1QRQA

Structure of a voltage-dependent k+ channel beta subunit
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
b'LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (KV BETA2 PROTEIN)
publication title Structure of a voltage-dependent K+ channel beta subunit.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport
total genus 117
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qrqA00
4GA8A 1X98A 4EXAA 2FZ8A 1S2AA 2QXWA 3CAVA 4EXBA 1UR3M 5AZ1A 4JTAA 4PMJA 2IKIA 2PDWA 1EXBA 4PUUA 2IPGA 3FX4A 3GUGA 2WZTA 2CLPA 4I5XA 3WBWA 4WDXA 2PFHA 4L1XA 2F38A 1Q13A 4GABA 2PDCA 1RY0A 2ACSA 3CMFA 3U2CA 1IEIA 4LBRA 1LWIA 3V0TA 3LZ5A 3B3DA 3UWEA 1EL3A 3R7MA 1T40A 3R94A 3UP8A 4WDUA 3UYIA 3N2TA 2PDJA 1Z9AA 2HVOA 4RPQA 2HEJA 2PDLA 1SM9A 2INEA 2NVDA 3S3GA 2PD9A 3LNMA 3WBXA 4Q7BA 4H8NA 2DV0A 1XGDA 5C7HA 1RY8A 5DANA 1XF0A 4LAZA 3RX3A 3V0SA 2ISFA 2IS7A 5KETA 2BGSA 3ONBA 4WRHA 1PWMA 2ACQA 3M64A 2ACRA 3C3UA 1HW6A 1R38A 3UGRA 3V35A 1Z89A 1C9WA 2F2KA 4XK2A 2IPWA 2BP1A 2BGQA 3ONCA 2P5NA 4R9OA 4JIHA 1OG6A 4QR6A 3UZXA 5JH2A 3UZYA 3CV7A 4JQ1A 2PDMA 1YNPA 1ZUAX 3MB9A 4XVDA 3LZ3A 4PRTA 4PR4A 1EF3A 3MC5A 2AGTA 3F7JA 1QRQA 4XO7A 4DBSA 4JQ4A 4PRRA 3UZZA 1VBJA 4PUWA 4H7CA 1AFSA 3DOPA 4DZ5A 4JIRA 4Q3MA 3EB4A 3R58A 2IPFA 3H7UA 3WCZA 2IPJA 3WG6A 4YVPA 3CAQA 5HNUA 4ICCX 3R8HA 3GHUA 1X97A 1AH4A 2PDKA 3LBOA 2PDNA 3DN5A 2FZDA 1ZQ5A 3CV6A 3M0IA 1S1RA 1EKOA 1YE4A 4FAMA 1Q5MA 1T41A 3WBYA 1LQAA 4JTCA 4ASTA 2INZA 2IKHA 1K8CA 4XZLX 1YNQA 4XAPA 3UZWA 4GCAA 1IHIA 3LQGA 2PDGA 2FZ9A 5JH1A 3GHRA 1PZ0A 2FGBA 4GQGA 3NTYA 3R6IA 4YVXA 2HE5A 1MRQA 4YVVA 2I16A 2PD5A 3Q65A 4IJCA 4QBXA 3R8GA 1MI3A 4XZMX 4AUBA 1AH0A 4G5DA 3N6QA 4HMNA 3V36A 3UG8A 2IQ0A 4LB3A 5HA7A 4XZIA 4JTDA 4FZIA 3Q67A 5LIUX 4LBSA 4GACA 3H7RA 4ZFCA 2IKJA 3CASA 4XVEA 4YU1A 4JQ2A 1S2CA 4JQ3A 3RX2A 2HDJA 2PDQA 3COTA 3R43A 1M9HA 4F40A 2PDYA 3LN3A 4MHBA 2PDBA 2PDIA 3LEPA 2ACUA 4OTKA 2A79A 5LIXX 1PYFA 1US0A 4WGHA 4JTRA 4WDWA 4FA3A 4QXIA 2PDUA 1YE6A 1AZ2A 1RALA 1Z8AA 3GHTA 3V0UA 1JEZA 2HVNA 2HE8A 1AH3A 3G1RA 3GHSA 2PEVA 3LD5A 4LAUA 5HNTA 4GQ0A 5LIYX 3D3FA 3G5EA 3P2VA 2IQDA 4JIIX 3BUVA 3BV7A 2DUZA 2FVLA 3QKZA 2PDHA 5LIWX 1FRBA 3O0KA 1VP5A 2PF8A 4DBWA 1QWKA 3ERPA 1PWLA 2PZNA 4JQAA 5LIKX 4QX4A 1Z3NA 4XZNX 4XZHA 1ZSXA 1ZGDA 3BCJA 1AZ1A 3KRBA 2DUXA 1XJBA 2R9RA 2VDGA 2J8TA 1S1PA 1PZ1A 3LUTA 2C91A 2PDXA 3O3RA 4NKCA 4WEVX 2NVCA 1HQTA 1MZRA 3LENA 1X96A 4XO6A 2HV5A 4GIEA 3EB3A 3H4GA 2IKGA 1GVEA 3VXGA 2FZBA 4LB4A 1ADSA 2PDPA 3UFYA 5M2FX 4WDTA 2I17A 1A80A 4L1WA 4IGSA 1J96A 3LQLA 2PDFA 2ALRA 3FJNA 2R24A 4HBKA 3T42A 3EAUA 4YS1A 5AZ0A 2WZMA 4JTQA 4IJRA 3BURA 3RX4A 3M4HA 4FALA 4DBUA
chains in the Genus database with same CATH superfamily
3RYSA 1XYFA 4GNJA 1AD1A 1DQWA 1JR1A 3CAVA 1WPCA 4EXBA 3EWDA 4AYSA 4PUUA 2DT1A 4V28A 2OZ0A 4DVOA 1QNSA 4O17A 1YTDA 1LOQA 1N8FA 1CB7B 3D46A 2NQ5A 1MQQA 2VEKA 3WIJA 1FHVA 2Y63A 1EJXC 2F38A 3OTRA 1JYXA 1RY0A 2Y8VA 5HJXA 5CSUA 3VOGA 1E56A 2BHYA 3LPPA 3GM8A 2CLIA 5EY5A 4TVUA 2H90A 4FNSA 5K3VA 1SFSA 4LF2A 1FDJA 2Z1WA 3TQVA 3W7JA 3ZLGA 4B15A 2Y7DA 3QSRA 2OOFA 2QUMA 4JX6A 4K8EA 2X1SA 3F4NA 3N9KA 2HEJA 1I2NA 1JCTA 2A85A 3TZFA 1TPUA 4GKTA 2FTPA 1J5TA 1IT0A 3N4FA 5CAHA 3T9PA 5BRPA 4FEZA 3VKBA 1VFHA 3C3UA 3NPVA 3PBYA 4B5XA 2ZRZA 3IIVA 3U6WA 1CDGA 3BL3A 5F2GA 4BF7A 2F2KA 3G0UA 1J0IA 4ORIA 1P7TB 2XSBA 1QOQA 4G7EA 4ZMGA 4C6BA 1OD0A 2Y1HA 2EEXA 3QR0A 1DE5A 4AD3A 5GPRA 3E9AA 1V77A 5BOOA 2D69A 3OIHA 3QBUA 5DXXA 4XVDA 1R0MA 1RBLA 3CQKA 1VS1A 1M1BA 3P8JA 4UQ9A 1TX2A 1BF2A 4O15A 3WQ8A 4CN4A 3WF0A 3I6RA 4GY0A 2TPSA 4PUWA 3S1WA 2GJLA 4H7CA 3EX6A 3OU8A 1B3ZA 3E0WA 5HUPA 3GTHA 4KCUA 3WCZA 3EXTA 5FIPA 1OFOA 2WKLA 5A3HA 3M0LA 1V3HA 2WV8A 3F5LA 3O16A 5BRBA 5HNUA 1EEPA 4QGCA 3BLDA 2OX1A 3NUKA 1YBQB 1KFCA 1ZQ5A 3DHPA 4E4PA 1PZ2A 3LXBA 3UBPC 1S2WA 2Z6IA 3G6MA 1OZMA 3DG6A 1EX1A 1IYXA 3UXAA 2PCQA 2WOQA 4HNCA 3WLHA 2W66A 3WBYA 1D9EA 1LQAA 1JCYA 3SCQA 2CNCA 2WO5A 3BLIA 1R7OA 2HPMA 1OT1A 3S6DA 4XAPA 2FB3A 3CL8A 4GCAA 2PGRA 4N9BA 4BQ2A 1PBGA 3M0VA 1VEPA 3BGJA 3SM0A 2X42A 3BAKA 1W3TA 4FXRA 3GXTA 1Q6DA 1QNQA 2REQA 2DW6A 1ZB5A 1KFEA 1PIGA 4A2RA 3N4EA 1NWRA 4YVVA 3WLIA 2Y5SA 2FPYA 4KEMA 1AL8A 4LYRA 5JU6A 3W24A 3QRHA 5CJ5A 2I9EA 2OX4A 1DIEA 4JTDA 3B4UA 1CZ1A 1F9CA 3GNRA 2OODA 3VGFA 4R7WA 1ISXA 1OFAA 3UJ2A 1PL9A 3TUUA 1CGYA 4V2XA 1FCQA 2XIIA 2QQ6A 1S5MA 1QK2A 1NH6A 1B54A 2ZWZA 2W79A 3E0LA 3N19B 2D20A 1DJQA 5CZKA 3UR8A 1YDOA 1ECEA 1TZ7A 3CUFA 3L4UA 3AXMA 1KA9F 2Q8LA 5G2WA 1VYRA 1XRSA 4CQ9A 4QDPA 5EFFA 3C2FA 1OX4B 3F4WA 2VRQA 2BLEA 1T96A 3PZGA 4PRWA 2Q01A 1AZ2A 3TEVA 1OGSA 1UKSA 1IWPA 4AHQA 1A5OC 4QEEA 2TYSA 1YXDA 2HE8A 2JIEA 2GSHA 1K8ZA 4QNEA 4UOQA 4B5NA 1ZJAA 1VD6A 3GS6A 2R94A 3KBSA 3OZYA 3M0JA 3BJSA 5BOEA 2J6XA 3AFBA 3P2VA 3USBA 1Q6CA 3E02A 4GGBA 3CMGA 3TV8A 4FF7A 3NZGA 3BV7A 1XG4A 2W62A 1JL8A 2GGEA 5I02A 3WDRA 3BE7A 1FRBA 5CLWA 1CXIA 3K8MA 4P61A 3GG0A 4C5ZA 4R5EA 2PZNA 1UKQA 4N2YA 4KPLA 2CC0A 4MNKA 5CEWA 2VWSA 4MKNA 3S2NA 4GGHA 1HJUA 1EO5A 1QWGA 2C1IA 3BO9A 4OHQA 3CZEA 3APGA 3TC7A 2ZE0A 3RLHA 4A3QA 4H9UA 3VI2A 1M3UA 3C86A 1YTEA 2PTDA 4WEVX 1C8YA 1FWCC 1GT8A 1E4IA 1SYTA 1W1TA 3UESA 5L9FA 1HG3A 2VZVA 5DFAA 1E3ZA 1BQGA 3T0TA 2HMCA 4DWSC 3ATZA 3LMZA 4CEXC 1DE6A 5AY7A 2E7FA 3W01A 4HNVA 2YCLA 1KM5A 4YTRA 2E68A 3EKGA 1B30A 2QUNA 1BKSA 1UROA 4JY8A 4ZQOA 1R47A 1Y0EA 5I7GA 4KWOA 1MZHA 3GVGA 2WZMA 1BPLB 1UD6A 4IGMA 4QG9A 1GEQA 4DJDA 4IIDA 1IGWA 3BURA 1QCWA 3TSDA 4W93A 4WGXA 4Q8TA 3E2VA 3EOOA 3PN8A 1UPMB 1GVRA 1XBVA 3NURA 3TQPA 2RDUA 5M5DA 9XIMA 3TW7A 1DTNA 4LRSA 3QKEA 3B8SA 1UWRA 2VEPA 4XZWA 5I77A 1XLGA 2Z1XA 4AEFA 3PSWA 4OKDA 3CBWA 4LNYA 3L9CA 1M01A 4JTJA 2JE8A 1ME7A 4N6FA 1BSIA 1BWVA 4HB7A 4ZB2A 2VC7A 1RVKA 2ATSA 4F8XA 3ZJ7A 4GUFA 3EB2A 2E6DA 3S1XA 3UG5A 4CGTA 3TC6A 3R7MA 3CB3A 3ARSA 4JKKA 3R94A 2PP1A 3A4WA 2X16A 3NNTA 4Z1AA 3NJ3A 3I3EA 5JVLA 1ZALA 4KGLA 3WDIA 3U3HA 2E40A 5DMLA 2PD9A 3QMRA 4DAFA 1K9TA 1L8PA 3RR1A 2V5JA 1KRBC 2OFJA 1XD0A 3WD1A 5GQBA 5BMXA 3CZ8A 4D6FA 3V18A 2GVJA 3V3WA 3ARQA 3GAYA 1XH2A 1JZ7A 5CJMA 2YSWA 5CZTA 1A0CA 3B0UX 7XIMA 2BP1A 3ONCA 1W17A 4MDPA 1X1NA 4DXXA 3VGEA 1LM1A 1ZBVA 2ZTJA 2H3BA 3I4KA 2A3LA 4DAIA 1XIEA 2VR2A 2BXVA 3FY1A 1F8MA 3FHAA 1JPMA 3PUGA 1PIIA 4E38A 2AGTA 3W7EA 4DBSA 1H2JA 1NDZA 8A3HA 4U3CA 3VC5A 1QMLA 3H53A 1WV2A 5HATA 4H41A 1UP0A 1TVPA 3L7RA 2CESA 3WLSA 2J7GA 3WNPA 1KM0A 2J9XA 4DO6A 1A50A 1F7BA 2V38A 1C8QA 1FY6A 3C2YA 4DLFA 1P1XA 5BMWA 2CZEA 4LUTA 2CXGA 1RPKA 5D8WA 1H49A 3M0IA 2DVUA 3OQEA 4A29A 1OIMA 1NARA 3CS2A 4NHVA 3HA1A 4ZQPA 5ECVA 5AECA 2IKHA 3BG3A 3O9NA 1OCQA 1VJIA 2UZ9A 7REQA 2X0HA 1GPWA 2WWDA 1KD0A 3CPRA 3VAVA 4KFOA 1EB3A 4PYSA 2UY2A 2GQAA 1AA1B 4TTUA 4DBDA 3SRKA 3VKDA 3I68A 2I16A 1PSCA 2WB5A 3QOMA 3GH5A 3PP7A 3R8GA 4UFJA 3BGAA 4IFKA 4PUMA 5IBXA 3SO7A 5TF0A 3N3MA 4D6JA 3L21A 1YLVA 1XLLA 3WJSA 1H7RA 1HJWA 1PIFA 4J9JA 3NSNA 3IIOA 4GZEA 1F6YA 2VKZG 3VIHA 3WQWA 2QR6A 5LSMA 5FAJA 3KHDA 1WZMA 5AHEA 3ZQ9A 3EZ4A 3W7KA 1TV8A 1XYZA 2O9OA 4HSOA 4ZB0A 3AO0A 2ZZ4A 3OLIA 2V5LA 1JNDA 2VZOA 3E12A 1M9HA 2PDYA 4PBEA 4HPNA 2Z2AA 3VD4A 5F1UA 2A79A 2X2GA 4EP8C 4BQ3A 4PL2A 2D3LA 4KFNA 4WGHA 1PHWA 3IGSA 4WDWA 3CPUA 2PAJA 5AC5A 4LEQA 5TAOA 3S6OA 3V0UA 4OJYA 1OCNA 2PEVA 3S1UA 3T7VA 1WCGA 4HK7A 4UZUA 4DYEA 4O1FA 3NL5A 1NM9A 3OB8A 3UYCA 3CEUA 2YA1A 1TTPA 3PPCA 5BOFA 3ZT7A 3R10A 1Q2RA 3BAIA 1T7LA 1GZJA 3VX0A 4Y90A 2YDRA 3T6CA 5DCDA 4HU4A 2I1OA 1VLIA 3P8IA 5AHFA 3VDHA 5M1TA 2NQ9A 1EP1A 1H60A 3HGOA 3BLPX 1D7FA 2RGLA 1B1YA 2YIHA 2B0MA 4EK7A 1X7FA 1VPQA 4M7TA 1O60A 1GOIA 4RDZA 1RZMA 1O12A 4W85A 4AMCA 4IWWA 3HG4A 3OZMA 1GGOA 4ES4A 2ON3A 1LRNA 5A6KA 3O05A 1LL6A 3PBWA 3UETA 1UKOA 2J78A 1OIFA 3DYOA 4PTXA 5MKGA 2VFIA 4PCSA 2O4QA 1WKFA 3ABRA 5HXMA 1E4LA 1Q6FA 1PZ1A 3NA8A 1KM1A 1ENUA 3NZRA 4A21A 3V5OA 3N11A 2UY5A 2WQDA 3BAXA 5CAKA 4D6GA 4JFWA 5E70A 3RGTA 2QUTA 4PMRA 3ME3A 4ZQNA 4LCRA 4BEUA 2AMGA 1JQVA 4M8UA 4ZE4A 5LA0A 1A80A 3FKRA 3ITGA 4M19A 4XAZA 3QJAA 1M7JA 1MW0A 4Z1BA 4DBUA 1VJSA 3VGHA 3E2QA 4B4HA 3F4DA 1S2VA 4HCHA 4ZB5A 3VNMA 1S2AA 4Q4PA 5B80A 2JEPA 3NDYA 1LTDA 4R7OA 1OG0A 2ZRXA 2C14A 2ZDRA 3CHVA 3CZLA 2WANA 3NL3A 5AYZA 1S5WA 1M03A 1TV5A 1EBHA 4C6PA 4UOJA 1HTIA 2BY1A 1NP0A 4ZVJA 4LWWA 2ACSA 2FZNA 1PX3A 1F3EA 2OTDA 2QCLA 5IHSA 1EDTA 4LBRA 1LLOA 1L2UA 1V0KA 3AZTA 3MANA 2DW7A 3WQFA 5DO8A 4X9SA 1QOXA 3VUSA 1GVOA 2FFCA 3UWYA 3WFAA 4PMOA 2EF9A 1Q7ZA 2WQPA 2P3ZA 2I5GA 3DC0A 3WEZA 1EQPA 4AIBA 1VHCA 5RUBA 2PWDA 3W2KA 3SGGA 2QF8A 4ATDA 4PFHA 4MVAA 3RX3A 1L6WA 3D3AA 3CUHA 1V3IA 4HTBA 2VTFA 3Q4DA 4REQA 3NQFA 4O1CA 4OIFA 2BGSA 3ZO9A 2QKFA 2ACQA 2HXTA 3PSVA 3DG3A 4A8IA 4F2BA 1ONRA 1DQUA 3ZSTA 2YXOA 2P8BA 3HG5A 2D1ZA 3BSGA 2PGEA 4MNJA 2OLHA 1BEUA 1JZ4A 3TYZA 5CC6A 5AHIA 1OYAA 3KBVA 4PB3A 1JFHA 5FACA 3I65A 1QOPA 4ZOBA 4KWVA 4PUEA 1TUFA 4FPSA 1KGXA 3TOPA 3VUPA 3G6LA 3EWXA 1I4NA 3PG8A 4LRTA 4S3AA 1KRMA 1FTXA 2J4GA 1V08A 2GOUA 3WQCA 3DEQA 4WY0A 1QU4A 2OPJA 1JZ5A 4LXFA 4PRTA 3ARRA 1BXNA 2PTWA 2YLAA 4ZQCA 3GNPA 5KINA 4DJED 1ITUA 3FXGA 4XZBA 4GISA 3MV11 5D2TA 4O54A 3OA3A 2DQWA 2EPNA 5DBUA 2GDVA 1TQXA 4I9JA 2X40A 4JIRA 3REQB 3NVDA 3KWSA 3B8WA 3IGUA 1L9WA 3A9BA 4E2VA 1V3LA 3ITXA 4UIOA 3RNDA 4J3VA 1B3XA 3FEQA 4Q6JA 5DF0A 1SZFA 3W7RA 1TQJA 3W73A 5K9CA 5EMLA 3RO6A 4ZO6A 3MHFA 1UR0A 3LXAA 2CLOA 6PTDA 3ID7A 3S9ZA 3S6TA 1EKOA 1EHAA 2I7GA 1YE4A 4FX6M 1U33A 3WUBA 5TNVA 2WZIA 2QDGA 5E5CA 4MB4A 3G8RA 4GRSA 1JRBA 4DJFD 5HQMA 5I78A 4A6GA 2D22A 2GYIA 2AKMA 2EKGA 3MUZ1 1THFD 1WNOA 6XIMA 5CG0A 4GWEA 4AWUA 4B3ZA 1Q85A 4NASA 4F9JA 3W29A 1TV3A 2GVGA 2W92A 3CV1A 3KBJA 1KCLA 2HE5A 4G56A 8XIMA 4IQDA 1I60A 2PZ0A 3HPXA 4XZMX 1XICA 3M0YA 3CNYA 4IUOA 1MNSA 4MF4A 1BYDA 3R89A 1B3WA 4CQDA 3H2AA 3E2RA 4MWAD 1GYNA 3K13A 5GVJA 4LOCA 4ZFCA 1WXJA 2IKJA 4MFDA 4DXKA 4KMQA 1Q7QA 1XWYA 1WE5A 4GH1A 2BVYA 3IJ7A 4E0CA 3TTEA 2UY3A 4FF5A 2IMRA 3THDA 5H8UA 4BI6A 3G1XA 2V68A 4XUGA 4HNUA 4CEUC 2NX9A 4OWGA 3B0YA 4LX4A 3T55A 2PDBA 2PDIA 1IR1A 3T78A 3ANYA 2WMJA 1MW3A 3SUUA 4P2VA 3SSZA 5LIXX 4ZZ9A 4JTRA 1TWSA 4GX9A 2OJPA 2XIBA 3HOJA 1VGAA 4Q7NA 4HU8A 4AZ7A 4WKFA 4ADSA 4D72A 4FX8A 2P53A 2DPEA 4JYDA 3ABZA 2BY0A 1RLDA 3B40A 2YPIA 1E6NA 1GHRA 2DZVA 5FKYA 3A6OA 3AYVA 4HP5A 3TYBA 3PJUA 3NQ7A 2WKGA 1GVSA 2ONEA 3QTPA 1VFSA 1G67A 1HJQA 4HNOA 3JS3A 1Q6QA 1OB0A 1M5WA 5FEPA 3VIKA 4LVBA 4TIMA 4A4AA 4U2ZA 4LS0A 4X63A 3M07A 3BARA 1U83A 3NXFA 1JZ2A 1UKTA 3VDBA 1RBAA 3AISA 8RUCA 1PKLA 1W1IE 1J6OA 2FVMA 1XINA 1OWQA 1GOMA 2VZTA 4LUIA 3TN3A 4AH7A 3BW3A 1ISWA 4ADUA 4LVGA 1CGUA 2ZUWA 1US2A 4GBUA 3TR9A 3B9EA 1KB3A 3CQ0A 3EWUA 1MZRA 3UJRA 3QPEA 3OYZA 2PGWA 3ES8A 2GUBA 1ZAJA 3M0ZA 1QXLA 1CI1A 5DT7A 4GXPA 1A4LA 1J18A 1H0IA 3A4AA 4LB4A 1ZP4A 3LM3A 2CWNA 4WLCA 4GVHA 1REQB 3PB2A 1PDZA 4M6UA 3LCLA 2R1LA 3VIOA 3WUGA 4NAFA 4XIMA 3QEZA 4Q8UA 2ISDA 1JAKA 4R27A 3T42A 1US3A 4LUSB 3T40A 4REQB 4GVIA 1ZL1A 1BVWA 3TAOA 1QI2A 4GA8A 1I2PA 1T8XA 4QE5A 3TCSA 1C29A 3GXPA 6ENLA 1P0EA 4W89A 3DFTA 2XFFA 3WH7A 5AZ1A 4ORMA 2X7WA 2DH3A 1G9HA 4HN8A 4KWWA 3RMJA 4MLJA 1EYEA 1O1HA 4UMBA 5K4XA 3EX3A 1EXPA 1LJYA 3E5PA 3SCRA 4AFYA 2DJLA 4B2DD 1VCGA 3CL6A 4I5RA 3UY8A 4H8UA 4WY0B 2BXZA 4ILSA 5LNRA 2ESCA 2XIOA 2YBVA 3W1AA 1OF6A 2OT1A 5FL1A 2XPKA 4HHMA 2D2HA 4AIUA 3QQWA 3ZR4A 4NIRA 3ITCA 4PCPA 2GZXA 3WX7A 3EDEA 3R5EA 3QOKA 3BLOA 1GCYA 5CC7A 3IAQA 3VABA 3GFYA 1R3SA 4BKNA 1HO1A 4BS0A 3KL5A 2E8YA 3SDOA 4ONVA 1K9EA 1CXKA 3AUJA 3PBMA 3SN1A 1UD5A 3ZVHB 3OHMB 4GIRA 1VFOA 3M0MA 2GGIA 4BI7A 5JBEA 3R11A 4JTSA 4PTMA 3KDNA 1R38A 4G7FA 4HTYA 4P7RA 1Z89A 1GG1A 1FH7A 4LW7A 3BPWA 1TX0A 5BU6A 3GH4A 3TYEA 1TPWA 1EGMA 4R3UA 1CCWB 1Z32X 2YB4A 4YTUA 4IFOA 3DI1A 4RNJA 5A2BA 3VKCA 4O28A 1YYAA 3UR2A 1U5HA 3C2VA 3KUMA 4E4FA 5BXSA 1ME9A 1X8CA 3HMCA 3AHTA 4GVGA 2G37A 3VA8A 3VO0A 4JDYA 5CPQA 4FK9A 3KZSA 3LLDA 3K4WA 1DIDA 2F2HA 1UOZA 1E51A 2D3NA 1XCXA 4MAZA 7ENLA 2H9AA 3PZNA 5BXTA 4O13A 4F0RA 3WG6A 3WD2A 1RXOB 1SW0A 3W75A 4AXNA 4D8AA 3GYEA 1B57A 5I24A 3GDRA 1D7KA 4ERGA 1QPOA 3CV6A 4M81A 1YADA 4Y6GA 3UXDA 4H2HA 4DXVA 4LS2A 3TTYA 1NFBA 3EKZA 3PB0A 5F2IA 1XX1A 4B16A 4H6QA 3GR7A 4F0MA 4P7QA 1KM3A 2INZA 1ZCCA 4XZLX 2Z1BA 3MP4A 3WLNA 4JFSA 2QNEA 2CETA 2G3FA 3LGGA 2PDGA 1I2QA 2R91A 1SO6A 4M56A 2CERA 4AVNA 3NDZA 2ISSA 2OR2A 2C1GA 3GXFA 3GNNA 5C8BB 2PMQA 1UMLA 1WDRA 4RZ6A 3P84A 4N4QA 3MUAA 4DELA 1GYMA 4R7JA 3E74A 3LCGA 5DT5A 4JTHA 5HA7A 3CUXA 4CUCA 4YL2A 3IK2A 3OBKA 4ZSUA 2VX5A 1FP8A 2C0AA 3U7VA 3DECA 5FI8A 4TU1A 1VPXA 1B5TA 4O18A 3GC5A 1EPVA 3CB8A 1XLAA 3W9ZA 4HMCA 4Z42C 1UC5A 3GYCA 4CCDA 5I0DA 4JNZA 1VEMA 4K8HA 4UR7A 9RUBA 4RE2A 1DXEA 5F1VA 3R43A 2P76A 1ZJHA 4NSBA 1JUKA 1FQ0A 2AQOA 1O5RA 4YWSA 3P7YA 1R6WA 4D6HA 1ELSA 3A5VA 4GIYA 4CQ8A 5HQLA 1IIGA 3G3MA 4QTGA 1GPFA 4W9TA 2J7FA 2YOCA 1MEWA 2GWGA 4NZ1A 2O9PA 1BRLA 2RUSA 3MSGA 1E15A 4NG3A 2DZBA 4WY0F 4YYCA 3MQTA 1OC7A 4Y8EA 1NVMA 3GE7A 3HPAA 2PP3A 2WLZA 1KQZA 2P1FA 4QFUA 3GFXA 4DPPA 2JF6A 1MW1A 1N8WA 1HGYA 4XAFA 3BUVA 1IEVA 5FJPA 4AZIA 1FX6A 2GJPA 3SECA 2FVLA 2BSLA 3MVTA 5DX7A 4BF5A 4UWMA 2YYTA 4ZA0A 3GW0A 1SZNA 2DP3A 3DDMA 3I6EA 3A21A 3SFKA 3DFOA 3GXMA 3S5ZA 3EOLA 3WFLA 1FP9A 3HM7A 2GSEA 4ZOEA 1TE6A 3KOZA 3TA6A 4N7QA 1JYWA 4XD6A 3C61A 3GDLA 4Z2JA 3IRDA 3GG7A 3DC8A 3LUTA 5I07A 2QCEA 4JFVA 1PYMA 3LPFA 5AB3A 4H2CA 4RDVA 4ZXLA 1C7TA 4EVZA 1AW1A 2OLAA 3BW2A 3VXGA 2V3GA 1EUNA 1AJ0A 5EFDA 2FTWA 4S1FA 4NQ1A 3SCUA 2BVWA 1J10A 1AMYA 3K8LA 1BSLA 4CVWA 1PEZA 3EXSA 1G1YA 1XIBA 3U2EA 4WKAA 1GORA 1VBRA 3BWWA 1T8QA 1V6WA 3RCYA 2E67A 3C5QA 1UB3A 4A3RA 4ZGYA 1G7UA 3I7QA 2ZRVA 2YW4A 3ARTA 4OU1A 1GKRA 1Q3NA 4JIQA 1E1CB 4NXKA 2QVNA 2OXNA 1W5PA 4WSJA 4TX8A 4GI9A 4JPGA 3VTRA 1W2PA 2JF7A 1KKRA 2PDWA 2VFHA 3OVPA 1Z6KA 3GC2A 3C0JA 1XSIA 1WAUA 1XDLA 3RCMA 4YXGA 4NT0A 4FLSA 4JN7A 1JAEA 4H04A 4WDXA 3G18A 2INFA 3VOJA 2ZOXA 3GDKA 3NQMA 4HPJA 1LDCA 1K1DA 1TZZA 4RPPA 2J7CA 1FHLA 3OGVA 4L65A 1TR9A 4I7UA 1N8IA 3TSMA 3KBMA 1C8VA 1GOWA 1ICPA 2DIJA 4TVCA 1ISVA 2GGGA 3VD5A 3PFMA 3RRAA 1J11A 3MUIA 1W9PA 3JRKA 5AYXA 1E72M 1H7OA 1IXPA 1E9LA 4NZ5A 4DJFC 2WVVA 4WSHA 1ADOA 4EX4A 1XUZA 1UA7A 4HQVA 5BWAA 2VI0A 3B0PA 3TJIA 5CQ1A 1J0YA 3S3GA 4WJXA 1WDPA 5D05A 3WL0A 1O5XA 1ADDA 4YMZA 1BVZA 4JKLA 3NM1A 2Q8XA 3V0SA 4POCA 5JIWA 3NPWA 1J2BA 1OGGA 4V1YA 2PF0A 1LBLA 3ONBA 1LUCB 2R1PA 5E0FA 1CLXA 4G8TA 4RNHA 4GQRA 4C6MA 2I5QA 3QGAC 3UGRA 5FJOA 2C18A 1C9WA 2YL9A 2YZRA 3KS6A 3TK7A 5I23A 1PKMA 3UVAA 1PJ9A 4U3AA 1BYAA 4R53A 2G41A 2ZQ0A 4KETA 2BGQA 4GFIA 1ODUA 3P6LA 5F4SA 4HU0A 3IK4A 2Y5EA 3IV8A 1VLWA 4W7WA 3UG4A 4QR6A 1GUVA 3TVAA 3UZYA 4H9MA 2J77A 4M24A 4RDYA 3NVTA 3ANVA 5BRQA 4J1OA 3SN0A 3VKAA 3FSTA 3I3BA 1GZGA 3U48A 3GDBA 2E1DA 3Q58A 1XFBA 4E8GA 4HT3A 1DOSA 4S3KA 4XD4A 5AHNA 4EACA 1Q4WA 1WXZA 4O1BA 2VDHA 3I10A 2XFYA 3NQGA 4L1GA 3VM5A 2PWUA 3E0FA 2V8ZA 5CPMA 2FPTA 4FNTA 5CBJA 1UCWA 4LCSA 2NSXA 4UTIA 1XKJA 4S3EA 1JVNA 2A7RA 4MNMA 1E4MM 4L9ZA 4HPHA 3R12A 1X6UA 3EMZA 4K2SA 3LHVA 2WVTA 5C9ZA 1ONWA 4K6AA 1H11A 4F0HA 1QHZA 2V69A 2QHAA 4KERA 1DKWA 1V02E 3VNZA 3DESA 4GH3A 5H2ZA 3B8IA 2HTMA 2X8RA 3ZT6A 4QJ1A 2Z00A 5FSEC 1E0XA 1OY0A 4XAGA 4IMCA 4QG8A 2FH8A 2HXUA 2RAGA 3QGKC 3PJXA 3PPHA 1GKQA 3QYSA 2P8CA 3HV8A 5JH1A 3M6DA 3SR7A 3C4UA 4S39A 5AN7A 4WR3A 3EDFA 2GVEA 1ZFJA 3H2OA 1NOWA 1Q45A 4J35A 4B92A 4MLRA 2FMOA 1DQXA 3WQ4A 3TX9A 2PD5A 4H4IA 4JD4A 2WMGA 3N6QA 3V36A 1V02A 3NFUA 1IZKA 2IQ0A 4S38A 1TA3B 3VDCA 1CXEA 4C6EA 1VBHA 1JG9A 1BHGA 1R2TA 3B06A 2YW3A 1JDCA 4PMVA 1XDJA 4MY8A 3KX6A 2RDTA 1MXDA 3B0VC 4DUWA 1TPEA 1LORA 3LI1A 3M41A 2B4GA 1KFLA 2PDQA 2J62A 3B04A 5H91A 4YNGA 1E71M 4S3DA 2G0WA 3W2UA 3PBGA 3SCOA 1FXQA 1A49A 2ZUSA 3VNJA 1UUMA 5DBTA 1J12A 4RX0A 3PZTA 1TMLA 3VD9A 1MDRA 4W86A 5H1WA 2ALDA 1RCOB 3QYQA 2ZZ2A 4PODA 4U2YA 4E3TA 3QHNA 2ZKMX 1GTEA 3A24A 3MSDA 4UUIA 1Y5XA 4PMDA 4S3FA 4J2MA 1RA5A 4DO5A 3NQDA 1UR8A 4AEEA 3SZ8A 2PTYA 1DIOA 1DPMA 4HNNA 4BCEA 1I9CB 1Y7VA 1XFCA 3R25A 4X22A 4QROA 3E5BA 2FJUB 4XTIA 2XSAA 3EXRA 4PL1A 1EGVA 1VIZA 4DJDD 1QVBA 4GYPC 3IUDA 4DWSA 2TSYA 1QUMA 3KAOA 1AODA 1HP5A 3WQDA 1F4AA 4C1KA 3KLLA 1LG1A 4B9YA 3H21A 1I8JA 4BF9A 2NWSA 2XSXA 4MMWA 1CNVA 4LVAA 4QX4A 2BWGA 4UTHA 2V67A 1ZSXA 3MKCA 3ZS4A 1PV8A 1AZ1A 2V5KA 2OQYA 1DXIA 2WCSA 2EPOA 5ENLA 1EA0A 2DT3A 4C6QA 4PN2A 2R8WA 2EJAA 4O52A 4EIVA 3TWAA 3QPZA 3QMTA 4US5D 4YHEA 1WO2A 3FSUA 5M17A 3QV9A 1LF1A 3CQIA 1BKHA 2XH2A 3TOYA 4ZO9A 2ZE3A 3CIWA 2ZRWA 3A5FA 5A6BD 2WSQA 3AYTA 3B9DA 3N15A 5G4HC 2CWXA 2BDQA 2ZA3A 4YJ5A 1BYCA 4UQDA 1C92A 2Z24A 1NDYA 4BQ5A 4Q8NA 1OZQA 4LF1A 5C2GA 4DQWA 3M16A 4IIFA 1U1JA 3W27A 4LAKA 5AVNA 2Y89A 2CLEA 1FWTA 2IUZA 1U30A 3FKKA 4F3HA 2FHCA 4CQCA 1OHLA 1EDQA 4TXEA 3MBFA 5KTLA 1RSCA 1XQLA 3RMEA 4AZ5A 3RX4A 5E9AA 1PKYA 3THUA 4O1DA 4FALA 1OFPA 2VEFA 4U33A 3HN3A 4JL2A 3FGCA 4YTQA 3KTXA 1UKPA 3P0WA 1UW9A 2ZX5A 4PMJA 3URQA 1HNYA 2V81A 2X05A 4H6KA 4DRSA 4XUYA 3R1ZA 4C6KA 3CLWA 4Y9OA 1ZNNA 4R33A 3VDAA 4BHYA 3K4DA 5IDZA 1TCDA 1JUEA 1W6TA 2D0HA 3LS9A 4F0SA 1VCVA 4CNTA 4L61A 3W2JA 3WF3A 1ZAIA 1H5YA 2R1NA 1LWIA 3DUGA 2B7QA 3OO2A 5I06A 4ICMA 4JX5A 3W2MA 1Y65A 4LYKA 2WHJA 2DFAA 2GJXA 2XYLA 1ZENA 5LGXA 3O1NA 1JI2A 1JXKA 4Q8PA 1X8FA 2SFPA 2DT2A 1GQLA 3MI2A 5T26A 1MMFA 8TIMA 3WDQA 3AZRA 3MMTA 1CGVA 5D33A 4AG0A 3ARVA 4IG2B 3OZOA 1WQ5A 1A5UA 5J04A 1DJWA 1NOFA 3OOQA 1JUBA 1KLYA 4F9DA 1T6MA 4Z1DA 1Q65A 3T1GA 4P8VA 3MS8A 1CENA 1P6WA 1JULA 3APYA 4PGLA 4O1EA 5T8GA 3W1LA 3D0CA 1MVYA 5M3WA 4XK2A 5D9MA 2WKJA 3NO3A 3CWHA 2HZGA 3TQ0A 3K30A 2VGFA 1DHKA 3R2GA 1W5OA 4IMFA 4PH6A 1KCKA 4CN1A 2ZZ3A 1TE1A 5M03A 3EPMA 6REQB 3W1TA 3UZ5A 4ZR8A 2AL1A 2Z25A 1OD8A 4FOJA 5GJPA 1A53A 3ALFA 3LV5A 3WJXA 4GG9A 3U4AA 2NT1A 1XLCA 3LZ3A 2DSWA 4MADA 1UBSA 4RLIA 1QRQA 4UBPC 3W3OA 5DCEA 1XIJA 4N4PA 5C9WA 2GK1A 3CQJA 2NUXA 2VYOA 3DAQA 1XLIA 1TSIA 5TBOA 2FFIA 4ZBCA 5FJIA 3DCPA 4PCFA 3KE0A 3WD0A 3B8DA 2QCDB 2QJHA 3G24A 3OPSA 3UVIA 5SWUA 2EQDA 2O92A 4HJWA 3TNOA 3P14A 5DRIA 3JUGA 1XLMA 1AH4A 3V5FA 3THAA 3VIFA 5GNYA 1L6YA 3AIRA 1QBBA 1KRAC 1NWTA 4LH8A 3RLUA 3W86A 3QHOA 1KNWA 3M5ZA 4KW2A 3SIZA 3EDDA 1XCWA 3BOFA 2YX0A 2OZTA 5A8NA 4MJMA 3IARA 3N2XA 4ZEPA 3S9YA 1CPUA 3TCEA 1Q6GA 4UFLA 2ICSA 3T8LA 1YNYA 5ABFA 2VC5A 2XVGA 3GXNA 3A3WA 2L5HA 3N3TA 2Y88A 1CB2A 3R6IA 1IIHA 1CX9A 4MPQA 2YDQA 3ITTA 4UB9A 3WBAA 3THQA 1J6PA 2G95A 1E6XM 3WSUA 2A1YA 2YDAA 3Q65A 4QLLA 4L6HA 1J0JA 1I2OA 3WQOA 4HMNA 3L4ZA 3R4IA 3TC3A 4U28A 4AIOA 2CBUA 2OU4A 3L65A 2B7PA 3GH7A 3Q67A 3GNDA 2R6OA 1JCJA 1EZ2A 3OIXA 5A94A 4P7NA 3R8RA 2VGBA 4JYFA 2GUUA 2VMFA 1O4UA 4P8UA 1OT2A 4LV4A 1S2CA 1UUOA 3L23A 1VH7A 2WJDA 5K2ZA 4AC7C 5I5RA 4M7SA 3W07A 3COTA 3ZWTA 2VD8A 3OG2A 5LHFA 4PSRA 5BXPA 1JCLA 2NUYA 1KXVA 3WDHA 4JHMA 3WD3A 3S0CA 2Z0IA 3QR3A 3J7HA 4OZOA 1DXFA 1RQEA 1Y5WA 5I3DA 4LAOA 4AZCB 4O0ZA 3K4AA 2WSRA 3M6YA 3FOKA 5CC3A 2VJXA 4JL1A 2O7QA 3CUGA 3W7OA 2OEKA 3GHSA 4LCQA 1UR2A 4NZ4A 3STCA 2Y7EA 3DKJA 3LU2A 4XQ6A 1TPFA 1K7EA 2QIWA 1GQJA 3H23A 1OFBA 2XG9A 1F6PA 1SFLA 1DORA 2FZMA 5CPLA 5XINA 4M6PA 4QISA 1XISA 1PTAA 4AHOA 1DEDA 4IM4A 4ZQRA 2PDHA 4CD4A 5LHEA 3ES7A 3FYPA 4C60A 4L7ZA 4BFAA 2VX7A 4H7ZA 1ZBCA 1WKYA 1JRCA 3GY1A 2XWEA 3GIYA 3S5YA 3WQ6A 1I45A 3SSJA 3QHMA 4HKPA 1H7WA 1EP2A 3TROA 1K6AA 3DZ1A 1KXQA 5FL0A 1EEXA 3S5SA 4GI6A 3PTMA 1W1ZA 3F2BA 1MWOA 1I1WA 5JIPA 2PE4A 3GTIA 3CUJA 5BU9A 4TR9A 1E5NA 2WHKA 2A6NA 1EH9A 4LANA 2A7PA 1HQTA 3GKAA 3N1AA 1B9ZA 1G4EA 1C90A 2HV5A 4O14A 3KHJA 3W71A 3I6TA 1Q6RA 2A3HA 4BWLC 5A6TC 4S3BA 1CECA 2VR4A 4XKYB 4FO4A 3DXIA 1ADSA 1CXHA 2CKSA 1KBJA 3CXOA 3HV9A 2LLEA 2Z26A 3V4BA 5DMMA 4M82A 1ZPTA 3PWAA 1HIZA 3W70A 3IJ6A 4O4VA 3W6YA 4WUIA 4P8WA 3EAUA 2V3DA 5DXYA 4C1NA 4EE9A 4IJRA 4JS3A 1L6GA 1V3KA 1UWAA 2GFTA 1FCVA 2BODX 2VZUA 4TX9A 2FZ8A 3N14A 3UQNA 2QXWA 1XBXA 3BH4A 5EMUA 3E1F1 5FJTA 4N02A 4EF9A 3GG1A 3MCOA 3P67A 2WMIB 2XUCA 2O9TA 1J01A 5G4EA 3MP3A 1IT7A 1QK0A 4DF1A 2CU0A 3PJTA 3GU1A 3C8FA 4I5XA 2QS8A 1GK8A 2J75A 2C79A 4GC4A 4N9EA 4AZHA 4CD6A 3WYZA 5LA1A 1M7XA 3B3DA 3KS5A 3UWEA 5CC5A 1R87A 1I6NA 4AB4A 1ZP3A 3TKFA 3CHEA 1KM6A 2HVOA 5A69A 2VVNA 1P0BA 2IXUA 3BLEA 3G22A 2GQ9A 2QCGA 3N6JA 1QW7A 2NVDA 1MFUA 1OCJA 3BMXA 2ZZ6A 1SMDA 3OLEA 3PJWA 4KH2A 3KL0A 1WUEA 4XD5A 4QJ5B 4RV8A 1RY8A 4URIA 3RN6A 1CGTA 1VPYA 4P7OA 1V03A 2NV2A 1SW3A 2ACRA 5LNWA 1J8VA 4JBRA 5LGZA 3AHZA 1SMAA 3NM3A 3VOHA 1VENA 4LSBA 3ZJ6A 4PMQA 4WJEA 4ATLA 2CBIA 7ODCA 4MWAB 5DY3A 4JIHA 5FEWA 1DWAM 2OO6A 2Q3RA 3KL3A 4JX4A 1V3JA 4Y9NA 2HBXA 5EB8A 1LQ2A 4HVXA 3W82A 4PTWA 1K4GA 2PRMA 2XIMA 5MF5A 3MB9A 5JMUA 2NWRA 3H26A 4PULA 3O8AA 3SY1A 1PO9A 3W37A 4RXFA 3MC5A 4A35A 4PSPA 3YPIA 5CZ0A 3ZT5A 4IJBA 1FCUA 2P0OA 4MGGA 3URNA 2QJMA 4PRRA 3BW4A 3SB0A 1YHTA 1D3GA 3IIPA 3DGBA 1H1YA 3IJQA 1FWNA 2W6RA 3SRFA 5G1TA 3A9IA 3HTWA 3SGZA 3ARZA 4W7VA 3FJ4A 4O53A 4PCNA 2E09A 4OQVA 3VCRA 1K8XA 2RH9A 3CAQA 3TJ4A 4NP7A 7TAAA 3EDJA 3STFA 2OKOA 2A4AA 5ABEA 4PTVA 5KMYA 3MUXA 1GTHA 1F73A 1GYLA 1ITCA 2YB1A 2Z27A 1DJIA 4D6IA 3QW4B 4L4OA 4LV9A 5LZLA 2TMDA 4LU0A 4PB4A 3S2JA 2YR1A 3WJYA 4XBSA 1TWZA 3BDKA 1L8NA 1EJRC 3FA5A 3GHRA 1ZJBA 1KFBA 3PZIA 3LHZA 1D3HA 4MJ4A 4ZXOA 3NTYA 4ZCWA 3MKKA 3CWNA 4DN1A 3JW7A 3WBEA 4WKHA 1SJCA 1X38A 2EPMX 3E38A 4H9YA 5DN1A 3NR0A 4JKMA 2XFRA 1A5CA 1WUFA 3WLTA 5H8PA 3AU6A 4JIEA 3EX2A 3AIBA 2FQIA 2Y62A 2HS8A 1HJSA 4Z1YA 4C5YA 2CBJA 4CCEA 3GD6A 4GJ1A 4HU3A 1R7AA 1SZGA 3GB6A 3LRLA 1IQ8A 2XU2A 2ZICA 3ITOA 2A2IA 2V0TA 3KP0A 4HZ8A 1KWGA 3QF0A 3AHYA 3VOCA 1OBAA 4J3XA 5HNRA 3P60A 3NPXA 2FLIA 4HYVA 4F0KA 4IXHA 1B0IA 5BW6A 2VO5A 1A5NC 2ZA1A 4D9PA 2PP0A 3UXKA 4MHBA 1J9YA 4GBDA 4RCXA 5I3FA 3LMYA 1RLCL 3KFTA 4UQBA 3MO4A 3EEZA 2PDUA 4C65A 1VEOA 1SO4A 2D0GA 4KCWA 3LD5A 3PNUA 3R13A 3V75A 3W84A 3L4VA 2QAFA 3ZLHA 1MUWA 2G3IA 1CIUA 1W8SA 2FHFA 2VFFA 5LIYX 3N6HA 4KWUA 4GXMA 1SPQA 3G0SA 3IEBA 2C19A 4MTVA 2XWDA 4U31A 1KFWA 5REQB 1LBMA 2P0IA 3E96A 4HMEA 3P81A 3AI0A 4QM1A 1WP6A 4KEUA 4CVUA 4D8ZA 2ZADA 1JD9A 2F6UA 1BD0A 4C1LA 3GU2A 1RK5A 1W9BM 2JEQA 3P3BA 5C2XA 2ZTKA 5LXEA 5D09A 1C91A 3HIJA 3KRBA 3PG9A 1EBGA 4W8BA 4ML9A 4NUWA 7CGTA 2HCVA 5AC6A 2VR5A 4DPQA 3VX1A 3HU7A 1UD2A 2PDXA 1FOBA 1HGWA 3BTNA 3ZIZA 2XN0A 1X96A 1B3VA 4DNMA 4KCTA 2C1HA 4M80A 1O94A 3XINA 2Q02A 2OWCA 2QUUA 4M1RA 4FP1A 3MTWA 3O63A 2VCBA 4QQ3A 3WLOA 1R2SA 3GQYA 4QJ3B 1VKFA 3G77A 4JTIA 5ECUA 4HBKA 4IX2A 2ZIDA 3UR7A 5EGRA 2J88A 5D9OA 2POZA 3M4HA 1JZ3A 3NL2A 3A47A 1X98A 4EXAA 1OVDA 1E0TA 3W7NA 3MP5A 3DHDA 4NX5A 1TJ2A 2WPBA 3AUOA 2RDXA 4LUJA 4MYXA 3M44A 2IPGA 2CIPA 3U2ZA 3EMCA 3STGA 3UW6A 4CNSA 5I00A 3MJMA 2MANA 1XG3A 2F84A 4E5TA 1F4HA 4GABA 5A6MA 5IRPA 3U2CA 3AOFA 1RHCA 4LT9A 1FWEC 1KFJA 2TRSA 3SY8A 3FCPA 5DELA 5EMJA 4WDUA 3W7CA 1C7SA 4R34A 6XIAA 1OYCA 4C91A 1RCXB 3T0DA 3TIMA 2CXEA 4RNFA 4GX8A 1GVFA 4TVDA 4IGHA 4GUGA 3SEPA 3LNMA 4OE7A 3JVAA 1TMQA 5AVHA 3WK2A 1NQKA 3AMCA 1LRTA 4B91A 4Q4RA 3T05A 4N6EA 2KZHA 3G1AA 3W7MA 4Z2HA 3T4CA 4NX0A 1DJYA 3LK6A 5EPDA 3IIZA 1UPPA 4NRRA 1OFEA 4WRHA 2XM1A 2UWFA 4U5IA 3O6CA 4QP0A 4H8VA 1FDZA 2BMBA 2EHHA 1GW1A 2BFGA 2F61A 5HWJA 3V35A 5CPOA 3VDGA 4V15A 4XD3A 1KXHA 4AD4A 4OUEA 4JAWA 1E43A 4MFEA 2YBTA 3AXIA 3G1SA 3WLRA 1GWJA 2R1MA 3CIXA 1ALDA 4R9OA 3W7DA 2XVNA 1PZ3A 2GVLA 4KBXA 1G4SA 4PEEA 4IGNA 2DSVA 4IMGA 3U2OA 1VYPX 2PB1A 4QSFA 1BGGA 3ALGA 3MU7A 4OBRA 1OCBA 3S47A 3A64A 1RR2A 3A4XA 3L2MA 5CBIA 1YPXA 2OEJA 1XLBA 2JK2A 2GSJA 2WK2A 1HFBA 2FGLA 4EAYA 4BZYA 5HUOA 3H7UA 4QLKA 1CYGA 3GZAA 2X2YA 1KBIA 1HL2A 1VIWA 4D1JA 1KLZA 4J2PA 3R8HA 4M0XA 3QXBA 1Z69A 2PDKA 5F2LA 2PC8A 1YTKA 3RPTA 5AFDA 2G3MA 3EWBX 4E3VA 2CZ5A 1DV7A 1UWIA 1J0KA 3BMVA 5CSRA 4YPJA 1PE1A 2OCZA 3BG9A 3PZOA 2OGYA 3CMJA 4JIPA 1XH0A 2VGIA 1ZTVA 2Z28A 5HMDA 1TFVA 3LBMA 2DU2A 3GK0A 5D37A 3QFEA 3RF9A 3WLPA 3N2BA 3H54A 1PS9A 1WBHA 1XIFA 3WJZA 3UZJA 1UMYA 1G4PA 1TZ9A 2G97A 4GJIA 3VIGA 3WH6A 3ZYZA 1DWJM 3CU2A 4EANA 4O8AA 4HNTA 4NJIA 3GLCA 3ITLA 4KESA 1XRFA 4LB3A 5D32A 4JTGA 3WMLA 3WLLA 4ERIA 2PPGA 4US6A 2VEMA 1QI5A 3PHAA 2PCEA 1J0HA 3G2GA 4DZAA 3VCCA 4XVEA 1BFNA 3U4FA 1V3MA 2OMAA 3WNLA 4WXYA 4D2JA 3ITVA 1HVXA 4UTLA 5A8OA 2AGKA 4RE0A 4MG4A 4E6MA 3H7VA 1YXCA 3LBCA 3CZJA 3L5AA 4IP5A 3VILA 2J66A 1XS2A 2DSZA 4M6VA 1KBKA 1K6WA 3P62A 4A05A 4RKAA 2QV4A 3ABQA 3C8NA 3AMLA 4RV3A 1YE6A 3WQEA 4DO4A 3UXLA 1K4HA 3PS7A 3NQBA 4G7EB 1I1XA 1XIMA 1HKVA 5A1AA 1ICSA 1XP3A 2WJEA 3WL1A 2ZC1A 1N7KA 3WLMA 3O07A 2YFNA 4DO7A 3CH0A 3ZZ1A 2IQDA 1A5LC 1O66A 5EBAA 3AJXA 2GQ3A 5GNXA 4ROQA 4KRTA 4TOQA 5AC7A 2D0FA 3BV4A 3FNDA 1TWWA 3LCFA 1V7AA 2DZAA 3BGGA 3ERPA 4UTMA 5LIKX 4LEFA 4FB7A 2VFDA 3U8GA 2Z6JA 2DZPA 5KZDA 2VVSA 1VYSX 1VZWA 1W91A 1V5XA 2HNHA 2WM1A 1LLZA 1S38A 2VDGA 3QMSA 4ZENA 4LPCA 1P6CA 1W3KA 2EG8A 1S3TC 1DHPA 4J7RA 5XIAA 4O11A 3WH5A 4PTDA 4XO6A 3SIMA 2VT0A 5D2YA 3NQ8A 2IKGA 3VVGA 3ARPA 1SO3A 3VMOA 4JEQA 2WHMA 4L5ZA 3T0BA 5G5IA 3GAKA 2PDFA 3SBFA 3MZNA 1KCXA 1XYMA 1ZZMA 4I8DA 2REQB 3MHGA 4JTQA 3NSMA 4U5KA 2X30A 2QGYA 4DJFA 1BF6A 3WUFA 3NGFA 2NX1A 4L6DA 5K9DA 3PR2A 3SUVA 3RILA 4AYGA 2JBMA 4IMAA 4L9XA 4ACZA 2GGHA 3LDVA 3AYSA 1EC7A 4UR8A 3B8TA 4XV0A 1XLEA 4FXJA 1HKIA 3S1VA 4IQJA 3KOWA 1QHOA 1TVLA 2OB3A 2QPSA 4C7GA 3UA3A 3RM9A 2EPKX 3LZ5A 1E1EA 3S42A 4C6JA 1ITQA 5G2HA 1H7NA 2WC3A 5K9XA 3NZQA 1M41A 4C7FA 4I6KA 3M43A 1K70A 1MQPA 2E5DA 5D04C 3TTQA 1V79A 1XIDA 2OO0A 1BWLA 3WBXA 2Y8KA 4PE8A 2AL2A 4H8NA 5C70A 4JHOA 1PCWA 2DV0A 4UNKA 2Z7GA 3P80A 1W9XA 4LC6A 1XF0A 4HPXA 2WAGA 4JTLA 2W27A 4XSLA 3S46A 3WQVA 4W5UA 1PWMA 3GG8A 1FWWA 1EYWA 1G69A 4GUIA 3LRKA 4GI8A 2XDFA 4IF2A 1W8GA 3VNYA 1QPKA 3DERA 2CITA 4J4KA 1DVJA 1E6PA 2B31A 5G1MA 4JDBA 1XQKA 4XZ9A 2DORA 3L5LA 3MZ2A 4NAEA 1AQFA 1XD1A 1HUVA 2HVMA 3RDKA 3FIGA 4Y9MA 2DUAA 2ZCGA 1B31A 3BSMA 3VPLA 3B9OA 1OFRA 1Q6LA 2X1UA 1YNPA 2QVHA 4PR4A 2J25A 3H2CA 3AROA 3GO2A 3HJEA 1W9VA 2AQVA 2WXDM 2J13A 4JN6A 4O8RA 5I79A 3TZNA 5KSWA 5PTDA 2VL4A 1QTWA 1U1HA 1N2VA 4DZ5A 4RE3A 3ZJ8A 5EYWA 3C6CA 2P50A 3RITA 1PCKA 4A3HA 4O19A 1PB0A 5BCAA 2C0HA 3BLKA 1XDMA 3PWIA 1P5BA 4G2DA 2C16A 1NJJA 2WBGA 4FXFA 2VWTA 2YCLB 1MXSA 2QMKA 3TFXA 4AU0A 1S1RA 1KGWA 1GKPA 5C9XA 3GXDA 2O4MA 4FOKA 2Y8UA 4C6FA 1T41A 3WDPP 2PUZA 2TODA 3A4JA 4L9YA 2J7BA 3G8EA 2X09A 1OK4A 4R9XA 4TX6A 2XHYA 1WDQA 4GPNA 1EFZA 2ZX7A 3WZ0E 3N73A 3LTPA 2BOGX 1KFKA 3M7WA 1VJZA 4JN8A 1J5SA 4GE8A 4UQEA 4AEOA 1TIWA 1PZ0A 3RFAA 4UZSA 3MT1A 1DJGA 2WNNA 1NWSA 2H8XA 5LNUA 1YDYA 1KCZA 1MRQA 4B90A 1O1ZA 5TIMA 3U57A 4J28A 3FJLA 4IHCA 4RUBA 3WD4A 2E28A 3KOFA 3P5ZA 4G5DA 3CJPA 3MMWA 4IP4A 4ZTXA 1S46A 4DWSD 4OFCA 5C6MA 4HOWA 1G6CA 3PZQA 4M6QA 1LL4A 3W6MA 2VM8A 2E9MA 1LT8A 4CKQA 4B2DA 4FS9A 1F61A 4UTWC 4GLEA 1ZRQA 1W3LA 4GYPA 3GKFA 3QV7A 2DVXA 1VBUA 3RM8A 3OLGA 4C6LA 1VC4A 5CPSA 2ZFAA 2OT0A 3MMDA 4OTKA 3VIPA 2VENA 4QNWA 2YL6A 5CKSA 3EEGA 2EPLX 3O0FA 3RU8X 1US0A 4GINA 3T2QA 4WX2A 4QXIA 3TTSA 1B4KA 1C3FA 1O5KA 1UH4A 4MYAA 4FIQA 2QW5A 1UC4A 2V3FA 3G1RA 3MCMA 4IPJA 2BOFX 3UERA 4ERAA 3NWRA 1XKYA 1F8IA 3RRXA 4GQ0A 2J47A 1SR0A 1TELA 4Z2IA 3W26A 5HPCA 3CH9A 3DU0A 3F4CA 2CKRA 4GQQA 1WKEA 4B3LA 3HPFA 1FKWA 4GYFA 4AZGA 4C6CA 1NF7A 1LP6A 3M5VA 4MJ2A 3WLJA 3LOTA 2CLKA 1P7TA 3PZMA 5F2MA 4F2UA 1RJQA 3GNOA 4CQAA 4PMXA 2DZWA 4C6DA 5FA5A 3B0XA 4JQAA 2DQXA 3L4XA 4IOTA 1OYBA 1EOKA 4JXCA 3U0HA 5F4WA 3LA4A 3CZKA 3NAVA 3GTNA 1W32A 3UA4A 2DUXA 3MDUA 1UZ1A 2ADAA 3TH6A 3BCDA 4RZBA 3NZ1A 2C91A 3TSBA 1R9ZA 4LUTB 1XLJA 5GNZA 3H4XA 2PLCA 3BQ6A 2OSYA 1D8WA 3GVRA 4Q4QA 3ZVIA 1RP9A 1HKMA 4C7DA 4G1NA 1ZLPA 2FZBA 1OSEA 4P7LA 3W83A 2F8QA 2XZ9A 2A3BA 4MY1A 3WN6A 2VELA 3CV2A 1YBQA 4RNIA 2YKKA 7REQB 1SJAA 4IGSA 4ZL1A 4X0VA 1A5BA 3VE7A 4OVXA 4AW7A 1F3TA 3VE9A 4M1BA 2ALRA 3EPNA 4NI8A 3EOEA 3IJLA 4MY9A 4PMZA 4OV9A 5FD0A 1XYCA 4JEJA 3RG6A 3VOFA 1M53A 3WQGA 2R1KA 3NQEA 3STPA 1W5QA 3IVSA 1A3WA 1ME8A 5JXQA 1W1A1 2OG9A 4IFKB 1U2YA 3ABOA 3PC0A 3FW6A 1BAGA 4JTAA 3WNMA 1EXBA 4HPGA 3UPMA 1V6UA 1XPYA 3WQ5A 1XC6A 3H24A 2ZUTA 2P3EA 1ISYA 1JPIA 2FTYA 4MOZA 3WBWA 1HX0A 2C8NA 1X6NA 2YDSA 1Q6EA 2JKEA 1XLDA 1SW7A 4IIHA 1GOKA 3A13A 3T81A 4DUXA 1UUQA 4DF0A 1GJPA 4GCXA 2Y24A 1EWEA 4FLRA 1O68A 4Q8OA 3EX4A 3W0KA 5JBFA 1QI0A 1XM3A 4LYPA 3UP8A 3EA1A 3UCDA 1P48A 2NVAA 2HSAA 1QPQA 2PBOA 1J0ZA 1XR2A 3VNDA 1OK6A 2J74A 1ZHAA 4XAYA 2QULA 2ZX8A 3PBUA 1JPDX 1QW8A 4Q7BA 4AWEA 2AOSA 3EWCA 5BXRA 3L2LA 5DANA 3ITYA 1Q8JA 3MSRA 1PX8A 1Z41A 1R9XA 2E8ZA 4FSAA 4YIWA 3TJLA 4IPNB 1UD8A 3M64A 4UFHA 3C2RA 4J3WA 2ZWYA 4NNCA 1J2WA 3N2MA 3MY9A 1WZLA 3BLFA 3W72A 2ZVRA 3AS2A 3GU9A 1RP8A 3AXKA 2Z7KA 3W81A 3POCA 2ZZ1A 5DCBA 5JH2A 3DFSA 3W76A 2EO7A 3KWXA 4XB3A 4CD7A 3FXYA 4K38A 4I8YA 1VFFA 3K2GA 3Q45A 2XN1A 3N18A 5MKGB 3EOSA 2G4FA 2AQWA 3SCSA 6CGTA 3IGXA 4D8LA 3N29A 4IIBA 2RDWA 5D2WA 5HBFA 4HZ7A 5EMKA 1EX5A 1IWAA 3PTDA 4H00A 5E1QA 3RPDA 1AUSL 2Y61A 4QE4A 4RK8A 4DHGA 4I9AA 3T8QA 4RZ5A 1UP3A 4Q3MA 1H41A 4R88A 1M7OA 3W85A 4WJ8A 1OGBA 1NOUA 2FDMA 2YCKX 4HSNA 5KZMA 4ICCX 4DYJA 1YRRA 1IXQA 3DN5A 3AYRA 2QCCA 4XBKA 1DP0A 3H2FA 2DIKA 4DM2A 5C0QA 1TIMA 4OGZA 3FA4A 3WO8A 5D8ZA 5A6LA 3RM4A 4TQTA 3AXXA 4GUJA 1BXCA 1TREA 5CGQA 5CGMA 2NT0A 2Y2WA 4JHZA 3DFHA 3SUSA 2PS2A 2QCFA 1MSSA 1JDAA 1R3TA 3I7RA 1HZYA 3HQPA 4N42A 1OFDA 2Q09A 1DWHM 3BJFA 1IGSA 5LKYA 1TPVA 1X1OA 1BLIA 3RJXA 5D9NA 3R0UA 4UR9A 1TJPA 3H2EA 3QZAA 1KM2A 1V8EA 4NYYA 5CG7A 4QBXA 2HROA 3LCIA 3RU6A 2WW5A 1P43A 1R3YA 3FVMA 3KOYA 1LL7A 2E9BA 2Z29A 4FZIA 5T91A 3EMQA 3VOIA 2EKCA 3OBEA 2AKZA 2QUVA 1AK5A 3CEPA 1TRIA 2ZXBA 3BXWA 1ZY9A 4UNLA 1VR6A 3EDKA 2PODA 3H22A 4ZE5A 2V3EA 2BG5A 2HDJA 1OABA 4MZ8A 3VM7A 2HK1A 1YEYA 4MUZA 4S2BA 4NZ3A 1RVGA 1QAPA 3TYCA 3SAZA 3VGDA 4HHPA 3UXIA 2DVTA 2J79A 3LEPA 4ZTYA 2Q71A 2ZX6A 4C90A 2QGHA 5HR7A 4H8HA 4MZ1A 1OX6A 1R3QA 3UY7A 3N2CA 3D6NA 5EKYA 1VFMA 3IRSA 2J6VA 2ZYFA 1JEZA 2EJ1A 4RR4A 1JZ8A 1QT1A 3E0IA 1JPHA 2CEQA 4LC8A 5HQEA 3G5EA 1VFLA 5IM51 4H83A 2E5CA 2PBGA 2DUZA 4BWLA 4DY1A 2E6AA 1E70M 3ARWA 4AX7A 8XIAA 3VKJA 1RUSA 3QTGA 3NPUA 1QWKA 3DBNA 2OOGA 1EPXA 1F5ZA 3PBVA 1LLWA 2RGMA 3SW6A 4XZHA 1TPH1 3NSXA 1ML1A 3EGJA 3APTA 2E9LA 3RCNA 4GI4A 2OWXA 3MO7A 2V5DA 3L4TA 1FWBC 2J8TA 5CLTA 3L0NA 3A23A 5A6SA 3UJEA 1P0KA 2V6AA 2FJKA 1QO5A 2KAUC 4GO9A 1WDSA 2HK0A 2VRKA 4NNAA 3MA8A 3CT7A 3LHUA 2FB2A 3AS1A 2EXOA 3HGSA 1TV2A 5ABGA 1IEXA 3WMBA 2XH0A 1FXPA 3SURA 1HJXA 2I17A 2HNEA 4HYRA 1OF8A 4RXGA 3AZSA 3FJNA 2CCRA 1NFGA 1RPXA 1XBZA 4YS1A 2XIQA 3BOXA 2BVDA 2DGAA 3AIUA 3WQPA 3IWPA 4GFSA 4LQ1A 3XIMA 1EP3A 1TVNA 4GK8A 1TG7A 4M51A 1EC8A 5A6AA 3D47A 3SY5A 1UR3M 1A3HA 1Z44A 1VQTA 3SJ3A 1JCXA 3AWNA 1CGXA 1W31A 1GZ1A 3LV6A 2Y0FA 4DYKA 4BY3A 2WC7A 3GUGA 2WZTA 1XGEA 2GLKA 1FH9A 2CLPA 3DHUA 4FMVA 3WEOA 1DJZA 3EWWA 2VEGA 4I3GA 3CMFA 3QY7A 1WOBA 1HT6A 4WZHA 2HRWA 3VU2A 1N55A 1SUXA 3HF3A 5G1YA 1YX1A 4QDMA 3IJ9A 1XSJA 4UFKA 4Y9AA 4K1WA 3F2CA 3DKLA 2WNZA 2FHBA 3MW7A 3CIVA 2G3JA 1PDYA 3EPOA 3PPGA 1P1MA 1M65A 4XISA 4OECA 1VRXA 3L66A 4E2OA 3HURA 3A3HA 3P93A 1TJRA 3DFYA 3O15A 3KVKA 2NV9A 4NU7A 4W87A 1KV8A 1XYAA 1XGDA 3BZJA 2YCEA 2OYLA 3H8AA 3V16A 4DZIA 2VURA 2EBNA 4WD0A 4IQLA 4J3UA 5IFTA 1PTGA 3DX5A 1W9UA 4PMUA 1UWTA 1JGMA 3UNTA 3TWBA 1QO2A 5DRCA 2FPVA 3H70A 3S8HA 2XIJA 1YDVA 2HWGA 3G1FA 3ATYA 3RJYA 2D2GA 4EAMA 1BGAA 4K68A 4JGDA 1XI3A 2Z4GA 3M9YA 3PZ9A 5C71A 1KO0A 2V63A 4UOZA 2NLYA 2VUYA 1JF5A 1J79A 3WF2A 1DJNA 2PDMA 2YFOA 4KQNA 3NQAA 1HL9A 1MYRA 1EF3A 4A8LA 3KCOA 1XCFA 5EL1A 2ASHA 4H9VA 4HA3A 1KRCC 3QH2A 1U1UA 4BEQA 2DDXA 1GQNA 3W88A 1WDWA 3NG3A 2DH2A 2VQTA 3VIIA 3VFCA 3AMKA 4V1XA 4XIAA 1RH9A 2ZUUA 3M5XA 2YL8A 4JTEA 4UFIA 5C54A 5JQ9A 4US5A 1XV8A 3PY2A 1RK6A 3T07A 3ABSA 1QDSA 1OX5A 3GC4A 5A8GA 4J3ZA 2YA0A 4TV5A 1BTMA 4QHRA 5A6BA 3WMCA 1CT5A 4NAFB 1VRDA 3QZ6A 2MUCA 4FAMA 5LXXA 4UQAA 2A3CA 3WELA 3LPOA 3V1HA 2QPXA 4JTCA 3W87A 2W3ZA 2XM2A 4MZYA 2BY3A 1IV8A 3LLFA 1F6KA 3TONA 4JTFA 4MNLA 2W5FA 4RW5A 1QNRA 3LQGA 2IXVA 1D8CA 2ABBA 4GQGA 3TYAA 3CHFA 4FI4A 3OZPA 3HG3A 1MXGA 3INPA 4PA8A 2OSWA 2V2CA 2YXXA 3GSMA 2PURA 4BI5A 5EA9A 2PC4A 3W1NA 4AUBA 1AH0A 1GQKA 4PUNA 3UG8A 1YIXA 3ZJKA 3UGVA 3DYPA 1QI3A 3BAWA 1LYXA 1ZBKA 1SZRA 3BCFA 3OVRA 3L0KA 2OQLA 4L56A 2WPGA 4Q8WA 3QM3A 1FWHC 2RKXA 3GTFA 4KIRA 1KR1A 2O55A 1ZU8A 3CHDA 1BYBA 1IR2A 3II1A 1T0OA 1GONA 3IJIA 4TMBA 2ZVIA 3PTKA 1XYLA 3AU2A 4PTNA 4PUDA 3W25A 1NFPA 3I3DA 1WXYA 4JR5A 4MJZA 5CPNA 4DM1A 1OC5A 3UWQA 1A3XA 3C0QA 4Z2GA 3DENA 3Q94A 3HMJG 5E6YA 5F4XA 4MB1A 1R3WA 4WHBA 5I3GA 4DJEC 3DIPA 2WNWA 2JKAA 4PEKA 4WOQA 2BOEX 1R46A 5B7ZA 3WNOA 3KEHA 2GDUA 2CLMA 3OW1A 3GIQA 1W0MA 4DNHA 1W56A 3IACA 3CAWA 4O4WA 2GUYA 1YKWA 1SO5A 2UY4A 3NYZA 3P74A 5I2UA 3O6DA 3HQ1A 5A6JA 3H6OA 1GVIA 3WK1A 1R85A 1YMYA 5A5WA 4CCCA 3PK7A 4MKSA 2E77A 3O0KA 1VP5A 3SJNA 3THCA 5HINA 3IV3A 1R30A 2PRHA 1FUYA 3CTTA 4WCJA 3NQCA 1GVQA 1SVDA 3U9IA 1CEOA 2XGZA 4JNMA 3VD7A 1X6LA 2DIEA 2VHLA 2CW6A 4L64A 1GG0A 2H9AB 1JGIA 4YCPA 3KCJA 1F05A 3RR4A 3T2PA 1B2YA 4NVTA 4UTFA 2O9RA 1CTNA 4NF7A 4GZIA 1DJXA 4D71A 3FLUA 3BANA 3SQMA 3VKKA 1FWSA 4Q6XA 4N9DA 4LTSA 3MUCA 2WSKA 4I7WA 1FWIC 5I3IA 3REQA 1ZCOA 1H09A 1X1ZA 4EF8A 4AISA 3CLMA 1TTIA 1UOKA 4I9TA 5I03A 2F7FA 4MWAC 5M2FX 2CYGA 3BOLA 5D2XA 1I2RA 1K03A 1M6JA 3LCXA 1Z48A 3AIWA 4H9XA 4F79A 2PTXA 3F03K 3CUIA 1UZDA 5EBUA 3W4RA 3VZYA 1XIHA 3Q2DA 4JCMA 3CPGA 1OADA 4GYKA 4ZODA 4NYUA 2G8ZA 4PMYA 1KC7A 4XG1A 4AIEA 2GQ8A 3E0VA 3WNKA 2DJXA 1MFVA 1JNEA 4O0KA 3E49A 4I9MA 2WSPA 2ZXDA 1S5NA 3F5JA 3KDOA 5J8LA 3V1PA 1HJVA 1HXJA 4MM1A 5CXPA 2WMHA 3WY1A 4HCDA 1MNZA 2PFHA 4L1XA 1Q13A 5I3HA 2AAAA 3RAOA 1IXNA 2PDCA 5HULA 3UCCA 1RAKA 1KTBA 2JFEX 1KM4A 3LERA 3MKVA 3TXZA 4LNCA 2A21A 2G50A 5IFPA 4P5UA 2DZSA 3IANA 4CU6A 3B8UA 1ZBWA 1K7XA 1EL3A 3GWQA 1IXOA 4YTSA 2GJRA 3N2TA 1AVAA 4RPQA 5HMFA 5JBDA 2C6QA 4HHLA 3ORWA 5FF2A 3ZOAA 4FIRA 1B9BA 2VOTA 5J5RA 1GJUA 3VZXA 3MMUA 4R85A 5DMYA 3C0LA 1AJ2A 3AAMA 3AWOA 3UNDA 3UWWA 1XYBA 2HBVA 1BRLB 4G6CA 1PPIA 3JR2A 4KRZA 4GJJA 2QIIA 4QIUA 5JUVA 1KGUA 2G5WA 1DIKA 2UBPC 2E6FA 3TE9A 4G9PA 1DL3A 5AC8A 3OBAA 4UTUA 2Y4SA 3MI3A 4DUVA 4IFRA 2IPWA 5EMMA 2Q3OA 4UFMA 4PC8A 3PUEA 5KITA 4ZOCA 4EWJA 4UNIA 3NQ2A 1OG6A 3C52A 1H50A 4PBGA 1VHNA 2OELA 3QR1A 3B9NA 1Z7AA 3H2MA 4ZO8A 3CYVA 2DT0A 5ABTA 2WYSA 2NXHA 3GZ3A 4AVFA 1UIPA 2NW0A 1TO3A 2H3DA 2V5CA 2XJ7A 1T5AA 1H7XA 4FNRA 4UTTC 3FS2A 2BNJA 3N17A 5FF4A 4Z0SA 1VBJA 4HZ6A 3C2OA 3DOPA 4IT1A 1GQIA 1XIIA 4QS6A 3TW9A 4Y96A 3CM4A 5HMEA 2IPFA 3UU0A 4TUFA 1DTUA 2IPJA 2BVTA 2WM0A 3HZ3A 4NY2A 9XIAA 1FH8A 1X97A 2Q6ZA 3C3NA 2GWNA 2FZDA 4PB5A 5U4NA 1KKOA 4YYFA 1FWJC 2BX7A 3URBA 1A47A 1V0MA 4A2SA 5FF0A 4HMDA 4Z17A 1BQCA 2XVPA 3N34A 1I0BA 5BROA 1RBOB 5A8QA 4N0RA 1JI1A 1H4PA 3W2NA 3QV6A 1K8CA 1YNQA 5CJNA 1XRTA 3HQNA 1REQA 5IDIA 2NXIA 4AVOA 2NQLA 2A7NA 4B5TA 1U5JA 4W7UA 4HJFA 2JQXA 2C3ZA 2XISA 4HA4A 3FEMA 2FZ9A 2O56A 4LUSA 2QEZA 2ZRYA 1C9DA 2QAPA 1R2RA 3NIYA 4YVXA 4PCTA 1E55A 3ZXWA 1UP2A 4DLMA 1Q63A 4CNUA 2E25A 3QY6A 1TV7A 1SJBA 2YGYA 1I75A 1WYIA 3T0AA 4WK9A 1A5AA 1O95A 2JIWA 4XZIA 1KXTA 4MB5A 3MVIA 1XHGA 4FHAA 3I4EA 4HIBA 5EMYA 2FMNA 2BHUA 2NLIA 1HN1A 3QZEA 4E8DA 1BG4A 3BZGA 4B5VA 1Q6OA 2WVVB 2BASA 3DFPA 4YU1A 3AIQA 2NQZA 1QR7A 1BTCA 4JQ3A 3RX2A 3IJ8A 1CWYA 2FIQA 4S3CA 3S83A 2Y7GA 3BC9A 3M0XA 4UMCA 9CGTA 3PZVA 1TTQA 5GJMA 4IMDA 1IE7C 4UXDA 1QW9A 5E9XA 4PUJA 1UIOA 3TU9A 2BXYA 4H9ZA 2XN2A 1E3XA 1RALA 1E1FA 1V93A 1IZJA 4K3ZA 2VNCA 3SGUA 4NL1A 4DB7A 1X7IA 3RIKA 3WLQA 2VC9A 5FF3A 1ONEA 3H12A 5HNTA 3ZVHA 1TWDA 3VNIA 1F74A 4QSHA 3D3FA 2Y85A 3FV9A 3NQ6A 1JDEA 1YW1A 2PU0A 1UR9A 1HF6A 3HGRA 5H8MA 4RE4A 4ZOAA 3WKZA 3ARXA 3NL6A 2RHGA 2QLYA 1EDGA 2WVUA 3IJDA 1V6TA 5A8MA 2ZUNA 3QC0A 4JOMA 4L4LA 4CNOA 3OP2A 3LTYA 3TMQA 1YQ2A 3W1QA 4Q4KA 1ZS2A 4GVFA 3GVWA 1Z3NA 4X0NA 4Q32A 3GIPA 1UASA 3SFWA 5A2AA 3LYEA 4F4RA 5HOSA 1FFQA 2R9RA 3KVMA 5DMNA 4OV4A 4XSMA 3O7UA 3ANUA 3O3RA 8CGTA 1GOXA 1Q7MA 3FVDA 4I90A 3EWZA 3WLKX 1LWHA 4EKJA 3H4GA 2JGQA 3ENLA 2J8FA 3NOEA 1CXLA 4Q33A 2J8GA 2WBKA 3KM8A 3UFYA 3W7GA 1XGZA 4WDTA 1B90A 3LX9A 3W22A 3VD3A 3TYDA 5F7UA 3ARYA 5HJYA 1RQHA 4L1WA 5IOBA 4NJKA 2DEPA 4RW3A 3FA3A 4X61A 2Z2BA 1QPNA 4XTDA 1H62A 3LHTA 4IQEA 4D6EA 2GJNA 3FDGA 3KRZA 1R5YA 3L68A 1K77A 3ECQA 4EWND 1LROA 3WENA 1RD5A 2VEIA 1I0DA 1TYGA 1JD7A 1W5MA 3K1DA 3W74A 7A3HA 4CD8A 1FFRA 4IX0A 4H6EA 3ZMRA 2CZDA 1PXGA 4CU7A 1TMHA 1N82A 1XIGA 3IS4A 1FWRA 4KEVA 3HPSA 1MO0A 5DY2A 3LM7A 1PHQA 4NZCA 3OVQA 1DJHA 3ARUA 3TFCA 1IEIA 2CHRA 1SFJA 2AAMA 5CH9A 2ATMA 3TN4A 3NDOA 3W1RA 3TR2A 2BTMA 1H51A 2WZHA 1EOMA 1LCOA 3WF1A 1A5MC 3LSCA 1IEQA 3KOXA 2OLSA 3PWGA 1QNPA 4HZMA 2PWHA 2QCNA 1DWFM 4GMEA 4J3SA 3U5YA 3MBDA 3LPGA 4GY1A 5E0CA 5HWMA 1WA3A 4PMNA 5DLCA 2PWEA 1POKA 4LALA 1SFTA 4W4QA 4WQ6A 3K5XA 3NEVA 5TD4A 4MKVA 3SCTA 2YXGA 3UEQA 4AY8A 1GOQA 4UTKA 4DWDA 2IS7A 3VZZA 3SUWA 5CCZA 2OSXA 3K46A 1UQZA 3A3XA 1WBJA 3FN9A 1W3HA 1FWGC 2H8ZA 4TTGA 4IXXA 1OJXA 1NTHA 5AKQA 3ZR6A 5D2VA 1NP2A 3VIMA 4GYJA 1H61A 1D3CA 4DWSB 5FJUA 5HWNA 5HNNA 2POTA 3AALA 4X2PA 7PTDA 3UD6A 1QJWA 2HS6A 1TR1A 2FKPA 2X41A 1AJZA 1SGJA 4A3UA 4ZO7A 4H9TA 1UH3A 1ZUAX 3LSBA 1A4MA 2WWCA 5G2IA 2PLMA 3TLLA 5D9PA 3HGJA 2ZX9A 3HJZA 4X3ZA 4C6OA 3OA5A 4O16A 1E6SM 4J3TA 3TJXA 4DX3A 3VMPA 4J5NA 4A8RA 1JQXA 3I7SA 1FKXA 3WH9A 4AD5A 2ODOA 3ZWSA 4ALDA 4H6RA 1JJKA 3W2LA 3W1UA 5HANA 2J9ZA 3TYUA 4B4FA 3UPWA 3NYDA 3LBOA 3N4AA 3JZEA 3O06A 2PWFA 3ABXA 3OGSA 3EOUA 4PBFA 4GZJA 4I5UA 3SQLA 1YDNA 1QNVA 5C5YA 2YJQA 1SR9A 1W1PA 4UTWA 4GD0A 4QCFA 2F6KA 3FGCB 3TW6A 3CZGA 1X39A 2W67A 3MPGA 4Q7IA 5LNSA 3F1QA 4Z2KA 1FWAC 4O10A 4IPPA 1XSKA 4LY8A 4YN5A 1G0CA 2OVLA 3P5YA 1JXJA 2TAAA 3KRSA 3CTLA 1F2JA 1OC6A 3DGRA 1E1CA 2D2OA 5CPTA 3QQ0A 1IF2A 4CD5A 1CXFA 5C55A 4AWTA 3TNBA 1EQCA 1KW1A 1EIBA 4IIEA 2GVYA 5FJRA 3S2CA 4QCEA 4QJ4B 4LVFA 3BAJA 4LBSA 4GACA 3H7RA 1JDDA 2AMXA 5FEZA 3C2EA 2GJXB 4GUHA 2J27A 2X0YA 3RLVA 1UWUA 2JKPA 4BA0A 3RK8A 4JQ2A 3KTCA 4GIAA 1KTNA 3GNXA 1SQ7A 4IPLA 4ZFMA 4TO8A 1ZAHA 2BS9A 4CLMA 4XWUA 1LG2A 2RFGA 2XH7A 2QJIA 1BG9A 3LY0A 3UWUA 2QJNA 4EPEC 2C7FA 2GPTA 3EX1A 2PU1A 2WMFA 3N25A 3BAYA 4BK9A 1EJ7L 2ZRUA 3G1DA 4MUPA 3QW3A 3AIVA 4IH3A 4AC1X 2R14A 2V30A 1MEIA 4C6IA 1RJRA 1G01A 2I5IA 1AH3A 5DEZA 1EJSC 2Y70A 3UT0A 4Y9PA 3GRIA 4OOUA 3T0CA 5MHBA 4KT2A 1LUCA 4OBTA 3V5CA 3W7IA 5I6SA 1UHVA 2KX9A 4AXKA 5I3JA 4P8XA 1GNXA 3PVFA 4C6NA 3PAOA 4Q22A 4GQBA 1ZJIA 5TQLA 1XPGA 4A22A 5LIWX 3M0HA 2E6YA 3T09A 1LRQA 3IGHX 2PGFA 1CBGA 2GK1B 2OYMA 1PWLA 4GHRA 2I9UA 2DSUA 4JTUA 2HPIA 3GDMA 4XZNX 3BCJA 3JU2A 2YL5A 3QN3A 2CZFA 3KW3A 1E5JA 3CK5A 4Y7EA 1H63A 4JY9A 1M7PA 5T9BG 5D02A 4WOZA 1GJWA 4UCFA 4HN4A 4YLWA 2NVCA 1FCBA 3LENA 2VXNA 3L2IA 1ONXA 2DZTA 2BZNA 1UYQA 3DFQA 1GVEA 3CYJA 1V4YA 2W61A 4ZSTA 2PDPA 1V51A 1H0GA 2OYKA 3WH8A 1NQ6A 2VX6A 1GOOA 3ZR5A 4D6CA 1A0EA 4WXZA 5ABFB 3W6LA 4FOUA 3SCPA 3PF3A 3PZUA 1WB0A 1KBLA 3F4VA 3LHYA 2OQHA 2C13A 3M1ZA 4ATWA 5D4YA 2OZ8A 3AMGA 3UWZA 1D2KA 2Z1VA 4ZQMA 3FJ6A 4INFA 1U22A 4Y2WA 4CN6A 3BG5A 4IL0A 5C2CA 4S23A 3IPWA 3TQKA 3P61A 2ANUA 4HOZA 4HK5A 1P0DA 5FCZA 1KTCA 2GL5A 3BMWA 1DYSA 3C0SA 3T2OA 4NJJA 1NDVA 2ZC8A 1L0PA 2R82A 1TA3A 1KV5A 3V0TA 3IAPA 3CT2A 1T40A 2QV5A 4O57A 3CC1A 1WX0A 2VCCA 4QDWA 2GDQA 1B3YA 4DJDC 3LG3A 4HSHA 2DZUA 4LS1A 3WF4A 1HKJA 1A5SA 3W7PA 5CSYA 3KP1A 1EF2A 1S3HA 1TRDA 4LJ3A 4QS5A 3OHIA 1MEHA 1NAL1 2HJPA 3WUEA 1FBAA 2RJGA 3LCWA 1OFQA 2VX4A 2J7HA 4FNQA 4HGXA 3UCQA 4ECLA 3PAJA 2W0UA 1FHDA 4GKLA 4O12A 2ZDSA 3PUDA 3K8KA 4QAIA 3BQ5A 5ABHA 3OJGA 3DH7A 2QT3A 4IUGA 5BYWA 4E2BA 1HW6A 2CHNA 2ZUVA 2E1WA 1S39A 1EHNA 4W5ZA 4CU8A 1TCMA 5A2CA 3VCNA 2PLKA 4PFMA 3W1PA 3RHGA 4AAJA 1C93A 2P5NA 4IPIA 3EKLA 1FA2A 3DBPA 4QLJA 3IVUA 3N9SA 5AHLA 3L5MA 2V82A 3CV7A 1RCQA 2GOKA 4Z2LA 3G3DA 1FDYA 4H1ZA 4XO7A 4BR1A 2IW0A 1OM0A 4JQ4A 3NQVA 4H19A 1MDLA 3ZSSA 4LVDA 3OVGA 4Y8FA 3SCNA 1XLHA 3N04A 4NJGA 2QDDA 3S2MA 3OYXA 2BY2A 1MQRA 4Q8QA 1WZKA 3WK0A 2P10A 5E09A 3M0KA 4JFTA 1TJ1A 4IMEA 1XW8A 2EAWA 3N12A 3FYYA 4KEZA 3WEMA 2WLYA 5FEXA 2NX3A 4C1NB 1E0WA 5K4ZA 1JCNA 3W53A 2XVLA 4Q8MA 1U5VA 3QGVA 1A0DA 2CLFA 4HD5A 3GVQA 5CZSA 1K7FA 1W37A 4UCGA 3V7PA 2BB0A 2ZUMA 3HPZA 1LWJA 4H01A 3IUHA 1E4NA 1UQYA 3R79A 1H7PA 1EWDA 1HKKA 4LAMA 1E9ZB 2DSKA 2WMKA 3TP4A 3EYPA 1S2TA 1RQBA 1Q66A 3HG2A 3ISIX 3UPBA 1NWUA 2A5HA 2WVSA 3M5YA 5A8PA 3AS0A 3RPMA 2EG6A 3VC6A 4IICA 4QRNA 2J24A 4D1IA 2VCAA 1GW9A 4CNPA 2BBFA 1K9FA 1RV8A 4K39A 4HHHA 4WIWA 3DG7A 3R0DA 4UQCA 4F0LA 1R86A 5H6HA 4G1KA 4HA1A 1UBPC 2XZ7A 2CPUA 1PYFA 2XINA 4K37A 3CAKA 1LOSA 1W3JA 2CLLA 2QZRA 3S1GA 3PUOA 3GVVA 5IBXC 2E0PA 4IG2A 3M47A 1Z8AA 3GHTA 3TN6A 4IISA 2E3ZA 2WHLA 4OBSA 1UWSA 2WCGA 1SZEA 3S4TA 2QJJA 1NY1A 1LT7A 2I57A 4GOAA 2EG7A 3ELFA 4NRSA 2QYGA 4V33A 2W9MA 1MW2A 3AICA 2J7DA 3HBLA 2FDSA 3UWVA 3ICJA 4GY7A 5GJNA 4YHGA 3EA3A 3KXQA 4FX7A 2V9DA 1S2UA 3BJTA 3USZA 3FK4A 3TTOA 5FOOA 3N9RA 2WC4A 3D5HA 4Z08A 1VFTA 4MPKA 5FF7A 6REQA 3H2NA 5AYBA 2W4XA 1G4TA 2GGJA 4ROPA 3NCOA 3TDFA 2V2HA 2F9RA 1RA0A 1V6VA 3STEA 4QE1A 1XJBA 3CGTA 4MIMA 1E6ZA 1S1PA 3UF9A 5IHRA 3W23A 4L4PA 4DI9A 1HVQA 1UWQA 4AQLA 2W91A 4QEHA 4NKCA 1LQ0A 3QSTA 1YXYA 4AZBA 4L6OA 1VBGA 3MYOA 4I6VA 1AG1O 3N2OA 2QCDA 3EB3A 1E9YB 5HPOA 2J7EA 1EZWA 2F6XA 3F2DA 1QASA 1IEWA 1V7YA 4NJHA 4B5SA 2G96A 3CHCA 3NO5A 2YCJA 4FLQA 4IL2A 3OG3A 2FGZA 3W7LA 2A0NA 1J96A 3LQLA 1HKWA 1NIUA 3QV8A 4WF7A 2VQUA 1R3VA 1NU5A 3OEXA 4O1AA