4WDUA

17beta-hsd5 in complex with 4-chloro-n-(4-chlorobenzyl)-5-nitro-1h-pyrazole-3-carboxamide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 118
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wduA00
1X96A 2PDCA 4JIRA 2INEA 2PDLA 2PDBA 3M0IA 3CAQA 3G5EA 2VDGA 4QBXA 4YVXA 4XZNX 1FRBA 1RY0A 1T41A 3UZWA 1X98A 2R24A 2HV5A 2HVNA 2FVLA 2FZ8A 3R7MA 3UG8A 3ERPA 1C9WA 3LEPA 4XVEA 4R9OA 2IKJA 1S2CA 1MI3A 2PDJA 1R38A 1PZ1A 2IPWA 4DBUA 1AFSA 4PRTA 3FX4A 3H7RA 3LZ3A 1AH0A 5LIWX 2AGTA 2DUZA 2ACUA 4WRHA 4JIHA 3D3FA 4EXAA 2PDPA 4GACA 4FAMA 2CLPA 2PDHA 3CMFA 1AH3A 5JH2A 1Z9AA 4DBSA 1YNPA 2IPGA 2PDWA 4JTRA 2IKIA 1Z89A 3P2VA 3UZXA 4LAZA 2HDJA 2HE5A 2PDFA 5C7HA 1RY8A 2BGQA 4FZIA 3WCZA 1VP5A 1IHIA 3LBOA 1Q5MA 2PD5A 1EF3A 2ACQA 4ICCX 4YS1A 2PFHA 4QR6A 1T40A 1GVEA 3M4HA 2PDUA 1S2AA 3EB4A 2C91A 3VXGA 3UFYA 3CASA 3UYIA 2BP1A 1X97A 4JTQA 2ACRA 3EB3A 4FALA 4GQ0A 1RALA 3LNMA 3DN5A 1SM9A 4QXIA 3R58A 3NTYA 3UZZA 4JTDA 1PWMA 3UZYA 1Z8AA 4LBSA 2FGBA 2I16A 2ALRA 2PDIA 4ASTA 4EXBA 3MB9A 1YNQA 2DUXA 2F38A 5LIUX 1AZ1A 4NKCA 1QWKA 4Q3MA 4XZIA 5JH1A 3V0UA 4LB4A 4PUWA 1PWLA 2BGSA 3ONBA 2QXWA 1S1PA 4JTCA 1PYFA 3U2CA 2IS7A 2PZNA 4FA3A 1M9HA 3CAVA 4IJRA 4LBRA 1K8CA 3MC5A 3B3DA 1MRQA 3LD5A 3UWEA 2NVCA 4JQ2A 3N2TA 2J8TA 1LWIA 4GA8A 2PDKA 4RPQA 4LB3A 1EL3A 3Q67A 2DV0A 4GCAA 2IQDA 3Q65A 3V35A 4XAPA 2IQ0A 3RX3A 5LIYX 1AH4A 3GHRA 3LUTA 5AZ0A 4JQ1A 1YE6A 1PZ0A 4PR4A 2PDXA 3BURA 2FZDA 1ZSXA 1J96A 4JQ3A 3O3RA 4JIIX 1HQTA 2WZMA 3G1RA 2HEJA 3LN3A 2IKHA 4YVVA 4PMJA 2WZTA 5HNTA 3ONCA 3BCJA 3LZ5A 3WG6A 4ZFCA 3LENA 4YVPA 4XVDA 4JQ4A 3N6QA 4IJCA 3R8GA 1Z3NA 3S3GA 4HMNA 4LAUA 3WBXA 3FJNA 2P5NA 2HE8A 3GUGA 3WBWA 3LQGA 4OTKA 5AZ1A 3R94A 2PF8A 4L1XA 1XJBA 1JEZA 2A79A 3QKZA 4Q7BA 1XF0A 4WEVX 2PDMA 4WDUA 3RX4A 1ADSA 3KRBA 4XZHA 3R43A 4GABA 5HA7A 1YE4A 3WBYA 2INZA 5KETA 1ZGDA 4WGHA 3R8HA 2R9RA 4H7CA 2PDYA 2HVOA 4GQGA 4XO6A 2PDQA 4GIEA 1UR3M 1US0A 3BV7A 3CV6A 4JTAA 2IKGA 3LQLA 3DOPA 1EKOA 4WDXA 3V0SA 1AZ2A 5LIXX 4YU1A 4AUBA 2PDNA 4I5XA 5LIKX 4MHBA 3GHSA 4H8NA 4HBKA 3F7JA 1S1RA 3COTA 2PEVA 3CV7A 4WDTA 4G5DA 2F2KA 2PDGA 1MZRA 4QX4A 3T42A 4JQAA 1QRQA 4DBWA 3EAUA 1ZUAX 3C3UA 4DZ5A 1LQAA 3V36A 2PD9A 2IPJA 3BUVA 4XZMX 2ISFA 4XO7A 4WDWA 1OG6A 1IEIA 5HNUA 1HW6A 4XZLX 3R6IA 4L1WA 3RX2A 4PUUA 1Q13A 3V0TA 1A80A 3H4GA 2NVDA 1ZQ5A 3UP8A 2FZBA 1XGDA 2ACSA 4F40A 5DANA 3UGRA 1VBJA 4PRRA 4IGSA 3O0KA 4XK2A 3M64A 2I17A 3H7UA 5M2FX 3GHTA 2IPFA 2FZ9A 3GHUA 1EXBA
chains in the Genus database with same CATH superfamily
3R79A 3LTYA 3K1DA 5A5WA 1KW1A 1ZBKA 3M5ZA 3KTCA 5CPTA 5BOFA 4O57A 3QR1A 4CD7A 1QI0A 3MCMA 3V75A 3MUAA 3XINA 3VE9A 2OSYA 2VCBA 1VHNA 4YTQA 2HTMA 4F2BA 4N6EA 3VDAA 2V0TA 1E6RA 3QYSA 1OYAA 5AYYA 3E0LA 2J77A 3UZJA 1CXHA 5AYZA 3W7GA 3HGRA 3CUIA 2AKMA 3LPFA 1Q6QA 3BANA 3LCHA 4DPQA 2VRKA 1I0DA 3TN5A 3UWWA 4LNYA 4O50A 2OVLA 4M6QA 3FXYA 3PZIA 1H7XA 3UR5A 1HT6A 5A6BD 4Q4PA 1KFLA 4WRHA 3WJSA 2FQIA 1J2WA 2Q3RA 4ZA0A 3O1NA 3PB0A 1C93A 1WNOA 2P50A 3LOTA 1I75A 2VCCA 3NZRA 3KOYA 2FTPA 2BGNE 1E6QM 3RCMA 2WVUA 3P2VA 3CO4A 1NOUA 3VIJA 2ZA3A 2XSXA 1US3A 5G2HA 1K9FA 2ACQA 5HANA 2CETA 3VZYA 1VEOA 2ANUA 1TE6A 1LQ2A 2ISWA 1T40A 3QGAC 4HJFA 3HURA 2VUYA 3EB4A 4K37A 2Y8UA 2WPBA 3NSMA 3A9IA 3SIMA 3WDQA 1DJYA 4AWSA 1POKA 1V0KA 5TD4A 4HU3A 2EPHA 3VX1A 1KTCA 7PTDA 1OADA 3BZGA 2XIQA 4N9BA 3NPXA 3WNOA 1XCWA 3ZVIA 4DO7A 1XLKA 2GQAA 1F8MA 1XIIA 4GUGA 4PZVA 4BF5A 1AL8A 2FJKA 3PJXA 3SRDA 3PM6A 3VC5A 2R1LA 5JBEA 2E09A 1XDJA 2CFFA 2JE8A 1H5YA 4IXXA 3RYSA 2WVTA 3AMDA 3QJAA 3W7CA 1G01A 4Q8MA 3NURA 2R14A 3RM8A 4J3UA 1UPMB 4LVFA 3WQDA 2C8NA 1M9HA 3UG4A 5AHEA 3VNIA 3VIIA 2EO7A 3B0YA 3RFAA 4AFYA 4URIA 5D2WA 3KS5A 4KEMA 2QV5A 3APYA 3VIGA 1OG0A 2DSVA 4MNMA 2J4GA 2NUXA 1GGOA 2Z6IA 2J47A 4FX8A 2NUYA 4ERGA 3C5QA 1G5AA 3JUGA 3MQTA 1W3HA 4H9MA 2CLEA 2V38A 2FHFA 1MUWA 2RAGA 3TJLA 4Y90A 3T0DA 1FCVA 4HU0A 3BAIA 4DO4A 4NZJA 1S5WA 4DJFD 3K1GA 2R1NA 1AH4A 3AALA 4Z17A 3M0LA 5XIMA 3B06A 4ALDA 3WNNA 5DLCA 4EVZA 1P1XA 3NQCA 4PB4A 4PRWA 4KFNA 1MFVA 4ZQPA 3WELA 1CLXA 4NZFA 3V7PA 4C6IA 4C6BA 1YPIA 1HQTA 4Z2IA 1FWIC 4C6MA 4QE1A 2PTYA 4NYYA 4RNFA 3IAQA 2C79A 1I2RA 2HK0A 4HU4A 2VCAA 4Q8WA 1P0DA 2NT1A 2WNWA 1ADOA 1A3HA 5A6MA 1UBSA 4C6DA 3CV1A 3GH4A 3LS9A 1OYCA 3UR8A 4H01A 3EXTA 4CVWA 1K77A 1W31A 2XHYA 3GR7A 1W3TA 4ACYA 1UBPC 2ESCA 4LANA 1MRAA 5EPDA 4HHHA 2PUZA 2YLLA 3RCYA 1TQXA 2G50A 6A3HA 5H2ZA 5E5CA 1VFFA 4AY7A 2OQHA 3R0UA 4O11A 1TA3B 3WEZA 4PN2A 2WMKA 3KOXA 4OHQA 2F6KA 2C0HA 1LRQA 1XS2A 2BMBA 4WEVX 1TIWA 5LYRA 3RX4A 3B0PA 2R94A 2B81A 4UTHA 2AGKA 3W7HA 2Q09A 1ZBVA 1XLFA 1H7WA 3PUOA 4EWJA 2WM0A 3KVKA 4OVXA 5JUVA 2CBVA 4LVBA 4RE4A 4P2VA 3FAXA 1HJSA 3ZS4A 5LGXA 1WYIA 1FA2A 4XAYA 2WYSA 2X0SA 4B5XA 1W56A 1XLJA 2ZZ6A 1TV4A 3SN1A 1P7TB 3RPDA 4BI6A 3P74A 3PZMA 3QTGA 3EA2A 4OIFA 3QPEA 1G1YA 1E1CA 1VIWA 2ON3A 2DIJA 4NASA 3PPCA 4N4PA 4G5DA 4MMWA 3LRKA 2CCRA 2XYLA 5I02A 4AZBA 4MPKA 3I68A 3NL2A 1PDYA 3O6DA 3PAJA 3M07A 4W89A 3GR4A 4JN6A 1VH7A 2YA1A 3AMKA 3WLJA 3A5VA 3PPHA 4ZENA 2BZNA 1C90A 2CLIA 1TJ2A 3GNNA 4PBFA 4FXJA 3PBWA 1HW6A 3W1UA 3N9SA 3H53A 3MDUA 1H0IA 4H3DA 3F4CA 5PTDA 4Y9OA 4CVUA 1J93A 3UP8A 2FZBA 4X61A 2E1DA 2ACSA 1DVJA 3WQ5A 1H1ZA 2NXHA 3A13A 5D38A 2VOTA 1FWAC 3UVIA 2V5CA 1CGUA 4GCXA 4PTDA 4U2ZA 3EZ4A 3BGAA 1HP5A 5C54A 2INEA 4IP5A 2P3ZA 2J7CA 3CAQA 1XINA 2XVGA 4YVXA 1EDTA 3NO3A 4GGHA 1JZ8A 2RUSA 1C3FA 3T40A 1H1NA 1CENA 2O9OA 3W73A 1FY6A 2XVKA 3BARA 4GISA 4K8EA 4PYSA 3G24A 4GOAA 4R9XA 2YBUA 1J0JA 3Q2DA 3PBUA 3B05A 2KX9A 4LNCA 1AJZA 2FZ8A 4U3AA 3ZZ1A 2Y24A 3L0NA 3TU9A 1HJQA 3W0KA 5I78A 1M04A 2D73A 2ABAA 1LJYA 1MQRA 2NSXA 3AS1A 3CO8A 3RILA 3S5NA 5CG7A 3C0JA 5FF3A 3VNDA 2I1OA 3MSRA 2YZRA 3VKCA 3GAKA 5FF7A 4NAFA 5BZAA 1A4MA 4GE8A 2WC3A 1ZAHA 1AH0A 3RRXA 3TYUA 4ADTA 2PWDA 4DXKA 2DZBA 1EOKA 1P6BA 4WX2A 4IIFA 3MKKA 3NQVA 1E73M 2QZRA 3S5SA 4C6PA 1DIOA 2CC0A 2IPGA 1JQXA 2QUUA 4MLJA 4RE0A 4HK5A 3RIKA 3W7RA 1KRCC 4PTMA 1ISYA 1XLCA 2BGQA 5CZSA 3DKJA 3VD7A 2XTKA 1TZ9A 1EHNA 1CPUA 4ZB5A 3ZOAA 1EF3A 2DZUA 1SJBA 4A3RA 3WQEA 4WK9A 1KBJA 4N4QA 3HB9A 3SB0A 1SQ7A 2X1SA 4LAKA 1K9DA 2PDUA 5CC6A 1NELA 1QI5A 1R5YA 4UQAA 2ZWZA 3B97A 4RUBA 4IT1A 1QR7A 4CD5A 3BQ6A 2QMKA 4QIUA 3PR2A 4QNWA 1HKIA 4C7DA 3LBCA 2NT0A 1K6AA 5DRCA 3SAZA 3UXDA 1G4PA 3QZ6A 5IFPA 3LNMA 4GPNA 1W1A1 2DP3A 2IXVA 1HFBA 1KBIA 3QLLA 1OY0A 3MPGA 3L4VA 2WBGA 2ZZ4A 4R85A 3VVGA 2G95A 2O9RA 1FDJA 3AAMA 2PZ0A 3IJQA 3SGUA 4M82A 1DV7A 2GQ3A 2WMIA 2CW6A 3B40A 4D1IA 1W9XA 3WD3A 4O15A 1Z69A 4XKMA 1PWLA 5RUBA 3WQOA 2E9LA 4TUFA 3WH5A 4B90A 3L23A 3K5XA 4ILSA 5BRPA 2GQ8A 2UBPC 1XKYA 2OKOA 2PU1A 3ZXWA 4UMCA 4IMEA 2VEKA 4HN8A 2ISSA 1BTMA 1OX6A 3AYTA 2YFOA 1UH3A 2Z1KA 5M17A 2CESA 2Y88A 1LWHA 1A5BA 1C91A 5DCDA 1JGMA 1TCMA 2IQDA 1F3WA 3MTWA 3V35A 5EBAA 3T8QA 1L6WA 1ONWA 5CLWA 3QSTA 3RM9A 3PFMA 2Y7EA 3E0WA 2ALDA 3BCFA 1C8YA 3VZXA 5HMFA 2B31A 3E3HA 1SW3A 1YXCA 1J0IA 4FX7A 1R2TA 4A2RA 1XX1A 5D33A 2I9UA 3W25A 2EXOA 3TFXA 2GOUA 5CZ0A 4D6EA 1XH1A 4D6JA 5FCZA 1XCXA 1QPRA 5F4SA 2WM1A 2PRMA 1BKSA 4HNVA 1E70M 4GD0A 4K3ZA 3LENA 4NSBA 2DH3A 3NOEA 4GBUA 3I4EA 4HK7A 3DGBA 3LHVA 3SRKA 1LOSA 1IEXA 1REQB 3DKLA 4M81A 3DI1A 1UMYA 4WVXA 2X1UA 6ALDA 3FJNA 3WJYA 1PCKA 1QBBA 4YN5A 3AYSA 2PC4A 3BLOA 3G1SA 2CHOA 2V69A 3APTA 4B5SA 1M1BA 3ZLHA 1U83A 1ZP3A 1I4NA 2WVVA 3TOPA 3W1PA 3EX4A 2CXEA 4QAIA 2EPKX 3SGZA 4QJ4B 3BLDA 3HG4A 3ID7A 2ZX8A 2V5JA 3O7UA 4MIMA 3T0CA 3QF0A 3OLEA 2BVDA 3W70A 1NWSA 4ZR8A 3GU2A 3C2VA 3GVRA 4IIEA 1OFAA 5C2XA 1EJRC 3AIUA 1I1XA 2ZZ3A 2XFRA 3CV6A 3EEZA 4AMAA 4JTAA 2DSKA 5K9CA 1BXBA 3GHSA 5DELA 3QPYA 5HQEA 4U3CA 3MANA 3COTA 1F76A 2GJLA 3T7VA 1LRNA 4AXKA 4S39A 3G0XA 4O8AA 4OT7A 5KTLA 3FGCB 1DHPA 3PC0A 5A8QA 1TUFA 4LTSA 2OX1A 4H8HA 4R27A 4XIAA 4B5TA 3DFQA 4NZCA 2FFCA 3WL0A 3WMCA 4I3GA 2OLHA 2O4QA 3AMCA 3SEPA 3Q4DA 2HNHA 3O05A 4JOMA 1IEIA 3GBDA 1S39A 2BOEX 2A3AA 4UFKA 2D3NA 3DHUA 5I79A 3RITA 3WUFA 3ARPA 6XIAA 1LOLA 1W1B1 4GVIA 4G7EB 4DO6A 2OQLA 7ODCA 1E6SM 3ARXA 2Y1HA 1LUCB 3GW0A 4PSRA 1A5KC 7REQB 4PMXA 1VBJA 2OLSA 3NL3A 1LLWA 3M7WA 1V6YA 3H7UA 1WDQA 3W2KA 2IPFA 4GUIA 3ZLGA 1J6PA 3CH9A 3FKRA 2IW0A 2WSRA 4GYFA 4KRUA 2PDBA 3M0IA 2FTWA 4UQDA 5BRBA 2RDTA 2WJZA 1QOPA 2ZTKA 1RY0A 4ZXOA 3RG6A 1GUVA 1FKWA 2CWNA 4LRTA 3A47A 3AOFA 3FA5A 4QG9A 3FLUA 3LV5A 5FEWA 1XBYA 2D2JA 4KEZA 2H8XA 1JZ4A 2Y7DA 3AC0A 1NQ6A 2I57A 5T8GA 4U28A 4XVEA 3UJSA 2VL4A 3U48A 4Z1YA 4Q8OA 3ITGA 1R38A 3BL3A 4DBUA 2VVNA 1UUMA 4O1DA 4PFMA 3SIZA 3DFSA 4LSBA 4KQNA 3UF9A 3H7RA 3LCFA 3MVIA 1E0WA 2AGTA 1TJPA 5CPMA 3D3FA 4J35A 2YIHA 1BGAA 5ECVA 1ML1A 1UWIA 3W28A 1UQYA 3CZEA 1BSIA 1PZ3A 2WW5A 2VX5A 4DBSA 4Y6GA 2B7NA 1W54A 1KR1A 1QDSA 1Z89A 2XFFA 3N04A 1FCUA 1OEPA 3DC8A 5I06A 1WKFA 3GKAA 3GDTA 2ZUVA 4PUJA 4IPJA 3SRFA 1KXTA 4AD0A 4V1YA 2HXTA 4QR6A 3M0KA 2NWRA 1D3GA 3OPSA 3HQ1A 3K4AA 4AEOA 4XZBA 9CGTA 1DTUA 2XGZA 5C9XA 1TV5A 3BAJA 4KWUA 3WLLA 3UD6A 2C0AA 2DVXA 4NI8A 3BE7A 3MHFA 3KTXA 3KWSA 4WJ8A 1LRTA 4TMBA 1G7VA 2V30A 1RQBA 3GO2A 5F2IA 2YDAA 4DWDA 3P67A 3CLMA 1L0PA 3I3BA 4FP1A 3OG2A 4QXIA 2ZXAA 2ASHA 3WQCA 2VFGA 3B8DA 3H6OA 2VFFA 3NPUA 1JYNA 3N4EA 4MM1A 1VKFA 1VBHA 3DFYA 1XIMA 4S3KA 2CIPA 2RHGA 4H7VA 4DUWA 4NF7A 4EXBA 1VENA 4PUMA 2DUXA 3KLKA 5LIUX 4OOZA 1NP2A 4WKFA 1P6WA 3SO7A 1UKQA 3TEVA 4DB7A 4O1CA 5G1YA 1EX5A 4IFKB 1ITQA 1TB3A 5F2LA 2DZXA 3EWWA 3HF3A 1XYBA 2ABBA 4LC8A 4X22A 3CAVA 4LBRA 3PFRA 1D8WA 4RNIA 3ZFHA 1W91A 4IP7A 1YLVA 4F79A 2X40A 5A8PA 4JPGA 1XQLA 3AXMA 4QQUA 4IISA 1N82A 1YHTA 1UZDA 1V0MA 1XLGA 2E1WA 1TSIA 1W9PA 4GA8A 2YA2A 4IJBA 1KGWA 5AYBA 1HGWA 1NAL1 2V5LA 5LNUA 2P0OA 4Z0JA 1TRIA 1SW7A 3QV8A 3WUBA 4AIEA 1PUDA 3JVAA 1TKKA 4YLWA 3CL8A 4TOQA 3DFHA 3NEVA 3UW6A 5XIAA 4H9UA 1JI2A 3RPTA 3PS7A 5HWNA 4WSHA 3VKDA 5TF0A 1XWYA 4Q6JA 3BLLA 3PZGA 3P62A 1K8ZA 1FWTA 1EO5A 3WD0A 4ROQA 4F8XA 3VGEA 1H4PA 4IIDA 3MCOA 5EMYA 4BQ3A 1V8EA 4YIWA 1CB7B 4XZ9A 2W92A 2QAFA 1ISWA 1OK4A 1E56A 1YIXA 2C15A 5LA1A 3CH0A 4OGZA 5HUPA 3UA4A 2QUTA 2QCNA 1A5MC 4UQCA 1RJQA 3GUGA 5BOEA 4Y9AA 1OFPA 3HQNA 4ICMA 6REQA 1XUUA 2V3GA 1I1WA 3L5AA 1CBGA 4F0HA 1UR0A 1FWHC 2ADAA 4J1OA 4C7FA 4UOQA 3INPA 4MWAB 1XIDA 3BLIA 3GDRA 2PDMA 4FXFA 4GC3A 2VURA 3OEXA 3LYEA 2PI6A 3KW3A 5A6SA 5TIMA 3GXMA 4LUIA 1R47A 4HNLA 4DLMA 2BVYA 3R8HA 3VI2A 3OGVA 3OBKA 5HAOA 2YKKA 4LUTA 1D3CA 1ITCA 2C1HA 3SQMA 5C2CA 1H51A 1QO5A 4C6EA 4NY2A 1VAHA 5AHMA 3F4VA 1TX0A 3VIKA 1UR3M 5TBOA 1MXGA 2IKGA 1UWSA 5LIXX 1XYMA 4YU1A 3E02A 3A12A 4HA3A 5D4YA 3EPNA 2VC6A 5XINA 4PMRA 4A8LA 3W83A 3UVAA 2QPUA 2NQJA 1RA0A 3HMJG 3VM7A 1VJIA 4RDVA 3SBFA 3H2NA 4AISA 1WA3A 1SFTA 4ZZ9A 1EQCA 2F2KA 1MYRA 3BMWA 4YCOA 1EJ7L 4RZ5A 1UWQA 4M80A 3DFOA 2BXYA 3S5YA 3CL7A 1QK0A 3CS2A 1UG6A 3MHUA 3K4WA 3UCQA 2VGFA 2ZBTA 1SFLA 3M5YA 2VENA 2J7EA 4KCVA 3DUGA 4P7NA 2ZUNA 4MNJA 2PBOA 3T05A 1WOAA 3BG9A 1OG6A 1XGEA 4IGHA 4AMCA 2PPGA 3GTNA 2AAAA 4GG9A 1EJWC 3OZPA 2AQVA 1DJZA 1UZ1A 2UY3A 2EJ1A 2XZ7A 2OFJA 1E9ZB 3OVRA 1BF2A 3VNLA 2VR4A 1R3TA 3VGGA 1EJXC 3SN0A 2VQUA 3VIFA 2H9AB 2QCMA 2AL1A 3N3TA 3WBAA 2RDUA 1YDVA 3UESA 1DOSA 4D9PA 2D69A 5IM51 4UTIA 3ARZA 5M03A 3EWCA 4O1FA 1IXOA 1X8CA 3LPOA 2GWNA 4CQDA 3GVVA 4JHOA 3TC7A 1CECA 1CXEA 1BLIA 3ITXA 2ZZ2A 2X2YA 3PZQA 4ADSA 1K8YA 3BPWA 3GNPA 3W82A 1Z44A 1W8SA 4JXCA 3CB8A 3P3BA 4JS3A 1XYFA 3VE7A 3GX9A 2GGJA 1VGAA 1Q4WA 2CLFA 3KOWA 3VNMA 3NQMA 1F05A 1PVNA 3RDKA 3UG8A 4J4KA 2ZUTA 2DFAA 5EFFA 3SUUA 3LTSA 3E49A 5AVNA 2PDJA 2GQ9A 2GDVA 3N14A 1U22A 1UWTA 3RK8A 3PPGA 1VPQA 1EEPA 3P14A 1PIFA 3SY1A 4DQWA 2BY0A 3ITYA 4RV3A 5MHBA 4B16A 3WLSA 1SR0A 3GH7A 4KRTA 1XG4A 1ZP4A 4JIHA 4KERA 3GYCA 4FAMA 2V9DA 3LPGA 3SUSA 4Q4QA 1WZMA 4J3TA 2BG5A 1G69A 5C8BB 5CJMA 5FI8A 2J7DA 3UR2A 3H24A 5J5DA 2BHUA 4LGXA 1ADDA 4LAZA 4CNPA 4NRRA 4L1GA 1FWNA 3NWRA 4B5NA 1LYXA 3WCZA 3KWXA 3I10A 4Q8PA 3IRDA 2P76A 1X8FA 5CC7A 1S2AA 2GVGA 2DSUA 3AMGA 5A6KA 2GGEA 5BCAA 2NX1A 3C2RA 3QW4B 2G3MA 2NWSA 3B03A 1I60A 1ZB5A 4PMQA 4GQ0A 3ARYA 5I07A 2PWEA 1ZCCA 1MXDA 4RPPA 4O1BA 5A8GA 1EX1A 4QJ5B 1WDPA 2CLHA 1E51A 3R58A 4QRNA 4HHLA 4BQ5A 3NTYA 3LHZA 5F7UA 3WZ0E 3S1VA 1D3HA 4GIYA 2ZE0A 1EZ2A 5BU9A 2ALRA 1KFKA 4ASTA 3CEUA 1S2TA 4YWSA 4C6FA 1OFQA 3SSZA 2R1PA 4HNTA 1OF6A 2XG9A 3UERA 3KBMA 2QCHA 1AW5A 3RO6A 2Y63A 3BVJA 5AC5A 1VBUA 3W7LA 1DTNA 1I6NA 4UCFA 4YHEA 3T08A 3KDNA 1SZNA 4JR5A 4UMBA 5E93A 2VEIA 3V4BA 3B3DA 1M41A 1V02A 3QTPA 1GVQA 4Q6XA 4YTUA 3W72A 5CXPA 5FJTA 3BJFA 1LF1A 3OGSA 2JEPA 4CD4A 1S5VA 3QOKA 4AZGA 3SDOA 1JIBA 3GYEA 3W7NA 1GOWA 3S9YA 3STGA 3V1HA 3CUJA 1KC7A 1YDNA 2Y2WA 4UR9A 3D5HA 4LUSB 1XFCA 1G6CA 3F2BA 4Y9PA 1H41A 2VX4A 2IQ0A 3IGXA 5DRIA 4EF9A 4X63A 2QDHA 3TN6A 1XKJA 3TCSA 2QYGA 4I9TA 3KS6A 1LL7A 3G1VA 3BGGA 5CBBA 1WKDA 3IJLA 4MF4A 4A35A 4HK6A 4FIQA 4RDYA 4JIIX 5E0KA 3WLNA 3VFCA 1WPCA 3A23A 4E6MA 2IKHA 4YVVA 5I3JA 4TV5A 2AMGA 3WK0A 2SFPA 2WC7A 3EDJA 3V16A 1AW2A 4MYAA 1HKVA 1YW1A 1GK8A 4J3VA 2WHJA 2FFIA 2J13A 2YL8A 2G3NA 4IJCA 2WKLA 4GKTA 1FP9A 3GC2A 1HJXA 3L0KA 4MVAA 1Q6GA 1VRDA 5CZJA 1NF7A 4R88A 4AEFA 1W1TA 2YL9A 4H41A 4OBSA 4JBRA 3O6CA 1TVPA 3FV9A 3MCNA 4DUVA 1LTDA 1EUAA 3CMJA 3PUEA 4FS9A 2V8ZA 1FDZA 4WJEA 2O55A 1EDQA 3PPFA 3PZNA 3DYOA 1ZGDA 1O1HA 4UNLA 4D8AA 4H04A 4GXMA 2OO6A 3DYPA 1RVKA 2GVJA 3B8IA 2JFEX 1MNSA 1US0A 1J9YA 1LLZA 4N9CA 3DG7A 1MXSA 1B90A 1E0TA 3TN3A 1QNQA 1FTXA 1FWBC 3A3HA 3GS6A 3EA1A 1Q7QA 2NXIA 4LCQA 1JCYA 5D03A 2OWXA 4K68A 4MZ8A 3TR9A 1M03A 4TQTA 1EQPA 4GJJA 3WFAA 3VGFA 7TAAA 4QCFA 2CU0A 2NUWA 3OLDA 5I23A 2DU2A 4NZ3A 1A3XA 4RDZA 1X1OA 1GOMA 4GHRA 5LNWA 3T09A 3T42A 1F07A 1O5QA 2Z28A 3PK7A 1QRQA 5CPSA 1ALDA 1FWWA 1BWVA 1XR2A 4IFRA 4JN8A 2ZKMX 4Y7EA 3AWNA 1CTNA 1J0HA 3LERA 3U4AA 3OOQA 2Q3OA 3UJEA 1PL9A 2E6DA 4ZOBA 2DZSA 3S47A 2ZYFA 5KINA 1A0CA 1HXJA 4Q8VA 3TP4A 4PUUA 3BWWA 3EEGA 2F6XA 4MKSA 4GZIA 1IWBA 4H6KA 3WLOA 1ZJHA 4NVTA 3VDGA 3R12A 1EC9A 4UNIA 2QR6A 1GCYA 4DN1A 1UW9A 3NPVA 3T6CA 1YYAA 3M5XA 4PUKA 3W1MA 1DL3A 3GHTA 5F2MA 2IXUA 2Q8LA 3F1QA 1KV5A 4REQB 1B3ZA 4DF2A 4AVFA 4C6CA 3IIVA 1D2KA 4HYRA 2NV2A 1QFEA 1H60A 2CNCA 1QMLA 4XZNX 3ZWTA 5I24A 4A4AA 2RDWA 4TX9A 4ZXLA 1BRLB 5FL0A 2V3DA 1EXPA 5FSEC 3QY7A 2E9BA 3U57A 1MFUA 4ENLA 3TNOA 5AC8A 1DIDA 4QG8A 4EWND 2JBMA 4OECA 4W86A 2ZRUA 2F8QA 1S2CA 4RLIA 1CGVA 4GNVA 3FEQA 2EKGA 3ATYA 3ISIX 1XBXA 4IICA 4E8DA 1MEWA 3A4XA 3SUVA 4AZIA 2VZUA 1AH3A 3MKCA 1Q7ZA 1A49A 4O19A 4D6CA 3T8LA 4PTVA 2CLOA 1FBAA 2OOFA 1ME8A 4GY0A 3CZLA 3W07A 4DWSD 1RY8A 4Z0SA 1R2SA 2X05A 3FW6A 2HVMA 3UT0A 4QDPA 5KZMA 4ICCX 2ZWYA 2WMJA 1ZRQA 3AHYA 5LHEA 1YQ2A 4FNTA 3NYDA 1GVEA 1RPXA 1PBGA 3ARSA 2ZRZA 4LU0A 2X09A 3WO8A 2JKPA 5D9NA 3AS3A 1LLOA 3UYIA 1ZNNA 1KKRA 1OFDA 1OF8A 3L5LA 4B3KA 3RU8X 3KDOA 3MUIA 1JZ5A 4HPNA 2YCLB 3MMDA 4D6FA 4I90A 4ZODA 1RALA 2A7NA 5FEPA 2ICSA 1DQWA 3IGSA 5HPCA 1XSJA 2QGYA 2VZSA 1B3VA 3O06A 3M6YA 3OYZA 3G2GA 3RU6A 3DU0A 2FKPA 3W6YA 3R8RA 1JVNA 1GOQA 3P61A 2QS8A 2WHKA 3LNPA 3SCNA 1CGWA 1K4GA 1K02A 3N2XA 1TZZA 2E9MA 3DECA 3E0VA 2FJUB 4CN4A 3KVLA 1AL7A 1XXXA 4HMEA 4PA8A 3N4FA 1NH6A 1R9YA 4JTFA 1SZEA 2WCAA 2YA0A 3AHVA 4LVDA 1PO9A 3LMZA 3ZVHB 1R3QA 3S1GA 3II1A 3ANYA 3W1AA 4PCPA 3W6LA 2ZTJA 2IS7A 1XLAA 2WZIA 4WGXA 3SCRA 4D2JA 3PBVA 4PBGA 1JFHA 3P6LA 4EE9A 3GVGA 4UCGA 3DFNA 3MYPA 1VYRA 3EWYA 2GOKA 5LA0A 4K8HA 1GNXA 1J0ZA 3KBSA 5K2ZA 3BSMA 1D7KA 2PLJA 3UBPC 2JKAA 2CEQA 1JZ3A 4PMDA 3VNJA 4MNKA 4HMDA 1WV2A 1RHCA 3HJEA 5T26A 3RHGA 5BXPA 3PZ9A 4NAEB 5CQ1A 4AC1X 5SWUA 2A85A 2GGHA 5HWJA 4W8AA 3GHRA 3LUTA 2DEPA 4FLQA 2WQDA 4AX7A 3ZJKA 2VR5A 2QDEA 1R0MA 1UD5A 1VEMA 2PDXA 3CXOA 2JKEA 3UXIA 3FXGA 5A69A 3AMLA 1GPFA 3KZSA 4DZAA 3HPSA 3LXCA 1DWHM 2JEQA 2HEJA 3GG7A 3LN3A 1L6GA 2ZCGA 1G4EA 2GDUA 2VFIA 2XH0A 3OYXA 1QPQA 3NCOA 2C19A 1CI1A 5IOBA 4LYPA 4Q4MA 2PB1A 3F5KA 2VYOA 1LQ0A 1W32A 1FOBA 4DJED 4AWTA 1TRDA 3TQ0A 3I3DA 1WQ5A 4UFMA 1PSCA 4R7JA 4HN4A 3W6MA 5EKYA 2PAJA 3QY8A 4XISA 1TPVA 1RP8A 4NNBA 4FPSA 5A2AA 4DZHA 1GZ1A 2OLAA 3GXPA 1JYVA 2OO0A 3PG8A 3AWOA 4KCTA 2HISA 1TIMA 4M6PA 1B3OA 1NFGA 1U5JA 2REQA 3FYPA 3MA8A 2PDYA 4GUFA 2A7RA 2QV4A 4AZ5A 1AQHA 3BAXA 3H2MA 3WLPA 2X1TA 1GG0A 3OU8A 5EMKA 1XIBA 3W3OA 3K46A 4JL1A 2WAGA 4MJ2A 3K4DA 4A8RA 2VVSA 3BMXA 3Q58A 4MJMA 1SPQA 4XQ6A 3LCXA 4PTNA 2RGLA 1VD6A 3U5YA 4QS5A 4HA0A 4HBKA 1ITUA 1VYSX 3N34A 1OX4B 2E77A 1I9CB 2PEVA 4L4LA 4XKYB 4JKMA 3NL6A 3H2FA 3IJ7A 3VD3A 4LEQA 4B5WA 3C2FA 2JALA 1KM0A 4M3PA 3WY1A 2BNJA 7REQA 3HPFA 1RVGA 1OZMA 1LQAA 4N9DA 2PD9A 3UJFA 4Y9NA 1SMDA 4N9EA 4GUHA 4QSFA 3STCA 4WDWA 4ONVA 1KXHA 1LWJA 1B3YA 1TMQA 5FJJA 3LA4A 1AVAA 1JQVA 2XINA 3CYJA 2YCEA 4LS1A 4QM1A 2J6VA 1B4KA 1A80A 4IGMA 3JW7A 2NVDA 5GJNA 3UPBA 2VEGA 3L4ZA 1AK5A 1HN1A 3M1ZA 2YDQA 2FGZA 1THFD 1GEQA 4YJ5A 4PE8A 1F7BA 3KOZA 1RSCA 5HDRA 5ABTA 4QSHA 1E0VA 4W85A 4DJFC 4KESA 3NZPA 1E4IA 1KR0A 3C4UA 4WR3A 3MWAA 4MJZA 4X9YA 4P8XA 2XUCA 1QT1A 3OVGA 3QMRA 1ELSA 3OQ8A 1MMFA 1YBQA 1QW9A 5BROA 3TSBA 2D2OA 4I6KA 4YTTA 2YOCA 4MZ1A 1AD4A 2X1RA 1KRMA 4IX2A 3G3DA 5F4XA 3JRKA 5EY5A 1ICSA 3TW9A 3AQUA 1Q6RA 3Q37A 3PB2A 4DJDA 1OFEA 3LM7A 1AODA 1K7XA 4TVCA 4F9JA 1WP6A 1FKXA 3A64A 1A5UA 1PIIA 4LPCA 2FDSA 2GL5A 3MMWA 1KFJA 1TR1A 5AHFA 4V1XA 3T0BA 3NGFA 2BODX 1F5ZA 5H8MA 3NO5A 1JAEA 3KBVA 4S2CA 1JF5A 4F2UA 5AN7A 1RLCL 2OJPA 1WXJA 3A24A 1GORA 3GFZA 5LHFA 3PP7A 2GVEA 1ECQA 3EX2A 3I6RA 3G1AA 2I9EA 1DJWA 4H2CA 2PFHA 2AKZA 4O0KA 3YPIA 4Z2HA 2VZOA 2R6OA 1F2JA 3W81A 4F0RA 3QQWA 1XH0A 5K4ZA 1F74A 1TPH1 3W76A 2ISVA 2VWSA 3IIPA 1GJWA 3TYDA 3EKGA 4FALA 3UETA 4ZQMA 4FLOA 4O17A 3PHAA 2FPVA 3PTDA 2ZXQA 5CPQA 4OV9A 1CEOA 2A6NA 3UWUA 4NJKA 4HU8A 3EDEA 1JUBA 2FB2A 1WO2A 2ATMA 3WDPP 2PDIA 3PBMA 4H8VA 4JNMA 1QBAA 2ZX7A 3KBNA 4F66A 4ZE4A 1YEYA 1Y65A 5JH1A 1J10A 1FFRA 4KGJA 3AIRA 4RZ4A 1Q6OA 1S1PA 3OZYA 2BOFX 4JEQA 2PZNA 4AQLA 4HNCA 4YTSA 1IEQA 1IQ8A 5A6TC 3IIZA 1K7FA 3LBMA 3FEMA 4JDBA 3C0SA 4HZ7A 4ZQNA 3WK1A 2OQYA 3EX1A 1QHOA 2QF8A 3EDDA 1UD3A 4GQQA 2P1FA 5A95A 4FX6M 4QGCA 4GCAA 4UTUA 1PXGA 2PF0A 4LF2A 5D2YA 4IP4A 5ABFA 2WLYA 3THQA 4CU8A 4JTSA 4Q8QA 3C2OA 4MFDA 4JDYA 3HPZA 1RR2A 2XDFA 4XBKA 2FZDA 5C9ZA 5TAOA 1PS9A 4R34A 5F4WA 4GNKB 4F0KA 2VGBA 3NJ3A 1EIBA 3SCOA 4O10A 4DWSA 4OFCA 3L7RA 1E4NA 4PMJA 5REQB 4C6QA 2ZRXA 1RD5A 3TLLA 1V0LA 2HBXA 3SJ3A 4MWAA 2J79A 1UR2A 3T0AA 1LROA 5CSUA 3MO7A 1L2QA 3CQIA 3O63A 4XVDA 3P7YA 2ZADA 3BLPX 4JQ4A 4YNGA 2RGMA 2JIEA 4MY9A 4MAVA 3H12A 3P8IA 3HG3A 3LLXA 1DJIA 3C3NA 3M41A 4KEUA 2PGEA 3DFTA 4UNKA 2YB4A 3G22A 4PCNA 3VUSA 3RJXA 3MZNA 1BF6A 5B80A 2A79A 1UR4A 2ZZ7A 4Y96A 1HL2A 2PP1A 4XZHA 3NQBA 3CHVA 4GABA 1FWEC 1GVFA 5HXMA 3IJ6A 1BWLA 5KETA 2GZXA 1TVLA 3L4TA 4XO6A 1AG1O 3TSDA 4N42A 1P1MA 1XI3A 3H22A 5HK4A 2OZ3A 3NA8A 3NYZA 1AZ2A 5HR6A 4DZIA 3CL6A 4GRSA 1R85A 5LNVA 1TG7A 3TW6A 1W9DM 4L6OA 3IJ9A 3LRMA 3MYOA 4PMOA 1R6WA 1JD7A 3GLCA 4AY1A 3ES8A 2PDGA 5D8ZA 4L6DA 3P5ZA 2VEPA 4L4MA 3QXBA 1IGSA 2V3EA 3H70A 1JPMA 2A3EA 3PTQA 3GM8A 2ISDA 4M29A 1XW8A 1ZUAX 5GNXA 3VOCA 1D9EA 1TX2A 3W7OA 1E6XM 4HZ6A 2YXGA 4HNNA 3W26A 4D8ZA 3ARWA 3W2MA 3OHMB 1VLWA 2ZXDA 2QUNA 2VT0A 3HGJA 1LG1A 4C6KA 4DX3A 1ZL1A 3TV8A 4O1AA 3GRIA 4MKNA 3VKKA 3NPWA 4TU1A 1PJ9A 2DH2A 4PBEA 3W27A 4F40A 4PH6A 3W7EA 1XDLA 1DBTA 1OHLA 2DUAA 3LSCA 4OU1A 1GVOA 1QI3A 4JX6A 1AD1A 1H61A 4OJYA 4ZEPA 1E71M 1CCWB 1UA7A 3KL0A 1X96A 1GONA 1KD0A 4OQVA 1PHWA 1EJVC 2PDLA 4Y9MA 5AFDA 4J27A 3KM8A 1V6TA 2E40A 3G5EA 1Q2RA 3VK5A 4JTTA 1W1ZA 1CGXA 4LAOA 5CC5A 3C8FA 4UC5A 3I7QA 3CUZA 2Z25A 3GH5A 3MI6A 1VHCA 3QFEA 1V3LA 5G4EA 4ZQOA 2XM2A 1TZ7A 2HMCA 4JAWA 5FF0A 2DJLA 3A6OA 3QMSA 3LHWA 3TMQA 5ABGA 1ZAJA 4D8LA 1TFVA 2HVNA 3WDRA 4W5UA 3EXSA 3R7MA 4U5KA 3W7KA 3F03K 4QE4A 4W8BA 3NQ6A 4I7WA 2GVYA 4PRTA 3FX4A 4HTYA 5TNVA 3MMTA 1JJKA 4CD8A 3KL5A 5K9XA 3NXFA 4U33A 2NQ5A 1GEHA 4GYPA 3EYPA 1E5NA 5DFAA 3TROA 4X60A 1UR9A 2Q01A 3ZYZA 3UZXA 2HE5A 3C2YA 1TWWA 4YXGA 2AQWA 5I77A 2BY2A 5CPOA 2PSNA 2ZE3A 5CH9A 4QDMA 4BCEA 1V5XA 1KXQA 1RQHA 2PWFA 4CQ9A 3M47A 3DESA 2Z27A 2Y7FA 1KM3A 4IG2B 3N29A 1VFMA 3EA3A 4UIOA 2YJQA 4ZOCA 3ZJ6A 1F3TA 4FOUA 1VQTA 3U0HA 3EWZA 4GFSA 3V5FA 1NFBA 1H0GA 4QISA 3B8UA 4YYCA 4AHPA 5HJLA 3FJ4A 3ME3A 3W38A 3TH6A 1E3XA 1Q2SA 1UQZA 3STEA 5E70A 2QCFA 4A29A 3LU2A 4ACZB 2E0PA 1P4CA 1E4MM 4RKAA 4K2SA 3TYCA 5CZTA 3LCLA 3S4TA 1R9ZA 1FXQA 2ZRYA 3BLEA 2F6UA 4I7VA 4Q8NA 4RZBA 3U8GA 1UASA 1BG4A 4HSOA 2QDGA 3ONBA 3MV11 4LUSA 4A05A 3GDLA 4JYDA 3VD4A 2CHRA 3BLFA 1OCNA 3T2OA 1UZHA 3BG5A 4BFAA 1D8CA 2ZIDA 3GXFA 1IXPA 1XYAA 2PMQA 3UWYA 1GTHA 5D2VA 2VOMA 1E0XA 4NX0A 1OD8A 2VC7A 2WHMA 2BHYA 1HL8A 4QDWA 4JTEA 2ATSA 3L67A 4NUWA 4MLRA 3TX9A 3MO4A 3L9CA 4PEKA 4EANA 4V2XA 1J5TA 4Z2JA 4NJJA 4PC8A 3R2GA 3GXIA 3ZT6A 4CCEA 4IQJA 3A21A 2G4JA 1HO1A 1JR1A 1OFRA 2FPYA 1SJAA 2HWGA 3IJDA 3WQGA 4KEVA 3OP2A 1KTBA 1A5NC 3CU2A 2XIMA 3WEMA 1QHZA 3LSBA 5CGMA 4JTUA 4CKQA 3HGSA 4TR9A 2OU4A 2XGIA 3ONCA 4JZ5A 4AG0A 2F84A 4CGTA 2PRHA 2X0YA 4KMQA 1UD4A 1IZKA 3GR8A 5EL1A 4B5VA 4ORMA 3IWPA 5BNKA 2QCDB 5EGRA 1H63A 4TX6A 1Z7AA 3WBWA 3VABA 3T1GA 4EPKA 3CNYA 4J3XA 2XWDA 5DXXA 1B57A 5EMMA 2EPNA 2BBFA 1DEDA 1ADSA 3AHTA 4CEUC 1IR2A 3MDWA 4AZCA 4WGHA 5FF4A 2BXVA 1J6OA 1GTEA 3R4IA 3VDCA 5I3GA 4PUDA 2BFGA 4GVGA 4EACA 4C65A 3OQEA 4V33A 5BXRA 4ZGYA 1HO4A 3P82A 2G3FA 3NQ7A 3W1RA 3AHZA 4LQ1A 2QUMA 1W5QA 1V51A 3T55A 4W87A 4C1LA 3LCIA 4DYJA 3M44A 2JQXA 3EWXA 3LLFA 3MI2A 1BQCA 2VTFA 3G0UA 3G77A 3CV7A 4ECLA 3ITTA 3N2OA 3RPMA 4C5YA 1Q4NX 4J2MA 4LCSA 3B9EA 3QPZA 1UOKA 1OSEA 2V81A 3MJYA 3GTIA 3TCEA 1V93A 4PSPA 1QO2A 1E9LA 4WXZA 5JMUA 5CEWA 2ISFA 3RLVA 2A3LA 5E9AA 3IARA 4DLFA 2EEXA 4ZO9A 4REQA 2VUNA 1RBAA 1J12A 2H8ZA 2VFHA 4DYEA 4E5TA 4L1WA 3NDOA 1FWFC 3W23A 3GB6A 4WXYA 2GJNA 4X0VA 1Y7VA 1ZQ5A 1PAMA 1XBZA 3U7VA 3XISA 3PULA 2A4AA 3UXAA 1NQKA 1BRLA 1FWCC 1J0YA 1YTDA 3H55A 4AYGA 2WXDM 4U10A 4PRRA 1KQZA 1UMLA 1W3LA 4KKXA 5E0FA 2IQTA 3BAYA 2DGAA 2FMNA 2Z2UA 1O6IA 5JBDA 3T44A 1NEYA 1FHDA 4XTDA 5FJOA 4PB3A 4NU7A 4MG4A 2G8ZA 3W71A 1QW8A 2Q8XA 4F0MA 1HVQA 2D0GA 4L80A 4NRSA 5HWMA 4LV4A 5F2GA 3HGOA 5IBXC 3WJZA 3SSJA 1T41A 3PUGA 3KHJA 3P80A 3OLIA 2WLZA 1U1JA 3ABQA 1FXPA 2E5CA 2XIBA 3VCCA 4KRZA 3ZR6A 3AS2A 1T99A 5IRPA 3KP1A 4LT9A 1YKWA 1DHKA 3LXAA 1MI3A 2BXZA 3CYVA 4TIMA 3N11A 3CWOX 4UR7A 3PNZA 1RA5A 1TWZA 1BVNP 2O9PA 5DX7A 1MSSA 2EG7A 1JPDX 1U5HA 1GHSA 3CMFA 3MP3A 4M7SA 4O8RA 1BEUA 1DJXA 3E0IA 3EOLA 4WSJA 4TTUA 1ZJIA 4K7YA 4UBPC 4JTRA 2IKIA 1ZZMA 4C5ZA 3WNKA 2PDFA 2HCVA 3IUIA 3VDBA 4FZIA 4CNNA 2XGBA 2DIEA 4JEJA 3CIXA 3OBEA 3ZMRA 3URBA 1PKLA 1JDAA 4A3UA 4EP8C 1FHLA 1UH4A 3FA4A 2TODA 3EB2A 4WY0B 1MNZA 3TC3A 2EQDA 4GO9A 1N8FA 3DG6A 4MSSA 1KXVA 3ICJA 2BP1A 1MUMA 2CBIA 3OW1A 3NXLA 2EF9A 2Q6ZA 3NM3A 3B0XA 5HOSA 4Q4KA 3EB3A 5C9WA 1TPFA 5CAKA 1FH9A 5A6JA 5ABHA 2W62A 3OZMA 3ARVA 1XL9A 2FYMA 5DBUA 2XVLA 3ARQA 3HG2A 4O4WA 3GY1A 3G1YA 3TXZA 2MANA 3UZZA 3P93A 3NQGA 1Z8AA 1G7UA 3S6TA 5FEXA 4HVXA 2JF6A 3OVQA 5LSMA 5DEZA 2Y8VA 3GG0A 2AL2B 3F2DA 2R8WA 3L5MA 2L5HA 3O9NA 3V0UA 1V6VA 1TO3A 3M9YA 4KETA 1L6SA 4UTMA 5GNZA 3QHNA 3T4CA 2BY3A 2VZTA 4W7WA 2D3LA 3K2GA 2J74A 4B3ZA 1NSJA 2UWFA 3QVQA 3T9PA 1E6NA 1VFHA 1FFQA 1SW0A 1XCFA 4LY8A 2XU2A 4J9JA 3VAVA 2EBNA 1WKEA 1EA9C 2J8TA 5AHLA 1XICA 5GQBA 3O6AA 1SMAA 1E15A 1GJUA 4IPPA 1EL3A 4FNSA 4A3QA 4DI8A 1GQKA 2EAWA 3QLDA 1OQFA 4ROPA 1J4EA 3FJ6A 4CQCA 2EPMX 4NAFB 1W1IE 1DWAM 1XLIA 5HMDA 3RN6A 1ZSXA 3TUUA 5I5RA 4GI9A 5FIPA 3MZ2A 1OWQA 3JZEA 3L4XA 1QATA 1M68A 3QYQA 4NNCA 5B7ZA 3AXKA 2CYGA 2FPTA 4ZTXA 5ENLA 1U1UA 2HSAA 4US5A 3MV01 2YPIA 4P8VA 4C7GA 3DIPA 2PBGA 3KFTA 2NQLA 1K9TA 1S2VA 2ZICA 1UC5A 3WNMA 4HPJA 4LAUA 3G18A 3CTLA 1JNDA 1KFBA 3EOUA 1U33A 2DW6A 3EXRA 3RGTA 2QMJA 2P5NA 4HSHA 4ZO8A 2WJDA 2AQOA 3BW3A 3ITVA 1KM5A 4OTKA 3F5JA 1XD0A 3QKZA 4NYUA 1OX4A 2C18A 3R43A 1ZLPA 3C52A 3PUDA 3NM1A 3ALGA 2OZ0A 4KBXA 3ITCA 5C5YA 4QLJA 3AZRA 5LNSA 3ATZA 4PMNA 4PCSA 1ODUA 2Q02A 4M51A 4AWEA 1EUNA 4JFVA 5DQPA 3GC4A 3LQLA 1DJGA 5T91A 4YHGA 2WMIB 4MHBA 4GINA 2TYSA 2ZUSA 3ELFA 5ECUA 4GY1A 1P0BA 4X2PA 4GZJA 5M3WA 1X7FA 3KCOA 3V18A 2BV9A 3WLKX 1IGWA 2VX7A 3T4WA 3CQKA 4JIQA 4PEEA 3S6OA 1ZY9A 3C8NA 1XQKA 1P43A 3V5OA 2QF7A 1JCMP 3AYVA 2DZTA 3N1AA 1TV3A 5CSRA 3NG3A 1E1EA 2XIOA 1VCGA 2XZ9A 2Q8ZA 1H49A 1AJ2A 4UTJA 4B2DA 1EJSC 5CSYA 5FSDC 4ATLA 4DRSA 3R6IA 4S3GA 5D8WA 1VFTA 1YDYA 3URNA 2VO5A 2W67A 3H2AA 4EOUA 1HKWA 4AW7A 4LFYA 2PTWA 2OXNA 1XIEA 1LCOA 1X7IA 4TVUA 4PUNA 1DQXA 4N7QA 3GG8A 4P7QA 1WX0A 1FQ0A 3WNLA 1LBLA 1WBJA 2X0HA 4BR1A 1QOXA 5BW6A 8RUCA 1KFWA 4ATDA 3L66A 3GG1A 4N02A 1ZJAA 1J8VA 4G1NA 1S2WA 2R91A 4MGGA 2J7FA 3UZWA 4IQEA 4J2PA 1XP3A 3KVJA 1JGIA 1WXYA 4HJWA 1OGBA 1HGYA 1M7XA 4K8GA 4NXKA 1JYXA 4Y2WA 3VZZA 2V3FA 2NV1A 2VRJA 4GUJA 3TOYA 3W01A 4UTWC 1SJCA 4CCZA 4IHCA 4EPDC 2VP8A 5I3DA 5FJRA 4ML9A 3E1F1 2A3HA 4CNOA 3HA1A 4ZTYA 1AFSA 2YXOA 1XIJA 5F1UA 2Y61A 4QS6A 2NX9A 2XFWA 5CG0A 3P8JA 3ES7A 1H7RA 4J5NA 3S46A 5JH2A 1FX6A 2G3IA 1QXLA 2E25A 3OG3A 1TTIA 3SY5A 4RDWA 1T7LA 2VC5A 4YCPA 4FMVA 4WY0F 1VP5A 4AIBA 3E2RA 3FOKA 5M1TA 3U4FA 4JTLA 2G97A 4RW5A 2V63A 4RL3A 2J66A 5DO8A 4S3BA 4M6VA 4MZYA 4BHYA 3TK7A 4IH3A 2UY4A 1BG9A 1AW1A 1ISZA 5DF0A 1X1NA 5DXYA 2Y89A 1DJQA 3FHAA 1K9EA 1A0EA 2YLAA 2JGQA 3PNUA 2RJGA 3VKAA 3ARTA 1CT5A 3U2ZA 1G4TA 3GFXA 2QJMA 3M0XA 1W5NA 1A5SA 9XIMA 4H2HA 3WK2A 1O12A 1XYZA 1DE6A 3CBWA 1F8IA 5AHIA 2XN1A 1A5CA 1S3HA 4ORIA 1GKRA 1RQEA 3WLQA 4CUCA 1WZLA 5E09A 1EC8A 3CHCA 4EX4A 1R7OA 1AZ1A 3BJTA 2J7HA 4B91A 5IHSA 1A5AA 2QNEA 1QWGA 1U5VA 2EPOA 3NO1A 3CGTA 5C6MA 3KUMA 2AMXA 2RFGA 2TSYA 4XD6A 4PMVA 1IT0A 1XISA 3LTPA 4XIMA 1KGUA 4WD0A 4FLRA 3U2CA 2OWCA 4TO8A 1TPWA 4MPQA 4MFEA 1Q6CA 1LL6A 3WF1A 1Q45A 3FVDA 2P8BA 1FWRA 1MRQA 2VD9A 4AY8A 3BGJA 3WQ4A 1V7YA 4HHMA 3WENA 3UWEA 4JQ2A 2WMGA 4F4RA 1JZ7A 3AJ7A 1I45A 5JBFA 2POTA 4DIAA 4AXNA 2RKXA 4OZOA 3BAKA 1UWRA 1AUSL 5DMNA 3F5LA 4R7WA 4F3HA 3G8RA 2XVNA 1K3UA 4M6UA 3UCCA 2J9XA 3KRUA 4CU7A 4XAPA 2O0TA 4RXGA 2W61A 1HL9A 3SN4A 4UTTC 5LIYX 2NQ9A 3FFSA 5H1WA 4ADUA 3MP4A 4WJXA 1E1FA 4NX5A 1W2PA 4U4MA 1MDRA 1TJRA 1E9IA 4QCEA 1CXFA 4H9TA 4RK8A 3MP5A 5BXSA 1EPXA 3W53A 3QZAA 4ZVJA 3WD1A 2O7QA 3U2EA 4H8UA 1R7AA 5KZEA 4FR1A 2KZHA 2I7GA 5HNTA 2JK2A 3W1QA 3DERA 3BCJA 2CXGA 3FDKA 4DNHA 1E4LA 3BQ5A 1KBLA 1DJHA 3IVUA 4HPHA 4GX9A 4AD1A 4NJIA 4CEXC 3N6QA 3L65A 4AD4A 3CQ0A 2VKZG 3QV7A 5IXEA 2RDXA 5FD0A 2WO5A 2OODA 5FEZA 4S3JA 2VEMA 5G4HC 2NZLA 2Y70A 3H54A 5AVHA 1EEXA 4MB1A 2CZFA 3DENA 1RCQA 3EWBX 3E0FA 2CZ5A 2QPXA 3AIEA 4ZL1A 4US6A 1XIGA 4QNEA 4Q7BA 4AD5A 3TJXA 4UTKA 2VQTA 5T9BG 3STPA 2YXXA 1BSLA 4PMUA 4ZOEA 3I4KA 1KO0A 3WMLA 1BVWA 1TWSA 2WSQA 3L2LA 3W88A 1JUEA 1JUKA 2QJNA 3H2EA 3EX6A 4NNAA 2HVOA 2H6RA 3ZJ7A 3KXQA 3AO0A 1GPWA 2FTYA 1R3YA 3LGEA 3UR7A 4XX6A 2FZNA 4LVGA 3PZVA 2VRQA 2ZX5A 4R53A 3W9ZA 1W17A 2DT1A 5LIKX 1MO0A 4GI6A 2WOQA 1US2A 5L6UA 2ODOA 1CX9A 1IWPA 2OEJA 2P88A 5D30A 4JY9A 4DI9A 2QUVA 4O12A 1XLMA 4JQAA 1F6KA 5HR7A 5CGTA 3HTWA 3KEHA 2PLCA 4I9MA 3STFA 3AI0A 2GJXB 2Z1VA 3TONA 5HINA 3PWAA 1JL8A 5EMLA 3VOGA 4BQ4A 1O66A 1XIHA 4Z42C 5K3VA 3QV9A 4OV4A 3TNBA 1JCJA 1W5PA 2GYIA 3V0TA 1DWGM 3QH2A 4I6VA 4M5PA 4D6IA 4G7FA 3RLHA 3LGDA 1IZCA 1EF2A 3R25A 5CPLA 1J5SA 5CBJA 3UGRA 4M8UA 4F2TA 1ONEA 4GJ1A 3M64A 2I17A 4A6GA 1WDWA 2VNCA 1VS1A 1IE7C 4JICA 5G2IA 1Y0EA 3WF4A 2Z4GA 2A6LA 3DHPA 1TPB1 2CKRA 1RBLA 3E6EA 4AB4A 3O0FA 4S3EA 1UWAA 3B4UA 4O0QA 3MBFA 3NQDA 4MY1A 3CAKA 2H3BA 2QW5A 3MI3A 4TVDA 4FK9A 2G41A 1OGSA 4LWWA 1X98A 2GUUA 1VEPA 1PKMA 2QAPA 4G2DA 2NLIA 2GGIA 2JF7A 2FVLA 5DCEA 4C90A 2E6AA 4HHPA 4AZ6A 3NEHA 1J0KA 2CHNA 2HNEA 4S23A 4JFWA 1HIZA 2CLKA 2DQWA 2ZRWA 3IIXA 4DJEC 1FWJC 4QJ1A 3E9AA 1TV2A 1V02E 3IANA 3LHUA 4BI5A 3GAYA 1GZGA 2QIIA 4KWSA 4XTIA 4Q22A 4IG2A 4GBDA 3NAVA 3WDHA 2G37A 4GXPA 1U1HA 1EB3A 5JIPA 1E43A 1VRXA 3ZT5A 1TV8A 3VUPA 3VO0A 1KCZA 1RP9A 1V7AA 2BY1A 4GXWA 3NNTA 3MY9A 2OGYA 4OUIA 3PSWA 1ITXA 3QEZA 2PP3A 3PZTA 1ONRA 4XUGA 1K03A 1HX0A 2ZZ1A 1KM6A 4LYQA 4XAZA 3UG5A 3I7SA 2X30A 2OYLA 2YYTA 3USZA 1E72M 4JFUA 3TIMA 3UPWA 4BEUA 1Q7MA 3BG3A 4O13A 4UMAA 5KEZA 1M01A 2HZGA 1UPPA 2C16A 1PYMA 2A1YA 4WSKA 2CLMA 1TREA 3WQ8A 2X7WA 3IV8A 3N2MA 2V82A 2ZX9A 3E74A 1SZRA 4JTQA 2ACRA 4DVOA 1AA1B 1NF0A 1UJPA 5I0DA 1J18A 2XH2A 4TX8A 4IQLA 3W2NA 3ZSTA 3PJWA 1GG1A 3PN8A 3SURA 1YTEA 4I5UA 1SFSA 3U6WA 1O60A 4XSMA 4CQ8A 2CKSA 4CD6A 1TQJA 1VBGA 3KVMA 2I16A 1R3SA 4IM4A 1HZYA 5I3KA 1DXEA 3ANUA 6TIMA 1HJWA 1TPC1 4H4IA 3MB9A 2F38A 2Y8KA 4F9DA 3VPLA 3OJGA 1GOIA 1BYCA 3H7VA 4E3VA 9XIAA 1PX8A 1GZJA 3RLUA 1DWFM 1KFCA 4LS2A 1I8JA 4LB4A 4PUWA 3TYZA 3W7MA 4R3UA 4ATWA 3I6TA 3S2NA 1GW9A 4BS0A 4RE2A 2WKJA 4PODA 3WN6A 2EPLX 2OWWA 2Z1BA 3REQB 1MDLA 4OKDA 1EOMA 4FOKA 1FH7A 1A5LC 2BDQA 1GQJA 5HQLA 3N2BA 1SZFA 2FZMA 1JCTA 3ZM8A 3M0MA 4LB3A 3ITOA 3HM7A 2DV0A 2P53A 1KGXA 3SFKA 3EMQA 1JAKA 1IT8A 3WYZA 2PGWA 2PGRA 3N19B 1UA3A 4D6HA 3GUWA 4AF0B 1H5VA 1LT8A 3B0VC 3W7PA 3TA6A 2O92A 5FESA 1YE6A 3XIMA 4PR4A 4GY7A 3BURA 3FHQA 3ZT7A 1DKWA 4HMCA 3K8KA 4DUOA 2Q71A 1S5TA 2QCDA 3VMPA 3K30A 3G1RA 1OCJA 2D1ZA 2OTDA 1T8QA 4HT3A 1TELA 3TTSA 3IJ8A 4JY8A 3LZ5A 4PCTA 2XN2A 3WG6A 2GJPA 4H6RA 2VJXA 5D9OA 3WKZA 2YCJA 3W24A 1OFBA 4JX4A 4YVPA 3LX9A 1AQ0A 3MT1A 1W1VA 1JXKA 1OB0A 1WDRA 3KL3A 1OINA 3S3GA 2PCQA 3T0TA 1W37A 2HXUA 2WKGA 3IIOA 2DDXA 1W3IA 2PODA 1K8XA 4KWOA 2F7FA 1NOWA 8TIMA 2TRSA 3TZFA 1B1YA 3GTXA 1QCWA 3GSMA 3HG5A 3C0QA 5HA7A 2XIJA 4FF7A 3C2EA 5LXEA 1QNRA 3K13A 3BCDA 4ZFMA 4BWLC 1QVBA 2B7QA 1HKJA 1I2NA 1EGZA 4GQGA 4HPGA 1H7NA 3GK0A 4JTKA 2DZAA 3AICA 1W5OA 1F61A 3BV7A 2QGHA 1ESWA 1KCLA 3QC0A 1EKOA 3POHA 1ZHAA 2TPSA 4CN1A 3S1WA 3KAOA 4AUBA 5E6ZA 1TUXA 5C71A 4I5XA 3C0LA 3NR0A 3H4XA 3M16A 1O5KA 4QLLA 3SADA 3BLKA 2HS8A 2W27A 1GYMA 2GLKA 4ERIA 3RNDA 1KKOA 5A94A 3KBWA 4HCHA 3SCQA 5A8NA 2FH6A 2GVLA 2Y62A 1OCBA 3ZSSA 3VOHA 5FOOA 1OD0A 2AOSA 2OGJA 3UCDA 4Q8TA 3C3UA 3BTNA 1DORA 1FH8A 4KCWA 4L9XA 2ZVIA 1SGJA 2PWUA 3DBNA 4IPIA 2CITA 4G1KA 4XZMX 3TDFA 3SQLA 3OBAA 3WQWA 4RNHA 4L4OA 2YCIX 4E2BA 2GSJA 3VIPA 5D04C 4UTLA 2J24A 3PWGA 3FJLA 4AEEA 4ZB2A 1Q13A 1WOBA 1A0DA 4HYVA 3B4YA 3THUA 1VPXA 5CC3A 1JRBA 1TCDA 2ZUWA 1SSGA 2ZDSA 2X8RA 3O0KA 1JF6A 3B8WA 3C86A 5JVLA 3CT2A 5U4NA 4CNSA 3VIOA 4CCCA 2NV9A 3EX3A 2WQPA 1ZFJA 2Z26A 2XISA 4XAGA 4MB4A 1M5WA 5KSWA 3VM5A 4A8IA 1C92A 4KF1A 4CCDA 4RV8A 3IK4A 4DXVA 3ABZA 3S83A 2J9YA 2YSWA 4IX0A 1OYBA 5DMMA 1BQGA 3CZKA 1C9DA 2HV5A 4E4UA 1L8PA 4CQAA 4PTWA 4HGXA 3NQAA 5E1QA 4L64A 2G96A 3MJMA 1ZENA 1Q66A 3WUEA 2QQ6A 3CPGA 5DCBA 3W1XA 3TWBA 3QFWA 1LG2A 1VJZA 4PCFA 1IIGA 1RJRA 1TWIA 3LDVA 1UCWA 4HIBA 4UFJA 1C8XA 3OVPA 5BWAA 2FMOA 4C60A 1PE1A 1IF2A 4EXAA 3OTRA 3ABSA 4WY0A 3CK5A 4D71A 2ZA2A 2TAAA 4W9TA 1HKMA 1BWKA 4BY3A 1RZMA 1QHPA 2ZFAA 1Z9AA 2A21A 2XVPA 1UWUA 5AC6A 1DXIA 3QHMA 3P0WA 4QITA 2E8ZA 1UB3A 4DF0A 3HFYA 5C7HA 2C14A 1S5NA 3ENLA 4ZBCA 1Q5MA 1NJJA 1OJXA 2VZVA 1VFLA 4NZ5A 2BB0A 4GVFA 5HULA 1E6ZA 1GOKA 1GVYA 4DAFA 1YMYA 3M4HA 1V3HA 4IPLA 4K36A 3WH7A 1PCWA 4B9YA 2WBKA 1CNVA 3TJ4A 3B9AA 3UXLA 4LUJA 3WD4A 4UQBA 1W5MA 5AB3A 3WFLA 1XRFA 4XD4A 3NDYA 1W9UA 2AL2A 1TA3A 2QCLA 3WDIA 1LM1A 1R9XA 1N7KA 2DJXA 3BMVA 3TW7A 3TZNA 1ME7A 5FACA 4MOZA 3P60A 4ZE5A 2V67A 4B15A 4B4FA 5C55A 1ICPA 4FB7A 2UY5A 4X2RA 4LEFA 1HG3A 2C3ZA 3WK3A 3CEPA 3OODA 1EWDA 3S9ZA 3VYLA 1NM9A 5EU9A 3CB3A 5DMYA 3WH8A 4P7LA 1IWAA 3I3EA 1CW2A 3RAOA 4QEHA 1YPFA 2QJHA 4NXSA 1P7TA 3AU6A 3TAOA 4DJDD 3MBDA 3MMUA 1P5BA 4IPNB 1KBKA 2YR1A 3AXIA 3WH6A 3SW6A 3N18A 3TN4A 1WUFA 1K7EA 1B54A 1XLDA 4A21A 1W3KA 4LVAA 2OZTA 3QY6A 3ZR5A 4UUIA 4ZQCA 1R8LA 3MHGA 3P5YA 1LWIA 4AZ7A 5IDIA 4E2DA 3EDKA 4BK9A 4IMCA 2OSXA 4K1WA 4EK7A 1MVYA 3FNDA 3ORWA 5AYIA 4JQ1A 1PZ0A 3W22A 1EJUC 3QOMA 1A50A 1HVXA 3EMCA 1Q3NA 3TR2A 1JDFA 3SY8A 1Q6FA 2WZMA 3UY7A 3EBVA 4B9ZA 2XFYA 1PIGA 3HMCA 1JI1A 1U2YA 4G8TA 1Q6LA 1KB3A 1LT7A 4MDPA 1EYEA 4WCJA 4GKLA 4OBTA 3VKJA 3QSRA 4UFHA 2CZEA 3VOIA 3SUTA 4ZOAA 1WBHA 3BZJA 1RAKA 3EOEA 1VFOA 1CYGA 1C7SA 1S3TC 3BH4A 1Z3NA 1O95A 4JFTA 3B0UX 4PUEA 4JX5A 4H6QA 3M0JA 4B92A 1UHVA 1IEWA 1VFSA 1GVSA 2MUCA 2INFA 3IVSA 3CLWA 2I5IA 3WUGA 4GO8A 4XUYA 1C8QA 1NARA 2D23A 4R5EA 2QDDA 1NU5A 3W2UA 1CLKA 2J8FA 3RR1A 4OE7A 1WDSA 1XG3A 3GVWA 1H09A 1XF0A 1QASA 2YFNA 1WDDA 4GIAA 2WB5A 5GJPA 2VEFA 4QAWA 5G4WA 5CSSA 4E8CA 2XM1A 1AQMA 1YDOA 3VD9A 4O54A 4KIRA 3APGA 2DVUA 4JNYA 3H8AA 1V77A 3AISA 1EBHA 2WNNA 2C6QA 1SU5A 3DHFA 3GNOA 5I3HA 1HF6A 5MF5A 4F48A 4WDXA 2NVAA 3BAWA 3DOPA 1N2VA 1SO4A 1NFPA 5A2CA 1XYLA 3NQFA 4B4HA 1TPUA 1YTKA 3GDBA 1OT1A 1C8VA 1XBVA 5FJUA 1F73A 3S1XA 1F3XA 2E6YA 5A6BA 3IV3A 5JIWA 4FNPA 2OMAA 4RNJA 4L5ZA 8XIAA 1ZU8A 2RJHA 1A4LA 1DJNA 3MSGA 1E5JA 2E68A 5D02A 4AHQA 3IRSA 4QE5A 3WIJA 2YW4A 1OCQA 1UKTA 1B9ZA 3BUVA 4NJGA 1MEIA 3A4JA 4XO7A 4AD3A 3VTRA 4PL1A 5HNUA 3F4DA 4MWAD 3SRHA 5CJNA 5FJPA 1JCNA 7ENLA 2HJPA 3RX2A 3VIHA 3N73A 3FSUA 3G1FA 4GJIA 3UY8A 4GMEA 4BF9A 3EOSA 5GNYA 3DGRA 1IIHA 1SO6A 3WJXA 1KM2A 2X2GA 4IMDA 4IGSA 3BDKA 3UG3A 2OCZA 4RZ6A 4JGDA 4MYXA 1BVZA 1DPMA 5I3FA 3ZQ9A 3Q94A 4C6LA 3UYCA 2HQAA 4NILA 4AH7A 3W02A 3M46A 3VNYA 3W4RA 1Z6KA 1JPHA 3B8TA 8CGTA 1FRBA 2E6FA 2F9RA 1HJUA 3QR3A 3CZGA 3HO8A 1F6YA 3DI0A 1EC7A 3VMOA 3WX7A 3WQ6A 2WV8A 5BMWA 5I09A 2VX6A 1W0MA 1HNYA 1KLZA 3QV6A 1UD8A 3NIYA 1E0UA 1G67A 5BRQA 1HUVA 3LEPA 1UKOA 4MUZA 4R9OA 4QP0A 1GOOA 2IKJA 5C9RA 1H2JA 4A22A 4Z08A 2WZEA 1P48A 3OA3A 2IMRA 4M1BA 1H7OA 3VC6A 3WLMA 3LV6A 2W63A 1GKQA 5LIWX 3W2LA 3GTFA 3U2OA 1RK6A 2ACUA 3HV9A 4GACA 2REQB 4V28A 1R46A 2E8YA 1R3WA 2OG9A 4PTXA 3LMYA 2WJEA 3IEBA 4O52A 5AKQA 3IGUA 3SUWA 1W8GA 2O7SA 1GQNA 1KTNA 3KOFA 3EMZA 4DJFA 3BSGA 2I5QA 3AXHA 2DORA 2OELA 3BOLA 4NZ4A 3GWQA 2D0FA 3TTYA 1REQA 5AOUA 3N6JA 2D24A 2PURA 4K1GA 5CBIA 2WK2A 1ZAIA 2QLYA 4GQBA 4M24A 3VXGA 3W1LA 4JL2A 2C71A 4FXRA 1YADA 2QHAA 3CASA 1VFUA 4LOCA 1RXOB 1NTHA 4QG6A 4MWAE 3TTQA 3W1TA 2V6AA 3URQA 2BOGX 2W4XA 3C61A 4AIOA 2OR2A 2YX0A 4LCRA 2PRLA 3HOJA 1WKYA 1V08A 1PWMA 1K1DA 4LBSA 3F4WA 2OKTA 2XSAA 1XIFA 4UQ9A 1W3JA 1RJPA 3FSTA 3EGJA 2FIQA 3TTEA 2O4MA 5IHRA 3DH7A 3POCA 4M56A 1NDWA 2I5GA 4NQ1A 2J9ZA 1ODZA 2C13A 3R10A 3EKZA 1OVDA 1XLHA 1WB0A 1HJVA 4A3HA 1H11A 3VDHA 3G0SA 1N55A 4JTCA 5AHNA 4IF2A 4GK8A 1OIMA 3VD5A 4LV9A 1DE5A 4QROA 1YBQB 3FGCA 2P0IA 1K8CA 4AZHA 4JHZA 4JNZA 4NIRA 1WCGA 2FHBA 3N9RA 3QBUA 2I56A 1EGMA 1KQYA 5A8OA 4DXXA 4GWEA 4JTHA 1KCXA 1KNWA 1YRRA 1P0EA 3PVFA 2C1GA 1N8WA 3C6CA 1QNSA 1Z41A 5C2GA 1U30A 1J01A 4Q4OA 1BYAA 1B3WA 2FHCA 4E2OA 2YCKX 3MSDA 1B5TA 1X38A 4G7EA 1M3UA 3NZQA 4C1KA 2WHLA 1Y8BA 1LUCA 4ERAA 4Y8FA 1Q6DA 3UJRA 1CLVA 3W85A 1J96A 3GE7A 3SECA 4UB9A 3WQVA 3WJWA 5L9FA 1YX1A 1JYWA 3CIVA 4ZSUA 3GNDA 2ZUMA 2HPIA 1PZ2A 3BOXA 3AIQA 4O18A 2WCSA 3ARRA 2QT3A 1B2YA 2NXGA 3B9NA 1LBMA 2DT2A 3DBPA 3WBXA 4JIPA 1B0IA 1S5MA 4POCA 1CXKA 1W9BM 4F0LA 5FAJA 3R94A 1W1YA 4EPEC 1FHVA 2PF8A 1MQQA 2ZRVA 1SUXA 4O1EA 4NZ1A 4B5UA 1XC6A 4WF7A 1ONXA 4NJHA 1YE4A 4KW2A 3WBYA 1UD2A 1ZS2A 3KP0A 3MUCA 1TMLA 1UP3A 5CKSA 2FVMA 2J7GA 2PS2A 4Z1DA 1PEZA 5LXXA 4M7TA 2DSWA 2CBUA 4GIEA 3AU2A 1W6TA 4H7ZA 2A2IA 3Q45A 1BYBA 2PA6A 1GHRA 4CNTA 4C1NB 3PY2A 2E3ZA 3PWIA 4E3TA 2BS9A 2GJXA 4ZQRA 1F9CA 2GK1B 3U9IA 3VFLA 3P0XA 9RUBA 1CB2A 4NT0A 3U7BA 2CPUA 1WAUA 1ZBWA 3QR0A 2Z7GA 4W8LA 5M5DA 4QX4A 1MWOA 2XH4A 3NOYA 1JRCA 3USBA 3BSHA 4DBWA 5J8LA 1O5XA 1JDEA 4CU6A 1SZGA 2E28A 3QM3A 1Q85A 4JKLA 3GU9A 4LYKA 2XN0A 2VXNA 4FI4A 3W7IA 2W91A 4WOZA 2B0MA 1KRBC 6PTDA 1KRAC 2CZVA 3NQ2A 2QJJA 1MW2A 2BASA 3T2PA 3ZJ8A 3S5ZA 1Y5VA 3LI1A 5ABFB 1P0NA 3C56A 3DEQA 2J75A 3CHEA 4J7RA 4JTGA 2YB1A 2Z0IA 4KWVA 5DT5A 1JDDA 1X1ZA 3AZTA 1PHQA 5HBFA 4HNUA 2Y7GA 2PGFA 1QAPA 3LM3A 1NIUA 1RK5A 4GZ7A 3R13A 5M2FX 4UR8A 2PTDA 4IFKA 4DWSB 2EGZA 4KGLA 4U5IA 3AUOA 2PC8A 4HZ8A 4L9ZA 5F1VA 5KZ6A 4WQ6A 3SJNA 3OB8A 4LXFA 4Q4SA 2ZZ5A 4V15A 3RR4A 5HQMA 2A5HA 1EBGA 5D32A 4Q33A 1LP6A 6CGTA 2JGYA 1GVIA 3O6YX 3GDKA 3FYOA 4Q8UA 1X39A 3PG9A 3M5VA 3TQVA 1OC5A 4XBSA 3W2JA 4QLKA 3A4WA 2X7VA 2OT0A 4C6OA 3FIGA 1GJPA 1TTJA 1E40A 2Z7KA 2QJGA 3PZUA 5C7VA 2DUZA 3PF3A 4B3LA 3SQSA 1TJ1A 3VA8A 3TMLA 1JULA 4HA1A 4DNMA 1JD9A 4D1JA 1VLIA 2V2CA 4WKAA 2WSPA 4GC4A 3VU2A 1M7PA 2I14A 3DHDA 3CHFA 3LBOA 2Z00A 1CIUA 3WMBA 2H90A 3NZ1A 3SGGA 3CWHA 3E5BA 2Y6ZA 5A6LA 2DW7A 1PX3A 3IUHA 4FXSA 4NP7A 4L7ZA 3I7RA 3MW7A 4U2YA 4MUPA 3JR2A 2GGGA 1ICQA 1KBBA 1WZKA 3FVMA 3WBEA 4IFOA 1MQPA 3AROA 1X97A 5B7YA 2GUYA 2W5FA 4Z1CA 1VR6A 2JIWA 2VFEA 3B8VA 4GFIA 2GWGA 4MAZA 3HFTA 1G94A 1L8NA 1AMYA 2X16A 3S2LA 3WF2A 1I0BA 1XRVA 4DPPA 3REQA 1L9WA 3R0DA 5DN1A 4KFPA 3UZYA 5A3HA 2PLMA 3OO2A 4Z2LA 4S3AA 5AC4A 2WJFA 4FLSA 3DC0A 4LS0A 1V6UA 4KT2A 1QWKA 3A22A 3VMNA 3AIVA 2Z29A 2WZHA 3IUDA 3PJTA 4W4QA 4QFUA 2QXWA 3LXBA 1PYFA 3WDJA 4FA3A 3VCRA 4AF0A 1Q8AA 3BICA 1F3EA 3FYYA 4LY4A 3TC6A 4H9ZA 4LAMA 3SCUA 5EYWA 1FUYA 4GH1A 3LCGA 4YL2A 2P3EA 3N2TA 1UIPA 3UWZA 3WLHA 3LLDA 2QIWA 3KHDA 2Z6JA 1PKYA 5DBTA 2WNQA 2D22A 5JXQA 3Q65A 2F61A 3GZ3A 3RX3A 5CPNA 1R3RA 5BMXA 1OC7A 2HS6A 2BX7A 1S46A 4DAIA 5AZ0A 3DAQA 1OX5A 4AIUA 1Q65A 3G1HA 1XLEA 2O9TA 5HJXA 4ZO6A 2YDSA 2H9AA 1KWKA 3HZ3A 3OGRA 4PB5A 3VKBA 3N4AA 3L12A 3A9BA 4CQBA 3TAKA 1V3IA 3O07A 3R1ZA 3TE9A 1TYGA 2BTMA 1LORA 1W2VA 2P8CA 3NZGA 1QI2A 2E7FA 2OOGA 3S0CA 3NUKA 4IIHA 5EA9A 4UTFA 1XV8A 4FIRA 1VZWA 3N15A 3O16A 1PB0A 1GQLA 3BW2A 4PFHA 3SCVA 4HMNA 1PKNA 3HPAA 1CGYA 4UQEA 3A5FA 3L68A 2Y4SA 1X6UA 4N0RA 5E0CA 5G2WA 4JCLA 4P8WA 1H62A 3LQGA 4GH3A 2WWDA 4JYEA 4XD3A 1QU4A 1DQUA 3MKVA 2C1IA 1KCKA 1VIZA 4IUOA 4L1XA 3GD6A 3PTMA 3W29A 1XPYA 2PWGA 1E6PA 3N12A 2PU0A 4J28A 4O28A 1L6YA 1RUSA 1G4SA 4KFOA 1Z32X 1GYNA 5BXTA 3N17A 1QPKA 1A3WA 4H7CA 3CJPA 3CZJA 1VYPX 1J11A 4EPBC 3QGVA 4H19A 4O16A 2W9MA 4HSNA 4PMYA 3NVTA 1IEVA 5MKGB 1QI4A 4F0SA 3K8MA 5H91A 4PGLA 1QNPA 4XBJA 1FP8A 3W74A 4ZCWA 4W5ZA 2ZQ0A 3QQ0A 4W7VA 3PANA 3NSNA 2ZA1A 1X6LA 1A53A 1VC4A 1N8IA 4KPLA 3TYAA 4WDTA 4KIEA 1UKSA 4Q32A 1XGZA 2BVTA 3CAWA 1MZRA 4HPXA 3GFYA 3MUY1 4MJ4A 4X0NA 1KA9F 8XIMA 3I6EA 1UR8A 4EAYA 3G6LA 1DIKA 4HTBA 1XM3A 3DCPA 2E5BA 3HJZA 1GT8A 1T5AA 4US5D 5A6AA 1UP0A 1M6JA 4HZMA 5KITA 5D09A 4C6JA 3M43A 1PDZA 1FWDC 2BLEA 2ZUUA 1XGDA 1BTCA 4FSAA 1B4EA 5DANA 1XYCA 1X6NA 1J2BA 4J3ZA 1JNEA 3V3WA 1FHUA 3DFPA 4IWWA 3QHOA 1WXZA 2WC4A 3AYRA 2VFDA 2VELA 1P0KA 3MU7A 1TE1A 4RJEA 3ABXA 4JIRA 2FGLA 1SFJA 3D3AA 1Q6EA 3VILA 4PL2A 4UOJA 2V68A 5A8MA 4HOZA 2A7PA 2PWVA 4QBXA 1BXNA 3QQ1A 5E6YA 2YBTA 3FAWA 4A3YA 2V5KA 1GYLA 3L4YA 1F4HA 1T8XA 1TTQA 4BF7A 3NQEA 1UROA 3UQNA 3CMGA 2WSKA 4DM2A 1VF8A 3GXTA 1ZTVA 4HYWA 3UNTA 3NL5A 1O1ZA 4GYJA 3EWUA 1PZ1A 1ME9A 2X41A 4AVOA 2EKCA 3O2LA 1QNOA 4NG3A 1SSDA 2GFTA 2QCEA 4AU0A 3LZ3A 3OZOA 4AD2A 1NDVA 3VOJA 4UWMA 4AZCB 5IDZA 2PDPA 3F4NA 1MW1A 1UOZA 1MZHA 3SFWA 2QJIA 2J88A 1BPLB 3SCPA 5E9XA 2IUZA 2QPSA 1F6PA 4BI7A 4D6DA 3RO8A 5IFTA 4E4PA 4XSLA 2HDJA 4LH8A 1JPIA 4IMAA 5LNRA 4HP5A 4W7UA 1DWIM 3GBEA 4B2DD 2VGGA 3NDZA 4JCMA 2Z1WA 5ABEA 3N6HA 8A3HA 2DIKA 3GZAA 5IBXA 4H00A 1QNVA 2A0NA 3THCA 1E3ZA 1O4UA 4W88A 1FCBA 3GIYA 3G6MA 2NLYA 5DY3A 1XH2A 3W7QA 3SR7A 3WH9A 5BYWA 3DN5A 2VHLA 3G8EA 1V3JA 1PTDA 3LY0A 1Q63A 3DXIA 5CJ5A 4JTDA 3MS8A 3WLTA 2V2HA 3P81A 3EOOA 1CDGA 3L4WA 1YNQA 4O4VA 1YXDA 3N3MA 4M19A 4CNUA 5C0QA 3MUXA 4XZIA 1F4AA 4QEEA 2D20A 2HBVA 3IAPA 5CGQA 1XSIA 3P84A 1O94A 5C70A 3A3WA 4L9YA 4XD5A 2E67A 4INFA 3RF9A 4YTRA 4N6FA 1JCXA 3T78A 3W7DA 3KBJA 4IXHA 1KLYA 1XUZA 1M53A 3LD5A 2EHHA 2OT1A 2NVCA 4E0CA 3CUFA 2G5WA 4YYFA 2DT3A 3KRSA 5LA2A 5I7GA 4RPQA 4P7RA 2WSYA 3WD2A 4XZWA 4GI4A 3BJSA 1MEHA 1NY1A 3W84A 5K7JA 3AS0A 2F2HA 2PTZA 2W79A 2WNZA 1RV8A 3A4AA 3CZ8A 3DYMA 2WMFA 3H2CA 5JU6A 1RD6A 3IVTA 2GDQA 1XC4A 1YXYA 3D6NA 2YL6A 3WF3A 5I3IA 2A3CA 1LOQA 1Z48A 4FR6A 1POJA 4WIWA 3G1DA 4K38A 4AWUA 5I00A 4IMFA 3VOFA 3ABOA 4ZSTA 3VIMA 1EWEA 5FKYA 3PBYA 3LK6A 2P10A 2QKFA 1E55A 2HRWA 4GGBA 4KS0A 2A3BA 1XDMA 1VJSA 4ZFCA 3KX6A 2PCEA 3M0ZA 3VGDA 3V5CA 3LGGA 2BVWA 2J78A 4Q7IA 5HMSA 3AUJA 4LW7A 1V6WA 2EG6A 4WOQA 5J04A 4CN6A 1K4HA 3GVQA 1NVMA 3ZWSA 3L4UA 4P7OA 1XRSA 2V5DA 3RM4A 3EKLA 3NSXA 3TWAA 5TQLA 2OZ8A 1C7TA 1VPYA 4HCDA 2J6XA 4WDUA 3NGJA 4P8UA 3WL1A 1QPNA 2NX3A 3E38A 2CWXA 3AJXA 1TJ0A 4NI3A 3FKKA 1HP4A 1XSKA 3QC3A 3CUHA 3MSYA 3TLQA 2PDQA 1RH9A 3N2CA 7A3HA 3N25A 2B7PA 5A2BA 1QK2A 4ICNA 4LBUA 1HTIA 2NSOA 1NP0A 3NVDA 2PDNA 2EG8A 5CCZA 4IGNA 4JYFA 3GKFA 4Q4RA 2V5BA 3S2MA 4E38A 3VX0A 2Z1XA 3UJ2A 4P5UA 2W6RA 4U31A 3QW3A 3WLIA 3KLLA 1T0OA 3CQHA 4LUYA 1OZQA 1UUQA 1UYQA 1R30A 3EWDA 4UFLA 4IQDA 3GW3A 3IK2A 4DZ5A 2YCLA 3W00A 2ONEA 4D6GA 4RCXA 3M0YA 1OIFA 1EZWA 1CZ1A 2FB3A 4G6CA 1E1CB 1JFXA 4AHOA 3BO9A 3PTKA 3BK0A 3AZSA 4UOZA 4JFSA 2DT0A 1LZOA 4I5RA 4AVNA 3L21A 4HD5A 3WEOA 1TPEA 5AC7A 1G9HA 4WLCA 4G56A 4J3SA 1KFEA 4AYSA 2G0WA 4XK2A 1TV7A 4C6NA 2ZC1A 1Y5XA 3GHUA 1ECEA 3TTOA 3PAOA 4IIBA 1EYWA 3ZVHA 4H83A 1S38A 5FF2A 1L2UA 3KZPA 2PDCA 1RCXB 3KTSA 4UZSA 2VDGA 1H1YA 1ZJBA 2PP0A 4LX4A 3THAA 2FH8A 5D37A 2C7FA 4YWIA 2YDRA 3EDFA 3DDMA 4Z2GA 3J7HA 3OIHA 5AECA 3VGBA 2R24A 2X42A 2OEMA 2RH9A 2VWTA 2OPJA 4RR4A 4DELA 2PTXA 3LHYA 5K9DA 3JS3A 3ARUA 4FOJA 1B30A 1SJDA 4PULA 3UWQA 1C9WA