6PTDA

Phosphatidylinositol-specific phospholipase c mutant h32l
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
296
Chain Sequence
b'ASSVNELENWSKWMQPIPDSIPLARISIPGTLDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
molecule tags Hydrolase
source organism Bacillus cereus
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
total genus 98
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 6ptdA00
1DJZA 1VD6A 3KS5A 2ISDA 2F9RA 5PTDA 4RW5A 3I10A 3EA1A 4GNKB 2PZ0A 4F2UA 6PTDA 2OOGA 1AODA 1DJIA 2PTDA 4R7OA 5T91A 3H4WA 1DJYA 5T9BG 2P76A 1O1ZA 1PTDA 2PLCA 3CH0A 3KS6A 2ZKMX 3OHMB 4I9JA 4QJ5B 3NO3A 1DJWA 1DJXA 3QR0A 2OR2A 3RLHA 4F2TA 3PTDA 3EA3A 1ZCCA 4OECA 4I9MA 3QR1A 3QVQA 1DJGA 1YDYA 4RV3A 4F2BA 4RW3A 4QJ4B 3H4XA 4I9TA 1PTGA 1QASA 3MZ2A 3V18A 1DJHA 4I90A 4QJ3B 4PTDA 5T9CE 7PTDA 4S3GA 2FJUB 1T8QA 1GYMA 2O55A 3V16A 1XX1A 2OTDA 4I8YA 3RLGA 1T6MA 1V8EA 3L12A 3V1HA 1QATA 4Q6XA 3EA2A
chains in the Genus database with same CATH superfamily
3MI2A 5IBXC 2YBUA 4U2YA 2PWUA 3W70A 1S1RA 3L2LA 5A8GA 1GTEA 4QLLA 3VCNA 2WQPA 5IDZA 3P6LA 3TC3A 1DWHM 3REQB 5I24A 5MKGB 5BXRA 3OLDA 1I9CB 2GVGA 3VNZA 3BCFA 4WOZA 3ZR6A 5CPQA 3E2RA 2QJHA 2ACQA 1KB3A 3S5OA 3MKVA 1Y5WA 4FOUA 4GO8A 1ONRA 3ZZ1A 3EX1A 4WJXA 3T0CA 3TLQA 1VFUA 3S47A 4RDYA 1KM5A 3QKZA 4JXCA 3CBWA 3QV7A 4FI4A 4D6IA 2E4TA 4KWSA 1K9FA 4S39A 3W7KA 1HIZA 4C6CA 4YTQA 1F07A 3TH6A 3E0WA 2NV1A 3GM8A 3CC1A 4PMUA 4GMEA 2W5FA 3DKLA 3NPWA 4LH8A 3VFCA 1W3HA 3BPWA 3HMJG 1U5VA 6REQB 1AZ2A 5EMYA 4UCGA 1VIZA 1MRAA 4JIQA 5CG7A 4F48A 2QKFA 2QCCA 2VWSA 1DJGA 3IJ8A 5BXSA 3BC9A 4QDWA 2J7GA 3V18A 1W5MA 3EB4A 3O05A 3W7LA 2E6DA 5D9MA 2Z1VA 3QZ6A 4DF0A 1OEPA 3P8JA 4ZQCA 3OLIA 3F4CA 4FSAA 1DIOA 3W37A 4MKVA 1A47A 1R6WA 1NEYA 2BODX 2RFGA 3SGZA 5CAKA 3QMTA 1AD1A 3WK2A 1FWWA 1KM4A 1W1A1 4IUGA 2J6VA 3OP2A 2QUTA 2JEQA 3BW3A 2DT2A 4NKCA 3R8HA 2EEXA 4PUMA 3UJFA 4Z1YA 2XU2A 1EKOA 4QE4A 1A5SA 3TA6A 3R5EA 4ZB2A 1V7YA 2QT3A 4MPQA 3W85A 1G1YA 1SM9A 1XIDA 1BHGA 5CZSA 4ORMA 1GQJA 2O0TA 3ICJA 4MB5A 4IIDA 3G8EA 1OY0A 3IACA 4MYXA 4ZENA 2CITA 3P7YA 2J7HA 1RBLA 1M7PA 3B9DA 3WNLA 4PMVA 3LG3A 3QPYA 5EA9A 1QO2A 3G1SA 3CPGA 1Y5VA 1K1DA 2XTKA 7CGTA 3VKJA 4A3RA 2GWNA 2GSHA 3FYOA 2YCLB 4PMNA 4TO8A 1KXQA 1VPYA 1OT1A 1I8JA 2VCCA 4FXJA 3UXAA 3UJSA 2PCEA 4HK7A 1HJUA 5M03A 1YMYA 3WEOA 2WMFA 4OUEA 3CIVA 1E72M 1OQFA 2ZRUA 2X0HA 1NY1A 4EWJA 1D3HA 3NZRA 4HTBA 3WMLA 3P74A 1PE1A 3CH0A 1QHPA 4KQNA 3CUGA 4W5ZA 4H19A 5K2ZA 1W8GA 1TV3A 3IJ7A 2GDUA 3VKKA 3TLLA 1VB9A 4JX6A 4IFOA 1US3A 1J93A 4XAFA 1KKRA 1XDMA 1PDZA 4MNLA 1E9LA 3FEMA 1QOPA 3AIEA 1FHDA 3KRUA 2OEMA 4GI4A 4CQ9A 3N18A 1ZAIA 1VZWA 1W1B1 5EMMA 3W1AA 1E6QM 3CASA 2QDDA 1NDYA 3NJ3A 4O1FA 1DWJM 3UXKA 2V5BA 3QTGA 3KOYA 3LBMA 2CLFA 3EDKA 2FMOA 3BAIA 4UZUA 1TMLA 2Y2WA 4LAMA 3VE9A 4GNKB 2W66A 4MB1A 4A6GA 4O1CA 1C8YA 3W75A 4UTLA 3VM7A 4L61A 3W01A 1XFCA 2DP3A 3Q58A 3NNTA 4DJEC 5CAHA 5I3DA 4PB5A 2J7EA 3HMCA 5A6MA 1YNPA 3AS3A 3R43A 1E5NA 3CZ8A 3T55A 3LOTA 3AMCA 2HWGA 1LWJA 2WZIA 2WHKA 3CWNA 1T6MA 1FBAA 4C6JA 3RR1A 3WJWA 2YA1A 1F3XA 3GH5A 1JNDA 4NRRA 1HL9A 3R6IA 1M9HA 1Q7MA 3B05A 2NVAA 3Q94A 2GGIA 4O1DA 4GY0A 4AC7C 2FTPA 4HSHA 1WZAA 4DY1A 2VGFA 4GI9A 2VFGA 3RCMA 5FAJA 3S1WA 2O55A 3V1HA 3HPSA 3VUPA 1B5TA 4ZR8A 1VD6A 4ES4A 3WFAA 5HJLA 1EZ2A 4DELA 4W9TA 2Y5EA 4L1WA 3RITA 2V68A 2DQWA 2NQ5A 4W8LA 3TYCA 5HR7A 2E68A 2I9EA 4MDPA 3CIWA 5I78A 2J4GA 2EBNA 2QMJA 8RUCA 2FDMA 1PVNA 5I6SA 1ZLPA 1GVOA 3RRAA 4O10A 3VABA 5D03A 2Z27A 4V1XA 1VIWA 1E6PA 4IM4A 1VBHA 2ACRA 2FGLA 1FQ0A 3SN1A 3D5HA 2FB3A 5FJIA 2Q71A 5C9WA 3CEUA 2C0HA 3VTRA 4E5TA 5J8LA 3I65A 2ISDA 3PWIA 3RRXA 3B8SA 4G7EA 3KRBA 3IUDA 5IHSA 4QM1A 3MBFA 4K37A 4XBJA 4FXSA 4JHZA 3D6NA 4GHRA 4MFDA 2DJLA 4JIRA 1DKWA 2QVHA 2QW5A 2DIJA 1ONWA 2XFYA 3EBVA 3M46A 3UA4A 1PJ9A 1XI3A 1LOSA 5BZAA 1MDLA 3KBVA 5FKYA 3PUGA 2RJGA 2ZXAA 4HHMA 3T07A 5FF2A 3U2CA 2FVMA 4JTAA 5FSDC 3NQ7A 2QJIA 5M1TA 3CXOA 5DBTA 3QOMA 1MSSA 1T7LA 4M6PA 2F84A 3VINA 3NXFA 2ZDSA 4IWWA 1EL3A 4NNAA 1H1NA 3USBA 2A7NA 4ZFCA 2WJDA 5FCZA 4QS6A 4PEKA 3WCZA 3S42A 2OO0A 3HOJA 3LZ3A 2I7GA 2AKMA 3ONBA 3QPZA 2I16A 4XAGA 4MIMA 1JZ8A 3E2QA 3FVMA 1CZ1A 1UR0A 4JYFA 5AZ0A 3VOHA 2JF7A 1TJ1A 3MWAA 2BX7A 3THCA 3HGJA 1KKOA 3CJPA 4PUDA 1B3VA 3GY1A 2YCIX 1V0MA 4AZ5A 1O1HA 2QUNA 2GDVA 2DZVA 3DFSA 4OE7A 4PEEA 1F76A 3WF4A 4IUOA 2W9MA 2WPBA 4DBSA 3R89A 1JULA 1FH8A 1MI3A 3ABOA 3GK0A 3FA3A 2OKTA 2ZVRA 4TXEA 6ALDA 5FJJA 4JBRA 2WO5A 2Y24A 5KETA 1UWQA 1HX0A 1TWIA 2VJXA 1S3HA 3IANA 1VBUA 1ISYA 3EOEA 4QDPA 2GQ3A 5AC7A 2ZX6A 3TSDA 4DF2A 4RKAA 4ZO6A 4QDMA 2IMRA 3NL6A 2CZEA 2DZTA 4HZ6A 4NZ3A 1UZHA 1L9WA 5L9FA 3I10A 3QQ1A 1XQKA 4CD6A 1UBPC 2WLYA 2YL8A 3G3MA 1ADOA 3K2GA 4AMAA 4EP8C 3WLSA 1KC7A 1JPKA 2VEGA 1CXEA 1KW1A 1GPFA 3W7RA 3CHEA 3UR5A 5A6KA 1JAEA 4O13A 4PA8A 4RDZA 3UR8A 2J8TA 2ZUNA 3UF9A 4AD3A 4FF5A 1EEXA 3MMUA 5DMNA 2VX7A 1HKIA 1P43A 2DZUA 1GVEA 2XM2A 3BZJA 3MUIA 3DC8A 3L4YA 2PA6A 2DORA 4R3UA 3SUSA 3SQLA 2ZVIA 3ORWA 1M3UA 3JW7A 4J1OA 4N42A 1UMYA 1RA0A 3W0KA 4AY1A 3ELFA 4MJ4A 3B0VC 3PBUA 1YTEA 2E9MA 3V35A 3CO4A 2VEMA 3ARVA 1VYRA 1LT7A 4KEMA 4KWVA 5BU9A 4KCUA 3R58A 1LDCA 4IL0A 3UGVA 1XF0A 1ESWA 2J9XA 3WQCA 2FH6A 7XIMA 3P0XA 4NIRA 3UESA 3RPTA 3PULA 1JFHA 3NQFA 1U2YA 1TIWA 4I8YA 1TCDA 1X39A 3LA4A 3GTHA 3IUHA 2VHLA 4XAPA 3T1GA 2A3BA 3URAA 1RPKA 2HS6A 3BJFA 1C8QA 1REQA 2NUWA 2DPEA 4O11A 3N6QA 4M81A 4CNOA 2XVKA 3BAYA 3G1YA 3UXLA 4GIAA 4AD1A 1X6UA 2SFPA 4BQ3A 4OBRA 1RY0A 1XCFA 1ITQA 2CZ5A 1SMDA 1VFOA 3TROA 3Q4DA 3L9CA 2PDLA 5HOSA 5RUBA 4LGXA 2OQHA 1W1VA 3QN3A 3W7GA 4JTIA 1B30A 3CTLA 4D1JA 2XYLA 4OIFA 1G01A 5IXEA 1LCOA 2D23A 5M3WA 1VLIA 3EKLA 2WWDA 2Y4SA 1YX1A 2G96A 4H9TA 4J7RA 4JTTA 1AODA 1F8IA 2QLYA 3WQ4A 1BF6A 3DHUA 4QCFA 1VFLA 3B8TA 1FH9A 2ZWYA 4E2OA 2BBFA 1PIGA 4S23A 5EMUA 1AK5A 3LHWA 1U83A 5CSYA 4WX2A 4DXVA 2Y7FA 2FHFA 4NNBA 1DOSA 1JJKA 2ZZ5A 3OGSA 4PRTA 1FWHC 1QW7A 5CBJA 4HP5A 3T2QA 3NZGA 1XKYA 5H2ZA 3KVKA 1LF1A 2WKGA 1BVWA 3RX4A 1H11A 4PMZA 1G4TA 2FHBA 1Q6DA 1US0A 2HS8A 1EJUC 1A3WA 3GXTA 1B90A 1RVKA 2VI0A 2HBXA 5DFAA 3LI0A 4WKAA 1JUEA 3EDFA 4L1XA 2NQLA 1KCXA 3ZT7A 2YB4A 4MAVA 3W1TA 2B4GA 1VYPX 1WKEA 2A1YA 3EDDA 3B06A 1SO6A 1VFHA 3W7JA 3G1VA 3CWHA 1WB0A 2GJPA 3T7VA 1VFMA 3THUA 3L23A 3OU8A 3M0KA 1B31A 1TPDA 1NM9A 3GWQA 3PBWA 3N1AA 2PS2A 4HNTA 3CT7A 2OJPA 2QIWA 1CTNA 3JZUA 3R12A 1Y65A 3L4VA 3R1ZA 4FXRA 3EOOA 3K4AA 2XJ7A 4IFKB 3OPSA 2YR1A 1B9BA 3EX4A 4QISA 5XINA 2CLPA 3SJNA 3TQ0A 1UWIA 4F0RA 5IOBA 1TV5A 3VC6A 3ZJ8A 1OYCA 3MZ2A 2Z0IA 3RCNA 3EAUA 3NSNA 4DWSD 2BY3A 1N2VA 4PYSA 2YZRA 4GLEA 1B3WA 3PWGA 2OZTA 1TJ2A 2P76A 2XVLA 3MP4A 3VOCA 1E51A 2NWRA 4EACA 4DAIA 3BW4A 4XBKA 1G67A 3BVJA 1O4UA 3SN4A 3L12A 2IKIA 4PULA 1IEQA 1WNOA 3MQTA 2E25A 1I1WA 1UG6A 3GC4A 3I6TA 1DL3A 1W1PA 4ERGA 1FP9A 4UQBA 2PI6A 2J78A 2P88A 2I5QA 1XSIA 4U28A 3I6RA 1RCXB 3TFXA 4X9SA 5ECVA 1FCQA 2ZTJA 4ADUA 3VDCA 3NIYA 2V30A 2PBGA 1QK0A 4S38A 1UA7A 2QCMA 1MRQA 1IT8A 4H6QA 5I3IA 1HN1A 2OQLA 1WBHA 2Y88A 1J96A 2HJPA 4DXXA 1J2WA 4CN6A 4JR5A 1JQXA 3DECA 2OSWA 3C2RA 1A5AA 2Z7KA 1YKWA 4R34A 5IBXA 2NW0A 3PUDA 3MYOA 3GXNA 5E9AA 1V77A 3P2VA 3W1PA 2WW5A 3EMQA 2JE8A 3NM1A 1LM1A 2BVDA 1KXTA 4KFOA 3G0UA 5DBUA 4U31A 4MGGA 2XSBA 4AG0A 1I2PA 1UR3M 1TG7A 1U30A 1YTDA 1OFOA 1IWAA 2ZWZA 4JIPA 1RJQA 3QXBA 2FPVA 1W5QA 1VGAA 2TSYA 4FLRA 3KVMA 3N6JA 1QPNA 4JNMA 4IMGA 1ZTVA 3GYCA 1MXDA 3STEA 1WXYA 3UG8A 5JIWA 3B9AA 3IJDA 3QEZA 1KRAC 4LBSA 3JZEA 4OZOA 4H7CA 1XL9A 1XGEA 1XUUA 1K9DA 3IJIA 3LV5A 3O0KA 4Z42C 1ML1A 3P14A 3WX7A 3TSMA 3P5ZA 1VFSA 5CGMA 1Q8JA 4CQ8A 2IPGA 1JDCA 1E1FA 1XICA 3SRFA 2YCLA 3WF1A 1CW2A 4IFKA 4KEVA 4LAUA 3AICA 3RMEA 2FPTA 1R0MA 3NUKA 2INFA 1H7RA 2NT1A 3OHMB 3LENA 1HJSA 1BXCA 4HN8A 2ACUA 1XWYA 1UR1A 2ODOA 1VAHA 3LY0A 3NZQA 4ALDA 1LWHA 2ZYFA 3LPGA 3W82A 1WBJA 3EPOA 4MNMA 2YLLA 3DEQA 3RU6A 1XPYA 3FV9A 2VR2A 1SO5A 4M6UA 1BGAA 1Q6RA 4LB3A 3CB8A 4A8LA 2VZVA 4PN2A 5K9DA 3IIZA 1MNZA 2C79A 3QOKA 1V0NA 4RNJA 3NFUA 1KFBA 3MU7A 4U4MA 2PPGA 1T8XA 4HVXA 1I2NA 3C6CA 3WYZA 3QFEA 3DDMA 3CTTA 5MKGA 1LL7A 4W84A 5AHEA 1OWQA 3U7BA 3NQCA 1R87A 3GXPA 1IF2A 1JPMA 3ARRA 3GHTA 4NUWA 1K8XA 1MEHA 4ZQNA 1K9TA 4CCCA 3VNDA 4QP0A 4P7RA 1WCGA 1UBSA 3N2TA 1PHQA 4X63A 3WENA 2OMAA 3S2CA 3AXMA 4M29A 3TV8A 4ADTA 3KAOA 3PZMA 3MV01 1V3MA 3M5YA 5EMLA 5BROA 4TTUA 4EWND 3LXBA 4OOUA 3KM8A 2FYMA 4JY8A 2DSWA 1NQKA 4LRSA 4AXNA 2INZA 1TELA 2V5JA 3FX4A 2TMDA 4OTKA 1F4HA 3RIKA 1EBHA 3GDKA 3ZR5A 4NZ4A 1J9YA 2E6FA 4Y2WA 1ZBWA 3L0NA 1PZ0A 1VPXA 4WKHA 3G24A 4UTIA 3DERA 2QULA 3OVGA 1OX4B 5IFPA 4ROQA 2G0WA 2R24A 4HZ7A 3WIJA 4AIOA 2GYIA 1Q6FA 3LX9A 1OBAA 4ZO9A 2EPOA 1XC6A 4GH3A 4A4AA 1J5TA 3G0SA 2ZCGA 3P60A 1JDFA 1FDYA 2G95A 3TYEA 1UZDA 3JR2A 3VOFA 1X38A 3WD4A 2WVUA 2W61A 4YCPA 1HZYA 1XCXA 1IWPA 4HYWA 4NXSA 4PUKA 3VZYA 5JH2A 4TV6A 5A8QA 3QR3A 1WZMA 4BA0A 1JCJA 3AS1A 3OTRA 1V6UA 4FNPA 4QLKA 3PFRA 4NZ1A 2YBVA 2I56A 2QYGA 3GAYA 5A95A 5HPCA 3BG9A 3HZ3A 4PUEA 2YB1A 3CL7A 2F7FA 4D8ZA 3GU1A 4H3DA 3M5ZA 5T8GA 3WBXA 2OB3A 1PCKA 4Q4OA 1Z6KA 2V8ZA 2R14A 3S1XA 1QU4A 2E1WA 4XIMA 4G7EB 1K6AA 4PTXA 5GNXA 2Z26A 2ZC1A 3A4WA 4DIAA 2ABAA 2JGYA 3EPMA 3MSRA 1PBGA 1RH9A 2DVUA 1Q6QA 1SZEA 4C6DA 4F40A 1ZB5A 3UG4A 3PBYA 1ZS2A 3A47A 1MUCA 4ZODA 3V0SA 2DVXA 1DQWA 2OX1A 4FNTA 4LVGA 5EKYA 3KHJA 2ZUWA 4MWAA 1UR2A 3WQEA 3GO2A 2AAAA 4LU0A 5FL0A 3SFWA 5DCDA 3TX9A 4WKFA 3M07A 2ZE0A 4NI8A 1ZP3A 3L4TA 3PJTA 4XTIA 4O1AA 3S8HA 3G1XA 3C2EA 1H7PA 2QJNA 4C91A 3O8AA 4NHVA 1EEPA 5LIKX 3DXIA 1DV7A 5GPRA 3S0CA 1TPWA 3KCOA 2PRHA 2PE4A 4DLMA 1JXJA 2TAAA 1OK6A 2PAJA 3UPBA 4MNKA 1XLHA 2VEPA 3H2MA 3DHFA 2OX4A 4DAFA 1RR2A 2R94A 1L6WA 1WXZA 4O12A 3PZTA 4HOZA 2D0HA 1KFJA 1SO3A 3AS2A 4E4FA 3EOLA 1XLEA 3PB0A 1V3HA 4GX8A 2D2OA 2XGIA 2PFHA 4KEUA 4HSNA 2OZ8A 4KRZA 3PZOA 1AVAA 3CB3A 3N29A 5CSUA 3DGBA 3AAMA 1XIMA 2D2JA 4REQA 1BWVA 3AFBA 1C8VA 3TW9A 3UWZA 2NXHA 2P1FA 3W2UA 1GJWA 2JQXA 2PGWA 5K3VA 1FDZA 3EDEA 3CHVA 4H8VA 2C18A 3H24A 4AZHA 4YL2A 2YZ5A 1JUKA 1HKVA 3VVGA 3DHPA 3L66A 2X42A 3U9IA 5I00A 2Z24A 3V5FA 3T8LA 1PYFA 2CXGA 3A3HA 4UOQA 2X1RA 5BW6A 1W3LA 4RLIA 4CNSA 5BXPA 1J4EA 4GIRA 2A7PA 2OXNA 4J3WA 2A3EA 1FWFC 3M44A 3MA8A 1A3HA 3EWXA 3U5YA 3DFYA 4GC3A 1XIBA 1KLYA 4H9XA 1O5XA 1FX6A 1KQYA 4K7YA 3CT2A 1VLWA 4B2DA 3GUGA 3KTXA 3TQKA 2J6XA 5AYYA 3M1ZA 3ALGA 3PP7A 3EWDA 5DANA 3VNIA 4UCFA 4HU3A 3V5CA 1QHOA 4A22A 3CIXA 4DO6A 3N13A 1E6ZA 1YDYA 4JTUA 2PDQA 1KV5A 2OKOA 1XLIA 3WN6A 1A80A 4C65A 3HG2A 4JAWA 1BYDA 1EYWA 4Q8MA 2ATSA 2VX4A 1ISZA 3SCSA 4ENLA 1PCWA 1H0IA 2FQIA 1GVQA 1WUFA 3UXIA 3SRDA 1GOOA 4HPNA 1XIGA 4RXFA 4O28A 2NVCA 4DBUA 1V6YA 1BXBA 4PCNA 2JKEA 4R88A 3ZR4A 4DJEA 3G8RA 1RY8A 4FX7A 1FCUA 4H6EA 1QTWA 1ZBKA 4L1GA 5F7UA 2PRLA 5KINA 1RBAA 3ZMRA 3APYA 3M0LA 1HT6A 5XIMA 4UTMA 5A6TC 1H5YA 1VCFA 4UIOA 2B81A 3BANA 1ALDA 2GVYA 4IJCA 3WMCA 5I03A 3DI1A 1O68A 1MYRA 2AL2B 3THDA 4W5UA 1J0IA 4XAZA 3W7OA 3WD2A 4HSOA 2VFDA 4XUYA 1H63A 4LTSA 3NPVA 1RSCA 5DT7A 1BF2A 4E8GA 2DJXA 3R8GA 4I7UA 4M8UA 1JI2A 1TRDA 3LLFA 2PB1A 4GQQA 3WQGA 1YPIA 3LGGA 3STFA 4QAIA 1J0ZA 2JEPA 3UETA 1YXCA 4Q4PA 3AISA 1E9IA 1AMKA 1H7XA 3RO6A 4DI9A 2PLCA 1VBGA 1Y0EA 3WBYA 4US6A 1PX3A 2FDSA 4HZMA 1V51A 1BD0A 3S6TA 3CV1A 5C70A 1TPFA 2ZRVA 3QV8A 1D9EA 4F3HA 3KBSA 3R13A 4UFKA 4NZJA 4X0NA 3MMTA 4BQ4A 3GU2A 2VMFA 3QGVA 4HZ8A 5FOOA 3F7JA 3U5UA 4B3LA 1CYGA 1MW1A 2V3GA 5LKYA 2PD9A 3WF2A 1V6VA 4JN7A 4WDXA 1GOQA 3EA1A 4MYAA 2Q8LA 1E56A 2E5BA 3BJSA 3W1LA 3U2OA 3I3BA 3HB9A 1XLBA 4BK9A 3TIMA 4X61A 1H09A 4JX4A 2VC9A 3KVJA 1XIJA 1BSLA 1KQZA 4MZ8A 4QROA 1EA9C 1E9ZB 3VD9A 2CCRA 1OG6A 1HJVA 3W4RA 2ZA1A 4AY8A 2R1PA 1H7NA 3E0LA 4Q4SA 3FOKA 1QJWA 3OZYA 2QMKA 3GQYA 2ONEA 1MVYA 1UWTA 4F0SA 3WNOA 1WOAA 3LCWA 3F4DA 1QNRA 5FJRA 1UQYA 4NZ5A 5I2UA 1UR4A 1EUAA 3RG6A 1JIBA 3C8NA 3I7QA 3NQ6A 2CHNA 2CWNA 3KTSA 4UOJA 3SJ3A 5SWUA 1H62A 4AEFA 4TVCA 2AGKA 1GG1A 1T5AA 2E5DA 1A0CA 4GYFA 4IMEA 4H04A 1E6RA 1BFNA 1S2TA 2WMJA 3WD0A 4MDOA 3MWCA 3B03A 3W2MA 3W7CA 1B3XA 1AJ2A 3AYVA 4O16A 1ISVA 3OLGA 3HPFA 3H2AA 2OG9A 2AL2A 3NSMA 3KXQA 4ZEPA 1TQJA 2BVTA 4A8RA 4XZLX 4K36A 5I79A 5CJ5A 3BWWA 3TTEA 3F2DA 2CBIA 2Y7DA 3T2OA 1LLZA 3PM6A 1W6TA 1PZ3A 3P8IA 3THQA 2YL6A 5K4ZA 2OOGA 3TJIA 5AC8A 4F0MA 1YQ2A 2AQVA 3LTPA 2G3NA 3LK6A 5LGZA 1W8SA 1PEZA 2PC4A 2I5IA 3FAXA 5L6UA 4FB7A 4J40A 2BOGX 4F79A 1EOMA 1IIGA 1B4KA 2YXGA 4XZWA 4F8XA 4PMXA 2ZX7A 9XIMA 1FHLA 4PSPA 2G41A 2V67A 4H9UA 1I4NA 4GQBA 4GYJA 2F2HA 3QR1A 1REQB 4DYKA 4AB4A 3E0VA 4LW7A 5DT5A 1Z69A 4A21A 4LFYA 4GVHA 4HMEA 4IXXA 5AECA 4JIIX 2YW3A 1WDWA 2PLJA 1CLXA 5DCEA 2HZGA 1C7SA 3CYVA 4HB7A 2X1UA 3CUJA 3N4EA 3EMZA 2Y1HA 1HUVA 1JPDX 4DRSA 2CLLA 3MSDA 3TN4A 4FX6M 3WSUA 1I45A 3DAQA 2FZBA 3CQJA 3SIZA 3QBUA 3NGJA 3AU2A 3N9RA 2J7FA 4EIVA 4WSKA 2HVOA 4J35A 2AKZA 4AMCA 1ONEA 3O3RA 5LIUX 1QFEA 1LQ0A 3PZIA 3MVTA 1XR2A 4V33A 4J3ZA 2QDGA 5CPTA 3GKFA 3S2NA 3S5YA 7REQA 1EO5A 3SZ8A 1AL7A 3BOFA 2VD8A 2GJNA 2VT0A 2CLIA 2Z1KA 1K4HA 4UMBA 2GJXA 4I6VA 3NURA 3QHNA 3SCNA 1POKA 1JZ2A 4PCTA 4QQ3A 3WDJA 1PXGA 2Z2BA 3ABZA 3U3HA 3ME3A 1P7TA 3VNKA 5KEZA 3T40A 4S3CA 3VGDA 4NP7A 4BKNA 3VNYA 3RDKA 4HPHA 4XD6A 4FR6A 1JYWA 2GGHA 3PZUA 5D02A 2D3LA 2AQWA 2GOUA 5JUVA 2PP0A 3NWRA 4GIYA 2R1KA 2GLKA 3UERA 3G1AA 2Y8UA 2A4AA 1VHCA 2RJHA 4QQUA 4WJEA 2O7SA 3DGRA 2W63A 2YL9A 3WZ0E 4GCAA 4IMFA 3D3FA 1C3FA 1LBMA 4YVPA 3BL3A 1C90A 3PSWA 2XIBA 3UU0A 2E7FA 2C3ZA 1FWRA 2V38A 2XN2A 3EKZA 4Y96A 5BNKA 5C71A 1XYFA 3NR0A 1XLFA 4LEQA 1PPIA 4BQ5A 3C0SA 3FSUA 4GRSA 3NOYA 4NX0A 3NQGA 1QI4A 2Q8XA 2YJQA 3VOIA 3R25A 4W8AA 3APGA 1EOKA 3LCFA 4A05A 4NI3A 1SW0A 3S46A 1US2A 3TCSA 5D2WA 3SUUA 4JKKA 2HISA 3IGUA 3IWPA 1RUSA 2HMCA 1F5ZA 4YVXA 3WDPP 2ALRA 2OZ3A 1JDEA 2D0FA 3E96A 3UYCA 1JCTA 5HXMA 4HJWA 1CWYA 3L0KA 4I9AA 4X3ZA 5HMFA 2ZUMA 4C6LA 1Q4WA 1E1EA 4Q8VA 3ZYZA 1M41A 3R79A 1KFLA 2DW6A 4HPXA 4DO7A 4W88A 4Q32A 4MVAA 4I5XA 3FS2A 1RQEA 4M24A 3E0IA 3HQPA 4ZSUA 1O95A 3N12A 1OFEA 4ASTA 1IV8A 3RF9A 5I07A 4KEZA 2VUYA 3NL2A 1I6NA 4IPLA 4QS5A 3STPA 4JTLA 4G7FA 3SUVA 2OWWA 4WGXA 1UD6A 3V0TA 3AALA 4LBUA 4CD7A 2V63A 3ZQ9A 1OX4A 2XGBA 4LUIA 3RPDA 2P0OA 4DWSC 1I2RA 1TZ9A 2FPYA 4LCSA 3WF0A 3NGFA 2GJXB 1GG0A 1X1NA 1VS1A 3HG3A 1XQLA 1QWKA 3W2JA 4Q4QA 3S6DA 4AQLA 4KGLA 4UTKA 5JBFA 4R53A 1KFWA 2QV4A 4PUNA 1KFEA 1TE6A 5D04C 3KOXA 1JZ3A 1Z8AA 3H4XA 2OODA 4G9PA 3HV9A 3K8LA 4PCFA 5BRBA 1Q6EA 2YDAA 3VDGA 2ZUSA 4RCXA 2AOSA 1XUZA 4IX0A 2B7PA 2Q8ZA 4AZCA 4ZE4A 2NLIA 1EGVA 4Q4RA 1Q4NX 3AIRA 1DWAM 4FA3A 1S5VA 3H22A 3ECQA 2X7VA 2OZ0A 4HA4A 3RM8A 1XV8A 3BLOA 3UW6A 5DY2A 1AL8A 5HMDA 3BAJA 5MHBA 2H6RA 3AXKA 3DCPA 1YNYA 1FVPA 2VOMA 3ENLA 2PGFA 4M1BA 1R38A 3W2KA 4RXGA 4J3TA 1TUFA 3ITOA 4HCDA 2XH7A 4AIEA 5HA7A 3REQA 2QCLA 1M7JA 1TTJA 2BY1A 3AXHA 1X96A 3WUEA 1GT8A 2X1IA 1UZ1A 4HGXA 2DY3A 3APTA 3BLPX 4GI6A 5A69A 2PU1A 4I6KA 2PLMA 4CNNA 3AIQA 3WLNA 1WDDA 3IRSA 9RUBA 1VEPA 3W1UA 1IT0A 4DUWA 4UNIA 1HP4A 1Q66A 1UR9A 1P0DA 1U33A 4UFIA 3FNDA 1TKKA 3BO9A 4O57A 1RVGA 2Y8VA 5A8OA 1QWGA 3BLKA 3UZ5A 3HIJA 1H4PA 3AHYA 3E9AA 3EX3A 3RUBL 2PEVA 1HNYA 1RCOB 1B3ZA 1TV7A 4P8VA 1W1YA 3FGCA 4JNZA 1V3LA 4KIEA 4JTGA 3ABSA 3SBFA 4GX9A 1PL9A 2RDTA 3AC0A 2GK1B 3DH7A 4H7VA 7ODCA 2VNCA 3EPNA 3TE9A 1SSGA 3LM3A 5A2BA 3CV7A 1VQTA 2C7FA 3GVVA 1WDQA 2JIWA 3V75A 2V5LA 4V2XA 4W7WA 3GG8A 4RV3A 1E6SM 3EGJA 3NTYA 4LC6A 4W86A 3WG6A 4QE1A 1YYAA 1C92A 3TUUA 3KL0A 1K7EA 2JGQA 4JS3A 3BMXA 2Y62A 2IKHA 3BGJA 3EXTA 3MVIA 4MM1A 2WANA 4BR1A 4K39A 1PX8A 3FIGA 4K2SA 2GUYA 3QGAC 2GQ8A 4Z1BA 5F1VA 3QF0A 3OODA 4IIGA 7ENLA 1SW3A 4L56A 3GUWA 2XFRA 1V03A 1SJCA 2ZX5A 4WEVX 3TOPA 4Q7BA 4FHAA 1P1XA 3UG3A 4CVWA 3B9OA 1F4AA 2CNCA 3VILA 1N82A 4DJFC 3IAPA 4ZA0A 4MAZA 3VMPA 4ECLA 3LTYA 3LHUA 2P10A 2HRWA 2J25A 2XVPA 1PTGA 1AA1B 2D22A 3OLEA 2GZXA 4UTHA 2PF8A 1WDSA 4KF1A 1C91A 3GC2A 1RJPA 1XS2A 5DX7A 4LJ3A 3W7QA 1LTDA 4XAYA 3DYMA 4Q8OA 1IZJA 3HTWA 3ZLFA 5E9XA 1MW3A 3KDNA 4AW7A 3ARPA 3H23A 2DZXA 4F4RA 3DZ1A 3ZSTA 3HQNA 1I1XA 4FZIA 4QSHA 2OYMA 2ZRXA 3GTXA 1QAPA 4C60A 4DWDA 1DYSA 1QRQA 1L6FA 3MP5A 1TTPA 3W1XA 3FJLA 4IZGA 3AHXA 3KWXA 2J62A 2V5KA 1W9UA 3G18A 1NP2A 1BWLA 1XH0A 2E3ZA 1TA3B 1K6WA 1TVLA 2XZ7A 5DELA 1MMFA 3SM0A 4WRHA 2PDHA 1JZ6A 6TIMA 1JYNA 3H54A 1XDLA 4CD8A 1UPMB 2QCFA 3MB9A 3SAZA 4BEQA 3IS4A 3DFHA 1CDGA 3GDBA 4NF7A 1YBQB 1H1ZA 4IGHA 4S3GA 3AZSA 3FA5A 3H21A 3FGCB 3N25A 3OVQA 3UR2A 4WOQA 2QEZA 2Y0FA 1XLCA 1DJXA 1W9PA 1W1IE 2GK1A 1VR6A 8CGTA 1H49A 5A5WA 4UFLA 1GORA 4YVVA 4HK5A 1E43A 3FYYA 5I77A 1P4CA 5HNNA 1OFRA 1QOXA 4MWAB 1BKSA 2DSUA 4UFJA 2VVSA 3PTQA 3WMBA 4ZOAA 1Q85A 5K9CA 2NUYA 3M4HA 2PWHA 1X98A 3ALFA 3G1RA 1S3TC 4N7QA 4PSRA 3R10A 2YXXA 1FWJC 1EQPA 4ZQRA 2W27A 3DU0A 1MQPA 1TYGA 1AUSL 3LGEA 5F2GA 2C13A 2VDGA 3WBAA 6XIMA 2Z6JA 4HU0A 4RE3A 1O5QA 3C2OA 5JBEA 3VIIA 3JVAA 5AB3A 2XH2A 3UP8A 3PPHA 1A5KC 1DJZA 5H8UA 2BG5A 1OM0A 4UTFA 3UFYA 4WHBA 1E3ZA 3BZGA 3PVFA 4JL1A 3SR7A 1EJSC 4TVDA 4AUBA 3WDIA 5LGXA 3A4AA 1UIOA 1T8QA 1XIIA 3OBEA 1ZFJA 2CHRA 4NXKA 1OX6A 5E6ZA 1XKJA 1G94A 1AQHA 1PWLA 1UIPA 1CXHA 1WXJA 3RAOA 2PTXA 3GG1A 5CH9A 4BI6A 3VUSA 2OELA 1RLDA 1MUMA 3OVRA 4QLJA 1QDSA 3OVPA 4FLQA 2VRQA 4NJIA 3TWBA 1XG4A 1TPVA 4AWSA 1ME9A 4LT9A 1R7AA 3RU8X 3MJMA 2CKSA 3KW3A 1ICPA 1MDRA 2HV5A 1TA3A 3NDZA 1MW2A 3FA4A 1S38A 4IISA 4DJDA 4O50A 1M53A 1XG3A 3B4UA 3FSTA 3ZT5A 4J9JA 4AVOA 4EPEC 1AZ1A 3GDLA 4Y9AA 7TIMA 1THFD 3OBKA 3SUTA 1WQ5A 1ZQ5A 3OOQA 3WD3A 3MBDA 4MKNA 2P3EA 3EB3A 1RP9A 3NO3A 4OJYA 3T42A 1RALA 5BWAA 1P0BA 3PBVA 2VCAA 3DFNA 4A8IA 1H7OA 1G4EA 2ZZ6A 1F05A 4RPPA 1UWAA 1W31A 2WB5A 3KWSA 3N34A 2RDXA 1GZ1A 2Y7EA 3B8DA 4MLJA 4KH2A 3BQ5A 4JKMA 3LCXA 4QSFA 1M68A 4LF2A 5G2HA 1W9DM 4HHPA 3QH2A 1QI0A 1FXQA 2OCZA 4B5WA 3SADA 4GCXA 1IEVA 3KL5A 2WC7A 1SZFA 2E8ZA 2J66A 5AYXA 4GJ1A 4INFA 4PL1A 1W9VA 2QF8A 2GVEA 4HCHA 3BCJA 3E49A 3FCPA 1PKYA 1RAKA 3LS9A 3SCPA 2WJZA 1ME7A 3GDMA 1TWDA 3MW7A 4LAZA 1NFGA 2CLKA 1TVNA 4CD5A 1W9BM 1A5CA 5CSSA 4US5A 1FKWA 4MUPA 3CAKA 3N2BA 3ZT6A 3VPLA 1YDNA 4FIRA 5DCBA 1LZOA 3C5QA 2O9OA 3KCLA 4ADSA 2WSQA 3S1UA 2PDIA 1NJJA 1UH2A 1QNQA 3VMOA 1JRCA 1V6TA 4XX6A 3WELA 1Y7VA 4AH7A 3OZMA 3IGHX 5CBBA 3NDYA 1T96A 4H8HA 3HPZA 4AD2A 1TQXA 1B1YA 2X2YA 5HNRA 2PTZA 1W3TA 2VVNA 3MCNA 4BQ2A 3LERA 4UR7A 4YTSA 1R2SA 2BSLA 4X2PA 3B97A 1XLGA 3SGUA 5I3FA 4H83A 4JQ1A 3LDVA 4KPLA 1ZAJA 3L4UA 3TQPA 2OSXA 4K6AA 5D37A 1J6OA 2ZIDA 3VKCA 2R8WA 1FWBC 2WQDA 3MY9A 3EXSA 3NZ1A 3S5NA 2BB0A 4JFTA 1NOWA 1NFBA 4JCLA 1NDVA 4HQVA 4H8NA 2TYSA 4LWWA 3CPUA 3DESA 1FWAC 5F4SA 3PANA 5I5RA 3NOEA 2GWGA 2EPMX 1XGZA 5BWFA 3SFKA 2VENA 4J2MA 4QE5A 2RUSA 4WY0B 3W24A 4C6EA 3CUIA 1LWIA 4TR9A 3LCHA 5KSWA 1GHRA 3GXDA 1UUOA 1TV8A 1AMYA 5I3HA 5CC6A 3RMJA 5AC5A 3T8QA 1H2JA 2VFFA 3P80A 4ZQPA 1GVRA 3U57A 3A24A 3WFLA 5H8MA 2KAUC 1KFKA 1XYAA 3ARQA 3QR0A 1GOWA 3A13A 4LUSA 5E6YA 2VUNA 3TCEA 1GOKA 1K8CA 3VNMA 3D0CA 5TQLA 1E55A 1Q7QA 1K8YA 3SECA 4AD0A 4EPDC 4C6OA 4KWOA 4NY2A 2ZA3A 5BRPA 1F9CA 1OB0A 4Q4KA 3QV9A 5G2IA 1YW1A 3PZ9A 4S3EA 3T05A 3W9ZA 4CU7A 2YCJA 3P82A 4OT7A 2XPKA 5E93A 3MHUA 4OWGA 1TB3A 2IQ0A 1RLCL 3M6YA 1GYNA 4B15A 2EPHA 2HCVA 2GSJA 2J47A 3MI6A 3RCYA 1UD8A 1LBLA 4EF9A 1T99A 1L2UA 3UZWA 3AHVA 2QCNA 3F4VA 2PWVA 3F2CA 1DXIA 4J27A 4R5EA 4WIWA 4UQDA 4UTUA 1DXFA 4MZ1A 4NX5A 4AWUA 3IV8A 1F73A 5LZLA 4CCEA 1VKFA 2J75A 1PTDA 2Y5SA 4LQ1A 1JRBA 1RV8A 3GW0A 3SURA 5LNUA 1TR9A 4BWLC 1EP1A 3MUZ1 2F38A 3GXFA 2VZTA 3UGRA 4XQ6A 2R1MA 1SMAA 2MANA 3IVTA 3TSBA 4DQWA 4PH6A 4DUOA 3C2VA 3F1QA 3W86A 1P48A 3EX6A 5I3KA 5C2CA 3BLDA 5I09A 2BFGA 4YTUA 4GFIA 3GD6A 1BG4A 4H6RA 2A21A 3COTA 3LRKA 4ZQMA 1J2BA 4UFHA 3KRZA 2EG6A 5C54A 1WAUA 1CGUA 2L5HA 4OU1A 3LPFA 4WSJA 1KCKA 4AZBA 3EA2A 1XLLA 3KLKA 1XHGA 4WY0A 3E5BA 3RHGA 1GEHA 1ZGDA 4DUVA 4KW2A 3M0IA 2O9TA 1HW6A 1W5PA 1SJAA 1GQIA 1JUBA 1ME8A 4MWAE 4OHQA 4DUXA 4CU8A 1N8FA 4KETA 1Z7AA 3AQUA 1CEOA 4N9CA 4MG4A 1F2JA 4M19A 1ZL1A 4GUGA 3N2OA 2Z29A 4LUSB 2A3LA 1UKOA 3TDFA 3CNYA 1JCXA 1ZCOA 2IUZA 1TMQA 3UA3A 5HAOA 1ZP4A 4Q8QA 5M2FX 3CS2A 1GWJA 1G7UA 1EDTA 3E12A 2OWCA 1SYTA 5C9XA 5LXEA 2BOFX 5C2GA 3WQ5A 3EWBX 1OC7A 4Q8WA 3A3WA 4GY7A 2IKJA 4PC8A 4K8HA 3UPMA 2XWEA 5HUOA 5TIMA 2J9YA 2AGTA 2QQ6A 3EA3A 1BVZA 3EEGA 1BRLB 3UWUA 1QNSA 2XSXA 4JFVA 3QHMA 4M3PA 1F3TA 3WNPA 2GL5A 1H1YA 3W22A 4GZIA 1W2PA 4CQBA 1KO0A 2BLEA 3GG7A 4LVBA 1GKPA 2C0AA 1FP8A 3UD6A 1G4PA 2XIIA 3MCMA 3IGXA 3FKKA 5DF0A 2XIOA 4IJBA 1TZZA 5DEZA 4BJHA 2VCBA 3PTKA 1JYXA 3MJYA 1V79A 1BSIA 1WKDA 1BPLB 2WAGA 3PUEA 1FFRA 3CM4A 3W7IA 2D0GA 3R0UA 5JBDA 4JTKA 1EHNA 2VGBA 3QVQA 4GBUA 1TV2A 1IIHA 3WH8A 2XH0A 1U1JA 3SCRA 1POJA 5K7JA 3K8MA 1DTUA 3UY7A 1U1HA 2DIKA 1IQ8A 4QEEA 4PUJA 1OFDA 1FHUA 3KX6A 3BLEA 5JMUA 1TRIA 1OX5A 1FY6A 4V28A 3VZZA 3HFTA 2WSRA 1NU5A 5KZ6A 4DJDD 3G0XA 2GSEA 2X40A 3CZKA 1CLKA 4F2UA 4L5ZA 5GJNA 1R3VA 2RKXA 1GCYA 1N8WA 1KLZA 2XWDA 2HNHA 2PDYA 3OIHA 1U1UA 1YTKA 4IGNA 4NQ1A 3I6EA 4Q3MA 4A2RA 4O15A 4UBPC 2XN0A 4P5UA 3WLPA 4ATWA 1MO0A 1QI2A 1F7BA 5BCAA 1I75A 3PHAA 5HQEA 1GYLA 3VIOA 2A3CA 1CCWB 3HGOA 3BV7A 4LV4A 2QJJA 1ZZMA 2BHUA 3KBWA 4H9YA 1XJBA 3B04A 3PF3A 5T9CE 3DFQA 1EIBA 3LU2A 5HBFA 4JN6A 4JFWA 1P0NA 1DJQA 5GVJA 3V5OA 2WPGA 5LA1A 3O06A 3POCA 2J74A 1SZNA 3EWZA 1BEUA 4JYDA 1HJWA 1M7XA 3GNOA 2F6KA 1V4YA 4IQLA 4HNCA 3SY5A 1EZWA 1Q3NA 3A9IA 3LLXA 3T4CA 1B4EA 4LVFA 3K13A 4QTGA 3DC0A 2C8NA 3IRDA 3VNLA 1SZRA 1MEIA 1DQUA 3HBLA 2OLHA 3URQA 2IQDA 3UQNA 4XD5A 1W37A 2YIHA 3QW3A 3N17A 1IGSA 1M01A 3FKRA 4MADA 3TTOA 4DB7A 1X7IA 4MB3A 2P5NA 3ZM8A 5DY3A 1KBKA 1M7OA 1KRCC 3B3DA 4ATLA 1W1TA 2QDHA 1Q2RA 2PWFA 3M7WA 3QZEA 1SJDA 3USZA 4D71A 2A3AA 3MPGA 3LQGA 5C9UA 1C8XA 4JHOA 4CEUC 1GJPA 3SB0A 4L6OA 4V1YA 1L6SA 2NVDA 1KTNA 1QPQA 1LOQA 2J7CA 5EGRA 1OCJA 1W56A 2UY3A 4FOJA 1R3SA 3BQ6A 3PAOA 3W72A 2ZZ4A 3GC5A 4CU6A 1CB2A 1RJRA 3U2ZA 4B9ZA 4TOQA 3VZXA 3U2EA 1E0XA 1W9XA 2YDRA 1WDRA 5G4HC 2CW6A 1FWDC 1BYAA 2ADAA 2YGYA 3PS7A 1ENUA 3AS0A 2ZADA 5AHIA 2G97A 4MSSA 3CL8A 3QSRA 4KERA 4U3AA 1LORA 3WFZA 2HSAA 4LC8A 2BVYA 3W74A 2JF6A 2DW7A 1WX0A 3LPOA 3EYPA 4QNEA 2VL4A 2WBKA 3GR4A 3W28A 3NXLA 1IEXA 4LUTA 3TN6A 4OFCA 1OGGA 1G5AA 5E70A 4FXFA 2BY2A 5EY5A 2O9RA 3KOWA 3UXDA 5A2AA 4O14A 1E6XM 2YYTA 2RGLA 4D1IA 4RDWA 4OQVA 4W8BA 4AZ6A 1B2YA 1ZSXA 3RN6A 4HMDA 3BSGA 1UWSA 4BS0A 4NRSA 1QR7A 3LD5A 1V8EA 2Y70A 2Z2AA 2D24A 1DQXA 2BOEX 1K9EA 1SR9A 2ZOXA 4KMQA 1SU5A 3CQHA 1KCZA 2G3MA 4D8LA 2POZA 1UWRA 2EXOA 2GUBA 4DM2A 3K1DA 4AD5A 3W1NA 3KLLA 2D2HA 5AVNA 2FTYA 3WNMA 1EO7A 2WSPA 2WXDM 3GZAA 3RJYA 1IEWA 3CK5A 2UV8G 5CPLA 2FFCA 3BOXA 3XISA 1EDQA 1LYXA 3I7SA 3OO2A 4CUCA 4BY3A 2PDNA 4GYPA 4MZYA 1ZBVA 2V5CA 2FTWA 4ZTXA 4TUFA 2O92A 3Q67A 2FZ9A 4DPQA 3QQWA 3W7NA 1BTMA 1U5HA 3K46A 3RX2A 3ES7A 3LMYA 1ZNNA 1I0DA 2YPIA 4EE9A 1LRNA 4ERAA 2XM1A 1N55A 3PB2A 3U0HA 5BOOA 4PR4A 4S3BA 1D3CA 5KTLA 1S5NA 2ZRZA 4DZHA 1OABA 1V5XA 1XSJA 4HNNA 2VURA 1OK4A 4WD0A 2FZDA 4C6BA 4E4UA 3GH4A 5CG0A 1W5OA 1CXFA 2ZZ3A 3IIXA 4NT0A 2VELA 3I4EA 5REQB 3P67A 2PC8A 5EBAA 1MZRA 4AVNA 6XIAA 3ZS4A 3GIPA 3GVWA 1W91A 1WZKA 1GUVA 2G3IA 1FWIC 4XZBA 2RHGA 1YPFA 3GIQA 1GOMA 3RM9A 3IJ9A 1IR1A 2HE5A 4W89A 3TYUA 2DUXA 2WLZA 3QW4B 4CCDA 4G1NA 3CMJA 1R47A 5HUPA 3B0PA 1EJTC 4R33A 2QVNA 3DBNA 3EOUA 1UZ4A 1IT7A 2NSXA 3UZXA 3W2NA 2H9AA 2V6AA 1GW1A 3SEPA 1KR0A 4WGHA 4IPNB 1KRBC 4DBWA 1ICQA 1OC6A 3JS3A 3RFAA 1TPC1 2V5DA 4B90A 1FDJA 4AZGA 4A3UA 1TMHA 1ECQA 4I90A 2PDGA 5A6LA 1YXYA 4ZBCA 3QV6A 1YEYA 3IIPA 3DHDA 2IXVA 3PZVA 3UVIA 4PFMA 4WXYA 3WKZA 2YCEA 4PBFA 4GISA 3W3OA 1JCYA 1CNVA 4P61A 4WDUA 3BLLA 3IGSA 5D38A 4QXIA 4P8XA 3RYSA 2CZFA 1F3EA 2WMIA 2XUCA 3PNUA 4Z0JA 1IXPA 3QC0A 1A5BA 1XM3A 3EXRA 3ARYA 3KZPA 4WY0F 1JXKA 1S2CA 4IFRA 4L6DA 4GVGA 5D05A 3VC5A 5D8ZA 3DOPA 3WDQA 1XIEA 2NQHA 3PZQA 4KIRA 2TPSA 1JGMA 5D9PA 2J8FA 1EH9A 3IVUA 4WK9A 3HURA 3R94A 1L2QA 4YIWA 3ZOAA 2E8YA 2ZA2A 2WCAA 1LUCA 3KUMA 4QBXA 2PUZA 4W87A 1GQNA 4REQB 3XINA 1XRSA 1NWUA 1K70A 3JUGA 1EA0A 1DWFM 3T0BA 4AWEA 4E8CA 1KFCA 3UJ2A 4FS9A 2PD5A 1HJXA 1AQMA 2RH9A 4H41A 4EF8A 4CCZA 1WKYA 4LS2A 2ZXDA 3SN0A 2JALA 2ESCA 2WZHA 4QX4A 1VJSA 2R91A 3TJXA 1SR0A 3M64A 4KESA 5REQA 4EAYA 1KBLA 3MKCA 4ZOEA 5EU9A 3VDAA 2CESA 1NOFA 3JU2A 2VFIA 1UCWA 3L5LA 4RZ5A 5AHLA 1ADDA 4LNYA 4UTTA 2FVKA 4U3CA 4QITA 4UTTC 3V7PA 1PKNA 2XDFA 4NU7A 1H51A 2ZZ7A 4WVXA 4QIUA 4CN4A 4IMCA 3C8FA 2UBPC 1R3TA 4O19A 1O94A 3DENA 3WQWA 3G2GA 3LHVA 4AWTA 3HQOA 2H9AB 1V3IA 3VNJA 1DIEA 4A8NA 5LNRA 4HOWA 4AC1X 4ACYA 2HVMA 3W83A 4E2DA 2VDHA 2UWFA 3CQKA 4G2DA 1XRTA 4U5KA 2ZC8A 4IP7A 2NV9A 2EF9A 2VRJA 1JDDA 1EGZA 1VENA 5DLCA 3W29A 4TX9A 3ANVA 2HQAA 1FWGC 3C86A 4U2ZA 4YYCA 3RILA 4FPSA 5U4NA 3M6DA 4DXKA 2WVVA 3QPEA 3M7SA 1FCVA 4IQEA 3S5ZA 3CLMA 4JL2A 2WMIB 3ATYA 1ISWA 3H4GA 1UKSA 4QJ1A 3RO8A 1H41A 4HMCA 3PJXA 3L4XA 4XD3A 2VR5A 2VGGA 4JQ3A 5AKQA 1AH0A 4PB4A 2Y7GA 4HMNA 4I3GA 3GBEA 4F9JA 3GNXA 2DT3A 4B92A 4FEZA 4IPPA 3PZNA 1NDZA 2W4XA 4C5ZA 1OGBA 3AYSA 5TAOA 6CGTA 4AYSA 4UMAA 1SJBA 4UTJA 3QC3A 4B5XA 2G3FA 3WD1A 3ZJKA 2CC0A 5K4XA 1DP0A 4IT1A 5FJTA 3K4WA 5EPDA 1U5JA 3L7RA 4PTNA 1VCGA 1BAGA 3V1PA 1EF3A 3C2FA 1CGWA 1FA2A 4ZFMA 1OCNA 2F61A 4Q7IA 5A2CA 3ZXWA 3N11A 3KS5A 4PL2A 3HQ1A 2B7NA 1AFSA 4KWUA 3GX9A 3CV2A 2B7OA 4ATDA 1YHTA 3DFPA 4I7VA 5C9ZA 1EJVC 4K68A 3VX1A 4DI8A 3WUBA 1G6CA 4AVFA 1A5MC 1C9DA 1OC5A 5JIPA 3H6OA 1HVXA 1JCLA 4AX7A 4MNJA 1J11A 1ZCCA 4JD4A 3FYPA 1VJZA 3KFTA 4RR4A 4UZSA 1GVSA 2PDUA 1UD4A 3NL5A 4MPKA 2DT1A 3LI1A 4HBKA 4D2JA 3KTCA 3MO4A 3CZGA 1UP2A 5BRQA 1E0TA 4ZB5A 3EKGA 2UY2A 4AU0A 4D6CA 4DWSB 3TFCA 1Z32X 3W7MA 3UEQA 4Z1AA 4DLFA 1E4NA 1BQCA 4OVXA 5LNWA 4CKQA 1MEWA 3GW3A 4YS1A 4DYJA 2F9RA 4RZBA 4N6EA 1UW9A 4ZO8A 2ACSA 5I06A 4FMVA 3WQVA 6A3HA 1CGYA 1UD2A 4N02A 2J7BA 3ZO9A 3VIPA 2VKZG 1R46A 5ABTA 2C6QA 1W3IA 3N4AA 2EG7A 2VYOA 1XRFA 3A5FA 4ZE5A 1EP3A 2H3BA 4QFUA 1JCMP 2AMXA 2FZMA 2BHZA 3TW7A 2HTMA 3O6CA 4K3ZA 2PWDA 1EGMA 3URBA 2EJAA 6TAAA 3U8GA 1M5WA 3N3MA 1UKQA 1R9YA 3A4JA 1EUNA 1NELA 4Q8NA 1W32A 1A0EA 4Q4MA 1XLJA 3TTSA 4EOUA 4AZIA 3AJXA 2HEJA 2H3DA 3FXYA 1UP3A 3W7DA 1F3WA 1BGGA 2I5GA 4ICNA 4LYRA 5HULA 4LAKA 3W7PA 2CU0A 4H7ZA 1XXXA 1QK2A 3AJ7A 4C7DA 5C8BB 4UOZA 1WO2A 4XKYA 3T78A 3B8VA 4GG9A 4C6NA 1JPHA 2OPJA 2WNZA 1VEOA 3RNDA 3UCDA 4RE4A 3GAKA 5FSEC 1EJWC 3LXCA 3AIWA 3TYAA 2NT0A 1T41A 1NTHA 3VO0A 4C1KA 5FA5A 3LRLA 3H7VA 3QKEA 2OU4A 4JTFA 3KDOA 4H9ZA 4KCWA 2HDJA 3W27A 3H55A 1BLIA 3R11A 5D8WA 3GTNA 5D32A 1ZALA 3XIMA 1GW9A 2I57A 3ZVIA 1E0VA 3VGHA 5HMSA 1R9ZA 2QPXA 3CQIA 3O15A 3GNDA 2DUZA 3TYDA 3VD3A 3F2BA 4JFSA 1G7VA 2JKAA 4ZL1A 3W7EA 4Q8TA 7REQB 4Q8PA 3BLFA 3O1NA 4GE8A 3E5PA 1GVIA 2OT0A 2J8GA 1UC5A 2CZDA 3F5LA 4R7OA 5IDIA 1AD4A 1NF0A 3HPXA 2PDJA 4DZ5A 2O4QA 2QAFA 4JEQA 3SCQA 4YJ5A 3PTMA 2YFOA 5D9NA 4BWLA 1HL2A 1BRLA 5EFFA 4CD4A 3TYZA 3WJZA 3AHTA 5JH1A 3MC5A 5LIXX 4Y8FA 4FR1A 1RD6A 4AIBA 1GKRA 5CEWA 4EVZA 1VYSX 1KWKA 5CLTA 1A53A 4MJZA 5FEXA 1P5BA 2NV2A 4DX3A 4S3FA 3SIMA 3DIPA 3RLGA 3M9YA 1ZUAX 5DRIA 3EWWA 1NAL1 3MT1A 1HTIA 1M6JA 3OG2A 3VMNA 1KBBA 3B8UA 4U33A 1OZQA 2V0TA 5CZTA 3N9KA 4J2PA 3TMLA 4GD0A 3ZVHB 2X1TA 1KR1A 5DXXA 4PTDA 4N0RA 2CERA 4AF0B 2WZEA 3ISIX 3URNA 4D6GA 4G56A 4AHQA 4JQ4A 3VGFA 3LEPA 1SZGA 3ZLHA 4GUHA 5D2TA 3W84A 2VM8A 2V69A 1NF7A 2C1IA 4NJKA 1DE5A 1NARA 3F5KA 2Z6IA 4GH1A 3QFWA 4EXQA 1HKKA 4MJ2A 3CZLA 3W88A 3QZAA 3IIVA 1XLKA 4WQ6A 4Q6JA 3MDUA 1MXSA 4ACZB 2ISVA 4XZIA 4W85A 3WF3A 1DJNA 1UKPA 4XIAA 2VC5A 1UKTA 5HNTA 1VP5A 4L9ZA 4HNUA 2XISA 2WVTA 4JHMA 4ML9A 2C19A 2QJGA 3V16A 1PTAA 2AAMA 3QGKC 4KS0A 4HN4A 4Y7EA 3W73A 3GKAA 3FXGA 3WK3A 2PGRA 2VX5A 3PWAA 3C61A 2PTYA 3CAWA 4BI7A 2XFWA 3R0KA 4IMAA 2Z00A 2JBMA 1GK8A 3VCRA 1Q6GA 5I3JA 3VKBA 1W3JA 1S2WA 2GVLA 1UD5A 1GJUA 4GNVA 4HA0A 4H1ZA 4NSBA 3K4DA 3BJTA 1DJIA 3WQDA 3T0AA 3DI0A 3UWWA 4M6QA 4MHBA 3UBPC 1YPXA 2YXOA 1TJ0A 2WCSA 4ILSA 3GS6A 1F8MA 3D46A 1VF8A 4RJEA 2BGNE 3GR8A 2QIIA 3ABRA 3PZGA 1TX0A 4NASA 1RPXA 5FESA 4Q7NA 4XKMA 1GTHA 3LN3A 3SRKA 4GUJA 2X30A 3NAVA 8TIMA 2IPJA 2WCGA 5KZEA 5HQMA 1S2VA 1IZKA 2FB2A 4US5D 3WUGA 3Q2DA 4GINA 5D2XA 3IK4A 2CBJA 5CLWA 3LQLA 3W00A 4UTWA 5F4WA 4IX2A 4AY7A 5AHNA 1CT5A 2X8RA 3MMWA 4IP4A 2C1HA 3C56A 3EOSA 4W7VA 2XSAA 2J79A 2YSWA 4DO5A 1J12A 1AQ0A 4K7VA 3W6YA 4MWAD 3PN8A 3RJXA 1GGOA 1P1MA 2W0UA 1M1BA 1HKWA 2POTA 3NVTA 4YTTA 4E2BA 2PODA 8XIMA 1JCNA 3WQFA 3LCIA 1WKFA 1Q63A 4GXPA 1GNXA 2GGJA 2A5HA 1PKLA 4GQRA 1LT8A 5G4WA 3LB0A 2PLKA 2PDBA 1JQVA 4Z2HA 3BK0A 5FEWA 4JTQA 4LYQA 1RK5A 1W54A 2VXNA 4KKXA 2O7QA 4LUYA 5H91A 2CIPA 4ACZA 3ARTA 5H6HA 1SPQA 1C7TA 3OG3A 2Z25A 4FNUA 3RR4A 2NQZA 4Z0SA 1OYBA 4JQ2A 3HGRA 3KVLA 3OYXA 4MY9A 3INPA 3AIUA 4Y90A 4A3QA 3BAWA 3N04A 4LUTB 4H01A 1YNQA 3TK7A 3ITVA 1XIFA 3HO8A 2E77A 2AMGA 1QXLA 5CSRA 3K8KA 3WUFA 2EPNA 1SFSA 3PR2A 3FJ6A 3BXWA 1ZJBA 4MUZA 4RNIA 4TU1A 4F9DA 1NWRA 1OT2A 2GGEA 1QHZA 4YTRA 1XBXA 3GNRA 2QV5A 4Z1DA 4L6HA 4HYRA 3CPRA 1O6IA 4GZJA 1RBOB 1L6YA 1Z9AA 1IE7C 1DJWA 3E3HA 2ZDRA 3W87A 3MHGA 1E3XA 1E1CB 1JG9A 3II1A 3HJZA 3LUTA 3SCTA 4IIFA 5LA2A 1OFQA 4O0ZA 5LYRA 2J88A 3MDWA 4OKDA 4OUIA 5U7SA 4CGTA 3RLHA 4Z2GA 3E0FA 3AROA 4HU8A 1XFBA 1QVBA 3ITTA 3SY8A 2Y89A 1OJXA 2E9BA 4C6PA 3OJGA 5HNUA 4Z2LA 4ZB0A 3IARA 6ENLA 1S46A 4Y9MA 4HCLA 3VI2A 3O16A 2H90A 1AW5A 4WLCA 1QNOA 4P7QA 3IEBA 3WEZA 1TWSA 4HNLA 3UNDA 2PDWA 2Z1SA 4N9BA 3L0GA 3O0FA 4I5UA 5E5CA 5FD0A 2YA2A 3O2LA 3T09A 2FZNA 3EWUA 4JCMA 1PIFA 4HU4A 2HBVA 3NYDA 2Y6ZA 3TA9A 3AZTA 2NXGA 3LHYA 2H8XA 3L68A 3VDBA 1TPUA 1HP5A 3S9ZA 1GKQA 2YX0A 1IXNA 3M43A 3T4WA 4RZ4A 5A6JA 4E0CA 5LXXA 4JTSA 4UQEA 3QRHA 5ABFB 5DMYA 3LNMA 5IFTA 3CAVA 4LOCA 2EQDA 4HK6A 1Y8BA 3GU9A 2OR2A 3M0VA 2A79A 5E0KA 3LCGA 1KCLA 1JZ4A 3B0UX 3B0YA 2EKCA 2A6LA 2NX1A 3A64A 3AMKA 4WR3A 5F2IA 1JD9A 4Z2IA 3SY1A 3P0WA 2Z7GA 2QCGA 1FKXA 1XYMA 2CWXA 1YBQA 4PB3A 4P7OA 5T9BG 1PV8A 3CUHA 1ELSA 2QUUA 2QPSA 2CPUA 5I23A 4G8TA 5AFDA 3GNPA 4C6KA 2I17A 3W71A 2WVVB 3AYTA 5HPOA 1JNEA 3B40A 1EPVA 3POHA 1JF6A 1F6YA 5D2YA 3TWAA 3NL3A 3U4AA 1XDJA 4OBSA 1XSKA 5IHRA 4TMBA 3W1MA 1EWEA 3G1DA 3MO7A 1A50A 2ZICA 4JTCA 3CH9A 4JPGA 5CXPA 2V3FA 1J0JA 4ZQOA 1E70M 3E2SA 1B57A 1DJYA 3OIXA 3H2OA 4YWSA 4A2SA 1H3GA 1X7FA 2KX9A 2A3HA 3LPPA 1UPPA 2IKGA 1YLVA 2V2CA 3GBDA 4QGCA 2TODA 4AD4A 3V36A 1FOBA 4KBXA 3S83A 3MI3A 2BS9A 1K77A 4HJFA 3LXAA 2CLEA 3VX0A 1SUXA 4ZXLA 1GZGA 4I9JA 4RE2A 5CGQA 2DDXA 3R7MA 3P5YA 4JTRA 3NSXA 2QCEA 2OYKA 1XLMA 4BF5A 2WC3A 3T0TA 3FY1A 1GYMA 5LIWX 5CPMA 1XH2A 5H1WA 4IG2B 1MQQA 3V4BA 2HE8A 2R1LA 1HJQA 5F4XA 4DZIA 5EMJA 3W23A 5CGTA 1BYCA 3C0QA 5GQBA 3DBPA 3CV6A 1EYEA 3H2CA 1JI1A 4OGZA 2RAGA 3EWYA 4PRWA 3TXVA 1PKMA 3HN3A 3LSBA 2FMNA 5CPNA 4MLRA 1TCMA 4J5NA 4UNKA 2CHOA 1K3UA 3GFXA 4U5IA 1A49A 3KOFA 3SSJA 5I02A 5FEPA 5A1AA 1F74A 3BV4A 4LBRA 2DSKA 3PBMA 2VX6A 2VQUA 5AC4A 1R9XA 2DZSA 4EPKA 2YYUA 1X6NA 4J3XA 1MFVA 1IGWA 4FAMA 5C55A 5FJUA 5GJPA 1J6PA 3AHZA 1UD3A 3E6EA 4PMOA 2OLAA 1G9HA 4B3ZA 1J01A 3DG3A 4YU1A 4DWSA 3NVDA 1NDWA 2UZ9A 4XZ9A 2BGQA 3DN5A 2EHHA 3F4WA 3KRSA 4O0QA 3TC7A 3QHOA 1ODUA 2G3JA 2ZKMX 5DRCA 1I2QA 4AHOA 1P0EA 4XZMX 3CHFA 1DPMA 4C90A 2XIJA 2GVJA 4AZ7A 4NJJA 4NZFA 1O5RA 3U48A 3VK5A 2BXYA 2VRKA 3C2YA 2A7RA 3VD4A 3CHDA 1AW1A 4XO7A 3HV8A 4GACA 3S2MA 4RUBA 2ON3A 3MP3A 3OZOA 3T9PA 1R7OA 3UWEA 1K8ZA 1EJXC 2PWGA 4Z17A 1QUMA 5GJMA 5TNVA 1EC7A 3BOLA 3N4FA 1NVMA 3UT0A 2QGHA 4PTVA 3TJLA 3GHRA 1RD5A 4JIEA 4WCJA 2WNNA 2Z4GA 5T26A 3UWQA 4RW5A 1W3NA 5B7ZA 4XTDA 1YIXA 1NH6A 4L9YA 3ARUA 4AIUA 2AQOA 1XLDA 3IIOA 4BF7A 2NQ9A 3MSGA 3PG9A 3E74A 4UFMA 4P7NA 2W6RA 2DZBA 1FWTA 3PG8A 3IAQA 4ROPA 4ZGYA 3HJEA 2E09A 3O6AA 3NEVA 1JD7A 4S3DA 1S39A 3VIMA 4D6JA 5JU6A 1NWTA 1R86A 2E1DA 1GQLA 5LHFA 2BTMA 3YPIA 4TX8A 3MYPA 3AXIA 4PMRA 4ML4A 1Q7ZA 4O4WA 4GA8A 1I60A 1ZPTA 2VEFA 2DSZA 1FWSA 4ZCWA 4NYYA 5FEZA 1WE5A 4X0VA 3WQPA 1TV4A 3P93A 1E73M 1OGSA 2VGIA 3VE7A 1UP0A 2Q3RA 2RDWA 4XG1A 4M1RA 3IJ6A 1WAWA 1M65A 4XKYB 4MF4A 1BTCA 3RK8A 4GXWA 1S2UA 2R9RA 4GGHA 4LVAA 3WQOA 2VDIA 4WZHA 1JL8A 1UASA 1VC4A 3WH6A 2Y5JA 1NOUA 4S3AA 3NPUA 3O9NA 5C0QA 3UZZA 1A4LA 4HKPA 1T0OA 4B3KA 1R8LA 4I8DA 4CNTA 2V2DA 1AJZA 4JEJA 1ECEA 3HM7A 1X1ZA 4UQAA 3U4FA 3WJXA 4GKTA 3CHCA 5ABEA 1TVPA 4YHGA 1WA3A 4IIEA 9CGTA 1UH4A 2HPMA 1VEMA 4CQDA 3PC0A 1TFVA 5F1UA 4M0XA 1SQ7A 2PTDA 1N8IA 1W3KA 4LS1A 1V08A 1P6CA 3M5XA 3HFYA 4C6QA 1HO4A 1AJ0A 4I9TA 7A3HA 4FLOA 1LRQA 3BAXA 4HIBA 4JN8A 1KM6A 2ZFAA 4IPIA 5HR6A 1KA9F 3WK0A 4FF7A 3Q45A 3BARA 3TP4A 2JFEX 2V82A 4PCSA 5FF0A 1M04A 3BTNA 1GVYA 3L5AA 3C3UA 1ICSA 1KM3A 1SW7A 2W79A 3B9NA 4A29A 3TXZA 3T44A 1UMLA 4PBGA 2QS8A 3OZPA 4CN1A 3AIBA 4HPGA 2F6UA 5CPSA 4WSHA 4ONVA 1MW0A 3T2PA 4Y9NA 4A35A 1EP2A 1E40A 3UG5A 4F0KA 3QY6A 3DUGA 5JXQA 1CI1A 4JNYA 3DFTA 4R7WA 8XIAA 4IQJA 1EJ7L 2ASHA 1B3YA 3ARSA 4AX6A 4UWMA 1V6XA 1TR1A 4UQ9A 1OIFA 5AHMA 1E4MM 1LROA 2BXZA 3GLCA 1OF8A 1CECA 4L65A 2X09A 1XW8A 1E5JA 1NFPA 3MKKA 4IGSA 1QI5A 4NVTA 4E38A 3J7HA 4PGLA 3N2CA 3UR7A 4IIHA 5E0CA 1PAMA 1JR1A 4RE0A 2ISSA 3SSZA 2QZRA 2V81A 2VQTA 4BI5A 4CEXC 4MKSA 3I3EA 1RZMA 4GUIA 4AF0A 1XD0A 1SFTA 2NXIA 3R0DA 3TVAA 5M5DA 2HPIA 3BGAA 1O5KA 3M0JA 2WNQA 3UWYA 4UXDA 1IXOA 3W76A 4YCOA 4C6MA 1ISXA 2IPFA 5I7GA 3VA8A 4PTWA 1H50A 5XIAA 1Q65A 2HROA 4O1BA 1KM0A 1N7KA 3BURA 1KM2A 2QGYA 2VC7A 2DEPA 3ITGA 3WNNA 3KZSA 2WKJA 1ADSA 3WL1A 1XBZA 3O7UA 1LG2A 4S2BA 5FF4A 4EXBA 3K30A 4GNJA 4LUJA 1CLVA 5DMMA 3MCOA 4FALA 1K03A 8A3HA 2JK2A 4YXGA 1F6KA 5BMXA 4IICA 1E4IA 2X41A 4RL3A 5HJYA 2WM0A 2V3DA 3NDOA 2YOCA 2HNEA 1S2AA 4O8RA 1TSIA 3CU2A 1PZ1A 3P3BA 1Q6CA 1TE1A 1KV8A 4RNHA 4DM1A 3E2VA 2F6XA 4ICMA 4HA1A 3M41A 2UY4A 2WKLA 1Z42A 2MUCA 1GEQA 4JY9A 3K5XA 2YCKX 2C1GA 5BOFA 1Q13A 1KWGA 2OWXA 1AW2A 3E38A 3B9EA 3CGTA 2OVLA 3M47A 1FWCC 4RW3A 3ES8A 3QSTA 5KITA 5KZDA 4DO4A 3IPWA 3H53A 2WV8A 3GIYA 3N73A 1WZLA 3D3AA 4K8EA 4E6MA 3HA1A 1A5UA 2Z1XA 3L5MA 3BAKA 2KZHA 2WHLA 3WEMA 3KBJA 4J3VA 1ZAHA 1V02A 2EPKX 1KTBA 3MZNA 1HF6A 3TONA 3WK1A 2DU2A 4LYPA 2W3ZA 2PZ0A 1YRRA 2NX9A 5G1YA 4F0LA 3ID7A 1DEDA 3VD5A 4R85A 4PMQA 2X0SA 1OIMA 3HGSA 3VAVA 1ZY9A 4B5SA 4QJ4B 4PODA 1CGVA 1Y5XA 4AFYA 4LV9A 4TV5A 4B9YA 1YE4A 2HXUA 2J7DA 2PCQA 3JRKA 3RXZA 4O17A 4CQAA 5CZ0A 1I0BA 5A8MA 5M17A 5C2XA 3UPWA 4XBSA 3QLDA 1BVNP 5AYIA 3GXMA 5H8PA 2VR4A 4LEFA 1JGIA 5AY7A 1XCWA 4PMYA 1EWDA 5CJNA 1HGWA 5EB8A 3PJUA 3A3XA 1A3XA 1X8CA 4YHEA 4IJRA 1XBYA 4H4IA 3W7HA 1CIUA 3AMGA 4KT2A 4AEEA 1PB0A 4D8AA 4DYEA 4GQGA 1WV2A 3TMQA 3NQMA 3FJ4A 2QCDA 3R8RA 1IWBA 1TPEA 2WZTA 1TZ7A 2GPTA 4IPJA 5D4YA 4CNPA 1Q45A 4JIHA 1AH3A 5A94A 1JZ7A 2YW4A 3OB8A 2BXVA 2QCHA 4X22A 2V3EA 1X97A 3H4WA 2VOTA 4Q33A 4AAJA 4XZNX 1O7AA 2B31A 1BWKA 4N9DA 2CBUA 3QMRA 3SCVA 3MMDA 3GXIA 4Q22A 2G8ZA 3TN5A 4ZMGA 4E2VA 5A8PA 2DIEA 5C7HA 4DF1A 3G1FA 3VYLA 1ODZA 4BFAA 2WYSA 2ZQ0A 1V0KA 5HATA 1SSDA 2YDSA 3LTSA 4ZVJA 4F2TA 2DZWA 5BYWA 3H7UA 2IW0A 1MXGA 4L4PA 1OFPA 3SQSA 1YDVA 4B5UA 4O1EA 2D20A 4QG8A 3RPMA 1S5MA 1C9WA 4GZ7A 2D3NA 1CGXA 4MB4A 2W67A 3CYJA 2VZSA 4G6CA 1NIUA 4TX6A 1VRXA 4RX0A 1BXNA 1W0MA 4MY1A 2ZX9A 2Y61A 1CENA 1LLOA 4H6KA 1UR8A 3FJNA 3VU2A 4QRNA 3VXGA 2FZ8A 4ZZ9A 4I7WA 4WJ8A 3L65A 2CZVA 4V27A 4C7GA 2NLYA 4GI8A 1A4MA 3QYSA 2E0PA 2PDXA 4TTGA 2E5CA 2ZRWA 5AN7A 5HQLA 3M0YA 3P62A 3BUVA 1EB3A 1UUQA 4C1NA 3KCJA 5ENLA 1H0GA 1R3WA 1WOBA 4HNOA 3TR9A 3LHTA 4M80A 4RK8A 4DVOA 1EDGA 1B3OA 4A3HA 3PJWA 3STCA 3VOGA 2ANUA 4XD4A 4O54A 3G6LA 4DJED 1QBBA 1TWZA 3SO7A 3K1GA 2QJMA 4HHLA 4C5YA 5AC6A 4U10A 4L7ZA 1H7WA 5C7VA 1PDYA 3GG0A 1LP6A 3AXXA 1VJIA 7TAAA 2ZXQA 4MMWA 3OEXA 5G5IA 2PDPA 4TQTA 3DX5A 1HXJA 3C52A 1R5YA 2INEA 2V2HA 3L67A 2ZZ1A 3G1HA 1H5VA 2HVNA 1OCBA 3GTIA 1DORA 1V02E 3GNNA 3A12A 4LS0A 3IUIA 5F2MA 3GFZA 3THAA 4ZSTA 2TRSA 3NG3A 3AUOA 3NYZA 2Q6ZA 2WJFA 1EX1A 3NO1A 3FHAA 3N14A 4B2DD 3H12A 1QBAA 3QM3A 2QUMA 3BE7A 2WNWA 3S9YA 4UNLA 3ZFHA 1JF5A 4PRRA 3E1F1 1UJQA 3BG5A 2QUVA 5E09A 1ZJAA 4FP1A 1W1ZA 1D3GA 3TOYA 4NJHA 4FOKA 1XINA 1S5TA 4L64A 3GDRA 3TYBA 2CLMA 1HO1A 2O4MA 3RGTA 5AVHA 4PUWA 2WHJA 1HVQA 4N4QA 1RHCA 4QR6A 2VWTA 4JICA 3CMGA 1OCQA 3W53A 4RV8A 2PP1A 1FRBA 3GH7A 3A5VA 3DG7A 3VCCA 4HTYA 5G2WA 5LIYX 3CUFA 1LL6A 1X1OA 1DWGM 1TO3A 4HD5A 3LZ5A 1QATA 1H61A 1NP0A 4Q8UA 1C29A 1KM1A 2DH2A 3BW2A 4LYKA 3G22A 4DPPA 4E3TA 1QPKA 3BICA 4AISA 1IYXA 3GVQA 5FJOA 4GIEA 3CLWA 3S4TA 5I0DA 3NPXA 4QG9A 3CEPA 2YLAA 3M16A 3ARZA 1HKJA 1Z3NA 2XZ9A 1K7FA 1K7XA 2O56A 1E71M 4NAEA 2C91A 2DZAA 2J24A 1H60A 4GUFA 2NSOA 3W38A 4X60A 4B4FA 3SCUA 3ERPA 4GQ0A 4EXAA 3NZPA 3UZYA 3ANYA 2Q3OA 4HYVA 2VTFA 2XIMA 4N4PA 4CVUA 3VIHA 3S5SA 2BZNA 2G37A 4L9XA 3FDKA 4DZAA 3GRIA 1TJPA 3C0LA 3VD7A 1EHAA 1KGWA 3CAQA 3VKDA 3LRMA 2HK0A 3O6DA 3MUY1 3H7RA 1J8VA 3F4NA 4KCTA 3ANUA 2VD9A 4L4MA 4DBDA 4GK8A 4IF2A 1RQBA 5CC7A 1R2TA 1S5WA 3RM4A 3WBWA 4MJMA 2OSYA 1DWIM 3GVRA 2OEJA 5CZKA 4QJ3B 4AHPA 1O66A 1L0PA 4M6VA 2E28A 1QW9A 1PO9A 2BHYA 3PFMA 3O07A 4J3UA 3IJLA 4KWWA 4OBTA 3E02A 2NZLA 1AQFA 3NEHA 4DBEA 1GZJA 5DMLA 2J77A 3ITYA 3EEZA 3QTPA 2WWCA 3W2LA 2FKPA 5AYBA 4O53A 1L6GA 4UC5A 2FVLA 3G6MA 4Q6XA 4OV9A 1WYIA 2CYGA 2HXTA 4IP5A 2R82A 4PFHA 4JZ5A 2B0MA 5ABFA 1GONA 1RA5A 1PHWA 2Y85A 4P8UA 3H2NA 1ZBCA 4N6FA 3ITLA 1C93A 2FIQA 5A3HA 2EJ1A 5EMKA 3FFSA 3S6OA 4V15A 1TPH1 5A6AA 3AUJA 1TREA 4JTJA 3S9IA 3GB6A 3CUZA 4WDWA 3ARWA 1SFLA 3S1VA 5FIPA 2OGJA 5D33A 1VFFA 4D6FA 5D09A 3WLHA 4X9YA 5CQ1A 4XWUA 5J04A 3QYQA 1E15A 2GQAA 3C0JA 3WY1A 3NQ2A 4H8UA 3W6MA 3W07A 2Q09A 2QNEA 4UR8A 5G1TA 1EBGA 1V93A 1UJPA 2X2GA 4ORIA 3GZ3A 5TF0A 4TMCA 4MY8A 3D47A 4MOZA 4R7JA 4R27A 2DFAA 2CBVA 5KMYA 3T08A 3TTYA 2PDKA 1AG1O 2W91A 4AXKA 4G1KA 4P8WA 1BYBA 4Y6GA 1IHIA 1FCBA 3TZNA 4GJIA 3SCWA 5HWJA 2DVTA 1FTXA 2WBGA 2WZMA 2D2GA 1LUCB 3B4YA 3SCOA 2FGZA 1YADA 3HG5A 1VPQA 2E6AA 4GO9A 2DZPA 3T81A 4P7LA 3B0XA 1KTCA 2PU0A 4CLMA 3ZWSA 4M51A 1F6PA 2XH4A 1D8WA 3NQ8A 2XFFA 2OT1A 2PBOA 4F2BA 4LPCA 2PDCA 3KP0A 4O18A 5FF3A 3AIVA 2QDEA 4KCVA 4GC4A 3R4IA 3NM3A 4JYEA 2A2IA 2R1NA 3O63A 1JYVA 3VIJA 4IG2A 4NJGA 4A3YA 3HG4A 1MZHA 1QOQA 2FLIA 3PPCA 2VZOA 1X6LA 1X8FA 5CPOA 3STGA 3WLKX 1UROA 2BWGA 1KBJA 1LBFA 4S1FA 4LCRA 3W1RA 1GPWA 1VHNA 4E3VA 4RPQA 1V7AA 3UCCA 1JEZA 4IXHA 4QCEA 2BY0A 3BG3A 2G50A 3H26A 4XVDA 3OGRA 1PYMA 4B4HA 4NZCA 5A6BA 4W93A 4X2RA 5B80A 4LANA 3WQ6A 3WLJA 1O1ZA 1UOZA 2QXWA 3N9SA 1RP8A 3NA8A 3M0HA 2V9DA 3NQBA 3WLQA 2QR6A 2WMKA 3Q37A 3BDKA 4HA3A 3FDGA 1O12A 5HK4A 2CFFA 4IOTA 5CC5A 4XK2A 3VKAA 3ONCA 4B5NA 6REQA 1B0IA 4O8AA 5T91A 3QQ0A 1Q6OA 1LLWA 2VFHA 1ITXA 5A8NA 1OZMA 1GVFA 4M56A 1LL4A 5CZJA 1OHLA 3A6OA 4JTDA 5DO8A 4JQAA 4MWAC 5AHFA 4UB9A 2WK2A 1LQ2A 4UR9A 1QMLA 4M5PA 4D6HA 4HNVA 3UJRA 4IGMA 3W81A 1CX9A 3KBMA 1HG3A 5LNVA 3OW1A 4FNSA 3FK4A 1VH7A 4ZTYA 4Y9OA 3OHIA 3KBNA 4BEUA 4O4VA 2XHYA 3VGGA 1TUXA 4DN1A 3EMCA 3KEHA 4KRTA 5G1MA 3RLUA 3HU7A 3BCDA 2A6NA 1CXKA 5C5YA 2FFIA 3FHQA 3PK7A 1XGDA 2ISWA 5ABGA 4WXZA 1LRTA 4C7FA 4LVDA 2VZUA 4LY8A 3UWVA 5HWMA 1QASA 5B7YA 1DJHA 2P53A 3A9BA 2EAWA 4URIA 4EAMA 2XINA 1AH4A 1ITCA 4H2HA 2GJLA 1DHKA 3L4ZA 4GPNA 3WO8A 1R3RA 3TW6A 1MUWA 3TQVA 5CBIA 3LHZA 3NQEA 3WLMA 1BG9A 3MUXA 1P6WA 4KRUA 3G5EA 3CWOX 1YE6A 3ABQA 2NWSA 3P84A 4TVUA 2Z28A 2UY5A 3Q65A 1U22A 2I1OA 3WLRA 4XVEA 1KXVA 1XBVA 3ATZA 1LOLA 1CPUA 3ITXA 4OECA 4I9MA 3NQVA 3NO5A 3U6WA 3AI0A 1E4LA 4YYFA 4GKLA 2E6YA 3EZ4A 3V3WA 2OTDA 4LCQA 1VCVA 5HANA 4CNUA 1D7FA 1WUEA 4XO6A 2Y8KA 1W17A 1G4SA 5JVLA 3VFLA 1XC4A 2XG9A 3FN9A 4QJ5B 3W26A 4ZOCA 4RNFA 1Z41A 2P8CA 4JX5A 1YXDA 2E67A 4BCEA 5HWNA 3LMZA 4DJDC 1EJRC 2YL5A 4QNWA 3AWNA 4LB4A 4K8GA 2P0IA 3AMDA 2OO6A 3BH4A 1HL8A 2VFEA 1CGTA 1IEIA 4PE8A 2XGZA 4L4OA 5EBUA 2EGZA 1EC9A 2IPWA 3WBEA 3CQ0A 4RZ6A 1KGUA 1BKHA 4HOXA 1OD8A 2WMGA 5FACA 3OYZA 3LCLA 3OA3A 2I14A 1K02A 3LGDA 3OBAA 1GQKA 1TJRA 1XISA 2I9UA 3TR2A 3FW6A 2OOFA 4BF9A 1R3YA 4E4PA 5KZMA 4JOMA 5TD4A 3R2GA 3AYRA 3PNZA 4WUIA 3CZJA 1SGJA 5GNZA 3MTWA 3H2FA 4OV4A 1J0YA 3KP1A 3PAJA 3SI9A 1EF2A 2ZUUA 1XYCA 4J28A 2RGMA 3MS8A 1IZCA 1QPOA 3DYPA 1LQAA 1DHPA 5E1QA 3ZSSA 4YPJA 3CL6A 3WLIA 4N9EA 4IHCA 5DXYA 4JDBA 1Q8AA 2GFTA 1ZENA 2D69A 1JPIA 3WLTA 3KHDA 3P61A 3PPFA 4PCPA 3A4XA 4M7TA 5F2LA 4E8DA 3AOFA 1WDPA 2YDQA 1SVDA 3ZLGA 4Y8EA 3VIKA 5JQ9A 2X16A 1G69A 4EANA 2PP3A 2ZUTA 3QY7A 1CB7B 1B9ZA 1A5OC 1NWSA 2VEIA 1D2KA 2ISFA 3AMLA 3V0UA 1EC8A 3I3DA 2J13A 3KL3A 1J10A 1UH3A 2PZNA 1PSCA 2ZUVA 2H8ZA 2DT0A 2IXUA 1DE6A 5D2VA 1D8CA 1V0LA 1XLAA 5FAGA 1OINA 5FL1A 3WNKA 2ATMA 3PBGA 3MV11 3LBCA 4D72A 1B54A 2ZBTA 1OD0A 3OQ8A 2Q01A 2FH8A 4QHRA 2QPUA 1ONXA 3SW6A 2WVSA 4IL2A 2REQA 4JKLA 3N2XA 2B7QA 2Z1WA 2VO5A 3UCQA 1EXBA 3TAKA 1VBJA 3A21A 3BMWA 3WH9A 3F5JA 2BDQA 3I4KA 3C3NA 4UTWC 2ALDA 1DVJA 4KFNA 1QPRA 2DUAA 2ZE3A 3MHFA 4EKJA 4K1GA 3MANA 1XIHA 1TIMA 4P2VA 2EKGA 4M7SA 2DV0A 4GZEA 1LJYA 2FJUB 2WHMA 2BV9A 4NYUA 3TAOA 3L2MA 3ZIZA 1RK6A 1KGXA 2D1ZA 4DJFD 4F66A 3GR7A 3UY8A 3GHSA 1RCQA 5DQPA 2X7WA 1FH7A 1MFUA 5HDRA 3LV6A 1JFXA 3TKFA 2C14A 3LM7A 2WMHA 3LBOA 3BSHA 2A85A 4GY1A 1QNVA 4FO4A 3VIFA 1HFBA 6PTDA 2J9ZA 3EDJA 3LNPA 4PBEA 2ICSA 1XPGA 4NNCA 1FWEC 1V3KA 4GFSA 2PGEA 4C1NB 1J5SA 5ECUA 2DSVA 1G0CA 3IV3A 2Z2UA 4PTMA 3C4UA 1RXOB 4B91A 3KOZA 2GUUA 4IMDA 3MSYA 4GVIA 3P81A 4R9OA 1EX5A 3S2LA 1NSJA 2OLSA 2PTWA 4PMDA 2XN1A 2X0YA 1CBGA 1KNWA 5CJMA 3VOJA 3S1GA 2EPLX 2F2KA 2FHCA 5AZ1A 1VBRA 3ITCA 4G5DA 2O9PA 3VGEA 4WDTA 4GYPC