1EDTA

Crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
b'KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H
publication title Crystal structure of endo-beta-N-acetylglucosaminidase H at 1.9 A resolution: active-site geometry and substrate recognition.
pubmed doi rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase (glucosidase)
total genus 88
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edtA00
5E0CA 1ISWA 2CCRA 9CGTA 2XSBA 1WE5A 3AMLA 1JZ3A 1LG1A 4AIUA 2XFRA 8A3HA 1E6XM 2Y2WA 1E6PA 4HPHA 2ZX5A 4X0VA 1VJZA 4C7GA 2VVSA 1UD5A 3DHUA 1GHRA 2WK2A 2J7EA 2X1IA 4D6CA 4EKJA 3PTKA 4U33A 2PWHA 1WCGA 1ZJAA 1UD3A 3WEMA 2YL9A 1UYQA 4AIEA 4J27A 4LYQA 2D1ZA 3T2PA 1UWQA 4BQ4A 3VD3A 1ZBCA 4HMCA 1PBGA 3W26A 4KGJA 4D6GA 5IFTA 4NRSA 1WDPA 3T08A 3VM7A 2FHFA 4M80A 1JFXA 5E6ZA 2D23A 3N13A 2DSKA 3WNKA 4U2ZA 2IXUA 4MB1A 2G3JA 2BVYA 3PZ9A 3VDBA 4RE4A 1UKOA 4KMQA 1N82A 3SURA 3APGA 1JL8A 3BLPX 4HPGA 7A3HA 2J7CA 4A3HA 5FCZA 2YA0A 1XH1A 3RMEA 2WXDM 2HISA 4D1JA 3MMDA 2VX7A 4ZENA 5ECUA 5I6SA 1VEOA 5A8NA 4HOZA 2YBTA 4MNJA 4YPJA 2PBOA 1CLXA 1KFWA 3VOCA 1MWOA 1XCXA 5A95A 3W81A 4KRUA 1A3HA 3RO8A 1KGXA 3OA5A 1HVQA 1KCKA 1O6IA 1R7AA 4JCMA 3BAWA 4J3XA 2X05A 2GFTA 3VINA 4AMCA 1Q6EA 2VCAA 2J7FA 1BVNP 1HKMA 1ZBKA 1ZS2A 2WM0A 1UR9A 2E3ZA 4C7FA 1XSJA 1JZ8A 2ZX8A 1MXGA 3RJYA 4IPLA 3TTOA 3VMOA 5BXPA 2WVSA 4UOZA 1TVNA 5BROA 3WMCA 3WUFA 2OLHA 4JFSA 3VU2A 4URIA 1W2VA 4GQQA 3AIEA 3VIGA 4KGLA 1Q6GA 1VFOA 3ZR5A 3VIPA 2HVMA 3M07A 1CWYA 3IAPA 1OBAA 3WNMA 1LJYA 4Q22A 4HA4A 3OIHA 4JCLA 4AZHA 2XSAA 2DSWA 1WP6A 1GONA 1AQHA 1E4NA 2WC4A 2ZUVA 4MDOA 2GJPA 2ZXDA 4JFUA 1JFHA 2J8GA 3MSGA 2BXZA 1BAGA 2WMIA 3EBVA 1MW2A 3BMWA 1HP5A 1GZJA 4CCDA 1CZ1A 2V3FA 4AD5A 3WUGA 4PTWA 2FHCA 3OB8A 3OGSA 1EIBA 5C8BB 3WF1A 4EE9A 1QHPA 1VEMA 1UOKA 1J12A 2EPMX 1FFRA 2UY5A 2MANA 4IPNB 3WELA 4UQAA 3UR7A 2WMHA 1GVYA 1G0CA 5A6MA 3F5JA 2VUYA 4CU6A 4XV0A 3CLWA 4W85A 4IM4A 4J3WA 5TD4A 3RM8A 3SUVA 3WF0A 1X1NA 5CZKA 1XRVA 2CKSA 4EK7A 1CTNA 1JI2A 5LA1A 4CU8A 1QNRA 4Z2HA 4BQ5A 1CGUA 3AIWA 1HL9A 3B8SA 1S46A 3ARTA 1UWUA 1JXJA 4GZEA 1JNEA 2ZXQA 4X0NA 3VIIA 3VGEA 5EFDA 1UD8A 2VQUA 3LPGA 3SUTA 3ALGA 2WCAA 4OOUA 2XJ7A 4BQ3A 4H8UA 1VFMA 2V5CA 4RE2A 4MB3A 1JZ6A 4AZCB 2EPLX 4MAZA 1OB0A 2VJXA 5ABHA 1UA3A 2EEXA 3D5HA 3NCOA 4LPCA 2YIHA 1JI1A 3T0AA 2F2HA 4TVCA 2J62A 1V6UA 2BY0A 2V3DA 1B31A 1H09A 4BS0A 2O9TA 1RP8A 3ZJKA 3WDRA 1CPUA 1ESWA 3VDCA 2J79A 4WK9A 3MU7A 1UZ4A 4W7VA 4J7RA 4AZ7A 2YL8A 3VPLA 4UOQA 1XSKA 1B2YA 4FMVA 4LX4A 1U2YA 4TX6A 3K4DA 1JIBA 3G6LA 3UG4A 1CBGA 2Y24A 2DDXA 2D24A 4AIOA 4ZXOA 1W9XA 2WMFA 3NDYA 1BHGA 3IANA 4PMNA 3AIUA 2DH3A 4H41A 3SCNA 4AD2A 2BY3A 4S3JA 4ZXLA 2JIEA 1UD4A 4QP0A 4KH2A 3HJEA 2VZVA 4FLQA 2VRJA 2YKKA 3BAKA 1E0XA 1PX4A 3A4AA 2WMIB 3MUY1 4DWSA 5GQBA 2G3IA 1M04A 2XGIA 2XPKA 2WC7A 3AHXA 3THCA 1H49A 4NSBA 3WKZA 3KL5A 2EPKX 1V3KA 3WQVA 3FXYA 1U33A 1B0IA 3A6OA 4UTFA 1B9ZA 4W93A 2C0HA 2UWFA 4UQDA 1WDSA 4PCSA 4Z2GA 4HMEA 1I1XA 3MUIA 4EAMA 4MJ4A 1QI0A 1UR8A 1V3IA 1G94A 2V38A 3AICA 5FOOA 3MMWA 1V02E 2J8FA 1UR0A 3AIBA 4GO9A 2ZUWA 5CG0A 2G41A 2WWDA 3WD1A 1RPKA 3O6AA 5M5DA 3RIKA 3CUFA 1EHNA 2UY4A 4J28A 1GOIA 1C93A 1UKQA 2W4XA 4WLCA 3PTQA 2QPSA 2V5DA 3QOKA 1JAKA 2PI6A 2O9OA 3VMPA 3GXIA 4NI3A 1GQLA 4TX8A 1GUVA 3SUSA 1OINA 3MS8A 1J0ZA 2XVGA 1BGAA 3II1A 4PMOA 4QLJA 4XUYA 5I24A 1E6SM 1K6AA 1HF6A 2ZXBA 2CKRA 4CN1A 1QPKA 2NSXA 4CVUA 1HJUA 1TE1A 1V6WA 3ARWA 2WYSA 1C8QA 5A6AA 3HN3A 1VFFA 2AOSA 3UERA 1BYAA 1IZKA 2JFEX 1V6YA 2RGLA 1JYVA 1HJXA 1WZLA 4V2XA 3VUPA 5KZ6A 5BXRA 1ODUA 2YDQA 2YDSA 2OYKA 2Y5EA 1VJSA 1OD0A 1W9VA 1C8XA 3ALFA 3AS3A 4E8CA 1E40A 4L4OA 4GI6A 2Q8XA 4UFKA 2G3NA 2XM1A 2PC8A 2PWDA 1BGGA 1M01A 4PTVA 2J7HA 5CSUA 3EDEA 4GI8A 1J18A 2CHOA 1ZBVA 1LWJA 2YOCA 1OM0A 1KB3A 5HOSA 1XC6A 1QNQA 4CKQA 4F79A 4L4PA 4FK9A 1PPIA 3AOFA 3M46A 3ECQA 2ZE0A 1DTUA 3VM5A 2D22A 4UFHA 4DWSB 3CUIA 4MJ2A 1DWIM 2YBUA 1GOOA 3GH5A 3ZM8A 1LL4A 1US3A 2PWEA 5EMYA 1JF6A 3CGTA 1MFUA 2CYGA 1J0JA 3AHVA 5CJ5A 3TTYA 3AHZA 4PTMA 1Q6CA 4V28A 5HPOA 2G3MA 4U5IA 4TVUA 3BXWA 3ARUA 5E6YA 3W27A 5D9PA 4OKDA 2DH2A 3M7SA 1J01A 3OBAA 4PTXA 4CUCA 4DUWA 1E72M 2E4TA 3EMZA 1HIZA 1C8YA 2CBVA 1GCYA 1E1EA 3POHA 3NYDA 2VC9A 3CHEA 2WZHA 3WDQA 3L2LA 3PZVA 1H0IA 4MPKA 4AXNA 1KXTA 3I3DA 4D6FA 4JL2A 2GK1B 4DWSC 1E6NA 4U3AA 3ZSTA 1D7FA 5GNXA 3PHAA 1NQ6A 4W89A 2AMGA 1KWGA 2VURA 4GPNA 3WSUA 3F5KA 1UH3A 3AIVA 1OSEA 4W86A 1ISYA 4H8VA 1C92A 1E73M 3BCFA 4W8BA 3TTQA 4B15A 2WHKA 4W5ZA 3L4WA 1JZ2A 3IJ8A 4MADA 4ZE5A 3SCRA 2CETA 2BXYA 1E70M 3U5UA 1TFVA 1ZBWA 1R87A 3DYPA 2OWCA 4NZCA 3SCPA 3VIKA 4JHZA 1C90A 1NH6A 2X2YA 5FKYA 3L4XA 4UOJA 3WH6A 3GTNA 1UR2A 5I5RA 3WF2A 3ZR6A 4OUEA 4UFLA 5IDIA 5A69A 5A8PA 4AZGA 4AD4A 1OWQA 2PWFA 2XTKA 1CXLA 4M56A 1CNVA 2ZOXA 3VNYA 4MAVA 3WN6A 1GVIA 2NW0A 1CXKA 2OSYA 4F8XA 1GQJA 1V08A 5BWFA 4WKHA 4KWUA 4MNMA 1OT1A 1OGSA 3MV01 2GJRA 1QHOA 2D3LA 5AC5A 2OYMA 4CD5A 5M03A 3SCWA 3AHTA 4AC1X 3WDIA 4W87A 2GSJA 3U7BA 3CO4A 4UQCA 3EDDA 3N1AA 3EDJA 1UD6A 1B30A 3SCTA 1MQQA 2XWEA 5BXTA 3W6LA 2DPEA 4DM2A 3WUBA 1NP0A 1XHGA 4TOQA 2DT3A 3K8KA 3VGHA 4BF7A 1NWSA 3W53A 3AXIA 2XWDA 4EANA 1AQMA 4YN5A 2CPUA 3KWXA 2B31A 3VIOA 2V3GA 1I1WA 2BFGA 5A2BA 4D1IA 1V02A 3WQ5A 3A4WA 5EFFA 1JZ4A 3OZOA 2BY2A 3PZMA 1E1FA 1KBKA 5A3HA 1J10A 1G5AA 4YHEA 2J7DA 2EPOA 3MMUA 1DWAM 3WDJA 4GZJA 4RE3A 2E9MA 4WIWA 4E4PA 1UH4A 2QMKA 3L4ZA 3NSXA 3NIYA 3ZIZA 4F9DA 1BF2A 3T2QA 4KRTA 1JZ5A 2PBGA 3DYOA 3GNPA 4MB5A 4FLOA 3GXDA 2GDUA 3CPUA 1E4MM 4ZE4A 2ZWZA 1M53A 1ITXA 1E0WA 1JYNA 2CXGA 1PAMA 3M6DA 2BY1A 4OBRA 1ISZA 1CGYA 2DIJA 1OGBA 3WH9A 2BHUA 1W3LA 2QLYA 1CXFA 3ARVA 5CXPA 1CECA 2WMGA 4D6IA 3HU7A 4JKLA 2WWCA 3GNOA 2WSPA 1V3HA 1OCQA 3CZLA 3SEPA 5ABFA 1MYRA 1W3KA 3OLIA 4JKKA 1QHZA 5CLTA 1E6RA 5IHSA 1E5NA 3DYMA 4WJXA 1GQKA 1WNOA 1TG7A 1VFUA 4M81A 3W82A 5CQ1A 2VX5A 4H7VA 5E9AA 1EHAA 1FA2A 3PN8A 4F9JA 1UWTA 3WBAA 3EYPA 1A47A 4M1RA 3G6MA 5LA2A 5A6SA 4W84A 1OGGA 1OIFA 3QHNA 3UEQA 2WZEA 3WH7A 5M3WA 2WLYA 3KZSA 2Y8VA 2Z1SA 1QI2A 2PB1A 4HMDA 1VAHA 3VX1A 2F8QA 2XVNA 4WSJA 2BVTA 5M17A 4AD3A 5A1AA 3AQUA 1CEOA 4PN2A 1TCMA 2VRQA 3U57A 3OLDA 5D9OA 2VTFA 5F7UA 4R27A 1WKYA 1HJVA 1WPCA 1LL7A 1GNXA 5BCAA 2J7BA 5BYWA 2JEQA 1R8LA 1XGZA 1BYDA 1HX0A 1RP9A 3WUEA 2D3NA 2VR4A 4LGXA 4HOXA 1FH8A 2ZX6A 1NP2A 3S2CA 2JALA 5LYRA 3ZOAA 3A3HA 5FD0A 1EXPA 1UWRA 2IUZA 2JF6A 1LWHA 2WVVA 3ARZA 3VD7A 1EOMA 5JBFA 2TAAA 1KXQA 1GW1A 5D4YA 2XHYA 3MUZ1 4GXPA 5CPSA 2DQXA 1MW0A 3GBDA 4OOZA 4AEFA 3KL3A 1PZ2A 3EMQA 3L4YA 2OWXA 1DP0A 3QGVA 2VO5A 1R85A 1BQCA 4N0RA 4B9ZA 3VVGA 4XB3A 5ABGA 3IAQA 1TMQA 1MW3A 4P7RA 2BHYA 4B9YA 3AZTA 3WQ6A 1QI5A 2Y8KA 2XFFA 4P8XA 2D0FA 3SCSA 1LLOA 3WNNA 3KL0A 5ABFB 2VCCA 2GJXA 3NSMA 4ACZA 2OWWA 3W0KA 1JG9A 5CLWA 1KQYA 3JUGA 4U31A 5DMYA 4TTGA 2EO7A 3IJ9A 2X0YA 3CHDA 2VZOA 1B90A 5HDRA 3RCNA 2WMJA 3AZSA 4HZ6A 3T2OA 1WZKA 4D71A 1H1NA 2YLAA 4WSKA 4FLSA 2GUYA 3I3BA 3VIMA 2WCSA 4BCEA 3B9DA 4P8WA 1E5JA 4GQRA 1DEDA 3VGDA 2O92A 2WBKA 2VNCA 1E3ZA 5C71A 5JIPA 2WKLA 2E9BA 4PUEA 3W29A 1G1YA 1OT2A 3N17A 2XYLA 1B1YA 4R5EA 3AMGA 3WNOA 3ZJ8A 1AVAA 1HL8A 5A6JA 4UZUA 1UKPA 1EO7A 1JAEA 1MQPA 1JYWA 1WDQA 1R86A 1C7TA 3WH5A 4P7NA 1RH9A 3TTSA 1W9BM 4BZYA 1FP9A 3FN9A 1WDRA 2OSXA 1UUQA 2BHZA 1E15A 4U2YA 1BPLB 1SYTA 4PMYA 3VIHA 2ESCA 1FH9A 1PIFA 4P7OA 2WVVB 4UFJA 3FHQA 1SR0A 1KQZA 5DEZA 1QNSA 4CN4A 1E71M 4DUVA 1QI4A 2J7GA 4H8HA 3CZKA 5A2AA 4AZ5A 4W8LA 3ZT5A 3N9KA 1V0LA 2JE8A 2DSVA 2ZX9A 4N42A 2O9PA 4PRWA 3AMCA 1Q6DA 3PBGA 5A6BA 2WW5A 3CMGA 3WQWA 2XGBA 1YQ2A 2BNJA 3LPOA 3ZO9A 4XZBA 4PUDA 1CXEA 4JFTA 5JBDA 2GJXB 2W67A 4ACZB 2VZSA 1NOUA 3VDAA 3J7HA 5E09A 3SCOA 4QDMA 1TVPA 1TA3A 1TZ7A 5DFAA 3U5YA 3WMBA 3ZT7A 4DWSD 1ECEA 3AHYA 3N12A 4UR9A 3N04A 3TONA 1D2KA 3TA9A 1V0MA 1GJUA 1HT6A 1HJWA 1JXKA 3O9NA 4TXEA 4HU0A 1NARA 1CIUA 3AMKA 4ATDA 1AMYA 1V03A 1PIGA 5IFPA 3BSGA 1QBAA 3GH7A 1JZ7A 4P7LA 1PX8A 1GJWA 2RGMA 1DWJM 3L4TA 3SUUA 4D6EA 3FAXA 1AQ0A 1IT0A 2QPUA 2C7FA 3VGBA 3KE0A 3MKKA 3GH4A 1CGXA 2VRKA 4CD6A 3VIJA 1BLIA 2EQDA 4B3KA 3VD9A 4XZWA 2CBJA 4D6HA 2ZICA 4JFWA 1HNYA 3WY1A 2UY3A 2FDMA 5EB8A 4ZEPA 1KXHA 1ZL1A 3AROA 3PZOA 2Y4SA 1WAWA 5ABEA 2UY2A 2XM2A 4CCCA 2W66A 3UCQA 3VGGA 2YDRA 5JBEA 4AD1A 5EBAA 4PEEA 4UCFA 3AS0A 2GDVA 4MNLA 3WF4A 1H0GA 4D6DA 1C91A 3WL1A 3W38A 3BAJA 2W63A 5CGTA 3VDHA 3RPMA 1H11A 2X0HA 1XSIA 4PMRA 1MXDA 1VIWA 3BC9A 1E6ZA 4PMVA 5GNZA 3WD0A 1WZMA 3VIFA 2ZX7A 1W3HA 1J9YA 1QNPA 1W3JA 4JHOA 1DHKA 3VTRA 3PZGA 1JD7A 1VEPA 2DIEA 3FAWA 4J3TA 2E8YA 3NSNA 3CUHA 3EMCA 1BYBA 4LXFA 4W7UA 1E4IA 1I75A 4JL1A 2J25A 1GORA 3WEZA 4AY1A 3ZT6A 4CD7A 3WFLA 1US2A 2J4GA 1W2PA 3GXFA 1Q6FA 1GHSA 1LQ0A 2YA1A 2A3HA 3L2MA 3WD2A 3ZMRA 2A3BA 2E40A 1NWRA 5D8WA 1W1VA 2CEQA 2WSKA 1BG4A 1B3WA 1SMDA 1TA3B 1EO5A 4H04A 3WNPA 1NOFA 2W61A 5IHRA 5KEZA 1GOQA 1H4PA 1FFQA 2EXOA 5E0FA 1QW9A 4GKLA 5IXEA 2FGLA 3S6TA 2YA2A 1UR1A 1EQCA 1GOKA 4AZIA 4FLRA 1W91A 2E0PA 4OIFA 4RL3A 2QMJA 1XCWA 4AD0A 3THDA 4CVWA 2WBGA 2ZUSA 3CZ8A 3HMCA 1BG9A 3AYRA 3ZSSA 1EA9C 3QOMA 4MB4A 1P6WA 3RJXA 2XFYA 3A47A 3SUWA 2G8ZA 2V3EA 4P8UA 4UFMA 3W6MA 2BS9A 1FHLA 3K8LA 4UQ9A 3D3AA 5CPTA 3WF3A 3A4XA 5A94A 5I77A 4F66A 2WC3A 2E8ZA 2ZUMA 4NRRA 1L8NA 3WMSA 3L4UA 1LL6A 3SCVA 3WD4A 2XG9A 4LYRA 4GINA 4AEEA 4E2OA 3UETA 2W62A 3K1DA 4X9YA 5DO8A 1UWIA 3IJ7A 4M24A 1E55A 3T09A 3MSDA 1VRXA 1QOXA 5BRQA 1M7XA 5A8OA 1DWFM 1V3LA 3AYSA 1E6QM 4M29A 1YHTA 2WCGA 1MVYA 3WENA 1GPFA 2VCBA 5HNNA 2A3CA 3W4RA 3GNRA 1HP4A 2XVKA 4Q7NA 2XVPA 3QR3A 2YL6A 3NUKA 1JDDA 4JKMA 3AIRA 1PZ3A 2WAGA 3NDZA 4W8AA 1HKJA 1EQPA 2JF7A 7TAAA 1W9PA 1E9LA 2Z1KA 4UQEA 1VB9A 1MFVA 4AZCA 2FHBA 1ZB5A 2CBIA 1BSIA 1LF1A 4MTVA 4IISA 1D3CA 1MW1A 1WB0A 3PZNA 4W88A 1V0KA 4HTYA 2CNCA 2CERA 4P8VA 3ZJ7A 2VQTA 1UKSA 4AW7A 4MNKA 3OG2A 1J0HA 5D8ZA 3GZAA 1GOWA 1QI3A 3EDFA 2DEPA 5HBFA 1K9EA 2J77A 1PJ9A 3BAIA 3MUAA 3RM9A 4W5UA 1W1PA 1IZJA 1HJQA 2WLZA 8CGTA 2VMFA 3ARPA 5I0DA 4A3YA 3OGVA 2XUCA 1JDCA 1Y7VA 3VD5A 1W9DM 4QCFA 2VZUA 1EDQA 1E56A 1W9UA 4HA1A 1SFSA 2FGZA 4JZ5A 4D72A 1NM9A 2F61A 1PX3A 3WDHA 2EBNA 4CN6A 1J11A 3WIJA 4YHGA 1FOBA 2VI0A 1GOMA 4PSRA 3BMVA 4QAWA 1H41A 2DT0A 1WO2A 4JAWA 1K9DA 3CZGA 1Q4NX 1OIMA 3WNLA 2VX6A 4PCTA 3AFBA 3AS1A 4V27A 1JYXA 2J78A 5GNYA 2CESA 3WFZA 2D0GA 1BTCA 2EJ1A 3WH8A 4TUFA 3UESA 2DT1A 1VBUA 1H3GA 2XVLA 1FH7A 1V6VA 2QF8A 5AY7A 1R7OA 4ATLA 4M8UA 3T0BA 1ZU8A 3CUGA 5JIWA 4LYPA 1QW8A 1C7SA 2WVUA 2G4FA 5FIPA 1KGWA 1EGZA 1E0VA 1DWGM 1WZAA 3TP4A 3RM4A 1KCLA 5A2CA 4GIAA 4J3UA 1UQYA 4Z2LA 2WZIA 1F4HA 1IV8A 4Z2JA 2NT0A 3WL0A 6A3HA 4AWEA 7CGTA 3UG5A 4GI9A 2O9RA 2J47A 3DC0A 1H2JA 2VOTA 2WHJA 1TR1A 5A8MA 3L4VA 2XIBA 3CUJA 4OZOA 2WVTA 2OYLA 4CD4A 3CH9A 2DGAA 5CPQA 1ISVA 1G01A 1MQRA 3ARYA 4PMDA 1UQZA 1RD6A 1XH2A 1W1YA 3BAYA 4W7WA 6TAAA 1E4LA 4WF7A 4ML4A 3GYCA 1XD1A 3GXMA 4DUXA 3PZQA 2CHNA 4U5KA 4U3CA 3SCUA 4K68A 5DT5A 2CIPA 3K8MA 1JF5A 1XD0A 3CTTA 2PF0A 4WKAA 1KBBA 3CHFA 3VD4A 1EDGA 3B9AA 2CBUA 4OJYA 3ZJ6A 3N11A 1EOKA 4UNIA 3W37A 5FL1A 2BVDA 3TOPA 1BYCA 3RILA 1XYZA 4E8DA 2WB5A 3AIQA 3LPPA 3LPFA 5BRPA 3OGRA 3NJ3A 3AXXA 2WPGA 2VT0A 3WBEA 5I78A 2QHAA 3QHMA 1EDTA 2WMKA 4CCEA 5JUVA 3FNDA 2YJQA 1ISXA 1GQIA 3ARSA 4GO8A 3ARXA 3FHAA 4PSPA 1ODZA 4AZBA 5I23A 2W91A 2WANA 1LG2A 1NWUA 3VGFA 1J0IA 4UQBA 3SIMA 1V3JA 2A3EA 1UD2A 4OBSA 4GZIA 1XV8A 2D20A 2BV9A 3DHPA 2FH8A 3CBWA 1Z32X 2X09A 5DT7A 1X6LA 4BA0A 5DF0A 1C3FA 4CGTA 3PZIA 4PMZA 4WKFA 4PBGA 2JEPA 5BXSA 4B16A 3PZTA 2WNWA 3AI0A 2ZUUA 3AZRA 2ZUNA 3CIVA 2GVYA 3MO4A 2WHMA 3VILA 6CGTA 2X8RA 4Y7EA 4HZ7A 4ATWA 3N15A 5E70A 3VO0A 1CGWA 1J0KA 4ACYA 1CENA 2VX4A 3T0DA 1J0YA 2VL4A 1UHVA 3W24A 1VENA 2GK1A 3BLKA 4M82A 2CITA 1F4AA 5I3DA 1JDAA 2NT1A 1EH9A 3EDKA 1B3XA 4A4AA 4DM1A 1B3YA 2D0HA 2D2OA 1KGUA 3OZPA 2ZIDA 4ZFMA 3BAXA 4HP5A 4MDPA 5FL0A 2VR5A 4HOWA 3I3EA 3VX0A 1QVBA 4QLLA 2YL5A 2WKGA 4QLKA 1FP8A 4P7QA 3CZEA 5A6LA 4CU7A 1UH2A 1G9HA 3AISA 3OLEA 4TVDA 3MANA 1HN1A 1VF8A 1CXHA 5C70A 2DT2A 3E1F1 1SMAA 1CLVA 5D9MA 1QNOA 4AISA 3OLGA 4B3LA 3WQ4A 3IK2A 3PZUA 3B9EA 5HXMA 1KXVA 2WHLA 1U30A 5D9NA 4BQ2A 1BFNA 1XYFA 5AYIA 1JD9A 3VMNA 3WQ8A 4IUGA 4UZSA 1VBRA 3W28A 2DSUA 1ZJBA 4H2CA 5A6KA 1CGTA 5GPRA 3U7VA 3UG3A 3AXHA 2DSZA 4Z2KA 4TTUA 4JFVA 1CGVA 5A8QA 3ZQ9A 4HU8A 3DECA 1HKIA 1HKKA 1E3XA 1B3VA 1OD8A 1TUXA 3AJ7A 2YLLA 4NF7A 1B3ZA 3FY1A 4PYSA 2ZWYA 1UWSA 1UKTA 4PMXA 3GBEA 3N18A 2VZTA 4LQ1A 1UZ1A 4QFUA 5LA0A 1KR0A 4QCEA 2ZXAA 3MV11 1KR1A 3BCDA 4S3KA 1O7AA 4FF5A 2AAAA 4HA3A 1FHDA 4UFIA 3RDKA 1V6XA 5AYBA 4C7DA 3BH4A 2XIIA 4J3SA 1K9TA 1H5VA 4J3VA 3CZJA 3VKKA 1JNDA 1UA7A 2W92A 1X6NA 3K4AA 1CDGA 1K9FA 3GDBA 3F5LA 2ZUTA 4PMUA 3WEOA 2J75A 3UR8A 1ITCA 3BGAA 3ARQA 1NOWA 3LMYA 4PMQA 4D6JA 1CYGA 2PWGA 1JGIA 3CMJA 2IXVA 1UR4A 5HPCA 1HJSA 1HXJA 2JIWA 2OSWA 3ARRA 3O2LA 1XH0A 3FW6A 1V3MA 1HVXA 5A6BD 3WD3A 3POCA 4HZ8A 5I79A 1L0PA 1DWHM 3WDPP 1E43A 1KWKA 2C8NA 3CHCA 4XX6A 5I2UA 1CXIA 2VVNA 3W25A 3F4VA 1BVZA 1W1TA 1NWTA 2J74A 1QBBA 2W5FA 3KEHA 4AZ6A 3PTMA 4Z2IA 5AC4A 1M03A 2FH6A 4JIEA 4CD8A 2EPNA 3K46A 3BSHA 3VNZA 4AYSA 1PEZA 1W32A 2E9LA 3SCQA 5CGMA 3AS2A 3GM8A 1V0NA 3QHOA 2QV4A 5CSYA 2A3AA 3AMDA 1UG6A
chains in the Genus database with same CATH superfamily
1QASA 5E0CA 4GC4A 3TUUA 2CCRA 3W2MA 4I7UA 4HQVA 1E6XM 1GT8A 5CAKA 3ORWA 4HPHA 3L68A 3GE7A 5EMJA 2VVSA 1H62A 3EOEA 1UD5A 1F7BA 1DQXA 2X1IA 3JS3A 3FK4A 1WCGA 3HV9A 1UD3A 1UYQA 4LYQA 4DB7A 3EB4A 3EWZA 1BKSA 2EKGA 1UWQA 4GXWA 1EP2A 1RJPA 1ZBCA 1KV8A 1XICA 1B9BA 1BEUA 2GLKA 1YE6A 2OZ8A 4D6GA 3LGGA 3H2AA 1E9IA 1RVGA 1WDPA 2FHFA 2WSYA 3N13A 3Q58A 1SVDA 3FS2A 3F4DA 2VKZG 3E9AA 3VDBA 2BDQA 4IJBA 2EG8A 3MVTA 4H00A 3SURA 1ZCCA 1JL8A 3TSMA 7A3HA 3A5FA 3CASA 1DQUA 4FB7A 2FZ8A 1IT8A 5HATA 4O1FA 1AMKA 1YX1A 3VA8A 1HGWA 4QE1A 4WXZA 2HISA 4D1JA 4XAYA 1XIDA 3PUGA 3HG3A 2JGQA 2PBOA 3EPOA 3VOHA 4YTSA 3WJYA 4MY1A 3RO8A 1KGXA 3V0SA 4O16A 5TBOA 2PEVA 1GGOA 3OA5A 1XQKA 1KLYA 4IQJA 5I3HA 1O6IA 3BTNA 1R7AA 4HT3A 2GFTA 3VINA 3RO6A 1BVNP 1HKMA 1CI1A 2Q3OA 1ZBKA 3GAKA 2AQVA 1ZS2A 1FX6A 4PL2A 3IJQA 2PCQA 2FZMA 3H54A 5AZ1A 5H91A 3VABA 4UOZA 4JICA 3SGGA 5D2XA 5BROA 3WMCA 3MI2A 5CH9A 2OLHA 3VU2A 4HHLA 2FMOA 4GQQA 6TIMA 2VELA 1PKLA 1Q6GA 3ZR5A 1CWYA 1XRSA 2WJZA 4IICA 5D2WA 3WNMA 1LJYA 2NQHA 4KEUA 3NXLA 2ZVIA 3DBPA 3KTCA 3M16A 3FJ6A 1DIDA 2WC4A 4MDOA 1LT8A 2GJPA 4JFUA 1JFHA 4GNVA 3OTRA 4FSAA 5E1QA 3W7MA 3PNUA 2V5KA 1MW2A 3BMWA 1GZJA 4PODA 3K1GA 4RNJA 1CZ1A 2V3FA 4AD5A 3O6CA 3G1HA 4PTWA 4JY9A 4B5SA 3ABZA 1VEMA 1XPYA 3W74A 3A22A 2E6FA 4M7TA 4WRHA 5GJMA 2YZ5A 3QSTA 3QEZA 4CU6A 1R3QA 2A6LA 2PP3A 4W85A 3O6DA 3SUVA 5CZKA 2CKSA 4WQ6A 3WLPA 3IVUA 3KWSA 1R9YA 4CLMA 4CU8A 3MB9A 2I16A 1QNRA 3NAVA 4Z2HA 2HE8A 3DERA 2B0MA 3OYXA 3ARTA 3UVIA 2BSLA 1KA9F 4FNQA 5EFDA 1GKQA 6REQB 4ZQOA 5DCDA 3LPGA 4WJEA 2WCAA 2Z2UA 4RE2A 2R94A 1XINA 3G3MA 2EPLX 4MAZA 2VJXA 1PHQA 1ME7A 2EEXA 3D5HA 3NCOA 3T0AA 1JI1A 4WY0F 2DP3A 3GWQA 1TMLA 1B31A 4LVDA 4GHRA 2ANUA 4A3RA 4JX5A 4ICMA 4GISA 3C3UA 3VDCA 4Z17A 3W02A 4TMCA 4QBXA 4W7VA 4AZ7A 3TWAA 4HPXA 1AUSL 1SJDA 5HMDA 3EWDA 4FMVA 4LX4A 3AU6A 1X97A 1U2YA 2OG9A 3G6LA 4AVOA 2RJHA 4AIOA 1W9XA 4UXDA 3W1TA 4REQA 4ZQPA 2OZ3A 1YADA 3OVPA 1UD4A 3MUCA 3PP7A 4PUKA 6PTDA 4FLQA 4LCSA 3FIGA 1W5MA 3U9IA 2BGQA 4NHVA 5CJNA 3BAKA 1E0XA 2WMIB 3O16A 1D3GA 4FI4A 4LS0A 2XGIA 2WC7A 3AHXA 1FWNA 3WKZA 1RLCL 2AL1A 4C1KA 1EJRC 4ZSTA 1KBJA 1W1B1 3G22A 1AG1O 5MF5A 4NYUA 2HJPA 4UQDA 1O1ZA 1WDSA 2AMXA 1LCOA 4Z2GA 3SB0A 2NX9A 4C6EA 3MUIA 4R34A 2BGNE 3HB9A 1V3IA 2FPVA 2PDNA 3KLKA 2H9AA 1J5TA 4CEXC 2J8FA 3RR1A 3CEPA 1IXNA 1LZOA 4RDWA 3S1GA 3FJLA 3DU0A 3TAKA 1OFPA 1JRBA 1W1ZA 2PGRA 1MZHA 1P0EA 4CQ8A 3PTQA 2QT3A 3FA4A 1TWSA 4OECA 2V5DA 3QMTA 2Q3RA 1A5BA 1YPIA 4AWSA 4RW3A 2OR2A 1J0ZA 4XO6A 3W1AA 2W3ZA 2PDPA 3U2EA 4Z1BA 1TE1A 2PLKA 5AVNA 3G8RA 1VFFA 3UERA 4I5RA 1UMYA 4E3VA 5FF0A 1WZLA 4ONVA 5KZ6A 1FVPA 4NZJA 1EA0A 1C8XA 4E8CA 1E40A 4US6A 1LTDA 3U2CA 4HN8A 1A4LA 2R82A 2YXOA 4QRNA 2NLIA 3OA3A 5E9XA 1OM0A 5HOSA 1XC6A 1QNQA 4FK9A 1KM3A 3OO2A 4JN7A 3AOFA 2ZE0A 4ADTA 2PU1A 4IMDA 4NASA 5KZEA 2QJGA 3LCIA 5GJNA 4O4WA 3H22A 4N9EA 1LL4A 1US3A 2PWEA 4GCAA 4S3CA 4B90A 1FWTA 1XKJA 1XJBA 2P8BA 1KKRA 4XKYB 2I57A 4PTMA 1Q6CA 5HPOA 3FKRA 3PSWA 4TVUA 4K8HA 3LZ3A 4QISA 3UPBA 3P5ZA 1JCYA 3TFCA 5FJPA 1JRCA 3HGSA 3EMZA 1W8GA 1GCYA 4IIBA 4C6KA 4LUTB 2WZHA 3G24A 4G6CA 3KVMA 2WNZA 1H0IA 3CQ0A 3Q4DA 4MPKA 3OVQA 2A7RA 4UMBA 4JL2A 2GSEA 2GK1B 3MZ2A 2E7FA 3KRUA 4FS9A 1D7FA 3W3OA 3PHAA 1S1RA 1M6JA 1KWGA 4ZVJA 2YXGA 4GUGA 3W1LA 3H2MA 3F5KA 4LRTA 1RR2A 2WHKA 5DLCA 1WYIA 4W5ZA 3VOFA 3IJ8A 4MADA 2FMNA 4ZE5A 4IPIA 3IIXA 4HK5A 3LGEA 3QZEA 1TFVA 1G6CA 3DYPA 4A6GA 1QT1A 4NZCA 4ZO7A 1IGSA 4JHZA 4QIUA 4A8NA 4ZB2A 3KUMA 1QCWA 2X2YA 3VC5A 1DXEA 5FKYA 3KTSA 5CSRA 2NVDA 1VD6A 3F2BA 3MYOA 2JQXA 4JOMA 4AZGA 1OWQA 3W71A 4C1NA 3BG9A 2PWFA 2XTKA 3ENLA 1EX5A 3BURA 3WN6A 1KM6A 4DXXA 2QIIA 4US5A 3DKLA 4F8XA 3BMXA 5BWFA 3B0UX 4MLJA 1OGSA 1ICQA 4XG1A 1HKVA 3HM7A 4BR1A 2XZ7A 4AC1X 3WDIA 3UJSA 3AUJA 4KCVA 1IF2A 4UQCA 4A2RA 4LWWA 2QCLA 1UD6A 2YCJA 5EGRA 4C6BA 5FEXA 3SCTA 2HPMA 2PDQA 5EMKA 1E1CA 2XWEA 5BXTA 2ZC8A 3R13A 3UZ5A 1TJ0A 1ZY9A 1R2TA 2HS6A 1XHGA 2HVOA 3O3RA 2OQYA 1O68A 4BF7A 1NWSA 4O1EA 5I07A 4GUFA 1Q3NA 2CPUA 4LF1A 3VIOA 2ZRWA 1I1WA 2BFGA 3HPSA 2B7QA 3A4WA 2BOGX 3PZMA 1J2WA 5I09A 3MMUA 1XF0A 5IDZA 2ISVA 2GVJA 1UBSA 2Q01A 2FJKA 1BF2A 3CV2A 3GNPA 4FLOA 3GXDA 4XTDA 3CPUA 3JZUA 2NUYA 1OCBA 2W6RA 1JYNA 3N73A 1ISZA 1OGBA 4Q4OA 2BHUA 5F2LA 5I06A 2WMGA 3WJSA 1DJHA 3SI9A 3L23A 3OBEA 4JKLA 2AGTA 1V3HA 1OCQA 3CZLA 3ZZ1A 5ABFA 5CSSA 4XZMX 2X42A 2Z4GA 5G5IA 4O50A 5IHSA 3UY7A 1E5NA 1XGEA 4MF4A 1GQKA 3LTYA 1CW2A 5IOBA 4GX9A 4R7OA 3IV3A 2P53A 2VX5A 4RZ5A 4MOZA 5E9AA 3W7DA 1TQJA 3OVRA 4AX6A 4F9JA 4RNIA 1O12A 5A6SA 4W84A 1TTPA 1RXOB 3LMZA 5U4NA 3WQPA 2QCMA 4IQDA 1KNWA 1QI2A 1VAHA 2XVNA 3TEVA 1B5TA 3AQUA 3BLDA 2FB3A 3PAJA 1TCMA 5D2YA 2VTFA 2I5IA 1WKYA 2NV1A 9XIAA 3FFSA 3VOIA 2BTMA 2JEQA 4YTQA 1OK4A 1FXQA 2HRWA 1UIOA 2OPJA 1UASA 1H7XA 1LWIA 1ONEA 4EOUA 5XINA 4AEOA 2VR4A 4LGXA 1SUXA 2ZX6A 5A8GA 2GQAA 3K5XA 3DFNA 3CC1A 3CAWA 8TIMA 3A3HA 1SO3A 4O8RA 1LWHA 3MDWA 4IGSA 4L7ZA 1RY0A 1XFBA 3KOYA 3W7OA 1GW1A 3MUZ1 5CPSA 4ZMGA 3KL3A 1PZ2A 5LGZA 5FSEC 2OWXA 3DFQA 5B7YA 4FXJA 3IIZA 1BQCA 3VVGA 2O4MA 4B9YA 1XFCA 3TQKA 1KBIA 4JR5A 4JD4A 1W54A 2XFFA 5DXYA 1C9WA 2P10A 1LLOA 3CT7A 4JXCA 2VEPA 1IEQA 1WKEA 2OWWA 2AL2A 1MMFA 3W0KA 3GDRA 1B54A 1KFBA 3D3FA 5CCZA 2HNEA 5DMYA 2PRLA 3IJ9A 2VZOA 1B90A 5HDRA 3RCNA 3AZSA 2CLPA 1RQHA 4F0KA 4PMJA 4WSKA 2GUYA 1TX0A 5CGQA 1XL9A 3M44A 3SRKA 4GABA 2PDHA 4AQLA 5CG7A 3B9DA 4P8WA 2QVNA 1TCDA 4GQRA 1VBJA 3DUGA 4NIRA 1QWGA 1OCJA 1T41A 4S38A 3UA3A 4PBEA 4C6MA 3P2VA 3I10A 3S6OA 4QE5A 5PTDA 2WQDA 3PBWA 5LIUX 1N55A 3D6NA 5AOUA 3DX5A 4MPQA 3UGRA 4HKPA 4R5EA 1W0MA 1AVAA 3R25A 1EO7A 1MQPA 3LCFA 3OEXA 1A3WA 1FP9A 4A8LA 1G4EA 3DC8A 3TZFA 2VDIA 3VCNA 2PTXA 1WBHA 2BHZA 1E15A 1M9HA 4U2YA 3R6IA 1K03A 1XYLA 3VIHA 2ESCA 1FH9A 2FFIA 4NXKA 3PJXA 5LSMA 2J7GA 4Q4KA 3G77A 4QQUA 4R88A 4XZ9A 5HQLA 2F6UA 4MWAD 3M0ZA 2ZX9A 4HPNA 1EYWA 2ZQ0A 4OVXA 2YPIA 3PBGA 1Q8AA 3LRLA 3HMJG 2XGBA 4IMGA 1YQ2A 4DLFA 3S0CA 3KTXA 4LB4A 4PUDA 1OF8A 2W67A 4L9XA 2YR1A 4ACZB 1P0NA 3SM0A 3L65A 1TA3A 4UIOA 4ZQNA 4YCPA 3WMBA 1UOZA 1XR2A 2GSHA 4A29A 3KS6A 4N9CA 4ZOEA 3NEVA 3JZEA 3O9NA 4TXEA 1CIUA 4WOQA 1AMYA 1V03A 2Q09A 1PIGA 4X3ZA 5IFPA 1SJAA 4IMFA 3USBA 4O57A 2RGMA 2E67A 3L4TA 3SUUA 7PTDA 1IT0A 4AX7A 3LN3A 3PC0A 1RAKA 3VGBA 2VM8A 3KE0A 3GH4A 2VRKA 5KSWA 3VIJA 4QG8A 4IIDA 1L2QA 3VD9A 1R2SA 2FDMA 3SRDA 1G7VA 1KXHA 3HPFA 1WAWA 4ROQA 5ABEA 2XM2A 5CC5A 3VGGA 3KW3A 2VFFA 2DVUA 3E0IA 4R33A 4QR6A 1MNZA 2NVCA 2QUUA 3WF4A 1TPFA 5HQEA 3EOOA 3BAJA 4RZ4A 3LSBA 1Z44A 5CGTA 3P5YA 3H24A 4NP7A 1H11A 3HG2A 1PVNA 1EXBA 3VCRA 1XSIA 3V7PA 1WZMA 2WQPA 3VIFA 3AC0A 3QV9A 1W3HA 1QNPA 3I7QA 3B40A 4R9XA 1S5MA 3TMQA 3SQLA 3BARA 3NSNA 5LNUA 4I9TA 1BYBA 3B97A 2OT1A 1DKWA 5LNRA 1E4IA 4K8GA 3C56A 3AXMA 4H9TA 5F2MA 1NY1A 3WFLA 3QFWA 1LQ0A 3L2MA 4HN4A 3VI2A 2E40A 3CQHA 4HSOA 4L65A 3P74A 1ZGDA 2HK0A 3GLCA 5E0FA 1D9EA 3K4WA 2D73A 1IXPA 2OEJA 2VEFA 4KWSA 2FGLA 1H1YA 3GG7A 3TIMA 2O4QA 2YA2A 4DF0A 2PDYA 2DZWA 3LU2A 2PDMA 2CW6A 3DI1A 2V69A 1Q66A 2E77A 4H8NA 1BG9A 2FLIA 4E4UA 2ZRXA 3AYRA 5C9WA 5DN1A 3QOMA 4MB4A 3BW4A 1P6WA 3RJXA 3QH2A 3ITOA 3VZYA 4ADSA 2BS9A 4ROPA 3K8LA 4UQ9A 2V9DA 5CPTA 2ZZ2A 3TXVA 3A4XA 1SSDA 2YBVA 2ZUMA 3RX4A 3TSBA 5LIKX 3SCVA 3WD4A 2XG9A 4GINA 1OYBA 3SJNA 3DFSA 3QGAC 4R7WA 4E2OA 1ZALA 3TOYA 3K1DA 4X9YA 3IJ7A 4M24A 1E55A 1XIIA 1WXJA 1M7XA 5A8OA 1DWFM 2Y5JA 3B06A 3LXBA 3WLMA 4AHPA 4IIFA 4LUJA 1KM1A 1O5KA 2OZ0A 4GIYA 5HMEA 2VCBA 2VC6A 1K8ZA 4JTUA 3TVAA 4ICNA 3GNRA 3LTSA 2XVKA 2JKAA 4Q7NA 3ZFHA 3BQ5A 5FESA 1KD0A 1Z6KA 2WAGA 4W8AA 4NU7A 1EQPA 1VB9A 1MFVA 1R3RA 3M5YA 1GG0A 1TX2A 3PZNA 1V0KA 4WVXA 1LLWA 4DO5A 2CNCA 2C1HA 4P8VA 2GWGA 1L6WA 2VQTA 3PWAA 4MNKA 2NQ9A 1AL7A 4HSHA 2J77A 3BAIA 4PRTA 1W1PA 1HJQA 3ME3A 3CQJA 1E56A 4UTWA 2ICSA 1W9UA 4HA1A 1SFSA 2FGZA 4D72A 2PWUA 4NAEA 1NM9A 4JTDA 4LANA 3FYYA 3WIJA 2QPXA 1GOMA 1V8EA 4PSRA 2X0SA 4C6LA 4QAWA 1WO2A 1H7PA 1K9DA 3CZGA 3GX9A 5E0KA 3UYIA 2ON3A 4ML9A 5C55A 1BRLA 3TCSA 3AFBA 1JYXA 4YXGA 2RAGA 1SZRA 1BTCA 3XINA 3WH8A 1EPXA 3UESA 2VGBA 4UMAA 1V6VA 4QTGA 4J2PA 4XIAA 5AY7A 1R7OA 3WCZA 3T0BA 3CUGA 1Q2RA 1QW8A 1C7SA 2G4FA 4S3GA 3TC6A 3S83A 1DWGM 1FCQA 2HE5A 1V5XA 1F4HA 1IV8A 2NT0A 6A3HA 7CGTA 5I3JA 4GI9A 2O9RA 3NZ1A 3DC0A 5DANA 5AVHA 3W7EA 3EX1A 4Q8PA 3CUJA 5CC6A 3EB3A 4OZOA 2OYLA 4CD4A 1K70A 1G01A 3ARYA 4BK9A 3LUTA 1RD6A 4UTKA 4LF2A 3NPXA 4W7WA 1E4LA 2GJLA 2GPTA 4XSLA 3PZQA 3N9SA 4U5KA 4U3CA 5C9RA 1G4PA 1KM0A 4K68A 1XYCA 4AVNA 3L12A 2OZTA 4IL0A 3DBNA 2J13A 5HR7A 3EX2A 3CTTA 4OU1A 3VD4A 1IEWA 2CBUA 1PIIA 1SW7A 3MCOA 2Q71A 3H55A 3W00A 4TV5A 4K3ZA 2YZRA 2QDHA 4YIWA 2GVGA 2RJGA 2WB5A 2GJNA 3DFPA 1UC4A 3R8RA 4GYFA 3LPPA 2YYUA 4C90A 2Y7GA 3LHWA 3OGRA 4P61A 2VT0A 4Q6JA 5I78A 2QHAA 3CPGA 4JQAA 1JPHA 4D8LA 1S1PA 1GQIA 3ARSA 3GDLA 1ALDA 4PSPA 3UZWA 3VGFA 5LIWX 1J0IA 4UQBA 3SIMA 3T6CA 2PWVA 2A3EA 4GZIA 1ADSA 1Z32X 5DT7A 3C0SA 3NPVA 4WKFA 4JYDA 3AYTA 2DW7A 4XD4A 4B16A 2OEMA 5HNRA 2FTYA 2ZZ7A 3MUXA 3UYCA 1GOXA 2GUBA 1QK2A 3SAZA 1SQ7A 4PCPA 3AZRA 2G3FA 3NO5A 2WHMA 2X8RA 3N15A 4HB7A 5E70A 2ATSA 2INZA 1W17A 3GB6A 1TTQA 1TR9A 1LRQA 2VL4A 1MEHA 3V35A 3R0DA 3AWNA 5I3DA 1EGVA 2J8TA 1B3XA 4A4AA 4DM1A 2OLSA 1QOQA 1YBQA 5KETA 3OZPA 2ZIDA 4NT0A 3NQDA 4K2SA 2VR5A 4IFKB 4M7SA 1R46A 4HOWA 3I3EA 3DH7A 3QQ1A 3BANA 3NZRA 4TVDA 4H9MA 1HN1A 5CBIA 3E6EA 4XD5A 1ZCOA 4H9UA 5D9MA 4Q8WA 4NAFA 5C2CA 3L21A 3T9PA 3WQ4A 3WLKX 1SO6A 1FDJA 3QN3A 5F1UA 2F6XA 2Y1HA 4AY8A 2WHLA 1U30A 2Y85A 1XYFA 4IP4A 1AJZA 1JD9A 1ZJBA 4H2CA 2JBMA 1X96A 1GVRA 4O8AA 3H70A 3GU9A 1TUFA 4TTUA 1CGVA 3CK5A 3LLDA 1XS2A 1HKKA 2I5GA 1FDYA 1QW7A 4NF7A 4PYSA 4Q8OA 1OYCA 2ZWYA 2WOQA 3UWQA 1BSLA 2WO5A 5D2TA 3AU2A 3C2FA 4QFUA 4QCEA 3BCDA 4G2DA 4HA3A 3GTFA 1V6XA 4C7DA 3OQ8A 3E12A 4J3VA 1UA7A 2W92A 1X6NA 3ISIX 3BJFA 4GUJA 1XLFA 3RRAA 1XBXA 4JBRA 3LMYA 5EPDA 4FIQA 3THUA 3QPEA 3M7WA 3SN4A 1RK5A 3FW6A 4E38A 3W7IA 2R1MA 5FI8A 1V3MA 1YDYA 1HVXA 3VFCA 3ZVHB 4HZ8A 3JU2A 1KWKA 3NO3A 4N4PA 4Z0JA 3UJ2A 1MEWA 2VVNA 3B0VC 1BVZA 1OADA 1W1TA 1QBBA 4Z08A 4AZ6A 1Q13A 5C9UA 3SN0A 5AC4A 1M03A 4TR9A 1TRDA 5CKSA 1JGMA 2Q8ZA 2EPNA 3K46A 3BSHA 3F1QA 1MDLA 3M0VA 5F2IA 1FWHC 2BZNA 4AYSA 1SW0A 3GU1A 1XDJA 3EOUA 4DO7A 1XIHA 1R2RA 3O05A 4OBTA 1XXXA 1ONXA 2PGFA 1SZFA 3IS4A 4O53A 4GRSA 4RXGA 1JZ3A 1ONWA 1OK6A 1REQB 3EOLA 1LG1A 4DEFA 4AIUA 2XFRA 8A3HA 3ABXA 4GD0A 4CNPA 1VIZA 3NM1A 1IIGA 1GVSA 3V1PA 1ELSA 5DCEA 3ES7A 3RXZA 3VNMA 1Z41A 1YE4A 3O1NA 4DBDA 1OVDA 2YL9A 4AIEA 4J27A 1E0TA 4UTHA 3T2PA 2PZ0A 4DPPA 4HMCA 4WOZA 1QNVA 4YL2A 3L0KA 3HTWA 4OHQA 5IFTA 4NRSA 5LNSA 2E5BA 4RK8A 4WDXA 3T08A 3NL2A 5E6ZA 5FEZA 2D23A 3IGSA 2DSKA 4IF2A 4U2ZA 3V4BA 3W7HA 1W3TA 1VS1A 1Y0EA 2IXUA 4E2BA 2P76A 1ZSXA 4DY1A 2BVYA 4A35A 1A5LC 2GYIA 1UKOA 1N82A 3R5EA 1Q7MA 3QY7A 4Q8TA 3O8AA 4ZO6A 3CB8A 3FEMA 4A3HA 4QAIA 2PDGA 3DG3A 2YA0A 3MI6A 1S2WA 3THAA 3IUDA 3LEPA 4QQ3A 1XH1A 4ZENA 5ECUA 5I6SA 2PDBA 4YPJA 4HYWA 1HFBA 1KO0A 3PBMA 5E93A 2I5QA 4DZ5A 1KCXA 3F03K 3UJEA 4DBWA 1BWVA 1UP0A 1HVQA 4O0KA 1F73A 3V36A 1F07A 3T44A 4RPQA 1WDWA 3PULA 4AMCA 2VCAA 3PBYA 1QUMA 1UC5A 3QLDA 3T05A 4JEJA 1F3EA 1UR9A 2E3ZA 2XIMA 1JZ8A 2ZX8A 1S2VA 3TTOA 4KWOA 4RX0A 2WVSA 1ZZMA 3KM8A 4V1XA 3TE9A 2YCKX 3KVLA 4PC8A 5LHFA 4ZTXA 3WUFA 1NSJA 1X7FA 5C7VA 1THFD 4JFSA 2DV0A 1W2VA 3UPWA 3PBVA 1VFOA 4IHCA 5TF0A 3VIPA 1UP2A 3MTWA 4HA4A 1I2NA 3MP5A 4N6EA 1EWDA 2EKCA 4FNRA 2E1DA 2XSAA 3R1ZA 1GONA 2XINA 4O52A 4BFAA 2J8GA 1MEIA 4NNAA 4FA3A 3WLQA 1U5JA 2BXZA 2ZRZA 3MSGA 1BAGA 5XIAA 3EBVA 1HP5A 4KIEA 4CCDA 2PE4A 2CLLA 3WUGA 1P0BA 5KINA 4UTTA 2FHCA 3OB8A 3OGSA 1LDCA 3CMFA 3WF1A 2ABAA 2IQTA 4U10A 4DO4A 3CU2A 1UOKA 1U1JA 3R4IA 4Z0SA 2EPMX 1FFRA 4IPNB 2EGZA 4Q6XA 4B91A 3WELA 4HYRA 4UQAA 2WMHA 1Q65A 3F5JA 2YB1A 4J3WA 3RM8A 1X1NA 1XRVA 2A7PA 1CTNA 1R3WA 4OFCA 3KX6A 5LA1A 2ZZ4A 1GZ1A 1BD0A 4Y9OA 3AIWA 2PSNA 1HL9A 1S46A 2ZXQA 1LT7A 4X0NA 5C6MA 3VIIA 3DFTA 4YTUA 4IMAA 3ALGA 3CAQA 3M0JA 1SR9A 3Q67A 4L1GA 2R1NA 3KVJA 2XJ7A 4ZOBA 1VP5A 1VFMA 1JZ6A 1JCTA 1W31A 3I7SA 4PBFA 1UA3A 2GZXA 2R14A 5ABHA 2F2HA 2J62A 4HCDA 2BY0A 3P84A 3FEQA 1X8FA 3MCMA 3WDRA 1CPUA 3QXBA 4M6PA 5LZLA 3E0LA 1MUCA 5MKGB 3GKAA 2ISSA 4UOQA 1DORA 4N4QA 3N4FA 1B2YA 3VNJA 2XZ9A 4BI6A 2DUAA 1ITQA 3NQ2A 1VLWA 1NFPA 1JIBA 3K4DA 4M6QA 3UG4A 1CBGA 4BF5A 2DDXA 2D24A 3HOJA 4DWDA 1A0EA 2YYTA 4LBSA 3WLSA 3IANA 2DH3A 3W7QA 2HQAA 5M1TA 4UMCA 5C9XA 2JIEA 4GNKB 3H4WA 3FSUA 2VZVA 3I4KA 4M6UA 5HINA 2VRJA 2YKKA 3HG4A 1LORA 3HGJA 1PX4A 4CNUA 3MUY1 4DWSA 3ES8A 1YIXA 2XPKA 2OTDA 1J2BA 1QWKA 3THCA 3GFZA 4NSBA 3KL5A 3FXYA 4BWLC 3U2OA 4IX2A 4I9AA 1XW8A 3A6OA 4DBSA 1B9ZA 2REQA 4W93A 2UWFA 4PCSA 1DYSA 4HMEA 4JEQA 1YXDA 2QCDA 2FVKA 4UB9A 2CWNA 1DHPA 3MKCA 1G94A 1SZNA 4C91A 4IQEA 3QV8A 3AYVA 3GS6A 4FX6M 2GGIA 3KOZA 1VC4A 4IOTA 2G41A 1VFHA 3H23A 4PTDA 3N25A 1OQFA 3CUFA 5LXEA 2UY4A 1XYMA 4J28A 5TQLA 1GOIA 1EJWC 1C93A 1UKQA 4WLCA 2Y8UA 2E5DA 3NPWA 4EXAA 1F9CA 4XVEA 3N2OA 5G2WA 1JAKA 2PI6A 4DJDA 2O9OA 3GXIA 2E6AA 1GQLA 4RXFA 2BVWA 3SUSA 1TO3A 1OINA 2NUWA 3II1A 4PMOA 4QLJA 4UTTC 1E6SM 1OFDA 4JDYA 2DY3A 1HF6A 2ZXBA 4CVUA 3M1ZA 4ZB5A 3WJZA 2VDHA 1C8QA 3HN3A 1EUAA 3ICJA 4H9YA 3AJXA 1BYAA 4PL1A 3VOGA 4QHRA 1JYVA 5C2GA 3C2VA 4PB4A 3VUPA 2HK1A 5EL1A 5BXRA 3W7KA 4HTBA 1JCXA 1VJSA 2VEMA 3UXDA 3XIMA 1W9VA 3ALFA 3AS3A 4MWAB 1OF6A 5JH2A 4UFKA 3W1NA 1KFCA 2XM1A 2PWDA 4PTVA 3SRFA 2PTWA 1PWLA 3W7JA 5CSUA 2R8WA 4GI8A 2C16A 3GO2A 1J18A 1M5WA 4KF1A 5T26A 2CFFA 2VEKA 1WBJA 4AY7A 4O1BA 1B4KA 4FPSA 4CKQA 4M5PA 4F79A 1JPDX 1PPIA 2QEZA 3ECQA 4JTHA 3VM5A 1GYMA 5FSDC 3CHVA 1DWIM 1GOOA 3RF9A 5EMYA 1QDSA 4DAFA 2CYGA 2PPGA 4HMNA 3AHZA 2WJDA 4ZQRA 4ORIA 4K39A 4F2TA 1FXPA 3QKEA 2G3MA 4U5IA 3BXWA 5D9PA 3DIPA 4GH1A 4Z1AA 1XLKA 2PLJA 5H8UA 3GG1A 4M6VA 3W70A 4DUWA 2E4TA 2J9XA 1HIZA 1C8YA 2Z1WA 1E1EA 1FHUA 4IPPA 1RA5A 3POHA 3A24A 2VC9A 1M7PA 3CHEA 1EUNA 4LS1A 2EG7A 1AA1B 4AXNA 4A8IA 3V5CA 3TN5A 2AQWA 4DWSC 1E6NA 5FAJA 1YDOA 3W75A 4H9XA 4MZYA 2VURA 1YBQB 1LLZA 1VFLA 4S39A 1Q85A 3WSUA 2DQWA 1VCFA 2XFWA 3GHRA 2AKMA 1UH3A 3AIVA 1ISYA 4H8VA 1C92A 2VR2A 3H7RA 3BCFA 2JK2A 3TTQA 4F0RA 2PZNA 1TV5A 3L4WA 4S2CA 2TSYA 3OOQA 3U5UA 1D8WA 2OWCA 3KP0A 3SCPA 3VIKA 1W5PA 3NOEA 4HGXA 1C90A 2QGYA 3SFWA 4DJEA 1IWBA 1UR2A 3P93A 4C5YA 1TPUA 1TTIA 3WF2A 4OUEA 3NXFA 5A69A 4FEZA 2R91A 3NDOA 2QIWA 4E6MA 4RV3A 1RJRA 5U7SA 1J93A 4B5TA 1RVKA 4MZ1A 3L0GA 1F6KA 2NW0A 2HDJA 2YX0A 4FNSA 2QZRA 1VZWA 1GQJA 3NQBA 4GH3A 2V5LA 5HNTA 4KWUA 4MNMA 3V18A 3MV01 1QHOA 3RPTA 2OYMA 5AHIA 1S5VA 1R3YA 2VHLA 4W87A 3EDJA 4L9ZA 3G0SA 1KKOA 2CWXA 3KOXA 1PWMA 3LTPA 2YDAA 5HUPA 2X16A 5EMMA 4D9PA 2W79A 5C5YA 3K8KA 4O0ZA 4PUMA 3VGHA 3PM6A 3AXIA 2V5JA 1DPMA 2XWDA 5BOEA 4PA8A 3C61A 1AQMA 4D1IA 3R2GA 4EX4A 5EFFA 1IXQA 5HWNA 1G5AA 2PDWA 2J7DA 3OQEA 3WDJA 1WX0A 2PDFA 4GZJA 4PH6A 4WIWA 4E4PA 1YKWA 2QMKA 2HZGA 5K3VA 3OODA 4O10A 2E5CA 2HS8A 3KFTA 3N3MA 2PBGA 3ANYA 3DYOA 2P3EA 4DZIA 3R12A 1OY0A 3OHIA 2Y7EA 1A0CA 1E4MM 4G7EA 3TW9A 1M53A 1XKYA 2O55A 1PAMA 4Z1DA 2PDKA 3P8JA 2DIJA 3WBWA 2QLYA 1CXFA 3KCOA 2CZEA 2FDSA 2V0TA 1A5MC 4MHBA 4D6IA 4IX0A 5GJPA 1ZJHA 2C19A 1NJJA 3ANVA 5D03A 2YCEA 2WSPA 1UMLA 3SEPA 1RSCA 1W3KA 1OZQA 3WLJA 1TE6A 1E6RA 1TVLA 2DZSA 4K1WA 2QCHA 4IL2A 4PTNA 3MP4A 1TG7A 1FWEC 3LY0A 1V51A 3T4WA 4B5WA 1UWTA 3FA5A 2Y7DA 3G6MA 5LA2A 1OGGA 3CLMA 5K4XA 3QHNA 5AKQA 3NQFA 2WZEA 2Y5SA 2Z28A 3TQPA 2PB1A 4HMDA 3VX1A 4Y96A 3QM3A 2BVTA 1QPQA 2PF8A 4AD3A 4FNUA 2VRQA 3OLDA 2OJPA 3A9BA 3FYOA 1AW5A 3MWCA 4DJEC 5HR6A 2IMRA 3UR2A 1R8LA 1XGZA 1HX0A 3NQ8A 1FQ0A 1P48A 1RP9A 2A85A 4B3ZA 3V5FA 1XIGA 3NGFA 4NX5A 5K2ZA 1SM9A 1MXSA 3WUEA 1FH8A 1FDZA 1I8JA 2GUUA 3S2CA 4L5ZA 3ZOAA 3S5ZA 3T4CA 4WY0A 2VEIA 1EXPA 4LAKA 2JF6A 4LUSA 3T8QA 1VYSX 3ARZA 3HIJA 1KXQA 3IRDA 4PEKA 4JIRA 3C0LA 4MSSA 4I7VA 3QTGA 3GKFA 3QGVA 2VO5A 3LHVA 1XLAA 4XB3A 3IARA 5ABGA 1TMQA 2V81A 4P7RA 3EKGA 3WQ6A 3L67A 4XBJA 4MY9A 4NL1A 2RH9A 3SCSA 4KIRA 3WNNA 1AD1A 3KL0A 4YCOA 2GJXA 3NSMA 1RD5A 4MIMA 5REQB 1JG9A 4RJEA 4WCJA 4RDYA 4U31A 3W2KA 1S38A 2HXUA 4TTGA 2EO7A 1P7TA 3CHDA 1OCNA 2WMJA 1F8MA 3T2OA 1WZKA 3M5ZA 4NYYA 4D71A 3N19B 3B0PA 3EPMA 1P6BA 5DMMA 5BRBA 3VIMA 2WCSA 5MHBA 2PDXA 3TJIA 4Y8FA 2C14A 3F2CA 2NXGA 1E5JA 3LCXA 4GC3A 1LBLA 4C6FA 1DEDA 3VGDA 3KHDA 2GGEA 4JGDA 2WBKA 3GIQA 2FKPA 4H6EA 1FRBA 6ENLA 3UXAA 1B1YA 3WNOA 4KETA 1HL8A 2HPIA 1HUVA 3WQDA 1POJA 2OCZA 3PNZA 4LW7A 5FF7A 3QPZA 3LCWA 4P7NA 1RH9A 1W5QA 2R6OA 3TTSA 4F0LA 1W9BM 3WBYA 1UUQA 3TWBA 2EPHA 4UC5A 2NQZA 1T8QA 3DFYA 1BPLB 1WAUA 2QCCA 3H8AA 4TU1A 3A4JA 4PMYA 3PF3A 2HBVA 4EIVA 5CBBA 2WVVB 3DHDA 1LP6A 5DEZA 1KQZA 1XLIA 4GYPA 3GDTA 2HMCA 2BOFX 4CN4A 1XM3A 1QI4A 3MP3A 3LGDA 4AZ5A 3UCDA 3PK7A 3W2NA 1V0LA 2JE8A 3G18A 3BOXA 1KTBA 5DBUA 1K4GA 5DRCA 1TMHA 1LBFA 3H2FA 2Y63A 5A6BA 1R30A 3WQWA 3E0WA 4KEVA 2RDUA 3M0YA 1YPFA 3PJUA 1PKYA 1F6YA 2B7PA 4JFTA 4F0SA 1I2PA 3J7HA 5E09A 4QDMA 3UR5A 1TVPA 2GOKA 1TZ7A 2KZHA 3C2RA 3EWBX 2ZE3A 4Q3MA 1TV4A 4UTIA 1P5BA 3TYAA 3N04A 4KCTA 3TA9A 3QW3A 7ENLA 1HT6A 1A0DA 1HJWA 1NARA 3AMKA 5SWUA 1PKMA 5B7ZA 5ENLA 3W1PA 3BSGA 4UTMA 2PMQA 3L7RA 3PTDA 2FGBA 1RZMA 1WV2A 3IVTA 3MKVA 4GVHA 1AQ0A 3IWPA 3EXSA 1X6UA 4WDUA 1T40A 4CD6A 4DVOA 1UWAA 4O28A 1BLIA 3DGBA 3WBXA 1KRAC 1TZ9A 1JDFA 4XZWA 3VKBA 3T0TA 4JFWA 3SY1A 2D69A 2PD9A 5AC8A 5I02A 5EB8A 4ZQMA 2FFCA 2V30A 4MYAA 4X60A 3B0XA 3VOJA 1YNQA 4MGGA 2YFNA 4HHMA 4XTIA 3TQVA 5JBEA 1AD4A 4AD1A 3RX3A 3ABRA 2FB2A 3FYPA 1SSGA 3GUWA 4UCFA 3QKZA 3RMJA 1H50A 1C91A 2DW6A 1AH4A 8XIMA 4AF0A 3U8GA 3VDHA 2TYSA 5HNUA 4JTIA 1TKKA 1TIMA 1VIWA 2BP1A 3BC9A 1H51A 4PMVA 5GNZA 3FVDA 4IG2A 3HA1A 4QNEA 3MVIA 1KW1A 3P62A 1DHKA 4JHOA 4XD3A 4Y9NA 3STCA 1HW6A 1LOQA 3WQGA 1JD7A 1VEPA 1IEXA 1WUEA 2E8YA 2BGSA 4HIBA 4LXFA 3M6YA 4W7UA 4MY8A 4JL1A 2J25A 1GORA 3WEZA 4AY1A 4CD7A 1W2PA 4XK2A 4WDWA 1Q6FA 4Q32A 1DXIA 4XAZA 3WD2A 2A3HA 3V1HA 4N7QA 1L6GA 2A3BA 1ADOA 4BHYA 5DY2A 5D8WA 1W1VA 2CEQA 1BG4A 1B3WA 1FTXA 1I2QA 2RDXA 4NJHA 5KEZA 3GK0A 1O66A 1H4PA 1QW9A 2Q8LA 5FEWA 2OQLA 1I4NA 1R3VA 1VR6A 2DUXA 4BKNA 3PPCA 4IFOA 3A21A 4XAGA 2QMJA 1XCWA 3DOPA 4IXXA 3LM7A 4KT2A 4CVWA 3Q2DA 1OFOA 2ZUSA 1A4MA 3CL8A 4G7FA 1SZEA 1Q7QA 2FPTA 3W88A 1KTCA 3O63A 4O11A 4KCWA 3CS2A 4GYKA 1EC7A 1RHCA 3MDUA 3RLUA 3A47A 3SUWA 2G8ZA 2V3EA 4J35A 1TRIA 5FJTA 4PRRA 3RLGA 3GZ3A 3S5NA 4F66A 2WC3A 2E8ZA 3B9NA 1L8NA 3RLVA 1R0MA 2DZUA 3L4UA 4IMEA 1S3TC 4FR1A 4LYRA 1YLVA 1BKHA 4AEEA 2I17A 2RDWA 3UETA 3AWOA 2A7NA 3BW2A 3HQNA 3T09A 1VRXA 1QOXA 2QGHA 1XLEA 4GI4A 1O5XA 2V63A 2OLAA 4M29A 1MVYA 3N2BA 3H2CA 4WGHA 4F0MA 4LV9A 1LUCB 3UFYA 4KESA 3QR3A 3NUKA 4ERGA 2FQIA 4RZ6A 5AC6A 3ZLHA 1TIWA 2QAFA 1E9LA 4UQEA 4GY1A 2FHBA 4JS3A 4MTVA 4Y8EA 1MI3A 2ZZ1A 4A3UA 4E8GA 4QJ4B 2FJUB 3F4CA 2ISDA 3RNDA 2CERA 1J6PA 1UKSA 4AW7A 1O95A 1GOWA 3DHFA 4DJFA 2DEPA 3TK7A 5HBFA 2INFA 2ZTJA 1IEVA 3MUAA 3RM9A 4W5UA 3QR1A 1DBTA 4US5D 8CGTA 2VMFA 1DQWA 4QM1A 4A3YA 1W9DM 3FV9A 3NA8A 2VZUA 4GJJA 4QITA 3H2EA 1UR3M 3WLLA 3DESA 1P1XA 1PX3A 1J11A 1FOBA 3B0YA 3G1VA 3GDMA 3HZ3A 3NYZA 4GZ7A 1FWFC 2Y0FA 5CPLA 1Q4NX 5LXXA 1OIMA 4RLIA 1RPXA 4IIGA 2VX6A 4FXFA 4PCTA 1ICPA 2D2JA 4V27A 1OG0A 2NQLA 3QRHA 4WX2A 1L6SA 2CESA 3F7JA 1SO5A 4GCXA 1G67A 2EJ1A 3RU8X 4H6KA 4QX4A 4LY4A 4JX6A 2DT1A 1IXOA 3DGRA 3WK0A 4CQBA 3GW3A 3OU8A 4LYPA 2WVUA 5FIPA 1DL3A 2E28A 1ZTVA 3H6OA 4FF7A 1KCLA 4ZSUA 3WK2A 5A2CA 4L1XA 4GIAA 1DJGA 4J3UA 1UQYA 1ZRQA 4Z2LA 2WZIA 4H3DA 4I5XA 4AWEA 3UG5A 2FTWA 3W2JA 1H2JA 2WHJA 3N2MA 5A8MA 1WUFA 5FJJA 3L4VA 1LYXA 2XIBA 4ENLA 3CH9A 2DGAA 3QY8A 1ISVA 1IWAA 3XISA 4ERAA 4MFDA 1M1BA 1UQZA 3GD6A 1XLDA 6TAAA 1U83A 4WF7A 1CX9A 4EPBC 1T6MA 4LB3A 1EL3A 2CHNA 1XGDA 1RCQA 2W0UA 1Q6OA 4C6QA 5D2VA 5DT5A 1KFLA 2Y7FA 1H7WA 4HD5A 3PAOA 1XD0A 2PF0A 2YGYA 1W3NA 2FZNA 2C15A 4LAZA 3NWRA 3W37A 1UPPA 2BVDA 4A22A 1GPWA 3TOPA 1BYCA 3E0FA 3RILA 1OX4A 3SY5A 3TQ0A 2Q02A 3G1SA 3T1GA 4GVGA 1IT7A 4QJ5B 3AXXA 3C2EA 1X1OA 2OKOA 2WMKA 4CCEA 5JUVA 4RPPA 3ARXA 1JULA 1Z8AA 2CLKA 1JPIA 2WANA 3CUZA 1R38A 3JW7A 4EPDC 3FLUA 1G7UA 1RBLA 1V3JA 4MFEA 4OBSA 3EEGA 2GQ9A 5LKYA 2G50A 4JIPA 4FXSA 4BA0A 1M41A 3GQYA 4PBGA 5BXSA 4KEZA 3ATYA 3AI0A 1F3WA 5ABTA 4QJ1A 3CIVA 1RALA 1TSIA 6CGTA 3GNDA 4HZ7A 1Z42A 1ZAIA 3LXAA 4ACYA 1CENA 2VX4A 3GUGA 3R89A 5D02A 3BLKA 2NV9A 1F4AA 4JYEA 2NT1A 2ZYFA 3E5PA 3QSRA 1GVEA 3EDKA 1PKNA 1D7KA 2ACSA 2ZA1A 2D2OA 2F2KA 3UWEA 4HP5A 4OTKA 2E09A 4LOCA 1DVJA 2HV5A 4QLKA 3CZEA 3PPHA 3B8IA 4CU7A 4WSHA 1G9HA 3AISA 3GTIA 4PB5A 2O7QA 4L6HA 5DELA 4Q33A 5F4XA 3UWZA 3WLOA 1QNOA 4AISA 1P7TB 1T7LA 1SO4A 1IHIA 3IGHX 3A64A 5HXMA 1KXVA 8RUCA 4BQ2A 2H3DA 3APTA 1F61A 2CU0A 1VBRA 3ZWTA 2J6XA 5GPRA 4I9JA 1FUYA 1W6TA 4Z2KA 1U1HA 1L2UA 3TXZA 5A8QA 1BXCA 3GG0A 1H7NA 3DECA 3SO7A 1E3XA 1B3VA 1PDZA 1OD8A 5K4ZA 1B3ZA 2O7SA 3FY1A 5I00A 4FX7A 3GBEA 1A5OC 2VZTA 4LQ1A 1NQKA 1OFQA 3ID7A 1UZ1A 5LA0A 1JDEA 2AGKA 2ZXAA 4S3KA 3W07A 3CWHA 4I6KA 3RDKA 4UFIA 1XDLA 3LV6A 3FDGA 4YYFA 3EXTA 6XIMA 3KCLA 5D04C 1H5VA 4OUIA 5F4WA 1IQ8A 4Q4QA 3TDFA 3K4AA 1CDGA 1K9FA 3ITGA 2ZUTA 4PMUA 1OFBA 3W1XA 3REQB 3BGAA 4PMQA 3FSTA 2HSAA 1UR4A 1HJSA 2JIWA 3ARRA 3LM3A 3O2LA 1PZ1A 2O0TA 4XZHA 3BL3A 5AZ0A 3GVRA 5TNVA 3WD3A 5I79A 1DWHM 2YCLB 1SU5A 4ZFCA 1VGAA 1JCLA 4XX6A 2XDFA 3M0HA 3W25A 3ITYA 4AAJA 6ALDA 1NWTA 2J74A 3G1XA 3BK0A 5FF3A 2MNRA 1Q8JA 4MWAE 4NQ1A 3UP8A 4IIHA 4LCRA 2FH6A 2ONEA 1PEZA 4LS2A 3AS2A 1AJ2A 3GM8A 4QEHA 2ZKMX 1A5CA 2AAMA 4HNOA 2A3AA 4XZLX 4PE8A 3AMDA 4UUIA 4KPLA 4XZNX 1ISWA 3OG3A 9CGTA 2XSBA 3UJRA 4RDVA 3AMLA 1EJXC 1D3HA 2Y2WA 4AMAA 5TIMA 4LNYA 4I5UA 3TYBA 1ZFJA 3RCMA 2ZX5A 1VJZA 1GHRA 2WK2A 2PAJA 3CJPA 1FY6A 3BLFA 4BI5A 3WX7A 2BB0A 5HJLA 4D6CA 3DFHA 4U33A 2PWHA 1ME8A 3BE7A 1R6WA 4O1DA 3BOLA 3HQ1A 1HO1A 1FWWA 1R47A 4H7ZA 3W26A 2PDLA 3W7GA 7REQB 1UW9A 1TPDA 5BU9A 4KEMA 1JFXA 4WD0A 3D47A 3TC3A 5BOFA 3S2JA 2YB4A 4MKSA 1RCXB 5I3FA 4KWVA 1RY8A 5I03A 3KRZA 3BLPX 4HPGA 5C9ZA 4I7WA 3W7RA 3WLHA 2Q6ZA 3NVDA 4F40A 2POZA 4ZCWA 5FCZA 5JH1A 1BTMA 2FZDA 4UWMA 3MMDA 4MNJA 6REQA 1NELA 3TYEA 3NGJA 3VOCA 1KFWA 1Q6LA 1MWOA 4H9ZA 5A95A 2A0NA 3W81A 2Y61A 1NTHA 3CYJA 4GIRA 2NWRA 1HZYA 3LK6A 1VHCA 4JCMA 1A49A 4GY0A 3KBNA 3T07A 1Q6EA 5J5RA 1F74A 2WM0A 4J5NA 5C54A 1XSJA 4DZHA 3LCHA 1QTWA 3E74A 2H8XA 5BXPA 1IIHA 1TVNA 3CL7A 4EXQA 2DIKA 3GXNA 2V6AA 4URIA 4KS0A 1ADDA 2CC0A 4FOUA 3LQLA 4KGLA 3M07A 3IAPA 1ZHAA 5AHLA 5CZTA 3F4WA 3BJSA 2RFGA 4FP1A 3DEQA 2B7OA 3LI0A 4JCLA 3C6CA 4AZHA 3IIPA 5M2FX 1E4NA 5A5WA 1X39A 1Q7ZA 1XQLA 1G69A 5G2IA 1A53A 1O4UA 2WMIA 4HU4A 2PURA 3LS9A 3KOFA 4XAPA 4JTRA 1QPNA 2IPJA 3EKLA 3B8VA 2WJEA 1YNPA 3NL5A 4NJIA 5C8BB 4H1ZA 1QHPA 2EAWA 4J4KA 1J12A 2UY5A 2MANA 3UXKA 4HNUA 2AQOA 5L9FA 4JTSA 5A6MA 2VUYA 4RNHA 4LSBA 4KRZA 3CLWA 4IM4A 5T9BG 3R8HA 3WF0A 4IPJA 4EK7A 3CWNA 1JI2A 3Q37A 1ICSA 4Q8QA 1ZAJA 4BJHA 3GVQA 3MYPA 3JRKA 1ZAHA 5D09A 4BQ5A 1V6TA 2ZA3A 1CGUA 3B8SA 1YTEA 4IWWA 2Z2BA 4UBPC 3VGEA 2X41A 3QQ0A 1UD8A 3MBFA 2ZRYA 4J3ZA 2A21A 3VNIA 2DORA 1W3IA 4OOUA 4TQTA 3VNLA 1OB0A 4LPCA 9RUBA 2YIHA 1A5AA 1V6UA 2V3DA 3ABQA 2DFAA 1H09A 3FCPA 4BS0A 2HXTA 3TYDA 3ZJKA 1J5SA 2J79A 2ZDSA 3MU7A 3QR0A 1UZ4A 4J7RA 2VGGA 1VKFA 2Z00A 1OX5A 3LBMA 4DLMA 3ZXWA 4ZXOA 1BHGA 2WM1A 3M4HA 3AIUA 5DMLA 3SCNA 3PG8A 1LRTA 2BY3A 3AO0A 3N2TA 1MO0A 4HNNA 4KH2A 5BZAA 1W8SA 3HJEA 4O15A 4PUJA 3A4AA 4ORMA 3LDVA 4YYCA 2XH0A 2XGZA 2G3IA 3QBUA 4RNFA 4LBRA 2EPKX 4LNCA 3WQVA 4B2DA 1S3HA 2A1YA 4ZQCA 1U33A 2PLCA 4UTFA 5G4EA 1NDYA 3BLEA 4XKYA 2Z25A 2C79A 4EAMA 3G0XA 3AICA 3GR7A 1TPEA 3HQPA 1V02E 4NJGA 3P60A 2WWDA 1K6WA 1RPKA 1QXLA 2ABBA 3RIKA 4FO4A 1C29A 2PFHA 4LY8A 1ENUA 4QG9A 3FX4A 5BWAA 2J27A 3GHTA 4LUTA 5HWJA 5C7HA 2ADAA 1GZGA 3LHUA 1XIBA 2VUNA 4YS1A 1M7JA 2QPSA 4IZGA 1UZDA 3QOKA 3FGCA 1XRFA 1GVFA 2XSXA 4NI3A 4NZ4A 5XIMA 4BF9A 1GUVA 1VH7A 2XVGA 1BGAA 3TJXA 4XUYA 1J6OA 5I24A 1M3UA 1Q63A 1K6AA 3P6LA 3SECA 3Q65A 1EF2A 2CKRA 3NZQA 4M1BA 1MDRA 2NSXA 1T99A 1HJUA 4E3TA 3ARWA 1CB2A 4S3BA 1IGWA 5A6AA 3URBA 3BVJA 3PB0A 1AJ0A 6XIAA 2AOSA 2UV8G 1N8IA 4N6FA 1V6YA 2RGLA 4V2XA 1ODUA 2Y5EA 2Y89A 2QKFA 2G3NA 3CV7A 2V68A 1JR1A 2PC8A 3YPIA 2F38A 3MY9A 4REQB 4QE4A 2J88A 2EG6A 2CHOA 1TV3A 3EB2A 1DE6A 4L4PA 4UTJA 3LA4A 4ZO9A 3M46A 3CO8A 4JX4A 1RQBA 3VKAA 2HROA 3CUIA 3NVTA 3N2XA 1NF7A 1PXGA 2PDCA 3QLLA 4QGCA 4GFIA 1IR1A 2Z7GA 1MFUA 3WQCA 3TTYA 5FEPA 3G1FA 2NUXA 2X30A 3SRHA 3ARUA 2PODA 2H9AB 2W9MA 2E6DA 4F3HA 3OZMA 4OKDA 4TX9A 5BOOA 3LNMA 2WPBA 3OBAA 1Z69A 4PTXA 4CUCA 5F4SA 3UZXA 2IQ0A 3NNTA 3SSZA 1JCMP 4UTUA 3PBUA 1E72M 4CNNA 2VFGA 2OB3A 4JTFA 2CBVA 3DCPA 3LCLA 1MSSA 3NYDA 4MZ8A 1T8XA 3WDQA 2PP0A 4IMCA 2QUTA 4IGMA 1KXTA 4D6FA 3E5BA 3LD5A 4RUBA 2I56A 3W1UA 4QJ3B 3S1WA 2AMGA 3C5QA 4GPNA 4GWEA 5JQ9A 1BWLA 4DELA 4HNLA 3S2LA 2TPSA 1LQ2A 1OSEA 4W86A 1QPOA 3UWYA 1E73M 3UWWA 3W6YA 2PRHA 4AWTA 3CM4A 4W8BA 4B15A 2OELA 1JZ2A 2XISA 1EZWA 2BXYA 1E70M 2NZLA 2QF7A 1S5WA 1ZBWA 1R87A 3UCCA 1SFTA 3R58A 5J8LA 2BLEA 1HG3A 2OFJA 3WH6A 2DVTA 3SR7A 4W9TA 1ML1A 1F3TA 3KDOA 3BW3A 3ZR6A 1BQGA 4UFLA 5IDIA 5A8PA 4AD4A 1CXLA 1XG4A 4M56A 3VNYA 4CQCA 4BEUA 1NDZA 1V08A 1ZQ5A 1OT1A 2GJRA 2OEKA 1A80A 2D3LA 2QUVA 4CD5A 5AC5A 2R1LA 3SCWA 3KDNA 3WJXA 2GSJA 3EA1A 4LVAA 4MKVA 3EDDA 3MW7A 3W01A 1O60A 4JDBA 1Y65A 3W6LA 5IM51 2ZA2A 5LHEA 5HK4A 1NP0A 5IBXA 3CXOA 4TOQA 3LV5A 5DQPA 2DT3A 2UZ9A 4DI9A 3W53A 5AHEA 1EC8A 5B80A 3R8GA 2OOFA 4YN5A 1P43A 3KWXA 2JKEA 2B31A 2C1IA 4QSFA 2V3GA 5A2BA 5D30A 3M0MA 4N9BA 1TQXA 2BY2A 1E1FA 1KBKA 1J10A 4L56A 2TRSA 2YXXA 2E9MA 2Z0IA 2X2GA 1VYRA 1S2UA 3NPUA 5LNWA 3NSXA 3ZIZA 4F9DA 4KRTA 1JZ5A 3M0XA 3NTYA 4NJKA 4MB5A 1U5HA 1FWRA 2GDUA 3HV8A 5F2GA 3MCNA 4RZBA 4ZE4A 2P50A 2OQHA 3C86A 3LOTA 2ZWZA 1XLMA 3SDOA 2CXGA 4XVDA 2BY1A 4OBRA 1CGYA 3NQVA 1AH0A 5CXPA 3IK4A 3EWCA 1KFKA 3E2RA 3HU7A 2WWCA 3GNOA 3C0JA 3PFMA 2WSRA 3OLIA 4JKKA 2OX4A 4MYXA 2QQ6A 3VC6A 3W23A 4HNCA 5AYXA 4AFYA 3ITTA 5EYWA 3B4UA 4C1NB 4WJXA 1OC7A 1WNOA 3TR9A 1VFUA 4K7YA 4M81A 3W82A 4GLEA 5CQ1A 4ERIA 4NI8A 4IP7A 1VYPX 1EHAA 1FA2A 2Z1XA 3EYPA 3WBAA 2C3ZA 1OIFA 2ISFA 3UEQA 3GNXA 4C6CA 4UTLA 4XIMA 3L5LA 4ZZ9A 2WLYA 2J66A 1QOPA 4AXKA 2Z1SA 3MQTA 1E1CB 4WSJA 1IEIA 7TIMA 4YNGA 1YMYA 4OWGA 1FBAA 3KBSA 3U0HA 4Z1CA 5M17A 1US0A 3UVAA 4E2VA 5A1AA 4S1FA 1ZLPA 2X7VA 5D9OA 1TJ2A 3N6JA 2POTA 1V7YA 4R27A 1GG1A 1FWDC 5BYWA 2J7BA 1BYDA 4HCLA 5JMUA 2GOUA 2KX9A 4YVPA 2VD8A 3PJTA 2D3NA 4NG3A 4HOXA 3GVGA 5DCBA 1NP2A 3TZNA 2F6KA 2JALA 5LYRA 3UZZA 3SSJA 5AHFA 3Q94A 2DZVA 2WSQA 1Q2SA 1P4CA 1S5NA 1UWRA 2OODA 4XKMA 5T8GA 3SJ3A 2AKZA 2Z29A 4Y9AA 3VD7A 1EOMA 3WMLA 4DYJA 2MUCA 1OJXA 4GBUA 1QK0A 3VE7A 1NU5A 5D4YA 3M5XA 4GXPA 3WG6A 2DQXA 1MW0A 4HJWA 3G3DA 3GBDA 4OOZA 5AC7A 3PWGA 4AEFA 3L4YA 4GFSA 3TSDA 3TU9A 1XPGA 5LNVA 4N0RA 4B9ZA 2BODX 5IBXC 3BV7A 1B4EA 3BG3A 3IAQA 1EP1A 4C1LA 3AZTA 2YSWA 1QI5A 4C6PA 1QJWA 5CPMA 3QV7A 4CNOA 2D0FA 5ABFB 2VCCA 4XD6A 4ACZA 3GVWA 1Q6RA 4B5UA 1KQYA 3JUGA 2PU0A 3CUXA 4ADUA 1BXBA 4O14A 4NZ5A 2WZMA 4RR4A 2WV8A 2ACRA 1JUKA 1JCNA 1H5YA 2ISWA 4S3EA 4KCUA 2YLAA 5FJUA 3S1VA 3V16A 2XN0A 4JHMA 4DNMA 2VNCA 1GK8A 5C71A 1AK5A 3C0QA 4LAOA 4O1AA 5JIPA 2HWGA 5HWMA 2E9BA 2G0WA 4PUEA 4OE7A 4GX8A 5CPNA 3N17A 2PCEA 4UZUA 4S3DA 1M68A 2PA6A 1CB7B 4DF1A 1R86A 1C7TA 2VFDA 2A6NA 5JVLA 4NJJA 2OO6A 3CTLA 4ZOAA 3FN9A 1WDRA 1ZJIA 4FNTA 1V77A 4UTWC 3EEZA 1SYTA 4DZAA 3RHGA 3FHQA 1SR0A 3EWXA 3HJZA 4DUVA 1E71M 3EZ4A 3B8TA 3CZKA 5A2AA 2OGJA 1J4EA 1OC5A 1EJUC 3EKZA 4KFOA 1Y5WA 3VAVA 3HFYA 2VWTA 4N42A 5LIYX 1CLKA 2WW5A 5C0QA 4L6OA 3KRBA 2OMAA 3LPOA 3GNNA 1H7OA 3UXLA 1CXEA 5JBDA 2AL2B 4XAFA 1NOUA 3TYUA 1QAPA 3M0KA 5C2XA 1MNSA 4L4MA 3ZT7A 4DWSD 1ECEA 1MRAA 4NNCA 1VBGA 2FVLA 1GWJA 4UR9A 3TONA 4NZ1A 1OC6A 2G97A 1JXKA 4HU0A 1V79A 1TV2A 3L2IA 3P8IA 1F76A 3TJLA 4ATDA 1DOSA 4HJFA 4EACA 5FJRA 1XX1A 3GH7A 3T55A 1TWDA 1FWGC 1JZ7A 3OVGA 4FOKA 1PX8A 4P7LA 3SQMA 3WQFA 1GJWA 2ACQA 1DWJM 4D6EA 3FAXA 3P3BA 4GIEA 1SZGA 1SJBA 2C7FA 4AB4A 3MKKA 4GMEA 3I68A 3BJTA 3L66A 2EQDA 4B3KA