1MRQA

Crystal structure of human 20alpha-hsd in ternary complex with nadp and 20alpha-hydroxy-progesterone
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
323
structure length
323
Chain Sequence
b'QDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C1
publication title Human 20alpha-hydroxysteroid dehydrogenase: crystallographic and site-directed mutagenesis studies lead to the identification of an alternative binding site for C21-steroids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 116
structure length 323
sequence length 323
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1mrqA00
2PDBA 3G1RA 1YNQA 2PFHA 4HBKA 4WGHA 3WG6A 2PDXA 4WDWA 4FALA 4NKCA 3M0IA 3LQGA 3R8HA 3LN3A 3BUVA 1PWLA 2PDLA 3LNMA 4XO7A 3UP8A 1MI3A 1Q13A 2WZMA 2P5NA 4XZHA 3U2CA 3CMFA 2FGBA 4YVPA 4JQ3A 4IJCA 1AZ2A 1EL3A 2ALRA 4WDTA 3R94A 2VDGA 4YS1A 4PUUA 1JEZA 4OTKA 5KETA 2AGTA 4H8NA 4LB3A 1VBJA 2IQ0A 5JH2A 3RX3A 3P2VA 2HE5A 2HDJA 2PDUA 4JTRA 3R58A 4XZNX 4PR4A 3R43A 4XAPA 3C3UA 4XVDA 2HVNA 1ZUAX 1HW6A 1QRQA 2CLPA 5HNTA 1AH4A 4Q3MA 4YVXA 3H7UA 1Z89A 1IEIA 3H4GA 1EKOA 4H7CA 3H7RA 1S1PA 2DUXA 5JH1A 3UYIA 4IGSA 2HVOA 3LUTA 3UFYA 2IPJA 3S3GA 2IS7A 4XVEA 2F38A 5LIKX 4R9OA 3V0SA 3V0TA 2PZNA 3G5EA 1AZ1A 1UR3M 2A79A 1T41A 4JQAA 4FA3A 2PDKA 1XGDA 3D3FA 4WDUA 4JQ2A 4ZFCA 3EB4A 5C7HA 2DV0A 4F40A 1XF0A 3UZXA 3V36A 4LB4A 4EXBA 4PMJA 1ZSXA 1MZRA 3R7MA 2BGQA 2F2KA 3N6QA 2ISFA 4AUBA 4XZIA 2INEA 3LZ5A 4PRRA 2PDJA 4JTCA 2HEJA 4GA8A 2ACUA 4GCAA 4WRHA 1S2CA 3GHTA 4XO6A 3CAQA 4JIRA 1GVEA 2IKHA 5LIWX 1M9HA 4JIHA 2PDNA 2R9RA 2PDPA 3V0UA 4GABA 1EXBA 3CAVA 4G5DA 3GHRA 2PDFA 2PD9A 1PZ0A 1RALA 2NVDA 4Q7BA 4QX4A 2BP1A 3RX4A 5LIYX 4JIIX 5HA7A 3ONBA 3BV7A 4FZIA 5HNUA 3RX2A 4JTDA 3BCJA 1QWKA 1AH3A 3Q65A 3T42A 1ZQ5A 3ERPA 4JQ4A 2J8TA 4PRTA 1T40A 3LEPA 3UWEA 1R38A 3CASA 1RY8A 4LBRA 2PDQA 3KRBA 1OG6A 1HQTA 4JTAA 2FZ9A 4ICCX 2I16A 4XZMX 2PD5A 1IHIA 1PYFA 4GQ0A 1MRQA 3WCZA 3WBYA 4EXAA 1X96A 1Z8AA 1RY0A 2ACRA 1LWIA 4LAUA 1YE6A 2IQDA 1ZGDA 3MB9A 4RPQA 1Z9AA 3Q67A 4JQ1A 3LZ3A 3CV7A 4I5XA 3R8GA 1XJBA 2ACQA 2PDGA 3ONCA 3FX4A 1Q5MA 4DBWA 3UZYA 4LBSA 4XZLX 2IKGA 1X98A 2FZDA 3UG8A 2BGSA 2WZTA 3BURA 1Z3NA 3COTA 3DN5A 3GHSA 1YE4A 2FZBA 2HV5A 4PUWA 3LBOA 1J96A 3LQLA 4QXIA 1SM9A 2IKIA 1EF3A 2PDMA 3NTYA 1VP5A 3V35A 5LIUX 2NVCA 1X97A 3QKZA 2C91A 2PDHA 4JTQA 4L1XA 4YU1A 2IPWA 4QBXA 1ADSA 3GUGA 2QXWA 2I17A 2PEVA 2DUZA 1A80A 4XK2A 4QR6A 4ASTA 1AH0A 4IJRA 4FAMA 1AFSA 4DZ5A 3MC5A 1LQAA 5AZ1A 4WDXA 1FRBA 3LENA 3EAUA 1C9WA 2FVLA 5LIXX 1PWMA 3DOPA 1K8CA 1S2AA 3WBWA 3M64A 4YVVA 3O3RA 2INZA 2PDYA 4DBSA 2IPGA 3F7JA 3B3DA 2PDWA 3VXGA 4GQGA 4MHBA 3UZWA 3R6IA 5DANA 1PZ1A 5M2FX 5AZ0A 2IKJA 2R24A 4LAZA 1YNPA 3FJNA 2PDIA 3GHUA 2PDCA 4HMNA 3UZZA 1US0A 3WBXA 2HE8A 3EB3A 4WEVX 3M4HA 2ACSA 3LD5A 1S1RA 3N2TA 3O0KA 4L1WA 4DBUA 2PF8A 3UGRA 4GACA 2FZ8A 2IPFA 3CV6A 4GIEA
chains in the Genus database with same CATH superfamily
3NM1A 3QN3A 5I3IA 2Y62A 4X2PA 3W07A 2O7QA 1HX0A 2CLOA 3WLTA 1DJNA 2ZXDA 3IIXA 3PJXA 2E9BA 3CWHA 2WMFA 2PDLA 4CNSA 5F4WA 3UU0A 3U7VA 3JRKA 5CLWA 4QQUA 1Q13A 4OBTA 3CL7A 1J01A 4XZHA 3FCPA 1F73A 4O0QA 1XRSA 3STCA 1E3ZA 1DWJM 2NQ5A 2YW4A 4O0KA 3SY5A 2GZXA 1R9YA 5I24A 3CAWA 2WVTA 6REQB 4Q4MA 2A2IA 3I3BA 1XRFA 4NJIA 3TP4A 1H0GA 3NCOA 2PLJA 5I77A 2OSYA 3BJSA 5D37A 3TNOA 3MUIA 1NDVA 2PDUA 1ME8A 4GNKB 4JTRA 5TQLA 3IV8A 1MUWA 3TSMA 3N34A 4HN8A 4OJYA 3C3UA 5CSYA 1YHTA 5CC5A 1J6OA 1XLKA 1E72M 2NSOA 4XUGA 3GKAA 3RCYA 2WLZA 3N2MA 4J40A 1ISXA 3CK5A 3UJRA 5IBXC 3B0YA 3LCXA 1UUQA 4H7CA 4RPPA 1VFUA 2OZ3A 2EKGA 1G0CA 3AXHA 5AC5A 4EWND 1JF5A 4GZEA 3W7GA 5GJPA 5MKGA 2NLIA 5KTLA 3W27A 3AJ7A 2VENA 4Y2WA 4N6EA 1GVRA 4NYUA 3EBVA 4S38A 4GIRA 4M3PA 2A79A 1IEQA 4V1YA 5I78A 4U28A 1U5JA 4HIBA 5LNUA 3GTIA 3MU7A 1XFBA 2XTKA 1CXLA 1QHZA 2Y8UA 3L4WA 1J5TA 2RGLA 4AD0A 4PTVA 1LRTA 2QAFA 4F40A 4Q8WA 3OJGA 1HJXA 4QLLA 3ZMRA 4LB4A 1KGWA 2A3EA 1DJWA 1AL8A 3WLJA 1MZRA 2WO5A 4DJDA 4EOUA 4UQAA 1A0DA 1YXCA 3KOZA 4LWWA 1J8VA 5KMYA 4AUBA 3H53A 4UMBA 1NOUA 4O18A 4ICMA 3FVDA 2ZX9A 2W5FA 2WXDM 1JDCA 2QCNA 1VRXA 3FIGA 4CNOA 3SUSA 2NUYA 3WY1A 2XIBA 1ZBWA 2PDNA 2PDPA 3W7DA 4IGNA 3NO1A 4JGDA 2ZUNA 5C2XA 1V77A 3ELFA 1HJWA 4IJBA 3QQ1A 3MUAA 1LBLA 1O68A 1VEPA 2PAJA 3NPVA 1FWEC 2FHBA 1KM0A 4DM2A 4JIIX 3II1A 4KWUA 1HKIA 3BV7A 2VFFA 4FZIA 5A8PA 3BQ6A 1O6IA 5LNSA 4GIAA 3N1AA 3GH4A 5MF5A 4L9XA 2I9UA 3C0JA 1UWRA 2ZTJA 4O0ZA 3KTXA 1VHNA 3TYDA 3ATYA 3NM3A 2PBGA 3TKFA 4Q8NA 3B9OA 4E6MA 4ZXLA 1E4IA 3KRBA 3SRKA 2BBFA 7ENLA 2YA1A 1RBLA 1BG9A 3GBEA 2YZ5A 3VNLA 4IHCA 2YCKX 4IX0A 1ZENA 4UQ9A 2XVNA 4IP7A 3VZZA 1E0TA 3HQ1A 1VCVA 3ZXWA 1J0HA 4HJFA 4CCDA 4UFMA 1VCGA 2FTYA 3FV9A 4JICA 1V3HA 4JTEA 3BAJA 4IQEA 3MB9A 3Q67A 4JFVA 1JCLA 3KTSA 3UPWA 3PULA 2H8XA 2OKTA 3WJXA 1VAHA 5CJ5A 4EANA 3Q45A 1B54A 3THUA 2VD9A 2NQZA 3F4CA 4K37A 4WZHA 1Z3NA 4W88A 4M6PA 4IMDA 2X7WA 3VM5A 1EFZA 4ZB0A 1QPOA 2HV5A 3AHZA 1SJDA 2GUUA 5GNYA 4JTIA 2CLKA 3W38A 3PZIA 2ZVRA 2OG9A 1EZ2A 2P0OA 3BLLA 1NEYA 3L67A 3UJEA 4NASA 4REQA 3LM3A 1X1ZA 4U3CA 4GXMA 1JPMA 4CD4A 2WM1A 2NV9A 1YTKA 4B5VA 3GDBA 4J3XA 1OF6A 5FJRA 2JKPA 1KQYA 1ZJIA 3EDEA 1TG7A 4GBUA 4C7DA 4FHAA 4A29A 1XBYA 4KFPA 1XI3A 2JIWA 1JCJA 3NQGA 1F4HA 4RXGA 4GRSA 4KWSA 7TIMA 2TYSA 3SY1A 9XIMA 1RVGA 5KZMA 1CGXA 4ZQOA 2XSXA 1IWAA 4UC5A 1QPKA 4IUOA 4H2CA 5E0FA 3S1GA 2Y8KA 3QLLA 3R6IA 5CPQA 2DZWA 3CUGA 4XG1A 4ZXOA 5H8UA 2HSAA 1K1DA 3W75A 1MUCA 1ITQA 3P81A 4RDZA 4BI6A 3PB2A 4PZVA 2QUNA 4QG8A 5C55A 3PAJA 5JBFA 1C7SA 1LDCA 4WX2A 4Q4OA 2YZRA 2QMJA 1REQA 1TZZA 1XLLA 3N14A 2E67A 3LPPA 4XWUA 2CZEA 3TMLA 3W25A 3CEUA 3S2MA 1E0VA 1P6WA 1UA7A 1M68A 4EPEC 2GQ8A 4ACZB 2FYMA 4DAFA 4HSHA 4Q6XA 2BV9A 3G6LA 4LVAA 4WDWA 4FALA 5M03A 3M7SA 2D20A 3EZ4A 3STGA 3LQGA 4WY0F 3TC7A 2RDTA 2CZ5A 3OLEA 5CQ1A 2VXNA 4HHPA 5B80A 1A5SA 3L2LA 4GX9A 2I14A 2R1PA 2PB1A 2FGBA 3WMBA 2GYIA 4GI8A 2XU2A 1KGXA 3LHYA 3URAA 4BWLA 3H24A 3DGBA 4Z2GA 3RXZA 1W3HA 3FSUA 3LSBA 4H6RA 3RRAA 3AIUA 3BC9A 3EOOA 2WCGA 5KETA 3S9YA 5GQBA 3T0CA 1XYBA 3AC0A 3WFAA 5IOBA 1G7UA 1E1CB 1XQKA 1VYSX 3VM7A 4NAFA 3P67A 1HW6A 3U5UA 2G3JA 1C8QA 2J25A 3MI6A 3CT7A 3LV6A 1IEIA 3IAPA 3CIXA 5AC7A 3EEZA 2VEIA 2VTFA 3ABXA 4C6EA 3SCPA 3UG5A 4XAYA 1PIGA 2HROA 3HPZA 4HCDA 3NOEA 1PYMA 3O6AA 5AECA 3A6OA 4F3HA 1JD7A 3F5KA 1XDMA 5M17A 1NDYA 4LEQA 3EWUA 4AF0A 4C6NA 3E2VA 4L61A 3GXPA 2D0HA 4DAIA 1F6PA 5AHFA 3U48A 1UD5A 3SRHA 1Z41A 1JPIA 3RIKA 1K4GA 3VK5A 4AIEA 1HO4A 1W5OA 4IOTA 4ZZ9A 1B31A 3GNRA 4DXVA 1KBJA 2V3FA 2R1MA 3HF3A 1B3YA 1NARA 3GTXA 4QTGA 2BGQA 1W3LA 4ZO9A 2XN0A 2ASHA 3BQ5A 1OG0A 4X0NA 4QNEA 1HL9A 2FKPA 1S5VA 2XVGA 4JTCA 5A6SA 3KL5A 1KQZA 5LZLA 3OYZA 1GOIA 3TAKA 3OODA 1FWRA 3VIPA 2G3NA 1YPFA 3VOIA 3FA5A 3ZIZA 1NELA 3W1TA 5AHIA 3TA6A 1J0JA 3AMLA 2VURA 2PDFA 4J3ZA 1R0MA 2DH3A 1SR0A 4BS0A 4BQ2A 1VF8A 2EO7A 3WUEA 2NVAA 1KO0A 1UR2A 3WH6A 3NQFA 3KP0A 3K8KA 4JTUA 1XCFA 4M51A 1RR2A 3NXLA 4UBPC 5BMXA 1OSEA 1QWKA 5AC8A 3O6CA 3NPUA 3M5XA 4WXZA 3HGSA 1SVDA 1JQXA 4JOMA 3WLQA 4GY7A 5JBDA 3TN4A 1M1BA 4QROA 3IVUA 1VZWA 3EKZA 5AFDA 4YPJA 1DJXA 2CZDA 4LBRA 5D38A 4LUSB 4E38A 5FEWA 4MWAC 2V69A 1BYCA 1IT8A 3M7WA 3MSYA 1CW2A 5DLCA 3AXKA 3O63A 2CHNA 3FXYA 4MYXA 2G3IA 3KL0A 1Z8AA 1CGVA 5EMLA 3PG8A 5HMFA 1W8GA 4LOCA 5BOFA 2GVJA 1Z9AA 5IHRA 1MQPA 1EO7A 3LSCA 5XIAA 2ZZ6A 5HJYA 3DYMA 3NURA 1VFHA 4INFA 3ITGA 1PO9A 2E6AA 1ODUA 1CENA 3KBSA 2J47A 3W86A 4Y9OA 1FWWA 2VDIA 5FACA 5FA5A 3L5MA 1NIUA 3GHSA 1MDRA 3GG7A 3UY8A 3W1PA 3LBOA 3BO9A 3CUHA 1SM9A 2IKIA 4H9XA 1OM0A 2WVSA 4GNJA 4WJEA 4ONVA 3WD4A 3CUIA 5FF7A 1I75A 1X97A 1NTHA 2H9AA 1XISA 4OV9A 1CECA 3LB0A 5FF4A 1HG3A 2P3EA 1DJYA 3ZQ9A 2IPWA 3G1XA 2ZZ1A 3THAA 1I2NA 2VEMA 4DBEA 5E9AA 3CXOA 1CI1A 3WQPA 1FWHC 2ZRUA 5EMYA 1R8LA 7XIMA 2E40A 3GZAA 1P0EA 3TN6A 3AMKA 1UZ1A 1EJ7L 1C9WA 2NQHA 3PVFA 2GSJA 3L65A 4GYPC 4AZ7A 1IT7A 1S2AA 1SFJA 3LMZA 3MVTA 2QDHA 3LYEA 2NX9A 3POCA 4S39A 1ZAJA 1X8FA 2EJ1A 3BW4A 3FDKA 2QV5A 1BYBA 3CYVA 3R25A 4LAKA 4ZVJA 4OUIA 3W1QA 4GE8A 1JQVA 3TXVA 1XS2A 1G4PA 5CPSA 2IKJA 5DQPA 1GQKA 2V5BA 2Z2UA 2HTMA 4JKLA 2PDIA 3RMEA 3GC2A 2XIMA 4DM1A 5DRCA 2J6XA 3KBNA 1I9CB 2WW5A 4B9ZA 1Q6QA 3PANA 6CGTA 1UR0A 1G4EA 3BL3A 3BPWA 3WBXA 2XPKA 2EG7A 4WEVX 1OADA 2A3AA 1L6WA 3BLPX 3DBPA 3HBLA 1OYBA 1TZ7A 4L1WA 1E9YB 3AXIA 2PF8A 1GG1A 3CQHA 4IGHA 3PR2A 1F61A 1RD5A 1JUEA 1MI3A 4QCFA 4DHGA 2QIIA 2OEJA 4HBKA 5JMUA 2DW7A 6A3HA 4TUFA 1R3QA 3WDRA 3C0QA 4Z1BA 1TA3A 3CTLA 4JIEA 4ZBCA 3ECQA 4LU0A 3UP8A 2G37A 4B16A 1NAL1 1R30A 1XLFA 5HBFA 4Q7NA 5DT7A 2DP3A 3PZGA 1V8EA 2W63A 3EWBX 1I8JA 3VNYA 1IR2A 3ZM8A 1OK6A 4LNYA 5AYBA 4LUJA 3H8AA 3VC5A 2C3ZA 1LWHA 4KEVA 4UTTC 1KRCC 3UWYA 2YL9A 3B9EA 4MPQA 2C1GA 2EHHA 2HJPA 4EPBC 3APGA 1OC6A 5A6MA 1UBSA 1CXHA 2Y2WA 4GI6A 1GOQA 5JH2A 2VVNA 4K3ZA 4UIOA 1Z44A 3SI9A 3VINA 3BAWA 5E0CA 4IPPA 1EXPA 4DWSC 2DSKA 4XZNX 4UNIA 3V5FA 4XAPA 4C65A 5EU9A 3OW1A 2OU4A 2QUUA 3PAOA 3STEA 3S4TA 1SUXA 3VE7A 1ZUAX 3RU6A 1ITUA 2GDQA 5AN7A 2VRJA 2CBUA 1RP8A 5A6BA 1Q2RA 2VEFA 4HA4A 1RBAA 3W83A 2V30A 5PTDA 1KBIA 3C52A 4XD3A 5M5DA 3AYRA 4NZ4A 1XM3A 3SADA 3LUTA 3UFYA 4ORIA 5AC4A 1GOKA 3VIGA 5HPOA 1ISWA 4R9OA 1XBVA 3W72A 4J2PA 3G5EA 3U2OA 3BE7A 4I7VA 4PCNA 1Q2SA 3CEPA 3OGRA 2PDKA 3WIJA 5HWNA 1BSIA 1CLKA 2WZEA 2FIQA 4GVHA 4V1XA 1EP2A 1XLDA 3CQJA 3VPLA 3G6MA 1XH1A 2ZE3A 5F1UA 4OVXA 1ONRA 3WEOA 2DT0A 4FXRA 3HGRA 1LG1A 1JUKA 3AZTA 1P43A 2YKKA 3IANA 2WSYA 3FHQA 3MVIA 4HOZA 2IXUA 4IT1A 3UXAA 1P6BA 4WY0B 2DJXA 2ZC1A 3CJPA 5BU9A 4JFTA 3IJ8A 4MM1A 1L2QA 3G18A 4MAZA 3AS0A 4GX8A 2Z1KA 1KM5A 1OQFA 3MBDA 1GTHA 1WE5A 2Z1SA 3PNZA 4AMAA 2VC5A 2PTXA 3CAVA 4G5DA 3F2DA 3VVGA 2ZQ0A 4D1IA 4QISA 4AXNA 4YL2A 3W00A 8RUCA 5I3GA 4URIA 4WKAA 4YTSA 3EXRA 4PTMA 4ZQCA 3EB2A 1A0CA 3ZSTA 2L5HA 2DW6A 1AH3A 3QPZA 2BDQA 1UH4A 3KVJA 2XZ9A 1EWEA 4QAIA 1BWKA 1JRBA 1KKRA 3WKZA 3ARZA 1KCKA 3RPTA 1RY8A 4H2HA 4GUIA 3SB0A 1EEPA 1T5AA 3HPXA 3CHFA 3MSDA 2ZC8A 4JFWA 3FJLA 4HYVA 4P7OA 2WBGA 2Y70A 3FYYA 4UFHA 1IHIA 5ABHA 3TTQA 1TIMA 3WELA 2P50A 1TYGA 5CZJA 2XDFA 3SN1A 1EWDA 4K6AA 3APYA 4GPNA 2CLLA 3UNTA 3PHAA 1R85A 1MYRA 2ZX8A 4H8VA 1XINA 1W5MA 4AC7C 1JYNA 2DZBA 4EPKA 1ME7A 3CMGA 3IGHX 4LS1A 4AD2A 1GOMA 4P7NA 1A5MC 1GVFA 1KA9F 1VHCA 1M65A 4LBSA 3SCOA 1EJVC 3UG8A 2VZUA 2XGBA 3W84A 1X7FA 4W87A 3NUKA 4DJFC 2W9MA 3KS5A 2WJDA 4NHVA 2XN2A 3LQLA 3MPGA 1EF3A 4XD5A 3ARPA 4M7SA 3R79A 3CTTA 4RZ6A 3F4NA 4L1XA 4S1FA 2OYMA 3ANUA 4JTKA 3VIJA 2AMGA 5TD4A 2CHOA 3N9KA 2YA0A 2GK1A 2D0GA 4JL1A 4WF7A 1YKWA 3A4AA 2D73A 3LENA 4MFDA 4AU0A 2W91A 3WDQA 5LIXX 1TJ1A 4UTUA 3H12A 2VP8A 4GINA 4JTSA 4E8DA 3W7OA 3WMLA 2H8ZA 1VFFA 3IUIA 1EGVA 1VD6A 3L66A 4HU8A 1GVQA 1K7FA 3KW3A 4BKNA 3PB0A 1QW9A 5HWMA 4GQGA 2O4QA 1UWTA 4H9UA 5JUVA 1V03A 1OINA 5IRPA 1HIZA 4IP5A 3B9DA 1F74A 3DECA 3PUGA 4DUWA 2J9XA 1QW8A 3LHTA 1TSIA 3O06A 2PDCA 1SO6A 2QDGA 1I6NA 3UA4A 4MNKA 1VBHA 4ML9A 3EOUA 1DJQA 1MW3A 4D6DA 3MP5A 3AO0A 2Y6ZA 1TPFA 2TPSA 4P5UA 1FWDC 4RV3A 3MJMA 4Q8QA 4JN8A 1EHNA 4LV9A 1TPH1 3GDRA 1XUZA 2PDBA 2V63A 1E70M 1VB9A 2PDXA 3QSTA 4CNUA 3WFLA 1Z69A 4U2YA 3VMPA 1DEDA 4YYCA 1CXKA 3W74A 1IGSA 3PBMA 5F2LA 1GWJA 2P5NA 3S5OA 1GOOA 4PCTA 3WLPA 1VRDA 4IPLA 4GQBA 2W92A 1EIBA 1E40A 4B92A 4B5SA 1V5XA 4PSPA 4IJCA 1ZFJA 3U5YA 4RDVA 1EL3A 4HYRA 4DJDC 2C19A 4ATWA 2J77A 1MZHA 3VE9A 4X60A 2G4FA 3W88A 1PKNA 3EWXA 4PL2A 5CCZA 1LOSA 5G4HC 2E5DA 4LB3A 4J3WA 4WUIA 2ZUSA 2YGYA 3TAOA 1TKKA 4Q4RA 4PR4A 1SFLA 3R43A 2D22A 2XG9A 1F6KA 3PFMA 2XSAA 4IIEA 1RCQA 4LS0A 4MFEA 2WHLA 2FPTA 2GGJA 3PP7A 5FOOA 3UCDA 4RZ5A 4JDYA 3KXQA 4IP4A 1M7PA 4MGGA 2WSKA 2HQAA 4KKXA 4W93A 3LY0A 3H7RA 2QAPA 3A3HA 5JH1A 1T99A 2BVDA 2XGZA 4IGSA 3QY6A 4PMUA 5A2BA 1M5WA 1W3IA 4GD0A 1XGEA 4HSNA 1Q8AA 4OECA 4GO8A 3QR3A 2PE4A 3U7BA 2P10A 1PX4A 1OT2A 3U4AA 3P84A 2VC7A 4WSKA 5AYXA 3FDGA 3BGJA 4LVFA 3OYXA 5DELA 4JQAA 1UC5A 2PTWA 3VKCA 4L6OA 3D3FA 3E5BA 1XUUA 1MNZA 3E96A 3NIYA 3FKKA 4B2DA 3A47A 5ECUA 1B57A 5T9CE 1TPUA 4DO4A 4GYFA 3HG3A 4B5NA 4K1WA 1A4LA 2Z29A 2F2KA 2ZA1A 2Q3OA 1UPMB 3LZ5A 5I00A 1KRAC 3UWVA 5AHMA 1V6VA 2PDJA 3I6TA 2HEJA 1P0KA 3H2EA 2A3BA 4WRHA 4QAWA 4Y7EA 1HVXA 1TCDA 5LA1A 2VYOA 3WZ0E 2QPUA 2GJPA 5ENLA 3BAKA 4KH2A 1EXBA 1EDGA 1XW8A 4K36A 3MCNA 1OVDA 3AS2A 1PZ0A 2BOFX 4GFIA 3MUXA 1E6NA 3FAXA 2OWCA 4H9YA 3LLXA 4PB3A 4UOQA 1YXYA 3LLDA 4CD8A 3I65A 3H26A 1B5TA 3Q65A 3UG4A 1GPWA 1EO5A 3AMCA 3T8QA 2BVWA 1L2UA 1C3FA 3GRIA 4QDMA 4ZL1A 4LYPA 3TEVA 3EGJA 5FD0A 3KWXA 1RV8A 3LHVA 4RNIA 2YXXA 3V18A 2JKAA 3SECA 3W1LA 4Z2LA 1K03A 3VZXA 1VFTA 3T1GA 4MKVA 3CV1A 1MRQA 3YPIA 2BB0A 4QS6A 3V1HA 2WNNA 3DDMA 4RL3A 2C13A 4MVAA 4F9JA 1K6WA 3NO5A 3UETA 2EPHA 1H7PA 1O5QA 3LHZA 3M6YA 1RA5A 3UEQA 2B0MA 2GVGA 3MP3A 2PLMA 3P5ZA 1C9DA 4LRSA 3R8GA 3LA4A 3QFWA 4JNMA 4AX7A 3A13A 2GWGA 4M82A 5AOUA 4J7RA 4GMEA 1XHGA 4UOZA 1KBKA 3IUHA 3COTA 4LTSA 1F07A 3PSWA 3NL2A 3VOFA 1WBJA 2D69A 2ZX5A 2HNEA 3R11A 5C7VA 2HS6A 4ZQNA 2ISSA 5C9ZA 3MUZ1 4O52A 3PZMA 1PJ9A 2G50A 1J93A 1UZ4A 2WMIB 1VPQA 1RJPA 2HNHA 3AHYA 3WBEA 5CBJA 3S5NA 4D9PA 1KFWA 1FH7A 2FH8A 1KXHA 4ZO8A 3VNKA 4YU1A 3XINA 3NA8A 1WOAA 4OHQA 2Z2BA 4DY1A 3GU1A 4PH6A 4H1ZA 1ADSA 1U22A 9CGTA 4PL1A 1H1ZA 1S5WA 2XVLA 3SCVA 1MEIA 5FI8A 4DZIA 4WSHA 2BXYA 5FEZA 2R91A 2R1KA 1E6PA 4ZGYA 1FA2A 1LQ0A 4HSOA 1FRBA 1W3JA 3GVRA 4FSAA 3AZRA 4Z2JA 2ZZ7A 1PWMA 2YYUA 3ANVA 2AAMA 1SJBA 4JX4A 2WC3A 3BMXA 4Q4KA 1IZKA 1KXVA 3AHXA 4LVDA 4F0KA 2Z7GA 3L0KA 3IRSA 3RM8A 2ZRZA 4MG4A 2GGHA 1EJSC 3CZGA 3GAYA 3MANA 1REQB 1J79A 5T26A 1TIWA 4BWLC 4HA0A 3G1AA 1IXPA 1G69A 1T8XA 4XIMA 2ZUWA 2R24A 1H5VA 3UVAA 3FK4A 4ZB2A 1HF6A 2E9LA 1A50A 1NOFA 1BLIA 4KETA 1FKXA 1CIUA 3TC6A 5EB8A 1OIMA 2XH2A 4NILA 3N9SA 3GVWA 3D3AA 4PMXA 4DJEC 1IWPA 4MB1A 4DBUA 2PTYA 2DZUA 2FZ8A 3JVAA 1ECQA 3B05A 4U5KA 3L4YA 2FGZA 3EDJA 1O5KA 3LPOA 1LL7A 5E0KA 4XISA 3TN5A 3W28A 1I60A 4CU8A 3Q94A 2ZRVA 3JS3A 1B3WA 8XIMA 2X40A 2FB3A 4CN4A 2YSWA 3FHAA 3RLGA 1PKMA 3W7EA 2DT1A 4C5ZA 1GT8A 4W9TA 3RCNA 1KB3A 4YVPA 4M1BA 3W26A 1UKOA 4HMEA 1UWUA 2XH4A 1Q6LA 1AZ2A 4NUWA 2C0AA 4RW3A 3B9AA 2FHFA 5IBXA 4UTWC 2D24A 1ADDA 3VGBA 2ONEA 3OVPA 1JJKA 3CUJA 1F9CA 3KLLA 4GG9A 5G5IA 1XXXA 3R12A 3SFWA 1NFBA 1XBXA 2E3ZA 1N55A 1N7KA 3NL5A 5F2GA 4AF0B 1FKWA 4C5YA 1JYXA 3G1HA 1W3KA 5CAHA 1EKOA 1BYAA 2VM8A 3AXMA 3CB8A 4XAFA 2NXHA 2O55A 5LA2A 4K8GA 4IPNB 4AIUA 3TLLA 2QJIA 4BQ4A 2QCEA 1JZ6A 2PCEA 2C1IA 3GIPA 1SW0A 4AD1A 4QJ3B 4XUYA 1DYSA 1M7JA 1EC9A 3W1NA 4K2SA 3DIPA 3MP4A 1OX4B 3ID7A 3DYPA 1RP9A 1XP3A 2REQB 2OQLA 1PEZA 3WLSA 4IMGA 3N73A 2BZNA 3GR7A 5A6JA 1OFPA 4EVZA 2QUTA 5C70A 1XD0A 2F8QA 1EBHA 4J3UA 5CXPA 2OT0A 4EXBA 2YA2A 5JU6A 1E9LA 2X16A 3R7MA 5CGTA 2XWEA 4QEEA 1S39A 4PMQA 2ZUTA 4IFKA 1B9ZA 4JN7A 2VL4A 4N4PA 4R7OA 1YXDA 3N2BA 4FIQA 2XH7A 4H83A 4Q32A 1PX3A 2CU0A 1E43A 3AIVA 4G9PA 3V0UA 4OZOA 5JQ9A 1H50A 4D6CA 4HPGA 6PTDA 3GSMA 3RU8X 4CNNA 1J4EA 3VD3A 1XCWA 3CZJA 1D8CA 1LLZA 4FOJA 2DSVA 2CLFA 4XQ6A 1BTCA 1TO3A 1W1A1 2VEGA 3NPWA 1TQXA 2WANA 2Y24A 4O16A 2OYLA 1AG1O 3EOLA 5DF0A 3OVGA 1KKOA 5CBIA 2CLIA 3IK2A 5DN1A 2EPNA 1F5ZA 1CX9A 1D9EA 5FF0A 5JIPA 4WLCA 4JYEA 4R34A 2YOCA 4BZYA 2CXEA 4A05A 1ISZA 3TCEA 5BXPA 1SZEA 1OG6A 4YTUA 5I06A 4XZMX 1W9XA 2D0FA 1CGYA 2YYTA 3K8LA 3DCPA 2UY3A 4CU7A 1SO5A 1DWIM 2FFIA 1Q63A 4EK7A 4Q4PA 4GH1A 2YDQA 3JU2A 1K7XA 3EX1A 2ACRA 3L4TA 2DIJA 2YCLA 2PTZA 1W17A 4JQ1A 5D33A 4C91A 2J79A 2WPGA 2GUBA 3B03A 4RLIA 1A5NC 1PTDA 3UQNA 1Q6FA 1RBOB 3Q37A 4ZSUA 1GZ1A 2H9AB 3WEZA 1W9DM 3ABSA 1XYMA 1UC4A 5CPLA 5A8MA 4HKPA 1S3HA 3IV3A 3WJYA 3BAIA 5G1TA 4JNZA 4IIBA 1BF2A 1HP5A 3HG4A 3W02A 4MAVA 2CC0A 4P8VA 4CD6A 4MUPA 1Q4NX 5ECVA 2J7DA 1BTMA 2TMDA 1TWZA 2YDAA 1R3RA 3TOYA 1X1NA 5DT5A 4CEXC 3ZZ1A 3B0VC 3G1YA 5LNRA 3THCA 1PKLA 3MKVA 3WMCA 1UD8A 4FPSA 4ZODA 3R0DA 4KW2A 3VZYA 1UMYA 1PPIA 3EMQA 4DO5A 1Q8JA 4HPJA 4GO9A 4HZMA 3B97A 5GVJA 1G5AA 3PPGA 3AMGA 1LQAA 1QO5A 3EAUA 1JCXA 2FVLA 3MSGA 3NVDA 2VFGA 2R8WA 3N29A 4EAMA 3SSZA 2YBTA 1G4SA 3CPRA 4U33A 2PRHA 3WLNA 5EY5A 3AMDA 4PMRA 4WR3A 3PG9A 2B4GA 2INZA 4B5XA 3V1PA 1C91A 1HKJA 1PHQA 5I3DA 3VNMA 1PSCA 2VWTA 2ZTKA 4FNPA 4E8CA 2F6KA 4DI8A 2C79A 3MMWA 3QHMA 3O6YX 1H11A 2HXUA 3LV5A 3AZSA 4GUFA 2E4TA 1P7TA 5FKYA 1QNRA 4UZUA 2FTWA 3EKLA 1NWUA 3MBFA 3KRSA 2Q8XA 1HKKA 1JULA 4A3QA 3LRKA 4GH3A 2HXTA 4H8HA 5D2WA 1W1VA 3KCLA 4CQDA 2GGEA 3CUZA 1TA3B 1TUFA 3NFUA 2FZMA 2OMAA 7TAAA 2ACSA 1R86A 2AQWA 3N2TA 5SWUA 1W1B1 3Q58A 1OZMA 3NZGA 4E2DA 5LXXA 2FTPA 3N25A 2GDVA 1JF6A 1BXNA 3EDFA 3M0IA 2Z1VA 1PDZA 1J6PA 1XYAA 5C71A 1ZP4A 1BQGA 2VI0A 3TYEA 1LTDA 3NO3A 4J3TA 3G3DA 2C71A 1UIPA 4ACYA 1QHOA 1E1FA 4F2TA 3LCHA 4XKMA 1R47A 1HKMA 4LV4A 5D32A 4PCPA 1RD6A 3NEHA 2HMCA 5HUOA 4NVTA 1MXGA 1AW2A 4FOKA 1K7EA 1CYGA 2WZHA 3BMWA 2PWEA 3QR0A 2QCDA 3VIIA 2AGTA 1BGAA 1VBJA 2X1SA 3AICA 3MUCA 4AMCA 1UZDA 3DENA 1S5TA 4L9ZA 4BY3A 3O6DA 4XVDA 2DEPA 4S3EA 3LLFA 2YXGA 3EDKA 1GORA 5EL1A 1YDNA 4KWOA 2GGIA 4QJ1A 3AJXA 4MY9A 1DE5A 2YDRA 3R10A 3TJXA 3VFLA 1W56A 2PUZA 2CKRA 3L7RA 3SAZA 3MQTA 3K8MA 1EUNA 1O95A 3K4AA 2PZNA 1K8ZA 5AYYA 1TPWA 3MO7A 3BVJA 3BSMA 4XBSA 3CZEA 1T41A 3A4XA 1YPIA 3T08A 3W1RA 1OHLA 4L6HA 3T4WA 2VRQA 5XINA 3S9ZA 1OT1A 2ISVA 4O54A 3L2MA 4XBJA 1MO0A 4UTHA 1Q4WA 5B7ZA 2DZXA 5BOOA 1D7KA 3FKRA 3V36A 1J9YA 1MEWA 1AVAA 3W2MA 1JR1A 5FJIA 4F4RA 5DFAA 4Q8OA 3UBPC 3L4UA 3UWWA 1AQFA 1VH7A 3C8NA 2VEKA 3AI0A 3WH8A 4LY8A 5AHNA 1K9FA 5ABTA 3VIOA 5BMWA 3SR7A 3UJFA 1QASA 2W6RA 3QM3A 4DPPA 9XIAA 1PCWA 1V6YA 3HPFA 2OQYA 4JIHA 2P1FA 3KVMA 1KW1A 3KUMA 2DVUA 3S42A 3KM8A 1EP1A 5BXTA 3W7KA 1R3TA 1W1IE 4M19A 3VOHA 1W3NA 4MWAA 1XH2A 5CPTA 1KC7A 4PC8A 3O2LA 1LT8A 1QJWA 1UP0A 4CN1A 5LIYX 2O9TA 5HA7A 3N2CA 4ZOCA 2ZZ4A 4JTDA 3VNJA 1LRNA 2WKLA 5FAGA 3SN0A 2H6RA 1PE1A 3BDKA 1U5HA 1HJVA 5FJOA 2QCCA 3UXDA 5DY2A 1H3GA 2GSEA 1JDAA 4FOUA 1M04A 3B4YA 1XYCA 5D2YA 2DQXA 4J28A 3R5EA 3AUJA 2J27A 3FAWA 1UKPA 1QNOA 2BODX 3HZ3A 3VCNA 3RPMA 3BJTA 3DI0A 4YHEA 4Z2HA 3T6CA 1W1YA 1W31A 4RPQA 7REQA 5HR7A 3VGEA 4OIFA 3LMYA 5EMKA 1FCVA 4W7VA 5ABEA 3CV7A 3PWAA 4M24A 2X8RA 1WNOA 3FX4A 2B31A 4NZ3A 2BG5A 1DXIA 3QGAC 4O1CA 3UZJA 8A3HA 5HUPA 2WZTA 4NJGA 3NZ1A 1KTNA 2D2JA 3EWYA 4TTUA 4TMBA 1OY0A 3M6DA 2DGAA 5CJMA 3BLOA 3D0CA 2GK1B 2Y5EA 4IPIA 5I03A 3PBUA 4NX0A 3NQDA 4GJJA 5LSMA 1YTDA 4M7TA 2PDHA 2MUCA 4JTQA 2PS2A 2ZYFA 4C6CA 2J7EA 4JS3A 2NZLA 5CGMA 4WVXA 3L0GA 4B4HA 1F3TA 2VCAA 1N2VA 3NXFA 4RZBA 1QHPA 2VVSA 1LOQA 3FA3A 3P74A 4XB3A 3WK3A 4CKQA 3NZQA 4A3RA 3WQWA 3DFOA 2WVUA 2RDWA 2VJXA 4UB9A 4W86A 3ZT5A 2PODA 4C7FA 3DOPA 4UQDA 3M64A 3M0KA 1EYEA 2Y8VA 2G5WA 2O9OA 4HNOA 5I07A 1FXQA 3WK1A 5TNVA 5HQLA 5HK4A 1TVNA 1MW0A 3NSXA 4A2RA 1H7OA 2ISDA 1PBGA 1TRIA 5BWAA 2OZ0A 1XYZA 2PSNA 3P93A 3GG0A 3HMCA 4MKSA 1CLXA 2C6QA 4NJHA 2FJKA 3ITYA 4N2YA 1XIDA 1EC7A 1TTQA 3B8WA 4HCLA 1O5RA 3DI1A 3B8DA 4JL2A 4QE5A 1JXKA 2X1TA 2G95A 3RNDA 2E6FA 3W22A 3AISA 1TPC1 4J3VA 3EWWA 1KRMA 3OG3A 4EF9A 1I45A 1N82A 4GK8A 1EBGA 5C9UA 5I3FA 2NT0A 4JN6A 1XIMA 3W7HA 1XG3A 2WVVB 1JZ4A 2QUVA 2QCHA 3UXLA 2O9RA 1JYVA 3W53A 3KOWA 4NXKA 3LK6A 2RDXA 2TSYA 4MPKA 4G7FA 3O07A 2XM2A 1RPKA 2J24A 4GI9A 3SIZA 3VDBA 2V5KA 3R8HA 2Z25A 3GB6A 1K3UA 3N13A 1NQ6A 2VUNA 4L4PA 3WDHA 4KF1A 2F6XA 1EOMA 4KGJA 3LNMA 4MJMA 5F2IA 4EX4A 2ZX7A 5E1QA 5DEZA 3N17A 3ZSSA 3UR8A 3REQB 2RH9A 1UJQA 3S47A 3BV4A 5T91A 3U2CA 3AXXA 1OFEA 2BOGX 3NL3A 1FWNA 4GY1A 3PPHA 5EMUA 4O28A 1OF8A 5H91A 2WWCA 3VA8A 4HPNA 3IJ7A 1SQ7A 4F9DA 1JEZA 3S1VA 4RX0A 4KFNA 4MNLA 2ZZ2A 3WD0A 1PCKA 2NQLA 3E0FA 3BSGA 4PFHA 4E2OA 2PBOA 2ZFAA 4QITA 5D04C 3VOCA 3GNOA 3AOFA 4LQ1A 1EGZA 3LI1A 3O15A 5REQA 1ZY9A 1ZHAA 2OLSA 1TV5A 3MCMA 3H7UA 4J2MA 3PFRA 1Q45A 1U30A 3NZRA 4QDWA 4GIYA 1BQCA 4IG2B 3UCCA 2HVOA 1QUMA 1YDVA 1L6GA 1E9IA 4AWEA 3VKDA 5DMYA 1CLVA 1WDDA 4HN4A 1Y5XA 1VC4A 4CD7A 3CO8A 1CB7B 4F66A 1JFHA 3B40A 1R3VA 3IACA 5LNWA 3FYPA 3TWAA 3M44A 2C0HA 2HVMA 3HFYA 4B9YA 1THFD 2QDDA 4FR6A 1HKVA 3RM9A 3EDDA 5A8GA 4DX3A 1RQHA 1WQ5A 2Y85A 5EBAA 3VABA 4PMJA 1SO4A 3TW9A 5BXSA 1DHKA 5HXMA 2OTDA 3L21A 5I02A 2GJXA 5C2GA 1GZJA 4AW7A 3EWDA 5D9NA 3ZS4A 4DYEA 4XZBA 4QE1A 4FXFA 4PE8A 3ZVIA 5A8QA 4HT3A 2E8YA 4CQAA 1OX6A 3SGUA 5IXEA 1B30A 1OCBA 4CUCA 3L23A 3VFCA 4WHBA 2UZ9A 1UMLA 2BASA 3QC0A 5D8WA 1BRLB 1XIGA 5T9BG 3MUY1 3I6RA 3UR2A 1V3KA 1DJZA 4MNJA 5GPRA 1A0EA 1ZBKA 3E12A 3N9RA 1CT5A 1EHAA 3GD6A 2Y5JA 4M5PA 1A5OC 4UFLA 1IXOA 3C3NA 3M0VA 3I7SA 4AZCA 2J8TA 4IH3A 3OZOA 3UWEA 1E56A 3G8RA 1AK5A 2V0TA 2PP0A 1JGMA 3VOJA 2NQ9A 1GGOA 2EGZA 3VUSA 4L1GA 3HFTA 5CZSA 3NR0A 1N8FA 1GVIA 1I2RA 3ZYZA 1EC8A 3GXMA 3WLOA 4IF2A 4OV4A 5A6BD 3FA4A 2A0NA 3VD4A 2VNCA 5C9XA 3ARWA 1DWGM 4ROPA 1X96A 2PP1A 4AD5A 3E0WA 4DJFA 3RUBL 4AEEA 6ALDA 1OCQA 4ES4A 2YBVA 4AHPA 3KL3A 1R46A 3TR9A 1NJJA 4I5XA 4BHYA 3B9NA 4NY2A 4BR1A 5D2TA 2VR5A 2TAAA 3SGZA 1Q5MA 1VIWA 5FEPA 1AQ0A 1QK0A 2D2GA 1WZAA 1C92A 1LLOA 3WD1A 3HJZA 3TYCA 4E0CA 2ZUUA 3EA3A 2PPGA 4PUWA 2ZX6A 3BG9A 4D8LA 2PDMA 3RILA 4X2RA 4E3TA 1EZWA 2VR2A 3GIQA 3C2YA 4I6VA 4IIDA 3ME3A 4A22A 4JY8A 1J0KA 3FW6A 2JEQA 3QKZA 1GQJA 4KWVA 3DZ1A 3LI0A 1WKDA 1K9EA 1UIOA 2HBXA 3GK0A 2ZA2A 3W1MA 1F3EA 5EFFA 4QCEA 1TV2A 3QZAA 3CIVA 1GVSA 3W6LA 1SYTA 1W54A 4QR6A 5H8PA 2EF9A 4X61A 1W9PA 1DORA 4ATDA 4FAMA 1F4AA 5ABGA 3BCDA 3MHFA 4WDXA 2BLEA 3SCWA 2YBUA 4Y96A 1OFRA 3SSJA 5AYZA 3LGEA 2EKCA 3OP2A 4GXWA 1XLJA 1K8CA 3DFHA 4I8YA 3L5LA 3WDPP 3P60A 2P76A 3PK7A 1BYDA 3EPNA 1XCXA 4GC4A 2VC9A 4DZHA 2OSXA 4JKMA 3R4IA 5CG0A 2I1OA 1W9UA 3SDOA 3UR5A 3VXGA 1H62A 1KLYA 4GVIA 5JXQA 4W5UA 1ZAHA 3H2CA 2PWUA 3RK8A 3GNNA 4CLMA 4DRSA 2XVPA 4LYQA 3TTYA 4FX7A 1NWSA 1V6UA 4IL0A 4LYKA 4YXGA 2CESA 3GHUA 2D3LA 3BJFA 3WQ6A 4QE4A 1PIFA 3SUUA 1LP6A 4GLEA 1LF1A 4IMAA 4S3DA 4HU3A 2HE8A 5AY7A 4IXXA 5KINA 1TE1A 1TVPA 1UCWA 3DX5A 3AFBA 4K38A 3B0PA 4HGXA 4QSFA 4YYFA 3W7JA 4UFKA 4UTFA 3QZ6A 3G1RA 2CETA 3CT2A 4EAYA 4CCCA 2NQJA 3URQA 3PZQA 3T78A 1TWDA 3GR4A 2X7VA 3PWGA 4R85A 2GDUA 1Q3NA 5DRIA 1VGAA 1N8WA 5FSEC 1W1TA 4GCXA 4AEOA 3VILA 2QKFA 4NF7A 5CAKA 2QVNA 1G7VA 4HHLA 1RHCA 3ARXA 4MLRA 2JK2A 2QNEA 1FCUA 1JDFA 2NT1A 2D23A 1U1JA 3I4EA 3CAKA 3E2QA 3N6HA 4ZOAA 1KTCA 1GW9A 2V5JA 1SSGA 2F6UA 3ABQA 3CYJA 1RJQA 1QR7A 2HDJA 1JI2A 1WB0A 3QSRA 3NDYA 1RCXB 1XICA 3ARTA 2BGNE 3LCFA 3GZ3A 2I5QA 3AHTA 1E0XA 3BAYA 4MZ8A 1V51A 3ITXA 4BK9A 2PGEA 3CU2A 2X0HA 3T0AA 3THDA 1FWSA 2PLCA 3G2GA 3CZ8A 5EMJA 3CHEA 4NZCA 3K5XA 3AIQA 3T0DA 3T05A 1GEQA 1AJ2A 4JCMA 3WO8A 2F38A 4PN2A 5D02A 1JCMP 2PA6A 4I3GA 4W7UA 2CLEA 3WL1A 2NSXA 1VIZA 4KESA 2V5DA 3KBJA 1FVPA 2GOKA 3G1FA 5AVHA 3ZVHA 3VUPA 6ENLA 4NX5A 2QGYA 3CLWA 4HNLA 1RH9A 1H7NA 2WSQA 2WMJA 3MZNA 2HWGA 1AODA 3G0UA 4RZ4A 1TB3A 3UZXA 1ZSXA 4M1RA 1B3XA 4LUIA 3UYCA 2R6OA 3L2IA 1P5BA 2WM0A 2I7GA 1QNPA 2ZKMX 5M1TA 4LC6A 4W85A 4P7RA 3H54A 3W71A 3PBGA 2DT3A 2DSUA 4HTYA 1WDPA 4Q4QA 4N4QA 4MZYA 5LYRA 2R9RA 3DYOA 4ACZA 1ZTVA 1VBRA 5E5CA 3QXBA 3AHVA 4QDPA 1DJHA 1WUFA 2XUCA 5A2CA 2IW0A 1QAPA 3CO4A 1QPQA 4HHMA 4C90A 1AD4A 4LGXA 1B4KA 2NLYA 1GK8A 1DL3A 3HV8A 2WSPA 3W6YA 1TPB1 4O17A 4KFOA 2Q02A 3SGGA 4LXFA 3T42A 4MWAE 3GU9A 4KQNA 4OWGA 2JEPA 3P5YA 1B9BA 1FHUA 3C2FA 3OLIA 5G1YA 5A8OA 2B7OA 5I3HA 3DU0A 5I5RA 3CNYA 1ZJAA 1XDJA 2FZ9A 4K39A 4PMZA 1G67A 1G01A 4GHRA 5D9OA 1RSCA 4GQ0A 1EX5A 2MNRA 4XAGA 2EBNA 4OUEA 3PZUA 1E1CA 1A4MA 3TYBA 1QO2A 3GTFA 3WH7A 1F05A 4E5TA 3VI2A 5C2CA 5DCBA 2Z1WA 4LCRA 1XV8A 3QHNA 3OEXA 1BWVA 1TELA 1K9TA 2IQDA 4LUYA 4A6GA 4GBDA 3T0TA 2I5GA 1FUYA 3EA1A 4TXEA 4UFIA 1J12A 1ZALA 2WKJA 3FNDA 3M16A 4A8IA 1J11A 4UNKA 2IKGA 1TVLA 5BRBA 4Q8VA 3ZFHA 1V0LA 3WQFA 1TX0A 2FMOA 2EAWA 2OT1A 4JEJA 3H2MA 4ERGA 3TN3A 5KEZA 1GONA 3L4ZA 5H6HA 3I3DA 3KBMA 3M5ZA 2RHGA 3D46A 1LORA 3VC6A 3T8LA 3VGGA 2J66A 5LIUX 2J7CA 5RUBA 3POHA 3BZJA 3HG5A 2VZVA 4W8LA 2VOTA 1TQJA 3QF0A 4UWMA 1X6NA 4KRTA 3ATZA 4AYGA 4N02A 3QW3A 3CB3A 4QBXA 3UW6A 3P82A 3ZR5A 1SMAA 1H5YA 3F4VA 4UQBA 3EEGA 1A5BA 3WK0A 2VT0A 2XVKA 4P7LA 4L4MA 2VGGA 2ZICA 1LWJA 3TCSA 4ZO7A 2O7SA 3GE7A 4CGTA 1KCLA 3UJ2A 3I6EA 4A21A 1SGJA 5CJNA 1MSSA 4UQCA 2QGHA 3FEMA 1P7TB 3AWOA 3AU6A 4ZA0A 3TU9A 4XIAA 1F8IA 5FEXA 1S3TC 4KPLA 1W3TA 3C5QA 1JCTA 3DKJA 4J9JA 3O3RA 4ZQRA 4US5A 3TR2A 3M0ZA 4GNVA 1VQTA 4DBSA 1FXPA 3NQAA 3H4XA 4L7ZA 5D2XA 3EX6A 1VYPX 2WV8A 3SW6A 4DJEA 1R3WA 3CHDA 3MHGA 2R1NA 5M2FX 4J35A 4KEZA 4X3ZA 3SRDA 1WBHA 1NFGA 3ZJ8A 2WMGA 1CEOA 1MRAA 3PUEA 4TOQA 1H2JA 4LUSA 2CZFA 1PIIA 3PBYA 1WXYA 1KCZA 1XIIA 1US0A 3MV11 4PGLA 1A53A 1M01A 1UR9A 2W67A 2GQAA 2PC4A 1GOWA 1UR8A 2QJGA 4H9VA 2VX7A 1GHRA 3N4AA 1JZ2A 4PUEA 2W27A 1SW7A 2YPIA 1CWYA 4WKFA 3AIEA 3R13A 2ADAA 2EXOA 5CEWA 3WF1A 2WHMA 2BWGA 4R53A 3S5SA 2V5LA 3NSNA 3UWUA 2DIKA 2YR1A 2D3NA 1JNDA 5C6MA 3BOXA 4UTWA 2WCAA 3LN3A 3EOEA 4PRWA 3TQKA 4D8AA 1KCXA 1ZU8A 3SJNA 2QF8A 4ZE4A 2ZUVA 1UQYA 3ZR6A 5HR6A 2WZMA 4GWEA 3SFKA 3N3MA 2NX1A 3QQ0A 4EXQA 3CH9A 4ZFMA 2YL6A 2WHJA 4AAJA 3LBMA 4LNCA 2P8BA 3TZFA 3SJ3A 3SCRA 3IGSA 4FLSA 1UA3A 2ZDRA 2A7RA 2JE8A 3VYLA 3VKAA 3DAQA 5KITA 3OVQA 3APTA 4DLMA 3EPMA 1POJA 3W37A 1VCFA 1FX6A 2FDMA 4I5UA 1CXFA 1NF7A 2CWXA 4Q3MA 5DMMA 2NV2A 2CZVA 3VGFA 3H4GA 3W7MA 3ZWSA 3T2PA 2XIIA 3QOMA 1S1PA 4DQWA 2OWWA 1IQ8A 1OFQA 5JIWA 2J9ZA 2RJGA 3QW4B 1AW1A 1RLDA 4ZMGA 2JIEA 5A1AA 1A3XA 2ZWYA 5LIKX 3ARYA 4RUBA 4MNMA 4TR9A 2V67A 1J2WA 3P0XA 1EQPA 2V2DA 3VAVA 3T0BA 5EKYA 3ARRA 3BWWA 4ZTXA 1GJPA 2DUAA 3PZOA 5BRQA 5EGRA 4K8HA 1O12A 4RE4A 5HQEA 4EIVA 2XISA 1A49A 1JZ3A 4MTVA 2QVHA 4LUTB 4JQ2A 4ZFCA 3S2JA 2VGIA 4EP8C 3PY2A 1FH9A 2BSLA 3O05A 3WQOA 1SO3A 4BF5A 1FHVA 1W91A 2X0YA 2ZOXA 3CUFA 2A7NA 3L5AA 3GAKA 4BEQA 1DHPA 4S3JA 1R7AA 4MWAB 2Z0IA 2ISFA 2Z1BA 4P7QA 3CPUA 2AKMA 1FCQA 3NWRA 2Y1HA 3WQGA 1VENA 3TFXA 1LG2A 3UPBA 1M53A 1ZBCA 4XO6A 1X38A 5HMEA 3R0UA 5LIWX 2J4GA 3VCCA 3VKKA 1YBQA 3ANYA 2Q8LA 4YLWA 1W1PA 3QPEA 1BVZA 2F7FA 3GHRA 3SQLA 3WLHA 3OZMA 2ODOA 1DWHM 3GY1A 4Q8TA 4MB4A 5HNUA 4QRNA 4G7EA 1G1YA 1W1ZA 4Q7IA 2J78A 2QHAA 1ZQ5A 4N9DA 2J7HA 3QV8A 1KM4A 3OLDA 4R7WA 2CBIA 1T40A 4W89A 3F2CA 3LERA 3XISA 2JKEA 1O94A 3LRLA 2Z6JA 4QEHA 7REQB 3RAOA 3TTEA 3LNPA 4RW5A 1YEYA 2VUYA 4ZO6A 3KVKA 4R9XA 2DQWA 4JTAA 4GQQA 1IXNA 4DI9A 2IMRA 2FDSA 4JYDA 1R3SA 3BARA 2OGJA 4AHOA 1US2A 2PGWA 3WCZA 1DXEA 4XTDA 4PUDA 3ABOA 2DSWA 3B06A 2V3GA 2CNCA 3JR2A 1JZ8A 3N19B 1EUAA 4KRUA 1AQHA 2POZA 5BOEA 4C1NB 4UUIA 3MI2A 3H4WA 2VQUA 2WJFA 1BXCA 1YDOA 4UTKA 2OOGA 4P2VA 3C6CA 3W2UA 5HAOA 1FFQA 1QPNA 1WDSA 1XJBA 3A23A 3KS6A 4DYKA 3KDOA 2QMKA 2A1YA 1TPVA 4A8RA 3B04A 1ZBVA 3B8UA 4IQLA 3DFNA 5BNKA 3S1UA 3J7HA 1UB3A 1DIDA 4KBXA 2W3ZA 4NU7A 2QQ6A 3HJEA 4G1NA 3G1DA 1NSJA 3QY8A 5FF2A 2NW0A 1J96A 2MANA 6XIAA 2XIQA 4AVFA 4AD3A 1CDGA 1V0KA 1ZB5A 4RE0A 2Z1XA 1Q65A 1PS9A 1G94A 2BTMA 3QJAA 4C6QA 4G56A 4HQVA 2G97A 1H09A 2XN1A 2Z00A 4H9MA 3GQYA 7CGTA 2WMKA 4AZHA 1E4MM 4PULA 4PYSA 4TX9A 1PXGA 1GHSA 3DFYA 5AVNA 3AIBA 2PEVA 4CCEA 4H7VA 3KOFA 1J18A 3U3HA 3HURA 4IGMA 1UD4A 1QTWA 3FEQA 3IGXA 4DZ5A 3MC5A 5A6AA 3BAXA 2CIPA 2FHCA 4Z2KA 1FWGC 1NM9A 2DFAA 3GLCA 2EG8A 4E3VA 4DUVA 4GJ1A 2AQOA 2WKGA 4Q8UA 5C9WA 1XLCA 1U33A 3BK0A 1Q6EA 1P1XA 4QIUA 4ERAA 5DANA 3UVIA 4N9CA 5E6ZA 1UG6A 5LGZA 1H0IA 3T9PA 2KX9A 3QZEA 3LU2A 1V93A 1P0BA 3PUOA 1V79A 4CN6A 4GY0A 4M56A 2NV1A 2Y88A 4HMNA 1FH8A 3VIHA 1MW1A 4OU1A 3TC3A 4KEUA 3E2SA 2DVTA 2RDUA 1PZ3A 2V81A 1EJTC 3OOQA 1KBLA 2P0IA 3QPYA 4ML4A 3LD5A 4DN1A 2YX0A 4DWSB 3C0SA 4GQRA 1TUXA 1U1HA 4FB7A 3WQ4A 5K4ZA 1LBFA 4FLOA 1I2QA 4A8NA 4G2DA 1KRBC 1YNQA 1Y5VA 3GW0A 3WD3A 1TCMA 2UY4A 4YJ5A 5AYIA 3MKCA 4EF8A 3IK4A 1KFJA 1MVYA 3BG3A 4ZQPA 4H7ZA 4LAOA 1ELSA 4PCSA 1GQNA 8CGTA 4RR4A 1W9BM 3WF0A 3WBAA 1L8NA 1A47A 4CD5A 3IIVA 3V16A 4UZSA 2FVKA 2NWRA 1WKYA 3BOLA 4PFMA 3BICA 3GM8A 3R0KA 3KLKA 1DVJA 5REQB 3AROA 1KWKA 3WLMA 4F0RA 4K1GA 2D1ZA 5K9CA 4O1FA 4WDTA 3R94A 1TTJA 1Y65A 8XIAA 4BA0A 2J8GA 4S2CA 1JRCA 4L80A 4HA1A 4KGLA 1OBAA 3U4FA 4C6MA 5I3KA 1VR6A 3HPAA 3QKEA 2XM1A 4HPHA 4XKYB 3EMCA 2XHYA 1IE7C 3ABZA 5HOSA 3A5FA 1S5MA 5DCEA 3A5VA 3JW7A 5EYWA 2ZE0A 5BWFA 1X6UA 2W66A 2X42A 1UH2A 3F5JA 4E8GA 2CW6A 5A94A 1ZCCA 2X1UA 3UWQA 4NSBA 3DFTA 1QOXA 3S3GA 2IS7A 3RMJA 4XD6A 4JR5A 1QFEA 3SCNA 3IAQA 1F6YA 1V0NA 4I8DA 3VNIA 1A3WA 4S3GA 1KM2A 5HMDA 4M6VA 3L9CA 2ZADA 2RFGA 3QRHA 1B0IA 1J0ZA 5BU6A 3I7QA 3W7NA 4C6IA 1BSLA 3W2NA 1R2SA 3W85A 4BF7A 3GG8A 4A3YA 3W2LA 2Y7GA 3S6DA 3DEQA 3T4CA 2PWGA 1XPYA 4WJ8A 1WZLA 2UWFA 3WQEA 3F4DA 3M47A 3KVLA 4AD4A 3OIXA 2WCSA 2INEA 4H04A 2OKOA 3W7QA 2R94A 4GA8A 3OG2A 4PBEA 2OPJA 3DFQA 1GG0A 4B3LA 2VFDA 4AZCB 2E77A 5L6UA 3LCLA 1ZP3A 4GVGA 4UR7A 1M03A 4QJ5B 2XZ7A 2YLAA 3I10A 4H6KA 1O4UA 2OFJA 3GUWA 1I2PA 2IXVA 1QU4A 3N04A 1W5QA 4HYWA 4MMWA 4CQ8A 1RALA 3E5PA 2QULA 3QR1A 1AMYA 4N9BA 3VDGA 1E73M 3FXGA 4F0SA 3MZ2A 2PZ0A 4LF2A 4R88A 4JTGA 1PUDA 1BXBA 4RNHA 3V4BA 3VDAA 3E74A 2FB2A 1RZMA 5C9RA 1MNSA 4DIAA 2DVXA 3AYSA 2DIEA 1OFDA 4DYJA 1YNYA 1JPKA 3P14A 4BCEA 1R38A 3O16A 1HGYA 4H01A 4WJXA 4JBRA 3TJLA 3LXAA 2AGKA 4YN5A 4IFRA 1DJGA 4QM1A 1HJQA 3GFXA 4AXKA 1ADOA 3NAVA 4C7GA 1OABA 5T8GA 3I3EA 3V5CA 5XIMA 4TMCA 3QC3A 5D09A 1E15A 4D6FA 3NZPA 4QJ4B 4TO8A 2V2CA 4EXAA 4HNNA 1P48A 3B8TA 3GDKA 1GJWA 4C6BA 2FJUB 4Z0JA 4BI7A 3WLIA 1TPEA 1LWIA 1FWAC 5BCAA 4O4WA 1ZGDA 1DQUA 1XYFA 1IXQA 1G4TA 2Z4GA 3DHPA 1KBBA 4YWSA 1X8CA 2E1WA 4XAZA 3BURA 3DKLA 4PEKA 4Q4SA 5CBBA 4HK6A 4G8TA 5A6TC 3OA3A 4PCFA 4BEUA 2ZRYA 3AWNA 3RLVA 3LBCA 3KHDA 5HMSA 2J62A 3KWSA 1O66A 3UA3A 5FJUA 4C6FA 1VP5A 3K2GA 5K7JA 1V3IA 1RK6A 1T6MA 3WQ5A 2OGYA 3VCRA 3HO8A 3NGFA 3NVTA 5CGQA 3ITLA 1OCJA 2W0UA 4TVDA 1TZ9A 4PTNA 4Z08A 3GX9A 4H00A 4BI5A 1PB0A 2CEQA 4CQCA 5G4WA 4V27A 2X1RA 3VIMA 2DUZA 2V82A 1XH0A 1A80A 3UJSA 4FO4A 4BFAA 3QMTA 3U2ZA 4MWAD 3H23A 1AH0A 3T2OA 3STFA 1P0DA 1XC4A 1I1WA 1YPXA 3PPFA 5HPCA 2QCLA 2VZOA 1SFTA 2O4MA 2AL1A 4JIPA 1SFSA 2HCVA 3VGDA 4H41A 5MKGB 4NJJA 3A9BA 2Z26A 3LM7A 4LCSA 4O15A 1JI1A 4JTTA 4PTXA 2VGFA 3FLUA 3M1ZA 3O8AA 2I5IA 2E5BA 1LBMA 2IPGA 1QT1A 2ICSA 4UR8A 3OPSA 4L65A 4NAEA 2Z24A 3E6EA 3TSBA 2AL2A 1UP3A 2C8NA 3DHFA 1TJ0A 2ZRWA 1WKEA 1WDRA 3H22A 3EMZA 3LXBA 1Y5WA 2A3HA 4C1KA 3FJNA 4S3CA 4PB4A 5I7GA 1TJRA 1TPDA 3CZLA 3EYPA 1WZMA 4HZ8A 4O1DA 5A3HA 3VX1A 3SQMA 3N15A 2FQIA 3BOFA 3M4HA 5DY3A 1E3XA 3VDCA 3IGUA 3O0KA 2V2HA 2GGGA 1JPHA 1EPXA 5CSRA 3MDWA 2W79A 4LVGA 3WF3A 5HNNA 3P8JA 4N0RA 3NQ6A 1WX0A 5A8NA 2YDSA 2IPFA 2H90A 4GIEA 3AYVA 4AC1X 4WK9A 1VBUA 4B3ZA 1XWYA 3W4RA 1KFEA 1NVMA 3T44A 3BGAA 4NKCA 5A6KA 4W4QA 3PSVA 5BXRA 4IFOA 3GH7A 2J6VA 2VO5A 2GVLA 1EX1A 4XD4A 4M6QA 4H6EA 4ENLA 3KEHA 1P6CA 3UT0A 4JTJA 4GKLA 4JNYA 3O9NA 3TSDA 3CMFA 1JZ7A 2HK1A 1AQMA 1Z32X 1XSJA 5D30A 3GU2A 2WB5A 2XSBA 4TIMA 2WMIA 4ZTYA 4PUUA 4GC3A 1B3OA 2W4XA 1W0MA 1IF2A 3WJZA 1AUSL 3USBA 4DNHA 4JTFA 4MKNA 1W37A 2E09A 1Q6CA 5A69A 4NQ1A 3NDOA 2V8ZA 2E5CA 2GQ9A 4FXSA 3SCTA 4IWWA 4HB7A 4U5IA 3H2NA 4A3UA 3UERA 3ES8A 2JGQA 3VMOA 4IQJA 2DSZA 2HVNA 2XFYA 3S1XA 3ZVHB 3F2BA 1UP2A 2QDEA 1OFAA 2ZIDA 1V08A 4UTMA 5KZEA 3G22A 2BMBA 4AY8A 4B91A 5HWJA 1YYAA 2JF7A 1LUCA 2UY5A 2BHYA 4KCUA 1V7YA 1V6TA 3M0HA 4NT0A 4F2UA 2DPEA 4ORMA 1AZ1A 1EIXA 4ZEPA 3U8GA 3B0XA 5CSUA 1V3LA 1XRTA 4UTJA 4WDUA 4US6A 5C7HA 3LGDA 4K7YA 1NP0A 3BGGA 3B8VA 4IIGA 4REQB 2DV0A 1FCBA 1XF0A 1ECEA 3LHUA 4PBGA 4HD5A 4A35A 1TR9A 2EJAA 5D9PA 4OT7A 3MYOA 1J0YA 2PURA 3GDMA 3NYDA 5BRPA 3A21A 3OB8A 3KRUA 1LJYA 1GUVA 1JD9A 1V02A 3MO4A 1HUVA 3UXIA 5LKYA 3GHTA 1CGTA 1SJAA 1UOZA 1RCOB 1W32A 2PF0A 4H4IA 1K02A 1DTUA 4DWSD 2GL5A 3BLIA 1QNQA 5K3VA 3QYQA 5CPMA 2PD9A 2CLMA 2GPTA 4V15A 1AMKA 3L4VA 4F0HA 2E7FA 1C29A 3TK7A 4N7QA 4Q7BA 1ZRQA 3EWZA 1IEVA 4GI4A 3ONBA 1L0PA 2XFFA 2PWFA 3WUFA 1EA9C 2Q01A 1HO1A 5HINA 1WYIA 3GG1A 1LL4A 4U3AA 2NUWA 1HGWA 4AX6A 4TV5A 1VBGA 4MJZA 1CBGA 1HT6A 2SFPA 4CQBA 2V9DA 1MFUA 3RG6A 3RM4A 2I57A 1HQTA 4I90A 1OGSA 2VC6A 1QDSA 1GQLA 3E2RA 4Y9PA 1PYFA 1VEOA 1S5NA 5FSDC 1J10A 2AAAA 3TJ4A 3GTHA 2ZZ5A 4B4FA 1QOPA 5LHEA 3GNDA 1VJIA 1YE6A 3LOTA 1UR4A 3C2EA 3LZ3A 2WJZA 3H6OA 4NP7A 4YHGA 3G1SA 2ACQA 3RJXA 2PGRA 2BY2A 1LYXA 3IIZA 3MTWA 1Z6KA 4WGXA 5G1MA 3VDHA 3R1ZA 4S2BA 3MHUA 1SW3A 4HHHA 1BVWA 1ZLPA 1LT7A 3LPFA 3NJ3A 3S0CA 1WAUA 5LNVA 1YE4A 2Y4SA 5TAOA 1CNVA 1W5NA 2WZIA 3MMTA 3DC8A 1OX4A 4MSSA 1DIOA 3MYPA 5KSWA 4D6GA 5FAJA 3F1QA 2REQA 1G9HA 1BWLA 2DH2A 1RUSA 4QSHA 4QNWA 3S6TA 4RDYA 2ZVIA 1EP3A 5HQMA 1E1EA 4XX6A 3K30A 1NY1A 3V35A 1KFKA 1IEXA 3GKFA 4XTIA 4PUNA 2VMFA 4K7VA 4Y8EA 3SUTA 3IJIA 4ADTA 4I7UA 2Y63A 3TQVA 3EWCA 3KE0A 1LL6A 4QLKA 2G41A 4NAFB 2RGMA 3DH7A 3BLDA 5F7UA 5DCDA 1EB3A 1TMHA 2AMXA 1G6CA 2OQHA 2EPKX 3PF3A 2QLYA 3N18A 1CPUA 1ISVA 2J7BA 3ITTA 3GVQA 1V3MA 3N11A 3TOPA 5JBEA 3K46A 3MMUA 3C61A 5HULA 3FS2A 3NSMA 1E4NA 2J8FA 5J5DA 1ICPA 4P8UA 3NQVA 1R5YA 4B5UA 2WNQA 2QV4A 2A3CA 4O4VA 4W8AA 4PODA 4HNUA 4MHBA 4EACA 2G0WA 4YNGA 3ENLA 2KAUC 5AZ0A 4MIMA 2E6DA 3V5OA 1JAKA 4MADA 3T81A 3IIOA 1F7BA 4PUMA 1IZJA 2D2OA 4I9JA 4HZ7A 1VEMA 3FOKA 3PZ9A 1GEHA 1UH3A 1L9WA 4DJFD 3W9ZA 1F8MA 4LX4A 1UWAA 4FX8A 2GQ3A 4FLQA 4WQ6A 1TV4A 1UWIA 1KWGA 4GACA 3PTKA 4J1OA 3CV6A 3EX4A 1EGMA 3INPA 1DPMA 2PFHA 3DERA 4JAWA 4CNTA 3CBWA 3WG6A 4EE9A 3MKKA 3N4EA 2C15A 4GKTA 3LDVA 4MB3A 4IQDA 4TTGA 3S46A 4O12A 3MY9A 3WH9A 4RV8A 3MWAA 3M43A 2Z2AA 1IV8A 3HU7A 4MB5A 4V33A 1ONEA 3L68A 2E0PA 3TYAA 3QOKA 2GVYA 1SMDA 4MDOA 3ITOA 3E02A 2OEKA 1IGWA 2I56A 2B81A 4HMDA 3Q4DA 3RDKA 7PTDA 1NWRA 1H4PA 3WDIA 3ZT6A 3GW3A 2X09A 4HA3A 2QW5A 4H8NA 1WXZA 3UXKA 2BHUA 3CUXA 3RHGA 1UYQA 1WO2A 3WNMA 1TE6A 2Y0FA 1HNYA 3SN4A 2CLPA 4FNSA 1AH4A 3HB9A 1PTGA 1JIBA 3RGTA 2WSRA 4MF4A 2OLAA 1KFLA 3STPA 2OELA 4U10A 3DFSA 5CC6A 1P1MA 4FR1A 2HISA 4L5ZA 2DUXA 1C8XA 1M41A 3PS7A 3SZ8A 1C8YA 1ZJHA 3BXWA 4YMZA 2Z27A 5IDIA 4YIWA 3U6WA 1GYNA 3UGVA 2Q09A 4EWJA 1S2WA 4MLJA 3S83A 3MA8A 2VEPA 3BSHA 5GNXA 4F48A 2DZTA 4GYJA 4LVBA 2X30A 1F2JA 5AKQA 3GWQA 4TX6A 1EQCA 1H51A 1LRQA 1JCYA 3E0LA 1A5LC 3XIMA 1YBQB 3H70A 1HN1A 3C2OA 1GOXA 1W5PA 5H8MA 2OCZA 1V4YA 1SR9A 1X39A 5TF0A 3HGOA 1GYMA 2O92A 4XZIA 1EJRC 1WPCA 1XLBA 2QF7A 4AY1A 4DBDA 2E6YA 2FH6A 5BROA 4FF5A 4DJDD 4WCJA 1JZ5A 2NX3A 3AIRA 3G0SA 4G7EB 1OZQA 1DXFA 1DOSA 5B7YA 1BD0A 3CAQA 4YCPA 2Q3RA 4XBKA 2IKHA 3LX9A 3ARSA 2CITA 4PUKA 1FWIC 4MUZA 5H2ZA 3CHCA 3RR4A 2Q71A 1D8WA 3GFZA 3NNTA 4IPJA 1TRDA 2X0SA 4UMAA 2BP1A 4JEQA 3RX4A 1E6RA 1JGIA 1MFVA 4C6JA 1VFOA 3TH6A 2ALDA 3ARVA 2B7PA 3S9IA 3W7PA 1S46A 3QGVA 3S6OA 5KZ6A 3CC1A 1ITXA 4S3AA 4OOZA 4L64A 3CASA 4HOWA 4D6EA 1BAGA 3K1DA 4FF7A 1KFBA 3K4DA 2D2HA 2V5CA 3UD6A 1EYWA 5DXXA 1OGGA 4NJKA 2BVYA 4EKJA 3W81A 3SCUA 2Z28A 3U0HA 3IS4A 4Y6GA 3MT1A 4W7WA 1U2YA 3KCOA 2JGYA 3G24A 4LPCA 1CXEA 4J4KA 4LRTA 2A21A 3OLGA 3M0JA 3OU8A 2VDHA 2OWXA 3TIMA 4M80A 1JNEA 2V68A 1SPQA 4NRSA 4E4FA 1EA0A 2IQTA 4B5TA 2E1DA 2G8ZA 1OFOA 3HV9A 3PZNA 4JHZA 4Z42C 4MOZA 1AA1B 1IZCA 1QI0A 4Y90A 2WWDA 1VFMA 1JDEA 5K2ZA 4O13A 2HPIA 2ZXBA 3CIWA 5LA0A 1ISYA 2P8CA 2NXGA 3C4UA 1K77A 1I1XA 1BKSA 2A6NA 2QT3A 3E38A 1C93A 1LROA 2VX6A 9RUBA 1QBBA 3RCMA 1KV8A 2FZBA 4YTRA 1Q7ZA 3H21A 3SQSA 4GZ7A 5AHEA 2CFFA 3A9IA 3BLKA 1VS1A 1HJSA 4JY9A 3DBNA 2NVCA 1H60A 4RCXA 1FBAA 2O9PA 1F76A 1WOBA 5H1WA 1KM1A 4K68A 1Z42A 4KMQA 2FVMA 3VIKA 5LHFA 4B3KA 4GFSA 5E6YA 4L56A 2VRKA 2TODA 4XK2A 2WNZA 2G3MA 1YADA 1H1YA 3MJYA 4O8AA 2DDXA 2BOEX 4X63A 3WBWA 3C8FA 4DXKA 4Q22A 4O14A 1IIGA 4CCZA 4HNTA 3G0XA 4XSLA 3OZYA 3DHUA 1EJUC 1XLIA 2WHKA 4DF0A 2G4JA 3GNPA 1TTIA 3UZWA 4GVFA 3MWCA 2ZCGA 1UKSA 4LC8A 1W8SA 1H7WA 2CBVA 4AISA 2CBJA 3OVRA 2OO0A 5F4SA 1XSIA 4DEFA 3MSRA 4FXJA 1H61A 3CPGA 3QMRA 5I09A 3VNDA 3RRXA 4IMEA 1H63A 4AB4A 3G77A 2NXIA 3URNA 3S8HA 2XJ7A 2OLHA 3O0FA 4PA8A 1T96A 4LFYA 2C16A 4OFCA 4M6UA 4ZOEA 1POKA 5DX7A 1XL9A 1SZFA 4TQTA 3UESA 3UG3A 4AZ6A 3OGSA 3TX9A 3AS3A 3UGRA 2QS8A 2A5HA 4QS5A 3TTSA 4JDBA 1TREA 4HVXA 3A64A 4ZSTA 4I5RA 5FJTA 3GVVA 3ZT7A 4AVNA 1E0WA 3LCWA 2OOFA 3KCJA 3CH0A 7A3HA 5M3WA 4KCTA 1PWLA 3SIMA 5U7SA 4X22A 4XO7A 3NQ8A 1BKHA 5CZKA 4IMFA 3QGKC 1K6AA 4Z1AA 1XKYA 3ZLHA 2WJEA 3KOXA 1RXOB 4FS9A 2YCEA 4DO6A 2CERA 3PTQA 4JTLA 3WNNA 4Z1CA 3WK2A 1MW2A 3QEZA 4CU6A 1QNSA 3VD7A 1FWFC 3B0UX 3D5HA 4GGHA 1NWTA 1E55A 2ABBA 3USZA 3BMVA 1UD2A 4O53A 4S3BA 2VCBA 3BZGA 2YXOA 3P2VA 5G2IA 5IFPA 4H9ZA 3SEPA 1FOBA 5I6SA 2QIWA 3MW7A 3TYZA 3W82A 3TDFA 5HNTA 1RK5A 1QNVA 4US5D 2VR4A 4YVXA 3C56A 2V6AA 3AALA 3A4WA 3DG3A 4HJWA 2FMNA 4H8UA 1MEHA 1WP6A 4Y9AA 1FY6A 3UYIA 2X2GA 2EPMX 4GZJA 4DJED 3W73A 1DIEA 4XVEA 4A8LA 4ZOBA 4O11A 1Y7VA 2O56A 3CS2A 2QR6A 4F0MA 3V0SA 3V0TA 1OYCA 5C0QA 1OC7A 1UR3M 3HQNA 4YCOA 3LTPA 1UOKA 3UZ5A 4RDWA 1SZRA 3LXCA 4UFJA 3IUDA 1TV7A 3KBVA 3M0YA 4E2VA 1FWJC 1PVNA 1XLEA 5DO8A 4AG0A 3EB4A 1KM6A 3HM7A 3HPSA 3U2EA 1KR1A 3QFEA 3TQPA 4EPDC 3K1GA 3HA1A 2BXVA 4WOQA 4S3FA 5FF3A 1GKQA 1JL8A 7ODCA 4PEEA 1QPRA 4NNAA 2BXZA 3TNBA 3AYTA 1EOKA 4B5WA 5IHSA 5HATA 2OO6A 3NQMA 3TV8A 4AZIA 2R14A 1M9HA 4N6FA 1H7RA 2WVVA 4M29A 4FLRA 1B3ZA 1B3VA 1VFSA 1V02E 2ANUA 3P6LA 5E09A 4D6JA 4R27A 4RNJA 1UROA 3LRMA 4LS2A 1IEWA 1BEUA 1LCOA 3NQBA 4O19A 3PBWA 1CZ1A 4X0VA 1ML1A 2VOMA 2ZXAA 4PMVA 3RX2A 2BS9A 1MUMA 3REQA 3ERPA 3G3MA 3C2VA 3GDTA 2VHLA 3LEPA 3C2RA 4ZR8A 4J3SA 1YDYA 5CC7A 1GVYA 4LW7A 1J5SA 3QBUA 1FQ0A 1JG9A 4MJ2A 2VX5A 2GOUA 2DT2A 1J2BA 2OXNA 3TROA 1YTEA 1B1YA 3QTGA 2PD5A 2GLKA 1WKFA 1B2YA 3TONA 2NWSA 4F8XA 3PJWA 3IARA 1QI2A 2E68A 2ATSA 2P53A 1MDLA 3NQEA 4H9TA 1RAKA 3VKBA 3U57A 2VKZG 4GZIA 4FNQA 4PMOA 4J5NA 5D2VA 1RQBA 2Q6ZA 3TQ0A 4IG2A 4KCVA 4PMDA 3VKJA 4BQ5A 3KZSA 4POCA 3A22A 4XZLX 1JVNA 4NNBA 2QPXA 1R9ZA 4M8UA 1PZ2A 4TU1A 3CQ0A 3KHJA 1TJPA 1ZAIA 3EXSA 1WZKA 4IL2A 1Q6OA 2Y89A 4M81A 4PB5A 3WH5A 1VLWA 4RNFA 1IYXA 2QCGA 2PI6A 4I9AA 1JYWA 1ZPTA 1MQRA 4V2XA 2ZRXA 2CKSA 1XIBA 4AH7A 4HOXA 2YFNA 3GIYA 3V3WA 2V3DA 3M07A 2AKZA 3TWBA 3M0MA 3V75A 3T55A 5DMNA 3PC0A 3WJSA 2OB3A 1ALDA 3OHMB 4R33A 2Z6IA 4GJIA 3GUGA 1SJCA 1R2TA 4ILSA 3THQA 2OZTA 4ASTA 3H2OA 5CPNA 2HPMA 1M7OA 1M6JA 4NAEB 2E25A 2WC7A 4V28A 2AL2B 1VFLA 3UF9A 3GS6A 4ERIA 2JQXA 3CMJA 3DG6A 1XC6A 1ENUA 4O1BA 1B4EA 3GH5A 4P61A 3WLLA 1BRLA 3JUGA 5EPDA 3RN6A 1D3CA 3A24A 4O10A 3A12A 3B3DA 4LCQA 3HQPA 2PDWA 4JYFA 3M41A 3HGJA 4WSJA 5EMMA 1PZ1A 1E4LA 2V3EA 5ABFA 1Q6RA 1VLIA 2VFEA 3P62A 3PZTA 4RJEA 1EF2A 1O7AA 2OSWA 3IVTA 1BGGA 3LS9A 2RUSA 5AB3A 3PJTA 1AL7A 1Q7MA 3GXFA 3MCOA 1PTAA 1DIKA 4Z17A 3WX7A 1A5KC 4OBSA 4MJ4A 3DHDA 2G3FA 4AVOA 2YL5A 1UD3A 2F84A 4KIEA 1O5XA 2V38A 4RKAA 4KIRA 4LYRA 4ADSA 1UKQA 1S1RA 5D03A 3OBEA 1LOLA 1R3YA 4UTIA 3FVMA 2RJHA 1RVKA 2Y7FA 4L4LA 2VX4A 3L0NA 2F9RA 1FHLA 2RAGA 3TZNA 1V3JA 3CWNA 5G4EA 2FPVA 3PZVA 1CGUA 5BW6A 3BTNA 3T07A 3F5LA 2Y7DA 3FN9A 1XBZA 4IIHA 1OCNA 1DJIA 1DWAM 2WOQA 4Z0SA 4NYYA 1CB2A 3QLDA 2QJNA 1E5JA 4PTDA 1IT0A 3SM0A 3FGCA 4WKHA 1IIHA 3WNKA 3ITCA 2DU2A 3N2OA 1OD8A 4NNCA 6XIMA 1XRVA 3IPWA 5BYWA 1KXQA 1QATA 5CZTA 1OIFA 5LXEA 1SU5A 4PSRA 4OTKA 1OC5A 3ZLGA 3WNPA 4Q8PA 5DBUA 2H3BA 1LUCB 1ZS2A 4NZ5A 1EDTA 1RPXA 2JALA 2IQ0A 5D8ZA 3ZOAA 2OODA 3ARQA 3BG5A 4XZ9A 1OEPA 4ZENA 1WCGA 2E9MA 4W5ZA 1A5UA 3ZJKA 1UJPA 1QRQA 1KTBA 3A3XA 5G2WA 4NZ1A 1RQEA 1HKWA 4DLFA 3WEMA 1H49A 1E0UA 4WIWA 1Z89A 6REQA 4XSMA 2QYGA 2CXGA 2WPBA 3JZUA 4W84A 4AFYA 1GW1A 1X1OA 4GYKA 4NI3A 3HMJG 4C6OA 3P8IA 4NL1A 3SUWA 1OD0A 2GSHA 4QHRA 4YTTA 5A95A 3UPMA 3OBAA 3OO2A 1HTIA 4O8RA 3H7VA 2J9YA 4HU0A 3FYOA 4RE3A 4CVWA 1L6FA 4UTLA 3WN6A 1S2UA 1KGUA 3WMSA 4JIQA 1UKTA 3OZPA 1WXJA 2WMHA 3UR7A 1AD1A 2YCJA 4QFUA 1KXTA 3IJ9A 5I79A 3A4JA 3ICJA 2FGLA 1E71M 4KT2A 2H3DA 2YCIX 2ESCA 4DPQA 1GZGA 1O1ZA 1QXLA 4Q8MA 1KLZA 1BF6A 1WV2A 3NDZA 3PTDA 4R3UA 3M0LA 1GVOA 4PMNA 1UUOA 5DXYA 3WDJA 3N6QA 1TFVA 1GQIA 2J13A 2QJJA 4HPXA 3LHWA 3PNUA 2DORA 3N4FA 3KOYA 1HZYA 3GDLA 1R87A 3OGVA 3M9YA 1S2CA 5FJJA 1YQ2A 4X9YA 4AYSA 3F03K 2EG6A 3N3TA 1E5NA 3R89A 3CQKA 5E9XA 4JD4A 4AEFA 1UD6A 3FJ6A 1T7LA 1T8QA 3I4KA 2WNWA 3IIPA 3PM6A 2C14A 3HQOA 4D2JA 3QH2A 3WL0A 3KAOA 3W7LA 3MS8A 4B15A 2OR2A 3VD9A 3BLEA 4NI8A 4HK5A 1FWBC 4UOJA 3BCJA 1E6XM 1O60A 3SBFA 1JAEA 4PRTA 4JKKA 5GJMA 1NU5A 4JXCA 4I6KA 4ZE5A 1FTXA 1Y0EA 1V6XA 3MV01 2PDQA 2PU0A 3EX2A 3OQ8A 4A2SA 3S5ZA 3W1UA 2J75A 4K8EA 3ZJ6A 1XLGA 4O1EA 3W1XA 5EBUA 2E8ZA 3GYEA 3V7PA 1XX1A 3ABRA 1ZNNA 2PWHA 4JCLA 5CC3A 1F3WA 1VPYA 3QQWA 1F3XA 2PLKA 3N12A 3EPOA 4LAUA 4Q6JA 2WBKA 2Y61A 4O50A 3T40A 1Y8BA 3W87A 3L4XA 1WDQA 1HXJA 2ZDSA 1UR1A 1XR2A 2PDGA 2ZZ3A 3UZYA 4E4PA 1L8PA 1TWWA 2A7PA 1NDZA 4LY4A 1EJWC 3W2JA 1ZZMA 4FK9A 5IM51 3CWOX 1Q6GA 2PWVA 5J8LA 3LCGA 4GUJA 3VD5A 5J04A 4F79A 4G6CA 1XIJA 1TTPA 4D72A 1XDLA 2HBVA 3TTOA 4QXIA 3WUGA 1NF0A 1E6QM 1ONXA 3EXTA 1H1NA 1XLHA 3VO0A 3WQCA 3CQIA 4ALDA 1FP8A 5AHLA 1NFPA 3RO8A 3CL6A 2FPYA 2HK0A 1V6WA 2C91A 1ZJBA 1CGWA 3IJ6A 2R1LA 1P0NA 3W70A 3W6MA 2GJLA 1OK4A 2WQPA 3NQ2A 2YIHA 5LGXA 2R82A 4P8XA 4UMCA 3TE9A 1OJXA 1LQ2A 1MQQA 4JFUA 4OQVA 1UQZA 3SCQA 4IJRA 2DZAA 1AFSA 1ESWA 3B4UA 1BG4A 3DXIA 1QCWA 4QQ3A 3MDUA 3GNXA 2A85A 1DQWA 4TX8A 4Y9MA 3QYSA 2XIOA 5FJPA 4MY8A 2J88A 3GYCA 5K4XA 1LLWA 3ALFA 1D7FA 3BW3A 4NXSA 4NZFA 5CLTA 1XQLA 2ZWZA 3GXTA 3AUOA 1PV8A 2OVLA 3PPCA 4P8WA 4WXYA 3A3WA 3E3HA 2BNJA 3E0IA 3KRZA 4NZJA 1V7AA 4LAZA 1YNPA 3LCIA 2DZVA 4TV6A 2VD8A 2DZPA 1H41A 3UZZA 1FDJA 2G96A 3IVSA 3QHOA 4GOAA 4IFKB 4IXHA 2ZA3A 4LH8A 4AZ5A 1AJZA 2PP3A 2QUMA 2A6LA 4ZB5A 4C6KA 1RLCL 4UCFA 3WLKX 1DWFM 3W7RA 4RK8A 4GUHA 2BY3A 2XFRA 3MMDA 4Z1YA 1UASA 3HIJA 4IM4A 2CPUA 3QV7A 1UZHA 4UNLA 3SURA 2Z7KA 3SRFA 3PWIA 1VJZA 3PN8A 1K4HA 1TR1A 2YL8A 1PKYA 3ISIX 4MYAA 3T7VA 3K13A 3NL6A 3P80A 2ON3A 1QI5A 3M5VA 1VJSA