1MRQA

Crystal structure of human 20alpha-hsd in ternary complex with nadp and 20alpha-hydroxy-progesterone
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
323
structure length
323
Chain Sequence
QDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C1
publication title Human 20alpha-hydroxysteroid dehydrogenase: crystallographic and site-directed mutagenesis studies lead to the identification of an alternative binding site for C21-steroids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 116
structure length 323
sequence length 323
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1mrqA00
3UG8A 2BGSA 1T41A 3WG6A 4XAPA 2VDGA 1VP5A 3H7UA 1ZUAX 2ACQA 4YVVA 4JTRA 4PRTA 3O0KA 3N2TA 1EF3A 1LWIA 1VBJA 4DZ5A 4GCAA 4L1WA 4QX4A 3UFYA 1AH3A 2FZ9A 4PUWA 3V0SA 4HBKA 3R94A 2PDUA 1S1RA 4IJRA 4F40A 3S3GA 3R7MA 1AZ2A 3G1RA 4IJCA 1ZGDA 5JH2A 3R58A 3D3FA 4XO6A 2IQDA 3FX4A 4FAMA 2PDYA 3UZXA 3CAQA 2PDWA 5LIUX 3EB4A 5DANA 4QR6A 3R8GA 3QKZA 4R9OA 2IKHA 2HV5A 1IEIA 2PD5A 2WZMA 3B3DA 2PDPA 3WBWA 3U2CA 2IPGA 4IGSA 4GIEA 2PDQA 3LQGA 4EXAA 3M0IA 4JQ3A 3DOPA 4DBUA 2FVLA 1X97A 2NVDA 2IKIA 3RX4A 3V35A 2PDIA 2DUXA 2BP1A 3LQLA 2AGTA 3MC5A 3R43A 2PDMA 3CASA 2PDCA 4YVPA 2PEVA 4YU1A 2HE5A 1XJBA 5LIXX 4ZFCA 1UR3M 1R38A 3CMFA 1FRBA 2CLPA 3F7JA 3GHUA 2WZTA 2PDKA 4FALA 4MHBA 1SM9A 4PR4A 1PZ1A 3T42A 1QWKA 3LUTA 3UGRA 1YNPA 1YNQA 1MI3A 1Q13A 3LBOA 4PRRA 1MRQA 2PDLA 2FGBA 1HW6A 1RALA 4GQGA 4EXBA 3WBXA 3LN3A 1YE6A 4XZNX 5LIYX 2INZA 3GHRA 3O3RA 3M4HA 4OTKA 4YS1A 3LNMA 2PDFA 4FZIA 4RPQA 4XZIA 4ICCX 3UWEA 1YE4A 4PMJA 4XVDA 1PYFA 5HNTA 2PDNA 1AH4A 2R24A 2IKJA 5AZ0A 2I16A 4H7CA 3CV7A 4JTAA 1EXBA 4JIIX 4JTDA 2HDJA 2BGQA 1RY0A 2PDGA 1Z3NA 4GACA 2PZNA 1XGDA 2ISFA 3BCJA 3GUGA 3Q65A 5JH1A 4ASTA 3UZWA 1A80A 1PZ0A 5C7HA 4FA3A 5HA7A 1AZ1A 2IS7A 3LD5A 1LQAA 2C91A 2ACUA 3V36A 1ADSA 2IPJA 2R9RA 1IHIA 5KETA 3GHTA 2PF8A 2HVOA 2ACRA 3UYIA 1GVEA 3NTYA 4QBXA 2A79A 3ERPA 2I17A 3C3UA 3UP8A 3UZZA 4DBWA 2DUZA 4LBRA 4LAUA 4WGHA 4WDUA 2F38A 2PFHA 1US0A 5LIWX 1AH0A 4PUUA 2PDJA 3RX3A 1Z89A 3CAVA 3WCZA 4GQ0A 4LBSA 3COTA 3LZ5A 3H4GA 3Q67A 4YVXA 2PD9A 1XF0A 2PDHA 2P5NA 1HQTA 1M9HA 3VXGA 2J8TA 3LEPA 3LENA 3BURA 2ALRA 2QXWA 1C9WA 3FJNA 4Q7BA 1EL3A 2F2KA 1OG6A 2NVCA 5HNUA 3KRBA 4LB3A 4L1XA 4GABA 1T40A 1S2CA 1Q5MA 2DV0A 2FZDA 4JTCA 3EAUA 2HE8A 1PWLA 4JIRA 1Z9AA 3RX2A 4JQ4A 2HVNA 4LAZA 3V0UA 4XZLX 2FZ8A 4JIHA 1Z8AA 3P2VA 3BUVA 1S2AA 3LZ3A 2IQ0A 1RY8A 4WRHA 3BV7A 5LIKX 2ACSA 4I5XA 2INEA 4Q3MA 4JQAA 4DBSA 3N6QA 3EB3A 1EKOA 4XZMX 3CV6A 1K8CA 4AUBA 5M2FX 3DN5A 3ONCA 4WDTA 4HMNA 3R8HA 1AFSA 4GA8A 1ZSXA 1X96A 3MB9A 3G5EA 4XZHA 2IPFA 1JEZA 4XO7A 4XVEA 2IKGA 4LB4A 3M64A 1MZRA 4WDXA 1S1PA 4NKCA 4WDWA 4G5DA 1ZQ5A 1PWMA 2HEJA 3WBYA 1J96A 4WEVX 3V0TA 2FZBA 4XK2A 4H8NA 4JQ2A 3UZYA 2PDBA 4JQ1A 4QXIA 4JTQA 3GHSA 1X98A 1QRQA 2IPWA 3H7RA 3R6IA 3ONBA 2PDXA 5AZ1A
chains in the Genus database with same CATH superfamily
4CCDA 4WR3A 3UG8A 2BGSA 4ZTYA 4NI3A 4ZQPA 3F4VA 4JY8A 2PB1A 3PJWA 1ADDA 4XB3A 3HG4A 2DPEA 4E2BA 3K8KA 3KL0A 9CGTA 3QW3A 4J1OA 3ZVIA 4PUDA 1KRBC 1UA7A 3PN8A 1XRTA 2GDQA 3BLDA 3MV11 2PLCA 4IJRA 1BYAA 3RCNA 1XLMA 1O5QA 3N9KA 5AC8A 1TX2A 3H22A 4LWWA 2PWUA 2YCIX 2QCCA 3UJ2A 2VT0A 3L4WA 4RV3A 4DJEA 4S3AA 5LIUX 5C5YA 2VEGA 2BMBA 1F61A 4GQBA 1FWIC 4AYGA 2Z7GA 1DP0A 4NRSA 2Q09A 4ML9A 3BLFA 3W6YA 5JIPA 2WJEA 3RR1A 3B3DA 3CH9A 4GXPA 2XIMA 2H9AA 2DT0A 1VYRA 1NY1A 3R0KA 4EANA 2VC6A 3CUHA 5FF7A 3TR2A 4AAJA 3MYOA 3N04A 1QPRA 4HNOA 3BGGA 3CH0A 4U5IA 4M6QA 3UXAA 1RLDA 1W17A 3DERA 1VHCA 4MB1A 4K3ZA 1IF2A 1D8WA 3RRAA 2GJLA 2AGTA 2VVNA 4P5UA 2OKTA 3N29A 4GFIA 4P7RA 5AC4A 4V33A 1CLKA 2PDMA 2PDCA 2AL1A 4CU8A 3KLKA 5CSYA 2EJAA 1FWTA 1WYIA 5D9PA 3GXIA 3RMEA 1V02A 4HNVA 1NFPA 5LYRA 3NQBA 1OX6A 3EX4A 5FIPA 3T4WA 1IEWA 4L6HA 2WMIB 4J2PA 1U1JA 3K30A 1KLZA 2JE8A 1NWTA 3HG5A 5A6KA 5D9OA 3A4XA 2P76A 4CEUC 3WL0A 1JD9A 4KGLA 4L5ZA 1CZ1A 3IGXA 4E38A 4ALDA 5CEWA 3U9IA 1RQEA 1UWIA 3GVQA 3HN3A 2NUYA 4YS1A 2ZRXA 4BHYA 3CUFA 1NH6A 2DSVA 2C15A 2Q3RA 1H0GA 3BSMA 5HULA 1JRBA 2ALDA 4A2RA 1WDWA 3I6EA 4XVDA 3VNMA 4RW3A 2V2CA 4GBUA 5M03A 2E8YA 1KD0A 2EPLX 4QJ3B 4RZ5A 2DZTA 3OLDA 2RJGA 6ALDA 1KCZA 3WQGA 3GKFA 3Q94A 1HIZA 3EXRA 3RU8X 4JIPA 3TYUA 2OX4A 5ECVA 1X1NA 1LZOA 2EBNA 4WIWA 2WC7A 3E12A 3KE0A 4IF2A 5FJRA 2D3NA 1F9CA 3BCJA 4JOMA 3QPZA 9RUBA 1R3SA 1NQ6A 3BW3A 5CH9A 4FX6M 1PZ0A 3ALFA 2BTMA 4V1YA 1RBAA 2OEMA 3HURA 5FF3A 4OBTA 2YDRA 1HJUA 1HP4A 3TJIA 3I7RA 2J24A 5I23A 3ZZ1A 1JVNA 3GDLA 4DAIA 4GIRA 1HG3A 4IISA 1EP1A 2NXIA 1M04A 3WENA 1V6WA 4N6FA 3HJEA 3V5OA 4AQLA 2BVTA 2WOQA 2BBFA 4UQCA 4GOAA 3C3UA 3G1SA 4G1NA 4IQDA 4ADUA 4YLWA 5HMEA 3ABSA 4RNJA 4E3VA 3EOLA 3RO6A 3H6OA 3TVAA 2VFIA 1GVIA 3K8MA 4MIMA 5C2GA 1FWNA 1N8IA 2NW0A 3VINA 4X0NA 2CITA 3NPWA 1VJIA 3B05A 3M0HA 3LI0A 3LZ5A 4JNMA 4QSHA 4FR1A 5BU9A 2PD9A 1PTAA 1XF0A 2QS8A 5H1WA 3QZEA 3M46A 1C8QA 1UOZA 4NT0A 1NELA 3GNOA 4DRSA 2G41A 5D8ZA 1IV8A 2OB3A 2HBXA 4R85A 3LENA 5FJJA 1FBAA 5AHNA 3UJFA 2XH0A 3OIHA 3HIJA 4DJED 4XSLA 4GABA 4D8ZA 5K4ZA 3QH2A 2I7GA 4Q32A 4V28A 3TEVA 3B8WA 1VBRA 4HMCA 2VX7A 2D0GA 1UHVA 2A5HA 4QG8A 1N82A 1NU5A 3GG8A 1TJ1A 3L0GA 1ZRQA 3AOFA 1DXFA 5E0KA 2D3LA 3EX1A 3VOCA 2YX0A 1TKKA 3LMZA 4ZQNA 4C1NB 2I57A 2CW6A 2XIJA 5D05A 2OLAA 2OZ8A 3DG6A 3N11A 2D0FA 3VOIA 2QF8A 3MKVA 1NVMA 2WSPA 4EAMA 1TZ7A 3VKBA 3QTPA 2DVTA 3W7JA 1DORA 3H2OA 3CV6A 4BQ2A 1L8PA 1HKWA 1E9YB 1QBBA 3OQEA 1UZ4A 3DN5A 4JKLA 2I5QA 3IIPA 4KS0A 1S5WA 4H9VA 3QC0A 1YHTA 3IGUA 2VXNA 1JEZA 3GXFA 2WNNA 2VR5A 1SPQA 1X6UA 3KOXA 4S3FA 3PAOA 3WBYA 3VNIA 5CJNA 1J96A 3JS3A 2FKPA 3ZLGA 1UWUA 4GNKB 1W2VA 1GYLA 4LUYA 3R0UA 2EF9A 1Q7ZA 4CNNA 4BI5A 1ZBWA 3PJTA 1OABA 1OFAA 4BK9A 3I6RA 4JTRA 1LQ0A 2VZUA 3C0JA 1CXLA 4FLQA 3LLDA 5I06A 4B5UA 4D6FA 3OYXA 3N19B 4HBKA 4MYXA 1XLIA 1KFCA 3CC1A 1R6WA 4J27A 4HHMA 3NSNA 2PMQA 4DJDC 3TH6A 2OGYA 3N6JA 1WKYA 4IIDA 3CQHA 3OLIA 3TU9A 3PM6A 3GH7A 4BJHA 1B2YA 1E3XA 1TIMA 4A4AA 5LXXA 3VX0A 2E7FA 3PC0A 1MMFA 3VOJA 3PPFA 2YB1A 4GPNA 4QNWA 5KEZA 4HQVA 1OYCA 3G1HA 1HJVA 2X2GA 3THCA 3PPGA 3POCA 4O52A 4ZCWA 2HISA 4D71A 5HBFA 1K9TA 3P8JA 2PDQA 2UY2A 2OLSA 3I7SA 2WSYA 4E4PA 3AIWA 4Q8WA 1QNSA 4HU4A 1X97A 1JG9A 1P1MA 5IOBA 2I56A 4ORMA 1LWJA 4QE1A 1HO4A 3RX4A 1P6BA 1I2PA 3DYPA 4NXSA 4FF7A 4F9DA 2AKZA 3GO2A 4DBEA 5M1TA 1V51A 1B1YA 3D0CA 2ZZ6A 1SO6A 4E2DA 3W0KA 1DJHA 3QQ0A 3MUAA 1XIJA 2J77A 2VX6A 2VFFA 4AXKA 3TTYA 2CZDA 1BYCA 5BOFA 6XIAA 3VNDA 3TQPA 4CNTA 5DXXA 1XIIA 3VIKA 3IIZA 1XDJA 3PBVA 1XIBA 4IGMA 3CWOX 4GI6A 3L4UA 2PGEA 4CQBA 3AS3A 3IUHA 4GE8A 1X1ZA 2Z1BA 3A4AA 4IUOA 1DWFM 2PWEA 4HT3A 3A22A 1GVYA 2QT3A 4IXHA 3FKRA 1UD5A 1YE6A 6A3HA 3DFNA 4YHGA 3TW7A 4PMXA 5FKYA 3TCSA 3TSDA 3H2CA 4RUBA 2UBPC 1H49A 1H50A 1MXDA 1UIOA 5J04A 4JTGA 2O9RA 3SQSA 2C14A 1QPKA 2Y7FA 4ICCX 3UWUA 3QV9A 3IGSA 4DLMA 2P3EA 3SN0A 2LLEA 1XW8A 2VZVA 3M7SA 3AU6A 4XIMA 2BVWA 1H5YA 3D6NA 1QTWA 3W2JA 4KETA 3WFAA 3CV7A 1FP8A 3MHUA 1PX4A 3WX7A 1EXBA 4LUSB 3BSGA 3S1UA 1JCTA 1GOWA 3SI9A 1R3YA 2XFRA 4KWOA 4IMGA 5A95A 4AZ6A 1Z3NA 2C19A 4DX3A 4GACA 3TROA 4XAZA 2J7CA 4MY9A 4MUPA 4NL1A 3BAJA 1C7TA 3CUGA 3KFTA 4E4UA 4M7TA 1QOPA 4UCGA 3CTLA 3GVRA 1JDCA 3NPVA 1GZGA 1AW5A 1DTUA 3C2OA 2G4JA 3CO4A 2BVDA 1R3WA 3SUSA 1EWEA 1IEQA 3AYVA 4GLEA 3CUZA 1HKMA 1UUOA 5L9FA 2E25A 4NIRA 3CV1A 4GUHA 3UZZA 3PS7A 1DWJM 2O55A 3EXTA 1XLLA 5H8UA 3TTOA 1TX0A 4S23A 4WGHA 3TC7A 3SN1A 1KM4A 2FMOA 3ECQA 2ZDRA 3KM8A 2PFHA 4BF5A 4GI9A 1A5SA 2YBVA 3N9SA 2XTKA 4GO8A 4J3ZA 1XWYA 3USBA 1YNYA 5AC5A 3JVAA 2GPTA 4ZB0A 3GNNA 1H7PA 4M81A 3CS2A 1LP6A 1XYCA 4QDWA 3RHGA 2Q8XA 2VM8A 1KA9F 5D02A 2ZA3A 1TUXA 3THUA 1MW0A 1EDGA 3VXGA 3GDMA 4QAWA 2FHBA 4D6DA 2ALRA 4UMBA 1EL3A 1MQQA 2EG8A 4AZ5A 3QHNA 3Q4DA 4DJDA 2E6YA 4KCTA 1SMAA 5AC7A 2PLMA 2YBTA 2WHJA 1HF6A 1YQ2A 1MUWA 4QP0A 5CPSA 3NIYA 2JGQA 2ZX5A 1CLXA 3L2MA 3S8HA 1EPVA 1IWPA 4WJ8A 4IL0A 3RLHA 3F4WA 2PC4A 1DIOA 1VKFA 3TQKA 4IFKA 3FDKA 2FGLA 4GNJA 5A6JA 2TRSA 5T8GA 1GVFA 1MEWA 4GQQA 1KCLA 4HCLA 1C91A 4YHEA 1MDLA 1E0UA 3W6LA 4NF7A 4R3UA 5D30A 2CBJA 1EKOA 4MWAC 4JFUA 2FVKA 4JN8A 2VEIA 1TE6A 3TTQA 3P62A 1RPXA 4HU0A 3NDZA 3EXSA 3LBCA 3AXKA 3WEZA 2R1LA 4N9CA 1UQYA 1NAL1 2CWXA 4S3DA 1JDAA 3T8LA 4O13A 4H8NA 2WPBA 1W5QA 1KM6A 4J7RA 3WLIA 3L4XA 4IQLA 5T26A 1QBAA 3RDKA 2J9YA 5I3JA 1XSIA 1EUNA 2OT1A 4O1CA 1Z7AA 1SSDA 3F5LA 1I8JA 5DCBA 3CQIA 1R5YA 1MDRA 1P0EA 3UR5A 4CNSA 3G8EA 4HJFA 5DT5A 3ZYZA 1AMYA 4C6JA 2R1MA 5AHFA 1EIXA 3WK0A 2WWDA 4PCFA 3E74A 4F2TA 4DQWA 3ZSTA 1JGMA 3LLFA 4GVHA 4E3TA 4JCLA 4QE4A 3PFMA 1HKIA 2OVLA 3VA8A 1ZBKA 5AYZA 4EPDC 3NA8A 1TR1A 2PE4A 3NM3A 1E6QM 1XFBA 4KIEA 4IJCA 5JH2A 3DC8A 1XM3A 4JIQA 2FFCA 1W9UA 4MM1A 2B81A 4FAMA 2A3AA 2PDWA 3OB8A 4EX4A 4O14A 1DXEA 2Y7DA 5CPLA 2HJPA 1UJQA 1Q6RA 4KRZA 1O7AA 1Q6DA 5J8LA 3FEQA 1XYMA 1Z41A 5K9CA 2ZUVA 2CZVA 3VZZA 2R1KA 5CPOA 4TUFA 1YADA 1J6OA 3UXKA 2H9AB 1M53A 3ITXA 3NVDA 1EBGA 3CXOA 4JDYA 3TMLA 1GKPA 3ZM8A 3MUZ1 4HCDA 4UR9A 1IGSA 3M6YA 1THFD 2J7BA 1XQKA 4FI4A 5A2BA 1YEYA 1NDWA 2OOFA 3AYTA 5A2AA 2GVYA 3PULA 1FKXA 4PTWA 2G96A 2VCAA 1DWGM 1UD6A 5KZDA 3HA1A 2PWVA 2PP3A 1GOOA 4NNBA 4UNKA 1UZDA 1F73A 1Z48A 4AD3A 3N2CA 1PZ3A 3WH6A 1EIBA 1Q65A 2JGYA 2OG9A 4UZUA 3W1UA 2Y1HA 3TNBA 4TU1A 2Z0IA 3TYDA 3IIOA 3WNMA 3EGJA 2P8CA 1O68A 3OIXA 2XZ9A 3VPLA 3OQ8A 1JZ3A 1B90A 3WBXA 2CKSA 3DFPA 2GK1B 2JFEX 5LIYX 2VR2A 4GINA 1OF6A 3KEHA 1CYGA 2PDFA 4DJDD 1UP3A 3EDKA 5CZKA 1FHVA 3QLLA 3LB0A 3E96A 1WZMA 2RDTA 2V38A 3IV8A 3UWWA 4P8VA 4PUMA 5DMNA 3IRSA 1PYFA 5DY2A 3NDOA 1QHZA 3WDQA 2Y6ZA 2VTFA 2Z7KA 2YLLA 1TMLA 3CV2A 5D9NA 4WHBA 5AZ0A 1S46A 1J5SA 2QCEA 3QFEA 4RR4A 2ZTKA 4AH7A 3KTCA 3W7HA 2Y8UA 1ZL1A 2P0OA 1K4GA 4F2BA 4LXFA 5DY3A 3QXBA 5M5DA 4W8LA 3W82A 5CBIA 1G0CA 2O4MA 3DU0A 3W74A 1ZCCA 1DE5A 5A69A 1H7NA 3B06A 4HPJA 1L6YA 4RNHA 3TV8A 4HKPA 2ACUA 3IUIA 3V36A 2D2HA 3NSXA 1MFUA 4CUCA 1JDFA 1B5TA 4ZO7A 3HBLA 1DJYA 1E1FA 3B0YA 3THAA 1BYDA 4QTGA 3OVQA 4O16A 2V6AA 2EG7A 2VZTA 3O05A 5B7YA 2ACRA 3UVAA 3NL5A 4UFHA 1O5XA 2GVGA 4QBXA 3ERPA 4LAMA 4JL2A 3L4VA 2NSXA 1TWIA 4IMEA 5A6LA 3R11A 1K70A 3IVTA 1OFBA 4R7JA 4DBWA 3MI2A 1F4HA 5D2VA 3MHFA 4YJ5A 2G3MA 3S1VA 1CGVA 2EEXA 4EK7A 1TTIA 7XIMA 3U6WA 5HAOA 3S2CA 3GVGA 4GBDA 1YIXA 5LIWX 5D2TA 2VGBA 3UCCA 3RU6A 3FSTA 2C18A 4O17A 3W25A 2WKJA 2O0TA 2DT2A 1V6TA 4YNGA 4I5UA 4HK5A 4AVNA 2P5NA 2WVVA 1M9HA 1QPOA 3VUSA 2WKGA 3GDBA 4TX9A 2TSYA 4M1BA 3CIWA 4IL2A 4BY3A 3DDMA 4LVGA 4CNPA 5BRQA 1UC5A 4DO7A 4XD3A 3M0KA 2QW5A 1IWAA 1FDYA 4UQ9A 1KFBA 3OVGA 1RCOB 1BEUA 4MB5A 2VQTA 2XISA 4OHQA 1GUVA 3GD6A 3R4IA 1PEZA 3O6DA 1W3JA 1BXCA 5A8PA 4HIBA 1W3HA 3RXZA 3I7QA 3QM3A 3A5FA 3POHA 2X16A 2Z6JA 3BJSA 4EVZA 2VC7A 5CSUA 5TIMA 2QDHA 3U8GA 4DF1A 3OJGA 1VZWA 3LV5A 4JN7A 3MSYA 1ZENA 4XAGA 4AIEA 3UNTA 4QCEA 2VQUA 3GVWA 2JALA 5JXQA 2A7RA 2ZUTA 2I5GA 1TVPA 2V3GA 3C4UA 3V16A 2YDQA 4QQUA 3RJYA 2D2GA 2EAWA 4N9BA 1AK5A 2PGWA 3S1XA 1KM3A 5LNUA 2A3EA 1NOFA 2J25A 3THDA 3SQMA 1X96A 3STCA 2WLYA 3G5EA 4NQ1A 1FH7A 1W1A1 3P93A 4L9YA 4B90A 3CNYA 3S9IA 4IPPA 3VCRA 1TB3A 5H6HA 4WDWA 2JKPA 3RPTA 3WJXA 3UZYA 2PDBA 1RPKA 2CBVA 3UCQA 3WJYA 1W56A 4MOZA 3DENA 3MJYA 2J7HA 1BVNP 2PDXA 4HOZA 3HGRA 1UBPC 1K1DA 1GOQA 4NNCA 2GGGA 4NZ4A 3NCOA 1XLBA 5AHIA 1OHLA 1QK0A 1W8GA 2WSRA 3VVGA 4PB5A 1XIFA 4WKHA 4C91A 1LWIA 1TRIA 3EWXA 3WQ5A 2AGKA 4L1WA 5FJTA 1XKYA 1HTIA 3LBMA 3EOSA 4MYAA 1UUMA 3BG3A 3WUBA 2QUVA 4B5XA 2Y89A 4A3HA 1WDQA 4EPEC 5BROA 3AXIA 3IANA 4ZOCA 2O4QA 4B5WA 2C8NA 2POTA 3G1RA 3W23A 2ZUUA 2OMAA 1N7KA 2OO0A 1KXTA 1UWQA 3BQ6A 5GPRA 3PZNA 3VC6A 5G1MA 5LSMA 1H63A 5LNVA 3QPYA 1CGTA 2PPGA 4ZA0A 5JQ9A 4KBXA 3QHOA 4X63A 3KVJA 1A5MC 3WD4A 3JW7A 2ZC8A 3LGGA 1TJ0A 3K8LA 1ONWA 3ABZA 1TWWA 2B7NA 3EDDA 1KKOA 5DCDA 3DFYA 2ZZ3A 1LT8A 5CGTA 4LQ1A 3FA3A 4IXXA 3V35A 2PF0A 1V0LA 3ORWA 1I75A 3GTNA 4LU0A 2PCEA 1G9HA 2J9ZA 2CLFA 3TC6A 1NP0A 4ZB2A 1XLDA 3BG5A 3NG3A 1LM1A 2NWSA 2ZKMX 3N18A 4O57A 3PPCA 4B3ZA 1F4AA 1GVRA 1TJRA 4IIGA 3S2JA 3NQ8A 1GOXA 2VP8A 4RL3A 4XBKA 3S2MA 3W4RA 1ZPTA 2HK1A 2AQVA 2H90A 3EDEA 5AKQA 3UJRA 2ZADA 3AHYA 3URBA 2PA6A 4FXJA 3W00A 1P7TA 2F6XA 3C61A 4PZVA 5A3HA 5LKYA 4K1WA 5BCAA 4JYEA 3QVQA 1VFOA 3LBOA 3KX6A 4PRRA 2FGBA 1A4LA 1B3OA 3CUXA 4GQGA 4PTMA 1WP6A 4C6FA 1S2UA 2NSOA 3AXMA 1W1ZA 1TPDA 4OTKA 1E4NA 1EQCA 4D6HA 4DF2A 2NUXA 3A24A 1Y5WA 1RSCA 2TAAA 2V67A 3LCXA 4TQTA 4Z2GA 2BLEA 3GWQA 5HNTA 4OFCA 3KZSA 1ODUA 3I6TA 1JPMA 2WK2A 5DQPA 1TIWA 4LTSA 1FWJC 3AWOA 2FIQA 4JTAA 2CFFA 4GY1A 1UMYA 4JTDA 5CPMA 3G1XA 4IM4A 5MHBA 2ZX8A 1XGDA 3HPXA 1ICSA 3JU2A 3S5NA 3W2MA 1ML1A 3SDOA 2FJKA 3PAJA 5C7HA 1G6CA 2FPVA 1C9DA 4KPLA 5EBUA 5IHSA 3WQ6A 2NWRA 1SFSA 1J4EA 2R9RA 1U1HA 4A2SA 4PMUA 1XV8A 1POKA 1KWKA 4WCJA 2PF8A 4P7NA 3LG3A 1V0MA 3WLMA 5LA0A 4PBEA 1OCQA 4YXGA 1F6YA 4NILA 5I3FA 5G4EA 1B57A 1CCWB 4ZL1A 3ARXA 4MF4A 1D3HA 3MO4A 1GNXA 3HZ3A 3TJXA 3EA2A 3ES8A 5FAGA 3QZ6A 4WXZA 1LWHA 4L4MA 4HU8A 2FDSA 3O0FA 1EJWC 1KFJA 3GAKA 4L7ZA 1NF0A 5H91A 2HRWA 1FWRA 3EPMA 5RUBA 4JD4A 1UQZA 4KWVA 3WIJA 3LEPA 5CBJA 1DWHM 3REQA 3GDRA 4UTJA 5BOOA 4GMEA 1Q3NA 1HVQA 3TYBA 1A5CA 3R79A 1I2RA 4B4FA 2ZICA 5KZ6A 1PYMA 1IT8A 1EHAA 3E5PA 5I2UA 1TCMA 1WO2A 3AALA 2X0SA 2HVNA 3SJNA 5IFTA 1VEMA 4O12A 3MI3A 3FJ4A 1OFOA 1PL9A 2HNHA 3ITCA 3D3AA 3BMWA 1L8NA 5DXYA 1QDSA 3OO2A 3NEVA 1JZ4A 1FCVA 3TN6A 1E6XM 2C13A 2JKAA 4HSNA 3ZOAA 2INEA 4H6EA 5JBEA 4IFKB 5F2IA 2HMCA 4TOQA 3WEMA 3LTSA 3WBAA 4W87A 2XM2A 3BL3A 3GNRA 1R46A 4PMVA 3ES7A 3ONCA 4FNUA 3TLQA 5CC3A 4M24A 2QF7A 2F84A 4GJJA 3SCRA 4LB4A 1GHSA 2FB2A 3ARYA 1C92A 4DYEA 9XIMA 2DJXA 1ZQ5A 2XIOA 1P5BA 3S6TA 3W72A 4A3RA 3PZMA 3RJXA 2FZBA 4JEQA 4P2VA 3WNNA 1X98A 4MNMA 1QRQA 3N25A 5JUVA 4OJYA 4HTBA 2VDIA 3L68A 1TWDA 3NZPA 1EQPA 1JPKA 3CIXA 1DHKA 2WHKA 2E0PA 2VJXA 5EL1A 4EKJA 4K39A 2ADAA 5MKGA 1J0IA 2VDGA 2QJMA 3ATYA 1V02E 1KQZA 4B15A 4J40A 3O0KA 3H24A 2QGHA 4FNQA 3W01A 4A3UA 1XI3A 4KWSA 3UNDA 3RLUA 3GAYA 2R82A 3V0SA 3GR8A 5IBXC 1OB0A 4CQ8A 3RPDA 1P6CA 2QCFA 3GUWA 1FWHC 2QJNA 1V3MA 4GX8A 1CB7B 1GJPA 2RJHA 3VOFA 5BMWA 2XVGA 2WJFA 2QZRA 1FKWA 3R8GA 2WCSA 4PTNA 1AA1B 4Y90A 3TYAA 3OZOA 4W8AA 3V4BA 2YKKA 4IX2A 4IPJA 3C2FA 2Q02A 4GIAA 1YXDA 2PWGA 1E51A 2CIPA 5G4HC 3TLLA 3LXCA 3H2NA 4XSMA 4U4MA 3TE9A 1KBLA 2HXUA 1UR9A 5A8MA 3TUUA 4UR7A 3GNPA 1L2UA 5IDZA 3W75A 2JBMA 4QHRA 2DUXA 3ZJ7A 4PTDA 2BP1A 4QSFA 3MC5A 3M0JA 3NO5A 4LEFA 3TWBA 2FPTA 3NQFA 1UWRA 5FEWA 4KCUA 5LNSA 1XJBA 5D2YA 4ZFCA 4DNMA 3WDIA 3WLSA 4Y9PA 4MZ1A 3E49A 1VPYA 3GU2A 1PDZA 3M5XA 2PDKA 3KL5A 3OU8A 3EWBX 1WDPA 1ONXA 2PTZA 1S5TA 4ATDA 1GT8A 1E72M 4QAIA 1R3QA 1PZ1A 1VGAA 1W91A 1EEPA 3E9AA 3NPXA 1J5TA 1Y7VA 3GM8A 2ABAA 1Q13A 2NQHA 1O1HA 3NEHA 1HW6A 1M03A 4MJMA 3W1AA 2XFWA 5EKYA 3DKLA 4RXGA 5E6YA 1RJRA 3GBEA 1BHGA 4NRRA 3M44A 2PSNA 3KP0A 3WF0A 5GQBA 3T9PA 4QG9A 3M4HA 5HJLA 1EX5A 2O7QA 4H2CA 4M82A 1H09A 1PBGA 1E71M 2AMXA 4QLJA 3BG9A 2W63A 1W9DM 1ZJIA 3K4DA 3GRIA 1XGZA 3ITLA 4GYFA 4EACA 5E1QA 4G9PA 3NZ1A 1PKNA 4PCPA 5AC6A 4NASA 2R24A 2R91A 2A2IA 3T55A 1A3HA 3LOTA 2PAJA 4H7CA 1PXGA 5CZ0A 3WF1A 2ZRUA 3UA4A 3AIUA 2GDUA 3TXZA 3A12A 4W7UA 5CJMA 4GY7A 2ZC1A 3ZR4A 2CCRA 2BGQA 1V6YA 3EOUA 3UWZA 3I4EA 5C9RA 2ISFA 1VBHA 1A80A 1A5NC 1DJNA 3F4CA 4JAWA 4XKMA 1AZ1A 2G0WA 3GXNA 4W89A 2DIJA 2OKOA 3QBUA 4HB7A 4C6KA 4L56A 2YCLA 2R1PA 1F2JA 5DLCA 1L6GA 3G18A 5AY7A 4CNOA 4UIOA 4TVUA 3LHYA 1OCNA 3TOYA 8A3HA 3WD2A 2EGZA 4I8DA 3UYIA 3WMLA 3BGAA 1CGUA 1BRLA 4IOTA 3UJEA 2B7QA 4WSKA 3N4FA 1TQJA 3KOWA 4YCOA 3LCHA 1MEHA 2DZXA 4JTJA 3VGBA 1BLIA 1B9ZA 2X42A 4IIEA 5HUPA 5HR6A 1EFZA 2J66A 3RILA 2PUZA 5CGMA 3PZUA 4LV9A 1WAUA 2O9PA 5DMYA 4ADSA 4PUUA 2W0UA 4GXWA 1VIWA 2YA2A 4L9ZA 3SAZA 3S46A 3Q67A 3OP2A 1A49A 3NJ3A 4LJ3A 4HU3A 2WSQA 1YTEA 3CL8A 2RAGA 4ERIA 2IMRA 4NP7A 2PGRA 4OQVA 3TFXA 4TMCA 2FDMA 1ODZA 4CCCA 3ABOA 2W62A 1FCUA 1XXXA 1QNPA 4XV0A 2WVVB 1E73M 5EYWA 5KSWA 3G6MA 1E4LA 2PLJA 2Y88A 4GRSA 4GWEA 4G2DA 4L1XA 3IVSA 3AROA 3W22A 4LF2A 4B3KA 1OINA 1OVDA 3FY1A 2ZYFA 2Y8KA 5D4YA 2HE8A 1NDVA 1OGSA 1OGBA 1ZJBA 1Q6CA 4JQ4A 2XGZA 2Z1SA 1NOUA 2FZ8A 4TXEA 4AVFA 1TQXA 3BUVA 3MCOA 2J6XA 1JQVA 4EWND 4H9XA 1RY8A 1OEPA 1B0IA 1GCYA 2E6DA 4PULA 3VM7A 1TPWA 5LIKX 1HL8A 3C8NA 5FL0A 3CTTA 3CHFA 1JCMP 5GNZA 1V6UA 1MW2A 1LG2A 1FP9A 4XKYA 1KM5A 4KCVA 2Z29A 3P84A 4HMNA 3RK8A 3TP4A 2H6RA 4GA8A 1AFSA 1SFLA 1OD0A 3DIPA 3KBNA 2VNCA 4FIRA 3EX3A 3IK2A 4B91A 1AMKA 4NZCA 4NKCA 4H1ZA 3KHDA 4I90A 1KCXA 1F3WA 3RRXA 1WXZA 3QY6A 4KMQA 1UASA 4ZFMA 1SJDA 1B3VA 4QXIA 2DSZA 4H6QA 4UOJA 3GHSA 3BLOA 4WOQA 4GYKA 3DEQA 2PBOA 1ZALA 3WELA 2Q8LA 4PUEA 3NWRA 1LT7A 3HQOA 4HA0A 2ATSA 4GZJA 4I3GA 3HO8A 2R8WA 1U5HA 4GYPC 5HUOA 1CGWA 3H7UA 3PTDA 4MZYA 2H8ZA 3OG3A 1Q66A 1LRNA 3FHAA 4LF1A 3BCDA 5HATA 2E77A 3SCWA 3SGUA 3AAMA 5FSEC 5U7SA 1A5UA 4MLRA 4C7DA 3OA5A 1VFHA 4G1KA 3CPRA 3O6CA 1XIHA 1IZCA 4PL2A 4NZJA 3TXVA 4UTLA 3Q58A 5FSDC 5GNXA 2GJPA 3ARTA 1KM1A 3B04A 4MUZA 3FIGA 4O19A 3FX4A 1XPYA 2PDYA 2XGBA 7CGTA 3RCMA 1IIGA 2X1SA 4Q8PA 2GVLA 1EC9A 1KBBA 3NYZA 3DCPA 3B8TA 1BF6A 2GJRA 4R9OA 5HMDA 5FACA 4KEVA 5K9XA 4DO4A 4AVOA 1QPQA 4K38A 1TR9A 3G1VA 4JY9A 3VUPA 4M56A 2ZE0A 3JUGA 2QMKA 2EQDA 5E0CA 1Y8BA 1RA0A 2V2HA 1A5LC 3BQ5A 5A6SA 4W5ZA 4KRTA 1K8YA 1CIUA 3TYCA 4KEZA 1SGJA 1VCVA 4X22A 3VNJA 4A8LA 5C7VA 4JHZA 4FOUA 3ZJ8A 5ECUA 2DIEA 3GNXA 2FPYA 3B97A 3MP4A 5F2LA 1GGOA 3BANA 3GZ3A 2VCBA 3SO7A 2YIHA 1AD4A 1M3UA 3TONA 3FVMA 4L1GA 1A4MA 1W8SA 5EMMA 1CTNA 1FHDA 4QLLA 2VELA 1R2RA 2YFNA 2NT1A 3LHUA 1ZFJA 2HPIA 3FEMA 2CXGA 4YYCA 2EPKX 2W92A 2NQ9A 3APTA 3M43A 1XUUA 4HMEA 4M8UA 4RDVA 1P7TB 5DCEA 4EXBA 1SO5A 2J13A 3ARRA 1TYGA 4A8RA 1DOSA 1P43A 3HFYA 5FEZA 4WXYA 2ZWYA 3MUIA 4FLRA 3S5SA 1X7FA 3CAWA 2VFGA 4LY8A 2EG6A 1Y65A 4KKXA 1TMQA 3INPA 3H2AA 3S6OA 5H2ZA 4YIWA 3W1XA 3P60A 3I10A 4AD4A 3D5HA 3RIKA 1ITXA 4KT2A 2OODA 3VKAA 5ENLA 1KGXA 3CGTA 3W2UA 3PUGA 1PVNA 1Q2RA 1ME7A 4B9ZA 4C1NA 2OSXA 1SZNA 5SWUA 1GEQA 3HPSA 3MJMA 3OPSA 1QOQA 1CLVA 1MEIA 1SW7A 4ILSA 4H9YA 5BXSA 4P8UA 2WZIA 2KZHA 3WFZA 3EWUA 2X30A 2WMFA 1XLEA 1SO4A 4NI8A 3PK7A 5E9AA 1W3TA 4ZQCA 1Q4WA 3NURA 2J8GA 5FI8A 4KGJA 1O66A 4GFSA 2B7PA 1TVNA 2XSXA 2A3HA 2MUCA 3PBMA 1J18A 2DP3A 3CBWA 4O4VA 3F2BA 1HZYA 3UPMA 2WPGA 3QQ1A 4M1RA 2PI6A 3W3OA 3B9AA 3MANA 1EEXA 1PJ9A 4FF5A 4LAUA 7PTDA 5DF0A 3W73A 1NM9A 2WW5A 2VDHA 5E0FA 2VC5A 2YPIA 4IHCA 3KOZA 1FFRA 3LCWA 4YTTA 1KB3A 1DQXA 3CAVA 5C2CA 1O6IA 3I68A 4LANA 4NJIA 2CBUA 1B31A 1DQWA 1F5ZA 1RK6A 2WHLA 3LHWA 1PX8A 4L80A 1W3LA 2HVMA 3WJSA 4CN4A 1G4TA 4Q7BA 1RA5A 4S3BA 3WH9A 1E0XA 2BOFX 4WJEA 3REQB 2RHGA 2VENA 4AY8A 8RUCA 1GQKA 3FAWA 3GIYA 3VKKA 3CLWA 3BW2A 1EZ2A 1VFFA 2I9UA 3A64A 4P7LA 4LAZA 3MUXA 2E9BA 3KW3A 1JL8A 2Y7EA 1TA3A 1XLHA 1S2AA 1Q8JA 3M1ZA 2DZUA 3W7OA 1LL7A 4C1KA 1U1UA 4S2BA 1T6MA 2J7GA 1C3FA 3A3HA 4AWUA 3LCGA 3WKZA 2Z27A 1OGGA 4Q3MA 3UG5A 1UA3A 4CNUA 2QQ6A 3UXDA 2Z1WA 3JRKA 3T2QA 2F61A 5A8GA 1XYFA 1EC8A 1QHPA 4OECA 2DY3A 4Y7EA 3CWNA 4RPPA 2G3JA 3MB9A 4XZHA 1Y0EA 4H6RA 4BKNA 4PSRA 1BTCA 1BQCA 4O50A 4M3PA 3WNKA 1M7JA 3H2EA 4K68A 1J6PA 3SY5A 3N6HA 4ACZA 1MUCA 3VFCA 5LHFA 4DI9A 2QUTA 1XBZA 1BAGA 4HHHA 1BG4A 1ZP4A 4UTMA 1UWSA 2WCAA 3CPUA 2BV9A 1PZ2A 3UD6A 1OCBA 4AW7A 3I3DA 4XAPA 2WJDA 5J5RA 4IQJA 4RKAA 4ZGYA 3MV01 1E0VA 4C5ZA 1H7WA 3GZAA 4LCRA 1B4KA 3MBDA 1RQBA 1AQFA 2BASA 3MMUA 4K1GA 3QYQA 2W27A 5MKGB 3VKJA 2VR4A 4QX4A 3FHQA 4GXMA 4I6VA 4ZQRA 3G3MA 1XH2A 3LYEA 1WBHA 2ZTJA 1O60A 1RVKA 3KRZA 4J3WA 1MNSA 1OX5A 1WDDA 4F40A 5KZMA 1UR0A 1REQA 1H1YA 4W84A 3HTWA 5AN7A 1ZGDA 5C55A 3RLGA 4HA4A 1ZAIA 3D3FA 3W70A 1US2A 3IJ6A 3SCTA 4S3GA 5CC5A 4JR5A 1ZHAA 5I3KA 4PMDA 1R30A 3E1F1 5A2CA 3LCLA 3CO8A 1HN1A 3IIXA 1G4EA 3TZNA 4IIHA 3A5VA 1FX6A 5EPDA 5JBFA 4PMRA 1EJRC 1DJQA 3PBWA 2BODX 4JQ3A 5CAHA 5KTLA 2NZLA 3BO9A 4PYSA 1TE1A 2D2OA 4K8HA 2Y24A 1RK5A 1T5AA 2XIIA 1YTDA 1IXOA 3B0VC 3B9NA 3M5VA 2W9MA 1PIIA 4X9SA 1G94A 1A3WA 2NT0A 4XTDA 1W9XA 4S1FA 2A6NA 3GIPA 1JQXA 2QULA 1BD0A 3OOQA 3P0WA 4ZO8A 3LK6A 1EZWA 4K7YA 4NZFA 2BGNE 4IMCA 1G7UA 5I6SA 4OBRA 2VEMA 1UKQA 3U48A 3VTRA 4KH2A 5EMLA 4UFKA 3R5EA 1JZ6A 1ZBCA 1CB2A 1W1PA 1J0HA 4O54A 1SU5A 4IGNA 3KDOA 4JZ5A 1CXEA 4M7SA 1NDYA 4FK9A 4I9JA 4WZHA 4XWUA 4M51A 3TQVA 2QV4A 3VGGA 1U2YA 2JIWA 1ME9A 4X3ZA 2ZRZA 1EA0A 1SFJA 1PDYA 4H8VA 3BARA 5C71A 3G0XA 2VRQA 2QPUA 3T0BA 3N2BA 3QRHA 4XZNX 2VKZG 3WNOA 5B80A 3B9EA 2FVMA 1XYAA 3BTNA 3GHRA 4REQA 1SVDA 3DC0A 3MZ2A 3GTFA 3LNMA 1X38A 1HUVA 2ZVIA 3C56A 3P80A 1FHLA 1BG9A 2J88A 3QTGA 1UOKA 3SIZA 2PRMA 3VD5A 1LDCA 1KBJA 3H8AA 4KWWA 1NP2A 1W1TA 4R7OA 4LAKA 4JXCA 2PODA 1OFPA 4YN5A 2E67A 1G01A 1QFEA 1GQNA 1UG6A 1W9PA 4JTLA 4BR1A 2RDXA 1DBTA 2PZNA 2HK0A 1TO3A 2TMDA 3VGDA 1ITQA 5TD4A 3QR3A 4L6OA 4NAFA 5F7UA 3CZGA 4Q4SA 7A3HA 5HA7A 1W3KA 4GH3A 2HNEA 4GIYA 4Z1DA 2C91A 3UZ5A 1GKRA 4NSBA 4UTKA 1MWOA 3AC0A 1AJZA 2Y8VA 3GSMA 5IXEA 1GG1A 3T7VA 3IJ9A 5AECA 3TR9A 5AYYA 1E70M 4D1JA 3C86A 5DMLA 2YCLB 4QJ1A 1KO0A 4CLMA 4U10A 5HWMA 1QU4A 3V5FA 5C54A 3BZGA 1NWRA 2CBIA 1OZMA 3OA3A 1X1OA 3XIMA 4XBSA 5I77A 2VUYA 4PTVA 4P7OA 1BRLB 4I9AA 1SYTA 2GGJA 3RNDA 1WZAA 2WLZA 1J0ZA 2QUMA 5M17A 1D7KA 2NXHA 2NV2A 2B31A 5CLTA 2YL8A 5CC7A 1AH0A 3ZWTA 5G5IA 4H4IA 3IPWA 1PUDA 4V1XA 3APGA 4LBSA 5HWJA 1RCQA 4IWWA 2Q71A 3FV9A 3VZXA 5D03A 3WQEA 2X05A 1SW0A 3ZXWA 4EP8C 3N34A 4YVXA 4UMAA 3PTQA 5IRPA 4L4PA 1TJPA 1K8XA 4BF7A 4K2SA 4AMCA 2CZEA 3R12A 2J8TA 4BQ5A 4PUNA 2E3ZA 1KCKA 3CZJA 3W85A 4ENLA 3AICA 5I7GA 2FMNA 1W9VA 2OSYA 3CQ0A 2OQYA 1XLCA 3QY8A 3H54A 1R9ZA 1FXQA 4XZWA 2FZDA 3BPWA 4OBSA 3TYEA 3TDFA 5F4XA 3W9ZA 3N9RA 5HR7A 1VFTA 2NLIA 2V5LA 4YYFA 3EEGA 1H0IA 1ZJAA 3LZ3A 2UY5A 1WDRA 4I9TA 1OIFA 1PHQA 2OQLA 4I5XA 1QJWA 4LNYA 3AXXA 3SIMA 4DBSA 3IJ7A 2BX7A 3EB3A 2A3BA 1I45A 3F5KA 3G3DA 1TREA 3VZYA 1J0YA 3EWCA 4XKYB 5I03A 3K1GA 4AZHA 4C6BA 1LL6A 3LM3A 3ZS4A 1K7EA 1KV5A 3G22A 4W85A 4R33A 1MZRA 3CEPA 2QCGA 2HS8A 3WK1A 4DI8A 1DQUA 2H3DA 3WK2A 1K02A 4D9PA 1AQHA 4QFUA 4CGTA 3A4WA 3VGFA 4FB7A 1JCLA 3TN4A 5FJPA 3RGTA 4Z1AA 4DM1A 1I0BA 3OYZA 1JNDA 3WG6A 3B9OA 3DESA 3QR1A 1UBSA 1W3IA 1F6KA 4YVVA 1AL7A 5BYWA 5E9XA 1VH7A 3FXGA 2XFYA 1YBQA 3N2TA 2QAPA 2Y2WA 3QGKC 2GK1A 4QS6A 3ME3A 3BSHA 4I7VA 4A05A 4DHGA 1PX3A 1SJAA 2FTPA 4FIQA 1IYXA 3PF3A 3LXBA 1WZLA 3BXWA 2OEJA 3PY2A 3E0FA 1S38A 7ODCA 4GQRA 5A6BA 5FOOA 3R7MA 1L6SA 3NNTA 3ZJKA 3EWDA 3W7GA 2ZRYA 3UERA 3AZTA 3QKZA 4WKFA 3L67A 4RE0A 3IJDA 3DG7A 1A47A 2HV5A 4D6EA 1E6RA 4J3UA 5CLWA 3UETA 2XN0A 1W0MA 2WZMA 3E2VA 4ERAA 4IZGA 4BCEA 3U2CA 1DEDA 3NAVA 4IMFA 2BFGA 4WUIA 1EH9A 3E0IA 1J11A 2DSUA 2F7FA 2NVDA 2ABBA 3MY9A 1TPEA 2QJJA 1KLYA 2FTYA 3UY8A 1OZQA 2PCQA 5T9CE 1ZAJA 2HCVA 1KR1A 3BLEA 3H4WA 3QV7A 4BWLC 5M3WA 3ANVA 3VGEA 2EJ1A 4DXVA 3QZAA 1P0BA 2A0NA 4NX0A 3QKEA 1V3IA 1R9XA 2EHHA 1MW1A 2E1WA 3SB0A 3II1A 2D23A 3FFSA 2D2JA 3GR7A 4TVDA 1SR9A 2BB0A 4KESA 2CHOA 1IEXA 3MUY1 4B5NA 3ZLFA 3AIBA 1JAEA 4MNJA 4N7QA 1GHRA 5EA9A 4FALA 4F0RA 4R5EA 2GQ9A 1IZKA 3ARVA 3EWZA 2V3FA 5BRPA 3IUDA 4MFEA 3T42A 2A7PA 1VFUA 3UGRA 2GDVA 5LA2A 1KBKA 3MDWA 1F7BA 4I6KA 1YNQA 4Q7IA 2PDLA 2WZHA 3K1DA 1GG0A 3WLLA 4MB4A 2ZUWA 1X8FA 4AEOA 4RDWA 4DO5A 3WO8A 4ZE4A 4MSSA 2INZA 2GGHA 1GQLA 1V3JA 4PB3A 1EJXC 1JDDA 3WQOA 1MUMA 3CU2A 4GISA 3QMTA 1MZHA 3MSGA 4XZIA 3U0HA 5CKSA 1OQFA 2QCHA 3BZJA 1EGMA 1S3TC 4UFIA 1YTKA 2YXGA 4E2VA 3GU9A 1Q6LA 3Q45A 4AC1X 3VD7A 4Z1YA 5HPOA 1XR2A 3G0SA 3UGVA 2QNEA 3J7HA 2AQOA 2EPNA 3E02A 1XLFA 4W8BA 4UTFA 2Y4SA 4F0HA 3TZFA 2QAFA 1CENA 5D37A 3VO0A 3I65A 1J79A 4I7WA 1VF8A 5JH1A 3P8IA 4ASTA 3UZWA 1NSJA 2ISSA 2GUYA 2C0HA 5DT7A 3PZGA 4GUIA 1ME8A 1NFBA 1EJ7L 3GG1A 1LQAA 5H8MA 1GOKA 4JHMA 4GGBA 3VFLA 4D6JA 5DX7A 1LCOA 2YFOA 3VNYA 5JIWA 3UVIA 3VDGA 3BLLA 4H7VA 5KETA 3QLDA 4FR6A 1XS2A 2E1DA 2P53A 1BQGA 3WYZA 4NYYA 2Z26A 3OBEA 3ARPA 2CPUA 3YPIA 3U2ZA 3NTYA 2P0IA 4RXFA 2CXEA 1HFBA 5I00A 1DXIA 4TX8A 3LRKA 3U5UA 3UP8A 4ECLA 1XDLA 4LBRA 5LXEA 1W37A 3U7BA 1JPHA 1S2TA 5ABFA 3NL6A 1BPLB 3TIMA 4X61A 4OU1A 3HPFA 1PCWA 2QVNA 5HQLA 1QNQA 1V77A 3CJPA 4GQ0A 2WANA 4CKQA 4P8WA 4OKDA 3WH8A 3CB3A 4KFPA 1GJUA 4C90A 2OGJA 4H9TA 4ZODA 1HQTA 1ZLPA 4ZO9A 1VLWA 2E9LA 1VYPX 5A6BD 2AAAA 4NJHA 3TCEA 3FCPA 4FP1A 4AEFA 2E5CA 4H7ZA 3Q37A 3E0VA 4D6IA 4QEEA 5LGZA 3EDJA 1I4NA 5K7JA 3PBYA 4PSPA 3EKZA 4H8HA 2X7WA 2D73A 4N9EA 3VMOA 2W6RA 1E4MM 4UFMA 3MKCA 4BS0A 4UCFA 1JCJA 2BY3A 8XIAA 3OBAA 2OYLA 1XLAA 3W76A 3V3WA 5B7ZA 1AW2A 5F2GA 2X7VA 3GIQA 3IK4A 4WY0B 2HS6A 5I24A 3UG4A 2I5IA 3IAQA 1X39A 1TA3B 1QW7A 2EPMX 1TWZA 1D8CA 4QQ3A 2ZUSA 4Q4OA 1OT1A 1JCNA 3WUFA 3G77A 4OV4A 2E28A 1Q7QA 4U2ZA 3W7DA 4QDMA 3FN9A 3U57A 3GFYA 3AXHA 3VIOA 2CLLA 5M2FX 2XWDA 1E56A 4LFYA 4JKKA 4BWLA 3GH5A 1EGZA 2IKGA 2YCEA 1XRSA 4C5YA 3O6AA 3BVJA 1A0EA 4WDXA 2C6QA 1XIEA 4G5DA 3N1AA 4Q4KA 2ICSA 4DJFC 1M01A 3M16A 4JQ1A 2Z2UA 3S47A 3LTYA 3L5LA 4ACZB 4LCQA 2W4XA 3RM8A 3T40A 3AZRA 1ZCOA 1KXHA 4AIOA 4QNEA 1A0CA 1RQHA 3T8QA 1MXGA 3QSTA 3LU2A 1DIDA 2P8BA 4KEUA 4UFJA 4BQ4A 2PURA 5AYXA 3OGVA 1GQJA 2Z00A 1ZZMA 4IJBA 2WHMA 4NX5A 2X8RA 4DAFA 1AH3A 4PUWA 1P6WA 2VWSA 1HGYA 3QF0A 4UOZA 3SJ3A 2BDQA 2PDUA 3ALGA 2GQ3A 3MU7A 3A4JA 2WC3A 3ICJA 4G7FA 4HK6A 3NUKA 4DB7A 3TOPA 1REQB 3EB4A 3M0XA 2GZXA 3ANYA 4O8RA 3FKKA 4PL1A 4W5UA 3IWPA 4HHPA 4DF0A 1HNYA 3KBMA 1PB0A 4PMYA 3AS2A 4ORIA 3VMNA 3ELFA 1T8XA 5C70A 1EC7A 3PG9A 2HZGA 3HM7A 1C29A 1M7OA 3VX1A 2VZSA 3G6LA 2WXDM 4ZSTA 2J9XA 3MTWA 4AIBA 1NFGA 1RAKA 2DDXA 4PCTA 5C9ZA 3AMDA 1FA2A 4RDZA 4Z0SA 2PEVA 4AIUA 1MO0A 5DBUA 2HE5A 4MAZA 1HX0A 2V5DA 1B54A 8CGTA 1UR3M 2DZBA 1U30A 3FNDA 3T0CA 4GZEA 6PTDA 2A1YA 1I2NA 1EXPA 3T81A 3AO0A 3LX9A 4Y96A 1FUYA 2W3ZA 1QCWA 2TYSA 3CK5A 5CG7A 4ZENA 5IM51 3ZT5A 5CPTA 3LPOA 1M5WA 3BOLA 3ID7A 3HQNA 3OHIA 1MI3A 2SFPA 3EOEA 1CX9A 1R3VA 4WY0F 1KC7A 3W1LA 4PN2A 1UKOA 3PG8A 1TV7A 3LNPA 2V9DA 3M07A 1YXYA 3C52A 4AZCA 4X60A 3FXYA 1LF1A 2FH6A 1H5VA 1FFQA 4LNCA 4REQB 3PJUA 4B92A 5CPQA 3W26A 2CLMA 4DZIA 1YE4A 3SRDA 3LLXA 1UP0A 3ITTA 1FWDC 3WDJA 3OVPA 4F2UA 3UT0A 4OUEA 2W66A 4CEXC 3BJTA 4HNUA 3KVKA 2DZSA 3QR0A 3AJ7A 4R88A 1RR2A 4GI8A 4YTUA 1C8XA 2ZZ4A 2NQJA 5IFPA 4HZMA 3SFKA 2VCCA 3BE7A 3VC5A 3BAKA 1MSSA 5TNVA 3SCVA 3GVVA 1BKHA 3GS6A 2O7SA 3GNDA 4PE8A 1QO2A 3WD3A 2REQA 4U3CA 2Z25A 4RW5A 1RJQA 1X7IA 5BNKA 4LYPA 1E15A 4C60A 4DN1A 1UCWA 4NAFB 4JPGA 2DT3A 2IPJA 2GSHA 3LDVA 2GVJA 3GHTA 3AFBA 4FX8A 1A3XA 2FFIA 4NG3A 4J9JA 4KCWA 4YMZA 4Q8TA 5HNNA 1ENUA 4W9TA 1UD2A 1HJXA 3MVIA 2FH8A 1E9IA 3U4FA 4M6VA 2QJGA 3CAKA 4PA8A 1AG1O 1W1YA 4DJFA 3A13A 4M6UA 2DUZA 3CPGA 3SZ8A 3F5JA 1GW9A 4HSHA 4LUIA 3BLPX 4LVAA 4GKTA 3TA6A 4QJ5B 4DPPA 3C3NA 3BW4A 3DYOA 4NY2A 4PBFA 4L4OA 2GL5A 3PZQA 1AJ2A 1VJSA 3NGFA 4AISA 4S3JA 3VDAA 2PDHA 4V15A 3WD0A 3TN3A 1EOKA 2QJHA 4AZIA 5KINA 4UNIA 3P3BA 4DPQA 3IARA 1C9WA 5LHEA 3SY8A 4FS9A 1HKJA 2PC8A 2NVCA 3KRUA 5HNUA 1WOAA 1VENA 2OWXA 3H23A 2DIKA 2G4FA 1RP8A 3CZKA 4HGXA 1P4CA 2Y62A 3C6CA 4BQ3A 1F3XA 3JR2A 3B40A 4IH3A 1GJWA 1U22A 1CECA 3GQYA 1GYNA 3UG3A 3FGCB 2OO6A 3LCIA 2ASHA 1VQTA 1R87A 1JFXA 4JX5A 2WV8A 2Q01A 5F4SA 4C6IA 4Y8EA 3SRHA 1Z69A 4O18A 1BWKA 1J93A 4YTRA 2OZ0A 2XSBA 3H2FA 5BXTA 4KQNA 1ZNNA 3SEPA 3BWWA 4N4PA 3GX9A 4AWEA 1VFMA 3W7CA 4IUGA 4C7GA 1MQPA 1ECQA 2G3FA 4UQBA 3SFWA 3LI1A 1JYVA 3L4TA 1BFNA 4PBGA 4C6DA 1POJA 2XIBA 1SSGA 3GY1A 4IP7A 1RVGA 3ARWA 3UEQA 4MPQA 4N4QA 3S1WA 1B30A 1QNOA 3W1PA 1ZU8A 5REQA 2VGFA 1OFEA 1FTXA 3LA4A 3N3MA 1RV8A 4JTSA 1O5RA 1E1CA 2V5JA 2VGIA 3HB9A 3WNPA 2A6LA 3KRSA 4N9DA 4RDYA 3RLVA 3FYOA 3B4UA 4Q6JA 4ZTXA 2XH7A 2EO7A 4H83A 1CI1A 2PRHA 2ZX9A 3L2IA 4W93A 1W5OA 4NZ1A 2WMKA 3VIJA 3DFSA 3LHZA 3B8IA 5HXMA 1YBQB 3WQFA 3EWYA 4C6QA 3ABQA 4AZ7A 2ZXBA 4N0RA 1WNOA 4PEEA 3OZYA 3DGRA 1ADOA 2CYGA 2ZZ1A 1KGUA 3W88A 1EJTC 1B9BA 4J4KA 4QM1A 4QGCA 1TELA 2OJPA 3SUWA 1EJVC 3STGA 4UUIA 1WV2A 4QR6A 1TCDA 1LLOA 3UR8A 5CCZA 3P61A 5HK4A 4JFTA 4W86A 4LVBA 3M9YA 1A0DA 1IEIA 1XG3A 2A85A 1M7PA 1PTDA 4FHAA 1BSIA 3V7PA 1CBGA 1HJWA 1R3TA 4IFOA 1XBVA 3GDTA 3M41A 1Y5XA 3LQGA 1EDTA 1VRXA 3WEOA 3GXDA 4DBUA 2J7EA 2A21A 1HT6A 3SQLA 4C6LA 4MTVA 5AHLA 2A3LA 4TX6A 5T91A 3K46A 5E70A 7ENLA 4QE5A 1H3GA 3THQA 2WSKA 2GVEA 4GX9A 4O28A 4DELA 3L23A 2GJNA 3VNKA 1ISXA 3WQPA 2KAUC 1GK8A 1M7XA 3CASA 2Z24A 1J9YA 4Q6XA 1VFLA 1LLWA 4B3LA 2WM0A 3KWSA 3KVMA 3W24A 3TTEA 4DJFD 1GPFA 1I9CB 1W6TA 3WBEA 3RCYA 5HQEA 2CLPA 3F7JA 1V8EA 1FWGC 4DWDA 4ZXLA 3NQCA 9XIAA 3S2LA 3N4EA 1HXJA 2YR1A 3R8RA 1KV8A 4J5NA 1QI0A 1ISWA 8TIMA 1MRQA 2OCZA 4JNZA 4HYVA 4E8GA 1IT0A 4S3KA 4CN1A 4PMQA 3AWNA 3MUCA 1UR2A 5T9BG 1OYBA 1KRMA 3R13A 3FSUA 5EMYA 5FJUA 3ITGA 4RPQA 4AEEA 4MZ8A 3MS8A 2XIQA 4F3HA 2PZ0A 1O5KA 2OT0A 3EDFA 1MXSA 4H9ZA 3ZFHA 4A3YA 1SJCA 2CC0A 3CWHA 4H01A 3PBUA 4AYSA 2ISDA 5AOUA 4ZBCA 3W1TA 3C2VA 2OSWA 3ARZA 4Z2JA 4FOJA 1V3LA 2IKJA 3S5YA 4K37A 2ZCGA 2FLIA 1B3YA 4HCHA 4O4WA 3MDUA 3MT1A 2P50A 4O10A 1OF8A 2HDJA 3CHEA 4MKVA 4RX0A 3JZEA 3SSZA 3W53A 2PWHA 2GOKA 4NVTA 3EOOA 1DTNA 1DJGA 4J3XA 4WKAA 2PTDA 5CZJA 2Z28A 1LORA 3NOEA 5HMFA 1Z44A 1UIPA 4LC8A 4NZ5A 3LGEA 3W1QA 1OX4B 1IR1A 2VGGA 5FCZA 3VKDA 1WCGA 5CGQA 3ZMRA 2VEKA 1ADSA 2YCJA 4IT1A 4RE3A 3QQWA 5G2IA 4B5SA 1K6WA 1CGYA 4W4QA 3UF9A 3BLKA 4CD7A 3W37A 2I9EA 3VDCA 4GUGA 2OYMA 3PSVA 4HN8A 3UR2A 3M0MA 1QW8A 1YXCA 3SCQA 2I17A 3W02A 1IQ8A 4G6CA 4XZBA 3KBJA 1JUBA 4LYRA 3GDKA 1E5NA 3TAOA 4WDUA 2F38A 2I1OA 2VD8A 4DLFA 2AQWA 2BXYA 2P1FA 4GK8A 1CDGA 1Z89A 1H2JA 2YW4A 5ABFB 3Q2DA 3AHZA 4LH8A 3F1QA 4OIFA 3TKFA 3KBSA 4GVIA 4OZOA 3PHAA 1JUKA 5TF0A 4PC8A 1ZY9A 2ZZ2A 1O4UA 2F6UA 3FJNA 3OGSA 3F2CA 4Y9OA 3QOMA 3UESA 5EMJA 4U3AA 5HQMA 1K9EA 1RBOB 3CYJA 1UWAA 2GOUA 2CERA 4Q4PA 3S0CA 4UTTA 1ISZA 1OY0A 2DV0A 4U33A 3EAUA 3AUJA 4M19A 2GSJA 3DH7A 4A35A 1YKWA 3OVRA 5DO8A 4UXDA 4WVXA 2QCMA 4Z2LA 2OWWA 2IQ0A 3NL2A 4UQDA 4XAYA 1BSLA 2XVKA 1JYNA 1A5OC 4HNLA 1OK6A 3PTMA 3W1NA 3VU2A 2VRJA 4I5RA 5E5CA 2QIIA 1WKDA 1XBXA 2XWEA 1KGWA 1FOBA 1UC4A 3W27A 1E4IA 4F0LA 4LV4A 4JTHA 3PSWA 1GVSA 4GVFA 4IX0A 1K9DA 1RJPA 4XO7A 5FAJA 4E5TA 4HPXA 3E2RA 1XBYA 4YL2A 1JPDX 2QR6A 4O8AA 2FYMA 1PWMA 2EXOA 1D2KA 2V2DA 2Q8ZA 3V0TA 1LYXA 3VCCA 2YGYA 4HNCA 3KBVA 1XPGA 3PFRA 4AZGA 4DYJA 4JTKA 3ZT6A 2IPWA 4AMAA 3WNLA 1YDNA 1XC6A 3W83A 3EMCA 4NZ3A 1E0WA 1CXIA 2V81A 1UH4A 1Q6FA 4XUGA 2R94A 3NSMA 3WLQA 1B3ZA 4FO4A 2G3IA 4B16A 2C3ZA 4BI7A 3T78A 3WDHA 3NQMA 5FJIA 2HBVA 2XINA 3UA3A 2Y70A 2DORA 2PTXA 3SCSA 4DM2A 1LOSA 4IP5A 3MKKA 3WQVA 2L5HA 4AXNA 4Z1CA 1EP3A 3VABA 3S3GA 3QC3A 2GLKA 2Z1VA 1EO5A 4P61A 2PWFA 1B3WA 1V0KA 3CAQA 3QV6A 4AG0A 1LBMA 2W61A 5D32A 3EKLA 5G4WA 3T2PA 3RO8A 4AY1A 3H26A 4JFSA 2X40A 3U2OA 2PD5A 1EYWA 2NQ5A 6REQA 2PDPA 4O1BA 3ZR5A 2XPKA 3G2GA 2IPGA 4LUTA 3JZUA 5D2WA 1X6LA 1JGIA 2Y61A 3V18A 1XL9A 4GIEA 2BSLA 3ITOA 3TNOA 2X0YA 1XP3A 2QLYA 3UCDA 4K8EA 4S39A 4XQ6A 1K8ZA 3B8DA 1GTEA 4Q4RA 5E6ZA 1G5AA 2X09A 1JF6A 3BGJA 3NQ7A 3PZTA 1MRAA 1NDZA 3F4DA 4AHOA 4Y2WA 1I1WA 1S5MA 4URIA 1V03A 4AB4A 5LIXX 2DSKA 2D0HA 3A47A 3CB8A 4U28A 3W7NA 2WM1A 2A4AA 1DPMA 4ERGA 4PGLA 4Q22A 3G0UA 3WMSA 1GWJA 3LSBA 1OC7A 1K7FA 3SADA 4PR4A 4HNNA 3W2NA 2WJZA 4NAEA 4E0CA 2XM1A 2XJ7A 4MVAA 4ZZ9A 5C2XA 3DZ1A 2ZZ7A 1RALA 1XUZA 5F1VA 3ZIZA 3EMZA 3MI6A 3MYPA 5HJXA 1WB0A 3LN3A 3A6OA 4POCA 4C65A 2JK2A 1J0JA 2IW0A 2PU0A 5AFDA 3VD4A 3OGRA 1L9WA 1ALDA 1DJXA 1TFVA 3AMCA 4AZCB 1RP9A 2WBGA 3TSBA 5TBOA 3UWEA 1UUQA 5A94A 3UBPC 3HFTA 1UROA 2VX4A 1LOQA 2QEZA 1HKVA 2ATMA 4RK8A 5C8BB 4INFA 2DQXA 5JVLA 2CLEA 3OZPA 4WLCA 2GYIA 2PLKA 1AH4A 4L9XA 5I09A 2E4TA 2ISWA 4ZQOA 2D24A 2V69A 2YDSA 5EMKA 3PR2A 5A6TC 3HU7A 2NX3A 1BYBA 1KTNA 5GNYA 2PDGA 4A3QA 4HP5A 3O06A 1L6WA 2DW6A 4PB4A 1XYZA 2GFTA 4ML4A 3M5ZA 3ZO9A 4JL1A 3NGJA 4OOUA 4AD0A 3CLMA 1V5XA 3IVUA 3N15A 3N14A 3HGSA 1OSEA 4XX6A 4AY7A 4WGXA 2UZ9A 3HOJA 4H00A 2WVSA 3PJXA 1H51A 1H1ZA 1F74A 4TVCA 2EPOA 2REQB 3VAVA 2GGEA 4E8CA 1WE5A 3OBKA 2OYKA 1PCKA 1PPIA 3L21A 3L9CA 4LUJA 4ROPA 1ITUA 3VIFA 3O8AA 3A3XA 2D69A 2ON3A 3A23A 1JNEA 1K6AA 2ZZ5A 3TTSA 2X1IA 3EPNA 4JX4A 3UJSA 1GVEA 3P5ZA 3VOHA 4MJ4A 2J27A 1XLKA 2YB4A 3BMXA 5HANA 4QJ4B 3CQJA 4CN6A 2C1IA 4F0MA 1DVJA 5D8WA 1I0DA 4GUJA 1US0A 3DHFA 4M0XA 4PMZA 4E8DA 2VX5A 2V5KA 3K4WA 4CQ9A 4FXRA 4CQCA 3PWAA 2E5DA 3IAPA 3E0LA 1WDSA 5JBDA 2CLIA 3OG2A 3MSRA 4MAVA 3WJZA 3TJLA 3DXIA 1EOMA 3SRFA 4BF9A 1V7YA 3NL3A 3W7IA 1XQLA 2F2KA 2DZVA 4TTUA 3W07A 4W88A 1A5BA 4I8YA 1MW3A 2AMGA 2XDFA 4C6NA 3QHMA 1Q5MA 2E9MA 4MKSA 3VI2A 1F76A 4BI6A 3OEXA 1JAKA 3CZEA 3W29A 4KEMA 3KL3A 2BOEX 2BVYA 4CCZA 3KUMA 3V0UA 4XZLX 1BXNA 3P2VA 4WJXA 4FX7A 4ADTA 3KTSA 4LVDA 2WNZA 4KFNA 4U2YA 4WRHA 4QRNA 4PCSA 2Q3OA 3LS9A 4UMCA 1EJUC 3AUOA 1E1EA 2RFGA 2QCNA 3GC5A 1Y5VA 4AF0A 3FS2A 3RM4A 4KRUA 2C16A 4LBUA 1GVQA 5U4NA 3S9ZA 4LT9A 4JYFA 4FOKA 2QUUA 3P14A 4O1EA 1PIGA 1V6XA 4IP4A 3VDBA 1P0NA 1UWTA 6ENLA 4UTWC 4A22A 4NJKA 1P1XA 5FJOA 4DYKA 3T0DA 1QI2A 2CLHA 4C6EA 2VUNA 4N6EA 2Y0FA 2NQLA 3R25A 4EAYA 1JXKA 2YLAA 2HPMA 5LA1A 1E3ZA 3K5XA 1JD7A 1MFVA 3LMYA 1DV7A 1H60A 3RYSA 4Z2HA 3WLJA 1YW1A 5BWAA 4HK7A 1T41A 1EPXA 5REQB 3EX2A 2QCLA 1ZUAX 3QYSA 1JZ2A 2BXVA 3OTRA 3K2GA 3WN6A 2V68A 3TMQA 3CMJA 1KWGA 1E1CB 1VBJA 2QCDB 4N2YA 4H6KA 3S4TA 1E6ZA 1RXOB 3TYZA 4FNPA 3KS6A 1LJYA 3N2MA 3O1NA 1YX1A 2X0HA 2HXTA 3C5QA 1S1RA 1BVZA 4MLJA 4WK9A 5I3IA 3S1GA 4GZIA 1RCXB 2JF6A 4AD2A 3PBGA 4IG2A 4LS2A 1VHNA 3MHGA 3R58A 2YSWA 1FWWA 5LGXA 1EDQA 3TX9A 1CWYA 2ANUA 3PB0A 4JKMA 1FY6A 5DANA 1ZAHA 2DQWA 3HGJA 2DVUA 4MG4A 1DJWA 2AL2A 3GFZA 1ESWA 5MF5A 3FK4A 1FWEC 3O15A 3A9IA 3TN5A 3WBWA 1KM2A 4IIFA 3WSUA 2PWDA 2YYTA 3EYPA 1GW1A 5FF4A 3HMCA 2Z1XA 1D7FA 4A8NA 4XG1A 2JF7A 2INFA 3AISA 2Z1KA 1K4HA 1K9FA 2FVLA 5AHEA 4G7EA 4XTIA 1IXNA 2VFHA 3CZLA 4P8XA 1H7OA 1T8QA 3KP1A 3KAOA 4GNVA 4ATWA 4NYUA 3WZ0E 4HA3A 1VCGA 4AU0A 1IE7C 2ZE3A 4MGGA 4WQ6A 4X0VA 1J12A 5BXRA 4ZR8A 1DWAM 1QAPA 3H7VA 3FJ6A 1QI5A 1J2WA 1R38A 2VO5A 3UU0A 4XZ9A 1HJSA 1FRBA 4OGZA 1I60A 2QGYA 1YDYA 2WZTA 1PKMA 1TTPA 4PCNA 4MHBA 4GJIA 3HQPA 1V6VA 3XINA 3P67A 3AYSA 1KFWA 3FOKA 2VL4A 1QWKA 4Y6GA 3QY7A 5DMMA 3AYRA 2F6KA 2TPSA 3W7KA 3T07A 3TW6A 3DFQA 4AWTA 1AL8A 2DU2A 2Y85A 3QMSA 5HNRA 1TPC1 1DJIA 1NIUA 4NHVA 2EKGA 4KERA 3WMCA 3O7UA 1VIZA 3QEZA 1HL9A 4B4HA 3SCNA 4TIMA 2DZAA 1G4SA 3NQ6A 2JQXA 4Q8NA 1XGEA 1Q6QA 3DHUA 3VGHA 3WK3A 1KBIA 1HP5A 3V75A 2RUSA 4M29A 4ZXOA 1KFLA 2FGZA 3PPHA 4V27A 1AUSL 3D46A 3HV9A 5BOEA 4WF7A 4MFDA 2ZA1A 4GHRA 1NOWA 5BW6A 1ISVA 4S38A 3ZJ6A 4JIIX 4L6DA 2O9TA 1QW9A 1UPMB 3AHXA 1XX1A 1UJPA 4C1LA 2PP0A 3MP5A 2F8QA 4M80A 3STFA 2BY2A 3FDGA 2XZ7A 3Q65A 3WQWA 1MQRA 5F2MA 4D72A 1R2SA 5I3HA 1XSKA 1E6NA 4A21A 4H04A 1EO7A 1FH8A 3ABXA 1TTQA 3LERA 4JTUA 4UZSA 3M47A 3AU2A 4A6GA 1FDZA 4U5KA 3DBNA 4F0SA 1ONRA 2GQ8A 3P81A 2WAGA 2I14A 3GXTA 2G8ZA 2IQTA 1S2WA 1SZEA 1LTDA 3W1RA 1OWQA 3DBPA 3AS0A 3CT2A 5H8PA 1M6JA 4EE9A 2WYSA 2VURA 5HMSA 4UTWA 3WDPP 2NVAA 3G1FA 4J2MA 2V82A 5EFFA 2J79A 2ZWZA 1WXYA 3GLCA 4Z2IA 2QKFA 3E2QA 3W38A 3CMGA 1E55A 4NJJA 3S5OA 4IGHA 1J2BA 1W5MA 1QPNA 3UW6A 4UTIA 4DBDA 2PDJA 3NZQA 3NO3A 1TV5A 3SECA 1YRRA 3LY0A 3H4GA 1EX1A 2GJXA 3T0TA 5LNRA 2C79A 2A7NA 5BMXA 5C9XA 4B9YA 1VEOA 2IXUA 1U83A 6TIMA 3F4NA 4HOXA 2XN1A 1E6SM 1ONEA 5GJPA 4FNTA 5JMUA 1R0MA 1OG6A 3KRBA 4KFOA 4LB3A 4S3EA 4CCEA 1AODA 4GO9A 4HPHA 2OELA 4AZBA 1V79A 1Q4NX 4GYJA 3R2GA 1R7AA 1S2CA 3N12A 2QHAA 4JTCA 1PWLA 3N3TA 3K4AA 4Y9NA 1Z9AA 2X1UA 1TG7A 3DECA 1OD8A 3NFUA 1IEVA 4JN6A 5CG0A 3NDYA 1Z8AA 1VEPA 3WQDA 2XFFA 3UXLA 5XINA 1QNVA 4D6CA 2VC9A 1TZ9A 1XCFA 4YCPA 4JCMA 2WVTA 3SR7A 4LSBA 2OZTA 2WZEA 5TQLA 4DO6A 2ACSA 4L65A 3U4AA 2OX1A 5ABGA 1KTCA 4Q8OA 4HVXA 5C9UA 5EBAA 2OEKA 3FAXA 4NJGA 4MWAA 3VDHA 5CC6A 3IIVA 3GC4A 1QMLA 1K7XA 1L2QA 3GTHA 5AYIA 1F3EA 2BHYA 3GG0A 1GKQA 2PTWA 1BGAA 4O0KA 3R8HA 1ZSXA 3U3HA 4XD5A 2IPFA 1S5NA 3URAA 4FLSA 1OFRA 1UPPA 4H19A 4QROA 3WQ4A 1S1PA 2NV1A 2HEJA 1M41A 1UR1A 5DBTA 3R89A 3B9DA 1WXJA 4XK2A 1HL2A 4Z17A 2G5WA 3EBVA 3W81A 1XLJA 4JTQA 3NO1A 5AVHA 1I2OA 4AHQA 4XD6A 1H4PA 5CZTA 5G2WA 2DH2A 3ONBA 1G1YA 3MO7A 3RN6A 5KMYA 1N2VA 4DIAA 1JI1A 1SUXA 3KS5A 1PO9A 2QDGA 3NQDA 2YW3A 3QJAA 2ACQA 3VIIA 5J5DA 1TPVA 3HF3A 2DEPA 4GC3A 4O11A 4DZ5A 3O16A 4GCAA 4RZBA 1E43A 4X2PA 3CM4A 1XFCA 4DNHA 2W91A 3B0UX 3M7WA 1JZ8A 2J75A 2Z2AA 4Y9MA 1JYXA 2X1RA 5BZAA 1QATA 1XSJA 4LCSA 4EIVA 4UB9A 2VVSA 1AZ2A 4IMDA 3EA3A 3T4CA 1RD5A 5E93A 3MSDA 3N2OA 4XO6A 2IQDA 3FW6A 3GKAA 4B5TA 2RGMA 4LS1A 4ONVA 2FTWA 1S5VA 5DRIA 1HGWA 2V5CA 1TPFA 1P0KA 2J7DA 5FD0A 5FF2A 4Q8VA 5A6AA 3TSMA 3LGDA 2OOGA 1V08A 1P48A 3WFLA 3N73A 1HJQA 1H1NA 2HQAA 6REQB 3M0IA 3S83A 1GYMA 3N13A 4LUTB 2V5BA 3NVTA 2IUZA 1TMHA 5I79A 1G4PA 3E2SA 3VD3A 1N8WA 1K03A 4RNIA 2NQZA 1RH9A 1XDMA 4JFVA 3ZQ9A 2J8FA 4ZOAA 2VOMA 3WLKX 1OJXA 2NX1A 3UXIA 4YU1A 3RMJA 2GUBA 4EPBC 4LYQA 4FEZA 4DZAA 4JEJA 3G1AA 1I2QA 3OW1A 2YA1A 4GH1A 3BC9A 2CWNA 5EGRA 1KFEA 1SM9A 3KVLA 3VM5A 3TWAA 1Z32X 3UYCA 3WJWA 4F4RA 4EF8A 3HPZA 4MDPA 1RHCA 3B4YA 4NAEB 2EKCA 1X6NA 2V3EA 4QG6A 4GUFA 5BRBA 2DSWA 2OTDA 3D47A 1PV8A 3GG7A 1JZ7A 3FYPA 4PFMA 3VE7A 1DKWA 1ICPA 1R7OA 3M5YA 1TV3A 1QT1A 4FZIA 2PBGA 4US6A 1QOXA 4PUJA 4Q33A 1G7VA 4O15A 4XAFA 2NXGA 1JPIA 1W5PA 1XISA 4PMJA 1D3CA 2E09A 3P74A 4I7UA 1BF2A 4ZO6A 1O1ZA 2ODOA 2Y5EA 3IACA 2JEPA 2FHFA 1Q7MA 1WQ5A 4NNAA 2Z6IA 3AHVA 1M65A 1VC4A 1J0KA 4WY0A 1QK2A 1J8VA 3DAQA 1V3KA 4L64A 2R1NA 2BOGX 1Z42A 2XG9A 5PTDA 1QVBA 4MWAD 3B0PA 1W5NA 5CZSA 1LG1A 2V3DA 2DUAA 5K2ZA 4N02A 4U31A 4XBJA 4ZB5A 1W2PA 1FWSA 2GSEA 3L4ZA 5DRCA 2O92A 2DGAA 1WKFA 4R9XA 1IHIA 1SJBA 3W7QA 3HG2A 3IRDA 4NXKA 3WLPA 1TZZA 2CNCA 5AHMA 3DI1A 3UPBA 5A8QA 3L7RA 4Q4QA 3L0KA 1LBFA 2E6AA 1RZMA 1J01A 3DKJA 1GEHA 3QOKA 3LXAA 2E40A 3GXMA 2X41A 2BXZA 3MWCA 4AX7A 3WLOA 5CSSA 1UW9A 2VOTA 1ZBVA 3MCNA 3CHVA 1XG4A 4QS5A 1B3XA 4HSOA 2YL6A 3RX3A 4LYKA 7TIMA 3U7VA 2C7FA 4QEHA 1S3HA 2VEPA 5CSRA 2G95A 3COTA 1O95A 3RG6A 1W31A 4FLOA 3W71A 5I5RA 1O12A 3B03A 6CGTA 3GB6A 1XHGA 4RLIA 1K77A 3MPGA 3ZVHA 1CW2A 1Q6GA 3EPOA 2J7FA 3H21A 1XIMA 4LOCA 1Q6OA 1VS1A 4DUVA 1GONA 3L12A 4CU7A 1SZRA 1T99A 2YL9A 1DYSA 3RAOA 1WUFA 1NARA 5FA5A 1LRTA 1A53A 2ZX6A 4HYRA 3S2NA 1XRFA 1T40A 1VYSX 3CHCA 3N17A 3UWYA 4Q4MA 1UP2A 1EWDA 1SO3A 4UNLA 2J74A 1L6FA 5A1AA 4JIRA 1CXKA 2CKRA 3ZR6A 1OK4A 1Q85A 3T05A 1L0PA 4GY0A 2OWCA 5F4WA 4LEQA 1R86A 3W7MA 2CHRA 4DWSC 3ANUA 5EFDA 3W2LA 1GTHA 3CUJA 3SRKA 2YL5A 4O0QA 5CBBA 2XUCA 3VKCA 1LUCA 3WMBA 1YPFA 1S39A 1JI2A 4IICA 2OQHA 3TJ4A 3PTKA 1JUEA 2AAMA 3PB2A 4DY1A 2XYLA 3AIVA 4F9JA 1XLGA 1PKYA 1GPWA 3NQAA 3MMTA 4DVOA 5JU6A 4UOQA 3C2RA 4XZMX 3UQNA 3W7PA 3WH7A 3NM1A 1V4YA 1S2VA 2YXXA 1JYWA 2PU1A 4AF0B 2JKEA 1XIDA 2WC4A 2GQAA 2V8ZA 4Z0JA 2G37A 2AOSA 3LSCA 2XH4A 6TAAA 2WCGA 4YPJA 2QPSA 3DHDA 1QWGA 3VD9A 3E0WA 2V30A 3UR7A 1JRCA 1KXQA 4FMVA 3W2KA 4FSAA 1HO1A 3AMLA 4ES4A 5ABTA 3BJFA 4AD1A 3SUVA 1VLIA 4MPKA 1TTJA 2ESCA 3PUDA 3GE7A 4PRTA 1FWBC 3T2OA 1BTMA 1OBAA 3H55A 4RE4A 4PMNA 4O1FA 3UFYA 3W7RA 1FWCC 4Q8QA 2YZ5A 1JZ5A 1XH0A 4D8AA 3U5YA 1TV4A 4CQAA 3R94A 3LPFA 3O9NA 1UR8A 3VNLA 4IMAA 4HTYA 4MDOA 1OYAA 1XCWA 3TQ0A 1XKJA 1OC5A 3H53A 5HPCA 1WX0A 1GZ1A 3BLIA 4R53A 4IG2B 5FESA 3CYVA 4EXQA 1VBGA 2B4GA 3V1HA 2V63A 1F8IA 4J3TA 3L66A 1EJSC 1UD8A 4CD6A 2AL2B 2ZXDA 1NWUA 5FEXA 4IGSA 4JNYA 4JGDA 3USZA 4O0ZA 3GYCA 3AMGA 4EXAA 3DOPA 2CESA 3W7EA 2ZXAA 2ZVRA 1E5JA 3H2MA 3WLTA 2IKIA 2P88A 1VRDA 1LLZA 2CZ5A 5G1TA 4J3SA 3SCPA 4G7EB 2Y7GA 1E9ZB 3QPEA 2B0MA 4BEUA 3PZOA 4D2JA 3SUTA 3WH5A 1XH1A 5AB3A 4AHPA 2A3CA 2D1ZA 1VPXA 4MY8A 2QDDA 1VPQA 3QMRA 3CMFA 2HWGA 1IT7A 4C7FA 3C2YA 4OWGA 3GHUA 3BAWA 1DL3A 3LM7A 1LL4A 2F9RA 4WD0A 1FCQA 2OU4A 3BCFA 5GJNA 5A8NA 4OV9A 1PAMA 1YNPA 1JIBA 1UH2A 2CHNA 2VZOA 3N2XA 3QV8A 3WLHA 1FVPA 1C90A 2PTYA 2EPHA 3BAXA 2CLKA 3SCUA 1NJJA 3AS1A 4O1AA 5FL1A 2J6VA 1XICA 4HMDA 4Z42C 4NU7A 4W7VA 5LNWA 3M0VA 1VJZA 1SZFA 4ZEPA 4IQEA 4JTTA 3ISIX 5G1YA 1RUSA 3XISA 3NQEA 3W6MA 1CXFA 3P0XA 2PRLA 4RJEA 2WQDA 2RDUA 1OT2A 3VK5A 1UZ1A 2WBKA 4TTGA 2YZRA 1NF7A 3NQ2A 4HPNA 1K3UA 3ZLHA 3FGCA 3U2EA 2UWFA 4L61A 1WAWA 2I16A 2Y5SA 2MANA 1YDVA 4AX6A 3W7LA 2V0TA 7REQA 4DWSA 4TR9A 5C9WA 1ZS2A 3IJIA 4HHLA 1ELSA 1EUAA 5K3VA 3QFWA 3SN4A 3ATZA 2DVXA 3EKGA 1DIKA 3I3BA 3C0QA 1BWVA 3VIPA 4UQEA 2BNJA 5L6UA 1WOBA 3KCLA 3W86A 3BOFA 4F0KA 5HJYA 4UBPC 2R14A 4S3CA 4PH6A 1VFSA 1X8CA 2YA0A 4B2DA 2YYUA 3KXQA 2KX9A 3S9YA 4UTUA 3OZMA 2YBUA 1WBJA 4A8IA 3GXPA 4H2HA 1OIMA 2J62A 4FPSA 2FB3A 1TRDA 3IEBA 4Q8UA 4UQAA 1T96A 5A8OA 3W84A 3E3HA 1DHPA 1JR1A 1XD0A 3T44A 4AC7C 4GCXA 3RFAA 1YPIA 2BY1A 4IIBA 4D1IA 1U5JA 1BWLA 1H11A 2VYOA 1GQIA 3EMQA 3DFHA 2C1GA 3EEZA 1WZKA 3ZSSA 4ZSUA 3WCZA 4ZMGA 4JTEA 1UKSA 2DT1A 2VMFA 3C0SA 5I3GA 2VHLA 4KWUA 3AIQA 5LZLA 1VD6A 2P10A 4E4FA 1Q45A 2XH2A 1DWIM 1E6PA 3LCFA 3B8UA 3S5ZA 3IJQA 1Q6EA 4ZOEA 4G56A 2GJXB 1J10A 2J47A 3G1DA 5ABHA 4MKNA 5I07A 4P7QA 7TAAA 3GTXA 3VIHA 3KBWA 4UTHA 2HSAA 3WLNA 1GVOA 5D09A 3RX2A 1RBLA 2JIEA 3DFOA 5KZEA 1N55A 2VFEA 4G8TA 5HDRA 1PIFA 1EA9C 4PTXA 2GWNA 4V2XA 2DH3A 1KTBA 3KTXA 3EZ4A 1W3NA 2FZMA 3AHTA 1QUMA 4ZVJA 3HQ1A 4H9MA 3UZJA 2QJIA 1QI3A 3L4YA 3SY1A 3N6QA 3GBDA 5GVJA 1M68A 3NPUA 2E8ZA 3DG3A 1QHOA 2OPJA 4MWAB 4PFHA 3CT7A 1U5VA 4QCFA 1CNVA 3EA1A 3TW9A 3WQ8A 1ICQA 5EMUA 3MBFA 4LX4A 4UWMA 3CHDA 1TVLA 3M64A 2ZXQA 1PSCA 3WDRA 4R7WA 4US5A 1MVYA 1JXJA 1NEYA 3AJXA 4WEVX 3E5BA 4WSJA 4LAOA 4HOWA 1A50A 2YXOA 1ITCA 1ZTVA 1UMLA 3VNZA 1KKRA 3IJ8A 1DIEA 2C0AA 3R6IA 1KR0A 2BY0A 2W5FA 4MMWA 5C0QA 3FVDA 1W32A 4CD4A 1JF5A 2BG5A 4LGXA 4FXSA 1US3A 3MA8A 4Z1BA 1VP5A 3VIMA 2FHCA