4WDUA

17beta-hsd5 in complex with 4-chloro-n-(4-chlorobenzyl)-5-nitro-1h-pyrazole-3-carboxamide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wduA00
4RPQA 2NVCA 1ZQ5A 5HA7A 1SM9A 3WG6A 2P5NA 3VXGA 1S2AA 4FA3A 2PDCA 3KRBA 3MB9A 4YVVA 1YNQA 3LBOA 3BURA 2HDJA 4JIRA 3U2CA 2HEJA 2PDYA 5LIUX 4H8NA 3NTYA 1EL3A 3N6QA 3G1RA 3M0IA 1EF3A 1VBJA 4XZLX 4WEVX 3ONCA 2I17A 3V35A 3C3UA 2IS7A 3R94A 3V0SA 2ACRA 3WCZA 3GHRA 3DOPA 1HQTA 2IQDA 2PD9A 4Q7BA 3LN3A 2BGSA 1AH3A 1PWMA 1Z3NA 4L1WA 2I16A 1XGDA 3FJNA 4PR4A 3GUGA 1AZ2A 4QX4A 5M2FX 2IPGA 4JTCA 2PD5A 3R7MA 3CV7A 4GACA 2PDKA 1S2CA 1MZRA 4PUWA 1ZUAX 3UZWA 4H7CA 1AFSA 2PDMA 3ERPA 4EXBA 4IJRA 3R6IA 4GQGA 3LEPA 5DANA 3F7JA 2FZDA 1IEIA 3BV7A 4XAPA 2HE8A 2INEA 1X97A 1Q5MA 2HVNA 4XK2A 2PF8A 3V0TA 3P2VA 2ALRA 2WZTA 2PDXA 4GQ0A 4QBXA 5LIYX 3GHUA 4WRHA 2PDGA 1MRQA 4DBUA 3UZXA 4JTDA 2F38A 1PZ1A 4WDWA 3RX3A 3UYIA 1XJBA 2HE5A 2F2KA 4XZHA 4LAZA 4LB3A 3LENA 2AGTA 3N2TA 1Q13A 4MHBA 3R8HA 1S1RA 4XVDA 2PDIA 3EB3A 4JIHA 5JH2A 1RY0A 3LUTA 1X96A 1ADSA 4JQ3A 4PRRA 1J96A 4JQAA 4WDXA 2PFHA 4YVPA 4Q3MA 3UZZA 2HV5A 1UR3M 1AH0A 3LZ5A 2R9RA 3O0KA 4LBSA 3UZYA 3D3FA 2IKIA 3GHSA 4JQ4A 2A79A 2BGQA 2IKHA 4IGSA 4FZIA 1YE6A 1LQAA 2IKJA 4QXIA 4ICCX 3LD5A 2DV0A 2FZ9A 3M4HA 1MI3A 2FVLA 1AH4A 4R9OA 1LWIA 2BP1A 4YU1A 2PDBA 3MC5A 4DZ5A 1X98A 1QRQA 4XVEA 4G5DA 3H4GA 4WDUA 2C91A 1R38A 4WGHA 1XF0A 3UWEA 1Z89A 4EXAA 3EAUA 2WZMA 1YE4A 1VP5A 1S1PA 2VDGA 3CV6A 3Q67A 1OG6A 4XZIA 3CMFA 5LIKX 1HW6A 3O3RA 4JTQA 2ACQA 2IPJA 4JIIX 2ACSA 1T40A 1AZ1A 2ACUA 3UFYA 1ZGDA 4GCAA 2J8TA 3T42A 4GA8A 2DUZA 4JQ2A 5HNUA 1M9HA 1FRBA 2FZBA 4XZMX 3B3DA 4OTKA 2PDLA 4NKCA 4XZNX 4LB4A 4JTRA 5C7HA 2PDQA 1YNPA 3CAQA 3Q65A 2CLPA 4DBSA 3EB4A 2QXWA 3H7RA 3LNMA 5JH1A 3CAVA 1EKOA 1PYFA 4GIEA 4YS1A 3BCJA 1GVEA 4GABA 2HVOA 2ISFA 2IKGA 3BUVA 2FGBA 5LIXX 3DN5A 4F40A 2PDNA 3WBXA 2DUXA 4PMJA 2PDUA 4HMNA 4QR6A 2PEVA 3CASA 4FALA 2IPWA 1RY8A 4YVXA 2PDPA 1Z9AA 3RX4A 4XO7A 2IQ0A 2R24A 1ZSXA 3S3GA 3LZ3A 3QKZA 3WBWA 3G5EA 3R8GA 4L1XA 3ONBA 4XO6A 2PDJA 3UP8A 2PZNA 1IHIA 2INZA 4AUBA 5LIWX 4PUUA 2PDFA 3UG8A 4JTAA 3LQGA 3R58A 1QWKA 3H7UA 1Z8AA 3UGRA 3LQLA 1K8CA 1T41A 5HNTA 1US0A 1RALA 4WDTA 4ASTA 1PZ0A 2PDHA 4LAUA 1PWLA 3V36A 3WBYA 3V0UA 5KETA 3FX4A 2NVDA 3R43A 2IPFA 3COTA 4JQ1A 4IJCA 1JEZA 5AZ1A 4LBRA 4HBKA 4FAMA 1EXBA 3M64A 4PRTA 1A80A 5AZ0A 4I5XA 4DBWA 1C9WA 3RX2A 4ZFCA 2PDWA 3GHTA 2FZ8A
chains in the Genus database with same CATH superfamily
2VOTA 1RCOB 4FIRA 1CPUA 3MDUA 4MADA 1PXGA 4V27A 5HA7A 3TJ4A 2A0NA 2WKGA 1XHGA 3B8DA 5AYZA 4F8XA 1IR2A 2VR2A 3GIPA 1I2OA 2EKCA 4G1KA 2ESCA 1D9EA 3DHFA 4XSMA 2YW3A 2W6RA 3E5BA 1E56A 4E6MA 1EL3A 3G1RA 4JTHA 4URIA 4CD8A 1EF3A 3PAJA 4R88A 3S2JA 1YDNA 4UTWC 3VX0A 1E0XA 2A2IA 2PODA 2W79A 4B5UA 2B7PA 1W1B1 2XH7A 2W4XA 4WIWA 4O12A 3DFSA 4GH1A 4AAJA 1HNYA 2P3ZA 1SFSA 4O28A 1OB0A 1RPXA 3KVLA 2NW0A 1IEXA 5HJXA 3ZR6A 4HYWA 5D05A 2VEKA 4HHPA 1VBHA 2HK1A 3HGRA 2CFFA 1AH3A 5BXPA 3PS7A 4W4QA 1B57A 3VUSA 4C5YA 3N34A 2PBOA 1VPXA 1W9BM 2QKFA 5M17A 1D7KA 1A0DA 4AWTA 1BTMA 4GACA 2OWCA 2DIEA 2JKAA 1PL9A 2Y1HA 2ZXQA 4RNJA 5A6BD 2E5CA 1TELA 3N15A 2XDFA 2Y24A 1IZJA 2E6FA 3I7SA 1VJSA 1XGZA 4IMDA 7TAAA 2CLFA 1XLBA 3ZR5A 2WK2A 1JQXA 1CTNA 2NVAA 2A21A 5AOUA 4E0CA 1W0MA 4HP5A 4K38A 5FF0A 4DF2A 1E6SM 4Y9NA 4YTSA 4C91A 4RKAA 3CZJA 1MYRA 3ZZ1A 4MNJA 4OWGA 4W8LA 3BWWA 4LANA 3W1NA 1I2NA 3GFYA 3SCQA 3AXIA 3UXLA 5M1TA 3WQDA 1FHLA 3SRKA 2VR4A 3CQHA 5K9DA 4QGCA 3B0YA 4LUIA 4AC7C 1XPGA 3C52A 4I9MA 4NYYA 1U1JA 4KEUA 5FF3A 4OUIA 1FWDC 1F4AA 2UV8G 1SFTA 1UD4A 3FKKA 4GIAA 2C16A 3L4ZA 3G0SA 2QCGA 5I6SA 2VD8A 2D0GA 3H2FA 2XIIA 4LCSA 2DSVA 3CPGA 1IEQA 3CUFA 1F7BA 1JIBA 8CGTA 3E3HA 1DP0A 2J9XA 1I6NA 1EUAA 4C6OA 3EX6A 1OT2A 3OVQA 4HTYA 2YL8A 3NEHA 3CEPA 4FZIA 3EEZA 1YE6A 2FH6A 4W8AA 1NSJA 3W85A 2YDRA 3S1XA 5AC4A 1SZEA 2QCCA 4LJ3A 3WK1A 4DVOA 5LNVA 5FL0A 4MPQA 1V6UA 4ZGYA 4ZE5A 3WD0A 4ZE4A 1H0GA 4KRUA 2EBNA 4YTQA 4QFUA 3IK2A 1O5RA 4ZBCA 3FDGA 1FP8A 2Z1KA 4FF5A 4LALA 1XYFA 3QBUA 3GAKA 4A22A 3WDHA 1TMLA 2PCEA 5C5YA 4UR8A 5HQEA 4ZO7A 2IW0A 4AMAA 1US3A 3DG7A 4DZAA 2DDXA 4P8UA 5D32A 1VZWA 1VGAA 2VDGA 1RD6A 1J6OA 1PPIA 2F9RA 1KM5A 5AKQA 3Q67A 2BMBA 1KV8A 4GUHA 1MXDA 3C0QA 1RD5A 4H4IA 4PTWA 2PGEA 4LUYA 3ABQA 4KKXA 4L64A 4GX8A 2DFAA 4BI7A 3PJXA 1AD1A 3GXPA 4CCZA 1MW2A 1UZDA 1DJIA 3MI6A 3ZVHB 3NDYA 1DXEA 2KZHA 3HG5A 3GO2A 4IZGA 4Q6JA 1FCUA 1H7PA 2JEQA 2YR1A 1H0IA 3ARSA 3SCVA 2GJPA 4JCMA 2E5DA 4ACZB 3U2OA 1FQ0A 2G41A 1EP3A 4IP7A 1HKVA 1KCLA 5C2XA 2VRQA 2VO5A 4JKLA 1ZRQA 1V6TA 5KSWA 4MLRA 3O0FA 3WFAA 2CLEA 4GISA 5DT7A 4EPKA 3KOZA 1ALDA 4GINA 2P1FA 4J1OA 3SW6A 4Q8UA 4DHGA 2QYGA 4FHAA 4MWAA 4XBSA 2VKZG 3EX3A 4CNTA 2Z6JA 4DWSB 3HJZA 3T4WA 4XBJA 4R33A 4AD3A 1ZBCA 5TQLA 1LWJA 4C5ZA 4J27A 2PZNA 3N18A 3OPSA 1B54A 1KBJA 3CZGA 4AHOA 4M1RA 2BV9A 3NQ2A 5GNXA 2YB4A 1G7UA 3WF3A 3E1F1 4IOTA 2BY0A 3CLWA 2PWDA 4PL1A 1FFQA 4WVXA 1TQJA 5I06A 3IIPA 2Y8VA 3STCA 2V2HA 1GQLA 4Q4MA 2PDHA 1XC4A 2W9MA 3ARXA 3N9SA 1PV8A 3T0BA 4UOQA 2BVWA 4N7QA 4HHLA 1G1YA 3W7CA 1XLDA 3W27A 4Z1YA 2JE8A 2Y6ZA 1P6BA 3GR7A 1W3JA 3DFYA 1J2BA 4HBKA 4AY8A 3KEHA 3BLFA 5MKGB 4PRTA 1RHCA 1QATA 4PB3A 3TW6A 3WK3A 4MDPA 4HN4A 1MQQA 3EOUA 1MZHA 4RPQA 2BSLA 3FOKA 4O15A 1SFJA 1YXDA 5LHEA 1X6UA 3WDPP 4K8GA 2VRJA 3GR8A 2ZADA 3E6EA 3DYOA 3U2CA 5DX7A 4JBRA 3TFXA 3CWHA 1UCWA 5EL1A 3VDGA 1GZ1A 3ZYZA 2WSKA 4KH2A 5IXEA 4S23A 1ICSA 3S6DA 3T0CA 3L4VA 1M68A 3T81A 3S46A 3W74A 1M53A 3TZNA 3E38A 3SCRA 3LN3A 3WNKA 2PLCA 4JAWA 3C61A 2DIKA 4FPSA 3RRAA 3TYUA 2DZAA 4HYRA 2Y63A 3PSWA 2G97A 1XQKA 3C0JA 3VFLA 4QS5A 3SSZA 5H8UA 3Q2DA 1ZALA 3OOQA 5FJOA 2WJFA 4FOJA 4W9TA 2XFRA 1X7FA 2PDKA 1JI2A 3TUUA 5G4WA 4ERGA 1W8GA 4KRZA 6REQA 4OBRA 1ITUA 4K8HA 5D8ZA 3EYPA 4ZCWA 4UR9A 1TX0A 1KLYA 4F0LA 1RQEA 3WX7A 2WVTA 3T44A 5FJTA 1FVPA 2O55A 1E55A 2A3HA 4DWSD 1BYCA 4CQAA 3MUZ1 5B7YA 1F3EA 2HS6A 2XHYA 1GOQA 1RBLA 2YJQA 5FSDC 5D09A 1O7AA 3MSDA 3MVTA 5I2UA 2OTDA 2WZTA 4JYFA 2PTXA 4HSOA 4F2BA 4NQ1A 1E40A 2J8FA 1XISA 3AYTA 3IRDA 3KHJA 4KESA 5HMEA 4ACYA 3RX3A 4C6EA 4AZCA 3AMGA 2ZIDA 1DJGA 1WBHA 4NF7A 4PCNA 5ENLA 1ODUA 2X2YA 3EDKA 3FCPA 4CCEA 3NA8A 7TIMA 3L66A 2QULA 3GU2A 3VFCA 5JH2A 1RY0A 4UMCA 4HYVA 4CNNA 2HK0A 2H3BA 1SW0A 2O9TA 1UKSA 3W4RA 4IPJA 4WSHA 2IXVA 1Q85A 3D3FA 3B04A 1TPC1 5D04C 4A2RA 4LCRA 3S47A 3AHTA 3H22A 3SAZA 2IKHA 3MP3A 3MSGA 2I57A 2CIPA 5H1WA 4IIEA 5C55A 3WO8A 4QXIA 1QR7A 3MZ2A 1G0CA 1TRDA 1CENA 1EJRC 4YLWA 4GXMA 1A5AA 4TX8A 4C90A 3TYEA 1Q6DA 4GH3A 2RDTA 2QIWA 2H3DA 3NL3A 5HMFA 2VZUA 1RH9A 5B7ZA 3PG9A 3WJSA 3RCNA 1CWYA 4RDVA 4ROPA 5C7VA 1SZNA 3UZ5A 4G7EA 2V3DA 4K2SA 3R25A 4KETA 3QGKC 4XVEA 1OWQA 2BZNA 3TJLA 1LOLA 3W1QA 2C91A 3UD6A 3UXKA 4RPPA 1AMKA 3FNDA 3OQEA 3W3OA 1FWSA 3VNMA 5CPNA 1WDRA 4LCQA 3QFWA 1EQPA 3I7RA 2J7HA 4C6MA 3VGGA 5BZAA 2ACSA 1AZ1A 1W3IA 4Q33A 2ZX6A 3KL5A 4MOZA 1HKKA 4U3CA 1OHLA 1IXQA 2PDLA 4D6EA 1OCBA 4PBEA 4NY2A 5BMXA 2OSXA 2GVLA 2Z6IA 4M29A 3LCIA 3WDQA 3D3AA 4ZOEA 2JK2A 5TIMA 2OSWA 3S83A 3M0MA 5LNWA 4DJFA 1UA7A 3CAVA 4S3BA 3WQCA 4CN6A 2ZC1A 4IMGA 4GABA 5AB3A 2EG8A 5T91A 3FGCA 2WSYA 4JNMA 1IT8A 2B7OA 4XG1A 5BOFA 5JIWA 3NQ7A 1MEHA 3W1MA 1Q4NX 3NEVA 2V5CA 1DWAM 1E9ZB 1N7KA 4QJ5B 1XYZA 2PEVA 1TR1A 3WDRA 3DKJA 2WKJA 5LSMA 1X7IA 1EWDA 2A3LA 4U2YA 2IQ0A 4F0HA 2OEMA 5MF5A 1LL4A 1S3HA 2R1NA 2VTFA 4TU1A 5T9CE 7REQA 3GSMA 2C18A 1GNXA 3GYEA 3VVGA 4JHMA 4FLSA 1GVRA 4MAVA 1EHAA 4Z1DA 2G4JA 1EJSC 4AZ6A 1HL2A 2YCLB 4NX0A 3ARZA 1EF2A 4B5TA 4GYJA 2VC7A 4W86A 1U5HA 4WDTA 1MQPA 2QR6A 4KGLA 3R0UA 1M6JA 2PPGA 3WBYA 3VD3A 4JD4A 3FA4A 3MWCA 3U48A 1GW1A 1WYIA 3QC3A 2WMHA 1TZZA 1BRLB 2SFPA 3N73A 3BQ6A 4Y7EA 1KM6A 2TPSA 4FI4A 3BVJA 4EP8C 1IR1A 4DBWA 3AXKA 3LRLA 2W61A 3N1AA 1IZCA 2YZ5A 4PCPA 4PB5A 3FV9A 3OBKA 2PWUA 4JFVA 2BDQA 5AHNA 4NAEB 3MDWA 1P0DA 1CZ1A 4JN7A 4GWEA 4WKFA 3RK8A 3JUGA 4DUOA 1DL3A 3CZLA 2WO5A 4DO6A 4C1NB 4AZIA 1DORA 4B3LA 2QDDA 2DQWA 2W91A 3DFQA 4HB7A 3W28A 3UG4A 1DTUA 2ZUSA 2J9ZA 3H8AA 3P8IA 3VIFA 2VC9A 1JZ7A 3TN5A 3WCZA 4RV3A 2PAJA 2XH2A 2G3MA 4O8RA 3WFZA 4AD4A 4UTKA 4EKJA 3PJUA 4O1CA 1PWMA 5FAJA 3RPMA 3KTCA 3PZOA 4J3UA 3CQKA 2WLZA 2EF9A 1AZ2A 1YBQB 3IS4A 4TIMA 2IPGA 3R7MA 3APYA 3IJ8A 3EDEA 4CQ8A 3LCFA 3RILA 5G1TA 1H7RA 4S3DA 2PBGA 1W8SA 2VQTA 3K46A 1MZRA 2D2OA 3EWBX 1VKFA 1AFSA 3GXIA 3QY8A 1WZLA 1WXZA 4I9AA 1LRTA 5T9BG 1UKPA 4NI3A 1THFD 5AC5A 1UR1A 2Q01A 1XLGA 1XIJA 4L4OA 1JZ8A 4PMDA 3TE9A 4LEQA 2HVNA 1JD7A 3BAKA 3W81A 1GJUA 1J9YA 2IUZA 3FHAA 3GRIA 2OEJA 1OT1A 4M82A 2YFNA 1UZHA 1MEIA 3NZQA 1EWEA 1IE7C 3SY8A 3PBYA 1MRQA 3QLDA 4DBUA 1AJZA 4Z2JA 5KTLA 3UYIA 3WLOA 4KQNA 4XZHA 4EPEC 5CLWA 2WCGA 3UR7A 4EAYA 1JVNA 1B4EA 3W7LA 5JQ9A 4B3KA 1Q7MA 3EWCA 3QRHA 3UWVA 5DO8A 3TN3A 3GNDA 3OEXA 5F4SA 3T0TA 2XYLA 3M1ZA 2WSPA 4Q8OA 1XSIA 1RVKA 2JIWA 1L8PA 1JF5A 1HX0A 4IIGA 4DLMA 4X61A 1ADSA 5EMLA 3GLCA 3HG4A 2FMNA 1KFKA 4DYKA 2VCBA 2PFHA 4XISA 4NZ4A 3AAMA 2Y88A 5AECA 1E43A 5CZ0A 4Q32A 1UR3M 3U9IA 4LVBA 4AXKA 3T09A 3QV6A 2OZ8A 3BJFA 4X9YA 4DNHA 3AU6A 1DHPA 2EPLX 1KWGA 2DZUA 1A3HA 2JF7A 3V18A 4P7LA 1GTHA 4F9JA 3CJPA 1XRSA 4GGBA 2F6XA 3EXSA 4S3CA 1Q3NA 4DO4A 4ZL1A 2QCMA 3P81A 4ZZ9A 1XUZA 3PAOA 5F4WA 1CXLA 3EDFA 3BSGA 5CJMA 5HAOA 4QDWA 4KPLA 3N4AA 2OZ0A 2QEZA 4Y9MA 1LWHA 1JDFA 3TEVA 1K8ZA 1UZ1A 2DPEA 3BOLA 4M6PA 3M0YA 1FWRA 4JNZA 1KA9F 2W66A 2PP0A 3QZ6A 3B8TA 3BCFA 4XKYB 4L56A 1UC5A 2VGBA 1Q6RA 3ATZA 2Z2AA 4C65A 4IFRA 3RNDA 1EYWA 1DQWA 4MFDA 1P5BA 1W6TA 1Y65A 3H21A 3KBVA 1YMYA 2V6AA 3LG3A 1WO2A 3UNDA 3DG6A 1TZ7A 4BF5A 3LPPA 4NZ5A 3W07A 2XSXA 4IP4A 3T42A 4B2DA 4M0XA 1E15A 5IOBA 2VFDA 3AZSA 1J5TA 1XLHA 2Y4SA 4XZBA 5BOOA 5E6YA 2ATSA 4LVGA 2XFFA 4AY7A 3N2XA 2OOFA 3CAQA 1TX2A 1M5WA 1N8IA 1Z69A 1E6QM 5I3KA 3G18A 4ROQA 1D3HA 3GYCA 1DWIM 1B4KA 3H53A 2E28A 1B3XA 2Y62A 4X60A 1JPKA 3NIYA 3OLDA 3RPDA 5EMUA 2QV4A 3EX4A 4I5UA 2Y89A 3FFSA 2WJZA 3PUOA 2F6KA 4FK9A 2PDNA 1NQ6A 4AD0A 2WHMA 2PDUA 4DAFA 3FYYA 2WPBA 5I23A 7PTDA 4X63A 4NJGA 3PPGA 3DESA 1Z9AA 2ZRXA 4A3HA 2Q8LA 3PZGA 4RDZA 4JFUA 2R24A 4UCFA 1NDYA 5F4XA 2Z1WA 1GZJA 1L8NA 3SIMA 4E4PA 4PODA 5HUPA 4UTFA 3HMCA 4NNBA 2R6OA 1FCVA 1QWKA 1WX0A 3CPUA 1XDMA 4S2BA 4TV5A 5LNUA 2EG7A 1K8CA 3O6CA 1V6VA 1VLWA 1XR2A 1R2SA 1RALA 4O0QA 4ASTA 3GVVA 1PZ0A 4CNSA 1T8QA 3W88A 3W7DA 4GGHA 3R43A 3P8JA 2PC8A 4UFMA 2YX0A 3VIHA 3BTNA 3TYAA 2PF0A 4PCFA 1RQHA 3QHNA 1ISXA 2G96A 1EJ7L 5AZ0A 1KRBC 3PZ9A 4M5PA 3D46A 2UY2A 5BU6A 4S3FA 3WBEA 3P74A 3C5QA 1BYBA 1DJQA 5I07A 3NFUA 5ECUA 3O7UA 3WG6A 2P88A 4J3SA 3PB0A 3Q4DA 2FKPA 3A4WA 4WQ6A 1DPMA 1KXTA 4GXPA 3LHYA 3N6HA 4BQ5A 4DBDA 3HGJA 1TE6A 5F7UA 2X41A 1DJXA 1TPVA 1WAWA 2QCEA 1WKDA 5LXEA 4RW3A 4WEVX 4DJDD 4PULA 3W1AA 3PN8A 2V3GA 4DPPA 2YFOA 3VZZA 3KAOA 1FWBC 1JDEA 2OT1A 3K4WA 5GVJA 1E1CA 1PTGA 3KP0A 4L6DA 5JBFA 1HO4A 2ALDA 2GL5A 3VA8A 4OZOA 2X1UA 3DOPA 1XM3A 3VNYA 3GFZA 3UA4A 1AVAA 3VM7A 4UNLA 1Q63A 4QHRA 4PR4A 1YIXA 4LPCA 2WMIA 2PA6A 1ENUA 2O56A 2WXDM 4D6IA 3QEZA 5BW6A 2ZRVA 3K8KA 3ABXA 1C92A 4IPLA 2YZRA 1W5QA 1PTAA 5D02A 4C6JA 4CQCA 4QCFA 1GYLA 1XFCA 1OFEA 2VNCA 4DM1A 3TONA 4HZMA 4IGMA 2VM8A 4NYUA 4PMOA 3N12A 1JXKA 5J04A 2X42A 4Q4OA 1UWSA 4WHBA 1UD3A 4LUSA 3A21A 3GY1A 2BY3A 2W0UA 1Q5MA 4FEZA 3TOYA 5HWNA 1WKFA 4CD7A 1QO5A 3HM7A 4W7VA 3WQOA 2A6LA 4MJMA 4E3VA 4GG9A 4BHYA 4QBXA 4RCXA 1Y5WA 1CXEA 2VEMA 3PSVA 5FEPA 1ZAHA 4JHOA 5J8LA 3UVIA 4UQEA 3B4UA 4FNPA 4LB3A 1LUCA 5AN7A 3IIVA 2G3FA 2I1OA 4AG0A 4WLCA 2UZ9A 4MHBA 1JL8A 1CLVA 1UPMB 2ZUUA 4HN8A 2TRSA 4KIEA 1V0KA 2V67A 4YL2A 2DT3A 3NR0A 4C6KA 2R8WA 2J88A 3DGRA 3F4VA 5GJMA 4D6HA 1EC8A 4N0RA 2W62A 2J7BA 2HV5A 1ZJAA 4PMUA 4HMEA 3BXWA 1E6XM 2JALA 4P7NA 4GBDA 1C9DA 4YJ5A 3IAQA 4XSLA 4ZA0A 3VMPA 5CBIA 4GX9A 4YN5A 1R87A 1WCGA 3M43A 4J5NA 5DXYA 3GD6A 3VIPA 1J5SA 1QW7A 3KHDA 2QCNA 3KL0A 4MKSA 1P0KA 2J25A 1XIFA 1MRAA 4EAMA 3WH5A 3T8LA 3UR2A 2GJNA 4BFAA 2QVNA 1KGXA 4EWND 1ZZMA 1P43A 3GVWA 1XKJA 4IQEA 3KS6A 3S9YA 2J47A 3YPIA 1UG6A 1UWTA 4DZ5A 1RVGA 3AS0A 3U4FA 2QPUA 1RLCL 2VZVA 4I6KA 3HJEA 3H4GA 4OBTA 2YSWA 3W0KA 4KWUA 2G3IA 3NG3A 3USBA 3VO0A 3LV5A 4HU8A 5XINA 2WZHA 2NV2A 2CWXA 4DY1A 1YE4A 1JGIA 1HKMA 3W2JA 4DI8A 4NHVA 3CMFA 2PGFA 3HQNA 2XIOA 1N8FA 4FXJA 1UWUA 1OGGA 3LB0A 3KVMA 4MM1A 2QMJA 4JYDA 1TB3A 4V33A 3UFYA 2A3EA 3S9IA 2GQ3A 9RUBA 1LL6A 4O17A 2VI0A 4DXVA 3EOSA 3VKBA 3TNOA 5XIAA 4NU7A 4MYAA 5I24A 1J10A 1I60A 4UFLA 1Q6QA 3W83A 3AYSA 4MB5A 1OX5A 3GXMA 3S2LA 4PBGA 3W37A 2RDWA 3R12A 1FDZA 1U30A 3AC0A 3L68A 1CYGA 1VHCA 3O6YX 3LX9A 3SJNA 1F74A 2WQPA 3QR1A 1W91A 4CD4A 3OVPA 3QZAA 1FFRA 2ABAA 1YHTA 1IF2A 3G3MA 3UZJA 2WKLA 4F2TA 1JCXA 2AAAA 5FOOA 1QPOA 3TTYA 5DCEA 5CGQA 3WD1A 4U5IA 2IPWA 4AFYA 1B3OA 2J7DA 2J8GA 1ZTVA 3CXOA 4BF9A 1ZSXA 3LRMA 2FTPA 2QDEA 3WSUA 1BKSA 3PWIA 1F5ZA 2RHGA 2YPIA 4Q4SA 1GWJA 1YPFA 3WL1A 2Y61A 3DEQA 3AXXA 3J7HA 3BAWA 3GH5A 3M41A 3TIMA 1GKPA 5DRIA 4YHEA 3ARYA 1GEQA 5CPLA 4CCDA 1MW3A 3BANA 3WLIA 1CNVA 3BK0A 2HCVA 4A2SA 3E96A 3ZLGA 3B0XA 3VZXA 2E9BA 4J28A 5HINA 1A4MA 3CHCA 2YYUA 2GVJA 4XV0A 4IQJA 1EO5A 1OZMA 2J13A 3IJ7A 1PIGA 2F61A 4ONVA 1ONXA 3E74A 1KKRA 1VPYA 3VD5A 4HCLA 3TYDA 4XUGA 3OP2A 9CGTA 3ANUA 1XIBA 3WLKX 3IAPA 4BS0A 3L5LA 4LC6A 1VH7A 4R27A 5LNRA 5I02A 4US5A 1QK0A 4DF0A 5FJRA 4DNMA 1R2TA 3THQA 1JFHA 3WH6A 3PHAA 3MWAA 2IQTA 3OYXA 1OFBA 2FLIA 2P0OA 5C2CA 2Z4GA 3W2MA 2W92A 1R5YA 5FJJA 2BVDA 3IVTA 4LYPA 3V5CA 4G2DA 3BSMA 4FLQA 4XAFA 1O12A 3MZNA 3WNMA 2FMOA 5DY2A 1VQTA 2BXZA 3R1ZA 3HO8A 4GKLA 4DJEA 4MWAB 3W2NA 4CD6A 4Q7BA 5ABFA 4DXXA 1C91A 2UY4A 1J0JA 4QQUA 4C6CA 3BGAA 2OQHA 2PGWA 2I7GA 4NX5A 3AIQA 3W86A 3H4XA 4QG6A 4JTFA 4UTIA 4PSRA 2DEPA 3PTKA 4Y8FA 2F8QA 2YA0A 4AEOA 2A4AA 3JS3A 2DT2A 1EJVC 3C2RA 2BG5A 3EPOA 2QIIA 2A6NA 5GJPA 3LNPA 4OKDA 5HNRA 3G1FA 1RXOB 5BNKA 2PDMA 3LEPA 1HGYA 3UW6A 2EG6A 3NQEA 3WL0A 3NL2A 3VKAA 3VKDA 1NM9A 1IEIA 3TKFA 2ANUA 3ZM8A 2ZE3A 2OB3A 1X97A 5D38A 3VYLA 2VC5A 3CUZA 1D7FA 5D2WA 4O0ZA 2MNRA 4GQ0A 4B9ZA 1GGOA 3K30A 3SCPA 4QJ4B 5DCBA 1E51A 1EZ2A 3TCSA 4PUJA 3BC9A 1BTCA 5I3JA 2WSQA 3TXVA 4L9ZA 3S1UA 1XBYA 2WPGA 2EJAA 3RDKA 4WUIA 4AZHA 1FUYA 1RCXB 4J9JA 1NFPA 4BF7A 4D72A 4GQQA 3NJ3A 5DELA 1EA9C 1O5QA 3R8HA 3K13A 3QV8A 2REQA 3BICA 2AQWA 3OYZA 1HJSA 5GNZA 4Z2GA 4FS9A 3L12A 1X96A 2X0SA 1UKQA 4TVUA 4IX0A 1KQYA 4PUDA 3WK2A 4GNKB 3N2BA 3AHZA 1A5OC 2F6UA 1J96A 4WJ8A 4CNPA 1X39A 3OA3A 3UZZA 1Y8BA 4KIRA 3PBVA 4ZTXA 3B9NA 4QAIA 1LOSA 2DUAA 1C8QA 2OELA 2NV1A 1UJPA 3LTPA 3M0KA 1VFSA 4GI9A 2Z7GA 1K7XA 3V16A 3GHSA 1QOXA 2VFIA 4Y9OA 2BS9A 1PVNA 4GZIA 1TO3A 4R53A 4GKTA 4GVHA 4DZHA 5DEZA 1M04A 3NPUA 2QUTA 1JYNA 4HPNA 4UZUA 6REQB 4XAGA 1E0VA 4HA3A 1OD8A 3CO8A 2FVLA 1AH4A 4GYPC 4AIBA 4PTXA 4IISA 2ISVA 4W88A 2DY3A 5AC8A 1JUKA 4MWAD 4Z1BA 2R82A 1YDOA 3VIKA 4CU8A 3MI3A 1TMQA 2DT1A 3AWOA 1X6LA 1ZAIA 3TQKA 4WDUA 2V68A 4CLMA 4CKQA 3DHPA 3KLLA 5DMLA 2DJLA 4GY0A 1QNRA 1E6ZA 5GPRA 1LRNA 3W25A 4A8IA 1YQ2A 4TMCA 2Q09A 2J75A 2C71A 1OM0A 3O3RA 4IQDA 4JIIX 4AZCB 1VFUA 3WENA 3DIPA 3AMLA 1Q6CA 1M9HA 1XKYA 3GFXA 3OLGA 4PN2A 1I0BA 4N42A 4F0RA 2Z2BA 2AQOA 4H7ZA 1C93A 4Y6GA 2BNJA 3W2KA 5KZ6A 4JFSA 3ZIZA 5M3WA 3UNTA 3E5PA 4RE4A 2YBUA 1PYFA 2V81A 2WNZA 1KGWA 2ISFA 1JZ6A 3IJQA 3LGEA 2C3ZA 5C9ZA 1W9PA 3UXDA 3S2CA 3OO2A 2HISA 4G7FA 5BXSA 4BWLC 3PZMA 4P8XA 3FYOA 1PDYA 1KW1A 4PMJA 1RJPA 4O10A 1NWSA 1EDQA 3S0CA 2EJ1A 1RV8A 3ABRA 4DAIA 1K1DA 3LGDA 3AXHA 1S2TA 1FWJC 1GT8A 4L6OA 3CHVA 3G8RA 3R8GA 3LGGA 3GH7A 4XTDA 4JL1A 4ZSTA 1VJIA 1DBTA 4MFEA 4TVCA 3TMLA 3IGHX 1XICA 3M46A 2NXIA 4KFNA 3I6RA 2GFTA 1FX6A 3QGAC 3QSTA 4JTAA 1TG7A 3LQGA 4N9BA 1M1BA 2FVMA 4RZ6A 1K9TA 5DLCA 1RP8A 2EEXA 2FJUB 3PNUA 3KW3A 9XIAA 1EIBA 4QQ3A 4G7EB 2NLIA 1V79A 3I7QA 3A64A 3H7UA 4GCXA 2RKXA 1R86A 1JCNA 3W7MA 4F2UA 4I8YA 5HNTA 3T0AA 5HR7A 2JBMA 3AMDA 4PEKA 2WNWA 1R3QA 4ZQOA 1BPLB 3GAYA 3AS2A 1L2QA 3GTHA 1ZB5A 3N9RA 4IJCA 1UP0A 3HPZA 3WH9A 1EXBA 1EC9A 3FA3A 5D30A 2XU2A 1PB0A 2D24A 2WSRA 3EPNA 3VE7A 3GZ3A 4KCWA 3BGJA 1V08A 5G4HC 2NVCA 4EPBC 1ZQ5A 1I1XA 4O4VA 1QNSA 5FAGA 2WBGA 4ZQMA 3TK7A 2C0HA 1A0EA 1T99A 4B90A 2AOSA 1QO2A 2D2HA 1XQLA 1I2RA 4M81A 1KFJA 3BURA 1PCKA 3BL3A 4B5WA 2VZOA 2YGYA 1KD0A 3N6QA 5KINA 2TMDA 2PUZA 1S5MA 2ZX7A 1REQB 2PRLA 5GQBA 3S9ZA 5JMUA 5AYBA 2QGHA 1K9FA 3AMCA 3UPBA 3K2GA 3ZS4A 1SFLA 4J7RA 3VPLA 3KL3A 5PTDA 2AGKA 4CUCA 1KBBA 2E9MA 1SSDA 2Y5SA 2E09A 4DYJA 5EBUA 1I45A 2AAMA 2ZYFA 3XINA 1FWTA 3K8MA 4PFMA 3WK0A 1H5VA 1GHRA 3BPWA 3TVAA 1YPXA 4L7ZA 5FEWA 1A53A 2QS8A 5HATA 4U31A 5HWJA 1AG1O 4ZOCA 2FHCA 1V8EA 1HP4A 3VOJA 1D8WA 4FXSA 3Q58A 3FKRA 4JX6A 4B9YA 1ISZA 1DV7A 1UW9A 3DERA 4C7FA 4GQGA 2WZIA 4Q8TA 4LUTB 2CHRA 1S5NA 4K3ZA 1EC7A 4YYFA 5I77A 2Z25A 1VENA 3UWUA 1MFVA 1CGUA 1HL8A 3WLHA 2QJNA 2XVGA 4AVOA 3JRKA 3P2VA 2H9AA 2ZXAA 3CH9A 4HT3A 1V3JA 1A5LC 4JX5A 3P7YA 3G3DA 1EB3A 4JTDA 2Y85A 3U4AA 2PI6A 5I3GA 4C1LA 2F2KA 4N9DA 4A3RA 4B4FA 2VGIA 2XM1A 3LI0A 2AGTA 1Q13A 3REQB 4WKAA 4DQWA 5B80A 4XVDA 1H7XA 3I68A 3M44A 3V75A 1HP5A 4HNOA 7ENLA 2PWHA 2NT1A 3LHVA 3EDDA 3VIGA 3SCSA 2ZOXA 4LF2A 4WDXA 1B31A 1YXYA 1TCMA 4KW2A 3CEUA 4HKPA 1U2YA 5BRPA 3EDJA 2P8CA 1W1IE 3F03K 3WBAA 2GUBA 2UY3A 2X40A 3QQ0A 4H2CA 1ICQA 4U5KA 3UZYA 3TN4A 3W7EA 2IKIA 1OCQA 3AIVA 1GUVA 3GU9A 4QIUA 4J35A 3DFPA 3TLQA 5A2CA 1N82A 1ICPA 1IIGA 3QPZA 2ISSA 2DW6A 4GXWA 1JF6A 4L80A 1S2UA 3VKKA 3VMOA 1P7TB 1MXGA 4QLKA 3AS3A 4E3TA 5E0KA 1YX1A 3KCJA 4NJHA 5D2TA 3IWPA 4U3AA 4R9OA 1BEUA 2BFGA 4HU4A 2BP1A 3GDTA 2OYLA 3O07A 1CBGA 1UZ4A 2DJXA 4AX6A 1T6MA 3T2OA 3VOHA 2ZTKA 3NSNA 3TSDA 3W24A 4HPJA 1KXQA 1R38A 3UJ2A 3H24A 1G4SA 3LCLA 4XZ9A 4F0MA 2BB0A 1OD0A 3BW3A 5E09A 2WVVA 4IT1A 3EAUA 3W6MA 3WQWA 4LV9A 3ZVIA 1SO4A 4WXYA 4GUIA 5C70A 3W7IA 4IMCA 4IMFA 1KXHA 3RLVA 2FDMA 3VE9A 2FYMA 2ZWYA 1IWBA 2DUZA 2OSYA 2WMKA 4MZ8A 6TIMA 2BXYA 3K1DA 3C3NA 4H9UA 3NO1A 4OTKA 3V5FA 5CC6A 2PTYA 1UUOA 3ATYA 1QK2A 4O1AA 4WGXA 1XIIA 3GG8A 1LORA 4DBSA 3QY6A 4LRSA 1F2JA 3INPA 3VNIA 4L65A 1JCYA 2EPOA 4PMVA 5FJIA 3T2QA 5K9CA 3GIYA 4H9XA 4W7WA 2VX6A 2ZCGA 2HRWA 5BMWA 1E0UA 4MY1A 3UCQA 5A6BA 3WUBA 4ALDA 3G1SA 3W1TA 2Z1XA 2HQAA 5KITA 3P82A 3L7RA 4HPXA 3WZ0E 1TSIA 2PLKA 3VMNA 3R89A 4IIDA 5HK4A 1IXOA 1R9YA 1OYAA 1SZGA 4B5VA 1AW5A 3ZT7A 3CIXA 4TO8A 3VCCA 3WBWA 4L1XA 3TOPA 2YOCA 2E68A 1IHIA 4NVTA 1YTDA 4U10A 2FPVA 1EPVA 2J77A 1D3CA 3SGGA 1FWCC 3VD7A 4DM2A 3N3MA 4HK7A 4P8VA 2ZX8A 4LXFA 1X1NA 4LGXA 3N2MA 5HPCA 1A4LA 2CYGA 3LQLA 3W7OA 5LKYA 2X1RA 2I14A 3I3EA 4WX2A 1VHNA 2ZXBA 1EQCA 3SFWA 3HU7A 1BSIA 1K7FA 2OCZA 4V28A 3UG5A 2TYSA 4MUPA 5KETA 4EF8A 1TIMA 1YLVA 2XGIA 2G50A 4WY0B 1KTNA 2FQIA 3OBEA 2PRMA 4D8ZA 3GB6A 4LBRA 1V4YA 3H2MA 4CEXC 5C8BB 2I5GA 2EPNA 2AL1A 4RR4A 4I5XA 2GGGA 4O0KA 4EIVA 4A29A 3GE7A 1QBAA 3RLHA 1Z42A 3TSMA 4B5SA 3PJWA 4MB3A 5DCDA 3P62A 5BXRA 1D8CA 3VXGA 3APTA 3N17A 1H09A 3WEZA 2HJPA 1RSCA 3Q37A 2QPXA 3GKFA 3LLXA 1FXQA 4OFCA 3KRBA 1ADOA 4O1EA 3IJDA 4JIRA 1XH1A 4B16A 2O92A 3CMJA 4R7OA 4MWAC 1PHQA 1TYGA 3QH2A 3O1NA 1UH4A 2O4QA 1VBJA 4B3ZA 4XZLX 3OA5A 3IGSA 3IJIA 3EXRA 4D2JA 2I17A 4PMNA 3WELA 2FHBA 4LVAA 4Q22A 1PDZA 3W7PA 2VGGA 4WOQA 4C6PA 2PTWA 1FWWA 3NGFA 4IIHA 1S2VA 1LROA 5I78A 2GSHA 5BWAA 1AQ0A 1IGWA 3SCUA 2V3FA 2XFWA 3SCWA 3PTDA 1ITQA 4LOCA 1TV2A 1MXSA 1PX8A 3SO7A 3N3TA 5IDIA 4LX4A 4Q4PA 1UR8A 2NSXA 2HXTA 2P8BA 1DJZA 3THAA 1J11A 4NT0A 4I8DA 3WQVA 4BWLA 2PC4A 3WQGA 1GQJA 5BCAA 4YNGA 3UZWA 2Y5EA 4FX6M 3GC2A 3MJMA 3P67A 4XWUA 2WMFA 3E2SA 1V3IA 3WQFA 4NAFA 4PBFA 1JDCA 1UASA 3KBJA 3AICA 1ZCOA 3ZT6A 2GSEA 4Z42C 1LZOA 3Q45A 4IIBA 2Y2WA 2ABBA 2WMGA 4XTIA 2DSKA 5AVHA 5EMJA 1S39A 3XIMA 2BASA 2I9UA 1EA0A 2PDXA 1IXNA 3OJGA 5H8MA 3NQGA 5FSEC 2X7VA 2HSAA 4XBKA 1I0DA 4MSSA 3L5MA 4I3GA 4WR3A 1NFGA 1XPYA 4K36A 4E5TA 1R85A 4WDWA 2AMGA 4HVXA 1F3WA 1UH3A 3QLLA 4M6UA 4LAZA 4E2OA 4JY9A 3GG7A 3OLEA 3LENA 2V69A 3QHOA 4FNRA 4TR9A 4ML9A 1VIWA 3A24A 1GVIA 1W5MA 2GK1B 2E4TA 3BLLA 3MUCA 2VEPA 2E0PA 5DMYA 4DRSA 1I1WA 3SCOA 1KGUA 3IIXA 1VCFA 4H6QA 1NU5A 3LBCA 4MNKA 1TCDA 4N4PA 4PRRA 1XLIA 1E5JA 2XWDA 4POCA 2PWGA 4Y9AA 5L9FA 1OX4A 1DXFA 1E1CB 3SBFA 1DIDA 1GKRA 4Q8VA 2FDSA 3O0KA 1K6WA 4IG2A 1DJHA 3S5YA 4O1BA 4MUZA 1ZHAA 2X09A 1B9BA 4KFPA 4QJ3B 3VU2A 1DWFM 1IWAA 4FNQA 5EB8A 3I3DA 2YKKA 4ADSA 5FF7A 1W1VA 3D47A 2CLOA 4CN1A 2NUXA 1JCMP 2FZ9A 2YA2A 3DC8A 3BDKA 3VM5A 1BFNA 1HVXA 1A0CA 1FKXA 3LLFA 4K39A 3K1GA 4XAZA 5IRPA 3P6LA 3CIWA 1MUWA 5IHRA 1XYAA 1B1YA 1W3TA 3N14A 1KR1A 2YYTA 1HL9A 1WAUA 5H6HA 1HKWA 1XUUA 2B4GA 1LYXA 1AJ0A 3VAVA 1I4NA 2V5KA 3MQTA 4YXGA 4PTMA 1EBGA 3DYMA 2DZSA 4O53A 2CBUA 1VEOA 2XINA 2ONEA 3EWXA 4A3YA 3E02A 4HNVA 1XX1A 2GVEA 3W70A 4W5ZA 2E6DA 3VX1A 4JTLA 1FH9A 1TRIA 2NUWA 4PZVA 3VDHA 3RMJA 3QR3A 1JG9A 3ZVHA 1AQHA 1HXJA 3LM3A 4L61A 2LLEA 3W1UA 1V51A 1V6XA 1NDVA 1YNPA 1Q8JA 2ZVIA 1HZYA 3Q65A 2YXGA 1AL7A 1SZFA 3LNMA 5JH1A 1OGBA 1QPRA 1QI2A 4H9ZA 2G4FA 3UXIA 2OPJA 4H00A 2E8YA 3W23A 4A4AA 4H9TA 3ZJ6A 5A3HA 1SZRA 2HBXA 1XBVA 3H54A 2XJ7A 4LNCA 3SUWA 2V2DA 1EOMA 4JCLA 1B3YA 1QPQA 4QR6A 1V5XA 3B0UX 4G6CA 1TQXA 1W3LA 3WH7A 4UFKA 3GTFA 2Z28A 3MP4A 2D20A 4H41A 4LS0A 4XD4A 1KCKA 1EDTA 3BLPX 4IXXA 2POZA 2E7FA 1VBRA 4QITA 3SCTA 1LLWA 1FHVA 3WLSA 3NAVA 3NPXA 1QW8A 2Q3OA 3TYZA 3NQFA 3K4AA 1P0BA 2J7CA 3ISIX 4PL2A 1W9DM 4KBXA 4H7VA 1RCQA 3M7WA 3SUTA 1EYEA 2ZTJA 5IHSA 4LC8A 3UU0A 4A3QA 3KBNA 4H1ZA 2Z0IA 4NNCA 3H12A 2WOQA 3EA3A 3V36A 4IPPA 1O1ZA 1TWDA 1BLIA 2OQYA 2ZUNA 2NVDA 4DUWA 3S1WA 1RLDA 2CHNA 4DIAA 3NVTA 7ODCA 2EKGA 3L4XA 1A80A 1FWNA 3FSUA 4DJFC 3MKVA 1C9WA 4ZFCA 1NDZA 3KWSA 1UIPA 3WDIA 2OXNA 3B0PA 3MMTA 1SM9A 2CNCA 2GZXA 1TPDA 4FA3A 1TJPA 4GJ1A 1TJ2A 4MB4A 3EX2A 1CGYA 2HDJA 3T07A 3L2MA 3UBPC 3C4UA 3ZJ8A 4XUYA 3RXZA 4D8LA 2ZZ2A 2V5BA 4AQLA 3SN0A 3E0VA 1KCZA 3DGBA 1OK4A 3OVGA 3O06A 3KFTA 2C1IA 2ZRZA 3QV9A 3B0VC 1T8XA 3IUDA 4JDBA 3L65A 3KE0A 1K4GA 4OJYA 3M5YA 1K7EA 3IVSA 3XISA 3DENA 3T6CA 4JTJA 1XGDA 2A5HA 5I00A 3R5EA 4S3AA 3NDZA 2WC7A 1UD8A 1DJYA 3W7QA 4JS3A 1T5AA 3IGUA 4CGTA 1MDLA 3S5NA 1R3WA 2A3CA 4F4RA 4NSBA 4UNIA 3MHUA 3UCDA 1UBSA 4HNTA 3L2LA 3KP1A 1WUFA 2P10A 2VEFA 4MB1A 1B2YA 1QDSA 1XXXA 4C1KA 1EP1A 4G8TA 3UESA 3TSBA 4N2YA 1BXNA 2Z27A 2YXXA 4O11A 5TBOA 4E2DA 1YPIA 3BV7A 2E67A 2OEKA 1W31A 1FWIC 4NASA 1C90A 3T78A 1KRMA 4UOZA 3UJEA 4KCTA 1A5CA 3W87A 2BODX 3SI9A 4GUFA 4CVWA 1E6NA 2C19A 3LM7A 2DZTA 1Q6LA 1SPQA 4CU6A 3MUAA 1F8IA 3LLDA 3LK6A 4QE4A 3DFTA 4IIFA 4C6BA 3TC3A 1XJBA 1PUDA 1SJAA 2ASHA 1J93A 3GTIA 4H01A 1YEYA 3MBDA 3HIJA 3RFAA 3HN3A 4O57A 3P60A 1G69A 4Z2HA 1WQ5A 3P0WA 3N6JA 1TWSA 4S1FA 5AC7A 1X8CA 2WVUA 2P53A 3W7GA 3QW3A 4IHCA 2RAGA 3OGRA 5HQLA 4C6FA 4LSBA 3DXIA 2C14A 3SRFA 3K8LA 3MHFA 2PWEA 4LBUA 2ZKMX 3WY1A 3MCNA 1A47A 3LHTA 1L0PA 3MI2A 3P3BA 4ZB2A 4Y96A 3PBMA 4LRTA 4JZ5A 4AZ5A 5ABFB 1XLCA 4BEQA 4KCUA 1JD9A 1PKMA 3HTWA 1P48A 1KFLA 3PY2A 2YDAA 2VYOA 4B4HA 1WNOA 4HA0A 4IPNB 4LY4A 1EJUC 1ZBWA 4ICCX 3A9BA 3P5ZA 4HJFA 4UTMA 1F6YA 4IMAA 1H1YA 3TTEA 1X38A 3IRSA 1KTBA 3PZUA 2QW5A 1L9WA 1KFEA 1W1A1 3PJTA 1MVYA 1ZENA 2YA1A 3H7VA 1L6SA 5CBBA 2ZUVA 3ICJA 2WHJA 2GVYA 3U7VA 7A3HA 3I65A 2O7SA 1UUMA 2ZA1A 4LVDA 1H60A 4JKKA 5HBFA 3NXLA 1K02A 1WXJA 4XQ6A 3QSRA 4AZBA 4S3KA 3W82A 2VFHA 2VVSA 3KVKA 1VFFA 3L23A 4M19A 3DAQA 1QASA 1VP5A 3BMVA 4OQVA 2E1DA 1OG6A 3IVUA 4GO8A 3URNA 3WQ8A 1H7NA 3L0GA 3GVRA 2CBIA 1VIZA 4J3VA 1IT0A 4GCAA 5U7SA 1XRFA 1LM1A 2JIEA 2V2CA 2CZDA 1A5SA 5GNYA 1P4CA 4HHMA 5G1MA 5A2AA 2XVKA 4ICMA 1OSEA 4Y8EA 4EACA 3BJTA 3QC0A 4HCHA 2OZTA 3M6DA 4MYXA 4AEFA 4CEUC 3MCOA 2G37A 3PWGA 4ZOBA 4W87A 3CUHA 4XIAA 2PMQA 1V77A 2V9DA 2Z24A 4IL0A 5E93A 2R14A 2A85A 2OQLA 3T40A 2F7FA 1LTDA 1H1NA 3ZJKA 2ZZ1A 4UQDA 5AVNA 3UYCA 4GZ7A 1XIHA 1E5NA 3B8VA 4US5D 4PEEA 3GK0A 6PTDA 3WLNA 3W1PA 5BOEA 3WD3A 1H2JA 1R46A 1P6CA 4N4QA 2OGJA 1OX6A 1QW9A 1E4NA 3LZ3A 4GD0A 5DQPA 5E1QA 1G94A 3VNDA 3THCA 5G5IA 1RR2A 1CCWB 4P61A 4M1BA 3C2VA 4DJED 3E0LA 4DPQA 5G2HA 1FBAA 3H2CA 2YCLA 3NZGA 4JYEA 2VWSA 3PG8A 1T41A 3R4IA 5EBAA 3AUJA 4K1WA 3DZ1A 1XCXA 2J7EA 1QOQA 3TTSA 5K7JA 2E6YA 3O9NA 1E4IA 3N2CA 3KDOA 3V0UA 3FX4A 5HJYA 2PZ0A 1ZL1A 2D2GA 3COTA 1E9IA 3NPWA 3SQSA 4AWEA 4WJXA 4QM1A 4S2CA 2KX9A 2CEQA 3W01A 3C6CA 3DHDA 3FJ6A 1JQVA 5IDZA 3W6YA 4QJ1A 4FSAA 1DIKA 1YKWA 1RJRA 4P7QA 3TQVA 2OO6A 4HU0A 3VIOA 4PUKA 1XLAA 1GVSA 2XN0A 1G4TA 4NAEA 3L0KA 4O18A 1EXPA 4Q4QA 1ZU8A 1A50A 1LLOA 3M47A 4FP1A 2QDGA 3AI0A 3LDVA 3IJ6A 3VNKA 3R0KA 1TTQA 6ALDA 1QI4A 3WEMA 4C1NA 1UHVA 3I6EA 1FH8A 1JNEA 4JEQA 3M0IA 3FS2A 3A5FA 3PWAA 4PYSA 2YCIX 3WQ6A 3V35A 3QQ1A 4BI5A 4HCDA 5IBXA 3FJLA 1TTJA 3BLKA 4NUWA 3R94A 3MO7A 3R2GA 1GPFA 2D69A 1GJWA 3C2OA 3L5AA 3SURA 3BLEA 2R94A 1AQMA 3OZYA 3AIRA 3UWYA 4NI8A 4QSHA 5F2IA 2DZVA 1JZ4A 1VEMA 4H8HA 4KGJA 3FW6A 4JIQA 4Z2KA 3PPFA 1FXPA 1K70A 4HNCA 1TVNA 3GWQA 3DC0A 4TTUA 4IH3A 3EGJA 4FX8A 2QJGA 4ZQRA 4GC4A 3LSBA 5KZDA 3GNPA 3IUIA 1M7OA 2OZ3A 1PE1A 2ADAA 4PB4A 4XB3A 4E38A 5U4NA 2JQXA 5ABHA 2J6XA 5A6JA 2RDXA 2YCKX 3IEBA 3VIJA 3VKJA 4QNEA 2PTDA 4X3ZA 5CQ1A 2PF8A 3CTLA 4FNSA 5AHMA 1Y7VA 4IGNA 2MANA 2WQDA 3BG3A 3WNPA 3GDMA 2WW5A 3BARA 4TXEA 5CH9A 5EMYA 1UPPA 3QHMA 4GJIA 4H04A 1ECQA 5EFDA 1P6WA 3V4BA 4DXKA 2QZRA 3CQIA 7XIMA 4YWIA 1FDJA 4GBUA 4W84A 3EB3A 1IEWA 1ZJBA 4H9VA 3HQPA 2C13A 3UG3A 4X2PA 3LSCA 3A12A 1J8VA 2I9EA 3GW3A 1JZ2A 3T8QA 4ZB5A 5F1VA 2X30A 4RDWA 3TA6A 1S2WA 3H70A 3STPA 1EOKA 4GNJA 2XH0A 5C9UA 1MEWA 3TDFA 4RLIA 1XG3A 3ORWA 3E9AA 4UUIA 1RA5A 1H61A 1ITXA 4JTKA 3M07A 5C9WA 2QAPA 1X6NA 1CB7B 3S5SA 3MUIA 4BQ3A 2IKJA 3EEGA 3A47A 2Q3RA 3SQMA 3KOWA 3NXFA 2ISDA 3NOEA 2VXNA 1DJNA 1Q66A 2VR5A 1NFBA 3URAA 1E9LA 3EWWA 3EKLA 2PDBA 5AYIA 1US2A 1AUSL 3G77A 3EX1A 4W85A 3EMQA 1LT8A 4RL3A 4GVFA 4GI4A 1E3XA 1P1XA 5CPQA 4H8UA 2FZNA 1QXLA 4FOUA 4AD1A 2WMJA 4NJIA 4ATWA 3VCRA 2H9AB 2EXOA 5I3FA 2QCDA 3RF9A 2BOEX 4LT9A 1KFCA 1CXKA 4ZQPA 4GVIA 2CETA 4FMVA 2VQUA 2AKZA 4O4WA 1AL8A 1KR0A 1EJTC 3LBMA 2ZA3A 3SN1A 5K3VA 4DJDA 1EHNA 1I75A 2FIQA 3RJXA 1W32A 2ACUA 1KWKA 1JJKA 3SN4A 3QOMA 4FX7A 3A9IA 2NWRA 4QP0A 1U5JA 1WOAA 4RJEA 1B30A 2XISA 4IFKB 5CC5A 3RCMA 2I56A 4JTRA 4G56A 4KF1A 1NTHA 3CV2A 3VOFA 2NUYA 1XC6A 4GNVA 3WMSA 2GOKA 3RR4A 3KLKA 1FHUA 5AHIA 3AYRA 3WF2A 4TMBA 3KTXA 3WKZA 1EKOA 3O6DA 4INFA 1E72M 3CZ8A 4OOUA 4G9PA 2FGBA 1J01A 2ZX5A 3RO8A 2DH3A 4MIMA 4ZXLA 3CT7A 3KWXA 2QT3A 5DXXA 3HB9A 1VEPA 3LA4A 3G6MA 2OLHA 2GJLA 3N9KA 4UNKA 2ZWZA 1K9DA 3MSRA 1HTIA 4I6VA 4Y2WA 3ANVA 1E9YB 1F61A 4RV8A 3PZIA 4YTRA 2HS8A 2XGZA 2GDUA 2R1LA 3W73A 3N2OA 3FYPA 3W6LA 1G01A 3G5EA 1CEOA 2ZUTA 2HROA 2P76A 2PDJA 4N6EA 3HZ3A 1B90A 2EQDA 3EKZA 3WNNA 2WLYA 4WXZA 2Q6ZA 5D9NA 5HDRA 4FNUA 3NNTA 2Q8ZA 2QGYA 3ALGA 1A5NC 5A6SA 1EH9A 1PX4A 2BXVA 1OCNA 4R7WA 4H2HA 1F76A 1HKIA 3KX6A 4U2ZA 1TE1A 4ZFMA 1B3VA 1UD5A 3DKLA 4RW5A 2C0AA 4CCCA 2WVVB 4TX9A 4C7GA 2C8NA 3CH0A 1FCBA 3C56A 1W5NA 2Y0FA 2Z2UA 3AXMA 2GQ8A 3W7HA 3OHMB 3BOXA 3O16A 5HULA 2Y70A 1JULA 3ABZA 4V1YA 4ZB0A 4C60A 2FGZA 5EGRA 5JVLA 4QISA 1EGVA 2HNHA 3ARUA 3RM9A 4RZBA 1TPWA 4GPNA 2OODA 2B7NA 2VZTA 3ARVA 1S2AA 1ESWA 4HNLA 1C29A 1GQNA 3VILA 1O5XA 3C0LA 1YNQA 2CKRA 3MYPA 2HEJA 2JFEX 1XLEA 4KMQA 3FLUA 1YW1A 3R0DA 2ZRUA 3GNRA 4S3JA 3BGGA 1G9HA 3UEQA 2E25A 4C6QA 2Z29A 5HANA 3EWUA 3HV8A 3DCPA 5CZTA 3VABA 2WCAA 2V5JA 3CK5A 1W5OA 4REQB 1F8MA 1ZPTA 3L4YA 1Z44A 1PEZA 4JTIA 1W37A 4FLOA 3GDRA 3LCWA 5C6MA 1Q7QA 2VGFA 3V1PA 1LF1A 1GQKA 1H63A 3S42A 2CC0A 3GUGA 3ZWSA 3WNOA 4ERIA 1QTWA 3AZTA 2XZ9A 2X0HA 2NX3A 3HMJG 1BGAA 4QX4A 3NZRA 2A7NA 3QFEA 3HA1A 3MKKA 3ZWTA 1A3XA 4HOXA 3T55A 4H9YA 1POJA 1XDLA 4WCJA 3ARQA 3LHUA 5AY7A 4PUWA 1ZUAX 3IANA 1UD6A 1DHKA 2ZXDA 1WV2A 1V93A 3W72A 2B31A 4ZSUA 4RDYA 3GBEA 4UIOA 4PSPA 1LBFA 1HN1A 1N2VA 4ADUA 3MO4A 5A6MA 4UFJA 3UJFA 5DANA 3SSJA 5K2ZA 1PO9A 4E2VA 4L9YA 1VJZA 2VUYA 1SMDA 1WDWA 1XH2A 3SB0A 1BF6A 3ITGA 2A1YA 5FACA 1WDSA 4I90A 4AD2A 2GJXA 2X05A 1DQUA 4Z2LA 2PDGA 1OYBA 2HZGA 4OE7A 4CQ9A 3OU8A 1H1ZA 4IL2A 4LYRA 1FWEC 3AIUA 4WD0A 1AQFA 5FD0A 3SDOA 2V8ZA 1Y5VA 4EX4A 4O8AA 3W7NA 3SADA 1ONEA 1F6PA 4IX2A 3UWZA 1XW8A 2VRKA 3DI0A 1NARA 3ARRA 3PUGA 1J4EA 4DJEC 4Q6XA 1G5AA 4JIHA 3DYPA 4A05A 1HO1A 1VFTA 3ES7A 1UMLA 1Z48A 4L4MA 3CT2A 1RK5A 1PCWA 5DF0A 4UFIA 1AK5A 3OZMA 3BW2A 3HGSA 1VAHA 3PNZA 4LS2A 2O4MA 2DVTA 1ZJHA 1UD2A 1OIMA 4MG4A 1ELSA 2ZC8A 2CESA 4LBSA 4JTSA 3OG2A 3BSHA 3O2LA 4YYCA 1XP3A 2V5DA 4J3WA 1VD6A 4O50A 6CGTA 3W22A 3GNXA 3E0WA 5AYXA 1HUVA 5HXMA 3R79A 1LQAA 5F1UA 2OLAA 3L0NA 3RHGA 3MYOA 4S38A 2OU4A 3WLRA 1W3NA 5REQA 3C86A 1CB2A 1VRDA 1NF7A 1UA3A 4CD5A 4NAFB 1LWIA 2RFGA 4UTHA 3R13A 4FOKA 4KCVA 3N4FA 2G95A 1RPKA 4QRNA 4US6A 3GM8A 4NJJA 1E4MM 1JCTA 1LCOA 4QNWA 3N19B 1RQBA 5CGTA 2BBFA 5A2BA 2FGLA 3HV9A 4KWWA 3BAJA 5JBDA 2VHLA 4E8DA 1E1EA 3H2OA 2ZUWA 4JTUA 4ZVJA 3M9YA 1DEDA 1H5YA 2VMFA 2BVYA 3CV6A 3P93A 1AMYA 2ZZ4A 3WH8A 5FJPA 4AEEA 1XIEA 4NZJA 2NLYA 2H90A 1QBBA 3ZO9A 1PKNA 5C9RA 3ZLHA 1J0KA 1L2UA 4Y90A 1KLZA 4OIFA 2B81A 1XWYA 4UB9A 4LB4A 3I4EA 3H4WA 4DO7A 4AXNA 3QMTA 3E0IA 2HPIA 3E2VA 3M6YA 2QXWA 3W7KA 2UBPC 1VBUA 2WC3A 4KWOA 5EPDA 1R3VA 3VZYA 3ARPA 1OX4B 3H2NA 2DZBA 2DGAA 2HVOA 1XLJA 1XRVA 2IKGA 1Z6KA 3MANA 4O14A 1PIFA 5CC7A 4Z0JA 5JBEA 4IG2B 2BY1A 3CUIA 2EHHA 3VNJA 5DBTA 4AYSA 2Y8UA 3PZNA 4KT2A 3HURA 2P50A 2YL5A 1TVPA 1Q8AA 3LPFA 2QV5A 2RH9A 1NEYA 1UOZA 1PAMA 2QUMA 4R34A 3Q94A 1WPCA 1R8LA 1VYPX 2HTMA 1OFQA 5CAHA 5CG0A 1RY8A 3AHYA 1NP2A 2FHFA 1FKWA 1JPDX 3B8IA 3WQ4A 2J74A 3AYVA 3QKZA 2CLLA 3ONBA 2PTZA 3OVRA 3VKCA 1NELA 4GO9A 5BYWA 4MJZA 5CJNA 4R9XA 4QG8A 4CVUA 3II1A 1U33A 2NSOA 1QJWA 1W1TA 1EEPA 3ZXWA 3QY7A 4RZ4A 3IK4A 4J4KA 1JUBA 3GX9A 3HF3A 3K5XA 4NXSA 2ZFAA 1V0MA 1HJQA 3ZSTA 2D3LA 4GQRA 5C54A 3EXTA 3ITCA 3CBWA 3B9OA 4ZO9A 2YB1A 1JYWA 3ZSSA 3WLTA 5CZKA 1W1ZA 3KTSA 5EU9A 2PGRA 3ITVA 4OHQA 2QJJA 5CG7A 5D9PA 1EZWA 4PCTA 2FFCA 4RNIA 2DU2A 3S2NA 2W27A 4CQBA 4LUJA 3WLQA 2QUNA 4C7DA 2PDCA 1FCQA 1BQCA 4HIBA 2ZRWA 1M7JA 2WZEA 3RJYA 4JEJA 4KWSA 2DSZA 3TU9A 3BMWA 3NTYA 1XG4A 4HTBA 4JPGA 4L4PA 2FFIA 2PRHA 2NQLA 4DZIA 1L6GA 3PUDA 3PF3A 1JYVA 1S5TA 1GOMA 4L6HA 4ZO8A 1PYMA 4MWAE 2CLKA 5CKSA 1J79A 3WLPA 2Z1VA 3NM1A 3LHZA 2IS7A 3LI1A 4IF2A 4D71A 2QMKA 4JFTA 3NUKA 2EGZA 2PD9A 1NOUA 1XIGA 1Z3NA 2VEIA 1XV8A 2I16A 1NOWA 3PULA 5JXQA 1BVWA 2GDQA 1LT7A 3HQOA 3VCNA 3CUJA 1A3WA 2CZVA 1UOKA 5HPOA 5D2XA 3MKCA 2BHZA 3CUGA 4LYKA 3T0DA 4LQ1A 1O94A 2CLHA 1U5VA 1EPXA 1BWKA 2P3EA 2WJDA 2NWSA 3HG3A 3W1LA 5LA2A 1BYAA 3EA1A 4IPIA 4DUXA 3MTWA 2G5WA 8A3HA 1EFZA 3B4YA 4B92A 2PWFA 3BOFA 4XAPA 1H62A 3WJWA 5LHFA 1YDVA 2INEA 4GC3A 2XTKA 1NQKA 1LG1A 1RK6A 5DBUA 5AHLA 2ON3A 3RR1A 4AC1X 4O13A 5D37A 1IIHA 3ITXA 3QYSA 4EOUA 3KS5A 3MU7A 2VFFA 1OFAA 4HSNA 1FWAC 4F79A 3QJAA 5E5CA 1J0ZA 4HPGA 3DBNA 1GOOA 2AKMA 4ZQNA 3URBA 3FY1A 5CJ5A 1UR9A 2XVNA 2B0MA 1NH6A 4AB4A 3TJXA 5EA9A 4PUMA 2V30A 1LOQA 3VOIA 3BG9A 1ME9A 3CU2A 3EPMA 4KWVA 1S1RA 4NJKA 1I2QA 3FAWA 2DW7A 5CBJA 4EWJA 3O8AA 1EP2A 3GQYA 1KBLA 1HIZA 4IWWA 1VCGA 3A3WA 3T08A 1JNDA 2VT0A 4YVPA 4Q3MA 3TW9A 2GUYA 1EJXC 3E2RA 1XYLA 7CGTA 3KRSA 3B05A 1AH0A 1WDQA 6A3HA 4RE3A 1J0IA 1ZFJA 4OBSA 3W76A 2A79A 4ICNA 3VK5A 3B9AA 1V3KA 5CGMA 1AODA 3UF9A 1BWVA 4GFSA 1HF6A 3N25A 4AVFA 3CPRA 2D3NA 2NV9A 3KVJA 1UKOA 1EX5A 2XUCA 1F05A 3HQ1A 2ZX9A 1TTIA 4FR1A 3WN6A 1LBLA 1MSSA 2J6VA 4WKHA 1HFBA 1E6RA 3I4KA 1ZY9A 5K4ZA 3FA5A 3TN6A 4JR5A 4DO5A 3PPHA 3SRDA 2W63A 4I9JA 1X98A 3QQWA 1G4PA 3R10A 5D4YA 2CCRA 2GWNA 3WYZA 2G0WA 4GJJA 1UJQA 1L6FA 1SO6A 1V0LA 2QJMA 4MVAA 3P84A 1LLZA 3CGTA 2TSYA 5CEWA 1WKYA 2R91A 3NQ6A 4XZIA 1X1OA 1ZP3A 4JTQA 3RMEA 3ALFA 3MT1A 1T40A 1BAGA 3TR2A 5HNUA 3VGHA 2F2HA 1OJXA 2Y7GA 1KTCA 1LQ0A 1SW3A 4XZNX 3AWNA 3S4TA 1LRQA 1VBGA 1K9EA 1OF8A 3ARTA 2PP3A 1PKYA 2WNNA 4GUGA 4QSFA 5E70A 1NWUA 3FVMA 3LTYA 4FNTA 1WOBA 1E0TA 3L2IA 2Z26A 1VFOA 3GDLA 4UTJA 2VD9A 3U3HA 2AL2A 1U1HA 2QPSA 4J40A 3ELFA 1CX9A 2X1SA 3TWAA 3CO4A 3UY7A 3DX5A 4PMRA 1WDPA 2ATMA 1XRTA 2DUXA 1ISYA 2E40A 1OINA 2CHOA 1CECA 1XI3A 4FALA 1OG0A 3DFHA 3UR5A 4M56A 3OZPA 1F9CA 1CXFA 1BVZA 3N4EA 4YVXA 2CZ5A 3FXGA 1GVQA 1PKLA 4UTWA 2YLAA 1ZAJA 3UP8A 1OFDA 4MPKA 4ML4A 3GU1A 2INZA 4RXGA 4PMQA 1E1FA 2NQHA 2IMRA 1YXCA 5ABGA 1LBMA 1I2PA 4QG9A 3CHDA 2D23A 1GONA 4ZEPA 3M0ZA 4N6FA 4E4UA 2GOUA 4H3DA 2VC6A 4BJHA 2ZQ0A 4HQVA 1GOIA 2Y7EA 1QFEA 4V2XA 4BQ4A 1OFPA 3WIJA 2CBJA 4MNLA 1UP2A 5TNVA 1JZ3A 1OF6A 4XD3A 5FEXA 1S5VA 4MF4A 3VIIA 4HD5A 1W3KA 4ORIA 1MMFA 1E0WA 4YHGA 3H6OA 4LFYA 4A8RA 1BGGA 2GWGA 3QF0A 5DMNA 5FCZA 2W5FA 4DBEA 1H4PA 3SR7A 3TNBA 4AW7A 4U28A 1ONWA 2EPHA 3G1VA 4UQCA 3F4DA 3LBOA 2ISWA 1SYTA 4YWSA 4M80A 4BA0A 3QV7A 4C6NA 2B7QA 4PMYA 1Q65A 1XYCA 4H8NA 4GMEA 2Z1BA 3VTRA 1O66A 1T96A 3VNZA 2BHYA 3AHXA 1REQA 2X7WA 3ONCA 2CPUA 4NRSA 2PU1A 4Q8PA 2GGEA 3BH4A 1I8JA 4HHHA 3B8SA 4BKNA 4JHZA 3L67A 4MNMA 1TPB1 1HQTA 3SECA 2HNEA 4UFHA 4BR1A 3N11A 1Q6EA 3B06A 1U22A 2O7QA 2CERA 2BY2A 4K7YA 1F3TA 1EGMA 3ZR4A 4LS1A 1I9CB 5G2IA 1CGVA 3MV01 1E4LA 4JTCA 3D6NA 1R30A 1XLMA 1IEVA 3OQ8A 1S2CA 3CIVA 4O54A 4XD5A 2JGYA 1WA3A 2VZSA 3UJSA 4I9TA 4GE8A 3PTQA 3TQ0A 1KNWA 3ZQ9A 3NURA 3NGJA 4BY3A 1UUQA 3PZVA 1GCYA 2H8ZA 3EBVA 1S5WA 4R5EA 3WF4A 3F2CA 2H8XA 4LUTA 3BE7A 3V1HA 4ILSA 1M65A 3GXTA 4ERAA 1OC7A 2BLEA 2ZZ6A 4ES4A 3THDA 5EY5A 4FB7A 4WJEA 3P0XA 3TWBA 1N8WA 1R2RA 4J3XA 4HNNA 1QI0A 1E71M 3A22A 1YRRA 3VDAA 3TMQA 3JU2A 4MZYA 4OVXA 3UZXA 2OKOA 1EUNA 3ITYA 3FK4A 5H91A 3GC4A 1V6WA 3L21A 5DY3A 4Q8NA 3NSMA 2BWGA 5FF4A 2QVHA 2YCJA 1NP0A 3N2TA 1KM0A 3REQA 1LJYA 5C2GA 2G3JA 4GZEA 3NO3A 4O1FA 1TJ0A 1M7PA 3NYDA 3NDOA 1TWIA 2D1ZA 3OIHA 3H55A 5A6KA 4W7UA 3BMXA 1PIIA 1NY1A 3JR2A 3SGZA 3KCOA 2CBVA 2W67A 3TXZA 3APGA 1HKJA 3IIZA 4HK6A 4KRTA 2GSJA 2R9RA 1TKKA 2OX1A 4RE0A 5HOSA 1CXHA 3SQLA 4Z08A 1OZQA 2J9YA 2BGQA 2FZMA 1PZ2A 2J66A 4ZMGA 5HNNA 2RGLA 3LMZA 1CLKA 1P7TA 1XDJA 3QKEA 1HJUA 2C7FA 3G2GA 4OUEA 5FKYA 4L5ZA 3LD5A 2OT0A 1VF8A 3M4HA 1M03A 3MP5A 1A5KC 1WZAA 1Q2RA 1XS2A 1MI3A 2OR2A 5LGXA 2PB1A 1R6WA 3VINA 4FIQA 4RZ5A 2WNQA 1OGSA 3UWQA 3G22A 5AHEA 3M0JA 3G1YA 3AIWA 5LNSA 2Z7KA 1QRQA 5KEZA 1UP3A 3VGDA 3CLMA 2PLMA 3CWOX 4UZSA 1UWAA 1WZMA 2KAUC 1EBHA 3MPGA 3GC5A 4WGHA 5JU6A 1B9ZA 2GGJA 1XF0A 1CDGA 3TX9A 3UWEA 4DF1A 4MJ4A 4Q7IA 4EXAA 1NF0A 3S5OA 3CQJA 3VGEA 1CT5A 1YDYA 2QDHA 2JGQA 2I5QA 2J27A 2Y7FA 1W5PA 3WMBA 2IPJA 3POHA 3THUA 3T05A 1E70M 3JW7A 4HZ6A 1OADA 1TPEA 3AOFA 1ZGDA 3M16A 2HBVA 1FRBA 3MY9A 1G4EA 3P61A 1UIOA 4EK7A 2QHAA 1GJPA 5A8MA 4D6CA 3CL7A 4M6QA 4HSHA 5I3DA 3M0XA 3O63A 3M0LA 1SU5A 4PMXA 2Q8XA 5I79A 2C79A 1K4HA 1VPQA 3M5XA 1OC5A 3PK7A 3ABSA 2L5HA 3EWZA 2VELA 3E0FA 5HWMA 1V6YA 3FGCB 4GK8A 3M0HA 2FPYA 4XKMA 3R11A 5I03A 2V63A 2OO0A 4OV4A 3W9ZA 1R0MA 2G8ZA 2YDSA 1TA3A 3W00A 3DDMA 3STFA 1UYQA 2DORA 2J78A 3UETA 3H2AA 2OGYA 1KM1A 4M51A 3UPWA 1Q7ZA 1PSCA 1CGXA 5A69A 2DVXA 3CWNA 4FXFA 4O16A 5A94A 1F07A 3G1XA 3PFMA 4XO6A 3IARA 4RX0A 4MJ2A 7REQB 2IXUA 5LGZA 3L9CA 4AHQA 4AUBA 3CYJA 4PUUA 3U5YA 3GTNA 3GUWA 5A8NA 1NWRA 1VR6A 3MMWA 3WD2A 2A7RA 4PCSA 5EMKA 3ZLFA 1SVDA 1LG2A 1H51A 5LYRA 3VDBA 3EOEA 2QCDB 1SUXA 4NZ3A 4JXCA 3KZSA 3IACA 3PTMA 3ENLA 4EVZA 3F1QA 4YTUA 1XH0A 4WY0A 3SZ8A 2HXUA 1ME7A 1W9VA 1JEZA 3OGVA 4D8AA 2CXEA 1O1HA 3GZAA 1M3UA 3FVDA 4GIRA 1NWTA 4LF1A 1PJ9A 4DLFA 1DTNA 3I6TA 3RX2A 5D03A 4KFOA 4M7TA 5CCZA 4F9DA 2P5NA 2XFYA 3U2EA 5CPMA 3RRXA 4L1GA 5I3HA 1RZMA 4Q4KA 1IQ8A 1QOPA 4D9PA 5J5DA 1RP9A 3ID7A 2OG9A 3C2YA 3T4CA 3GNOA 5CZSA 4Q8MA 4DWSC 1RBOB 5A6LA 3KUMA 3HFTA 4DN1A 1QHZA 3PBWA 5FIPA 3K4DA 3W1XA 1KKOA 4LAKA 3OGSA 4I7VA 1FDYA 4UQ9A 1KC7A 2XH4A 3GHRA 3VOCA 1FTXA 5F2LA 1R3TA 5M5DA 3KXQA 4L1WA 2Q02A 2NQ9A 4FF7A 1J0YA 2RJGA 1JPHA 1KQZA 3FJNA 3FXYA 4DJFD 2GDVA 3RYSA 5FI8A 3CB3A 5M2FX 1W2PA 5A8QA 2OMAA 5D8WA 3LPOA 1R3RA 5BROA 1OFRA 1GTEA 3PC0A 1V02E 2Y8KA 5G4EA 2NT0A 5A8PA 5FEZA 4NZ1A 2V3EA 3NZPA 1DWGM 1VCVA 3RN6A 4Q8WA 1C7SA 1K3UA 4CU7A 1OBAA 5G2WA 1SJCA 3O05A 4J3TA 4KERA 1ME8A 3EMZA 3IUHA 4IJRA 1V02A 3W84A 3WNLA 1KFBA 4NIRA 3F7JA 4B5NA 5C0QA 3SJ3A 4X0VA 1ML1A 2WCSA 8XIAA 1W1PA 1UH2A 4GI6A 4JIPA 3V0TA 3G1HA 5JUVA 3PP7A 3MVIA 5IM51 5E0FA 2ALRA 1GVOA 4K8EA 4UBPC 4XD6A 1NIUA 5LIYX 1MUMA 2R1PA 3AUOA 4WRHA 1E73M 3AFBA 3ARWA 1P1MA 1QVBA 1GOKA 2ZA2A 3FHQA 1N55A 4ECLA 1JZ5A 3W1RA 2HE5A 3GXNA 5MHBA 3MBFA 2BTMA 3QGVA 1OIFA 4AZGA 5A1AA 4MKNA 1FWGC 3P14A 2GK1A 2GQ9A 2Z00A 3LCHA 1ZCCA 5T8GA 3GDBA 3W75A 3WUGA 1HGWA 5AYYA 3TFCA 1P0EA 1TTPA 3LXBA 4D6GA 4F0SA 1JPMA 3NQAA 1CGWA 1JR1A 1DKWA 4RUBA 1WXYA 3LZ5A 4QTGA 5RUBA 4GYFA 3O6AA 1J12A 5I5RA 1ZLPA 3OLIA 1VFHA 1UR0A 1FHDA 2D0FA 3PBUA 1TVLA 3RCYA 2QCHA 1BYDA 1H7OA 4I5RA 2QJHA 2UY5A 1A49A 1O5KA 4EXQA 1CGTA 2I5IA 5D33A 4M24A 3RO6A 3UVAA 4EPDC 2E8ZA 2OOGA 2D0HA 2J62A 4L9XA 1HJVA 3ZT5A 1R7AA 5HQMA 2JKEA 1DE5A 4LYQA 4AIOA 3UQNA 1ODZA 2VUNA 1UR4A 4G5DA 5LA1A 4QEHA 1SMAA 1O68A 3HOJA 3OZOA 4LAOA 4A35A 3NQVA 4XZWA 2AMXA 3ZMRA 3G6LA 2R1MA 1F3XA 2GJXB 1NDWA 3NPVA 1KM4A 1WDDA 4AF0A 4GRSA 1ITCA 5SWUA 1F6KA 2TAAA 4GI8A 1XIDA 3OHIA 1S1PA 4M7SA 4TX6A 5E0CA 3BLDA 3B97A 2YBVA 4JOMA 3W2LA 4WZHA 1UROA 2VCCA 2CWNA 1XFBA 2Q71A 5FL1A 3MMDA 1DIEA 5EYWA 2WB5A 3UT0A 4GA8A 4C6IA 1E6PA 1IT7A 3B3DA 4NKCA 1UBPC 4J2PA 3ZJ7A 1GOXA 3VI2A 3AIBA 3U6WA 3VGBA 4BCEA 4Z1AA 1JRBA 4R85A 2VX5A 4YPJA 2DIJA 1Q4WA 4H19A 4LH8A 4NG3A 1B5TA 4QDPA 1S38A 1HJWA 4HZ7A 3CMGA 4GIEA 4MLJA 3BCJA 1DVJA 1NAL1 3PZQA 3QR0A 3FAXA 4D6JA 4F40A 3IIOA 5CPTA 1PHWA 3VIMA 2DZPA 4HGXA 5A95A 2WANA 4PTVA 3QPEA 3WBXA 5A6AA 1TV8A 3G1DA 3T1GA 3G24A 4KS0A 4AIUA 5BWFA 2FTYA 2FJKA 1O60A 2C1HA 2PDPA 5ABEA 3LCXA 2RGMA 2E77A 4HOZA 2RUSA 3F4WA 4FO4A 5REQB 2CW6A 3WF1A 3TROA 1OYCA 1MNSA 3VOGA 1FP9A 5TD4A 2Y7DA 5CZJA 3KBMA 4JX4A 1A5MC 4HU3A 1Y5XA 3LYEA 1EGZA 3UG8A 5LZLA 1NOFA 3GNNA 2J7GA 1W3HA 5CPOA 3B40A 1JPIA 1XYMA 3POCA 1Q6GA 4A8LA 2WHLA 3E49A 1C7TA 1XSKA 3QVQA 3ITOA 1TR9A 1QNOA 1V7YA 1FA2A 4GVGA 1F73A 4JL2A 3TP4A 3S5ZA 3VC6A 3FN9A 3PFRA 4NNAA 3OB8A 1H7WA 5CSRA 4MY8A 1TPH1 1JCJA 2PDWA 4Z1CA 4AIEA 2FTWA 4GY7A 2CLMA 5I7GA 3AQUA 3W38A 2DSWA 3QXBA 4GY1A 2PWVA 3ES8A 3ZFHA 3GKAA 2FPTA 2WWCA 3AROA 3RIKA 5A5WA 2QJIA 4MMWA 1IGSA 4YVVA 4JKMA 3WF0A 3P5YA 4AVNA 1GG0A 4S3GA 3A3XA 4NZFA 2O9PA 1H3GA 1Z41A 2ZVRA 3SCNA 1GG1A 4I7WA 3C3UA 1TV4A 2E6AA 1VS1A 3EOLA 1UKTA 3HG2A 2WM0A 4JTGA 3A3HA 2V82A 4B2DD 4QAWA 1GEHA 4JN8A 4WF7A 2PE4A 1IZKA 2J7FA 3STGA 4LAMA 2IQDA 3A5VA 1J6PA 1BF2A 5I0DA 1VC4A 2GUUA 3AO0A 3S6TA 1LP6A 2XIQA 5EFFA 2WMIB 3BAYA 3F4NA 2WC4A 4AWUA 2GGHA 4R3UA 3MA8A 3CV7A 3STEA 4RXFA 3RAOA 3AJ7A 1XBZA 4RE2A 3TJIA 5BXTA 4PMZA 2OX4A 5L6UA 2QQ6A 4H7CA 3NOYA 3MUXA 1CLXA 3NYZA 5C71A 1IYXA 1ZJIA 1ECEA 1TJ1A 5BRQA 2JF6A 2J24A 5KZMA 1QUMA 2VX4A 3TYCA 4S39A 4LUSB 1R9XA 3QN3A 4X2RA 5LA0A 2XN1A 3TAOA 2HE8A 1ZP4A 3SUUA 5D2YA 4HPHA 3EB2A 4GHRA 4QEEA 4XK2A 2ODOA 4IUOA 1TMHA 1UMYA 2JEPA 2R1KA 4GOAA 2ZUMA 2GQAA 2X2GA 4E2BA 3CHFA 2XGBA 2PU0A 3B9DA 3GHUA 1SGJA 4C6LA 4D6DA 1FH7A 3IV3A 1XBXA 1PZ1A 3TYBA 1OC6A 2C6QA 5HUOA 1RA0A 4GZJA 5IBXC 1D3GA 3GG1A 5H8PA 3BQ5A 1LUCB 3DH7A 3EMCA 5FF2A 1A5BA 1M7XA 3M5ZA 3MSYA 4H83A 2PDIA 5D9MA 3OG3A 4RK8A 2QCLA 2ZDRA 1P0NA 4IJBA 3TAKA 5FESA 4AU0A 9XIMA 4ACZA 3HGOA 4LV4A 3UJRA 1ISVA 4JQAA 3S8HA 4D1JA 1C3FA 1KBKA 3WJXA 3L4WA 1AW2A 3TCEA 3GIQA 4O52A 4UC5A 3BZGA 2XIBA 1W2VA 1BHGA 2A3AA 3AS1A 3GH4A 6XIMA 2NXHA 1BG4A 1LQ2A 3NL6A 4UCGA 4JTEA 1YADA 4K68A 3SY5A 2VVNA 3NQMA 4ZR8A 3G8EA 2X0YA 1BWLA 1GZGA 4K37A 1DWJM 3L4TA 4CN4A 4TUFA 1K77A 4DWSA 5ABTA 4BQ2A 5CC3A 1UQYA 4JN6A 3WJZA 3B03A 1XLKA 3CC1A 2NXGA 1PX3A 2GJRA 3B9EA 2DQXA 1KRAC 1PS9A 8RUCA 1IXPA 3MC5A 4PTDA 5J5RA 1YYAA 3IV8A 4XX6A 2O9OA 3D0CA 1OEPA 6ENLA 4HMCA 5E9AA 2VCAA 3WLLA 5HMSA 4MAZA 4IMEA 5CSUA 3F4CA 1G67A 1G6CA 1QNPA 3KRUA 1AD4A 1HT6A 1LL7A 3VDCA 1C8VA 4YTTA 4P5UA 2VX7A 4UMBA 3KM8A 3SUVA 4F3HA 5MKGA 4NP7A 4CNUA 1ONRA 1H41A 2ICSA 1EO7A 2JKPA 2PSNA 2C15A 3CTTA 2X1TA 1Y0EA 2FZBA 5C9XA 1H50A 1DIOA 5I09A 4F48A 5ECVA 3CUXA 2V38A 3T9PA 1VYSX 3R8RA 3OW1A 4LWWA 4MY9A 3TZFA 3EWDA 3JZEA 1QNVA 3WMCA 2CLPA 1JGMA 3IPWA 1WZKA 2ZBTA 3RU8X 2V0TA 3UERA 3MJYA 3IJ9A 4YS1A 3CNYA 3GDKA 2VENA 1GQIA 3PUEA 3DFNA 4IP5A 5LIXX 3AJXA 1SQ7A 3C0SA 4S3EA 1U1UA 2PS2A 2OVLA 2CITA 3H23A 2XIMA 2J4GA 3G0UA 2QAFA 1KM3A 1KCXA 1T7LA 4DB7A 3URQA 4UMAA 4HMNA 3MHGA 4W8BA 2ZRYA 1XIMA 3CASA 3T7VA 4OV9A 3QMSA 3KRZA 3F2DA 3WLMA 3BG5A 1ZBKA 3DBPA 4N9CA 1Z7AA 2EAWA 3FSTA 3IGXA 4W5UA 4A21A 1BXCA 3RU6A 1MDRA 1E3ZA 5E6ZA 4UXDA 3O15A 4BZYA 3MCMA 1EDGA 1WUEA 2OYMA 1AA1B 3C8NA 1L6WA 4WOZA 5LXXA 2VJXA 3V5OA 3W29A 3RLGA 2PDFA 1B0IA 1MFUA 4XIMA 3E2QA 3UGRA 3OODA 4DJDC 4J2MA 2VFEA 4PGLA 1DXIA 3USZA 1US0A 5CSYA 1C8XA 2X8RA 2PURA 4K1GA 1XCWA 1R9ZA 5I3IA 1TZ9A 1SO3A 3HPFA 4LAUA 4TV6A 3SFKA 3WEOA 2BHUA 3NQBA 3F5KA 2UWFA 4TOQA 2IPFA 3RLUA 4DI9A 1UQZA 2GGIA 1EEXA 4JIEA 1XD0A 1BXBA 2ZICA 3TC6A 5E9XA 3TTOA 2XIJA 2D22A 3M64A 4J3ZA 4EANA 4QLJA 1SSGA 3PANA 1JRCA 3A4JA 3FJ4A 3F5LA 4F0KA 1K8YA 1GVFA 1DOSA 3LV6A 2DH2A 4WK9A 4AZ7A 1NVMA 1XYBA 1QWGA 1R7OA 5M03A 3GXDA 3UPMA 2V5LA 1UC4A 3LY0A 5CSSA 3MB9A 3W53A 3JVAA 4GQBA 3W2UA 4NILA