4O8RA

Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
220
structure length
220
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 85
structure length 220
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4o8rA00
1NSJA 2OMAA 2VFHA 1LRNA 4LVGA 3CTLA 2QUUA 4GBUA 1S5WA 1EP1A 4OV4A 4NZFA 3VFLA 1YTKA 3AJXA 2ZA3A 3PBWA 3I65A 4D2JA 3A5FA 3NEVA 3LHYA 4LY8A 2E6YA 3G1HA 3LM7A 1JRBA 3TC7A 2OZ0A 5C6MA 2NV2A 4IMDA 4UNKA 5AHIA 1GZGA 3ZS4A 4BF9A 3ABQA 3GR7A 4OGZA 5D2VA 2ZZ3A 5AYYA 4ZVJA 1GVRA 3S5YA 1TTJA 3QFEA 2PE4A 3NAVA 3S0CA 2GVJA 3TJXA 1W31A 4N4QA 4UFLA 3Q58A 1JVNA 2VFEA 1KTNA 1SO3A 2X16A 4PC8A 1BWKA 4HN4A 3PWAA 4AHPA 5ABTA 3UXAA 3T7VA 2FTPA 3W1RA 1RQEA 2VELA 2GVGA 3RMJA 3CIWA 5F1VA 4P61A 4LOCA 2V5LA 1AMKA 2FPVA 4I7VA 3A24A 3TX9A 3S6DA 3WFAA 5BW6A 5E93A 2JBMA 1JCYA 1WOBA 3W2NA 3PSWA 4O11A 3GK0A 2WNZA 3SFKA 1FCBA 3DFOA 2CZ5A 3HG4A 5HWMA 2HSAA 4K37A 3JS3A 4KFNA 1QPNA 4O17A 4Q33A 2ISWA 3TFCA 3W7EA 3EX4A 3G0XA 1V5XA 1TQXA 3H55A 1W37A 4CQ8A 1VH7A 4NNCA 4OT7A 2ATSA 3HPSA 3W7KA 3UZ5A 4IMEA 3B05A 2P0OA 1H7NA 3INPA 2BLEA 4IX0A 3GYEA 4TMCA 4UTUA 3L66A 3LCGA 3F1QA 4PCFA 3F4WA 4N2YA 1PIIA 4GJ1A 5I3GA 3I6RA 3GZ3A 3LRMA 1A53A 4IQLA 3C2OA 3H53A 4JTIA 3N3MA 3MYOA 4A21A 4Z1AA 2AQWA 3PG9A 4LRTA 2RKXA 1TPEA 1JCMP 1Z48A 3TA6A 2FB3A 3EKLA 1AL8A 5CZTA 2RDTA 4DF1A 3PG8A 3P8JA 3DENA 2R14A 2J27A 3GDTA 3UPBA 3R5EA 3R12A 3P82A 3C52A 4JS3A 4OE7A 3QEZA 4JY8A 3NQ6A 5F4XA 3TDFA 5AHMA 2C3ZA 3QSRA 1OF6A 2A4AA 3W7GA 3E9AA 3ABRA 2H90A 4FO4A 3ZWSA 4N6EA 2H8XA 3VE9A 3EEGA 3MHUA 3M16A 3BVJA 5DY2A 1A5SA 2Z1BA 5AC8A 4UR7A 3B4UA 1W56A 3W75A 1XDMA 4O1DA 1T99A 3NL2A 1G4TA 1KTBA 3PB2A 1T96A 1MXSA 3LX9A 1J2WA 5G2HA 3MHGA 1EX5A 1TRIA 4I7UA 3NPUA 4ADSA 1N55A 3SZ8A 3C61A 4MYXA 4ORMA 4LRSA 1EIXA 3G24A 3B06A 2EF9A 4EF8A 5G2IA 1YXCA 1BTMA 4XTDA 4FHAA 2O7SA 4O4WA 4A3UA 1H1ZA 2ZZ2A 4FNPA 2V30A 4NXSA 5G1YA 3TROA 1JULA 2Q3OA 3SJ3A 1GYLA 3NL6A 5D02A 1I8JA 1I2PA 2Z2UA 4JTEA 3R89A 4BR1A 1IXNA 3PBYA 4ZZ9A 3CT7A 4DQWA 4LVDA 5HJLA 3HIJA 3W9ZA 1XBYA 1PE1A 4JGDA 1QPOA 4DPQA 3RFAA 3SIZA 4BWLC 5LNUA 1GT8A 4MOZA 1HO1A 1HO4A 4GFSA 1GVQA 1P0NA 4MLJA 5HUPA 4JEQA 3W72A 1NF7A 4NQ1A 3TJLA 3QW3A 3DFSA 4TR9A 1QCWA 2JKPA 4NJHA 5E0KA 5T26A 3PY2A 2AAMA 4O4VA 3BARA 3NA8A 1B3OA 2Z6IA 3LDVA 1OFRA 1YPFA 1KBIA 4Y96A 5G4WA 2QCGA 2QJIA 4BFAA 2V81A 5G1TA 3PF3A 1OFQA 3T55A 1XBXA 1LCOA 2A1YA 4UMAA 1RR2A 3M9YA 2E77A 4FF7A 3NPVA 3QQ1A 3DGRA 3HG5A 3W7LA 5EYWA 3O6CA 2VFDA 3P62A 5EL1A 1NF0A 2D73A 2E5CA 3CU2A 5HWJA 3TC6A 4O1BA 1MEWA 3GX9A 4AWUA 2OJPA 4HPJA 1RZMA 4JDYA 4Z0SA 1EP3A 3SI9A 4QAIA 5G2WA 4OBTA 4E2BA 3GAKA 3EX1A 1KFCA 2HMCA 2R8WA 3QYQA 1KW1A 5FEWA 1L9WA 4QJ1A 3LCHA 1A5AA 1F76A 4UMCA 2B7OA 4XZ9A 4ZQCA 2JKAA 3T4CA 2FDSA 5KMYA 5CPOA 3T78A 4Z1BA 2NXIA 2ZRYA 3FJLA 2PRLA 1FBAA 4R34A 3LV5A 3B0UX 4AVFA 5DY3A 4LUJA 2CFFA 2V0TA 1YDNA 1AK5A 4UTHA 3TQ0A 3W85A 1QO2A 2EGZA 4MUZA 4MZ8A 2Y85A 2F84A 3W88A 1K7EA 1W5QA 2Y62A 2WSRA 3C2RA 4HNNA 1LROA 4LTSA 2WNQA 3FKRA 1TV7A 1WBJA 3G0SA 3PB0A 5L9FA 3T44A 4DO5A 2ZRWA 4O13A 3A23A 3STFA 3STEA 3FIGA 3DFQA 3OVRA 3RK8A 4AHQA 2QCMA 3L67A 3LCFA 1KM0A 2GQ8A 2C13A 3MBFA 3M5VA 3GKFA 2ZYFA 3IV3A 3KRZA 4N4PA 2JKEA 1W5MA 5U7SA 3UD6A 4CCEA 4N9CA 1H5YA 3H54A 4O0ZA 3GDMA 1JCXA 1Q6RA 1TPB1 3E0IA 1RQHA 4IMFA 3EWUA 2A6NA 1KM5A 4S2BA 4DO4A 1U83A 3QF0A 1EP2A 4LVAA 1F73A 2V2HA 3UY8A 5AC7A 2HTMA 2EAWA 2GQ9A 4AWTA 3STGA 3VKJA 3P81A 3G1VA 5K3VA 4Q32A 2QCFA 4JIQA 3IEBA 4ZQOA 3QM3A 1JRCA 1NFBA 3TFXA 3MI2A 2NWRA 3TE9A 5MHBA 3QRHA 4GUFA 4JXCA 4UFHA 1LBFA 3GXPA 1JJKA 4NT0A 3LERA 3LLDA 4GUJA 4AB4A 1W1ZA 5I3IA 3GXTA 4H3DA 3TSMA 1VCVA 3NZ1A 5F2LA 5HNRA 2UV8G 1K03A 2A7RA 2NX9A 3LXAA 1TREA 3NQVA 2DZXA 1FY6A 1S3HA 5BOOA 3EXTA 4NJGA 4CNNA 4FB7A 5GVJA 4M6QA 4HSNA 1TB3A 2ZTKA 3TXZA 5K2ZA 1LORA 5FEPA 1RVGA 3CEUA 3QZEA 1I45A 4BWLA 4N6FA 3UWUA 4ADUA 1O60A 2NXGA 4JTJA 2QCCA 1A50A 3KRSA 4E2DA 4TU1A 1QNVA 3KRUA 4O57A 3L5AA 4JYFA 2DU2A 4LWWA 2LLEA 5CG7A 4Y90A 1WDWA 1GG1A 2CW6A 2E6FA 4ZQNA 5LKYA 2V8ZA 4OWGA 1EWDA 2CLOA 3LCIA 4JTLA 1P4CA 3BPWA 1I2OA 3MI3A 2CLLA 4LUIA 4GUIA 2VFFA 1KLYA 3LCXA 5HUOA 3E12A 1WXJA 4H6KA 1FUYA 2Y70A 3O07A 1W54A 1F7BA 3BO9A 3WK1A 3W7MA 4O18A 3FYPA 2ZA2A 1HTIA 1K8ZA 3P5ZA 4UFMA 1ZCOA 1IIHA 3G1DA 1BEUA 2X1SA 5LGXA 3PBUA 5EMUA 5D2WA 1QWGA 4ZQMA 3A5VA 1DJQA 1EPXA 1SFLA 1ZAJA 3MUXA 5LNRA 3QMRA 3BG3A 2DP3A 5KITA 3MI6A 1P5BA 5CPMA 1OX5A 1Q45A 3STCA 1UBSA 3G3DA 3QW4B 1DQXA 3W1AA 5AYZA 3Q2DA 4LVBA 4W9TA 1D3GA 3W1NA 3S1VA 3UWVA 4IPIA 4Z1CA 4DXVA 2G95A 2NZLA 4WY0F 1X8FA 4GC4A 5DCEA 3BW2A 2A2IA 1GWJA 1KFEA 3W7DA 1QFEA 1G69A 2Q8ZA 4KKXA 2NX3A 3W86A 3EWYA 2ZBTA 5K7JA 4GUGA 1SW0A 4P2VA 1GPWA 2QKFA 1ME8A 3O63A 2R94A 1OFDA 2DZVA 3TV8A 1ZALA 2CLFA 4Z08A 1VHCA 3LHZA 3CB8A 5G4EA 2EHHA 4XKYB 1X1OA 3O06A 4JR5A 1XBZA 5I3JA 1VCGA 3CIXA 2FPYA 2WNNA 3Q94A 3O1NA 2J9YA 5AOUA 3U8GA 3G1FA 1TV8A 2GUUA 5U4NA 3W1XA 3G18A 3V1PA 3PC0A 3L0GA 4JTKA 3C56A 4QNWA 1TYGA 1C8VA 3O05A 5K4ZA 3TSBA 3HG2A 4BI5A 2BWGA 1EUNA 2W79A 3E96A 1O95A 2W0UA 3QPYA 1KFKA 2OT0A 1KFLA 1THFD 2DZUA 1W5PA 2GJLA 3N14A 1ZNNA 1D3HA 1QPRA 2J6XA 4M6PA 4HNUA 3LI0A 8TIMA 1XDLA 1R2RA 2FB2A 4O10A 4A22A 3NGJA 3WK2A 1RPXA 3OIXA 4NJKA 3TW7A 1P0KA 3W83A 3ABOA 3W1MA 2E5DA 3W7JA 1CW2A 3DI0A 4HT3A 3GXNA 4U4MA 1LOLA 1O94A 3DFPA 5G5IA 2YXGA 2C14A 5A5WA 1FCVA 3NG3A 3S5NA 4IJBA 4PL1A 4DELA 1XL9A 4IUOA 2E1DA 3TCEA 4DF0A 3TQVA 1G7UA 4MIMA 4RXGA 1GVFA 1JQXA 4JNMA 2VEMA 1I2RA 3NOEA 3G8RA 4K8HA 1DORA 2X1TA 2J24A 4IMGA 4Y9AA 1GG0A 2GVLA 4NU7A 4JX6A 4MFDA 1R2SA 5D2TA 4CQ9A 1QOPA 2A0NA 2A21A 4I7WA 3BW4A 4EVZA 5HINA 3EB2A 1YTEA 2QCLA 3PUOA 1JUBA 1OYBA 3DZ1A 3OVQA 5F4SA 4NJJA 5F2GA 4RCXA 3IIXA 1QMLA 3L65A 2ABBA 3SY5A 4ADTA 1GOXA 2J9ZA 4O1AA 1Z41A 4NX5A 1N7KA 3ZR4A 4XKYA 1G4SA 3KX6A 1AG1O 3LRLA 4LS1A 2WKJA 3CC1A 1H7OA 5CPLA 5D32A 1QPQA 1SUXA 3TIMA 3O15A 3NQAA 4O0KA 1D9EA 3NM3A 1B57A 1YTDA 1L6WA 1ICQA 1SQ7A 4LVFA 3MBDA 2ZA1A 2WV8A 2GPTA 4LV4A 3WJSA 2WQPA 4YCPA 2QDHA 4UNLA 1PCKA 4NVTA 3W1QA 3S5OA 3PULA 3DU0A 3PUEA 4QITA 4O50A 3B0PA 2VEPA 1PL9A 1X1ZA 1MO0A 2ZRUA 1H63A 2CZFA 3KAOA 1VGAA 3FA5A 1YLVA 5IBXA 4QSHA 3HBLA 4OQVA 4O16A 1MEIA 4UTWA 3GNNA 3BGJA 5C5YA 1DJNA 1IXPA 2DZPA 3W22A 5CZSA 3S9YA 4MY9A 1FDYA 3UY7A 3IVSA 2ISSA 3ATYA 3D0CA 5E1QA 4WZHA 4JIPA 2QAPA 1B4EA 2H3DA 3UZJA 3QMTA 4UFJA 1JCJA 4KFPA 3TNOA 3THAA 1GQNA 5FESA 1KBJA 3NQ2A 4KWWA 1FXPA 3W07A 1H62A 4NUWA 1AW2A 4M5PA 4X22A 2EKCA 3O16A 2G96A 3PVFA 3HQ1A 2NXHA 3T40A 1KFJA 4CNOA 4O1CA 4N9EA 1VLIA 3W23A 1U5JA 1LBMA 1LTDA 1EB3A 4WXYA 4UTTA 3W2UA 4FXRA 1OYAA 4FIQA 1K8XA 2RFGA 3P74A 2Y89A 5EBUA 5AFDA 1OYCA 1MSSA 3NQDA 4FNQA 5BNKA 2OX1A 3DHFA 1G4EA 4HPXA 3U6WA 1PS9A 5FF4A 3P5YA 5AYXA 3S1XA 4TX9A 3HPZA 1L6SA 1W3IA 4L4LA 3W74A 4JTFA 2A7PA 4LU0A 4H4IA 4WY0B 3MP5A 3UPWA 2VEIA 3DXIA 2VEKA 3W7OA 2P10A 1LYXA 1FWNA 5EY5A 3LOTA 1KV5A 1XC4A 2WO5A 4IGHA 1OX6A 2B0MA 2YDAA 3P84A 3GR8A 4YXGA 2ABAA 1LRTA 3DH7A 1KA9F 2GJNA 3YPIA 4MY8A 4FEZA 1YPIA 4MZYA 4JY9A 5DCDA 4YCOA 2YW4A 3HGSA 3G22A 3CHVA 1XM3A 4UTJA 4AXKA 4DBDA 1HL2A 1F5ZA 3WJYA 1G6CA 4UMBA 1A5CA 3NYZA 1GTHA 1UCWA 4HIBA 4AH7A 1W3NA 5D38A 3P8IA 3DAQA 4FNTA 3DFNA 2FQIA 1TMHA 3W3OA 1K8YA 3L9CA 5D37A 4WJEA 2ZZ6A 1IGSA 1JQVA 3B03A 4RZ5A 1SW3A 3MYPA 4UFKA 1QDSA 5DBUA 1ME7A 2RDUA 2QCNA 5HMSA 3UXDA 4FNUA 1HUVA 4ALDA 5EA9A 1LLWA 4WXZA 1TJPA 5K4XA 3LBCA 3PAJA 2DZTA 3LRKA 4RR4A 2A85A 3GAYA 3USBA 1EEPA 3FFSA 3EWBX 2A6LA 1ME9A 4K7VA 4MLRA 3I7RA 4OHQA 2JGYA 3LHVA 3P67A 3HG3A 1OX4B 3N2XA 1TPH1 3F03K 3TQKA 2Y88A 3NM1A 5KINA 5D2XA 3W84A 2BX7A 3L0KA 5FF3A 4ZQRA 5I3FA 3IIPA 3DKJA 4XBKA 1RQBA 3M7WA 3W87A 1PCWA 4FX6M 3ATZA 3A9IA 3M41A 2CZEA 3C2EA 1DVJA 4A29A 5D30A 1EUAA 2ZDRA 1LM1A 2WJZA 3VI2A 1QOQA 5LHEA 1X6UA 2E09A 3W1PA 1SFJA 1S5VA 1TTIA 4JTHA 2B7QA 4TO8A 5J5DA 4WY0A 1OVDA 1L6YA 4K7YA 2V2CA 3UWQA 3P61A 4A2SA 4MYAA 1TSIA 1O5KA 1G67A 1I2QA 2E68A 2ALDA 1H50A 1I4NA 1WOAA 3IIVA 4GRSA 3IRDA 3VE7A 3W73A 2TSYA 3ZFHA 1XFBA 3EWZA 3FEMA 3W70A 2VXNA 5CGQA 2NUYA 2ZCGA 1F05A 3S42A 1FQ0A 3HO8A 3KVKA 3CQ0A 4JYDA 3M5YA 1TV5A 1LOQA 4EWND 4X9SA 4XUGA 1JR1A 2Q3RA 2C6QA 2B7PA 3FYOA 3QC3A 1Q3NA 2KZHA 5F2IA 4CLMA 4NJIA 1HFBA 3MJYA 3F4NA 1W5OA 3E49A 1VLWA 4UTIA 3KHJA 5K9CA 2AGKA 2NV1A 1LOSA 3TAKA 3G1XA 1OK6A 3IGSA 5K9XA 2QJGA 5BRBA 3L0NA 5LGZA 3A22A 3GLCA 4BK9A 3IGXA 3G3MA 1ZENA 4GUHA 4AMAA 2YW3A 1K02A 4NNBA 2OCZA 2PRHA 2QCDB 4HNVA 4IOTA 1ALDA 2OT1A 4G1KA 1F6KA 2ZRVA 3L68A 2A7NA 1OX4A 2YFOA 1V7YA 5KTLA 2ZQ0A 3FJ6A 2H3BA 3GVGA 1TTQA 1XUUA 1VYPX 1ZY9A 2TPSA 5BMWA 5TBOA 4J9JA 4CQAA 4E38A 1OFEA 5C2XA 2Y61A 2B4GA 4KFOA 3FS2A 2I1OA 3TKFA 1WQ5A 4RZ6A 1OK4A 3N73A 4UFIA 1DBTA 1KFBA 5BMXA 1WA3A 2C15A 5CSSA 2PCQA 3EKZA 3QSTA 3S1UA 1T0OA 4HNTA 1AL7A 3HMJG 3C3NA 4UTLA 2TRSA 3NQMA 4JTSA 4MZ1A 5IBXC 4R53A 3UWYA 3UQNA 1SO6A 2NLIA 1Z42A 1SU5A 1BWLA 2I9EA 2ZZ7A 1FWTA 1K3UA 3GDRA 4UTWC 2CU0A 4ONVA 5FI8A 2DJLA 3GDKA 1Q6QA 4QIUA 1VS1A 2Y7GA 3LHTA 2GQAA 1DL3A 3LGEA 5FEXA 4ZQPA 1XUZA 1JUKA 2CLKA 1X7FA 2HS8A 1DOSA 3TK7A 2RDWA 4GWEA 4LS0A 2CLMA 3PUDA 3GDLA 1VPXA 3TMLA 3G1SA 4JN6A 4MPQA 4U28A 4AF0B 1IIGA 1KM6A 3KFTA 1G4PA 2QUTA 3GNDA 2Y7DA 4WOQA 4YLWA 3B0VC 3G8EA 3OHIA 3W7RA 1W0MA 5SWUA 3BW3A 3HB9A 4PODA 2VOMA 3HPXA 4QISA 2Y63A 4UTTC 5D04C 1RD5A 1YDVA 4LW7A 1XKYA 5LZLA 3M44A 2G97A 3PR2A 4NZJA 3IIZA 4IX2A 4FNRA 5LHFA 4WQ6A 1JCLA 3TUUA 1DQWA 2PC4A 4RX0A 1VR6A 1H7XA 2HS6A 2QCDA 3NQ8A 3BK0A 2CZDA 3KVMA 1VZWA 1LZOA 2JGQA 5DBTA 1SO5A 3U2OA 3TXVA 1NAL1 1TQJA 1YXYA 4LC8A 3Q37A 2VKZG 4IXXA 5HR7A 3MHFA 2QJHA 1OJXA 5FF7A 2FJKA 3SGZA 2JK2A 4BI6A 2F7FA 1R2TA 5LNWA 1F6PA 2TYSA 5DELA 3W7NA 4PL2A 1DHPA 5FF2A 2QAFA 3LXCA 3CEPA 1C29A 4DPPA 3N19B 1ZFJA 5H91A 5CPNA 1H7PA 3OG3A 1T8XA 3CWOX 1LP6A 4DEFA 4FXSA 3ANYA 4RJEA 2E6AA 4Q4KA 3GB6A 4IXHA 4MJMA 1B9BA 4JTTA 2VENA 4JTGA 1GJPA 1XBVA 1XXXA 3W2JA 5LNVA 2ZZ5A 3CWNA 3N9SA 4O12A 1PV8A 1MZHA 1FDZA 1TPFA 3GKAA 4FX7A 3C8FA 3C4UA 3SSJA 3PM6A 3NL3A 3O6YX 1TTPA 2X2GA 3SECA 1I2NA 2BZNA 2VC6A 1UUMA 5C55A 2IQTA 4S1FA 3SW6A 4AF0A 1VCFA 2ZZ1A 1AW1A 3CLMA 4QM1A 1WBHA 3RNDA 3TMQA 3W7CA 3FOKA 2P1FA 5H2ZA 1UUOA 4RLIA 3UWWA 4YMZA 4OU1A 3DKLA 4K8EA 2V9DA 4K39A 4PFMA 1TO3A 3KVJA 5AC6A 4N9BA 2WSQA 2VFGA 4M19A 3N2MA 5F1UA 1VYSX 1YYAA 1SZGA 1SSDA 1TPVA 3WK0A 4KWVA 3W1LA 2NX1A 4ICNA 4B5NA 2YSWA 2J88A 2CWNA 3B8DA 1MEHA 3DBPA 4O28A 4PEKA 1SPQA 3WJWA 4GXMA 3W1TA 4RXFA 2YCEA 1EWEA 3LLFA 5DN1A 5J5RA 2H6RA 1SZFA 2B7NA 1M6JA 4WOZA 4AAJA 3LV6A 3TU9A 2O7QA 2A5HA 4M7SA 4O15A 2C16A 3RLVA 4XWUA 4YL2A 1ADOA 4LS2A 2V82A 3EXSA 2YX0A 3PBVA 3EX2A 3O8AA 1OF8A 4K36A 5KSWA 4ZL1A 1E51A 3LB0A 3MW7A 2BXVA 2EPHA 4Z0JA 1JUEA 1M7OA 3W1UA 3DI1A 3UNDA 1KM4A 2YGYA 3KOFA 3LCLA 1OFOA 5D05A 3MWAA 4AHOA 1OG0A 3VCRA 1LRQA 4YWIA 4POCA 5C54A 1RV8A 4MVAA 4TIMA 3HF3A 5FF0A 2FPTA 3SGUA 5KZMA 2X1RA 2Q8LA 4ML9A 3AO0A 1Q6LA 1GTEA 3BGGA 2RHGA 2ZRZA 1R47A 3MMTA 5HULA 3LTSA 2Z0IA 2YPIA 3CM4A 1KLZA 4RK8A 2DZSA 3TSDA 4NX0A 4WUIA 3A21A 3NQEA 4QQ3A 1OFPA 2Y7EA 1PHWA 1O5XA 3E02A 1H61A 3HJZA 3QH2A 1F74A 5DXYA 5EPDA 2BSLA 4Z1DA 4C1LA 2R91A 1P1XA 3LBMA 3I7SA 1TRDA 4WD0A 4JICA 4LV9A 2PURA 2I14A 4AEOA 5A8GA 3P60A 1W8SA 1KTCA 5D09A 1UASA 1YDOA 1IF2A 5L6UA 3LHWA 3OVPA 4Y8FA 5I3KA 4X2RA 2CLIA 2PRMA 2W6RA 2YZRA 3W2MA 3NL5A 3EXRA 3I7QA 4GE8A 1O4UA 5F4WA 5D33A 1FX6A 4A2RA 1BKSA 3L5LA 5LSMA 4UIOA 1PHQA 2Y7FA 3LHUA 4PH6A 3M5XA 3CPRA 4LT9A 4RV8A 4DO6A 1J5TA 4XQ6A 5K9DA 5AHNA 4M6VA 3ABSA 1KV8A 3FLUA 3JRKA 3LTYA 1VHNA 3LXBA 2E5BA 3L2IA 4DF2A 3M1ZA 1SO4A 2X1UA 3PSVA 4NXKA 2VFIA 3TH6A 3LTPA 1GVSA 2XN0A 4PA8A 3C2FA 1TPUA 2NUXA 1ONRA 4UTMA 1OABA 1TPDA 3BV4A 1FWRA 5EKYA 2Y6ZA 1F2JA 1R30A 4I9AA 1ZAIA 7TIMA 3QJAA 3N9RA 1KM2A 4HHPA 4QNEA 1Z44A 2DORA 2QUVA 4IMCA 2WSYA 5AHLA 5CZ0A 5CSRA 1NEYA 4IWWA 4ZMGA 4M7TA 4EF9A 2ZRXA 3M0ZA 4MJZA 1UJPA 1TJRA 3MO7A 1WX0A 3P80A 4K6AA 3UYCA 1LBLA 3LCWA 2TMDA 2GOUA 4O53A 2QDGA 1ICPA 1W3TA 3NXFA 3IGUA 1FWSA 2V5BA 3OBKA 1QAPA 4UUIA 1VJIA 4UC5A 1ZHAA 1G7VA 1H7WA 2XFWA 5KZDA 3NR0A 5AN7A 4C1KA 2H8ZA 3C2VA 3GIYA 2C0AA 5DCBA 1SR9A 3NO5A 2DJXA 3OA3A 1AW5A 3NVTA 5FEZA 4UTKA 2C18A 5AHFA 3SR7A 1KM3A 1NVMA 4HKPA 1L2UA 1XCFA 4XTIA 4LNYA 2V2DA 3MP4A 4ORIA 4TMBA 4RZ4A 5D03A 3S5ZA 5CKSA 3BG9A 4JDBA 3NPXA 4AWSA 1VQTA 4X3ZA 2QF7A 1YADA 1DKWA 4RKAA 5IM51 4MFEA 1QR7A 3M47A 4UXDA 3L5MA 2QEZA 1SSGA 4N9DA 2CLEA 4Y6GA 1FXQA 2FIQA 3QQ0A 4JD4A 1PVNA 1GYNA 4GNJA 3W76A 1OHLA 1WV2A 2Z6JA 3L21A 3EWXA 1H7RA 1ZAHA 4CNPA 1QO5A 3IVTA 2NUWA 4XBSA 3NQGA 2NWSA 5KZEA 5HR6A 2WPBA 2YYUA 4HSOA 3R2GA 1A5BA 4O54A 3UWZA 1SZEA 1IXQA 1ML1A 2QCHA 2X30A 3W6YA 1H60A 5LNSA 3HGRA 3NQ7A 4MKNA 3M5ZA 2E6DA 3BLFA 1M5WA 1TCDA 4JTUA 3S8HA 3WJXA 1FCUA 4PTNA 3NQFA 3ZWTA 3B04A 3P7YA 3W7QA 1YXDA 3C0JA 3W7IA 3JR2A 3K30A 4FIRA 3TR2A 3NQCA 3DFTA 3QMSA 4NNAA 1K7FA 1CI1A 2RH9A 4MY1A 4N02A 1Q6OA 3BLEA 5DLCA 3THQA 4WX2A 3HGJA 3QPZA 6ALDA 1H51A 3EX6A 4DBEA 1H1YA 2QR6A 3WK3A 2QCEA 1IXOA 1S5TA 1M7PA 1VYRA 3RLUA 3PS7A 2CLHA 4EIVA 4JYEA 4CCDA 3I68A 1B4KA 3RU6A 4OV9A 1LLZA 2YFNA 3W2LA 3G0UA 5F2MA 2ISVA 5TQLA 3KXQA 3HOJA 1XI3A 1OFAA 3W71A 1VC4A 1TIMA 3N34A 4CCCA 5DXXA 1OFBA 1FDJA 3RF9A 3TW6A 4EOUA 1W5NA 1SW7A 3EX3A 2XN1A 6TIMA 1TPWA 3HGOA 2BTMA 3KVLA 3DHDA 3W7PA 4LC6A 5HQEA 1FWWA 2G5WA 3OEXA 5I3HA 3W7HA 2ZTJA 3FKKA 3BLIA 2J9XA 2XN2A 3MP3A 3R13A 4JX4A 4O52A 4K38A 4UR8A 1K7XA 3M6YA 4E0CA 4O14A 1TPC1 1LDCA 1HG3A 4S2CA 1J4EA 2ZFAA 3NNTA 3O6DA 1ZJIA 1C9DA 5TIMA 3NZRA 3TAOA 2WOQA 3NPWA 4R33A 3NDOA 2ATMA 3W2KA 5CZJA 3G1YA 1KM1A 1EA0A 4FNSA 1UB3A 2FFCA 1FCQA 5D2YA 3C6CA 3BG5A 1Y0EA 1JCNA 4O8RA 1N8FA 5AB3A 4BI7A 4IPJA 3EWWA 3R8RA 5HWNA 1WYIA 1SZNA 3ELFA 1VRDA 3LI1A 1ICSA 4L4MA 2ZZ4A 1GEQA 2YYTA 3WJZA 3M43A 4UCGA 2FLIA 4R7JA 3IVUA 3IIOA 2C1HA 3V75A 2DZWA 3VNDA 4FX8A 2C19A 5AHEA 4O19A 1CX9A 1GVOA 2YR1A 1R46A 1WAUA 3G1AA 3S1WA 1DV7A 4JX5A
chains in the Genus database with same CATH superfamily
1NSJA 2OMAA 2WBKA 4LVGA 2O0TA 1S5WA 1EP1A 3I6TA 3VFLA 1YTKA 3EA3A 3GC4A 3MUY1 2QUMA 5JH2A 3PBWA 4V28A 4D2JA 3A5FA 3NEVA 1OBAA 1QVBA 4LY8A 5BOFA 4AC7C 3G1HA 3LM7A 4KIRA 3RLGA 4UNKA 5CAKA 4JCLA 3MSDA 1JXJA 5D2VA 2ZZ3A 3CAKA 2PDPA 1H1NA 1LT7A 3O7UA 4KIEA 3S5YA 3GTNA 3QFEA 4E4UA 3S0CA 1W31A 4IQEA 3SURA 4AY1A 4UFLA 3Q58A 4AFYA 2X16A 5M3WA 4PC8A 5CGMA 2QPXA 4DNHA 4AHPA 1UMLA 4Q8PA 3UZYA 2ZX5A 3EMCA 1RQEA 2VELA 1SJDA 5EMYA 4IZGA 2HPIA 5F1VA 2FPVA 3FDKA 4I7VA 4AZBA 5E09A 4DJED 1EFZA 3S6DA 3WFAA 1WOBA 4UOZA 4M24A 4O11A 3SUWA 4CVUA 1FCBA 4KESA 1IYXA 1KXTA 5CXPA 2CZ5A 2RJGA 4KFNA 1G9HA 3KTXA 3TFCA 3UPMA 4UNIA 1V5XA 3GTFA 1HJSA 1F61A 1JPMA 3H55A 1V77A 2CKRA 2PF0A 4XZLX 3VOCA 4CQ8A 5A6LA 2W91A 2QGYA 4OT7A 3QR3A 5GPRA 3W7KA 1W6TA 2E9BA 2FHFA 2JQXA 1AH4A 5HA7A 3B05A 3INPA 3BLLA 2BLEA 2GJXA 3F4WA 1H41A 3GZ3A 4IQLA 3UNTA 1T5AA 1Z7AA 2QJNA 4JTIA 3OQ8A 4JTAA 1XISA 3GU2A 3OPSA 2BV9A 1TPEA 1JCMP 1Z48A 1CBGA 2JF7A 3OBEA 3TA6A 1XSKA 5CZTA 3KDOA 2RDTA 5AZ1A 2VZOA 4IH3A 3PTDA 2J27A 3N12A 3UPBA 1V3MA 4U2ZA 4Q7IA 4Q8UA 4C90A 5DMNA 3QEZA 4JY8A 3N2BA 1VFUA 4AZ7A 1UJQA 1Q63A 3LQGA 3W7GA 3AU2A 1VBGA 5B80A 3EWCA 2H90A 3ZWSA 3SAZA 3BSMA 2J7HA 1Q8JA 3VIOA 5DY2A 1A5SA 2Z1BA 1JAKA 2Y8VA 3PJUA 2PMQA 4UR7A 1E9ZB 1XDMA 3TYZA 1T99A 2CHOA 4NIRA 3S47A 4UZSA 1T96A 2X7VA 2EG6A 5AVHA 1GYMA 4I7UA 4ADSA 2CKSA 1Q4NX 4AWEA 4K3ZA 1EIXA 3VYLA 5CCZA 3CV6A 4EF8A 1YXCA 3K5XA 1BTMA 3K2GA 4XTDA 2BGSA 4R9OA 1B1YA 2AQVA 2GVEA 5A1AA 3SUUA 4NXSA 2PAJA 1GW9A 1RAKA 3UJEA 1XD1A 5BOEA 3AHZA 4Z2LA 1I8JA 2WC4A 1YHTA 3R89A 2Y8UA 1R6WA 3VM5A 4DQWA 1ITCA 3SUTA 4ZE4A 5B7YA 3BLPX 4UR9A 4D6HA 3ZMRA 3UBPC 1XBYA 2PU1A 4BF5A 1QPOA 2Q02A 3U7BA 4DPQA 2YL9A 1GT8A 4MOZA 1IWPA 1XIGA 2YB4A 4GFSA 4JEQA 3W72A 3AU6A 3TJLA 2OVLA 1XCXA 4GHRA 3BJTA 3EMZA 3WLMA 2HRWA 3VNLA 4WSHA 4MWAA 2AAMA 3BARA 4H7ZA 3NA8A 4EPBC 2OGYA 4NAEA 3LDVA 4ML4A 1YPFA 2WK2A 5G4WA 5I07A 2QCGA 2E7FA 1W1YA 3PF3A 3O3RA 4Y9PA 1PDZA 3CQJA 3RPTA 1E73M 4S3JA 5M1TA 3M9YA 2WM1A 2E77A 1RCXB 3QQ1A 3CNYA 4J27A 1XLAA 1E43A 1TFVA 2E5CA 3CU2A 4NYUA 4A8IA 4O1BA 2YCLA 4Z0SA 1EP3A 4FPSA 3SI9A 5DF0A 2QVNA 1LUCA 3KHDA 2P8CA 2HMCA 1KW1A 2FGBA 1A5AA 2ZOXA 4UMCA 3DUGA 4ZQCA 3RG6A 5KMYA 1QHOA 3T78A 1V08A 3FJLA 4R34A 4HK6A 4V1XA 4AVFA 1ZU8A 4XAPA 4LUJA 2CFFA 2V0TA 3BOFA 4UTHA 3KP0A 2IKHA 4MZ8A 3PPGA 1J18A 1NWRA 3UESA 2WSRA 4QE5A 1KQZA 4GZ7A 4ZBCA 1ZCCA 3GNXA 3T05A 3T44A 4DO5A 2ZRWA 1UC5A 2C1GA 3N29A 2ZUMA 4DBWA 4RUBA 5FJJA 1XYZA 2QCMA 3PANA 4C60A 2R6OA 3L67A 1KM0A 2C13A 3M5VA 1NDYA 3GKFA 4H9YA 3IV3A 3DYPA 4N4PA 2JKEA 3W00A 4TTGA 1W5MA 3MV11 3UD6A 4N9CA 1H5YA 1W17A 3DFYA 4O0ZA 3GDMA 3M0IA 1Q6RA 4JTRA 1RJPA 3VGGA 1K6AA 4OECA 2A6NA 1KM5A 2AKZA 3F7JA 1U83A 1EP2A 1GGOA 3TLLA 4G6CA 3B8TA 2RGMA 4C6KA 2I57A 2EAWA 2DSKA 1HF6A 2ZADA 3NOYA 4JQ2A 3VKJA 2I7GA 1V3IA 1S2UA 2PCEA 5K3VA 1AODA 1ESWA 4AD4A 4JIQA 5DRIA 4IFKB 1JRCA 3VD9A 3VC5A 3ZR5A 3OVGA 4XAYA 3QRHA 3WQPA 4D1JA 4UFHA 3VIMA 3LERA 3QY8A 4GUJA 4GVIA 5FJOA 1W1ZA 1A0EA 1EC9A 4G7FA 3GIPA 5F2LA 1K03A 1TREA 3DC0A 3PTQA 1WE5A 3RAOA 3S9IA 4UOJA 3USZA 3CUHA 4CNNA 3RRAA 4Z17A 4M6QA 4U2YA 4HSNA 1TVPA 2ZTKA 2IS7A 3D3AA 1X96A 3RX2A 3ZT5A 4URIA 1LORA 1XGZA 5FEPA 1UD4A 1NOFA 3CEUA 3QZEA 4N6FA 1ZQ5A 5ABGA 3UGVA 4RDYA 1O60A 2QCCA 1VFFA 4PTXA 3VGDA 2CIPA 1QNVA 2LLEA 1YEYA 2VRKA 2CW6A 1PTDA 4ZQNA 3SJNA 3KE0A 5LKYA 4DWSB 2V3FA 1QI3A 3RO8A 1P4CA 4HB7A 3DIPA 3R0KA 3LPFA 3QVQA 4LUIA 1HJQA 4YTTA 4GQ0A 3LCXA 1WXJA 2PZNA 2WMIB 3O07A 3S2LA 4ZEPA 5FCZA 4PUEA 4QEHA 1RH9A 1UKOA 1XIBA 3U2CA 3P5ZA 3T09A 5DMMA 3N6HA 1XPGA 4L5ZA 4FLOA 5LGXA 5EMUA 1QWGA 1DJQA 1EPXA 4DLFA 3PZQA 4HU4A 3BG3A 4WEVX 1CLXA 5HK4A 1DQXA 5AYZA 4PB4A 4XB3A 3QZ6A 4XG1A 3S5SA 4DXVA 2G95A 4HU3A 1X8FA 4F9DA 2VTFA 1F9CA 3TCSA 1XSIA 2DT0A 2GUYA 2FZDA 6ENLA 1ME8A 1V03A 1GOIA 2G3NA 4DBUA 4DJFD 2AL2A 3DX5A 1RP8A 4Z08A 4W89A 1CECA 5G4EA 4EX4A 3AUJA 2E28A 4GGHA 4XKYB 3O06A 3UR5A 3GTIA 4MWAC 4Q8OA 1VCGA 2FPYA 1OZMA 2WNNA 3Q94A 3LEPA 5AOUA 4H19A 3SCOA 4MNMA 3H2AA 2ANUA 3PWIA 2F61A 3C56A 3ALGA 2P3EA 4BI5A 1EUNA 2W79A 3E96A 3NXLA 4DYKA 2VX4A 3WG6A 4HA4A 1GONA 1KFLA 2DZUA 2GJLA 1GCYA 4W7WA 2V5JA 4M6PA 8TIMA 2G3JA 3I4KA 1EJTC 5IDIA 1TZZA 3TNBA 4O10A 4A22A 4NZ1A 3NGJA 5EGRA 4U3AA 3VOFA 3N18A 3OIXA 4L61A 1P0KA 4JFUA 2BVTA 2E5DA 3W7JA 3RR4A 1KXHA 4CD8A 4LEFA 1LOLA 1PPIA 3QKZA 1FHVA 5G5IA 5PTDA 1U22A 4O1FA 1OT2A 4A6GA 3QOMA 1PZ2A 4QQUA 3TJ4A 5BXPA 4HZ8A 4DF0A 3WLTA 4NRRA 1JQXA 4PMZA 1I2RA 3NOEA 2OEKA 1U5VA 4P8WA 4MADA 2J24A 3E2RA 3WN6A 4JAWA 4Y9AA 1E0UA 3G6MA 3VPLA 2GVLA 4NU7A 5D2TA 1R2SA 1F3WA 2A21A 1EJUC 1CXHA 2DH3A 3SO7A 2WZMA 3PUOA 3A6OA 1E6PA 4HMDA 1TV4A 5F4SA 5F2GA 1GOQA 1GOMA 2VGIA 1JFXA 2ABBA 4H2CA 4ADTA 5CSUA 1MUCA 3ZR4A 1UR0A 4LCRA 4AZIA 4PBEA 1G4SA 4NASA 3LRLA 3CC1A 3VO0A 1H7OA 2Z28A 4LAOA 5CPLA 5D32A 1QPQA 4W85A 3CZLA 3O15A 1ELSA 3E5PA 4O0KA 3WDQA 1YNYA 1ICQA 2QMJA 1XFCA 1HIZA 1US2A 1T40A 1WUFA 1ZS2A 2WQPA 2QDHA 4E4PA 1A3XA 2DW7A 2PSNA 3ARZA 4NVTA 3TTEA 4L64A 5LA0A 3ARPA 3PUEA 1W9VA 2VEPA 3C86A 1J12A 4UWMA 3KAOA 1J10A 1VGAA 3FA5A 3MCMA 4OQVA 2BMBA 3IJDA 3PZGA 5A94A 4XZHA 1PSCA 2V69A 2OSXA 4GYJA 1FDYA 3UY7A 1JZ4A 3IVSA 1AJZA 1NOWA 4ATWA 1PX3A 2QLYA 3UZJA 3KZSA 2WMJA 3VNIA 4KFPA 3TNOA 3LS9A 4GMEA 4M6UA 1HKMA 3SCWA 3FAXA 1AW2A 4EPDC 2CBJA 4FXFA 3DYMA 3FHQA 3HQ1A 3T40A 3HU7A 5A6MA 4O1CA 1A5KC 3GSMA 4N9EA 4Q4MA 2OEMA 4IIHA 4FOUA 4DVOA 1LBMA 2ZXAA 1EB3A 4WXYA 3W2UA 4HSHA 1OGBA 4H9XA 1S2VA 1OYAA 1J0JA 4IG2A 2VCAA 3VU2A 4FIQA 2RFGA 3VX0A 2FYMA 3WQCA 1XPYA 5EBUA 2PDKA 3VNKA 5AFDA 1OYCA 1EC8A 2PTZA 3U6WA 4L9ZA 4KGLA 1EDGA 2D3LA 3MCNA 1E4LA 5AYXA 1UH2A 3TYEA 3E5BA 2A7PA 3S2CA 4CNUA 4XKMA 1IZJA 4WY0B 3MP5A 2VEIA 2ZIDA 4JKLA 1QI2A 4LH8A 1KV5A 4IGHA 2YDAA 3TZNA 4YXGA 4WR3A 3DH7A 1KA9F 3WD2A 3YPIA 4MY8A 4FEZA 3V5OA 5CZKA 3BMWA 3U0HA 3OW1A 3T0BA 4YCOA 3RITA 3CHVA 4H8VA 4UTJA 4AXKA 4A35A 1HL2A 1J0YA 5C9RA 1R3VA 2Y2WA 3A4XA 1XLHA 2DIEA 1W3NA 4JHZA 4GQRA 1XLEA 1E1EA 2OQYA 3ZR6A 4UQCA 3VGHA 3H7UA 4AY8A 4BEQA 1UD8A 1K8YA 1L6FA 1YE6A 1KQYA 1YRRA 2ZZ6A 1GQJA 3EOUA 5T91A 4FSAA 1FWIC 2I17A 1QDSA 1MW0A 5C2CA 1XLLA 3UXDA 4ALDA 4GIRA 1GQIA 1XV8A 5C7HA 5K4XA 1V6YA 3LBCA 2DZTA 4RR4A 1AQ0A 3ZSTA 3W01A 3KBMA 3EWBX 3IRSA 4MLRA 2XTKA 1R85A 2HEJA 1EA9C 4MJ2A 2PDLA 4B4FA 2Y88A 1GNXA 4ASTA 2CBUA 3W84A 4L7ZA 2BX7A 4XX6A 4CN6A 4ZQRA 5I3FA 5TF0A 4XBKA 3TP4A 1E0TA 2GUBA 1Z32X 2DDXA 1E55A 3ID7A 2EG7A 3C2EA 5D30A 1A5MC 1EUAA 2ZDRA 3HPAA 3WZ0E 2WJZA 3VI2A 1QOQA 3CAVA 4EAMA 1X6UA 4REQA 3W1PA 3W82A 4A8RA 3SUSA 3W28A 1S5VA 4XBJA 1POKA 1J5SA 3O0KA 2RAGA 4ACZB 2O92A 3P61A 4A2SA 3VMNA 2WVVB 3UR7A 2QPUA 1VJZA 3HQOA 4WJ8A 1XLDA 4QP0A 2V5CA 4GRSA 3WD3A 4AZCB 1P7TB 4KCTA 2WZHA 1F07A 2Y5JA 3MU7A 4PMOA 4ATLA 3FEMA 3B9DA 5CC6A 2J4GA 4QJ3B 1F05A 3HO8A 3KVKA 1E4MM 4JTQA 2VWTA 4EWND 4XUGA 3R1ZA 1CXKA 4H83A 2KZHA 3E49A 1VLWA 1DJWA 1LOSA 3TAKA 5K9XA 5C70A 2V67A 3L4WA 1V6VA 4BA0A 3UZWA 4I5RA 2D2GA 4BK9A 1IV8A 3G3MA 2YW3A 4H9MA 1XQKA 2QCDB 3N6QA 1ALDA 3QV8A 1UHVA 4G1KA 1BXNA 2ZRVA 2IXVA 1OX4A 1EJ7L 2X0YA 2OZTA 4NL1A 2GK1B 3T9PA 4U31A 2H3BA 3GVGA 1XUUA 3CV2A 1OCBA 1EQCA 3WDPP 3GVVA 4AZHA 2ZUVA 3SN4A 3A9BA 1KFBA 1WA3A 5CSSA 2EJ1A 3QSTA 1EHNA 3HMJG 1UWUA 1BYAA 1XLIA 5A6SA 4L6HA 3PBGA 2ICSA 3GHTA 5FI8A 2HBVA 3LHTA 3CJPA 4FOJA 1JUKA 5DMYA 3CWHA 1X39A 2RDWA 3CPUA 3WEZA 1V6TA 4GWEA 3MPGA 3THDA 4WJXA 1VPXA 4S3GA 1AZ2A 1VIZA 3DERA 4AF0B 2BASA 2DUAA 2QUTA 3WNOA 4IL2A 1BVNP 4H41A 4DLMA 4PODA 2VOMA 2QPSA 4LW7A 1XKYA 4GC3A 4C6OA 3WQEA 4GFIA 2G37A 4AD0A 3A3WA 4W5UA 1QRQA 4RZBA 1DWFM 3WQVA 1EPVA 1EYEA 1UR8A 4FXJA 4WDTA 1IT7A 1DQWA 1H49A 4W86A 3T2OA 3W37A 4PEEA 1X1NA 5TAOA 2XSAA 2CZDA 5DBTA 3GXDA 1TQJA 4LC8A 3AXIA 3NFUA 5FF7A 3SGZA 1OEPA 2JK2A 1RCQA 2F7FA 3URNA 1R2TA 5DELA 1XH0A 3CEPA 3AISA 2REQB 3V0TA 3EDEA 5FL1A 3LN3A 4NHVA 1G01A 5H91A 1Y5XA 1H7PA 5CPNA 1ZJHA 4CN4A 1K70A 4FXSA 2J8GA 3WLOA 1NQ6A 3VD3A 4Z2GA 2ACUA 2XWEA 4LB4A 5G4HC 1XXXA 1NARA 1JYNA 3UG5A 2PDMA 3CH9A 3N9SA 4O12A 1FTXA 4FX7A 2WAGA 3GKAA 3NYDA 5FACA 1DXEA 3RPMA 1RY8A 3SSJA 3PM6A 4FZIA 2Z29A 2FVKA 5LYRA 1I2NA 4NF7A 4J1OA 3AXMA 2IQTA 4S1FA 1UWRA 3VDGA 4WSJA 1AW1A 3GC2A 2J75A 3KBNA 2Z1KA 1Z3NA 1WBHA 1DTUA 3S2NA 3W7CA 4C6PA 5H2ZA 3UR8A 2XH2A 3NWRA 5A69A 3UWWA 4YMZA 4GY1A 4KT2A 3ICJA 4K8EA 2WPGA 1CTNA 3GHUA 4PFMA 5HJXA 4XSLA 3APTA 4O1EA 3IARA 2DUZA 4N9BA 2WSQA 4M19A 1YYAA 3QZAA 1V6XA 3W1LA 2JIWA 5IXEA 4W8LA 4HZ6A 4QTGA 1EEXA 2D22A 4M51A 1QOXA 3UJ2A 2CBIA 1FHLA 1OG6A 3AMLA 3WF2A 4F0MA 3ZT7A 1KGUA 4AAJA 3LPPA 3LV6A 3EXSA 3FGCB 2ZXBA 3E0LA 2OTDA 2XISA 4K36A 4Q6XA 1C8QA 4GINA 4HU8A 3DI1A 3UNDA 3HV8A 4MWAE 4L65A 3LCLA 2OKTA 5C54A 4MVAA 4WKFA 4TIMA 3KOZA 3SGUA 2VGGA 4M82A 1UP0A 3POHA 3P6LA 3UERA 3CYJA 1GTEA 1R9ZA 2CHNA 2DSWA 1ZSXA 4I9MA 3LBOA 2QQ6A 4PBFA 3M0XA 4AMCA 1KLZA 1NY1A 3K13A 4WUIA 3E0FA 3NQEA 2Y7EA 1PHWA 1O5XA 4H2HA 1PEZA 5DXYA 3N17A 4Z1DA 1B9ZA 2DIKA 1P1XA 3LBMA 1QHZA 4DUXA 3VAVA 1CZ1A 4RW3A 4IGNA 5A8GA 3HTWA 4JIHA 3P60A 1W8SA 5D09A 4ICMA 1YDOA 1IF2A 2ADAA 3GTHA 4GQBA 5I77A 4AY7A 3QR0A 4FS9A 2OSWA 3AIVA 2YZRA 2R1MA 3I7QA 4WIWA 5F4WA 3DGBA 5CH9A 2YL8A 2Y7FA 3CPRA 4RV8A 3KLKA 4G5DA 5K9DA 2Y5EA 3AS1A 4LBUA 3ABSA 3ANVA 3LPOA 1B54A 1YBQB 3LXBA 1PO9A 4J3ZA 3M1ZA 2G4FA 1NQKA 3FEQA 2E3ZA 3RN6A 4PA8A 1OD0A 3C2FA 3II1A 1EOKA 3I3DA 2HNEA 4BQ5A 1TPDA 5EKYA 2W5FA 1TJ1A 2G8ZA 5JMUA 3QOKA 3QJAA 3MJMA 1Z44A 2XVLA 2WSYA 3F5LA 3DN5A 4FI4A 3UYCA 1WX0A 2XDFA 1HJVA 3ITOA 4GQGA 3EPMA 4O53A 4W5ZA 2QDGA 1ICPA 1E56A 3V3WA 2IKIA 1FWSA 4UQ9A 1UQZA 2A3BA 3AALA 3PZTA 1H7WA 2OR2A 1TVNA 1H0GA 5FAGA 3HQPA 1XX1A 2QF8A 3NR0A 3IK4A 3C2VA 4HYWA 4EKJA 4V33A 4GVHA 2C0AA 1UMYA 1V6WA 3CHCA 2DJXA 1GEHA 4LUYA 5AHFA 3ZM8A 3UW6A 3MUAA 3PNZA 1WNOA 1LWJA 3EMQA 4HKPA 1DP0A 2V2DA 1LL7A 1MUMA 3MP4A 1NM9A 3OO2A 4H7CA 4G1NA 1W1PA 2J47A 3CQIA 2FVMA 9RUBA 4AWSA 1FP8A 1YADA 3ZJKA 2HVNA 4RE3A 4RKAA 4U10A 4MFEA 4PCTA 1V0KA 5BCAA 4GKTA 1DXIA 1GYNA 3W76A 1WV2A 3EWXA 1H7RA 3M0YA 2ZX9A 2OG9A 4CNPA 1QO5A 1EBHA 3IVTA 2D23A 3OYZA 4C1NB 5I0DA 2BY2A 4DIAA 2YDRA 3NQGA 2NWSA 3THCA 2WPBA 4QS5A 4UQEA 5IOBA 4MMWA 3OGVA 2YBTA 4X60A 4HD5A 1IXQA 3ZOAA 3F5JA 4ICCX 1MQPA 2E6DA 4XVDA 1Q4WA 1QK0A 3WJXA 3MT1A 4PTNA 3OODA 3B04A 3N9KA 3MWCA 3SGGA 3W7IA 3T0AA 1AQFA 3JR2A 3TR2A 1VFTA 3NQCA 4NNAA 5AVNA 1CI1A 2RH9A 3BLEA 1UZ4A 3QPZA 1H1YA 3H2FA 1S5TA 1PKYA 2GGIA 3G1RA 1M7PA 3RLUA 4YTRA 4JYEA 1VBUA 4OV9A 1LLZA 4B16A 1T7LA 3DHUA 5TQLA 3GXIA 3KXQA 3HOJA 4DJDD 3W71A 1VC4A 5B7ZA 4CCCA 2PD9A 4WHBA 4AIOA 1U1JA 3BSGA 2AL1A 3KVLA 3FXGA 1XRFA 5HQEA 4PUDA 1FWWA 2G5WA 3W7HA 2XN2A 3MP3A 3R13A 4JX4A 3SCPA 3EAUA 5EMKA 1LDCA 2PDNA 1HG3A 2ZC8A 5CPTA 1J4EA 4GXPA 4LUSA 1JIBA 3WLSA 3AMKA 4MB5A 5A6BD 3NNTA 1SJBA 2BP1A 2J7DA 1ZJIA 2G41A 2PP0A 4LBSA 4R33A 3NDOA 3RUBL 2ATMA 3W2KA 4LYQA 4LAKA 4FNSA 3C0QA 5D2YA 1V79A 1Y0EA 4O8RA 3WQ4A 1UPMB 3UF9A 3CB3A 4QDPA 2WCGA 4BI7A 4NZ5A 2ZX6A 3EWWA 1KWKA 3PP7A 1A3HA 1O12A 5HWNA 1VRDA 4L4MA 1GEQA 1KCZA 3M43A 4UCGA 3GUWA 3IVUA 3ITGA 5IFPA 1Z69A 3KP1A 4LCSA 4ZXLA 2GJXB 1RLCL 2O9PA 4ATDA 4FX8A 4LX4A 3WD1A 2YR1A 3TN6A 1R46A 1T8QA 1IEVA 1LQAA 3QHOA 2VFHA 1OD8A 3OZYA 5LIUX 1MNZA 2IPFA 4GBUA 1BLIA 4M0XA 1R9YA 2WC7A 1R3RA 3I65A 1UKPA 4OJYA 3LHYA 1MNSA 1EJXC 3RGTA 5C8BB 3GE7A 2OZ0A 5C6MA 4IMDA 2WKGA 4L1GA 4HA1A 3ZS4A 4BF9A 3ABQA 3GR7A 4OGZA 4XZWA 1PTAA 2FHCA 4ZVJA 1GVRA 1TCMA 3M6DA 2PE4A 1MW1A 3PZMA 3BTNA 4N4QA 4QRNA 4PMRA 1PIFA 1BWKA 3QTGA 1ZP3A 4XD6A 4QE4A 2FTPA 4RDZA 3AIQA 1XP3A 4P61A 4LOCA 2V5LA 1AMKA 3B9OA 4GX8A 5JBFA 4C6NA 3A24A 6CGTA 3T6CA 2WVTA 5H8PA 2ZX7A 2JBMA 1RPKA 2E4TA 1KBLA 7CGTA 2WNZA 5FIPA 3UZXA 1JD9A 4O0QA 5FKYA 3VGFA 3OA5A 1Q6EA 1E71M 3AIUA 1HP4A 4O17A 1QPNA 2ZUUA 1EL3A 2XVNA 3EX4A 5EFFA 3G0XA 1U1HA 5KZ6A 1VH7A 4NNCA 3HPSA 1TWZA 3T42A 3UZ5A 2P0OA 1G1YA 4H04A 4UTUA 1E72M 5CJMA 1ECEA 4N2YA 1PIIA 1UR1A 1SMAA 2VR2A 2VC7A 5CC3A 3ARUA 3H53A 1AUSL 1V02A 4A21A 3U3HA 4Z1AA 4YVVA 3PG9A 1EDQA 4LRTA 3GR4A 4MWAB 2A3AA 3PBMA 3EKLA 3CXOA 4DF1A 3P8JA 2WHMA 1CXFA 4NAEB 3GDTA 3R5EA 4YWSA 3P82A 3C52A 4JS3A 4Y2WA 2PDCA 4Q8QA 3NQ6A 4JFSA 3TDFA 2C3ZA 1OF6A 5BROA 5ECVA 1YPXA 3ABRA 1GOWA 3VE9A 3GW0A 3M16A 4X0VA 2YCLB 5AC8A 3B4UA 5F7UA 3GC5A 3UA4A 3B8IA 3NL2A 5E5CA 1LUCB 2V63A 4F0RA 1G4TA 3WBAA 1KTBA 3AZSA 4IMAA 1MXSA 1J2WA 3MHGA 2VX7A 1TRIA 1E6XM 3SZ8A 3GRIA 4DWSD 3O0FA 4TV5A 3G24A 1ADSA 4ZFMA 3TC3A 1C91A 1E9LA 5G2IA 2FMNA 1EJWC 1W91A 4X61A 2ZZ2A 2PB1A 5G1YA 1B3WA 1JULA 3GHSA 4GZJA 3SJ3A 2GWNA 1GYLA 2OOFA 4QG8A 5CG0A 3U5UA 1JYVA 4JTEA 4BR1A 1QU4A 3PBYA 4ZZ9A 1JD7A 5GNXA 5HJLA 3N4AA 4B5TA 3HZ3A 2E8YA 4ZODA 2E9MA 3WLRA 4BWLC 3GFZA 1HO1A 2VRQA 3P0WA 1P0NA 5FJUA 4NP7A 1EF3A 4QAWA 4NQ1A 3CZGA 4B3KA 4TR9A 1QCWA 2JKPA 2E0PA 4OOUA 4C6BA 4MF4A 1A47A 1I6NA 4O4VA 2Z25A 1XYMA 2OOGA 2Z6IA 2ZWYA 3HFYA 3NZGA 1OFRA 4Y96A 1KBIA 4AQLA 1Q2RA 2QJIA 4BFAA 2V81A 3D3FA 1E3XA 2PLMA 4PMNA 5LXXA 1XBXA 2NW0A 1LCOA 4W8AA 3WUEA 3QXBA 4UMAA 1RR2A 3L12A 4QDMA 5A2CA 2WBGA 3SCQA 3W7LA 4AVNA 3U4FA 2D73A 4J3TA 3WH5A 1X38A 2P3ZA 3TR9A 2WYSA 4QAIA 3BSHA 3FDGA 4GNKB 1Q66A 3H21A 2PDIA 2R8WA 4MG4A 4HCLA 2B7OA 3T4CA 2JKAA 2B31A 3B0UX 3VVGA 4KWOA 1AK5A 3TQ0A 5LIYX 1QO2A 2EGZA 4IQDA 3W88A 3V0UA 1K7EA 4C7GA 2Y62A 4PTMA 1R87A 3C2RA 1LROA 3DEQA 4A8NA 3IAPA 2JEPA 4LTSA 4EXBA 3FKRA 1WBJA 3G0SA 3AHXA 1P0BA 3ZQ9A 5IHRA 3GFXA 3P14A 1TG7A 3STEA 2P5NA 4DB7A 1FVPA 2WZTA 2J7FA 3WF3A 1GKQA 4JQ4A 4HJFA 2GWGA 2GQ8A 3MBFA 1UD2A 2ZYFA 3QLDA 5U7SA 5HXMA 1EJRC 3WBXA 2XIMA 1JG9A 1GQLA 5DRCA 3EKGA 3E0IA 1RQHA 4IMFA 4QG9A 1KWGA 1RA5A 3QF0A 5FJRA 1F73A 2F9RA 2V2HA 1UBPC 2EPNA 5AC7A 2HTMA 1PKNA 2GQ9A 3MSYA 3STGA 1VRXA 3P81A 3QHMA 3ARVA 4PRRA 3IEBA 4ZQOA 3QM3A 4GXWA 2HQAA 4W7VA 2HXTA 1NFBA 4UCFA 3TFXA 5AZ0A 4HVXA 3UVIA 3ERPA 4D9PA 4FLSA 2G3IA 3UT0A 3T81A 1MDRA 4E2VA 5DFAA 3AICA 3LLDA 4AB4A 2D69A 2XGZA 1POJA 1HZYA 2XVPA 3CAQA 4BQ4A 5HNRA 3VD5A 3MC5A 2NX9A 3LXAA 1Q6CA 4LJ3A 2BHYA 3NQVA 3R0DA 4AZ5A 1S3HA 2AL2B 3FVMA 3BGAA 4NJGA 4FB7A 3CPGA 4S3EA 1TB3A 3TXZA 2IQ0A 5HMDA 4U5KA 4CU8A 5C71A 4KETA 4Q4SA 4L4OA 1I45A 1M01A 2WHJA 5C9UA 3UWUA 2W62A 4JTJA 1VBJA 1ISWA 3L5AA 4JYFA 2DU2A 4LWWA 4A3YA 4Y90A 4F3HA 3F2CA 2V8ZA 1CDGA 1R9XA 1EWDA 1DIKA 3EA1A 4IL0A 3D46A 4JTLA 1I2OA 1D7KA 2FDMA 4UTFA 2Z26A 3A13A 3MUCA 1HW6A 3E12A 1DJZA 1FHUA 1K9FA 2YLLA 1OWQA 1HTIA 1K8ZA 1IIHA 1BEUA 3AJ7A 1E0WA 4EAYA 3A5VA 5LNRA 3CGTA 1PBGA 2GJRA 4Y7EA 5CPMA 3LZ5A 3AWNA 4JNYA 1I9CB 1J0HA 3ITXA 4W9TA 2DGAA 2V5DA 3OG2A 3W1NA 3S1VA 2EXOA 4GI9A 2WHKA 2YA1A 4LALA 2NZLA 3GDBA 1O66A 4GC4A 2J8FA 5DCEA 1SFSA 1O68A 2F2HA 3W7DA 1QFEA 1G69A 4KKXA 2NX3A 3BAKA 5K7JA 4NZ4A 1SW0A 3WFZA 2R94A 1OFDA 2DZVA 1UKSA 2QYGA 1E5JA 1UOZA 1KNWA 2CLFA 5FAJA 1US3A 3I4EA 3W27A 3DOPA 1VHCA 4ZO6A 3F4DA 1E1FA 1X1OA 3PNUA 4HCDA 4JR5A 1XBZA 1TUXA 5I3JA 4YTSA 1KGWA 2GDQA 5D8WA 3EEZA 1M68A 2NQZA 4PULA 2GUUA 1ADDA 3N25A 1K8CA 3PC0A 4QNWA 3UCCA 3H12A 2VO5A 3AS3A 3TSBA 1V3LA 4EXAA 3HG2A 2BWGA 5A8NA 3UJRA 1VEOA 1R3WA 1DJIA 2C79A 3QPYA 1KFKA 1R5YA 3A12A 5CGTA 4GCXA 1THFD 5CC7A 1LG2A 1W5PA 3VUSA 2VUYA 1D3HA 2J6XA 3LI0A 1E6SM 3MB9A 3BURA 1XDLA 1ZUAX 2ASHA 1AH0A 3GH7A 4F40A 4NJKA 1FWCC 2QNEA 1XH2A 1RBLA 2L5HA 7ODCA 3W1MA 4NI3A 2Z4GA 5FSEC 3DI0A 1NWUA 4HT3A 4LYRA 2XHYA 3DC8A 2J6VA 3H2MA 3M64A 8RUCA 4LANA 5M17A 3DFPA 2YXGA 2C14A 1F3XA 3SDOA 1XL9A 1FH9A 2BXZA 2E1DA 4GISA 1LF1A 4JNMA 2VEMA 2GSHA 1FP9A 4IIEA 4IG2B 4JX6A 4MFDA 1NFGA 2D20A 3ZLGA 1A4LA 4QEEA 1XG4A 3OYXA 1OYBA 3DZ1A 2VNCA 3W6MA 1E70M 4JIEA 4RCXA 3DG3A 3L65A 1XLJA 1I0DA 3SY5A 2J9ZA 4O1AA 1Z41A 1GPFA 1P43A 1WP6A 1AG1O 4LS1A 1QATA 2WKJA 1L2QA 1SUXA 3AUOA 3GH5A 1D9EA 1B57A 1YTDA 1L6WA 3MMUA 2ZA1A 1FWGC 4PRWA 1UD6A 2GPTA 4LV4A 4R3UA 4DYEA 4UNLA 2GDVA 5GQBA 3S5OA 4YU1A 3VKDA 3MUZ1 2CERA 2WZIA 3H2CA 2FMOA 1F8IA 3B0PA 1N82A 1X1ZA 1PXGA 1M3UA 3KBSA 5IBXA 3SCUA 5CBJA 1MEIA 3GNNA 3BGJA 4A3QA 1E9YB 1L6GA 2DZPA 2E40A 2I5QA 1W3JA 5E1QA 4WZHA 4JIPA 2H3DA 4UFJA 2J8TA 3MZ2A 3THAA 3NO3A 4DY1A 4ZSTA 3NQ2A 1D8WA 1FXPA 3W07A 1VPYA 2EKCA 4MAZA 2NXHA 1K1DA 1KFJA 1TA3A 3QY7A 1ONWA 1S2TA 1LTDA 4YVPA 4UTTA 2INEA 4DI9A 2VHLA 2D3NA 3BCJA 5A8QA 3V5FA 3EDFA 2DT2A 1UROA 2W63A 4V2XA 4ZO9A 4FNQA 5BNKA 3KBJA 4EPEC 4HPXA 3PN8A 4TX9A 3HPZA 4REQB 2BVYA 1L6SA 4CD6A 4L4LA 3W74A 1KBKA 3LOTA 1XC4A 5AY7A 1OX6A 5EMMA 1VFMA 4P8VA 3HMCA 3KTCA 1W1B1 2ABAA 2X05A 1LRTA 1QPKA 4PMYA 4GNVA 3B0YA 3T1GA 4PTDA 1G94A 5DCDA 1A0DA 2VDHA 5IRPA 1XM3A 1MRQA 1A5UA 4F0HA 1IEIA 5M2FX 3WJYA 1VEMA 1G6CA 4UMBA 5JVLA 1RXOB 4JCMA 3L4VA 4HIBA 1GTHA 4AH7A 1DIEA 5D38A 3DAQA 3P0XA 1ONXA 4JKKA 2HROA 2BHZA 2FQIA 2F2KA 2QUNA 2RGLA 3AS0A 1KB3A 2NV9A 4RZ5A 3MYPA 4C6CA 4A3RA 5DBUA 5HMSA 3SN1A 4FNUA 4IM4A 4DM1A 2VP8A 4MHBA 5I7GA 2CESA 4C6MA 2P50A 3APYA 2A85A 2FZ8A 3USBA 3AI0A 4YHGA 4K8GA 1ME9A 1RJQA 3LHVA 3P67A 3IAQA 1OX4B 3F03K 4M1RA 4LYKA 3NM1A 1MZRA 4P7LA 5D2XA 5KINA 3BWWA 3L0KA 5FF3A 2Z1WA 3CASA 4ROPA 4LQ1A 3EBVA 1ZTVA 3W87A 2NT1A 5DMLA 2ONEA 2CZEA 1LT8A 2OELA 4DBSA 1LM1A 3CV1A 5LHEA 5E9XA 2BOGX 4J3UA 1HKIA 3VDCA 5I5RA 1SFJA 1TTIA 4PE8A 1TZ9A 4JTHA 2B7QA 3PPFA 3WH7A 3A3XA 1JZ7A 1SM9A 2D2HA 1HKVA 1TSIA 2NLYA 1XS2A 1J96A 2YDSA 3E0WA 1IQ8A 1WOAA 1MFVA 2X1IA 3VE7A 3AYSA 1OQFA 4TX6A 3M0VA 3N15A 3W70A 2NUYA 4J4KA 2DSZA 3ITVA 4C7DA 1V4YA 3HPFA 2PWEA 1JR1A 1JZ3A 3ZZ1A 4D8ZA 4BF7A 3G6LA 2V5KA 2PTDA 3FYOA 1Q3NA 4L6OA 4NJIA 3PFMA 2CHRA 1UH3A 5FA5A 2WANA 3F4NA 5G1MA 1BPLB 4K2SA 3T4WA 4RE4A 4LBRA 4RDWA 3BL3A 2O9RA 3K4AA 1J01A 1OK6A 3S2JA 1RVKA 3IGSA 4XZNX 2HVOA 2QJGA 4QR6A 4G56A 3L0NA 1XQLA 4OFCA 1FKWA 3GW3A 4NNBA 3G2GA 1UZDA 4HNVA 2JFEX 4HA3A 1MVYA 2HJPA 3LNPA 2O56A 3ZVHA 1F6KA 1OB0A 2YFOA 2TODA 1CIUA 2ZQ0A 3BMVA 3VCNA 1TTQA 1VYPX 2TPSA 4RNFA 4HBKA 4CQAA 5C2XA 1OFEA 2PDWA 4S3DA 1BXBA 1IWBA 3FS2A 3V0SA 1E0XA 3B8SA 4US6A 3TQPA 2I1OA 1WQ5A 1OK4A 1EHAA 1DBTA 5BMXA 2G3FA 1EYWA 4US5A 1T0OA 3CMGA 1S5NA 2W66A 2WCAA 4MZ1A 4LXFA 2J66A 5IBXC 4R53A 3WH8A 1Z42A 3H2OA 1SU5A 2I9EA 1B0IA 5D9OA 3HQNA 4QIUA 1VS1A 5AYIA 2GQAA 3LGEA 1CXIA 1XUZA 7ENLA 1QNOA 1OINA 3TK7A 2VZVA 1XLFA 2WLZA 1HL9A 3GDLA 2EQDA 4JN6A 3EOLA 4U28A 1GQKA 1IIGA 1GKRA 1KM6A 2PDJA 4PB5A 3CHDA 3B0VC 3OHIA 1W0MA 1DWHM 1J6PA 2WJFA 3HB9A 3HPXA 4GKLA 4QISA 2Y63A 3UR2A 4UTTC 2R82A 3ISIX 3VK5A 3M46A 5LZLA 4QJ5B 2G97A 4IISA 3PR2A 5D4YA 3XISA 1BD0A 5LIKX 5J04A 3SM0A 1KGXA 3QYSA 1VBHA 4L4PA 5H8MA 5JU6A 2ZC1A 2W9MA 2HS6A 4F79A 3BK0A 3SQLA 1LZOA 3U2OA 3WY1A 1YXYA 3A47A 5CJNA 3UG3A 2X7WA 1UWIA 2CCRA 1YNPA 1H3GA 4J28A 1B2YA 1V02E 5H1WA 1JNEA 1DIDA 4PL2A 5FF2A 1MWOA 4J5NA 1P6WA 4P7OA 2FH8A 3N19B 5DANA 4YYCA 4IHCA 5DEZA 3OG3A 4RJEA 3GB6A 4IXHA 4LAMA 2DEPA 2DT3A 3LA4A 4JTTA 4H8HA 2QT3A 2VENA 3GU1A 1XH1A 4H9TA 3E74A 3XINA 4UQBA 2XU2A 3WBYA 4WKAA 1PV8A 1O7AA 2X8RA 3W81A 4ZOEA 3C4UA 2YJQA 4LAZA 2HV5A 3NL3A 4FLRA 2QDEA 1WAWA 2X2GA 2QS8A 3LY0A 4Q3MA 4W7UA 3OGRA 4ACYA 2QGHA 1ISVA 2D0HA 1VCFA 1E9IA 3TJIA 4B5SA 3CLMA 4QM1A 1BYDA 2NQ9A 3FOKA 3CIVA 4RLIA 5HOSA 4OU1A 3DKLA 2VCBA 2VX5A 1JPDX 3T8LA 1HQTA 2I5IA 4AZGA 1VYSX 3WNLA 3GWQA 3GFYA 4B5NA 2CWNA 3B8DA 2F6KA 3DBPA 1WDSA 2Z27A 1SPQA 4GXMA 4Y9OA 3W1TA 1EWEA 2AAAA 3LLFA 3R0UA 3VNMA 1M53A 2XIBA 3WSUA 3XIMA 5I23A 3N3TA 1M6JA 4TXEA 1TZ7A 3RCNA 4FMVA 4RV3A 4O15A 3RLVA 2C16A 4YL2A 1ADOA 1J93A 2V82A 2HCVA 2YX0A 3PBVA 1TWWA 3EX2A 3O8AA 4B2DD 2GSJA 4ZSUA 1UR2A 3VA8A 4ZL1A 1E51A 3UETA 4WK9A 2EPHA 4Z0JA 1M7OA 3AYRA 3LGDA 2YGYA 7PTDA 3KOFA 1F8MA 5D05A 3MWAA 3VCRA 1LRQA 1C9WA 1NU5A 4WLCA 1W9XA 2YXOA 1XGEA 4XIMA 3HF3A 5FF0A 2Z24A 2X1RA 3N2TA 2Q8LA 1WDDA 1XYAA 5ENLA 1Z6KA 4YJ5A 3AO0A 4C65A 1ZL1A 1LL6A 2VZSA 2ZRZA 3B40A 1R47A 1UWTA 2Z0IA 2YPIA 5TD4A 2PTYA 4NX0A 3WBWA 3A21A 3MMWA 4Q7BA 2BGNE 3E02A 5EPDA 1JXKA 2WMHA 3UGRA 4OZOA 2YL5A 1AFSA 3BH4A 4IPLA 2HE8A 4CU6A 1UH4A 1KO0A 4LV9A 3T0TA 2I14A 2O9TA 4IP4A 3FW6A 4EWJA 5T8GA 4C6FA 4XV0A 3AROA 1KTCA 1UASA 2DH2A 4DZAA 4MKSA 4Z42C 1H0IA 3W25A 2PRMA 1M7XA 3W2MA 3GBEA 2Z2BA 3LUTA 3L5LA 4PH6A 3LHUA 2DY3A 3M5XA 4LT9A 3E2QA 4DO6A 1S5MA 1J5TA 5AHNA 4M6VA 1XICA 1KV8A 4B3ZA 3FLUA 2E5BA 3ALFA 1AJ2A 3L2IA 5EU9A 2RDXA 4KEUA 3UU0A 4B15A 4QJ4B 2O4QA 5A6KA 3I3EA 3WLJA 2XVGA 1PWMA 3LTPA 1GVSA 1EIBA 4OKDA 4AU0A 4LYPA 4QLLA 2NVAA 3ITYA 1OABA 4JNZA 3BV4A 4R27A 4KQNA 1F2JA 1R30A 4I9AA 4BZYA 1ZAIA 4B4HA 4BQ3A 4TUFA 3IUHA 4HHPA 3ZLFA 2DORA 3MZNA 4XD4A 1S39A 5AHLA 4M81A 5CZ0A 2ZUWA 4MPKA 5A2AA 1UJPA 3MO7A 3AXXA 3T08A 4R5EA 2GOUA 1OC5A 2PF8A 1SJCA 1MQRA 2PBGA 4GZEA 4UQDA 3NXFA 4KEZA 1BXCA 3KTSA 1YIXA 3OBKA 8A3HA 4Q4PA 1QAPA 3TWBA 1QNRA 4UC5A 1ZHAA 4CQDA 3R94A 3ARTA 4S23A 1A4MA 5AN7A 1E40A 5A2BA 4LF1A 2OWCA 3B97A 4CD7A 4H7VA 3FN9A 1WO2A 1P1MA 3NVTA 3OLDA 3SUVA 4UTKA 2C18A 1U2YA 3VKBA 1NWSA 2Y8KA 1BWVA 1W32A 1MXGA 4H9VA 3S5ZA 5CKSA 3BG9A 3ITLA 2DZBA 1VQTA 4G7EA 2NVCA 4ERAA 2QF7A 3DYOA 1GVIA 3ABXA 3F5KA 3PAOA 4KRZA 3VC6A 4R9XA 1QR7A 1W8GA 2QXWA 2QEZA 2YOCA 1SSGA 4LUSB 2CLEA 4P8UA 1MXDA 1YMYA 4MAVA 1XIDA 2FIQA 1PVNA 1RCOB 1OHLA 3L21A 3KUMA 2OGJA 3CL8A 2OPJA 3K8LA 4XBSA 4MWAD 1JNDA 2YYUA 3TYDA 1W9BM 2PDGA 1EKOA 4QLJA 2E67A 4ZGYA 3UWZA 1SZEA 4R7OA 1ML1A 3SQSA 2PLJA 1UWSA 6XIMA 4RL3A 4DHGA 1H60A 5LNSA 3HGRA 3L7RA 2VD9A 2PWUA 1A5NC 3AIRA 2OFJA 3BLFA 1TVLA 1HKWA 3N4FA 5C7VA 3ZWTA 1TX0A 2DZAA 3E2SA 1CYGA 4MDPA 3C0JA 3QPEA 3GG8A 1MFUA 4M8UA 3ZT6A 4JIIX 3DFTA 3QMSA 1DJHA 1M9HA 2VDGA 3R79A 2GYIA 3WLKX 3AHYA 3THQA 4JEJA 6ALDA 2WMGA 2PGFA 3EX6A 4DBEA 4MUPA 4HYVA 2QR6A 4M80A 3WK3A 2WW5A 1RHCA 1UWAA 3EWDA 4EIVA 3LM3A 3UFYA 5F2MA 1V8EA 5BYWA 5JUVA 3Q65A 5CLTA 1XI3A 4IJRA 4Q8TA 1FDJA 1W5NA 1GJWA 1OCNA 3EX3A 6TIMA 1TPWA 3HGOA 1CXEA 2PDHA 2XSBA 4HK5A 3W7PA 5I3HA 3LGGA 4BEUA 1K9EA 2INZA 3FKKA 1TJ0A 4DO7A 4KBXA 1K4HA 3M6YA 3RMEA 1TPC1 3FY1A 2CWXA 4S2CA 3RCMA 3OLGA 1BQCA 1UA7A 1NJJA 1JF6A 5TIMA 3NZRA 4KMQA 1LG1A 5CBBA 1V0NA 4GIAA 5C9ZA 4S3BA 1E6NA 3WELA 2FFCA 2WZEA 2J78A 2A3HA 1N8FA 3NUKA 1NDWA 2PGRA 3NZPA 5FOOA 3CHEA 1W9UA 1OCQA 3WNMA 4W93A 4X9YA 3R8RA 1WYIA 3NIYA 3WJZA 3P2VA 3W24A 1US0A 2C1HA 3DG6A 4KF1A 2DZWA 4GYFA 1RALA 3VOHA 4RDVA 5AHEA 4O19A 1S1RA 3BAYA 3QHNA 4NAFA 3RJYA 3S1WA 3WDHA 4E6MA 4EE9A 3FJ4A 3AFBA 1LRNA 1XLGA 2POTA 2QUUA 4S3FA 4C6JA 5FL0A 4OV4A 1B3XA 4NZFA 3OOQA 3DG7A 2ZA3A 4IP7A 4I5XA 3EOEA 1D3CA 4MB4A 3CV7A 1R7OA 1Q13A 1OIMA 1JRBA 3TC7A 2YCKX 4DRSA 1Q65A 6TAAA 2NV2A 5AHIA 1GZGA 5E9AA 3ZSSA 2XIOA 1TTJA 3QTPA 3NAVA 2GVJA 3TJXA 3KLLA 2VZTA 1JVNA 3K8KA 2VFEA 1GORA 1KTNA 1SO3A 3H24A 5DO8A 1E0VA 3ENLA 2VL4A 3PWAA 2VOTA 3GNOA 3W29A 3W1RA 4H8NA 2GVGA 3RMJA 3CIWA 1ZP4A 2XGBA 1VAHA 3KL3A 2VI0A 3KL5A 2FTYA 4PTWA 5E93A 3H8AA 3W2NA 3ARYA 4ZR8A 5D9NA 3D5HA 3GK0A 3PZVA 2WQDA 4HPNA 2YCIX 2BHUA 3IWPA 4QROA 4MKVA 3TYAA 4CVWA 1B31A 1CGVA 3AMDA 3DFOA 4EXQA 5HWMA 4K37A 4Q33A 1DTNA 2ISWA 3KBWA 1QHPA 4ROQA 1Z8AA 2CNCA 1TQXA 1PZ3A 3OZOA 1KR0A 4IMEA 2PFHA 1H7NA 4IX0A 4PMDA 2X40A 4P7RA 4TMCA 3LCGA 4J40A 4PSRA 4QSFA 1CENA 3I6RA 3LRMA 3OZMA 3T07A 1A53A 1MW3A 3C2OA 3N3MA 3MYOA 3WF1A 1HL8A 2AQWA 2RKXA 1O5QA 3B9NA 3FK4A 5I6SA 4M56A 2R14A 1OZQA 3R12A 1REQA 4H9ZA 1J9YA 5GJMA 5F4XA 4B5XA 3STPA 2A4AA 3PJXA 3RYSA 4OBSA 5KEZA 4GPNA 2GGHA 1AD4A 3E9AA 3K8MA 4N6EA 2H8XA 2PD5A 9XIAA 3EEGA 3JW7A 2VDIA 1DIOA 2QHAA 4M1BA 3W75A 4O1DA 4C6IA 1KBBA 1KFWA 2OO0A 2C8NA 3VIFA 3CBWA 3LX9A 2BODX 3Q45A 3RX3A 1EX5A 3SFWA 3A64A 3PZIA 1UKQA 1K77A 1AA1B 3C61A 1U30A 4ORMA 4LRSA 2FKPA 1EBGA 5AC5A 3EDDA 1VBRA 4A3UA 1XIMA 5FJTA 4PUWA 2V30A 3ES7A 3KZPA 3TROA 2Q3OA 4B90A 3ABZA 2QZRA 4R88A 3B3DA 1XR2A 4LVDA 2XIJA 4AIBA 3W9ZA 5GNYA 1IWAA 4W84A 3CH0A 4JGDA 1PKMA 3RFAA 4B91A 5LNUA 3CUIA 1S3TC 1GVQA 2GZXA 1TELA 5FD0A 2DIJA 1NF7A 3QW3A 1Q85A 4I3GA 3J7HA 4HMCA 5E0KA 1KRCC 3GVRA 6A3HA 3SQMA 2PS2A 3FA3A 1B3OA 3SRDA 1QW8A 1ITUA 2BS9A 3CZKA 3ZJ8A 1XYFA 1GJUA 3V7PA 5G1TA 1NDZA 1NIUA 4H6EA 3RX4A 3B9EA 3VTRA 3MUIA 2O55A 2R1NA 2W27A 4NZCA 3NPVA 3DGRA 3HG5A 3IANA 5CSYA 3O6CA 1Q7MA 1YKWA 3P62A 1ZJBA 5HWJA 3TC6A 3UCDA 1MEWA 2OJPA 5BU6A 3ZJ7A 1TE6A 2VR4A 4JN7A 4E5TA 4OBTA 3GAKA 3EX1A 1KD0A 4PUUA 5LIWX 1JDEA 4WSKA 4QJ1A 3LCHA 2VM8A 2PDFA 3LU2A 4DX3A 4ZB5A 4Z1BA 2NXIA 3TEVA 1CCWB 2IKGA 1XSJA 1SMDA 3LV5A 3OBAA 3CUJA 1EJSC 1J0IA 2OYKA 1WZAA 2NQLA 4PMJA 2D24A 3GVWA 4MUZA 4AYGA 1XYLA 1UOKA 4B9YA 3UXLA 4N0RA 2D1ZA 3SBFA 1DWIM 4XUYA 3VIIA 1S38A 3N11A 2GLKA 3WH9A 3PB0A 3VZZA 5L9FA 4AX6A 3KDNA 4O13A 1XRTA 3A23A 3STFA 3LMYA 3LZ3A 3DFQA 3OVRA 3MDUA 4AHQA 3FX4A 3LQLA 3URAA 3LCFA 2W92A 3R25A 3HURA 4HMNA 2PC8A 1BF6A 1VENA 1S2AA 1RK6A 2ISDA 3UP8A 2CITA 3TYUA 4UB9A 3GU9A 5HQLA 4CUCA 3L4XA 5C9WA 1TPB1 1W9PA 2VC5A 4OBRA 3MKKA 3V4BA 4OTKA 3ZJ6A 4DO4A 2PWVA 1R3SA 3ZLHA 4DWDA 3ME3A 3KOXA 3T2QA 1DE6A 1PKLA 5ABFA 4AWTA 3H7RA 4AEEA 1MQQA 1P48A 4Q32A 4HOXA 4AW7A 2YZ5A 2V3GA 1LLOA 2ZX8A 3MI2A 2NWRA 4NSBA 3HM7A 1WZLA 3TE9A 5MHBA 3VIHA 3BOLA 1GOKA 4JXCA 1LBFA 3GXPA 1JJKA 3IJ7A 3FYYA 3MSRA 2H9AA 5I3IA 4Q8MA 2J13A 4YPJA 3TSMA 1VCVA 2UV8G 1QI5A 2A7RA 2P76A 5JIWA 1HVQA 5HPOA 4C6LA 1Q6FA 5BOOA 1XHGA 5DQPA 5BU9A 3AIBA 4GIYA 2J25A 3T0CA 2DQXA 3ITTA 3ZXWA 4CQBA 4QS6A 3TLQA 1SJAA 2YA0A 1RVGA 3PFRA 2V38A 4D1IA 4J35A 3CUXA 4J3WA 1KKRA 3R8GA 2ZICA 2NXGA 4I5UA 3KRSA 4E2DA 3KRUA 1I75A 4IF2A 5CG7A 1WDWA 1UW9A 4DJEA 3RO6A 1UR3M 3B8UA 1CGUA 1PX4A 4OWGA 2CLOA 5CQ1A 3U2ZA 5MKGA 4KRTA 1G0CA 3MI3A 1BVWA 1WPCA 2CLLA 4GUIA 1ODZA 2VFFA 3FHAA 5DX7A 4H6KA 2Y70A 1W54A 1F7BA 2IMRA 3W7MA 1UKTA 3FYPA 2ZA2A 1ZCOA 1GVYA 3PBUA 4BKNA 2BVDA 3HN3A 4M3PA 4ZQMA 1GK8A 3GQYA 3MUXA 4JZ5A 3QMRA 1DJXA 2DP3A 2OLAA 4GA8A 5KITA 4YS1A 5IFTA 1P5BA 3W26A 1OX5A 1Q45A 3MVTA 1A5OC 3G3DA 4MDOA 3I6EA 4GI8A 2CETA 3RHGA 4F0KA 4QLKA 4D6GA 3BW2A 2A2IA 1R3YA 4GVFA 3GXMA 1KFEA 4ZO7A 3VGEA 1JI2A 2DV0A 3W86A 4NYYA 1GHSA 2ZBTA 1XW8A 1DJGA 1EXBA 4U33A 4P2VA 5FJIA 1LWIA 3MQTA 3TV8A 3WUBA 1ZALA 4M29A 1KXVA 5HNTA 4B2DA 1FWEC 1VFOA 1IHIA 4DZIA 1WUEA 3LHZA 2EHHA 3IPWA 2EO7A 2Y24A 4HCHA 3BZGA 2TAAA 4X2PA 2Y1HA 1XINA 4X63A 2J9YA 2ZXDA 3U5YA 3U8GA 1TV8A 3LENA 1ZGDA 4PZVA 1TX2A 4B5WA 5U4NA 3W1XA 2GQ3A 3RM4A 3P3BA 2FTWA 1NDVA 3O05A 1XLMA 1UC4A 3GM8A 4XISA 2WWCA 1O95A 4ZXOA 2OT0A 4AD3A 3FJNA 4G2DA 3CQHA 5HANA 1QPRA 2R24A 3AZRA 5AC4A 4F0SA 4HNUA 4D72A 4FA3A 4P5UA 4TV6A 4GY0A 1R2RA 2FB2A 3KWSA 2XFRA 4F48A 3WK2A 4CNTA 1RPXA 4IIDA 4GO9A 5A6TC 3W83A 3ABOA 4L56A 3BJSA 1F6YA 3EPNA 1DWGM 5D9PA 1ZPTA 3TN3A 4GK8A 3WQFA 4U4MA 1O94A 3VZYA 3MTWA 5A5WA 1WKFA 4IJBA 4PL1A 4DELA 5RUBA 3TCEA 4ZB2A 3BLKA 1W1A1 3TQVA 1G7UA 1TA3B 1GVFA 3G8RA 4K8HA 2G3MA 2VURA 2X1TA 3WQ6A 2P53A 1GG0A 1QWKA 4CQ9A 3NCOA 2OU4A 3W53A 1QOPA 4W8BA 2A0NA 4I7WA 3BW4A 4EVZA 3K1DA 1JUBA 3RLHA 3OVQA 3PJTA 3C0LA 3IIXA 2DPEA 3V5CA 1OADA 3KX6A 3BLOA 3H70A 1V3HA 2FJUB 3TIMA 4Y9MA 2NQ5A 4LVFA 3MBDA 2WV8A 6REQA 3W38A 4GY7A 4MB1A 3WJSA 4YCPA 1PCKA 2IUZA 1JDDA 4GYPA 3PULA 3CLWA 3DU0A 3VMOA 4QITA 4PTVA 3PPHA 1H09A 2Z2AA 3GO2A 1LJYA 1M65A 1MO0A 1LQ0A 7REQA 2ZRUA 1H63A 3AZTA 2PGEA 5EBAA 1YLVA 4QSHA 4O16A 4HOZA 2OWXA 2VGFA 4UTWA 5C5YA 4F2BA 1DJNA 1IXPA 2A3EA 3S9YA 5A95A 4MY9A 2GDUA 4WGHA 2YBUA 3BAJA 3NJ3A 2PUZA 1B3ZA 5TNVA 3MA8A 1EDTA 1TE1A 4H6RA 3LK6A 2C1IA 1GQNA 3U57A