4O8RA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
rcsb
source organism Methanothermobacter thermautotrophicus
total genus 85
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o8rA00
1AL8A 3NR0A 1TPH1 3I7RA 4L4MA 3S5YA 3GNDA 1XBXA 1Q6LA 4UTJA 3TKFA 1DV7A 1FDJA 3SECA 5BMXA 3KRSA 4UFMA 2EAWA 2JGYA 5DBTA 3W2KA 2X1SA 1SQ7A 3LCFA 4UNKA 4YMZA 5FF3A 4QJ1A 4TR9A 1JQVA 1I2OA 3VKJA 2A2IA 4QISA 2YPIA 1M6JA 2JGQA 3G1VA 4JTTA 2V82A 4MPQA 5LKYA 4DPPA 4OGZA 1O5XA 4GUJA 4O11A 3GVGA 1V5XA 5C6MA 1PCWA 5HUOA 4GUHA 5E93A 2FQIA 1KBJA 4WXZA 3VFLA 3KAOA 5DXYA 4YCPA 1KV8A 4QSHA 1SO4A 1F7BA 3DFSA 3W1UA 5FF7A 2DZXA 1DVJA 1XUZA 4O0KA 1W31A 2JKEA 3GDLA 3NQGA 2VFDA 4IPIA 4AEOA 3NQ7A 4K6AA 1MEIA 5G4EA 3FKKA 4QQ3A 4QAIA 4JX6A 1GVSA 1FXPA 2H6RA 3NL2A 3EX3A 3IGUA 3VE9A 1EP2A 3TJXA 5EYWA 3GZ3A 3W07A 3NVTA 5KMYA 4O54A 3UPBA 1Z41A 1T99A 2E77A 4KFNA 4GNJA 4S2BA 4A29A 3R89A 1IXOA 1FBAA 2DZVA 2QCCA 4LV9A 3TXZA 3V1PA 1GTEA 3L0GA 1H51A 3STCA 5LHFA 1S5TA 4WZHA 2A21A 3N2XA 2A1YA 3C2FA 3STEA 1OX4A 4ZQRA 2YFOA 1VCGA 2C1HA 1VCVA 1H7RA 3NZ1A 3SZ8A 1KLYA 2YFNA 3BVJA 2PCQA 1LRNA 4UTUA 2NXIA 4I7WA 1K3UA 2GPTA 3NL5A 1YTEA 2G5WA 1G7VA 4IPJA 3HQ1A 3STFA 1PCKA 1QDSA 1EP1A 1G4EA 1XXXA 3NM3A 4DO4A 2AAMA 3UZJA 4OU1A 4O4VA 2Y7DA 2WSYA 4EIVA 5HUPA 3P8IA 3CPRA 5G2IA 4Z08A 3PSVA 4RX0A 1OFEA 1C8VA 4AVFA 3A23A 4JTFA 3SY5A 3OHIA 4UTWC 4M7SA 5AHIA 1IF2A 5K4XA 3IIPA 2NUWA 3W2MA 3W7RA 3CIWA 3GK0A 1H60A 3G0XA 3KVJA 4GBUA 1L6WA 1WV2A 1YDNA 1KFLA 1P0KA 2I14A 4K8EA 4R33A 4JICA 4WY0B 1TO3A 3C61A 3AO0A 1KM1A 1W5MA 2C13A 2KZHA 1HL2A 1ZHAA 1X8FA 3MHFA 3W7CA 2NX3A 4UTLA 1LROA 4KWVA 3QF0A 4QNEA 2Y85A 6TIMA 2GQ8A 2IQTA 2J24A 3W1PA 1H1YA 2OZ0A 3EXSA 1QO5A 4ML9A 3F03K 5I3IA 1R47A 3BW2A 4HNNA 1TJRA 3S5NA 1HO4A 1XBZA 3G1XA 4N6EA 3USBA 1EEPA 1G6CA 1SFLA 1A5SA 3PC0A 4XUGA 3S1XA 3W7QA 4E0CA 2TSYA 4YXGA 2ATMA 1KM4A 2YW4A 1UASA 1E51A 4S2CA 1AK5A 5F2LA 1D3HA 3B0UX 1WX0A 4CQAA 5G5IA 1WOAA 1O4UA 2E1DA 3CM4A 4A22A 4JIPA 2QCDB 3A21A 2A85A 4LTSA 4RV8A 1RQEA 2VFHA 2QCGA 2YX0A 3QRHA 4FF7A 3LRKA 1TPC1 1P1XA 3SSJA 3N34A 4NZFA 3WFAA 1BKSA 4XTDA 5IBXA 2FDSA 3LCIA 3LCGA 1I2PA 4O10A 4MUZA 3D0CA 2QKFA 2VEIA 1RV8A 3R13A 3EXRA 3TR2A 1SR9A 3O63A 3GYEA 3TMLA 1AW5A 1WOBA 4AHOA 1PIIA 3O16A 4ZMGA 2Y89A 4CCEA 3EX6A 3BLEA 5I3JA 3IVSA 2O7QA 3MUXA 3T40A 1GG1A 1HFBA 3G0UA 2FJKA 1X6UA 1RZMA 1A5BA 1VS1A 3L68A 2Q3OA 1L2UA 2VFIA 4B5NA 1F6PA 4OE7A 1TV5A 2NX9A 1EB3A 3PS7A 4UXDA 2V2CA 3A22A 2C15A 3LHUA 3CIXA 2ABBA 5HWNA 1JUEA 3EWXA 1QOPA 1CX9A 2XN1A 5CGQA 3QMRA 3HG4A 2QCEA 3P82A 3U8GA 4IUOA 3FFSA 3SGZA 5K9CA 3QH2A 4NZJA 3W70A 1JUKA 3LTSA 4TX9A 1GVQA 1MSSA 1JVNA 3VCRA 2NV2A 2B7PA 4BWLA 2NXGA 3SI9A 2YR1A 4N9CA 2DZPA 2ZZ1A 1JCXA 1K02A 1ZALA 3QW3A 2NUYA 4XKYA 4A2SA 1VHNA 3LLFA 3C0JA 2V30A 3GXPA 1WXJA 3HB9A 4YCOA 5LNVA 3KVMA 1KFCA 2V0TA 3MMTA 2ZZ6A 1GYLA 2P10A 2X1TA 1RQHA 4NXKA 5LZLA 1UCWA 1O5KA 1OK6A 4MJZA 3A9IA 3PWAA 2ZTJA 3M5YA 3DFQA 4AHPA 4NJKA 4N9BA 1TPEA 3QSRA 1QOQA 1SO6A 1VYRA 5K9XA 3GDMA 4NNCA 4YL2A 1N8FA 3GB6A 3WJZA 4LVDA 1R2RA 1LZOA 3BW3A 3P84A 4XQ6A 3H53A 3TW7A 3DI0A 1EIXA 1QAPA 1FCUA 2J9YA 1W5OA 2CFFA 3QFEA 4NQ1A 4HNUA 4A2RA 4KFOA 3LXAA 3LOTA 1BWKA 1KFKA 3P74A 4HPXA 4O52A 3LB0A 4U4MA 3BG9A 2VFGA 1VCFA 3W2UA 2B4GA 4GUFA 5D32A 3E12A 4ORMA 2WO5A 4OV9A 4RCXA 4K38A 1Z44A 3CLMA 2CZDA 4FIRA 5G2HA 3C56A 2B7NA 5HJLA 3TE9A 3TA6A 3ATYA 2FPYA 4GXMA 3FJ6A 2I1OA 1EX5A 4AHQA 5I3HA 2GQAA 3OA3A 4XWUA 4ONVA 3HIJA 2CU0A 1A5CA 2Y7GA 4IGHA 3LBCA 3Q2DA 3N9RA 2ATSA 3TAOA 3W7JA 3CWOX 4O1BA 4PL1A 1LP6A 5KINA 4S1FA 1W5NA 3MP4A 1Q6OA 3PAJA 2V8ZA 3FA5A 4MFEA 1GQNA 4L4LA 4UFLA 3C2VA 4HNVA 5J5DA 2OT0A 2QAFA 2V81A 4JDYA 4M6PA 1EPXA 1I45A 2BX7A 2NX1A 3PVFA 5A8GA 3U6WA 4ZQOA 1KW1A 2A7RA 4DELA 3LRMA 3BPWA 4LC8A 1N55A 4UTMA 4CQ8A 5AHEA 2EPHA 3NEVA 2TPSA 2FIQA 5LSMA 2H3DA 4JDBA 1FCBA 2ZZ5A 4JN6A 3LCWA 1IIHA 3CU2A 3ABQA 4CQ9A 1U5JA 4OQVA 2LLEA 1NF0A 1PHQA 3L5MA 3BW4A 3Q94A 1LRQA 3IVUA 1B4EA 3BLIA 4TO8A 3CWNA 4XZ9A 3MO7A 4IXHA 3WJXA 3JS3A 1SPQA 1SSDA 3M7WA 1ZNNA 4O1CA 5AB3A 1W3NA 4LVFA 1MEHA 3W1LA 2O7SA 1LOLA 2WPBA 1VYSX 3FIGA 1ALDA 3LX9A 1QR7A 1D9EA 1LORA 4OV4A 4I7VA 3LXBA 1H7NA 2JBMA 5AFDA 4NX0A 3W1TA 3P7YA 3N19B 4RLIA 3MBFA 2GQ9A 3QSTA 3P62A 2TRSA 3NQAA 1TPWA 3HMJG 5KITA 3LV6A 4JNMA 3RFAA 4Z0JA 4PL2A 2ZBTA 3E49A 2Z6IA 4PFMA 1LOSA 3G0SA 4QM1A 5CPNA 5AHNA 3LHTA 4KWWA 3LLDA 2Y63A 3EWZA 1K7XA 4Z1BA 5IBXC 1NSJA 3BGGA 1KM3A 2QJGA 3IV3A 4E2BA 4LWWA 5DBUA 5F4WA 3NYZA 4NU7A 1YLVA 5GVJA 4Y96A 1TPVA 1TSIA 2VC6A 1TV8A 1BEUA 3DKJA 2QUVA 3IIVA 3EWBX 3O8AA 1MO0A 4CNOA 1JUBA 4Q32A 3W7MA 2Z1BA 1GVFA 2VEKA 4ZZ9A 1VJIA 1YXYA 1T96A 3TQ0A 3VNDA 5EKYA 1FCVA 4KFPA 1DKWA 2X1RA 3LTPA 5J5RA 4JYFA 1HO1A 3H55A 3DBPA 1WDWA 4DF2A 3ZFHA 2OCZA 3EEGA 1H61A 3MBDA 4UFIA 4UR8A 3PY2A 3O1NA 1YXCA 2QCNA 5D30A 1FWSA 2GVGA 4O13A 1UB3A 3V75A 4JIQA 1P4CA 3TFXA 3SIZA 3ZR4A 2F84A 3MYPA 4GFSA 4DQWA 5BRBA 2FPTA 1TREA 4O1DA 2R8WA 2VOMA 2VENA 3W6YA 1LTDA 3H54A 4BWLC 3DI1A 5FF0A 2C3ZA 4LV4A 2PRHA 2GJLA 4JTUA 3UWYA 3LI0A 2E6DA 3I65A 2XN0A 1FCQA 1W54A 2BTMA 2BLEA 1A50A 5DXXA 5CZSA 4X3ZA 3S1VA 2W79A 1QPOA 3P60A 3SW6A 1ZCOA 4MJMA 4A3UA 3BG3A 2ZZ4A 4WY0F 3UWUA 4BF9A 3P5YA 5K4ZA 3E96A 5BW6A 1AW2A 4NJHA 5AYYA 1XBVA 1YTKA 2ZA2A 3TCEA 4JD4A 1OFQA 1I2QA 2E6YA 1GJPA 3C2OA 1EUAA 3OVRA 4UFJA 4X9SA 4JTJA 4J9JA 1SW7A 1K03A 3FKRA 4KKXA 3ABRA 3LTYA 3G1DA 4UUIA 1ZFJA 1P0NA 2PURA 1ONRA 3R8RA 3M16A 1IXNA 2R14A 1MXSA 1G4SA 4CCDA 3L2IA 4FX7A 3WK1A 1GEQA 4MZ8A 4E38A 1QWGA 2QR6A 3W71A 1NF7A 4XTIA 1TTJA 3W1NA 3PG8A 5HQEA 3LCXA 1G4PA 5KZEA 3BK0A 3KHJA 4FXRA 5F1VA 1B3OA 2ZZ7A 3T44A 1TCDA 5AC6A 4JS3A 1ZAJA 2QUTA 3FEMA 5D03A 1YPFA 3BG5A 1R30A 4WXYA 5HINA 3HGJA 1FWNA 2VFFA 3HG5A 4JX4A 3G1HA 3PF3A 5CKSA 1R2SA 4N6FA 3DU0A 4MLJA 3KRUA 4IOTA 3I68A 3LXCA 2FTPA 3HG3A 2ZRVA 3G8RA 3NOEA 3M5VA 3PBVA 3PULA 3TSMA 1L6YA 4Y6GA 3P81A 1DQWA 1SZEA 3NPXA 2UV8G 3DXIA 4PEKA 2ZCGA 3EX2A 2VEPA 3FYPA 3G3DA 2J9ZA 4O53A 3SFKA 4HNTA 1GOXA 1X7FA 2NWSA 4FNSA 1FY6A 2JKPA 4NNAA 1OVDA 2XFWA 1QO2A 3STGA 4MY8A 2Y7EA 4HSNA 2J6XA 3L66A 3FJLA 1TYGA 1EA0A 1UBSA 1HUVA 4M7TA 4N9DA 4FIQA 3TQVA 5TBOA 3W2JA 5C5YA 1OJXA 1WBJA 5LNSA 3IGSA 3MI3A 3UY8A 1F6KA 5MHBA 2ISSA 3W7LA 1WYIA 4RZ6A 1SSGA 2NXHA 3M5XA 2DZSA 3R5EA 3IIZA 4RZ4A 3UYCA 4LUJA 4MYAA 5LGXA 2CWNA 4MOZA 4NJIA 1BTMA 1GTHA 4UC5A 5F4XA 4M6QA 1K7EA 3QYQA 5HWMA 5HR7A 3KX6A 5D2TA 2GOUA 5ABTA 1RR2A 4UCGA 1BWLA 3YPIA 4GE8A 4FB7A 3WK0A 1LDCA 4K7VA 4GJ1A 4Z0SA 5HMSA 3BGJA 1KM0A 4N9EA 3S42A 3DFOA 3EKLA 3QMTA 3NNTA 2HSAA 2WOQA 1GWJA 1YDVA 2HS6A 5I3FA 2V5BA 1LOQA 2ZRUA 3GR7A 4FNQA 2CLOA 2B0MA 2E68A 3O15A 2EF9A 4MIMA 1UUOA 2X16A 1TTIA 3TAKA 1YDOA 2YYUA 5AHLA 2G96A 2W0UA 3L67A 3TFCA 5C2XA 1RPXA 1A53A 3LDVA 4XBSA 1S5WA 1ZY9A 3HGRA 1AMKA 1ZAHA 4G1KA 1H5YA 1VLIA 3BLFA 2GJNA 2FB3A 2PRMA 4ZQCA 1ZJIA 1A5AA 1W0MA 1SW0A 1AW1A 1DBTA 1F73A 4CLMA 5L9FA 1KTBA 3I7SA 4P2VA 1H7OA 4U28A 3PG9A 5AOUA 5HNRA 5EPDA 2E5CA 2E6FA 1OF6A 1WAUA 5D2WA 1EWDA 3CQ0A 4X22A 2X30A 1H1ZA 4C1KA 1OX4B 3IVTA 3I7QA 1EUNA 1IXPA 2PE4A 4JGDA 1Z48A 2WSQA 1G4TA 2Y62A 4AWTA 1U83A 4R53A 4RKAA 2ISWA 4LY8A 4N4PA 3DHDA 2ISVA 2A6LA 4AWUA 3PBYA 4O19A 1DQXA 3NG3A 1XBYA 2ZRZA 4WJEA 3S8HA 4N02A 1TMHA 3P8JA 4M19A 1GT8A 4BI5A 1SZFA 4TMCA 1W56A 1J5TA 3FS2A 3LHZA 5CZJA 3NAVA 1VR6A 5D09A 3EWWA 1ML1A 4AAJA 3TW6A 1KTNA 3RMJA 3W7GA 3PBWA 3B03A 3HO8A 3TQKA 1JRCA 4JXCA 1OF8A 3UD6A 3B8DA 3LRLA 1LBMA 1G7UA 4ZQMA 3W1AA 4JEQA 1JCJA 4AH7A 2OT1A 4IJBA 1H7WA 4DBDA 4RK8A 3PSWA 1OFAA 1EWEA 2ALDA 3W75A 5F4SA 2B7OA 3W1QA 5D2XA 3MWAA 3FLUA 4PCFA 3PUEA 4WX2A 3OBKA 3OVPA 3QPZA 4JTLA 1IGSA 1PE1A 4K8HA 4LT9A 3ABSA 1F2JA 3INPA 3MP3A 6ALDA 5SWUA 4D2JA 2VEMA 1OG0A 3F4NA 1TPFA 4FEZA 1XKYA 3VE7A 2QAPA 5CPOA 3NO5A 1KFEA 3HGOA 5LHEA 4I9AA 5HULA 3M41A 1LBFA 3EKZA 4TU1A 2YXGA 1L6SA 4GUGA 1OX5A 1QFEA 2NUXA 2E5DA 3O6CA 4O28A 2CLKA 5KZDA 1SUXA 5LNUA 4UTIA 3LHYA 3E02A 2D73A 2J88A 5HR6A 1YYAA 4LC6A 3RLVA 1H7PA 3LCLA 4FX6M 2A4AA 2H8XA 2HMCA 5CSSA 4HPJA 5F2GA 3IGXA 4BI6A 3S9YA 2VXNA 2V2HA 3I6RA 3N3MA 3Q37A 5DCBA 4ZQPA 3B04A 1SFJA 4NJJA 1NVMA 4NVTA 4O1AA 3RLUA 4JTIA 3S5OA 4YLWA 4PC8A 4MY1A 4FO4A 1KM5A 3G1AA 1W37A 2QDHA 1VHCA 3ATZA 1I2NA 3UPWA 1XM3A 4UIOA 1Q45A 1SW3A 4LNYA 3W1XA 5EMUA 2RDWA 4Z1CA 3EX4A 3UXAA 4FHAA 3TK7A 1LRTA 1ICSA 3S0CA 4DO5A 1B9BA 1QPQA 1GYNA 2Y70A 3G1YA 3WK3A 1JCYA 2X1UA 5D05A 4EOUA 3R2GA 3LM7A 2X2GA 2F7FA 4OWGA 5EBUA 5K3VA 3NQVA 1X1ZA 2NWRA 4O57A 1T0OA 4AF0B 4JTSA 3W1RA 3W9ZA 3L65A 2ZTKA 4Q33A 3QC3A 4BR1A 1JULA 1OYBA 1H62A 3W1MA 3W2LA 3NQ2A 3TDFA 3RK8A 1K7FA 3DFTA 4QITA 4LOCA 2BWGA 2BXVA 2OMAA 4UTHA 2A6NA 2QJIA 3RU6A 3EB2A 3HPXA 4WY0A 3L5AA 2ZA3A 4DEFA 2YYTA 4CCCA 4LRSA 1TJPA 5F1UA 4RXGA 3MP5A 2P0OA 4DBEA 5U7SA 2PRLA 1UUMA 4IQLA 3S6DA 1FDZA 4XKYB 1JRBA 1KA9F 2C0AA 3FYOA 3TSDA 1SZNA 2Q8ZA 4NUWA 1XCFA 4AWSA 2I9EA 3GNNA 1KM2A 3GAYA 3W23A 1VPXA 3C2RA 4IMFA 3O05A 3EXTA 1C9DA 4PA8A 2H3BA 4RZ5A 5FEXA 4JYEA 2DZUA 1S5VA 4POCA 2W6RA 1PV8A 1VLWA 1JQXA 3P5ZA 4IWWA 3M6YA 5KSWA 3HBLA 4R7JA 1W5QA 5D04C 4NJGA 3NQFA 4ICNA 5U4NA 1QMLA 3TSBA 1YPIA 3ANYA 3GKFA 3EWYA 2ZYFA 1Y0EA 3W84A 2Z0IA 5LNWA 3TC6A 4CNPA 2QCDA 4E2DA 4JR5A 1K8ZA 4ZVJA 4ADUA 3QEZA 1OFOA 4O0ZA 3B4UA 3M43A 4Z1DA 3P80A 1H63A 4DXVA 3LERA 3W7NA 1JJKA 3TNOA 4MVAA 2Y7FA 1NAL1 3W3OA 4JTGA 1FXQA 2QCMA 2ZRYA 3ELFA 2RDTA 3W83A 1LYXA 3MW7A 4LW7A 5E1QA 5H91A 3T4CA 2R94A 3OVQA 1VH7A 1TV7A 2A7PA 1OABA 5K7JA 1WQ5A 3W2NA 1Z42A 3PUDA 5DY2A 4O4WA 4RXFA 1CI1A 4K37A 2WSRA 3TC7A 3W7HA 4AB4A 1M5WA 1SO3A 2A0NA 4AMAA 2V2DA 2G97A 1VC4A 1K8XA 2J27A 5CG7A 3SGUA 1CW2A 1DJQA 3SJ3A 2ZZ2A 2QCFA 3NL3A 3QW4B 5BMWA 3PBUA 2V5LA 2AGKA 4AXKA 1DJNA 4JY9A 4UTKA 4BK9A 2JKAA 4GRSA 1DHPA 3NQCA 1RVGA 1FUYA 4GC4A 2GUUA 3IRDA 2Z2UA 5DELA 3F4WA 2DORA 1KFJA 2VKZG 4UFHA 2JK2A 2RH9A 3TH6A 3OIXA 4XBKA 3MHGA 1OFRA 2BZNA 5AC7A 3MYOA 2C18A 3ABOA 3LHWA 1JR1A 2RKXA 3QJAA 5L6UA 1QPNA 1W3TA 5CPMA 5FEZA 1XI3A 5FEWA 4IMCA 1JCMP 1XDMA 2CLHA 2WNNA 1JCNA 4PH6A 3W85A 1UJPA 2ZZ3A 1M7OA 3G1FA 3NQDA 3W7DA 2VFEA 2CZEA 2A5HA 1W5PA 4A21A 3HPZA 3HG2A 4JY8A 1FWTA 3GIYA 3UQNA 1QPRA 5FESA 3NPWA 2FPVA 1ME7A 1GZGA 5G2WA 3HF3A 3C6CA 3N73A 5D2VA 4JYDA 3PUOA 3M0ZA 1F76A 1GPWA 2YCEA 5AYZA 2YW3A 2QCHA 1XC4A 4R34A 3UXDA 1JCLA 5D02A 3HJZA 3DKLA 2CZFA 3M5ZA 4K7YA 2BSLA 3OEXA 5F2IA 1GG0A 5I3GA 1F05A 2ABAA 5D33A 4LS2A 1TPDA 1DOSA 3KXQA 3B0VC 3LV5A 4ADTA 1XDLA 3KRZA 2YDAA 5DY3A 1IXQA 3DZ1A 3W7IA 3LCHA 1SO5A 2Q3RA 4M6VA 4LVAA 5CZ0A 1W1ZA 5EA9A 4FNRA 4PODA 3W88A 3UWWA 1GVOA 3A5FA 4Z1AA 3G22A 4LUIA 4DPQA 5AYXA 3CHVA 3DFPA 4HSOA 3WK2A 3TMQA 3GLCA 3L21A 1Q3NA 4ALDA 3NXFA 3NZRA 4O18A 2C14A 3IEBA 4K39A 1VRDA 3DFNA 3NPUA 1LCOA 4WUIA 2XN2A 3W22A 3WJSA 1TQXA 4FNTA 3HOJA 2RHGA 7TIMA 2NZLA 3G24A 3T78A 1FWWA 2YZRA 3GDKA 2WQPA 4IX2A 5FEPA 2DU2A 5I3KA 4UFKA 5K2ZA 4NT0A 2Y61A 2OX1A 3KVKA 3G1SA 2QF7A 1LLZA 4DO6A 4HIBA 4MZ1A 2GVJA 1THFD 5HWJA 2DZWA 4JTHA 3UWVA 5CSRA 3W86A 3QPYA 2B7QA 3L9CA 1B4KA 4O14A 2Q8LA 1LBLA 2FFCA 3L0NA 3KVLA 3MI2A 3TROA 2YSWA 1IIGA 4UTTA 5T26A 4MYXA 3SR7A 3WJYA 4MLRA 4Q4KA 4N4QA 4UNLA 1R46A 1TIMA 2CZ5A 3ZWSA 3NDOA 4N2YA 3GR8A 3O6DA 3UZ5A 4NX5A 4WD0A 3G8EA 1B57A 4O8RA 5D38A 1F74A 4O15A 1TRDA 3O6YX 1DORA 3LHVA 4LVGA 1MEWA 1ME8A 2TMDA 4RR4A 2Y6ZA 3MJYA 3PR2A 1F5ZA 2DJLA 3TJLA 1LLWA 5EL1A 4EWND 4W9TA 1OYCA 1QNVA 1XL9A 4IMGA 3M1ZA 3W74A 3B06A 5D2YA 5IM51 1OX6A 3U2OA 1FDYA 4LVBA 1HTIA 3HGSA 3GXTA 1X1OA 3TXVA 1TTPA 1WA3A 1FWRA 1XUUA 2ZRXA 3DH7A 4O16A 1RD5A 3W76A 4AF0A 2DZTA 4MY9A 2E09A 3W72A 4CNNA 1H7XA 5G4WA 1LM1A 4HKPA 3GDTA 1OYAA 1W8SA 4H4IA 4UMBA 1FQ0A 5FF2A 1NFBA 2EGZA 1OHLA 1PL9A 3IIXA 4NNBA 4IMDA 3C52A 2TYSA 3G18A 2ZRWA 4YWIA 1VZWA 1WBHA 3WJWA 2WNQA 3W7EA 2OJPA 1OFPA 1QCWA 4FNUA 1OFBA 5CZTA 3UWZA 3FOKA 2FB2A 3S1WA 4P61A 4LRTA 3O07A 5DLCA 2QJHA 1YADA 2FLIA 5CPLA 5G1TA 1H50A 1FX6A 1ICQA 3GXNA 4EF9A 2ZA1A 2WJZA 3GX9A 4JTEA 1O60A 2A7NA 4MKNA 4O12A 4UMCA 4OBTA 1N7KA 3W73A 4ZQNA 1TB3A 1I8JA 1SU5A 5BNKA 4QNWA 1R2TA 3NM1A 2ZFAA 2V9DA 3CC1A 3CEUA 3CT7A 4FNPA 3B05A 4BI7A 2DJXA 4ZL1A 4EF8A 3NQMA 3DHFA 2VELA 2CLEA 4RJEA 3TU9A 4TMBA 4FX8A 1C29A 5G1YA 3TX9A 1TRIA 2J9XA 1M7PA 5AC8A 5LNRA 4HT3A 3HPSA 3IIOA 5AHMA 3C3NA 1MZHA 1OFDA 2HS8A 3N14A 4IX0A 4UMAA 1K8YA 1KLZA 4JX5A 4I7UA 4K36A 3CB8A 3LI1A 5BOOA 3RNDA 1TPB1 1Q6QA 1TTQA 4Y8FA 3O06A 5TIMA 2CLIA 5AN7A 4WOQA 4BFAA 3EX1A 3W7KA 3THAA 2EKCA 4HN4A 1ZENA 1NEYA 3C4UA 3ZS4A 4LS0A 3MHUA 4H3DA 5DCDA 1RQBA 3F1QA 5C54A 3MI6A 3P61A 5EY5A 3S1UA 3UWQA 3PM6A 5LGZA 4GUIA 3CTLA 4UTWA 3T55A 4DF1A 4Y90A 1I4NA 2Y88A 2C6QA 3GDRA 2EHHA 3JR2A 3NGJA 3PB0A 3EWUA 2HTMA 3KOFA 3E9AA 2NLIA 1D3GA 3TIMA 2CW6A 5K9DA 3GAKA 5KZMA 3NA8A 1PS9A 1V7YA 3UNDA 3QMSA 1KM6A 3QM3A 3N2MA 3A5VA 1J2WA 2H90A 3OG3A 1KFBA 3N9SA 1S3HA 3L0KA 3K30A 2WKJA 2CLMA 1I2RA 2CLLA 1T8XA 4QIUA 4TIMA 3ZWTA 3NL6A 1XFBA 1DL3A 3BARA 3TV8A 4ADSA 3W87A 2NV1A 5DCEA 2ZQ0A 1ME9A 1TPUA 5TQLA 1P5BA 4FXSA 4X2RA 3LBMA 3TUUA 1Q6RA 2QEZA 4UR7A 3C8FA 1VQTA 5D37A 2YGYA 1OK4A 1L9WA 1ZAIA 1HG3A 2C16A 3NQ8A 2CLFA 2AQWA 2PC4A 3R12A 2G95A 1O94A 2GVLA 5H2ZA 1KTCA 3RF9A 2WNZA 4NXSA 4IXXA 1KV5A 3W7PA 1PHWA 4MFDA 4OT7A 5A5WA 4WQ6A 4M5PA 4C1LA 3BO9A 5FF4A 2ZDRA 5F2MA 3NQEA 3KFTA 1GVRA 4WOZA 4JTKA 1ADOA 4EVZA 4GWEA 4ORIA 1EP3A 5AHFA 5E0KA 1VYPX 5DN1A 3A24A 3JRKA 3Q58A 4PTNA 3THQA 8TIMA 1O95A 4O17A 4MZYA 1YTDA 5FI8A 1PVNA 3PB2A 3G3MA 3NQ6A 4Y9AA 3AJXA 2H8ZA 3BV4A 4IMEA 2R91A 3DGRA 3M9YA 4OHQA 2QUUA 1G69A 2WV8A 3QZEA 3T7VA 1G67A 4O50A 4UTTC 3B0PA 3S5ZA 1KBIA 3M44A 3E0IA 4H6KA 5C55A 4LS1A 2QCLA 2DP3A 2RFGA 2P1FA 2C19A 2Z6JA 3P67A 1W3IA 1ICPA 4LU0A 4DF0A 1SZGA 1YXDA 4HHPA 3DAQA 5KTLA 3M47A 3VI2A 3DENA 3GKAA 3LGEA 3W7OA 3CEPA 1VGAA 1AG1O 1AL7A 3QQ0A 3NPVA 1J4EA 1TQJA 2E6AA 3C2EA 3QQ1A 2QDGA 3L5LA 2E5BA 3UY7A 2RDUA
chains in the Genus database with same CATH superfamily
2J66A 4QDWA 3I7RA 2X8RA 4FI4A 3M0KA 1P7TA 1G0CA 3TKFA 5BMXA 3WD4A 2JGYA 4Q7NA 3L23A 5DBTA 1LUCA 3W2KA 2QGYA 1XQKA 3CAKA 4WSKA 4TV5A 2RGLA 4YMZA 3BAYA 4QJ1A 1DP0A 1JQVA 2A2IA 1CXHA 1JXKA 2YPIA 1E5JA 4GC3A 3QN3A 1C90A 3LSBA 2ZUMA 4JTTA 4MKVA 4MPQA 4CGTA 4OGZA 1O5XA 2OKOA 2JALA 1PCWA 2VQTA 2GK1A 4GUHA 3E0WA 5CC6A 4J3VA 3KAOA 1E9IA 5DXYA 4YCPA 1SO4A 3W1UA 1XUZA 2JKEA 3CJPA 3WDJA 3GDLA 4DJDA 4PMQA 4WDXA 1KQZA 2XSBA 4AEOA 5G4EA 1HT6A 4P8WA 4JX6A 1R9YA 3VKCA 2VZVA 4S39A 4D6JA 1K8CA 2V3GA 4O54A 4LB4A 4B91A 5HJYA 1FBAA 3FAWA 4NL1A 5C9XA 2W9MA 4BHYA 3STCA 3C0QA 3N2XA 1PO9A 1ZTVA 2DVXA 1UWAA 1MRAA 3VOCA 2PDHA 3QV9A 3F4VA 1BFNA 4B9YA 1PTAA 2OO6A 1EHAA 3NZ1A 1V93A 3SZ8A 1W9BM 1ZU8A 1RA5A 1V08A 2FH6A 4UTUA 1O6IA 3GVWA 2G5WA 3BWWA 1CEOA 1QDSA 2VUYA 2Z29A 1B5TA 4OU1A 3PPGA 1HL9A 2WSYA 1T5AA 3VCCA 4PN2A 3WNKA 3CPRA 2DW7A 4Z08A 4MWAD 1V6UA 1ZRQA 5IFPA 3PSVA 4RX0A 1BQCA 2GVYA 3PWGA 4M7SA 5AHIA 1IF2A 5K4XA 3QKZA 7PTDA 4L1WA 3LZ5A 1S2VA 2X0HA 3CIWA 4GIAA 3GK0A 3H2NA 4GQGA 4GBUA 3FDGA 1KFLA 1YNPA 3GG7A 2QZRA 3C61A 3ZVHA 3BE7A 5BOFA 2C13A 1E3ZA 1Q66A 1HL2A 3KCJA 3MHFA 3VUSA 5HOSA 4XSLA 3NXLA 5EMKA 3WEOA 3QV7A 1XG4A 3W1PA 4QHRA 1DE6A 4LCSA 4DZAA 8XIAA 1J6OA 2WZHA 1HO4A 2ESCA 1XBZA 4N6EA 1TVNA 4B5WA 1FWHC 3CPUA 3VIOA 4B15A 4HCHA 3S1XA 5B80A 4XBJA 3W7QA 2G8ZA 3VOJA 1ADDA 2O0TA 5F2LA 1YHTA 4KS0A 1TJ1A 1S2TA 4CQAA 5M1TA 4QP0A 5DRCA 1O4UA 3KCLA 3CM4A 3WBXA 4GK8A 4JIPA 4XZHA 1AQMA 2WB5A 3CZLA 3T9PA 2QCGA 3WDPP 2YX0A 3I4EA 4FF7A 2BOFX 1TPC1 3SSJA 2YDQA 2PDUA 3GVRA 4MWAB 2RUSA 1F61A 4O10A 3UGVA 3FGCB 3R13A 3TR2A 1SR9A 4HN8A 3GYEA 3PNZA 4AHOA 2YCLB 5A6JA 1L2QA 4ZMGA 3T1GA 4CCEA 1TZ7A 3BLEA 2O7QA 1GG1A 2FJKA 4QEHA 2Z27A 4QE1A 4W8AA 1L2UA 3PJXA 4FOKA 2A3HA 4B5NA 5BROA 1UHVA 4P7QA 1EB3A 1BRLA 1NWTA 1G9HA 4OKDA 2YXOA 1R3TA 2C15A 1HGYA 2EBNA 4RW3A 3H4XA 5CGQA 3QMRA 3HG4A 2QCEA 4H6QA 3U8GA 5A8MA 4IUOA 2FZDA 4HA3A 4AIBA 3RPTA 1TG7A 4BWLA 2R9RA 2NXGA 1FHDA 5FJUA 3A47A 5LYRA 3QW3A 4XKYA 5C70A 4B92A 3C0JA 3ANUA 5LNVA 2ZC8A 1ADSA 2ZZ6A 3Q4DA 2P10A 2X1TA 5LZLA 1O5KA 4MJZA 5A6SA 3OZOA 1M04A 2DH2A 2ZTJA 4AZGA 5REQB 1LQ2A 4H1ZA 5ENLA 3KRBA 3M5YA 4AHPA 3URAA 5BCAA 3QSRA 2R1NA 4X63A 4WEVX 1SO6A 1VYRA 5K9XA 3AAMA 4YL2A 3GB6A 4LVDA 4DJDC 3KS5A 1LZOA 1Z7AA 1PYMA 4HJWA 3EEZA 5M03A 1XD0A 1W5OA 5BU6A 4NQ1A 3ALGA 3WX7A 1VIZA 3LXAA 3L7RA 3P74A 1UP3A 4HPXA 2HQAA 4ROPA 3AZRA 4RDYA 2WO5A 3DECA 4RCXA 4K38A 2XIQA 5G2HA 1XSKA 3TE9A 3TA6A 2FPYA 3ZSTA 2I1OA 1EX5A 3OA3A 3OQ8A 4XWUA 4ONVA 3HIJA 5B7YA 2HDJA 4WKFA 1U2YA 1R38A 2WANA 2WMKA 3O0KA 3TAOA 5E70A 2Q8XA 3W7JA 4GX9A 3PPHA 3WF0A 4S1FA 4ZB0A 4A8IA 2QMKA 1XYAA 3UR2A 1Q6OA 1R9ZA 1UOKA 3FA5A 1HF6A 1DYSA 3FSUA 2V81A 2BVDA 1MRQA 3D47A 3N13A 2NX1A 2PDWA 2Y4SA 3VD7A 2AGTA 5A8GA 3U6WA 4GI4A 2A3CA 1YEYA 3URQA 2VL4A 3KW3A 4I6KA 4AIEA 5I3DA 2O9OA 3NEVA 3WL1A 2V67A 2E4TA 2H3DA 4JN6A 2F38A 2OZTA 3ZJKA 4G1NA 4CQ9A 1U5JA 4OQVA 1NF0A 3Q94A 3WZ0E 1OY0A 2HWGA 2PDQA 4OBRA 1LLOA 4DJFC 4IXHA 1RALA 3LM3A 3VOHA 2FGLA 1HN1A 3JS3A 3R7MA 1MQRA 2VC9A 4TX8A 2AMGA 3M7WA 3AU2A 4QDMA 2FZ8A 1W3NA 4DZ5A 2PS2A 1TCMA 2DSVA 1D9EA 2ZX6A 4P8UA 4WSJA 4WJXA 1H7NA 2YB4A 4G6CA 1CGUA 3WLQA 2ALRA 5AFDA 2VM8A 3P7YA 4RLIA 2TRSA 2OGYA 3NQAA 2ZUUA 3LV6A 4LF2A 2GJXA 4PL2A 3KP1A 3L4TA 3MS8A 2OODA 3BAWA 3LHTA 3WLMA 2Y63A 4NZ1A 1PTGA 4JHMA 2WZIA 1K7XA 5CC7A 5I23A 2HROA 2G4JA 3IV3A 4TX6A 2BASA 4A8RA 1TSIA 3RM9A 2VC6A 2Y24A 1CNVA 3EWBX 1QHPA 1LWHA 2IPJA 4PB3A 3V35A 2VEKA 3LSCA 2JIWA 1YXYA 1A0CA 1LG1A 3K4WA 4XD4A 3HQOA 2WVVA 4ZTYA 4BKNA 5J5RA 4OECA 1HO1A 3R4IA 5JBFA 3H55A 3TA9A 1WDWA 2PGWA 2DT0A 3TOPA 4UR8A 3GTIA 1PAMA 2I56A 3ZT5A 1IR2A 1W6TA 1GOWA 1YXCA 5C7HA 1UA3A 5D30A 3V75A 4JIQA 4Y2WA 3BZJA 4DAFA 2BOEX 2V6AA 1IWAA 3MYPA 4C1NA 4J3UA 1ZZMA 4ZO9A 3SEPA 2WSPA 4ZO8A 4GQRA 1CDGA 1WZMA 2PDBA 4UTFA 3W6YA 1DJIA 3N1AA 1MVYA 4BF5A 4GJJA 1LTDA 2ZC1A 4BWLC 1UR8A 1TMLA 4LV4A 2W3ZA 3DERA 1FTXA 3LI0A 1OCNA 4LH8A 1EL3A 2BTMA 5A6BD 1IEVA 2XVPA 5CZSA 4X3ZA 3S1VA 2CBJA 4MJMA 4A3UA 1TELA 2CC0A 4GNKB 4P8XA 1WZKA 3UWUA 3VINA 1S39A 2WLZA 1QW7A 5CBJA 1QNSA 5BW6A 1AW2A 2NW0A 1Z32X 2RJHA 1I1WA 5AYYA 1YTKA 4JD4A 4CD6A 1BF6A 4EPDC 2E6YA 4TUFA 1IEQA 4NSBA 3H21A 4I6VA 3OVRA 3UFYA 2YCJA 3KTCA 1HJWA 3AS2A 3TJ4A 4KKXA 3ABRA 2HISA 4H41A 3LTYA 2CBIA 1JNDA 1ODZA 3H26A 3BV7A 4HBKA 3M16A 4KCTA 1UR9A 2F8QA 3CO4A 1OINA 2IKGA 4FX7A 3KWXA 4N0RA 4MZ8A 3CUIA 2QR6A 3W71A 1NF7A 2GDUA 3RR1A 2FZBA 1G4PA 7CGTA 4FXRA 5F1VA 3EBVA 1B3OA 2ZZ7A 1OCQA 1TCDA 2HCVA 2XVKA 1ZAJA 3G6LA 2QUTA 5D03A 4TTGA 4DLMA 4MWAE 3HGJA 1FWNA 4QRNA 2VFFA 4RE0A 1XLGA 3G1HA 4J27A 3WNOA 5CKSA 1JZ5A 3H23A 4MLJA 3BJSA 2WWDA 1PDZA 3KRUA 4IOTA 4G56A 5M17A 3LY0A 3PULA 1UH3A 4F40A 4Y6GA 4ATLA 1DJWA 2X7VA 3DXIA 2UV8G 4PEKA 1VP5A 2MANA 3GTFA 4YIWA 2V69A 7ODCA 5CJ5A 1Q4WA 4JKMA 4O53A 3T09A 1KGXA 4HNTA 1GOXA 3T81A 3AMKA 4L6DA 2NWSA 1HZYA 3ES8A 1QO2A 4MHBA 1A5UA 3ME3A 1UBSA 1BSLA 4M7TA 3TN4A 3H2CA 3NUKA 4RPQA 4N9DA 4KMQA 5EU9A 5C5YA 2PDGA 2ZE0A 5LNSA 3BANA 3MI3A 2X2YA 2WZTA 1ZGDA 3W7LA 3KL3A 3IUIA 2DZSA 3R5EA 1R7OA 5HNTA 1PIFA 4YTRA 4IIHA 4LUJA 4MYAA 5LGXA 4C6NA 2CWNA 4MOZA 3RAOA 4NJIA 4L65A 4G2DA 1GTHA 2F6KA 4M6QA 3SUVA 3AI0A 1BXCA 3KX6A 1RR2A 1KFWA 1LDCA 4GJ1A 4F9DA 3KBVA 4Z0SA 5HMSA 2G3NA 3EMZA 4TXEA 3THCA 3QMTA 5F7UA 3N25A 4LSBA 4ZO7A 4QROA 2HS6A 2E68A 5LA2A 4D6EA 2J7DA 3O15A 3KBSA 4R7OA 4U10A 2OFJA 1W9PA 4GIRA 3TAKA 3KDNA 1ZB5A 4CD5A 4Y9NA 5C2XA 5GQBA 3GNOA 1S5WA 3M07A 2P8BA 4G1KA 3WD2A 1VLIA 3IANA 3BLFA 4ZQCA 2XHYA 1EX1A 4IL2A 3CT2A 1F73A 3VGEA 1KTBA 4H83A 1UC5A 3PG9A 3PZIA 3HFTA 2E3ZA 2E5CA 2E6FA 5D2WA 2X05A 3U5YA 5E5CA 1EWDA 3CQ0A 5FACA 4RE3A 1IZJA 3UA3A 1H1ZA 3N4EA 1R3WA 2XIIA 3WEZA 2Y62A 2F61A 3GUGA 3RM8A 4R53A 3HPAA 2RGMA 3MSDA 5T91A 2XFRA 2OQLA 1S2UA 3QHMA 3STPA 3VDAA 4AWUA 4O19A 3NG3A 1K9DA 4GKTA 4WJEA 4YVPA 4S23A 1XS2A 1M7JA 4G5DA 1M68A 4M19A 3SN0A 3PTQA 1SZFA 4I90A 4FLOA 4XD5A 3FHQA 3IAQA 2O92A 3GW0A 3LHZA 5CZJA 1H2JA 3APYA 3EWWA 1XRTA 4NAEB 5E6ZA 2IXVA 1TWWA 3HO8A 3FDKA 4HK6A 1LBMA 3VZZA 4ZQMA 4IJBA 3LQGA 2EO7A 1D7FA 2OLHA 3PSWA 1EWEA 3W75A 3W1QA 3VMOA 4W86A 3BICA 2V3DA 3GY1A 3OVPA 3KOWA 3AXKA 4JTLA 2VI0A 3GC5A 4LT9A 1NDVA 3ABSA 4IJCA 2J77A 1PSCA 5SWUA 4FEZA 1YMYA 5E09A 4KPLA 1Q63A 3KLKA 4NRSA 3GFXA 4ATWA 3K8MA 2RAGA 5I79A 4W88A 2YJQA 4V27A 4W8LA 1XG3A 5DX7A 4DN1A 3OGSA 3EKZA 2YXGA 4GUGA 2YL9A 1OX5A 3UGRA 2NUXA 2O4MA 1BTCA 3O6CA 4ZXLA 1SUXA 3QOMA 5I7GA 1JPIA 4XG1A 1V7AA 4XO7A 3CUHA 4MB3A 1YYAA 2AOSA 3UG5A 1Q2RA 1A80A 3WLOA 4JTCA 3B8WA 2QYGA 1FOBA 1GK8A 3H2EA 3CASA 4EWJA 3IGXA 3WKZA 3S9YA 1S2AA 2V2HA 3I6RA 3N3MA 4ZQPA 1NVMA 3U7VA 4KIRA 4JTIA 1XLHA 1Q4NX 4KEVA 2PAJA 4EE9A 3UP8A 1VHCA 3ATZA 1QOXA 4WKHA 1XM3A 2CHNA 1H5VA 5A2BA 4LNYA 1AZ2A 3SRKA 4YTTA 4Z1CA 2QQ6A 3WUEA 4FHAA 3TK7A 4C5ZA 3PFMA 1ICSA 1FWEC 3S0CA 5E0CA 1XLLA 4L4PA 2OSWA 1E56A 1K6AA 1UZDA 4EOUA 3R2GA 3LM7A 3SN1A 4B90A 4GY1A 3AHVA 5JMUA 3W9ZA 1E72M 3RDKA 3GH5A 4L4OA 1YQ2A 1HIZA 1MYRA 1R3QA 3W1MA 3NQ2A 1EJ7L 2XYLA 3TDFA 5CC3A 3RXZA 4UTHA 2A6NA 3RU6A 4XIAA 1N2VA 3ZQ9A 2ZA3A 4CCCA 1OIFA 4DBEA 2PRLA 3ZM8A 3S6DA 1FDZA 2Z25A 3AZTA 1JRBA 1ZBVA 3AMLA 3GNNA 5XIAA 2ZX9A 2OZ8A 4IMFA 3B4YA 1US0A 1EGZA 3T4WA 3OHMB 2H3BA 1EJUC 3EB3A 2PDJA 3R11A 3VC5A 2W6RA 2Z24A 2GOKA 1REQB 4IG2A 4X0VA 4GIEA 1JQXA 1TWDA 4S38A 2GWGA 5D04C 3CYVA 1UKQA 5U4NA 1IWBA 3TSBA 3ITTA 1HW6A 3WSUA 2D0GA 3EWYA 4G7EA 3GTXA 1E9YB 3W84A 1KNWA 1VB9A 2WCGA 4RW5A 1AD4A 2PWDA 3CL7A 2QCDA 4W5ZA 3IK4A 2YL5A 4ZVJA 4Z1DA 3HM7A 4Y9PA 3SAZA 4AVNA 4MVAA 1B31A 2Y7FA 2NSXA 4JPGA 3GDBA 4JTGA 3TTSA 3ZR5A 1LYXA 4LW7A 4PZVA 5LIKX 1VH7A 2A7PA 4IIFA 2ZVRA 1JI1A 2NQ9A 5DY2A 1CI1A 2WSRA 3RUBL 3WQOA 2A0NA 1V6VA 4MM1A 1VC4A 5CC5A 2DSZA 3P2VA 1GPFA 1FFQA 3SJ3A 2ZZ2A 2QCFA 3NL3A 1YNQA 3JZUA 3WD1A 1BD0A 1N8IA 1W1B1 4J3SA 4UTKA 1OSEA 1DHPA 2J79A 1FUYA 5AYIA 1QTWA 2CESA 2DORA 2REQB 2VKZG 1KRBC 4FSAA 1RP9A 2JK2A 1JL8A 3TH6A 1UWRA 1Y7VA 3OIXA 1F07A 4XBKA 2XH4A 1KO0A 3H24A 3LG3A 4NIRA 1QHOA 5BRQA 5AC7A 1IT7A 2C18A 4FALA 4YVXA 1HKJA 4L6OA 1XI3A 1O1HA 2AAAA 1JCMP 1XDMA 2CLHA 1JCNA 3W85A 5FSDC 2VHLA 3G1FA 2HPMA 2A5HA 4C6EA 4H9TA 3UQNA 1QPRA 3U4FA 3CQIA 3IUHA 3E2SA 5TNVA 1NJJA 3N11A 3BSHA 4Q4MA 1FWDC 4RPPA 4JYDA 4U33A 2UWFA 3MCMA 2HEJA 1KCLA 4DUOA 3IJQA 4FS9A 4R34A 3UXDA 4IP4A 3NWRA 3HJZA 4CNUA 3W27A 3VC6A 2XSXA 1Y65A 1GG0A 2ABAA 3U48A 5D33A 3TLLA 2E9MA 3B0VC 3LV5A 1Q7ZA 1XDLA 4WDUA 5DY3A 3VFCA 2KX9A 2ZWYA 2ZOXA 2YLAA 3W88A 2XFYA 2NQJA 4ZOBA 4Z1AA 2TODA 2P3ZA 4LUIA 3VZYA 3CHVA 2VCCA 1UIOA 3TMQA 3M7SA 3AIRA 1Q3NA 3NXFA 7REQB 4QAWA 3NZRA 3VIHA 1RCOB 4HU0A 5CLTA 3W22A 3EAUA 2DEPA 6A3HA 2BMBA 4IX2A 1EC8A 2XWDA 5JIPA 5I3KA 2J13A 1JDDA 1GW1A 1A3HA 4UFKA 3T0CA 1VFUA 5K2ZA 3TOYA 1OCBA 3VABA 3GU9A 3OOQA 4DO6A 4UQAA 4MZ1A 2GVJA 4PUWA 1P7TB 1OC5A 3W4RA 4YHEA 2J8FA 3BCFA 5CSRA 1EJXC 3OZMA 3PZTA 2YDRA 1LUCB 4GIYA 3L9CA 2NT1A 4ACYA 5I09A 1LBLA 1X98A 2QULA 4GYPC 9CGTA 3LA4A 1QW9A 3R58A 3UPMA 4UTTA 4MYXA 3SR7A 2IPWA 1R46A 3KDOA 1TIMA 3ARZA 3GR8A 3O6DA 3UZ5A 4NX5A 2GK1B 1B57A 5D38A 1F74A 3O6YX 4Q4QA 1ME8A 1B3WA 3QKEA 4QS6A 5ABEA 3WENA 2XM2A 1QATA 2UY5A 1XL9A 3M1ZA 5D2YA 4JEJA 4JIEA 4C6FA 1UPPA 4GGBA 1M53A 4AF0A 1J0YA 3E1F1 2E09A 2NQHA 1H7XA 2DZBA 1S1PA 4HHMA 4AMCA 2R1PA 3BUVA 2UY3A 3NGFA 5BWAA 1M7XA 1UKPA 1XDJA 1WZAA 2EGZA 1PL9A 1XFCA 3G18A 3JVAA 4AX6A 4M80A 1WUEA 2WNQA 3WH7A 3W7EA 1NFGA 1QCWA 3O6AA 3VM7A 1JYNA 2CCRA 3FOKA 4P61A 2PWHA 5DLCA 2CBUA 2QJHA 4GGHA 3W38A 4NG3A 2FLIA 3JZEA 2VP8A 3OP2A 5CPLA 1H50A 4CUCA 5H8UA 3ITVA 3S6TA 3GXNA 1XIGA 1SJDA 1KCZA 3R0UA 1I8JA 1ZP3A 3SDOA 5BNKA 3RR4A 1P0DA 3AHXA 5DRIA 3EGJA 2GUYA 2NVDA 1W1YA 3T42A 4GLEA 4JL2A 3HFYA 3B05A 3BJTA 4ZL1A 4ERAA 4EF8A 3NQMA 2VELA 4RJEA 3TU9A 4XO6A 2F9RA 1EF2A 3ORWA 4FX8A 1C29A 3ZVHB 3TWAA 3WBEA 3AZSA 3HPSA 4IFKB 5AHMA 3C3NA 1AQFA 4E8DA 2C71A 5BZAA 4GABA 1KLZA 1VFMA 3LI1A 3RIKA 4Y8FA 5KZ6A 3LQLA 2PEVA 3OPSA 1P48A 5TIMA 1XLIA 5CBBA 1S38A 1TX0A 2FGBA 4KCVA 2EKCA 4Y9OA 3UXLA 4ZOCA 4DUWA 4HYVA 4FK9A 3RX4A 4HMCA 1SFSA 2D2HA 1DIKA 4FR1A 5DCDA 1RQBA 3F1QA 3TYEA 3UWQA 2ANUA 1DJGA 4U5KA 3CTLA 1XIDA 3IUDA 4Y90A 1HQTA 3GDRA 3JR2A 2EHHA 5ECUA 2HTMA 1AJZA 2QPUA 1K9TA 5JBDA 1A5MC 1BG9A 3E9AA 2ACQA 1F3EA 1EO5A 3VNZA 5K9DA 1PYFA 4HYWA 1PS9A 2R1LA 1IQ8A 4C6JA 4S3JA 1E3XA 5ABFA 1BYDA 1IEXA 1E0UA 3A5VA 5CZKA 2H90A 3BXWA 3G77A 3UJSA 2CLMA 3EA1A 4JQ2A 3W0KA 2CLLA 1T8XA 4QIUA 3WQFA 4TIMA 3QTPA 3ZWTA 3NL6A 1XFBA 3AIEA 3GC2A 3W87A 4DJED 4X2RA 1X96A 3ZMRA 2QEZA 3C8FA 1VQTA 4HPHA 1XGZA 2C16A 2CLFA 3JUGA 2AQWA 2PC4A 3WEMA 4GZJA 3SRDA 3R12A 3ARSA 3RCYA 1XISA 1OIMA 2L5HA 4M0XA 4V15A 4OT7A 4S3CA 4WQ6A 4Y8EA 4C1LA 4Q8OA 3ABXA 2ZDRA 5D9PA 1PEZA 3MUZ1 3NQEA 1HJXA 3VKAA 1ECEA 1E70M 4EVZA 5I02A 4GWEA 4OZOA 3MMUA 1EP3A 1DWHM 2XH2A 5FSEC 3A24A 2IKIA 1RH9A 3PZGA 4G7FA 1YTDA 5FI8A 1PVNA 2WKLA 1J11A 2XFFA 3PB2A 3SRFA 3IWPA 5EMLA 4Y9AA 3UCQA 1OQFA 4AD2A 3DGRA 1G69A 4MB1A 1VFFA 1ZP4A 4UTTC 4MADA 5FL0A 5A95A 1AH4A 1KBIA 1YNYA 3E0IA 4H6KA 4FR6A 1XIBA 2DP3A 5AYBA 1UD6A 3P67A 2ASHA 3VX0A 8RUCA 3G1RA 2DUAA 4LU0A 4W7WA 2JFEX 2C79A 3M47A 5CLWA 1LF1A 3ITLA 3C2EA 1J0ZA 1OWQA 1XIIA 2QDGA 3L5LA 4H00A 4NZ3A 4GY7A 4J4KA 2RDUA 3GG0A 3NR0A 1TPH1 1NFPA 2OVLA 4IH3A 1QASA 4L4MA 1W2PA 3S5YA 4CNSA 3GNDA 2VZUA 1BGGA 1EIBA 2QPSA 3OLGA 2GGEA 3II1A 3HJEA 1ITCA 3ZJ7A 3C86A 1W3LA 5FJRA 3WLNA 1F4AA 1TWZA 4J7RA 4UB9A 4IISA 1EH9A 5FF3A 4TR9A 2DQWA 1I2OA 4X2PA 1KGUA 3N6HA 2WQDA 4K1GA 3MUCA 4R27A 2JGQA 3CAVA 4NYUA 1PZ0A 2YZ5A 4LAOA 4O0QA 4O11A 2PUZA 3VD3A 1GEHA 3GBDA 1KV8A 4QSHA 3DFSA 3RX3A 5FF7A 2EEXA 3KL5A 1JZ8A 3GTNA 2VFDA 4IPIA 3OBEA 1UUQA 3GSMA 1SZRA 1UQYA 1GVSA 2E8YA 3EX3A 4CU6A 3IGUA 4LYPA 2POZA 5FAJA 5EYWA 3NVTA 1E71M 5LIUX 1UH2A 3UPBA 3CUGA 1E40A 2FZMA 2FVLA 4EKJA 1EJRC 4A29A 3R89A 1IXOA 3OLDA 2QCCA 4LV9A 1KXQA 4NHVA 2G37A 4KERA 4WZHA 4TVUA 3K8KA 3ITXA 4ICCX 5LXXA 3EDDA 1WUFA 1U1HA 3ABZA 1CZ1A 2C1HA 4L1GA 1VCVA 1H7RA 2A3LA 1KLYA 3BVJA 4DBWA 3T0DA 1DJXA 4I7WA 3A64A 1V0KA 1WDDA 4EPKA 1YTEA 4IPJA 4QGCA 3K5XA 1EP1A 3FVMA 2AAMA 3RO6A 4R5EA 3H2OA 4TQTA 4LYRA 1UJQA 4KF1A 5HUPA 3LBOA 5G2IA 5HATA 3GU2A 4E2VA 4HJFA 4PUUA 1OFEA 1C8VA 4AVFA 2DVTA 1E6ZA 3UZWA 3OHIA 4MNKA 2PFHA 3WNMA 4M29A 2GJXB 4UOZA 1MUMA 1H60A 2BGSA 3AICA 5JUVA 4R33A 4YPJA 1TO3A 1CGYA 3WQ6A 3AO0A 1L0PA 1P0BA 3OA5A 4S3DA 1NQKA 1X8FA 4WF7A 7A3HA 1CCWB 3W7CA 2NX3A 4UTLA 4B5TA 4KWVA 1ONWA 1RJRA 4PR4A 2J24A 4AEFA 5H1WA 1H1YA 1YE6A 3DYMA 4ML9A 3F03K 3VDCA 4UR9A 4QS5A 3NSNA 1TJRA 1IT0A 3NOYA 3VNIA 3USBA 2WVVB 3ZR6A 1SJCA 1SFLA 4M6UA 3UVIA 4UOJA 4E0CA 2TSYA 4YXGA 2ATMA 1KM4A 2YW4A 1UASA 1AK5A 1R5YA 1WX0A 2WAGA 3AHZA 2HK0A 1WOAA 1FKXA 2A85A 4LTSA 4RV8A 1RQEA 4C1NB 2VFHA 1N8WA 4E4FA 3LLXA 1P1XA 3WFAA 3CV2A 5A6AA 1BKSA 4QR6A 1ONEA 1AD1A 4C6PA 2VEIA 3EXRA 2Z4GA 3TMLA 2QVNA 3GH4A 1XYLA 2Y89A 3FHAA 4KRTA 3B97A 3EZ4A 4QG8A 3IVSA 3MUXA 1ISWA 3P93A 3WNLA 1HFBA 4B9ZA 4XK2A 5EGRA 3G0UA 1XRFA 1X6UA 3CUFA 1A5BA 4H8UA 1XCXA 1XIEA 2GSHA 4R9XA 2VFIA 3WLIA 1RAKA 1F6PA 3WQWA 1ESWA 1F8MA 3F2BA 3PS7A 4Z42C 3IK2A 3FEQA 1ZJAA 4IICA 3A22A 2JIEA 3I6TA 1PX8A 3CIXA 2ABBA 5HWNA 1JUEA 2O9TA 1JZ2A 5BXTA 1QOPA 1CX9A 2BS9A 1VFHA 1Z69A 1XCWA 1MSSA 1JVNA 3VCRA 3GHUA 1JF5A 1L8PA 3ARXA 4CQBA 4N9CA 2ZZ1A 1K02A 4V28A 3L4VA 3NSMA 2CERA 3S2MA 3LLFA 5HJXA 3MB9A 1XRSA 3BCJA 3GXPA 1WXJA 1KFCA 3AHTA 2V0TA 1FA2A 1CENA 3SCOA 4NXKA 3APGA 4LNCA 1JYVA 3A9IA 2Y5EA 2D3LA 1B3VA 4F2BA 1EFZA 3DFQA 4NJKA 1NP2A 1QOQA 1XH0A 3SBFA 2P76A 2PF0A 2WMHA 1NIUA 4OOUA 1MNZA 3BW3A 1XLBA 3BMVA 4H04A 1XYMA 1QW8A 1QAPA 3W82A 1KBLA 1U1JA 2CFFA 3E2VA 4RE2A 3LOTA 3BOFA 4WHBA 3LB0A 4U4MA 3BG9A 2VFGA 1VCFA 4QCEA 4AZHA 3W2UA 3QVQA 3PTKA 4OV9A 3CLMA 2CZDA 2B7NA 1PTDA 4EAYA 3ANVA 3GNPA 3CTTA 1V3JA 4GXMA 2OLSA 3MVTA 1UWSA 5MKGB 2CU0A 1W1VA 2O4QA 1W9DM 3Q2DA 3CWOX 4PL1A 4I9TA 1PKYA 3GHTA 2WYSA 1W5NA 3A3WA 3ARVA 1Z8AA 3V5CA 1GQNA 4L4LA 3C2VA 1GVYA 4GI9A 2OT0A 1DJHA 1MWOA 1ZBKA 4GI8A 1I45A 2AL2A 4GFIA 1TJ2A 3CUJA 4ZQOA 2A7RA 2W91A 3LRMA 1CXEA 2V5KA 4UTMA 1W2VA 2WZMA 3AQUA 2EPHA 2FIQA 5DFAA 4JDBA 1FCBA 3LCWA 1IIHA 4HOXA 4L9XA 2DUZA 2LLEA 5CEWA 3BW4A 3WFZA 4QLLA 1J9YA 2G50A 3BLIA 4TO8A 4XZ9A 5AVNA 3WJXA 1NU5A 3RN6A 1SPQA 4HK7A 1U33A 5LA0A 1AODA 1ZNNA 1KXVA 2VEGA 3KOXA 4AYSA 1C8YA 3MKVA 3FIGA 3LX9A 4OV4A 4I7VA 1L6GA 3WF1A 1MUWA 1QNQA 3CL8A 3VKDA 3MBFA 2GQ9A 4I3GA 3QSTA 3P62A 3E2QA 3URNA 4UOQA 3AIWA 4REQB 2PLJA 3RFAA 3LN3A 2ZBTA 3E49A 1UZHA 4Q8MA 5AHNA 4AISA 2HBXA 5C9WA 4KWWA 4D8LA 3DGBA 3VPLA 4Z1BA 3DG7A 4XAFA 1NDWA 1KBKA 1XW8A 4I5UA 4LWWA 4E2BA 5F4WA 4M24A 4C6KA 4QDPA 4GI6A 4Y96A 3WIJA 3DKJA 1FWIC 3O8AA 2ZUTA 1JUBA 4V1YA 2Z1BA 4ZZ9A 1T96A 3TQ0A 4IM4A 1FCVA 5A8NA 5GJPA 2FDMA 1CGTA 3RPMA 4E8CA 5IHRA 2D3NA 4DF2A 3U7BA 3EEGA 1KKRA 1GJUA 5A69A 4AC7C 3R0KA 3O1NA 2FVKA 1EYWA 2QCNA 2VO5A 4JL1A 4JTDA 3C3UA 2F84A 1F8IA 1QJWA 1CXFA 4DQWA 1HKVA 4PUMA 3MWCA 5BRBA 5A6LA 5A94A 2FPTA 3GIQA 1J18A 2R8WA 2GUBA 2VENA 2WWCA 4P7NA 2GZXA 4S3FA 3OLEA 2GJLA 3UWYA 2I7GA 3QHOA 3E74A 3ZO9A 2OTDA 3AIBA 1V3IA 4WK9A 2EG8A 2BLEA 2GDQA 1A50A 1FVPA 3E38A 1QPOA 3OB8A 3WNPA 4H2CA 1ZCOA 4Y7EA 3M0XA 5I0DA 4YTUA 2ZZ4A 3VIKA 4QG6A 2WKGA 3CIVA 2BFGA 2GGHA 3P5YA 4A05A 4GJIA 4GQQA 2PODA 1GJPA 4E4UA 1YW1A 4ML4A 1UW9A 2PWVA 1XJBA 4ZOEA 4X9SA 3FYYA 1K03A 3MT1A 3RRXA 3G1DA 2PURA 3THDA 5C2GA 4PEEA 4YHGA 4H9ZA 2BGNE 2XIOA 1MXSA 3U2EA 1G4SA 4CCDA 1WXZA 3WK1A 2AL1A 4E2OA 4F79A 1QWGA 3DYOA 1SVDA 5C71A 3S2CA 4U3AA 4WLCA 4R3UA 3W1NA 2X40A 1UYQA 2FKPA 2FFIA 1UKSA 5AC6A 4JFSA 4JS3A 1POKA 2QIIA 1JDCA 3FEMA 4JBRA 1YPFA 4D1IA 5PTDA 3BG5A 3SCSA 1RLDA 1WXYA 2QGHA 2X0YA 1R2SA 3T2OA 4N6FA 4FA3A 3DDMA 3L2MA 3LXCA 3O7UA 4H9YA 3HG3A 2O56A 3M5VA 4CNTA 1NELA 3PJUA 4AW7A 4GCAA 1DQWA 1UR0A 2P3EA 2INZA 1P6BA 3BMXA 4CKQA 5CPSA 3FYPA 2J9ZA 1B54A 4JQ4A 1XV8A 1TR9A 4LBRA 4FNSA 2JKPA 5IHSA 1OZQA 4Y9MA 3AISA 4U2ZA 3DIPA 3IARA 3DOPA 4MY8A 4UBPC 1QPKA 2W66A 3L66A 1SJBA 3E0VA 2P5NA 1AJ0A 4IG2B 3RHGA 1HUVA 3TYUA 3FA3A 4FIQA 3W2JA 3UY8A 1Y5VA 5T8GA 4RZ6A 3M5XA 2XISA 2G3MA 3L4ZA 2G41A 3RX2A 2G3FA 1BTMA 3K46A 5F4XA 2BB0A 3DFHA 1K7EA 1E6XM 1M3UA 5HWMA 5HR7A 4EANA 3TONA 2XIBA 1DWAM 4KW2A 3KTXA 4GE8A 1EYEA 3MZNA 5FKYA 4K7VA 2J7BA 2IPGA 2VGIA 3DUGA 3BGJA 1KM0A 4DBSA 3EKLA 1BWVA 3RCMA 3AXXA 4DB7A 1SR0A 2WOQA 1YDVA 1LOQA 4C6QA 1K6WA 2B0MA 2WSKA 3WMCA 1I0DA 3H2AA 2EF9A 3LENA 4MIMA 2X16A 3V0UA 1YDOA 2YYUA 4KEMA 4H7ZA 2CKSA 3L67A 3FXYA 1Q65A 1WDQA 1YIXA 3A4JA 3E5PA 1Q8AA 2QV5A 1FH9A 4A4AA 1A53A 2ACSA 2EXOA 4PTWA 3LDVA 3WN6A 1ZY9A 3HGRA 3PPCA 2GJNA 3ZLFA 3T2QA 1BKHA 3MSYA 4MB4A 4D6CA 4F0LA 1A5AA 3EDEA 1SW0A 1AW1A 1DBTA 1DWGM 4HTYA 4UWMA 2E7FA 1B90A 3I7SA 4P2VA 5AOUA 1O68A 1GORA 5EPDA 4AZIA 3CPGA 3CWHA 3GXIA 4I9JA 4NAFA 4KESA 3I10A 2X30A 4DWSA 1OX4B 2VJXA 3IVTA 3DCPA 4X0NA 4JGDA 5CPTA 1Z48A 2WSQA 4F8XA 1TWIA 1G4TA 4RKAA 4N4PA 5CG0A 1NY1A 1KRMA 1FHLA 3V4BA 4IIEA 3MC5A 2A6LA 4PE8A 3PBYA 3GZAA 1XBYA 2ZRZA 4IL0A 2DW6A 4OUEA 3S8HA 3UZXA 4BI5A 1XKJA 4EPBC 2DFAA 1J5TA 4Z17A 3FS2A 1VR6A 5D09A 1MW1A 2QDDA 3VKBA 1ML1A 1U5HA 4AAJA 3BL3A 1KTNA 2DSKA 2XSAA 3B03A 2AKZA 4FMVA 1JRCA 1OGBA 3RLGA 1G7UA 3W1AA 3B8IA 4AEEA 3VOGA 3W6LA 1H7WA 2WHKA 1EDQA 1FKWA 5F4SA 5D2XA 1XSJA 1E0XA 3MWAA 3FLUA 4WX2A 3OBKA 3I3EA 1R8LA 1UMLA 3MDUA 4IIDA 1AVAA 1QK0A 2HVOA 6ALDA 4D2JA 4NI3A 1TPFA 2OYLA 4DBUA 5CPOA 1UWQA 1FP9A 4I9AA 2FJUB 5HULA 2R1MA 4TU1A 1L6SA 1MXDA 1I75A 3I3DA 2E5DA 4O28A 5KZDA 3WH8A 5LNUA 3LHYA 3U0HA 2D73A 2J88A 5ECVA 4PMXA 4LC6A 3RLVA 2A4AA 2H8XA 2HMCA 3WLTA 1UD2A 2PDLA 4BI6A 2P0IA 2YDSA 3BDKA 2QNEA 3Q37A 3CH9A 4NVTA 4O1AA 3SUSA 3CMGA 4MY1A 2CXGA 3G1AA 3POHA 3SCRA 4ZODA 1W37A 2QDHA 4YYFA 3I6EA 3UPWA 4UIOA 1Q45A 4Q4RA 1CT5A 4D6HA 3W1XA 5EMUA 4HU4A 4JTQA 4L56A 3VILA 4HVXA 1C3FA 4PGLA 4DO5A 1V3MA 1MW3A 3WF3A 3PBMA 1GYNA 3W25A 2Y70A 2G3IA 2RJGA 1JCYA 3NO3A 3V36A 1YRRA 1EKOA 2Y8VA 1G5AA 2CITA 5K3VA 3WBWA 1X1ZA 2NWRA 2RDXA 4LX4A 2NSOA 1JYWA 4F4RA 1JDEA 4AF0B 3A4XA 3MVIA 3L65A 3W53A 4H8VA 4PRWA 4BR1A 3SCUA 1Q6GA 3W2LA 2F6XA 3RK8A 1K7FA 3V0TA 1TE1A 4LOCA 2BXVA 2OMAA 2QJIA 3EB2A 4L80A 4DEFA 4MMWA 4LRSA 5F1UA 4RXGA 1I1XA 1DXFA 2P0OA 2GDVA 2JEQA 3ONBA 5U7SA 4WVXA 1UUMA 1JCTA 5HMEA 4IQLA 1TX2A 2VCBA 1KA9F 2W63A 1PWLA 1QT1A 1SZNA 4O1FA 4AWSA 1PBGA 1KM2A 4IQEA 3VIGA 1ZBCA 3O05A 3CNYA 4US5A 4M56A 1C9DA 2PSNA 3E0FA 1KGWA 2DZUA 4L61A 1S5VA 3ECQA 1PV8A 3I4KA 4PB4A 3SQMA 1DHKA 1W5QA 1QMLA 1YPIA 5CSYA 3GKFA 2ZYFA 4AUBA 4E2DA 4JR5A 3B0YA 1WKDA 3QEZA 1OFOA 4O0ZA 1RK6A 3W7NA 2GWNA 3KP0A 3TNOA 4C90A 4HOWA 2Y1HA 3IJIA 3OO2A 4MWAA 2J75A 5M5DA 2QCMA 2ZRYA 3ELFA 1AQHA 3W83A 4AZ5A 3MW7A 2X09A 1Y5WA 1EJWC 4DWSC 1OABA 2ZDSA 4V1XA 1CIUA 3W2NA 1Z42A 1AH3A 3QGAC 3TC7A 3F5JA 3W7HA 4AB4A 1CGVA 4AMAA 1OC6A 2V2DA 1K8XA 2J27A 1CW2A 3SJNA 1DJQA 3RCNA 3GG1A 3QW4B 3VTRA 2WJEA 1DJNA 1ZBWA 2XM1A 4GRSA 5D9OA 2PDIA 4GC4A 4NASA 1DEDA 1W1TA 5DQPA 3F4WA 3D46A 1QBAA 4UFHA 2ZWZA 2RH9A 3T0BA 4PCTA 3PANA 5LA1A 1H11A 3OU8A 1OZMA 3LHWA 3QJAA 2PLCA 3V5OA 2I5QA 5CPMA 6PTDA 1V6XA 5FEZA 2WNNA 4PH6A 3UNTA 3FA4A 1RBLA 1OGGA 3NQDA 1M7OA 4XIMA 2C1GA 3P3BA 4CU7A 4PRTA 3HG2A 3PPFA 5XIMA 4JY8A 1SM9A 3WLRA 3MJMA 1E5NA 4BY3A 3HF3A 3N73A 2EPOA 4FOUA 3BMWA 1VBJA 3EOUA 1F76A 2J8GA 2DIEA 1W9VA 3A6OA 3B3DA 5AYZA 3QFWA 1TV2A 4KWOA 4AVOA 2PP0A 2CZFA 4K7YA 2BSLA 2PBGA 5HAOA 1HL8A 3ARTA 5I3GA 3QY6A 3EOEA 3A12A 2NQLA 5GJMA 2IPFA 1L8NA 2YDAA 3KBJA 2PI6A 3UBPC 5EA9A 1QBBA 1RCXB 5CZ0A 3PZUA 1C8XA 3OYXA 1ISXA 3UWWA 3EPMA 2FHFA 3A5FA 4DPQA 1DJZA 1POJA 1GQKA 3WK2A 1E4IA 3GLCA 3L21A 2OX4A 4DJFA 1RXOB 4ALDA 2C14A 3BH4A 2P50A 3IEBA 1VRDA 3DFNA 2PD9A 1YX1A 2QJJA 7TIMA 3H4GA 5HA7A 2YZRA 3GDKA 4A8NA 4C5YA 4DM2A 1YPXA 5JH2A 1E1CA 3GFZA 1QI0A 2YBTA 1Q6EA 2Y61A 3CLWA 1KR0A 4GVFA 2D20A 2QF7A 4DXXA 3CB3A 3IAPA 3B8VA 1THFD 5HWJA 2DZWA 4TVDA 3UWVA 1FRBA 2Z26A 3HTWA 3BSGA 3PHAA 8XIMA 4ZCWA 3IACA 1AJ2A 1QU4A 5GNXA 2Q8LA 2FFCA 2QHAA 3WF2A 4AY7A 3L0NA 3TROA 2YSWA 4AD0A 2BDQA 1UZ1A 5T9CE 4Q4KA 4N4QA 1IZKA 3ALFA 4U2YA 2VWSA 1XICA 3KS6A 2CLPA 3AMDA 3ITCA 7ENLA 4WD0A 5LXEA 3SURA 4O15A 5GPRA 1DORA 1S46A 4RR4A 3K1GA 4HQVA 4Z2GA 1DXEA 1H1NA 3TJLA 1A4LA 5EL1A 4O8AA 3RYSA 2KAUC 3UJ2A 3B06A 2XUCA 5IM51 3U2OA 4LVBA 4PUEA 2OZ3A 1HTIA 1FWCC 3HGSA 2YL6A 3FX4A 3ERPA 1WA3A 1FWRA 1RD5A 2Z7GA 4CNNA 1L6FA 2PDPA 4HKPA 2Y0FA 4H4IA 4CQDA 1Q6CA 1SMDA 3VA8A 4UMBA 2PDNA 1XLCA 2G3JA 3WNNA 4MWAC 3IIXA 1PZ2A 3C52A 3MMWA 4YWIA 1WBHA 4PMDA 2BBFA 2JF7A 2PWUA 4FNUA 5FJJA 2FB2A 3S1WA 4MGGA 3WQPA 1PKMA 3AXMA 1KXTA 3PNUA 3LNMA 4J2MA 4CU8A 2VGGA 1M9HA 3HQPA 4H01A 2WJZA 4JTEA 1O60A 3GE7A 2I57A 2EPMX 4OBTA 2D22A 1N7KA 3W73A 1OD0A 2YBUA 3OZPA 4QNWA 1JG9A 2ZFAA 5FL1A 3CC1A 3CT7A 4FNPA 2OEJA 3TLQA 4BI7A 2DJXA 3DHFA 1RD6A 1C9WA 3IGHX 4K1WA 2WHMA 1M1BA 3KZSA 3OVGA 4FLRA 4HT3A 3VNKA 3IIOA 1TA3A 2HS8A 1E0TA 4IX0A 4JX5A 4I7UA 3CB8A 2WMJA 2CZVA 1TPB1 3O06A 2XG9A 3EX1A 4HTBA 2VMFA 3W7KA 1I0BA 2CIPA 1NEYA 4GPNA 3N2BA 4LS0A 2GSEA 5EBAA 5CAKA 4H3DA 5C54A 1QNRA 4D72A 3S1UA 2HXTA 2Y5SA 4GH1A 4AZ7A 3PM6A 1F3TA 5A6MA 4D8AA 2PDFA 5ABHA 1X6LA 1JPDX 3LPFA 3ZJ6A 3NGJA 3PB0A 1X97A 3GXFA 1MDRA 4DX3A 3AYRA 3KOFA 3WUBA 2NLIA 4Q8VA 3UG3A 3W81A 1RUSA 3CK5A 3GAKA 4H9MA 1CBGA 2A79A 1V7YA 3UNDA 2VD8A 1JEZA 1J2WA 3PJTA 1KFBA 3BOXA 4GZEA 1GYMA 2Z00A 3DC0A 3K30A 1ITUA 4C7FA 3PN8A 3QBUA 3TV8A 1Q7QA 3P14A 2NV1A 5DCEA 2ZQ0A 1ME9A 4N7QA 1P5BA 4FXSA 4UR7A 1LL7A 4R9OA 4MKSA 2Z1VA 1OK4A 1L9WA 1ZAIA 5JVLA 1EC9A 4JIRA 4H2HA 3UCCA 1KTCA 3VIJA 4IXXA 1K1DA 5F2MA 2CETA 3KFTA 4JTKA 4P7OA 2QW5A 4HZMA 5AHFA 5DMNA 2VZOA 3JRKA 3Q58A 5D4YA 3VGHA 4JQ3A 1CXIA 4O17A 3TP4A 3PAOA 2JE8A 3AJXA 2H8ZA 4IMEA 4XD6A 3MKKA 4NZ5A 4F3HA 4NYYA 2WV8A 3T7VA 1G67A 4HMDA 4A3QA 4MAVA 3B0PA 1ZS2A 4L9ZA 4QJ4B 4ACZB 4BQ2A 1QI4A 2C19A 3MANA 2PB1A 4A6GA 2VDIA 1YXDA 4HHPA 3ARRA 1GVEA 1XLEA 3VI2A 3LGEA 2YIHA 1R6WA 2AQVA 2F6UA 3QQ0A 3Q45A 1ZL1A 2E6AA 2V63A 2W62A 3HA1A 1DXIA 4AQLA 3UW6A 1AL8A 1D8WA 1XBXA 3TTQA 3M64A 4S3AA 4INFA 1QNOA 2Y8KA 3SECA 3GQYA 3KRSA 2EAWA 2VC5A 4ZEPA 3E2RA 4M81A 1SQ7A 4PULA 3LCFA 4UNKA 1P6WA 3S9ZA 2ICSA 4ASTA 1W8GA 4QISA 2EG7A 2E8ZA 2EPKX 1M6JA 4KBXA 1XPYA 3AYTA 3GWQA 3RILA 3G1VA 1CB2A 3EA2A 2V82A 3ARQA 4KEUA 1C7TA 3CZEA 3H2MA 4GUJA 4K8GA 5GJNA 3GVGA 1V5XA 4U3CA 5E93A 5DO8A 4M1RA 2FQIA 1KBJA 3VFLA 2DT1A 2INEA 1F7BA 1DVJA 3QR1A 4O0KA 1W31A 3SY1A 4DI9A 3NQ7A 1MEIA 4R85A 4ZB2A 4QAIA 1O5RA 2PZNA 4NZCA 1FXPA 3QHNA 2H6RA 3VNJA 1LWJA 4Q6JA 3M0LA 1V6WA 4HNOA 1T99A 2E77A 3V18A 3TEVA 3L0GA 2C7FA 1H51A 4C6CA 5LHFA 1S5TA 2A21A 3TN5A 2A1YA 1GKPA 4RDVA 1VCGA 4OVXA 3T07A 4AD3A 1TZ9A 2EG6A 2F2KA 2PCQA 1LRNA 4LAZA 2NXIA 3SCTA 1K3UA 3FAXA 1G7VA 4J2PA 1PB0A 3STFA 1PCKA 4Z2KA 1G4EA 4IIGA 1DIEA 2G4FA 3WQ5A 3UZJA 2D2GA 4O4VA 2Y7DA 3CHEA 4HU8A 4Q7BA 3WLPA 4FF5A 4YTQA 1A3XA 2HVNA 3RM4A 5D8WA 1WPCA 1GVIA 3C0SA 2Z2AA 3N3TA 4OUIA 3NDZA 3VYLA 2BHZA 3F5KA 1UR1A 3A23A 1E0VA 4JTFA 4HOZA 2V5DA 1UD4A 1A0DA 5A8QA 2E67A 3IIPA 4PTDA 3WFLA 3UF9A 2NUWA 3W7RA 2X0SA 3GXDA 1L6WA 4K8EA 2I14A 3B9AA 2E9BA 2J25A 1WCGA 2JEPA 2ZX8A 3M0YA 4JICA 3S1GA 4WY0B 5HBFA 4LANA 1W5MA 2KZHA 5DT5A 2BXYA 4PTMA 2C0HA 3PZ9A 4QNEA 2Y85A 4PBEA 6TIMA 2GQ8A 1AH0A 2EJAA 1VRXA 3EXSA 3F4CA 4IP7A 4MUPA 4WGHA 3WH6A 5TAOA 3D5HA 3CBWA 1R47A 3CMFA 3BW2A 1V02A 4HNNA 4KT2A 3S5NA 3BZGA 4MTVA 4QJ3B 4CEUC 1EEPA 1WDPA 5BXSA 1G6CA 1KC7A 3PC0A 4O1EA 4YJ5A 3WYZA 3CHCA 1E51A 3VIPA 4LUTA 2J74A 1E4LA 1EQPA 3GD6A 3TN6A 1TVLA 4KIEA 5BRPA 5DF0A 3A21A 2ZXQA 1E73M 3S2NA 3QRHA 3MTWA 3LRKA 3N34A 4XTDA 4IF2A 5IBXA 1I2PA 2OELA 3M0HA 4MUZA 5FOOA 1TFVA 3VOFA 5GNYA 3O63A 1HJQA 1WOBA 3O16A 1XLJA 3OGRA 3GVVA 3DG6A 3WMBA 4J3ZA 3JU2A 3EX6A 3L4WA 5I3JA 3QOKA 1FWFC 3T40A 3BAIA 3T8QA 1RZMA 3IJ6A 2E25A 3LMYA 2ISDA 3SY8A 1LL4A 5H6HA 1SFTA 1EDGA 1XHGA 2NX9A 1A4MA 2FZ9A 2DZAA 4UXDA 4J40A 2V2CA 3GFYA 3WH5A 4C65A 4LEQA 1EO7A 2IW0A 4PMOA 2HNEA 1K9FA 2FMOA 4HZ7A 4W85A 4P7RA 2NLYA 2WPGA 3WL0A 3FFSA 3QH2A 3W70A 3LTSA 4JKKA 3FK4A 4GA8A 5A1AA 2B7PA 4PCPA 1NTHA 4MJ2A 3SI9A 4DZIA 2YR1A 1B2YA 2DZPA 1JCXA 1AA1B 3R25A 4XZWA 3TYZA 1PUDA 2IXUA 2D2OA 2NUYA 5C0QA 1VHNA 1NDYA 2V30A 1B3ZA 4YCOA 3KVMA 3VIMA 3MMTA 1GYLA 1RQHA 2WJDA 1E15A 1OK6A 2PU1A 4D6GA 3IV8A 5IOBA 1BVNP 1NARA 2FHBA 1A0EA 1TR1A 3GDMA 3FY1A 4GG9A 3WJZA 1N8FA 1R2RA 3P84A 3H53A 1HJVA 2C8NA 3TW7A 1RCQA 1EIXA 1EA9C 1FCUA 2J9YA 4HNUA 3QFEA 3W01A 4A2RA 4AZCB 1HJSA 1BWKA 4DYJA 3LK6A 3KOZA 3BQ6A 4O52A 4PBGA 3CYJA 1FWJC 3VCNA 2YCIX 2E28A 1JDAA 4LBSA 3PZVA 3B0XA 5D32A 1O7AA 1MI3A 4AD1A 1DJYA 3C56A 4LCRA 5HJLA 4EP8C 1CWYA 3VXGA 2QLYA 4GXWA 4OJYA 3ATYA 3NVDA 3FJ6A 3NURA 4AHQA 5I3HA 3VGFA 3UVAA 5E6YA 1A5CA 4IGHA 3O9NA 3LBCA 3N9RA 2ATSA 4O1BA 3WELA 4M82A 1LP6A 2ZUNA 3MP4A 3WLLA 3PAJA 2V8ZA 1C91A 4DWSD 2WMGA 4UFLA 4ICMA 1B3XA 2DY3A 4GACA 2QAFA 3O2LA 4M6PA 4KWSA 1UPMB 2PMQA 1V51A 1S2CA 2BY1A 2PDKA 3T6CA 2REQA 2PWGA 1PZ1A 4F0SA 1KW1A 4GYKA 3VUPA 3OBAA 4FXJA 4LC8A 3CXOA 1HKMA 4CQ8A 3TJIA 1WKFA 4LBUA 5AHEA 4QX4A 2V38A 2TPSA 1YDYA 5LSMA 4C7DA 5IRPA 2ZZ5A 2R6OA 4WDTA 3CU2A 3AXHA 4HNLA 1LRQA 1QK2A 3IVUA 1B4EA 1SYTA 3CWNA 4ZBCA 3H2FA 4HB7A 1JAEA 2J47A 1FFRA 3V5FA 4QLJA 6REQB 3F2DA 2V3EA 4TVCA 1SSDA 5I00A 4LUYA 2GYIA 2GQ3A 3NEHA 4O1CA 3BAKA 2A3EA 1VFLA 4FZIA 2OB3A 2DT2A 1WDRA 1DWFM 1MEHA 1ALDA 4PB5A 3UG4A 1QR7A 1VPYA 2JBMA 4WCJA 4AZBA 2BV9A 3S2JA 1J0HA 1JZ6A 1CGWA 3AMCA 4NI8A 3HMJG 4QSFA 5KITA 1OEPA 5C9UA 4JNMA 5HK4A 4NAFB 3N4FA 4Z0JA 1QXLA 1RA0A 3WUGA 4JOMA 4PFMA 4DWSB 1LOSA 2IS7A 5CPNA 4GYPA 1EOMA 4ERGA 3EWZA 5IBXC 4ZO6A 2J4GA 3BGGA 5DBUA 2VX7A 1YLVA 3RU8X 1TPVA 1OC7A 1TV8A 3IIVA 4GY0A 7REQA 4IQJA 1WP6A 2BY2A 4CNOA 1A49A 4Q4OA 3TW9A 4Q32A 3N18A 2PGFA 3PWIA 1VJIA 5HNUA 3VNDA 3MUY1 5EKYA 4I8DA 1KR1A 3UA4A 2O9RA 1DKWA 2X1RA 3LTPA 3QPEA 1US3A 3DBPA 4KGJA 4Q8TA 2OCZA 1H61A 3MBDA 4UFIA 3AU6A 3PY2A 4NP7A 2QPXA 4HA1A 4O13A 1TUXA 3T2PA 5BOEA 3TFXA 4PMRA 2X41A 4MB5A 2WBGA 5GNZA 3EB4A 1N82A 2QJNA 2QF8A 1JYXA 1DIDA 4O1DA 1WDSA 2VOMA 4HSHA 1U30A 3IS4A 4I9MA 4BS0A 2C3ZA 4JTUA 2YA1A 3ZT7A 1GOOA 4LAUA 3N4AA 2XN0A 2P8CA 2EQDA 4HCDA 4E6MA 3SW6A 3T0AA 3BG3A 2D69A 4OBSA 4JIHA 1IV8A 3HZ3A 4BF9A 2BXZA 3NFUA 5K4ZA 3E96A 3TCEA 1OFQA 3WY1A 3QLLA 4BF7A 4H7VA 4F2UA 1LWIA 1OBAA 1EXBA 3CQHA 4US5D 1ZJHA 1S2WA 2OPJA 1VENA 3QYSA 4JTJA 4J9JA 2W92A 1SW7A 3UXIA 4XISA 1UD5A 1B9ZA 1ZFJA 3R8RA 1ONRA 3UESA 1IXNA 2R14A 3GRIA 1SGJA 3L2IA 4MAZA 2WVSA 4E38A 5CXPA 4CD4A 4CN1A 3D3FA 2A3AA 1TTJA 3VMPA 2QMJA 5FCZA 2J6VA 3D3AA 1GZJA 2ZADA 3PTMA 5HQEA 4QG9A 5FJTA 3DC8A 3BK0A 4IJRA 3R94A 1H49A 2D2JA 2WCAA 1R30A 5HINA 4QE5A 4DHGA 1T8QA 3G6MA 3HG5A 3H7RA 5D9MA 2XZ7A 1LQ0A 3BAJA 4IIBA 2NVAA 4QXIA 4MJ4A 3DU0A 1BF2A 1O12A 3I68A 1J96A 2FTPA 1VEMA 1HX0A 3G8RA 3R8HA 3PBVA 4IPNB 1L6YA 3P81A 3BOLA 4IFKA 3NO1A 3V3WA 5FIPA 2TAAA 3NPXA 4LF1A 3SFWA 3A3HA 3EX2A 2VR2A 2VR5A 2FHCA 4DJDD 5AY7A 4H9VA 3SFKA 4TTUA 1XR2A 3ARWA 1UC4A 4NNAA 1V6YA 4JFVA 1OVDA 2XFWA 3STGA 2Y7EA 4HSNA 2BNJA 3N04A 1E0WA 3FJLA 4LXFA 1EA0A 4JTRA 2PDMA 3ARUA 3TQVA 1IT8A 5TBOA 3PBGA 1CPUA 5C2CA 4W89A 4YYCA 2VZSA 1WYIA 1SSGA 2NXHA 3IIZA 3GM8A 3OLIA 3LUTA