCCA 4ACYA 1V0LA 3OVRA 4IMAA 3TQKA 1O66A 1BRLA 5B7ZA 2EF9A 2QYGA 5BU9A 1FXPA 1C3FA 1Q8AA 3D5HA 2V5CA 2PDMA 4FI4A 5A6JA 3YPIA 2TRSA