4O8RA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
b'RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Methanothermobacter thermautotrophicus
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
rcsb
total genus 85
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o8rA00
3PBYA 5D32A 3W7CA 1W0MA 4S1FA 5E93A 3DXIA 3KXQA 1GOXA 3DAQA 1FWRA 3EX4A 5FF2A 3O16A 1FCQA 4RXFA 4MIMA 3BK0A 4UFJA 1NF0A 4CQAA 3M5XA 1QFEA 4N4PA 2Q8LA 2YDAA 3W71A 4RJEA 2P1FA 5AOUA 3T4CA 5BMXA 1TTPA 3NPUA 3RLVA 1GZGA 1F5ZA 4IMEA 1XUUA 3A24A 2CZEA 4O11A 2FPVA 4JDYA 1B4KA 3C3NA 1SZGA 1ZJIA 1ZNNA 4AB4A 4XQ6A 1DL3A 1M7OA 1TB3A 3FJLA 4IPIA 4ZQRA 2H3DA 1YDNA 4I9AA 3SFKA 3W2MA 2ZZ2A 1H63A 2RDUA 2A1YA 3BW3A 4JYDA 3T40A 1B57A 3CB8A 3EX1A 4ZQPA 1SW3A 3NQMA 1NF7A 3PC0A 3STEA 3W1NA 1XBXA 1OX6A 4TMBA 5BNKA 2C15A 3S9YA 3BG3A 5F1VA 3H55A 1G69A 4EOUA 3HF3A 4O8RA 3AJXA 1MEWA 1H50A 1AW1A 1VPXA 3WK0A 1D3HA 3IIOA 5I3HA 3PULA 2Z6IA 1EA0A 4S2BA 2YYTA 3LERA 1JRBA 3LRKA 4MJZA 3W2UA 5K4ZA 3STGA 4JTIA 5EKYA 2C3ZA 1WDWA 3L21A 1RD5A 2Y7GA 2YFNA 3NR0A 1O4UA 3LCLA 2DORA 3WK1A 1SO6A 5DELA 1VCFA 3ELFA 3TXVA 3N9RA 4AWTA 3PBUA 4JYEA 2RKXA 2BSLA 2R8WA 5FESA 3W87A 1OYAA 4XUGA 4A2RA 3GX9A 3SW6A 5KZMA 4MZ1A 1KM1A 3PB2A 2WPBA 2V81A 1GVFA 3LHWA 1XDLA 4J9JA 1VYRA 4UTWC 1G7UA 1GVSA 4BF9A 4LUIA 3GKFA 4LRSA 2HMCA 1G7VA 1RQHA 3BLIA 2FPYA 3MI6A 2C0AA 3E96A 1V7YA 3STCA 4UTUA 4R34A 1KW1A 3DFTA 3P8JA 1GWJA 2OMAA 2OCZA 3N2MA 5DY2A 4OE7A 4HNVA 3LCFA 4UXDA 2ZDRA 2ALDA 1JVNA 3M6YA 3PY2A 4A21A 3BW4A 3P5ZA 1W56A 2EF9A 4AH7A 5FEWA 1LZOA 5LGXA 1SZFA 3S1WA 3S42A 3W83A 4JIQA 1TTQA 4MZ8A 2YSWA 2CLKA 1C9DA 1FXQA 4NUWA 4PTNA 1YTDA 2JKAA 1EEPA 3QMRA 4FEZA 2DJXA 3UNDA 3HBLA 1EWDA 3TR2A 1TQJA 3QW3A 1O5XA 1GYNA 1ZHAA 1S5TA 3NQVA 1GJPA 4UTJA 4GBUA 1QOQA 1TV8A 1JCNA 2W0UA 4O15A 4ZQNA 3W75A 3LX9A 1SQ7A 4Y8FA 3W9ZA 1BKSA 2ZA1A 4X22A 1H7OA 3UXDA 4OV9A 4JYFA 4JTFA 1VR6A 4YWIA 4X2RA 4Z1AA 4M5PA 5AB3A 2WJZA 3N34A 1I2QA 2ZFAA 5C5YA 3NQ7A 4CQ9A 1FUYA 5F2LA 1TMHA 2JBMA 3SR7A 3W1MA 3C61A 3VE7A 1JCMP 1WBJA 1OJXA 3WK2A 3EWYA 3G18A 4LUJA 3W7QA 6ALDA 1A5BA 5CZTA 5DCDA 1UASA 4PH6A 4AF0B 2PURA 5KTLA 3QEZA 2NX3A 2VKZG 1YXCA 1FQ0A 1TRIA 5HWJA 3MMTA 3MWAA 3B0UX 4ALDA 1EWEA 4FF7A 4NT0A 4N2YA 1R2SA 3GYEA 3Q37A 3F1QA 2HS6A 3R5EA 5D02A 4N4QA 1VLIA 4UR8A 3QSRA 4X3ZA 4O52A 2CLHA 1LP6A 3VI2A 2ZQ0A 3BLEA 3M0ZA 3PBWA 2VC6A 1F05A 3NQAA 5KITA 3LHTA 3W72A 3MHGA 1D3GA 2GQ9A 2NX1A 1RQEA 1JJKA 1OFEA 5G1YA 3GXPA 1WXJA 3QF0A 4TIMA 3THQA 1AG1O 1FX6A 1SUXA 5G5IA 5F1UA 4DELA 4LRTA 4OHQA 2A85A 4HSOA 2QDGA 3RMJA 3SY5A 1MO0A 3NL6A 2ZZ7A 3BPWA 1YXDA 3VCRA 3EWXA 4AWUA 3NYZA 1KFBA 3O6DA 1AMKA 2ZRXA 3FEMA 1EPXA 1LBLA 3AO0A 3L67A 4FNUA 5K4XA 2QCNA 3P82A 5G2HA 4EF8A 1QO2A 4TX9A 5HWNA 3B0VC 1K02A 1NFBA 2V82A 3EWUA 2PRLA 2QAFA 2X30A 3BO9A 4IMDA 3TH6A 3DGRA 3OVQA 1PHWA 3KAOA 3LI0A 3PBVA 3MP3A 2QCDB 5CPNA 1GTEA 2H3BA 3QPYA 2Y62A 2P10A 4WY0B 1OFQA 3LOTA 4ORMA 4WXYA 3I7QA 1I2NA 4NZFA 1YLVA 3NAVA 3B05A 4WOQA 3OBKA 4JN6A 5BMWA 3DHDA 4DF0A 3QZEA 1LLZA 2QCCA 1G6CA 4O1CA 3NVTA 1N7KA 4HIBA 4FNPA 3PG8A 1GQNA 4OQVA 1MZHA 3T44A 3PAJA 4H3DA 4RZ4A 4EF9A 1DBTA 1I45A 2C14A 4UFLA 3IIZA 2NXGA 3U6WA 3HIJA 4U4MA 3VNDA 5DXYA 5AHIA 2H6RA 3W2JA 3G1VA 1P0KA 4FHAA 2TRSA 4FNRA 2WOQA 3W7OA 3PUDA 2QUTA 6TIMA 1VQTA 3HG4A 4O1BA 4Z08A 2YXGA 4GUGA 1OX4A 2I1OA 4K8HA 1X7FA 2O7QA 4MKNA 3NA8A 5C55A 3IVTA 1JCXA 1R47A 1OFAA 2A2IA 3A9IA 3GR8A 5U7SA 3O15A 1EP1A 4GUFA 3P60A 2C13A 3RF9A 1OFOA 3PUOA 1YXYA 1L6YA 1NSJA 1D9EA 1RVGA 3HPSA 2GVJA 3L66A 3HG5A 3OG3A 4D2JA 3DZ1A 3IVUA 3LM7A 2D73A 2GOUA 4KKXA 2EHHA 1VGAA 4E2BA 4M6PA 4KFOA 1VYSX 3TSMA 3EWWA 5EA9A 4LS2A 4CNOA 4AVFA 1H7WA 4JNMA 3TW7A 2YPIA 5LSMA 4YL2A 4GC4A 1PL9A 3CEPA 1N55A 1M7PA 1DV7A 4YXGA 2TYSA 3W7HA 1LOQA 1J5TA 5GVJA 4UUIA 3BLFA 3HPXA 3A21A 4O10A 3M16A 3PSWA 4PC8A 1O60A 3W1PA 1LDCA 3TQKA 2YR1A 1KM2A 3U8GA 3TQ0A 1FDZA 4MUZA 3HJZA 4G1KA 4PFMA 4UTTC 4NJJA 3VKJA 2CZ5A 5AYYA 5TQLA 3TX9A 1EUNA 4BI5A 3PR2A 1CW2A 2BZNA 4LVAA 4A2SA 1LRTA 3W1UA 1H1ZA 2NV2A 3LTSA 3S5ZA 3W7GA 4LVFA 2Q3OA 2VFGA 4DO5A 1FDYA 3P67A 2DZVA 5TBOA 3WJYA 1R2RA 1IF2A 4LVBA 2VENA 3M41A 3MW7A 1OFPA 3GZ3A 3IGXA 3SECA 1Z44A 3IGSA 2PCQA 2V2DA 1OABA 1VH7A 2CLIA 2PC4A 5D2WA 1LRNA 2QUUA 3IRDA 3MI3A 3QW4B 4JXCA 2CLOA 2QCLA 4IJBA 3MHFA 2ISVA 1VHNA 5FF4A 3EEGA 1QPRA 3ZFHA 2V2CA 1HO1A 3GR7A 3TXZA 5CPOA 4RZ5A 2QCGA 3LV6A 2J24A 1RR2A 1PV8A 1EUAA 1KBJA 3QM3A 1KM3A 1UB3A 1DQXA 1W5NA 3LBMA 3QFEA 2QCFA 1NVMA 3EX6A 4FNTA 4N9CA 2WNQA 1SU5A 4UMBA 2B7QA 4NXKA 3NL5A 4WX2A 4DO6A 4K39A 3UZJA 1Y0EA 1KFJA 1YPIA 1IXQA 3LCXA 5IBXA 1LOLA 2WQPA 4O13A 3OEXA 5HR7A 3W1TA 3G8RA 1SO5A 4JTTA 3IIVA 4TU1A 2CLEA 4YMZA 4Z0JA 3P8IA 2DZUA 4UTIA 1A5SA 5HWMA 3ZS4A 4LWWA 1A5CA 4K7YA 3SSJA 2G95A 5D37A 5D03A 2Y70A 3Q2DA 3FOKA 4KWVA 2GJNA 3T7VA 3W1QA 4XTDA 5G2IA 5IBXC 3L5LA 1W3IA 3W1XA 4HHPA 3BW2A 5K9CA 5F2IA 1A5AA 4PEKA 5D2VA 3F4NA 4TR9A 4ZMGA 3NG3A 5F4WA 1FWNA 1JUKA 3HMJG 1DQWA 2X1TA 4JICA 3C4UA 4JR5A 1I2PA 2E1DA 2V5BA 4N9DA 4O57A 5T26A 3B04A 4XTIA 4O1AA 4NJIA 1BEUA 1OF8A 1M5WA 5DY3A 4R7JA 4NVTA 5J5DA 5EYWA 4IOTA 5AHMA 3LI1A 2V5LA 1F6PA 3G0UA 1AL8A 1DVJA 1KBIA 1SSDA 3DH7A 4ADUA 4PODA 2A4AA 5BW6A 4UCGA 3KRSA 3NZ1A 2VEKA 3ABSA 3O07A 2YGYA 4GE8A 1I2OA 3NQCA 3QC3A 5CZSA 5AYXA 3W86A 4Z0SA 3MYOA 1SO3A 4FNSA 3YPIA 1VS1A 4XBKA 4JTJA 1KLZA 4IXHA 3E02A 1ME7A 3UWYA 4JEQA 3R13A 1JCJA 2J9YA 4MLRA 5I3JA 1ML1A 1W5QA 4POCA 1J4EA 1OF6A 3KRZA 3HGJA 5D30A 1P4CA 2QJHA 2I9EA 3G0SA 5K7JA 2B7PA 1WAUA 2WNNA 3WJZA 2CLMA 2WNZA 4IQLA 4O4WA 1EX5A 4DF2A 3CHVA 5KMYA 5F4XA 4LU0A 5CG7A 4WD0A 3R8RA 3E0IA 4LV4A 1H5YA 4FXSA 3DKJA 1AL7A 2E77A 2FJKA 3TROA 3GK0A 2GPTA 4I7WA 2YX0A 4K6AA 4I7VA 3LHVA 2DU2A 3NO5A 1QPNA 3TMLA 2EAWA 4XZ9A 3G1HA 1U83A 2ZRWA 1FCVA 4Y6GA 4OGZA 3T55A 5ABTA 4O50A 5DBUA 1QR7A 4NNAA 5HINA 1WYIA 4E0CA 3F4WA 1WOBA 3T78A 3S5OA 2VEIA 5EBUA 1G4EA 3WJXA 2A21A 1X8FA 1LCOA 1TPEA 5A5WA 4RZ6A 1SW7A 2QJIA 3BG5A 1YTKA 4K38A 1TV7A 4NJHA 1XM3A 5E1QA 4JTUA 4AXKA 1TJPA 5HJLA 1HTIA 1OHLA 2C16A 4UFMA 2YW4A 3KVJA 2NV1A 4W9TA 4O28A 1IIHA 1VJIA 2C18A 3SZ8A 1O95A 3L0KA 1VCGA 4MJMA 1ZAHA 3QPZA 4O12A 1GYLA 1H7RA 2X2GA 1WV2A 1Z42A 3EXSA 2X1RA 4JGDA 4WUIA 1WA3A 2X1SA 2FFCA 4M6QA 3HG2A 4K7VA 4C1KA 2QCMA 1S5WA 4E2DA 1R2TA 4NX5A 1T96A 4UMCA 3DFPA 1LBFA 1OK4A 1UJPA 4K8EA 5DBTA 1CI1A 3B06A 1VYPX 4WY0A 3CLMA 4MFEA 1GG0A 3UPWA 5LHEA 3EX2A 4RLIA 2NXHA 1OG0A 1G4TA 3ABQA 3OIXA 3ZWTA 4ZQMA 3FJ6A 2G97A 3LCIA 1Q6QA 2E09A 4JX4A 4JY9A 4HT3A 2E6AA 3B4UA 2DZWA 4UR7A 3KVKA 1QWGA 1H60A 4HNTA 4AHQA 3PUEA 3G1YA 1W5OA 3PG9A 3UXAA 3W2LA 1K8YA 4IMCA 2Y6ZA 4MY1A 4I7UA 1ZENA 4NNCA 1QNVA 4QIUA 5EL1A 3OVPA 1FCUA 1K7FA 2VOMA 2Y88A 4CCEA 1W31A 2Z2UA 4LW7A 3PM6A 4FO4A 3KHJA 3NNTA 5AC8A 1YDOA 3G1SA 5TIMA 1ADOA 4EWND 3TKFA 3K30A 3NDOA 3TC7A 3LHUA 3LHYA 2NWRA 3TIMA 1FWSA 1QMLA 2DZSA 4OWGA 2YW3A 3LLDA 1T8XA 3TC6A 1TCDA 1UUMA 1RPXA 3GVGA 3HOJA 1DJQA 4ZVJA 5HNRA 1YDVA 4FX7A 4AF0A 5D2YA 3C2FA 1C29A 1W54A 3W3OA 2A6LA 4GUIA 2C19A 2GQ8A 2J88A 2CW6A 4AWSA 3MUXA 4QM1A 1A50A 2ZTKA 4NJKA 5KSWA 4GWEA 3CQ0A 2CZFA 4MY9A 2O7SA 1TPC1 5FF7A 3GAYA 5HULA 1TIMA 5HUPA 3UY7A 4DPQA 2A7PA 2CFFA 4TO8A 1LYXA 3TSDA 4DBEA 3P5YA 4CNPA 1ZALA 2EKCA 2VFEA 2ZZ6A 3LCGA 3I65A 4UC5A 3EKZA 4CCCA 2PRHA 3UWQA 4ZQOA 1QPOA 1AW5A 4OT7A 4CQ8A 2FQIA 2FIQA 4LS0A 1LROA 5FEPA 1NAL1 4DPPA 1ZAIA 1RQBA 1JUBA 3UD6A 5HQEA 3L68A 3CPRA 1SFLA 5CGQA 2R91A 2Z0IA 1SR9A 3BVJA 2WSYA 4JTGA 4JTKA 4MPQA 4O18A 1U5JA 4LV9A 3V75A 8TIMA 1JQVA 1W8SA 3P81A 4PA8A 1F6KA 3GDRA 4Q32A 2FPTA 4BI7A 1GPWA 3TU9A 1ZFJA 1R46A 7TIMA 2NUWA 4ZZ9A 2ZRYA 4IMGA 3UWUA 1YPFA 1PCKA 3ZR4A 4JX6A 5DCBA 3EXTA 4LS1A 3G1FA 3MBFA 4GJ1A 4UMAA 1H7XA 3G1XA 2FTPA 2W79A 2WSQA 1SZNA 1TTJA 1TPVA 3ABOA 3I6RA 1QCWA 4K37A 3WJWA 3USBA 1IXOA 4QNWA 1JULA 3GDLA 3LDVA 5G4EA 3TE9A 4R33A 2QKFA 2E6YA 1M6JA 2DP3A 3SJ3A 1TPDA 2VFHA 1XL9A 3W7EA 2Y7DA 2ZBTA 3W7KA 4DQWA 2E6FA 4N6EA 4YLWA 3HGOA 4JIPA 2TMDA 3TCEA 2Y61A 4Z1CA 3UWWA 4H4IA 3TAKA 2QJGA 1P1XA 5EMUA 1G4PA 3A5VA 1KFLA 1GVOA 3SGUA 3GLCA 3CWOX 3IVSA 4WXZA 4R53A 3OVRA 3NZRA 5CPMA 1FCBA 1GG1A 1X6UA 2F7FA 3QMSA 1B3OA 5K9DA 3UWZA 4WQ6A 1AK5A 1S3HA 3M47A 2OJPA 2QF7A 1P5BA 2JK2A 4Q33A 4UFIA 1G4SA 2I14A 3CC1A 3B03A 3N73A 5EPDA 1TPB1 1SSGA 2HS8A 1UUOA 3DFSA 5C2XA 3GXNA 3M5VA 4O1DA 2ZZ1A 4MLJA 5D04C 5FEZA 4GRSA 5F4SA 1XUZA 4MVAA 3S1UA 3TNOA 4BWLA 3G3MA 2YFOA 2H90A 4FX8A 2Y89A 3LB0A 2OX1A 4UTWA 1OK6A 1TPWA 3R12A 4HPJA 5LKYA 2XN1A 3TAOA 3IIPA 5AFDA 2YYUA 2ABAA 1IIGA 3A23A 1HUVA 1UBSA 1KTBA 2A5HA 5D2TA 2ABBA 3W1LA 5A8GA 1WX0A 3TFXA 5EY5A 1VRDA 4JTSA 4LOCA 4BWLC 3DI1A 1Q6RA 2R14A 4WZHA 1ONRA 4HN4A 1JUEA 3NL2A 2B4GA 3TV8A 4MY8A 1DJNA 2VEMA 3TJXA 2Y7FA 3L65A 1OFRA 4O0KA 2G5WA 3LCHA 4GUJA 2VXNA 2WO5A 3QH2A 3E12A 3C56A 2W6RA 2NX9A 3GAKA 4M19A 3NXFA 4GFSA 2ZRUA 3KVLA 3CIXA 1I2RA 3NPWA 3QJAA 4UFKA 2YCEA 5AN7A 2UV8G 1KFKA 2A7RA 4IGHA 5CZ0A 3P84A 5AHNA 1HG3A 1YADA 4LVGA 5I3KA 5FEXA 1W37A 3S5NA 5KZEA 5D38A 2QCDA 4JY8A 2B7NA 3DBPA 1PVNA 3INPA 3W7JA 4MOZA 2XN0A 1IXNA 3ATYA 4PL1A 1K8ZA 1OYCA 3O8AA 4KFPA 3TQVA 3LXAA 2V9DA 3GNDA 1KM0A 2F84A 5LZLA 1TJRA 3FS2A 2ZYFA 3PB0A 1O94A 4NX0A 3W7DA 2AAMA 3NEVA 3ABRA 3NQEA 4XKYA 3FYOA 3A5FA 1BWKA 1QAPA 3HGRA 1SPQA 1SFJA 3P7YA 2NZLA 2Y7EA 3M9YA 5KINA 5G4WA 1JR1A 2C1HA 3ATZA 1L6SA 5LNWA 4WJEA 3I7RA 5CZJA 4N6FA 5LNUA 2NXIA 3LV5A 4DF1A 3RNDA 2P0OA 1HO4A 4RKAA 1I8JA 3BG9A 1LLWA 1FBAA 4ICNA 3ANYA 3B0PA 1ZCOA 3B8DA 1DKWA 3DU0A 1NEYA 4OU1A 1THFD 3C52A 4GUHA 4ML9A 3OA3A 4JD4A 3NQGA 4Y9AA 3LRLA 1J2WA 3C2VA 5H2ZA 1H1YA 1MXSA 1T0OA 4DEFA 1QPQA 4A22A 3W7NA 3IGUA 5F2MA 1KA9F 4JS3A 2A7NA 1ME9A 5LHFA 1KTCA 3S0CA 1V5XA 2WV8A 3HPZA 3DENA 4Q4KA 1HFBA 5DLCA 4ONVA 3CIWA 4DO4A 4BR1A 1P0NA 3CEUA 5FF0A 5F2GA 1KTNA 3LTYA 2ZTJA 1ZAJA 3C2OA 5L9FA 1BTMA 3G24A 4JX5A 4HNUA 3JS3A 3UY8A 3RU6A 2OT0A 1Q6LA 4IXXA 4P2VA 2ZZ4A 3O06A 2EGZA 3Q58A 1K3UA 4AHOA 3EWZA 3I7SA 3IV3A 1KM4A 3CTLA 1XC4A 1K03A 4HSNA 2GVLA 4LT9A 3WJSA 3CU2A 5G2WA 4XKYB 1VZWA 2CWNA 2CLFA 4UIOA 1G67A 3P62A 4FX6M 4Y90A 1Z48A 3C8FA 1IXPA 2RDWA 5K3VA 2NUYA 3G8EA 4LNYA 1W1ZA 1ICSA 1XI3A 4NU7A 2QDHA 4QSHA 2XN2A 1Q3NA 3DHFA 3BGGA 4ZL1A 4IPJA 1F2JA 3HQ1A 5K9XA 3MP4A 5CSRA 1SO4A 3L5MA 4IX0A 4GXMA 3ZWSA 1JCYA 3EB2A 5AC7A 2RFGA 1H51A 3VE9A 1XCFA 4P61A 3EXRA 4FNQA 3NQ6A 3TMQA 3LTPA 2QUVA 3LLFA 3QMTA 1WBHA 3NOEA 3PWAA 3TJLA 3FIGA 3F03K 2E6DA 3IEBA 4NZJA 2EPHA 4IUOA 2Q3RA 2B7OA 2V2HA 5J5RA 2AGKA 1N8FA 1H7NA 3MP5A 1LORA 2B0MA 1TPH1 4XBSA 3FLUA 5AHEA 3MJYA 5I3IA 1OX4B 3G1AA 1KV5A 2RH9A 2J6XA 1IGSA 1YYAA 3NPXA 1ICQA 1O5KA 5D05A 4M7TA 3M5ZA 2QEZA 3LRMA 5FF3A 3C2EA 3RFAA 2DZTA 1K7EA 5I3FA 4JTEA 2G96A 3NQFA 1C8VA 3KVMA 2RHGA 2FB2A 3HO8A 3SIZA 4ADTA 1FWTA 3MBDA 3SI9A 5SWUA 5AHFA 1JCLA 3L2IA 3W2NA 3NPVA 5C54A 1TRDA 2ISSA 5CPLA 4BI6A 3C2RA 2ZZ3A 5CKSA 3S6DA 4FIQA 3GDMA 5CSSA 3W07A 3UZ5A 4QAIA 4O17A 5K2ZA 1WOAA 1ZY9A 1K8XA 3N19B 4QISA 3O05A 1FDJA 4E38A 3LHZA 1LOSA 4UTTA 4UTKA 3JR2A 4KFNA 1SW0A 3M43A 5E0KA 4C1LA 1FWWA 5H91A 1VLWA 2NLIA 3Q94A 5DN1A 4JTHA 3FA5A 4RR4A 3CT7A 3FKRA 1XFBA 4O14A 4RCXA 4N9EA 3WK3A 2PE4A 4O54A 3S8HA 3PF3A 3W7LA 1ALDA 1GVRA 3GIYA 2Y63A 3LCWA 4AHPA 2GJLA 3L5AA 4YCOA 1W3NA 3L9CA 1FXPA 4MZYA 1S5VA 4FIRA 3UYCA 1I4NA 4JDBA 3M1ZA 1PHQA 3FKKA 2ZZ5A 3DFQA 4DXVA 5LNVA 3NQ8A 1TO3A 3NQ2A 5HUOA 3TFCA 2JGYA 3N3MA 3E9AA 1LBMA 5DCEA 1PCWA 1TYGA 4UTMA 1XBYA 3TSBA 4KWWA 3R89A 4NNBA 2LLEA 3TA6A 3LXBA 1UCWA 1F74A 2R94A 1B4EA 5U4NA 4ORIA 5AHLA 2BX7A 3DFOA 1R30A 4A3UA 4O19A 2J27A 4HKPA 4MYXA 3PSVA 3G22A 3N2XA 4BK9A 1QDSA 1XKYA 1B9BA 4IWWA 1Z41A 5D2XA 3DI0A 1OYBA 3CWNA 4LTSA 1TQXA 2HSAA 1W5PA 2E68A 2JKEA 3W6YA 1SZEA 3L0GA 4LY8A 1GT8A 3S1XA 1HL2A 2QCEA 3G1DA 3S1VA 2CZDA 3NQDA 2YZRA 1FY6A 2BTMA 5AC6A 1OX5A 4UNKA 3EKLA 3O6YX 1H62A 4U28A 5AYZA 2JKPA 1QO5A 3G0XA 3GKAA 2IQTA 4RXGA 1YTEA 1W5MA 2ATMA 4OBTA 4UNLA 3NM1A 4ADSA 1H7PA 4LC8A 3GDTA 2V8ZA 4HPXA 4GNJA 5HR6A 1GEQA 3I68A 3W88A 2ZA3A 3BV4A 2FLIA 4NQ1A 1VC4A 3M44A 1X1OA 4N02A 3UPBA 3C0JA 3W7RA 2J9XA 1K7XA 1MEHA 2X1UA 2E5BA 3QRHA 2FB3A 3THAA 3W1RA 5G1TA 4AEOA 3HGSA 1X1ZA 1Q6OA 4RK8A 5BRBA 1PS9A 2FDSA 2WSRA 1XBZA 3M7WA 3W84A 1ICPA 3R2GA 3W7PA 4N9BA 2Z1BA 1H61A 1JQXA 1KM5A 1OFBA 2ZRZA 4WOZA 5LNSA 4PCFA 1RZMA 1L6WA 1GVQA 3L0NA 4MYAA 3RLUA 3S5YA 4LVDA 3QSTA 1WQ5A 3PS7A 3QQ0A 4LC6A 3W7IA 3H54A 3NGJA 1MSSA 4NJGA 4L4LA 4X9SA 4EVZA 1TPUA 3CM4A 3V1PA 4K36A 4Z1BA 1F7BA 2GUUA 2XFWA 2CLLA 5IM51 2PRMA 1T99A 1E51A 3PVFA 2E5DA 3DKLA 4S2CA 1L9WA 1W3TA 4RV8A 3LXCA 3SGZA 3W74A 2VEPA 3O63A 2AQWA 2ZCGA 3HB9A 4EIVA 3UQNA 2J9ZA 2VELA 5L6UA 3BARA 4O53A 4O0ZA 3TDFA 4O16A 1JRCA 3NL3A 3W22A 3E49A 4H6KA 3H53A 3U2OA 4UTLA 4Z1DA 3FYPA 2RDTA 3GDKA 3VFLA 3W23A 3W85A 4IMFA 2KZHA 2NUXA 3O1NA 2BXVA 2V30A 2QAPA 1TREA 3TUUA 2GVGA 1OVDA 2H8XA 1Q45A 1DOSA 3RK8A 4CNNA 1LM1A 1CX9A 3N9SA 3GNNA 3KRUA 1LTDA 2VFDA 3STFA 4QNEA 4QJ1A 3WFAA 4A29A 1DORA 2OT1A 1BWLA 4L4MA 4PL2A 3D0CA 1KM6A 2TSYA 3KOFA 4M7SA 4QQ3A 3P61A 2H8ZA 1EP2A 1OFDA 4RX0A 4WY0F 1TSIA 4CLMA 2DZXA 4O4VA 2Y85A 4CCDA 1ME8A 3TK7A 1F76A 2HTMA 3IIXA 4OV4A 1KFCA 1RV8A 3M5YA 3NM3A 2BWGA 1XBVA 2A6NA 2ATSA 3W76A 5D09A 2E5CA 3BGJA 3FFSA 2A0NA 2NWSA 3GB6A 3UWVA 2Q8ZA 3OHIA 2QCHA 5DXXA 2CU0A 4HNNA 1KLYA 1A53A 3QQ1A 2V0TA 4FXRA 2ZA2A 4UFHA 2X16A 1XXXA 3W70A 4BFAA 4IX2A 1VCVA 4UTHA 3MYPA 4B5NA 5LGZA 3EWBX 4NXSA 2WKJA 2VFFA 3O6CA 3QYQA 1VHCA 5HMSA 1LRQA 2DZPA 5C6MA 2ZRVA 2JGQA 1TPFA 1XDMA 2Z6JA 3GXTA 1KFEA 4M6VA 4Y96A 3TW6A 2TPSA 4MFDA 4AAJA 1EB3A 3JRKA 3MO7A 2GQAA 5FI8A 3KX6A 3KFTA 3MHUA 1L2UA 2QR6A 2OZ0A 3HG3A 5BOOA 3G3DA 1F73A 3EX3A 1PIIA 3A22A 3LGEA 2BLEA 3C6CA 3MI2A 3P80A 1EP3A 3P74A 3W2KA 5MHBA 2C6QA 3W73A 4QITA 3LBCA 1AW2A 5LNRA 1GTHA 1QOPA 4DBDA 4ZQCA 2VFIA 4YCPA 4TMCA 1TTIA 3W1AA 5D33A 1MEIA 4XWUA 5KZDA 2ISWA 4AMAA 1EIXA 3W7MA 4JTLA 1DHPA 3DFNA 2DJLA 4FB7A 1PE1A 1KV8A 1TV5A 5I3GA 3N14A
chains in the Genus database with same CATH superfamily
5DMNA 4J3SA 2VD8A 4CKQA 5D32A 3W7CA 1CEOA 3VDBA 5E93A 2VCBA 4ICCX 5FF2A 2HEJA 2XIMA 3O16A 4MIMA 3RU8X 3T9PA 4URIA 4UFJA 1NF0A 3B8TA 4A6GA 1IQ8A 2YDAA 5KETA 1FWHC 2PDBA 5AOUA 3T4CA 3NPUA 3RLVA 1GZGA 3WCZA 2BHYA 1F5ZA 3AZTA 4Z2IA 5G4HC 3A24A 5I78A 4JDYA 3OVGA 1B4KA 2XU2A 2WW5A 1E4MM 1ZJIA 4MUPA 3OA5A 2H3DA 2BGSA 3SFKA 3W2MA 2ZZ2A 1H63A 3K1DA 4JTCA 3EX1A 1KFWA 4ZQPA 2GGHA 3DG6A 1HL9A 1FHUA 3PJXA 3PC0A 3LY0A 3W1NA 4E4FA 1OX6A 5BNKA 3MJMA 2PF0A 1MEWA 1F6YA 1VPXA 3WK0A 3WQOA 3PULA 2OTDA 3BJTA 3VNYA 3FSUA 4S2BA 4LXFA 3LRKA 5K4ZA 5C2CA 1AUSL 1ITUA 1WDWA 2JF6A 3AI0A 2DORA 1FWDC 3ELFA 5E0FA 3TXVA 2VWTA 3FDGA 2RKXA 2R8WA 4S3CA 3O7UA 3GTIA 1KM1A 1CXEA 1XHGA 4GLEA 2WPBA 2ACRA 3BAJA 1DXFA 2HVOA 4Z42C 1XDLA 2X42A 4UQCA 4WVXA 1YDYA 1HJUA 2YA2A 3N29A 4LRSA 3NCOA 2FPYA 5CZKA 3STCA 2PPGA 4PRWA 1TMLA 3N2MA 4HYRA 4U3CA 1RXOB 5LXEA 3WBEA 4U2YA 3EPNA 3BW4A 2EF9A 1W56A 5I00A 1FWGC 3GG0A 4IP4A 4OVXA 4JIQA 1TTQA 2WBKA 2IS7A 3EGJA 3AS1A 2A3EA 2WJDA 4H41A 1EEPA 1GZJA 3QMRA 2IKGA 4IF2A 3HBLA 1VFOA 3TR2A 3WL1A 5HQMA 4W4QA 3AYSA 2PDWA 4GBUA 1TV8A 4O15A 2ZWZA 3GVQA 3W75A 4OZOA 4IGMA 3UJEA 1J0IA 2EPOA 1JD9A 3T08A 3WNPA 4YWIA 4JTFA 1VR6A 3TCSA 4PTVA 4CU8A 4K68A 3ARUA 3M0KA 4L1WA 5BU6A 1LLOA 2YDSA 5C5YA 1FUYA 3FW6A 1TMHA 4EACA 3RPMA 1W1TA 1OJXA 3ORWA 3G18A 1ZGDA 5FAJA 3N25A 1A5BA 4MHBA 3WQDA 4JQAA 3TQPA 1UASA 1FH8A 4AF0B 5F7UA 2D2OA 3QEZA 5CJNA 4QGCA 1YXCA 1H3GA 5A6LA 1UHVA 5EMKA 6REQA 4D6JA 4NL1A 5HMFA 5FAGA 3LSCA 4C6JA 1W9XA 4FOUA 3R5EA 4UR8A 2ZUNA 4DWSC 4EWJA 3SB0A 2E8YA 1F05A 3BXWA 3BCDA 3MHGA 4B91A 2NX1A 1RQEA 1JJKA 3BJFA 1WXJA 3V0UA 2D2JA 1AG1O 1DJYA 1FX6A 1W9UA 4M82A 4DELA 3W6LA 1XIMA 4HB7A 4OHQA 4PBGA 3SY5A 1IWBA 1V6XA 2Y8KA 4OECA 3DFYA 3S2MA 5A6MA 1KFBA 3O6DA 4YJ5A 1AMKA 1LUCB 4KWUA 1LBLA 4KCTA 3CZKA 4FNUA 5K4XA 1CGYA 2QCNA 3P82A 3T05A 3VIFA 3V5CA 2WM1A 4NI3A 1ZZMA 2QAFA 2X30A 1QXLA 3TH6A 3DGRA 4UB9A 3LI0A 3MP3A 3PBVA 2H3BA 3ITLA 3WYZA 1E73M 3LOTA 3M64A 4LY4A 1RA0A 1NOWA 3NAVA 4NAFB 4DF0A 3WFLA 3QZEA 1OQFA 4JCMA 1A3XA 3NVTA 1YHTA 1KCZA 4HIBA 4FNPA 1GQNA 4QX4A 4HJWA 2PA6A 4INFA 4OQVA 4IFRA 4MKVA 1JZ7A 4RZ4A 1RA5A 1LG2A 4UFLA 3HIJA 3H70A 4ZBCA 1VKFA 1E71M 5AHIA 1E40A 1PXGA 3TOYA 2H6RA 3WQWA 3B8UA 4N42A 3FY1A 3G1VA 4FHAA 4V15A 2QUTA 5J8LA 1X7FA 3GFZA 2O7QA 3OZMA 4GQRA 3EYPA 3VOJA 2VR5A 4CD6A 1R47A 2W27A 4DBWA 2VWSA 3GR8A 1EP1A 2C13A 1WZKA 1AJZA 4HBKA 3TLQA 3HPSA 2ZX6A 2FGZA 3LM7A 3WD4A 5A6BA 2EHHA 3GIPA 1DHKA 4ICMA 3N13A 2CERA 3M0HA 4LS2A 4L65A 4B9ZA 4JNMA 4PB3A 3TW7A 4ZR8A 4F8XA 1SZRA 3VKDA 3RILA 4RDZA 3W7HA 2PAJA 3HURA 3BLFA 4Q6JA 4O10A 3PSWA 6TAAA 3A9BA 1DQUA 3W1PA 3BE7A 2YR1A 3U8GA 4HTYA 3TQ0A 5GNXA 4ERAA 4NJJA 3DYMA 2CZ5A 1W1PA 2WB5A 1GEHA 1V3IA 4WKFA 1CW2A 3VZYA 4LVAA 3NEHA 3W7GA 3BQ6A 3KTSA 2ANUA 3K4WA 5LIYX 1UMLA 1R2RA 3CUHA 2VENA 3MW7A 2JE8A 2PCQA 1VH7A 3SCWA 3FHQA 1HGYA 2PC4A 3IRDA 4JXCA 2CLOA 2QCLA 3HQOA 3O3RA 8XIMA 3MHFA 1A5LC 4DXKA 5JH2A 3XIMA 1C8YA 1X96A 1NIUA 3UGRA 4QRNA 2QCFA 1OD0A 4Q8MA 4S39A 2WNQA 3WLIA 1SU5A 4KEUA 3BLDA 1TV2A 2V63A 3PTQA 4IFKB 4NXKA 3NL5A 1SYTA 1Q2SA 3LCXA 5IBXA 3PTDA 3B0YA 1ITCA 4ZE4A 1OEPA 3OEXA 4YMZA 5CLTA 2WWCA 4K7YA 4AIOA 4R5EA 3FOKA 2QS8A 1LWIA 2TAAA 3TR9A 3L5LA 4DWSB 4J3TA 1W3IA 3W1XA 5K9CA 1A5AA 2H9AA 5D2VA 3F4NA 4ZMGA 4KMQA 1QVBA 1GQIA 3HMJG 1JFXA 1I2PA 4NASA 4IG2B 2X8RA 4O1AA 3GTHA 2CESA 5D9MA 4R7JA 4DI9A 1LJYA 4LB4A 3LI1A 1Q6FA 1AL8A 1DVJA 4U5KA 1OT2A 3KRSA 3NZ1A 3ENLA 3EA1A 2AKMA 4I6VA 4NYUA 9XIAA 3W86A 4Z0SA 3WBXA 2BXYA 3QR0A 2HQAA 3YPIA 5BWFA 1EL3A 3OW1A 3E02A 1ME7A 2ZUMA 2VOTA 4JEQA 1FFRA 2XTKA 3PWGA 2XVNA 2VRJA 2I9EA 1K6AA 2B7PA 3U5UA 3GD6A 3WDHA 3ARTA 4J3XA 2WNZA 4X60A 2F6UA 5KMYA 4WRHA 1F3WA 5CG7A 4WD0A 4LH8A 4U33A 3BQ5A 4ML4A 3O0FA 2Z1XA 1XYFA 5C71A 3DKJA 2DT1A 1OB0A 3COTA 3HZ3A 3N12A 4I7VA 3LHVA 2DU2A 3TMLA 4XZ9A 3DX5A 4QHRA 1U83A 3VIKA 4HA1A 4KS0A 3BCJA 5DBUA 4ILSA 1WYIA 4PRRA 4RE3A 4E0CA 4WSKA 3S5OA 1VBUA 1H2JA 2OEKA 2D1ZA 1X8FA 5A5WA 2C8NA 3LMYA 3LA4A 2QJIA 3BG5A 3SUSA 4NJHA 3CT2A 4L4OA 2HNEA 4AXKA 1TJPA 4CU6A 4UFMA 2NV1A 1K9DA 3OIHA 3RAOA 5FL1A 4H6QA 1TVPA 4TVUA 3TVAA 1S2VA 2OWXA 3CQKA 1GYLA 3U7BA 2PDNA 1OC7A 2NQ9A 2BVYA 4WUIA 1WA3A 4M1BA 1BXCA 3EMQA 3OB8A 4DM2A 2PEVA 1V0LA 3OZPA 4E2DA 1R2TA 2WHLA 2R1LA 1UC4A 1T96A 2R1PA 4J3ZA 2YL9A 5IFTA 1E0UA 4GPNA 4HMCA 1LBFA 3KM8A 2XFFA 1DWHM 3MANA 1O5QA 1VYPX 1KQYA 1GG0A 1M65A 3B8VA 5LHEA 3EX2A 2HWGA 4DLMA 2G97A 4PZVA 4GINA 4JX4A 4JY9A 2E6AA 2VR2A 2PBGA 3B4UA 4DJFD 4UR7A 3V1HA 4AZCB 1QWGA 3AMKA 4GOAA 4AHQA 3HV9A 1VIZA 1J2BA 4AZ6A 3WLKX 5ABFA 1JZ2A 3W2LA 1MW1A 1QW8A 4IMCA 2RAGA 3B9DA 4MY1A 1E9YB 5EL1A 1FCUA 3WDQA 1VFLA 1UBPC 4CCEA 5AYBA 3PM6A 1MQRA 5BRQA 4HPHA 2XVKA 4EWND 3K30A 3TC7A 3TIMA 1QMLA 1KQZA 2YW3A 1U1UA 3GTXA 2WHJA 3KW3A 4UTFA 4ZVJA 1R3QA 5HNRA 4B92A 2DT2A 2VURA 1M1BA 4AF0A 3E5PA 1C29A 3SUVA 1KRMA 4GUIA 5REQA 4AWSA 4QM1A 3KOYA 2BVTA 1VEOA 3K4AA 3JU2A 4ZO6A 1IZJA 1SVDA 5E0CA 3GAYA 3UXKA 5HULA 1TIMA 2WMFA 2QPUA 1O5RA 1PJ9A 3RRXA 1H0IA 4B3ZA 4RZBA 4TO8A 2D0FA 3CHCA 1JPHA 3P5YA 1ZALA 2WSPA 4Q7BA 3THDA 3U4AA 2E67A 3CZEA 4CQ8A 1UKOA 2XVLA 3WQ8A 2FIQA 3QTPA 4MB5A 1QJWA 2VGFA 5FEPA 5FL0A 1GHSA 4QLKA 1RQBA 1JUBA 3VX1A 3TYCA 4F0MA 2DT0A 3CPRA 4IQDA 1ZPTA 2Z0IA 3AXKA 3RJYA 3BVJA 3AIRA 1EZWA 3GS6A 4O18A 8TIMA 4UCFA 2ZX8A 1XH0A 1AODA 2ZWYA 1AH3A 3TU9A 4LAUA 1W8GA 4M81A 2QDEA 2ZRYA 3FCPA 4NZ3A 4IMGA 4FP1A 1NWUA 2O9PA 4IMAA 2GGIA 2WVTA 4W8BA 1KBLA 3EXTA 1S2TA 3H21A 1SZNA 1XPGA 4PTDA 5I77A 1TPVA 4CD7A 1Q63A 5CC7A 4W93A 2Z1WA 3CV7A 2OU4A 3VILA 1FWEC 4LQ1A 2CXEA 1PDZA 1PKYA 4QNWA 1W3JA 2WKGA 1JULA 3EMZA 2E6YA 2YIHA 4DJDA 3VD3A 3SJ3A 2VFHA 4AQLA 3LGDA 3W7EA 2Y7DA 2DT3A 4DQWA 4J4KA 2ZE3A 1BQCA 1NY1A 1DWJM 3TAKA 2QJGA 1IT8A 1JDDA 1TJ0A 4Q8TA 3A5VA 1XYZA 2Q09A 5HJXA 1P0EA 4IL2A 4HCLA 4D6CA 3EA2A 3OVRA 1T8QA 1SFSA 4HZMA 1FCBA 4PCTA 2IKHA 5K9DA 1OIMA 4WQ6A 3QR3A 2ICSA 3M47A 2GDVA 4GKLA 4Q33A 1G4SA 3WQGA 3OG2A 1UH4A 2W91A 3CQJA 3BCFA 2PSNA 4HTBA 1SSGA 5C9WA 2EPNA 1UUOA 4DN1A 1CYGA 4O1DA 1FP8A 5D04C 2D23A 4GRSA 1E4NA 2Q8XA 3S1UA 1UROA 4BWLA 4US5D 2PLMA 2H90A 2YFOA 1FWIC 4KGLA 1AQ0A 3FA4A 4PGLA 2PDPA 1L8PA 1BVZA 1QI0A 2YYUA 3O6AA 2ABAA 3KOXA 1KTBA 1ENUA 3N4FA 5A1AA 3W1LA 5A8GA 4GI4A 4D71A 3GM8A 3TTSA 5EY5A 1QNRA 1BTCA 5CAKA 1Q6RA 2R14A 4IFOA 4WZHA 4HN4A 2WZTA 4I5RA 3WENA 2HPMA 4MY8A 3GNPA 1DJNA 3Q67A 2VC7A 2Y7FA 4R9OA 6CGTA 2VUYA 1XIFA 3ZO9A 4GUJA 4CQBA 2W6RA 2NX9A 4GQ0A 3VUSA 4GFSA 3KVLA 1R38A 3NPWA 4QEEA 1UD5A 4TV5A 2YCEA 1V6WA 4LALA 3F2BA 5A2CA 3P84A 1JGMA 5FSEC 1JZ6A 1VBHA 1S5NA 4HNOA 3N17A 5D38A 1PKNA 1QASA 2XVPA 3DBPA 1WP6A 1PVNA 4LCQA 4MWAC 2GFTA 3PZ9A 3HFTA 3UW6A 4PL1A 4IM4A 3O8AA 4KFPA 4E4PA 2P8CA 2V9DA 1WZLA 1FHDA 1V8EA 3PP7A 5LZLA 1FTXA 3N3TA 2WSKA 3S6TA 1O94A 1ZBWA 4NX0A 1EJTC 3R0DA 3ARSA 4AX6A 1TE6A 3WUGA 4XKYA 3A5FA 4XD3A 3WN6A 5MKGB 1BWKA 3U2EA 4P7NA 3HGRA 1JXKA 1SPQA 4PUUA 2P3EA 3LPPA 2QYGA 5HNUA 3D6NA 3KBNA 2G3JA 4H8HA 3PNZA 2Y7EA 3RX2A 4LX4A 4XD5A 5KINA 3AYVA 3AHZA 4IGNA 5HJYA 2GDUA 5LNWA 1WDRA 3N1AA 4WJEA 3I7RA 3S46A 4E5TA 2OOGA 2NXIA 2PDHA 4YVXA 3MC5A 3UT0A 4AD3A 1ZCOA 4K1WA 2WCSA 4NF7A 1XYCA 3DU0A 3H7VA 3CJPA 3VIMA 2WHKA 2C1IA 3WQ4A 3H4XA 1XYLA 4HYWA 3H7RA 3PTMA 4N7QA 1VJZA 3WH7A 1S46A 3C2VA 1H1YA 1T0OA 4DJFC 3LNPA 1B2YA 1U5HA 5F2MA 3IGUA 3EOEA 5LHFA 4KIEA 3HPZA 2WV8A 4Q4KA 4WDXA 3CIWA 2DSVA 2F8QA 1P0NA 5LIWX 3W38A 3LTYA 2POTA 1BTMA 3G24A 3ME3A 1Y65A 4H9YA 1UJQA 3NSXA 4AD4A 3FSTA 1EKOA 1K6WA 1QHZA 3AMLA 1VEMA 3WBAA 1UZDA 1IV8A 3IWPA 3AOFA 2ZZ4A 3O06A 3Q58A 4ASTA 2ZKMX 3OQEA 3TN3A 3UCDA 3G6MA 3CTLA 3NYDA 1O7AA 3VNKA 1K03A 1R3RA 1CZ1A 4LT9A 4S3KA 1UD3A 4PUKA 1JD7A 4FX6M 4GVFA 3WQPA 4Y90A 3C8FA 1IXPA 2RDWA 5DMYA 2NUYA 3V3WA 5K3VA 3N2TA 4KETA 2XN2A 1Q3NA 3BGGA 3RGTA 1IHIA 3OHMB 4CN6A 1YIXA 1X39A 2V67A 1EA9C 3H4WA 1C8QA 1IE7C 3KL0A 3RHGA 4IX0A 3H23A 3IS4A 3WNMA 4PCNA 4HA4A 1HNYA 3WLQA 3VE9A 1H51A 5C70A 3CK5A 2OQLA 3NQ6A 3TMQA 4Q4PA 3LLFA 4QAWA 2XWEA 3GXMA 3SCOA 3NOEA 3PWAA 3FIGA 3F03K 3IEBA 3EPMA 1UH2A 2BP1A 1RLDA 2Q3RA 1M68A 5LXXA 2V2HA 1ZRQA 1N8FA 1TWZA 3MP5A 2PGWA 3MV01 2B0MA 3DFHA 1V3JA 1OX4B 3P6LA 1XH1A 5HXMA 1DTUA 2YJQA 1Q6EA 3NZQA 4JTQA 4D6GA 4JTEA 1Q6GA 2G96A 2RHGA 5M03A 4HA3A 5AHFA 1FH7A 5FACA 1NARA 3IJ6A 5CPLA 4BI6A 4BQ4A 2XSBA 2PD9A 3R4IA 4B9YA 4C6LA 4QAIA 4S3JA 2E1WA 1WOAA 3O05A 3R58A 4PRTA 4E38A 3F7JA 4PUDA 1SW0A 5E0KA 4X2PA 3K2GA 2G3NA 1AMYA 4J5NA 1FA2A 1VLWA 3Q94A 3MKVA 1XFBA 1XH2A 2PTYA 5FCZA 2WQDA 3CUFA 2WXDM 4RCXA 3ALFA 4IHCA 4PFHA 1NQKA 3WQCA 1PEZA 1ALDA 2A3CA 3T8QA 3VYLA 1E43A 2X0YA 3WNOA 4C6IA 2Y63A 3LCWA 2GJLA 3L5AA 4LAZA 4YCOA 1GK8A 3V7PA 5LIUX 4M80A 4UZSA 4QG8A 4FIRA 3BSMA 4EAMA 3RM8A 4GHRA 3DFQA 1YE4A 4W7UA 3NQ2A 3TYEA 1XP3A 3ZQ9A 1UP2A 3E9AA 4ACZA 1LWJA 1PCWA 1UR2A 4UTMA 3CV1A 2LLEA 1RH9A 4P7OA 1JYWA 2QGHA 1V7AA 3AXXA 2ZUVA 3KLLA 1B4EA 3F2CA 1REQA 3NO1A 3DFOA 1GYMA 4A3UA 2VZOA 3PPFA 3S2CA 4HKPA 2EXOA 1B9BA 3FEQA 2SFPA 4XO6A 4O0QA 3LGGA 2WMJA 4JIIX 1T7LA 2YL8A 4LY8A 2ZICA 5D4YA 3PNUA 3S1XA 1HL2A 4AZHA 1JL8A 3S1VA 4R27A 3QTGA 3AS0A 5ECVA 1T5AA 3EKLA 4KT2A 3VNJA 2VD9A 5AYZA 2JKPA 2Z27A 3RUBL 4AD5A 3UG3A 3GYCA 2ATMA 4ADSA 2CZVA 5CPTA 4C7GA 1XF0A 3LBOA 2GDQA 4REQA 3W88A 4JIEA 3H22A 3BV4A 4HSHA 1LF1A 1G5AA 3UPBA 2P50A 2J9XA 1K7XA 4P8UA 4F0SA 2X1UA 3MTWA 3MCNA 1HP5A 5RUBA 2FB3A 1QHOA 1CENA 3VOFA 4AEOA 2Y5JA 4XK2A 3HGSA 4RK8A 4JTRA 5CCZA 1TV4A 3M7WA 3W53A 3W7PA 4FSAA 2HXTA 2ZRZA 1ZSXA 4WOZA 1RZMA 1GOIA 5KEZA 3PS7A 5A8QA 4LC6A 3OGSA 3NGJA 4CEUC 5A95A 2ZUSA 3CM4A 4K36A 3SRHA 4IPNB 4Z1BA 2PDUA 1XW8A 2CLLA 3VFCA 2PRMA 4JKKA 4REQB 1E51A 4S2CA 1L9WA 4MWAB 3LXCA 2VEPA 4PMZA 3UQNA 2VELA 4V33A 1KXTA 4O53A 1VBRA 3M6DA 3TDFA 1C3FA 1JRCA 3E49A 3FX4A 1CXHA 3KS5A 3ZT5A 3MY9A 4YHGA 1Y8BA 3FYPA 1KNWA 2RDTA 3VFLA 3K46A 3RRAA 3BOLA 3BOFA 1HKVA 2KZHA 2QAPA 4WKAA 2PLCA 4B15A 1LM1A 1TX2A 1ELSA 2J6VA 4TTUA 4AZCA 1LTDA 3LS9A 3WFAA 3IAQA 4PL2A 3D0CA 3W26A 3W25A 2OB3A 3WF3A 4E8DA 1F3XA 3PN8A 4QQ3A 2TODA 3KCLA 3HM7A 3EEZA 1I75A 1TSIA 2DZXA 4ENLA 4GIYA 4GFIA 1B30A 4P8XA 4B2DA 4CCDA 3FXGA 3OBEA 4D6EA 2QDDA 1XLFA 1RVKA 5DO8A 1F76A 4U2ZA 1E6PA 3WF1A 2QF8A 5M17A 1KB3A 4H9VA 3TC3A 2PDXA 3NM3A 2BWGA 3CGTA 4J40A 1XBVA 4FS9A 1L8NA 5CQ1A 1AJ2A 3UWVA 1XR2A 2Q8ZA 2QCHA 3W24A 1KLYA 2AL2B 4V1XA 4FZIA 3KP0A 2BDQA 3PZVA 2X16A 4CNUA 1XXXA 1TUFA 3W70A 5LA1A 1E1EA 1VCVA 4H7VA 3TJ4A 3T4WA 3OTRA 2PBOA 4A3RA 3L23A 3LYEA 1IWAA 4A8IA 1KFEA 4G1NA 3N6HA 1RY0A 3TW6A 4MFDA 4D9PA 1EB3A 2GQAA 3KX6A 3JUGA 1J0YA 3HG3A 3G3DA 1TWWA 4EPKA 1P43A 3EX3A 3LGEA 1ODUA 2BLEA 3C6CA 1FHVA 2IKIA 3I3EA 3P80A 2X7VA 3P74A 2EEXA 1DWFM 3HMCA 4P7QA 4QITA 5EMLA 3PZUA 1QOPA 4DBDA 3V35A 4ZQCA 4MNMA 3FN9A 3CYJA 4GX9A 3OOQA 1GONA 3K8KA 1TTIA 5D33A 2V5CA 1PYFA 1W3LA 1V3HA 2Y1HA 3TLLA 2D3LA 1RJRA 1SJCA 4FB7A 3ZT6A 4JTUA 1KV8A 1TV5A 5I3GA 3BAWA 2YLLA 3O2LA 1W0MA 3GC2A 3HQNA 4S1FA 3SFWA 1VFHA 6XIAA 3UR2A 2XH4A 1ZCCA 3R94A 4QDPA 4RXFA 3ITOA 3S1GA 1QFEA 3IJDA 4N4PA 1UQZA 3BLOA 2XISA 3W71A 4EANA 3GVWA 3MUIA 1XUUA 3IGHX 1F3EA 2CZEA 1DTNA 3E0FA 4D6IA 3QV8A 4IPIA 3AU6A 3UZXA 1YDNA 5FJUA 1NWTA 3VD9A 2RDUA 2A1YA 2X09A 2GSJA 3CB8A 3T40A 5XIMA 3SQLA 2ZXBA 1NM9A 1E0TA 3KS6A 3NQMA 3M0MA 2Y0FA 1S3TC 1XBXA 5M2FX 1TFVA 4TMBA 2IW0A 2ASHA 3WUEA 4LUTA 4EOUA 3VMNA 3AJXA 1H50A 3M46A 1AW1A 3R8HA 1D3HA 2DUZA 4NI8A 2Z6IA 4YS1A 3LERA 1JRBA 2Z7KA 3M0LA 5EKYA 1ZBVA 2C3ZA 3L21A 1RD5A 3NR0A 4DO7A 5G1MA 2W92A 4B5WA 4O1FA 1JYNA 3WK1A 1SO6A 5DELA 1GNXA 1VCFA 3L4UA 3ZOAA 3EWCA 4JYEA 1UR3M 2PMQA 1HKKA 2I5IA 3ZLGA 3E0LA 4G9PA 2WMHA 4UZUA 4KRZA 1ZUAX 3PB2A 1JZ8A 1NWRA 2V81A 1GVFA 2PU0A 4UTWC 1LT7A 1WUEA 4LUIA 3GKFA 1G7VA 3MI6A 4UTUA 3V16A 4DJDD 3S6OA 4R34A 3ARZA 3HV8A 2BHUA 1GWJA 5BOFA 5DY2A 4CEXC 4OE7A 4HNVA 1EQPA 2NVAA 4OJYA 3MV11 2VDHA 4UXDA 4XG1A 3RG6A 1HKIA 2ALDA 2ZDRA 3ZJ7A 3S9IA 4QDWA 4A21A 4H9MA 5FEWA 1R3WA 3S1WA 4C1NB 3HJEA 3WG6A 4MZ8A 2YSWA 3DGBA 3WDIA 1PWMA 4PTNA 1YTDA 3KTCA 4FEZA 2DJXA 1EWDA 3LUTA 4FOKA 1GJPA 1UZHA 1QOQA 2HRWA 4Y8FA 3W9ZA 2ZA1A 2Y4SA 4X22A 3SAZA 1V02E 1H7OA 2HZGA 3FAWA 2EPMX 1Q6DA 4DYKA 2VP8A 3MKKA 4D6DA 4LAKA 1IEIA 2ZFAA 4H19A 2NW0A 1AVAA 4E8CA 2JBMA 2CCRA 3VIJA 1WBJA 1X6LA 4MMWA 4JN8A 1VEPA 4ZOAA 1A0DA 2FMNA 1X98A 1FFQA 1B3WA 1OGSA 3ALGA 4D8LA 3W7QA 4US6A 5CZTA 1HX0A 4AYSA 4H7CA 1UP0A 5KTLA 3W37A 1WB0A 1TRIA 3MMTA 1J96A 4E2VA 1EWEA 4FF7A 4O8AA 4N2YA 2FHFA 1UWUA 2CBJA 3AWNA 3GTFA 2HS6A 2QUNA 5D02A 1XDJA 3VDHA 3S5SA 4YWSA 2X41A 4O52A 2CLHA 1LP6A 3UNTA 2BV9A 3BLEA 4E3VA 3NQAA 3PPGA 5KITA 3LHTA 1D3GA 1OFEA 5G1YA 1DIDA 3QF0A 4TIMA 3NDZA 3BC9A 2PWUA 4MB3A 2A85A 3GIQA 4LSBA 3WSUA 3RMJA 2X2YA 3ZZ1A 3NL6A 1NOUA 4A4AA 1YXDA 4AWUA 1OBAA 2J62A 5EGRA 2ZRXA 3FEMA 2X7WA 3AO0A 4IIFA 2WLYA 4EF8A 1UR4A 2W61A 4QP0A 4TX9A 5HWNA 4AC1X 1NFBA 3PZOA 1VFSA 2PRLA 4IMDA 3AYTA 7CGTA 1CCWB 1EDGA 2QCDB 3EAUA 5CPNA 4ZFMA 3QPYA 2P10A 9CGTA 2YDQA 3NVDA 2D20A 3B05A 1EC9A 3OBKA 3VD7A 1RD6A 2I7GA 5BMWA 2RJHA 3DHDA 4OUEA 4I5XA 2GGGA 4IGSA 1G6CA 3ZXWA 1X6NA 1VPQA 5D9OA 2YLAA 1E9LA 1MZHA 3SURA 2ZC8A 4EF9A 1HP4A 1DBTA 1I45A 5C0QA 2NXGA 1J0HA 3WD3A 4UOQA 1MUWA 3AAMA 1P0KA 2XVGA 4QG9A 4JFTA 3SY1A 3RYSA 4NZ1A 3ZLFA 4JHOA 3UZYA 5A8MA 9RUBA 4MKNA 5HK4A 4AMCA 1JCXA 5EMJA 4GY1A 2Q6ZA 3EB3A 2A2IA 3CL7A 5FJOA 4GUFA 1OFOA 1YXYA 3D5HA 1D9EA 2GVJA 5A8OA 1V3LA 1MFUA 2QULA 5A2AA 2G50A 4ZGYA 1VGAA 4E2BA 1VYSX 3G5EA 4L1GA 3EWWA 5EA9A 1YMYA 4AVFA 1IWPA 2JALA 2FTWA 1I1WA 4HNCA 2YPIA 5LSMA 4GBDA 2FZMA 4YL2A 3BLKA 4W5ZA 1UWIA 1PL9A 3WF0A 4YXGA 1QTWA 3SUWA 3RR4A 5GVJA 4YTSA 3HPXA 2XFRA 4PC8A 3EWDA 1LDCA 1KM2A 4ZB5A 2D3NA 2W5FA 1BVWA 2WM0A 4DWSA 5HAOA 4PFMA 4UQAA 3AHXA 3VKJA 1QATA 1BD0A 1QBAA 4KCVA 4GABA 4GNVA 3H4GA 4A2SA 3H12A 3MUCA 4S3BA 1FWFC 3T0DA 4LUSA 2OEMA 1LL4A 3LZ5A 2WAGA 1MNSA 2Q3OA 2VFGA 4JQ1A 5A3HA 4F2TA 1NELA 3M41A 2DZAA 3IGSA 3TOPA 2V2DA 1KWKA 4DJFA 2CLIA 3FA3A 1NFPA 3QKZA 5C8BB 4WLCA 4RDWA 3MI3A 4H8VA 1UZ1A 2ISVA 3EEGA 1QPRA 5FJJA 2V2CA 4B5XA 1HO1A 3ITTA 2QCGA 4KW2A 1RR2A 1NWSA 3UXLA 3M0YA 3QM3A 1KM3A 4PTXA 1MUMA 1UB3A 1W5NA 4GYKA 3LBMA 3QFEA 3MSGA 3VOHA 4PMQA 2BHZA 1EJUC 3GVRA 2I16A 4IH3A 4I3GA 2PDCA 3KDOA 2YCLB 4K39A 2OG9A 1KFJA 4Q8WA 1QK2A 2XZ9A 1BGAA 1LOLA 2WQPA 3J7HA 1ZBCA 4Z2HA 5HR7A 3G8RA 4NILA 4TU1A 2CLEA 4Z0JA 3AISA 3P8IA 3SO7A 3ZS4A 4JTAA 4LWWA 1A5CA 4MJ2A 5IDIA 1FP9A 3FYYA 5D37A 3VGBA 3WMSA 2HCVA 2GJNA 3W1QA 4PBEA 3URNA 5IBXC 4US5A 5F2IA 3VNZA 1E0VA 3NG3A 2EJ1A 5F4WA 4GC3A 3LG3A 3MQTA 1DQWA 5E6ZA 1Y5XA 2X1TA 4JICA 3C4UA 3H2MA 5T26A 3WUFA 3RMEA 4PCPA 4NJIA 3VGFA 4RV3A 3GG1A 1M5WA 4NVTA 1KCXA 4IOTA 2V5LA 1R7AA 3OP2A 1M9HA 4YTTA 2YL5A 3HA1A 3DH7A 1BKHA 4W88A 4H9ZA 1JYVA 4G7FA 5BW6A 2GSHA 4UCGA 3V5OA 5CC5A 4ZXOA 2YGYA 3EDDA 1EGZA 3NQCA 3B9EA 1E70M 3SCTA 1VS1A 2GSEA 4E2OA 3H2EA 4DUWA 3LU2A 4MLRA 5I3JA 1ML1A 1W5QA 4POCA 1J4EA 2WCGA 3V4BA 4XISA 4GIAA 3UEQA 4X63A 2QJHA 3GNRA 3KBMA 2WNNA 4MF4A 1DXIA 4GO8A 2CLMA 4J1OA 4O4WA 4ZB0A 1EX5A 1B54A 1W1IE 2Y2WA 4DF2A 3CHVA 4LU0A 2ON3A 1I1XA 3R8RA 1H41A 3GHUA 1UUQA 1AL7A 1OADA 2YX0A 3W6MA 2J8GA 2VZTA 2ZRWA 4OGZA 3BTNA 5BCAA 5A6BD 1M53A 4O50A 4MB1A 4NNAA 5HINA 1XC6A 3VUPA 3CIVA 1CXLA 1WOBA 1C93A 2VEIA 1BFNA 1G4EA 1Q7QA 4XZIA 5HNTA 1TPEA 4RZ6A 1A49A 3QVQA 4KERA 3ZVIA 4KEVA 4XZMX 1TV7A 2IPFA 5HJLA 3NOYA 1M7XA 3IUIA 1TJ2A 4O28A 1A4MA 1IIHA 3LQGA 4R7OA 2C18A 3MDUA 4KCWA 3TEVA 4L6HA 3L0KA 4C6QA 1VCGA 1ZAHA 3QPZA 3TYZA 2VM8A 1GQLA 1Z42A 3XISA 2BG5A 2I5QA 2BVWA 3EXSA 3WNLA 1TZ9A 2EBNA 3IJ7A 2FFCA 2IQ0A 4C1KA 4K7VA 3APGA 5M3WA 4HHHA 1AFSA 4S23A 4DJEA 1DE5A 1BYBA 4UMCA 4DNMA 7TAAA 3P14A 3CUJA 1OK4A 1UJPA 3QKEA 3B06A 1X8CA 4BCEA 4WY0A 1TJ1A 1SGJA 1CLVA 1NH6A 4KBXA 1G0CA 3OZYA 4Q8PA 3OIXA 3O0KA 5GNZA 1TX0A 3H2NA 3FJ6A 3ZT7A 1EJSC 3LCIA 2QJJA 5IFPA 4HT3A 3KVKA 1W2PA 1H60A 4JBRA 4GIEA 2HBVA 3PUEA 3G1YA 1AD1A 2OWCA 3UXAA 4R7WA 3AC0A 2G3FA 3R0UA 4QIUA 1MWOA 7REQB 2Y88A 5TF0A 4DAFA 1UWRA 1W31A 3OLIA 4ZCWA 3ZLHA 3NNTA 3URAA 5AC8A 4BA0A 3R0KA 5TIMA 5D8WA 1Y7VA 3TKFA 1KKRA 3AQUA 2PLJA 3QHOA 3BZGA 1JGIA 1VRXA 3UPMA 5HANA 3E2RA 4OWGA 1KBBA 3LLDA 1T8XA 2ZC1A 1TCDA 1UUMA 4V28A 2OWWA 1DJQA 1YDVA 4BEUA 3POCA 5D2YA 1VIWA 3C2FA 4I9TA 3W3OA 3WQ6A 4U3AA 4GMEA 2J88A 2CW6A 3MUXA 5KSWA 4GWEA 3TWBA 3CAVA 3ITYA 2J75A 4EP8C 2CZFA 2O7SA 3BMXA 1TPC1 2FMOA 5HUPA 3UY7A 2A7PA 1HVQA 3S2NA 2CFFA 1LYXA 2A3BA 3OYZA 3C0QA 4LANA 2EKCA 2VFEA 4AZ5A 3I4KA 4UC5A 3EKZA 5JBEA 4F0KA 4RNJA 2OLAA 1JPIA 3CUGA 3ZJ8A 4LS0A 1LROA 2XGIA 2NSXA 3VMOA 1ZAIA 4FLQA 4NZCA 2X1IA 2EQDA 4GVGA 4C90A 1SFLA 2I56A 2FTYA 4YTUA 3S9ZA 5FKYA 4H9TA 4HPGA 1C90A 1QI5A 3STPA 4LV9A 1POKA 5DEZA 2JIWA 4TTGA 1W8SA 1JIBA 4KEMA 4PA8A 3VDGA 1F6KA 3AIUA 4Q32A 2FPTA 3UU0A 4BI7A 2PDGA 1ZFJA 2PTXA 2NUWA 5ABGA 4Z2GA 1TR9A 1WE5A 1YPFA 3ZR4A 1E4IA 4DJDC 4LS1A 1BPLB 4UMAA 2WSQA 1TTJA 3I6RA 2OR2A 1XRVA 4IQJA 1KRAC 2A79A 1H0GA 2I17A 3ZJKA 3LDVA 1UOZA 3TE9A 5JQ9A 1R6WA 3CZGA 3I6TA 3TJIA 4Y8EA 4BQ3A 1ZTVA 3CZLA 4YLWA 4JIPA 1IR2A 2TMDA 4DUXA 4LEQA 4Z1CA 1DWIM 4XV0A 4EPDC 2HVNA 3CTTA 4KRUA 1KFLA 1GVOA 3SGUA 2ZE0A 1DJZA 3CWOX 1GHRA 4IICA 1C8XA 4HHMA 3VKKA 3WLSA 4W84A 1GG1A 3PJTA 3AMGA 1X6UA 4DHGA 1ZQ5A 3UWZA 4P7LA 2XGBA 4ROQA 1S3HA 2FDMA 2OJPA 2QF7A 4XZHA 1O66A 1P5BA 3VPLA 4UFIA 3R7MA 1WXYA 1HJXA 2I14A 3CC1A 1R8LA 3KRBA 3QGVA 4LBUA 5EPDA 4Q4MA 3FGCA 2HS8A 2MUCA 5MKGA 5GNYA 2BOGX 5C2XA 3GXNA 1W1YA 2ZZ1A 5F4SA 1ZB5A 2J47A 5CJ5A 2VYOA 1JNDA 4KPLA 3TNOA 5TAOA 4FX8A 4D8AA 4HPJA 5LKYA 2XN1A 4NAEB 3TAOA 1GOMA 3VGEA 5AFDA 1DXEA 5I0DA 2QV5A 1HUVA 2R9RA 4ATLA 2ABBA 4FPSA 3A12A 3E3HA 3WBYA 2Y5EA 1VRDA 5HNNA 4BWLC 3DI1A 4GVIA 4HZ7A 3WMBA 4C7DA 1JUEA 1RALA 3NL2A 2B4GA 2W67A 4GO9A 2G3IA 2VEMA 1W1VA 2W63A 3HQPA 1XRTA 3NZPA 1OFRA 4O0KA 3UCCA 4PMOA 3QH2A 1EJXC 1XLMA 5T9BG 2ZRUA 1JCTA 4A05A 3QJAA 1RP8A 4MWAD 1HW6A 2UV8G 1KFKA 2A7RA 4OTKA 4IGHA 5CZ0A 5DRIA 5HMDA 1S2CA 4JNYA 1BYDA 4YN5A 5FEXA 4W5UA 4DYJA 1PTGA 4RE2A 1L0PA 1TCMA 2ACUA 5KZEA 3JW7A 2QCDA 3PZNA 1XG3A 3INPA 1V03A 2GWNA 1R7OA 1OYCA 1EX1A 1FHLA 3CASA 2F84A 1JZ3A 1TJRA 3FS2A 2ZYFA 3AMDA 3PB0A 4PMJA 2VI0A 4B5TA 4ZTXA 3U4FA 3W7DA 5DANA 1J01A 3CL6A 3TYUA 1QAPA 5AYIA 5CBJA 2XHYA 1KXVA 1U5VA 3P0XA 1SFJA 1WDPA 3P7YA 2ZXQA 5C9ZA 4CD8A 4H1ZA 1JDEA 3VIOA 1JR1A 1R87A 3ATZA 2XIJA 1Q7MA 3UF9A 3A64A 3RNDA 1HO4A 2HE8A 1LLWA 4NHVA 2ZDSA 3B0PA 1ADSA 2B31A 3C52A 4TQTA 3QV6A 1RBLA 2HPIA 1K77A 3CS2A 2DIEA 4XVDA 2R82A 2UY5A 4A22A 3W7NA 4JS3A 1ME9A 5JU6A 1KTCA 3G2GA 5DLCA 5EFFA 5FJTA 1W9BM 4PMUA 3ITVA 4BR1A 3BV7A 3SQMA 1OWQA 5FF0A 2F9RA 1XGDA 4ES4A 2ZTJA 3PTKA 3C2OA 3PUGA 1FWAC 1VD6A 3GHTA 4JX5A 2NT1A 3F4VA 5IDZA 2EG7A 1UG6A 2HXUA 4PCSA 3U0HA 3GXIA 3MWCA 2OT0A 5I03A 4AVNA 1EC8A 3L7RA 1AQFA 3IV3A 1MDRA 4F79A 4FF5A 4ZO8A 4JAWA 3CU2A 2V69A 1VZWA 2QJMA 2CLFA 4UIOA 5ABFB 2O4QA 3CUXA 1Z48A 4L64A 3G8EA 4QJ5B 1W1ZA 3DBNA 3MSYA 2J7GA 4ZA0A 5E6YA 4GISA 2WLZA 4ZL1A 3ARWA 3GHSA 3QGAC 3HQ1A 4AFYA 3CQIA 4NRRA 1E6SM 4C6KA 1XPYA 3BGAA 3DEQA 3V0SA 3ZWSA 1YW1A 1JCYA 5AC7A 3RITA 2RFGA 5JBDA 4GK8A 2JQXA 4FNQA 3LTPA 1LQ2A 1EIBA 1CXIA 3GXDA 3U3HA 1DIKA 4IUOA 3GZAA 1U33A 2OPJA 2B7OA 2AGKA 5AC4A 2J7HA 4YTQA 2FH8A 4K3ZA 3GFYA 2Z24A 5I3IA 4GY0A 2DSWA 1XG4A 3BL3A 1EXBA 3UZZA 2R1NA 4AIUA 1B1YA 2PB1A 4D8ZA 1A0CA 1UOKA 4P7RA 2WJEA 3LRMA 1XSJA 4GYJA 1TG7A 4LCSA 2VX6A 1REQB 2NVCA 2FB2A 3HO8A 1WPCA 3SIZA 2J7CA 3SI9A 1SJDA 1FWBC 5SWUA 1V6UA 1H11A 3RLHA 4AC7C 2WMIA 3BAKA 3W2NA 3NPVA 5EMYA 3C2RA 5E09A 3KBVA 3WQFA 1E4LA 3S6DA 3PZMA 2ZVIA 1IGWA 2PGEA 4BS0A 4O17A 2VX5A 4QISA 3GXFA 5EFDA 3LHZA 4W7WA 1LOSA 3N9KA 2R24A 4PMVA 3JR2A 4KFNA 3M43A 5C7VA 5M1TA 3VIGA 8RUCA 2QMJA 4BZYA 2PTWA 4LUTB 2NLIA 2FH6A 2CHOA 1C91A 3EKGA 3DYPA 3WZ0E 1EDTA 4N9EA 4O54A 4ZTYA 3S8HA 1N8IA 1XSKA 2VEGA 3DECA 4HCHA 3LENA 4AHPA 4IP5A 3SCVA 4RL3A 1FXPA 1UWQA 2V3FA 3NQBA 1UPPA 3BMVA 4UQ9A 2F6KA 2RDXA 2EPKX 4EE9A 3GWQA 3M1ZA 1PHQA 4C6NA 3FKKA 3TNBA 1TYGA 3BLPX 1XSIA 1V0KA 2WVVA 1UC5A 3ABZA 4KWWA 3LXBA 2R94A 2HK1A 4GXPA 1V3MA 5U4NA 3CUZA 1R30A 5EU9A 3T1GA 4O19A 5FD0A 3PSVA 2PTZA 1KGWA 3VC5A 5CEWA 3UBPC 3WEOA 4IWWA 3CWNA 1F4AA 2E25A 1P6BA 4D6FA 3QYSA 3OLEA 2PWFA 1OCQA 4Y7EA 3ZSTA 5I07A 1R3VA 1GT8A 4IIGA 3G1DA 3G77A 1P7TA 1NDWA 2YCJA 2BTMA 1OX5A 1K70A 4UNKA 1PZ3A 4U28A 2J8FA 1A5MC 3G0XA 1H49A 5T9CE 3W0KA 2DV0A 2XIIA 4RXGA 3GRIA 1YTEA 4HPXA 1EF3A 1Z6KA 3T09A 1OY0A 1X1OA 2DH2A 4N02A 3Q65A 4AW7A 1PZ1A 4BEQA 3TP4A 4UQDA 4RNHA 1EOMA 1PS9A 2FDSA 4UOJA 2WSRA 3W84A 1OSEA 2Z1BA 5HDRA 5AVNA 1OFBA 3S2JA 1L6WA 3QSTA 4IISA 1BF6A 1V93A 1NJJA 4Z2KA 2Q71A 3JZUA 1K1DA 3QQ0A 4NIRA 1XQLA 3OO2A 4NJGA 3VD4A 1OG6A 4EVZA 1TPUA 1WXZA 4QXIA 3AZSA 4RUBA 4QJ3B 4MPKA 2GUUA 4PMNA 5JUVA 3T0TA 3PVFA 3UG8A 3PBGA 3O63A 2AQWA 2GUBA 3RJXA 2VRKA 2V6AA 3ZM8A 4TVCA 2J9ZA 2FZ8A 4GA8A 2UZ9A 2BOFX 4ATDA 4H6KA 3A4AA 3U2OA 2OOFA 4Z1DA 3PJWA 1LG1A 2C0HA 5FSDC 4IZGA 4U10A 5FJPA 3RCYA 1NTHA 2BXVA 2V30A 3E2QA 3QQWA 3O1NA 4QFUA 3TUUA 2GVGA 1GOWA 2H8XA 6A3HA 2PCEA 3VOIA 1CX9A 1TZZA 3N9SA 4F3HA 2W62A 1GVIA 4BF7A 4MDOA 3V0TA 2QPSA 1BG4A 4L4MA 1BWLA 1XQKA 1HJQA 3IUHA 2GJXA 2TSYA 4M7SA 4XD6A 3N4AA 3MCOA 1D3CA 2H8ZA 3UZWA 2QIIA 2DDXA 4WY0F 1AZ2A 4P5UA 4O4VA 2Y85A 1YBQA 7A3HA 4NZ5A 2E4TA 2WMIB 4M0XA 3TK7A 5A6KA 2HTMA 2XM1A 4YVPA 1UWSA 4B5VA 2OGYA 1RSCA 2HISA 1CGWA 3O9NA 3M5YA 2OQYA 2A6NA 4AZBA 3W76A 2UY3A 3CXOA 4AD1A 5LYRA 4A8RA 1XIEA 2O92A 2A0NA 1MYRA 3U2CA 3OHIA 2CU0A 4HNNA 2AL1A 1DJGA 2XZ7A 1RBOB 2PDFA 2OYKA 1BAGA 1I60A 2BNJA 1EF2A 4HN8A 3MYPA 4DM1A 3EWBX 1E6RA 1HJWA 3S4TA 3NIYA 3IK2A 4NY2A 5C7HA 1EPVA 1X97A 1QI4A 3IANA 4BHYA 1TWDA 4LUYA 2CBVA 1FWJC 2DZPA 3EOOA 1UW9A 4MDPA 2Z1VA 4Y96A 4BF5A 3B9NA 1KKOA 1DEDA 3ARYA 3JRKA 5FI8A 3KFTA 1XICA 2J13A 5BOOA 2BGNE 4YYCA 3WUBA 3F4CA 2DQWA 4AU0A 3MI2A 1EP3A 2OVLA 1E1CB 3SM0A 5MHBA 2C6QA 3MSRA 1WUFA 4HGXA 3TTEA 1MQQA 2AQOA 4GZ7A 5JH1A 4RE4A 4YCPA 5MF5A 3W1AA 4XAFA 4JHMA 1B5TA 1CGUA 1RHCA 3N6QA 3VINA 4CGTA 3W7MA 3M0IA 2OO0A 1OZMA 2DSUA 3R1ZA 2DJLA 2Q02A 4GCAA 5A6SA 1Q65A 3DXIA 1GOXA 3M0XA 6ENLA 4J3VA 1WO2A 3EX4A 1LUCA 1FCQA 4L5ZA 5AVHA 3PZTA 3DN5A 2Q8LA 2RUSA 4RJEA 3ZR5A 3KZPA 4KRTA 5BMXA 1Q66A 4MNKA 4Q8NA 3GU1A 4Y9MA 4LUSB 3S47A 1IEWA 2J78A 4IMEA 2PWGA 4O11A 3A4WA 1QW7A 2FPVA 2Y5SA 3C3NA 4J2PA 1SZGA 1JI2A 1ZNNA 4AB4A 4DB7A 1DL3A 1M7OA 3NWRA 4ZQRA 1UKQA 4I9AA 2ZADA 4JYDA 1B57A 1Q8AA 3N2CA 5J04A 4JL1A 2E7FA 3STEA 3LD5A 3LNMA 1XJBA 2C15A 4GQBA 2DEPA 3H55A 5BU9A 4JFWA 3WLLA 3EDFA 1XIJA 1HJSA 4O8RA 3VO0A 2O55A 3PK7A 5I3HA 4WIWA 1DJWA 2YYTA 1D8CA 1XWYA 3STGA 3WLMA 1ZJAA 3IRSA 3K8MA 3QY6A 4JTIA 3WLNA 4CNSA 2YFNA 2VVNA 2OSWA 3UXIA 1FH9A 4OBSA 3SY8A 2V38A 5HA7A 4H6RA 4AWTA 3VX0A 4AY7A 3PBUA 2AKZA 2XDFA 6XIMA 2YDRA 3WDJA 2DVUA 5FESA 4J7RA 3W87A 1OYAA 5LIKX 4A2RA 1GW1A 3R8GA 2OXNA 2ONEA 3GX9A 4C6FA 1EO7A 3SW6A 2VGIA 3VTRA 1IEQA 4MZ1A 3IJ8A 4PUJA 4PTMA 3LHWA 4F9JA 5E9XA 4I9JA 1JNEA 3PAOA 2HNHA 4QEHA 1VYRA 2HV5A 3SIMA 1F3TA 1G7UA 4BF9A 2FJUB 3RX4A 3H7UA 4ZO7A 2HMCA 1CXKA 1RQHA 3E96A 1E3XA 2A3LA 2EJAA 2JFEX 5LA0A 3P8JA 2XH7A 3SCQA 2FGLA 3VC6A 3LMZA 4GQGA 2RJGA 2WVSA 3CYVA 5TD4A 2GZXA 3WIJA 1WNOA 8CGTA 2CLKA 1FXQA 1MZRA 3W28A 4JPGA 3D3FA 1E5JA 1EJVC 4JL2A 3WFZA 5BRPA 2DY3A 3MB9A 3QW3A 4HYVA 1RLCL 2IXUA 4UTJA 4ZQNA 1JCNA 1A5UA 3LX9A 1SQ7A 6REQB 2DQXA 1BKSA 5BOEA 4NP7A 5HBFA 1HKJA 2PP1A 1A3HA 4OV9A 4JYFA 4Z1AA 4PSPA 5BWAA 3GBEA 2HJPA 3E5BA 1YEYA 3NQ7A 5F2LA 3EOSA 3PPCA 3SR7A 3QC0A 1ITQA 2VO5A 3TA9A 3C61A 1JCMP 3T8LA 3PANA 3WK2A 1J0JA 2QVNA 2XYLA 3EWYA 2OELA 4GNKB 4DNHA 1XYMA 6ALDA 4NSBA 2W4XA 5DCDA 4PH6A 2PURA 2NX3A 2AQVA 2VKZG 1FQ0A 5HWJA 1BRLA 4A8LA 2QPXA 3B0UX 1RCXB 5A8NA 3H2CA 3GYEA 4J27A 1N82A 2Z7GA 1E1FA 3QSRA 2WVVB 4JQ2A 1YRRA 3M0ZA 3PBWA 3CLWA 2VC6A 1R85A 4PE8A 4W85A 2GQ9A 2Z00A 3NGFA 3VCNA 3RM9A 3AHYA 2PUZA 3THQA 1SUXA 5G5IA 5F1UA 1CGXA 1QI3A 3MUAA 1WAWA 3ONCA 4CN1A 2D0HA 3N2BA 1I0BA 5B7YA 1POJA 1XD0A 3HFYA 3VCRA 1R3SA 3EWXA 3NYZA 3BAYA 1OZQA 2X0SA 4FMVA 3DC0A 3B9OA 2VR4A 2QNEA 3KOZA 3L67A 5G2HA 2NQLA 3RPDA 1QO2A 1A0EA 3B0VC 1K02A 3CUIA 3KWXA 2V82A 1DYSA 9XIMA 1QRQA 3WEMA 2E9MA 2J7EA 3KAOA 1GTEA 1RAKA 2Y62A 4WY0B 3UVAA 1OFQA 3GTNA 3R43A 1IZCA 3I7QA 4NZFA 4JN6A 3EDKA 3C86A 2BASA 3WMCA 3N11A 4Z17A 2QCCA 1XLBA 4DJED 4O1CA 2GVYA 3B8WA 3GH7A 4P8VA 5A6JA 2MNRA 3T44A 3PAJA 4H3DA 3U6WA 3AIVA 4U4MA 1H5VA 2Z4GA 4H6EA 1EYWA 4DZIA 2TRSA 1H4PA 1ZBKA 4FNRA 1BGGA 3PUDA 4QG6A 3HG4A 5E70A 4B16A 2VCAA 4GUGA 2I1OA 3TTOA 1M7JA 3IJ9A 1US2A 2VDGA 3AU2A 3SADA 3DDMA 3P60A 3RF9A 3PUOA 3A3HA 4AEEA 1QNQA 2NVDA 4FALA 3P3BA 1NSJA 1RVGA 4D2JA 3REQA 3IVUA 4WR3A 3KBSA 4NYYA 3OU8A 4L9XA 4EXBA 3KL5A 2MANA 4GC4A 4QBXA 3CEPA 4DIAA 1XV8A 3OYXA 1N55A 1M7PA 1DV7A 1KRBC 4XAZA 4ZENA 1RPKA 4F48A 5C9XA 3NSMA 1K8CA 1O60A 1FDZA 1EFZA 1DIEA 1XYAA 3HJZA 3UETA 2NV9A 1MMFA 3LEPA 5TQLA 3TX9A 2PLKA 3PR2A 5EMMA 1LRTA 2ESCA 1H1ZA 4Q6XA 3LTSA 3B40A 4F9DA 3E6EA 3BAXA 3IK4A 1TV3A 4LVFA 3QXBA 3TW9A 5DMMA 4DO5A 5TBOA 3P67A 4CVUA 1HKMA 5DT5A 4FK9A 4E8GA 3GZ3A 1Q85A 1OABA 5CSUA 4CD4A 1UQYA 3U2ZA 1B0IA 5D2WA 3BLLA 1LRNA 1JF5A 5BYWA 1W9VA 4AIEA 1VHNA 5FF4A 3ZYZA 1ONWA 2VX7A 3WEZA 5CH9A 1HT6A 2P0IA 3TXZA 3M0VA 5CPOA 5AKQA 3OGVA 1PV8A 2AMGA 1AZ1A 1FVPA 3H2FA 1EUAA 2VC9A 3FAXA 5BXPA 1U1JA 1NP2A 4J3UA 1TIWA 5FJIA 3EX6A 4FNTA 1V02A 3CAWA 3SN0A 5A94A 4UMBA 3GC5A 3ZSSA 2B7QA 4WX2A 4DO6A 3CHDA 3UZJA 1KO0A 3UR8A 2BY3A 3EPOA 3GNOA 1IXQA 4H9UA 2R1MA 4O13A 3NURA 1SO5A 4JTTA 3IIVA 2OZ3A 3LN3A 2DZUA 4UTIA 4XVEA 3U7VA 3AXIA 1A5SA 3E38A 4NZ4A 1JYXA 3SSJA 8A3HA 2G95A 1R3TA 3NDYA 2CC0A 5DF0A 5D03A 4XTDA 5G2IA 4Q4QA 4HHPA 3BW2A 4G56A 3SQSA 4PEKA 1UIPA 3QLLA 1FWNA 1JUKA 1UA3A 4LGXA 5ABHA 2VNCA 4JR5A 2XH0A 3ICJA 2V5BA 4N9DA 4HOWA 4O57A 1YNYA 3B04A 5AECA 4XTIA 1BEUA 1OF8A 2CHRA 4JQ3A 5DY3A 5H1WA 5J5DA 3KLKA 1IT7A 1F6PA 1ISXA 3G0UA 4ZOEA 2DUXA 1SSDA 3I10A 4AX7A 3CMJA 1P6CA 5AY7A 3E0WA 1EHNA 4F0HA 3MMDA 2E9LA 1C7TA 4C1NA 2VEKA 4ZOBA 3ABSA 4GE8A 4E4UA 1I2OA 3TZFA 5CZSA 3WQVA 4ECLA 1SO3A 4FNSA 3VDCA 1KLZA 4IXHA 3UJSA 4AISA 4H04A 3A4JA 2J9YA 3QN3A 4XAYA 1VAHA 1EO5A 2AOSA 3KRZA 3HGJA 5D30A 1P4CA 4LAOA 1WAUA 2F61A 3TN4A 1BLIA 3WJZA 4AD0A 1Q4NX 5F4XA 3AICA 3SCNA 4LV4A 2GK1B 3B0XA 5H8UA 1P0DA 1IYXA 2FJKA 3GK0A 4IP7A 3BSHA 3H6OA 4I7WA 4K6AA 2V3DA 3NO5A 2EAWA 3G1HA 3B4YA 5GJMA 1FCVA 3DHUA 1XIIA 3T55A 5ABTA 2KX9A 1RUSA 3R79A 3T78A 3FVDA 3SJNA 2I9UA 3REQB 4TXEA 4X0VA 2VQTA 2A21A 1LCOA 1M01A 2QUMA 1SW7A 3KDNA 4K38A 1E6QM 4F0LA 2VRQA 5CAHA 3F4DA 4BKNA 1GCYA 3VKAA 2OSXA 3ZR6A 1DJHA 2YA0A 3IACA 4W9TA 3M4HA 1S2AA 3SZ8A 1O95A 2CNCA 4GI9A 3EZ4A 2NQJA 4QDMA 4QS6A 1V6TA 2NSOA 4Q22A 2X1RA 2X1SA 2PTDA 3VIPA 3QV7A 4XIMA 5H8PA 2QCMA 1S5WA 3A13A 4R85A 1VPYA 5CGMA 4NX5A 2J79A 2UWFA 1XLAA 5DBTA 1P48A 2P3ZA 1IEXA 3CLMA 4UOZA 3M0JA 3W27A 2OODA 2ADAA 2NXHA 1G4TA 3ZWTA 1T40A 1L6GA 1Q6QA 2E09A 4AVOA 3KP1A 1ECQA 1EGMA 2IXVA 2DZWA 5CJMA 1MW0A 4HNTA 1PIGA 3CL8A 4AY8A 1MUCA 2PI6A 1W5OA 1G9HA 1K8YA 1VB9A 3L4WA 1ZENA 3VOGA 3OVPA 1UR8A 4TOQA 3MA8A 4LW7A 4D6HA 3BWWA 4LCRA 2BMBA 4L9YA 3G1SA 4DWSD 2VJXA 3LHUA 2NWRA 2DZSA 4K1GA 1V4YA 1ZU8A 2DW6A 2Z25A 2ALRA 3AHTA 3TC6A