1EDTA

Crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of endo-beta-N-acetylglucosaminidase H at 1.9 A resolution: active-site geometry and substrate recognition.
pubmed doi rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase (glucosidase)
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H
total genus 88
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edtA00
1K9EA 2ZUNA 3WNKA 1QHPA 3CO4A 3FY1A 1BVNP 1JG9A 1AQHA 5DEZA 1LL4A 1V6UA 9CGTA 1BG4A 3A4AA 3BLPX 1FH7A 4P8WA 3MSGA 1GZJA 1R85A 3F5LA 1ODUA 4IPNB 1OB0A 4KRUA 1UZ1A 3WL1A 1XYFA 2JFEX 1QW9A 3UEQA 1UWRA 1XV8A 1DP0A 3CZ8A 2J7EA 5FL1A 3CLWA 3K46A 1KGXA 4MPKA 1A3HA 3ARZA 1MQPA 2DT1A 3WD4A 1H5VA 3AS2A 3M7SA 2J74A 1QI0A 3RPMA 5IFPA 1JYNA 2WMFA 4GIAA 4UFJA 4LYRA 4UTFA 1EGZA 2ZX7A 4B3KA 4W89A 3AHVA 1KXTA 4P7LA 1VF8A 2DEPA 5FIPA 1B2YA 1CLXA 4UFHA 2EXOA 1U33A 1UHVA 1QI3A 3OLIA 5HNNA 4TVCA 3N18A 4PEEA 4ATDA 3L4YA 1B3ZA 3ALFA 1S46A 4UQDA 3W24A 2BY0A 2VQUA 3PTKA 2EPKX 3WSUA 3BCDA 2G3NA 1GQKA 1QHOA 3VGHA 4CKQA 4GKLA 1I75A 1BGAA 3BMVA 3BSGA 3WY1A 2NSXA 1UR4A 4YPJA 1I1XA 2G8ZA 4Y7EA 3RM8A 3RM9A 3VMNA 3TOPA 1GOWA 3ARTA 1XSJA 1HIZA 4ZE4A 2MANA 2CIPA 5D8ZA 2WC4A 2VRQA 1EDTA 1J10A 3AMKA 4AIEA 1V0KA 2WKGA 3GNRA 3NYDA 4TXEA 3CHCA 1UWSA 5JBFA 1ESWA 4KGLA 2A3CA 2VT0A 1J0IA 3T0BA 5FL0A 2O9PA 3CZJA 2VMFA 1CYGA 1QW8A 3WUBA 2ESCA 1ZL1A 1HKIA 2W63A 3WH9A 3UETA 1JNEA 4W88A 1WKYA 2BHZA 2WVTA 5CJ5A 3AZSA 1NP2A 2CETA 2VVNA 1WO2A 2YDRA 4PUDA 1HJVA 2WCSA 7TAAA 1FA2A 3N04A 4QLLA 4GQRA 1DWJM 1HJQA 4WSJA 1HL8A 3AHXA 3E1F1 5CPQA 4ATWA 2VZUA 2OWXA 2XWEA 2E9MA 2WK2A 2GFTA 4DWSB 3VD9A 2C0HA 4W87A 1B9ZA 1UKPA 1G94A 2J8GA 2JEQA 3MUZ1 3SCNA 2VX6A 4C7FA 5C71A 2WPGA 4UR9A 3AZTA 2Y8VA 1ZJAA 3AIWA 1L0PA 1Q4NX 2X0YA 3PZOA 1SFSA 2J7BA 2WKLA 4TX6A 3WEMA 3AMLA 4MDOA 3ZR6A 4V2XA 4D6HA 4MADA 4AYSA 2GJXA 2W92A 4W7WA 1Z32X 3WF1A 2Y24A 5A8PA 3WMSA 1HXJA 2D0GA 3K4DA 1GORA 4UOZA 1C8XA 4TUFA 3TTQA 1BYCA 4AWEA 4X9YA 2QHAA 3WNPA 4MJ2A 1HJSA 5CLWA 1NOUA 3MMUA 2D3LA 2YJQA 4AEEA 1CGTA 3WQ8A 4H2CA 2XHYA 5E09A 3HMCA 1KWGA 1K9FA 3CUIA 2PBOA 4LPCA 1E56A 1FFQA 4MDPA 3DC0A 3L4TA 2E9BA 3AIQA 1OCQA 3QHOA 5CPTA 1V3KA 1GOQA 5HPOA 3ARUA 4W5UA 2D2OA 2WHMA 4B16A 1V6WA 3SEPA 3JUGA 3W37A 1EDQA 1JXKA 4PMYA 1GHSA 1HP4A 1ISVA 3OLEA 1OIFA 1H11A 4J3SA 1EIBA 1VIWA 3IANA 1TFVA 3AS3A 3VM5A 5A1AA 1C7TA 3EDEA 3HU7A 1MXGA 1E0WA 3PZTA 1NOWA 1R7OA 1TVNA 3VIHA 4U33A 1CECA 2XVKA 1W3HA 3W26A 1VBUA 2YDSA 3BSHA 4JFUA 3VIJA 3BCFA 1H1NA 2QMJA 3AS1A 2F8QA 2A3HA 1XSIA 1JAEA 3J7HA 5I3DA 1UD4A 1ITXA 5A69A 1JI1A 3GYCA 2X05A 4B9YA 4CD4A 2VRJA 3CZEA 2WXDM 4U3AA 3B9DA 2XVGA 3LPOA 2BHYA 4CUCA 1HJWA 5IDIA 1CGXA 5A8MA 1GOKA 3RO8A 1NWTA 4UQAA 4WJXA 2JIEA 4JKMA 4J7RA 3HN3A 3OA5A 4OZOA 2WAGA 1GW1A 1QNRA 1UQYA 1JDAA 3PZMA 2QPSA 1BQCA 4ATLA 1HKJA 3VDBA 1MXDA 3VDCA 2DSKA 1DTUA 1FH8A 4B15A 3OGVA 1B3VA 3SUVA 2FHFA 4JL1A 4QP0A 4W93A 3GXIA 1JF6A 1MQQA 1UWQA 1H4PA 4NF7A 3THCA 2V3DA 1UH2A 1FFRA 2XFFA 1PJ9A 2VURA 2ZE0A 1D3CA 3ZJ7A 1JFXA 3S6TA 3VNYA 1BG9A 2HISA 2WMKA 5IHRA 3L4UA 2DSUA 3CHFA 3VKKA 1EDGA 1V6YA 1VFFA 1XCXA 3U7VA 1GOMA 1CGUA 1TZ7A 2ZXQA 3LMYA 1QI4A 1H09A 3PHAA 4KGJA 4UCFA 1ECEA 2FHBA 1C90A 4DWSC 3UG4A 1Q6CA 1G1YA 1W9PA 5DMYA 4BF7A 1JD9A 2CBVA 2XIBA 2O92A 2AAAA 2YBTA 3L4ZA 4V28A 4AXNA 4FLOA 4XUYA 3BXWA 4NSBA 1PX8A 2CPUA 1J11A 2VTFA 4GZJA 3MO4A 1XRVA 4W86A 2EPMX 4UFKA 5I77A 1TA3A 2GJXB 4D6IA 1HP5A 1CENA 1OWQA 2XUCA 3ARYA 4F9JA 1GNXA 1PIFA 2PI6A 1UH3A 2OYMA 2UWFA 2ZX5A 1W3LA 4GPNA 2IXVA 1BYBA 3BH4A 4GZIA 5CQ1A 2BVYA 1VENA 4JAWA 3B9EA 1BGGA 1E6ZA 5FCZA 1D7FA 3MU7A 2XVNA 3WD1A 1KFWA 5AYIA 1B31A 1E43A 2WHJA 1CLVA 1J0JA 3WDJA 1V6XA 3VGBA 1E0XA 4U3CA 2WVSA 4DUVA 1EO7A 2DSVA 4QAWA 2OLHA 2V5CA 4UFIA 5A8OA 1IV8A 5M03A 5LA1A 2O9RA 4BS0A 1EA9C 2ZICA 4AIOA 5I2UA 5JIPA 1C93A 5E9AA 5CSUA 3AMGA 1NQ6A 4QLJA 1O6IA 3FHQA 1GUVA 2ZUWA 4UOQA 1OGSA 1W3JA 1JIBA 4DUWA 3ZOAA 3GXFA 2J25A 1MW0A 1JZ5A 3CGTA 4D6EA 2XPKA 2WMJA 3OGRA 4HP5A 5IXEA 1SMAA 1LL7A 3BAXA 1G01A 1V02A 4GINA 4UFLA 2PWHA 4JKLA 1C3FA 3WQ5A 4UZSA 5BXTA 1W1PA 3OB8A 1D2KA 1JZ4A 1EH9A 5EFFA 3ARWA 2WLYA 3MUAA 3CIVA 2VCBA 1B90A 2WZIA 4C7DA 2BY1A 3GH7A 4H7VA 5C8BB 5FOOA 4MAZA 4HMDA 2D1ZA 1EXPA 1DWIM 1V3MA 2G3JA 3T09A 4JCMA 3AICA 1UR2A 2IXUA 3AMDA 1W2VA 2D0FA 1E6NA 3VU2A 4CD7A 4BCEA 2GK1A 5I23A 3FNDA 2ZX6A 5CPSA 2YLLA 1J12A 3U7BA 4ZEPA 2XG9A 3POHA 1V0LA 4QCEA 3BAIA 3WFZA 3WH6A 1XH2A 3WDPP 4PMNA 1CWYA 4M1RA 3CHEA 3W53A 3WUGA 4AD5A 3VDAA 4V27A 1FHDA 1CPUA 4TTGA 2FH8A 4AD4A 2X8RA 1LWJA 2CCRA 1QOXA 3O2LA 2ZOXA 3ZQ9A 3MUIA 3MANA 3EDJA 3MV01 4D6CA 5BXSA 3AHZA 3N12A 5M5DA 2ZUSA 1UYQA 1LQ0A 3VIGA 1TE1A 5I0DA 1V3IA 3BAWA 4AISA 2YIHA 4NI3A 3TA9A 1V3LA 4P8VA 1E40A 1GPFA 1CTNA 4JFVA 5EFDA 1W3KA 1WPCA 4CU7A 4NRSA 4PN2A 4AZIA 2XYLA 1TMQA 5E0CA 4JKKA 4CN4A 3T2QA 1KBKA 3UG5A 5I5RA 5DT5A 3AS0A 2BHUA 2QV4A 2Z1KA 1QHZA 5A95A 2A3AA 3N9KA 3WD0A 3L2LA 1CDGA 4WKAA 4WIWA 4CN1A 2GUYA 2XSAA 1UH4A 2YL9A 4GO9A 5D9PA 3W29A 1HKMA 4E8CA 1ZBKA 4H41A 3W6MA 1IZJA 1NOFA 1V02E 1MW3A 2WBGA 3WENA 4W8LA 3A47A 2CHOA 5E6ZA 1IT0A 2XIIA 4XX6A 2FGZA 3WH5A 2BXYA 1SMDA 5I24A 1QNPA 2XFRA 5IHSA 3NCOA 1KGWA 1XGZA 5D8WA 4J3XA 1CXFA 3APGA 4UQ9A 2YL6A 3ZMRA 1DWHM 5ABFB 3D3AA 4CD8A 1JYVA 1M04A 1HJXA 1DHKA 3FW6A 4B9ZA 1VEMA 2D24A 3M6DA 4FLSA 3W82A 5HXMA 4AZHA 4Q22A 1H41A 1NP0A 3DHPA 2YL5A 1US2A 5FKYA 2J78A 2G3IA 2W5FA 3CUHA 1E4NA 1IZKA 3AIUA 4OOZA 1PIGA 1H0IA 3EBVA 4BQ5A 1KQZA 3A4XA 3WNOA 1W91A 2Y2WA 2B31A 2DIJA 2QLYA 3LPFA 5HPCA 1H0GA 3N17A 4S3JA 3U5UA 3RMEA 2BNJA 4PYSA 4AZGA 1GJUA 2Q8XA 1UUQA 2G3MA 4PMZA 2YA2A 3CUJA 1WZAA 1EHAA 1AVAA 4PMRA 1PZ3A 3NIYA 3WQ6A 3FXYA 1TUXA 1CXKA 3DYPA 4RE4A 3VIFA 1BYAA 3EDKA 3I3DA 2JEPA 1KR0A 1ISWA 1M03A 3KZSA 3EMCA 2YA0A 3N1AA 5JBDA 1LL6A 3AXHA 5LA0A 2VOTA 3GTNA 1E9LA 5M17A 3ARXA 1UD8A 1EOKA 3EMQA 4EK7A 2WC7A 1JZ7A 2AMGA 2XSBA 5AYBA 1N82A 2QF8A 1CXHA 2VJXA 4OIFA 1LF1A 3WDIA 4L4PA 3WL0A 2VC9A 1FP8A 4J28A 4B3LA 4JIEA 2QMKA 4ZE5A 3WDQA 3QHNA 1W1YA 1ZU8A 2CKSA 2ZXDA 3HJEA 2XJ7A 1E0VA 1VRXA 3O6AA 1ODZA 3AISA 1UD6A 2WCGA 4U5IA 4GXPA 4ZFMA 4TVUA 1B1YA 3CTTA 3KL0A 3PZGA 1E71M 2JF7A 5M3WA 3IJ7A 4P7NA 1KR1A 2J7FA 3EDDA 5D9OA 4DWSD 1M7XA 1U30A 2CBIA 1JD7A 4FK9A 4MJ4A 3ZIZA 3TP4A 4HZ7A 2Y5EA 1PPIA 4CCEA 1CZ1A 1W9XA 1XYZA 1HNYA 5DFAA 3VGGA 2CITA 4XZBA 4CN6A 1KXVA 2EJ1A 2C8NA 4P8XA 5BWFA 1B3YA 1JI2A 1EQPA 5A2CA 1ISYA 5CSYA 4PMXA 1NWSA 1R7AA 1WZKA 3VIMA 3TTSA 3WBAA 3WD2A 4R5EA 2E3ZA 5EB8A 3SUWA 1VFUA 2IUZA 1CEOA 1I1WA 1OT1A 1OM0A 1UKQA 5BRPA 2YOCA 3VGFA 1BYDA 3MV11 1TVPA 2DDXA 2DT2A 4OKDA 1HVXA 5CGTA 1HT6A 3BLKA 1FH9A 2CBUA 3EMZA 1K9DA 2VZTA 1VBRA 4PTVA 1GVIA 1GCYA 4MB1A 4M24A 1JYXA 1UA7A 1UWTA 4ACZB 2DSZA 1J01A 3F4VA 3SUSA 4U2ZA 1HX0A 3ARVA 2DT0A 3UERA 5ABGA 1NWUA 4P8UA 3WUEA 1K6AA 4JZ5A 3CHDA 2WB5A 4LQ1A 2QPUA 4H8HA 1OD0A 2WMIB 3AIVA 3QOKA 1UZ4A 2RGMA 3OBAA 1OGGA 3OG2A 3AHYA 1ZBVA 5JIWA 1BHGA 3CZLA 3I3EA 1SYTA 5BYWA 3POCA 1GVYA 2WM0A 1J18A 4HU0A 5CLTA 2VRKA 2DSWA 4PBGA 3AJ7A 3IK2A 3DHUA 2WBKA 4JHZA 3PTMA 4IUGA 3GXDA 1KGUA 1PZ2A 3WMBA 1M53A 1UR8A 1CXEA 1GOOA 5A94A 1OSEA 1PX4A 3VMOA 4QLKA 4H8VA 2W91A 2E8YA 2E40A 1Q6GA 2UY3A 4CVWA 5AC4A 1E6RA 4EANA 1UQZA 4J3TA 3ARSA 3GDBA 1JGIA 2BY3A 3CZGA 4D71A 5HDRA 3WN6A 4HA1A 3AQUA 2RGLA 3EYPA 1MQRA 2G41A 1K9TA 4A3HA 2NW0A 4PMOA 1WE5A 1CIUA 3WMCA 2E0PA 3K8KA 3AROA 4M8UA 2BS9A 4WLCA 3WD3A 1H49A 3W81A 5GNXA 3WIJA 2ZXBA 3MMDA 4JHOA 3T2OA 3WF3A 1R8LA 1NWRA 3F5KA 1XC6A 3NSMA 2XVPA 4UZUA 4PTXA 1U2YA 1HN1A 3QHMA 4W5ZA 1E5NA 4UQBA 3EDFA 4J27A 4DWSA 1GHRA 4MAVA 5BXPA 3ZO9A 1EO5A 1JDDA 2A3BA 2OYKA 4JFWA 4L4OA 1R86A 1XH0A 4UFMA 4M80A 2VR4A 1JZ3A 5A2BA 1HVQA 3VD7A 1ISZA 3L2MA 4IM4A 3WQVA 3RIKA 2F61A 2VQTA 2EEXA 1KCKA 2V5DA 1BLIA 1E55A 3W27A 5JBEA 4PMDA 2WMIA 2YL8A 2CXGA 3CMGA 1E15A 3BMWA 4OJYA 3MS8A 3F5JA 3ZSSA 5ABHA 1OBAA 1BVZA 5AC5A 3WNMA 5HBFA 2WWDA 2CKRA 3UR7A 4ACYA 1QNOA 3SCWA 1BSIA 4MNLA 3GBDA 5BCAA 1VFMA 4ACZA 4DM2A 1QNQA 4P7QA 4X0VA 3DYMA 1HL9A 2JE8A 3MSDA 2PWDA 1NH6A 2D23A 2PF0A 4BQ3A 1CGVA 2WHLA 1X6LA 3DECA 4D6GA 2FDMA 4JFSA 5GNZA 2CEQA 3WNNA 3LPGA 3TTOA 1H3GA 1PBGA 2WVVA 4Z2IA 3OZPA 4YN5A 3CH9A 4MB5A 1UD2A 3SUUA 1Q6EA 1LG2A 1BPLB 2X1IA 4R27A 2YDQA 2VO5A 2J75A 1FP9A 2J79A 4LYPA 5EMYA 4UQCA 1KCLA 3BGAA 2BY2A 4PCTA 1UA3A 4HOWA 4PUEA 3VO0A 1DEDA 1BF2A 1EQCA 1VEPA 1EHNA 3KEHA 2VNCA 4P7OA 2VX5A 1GJWA 3CMJA 4M81A 4MTVA 7CGTA 2CERA 5ABEA 4CU8A 5AY7A 3ZT5A 4M56A 3VOCA 5A8QA 1W9DM 3VD4A 4Z2GA 4ZENA 4URIA 4OBRA 4CCDA 1V08A 2XGIA 2VZOA 3LPPA 2CESA 2DGAA 2WW5A 1BFNA 1E3ZA 4GI6A 2ZIDA 3SCVA 3CBWA 5D9NA 1UWIA 5KZ6A 4J3VA 2J4GA 2WANA 4A4AA 3L4VA 2VZSA 3VD3A 2J7CA 3NSNA 1XSKA 4FLQA 1F4AA 3PBGA 2YBUA 1CNVA 3ZT7A 1J0ZA 4NZCA 2OWWA 1CGWA 5I6SA 5A6KA 4TTUA 3VPLA 3IJ9A 2D20A 3OZOA 1JAKA 1DWFM 3BC9A 1E3XA 3PZNA 3KE0A 4EE9A 1CBGA 3WQWA 1GONA 4JFTA 3SIMA 4MB4A 3N11A 1W2PA 5I79A 3KWXA 3B8SA 1OD8A 1QNSA 4XB3A 2ZWYA 3VD5A 3W6LA 3ZT6A 4XZWA 3QOMA 3VIOA 5EBAA 4BQ4A 3T0AA 2VCCA 3WBEA 1J0HA 4HMCA 2ZX9A 1JFHA 4BZYA 1UKSA 1V0MA 5A6AA 1VJZA 1WZLA 3ARRA 2JIWA 3ARQA 1TR1A 1VJSA 2XTKA 4AEFA 4AMCA 1LJYA 2BVDA 3UR8A 1XHGA 2X0HA 3WNLA 1KQYA 3ALGA 3MMWA 4D6FA 1G5AA 5GPRA 2O9OA 2CHNA 3AMCA 2V3EA 5D9MA 3SCPA 4AZ5A 1LWHA 4PMQA 3VGDA 1AMYA 3VX1A 2GDUA 8A3HA 3AIBA 1ZB5A 5A2AA 4CGTA 2WVUA 2CBJA 1C92A 1OINA 1ISXA 3U5YA 3TTYA 4AZCB 2J62A 3GNOA 3NJ3A 2ZUMA 4PMUA 2DPEA 2OWCA 4N0RA 3VM7A 4AD3A 3ZJKA 4AW7A 2VZVA 1YQ2A 2PB1A 2TAAA 2V38A 2VX7A 3FAXA 4UOJA 1UR9A 4HU8A 3CZKA 2V3GA 3FHAA 4W85A 1UD3A 2WSKA 4DM1A 5A6LA 1MFUA 2DH2A 2ZUTA 1SR0A 3WDHA 1RH9A 3PTQA 4CD5A 2WC3A 1E6SM 2VCAA 3WUFA 4AY1A 1GOIA 5CG0A 1GQIA 4GI8A 3A6OA 4M82A 4MNKA 3N13A 3SCOA 1B30A 2UY4A 1ZS2A 5LYRA 3VGEA 1US3A 3SURA 1OT2A 1XD1A 2E8ZA 2WHKA 1F4HA 2AOSA 1MW1A 4TX8A 1CXLA 4W7VA 3ZM8A 4AD1A 2NT0A 3L4WA 3NDYA 2W67A 1QBAA 3RILA 2ZXAA 4D6DA 3TONA 2UY5A 2OSXA 4E2OA 1KXQA 3IJ8A 4Q7NA 4UQEA 1RP9A 5IFTA 3S2CA 3ARPA 4H8UA 2WVVB 2Y4SA 4IPLA 1TA3B 4FMVA 3K8MA 1C91A 3L4XA 3VTRA 1PAMA 1G0CA 4RE3A 4XV0A 1AQ0A 3BAJA 3WDRA 1GQLA 4TVDA 3PZUA 1WDPA 4KMQA 4PSRA 1ZBCA 1TCMA 4GO8A 4YHGA 4UNIA 4F79A 3GBEA 5GQBA 3UCQA 1E1FA 1Q6DA 5C70A 1UG6A 2PWEA 2VUYA 4YHEA 1C8YA 2DT3A 3I3BA 1X1NA 3VUPA 1E6QM 1HJUA 1UR0A 4PCSA 3SCTA 2W4XA 1WDQA 2PBGA 2V3FA 3K4AA 1RPKA 1MFVA 5BROA 2VL4A 5HOSA 1B3WA 1O7AA 1JZ8A 3WF2A 2FHCA 4OBSA 4FF5A 3M07A 3WH7A 4ZXLA 1WP6A 1VEOA 4LYQA 1UOKA 3AOFA 2WCAA 1DWGM 3GZAA 4DUXA 1E73M 4HPGA 1QI2A 3RJXA 5A8NA 1HF6A 5D4YA 1WDSA 5KEZA 2ZUVA 2VX4A 2X09A 4MNJA 2WYSA 4AC1X 4BQ2A 3AYSA 1JF5A 3AIEA 3A3HA 4X0NA 4AD0A 1CGYA 4LXFA 1JL8A 4D1IA 1E6XM 2J77A 1W1VA 1E6PA 4HA4A 4W7UA 2W66A 4AIUA 3DYOA 3NSXA 4MNMA 3IAPA 1X6NA 2PWGA 1JYWA 3PZVA 1NM9A 4LGXA 2CYGA 3AHTA 5A6BD 2XFYA 5A6SA 1GQJA 1C7SA 4EKJA 2WZEA 4RL3A 4AD2A 2BFGA 3ZJ6A 3T2PA 3ECQA 3VX0A 4F66A 5CGMA 2ZWZA 5DF0A 4A3YA 4E8DA 5I78A 3W25A 3G6LA 2CNCA 4Z2JA 3CPUA 3D5HA 2DH3A 1MVYA 4JCLA 1JZ6A 2F2HA 3GH4A 1EOMA 1UR1A 2JALA 3VIKA 2DQXA 3UESA 1MWOA 1W9VA 4Z2KA 4U5KA 2GJPA 2GDVA 3VIPA 1B0IA 3B9AA 4HZ6A 1L8NA 3AXIA 3K1DA 3WFLA 4QDMA 2J7DA 4S3KA 2ZUUA 1UKTA 1V0NA 3CUGA 1E72M 4H04A 3T0DA 2C7FA 5E6YA 5GNYA 3OLGA 3WEOA 4HA3A 4QFUA 3M46A 1B3XA 1W9UA 4HZ8A 4E4PA 5LA2A 2OSYA 4TOQA 2GVYA 2Z1SA 4HMEA 3WF4A 2XM1A 4ML4A 4PMVA 6A3HA 1VFOA 3G6MA 3SCRA 1QVBA 4PTWA 1V03A 3VVGA 4OOUA 2GJRA 2EPLX 4WKFA 2J7HA 1JNDA 3PN8A 1ITCA 3IAQA 2XGBA 1CXIA 5CZKA 3WEZA 1Q6FA 5ECUA 4KRTA 1PX3A 5BRQA 1E4LA 1XD0A 1WNOA 2OSWA 2NT1A 6TAAA 3OLDA 4GZEA 2WWCA 3WQ4A 1A47A 3RJYA 1HKKA 5A6JA 3NUKA 2WNWA 1WB0A 3FN9A 3MUY1 1E4IA 3AIRA 1XCWA 2EQDA 3PZIA 1UWUA 2PC8A 4K68A 1MW2A 1BAGA 1QPKA 3GH5A 3ZJ8A 1WCGA 2D3NA 3QGVA 4U31A 2XVLA 1Y7VA 3WF0A 2D0HA 4W8AA 4CCCA 4PTMA 4M29A 1JXJA 4PSPA 4EAMA 3K8LA 5FD0A 3WH8A 2J47A 4F8XA 4AZ6A 2VR5A 4AZ7A 1P6WA 3ZR5A 2W62A 3VINA 4D6JA 1AQMA 3W4RA 2FGLA 3U57A 2VI0A 7A3HA 4D1JA 4U2YA 4WF7A 1JZ2A 3QR3A 4AZBA 3AI0A 1PEZA 4JL2A 1E5JA 5DO8A 3AYRA 4WKHA 1V3HA 4KH2A 1NARA 2WZHA 1R87A 5A6MA 1KWKA 3O9NA 3VNZA 4HOXA 3GM8A 1ZBWA 1OIMA 3OGSA 1KBBA 4MB3A 2PWFA 2GSJA 2D22A 3SCQA 4GQQA 3FAWA 1UKOA 2BV9A 4J3WA 2EBNA 4P7RA 1H2JA 1E4MM 3W28A 1ZJBA 4IISA 4RE2A 5CXPA 3SUTA 3SCSA 2W61A 4ZXOA 5A6BA 3THDA 4HTYA 2EPOA 1DWAM 4QCFA 3KL3A 2G4FA 5E70A 1WAWA 4OUEA 4FLRA 1V6VA 2X2YA 2XWDA 3RCNA 1VB9A 3WELA 2HVMA 4CVUA 1RD6A 2YA1A 1BTCA 3AXXA 2VVSA 4C7GA 1JDCA 8CGTA 3PZQA 4NRRA 5A3HA 1E1EA 2E4TA 4W8BA 4KWUA 1LLOA 3NDZA 1MYRA 2J7GA 1G9HA 3VIIA 4Z2LA 3UG3A 2GK1B 1J9YA 2XM2A 1C8QA 1KB3A 3OIHA 5TD4A 3W38A 3VILA 3RM4A 1TG7A 4W84A 3W0KA 2OYLA 1W1TA 1RP8A 4GI9A 1XH1A 1QBBA 2BVTA 3SCUA 2Y8KA 5JUVA 3T08A 1W32A 4AZCA 3MKKA 2BXZA 3CUFA 1WZMA 3A4WA 3ZSTA 2E9LA 1WDRA 1QI5A 3KL5A 4Z2HA 3II1A 1VAHA 2ZX8A 4LX4A 5E0FA 5DT7A 3VDHA 2WMHA 5BXRA 1V3JA 4N42A 1J0YA 3GNPA 5ABFA 2JF6A 1KXHA 4F9DA 3GXMA 1J0KA 2A3EA 2YKKA 4CU6A 2FH6A 1FOBA 3BAKA 1W9BM 4WSKA 3VMPA 3RDKA 4HPHA 4HOZA 3AFBA 3PZ9A 1UD5A 2YLAA 2O9TA 2EPNA 2WLZA 4WK9A 3WKZA 3N15A 1E70M 5F7UA 1LG1A 1M01A 2DIEA 1OGBA 2WMGA 4PRWA 4J3UA 4BA0A 1FHLA 2WSPA 2EO7A 2J8FA 3BAYA 6CGTA 3AZRA 4D72A 1YHTA 2UY2A 4CD6A
chains in the Genus database with same CATH superfamily
3WNKA 1QHPA 4O8AA 4GK8A 3ELFA 1AQHA 2YSWA 1LL4A 2EG6A 4US5D 4P8WA 1WXJA 1GZJA 3F5LA 4IPNB 5D05A 1OB0A 3VCCA 1IR1A 4JNZA 2A7RA 1XV8A 1HL2A 3ZVHB 1J79A 1DP0A 3CZ8A 2J7EA 1XIFA 5FL1A 3CLWA 3G1DA 4HMNA 3HQOA 4MPKA 2RDUA 1A3HA 2DUAA 3ZWTA 3FJNA 2VUNA 1GOXA 3RPMA 3TJ4A 1YPFA 4UTFA 1EGZA 1XXXA 2ZX7A 4B3KA 1SJCA 1RSCA 1KXTA 3N73A 3QY6A 3URAA 1WXZA 2GVEA 1CLXA 4UFHA 1U33A 3W02A 3U4FA 4NUWA 1QI3A 4BI5A 1XC4A 4WDXA 4RCXA 4PEEA 2PSNA 1B3ZA 1UPMB 2I1OA 3P14A 3C3UA 1JCNA 1TIMA 3U2OA 3OVQA 3BCDA 3VGHA 3W76A 2XH0A 5J5RA 4LVFA 1BGAA 4GBUA 3BMVA 3BSGA 2NSXA 3EB2A 4YPJA 3RM8A 5EYWA 3NQCA 1R9ZA 2FZNA 1XLLA 3BSMA 1NY1A 1A5MC 4TXEA 4XUGA 3ANUA 5AHNA 3N6JA 4EF8A 4Z0SA 3LQGA 2VT0A 1TKKA 2PWUA 3WZ0E 3H2NA 3M0MA 4RW5A 5AVHA 1VHNA 3BG3A 5KINA 2OG9A 3UJFA 3WUBA 4YS1A 2RDWA 1GVEA 2PF8A 4L6HA 3TSMA 2W63A 3W7JA 4IQEA 3C61A 4W88A 2BHZA 1VGAA 2WVTA 4ERAA 2I56A 1WO2A 4YYFA 1IQ8A 1HJVA 1RAKA 3R6IA 1L6FA 1OCJA 3QFEA 1B57A 3E1F1 4ATWA 1XWYA 1AD4A 3BICA 4M6PA 3E0IA 2GFTA 4MKVA 3SCNA 1EJVC 1EX1A 3DZ1A 1SUXA 4C7FA 5C71A 2DJXA 2NVDA 4QAIA 2VKZG 4UR9A 1J2WA 5HNRA 1AW2A 2X0YA 3MBDA 3N6HA 1S5VA 5CPOA 1SFSA 4XBSA 2WKLA 5I09A 4TX6A 3WQEA 4MZ8A 4F4RA 4KKXA 2GJXA 3GW0A 4ML9A 4O0ZA 3FLUA 5I3KA 5A8PA 2D0GA 4N02A 3WLIA 1DHPA 4F0SA 3FSTA 3I7RA 1BYCA 4FXJA 3S6DA 4PUJA 1JQVA 4LBSA 5CLWA 1NOUA 2NXIA 3DFPA 3WQ8A 4H2CA 3NPVA 3GY1A 4HHPA 4DAFA 1E56A 1FFQA 4PMJA 2B81A 3NNTA 5K2ZA 3KOWA 3S5OA 1V3KA 2Y63A 4WDTA 2WHMA 4HNNA 1XQLA 1YBQB 1EPXA 3SEPA 3JUGA 1RQEA 2DIKA 2X42A 1EDQA 3BK0A 1VZWA 1GHSA 1HP4A 3GVQA 3G0XA 4J3SA 1EIBA 1LTDA 3UNDA 3QF0A 2C79A 3WK0A 4YLWA 3HU7A 1E0WA 3WLPA 3VIHA 2ZRZA 2ZZ1A 4KCVA 3IJQA 3VNKA 1F2JA 2NVAA 4IHCA 4JFUA 3VIJA 1H1NA 3HM7A 3AS1A 3I7QA 2A3HA 1ZJHA 4DLFA 2AQVA 2V68A 2Z6IA 4XKYB 2ZTKA 5FF4A 3QN3A 1UD4A 4OWGA 3WLQA 1ITXA 4NASA 5DY3A 1JI1A 3GYCA 4B9YA 4CD4A 1TX0A 2VRJA 5KZEA 3CZEA 2WXDM 3M5ZA 3AU2A 4O52A 1L2QA 1RK6A 2BHYA 5KZMA 1K8YA 4A3RA 1X98A 2J9YA 1Q3NA 4UQAA 3AC0A 3MP4A 4PTNA 4J7RA 4GACA 4OZOA 4JQ3A 4XIAA 1ENUA 1KM4A 2OB3A 3RUBL 4JTLA 3M5YA 3I6TA 3NZQA 5U7SA 4B15A 3EKLA 2A6NA 2OOGA 1CW2A 3SUVA 2FHFA 4W93A 1TV8A 1JF6A 1MQQA 1UWQA 1H4PA 3CL8A 4NF7A 3B40A 1UH2A 1FFRA 3TYAA 1H7PA 2XFFA 1PJ9A 4HCDA 1D3CA 1TYGA 4C5ZA 1BG9A 2HISA 4DF2A 5LGZA 1VFFA 1XCXA 3EEGA 3TN5A 1GOMA 3Q45A 4JTHA 1TMLA 3W74A 1ECEA 5JVLA 1W9PA 3RCYA 1JD9A 3PK7A 4DB7A 3N19B 2AL1A 1PE1A 4GZ7A 4Z1CA 3UZXA 1U5VA 3L4ZA 4AXNA 5K7JA 1Q7ZA 2CPUA 3TYCA 4GI4A 2VTFA 1FXPA 1AODA 3I10A 4UTIA 1TA3A 3QKEA 1AH0A 4NQ1A 3ARYA 4F9JA 3STGA 3ZYZA 5DELA 1QUMA 1UH3A 2OYMA 2UWFA 4GWEA 2PTDA 2ZX5A 4JQAA 4GPNA 1FDZA 1J5SA 1YXCA 2PGFA 1E6ZA 3TROA 1D7FA 2QCHA 3MU7A 3H2OA 5LIXX 1KFWA 2HPMA 8XIAA 4PB4A 1ONXA 5H8MA 3WDJA 2B7QA 2V2DA 1XGEA 2NQHA 2BXVA 4N9DA 2A2IA 4U3CA 2J24A 4ZO9A 2CC0A 3ABZA 4UFIA 1IV8A 5LA1A 2O9RA 4JTKA 1DJQA 5AYXA 1IEVA 2JKEA 5I2UA 5JIPA 2CLKA 1C93A 3BARA 3LLXA 5E93A 5CSUA 2F38A 1R47A 1J2BA 4QLJA 3EZ4A 3UY8A 1I4NA 3B0PA 1YRRA 4DQWA 1V79A 5CCZA 4Q8TA 1RA0A 1VYSX 1W3JA 1FVPA 2MUCA 1IGWA 3GXFA 2Z0IA 2XPKA 1FKXA 1S5WA 1LZOA 2FB3A 4MLJA 3FIGA 5AZ1A 2C1GA 3KCLA 2GUBA 4QROA 1KFLA 1EH9A 5EFFA 2NX9A 3ARWA 3WJSA 2VEKA 4DJFA 3TQVA 3NZGA 4BR1A 2H3BA 2QDGA 3B0YA 3UWYA 1Q6QA 2H9AB 1K77A 1EXPA 4NAFB 3CAWA 2IXUA 1O5KA 5I23A 1V77A 3LM7A 5CPSA 4HNCA 1J12A 2XG9A 3BAIA 4RLIA 3C8NA 5KITA 4GOAA 4LUSA 3ATYA 4L9XA 4AD5A 3VDAA 2V8ZA 5HQEA 2PLCA 3H7RA 5TIMA 2OELA 3A3WA 5D32A 1LWJA 3SECA 2MNRA 2ZOXA 1JCYA 1PSCA 3MVIA 1GK8A 5BXSA 5MHBA 5M5DA 1LQ0A 4O4WA 1XFCA 5I0DA 3NO1A 2YCIX 1GVRA 4N6EA 3E38A 4GHRA 3DCPA 1E40A 5EFDA 1FWDC 1WPCA 4L64A 4AZIA 1TMQA 3DBNA 1Z48A 3NYZA 1KBKA 3LUTA 1EJRC 1XCFA 3PFMA 3MC5A 1XIDA 5DT5A 1P43A 2Z1KA 5A95A 1XBYA 4LCSA 3SI9A 3WD0A 3L2LA 4CN1A 1MDLA 3E2VA 3GSMA 1RK5A 3QC0A 4E8CA 2HVNA 1M7JA 1S2AA 3LERA 4H41A 3W6MA 2H9AA 2ZRVA 1NOFA 4GVGA 5G4WA 2WBGA 3K30A 5HANA 4IMDA 1FWTA 5I3IA 1OFPA 5EPDA 1QPQA 3WH5A 2Q02A 3W1MA 8TIMA 1VHCA 4YTSA 3L23A 2PP1A 2XFRA 3IVTA 2FIQA 5HNTA 3LNPA 4B91A 4J3XA 5FJTA 1TTJA 4BWLA 3APGA 1E0UA 4DO6A 4XVDA 3ZMRA 1DWHM 1YE4A 4Z1DA 3WQDA 1JUKA 1DHKA 3FW6A 2OLSA 3SN1A 2FZBA 3M6DA 4Q22A 4HK6A 3ZWSA 4IOTA 3R1ZA 3G1VA 2KZHA 4RW3A 3QBUA 2W5FA 3CUHA 1E4NA 3MZ2A 3ORWA 2PCEA 4AH7A 1PIGA 4GRSA 1XBVA 3QQ0A 3R4IA 1IEQA 1KQZA 1KBLA 2Y2WA 5HPCA 3W7GA 1LOQA 1H0GA 2E09A 6ENLA 4AZGA 3T05A 4NZFA 4IP4A 1PTGA 4NXSA 4J2PA 1AVAA 5LKYA 3QLDA 1XISA 2O7SA 3PBUA 3INPA 4RE4A 1MZHA 1BYAA 3VIFA 3F2CA 2JEPA 3MZNA 5CAHA 1DORA 3B0VC 3EMCA 2A7NA 4JTEA 1NAL1 2XH4A 1F6PA 2QJNA 2VOTA 4IFOA 3EX4A 3ARXA 2IS7A 1EF3A 2HS8A 4EK7A 2VD9A 1JZ7A 3OBEA 2XSBA 2CU0A 3WK3A 3URBA 3M0JA 2HQAA 1KM6A 3H4WA 1TJRA 4L4PA 4NJJA 2ODOA 2C6QA 2REQB 3GNDA 4JIEA 3WDQA 3QHNA 1NFGA 1W1YA 1ZU8A 1Q7QA 2CKSA 2C16A 4HQVA 3R58A 3RXZA 3P80A 1UD6A 1TQJA 4KETA 2WCGA 4AHQA 1QPOA 4U5IA 3P6LA 3GE7A 4N4PA 4H1ZA 3TR2A 1QJWA 4GUJA 2JF7A 3FGCA 3E12A 4C6KA 1GTEA 4P7NA 2WOQA 4F0LA 4E3TA 1M7XA 1F3EA 4FK9A 2I17A 3TP4A 4HK7A 1W9XA 5L9FA 5DFAA 3VGGA 3U2EA 4M6QA 2O56A 2OCZA 4P8XA 3MUXA 4IH3A 1JI2A 2GVJA 1ISYA 2GWNA 5FEXA 4N9EA 4PMXA 1QFEA 3H24A 5B7ZA 3KBVA 3WBAA 3HQPA 3NWRA 1C29A 2H90A 3T07A 1CEOA 1OT1A 1UKQA 5LNWA 1OVDA 1ADDA 1M9HA 3GW3A 4IP5A 3A5VA 4LV4A 3P81A 1FH9A 1QT1A 1LORA 1GZGA 3ONBA 1XYAA 3BW2A 4PTDA 4MB1A 4JTDA 1R2SA 3H4GA 3W6YA 3W7QA 1PKMA 3HGOA 1J01A 4QS5A 3SUSA 4U2ZA 3ARVA 4AVNA 3UWUA 1JCLA 1Z6KA 4DUOA 1PTDA 3M16A 2INFA 1NWUA 3MO7A 4IJBA 3GIYA 2Y6ZA 1WAUA 1PKNA 4TV5A 4MGGA 5I00A 1OD0A 3VXGA 3UA4A 3QGAC 4UNKA 4EOUA 2PDIA 1A5KC 1OGGA 3OG2A 1TE6A 1ZBVA 3CZLA 1LWIA 4MY9A 1XLEA 2Z29A 3POCA 2C1IA 3FS2A 4HU0A 3O8AA 1ZSXA 2VRKA 4QDWA 3TSBA 3SR7A 4X2RA 4AAJA 4ICCX 3QPZA 4CNNA 2CZFA 3GXDA 1KGUA 2G37A 3PANA 1U1UA 5G1YA 3WMBA 1M53A 3TW7A 1UR8A 5A94A 4Z1YA 3FV9A 2BMBA 1A0DA 3PS7A 4B5WA 2Q8ZA 2IPGA 3VFCA 2HRWA 4WDWA 1V8EA 1E9IA 1YX1A 4CVWA 5AC4A 3C0LA 3XINA 4HGXA 1E6RA 2HS6A 1EYEA 3O0KA 1UQZA 3H2EA 4J3TA 4I9MA 1JPMA 1DPMA 3GNXA 4LV9A 1KBJA 5F4SA 3KX6A 5HDRA 1QMLA 1Y5WA 3ID7A 2WSQA 2E6DA 2RGLA 3TXZA 1MQRA 4YNGA 3VKCA 2PA6A 4UMAA 1CIUA 4WEVX 2HE8A 3AROA 3N34A 3VNMA 3WIJA 4XKMA 4HNVA 4UB9A 3MMDA 3PY2A 1EPVA 3BANA 1R8LA 4B4HA 1Z8AA 4GUIA 1TV2A 1XC6A 3M43A 5H1WA 3Q2DA 2J88A 3TYZA 1LT7A 1NFPA 4UZUA 1HN1A 4HNUA 3QV7A 3EDFA 1X38A 3UGRA 3QR0A 3TTEA 3ZO9A 3B05A 2QCNA 1JDDA 3L68A 1JZ3A 1IIGA 5A2BA 1ISZA 2RFGA 4REQB 3NL6A 3T6CA 3RO6A 1BLIA 1LUCA 3CQIA 1ICPA 3P93A 3QRHA 4RPPA 3JZUA 1AH4A 1G4TA 3MS8A 4OJYA 2A7PA 4PFMA 2AMXA 1LDCA 4I5RA 2GQ8A 1ALDA 4XG1A 4XAFA 3W2MA 2WWDA 4JIHA 3SCWA 4FNTA 4MNLA 5LXEA 3V5FA 4DM2A 2AQWA 1QNQA 2F84A 4X0VA 2P8BA 1HL9A 2JE8A 2PWDA 2NQZA 3SRHA 2D23A 4I7UA 1TWIA 4PCPA 4BQ3A 1PWMA 1IEIA 1ML1A 4XISA 2A0NA 4BI7A 2FVKA 2FDMA 5HQLA 3CV6A 3N4FA 4ERGA 5K4XA 1ZTVA 2WVVA 3M0ZA 4MB5A 1VLWA 1DJYA 1UD2A 3SUUA 5JH1A 5CG7A 3WLLA 1BPLB 2X41A 1P7TA 4JXCA 5EMYA 4LYPA 4JTCA 1MNZA 4XD4A 5CPNA 3KCJA 2R8WA 4PUEA 3W83A 3VO0A 1DEDA 4FX7A 4ZQRA 1VEPA 1ZRQA 3KEHA 3ZVIA 3NR0A 5G5IA 4P7OA 1B5TA 2QS8A 4GLEA 4M81A 1ZGDA 4K8HA 3GD6A 3A24A 7CGTA 5ABEA 4CU8A 2OO0A 2R6OA 3H22A 4FA3A 4NIRA 3E9AA 4ZODA 4OV4A 5DXYA 5HWNA 1MEHA 4ICMA 5AOUA 1C9DA 2WV8A 3SCVA 3TCSA 1ZENA 4QEEA 1ELSA 2WANA 3VFLA 4A4AA 4C6PA 3HOJA 3UCDA 3ZVHA 4ZMGA 4IZGA 1F4AA 5HA7A 3GVWA 2P76A 5I6SA 1PL9A 5A6KA 1QOPA 5FF7A 3KTSA 3CUZA 1E3XA 4X63A 2FVMA 2PTYA 1BWVA 4JFTA 5J5DA 5I79A 3HPSA 4A35A 1R2TA 3H54A 2ONEA 3AJXA 4GGHA 2PGEA 5EBAA 4BQ4A 4S3AA 4O18A 2BGSA 2VCCA 1J0HA 2OQHA 5G2HA 4QR6A 2CW6A 5JH2A 3BGJA 1SZGA 4GUHA 1QWGA 1VJZA 2JIWA 4S39A 1VJSA 1YDVA 2QZRA 2X0HA 1WBJA 1AQFA 3WNLA 1Z44A 4C1NB 4PUMA 4IFKA 2O9OA 3TDFA 5HR7A 3SCPA 4UXDA 1GTHA 3V4BA 1PO9A 4PMQA 2B7NA 3VGDA 3UXIA 1QCWA 4Y96A 1PYFA 2GJLA 1ZB5A 1C92A 1GWJA 1OINA 1ISXA 4ZQCA 4MPQA 3E6EA 2J62A 5I3FA 4DPPA 4NG3A 3CV1A 4FB7A 4KWWA 4WX2A 2WM1A 3ZJKA 1YQ2A 2OU4A 2VX7A 1LM1A 4H3DA 3QXBA 1H51A 4LAOA 4LF2A 2YGYA 5A6LA 3P0WA 4RZBA 2ZUTA 3WDHA 1RH9A 1MZRA 3PNUA 4HNTA 2VCAA 1VPQA 1TPDA 4Q4SA 3S83A 1B30A 4Y2WA 3TOYA 4L6DA 4LSBA 1DKWA 3ISIX 1V7YA 1V93A 1MW1A 4TX8A 4W7VA 3ZM8A 3OO2A 2RUSA 2NT0A 3L4WA 1NIUA 3PB0A 3TLQA 4YWSA 2DV0A 3TONA 2OX4A 2OSXA 4XD5A 4DBDA 4HSOA 3WCZA 5ENLA 1RP9A 4PC8A 3ARPA 5F2LA 2DUZA 4IJRA 1TA3B 4FMVA 3K8MA 5FJJA 3L4XA 1R3YA 1PAMA 2C91A 3GR4A 1SM9A 3WDRA 2C1HA 3PZUA 4QJ3B 1TCMA 4PULA 3LRMA 2Q01A 4QQUA 1P0DA 1Y0EA 4K7VA 4LUTB 3UCQA 3WBYA 3OG3A 3VUPA 1V51A 1HJUA 2CLEA 3SCTA 3AUOA 2YCEA 2PBGA 6ALDA 3C4UA 1GYNA 1T96A 1EEPA 2XN2A 1O7AA 4OGZA 5DCDA 1A3XA 4ZQOA 1WP6A 4O0KA 5G2IA 4J35A 1MRQA 3H70A 2YXXA 3I68A 3W2JA 4HPGA 3RJXA 3OU8A 2OKTA 3TUUA 1HF6A 1XIGA 4MNJA 4KCTA 4AC1X 4BQ2A 4GYFA 3W2KA 1A50A 1CGYA 3GC4A 4IGMA 2GVGA 1W1A1 2J77A 1E6PA 2CLHA 1WKFA 2W66A 3PSVA 3IAPA 2NQ9A 5BW6A 2Z27A 3S1UA 4H9VA 1GQJA 1R3QA 4EKJA 2CFFA 1F61A 3MW7A 3SQLA 5CGMA 4X2PA 4GJJA 3W7EA 2P5NA 4RKAA 3W25A 3G6LA 1RZMA 8RUCA 3R0KA 3NZ1A 1H5YA 1IHIA 1EOMA 3OBKA 3AWNA 4L6OA 3VIKA 1W9VA 1XLBA 3PFRA 4JPGA 3MPGA 4JOMA 5AECA 5FJUA 2Y5JA 3NQMA 3CB8A 3MDUA 2GDQA 3JW7A 4QDMA 4S3KA 1V0NA 3DFYA 2UZ9A 3CUGA 3M64A 2C7FA 1O5XA 2PU1A 5GNYA 4GBDA 2D2HA 1T8QA 4QFUA 3BLLA 1W9UA 3OYXA 3QSRA 1S2UA 4RNHA 2BX7A 2OSYA 2Z1SA 4HMEA 3WF4A 4XTDA 4IPIA 3CT2A 4PMVA 5CPMA 1VFOA 1F7BA 2R24A 3SCRA 5I3GA 1I45A 4WKFA 2J7HA 3UR5A 4PCNA 4CEUC 4NX5A 2WO5A 3CM4A 1JUBA 3M47A 1UR3M 3TC6A 1VQTA 1PX3A 4FALA 2WSRA 3B8WA 1XD0A 3TR9A 1VPYA 3SN0A 2WWCA 1UZHA 3RLGA 1A47A 3RJYA 1HKKA 3FN9A 4UMBA 2XH7A 4H6EA 2YCJA 3KOFA 1IT7A 3CV7A 2E7FA 3H6OA 3TNBA 4M51A 2EQDA 3C2EA 3HG5A 2DZPA 1T40A 1BAGA 4XZNX 3PJUA 1M1BA 3LK6A 2W27A 1WCGA 3B03A 1Y7VA 3EA3A 3EXSA 4W8AA 3T44A 4O1DA 1H63A 3K8LA 5D37A 4IXXA 2R82A 4DJEC 4J9JA 3C2VA 4GE8A 1SGJA 3CAKA 1P6WA 1SZNA 3R7MA 1U1JA 1KLZA 3VINA 1AFSA 1AQMA 3W4RA 2V6AA 2FGLA 3U57A 3MTWA 3CWOX 2NLYA 4D1JA 1JZ2A 8XIMA 4JL2A 3AYRA 4WKHA 1HUVA 1V3HA 4KH2A 4YJ5A 2WZHA 3L2IA 1ZPTA 1UUMA 3EOLA 1FWRA 3GM8A 1OIMA 4I6KA 3TSDA 3ONCA 3B06A 2D22A 4GQQA 1PKYA 3SRFA 2BV9A 2EBNA 1E4MM 1XGDA 4IISA 4RE2A 1ZJBA 1TJ2A 3HBLA 4S38A 4YTTA 2PS2A 2EPOA 1SZEA 3G8RA 3QC3A 2INZA 2Q3OA 2DZVA 2W3ZA 3MJYA 1HQTA 3WLKX 4UTKA 4FLRA 2F6XA 3ABRA 4S3CA 3G3MA 2YA1A 2I14A 3V75A 4Q4RA 3CXOA 3GU2A 4W8BA 3NM3A 4BI6A 2Z4GA 2YFOA 3GK0A 4PUKA 4B2DA 4TMCA 1NU5A 1C8QA 3OIHA 5CBIA 5IBXA 4IPJA 3CWNA 2Z7KA 1W1TA 2HJPA 4GI9A 1CX9A 3DG3A 5EMUA 1YNQA 1PB0A 4PRTA 3F4WA 2VC5A 3ABXA 4IIHA 1VAHA 1DJHA 5REQA 3LXCA 3FFSA 3EAUA 2JF6A 3RR4A 1J96A 3AYVA 3F2DA 4F9DA 3GXMA 3W7DA 3SRKA 4CU6A 1B54A 3C2YA 4EPDC 3KVMA 1TZZA 3UA3A 2YLAA 4CNSA 2GQ9A 3WKZA 4ZQMA 1NSJA 2C13A 3O3RA 3W1QA 4O54A 3DGRA 2VC6A 3ENLA 3PBYA 6CGTA 3LI1A 3OVPA 5CZTA 2Q09A 2PD5A 3T4CA 5CZSA 2QCLA 3ZFHA 3FY1A 4MWAD 1X6UA 1JG9A 5IRPA 1F73A 1V6UA 3WLOA 4MFEA 3MSGA 1R85A 1JCMP 2J9XA 4KRUA 1XYFA 1UWRA 1KFCA 4LUTA 3DFNA 1W5MA 1NQKA 4Q4OA 1FHVA 1KGXA 1R3VA 2JGYA 3D46A 3KOYA 3BLOA 4IMAA 2DT1A 4RV3A 3FDKA 2WMFA 4GIAA 4QG8A 1XLMA 4LYRA 1SW3A 3TJXA 4PUNA 3QV6A 4JYEA 4P7LA 2DEPA 4GNJA 2P8CA 3OLIA 3SJNA 4QM1A 4PGLA 5HNNA 3MP5A 1L2UA 1RCQA 1S46A 3NVTA 1EEXA 1TWDA 4IIFA 3T8LA 3NOYA 1EZ2A 2G3NA 1GQKA 1QHOA 4CKQA 1O60A 3PUGA 4KWSA 5HATA 2VHLA 1TJPA 4IF2A 2G8ZA 2DU2A 5D2XA 2D2JA 4NNBA 4K1WA 3VMNA 1GOWA 5HMEA 4DJDD 5G1MA 4CNTA 2MANA 5D8ZA 2NVCA 4Y9AA 4HNLA 4ROQA 4QE4A 4AIEA 2WKGA 1MNSA 1EXBA 1ESWA 3S5ZA 3GG1A 4KGLA 2E68A 1LLZA 2YZ5A 4U10A 3SBFA 2O9PA 2VMFA 4DAIA 2B0MA 5DQPA 1G7UA 4JDBA 1ZL1A 3WH9A 2NQLA 1SU5A 3W1AA 3LBMA 1JNEA 4MJZA 2Y62A 1GEHA 4FR1A 3AZSA 3REQB 2VVNA 3GVVA 2YDRA 2WCSA 7TAAA 1FA2A 3GG8A 3FJ6A 3H4XA 4GQRA 1HJQA 2A3LA 2A21A 2VZUA 1EIXA 1J93A 1GG0A 3P7YA 2E9MA 2WK2A 4LF1A 1KKOA 4H6RA 2HNEA 1KRBC 1EBGA 4W4QA 5CGQA 1OFAA 3MDWA 3R89A 1KKRA 4UC5A 3PZOA 4OVXA 2BOFX 2Y7DA 2J7BA 3E0WA 4AEOA 3P0XA 3AMLA 4MDOA 3ZR6A 3M44A 4TMBA 1QAPA 4V2XA 2G50A 3ICJA 3PWGA 3ZZ1A 3WMSA 4WJ8A 1HXJA 3FGCB 4TUFA 3NOEA 2DP3A 4WOZA 3TTQA 1P6CA 4AWEA 1A3WA 3CH0A 4MJ2A 3HGSA 3WJYA 2PDWA 3OVGA 2YJQA 4NAEA 1KFBA 3LN3A 3HMCA 3KAOA 1OC5A 2I5GA 1UASA 4LRSA 1IWBA 3UD6A 4GH1A 3FCPA 3JVAA 4MY8A 3HO8A 4GYKA 3NEVA 3EWUA 3RPTA 4Z1AA 3EOEA 4B16A 4DJFC 2VEIA 3BLEA 4PMYA 1DYSA 3OLEA 1H11A 1ONWA 3W9ZA 1VIWA 4QG9A 1S5TA 2VDGA 3LHYA 4XAPA 3JU2A 4R9OA 3VM5A 3GU1A 1TPH1 2FVLA 3C5QA 1MXGA 1TR9A 3TJLA 3TIMA 4H83A 4DLMA 2HCVA 4Q32A 1NOWA 1R7OA 4F2BA 1QPNA 1XDLA 4U33A 4RXGA 1CECA 1W3HA 5D38A 4UTMA 2ZA1A 1WDWA 1RD5A 2HE5A 2F8QA 3W7MA 4F0KA 1F9CA 1JAEA 3UJSA 1SW7A 3KVJA 5I3DA 3PJWA 4Z17A 3P82A 3DEQA 3GC5A 2DVTA 4Q8VA 4GG9A 3NZPA 3V1HA 4O28A 1T6MA 3OHMB 2XVGA 5B7YA 3LPOA 1H7RA 2QV5A 4QITA 1K4HA 1HJWA 5IDIA 1WDDA 1CGXA 1LT8A 4EAYA 1OFDA 5DLCA 3RO8A 1NWTA 4JQ1A 2QJJA 4WJXA 2PDHA 1PUDA 4JKMA 1BXBA 3A21A 3KUMA 3UT0A 1GW1A 1OJXA 1XF0A 1LUCB 5A8GA 1RUSA 1ZLPA 2DSKA 2E5DA 4DZ5A 3S6OA 4KEZA 3DFQA 4GD0A 1DIDA 4JL1A 5F4WA 3GXIA 4DJEA 3THCA 2V3DA 3AO0A 2PDUA 1JFXA 2PDJA 1YDOA 3OVRA 3L4UA 6REQA 1VD6A 3CHFA 3LENA 4XBKA 1EDGA 2ZXQA 5CBBA 3GLCA 4G7EA 1C90A 3GXPA 2OKOA 4OFCA 4RZ4A 1G1YA 2VFGA 5DMYA 2FTWA 3ZR4A 4BF7A 3LEPA 4GVIA 3GVGA 1XLJA 2XIBA 4Q8NA 3W07A 4FAMA 2O92A 3CTLA 3RN6A 4V28A 4FLOA 4DXVA 4S3FA 4NSBA 1PX8A 3AU6A 1Y5VA 3NGJA 3MO4A 4DBEA 1XRVA 5E9XA 4MFDA 4I8DA 1UWAA 4D6IA 1HP5A 1CENA 3GG0A 2XH2A 2O0TA 4M5PA 4PL1A 2DY3A 2YCKX 4K7YA 1BYBA 2O7QA 3CQJA 2E67A 2BVYA 4JAWA 2LLEA 1RQBA 3F7JA 1Y5XA 3WQCA 1AA1B 3WD1A 5AYIA 1F74A 1E43A 3IIVA 3UR2A 1J0JA 4NAFA 3G1SA 4R33A 1V6XA 4FHAA 2P0IA 1EO7A 1GGOA 4QAWA 2V5CA 5FF2A 4LALA 1DVJA 5CZJA 2UBPC 2ON3A 1O6IA 4KEMA 1KFJA 2PTZA 3LCIA 4HYRA 4OUIA 3U9IA 1Q63A 1OGSA 1BTMA 4KBXA 2NX1A 3KHDA 2WMJA 3BAXA 5CKSA 2VXNA 1V02A 4UFLA 2PWHA 3NQ7A 2XGZA 4IGSA 1W1PA 1FCBA 1EJWC 1EBHA 3DI0A 4K36A 2CWNA 5FJIA 3VC5A 1GPWA 4G9PA 1EJ7L 2Y89A 3F4DA 3WLTA 2PTXA 3F03K 3GH7A 5C8BB 5K3VA 3NQBA 1K8ZA 4NJKA 4HMDA 1Z3NA 2D1ZA 1EZWA 4GFIA 4JCMA 1W2VA 2D0FA 3UWVA 1E6NA 1T8XA 2GK1A 1HKVA 4FZIA 5HWMA 2GGEA 3VZYA 4XAYA 3U7BA 4ZEPA 1K02A 3POHA 1V0LA 3RLHA 3B04A 2DJLA 3WH6A 4B5UA 1BWKA 4PMNA 1XLFA 2VDIA 1Z9AA 4DPQA 4LAZA 1FHDA 5TQLA 1X7IA 2X8RA 4Y9MA 1QOXA 3A9IA 5A5WA 3ZQ9A 1WOAA 3E2RA 1IXPA 1LQ2A 3MANA 3MV01 4D6CA 3AHZA 2P3ZA 1TE1A 1AH3A 2V9DA 1I2PA 1V3IA 4OHQA 4LRTA 5LIYX 4R7OA 3EWDA 3TA9A 1ZP3A 4P8VA 1GPFA 1VJIA 1WYIA 1W3KA 4KF1A 4OV9A 1Q8AA 1IWPA 2I9UA 2XYLA 3HURA 2QEZA 3IIZA 4CN4A 4IIGA 3M9YA 3TYEA 3N2BA 1XLAA 4AQLA 3JS3A 2W6RA 2Z1VA 2QV4A 1XKYA 2A3AA 2VGBA 3N9KA 4LCRA 3DAQA 1CDGA 4WKAA 4WIWA 1OZQA 4AWTA 1UH4A 4L56A 3PPFA 5HWJA 1XUZA 3IVUA 1HKMA 3GFZA 4WXYA 3GUGA 1ZBKA 2CLIA 4FPSA 1V02E 1I0DA 4W8LA 4C6FA 1Z69A 1XYMA 1M41A 3P84A 1V4YA 3L0NA 3LNMA 3NQ2A 1I2RA 2BXYA 5I24A 4ZO6A 2XIQA 3SSJA 3IGXA 4UQ9A 3D3AA 1XIHA 1XBZA 2O55A 4IL2A 1HJXA 4B9ZA 4FP1A 4P61A 2D24A 5C2CA 3W82A 4AZHA 1QWKA 1YTEA 1NP0A 1DJWA 3LHTA 3S1WA 2YL5A 1YW1A 2QCFA 4BJHA 4HSHA 3C0JA 3GHUA 3W7NA 3SW6A 3A4XA 4GC3A 2DIJA 4A05A 4ZTYA 3S47A 3U5UA 4NZ1A 2BNJA 4JIIX 4PYSA 4Q7BA 2X16A 1UUQA 3S5NA 4PMZA 3UPBA 2YA2A 4PBFA 4HU4A 4HIBA 1O1ZA 3UJRA 3LGEA 4LH8A 4UTWC 3NIYA 3LMZA 2HSAA 4XTIA 1Q5MA 4UR8A 2Y1HA 3H12A 3M7WA 5MF5A 2GPTA 3FSUA 5LZLA 7XIMA 1M03A 3RAOA 1PWLA 4LS0A 5D2TA 5JBDA 1LL6A 4N4QA 1JPDX 5AHMA 2QIWA 1E9LA 3LRKA 4KT2A 1AL7A 1UD8A 4L9YA 2XZ7A 2D69A 2IW0A 5GJMA 4Z1BA 5I07A 3UXLA 5AYBA 1SFTA 2QF8A 1TIWA 2R9RA 4LJ3A 2VFIA 3BMXA 4DX3A 4WHBA 3TYBA 1FP8A 5J04A 2INEA 3TN3A 4C65A 4NNAA 1LBLA 3HJEA 4DNHA 1E0VA 1VRXA 5CC5A 1A5LC 2X7WA 3WBWA 4TVUA 1FBAA 1S1PA 3DDMA 5D33A 3PZGA 3LHWA 1E71M 3E96A 2Z7GA 5CEWA 3QZ6A 3EDDA 5D9OA 3LB0A 3IIXA 3QFWA 2GSHA 3WFAA 3S1VA 3ZIZA 4ZR8A 3R43A 1PPIA 3LBCA 4CCEA 1XYZA 1HNYA 2HXTA 3UWZA 1W37A 3G0UA 3FA5A 2C8NA 1I2NA 1EQPA 4M3PA 1K3UA 1OC7A 5CSYA 1NWSA 1WZKA 3UWQA 2VELA 3HPAA 5LXXA 3WD2A 3KXQA 3H7VA 3PPCA 4R5EA 2HK1A 1UZDA 3P3BA 5EB8A 3SUWA 4L5ZA 1I1WA 2VFHA 2YOCA 2DZXA 2OO6A 3MV11 1TVLA 2DDXA 1DJGA 1HT6A 2F6UA 2NUXA 3EMZA 1VBRA 2QDDA 4K8EA 4NU7A 4PTVA 1GCYA 4GCAA 1UA7A 4ACZB 1TQXA 4A2RA 2QAFA 1WQ5A 3LTYA 3CEUA 3UERA 3RRAA 3C2FA 4ORIA 3SIZA 3HFYA 2PDCA 4AY8A 3LI0A 4ILSA 4XO7A 4JZ5A 3T8QA 3UF9A 4ZCWA 2WMIB 4ZB0A 4KIRA 2DFAA 1UZ4A 2RGMA 2WJDA 4RDWA 3S2NA 4Y6GA 1I6NA 3AAMA 4PE8A 3S9YA 1KC7A 1R3TA 4K1GA 3AHYA 1OF8A 1FWNA 1DBTA 1QTWA 1SW0A 4Y9OA 3C6CA 4YIWA 3QMRA 2WM0A 3W72A 1QK0A 1J18A 4XZHA 2DSWA 4I6VA 4YWIA 1LBMA 4PBGA 5EGRA 3W1NA 3IK2A 2DZAA 2HV5A 2WBKA 1QATA 2HTMA 5C7HA 1KRMA 2PDFA 2AL2B 4H8VA 3B0UX 1L6SA 2W91A 3D3FA 3RF9A 1D8WA 2E40A 2IPJA 3E49A 1Q6GA 2UY3A 1UB3A 2BP1A 1RY0A 3FYOA 4RE0A 1Z41A 4RDZA 1JGIA 5L6UA 2GSEA 1D3HA 1A5AA 2NX3A 4L80A 1H50A 3PBWA 3GC2A 1N55A 4I90A 1IIHA 2Y5SA 3O6YX 3GTFA 1ADOA 1K9TA 4A3HA 1DIEA 5A6TC 3RFAA 4PMOA 3JR2A 3EWZA 3K8KA 4NAEB 5AHEA 3WD3A 3KLLA 3W86A 4LS2A 4JHOA 3FA4A 3E5BA 1NWRA 3F5KA 2Y8UA 3WLSA 1O66A 2V30A 3LXBA 3UU0A 5G2WA 3W1RA 1E5NA 4UQBA 4N6FA 2C14A 2QUTA 1IXQA 4TO8A 2PDMA 1YDYA 2IKJA 3KTXA 1YDNA 1JPIA 4FNQA 1Q8JA 4L4OA 1XH0A 4B92A 4UFMA 4GY7A 4QTGA 3DKJA 3W1UA 3VD7A 1LCOA 3WQVA 3RIKA 1ONRA 2F61A 3ES8A 2JQXA 4FSAA 2PDLA 4Q4QA 1E55A 2PDXA 1MUMA 3TFCA 1WBHA 2G95A 1W17A 2NSOA 3BMWA 2X2GA 4N9CA 5ABHA 1P0BA 3WNMA 2ZFAA 3WQPA 4ACYA 3QZAA 2GJNA 1QU4A 1TWSA 3HV9A 1J5TA 3GBDA 4L61A 3A13A 3KFTA 5IDZA 1QNVA 1NH6A 2GOUA 1X7FA 2PF0A 3PM6A 2I5QA 1D9EA 4LBUA 4IL0A 5GNZA 1R2RA 3LPGA 1P4CA 3MSYA 1S1RA 4Z2IA 4JTUA 4YN5A 1HO1A 3QZEA 4G1KA 3NL2A 1MO0A 5H8UA 2XN1A 1FP9A 2J79A 3NQVA 4GGBA 4YU1A 1KCLA 3V0UA 4PCTA 2ADAA 4LU0A 4F40A 1NDYA 4S3EA 4NKCA 2Z28A 4DBSA 3P5YA 5CC6A 3PJXA 1YIXA 2OZ8A 3CMJA 4MTVA 1OK4A 1OFRA 4F48A 3STEA 4AVFA 1S2CA 5AY7A 3VOCA 2QXWA 1W9DM 3LSBA 4ZENA 4URIA 3D6NA 2VZOA 4QDPA 2CESA 3H8AA 2DGAA 2IPFA 1E3ZA 3BQ5A 3NXFA 2XIMA 3N2OA 1FWIC 4DEFA 3UG8A 1VFHA 2VZSA 3B8TA 2J7CA 1JQXA 4D8ZA 3B8IA 4WDUA 2JK2A 3PPGA 2YBUA 1J0ZA 1OX5A 4A8IA 1HTIA 1CGWA 1SPQA 3SSZA 4O16A 2V5LA 1JAKA 4JX4A 2XIOA 4KWOA 2HXUA 4GISA 4E0CA 1GONA 5HNUA 5HJYA 1IXOA 1VYPX 2PRHA 3FEMA 4XB3A 2OZ3A 1W3NA 3ZT6A 4DN1A 4LWWA 4EPBC 3LCXA 3VIOA 1OEPA 2P53A 3T0AA 4RNJA 3KRUA 3WBEA 3GHTA 3VK5A 1OX6A 1I0BA 4HMCA 1JFHA 3CQHA 1EWEA 3ITTA 3A5FA 5A6AA 2NWRA 3UZJA 9XIMA 1BQGA 4TR9A 1TR1A 4AEFA 4AMCA 1LJYA 2ZZ3A 3QM3A 4FNUA 1JCTA 3TH6A 3ALGA 3NQEA 5JQ9A 1S2TA 3MMWA 4IP7A 3PUDA 1ZALA 4AZ5A 1AMYA 3B8DA 3VX1A 2GDUA 1OG0A 3Q4DA 2JGQA 2CBJA 1QDSA 4QEHA 4XO6A 4LAUA 5LNVA 1OX4B 4KCWA 2DPEA 5EMJA 3UXDA 3VM7A 3IIPA 1G4PA 3MB9A 3FKKA 3FHAA 3NXLA 3EKGA 4J2MA 4KS0A 3WLJA 5DX7A 3G1AA 3TWBA 5REQB 4CQDA 4HTBA 2VWSA 3FOKA 2H8XA 3OP2A 4HU3A 4AY1A 1GOIA 1GQIA 3QTGA 3A6OA 4M82A 2CLFA 3F1QA 2UY4A 5PTDA 5G1TA 3SURA 3SFKA 1XD1A 2E8ZA 1OYBA 3DXIA 4I5UA 1K4GA 1AJZA 3ES7A 4O0QA 5U4NA 5DRIA 3GHRA 5BMXA 2EGZA 3I7SA 2I57A 2Y0FA 1VFTA 3VA8A 4ZSUA 4PUWA 5K9XA 4L4LA 2QJHA 1PCWA 1ZAHA 1A5SA 2P3EA 2Z00A 4E2OA 1KXQA 4OU1A 3VE9A 2QJIA 1F6YA 3IJ8A 1L6WA 4UQEA 2BGNE 3S2CA 2GVLA 4RR4A 2WVVB 1SR9A 2Y4SA 4C6NA 3VTRA 4DIAA 3R0UA 1UMYA 1OFEA 3WMLA 4XQ6A 4HCHA 2WQDA 5LNSA 4PSRA 1ZBCA 3USZA 4GO8A 1ITQA 3K13A 2AQOA 1LBFA 4JEQA 4HPXA 2VC7A 2EKCA 4MYXA 4ZQPA 2VUYA 3I3BA 1K8CA 5AFDA 1U22A 1WDQA 4PL2A 3K2GA 4FOKA 1MFVA 5BROA 1K6WA 2VL4A 2WNNA 1XJBA 5BU6A 4OT7A 7REQB 1JZ8A 2E6YA 3UZYA 3WK1A 3M07A 4DYEA 1IEWA 5T9CE 3AOFA 1DWGM 3GZAA 1E73M 4I9AA 1H62A 1QI2A 1W8GA 5A8NA 4OTKA 3LQLA 5KEZA 3GKFA 1PKLA 2ZUVA 3NL5A 1FX6A 4RXFA 1R38A 1P1XA 1KA9F 3AYSA 2GL5A 1ZAJA 4Z0JA 1YXYA 3AIEA 2PWVA 4XIMA 4X0NA 4LVDA 2OT0A 1JL8A 2Z2BA 4D1IA 3GX9A 4O15A 1E6XM 1W1VA 1ZFJA 4HA4A 1R3SA 1LOLA 4W7UA 5IM51 2J27A 3PULA 3GO2A 4JN6A 4DRSA 1JYWA 1KTNA 4C6JA 4ASTA 2CYGA 3N6QA 5FA5A 5A6SA 1C7SA 4GX9A 2WZEA 3NTYA 4RL3A 3ZJ6A 1UOZA 2ZWZA 5DF0A 1XBXA 4B5TA 3GDLA 5I78A 5HULA 4JYDA 4Z2JA 3CPUA 1YE6A 4TU1A 3BOXA 3CB3A 1DE6A 4JR5A 1BSLA 2DQXA 3UESA 2A79A 2GDVA 3PTDA 4CQAA 3E0LA 4NL1A 4DXKA 1SVDA 2BSLA 1GQNA 3VOIA 3W75A 1TMHA 3WFLA 5FF3A 4HN4A 4B2DD 5AHIA 5EBUA 4H04A 1YTKA 2Y7FA 5E6YA 3OLGA 1HO4A 2R1MA 4HA3A 4QG6A 1B3XA 4HZ8A 4E4PA 5DCBA 1LQAA 2C18A 4ML4A 6A3HA 3ZLGA 1JVNA 3TAOA 1BD0A 4IG2A 1S38A 2GJRA 2EPLX 4GA8A 2IMRA 2CLOA 3PN8A 5CPLA 1O68A 1UW9A 3W73A 1CXIA 5CZKA 4O1AA 3GTIA 3BLDA 1TPB1 4LUIA 1Q6FA 4N9BA 3VZZA 4PB5A 1M3UA 4GY0A 4EPEC 1T5AA 3EGJA 2HROA 1XPGA 1KW1A 1OADA 1WV2A 2NT1A 3OLDA 6TAAA 3WQ4A 4O11A 2WNWA 1WB0A 4H9UA 3HFTA 5DRCA 3U2CA 2BODX 1XCWA 3NPUA 1UWUA 4AVOA 3U3HA 2PZ0A 1PVNA 3AWOA 1W6TA 3GH5A 3PVFA 2XVLA 3WF0A 2D0HA 3UZZA 3CASA 5DBUA 2ZZ5A 3WH8A 5C9WA 4M7TA 3U8GA 1TRIA 1TZ9A 2ANUA 3V3WA 4D6JA 3TYUA 3O16A 3OW1A 4A3UA 1EC7A 3ITYA 4WF7A 1KM5A 4IJCA 3AI0A 1PEZA 3WLHA 2WPBA 2DVUA 3KBSA 1NARA 3TN6A 5T9BG 5GJPA 5CC7A 5A6MA 1KWKA 3O9NA 1XLKA 4I7WA 3OGSA 1XLDA 3SCQA 2NXGA 3FAWA 3R5EA 1QW7A 2OEKA 3C8FA 3L65A 3MJMA 4CQ9A 3G5EA 4GJ1A 5A6BA 3THDA 5C6MA 1BWLA 2EG7A 3KL3A 4Z08A 4K6AA 5E70A 1A5BA 4HJFA 3RCNA 3M5VA 2PP3A 3MCOA 1R9XA 1VS1A 3S2MA 1XLGA 4GVFA 1BTCA 2ACQA 3AXXA 2VVSA 4DJDA 4ADTA 1JDCA 8CGTA 1RCXB 1E1EA 4KWUA 1QPRA 1LLOA 1MYRA 1W5PA 2OT1A 2J7GA 3VOJA 1G9HA 3VIIA 4Z2LA 3UG3A 2GK1B 1FDJA 1WKEA 3C0SA 4DO7A 3P2VA 1Z89A 3LV6A 4DYJA 2PZNA 3VILA 1B4EA 4AX6A 1H61A 2OYLA 1YNYA 1RP8A 3G1HA 3TMLA 4FR6A 4JTSA 1IXNA 3MYPA 3A22A 3LZ3A 5JUVA 3T08A 3SADA 1R46A 4AZCA 3MKKA 4IGNA 3A4WA 4MVAA 2VFFA 3G1RA 3QYSA 1S2WA 3KL5A 4Z2HA 2ZX8A 2PP0A 4LX4A 5E0FA 4DBUA 1F3WA 5BXRA 1V3JA 1VFLA 2Z6JA 1J0YA 4AB4A 3TVAA 2FB2A 1NDVA 4E2DA 1RA5A 1KXHA 4O1CA 2CZEA 4IMGA 1J0KA 1K03A 3M0LA 3MWAA 4LYKA 4RV8A 2GYIA 2QCEA 4HOZA 1VBGA 3AFBA 1UD5A 4KESA 1RBAA 2O9TA 2WLZA 1A80A 1E70M 5F7UA 1LG1A 4C5YA 3HQ1A 1OGBA 2PC4A 1A5CA 5K9CA 1FHLA 2EO7A 3TC7A 4A8NA 5GVJA 3EWBX 1OHLA 1PXGA 3AZRA 3HA1A 1YHTA 3VKDA 4CD6A 4LANA 2I9EA 2ZUNA 4NXKA 1TPEA 1GJPA 2X1TA 3GDTA 3VKAA 1BVNP 9CGTA 1BG4A 2FKPA 2W0UA 1K7EA 3A4AA 1RJQA 3TU9A 1ODUA 4F0RA 1SJDA 2EG8A 1UZ1A 3WL1A 2PD9A 2JFEX 1W31A 3KVKA 3UEQA 3LGDA 4GXWA 4WOQA 4E8GA 4R9XA 3ARZA 4HB7A 1MQPA 3AS2A 4RJEA 3M7SA 2J74A 2X1UA 3L12A 2ZTJA 1JYNA 3E0FA 4JQ4A 2GGGA 4W89A 3AHVA 2WJFA 3L9CA 4C91A 1FXQA 2R1KA 2ALRA 5D2YA 4KERA 2E25A 3DGBA 2A1YA 2YCLB 3UGVA 1H7NA 3N18A 4ATDA 4G7EB 3L4YA 3N3TA 3ALFA 4UQDA 3W24A 1P6BA 2VQUA 2EPKX 3WSUA 4H7CA 6REQB 3O6CA 4GKLA 1I75A 3DN5A 4B4FA 4RNFA 4XZLX 2H6RA 3THAA 4Y7EA 4HSNA 4A29A 1KLYA 1FWSA 3TOPA 4UTWA 2ZA3A 3W1TA 2OJPA 3W2LA 2FJUB 6PTDA 3S2JA 1EDTA 4NT0A 1AZ2A 1CLKA 1J10A 4H6QA 3AMKA 3LRLA 3GNRA 3NYDA 5JBFA 3CHCA 1UWSA 3LGGA 2XFWA 4WRHA 3W3OA 5KZDA 1TPUA 1DJXA 3RX4A 2Z2AA 3UQNA 2A3CA 3LXAA 3T0BA 1U1HA 5FL0A 3QGKC 3KP1A 3TQPA 3CZJA 1CYGA 3DERA 2G4JA 1UP2A 4S3DA 2QR6A 1QW8A 3VCRA 4LB4A 3BJSA 3Q67A 2BOEX 1WKYA 4WY0A 1NP2A 2RH9A 3IUDA 4PUDA 3UYIA 1XYLA 3N04A 1BXCA 4L9ZA 1GVFA 4QLLA 1RR2A 4WSJA 5CPQA 2FZ8A 1F8MA 2OWXA 4WQ6A 4L65A 4QS6A 3FA3A 2YBVA 1L8PA 4DWSB 5C54A 3VD9A 1B9ZA 1UKPA 2FJKA 2J8GA 2JEQA 4MYAA 2UV8G 5BNKA 4O1FA 2WPGA 1ZJAA 3AIWA 5FEWA 2EJAA 4MJMA 3CS2A 5KETA 5F4XA 1UUOA 3W84A 5BMWA 4HT3A 4GQGA 3OQ8A 2NQ5A 4AMAA 4MADA 4AYSA 5J8LA 3RG6A 1AW5A 1OFBA 2W92A 4W7WA 1Z32X 3W7RA 1TB3A 2OTDA 2Y24A 2OR2A 3FX4A 1XIIA 2QUUA 4UNLA 3S5YA 1I8JA 4NZ5A 5HK4A 4A8RA 4Q4PA 4X9YA 3IGSA 3WNPA 2D3LA 5AYYA 3KM8A 2XHYA 5E09A 1K9FA 3CUIA 4NX0A 4LPCA 4UTTC 1I2QA 4DZIA 4ZOBA 2V2HA 2E9BA 1R9YA 3QHOA 5CPTA 4XWUA 4I9TA 1RY8A 1GOQA 5HPOA 3ABQA 2PGRA 4W5UA 5DMLA 2D2OA 3GWQA 1F8IA 1NTHA 2ATMA 4ERIA 3DHDA 2ZE3A 2QQ6A 1A5OC 5BOEA 1JXKA 3NM1A 3GAYA 1UPPA 1UCWA 2QGHA 5FJRA 3IANA 4AWUA 4LVAA 1REQA 3PUEA 5A1AA 1MEWA 3TKFA 4QRNA 3EDEA 4XBJA 1DJIA 3PZTA 1TVNA 1UIPA 3USBA 2XVKA 3W26A 1VBUA 3BSHA 2P50A 1LYXA 4QBXA 2QMJA 5EL1A 1XDJA 3GQYA 2IKHA 7ODCA 5D03A 3G2GA 2GWGA 4ORMA 1KTBA 5A69A 1BKSA 2PTWA 2X05A 4IIBA 4MHBA 4C6BA 3B9DA 3CEPA 4A2SA 3S9IA 5HMFA 5A8MA 3TC3A 2IQ0A 1XX1A 5EKYA 3BO9A 1NDZA 1TJ0A 3U2ZA 5CJNA 3HN3A 2OX1A 1H60A 3OZMA 2DZSA 5C9UA 2WAGA 5H2ZA 1RBLA 4WJEA 1UQYA 1JDAA 3PZMA 3IUIA 3CLMA 3M1ZA 2HEJA 4LBRA 1HKJA 4ATLA 1DOSA 2GOKA 4MG4A 3VDCA 2BGQA 1DTUA 1B3VA 4QP0A 5XINA 3TLLA 2B7OA 3NQFA 3VNDA 4S2BA 3ERPA 1FWGC 2ZRWA 2VURA 3VNYA 3U4AA 2WMKA 5IHRA 3B9OA 2DSUA 3TV8A 3VKKA 1UJPA 2F9RA 1V6YA 1TV5A 3U7VA 4NYYA 1QI4A 4CQ8A 3FYPA 3PHAA 2VP8A 4UCFA 1IF2A 2WZTA 2XSXA 3M0IA 3CQKA 4PBEA 3QW3A 1TPVA 5CZ0A 4GJIA 2PE4A 1JGMA 1XIJA 1PZ0A 1ITUA 4YMZA 2A5HA 3QKZA 1EKOA 4NY2A 4JX5A 2AAAA 2QPXA 3O15A 2JBMA 3MSRA 4GZJA 4BF9A 2V63A 3H2CA 4W86A 2EPMX 4H9YA 4UFKA 1XI3A 2GJXB 3LCFA 3FVMA 2R1PA 4GNKB 3UWWA 4S23A 3SGZA 5H6HA 1Q6OA 4Q6XA 4WXZA 2PI6A 3U0HA 4EPKA 1MMFA 4CLMA 3ABSA 1VCFA 3BH4A 5CQ1A 4IPPA 1VENA 4IIEA 1HG3A 5FSDC 3G1FA 1ZP4A 1A5UA 2XVNA 3KRZA 5C55A 4OQVA 1EFZA 4ZA0A 3W01A 1M68A 3Q94A 4E2VA 3HGRA 5I3JA 5HR6A 1TWZA 3VGBA 1F6KA 3BURA 1E0XA 2WVSA 3TFXA 1NJJA 4DUVA 2OLHA 5A8OA 2R91A 1ZNNA 1GYMA 4BS0A 4DXXA 2ZICA 3R79A 1D3GA 4WD0A 3XIMA 5E9AA 3AMGA 1NQ6A 3BW3A 3STCA 3KDOA 3FHQA 4ZGYA 4HKPA 2QGYA 2ZUWA 4MM1A 1RQHA 4UOQA 2RHGA 3THQA 4X3ZA 1JIBA 4AXKA 1TJ1A 2J25A 1MW0A 4QE1A 1HW6A 3OGRA 5IXEA 1L9WA 1SMAA 5CJMA 1G01A 3HZ3A 4JKLA 4UZSA 5BXTA 2WNZA 3DENA 3BJFA 2PEVA 1D2KA 2TODA 1JZ4A 3MP3A 4D2JA 2VCBA 2G3FA 1U5HA 1B90A 5TF0A 2WZIA 4C7DA 3LHUA 5MKGB 3D0CA 4H7VA 3GIPA 4BK9A 2XU2A 1X1ZA 5FESA 1V3MA 4JNYA 3DFOA 4JIRA 3AMDA 3GUWA 4LCQA 4JEJA 4LNCA 3LHVA 7PTDA 3VU2A 4B3ZA 5AC8A 2YLLA 4Q8OA 4F3HA 2XDFA 4QCEA 3WDPP 2F7FA 4DBWA 3CHEA 3W53A 1H1YA 1TTIA 4V27A 1CPUA 1R3WA 5TNVA 3QTPA 4GH3A 4DJDC 1S2VA 4EWJA 2FH8A 5M2FX 4ECLA 4AD4A 3O2LA 4HYVA 3MUIA 1I9CB 3EDJA 1XRTA 4EX4A 2ZUSA 1UYQA 1R0MA 5RUBA 1GT8A 1YKWA 4AHOA 4NI3A 3TE9A 1V3LA 1CTNA 3C86A 4JFVA 4F2TA 1EJTC 3LV5A 4NRSA 4CCZA 4JBRA 3S1XA 5F2IA 3FKRA 1M6JA 4H6KA 3DOPA 1S3TC 5I5RA 1JUEA 3AS0A 5BOOA 3O63A 2BHUA 1VYRA 5EMLA 3RU8X 4BY3A 5LGXA 2XSAA 4Q7IA 4GO9A 5D9PA 1RVGA 2I7GA 3DG6A 3NAVA 1VBJA 3URQA 1MW3A 3E0VA 2IPWA 2CHOA 1IT0A 2XIIA 4YVXA 3DFHA 4XX6A 2QULA 1YPIA 4LUSB 1SMDA 3NCOA 1KGWA 3CJPA 4C6MA 5M1TA 3LHZA 1CXFA 2OFJA 4PCFA 3DX5A 2YL6A 2QCGA 2WNQA 4U4MA 4CD8A 1M04A 4O13A 2V82A 4FLSA 4INFA 4LT9A 5HXMA 1Q85A 3STPA 4AFYA 2FLIA 4YTQA 1R3RA 2QYGA 4H9XA 4OOZA 3RPDA 3LM3A 2NXHA 1XFBA 1W91A 5AKQA 2VR2A 3H7UA 4S3JA 3RMEA 1GJUA 2E28A 3B4UA 3QJAA 2VGGA 2ISWA 2ZVRA 4AYGA 1WZAA 1EHAA 3OEXA 3EWYA 1RLCL 3FXYA 1CXKA 3DYPA 3I3DA 3UW6A 1KR0A 3HQNA 1W3IA 3P8JA 4I3GA 3I6RA 4MLRA 5DANA 3L66A 3N1AA 1POJA 3N3MA 1KCXA 3GDKA 1XINA 3GTNA 4GIRA 5M17A 5LNRA 4A8LA 1EOKA 1EP1A 1OC6A 1N82A 4H9TA 2OODA 1TTQA 1TV4A 1LF1A 1YTDA 3WL0A 4ZZ9A 4J28A 2OEMA 4B3LA 1VBHA 4H9MA 2QMKA 3TCEA 4ZE5A 3A4JA 2XJ7A 1SSGA 1ODZA 3AISA 3UWEA 1G67A 4GXPA 1RVKA 1B1YA 1H7XA 4KW2A 3CTTA 2OOFA 3O6DA 3V7PA 2CLLA 4MWAB 1THFD 1ZQ5A 3IJ7A 3VNLA 2J7FA 3IS4A 3L21A 2VDHA 5XIMA 4PEKA 1U30A 3SRDA 2CBIA 1AL8A 4C6QA 2TRSA 4ZO7A 1T7LA 2CITA 4XZBA 2PMQA 4CN6A 1BKHA 5A2CA 3N25A 5I3HA 1ADSA 1DIOA 1DXFA 3TTSA 5ECVA 2A4AA 2PLKA 4R85A 1VFUA 4LFYA 4MF4A 3ZLFA 1OM0A 1YLVA 3VGFA 3EOUA 4ES4A 1PZ1A 1PV8A 4BEQA 1AJ0A 3LDVA 2DT2A 4OKDA 1HVXA 3NL3A 4DI9A 3KWSA 3SZ8A 3GR8A 1OK6A 1K9DA 2Q8LA 1GVIA 3HTWA 3RITA 4M24A 1JYXA 1LRQA 4I5XA 1M65A 1JEZA 4LVGA 6TIMA 2EPHA 3F4VA 2DW6A 2VOMA 4WGXA 5LHEA 1GVOA 4P8UA 3WUEA 3CHDA 4LEFA 3KP0A 3AIVA 2YYTA 2GQAA 3QOKA 1EJSC 4O1EA 3HF3A 5DBTA 3OBAA 3G1XA 4AWSA 3S46A 1R30A 3KDNA 3I3EA 2Y88A 3T78A 4XKYA 2PDQA 1SYTA 2XIJA 1GVYA 1HGYA 3QH2A 4H00A 3AJ7A 1OCBA 1IZCA 3I65A 4QX4A 2C3ZA 3PG8A 4JHZA 3IJIA 4IUGA 3LLFA 5E5CA 2G97A 1OFOA 2ACRA 4JN7A 1PZ2A 2J8TA 3PWIA 1GOOA 1PX4A 3PR2A 4IICA 3DBPA 3UJ2A 4J40A 1RJPA 2FGBA 2V81A 3MBFA 4QSHA 3UFYA 4ZVJA 1YBQA 2AKMA 3UVAA 4EANA 3ARSA 4JQ2A 4JIPA 2R14A 2BY3A 4D71A 3O0FA 1YADA 4KFPA 3S0CA 4HA1A 3AQUA 1FWEC 3EYPA 4QE5A 2NW0A 3ME3A 1G7VA 4WY0F 4QHRA 4D9PA 1XG4A 3PAOA 3UBPC 5HINA 2E0PA 4O14A 4JTTA 1TELA 4M8UA 1MRAA 4WLCA 5AHLA 1H49A 2F2KA 3W81A 2C71A 5GNXA 4HJWA 5C2XA 3T2OA 4EIVA 3IPWA 3G0SA 3BV7A 4MSSA 4V15A 1XR2A 1JCXA 4D8AA 1HFBA 4PTXA 4W5ZA 3QHMA 4BHYA 4J27A 4DWSA 1P0KA 2KAUC 4GYJA 1VP5A 1EO5A 4NJIA 2A3BA 1SSDA 2OYKA 4C6CA 1Q45A 2QCCA 4M80A 1FTXA 2R1LA 2VR4A 3EKZA 1F5ZA 1HVQA