1QRQA

Structure of a voltage-dependent k+ channel beta subunit
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a voltage-dependent K+ channel beta subunit.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords PROTEIN (KV BETA2 PROTEIN)
total genus 117
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qrqA00
2IQDA 1PWLA 1RY0A 3UWEA 4YVXA 1Q5MA 4R9OA 2BP1A 1EKOA 5HA7A 4Q7BA 3U2CA 1JEZA 3H4GA 4PUUA 1K8CA 3O0KA 2PF8A 4LB3A 3CV6A 3LN3A 5AZ1A 4JQ1A 2ACSA 1Z89A 3CASA 4XVEA 3LUTA 1ZSXA 4DZ5A 4QR6A 4FZIA 3M64A 1Z3NA 1XJBA 1A80A 2HEJA 4WEVX 2PDYA 1X96A 2IKHA 1C9WA 4XZNX 2VDGA 1Q13A 3GUGA 4EXAA 2PDGA 3S3GA 3MC5A 1ZQ5A 2HVNA 4GIEA 3UFYA 4WRHA 2ACUA 1X98A 1SM9A 3H7UA 4LB4A 4QX4A 4LAZA 4JTRA 3UP8A 3FJNA 3DN5A 5KETA 3UZWA 4GCAA 3UYIA 2FZBA 3GHUA 4WDTA 2DV0A 4JQ2A 2FZDA 4GQGA 2PDBA 4YU1A 2PDWA 3LQGA 3UZYA 1VP5A 1EL3A 4PRTA 4DBWA 5AZ0A 1AZ2A 4L1XA 2PDUA 4GQ0A 1AH0A 4JQ3A 3CV7A 2INEA 2P5NA 4QBXA 3R8HA 3UGRA 4HBKA 5LIKX 1J96A 3CAQA 2A79A 3LZ5A 4HMNA 5C7HA 3C3UA 2R9RA 2C91A 2PDXA 3WBWA 2R24A 2PDCA 3BV7A 2NVDA 2WZMA 3Q65A 2ALRA 2ACQA 2IKIA 3FX4A 4JTQA 3R58A 2PZNA 1PWMA 2F2KA 1OG6A 5LIUX 4XVDA 3RX4A 2PDPA 4IGSA 3F7JA 3N2TA 1Z9AA 1PZ0A 3GHSA 2I17A 3B3DA 2IPGA 3RX3A 3CMFA 2J8TA 2HE8A 1HQTA 5DANA 4MHBA 2HDJA 1AH3A 2PDKA 4LAUA 4JTCA 1EXBA 4F40A 2PDMA 3BCJA 3Q67A 3V0TA 1PYFA 3T42A 4FALA 2NVCA 4GA8A 4H8NA 3R8GA 4LBSA 2F38A 1ADSA 2FZ8A 3ONCA 2PD5A 4JQ4A 4H7CA 1IHIA 1FRBA 2FZ9A 1YNPA 1S2AA 1QRQA 1M9HA 2PDNA 2IPFA 3QKZA 3LENA 4Q3MA 3WG6A 4XZMX 2WZTA 4WDUA 4PMJA 3EAUA 1EF3A 3BUVA 3RX2A 4JTAA 4JIIX 4WDWA 4JIRA 2DUXA 1RALA 1T41A 2BGQA 3V0SA 4ICCX 1ZUAX 3LQLA 1RY8A 3R94A 3O3RA 4G5DA 4RPQA 4XZIA 4AUBA 4DBSA 1AFSA 1S1PA 5LIWX 2BGSA 1MRQA 2IQ0A 1Z8AA 2INZA 2FVLA 2IKJA 3V36A 3G1RA 3G5EA 4YS1A 4ASTA 4IJRA 1GVEA 3KRBA 5JH1A 1MI3A 3V0UA 2PD9A 2IPWA 2I16A 4XAPA 4GACA 1R38A 3D3FA 3M4HA 4WGHA 3R43A 2PDJA 3GHRA 4QXIA 3MB9A 2ACRA 4YVVA 4XK2A 2AGTA 3NTYA 1IEIA 1LWIA 3WCZA 4XO7A 2PEVA 3UZXA 4DBUA 2HV5A 3WBXA 4JTDA 4L1WA 1UR3M 3P2VA 3V35A 4I5XA 4XZLX 4JQAA 1XGDA 2PDIA 2DUZA 3H7RA 3N6QA 1LQAA 1QWKA 4PUWA 3LBOA 1YNQA 1AH4A 1T40A 4XO6A 1PZ1A 4LBRA 5LIXX 3BURA 2IPJA 1X97A 4IJCA 3LZ3A 2CLPA 3DOPA 3GHTA 3R7MA 3ERPA 3ONBA 2FGBA 4JIHA 2IKGA 2IS7A 3UG8A 1XF0A 1AZ1A 4PR4A 3M0IA 5HNTA 1HW6A 3EB4A 2PFHA 3EB3A 3LD5A 3LEPA 3CAVA 4OTKA 1YE6A 5JH2A 3R6IA 4WDXA 1S2CA 3VXGA 4ZFCA 1US0A 1S1RA 4EXBA 3COTA 4FA3A 3WBYA 5M2FX 4PRRA 4FAMA 4YVPA 4GABA 5HNUA 2QXWA 5LIYX 2PDHA 2HE5A 3LNMA 2HVOA 1MZRA 1VBJA 1YE4A 2ISFA 2PDQA 4XZHA 2PDLA 4NKCA 2PDFA 1ZGDA 3UZZA
chains in the Genus database with same CATH superfamily
2XIOA 4YYCA 1YKWA 3GTXA 4YVXA 3C3NA 5CBBA 1Q5MA 3VNJA 2X7WA 3BQ6A 3PANA 1JPHA 1IQ8A 1R3YA 3GXDA 1TJ2A 3ARRA 1IWPA 3ZMRA 3KLKA 4LB3A 2WCAA 2QCDB 4E4PA 3G1XA 3CIXA 1NDZA 4B5UA 2BXVA 3M0HA 4PTWA 3HOJA 3CPRA 3EX3A 3O07A 2RFGA 1PIGA 1ZSXA 3GBEA 3MV11 4XTDA 4O11A 1DQWA 3TCSA 3VOGA 6REQA 2YOCA 3IRDA 4UTLA 3P80A 3EOLA 4I6KA 4BQ3A 1H49A 3NZ1A 3VC6A 2PP3A 2BV9A 1J01A 1OT1A 4Z0SA 4JD4A 5HUOA 2Y24A 1IGWA 4D6FA 3ZT7A 1HJVA 3N2XA 2J47A 4NI8A 3PPGA 4ZOBA 3L21A 2O9TA 3T81A 3ZFHA 4IL2A 2QCLA 3ABRA 1K8ZA 3W73A 4ZTXA 5BZAA 1HL8A 2ANUA 2QUMA 4L1GA 4QX4A 1THFD 4URIA 2CETA 3T0BA 1L6GA 4AEFA 6ENLA 3OGSA 4ROPA 1JPKA 4GCAA 2FZBA 4O52A 1SJCA 1SR9A 5I3JA 3K4DA 1E55A 3FYPA 3IACA 4TXEA 3AALA 4CQ8A 4ECLA 4D8LA 4XTIA 3AFBA 5E5CA 3WQOA 2WJZA 4DNMA 4GFIA 3P62A 3WDIA 3DKJA 3UZYA 3GDKA 1FWRA 4M80A 2B81A 2BVWA 3G77A 4O53A 2XTKA 3TVAA 1ONRA 4YYFA 1MQPA 3CQKA 1K4HA 3IIVA 3RIKA 3KAOA 4GQBA 4RR4A 1A5UA 3GXNA 1P6WA 3DDMA 1LZOA 2WJDA 1ITXA 1CXLA 3S9ZA 3WBWA 1LTDA 5D04C 1XICA 3ZIZA 4A3HA 5E0KA 1GGOA 4UTMA 4NJHA 3CB3A 3JVAA 3PBYA 3SY5A 4DJED 1E6XM 3FX4A 2XSBA 4QQ3A 1KM5A 3G0UA 3CYJA 3VGDA 3L5AA 5T26A 4Q4KA 3GZ3A 1UBSA 5FI8A 2GJPA 5LIUX 4C6JA 4LXFA 2GSHA 2WC4A 2Y61A 4GY7A 2IPGA 3TYBA 3RX3A 1W54A 2G3IA 3WQ6A 1UC4A 1VENA 4ALDA 2BY2A 5DANA 3HG4A 2G4FA 4NZCA 2HDJA 2PDKA 3T55A 3TSBA 2TPSA 3GUWA 4F3HA 3R0UA 5IDIA 4PTXA 4KBXA 3M07A 2Z2BA 1QO5A 3DESA 5FA5A 2X0HA 3ARYA 1C92A 1WAUA 4US5A 4QNWA 1ADSA 3TJ4A 3HA1A 4W5ZA 4UFKA 1ITUA 3V5OA 3QZAA 4DQWA 3N4FA 2FPTA 1W9BM 3C2RA 5KZMA 2QJJA 4GNKB 2WOQA 1M7JA 4Q3MA 4XKMA 1FCUA 3PAOA 3IJLA 3OIXA 5A94A 1DWFM 2F6KA 1LLWA 3QHNA 1WCGA 3W7EA 3CU2A 4HJWA 4DIAA 3L2MA 2YFOA 1XM3A 1PL9A 3G18A 3VIFA 4I8DA 4DWSA 2E6AA 1JR1A 3C2VA 3VD7A 4NF7A 2PRMA 4Y2WA 4ZFMA 1JYVA 3O3RA 1AL8A 2XVKA 2D20A 4EIVA 4MZYA 2I1OA 1AFSA 3A4WA 2IQ0A 4B4FA 1P0NA 4WKAA 1O5KA 2Y7EA 4PA8A 4YLWA 5HMEA 4IT1A 3ABZA 4RZBA 4B92A 3IWPA 4Q22A 3ITTA 1KV8A 4HZ6A 1GVOA 1FCQA 1QNPA 4D6GA 4B5WA 3EDFA 4B3ZA 3IJQA 3Q94A 2PWEA 4XAPA 1NIUA 1GG0A 1R7AA 2NWSA 4WY0F 4CKQA 4RXGA 2X1UA 3E0FA 3GHRA 2XIQA 4GQRA 5FAJA 3EMZA 1Q2RA 1KR1A 1VZWA 2PEVA 3GRIA 2YJQA 1RBLA 2ZA2A 3THQA 1I2NA 3LI0A 3K2GA 2RUSA 5TBOA 2NW0A 4GH3A 4CQDA 4AVNA 4I5XA 1X6LA 1XGDA 1TX0A 3ARXA 4AEEA 2WZHA 3D6NA 3TK7A 4YTSA 4B9ZA 2GK1A 2FHFA 2IW0A 4LEQA 3M0ZA 1VB9A 1IT7A 4PUMA 3RG6A 1MNZA 3APYA 3GC4A 1F6YA 2O9PA 2YKKA 3CQJA 2HRWA 3IJ6A 3H21A 1AODA 1AK5A 3ZJ7A 1U33A 2J7EA 2J7CA 2WSRA 1A49A 1U1JA 1XKJA 3ZSSA 9RUBA 2VC6A 1VQTA 3IARA 3CYVA 1HW6A 2YB4A 2R6OA 3PTKA 3KBSA 3MBDA 1GW9A 4NX5A 2XN0A 3E02A 2XUCA 1J4EA 2QIWA 5F4SA 1KRAC 1JRBA 1OFPA 5DF0A 1FH7A 2QCCA 5IHSA 1CLKA 1US0A 3AUOA 4AQLA 5KZDA 2AMXA 1W5PA 3MVIA 3T09A 4B2DD 4GABA 2VENA 4B3KA 1JCJA 3P0XA 1KRBC 3QRHA 2C1HA 2HPMA 3MHGA 2WANA 1VBJA 3MTWA 4Z2IA 5G4WA 2VR5A 4DJDD 1EGZA 1HXJA 3SUUA 2PDFA 4CNOA 3VMPA 3K8KA 1ZGDA 3O2LA 3GM8A 2DH2A 4J3UA 1XLFA 4QISA 3UWEA 2G5WA 2Z27A 2DY3A 1NEYA 3USBA 4HMEA 4GIAA 4U3AA 3H53A 5AB3A 3WLMA 1K8CA 3H2EA 1UP2A 5FF3A 3S83A 3MMDA 5ABFB 3R79A 1HKJA 2EG7A 3OBEA 3HTWA 2VT0A 4MNKA 1KLZA 1YIXA 3FEQA 2QJGA 2D73A 5AVHA 4E4FA 4QR6A 4D9PA 3SGGA 2QR6A 2A5HA 2F9RA 3AHVA 1V3HA 2CBIA 4HMDA 1B3YA 3R2GA 3OLEA 1OC6A 2BG5A 2OZ8A 2WNZA 2XWDA 4L7ZA 1AQMA 3WN6A 3ZT5A 1DOSA 5BXRA 3AICA 2CZEA 5E93A 1LCOA 2PU1A 2ZWYA 3VNDA 4HOXA 1QPOA 3ZZ1A 2CLMA 1K7XA 4DYEA 4ZCWA 1KQZA 3CO4A 3GO2A 1TG7A 2PCEA 4EPBC 1DORA 3LY0A 4JIQA 1NFBA 2EF9A 3L23A 3H2OA 3LCFA 1OABA 4HT3A 2CNCA 3W1QA 3HPFA 2G3JA 3QQWA 4RZ4A 4U2YA 2PODA 5D38A 3W72A 4YU1A 3TC7A 4LS2A 2ZZ7A 2KX9A 1JVNA 3EOUA 1VP5A 4GI9A 3NL3A 4GQ0A 5AC8A 4B3LA 3EKZA 4WUIA 1D8CA 4HHPA 2INEA 1LBFA 1AD1A 3VD3A 2A79A 4ORMA 1KRMA 2QDEA 2W66A 2V68A 3SCVA 4RZ6A 3SW6A 5HMSA 1ICQA 1Q66A 3ABQA 3KRZA 4I9JA 4J28A 4QDMA 2HS8A 4LFYA 7REQB 2Z1VA 2RDUA 1C29A 3C2OA 4ZO6A 2PU0A 3LV6A 4IGSA 4B2DA 2ZX8A 3KCOA 3M5XA 1WPCA 1PZ0A 2ZUUA 3GHSA 2I17A 3LCWA 4QJ4B 9XIAA 2D0HA 3UJRA 1UD8A 5A2BA 3GAKA 3G1FA 1XLJA 5C55A 4I90A 3E2SA 1O12A 2V0TA 3AYTA 1RPXA 3UZJA 4JTEA 1ZZMA 1RD5A 1KBLA 2P88A 1UD6A 2FVMA 2FPVA 5CPNA 4GJ1A 2NX9A 3M0XA 1SZNA 5DRIA 1DPMA 4GYKA 1PYFA 2E1WA 4GA8A 4H8NA 2Y62A 3FKRA 4UTJA 5FEZA 3FXYA 3PUDA 3NQ2A 3B0XA 4MIMA 4XX6A 4IIHA 1R6WA 3SN0A 4DWSB 1PX3A 4GUJA 4DJFA 1S5WA 1M03A 2FTYA 3R12A 4WDUA 3SUVA 1QI5A 3FVMA 2QPSA 1NWUA 3ITOA 2YXGA 4IPLA 1NQKA 1HJUA 1EF3A 3W7IA 3H22A 5CSRA 1OD0A 3M5VA 2Z4GA 1JPDX 4C1LA 3DH7A 4I9AA 4XIAA 1D9EA 1QUMA 2GQ3A 4H6QA 3VUPA 2FIQA 3CUXA 3IIOA 2W62A 3WD0A 3E5BA 4GIYA 4IL0A 5BXSA 4H8HA 1GONA 1Q6DA 4YL2A 1J5SA 1LWJA 2XIIA 5LYRA 1K8YA 3Q4DA 1G01A 2E9LA 3V36A 2EO7A 5D37A 4YS1A 4QCFA 3FAXA 2YX0A 4DJFC 1V7AA 3N4AA 3ZVHA 3V0UA 4U5IA 4M6UA 3T6CA 4RL3A 1XV8A 3T8QA 1SFTA 1UJPA 1C90A 3BGAA 2ADAA 4IIFA 4LV4A 2VC9A 2XVPA 3HG3A 1TV5A 3CUFA 3I3EA 4YTQA 2VZTA 3MB9A 4CLMA 1EP2A 2HTMA 1FWDC 4E2BA 2GFTA 3W7NA 3V75A 3CEPA 4K38A 4HOZA 2DT0A 3AS0A 2NV9A 5CGQA 1XSKA 4DUOA 1XG4A 1WKEA 1P0BA 3D3AA 1E6SM 4PEKA 3ARZA 3CUZA 4CGTA 1CGWA 4DX3A 1GORA 3DFHA 4GI4A 3KS5A 2KZHA 3B8WA 4JHZA 4DN1A 1YNQA 2YIHA 4RPPA 5I3HA 4A2SA 1T99A 2VCBA 2VCCA 3R8RA 5AC5A 1SW0A 4FNPA 4K7VA 2WWCA 2YDRA 1H3GA 4DYKA 1L0PA 2IKGA 3SBFA 2EXOA 5EBUA 2ZXQA 2YGYA 2OSXA 2QGYA 4O1CA 2YDAA 3OTRA 2AQWA 3TFXA 3M7SA 1E40A 3EB3A 3PJXA 4HTBA 3LEPA 4ADSA 4S3KA 3PZVA 2QF8A 4CD6A 1N7KA 1D3HA 3RLVA 5U7SA 1S1RA 2Q09A 4PMZA 5DRCA 5EYWA 3GTHA 1OCJA 5LNUA 2F84A 2O55A 3KBVA 2YW3A 1F3EA 1UP0A 3BJTA 4P2VA 4Z2HA 2GK1B 4HK6A 2JIWA 1VPXA 3VYLA 4NYUA 4AHOA 1LP6A 3CLWA 4H9UA 5E6YA 2DZUA 4BY3A 1SJAA 1VEMA 2FDSA 1BYDA 4W7UA 3KWXA 1KM1A 1J79A 2J8FA 4GE8A 9XIMA 2TAAA 1W0MA 1CI1A 1DIOA 1A5NC 3AIWA 5D09A 4NNBA 3LCHA 2QCHA 1TPB1 1DHKA 5HQMA 1EHAA 2Y6ZA 5A3HA 4GRSA 2CITA 3RF9A 1TVLA 1Q6RA 3VCRA 6TAAA 1Y5VA 4YTUA 4CVUA 1QWGA 1TVPA 1UWRA 1I2PA 3N17A 4HNNA 3UNDA 3TU9A 4H19A 1OC7A 1WZLA 3ISIX 2F2HA 2C7FA 4QJ1A 3QBUA 5J8LA 4GZIA 4MGGA 4LF1A 4Y8EA 5BRQA 1HZYA 3VIMA 4FIRA 4DUWA 5IRPA 2Z7KA 4DLFA 4UTWC 1C93A 5D2XA 4D72A 4UR9A 3VU2A 5JVLA 3ANUA 5G2WA 1DIKA 4AMAA 3HGJA 3BAKA 4LB4A 3NZQA 1JCLA 2DSZA 3RNDA 4P8XA 4IISA 1XYFA 5IDZA 4F9DA 1SZFA 4UFJA 4GQGA 4EWND 3YPIA 2PWDA 4HN4A 4ZENA 1PZ2A 3W53A 4FK9A 2XVGA 3WLNA 4XV0A 1KBIA 1VEOA 4E8GA 1OX6A 2OODA 4JDBA 3TAOA 3CAKA 2Y8VA 2W91A 3LDVA 1WZAA 1GHSA 3TMLA 5C7HA 1TX2A 2VX6A 3S0CA 2E6YA 1OINA 2PDCA 1DWGM 2GQ8A 2Y8KA 4LEFA 3C52A 3EXTA 3R58A 2BY1A 2PZNA 5D03A 3L66A 4AY1A 4J2MA 5C6MA 3U3HA 1E6PA 2AL2B 3SCPA 4B90A 4H3DA 1OG0A 4D6JA 2VNCA 3WF0A 4LVAA 4QE5A 3WBAA 3VABA 3U6WA 3IRSA 2J75A 1F2JA 4NILA 4W8AA 1J0YA 3GVRA 1XD1A 2EG8A 4MAZA 4UB9A 5EMLA 2WVTA 1R2RA 1G69A 1V0MA 4LAUA 1CEOA 2LLEA 4PCSA 3WLRA 5AC7A 3QC0A 1NH6A 1U22A 4I3GA 2OOFA 5E70A 2A7NA 4LX4A 3KOYA 1Q2SA 4LBSA 2VYOA 1QPQA 3OP2A 4E8CA 4DZIA 3ATYA 3AIRA 4ACYA 2WYSA 5TIMA 4EPKA 2FZ9A 5A6AA 1RBOB 2JGYA 3CXOA 1M9HA 3PBUA 4NZ4A 1UWAA 3UPMA 5BRPA 3B9EA 3APGA 2PUZA 3PP7A 2TRSA 1CLVA 3VA8A 2REQB 4YTRA 1GCYA 4Y9AA 3K1DA 2ZA3A 3TOPA 2J9XA 2YCJA 1NDWA 5HNNA 2J8GA 3J7HA 3L9CA 1P48A 3FOKA 1NQ6A 3EZ4A 3LXAA 4GUHA 3U2EA 3TYCA 3H70A 3URNA 1BRLB 3NL2A 3VOFA 2EEXA 2ZX9A 5I5RA 3ES8A 3UWQA 3G1DA 1TIMA 4QE1A 1GVQA 2AGKA 4PC8A 4DVOA 2OPJA 3G5EA 1ODZA 3AWNA 1E3ZA 3PZGA 4IJRA 1Q6QA 3EWYA 1XDMA 1WBHA 4P7NA 1FHLA 3A9BA 4N9BA 4M6QA 3QW4B 4UQ9A 8CGTA 5IOBA 5CZ0A 3W22A 4JFVA 1MO0A 2QKFA 3KVJA 2Z2UA 3QPYA 1VAHA 3OZMA 4GGBA 8XIMA 4PB5A 4HGXA 5H2ZA 5CBJA 5DMYA 4WOQA 4QXIA 1TJRA 1MQRA 1IT8A 3A13A 2Y85A 1WB0A 1V02A 4GBDA 1FKXA 4FLOA 1VJSA 4WHBA 2FFCA 3FA3A 2NUXA 1F3WA 4G7FA 1HJSA 4ATLA 1XCXA 5A8PA 3SRKA 5JXQA 3CTTA 1TUFA 2O92A 2PBGA 3BLEA 4CNSA 4JQAA 4DRSA 4UFLA 4PN2A 1QWKA 3W24A 3B04A 1QW8A 3QM3A 1YLVA 3O9NA 5I23A 1ISWA 4TVDA 3R1ZA 3PWGA 1VS1A 5I3FA 3B40A 4S3FA 5LA1A 3DOPA 4V1YA 1XH1A 2E3ZA 1TWSA 4IXHA 4QIUA 2FGBA 3UG5A 3A4XA 1B3ZA 7PTDA 1AZ1A 1QVBA 2C79A 3GVQA 3SN1A 2GGGA 4WJEA 1TMQA 2XN2A 5BMXA 1OY0A 3CL7A 1PKLA 1CTNA 1YQ2A 3P84A 1V0LA 3LK6A 4R3UA 4OTKA 4Q7NA 3OIHA 1X39A 4K3ZA 3TNBA 2XN1A 4MYAA 4KCVA 1XBXA 1BWLA 1E4NA 2EGZA 2GJXA 1H63A 4GG9A 4IM4A 4ES4A 2VGBA 1HVXA 3PY2A 3WBYA 3VKCA 3DUGA 2C16A 4GISA 3IPWA 4M6PA 3ARWA 2CLOA 4H9TA 1GVYA 5F7UA 1I9CB 4QDPA 3WH8A 3NPXA 3SCRA 1H7NA 1V08A 3EX1A 2ZFAA 4O8AA 2QPUA 2WVSA 4TOQA 1K1DA 3L2LA 3GU2A 3CIVA 3URBA 1S5VA 2QCFA 3N3TA 4JPGA 1F8IA 1PWLA 4F9JA 3Q58A 1P0KA 1UD5A 1FP8A 3KVKA 5C0QA 3EDDA 1CDGA 3CS2A 3B9DA 3DYPA 4O1DA 3UEQA 1JEZA 3DXIA 3OW1A 3O0KA 2FH6A 1N8FA 2D3LA 1BYBA 2C1IA 3WDRA 1W1A1 3PB0A 2WMGA 4FR6A 4EANA 2Y88A 4F0MA 4F0HA 5T9CE 4N02A 2XGZA 4JTFA 4EPEC 4DZ5A 2PF0A 4O1FA 1XBZA 3ABOA 1XH2A 5C8BB 3ZLGA 4AIEA 1XG3A 1RVGA 1UMLA 1VCGA 3GK0A 2HISA 3IUDA 1S5NA 3QQ1A 4FSAA 2IKHA 3GB6A 4L80A 5KZEA 2E8ZA 3CHDA 5FSDC 3CMJA 2VZOA 1R3VA 4FMVA 4HU4A 3A23A 3DFSA 4Z0JA 1VLWA 1QOPA 3W1NA 1BF6A 3GS6A 2Y1HA 3KP1A 3VNMA 1J18A 1OVDA 2DZTA 2XZ7A 4ZTYA 4H9ZA 1GYNA 2YSWA 4MLRA 4JTRA 3UP8A 5BYWA 1S3HA 1RK6A 3VIHA 3AMDA 5KTLA 1G7VA 3MUIA 1BSIA 1BG4A 2QDDA 3MWCA 3UXLA 3E2RA 2PWFA 4HB7A 4GYPC 3TR2A 3ZJ8A 1AUSL 4LW7A 5G1TA 2XFFA 2NQ9A 1XLMA 3VIKA 2VWSA 4LUIA 1M5WA 3STGA 4HU8A 1IT0A 1CGXA 1F73A 1UD4A 5GQBA 2V3DA 4LF2A 1P5BA 5E09A 4NQ1A 1DJQA 4JQ3A 4EXQA 3DYMA 4L4MA 3A64A 5LNSA 4O28A 3UWVA 4HBKA 2WLZA 2BS9A 5LIKX 2X1IA 4IGNA 3LXCA 3V18A 3L4VA 2C91A 4HVXA 2Y70A 3S2LA 2CWXA 1ALDA 3RCYA 3WZ0E 5IBXC 1H11A 1UHVA 1NTHA 3U5UA 2VTFA 4GJIA 1AJZA 2DZWA 1XDJA 3DFNA 3BICA 3W3OA 2OJPA 3H12A 3ARTA 4C6BA 2AAAA 2YA2A 4LUSA 1VRDA 5IFPA 4JEJA 3QY6A 4FX8A 5ABEA 1G4EA 3RN6A 2QQ6A 1BLIA 1E4MM 1MFVA 1C91A 3N3MA 4HA1A 1KCKA 1E3XA 3NXFA 4EWJA 2OZ3A 3PPFA 3VIIA 3MVTA 4PULA 5K9CA 3ELFA 3WMLA 1X8FA 2XFRA 2Q02A 1S2UA 3S2JA 3IANA 3PBMA 1VH7A 3C61A 6A3HA 4S3AA 1UH2A 5EGRA 1UH3A 4U2ZA 1KD0A 2PTDA 3L7RA 2G3MA 3UXDA 3ZJ6A 1KRCC 4TVUA 4C6DA 4Q8OA 4PMJA 1V8EA 1GYLA 4GYFA 4ICNA 4AZ6A 3E0VA 1FCVA 3AYRA 2W6RA 3POCA 1QW9A 2D2HA 3U8GA 2BGQA 4MB1A 1XS2A 2CW6A 2HQAA 2EQDA 3N4EA 3L4WA 2YCKX 4PBEA 3TNOA 2I14A 1W56A 3OA3A 1PCWA 4CD7A 1W3NA 3MMWA 4N42A 5F2MA 3L4XA 4WIWA 3VNYA 1EUNA 1D3GA 4R27A 3GFYA 3NIYA 1R9ZA 3BPWA 4INFA 1R3QA 1WYIA 1P7TA 4NZ5A 5TF0A 8TIMA 2IKJA 3RMJA 1NOFA 4GNJA 3NM1A 4P7RA 3TSMA 5CZSA 4GIRA 1GVEA 3TONA 2ISVA 4B15A 5E0CA 2IPWA 2XSAA 2Q01A 5AOUA 1PB0A 4LSBA 4ZVJA 1GW1A 1PAMA 2RDTA 5ENLA 1LT8A 1Q6GA 2GJRA 4PMVA 3M4HA 1H7OA 5FEXA 3PSVA 1CGYA 1BXNA 5G4HC 4LYQA 3WK2A 5FJIA 1J2WA 3B0PA 3T0AA 1XQKA 2AGTA 4M82A 3NOYA 1TMHA 5FAGA 2YL6A 4UZUA 3LLXA 3E9AA 3EX6A 5D9NA 3M5ZA 3S6OA 3FW6A 4UQEA 4O4WA 3EX4A 5U4NA 3QLDA 1R9YA 4LVFA 4IFKB 4O14A 1OFOA 3P14A 1SO5A 1T40A 4ACZA 1F9CA 4C6IA 4HNCA 4F2UA 2HNEA 1PV8A 2I5IA 3F03K 1M7PA 3M0YA 2QULA 1JZ3A 3UXKA 4PODA 3PG9A 5C71A 3WNNA 2Y5SA 1JJKA 3K4WA 2D24A 4ATWA 3W00A 2PLMA 3VD9A 4L6OA 3I7SA 2C14A 3W2KA 4K8GA 3T2QA 4O1EA 1IR1A 4C6QA 1CYGA 4WDXA 1F3XA 3MWAA 3EDKA 4G8TA 3E0IA 2VQUA 5I79A 4NZ3A 3EGJA 3PAJA 1UKQA 4J3VA 2RJGA 4IIGA 3B8VA 1WDPA 1HKIA 3GW0A 3CEUA 4PYSA 5LIYX 2PDHA 4MJ4A 4KFNA 5LKYA 1HKKA 1DEDA 3C86A 3GW3A 2ZTJA 3UJSA 2PPGA 4ZSTA 1JAKA 4MJZA 1B0IA 2WPGA 1HT6A 1GKPA 4JTKA 1EJSC 2YZRA 1SJBA 2ZZ4A 1U5JA 3EPNA 2IXUA 3K8MA 2V9DA 3CB8A 4WSHA 4BQ4A 3WBEA 2ZZ1A 3IJ9A 2Y5EA 1AG1O 4BKNA 3LM3A 4JKKA 3LN3A 1DBTA 2Q6ZA 5AZ1A 2OT1A 4Z17A 4YTTA 4J9JA 3M5YA 2WXDM 1Z41A 3B0VC 3CQIA 3MKCA 1YPXA 4BJHA 4UNKA 5K2ZA 4NXKA 3Q2DA 1WDRA 1UUQA 1A80A 1OD8A 5DEZA 4CNNA 1W9PA 1SO3A 2UBPC 2NLYA 1J12A 2PDYA 1ZP4A 4JIEA 3QOKA 3QTPA 1V93A 5T91A 5TNVA 5KZ6A 4QP0A 3LXBA 3QY8A 3KEHA 3NL6A 2FPYA 2Z6JA 4AWTA 3HG2A 4AX6A 3PZ9A 1OCNA 3FN9A 2GYIA 1BXCA 4BR1A 3L0NA 3HMCA 5CAKA 2QCDA 2DZPA 4PB4A 3VIJA 1FHUA 1YADA 3OHIA 1ENUA 1C8QA 1J11A 2C1GA 3KL0A 4REQB 1DTUA 4FNTA 2DSKA 3WJWA 2FKPA 3SSJA 1EQPA 2HK1A 1CB2A 4UTUA 3TZFA 2PDUA 1LROA 1LYXA 4H6KA 4AF0B 5BWFA 3CO8A 4RX0A 1EDQA 4DBEA 4HMNA 4UCGA 4KRTA 1W1VA 1W1YA 3QHOA 3AS3A 3W2UA 4HPXA 1J0JA 2DORA 5C9UA 2PMQA 3W1XA 2ZQ0A 3URQA 5M17A 2CXEA 3CZEA 4IMAA 4XKYA 4RW3A 4YJ5A 1WDDA 2F2KA 4I7VA 1T6MA 3ZVHB 3NQEA 3BLPX 2QJNA 3PZMA 1TO3A 1WKYA 2OZTA 4V15A 3S9YA 2YDQA 1BYAA 2XU2A 1JDDA 3R25A 2HVMA 3UG4A 2ISDA 4G9PA 5BOEA 1MUWA 4P7OA 3W02A 2PDMA 1DJHA 3FA4A 3WUBA 3DIPA 3CGTA 5LXEA 2PD5A 3U48A 3W7JA 5RUBA 3FJ6A 5B7YA 4LC8A 4MY8A 3AUJA 3TIMA 4A05A 4UNLA 2OEJA 2PWGA 2D2OA 1ISVA 1DP0A 1X1OA 3L67A 4M3PA 2GJLA 2BVYA 1UD2A 4NUWA 1NP0A 1W3LA 5KMYA 3DECA 1FUYA 3CZKA 3Q45A 3LHWA 3A5FA 3P3BA 1E4IA 2V5CA 4JIRA 2J62A 2WW5A 3WQPA 3TN4A 3CL6A 1RV8A 1FHDA 1OK6A 1AL7A 1XLLA 5FJTA 1YDOA 4Q4MA 4E8DA 1FWSA 3VM5A 1QPRA 2WCGA 3HPAA 4QAWA 4DBSA 4L6HA 3TYDA 4W5UA 3GTNA 1FBAA 3AI0A 3GNNA 1Z8AA 3SR7A 2R94A 3GDTA 3IK2A 4OBRA 1TV3A 1YRRA 3QY7A 4HA3A 1A3WA 3SDOA 3BW3A 2WC7A 1GG1A 5BU9A 1C3FA 3U4FA 3SUWA 3W7OA 3W37A 3PWIA 1VFFA 3QOMA 3QC3A 2GUBA 1B3VA 1VFHA 3NGJA 4Z1DA 5HJYA 2A6NA 1E43A 4LNCA 2J9ZA 1UW9A 1NF7A 3W2NA 1E71M 4C5YA 4N0RA 3SECA 3FV9A 3NWRA 4FXSA 3CWNA 5I3IA 4DWSC 2CU0A 3P2VA 5BOOA 3OVRA 4XG1A 2QAPA 1E6RA 4UMAA 5TD4A 3UJEA 3QVQA 1PIIA 2VFHA 5DT5A 3NM3A 3KBJA 5FJUA 4OBTA 3SQMA 3F2DA 5HDRA 5SWUA 3ZJKA 4XAFA 1OT2A 1E5NA 5KEZA 4Q6XA 1ZENA 3W0KA 3WK0A 1VCVA 3AHTA 4HA0A 3QZEA 3KTSA 1ZJBA 3GHTA 4BCEA 2WKGA 2AKMA 2J27A 1R46A 1VBGA 2WNWA 2HS6A 3AMKA 5A6TC 1UOKA 2GVYA 1XD0A 3SCWA 4C91A 3UPBA 5FJRA 2P0OA 1LF1A 1SPQA 4W8LA 3K8LA 1EUAA 5BNKA 1TKKA 2V6AA 4HA4A 2CBJA 3A9IA 2DGAA 3NFUA 2ZXAA 3GAYA 1ZU8A 2OG9A 4Z42C 5BOFA 1JF5A 4DJEA 2QMJA 4C6KA 2CLKA 4MG4A 3BAWA 4PMUA 1B1YA 3WH9A 1XBYA 4FAMA 3M7WA 2Z1KA 4MJ2A 4M29A 3W7LA 4FI4A 1E9ZB 4UBPC 2P3ZA 5CXPA 1NF0A 4GQQA 1TE1A 2XYLA 4BEQA 1KBBA 3S6DA 1PKMA 1TWDA 4G1NA 2ISWA 1LT7A 3AS1A 1Z44A 4N4PA 3BOLA 4WSJA 1XIDA 1MXSA 3WF4A 4AVOA 1TPFA 4GH1A 1Z32X 4O0ZA 3WLQA 4RE2A 4JBRA 2EJAA 3LX9A 2ZVRA 4UFHA 3T2OA 1P4CA 1KLYA 2GGHA 3HGSA 2V2DA 2CLIA 3R0DA 4UC5A 1P1XA 3QMTA 5JBEA 4S3GA 1H5VA 4OHQA 2EKGA 1KFJA 4IFKA 1OF6A 2BWGA 2E28A 2WMHA 1X8CA 3NSMA 1OHLA 3PM6A 3T78A 2XH7A 1GEQA 1TMLA 2VMFA 3QR0A 3T08A 1SYTA 3WQ5A 1R3SA 1XJBA 3E38A 3SCNA 1JPIA 2HEJA 3LHUA 1JRCA 1RD6A 2E67A 1SSGA 2INFA 3VFCA 3QGKC 2V63A 1FCBA 1YBQB 1TTIA 2BOGX 2HVNA 3U5YA 1ZJAA 3GH4A 2FGZA 5A1AA 3NQAA 4JYFA 2TODA 3PZNA 3BLIA 1IXNA 1RLCL 4B5TA 2VGFA 3NYZA 1LUCA 1JCMP 4Y9MA 1QI0A 3DI0A 4IGMA 1FH9A 1TWWA 4KEUA 3BE7A 4JDYA 3VCNA 3PSWA 4AY7A 3ZQ9A 4E4UA 4JKLA 4Z1BA 2PDBA 1TZ9A 4L9YA 5J04A 2JKEA 1AQ0A 1E15A 5A8OA 3E3HA 2VEGA 2XPKA 1DJNA 3GG7A 1EL3A 1AVAA 2GVLA 1ZPTA 2YR1A 1LL4A 3TR9A 4A21A 1Q7QA 1XBVA 2EPKX 3JZEA 3W2MA 2QVNA 3CV7A 3GD6A 4Z2JA 3GXMA 3AXKA 4X22A 3GVWA 5AYBA 4IPPA 3CAQA 4MWAD 1EP3A 3VI2A 1TWZA 4N2YA 3N9RA 2YCLA 4C7DA 7ENLA 4B91A 3MI6A 4FOKA 3TAKA 4QM1A 2PTYA 3LM7A 1OYCA 4L6DA 1XR2A 7XIMA 1Q4NX 3JR2A 4LYPA 4S23A 5AHMA 3GR4A 1J93A 1H7PA 1FDZA 2VEIA 3IV3A 3G6MA 3E96A 3N29A 2E77A 3VGEA 1GOIA 4NRRA 4E0CA 4IICA 2CXGA 2X8RA 4FLSA 1M04A 1PUDA 3T44A 1YMYA 4MHBA 3POHA 3BDKA 4C60A 1MUCA 1AH3A 1L8NA 3BLKA 2P10A 2EPHA 4ZR8A 3XIMA 1V6WA 2Y7DA 2VVSA 3T4CA 3MS8A 2WHMA 1TVNA 3KDOA 3KTCA 1TPH1 3LLFA 3CL8A 1H1NA 3IGHX 3CUHA 3KOWA 5DN1A 2HMCA 4QLLA 4E5TA 3P61A 5HPOA 4Q8VA 4WCJA 1VFUA 4X2PA 2PLCA 3A21A 3BW4A 3WMSA 4YPJA 3QKZA 4ZE5A 3TZNA 3UR2A 1GTHA 4C5ZA 1RJRA 4LS1A 4F8XA 3TTEA 4LVGA 5XINA 4JTAA 3RRAA 1LOSA 2I56A 5K9DA 3KOFA 4WVXA 1TPC1 1KCLA 4B4HA 2GVJA 4J3TA 1G4PA 3V0SA 1POJA 1BWKA 2G3FA 4CEUC 1B9BA 2FGLA 1ZCCA 1W2VA 4RPQA 3VIOA 4US5D 4UOQA 4KW2A 1PX8A 5A8NA 1HGYA 3EYPA 3K13A 2OFJA 5GNZA 1Q63A 1F76A 1YTKA 4JCLA 3AS2A 4M7SA 5H8MA 6XIAA 4DEFA 1QW7A 3QPEA 5JH1A 1AMYA 5D9OA 4B9YA 1A5MC 4HSHA 2J6XA 3TKFA 3DG6A 2I16A 1OYAA 2PTXA 3H2FA 4H4IA 4P7QA 3T0DA 3PPCA 4JX6A 2WSQA 3GLCA 4BQ2A 4RK8A 2PP1A 5CLWA 1XINA 1XWYA 5DMLA 3THAA 4DNHA 4OV4A 2XDFA 4LVDA 3SIZA 1CZ1A 4WF7A 3VD4A 1CLXA 4W85A 1R87A 2PRHA 1DWJM 1TSIA 5G2IA 4DUXA 5IM51 1V3LA 4AZ5A 4IPIA 1H60A 3QLLA 3RUBL 4K36A 1P43A 1FWTA 2V3GA 3EEZA 5DO8A 4QG6A 1SW7A 1A5OC 1F74A 1A5KC 4JTLA 5CG0A 2X30A 3ABXA 4PH6A 4ZQRA 1W3TA 1B54A 1B31A 2YDSA 4GBUA 4CQBA 1A0DA 3RRXA 1VRXA 4W87A 4HIBA 3BAYA 4GI6A 4A22A 1A50A 1RJQA 3HO8A 1UWUA 4AWUA 3N15A 4XKYB 1D2KA 4N7QA 3QZ6A 5GPRA 2PTWA 2FTPA 4DBDA 2OMAA 3BVJA 1JI2A 4NT0A 4BF7A 1XIBA 5JH2A 3B8UA 4JZ5A 3TJIA 1AQHA 4EXBA 3LTSA 2FJUB 1RJPA 5D2TA 4ZQMA 2Z26A 3P8JA 3OZYA 3MV01 5CC6A 3BK0A 3G8RA 3B9OA 4B5SA 1D7KA 3DX5A 4KPLA 4V27A 3HZ3A 3K4AA 1TZ7A 2DZXA 4GD0A 5FF7A 2BZNA 4H6EA 1Q65A 4DB7A 1EA9C 1RY0A 1A47A 6CGTA 2Z2AA 1EKOA 4K37A 4ACZB 1UBPC 1E6ZA 3NAVA 3U2CA 2GZXA 2WZIA 3GC2A 1J0KA 4HD5A 2JFEX 4KWUA 4GGHA 1NOUA 2O9OA 2YCEA 3B8TA 4HPNA 1K8XA 4HU3A 1GQNA 4YN5A 5LGXA 4LYRA 2WQDA 1LQ2A 3B8IA 5HMFA 2YL5A 1PBGA 2Z7GA 4TTUA 1EOMA 1DXIA 2J88A 4EAYA 2BVDA 4AZ7A 1OC5A 4A2RA 3N2MA 4LTSA 4IMCA 4ORIA 1X98A 3ZWSA 1OGSA 3BLLA 2OT0A 3NQ6A 5GJNA 3TEVA 1XLIA 3KRSA 3W29A 5CC5A 1ZLPA 4IP7A 3D47A 4Q4RA 4S2BA 3SY8A 1KGUA 4RE0A 3FGCA 5EFFA 4JL2A 1VYPX 3KW3A 3FDKA 5BCAA 1K9FA 1E1EA 5C2GA 4U3CA 5AFDA 5CPLA 2EG6A 3W1MA 3CHFA 4QJ3B 4NNAA 3PUEA 4TTGA 2W79A 3R89A 5BROA 2A3HA 1JD7A 2HNHA 5TQLA 3NQBA 3N12A 2F61A 5D9PA 1YXCA 1OX4B 4NY2A 5FIPA 3UETA 5I6SA 3LHZA 3WH7A 3PTQA 2PZ0A 3VDAA 1G67A 3U4AA 3R8HA 1B2YA 1DKWA 2WBGA 3A3HA 3E5PA 2WMIA 4JTGA 3S8HA 1PCKA 1Q3NA 3STPA 2WB5A 2QUTA 4A3UA 2O0TA 3S2CA 2OEMA 3C0JA 1QNVA 4JTSA 3HF3A 1G4SA 1KWGA 1ZB5A 3M16A 4Z2GA 4KT2A 3S47A 5D2VA 2E40A 3HG5A 1BTCA 2I57A 1K7EA 4AIBA 3MUCA 2V67A 1VBRA 2WVVA 1E4LA 1OZMA 3GBDA 2J79A 3M44A 3KL3A 4JTCA 4A8RA 3VNZA 3UU0A 4EAMA 4F40A 5A6KA 4S38A 1TCMA 3RLUA 3G0XA 3WQGA 1XQLA 1H51A 2F38A 3MKKA 4MVAA 2GGJA 2FZ8A 5D4YA 2A3EA 2YYUA 4M5PA 1XFBA 4KIRA 4H7CA 1IHIA 1M7OA 1YNPA 3IK4A 3TW7A 1S2AA 1CIUA 2RGLA 2VO5A 1H41A 1ZJIA 2FB2A 3VE7A 3NR0A 4XZMX 3PUGA 4LV9A 4FP1A 1V3JA 1GOKA 3NQVA 2VZSA 3SFWA 4TVCA 4XSLA 4F79A 2WMJA 2DUXA 3GKAA 1IGSA 3H4XA 5LA2A 3QMRA 5C2XA 3CIWA 2QMKA 3MZNA 3VGBA 4LUJA 1W5QA 3PZOA 3RM9A 3S1GA 1W1ZA 4W84A 4S2CA 1JPMA 4LPCA 3AXMA 4PTDA 5CBIA 3BG9A 4JNZA 3PVFA 1LJYA 1EJWC 4PL2A 3P7YA 4M56A 4DWSD 1MW1A 1EOKA 1JL8A 1K6AA 3UY8A 4Q4PA 1UR8A 1UCWA 2Z29A 2QEZA 1MZHA 2WHJA 1OFQA 3CMGA 2AQOA 3O05A 4NAFA 3R43A 1J10A 3QGAC 2DT2A 3HGRA 2PDJA 4OECA 3QTGA 1IIHA 1O66A 4AZCB 4JHOA 3HPXA 2ZKMX 3B03A 4CD8A 1LWIA 3LCIA 4A35A 4NP7A 1UZHA 4TUFA 3GDLA 2OQYA 4F4RA 4NYYA 1QOXA 4KCWA 2C0HA 3W81A 3B4UA 1FHVA 1BHGA 2J13A 3H4WA 1W5MA 2QW5A 1XRFA 3M0KA 2NT1A 5D33A 1L6FA 1ZAJA 1MFUA 4M24A 2E5CA 1BPLB 1QXLA 2WSPA 3AU2A 2E6FA 5C9WA 4OGZA 1BKSA 5D2YA 1I8JA 4E3TA 1YEYA 4L5ZA 2YPIA 1TZZA 1MNSA 4ZQPA 4LAOA 4LC6A 1EJ7L 1LOLA 1DJIA 5CG7A 2OR2A 4C1NB 4Z2KA 5M1TA 1E0XA 3S1VA 4RZ5A 3UJFA 3WIJA 4KWVA 1S5TA 3VMOA 5HNTA 3DI1A 1CECA 3AU6A 2VC5A 2CBVA 5F1VA 4TMCA 1XIHA 1W2PA 3AIUA 1HX0A 2E4TA 3DHFA 4JICA 4WXZA 1YE6A 1ZBVA 3BG3A 5C70A 2G96A 1UKTA 2BHZA 4XUGA 5HQLA 1WOAA 4R7WA 1OF8A 1SFSA 2NUYA 3LB0A 4IPNB 3DFOA 3RCMA 3COTA 2GLKA 3AROA 3TTQA 3XISA 5M2FX 3M1ZA 2FYMA 1DIDA 1XW8A 2A3LA 3CC1A 1E1CA 4C90A 2Y7FA 3LNMA 4AG0A 4DHGA 2HVOA 2DP3A 4OKDA 1PDYA 2RKXA 4BI6A 4TV5A 1AJ0A 1TRIA 3DC8A 2ISFA 2W0UA 1WNOA 2XISA 3GDMA 4P8UA 1XX1A 1KFKA 3G8EA 2ZX5A 1XI3A 2YBVA 3WL0A 1H0IA 2JEPA 4XD4A 3S42A 4IQDA 1NU5A 2UZ9A 2BP1A 1H2JA 3W84A 4HHMA 3G1VA 3H4GA 1ME7A 2OTDA 1A5BA 3VOJA 3BCFA 3AIBA 1VBHA 3W7DA 1YDNA 3OEXA 1UPPA 2ACSA 4NAEA 1TB3A 2A3AA 2V3FA 1VD6A 2CLLA 4G7EA 5BMWA 1A4MA 1CGVA 1YXYA 1MVYA 4CVWA 5DLCA 3M64A 3RU8X 1RCXB 1L6YA 4DF0A 3JW7A 1BVNP 5K4ZA 1T96A 1YX1A 1JI1A 3MPGA 2P0IA 1Y0EA 3OO2A 2GDUA 3BAXA 5J5RA 4AD5A 3V3WA 3MO7A 3R10A 4W89A 1SM9A 4G56A 1N82A 3QSRA 4MWAB 1I1WA 2H6RA 3GQYA 1VFTA 2PBOA 2XJ7A 2CFFA 3PC0A 1CB7B 1KFBA 2H3BA 1H7RA 3HJZA 4H01A 1A4LA 3T4WA 5AYYA 3G6LA 3RFAA 1E73M 3KWSA 6TIMA 4GX8A 4MAVA 1EIBA 4JQ2A 3SEPA 4OQVA 1GNXA 2FZDA 4PCPA 3I6TA 2RDWA 1LRNA 2QUVA 1NJJA 3SUSA 1WUFA 2PDWA 2UY3A 1R7OA 4G1KA 4LY8A 5F2LA 1CW2A 1MQQA 2J7GA 3W01A 1W1PA 4KRUA 2G8ZA 4K68A 1R85A 3WH5A 2JK2A 3NO5A 5ECUA 4AWEA 1I2OA 1TCDA 4O0QA 2E6DA 3GSMA 3EWCA 3I6RA 1JFXA 4GPNA 3W9ZA 3AXHA 4MNJA 1EDGA 4MKNA 1KXQA 2YBTA 1OFEA 5AHEA 5EMMA 3WUEA 2R1NA 1N8WA 1E70M 1EZ2A 1GTEA 2J6VA 2NX1A 5DCEA 3VVGA 2IKIA 1JZ8A 4JTQA 3E1F1 3U7BA 1V3MA 3UW6A 3W1LA 4Z08A 3ATZA 2J74A 4O4VA 4IP5A 4PFHA 3UCCA 3PBVA 3PFMA 2GWNA 4GZ7A 3FJ4A 3OJGA 2J8TA 4AZBA 4BK9A 3SGUA 4BWLA 1MW0A 2WJFA 2L5HA 3NZRA 4GKLA 3WQCA 1ELSA 4QEHA 3TP4A 3WD3A 5A69A 2WM0A 5EY5A 1R9XA 1GZJA 1MXDA 2VX7A 4GUGA 4J3WA 3M6DA 2XVNA 2HWGA 4G7EB 4UCFA 3FHQA 2NVCA 2C6QA 3EOSA 5EMKA 4LUTA 2PRLA 1QI2A 3D46A 2HBVA 3HQ1A 4PUDA 1ONEA 1DJXA 1KM3A 3QH2A 1KGXA 5BU6A 3ZVIA 1JZ4A 3AC0A 4E2VA 1AW2A 5I03A 3AHZA 4G6CA 1DQUA 3S9IA 2WM1A 4ZA0A 3INPA 3BMXA 2ZXDA 3EAUA 5K3VA 3BUVA 1NVMA 2QF7A 3P81A 4ZQCA 3FS2A 4KEZA 2F8QA 1KGWA 1EB3A 2XG9A 4HNUA 1UIOA 4JYEA 3TE9A 1K4GA 1ZUAX 2D0GA 1XUZA 3FIGA 3LPGA 3C0LA 2QYGA 1RHCA 2JE8A 3RLGA 1XUUA 5LIWX 5DY2A 3BXWA 4QFUA 1SO4A 3UNTA 2BGNE 4KERA 1MRQA 4ML4A 2DIEA 2I9EA 4D2JA 4WY0A 3N34A 4Y96A 4RUBA 1VFLA 3V4BA 1XLBA 1W5NA 1MW3A 4ASTA 3GFZA 4PUKA 1NSJA 4R85A 4WR3A 4LUTB 2DFAA 5EKYA 3O7UA 3MHFA 2DSVA 5DFAA 1C7TA 3SAZA 4UIOA 4EX4A 1BVWA 2BFGA 2QCNA 1H62A 3WQ4A 1RXOB 5A6LA 4LGXA 1ESWA 3PF3A 3D3FA 1JXJA 1WQ5A 3LPPA 5K9XA 2Q3RA 5GJPA 4DXXA 1FQ0A 4LVBA 3M41A 1TTPA 2BY0A 1HJWA 2NXHA 3ZS4A 2YA0A 2YBUA 5A6MA 1WUEA 4C1KA 4DBUA 4QE4A 3VDBA 4GNVA 3FNDA 3L0KA 3WBXA 1PXGA 4FLRA 5A6BA 1FA2A 1L2QA 4RNFA 3SURA 1GVRA 1UR3M 2OWCA 3QR3A 1YYAA 2YLLA 5J5DA 3MU7A 3N9SA 2NWRA 4RNIA 1H5YA 2UV8G 2BSLA 3UA4A 2OLSA 3WUGA 4MMWA 2CPUA 3W1TA 2OYLA 3W83A 1JFHA 4L65A 1S2VA 3TN3A 3ZOAA 4DELA 4JOMA 4XAGA 2E9BA 1RQEA 4JXCA 4BF5A 4GJJA 5AC4A 2WLYA 4U4MA 4D1IA 4HMCA 2H9AA 1RK5A 3SADA 2VD9A 3QR1A 4GCXA 2VFIA 1JDEA 4H9VA 3SY1A 4S3EA 1S2CA 2Z00A 1D8WA 3SCQA 3A12A 2D23A 3L4UA 5CH9A 1LM1A 1MYRA 3SCTA 1JF6A 4PRRA 1GYMA 3EPOA 3RXZA 4FX7A 4JTJA 3M47A 4MPKA 3M0MA 3NNTA 5DT7A 3GG1A 5D02A 4FF5A 2B7QA 3B0YA 1W9UA 4O10A 3AAMA 4PMXA 3U9IA 1U1UA 1H50A 5HJXA 2Y8UA 2OX1A 4JNYA 2HSAA 1W8GA 2POZA 4LCRA 1F6KA 1YTDA 2HK0A 3GY1A 4E38A 2QS8A 2VFFA 1GZ1A 2BHYA 3BV4A 4AX7A 2R91A 3EA1A 1MDLA 1OGBA 3WO8A 4D6CA 4ZO9A 4F0SA 2OWXA 3A4JA 3RPTA 3CH0A 4PMQA 4OWGA 4V1XA 3ITXA 2YB1A 3SJNA 1PJ9A 4MDPA 4W93A 2G0WA 4QRNA 4BEUA 1UA3A 3A3XA 4IP4A 1DJWA 3CZGA 2WKLA 1BGAA 4Y8FA 4WEVX 1VCFA 4UMBA 4Y7EA 1UUOA 1B57A 3KCLA 1AA1B 1YTEA 1NARA 4K8HA 3HV8A 3F5LA 1E0WA 1JCNA 1Z7AA 5D05A 1V0NA 1BAGA 1YPIA 4PUEA 1HF6A 3ARVA 1DXEA 3H7UA 4MB5A 2V5BA 3EKLA 2BOFX 1Y65A 4LAZA 3B97A 4UTHA 1P0EA 4JIPA 3DN5A 4DUVA 5JIPA 2J7BA 1R3TA 4ZEPA 2Q8XA 3OA5A 2CLHA 2XIJA 4NXSA 1NDYA 5K7JA 2PLKA 4PMNA 3CT7A 3CUIA 3U2OA 4AIOA 1WX0A 1ME9A 4IX2A 4Q6JA 1O95A 4IUGA 4O57A 3MJYA 4AD1A 3T8LA 5DBTA 5A6SA 5AZ0A 4HSOA 3MP3A 3H7VA 4XISA 4JN6A 1BYCA 4PEEA 4CNPA 2OGYA 3BAJA 3C3UA 3WLIA 4AFYA 2ISSA 3T2PA 1EC8A 1QPNA 3L68A 4U5KA 4EPDC 4IPJA 5EMYA 3WJXA 2NVDA 5EB8A 1HTIA 3SCOA 4IGHA 4LAMA 3VOIA 3KOZA 5L9FA 1FWJC 2V2CA 3W1RA 3CZLA 3H2MA 3N04A 4UTTA 2X7VA 2OO6A 3RX4A 4K7YA 2X41A 3C2YA 2B4GA 2Z1XA 3OZPA 4X0NA 3B3DA 2JF6A 3URAA 4WY0B 3HIJA 2J78A 1GJWA 2I5GA 4MY1A 1VFSA 4W86A 3CAWA 1POKA 1IF2A 3DC0A 3GVGA 1QJWA 5HXMA 3Q67A 2BTMA 3AWOA 2Y7GA 1TR9A 4R53A 3UERA 2PTZA 3MQTA 5PTDA 1EGVA 1F07A 4JQ4A 2J7FA 3KHDA 4XB3A 1ONWA 5ABTA 4AZHA 4BI7A 3LENA 1K9TA 2H3DA 3W7KA 4J35A 3ZR6A 3WF1A 3EWWA 3N1AA 5HULA 1H1YA 2R1KA 4IMGA 3DEQA 1FWAC 4CN6A 3OOQA 4F0LA 4MOZA 4OE7A 1BG9A 5GVJA 3C5QA 1E9YB 1I0DA 3LQLA 4N6EA 3CV2A 1XLGA 4XZIA 3W75A 1UQYA 4HCHA 4V28A 1E56A 2WO5A 1EC7A 1ECQA 1RR2A 2YYTA 4O0KA 3U7VA 2EHHA 4KCTA 2P3EA 2QT3A 1VYSX 4LH8A 2ZUSA 3AHYA 1UUMA 4HTYA 2ZDRA 3S4TA 3U57A 3H54A 4RE3A 3P5ZA 4RXFA 1UROA 2X42A 5G5IA 1F3TA 3BLOA 4PMRA 3V1HA 5FJJA 5DMNA 3BSHA 4EF9A 2AQVA 5CCZA 3VINA 1YNYA 4DXVA 3F4DA 4M1RA 4YCPA 1V3IA 1NFPA 3MUY1 4CQ9A 4GINA 1UIPA 1TR1A 3QV7A 3MA8A 4MWAC 1JCTA 3VIGA 3NPUA 3QN3A 3AJ7A 4ADUA 3ZM8A 4UOJA 3LRLA 3PUOA 4Q8NA 2P76A 1JCYA 4AD3A 2FLIA 2HBXA 3UZXA 3NPWA 3MYPA 6REQB 3OQEA 5C9ZA 1VFOA 3KBWA 4QSHA 4HZ7A 2VWTA 1PHQA 4XZLX 1J5TA 2ESCA 2DUZA 3SQLA 1A0EA 4NAEB 3W1PA 3H26A 1BQGA 2W67A 3PTDA 4TQTA 4XO6A 1QNSA 4O18A 1A5AA 1TFVA 1OGGA 2DSUA 1CNVA 9CGTA 3LZ3A 3DBPA 1OWQA 3RILA 3VCCA 1MW2A 4M81A 4IIEA 3WQ8A 1IYXA 2DUAA 1KM4A 3O15A 3GNPA 2FMNA 5C54A 3OLDA 4UXDA 2PURA 4H9MA 1OFRA 1ADDA 2X2GA 1FWEC 2I9UA 3TC6A 4PMOA 3RDKA 3PPHA 4AD0A 4J40A 3WD2A 5A6JA 4IG2B 5FJPA 3AYSA 4PTMA 4ZFCA 3I3DA 2ZVIA 3AIVA 3O6AA 2PLJA 4ZO8A 5I7GA 2ZX7A 4XAZA 2ICSA 1EA0A 4Z1CA 2YCLB 3QSTA 4UZSA 1UH4A 3C6CA 4RDZA 2DH3A 3AOFA 4O1AA 2GQAA 4NJIA 2O4QA 1LWHA 2VRJA 3PK7A 4F0RA 3SFKA 4WOZA 3TWAA 3CUJA 2JKPA 1US2A 3WLSA 4C6MA 2FFIA 3B9NA 2G41A 1X6UA 4K8EA 3TH6A 3BSMA 3EWBX 4XBJA 2R8WA 3VZXA 2E25A 4E2OA 1E72M 1SMAA 2PF8A 4P8WA 2ASHA 5FL0A 3OQ8A 3RAOA 4HN8A 2WQPA 1QATA 1W1IE 3MSDA 2VUYA 1FWIC 1H09A 5C9RA 1EO5A 1UR2A 2X09A 3RK8A 1F5ZA 4PE8A 1O60A 1IR2A 4HJFA 4CCZA 3HJEA 1JZ6A 3H8AA 5C5YA 5G4EA 3EWZA 2ODOA 1DTNA 1DJZA 1X1NA 1B9ZA 2DIJA 2OQHA 4FNSA 2Q3OA 3MZ2A 2VDGA 2NQHA 3W1AA 3GUGA 4REQA 2ZE3A 4UTIA 3SCSA 3NQFA 1PS9A 1ISXA 3P8IA 4GIEA 1Y5XA 2BASA 5D9MA 5FESA 1H7XA 2Y2WA 2FQIA 1U30A 3GKFA 4DJDA 5CZJA 1LLOA 3ITCA 2XM2A 4PMDA 1SMDA 4GUIA 3HN3A 2BHUA 1ZFJA 1Q8AA 1LORA 4BF9A 3BLDA 5HUPA 1O7AA 3BOXA 4Z2LA 2BNJA 2DPEA 4FB7A 1GQJA 3CPGA 3Q37A 1W3JA 3NPVA 3BZJA 4QG8A 4CU7A 5AECA 2HXUA 4EACA 1JUBA 3O8AA 3SIMA 3MSRA 3N2BA 4GO8A 3RCNA 3QF0A 5FEWA 3WEOA 1UWQA 5AC6A 4HNVA 2P5NA 3CBWA 3IIZA 1JDFA 2FTWA 1JXKA 1TPEA 3UWZA 3CWHA 4JFSA 2ZRYA 2R9RA 2OELA 1I2QA 4I5UA 5H8PA 4KQNA 3SRFA 4BWLC 7TIMA 4EE9A 2ZYFA 2B7PA 3PZQA 2ALRA 2G95A 4Z1AA 1Y8BA 1A5LC 2NQ5A 3UXAA 1CT5A 1KO0A 3G24A 1FOBA 1PWMA 3ZSTA 7ODCA 4QITA 1E1FA 2PDPA 3F7JA 1Q6LA 2EAWA 4AB4A 2C71A 3NA8A 1T5AA 1Z9AA 4GY0A 4DI8A 3UR8A 4X63A 2WVUA 3GE7A 4Q8MA 3P60A 4A3RA 4D6DA 3O1NA 1V6TA 2ZC8A 3EBVA 3LMZA 1KBJA 1GQIA 3UA3A 4UMCA 1M53A 4EP8C 2PS2A 2P8BA 4UQBA 2BBFA 4R34A 2GSJA 1FP9A 3ALFA 3W2LA 1L6SA 1UJQA 1G5AA 2I7GA 1F05A 5HBFA 3W7RA 3QKEA 1KW1A 1RUSA 5F4WA 4CCEA 1Z42A 1MMFA 2PSNA 3KP0A 3TJLA 4OIFA 3RJXA 3CWOX 3C0QA 3TCEA 2PDNA 2PE4A 1LLZA 4NZ1A 4JFWA 3CJPA 4KCUA 1G6CA 3ITGA 5HWJA 4CCDA 3BGGA 2ATSA 1VBUA 3MHUA 4LYKA 3UQNA 4MB3A 2F6XA 1R3WA 1QI3A 4EOUA 4C1NA 3DGBA 2Z6IA 1NWRA 2ZE0A 2VGGA 3A22A 2CLEA 1Q45A 1MSSA 1B30A 3NYDA 3B9AA 4AUBA 2CZVA 4JTTA 2UY5A 4MSSA 3UY7A 2V30A 3W70A 5LA0A 3THUA 3TN5A 2FVLA 2AMGA 3GNOA 2Y4SA 3MYOA 1QMLA 4YXGA 1T8XA 2VR2A 1FWHC 2XFWA 3NL5A 3REQB 3RLHA 1EJVC 1R0MA 1SZRA 1HO1A 2E5DA 4JKMA 4IX0A 4TR9A 4D1JA 4WGHA 1OQFA 3TN6A 4TV6A 2X16A 2A3CA 1SR0A 3QXBA 4OFCA 3TFCA 1VIWA 4XK2A 4ZO7A 1OIFA 1GOQA 3IGUA 2V5KA 4D8AA 1U1HA 1O68A 4LQ1A 1O6IA 3N73A 4P5UA 3GXIA 3UGVA 3UXIA 4E3VA 4WZHA 1R3RA 5F2GA 2NLIA 4JS3A 3N6QA 1AMKA 2QNEA 2A0NA 1BTMA 1JNEA 4UOZA 1ODUA 2RGMA 2WWDA 3FVDA 4WK9A 4FX6M 1AH4A 3L65A 4W88A 1FWGC 3MUAA 1R8LA 2IPJA 3FJLA 1PE1A 2G97A 4IH3A 3V5FA 5DX7A 3LERA 2XH2A 5DBUA 3ONBA 3WD4A 4F48A 1XC4A 4C6LA 4DY1A 4Y9PA 1DWHM 4GVHA 4XBSA 1CXIA 2XH0A 1XRTA 1ZS2A 2RH9A 1O5XA 3MANA 2X2YA 4PFMA 3FY1A 1FY6A 5DXYA 1W3IA 3LG3A 1GK8A 5GJMA 1IXPA 1BKHA 3HPSA 1IXOA 2V5LA 1OEPA 4B16A 3WUFA 1L8PA 1OBAA 2AOSA 1UZ4A 2BMBA 1V6YA 4GXWA 4RNJA 2FVKA 1SU5A 2VDIA 3BJSA 3CT2A 2V8ZA 4DPQA 1R86A 3TMQA 4DLMA 4N6FA 1ICSA 3EXSA 4XZWA 3DG7A 1IWAA 2IMRA 2GDVA 4AF0A 3HQPA 4K39A 2TYSA 4X9YA 3MP4A 4JX4A 2RAGA 4NKCA 2D22A 2DJXA 3T0CA 1CBGA 3NEVA 3S2NA 1WXJA 3GH5A 4R9OA 1ZAHA 3DBNA 3FXGA 3KX6A 3BGJA 4JFTA 1DVJA 4DM1A 3WQVA 2J7DA 2V5JA 3MW7A 3BLFA 2QVHA 2E7FA 4UNIA 5REQB 4W7WA 4M7TA 2JF7A 3ID7A 2QIIA 1KC7A 3KBMA 1NM9A 4ZMGA 1VHCA 4BI5A 4XVEA 5D30A 4TU1A 1VJZA 3CHVA 2W9MA 3KRUA 3B06A 1Z3NA 1UOZA 3RPDA 3F5JA 3PHAA 2NXIA 5CLTA 1D7FA 3N9KA 5ABGA 1CCWB 2E0PA 3CK5A 5HANA 4DYJA 1FKWA 2OCZA 4CUCA 1EDTA 5KINA 1C9WA 1NP2A 2YXOA 3KS6A 3WMCA 3VPLA 1XCWA 3W25A 4XSMA 2EPOA 3VUSA 1J6PA 1KFWA 3TWBA 4Q7IA 3F4NA 2WVVB 5D32A 3MDWA 4O19A 3WEZA 4A3YA 2V3EA 3MCOA 2D1ZA 2DSWA 4A29A 3WJZA 4UTWA 4MF4A 1VGAA 1NY1A 1OCQA 1ISZA 1WZKA 4G2DA 3ANVA 3G1SA 3FFSA 4J7RA 3VE9A 4R5EA 1ITQA 4I6VA 3R0KA 4UQDA 4IHCA 3N6HA 5CPQA 4NNCA 3WNOA 2GGIA 3B0UX 2SFPA 1B3XA 1BEUA 4KS0A 2HZGA 1XLCA 4QLJA 4QBXA 1B4KA 1FTXA 1G7UA 1J96A 3N2OA 1I4NA 3VNKA 3EDJA 2OU4A 4R7OA 3IAQA 4WKFA 3HMJG 4JGDA 5E6ZA 2R24A 2ONEA 1O94A 4HHLA 1JQXA 2CERA 1Q6FA 4CNTA 1DE6A 4QGCA 3WLKX 4KFOA 4K1WA 4NJJA 4UWMA 4W4QA 2AL2A 1EXPA 3N2TA 1V03A 2E9MA 2XH4A 4BZYA 4DO7A 4DI9A 3ICJA 1UWIA 3AMCA 2PCQA 3CMFA 2EPMX 1DXFA 1K70A 2HE8A 5CC3A 1MWOA 1UD3A 4HKPA 5CZKA 4J3XA 3KDNA 1V0KA 2HCVA 1JZ2A 1X38A 4N9CA 4M1BA 1H61A 2QCEA 3P0WA 1E6NA 3TYEA 3U0HA 2O4MA 3PNZA 4HZ8A 1CWYA 3R8GA 4MNLA 4ZXOA 1GOMA 2F6UA 1E9IA 4DAFA 3RU6A 1W32A 5AVNA 3SB0A 4H41A 2TSYA 3BOFA 3ITLA 3KCJA 4FOUA 2DW6A 2IPFA 3WG6A 3N18A 2VJXA 2FZMA 4HYVA 1FDYA 1HO4A 4AW7A 2NVAA 3AMLA 4DM2A 2R82A 1GHRA 4Q4OA 4DJDC 3ENLA 3WH6A 4YCOA 4QS6A 1N2VA 1UR0A 3M0VA 4N9DA 3A4AA 3T0TA 4JY9A 5T9BG 1Q7ZA 2IXVA 5D8WA 4I7WA 4CU8A 1QASA 4MKVA 4GKTA 2ZRUA 4AEOA 3PNUA 2VZUA 2WSKA 1L9WA 1H7WA 1WXZA 2BGSA 2ZZ2A 3NVTA 3S5ZA 3ZLFA 4IG2A 4RCXA 3ZO9A 4AXKA 3LLDA 4D71A 1SQ7A 3UYCA 3WJSA 3EWDA 3UD6A 3DKLA 4MFDA 3L5MA 1UQZA 4HU0A 3WK1A 2WNQA 5FF4A 2ON3A 1HUVA 1ICPA 4RJEA 3DFTA 1R38A 4UTKA 4Q8WA 2NX3A 4V2XA 1KCZA 4UR7A 4O17A 1JG9A 4E6MA 4GMEA 4PSRA 2Y63A 3UVAA 3QJAA 5G1MA 3EKGA 4YVVA 1RQBA 1LUCB 1GT8A 1LQ0A 4ZXLA 3FYOA 3NTYA 1XSIA 2NZLA 4C6EA 1SJDA 2O7SA 3KXQA 4JAWA 1A3XA 3UG3A 3GR7A 2UY4A 4S3DA 4UTFA 1GOXA 3W85A 2A85A 3R4IA 1Q6EA 5LSMA 4AMCA 1K6WA 2PDIA 6XIMA 3WNPA 2ZA1A 3NSNA 3C2FA 2VX5A 3DFYA 3ME3A 4FF7A 2WNNA 3MJMA 1EQCA 3WLTA 3TV8A 4IJBA 1CXHA 1IEXA 1RP8A 4GI8A 3E74A 4QHRA 1C8VA 4H7ZA 5LIXX 2PGFA 2NV1A 3T1GA 4IJCA 1EPXA 1IXQA 5CKSA 4L64A 1HVQA 3SI9A 3P82A 1PIFA 5I3DA 3UG8A 2WJEA 1ADOA 1XF0A 2QLYA 1UKSA 3K46A 4CEXC 1QHOA 2GOUA 1MDRA 5HJLA 1E5JA 2PB1A 2R1MA 2VX4A 1KM2A 4F2TA 2W63A 1JYNA 1LG2A 4U31A 4D6EA 4F0KA 4HYWA 1WXYA 2JBMA 4Y90A 3THDA 2REQA 4XBKA 3AIEA 2B7OA 4FA3A 3IJ7A 3KL5A 1TJ1A 2QXWA 4A8NA 4JN7A 1QCWA 3C4UA 1ME8A 1JGIA 2HE5A 4LT9A 1BD0A 4NSBA 3NOEA 5LHEA 3ARSA 3WDPP 4HNOA 4WQ6A 4HPHA 1XGEA 3LYEA 2PDLA 1P6CA 1G9HA 4POCA 2WK2A 1WDWA 2BVTA 4H7VA 1QK0A 5H8UA 1HFBA 2BODX 3TUUA 3HBLA 2VFGA 1JYXA 4JN8A 4Q7BA 2DEPA 4PUUA 5C7VA 2QZRA 1A3HA 1OIMA 3PWAA 2CWNA 4QQUA 5GNYA 5DCDA 3BMWA 5CSYA 4JQ1A 3UBPC 1SGJA 2ZRXA 1XYAA 4DO6A 3EA3A 3LUTA 1ZNNA 1B3WA 3AZSA 3OVGA 4FZIA 1DV7A 3M9YA 3BH4A 1MEIA 4BQ5A 3T07A 3WQWA 2ZC1A 1RAKA 2YA1A 4LALA 3ORWA 4CNUA 1G4TA 3H24A 3N11A 4YMZA 5FL1A 2VZVA 4XZNX 3PS7A 1W17A 3KLLA 1I6NA 1TA3B 1M68A 1RPKA 4H2CA 4LCSA 1BQCA 1JCXA 1HNYA 2ACUA 2VI0A 4DWDA 1R2SA 3MI2A 3LI1A 4QNEA 3LSCA 4HZMA 1Q7MA 3EOOA 2A6LA 4J27A 5DXXA 4PB3A 3WENA 1QI4A 3UZWA 3EMQA 4ZOCA 4Q8UA 1EHNA 1UKOA 3STFA 3AIQA 2X1SA 4EVZA 1VR6A 3PBWA 2DV0A 1XISA 3EA2A 2NQJA 4PBFA 3IIPA 4GY1A 4R9XA 3TLLA 1FFRA 3S5NA 4PGLA 1R2TA 3MY9A 3OYXA 1W8SA 4I5RA 5BWAA 1V79A 1S3TC 1BSLA 3ARQA 1QPKA 3E2QA 3WDJA 4GVGA 1EP1A 3WEMA 5DMMA 6ALDA 5HNRA 1XIFA 2OOGA 4C6OA 4FIQA 4JTHA 5HWMA 4Q4SA 2CHOA 3SO7A 3B4YA 2OB3A 3QV8A 2J24A 1HP4A 4XVDA 3TXZA 1KFCA 1ZBKA 5FCZA 3KZPA 3PJWA 3CHCA 1W9VA 2IUZA 3LHTA 3FEMA 3O63A 2VGIA 3LCGA 1CPUA 1PVNA 4DJEC 1T8QA 3ZR5A 3WL1A 2X1RA 3TDFA 5A8QA 2QJHA 4H6RA 1TPWA 3V0TA 3PZTA 3T42A 3NXLA 2C3ZA 3NURA 1SSDA 1W9DM 3WK3A 4E2DA 5I06A 3PR2A 1A0CA 1P7TB 4DZHA 1NOWA 5FSEC 2NUWA 3TYAA 3WQDA 3II1A 3NVDA 3I65A 1HL9A 3P67A 1XKYA 2H8ZA 5EPDA 1L6WA 3VOHA 4KKXA 3M0JA 4PCFA 3RX2A 3ZWTA 2XIMA 4MUZA 1SO6A 3E49A 3L5LA 1FWNA 2ABBA 5AY7A 1RALA 3WNKA 3KZSA 4ICCX 1EJRC 2OYMA 3H23A 1KR0A 3WNLA 4NRSA 3TYZA 4M0XA 1W1B1 3GNRA 4CQCA 3VX1A 1BWVA 3MP5A 3QMSA 2VM8A 4PL1A 1UR1A 2V69A 1WDQA 3S1XA 1HGWA 4O50A 3K1GA 1GPFA 2W4XA 2OZ0A 1Y7VA 1J6OA 2W5FA 5LHFA 1B5TA 2PD9A 4DXKA 2ABAA 3GZAA 2OWWA 5DELA 3RO8A 4GACA 2OX4A 4HNLA 2XWEA 3W88A 3VZYA 3LTPA 3ITYA 3WLOA 3VGFA 3M43A 4FPSA 4FOJA 1I0BA 2DVUA 1LOQA 1MXGA 1YW1A 4XQ6A 1RA5A 2F7FA 2GL5A 2GJNA 2YL9A 2ZOXA 3GTIA 3GNDA 3WQFA 1IIGA 1ZRQA 3OZOA 3L12A 2QV5A 5HK4A 3UZ5A 2GGEA 2PGEA 1EBHA 3N6JA 5EMJA 4K1GA 5IBXA 4IQJA 1KCXA 2CIPA 3H2CA 3MCMA 4RDWA 4LRSA 1VC4A 4Q8QA 5HR7A 1AJ2A 3IJDA 2CKRA 1DIEA 4O1BA 3ZYZA 1PZ1A 1UWTA 3GH7A 3BURA 1KKOA 1BGGA 3TX9A 3R7MA 4GK8A 1W91A 1Z48A 2JGQA 3HGOA 3MMTA 1VIZA 4PR4A 1O4UA 4XIMA 3M0IA 2CEQA 4CU6A 4X2RA 3NEHA 1IZCA 1UA7A 4NG3A 1M3UA 1G0CA 2Z1WA 2PFHA 2GUYA 2OO0A 2QAFA 4ZB2A 1W37A 3VKKA 3SGZA 1TPVA 3C8NA 4HNTA 2OQLA 2A7RA 3R6IA 1XXXA 2GQ9A 4CN1A 3VK5A 3L2IA 3PG8A 1OFDA 4Q8PA 3W87A 4NJGA 4EK7A 3NQDA 4WLCA 3NGFA 2E09A 4TX9A 2QGHA 1QOQA 2WZEA 1FXQA 2QUNA 3WLHA 3V16A 3NO3A 4JTIA 3W07A 3VC5A 1ZL1A 3N25A 4RNHA 7TAAA 2Q71A 3IGXA 4N9EA 5REQA 3DGRA 3H55A 4NZJA 3AMGA 2GOKA 3H2AA 3A6OA 2ZIDA 4DF1A 3QFEA 1GOWA 1FX6A 5FJOA 2C13A 2CHRA 1F7BA 3TJXA 1GVIA 5IHRA 1Z69A 5MHBA 4LWWA 2A3BA 3CV6A 2C8NA 5HAOA 3PJUA 5DQPA 3IJ8A 3HV9A 1QTWA 3FHAA 1AW5A 1EC9A 2FHCA 1LDCA 4LS0A 3WMBA 1ECEA 4K6AA 2EPLX 4R33A 1OX5A 4OBSA 4OJYA 3OODA 1VHNA 3EWXA 4LU0A 5CPOA 1UMYA 3F2CA 1TTQA 2WMKA 3DFQA 2BB0A 1EEPA 1IEWA 4KGLA 1P1MA 1W3HA 3AHXA 4Y6GA 4L4LA 1BXBA 3KM8A 2PDGA 2XVLA 2QJIA 1ZQ5A 5I02A 3UFYA 3VMNA 3GXTA 5JQ9A 5I2UA 3DYOA 4MB4A 4HOWA 2NXGA 8A3HA 4PTVA 3OHMB 1XIEA 4O8RA 2VD8A 5CPTA 3DENA 1EGMA 2VFDA 4LOCA 1Q4WA 1GPWA 3UYIA 1A5SA 1GVFA 3CQ0A 5LNVA 1EYEA 2ZZ5A 3UJ2A 3FAWA 3CTLA 3L4ZA 2ALDA 1KA9F 2AL1A 4IMEA 2PWUA 4AWSA 4UR8A 5JMUA 2FH8A 2ZBTA 4AZCA 3JU2A 3C2EA 3LQGA 2MNRA 2H8XA 3DHPA 2FDMA 3UCQA 4ZB0A 2EJ1A 4PRTA 1E0TA 1AZ2A 4D6IA 3MKVA 2ZUTA 4L9XA 1SUXA 3WDQA 5BXPA 1EJXC 4N4QA 4UTTC 3OG2A 1QK2A 3LCXA 4K2SA 3TQVA 3UGRA 3LRKA 2E8YA 3LZ5A 5FACA 1XYMA 4B5VA 4ZBCA 4J2PA 4MJMA 3VO0A 1KXHA 1OCBA 3LGDA 1IZJA 3B05A 3ANYA 4CD4A 3BSGA 3TW9A 4XWUA 2NSXA 2WZMA 3AZTA 5H6HA 1JYWA 2OYKA 2ACQA 5I24A 3G1AA 3T40A 5EBAA 1NDVA 1KV5A 1TRDA 1V02E 3WLJA 2O7QA 1S38A 5IFTA 3CZJA 2C18A 3MCNA 1HN1A 1QR7A 2J77A 3O16A 4QJ5B 1T7LA 3RM4A 1KB3A 2XSXA 1Q6CA 4AHPA 4U10A 2EPNA 5GNXA 4QAIA 1OJXA 1EH9A 3GIYA 4M19A 3C0SA 1EXBA 3LCLA 1EF2A 2ZICA 2WHKA 1A53A 3B8SA 2DU2A 3AISA 2VCAA 2DIKA 4C6NA 3PZUA 4C6CA 3NG3A 3QQ0A 4ERAA 2Z1SA 1S39A 1M6JA 4M51A 4KETA 3W6YA 1KM6A 4MZ8A 1QRQA 1YDYA 2XM1A 4ERIA 2C0AA 4JCMA 4GZJA 2Q8LA 1JDCA 4YHEA 4DPPA 1F8MA 5HOSA 3OBKA 3RMEA 3O6DA 1O1ZA 1JAEA 4AYGA 4NJKA 3PZIA 2ZTKA 2YCIX 4GC4A 1KNWA 5M03A 1XPGA 3N14A 3STCA 4NVTA 3WNMA 4X61A 1D3CA 1EEXA 1EYWA 4V33A 3MMUA 3S2MA 1SVDA 1RY8A 4Y9NA 3JZUA 4ZL1A 4IFOA 2PWVA 2DJLA 3DHUA 1OK4A 4J5NA 5ABHA 5CEWA 1J9YA 2KAUC 2INZA 3HM7A 4BHYA 4JTUA 3F4VA 2WMIB 3RM8A 4AD4A 3LNPA 4MFEA 1MI3A 5CJMA 5CGTA 4TIMA 5LZLA 4H83A 3P74A 3W7GA 4J1OA 4L61A 2FMOA 2OKOA 3PN8A 1DE5A 3A5VA 1ZAIA 1ITCA 3LSBA 3KHJA 2VRQA 3IUHA 4BFAA 3QV9A 1W5OA 2HPIA 3D0CA 2CBUA 3AQUA 1BVZA 4WGXA 3GU9A 4XO7A 2ZUVA 3I6EA 4RV8A 3TW6A 4RDVA 4IF2A 1Y5WA 2ZRVA 3UR5A 3LPFA 3UT0A 2C19A 3ABSA 3E2VA 4H1ZA 1KM0A 4WKHA 5MKGB 4HHHA 3W7QA 3H7RA 1FXPA 1UWSA 2E5BA 3LBOA 5JBDA 1LBMA 3RPMA 2FJKA 1PX4A 3N13A 3R11A 3E0WA 1GUVA 1LBLA 1E9LA 2QV4A 3BQ5A 2WV8A 3OVQA 3W1UA 1XC6A 1TV2A 1JNDA 3VGHA 1PTAA 4ZB5A 4R7JA 5F4XA 4IOTA 3NQCA 4XZ9A 5MF5A 4IMFA 4UUIA 3SN4A 3S5SA 2PC4A 4JR5A 4L56A 5AHFA 3LGGA 1TV8A 4LRTA 4QG9A 5LGZA 1ZY9A 3EXRA 1ISYA 3WSUA 1TV4A 1TJPA 4P8VA 4OU1A 2IQTA 4S1FA 2DW7A 4AHQA 3GWQA 5HMDA 1TJ0A 1G94A 4LUYA 4NAFB 2GVGA 1YE4A 3MBFA 4MPQA 3TTSA 4KWOA 2VR4A 3QEZA 4XZHA 5A8GA 1BFNA 2PWHA 4FS9A 1HIZA 1JIBA 1YBQA 3IAPA 3H6OA 3BG5A 4GUFA 5CJNA 4AXNA 1VKFA 1CGTA 4C7GA 4I9MA 1EWDA 2P53A 1FH8A 4KMQA 3S46A 2DT1A 3WF3A 3P93A 2JQXA 2BXYA 4A3QA 1VJIA 2TMDA 3HQOA 3BWWA 3HB9A 4FEZA 4NHVA 1AD4A 2DZVA 1M1BA 1K9EA 3A24A 4NZFA 3SM0A 3CASA 1FWBC 1C9DA 2POTA 3F5KA 2P8CA 1J8VA 3P6LA 5CJ5A 2WMFA 2I5QA 4I7UA 1J2BA 5E9AA 4AU0A 7A3HA 3AZRA 3E0LA 1P0DA 4XAYA 2XHYA 2MUCA 1Q8JA 3CM4A 3IVSA 1TTJA 2DVXA 3AXIA 1RP9A 3TSDA 1KTBA 1VPYA 1QHPA 4I8YA 4MDOA 4AY8A 2A21A 1XDLA 3W7PA 4L4PA 4WRHA 3WLPA 2BDQA 2H9AB 1XLEA 1PEZA 4JY8A 3BAIA 5M3WA 3OVPA 1O5RA 3I4KA 5I77A 2DT3A 4U33A 3FJNA 1SFJA 3GC5A 4WXYA 4GXMA 4QDWA 4US6A 4F2BA 3BTNA 4WDTA 2VOTA 1QBBA 4W9TA 3HURA 3NDYA 1K02A 3TYUA 3KFTA 4MLJA 1ZBCA 4J4KA 4M6VA 1GJUA 2JEQA 2R1PA 1RH9A 1M01A 3W23A 1OX4A 5CQ1A 1K3UA 2P1FA 3LV5A 1U83A 4TX6A 4JEQA 1E1CB 1TELA 1V6XA 1PSCA 3VD5A 5I3KA 2D2JA 1NWTA 1DL3A 4F66A 3KUMA 3JUGA 3WDHA 1HG3A 1K77A 1R30A 1XHGA 2WBKA 2PDXA 3F1QA 5D2WA 1LRQA 4QSFA 1PKYA 4FNQA 3BMVA 3ZT6A 2PGWA 3EB2A 4KESA 2W27A 3VZZA 4LJ3A 1F6PA 1W1TA 1M7XA 2CKSA 4DZAA 4NU7A 5ECVA 3WFLA 2G3NA 2ZUWA 2MANA 1BF2A 1ML1A 2OSYA 1U5HA 1MEWA 4WJ8A 5CSUA 2DZAA 4H00A 1X6NA 3NJ3A 1HQTA 2WC3A 2J9YA 2DQXA 4NASA 5LXXA 1BRLA 2BXZA 2J66A 3EMCA 4IQLA 3MSGA 5FKYA 2RJHA 3DAQA 1B4EA 1H4PA 3LMYA 4H9XA 3KVLA 4FALA 1OSEA 4AC1X 1XLDA 2NSOA 1XRVA 1OADA 1RCOB 1QNOA 1XIIA 4Q32A 1IEVA 4GXPA 4MUPA 5M5DA 3T9PA 4QCEA 1GQKA 2BOEX 3DCPA 3NZGA 2QHAA 3H2NA 3VX0A 1EJUC 2QDHA 4FR1A 1MRAA 4FXRA 1K7FA 5FEPA 4GFSA 3CNYA 4WDWA 2OGJA 1ZALA 4JX5A 3GNXA 4WSKA 1MEHA 3RYSA 5A2AA 1XLKA 3R94A 3W7CA 4G5DA 3QYSA 3TTOA 3LS9A 3F4CA 2O9RA 1S1PA 1GZGA 3LBMA 4W7VA 3S5YA 4FO4A 3NQGA 1TUXA 3TQKA 1FWWA 3EWUA 4IZGA 3M0LA 2XFYA 4GZEA 4IQEA 4RLIA 2Z0IA 2YL8A 3QFWA 4JL1A 3WX7A 2J4GA 4KGJA 3O0FA 4ATDA 2DQWA 4O15A 3VKDA 3N2CA 1XCFA 3DG3A 4AAJA 1N55A 2P50A 2UWFA 1VFMA 3W74A 1KWKA 2R14A 4GOAA 5CZTA 2WHLA 3W28A 2QCMA 4S3JA 2ACRA 4NIRA 3LTYA 2W92A 3E6EA 3WKZA 3GTFA 4H9YA 5C9XA 4OZOA 5EMUA 4XUYA 4O16A 2HV5A 4TO8A 4JTDA 4DJFD 2VP8A 2X40A 4DAIA 3V35A 1RBAA 2YLAA 4JYDA 3MO4A 3DFPA 3G2GA 1NAL1 3VM7A 4IIDA 4XD3A 1X7IA 3TOYA 1EJTC 3NDOA 5CGMA 2RDXA 5JU6A 2V38A 5B80A 4DO4A 3VOCA 3RO6A 4KFPA 2OLHA 3SSZA 3ARUA 1FWCC 4KH2A 5I09A 2OKTA 3BL3A 2J7HA 3IEBA 2CCRA 5E0FA 3NQ8A 2VEPA 4MWAA 3GXFA 1RCQA 1QNQA 1W6TA 5T8GA 3G22A 3UR7A 2VEKA 3ES7A 4FNUA 1GJPA 3VTRA 3GYCA 2CESA 1XH0A 3W71A 2DZSA 1UR4A 2B0MA 5FF0A 4HYRA 1E51A 5EA9A 3VGGA 2W3ZA 3VXGA 5AKQA 3FK4A 1X7FA 2UY2A 4PUJA 1QHZA 1SZEA 2VQTA 3TROA 5HNUA 5FOOA 4P61A 5EU9A 1SFLA 2WKJA 4IMDA 1W31A 2JIEA 3KE0A 3KTXA 3MT1A 3DERA 1XYCA 4U28A 1V51A 3CQHA 3UF9A 5H1WA 3VKBA 5AHNA 4FNRA 3DHDA 3WFAA 4IIBA 3GU1A 4AZIA 1WO2A 2VOMA 4O54A 4A6GA 1I1XA 5BRBA 5CPMA 4LBUA 1HKWA 3RITA 1V4YA 5FD0A 1US3A 3TA6A 2VVNA 1Z89A 5I00A 4YWIA 1CXKA 1UASA 2JALA 1U2YA 3DU0A 2PC8A 4QTGA 3LA4A 4GVFA 2PA6A 3NZPA 2CLFA 4GO9A 2B7NA 4FXJA 4JNMA 3HQNA 4MWAE 3V7PA 1V6UA 3L0GA 2V2HA 1X96A 5BW6A 1CGUA 3EDEA 5BXTA 1T0OA 3RJYA 1Q13A 3UCDA 4EXAA 5AHIA 3FSTA 4GYPA 3S3GA 3PULA 3I4EA