6PTDA

Phosphatidylinositol-specific phospholipase c mutant h32l
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTLDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 98
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 6ptdA00
3V18A 1DJHA 1PTDA 3EA1A 4RV3A 1AODA 2OOGA 4RW3A 4QJ4B 5PTDA 2PZ0A 2FJUB 4RW5A 4GNKB 2PTDA 4QJ5B 4I9MA 1QASA 5T91A 1QATA 3CH0A 3QR1A 3EA3A 1VD6A 1O1ZA 1PTGA 2P76A 1DJIA 3H4XA 1GYMA 2OR2A 3V1HA 6PTDA 1T6MA 3RLGA 2F9RA 4F2BA 4F2UA 3QR0A 1DJYA 4I9TA 2ZKMX 3H4WA 4R7OA 4PTDA 3KS6A 3KS5A 1XX1A 3PTDA 1ZCCA 3L12A 1YDYA 3RLHA 3MZ2A 2OTDA 3QVQA 1DJWA 4OECA 4QJ3B 1DJZA 5T9CE 4I90A 1DJXA 1DJGA 3NO3A 5T9BG 3V16A 3EA2A 4Q6XA 3I10A 2O55A 4I9JA 4I8YA 2PLCA 2ISDA 1T8QA 3OHMB 7PTDA 4S3GA 4F2TA 1V8EA
chains in the Genus database with same CATH superfamily
3DBPA 1RY0A 4HK7A 2GYIA 2Y7DA 4J35A 1IXQA 3TYCA 4I9TA 3E5BA 1JAKA 2BV9A 5MF5A 4MY1A 4QS6A 5C2GA 2ZZ1A 3SM0A 2YL9A 3GB6A 1J2WA 3GR7A 3FW6A 3DXIA 3UA4A 3S5NA 3FEQA 1PE1A 4NL1A 3VNLA 4O8AA 2W9MA 4NG3A 3VYLA 1A3HA 3BW2A 2WVUA 4TQTA 3C0LA 2F9RA 3HB9A 2BVYA 4IIFA 2XTKA 4HT3A 3G0SA 1W6TA 3WD1A 2ISFA 1GCYA 3OLEA 4A6GA 1UJPA 5FAJA 3VVGA 4ZO6A 2Q71A 3AWNA 3K5XA 5C0QA 4E3TA 3AS2A 1VCGA 2OX1A 1F4HA 2QCMA 3A64A 2R8WA 4A29A 3MV01 3USZA 1KM4A 1UUQA 3QZEA 2NX9A 4U2YA 3MWAA 3WD4A 1GW9A 2BGNE 2HE5A 2NQ9A 3VNMA 1POKA 2HVMA 2ZADA 4D6CA 1W56A 5B7YA 2VURA 3LMZA 1TB3A 5MKGA 5LA0A 1H51A 3NOEA 1J6OA 3TYBA 3P14A 2OTDA 1M7PA 5CBIA 3IWPA 1E15A 3QW3A 3S5ZA 4JTGA 4RNIA 2J7DA 1AMYA 1BHGA 3FXGA 4DYJA 4P7OA 4PSRA 1I1XA 1AH4A 2BSLA 3GKAA 3B97A 1E3XA 1MZHA 4PUMA 1W5OA 2Y6ZA 4GG9A 1PVNA 1ZAJA 2YXOA 4IJBA 3FJLA 3NDOA 5A8MA 1A4MA 1DYSA 1TRDA 4XUGA 3RYSA 1GVRA 2DQWA 3UJSA 3W07A 1TZZA 3HN3A 2YZRA 1GK8A 4QEEA 1P6WA 3PJUA 5EMUA 5J5RA 1E1EA 4N2YA 2KX9A 3VDBA 2Z1KA 3DHPA 1YMYA 4NHVA 3FDGA 3QFWA 3DX5A 1JI1A 4GD0A 4WX2A 1TV5A 4EXAA 2GOKA 4AD2A 1VPYA 5FEPA 4KWWA 3NVTA 1LRTA 2DVUA 5FCZA 3SW6A 3A4AA 3RXZA 1F5ZA 1XICA 3SQSA 3T7VA 1R86A 1V5XA 2EF9A 4MSSA 5H8PA 3VCRA 3MU7A 4NQ1A 2ZXAA 1HW6A 5E9AA 1UASA 1M9HA 4JQAA 5LZLA 4EAYA 4F0RA 1E40A 3DFPA 2DZWA 1KLZA 2WQPA 3R12A 2PF8A 3QTPA 3MSDA 4IISA 2B7OA 1Z7AA 4C65A 2Z6JA 3N2CA 1UD6A 4GLEA 4A8LA 3NJ3A 3G77A 1PHWA 3SADA 3TX9A 3R1ZA 1RVGA 5K2ZA 3WMLA 5DF0A 1W3IA 5DRIA 4DNHA 1UWAA 1WKDA 1FDYA 1GTEA 4JR5A 1FKWA 2F6XA 5EKYA 1AUSL 5BCAA 1H7XA 2W3ZA 5FJUA 4FNRA 1G6CA 2P76A 1M5WA 3VC5A 4EPBC 2D73A 3G0XA 2DZUA 4E4FA 1QW7A 3CZGA 2HISA 3GFZA 2Z26A 4AEOA 1FA2A 5CZJA 3FIGA 1PIGA 3M0XA 2OU4A 3NPXA 4C6PA 1FTXA 3OA3A 2XDFA 7CGTA 4UTWC 1EJUC 1W32A 2C16A 3GAKA 1UQYA 3UY7A 3B9AA 4RZBA 1ZENA 4D9PA 1OC7A 2GGIA 1U5JA 2J25A 1XDMA 5EA9A 3UWWA 1X8FA 1BXBA 4JFUA 1EF2A 1LZOA 3QQWA 4BQ5A 1US0A 7REQA 2NQJA 3N18A 1DJGA 3MPGA 2DQXA 4P7LA 2XU2A 2ZC1A 3T08A 4NNBA 1US2A 2Y70A 4YTUA 2GJLA 1UP2A 1XRFA 2LLEA 3GQYA 5I3GA 2Z1VA 3W7DA 1UH3A 1XIJA 3LYEA 3MVIA 1G7VA 3B40A 4R3UA 3M0KA 1J12A 5HOSA 1BSLA 1FWRA 2PLCA 3H8AA 1IZJA 2NZLA 1O68A 1ZY9A 3P5YA 3R0UA 3T4WA 4IJRA 5AFDA 1E6XM 2CLIA 4UCGA 1P1MA 3L4YA 4GO9A 3MQTA 2EG8A 3PZ9A 1TE6A 4C6FA 1TREA 3NA8A 1NP2A 3DH7A 3W83A 3EA2A 3CHFA 1W2PA 4NU7A 3UCQA 4AF0B 3P62A 1DJHA 5HMFA 1XC4A 4MB3A 1UC4A 2TYSA 2IQDA 3GIPA 4RPQA 4IPPA 4HZ8A 1KFLA 4M51A 1DJWA 4YVXA 3VO0A 4F9JA 4WSJA 3BZJA 3NCOA 1A5SA 1UPPA 5HINA 4JXCA 6PTDA 1TV4A 3VOHA 2OWCA 4DNMA 4LEQA 2ZICA 3FJ4A 1E5NA 4R7WA 3K8LA 1RBAA 3H6OA 1V3MA 4CN1A 5C2XA 3S6DA 3R11A 1ZTVA 3DGRA 2DZTA 1TIMA 3NYDA 1HX0A 5HMDA 4Q6JA 3W3OA 3GNXA 3AHYA 1Q6FA 4YTSA 4GH1A 3R94A 1KLYA 1XISA 3WLMA 2O9RA 3FGCB 2XVPA 4J2MA 4N7QA 1CTNA 4DLMA 2V38A 1TTQA 3OLIA 3TAKA 3EBVA 3VE9A 2HWGA 3PZUA 2P8BA 1FHLA 4XSMA 2AKZA 4V1XA 1K77A 1LL6A 3BV7A 3N2XA 2XFWA 2WMGA 1JR1A 3AZTA 2E1WA 4DQWA 2OT1A 3MI2A 1UUOA 3WQ4A 4R53A 4E8GA 1A49A 4IGSA 4WUIA 4E2BA 4QLKA 3W1TA 2GQ9A 4HIBA 2FZMA 2PLJA 1WXYA 2CHOA 3LQLA 4F3HA 3EWWA 4BF7A 4I6VA 2PZNA 4YN5A 1POJA 3OBAA 1TJ0A 1QNVA 1XQKA 1BGAA 1VB9A 1FFQA 1HKIA 4S3DA 1ISZA 2QJIA 5D32A 4AZCB 4O52A 3B0YA 2GJNA 1NP0A 3TCSA 4AZCA 1AW1A 2PDWA 5CGMA 3P8JA 2A79A 3CH0A 2OLSA 4U2ZA 5AOUA 1Q3NA 3N13A 3BLEA 5I09A 1DWIM 3W7RA 1A5NC 4G7FA 4K37A 1JCJA 3BDKA 3VM7A 1U22A 2TPSA 1VP5A 5G5IA 3MUXA 4A8RA 4D8ZA 2P88A 4IMEA 1F61A 3W1PA 2GQAA 2BBFA 2YCEA 4YCPA 1XLEA 2QCLA 5J5DA 5BOFA 4EKJA 1IF2A 3KZSA 2VEFA 4CD5A 2BZNA 3ZMRA 1QOXA 1YE6A 2EJ1A 1DWGM 4HPJA 4MJ4A 3SRHA 3TU9A 3DFHA 3MKCA 4MKNA 4XD4A 3ZSSA 1NWRA 3UR7A 5AC4A 3DHDA 3LPGA 1J9YA 1P0KA 3IVSA 3CWHA 1OF8A 4CU7A 3T42A 5I3JA 1F6PA 3WL0A 2V3GA 3GXTA 1WE5A 6REQB 2F7FA 4ZFMA 4MDOA 3OIHA 5BWFA 4LB4A 3A9BA 4ZGYA 4KT2A 3DZ1A 4M3PA 2UY3A 1JPIA 3GE7A 1VFTA 1J01A 2ON3A 2ZZ6A 4HGXA 3W88A 5I0DA 3WLSA 4OV4A 1UKTA 3BAKA 5AECA 2RGLA 1HXJA 4KH2A 2PDHA 4P8UA 4PE8A 1TV7A 4CD4A 4LVFA 4QXIA 4Y96A 1AD4A 5D03A 1RCQA 1WYIA 5A6BD 1W17A 3W7GA 2VEKA 2BTMA 2ZX6A 1NWSA 3TOYA 4IL2A 3LU2A 4DF1A 3SURA 1IEWA 4ERGA 3GH5A 2EPLX 3OW1A 5G2HA 1E9ZB 2XUCA 3LTYA 4DM2A 2PPGA 1H63A 3W7IA 4CQ9A 3HPXA 2QCCA 4REQB 4S2CA 4N02A 3W7MA 1CDGA 1VLIA 2Z2BA 2YA2A 3PFRA 2ZXDA 5EMMA 4FNSA 5AC6A 2NW0A 2ZXQA 4J3UA 2YSWA 4NAEB 5ABFB 1HO4A 3WLNA 4HNVA 2UY2A 4GYJA 1W8GA 4YU1A 2NWSA 4DN1A 2X2YA 1QI5A 3FV9A 1QAPA 4HU8A 4ZB2A 1EOMA 4AWTA 2AOSA 1F05A 4TO8A 1TYGA 1ML1A 5EMYA 3LOTA 3NEVA 3PAJA 1HJXA 1PDYA 2Z24A 4QQ3A 1Q6EA 3G8RA 4GQQA 4O0ZA 4E4UA 3SGGA 4QIUA 3Q45A 3ZQ9A 2WZIA 3JVAA 3FVDA 2CERA 2HPMA 4GY7A 3BAXA 1CXIA 4ML4A 5JH1A 2V8ZA 2GL5A 4PCFA 5HJXA 3DFSA 3D5HA 3LHTA 1TWWA 2DY3A 2WWCA 1XYBA 4RNHA 4UQ9A 2GK1A 4JIPA 2VRKA 2IXUA 4LAZA 3OIXA 3WQCA 1ODUA 1QO5A 4ZO9A 5EFFA 1U2YA 3ABRA 1MW1A 2GVEA 3C6CA 3GK0A 3V5OA 2RGMA 1RK5A 2HQAA 3BOFA 3TYEA 1V93A 3L66A 1JCXA 5CJNA 3IPWA 1AA1B 3PZIA 5HNNA 2EEXA 4C6LA 4O11A 4M6UA 3ICJA 4FOUA 1TPWA 1P4CA 1H4PA 4FNQA 1PCKA 3F5JA 2RH9A 3WQPA 2OX4A 4XD3A 4ATDA 2VFFA 4KRUA 2F61A 1M65A 4XG1A 1MFUA 2PB1A 3L21A 3N2BA 1US3A 5F1UA 3LDVA 1C8XA 3C52A 2WYSA 3TAOA 1XHGA 2WMIB 2VNCA 3UZZA 7A3HA 3UESA 4UQEA 3QHMA 2B7PA 4MG4A 4MZ8A 2I5GA 4IIDA 4RPPA 1OC5A 2O9PA 7TAAA 4N0RA 5CCZA 3TFCA 2E9BA 1VF8A 4MWAC 3O8AA 2J7BA 1FCQA 3ANYA 4YHEA 5IOBA 3G8EA 3SUSA 2O9OA 1T7LA 1WZLA 1SR9A 4GCXA 3CPGA 4NZ4A 1UBSA 3VZYA 4DYEA 4L61A 1DTNA 1WDQA 2C79A 1BKSA 1CGYA 2CLHA 3IV8A 3VKCA 1FVPA 3CGTA 2FHFA 2YR1A 1KB3A 2E0PA 1F6YA 2C18A 1E0VA 4Q22A 3WK0A 1QWKA 4I8DA 1VCVA 2CXGA 1Q6CA 3U8GA 1VRXA 3N34A 1UWRA 2PDJA 2GVLA 3GNDA 3ID7A 3W81A 4K8EA 1BYCA 2DUZA 1AQHA 1Q7QA 3KBVA 5G2IA 2A4AA 3D47A 3SFWA 3EAUA 1XF0A 4XISA 2WMJA 4U4MA 5BNKA 1IE7C 5LSMA 3VD4A 5I2UA 4B90A 2DSZA 3WK3A 4J2PA 5D05A 3K1DA 1Z42A 3CV6A 3T0TA 5IFPA 3PTMA 1PTGA 1P43A 3AAMA 1XINA 2Z29A 4S1FA 3O6AA 4CQCA 3WQFA 1C93A 4B2DD 2W63A 3H70A 2D1ZA 1PV8A 2QDEA 1UP0A 4CCDA 4KGLA 4CCCA 2V9DA 1XLDA 4CD8A 3LCFA 3V18A 5HXMA 5AHIA 3HV9A 3V0SA 1PX4A 2W0UA 1KRBC 4JD4A 3UR2A 4HNNA 2PTWA 5A2BA 5EBUA 4MOZA 2HNHA 1XRSA 1J6PA 3EX1A 1MI3A 2I5QA 4R9XA 1WDSA 2J88A 3CQKA 3C56A 4I7WA 3DOPA 4JAWA 3BW4A 1G4TA 4ICCX 4YMZA 1AJ2A 4WY0B 2VCBA 3STPA 4E2DA 2NX3A 1XYLA 2E6YA 4GZIA 3LM7A 4NXKA 2ZUMA 1CECA 3BAJA 2WNWA 3STCA 4IP4A 4S3CA 2DGAA 1TV3A 2VDIA 1AZ2A 2CNCA 4NAFA 4YYFA 3TWAA 4AD0A 5G4WA 2I1OA 2OYLA 5F2GA 3WNPA 4DELA 2R1PA 2G3MA 2JF7A 3B04A 1FWSA 4CN6A 3AIRA 3KHJA 3CZJA 1AJ0A 3FKRA 2FTWA 2BXYA 2CLMA 1AFSA 3GHSA 4AW7A 1CZ1A 3N4FA 4FLRA 2YA1A 2HCVA 3MO7A 3EPOA 1XG4A 1CWYA 4RNJA 2XGIA 1IIHA 4ZXOA 1CLVA 4X2PA 2WSYA 4JQ1A 2VOMA 1V79A 1QPRA 3HPFA 3IANA 4P7RA 3MMDA 3LNMA 1KFJA 1N8FA 1FP9A 5HR7A 1L8NA 3E12A 3DHFA 4F8XA 4LXFA 3RJXA 4KFOA 2G5WA 3VXGA 1GKRA 3GH7A 3ES8A 3CUHA 3LCXA 5EB8A 3UETA 1D8CA 3FX4A 3TNBA 1QFEA 1LLZA 4Q4QA 3IRSA 2BOGX 1V6YA 4AEEA 4UWMA 2ZX5A 3KWSA 3PZGA 1Y8BA 1KR1A 1IV8A 1LL7A 2WOQA 3SCOA 4BF9A 3ONBA 1KFCA 3P74A 1IQ8A 3AWOA 3ABSA 5CPMA 4LS2A 1NDVA 1JUEA 3FS2A 3M5VA 3M6YA 3QC3A 1EP1A 4K8HA 4EF8A 2DU2A 3I6RA 1OZQA 3HFTA 2IUZA 3H2MA 3T81A 2QYGA 3O9NA 4I90A 1OB0A 4MZYA 3CMJA 3CAKA 2A85A 3ZR4A 1BXNA 4Y7EA 1Q7MA 3EZ4A 1I4NA 1DJQA 4I9MA 4MB4A 4UZUA 3POHA 3RFAA 3VOJA 3KDOA 3F5LA 4TV6A 1DE6A 3CAWA 4XIMA 5A6MA 1W1YA 1HJQA 1PYMA 4PCNA 5AKQA 3L5LA 1ZRQA 1F2JA 6XIMA 1EPXA 1R3YA 3BH4A 2CBIA 4LAMA 3K30A 3N9RA 5H8UA 4O1FA 2Z1WA 4DZHA 3E2SA 2V5JA 4RE3A 2PTZA 3VIPA 3GG1A 1GQLA 1JDFA 3CWNA 4GJIA 1K7FA 2QUNA 1RD6A 7TIMA 2OZ8A 4Q32A 4GYFA 3ANUA 1PKNA 4AUBA 1E73M 4FALA 4HOWA 3II1A 4XIAA 1DWJM 2HV5A 2D3LA 4W86A 3OJGA 1MNSA 3UG8A 4PUWA 3VPLA 3BLPX 2HTMA 1VYPX 1TPB1 3EMQA 2ODOA 5DMMA 2XIJA 1FWFC 1I0BA 1TPVA 3ABXA 5CG7A 3I4EA 5BXTA 3FKKA 1TWZA 4QAWA 4X63A 4DJEC 1EFZA 4BWLC 2QEZA 3LUTA 3M0ZA 4DBWA 3U48A 1X96A 3MUY1 2HMCA 5AYBA 4ZO8A 3GVWA 5HBFA 1UB3A 4QLLA 5DO8A 2QCDA 4FI4A 3EEZA 3WFZA 3WBYA 1DJZA 3C0SA 2DZPA 3ZJ6A 1TKKA 1Q4NX 3MHUA 2Q3OA 3TH6A 4S3GA 3GIYA 4ACZB 4ZXLA 5D2WA 3O63A 5KZDA 1JZ6A 3SR7A 1ZS2A 4XB3A 2VZOA 3B4YA 3TP4A 4DBSA 1NOWA 1QPQA 5DMNA 1YXDA 2BMBA 1A0EA 1RQHA 1WOAA 2FYMA 1GOIA 4C5ZA 4QGCA 5EGRA 3ARYA 4PBGA 2PD5A 1Y0EA 4AAJA 2Y85A 1RUSA 4LUJA 4QSHA 3RR1A 4YL2A 3EX4A 4NT0A 5CLTA 4MDPA 4UR8A 1QNSA 3NEHA 5E6YA 4RE2A 4XUYA 4BI6A 1IWBA 4US6A 2E28A 3ALFA 1M53A 3K4DA 4JTKA 4LH8A 5KMYA 3WDRA 4V33A 1FKXA 3F5KA 3EOLA 1K8ZA 2J79A 4JQ3A 5D2TA 1NVMA 1KTCA 4H6KA 4L1XA 3MMUA 2E6AA 1EJ7L 4FB7A 5H6HA 4ATLA 1EA9C 1S2AA 3LLFA 1D3HA 3SCRA 4S3FA 2CC0A 1IHIA 2GUUA 1AQFA 4HNOA 2VDGA 3K8KA 1QHPA 1YHTA 4O28A 3B8WA 1EDQA 2Y1HA 3LCIA 2NVDA 4IT1A 1XIBA 3O07A 3BICA 3ZM8A 4LVAA 1M7OA 3TTYA 1XWYA 1W1A1 3U2CA 5BMXA 3QSRA 5A95A 1WZMA 4B5XA 1O5RA 3V36A 5CLWA 2VR4A 3PWAA 3AU2A 4CLMA 1SMAA 3T0CA 5BOEA 3A3XA 2Y8VA 3DCPA 4CVWA 3EOSA 2BP1A 3WNMA 3LHYA 1RPXA 4YNGA 4YYCA 4DZAA 1B4KA 2REQB 3ZT6A 4GIAA 3MJYA 1R3RA 1ZJBA 3PPFA 4IXXA 3H55A 2EPMX 1BXCA 2Y4SA 3M1ZA 3MB9A 3NQCA 2P5NA 3TTSA 1S2WA 4RE4A 4C91A 3NO5A 1EZ2A 2WLZA 4GUJA 5AYZA 1ITUA 5DCDA 4IF2A 4QAIA 4HA0A 4MPQA 3B03A 4J28A 5AC8A 3P5ZA 1PZ3A 1ICSA 4YLWA 1DPMA 3AS3A 4JFVA 3TCEA 3TC3A 1GWJA 1HJSA 4S3BA 5G1MA 2FDMA 3CIWA 3NDYA 3VIJA 3R4IA 7ENLA 4AVOA 2GOUA 1R3TA 4Q4KA 4D6GA 4CQ8A 3N15A 3FVMA 3W6LA 1REQB 3KRBA 4PUEA 1H3GA 4JIRA 4QEHA 1LOSA 2W66A 4LU0A 1ZJHA 1QOPA 3N4AA 4N42A 1MRAA 1MDLA 2B81A 2A3CA 1XYMA 4QDMA 4PCSA 4TTGA 2PRLA 3G6MA 2BXZA 3U9IA 3QM3A 4HPHA 4JIEA 5FF0A 5I3FA 3PBMA 3F03K 3KBWA 3V1HA 3AJXA 1OT2A 3BJTA 4ZQPA 3TJIA 5KETA 1RALA 3QZ6A 1UKOA 2XH2A 4HZ6A 2BVWA 1YE4A 3WH9A 3G1RA 3EX6A 5A94A 3PWIA 3PFMA 4MFDA 4IICA 4XZLX 3KP0A 3W7NA 3DC8A 4FS9A 5DMYA 1BTMA 1MFVA 1VEPA 1F3EA 1UR3M 1EO5A 3HM7A 1Z9AA 3WQ8A 2PDUA 4F0MA 1PBGA 3QGAC 1X1ZA 3S1XA 2V68A 5CGTA 3FNDA 4L1WA 3NZ1A 3VGHA 5FL1A 3FGCA 3ZJ8A 2VDHA 4Z17A 5HUOA 1RVKA 1OGGA 5FKYA 3KOFA 3H2AA 3GG0A 4Y8FA 5G1YA 2G0WA 1NFGA 4GIYA 3UFYA 1R87A 2RDXA 1IWPA 3GNPA 2PC4A 5D9OA 3HGRA 4QS5A 3MSYA 3AIVA 3C86A 1K03A 2D69A 1JYWA 5C8BB 3F2BA 2WB5A 5JBDA 4GNKB 4DWSB 3U4AA 4S39A 1GOQA 4Z0JA 1ITXA 3VU2A 3HMJG 3SB0A 4A8IA 1GT8A 1V3HA 3SGZA 3MDUA 1CB7B 1JPMA 3W2JA 2D23A 4CEXC 2JEQA 1M04A 3PF3A 2VGBA 1E72M 4EE9A 3PPCA 2ANUA 4BY3A 3HQ1A 1MEWA 4GJJA 4FEZA 3RLGA 1NDYA 1HJVA 1ZJAA 1LOLA 1SZGA 3MKVA 3NQBA 3W23A 4GY0A 2CPUA 2GGEA 2PDMA 4PB3A 1TVLA 4GVGA 4UUIA 1LLWA 1KW1A 4CQDA 3WLLA 3R58A 1ZCOA 4O0KA 3WN6A 1X7IA 4AWUA 1CGUA 2BODX 4WXZA 2A6NA 3QTGA 1J79A 4UQDA 4JKLA 1DJNA 5E1QA 1RA0A 4D8LA 1VFOA 4O10A 3NIYA 4QROA 1C8YA 5C54A 4S3KA 2Y8KA 1V6WA 4LANA 2Y62A 1ZHAA 2QCGA 1R7AA 5KZEA 2J7CA 4QE1A 1EDTA 3NFUA 4K1WA 2V5KA 4K36A 2HS6A 4UTWA 2ABAA 3OVPA 1H7WA 1P0BA 4DO7A 3ABQA 3UWVA 4BQ4A 3PTKA 3W00A 1LTDA 2OOFA 1PKMA 2PWEA 3GBDA 4LYRA 3W6YA 4WSHA 3VTRA 3HFYA 1LUCA 3ZJ7A 4DJFC 3MY9A 3MI6A 4FNUA 5FL0A 4MAVA 4XWUA 1R3SA 4GHRA 3UGRA 4GK8A 4UFHA 4XKYA 2P3ZA 3C2RA 2WZTA 2A3BA 3SJNA 3UXAA 4IIBA 2VQTA 1S5NA 3A13A 1X7FA 1VR6A 2QJMA 2NUYA 3SQMA 5I23A 4AC7C 2VRQA 2XWEA 4DXVA 1SZFA 3O6CA 1KNWA 1V6VA 3P60A 2CBUA 3ITTA 3R10A 3QV8A 3IGHX 1EBGA 4FIRA 3IVUA 4I3GA 4XK2A 3CH9A 1AL7A 1Q6DA 1LYXA 3BC9A 3LD5A 4Q8PA 1RH9A 4DXKA 3UPMA 1VENA 3T0DA 4I5XA 1NJJA 2XIBA 3DBNA 5MKGB 3NTYA 4RLIA 2QUVA 3HG5A 2WVVA 2TODA 1Q2SA 5AHNA 4ZTXA 2HE8A 4PUJA 4LAOA 4DWSD 5LNUA 2BS9A 2E9LA 3AS0A 2V81A 4FLSA 4CD6A 3NQ6A 4PFHA 3ABOA 3WLKX 1J5SA 2MANA 1YPXA 4CCZA 1GEQA 4PB5A 4ML9A 3GC4A 2WNNA 4EPDC 2VR5A 1GYNA 4X2RA 1DP0A 4PR4A 4Z1YA 4Y2WA 3AUJA 3GX9A 3KM8A 4MWAD 2V63A 5BRPA 4EOUA 2YBVA 3BLIA 1OX5A 1G1YA 1CXKA 4AWSA 2GDUA 3INPA 2NX1A 3GDTA 4HMDA 3WLQA 1NAL1 2WVTA 1PUDA 2I5IA 1NF0A 4O1AA 3SIMA 5BXPA 5DT5A 1M01A 2V2CA 1X6LA 1ALDA 4HB7A 3LERA 3W26A 3KHDA 2QCNA 2FZDA 3HGJA 4C7GA 1L6WA 3R7MA 4KBXA 2Y63A 1KQZA 3HQPA 4A2RA 3W1MA 1BG4A 1YYAA 2ZA2A 3ITLA 2QJGA 3ANVA 4AIOA 2V67A 3TQKA 1B2YA 4JZ5A 4X60A 2VEGA 3SN4A 2OEJA 3A23A 4C5YA 1OFQA 3FSTA 3BMVA 1EEXA 4RZ5A 1XYZA 4HSHA 4JICA 4XKYB 5H1WA 1A5KC 1ME7A 2Z25A 2ZVIA 2PS2A 3DFNA 4ADTA 4OQVA 1GQIA 1R2SA 4H19A 3ZR6A 2VHLA 1TVPA 4DJDD 3VNKA 3TONA 1R2RA 4H9XA 5FJOA 3PB0A 4R7OA 3VX0A 1QNOA 2YL5A 1U5VA 1GW1A 4MZ1A 4H41A 2W79A 3SUTA 4GY1A 3BOLA 1F73A 2PU0A 3COTA 1W1PA 1PTAA 1ZLPA 2DW6A 1PAMA 1UR9A 1H5YA 1QU4A 2YL6A 2YYTA 3WLIA 2QT3A 3W7OA 3VFCA 3AHVA 3FJ6A 2ZZ5A 2OKTA 4ZQOA 3CK5A 1XLJA 4Y6GA 3NAVA 3V3WA 1P7TB 3N25A 3WMSA 4GVFA 5AHMA 2FTPA 4QJ1A 2D2JA 4CNSA 4JTUA 2XVKA 1J11A 4JX4A 1ZPTA 2CKRA 3AXIA 4XZHA 1S2TA 4WGHA 1PXGA 2GQ8A 4GUFA 4K3ZA 1GKPA 2Y5SA 2WNZA 3L0NA 2C71A 1YDNA 5HNUA 2NV2A 2ICSA 2NUWA 2QAPA 2DT3A 5CC3A 1XG3A 4IG2A 1GZGA 4N6FA 4GJ1A 1RAKA 3CEUA 4HNCA 4B4HA 2ESCA 1WAWA 4LNYA 3V5FA 1PZ0A 2WKLA 4WRHA 3A4XA 2X0YA 5AYYA 2CFFA 2CESA 4E4PA 1DHKA 4ZTYA 5K9DA 4ZQRA 4HHPA 3URNA 2BNJA 1IYXA 1PIFA 3PR2A 2AQWA 3ITCA 1KM5A 3AHTA 3URAA 4NZ1A 2GGGA 5D02A 2VL4A 1R0MA 3W1LA 4AZIA 1EXPA 2XVNA 3T07A 4C1LA 4TVCA 1NEYA 1D9EA 3SCVA 1S1RA 3OVQA 4ICMA 3RIKA 3SAZA 3H2OA 1EIBA 1W3HA 3E9AA 1NM9A 3WH5A 3OB8A 4PEEA 1XC6A 2PA6A 1RXOB 2WMFA 3V0UA 1RJPA 2WSPA 4I9JA 2WM0A 1WO2A 3VUPA 2XIMA 2YZ5A 3VNYA 3RUBL 1QNPA 2ZFAA 3FYPA 1W1B1 2GWGA 3QYSA 1AZ1A 1OD8A 5H8MA 3SUVA 1YNQA 1XYCA 1H7RA 3QKZA 4YTTA 4XZNX 1TX0A 3PZOA 4BEUA 1RQEA 1G0CA 2JIEA 3KAOA 3C2VA 4BKNA 2QAFA 4DEFA 5LNRA 4LC8A 4IIGA 1R6WA 3HJEA 2J6VA 3BSMA 1BYDA 2W61A 2XVGA 4NX5A 4ZO7A 1U83A 2G95A 1PHQA 3OBKA 3QHNA 1OX4A 3SUUA 3SCSA 1XI3A 3A4WA 3VINA 6CGTA 1XDJA 4PYSA 1Y5XA 3REQA 1XH0A 3I6TA 4Z2IA 4W85A 5RUBA 2P0IA 2PSNA 5G2WA 1WZKA 4R9OA 3TA9A 5HJLA 1P0EA 5IDIA 3U57A 3IIPA 4YHGA 4PTDA 3DFOA 2DZSA 3S4TA 3PVFA 3SCPA 3RN6A 3O15A 1RV8A 3KWXA 3G1YA 1WOBA 3BAIA 2G4JA 1V03A 3LCHA 5KINA 2JK2A 4DBDA 3WQ6A 4PTWA 3EXTA 3N3MA 1IR1A 5L9FA 3GTFA 3VFLA 1ZP3A 4U31A 2WHLA 5FJPA 1L6SA 3QPEA 3LGGA 4H3DA 3IUHA 4IMAA 2CCRA 3UJFA 3EDDA 1EIXA 1WV2A 1Q6OA 1UD8A 2FH8A 3TJXA 4AYSA 3W87A 1O94A 1OT1A 4B91A 3W0KA 4V2XA 3VGDA 4UQBA 1N55A 2BHUA 2VX4A 3DC0A 1CT5A 3B8UA 2MUCA 1C7SA 5JVLA 1QO2A 2ZWYA 4RE0A 1YXYA 1KWKA 4AY1A 4PMRA 4TXEA 3LRLA 1YQ2A 4K1GA 4U33A 1R47A 2Q8LA 1JF5A 4A8NA 1WKYA 2H9AB 2NSOA 1UC5A 4L6HA 4PTVA 1X6NA 4LYPA 1O66A 2JIWA 4W88A 1E6QM 2O56A 1G69A 4UNIA 2E68A 4AIUA 3KRUA 4TOQA 5T9BG 3R8HA 3CYVA 1LBFA 2HK0A 3VUSA 3VMPA 4YVPA 4QJ4B 3M47A 2PWFA 3LBMA 1QATA 3ELFA 2PI6A 2X1IA 4G5DA 2J9ZA 2R6OA 1A4LA 3NPWA 3W7LA 3FY1A 2WJDA 3BURA 1XW8A 3IAPA 4TU1A 1S46A 2GUBA 1TV8A 4ADSA 5IHRA 4J7RA 3UG3A 1H1NA 1W9XA 1E0UA 3L4TA 4Y9OA 1I2RA 4KCVA 1OBAA 3M0LA 4N4PA 1PZ1A 4NI3A 1YDVA 4D6FA 3WSUA 4IX2A 3F4DA 2E8YA 2WLYA 2EGZA 3A4JA 1WKEA 4XZMX 1QUMA 2ZA1A 1U1UA 4HQVA 4UFMA 3CQ0A 2QDHA 4M82A 4UXDA 3AMLA 1EHAA 3RCYA 4L1GA 4KEMA 1SFSA 1KQYA 4ROPA 3MMWA 2ZWZA 4I7VA 1RBLA 3AYVA 3W6MA 5FF3A 1DHPA 2Q3RA 1J0YA 2AAAA 4X0NA 3APYA 1NARA 1FWHC 1XFBA 4IFRA 3W27A 3UXKA 2J9YA 3LLDA 3WENA 1W9PA 3QSTA 3RO8A 3B9DA 4W89A 5REQB 4C7DA 5SWUA 1QCWA 4EACA 4FK9A 3TC6A 4ALDA 1Y7VA 4DIAA 3TQPA 2P3EA 4IMGA 3LPFA 1RPKA 1P1XA 1P6BA 4DO4A 3TSDA 1LF1A 1QK2A 2JBMA 4ASTA 1S5MA 4HA3A 4RDWA 2QCFA 3JUGA 3WD2A 4PEKA 3L68A 1OFRA 3W86A 2ZOXA 4ONVA 3RILA 3AQUA 2TSYA 2ZRZA 5CPLA 4J3WA 2VENA 3T44A 3O06A 2I9EA 4E2VA 1RCOB 1GOKA 4LALA 3W24A 3BGAA 3KW3A 4IZGA 3N11A 3OGVA 3GDMA 1KM3A 4KFPA 3W7EA 3BCJA 2P8CA 4LYKA 1UMYA 1LRQA 1XDLA 3BSHA 3BZGA 3SEPA 1JJKA 4AY8A 2HZGA 3A5FA 3JZUA 3TVAA 1VIWA 5A6AA 2GWNA 3T40A 2G8ZA 2GPTA 3EX3A 4DY1A 3L12A 3NSNA 4WD0A 2Y0FA 3NUKA 3N2MA 3VGFA 3MO4A 2X7WA 4DWSA 3ZJKA 4UOZA 3A6OA 2YLLA 3NURA 4ZOCA 4Z1AA 2V5BA 4TX6A 2VGIA 4M6VA 4NAEA 3UA3A 4F0HA 5CAHA 3CZEA 4JYDA 3BMXA 3IJ9A 2GGJA 4HYRA 3MZ2A 4WY0F 4MJMA 1IZCA 5BU9A 3ZVHA 4GYPA 1Q2RA 1HKKA 2WBKA 3TDFA 1RLCL 4H2CA 3CAVA 1XKJA 2DT2A 1J0HA 2WMHA 5J8LA 1FWCC 3TOPA 1QW9A 1XLCA 3GR4A 4FXRA 4NJIA 4PZVA 2OT0A 3A3HA 3KX6A 5K9XA 5L6UA 5JIWA 1NY1A 5BU6A 3JU2A 3VAVA 1YLVA 1TPC1 5T8GA 1UUMA 2VZTA 3GXMA 1GQNA 4FSAA 4DJDC 1OFDA 3RPDA 1R30A 4JQ4A 4WF7A 4EWND 3WJWA 1MW0A 1HN1A 3AHZA 1XLLA 1F9CA 2A3EA 1AMKA 4J3TA 3B8SA 2G4FA 5CJ5A 2QV5A 1M03A 4FOJA 5CPOA 1ZNNA 1JI2A 4JTSA 1RLDA 4TTUA 3QR0A 1XLAA 2GVYA 4OU1A 2YDAA 5K4ZA 4X9YA 4HVXA 1XUZA 3GU9A 1A80A 4MYXA 1LLOA 1JQVA 3HJZA 4X22A 1GOXA 4WEVX 2QLYA 1OF6A 2OO6A 3KZPA 3PANA 2Z28A 3GTHA 3RCMA 3IJQA 1XSIA 1GG1A 3U4FA 2ZRXA 4D2JA 4F2UA 1UCWA 3GYCA 1GHRA 2JF6A 3DKLA 4NSBA 1VPQA 2AL2A 5ABHA 1H7NA 3ZYZA 1SSDA 1IEIA 1UR1A 1KM1A 1HQTA 3WNNA 3WD3A 1PX8A 4XO7A 1W31A 4M1BA 3LCGA 1QPKA 3PPGA 1EEPA 4IGMA 1HP4A 1NOUA 4TMBA 1V51A 1KCXA 3AJ7A 3G1AA 4OT7A 3BJFA 3DYOA 4DM1A 3O05A 1JL8A 3WFLA 5D9MA 4G1NA 4AMAA 2YFNA 1JUBA 5I00A 3SBFA 3T4CA 1UIPA 2RJGA 3R89A 1JDDA 2DIJA 2YXXA 3EB4A 5GJPA 1XIMA 1HF6A 5LIXX 5I07A 3MJMA 3HG4A 3EKGA 3UZXA 1H1ZA 2VELA 5FF7A 4GWEA 4FX7A 4CUCA 1DQWA 5LIUX 1O5KA 5IBXC 5M17A 1ITCA 2Z7KA 3S1VA 3MDWA 3RMEA 3N17A 3ZO9A 5A5WA 2B31A 2UY4A 1ZALA 4P2VA 1KCZA 1EL3A 3IK4A 1J0JA 3PZNA 4LV9A 4GINA 3G22A 3U7BA 4OV9A 3F2CA 4UC5A 5FSEC 1KR0A 3SCNA 5HMEA 4RXGA 3FHQA 3UZJA 3S47A 2XHYA 1XGEA 2XM2A 3E0WA 5HWJA 3O2LA 2VZVA 1XH1A 1OGBA 3M07A 2DEPA 4Y8EA 3C5QA 5A6SA 1XH2A 2PRHA 2PEVA 3RX4A 4C6DA 3V35A 3FJNA 3LI0A 1UZ4A 4KWSA 2ATSA 1TRIA 3EXSA 5ECVA 4L6DA 4K8GA 1E6PA 1B3VA 1L6GA 3MW7A 3C2EA 4B5VA 2ZUSA 1TSIA 5CQ1A 1H7OA 3KOZA 1E4MM 3LY0A 1CPUA 3UY8A 3NM1A 4GQGA 3HO8A 3KBJA 3H2NA 4D1IA 3W82A 4Q7NA 1L2QA 3KCOA 3S46A 5A69A 3KFTA 3PWGA 3SSJA 4MF4A 5HNTA 2ACQA 3XINA 5HUPA 1ZJIA 1NQ6A 4QR6A 5HANA 2FPTA 1LOQA 2G50A 4B2DA 1Q85A 4Q3MA 1VFUA 3APGA 3IGXA 3W76A 4W7WA 4L9YA 4M0XA 4MLJA 2FB3A 2RJHA 5HULA 1OSEA 2D2OA 3FA3A 1FXPA 2PGFA 3QC0A 3FXYA 1WUFA 1GVQA 5A8OA 1EX1A 2DSUA 2WC7A 1WXJA 2QKFA 3K4AA 1XCWA 2VZSA 1TTIA 1GZJA 2FZNA 1TR1A 3WNKA 2FVLA 1R38A 2E1DA 4N9CA 2QDDA 4Q8UA 1R8LA 1THFD 6REQA 1C8QA 5GNZA 1XPGA 4LBUA 4YIWA 3VDGA 3L5AA 1HL9A 2FIQA 5FEWA 4LRSA 1XSKA 2CKSA 4B16A 1LBLA 4D6DA 3C2FA 2PDNA 4PTMA 1H1YA 3GIQA 4H6QA 3N1AA 2WXDM 3MHGA 3GXFA 5KZ6A 1SFJA 3GUGA 3LHUA 1G4PA 2F84A 2Z0IA 4MHBA 2OLAA 1XXXA 3UJRA 3WEOA 3FA4A 4GUIA 4ZSUA 3LPPA 3S5SA 3GVGA 3UZWA 1EXBA 3UBPC 2RHGA 3M7SA 3IVTA 3M6DA 4HA4A 4XBKA 4PRRA 3M64A 4MUPA 3N6HA 1W9UA 1JCMP 3MCNA 2CZVA 3UVAA 1N2VA 5DRCA 1G4EA 1OADA 2QUUA 1S39A 5CKSA 1T99A 4X0VA 4AWEA 3PHAA 1JPDX 5I79A 2IW0A 3P61A 1UWQA 1XIIA 2X1UA 2J7GA 2XISA 3UZ5A 2ISSA 3C3UA 1JVNA 4GI6A 5KSWA 4GZEA 3BXWA 4KETA 4WLCA 1HUVA 3VNDA 2YJQA 3W2UA 3M46A 4DLFA 3HMCA 2ONEA 4JEJA 4RV3A 3RG6A 1H0GA 4IHCA 2QJJA 1UYQA 2PBOA 3WF4A 3RM9A 1M68A 4R5EA 3VD5A 2J66A 3UP8A 1UROA 1B9ZA 1I2OA 4FO4A 4ZE4A 3GR8A 1O95A 1G94A 3W29A 1F7BA 5AHEA 3UYIA 3N12A 3UEQA 4DHGA 5H2ZA 2VGGA 4JTQA 3RLUA 3MUZ1 1FWWA 3EKLA 3SCUA 3R13A 1E6NA 4YWIA 5I03A 1CW2A 4DO5A 1CI1A 1R9YA 1HVXA 4HJWA 5I24A 1UR2A 1E1CA 5FA5A 3RM4A 2O4QA 1JCTA 1IT7A 4B15A 3W4RA 4E8CA 2WCAA 1L6FA 4WSKA 3UVIA 3WH6A 2FHCA 4HN4A 3CPUA 1ECQA 4UTFA 3AICA 3VD9A 2O4MA 2G3JA 2PWHA 1J0IA 3T2OA 2PF0A 1GONA 1RD5A 2OKOA 3POCA 1X38A 3C8NA 1TVNA 2F2HA 1K6WA 1R3VA 1CXFA 3H4XA 2XN1A 1OFAA 5IBXA 2PRMA 2YKKA 1B90A 1W37A 3O3RA 1OX6A 3TKFA 2VXNA 2GSJA 3RRXA 3U2ZA 1VBHA 2PWUA 3HA1A 2GDVA 4MKSA 4IGHA 3TR2A 3KCJA 4PMOA 1NDWA 2D2GA 2Q09A 4XAFA 3ITOA 3ZR5A 2J24A 3LMYA 4XTIA 3VIFA 2NT0A 1VIZA 4L7ZA 5CZTA 3HURA 4AF0A 4H7ZA 1OYCA 1N8WA 2VVNA 2NWRA 1OCQA 1VAHA 3S1GA 4Z1CA 3CHVA 1F4AA 4DAIA 1EGVA 1L6YA 3HIJA 3H4WA 3E0FA 3E3HA 1A3WA 4NX0A 2YCJA 3S1UA 2P53A 2YW4A 1KC7A 4LV4A 3OZOA 4AX6A 2XN2A 2EHHA 3N4EA 1R9XA 1W3NA 2ZIDA 1X1OA 2UZ9A 1NFBA 1O12A 1PPIA 2A1YA 1MVYA 3LXCA 3G1VA 3MHFA 5D9NA 2OSWA 1Z32X 3IUIA 4FHAA 1I2PA 1EQCA 2DH3A 4GUGA 2OO0A 3DIPA 1TPDA 4U3AA 1QDSA 4JKMA 3QKEA 1TCDA 4HTYA 3MBDA 4L65A 1I2QA 1QI2A 3EWXA 5FIPA 3C3NA 5DELA 1PJ9A 1E3ZA 3QMTA 1EA0A 4L6OA 4Z1BA 3KBNA 2QXWA 5A6JA 3USBA 4QQUA 3LZ5A 4HJFA 1KFEA 1W0MA 2Q8XA 5C9UA 2OQLA 2VEMA 4IP7A 3AXMA 4M7SA 1OK6A 2YCKX 3DAQA 1OCJA 4MWAE 1E55A 3UWEA 2E9MA 4PCTA 1W9VA 2FZ9A 3VA8A 4H6EA 3I7QA 3AO0A 4HYWA 4UTTA 2AQOA 3PULA 4J3SA 4LUSB 3RO6A 4L4MA 2E3ZA 3NXLA 3KS6A 4A3UA 3KDNA 4JQ2A 1ONWA 3Q58A 4GYPC 2REQA 1D2KA 4NIRA 1T0OA 2BDQA 2Y24A 1MW3A 5CPTA 3ITXA 3E74A 4J3ZA 5A6TC 2QF7A 4WZHA 4UTTC 5E09A 1S3TC 1O5QA 4JN8A 1LROA 2WBGA 3OGSA 3LPOA 3B05A 5DN1A 5I3KA 3T0BA 3CL7A 1V8EA 2BHZA 2Z1BA 3TV8A 2VC6A 5CSSA 1H11A 2IMRA 3LK6A 2VC5A 1KM6A 2NXGA 4ZB5A 3NO1A 2QCHA 3RJYA 4ZODA 3W9ZA 1TTPA 3LV6A 3GTIA 3CMFA 4UTHA 2A7NA 1ZL1A 2G96A 2VZUA 5CBJA 2J7EA 3WKZA 1UPMB 5C9RA 3MTWA 3LRMA 4JOMA 3SI9A 4GKTA 3F4WA 1TZ9A 3GNRA 4M81A 5E93A 1P48A 2YXGA 4H8VA 2Y7FA 3KBSA 4O18A 4G8TA 3EKZA 3S9ZA 4B5UA 1Z3NA 3ONCA 3DECA 3ITVA 4HP5A 4ROQA 4M1RA 3GFXA 4FR6A 3HF3A 1XL9A 2PP1A 3AC0A 1GGOA 2X16A 3TFXA 3OVGA 1I0DA 4DUVA 4CD7A 3KLKA 5U7SA 4TIMA 3OTRA 3G1SA 1K6AA 2Y2WA 4Y9NA 3WJYA 4IP5A 5DBUA 3TSMA 4KW2A 1WQ5A 1JD7A 2FHBA 3M0VA 4OBTA 1UWSA 4L80A 4RCXA 2SFPA 4LJ3A 2QDGA 3STFA 4LCSA 2TAAA 3E6EA 2D22A 4DPQA 1KBIA 4C6IA 4MNMA 3TN4A 3MA8A 1YDYA 4KS0A 4F48A 3GBEA 2B4GA 3PJTA 1CCWB 1SQ7A 1DXEA 4NZJA 1BFNA 3WQGA 4IFKB 3UD6A 3IJ7A 1N8IA 3IGUA 4QHRA 3UXLA 1JDAA 2CZFA 1ITQA 1VD6A 5CAKA 1BEUA 3EWCA 3AHXA 3CUXA 1GVEA 1UZ1A 3B9OA 3FOKA 1V6UA 4G1KA 2DUXA 2GVGA 2C91A 4OBRA 5T91A 4QCFA 2A6LA 2WHMA 3ME3A 4JN7A 4LRTA 3WLOA 3GHRA 8TIMA 3OLGA 3RU8X 4AZ7A 5IRPA 1MYRA 3H2FA 4IUGA 4P5UA 4UTKA 2J75A 3MCOA 3W7CA 1RZMA 1YBQA 1E6SM 3NQVA 3CS2A 2HVNA 3OA5A 3CIVA 4TVUA 3ZS4A 3NM3A 4HZMA 4H7CA 3DI0A 1TO3A 3D3AA 1B57A 1X98A 4O57A 4JHOA 3QLLA 2NXIA 4V27A 4PMNA 4I7UA 4LPCA 1SW3A 4GC3A 1WX0A 1VC4A 4QRNA 4DVOA 3UCCA 3DI1A 3RLVA 4DJFD 4LBRA 1GPWA 1H60A 4LUYA 1VCFA 4AD5A 4CVUA 3GNNA 4ZEPA 4YCOA 2W27A 5CBBA 4PL1A 3M7WA 4UB9A 3SJ3A 3TN5A 1FP8A 2QPUA 6XIAA 2OGYA 1E9LA 3N14A 1OCNA 1XLFA 1JGMA 1I9CB 4Z42C 2W91A 2VX6A 1FWJC 4KCTA 3GHTA 1B54A 2XFYA 4MWAA 3CO4A 4Q8OA 3F4VA 1SMDA 4WKHA 1OHLA 4B4FA 1GJUA 2VJXA 3WEMA 1XR2A 1HKMA 3DGBA 2VP8A 2WSRA 3FLUA 3GU1A 3P67A 1JGIA 3SCWA 4HHLA 1MEIA 4LYQA 2VEPA 2HROA 1M41A 2Y61A 4C6QA 4UTJA 2YIHA 1WA3A 4JDBA 3RR4A 2ZZ3A 3W75A 4JDYA 4C6MA 1SO4A 1KXTA 4Q4PA 5C2CA 2Z6IA 4JTHA 3TTQA 3M44A 1PZ2A 1PL9A 1SZNA 3IUDA 3A3WA 2CITA 1UA7A 3EOOA 3NG3A 4UBPC 1W5MA 3EDFA 4ILSA 3MCMA 1KM0A 2IPFA 4N4QA 1SUXA 4IMFA 3VZZA 4AHPA 1UWIA 4FIQA 3NQGA 1EJSC 3CT2A 3WZ0E 1UOKA 3NQFA 3W1QA 3B4UA 4JIQA 5DT7A 3E96A 1J96A 3R43A 4INFA 2WJEA 1ZBWA 5ECUA 2UV8G 1SJBA 1OGSA 3S9IA 3WQVA 4EPKA 1H61A 3TXZA 3ARTA 2WW5A 2HBVA 5JMUA 4HBKA 3PN8A 4C6JA 1W1VA 1XKYA 1FHVA 4R33A 5F4SA 1EPVA 3WNLA 5AYXA 3VCCA 2C6QA 1G67A 2ACUA 2YB1A 4G7EA 4F2TA 3QJAA 2HPIA 3B8TA 4MYAA 4LAKA 5EU9A 1TR9A 2VGFA 3CEPA 2OWWA 1VH7A 3U2OA 3ZOAA 2OQHA 3CTTA 3LS9A 1V0MA 2ZCGA 3TE9A 3W84A 1NQKA 3DG3A 2OLHA 1QJWA 4Z08A 1YADA 4C6OA 2WM1A 2OVLA 3URBA 1SJDA 4O8RA 3AISA 3AZSA 2NUXA 1H62A 4MUZA 4EXBA 2VO5A 1A5LC 5CG0A 2E25A 3PJXA 3D46A 1VPXA 5I3DA 3W74A 4KIEA 1E5JA 3WJSA 3K46A 2PGRA 4ZOEA 1LRNA 4PMQA 2XPKA 1VZWA 4XBSA 1J93A 3C0QA 1R5YA 4A2SA 1XLKA 3B0UX 3RHGA 1I1WA 3SRFA 3LNPA 1FWBC 3RNDA 3AS1A 5A6KA 1JPKA 4FF5A 5IFTA 3UWZA 4LUSA 4OUIA 4OFCA 4A3RA 4Q8VA 4O1BA 3W25A 4KWUA 1G7UA 5F1VA 3PZMA 1BAGA 4CCEA 1IIGA 4IQJA 3CV2A 1LBMA 5A3HA 4C1NA 3HPSA 4TX8A 2E5DA 1ICQA 4C1NB 1CYGA 4KEVA 1NWUA 2XIQA 3SQLA 3NYZA 2OZTA 2DSVA 1TMQA 2EXOA 2JGYA 2PTXA 4PMZA 2CXEA 3UR8A 3FEMA 1JULA 3M4HA 4GFIA 2XZ9A 1VHCA 4H00A 4IIEA 4H8HA 4GKLA 2NXHA 3NNTA 1TPUA 2QPXA 1G5AA 2C13A 1HKWA 3WF3A 1D3CA 4A3HA 1FX6A 3M5YA 2FZ8A 1HJWA 2J77A 5DX7A 4AD4A 3S3GA 3ARRA 1U33A 1F3WA 2BVTA 5DXXA 4YVVA 1EJTC 1JZ7A 4UQCA 4LQ1A 1TPEA 1GJPA 3TIMA 7PTDA 2J13A 3AXXA 5C55A 3GSMA 1UH2A 4PN2A 4LUTB 3KTSA 3PTQA 4J40A 4H8UA 3BCDA 4RX0A 1V0NA 1KKRA 3ITGA 3EA1A 3UNTA 1SZEA 2WJZA 5K9CA 1PKYA 4IPIA 2J8FA 3VC6A 4PUUA 2QPSA 1ZBKA 4XVDA 4W8AA 1GUVA 1AG1O 1E4IA 1TE1A 2IXVA 3AMDA 4CNPA 4JYEA 2G3NA 4XZBA 3TYZA 4GVIA 1ZP4A 5M2FX 4QLJA 5U4NA 5FAGA 5I7GA 3GU2A 3QH2A 2ALRA 2XYLA 2YB4A 2YCLA 4DUXA 1CLKA 2HXUA 1YPIA 1Z89A 3P82A 3TZFA 1RA5A 3EPMA 4HK5A 2Y89A 3S83A 3CLMA 1B5TA 5D2YA 3O0FA 1AQ0A 1IGWA 2OEKA 4RXFA 2WCSA 2V5DA 1J18A 3IS4A 4QISA 4G6CA 4O19A 3UJEA 1XV8A 1EB3A 3LB0A 4F79A 4XAYA 3W1NA 4JX6A 2J4GA 5M3WA 3STGA 4NXSA 4AISA 4PMYA 5DQPA 4NJJA 2ZQ0A 4CGTA 2XSBA 1CGXA 1DE5A 2JEPA 2GLKA 1SO5A 3I3EA 3UU0A 4BK9A 1E1FA 3A22A 4Q8WA 5CPNA 3NSXA 2Q02A 5F4WA 4DJFA 1ZB5A 3BANA 4N9BA 3C2OA 4Q8QA 3QV6A 3LCLA 3VIGA 1JZ4A 5C7HA 1UKSA 2Z4GA 4OJYA 3WJXA 2VFGA 4H9UA 3L4VA 5C7VA 3NQDA 1VGAA 5FJJA 3WQWA 4V28A 4C90A 3FAXA 4HNTA 5A8NA 3IJIA 4OWGA 4W8BA 1RK6A 3LXAA 3LN3A 4HMEA 4HD5A 1Q6QA 1GQKA 2WPBA 3DFYA 3MC5A 3IARA 3BMWA 3HG2A 2QGHA 1UHVA 2VD9A 4JPGA 2NT1A 2C1HA 1AJZA 3H53A 3W1UA 4HPGA 1X1NA 4UTMA 1H0IA 4QTGA 1QPNA 1K1DA 3VNJA 2PDQA 1S5WA 2VWTA 1XIFA 5HQEA 5B7ZA 5KEZA 1GVOA 2ALDA 1W3JA 1DXIA 4WY0A 2DZVA 2X1TA 2CEQA 2JE8A 2A0NA 3QF0A 4MAZA 2I7GA 4HKPA 2C0AA 4EWJA 4F40A 5LNWA 1SR0A 3RRAA 5D8WA 4M6QA 3G6LA 2XINA 2VC7A 3IIOA 4XTDA 1K3UA 2AL1A 3OQEA 3VMOA 4D8AA 2FDSA 5F2IA 1J4EA 2W67A 2VM8A 2WHKA 2ZX9A 4K7YA 1GTHA 1O7AA 1YIXA 1E0XA 4QE4A 4AIEA 4DJED 1TJRA 4LTSA 4Q4MA 3RPMA 1L2UA 1KFKA 1WKFA 5CSUA 1O6IA 1AQMA 3RX3A 4LWWA 2D0GA 1L0PA 1Q7ZA 3PPHA 2C19A 4GXMA 3LSBA 1Q8AA 4W87A 1LP6A 4H9VA 4LB3A 4W9TA 2ZKMX 4KWOA 3VKKA 1MXSA 1OYBA 3AYRA 3OHIA 1HIZA 2QVHA 1AH3A 1K9FA 3BG3A 1B0IA 2VCAA 5GPRA 1VS1A 5DY3A 2HEJA 3KL0A 4WJ8A 2POTA 3N9KA 1OC6A 3ZWSA 3M5XA 3P0WA 2X0HA 1GEHA 3WX7A 3URQA 5ENLA 1FDZA 1TUFA 1XP3A 3OZMA 3M0HA 4MKVA 5T26A 3VK5A 4QBXA 2AMGA 4JTEA 5D33A 2V2HA 3ORWA 4OOZA 1P0NA 1HL8A 5LXEA 4O12A 2DIEA 3BO9A 3MP5A 2C7FA 3TQVA 1EBHA 1MQPA 4GNVA 4NJGA 2PLMA 2BLEA 4HNLA 3W2KA 1ONXA 2IKJA 3UXDA 2VRJA 1UD5A 1QNQA 1NOFA 1A5OC 2ZBTA 2VC9A 4ZE5A 4Q4RA 1HT6A 2VX5A 1D7KA 2Y88A 4RV8A 4AIBA 4KEUA 4PL2A 1FWAC 1SGJA 4I5UA 1QTWA 2I57A 2XJ7A 3L2IA 1BF6A 1V08A 4BI7A 3U2EA 3MUAA 3H7VA 2DVTA 1K8CA 3AIQA 1BVNP 4GCAA 2P0OA 4AX7A 1TWSA 2HJPA 1GG0A 1BSIA 3QVQA 2H8XA 3GG8A 4C1KA 3KXQA 1FWNA 4N9EA 3SY8A 4R88A 7ODCA 4Q33A 1XCFA 2YLAA 3L2MA 3PJWA 4JCMA 1W9BM 3BG9A 2V69A 3LEPA 4CN4A 3AMCA 3VGEA 3QZAA 3UQNA 3N19B 1E6RA 3W7PA 1DEDA 1XD0A 3TW9A 5GVJA 2O55A 3K8MA 2C1IA 1V4YA 3GC5A 4JTFA 2IKIA 4DWDA 2CWXA 5DY2A 5D09A 1KCKA 3WLRA 4AVNA 3WK2A 1FRBA 2A5HA 1BVZA 1C92A 4LY4A 2QJNA 2DJXA 4GQ0A 1XGZA 2QQ6A 4DF2A 1C91A 8XIAA 1A53A 3H21A 3I65A 2CBVA 1E1CB 4HPXA 1KBBA 2FH6A 2RFGA 2D24A 3GW0A 1KGXA 3DFTA 2L5HA 2VFEA 1ZGDA 3IJ8A 3AIUA 1W5NA 1TJPA 1VYSX 4UOQA 4IPNB 4F0SA 3WK1A 2WSQA 3MYOA 4DXXA 3A12A 1T8XA 3GO2A 1C3FA 3AMKA 2E4TA 1YW1A 2A2IA 3CO8A 4DO6A 2ZRWA 3MYPA 4ZOAA 3WMCA 1KGUA 3J7HA 5HR6A 3IACA 4Y90A 3WQEA 4DBEA 3EDEA 3WDJA 3F1QA 4KWVA 4L5ZA 2HSAA 5D04C 3NDZA 3PNUA 1JNDA 4DBUA 3I6EA 4AYGA 1ADOA 3BW3A 1DVJA 4US5D 1K9EA 4RK8A 3ISIX 3W02A 2PWGA 2OEMA 3BTNA 5E6ZA 4KMQA 3T55A 8XIMA 3P0XA 1BPLB 3HU7A 4LAUA 4MIMA 4GGHA 4DJDA 4HU3A 7REQB 2RDTA 3W37A 1BGGA 3P84A 3VNZA 2WK2A 4GQRA 1XBVA 3FA5A 2PDKA 3EXRA 4NRSA 1IT0A 1CBGA 2BX7A 1GVFA 4MJZA 3B0PA 4HOZA 3D6NA 6A3HA 5KITA 2INFA 1GOOA 3T05A 4CU6A 1V3IA 2JALA 4N6EA 3SZ8A 3ITYA 3H12A 4JKKA 1QHOA 3M5ZA 3TMQA 3BAWA 2QCEA 1E6ZA 2FVMA 4KKXA 3NQMA 3QV9A 1AH0A 1F3XA 3W2LA 2PE4A 3MUIA 5FF2A 1H41A 1HGWA 3M43A 1DJYA 3W7QA 1C7TA 2X30A 4JTDA 3LGDA 1K9TA 2BASA 3CUIA 3L9CA 4IPLA 2UY5A 1DIEA 3N2OA 2EG6A 5HDRA 4UMAA 5LGZA 1QWGA 4PMJA 4Z2KA 1J10A 2XH0A 3G3DA 2PDXA 4H4IA 1FH7A 1V02A 1JYNA 3N3TA 1R2TA 3KRZA 2OQYA 4Q4SA 4CNUA 4HOXA 1MDRA 1L8PA 4DJEA 4C6EA 2PZ0A 5PTDA 2J62A 1MUCA 1IXPA 3CL8A 2FPVA 1JG9A 3U5YA 4Y9AA 3EB2A 4A4AA 4LUTA 3LBOA 1BF2A 4DI9A 5DBTA 1ONRA 3C0JA 2UWFA 5AHFA 3SFKA 3PZTA 4EANA 2ISDA 4L4PA 1K9DA 3HV8A 2DW7A 4NP7A 4OE7A 1WXZA 5MHBA 3W1AA 1LORA 1O1ZA 3AIEA 4U5IA 1LDCA 3ARVA 3BLFA 1RSCA 4KIRA 5BROA 1QW8A 3ARXA 5C5YA 2V6AA 4R7JA 4RDVA 4H04A 1LQ2A 1KCLA 1UJQA 4ECLA 3HPAA 4JNYA 3P93A 4B92A 1EGMA 1HZYA 3MS8A 5M1TA 4DZ5A 5JBFA 1DWAM 4UFIA 3DEQA 3GY1A 3T6CA 5BZAA 1NSJA 4CNNA 4ICNA 5EFDA 1JFXA 3PY2A 1FCUA 3TMLA 5BXSA 3DU0A 2WKJA 4HA1A 2DP3A 4QITA 1DJXA 2P50A 2YCLB 4NKCA 3BJSA 3CV7A 1AVAA 2O7SA 2PCEA 4JL2A 1GORA 3GRIA 4E3VA 4G9PA 1E0WA 3CAQA 4O16A 1G01A 1JPHA 2VUNA 3EDKA 2V2DA 1AW5A 3DG6A 1ODZA 3UXIA 4CNOA 3ZZ1A 3NL2A 3W2MA 4XZIA 1CGWA 1F6KA 2OCZA 4L56A 1E4LA 3S8HA 4RJEA 4W7VA 5DEZA 3QW4B 5LNVA 2FPYA 3PG8A 4UNKA 3QR1A 3WG6A 5ABEA 4NNCA 4BR1A 3WMBA 1PKLA 3WF2A 3VD7A 3E0VA 5A6LA 4PRTA 2EKCA 1OIFA 3CHDA 3A47A 1T8QA 2I56A 2R14A 1PTDA 1UR4A 2C3ZA 2ZRYA 2X2GA 2HBXA 4HK6A 4PTXA 3WBEA 2GGHA 4TV5A 4BHYA 1V0LA 1ZBVA 1EGZA 1NTHA 2CHRA 3KTCA 3G3MA 4PMDA 3UT0A 2G37A 4ZFCA 5EBAA 4P7QA 2R94A 4XKMA 1S2CA 2PC8A 3L67A 5LKYA 1S2VA 3AOFA 3ZWTA 5AC7A 1NELA 4HMCA 2VX7A 3TK7A 3FFSA 4U5KA 1XBZA 1IR2A 3JS3A 1O4UA 1TTJA 3IGSA 1K8XA 1N82A 5CPQA 3YPIA 2A21A 1H7PA 4BWLA 3E2VA 2POZA 3P3BA 1J5TA 3R79A 4FXFA 2D0FA 5I06A 4LY8A 3BSGA 1UOZA 3QBUA 4AFYA 1YTDA 3M0JA 4MTVA 1KRMA 4PGLA 3AU6A 2WV8A 1EKOA 3NZPA 3PS7A 2PGWA 3NXFA 2XIIA 1BG9A 4GXPA 4W93A 2PGEA 2TMDA 2XH4A 4ZQMA 4MFEA 1S2UA 1EO7A 1LG1A 1JYXA 3CZ8A 1TMLA 1WBJA 3IJ6A 2VQUA 4UFJA 3PZQA 4YTRA 2OGJA 4UCFA 3R25A 4REQA 1TWIA 3CBWA 2QIIA 1X6UA 4FR1A 1JDEA 2O92A 4XZ9A 1D8WA 2YA0A 4WIWA 2VCCA 4NZ5A 1X39A 3BVJA 3OZYA 4TMCA 1HVQA 3GXPA 2VOTA 4QJ5B 3A24A 2QS8A 4YXGA 3I3DA 3HG3A 3AXKA 2PURA 5BW6A 3BLDA 4UTUA 2VFIA 1ADSA 3QPYA 1VBGA 3CASA 3GS6A 1QI3A 1OY0A 5TIMA 1SM9A 1UKPA 2PMQA 1PO9A 1A47A 1MEHA 3SRDA 2WCGA 5HAOA 3R2GA 4OTKA 3HGOA 4V1YA 1XYAA 5JU6A 1VEOA 2CBJA 1Z69A 1KKOA 2WHJA 1D3GA 3NOYA 1T40A 2QJHA 1WDDA 2YDQA 4Z2HA 2JQXA 2AQVA 2OFJA 1CENA 1TV2A 4OGZA 2DZBA 2Y7EA 3B8VA 4IQDA 4Q8NA 1T96A 2GQ3A 2P1FA 3WY1A 4KQNA 2G3IA 1DWHM 3V7PA 3HQNA 1TZ7A 2H3BA 1GNXA 3UGVA 1VJIA 5HQMA 3LG3A 2X41A 1SSGA 4XV0A 3GXDA 1IEVA 3KL3A 5CXPA 3H2CA 3KOWA 5GNYA 3WEZA 4AEFA 1NF7A 2KZHA 4ATWA 1Q6RA 2BOFX 1XJBA 3NL3A 1TG7A 1ZSXA 1KRCC 3W28A 5BWAA 2TRSA 2HNEA 1B31A 4XD6A 5D38A 2DV0A 3OGRA 1Q6LA 4LNCA 1HFBA 5FJIA 5I02A 3SCQA 1S3HA 4QG6A 4OKDA 4B3LA 5IM51 4ZA0A 1PWMA 1PEZA 2PDGA 4IL0A 3FYOA 1DKWA 1TA3A 1W5QA 3TYUA 1JRBA 4LF1A 3BV4A 3CL6A 4ENLA 1V3LA 5EMJA 3EWBX 3QQ0A 3ZIZA 3EWUA 4KFNA 3ZFHA 4FPSA 3S6TA 3UZYA 1PIIA 3O7UA 1TIWA 4U28A 3JR2A 3W72A 3LBCA 2R1NA 5C6MA 2BGQA 3I10A 3O0KA 4JBRA 1BYAA 2V3FA 2CLOA 2HS8A 3KVKA 3VDHA 3VOCA 1UD2A 4C60A 2DFAA 3B9EA 3GKFA 2R1MA 1B3OA 2PDYA 4HCLA 2NVAA 1TPFA 1LT8A 2JFEX 2VI0A 3IRDA 5D2VA 5TAOA 1XLIA 1VBUA 3L5MA 1OWQA 1WDPA 3SECA 1TELA 2ZUWA 3OZPA 2X1SA 4U3CA 1IXOA 4G7EB 3KE0A 4PMVA 1XIEA 4DI8A 4YS1A 4WXYA 2GVJA 2OJPA 1QOQA 3WDHA 2NQLA 1XX1A 1VJSA 3OLDA 1DIOA 3GTXA 2F6UA 3W1XA 3VKJA 1E9YB 1ZAIA 5JQ9A 2Q8ZA 2I14A 1ISYA 1GVYA 2QR6A 2C1GA 3VM5A 2QGYA 3G24A 1VFHA 2I16A 2OZ3A 2QCDB 1UR8A 3WCZA 3ARQA 1QT1A 4JNMA 3GW3A 4L9ZA 4WHBA 3IAQA 4M29A 4H9ZA 4X61A 4M80A 4K2SA 2Q6ZA 3NQ7A 4O14A 1JCLA 3NGJA 1F74A 5F2LA 3VZXA 4PTNA 5IXEA 1S1PA 1D7FA 3UPWA 3GVVA 3KRSA 1B9BA 5EMKA 2X8RA 2WSKA 4HZ7A 5AZ1A 1MXDA 1XLHA 1OYAA 3GVQA 3VIKA 1B30A 3L2LA 3ARSA 1M1BA 1TUXA 2OODA 1YBQB 4PB4A 3ABZA 3C2YA 2CU0A 2FJKA 2G3FA 4EIVA 3DYMA 4HHMA 2XG9A 4QG9A 3VIHA 4H9YA 3APTA 1RJRA 2OELA 4PSPA 2V82A 3K1GA 1MWOA 2WC3A 1EJRC 1E9IA 4FXJA 4KGJA 4BZYA 4TX9A 3D3FA 4GYKA 2PUZA 4DX3A 2J47A 4K39A 4AHOA 4AZHA 1CX9A 2ZZ7A 1KBKA 2FGBA 3V1PA 1U30A 3OG3A 1GKQA 4MY9A 4JTAA 4A35A 3TJLA 3EB3A 4B5SA 1FWTA 3OO2A 4IGNA 4M7TA 3WQOA 3L0GA 3N2TA 1N7KA 2HXTA 1TFVA 3CYJA 1CGTA 4WGXA 3CTLA 4GMEA 3GUWA 5DLCA 3Q2DA 1W54A 5HA7A 1RHCA 3FK4A 3Q67A 1B1YA 1JXKA 3UG4A 3VKBA 4I5RA 3GHUA 1GYMA 1FUYA 4JN6A 3OEXA 1UBPC 1U1HA 2WANA 4PBFA 3T2QA 3ZVHB 1BTCA 1UKQA 4MJ2A 4PFMA 1DXFA 3R5EA 3GM8A 2VMFA 5I78A 1KXHA 2WO5A 3QY6A 5EY5A 2PTDA 4IMDA 1FFRA 4LVDA 5ABTA 3H7RA 5LYRA 1ZUAX 1J2BA 4NJKA 1NIUA 3VABA 2V5CA 3H4GA 3RGTA 3HGSA 2O9TA 2QUMA 3VKAA 4MNJA 2OB3A 4NZ3A 1QBBA 3MP3A 2WQDA 4WVXA 2IS7A 1CLXA 4JIHA 5EPDA 1I75A 2IPWA 2H9AA 1ME8A 3CUJA 1KFBA 5LIWX 2X0SA 3IIXA 2OSXA 1SZRA 5FJRA 4QG8A 3S1WA 3GZ3A 2QF8A 2WZHA 2R24A 3W71A 4GABA 2A3AA 2DZAA 1KO0A 3CIXA 1EQPA 3UF9A 3PBGA 1FCBA 5HQLA 2VEIA 1KM2A 1GYLA 3CUFA 2KAUC 2E5CA 2A3LA 3RM8A 4B3ZA 1A0CA 8RUCA 1C8VA 3W7KA 1NWTA 3BGGA 4GIEA 4E38A 3GNOA 4Z1DA 3VGGA 1F76A 2JKPA 1EP3A 5LA1A 5HWNA 2V3DA 1J0KA 3CNYA 3MSGA 1OIMA 1WUEA 3IJLA 2PWVA 1E56A 3WQ5A 5HMSA 3H23A 3SSZA 1RJQA 1A5AA 4QJ3B 2ISVA 4R34A 4FZIA 2EQDA 4O4VA 4C6CA 2Y5EA 4QX4A 1JZ5A 4QDWA 4RDZA 1LCOA 1UA3A 5D30A 3GG7A 3OP2A 3ZLHA 3S2MA 3ERPA 5AB3A 2DT1A 3WO8A 2QZRA 2A7PA 1BYBA 3GXIA 2J7FA 1MZRA 4OBSA 4LF2A 5EL1A 4XVEA 3BARA 1LWJA 3U5UA 5LXXA 3AI0A 1TMHA 1M7JA 4M19A 1SJCA 2DT0A 4XAZA 3SCTA 1A50A 1W1IE 3TLQA 4C6KA 2UBPC 4OECA 3PNZA 2BY3A 1EC9A 4YJ5A 2WVSA 2VT0A 1S38A 2VKZG 2DVXA 4ZR8A 3NQ8A 1EJVC 2FJUB 1UR0A 2QHAA 4XX6A 1QI4A 3CB3A 4MPKA 5A1AA 4KPLA 1NH6A 1O1HA 3SY5A 4US5A 3TJ4A 8A3HA 4EPEC 3W1RA 4P8VA 3WLPA 5FF4A 1JCYA 3EOUA 3G1FA 3QXBA 4RDYA 4Q6XA 4A22A 1VFFA 5AC5A 1XS2A 3NQEA 4GZJA 3RX2A 3RITA 4D6EA 1JF6A 4D71A 1T41A 5E9XA 3LX9A 5D2XA 2PDLA 3KBMA 3G18A 5M03A 2INEA 3TXVA 1FWIC 2ZUTA 2Z2AA 4NF7A 4FLOA 1S5VA 2FGLA 1JEZA 4HU4A 3W85A 5FEXA 4LCQA 2DZXA 3S2LA 1AL8A 1OINA 1V7AA 4H9TA 1VFMA 3PAOA 3AMGA 3WNOA 1R3QA 1KBLA 1DORA 4P8WA 3VCNA 4ZQNA 3PSWA 3QPZA 3P6LA 2YL8A 4HSOA 3T8LA 4GI9A 5K7JA 5XIMA 2Z7GA 3N04A 1X97A 4AZ6A 3EDJA 4UFLA 3N6JA 3LV5A 3WDQA 1QBAA 2QMKA 1OD0A 1JUKA 5IDZA 4PCPA 2NLIA 1K70A 3ATZA 1FOBA 3CM4A 1UWUA 4EF9A 1OG0A 2X05A 3DDMA 3FHAA 4UZSA 3I3BA 2JGQA 1FWEC 2P10A 2WJFA 4HHHA 4PMXA 4DF0A 1QK0A 3V5CA 2F6KA 1EUNA 2MNRA 1Y5WA 1X8CA 1V77A 1PSCA 5CC6A 2NQHA 1E4NA 4BA0A 4EP8C 3EEGA 5TQLA 4UIOA 5A8GA 1KXQA 1DQXA 3C4UA 1SO6A 2A7RA 2XFRA 3DENA 3PG9A 2WKGA 4ACYA 5ABFA 3PBUA 1P6CA 3U6WA 4ERAA 5DCBA 3F4NA 3KEHA 1VRDA 4J4KA 1FCVA 1DQUA 3QRHA 3GVRA 2BXVA 5I5RA 3OOQA 3THDA 4GX8A 2BWGA 4ERIA 6ALDA 2BGSA 2J9XA 4W5ZA 5FD0A 2QV4A 1ONEA 3SN0A 3RF9A 1SW0A 2ABBA 1KTBA 4OVXA 1E51A 3CV1A 2EKGA 1L9WA 3E2QA 1EX5A 1TJ2A 1IGSA 1R9ZA 4ES4A 2Z1XA 2AGTA 4WDUA 4FA3A 4PA8A 2INZA 3VGBA 1GOMA 4ZB0A 5HPOA 1Z44A 5FOOA 4JGDA 3S9YA 3AYTA 5TD4A 3TYAA 2WC4A 4FX8A 4B9YA 2W4XA 2RDUA 2WMIA 5DMLA 4BS0A 2J8GA 2BHYA 4RKAA 4X3ZA 4W8LA 3RPTA 4XD5A 3UWUA 4XBJA 3WH7A 3KCLA 3WUGA 4FF7A 3VDCA 4AZBA 4C6NA 3M0IA 2CIPA 3FAWA 1ADDA 2BY1A 2ZA3A 5A2CA 4EK7A 2OXNA 3A21A 3EX2A 5HNRA 3RK8A 3QN3A 2ATMA 4A05A 2PAJA 4GQBA 4AMCA 3GXNA 4ZVJA 1QASA 4NILA 4W5UA 1Q45A 4PULA 5CC5A 1HKVA 4IX0A 1GVSA 1GQJA 3MKKA 3TN3A 3B8IA 2PODA 4GIRA 3THCA 3QMRA 4H8NA 4KERA 2AL2B 2WVVB 5CZ0A 3VNIA 3NZQA 2X7VA 3EPNA 3PP7A 4LC6A 1XBXA 5HJYA 1C9DA 3REQB 1I60A 2ACSA 1YX1A 3WUEA 3AUOA 3GAYA 2H3DA 1KA9F 2D0HA 2EBNA 1AK5A 1ZQ5A 4AXNA 3L65A 3QY7A 4UR9A 1I45A 4OIFA 3QY8A 3C61A 4E5TA 1FH9A 3L0KA 2IQTA 1OFPA 4JTIA 4E6MA 3PM6A 1I2NA 1R3WA 4YTQA 2DSWA 2G41A 1LT7A 3R8GA 3U3HA 2NV1A 3ARZA 3FN9A 1FH8A 1XRTA 3G2GA 2FKPA 1VFSA 3CMGA 4A3YA 4DB7A 4IPJA 4PRWA 2PP3A 3GC2A 4O4WA 3WELA 3Q94A 4GXWA 3CHEA 3MSRA 3NZGA 5FEZA 2CZDA 3RCNA 4S38A 1ESWA 5CH9A 3Q37A 1ICPA 1KWGA 4MADA 5AYIA 1HP5A 3N9SA 1MQQA 3OODA 1JZ8A 1JIBA 2FVKA 3AZRA 4QNEA 1QNRA 4ZSTA 1VKFA 3O1NA 3TWBA 1KBJA 4AZ5A 4IJCA 3E0IA 1LQ0A 2ZTKA 3NR0A 2Z27A 3BWWA 3LHZA 2ADAA 3N73A 2OYMA 3PC0A 3H24A 3NQAA 4MMWA 3W73A 4BF5A 1OCBA 2E09A 1EJXC 3WF0A 3OYXA 5IHSA 2B7QA 3GDLA 4O0QA 1LM1A 3EGJA 4H9MA 2R91A 3KVMA 4KCUA 2OYKA 2DH2A 1HKJA 2DUAA 1JQXA 3ENLA 5C9WA 4G2DA 2XH7A 3W2NA 3WLTA 1EYWA 2V5LA 3BCFA 3THAA 1H09A 1GZ1A 1ENUA 5G4EA 4TVDA 2AMXA 4AC1X 6TAAA 1M6JA 1Q63A 4CU8A 1UH4A 2X42A 5DFAA 4J9JA 5D8ZA 3CQIA 5D9PA 2WWDA 3GDRA 3IIVA 1JDCA 1SYTA 2J27A 5E0CA 1MQRA 3DESA 5G1TA 1EYEA 2ZZ4A 3MANA 4Y9PA 4POCA 4B5NA 1REQA 3T2PA 3S0CA 3ES7A 1XUUA 2HRWA 3KVLA 4GC4A 3BG5A 3BE7A 4IMCA 5GJNA 3K4WA 4PC8A 2XZ7A 4X9SA 3XISA 1VJZA 3DYPA 3CZKA 1QVBA 3MT1A 4MWAB 3HPZA 1Q4WA 3SUWA 4IQEA 4ZL1A 1QXLA 2YPIA 3SY1A 3VX1A 4GVHA 4KESA 5JH2A 1YXCA 3NGFA 1SU5A 1UMLA 1PWLA 3GDKA 3WDIA 2XM1A 3VI2A 2XIOA 4KEZA 1UW9A 1DL3A 4RW3A 4FLQA 3RU6A 1Z6KA 2ZXBA 3UPBA 3DN5A 1LJYA 1XQLA 3BAYA 3ZT7A 3EMCA 1QMLA 1GPFA 2PDFA 3B8DA 4LS0A 1HTIA 1BRLB 4DUWA 4RZ4A 4CNTA 4WJXA 3WJZA 1KXVA 5BMWA 5I6SA 1PS9A 2PBGA 1MXGA 3QGKC 1W1ZA 3B06A 4H2HA 4XAGA 3S6OA 1H49A 3PUEA 1WP6A 4D72A 3UG5A 1GVIA 3H22A 2BFGA 4AU0A 2CWNA 2Y7GA 4LX4A 1LQAA 2ZDSA 5FSDC 3WBXA 4JHZA 2NQZA 2ZTJA 3H26A 4RW5A 3U7VA 1XFCA 3F4CA 3WLJA 3GD6A 2ZVRA 4O53A 2NVCA 1GJWA 4IXHA 1LL4A 2X1RA 4RR4A 1I8JA 4I9AA 4WOQA 1TX2A 3LENA 2EPHA 1JXJA 2CYGA 1AD1A 5C70A 5I77A 3V0TA 1BLIA 1W9DM 1OFEA 5F2MA 1B3ZA 4GX9A 3KP1A 3L4XA 3HTWA 1DJIA 4GOAA 1CB2A 4L64A 4WR3A 4UTIA 5C9ZA 4O17A 2GJRA 3XIMA 3M16A 4WCJA 4P7NA 1IZKA 2XVLA 3GLCA 4UR7A 1EP2A 5E5CA 4PUNA 1B3WA 1EUAA 1UZDA 2FLIA 3H7UA 2PDCA 1CNVA 5LNSA 2AAMA 4FMVA 3E5PA 2VVSA 3WDPP 2EAWA 4P8XA 4MB5A 3BOXA 3SRKA 3VMNA 4Z2JA 4JEQA 4QDPA 5E0KA 3W01A 5LIYX 4GBDA 4XAPA 1JD9A 1ISWA 1WAUA 3ARUA 4C7FA 2J78A 4AD3A 4BI5A 4S3JA 3EA3A 3UR5A 4IIHA 5CC7A 3P8IA 2F2KA 4UNLA 4J27A 1EWDA 2V0TA 3VOGA 4C6BA 4LEFA 3IIZA 2B7NA 4S3AA 3DKJA 2EG7A 3BK0A 4EX4A 4H7VA 2V30A 5AY7A 1O60A 5HK4A 3TC7A 1MMFA 4Z0SA 4DZIA 4PH6A 1A5UA 4AQLA 1VFLA 5JXQA 3S2NA 2WZEA 1JAEA 2R1KA 3B3DA 3F7JA 2PFHA 2QVNA 4ZOBA 3O16A 2X40A 4R85A 3AFBA 3S5YA 1PX3A 1VLWA 3PK7A 4F0LA 4GZ7A 3AIWA 1YTKA 4B5WA 3JZEA 4JX5A 1DTUA 2OWXA 1V0KA 1HNYA 3SDOA 4NI8A 1XLMA 2XN0A 3LSCA 4WKAA 4WDXA 2PTYA 4K7VA 5HPCA 1IT8A 3RMJA 5C9XA 1AW2A 1WPCA 4MVAA 1XIGA 3EMZA 3SO7A 2VTFA 3RDKA 3WYZA 4IH3A 4HCHA 2V3EA 2H6RA 2OZ0A 3T8QA 3ZSTA 4MB1A 3VIMA 2VFDA 5CEWA 4Q8TA 4BQ2A 1E71M 1A5CA 5JIPA 2BVDA 3H54A 3NZRA 3P81A 1LWHA 1MNZA 2EPKX 4H01A 3LCWA 4QNWA 3K2GA 1QHZA 5KTLA 4MY8A 3U0HA 3OHMB 2Z00A 5XIAA 4I6KA 3R8RA 2VFHA 3LTSA 2HVOA 1PDZA 2ZX8A 3T78A 3G1HA 1Y65A 2PDBA 2GK1B 5AN7A 3Q65A 1BD0A 1K02A 4ACZA 3EWZA 3CWOX 5HWMA 2F8QA 3GWQA 4B3KA 2QNEA 3JRKA 1BQCA 1K8YA 3GYEA 2XFFA 3L23A 4JY8A 3BL3A 2ZRVA 2BG5A 4JHMA 4IQLA 7XIMA 3P80A 1B3YA 2BY2A 1KV8A 4ORIA 3WIJA 5AZ0A 1XPYA 2YX0A 2QIWA 2HDJA 4AZGA 1CGVA 1EZWA 5FJTA 3NWRA 1CEOA 1TA3B 3CZLA 1XGDA 3ZXWA 1UG6A 1WCGA 4WDTA 4LUIA 2QULA 1Q66A 4GACA 1P7TA 1HJUA 2YW3A 1OK4A 3WFAA 1UZHA 2YBUA 9XIMA 1BQGA 3QV7A 1EDGA 3TUUA 4O13A 5CSRA 3W38A 1ISXA 3CU2A 1EOKA 4GISA 2FQIA 3CB8A 4JTLA 2ISWA 3NPVA 4WDWA 4BFAA 4J1OA 4NASA 4LS1A 4DAFA 1JRCA 1P0DA 1WDRA 2GUYA 1UQZA 2YDSA 4NUWA 3DFQA 3QOKA 1UWTA 4ZQCA 1FWGC 1PB0A 3L7RA 3BGJA 1WZAA 1H50A 1OQFA 4CQAA 1NDZA 2ZUNA 4O1DA 1BWKA 4NY2A 3PUGA 4UMBA 4UOJA 1QPOA 4ZENA 2D2HA 4NRRA 4PODA 4P61A 4L9XA 3CC1A 4NYUA 2E67A 1F8MA 1FBAA 1ME9A 3PUOA 3TZNA 2WNQA 5BYWA 4AB4A 1TQJA 1JNEA 4LSBA 2WPGA 5BXRA 4ZZ9A 1MW2A 4GBUA 2ZUVA 1CXLA 2QW5A 3QYQA 3TEVA 4MM1A 3PTDA 2IKGA 2YYUA 4KF1A 4D6IA 3IEBA 1TPH1 1OVDA 3A5VA 4JY9A 3V4BA 1R85A 4BJHA 2OSYA 4MLRA 2EPOA 2E40A 1KFWA 1W2VA 3E2RA 2Z2UA 4GGBA 4JCLA 4LBSA 4NZCA 3G5EA 2YBTA 3Q4DA 3LI1A 1A5BA 3EYPA 1TWDA 2NLYA 3DERA 4Q4OA 4HCDA 1V6TA 4WQ6A 3VE7A 4J3VA 3NPUA 2FGZA 1W3LA 3TQ0A 4GFSA 2E8ZA 1LWIA 4GRSA 4UQAA 5DANA 1YTEA 2E77A 1C90A 1SFLA 3HBLA 4LGXA 2NSXA 2YDRA 1XLBA 4PUDA 1FY6A 2W6RA 4O54A 1PYFA 2Y8UA 4LFYA 3LTPA 1MUWA 4YPJA 4JIIX 3S2CA 5CJMA 4NAFB 4EVZA 1XYFA 1IXNA 4GA8A 2WMKA 2C0HA 4OZOA 4M8UA 2YCIX 3KOXA 3VIIA 1OG6A 3W22A 2FFCA 2O7QA 1EH9A 2J7HA 3MI3A 1VQTA 2IPJA 3GH4A 1Y5VA 3L4ZA 5GQBA 3ARPA 1J0ZA 3V16A 3WUBA 3ZLGA 3TYDA 2DPEA 3R0KA 5BRQA 2HK1A 1GOWA 1VYRA 2ZDRA 3TN6A 3T09A 4K6AA 4E0CA 3TROA 1RQBA 4NJHA 2PCQA 3BPWA 5TNVA 4OHQA 4K68A 1H5VA 5G4HC 5LHEA 2VYOA 2GSEA 4NYYA 3ZT5A 3OYZA 1YEYA 3GTNA 2FZBA 4NNAA 3TLLA 4W4QA 2CZEA 4BCEA 5CSYA 4JS3A 1E70M 3VD3A 3VDAA 1GHSA 1O5XA 6TIMA 4GI8A 3C8FA 3HQOA 2GSHA 4H6RA 3VOFA 4MNKA 3LM3A 4QP0A 3UNDA 1A5MC 3BLLA 9RUBA 4NVTA 4GO8A 2GZXA 3MP4A 4HYVA 3AROA 4FX6M 3CQHA 4LW7A 4XQ6A 1MSSA 2BB0A 2BY0A 4CQBA 4JTRA 5D4YA 3AYSA 1YNPA 2CLKA 1OEPA 4FP1A 4JL1A 2QMJA 3ZVIA 1Q13A 4N9DA 4RNFA 1KTNA 5CZKA 4BEQA 1LG2A 4QFUA 1RCXB 4F4RA 1C29A 4D6JA 3G1XA 1ISVA 4UTLA 3JW7A 4XSLA 3THQA 3TTEA 3QGVA 4HPNA 4QSFA 3OQ8A 4URIA 1Z41A 2CLFA 2OMAA 4HSNA 5K4XA 1SFTA 1JCNA 1WNOA 5F4XA 5A2AA 2J6XA 3GZAA 1IWAA 4ZCWA 3BUVA 4IFOA 3WBAA 2D20A 3IJDA 4M56A 5XINA 4DRSA 1JZ3A 3FDKA 2PD9A 4Q7IA 4NZFA 4IFKA 1P5BA 2GJPA 1YPFA 1HG3A 4M24A 1VBJA 3P2VA 4B5TA 4O15A 3ATYA 3I7SA 1YDOA 3UW6A 1DBTA 3TTOA 1XCXA 1QRQA 3N6QA 4LVGA 2C15A 4ZBCA 4Y9MA 4KRZA 1AODA 2OOGA 1WDWA 4QCEA 2BOEX 3W70A 2RAGA 1YNYA 2J8TA 4J5NA 1UD3A 2Z1SA 2R9RA 3VOIA 3AXHA 4OUEA 5BRBA 1KD0A 1WB0A 2FFIA 1JZ2A 3UJ2A 1XBYA 1YRRA 4HTBA