6PTDA

Phosphatidylinositol-specific phospholipase c mutant h32l
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTLDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 98
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 6ptdA00
4RW3A 2PZ0A 3CH0A 2F9RA 3QR0A 3PTDA 4QJ3B 4R7OA 2PLCA 1T6MA 3H4WA 1DJYA 3EA1A 4S3GA 3H4XA 5PTDA 3EA2A 1QASA 3I10A 4OECA 4F2UA 1AODA 1DJZA 4I9TA 5T9CE 4F2TA 3V18A 1DJWA 2OR2A 4PTDA 4Q6XA 2ISDA 4I9MA 2O55A 4I9JA 5T91A 4F2BA 3EA3A 4QJ5B 7PTDA 4QJ4B 3MZ2A 2PTDA 6PTDA 3KS6A 5T9BG 4RV3A 1VD6A 3V16A 3QR1A 1YDYA 3L12A 2OTDA 1O1ZA 1GYMA 1T8QA 2OOGA 1PTDA 2P76A 3RLGA 1DJHA 1DJGA 1DJXA 1DJIA 4GNKB 4I8YA 3RLHA 1V8EA 3QVQA 2ZKMX 4RW5A 3V1HA 4I90A 3NO3A 1XX1A 2FJUB 1PTGA 1ZCCA 1QATA 3OHMB 3KS5A
chains in the Genus database with same CATH superfamily
1LQAA 2YPIA 1NFBA 3N3TA 4A4AA 1M7XA 3LPFA 3AFBA 4YWIA 4YYCA 5IHSA 4B92A 5CZKA 1A5KC 1EWDA 1JIBA 5A8MA 4B5VA 2EPMX 2CETA 1FHDA 4JBRA 5CCZA 3UWYA 3SY8A 3H22A 5CC3A 4K8GA 2C7FA 1GVSA 1CB2A 5H8MA 4WK9A 3B8DA 5FL1A 1TPDA 1J8VA 2BVYA 3BWWA 4CNNA 1MUCA 3UR8A 2E3ZA 4YIWA 3WMLA 1TVLA 4WDTA 2FZNA 2ASHA 3DFOA 1OADA 3ANYA 3PTMA 1XH2A 4ZGYA 3B4UA 2PTWA 1TA3A 1UASA 4UOZA 3APGA 1XM3A 2DY3A 2PGWA 2ZTJA 3WK2A 1J0IA 1EH9A 1HP4A 4PTMA 2JEQA 1XG4A 2YXXA 4KERA 3SCOA 2J7EA 1ITCA 3GR4A 4HZ6A 3NA8A 2OWXA 4YHEA 4YVXA 4PC8A 5LNUA 1OC5A 2UY4A 4AY7A 3C2FA 2PDKA 3W6MA 3HURA 1LM1A 4Z2LA 2GUUA 4GJJA 4R7WA 3IVTA 5D9OA 3FJ6A 1TPWA 4PB4A 3VIOA 1E4MM 5GJNA 3TR2A 3U8GA 3HB9A 4QSHA 5E0CA 3LBCA 2R1LA 4CN6A 2DUZA 4MJ4A 1J96A 5J5RA 1HO1A 1BQCA 4O19A 4WSKA 1VYPX 2IQ0A 3OQEA 2POZA 1NDZA 1LLWA 3Q2DA 3WDQA 3P2VA 5C7HA 3SCNA 3IRDA 1BEUA 1NOFA 1QWGA 2FZ8A 3EOLA 4W85A 2FTPA 4K68A 2DZVA 2Y88A 4CNTA 1UD6A 4JFTA 4NI3A 3LLDA 4CU7A 4LC8A 3FV9A 3PP7A 2DIJA 1SO3A 4WDWA 1R3VA 1QU4A 4I6VA 1ZHAA 2INZA 4JYFA 5FEPA 4TX6A 4KFOA 1VENA 4C1LA 1H7XA 3QY7A 3VOFA 2DSWA 1ZJHA 4HMCA 3U4AA 2XM2A 3SBFA 3KCOA 4FXFA 3DDMA 4LVDA 4O8AA 1K02A 1Q85A 4PFMA 5D2YA 3FA3A 1M65A 3GDTA 4MNLA 2PTYA 2HS8A 3F5KA 1MQRA 2V5KA 2YCIX 5LGZA 4DI8A 2PSNA 3NQ6A 3NDYA 1QT1A 1H41A 2EGZA 1LF1A 4O0QA 4RE4A 3V0TA 2PLCA 3E96A 1ADDA 4RX0A 1V3LA 3QYQA 2HPMA 1OF6A 4AIBA 3BXWA 3R8RA 3K8KA 2PWVA 3PB0A 1XH1A 3I10A 4GXWA 3S6TA 3MMTA 3IJLA 4RE3A 4ERGA 3GG0A 4JFUA 4CNUA 3AHZA 1SO6A 2P88A 1BG4A 5G4EA 2OOFA 1B57A 4AZ6A 3LHWA 1KM2A 1OQFA 3E6EA 3W7EA 3W73A 3K8LA 5E6ZA 1Q8AA 4GLEA 2PDCA 1JGIA 4KWSA 4LXFA 2FDMA 1JZ6A 3VAVA 1XGDA 5LA1A 1F3TA 3T0CA 3OOQA 1SZNA 2CKRA 4JXCA 5GNXA 1NF0A 1X6NA 1SYTA 4TVCA 1EYWA 4I90A 4BI6A 5U7SA 1UWQA 5A8PA 3BZJA 1JXJA 1V02A 1KBIA 4KRTA 1N2VA 2YBUA 1UR2A 3SY1A 1AA1B 5LXEA 4ZQOA 5D9NA 3PWIA 1LWHA 1BQGA 2F9RA 2FZMA 2PGEA 4MFDA 5F2IA 3HV9A 2Q71A 3WDHA 1OCJA 4JTTA 4XD4A 3SIMA 3BMXA 3I68A 3N25A 4FX7A 3DYMA 1NM9A 4EVZA 2R24A 3AJXA 4QNEA 1GHRA 2ZWZA 2YBTA 1W3KA 3VO0A 4EPKA 5JIPA 1H4PA 1JGMA 1K6WA 3RM9A 4CQ8A 5F2MA 2E5DA 2WV8A 1PDYA 2Z24A 3IJIA 1XLMA 1ZNNA 1OT2A 2D69A 2OGYA 3CWHA 3PPHA 3BAKA 3GHUA 4L5ZA 4M1RA 4DWSD 3WLPA 4AW7A 4GK8A 2GJLA 4AZCB 1V93A 4N6EA 1MUMA 4RE0A 2NQLA 3AHTA 4U33A 4QROA 1V7YA 2PI6A 2ZFAA 2CXEA 4C6EA 3EEZA 2ZX6A 3QR1A 4QIUA 3W1PA 3GXIA 2PPGA 1UMLA 5D09A 3QPEA 1EPXA 1XSIA 4GRSA 4EPBC 1XSJA 1VPYA 1QUMA 4ECLA 3VINA 3PZUA 1TPUA 3EAUA 2NQ5A 5H8PA 3F2CA 3BICA 1IWPA 1OYAA 3HTWA 3KBWA 2BODX 4KRUA 2ZIDA 1DOSA 1Z44A 3W86A 2W66A 3LNMA 4RW3A 1DVJA 1U5JA 1A5SA 4NUWA 4H9VA 4U2ZA 3E5BA 4XTIA 2GVGA 3WD3A 1N8WA 2O4QA 2IUZA 3IARA 2ZRVA 1RQBA 2D2OA 4Y9OA 3S9YA 3S2CA 3TCSA 2C6QA 3NQVA 1BWKA 3PZVA 2CBVA 5FCZA 4M81A 4PBGA 4UTWA 4AHOA 4L1XA 1WAUA 4XZMX 3W38A 3IIZA 4ACZB 2B7NA 3SADA 3VZYA 1GGOA 3NQFA 4WKAA 1TPC1 1S2AA 3SO7A 1OX5A 2X7VA 4ZQNA 3LNPA 2ZA1A 3KTCA 3EKLA 2FYMA 1F3WA 2Z6JA 1F4AA 4HZ8A 3ARQA 3DHFA 3P7YA 2X30A 1WDDA 1VFUA 3WF4A 4LALA 1WNOA 3GNPA 1B3WA 4DAIA 1BYBA 3DU0A 4MJZA 2JKEA 3NQDA 4Z0SA 4US6A 3MKCA 1W31A 5AC4A 3CIWA 3EDJA 1JZ5A 1L8NA 4IGSA 1LZOA 3W81A 3QV7A 3AS2A 1G94A 1XKJA 1E9YB 4CD4A 1UR0A 3V1PA 3TC7A 4IJCA 3BLPX 3VOHA 4K1WA 4NJIA 3VGEA 3AZSA 4H7CA 4KIEA 2V2CA 4KWOA 1M9HA 4S3EA 4S3CA 3N6HA 4PCTA 2PC4A 1QBBA 5I77A 3W01A 4I6KA 3JS3A 1JVNA 5JH1A 3PBYA 2NX1A 2OYLA 1XIBA 3T55A 1H2JA 1E40A 4XK2A 3RXZA 4AWSA 1TMHA 4MG4A 2E1DA 4X2PA 2V8ZA 5FF4A 4JTRA 1VFHA 3B8WA 5AECA 2R91A 2I7GA 3V75A 4F8XA 2W91A 1V3IA 3VPLA 2GDUA 3M0HA 2VOMA 3F2DA 3NWRA 2WB5A 3BLDA 3RFAA 4IJBA 1DE5A 4O0KA 2GWGA 2XSBA 4FOKA 1KM0A 1KNWA 2RDUA 4LAMA 3EB4A 3H7VA 3O05A 3UA4A 2H90A 1VCVA 1BXNA 1GVRA 4Z1CA 4M29A 3TYEA 1GYMA 2QUTA 2YL9A 1FWTA 5BYWA 3O63A 1JFHA 4TO8A 3TDFA 2NXIA 4U5IA 1LUCB 2HNEA 3G0UA 4LQ1A 1F8IA 3ZIZA 1C8XA 5JU6A 4N9DA 4B4FA 1SPQA 3PN8A 3SRFA 2Z1XA 3NIYA 3T2QA 1N8FA 3WLHA 4C6OA 3TYZA 4B15A 1XV8A 2KZHA 2Z4GA 3H2NA 1VPXA 1TELA 4CCCA 1XLKA 3IJ6A 4PTVA 5E0FA 1N82A 1XKYA 3BARA 3QR0A 4QJ3B 3W2LA 2BXYA 1Q2SA 1T41A 4G56A 1TTPA 3P84A 1XPGA 1NDYA 3AWOA 1PCWA 1R87A 3P3BA 3KBVA 1UWSA 4GVGA 3RYSA 4XZIA 4ADSA 5AHIA 3NFUA 4NX0A 1UZDA 3MZNA 1OFQA 7REQB 1DJWA 4EF9A 1LL7A 3L5MA 3QQ0A 4I9MA 1KGUA 3DFYA 4YNGA 3KTSA 3U57A 3S5YA 3CH9A 3S1VA 2XTKA 3B0VC 5I3JA 3TW9A 3M6DA 4LV9A 4N7QA 1OK4A 3U2CA 4RXFA 5DMYA 4FNUA 4BK9A 4O18A 4H9XA 2XIMA 3NPWA 2G50A 2H9AB 3N15A 4XISA 4MZYA 1TJPA 3PJWA 4AFYA 1P0NA 3L66A 4HJWA 1GTHA 5HINA 4GNKB 2VELA 1J11A 4J2PA 1XJBA 1XDMA 4H04A 5M17A 1EJUC 2A21A 2VC7A 3M5ZA 3OVPA 4JIQA 3FYOA 3TUUA 1IEQA 1P6WA 4NJJA 3D5HA 4PSRA 1R8LA 2YW4A 1KXQA 3LCIA 3S2NA 4GQ0A 3RRAA 1JRCA 1UP0A 1FWDC 1F3XA 1AL7A 1YW1A 3WK0A 1W9DM 3F2BA 5I3KA 6ALDA 5E6YA 3BW3A 3WMCA 3VKDA 1XC4A 3WK1A 1BFNA 4DYJA 4ACZA 3D3AA 4CVUA 3ECQA 1X6UA 3LN3A 3ZMRA 3QR3A 3EDDA 3A3HA 2VRJA 1EDQA 5GJPA 5C6MA 2V0TA 3URQA 5M5DA 1JL8A 4KBXA 2J8FA 5KMYA 3NTYA 3VVGA 3TE9A 4GZJA 1HFBA 2AGTA 2F2KA 4JIIX 4JY8A 1KM6A 4G6CA 4X2RA 3ZSSA 4XKYB 1VC4A 3CV7A 1IE7C 3PY2A 1EX1A 2EJ1A 1Y65A 4NHVA 2F6KA 1LOLA 3P6LA 3VM7A 1XRVA 3WFLA 5HQMA 2UV8G 1ZJBA 4O15A 2YIHA 1QHZA 1RVGA 3PM6A 1WOAA 4AZIA 3NSXA 1XYFA 3W2JA 5BU9A 1F73A 2QXWA 3RO8A 4GMEA 3FAXA 5BOFA 4H8NA 4NP7A 3TQVA 2QDHA 2BG5A 2CESA 1D2KA 1G67A 4HNNA 2GL5A 3W22A 1WXZA 1VFSA 3SDOA 1J79A 1O60A 3VDHA 3NSMA 3VD7A 2FDSA 3WQGA 3CS2A 3A4WA 4B2DA 5G1TA 3KHDA 4QNWA 2JK2A 3IAPA 1KTCA 3N2MA 1QPQA 2WPGA 4XZ9A 4L4PA 2Y85A 1XIJA 1B9ZA 4GFSA 3UG3A 3QHOA 3TKFA 4HOZA 3NPUA 1CPUA 2OO6A 4DI9A 1W1A1 4AIUA 2BFGA 2VZVA 1L2QA 2QJMA 4XAFA 2CLOA 1WZAA 3KCLA 3P67A 4GI6A 2HE8A 3KS6A 3NUKA 4X0VA 1LUCA 2ZX8A 2QMJA 4CN1A 3GUWA 3ICJA 3JW7A 4NXSA 4HA4A 1I2OA 2ZXDA 4A3QA 3CAVA 2ZOXA 1WQ5A 1JFXA 4E38A 2PFHA 1AZ1A 2YZRA 1UIOA 1I0BA 3WF3A 1ZSXA 1Z89A 3DENA 4JTEA 4W9TA 4PCPA 3M0JA 4WOZA 2QZRA 1MW3A 3TQPA 1C7SA 3NGFA 4IH3A 4OQVA 4P61A 1XLIA 1ZBVA 3RO6A 1VFMA 3CH0A 1W3HA 3DZ1A 7TAAA 2Y63A 4TV6A 4FP1A 4R7OA 1TR9A 1S2TA 2VWSA 5I09A 2RUSA 4Z42C 4DJDA 1OD8A 2HVOA 1S3TC 7REQA 3W1UA 3U6WA 4YTUA 1UC5A 2NUWA 4NQ1A 4A21A 2ACUA 4M3PA 2PGRA 3A5FA 3BAXA 1ELSA 3MVIA 1R9YA 3AZRA 3E9AA 4GUJA 3QF0A 1I1WA 8XIAA 3GDMA 4Q6XA 1XLHA 1AG1O 2WNZA 4MKVA 3VDCA 1Z7AA 4HPNA 4UTTA 3JUGA 3S1WA 1W1PA 5HJLA 5IOBA 5IBXA 2VFGA 1YXYA 4ICNA 1EC8A 4ADUA 3DGBA 3S1GA 4UQ9A 3SQSA 3TWAA 1BYCA 3H26A 4PUKA 1KW1A 1JZ7A 2FVKA 4LX4A 4PUWA 3HG4A 4U5KA 2WLZA 3GNOA 2NX3A 4C6QA 2XGBA 4AU0A 5AB3A 2ZYFA 1CXFA 5CAHA 1GVQA 4UR7A 4ROPA 1V79A 4XUGA 2C18A 2VUYA 2OFJA 1QAPA 3IWPA 3WUFA 2VT0A 3AIWA 3SRKA 4XSMA 1LYXA 1I8JA 3ARVA 2PDUA 1GVIA 3BPWA 2ZDRA 3DKJA 4LTSA 4Y8FA 2ZVIA 3URBA 2J7FA 1WZKA 3WLMA 2GK1B 2WJFA 4LF2A 1BF2A 2Q8XA 5REQB 4UQBA 4D6JA 1HJUA 5B7YA 4IGNA 3IJDA 4WCJA 1KLYA 2Z1WA 3CT7A 5SWUA 4KEZA 1LOQA 2TAAA 1T5AA 2QF8A 5F2GA 4GYKA 2EHHA 1VYRA 4CCDA 5HDRA 4XKYA 3NDOA 4M56A 1KR0A 1I4NA 1L9WA 1MW0A 3B0PA 1RK6A 3OPSA 3MDWA 4KRZA 3TOYA 4WQ6A 3NPVA 1JNDA 1KLZA 4L64A 5F4XA 3HF3A 3UETA 3SECA 1NP0A 4DZAA 3TLQA 4FEZA 4JHMA 3CHEA 3MWCA 3EWUA 4DJEC 1LG1A 1SO5A 3CHVA 2BP1A 3PVFA 2HNHA 3Q4DA 3FEQA 1RD5A 4YVPA 1S2WA 4HOWA 4J3SA 4MNJA 3C52A 4H8VA 2PB1A 4QAWA 1A0CA 3AMLA 1JYNA 4EP8C 4D6IA 2AL2B 3GD6A 2CZEA 3LQLA 4O4VA 3T78A 4IQEA 1AJ2A 3LPGA 4IMAA 3T0BA 3W76A 1KV8A 3N4AA 2YCLA 3CQ0A 1I45A 3VABA 2BDQA 5HR6A 1GTEA 2J9XA 2TMDA 5JH2A 3LSBA 4GXMA 3PNUA 3H2EA 2DQXA 4IOTA 1S1RA 1DQXA 4J5NA 3W7CA 3GSMA 3LHYA 1C8QA 2F84A 3B0YA 1R3TA 3XINA 1LWIA 3BSMA 4IMEA 1A4MA 2PDIA 2VEIA 2VM8A 5DBTA 4W84A 4Z1YA 4I5XA 2GQAA 3XISA 3UG4A 2ICSA 1FOBA 3VIMA 4FX8A 4XD3A 4MTVA 2E8YA 3ALGA 1OZMA 2INEA 4PE8A 4B91A 1YEYA 2FFCA 5A2AA 3QHNA 2X40A 3WLRA 1IZCA 3TMQA 2WNNA 3GXTA 1KQZA 1LJYA 3CLWA 5AC7A 3A47A 4O54A 2Y2WA 4QS5A 2BOFX 4RNIA 2I5QA 1QI3A 2JQXA 3M9YA 2E67A 2V63A 1FRBA 1PXGA 3UXDA 3BO9A 3G77A 1U1JA 3E0FA 1M68A 1JPDX 3N6JA 2Z7GA 1CZ1A 4GC3A 1MI3A 4HTBA 3GLCA 1DJNA 4E2BA 2VC9A 3O6CA 2QW5A 1OB0A 5D03A 5DT5A 3N29A 2G97A 3KRZA 4QE4A 1DKWA 4B9ZA 3OGVA 2YJQA 3IEBA 1QW9A 1XHGA 3EWBX 4ICCX 2A3AA 1RUSA 3CWOX 5JIWA 4POCA 3UVAA 3QGVA 2A79A 5EBAA 3S6DA 1H7RA 1E6QM 3DC8A 4Q4QA 1P4CA 3EPOA 1DIOA 4TTUA 2R1NA 2XWEA 2JBMA 2ABBA 5BU6A 3W1AA 4ZFCA 3WQOA 1YDVA 2DEPA 4IT1A 4UFMA 1OINA 4QG8A 4HTYA 1BVZA 1V6VA 4NU7A 1VEMA 3THAA 4B3ZA 3DCPA 2PWDA 2BOGX 3F1QA 4XSLA 2E6DA 2VDIA 2D2HA 4A35A 1GZ1A 3GVQA 5A8GA 2W62A 4YHGA 4NX5A 4GI9A 3MKKA 3ZWSA 1PVNA 3SUVA 5C2CA 1C90A 3IIPA 1VB9A 3RU6A 3GTXA 3NL6A 5C8BB 4MLRA 2XJ7A 3QZAA 1WUEA 2XZ9A 4HPHA 1UB3A 1RJPA 2PEVA 1O94A 2GK1A 5DF0A 3VD4A 4ZO6A 5ABFB 3N2OA 4LV4A 4V33A 2DGAA 1S1PA 1HN1A 3WLSA 1IV8A 5CBIA 2J25A 4ZOBA 4HNUA 1BTMA 1IR1A 4JEQA 6REQB 1ZL1A 2XSXA 4JN8A 2J8TA 1JDEA 6ENLA 3T44A 4RJEA 5H6HA 1QPKA 3LHUA 3I4KA 4D72A 2NWRA 3S2MA 2J78A 3BOXA 5A6AA 3C3NA 4J2MA 4NZ5A 3EZ4A 1QNVA 1H0GA 2B7PA 5JBDA 2D23A 2BHUA 2R9RA 1WDRA 3SN1A 1PL9A 1Q6DA 1GG0A 1FUYA 5EYWA 3THQA 3LPOA 1R7AA 3DYPA 1FWRA 1W2VA 5TAOA 5DXYA 2HK0A 4XIMA 1A5MC 2YKKA 4C1NB 3PS7A 3BANA 4AZ5A 1UYQA 3FNDA 2ZADA 1KXTA 1NU5A 1AMYA 3OHIA 1JYXA 1IT0A 3LGEA 2DZTA 3IGXA 4BEUA 3T1GA 1PE1A 3SUSA 5C9RA 4UOQA 1KBLA 4PH6A 1M01A 3NQMA 4PCNA 1B2YA 4UCFA 3SGZA 3UG5A 2VC5A 1DJHA 5EMMA 3GR8A 2XN1A 3GXPA 4UR8A 4BQ2A 3QSTA 1LLOA 4WXYA 3ARZA 4FA3A 2AL2A 2WCAA 2PURA 1NAL1 3W7KA 1GYNA 1UP3A 4C6DA 2C71A 1Q6LA 3PUDA 4HK6A 3B97A 3PZIA 2VR2A 1LT8A 4GVIA 1WX0A 2D22A 4M6UA 3BTNA 1US0A 2GDQA 2J13A 5A6KA 1A50A 1WE5A 3POHA 4F0KA 2DT0A 2CLHA 5A6MA 2O7SA 3HOJA 3K30A 3P14A 3KHJA 2XINA 1R3WA 3TJIA 3BAYA 3HPZA 4LUJA 5CAKA 4LUTA 4CNOA 2PTXA 2O9TA 4OGZA 2YDQA 4ZQPA 5LIKX 3TONA 3KBJA 3HG5A 4W7WA 1YNPA 1XLCA 3RJXA 3THDA 4NNCA 1HW6A 2A85A 4JCLA 1HO4A 4US5A 1W8GA 2ZZ6A 4IZGA 4NVTA 1BYDA 5XIAA 3WLNA 4HK5A 3CIXA 4GUIA 2JIWA 4O1AA 2J27A 1RA5A 1E55A 1C8VA 4FLSA 4CVWA 2EQDA 1DIDA 3ARUA 3WFZA 5CLWA 4LANA 1GEQA 4GINA 1CW2A 1VCFA 5FJJA 1KFBA 3LYEA 2RH9A 4BWLC 2P0OA 1ZU8A 1A47A 1PIGA 1HT6A 3ALFA 3RR1A 1ZS2A 1W5MA 1VH7A 3IUHA 2VR5A 3FKRA 5FOOA 1GQIA 5A8NA 4MVAA 3UGVA 4LYPA 4IIFA 2BVTA 1E6RA 1YBQB 5DY2A 2WZIA 3RR4A 3UJSA 2UZ9A 2YA0A 3O6YX 1TQXA 2ZA3A 4WGHA 2OMAA 1NFGA 3MSGA 2WO5A 2XH2A 2PLJA 1A5AA 4DLMA 1OSEA 2E0PA 4CD7A 1E70M 3CZLA 1Z41A 5TBOA 5LIYX 4AD0A 3G18A 5J8LA 3EXRA 2A7NA 4QSFA 4O12A 1GOXA 1HKIA 5C55A 5C5YA 4FR1A 4I7WA 1X8FA 2A7PA 4K37A 3MANA 1G7UA 4F2UA 3NQAA 1IEIA 2FZBA 1CXIA 1Q7MA 1WXYA 1RCQA 2CLKA 1WZLA 4IX2A 4XB3A 1KR1A 4E0CA 5CZJA 3MY9A 3IJ7A 2PLMA 3CT2A 2ZZ2A 1Z32X 3GC5A 1EPVA 1JUKA 3H7UA 4DJFA 4C5ZA 2CYGA 1K8XA 2GVLA 1KC7A 3LXAA 3U5UA 4OZOA 1U1HA 3ITLA 1U1UA 5DMLA 1OIMA 3W6YA 3FYPA 1KGWA 1GEHA 3GFYA 3VU2A 2GQ9A 3MV01 1Q2RA 4HYVA 1UCWA 4GACA 2VEPA 1ENUA 3F7JA 4PL2A 1E51A 1D8CA 3GRIA 2BTMA 1CTNA 7A3HA 1QNRA 1M53A 1DQUA 1EX5A 4DBSA 3C2OA 4RPQA 3EOSA 4C60A 1NDVA 5EPDA 4W8BA 3H2MA 3NURA 5HQEA 3LXCA 1R2RA 3BV7A 1CWYA 3GS6A 3QV9A 4UTKA 6REQA 1TV7A 1LQ0A 1FWFC 1ITUA 3VTRA 1QHPA 3VD9A 3CBWA 2QCNA 3ZZ1A 2HVMA 4AD5A 4HU8A 3VNJA 1E3ZA 3NQ7A 1POKA 5JVLA 3KZSA 3KL5A 3KM8A 1Q6CA 1C29A 5I5RA 3P5YA 4L6DA 2AQOA 5HWNA 4OUIA 1LRQA 3ZLFA 5M3WA 1Q5MA 4W93A 3NXFA 1ZCOA 1MEHA 3VNIA 4C1NA 3CXOA 3USZA 1W0MA 3WBEA 5A2CA 3TR9A 4PA8A 1FWWA 1OF8A 4RNFA 4FX6M 1JUEA 1P1MA 4IIHA 5LYRA 3S5OA 2D24A 3U48A 1YKWA 5A6BD 5MF5A 3ITOA 1ZAJA 2DH2A 4RZBA 1FKWA 2WKGA 4Q32A 4MIMA 2J88A 1QDSA 3MYPA 2ZDSA 4J3UA 3I3DA 5BXTA 2DT2A 1A80A 1R3YA 1E0VA 4K7VA 2HISA 4Z2IA 4UQCA 5CPMA 5FESA 2RFGA 2OG9A 2W67A 1TFVA 4GO8A 3W1MA 2QPUA 3UZJA 1J01A 3W53A 1RV8A 3W1RA 3VXGA 1WKEA 3VILA 1N7KA 1X38A 1EXPA 4DWSB 3EWCA 1XBYA 2W5FA 4PUEA 2VFHA 3B3DA 3WJZA 5BMXA 4MB3A 4NI8A 4JQ1A 5CPTA 3VGFA 3QSRA 5LIXX 1SZRA 3URAA 1K77A 4QE1A 3CL7A 1E0UA 1U33A 5I7GA 4S3GA 3VOCA 3EPNA 4H83A 4DO5A 4E5TA 3WENA 2VZUA 1FWIC 4UFHA 3CV6A 2GVYA 5T9CE 2XFYA 4E2DA 1BGAA 3AXMA 3R0DA 3BW2A 5AVNA 2CLFA 4NZCA 1UBPC 4IMGA 3E0WA 4OUEA 1S5VA 2YDSA 3BCJA 3SI9A 4YPJA 1EO5A 1Q66A 5HMSA 3KL0A 3A64A 3TAKA 4GC4A 2WMFA 3U7BA 2WJDA 3SRDA 1F05A 3CZ8A 2PWUA 3DFPA 1EO7A 3W6LA 1KRCC 1TR1A 1YBQA 2FMNA 2VWTA 4YCOA 1J12A 2YYUA 5LNSA 4CD5A 3K4DA 1NWTA 3PBVA 1RCXB 4S3JA 4UUIA 4J3WA 5C0QA 1FDZA 3GTHA 3NQCA 3AU6A 1PEZA 2O4MA 3R25A 3V1HA 3AU2A 1F6YA 4FXSA 3AYSA 3SY5A 3SCVA 4N4PA 4A8IA 3QEZA 4Y9NA 4Q8OA 4K6AA 3AISA 3EMQA 1GOIA 2Z2AA 2C16A 4H6EA 3KRSA 2QULA 1T40A 1GJPA 1XLEA 3H24A 3AIQA 3JVAA 4HSNA 3M0ZA 6TIMA 3OYXA 3EA1A 4GZ7A 3OG2A 4N9BA 4R9XA 1CCWB 2WQDA 3D46A 3HJZA 2YL6A 3VIGA 3Q45A 3C3UA 4MNKA 1GKQA 1KM3A 3LMZA 3M43A 4ZQRA 4NL1A 1FFQA 4IIGA 3G1YA 3GHSA 4A8LA 3L4UA 3PBUA 1MXSA 1RLDA 4WF7A 1Q45A 1WXJA 2DDXA 4MWAD 5TQLA 2BY1A 4WVXA 2UBPC 2TODA 3PAJA 3TP4A 3VKKA 4OBSA 2RGLA 2DSKA 5T9BG 3BVJA 2NV2A 5E0KA 1FQ0A 1XI3A 5I06A 5HK4A 2OTDA 1NWUA 1OCBA 1BPLB 4K1GA 5T26A 4TQTA 4W8AA 2FHCA 2VRQA 3D47A 5HUPA 1DJIA 4RUBA 3WQEA 1F74A 1Y0EA 4JS3A 2QGYA 3BL3A 4ZODA 2GWNA 3C0JA 4S3KA 7ENLA 3L23A 5FKYA 3RJYA 5A5WA 1Z69A 1BD0A 4MYXA 1X98A 2E6YA 4PTNA 1VBHA 3VOIA 2V30A 2QJGA 2YL8A 4KESA 1CT5A 3V7PA 4DXVA 4LAOA 1FCVA 3KOFA 2IPWA 1AJZA 2EF9A 3OGSA 4FS9A 1YPXA 4M8UA 3SCQA 1EF3A 3MV11 3S1XA 4X61A 4RPPA 1UQYA 4MUPA 3EYPA 1XLLA 2ZC8A 1SR0A 1EWEA 4HA0A 3GXNA 1ZQ5A 3UZWA 4C6LA 3R6IA 5I00A 4GZIA 2VGBA 4EK7A 4F0RA 1AQFA 3DI1A 3EKGA 3KUMA 4R7JA 4ZB0A 1U2YA 3Q37A 2G8ZA 3UJEA 4QX4A 3OVQA 1WP6A 1XUUA 1MW2A 2OSYA 3VGGA 3EWZA 3TWBA 4TMBA 1OG6A 4Y9AA 4TXEA 3N9RA 1DIKA 3AOFA 1B1YA 4BI7A 4ZCWA 2A3EA 3TYBA 3OEXA 4DWSA 1EC9A 3L4TA 4AIEA 3T4WA 2PDPA 4JIHA 4NILA 1HGYA 2P53A 3MUCA 5D4YA 2OGJA 3W4RA 5G4HC 2QV4A 4R3UA 2INFA 4ZBCA 2Q01A 1RP9A 4AVNA 2RDTA 3KTXA 4Y96A 1CGXA 1VGAA 4JTSA 3L0GA 4LH8A 3BUVA 4JIEA 4DYKA 4MY1A 5HMEA 1M6JA 3PZQA 5A69A 2ATMA 1FA2A 2RJHA 3L21A 2ISDA 3IACA 3WF0A 3KOXA 2OELA 2J75A 1QTWA 3FJ4A 3ONBA 1XLAA 1PZ0A 1KKRA 1OFDA 3W88A 1LRNA 3RCYA 1U22A 4A2SA 2OYMA 2QQ6A 3MC5A 4IUGA 3HA1A 2I5IA 2CZ5A 3N2CA 3BGAA 2BV9A 3I65A 1FH8A 3QY8A 1IHIA 4NASA 7XIMA 4RLIA 1VQTA 1CBGA 4RNJA 1KB3A 2BLEA 1M1BA 1EP2A 1KCZA 1G4EA 1GOWA 1US2A 4W89A 3WDPP 3VUPA 4WR3A 1I6NA 1IZJA 1AH4A 4FALA 1XIIA 1HKMA 3A4JA 3F4DA 4E2OA 3DFSA 2OX4A 4P8XA 4RXGA 2P0IA 3UJ2A 3LCWA 1NQKA 2F6XA 3HGOA 4JYDA 3CQIA 4WJ8A 3W87A 4DAFA 5C9ZA 1K1DA 1V0MA 3OIXA 1YPFA 3IK4A 2TYSA 2OSXA 4MDPA 1IZKA 1W91A 3GBEA 2X2YA 3LY0A 4KWVA 3DYOA 2VCCA 4NRSA 1XFBA 3B9DA 4NXKA 3MSRA 4YVVA 1FDYA 1K3UA 3FHQA 4EXQA 1UKOA 1K03A 3GIPA 5BXRA 1BF6A 4UTJA 3KRUA 4HNTA 1A0EA 3C0LA 4HKPA 4KFPA 4WIWA 4YLWA 3QYSA 1R46A 3W2UA 2X7WA 2DZXA 3Q58A 3OA3A 3A12A 4IXHA 4IFRA 2HPIA 5K9XA 4HNVA 3SM0A 5TIMA 3E2VA 1ISWA 3SUTA 5EY5A 4E8DA 3W37A 3A4XA 2G5WA 2VL4A 3NQ8A 5BROA 1ZRQA 3APYA 4GQRA 2JEPA 2G4JA 3NZPA 3SEPA 1PYFA 2Q09A 2YBVA 1KCLA 1Q63A 1A3HA 3WD2A 1E4IA 5LHEA 3ME3A 3N2TA 3GIYA 4FLRA 5D38A 2X0HA 1WPCA 4M24A 2WZEA 4JIRA 3R12A 4ATWA 4UXDA 1NWRA 2J47A 3W7DA 4J1OA 1FKXA 3MUAA 1VFTA 5PTDA 3MP3A 1OD0A 3L4WA 1DHKA 1A49A 4IPLA 2G3NA 2W3ZA 4TVUA 4JDBA 3N3MA 2MUCA 5LA0A 1L6WA 3RRXA 5H2ZA 1RQHA 3V36A 3W2MA 5FSDC 2Z2BA 4MADA 4KW2A 4ZO8A 3W75A 3MMUA 1D3HA 3SFWA 3T4CA 3QY6A 3STCA 4IG2B 4M6VA 3SW6A 2VUNA 2ZC1A 1UHVA 1UR8A 4ORIA 1OX4A 4PMQA 1VLWA 2D3LA 3E0VA 2X0YA 3T81A 4AHQA 1UG6A 3ITTA 1W9UA 3P0WA 5BW6A 4JTLA 1SFSA 3QOMA 3KLLA 1O12A 2QMKA 3IIVA 4LRSA 4NT0A 2DU2A 1FWBC 2R82A 4WSHA 3W23A 5AN7A 1PX8A 5CLTA 4F66A 2EG7A 4MWAC 1E1EA 3AC0A 4BF7A 4DBUA 3ZJ7A 2ZTKA 1BWLA 3QGKC 1CXHA 4QEEA 4GI4A 3RUBL 5CBBA 4GNJA 1MZRA 1U30A 2HXTA 2NUYA 2ZZ1A 1UKTA 2PDLA 2XU2A 3PBMA 3MVTA 4NG3A 1SMAA 4JTGA 3OZOA 3WLQA 1GZJA 1XP3A 3R94A 3ELFA 3DH7A 1FWCC 4L1GA 1FXQA 3WBWA 1I0DA 2CBJA 1XWYA 2PE4A 3WLKX 5I23A 4AWEA 1WZMA 1OG0A 2GGIA 4F2TA 4FOUA 5AZ0A 4MHBA 4D6EA 4UIOA 3R43A 1Q6GA 5I0DA 4JFVA 3N4EA 1S5NA 5KEZA 1DYSA 4GX9A 1B9BA 3GNRA 3WD1A 2WBKA 3CYJA 4GY1A 3KOZA 1CGTA 3FFSA 3AS0A 4EF8A 4ZTYA 3KAOA 2Q02A 3NCOA 1L6YA 4GY7A 1H11A 2E9MA 2YLLA 3UA3A 3I4EA 3CJPA 3VCNA 3ORWA 4DZHA 3WNMA 1RSCA 4M80A 1Z3NA 1YQ2A 4MKNA 2GFTA 2H8XA 2DJXA 4PN2A 4D8AA 4ZE5A 3BQ5A 3S5ZA 4ZO9A 3KCJA 1VBJA 4FR6A 4DUOA 1OZQA 3W28A 4K8EA 1CX9A 1D8WA 3SN0A 2PDFA 3VFLA 3MDUA 1F07A 3C2EA 3CB3A 2FJKA 4DXKA 4UMCA 3OVGA 2PRMA 4MSSA 2E6AA 3PUOA 3FXGA 8RUCA 1YTKA 1K9TA 2QJIA 4B90A 3N12A 2QUMA 4PBEA 3H2AA 4Z2GA 2EO7A 4HQVA 1R30A 4O57A 3T42A 2XZ7A 1LDCA 2QEZA 2J8GA 4HMDA 4P7RA 2WW5A 3KLKA 4PR4A 1F76A 1JCJA 1K4HA 1KFWA 1RH9A 3GG8A 4CN4A 1FCBA 2ALRA 3WD0A 4FNSA 4GYPA 2H8ZA 4DQWA 3HMCA 1ZBCA 5I3HA 4L65A 2C19A 3CPUA 4N9CA 3DIPA 2PWGA 1O6IA 3N2XA 1UWIA 4KS0A 2QCGA 3NM1A 2ZUWA 3ITCA 4FAMA 5HJYA 3L12A 4ZQMA 1ONXA 1YNQA 3ID7A 1AQHA 1MO0A 1ZAHA 4H9UA 4RCXA 3WUBA 3DG6A 1L2UA 2BX7A 3WBAA 4DBWA 3TU9A 1VYSX 1G01A 2IS7A 1CGYA 4OV4A 3TSBA 4DZ5A 1W9BM 4IL2A 3I7SA 3LCGA 2JGYA 2YW3A 2IPJA 3T2PA 1B5TA 3UZZA 1P48A 1E0WA 4E6MA 1UA3A 1ISZA 3W1LA 5DN1A 2YFNA 1TWDA 3N6QA 4C65A 4AIOA 3QRHA 4HP5A 1AQ0A 4JYEA 4AWUA 3VZZA 3HZ3A 1ZENA 2Z28A 1ZBKA 2FTWA 1SMDA 4JQ2A 4PMUA 4PCFA 2V69A 1W3TA 1EDTA 2WM1A 4F0HA 1JXKA 3NL2A 5A6LA 4I9TA 1JCYA 3OGRA 5G5IA 3VD5A 1OFRA 4IG2A 2FH8A 3WNPA 3HM7A 3R13A 3S46A 4H19A 4F2BA 1XYMA 1BXCA 4JTUA 4RDYA 5LIWX 1J4EA 5EMKA 5HWMA 1QJWA 1DWIM 2ZUSA 4HHHA 4GY0A 3W27A 1OC7A 4IMFA 3U2EA 2GVEA 3TZNA 4IIDA 1UA7A 4O1CA 5EMJA 3DX5A 3QQ1A 4Q4KA 1XF0A 3O7UA 4F79A 3UR5A 1MDRA 5AHFA 5A8QA 3GYEA 4KQNA 2X2GA 4ZXOA 3VNKA 4IIBA 2G3MA 3WBXA 3FN9A 3KFTA 5F2LA 5FIPA 4HB7A 4EE9A 3IRSA 5I07A 5K2ZA 4MYAA 4FNTA 1FVPA 3M7SA 1EDGA 3PZGA 1IIHA 3IGUA 3M5XA 4IGHA 1N8IA 5K4XA 3AS3A 4C6MA 4ASTA 3U4FA 3ZWTA 2CKSA 2C91A 4RK8A 2AMXA 5IHRA 4W5UA 1IEVA 3LRLA 4Q4RA 1S2UA 1J93A 1KRBC 4G8TA 1SU5A 1JQVA 2ODOA 1KD0A 1WV2A 3NYZA 5BRQA 4OIFA 3TX9A 5DRIA 3PPCA 4DUVA 3TOPA 3FVDA 1GNXA 5CC5A 2ACRA 2FVLA 2XVGA 3TVAA 2XSAA 4CU6A 3CMGA 4JY9A 2D20A 5G4WA 4D9PA 3K4WA 4HBKA 5CZTA 3UESA 1KRAC 3WK3A 2XIQA 1G69A 5C9XA 3G8RA 4FIQA 1W56A 5FL0A 1JYVA 6PTDA 3NQGA 1W17A 3PHAA 4LB4A 4P8WA 3F4VA 1MZHA 1BSIA 1XC6A 3V4BA 4ACYA 3LQGA 1AFSA 2EAWA 2WJZA 1RBAA 2G41A 2ZZ5A 1I2NA 1JYWA 3FX4A 4O14A 3LTPA 3OLGA 1G1YA 2G4FA 3WQ4A 2WM0A 5LXXA 1TTQA 4UFIA 2J9YA 2OT0A 1B3YA 3BOFA 4CEUC 4XVEA 5IFTA 3I3BA 3O0KA 2F38A 3VIJA 3ZJ6A 3OZMA 1VEOA 2E9BA 2JE8A 1GUVA 1A5OC 3VDBA 4KGLA 2X1TA 1S2CA 3CTTA 4QLLA 3VC5A 3AMDA 5K9CA 8TIMA 2BBFA 3K1DA 3TNBA 3M16A 5HBFA 1SM9A 4JTHA 5TD4A 1YNYA 3ISIX 2BWGA 4QCEA 4KWUA 4BA0A 3F4CA 4KWWA 1VBUA 1TV3A 2PWFA 4PMXA 4DELA 1KXVA 1Q6EA 2IQDA 1TJ1A 1K7XA 2J6VA 3ARWA 1HP5A 3QN3A 4HCLA 1S3HA 4WJEA 2KX9A 1S5TA 3R0UA 3U7VA 3SGUA 4UQAA 3OVRA 1ITXA 3SJNA 3TMLA 1YTDA 4JL2A 2Z27A 1UR4A 3UG8A 1G5AA 3BURA 4IPIA 3R8HA 4MMWA 4GYJA 2YA2A 4Z2HA 3FKKA 4HU4A 4JKLA 2C8NA 2HZGA 2FTYA 4QR6A 4BFAA 3F4WA 2FGBA 2PCQA 3ITGA 3ZR4A 1RCOB 3G1SA 4LYRA 1J10A 1WOBA 2E8ZA 2PA6A 3AMCA 3MMWA 3OYZA 2PWHA 3CUXA 1F7BA 1TUXA 3FSTA 3ZLGA 5CXPA 3O06A 2VEKA 3FYYA 1MRQA 4JIPA 1TRDA 6TAAA 1PHQA 3ATZA 1PZ2A 2J4GA 4Q8WA 3DBNA 1CECA 1V3KA 4FO4A 1LBLA 4FNRA 4O17A 1GPFA 3AO0A 4O16A 3RX2A 3A21A 2OO0A 3AXXA 3DG7A 3UERA 1UD2A 4GBUA 5BZAA 2PDMA 4HHLA 1LWJA 1ZP4A 5FAJA 4LEFA 1REQB 1SFLA 3CASA 4XWUA 2FGLA 3ANUA 3GKFA 4NZ4A 5CZ0A 1MYRA 2XIBA 3B8SA 1EEPA 3O07A 6CGTA 4ML4A 3MCMA 4ENLA 1E72M 2HS6A 3URNA 3EA3A 4V15A 2OT1A 3O8AA 3S6OA 2Z29A 3GZ3A 3VMOA 1V3MA 1MEIA 2XFRA 3GH5A 5E1QA 5HUOA 3G1DA 5K7JA 3V0SA 2X8RA 1LROA 4LFYA 1W5PA 4GGHA 4S3DA 4UFLA 5HQLA 4HZMA 3PK7A 1GOKA 3D6NA 1QI5A 1VAHA 1KBKA 2EPHA 3O15A 2BY3A 3NXLA 4IM4A 4E3TA 2HQAA 2PF8A 3A13A 2VMFA 1BKHA 1TYGA 2OCZA 1RZMA 3C8FA 5E93A 2WNWA 1IXPA 3RF9A 3MBFA 1MW1A 4DX3A 3BG3A 2V5DA 3S2LA 5CJMA 4IJRA 1F6KA 4AD3A 1AH0A 3QZEA 3OJGA 4DF0A 3L4XA 3C2VA 3UWQA 3AUOA 4N2YA 1I2QA 3FXYA 1VLIA 4Q7BA 1WDQA 3EDFA 2WWDA 5BWFA 4TOQA 3SFKA 3RAOA 1XIMA 1XICA 1F2JA 4ALDA 1ONRA 2VFIA 3EBVA 3A6OA 4GWEA 4GCXA 4QISA 4TX9A 1MSSA 3WZ0E 3ATYA 4AQLA 4MGGA 3AWNA 3GBDA 5AC8A 2A2IA 4QJ5B 4IF2A 1TMQA 5CPNA 3EOUA 1QNPA 2QPSA 4QJ4B 4UTWC 3KBMA 3M0LA 1NSJA 3PG8A 1RXOB 4Q4SA 1HL8A 5FF0A 1J0KA 1YDOA 1HVQA 2ADAA 3L5LA 4B9YA 5DO8A 2X16A 4JNMA 2QDGA 3N19B 4IUOA 3WNLA 1L6GA 1UD3A 1KV5A 1PZ3A 2VCAA 1D3GA 4I7UA 4UTIA 2X0SA 3WY1A 4EXBA 5AOUA 2V9DA 1EF2A 3KVMA 2YFOA 4O52A 3DHPA 1UH4A 3ZVIA 2E7FA 1PX4A 2FVMA 5A8OA 3C61A 4W88A 1PWLA 5DX7A 3W70A 4DJDD 4W87A 1IXQA 4K3ZA 3VNMA 1D3CA 1PHWA 4QE5A 3MI3A 1EC7A 1A5BA 1RK5A 2GOUA 3LDVA 4FLOA 4B4HA 1EIBA 2PDJA 2JKAA 1O5KA 1SSGA 5LA2A 3I6TA 4PMJA 4A3UA 4OBTA 1AODA 2BY2A 3MI6A 1FWGC 3GTNA 4JEJA 3DI0A 2WCSA 3NJ3A 4K2SA 4ZSUA 1FWEC 1XH0A 1Q7QA 5EKYA 1FHLA 1JJKA 2L5HA 3M47A 4E4UA 2QNEA 2A5HA 2CZVA 4JTJA 3VIPA 3VKJA 3COTA 3QHMA 1W9VA 3UY8A 4HU3A 4DO6A 1LG2A 1NH6A 4J7RA 4FNQA 4S3AA 1GORA 3WLTA 1C91A 1UKPA 2D1ZA 4P8UA 2O0TA 4UFJA 3FDGA 1XPYA 4K39A 3U2ZA 2YGYA 3BG5A 5HPCA 3NDZA 1ITQA 1ZJAA 1DJGA 1HJXA 1PUDA 3G0XA 1GQNA 3IV3A 1JAKA 4X22A 1O7AA 5C54A 4N9EA 3CV1A 4D6FA 1A0DA 4G5DA 5B7ZA 3AYTA 1Y5WA 1MQQA 4D2JA 4MB4A 3WMSA 1JDDA 3H2FA 2C79A 3TC6A 4Z2JA 4H9ZA 4JR5A 2CHRA 3PUGA 4JAWA 3CHFA 3QW3A 1JZ2A 4Q8NA 5GNYA 3PTDA 4UB9A 1KXHA 4ZE4A 1REQA 4A2RA 1C9DA 3BJTA 4RV8A 3KXQA 3R89A 4S2BA 2I57A 3SIZA 2IQTA 1V03A 3LMYA 2WLYA 1LOSA 3MKVA 3UQNA 3UPMA 4ZOCA 1C8YA 3EGJA 4LYQA 4DN1A 4GIYA 2V2DA 3OODA 1XGEA 1XW8A 3MW7A 2NQHA 3MHFA 4C6BA 3RX3A 1OC6A 1UD4A 1W6TA 4AEEA 2PTDA 3RPTA 5FAGA 2W79A 4Y90A 2BASA 2R94A 5JUVA 1FWSA 3R1ZA 4KT2A 4LF1A 1KCKA 2BZNA 2AQVA 1R47A 4B5WA 1P6BA 3QPYA 1O5RA 3SURA 1AK5A 2WKJA 3C8NA 4UZUA 2W0UA 4IPNB 4ZVJA 1RP8A 2MNRA 4RZ6A 3NO3A 3QV6A 4HHMA 3ARXA 1XUZA 2DQWA 3BG9A 3WUEA 3TV8A 2J7BA 1L6FA 3WL0A 2X1RA 1TTJA 3SRHA 1LCOA 2V3DA 3OW1A 1W5OA 1G4SA 1GW9A 4FLQA 3KX6A 1AW5A 5CG0A 5F1VA 1IF2A 4IQLA 4Q6JA 3UEQA 4L4LA 3HGJA 3VDAA 5C70A 4GXPA 3H2OA 4DB7A 3EA2A 1Q65A 4HZ7A 3TW6A 2FGZA 1Q8JA 3SQMA 4M51A 1H5VA 3V18A 3B06A 3N17A 3SCRA 2CWNA 1DEDA 4DWDA 4FXRA 1V0LA 1P6CA 2WVTA 5DBUA 1NP2A 4MB1A 1XYBA 4DF2A 4CGTA 3QC0A 1JCLA 4LOCA 1R85A 2Q3OA 3V16A 4H9YA 4AVOA 3AAMA 1W3LA 2OOGA 2CBIA 3LCHA 2XIIA 3WQCA 3VOGA 3DBPA 2C1HA 2WCGA 4PUJA 5EGRA 4BKNA 4NZ1A 2OLAA 4QHRA 4C7FA 4X60A 2JFEX 1TX2A 2ZE3A 1J2BA 4XG1A 4WEVX 1BKSA 4ZSTA 3VIIA 1P0DA 4V28A 1P0BA 1GJUA 2WMHA 5A6BA 1Q7ZA 4DJED 4AZCA 1ZFJA 1Q6QA 2XDFA 2OZ0A 4LUSB 3MT1A 1QK2A 1B3VA 1SJBA 2WVVB 3Q65A 1EKOA 3ABZA 3O9NA 3DEQA 4ZTXA 1U83A 5FACA 3GHRA 1KRMA 2IPGA 5HNNA 1DXIA 3AIVA 3STGA 4DNMA 2VZTA 3FJNA 4PMNA 2IKGA 4GYFA 4R85A 5AYZA 5BCAA 2VURA 1E43A 3UFYA 2AAAA 3UXAA 3W29A 2XH7A 3MUZ1 4HGXA 2X1SA 3A9BA 3L4YA 1I2PA 2QGHA 1QNQA 3O6DA 5DCDA 3P8IA 4PRWA 1W8SA 2J74A 3GU9A 3WQ8A 4BR1A 2QIIA 4WOQA 3WQDA 4X63A 4DPPA 3ABSA 1YLVA 4MZ8A 3WF2A 4RNHA 3N18A 3VYLA 1H3GA 1JEZA 2VXNA 3G6MA 3B4YA 1UQZA 1UWTA 3HJEA 1V5XA 2QCMA 2ZX5A 3QQWA 1IGSA 1CXKA 2QV5A 2X41A 4NYYA 5LKYA 5AKQA 2PD9A 2QVHA 1B90A 3NM3A 2ZKMX 4DEFA 3EWDA 4WDUA 3FSUA 3G3DA 2BNJA 1XXXA 2HRWA 3OU8A 1W32A 2IW0A 1T96A 2WMIB 4JPGA 2VFEA 3UGRA 4JTCA 1EL3A 3NQEA 4BQ5A 3RIKA 2DZWA 1RAKA 1OGSA 3W07A 3OA5A 1CLXA 3HPAA 2QCCA 5CEWA 4A8RA 4GQQA 3GVGA 5DEZA 5FSEC 1ICQA 4UMAA 1EA0A 2IKHA 3WYZA 2VEGA 2ISFA 3WQ5A 1CENA 3QKEA 4Q3MA 2WMJA 4OECA 3W02A 5A94A 3ITXA 5CGQA 4DJDC 1JDCA 1RA0A 4V1XA 2VZOA 3W85A 3W0KA 1BHGA 3KBNA 4IQDA 1TV2A 4C7DA 4WRHA 3TTSA 1QPRA 1I9CB 4PB5A 1FHUA 3BSGA 4LT9A 2XUCA 3MHGA 4UTTC 3BLOA 1VD6A 3BC9A 3N14A 3KW3A 4R33A 3MUY1 1YXDA 5IBXC 1UOKA 3WEZA 2Y7EA 4D8ZA 1EOMA 1R7OA 3M1ZA 1HG3A 2XIOA 3O0FA 5AVHA 3WJXA 2E4TA 3SSZA 3KE0A 4QG9A 5CC7A 4GOAA 2BY0A 1UH2A 3TN4A 3J7HA 1K7EA 5D8WA 1UWAA 4S2CA 2D3NA 4GIEA 1PTGA 2C14A 1KFKA 4DYEA 3P80A 1EZWA 3LTSA 4U28A 2OVLA 3TLLA 2PRLA 2Z2UA 2NQ9A 3UWUA 3CUFA 3PTKA 2E28A 2ONEA 5LZLA 1HUVA 4PRTA 3W83A 4US5D 2HEJA 5E9XA 4U10A 1W5QA 3EWXA 2DZBA 3EXTA 3JZUA 4HHPA 5LSMA 2JF7A 3G3MA 1P7TB 1ZGDA 2ZRUA 1HL2A 2FLIA 2QJJA 2YDRA 2DJLA 3NAVA 1QNSA 1VFLA 1J0HA 4H6KA 1UR9A 1GONA 2Q3RA 4HN4A 1PWMA 2Y1HA 1UR3M 3BLLA 5A95A 2R8WA 1F61A 3WJWA 1W1YA 1VS1A 1TTIA 4GIRA 2VJXA 4BF9A 3T0DA 1TWZA 1UR1A 3ZXWA 3NEVA 1DORA 3NG3A 4P2VA 2ZX9A 3A3WA 4UFKA 4GBDA 3EX6A 2DVXA 2Y61A 2BB0A 4ATDA 2OSWA 1IR2A 1E0XA 1E6XM 2VNCA 5C9UA 2EPOA 5KETA 1M41A 2ZZ3A 4O28A 4AC1X 3RPMA 3VX1A 4NAFB 2F8QA 1GT8A 2ZX7A 4DO7A 1XLBA 4K7YA 4G1NA 4DXXA 3UNDA 3VDGA 2CHNA 1XD1A 4KEUA 4LUSA 1F4HA 1YX1A 5H91A 7TIMA 2WVVA 4GA8A 4G7EB 2Y89A 3B40A 2Y5JA 3THUA 3VUSA 3GNDA 4JFWA 4L56A 5D2WA 2YZ5A 5KZDA 3AZTA 4XO7A 2HXUA 3HQOA 1BSLA 4PBFA 2DT1A 3SCTA 4HT3A 4L4OA 3SAZA 3R7MA 3G24A 1VPQA 2H9AA 4LSBA 4MAVA 3CGTA 1SO4A 2WHKA 1UD8A 2NUXA 5MKGB 4DBDA 3EDEA 4NIRA 5A1AA 2I16A 2WSKA 4E2VA 1OYCA 1UZHA 1TKKA 1KKOA 1GVOA 3BLIA 4N4QA 4YN5A 2V5BA 3MZ2A 5BWAA 1A5UA 3M0XA 2PC8A 4M6QA 3E0LA 2WANA 2BS9A 1O1HA 4Y9MA 2WHLA 9XIMA 3WG6A 4H8UA 1HKVA 1QRQA 2CLLA 2PTZA 1EJWC 2VR4A 3LD5A 2AMGA 1FH7A 4GO9A 3TK7A 1U5VA 6XIAA 4PB3A 5CQ1A 4YYFA 4C1KA 2ZWYA 1S39A 1XLDA 2WMIA 4I8YA 5G2WA 4FMVA 3DOPA 3VIKA 2V5CA 3ZR5A 3MO4A 3WH5A 4UTUA 3GAYA 3TA9A 1PX3A 3G1AA 4GH1A 4AB4A 1OFOA 3C0SA 3W1QA 2WJEA 5AYIA 2X42A 4IP7A 2PZ0A 1QWKA 2GSEA 4QTGA 3CLMA 3MCOA 1G4PA 2BHZA 1H7OA 1FP8A 4EWJA 3BCDA 3A3XA 1E5NA 5J5DA 4Z2KA 3H4WA 3WLOA 3PSVA 3SUUA 3LA4A 4GKTA 2DSZA 5CKSA 1B3OA 2YSWA 4YU1A 4UWMA 1V6XA 4L61A 4CQCA 1TV8A 3P62A 3QZ6A 3DERA 1PSCA 3I7QA 2F2HA 3K5XA 3PB2A 3STPA 4OTKA 2BVWA 1HQTA 4C6NA 3STFA 2ZUNA 2OR2A 3VZXA 4FF5A 1JDAA 1NELA 3TW7A 3U0HA 3R58A 4I9JA 5T91A 3WJSA 1UWUA 1U5HA 1B31A 1D9EA 1YXCA 4A29A 4FNPA 4UR9A 2UWFA 3WQPA 2YB1A 3L2MA 3DHDA 3W00A 2HE5A 5AHLA 1EQCA 3LV6A 1IEXA 1S2VA 1UP2A 2NT0A 3UWWA 5KZ6A 2VO5A 5H1WA 1D7KA 3W24A 2FHBA 1E6ZA 5RUBA 4HCDA 3SGGA 4F4RA 3VIFA 9CGTA 3WFAA 1UJPA 4J3XA 5JBFA 1JF6A 3LCXA 3LZ5A 1MMFA 4Q8VA 3TYCA 1YE4A 1XGZA 2PUZA 5BMWA 2B31A 1NARA 3QOKA 3NSNA 2Y70A 1EYEA 4UTLA 4RW5A 3QMTA 3QJAA 3F4NA 1LBFA 1XBZA 3UR2A 3BGGA 3FW6A 3WD4A 1YRRA 1FTXA 3AXKA 5EFFA 4D8LA 3VM5A 3CUZA 4C6CA 1CGVA 2IPFA 5A6JA 1PBGA 1P7TA 3WNKA 2JIEA 1NQ6A 3NNTA 1VBRA 4AMAA 3W1NA 4KKXA 2WZMA 2ZRZA 1WKFA 1SJCA 4HA1A 3KBSA 3OBKA 1MXGA 3GQYA 5A6SA 4MUZA 4KEVA 9RUBA 2GLKA 4YTSA 4AG0A 2OZ3A 3MCNA 1NJJA 5CBJA 4M7SA 4H2HA 5IDZA 4I9AA 4JTDA 3BLFA 7PTDA 5F4SA 3ZT5A 3CC1A 2NSOA 2CEQA 3L68A 5IDIA 1VHNA 4CD6A 1VRDA 4QGCA 3T8LA 3EWWA 3A24A 4L7ZA 4V1YA 3CM4A 4XO6A 3NO5A 2Y5EA 1A5CA 3DN5A 1YDYA 5BRBA 2P3ZA 3CIVA 3GU1A 4P7QA 1ODZA 1UW9A 2XGZA 3EPMA 4H6RA 4NAFA 1XISA 3UCCA 3FAWA 2IXVA 4R9OA 4HPJA 2QF7A 1YHTA 1W1B1 4CCZA 1ADOA 1IQ8A 1CB7B 4B5XA 2VQTA 3K1GA 3NVDA 4G7EA 5CH9A 4EIVA 3GG1A 5D04C 3N9KA 4ZFMA 2REQB 1TUFA 4QAIA 2EBNA 4GJ1A 5BXSA 3GXDA 4N0RA 2J6XA 3TTOA 4FK9A 4NSBA 3QLDA 3PZNA 5GQBA 4OOZA 2DORA 5E09A 4XZBA 2D0FA 3WH6A 3CL6A 1CXLA 5FF7A 4ZOEA 2Z00A 3I7RA 2OODA 3R79A 5BOOA 1VIWA 4LVAA 3CZKA 4FHAA 4XD5A 1G9HA 5MKGA 2WK2A 4ZMGA 1FXPA 1WKYA 4JHOA 3WQVA 3ZS4A 3TSDA 3ERPA 3VI2A 3PZMA 3ES8A 4R34A 5D2XA 3TSMA 4R5EA 3M5YA 3RLUA 2PDQA 2C15A 4MJ2A 5AFDA 4QJ1A 3TN3A 1K9DA 3E2SA 4IMDA 2ZBTA 4AUBA 2VOTA 3WIJA 2GJRA 3PWAA 1L8PA 4X9SA 2AGKA 2FHFA 4AXNA 3OLDA 2QUUA 1UC4A 5LIUX 1RD6A 3TTYA 1X7FA 1N55A 1WUFA 3LHZA 3WCZA 4DM2A 3LS9A 1PAMA 3H70A 1WKDA 3M0VA 1XLJA 1J5SA 2GJNA 3WQWA 4XAYA 2PWEA 3M4HA 1E56A 2QAFA 2ZRXA 2OU4A 5REQA 1X6LA 3M44A 1AD1A 2V2HA 1IT7A 1AMKA 1OY0A 1HKJA 3CMFA 1HXJA 5HXMA 3S9ZA 2DP3A 3KWXA 1BVNP 2Z1BA 2QCEA 5HAOA 3NO1A 1XX1A 3IIXA 3ZVHB 2O7QA 5AYYA 2FZ9A 3A23A 1VBGA 4Z08A 1FWHC 5C2XA 4M19A 3NQBA 4IFKB 3VE9A 4EOUA 3SN4A 3TC3A 3VOJA 5DANA 3AYVA 1US3A 2QR6A 3ZOAA 3LZ3A 2YR1A 3BLEA 3QM3A 1JQXA 4OVXA 3WF1A 4CQBA 2OPJA 4OFCA 4OBRA 2IMRA 1JZ3A 4PMZA 2EXOA 1TE6A 3LI1A 2J7DA 3O16A 3FS2A 4HNOA 4C6KA 4WY0B 1XCFA 3LX9A 2PD5A 2XH4A 4AD2A 3C4UA 5AYBA 1J2WA 2VFDA 1UD5A 3DUGA 2C1IA 2E09A 3AROA 4HNCA 3ZFHA 2QYGA 5D05A 1XINA 4A3RA 1LTDA 1TPH1 4BS0A 4DJFC 1QOQA 4HOXA 1TO3A 1FWJC 3UD6A 1EJ7L 5H8UA 1O5QA 2W63A 1BTCA 1WYIA 2P8CA 1IEWA 4NJKA 2CC0A 2Y8VA 3VKCA 2HV5A 1IYXA 2NV1A 5M2FX 3VFCA 2PGFA 3RLHA 2ACSA 3AMGA 2Y4SA 2PS2A 4TU1A 2GGEA 1TV4A 2Q6ZA 5I3GA 4WXZA 1A3XA 4JNZA 1FDJA 2XWDA 3VCRA 2TSYA 1VP5A 1P5BA 4TMCA 4PMRA 5G1MA 5DMMA 1XRFA 3F03K 3HPSA 3REQB 1QFEA 3WEMA 3PG9A 3UXKA 1KCXA 4KCVA 1E5JA 2TRSA 1HVXA 2Y5SA 4J27A 2OLHA 4S3FA 4NAEB 1JF5A 3KDOA 4PTWA 2I9EA 4XAGA 1YMYA 2DT3A 2E5CA 3MS8A 4H2CA 3ZT7A 1GOMA 3CL8A 2Q8LA 1POJA 3BMWA 3K8MA 3CB8A 4M0XA 3I6RA 3SUWA 4JQAA 3V35A 2YCKX 4EPDC 1TJ0A 3MJMA 3H54A 4JX4A 3MQTA 3G1RA 1H50A 2RDWA 3QKZA 3HPFA 1E9ZB 4Q7NA 4LY4A 4GNVA 4AC7C 3WQFA 4IMCA 1VIZA 3IJQA 1UZ1A 3W7IA 5GVJA 2EPNA 1PKNA 2V3EA 4GJIA 1K8CA 1LT7A 1PS9A 2D0GA 3ZO9A 3GY1A 3QV8A 3HQ1A 2HCVA 4HCHA 4MPQA 2JF6A 3QC3A 3TJXA 5AY7A 4A22A 1Z9AA 1UOZA 1LQ2A 3I3EA 2REQA 1R3QA 2SFPA 4PMVA 1KBJA 2AOSA 4O1DA 4JHZA 3GHTA 1W2PA 3M46A 1VFOA 3T08A 3G2GA 2WVSA 4FOJA 4Q8TA 2A1YA 4GUHA 3RNDA 2A0NA 4XZHA 3UW6A 1TIMA 3GDLA 3THCA 3LOTA 5D2TA 4DY1A 2V38A 4YTTA 3CUHA 1XQKA 4UQEA 1RHCA 4C6IA 4H9MA 3H4XA 2OYKA 2CITA 3QTPA 1SFTA 5FJOA 4AEOA 4TUFA 4PUDA 2I14A 4LBUA 3PPFA 3S5SA 3MU7A 1OK6A 2HSAA 3VMNA 5ABGA 1BLIA 1H7NA 2ZXBA 2A6NA 4UTHA 2EPLX 4GQBA 4QDMA 1V6YA 5JMUA 4KF1A 1PJ9A 5T8GA 1Z6KA 2DFAA 4B5SA 1H49A 1J6OA 2QJNA 3W71A 5ABFA 3UYCA 1RY8A 2UY2A 4MM1A 1ME7A 3RU8X 3ABXA 2C0AA 1TPFA 1QPNA 3H53A 4MJMA 3VGBA 3BAIA 5M03A 4BHYA 3RMEA 1R2TA 1RY0A 5AYXA 3EX2A 3ZVHA 2EG8A 3RHGA 2BVDA 2BXVA 4GH3A 5DELA 3OLEA 1GOOA 1GKPA 1OFAA 2P3EA 3AMKA 3N1AA 4JFSA 2E25A 3CYVA 1RALA 1RBOB 3OTRA 4IFKA 3N13A 3H4GA 4UBPC 4QDWA 1W1TA 1O66A 5CPQA 4C91A 2ZUVA 3EDKA 4JN6A 4J3VA 1EJRC 3T09A 2DV0A 3A5VA 1UPMB 3CQKA 1XCWA 2V5LA 1W54A 4CUCA 2E9LA 1XDLA 2B81A 2TPSA 3EB2A 4IHCA 1JI2A 1KM4A 4ATLA 1M7OA 1ML1A 2CLMA 1PTAA 1CGUA 3QMRA 5I24A 3E2RA 1H09A 4HYRA 4WY0A 4Q22A 1ME9A 4LAUA 3CUIA 4R27A 4RR4A 4LWWA 2VHLA 4I8DA 1X8CA 4KCUA 3LI0A 3E02A 2NSXA 1BXBA 3M6YA 1QCWA 4FI4A 1JAEA 4M1BA 2J62A 1UUQA 4RZ5A 2OZ8A 1I60A 3KRBA 3MB9A 5D30A 2ZZ4A 4AH7A 5BOEA 2VGIA 2OQLA 1SUXA 3AXHA 4YWSA 3CUJA 3K2GA 4GHRA 4AY8A 4J4KA 1DWHM 4ZO7A 4CQDA 3GFXA 1HF6A 3LENA 1JZ4A 3INPA 4LB3A 3CPGA 5MHBA 4OWGA 1OX6A 4LPCA 5FEZA 1V7AA 4Y8EA 3BGJA 3LRMA 2VYOA 4MPKA 4H7ZA 3N9SA 1V3JA 1YE6A 2E40A 3H23A 4QQ3A 5GPRA 1OGGA 1O5XA 4BY3A 1DJXA 4DPQA 1TWSA 4GABA 4PCSA 2ZQ0A 5EU9A 3PSWA 5KSWA 1A3WA 4H7VA 2VX7A 1NOWA 1XIGA 1QBAA 2KAUC 2V67A 2MANA 3PBWA 1EUNA 4XIAA 4WJXA 3GH4A 4KCWA 3REQA 3V5FA 3BJSA 1M5WA 5AC5A 1BGGA 1EP1A 3UPBA 4MAZA 1HNYA 2ACQA 3GDRA 4JDYA 2C0HA 4NAEA 3PULA 1DWJM 3V3WA 1ONWA 1MDLA 3EWYA 4REQB 5JBEA 3ENLA 4O4WA 3RILA 2J66A 3OZPA 3H12A 3EKZA 3W82A 3KDNA 4JQ3A 4PUUA 1FFRA 1EP3A 1QHOA 4IPJA 4C5YA 1QK0A 3IUIA 1LORA 1VEPA 1W3NA 1AUSL 4JTIA 3B8VA 3RCNA 1DJZA 3IPWA 2PDXA 1WDPA 1JPKA 2FZDA 2V5JA 1P0EA 1ISVA 1F3EA 3GVVA 4UNKA 1JPHA 3C2YA 2GOKA 4NJHA 4XQ6A 1LLZA 2PBOA 1UH3A 2EEXA 2GJPA 5FJUA 2GGGA 5HATA 1Q3NA 3E2QA 4LJ3A 4AD4A 3C0QA 1H51A 4N42A 3CK5A 4IWWA 3LV5A 4P7LA 4L4MA 1J18A 3PJTA 3TFXA 2P76A 4PULA 3VNLA 2BMBA 2JGQA 3ARTA 2RGMA 1VJIA 2A3LA 4PEKA 4ZA0A 5GJMA 2PP1A 2FMOA 2FPTA 1KFLA 1IGWA 1HKKA 2W61A 4UQDA 4PUNA 2FQIA 3W1TA 1S5MA 2NQJA 4LAZA 1WBJA 2GPTA 4GCAA 4WUIA 1P0KA 4DWSC 3NOYA 4Q33A 2WSPA 3CAKA 2AKZA 3V5CA 4YXGA 1DBTA 1I2RA 1SW3A 2J77A 1GJWA 5D2VA 1DJYA 1FHVA 4QFUA 5DMNA 3AHYA 4WHBA 4H41A 3GE7A 3CEPA 4B5UA 3PUEA 1DL3A 4AMCA 1P43A 1HGWA 3LM3A 4L1WA 1UBSA 1ISYA 2CNCA 3CHDA 3R11A 1TCMA 3GKAA 4CCEA 1WBHA 1K6AA 1Y5VA 3UWVA 3PAOA 2YCLB 1V6TA 3RG6A 1EQPA 3P0XA 2QJHA 3PJXA 1YYAA 4B5TA 2FFIA 1IXOA 4B16A 3T8QA 1W1IE 4MKSA 2Y7GA 1GQJA 1Y7VA 2C3ZA 3G1XA 3GH7A 1TB3A 4TX8A 2PP0A 3NZ1A 1GHSA 3SB0A 3CZJA 2Y0FA 1VRXA 3W9ZA 3WUGA 2X05A 5DRCA 1EBGA 1KFEA 3CO8A 4YTQA 1E9LA 3WLLA 2PRHA 1Q4WA 1TIWA 5HANA 1SVDA 1ZPTA 3UBPC 4E8CA 3GR7A 1JCMP 1F5ZA 2NWSA 1PZ1A 1XYLA 3ZQ9A 6XIMA 2NZLA 4F48A 3BLKA 4LUIA 3MJYA 2VX4A 1XIEA 1ECEA 2XGIA 1K9FA 3LM7A 1ZALA 1ICSA 1TVPA 1VCGA 1SR9A 4QLJA 1CEOA 4HYWA 4S1FA 4JNYA 5F7UA 3KOWA 2WBGA 1XYZA 2Z1SA 2FKPA 2H3DA 1T8XA 2GUBA 1GVEA 1XIHA 2B7OA 2WC7A 3LGGA 2I17A 3BW4A 3P8JA 2PODA 3NVTA 3AICA 3UT0A 1Z42A 4WSJA 4PMOA 3GVWA 1TE1A 2POTA 3TN5A 4TTGA 1F6PA 2WZHA 5FJTA 2ZE0A 3DAQA 2VGFA 5I02A 2CLPA 5E70A 5CZSA 1MWOA 4XBSA 5FJPA 4GX8A 4H8HA 4RV3A 2BXZA 3MTWA 3UU0A 4HN8A 1GWJA 4MY9A 3W25A 3B9OA 1NFPA 4S38A 1HX0A 3ABRA 2OZTA 3TJLA 5F4WA 2WXDM 4IP5A 3RMJA 4XTDA 5GNZA 3CPRA 3W7HA 2CHOA 1HKWA 3ARYA 2HMCA 1TREA 3OB8A 1TQJA 3PFRA 4JTQA 1GK8A 3HV8A 4XAZA 4REQA 4XBJA 1OVDA 2CCRA 3C6CA 5HNRA 4MZ1A 8CGTA 3EX1A 3RLVA 2DPEA 5L9FA 3M41A 3B9EA 2CXGA 1CIUA 3MPGA 3CEUA 3V5OA 4JCMA 3VX0A 1IWAA 1QOXA 2ZCGA 3TCEA 2PDYA 3ES7A 1OBAA 1ZP3A 4CQ9A 2DW6A 2VRKA 1AD4A 3W7GA 4BCEA 1PPIA 1X7IA 3T9PA 1GZGA 5D32A 4EKJA 2BOEX 1TPEA 2PU0A 3W7PA 1GG1A 1TX0A 5ABHA 1S38A 3IGSA 4QP0A 2ZVRA 4DZIA 3WN6A 3LSCA 5F1UA 1D7FA 3GFZA 1ICPA 2GQ3A 1GYLA 2LLEA 1UJQA 1KM1A 4GKLA 5DY3A 1QO2A 2A3HA 1QW8A 3AHVA 3BV4A 5BRPA 1NWSA 2ALDA 2R1KA 4LBRA 1NVMA 2HBXA 1CNVA 4S39A 1V8EA 1EHAA 3AXIA 3GB6A 1V77A 3ZM8A 2NVAA 5L6UA 3SZ8A 4IP4A 4X0NA 1PIFA 3D3FA 2R14A 1KM5A 5AHMA 1E6NA 5EMLA 3CZGA 5IRPA 4ROQA 3O2LA 2PDNA 3TXVA 1H61A 4AF0B 1EJTC 1JCTA 5B80A 3WNNA 4KMQA 1GVFA 2Z7KA 7ODCA 3LTYA 3WKZA 1C93A 4F0LA 4PGLA 5FJRA 6A3HA 2XVNA 3EX4A 1KWGA 3E0IA 1SZGA 1SZEA 4HMEA 1LL4A 1XR2A 2GUYA 3L2IA 4A05A 4P8VA 2V3GA 2RKXA 9XIAA 3SSJA 4DHGA 2V6AA 1OCNA 3JU2A 3W84A 4W4QA 4TVDA 3QH2A 3B0UX 3WSUA 4LU0A 3VK5A 3UR7A 3BOLA 3O1NA 5CC6A 1XG3A 4EAMA 2DZUA 4WX2A 4LUTB 4D6DA 3ZJ8A 3WDRA 5JQ9A 3VNDA 3NEHA 4H6QA 1E9IA 2AAMA 2IKJA 3GNNA 4Y6GA 1EIXA 3PFMA 4LCRA 3A4AA 3CO4A 3N4FA 3S1UA 1W3IA 3GIQA 4N6FA 2DZSA 1RR2A 4NYUA 4R53A 4D6HA 2XN0A 3BK0A 3FY1A 1AQMA 1ZTVA 3GTIA 1UKSA 2VGGA 1C92A 4UOJA 4CNSA 2B0MA 4GISA 4H01A 1PKMA 1QATA 5CPSA 3FA5A 1GQLA 1ZY9A 4W86A 4QQUA 2GYIA 3GTFA 4HK7A 3LRKA 5CSSA 4QITA 1WAWA 2ZA2A 3RM8A 4MDOA 5XIMA 4EX4A 4AYSA 4L6OA 2NVDA 1J6PA 5LHFA 3F5LA 1QASA 1RJQA 2PF0A 2Z1KA 1KWKA 1K8ZA 2QAPA 4LEQA 4RDVA 3WNOA 4U2YA 2QKFA 2P10A 1FH9A 2EG6A 3CAWA 3KL3A 3T07A 3MP4A 1SQ7A 1NEYA 1QMLA 4V27A 1JUBA 3ZSTA 1OWQA 3G1FA 3VA8A 1O68A 4GYPC 4ZOAA 4DJEA 2Z1VA 1EOKA 3H6OA 1J0JA 1W5NA 3UPWA 3O3RA 4NNAA 1R3RA 1WDWA 4QXIA 3CQHA 1K9EA 1OYBA 1GOQA 1IIGA 2VQUA 2VCBA 4IFOA 1KGXA 3P60A 3WH9A 1QI0A 1C9WA 4O1EA 4ERAA 1F8MA 4ZR8A 2I5GA 1TZZA 2V81A 3G5EA 1QPOA 1TZ7A 4QG6A 5J04A 2XYLA 1H1ZA 4PUMA 2HWGA 4OOUA 1XLGA 1VKFA 3DC0A 4U3AA 3UZYA 3ZJKA 4L9XA 4GFIA 3MUIA 1Y5XA 2YB4A 5K4ZA 4XUYA 3U9IA 2BGSA 1UWRA 3HN3A 3UVIA 2BGNE 1LBMA 1VR6A 1OABA 4GI8A 3UXIA 2RJGA 3T2OA 4PMYA 1LL6A 2O9OA 4XD6A 1O95A 1AW1A 4Z1AA 3BQ6A 2ZUUA 2W27A 3P82A 3VCCA 2ESCA 2OWCA 3IJ8A 3OZYA 4GG9A 2CU0A 2NQZA 3HGSA 4GGBA 2FPYA 1UROA 3W2NA 4PTDA 5ENLA 3SCUA 1J9YA 4NNBA 2UY5A 2QDDA 2XIJA 2C1GA 1KTBA 5G2HA 4HA3A 3G22A 2VZSA 1BYAA 1M04A 1JZ8A 1GVYA 1X1ZA 4QM1A 2V68A 1HL9A 5C71A 4YMZA 1V6WA 3LBMA 5EL1A 4FXJA 3JZEA 1HTIA 4GVHA 3NZQA 3AIEA 3KZPA 3GWQA 2A6LA 1THFD 3GAKA 1XD0A 3HG2A 1QXLA 2WSYA 2GDVA 4GVFA 4KFNA 4OV9A 4LNCA 3TA6A 1TWIA 3WO8A 3MHUA 4Z0JA 4PYSA 1NTHA 2G96A 3W7QA 5AC6A 3WMBA 5CG7A 3B04A 2R1MA 1HZYA 3M7WA 3P93A 1E3XA 3WJYA 3B0XA 4AF0A 4TV5A 2QLYA 1VJSA 4J28A 4FB7A 1OT1A 3P5ZA 2OXNA 3FJLA 2DIEA 4GUFA 3W74A 1X1OA 2WC3A 4UNLA 2D73A 2W9MA 3T0TA 3BAWA 2CLIA 2J9ZA 2WC4A 3LXBA 4MB5A 1UUMA 3T0AA 3ITVA 4H3DA 2OX1A 2QUVA 3WDJA 1EUAA 2NLIA 1WO2A 3TYAA 2YXOA 3B9NA 1QOPA 4GD0A 4H4IA 4JKMA 2QIWA 4A6GA 3W7LA 1WA3A 1T99A 4ML9A 1B0IA 3DFNA 2DW7A 4KCTA 1PDZA 1EBHA 1SFJA 3CUGA 2HBVA 5DFAA 3C2RA 5EA9A 2YDAA 1V51A 1HJQA 3EOOA 1E4NA 1MNZA 1XS2A 4HPGA 3WH8A 4DVOA 2X09A 1VHCA 2VD9A 3E3HA 4S3BA 1EGMA 5BXPA 3IVSA 4H1ZA 4JX5A 5FA5A 2ZRYA 2F61A 3MSDA 4FPSA 5HOSA 1SGJA 4I7VA 4W7UA 3LLFA 1E1FA 3ARSA 3VE7A 2OJPA 3FEMA 4ADTA 1R86A 1DPMA 4X9YA 3H21A 1KFCA 2PLKA 1M03A 3HU7A 2PCEA 1EFZA 2AKMA 5EB8A 4Y7EA 2A3BA 2NXHA 3HG3A 1MQPA 2VKZG 2YCEA 5HMDA 5E9AA 4F0MA 4AD1A 1H0IA 4JL1A 1B4KA 4CKQA 1ZUAX 5CSYA 1CXEA 3K4AA 3NQ2A 1ME8A 2V82A 4D6CA 1C7TA 4A3YA 1S46A 1MVYA 4BI5A 1HJWA 3MYOA 4LW7A 3QLLA 2CZFA 2QCDB 2Y8KA 3F5JA 2FB3A 3KWSA 2ZRWA 3H7RA 1E71M 1DWAM 1QI4A 1G0CA 4CLMA 1IWBA 1PYMA 2QPXA 2GSJA 4S23A 3R2GA 5LNWA 1O1ZA 2IKIA 3PJUA 4PFHA 3EXSA 3EMCA 3DXIA 3UJRA 1TZ9A 3M5VA 1RPXA 1E4LA 3HPXA 1BAGA 4JOMA 3W7NA 5C7VA 3W26A 2O9RA 2XM1A 3PZTA 3ABQA 5KITA 3PZ9A 2H6RA 3TN6A 1XYAA 3QBUA 1TSIA 3E5PA 3O6AA 1HJVA 1ZBWA 4JX6A 4UMBA 2DSVA 2IXUA 5G2IA 3L0NA 1KBBA 2NVCA 2E68A 1OCQA 2ZUMA 2J7HA 3TROA 5I03A 1AZ2A 4KH2A 2WAGA 3L65A 5D37A 4KGJA 2ON3A 1EEXA 5K9DA 2PDWA 1DWGM 2I9UA 4Q4MA 1SJAA 2CZDA 1OFBA 1DIEA 2WSRA 3AIUA 3TNOA 2WKLA 1M7PA 4CU8A 4AYGA 4KETA 2Y7DA 1GW1A 3ZR6A 4AEFA 4AHPA 1XQLA 4RKAA 3W7MA 1V08A 4XBKA 2CW6A 4BWLA 4XKMA 4D71A 5DLCA 1JG9A 5D02A 4LNYA 4A8NA 3II1A 3W72A 5EMUA 4Q4OA 4ONVA 4J40A 1XRTA 1GQKA 4DM1A 1AVAA 4URIA 2XG9A 1UUOA 1A5LC 3TEVA 2WMKA 4F9DA 2P50A 1R0MA 1DQWA 3TYDA 3CMJA 4H9TA 1JD7A 3M0YA 5EMYA 4C6JA 4W5ZA 4O8RA 2G0WA 3FHAA 3IANA 4ZENA 3GX9A 2DH3A 3MWAA 4JKKA 3ITYA 4NY2A 3P74A 1TWWA 2WWCA 4FIRA 2FPVA 4YJ5A 3T7VA 1Q6RA 4FF7A 1ISXA 1B4EA 1JNEA 3RGTA 3W1XA 3TQKA 4WKFA 3FA4A 1L0PA 3WX7A 4Y9PA 3TTQA 5I2UA 4V2XA 1CDGA 2Y6ZA 4AX6A 1R9XA 4ILSA 2QS8A 4WZHA 2NX9A 3T40A 4AX7A 1RQEA 1R9ZA 2OWWA 4DF1A 2PDBA 4Q7IA 4Q8UA 2XVPA 5BNKA 1SW7A 3S0CA 3HFTA 1VF8A 4QEHA 3UNTA 4GPNA 2QVNA 2JKPA 1ZB5A 4WGXA 3TYUA 4IXXA 2YA1A 4HNLA 3PR2A 3OBEA 4LVBA 5I3IA 3AQUA 4A3HA 4K38A 1ZLPA 5CSRA 2ZUTA 4RE2A 5C2GA 1W9PA 3AHXA 5I6SA 3GM8A 4AZHA 3GO2A 4QLKA 2XH0A 2PP3A 1FWAC 1RVKA 1R5YA 3QXBA 3R10A 2J7GA 2HDJA 1TJ2A 3GNXA 3LGDA 7CGTA 3EB3A 3P61A 2VD8A 2PDHA 1M7JA 3FIGA 2G3JA 1W9XA 4NZJA 3VKBA 4DUWA 2GQ8A 1H7WA 5HJXA 1NDWA 3EEGA 3KOYA 1DWFM 3GDBA 3HMJG 5I3FA 3SCPA 1PKLA 1G6CA 3VKAA 2QCLA 2GVJA 3LLXA 4JQ4A 1RPKA 1OHLA 1WB0A 2VEMA 1DHPA 1EHNA 1X39A 4EXAA 4C6PA 5TNVA 3RX4A 1M3UA 5KTLA 1OM0A 4U3CA 2NXGA 4HD5A 3SQLA 3TJ4A 2R1PA 5CGTA 3C56A 4EAYA 4XVDA 2DUXA 1B3ZA 4UZSA 2QCDA 3N34A 4NJGA 2YL5A 1MUWA 3S4TA 4D1JA 5FD0A 5I79A 4M82A 4O50A 3SCWA 4AISA 3N73A 3UYIA 3XIMA 3VGHA 2Z25A 4U4MA 1RJRA 3B9AA 3RN6A 3S47A 3S2JA 3QW4B 5ECUA 4L9ZA 4MWAE 4JTAA 3OP2A 3YPIA 3JRKA 1B54A 1DV7A 3NYDA 2O92A 2P1FA 4QRNA 3DFTA 4JTKA 3A22A 4DIAA 3M07A 5IM51 3OO2A 3TQ0A 3S42A 3G1HA 1EJXC 2E6FA 4B2DD 1SSDA 3IGHX 1DTNA 3R8GA 3PTQA 3AIBA 5IXEA 4WDXA 3V0UA 3FDKA 3N11A 3GZAA 3MP5A 3VD3A 3VNZA 2J79A 2ZZ7A 4ZXLA 1CGWA 3N2BA 3IUDA 1DP0A 2X1IA 4LUYA 4NKCA 1V0NA 3FVMA 2P5NA 1XCXA 2VDGA 5HWJA 1KFJA 1Q6FA 4LC6A 4EWND 4LS2A 4LRTA 1AL8A 2WSQA 3CQJA 1L6SA 3NOEA 1I75A 3MA8A 2BGQA 2VX6A 4I5RA 4YTRA 1KO0A 3DGRA 3TIMA 3T6CA 3R5EA 1VFFA 3TZFA 5FF3A 4DLFA 4O0ZA 2DSUA 2R6OA 2VVNA 3GW3A 1FBAA 3CWNA 2QT3A 2GSHA 4Q8PA 4LS0A 1J0ZA 1TV5A 4IPPA 4BF5A 3UP8A 4IX0A 1H60A 2Y7FA 3GYCA 2V3FA 2GGHA 2A7RA 4IQJA 4OKDA 3WL1A 1J5TA 1XDJA 1K8YA 1IT8A 2QUNA 3GK0A 4C7GA 1YDNA 1GKRA 1PO9A 3FCPA 2WOQA 4W7VA 4Z1BA 1PCKA 3U5YA 1NIUA 1ECQA 2CBUA 1ZJIA 4UCGA 2PZNA 3NPXA 4C90A 3SR7A 4PSPA 1PKYA 4HMNA 5DQPA 1W3JA 4HSHA 1OX4B 1EGVA 1JD9A 3K46A 2WQPA 3P81A 3PBGA 2FH6A 5HA7A 1Q6OA 4QBXA 2E5BA 3OIHA 4IGMA 1NF7A 3WQ6A 2W92A 4ERIA 1A5NC 2YCJA 1OFEA 3PWGA 3AIRA 3QGAC 3RM4A 3WBYA 5KZMA 3OLIA 2ISVA 3KVJA 4HPXA 3CTLA 3N04A 3STEA 2ZXAA 4IL0A 4XZLX 4LBSA 5CSUA 3BDKA 1CYGA 3AI0A 4O10A 3IS4A 1W37A 3PNZA 3AYRA 2ZICA 3B8IA 5HPOA 3DKLA 2C13A 4HIBA 4ES4A 4B3LA 5U4NA 2CPUA 3CHCA 3AUJA 3LG3A 2Y24A 1MXDA 3JR2A 4PL1A 3WELA 1Q13A 1XLFA 5A3HA 5CPOA 2D2JA 3FLUA 3VGDA 3NL3A 2HK1A 1XFCA 4AVFA 1QVBA 1JPIA 2X1UA 3MBDA 2I1OA 1V3HA 5D9PA 2G37A 3W2KA 1MNSA 2VC6A 3L2LA 2QHAA 5LNRA 4W8LA 5A6TC 1R38A 1NOUA 2D0HA 3ONCA 3G0SA 4UTFA 3L5AA 1JPMA 3IIOA 3B03A 2YLAA 2YXGA 1SJDA 2E77A 3HQPA 2WZTA 5E5CA 1E1CB 5FEWA 5IFPA 2WHMA 1J0YA 4J3ZA 3B8TA 4PODA 4LAKA 2EJAA 3GU2A 2XFWA 4UNIA 1GPWA 3K13A 2NV9A 3HO8A 1Z48A 1WDSA 2XISA 2VI0A 3USBA 3GXFA 3VC6A 1DE6A 2GJXB 2Q8ZA 2XPKA 4JGDA 3LBOA 1XSKA 3UXLA 4I5UA 4XX6A 4F3HA 5DCBA 1E15A 2OB3A 5DCEA 1R6WA 1YADA 3WEOA 5ABEA 1CLKA 3UF9A 2G95A 2OQHA 4WY0F 1UKQA 2O55A 3D0CA 3HBLA 4JN7A 4LCSA 1G4TA 4B5NA 2Y62A 1O4UA 2HVNA 1AJ0A 1TRIA 3LHTA 2VDHA 5G1YA 2WYSA 4J3TA 1F9CA 3G6LA 1YTEA 3QFEA 2EKGA 1K7FA 3IVUA 3PPGA 2Z6IA 1DTUA 3C5QA 3BZGA 2XVLA 3LK6A 4TIMA 4X3ZA 1IXNA 1PTDA 1YIXA 4U31A 1W1ZA 3CV2A 2CERA 2GGJA 3BMVA 2JALA 3IJ9A 3R0KA 5HMFA 4GUGA 3S8HA 3IV8A 3QVQA 4MWAB 3OBAA 5AHNA 3AS1A 1ESWA 4LY8A 2GZXA 2YOCA 4ZB2A 2BHYA 3G8EA 1PIIA 3QTGA 4M6PA 4OE7A 3BH4A 1BVWA 1H7PA 4IIEA 2B4GA 4Z17A 2NT1A 1A53A 3M0MA 3S83A 3GXMA