1EDTA

Crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H
publication title Crystal structure of endo-beta-N-acetylglucosaminidase H at 1.9 A resolution: active-site geometry and substrate recognition.
pubmed doi rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase (glucosidase)
total genus 88
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edtA00
1GOWA 4W8BA 1CZ1A 1JF6A 3KL5A 4P7OA 5IHSA 4NI3A 3SCUA 1TA3B 2J78A 1UKQA 1AVAA 2OYKA 4UZUA 4UFLA 4AEEA 2ZX7A 3TTYA 4FLQA 3WD3A 3VD3A 1K9DA 4E8DA 4B3KA 2YLLA 5D8ZA 3TTSA 3VO0A 1CXFA 2B31A 1VBRA 2XUCA 1A47A 3GXDA 3VKKA 1J12A 3I3DA 3PZIA 1R7AA 2YLAA 3AHTA 2EQDA 3VNZA 4NZCA 3GTNA 2PWGA 3BCFA 2WHLA 1V0MA 4KGLA 1WCGA 4XZBA 5F7UA 2WAGA 1Z32X 1GQIA 1EA9C 2X8RA 1UKTA 1ITXA 4AW7A 1V0NA 1JI1A 1IZJA 4MB1A 2OWWA 1SFSA 2XM1A 3WNOA 1ESWA 4AYSA 5FIPA 2WSPA 2Z1KA 3ZIZA 2TAAA 3UR7A 4H04A 4LGXA 1EDGA 2WPGA 4QLKA 1NQ6A 3GZAA 1GOIA 2J7HA 3LPFA 5I78A 4J3WA 1UR8A 1RP9A 4IPNB 5GQBA 3VX0A 1G9HA 3VU2A 5D9MA 2BFGA 1NWTA 1E1FA 5CQ1A 1JZ5A 2GDVA 2XHYA 3VMNA 3OB8A 3SEPA 2HISA 3WKZA 2YJQA 2CHOA 1PBGA 2VR4A 2DT1A 1M01A 5EFDA 2DSKA 3CLWA 1ZBVA 1SMDA 2E9BA 1J0HA 1FFRA 3B8SA 4AZCA 1XRVA 2WK2A 3VILA 4W8AA 5BYWA 1WDRA 2VMFA 2VR5A 3ZT5A 1BYDA 1KR1A 3A47A 2EPLX 1E6XM 3DYOA 1MXGA 4GZJA 3N18A 3MV01 1LG2A 1AQ0A 1CENA 2E4TA 1OWQA 1JZ3A 3WF4A 4LYPA 1ZBKA 3GNPA 1JG9A 3POHA 3BAYA 4XZWA 4TVCA 4CU6A 2JIEA 4AC1X 3AXHA 2VCBA 2XFFA 3BC9A 4HPGA 3ARQA 1UYQA 3UG3A 3AJ7A 2YOCA 1IV8A 3WN6A 1QNSA 3IANA 1UD3A 2EPOA 1F4AA 4AZCB 4J3SA 3N15A 1Q6DA 3AZSA 5I23A 1GJWA 1MWOA 5HDRA 3VIJA 5M5DA 3L4TA 4W7VA 1GCYA 3M6DA 3VIGA 1PZ3A 3VIPA 3GNRA 1CXKA 2XFYA 2DEPA 2WVVA 1W1VA 3AS2A 1CDGA 1VFOA 3W27A 2VOTA 4MAVA 5AYBA 1I75A 5FD0A 3PTQA 2YIHA 4CCDA 3ARUA 5E6ZA 1H49A 1VB9A 3A3HA 3FAXA 5GNXA 2XGIA 2WM0A 1H11A 1HNYA 3G6MA 4MADA 4LPCA 1UKOA 4W8LA 3EYPA 4TVUA 2Y5EA 3DHUA 4AZBA 3VIMA 1VEOA 2GSJA 1V03A 2OWXA 4HPHA 1V0LA 3FHQA 2OWCA 5A8OA 1W1YA 4RE2A 4XV0A 5AY7A 3UG5A 1JZ2A 3BMVA 4EK7A 1GQLA 2DSZA 3BH4A 4U5IA 5I5RA 1DWIM 1VBUA 4H8UA 1QBAA 3VMPA 2WVVB 1PAMA 1JF5A 2PWDA 2ZXQA 5EFFA 4D6CA 3VUPA 1UZ1A 4MB3A 2V5DA 4J3VA 5LYRA 4J7RA 5D9NA 4JZ5A 1ODZA 2W92A 1SR0A 2NT1A 1E9LA 1QBBA 2V3GA 4FF5A 1VIWA 1WE5A 3ZT7A 2VZUA 4ZXLA 3M46A 4HA3A 2CITA 2D24A 4AD1A 2XG9A 1E55A 2DIEA 1EDQA 5DMYA 4W93A 2VZSA 1E4NA 4HTYA 5BXSA 3AXIA 3FXYA 2DQXA 1KBBA 1V3LA 3WL1A 4N0RA 4UFIA 2JEPA 1E4LA 4DM2A 3IJ8A 3AIVA 2WW5A 3WD4A 1NP0A 3LPOA 4KRUA 4U31A 1GHRA 1XC6A 3G6LA 2F8QA 2ZX8A 6TAAA 4HZ7A 4YN5A 2ZUNA 3WUEA 1CWYA 2DPEA 1MVYA 1H4PA 4UQDA 1UD2A 3WUFA 5I2UA 9CGTA 3WMCA 3W26A 1V0KA 1ZJBA 1H5VA 2JIWA 3VINA 4M29A 3GH7A 3AHVA 2FGLA 4MNMA 1B2YA 3AHYA 3ZM8A 1I1XA 3OG2A 4UTFA 5LA1A 4UR9A 4ZENA 3SUTA 2D0HA 3WDRA 2D1ZA 3LPPA 1RPKA 3ZJ8A 4HMCA 1AMYA 3AMKA 2BY1A 2DIJA 1MW3A 5TD4A 1EO5A 1E71M 3OZOA 3OA5A 1CECA 4OUEA 4HZ6A 1TUXA 2PBOA 3SCSA 1NOWA 1V6YA 5CXPA 4CD7A 2ZE0A 2G41A 3THDA 1K9TA 1JGIA 1C92A 3IAQA 4AZIA 3ARXA 2XSBA 1CLVA 1QHOA 4QLLA 2G3IA 1VEMA 1HKIA 1NP2A 3GYCA 1N82A 5DEZA 3FY1A 4FK9A 1JYNA 3QHOA 4ZFMA 5AC4A 3SCWA 2NW0A 5A6KA 1BVZA 3DYMA 1QNRA 3RM4A 3U7VA 2NSXA 4HOXA 2BY3A 2JALA 3W25A 4JL1A 4LYQA 1D3CA 1L0PA 2CESA 3DHPA 4C7GA 1EO7A 4ZEPA 2W4XA 3HJEA 3VDAA 4AIUA 2V5CA 2FH8A 3VNYA 1ODUA 5BWFA 4WSKA 1V02A 2WMHA 1K6AA 1B3VA 1BYBA 2WBKA 3W82A 1TZ7A 3WL0A 1P6WA 1E0VA 2Q8XA 1ZU8A 2FGZA 1Q6EA 1CPUA 5I77A 4AD5A 2WCGA 2WCSA 3TA9A 1QPKA 3RIKA 2WSKA 2GDUA 4HU0A 1KXHA 2GK1A 3QOMA 2CEQA 4AWEA 1TVPA 1GZJA 4KH2A 1HVXA 4AD4A 1WZLA 3WUBA 1E4IA 4JKMA 1W3LA 3VOCA 1K9FA 3SUSA 4D6IA 1PX4A 2C7FA 3PZOA 3AMGA 3AIWA 1JNEA 4BF7A 2VCCA 3WENA 4D1JA 2GJPA 2WMIA 3ZMRA 1NH6A 4Z2KA 2PWFA 1BPLB 4PCSA 4U3AA 2G4FA 4W7UA 2DDXA 1B90A 1H3GA 1FP9A 1H09A 1LWHA 2XVNA 4WJXA 1UWIA 3KEHA 4OKDA 4KWUA 2E40A 2WHKA 4UFJA 4W85A 2YKKA 4P8WA 1R85A 1FHDA 5EMYA 3N1AA 4ZXOA 1OM0A 2GK1B 2YA0A 3MKKA 5A1AA 4PMDA 4CD5A 4UQCA 1W9UA 1F4HA 1OIMA 1JYWA 1OD0A 4ZE5A 3SURA 1UOKA 5A69A 2WVTA 4J3UA 1W9DM 3N12A 3CGTA 3UCQA 3CPUA 2ZX9A 1E6PA 1DWJM 3NCOA 4WIWA 4PMUA 1BHGA 1CNVA 4Y7EA 5BXPA 2W5FA 2ZX6A 4DWSD 1Q4NX 2WMIB 4W86A 2D22A 1R7OA 2XWDA 1HKKA 4MJ2A 3WNPA 1OBAA 4E8CA 5JBDA 1JZ8A 1LLOA 4FLSA 1M04A 5A2AA 1J10A 3K8LA 4PRWA 2XVGA 2J7EA 4U2ZA 3AIEA 7TAAA 3N04A 4IM4A 1X1NA 4P8UA 4GIAA 3EDEA 2WZHA 2CBIA 3FNDA 2O9RA 2VRQA 3PZQA 2DT3A 1EXPA 4J3XA 2XFRA 1JIBA 2EEXA 1QI2A 1ZB5A 4HMDA 1C7TA 1SMAA 3HN3A 3JUGA 5CJ5A 3TTOA 5CPQA 4BA0A 1J18A 3VIHA 1PIFA 3WMSA 2C8NA 1JNDA 1QW8A 4C7FA 2DSWA 2O92A 4L4OA 2WKLA 4P8VA 4TXEA 3AS3A 4UOQA 3T2PA 3GM8A 1HIZA 5DT5A 2ZWZA 1W2VA 3O2LA 4WKAA 1UKSA 3CBWA 2WKGA 3CZ8A 3CIVA 2ZUTA 1CEOA 4UQAA 4A4AA 3WQ6A 4BQ5A 4QP0A 1LJYA 4R5EA 4F8XA 1ZBCA 2E0PA 1UWQA 1FH9A 4XB3A 4QAWA 5LA0A 1L8NA 5DT7A 1W3JA 4R27A 2WZEA 4AIOA 1VAHA 5FKYA 1HXJA 3ALGA 2W91A 1VEPA 5FL0A 1BYCA 1RH9A 3WDPP 3RM8A 5E09A 3VGEA 1J11A 4PN2A 2ZWYA 5BXRA 3D3AA 3UERA 2YDRA 1JL8A 1GVYA 1JYXA 2F61A 4AIEA 2ZUMA 4CKQA 3N17A 3WFLA 1CIUA 2NT0A 4W7WA 5A8MA 5A6MA 3RJXA 4JCLA 2WLZA 4Z2GA 5BRQA 4F79A 1MFVA 4URIA 4JFUA 4PTMA 4K68A 5EB8A 4N42A 4TOQA 4QCEA 4AD3A 1E5JA 3WDHA 1GORA 3O9NA 4OOUA 2W67A 1KFWA 3CZJA 1W9VA 1JXJA 4OZOA 2EPKX 2XJ7A 4CGTA 4M24A 1EHAA 3W4RA 3J7HA 3L4VA 1B1YA 5AYIA 1OCQA 3K46A 4Z2LA 3VIOA 5DF0A 2ZOXA 3OLDA 3RPMA 4IPLA 1Q6FA 4GO8A 1W2PA 3BLKA 4D72A 4UQBA 4PMVA 1JD7A 2W66A 1GOKA 4H41A 3EMCA 4HMEA 3WUGA 1OT1A 2XM2A 1LWJA 1BAGA 3WMBA 3DC0A 5CG0A 3SCVA 5E9AA 2EJ1A 1TVNA 2DSUA 2VL4A 1GQJA 1BF2A 2VNCA 1RP8A 3EDDA 4GINA 3MANA 4W87A 4PUEA 3S6TA 3W24A 4RE4A 3WD0A 3KE0A 6A3HA 2DGAA 4CN4A 4MJ4A 3WEMA 3NYDA 2VTFA 4P7QA 1HL8A 2DH2A 1PZ2A 4UQEA 4MB4A 1MFUA 3U7BA 2YA2A 5C70A 2CPUA 4WLCA 4AZ6A 5CGTA 1A3HA 3L4YA 1E6NA 2WVSA 2J7CA 4PMNA 4KRTA 3UESA 4OBRA 2EO7A 3MS8A 2OYLA 3AROA 3MUY1 2JF7A 2ZX5A 3PZTA 4KMQA 4Q22A 4HA1A 1DTUA 4TX6A 3A4XA 1GW1A 3GH5A 3ARZA 1BLIA 1DWAM 3SCTA 2YDQA 1WDSA 4ATDA 3NDZA 3NIYA 1U2YA 1E40A 2VVSA 4ATLA 2UY3A 1SYTA 2OSXA 3GNOA 1V02E 2VRJA 1UD4A 3T09A 1Q6CA 2GUYA 1W91A 1NOFA 1GQKA 3OGSA 3BCDA 1TFVA 2D0GA 2WVUA 1W1TA 1J0KA 3N9KA 4JIEA 1UA7A 3BAKA 1VFUA 1E4MM 1UD5A 2WMFA 4NF7A 4PYSA 3VGBA 3VX1A 1R86A 3ZJKA 1UQZA 3WH9A 2WC7A 1OT2A 5A8PA 5KEZA 2VQUA 5A6SA 4E2OA 3M07A 1GHSA 4W5UA 5ABHA 2A3CA 3AISA 4M1RA 4UQ9A 5A6BD 2CETA 4WF7A 4BS0A 1V6WA 3NSXA 1UQYA 1UG6A 1C8YA 2XIIA 2BNJA 2XWEA 2YDSA 4PTVA 2JE8A 3VDCA 4EKJA 3ZSTA 1MW1A 4HA4A 3ZSSA 1WDPA 1UKPA 3CZEA 3FW6A 5AC5A 5A94A 5ABFA 1EOMA 4NRSA 1U33A 3OIHA 1OGGA 4GKLA 3ECQA 1UD8A 2WC4A 2Y8VA 2YL8A 1V3JA 1UWRA 1XSKA 5IDIA 1R8LA 3CUFA 4UOZA 5CPTA 1QI5A 3TONA 1B3YA 1QNOA 2VURA 3WQ4A 3MMUA 2CERA 1H1NA 2BHUA 3KZSA 2ZUVA 3VIFA 5I0DA 1AQMA 3RMEA 2IXUA 1RD6A 3K8MA 4XX6A 4YPJA 3WY1A 1DWFM 1PX3A 1I1WA 1CGTA 3PZGA 1KXVA 1WZMA 3CHDA 3UETA 1GPFA 3MU7A 1XSJA 2BY2A 1ISYA 2BVDA 1HF6A 4M8UA 1ZJAA 8CGTA 2BHYA 5ABGA 3OLEA 1V3KA 3OBAA 1CXEA 3CHCA 4FLRA 3N13A 2YBTA 1BYAA 1V08A 5HBFA 3BXWA 1MXDA 5ABFB 1KWGA 3CHFA 3EMZA 3U5UA 4D71A 2VI0A 3WQWA 2QMJA 4GI9A 4DUVA 3O6AA 1B31A 4ACZA 1GOMA 1E72M 4CVUA 4LQ1A 4LX4A 1TMQA 4GI6A 1XGZA 1KWKA 3PN8A 1AQHA 1EH9A 1OGSA 3RJYA 5LA2A 3AS0A 4PSPA 2WLYA 4UCFA 5IFTA 2VX5A 1OIFA 3LMYA 3OGVA 3T0AA 3NSNA 2O9PA 3WNMA 4M82A 1LF1A 3ARSA 3TOPA 1KGWA 4FMVA 1XHGA 1C8XA 1HJQA 1JDDA 4DUXA 3AS1A 5BXTA 1QVBA 3K4DA 3AIQA 2WMJA 2XVPA 2QV4A 1DWGM 1XSIA 3PTKA 4HP5A 5I24A 5M03A 3GBEA 3EDJA 3L2MA 4S3JA 2QPSA 5CSYA 2WXDM 4OOZA 5JIWA 1XD1A 1BTCA 1GVIA 3S2CA 1NWUA 4ACZB 3SUUA 4X0VA 1HVQA 2CBUA 4D6GA 3WD1A 3I3BA 1WZKA 3CUHA 4BZYA 1LG1A 1MW0A 1UH3A 1D2KA 4P8XA 2J79A 3DECA 4H7VA 3SCNA 1MYRA 5IHRA 2QF8A 3E1F1 1LQ0A 5IFPA 3RDKA 1JDAA 1OGBA 2X09A 1QW9A 1H0GA 3TP4A 2CKRA 4WSJA 4MAZA 4HU8A 3PZ9A 4H8VA 3BMWA 4TX8A 4PMRA 4WKFA 2BXYA 1OSEA 3SUVA 3ZR5A 4ACYA 2WHJA 3B9EA 4C7DA 3RO8A 1C91A 2WMGA 3FHAA 3FN9A 4UFMA 5CPSA 2ZXAA 3NJ3A 3QOKA 4JFWA 4GZEA 2XPKA 2PC8A 5FOOA 3GXMA 1B3ZA 3VIKA 3VGHA 1JZ6A 2C0HA 3W37A 1HP4A 1VFFA 2XTKA 2VX7A 5A6BA 2E8ZA 1E1EA 3MV11 2WWDA 4MNKA 3L4WA 1X6NA 1TR1A 1C90A 2XYLA 2J7DA 2PWHA 3LPGA 3W38A 2GFTA 3WEZA 3VGGA 3WBAA 3WDIA 1UR0A 2UWFA 5CLWA 2YL6A 1E3ZA 3ARPA 1GUVA 4QFUA 5ABEA 2XIBA 2J7FA 4W5ZA 4Z2IA 3A6OA 2ZXDA 2UY2A 1BQCA 4GI8A 2CHNA 2FHCA 5D9PA 3WQVA 2ESCA 3DYPA 1QOXA 1W9XA 3IJ9A 2A3BA 2WANA 1OD8A 3CUJA 1ISVA 2E9LA 2FH6A 4PTWA 3UG4A 1UR9A 4BQ3A 5A2CA 3WQ5A 3AZTA 1BGGA 2CYGA 2A3HA 3QR3A 4M80A 4MNLA 1HJVA 4Q7NA 1YHTA 4A3HA 5HXMA 2BV9A 1LL4A 1NWSA 2UY5A 3AMCA 3AFBA 4B9YA 1HT6A 1TCMA 1KGUA 4D6EA 1M7XA 5I3DA 3ZT6A 1V3IA 3WH7A 3F5KA 5HOSA 3CMJA 1UHVA 2V3FA 1PIGA 2Y4SA 3F4VA 3VDHA 1ISXA 4HZ8A 1ECEA 5FL1A 1KB3A 5D4YA 1US3A 3NUKA 1ISZA 1XYFA 1XCWA 4UOJA 3CUGA 4NRRA 3WSUA 3VGFA 2BS9A 3IK2A 5KZ6A 1FH7A 1VRXA 2PWEA 3CZGA 4QDMA 1NOUA 2D20A 1CGVA 4DWSC 3QGVA 6CGTA 1B30A 1FHLA 4MPKA 1GOOA 4JL2A 2ZUSA 1HKJA 1WB0A 3CO4A 1HP5A 3ZR6A 2VRKA 2AAAA 2O9OA 2JFEX 2G3MA 3VD7A 4DM1A 2D23A 3L4UA 1HL9A 2WC3A 1EOKA 1HX0A 3ARRA 1UD6A 1FFQA 4AZGA 2VVNA 4PEEA 2V38A 4RL3A 3GXFA 2FHBA 1Y7VA 2X0HA 1W9PA 4TUFA 4Z2HA 3VPLA 2XVLA 4S3KA 2W62A 1KXQA 2QPUA 3OLIA 4P7NA 1W32A 1DHKA 3VD9A 5JUVA 3BLPX 1J0IA 3MSDA 1E0WA 5D8WA 2VCAA 1J9YA 2RGLA 4GPNA 1TE1A 1UWSA 1XH2A 2V3EA 3AICA 1JD9A 4CU8A 1M03A 4V28A 2VJXA 2ZICA 4ATWA 2D0FA 1C93A 3GDBA 1JYVA 2J62A 2VX4A 3VM7A 1WAWA 3SIMA 2Y8KA 2DH3A 1WZAA 4LYRA 3AQUA 2CBJA 2ZXBA 2E9MA 2D2OA 4JFTA 1JZ4A 3W6MA 1ZBWA 3OLGA 2WMKA 3ZOAA 5A8QA 3KL0A 2E8YA 2GJRA 2VZOA 3K8KA 3EMQA 1ISWA 1QNPA 2XSAA 4F9JA 3MUAA 3RM9A 2VT0A 3WNNA 2QMKA 4B3LA 4UFHA 3M7SA 3AXXA 1JFXA 1EDTA 3A4WA 3BAJA 2J25A 3PZMA 4CCEA 1IZKA 2BHZA 2QLYA 4J3TA 2CIPA 1EQCA 3FAWA 1GOQA 1US2A 3BAIA 1YQ2A 3ARYA 3BGAA 4GXPA 3WF2A 5BCAA 3AZRA 5I79A 4AZ7A 5FCZA 4TVDA 5M17A 3VD5A 2VUYA 1E43A 4D6JA 2VZVA 4AZHA 4PCTA 3WF1A 3APGA 4EAMA 1CGXA 1HJSA 1U30A 2X0YA 3BSGA 5A6JA 3CUIA 2XGBA 4JCMA 4V2XA 1C8QA 1PPIA 4QCFA 2CCRA 1QI0A 1CYGA 4JFVA 1X6LA 5DFAA 1GONA 4OIFA 3EBVA 1JDCA 7CGTA 1KQYA 4DWSA 5A6LA 3WEOA 1C3FA 4U5KA 5DO8A 4TTUA 1E0XA 4MB5A 4F66A 4PBGA 2J4GA 3U5YA 2VQTA 1K9EA 3IJ7A 2WHMA 1DWHM 5A3HA 5C8BB 5CSUA 2HVMA 4D1IA 1E5NA 4H8HA 1G1YA 4PTXA 3AIUA 4MDPA 1GJUA 1MQQA 2QHAA 5A95A 1UR4A 3MMDA 1FOBA 3ARWA 2JF6A 4YHEA 1O6IA 2VC9A 4PSRA 3VD4A 3VTRA 1IT0A 4KGJA 4F9DA 1JAEA 3T08A 4MDOA 1XH1A 1J0ZA 1JFHA 3ARVA 3CZKA 1HJUA 3VIIA 4ZE4A 1KXTA 2J8FA 1CBGA 4JHZA 4DWSB 4AXNA 4W89A 4BQ4A 3GH4A 1FA2A 2J74A 1QHPA 3MUZ1 1FP8A 4D6FA 4J28A 4AISA 3KWXA 3PBGA 2ZUWA 7A3HA 1NM9A 1H41A 1LL6A 2WYSA 2OLHA 3ALFA 2FDMA 1CLXA 2BXZA 5M3WA 4JAWA 3T0DA 3CTTA 3NSMA 3SCOA 1UWUA 2RGMA 2MANA 2EPNA 4CUCA 3B9AA 1CXLA 1EQPA 2A3EA 1B0IA 8A3HA 1QHZA 5HPCA 3T0BA 2O9TA 3WNLA 5D9OA 1ZL1A 4JHOA 5GPRA 3WD2A 3WF3A 5CLTA 1KCKA 1W3HA 5A2BA 3F5LA 1UUQA 2GVYA 4WK9A 3W28A 3HMCA 2Y2WA 2YL9A 1G01A 3PZVA 1G94A 2J77A 3AYRA 3CMGA 2OSYA 4EANA 1QNQA 2CBVA 1UA3A 3VGDA 2ZIDA 1E15A 3KL3A 1WNOA 3VDBA 1WPCA 1PEZA 5BROA 3L2LA 4JKKA 1PJ9A 5JIPA 4IISA 1R87A 4NSBA 3W81A 2E3ZA 1WKYA 4WKHA 2BVYA 3WBEA 1WP6A 4CD6A 3K4AA 4H2CA 3PZNA 2D3LA 1KR0A 2D3NA 4Z2JA 4AD2A 3EDFA 1ZS2A 2F2HA 4BQ2A 1J01A 2G3NA 4IUGA 4D6HA 5JBFA 2J7BA 2VO5A 5A6AA 1PX8A 4V27A 1HJWA 1VENA 1M53A 1MW2A 1H0IA 1S46A 3QHNA 2BY0A 2J7GA 2G8ZA 4LXFA 4P7LA 4P7RA 1QI4A 1C7SA 1UR2A 5GNZA 3BSHA 3U57A 2WNWA 1G5AA 4PMOA 1MQRA 1CXHA 1W1PA 5C71A 1BSIA 3MSGA 2EBNA 4GZIA 5E70A 2DT0A 1CGWA 1O7AA 3T2QA 4CD8A 2AOSA 2XVKA 3WIJA 3WQ8A 3THCA 1CTNA 2WB5A 4AEFA 5JBEA 1E3XA 1E6ZA 3CH9A 4B16A 3WDJA 3W6LA 1BVNP 4JFSA 1G0CA 2CNCA 4CVWA 1CGUA 1UWTA 3UEQA 1KCLA 4GQQA 4UNIA 1XCXA 5ECUA 1DP0A 1VFMA 1ITCA 1HJXA 2FHFA 2J75A 4XUYA 4D6DA 1V3HA 1E70M 5GNYA 3B9DA 2W63A 4CU7A 1Q6GA 2PF0A 2A3AA 1D7FA 3AIRA 2G3JA 3EDKA 4YHGA 1XV8A 3WH8A 1KBKA 1H2JA 3MUIA 3SCQA 3AHXA 3WDQA 1CGYA 3AOFA 1MQPA 3WNKA 4PMXA 4GQRA 1E6QM 3D5HA 1UH2A 1WDQA 3F5JA 2IXVA 4HOZA 2YA1A 4MTVA 2BVTA 2Y24A 4CN6A 3VVGA 3VMOA 5BRPA 1V6XA 3ZJ7A 4B15A 2PBGA 2YL5A 4FLOA 3VM5A 4PMQA 2WZIA 1J0JA 1XH0A 1OINA 1W9BM 2WWCA 2EPMX 3NDYA 4U33A 3AI0A 3I3EA 4M56A 4PMZA 1JXKA 2Z1SA 3W0KA 3GXIA 4X0NA 2X05A 3UR8A 2WCAA 3N11A 2DT2A 1W3KA 1V6VA 4U2YA 4J27A 1E6RA 1V3MA 2OYMA 1LL7A 1GNXA 2WBGA 1JI2A 3ZJ6A 1NWRA 1DEDA 1UZ4A 1EIBA 2CKSA 1UR1A 3BAWA 4AY1A 1NARA 3GBDA 3TTQA 1OB0A 3MMWA 4L4PA 3POCA 3AYSA 2V3DA 3AHZA 1VJSA 3IAPA 2AMGA 3ZO9A 5CGMA 1BFNA 1JAKA 3AMLA 4OBSA 1XYZA 1BG9A 2YBUA 3QHMA 4E4PA 1JZ7A 5E0CA 1XD0A 3T2OA 2X1IA 3SUWA 4UFKA 3ZQ9A 4PUDA 4CD4A 1WO2A 2VZTA 2GJXA 3OGRA 1QI3A 2CXGA 2EXOA 2JEQA 4RE3A 3SCPA 4W88A 4JKLA 1BGAA 3L4ZA 3AMDA 3RCNA 4A3YA 4CN1A 3WELA 3MO4A 1TG7A 3L4XA 2VX6A 1B9ZA 2UY4A 4AMCA 4ML4A 5I6SA 3BAXA 1J0YA 3SCRA 1FH8A 2PI6A 3RILA 5CZKA 4DUWA 3PZUA 1E6SM 2X2YA 3K1DA 3W29A 3OZPA 5HPOA 3PTMA 3II1A 1B3WA 3WH6A 3CZLA 4B9ZA 1V6UA 1UH4A 1TA3A 4MNJA 4U3CA 2DSVA 1KGXA 3AIBA 4AZ5A 4BCEA 4CCCA 2ZUUA 3PHAA 1HKMA 2IUZA 2GJXB 3HU7A 5HNNA 2J8GA 3ARTA 1HN1A 4GO9A 4EE9A 3CHEA 2W61A 1VF8A 4M81A 4PMYA 1E56A 1EHNA 1VJZA 3A4AA 5A8NA 2OSWA 1BG4A 4OJYA 4UZSA 3W53A 1EGZA 5E0FA 1KQZA 2PB1A 5EBAA 5E6YA 3WH5A 3WFZA 4QLJA 1B3XA 3WF0A 1CXIA 4HOWA 4AD0A 2J47A 4X9YA 4TTGA 1E73M 5IXEA 4W84A
chains in the Genus database with same CATH superfamily
2C0AA 3DHFA 4M6UA 4ADTA 1JF6A 3KL5A 4P7OA 4NI3A 1TA3B 1BWLA 1UKQA 1KNWA 3HGOA 2OYKA 4UZUA 3W23A 2V6AA 3N9SA 3TTYA 1XLGA 1GYLA 1VGAA 3LK6A 1PIIA 4FS9A 3VD3A 3MBFA 4PL2A 4GFSA 5D8ZA 3TTSA 4AF0A 3VO0A 4X60A 1VBRA 2F6XA 1A47A 3CT7A 3GXDA 1R2TA 4R9OA 2H3BA 3PZIA 1K03A 1R7AA 3BE7A 4O1AA 3W7PA 3BV7A 3GTNA 2PWGA 4FR6A 1HTIA 1V0MA 4KGLA 1WCGA 4XZBA 3UWEA 4NU7A 3SGUA 1EA9C 1UKTA 1ITXA 4AW7A 3IUIA 1CB7B 2YB4A 1D8CA 2OWWA 1SFSA 4ZFCA 1POJA 2ZZ3A 3BTNA 2A6LA 4AYSA 1TX0A 5FIPA 3O63A 1SPQA 4LGXA 2AAMA 1Y0EA 2WPGA 3ABQA 1NQ6A 1GOIA 3TMQA 4J3WA 3CV2A 3ZVHA 4XIAA 5GQBA 1G9HA 5AHLA 1I2RA 2A7PA 3SEPA 3BWWA 4H4IA 3NQVA 3TWAA 3WKZA 5AOUA 1KTCA 2VR4A 1ZAJA 3HPFA 2OVLA 3TUUA 3KCOA 1ZBVA 3WBWA 2E9BA 1DJIA 4IX0A 1SR9A 3CQJA 4K8HA 1WKFA 4FI4A 3UJ2A 2WK2A 5BYWA 2VR5A 3LGGA 1PYFA 3A47A 3W74A 1E6XM 4GY1A 3O6DA 5DMMA 2OB3A 4GZJA 1LG2A 4LVDA 1OWQA 4C1NA 1XISA 5I09A 3WF4A 5C2XA 3EOOA 2ZE3A 2FFCA 1PXGA 2JIEA 4AC1X 3UQNA 1XGDA 3SSZA 5GJMA 1R3QA 2ZDSA 3DI0A 3EX2A 1RJQA 2BG5A 3WG6A 4KKXA 1BKHA 3HQ1A 4JTHA 5I3FA 2NXHA 2VFDA 4J3SA 1Q6DA 5GJNA 1ZJIA 1GJWA 2H9AA 3A64A 4W7VA 3P74A 4OVXA 5K4ZA 3GNRA 1H7WA 2TSYA 5AHMA 2DEPA 3HQPA 2ZTKA 2G50A 3B05A 2WVVA 1CDGA 1W1B1 3W27A 1Q3NA 1A5AA 2VOTA 4DAFA 1OFEA 1XM3A 5F2IA 4UC5A 3PTQA 2Y62A 4CCDA 8XIAA 3FAXA 2GJLA 1LORA 1HNYA 4A22A 2Q01A 3F4WA 4MADA 3MB9A 4QM1A 1W37A 3DHUA 4ZB2A 3TZNA 1KFBA 2GSJA 2OWXA 2QUNA 4LC6A 1XQLA 1V0LA 3TH6A 3UG5A 4IT1A 2ZRYA 4A8IA 1ZLPA 1SW3A 5I5RA 1DWIM 1VBUA 1F05A 3VMPA 3HTWA 1JF5A 2PWDA 2QS8A 4AEOA 4D6CA 5PTDA 7REQB 3UY8A 3BVJA 3RUBL 1LM1A 4B2DD 2BASA 2E6DA 3O8AA 4JEQA 3TDFA 1QBBA 2V3GA 4FF5A 1WE5A 3BLLA 3ZT7A 2VZUA 4INFA 5AYZA 3B03A 2CITA 1DJWA 4AD1A 1F5ZA 1VPYA 2DIEA 3JU2A 1TQJA 4W93A 4Y6GA 3NPXA 5E1QA 5BXSA 3AXIA 1NFGA 3BANA 1KV5A 2IMRA 3JZEA 4D8LA 1DIOA 3T1GA 1V3LA 2JEPA 1E4LA 4DM2A 3AIVA 4WDTA 1SJBA 4C6KA 2ZVRA 4WGHA 1GHRA 1XC6A 2JKAA 3H23A 4HZ7A 2C18A 3Q45A 4OHQA 4N7QA 3TJ4A 1H4PA 4UQDA 1UD2A 2R24A 5I2UA 5D38A 4FIRA 3FGCB 4GJ1A 5G2HA 1W1A1 3WMCA 4U10A 3W26A 4O1DA 1ZJBA 2DZPA 3AHVA 4WCJA 1DPMA 3EX1A 4GFIA 2GWGA 1A4MA 5K9CA 3A4JA 1I0DA 1MXSA 1WKDA 5HMEA 3LPPA 1RPKA 3ZJ8A 3LI1A 1AMYA 4E3VA 5EMKA 1BRLB 2PDMA 1MW3A 5DANA 2J6VA 4J35A 5TD4A 2GLKA 3KZPA 3G77A 4AU0A 3OA5A 4QRNA 3GVWA 4PFMA 1YIXA 4HYWA 2Z25A 1V6YA 2G41A 1D9EA 3FEMA 1OC5A 2PTZA 4DWDA 5C5YA 2H8ZA 3BZGA 3EWWA 2MNRA 1QHOA 2Y88A 3R79A 2G3IA 3P8JA 3U2EA 1GKRA 3DDMA 5F1VA 4FK9A 2P0OA 2INZA 2Y7DA 4HNOA 5A6KA 5TQLA 1BVWA 4QDPA 3RM4A 3U7VA 1GVEA 2E6FA 2OJPA 2JALA 4I6KA 1EC8A 1D3CA 4GACA 1DQWA 1ZCCA 2CESA 2PLMA 1EO7A 3NPVA 3RX3A 4ZEPA 2W4XA 4XWUA 3HJEA 1ZCOA 4EWJA 2XGZA 4HU3A 3FOKA 1JDEA 3TSMA 3ITVA 3LN3A 2DJXA 3LNMA 1IT7A 2ZVIA 3W7OA 2VKZG 5BMXA 2PLKA 4LVAA 1EBHA 2YYUA 4XAZA 2GGEA 1GVSA 4ERGA 1GZJA 4KH2A 1HVXA 4XO7A 3TYUA 4JKMA 4N6EA 1U5HA 1K9FA 5LNVA 3BLOA 1EC9A 1YNPA 1Q2RA 3PS7A 3FDKA 3PZOA 4CNTA 4X63A 4MWAC 1MNZA 4YVPA 1HW6A 1LBLA 1TPH1 4D1JA 1K3UA 2WMIA 1TSIA 4ECLA 1BPLB 3UR2A 3WFAA 5DBTA 2XVNA 2XU2A 2BVWA 1UWIA 4OKDA 3VNIA 3LHTA 1KBJA 4JNMA 3N25A 5DN1A 4LUIA 1FHDA 4GC3A 4M3PA 1OM0A 2VEPA 1GEQA 4KCVA 2FTPA 3MKKA 1IWPA 2INFA 4RKAA 3JZUA 4PMDA 3BSMA 1OIMA 3QZEA 1JYWA 2CLHA 1PCKA 1P7TB 5U4NA 1OD0A 1PKYA 2ZBTA 4HT3A 1TCDA 3SURA 4Z08A 4J3UA 3TMLA 2Z29A 3MVTA 1N55A 1BHGA 1VHCA 4YCOA 2VFGA 3NR0A 1HKKA 4MJ2A 1XRFA 3NA8A 3QC0A 4DI8A 4LNCA 4E8CA 5FEPA 2PCQA 2XDFA 1J10A 3N4FA 4LBSA 4FNPA 3AIEA 3FYPA 3N04A 4FX7A 4FOKA 4GIAA 3W00A 2WZHA 2CBIA 5REQA 5AC6A 4CNNA 3QZAA 4JX4A 4G2DA 1EJXC 3NEHA 4ZBCA 4HMDA 1C7TA 2J24A 3GTHA 1C9WA 3HN3A 3JUGA 5RUBA 1S5MA 3VIHA 4GVHA 3N2TA 2IKJA 3WMSA 4FAMA 5DQPA 2C8NA 4GIRA 1JNDA 4O19A 3TV8A 2HNEA 5M1TA 1PSCA 1NU5A 2O92A 2OXNA 4ICNA 2CLKA 2WKLA 2EG7A 3T2PA 2I57A 4FSAA 5DT5A 3S6OA 3UCCA 1YW1A 2WQPA 5CC7A 2WKGA 1L6SA 1EF2A 3CZ8A 3KTXA 2ZUTA 5HUPA 3WQ6A 3I68A 3N3MA 4A29A 4F8XA 3DUGA 1L8NA 2R9RA 1VRDA 5AC7A 4AFYA 5DT7A 4BI7A 2WZEA 4AIOA 1OYAA 1HXJA 3ALGA 3WDPP 3VGEA 4PN2A 3ZLFA 3UERA 1YDNA 1UPMB 3QYQA 1JL8A 1RVGA 3DXIA 4XSMA 4JGDA 2ZUMA 1IR2A 2QAPA 2Z1WA 3R13A 2Z27A 3GHTA 3R8GA 3N17A 3EWDA 2NT0A 4N9BA 2YPIA 2YR1A 3HFYA 4F2UA 1UIOA 5A6MA 2CLMA 1CI1A 4F4RA 1WBJA 2FPYA 1OHLA 5IM51 3STPA 2E25A 4K68A 3ITTA 2R6OA 4I7WA 3FJ6A 3MKVA 5LGXA 1PO9A 1E5JA 3WDHA 1GORA 3O9NA 1M65A 4IICA 5LNRA 4REQA 4OZOA 4DEFA 2EPKX 1DV7A 4CGTA 1B1YA 5AYIA 1E9IA 3WLMA 1EP1A 1ZRQA 1H51A 4HSHA 3IARA 1W2PA 1PV8A 4TV5A 3BLKA 3B04A 4MYAA 4MZ8A 2W66A 3AWOA 4DNMA 3WLNA 1GOKA 4UTWC 5HUOA 4HMEA 3WUGA 4DRSA 1EYEA 2PUZA 2XM2A 4H7ZA 3SCVA 5E9AA 2PDCA 5K9XA 1RP8A 4IJBA 2FFIA 1XYMA 2L5HA 2Y61A 9RUBA 3QGAC 3S6TA 4ZOEA 1V7AA 1TV8A 6A3HA 4CN4A 1OX6A 2Q02A 3WEMA 2VTFA 3ERPA 4P7QA 3EXRA 1HL8A 1A0CA 1S2WA 2VXNA 2C1GA 2YA2A 4XG1A 1A3HA 4QS5A 4C6QA 4PMNA 3NEVA 3UESA 5KITA 3H12A 4OBRA 2EO7A 2OYLA 3HPSA 3W1PA 4JQ1A 1ITQA 2JF7A 2ZX5A 5AB3A 5BMWA 4DXKA 4TX6A 3GH5A 3HG3A 4ZO6A 1R3RA 2YDQA 3CEPA 4NZ1A 2OGYA 3P93A 1T8XA 4ATLA 2UY3A 1SYTA 4F0LA 4PCNA 4WXYA 3C2YA 3T09A 3WJZA 1GQKA 2V2CA 5JH2A 2WVUA 1J0KA 4JIEA 1VFUA 1AJ2A 1TYGA 4EP8C 4AH7A 3VGBA 3VX1A 2WC7A 4AUBA 1OT2A 5KEZA 3TOYA 4E2OA 7XIMA 4LJ3A 1I9CB 3GZ3A 4WX2A 1XDMA 2A3CA 3LQGA 3AISA 3MKCA 4WF7A 4BS0A 3M4HA 3NSXA 4OU1A 1C8YA 3P3BA 1I8JA 3EOUA 2BNJA 4NYYA 1RVKA 1MO0A 3GU1A 4EKJA 3NQAA 3QY6A 4CQCA 1UKPA 2F7FA 2RKXA 3FW6A 1TQXA 5ABFA 1GYNA 2ZRUA 3FA4A 4GD0A 1KLZA 1OGGA 2YL8A 1UWRA 1XSKA 2QYGA 1R8LA 3CUFA 4IGNA 3TAOA 1QNOA 4WQ6A 4LB3A 2VURA 3WQ4A 3K4WA 2CERA 3MTWA 5DMLA 7ENLA 1H1NA 3H4XA 2ZUVA 5HJLA 1PKMA 1LYXA 3E12A 1DWFM 3WY1A 1F8IA 1KXVA 3CHDA 4IFKB 3UETA 3MU7A 3WLPA 3INPA 2DUAA 5TAOA 3KBMA 1ZJAA 2BHYA 2Z1BA 1R3TA 4FLRA 1QWGA 4S2BA 1V08A 1FVPA 2J9YA 3PG9A 1EYWA 2GGHA 3CHFA 3WO8A 4DUOA 4J9JA 3WQWA 3G1RA 1VYSX 2A2IA 1AK5A 2QULA 4DUVA 1ECQA 2PTDA 1AQHA 3MDUA 5LA2A 3A23A 2F6UA 4UCFA 3W7NA 2VX5A 3GIQA 3F1QA 1N8WA 3NSNA 5ABTA 2O9PA 4H01A 4B5XA 4Q4QA 3EB3A 4IMDA 3ARSA 3LHUA 1M7OA 2VELA 1XHGA 1C8XA 1HJQA 3SJ3A 2JBMA 3M0IA 1ZALA 2C3ZA 2VC7A 3RITA 5I00A 2ACSA 3K4DA 2QV4A 3TN4A 4Y9MA 2B4GA 4XKMA 2KAUC 5M03A 2YCEA 1IEIA 3F4CA 3P14A 5FSEC 4IP5A 1F6YA 3L2MA 2V5LA 4S3JA 2QPSA 2WXDM 1D3GA 4JTQA 5JIWA 3SRFA 1NWUA 4ACZB 3SUUA 1OFOA 3WD1A 3UPMA 1UH3A 4P8XA 1OYCA 4H7VA 3SCNA 2HVNA 3E1F1 1J2BA 1JDAA 2QUUA 3EPMA 1OGBA 1THFD 3TW7A 3UJRA 1Q6LA 2EF9A 1WOBA 4FNSA 4BEUA 3DESA 2YZRA 4ACYA 4GA8A 2DQWA 3SUVA 3ZR5A 1VFTA 2Z26A 2A4AA 1W5PA 3GG1A 4NZ3A 3FN9A 4LB4A 4UFMA 1H7NA 5KMYA 3NQBA 1QU4A 2PC8A 4NNAA 3A24A 4JBRA 3APTA 2BZNA 2VC5A 2C15A 3IGSA 4IZGA 5LNUA 3B3DA 4NZFA 2WWDA 3QR0A 2OR2A 2PZ0A 3MMTA 2FMOA 3TYBA 2J7DA 5F2GA 3LPGA 1BXBA 5SWUA 3LOTA 3TYDA 3KBNA 3A3XA 5CLWA 2YL6A 1O95A 1E3ZA 3ARPA 4D2JA 5FACA 5ABEA 4PL1A 1FDYA 4S3GA 4GIYA 5D9PA 3WQVA 3S2JA 1AQFA 1LUCA 3DYPA 1QOXA 8TIMA 3TJLA 5AHNA 4J3ZA 2WANA 5IBXC 3Q37A 1ISVA 4K38A 3V18A 4QX4A 3AZTA 4Q32A 3P0XA 3N6QA 3MVIA 4E8GA 4M80A 1HJVA 2GUBA 4Q8PA 5HXMA 1RQHA 1C8VA 1LL4A 1FWFC 2V9DA 2TMDA 3AMCA 3S42A 3UBPC 1HT6A 4B9YA 5I3DA 3L68A 3UGVA 1TREA 3CMJA 2V3FA 3F4VA 2Y4SA 1ECEA 5HR7A 3O0FA 1US3A 4X2RA 3EWYA 3VGFA 1FWIC 1XLEA 3LBCA 1FH7A 3EKLA 2WSRA 3KTSA 2PWEA 5I03A 1H61A 3XIMA 3EGJA 1S2CA 2E1DA 4UB9A 4B5NA 3OVRA 1HKJA 1WB0A 3CYVA 3QLLA 1HP5A 3ZR6A 2AAAA 3FKRA 3MHGA 2D23A 1LOSA 1HL9A 1YDVA 3L4UA 4JTUA 1WUEA 3NOEA 1EOKA 2V5BA 3LTSA 1IIHA 4AZGA 4GXWA 4DJEA 2YCLA 3TLLA 2ZA3A 1Y7VA 2EKGA 1FWSA 2HROA 4AWSA 1W5OA 2DZSA 4PODA 2W62A 5EMJA 1G7VA 5I02A 4P7NA 3EOEA 5JUVA 2V0TA 2VFEA 2ACRA 4BWLA 5D8WA 3PAJA 4Q4PA 2PF8A 2RGLA 4GPNA 2V3EA 3W85A 4CU8A 1KW1A 2VJXA 3OO2A 2ZICA 3PPGA 4LCSA 1AW5A 1WAWA 1O1HA 4V15A 3SIMA 3AU6A 3R1ZA 1QR7A 4LYRA 3AQUA 3KDOA 1LROA 3OJGA 1MMFA 4ILSA 3VKAA 3W6MA 3OLGA 2WMKA 4G5DA 4Q7BA 5C9RA 4DO7A 1NF7A 1QOPA 2GJRA 1DXEA 2ZCGA 1BSLA 4X61A 3K8KA 1ISWA 3TQKA 3EWXA 4UFHA 1GVFA 1T7LA 4WUIA 1TV5A 3AXXA 3OYZA 3CK5A 1XUUA 4JTDA 4CCEA 4RNHA 2VC6A 2QLYA 4RDYA 3FAWA 3OBEA 3BAIA 3ARYA 4H6EA 1XLKA 3WF2A 5CSSA 2IKIA 3AZRA 4AZ7A 5IRPA 4NNBA 2JKEA 3PTDA 3VD5A 4C1LA 2QCHA 5AYYA 3VZZA 1MDLA 3AXMA 3SGZA 3L67A 4AZHA 4PCTA 2A0NA 4NILA 1FCBA 3APGA 3CO8A 2VEMA 4V2XA 4TR9A 3BG5A 4YYFA 5CPLA 4Q8UA 4QCFA 4Z1DA 5FEWA 3A3WA 4GH1A 3G5EA 1WDWA 3VC6A 3ORWA 5F1UA 4OIFA 1XLDA 4JN6A 2JK2A 1KQYA 1FX6A 4DWSA 4DO6A 1DTNA 4A8NA 1EP2A 4TTUA 2Z0IA 1E0XA 4LCRA 3K30A 3WQPA 4UR8A 1G4EA 2VQTA 5HANA 4KEMA 1YPXA 2FDSA 3NL3A 1ONRA 5CSUA 4H8HA 4KT2A 5D03A 3QZ6A 2VEKA 3W9ZA 1UR4A 3MMDA 2JF6A 4WY0A 2PWVA 3VD4A 4PSRA 2BP1A 3T08A 4DF2A 1QT1A 4PMJA 3F7JA 1JFHA 3RXZA 2FJKA 4QJ3B 3MSRA 1HJUA 4ZE4A 2J8FA 1CBGA 3CEUA 1T99A 4Q8WA 3GH4A 3N6HA 1QCWA 4FZIA 1R3SA 1FA2A 4YJ5A 1TIWA 3MUZ1 5XIAA 4J28A 4LANA 2FMNA 4E6MA 2ZUWA 1YRRA 4ZSUA 2RFGA 3M5XA 1TTPA 2HXUA 5HMFA 3CV7A 1EBGA 4H3DA 1B57A 2OG9A 5M3WA 2AQOA 1FCUA 4HCDA 3SCOA 4ZB0A 5CJNA 3ZZ1A 2NX1A 2G97A 1SSGA 1R0MA 3B9AA 1CXLA 3TC7A 4JICA 4QDWA 1G4PA 1ADDA 1ZP3A 2WNZA 3T0BA 3ZFHA 4YTQA 3RRXA 3SN0A 2W0UA 3UJEA 5GPRA 3W87A 3UP8A 3OOQA 2XZ9A 5A2BA 5MKGB 3F5LA 4JTRA 4S2CA 4QSFA 1KA9F 3L23A 1G01A 4IG2B 3O6CA 2Z2AA 2WSQA 4NAEB 3MUCA 1PHQA 4EANA 1UA3A 2ZRZA 3LB0A 1PEZA 5BROA 2I17A 4IISA 4CNOA 3M47A 3DBNA 3HIJA 1EA0A 4HHMA 3REQB 1FWRA 1RY8A 3K4AA 2D3LA 1UCWA 2D3NA 4Z2JA 3LSCA 4JQ4A 4E2DA 1PVNA 1ZS2A 1H7XA 3G8EA 1A5NC 3QFEA 3TE9A 5A6AA 3BLIA 1Y5VA 5I7GA 4V27A 3ITGA 1H0IA 5TBOA 3W72A 5H8MA 2YXGA 1IEWA 3BSHA 4PMOA 2ZQ0A 1KM4A 1F07A 4EPDC 2UBPC 1XBYA 4NYUA 3V0TA 4GVGA 5C71A 4US6A 4C91A 5E70A 1O7AA 2Z7KA 3T2QA 3WIJA 3R89A 3A5VA 4J1OA 3PFMA 4PB4A 4NL1A 2OZ3A 1KM3A 2HEJA 3B4UA 4KEVA 3I10A 4R53A 3WCZA 2HWGA 1VP5A 4JFSA 3QFWA 1QK0A 3PSWA 1DJNA 3LGEA 3IGUA 4YNGA 1WKEA 2CNCA 1CGUA 1FKWA 1EXBA 1KCLA 1XCXA 5ECUA 1DP0A 2PDXA 3B0XA 2FHFA 2J75A 4CQBA 1E70M 1M6JA 4WY0F 1Q6GA 2PF0A 4NP7A 3PBVA 1KBKA 1VYRA 4CNSA 1Y5WA 3AHXA 3WDQA 2EHHA 3AOFA 4I9AA 1K7EA 4IMFA 4PMXA 3F5JA 3QKEA 4NX5A 4QSHA 2ABBA 4MTVA 2BVTA 2Y24A 3E02A 3O0KA 3VVGA 4OGZA 1OX4B 3A5FA 2YL5A 1XH0A 3KBSA 2SFPA 5HQLA 3WQFA 3FSTA 3VE7A 3NQ6A 3R10A 1OK4A 3BLEA 4PMZA 1JXKA 3CWOX 3UXKA 3B0VC 1XBVA 1A0DA 1RPXA 4PUUA 4B92A 3OHIA 4H6QA 3W86A 2WCAA 3IV8A 3TC3A 4UWMA 3KS5A 4QEEA 3KP0A 5J5DA 3MWAA 3TIMA 1LL7A 1JI2A 1DEDA 1VPQA 2CZDA 1OX5A 3BAWA 1JPDX 2J9XA 5T26A 3TTQA 3AYSA 2NSOA 3JR2A 3H54A 3PPHA 4YTTA 4EPKA 3R43A 1J93A 3ABZA 3GNXA 3AMLA 4RDZA 1XYZA 2YBUA 3QHMA 1MZHA 4E4PA 3C3UA 2QCEA 3T2OA 3SUWA 1AD4A 3C2RA 4CD4A 2F2KA 3R0DA 4C5ZA 4DQWA 4Q8VA 3KRBA 3SCPA 4C60A 1K8CA 2C16A 2OCZA 2Y7FA 3RNDA 3RCNA 4ROPA 3B8DA 2OQLA 4AMCA 2UY4A 2IPWA 1OFDA 4H9ZA 3AC0A 3DFHA 3SCRA 2BTMA 2XN2A 1UB3A 1ZGDA 2PI6A 3F2DA 4DUWA 1B4KA 3SI9A 2NX3A 3GAYA 3TR2A 3L5AA 1S5VA 4NJJA 4MNJA 4U3CA 5HQEA 4CCCA 4BCEA 5E9XA 2ZUUA 1HKMA 3R7MA 1OYBA 2NV9A 3UZ5A 2WQDA 4PB5A 2I16A 1PWMA 3IPWA 3I7SA 3HF3A 4TQTA 5HJXA 1QPNA 2W61A 3VC5A 1VF8A 4FNUA 4KFPA 1XIMA 1T8QA 3N29A 5K3VA 1S5WA 1WQ5A 5EBAA 5E6YA 1GVRA 3WF0A 3M16A 2J47A 5DMNA 1GOWA 5H8PA 4W8BA 1CZ1A 4RV8A 1EUNA 3UF9A 2J78A 1E1CB 1JULA 3GHUA 1TVLA 4JQ3A 4AEEA 2ZX7A 4FHAA 1K9DA 4R85A 5TF0A 5DRCA 4I6VA 3KAOA 4ES4A 3QMRA 5DY2A 1J12A 4LBRA 3AHTA 5G2IA 2EQDA 6ALDA 3E6EA 3AJXA 1XICA 2ISDA 5F7UA 2WAGA 2X8RA 3KHDA 1V0NA 4IPIA 1JI1A 3G1AA 4KF1A 2OLSA 1F6KA 4LUJA 1DVJA 2E6YA 4UTIA 4MWAA 3WNOA 1ESWA 3TYCA 3SJNA 4AWUA 4I9JA 4F48A 2WSPA 4TMCA 3ZIZA 2V5JA 3UR7A 1UPPA 4H04A 3O06A 2YW4A 1TWWA 3GZAA 3KBJA 3FJLA 1O5QA 2A7RA 2GOKA 2G37A 3NOYA 5I78A 2PODA 1IT8A 2I14A 1RP9A 4IPNB 3STGA 4C6LA 3VU2A 4ZB5A 2BFGA 3CMFA 4AF0B 1H50A 1NWTA 2OT1A 2GDVA 2R1NA 1PTAA 2XHYA 3C2EA 3PNUA 1MEWA 2HISA 4L7ZA 5L9FA 3NQGA 2YJQA 1RK5A 4EIVA 2FZDA 3QPEA 4ROQA 5HWJA 1M01A 3CASA 4DBSA 1G69A 2V8ZA 1J0HA 1XW8A 3B8SA 1TV7A 4AZCA 5J5RA 1XRVA 1WDRA 3ZT5A 2CLIA 2CLLA 1TPUA 1AQ0A 3VA8A 2E4TA 1VH7A 2QXWA 2E28A 2P53A 4GVIA 5FAGA 1ZBKA 4CNPA 3LZ3A 3S5ZA 5XINA 4XZWA 2X7WA 2R1MA 3AXHA 4HPGA 2XFFA 4KWVA 3UWUA 2YZ5A 4KETA 3AJ7A 1SFLA 2PD5A 3IANA 5A8GA 1F73A 2EPOA 4L1WA 5KINA 2AL1A 3VIJA 3H4GA 1GCYA 3VIPA 1CXKA 1RBOB 3H55A 4N02A 1Z44A 2PDGA 3GWQA 1W56A 5F2LA 1OFAA 4C1NB 3W76A 3RO6A 1Y8BA 1B54A 4NXSA 3BUVA 4UTTA 3A3HA 3CWNA 3TROA 2WM0A 5HATA 5LIWX 3G6MA 4LAUA 1D3HA 1FWGC 4PUJA 4W8LA 3M43A 3EYPA 1LBFA 4JYDA 2KZHA 3URNA 4NG3A 1V03A 2QF7A 4HPHA 4LV9A 1ZHAA 2E5DA 5HNUA 1SJDA 3V0UA 2H9AB 1DOSA 1W1ZA 2Y70A 3TSDA 1JZ2A 2E09A 3UW6A 4EK7A 2HS8A 1GQLA 2DSZA 3BH4A 4BI5A 3TN3A 2WVVB 1PAMA 2ZXQA 2B7QA 3KRUA 4L64A 3VUPA 1UZ1A 1NSJA 5LYRA 2VDHA 3N4EA 4IGHA 3QKZA 1Q65A 2HJPA 4LUSA 1TPDA 3VNLA 4NZJA 4HYVA 1K7FA 3S47A 2D24A 1MZRA 2BX7A 1HGWA 1E55A 1X97A 3S1VA 2QJHA 4M19A 4GZ7A 3FXYA 3H7VA 3PAOA 3LTPA 3EAUA 3WL1A 4UFIA 3PWIA 4GUFA 1F3EA 2WW5A 2RAGA 4H9XA 4U31A 2ZX8A 4YN5A 2ZUNA 1CWYA 3T81A 3PWGA 2H3DA 9CGTA 3N34A 2J6XA 3UXIA 1JPIA 5CGQA 1V0KA 2P88A 4GG9A 3OA3A 4MNMA 3FA5A 3AHYA 1I1XA 1SO3A 3OG2A 4C6EA 2FB3A 5LA1A 9XIAA 4ZENA 3S9ZA 4YXGA 2D0HA 3WDRA 2D1ZA 5A6TC 4JQ2A 2PP1A 4HU4A 2EG6A 2BY1A 3S4TA 3LS9A 1E71M 3C56A 1CECA 3NGJA 4HZ6A 1XDJA 4AXKA 3B0PA 4DYKA 2C19A 5G4WA 4CD7A 2ZE0A 1JCXA 4GYPA 1GKQA 3GKAA 4YWIA 4F0RA 5I3IA 3ANUA 4JIPA 5CBJA 3H2EA 4TU1A 1L6WA 3ARXA 2XSBA 4QISA 2ISVA 3PVFA 2FLIA 1HKIA 1NAL1 4QR6A 5C0QA 3GYCA 1N82A 5DEZA 4HK5A 2WNNA 5AC4A 3SCWA 3DAQA 4DLMA 1FWWA 2QDEA 3V36A 3H8AA 4DJED 3DYMA 4HOXA 3W25A 4JL1A 4RXGA 2HTMA 4XKYA 4C6FA 1KKOA 3T55A 1W3IA 1JCJA 3E9AA 2V5CA 5BWFA 1XG4A 3W7GA 5I06A 1TZ7A 1UR3M 1P6WA 2Q8XA 1KBIA 3W75A 2FGZA 1F3TA 1PKLA 5I77A 2GVJA 2I5GA 1VLIA 3W71A 1LDCA 2O7SA 3MZNA 1TV4A 2P50A 3TA9A 3RIKA 3C0LA 1EPVA 4Q8QA 4DJFA 4PULA 4AWEA 1ML1A 1RALA 4AHPA 1H5YA 4AD4A 4JX5A 1GPWA 2YGYA 2HE8A 4JY8A 5AN7A 3UVIA 3VOCA 2P8CA 4NZ5A 1PX4A 2PDWA 4L4LA 3AMGA 4QTGA 2B7OA 5F4WA 3TK7A 4AHOA 1JPMA 3O16A 3WENA 4GUJA 4O50A 3VCNA 1NH6A 3NO1A 1RZMA 4XZHA 2PWFA 1VCVA 4PCSA 1TWIA 3GRIA 4W7UA 1W17A 3M64A 1Q7QA 1FP9A 1LWHA 1V5XA 1VLWA 2FTWA 1B5TA 1UMYA 3RHGA 5C9ZA 2WHKA 2YKKA 4P8WA 2QGHA 3W7MA 4GHRA 4FB7A 5A1AA 1U5JA 4ICCX 4H9VA 1W9UA 5IDZA 4ZE5A 3ITXA 4OV4A 4QITA 1W9DM 3CGTA 3TWBA 3CPUA 1W3NA 2GZXA 1E6PA 2ZX9A 2VFIA 4CEUC 3GUGA 4Y7EA 4DWSD 1Q4NX 2WMIB 4W86A 2XWDA 3TNOA 3BGGA 3I4EA 4KIRA 4PRTA 5JBDA 1JZ8A 1LLOA 1OZMA 3KDNA 3KUMA 1VS1A 1FXQA 1NVMA 1Z69A 3C3NA 2J7EA 4U2ZA 3ANYA 4IM4A 1X1NA 5CPNA 4DN1A 1GQNA 4H8NA 2DT3A 1KRBC 1EXPA 4J3XA 1SU5A 5I3GA 2VWTA 3EWUA 3RLVA 1S1PA 4GXMA 4G8TA 1XFCA 3TTOA 5CJ5A 1ZQ5A 5CPQA 2FYMA 4BA0A 3VOGA 3C61A 4DZ5A 1PIFA 1PDYA 1W54A 4GGHA 4C7FA 3TCSA 5BZAA 1S2VA 4RPPA 3AS3A 3GVRA 2ZWZA 4IHCA 1W2VA 3WLLA 4WKAA 3TFCA 2CLEA 3CBWA 1W5NA 4IUOA 4X3ZA 5EGRA 3BV4A 1H62A 4UQAA 1X38A 4BQ5A 2C14A 1LJYA 4R5EA 1WOAA 3BJTA 3S0CA 3ITYA 1Z41A 2REQA 5REQB 4Y9NA 3MQTA 3USBA 2AKZA 3PUOA 2Q09A 2DJLA 4A21A 1CCWB 4NJHA 5FKYA 2W91A 1VEPA 4MGGA 1BYCA 5E09A 1J11A 2R94A 1GVYA 4AIEA 2BB0A 1Z3NA 4X9SA 1LWIA 3DGRA 1GWJA 3WFLA 1GZGA 2NZLA 4HNCA 3G0UA 3UWZA 1PL9A 4PB3A 2AQVA 4B4HA 2ZRXA 4Z2GA 3GXNA 4FNQA 2VD9A 2YCIX 4JFUA 2I56A 3GXTA 3B8TA 2Q8ZA 3L66A 2PURA 4QCEA 4IPPA 1VKFA 4OOUA 3C86A 5IBXA 4OV9A 3EA3A 1W9VA 1S2AA 4MKSA 3V16A 3DH7A 2NWRA 3GX9A 3LZ5A 4NJIA 5DF0A 5LSMA 3OLDA 1AW1A 4ZGYA 4D72A 1X8FA 3MBDA 4UTJA 4UQBA 1EF3A 1XBZA 1A5LC 2C91A 4Y8FA 4PFHA 3S9YA 1YTEA 3U8GA 1LWJA 3SW6A 1BAGA 1RAKA 2DFAA 2YBVA 4FEZA 3DFTA 1N7KA 4WJEA 2DSUA 1XRSA 1NDZA 2VP8A 4JTTA 1UZDA 4JDBA 5KZEA 3WYZA 4QG6A 1HZYA 2DV0A 1ELSA 1Z6KA 4PUEA 4MKVA 2BGQA 3NYDA 2F84A 4RZ6A 1PS9A 5D2TA 2GSHA 1MFUA 4AZ6A 4WLCA 3WLSA 3EA2A 1MRAA 2WVSA 2J7CA 4O18A 3W73A 7REQA 2VEFA 4J4KA 2VENA 5JVLA 1HKWA 3FYOA 4NNCA 4BKNA 5FA5A 1Z7AA 5DXXA 3PZTA 3NQFA 4GGBA 3LXBA 4GX9A 3A4XA 1OG6A 1BLIA 3CNYA 5FJPA 4F0KA 4DPQA 5B7ZA 5BOFA 3NDZA 2OSXA 3CB3A 1V02E 2VRJA 3QR1A 3GXPA 2PGEA 1B4EA 3M7WA 2GUYA 1NOFA 3OGSA 1RLDA 2D0GA 4M7TA 3ZWSA 3N9KA 3S5OA 5LXXA 1DJHA 2Z2UA 1CX9A 3BAKA 3NL6A 1E4MM 5CZTA 3CAKA 4WOQA 1H7OA 3B0UX 5A8PA 5K4XA 1SZRA 4HQVA 2VQUA 3RF9A 2Z2BA 5A6SA 1XC4A 1TRDA 2NQZA 3QPZA 3KVMA 4AAJA 4WEVX 5D05A 4M1RA 5A6BD 2CETA 2YFOA 4QXIA 1KM2A 1V6WA 4M6VA 3DX5A 2OEKA 3LRMA 3UWVA 3SO7A 4L9YA 4I9TA 2ZC1A 3VDCA 3ZSTA 5B7YA 1O66A 3CJPA 5A94A 1BF6A 2Y5SA 1EOMA 2A7NA 1U33A 4GKLA 3I6EA 3ECQA 2QR6A 2VM8A 1BRLA 1V3JA 3DG3A 2EJAA 2P8BA 4IMAA 3S5SA 4UOZA 3IVSA 4LBUA 3TONA 3G18A 3MP5A 3KZSA 4L6OA 4MY9A 1AQMA 1IEXA 3LM3A 3LHZA 3K8MA 4YPJA 1PX3A 3PZGA 1WZMA 5CCZA 1G4SA 1XSJA 2NQHA 5JH1A 1GOXA 2BY2A 1ISYA 2BVDA 1HF6A 3OLEA 4LALA 4AY8A 1XPYA 1CXEA 3CHCA 3LRKA 3N13A 1BYAA 3HA1A 4H19A 2D2GA 2G3FA 5HBFA 5ABFB 3U5UA 3EMZA 4LRSA 4JY9A 3OQEA 1TJRA 2QMJA 2PDUA 2PDJA 4GI9A 4I3GA 5FJRA 4PTNA 1B31A 1GG0A 5EL1A 3UT0A 1E72M 4CVUA 4LQ1A 4LX4A 2QQ6A 4XZMX 1EH9A 1OGSA 4OFCA 3UG8A 3N2OA 1TO3A 3CV6A 2NUXA 2WLYA 5IFTA 3D0CA 3HO8A 3U2ZA 3V35A 3LXAA 3OGVA 3T0AA 4ZSTA 3OVPA 1RY0A 2B81A 3L0NA 2G4JA 2YW3A 3QGKC 2OZ8A 4KESA 4DUXA 4A3QA 5BXTA 4H2HA 2XVPA 3QMTA 4HP5A 2XIQA 4J2PA 3NQEA 3BL3A 2WM1A 3LSBA 1Q85A 5CSYA 3QEZA 3MPGA 1GVIA 1Q6OA 5J8LA 1FQ0A 4DELA 4D6GA 4XZNX 1JRBA 4LNYA 1WZKA 3CUHA 2IPFA 1YE4A 3BCJA 1AH4A 2J79A 4PCFA 1YBQB 1EJWC 1T0OA 1XXXA 5AYXA 2X09A 4DJEC 1QW9A 4UTUA 1OZQA 4LS1A 1LLZA 2CKRA 4MAZA 2H8XA 3QY8A 4GUHA 3TVAA 4PMRA 2QKFA 5FJTA 5C9WA 5AZ1A 2WHJA 1LBMA 3MO7A 3EKGA 3RG6A 3UVAA 3T8LA 4C7DA 1C91A 3D3FA 3CAQA 3FHAA 1JRCA 3OIXA 2A79A 4DBEA 3GXMA 1B3ZA 4HD5A 1UUOA 4JYFA 4G7EA 3VIKA 1DYSA 3HGSA 3MUXA 4BR1A 1JZ6A 3W37A 1H63A 1HP4A 2A5HA 2XTKA 2E8ZA 3USZA 5KZMA 1F61A 1R46A 5FF2A 1X6NA 2XYLA 2QZRA 3H4WA 3WDIA 3CWHA 3CUXA 3U48A 1UR0A 2UWFA 1XCFA 4UR7A 4WR3A 3LYEA 4H9UA 3V7PA 4QFUA 4O0ZA 1IHIA 4W5ZA 4Z2IA 3ZLGA 1BQCA 4KFNA 2DZUA 2V2DA 8RUCA 3H70A 4Q4MA 1A4LA 1A5CA 1BTMA 2J9ZA 1JCYA 3IJ9A 2A3BA 3ELFA 1UP3A 3CUJA 3MYPA 1NELA 2E9LA 4IQDA 3HQOA 3PK7A 3NZRA 1BGGA 2A3HA 4MNLA 4TMBA 2C1HA 3ZVIA 4B4FA 6ENLA 4US5A 5CKSA 1WAUA 1TJ0A 3QW3A 4ICMA 1F7BA 3KVLA 3AFBA 3G1SA 1KGUA 1LRQA 1P1XA 3ZT6A 1V3IA 1K1DA 3F5KA 1UHVA 1PIGA 3WMLA 3DFPA 1ISXA 2OEMA 3XINA 1AL7A 4YTSA 3QV8A 2OZ0A 3DFSA 2A1YA 2ISWA 1LUCB 1EEXA 2QJGA 3A12A 3H2MA 3V0SA 3CZGA 4QDMA 1OCBA 4PBEA 1CGVA 4DWSC 4R7OA 5FF4A 1PTGA 4MPKA 5FJOA 3GO2A 3PB2A 2VRKA 3TX9A 1I0BA 4DM1A 1P0DA 2KX9A 4XBJA 2NWSA 1HX0A 2Q3RA 4UIOA 3ARRA 4CQDA 1FFQA 1DXIA 4JN7A 4PEEA 2V38A 1EJUC 3GXFA 1KO0A 1T41A 2PP0A 4HYRA 2NVAA 2X0HA 1W9PA 2CZEA 3FV9A 1VBJA 1GJPA 1TUFA 4IGSA 1H60A 4QQ3A 4XD6A 3S9IA 3W1MA 4A6GA 4EWND 4M1BA 4AYGA 5D2YA 3UZWA 3AICA 4V28A 4ATWA 2D0FA 1C93A 2CW6A 1JYVA 2J62A 4L65A 3DG6A 1P4CA 1EB3A 1VR6A 2DH3A 1EZ2A 3C0QA 2OX4A 2ABAA 2CBJA 4C6DA 2Y1HA 4IL2A 2D2OA 3KRSA 1JZ4A 1VBHA 2O56A 4MFEA 4NASA 4GNJA 4EPEC 1QNPA 4MLJA 4F9JA 4D8ZA 3F2CA 2R1LA 3RM9A 3BO9A 5CC3A 2VT0A 1XLFA 5CJMA 1FWTA 2QMKA 4MYXA 2RUSA 4B3LA 3PJXA 3M7SA 2QJJA 2F6KA 3P7YA 1EDTA 3A4WA 1I4NA 5KZDA 1RQBA 2D69A 2RDXA 2CLOA 2CIPA 3FJNA 1GOQA 3BGAA 4GXPA 5BCAA 2WO5A 5I79A 3OHMB 2WZMA 3RPDA 4TVDA 1QNVA 2QCFA 3VXGA 3ZWTA 1ME8A 5H6HA 2VZVA 1UOZA 1SM9A 1V4YA 3I7RA 2RDTA 1QASA 1HJSA 3BSGA 2PLJA 5A6JA 3CUIA 1O4UA 2VGFA 2PCEA 1PPIA 3PJWA 1U83A 1QI0A 4BEQA 5FSDC 4HPNA 1CYGA 5FJJA 5DFAA 2QNEA 1H1YA 3EBVA 1JDCA 2X16A 4L6HA 3IJQA 7CGTA 3ATYA 3C8NA 3LTYA 4U5KA 1JCLA 1ZAIA 1TE6A 4HNNA 4MB5A 2J4GA 1MEIA 5G1YA 4FX8A 3W2NA 1U1UA 1K9EA 3Q94A 3GVVA 1QFEA 4HHHA 1RHCA 5T9BG 1E5NA 3PUDA 1XI3A 1G1YA 4PTXA 3AIUA 1MQQA 4I5RA 4MM1A 4YHEA 1O6IA 4QIUA 5DLCA 3I6RA 3SN4A 4MZYA 1KFLA 4F9DA 1JAEA 4JQAA 4MDOA 1XH1A 1S3TC 4Q7IA 3P81A 1J0ZA 2E5BA 2HNHA 3ARVA 1EEPA 2NUWA 3PPCA 1ADSA 3G22A 3UJSA 3VIIA 4JHZA 4DWSB 4W89A 3LGDA 3CU2A 4BQ4A 3U6WA 3VOHA 4G6CA 1FP8A 5DRIA 4AISA 1HKVA 1HO1A 3PBGA 1VZWA 1Y65A 3WQGA 7A3HA 2DY3A 2FGBA 3SB0A 1CLXA 2PS2A 3WK2A 2Y89A 3DKJA 4GH3A 4JAWA 2FZBA 1AFSA 3T0DA 3CTTA 3NSMA 4W4QA 1UWUA 1H7PA 3W1UA 3GU9A 1FCVA 3MI3A 1EQPA 1B0IA 4JIIX 4FF7A 4LUTB 2X2GA 3WNLA 4LY4A 3JRKA 5D9OA 1ZL1A 5AC8A 3QVQA 1XLLA 2ADAA 1OABA 4DJFD 4L4MA 1JDFA 5DCDA 2OMAA 3T4CA 4R3UA 3CAWA 3K1GA 3RN6A 1NTHA 3PZVA 4RE0A 2J77A 3DKLA 1QNQA 3EXSA 3VDBA 1WNOA 4OE7A 1WPCA 2QJMA 3IJIA 1REQA 4IP7A 1PJ9A 2V82A 1ZP4A 4S23A 5FEZA 1R87A 3BQ6A 3W81A 2E3ZA 2PLCA 1WKYA 3WBEA 4B3ZA 3PZNA 3M0XA 4MJZA 3QQWA 4V1XA 4DZIA 1Q7ZA 4GKTA 3YPIA 4XO6A 3SFWA 4XTIA 3RX2A 4BF5A 4DAIA 1F9CA 2G3NA 4AVNA 5JBFA 3ES8A 1R9YA 4GVFA 1VENA 3QHNA 1Q6RA 2J7GA 2G8ZA 3EPNA 4P7LA 4LXFA 5DBUA 2G95A 1O5KA 1TELA 1XIEA 1UR2A 1S5NA 2EGZA 4HHPA 3CTLA 1EWEA 2PC4A 1CXHA 1W1PA 1P5BA 3MSGA 2WJFA 4GZIA 1CGWA 4CD8A 4H9MA 3JS3A 3FSUA 2DZAA 3IJLA 4F0HA 3CUZA 1WUFA 1JCNA 1CTNA 2WB5A 3F4NA 4Z42C 3E2SA 3CH9A 1W3TA 4B16A 4TIMA 1BVNP 1QDSA 1V93A 2RH9A 3D6NA 2E67A 1HJXA 1CB2A 1ONEA 4KWOA 4XUYA 4D6DA 1V3HA 1ZUAX 4M7SA 3SM0A 1E51A 2INEA 5GNYA 3B9DA 2W63A 4CU7A 3V5FA 2A3AA 3CPRA 1B9BA 3EDKA 3BJSA 4YHGA 4KQNA 3WH8A 4JTIA 1CGYA 4DXVA 1EX5A 4GQRA 4XAFA 2V68A 2QCLA 1UH2A 3MCNA 4AHQA 1K6WA 2IXVA 1TRIA 1MUMA 3NGFA 4J40A 2YCJA 5BRPA 1V6XA 2P76A 4EF9A 3P0WA 1XIIA 3BOFA 4PMQA 2FB2A 2BOGX 3H22A 4JTEA 3GB6A 3BOXA 3I3EA 4WRHA 2HXTA 4M56A 4RLIA 2P5NA 2FZNA 3KBWA 4IQLA 3GXIA 4X0NA 2X05A 4JN8A 3VDGA 5AVNA 3DEQA 3CXOA 4U2YA 3UNDA 1V3MA 4EXQA 2OYMA 1GNXA 3DBPA 3ZJ6A 1NWRA 2PRLA 2CKSA 4ZQRA 1UR1A 4UBPC 1JJKA 3GBDA 4L4PA 4F2TA 4HZMA 1K77A 3IAPA 3HFTA 2FVMA 3G1DA 1JAKA 4OBSA 1JZ7A 1U22A 2ZDRA 1KRMA 3ZQ9A 4I5XA 2VGBA 2QIWA 4PUDA 1TKKA 3QXBA 5G5IA 2ACUA 2CXGA 3LMZA 4RE3A 5MF5A 3AWNA 2HCVA 3U2CA 1V8EA 3DERA 1JVNA 4MG4A 1TIMA 7PTDA 3ICJA 4YYCA 4IIHA 3MO4A 1TG7A 1F6PA 5I6SA 2DORA 4ZTYA 3SQSA 5LIKX 5CEWA 1ZJHA 1FH8A 3RILA 3DIPA 2TRSA 1UBPC 3PZUA 4K7VA 2QAFA 2X7VA 1TWZA 3W29A 2PE4A 1DIDA 1B3WA 3WH6A 2I5IA 3CZLA 1V6UA 2ASHA 2DSVA 4O0QA 1KGXA 2XH7A 3AIBA 4Y90A 4EX4A 4S3FA 3W7HA 3HU7A 3PBMA 2XH0A 2J8GA 1WDDA 3ARTA 2ALDA 1XYLA 4EE9A 1X7IA 4G1NA 1NY1A 3IIXA 1EHNA 4TO8A 3LLXA 4Y9PA 3KFTA 3CIWA 3KHJA 3KOFA 3W53A 3QMSA 3WH5A 3WFZA 4KWWA 1BD0A 4EPBC 3TYAA 5HINA 1Q66A 4GI4A 4X9YA 1DORA 4EAYA 1E73M 1JQVA 1H1ZA 1DJGA 2A3LA 3N6JA 3KOXA 1KFEA 4RCXA 3QTGA 4IL0A 1KM6A 4UTTC 2BODX 4FLQA 4LW7A 2PRMA 2R1PA 4E8DA 1OVDA 3PB0A 2O4QA 2YFNA 3MY9A 3LD5A 3O1NA 2B31A 4WSHA 4KRZA 3VKKA 1QW7A 5EMMA 3VNZA 1TZ9A 4NZCA 2X1UA 2VHLA 3BCFA 1N8FA 4BJHA 1Z32X 3T8QA 3E0VA 1I2PA 2OELA 1QPOA 1IZJA 3QQ0A 4MB1A 3TQPA 4B5VA 4R9XA 2QEZA 5D09A 3GNDA 2XM1A 5FAJA 1KFCA 2Z1KA 4HMNA 3BLDA 2BLEA 2TAAA 5CAHA 1NDWA 3VUSA 3VNDA 3L21A 3W83A 1K4GA 1IEVA 3BLFA 2Z6IA 3BG3A 3O7UA 4RNJA 3VX0A 3HURA 3URBA 1E1FA 1JZ5A 3RLGA 3VMNA 3OB8A 1ZPTA 3QC3A 2WJDA 3H2NA 4PGLA 2CHOA 1PBGA 4GISA 5I3HA 2DT1A 4JYEA 4IJRA 2LLEA 4JHMA 5EFDA 3PSVA 2DSKA 4ZMGA 3E5BA 3DG7A 2I5QA 4P2VA 1FFRA 1HL2A 3WLTA 3W7KA 4ZO9A 3FYYA 2XISA 4W8AA 2P10A 3EX6A 3SQLA 1BYDA 1KR1A 4MWAB 2EPLX 3EOSA 3ID7A 2DP3A 1MXGA 3IUHA 3N18A 3MHFA 1CENA 3N2BA 1P0BA 3OEXA 1JZ3A 1JG9A 3M0MA 5IOBA 3C8FA 3COTA 4ZVJA 4O17A 4QQUA 3ABSA 4CU6A 4TVCA 1XIBA 2ZA2A 4RX0A 2Y85A 4AWTA 3ARQA 5LZLA 1QTWA 4H9YA 1QNSA 1R9XA 1F4AA 4AZCB 3AZSA 3GDLA 5I23A 3G3DA 3V3WA 1KM1A 2W3ZA 5M5DA 1AJ0A 4YTRA 4ZOCA 1PZ3A 1ZTVA 1AZ1A 4WDUA 4R7JA 3R2GA 1MRQA 4A2RA 2X30A 4QBXA 1SZGA 1EIXA 1W1VA 3KVKA 2FPVA 3SY8A 3LCXA 2NQJA 5AYBA 3WLRA 4MUZA 4WDXA 3P5YA 4GYPC 4WXZA 2YIHA 3ARUA 3GC4A 1YTKA 2NX9A 4KIEA 5E6ZA 2BOFX 2IW0A 1P0KA 3RU8X 3GG0A 1BEUA 4IMEA 4LPCA 5MKGA 3M1ZA 1UKOA 4TVUA 3P62A 2CHRA 1QXLA 3P67A 1XLIA 4AZBA 3PFRA 1FDJA 3VIMA 4XUGA 4Q4SA 2HVOA 3S1XA 4MF4A 2GQ3A 4IMGA 5CC5A 3GW3A 4IG2A 3FHQA 4MSSA 4O12A 2NQLA 1SFTA 5A8OA 4RE2A 5HWMA 4NAEA 4XV0A 4ERIA 5J04A 5AY7A 4PCPA 2HQAA 4WZHA 3BMVA 5GVJA 2X42A 2NVDA 3PP7A 4JTLA 3LENA 4XZ9A 4YMZA 4H8UA 1XIDA 1LOQA 3W2LA 5EFFA 5D30A 2TYSA 1XYAA 1IXNA 2BGSA 4J3VA 3G1YA 2IKGA 1K7XA 2W92A 1E9LA 3OZMA 1VIWA 2NV2A 1VFHA 2PDYA 4ZXLA 3GW0A 3M46A 2ZTJA 1EZWA 1XINA 2QCGA 1FDZA 3DU0A 3L0GA 2C71A 5EKYA 4CQAA 1M1BA 1RJPA 5EA9A 1EDQA 3SRDA 1W6TA 3EB4A 1Z42A 3N3TA 1P1MA 1GT8A 3S5NA 3DFOA 4DF1A 3EWCA 2DQXA 4N0RA 3T4WA 1I60A 4DJFC 4N2YA 2CFFA 1NP0A 3WD4A 3W84A 4KRUA 4LV4A 3G6LA 1R2RA 1KM5A 3EXTA 2C6QA 1IF2A 2DUXA 2DPEA 5EPDA 2GGGA 3WUFA 4LUSB 1TJ2A 4ZOAA 4DZAA 1U1JA 3KWSA 5CG7A 1QUMA 1H5VA 2JIWA 3GH7A 4FOUA 1XX1A 3SFKA 2P1FA 3WBXA 3MA8A 4ORIA 3ZM8A 4US5D 1TPB1 1DE6A 3TQVA 5CBIA 4UR9A 3W02A 2C1IA 3SUTA 4O52A 3CQKA 1SO6A 3K5XA 4HMCA 3AMKA 4IFRA 3IUDA 3KP1A 3GUWA 3O05A 1CT5A 2QUVA 1SO4A 1SVDA 3OZOA 4OUEA 1JUBA 1TUXA 2PBOA 4YVXA 1NOWA 3SCSA 3LI0A 1AH3A 2ATSA 3T78A 1JGIA 2IKHA 3UWYA 3SECA 1OX4A 4XBSA 4QLLA 5DX7A 1VEMA 4A35A 5D04C 1NP2A 1UIPA 3L7RA 4O54A 1SZNA 3FY1A 4C6MA 1E0TA 2Z1XA 4QE4A 3P61A 2QVHA 3E74A 3RLUA 2WSYA 4B5TA 3CC1A 2UZ9A 1TWSA 1ZZMA 4R7WA 4C6JA 2BY3A 3UYCA 4GK8A 3E3HA 4LYQA 4FXRA 1L0PA 4S3EA 3T44A 1ICQA 2OOFA 2QDDA 3IEBA 3VDAA 1OEPA 3GY1A 3BURA 3UGRA 1W8SA 1ODUA 4L6DA 4WSKA 1V02A 2WMHA 1WX0A 3URQA 1K6AA 1B3VA 3W82A 1P6BA 2PDBA 5HJYA 3WL0A 4V1YA 3GQYA 1ZU8A 1CPUA 3CQ0A 4AD5A 4QJ1A 4R88A 2WCGA 1K02A 3SGGA 2WCSA 3B06A 3BQ5A 3VZXA 3K2GA 2WSKA 2HK1A 3KLKA 2GDUA 4XKYB 2GK1A 3QOMA 2CEQA 1LQ2A 2PDHA 5TIMA 1RA0A 1WZLA 5HULA 3WUBA 1E4IA 2RDWA 3SUSA 3LHVA 3N2XA 4RDWA 2NVCA 3NDOA 3I65A 1VYPX 3M6YA 2AMXA 5D2XA 2WKJA 4BF7A 4MFDA 2VCCA 5CZJA 4DJDD 3TEVA 4LAMA 4U3AA 4JTCA 1B90A 1H3GA 4JTFA 1H09A 4WJXA 2GGJA 4LFYA 1R2SA 5LKYA 2D2JA 3ZLHA 2GVEA 5C55A 2E40A 4JS3A 5G4EA 3EWZA 1R85A 2HBVA 5HNTA 5KTLA 4RPQA 3N1AA 1XIGA 4ZXOA 4HCHA 1M3UA 2YA0A 2J88A 3H2OA 3LHWA 4RJEA 4H7CA 1RLCL 5A69A 1GKPA 2WVTA 1R3YA 3UCQA 1DWJM 1XGEA 5K9DA 1CNVA 3EEZA 5CZSA 4IMCA 1UC5A 2D22A 5EMLA 6REQB 1XS2A 4GCXA 4OUIA 1IZCA 4MY8A 4W9TA 4FLSA 3N2CA 5A2AA 1VBGA 1YNYA 4GOAA 2XVGA 2PSNA 2Q6ZA 4GUGA 7TAAA 3TNBA 1XJBA 4P8UA 2VDGA 3W1XA 2O9RA 1S2UA 1K4HA 1LZOA 4C6IA 1JIBA 4IQEA 3EX4A 3SDOA 1ZB5A 2OODA 4IOTA 3N14A 1WYIA 2ISFA 1SMAA 4EOUA 1J18A 4HVXA 1OJXA 1PB0A 1AG1O 1S5TA 4M51A 3VI2A 3KW3A 4OBTA 3E96A 1JCTA 2CC0A 3GM8A 3T7VA 1XKYA 4X2PA 1UKSA 3Q2DA 3PUEA 1CEOA 3QBUA 4DO4A 3PANA 3TYEA 3GTIA 1ZBCA 3SRHA 1GEHA 4POCA 1UWQA 1FH9A 4XB3A 2XN1A 4QAWA 2PWUA 1W3JA 4R27A 5DY3A 2A21A 4O10A 4UMAA 1ICSA 5FL0A 1RH9A 4ADUA 3VOJA 3RM8A 1RQEA 2ZWYA 1JQXA 3PPFA 3RGTA 1JYXA 1KCXA 2IS7A 4IPJA 3U3HA 1SSDA 3RR1A 3L2IA 1UP0A 1FWBC 3BW2A 3V4BA 4K36A 3RJXA 3VOFA 1Q2SA 2WLZA 3R6IA 4E2BA 5BRQA 4F79A 3VNJA 4URIA 4PTMA 4O8AA 2REQB 3TJXA 1PE1A 1NFPA 1ICPA 1XIJA 4N42A 5ECVA 2OTDA 2W67A 3W2JA 3T9PA 3CZJA 4IJCA 2AGTA 2HRWA 1JXJA 1J8VA 4O15A 4AVFA 4AQLA 1SZEA 1EHAA 1OCQA 4JEJA 4Z2LA 2X0SA 5C7VA 3B4YA 1UJQA 3F4DA 1Q6FA 4PE8A 4GO8A 4JIRA 4JTKA 4XD5A 4NZ4A 4H41A 3EMCA 4YVVA 1Z8AA 3UWQA 3MYOA 3TA6A 4IQJA 4S3BA 2CLPA 3DC0A 5CG0A 1TMLA 5AKQA 1TX2A 1YPIA 2VL4A 3U9IA 5CC6A 1BF2A 3FK4A 4FXSA 3EDDA 4GINA 4C1KA 3MANA 4W87A 1J6PA 3W24A 4RE4A 3KE0A 2WNQA 4LAZA 3D46A 3EZ4A 2HSAA 2DH2A 3QTPA 3U7BA 3G1FA 5D32A 3TYZA 3L4YA 4DZHA 3B97A 4KRTA 1RR2A 2HZGA 4L5ZA 5ENLA 3MS8A 3TN5A 3AROA 1ENUA 3GDRA 3MUY1 4BF9A 4Q22A 4HA1A 1N8IA 1DTUA 4G56A 4QAIA 1GW1A 3PBUA 1C29A 4NUWA 4ATDA 3ENLA 4QHRA 3T07A 3W7IA 1U2YA 2VVSA 1UD4A 1Q6CA 3M0KA 2ALRA 1W91A 3Q67A 2I7GA 3BCDA 1TFVA 3E0FA 1W1TA 4LT9A 4JIHA 4JNZA 2QDHA 3Q58A 1WV2A 4B5UA 4NF7A 4LF1A 3LG3A 3OW1A 2GQ9A 1UQZA 1RD5A 3V5CA 1WXZA 4LAOA 4QG9A 3M07A 4KW2A 3WLKX 5ABHA 2DZXA 4P5UA 4IWWA 5LHFA 3GFXA 3IWPA 2DU2A 1RSCA 1UG6A 1FBAA 3W88A 1ITUA 2XWEA 1VFLA 2YDSA 3P80A 4WD0A 1RUSA 3ZSSA 3W7EA 1WDPA 5AC5A 4PTDA 2OX1A 4NRSA 3OIHA 3VCRA 1UD8A 1P43A 2WC4A 2Y8VA 4B90A 2PGRA 4CQ8A 4UCGA 2HPIA 2Y6ZA 3H21A 2OU4A 5D02A 1QI5A 4ZL1A 1EFZA 4K37A 2XINA 1W0MA 2BHUA 3WQCA 4GLEA 3VIFA 3RMEA 2IXUA 1KKRA 2RJHA 1J5SA 1I1WA 1VPXA 1CGTA 1FCQA 3CPGA 3L0KA 3IVUA 4FXFA 3LCGA 4M8UA 3R58A 2BXVA 2Q3OA 1V3KA 1V7YA 3CL8A 4UNLA 5FF3A 5JU6A 2YBTA 1MNSA 4DHGA 5FF7A 1MXDA 3KLLA 4CQ9A 1YKWA 1Z89A 4QJ4B 3GSMA 3O6AA 4MIMA 3WX7A 2CZ5A 1P0EA 3LCIA 3MJMA 1XGZA 1BQGA 2HMCA 3AU2A 2GUUA 3AS0A 4PSPA 2V63A 1L6FA 3LMYA 1AUSL 4WVXA 1LF1A 2FZMA 2AKMA 1KGWA 1JDDA 4HPXA 3AS1A 3E2RA 2WMJA 1A0EA 1DWGM 5I24A 4XBKA 3GBEA 4N4QA 1AZ2A 3N4AA 5CPMA 3IJDA 4ZODA 3S2CA 1F3XA 4UTMA 1JR1A 1X1OA 2E77A 3I3BA 1TJPA 1LG1A