1QRQA

Structure of a voltage-dependent k+ channel beta subunit
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
325
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords PROTEIN (KV BETA2 PROTEIN)
publication title Structure of a voltage-dependent K+ channel beta subunit.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 117
structure length 325
sequence length 325
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1qrqA00
2HVOA 4LAZA 4DBUA 3H7RA 2HVNA 1ZGDA 3UG8A 3LUTA 3UP8A 3H4GA 3CASA 4L1XA 2HEJA 2I16A 2A79A 1T41A 2ACRA 1SM9A 3GHUA 4IJRA 1HQTA 2IPJA 3UWEA 3LEPA 4LB4A 1LQAA 4JQ3A 2PDXA 5LIWX 4XAPA 3ERPA 1OG6A 3CMFA 3H7UA 4ICCX 1A80A 4JQ2A 5AZ1A 3Q65A 3D3FA 3QKZA 4JIRA 2I17A 4XZLX 4HBKA 4NKCA 2F38A 3M4HA 1R38A 4JQ4A 2PDCA 1MRQA 3CV6A 3UFYA 3NTYA 1X98A 4WDWA 2QXWA 4GA8A 3V0SA 1QRQA 2PEVA 3LZ3A 2HE5A 3O0KA 3R43A 4H8NA 2IQDA 4WDXA 4LBRA 4PRRA 3KRBA 1S2CA 3EAUA 3GHRA 3GUGA 1YE6A 4XZNX 4IGSA 1EL3A 2PFHA 2PDIA 1J96A 1YNQA 3R58A 3F7JA 1PWMA 2PD9A 2HE8A 1RY8A 3G5EA 3WG6A 2HDJA 2IKHA 3LENA 3MC5A 1AH3A 2INZA 1IHIA 1VBJA 4ZFCA 4GQGA 1Z3NA 1X96A 3U2CA 3R8HA 4GQ0A 1C9WA 2PDBA 3LQLA 4PUWA 5HA7A 2DUXA 2FZDA 4IJCA 2ALRA 4XK2A 4JIHA 1HW6A 4Q3MA 4PMJA 2PDWA 3R8GA 4XVEA 3C3UA 4JTAA 2C91A 3LQGA 4JIIX 3VXGA 4EXAA 5JH2A 2R9RA 5LIUX 3WBWA 5LIKX 1MZRA 3LD5A 2NVDA 1Z9AA 2ACSA 3DOPA 3R94A 4ASTA 4XZIA 2WZMA 3RX2A 4PRTA 3M64A 4FALA 1S2AA 2PDPA 1FRBA 4LBSA 3CAQA 1XJBA 1ZUAX 4LB3A 1T40A 1M9HA 2BP1A 1ZQ5A 3R7MA 2IS7A 3N6QA 3O3RA 4GIEA 2BGSA 3UZZA 2IKIA 3COTA 1VP5A 3RX4A 2ACUA 1YNPA 3RX3A 2PF8A 1AH0A 4YS1A 4Q7BA 1AZ2A 3M0IA 1RALA 2PDJA 3BV7A 4H7CA 5LIXX 4JTQA 3LBOA 3FJNA 1Q5MA 3WBXA 1PWLA 3V35A 4GACA 4XZMX 4QBXA 2FZ9A 3GHTA 2ACQA 2BGQA 3N2TA 2PD5A 3UZYA 2PDNA 2FZBA 3UZXA 3LNMA 4OTKA 4JTDA 4DBSA 2DV0A 3G1RA 1Q13A 5DANA 1YE4A 3CAVA 1XGDA 2IKGA 1XF0A 4R9OA 4YVPA 4XO7A 5JH1A 4XO6A 5C7HA 4QXIA 2IPWA 3V0TA 3S3GA 1EF3A 4L1WA 3Q67A 4WGHA 1US0A 4GABA 4WEVX 2PDHA 3ONCA 3CV7A 3UZWA 2R24A 3LZ5A 1ZSXA 3EB3A 4PUUA 2PDUA 3WBYA 4EXBA 4FA3A 1EXBA 5KETA 1X97A 4YVXA 4QX4A 2FZ8A 2PDFA 1ADSA 2VDGA 4WDTA 2PDKA 4AUBA 3WCZA 2INEA 2J8TA 3P2VA 4I5XA 3BUVA 3ONBA 5LIYX 1QWKA 4WRHA 2NVCA 5HNUA 2IKJA 4PR4A 1EKOA 3V36A 1JEZA 1S1PA 2F2KA 1PZ0A 3BURA 5M2FX 4YVVA 4WDUA 1UR3M 1RY0A 4JTCA 2IQ0A 2FGBA 2HV5A 3BCJA 4JQAA 1AFSA 4HMNA 3B3DA 4G5DA 4FZIA 4JQ1A 2IPGA 1AZ1A 2AGTA 2PDYA 1PYFA 3MB9A 2ISFA 4FAMA 1LWIA 3UGRA 3EB4A 4DBWA 3FX4A 2PZNA 3GHSA 4DZ5A 4F40A 2CLPA 3LN3A 2PDMA 3UYIA 4RPQA 1Z89A 3R6IA 4XZHA 2WZTA 2PDLA 4LAUA 2FVLA 4XVDA 4YU1A 5HNTA 3V0UA 1AH4A 2P5NA 5AZ0A 3T42A 4MHBA 2DUZA 3DN5A 2IPFA 4QR6A 1MI3A 1PZ1A 1IEIA 2PDGA 2PDQA 1GVEA 1S1RA 4GCAA 4JTRA 1Z8AA 1K8CA
chains in the Genus database with same CATH superfamily
5K9DA 4GYJA 1POJA 4DBUA 1TRDA 4Z1DA 3B03A 4A22A 4Q4OA 3ITOA 2DH3A 4K38A 3K8LA 4OOUA 4Y9NA 5LA1A 3C4UA 3K4WA 4JFVA 3TSDA 3LPFA 2Z7KA 3GIPA 3WMCA 1PAMA 5XIMA 3ANVA 2PTDA 3TN4A 4M56A 1Z44A 1Q6OA 3IJLA 1KFWA 1K8ZA 1KQZA 1V5XA 1GOIA 3KXQA 2H3DA 2XFWA 1LROA 4UFMA 3SCOA 2XGIA 3WN6A 3MYPA 1B9ZA 1ITXA 3WH9A 1P6BA 1FWHC 3UFYA 3TYBA 4WUIA 3GNPA 4HYWA 3EXRA 4I9AA 1PEZA 1KM6A 9RUBA 3BOLA 5HBFA 2ZXAA 4EK7A 4XTIA 4EF8A 1XHGA 4M24A 4TMCA 4M19A 2R1MA 4LV4A 1UMLA 3N4EA 1MWOA 3SFKA 1EEPA 1QTWA 3HB9A 5A2AA 1HXJA 1J96A 3WUEA 1BWLA 1YDOA 3CS2A 5D2TA 4HB7A 1V77A 5BCAA 1TA3A 3W1AA 5I79A 1QPOA 1QASA 3MHFA 3GH5A 4GIRA 3AZSA 2GGIA 4D6FA 2QKFA 5H8MA 2VGGA 4KRTA 3RLVA 2FIQA 2YW4A 3CWHA 2VQUA 3L12A 2DT1A 3R8HA 2QW5A 3LQLA 4XAYA 4PB5A 5D38A 3THAA 2OGJA 1XLCA 3PUEA 2ALRA 3M47A 2JKEA 2PWUA 3URQA 2ON3A 3S1UA 1X8FA 2QCDA 2C0HA 4AY1A 4LUSA 3E96A 1Z9AA 1J0JA 1OX4B 4PMYA 1P6CA 2GVEA 5JVLA 1VFUA 4GHRA 1HL9A 4XZIA 2MUCA 4IF2A 3M64A 1B54A 1S2AA 1ZBWA 4A3YA 4ATDA 3VOHA 2YDRA 5BRPA 1O5QA 4C7FA 1JUBA 4XSMA 2XN2A 5DXYA 3V5CA 1TPEA 4N6FA 5FOOA 2Z4GA 4ZB2A 1GHSA 2IS7A 2NUWA 1R7OA 1YX1A 4C6IA 5I3IA 1GOOA 6ALDA 3RX4A 1VYSX 2ACUA 2D0GA 4HCHA 1DWAM 8RUCA 4QITA 3DUGA 2VURA 3W2MA 5F2LA 2GUBA 1W9PA 3SRFA 2QYGA 3O1NA 4AD5A 4E8GA 4JR5A 3HF3A 2XG9A 5LA0A 4JTJA 4GY1A 1P0BA 3NYZA 3KCJA 3PBYA 5C9UA 3FCPA 1T96A 2CLLA 4GH3A 1JNEA 4EIVA 4LV9A 4NIRA 1UA3A 3L0GA 3RU8X 3PB0A 1DXEA 3UZXA 1T6MA 2I56A 4IX2A 3OYZA 4ZMGA 5DCEA 3PPHA 4R9XA 1Q13A 2ABAA 2ZUNA 1AJ0A 2XIMA 4GIAA 5HINA 4JL2A 5KZ6A 1NVMA 2G8ZA 1XUUA 2XGBA 2JF7A 1NWTA 5H91A 3QZAA 1JYXA 5FJIA 1QNOA 3LHYA 3IV3A 3HBLA 3SUTA 4O15A 2V3GA 7ODCA 2VZVA 1HUVA 4QE5A 3VA8A 3Q67A 4WGHA 1H7PA 1US0A 4KMQA 1NIUA 2OLAA 3N1AA 3P6LA 2EPLX 3W7EA 5D9MA 4DAIA 1ALDA 3LZ5A 1ZSXA 1E9ZB 3CUZA 5FJUA 4I8YA 6TIMA 3MSRA 1J8VA 2FZ8A 2V3EA 1ISYA 2RFGA 3AYSA 2E4TA 2PDKA 3IGSA 3FVMA 5MKGB 1O6IA 3AXXA 1DE6A 4WRHA 3P0XA 2OOGA 3PP7A 2IKJA 1TJ1A 4Z0SA 3SIMA 1M7OA 3MQTA 4OU1A 3LPPA 3BLLA 2JGYA 3WQFA 3DHDA 1VQTA 2NV1A 1BSLA 2GOUA 2RDTA 1YDYA 3ABSA 2OFJA 3W07A 2YBTA 3EWDA 4AXNA 1TV3A 5BXTA 2IQ0A 3PUOA 2Y7DA 4HMDA 4C6JA 4IPPA 3V18A 1VHNA 5M03A 3GG0A 3LGEA 4HQVA 1A3WA 2L5HA 2D22A 1TPUA 4LAKA 2GUYA 2XFYA 4XKYB 3ZR6A 2CZVA 5T9CE 1ZHAA 1AJ2A 3WQEA 1EP2A 3MYOA 4GY7A 3WH5A 4YYFA 3W3OA 5D8ZA 2WVVA 3SQLA 2PDLA 1TZ9A 1P6WA 3LSCA 3UERA 3OVPA 2MANA 2DZVA 4GNJA 1V8EA 2JQXA 2F6XA 1RLDA 5K2ZA 3B9NA 2WBGA 3T42A 2Q3OA 2WNZA 3LERA 1CGXA 2NVAA 3CC1A 1H0IA 2WZHA 3VZXA 1O95A 3OG3A 2I9UA 3OGRA 5I3DA 1GUVA 3BDKA 4GCAA 3RJYA 4U3AA 1YNYA 2VOMA 3PFMA 3N4AA 5JUVA 1OFPA 3RRXA 1K8CA 4WLCA 2I5IA 3TC7A 3BARA 1XWYA 2YKKA 5D2VA 1HP4A 2X42A 2ZRYA 4DM2A 4J2PA 3O6CA 3UJ2A 1PKYA 1QPRA 4QSHA 1IWPA 2EKCA 2J7GA 4V28A 3CXOA 4S3EA 3CB8A 3LXBA 3G22A 4D6HA 4P5UA 1B1YA 3W7DA 3GVQA 3KTSA 1XQKA 1VLWA 1WZMA 4U33A 6CGTA 4JQ3A 4B9ZA 3ZXWA 2VC7A 4PCNA 3TUUA 1PJ9A 3KL3A 5C2CA 1ECEA 3KBWA 3TCSA 3NOYA 1B3XA 1J2BA 2IW0A 4IQLA 3S42A 1A80A 1ZJHA 3RIKA 5I77A 3FGCB 5BOFA 3F4DA 2FJUB 4XUGA 4FXSA 2ZDRA 5EMKA 3NZGA 7ENLA 3U48A 1UPMB 1FDZA 4MPQA 4NZ3A 2VI0A 5I5RA 5A8MA 5AN7A 1FKWA 4QM1A 3GB6A 3EOSA 2WC4A 2YYUA 2WHMA 4B2DD 2CBIA 4GUJA 3T40A 2HE5A 1KV8A 1OC7A 1TQJA 1F9CA 4PRRA 1XLGA 1BWVA 3P82A 3CT7A 3S9ZA 3GUGA 1BD0A 5E93A 2BVYA 2PTWA 1HO4A 2DZXA 2Z2BA 1CLVA 1PKLA 2C79A 2VGFA 4AWEA 4IFKA 1A5BA 1CNVA 2ZICA 4KETA 3VD9A 4AMAA 4OIFA 4RZBA 4PMUA 4X2RA 1E3XA 2F9RA 2ZXQA 1W9UA 3EWXA 2I7GA 2VQTA 4X0VA 4E0CA 2CZDA 1PDZA 4H04A 5FJTA 4DWSC 4HVXA 2QAPA 3F2DA 3VNLA 2JGQA 4KS0A 4Y9AA 5HA7A 3RUBL 1TELA 2QDHA 2XINA 1O94A 2GJPA 3RM9A 3H4WA 1EGVA 2VZSA 1VEMA 4JTEA 1TZ7A 2FKPA 3WH6A 1YXYA 4CD5A 4OJYA 3WK3A 1CXFA 4RNIA 2PWGA 3PWGA 3SDOA 5LIKX 3AHVA 4IPJA 1JCJA 3OGVA 3LU2A 5EA9A 3R94A 3VABA 1J9YA 1XPYA 5EKYA 3LPGA 3H53A 5GNXA 1I2PA 1NF7A 2FTYA 3R7MA 3AIQA 1OT1A 1R2TA 4MYAA 3FIGA 4KF1A 3KRSA 3P93A 2ZVIA 4P7RA 2VC6A 1LLOA 4NZ4A 1BYAA 2YCLA 3QRHA 1HKVA 4GKTA 3RO6A 3SCUA 1PKNA 3N2MA 3FYPA 4RNHA 4KEZA 4RNJA 5A6MA 1R47A 3MV11 1RBAA 3UXDA 1F6PA 1LDCA 3GU1A 4AISA 1W0MA 1L8PA 4P7OA 1EDQA 2W79A 1XRFA 2V5DA 2E6DA 2D2JA 2O9TA 5FF0A 1KA9F 3E5PA 1VCGA 4GIYA 5BYWA 4HNNA 5RUBA 4ZOCA 4J3SA 4OBTA 2AGKA 1OT2A 2FZBA 2PTZA 4HA0A 4HCLA 3P5YA 3PZIA 1PB0A 1SW7A 3W7PA 2XN0A 3LM3A 5CG7A 1K3UA 2C1GA 4LOCA 2W63A 4B5XA 2ZXDA 4KBXA 3DECA 2XWEA 3AISA 2WKLA 3T55A 1GEHA 3BZGA 5EMYA 4GZJA 4DY1A 1WX0A 3SCPA 4H83A 5REQB 4UTHA 4RUBA 4KGLA 5CSYA 3ARVA 1HF6A 3SR7A 4IP5A 1Y7VA 3UJRA 3P60A 3F4CA 1AK5A 3WNKA 1QBAA 4ZODA 1GZJA 5E9AA 3CZKA 3CHFA 4NNAA 3LCGA 1F3WA 1HJXA 3KBMA 3WBYA 1DJGA 2Z2UA 1G67A 2V2CA 1NP0A 1O1ZA 3BVJA 3W72A 3M0YA 1ML1A 3LBMA 3I6EA 1G7VA 1X6NA 5D03A 2I5QA 3EDJA 1US3A 2SFPA 4KEVA 1KCXA 3TQPA 2XUCA 4UIOA 1JAKA 1HKIA 3UNDA 3QC0A 3APTA 2QGHA 4BS0A 3W24A 5I09A 1PCKA 1XBVA 1OFDA 2W66A 3SCWA 2V38A 1MNSA 4RV3A 2QT3A 1JQXA 2F2KA 4L80A 3PJXA 2ZA2A 3BG5A 1KCZA 2W61A 1XYCA 3DG3A 4O10A 3R10A 2FGBA 3SM0A 1CLXA 2FGLA 3N2BA 4HT3A 3QXBA 3RYSA 3BGJA 3QQWA 3TN3A 3BMVA 4CU6A 1GTEA 4I90A 1FDYA 2QS8A 3UNTA 3DGRA 3NL5A 5AC5A 3AHTA 1YDNA 4J3ZA 1TPWA 1XH2A 1RJPA 4U2ZA 1RVKA 1H7XA 3CIWA 1XBXA 4IP7A 1GW9A 4GD0A 4IL0A 3O7UA 1TQXA 4DJED 3CH0A 4AFYA 5IXEA 1PZ2A 4LAUA 2BY3A 1JAEA 1CDGA 4EPDC 1VIWA 1JXJA 2OLSA 1XKJA 3U57A 5CBJA 2WOQA 4W85A 1WUEA 3UJEA 2NXIA 3ZR4A 4J3UA 4QSFA 1UR8A 3TV8A 4QQ3A 4YJ5A 3I7QA 2FVMA 5EMLA 1DJXA 1GGOA 1PBGA 1YQ2A 1S1RA 3JR2A 2OO6A 4EPEC 1HN1A 4AF0B 5D2WA 3L66A 4AYSA 5F7UA 1SZEA 1PE1A 5CPOA 4PULA 5DCBA 4GZIA 4Z2KA 1QNRA 3W00A 3RFAA 4DO5A 3JUGA 4IJRA 5TD4A 3FJ4A 4W8BA 2C0AA 1HQTA 4REQA 1SSDA 3BGAA 1LQAA 3QHNA 3EBVA 3OBAA 3KOYA 4LSBA 4XWUA 1UKTA 4IUGA 1TYGA 5HK4A 3WBEA 3UWYA 4V1XA 5H8PA 4HSHA 5AHNA 2A6NA 4MAZA 2WHLA 4I6VA 2WMIA 3FSUA 3FDGA 4Q4MA 1Q63A 4KWVA 3DFTA 2CESA 3FOKA 3C2FA 3CUIA 1UZHA 5C6MA 2C8NA 3O0FA 1Z42A 2QIWA 3WLQA 1IZJA 1UKPA 1REQA 2QVHA 1QRQA 1XIIA 1GT8A 2EBNA 4GQQA 2VUYA 1A5UA 4WDXA 1GQNA 1UWUA 3GD6A 3NQDA 3WLNA 4X0NA 1EC8A 1F3TA 1EXPA 4O0QA 1W5NA 5HXMA 5A8GA 1YE6A 4PN2A 4QDPA 4PL1A 1EX5A 3ZVHB 3A4XA 4LRSA 4O54A 1L6GA 3VUSA 2QUMA 4MUZA 3F7JA 5C71A 2PD9A 4UQEA 4CD4A 4Z2GA 2ISWA 1JUKA 3C0LA 1AMYA 1E40A 2DJLA 5U7SA 4CN6A 4DXXA 3TKFA 4AHQA 3WMLA 4JAWA 4MKSA 4WZHA 3IIPA 5ABFB 3M41A 1U2YA 3QHOA 4PUWA 4RE2A 3ZJ8A 4J3TA 3MA8A 4I8DA 4Z1CA 4XK2A 1I0DA 2H8ZA 5F2IA 4XZ9A 3DBPA 3SN1A 1UC5A 2YCJA 3C3UA 3NQBA 2PP0A 2GDQA 3LQGA 3MJMA 4E2VA 2WAGA 2XM1A 2DH2A 3LD5A 1KFLA 2VNCA 3LV6A 1XD1A 4ERGA 2Y8VA 5KTLA 1XSJA 4L64A 4O28A 3V3WA 3GDMA 3NNTA 3GG7A 4YN5A 4NZJA 1GJWA 2OWWA 3HFYA 3LM7A 4HOWA 2KZHA 1Z41A 2WK2A 1ADOA 1XDMA 3IEBA 3LPOA 2ZX5A 3W7RA 5DO8A 1GTHA 1RVGA 1YDVA 2EEXA 4FLSA 1QVBA 1WBHA 3CUXA 3UZZA 4DXKA 3CHCA 1TA3B 4F48A 3FA3A 1YNPA 1BPLB 2X2YA 4EXQA 4YS1A 4IMCA 4Q8NA 3TC6A 3BOXA 1SO6A 1E73M 3PBVA 1TG7A 1HIZA 2OB3A 3VNJA 3TOYA 2ZXBA 1GOMA 1Y65A 5BOEA 1OCBA 1S5NA 2BLEA 3VNYA 4JN7A 1WKEA 3UQNA 3BANA 4A05A 4NYYA 4MPKA 1K4HA 3GTNA 1GHRA 2WSRA 1XDJA 5AC4A 2XFRA 4PMQA 1V08A 2CLHA 5FF2A 3PANA 2E40A 3CHEA 3L4TA 4LUSB 5EYWA 4W7VA 2QVNA 4NRSA 3G1RA 5CLTA 3WDRA 3I65A 1XCWA 3K1GA 1A49A 1XUZA 2EG7A 2IKGA 3QTPA 3Q4DA 5PTDA 4YVPA 4R34A 3A12A 3MBFA 1VFHA 4LVDA 4KPLA 1X7IA 3P8JA 1E6PA 4Z2IA 1QOQA 1XKYA 4KWUA 3DG7A 1TR9A 3GYCA 4A3HA 1XYFA 4PUMA 3AYTA 3ONCA 1WZAA 3GW3A 4AW7A 4AHOA 3GIYA 2GVJA 1D3GA 5LYRA 5EFFA 1R3SA 1JYNA 4J35A 2ZZ2A 4W93A 3UYCA 3LCIA 2ONEA 1EXBA 4HPXA 3GC4A 3PBUA 1KWGA 2GJXB 3BLFA 4GWEA 4R53A 4L4PA 1UBPC 2X1RA 3WYZA 2BTMA 3MP4A 2B7NA 4GH1A 3C2VA 1DWGM 3JW7A 3ZIZA 4I5XA 4IXHA 3NPVA 3UZJA 4GMEA 2DQWA 4IMGA 4XD4A 4PR4A 2ATMA 1EKOA 5GNYA 3MI2A 4UQCA 5E0KA 4M1BA 2NV9A 4YVVA 2HNEA 4QE4A 1VCVA 5I3FA 1XYMA 4ENLA 4JTCA 4TOQA 1E0WA 1SW3A 2D0HA 5SWUA 5LKYA 2VVSA 3V16A 4ATWA 4EPKA 3BCJA 4L9ZA 3FAXA 3OJGA 4MOZA 1PHWA 2ZA3A 1OD8A 2Q09A 4RR4A 1RCXB 3WLOA 4JKLA 2FH8A 4P7LA 1PTGA 5G1MA 1B30A 4AD1A 3G77A 3MKKA 4JQ1A 4H6QA 3MANA 4WVXA 1AZ1A 3G1VA 2VFGA 3ITVA 3UWVA 5IHRA 4L5ZA 2NSOA 4JFSA 3V1PA 4Y9MA 3E0WA 3NL2A 3DH7A 2WPGA 1B3YA 2PDMA 1JUEA 5JBEA 3WDHA 2OGYA 2VCAA 4ERAA 3PPFA 4AZBA 3KTCA 4IIDA 2OR2A 1ZBCA 4BEQA 4QJ5B 5KEZA 2IXVA 1ZAIA 4NL1A 3VFLA 3G6LA 5CZJA 2AL2B 3C86A 4JZ5A 4O17A 3JZEA 1OZMA 1A5OC 4O16A 1V6VA 2GJLA 4YCOA 3M6YA 1H7RA 1UD6A 4QS6A 2WSPA 4QR6A 3VNMA 4XUYA 2PTYA 4NAFA 4E3TA 7A3HA 2J7BA 2HSAA 1E1EA 5IOBA 3P61A 1EJXC 4CKQA 5HWMA 2XZ7A 3VI2A 3ARUA 3GXPA 1T99A 3LHTA 3TWBA 4LAZA 3H22A 3B8SA 1AQ0A 4E6MA 5KINA 2PAJA 3FFSA 3RPTA 1SM9A 2D3NA 1M68A 4BFAA 5A5WA 3GXTA 4AEFA 4DJEA 3MSGA 1MW0A 3S1VA 2VEIA 4PTNA 5DT5A 1CGTA 2PGWA 1PIGA 3UY7A 1EQPA 2P53A 4WSKA 3S2NA 2DZSA 1CEOA 1U1JA 4AIEA 4XZLX 1NH6A 3ZLHA 3A21A 2RKXA 3VZYA 2DVXA 1S5TA 5A8QA 3RM8A 3CV6A 3ZO9A 2YDSA 1PXGA 3WL0A 4Q8OA 3W26A 3M43A 1O7AA 2PEVA 5D2XA 1H7OA 4W5ZA 1KLYA 1F74A 2QCLA 1TWIA 4LYRA 2GFTA 4HSOA 2AL1A 3KRBA 4HNTA 1MQPA 1CYGA 3ZSSA 1P0DA 4CNTA 3GO2A 1JJKA 3ZM8A 4QJ4B 2B0MA 2PFHA 3N11A 4HZ7A 3HIJA 3L7RA 2VL4A 3IUDA 4UC5A 3A64A 4FNRA 3KP1A 2J13A 4ADTA 2IKHA 3U2OA 1XLFA 4CUCA 1DL3A 1TE6A 2AAAA 3PZ9A 4GVFA 3VFCA 1JNDA 4M7TA 1C9WA 5LHFA 2OODA 2XSXA 2PA6A 4B5UA 3N2XA 3AXMA 1EGMA 4HU8A 3TROA 4JIEA 4MKVA 1OK6A 2PDWA 3L4ZA 3KE0A 3UXIA 2PP1A 3LS9A 3EDDA 1R46A 1P43A 4AZGA 4FNQA 1FFQA 3UR2A 4FS9A 2D1ZA 4AC1X 4DHGA 3VIJA 1ZNNA 3M5YA 1K8YA 1JDEA 4TTGA 1E71M 5IFTA 1YXCA 3T07A 5D33A 4K36A 5H8UA 2YCKX 2P3EA 3L5LA 5CGTA 1ZCCA 4LC6A 4H41A 3LYEA 3CAKA 1J4EA 3SI9A 3FEMA 1KXHA 1LRNA 3HQOA 4KGJA 4NJGA 1LUCA 3FEQA 3WF3A 2A3BA 3RN6A 5G5IA 1OYAA 2VWTA 4OGZA 1XISA 2XVKA 3WKZA 4HN8A 1DJQA 4CD6A 3RCNA 4N02A 3QKEA 4H7CA 4WIWA 2H90A 5GNZA 5CSRA 3WEOA 1Q5MA 5HWNA 3QGVA 1IT8A 1VPXA 1EJSC 3PK7A 4ERIA 2WO5A 2OZTA 2QHAA 2BX7A 4E2BA 2PWVA 1X1NA 2P10A 2ASHA 3W74A 2J88A 4WCJA 1M03A 3KBNA 4AHPA 1X39A 2V9DA 4IL2A 1GJPA 4PZVA 1WDSA 1V02A 2PMQA 3VILA 3IUHA 2DT2A 4WKHA 3VNZA 3CAVA 2Y24A 5F1UA 5B7ZA 2ISDA 1OIFA 1XF0A 3BLEA 4UMCA 2BSLA 1HTIA 2IPWA 4B9YA 1GW1A 3H4XA 4PCTA 1I9CB 3DENA 3WF0A 4JFUA 1BSIA 1KBKA 3MDWA 1B90A 1M04A 1LLZA 3EX3A 5H2ZA 3M0JA 3GR4A 3KOXA 2FPYA 2EJAA 3FW6A 4GABA 1FH7A 4D1JA 3CV7A 5DELA 1BFNA 1H41A 1T8XA 2DY3A 3ZWSA 2J7HA 3NO3A 1DIOA 3NZQA 2R24A 4J27A 3W7OA 2XM2A 1CWYA 3GM8A 1NQ6A 3W6YA 4MY8A 3RPDA 1OX5A 2Z1SA 2JIWA 4GQRA 4QNEA 3TONA 2C18A 2HQAA 3QMSA 1YTEA 5EL1A 5AHLA 1XXXA 2YFOA 5ECUA 1HKWA 3S47A 4DO7A 2Y85A 2CKRA 4QISA 1DKWA 4MLRA 4QEHA 2NZLA 3STFA 4H4IA 2ZIDA 4ZSTA 1FP9A 3SY8A 2EF9A 3V36A 1TUXA 1ONWA 2GYIA 1S1PA 1DIDA 4NG3A 2XIIA 3EEGA 6TAAA 3W2LA 2QF7A 1TWSA 3DKJA 1UR3M 4JHOA 3UR7A 1OFOA 1XFCA 3W6LA 1VC4A 1D2KA 3EWWA 2TAAA 3QW4B 3T2OA 3PZNA 4FX7A 2G37A 1KCKA 1RQEA 2Z2AA 3B3DA 1FTXA 4FOUA 1UJQA 2ZYFA 5I24A 1OZQA 3RM4A 3A5VA 4KWWA 3Q94A 4L4MA 3OA5A 2XVPA 3FX4A 2FDSA 2PZNA 3W53A 3IGXA 3BAXA 4F40A 1V3KA 2J24A 1OGSA 4X60A 4E2DA 4WD0A 1UA7A 3AHYA 4DWSD 5A6KA 4W84A 4GGHA 2HBVA 4O8RA 1W1PA 4MFEA 4RW5A 4FNPA 1ODZA 1A3HA 3UA3A 1LYXA 2Y89A 3SRHA 2A3CA 3R11A 3PG8A 5DMLA 1E1CA 3QMTA 3NSNA 5AZ0A 4PA8A 1A50A 4C6EA 1V7YA 1TJRA 1UD2A 2IPFA 1VR6A 4Y7EA 3B8TA 3VCRA 2DSUA 1AQMA 5FAJA 3EKGA 1V6WA 2X0YA 1Q6GA 1K02A 3C2YA 4C6MA 2WWCA 3CU2A 4DF1A 1H61A 3TLLA 2HK0A 4IG2B 1XLKA 4H00A 2VD9A 2HVOA 1V0NA 3O2LA 1NDZA 1WB0A 4DUVA 1DV7A 3I6TA 1ZGDA 3EWUA 4NZ1A 5B80A 1I45A 4IMAA 3A4AA 3LV5A 2AQWA 2BDQA 2QGYA 4GGBA 5DFAA 5DBTA 3SECA 2V6AA 1RH9A 1GVQA 5DT7A 3C8FA 4ACZA 3QBUA 2G3JA 4JTSA 4O1BA 3OGSA 1EEXA 2NT0A 1PIFA 4GRSA 3LX9A 3P8IA 4P8VA 3EKZA 3KFTA 2WMJA 3VD5A 2E25A 1GORA 4ZO6A 5AZ1A 3D3FA 3UR5A 3QFEA 2YL6A 3HU7A 1ISZA 1OWQA 3G3MA 1OGGA 1V6YA 4NKCA 4GNVA 3G1XA 3EDEA 4TX9A 4A8RA 3OZOA 4GINA 1VJZA 3DYMA 3DFHA 1EA9C 2RUSA 4M8UA 2QR6A 3NTYA 1X98A 3AS2A 4EKJA 1IF2A 4H8UA 3ABQA 1JZ5A 3QPYA 4Q8QA 4IQEA 4ZQCA 3W7NA 4B5TA 1PX8A 1F73A 3NUKA 2EQDA 4FX8A 2Q01A 4AZ5A 3SCRA 1E4MM 2B31A 2PURA 1BRLB 3EAUA 2V67A 4O11A 1CBGA 1YPIA 4ZOBA 2QULA 3T44A 2QV5A 3M5XA 4GYKA 4MDOA 3L23A 2CLIA 3TE9A 3WJZA 2ZE0A 5C9XA 3T0BA 1RY8A 3NGFA 4B3LA 2NX9A 3VOGA 1M1BA 1EJ7L 4OZOA 3S8HA 3CIXA 4JNYA 1RPXA 1MMFA 4ICMA 2I14A 4CVUA 5BRBA 1WXJA 1F4AA 3OLDA 3S46A 3AQUA 3RAOA 1AG1O 4INFA 2G3MA 1MXGA 3ARQA 5I3JA 4JIHA 1HW6A 4LS1A 4PMJA 2PTXA 3LCLA 5K4ZA 1QJWA 2J7DA 3EYPA 1KXQA 3TNBA 3BSGA 3LSBA 3S2CA 1W3LA 4F9DA 4NU7A 1NP2A 1ONRA 3MHGA 3LI0A 2REQA 3G6MA 3QY7A 3HN3A 4ASTA 4NRRA 4C6CA 4AWTA 2PDPA 1IWBA 1FRBA 4LBSA 1RJQA 9XIMA 2FDMA 4CNNA 4BY3A 2PGEA 5T8GA 4I9TA 1JI1A 2PLKA 2R8WA 3A13A 3N6QA 2X09A 4MVAA 1T7LA 1KFEA 4KIRA 3NM1A 3GX9A 1VBHA 1DTNA 2WLZA 2IKIA 3COTA 4AB4A 3P62A 5GPRA 1DEDA 4X61A 5AVNA 2ZRWA 3ISIX 3ARPA 3BK0A 4KCUA 3VDGA 1J0IA 3M0IA 4A2RA 1XLJA 3ZJ6A 4MJZA 2HZGA 5K9CA 3PBGA 2VGIA 4R7OA 3FJNA 5D8WA 3KDNA 3WF1A 2XJ7A 1I1WA 1GK8A 1SZFA 5CGQA 4QAIA 1ONXA 3BSMA 3N2TA 5K4XA 1UZ4A 2AKZA 3SRDA 4UQDA 4C5ZA 4S1FA 4TIMA 1BEUA 3CO8A 4OTKA 1V3HA 4WJ8A 2D2HA 2OSXA 3UCQA 4F0KA 1W3KA 4C6KA 2XFFA 4N7QA 3R0KA 1GPWA 3BLIA 4NVTA 2VRQA 4LVGA 2DDXA 4ZSUA 1Z7AA 1QPQA 5JIWA 3GS6A 4NJKA 3S3GA 1RAKA 3TTYA 1GOKA 1JRBA 3J7HA 3U0HA 3GAKA 1YPXA 3W25A 3TX9A 5BWFA 4PYSA 2VEGA 1VFTA 3CPGA 1A4LA 4R7WA 4ORIA 3TOPA 1LF1A 3EKLA 2BY1A 1U5VA 3AWOA 1E15A 3SADA 1QR7A 3K1DA 3VIMA 1JR1A 1QU4A 1MQRA 2W0UA 3L2IA 2EPNA 4QE1A 4LF1A 1EGZA 3FK4A 3VGFA 4CGTA 2BODX 1E70M 1GQJA 4KWOA 5CJMA 4HNCA 3CQKA 4DNMA 1JF6A 2WSYA 5LIYX 1QWKA 4NX0A 4MJ4A 5J5DA 5EBAA 5HQLA 2F84A 1JEZA 4L4OA 4BI5A 5M2FX 3MPGA 4US6A 3KHJA 3QH2A 3C61A 4N9DA 7TAAA 1XV8A 2YLAA 4WY0A 2O55A 4JQAA 1R3VA 1XIHA 4MKNA 3A3HA 3H2AA 2GQ9A 4BR1A 2X0SA 1KBJA 4IPNB 5C55A 1CT5A 5BWAA 3N13A 2UY5A 2WQDA 4HOZA 1R3QA 1ZLPA 2ISFA 4XSLA 3T0AA 3M44A 3C0QA 2DQXA 4GZEA 4RW3A 3DKLA 1XDLA 2CLKA 1W5MA 3NL6A 4DF2A 4J3VA 3TN6A 1DHKA 2VO5A 2WZTA 2FVKA 4NHVA 1DWIM 5CLWA 3SRKA 1SJBA 1YPFA 2YL9A 4PL2A 1W2VA 3TYZA 4H9MA 3S83A 3UEQA 1Q85A 1W1IE 4DVOA 3GZ3A 3AHZA 5HATA 3CQJA 2BBFA 1LG2A 2CETA 1CCWB 4YYCA 3ALFA 3LLFA 1FWSA 3AMGA 3F2BA 1SJDA 2PSNA 1M41A 1UR2A 1O12A 1V3LA 2X0HA 1UZDA 3FYYA 5JBFA 2X16A 4NASA 3Q45A 4UFLA 1B3ZA 4KEUA 3LUTA 3S4TA 3D5HA 3UP8A 3B04A 3W70A 2B4GA 2I16A 1HL8A 1LP6A 2ACRA 3VZZA 1V0KA 1O4UA 1R9XA 2UZ9A 2E6YA 4DWSA 3QV6A 3PUDA 4AIOA 2EGZA 3ANYA 4IICA 1A3XA 3MHUA 4KEMA 5E70A 1TIWA 2E1DA 4ICCX 3IRDA 3BW2A 4JQ2A 1HZYA 3W2UA 3PZMA 1SZRA 3CBWA 3L67A 2BHYA 4MB3A 1MEWA 2VEKA 2VGBA 4MUPA 1L6WA 4FSAA 1LT8A 1HVQA 4B16A 3LHVA 4O19A 3QVQA 1W9XA 2J74A 4WDWA 3VGDA 1S3HA 1JPIA 3O6YX 1F2JA 2OQLA 5D2YA 3V7PA 1R6WA 2I5GA 4LUTB 3CPUA 1NWRA 2FYMA 3E5BA 5FAGA 3NQ7A 4EAYA 4YMZA 2WLYA 3WH8A 3MUZ1 4IZGA 4LCRA 3AXHA 1J0YA 1X6LA 2R1PA 2ZA1A 3K4AA 4KH2A 3TJXA 2Y61A 4C7GA 2QMKA 2CLFA 2GVLA 5AHMA 5AHIA 4Q8UA 1XC4A 3LENA 1UG6A 1B4EA 2X30A 4E2OA 1L9WA 4CNOA 1QXLA 4MTVA 3RLUA 4GQGA 3BLDA 2GOKA 3TTOA 2Q8XA 4QLLA 5FSDC 4CQDA 3ECQA 4O52A 4JPGA 4UQ9A 4UZSA 2OOFA 4ML4A 2PDBA 2F6UA 1BVZA 3B97A 1PIIA 1EIBA 4HJFA 3PULA 3WLRA 1Y5WA 4B90A 1HJSA 4AZIA 2MNRA 3NZPA 3ABOA 3GBEA 3U2ZA 3BJTA 1UQYA 4DAFA 1R3TA 2ZRZA 1SO3A 3CZJA 2J66A 1JCTA 2ACSA 3BPWA 3C0SA 1W5PA 3KTXA 3ANUA 1TVLA 2CHNA 3B9OA 4GISA 3KW3A 3HJEA 2J47A 4FALA 4Q8PA 3TDFA 2BNJA 4FB7A 1L0PA 2WNNA 1M9HA 3GNDA 4TMBA 3P84A 2WJFA 1AW5A 4H6KA 5DX7A 3TYAA 2AKMA 2VTFA 3KM8A 4DBEA 1PHQA 4NZ5A 1QI5A 5E9XA 3N34A 3GFZA 4J4KA 3ZLGA 2PU1A 2PF8A 1KKRA 5CEWA 3S9YA 2PDJA 2WCGA 2X40A 3H21A 3AUJA 3M7SA 3RHGA 2JEQA 3H2NA 3GC5A 4IGHA 4EANA 5TIMA 2ZADA 3OODA 2E8YA 1R2RA 3VU2A 1ONEA 3VGGA 5MF5A 2BGQA 4L4LA 4GC4A 3KVKA 3SGZA 3C52A 1G69A 3EWYA 5BW6A 4WJEA 1A0EA 2C1HA 1MXDA 3G1YA 3UBPC 4HCDA 4C90A 4I7VA 1WUFA 1YEYA 1A0CA 1GKQA 5DANA 5LSMA 2VX7A 1GWJA 3UXKA 4GXPA 5IBXC 3FS2A 3EPMA 3TW6A 4AY8A 4QP0A 2BVTA 3MW7A 1EP1A 2Z1WA 5AFDA 1WE5A 2G3IA 4AZHA 4BI6A 3TSMA 4RZ6A 4NAEA 3SB0A 3RXZA 1ZBVA 3MUXA 2ISVA 7CGTA 2BB0A 4NYUA 1DORA 2Q6ZA 2JF6A 2OVLA 1Z48A 2YDQA 1F5ZA 1MUCA 3F03K 3GNXA 4MY9A 1UR1A 4HYVA 4ZQMA 2VENA 3W1QA 5HANA 2ZDSA 1IXOA 1GG1A 4WDTA 2YCEA 1FCUA 2DZWA 3T0CA 1TVNA 3VKJA 3WENA 3C8NA 4DUWA 4D6DA 2A2IA 3TR2A 5BU9A 4IX0A 1B5TA 5LGZA 2XH4A 3RCMA 3SN0A 3KX6A 1KM4A 1W1B1 4F66A 5FF3A 1TPB1 4MADA 1MQQA 2GQ8A 1F4HA 2C3ZA 4CCDA 4DELA 5CKSA 3GDLA 1QBBA 2OYKA 3WLLA 1AFSA 4XX6A 4UCFA 3UXAA 3TZFA 4DPQA 4MZ8A 4L56A 1VJSA 1NEYA 4XBJA 1Q66A 5I06A 4WJXA 2AGTA 4K7VA 1OC6A 5CC6A 4H7VA 1TMHA 1LCOA 3POHA 2ALDA 4HHLA 4ZCWA 1BQGA 2GK1A 1G4PA 1BLIA 2C71A 1ZJIA 4XAGA 3L65A 1SFTA 5CGMA 3WQ6A 5CXPA 2Z6IA 5HNTA 3FNDA 4A3QA 3DHFA 3MO4A 3MUCA 4JTUA 1HJWA 1W3HA 3G1HA 4KRUA 2F7FA 3BICA 4PMXA 4YLWA 1VJIA 3SURA 1AUSL 1FWIC 3CTTA 3IWPA 2VOTA 4BF7A 1B57A 3PB2A 4DYKA 4PTDA 2OMAA 2W62A 5CCZA 2AQVA 1CXHA 1VENA 4JX4A 5KZDA 3H7VA 1UQZA 4LBUA 3IIOA 3PTQA 4V27A 3JS3A 3M0LA 3H24A 3QF0A 3PFRA 2C19A 5GQBA 3WMBA 4QCFA 2G41A 3P5ZA 4Y9PA 3GG1A 4JIQA 3N9RA 4B5WA 3RR4A 3IACA 2HS6A 3BLOA 2PDXA 1TKKA 5C54A 3NDOA 1GYLA 4KFPA 3OG2A 4HA3A 2VX6A 3CL8A 1VYPX 4QGCA 1UR0A 5G4WA 2QDEA 2OJPA 2F8QA 2ZWZA 4ZQNA 2EKGA 4C1KA 4JOMA 1R38A 1FWTA 3NZ1A 3EX1A 2DZUA 3TJIA 4O4WA 2WZIA 1BF6A 1TB3A 3W76A 1U5HA 1YLVA 1ZL1A 3N04A 3LCXA 3R12A 3W7LA 1XLBA 3VGEA 4HJWA 3TIMA 3F4NA 2FHFA 4WQ6A 1CW2A 2VCBA 3G0SA 2ZUTA 1YBQB 4HHPA 4XZWA 2YOCA 1RBOB 1JL8A 2HCVA 2V69A 1XIDA 5T91A 1DJHA 1E43A 5DEZA 3VNDA 3WG6A 3QOKA 5IM51 2GWGA 1XL9A 3TEVA 2JFEX 4E3VA 1XICA 1Q2SA 1R85A 4YWSA 5K3VA 5D30A 1FOBA 4GQ0A 3NXFA 4JNMA 3IGHX 4F79A 1B0IA 1U30A 4RK8A 2DZPA 3EXTA 3S5NA 1V93A 3M5ZA 4IUOA 3PHAA 3WNPA 3HV9A 3R8GA 3RNDA 4FOKA 3WQGA 1BQCA 3N3TA 5A3HA 3HGRA 4OUEA 4OWGA 1DE5A 1G9HA 5A6BA 4UB9A 3W7CA 4PUNA 4WKFA 1KCLA 1EDGA 4PUDA 3WH7A 1SQ7A 1W37A 3FHAA 3AOFA 2A0NA 3U9IA 3HPFA 4JXCA 1KB3A 3PVFA 1UROA 1GVOA 4HU0A 3I3EA 4FI4A 3M0HA 3OHIA 2A7RA 4J3WA 5I3KA 3ZQ9A 1Y8BA 2XIQA 3GXIA 3GAYA 3NYDA 5DBUA 4Q7BA 1G01A 4CCEA 3ES8A 1XSKA 3SBFA 3K2GA 3CNYA 5LIXX 4R27A 4TU1A 3VIKA 1JZ7A 5AHFA 5HWJA 1TWWA 4P8WA 4LCQA 4GOAA 8XIMA 1PKMA 1G5AA 1T0OA 2ACQA 3UJSA 3GFXA 1RSCA 4RPPA 1VCFA 2BOFX 3E74A 2E5DA 1KXVA 3CQIA 4BCEA 1UWSA 4C7DA 3NQ2A 4WXYA 1F6KA 2X1TA 2E5BA 4Q8VA 2P8BA 5FACA 2REQB 5I00A 3I3DA 3TN5A 3C2EA 3H2FA 3XISA 4JBRA 1DQUA 3ZFHA 3HJZA 2YIHA 2XWDA 3GXNA 5HOSA 5A8OA 3WSUA 3EX6A 3HG5A 4QIUA 4JD4A 1QPNA 4R7JA 4C1NA 3LTPA 4O13A 2B7PA 3TTQA 2PBGA 1W91A 4ZA0A 1JDCA 5EMJA 3APYA 3THQA 4I7UA 4AIBA 4BQ2A 1EO5A 3LRMA 1J18A 4WY0F 2D20A 3CQ0A 4H9VA 1A5KC 1K77A 3PWAA 3E0IA 3R4IA 3TXVA 4NZCA 4FA3A 3OZMA 2XZ9A 1OYBA 3R13A 3R5EA 2P50A 3QN3A 2CLOA 1V0LA 1GOQA 5A6AA 1SMAA 2Z27A 3CT2A 1I0BA 4IGMA 2ZRUA 3NVDA 3IVTA 1Z69A 1EPVA 2XU2A 1W3NA 4KCVA 4Z1AA 1BYCA 3G24A 3PS7A 5HNUA 2QUUA 2DW7A 4GG9A 4QEEA 1PCWA 1E0VA 1EWEA 4EP8C 5CAKA 1Q7QA 2VR5A 3GY1A 1NOWA 3I3BA 1AQHA 3W0KA 3QTGA 1FWCC 2WJDA 1BGAA 2HWGA 3W7QA 4WGXA 4MB5A 4G5DA 1VHCA 4IIHA 1E72M 3KS6A 4N4PA 3OQ8A 2ISSA 2IPGA 5E09A 4K8GA 3TAKA 2A5HA 3GHSA 3GLCA 4D2JA 1WDRA 1VBRA 1IGSA 3A47A 4Y2WA 5D9OA 4H9TA 4AD2A 4NF7A 2UBPC 3UXLA 4XQ6A 4LYPA 4ACYA 3T81A 1C29A 4S3FA 5C2XA 3TWAA 4NJHA 3W82A 4B15A 3DN5A 4Z17A 1X1ZA 4MWAB 3VNIA 3ARXA 4R85A 4UTTC 3QV7A 5I23A 3G1FA 3MZNA 1ECQA 3B8UA 5JQ9A 3LOTA 1X6UA 1PDYA 3VE7A 3UG3A 1VZWA 2J7CA 1U33A 5C9ZA 2QJGA 3A5FA 3UG8A 1BG4A 2E5CA 2VFDA 3LCHA 3Q58A 2GLKA 3G0UA 2EAWA 3S0CA 1XYAA 1UZ1A 2CBUA 7REQA 4JICA 1XIJA 4A3UA 1JCYA 1YXDA 3U3HA 1C7SA 1Q6LA 4K39A 4B5VA 2G3NA 1ODUA 3VIFA 3AIVA 3FHQA 3K46A 3QQ1A 2DIJA 3FY1A 1J01A 1RCOB 2YZRA 4B4HA 2B7OA 3BAYA 4G7EB 2IQTA 4GX8A 3M4HA 3VIOA 2CERA 2TODA 4G2DA 3NQVA 1E9IA 3U7BA 2O7SA 5IRPA 1C8XA 1B2YA 3WLPA 3V5FA 2VM8A 3STEA 1QAPA 3RLGA 2QJMA 4MG4A 4LY8A 1D3CA 3WK2A 4XKMA 4OVXA 3OLEA 4B4FA 5HAOA 1BYDA 2WMFA 4BKNA 2QJNA 4UTMA 4F0LA 1TWDA 1K9DA 3T2PA 2FZMA 5E0FA 4IGSA 3BJSA 3FKRA 3WJYA 4I5UA 2GDVA 3VOCA 2PWFA 1KR0A 3TXZA 1JPMA 1TZZA 3G5EA 1XQLA 3OYXA 4UTWC 2WMGA 1GG0A 1J0ZA 1UH2A 2O4MA 1FX6A 3ID7A 2OKTA 1BTMA 4NZFA 4H9YA 1HO1A 3RDKA 3VDHA 4MNMA 1KTNA 4MNLA 1Z3NA 3HPAA 3PR2A 3NPUA 4JGDA 4OT7A 4TXEA 1S46A 2DUXA 1WXZA 2FZDA 4IJCA 2QCFA 1JZ4A 3NEHA 2D3LA 1MVYA 1F8MA 3QQ0A 4M0XA 4XG1A 3REQB 1G4SA 3SAZA 2BG5A 4HA1A 3OO2A 4JTHA 4LCSA 1KR1A 4RZ4A 1RQHA 3B9DA 1JI2A 3KZPA 2PS2A 5H1WA 1FHDA 3OBKA 2X1SA 1K9TA 3M7WA 1OCQA 4N4QA 1B3WA 1KTBA 1CGUA 5CC3A 2DPEA 2OCZA 2VX5A 3EWCA 3N14A 1T40A 1MUMA 3IV8A 3S6TA 3EX2A 1OCNA 3F1QA 4ZTYA 4YTUA 2YW3A 1KM1A 4M6VA 4PTWA 1XRVA 4F0MA 1OFRA 2NQJA 4XBKA 3O3RA 3PTDA 2TPSA 3SN4A 1XLHA 2H3BA 3NURA 1J93A 2E6AA 3H2CA 1EJTC 3NEVA 3KHDA 1UOKA 3DYOA 1NF0A 1J5TA 1OX4A 3GDKA 3HOJA 1I60A 1R2SA 3FYOA 3VINA 2HRWA 1UD5A 1P7TB 5FI8A 4FP1A 1UWRA 3LBOA 1V3JA 1PSCA 2A3HA 4S39A 5AY7A 1PX4A 4HU4A 1EWDA 1YADA 2CITA 1R30A 2G0WA 4DYEA 4FO4A 4PUEA 3UU0A 4O1FA 5I6SA 1ZALA 1WOBA 2R14A 2YJQA 3OTRA 2FH6A 1L6SA 3KWXA 4DUXA 4L6DA 1I2OA 3G8RA 3DDMA 5F4SA 2VELA 1R87A 3WLSA 4IP4A 2QJHA 3CWNA 1NTHA 5JH1A 1WNOA 3P7YA 1HX0A 3IJ8A 3QC3A 1HKJA 1HNYA 1MO0A 4I3GA 3AIRA 2GL5A 2E9MA 3HV8A 4O12A 2BFGA 1UW9A 1H3GA 2WWDA 2O9RA 1BXNA 4L1WA 4M80A 2VFEA 3DESA 4K8EA 1EZWA 4Q6XA 4D1IA 3GTXA 1XR2A 5I03A 1JULA 4D8ZA 3QY8A 4UTLA 3W29A 3E6EA 2ZKMX 3EOLA 4GVIA 6REQB 1XRSA 1WP6A 1JCMP 3W84A 3M07A 3SCVA 3IJ9A 3VX0A 3N4FA 3PNZA 3NQ6A 3M0XA 4CD8A 3HTWA 3B8VA 3NR0A 4R5EA 4E4UA 2Z6JA 4FHAA 3TZNA 2NVCA 4AQLA 3A23A 3O6DA 1P0EA 4HMEA 3O8AA 3QY6A 3B8DA 4N0RA 2ZUVA 3G1DA 3KWSA 4HKPA 3KBVA 3WO8A 2VDHA 3ITTA 2XH7A 3P3BA 3VIPA 2QF8A 2I57A 3S2MA 8TIMA 1W9DM 1S2VA 3LCWA 4IIFA 2RDXA 2V5BA 1BGGA 4DJDD 3BC9A 4NUWA 3H70A 5F1VA 4CN4A 5MKGA 1E6ZA 4JS3A 3WF2A 1YMYA 4AIUA 1K03A 3MB9A 3PN8A 4UTUA 1C8QA 4U3CA 4C6PA 4NAEB 3EPNA 3ITYA 3EB4A 4DBWA 2OT1A 1K9FA 4CNUA 2CLPA 3N29A 1IR2A 3VGHA 2VJXA 1H60A 5G2HA 4ZTXA 1WV2A 3SSZA 1XLLA 2YBUA 4PBGA 4LUIA 5CZSA 1QNVA 5LNSA 1FHVA 5AYBA 3PZTA 3HO8A 3AJXA 3DFSA 3L4WA 3NPWA 2P5NA 4J2MA 2WM1A 1IXPA 4RXFA 2YCIX 2ZC1A 1W8GA 3APGA 3GNNA 3M5VA 1K7XA 1WAWA 1S2TA 4W7UA 4AH7A 3R79A 3A3WA 2OSYA 4IXXA 2PDGA 4XKYA 2PDQA 3T09A 5LNVA 4QCEA 1U22A 1P5BA 3B40A 3EMQA 3H26A 4FNTA 2ZUUA 1GCYA 3UA4A 4HN4A 2BOEX 1LZOA 3KVMA 1C93A 2V63A 4ORMA 1WCGA 2DUAA 4US5D 3TAOA 1F8IA 4TV5A 3H4GA 5LNUA 1IGWA 3P80A 3SUSA 5AOUA 3B8IA 3F5JA 1GVFA 1ZP3A 3NO1A 1J79A 4LT9A 3IJQA 1JFXA 5EU9A 2WPBA 1PO9A 3LEPA 3LRKA 4GO8A 1XIEA 2OWXA 5CC7A 2BASA 4RCXA 2GK1B 2DSKA 3SGUA 4YNGA 3KVJA 5AKQA 5D37A 9XIAA 1XRTA 2CBJA 4HBKA 1HJVA 2OEKA 3KBSA 3VIIA 3ZJ7A 5IFPA 4N9BA 3O05A 3IARA 4XIMA 2ZUWA 1GKRA 3QZ6A 4AX6A 3DC0A 2JKAA 2GJRA 2VMFA 1O5XA 2NWSA 2Y5JA 3N6JA 5DLCA 2Y6ZA 3GTHA 1S39A 4GFSA 3KOWA 2PLMA 3DBNA 3TW9A 7XIMA 4PMZA 1O66A 3VMPA 3FGCA 3GTFA 1V4YA 3FJ6A 3O06A 4ZOEA 3NPXA 1I2RA 1ZBKA 2GGEA 2A6LA 4M5PA 1LQ0A 4MDPA 7TIMA 1C8YA 3A9BA 4KIEA 3DYPA 4WSHA 1IHIA 1V51A 1WAUA 4X9YA 1KM0A 2PRHA 3E9AA 4Y9OA 3MJYA 3B4UA 5LA2A 1R3WA 3MMUA 4IIEA 2IMRA 1FXPA 2VZOA 5CG0A 4GXWA 1RD6A 5FF7A 5I0DA 1Q3NA 1TTIA 4BK9A 3LRLA 4A6GA 2Z1BA 2C91A 3R89A 2FFCA 4L61A 1WDDA 3SGGA 4JIIX 4EXAA 1UD8A 2PRLA 1C9DA 5LIUX 1A5CA 1W17A 5DRCA 1H11A 4D6IA 3ATZA 2HXTA 4XD6A 4HHMA 5M5DA 3URBA 1A4MA 5G4HC 2FB2A 2ZX9A 3W83A 1EP3A 1ZPTA 2VVNA 2EHHA 3NQ8A 4PMOA 4TO8A 2QLYA 3AICA 3CAQA 4H19A 2I9EA 3KCLA 3WQCA 4C6OA 3CMGA 2WSKA 3IGUA 4GVGA 4M51A 1A5AA 1W9BM 3RF9A 3GVRA 4U5IA 5I78A 1VH7A 3HG2A 4EWJA 5E0CA 2HNHA 2FFIA 3M9YA 1VP5A 1EYEA 3L5MA 3PZGA 1RV8A 4LAMA 5M1TA 2ANUA 1D8CA 1Q6QA 3WBAA 4KKXA 3CUFA 1C8VA 4GE8A 2PC4A 1ZS2A 3NGJA 4EE9A 3POCA 4C65A 1F7BA 4GACA 4IH3A 3FV9A 1KM3A 1S5VA 4O4VA 1TSIA 1ZTVA 2QPSA 2Y88A 1CB7B 3VX1A 2WYSA 2PD5A 2FJKA 4MIMA 4DEFA 1VPYA 2PDNA 2PBOA 2Q8ZA 3O63A 4Q33A 3W88A 4ALDA 4OV9A 4G9PA 4BQ3A 1XW8A 4S3DA 5GVJA 4CEUC 2XVLA 5ABEA 4JTDA 2QAFA 2V5LA 4I7WA 4UR9A 4GJJA 4GBUA 2ODOA 1DWHM 1EIXA 3ARYA 3UVIA 3VD7A 1IEQA 4ROPA 3U5UA 2O7QA 3H55A 2NX3A 5JU6A 3CWOX 1JXKA 5HUOA 3GFYA 3UVAA 1E55A 1FH9A 4B3KA 4AD3A 2YDAA 2Y63A 4FXFA 4XD5A 4CU8A 4PRWA 5A95A 3AI0A 1Q6DA 2FB3A 2Z26A 3LHUA 4FF5A 4TX6A 5C70A 3EMCA 1GVYA 3BV4A 2PDUA 3W1PA 4MJ2A 4GBDA 5A1AA 5KETA 3W73A 1ZFJA 4O1AA 2NLIA 4FR1A 4YTRA 4LW7A 1K6WA 1JPDX 4AUBA 2GGGA 1FP8A 2INEA 3WELA 4PFHA 4WK9A 3BCFA 3THUA 4AC7C 2UY2A 3USZA 4LF2A 3AYRA 3HG4A 2E68A 2WVUA 3H23A 1MFUA 1NWUA 1OB0A 2GDUA 3W7JA 1SJCA 3GDTA 5KSWA 2C6QA 3OA3A 3WD2A 3VIHA 4O18A 1VFSA 3MVTA 3MUY1 1AA1B 5IHSA 2WW5A 2PWHA 3M46A 3EB2A 4MAVA 2CC0A 1W1YA 1JPHA 2E1WA 1S38A 1QWGA 4W8AA 1OFEA 3PZUA 3OZPA 2VC5A 2HBXA 5EPDA 4DRSA 3RPMA 4JHMA 2DZBA 2H9AB 1DIEA 4D6GA 4ZOAA 3UT0A 4LQ1A 3LN3A 2P88A 2WB5A 4PB4A 4DJFC 4W87A 1QMLA 3GQYA 1H62A 1TUFA 1OD0A 3WQ5A 4S3BA 5J5RA 2XSBA 4H9XA 5L9FA 3BXWA 1UP3A 3XINA 1PPIA 4GYPC 1LLWA 4HYRA 3D46A 5CH9A 2Q8LA 5CSSA 1OM0A 1TV4A 3NWRA 1FWGC 3QYQA 4M6PA 3G2GA 3ATYA 1ENUA 1WKYA 2OSWA 1KW1A 1PTDA 4EVZA 5DY2A 3VCCA 4TTUA 1GYMA 3B0VC 1EC7A 1KWKA 2Q02A 5FJPA 2V5JA 2WV8A 2NQLA 2INFA 4WHBA 1SFLA 4B2DA 3BW4A 2WNQA 2A79A 1BXBA 3OVRA 1D8WA 2YXOA 3UWWA 1XINA 4S2BA 4EF9A 3DC8A 5FF4A 1W3JA 5HPCA 1JZ3A 1Q7MA 2POTA 3TTSA 5LIWX 1UWIA 3N15A 4LVBA 3ERPA 4ZFMA 4N9EA 1H1NA 3D0CA 3WK0A 1KFBA 3QGKC 4AF0A 3F5KA 5AECA 3Q65A 4DI8A 1R8LA 3QKZA 2C14A 2PWDA 1AD1A 4GUFA 4H6EA 4LY4A 2HK1A 2YFNA 1ESWA 3GBDA 3RK8A 1SW0A 3U5YA 1UOZA 1RXOB 4Y8FA 1TJPA 2YA1A 2HJPA 4M3PA 4LXFA 2G4JA 4LC8A 1TPVA 1GZGA 2QXWA 1JD7A 1GKPA 5I3GA 3OB8A 4GA8A 2YB1A 3I7SA 4TVDA 3E3HA 3NQAA 2TRSA 4L6HA 4FOJA 2IQDA 1E9LA 1ZJBA 3STCA 1S2CA 3GHRA 4R33A 1VYRA 4OV4A 4AEOA 5EFDA 1EL3A 4IJBA 2DIKA 1TO3A 3FN9A 3R58A 3OIXA 2QCDB 4U28A 1O5RA 2HMCA 3PG9A 4OBRA 4TX8A 2CEQA 3K8KA 2HDJA 4GFIA 4HHHA 1KKOA 5HNNA 3ZSTA 1AH3A 3NDZA 2VUNA 1PUDA 4UTFA 1UMYA 4W4QA 2DSWA 3DG6A 3I4EA 1MEHA 3A24A 2RJHA 1XYLA 2A3EA 1A5SA 4FXJA 5G1YA 1V79A 1Z32X 2WHJA 4Q3MA 2ZZ7A 4F2TA 4EACA 5TBOA 1GZ1A 3ZVHA 4IPIA 3DFQA 3F2CA 4JY8A 3B8WA 4FLRA 4JTAA 5KZMA 4OFCA 2FMNA 5IDIA 4DO6A 5FEXA 5FEWA 4HZ8A 4ZO9A 1QW9A 2FGZA 2R82A 4IGNA 1Q6FA 4EAMA 2WMHA 4AWUA 3W2KA 1EPXA 3P67A 3AFBA 3VOFA 1N55A 5IBXA 2HS8A 5ABFA 4IQDA 5K9XA 2ZZ5A 4LUJA 5I2UA 3L21A 1Y5VA 3AO0A 4N6EA 3U7VA 4DZAA 1H63A 1LORA 1FA2A 3W2JA 2OX1A 4EOUA 1JYWA 3PPGA 3UZ5A 1RK6A 2GPTA 4A4AA 4JTFA 3KL5A 3IANA 1R3RA 2J9XA 1QI4A 5C9WA 3VD4A 3ME3A 5EMUA 3FLUA 3VKDA 2ZOXA 3HA1A 4JYEA 4WR3A 2ZRVA 1A5MC 1CXLA 3P81A 1QHPA 4Q8MA 2VZTA 1DTUA 1UB3A 2XVGA 3L0KA 1LBFA 2A21A 3A3XA 4ZE4A 3TYEA 4QLKA 2E67A 3AU6A 2UY3A 4L6OA 4C6LA 4H01A 3TYDA 1P48A 4G1KA 5JIPA 4RZ5A 3R8RA 2PE4A 2IXUA 3AJ7A 1Z6KA 3CZLA 4RDZA 4V1YA 2DORA 4QTGA 1R7AA 3ARWA 4CVWA 4UMAA 5DQPA 3VC6A 4GPNA 1OINA 3T8LA 2OO0A 4F2UA 5C7HA 2JEPA 4HPJA 1POKA 5HMFA 3ZS4A 2C15A 3QFWA 4ZGYA 2WKGA 4NILA 3V0TA 3BE7A 3WD1A 3ARZA 2ZZ6A 1RCQA 1E0XA 3EMZA 4LFYA 1IEXA 2DZTA 1US2A 1EUNA 2XIOA 3UGVA 2ZZ4A 5E6ZA 4TUFA 4D6CA 3DFNA 4X63A 3TQKA 3SY5A 3BW3A 3QR3A 4IWWA 1M65A 1NELA 2OT0A 2QDGA 1WKDA 3UZWA 3GU9A 4V2XA 1KQYA 4FPSA 4JEQA 3W1RA 3EB3A 5LZLA 5HDRA 3DFPA 3W7GA 3USBA 4PEKA 1V0MA 1O1HA 3UW6A 4C6BA 1LOSA 1PTAA 1MNZA 3ABRA 1B31A 3FXGA 1BKSA 3TU9A 3UWQA 3L9CA 2KX9A 4CQ9A 2NXGA 3DFOA 2FZNA 3PBMA 4Z1BA 1IR1A 2PWEA 1N82A 2NWRA 4O0ZA 4R88A 3CH9A 1KNWA 1J11A 2WVVB 1K7EA 3RMJA 1EFZA 3QZEA 2DFAA 5LXEA 4YWIA 4UOJA 3W86A 4IQJA 1NOUA 3AMDA 3A22A 3GWQA 4BF5A 4HMNA 2GJXA 3CHVA 1XS2A 3EOUA 4FZIA 3HGSA 3DFYA 4IISA 2Y5EA 3MS8A 4AAJA 3F4WA 2CHRA 4Y96A 1SVDA 1G1YA 1QK2A 3BAIA 1BVNP 3DGBA 4HZMA 1H0GA 1LRQA 3MSDA 2D69A 2D73A 4DI9A 3PTMA 4XZHA 1ELSA 2CW6A 3WFLA 4HTYA 2C7FA 4XVDA 2CLMA 2QNEA 2O9PA 4L9YA 3W7MA 3QSRA 3CQHA 2I1OA 3V5OA 4E38A 3CUHA 4MZYA 4XD3A 3PAOA 4PMDA 1IT7A 2W5FA 3BSHA 4AMCA 2DSVA 1GQLA 1UR4A 1EOKA 3DEQA 3OIHA 4RX0A 4C6NA 2GVGA 3WY1A 1K6AA 1VFFA 4JCLA 1NWSA 4J5NA 4W9TA 5I02A 4QJ3B 1OX6A 5K7JA 1DJWA 1ZB5A 1TPC1 1VEPA 3TFXA 3IRSA 3RITA 4HTBA 1WKFA 3PAJA 3FA4A 3KLKA 1A47A 3VAVA 1RR2A 3WLIA 3R2GA 2UY4A 4L1XA 2AL2A 1T41A 1MEIA 3NQEA 2W92A 3G8EA 5A8PA 1D9EA 1FUYA 1VRDA 4HK6A 1ZAHA 3PTKA 3S1XA 3BWWA 4UOZA 1SZGA 4W7WA 2XIBA 4JL1A 4PSRA 1C3FA 2H8XA 3CMFA 2NQHA 2EO7A 3LHZA 2E28A 4PB3A 2Y7GA 1UASA 2BHUA 3K4DA 3B0PA 4OBSA 4P7NA 1BAGA 1GVRA 1UP2A 3HPZA 1VFLA 1Q6RA 3HMJG 1Q2RA 4IFKB 2BOGX 2EPOA 3QPZA 3VOIA 2BY2A 1BXCA 3VM5A 5CPMA 3DAQA 4XZBA 3WLKX 4FIRA 3OBEA 4XAZA 1BHGA 3V0SA 2QCEA 4K6AA 1GQIA 3ORWA 3D3AA 4RE3A 1W3TA 1BF2A 2J7FA 5F2GA 3WNLA 3CZEA 3FDKA 3WNNA 1TTQA 2Z0IA 5HNRA 5A94A 4YTTA 4FNSA 1ZY9A 2QCCA 1LM1A 3VYLA 1PWMA 4MB4A 1UD3A 1WDQA 3VUPA 4HMCA 4CQAA 3WD4A 3VD3A 4XTDA 3W9ZA 1UKQA 2INZA 4LX4A 4MWAC 2P76A 1XCXA 3M0MA 3DCPA 5U4NA 3QGAC 4NX5A 3MBDA 1XLDA 2BZNA 1JCLA 4A29A 4AZ6A 4JDYA 2XSAA 1G4EA 3N12A 4UZUA 4QG6A 3IIZA 3WLHA 4NP7A 2JBMA 1RP8A 2OZ8A 3S6OA 5DY3A 3C0JA 1TRIA 3ES7A 4XVEA 2VXNA 2YCLB 3EX4A 2V81A 1TWZA 2QUNA 5D9PA 1F05A 1W9VA 1A53A 3FJLA 3W28A 1E51A 4PC8A 1VD6A 2VR4A 1KO0A 1S5WA 2G96A 1ZUAX 1N7KA 1E6QM 2DU2A 2EPMX 2BXZA 1YHTA 5EB8A 3VCNA 2AMXA 1OFBA 1G7UA 1GONA 2V5KA 3O16A 3N9KA 2W9MA 3MP5A 4GVHA 3W71A 1UR9A 4I9JA 1DQWA 1ITCA 1FDJA 1JPKA 4RKAA 1VBUA 3RCYA 3S5ZA 1JGIA 1H1ZA 3S1WA 1MW3A 1A5NC 1I75A 3IAPA 4ZENA 3I6RA 3W6MA 1MUWA 3BV7A 5D4YA 1J0HA 1YIXA 3AS3A 2VYOA 4V15A 5D32A 2GQ3A 3V35A 4ECLA 2BVDA 3I68A 3VTRA 4C5YA 5CPTA 3U4AA 3TQ0A 3AWNA 1ME8A 2PLCA 3UZYA 4GYFA 2ZUSA 1VKFA 3RGTA 2PP3A 2X7WA 1P0NA 3VMOA 3W37A 3LNMA 1UUMA 1AVAA 4MSSA 4P8UA 4N42A 1KD0A 3B9EA 3TCEA 3TW7A 4IHCA 1XGDA 2W6RA 4GLEA 3L4VA 4XO7A 4XO6A 3SY1A 2VKZG 2H6RA 4ONVA 4YTQA 3K13A 3WX7A 2VEPA 4KT2A 4GI4A 3U4FA 1PS9A 5C0QA 3VKCA 3ZT7A 2BGNE 3KOFA 2WJEA 3UG4A 1SR0A 3LTYA 5FJOA 1LOLA 3SIZA 1SYTA 4GCXA 5G1TA 1JDAA 4A3RA 1XG3A 1IZKA 4IMDA 5HQMA 4U31A 2QJJA 3A4WA 1X97A 1FFRA 4UR7A 4PTVA 3TVAA 4FLOA 2WC3A 3E2QA 3FAWA 3VPLA 2QZRA 3JRKA 2YR1A 1KFCA 3IVSA 4URIA 3BUVA 5T26A 4PCFA 1W1A1 1CLKA 4UUIA 1MFVA 4O8AA 4UTTA 3ZMRA 4ES4A 1XCFA 3H2OA 2OG9A 1Q6CA 4M81A 2YLLA 1VPQA 5BXPA 2NT1A 1FWWA 1RUSA 4AVNA 1S2UA 3VVGA 4OKDA 2UWFA 4O57A 1HJUA 2QCGA 4PCSA 3W22A 3PSWA 4S2CA 4JTIA 4CQCA 2WCSA 4HNOA 1X1OA 3WLMA 4JTLA 3ENLA 1E3ZA 1NDVA 2XN1A 4S38A 2Y8KA 2EPKX 4GXMA 2YZ5A 4LS0A 3ITLA 1NFBA 4QROA 3I7RA 4Q4SA 2D2GA 5DXXA 4Q7IA 1KFJA 1DYSA 4RPQA 1BVWA 1E6SM 3VDBA 4LEFA 3G18A 4XISA 3T4CA 2FVLA 1EBGA 3ABZA 4LVAA 1FH8A 1EO7A 4ZB5A 4U5KA 3ITCA 3BQ5A 4H1ZA 1R9YA 2RDUA 3E0FA 3GG8A 4ILSA 2BHZA 1W8SA 3AU2A 1SPQA 2NX1A 1U83A 4ROQA 4REQB 2QUTA 3TSBA 3WLTA 4AZCA 1PZ1A 1ME7A 1XX1A 2ZC8A 1J6OA 4HSNA 3P0WA 1W6TA 1XBYA 2PCEA 2WMIB 3CUGA 3HURA 2E8ZA 3H6OA 2DP3A 1W5QA 2J62A 1FCBA 1W1ZA 3PZVA 3MTWA 3DI0A 6XIMA 3CASA 2W3ZA 4UTWA 1IEVA 5EGRA 3CEUA 1C92A 3FA5A 4HNLA 2XH0A 3GHUA 3GR7A 4LTSA 2DJXA 3LXAA 4Q32A 1REQB 4JCMA 2OZ3A 3UWEA 1LQ2A 1CZ1A 3ZOAA 4XBSA 1GVIA 3GZAA 1OHLA 2RGMA 4C1LA 4LEQA 2E3ZA 2OXNA 4DZHA 2GSEA 4A8LA 4S3GA 2I17A 2XPKA 3TTEA 3JZUA 1LBMA 4IG2A 1TTPA 3M0ZA 3BLKA 2AOSA 2XTKA 1CX9A 3N2OA 1KV5A 3S6DA 4H2HA 2OLHA 1OK4A 4S3JA 3IJDA 4MZ1A 3ZYZA 5HULA 4UTIA 1G4TA 4L9XA 3SJ3A 1H7NA 1X7FA 1LRTA 1TV7A 3DIPA 1TJ2A 3QR0A 4M29A 1MYRA 1E4NA 3BH4A 3LLXA 1M01A 2PB1A 5XINA 4K1WA 3KEHA 4ICNA 4DNHA 2Z29A 2PDIA 3LA4A 1R3YA 3HGOA 3ZZ1A 2PUZA 4ZL1A 4RJEA 4A21A 5JMUA 3GVVA 3HPXA 3LNPA 1HKMA 3P74A 1LL4A 4CQBA 5M3WA 3MC5A 5HPOA 1Q7ZA 1QOXA 1VBJA 1UH3A 2V3FA 1TMLA 3SUUA 4JIPA 3FVDA 2XGZA 1JGMA 1AODA 1CB2A 1UH4A 4ZO8A 3U2CA 2XISA 4O14A 4G8TA 4H9UA 3WLJA 1BRLA 5D02A 4QAWA 1UC4A 3CAWA 3AS1A 2DSZA 3EOOA 1DVJA 4PTXA 5FEZA 1XLEA 5ABGA 4C91A 4O50A 3Q2DA 6PTDA 4O1CA 3MO7A 4E4FA 3VXGA 4OQVA 3FXYA 1DWFM 3PC0A 4X2PA 1P0KA 4LVFA 2GWNA 1IQ8A 3DOPA 2WVSA 3WUGA 6XIAA 3SQMA 1JD9A 1TV8A 4PRTA 4BF9A 3UPWA 4PBFA 1DJYA 3UESA 2O56A 1XJBA 1EUAA 2OKOA 4LB3A 3KUMA 3E0LA 4PMRA 3HGJA 2CFFA 3HM7A 1XIMA 4PEEA 3DXIA 1W1TA 3UWUA 3OEXA 4GIEA 3AXKA 3TC3A 5BXRA 2GUUA 3U6WA 4UNKA 3LY0A 5DMYA 1SGJA 3GDRA 4LYQA 3RX3A 4A2SA 3CPRA 4YCPA 2VT0A 3QLDA 3BLPX 1J2WA 3QPEA 4H9ZA 2LLEA 1PWLA 1A0DA 2VFFA 4KERA 4DJFD 3T0DA 4QBXA 1XYZA 5EMMA 4ZXOA 3E2RA 4CNPA 1CIUA 3BJFA 4KQNA 1W31A 3HQPA 5CPQA 3GHTA 4MNJA 1AL7A 1OGBA 1NJJA 4ZXLA 5J8LA 2XYLA 2A85A 1NY1A 4QFUA 4Q6JA 3GK0A 4LS2A 1OY0A 1R86A 2DV0A 3SUVA 1ME9A 1M3UA 3MCNA 2WVTA 3CEPA 1V02E 4GNKB 4Q8WA 4AEEA 3QLLA 3JVAA 1VEOA 1KLZA 3MKVA 3BAWA 3LGDA 3UY8A 1V6TA 3CLWA 1UCWA 1QT1A 3DZ1A 1L2UA 2BS9A 5AYXA 3BTNA 1TX2A 3BZJA 2E09A 1T8QA 4I6KA 4Z2HA 1Q45A 3NOEA 5H6HA 4O0KA 1WXYA 4Y90A 2FHBA 2WXDM 5HJXA 2ATSA 3N3MA 3N73A 4QDMA 3WIJA 1XD0A 1D7FA 3V75A 5HJYA 7PTDA 3CZ8A 1AJZA 1ICPA 4EXBA 1SO5A 4GK8A 3WJSA 1NSJA 2J9YA 4FXRA 1E0UA 1DJNA 4YVXA 4JKKA 4QX4A 1OYCA 3S2JA 4E5TA 2RHGA 2YBVA 1J10A 4BA0A 1SMDA 1L6YA 1B9BA 3S5OA 3ONBA 3DHPA 2X05A 3MMWA 3CZGA 3PF3A 1QFEA 4PUJA 3M0KA 5D04C 1LL7A 2JIEA 1M7JA 1FWJC 2OQYA 4D72A 1FWRA 5FESA 3IJ6A 2W67A 1JDFA 2FMOA 5HQEA 2Z1VA 1L6FA 4EPBC 4IIGA 2G97A 4W5UA 4FX6M 2HPIA 4JX5A 1XLAA 1JZ2A 1EH9A 2A7NA 4K68A 1HGYA 4NAFB 1NQKA 2PDYA 4BWLC 3OLIA 2P3ZA 5CBIA 1WOAA 1FWFC 3MU7A 2J78A 4DLFA 3LTSA 2J8GA 2V82A 1K70A 2JE8A 4UFIA 4DJDC 2QMJA 3KRZA 4GUIA 1QNQA 4CCCA 1KRCC 3B0YA 4LWWA 2Q71A 1WZLA 3T08A 5LNRA 2HVMA 2HXUA 3S5SA 4YTSA 1EHNA 4ADUA 4B3ZA 3OLGA 4KESA 1W2PA 4TVUA 1LG1A 2X7VA 3KCOA 1XGEA 8A3HA 3RO8A 1RLCL 5AC6A 2X1UA 3W2NA 5FJJA 1XLIA 4U4MA 2OX4A 3M1ZA 1UP0A 1IYXA 1I8JA 2Y0FA 2W4XA 3ZJKA 1N8FA 3IIXA 2WM0A 4H8HA 3NQCA 3UPMA 1J0KA 3H2EA 4MY1A 4AYGA 4ZR8A 1FWNA 4FR6A 1DPMA 2TSYA 3OOQA 1ZU8A 5CBBA 4BQ4A 1JCNA 1TPDA 4LB4A 2A4AA 3CL6A 5A6SA 1CECA 1J6PA 4IOTA 3M16A 5BOOA 3NDYA 3W7HA 1CGWA 3GIQA 2ZQ0A 4JIRA 3L4YA 2GZXA 5I7GA 1XM3A 1KM2A 3H12A 2WCAA 3E1F1 5CC5A 3MVIA 5KZEA 1UHVA 2PDCA 1MRQA 3MI3A 1XFBA 3W7IA 2TMDA 1J12A 1CXEA 2FPTA 4IFRA 3A6OA 3O6AA 3VK5A 2ZBTA 3H2MA 1W56A 3MMDA 4Q7NA 4D8AA 1MSSA 3BG9A 1KTCA 2CXGA 1OFAA 3O07A 3HQNA 6ENLA 3UCDA 4MM1A 2YXXA 3NAVA 4PUKA 3EPOA 1QI0A 1OIMA 1V7AA 1IZCA 3WK1A 4BZYA 4G56A 1LJYA 1JQVA 3B06A 3G1SA 2R94A 1RP9A 1E0TA 1EYWA 1JRCA 4JN8A 2ZTKA 4QG9A 3WFZA 4IM4A 4Q22A 3WQOA 4HNVA 1WYIA 1RK5A 4GUGA 3Q37A 2OU4A 2RAGA 4IT1A 2J77A 4TQTA 1JYVA 1VS1A 1DQXA 4LUTA 1FY6A 3MWCA 4JKMA 1GVSA 1UUOA 1H51A 1KBBA 2PODA 3CO4A 4GUHA 4D9PA 1S2WA 5CZKA 2QPUA 4HK7A 1Q65A 2GSJA 3AALA 4CNSA 1D7KA 3GUWA 2WQPA 1UIPA 1WBJA 3UCCA 1LUCB 1CTNA 3INPA 1VGAA 4WXZA 4OOZA 4NSBA 5JH2A 4C6QA 1F76A 1VIZA 1LT7A 5BNKA 1W32A 1OC5A 2QQ6A 1EZ2A 3BG3A 1TR1A 4UTJA 4ATLA 1RA0A 1PV8A 2WZMA 1JF5A 3GYEA 1TV5A 3BMWA 1AMKA 4Z08A 1MW2A 2PF0A 4JDBA 4KFOA 3HQ1A 3TYCA 3W75A 1QCWA 1QNPA 2XIJA 4KCTA 3AXIA 1H1YA 4X22A 1NDYA 3MV01 3W1UA 2WANA 1KGUA 4D8LA 1ADDA 1G6CA 5M17A 3HMCA 1LBLA 3VDCA 3ABXA 3ICJA 4MGGA 2PCQA 1AZ2A 5LGXA 2ZCGA 2NQZA 5FSEC 3TP4A 2ZX6A 5DMMA 1DWJM 3CV2A 3WBXA 4Z2LA 3KP0A 2OTDA 4CQ8A 3WL1A 4LYKA 2CXEA 4GI8A 1TFVA 1RJRA 5B7YA 4LAOA 4NJIA 4BEUA 1MW1A 1QO5A 3CYVA 1UWQA 3GXDA 2ZTJA 3OZYA 1BG9A 4JFTA 4PTMA 3CJPA 5HMSA 1YE4A 2P1FA 1L2QA 3HPSA 1GYNA 3EDFA 4NNBA 3MCOA 4DBDA 3KZSA 1V3MA 1KC7A 1JDDA 1TV2A 3PPCA 2HISA 1UPPA 3TYUA 4HD5A 3IK4A 5FKYA 2ZUMA 4AXKA 2CZFA 4JTTA 5F4WA 1HL2A 3CTLA 1NFGA 4UWMA 3N25A 4UQBA 4GKLA 3WQ8A 1CGYA 2NLYA 5C9RA 4MB1A 2Y7FA 1TCMA 1XH1A 2B7QA 2PDHA 4O53A 2FTWA 4DJFA 3MI6A 1QNSA 3VIGA 1XYBA 3QOMA 3STGA 4NQ1A 1KRMA 4DZIA 2EJ1A 2CU0A 4UNIA 3W38A 4JTGA 1TVPA 1ADSA 2TYSA 4GYPA 1Y5XA 2G50A 2ZX8A 1AL8A 1E4IA 2V0TA 2FHCA 1JFHA 1F3XA 4DUOA 3CUJA 2ZE3A 3TJLA 3EDKA 1M7PA 3W1XA 3WQWA 4MWAE 4CLMA 3ITGA 3BURA 3R0UA 2OPJA 3TA6A 5AYYA 1FHLA 4N9CA 3ITXA 3LMZA 5CJNA 2BWGA 1I1XA 3NFUA 1IIGA 3GVWA 1THFD 1WA3A 4AX7A 2NQ9A 1UYQA 3AZTA 3PWIA 1E1CB 3SCTA 4UCGA 3CB3A 1GEQA 2WNWA 4C6DA 3B05A 1BTCA 3W1NA 3A4JA 4DXVA 5EBUA 1SSGA 2VP8A 4FAMA 1CGVA 2GGHA 3UGRA 5E1QA 1ISWA 4DZ5A 1VBGA 4HP5A 2VFIA 3UYIA 1FHUA 4MWAD 5BU6A 1OFQA 1NAL1 4S23A 2QDDA 4Y6GA 3JU2A 3D47A 3AUOA 3R6IA 4IMFA 4W89A 8XIAA 5DCDA 2C16A 4BI7A 3URNA 2PU0A 3LDVA 3MUIA 4OUIA 5AYIA 1NARA 1GQKA 2A1YA 2WHKA 4G1NA 3R1ZA 3GW0A 4GI9A 2IUZA 1DXIA 1AW2A 3STPA 4UQAA 3B0UX 4GY0A 1BWKA 2DW6A 1MI3A 1W1VA 1HGWA 4ACZB 3B4YA 2OWCA 4RDYA 5I3HA 5G4EA 3THDA 1MRAA 4RL3A 3AMKA 4UTKA 2O92A 3CYJA 1S5MA 4J1OA 4BJHA 2HVNA 2X41A 4H6RA 3QHMA 3ELFA 2E0PA 3OVGA 4F3HA 3P14A 2VEFA 3WQVA 4JNZA 1OF6A 4ZBCA 4P61A 3W1TA 2DZAA 1IWAA 2IPJA 2PLJA 1H49A 1OABA 3LK6A 3WJXA 3IK2A 2XHYA 4XAPA 5TQLA 1OSEA 2V2HA 2NUXA 4UR8A 4YHEA 3GTIA 3WEMA 4OECA 4F9JA 1IV8A 4GZ7A 3RR1A 1E6RA 2J75A 4J7RA 3SO7A 2NXHA 5IDZA 2D2OA 1LOQA 5L6UA 1GJUA 1XPGA 4IPLA 4POCA 3AC0A 1NM9A 5A2BA 3H54A 1XGZA 4QLJA 3GKAA 4AZCB 3O9NA 4M6QA 4DPPA 2O4QA 3BMXA 4LNYA 3H8AA 4H8NA 1HT6A 3HG3A 1PL9A 4HGXA 4Z42C 3W1LA 4Q4KA 3UETA 4JTKA 4HK5A 2OELA 4PMVA 1ZCOA 1RA5A 2WJZA 1IT0A 1CI1A 2HE8A 4W8LA 4NXSA 1ISVA 1XI3A 3L2LA 1KGWA 1QHZA 1QATA 2NV2A 2OYMA 4L1GA 1HFBA 3UD6A 4PGLA 1UUQA 3MSYA 4DN1A 4ZZ9A 2G95A 1RQBA 2YB4A 1J5SA 2R6OA 3MMTA 1H5YA 2OEMA 4I9MA 3W02A 1X96A 5BZAA 5T9BG 1TMQA 4JX6A 1MXSA 1Q8JA 4F2BA 3WUBA 2VWSA 1PVNA 4RLIA 3SUWA 2V3DA 3E02A 2Z28A 4JYDA 4NI3A 3QW3A 1QK0A 1YBQA 3W1MA 3WFAA 2D24A 4LPCA 4F4RA 4IIBA 4AU0A 3HZ3A 2J25A 1W5OA 3OPSA 4NNCA 4MNKA 3AHXA 4GJ1A 1DBTA 3IPWA 4GC3A 3U2EA 3PJTA 3V4BA 1EBHA 4JFWA 1MZRA 1DIKA 1QHOA 4JEJA 1EHAA 3NM3A 4AY7A 4MMWA 1P1MA 5GJPA 4RE4A 3E38A 2EG6A 3GDBA 1B3OA 1XP3A 2DEPA 1M7XA 3RX2A 2V5CA 1QUMA 5D09A 2CNCA 3WQDA 2GSHA 1E1FA 2Z1KA 2F2HA 4E8DA 3A9IA 2BP1A 3RLHA 2CCRA 4RV8A 3QYSA 3THCA 2VEMA 3W81A 2DGAA 3VKBA 5F2MA 2CWNA 3GE7A 3L68A 1LWJA 3W85A 3PZQA 3DI1A 3WD3A 4YL2A 2E6FA 1UKOA 5CZTA 4HPNA 2BXVA 5A6JA 2R1LA 1TCDA 3QR1A 2J6VA 1SFJA 3T1GA 3WDPP 4AD4A 2F61A 4LJ3A 3QJAA 1E6XM 2V30A 1K8XA 3NXLA 4Y8EA 4M82A 2DT3A 1Q4WA 2XVNA 2D23A 5EY5A 1FWDC 3RU6A 3IUIA 4GJIA 3AAMA 3WUFA 5FL1A 2C13A 2ABBA 3N2CA 1I6NA 4J9JA 3IVUA 3GSMA 2ADAA 3NSXA 3EZ4A 4FK9A 4UXDA 4DX3A 2VDIA 1KM5A 1R5YA 3BL3A 2J8FA 1H50A 2NSXA 5BXSA 4O1EA 4R9OA 2J7EA 4PCPA 4K2SA 1C91A 1FWBC 3S5YA 2AAMA 2P0OA 1WPCA 3ZT6A 1XG4A 3MT1A 1MDLA 2QEZA 1JZ8A 6A3HA 3EGJA 1TX0A 3GNOA 4K3ZA 4DB7A 3D6NA 1IXNA 3I4KA 1OQFA 1HJQA 4WSJA 1BKHA 2R1KA 4LH8A 2JALA 4WEVX 1E4LA 1XLMA 3SQSA 4BQ5A 2YL8A 1EX1A 5KITA 1SFSA 2DVUA 2YSWA 3PSVA 3LHWA 3C2RA 2DIEA 4L7ZA 4WY0B 5CQ1A 5AC8A 2F6KA 1RZMA 4QJ1A 3N18A 3VO0A 4Z2JA 1WQ5A 1SO4A 3UWZA 2ESCA 3KAOA 4ZQRA 2QCMA 3PZOA 2E9LA 3GH4A 3MZ2A 4RNFA 5A6LA 1G0CA 1R9ZA 1EB3A 4L65A 4NI8A 2V8ZA 2YL5A 4WDUA 2GGJA 3FKKA 1W54A 1RY0A 2WBKA 3ZWTA 2VRKA 1R0MA 2Y4SA 2E77A 3BCDA 1Q6EA 1TPH1 1E5NA 2E9BA 1VFMA 3WJWA 2JKPA 2FQIA 2HTMA 1GOXA 1ZJAA 2Y1HA 3CMJA 5LNWA 2EG8A 1SJAA 2Y70A 4EWND 5C8BB 4YIWA 1E6NA 1ZENA 3LCFA 5CAHA 1TJ0A 2PGRA 4EX4A 1QW8A 4I5RA 4D71A 4GO9A 1PYFA 2O0TA 1QO2A 2WMKA 3SCNA 4QG8A 2D0FA 2ZVRA 3AMLA 3C56A 1H7WA 3T6CA 4TVCA 1Z89A 5HR7A 3TQVA 1H4PA 4CCZA 3WDQA 4IMEA 1KBLA 3URAA 2POZA 3VGBA 4YU1A 3WNMA 3NQGA 4H8VA 3V0UA