1MRQA

Crystal structure of human 20alpha-hsd in ternary complex with nadp and 20alpha-hydroxy-progesterone
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
323
structure length
323
Chain Sequence
QDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C1
publication title Human 20alpha-hydroxysteroid dehydrogenase: crystallographic and site-directed mutagenesis studies lead to the identification of an alternative binding site for C21-steroids.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 323
sequence length 323
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1mrqA00
3VXGA 2FGBA 3UGRA 4JQ4A 2NVDA 4H7CA 3GHTA 2I16A 4JIIX 1QRQA 1T41A 1XGDA 4FZIA 4GCAA 1VBJA 3MB9A 5M2FX 1JEZA 2PDFA 3FX4A 5HA7A 2ISFA 3QKZA 3UYIA 2NVCA 4JIRA 3V35A 4JTDA 1VP5A 2A79A 1US0A 2PDCA 4YU1A 4XZIA 4MHBA 2INZA 3M4HA 2WZTA 2FVLA 2PDWA 4DBWA 2PDQA 3H7UA 1LQAA 2PDIA 4H8NA 1ZSXA 2F38A 3V0UA 3R58A 4JIHA 4LBSA 2PD5A 1J96A 4JTQA 4R9OA 1YNQA 1YNPA 4YS1A 2PDJA 1ADSA 3P2VA 5DANA 2PDHA 4YVXA 3G1RA 2IQDA 1MZRA 1S2CA 3EB4A 5JH1A 1X96A 3LENA 1Z3NA 1M9HA 2F2KA 3UFYA 3F7JA 2PDUA 2HDJA 3LNMA 4Q7BA 4GIEA 4XZHA 2PF8A 1PYFA 3GHRA 2CLPA 2PDBA 1PZ1A 1MI3A 3C3UA 1EL3A 3B3DA 2WZMA 3S3GA 5LIXX 2ACUA 4LB4A 4WEVX 1HQTA 1C9WA 2BGSA 2PDNA 4RPQA 5HNUA 1RY8A 4FA3A 3RX3A 1OG6A 4IGSA 3UWEA 3V0TA 2BGQA 4HBKA 4PR4A 3R7MA 4EXBA 3LBOA 4QX4A 1K8CA 2HVOA 2IPWA 4LAZA 3UP8A 3WCZA 4WDWA 5LIYX 1PWMA 2ALRA 2QXWA 1PWLA 1UR3M 2HEJA 5KETA 2ACRA 1ZQ5A 3EB3A 4HMNA 3GHUA 1A80A 1RY0A 3V0SA 1Z89A 4GACA 4GABA 2PDMA 1HW6A 3CAVA 3UZZA 3LQGA 2HV5A 4IJCA 4LB3A 1YE6A 3LZ5A 2P5NA 1AFSA 3V36A 3BV7A 4JQAA 1YE4A 3BUVA 3CASA 5LIKX 4DZ5A 4LAUA 2IPJA 4WRHA 4JQ3A 1IHIA 1RALA 4GQGA 4JQ2A 2VDGA 4QBXA 4JTRA 5HNTA 3BURA 1Z9AA 3CV6A 2C91A 3LZ3A 3GUGA 2IKGA 4PUWA 1AH3A 2DUXA 4XAPA 3LUTA 3LEPA 4XO7A 2I17A 3N2TA 1Z8AA 3M0IA 2IKJA 4GQ0A 4DBUA 1Q13A 2DV0A 3WBWA 3RX2A 4LBRA 2IKHA 4YVPA 4WDXA 2J8TA 2ACSA 2HVNA 5JH2A 2HE8A 3G5EA 3DOPA 4WGHA 1PZ0A 2PZNA 3EAUA 3Q65A 4XZMX 3R8GA 3LD5A 4JTCA 4XZLX 1T40A 3ONCA 4FALA 4WDTA 4QXIA 3KRBA 4OTKA 2AGTA 3WG6A 1LWIA 4XK2A 2HE5A 3R6IA 1GVEA 3D3FA 1Q5MA 2PDPA 3U2CA 3CAQA 5C7HA 1AZ2A 5AZ0A 1AH4A 1XF0A 4GA8A 4AUBA 4YVVA 4ASTA 2DUZA 2PEVA 4PUUA 3LQLA 4XVEA 1QWKA 4XO6A 4PRRA 1EKOA 4DBSA 4IJRA 2IKIA 1XJBA 1ZGDA 1S1RA 2IPFA 1ZUAX 4JQ1A 4ICCX 3H7RA 1S1PA 3UZWA 4NKCA 3CV7A 2FZ9A 2PDGA 2FZ8A 4PRTA 3NTYA 4F40A 5AZ1A 2PD9A 3FJNA 3O3RA 1MRQA 2PDLA 3RX4A 3Q67A 2BP1A 4PMJA 4QR6A 1EF3A 2R9RA 5LIWX 1FRBA 1R38A 3BCJA 2R24A 2ACQA 3WBXA 3GHSA 1EXBA 1AZ1A 2FZBA 4G5DA 1X97A 3UZXA 3H4GA 4I5XA 3COTA 3R94A 4WDUA 2PDXA 1SM9A 2FZDA 1X98A 2IS7A 3CMFA 3MC5A 2INEA 2IPGA 3R8HA 3T42A 3WBYA 3ERPA 4XZNX 1AH0A 2PDKA 2PFHA 4Q3MA 4L1WA 3DN5A 3UG8A 5LIUX 4FAMA 4L1XA 4JTAA 3ONBA 3LN3A 4EXAA 3R43A 2IQ0A 3N6QA 3UZYA 4XVDA 3O0KA 4ZFCA 2PDYA 3M64A 1S2AA 1IEIA
chains in the Genus database with same CATH superfamily
3FNDA 2WB5A 5C6MA 4A2RA 4V33A 3GR7A 4XSMA 1I60A 4JQ4A 3PTQA 1EWEA 4CKQA 4LVGA 3DBNA 3L0GA 3P8IA 3T4WA 3YPIA 2R1KA 1MDLA 1QCWA 4IMCA 1VKFA 3I7RA 1XKJA 5EGRA 4OE7A 1YPIA 1J5TA 4I7WA 1E70M 1R30A 1WP6A 3HPFA 1F2JA 1VD6A 3M41A 5FD0A 4JTHA 4DJFD 1Q7MA 2UY5A 1R2RA 2PTZA 2XIMA 4KQNA 5HQLA 3LCXA 4XD5A 4TMCA 2O0TA 2UY4A 5A8MA 4CNNA 3UPWA 2J7DA 3LCFA 5JIPA 1D3HA 4B3KA 4CD6A 4MB5A 4G6CA 2G3JA 4IFKA 8A3HA 4MG4A 4J3TA 1UP2A 3WF3A 1H1NA 3P81A 3UNDA 3UJ2A 4YVXA 3ARQA 1UD3A 2WBKA 3AMGA 3W2NA 4AY7A 3W7RA 2FMOA 3VKAA 3A21A 5BW6A 2VDHA 2BB0A 3WH6A 4HSHA 2PDUA 3NEVA 4AHQA 3K8MA 4M5PA 1P1XA 1GT8A 3EDEA 4KBXA 1TX0A 4JYEA 2WMFA 3EOSA 4PTNA 4YCPA 3CZLA 4IMGA 3RPMA 2A3AA 1ONWA 4QRNA 4RV3A 3MBFA 1KCXA 3NPUA 2ZXBA 1I4NA 1XKYA 4F8XA 2NQJA 4GYPA 3NXFA 4B15A 5HINA 5EPDA 1LF1A 5DMLA 5I07A 4C5YA 3VGDA 2O56A 4DWSC 3RX3A 1DL3A 3SQSA 4I8YA 3LXBA 1KGWA 1X39A 2HVOA 4IFKB 4LYPA 2VZOA 4DPPA 4TR9A 1LLZA 3UP8A 3RCNA 4IICA 1QATA 1OHLA 2VGIA 3O15A 3FYYA 1AW2A 2R14A 4GABA 4BI7A 1TUXA 3FLUA 4IJCA 4MGGA 2OSWA 1HKJA 2PWHA 1AFSA 1XRFA 3BMVA 2AMGA 4U5KA 2DVUA 3C61A 3V1PA 4JYDA 3DCPA 4KWVA 4AZ6A 2DZAA 3LBCA 4TX9A 1XSKA 4AVOA 3FK4A 1BF2A 4PYSA 3SCQA 4D6EA 3G1YA 3SAZA 4ZA0A 1RK6A 1ODUA 3BZJA 2ZICA 1UASA 1QAPA 1JF6A 1ML1A 3KCLA 3E2QA 1QI3A 6A3HA 2TYSA 3OTRA 5LA2A 3O6AA 1RUSA 1HJSA 1SPQA 2JALA 4J3VA 3CUJA 3IK4A 4PMRA 2PPGA 3L4ZA 4YVPA 3H21A 3C2VA 2VHLA 3BGJA 4YCOA 2G4FA 1MW2A 2R8WA 4IISA 5C2GA 1UWUA 3LHYA 3EAUA 1H62A 4IIHA 1HUVA 3NVDA 1QDSA 3PWIA 4F2UA 3EEGA 4Z17A 3GXMA 4DJDA 4ZBCA 1JFXA 3CIVA 1TZ9A 1KW1A 4FLRA 3KRSA 1XCWA 1VFFA 5FACA 4TOQA 3RU8X 1RQHA 5J5DA 2QUVA 5BRPA 3P80A 1SZRA 4JFVA 4MWAB 3IJDA 3CIWA 1GUVA 3DIPA 4EAMA 3VGEA 3ZLFA 3S1UA 5DY3A 3GH4A 1IR2A 3TFCA 3SGUA 2DUAA 3VGFA 1XUUA 3FOKA 1JQVA 2IKIA 2V81A 1HG3A 3BLIA 3W82A 2Y8KA 3ELFA 4RPPA 3E5BA 1HJXA 4WY0A 3PPHA 3PTMA 3QTPA 4Q7NA 3VGBA 2WSPA 4L9YA 1BQGA 3V18A 4C65A 3ANYA 4AVNA 5JXQA 4LVAA 4REQB 3BMWA 3FV9A 4B3LA 1XCFA 5CPMA 4Q7IA 1DV7A 3LI0A 2HSAA 4QR6A 2R9RA 2OQHA 1WA3A 1ZB5A 1XV8A 4HP5A 1EQCA 1UH2A 4YNGA 2O7QA 3LU2A 1KTCA 2BDQA 5A8GA 2HCVA 1X97A 1RV8A 3ABZA 3BSMA 4RLIA 1XD1A 4OV9A 1SR9A 2OFJA 3U2ZA 3WNKA 3E2SA 4WDUA 3CL8A 2DZVA 3PZ9A 5G4EA 5BNKA 3MKVA 1SM9A 2GVGA 4UTJA 4LWWA 3NJ3A 2QCDB 1QK2A 4R9XA 4IMAA 4S3BA 1MFVA 2A2IA 3EWZA 1TA3B 4WY0B 1DE5A 1XYMA 2FZNA 4PRWA 4U3CA 1VFLA 4BQ4A 4D1JA 5HBFA 4W89A 1EC8A 2VEMA 1F07A 4HK5A 1E6XM 4H6KA 3A4JA 4Z1BA 1XDJA 4B16A 2WSRA 3EZ4A 3AJXA 4JTAA 2RDUA 4OHQA 2VFIA 4HJFA 1F74A 1TPFA 2QF7A 1ADDA 2P1FA 4NT0A 1UKOA 3U5YA 2ICSA 1H1YA 2E9MA 3WQ4A 3LERA 4KWSA 3P0XA 1E0TA 6PTDA 2QCGA 2VX7A 2X8RA 1O1ZA 1MMFA 2V5LA 4HD5A 4W93A 3IARA 1S2AA 3WJXA 1GQKA 3FKRA 3H4WA 2YDQA 3LM3A 2DPEA 4KWOA 3RAOA 1YTDA 3SFWA 3MS8A 3FJLA 3WEMA 3SCSA 5LYRA 1AJZA 1I2OA 1M65A 3ABQA 3OIXA 1OX6A 3O63A 2PRHA 4AMAA 4J3SA 4G7FA 5HJXA 2DZBA 5HA7A 2TODA 3SBFA 1U30A 3IIXA 3L2IA 4JIRA 4UR8A 2YA1A 4JYFA 1EJXC 3W1NA 1UKQA 1R6WA 1A5CA 5EMLA 1KWGA 1NWUA 4CEXC 4J9JA 2GUUA 5D2XA 4CQDA 1J9YA 1OFEA 1GOQA 5GNYA 3WIJA 2ZRUA 2EJ1A 1RZMA 5KSWA 2Y1HA 3AUJA 3LDVA 4DXKA 2XVLA 1L6YA 4BF7A 1V6XA 4JTQA 5GJMA 2NXGA 4N0RA 3ABRA 2GWNA 2XH7A 4EWJA 1VEMA 4KRZA 1GQJA 3L65A 4NAFA 3TX9A 2DZWA 3G1RA 4PL2A 3GXIA 3L12A 3N25A 1KTNA 3LENA 7ODCA 1K7EA 5DFAA 1JNEA 4HNCA 3QKEA 1GKPA 1JZ3A 1JPHA 3LNMA 1K8ZA 5AFDA 1BWKA 4KCUA 3MJYA 4LXFA 3HIJA 4DX3A 3C3UA 1EL3A 1R3SA 4GY7A 3LXAA 3S2NA 1B90A 1BSIA 1WAUA 1LZOA 5HUPA 5AYYA 2WK2A 4I9JA 4MKVA 5I24A 3FSUA 1FH8A 1Z6KA 4C6LA 1GQLA 4EXBA 3FYOA 1ISYA 4D6CA 1EUNA 3AIQA 4RW5A 3QTGA 2CLHA 3MSRA 3LRKA 4KF1A 3SRDA 1P0KA 4NAFB 4NYYA 2W0UA 1HNYA 1R85A 4M6UA 4A05A 5F1UA 3ZOAA 2CCRA 3GHUA 4QCEA 3HGSA 2IW0A 3IJ7A 4K6AA 4W5ZA 4LUTA 3GNOA 2CHOA 5A8PA 2PDMA 1IXQA 1V03A 1PCKA 4JL1A 1TWWA 3S5ZA 2CC0A 3PSWA 2OXNA 4AIEA 6XIMA 5K3VA 4IP4A 4WRHA 3UYCA 1OJXA 3IJ8A 4PULA 4GQGA 4E2BA 4PMNA 1B4EA 1RH9A 1E72M 3A22A 1VZWA 4JHMA 4V28A 5FJOA 1Q6DA 3R8RA 2VGBA 3MCNA 3GNDA 2J78A 2L5HA 3SFKA 1T96A 3NQBA 1XYCA 1EJTC 2B4GA 4O18A 5XIMA 1UWIA 1W5MA 3SCVA 1EO7A 4MFDA 1ZP3A 1JRCA 1K03A 2ZX7A 3VI2A 1CWYA 4JX4A 2IKJA 3F4DA 4KKXA 2NQ5A 2QAFA 2R94A 1QHOA 4PTWA 1Q6QA 2P3ZA 2CWXA 3MI6A 2YR1A 5CJNA 1PO9A 3TOPA 1KCKA 4LBRA 3EKZA 1M1BA 1OBAA 1SZFA 1KFCA 1GOIA 1CGTA 3WDPP 3F2BA 5JH2A 2VWSA 4YIWA 4DYEA 2ZZ4A 2ZCGA 4FNRA 1JYWA 4IX2A 6CGTA 3ONCA 5EMYA 3KRBA 1H50A 1CGUA 1VPXA 4OTKA 2IUZA 5EFFA 1YBQB 3SY1A 4L4OA 3FY1A 3L21A 1B0IA 1TMQA 3W86A 1YYAA 3ITXA 4EPEC 4Q4OA 2ZX6A 4W8BA 3WUEA 4J27A 2O55A 1AZ2A 2KAUC 3NSXA 3EDKA 1QWKA 2FKPA 3MI3A 2WSYA 4WD0A 1EP2A 1GVRA 1WCGA 4FS9A 1CXFA 3C2EA 4PFHA 3EWYA 2DGAA 1A3XA 1ZGDA 3LSBA 1XH1A 1W3JA 3PB0A 4LX4A 5A69A 1TQJA 1VEOA 2KZHA 4I3GA 3OGVA 5F4SA 1R47A 3CV7A 1FTXA 4AZCB 1OX4B 4PRTA 1Z48A 4F40A 1IR1A 3GNXA 1XGEA 2YOCA 4JXCA 4U10A 3S1XA 4KS0A 4J35A 5FEPA 4ZXLA 3U3HA 4M82A 3ZJ7A 1RAKA 2E7FA 4P5UA 2RDTA 2W67A 2WMJA 2OU4A 1ISVA 2UY2A 2ZA1A 2EQDA 3F2CA 1RCXB 2BY3A 4JFUA 2NLYA 1ESWA 1TPC1 5HMEA 3KDOA 3MWCA 4I5XA 4G7EA 2V3GA 1J11A 2PDXA 2ZC1A 3B8VA 3WLOA 3R4IA 1MSSA 1POJA 3NM3A 1PV8A 3DHPA 3VAVA 3LHVA 3F4VA 5KZEA 2E0PA 2ZZ5A 3KL5A 5EYWA 4M80A 3EX1A 1AW5A 1Q7ZA 2CNCA 3W7EA 1QI4A 3HQPA 7TIMA 3G3MA 2ADAA 3W88A 3FW6A 4JIEA 5H8UA 2EG6A 4HNOA 3EOUA 2YBVA 4XUGA 3URQA 4ACZA 1QTWA 1KRCC 3UZYA 3GTHA 1GG1A 4IGMA 2PP0A 4Z0JA 4JNMA 8TIMA 4KW2A 4KCVA 3QV9A 1U1HA 3UW6A 4G7EB 1BG4A 3I10A 3BARA 1ZP4A 3VKJA 2J8GA 1OC7A 3GHTA 1DVJA 3UT0A 2OJPA 3GXPA 3UR5A 2PUZA 5AHIA 3TYCA 1W3KA 1B3VA 4IFOA 4RJEA 2YA2A 3W37A 1B5TA 5DEZA 2ZUMA 5E9AA 4TUFA 4JTDA 4MIMA 3WKZA 1TV2A 3OVGA 3QV8A 4S23A 2JIWA 4RDZA 4RZ6A 3S47A 2YL6A 1VS1A 1TRIA 3KBVA 1LT7A 1YHTA 5I78A 4RNHA 3H7UA 1LYXA 1H63A 2P10A 3PY2A 4Z2GA 5PTDA 4JIHA 3F4CA 1PIGA 3NQAA 3UGVA 1CEOA 4C1LA 4IIBA 1Q2SA 2ONEA 1TPDA 3QF0A 3NYDA 4PUKA 1MZRA 3T8LA 5JH1A 3M6YA 3PBGA 4C6FA 1X96A 2RDXA 5BU6A 3PBYA 2D0GA 3CQIA 4K38A 3CV1A 4L9ZA 1CXKA 3NZPA 1E0VA 3ZJ6A 1D7KA 4XZHA 3CHVA 2B81A 1H41A 3N73A 2H9AB 1FHVA 3T0TA 1XSJA 3QPYA 4LSBA 3BLKA 4LC6A 1BQCA 1JNDA 1NDWA 1TJ0A 2ACUA 3UPMA 1A5LC 5CC7A 4CUCA 4GYKA 1KKRA 2FYMA 4M19A 4ZL1A 1N8FA 1SYTA 3ZJ8A 4PMOA 4IXXA 2YLLA 3PUOA 1GORA 1WNOA 3N4FA 1CYGA 3LI1A 5D8WA 2Z1VA 1RJPA 2DY3A 3OOQA 4R27A 2IPWA 1VJIA 4HVXA 1GVQA 2WV8A 1PIFA 1CB2A 1NTHA 3VNMA 2CZEA 4HNLA 4Z08A 3TFXA 1DJIA 1E3XA 2Q3RA 1D8WA 5B7YA 1E71M 3V5CA 3TTYA 4F4RA 3UF9A 4UTFA 3BLDA 2MNRA 3G1SA 1O66A 3VNKA 1DORA 3LCHA 4CNOA 1W8SA 1F4AA 3BTNA 1JZ4A 4RDWA 4GUGA 4C6EA 2VCCA 2HJPA 3NGFA 2Z6IA 4NJKA 4GYPC 1NWTA 1R0MA 2ABAA 2VDGA 5C9WA 1Y65A 4J40A 3VIOA 3BG5A 4JY8A 4A3YA 4KGLA 3FDGA 4XBJA 4K1WA 1YX1A 3TVAA 3BV4A 2DT3A 1CGXA 5CLTA 2E28A 4S1FA 1LQ0A 3NQVA 5I3FA 1YNYA 1WZLA 1LG2A 3T4CA 3NXLA 3QFWA 2Z25A 5D30A 1PTGA 3N34A 4HK7A 3NSMA 4XO7A 4R3UA 1K4HA 2DVTA 5A8OA 4O1CA 2QV5A 5AC7A 5I3GA 2J9XA 3IGXA 1UBPC 3RX2A 4FNQA 1XH2A 4J2MA 3CIXA 1HX0A 2PODA 3WH7A 1L9WA 1CLXA 1AQHA 4L61A 4C6CA 3GU2A 5EL1A 1KCLA 5C8BB 1O5QA 1KFBA 2G3NA 2NXHA 5D9NA 3G1FA 4QXIA 4HU0A 1HVQA 4HCLA 1SFTA 4C7DA 4XD3A 2F2HA 1CGYA 1ICQA 1Y7VA 4RZ5A 4DM1A 1TR1A 2C8NA 3P5YA 4FPSA 3GKAA 3OIHA 3TYUA 3EMQA 1ZRQA 3VVGA 5EMUA 2D2GA 3PBUA 4FK9A 4I9AA 2QJHA 5EBUA 4JKLA 3GVGA 3I65A 2ZXAA 4HZMA 1TJ1A 4H3DA 2NX9A 1W1TA 4Z1CA 4S2BA 4ADSA 4J3ZA 4GZ7A 3ZQ9A 4O1EA 2ZXQA 1VBRA 3M1ZA 5AHFA 3BO9A 4D8LA 3PNUA 2J7BA 1RPXA 4AZGA 1G69A 1W1ZA 1K77A 3RUBL 3PTDA 5G2WA 3UJFA 2FPYA 3VO0A 2H90A 3VCCA 4QCFA 1DTNA 2HXUA 1Q66A 1NFGA 2Y8UA 1ZBKA 5KEZA 3GIQA 3ZT5A 2XGIA 3AHYA 4GVGA 2XJ7A 4UOJA 4JN7A 3LY0A 3N11A 1FRBA 2R24A 1IV8A 3SZ8A 1YQ2A 3H2FA 4YTSA 1V6VA 4UTTA 2BXVA 1O95A 3SRFA 4O57A 1LBLA 1ITCA 4PB3A 2GK1A 4F9DA 2FZDA 4I5UA 1ZPTA 3N15A 3PJWA 2O9RA 2OO0A 1FHLA 4JS3A 4D2JA 3XISA 3T42A 3EPNA 1JD7A 4KIRA 3IIOA 1DHPA 4AD4A 2FPTA 4MM1A 1BKSA 1LOQA 1XC4A 2PDKA 1B3OA 3DHFA 2R1MA 5DBTA 1RSCA 4RDVA 3E3HA 3ONBA 3IWPA 1UPPA 2Z2UA 3LN3A 2WHLA 3QR0A 4KFPA 1H7RA 1LL7A 3SSJA 4FOKA 4Y9PA 2HTMA 1RQEA 2PP3A 3ARUA 3S6TA 1ZFJA 1QPRA 4YPJA 2PDYA 2QJJA 4RZ4A 3W02A 4C1NA 1UMLA 2X30A 1OCNA 3AXKA 1XIIA 1W9VA 1OM0A 4FXJA 3M46A 4QDPA 4MJ2A 3FHAA 1FWBC 2GK1B 3M16A 3OVQA 2HMCA 1XG3A 3CUZA 4W87A 3TNBA 2B7PA 3IJ9A 5A5WA 4NRSA 2OKOA 5CSRA 4C7GA 1VFTA 2PB1A 4NZJA 3QY8A 2PGEA 4WF7A 4MNLA 5DBUA 2XH4A 1RCQA 3W2KA 3QY6A 1TE6A 1I0DA 3JW7A 1REQB 1XG4A 1V4YA 2GOKA 3TN5A 3ALGA 2X2YA 4AZ7A 2EHHA 5EMMA 3HGRA 3AU6A 3INPA 1JPKA 4B90A 1MUCA 2VZSA 1P48A 3M4HA 1AD1A 1WZAA 1SUXA 1Q8JA 4MWAD 1LQAA 1XIFA 3ICJA 3M5XA 1KM5A 3CUHA 1I75A 1Q8AA 1UB3A 3SCNA 3AQUA 1J96A 4JKKA 2X0SA 2XH0A 4F0RA 1IF2A 5F1VA 4UQDA 5AC6A 1GOXA 3LV5A 4DAIA 1E6QM 1P6BA 1IXOA 3DYMA 3I4EA 3DFNA 2J62A 4JNYA 3KUMA 3GXDA 3MUZ1 4HMEA 2ZUNA 4HSNA 5RUBA 2ZKMX 5HPOA 1GEHA 4DJDD 4Q6JA 1GQIA 2PF8A 3ZT6A 2GZXA 2GQAA 1K7FA 1A0DA 2BOEX 3B3DA 3QPEA 3UCQA 4MDOA 4C6NA 5I3HA 2QJIA 4CGTA 4H4IA 1E1CA 1C9WA 1V8EA 3SUVA 4EIVA 3BLPX 3I3BA 5BXTA 3P8JA 1U1UA 3VCRA 4BZYA 1S46A 2J24A 3EDJA 4K2SA 2CFFA 1UD4A 2WAGA 3LCWA 2GDUA 1TYGA 2HS6A 1MQPA 2PC8A 3W4RA 1EFZA 5E0KA 2DDXA 2ZQ0A 2EKCA 3NG3A 3MT1A 5T26A 1UR3M 1K8XA 3U6WA 2O4QA 1FOBA 3NQMA 4ZXOA 1NY1A 3GW3A 4NZ5A 3RCYA 3EMCA 4H8HA 3FSTA 3NM1A 3UXAA 1UPMB 2XIBA 1TR9A 3WQ5A 1JCXA 5KZMA 2ISWA 3E1F1 1B54A 1QW9A 1LT8A 4QJ5B 5U7SA 4NF7A 2YBTA 3AXIA 4O1DA 3CL7A 4LAUA 2DH2A 4HA3A 1BD0A 4NJIA 4MOZA 1PVNA 2Y63A 1BYAA 1UYQA 3UVIA 4Q8OA 3QM3A 1W2PA 2Y5SA 5B80A 2WPBA 3NGJA 4MB4A 4LUSA 3W76A 2J7HA 5HNTA 3KVJA 4MPKA 2GJXA 3KEHA 4GE8A 1DKWA 4NRRA 4Z2JA 4DZHA 1SMAA 2A3BA 3N12A 4U3AA 3RR4A 4XBKA 3HM7A 4DYKA 4TMBA 5C7VA 1TV7A 1QPNA 3ITTA 3E0IA 4KETA 1DWAM 5HMSA 3IAPA 3N2TA 2RGMA 1UA3A 4GXWA 1H51A 4LCRA 7PTDA 1G94A 1I8JA 1Q13A 2PWUA 1BEUA 5CPSA 4LYRA 4DBEA 1E6ZA 1PX8A 5BU9A 1CIUA 1VFHA 2ANUA 1FX6A 4WDXA 2GQ3A 3W38A 3UR7A 1H4PA 2CLOA 2ZVIA 3SURA 1Y8BA 2PA6A 2ZZ2A 3VMPA 1F3WA 3NA8A 4WDTA 4QISA 1W3HA 1UJPA 5IOBA 5LGXA 5H8PA 4QS6A 3QN3A 3WZ0E 2CLFA 4YTUA 2GJXB 3GH7A 1PKNA 1QNQA 2BFGA 2OEMA 4M6QA 4TV5A 3N14A 3APTA 3R79A 4GIRA 2QUNA 5F2GA 1FY6A 3UG3A 4IPIA 1G4SA 3TSDA 4O8AA 3BQ6A 1T99A 1LLOA 4JCLA 1V6YA 4PUUA 1ZL1A 3D47A 4J2PA 4V1XA 1K9TA 1O4UA 2XN0A 4GQQA 1OFRA 4RKAA 1XIDA 1QR7A 3NQGA 4LVBA 3HMCA 3RJXA 3KM8A 2A7NA 1X1NA 1SO6A 4XAGA 4FF5A 4X3ZA 2G95A 4AC7C 1XIJA 4GI9A 3EB2A 4JZ5A 4AD2A 5AZ1A 1PCWA 4EPDC 3VD7A 5J8LA 1MRQA 4F0LA 2EPNA 2X1IA 3WN6A 2VD8A 4L6HA 3VIPA 1ZBWA 2OYKA 2PGFA 3SCTA 1B3YA 1CECA 4C6QA 1L2UA 3WBXA 3M0MA 3MY9A 3A23A 3B9DA 5CBJA 4PSRA 4LS0A 3HG2A 4OQVA 2VEPA 1F6PA 2KX9A 4AYGA 2GSHA 5JMUA 3MMWA 4RUBA 1D8CA 5JBDA 5IFTA 1G0CA 3AAMA 4NXKA 5BXRA 5EMKA 2BY1A 3QW4B 3O6YX 1TTJA 3UPBA 2G3FA 2VR4A 1N82A 2V5BA 5HDRA 1XS2A 3OVPA 4HA0A 5C9ZA 5FF2A 2YB4A 1HL8A 3SN0A 4MFEA 1EUAA 1J0IA 1O5XA 1IEVA 1MXSA 1KLYA 3QMSA 3WL0A 2PF0A 1CB7B 3V5FA 3BL3A 1KB3A 2E3ZA 2CW6A 3GTNA 2YXOA 4OV4A 4ROPA 3SECA 2V5CA 2FB2A 4E2OA 1GHSA 1EXPA 4GC3A 3WJYA 5EB8A 4N4PA 4W84A 4HNVA 1M41A 3B9AA 4QJ1A 3NQ8A 4YWIA 3T55A 2I16A 1QRQA 2D73A 4ML9A 3G1VA 5LSMA 2Y7FA 3D5HA 1EZ2A 3K5XA 3N9KA 4WGXA 4BCEA 3EA2A 2DQWA 3KLKA 4A8IA 3KOZA 2DJLA 1Y5VA 2E40A 2C6QA 2YCLA 1ZAJA 3W73A 3BOXA 4LH8A 3A6OA 2A79A 3LA4A 3CQKA 1F6KA 5I23A 1JPMA 4MHBA 4WOQA 4CN4A 1SSGA 2UWFA 3QMRA 2HZGA 1TV4A 2OEJA 4B5UA 5DCBA 4GYJA 3LX9A 3OHMB 3L4WA 3BGGA 1TQXA 3PZQA 4P7LA 4Q4MA 3SIZA 3GTXA 1W8GA 4PCSA 2XISA 1HKWA 3STEA 1UOKA 1ZU8A 4U2ZA 3T9PA 3W1PA 3GFYA 4DJFA 3CQJA 5FF4A 5FAJA 1S3TC 4ATWA 3CLMA 1UP3A 4LEQA 1NEYA 4ZVJA 2PLJA 4ZTXA 1J0ZA 2PBOA 3NYZA 4GO9A 2CERA 2PU0A 2AKMA 1ISZA 2OWXA 4U31A 3IEBA 3R0DA 3C4UA 3H2NA 4UB9A 3TW7A 3MUY1 4W4QA 5CJ5A 3VFLA 1G7UA 4M51A 4TX6A 2Z6JA 3SCPA 2O9OA 1O5KA 3B9EA 1V3IA 4MUZA 3R0UA 3MZ2A 3CPRA 5HNUA 4BQ5A 1M01A 3W28A 1JCLA 2X42A 3TXZA 2E6YA 1E3ZA 1Z32X 4A8NA 2FIQA 2AL2B 2IMRA 3THAA 5A95A 3RR1A 4OECA 4F3HA 4UQCA 3U7VA 1PWMA 1LUCA 2QT3A 1SJDA 2FGLA 4PBGA 1RVKA 4H9YA 2VZTA 1YEYA 1RY0A 3DHDA 1S5TA 4GMEA 4IQJA 1G9HA 3D3AA 3W1UA 3SI9A 1US3A 5DY2A 3CNYA 1R87A 3T81A 4LB3A 2BOGX 4WKHA 3WYZA 2CZDA 4CQBA 4KESA 2VC5A 1EPVA 3EMZA 4V27A 3PPFA 2QCEA 4O0ZA 3WNLA 3PZTA 4L65A 5LGZA 1F8IA 5A8QA 4UTUA 3QEZA 1OYAA 4JDYA 1V3KA 4A8RA 2WSKA 4M24A 4MVAA 4TTUA 3A5FA 3N9SA 2HWGA 4UMCA 2NQZA 1XYZA 3CAKA 2IQTA 2WNWA 2YSWA 3G8EA 3NQ2A 3ZO9A 3B4YA 2X16A 1QHZA 3RMJA 4QLLA 3N2CA 5FIPA 1NF7A 2BV9A 4GZIA 1J10A 2CZVA 2Y6ZA 6XIAA 3LHTA 1XL9A 1Z8AA 2DORA 3H53A 4H9UA 2QGHA 5FCZA 4H7ZA 1LLWA 1M04A 1T8QA 4GY1A 2BLEA 3F03K 1EJ7L 2WQDA 1DQWA 4B9YA 2J88A 3PULA 4GZJA 4PZVA 2GL5A 4H9MA 5C5YA 2FDSA 1XRVA 4YYFA 1ONEA 4MY8A 4MPQA 4F0MA 4BFAA 4DXVA 4U33A 5DCEA 4YYCA 4X9SA 3N6JA 4B4HA 1V93A 3NR0A 3W7HA 1TMHA 1AL8A 2QLYA 3FVDA 2EO7A 2G96A 4Q33A 5FKYA 1Q5MA 1P4CA 2GJNA 2R1PA 2VRQA 5C7HA 3I6TA 4DO4A 4R33A 3W6MA 3G1HA 3CU2A 4AIBA 2PLKA 4QS5A 3LQLA 4XVEA 4S3EA 3TDFA 1ZY9A 1E56A 4MB3A 3O6DA 4PRRA 4C1KA 1ECQA 3NDOA 1HTIA 1B3ZA 2BX7A 5JUVA 1HGYA 1HJVA 2CIPA 5DELA 2P8CA 4MJMA 5DMNA 4DF0A 2VDIA 5IBXA 5F4XA 3CUXA 4TVCA 2CBVA 1QFEA 1GHRA 3B05A 4MJZA 4UTLA 1H7NA 3TLLA 3HJEA 1ADOA 3W7NA 5C0QA 1TV8A 1FH9A 4PMJA 3OZYA 1M53A 3B8UA 4UNIA 4PTVA 4XB3A 1R38A 1WAWA 3VIMA 1EHNA 1A5UA 4FOUA 4JIQA 1HP5A 3UZXA 1HN1A 1DYSA 4PMXA 4AD1A 1Q6GA 2AKZA 1TTPA 4A29A 3TONA 1JZ7A 2QZRA 4W85A 1XHGA 1X98A 1EYWA 2VM8A 4KH2A 4IUGA 3FXGA 5AYXA 2PRMA 2E5DA 5LHFA 2G8ZA 4JFWA 3VNDA 3GSMA 4IF2A 3I7SA 4Z2KA 4AHPA 3DXIA 2WWDA 3MHUA 3LTSA 5KITA 4L1WA 1TVNA 3EA3A 3WLJA 2YFNA 4AC1X 4N02A 1BF6A 2RHGA 2QPSA 4H2CA 4Z2IA 3CO4A 3Q4DA 3R43A 4GBDA 2IQ0A 2NXIA 4HNTA 3HOJA 2QJMA 4UTTC 1ZJBA 4W5UA 3UZJA 1QBAA 1GK8A 3KOXA 4AF0A 2E68A 3VXGA 4CD7A 1X6LA 1NSJA 3NQDA 4I6KA 3N4EA 4A8LA 3E0FA 3BCFA 1L6SA 2C18A 3SN1A 1ZHAA 3PBVA 1LM1A 1T41A 3T2PA 3MVIA 4AWTA 4ZR8A 1TIWA 4N4QA 1TREA 2EGZA 4LUYA 4DZAA 3H4XA 1VYPX 4C6KA 1WDDA 6TIMA 4ZSUA 1DIKA 3BMXA 2NVAA 2HS8A 2YBUA 3U0HA 4OUIA 1ZBCA 3EA1A 3VABA 1NWRA 2WHKA 3DEQA 4F66A 1GEQA 3UVAA 3U57A 4PCFA 1IXNA 2I7GA 2X1UA 4BY3A 4RE3A 3LLDA 4BA0A 2HBVA 3BC9A 5I2UA 1PBGA 3CGTA 2BVYA 3PUGA 4AF0B 2PZ0A 1E51A 4DO6A 3LS9A 5D38A 3CB3A 2JEPA 3P2VA 1ME8A 1FHDA 1CZ1A 3QQ1A 3M0XA 4GLEA 2WO5A 4ZMGA 4LQ1A 1M9HA 3KFTA 1E4NA 3GAKA 2ZRZA 3N9RA 4CNTA 3SCUA 1Q6OA 4UZUA 5EBAA 3M7SA 1W3LA 2Y89A 3LTYA 3G0UA 4FLSA 5HANA 3F1QA 3L2MA 2WZMA 2QGYA 3MV01 3GXFA 4DNHA 2V30A 3F5JA 5F2MA 4D6IA 1A4MA 2H3DA 1YMYA 3LYEA 3CYVA 1L2QA 3VM5A 1OFOA 3HO8A 3ZSTA 3UJEA 4AWEA 2Q8ZA 2VRKA 2JE8A 2PDNA 4IWWA 4AWSA 3QZ6A 3LGGA 4N6EA 1PB0A 3SN4A 2JQXA 2MANA 4QX4A 4H83A 1R2TA 4ROQA 4ONVA 2ZZ3A 1PJ9A 4JEJA 2YL5A 4LW7A 4DNMA 5H2ZA 5BOFA 1C8YA 1OZMA 4LS1A 5JBFA 2QXWA 2C71A 1W9DM 3AOFA 4ZQOA 2E6FA 3LOTA 4LANA 4UUIA 2FMNA 3VD3A 3S4TA 2DIKA 4ACYA 4Q8UA 2VFHA 2D0HA 2FTPA 1Z89A 1RHCA 4KEUA 4GKLA 1IEXA 4LJ3A 4C6BA 4MNKA 3MYPA 3LQGA 4NP7A 4AY8A 1FWRA 3HPSA 1AJ2A 3UWZA 3B8TA 2FLIA 1DXIA 1A47A 4JTFA 4UR9A 1R7AA 1QNVA 2YLAA 1MQQA 3GR8A 4X22A 1IHIA 1SZGA 4OBSA 3AU2A 4ZTYA 4JQ2A 1EA9C 3W1AA 1G7VA 1BVNP 1W1A1 3GFZA 2D2HA 3AIEA 4W8AA 4L56A 5H91A 1E5NA 5D33A 4X60A 4JFTA 3LZ3A 1DWGM 3IVSA 1P0BA 1UA7A 1WDWA 1DIEA 3TTEA 2QS8A 4LT9A 4IG2B 2BNJA 4RL3A 3UCCA 1QOPA 1MQRA 2W3ZA 4Y8FA 2Z29A 1XISA 3QSTA 1K3UA 3WLMA 4AIUA 1OG0A 4QLJA 3TV8A 1LOLA 3RLVA 3AROA 4M29A 1PZ0A 3G77A 3WH5A 1WPCA 2REQB 4Q8PA 1TZZA 3R8GA 3M9YA 4NILA 3ZS4A 3NFUA 3QHNA 5I77A 1VB9A 1W1YA 4FHAA 3THUA 4H7VA 2J25A 3UJSA 2WOQA 3TW6A 3LRMA 2Z1WA 1HFBA 2WZHA 3A4WA 1RA0A 4IPJA 1DWJM 1YXCA 4GA8A 4AUBA 2XVNA 2NWRA 2DUZA 2XVKA 4NU7A 3KTXA 4JN8A 5CGTA 3HPXA 3BW4A 1J2BA 1F73A 3I6EA 3S8HA 4HMCA 3HGOA 4XAYA 2Z1XA 4DLFA 1UP0A 2WVSA 3N3MA 1KRMA 4ICCX 3ARTA 3TMQA 1S5VA 3M5YA 4J3WA 3RPDA 3C8NA 1KR1A 3GZAA 4E38A 2PWVA 2BY0A 3AYTA 3UG5A 5F2IA 4WX2A 1AJ0A 4F0HA 4KCWA 3CTTA 1LWHA 4H1ZA 4Q22A 1SZEA 3TC6A 3W24A 4H2HA 5FJJA 1NQ6A 1S5NA 4PUDA 4NY2A 1ISWA 5CJMA 1FCVA 1OD0A 1XLGA 3TZNA 1KQZA 3D6NA 2Q02A 1S39A 5HPCA 2XPKA 1D3GA 3MP3A 4Y9AA 2HNEA 3KTSA 1CGWA 2WCAA 1H3GA 4OBRA 5MKGA 3A3XA 2WHMA 5CSUA 3PVFA 5FOOA 2OZ0A 1MEIA 3A4XA 3POCA 2J7GA 3VGHA 3M5ZA 4GVHA 3T6CA 4GXMA 3NURA 2WVVB 4OGZA 3ERPA 4AVFA 3KRZA 3VD4A 4JAWA 2ZADA 2WMHA 3TIMA 3W75A 4WIWA 4K8EA 3N04A 1XIEA 4BK9A 4PSPA 3RLGA 2XVPA 4X61A 1Q7QA 1PXGA 3N6QA 1WDPA 4K7YA 4JOMA 2WMIA 5IHRA 4CN1A 1IEIA 1A5SA 4WHBA 4NVTA 4GY0A 3QC3A 3B9NA 2DZXA 2DW7A 2XN1A 3O05A 3TN4A 3A3WA 3VINA 3GD6A 5FA5A 1IIGA 3QYQA 5MKGB 1LG1A 4H7CA 1AD4A 1EF2A 1XBYA 4JR5A 5M3WA 1GVIA 3E2RA 1IYXA 2B7NA 1RPKA 3QV7A 1O12A 3ALFA 3OA5A 3TLQA 3Q94A 4B5VA 1VP5A 1QASA 3VFCA 4IQDA 4LV4A 4JTEA 2W9MA 3G24A 1V0KA 1YDYA 3VCNA 3WK3A 4QHRA 1KBKA 3EX4A 4BS0A 4EF9A 4CQ8A 3CXOA 3W00A 4B3ZA 1JGIA 2WCGA 2WMIB 3BSGA 3UZ5A 3M07A 5LNUA 4DJEC 1EP1A 2PDIA 4RDYA 3SY5A 1TZ7A 2ZX8A 4L4MA 3V0UA 2PGWA 4A35A 2BVTA 3DDMA 5EU9A 1I2PA 1YNQA 3GVQA 1F5ZA 3SM0A 1T7LA 3CUFA 4U5IA 1KD0A 2X1SA 1TCDA 1BAGA 3T09A 4EF8A 3WLNA 1R3WA 5SWUA 4JTLA 1HF6A 4J1OA 3R13A 4LS2A 1EDQA 3LCGA 2DP3A 4DPQA 4LV9A 1YRRA 4AD3A 1DJZA 1Y0EA 3ITCA 4AFYA 1MI3A 3W2JA 3I4KA 1O94A 5HMDA 5BXPA 1KNWA 2OSYA 2HNHA 1YXYA 1QT1A 1WZKA 1OFAA 4LB4A 2JF6A 4KIEA 4UC5A 3WLRA 1MWOA 2ZYFA 4EK7A 4CEUC 2MUCA 1C92A 3AIWA 3RJYA 3QR1A 1RY8A 3STFA 2EG7A 1KO0A 4PR4A 1BVZA 3I3EA 1OZQA 3RU6A 4OIFA 2WANA 1FDYA 2SFPA 3K4AA 4TU1A 4R5EA 1M7XA 1BG9A 4GUJA 4QDMA 3ZVHA 3UWQA 2CBIA 4UTMA 1TVPA 5KZDA 4F79A 1HKKA 1PAMA 2CKSA 3FEMA 5FL0A 4LF1A 4EWND 2G50A 4N2YA 4Y96A 3SO7A 4FF7A 4QG6A 4ZENA 1IT0A 3PB2A 3QHOA 1NAL1 3REQA 3BJTA 1XLCA 1JPIA 3BV7A 4JQAA 4B5WA 2XDFA 2IPJA 3IGUA 4M6VA 2YCIX 2A3LA 2A85A 2PE4A 3EKLA 3TTSA 2BVDA 2VTFA 1RD6A 3CHCA 4AB4A 3BE7A 4XKMA 4BEQA 3P93A 1JUEA 4J3UA 4GJJA 4ENLA 3LHWA 3WENA 1YW1A 3NIYA 2C91A 1LCOA 1T8XA 4LUIA 3SGZA 2ZWYA 1GVSA 1JDDA 1GYMA 2DUXA 4IHCA 1R7OA 1U33A 2J77A 3M0IA 1B31A 4CNSA 2ZUTA 1V51A 3OPSA 2O9TA 3W1QA 3II1A 2QUUA 4MUPA 2RFGA 2EPHA 3KBNA 1EZWA 2PI6A 1E6NA 2BGNE 2J7CA 2RH9A 1M68A 7REQB 3KCJA 3REQB 3MI2A 1JYXA 2ACSA 1FWEC 2J9YA 3D0CA 2EXOA 4Q32A 4NZCA 2FTWA 3U5UA 1JAKA 5AHLA 2P8BA 3EX2A 4WSJA 1MW3A 3L67A 3FAWA 4FLQA 4CQAA 4L6OA 4L4LA 4LVFA 4K68A 1UQYA 2VKZG 5GJNA 2FHBA 3F4NA 2GVLA 4TVUA 3WUGA 1GVEA 3KOYA 4QITA 1PE1A 3L23A 3HG5A 3CAQA 3AFBA 5D9MA 4DO7A 5DT7A 1XF0A 1G5AA 4Q4KA 1WKYA 2VRJA 2ZZ7A 3KLLA 3WD1A 2EBNA 1BVWA 5AC8A 1ONRA 1I2NA 4PMVA 1OGSA 3ID7A 4MNJA 3H2EA 4X63A 3W7CA 4B2DD 1XRSA 1EKOA 5I02A 5T9CE 3MSDA 4LFYA 4NX0A 2BSLA 3IIPA 3WD0A 1ZUAX 3PAJA 4ZFMA 1HIZA 3T1GA 3H8AA 4H6RA 2PWEA 4P8WA 4RE4A 3THDA 3WDQA 5I09A 3RFAA 3ECQA 3L5AA 3F2DA 2FZ8A 4C6PA 2HISA 2V3FA 4AMCA 3KHJA 2X1RA 3E12A 1NELA 4FXSA 4CNUA 3RX4A 3IGHX 3WDIA 2AAAA 2OZTA 2WVTA 1AQFA 4ZB5A 3NDYA 4YHEA 3GWQA 1GZGA 1X6UA 1QI0A 1OGGA 4GFSA 1CGVA 1I6NA 2ACQA 3T07A 9RUBA 1E4IA 5FSDC 4UFJA 5I7GA 2GYIA 1WB0A 5C9RA 4XV0A 4EAYA 3TXVA 1GOOA 2OB3A 4AISA 1P6CA 4ZEPA 4PBEA 4PUEA 4P8VA 1K4GA 3SQLA 1CX9A 3DG7A 3VE9A 2VXNA 3WJZA 4KRTA 3WBYA 3H23A 2ZA3A 2G3MA 1R3VA 4E2VA 1SJCA 1E4MM 5IBXC 1SFLA 4FR6A 4FIQA 5G4WA 5A6JA 3TCSA 3URNA 1JDCA 4GCXA 4BKNA 4AEFA 1M7JA 4Z42C 1CXIA 1GJPA 2XSBA 1FP8A 1WQ5A 2E5BA 1QNOA 4OT7A 4LYKA 2V69A 4JY9A 4LY8A 3CK5A 3U2EA 1SFJA 3PNZA 1V02E 1NOWA 4XISA 3GXNA 1OABA 4D72A 5D2VA 3DFHA 3FA5A 1UUMA 1OEPA 4QFUA 5L9FA 3B06A 6ENLA 3W81A 3B0UX 4IZGA 4ZO8A 3VOCA 3SW6A 3PFRA 1DJWA 4BI5A 2C16A 1F6YA 1XICA 3A3HA 1M5WA 1TV3A 4PODA 1G67A 3S6DA 2Y8VA 3UA4A 4PH6A 1XXXA 3A12A 3PZNA 3W25A 3M0LA 1VC4A 3GW0A 5A6MA 4IMEA 3WDJA 3V35A 4H8VA 5HK4A 1AQ0A 5FAGA 1V6TA 2QUTA 3B03A 2A7RA 1DHKA 2QKFA 3TYBA 4K8HA 2J66A 1FWAC 4M7TA 1HL9A 1HJQA 5E1QA 1F05A 1MXGA 4W7VA 3KAOA 3DECA 3VC5A 3RGTA 1ZSXA 3GVRA 3KOWA 2X2GA 3WLLA 2F61A 2TPSA 5AY7A 4WZHA 4YS1A 1G4PA 3WF2A 4LALA 1XQLA 4ZODA 3WBAA 4MWAA 5LNRA 4I7VA 4UTKA 5FSEC 1K8YA 2F2KA 3SUTA 2F9RA 3VNLA 3IVTA 4IOTA 1IZCA 1CNVA 4Q7BA 3AI0A 5TD4A 4AX6A 5D04C 1I1XA 3WQ6A 3GHRA 3TCEA 3FYPA 4MSSA 2XSXA 4D9PA 1UZHA 1SW7A 1Q6FA 3EWDA 4XTIA 3ZVIA 2VI0A 3HU7A 4US5D 4TQTA 1JUKA 1O5RA 3PFMA 3UQNA 1L0PA 1N8WA 2YL8A 2BBFA 3W22A 1PZ2A 5A2BA 4JNZA 1A5MC 3W70A 3LLFA 5HWJA 4REQA 3VPLA 4IM4A 2CZ5A 3C52A 4HZ7A 3ARXA 5DF0A 1I45A 1K02A 1OGBA 3GU1A 4ZO7A 2XIOA 4DO5A 3L5LA 2V67A 3R1ZA 3W87A 1JULA 5I3KA 2EEXA 2ALRA 1OCBA 1VIZA 2GOUA 4NSBA 1A80A 5C71A 3TN3A 1DE6A 1UH4A 5KZ6A 3TTOA 1DIOA 2VEGA 4GINA 3C56A 1ME9A 2YJQA 1XYFA 4HZ6A 3EBVA 1SW3A 4JX5A 3KBJA 3W84A 2QCDA 1JDAA 4B9ZA 4CVUA 1W1B1 1TA3A 3TQKA 3OBEA 5LIKX 1Q3NA 4WKAA 3VKBA 2JKAA 3ZM8A 4W9TA 3CEPA 1EC9A 2W5FA 4NIRA 2QPXA 1XINA 1XLMA 3HG4A 5FESA 3MHGA 3RIKA 1Z41A 1HZYA 2VVSA 4WOZA 4CCCA 3WLTA 2DSKA 3WQEA 3R25A 3GU9A 1RVGA 2GFTA 4PMUA 1P0EA 2VCBA 1E6SM 2DZUA 1VQTA 4QP0A 3IS4A 1ITXA 2ZUVA 2J7FA 3UNTA 5AN7A 4UMAA 4MLRA 3T7VA 4AU0A 1TJRA 2QCCA 3OZMA 4IIDA 4FI4A 3S2JA 1F4HA 2EPOA 3WH9A 1TTIA 4L64A 5FJIA 6ALDA 1YDOA 3VZXA 3WNMA 5E9XA 4X9YA 2ZZ6A 4ML4A 3A9BA 1YPXA 3VX1A 3BH4A 3VIIA 4H6EA 4HSOA 3GIYA 3NL5A 3Q65A 9XIAA 3FJ6A 3NOYA 5BOEA 3HPZA 4O4WA 3KVKA 2VOMA 4AEEA 2IXVA 2GGEA 1YDVA 1IE7C 4DWSB 2EF9A 4P7OA 2WLZA 3NO1A 1US2A 4A4AA 2WNZA 4LAKA 1Q6RA 3M0YA 3U9IA 4WXYA 1EWDA 1A5AA 4QSFA 4O13A 4ZQRA 3AHVA 1OD8A 1KTBA 3W7MA 3ZXWA 3L7RA 3KOFA 4MJ4A 5DRIA 4C6DA 3DUGA 3I3DA 5AHEA 1W9XA 4DI9A 2PCEA 5IXEA 2VC6A 4AXNA 8RUCA 3KHDA 1RCOB 3T0AA 1V08A 4B92A 1GONA 4DUXA 1BXNA 1KR0A 4RXFA 4E8GA 3C0LA 4OKDA 3DFPA 1K6AA 4FSAA 3QQ0A 4HA1A 4UQ9A 4CD8A 1VR6A 3DH7A 1ZBVA 5FEZA 2C0AA 1F3XA 3MP4A 2Z28A 2OODA 3HQOA 3K30A 2OYLA 5C9XA 3WJSA 2CLLA 3VZZA 3VNIA 1WDRA 2D1ZA 3WFZA 1JR1A 3AIUA 5HATA 3AISA 5HR6A 1DJXA 4DELA 1K70A 3E74A 1QUMA 1THFD 5H8MA 4O17A 1ICSA 1Q85A 1TUFA 3UWWA 1ZTVA 5FJRA 3ZWSA 5CKSA 1GYLA 1KGUA 2H6RA 3G6LA 2Q71A 3VDAA 1XLJA 2ZRXA 4HZ8A 4GC4A 3XINA 3DHUA 5D2TA 3DC8A 1IEWA 3N6HA 4Z1YA 4R85A 1PZ3A 5CXPA 4NNBA 3OJGA 2WQPA 3MO7A 2ODOA 3VOIA 3CPGA 2HROA 3AHZA 2CPUA 1OC6A 4HTBA 1W1VA 2YIHA 5D09A 4XVDA 2YW3A 1K1DA 3C0SA 4C91A 3GXTA 2C3ZA 1QPQA 1EGMA 2ZTKA 3RLHA 5AKQA 4N42A 5CG7A 4Q8WA 4JHOA 4G9PA 3L4VA 3AZRA 3EWXA 3OG3A 1X1ZA 2FGBA 3O0FA 2VR2A 4WK9A 3UGRA 2QCHA 5EMJA 3M6DA 2EJAA 1R2SA 1HGWA 3CZGA 2OT1A 3WQOA 1T6MA 5CPNA 3BG3A 2ZXDA 4O54A 4CCDA 1V0LA 4OFCA 4LRTA 1QK0A 4PCPA 2Q8XA 3PPGA 8XIAA 1XIMA 1V6UA 3QKZA 2XN2A 4FIRA 5IFPA 4QQ3A 5BROA 2C79A 2VOTA 1I9CB 4XD6A 1IZJA 3WNNA 4HPJA 2NUWA 4PA8A 5K4ZA 1B3WA 1QO2A 2GPTA 4DBWA 3O9NA 3WK2A 3ES8A 2CU0A 3HBLA 1FWHC 1YBQA 4B5NA 1FWJC 4PBFA 5BCAA 2Y7DA 3W7LA 4LBSA 4TTGA 2BOFX 3AMDA 3Q58A 3TJLA 3SB0A 3RRXA 2PDJA 2GGIA 4OU1A 1GW9A 4NAEB 3G1XA 5U4NA 1EX5A 2PDHA 5A2AA 1IQ8A 3T44A 4QQUA 2ZE0A 4H9ZA 4JN6A 2BVWA 3LTPA 3VD9A 3F7JA 1YTKA 2HDJA 2WLYA 2NLIA 4AZHA 1BWLA 1N8IA 4WJEA 2YFOA 3LCLA 2VL4A 4MZYA 4O14A 4E4UA 1E9YB 5BOOA 1MNZA 5LIXX 1GZJA 2W66A 3GG0A 1NF0A 1Q63A 4WEVX 1CXLA 1TJ2A 3T08A 2G37A 4AZCA 1OX4A 1EGVA 1PUDA 3AXMA 3VK5A 2Y0FA 4OBTA 3MPGA 1XFCA 3LRLA 1DXEA 4RV8A 3IJ6A 1K8CA 1FDZA 1FHUA 4FX7A 2WHJA 4UTHA 2PTWA 3GG7A 4HMDA 4ZO9A 1XM3A 1JZ2A 3IAQA 1UD2A 2W27A 5DRCA 2ACRA 1LWJA 1ZQ5A 1JZ8A 4ZE5A 4RX0A 3E02A 3TYZA 3PZGA 1OF6A 1HW6A 1FWCC 1JXKA 3OODA 1KV8A 1YE6A 5I3JA 4EXQA 3TAKA 2P5NA 2GGGA 4UQEA 1IT7A 3IJQA 4MLJA 3ME3A 3AMCA 1UZDA 3NQ6A 2QUMA 1BHGA 1B1YA 2GUBA 4FO4A 5HAOA 1RXOB 1IT8A 3PAOA 1SQ7A 1WOAA 3WL1A 3KW3A 4QBXA 1UWSA 3NSNA 4UZSA 4CU7A 2WC4A 1QI5A 4H01A 1TPWA 3VOJA 2WNQA 1J18A 3FHQA 2NWSA 2PSNA 2I5IA 5HJLA 4UCFA 1S3HA 3N2BA 3EOOA 1TPVA 3S46A 2VEFA 4HGXA 3EWBX 3W2LA 1POKA 4QIUA 1JD9A 2OOFA 4NJGA 3DFQA 3WBWA 3QZEA 1OFBA 4C60A 2LLEA 3BVJA 3GRIA 3TK7A 3XIMA 2OT0A 4GVFA 2XFRA 2UZ9A 3GNPA 4ZB2A 3DOPA 3TROA 1GOKA 4R7JA 2DU2A 3HFTA 1SFSA 1LL6A 1AODA 4A21A 4RNFA 5CZ0A 3KWSA 3L5MA 2Z4GA 4L6DA 3RNDA 4A3RA 2D3NA 3TQPA 4YTRA 2PBGA 1JVNA 3KE0A 3UJRA 5HWNA 4Z2LA 1JCTA 4FNPA 1A5NC 3U8GA 5ABTA 3M0VA 3LBMA 3NQEA 5T9BG 1J4EA 2VNCA 4WUIA 1E15A 1AH4A 1B3XA 3STCA 3C2FA 2PEVA 2V3DA 4HHHA 2WKGA 3TC7A 2QIIA 3EXTA 3QQWA 4S3JA 3GDRA 2A3HA 2Y70A 2XTKA 4S38A 4DBSA 1H2JA 1C29A 2HPIA 2DFAA 5ENLA 1S1RA 3PZVA 3QVQA 2V2CA 4EP8C 3N3TA 4IUOA 3T0BA 3VIFA 1S1PA 3PSVA 3CTLA 3CM4A 5CZKA 3R89A 1ZZMA 3M43A 2Y7GA 1MVYA 3W1LA 3Q37A 4H19A 4GBUA 2H9AA 3FJNA 3M0KA 1GVFA 4RK8A 1GW1A 5CSYA 3VYLA 1LBMA 2GQ9A 3MTWA 1EF3A 5DN1A 1JRBA 4WJXA 4LRSA 1BLIA 1VIWA 3OW1A 1I2QA 4DXXA 1E4LA 2F6XA 3USZA 5FL1A 1H1ZA 1JCNA 1MZHA 2XIIA 5D32A 4UNKA 3H4GA 4HKPA 3OLIA 5REQA 1UKSA 4C90A 3ARWA 1LRTA 3GYCA 1VYSX 1C90A 2PRLA 2ATMA 3JS3A 1B4KA 1J93A 3WEZA 4I90A 2CLEA 3T78A 3VDBA 3MC5A 2EPLX 1SVDA 3TJ4A 3EPMA 3W0KA 4PL1A 1LRQA 3IIVA 2E77A 4XZNX 2WWCA 4UFIA 3CZJA 4Y2WA 3GM8A 3MDUA 3PUEA 5TQLA 1OK6A 3O7UA 4EXAA 4ORMA 4INFA 1KFKA 1P1MA 4UFKA 2VYOA 1GGOA 3O0KA 4ZFCA 4D8ZA 1FCQA 3M64A 4O11A 1A5OC 1ECEA 2J6VA 4LPCA 3P3BA 3QGKC 1U83A 1W6TA 1UR0A 2GDVA 4JCMA 3ZR5A 3VOFA 5AHNA 5REQB 3VUSA 1ALDA 3H55A 1WZMA 3WH8A 4AZBA 2AMXA 1KBIA 1JAEA 2FPVA 4WCJA 3I7QA 1ZNNA 5M2FX 2ATSA 3G6MA 4PCTA 2IXUA 1FWIC 1GPWA 3UD6A 4JFSA 1UKTA 2VJXA 2GJLA 5TIMA 1OYBA 3TQ0A 1O1HA 2WCSA 3RITA 4JX6A 4MDPA 3O6CA 3AZTA 4JGDA 4KWUA 1EPXA 2ZVRA 4NNAA 3VIHA 3OQ8A 3ISIX 4QSHA 5JVLA 4TXEA 1W5NA 3WLSA 3ATZA 4HCHA 3OGRA 4DB7A 1P0DA 1V3JA 4YTQA 4H8NA 4NNCA 4CVWA 2F38A 4Y9OA 1V3MA 1RR2A 4IFRA 5CPTA 4O8RA 3M0ZA 2PD5A 4PTDA 1S38A 3A64A 5GVJA 2CHRA 1WXYA 3DFTA 1SW0A 1DWHM 2W79A 4HHLA 4AXKA 4EX4A 1EB3A 1X8FA 4M1BA 4GIYA 2J79A 4R7OA 1QO5A 4JD4A 1EBHA 4WY0F 4BR1A 1Z3NA 2H8ZA 3TUUA 1F9CA 2O92A 3IV8A 1EX1A 4GOAA 4KGJA 4N9BA 3DG3A 3QGVA 4UFHA 4LU0A 2OZ8A 3K1GA 4LY4A 2Z26A 4DJED 2WBGA 3FGCB 5HULA 2E9BA 3HV8A 1VCGA 2G0WA 1KRBC 3PWAA 3SJNA 3AXHA 3QW3A 2XFYA 1KM3A 2HVMA 1EDTA 3O1NA 5ABFA 2E6DA 4A22A 1UWTA 4DM2A 1OG6A 1XGZA 5AECA 3ZLGA 1QOQA 3CS2A 4MWAC 4DIAA 4UQBA 1PWLA 5KETA 2F84A 2FGZA 4HMNA 4GJIA 1V5XA 2B7OA 1AVAA 1TWDA 1WOBA 3K8LA 3ABSA 3PUDA 3P62A 2QYGA 2ZFAA 3UZZA 1JL8A 3HMJG 5FI8A 4BQ3A 1EH9A 1NU5A 3CASA 4FOJA 4P7QA 3AC0A 1VFMA 3L9CA 4ZQNA 1RALA 3H2CA 1HL2A 4QDWA 4DJDC 3BQ5A 1V0NA 2ZA2A 5ABFB 3DKLA 5CZTA 1KM1A 2VQTA 2Y24A 2NX3A 3FVMA 1FWNA 5I03A 1M03A 3K4WA 1NARA 3IVUA 1EJWC 1OFQA 1BTCA 3GUGA 1VH7A 1VCVA 4ZSTA 1DJGA 3IK2A 4XAPA 3HJZA 1KFJA 3WK0A 1Q6CA 3SRKA 4S3FA 1JYNA 2J9ZA 3K4DA 2WZIA 3ARZA 4GQ0A 1XIBA 4NASA 4OVXA 4HPNA 1QOXA 3AXXA 5A6KA 3UEQA 2DIEA 1P5BA 5B7ZA 1XYAA 2PP1A 4LNCA 3VOGA 4WSKA 2V0TA 4DQWA 4N9CA 3AS2A 3GKFA 5AYZA 3CV2A 1OADA 2Z7GA 4S2CA 3NUKA 1GTHA 4DF1A 5M17A 4ADUA 3EKGA 2HXTA 1JIBA 2GWGA 2WKLA 1T40A 4XZLX 3W9ZA 1REQA 4PGLA 1WDSA 3G18A 3S9YA 3PG9A 5FEWA 2F6KA 3ARSA 2BHYA 1S2UA 1P6WA 4HOXA 4POCA 3NZQA 3W53A 2C0HA 1FCUA 1QPOA 4H9XA 3W07A 1JI2A 3MBDA 5I79A 3W7OA 3HA1A 2QF8A 3S1GA 1A49A 3ANUA 3ZFHA 5A6AA 2E4TA 4Q8MA 3RXZA 4MYAA 4UQAA 4Z1AA 4QTGA 1SJBA 1BTMA 5AHMA 4OOZA 3LLXA 3WNPA 4TO8A 4JQ1A 5A3HA 4UIOA 1NWSA 2A7PA 1DJHA 2FH6A 4C7FA 4O4VA 5BXSA 1OWQA 3KP0A 1C8XA 2UBPC 3M44A 1TPH1 3MMUA 3AO0A 3DENA 4GIAA 1EJSC 3B0VC 5CAHA 3DYPA 1OIMA 3MUXA 2JEQA 2V38A 4V1YA 5F4WA 2ESCA 2DSZA 2Q8LA 1XBVA 3G22A 2RGLA 2QVNA 2A0NA 3NZ1A 4QE5A 1UWAA 1AL7A 1VF8A 3OQEA 4WSHA 1J6PA 1GQNA 2FHFA 3A4AA 2O4MA 4PTXA 3LSCA 3G0SA 4HYVA 1GOWA 4KEMA 3T05A 2ASHA 3VD5A 4XIAA 4G8TA 4A3QA 4LBUA 1F61A 4Q3MA 1FP9A 5CC5A 5M03A 3VA8A 1KWKA 3PF3A 4RCXA 1XLKA 2JBMA 5G2IA 4ERGA 2DZTA 3KVLA 1CLKA 3W7KA 3QZAA 4M7SA 1FWSA 1VBGA 3BDKA 4PTMA 4EACA 4RW3A 4D6HA 1E5JA 3PZOA 3WQPA 4HIBA 3EX6A 3AMLA 3N17A 1PKMA 5F2LA 3FFSA 2QDGA 1U5VA 1IWAA 4L4PA 4XZBA 2YYTA 3CPUA 4FEZA 1VENA 4JIIX 4Q8QA 4ES4A 4C6IA 5A6TC 4KFNA 5HXMA 3GG1A 4LOCA 2V9DA 3TSMA 3GC5A 4HT3A 4OZOA 4MF4A 5TAOA 2JIEA 2V63A 1NDYA 4DWSD 3K1DA 3W23A 3NZGA 3TP4A 4FMVA 2QEZA 4H6QA 2WJDA 5DXXA 2FH8A 2ZX5A 3DC0A 4J7RA 3URBA 4O19A 1DTUA 3P5ZA 5CH9A 2QPUA 4PB5A 3R12A 5D2YA 1TJPA 2QDHA 2YZRA 2PDQA 2VUYA 1X7IA 2Y62A 4ZGYA 2VCAA 1W9PA 1TV5A 2G97A 4Q4QA 3HGJA 1NH6A 4R9OA 3NQCA 3C2OA 3GR4A 1J01A 3K46A 5KINA 2Y5JA 3LNPA 2V6AA 3BAIA 5A94A 4HU8A 4HN4A 1VBHA 1WXZA 3P61A 3UFYA 3W3OA 1QJWA 4H9TA 4L80A 5K4XA 2WJEA 3VZYA 1VLWA 1VPQA 4NZ3A 4ATLA 4P2VA 4O1FA 3WF1A 2O7SA 1IIHA 4UCGA 3PR2A 1NDZA 3BCDA 8XIMA 4R34A 4DWDA 4I5RA 1FQ0A 2GJRA 3DX5A 1TKKA 3P14A 1PL9A 1LTDA 3W1MA 1NFBA 3VC6A 1BPLB 5E0FA 1WO2A 4GNVA 3WMBA 1FWWA 1XQKA 4ZCWA 1Q4WA 4RPQA 2OELA 3CLWA 3P6LA 5HWMA 1EHAA 4FNSA 4IGSA 3UWEA 1GYNA 4HBKA 3R7MA 3RDKA 2DSWA 3NQ7A 3LBOA 3MWAA 2OCZA 1Q4NX 2VFEA 3VILA 4FNTA 4QJ3B 1KXQA 3C2RA 2XGBA 3APYA 3A5VA 4GQRA 4WDWA 2WPGA 5LIYX 3RG6A 4YXGA 1A53A 3AUOA 4FXFA 4RXGA 4KRUA 1TE1A 3AICA 4MY1A 1E0XA 4PUNA 4GACA 2FFCA 1W5QA 1VFUA 3GTFA 1AMKA 1XX1A 3GG8A 1XIHA 3KCOA 3H2MA 2PWDA 5G1TA 3OBKA 2EPKX 2Z1SA 3V36A 2XVGA 3ORWA 4XUYA 3PBWA 4GH3A 4DZ5A 4GXPA 3KBSA 4MB1A 2I1OA 3G3DA 1DPMA 2VEKA 3AS1A 1UUQA 3LK6A 1VEPA 3GBEA 4KMQA 2TMDA 1MYRA 3QHMA 3AWOA 1BYDA 1HJUA 4MY9A 1BGAA 1A4LA 1Z9AA 2G3IA 4UBPC 2WYSA 4PUWA 2NZLA 1UBSA 1CXHA 2D2OA 2VVNA 1FWFC 2ZUWA 1Q6EA 4B5XA 2XYLA 4IIGA 3CH0A 1QWGA 1D2KA 4DN1A 4A3HA 4AZ5A 1GWJA 4DBUA 4CU8A 1HP4A 2RJGA 3TJXA 1DQXA 3IRSA 4GFIA 1UZ1A 2VFFA 3BZGA 2W62A 4E3VA 2UY3A 4LEFA 4QNWA 3OZPA 1JG9A 1IXPA 2ZUUA 3STGA 2FB3A 4WGHA 2QIWA 1FWDC 6REQA 4JTCA 1PIIA 3H12A 4Q4RA 2XM2A 1HJWA 1X38A 2XU2A 3E6EA 4UOQA 2OGYA 3NNTA 4PMDA 2X1TA 3A24A 4GZEA 3G8RA 1KBBA 4ERIA 3CJPA 1XCXA 5TNVA 4YTTA 1FWGC 1LWIA 1JGMA 1YTEA 5LKYA 3W27A 1K6WA 1E6RA 3QR3A 3JU2A 4GI4A 1XBXA 4KERA 4X2PA 5LNWA 3UG4A 3WO8A 1Z44A 5GNZA 4JKMA 3TWBA 5AZ0A 4IIEA 3FJ4A 3PHAA 5CG0A 2JGYA 1NOUA 4ASTA 5BWAA 1TWIA 2NUXA 3UERA 5CZSA 4RR4A 3CWNA 3EOLA 5F7UA 1UG6A 2QCFA 4MKSA 3OZOA 4Y9MA 2Y85A 1SR0A 3IIZA 1QHPA 2V68A 2EKGA 2NV2A 1J6OA 1XJBA 3MA8A 1DEDA 1CT5A 3O06A 4HQVA 1NP0A 3DKJA 5A6BA 3BJFA 4ZB0A 3LPOA 1XLBA 3O16A 3UZWA 6REQB 2EAWA 4IMFA 1UKPA 3RRAA 2PDGA 4B2DA 1PX3A 3FA3A 1EYEA 2C14A 1R3RA 5C55A 3BOFA 1GJWA 5HMFA 1UW9A 3NL6A 4IL0A 1XLAA 4GKTA 1E9IA 2YCEA 2BP1A 3GAYA 4UMBA 4O12A 3F5LA 3MKKA 1XPGA 2OVLA 1R9ZA 3BW3A 3N19B 4JBRA 4UTWA 3V4BA 3CAWA 4RE0A 3U7BA 4Q8TA 4QG9A 1EO5A 4DZIA 4HOWA 3R11A 4EE9A 1FXPA 1V79A 4NJHA 1I0BA 1W9BM 1MEWA 2E5CA 4Q8NA 4LUTB 2AL2A 5CC3A 3PJUA 2ABBA 2ZRWA 1Z69A 1XPYA 1QMLA 3OBAA 4GI8A 1W0MA 1OT1A 2JF7A 4F0KA 4XAFA 3CMFA 4HHMA 2INEA 4LAOA 3VE7A 2JKPA 1FVPA 1W54A 1O6IA 4J5NA 3DFSA 3SSZA 1W91A 3HV9A 1W1IE 3S83A 3W2MA 1F3TA 4FAMA 3NPWA 4YMZA 3QGAC 5K7JA 3E0WA 2TAAA 3E0VA 4E4FA 4Q8VA 1PYMA 2CXEA 2QCNA 1QNSA 4ZQCA 1CBGA 2VZUA 3N2MA 2D69A 3UETA 2DZPA 2VFGA 1ZCCA 4UFMA 1TCMA 3L0KA 3G1DA 3QYSA 3QPZA 2E1DA 1AUSL 1GVYA 3CHEA 2I9UA 3H70A 3P67A 5E5CA 1SGJA 2NVDA 1CDGA 3IUDA 3OO2A 2NV9A 3ZR6A 1LOSA 4J4KA 3WBEA 3H24A 2ZTJA 1H7XA 3W2UA 2NQ9A 4PUJA 3QRHA 1VBJA 4KEVA 1OB0A 4OWGA 3CHFA 5GNXA 2PDFA 2OR2A 3UYIA 4GX8A 5A6LA 3UU0A 3DBPA 2VO5A 1KGXA 5FJUA 2J7EA 2YDAA 1V02A 2XUCA 2GGHA 4LNYA 4GPNA 3LHUA 1JCJA 1OINA 5K2ZA 3N18A 1OCQA 3WMCA 2NUYA 1UQZA 1CI1A 1U1JA 3T40A 5C9UA 1ZJAA 1TO3A 3RM4A 1U2YA 2Q6ZA 4ZZ9A 1EEXA 3B0PA 4NZ4A 3L68A 1YNPA 2X7WA 3NL2A 1IGWA 3BWWA 1ADSA 4IMDA 3C86A 3EDFA 1KM6A 3OGSA 1QNPA 3LPFA 3WSUA 7A3HA 4IXHA 3IACA 4HPGA 1ZJHA 3PJTA 3TH6A 1KFWA 2BY2A 4DBDA 2VENA 3FDKA 5FEXA 2OKTA 4GK8A 2YDSA 4CD5A 3V3WA 3TC3A 2PURA 1BFNA 4QE1A 2QJGA 4C6OA 3GO2A 3H54A 3C6CA 2F6UA 1OFDA 1GOMA 1UH3A 2BGSA 4WR3A 2NV1A 3P82A 4XQ6A 3NQFA 5HJYA 2E9LA 3M7WA 4US6A 3SUUA 1L8NA 4YHGA 1E73M 2OQLA 3NO5A 4US5A 3GNRA 4ZQPA 3ZSSA 4DI8A 2E09A 3T8QA 5AVNA 2XG9A 3PM6A 2DQXA 3ATYA 2E25A 3IJLA 2BWGA 3PTKA 3MCOA 5ABHA 2GVEA 1HVXA 3V0SA 2WSQA 4X0VA 1BKHA 2DSUA 1L6FA 2V2DA 1MO0A 2OPJA 4JTTA 5EKYA 4QAWA 3KBMA 3LZ5A 3HN3A 2R6OA 4DLMA 1XRTA 3GTIA 3AIBA 4GRSA 4ACZB 1YE4A 1NJJA 3P84A 3GUWA 4FR1A 5BMXA 3VNJA 1KXVA 4WKFA 2Z0IA 3BAJA 4XD4A 3DGBA 3R5EA 2ZC8A 5LXEA 1WV2A 1KXTA 4GVIA 1HO1A 4JTRA 1GKRA 3JZUA 5E6ZA 3NO3A 2AGKA 2VURA 2VELA 5C54A 1XLHA 4NUWA 3Q2DA 3KDNA 2F7FA 3WF4A 3MQTA 4BJHA 2I17A 5AOUA 1JZ6A 3TZFA 1QNRA 5ECUA 4Y7EA 5D02A 2QCLA 3O07A 4HNUA 2Y7EA 4XBSA 4WQ6A 4D6GA 1S2TA 5EFDA 3UY7A 2PWFA 3UWUA 2HVNA 2HE8A 4D6DA 2AQWA 3RILA 5ECVA 4IL2A 1YPFA 3RYSA 1RJQA 2WMGA 3NWRA 1WUFA 4DHGA 4JICA 2Z2BA 2GSJA 2DZSA 4XK2A 3C5QA 3BAXA 1JXJA 2OWWA 2C19A 3EOEA 4S3KA 2PGRA 3U2CA 3E38A 3HQNA 2Z1KA 4FX8A 1TVLA 4O16A 3N13A 4DUVA 3VKCA 4M6PA 3G1AA 3EGJA 1XDLA 3DGRA 2J27A 4O50A 2QDDA 2B31A 4E8CA 2BS9A 4IGNA 1LRNA 3GDLA 3PC0A 5FF3A 2R91A 3W7GA 2TSYA 4N6FA 4S3DA 4ZO6A 3GC4A 3ITVA 2VGGA 4NKCA 1HKIA 1RK5A 4JDBA 3VKKA 4K3ZA 3I68A 3UXKA 3BSHA 5CZJA 4AW7A 2BHUA 4CNPA 2X7VA 3V75A 3EYPA 1ZAIA 3O3RA 4F48A 3RLUA 1D3CA 2PDLA 8CGTA 1RA5A 1JYVA 3HTWA 5IDIA 3MW7A 2ZE3A 1C7TA 3TAOA 3ARYA 2DW6A 3FXYA 1QXLA 3W6LA 1KV5A 3THQA 3IANA 5IHSA 3UXLA 3NVTA 1AZ1A 5IDZA 2FZBA 4NZFA 4FP1A 4GO8A 1EJUC 2GQ8A 3ABXA 3QY7A 2FHCA 3R94A 2WKJA 4O53A 1WYIA 3GZ3A 3KL0A 4XWUA 3E96A 2VX4A 3OYXA 2CESA 2V5JA 3RHGA 4DRSA 3GDTA 1GZ1A 3H2AA 1TG7A 4HN8A 2AQOA 3W1TA 2XWDA 2I9EA 3SEPA 1KCZA 1G01A 4NYUA 1WKEA 1GPFA 4QLKA 2WMKA 5K9DA 2YW4A 2YA0A 3CB8A 3RF9A 4L1XA 2OLAA 2NSXA 2WVUA 5DQPA 1SMDA 3WNOA 2PLCA 4MKNA 5AYIA 4NI3A 3CYJA 3H2OA 3S2LA 3JRKA 1MFUA 1RLDA 1QVBA 1IZKA 2PTDA 2C1GA 4R88A 3MUCA 4URIA 3N2OA 1F3EA 4IP7A 5TF0A 1QW8A 4ICMA 1B57A 3QSRA 1LDCA 2CLMA 3TTQA 3WQDA 4AD5A 2QQ6A 3W7DA 3PBMA 3PZMA 4IIFA 5J5RA 1PEZA 1KQYA 3B0YA 3JUGA 5G2HA 4AEOA 2BMBA 2PLMA 5LNVA 4IG2A 4FZIA 4A2SA 2BG5A 4ZOBA 2X41A 3MB9A 3RMEA 2VD9A 4XTDA 1TMLA 2DT2A 3EXSA 3B8IA 3ARVA 1TTQA 1DBTA 1H61A 3VNZA 4GHRA 1NP2A 4IP5A 4GYFA 5HR7A 1NQKA 3TKFA 4F9JA 1TWZA 3ITGA 4NG3A 2FJUB 4YL2A 2V3EA 1A3WA 2REQA 1UOZA 1V3HA 1EC7A 3GDMA 4GUIA 2HPMA 2FVLA 3F5KA 2PDWA 7CGTA 3L66A 3H6OA 1CTNA 3EPOA 1EDGA 1RP9A 1B30A 1H5VA 4K1GA 4QAIA 4AX7A 5J04A 4PMQA 1DJYA 4JL2A 2F8QA 2R82A 2IQDA 1S2CA 3PJXA 4U28A 1KRAC 2Y2WA 4S3CA 4PMYA 4E2DA 1M7PA 5FJPA 1ICPA 2QHAA 4O1AA 4D6FA 3LM7A 2VC9A 2Z00A 4KWWA 3DYOA 3PG8A 1PYFA 3CQ0A 2X05A 2VUNA 1AK5A 4GQBA 5D2WA 1FCBA 4IPPA 3GB6A 2JKEA 5LA0A 2OLHA 1W56A 3L4UA 1F76A 4HA4A 3DI0A 1RBAA 2NT0A 4LTSA 4E0CA 3MHFA 3H7VA 5CGQA 2RAGA 1JZ5A 3W6YA 3MMTA 1HQTA 1OX5A 1WUEA 1ONXA 3GC2A 3JR2A 3VTRA 4GUFA 4DF2A 5AC4A 4I8DA 3BXWA 3UR8A 4S3GA 1Y5WA 2C15A 2J8FA 1Q45A 1Q2RA 1RQBA 2D0FA 2V2HA 5D37A 2XIJA 3BPWA 2OOGA 3MP5A 4QNEA 3S2MA 1UR9A 3V16A 2YCKX 2HEJA 9XIMA 3R0KA 1QI2A 3E0LA 2XM1A 1VAHA 1BYCA 3S2CA 4MWAE 3MZNA 4AY1A 4Q4PA 4Y8EA 4BWLA 4AQLA 5IM51 1TSIA 4P8XA 1TPEA 3GFXA 2Y4SA 3B04A 3SCRA 4LYQA 3HFYA 1J0KA 3S1WA 3QH2A 2WVVA 1R8LA 2BASA 4ATDA 5G5IA 5K9XA 3W1XA 3SQMA 5AB3A 1L6WA 4U4MA 1WXJA 4C1NB 1K9DA 3OP2A 2Z2AA 4PB4A 3UA3A 3CV6A 5CEWA 3MMDA 2IKGA 3CHDA 3NPXA 2XIQA 1YADA 1AH3A 2I5GA 3B9OA 5M5DA 3LCIA 3LUTA 4J28A 1GJUA 3OLGA 1PX4A 1XW8A 1E55A 2GDQA 1IEQA 4AH7A 1A5BA 4G2DA 3NCOA 4CCZA 3EWWA 4LCSA 1OCJA 3BAYA 3LMYA 2PWGA 3P7YA 4QG8A 2ZUSA 3VDCA 1M3UA 1CW2A 2W61A 1R5YA 3O2LA 3W01A 4AZIA 2IKHA 1VFOA 5BRQA 4D8AA 5BRBA 1BSLA 2CWNA 3GY1A 3GNNA 1FKWA 5DLCA 5CPLA 1H60A 4MAZA 3OA3A 3CMJA 3STPA 3GLCA 4LC8A 1I1WA 3DG6A 2J13A 3ARRA 4F2TA 1V3LA 2PU1A 4G1NA 4GNKB 1XFBA 4UNLA 3QJAA 1OY0A 3SR7A 2CYGA 3A9IA 4ZQMA 2AQVA 3N29A 2D23A 5AYBA 1OQFA 3MUIA 1G1YA 3AWNA 1ITQA 4R7WA 2C7FA 2BHZA 3CT7A 4NHVA 5CPQA 1W5PA 3RO8A 2JGQA 5HOSA 5E70A 1LORA 3WFAA 1U5JA 4ZOCA 4WXZA 3RM9A 1LROA 1UUOA 1J12A 1BXBA 2J75A 3CUGA 4IJRA 3UESA 2IPFA 4B4FA 1JDFA 1YLVA 2BXYA 1O7AA 4AD0A 1E1CB 3DFYA 3K13A 4JTUA 3FCPA 4GWEA 3NTYA 1RD5A 2PD9A 4JTGA 2QULA 1RBOB 2VZVA 4PUMA 1E43A 2E8ZA 3W7IA 4H9VA 3W7JA 2QMJA 1LL4A 1C91A 3W29A 1DIDA 5LIWX 3B0XA 4NI8A 1H09A 4H8UA 3WF0A 3GHSA 1EA0A 1OT2A 3A47A 3IGSA 1MW0A 1EQPA 4H04A 5CQ1A 1E40A 1PHQA 3COTA 2VWTA 1QU4A 3B8WA 1QBBA 1IGSA 1K7XA 2E8YA 3CMGA 1C9DA 2IS7A 2A6NA 5GPRA 3R10A 3EDDA 3LV6A 2IPGA 3R8HA 4DYJA 1TFVA 2C1IA 4K8GA 3ZLHA 3UY8A 2XHYA 1RBLA 5AVHA 3CZ8A 4J3XA 2DT0A 2ZX9A 1XDMA 3DN5A 2GLKA 4LUJA 1B2YA 4N9DA 4HYRA 3KS5A 4LUSB 3ITLA 3UXDA 4K7VA 2G4JA 3BK0A 1E9ZB 3B8DA 2CETA 2R1NA 1KFLA 1W17A 1O68A 4E8DA 2D20A 5K9CA 3HPAA 5JU6A 1UZ4A 4UTWC 1XYLA 3WUFA 3VM7A 1H7PA 3MO4A 4DJFC 4XG1A 1Y5XA 1JCYA 1EEPA 4HU3A 4PN2A 3CQHA 2C13A 2VQUA 1R3QA 4WVXA 1O60A 1GG0A 4HCDA 2OSXA 4YLWA 1VBUA 3GBDA 1VYRA 2ZRYA 2H3BA 3RK8A 3FX4A 3VMNA 1UROA 1AA1B 2ISFA 1TPB1 5G1MA 2E67A 3CH9A 5I06A 2FVKA 1B9ZA 5D03A 7REQA 3HB9A 3SRHA 4KEZA 3VMOA 1FH7A 2P3EA 1C8QA 2A5HA 3CO8A 3VX0A 4XZIA 3BLLA 5I3IA 3G2GA 2HBXA 3E9AA 4V15A 1KC7A 4NXSA 1UC4A 2WM1A 4BQ2A 1PPIA 1PS9A 2XGZA 3TYDA 4ZE4A 4BI6A 3DERA 5ABGA 5H6HA 1DWFM 1TWSA 5BYWA 5I5RA 4W8LA 1UMYA 1L8PA 1HT6A 1W3IA 4WLCA 1EBGA 3LPPA 1MW1A 2J74A 1B9BA 3TA9A 3S42A 3MSYA 2YZ5A 1J0JA 2OYMA 1GKQA 5LXXA 1XP3A 3SGGA 3IRDA 2D2JA 4I9MA 3WLIA 1X7FA 5A1AA 4TX8A 3NEHA 4GIEA 3W7QA 3P60A 3ANVA 4F2BA 2Q3OA 1PKLA 2CLPA 5EY5A 4IQLA 3S5SA 3ZJKA 5FF7A 2J47A 1E1FA 4TV6A 3C0JA 1L6GA 3S3GA 3HG3A 2BZNA 4TIMA 3GS6A 1J2WA 2QCMA 3ITYA 1KBLA 2XFFA 3B8SA 1H5YA 2X40A 2A6LA 4FA3A 4JTKA 1MRAA 4DJEA 2FQIA 3WDRA 1JUBA 2W91A 2GJPA 3EWUA 4QROA 2TRSA 4AAJA 3CC1A 2NW0A 2DEPA 4EKJA 1JFHA 4KPLA 2RKXA 5A6BD 3AIRA 3MU7A 2YKKA 3GDKA 3SUWA 3W72A 1FFRA 5LHEA 2HV5A 4HNNA 5D9OA 1C7SA 3WLPA 1UJQA 1YXDA 2ON3A 2VEIA 2XSAA 4JQ3A 2QV4A 3EEZA 4JTJA 3BLEA 1BWVA 5I3DA 1E0UA 1G6CA 4ZOAA 2C1HA 2Y5EA 3UWYA 1HKMA 2P88A 2QJNA 3LHZA 1C93A 3VIJA 2J4GA 3BURA 2ISDA 4UOZA 2BODX 4CCEA 2FTYA 3LEPA 3S0CA 5JBEA 1W32A 2CBJA 2W63A 1U5HA 4K36A 4DEFA 1JI1A 1P7TA 3ZYZA 4M81A 1UWQA 2YCLB 1W5OA 1JDEA 5D9PA 3NAVA 2VFDA 4BF5A 5T91A 5XINA 3N4AA 3HZ3A 5C70A 2QDEA 1ODZA 4OUEA 4M1RA 3T0DA 3VU2A 2Z27A 3TU9A 3LGDA 4I7UA 1U22A 1XLIA 3LD5A 4FALA 9CGTA 2XFWA 3TYEA 2OWCA 1DJNA 3V7PA 3EX3A 2P76A 3WELA 2E6AA 2ZBTA 1DJQA 3DU0A 1AMYA 3WG6A 1ZALA 1Z7AA 3CUIA 3ZR4A 2OZ3A 2D3LA 5MHBA 5DXYA 3QOMA 1J0HA 2OQYA 4O52A 3WY1A 6TAAA 1VLIA 2XWEA 1UD5A 2OLSA 1AW1A 3TWAA 2I14A 3JVAA 3VDGA 3AHTA 1W9UA 1XBZA 3WUBA 4O10A 5DMYA 4PCNA 2ZWZA 4XO6A 1P7TB 4AWUA 1SO4A 3L4TA 3TNOA 5TBOA 2X0YA 5E93A 3KX6A 1R46A 3OHIA 4JHZA 3P74A 2YXXA 5G1YA 1NIUA 1YDNA 1J79A 1S2WA 2ISSA 4G1KA 3PANA 2G5WA 3JZEA 1XLLA 1W37A 3OU8A 1WDQA 1ELSA 4KCTA 4NL1A 4FB7A 3DFOA 2ZDSA 1M6JA 2FZ9A 4OOUA 2AAMA 3GK0A 4ORIA 1A0EA 1FKXA 1VPYA 1H7OA 5CSSA 3BANA 3TR9A 1G4TA 4A6GA 3Q67A 2WM0A 1D7FA 1RP8A 3WQGA 3UXIA 3IUHA 5C2CA 3OLEA 4ICNA 1YKWA 1LUCB 5I0DA 3RN6A 1NDVA 4JIPA 4D71A 4I9TA 3SJ3A 3T2QA 2VR5A 4I6VA 1MUWA 3W85A 2NSOA 1UR2A 3ES7A 2XINA 4PFMA 2YL9A 3WLKX 1HXJA 3RCMA 1QW7A 5G4HC 4RZBA 3ARPA 3PP7A 3AYVA 1R9XA 3GIPA 4P7NA 4FXRA 4B5TA 2YX0A 1LBFA 1MXDA 1UC5A 3TOYA 5D05A 3E5PA 2I56A 1EGZA 1PKYA 3CT2A 4HK6A 1TELA 2YXGA 3QBUA 2YB1A 4UR7A 2NX1A 2XH2A 3AS3A 1J5SA 4RE2A 5LIUX 1OYCA 4HOZA 2VP8A 3NOEA 2A3CA 3E2VA 1EP3A 1DXFA 1DQUA 4BF9A 3KXQA 5KMYA 2EPMX 3POHA