1QRQA

Structure of a voltage-dependent k+ channel beta subunit
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a voltage-dependent K+ channel beta subunit.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
molecule keywords PROTEIN (KV BETA2 PROTEIN)
total genus 117
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qrqA00
2QXWA 3LZ3A 4LBRA 3B3DA 2AGTA 3DOPA 1ZSXA 1EF3A 1MI3A 4XK2A 1X96A 1Z8AA 3T42A 4YS1A 3CAQA 2F38A 4PRTA 2PDPA 2FZDA 3O0KA 2HVOA 5AZ0A 4FAMA 1QRQA 1AH0A 3UGRA 4XZLX 1S2AA 1AH4A 3V0TA 4FA3A 4ICCX 2J8TA 1OG6A 1J96A 1Z9AA 4DBSA 5HNTA 4IGSA 4JIRA 1RALA 4WDUA 1IEIA 2ACSA 4H8NA 3U2CA 4PUWA 2IS7A 3H4GA 2INZA 2FZ9A 1EL3A 2FVLA 4MHBA 4LAZA 4XVEA 1T41A 2R9RA 3VXGA 1T40A 2R24A 4JTCA 2PDWA 4XO6A 3LD5A 1XGDA 4I5XA 1Z89A 3GHUA 3GUGA 2C91A 4XAPA 1PZ1A 5KETA 2IPFA 4LAUA 3P2VA 3RX4A 1M9HA 1SM9A 1Q5MA 5LIXX 3UWEA 4WDWA 2PDNA 4YU1A 1YNQA 3GHRA 3UFYA 4YVXA 1XF0A 4GIEA 3D3FA 5LIWX 2PDIA 3LN3A 2CLPA 4HBKA 1XJBA 4JTRA 1Q13A 4NKCA 4JIHA 4G5DA 4F40A 3WBYA 2PD9A 2PF8A 4PR4A 2P5NA 4JTDA 1K8CA 1AZ2A 1LQAA 3CMFA 2IPJA 3ERPA 3G5EA 1YNPA 3O3RA 4DBWA 2PDKA 1JEZA 4JQ3A 3M0IA 3FX4A 2BGSA 2IQDA 3R43A 1S1RA 2PDUA 1HW6A 3R7MA 1US0A 3UYIA 3LQLA 3WCZA 3QKZA 2BGQA 2PDGA 3LEPA 4IJCA 3BCJA 2PZNA 4L1WA 4WDTA 3WBXA 3UZWA 4L1XA 2ISFA 2A79A 4GQGA 4GCAA 3UP8A 4XZIA 3R8GA 3N6QA 4DBUA 2WZMA 3MC5A 4FZIA 1Z3NA 1PYFA 1ADSA 4XZNX 2ALRA 1YE6A 4ZFCA 2BP1A 3CAVA 2PDXA 3ONCA 4LB3A 4OTKA 4PMJA 3R6IA 3Q65A 4YVVA 4R9OA 1AZ1A 3EB3A 4LBSA 2PEVA 2PD5A 4QBXA 4JIIX 2FGBA 3BUVA 3GHSA 3V0SA 4JQ1A 4GA8A 4XVDA 2PDJA 4QX4A 2HE8A 1ZUAX 1X97A 3N2TA 4Q3MA 2WZTA 3R94A 2IKHA 3LQGA 2I16A 4PUUA 3V0UA 2IKJA 3MB9A 1C9WA 3CASA 5HA7A 1UR3M 3LUTA 2HVNA 4GQ0A 4WEVX 4HMNA 3FJNA 2NVCA 4Q7BA 3COTA 5M2FX 3M4HA 2IKIA 3CV6A 3WG6A 4LB4A 4H7CA 3R58A 2HE5A 3LZ5A 3V35A 2PDBA 4JTAA 2PDLA 5HNUA 4FALA 2NVDA 1PWMA 3F7JA 5C7HA 5DANA 1VP5A 3RX3A 3R8HA 5LIUX 2PDMA 2DUZA 3BURA 3G1RA 3LNMA 3Q67A 1LWIA 1PZ0A 3KRBA 1S1PA 4YVPA 2IPWA 1X98A 3UZXA 4WGHA 1IHIA 3V36A 1EXBA 1PWLA 2PDFA 3GHTA 4XZMX 3BV7A 4WRHA 2IPGA 3UZYA 2PDCA 5LIKX 2IKGA 1MZRA 4XZHA 3ONBA 1YE4A 2ACQA 1QWKA 3DN5A 4JQAA 1AH3A 2ACRA 2F2KA 3C3UA 5JH1A 3H7RA 3M64A 5LIYX 2I17A 1ZGDA 4JQ4A 1RY8A 4PRRA 4WDXA 2HEJA 4AUBA 3EB4A 4GACA 2ACUA 2IQ0A 3LENA 3NTYA 1HQTA 3CV7A 2PFHA 1GVEA 2HV5A 3UZZA 4ASTA 4EXBA 2FZ8A 2HDJA 2INEA 4QXIA 3H7UA 2FZBA 1ZQ5A 3UG8A 2DUXA 3EAUA 3S3GA 1A80A 4GABA 4JTQA 4JQ2A 1R38A 2VDGA 1VBJA 1MRQA 4QR6A 4RPQA 2PDYA 1S2CA 5AZ1A 3RX2A 1RY0A 4XO7A 4DZ5A 3WBWA 2PDQA 4IJRA 3LBOA 1FRBA 5JH2A 4EXAA 1AFSA 2PDHA 1EKOA 2DV0A
chains in the Genus database with same CATH superfamily
5AHFA 3CLWA 5I24A 1H2JA 3VKCA 1BSLA 1CLKA 1VFHA 3EMZA 4HYWA 4YJ5A 2NQJA 3VFCA 4LUTB 3MO7A 3MSGA 3W74A 3UG5A 3H2FA 4ROPA 1K1DA 5EFFA 3MJMA 2FQIA 1E5NA 2ZX6A 1VGAA 3N2MA 3MHFA 3ZIZA 3TSMA 2HVOA 1QRQA 1AH0A 1E73M 3NCOA 2KZHA 3N11A 3MP4A 5A8OA 4HOXA 1D8WA 5HQLA 1NWUA 3WJWA 4GVIA 4PCNA 1ZS2A 1ONRA 2OEMA 1H11A 3LHYA 3FA5A 6ENLA 3E0LA 1XYZA 4BKNA 2WMFA 2UWFA 3QKEA 3CBWA 4WDUA 5E5CA 1FFQA 4NYUA 3NOYA 2B7OA 1V3KA 3BZJA 5I79A 3PK7A 4O12A 1U30A 4XWUA 3TONA 3DECA 5AKQA 1LOSA 3SRDA 1TZ9A 1W1IE 3ZVIA 3OB8A 5HWNA 4UFKA 2HS8A 4OT7A 4KIRA 1T40A 2PU1A 1E51A 2CLKA 4Q4MA 4I5XA 1YXYA 2HVMA 1FDJA 5DX7A 4H9XA 5JU6A 1YQ2A 4F2TA 3BW2A 1M7OA 3LSBA 3FEQA 4AU0A 3SQMA 5C2GA 4FEZA 4KIEA 3CPRA 4V15A 3QM3A 2V0TA 1JCNA 4Q4RA 4AD5A 4IFKA 1SR0A 4L1GA 2BOFX 5DT5A 3W2UA 4UR9A 2QJJA 4S3DA 1L2QA 4IPIA 3G6MA 1K7XA 5BYWA 4ILSA 4LVDA 2VFFA 3CQKA 2G95A 2J88A 1W3HA 4RE4A 4GINA 3VD5A 1OX5A 1KFEA 5EGRA 4JIHA 1HO4A 3MI3A 1E5JA 2WWCA 3UVAA 4GC4A 4PR4A 2P5NA 1EA0A 4JTDA 1AZ2A 2VWSA 2HWGA 4IFKB 5C9UA 3F2CA 4U3CA 1ZBVA 4HNLA 3S5ZA 1W1VA 4L4PA 1JEZA 4HPNA 3BAWA 3LHWA 1RXOB 2UY2A 1YRRA 3QFWA 1XV8A 3VOJA 4MMWA 3FX4A 1TPWA 1XC4A 4S38A 3WUEA 2YSWA 1LWJA 1HW6A 3CTLA 4J40A 1B54A 2E5CA 4UNLA 2Z6JA 3WFAA 5BOOA 2WHKA 2VP8A 3NQVA 2VGIA 3CK5A 3W01A 1VHNA 3O15A 4R3UA 2B0MA 1ZAHA 3WF3A 4F2UA 3W72A 4OE7A 2DIKA 1Q6FA 3S2NA 1O5XA 1MDRA 2C0HA 1X7FA 3I6EA 4DJFD 1EP2A 1BHGA 1ENUA 1PPIA 1WBJA 4JTGA 3I65A 4LV9A 4MLRA 3ZZ1A 1KWGA 2IXVA 5D33A 3QHOA 4KWUA 5CAKA 4CQCA 3UD6A 3SN4A 3PZNA 5BMWA 1DBTA 2XWEA 1TV4A 2D2JA 3STEA 1PIFA 4JDYA 5I78A 3G22A 1XQKA 1WZAA 2XINA 3W1XA 1SJCA 3MW7A 1EC7A 1S38A 2XM1A 1JYNA 3W2KA 1FXQA 2E4TA 1HVQA 3TR9A 1RJPA 4NZCA 5M1TA 4JIIX 3WJZA 1ZY9A 4E4PA 3E9AA 4ORIA 4DI9A 4Q8MA 4XAGA 4P61A 1RK5A 3NAVA 3RITA 3F1QA 3GIYA 2WVVA 1XG4A 1BG4A 2BHZA 4KT2A 3ZVHA 2YYUA 1KB3A 4GVGA 1G7VA 3M7WA 2X7WA 4I8DA 4MKNA 1TSIA 4AHPA 1FQ0A 4AYGA 3OGSA 1H61A 1C7SA 1KNWA 3KOZA 3G1YA 2QCCA 4E2BA 1JAEA 3MVIA 4PMNA 4WLCA 3R58A 3SCRA 3ARUA 1F6PA 1WDQA 5DBUA 4M82A 4DUXA 1GQKA 4DI8A 3NO5A 4GYKA 1FOBA 1H7PA 3S47A 5CZJA 5D4YA 4UQ9A 4WIWA 5HR7A 2YPIA 5T9CE 1B2YA 2X1UA 4Z1DA 4Y9MA 1GHRA 4H04A 3N2CA 4FNUA 4YTSA 1FX6A 4S3BA 2DT2A 1UR9A 1UD8A 1DKWA 4MF4A 1WKFA 3K1DA 1GG1A 1RSCA 5GNXA 3UR8A 2PWVA 4S23A 4HJWA 4PN2A 1UQYA 3UG4A 2QDHA 1DJWA 3WQOA 2A3BA 1NAL1 1PDYA 1XGEA 4K1GA 1SZNA 4G6CA 3TU9A 1JXKA 4IPPA 2YDSA 1VHCA 4WDXA 1VJIA 1A5NC 5K4XA 3R12A 1WB0A 2WVTA 4FR6A 1OABA 1PKYA 1WXZA 4U31A 3T78A 1Y65A 2DZXA 5HANA 4ASTA 3L23A 1H1NA 3DI1A 1DJGA 3FHQA 1DTUA 5D9NA 1UD5A 3E02A 2A6LA 3QHNA 3BAJA 3MVTA 2OWCA 2OZ8A 1EF2A 3PFMA 1TUFA 4S39A 4PSRA 4RPQA 3B0UX 1WPCA 2C3ZA 3AIRA 5AZ1A 4CU7A 4MWAB 3N2OA 1UZDA 1OX4A 4RNFA 5JH2A 1AFSA 3W7PA 1DIOA 5LA2A 3WD1A 2OZTA 3L2IA 2DSKA 4LBRA 3URBA 3F2BA 3FSTA 3BCFA 3IJ7A 1R3QA 2BTMA 2NXGA 1XRSA 3PZVA 1BF6A 4UR8A 4U5IA 3NIYA 4S3GA 4UOQA 2VFIA 4PH6A 4JDBA 3A12A 3W9ZA 4AZ6A 2ABAA 3MZ2A 2LLEA 2PI6A 4MM1A 5CZ0A 1ZALA 1S2AA 4MWAA 4TX8A 3I6RA 2OPJA 1KFBA 1XH2A 2D24A 4XUGA 1KC7A 2POTA 4FA3A 4NJHA 4ICCX 3UWQA 1OIMA 2GLKA 1KFJA 2PAJA 4TTUA 2RH9A 5G2HA 1OFQA 1GKQA 1PIGA 3QLLA 4QDWA 3JZUA 3R2GA 4MZ1A 1GYNA 3KL5A 3DFPA 4H2CA 2KX9A 2JGYA 5BRQA 4NRSA 1DOSA 3UXKA 2FVLA 3PWGA 4RL3A 3ZWTA 1QPKA 5LHEA 2I5GA 3BG9A 5D32A 1KM6A 1EB3A 2G0WA 3W1AA 4B5UA 1VH7A 1MEHA 5BXTA 5FJTA 2WVUA 1Z89A 3GHUA 3ELFA 2ZE0A 2OG9A 2C15A 4HPHA 4RV8A 2Q3RA 1R85A 3W1UA 2OMAA 3G8EA 3EOOA 5H6HA 4QAWA 2OYMA 1X1OA 2OT1A 5A5WA 3WMLA 3MWAA 3HV8A 3HB9A 1XHGA 3EPNA 3WLRA 3CZJA 2GJRA 1J12A 4YMZA 3AHZA 1QI2A 5CPSA 2QJHA 2FDMA 2H3DA 3E5PA 5BCAA 2PDIA 3HG5A 3VNKA 3HJZA 4HK5A 2NQ5A 5CPQA 4CGTA 4PB4A 3NQMA 5T9BG 2YR1A 2PD9A 4E38A 4IX2A 1SR9A 4MJZA 3QV8A 7CGTA 3PBVA 1JZ7A 4UZSA 4UTTC 1P0DA 4YYFA 2E9LA 2ZZ6A 5IBXA 2QGYA 5F4WA 3IVUA 3M41A 1VQTA 3WF1A 4AEEA 1JFHA 4JR5A 4UQCA 3B9EA 1BFNA 3VOGA 1MQRA 3L66A 2VXNA 3CC1A 3UBPC 5IOBA 1WDPA 2BASA 3G1VA 5E1QA 2HNHA 2PRMA 4G8TA 1EYEA 3IIOA 3K4DA 1LORA 1AL7A 1YYAA 2WANA 2YCLB 5BXSA 1KRMA 1K7FA 4UTTA 7XIMA 4EXQA 3W0KA 4LUSA 3W4RA 3TYEA 3FIGA 2BSLA 1Q65A 3WNLA 1YE6A 3CZKA 3CPUA 2PS2A 1GW9A 3IGUA 2V67A 3DAQA 2QR6A 3TVAA 3CUJA 1L0PA 4LB3A 4QLJA 2EG6A 4TXEA 2TYSA 3BDKA 5JVLA 2D0HA 2VEGA 1EJRC 3F4VA 1K9DA 1MO0A 4EPKA 1DORA 4MSSA 4POCA 2WKJA 1FXPA 3M47A 4FLOA 3PFRA 4QE5A 4CCCA 4KBXA 1CENA 1SFTA 5JQ9A 1O60A 1U1UA 4Q3MA 3A22A 5FD0A 1H5VA 2ZC1A 1Q6LA 3DGBA 1IXPA 5CBJA 2RJHA 3EXSA 2ISDA 4MKSA 5MKGA 4NJIA 5BXRA 2IKJA 3TZFA 3E2RA 3U7VA 3CASA 1WXJA 1P43A 3S1XA 2HVNA 3AHXA 1I8JA 1TPB1 3HQNA 4LRSA 3ANUA 3MUAA 2PP0A 5CPLA 2AGKA 4IMGA 1E0TA 3SW6A 5BWAA 3VKDA 4H7ZA 2QIWA 3CLMA 3RCNA 1KRCC 1E56A 3AWOA 4WR3A 4JIQA 2G3IA 2P88A 2QJIA 3V35A 4XG1A 5K9XA 4OVXA 2V5KA 3EA1A 4AC7C 3DFNA 4CU8A 2VI0A 3NZPA 3ZSSA 1B3WA 1MW0A 1WP6A 1IT8A 4K1WA 3MJYA 1MRAA 3ZJKA 4Z2IA 1AVAA 5D38A 2P3EA 1U2YA 4D6EA 3TDFA 1E9LA 2C13A 3EX2A 2E40A 3TYZA 4JTUA 3PS7A 1L6SA 3L2LA 2C79A 1Y0EA 2PWGA 2QUMA 4IXHA 4QJ1A 1HG3A 2GQ9A 2RHGA 2VGBA 3RM8A 3BSHA 2GGJA 1W9VA 4WOQA 2IKGA 4O11A 4FK9A 2C1HA 1MMFA 5H91A 4XZBA 2X16A 5CPMA 1J0KA 4QJ3B 1S2VA 2J7CA 4D9PA 3L0GA 1W5QA 1XBXA 3GR4A 2INFA 1M01A 2VOMA 4FLSA 4GACA 2FGLA 3NPXA 3TMQA 3LENA 4NG3A 3O6AA 1R9YA 3SN0A 4W8AA 3MP5A 4KESA 3ARWA 3VNLA 3HQPA 4HU8A 1GOKA 2ZUWA 5BRPA 4L6DA 4ZO9A 3P14A 3C2VA 3PBYA 4P8WA 1XIDA 2UY4A 5L9FA 4PCFA 3WLJA 3RDKA 4XSLA 1O94A 1HIZA 2BXZA 2OXNA 4QXIA 4WKHA 5M5DA 4HHPA 1HKWA 1KQYA 2OOFA 1XDMA 2EO7A 3HPXA 2DH3A 1I9CB 2P8CA 3MMUA 3WNNA 1J0ZA 3HPZA 1YIXA 2BVYA 1OIFA 1XLCA 4JICA 4OBRA 3W6YA 3QTPA 3DKLA 1IQ8A 4JKKA 3BJFA 2FYMA 1E3ZA 5F1UA 1H62A 1EPXA 1OFAA 3L4YA 3MV11 4Z2JA 3GU1A 2J62A 3QVQA 4W7VA 3FYPA 4AVFA 5LA0A 3LCGA 3NPVA 1ZSXA 5AY7A 3LCWA 3ICJA 3PPGA 2E6FA 4QGCA 5I3GA 1HKIA 6REQB 3TMLA 1XCWA 5CH9A 4JL2A 2QCLA 2D0GA 4AEOA 3T55A 2V69A 3WLIA 4JYDA 1JULA 3WNOA 1GEHA 1LRNA 4W87A 1XS2A 4J3TA 3KBWA 3SEPA 1UH4A 3USBA 1MUCA 4NF7A 2J8TA 3LB0A 5IDIA 4QCEA 1OC5A 4Q33A 4DN1A 3AYTA 3ZT5A 4ACZA 4CQ9A 1V3MA 4JX4A 2WM1A 2W79A 4LS0A 3EOLA 2GJXB 1G5AA 3VD4A 4Z2HA 4H8NA 3S6TA 1XYAA 2IS7A 3A4JA 2D73A 4FF7A 4ERGA 3CXOA 2PZ0A 3QZ6A 2FZ9A 1UWTA 4E2OA 2WB5A 2OB3A 4WJXA 4DO7A 4QEEA 3UPMA 4DAFA 2PUZA 4BI5A 4AISA 4L4MA 1FWBC 3AHTA 2FHFA 4O19A 3VILA 1HGYA 2P10A 4NZ4A 2JF6A 3BG5A 3DIPA 4FB7A 3EWXA 4Z2KA 3REQB 3GIPA 2GJXA 2GK1A 1T5AA 2YDQA 4LYPA 4PTXA 3SRKA 5T91A 4S3JA 2QJNA 4A29A 4GFIA 3W73A 4JN6A 2NVAA 3T1GA 3OEXA 4DWSC 5LIWX 2VZSA 4CCEA 3LN3A 4B5VA 3KCOA 2VCAA 1KXQA 5CJNA 1OK4A 4YYCA 2D20A 1XLMA 5BMXA 3SCTA 1AMKA 4G5DA 2OR2A 1OVDA 1JCLA 1TZ7A 1XLEA 1GZJA 3THUA 1S3TC 5D30A 2J7DA 3WDPP 1MW3A 2TODA 3A5FA 2GQAA 5F1VA 3T7VA 2WJZA 1W3KA 1DJQA 1KXVA 3H6OA 1A5AA 2V6AA 3M0IA 2O0TA 4H9ZA 4YIWA 3NXLA 5DCDA 4DO6A 5FESA 3QC3A 1OF6A 5D2VA 2QLYA 4UTHA 3UYIA 2Y4SA 4U33A 3M9YA 3WK1A 1MZHA 3GVVA 1MXDA 3LEPA 1ECQA 4FNRA 4IUOA 5LHFA 4Z42C 3N34A 1L2UA 2GDVA 1K6AA 5BXPA 4L1WA 1SO6A 1XLFA 3ABOA 1BYAA 1UJPA 2VQTA 3UETA 4GD0A 1AQFA 3UP8A 3H54A 3R8GA 1Q8JA 1EJSC 4JKLA 3NGJA 2Q02A 2CLFA 3K8KA 3C6CA 1RHCA 4AZ7A 2XVPA 3WNMA 4LF2A 2QHAA 5LZLA 2AAAA 1XIBA 3GTFA 5AHEA 3MKCA 2CZ5A 4CVUA 1EX5A 4LUSB 5A6MA 2J7HA 4QP0A 2VFGA 1I45A 4ZSTA 4D8LA 1R7OA 4CLMA 4L4LA 1VFOA 3FYYA 4C7DA 2DSVA 1L6YA 1VCVA 1DJHA 1PCWA 1F7BA 4PA8A 3AXMA 3W2NA 1XPYA 2P76A 3EKGA 2ISWA 3EWBX 1DTNA 2QPUA 3T6CA 4LC6A 2VYOA 2CW6A 1YDOA 3BL3A 4HA1A 3LERA 1YBQB 2XSXA 2OZ0A 3TH6A 1NEYA 2XTKA 4AVOA 1ZTVA 4EPDC 1W1B1 4AZIA 4JCMA 4XD3A 5A2BA 3PWAA 3Q45A 2BGNE 1XD0A 1JI2A 2WZIA 4D6HA 1XIGA 2C1IA 4Y8EA 2C16A 1XXXA 3VNMA 2G5WA 4DJEC 2V5DA 1M65A 3V18A 3V75A 4AMAA 2DZPA 4YTRA 3S9YA 4LS2A 2NV2A 1ZBWA 2BVWA 4XISA 4OECA 3BSGA 2J13A 1CXIA 1PWMA 4GO8A 3F7JA 4WSHA 1UOZA 2WJEA 3OQ8A 3EWYA 1OEPA 3M0MA 2WCGA 2HPIA 3EX3A 1FWFC 1MFUA 1ITQA 3BOXA 3RO6A 3VMOA 4PTVA 1IHIA 1PWLA 1K70A 1Q6RA 2H9AA 3CHFA 2ZVIA 2ZZ2A 4IFOA 3WMCA 2DT1A 4REQA 2YBUA 5AC5A 3CEUA 1FWEC 3AYVA 4MY8A 1SVDA 3UXAA 1LT7A 1HKVA 3WDQA 4CVWA 4M3PA 1XIEA 3SR7A 1F07A 2G4JA 2Y2WA 3KHJA 3M64A 3FGCA 4ZE5A 4XTIA 3P5ZA 1XBZA 3LPFA 1KA9F 1E6PA 4QE1A 3HG2A 1UBPC 3G1FA 4P8XA 2ZWZA 2UBPC 2PBGA 2HROA 3EB4A 3E2QA 4RNHA 1HQTA 4PMOA 3QRHA 4C6OA 1UC5A 3IV8A 3B4UA 2PSNA 3VZXA 3ITLA 1W1PA 1QHPA 2Y89A 1QO2A 2INEA 3O6CA 1E0UA 3MSRA 3GE7A 3A6OA 2O9OA 1PIIA 3QBUA 3VUPA 1OFPA 2XFYA 4PL1A 1Y5XA 4JQ2A 3F5JA 3M46A 2ZX7A 3PSVA 1EBHA 1FKXA 3PY2A 4R27A 2Y85A 1POJA 4XO7A 3FA4A 4EXAA 1OADA 3THQA 3AYSA 4XSMA 1IXNA 1FKWA 3T2PA 3EA2A 2CXEA 1TE1A 3PZMA 4DM2A 3QW4B 4C6IA 4PBFA 4M29A 4Q4KA 3IUHA 5D9MA 4C7FA 4YCOA 1S2TA 1ISZA 5DY2A 3EKLA 2FB3A 1NDZA 4J3ZA 2V2DA 1Z42A 3PPFA 1G1YA 3CUFA 1TB3A 2CXGA 4HOZA 3TW7A 2O9RA 3VX0A 3VNZA 3M0VA 1RPXA 1FWRA 3L4WA 3HM7A 4TV6A 1QHOA 4OBTA 1EP1A 1M68A 4FS9A 4ZODA 1WZMA 3H2MA 4UTKA 2NSXA 4JIRA 4ZQMA 5JUVA 1VBHA 4GQQA 3LDVA 3GFZA 2W67A 4JNMA 4H7VA 2A0NA 1P6BA 4L9XA 1TZZA 3V4BA 1P5BA 3DC0A 4J2MA 3TKFA 2WW5A 1VEOA 3LXAA 2A3AA 2HZGA 2WSKA 4WXZA 3LGEA 5F4XA 4MPKA 2F7FA 2BWGA 9XIAA 1PJ9A 1NOWA 4I9JA 4PTDA 4GJJA 3DI0A 1AMYA 1XX1A 4E8CA 1RD6A 3N04A 3W7EA 4KKXA 4MFEA 2W0UA 1UP2A 3ZR5A 4DNHA 1TVLA 3SURA 1QI0A 2YCEA 4AIUA 4A21A 2DZWA 3A3XA 4AMCA 3NVDA 4WY0F 4ZTYA 1TJPA 1O68A 2OSYA 3EX1A 2I9UA 2QIIA 1UASA 4BR1A 4WDWA 4M6PA 2QUVA 1UZ1A 3AAMA 3CWNA 1FWAC 1DP0A 3I6TA 4RJEA 4ATLA 3PAOA 4KWVA 4D1IA 3D3FA 4LUIA 4C6MA 2RDUA 2XUCA 3M1ZA 1PTDA 4IP4A 4HBKA 4Q4PA 4AF0B 4HTYA 5LNUA 3VKKA 2BVDA 2NLIA 5D9OA 3KE0A 4MNLA 3LCHA 4TOQA 3DBNA 4TMBA 2GGHA 4LCSA 4AIOA 3LM3A 4F0RA 1DL3A 3UXIA 1KKOA 2D2GA 4L7ZA 5BZAA 3CMFA 1TTJA 3HPFA 2IPJA 4XV0A 2DPEA 4XB3A 2Y7DA 4NAFB 3ZXWA 3VCRA 2ISVA 1UWIA 3OO2A 3DBPA 2C19A 1UWUA 4A3RA 4UOJA 3NPWA 4Q8VA 4QTGA 2XVGA 3VA8A 2CLEA 4DLMA 3PN8A 1M41A 2QCHA 3FYOA 2BGQA 4S3FA 3GAYA 1AW1A 1PBGA 4V1XA 2C1GA 3HV9A 2Y61A 4QISA 1JZ2A 1HN1A 1V03A 1M6JA 4EVZA 4NAEA 2PP3A 2MNRA 2QAPA 2B31A 5EFDA 3UZWA 3OGRA 5I7GA 4B16A 1XLGA 6REQA 1CGWA 3MC5A 4ONVA 5HMSA 1KR1A 2NUYA 5DLCA 4MZ8A 4QLKA 3WUGA 4EPEC 5AHNA 4ES4A 1IF2A 2WLYA 1IIGA 1UWAA 3GNDA 4OTKA 3M5YA 3F4NA 4N7QA 3PF3A 4FF5A 3RLHA 2BNJA 4O14A 3THDA 3BUVA 3GC4A 4HSHA 4AY8A 1Y5VA 1J18A 2ZA2A 3AI0A 3M0LA 4GQBA 1XBYA 5CZTA 3W3OA 3GH4A 2HXUA 4IJBA 5G4EA 5HJXA 1TELA 3GAKA 3LQGA 3TFCA 1Q45A 3B06A 4DYEA 2YCLA 1MYRA 4EIVA 1E6QM 3IK4A 2J4GA 1XKYA 4GUFA 4JYEA 1XRVA 3TTYA 2B4GA 4PBGA 3DZ1A 5AVHA 5CKSA 1UWSA 2AL1A 1X6LA 1OFRA 3SFKA 4JY9A 4INFA 4JN8A 3BQ5A 5HUOA 5T8GA 2NT0A 1EDGA 4WX2A 1I75A 3F5KA 4QITA 2VRQA 4GX9A 3PZOA 3R8HA 2VRJA 1JQVA 3FA3A 4YVPA 2W6RA 4PRWA 2YW4A 3W1PA 4K39A 4NJGA 4GVFA 4PMVA 3D6NA 4N4QA 4B3KA 1V6VA 1E9ZB 3HG3A 5HULA 3UZYA 2ON3A 3IIVA 1PZ3A 4RZ5A 1QNPA 2VL4A 3GC2A 2E09A 2YLLA 3Q2DA 1S39A 2J6VA 4ZO7A 5ENLA 2PC4A 2Y8UA 3UJFA 2YDAA 1W31A 3AIQA 3LV6A 4LC8A 4HZ7A 2PFHA 3M5ZA 4HU0A 1KCKA 2CLHA 4IIHA 3VGBA 3AS0A 4EF9A 3K8MA 3UERA 2GSJA 1POKA 3NR0A 3CHVA 1RV8A 3CV2A 5AECA 1VFTA 3NQAA 4JY8A 1ICQA 3IJQA 3M5XA 3GG0A 3SJNA 3NXFA 2ZA1A 2PGRA 2JK2A 3TW9A 3S5SA 4XZWA 5D09A 2Q8ZA 1XYFA 1ZHAA 5A95A 5XINA 5AVNA 1R2TA 1ELSA 3R5EA 1Y7VA 3LHUA 2E77A 1C7TA 3C86A 3TTSA 4DWSB 4NNAA 3IIZA 3BLEA 1W9PA 2P50A 4OJYA 3SUSA 4GKTA 5FCZA 3BSMA 5J8LA 3T42A 3VPLA 3WZ0E 1JQXA 2J77A 4Z2LA 3RU6A 4OGZA 4D1JA 4UTMA 3SRHA 5I5RA 1DWIM 4GGHA 3V5OA 4E0CA 1GOQA 2OCZA 1W3JA 2VURA 3GQYA 1CDGA 1AH4A 2YA2A 2FTYA 3WJXA 2OYLA 7ODCA 4CCZA 1HJQA 3KZPA 4IGSA 4IGMA 3M43A 3SY8A 4LRTA 4JS3A 2Y5JA 3L5AA 2P1FA 3IS4A 5G1MA 5I06A 2INZA 1EL3A 1NFGA 5D8WA 1SO5A 4XVEA 1JI1A 2R94A 3OIHA 2ZTKA 3FOKA 4ZOEA 2R9RA 2QJMA 1DJNA 3MSYA 4LY8A 2FTPA 2RGMA 3WMSA 5T26A 3UW6A 1ZJBA 1A5UA 1MQQA 4O4VA 3WF4A 1UIOA 4G1KA 1S5VA 1LOLA 4JTHA 2YGYA 2E28A 4ADSA 4V2XA 3BVJA 4WQ6A 2XWDA 2P3ZA 4YU1A 4GY0A 3LPOA 2GWNA 5C9ZA 4M24A 3SGGA 3RLVA 3RGTA 4JIEA 4IMFA 4E3VA 2OX1A 3V7PA 2OQLA 3PBMA 4NKCA 1VBGA 1W17A 3N9KA 3LU2A 1SZEA 3WLNA 2ZUSA 2G3MA 3NDZA 2H3BA 3O1NA 3AISA 3NZRA 4IMCA 1TA3B 1V77A 3I10A 2PF8A 1R2SA 1DQWA 5C0QA 2WNZA 3EEGA 5KZ6A 2W66A 4Y9OA 3SSZA 4F66A 4W85A 3EX6A 2X1SA 2WV8A 5DO8A 1UH2A 4AX7A 1VBUA 1UZHA 4O57A 1FHVA 3NDYA 1BTMA 5E0KA 3SAZA 3KTCA 3L4TA 3C0SA 2EG8A 2H8XA 3BAYA 4WOZA 5ABEA 4NYYA 5E93A 4C6CA 1UA3A 2PDGA 4A8NA 4DLFA 3UNDA 1W3IA 5F2GA 1HJWA 4BFAA 2NQZA 1TJRA 4AZ5A 5HR6A 3TQVA 1NWSA 3S2JA 1OQFA 4KF1A 3TJ4A 1AQHA 3DYMA 3AZRA 4GQGA 4GCAA 4XZIA 4NRRA 1FHLA 3NQCA 3LRLA 4NNCA 1JDEA 4ATDA 2WZHA 3GFYA 3VZYA 3MQTA 3EXTA 3OBKA 5EA9A 4JN7A 1IR2A 1AA1B 4RE3A 4HK7A 3BLFA 5CQ1A 3HZ3A 1IXOA 3NQGA 3GTXA 2E8YA 3CEPA 3B0YA 2CWNA 2VT0A 4N6FA 4HVXA 2RDWA 5AN7A 2UV8G 4TMCA 4PMJA 1EGZA 1EJXC 4H6KA 3UWYA 2SFPA 1HJSA 1XFBA 3NYDA 4AH7A 2GVYA 1QUMA 1ZFJA 2DORA 1DWFM 2Z26A 3W22A 3ZYZA 2EGZA 3KAOA 2PD5A 4IQJA 4R9XA 1DIEA 5DRIA 1CI1A 1VEPA 4DY1A 2ZX5A 3P60A 1JYWA 4MOZA 3FGCB 1KLZA 3HG4A 3W87A 3CB8A 1G01A 1IV8A 1LRQA 8RUCA 1FCUA 2EPNA 1W5PA 3VD9A 1NOFA 2V2CA 1DWHM 4AWUA 1W0MA 5TAOA 1EWDA 7REQA 4O52A 3G3MA 3GB6A 3EOUA 2VNCA 1R46A 2QVNA 4CNUA 1TFVA 1ZBKA 3W7HA 4RXGA 3FAXA 5D05A 3POHA 1D3HA 4PUDA 5AYIA 3QH2A 2X42A 3TLLA 1P0BA 3PG8A 3DDMA 2V3DA 2YXXA 3SECA 3WEMA 1VPYA 3W23A 4N2YA 4LFYA 1J0HA 1R3TA 3U48A 2CHNA 4GPNA 4WRHA 2WM0A 3W25A 1O1ZA 1JUBA 1KTBA 5FAGA 4ZOAA 3WENA 4RDYA 1QWKA 4PCTA 2Z7KA 4HNUA 1W32A 4Q4SA 5G2IA 4U28A 1JGMA 3AJXA 3RG6A 2FJKA 1ZPTA 4JIPA 4BK9A 1KFKA 2ZE3A 3GSMA 1V6WA 3SIMA 2IQ0A 1T0OA 4A2RA 1A3XA 4GYJA 2VUNA 4K68A 5BW6A 3P0XA 4S3KA 2BS9A 4I9TA 5LNVA 3U3HA 1LQ0A 4LQ1A 4GXMA 3I3BA 1A3WA 2ZDRA 1RCQA 3TAKA 1C90A 4QNEA 4ADUA 1F3TA 1LRTA 1J0YA 2NUXA 3LRMA 4JTIA 4F4RA 4B5NA 4GLEA 5HWJA 1TX2A 4X9SA 1XL9A 3UZ5A 5LKYA 1KW1A 1PV8A 4LYRA 2E6DA 1MRQA 3THAA 3BC9A 1CYGA 2XGBA 4FX8A 1I2PA 2XVNA 3LCXA 1SZFA 3OW1A 2XGZA 4KRTA 1Q66A 1W1A1 3QC0A 5IHRA 1VC4A 3OLGA 4U2YA 3PPCA 4LV4A 4HNVA 3WD3A 3T2QA 2OEJA 3FS2A 3FJ4A 2XYLA 4QHRA 1Z8AA 2D2HA 2GVGA 1DIKA 4I3GA 4MLJA 2BHYA 5AHMA 4RNJA 4IPNB 5FJIA 4RPPA 4R85A 1QPNA 4D71A 3QW3A 2ASHA 3EA3A 4O18A 2OOGA 1XG3A 4PUMA 4LNCA 5C71A 3F4CA 2Y5SA 3NL6A 2CIPA 1FTXA 5A6BD 3P8JA 1FCVA 4U2ZA 5HNTA 1DE5A 1EUNA 5KEZA 1HL9A 4J1OA 5A6SA 3VABA 3U2CA 4NAFA 2EQDA 3FDGA 4TQTA 1ZNNA 1F3WA 1MWOA 2J9XA 2ZRYA 1H7XA 1UYQA 5M03A 3JZEA 4B15A 3N9SA 2PDWA 3CIXA 1S5NA 4ZEPA 4UQEA 4QDPA 1JDAA 4JTKA 2WXDM 2CEQA 1QCWA 2DW6A 3DG6A 3KOYA 2GGGA 5CLWA 4ZO8A 1W2VA 4V33A 3QXBA 4IH3A 4MFDA 3NQEA 4J2PA 4JTEA 3OTRA 3AWNA 3KBNA 3RCYA 1M5WA 2PCEA 1VLWA 3GHRA 3HU7A 2AQOA 2CZFA 4GI4A 2QW5A 5I3HA 2XSAA 3CWHA 4PEEA 1BEUA 2DVXA 4GI6A 1U5JA 5A8QA 2VFEA 1CB2A 1Y5WA 4KWSA 1RQBA 3RM9A 1JZ4A 4P7QA 2YXGA 4L5ZA 2E5BA 3RR1A 1PE1A 1R2RA 3WK3A 3ARPA 3GYCA 2OEKA 4UB9A 2PURA 3LMYA 2KAUC 3DYPA 1XDLA 2QS8A 4DBWA 1NM9A 1M7XA 3OLEA 1WA3A 4GX8A 1OCQA 3DGRA 5KITA 3B8WA 1FWDC 3UGVA 3CH0A 1HT6A 1US3A 3DHPA 4N6EA 5J04A 1DHKA 4J3XA 3MI6A 3LNPA 3G1XA 3H22A 2JEPA 1A5SA 1IT0A 1O7AA 3EMQA 4IISA 4L1XA 2DGAA 3OGVA 3B97A 1J6OA 3VO0A 3A13A 3LI0A 2JKEA 4XTDA 2TSYA 3EGJA 1R30A 1JCTA 2DSUA 1JXJA 1PYFA 3ABRA 4Q8WA 4RDVA 4HPGA 4IX0A 3CAVA 3BGJA 3MSDA 3H2NA 3NPUA 5I0DA 4H2HA 2AKZA 1CXFA 3EPMA 3KL0A 3R6IA 3PM6A 4NAEB 1EDQA 4F0SA 1Q6CA 3LLXA 4M8UA 5J5RA 4QSHA 4O0ZA 4GMEA 2ZZ1A 4MVAA 4GZ7A 1QDSA 1DV7A 1LBFA 3SN1A 1J11A 5C54A 1XLHA 3GDTA 2CZVA 1AK5A 4IQEA 1OCBA 2IKHA 2XDFA 3AXIA 1KBIA 3W76A 4HIBA 1XIJA 1RK6A 3ITVA 3OHMB 3DFHA 1D3CA 3CAKA 4W86A 4D6IA 2IKIA 4HGXA 2OGJA 4DBEA 3NOEA 1WYIA 3CV6A 1PKLA 1BVNP 4H7CA 3B9DA 3QY7A 3T0BA 1V51A 2PDBA 3RF9A 3QY6A 3TTOA 2VX5A 4IQLA 4FALA 3SGZA 4H41A 2DFAA 4I6KA 4PE8A 2W9MA 3RUBL 3VNYA 4GY1A 1PZ0A 1OT2A 3OA3A 1FDYA 5IHSA 2R1NA 4PL2A 1K3UA 5IDZA 2ZXDA 1PTAA 3TTEA 1BF2A 1DXIA 1SUXA 1HX0A 1EFZA 1XIFA 1XRFA 1K8XA 1RBAA 1Y8BA 3E12A 5A8NA 2CNCA 4XX6A 1MZRA 1JD7A 3DN5A 2VR2A 4M51A 2HCVA 3W1MA 5AC4A 3W1QA 3KM8A 1ITUA 3W1RA 4F0HA 4IIFA 4PULA 4Z1AA 2XIIA 1TV2A 5DY3A 4RE0A 2VC9A 5K2ZA 4UWMA 4RE2A 1WKEA 3CJPA 4UMCA 4EACA 1KTNA 1PYMA 1SZRA 4JL1A 3TA9A 5D37A 2CU0A 1E9YB 2GZXA 2WJFA 4M56A 1FWWA 2A5HA 1FFRA 3UZZA 2YL5A 3WLSA 1CGVA 1K8ZA 1TCMA 4HA3A 5U7SA 3VOFA 1ZQ5A 1KBKA 1NOUA 3U4AA 4PTNA 4DRSA 1OJXA 2W62A 1A5KC 1EA9C 3URNA 1PXGA 3DKJA 1F76A 4L56A 2WC4A 3SJ3A 5XIAA 3BH4A 4BF7A 3OYZA 1EPVA 2VZTA 4CD4A 3C2YA 2AGTA 4XQ6A 3DFSA 1JNEA 1GWJA 3GXIA 3RO8A 1ME9A 5C55A 3KTXA 3SCPA 2YB4A 2GQ3A 5A6JA 1WDDA 1TIWA 2FZDA 1XBVA 4S3AA 3UGRA 3P0WA 1CW2A 1QNQA 4MUZA 2ZZ4A 4CD6A 5LXEA 4H9YA 4AHQA 4J3VA 3L4VA 3LMZA 1WE5A 4GGBA 4DJDA 3QR1A 1CT5A 3SI9A 3WF0A 3FW6A 2XVKA 3URQA 3GDRA 1ZLPA 9RUBA 1CPUA 4XBKA 1KLYA 4XKMA 3I7RA 2WCSA 3AIBA 4D6GA 3TEVA 3CYJA 2BY0A 5HINA 1PX4A 1Z32X 3AIEA 4J35A 2I14A 4QDMA 2Z2BA 3MANA 4IMDA 5FSEC 2QCDA 3UR7A 4UTUA 1HNYA 5I3DA 4DPQA 4R5EA 1O4UA 3NL5A 3E74A 3G8RA 5CGQA 4PMXA 1M7JA 4PUEA 1R9ZA 4DJED 2EKCA 4UMBA 3KDOA 1YTDA 3BO9A 4GE8A 5LNSA 1CCWB 2EHHA 1P4CA 1WOAA 2ZKMX 3AC0A 4HSNA 2G41A 2Y5EA 1JGIA 3ARSA 1XP3A 5LIXX 2J25A 3W7IA 3NYZA 4B91A 3UESA 1GNXA 1W3LA 1B4KA 2V5JA 3PB0A 4O17A 4I90A 2HS6A 2ZA3A 3WDRA 1F3EA 3DFYA 3V1PA 1I2NA 3RMJA 3IWPA 4G56A 1HKKA 3LLDA 3VIGA 2VR5A 3VVGA 3H26A 4JTRA 2PRHA 4AZCB 4Q6JA 4PZVA 3VDGA 2NX9A 3KBSA 3CHDA 3CMJA 3GWQA 3WBYA 3WL0A 1CLXA 1OYBA 5FF0A 1F3XA 4L9ZA 4OKDA 2QCMA 3SCVA 5A8PA 2YXOA 3PP7A 3HBLA 3L67A 4W7UA 1YNPA 1UQZA 3BPWA 4DEFA 4C6EA 3WH6A 1GVOA 4UFIA 1O12A 3EOSA 3U9IA 3ARYA 3TUUA 2NWSA 1VKFA 1LL4A 3NGFA 4LJ3A 4Y6GA 1ALDA 1S1RA 5C6MA 1ONXA 1V4YA 2POZA 3UR5A 4UUIA 4KFOA 1T96A 3KS6A 4MY1A 3LV5A 2GJPA 3QHMA 4YTUA 1S2UA 1AW2A 3T05A 1TR1A 2E1WA 3BCJA 3WQGA 1KGXA 1H7RA 4HNNA 1TQXA 8XIMA 1XYMA 3I68A 4ZL1A 1EGMA 3PZ9A 4FNSA 3WLPA 4IQDA 1O5RA 1CGXA 1KBJA 4GIAA 5EL1A 5DN1A 1QNOA 1LUCA 4GYPA 1JPKA 3CQHA 4XZNX 2ALRA 1NARA 2G3JA 3RFAA 4D6JA 5FF3A 3N4AA 4NT0A 3JW7A 2A7PA 1QHZA 2CLIA 4E8DA 5DCEA 2E1DA 3L4UA 3OG2A 1Q8AA 4MJ2A 4IHCA 2B7PA 1IZJA 3QZEA 3CUXA 4RZBA 5FSDC 3GVGA 4HPJA 4KERA 4HCDA 1MEWA 1QW7A 5HQMA 1JDFA 2OKTA 3B0VC 1KM3A 4K3ZA 4DJFA 4LX4A 3WL1A 1OGBA 4FNPA 1VYPX 4XD6A 4XAZA 3ZT7A 4KEZA 1C9WA 3B9NA 3UCCA 3GDKA 1F61A 4ERAA 1FH8A 2NVCA 4AAJA 2Y62A 3M4HA 5HNRA 3NQ7A 4ATWA 3P7YA 5C8BB 4HA0A 3W27A 3R25A 1BKSA 3WO8A 3ABQA 3MMWA 4F0LA 2PLMA 4DF2A 1ZP4A 3BURA 1UCWA 3KFTA 1NFBA 2XHYA 1N8IA 4NP7A 4MDOA 1S1PA 1DQUA 4KQNA 2WPBA 3LY0A 3VTRA 3OBEA 3QF0A 3K4AA 5E9AA 3SIZA 4LYKA 2RFGA 3JVAA 1IXQA 1UR2A 1HJXA 5F7UA 1BXBA 2TRSA 2VZVA 3BV7A 4LSBA 4AG0A 5I3KA 3ZSTA 1FUYA 3MA8A 1W8SA 2PDCA 3MU7A 1SW3A 3S4TA 4PMRA 1PAMA 3S42A 4E2VA 4AEFA 1WNOA 4I7VA 3K5XA 1X7IA 5LIYX 4G2DA 4JTJA 3BTNA 2CKSA 5GJMA 3NQ6A 3GH7A 3UWWA 1TA3A 2ADAA 4TX6A 3TK7A 1E4LA 1LJYA 3BCDA 4H01A 2VENA 2HV5A 2XZ7A 2CYGA 4HD5A 3P6LA 1WO2A 3WDHA 1FP8A 3SM0A 2NSOA 4GUIA 2A3CA 1OF8A 2CESA 3WQWA 2ATSA 4E4FA 1MDLA 3LHTA 5DMLA 1J0IA 5EMYA 3KOWA 1VBJA 1IZCA 5PTDA 4XAYA 3STPA 1GVFA 1XLJA 3L12A 3AXXA 4BWLC 1KBBA 2PDQA 2QULA 4EWND 2Z25A 4JHMA 2HBXA 1MXSA 2Q8XA 4ALDA 3GXDA 2QAFA 2VELA 3CWOX 2QXWA 3NEVA 5GNYA 3S46A 2O9PA 3S2LA 1FP9A 1GOOA 5B7ZA 1EF3A 1IWPA 3W75A 3URAA 1HF6A 1RZMA 1B4EA 3I3EA 3M0XA 1JPIA 4UIOA 2G96A 4J7RA 3O6DA 4W5UA 1C91A 2J6XA 4HU3A 3A4XA 2VQUA 2DIJA 3DC8A 5E0CA 5C9XA 2YCKX 4W9TA 1LL7A 3U2OA 4EE9A 1XUUA 2QF8A 4X60A 1GEQA 4X0NA 1F8IA 5CBBA 1OGGA 1SO4A 2DSWA 3LTYA 4O1FA 5MHBA 3R13A 3GO2A 5ABTA 5DMNA 3R0UA 3CO8A 3RXZA 1Z69A 1PHWA 3MUZ1 2OU4A 3NQ2A 3MDUA 4JCLA 2ZUVA 2EPHA 3VXGA 3AMCA 4NY2A 2WJDA 4LOCA 1OY0A 3K8LA 1DWJM 2V68A 5AYXA 2FDSA 3W7JA 4ZB5A 3AMLA 1MW2A 5HJLA 3TQ0A 1XICA 2ZWYA 1WDWA 2IPFA 2WBKA 2A2IA 1Q5MA 2BODX 5FOOA 3QGAC 1OSEA 2R91A 3GFXA 1XYLA 1K4HA 2PDNA 3T0TA 3LX9A 3EWWA 2VEMA 1XF0A 3UG3A 2B7NA 1R3SA 3HFTA 1V02E 4LVAA 4RDZA 1B3ZA 4C6PA 2CLPA 3BLLA 3PZQA 3VDAA 5BU9A 4AD2A 4X0VA 5CGMA 3RU8X 3MCMA 3DX5A 4CD5A 4RW5A 1EZWA 1AW5A 3O16A 3KHDA 3PTQA 3QMTA 3B8IA 2HXTA 5E6ZA 3M44A 1LQAA 3W86A 1LDCA 4Y90A 4NHVA 7ENLA 1W9BM 4A8IA 4P2VA 3MWCA 1UKSA 4ROQA 3PTMA 3BAKA 4GNKB 1SW7A 2RAGA 3ZLFA 2Z2UA 4GZEA 3VC6A 3W2LA 4Q8PA 3EDKA 5A8GA 4UR7A 3E1F1 4M80A 4MWAC 2OSXA 3WCZA 3AZSA 4FP1A 4IT1A 3GKAA 2ZXAA 4S3EA 1VFFA 4IUGA 2ODOA 3B8VA 2XN2A 1FWIC 4PMUA 1V02A 2DW7A 3CT2A 4K37A 3BQ6A 4IIBA 4W84A 3MMDA 5HDRA 2J79A 3S5YA 2ISFA 5B80A 2XG9A 2JE8A 1V6YA 4RZ6A 3N18A 3W7LA 4UTLA 4FMVA 4TUFA 1EJWC 4FNQA 4DBUA 3DESA 2XIOA 2CBJA 3VGGA 4OWGA 4ICMA 2FHCA 1UKOA 2QF7A 3IANA 1L8PA 3D0CA 2I57A 4OOUA 1OZMA 3WJSA 3W2JA 2VC6A 5FEZA 4MADA 4ZMGA 2PGEA 4RW3A 2OKOA 1GTEA 2I1OA 2PDXA 4C1KA 4DO5A 2V3GA 4O4WA 2ZFAA 4YVVA 1XISA 1Q3NA 1V8EA 2BFGA 3T4WA 1ZAIA 1VFLA 1V0MA 1RQHA 2X2YA 2E25A 1A50A 2HISA 4FHAA 3F03K 4C6KA 5G5IA 4B9ZA 4AWTA 2YOCA 3VGFA 4U5KA 2VD9A 3LG3A 3PZIA 4F0KA 3GW0A 3LI1A 1EEXA 1P0KA 3TQKA 2X41A 2GDQA 3C2RA 1SJAA 1XQLA 4D6DA 3FJNA 1QI3A 4I5RA 3KRZA 2G3FA 4Q7BA 4AXKA 2AQVA 3TYBA 1GJUA 1VR6A 4PUJA 3UY8A 4CD8A 1EH9A 4KEUA 3SUWA 1WZKA 4AZBA 5IM51 4X61A 3IGHX 1R47A 4O1AA 2J78A 4O28A 3RYSA 1KKRA 1WUFA 2NQHA 2CBIA 6CGTA 2DP3A 4K8GA 5G2WA 2CLOA 3KVKA 1XLIA 5KMYA 4EAMA 3APYA 3UR2A 4IICA 1LF1A 4MAVA 1YDVA 3G1RA 3ANYA 1OINA 2Q01A 3TOPA 3L0NA 4RDWA 3VOCA 1WXYA 3NWRA 1TPH1 4AVNA 1JF5A 1UA7A 1XYBA 3V36A 4QAIA 4DIAA 1O5KA 3VFLA 3BG3A 4AXNA 4B3ZA 2RDXA 2YJQA 4NXKA 5A6LA 3W29A 3D3AA 1A5OC 1E72M 3ONBA 3FFSA 4AY1A 2GGEA 5D2TA 5M3WA 4JQAA 5D9PA 2EG7A 3OHIA 2VEIA 2WHLA 4EPBC 5AYYA 3SCSA 4A3QA 1E40A 2ZDSA 4AB4A 2ZRVA 3FK4A 2OLSA 2FHBA 5DELA 3O05A 1QFEA 2ACUA 1CTNA 1XKJA 4TO8A 5I23A 2DT0A 2CERA 3TW6A 3CUIA 3F5LA 5JIWA 2B81A 4LY4A 4BQ3A 4DUOA 2YL8A 4LUYA 4DWSD 2FZ8A 2FTWA 4GBDA 1US2A 2WQDA 2DH2A 1GHSA 3GU9A 3M0KA 4Z0JA 4MGGA 3Q58A 3P93A 4O0QA 2DUXA 3S3GA 3VIKA 4M6VA 4XUYA 4MYXA 1W56A 1JG9A 3ME3A 4M6UA 2Z1VA 3GS6A 4DXVA 4X2RA 3ITOA 1QR7A 3IV3A 2V2HA 3PUGA 1NU5A 2QDEA 1EYWA 3RX2A 1RY0A 2WKGA 4B5WA 3WBWA 3LBOA 1K9TA 2BZNA 1GOXA 4HKPA 2X0HA 1EGVA 2FJUB 1X38A 2V30A 2W61A 4RV3A 3LCIA 3BANA 4US5D 3XINA 1X96A 1GONA 5DT7A 4C5YA 3GG1A 2WK2A 3WX7A 1R8LA 2OO0A 1W3TA 1E71M 1LTDA 4LF1A 3WQ5A 3AIUA 5DBTA 4B5SA 3AHVA 3B04A 3EEZA 5KZDA 4F0MA 3BLOA 3K4WA 3GR7A 1TVNA 2JQXA 1E4IA 2P0OA 4KCVA 1WKDA 2OT0A 2YFOA 4FOJA 1J96A 5LYRA 1ZJAA 3BZGA 4UCFA 3GUWA 3T0DA 3GR8A 2WKLA 3QMSA 3KW3A 3AROA 2W63A 1EXPA 1UKTA 1X6NA 2HBVA 3IJ6A 4K38A 3C2OA 1ZRQA 1E55A 2C14A 4N4PA 2CHOA 4GIRA 5CBIA 4PMQA 3CQIA 1VPQA 4HJFA 1CXKA 1FHUA 4PCSA 1B3OA 5FL0A 3KCLA 2VEPA 1RQEA 2PODA 2OLAA 3RAOA 5AOUA 3WEZA 3OVQA 4A2SA 4ZB2A 3VIJA 2ZC8A 3RR4A 3AALA 4DNMA 2PU0A 1GVIA 1BGGA 1AQ0A 2A6NA 2TAAA 4I7WA 4CQ8A 3VIFA 1KM2A 1V79A 4E5TA 3HN3A 3S8HA 4CQAA 2YKKA 5C2CA 4PB3A 5C9WA 5AC8A 2FGZA 1IT7A 1E1CB 3CMGA 1KM1A 4O54A 3ITGA 3WQDA 3DFOA 3MMTA 3N9RA 3B0XA 4Y2WA 1OWQA 1QASA 1TV5A 3ZO9A 2FFIA 1TX0A 3B05A 3USZA 4KCTA 3UA4A 2QCNA 1NJJA 3PZUA 4DAIA 2BOGX 3ECQA 3S6DA 2FZNA 5LSMA 4FLRA 1HL2A 3O3RA 3CL8A 4HZMA 2Z0IA 4J4KA 1W6TA 4KRZA 5JBDA 4UTWC 4D2JA 3DFQA 3QV7A 2QVHA 1EHAA 1M1BA 1LP6A 5CGTA 1M04A 2PDUA 1E70M 3CGTA 5C2XA 3R7MA 1LZOA 4O16A 1ML1A 3NO3A 3R0KA 2C71A 1B9BA 3FV9A 1KO0A 3W7CA 4R53A 4C6NA 4WJ8A 1QPQA 3ZJ8A 5ABHA 4IJCA 4HMDA 3T81A 2WZEA 1SMDA 3LBCA 4Y96A 3TLQA 3M16A 2AL2B 4AZGA 3WBXA 3TOYA 5AFDA 4AFYA 2CPUA 4C6FA 4ZVJA 4WHBA 4RR4A 2V5BA 3H4WA 1QT1A 4GC3A 2WZMA 3SCNA 2PGFA 1RA5A 1V3LA 2OQYA 4REQB 4UMAA 2GWGA 3ZWSA 1XI3A 1FWJC 2GFTA 2FVMA 2VMFA 1XUZA 1GVSA 1NH6A 5I3FA 4UZUA 2HMCA 2OO6A 4PODA 3GXFA 3NQFA 1EEPA 4B9YA 1BVWA 3W71A 3WQVA 1TUXA 1HZYA 3V0SA 1GW1A 2RKXA 2GUBA 2O7SA 2CHRA 2VX7A 3DEQA 1ZUAX 1IWAA 2QMJA 5M17A 3PJUA 1RCXB 3NDOA 3CB3A 4H19A 2V3FA 4DF1A 3MB9A 1ZU8A 1L6FA 2QUTA 2OELA 2Q09A 1GYLA 3COTA 1O5QA 4JFWA 3WQ6A 1A5LC 2ZXBA 4LANA 1TYGA 2XZ9A 3WG6A 2NQLA 3WBAA 1BWKA 4WKFA 4DYKA 3EWDA 3NQDA 1UW9A 3TAOA 4B4FA 5DANA 4GZJA 1NSJA 2CLLA 1UR0A 3Q67A 4EKJA 1ADOA 3TN5A 3CUGA 4L61A 1F2JA 1XYCA 4IXXA 3H4XA 5BWFA 4BF5A 4JZ5A 3VKAA 3FJLA 4GXWA 2JEQA 2Z1XA 3H24A 3QLDA 2ZIDA 1AH3A 3RLGA 3B0PA 3C3UA 3V1HA 3N12A 4XIMA 4J5NA 3S1GA 2CZDA 3A5VA 1YXCA 4HNTA 3LHZA 3ZLGA 3FLUA 1UJQA 1JD9A 2Y24A 1SYTA 4FXRA 4AUBA 3WLKX 4XZ9A 1QK2A 3NZQA 3PZTA 4O1CA 2DZTA 3TROA 1QAPA 1JJKA 1GVEA 4CD7A 1MNSA 5FEWA 1RD5A 4M7TA 1PKMA 4AIBA 1LL6A 3PBUA 1AG1O 3LRKA 2OTDA 3I4EA 3H21A 6A3HA 3UG8A 3WNKA 4K8EA 3KX6A 3MUY1 3H2AA 1KV8A 1YPFA 3TYCA 1TJ2A 1ZZMA 3HPSA 4L64A 2DIEA 5A1AA 3CL7A 2A85A 3PNZA 3W38A 1OFBA 2PPGA 1FRBA 2PGWA 1RLCL 3PHAA 1EKOA 2DV0A 1QK0A 3PJXA 3VCNA 1F05A 2BVTA 1NIUA 3N3TA 3DOPA 2WYSA 5G4WA 4LU0A 1UP0A 2PWDA 4XK2A 5DF0A 1FWSA 2YBTA 4HTBA 4XD4A 4AIEA 1W9XA 1JAKA 5A8MA 2F38A 1T99A 3CM4A 4BI7A 1XIHA 2PDPA 4LT9A 3G0SA 4JX6A 5H8MA 4FAMA 1AJ0A 4XZLX 1THFD 1UG6A 3L0KA 5BOEA 3NQ8A 1SFSA 2NWRA 1BRLA 3SCUA 5FJJA 3O07A 1UKPA 5A2AA 2E7FA 2WOQA 4FX6M 4DBSA 1GQLA 5GPRA 4JNZA 3G77A 4IMEA 3H23A 3W53A 2X1TA 4Q32A 4KCWA 4UTJA 4DPPA 5FKYA 1IEIA 4ZXLA 2YIHA 2YZ5A 3PB2A 3GNOA 4H8HA 3TIMA 3E2SA 4ACZB 4F48A 3KXQA 4L6HA 1J4EA 1D8CA 1ESWA 2DZAA 4AY7A 3CZ8A 1EDTA 2R24A 3L4ZA 4FOKA 3AMKA 1PKNA 1B3VA 1T6MA 1QJWA 1BD0A 3UCDA 4YHEA 6XIAA 1FVPA 3RPTA 4MJ4A 3BAIA 3NJ3A 3GLCA 1O6IA 3SGUA 1KM0A 1K77A 2WQPA 1AD1A 4FPSA 3HGSA 4R7WA 2DVUA 3BXWA 2BMBA 4NUWA 3P82A 4NU7A 3BAXA 5CSUA 2GDUA 1HKJA 4US5A 4M19A 1R3RA 4A3HA 3UVIA 2WBGA 4N9DA 4W4QA 2PWHA 2WCAA 3GTIA 5SWUA 1YBQA 2VDHA 2DU2A 1VCFA 4WGXA 4AWEA 5CC6A 1N82A 5DMMA 1RUSA 3D5HA 3C0JA 1AQMA 3GTNA 3KDNA 3ZS4A 2PRLA 3N2BA 1G4TA 4HN4A 3LTSA 4MWAE 2BB0A 4EF8A 4Q7NA 2Q71A 4GNJA 4YWSA 1EO5A 2PDKA 1WDSA 1ZP3A 1Z44A 4HCHA 2F6XA 3W7NA 3SSJA 4FIQA 3WNPA 2HTMA 2BGSA 2Y6ZA 2Y70A 3QJAA 3R43A 4W88A 2NV9A 2ZX8A 3V16A 2JIEA 3EXRA 3GIQA 3AQUA 3VM7A 3VM5A 5REQA 1LLZA 3R79A 4S1FA 3MKKA 4PSPA 3BLDA 3ATYA 2WMHA 4ZTXA 1NQKA 1C8VA 2FZMA 3TCSA 2IXUA 1RR2A 2A1YA 4UQDA 4WDTA 7PTDA 4B4HA 2CCRA 3NUKA 1K4GA 3C0QA 2BY1A 3S2CA 3LGDA 4B5TA 4NQ1A 1XIMA 3GU2A 4Z17A 1F9CA 3L5LA 5I3IA 3QQ1A 5D2XA 1JZ3A 4QJ5B 1Z3NA 1ADSA 3H70A 4Z1CA 4CEXC 4BZYA 4LEFA 4UFLA 4KH2A 4D72A 2E68A 1E4MM 2DEPA 2EKGA 1B30A 3Q65A 3ARXA 3ALFA 1KWKA 1K7EA 1VYSX 1XLLA 3TYUA 4BI6A 2D69A 2WSYA 2E5DA 2QKFA 1L9WA 3PULA 3B8TA 3PUOA 3GBDA 4DHGA 1J5SA 1TRDA 3II1A 4RZ4A 1PX3A 4QX4A 2YA1A 5I03A 2WZTA 4IOTA 4PC8A 1J2BA 4G7EB 3QOKA 4H9VA 1SO3A 3KVLA 1I4NA 4O0KA 4P7NA 3PWIA 4N9BA 5CCZA 4HMNA 1VRDA 2PTZA 4DQWA 1XD1A 5KZEA 2R1KA 2WSQA 2DZBA 2DJXA 4FX7A 4G7FA 1NF7A 3QY8A 1G6CA 1UOKA 1GK8A 3RNDA 3KS5A 1RJQA 3M0HA 4R7JA 1RPKA 4RNIA 4CU6A 3L5MA 5LIUX 3P62A 1U1HA 1IE7C 3B8UA 3CIWA 1CECA 3DU0A 1RP8A 3GH5A 1H41A 1OFOA 1KCLA 1PS9A 3T2OA 3GHTA 1OCJA 3JS3A 4K36A 4O1BA 1E1EA 1E0VA 2VUYA 2WHMA 3B8DA 2ZX9A 4TU1A 5IFPA 2NXHA 4M81A 5JH1A 1R3YA 1M03A 4JD4A 4X22A 4GUJA 4TX9A 3P81A 4ZCWA 1ZGDA 1F6YA 4R7OA 4YHGA 1H4PA 5CJMA 5C5YA 5A6AA 1SSDA 1JZ5A 3PJTA 3VNJA 4H3DA 3TJIA 2XIQA 2XH7A 3GXPA 1YPIA 1NY1A 2CKRA 1UZ4A 3FXYA 3RHGA 4K6AA 5FJPA 4NJKA 3IRSA 1WBHA 5TIMA 3H7UA 1RBOB 3N3MA 3OVPA 1HVXA 1FY6A 1JPMA 3IVTA 3EAUA 3L2MA 4QS6A 2MANA 5FF7A 2J27A 3LLFA 1LG1A 3VIMA 4AD0A 1ZB5A 4UFHA 2C0AA 2OWWA 4H4IA 4C60A 2OSWA 3IGXA 1S3HA 2WHJA 4WJEA 2WMJA 4DZ5A 4JTTA 4Q4OA 5DXXA 1QMLA 1HO1A 3ZJ7A 2W92A 1JCXA 4B2DA 1KGUA 3E0VA 5GNZA 2DZSA 3F2DA 1VD6A 3JUGA 1G9HA 5EMKA 2VCBA 4GK8A 4W8LA 4OZOA 4WY0B 3U2ZA 4NJJA 2WMGA 4GG9A 1NQ6A 3GX9A 4ZSUA 1TV7A 1LLWA 2QPSA 5DXYA 1UR8A 4P7RA 3OOQA 1OG0A 1V5XA 2QPXA 3TNOA 1OYCA 5CC3A 3W07A 5K4ZA 3U0HA 2VOTA 4FXSA 3MZNA 1UUQA 3DHUA 1Z9AA 4JXCA 3VGEA 5E70A 4UTWA 3MCOA 1C92A 4KGJA 8CGTA 4I7UA 1QOXA 3WFZA 4Z2GA 5U4NA 4LUJA 3GDBA 3CQ0A 3PNUA 1ZAJA 2XIJA 3ORWA 7TIMA 5G1YA 4PUWA 4NZFA 5ABFB 2W4XA 5CSRA 1HP5A 3CYVA 3DYOA 3H12A 4W5ZA 4DB7A 4GQRA 1PO9A 1ZENA 4LXFA 1TPFA 3MI2A 2PTWA 4AYSA 3JR2A 3IACA 5CC7A 3WLMA 2E8ZA 1RCOB 2D3NA 4GH1A 1R6WA 3WLHA 4IL0A 1A4MA 4E4UA 3VOHA 3LS9A 3W1LA 1TR9A 3E5BA 3QQ0A 4CCDA 3WDJA 4P7OA 2DQXA 3PBWA 2XH2A 4ERIA 2VVNA 4IPLA 3FVMA 4CKQA 3ZMRA 3QFEA 2QUUA 4QRNA 4KWOA 3TFXA 5A6KA 3STGA 3WKZA 3U5UA 1ONWA 3P8IA 2X09A 3B03A 3MDWA 5EYWA 3GVQA 4IP7A 1G0CA 2P8BA 1H7NA 1SFLA 4C1NA 2HK0A 2WNQA 3G1AA 3I7QA 5HOSA 5JIPA 5CLTA 4B5XA 2PA6A 3UQNA 3N17A 3S0CA 4W8BA 4TVUA 1U5VA 4M5PA 4JOMA 4NX5A 4HHLA 3UJSA 4X3ZA 4AZHA 4MAZA 1QXLA 2YB1A 5XIMA 1R3VA 4CUCA 2QCDB 3KVJA 3PVFA 1R3WA 2REQA 3SB0A 3C8NA 3M6YA 1LBMA 4HB7A 2BY2A 3EMCA 1UD6A 3N2XA 4PBEA 3T4CA 2ZVRA 3VDCA 1H09A 1F4HA 5LNWA 2VTFA 3C56A 1B31A 4A8LA 3C2EA 4Y8FA 3BWWA 1XH0A 2GGIA 3W00A 1TTQA 1V6XA 1BAGA 4BQ4A 1EIBA 3WMBA 2A79A 1TV8A 2D2OA 1DHPA 1OB0A 2H8ZA 1BRLB 3N25A 3LSCA 4UTIA 3MKVA 4Q6XA 2F9RA 3SO7A 1E1CA 3UWVA 2ZZ5A 4J3SA 1D9EA 1FWCC 4ZQRA 5AYZA 3M5VA 4ZFCA 2GQ8A 1TJ0A 3PZGA 1MW1A 1YKWA 3DHFA 4HT3A 4H9UA 2FIQA 4HU4A 4N42A 1DXFA 1SU5A 1E43A 4P8VA 1HKMA 2QJGA 3ATZA 5EBUA 1Q6QA 1H5YA 4AD3A 3VDBA 5CEWA 3MBDA 1Z48A 2GUUA 2NW0A 1XH1A 2FGBA 4MNJA 2J7FA 1OBAA 3GHSA 4YL2A 2FLIA 2B7QA 4CNPA 1TREA 4EX4A 3M07A 1V7AA 1KR0A 2A4AA 1X97A 2J24A 1JR1A 1RLDA 1W3NA 1QPRA 5TF0A 3NM3A 4PUUA 3B4YA 1TPVA 5FEXA 1I0DA 3RPMA 5HA7A 1RAKA 1EC9A 1G94A 1W1TA 1L8NA 5CZSA 1PDZA 4BEQA 1KRBC 3UXDA 3HGRA 5EY5A 1H1ZA 3HURA 3QPYA 1CEOA 1JPDX 3CT7A 4LB4A 2ZZ7A 3LOTA 2J7GA 1AJ2A 4QG9A 2XH0A 3OZOA 3P74A 4JTAA 3B9AA 2GJLA 4C1LA 3OVRA 1T8XA 1ZJHA 1VJZA 5DQPA 3GC5A 2O7QA 5EMMA 3E6EA 4D8ZA 1NF0A 1B0IA 1EQCA 4MB5A 1X98A 3T40A 2WO5A 1NWTA 3G1DA 4H9MA 3L9CA 4KCUA 3LA4A 1EXBA 4S3CA 3AS1A 3S6OA 3UPWA 5I77A 3GNPA 2VZOA 4H8VA 4E8GA 2YDRA 1GQIA 5E6YA 2AOSA 3VNDA 5HBFA 3MT1A 4Q8OA 3DG3A 1QOQA 1D7KA 4HP5A 4CN6A 2XM2A 4FSAA 1PB0A 1YEYA 3UXLA 4JQ4A 4DXXA 3WY1A 2HEJA 3IUIA 4J3UA 4UTFA 1GOWA 4QJ4B 5GJPA 1VFMA 4CN4A 1DJYA 4ZOBA 4EAYA 3FNDA 3E0WA 2DDXA 3A23A 3ES7A 4BS0A 1RH9A 3V5FA 1DJZA 2XIBA 1D3GA 5D02A 1I60A 4MWAD 1TPDA 1A80A 1R87A 4CEUC 1GGOA 3QR0A 1EZ2A 4WK9A 1R0MA 2O9TA 3O63A 3W7MA 3NZ1A 3KWSA 5KZMA 4IJRA 1T7LA 3K1GA 3C0LA 3IJIA 1ME8A 1BWVA 1ONEA 1KGWA 4O8RA 2EJ1A 1O95A 1BKHA 3LZ3A 3P61A 3GD6A 5F4SA 1UMYA 3MPGA 1W9UA 2GL5A 4GNVA 2BOEX 4FO4A 2VCCA 2Z29A 4GZIA 3S5OA 3W28A 2AKMA 1Q6GA 1W2PA 1XIIA 2PF0A 3CAQA 5F2LA 1F8MA 4BQ5A 1VIZA 3AMGA 4Y9NA 3TR2A 3RRAA 4GHRA 4GYPC 3IIXA 2EF9A 1G4SA 4JEQA 3IGSA 2JIWA 1OG6A 5FI8A 3S83A 7TAAA 4A05A 1HTIA 1RALA 3CIVA 1JDCA 1JCMP 4DVOA 3ITYA 4H83A 3BJSA 3R8RA 3KRUA 3GK0A 5I09A 1LOQA 4MHBA 1JIBA 4JTFA 5LA1A 1U83A 1UUOA 2WC7A 1GPFA 4JX5A 4DX3A 4QE4A 2AMGA 2QCGA 1ADDA 1W5OA 1EJUC 3OZYA 4OQVA 5D03A 5KSWA 1GQJA 2Z1WA 8A3HA 4UFJA 3AXHA 4C6DA 1QPOA 2Y8KA 3QGVA 1CGYA 3GBEA 5BOFA 5ECVA 4ZB0A 1QNSA 3RX4A 3UEQA 4LEQA 4G1NA 1A4LA 3JRKA 1IZKA 5ABGA 3QZAA 3U8GA 5C70A 2WMKA 1BYDA 2C18A 1XC6A 4Y9AA 3OLDA 4DZHA 3WEOA 4NIRA 2PBOA 2NZLA 5CAHA 4YVXA 4H6EA 4DZAA 4J28A 3VOIA 2OYKA 2AAMA 3VI2A 4PB5A 1Q6DA 1YNYA 1QNRA 4QEHA 5HAOA 1OT1A 4F8XA 2EPOA 4RK8A 4D6FA 2TMDA 2EPKX 2NV1A 5EMLA 3H2EA 3ARQA 1TVPA 3A4WA 4J27A 1HUVA 2GSEA 3MTWA 2PE4A 5GJNA 4ZOCA 3IJ9A 1A0DA 1JZ6A 1GOIA 1I2RA 1WOBA 2XJ7A 2EJAA 1NFPA 4Y7EA 1XDJA 2PWEA 1E6ZA 3WF2A 1A47A 1DEDA 3P84A 3R11A 5BRBA 1OYAA 1W91A 1JUEA 1E6XM 1DVJA 3GZAA 1GZ1A 1QBBA 3FCPA 3TZNA 1ME7A 2PLJA 3R4IA 2PZNA 1P7TA 1CB7B 2VO5A 4FLQA 1ISVA 2G3NA 4WCJA 5IBXC 4GKLA 4QROA 3T07A 2YYTA 4KMQA 5TD4A 3W85A 1TJ1A 4LW7A 3H53A 3WUFA 3BOFA 3G1HA 4BJHA 3WH9A 2Z27A 3LCFA 4RX0A 4HCLA 4LBUA 4M7SA 6XIMA 1QOPA 2PTXA 1E0WA 3GM8A 2YW3A 3KCJA 3AJ7A 2EPLX 4BEUA 3HPAA 3QV9A 1KFCA 2F84A 1MVYA 3AO0A 3LPPA 3TXVA 3WH7A 3TYDA 3K2GA 1VEMA 3MBFA 1REQB 1PVNA 3UA3A 4HSOA 3U7BA 2WWDA 4GA8A 1E1FA 1KFLA 3M7SA 1Q4WA 1RP9A 4NXSA 1Q2SA 1ZCCA 2C7FA 3OVGA 3P80A 2A7NA 3W83A 1QATA 5AHIA 1U33A 5MF5A 3ABZA 4GRSA 1BYBA 4IZGA 2I16A 4GIYA 4DJDC 4YNGA 1TPUA 4H6RA 4P7LA 3UYCA 1HFBA 3GXMA 1VYRA 1EC8A 1S5MA 5M2FX 1I2QA 5C7VA 4IFRA 3S2MA 3ITCA 2PMQA 5I00A 3E49A 2OZ3A 2Y7EA 4DF0A 1NDVA 1M53A 1QI4A 5K7JA 3KOFA 1AJZA 4HPXA 1TWZA 1EO7A 4MJMA 3T0CA 3HGOA 1UKQA 4OV4A 1LG2A 1PCKA 5D2YA 3LNMA 3E0FA 4ZR8A 5F2IA 3THCA 4HYRA 3KRBA 2Z2AA 1GOMA 2IPWA 3SDOA 1D2KA 3OBAA 1Q85A 4AC1X 3UZXA 3N6HA 1ECEA 4XZMX 3UNTA 2H90A 3XIMA 4OOZA 3ZFHA 2FPYA 2A7RA 1JRBA 2BY3A 4DJEA 4HNCA 5LIKX 1G4EA 4N9CA 1V0LA 1OZQA 2ACQA 4A35A 4LCRA 2Z4GA 5DCBA 1V7YA 3MHUA 1A5CA 4BA0A 3CZGA 4V28A 5EPDA 4QNWA 1W54A 2VKZG 4RKAA 5BROA 2JBMA 3IVSA 1D7FA 2VRKA 1RY8A 3KUMA 4PRRA 1W1ZA 5EU9A 1PL9A 4BWLA 4KRUA 5HXMA 4YTQA 1REQA 3D47A 4JAWA 4FXFA 2X40A 2ABBA 3S5NA 3BLPX 4BQ2A 1R7AA 2C8NA 2ZXQA 3OQEA 2F61A 1XLBA 3SUTA 4C7GA 3BW3A 1VPXA 1W9DM 5CC5A 4EXBA 5MKGB 3WD0A 3O8AA 2Y7GA 1BVZA 1DPMA 3R89A 2YFNA 1ZJIA 2YZRA 3WYZA 1YDNA 2FH8A 3IRDA 2QT3A 1IEVA 2BBFA 4HK6A 2OGYA 2VDGA 2R6OA 5H8PA 3S1VA 5CPTA 1ISYA 1J0JA 1KQZA 2V5LA 3QYSA 1QO5A 4JPGA 3TJLA 3PSWA 1J5TA 3QSTA 4I6VA 5DFAA 4CNOA 4A4AA 1I1WA 5AYBA 4NSBA 2JGQA 5LXXA 4KS0A 1WKYA 3NL2A 4MIMA 5BU6A 1GKRA 4HA4A 2ICSA 2NQ9A 4V1YA 9XIMA 2F2HA 4O1EA 2OODA 3T8QA 2FVKA 2QCFA 2XH4A 4UC5A 5G4HC 2V3EA 1TWIA 4P5UA 2OX4A 1U5HA 4NZJA 1V0KA 3C52A 3WK2A 5CG0A 2GK1B 4YXGA 3BOLA 3O0KA 4OBSA 3PJWA 3NFUA 1Q4NX 1KFWA 1R86A 3ARVA 3MP3A 4LYQA 2XFRA 2V38A 3TWAA 4A22A 4QFUA 4R34A 3INPA 3T8LA 2VJXA 2WAGA 1G7UA 3FAWA 3HJEA 5LGXA 1BG9A 4M1RA 3CHEA 3ALGA 1OFEA 1E9IA 2O4QA 3V3WA 4KETA 1UB3A 1EBGA 4UOZA 1FCQA 4E3TA 4JHOA 1OFDA 3WQ4A 2EEXA 4HZ6A 1JZ8A 4C6BA 1GVQA 1TQJA 1JRCA 2I7GA 3OLIA 3W6MA 1W8GA 2GOUA 3IJLA 3U2EA 1NVMA 3U4FA 3GYEA 3WJYA 2ZUNA 2Y88A 4JTCA 4MNMA 4HYVA 3VAVA 1K6WA 3TN4A 3GUGA 2C91A 5CPNA 4DWSA 5A69A 1PZ1A 2P0IA 3ISIX 4LAUA 1L6WA 3P2VA 3IAPA 2GUYA 5AB3A 4JGDA 1M9HA 1BGAA 1BSIA 2PC8A 3UJEA 1QTWA 3UWEA 1JYXA 3H8AA 4GBUA 1RVGA 1UH3A 3W7OA 3W7KA 5RUBA 4WY0A 1OD8A 3MS8A 3EYPA 3UFYA 1GCYA 1OM0A 4GIEA 4C91A 1VZWA 2CBUA 5EKYA 2VVSA 1FHDA 3ITTA 1UMLA 2YCIX 3ID7A 3SUVA 1IEQA 3BE7A 3ANVA 3MO4A 1W37A 3SQLA 3EWUA 4NZ3A 1E6NA 3TC3A 3KBVA 3W1NA 2IW0A 3Q4DA 4PGLA 1K8CA 1MQPA 2HK1A 4FOUA 1A53A 2WPGA 1LCOA 1TG7A 4J9JA 1P0EA 3FEMA 2Z6IA 3RILA 1VFSA 4OU1A 4C5ZA 5HMDA 1EP3A 4KW2A 1GJWA 4Q8UA 2ONEA 5GVJA 3GDLA 1DJXA 3WSUA 5A6BA 2Z28A 3C3NA 4PTMA 3MUCA 2QYGA 3QKZA 1Z6KA 1J01A 1FA2A 3CNYA 2BHUA 4HHHA 3M0JA 5HATA 3W02A 2GJNA 3CZLA 3N15A 2WMIA 3CHCA 4OUIA 1E4NA 3W37A 2JKPA 4S2BA 3KP1A 3W24A 4WF7A 3NSNA 2GVEA 1BWLA 2W3ZA 4LNYA 4ML9A 3MCNA 3EDFA 5EB8A 3BMXA 4H1ZA 5H2ZA 4UNKA 2Y63A 3P5YA 5CSYA 1ODUA 3PTDA 4ECLA 1U1JA 3NQBA 3DERA 5HK4A 2FPTA 1IWBA 3R0DA 2I56A 3RCMA 3TC6A 3TN3A 2MUCA 1KBLA 4LBSA 3L65A 1BXCA 3RIKA 3IPWA 2NXIA 1TKKA 3FVDA 4QBXA 3PAJA 1HJUA 3VIPA 1C3FA 2R8WA 3G3DA 5TNVA 1PUDA 4MNKA 3QEZA 5HQEA 3PPHA 3ZR6A 3N2TA 3SCWA 4LTSA 1Q7ZA 3KWXA 1UPMB 3W7RA 1WCGA 2Z1SA 2D1ZA 1SZGA 2D22A 3HF3A 1VLIA 1ZL1A 3G18A 1F5ZA 3BMWA 2PLCA 1WUEA 2PWUA 3NO1A 1UPPA 3FKRA 2XN1A 5FJOA 4N02A 5C9RA 1GPWA 5CPOA 4A8RA 1PEZA 3AMDA 2NT1A 1CLVA 3TC7A 4GCXA 1UROA 3NSXA 3TQPA 1RVKA 2V9DA 4GY7A 3AHYA 3WIJA 4N9EA 2NVDA 1K9EA 5IXEA 3OODA 5C7HA 1VP5A 1XLDA 3GNRA 4MB4A 3F4WA 3W88A 3IJ8A 3QN3A 3VD7A 1X8CA 1GQNA 3A24A 3WQPA 2ALDA 2GOKA 2V8ZA 1YXDA 3CPGA 5FJUA 3QYQA 4Q22A 3VX1A 3ZR4A 3P3BA 4W93A 4UQBA 1EWEA 1SMAA 3A9IA 1FDZA 4PTWA 3TCEA 3ZQ9A 3WN6A 3CO4A 1TMQA 2IQTA 1F74A 1YADA 3LPGA 3BGGA 1IR1A 2G37A 3VU2A 2OQHA 4GYFA 3REQA 2WNWA 2V63A 3AUOA 3TJXA 1HXJA 1W5MA 2ACRA 3RMEA 2F2KA 3PANA 3H7RA 4IG2B 3ARTA 2XFFA 3PC0A 2I17A 1K03A 3DFTA 1TTIA 4ACYA 5E09A 1K9FA 4FNTA 1Q7QA 7A3HA 2PB1A 2QGHA 4HN8A 3MYPA 1IIHA 2VEFA 3UCQA 2J74A 3M0ZA 3VCCA 1VRXA 1EOMA 1B5TA 3UJRA 3SCOA 4WKAA 1GT8A 3GKFA 3C5QA 1H0IA 3E2VA 2Q6ZA 4BHYA 1VCGA 2AMXA 3W7GA 2X2GA 3BGAA 1WAUA 4JTQA 2E67A 4Z0SA 1SGJA 3IARA 5I07A 1VAHA 1XW8A 3EBVA 4GO9A 1YHTA 2I5IA 4U3AA 1FWHC 4DO4A 4LAMA 1QNVA 1SW0A 3QOMA 2ZTJA 5FL1A 2W27A 2QCEA 1XLKA 1OC6A 3A47A 3B3DA 3G0XA 1NDYA 2V81A 2AL2A 4ADTA 2Q8LA 3IIPA 2ANUA 4IIDA 1KM5A 1BLIA 2H6RA 1XCXA 4TIMA 2R1LA 3P67A 3KRSA 2J8GA 3GXNA 4M6QA 3SY5A 3K30A 2H9AB 5AZ0A 1UP3A 3S1UA 4Z1YA 3G6LA 3MHGA 3OP2A 3HFYA 3L7RA 5FEPA 3WBEA 4AW7A 4PCPA 3V0TA 3TE9A 3GTHA 3KL3A 4ZENA 1GKPA 4AD1A 2TPSA 3LXCA 3KTSA 4I9MA 2ZRZA 3CL6A 4YPJA 4JFTA 4NZ1A 4FXJA 4MB1A 1YX1A 3U57A 1V08A 4WD0A 5ABFA 4TV5A 2ACSA 3PTKA 4L9YA 2RGLA 2CLMA 3A3WA 4B3LA 2WMIB 4B2DD 3H4GA 5LGZA 1CXLA 1JPHA 1N55A 4JNYA 1LBLA 3J7HA 1YDYA 3TSBA 4YCPA 3GG8A 2Z7GA 5FACA 5D2WA 2DUAA 3VNIA 2W91A 2G4FA 4OFCA 2BXVA 3EDEA 4DUVA 1N7KA 3AU6A 2L5HA 1XRTA 3GY1A 4TTGA 5L6UA 3PUDA 4XAPA 5KETA 3T09A 1VF8A 2QMKA 3HOJA 5IRPA 1QW9A 1K8YA 2ATMA 6TAAA 1S5WA 4BY3A 5IFTA 3VDHA 1ODZA 1HJVA 1YNQA 3O06A 3PBGA 4U10A 1RA0A 3GDMA 4IF2A 4HOWA 1DJIA 1FBAA 1MFVA 1GORA 2VC5A 3N6JA 4TVDA 5F2MA 5K9DA 3O7UA 5DEZA 4B90A 1XJBA 3BK0A 6TIMA 3QTGA 3STFA 4K7YA 4YN5A 4EP8C 1H63A 4GI8A 4DELA 5A3HA 1B9ZA 3WFLA 2VFHA 2D3LA 4H00A 1UHVA 2VDIA 3VUSA 4LS1A 1ICPA 3HQOA 4AZCA 3OIXA 2CITA 3NSMA 4ML4A 4X63A 4LALA 3W7QA 3D46A 4ZQPA 5K3VA 2DY3A 4JFSA 3HA1A 2WNNA 3KZSA 4KGLA 3W2MA 1JYVA 4NASA 1P1MA 1I0BA 3Q37A 1IYXA 3Q94A 5ECUA 1P1XA 3DH7A 4RLIA 3OZMA 3EDDA 4JFUA 4WUIA 1FWNA 3W81A 3OA5A 3MY9A 4LCQA 2XFWA 3W6LA 2OFJA 1DWGM 1YPXA 1DIDA 4GJIA 3N6QA 1VJSA 1YW1A 4LH8A 1MSSA 4YLWA 1VS1A 4I5UA 4ZO6A 2YL9A 3N19B 4FZIA 2NX1A 1F4AA 4L65A 3WH5A 2YA0A 2VGGA 3FHAA 3AOFA 3W7DA 2BP1A 1V0NA 4G7EA 4GI9A 2ZRWA 3IK2A 1MUMA 4MB3A 3YPIA 4KWWA 1GZGA 1IEXA 1OX6A 1Q6OA 1E6SM 1W1YA 3VGHA 3G0UA 1JUKA 4C6JA 5KTLA 4WVXA 2E0PA 2Q3OA 3GVWA 3ZM8A 4C6LA 1GTHA 2FPVA 3POCA 3SBFA 3U5YA 3OZPA 3UWUA 4ZZ9A 4A3YA 4XVDA 1QU4A 3BJTA 4XBSA 1J6PA 3ZT6A 3TXZA 3VE7A 3ZLHA 2OLHA 4QCFA 2Z00A 4PMDA 5REQB 3GVRA 4E2DA 2G8ZA 3APGA 4GQ0A 1JCJA 1VFUA 1ISWA 1KV5A 4CNTA 2Y0FA 1X1NA 1KM4A 4MKVA 4O13A 1C29A 1KTCA 4IWWA 3PG9A 2A3LA 2HE5A 4KFNA 6ALDA 4R88A 3OJGA 3UT0A 4O10A 2PDLA 1X8FA 1VIWA 4MDPA 3W70A 1SPQA 4WXYA 3BLKA 3GNXA 3RX3A 5I3JA 4F9JA 1XSKA 4W7WA 2EBNA 4C90A 2PDMA 1UD2A 1UUMA 2FH6A 1LWIA 3QQWA 1OCNA 3S9ZA 4MY9A 1V3HA 3L4XA 4JTLA 3N73A 5K9CA 1GVYA 4Z1BA 3VMPA 1SJDA 4XIAA 3E96A 3WELA 1WDRA 2VZUA 2ZICA 4XZHA 1DWAM 4UQAA 3CUHA 1PZ2A 4F79A 4UXDA 2D0FA 4PFHA 1C8YA 2J47A 2VC7A 1PX8A 3QSRA 1PSCA 1CWYA 4UCGA 4IMAA 1O1HA 3EKZA 4AQLA 3BARA 4UFMA 1OC7A 5LNRA 1JDDA 2JALA 4S2CA 3AIWA 3B8SA 2ZYFA 4EOUA 2QQ6A 1BQCA 3ZJ6A 3VKBA 3BMVA 1XINA 4LPCA 3F4DA 3QPZA 1B3XA 4IL2A 1M3UA 2DJLA 4GOAA 2JKAA 2HDJA 4NL1A 1I1XA 1CX9A 1LUCB 2YL6A 3WLOA 3VD3A 3KEHA 3LHVA 4QR6A 2NX3A 3WD2A 1NELA 1JL8A 4QLLA 3N4FA 1TMHA 4AWSA 2YCJA 3EOEA 3CAWA 4EWJA 1E15A 5EMJA 1U22A 1P7TB 1PHQA 1WV2A 3RN6A 2V5CA 5HPCA 4PMZA 3RLUA 1MI3A 4CQBA 3BLIA 4K8HA 4ZA0A 2Z1BA 3DUGA 3TV8A 1IGWA 3ES8A 5CG7A 1EQPA 1UWRA 2QV4A 3U6WA 4ZFMA 4X9YA 9CGTA 3CUZA 2O92A 2X05A 1Q63A 1H50A 1TPEA 4F9DA 1YTEA 2XPKA 3FY1A 2PCQA 3DCPA 4GJ1A 2VX6A 3EDJA 2JFEX 3VINA 5FF4A 5D04C 3M0YA 4KFPA 4GUGA 4ZQNA 2R1PA 3LXBA 1GG0A 1H51A 5JXQA 4IIGA 4R33A 1J93A 2EAWA 5CJ5A 4RCXA