1EDTA

Crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (glucosidase)
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H
publication title Crystal structure of endo-beta-N-acetylglucosaminidase H at 1.9 A resolution: active-site geometry and substrate recognition.
pubmed doi rcsb
source organism Streptomyces plicatus
total genus 88
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edtA00
1EGZA 1H5VA 2PB1A 4YN5A 4HA4A 1CYGA 1HF6A 2C7FA 2WC7A 2VQUA 1GJUA 2FHCA 2OWXA 3A4XA 2CHNA 3W28A 1EA9C 1VFOA 2XM1A 3POCA 1J0KA 2Y24A 5LYRA 3VIOA 4H7VA 3A4WA 4CD6A 1QOXA 4M80A 2X09A 4IPNB 1SFSA 3OA5A 3QHNA 1PPIA 2ZUUA 3MSGA 4UCFA 5ABFB 2A3HA 2W62A 2JALA 1VEOA 4CUCA 4Z2LA 2YDRA 5HDRA 4W93A 1E73M 4AZ7A 1W9BM 3CUHA 2YDSA 1J9YA 3AZRA 4MB3A 3WNMA 2WAGA 3GTNA 2WKGA 3RM4A 3WF3A 3RDKA 4ZXOA 4XV0A 2BHZA 1JNEA 3PZ9A 4K68A 3SCNA 3ARZA 3GZAA 4CVWA 3CO4A 1E55A 1G01A 3FXYA 4OOUA 1V02E 2YL9A 3VPLA 2W92A 1EXPA 1V6WA 4GI9A 3U7BA 2OSWA 1M03A 1XCWA 2IUZA 1UHVA 1D7FA 1TZ7A 2YBTA 3AIWA 1E70M 1J0YA 1ZJAA 1NOFA 4N0RA 3NIYA 3VIGA 1WB0A 1UR9A 1D2KA 1ITCA 3BSHA 4P7RA 3BAKA 3PBGA 2PWHA 1MFVA 1E9LA 4WF7A 4A4AA 2O9OA 5BRQA 7CGTA 3A6OA 2CBJA 3PZMA 5DT7A 1C8XA 1LL4A 2XVGA 2WM0A 3SCSA 3ZR6A 2FH6A 4D1JA 1ZBWA 3ARWA 2EPMX 4TVDA 2EPNA 3WDRA 1MVYA 4FLRA 4MTVA 2EPKX 2WLZA 1V0LA 2XHYA 4NSBA 4C7GA 2TAAA 1K9DA 2NSXA 2PWFA 5BCAA 4B9ZA 4U33A 3WNOA 2XM2A 3WDHA 1M04A 3ZQ9A 1LJYA 4GZIA 1KCLA 4AD5A 4CU7A 3WD3A 1JZ4A 5IHSA 3K1DA 2YLLA 4LYPA 1K9FA 1MW1A 4HOWA 1VIWA 3K4AA 2J25A 4B9YA 2J7EA 1CDGA 3PZQA 5A8MA 3SUVA 2ZICA 1V3JA 4P7NA 3CHCA 3B9DA 2X05A 1UKOA 3WMBA 1XH2A 4FLOA 5CPQA 1C7SA 4GPNA 4CU6A 3U7VA 4JAWA 3B9EA 3O2LA 2G3JA 4CCEA 8A3HA 1KXVA 1JGIA 1E5NA 3ZMRA 1X1NA 3CZKA 2VRKA 4GZEA 4TVUA 2ZUMA 3MMUA 3WF2A 4B16A 2Z1KA 3LPFA 2E8ZA 2ZXDA 3WD1A 5A6JA 1WDRA 1R87A 4BCEA 3EDJA 2ZXBA 3L4TA 1V03A 1JDCA 2GVYA 4U3AA 4AXNA 1VJZA 4AW7A 5LA0A 4S3KA 4PTXA 1GJWA 2A3EA 1XSIA 5ABGA 1J12A 3TP4A 4BQ5A 4LPCA 4W88A 1QPKA 5BXTA 1W2VA 2C0HA 4RE4A 3GDBA 3K8KA 4V27A 3FHQA 1ZS2A 3WUEA 1BGGA 2E40A 2J47A 4HMEA 4AD2A 4D6JA 3ALFA 3ZJ7A 1Q6DA 3AMKA 4W85A 2JF7A 1GHSA 4PSPA 4ZXLA 3RJYA 3BAIA 2O9RA 4KGJA 2DSZA 2Y4SA 1JZ8A 1EHAA 4DWSC 1GQLA 3I3EA 2VZUA 5HPCA 3GNPA 3QGVA 4YPJA 1GQKA 4TXEA 5A8OA 1GQJA 1KXTA 4OBSA 1FHDA 4OIFA 4UOZA 3DECA 2A3BA 2D24A 3VNZA 1L0PA 1PIGA 1GOIA 1H11A 3EDKA 3WH8A 4PMOA 5A8QA 5I2UA 5E0FA 1JZ5A 2CPUA 2WMIB 5FOOA 3MUY1 1MWOA 3AMLA 1V3HA 1AMYA 3VMOA 4HU8A 3OG2A 4QDMA 1J01A 1OIFA 4CD5A 1KCKA 2DT1A 3AZSA 5DT5A 3RCNA 1QW9A 2CETA 2ZE0A 3AOFA 2WANA 4QLLA 4GZJA 3DHPA 5A6MA 4Z2HA 3W26A 1V08A 3HMCA 1CGUA 1IZJA 2PC8A 4W87A 2X2YA 1HX0A 4FLSA 1PAMA 2JIEA 4FMVA 1V3LA 4DM2A 1JZ2A 5BWFA 3CLWA 3MKKA 3PTMA 1UWRA 2A3AA 4HOXA 2BXZA 3K8MA 1K9TA 3WD0A 4H8HA 4QP0A 4OKDA 5M5DA 1TA3B 1W3KA 5A3HA 1LG2A 1SYTA 4JKLA 4CKQA 1B31A 1BYAA 2JFEX 2AMGA 3KZSA 4MNLA 1CXLA 4YHEA 3BGAA 1H41A 3VIFA 3WDQA 2X0HA 1C8QA 1TE1A 4LXFA 1QNQA 1JXKA 2XSAA 1UR4A 2BHYA 1GCYA 4E8CA 4AZIA 1ESWA 4D71A 3AZTA 3SIMA 5CPSA 2E9MA 1OT1A 1BYDA 3VIPA 2VX5A 5CXPA 1UYQA 1W3JA 4NI3A 3GYCA 1BVNP 2VO5A 3DC0A 4M8UA 3DYMA 1QNSA 1QHOA 3VIHA 2BVTA 4W86A 2CHOA 3GNOA 1J10A 2VJXA 1BYCA 1UD3A 5E6YA 3G6LA 4W7UA 3RO8A 4QLKA 3TTSA 3MUZ1 1E4NA 4TTUA 4HP5A 1CXEA 4OJYA 4PMQA 1FHLA 5JIWA 1KBBA 4GI6A 1H49A 8CGTA 4DM1A 4N42A 2IXUA 5A6KA 1JAKA 1XGZA 2F2HA 4OZOA 5ABHA 3LMYA 3T09A 3AROA 3N11A 5E9AA 1BHGA 3T0AA 2CNCA 1GW1A 1RP8A 4JFSA 1C8YA 3KL0A 4AY1A 3VILA 3I3DA 3SCOA 2VZVA 1NWTA 4AD1A 1E6NA 1QNPA 2YOCA 1OCQA 1WNOA 3WF0A 2GK1A 2VNCA 1OD8A 1XV8A 4ACZB 4PN2A 2XGBA 1GHRA 1DP0A 3IK2A 1KWKA 1JD9A 3VM7A 2YA2A 3WF1A 2ZX8A 3A3HA 1MQQA 4AMCA 3VD4A 7A3HA 1EDGA 1AQ0A 1OM0A 5I3DA 2PBOA 2AAAA 1E3ZA 1CLXA 1CEOA 3GH4A 3WUFA 2D23A 1V3KA 3BLKA 2GUYA 2C8NA 3K4DA 2VI0A 2ZIDA 1R8LA 4PMVA 3OGRA 4WSKA 2WVSA 3UCQA 1D3CA 4MDOA 3MV11 1WE5A 1CENA 4JFWA 3POHA 3WDJA 4JL2A 3SUSA 2WMIA 4WKFA 4UQCA 1E0WA 2BV9A 2AOSA 3RILA 4YHGA 1E6RA 4AZGA 3VD7A 1QHZA 1UZ4A 2YL5A 3WBAA 1MQRA 2DT3A 3WDPP 3K46A 3CUGA 2QMKA 3M46A 1OBAA 2XPKA 1UD5A 2X8RA 3NUKA 5DMYA 1C91A 2XFYA 4GQRA 4DUWA 1BAGA 3KWXA 4F9DA 2ZUTA 1R7AA 1WZLA 2WHLA 4CU8A 2QPSA 1UR0A 1W1TA 4ML4A 5D8ZA 2WSPA 4C7FA 2DSWA 1B0IA 1QI5A 3KL5A 1VBUA 4RE2A 2ZXQA 4AZ5A 5IFTA 1CXKA 1WDSA 4WJXA 1JFXA 2CESA 4CCCA 1FP8A 1BG4A 3DYPA 1VF8A 4QFUA 1Q6FA 1TFVA 1WZKA 4U2YA 4DWSB 3VU2A 3MSDA 1ECEA 1H1NA 3IAPA 4X0NA 1C3FA 4UFIA 1MW3A 2DH3A 4UQDA 1IV8A 2XWDA 1E43A 5AYIA 5BROA 1VFFA 2J62A 3K8LA 4EK7A 3LPPA 5FL0A 3AIBA 4HA1A 1HL9A 2ZUVA 1GVYA 4B3LA 4J28A 1PX8A 1H4PA 3U5YA 3WQ8A 5A8PA 2D22A 3N15A 5E6ZA 2XVNA 1CTNA 5TD4A 4AC1X 4MB1A 5IXEA 3ZT6A 3O9NA 3PHAA 1CXIA 1V0NA 4CCDA 3ARUA 3BAJA 1B30A 1TCMA 2X0YA 2CXGA 4KRTA 3VX0A 2VR4A 5DO8A 2Z1SA 2VOTA 1UWSA 1B2YA 4S3JA 3RMEA 3EBVA 4U31A 4TX8A 2FGLA 1SMAA 2PWDA 3KEHA 2J78A 4AEEA 1SMDA 1SR0A 2VZOA 4FLQA 2GJXA 1W9UA 4P8XA 2ZX6A 5GNXA 1AQMA 1V6XA 1E15A 5CGTA 5I78A 1VB9A 3WF4A 4AZHA 2DQXA 4W5UA 3B9AA 2VT0A 2V3DA 2HISA 1WP6A 4JFVA 3WMCA 2WWDA 3EYPA 3WENA 3NDYA 3N17A 4F9JA 4AD4A 3BAXA 5AC5A 2GDVA 2E0PA 2VCCA 5A6BA 1CLVA 4D6CA 1CGWA 4HA3A 4MPKA 4W8LA 2IXVA 1E1FA 1NWRA 1UZ1A 4JFTA 2FH8A 3VMPA 3ZR5A 5M03A 4XZBA 2WBKA 4ACZA 4CD4A 3ZOAA 4W8AA 2WVVA 2V38A 1BQCA 3ZJKA 3W24A 3UG4A 4PUDA 1UA7A 4HZ8A 4DUXA 3ALGA 2CKSA 2ZXAA 3D3AA 5IHRA 3MANA 1HKMA 3OGVA 1MFUA 3WKZA 1BPLB 1HJSA 1QNOA 1MQPA 1QBAA 4GO8A 2CCRA 4HZ7A 5BRPA 1V3MA 4GO9A 3VX1A 2HVMA 4LQ1A 4AIUA 2WHMA 3GXFA 5GNYA 2WZIA 2XJ7A 2GJRA 3BH4A 3IJ8A 3HJEA 4RE3A 1BSIA 1PEZA 5HPOA 4D1IA 2J7GA 2JEPA 2DT2A 1GPFA 1UR8A 1X6NA 1XSKA 3WNNA 2XVKA 5LA1A 1EDTA 2XWEA 1QHPA 5D9MA 4UFLA 1WKYA 3OB8A 3WH5A 2DH2A 3ARXA 1NWUA 4IPLA 4H04A 1B9ZA 4MADA 4KH2A 2V3EA 1XC6A 1HIZA 4GXPA 3AI0A 1LWJA 1JF6A 4TVCA 5F7UA 1JNDA 4BQ4A 1WPCA 2O9PA 2G41A 3G6MA 1J0JA 2J7CA 1E6ZA 2GJPA 1WO2A 4DUVA 3ARPA 3KL3A 4OOZA 1W1PA 1XH0A 3F5LA 2WBGA 4WK9A 1DWAM 2OYMA 1XD0A 2EQDA 1LL7A 3ARVA 3SCUA 4BQ2A 4D72A 1B1YA 3RJXA 4WLCA 1QW8A 2UY4A 4M81A 2CIPA 3W81A 4IM4A 4Y7EA 1UD2A 4DWSA 2GFTA 3PZNA 2WVTA 2VCAA 1HXJA 5CSYA 3AIEA 3M07A 3DYOA 1E0XA 3FAXA 3EMCA 3W53A 1KR0A 2OSYA 2YLAA 1JIBA 2WMJA 1W9PA 3EDDA 1C7TA 2VCBA 1F4HA 5E70A 4L4OA 2DPEA 1PX3A 2V5DA 2W61A 3VOCA 1EOMA 3CUJA 1WDPA 4H2CA 2NW0A 1KGUA 4WKAA 4F66A 1US3A 3BSGA 3L4UA 1EH9A 4IUGA 5CG0A 4QLJA 5JUVA 1RPKA 3OLGA 5AC4A 1H0GA 1JDAA 2QPUA 1JZ3A 3ARQA 4NZCA 2BY2A 2WK2A 3GNRA 4J3SA 4AYSA 3CZ8A 3GBEA 1CBGA 1ISWA 3ARSA 3T2QA 3VINA 2YJQA 3ECQA 3ARRA 3SURA 1ISXA 1V3IA 3FHAA 3II1A 5GNZA 4PTVA 1UWUA 1CZ1A 3TTYA 1VJSA 1TMQA 3PN8A 4M1RA 2UY3A 4OBRA 3VIMA 1UD4A 3OLIA 2EBNA 4BA0A 5ABFA 2ZOXA 1Z32X 2D3NA 3L4WA 3AHXA 3CBWA 4ATDA 1QI2A 2PF0A 4KGLA 5CLTA 1EOKA 4U3CA 4E2OA 3CPUA 3BCDA 3WFZA 4MAVA 3CZJA 5D8WA 1H09A 2E9LA 4P7QA 1YHTA 3VTRA 4AZCB 1K6AA 4MAZA 2J7HA 2XIIA 5EFFA 2VL4A 3WL1A 2W67A 4C7DA 1W3LA 1CWYA 1NP0A 5D9OA 5DF0A 4AD3A 2D0FA 4ACYA 4W7WA 1BLIA 4H41A 1E6XM 1NQ6A 3AS3A 2A3CA 3NCOA 3CH9A 2PWGA 1UH3A 2QF8A 4L4PA 1BF2A 1H2JA 2EO7A 1ISZA 4JHOA 2D2OA 3VGFA 3FW6A 2WWCA 1NARA 2DEPA 3AISA 4JFUA 4MB4A 4CD7A 1LWHA 5E09A 4UQBA 1CIUA 1EO5A 4M56A 4AWEA 1JFHA 3GH5A 1TUXA 1YQ2A 4R27A 5I23A 2CEQA 2YKKA 1GOWA 1B3VA 3WEOA 3VDCA 1AQHA 5A1AA 4W5ZA 2G3IA 1E6QM 4UQ9A 4J3TA 3QOMA 2GDUA 2W4XA 1ODUA 3SCTA 1GUVA 3BLPX 1CXFA 4ATWA 2BY0A 5A2AA 1MXGA 4TX6A 2XUCA 4E8DA 3WEMA 1B3XA 1NOWA 1ZBKA 2FGZA 3PTQA 3UERA 3UG5A 3W29A 5JBFA 3WSUA 2BS9A 2WSKA 2G4FA 3L4YA 2XYLA 3BXWA 5LA2A 1DTUA 5GQBA 1JZ7A 1WAWA 2D1ZA 2OSXA 5DEZA 2XFFA 3MS8A 1JL8A 3NSXA 1P6WA 3T2OA 1OGSA 2WVUA 1BG9A 3VIIA 1GONA 3WBEA 4UFHA 4D6EA 4D6HA 3AJ7A 3L2MA 2RGMA 3ZO9A 1HP4A 3S6TA 3PZGA 3UETA 3AIQA 3PZVA 4U2ZA 3J7HA 5EMYA 1RD6A 4MNMA 1W9XA 1UUQA 3QHOA 3GXIA 1PIFA 2FHBA 3WQ6A 3ZSSA 3T0DA 1UD6A 3AMDA 2WZEA 5DFAA 2EPLX 2J7FA 2YBUA 1G94A 1OT2A 1L8NA 4PCTA 4BF7A 4IISA 1VENA 1V02A 1W32A 2UY5A 3WN6A 2ZUWA 1LF1A 3VGEA 3MMWA 2YA1A 1GZJA 7TAAA 2J79A 3W37A 4EE9A 1V6VA 4JL1A 3VKKA 2VURA 1UH4A 1CGVA 9CGTA 2RGLA 3SEPA 1NWSA 2CBUA 3PZTA 1UWTA 2W63A 1KQZA 4XUYA 2J7DA 4A3HA 4ZE4A 4URIA 1WDQA 2YL6A 1GOMA 1R7OA 4PMUA 1GNXA 3T2PA 4TTGA 1W9DM 1BVZA 4MNJA 2OYKA 2WMFA 3ZT7A 1KXQA 3EDFA 3VDBA 1HKJA 1ISVA 4XZWA 1FH7A 3DHUA 1UG6A 1CGTA 2EXOA 1VFMA 1HJWA 3LPGA 1OIMA 1UR2A 4P8VA 2Q8XA 3M6DA 3SCPA 2X1IA 2XVLA 1TVNA 3T08A 1J0IA 2DGAA 3OBAA 1XSJA 1Q6CA 3WUBA 3THCA 1QI4A 1E56A 4KMQA 2VTFA 4PBGA 2WHJA 3BAWA 1UWIA 3AHVA 5I79A 4Q7NA 2XGIA 1EHNA 4E4PA 1NP2A 3L4VA 1UR1A 4NRSA 3CZLA 1WZMA 3VGGA 1TA3A 2J8FA 1OD0A 3B8SA 6CGTA 1H0IA 1U30A 4HMDA 1JI2A 3WQWA 3N1AA 1EQPA 1KWGA 3JUGA 4Z2JA 4RL3A 2JF6A 4W89A 2JIWA 1QBBA 3TTQA 2XG9A 4BS0A 2EPOA 2DSVA 5D9PA 2BVYA 4LX4A 5A69A 1ITXA 3EMZA 2DSUA 2F61A 2QV4A 2CKRA 3UR7A 2DDXA 2D20A 4UFMA 3CUIA 5C8BB 3PZIA 1QI3A 5I6SA 2O92A 4D6GA 5A8NA 1E5JA 2DIEA 3CIVA 3L2LA 1IT0A 2PWEA 5HBFA 2G3MA 1FFQA 3W4RA 5BYWA 3UESA 3QR3A 2QMJA 1KXHA 3I3BA 3CUFA 1A3HA 4FF5A 1V6UA 3AHYA 4CVUA 2ZX9A 1BYBA 2JE8A 5I5RA 3CGTA 1B3WA 6TAAA 2BY3A 3ZIZA 2WKLA 4PSRA 5IFPA 4Q22A 4B3KA 1GVIA 2E9BA 3BMWA 3F4VA 3CHDA 3WQ5A 3WELA 2J75A 3SUTA 1PZ3A 4HU0A 3A47A 2EEXA 4GI8A 4ATLA 1XHGA 3UEQA 4Z2GA 1WCGA 4MNKA 3W6LA 4ZFMA 2BHUA 4J27A 3GXMA 1H3GA 3TTOA 1JYNA 4MJ2A 3KE0A 4D6DA 1J0HA 2NT0A 2QLYA 2DSKA 3LPOA 1DWIM 3IJ7A 4M24A 1HL8A 4PMNA 4GKLA 3FY1A 1E40A 1U33A 1E0VA 1G0CA 2XIBA 1PX4A 3VVGA 4PCSA 4XX6A 3OLEA 2J8GA 4QCEA 1XD1A 4JCLA 1VEMA 3RM9A 2B31A 3BCFA 1ZJBA 1DWGM 1XYZA 3AMCA 2OYLA 1MW0A 4UOJA 1XRVA 2VX6A 4D6IA 1KR1A 2WCAA 2YDQA 2VX7A 1CGXA 2OWWA 2BY1A 1EQCA 1M7XA 2VRJA 3ARTA 5GPRA 5A95A 5JBDA 1BGAA 1JAEA 2WPGA 4AISA 4AZBA 1HVXA 2JEQA 1LQ0A 4PMRA 5A6BD 1J18A 4D6FA 2WYSA 1Q4NX 2WMGA 2G8ZA 1FFRA 5IDIA 3UR8A 4QAWA 1ZU8A 1JZ6A 3RPMA 3IAQA 3WNLA 1HVQA 2ZX7A 1HNYA 2FDMA 4HOZA 2VRQA 1HKKA 4LYQA 3VM5A 4PTMA 5BXRA 1XYFA 1GOOA 4B15A 3AXHA 2WC3A 3S2CA 1UWQA 3E1F1 1JDDA 2ZWYA 4H8UA 4P8UA 1R85A 2CITA 2D3LA 5CLWA 1C90A 1RP9A 3IANA 3SUWA 3WY1A 2YL8A 1PZ2A 4HZ6A 3WH6A 4XB3A 4PTWA 1DHKA 4HTYA 2BFGA 3W0KA 1X6LA 3AHTA 3W25A 1GOQA 3NDZA 2NT1A 3FAWA 3ARYA 5AY7A 4UR9A 1E6SM 2V3FA 5A2CA 1LL6A 1I75A 3T0BA 1O7AA 3WEZA 3NJ3A 4ZENA 4WSJA 3AFBA 4UZSA 1HP5A 2ZUNA 3VUPA 3AS2A 1ZL1A 1DWJM 2ZUSA 1BTCA 1W9VA 2J7BA 1FP9A 1DWHM 3WNKA 2CBVA 3VO0A 3AS0A 2GK1B 3U57A 2WXDM 3WQVA 4PMDA 2XSBA 1ZB5A 5KZ6A 3N13A 1OSEA 5EBAA 1W2PA 2UY2A 3L4XA 3HN3A 2PI6A 1HJXA 1FH8A 2PBGA 5A2BA 3O6AA 1HN1A 1EDQA 3CMJA 5I24A 1TR1A 3AYSA 2V5CA 3MV01 2O9TA 3WD4A 2UWFA 3SCRA 3F5KA 4P7LA 2W91A 1TVPA 3VGHA 4V28A 3VGBA 5HOSA 5I0DA 1HJUA 1GORA 1NM9A 4UZUA 4JKMA 2V3GA 3AIVA 3VGDA 3ZJ8A 4DWSD 3VDHA 4KRUA 5CZKA 4UQAA 5JBEA 4WIWA 4X0VA 4UFKA 1ISYA 3OGSA 2E3ZA 3RIKA 1JF5A 4R5EA 4JKKA 3QHMA 2FHFA 1HJQA 4HPGA 5FD0A 5A6AA 2WHKA 4U5IA 1Q6EA 1JYVA 2Y2WA 1JG9A 3WQ4A 2ESCA 1R86A 4UTFA 4F79A 1KFWA 4AD0A 4AIOA 5KEZA 4NF7A 4TUFA 1QI0A 1RH9A 2DT0A 1ZBCA 4JZ5A 1AVAA 2XFRA 5ABEA 3GBDA 3PZUA 4PUEA 4X9YA 1IZKA 1OINA 3VMNA 1HT6A 4H8VA 4QCFA 1F4AA 4LYRA 1E71M 3FN9A 1G9HA 4J7RA 2WNWA 2E4TA 1W1YA 2XVPA 5D4YA 3TONA 2QHAA 1NH6A 4J3UA 5CPTA 1VAHA 1ODZA 4Z2KA 2F8QA 1UKPA 1B3YA 1VFUA 6A3HA 1UH2A 3OZPA 2WC4A 1XH1A 1EO7A 2G3NA 1OGGA 2VR5A 2XTKA 1OGBA 1ZBVA 4LGXA 2Y5EA 2EJ1A 2WMKA 3AIUA 1M01A 1C92A 1QNRA 1KB3A 3M7SA 4UOQA 3MU7A 1V0MA 1OB0A 1PJ9A 4GQQA 1CNVA 4NRRA 5BXSA 1B90A 1E6PA 3A4AA 2VC9A 3OIHA 5FL1A 3MO4A 5CGMA 4A3YA 1E72M 4J3WA 1W3HA 1B3ZA 1Y7VA 3N9KA 3L4ZA 5FKYA 2MANA 3MUAA 3VD5A 2WB5A 1U2YA 4GINA 4CGTA 5CQ1A 1JXJA 1MYRA 1V6YA 4V2XA 3AYRA 3GM8A 1LG1A 2OWCA 2D0GA 3PTKA 5A94A 1UKQA 1UOKA 1EIBA 3N04A 3CZEA 3VIJA 1KQYA 1W91A 4JIEA 3WUGA 1OWQA 2WZHA 1PBGA 4PRWA 2GJXB 5I77A 5CSUA 2BNJA 5CJ5A 5ECUA 1VEPA 1QVBA 3ZM8A 4PEEA 3EDEA 4TOQA 3IJ9A 1KGWA 2WCGA 2J77A 1G5AA 3CMGA 3AS1A 3CHFA 4KWUA 5C71A 1J11A 4FK9A 1LLOA 4MB5A 3MMDA 3WD2A 5A6LA 3WFLA 1Q6GA 3F5JA 1NOUA 3TA9A 2Y8VA 4W7VA 1W1VA 3ZSTA 3ZJ6A 3AXXA 2VQTA 2VZTA 2ZWZA 5EFDA 4P7OA 4ZEPA 2WVVB 3WIJA 2OLHA 1CXHA 2ZX5A 3N18A 2VX4A 3OLDA 3SCVA 1G1YA 1DWFM 2WLYA 1CECA 4EANA 1MXDA 5M17A 4ZE5A 3VNYA 1UQYA 3VIKA 1JI1A 1JYWA 2WCSA 4CN6A 5FCZA 3BC9A 1FH9A 4BQ3A 5A6SA 4W8BA 2BVDA 4M29A 1C93A 3PZOA 3CHEA 4GIAA 3W27A 1E4LA 1BFNA 3AQUA 3HU7A 5JIPA 3WL0A 4JHZA 4M82A 3VD3A 4AEFA 3AXIA 1UA3A 1WZAA 1GOKA 1TG7A 2W66A 2YA0A 1E4MM 2CYGA 1E1EA 1VBRA 2VVSA 4CN4A 3QOKA 1US2A 3FNDA 3NSNA 3MUIA 1KGXA 4OUEA 2CBIA 5FIPA 3NSMA 2BXYA 3D5HA 1UD8A 1DEDA 4PMZA 4UQEA 2VMFA 2VVNA 3VDAA 1O6IA 3ZT5A 5M3WA 2YIHA 1FA2A 2Y8KA 2DIJA 1E3XA 3NYDA 3TOPA 1MW2A 4AIEA 1FOBA 3WMSA 1HJVA 5D9NA 4AZCA 1UKSA 3EMQA 1GQIA 1N82A 4F8XA 3N12A 4PMXA 1VRXA 1K9EA 3WNPA 5BXPA 3BMVA 2GSJA 3WDIA 1UKTA 4AZ6A 4HPHA 3OZOA 2CERA 3APGA 1I1WA 4PMYA 4P8WA 2J74A 1E4IA 4W84A 1A47A 3AMGA 3W82A 1M53A 3AICA 3W38A 2J4GA 4HMCA 4UNIA 3CZGA 3UG3A 3BAYA 3WH7A 3THDA 2WMHA 1JD7A 4WKHA 4CD8A 4JCMA 3CTTA 4PYSA 1CGYA 2E8YA 2D0HA 2W5FA 4U5KA 1J0ZA 4MDPA 4BZYA 1I1XA 3GH7A 2WW5A 4EKJA 4J3VA 3WH9A 1KBKA 5E0CA 1S46A 1UQZA 4Z2IA 3W6MA 3SCWA 5EB8A 1CPUA 4J3XA 1JYXA 3AIRA 1XCXA 3SCQA 5AYBA 2VZSA 3AHZA 4MJ4A 4CN1A 1HKIA 5HNNA 3VD9A 3RM8A 3SUUA 5HXMA 1V0KA 3U5UA 2VUYA 5C70A 4UFJA 3GXDA 4EAMA
chains in the Genus database with same CATH superfamily
3U2OA 4XO7A 4HSHA 4B4HA 2PCQA 1K4GA 1HF6A 1Q3NA 2WC7A 4QJ3B 5HUPA 3VOJA 3CIXA 4O1FA 4LH8A 3HPFA 1XIHA 3O06A 3POCA 2Y24A 4DJEA 5H2ZA 1YLVA 5FJPA 3VIOA 3RITA 4AQLA 4IPNB 5CKSA 1SFSA 2OEMA 4JTHA 4UCFA 3MSGA 4JQAA 1VEOA 3KDNA 5HDRA 3LDVA 1FXPA 5AC6A 1RY8A 4R7WA 1XGDA 2WAGA 2RAGA 2DVUA 1JNEA 4B91A 3SN1A 1H7RA 2XH4A 3VPLA 4ROPA 3VKDA 1EXPA 1M03A 3LEPA 1D7FA 2YBTA 3LI1A 1E70M 5C2CA 3CEPA 1D3GA 3FJLA 4HB7A 4UTTA 1B4EA 3NIYA 4HGXA 3VIGA 1WB0A 4H19A 4HVXA 1D2KA 4HNLA 3BSHA 2CZVA 4P7RA 3PBGA 1TPVA 1FWJC 1OY0A 2PWHA 1F6KA 2O4QA 4WF7A 5I06A 5BRQA 2VDHA 4IH3A 2CBJA 2XVGA 1VBGA 4ZCWA 3RNDA 1RLDA 4JD4A 4FXJA 3M5VA 1MVYA 3WCZA 4FLRA 3H54A 2EPKX 2WLZA 1KM0A 1V0LA 3BOFA 4WY0F 2TAAA 2NSXA 4IL2A 3TYDA 4TMBA 1OCBA 1AJ2A 3ZLFA 3NQ8A 5RUBA 1M04A 4NX5A 3R6IA 3WD3A 2V63A 2YLLA 4WEVX 4ZOCA 4HOWA 3W71A 2J25A 1H50A 3GZ3A 1FWBC 2IPFA 4O54A 2CLLA 1RK6A 1QATA 3CHCA 3QSRA 3TW7A 2X05A 1UKOA 2Z24A 5CJNA 4GPNA 5XINA 2YSWA 4JAWA 3B9EA 4JGDA 5I3GA 3O2LA 1L6SA 3VNKA 2BGSA 4TVUA 3MMUA 3WF2A 4JXCA 2E8ZA 3WD1A 4Y6GA 2ACRA 5AHNA 2ZXBA 5C55A 4U3AA 4XAYA 3UP8A 4PTXA 3L0KA 3GTHA 2QT3A 5DMNA 4RNIA 3AU2A 3UYIA 1V93A 3CMFA 1W56A 4AUBA 3MT1A 4BQ5A 4JTSA 1T96A 1QPKA 4RE4A 3MCMA 4PL1A 1ZJHA 3K8KA 2E68A 1ADSA 1YYAA 4V27A 3WUEA 1BGGA 2PD9A 3PFRA 1J8VA 3MI6A 3C4UA 1EEXA 3DFOA 3TSBA 4KGJA 2O9RA 2VDIA 2Y4SA 3TN4A 1JZ8A 4DWSC 3W84A 3DFSA 3I3EA 2VZUA 2YB4A 5TIMA 1QU4A 4TXEA 1XLBA 4HTBA 4OBSA 3B0PA 5DRCA 3TYZA 2A3BA 4J9JA 1L0PA 3A3WA 1KLZA 1V5XA 1M7OA 2V2HA 1H11A 3EDKA 4XZMX 2L5HA 1CB7B 2CPUA 5FOOA 2TODA 4JTUA 4QNWA 1YE6A 4YCPA 3SSZA 4BEUA 3GAKA 3L21A 5DXXA 1V3HA 4JIIX 4QDMA 1KCKA 3AZSA 5DT5A 2PDFA 5EA9A 3M0LA 1UPPA 4AU0A 3UY7A 5A6MA 3N9SA 3HMCA 2PGRA 4G2DA 4UR7A 1HX0A 4XWUA 1GVFA 4FLSA 3HM7A 4ML9A 3SFKA 1EZ2A 4DM2A 4QG8A 3CLWA 4LBUA 3C0SA 4FX7A 3MKKA 2A3AA 1DL3A 2BXZA 3RCYA 2GGHA 3GR8A 3KLKA 5M5DA 4O0KA 1E9ZB 1KRCC 1NFPA 1TWZA 2DP3A 3KZSA 1CXLA 1H41A 1J4EA 1C8QA 1DQUA 1TE1A 2ZC1A 3WJSA 2QCCA 1UUMA 3D0CA 4YWIA 4E8CA 4AZIA 5J5DA 4TV6A 3SIMA 5DN1A 2E9MA 1OT1A 3ZFHA 4L64A 4OBTA 3T4CA 1BVNP 5EMUA 3V0SA 3SIZA 4LS1A 1VPXA 3P3BA 1XDJA 2BVTA 4W86A 3GNOA 5AHMA 1F74A 1UD3A 4IIGA 3G6LA 4BKNA 1SM9A 4ZODA 2WKJA 4C6JA 4O53A 1E4NA 1P0DA 1MRAA 1CXEA 4KT2A 3NXLA 5FSDC 1PZ0A 1D8WA 3LV6A 4DLFA 1H49A 8CGTA 4N42A 1KBLA 2IXUA 4C6MA 1D3HA 5AZ1A 4OZOA 3AROA 2VEPA 3LLXA 1BHGA 4GY0A 2Y5JA 1TRIA 3FKKA 1RP8A 2PDMA 4LNYA 1LCOA 4EPEC 2B4GA 1DTNA 1E6NA 2YOCA 3WJYA 4RDYA 1JUBA 2OT0A 2I5IA 2OU4A 2VNCA 1OD8A 2BOEX 4I9TA 5LXXA 3IRSA 4ACZB 2J27A 1Y8BA 4GNVA 1EYWA 1PB0A 1FKWA 3D46A 1JD9A 1RQEA 1U5HA 2A7PA 3VC5A 5IBXC 3UWQA 1R3VA 1UC4A 3E49A 2YXOA 5T8GA 2QXWA 3ZLHA 1ONRA 2AAAA 5C9XA 3WUFA 3VOFA 1XLMA 3C0JA 3OPSA 2AQOA 2Q3RA 3K4DA 1JULA 2ZIDA 3OGRA 1NFGA 1VIZA 2ZA1A 4GA8A 3UCQA 4FB7A 3RF9A 4QS5A 3W2JA 3N3MA 3SN4A 4EWJA 1S2TA 4Z42C 4UQCA 4J1OA 1IEVA 4IZGA 8TIMA 3LRLA 3GR4A 5IDZA 3VD7A 5D09A 2DJXA 1UZ4A 2YL5A 4GX8A 3Q45A 4XTIA 3K30A 3W02A 3WDPP 2QULA 3M46A 5CEWA 1P5BA 4EIVA 4DPPA 1HQTA 1BAGA 4PUWA 3KWXA 4GVIA 1G69A 2GOKA 4CU8A 2JK2A 1UR0A 4ML4A 1IEWA 3BOXA 3W7HA 4RZ6A 3MA8A 3KL5A 3KRUA 4RE2A 2DZVA 3MKCA 4WJXA 1JFXA 3A23A 4OFCA 4CCCA 2H3DA 3DYPA 1VF8A 1OF8A 1WZKA 4U2YA 2INFA 1V6TA 2W9MA 1DJWA 5DY3A 1YNQA 2X7WA 1C3FA 2DV0A 3GIYA 1MW3A 4UFIA 1LORA 2DH3A 5D2YA 1IV8A 1RBAA 3SBFA 1S2UA 3ITYA 5BROA 4RNJA 4EK7A 5AHIA 5MKGB 4HJWA 4J28A 2Z6JA 1RA0A 5A8PA 2D22A 3N15A 5E6ZA 1CTNA 3RO6A 5XIAA 4MB1A 3NZPA 3IGUA 3O9NA 3PHAA 1JRCA 2O55A 3ARUA 4J3ZA 1B30A 1FX6A 2CXGA 1RCXB 3VX0A 5DO8A 1LQAA 2VOTA 1UWSA 2FTYA 2VHLA 2Z1SA 3ABXA 1VR6A 3RMEA 5BOEA 4U31A 4TX8A 2PDGA 3KEHA 2J78A 2OJPA 1XQLA 4AEEA 2VZOA 2JGYA 1ADOA 4YIWA 3PBWA 3P74A 3SRHA 5KSWA 5I78A 1TQXA 1VB9A 3WF4A 3RLHA 5CC5A 3QC0A 1TJ1A 3O07A 3B9AA 2VT0A 5BU9A 3OYXA 3P81A 4A3RA 3H7VA 4HT3A 3O63A 3W23A 5G4EA 4NZJA 3TU9A 1UCWA 3VABA 2GDVA 2VCCA 4HCDA 1A5AA 1YTEA 4D6CA 3LCFA 2IXVA 4DZAA 3T1GA 3W1TA 3Q4DA 4AB4A 3BLIA 3VMPA 3ZR5A 3S1VA 4NP7A 2ZC8A 4GJ1A 1SJCA 2NVCA 4ACZA 5DMLA 1ZSXA 3QH2A 3R13A 3ZJKA 3EPOA 4PUDA 1TB3A 4AF0B 2FZNA 4DUXA 3CT2A 2CKSA 1WXJA 3WJXA 1FRBA 3CEUA 4FNPA 2P8CA 4JIHA 2QUNA 1BPLB 4DF1A 2FYMA 1ZALA 3LGEA 2I16A 4FNUA 3KX6A 3SGGA 5BRPA 1K7FA 3KM8A 3F4DA 5DCEA 1FWWA 4LT9A 2HVMA 4LUTA 4AIUA 3O0FA 4DJED 1SO4A 5HINA 2WZIA 4LY8A 4HQVA 2GJRA 3BH4A 5DCBA 3HJEA 3L66A 2NXHA 1DJNA 4B5SA 5I02A 5HPOA 4D1IA 3N14A 3BUVA 2DT2A 1GPFA 1X6NA 5FAGA 5LA1A 4PE8A 2Q01A 3CPRA 3SJ3A 3BOLA 3WH5A 1W8SA 1OCJA 3A9BA 4GUJA 1H62A 1XC6A 3AI0A 1LWJA 2GQ8A 4JBRA 5F7UA 1JNDA 3DC8A 4DZHA 4O52A 2TPSA 2PDKA 4GXWA 4ZB2A 4KEZA 3G6MA 4QS6A 1J0JA 2J7CA 4F2TA 1WO2A 1RAKA 3ARPA 4OOZA 2WBGA 1SO6A 3IGXA 3PAJA 1DWAM 2OYMA 4N6FA 4EWND 4ZOEA 2GVGA 3IIVA 1A5SA 4GJJA 4HYRA 3W86A 4D72A 4ZB0A 3DFHA 2A21A 1P7TA 1ZZMA 5TF0A 4DF0A 4IM4A 5C9ZA 4GY1A 3NO1A 4Q33A 1KFBA 3MPGA 4N4QA 2YLAA 2OQHA 3EWDA 1OX5A 1R3TA 2WMJA 1PZ1A 3MO7A 3HGJA 2REQA 5MKGA 4NT0A 2W61A 3VOCA 1EOMA 4H2CA 1M6JA 4ZSUA 4WKAA 3UJFA 5KZMA 4FOUA 2A85A 2W6RA 3DFPA 2P88A 2HSAA 5C9WA 4MPQA 5AC4A 1JDAA 4B2DA 4IP5A 3T40A 4CEXC 2BY2A 2WK2A 3HB9A 3T78A 3CZ8A 1TR9A 3SSJA 1TV8A 2HXUA 2BODX 1XRSA 3ECQA 4C5YA 3ARRA 1KM3A 2Q02A 3OZYA 4PTVA 4HKPA 2NLIA 1RR2A 1TMQA 1A3WA 1W5NA 2FJUB 2UY3A 3M0ZA 4DY1A 2P10A 1X97A 3OLIA 2PZNA 5I3HA 1LTDA 4M7SA 1AK5A 4L65A 2D3NA 1BRLB 3L4WA 4XVDA 4ATDA 3G1FA 5B80A 3HTWA 4E2OA 4LUJA 4JDYA 4ZR8A 1XDMA 3CPUA 3NG3A 2ADAA 2ZZ1A 3VTRA 4AZCB 5ABTA 1K6AA 5CG7A 4BI5A 2ISFA 2XIIA 3M5YA 3P93A 4IICA 3G0UA 3QMSA 3WMLA 3REQB 3P67A 1JRBA 1TZZA 4I7WA 3NPXA 2OG9A 4PODA 1F8MA 3DFNA 4HN8A 3KBVA 2A3CA 3NM3A 1GYMA 2YX0A 3CXOA 2V68A 3UVIA 4BHYA 3H23A 4REQB 4LAOA 4PFMA 2EO7A 4JHOA 1F07A 3B03A 2HE8A 2GJLA 1BWKA 3TSDA 3AISA 5D2VA 2XIQA 4UQBA 2JKAA 2Z4GA 4IPIA 4AWEA 1JFHA 3GH5A 4UMAA 2I57A 4QSHA 2YKKA 3WEOA 3E02A 3GNDA 3VDCA 3H4WA 1UW9A 3QEZA 4W5ZA 5C5YA 3FCPA 3KP1A 4CQDA 3W7NA 3BTNA 1P0NA 3BLPX 1CXFA 1AZ2A 4LFYA 3UWWA 4TX6A 4E8DA 1B3XA 1NOWA 3M0IA 4I5XA 3UERA 2WSKA 2BMBA 3L4YA 1QOPA 3ATZA 3IJIA 3IUHA 3NQBA 1DTUA 1RSCA 1WAWA 3MS8A 3P80A 3AU6A 1T99A 4K37A 1OGSA 1BG9A 1F76A 3WBEA 4UFHA 4D6EA 5HJYA 3EWWA 3ZZ1A 1HL2A 3PZVA 1CW2A 1ICSA 3FSUA 3TLQA 5EMYA 2YCEA 2I17A 3WQEA 1DIEA 4PTDA 2XIMA 2ZDRA 3NYZA 1UD6A 3T0DA 1XS2A 2WZEA 2GUBA 2X16A 5HANA 5DFAA 2EPLX 3CWNA 2YBUA 4KWVA 4IISA 1V02A 3VUSA 2UY5A 3U2EA 3VZYA 2ZUWA 3BLLA 4O17A 2YA1A 3QBUA 1GZJA 3G1HA 4WDWA 4GOAA 4KERA 4EE9A 3W37A 1VFSA 2Z1XA 3H24A 1V6VA 4JL1A 1LZOA 3GFZA 4IMAA 1CGVA 1RY0A 3TKFA 2WQDA 2PURA 2RGLA 1UWTA 1KQZA 3GRIA 4A3HA 4S3GA 3FLUA 4GFIA 3KLLA 2C19A 3NO5A 3MDUA 4S39A 5C9UA 3WLMA 1NFBA 3VK5A 3EDFA 4NNBA 4XZWA 1FH7A 4JHMA 1UG6A 1CGTA 4HSOA 1AL7A 1VFMA 3F03K 3LPGA 2VC5A 3UY8A 1BRLA 2WSYA 3XINA 1TZ9A 3QQWA 2Q8XA 4GCAA 2X1IA 1PCWA 2DGAA 3WUBA 3D6NA 1IT8A 3BZGA 1XBXA 4PBGA 3ANYA 4LV9A 1NP2A 3L4VA 3MSYA 2FFIA 3S5NA 3CZLA 4PBFA 3LTPA 1Y5VA 5HUOA 4K2SA 6CGTA 2WJFA 5I00A 4OQVA 1H0IA 1U30A 2G4JA 4HMDA 1WA3A 1JI2A 3WQWA 1KWGA 3E2SA 3KS6A 3E6EA 1ZJIA 3AYVA 2JF6A 4RL3A 4W89A 3NQFA 2JIWA 1QBBA 2QUVA 2XH7A 2XG9A 1JEZA 4WRHA 1ITXA 4XBJA 2OO6A 3EMZA 4REQA 3RUBL 2DSUA 3OOQA 3FDGA 2QV4A 2CKRA 3UR7A 1Q65A 1UJQA 1QASA 3PZIA 1QI3A 2QCHA 3EOEA 3F2CA 2O92A 5A8NA 2D2JA 3L0GA 1E5JA 4ERIA 1LUCB 3TUUA 3L2LA 1Z48A 3ONBA 3HQOA 3T8QA 3GG1A 3CC1A 3NQMA 3QR3A 3CV2A 3LD5A 1I2QA 4FF5A 4CVUA 3KHDA 1BYBA 2PC4A 1GK8A 1AJ0A 3CGTA 1B3WA 4ORIA 5EY5A 2X41A 3TC3A 4B3KA 1GVIA 4EPKA 1EUNA 3CAWA 3EA1A 2Y70A 3SUTA 2NQ9A 1A5KC 4GI8A 1RXOB 1QXLA 3PG8A 3I7RA 3QZEA 1PVNA 1KBIA 2TMDA 2HVNA 1JR1A 3FJ4A 2BHUA 2ALDA 4DF2A 3RAOA 3EXRA 3ABQA 3CQKA 3TTOA 2F38A 4AVNA 1LT7A 1QRQA 4CNSA 1NEYA 5D38A 2QLYA 4NUWA 3EOSA 1UP3A 3LPOA 1OYCA 4M24A 1HL8A 3RG6A 3IVTA 1GJPA 1PX4A 5G2HA 3UWEA 3VVGA 2J8GA 2XIOA 5LIWX 5K2ZA 3TZFA 1ZJBA 1PL9A 1R3QA 1DWGM 3Q65A 4ICNA 3AMCA 4L61A 4DJEC 2JGQA 3VOGA 2EKCA 2OYLA 3LMZA 2VX6A 1KR1A 2OODA 3OTRA 1CGXA 1FBAA 3NO3A 1UUOA 4HJFA 4KIEA 4CNNA 1WV2A 3NQ6A 5REQB 2RUSA 3OHMB 1JAEA 3M16A 3ORWA 3EOOA 4AISA 4O0QA 4YL2A 3BGGA 1XFCA 4PMRA 1SU5A 1XL9A 3RLVA 4XZ9A 1J18A 4D6FA 3UWUA 3GXPA 2PU1A 1PUDA 1X1ZA 1ZU8A 1JZ6A 3IAQA 3WNLA 1X7IA 2OELA 2ZX7A 7ENLA 1HNYA 2FDMA 4BWLA 3QLLA 1N2VA 1UPMB 4KBXA 2GYIA 4WD0A 5BXRA 4B15A 1A5LC 2OXNA 1P43A 3AXHA 2WC3A 4C6KA 4UTTC 4F2BA 3E1F1 2ZWYA 2CITA 4O50A 3AWOA 1RP9A 4R53A 2ZADA 4ENLA 1PZ2A 4GYFA 3W7PA 3TW9A 4XB3A 2VEIA 3W25A 3E5BA 4AC7C 3NDZA 4IF2A 2PU0A 1A0CA 4UR9A 1TWIA 3KOYA 3JS3A 5A2CA 3NQCA 3WBYA 3E96A 4XAGA 3S4TA 4KWOA 1O7AA 3QV9A 2XH0A 4ZENA 3QY8A 1L8PA 3FGCB 1O95A 3STCA 3W7GA 3TYBA 3VUPA 3AS2A 1ZL1A 3GFYA 2CLOA 1FXQA 2ZUSA 4F0SA 1BTCA 2J7BA 5EBUA 1DWHM 4YTQA 3VO0A 3AS0A 4A21A 4PMDA 3EPMA 4Q6JA 3N13A 1O1ZA 3BZJA 3L4XA 2ISVA 3W1LA 2HDJA 4LU0A 5I24A 1TR1A 3AYSA 2E25A 4DXKA 2V5CA 3AYTA 2O9TA 3WD4A 2CZ5A 2UWFA 1ONEA 2VYOA 4P7LA 4UTKA 1TVPA 5G1TA 3VGHA 2DJLA 5I0DA 1LM1A 1GORA 2HROA 4UZUA 3UG8A 4IGHA 5HJXA 3ZJ8A 1TSIA 5JBEA 1TTPA 3G0SA 1FWAC 1ISYA 1JF5A 2QJJA 4HPGA 2FHFA 4PB4A 5A6AA 5FD0A 3L5MA 4PMJA 1SO3A 3S1XA 3BPWA 1UWAA 2H9AB 4F79A 5EPDA 1RBOB 3DERA 6XIMA 4AIOA 1QI0A 2D73A 1AVAA 4B2DD 1RQBA 2PLKA 4X9YA 1IZKA 1HT6A 4H8VA 2PDLA 1F4AA 2CU0A 2TYSA 1GZGA 4O11A 3HFYA 4D8LA 3QTPA 1H7WA 3WLQA 2E4TA 1EF3A 1W1YA 4QE5A 4PRRA 3DGRA 1SUXA 2QVHA 4J3UA 3EA3A 3GG8A 5KZDA 3DHFA 1UKPA 1VFUA 1UH2A 4XZHA 4JNZA 1XH1A 2CXEA 1FY6A 1TWSA 2XTKA 1ZBVA 3HIJA 3ZWTA 3VOHA 3MYPA 1QO2A 5CH9A 2YZRA 4XO6A 2AL2B 2GLKA 3UXDA 5AZ0A 1ZPTA 3BE7A 4Q8PA 2PDYA 4AWUA 4XKYA 1PKNA 2QCDA 3MO4A 2OX4A 5FF0A 4QEHA 4QBXA 3N9KA 5FF7A 4K6AA 5PTDA 2FMOA 3MUAA 3BLEA 4CGTA 1QFEA 2VWSA 1JXJA 1PTDA 4KETA 4V2XA 5LXEA 1W3TA 4YYFA 3V5CA 3O1NA 1XUZA 3CQHA 1UKQA 3ES7A 3NQGA 1OYBA 1UOKA 2J9XA 3CZEA 1KFKA 1KQYA 4L9YA 3WUGA 1OWQA 1PBGA 4PRWA 4DXXA 2GJXB 4DO6A 5I77A 1O5XA 4E3TA 1QVBA 3ZM8A 1TMLA 1ZUAX 5D02A 2PGEA 1FCBA 3EDEA 3W6YA 4EF9A 3IJ9A 3H2CA 2WCGA 1XBVA 2GOUA 5D30A 2INZA 3CHFA 4KWUA 1J11A 4FR1A 3IGSA 3WFLA 1Q6GA 2EPHA 2R9RA 3QY6A 1NOUA 3NL5A 4K3ZA 1W1VA 1SR9A 3ZJ6A 4Z0SA 1Z69A 1TPWA 4RZBA 4ZQOA 3N3TA 3QZAA 3WLTA 3T55A 3R7MA 1IWPA 3ABRA 1VYPX 3OLDA 1OABA 2WLYA 3KOFA 4IGSA 1MXDA 5CZ0A 4ZE5A 3W3OA 4Z1YA 4CEUC 3BC9A 3W7QA 1FHVA 2AGKA 3DAQA 1PDZA 2ZZ4A 3TA6A 5GVJA 2AQVA 1C93A 3WJWA 2BASA 4GIAA 1A0EA 2A79A 1E4LA 1LOQA 2B81A 3AQUA 3HU7A 3NZ1A 1E51A 4BFAA 4F48A 6ENLA 4WVXA 3AXIA 1MEHA 1UA3A 3LBOA 4LALA 2DZSA 1TG7A 1XPYA 2VC6A 2IKHA 4UTLA 3WLOA 2OB3A 1E4MM 2CYGA 1DE6A 1E1EA 3THQA 3FA3A 2QKFA 4K8HA 1US2A 5DX7A 4OUEA 3OQEA 3NPUA 1VQTA 5LNUA 3L0NA 5JQ9A 4FPSA 2C1GA 4UQEA 2WOQA 3DBPA 2VVNA 2E6AA 3V3WA 1MMFA 2DIJA 3JU2A 3UFYA 3PBMA 2J8TA 2VEKA 3WMSA 1UKSA 3JW7A 2WJEA 1IZCA 1GQIA 4F8XA 4PMXA 1E1CB 2FZDA 4Q3MA 5LIUX 2GSJA 4AZ6A 1SQ7A 1UKTA 2CERA 3O15A 1I1WA 3ELFA 2VFFA 3OVGA 4U10A 3W82A 4ADUA 5CC6A 4LANA 1YRRA 3CZGA 4IP4A 3UG3A 2O7SA 3BAYA 3IK4A 3WH7A 1O66A 3NNTA 5EL1A 2GVEA 2BB0A 4WKHA 1Z41A 4JCMA 3VKBA 3CTTA 1CGYA 5HR7A 1TUFA 4H9YA 3CL7A 4G1KA 3UBPC 3HF3A 1PXGA 1IR1A 2AL2A 3UR5A 5F2LA 4A6GA 4MDPA 5JH1A 1I0BA 3GH7A 4LBRA 3W6MA 3LI0A 3UNTA 2ASHA 4QSFA 5FAJA 4IPJA 3W2KA 1CB2A 1CT5A 4CN1A 1HKIA 3D47A 1ELSA 5AHFA 1UIPA 1R9XA 4PCFA 2JBMA 3AO0A 4G7FA 3QV6A 3I4KA 2IKIA 3B8IA 4GWEA 2VUYA 3GXDA 2WJDA 3LXAA 3S3GA 4XAPA 3TN6A 1A5UA 1QK0A 4AIBA 1H1ZA 1T40A 4O19A 4YN5A 5I07A 2C7FA 1GJUA 2CHNA 1Y5WA 2R1MA 3W28A 2BXVA 3GE7A 3VE9A 5LYRA 5A8GA 4H7VA 4HNOA 4CD6A 5LNSA 1QOXA 3QHNA 5ABFB 5HMFA 1Y5XA 1A5NC 1M7JA 1J2BA 2XN2A 4GX9A 3MHGA 4Z2LA 1YPXA 4AZ7A 3CUHA 5CAHA 1L6YA 4GH1A 4KCTA 2V30A 5BNKA 2AQWA 1CLKA 4K68A 3PZ9A 3SCNA 2Z00A 3CO4A 3W73A 1G01A 1EJUC 2YL9A 2W92A 3VZZA 1W8GA 2NLYA 4GI9A 4AWSA 3MDWA 3B06A 2F6XA 1JPDX 1TZ7A 1VGAA 3DXIA 4AYGA 4O4VA 4N0RA 4FS9A 1UR9A 1XLAA 1ITCA 1VJIA 3BAKA 1KNWA 2WNQA 3C2OA 4A4AA 5EGRA 2Y88A 4IGNA 5DT7A 1LL4A 2NUWA 3SCSA 3KCJA 4D1JA 1ZBWA 3ARWA 3VA8A 4S3DA 2EPNA 1WXZA 2R82A 4MTVA 3DCPA 1RQHA 3ZS4A 4US5A 2XHYA 4NSBA 1B5TA 4ROQA 3V0UA 3KBJA 1IQ8A 4AH7A 3M7WA 5DRIA 3UZJA 4AD5A 3K1DA 3RR1A 4LYPA 1UBPC 3TE9A 3K4AA 1P0EA 1R9YA 4B9YA 3KRSA 3UPBA 2J7EA 3PZQA 3ITLA 3O6DA 5D2XA 1V3JA 1PKYA 3PBUA 1XH2A 4FLOA 2GUUA 3U7VA 2B7NA 1RJQA 4CCEA 4C1LA 4MZYA 1KXVA 1JGIA 8A3HA 4RDWA 1X1NA 2Q3OA 5KMYA 3CQ0A 2ZXDA 5A6JA 4BCEA 4LB3A 3EDJA 1GVOA 3CYJA 4S23A 5EMJA 1V03A 1XINA 1JDCA 4LVAA 4AXNA 1VJZA 4AW7A 4S3KA 1EB3A 5F2IA 8RUCA 5F4WA 3SQLA 2Y0FA 1XSIA 1XYLA 4QROA 3R2GA 1SJDA 3I65A 1RALA 4LPCA 3LZ5A 4GE8A 3GDBA 3FHQA 4DJDA 1LT8A 1VBHA 2J47A 4HMEA 3TYAA 2F9RA 2ALRA 4IPPA 3HG3A 3ALFA 4Q8TA 3AMKA 2JF7A 1GHSA 4PSPA 1SZFA 3RHGA 3B8UA 1LYXA 4Q4SA 2C0AA 2DSZA 5K9XA 3W7RA 3BLOA 5GJPA 1X38A 4O15A 2OTDA 1GQJA 2QCEA 3URAA 3WQPA 4OIFA 1YX1A 3Q58A 4QXIA 1TJPA 3DECA 2D24A 4LJ3A 3VNZA 4B90A 4HZMA 1GOIA 3XIMA 3MZ2A 5C54A 4PMOA 1FWHC 2JKEA 4XBKA 4CNTA 1TPFA 3BV7A 1DJZA 3QMTA 1MWOA 3AMLA 3MUY1 4KRZA 3GSMA 1VC4A 3OG2A 1JCMP 4GMEA 4KFOA 3RCNA 2CETA 6ALDA 3LLFA 3AOFA 1U5JA 3L5AA 2I56A 3T81A 1Q6LA 3N6JA 1LWIA 3WBWA 3W2UA 3AXKA 1MSSA 1CGUA 1IZJA 2JIEA 4FMVA 5BU6A 3APTA 5LHFA 1V3LA 4DAIA 1JZ2A 1QJWA 5BWFA 4H83A 5AB3A 5CBIA 3PTMA 1UWRA 3GTXA 4HOXA 5EMKA 3GHRA 1V8EA 4H8HA 2Q8LA 4QP0A 3UJEA 1W3KA 2C71A 5T91A 1SYTA 4JKLA 1B31A 2VKZG 4Q8QA 2AMGA 2JKPA 1PWMA 5HULA 3VIFA 3UVAA 2ON3A 1F6YA 3TW6A 4LXFA 3LSBA 2XSAA 3UYCA 3MKVA 4XD3A 3G2GA 4J2PA 1K6WA 2E5CA 2YW4A 3VAVA 3QM3A 3G24A 1UYQA 4IUOA 2J6VA 3W76A 3GYCA 1TKKA 4YU1A 3KBNA 3F2BA 1QOQA 3DYMA 4DO4A 3OIXA 1QHOA 5HNTA 3VIHA 5HA7A 1ENUA 2PPGA 3CJPA 1QWGA 1BYCA 3RO8A 3W1NA 3W7KA 1LDCA 1UP2A 3W7IA 3VDGA 2QCNA 4TTUA 4L1WA 3QKEA 3STFA 1XRFA 2BVWA 4PMQA 4LUYA 4XZNX 1XWYA 3LXCA 2XIJA 4HHLA 4DM1A 2YR1A 4MZ8A 5A6KA 4ZOAA 2F2HA 4HNTA 3LMYA 2OEKA 5DBTA 3N11A 3T0AA 3NQ2A 2ATSA 4JS3A 4M6QA 3R12A 3KL0A 4ZO9A 3RMJA 1UB3A 4J2MA 4JTTA 3WJZA 3UZXA 3GIPA 3YPIA 1TE6A 2GK1A 3BW4A 4IHCA 1ZENA 2QPXA 1LRQA 3LG3A 4X2RA 3ZWSA 3F4NA 2WSQA 1GHRA 2X1UA 5A6TC 2QJMA 2PRHA 4WXYA 3M0XA 2YA2A 3NFUA 4ALDA 3WF1A 2ZX8A 3A3HA 1MQQA 2Y61A 2R6OA 7A3HA 5HQEA 1EDGA 1OM0A 2HZGA 5D05A 1REQB 1CLXA 1CEOA 4AWTA 2D23A 1V3KA 2C8NA 2VI0A 1RUSA 2C16A 1R8LA 4HBKA 5HNRA 4GHRA 3O16A 4WSKA 1W5MA 3CK5A 4MDOA 3DHDA 4GNJA 1EZWA 1CENA 4P5UA 2GDQA 3HQ1A 3POHA 4S1FA 2PF8A 3WDJA 4NILA 4WKFA 3JRKA 2AOSA 2IS7A 2Y8UA 1F3WA 1U22A 1X39A 1QHZA 3E74A 1TREA 1VRDA 1C9DA 3K46A 5AN7A 2R1KA 3CUGA 3LHVA 3S8HA 2C3ZA 4H7CA 2X8RA 3N4AA 2Z2UA 3QSTA 5DMYA 4JTGA 1OYAA 4K39A 4GQRA 2X7VA 4N9DA 4LS2A 1MZRA 3K2GA 2DFAA 1IXOA 3CB8A 2ZUTA 1R7AA 4O1DA 1I9CB 1W1TA 4I90A 3SADA 1B0IA 2RJGA 3E2VA 1H60A 4KEMA 2ZXQA 4H6QA 4B5VA 4AMAA 4QFUA 1TFVA 3R8HA 1ZAHA 5HJLA 1P0KA 3I6EA 1H1NA 3RPTA 3IAPA 2FZMA 4UQDA 1HGYA 3R58A 2XWDA 2VWTA 3WG6A 2ZRXA 1E43A 4Q8UA 1UIOA 3MI2A 2C91A 4MWAB 3AIBA 4HA1A 1A80A 3DGBA 1G6CA 1GVYA 2VP8A 3UJ2A 2POTA 4DZIA 2EGZA 1H4PA 3U5YA 2PDCA 2G97A 4HPJA 5EU9A 3G1VA 2IKGA 3ZT6A 1V0NA 4D2JA 2A6LA 3B0VC 1GKQA 1B2YA 2GWNA 5XIMA 3BG5A 3UQNA 1Z9AA 1SR0A 4FLQA 1KCXA 3CS2A 2VDGA 2IQTA 4YTSA 1ZP3A 5GNXA 4LF2A 1AQMA 3PJUA 1V6XA 4A29A 3TNOA 2YXGA 3T0CA 4JY9A 1H51A 3R8GA 1WP6A 4X9SA 3WMCA 2QS8A 2ZZ3A 3EYPA 3WENA 1JCNA 2NUXA 3N17A 3BAXA 4C6IA 3U2ZA 5A6BA 1YXYA 4MPKA 1E1FA 2HPIA 3W9ZA 1UZ1A 4JFTA 4LV4A 2V67A 3S1UA 2A0NA 3DDMA 3IIZA 1BXCA 2ISWA 2WBKA 3OVQA 3FDKA 3TWAA 3U8GA 3ZOAA 4EAYA 1GVSA 3C61A 4KWSA 3F1QA 1BQCA 3UG4A 1KKRA 4UC5A 3ALGA 1YKWA 4DBEA 1AG1O 3N2MA 3D3AA 5IHRA 4WZHA 4I7UA 3MSRA 1EJRC 1MFUA 2HCVA 3WKZA 1QNOA 3D3FA 1JUEA 1REQA 3R94A 4MY8A 4GO9A 3GXFA 5H8UA 1VFHA 5K4XA 4RE3A 2PDNA 3NTYA 2H6RA 4R34A 6PTDA 1G67A 4FNSA 3GHTA 1PEZA 1XFBA 4LC6A 3DN5A 2J7GA 3WNNA 1XSKA 2XWEA 5D9MA 1WKYA 1WAUA 3OB8A 3T6CA 3C8NA 4LAUA 4IFKA 3DG6A 1B9ZA 1F9CA 4MADA 4KH2A 3M5ZA 2A6NA 4Y90A 4QE1A 1EC8A 1X1OA 2O7QA 1ZHAA 4M3PA 2G95A 2O9PA 2RKXA 1E6ZA 4DUVA 1W1PA 1XH0A 3F5LA 3VCNA 3KVLA 2RDUA 2Z1WA 3LM7A 3W07A 3SRDA 4JTLA 2EQDA 3P14A 4JEJA 4HPXA 2DZPA 1T5AA 2NQHA 2ZZ2A 3GIQA 1R3SA 4M81A 1XIDA 1EP2A 4GBDA 1R3YA 4F3HA 4US5D 3NURA 2GFTA 3USZA 3VKAA 4R88A 1J6OA 3M07A 3DYOA 3FAXA 1GKPA 1KR0A 2ABAA 3T05A 2E09A 3CAVA 4Z17A 3EDDA 1C7TA 4ADSA 4MWAA 3HFTA 2AMXA 2DPEA 1EA0A 2I14A 5DMMA 3MJMA 4E2DA 2FVKA 4GC3A 1EH9A 5FJTA 5HWMA 3EEGA 4IUGA 3ONCA 4QLJA 4QE4A 2ZVIA 5JUVA 4NAEB 5AYZA 2QPUA 4Q8NA 1JZ3A 1N7KA 4I8YA 4NZCA 2PTXA 1R0MA 3TROA 3VFCA 1MUCA 4XBSA 1P4CA 4L4LA 5GNZA 1L2QA 2FQIA 5DCDA 3TK7A 3TR2A 3RLUA 3PN8A 3VIMA 2V2CA 1A5OC 1UD4A 2EBNA 2GQAA 4BA0A 4K8GA 2HBXA 4DJDD 3EB4A 3TQKA 3AHXA 4RV3A 5CLTA 3HZ3A 3ABSA 5D33A 3W7LA 4U3CA 2PSNA 1SZEA 4MAVA 3CZJA 2E9LA 4BF5A 1W3NA 4TX9A 2PDUA 4MAZA 2P5NA 4GYPC 4PA8A 1NU5A 4JNYA 3W7EA 1H1YA 4HK7A 3GQYA 4C7DA 3CPGA 4OV9A 4ACYA 3WLKX 1XLHA 1S1PA 4WHBA 2HEJA 3VI2A 1A4MA 4L4PA 1YBQB 4FX6M 5EMLA 2WWCA 3NQDA 3I6RA 1NARA 3L2IA 4O1EA 3TVAA 1LWHA 1DQWA 5E09A 3A4JA 5C6MA 5TBOA 1YQ2A 1XLIA 2CEQA 3BV4A 1B3VA 3W2MA 1FWSA 1DIKA 2G37A 1AQHA 5A1AA 1E6QM 2KAUC 2OOFA 3S6DA 4UQ9A 2ZDSA 4DWDA 4Q6XA 4J3TA 1ADDA 1DBTA 3G18A 2F7FA 4DJFA 3DIPA 3W75A 3I7SA 5H91A 1ODUA 3ZVHB 3SCTA 1GUVA 1E9YB 1TV4A 2BY0A 4NG3A 1MXGA 1XIBA 3EB3A 2XUCA 3ERPA 1ZBKA 3PTQA 4MKSA 1GPWA 3WSUA 2BS9A 5I3FA 4GGHA 2G4FA 2PODA 4NY2A 2OT1A 5GQBA 1AH3A 2E77A 2D1ZA 1JL8A 3OYZA 4S3CA 3NSXA 1GQNA 3T2OA 3L68A 4Z0JA 2NWSA 1GONA 3W85A 1XDLA 4PUJA 4D6HA 2B7PA 3FYPA 1H63A 3L2MA 1YNYA 3S6TA 3BLDA 3UETA 3PUGA 3KTXA 4EP8C 3FEQA 1QTWA 4M6VA 4LRTA 4MNMA 4C1KA 1W9XA 3QHOA 3CL8A 3GXIA 3N2TA 5CCZA 2CLMA 3C5QA 2J7FA 3EOLA 1G94A 1OT2A 3WK1A 2Z7KA 3MMWA 4NYUA 4V1YA 4Y9MA 4AY7A 4C6BA 3NZRA 3SECA 1NWSA 2CBUA 4JX6A 3IJLA 1A5BA 3S0CA 4URIA 5FJOA 4FIQA 3W7JA 1WDDA 4GVGA 4PMUA 1GNXA 2ICSA 1W9DM 2IW0A 2QIWA 1KXQA 3VDBA 1ISVA 3LHZA 4R9OA 3DHUA 3V1HA 1W5OA 4IMFA 2Z6IA 3MUCA 2EXOA 3BURA 1JCYA 1QT1A 3GXTA 1W1A1 4JTIA 1YPFA 3EWXA 1FWEC 5G1YA 3OBAA 3W01A 4ZTXA 3OHIA 3G77A 1N8IA 4KMQA 3DEQA 4Q7NA 4YXGA 2XGIA 1ML1A 3EX4A 3VGGA 4L6OA 1TA3A 2GL5A 3QN3A 1QAPA 4O13A 1N55A 4MG4A 3JUGA 3QPZA 4Z2JA 2Z2BA 3URQA 3F4WA 3UPWA 3TTQA 2IMRA 4MUZA 2DSVA 4LX4A 5A69A 3CU2A 5K7JA 5DELA 4NZFA 1YBQA 4HYVA 1MUMA 3WLHA 8XIAA 4WY0B 2E67A 5C8BB 3O3RA 1DXIA 3PUOA 5I6SA 4D6GA 3PSWA 1JPKA 3DX5A 1FFQA 2Y89A 3W4RA 3LCLA 4Q4QA 4X22A 3NQEA 4Q7IA 4IQLA 2NXGA 4P2VA 3GNNA 1V6UA 1XLFA 2QQ6A 1HUVA 2ZX9A 3LSCA 2JE8A 2Z1VA 4RCXA 3LB0A 4WCJA 5E9XA 1GVEA 1X8CA 4GRSA 3W00A 3BMWA 5JU6A 5KTLA 1DIDA 2J75A 3WELA 3H12A 4RZ5A 4HU0A 2GSEA 2FB2A 2EEXA 1WQ5A 1OZMA 4ATLA 3DOPA 3UEQA 3BW2A 3GTIA 3CIWA 1TX2A 3HPXA 2W0UA 3GXMA 1NDZA 4EPBC 2G5WA 5CPOA 2BGNE 3IJ7A 1ME9A 2WZTA 3FY1A 3OO2A 4CNPA 4PCSA 4XX6A 3OLEA 4IT1A 4JCLA 1OG6A 1VEMA 1MNZA 2VFEA 1RCOB 3URBA 2B31A 4I8DA 4JQ3A 5F1VA 1AFSA 2Y63A 1KC7A 5AHLA 1AD4A 4PL2A 2QJIA 4D6IA 5J8LA 2YDQA 4YYCA 3M43A 2BY1A 1M7XA 2VRJA 1Q8JA 3R43A 5CZSA 4AZBA 4M1BA 2GGIA 1TCDA 2JEQA 3IJQA 4YTTA 5A6BD 4Y9OA 3GWQA 3N34A 1FFRA 3FA5A 3ABOA 1HVQA 4LCQA 1HW6A 3WFAA 4HOZA 2VRQA 1HKKA 4LYQA 3VM5A 1ZRQA 4JICA 1WYIA 1UWQA 4D8AA 4UTJA 4P8UA 2E5DA 1L6GA 2UBPC 1FWIC 2FIQA 4RW5A 2YL8A 4HZ6A 3WH6A 1WUEA 3W7CA 5U7SA 3W7OA 4ZSTA 5KZEA 2A3LA 1DJQA 2ZRWA 1GOQA 3AHTA 2DVXA 4QEEA 5AY7A 5A5WA 3SJNA 1S2VA 1E6SM 4C1NB 5HQMA 4AG0A 4K1WA 2FKPA 4YNGA 3H2EA 1PS9A 3NJ3A 5K4ZA 5T9CE 4UZSA 1R47A 1HP5A 1YXCA 2C14A 2ZUNA 1O68A 1DWJM 3IGHX 1QMLA 1FP9A 1YDYA 2GQ3A 1K8CA 2WXDM 4UIOA 4WDTA 1S1RA 1ZB5A 2YCIX 5KZ6A 4WY0A 1OSEA 5EBAA 3PULA 2NVDA 2UY2A 1S5TA 1ZLPA 3W7DA 3CUXA 5A2BA 3O6AA 1HN1A 1EDQA 3CMJA 3LA4A 2SFPA 3NL6A 3MV01 2VD8A 3RK8A 3UPMA 3QV7A 3P62A 1V7YA 3H6OA 3W1PA 2W91A 1D7KA 4UMBA 4PFHA 4NJHA 1R3RA 5HOSA 1NM9A 2VFDA 4LCRA 1BSLA 3QGAC 4O1BA 3K4WA 4UQAA 3NXFA 1LBFA 1RV8A 1YADA 2ZTKA 3OGSA 4IX0A 3NOEA 2Z1BA 4JKKA 3GX9A 2FZ9A 4MWAD 1FCQA 3OG3A 3NGFA 1HO1A 4HHHA 4UTFA 5HQLA 3R1ZA 2FZBA 3NOYA 1NIUA 4AD0A 1TYGA 2F84A 1TV5A 1RH9A 1XYCA 4LSBA 2X1RA 2QCLA 5FJIA 5DLCA 3VMNA 1OINA 3G1SA 2H3BA 1OX6A 1E71M 5D04C 2WNWA 1XC4A 4F4RA 3DENA 5D4YA 3TONA 2QHAA 1S5WA 2F2KA 4WJ8A 3HOJA 4Z2KA 2F8QA 1TQJA 4ILSA 1SJBA 2Y7EA 4RJEA 1LBLA 4XTDA 3BWWA 3NQAA 1VKFA 4L80A 1YXDA 2WMKA 3WZ0E 3AIUA 1M01A 3KVMA 1C92A 3MU7A 3S6OA 4Q4KA 1V0MA 4HHMA 3V36A 4QQ3A 3FK4A 4GQQA 1DVJA 1B90A 2NV2A 3A4AA 1KM2A 2G50A 1E72M 3GR7A 3WQGA 5E5CA 1TPUA 1VH7A 3I7QA 4K36A 2FZ8A 3WYZA 5CGQA 2MANA 3VD5A 1AW1A 5CQ1A 3TAOA 2HMCA 4S2CA 1MYRA 3IWPA 1EF2A 1V6YA 3STEA 3LHTA 2OZ8A 4ZOBA 1VPYA 5A94A 3S9ZA 5AFDA 3A13A 3E12A 4FALA 4JIEA 3W2LA 2GGEA 1EC7A 3N2XA 2V5BA 2QDGA 3EWBX 5ECUA 5IBXA 1VEPA 1NDYA 1XBYA 4C1NA 3GKAA 3KTSA 3ITXA 3HURA 4NJKA 4FOJA 2W27A 3LGDA 3NPWA 3AS1A 3B9OA 5CAKA 2NQ5A 4FK9A 1LLOA 4MB5A 1SSGA 1FCVA 1XKYA 2GQ9A 3ES8A 4QITA 4HD5A 1UZDA 3ZSTA 3AXXA 2ZWZA 2YYTA 5EFDA 5AECA 4NYYA 3LOTA 2OLSA 2OLHA 2ZX5A 4DJFD 4R85A 2VX4A 4YVXA 3SCVA 1DWFM 1CECA 3NZGA 3PWIA 1UQYA 1FVPA 1ZFJA 4H8NA 4Z1BA 2WCSA 5FCZA 5FF3A 2YZ5A 1W3IA 3A5VA 3G1XA 4MM1A 3PZOA 3RRXA 1YDNA 3W27A 3B40A 3QGKC 1SGJA 1GG1A 3BQ5A 4LUTB 3WL0A 1BXNA 4PEKA 1ONXA 2YDAA 3KOWA 1EP1A 1ZNNA 1M9HA 1OG0A 3E9AA 2YA0A 3COTA 2FFCA 2OX1A 3LLDA 2VVSA 4HU4A 3RLGA 4UMCA 3NSMA 1DEDA 3T8LA 1YPIA 4QGCA 2QVNA 3TR9A 3GS6A 1RVGA 1IHIA 4JPGA 3QTGA 2QV5A 3O7UA 3ZT5A 5M3WA 1B57A 3R11A 1FWGC 3UZWA 4LBSA 4RR4A 4Q8OA 2OZ3A 2NZLA 3HO8A 1A0DA 1L6WA 3RRAA 2PA6A 2FPYA 2GGGA 1VRXA 2INEA 1K9EA 1DIOA 3KDOA 3BMVA 3P60A 3WDIA 4PMYA 3APGA 1EJVC 1KM1A 1E4IA 4PBEA 4W84A 4XISA 1PSCA 4IXXA 5KITA 4PUKA 4UNIA 4RDVA 4NASA 3QW4B 4C6NA 3AUOA 1NJJA 1DHPA 1P7TB 2FPTA 1TV3A 4CD8A 2HTMA 1K3UA 4FXRA 1TPDA 4DYEA 1J0ZA 1A53A 4RW3A 2VEMA 1KFCA 4ZFCA 4DYJA 2REQB 3SY8A 3EX1A 4EKJA 4M19A 4J3VA 2PEVA 1KBKA 3WH9A 4GISA 1S46A 1VLWA 4Z2IA 2PDPA 5EB8A 3SCWA 1CPUA 4J3XA 5E93A 4JDBA 1JYXA 1GW9A 1EJXC 2NQLA 1F2JA 3VD9A 1OFDA 3V1PA 5H1WA 3SUUA 3CM4A 3B97A 1V0KA 4QQUA 3U5UA 1I2PA 3E0VA 3LQLA 3WLPA 5K9CA 1LLZA 1V51A 2V8ZA 5I3JA 1XG3A 2PB1A 1KD0A 3UXLA 5IOBA 4HA4A 3SAZA 1IXQA 1CYGA 4RPQA 2OKOA 4JY8A 4HMNA 2XM1A 3UR2A 1J0KA 3QC3A 4E0CA 3NAVA 2DZBA 1XF0A 3AUJA 4HCHA 2CHRA 3MI3A 3OA5A 3KXQA 2A4AA 2W62A 2JALA 3L67A 1Q85A 4FI4A 4CUCA 2YDRA 2V81A 4C6QA 4BI6A 4ZMGA 1W9BM 9XIMA 4L9XA 3AZRA 4MB3A 3BANA 3WNMA 2WKGA 3WF3A 1YEYA 4I6KA 1O5KA 1IT7A 4YCOA 2PDWA 4CVWA 4C5ZA 1E55A 3FXYA 2Z27A 3AXMA 5LZLA 4FXSA 1U1UA 4IGMA 1T8QA 4MKVA 4C6DA 4QAIA 2GZXA 4WX2A 3N6HA 3U7BA 2OSWA 3TMQA 1ALDA 3EXTA 2ODOA 2XGZA 3GY1A 1G4PA 1ZJAA 3C2YA 1NOFA 1H61A 1LOSA 3BDKA 4NAFA 3T0TA 2QJHA 1WX0A 1BKHA 1MFVA 1E9LA 4XQ6A 7CGTA 3A6OA 2X2GA 3PZMA 4O10A 3O0KA 1EIXA 3ZR6A 1NVMA 1IF2A 4E6MA 5M2FX 3ABZA 2FB3A 5M1TA 2FVMA 4DI9A 2WPBA 1MRQA 4JIRA 4C7GA 2PWFA 4D8ZA 4DNMA 2OR2A 5FJUA 5BCAA 3WNOA 4Y9PA 2XM2A 1IIGA 1LJYA 4GZIA 4CU7A 1DPMA 3JZUA 2NWRA 3HPZA 3H4GA 4QHRA 1JZ4A 5IHSA 3TYCA 1VIWA 4ADTA 4MYAA 1KFEA 2XSXA 1ZCCA 1PDYA 1LROA 3QKZA 3VNDA 1VCVA 3TNBA 1U5VA 5A8MA 1KTCA 4PGLA 4I5RA 1G4SA 2ZICA 2QJGA 3SM0A 5BWAA 4GJIA 4AY8A 4Y96A 3EOUA 3WMBA 4Q4RA 1XKJA 3INPA 2ZTJA 4CU6A 2VXNA 1OFBA 4XZLX 3ZMRA 3LRMA 2VRKA 4GNKB 4AX7A 2BGQA 2EHHA 4B16A 1WDRA 2Z25A 4PCPA 4RXFA 3N4EA 2GVYA 4G5DA 5FF4A 5LA0A 3EX6A 1IXNA 2A3EA 3T07A 2E28A 2VM8A 1JCJA 4OECA 3TP4A 1PHQA 5BXTA 3PF3A 1W2VA 2C0HA 2PRMA 1BKSA 1ZS2A 2CZEA 2E40A 2NV1A 4GXMA 3V4BA 4AD2A 4OGZA 4D6JA 1ZAIA 2P0IA 1EX1A 3ZJ7A 1Q6DA 2J66A 5D2WA 3UZYA 4ZXLA 3MP3A 3BAIA 6REQA 4QJ1A 3RGTA 3T9PA 1EHAA 2ATMA 3RXZA 2PDXA 1GQLA 4FF7A 5HPCA 3GNPA 1XYMA 3QGVA 3UCDA 4YPJA 1GQKA 5A8OA 3V7PA 3TQVA 1KXTA 4GFSA 5C7VA 3LTSA 1FHDA 4Y2WA 2QCGA 4UOZA 4H7ZA 3R0KA 2ANUA 1EX5A 4LWWA 4MWAC 2D69A 5FI8A 3AALA 3LXBA 2H8ZA 1ONWA 1XJBA 3LRKA 4EACA 3LENA 4JQ4A 5H8MA 1EP3A 1VCGA 1XIFA 4CD5A 1QW9A 1V79A 2ZE0A 3P6LA 2J88A 3BCJA 4LRSA 4HPNA 4HNCA 2PS2A 4UTWC 4GZJA 4JYFA 4HU3A 5CJMA 3W26A 3EKZA 1V08A 4M5PA 2PC8A 2NVAA 4KW2A 4W87A 4K8EA 2X2YA 4CNOA 4G9PA 1T6MA 1A4LA 1Q5MA 4O1AA 5FEPA 3WLRA 4C65A 4W4QA 3S2LA 1K9TA 5AVHA 3WD0A 3UJRA 3M0YA 1DJGA 1LP6A 4IWWA 3PB0A 1LG2A 2PTDA 4IIHA 3KS5A 1BYAA 5GJMA 4JIPA 3P84A 4O4WA 3BGAA 2HBVA 4A8RA 1XIEA 5CBBA 1FCUA 1GYNA 2QUMA 1XRTA 3GC2A 1QNQA 4QNEA 1JXKA 2OZ0A 4ECLA 3HGRA 2BHYA 2E6FA 3KRZA 1H7XA 3LHYA 3SI9A 1ESWA 4ZL1A 3A22A 5J5RA 3W87A 4IIBA 5CPSA 4A05A 1BYDA 3VIPA 2VX5A 1AH4A 4EVZA 1W3JA 1S39A 4E4UA 4HK6A 2VO5A 3E5PA 1BQGA 3DC0A 1JPMA 3DI1A 2C6QA 1QNSA 5FEZA 3I10A 1VP5A 1XBZA 2CHOA 5E6YA 2J24A 3N2BA 4W7UA 1OK6A 3NVDA 3IIXA 3U48A 1WKEA 4QLKA 3TTSA 3MUZ1 4OJYA 5LGZA 2QUUA 1FHLA 5JIWA 1KBBA 1WUFA 1B54A 2HVOA 1JAKA 3MYOA 5ABHA 4NHVA 4NZ4A 2W79A 3N4FA 5E9AA 1XR2A 2CNCA 1M5WA 4JN6A 1I60A 2VGBA 4JFSA 4NZ3A 4KS0A 3CV7A 1NWTA 4LAKA 2XDFA 4MWAE 4L9ZA 1OCQA 1B9BA 1WNOA 3UT0A 2XH2A 5FJRA 2WNNA 4G7EB 3OW1A 4MVAA 1XV8A 3SRFA 1RPXA 3NL3A 4JYDA 1DP0A 3AAMA 4HNNA 3KRBA 1B3OA 2HS6A 1S2WA 5I3DA 2PBOA 4Q8MA 5F4SA 1E3ZA 1YMYA 3GH4A 4MJZA 3BLKA 4O8RA 3THUA 2GUYA 4RZ4A 4IMGA 5F2MA 3QQ0A 1OC6A 3QVQA 2WVSA 1D3CA 2P1FA 2Y5SA 3PSVA 1HTIA 5F2GA 1Q6QA 2OMAA 1I6NA 1WKFA 3QFWA 1ZQ5A 3SUSA 1YNPA 5D37A 1E0WA 3GDTA 3V18A 1OFAA 2BV9A 1KCZA 1OZQA 4AZGA 4LVDA 3A9IA 4KQNA 1J93A 3QZ6A 2DT3A 1B4KA 1P48A 1RJRA 1OBAA 2XPKA 1UD5A 3BARA 4XKMA 3NUKA 4H9XA 3LNPA 4DUWA 3GYEA 3PNUA 4F9DA 2QPSA 3BMXA 5D2TA 4JTAA 3S2MA 4C7FA 1UMLA 2DSWA 3MVTA 4WGHA 3B0UX 1VBUA 1WXYA 3JVAA 3B04A 3SW6A 1MDRA 4AZ5A 6XIAA 4GC4A 2CESA 1BG4A 1N8WA 1Q6FA 3S2JA 3G1RA 3U0HA 3N19B 4ZTYA 3VU2A 4X0NA 1LRTA 4X60A 2YB1A 4MUPA 4FA3A 4MOZA 3MTWA 4A35A 2CW6A 1M68A 1SW3A 1VFFA 2J62A 1A50A 1J5TA 3LPPA 1W1ZA 1HL9A 2ZUVA 3C0QA 4ICMA 2OEJA 2YYUA 3U6WA 1PX8A 3GW0A 3WQ8A 2XVNA 5TD4A 1VYSX 1QW7A 5IXEA 3LNMA 3AJXA 4CCDA 1U83A 2QAPA 2PRLA 4JTDA 2VR4A 1PHWA 2J9ZA 4GVFA 1S5MA 3BJTA 1EFZA 3W1UA 1SMAA 2PWDA 1R6WA 4N9CA 3CQIA 1SMDA 2V9DA 3DKLA 2BLEA 1QPQA 1RVKA 4P8XA 2ZX6A 2CWNA 3A24A 1E15A 5FF2A 2BSLA 4AZHA 3TWBA 1DOSA 3HPAA 3RX3A 1NDVA 1XLKA 2V3DA 5HNUA 2HISA 3EWZA 2PP3A 2I9UA 4JFVA 1PTGA 3A12A 3M4HA 1QCWA 2ZQ0A 2TRSA 1JJKA 3Q2DA 1TV7A 3S5YA 3QLDA 4AD4A 2CLPA 3KOXA 5AC5A 1K4HA 1CGWA 4DO7A 3BW3A 4H00A 1P1XA 1SSDA 4FEZA 5M03A 1JGMA 2RHGA 4G7EA 1PYFA 2GPTA 4XZBA 4CD4A 1Z42A 4Z08A 3UNDA 2ISSA 3MMTA 2WVVA 4IG2A 4W8AA 1IXPA 3GD6A 3W24A 2VOMA 1DJYA 4PR4A 4HZ8A 3WLSA 1K03A 3RN6A 1K8XA 3S46A 1PIIA 2ZXAA 1DKWA 2PP1A 3S9YA 3EA2A 3CYVA 1HJSA 1FQ0A 3WLNA 4GO8A 2CCRA 3L23A 2RDTA 4HZ7A 5B7YA 1VCFA 3VX1A 4IFOA 2WHMA 3H21A 1TIWA 4PCNA 4V15A 5GNYA 3FJ6A 2XJ7A 3PY2A 3PR2A 3PUDA 3IJ8A 5HMSA 1MO0A 3SDOA 1BSIA 2V5JA 1OFOA 3GC4A 2JEPA 1X7FA 1UR8A 4S3EA 4I7VA 3V0TA 1EDTA 4UFLA 4A2RA 4XKYB 2QCDB 1TPH1 3ARXA 1NWUA 1KFJA 4IPLA 4L56A 5BW6A 1DV7A 4NJIA 1HIZA 4GK8A 4F40A 3RCMA 2QF7A 4ONVA 3NL2A 4TVCA 3KAOA 3MY9A 3EKGA 4JTJA 2YCJA 4R33A 1QO5A 3GU1A 3DU0A 3QFEA 3KL3A 1TTIA 1ICQA 4LVBA 4IQDA 3F7JA 3SY1A 1XD0A 4ERGA 3R5EA 4GACA 2IPWA 1LL7A 2DW7A 3E2QA 3RJXA 1ZY9A 3B4UA 3LCIA 4HIBA 3HBLA 1QW8A 2CIPA 1LBMA 4LW7A 2ZRUA 4Y7EA 1UD2A 4K7VA 4IMDA 5HMEA 2WVTA 3GVRA 5CSYA 4L5ZA 3EMCA 2BWGA 3C0LA 3S9IA 3GUWA 2OSYA 4GUGA 1JIBA 3BK0A 1AQFA 4ZGYA 1QR7A 1W6TA 2ACUA 5G5IA 3GK0A 4ZQRA 3OQ8A 2VCBA 3LGGA 1F4HA 1K77A 5E70A 2HNHA 3FA4A 1GWJA 4L4OA 5EYWA 3VFLA 3MWAA 2V5DA 1WDPA 2NW0A 4F66A 1SO5A 4EF8A 1US3A 2QEZA 4ZB5A 3BSGA 3L4UA 4X2PA 2P3EA 4MJMA 3SR7A 3Q67A 2BOFX 1E0TA 1H7NA 1F3EA 2ZVRA 4LTSA 1DYSA 2PLMA 3GO2A 5I03A 4F0KA 3ARQA 1OF6A 1Q6RA 4J3SA 4IJCA 4AYSA 1Q45A 5LIYX 3GBEA 3H53A 1ISWA 2LLEA 4NJJA 2X30A 4H6KA 2YJQA 2QR6A 2WSRA 1ISXA 3II1A 2GVJA 1UWUA 1CZ1A 1VJSA 4DYKA 4H2HA 4M1RA 1EEPA 4OBRA 3DI0A 1NF0A 4O18A 4WOZA 3IJDA 1M41A 2ZOXA 4K1GA 3CBWA 4XIAA 4KGLA 1YW1A 1EOKA 3S42A 1EYEA 2CZDA 1JDEA 4ASTA 1MNSA 4IMEA 4KEVA 1GVRA 4P7QA 3ENLA 4PB3A 2V2DA 4UTHA 5AC7A 3M64A 3QR0A 4LVGA 3W2NA 1TELA 3BSMA 2ZA2A 2VL4A 2GGJA 2W67A 1W3LA 1CWYA 1KW1A 1NP0A 3PPHA 5L9FA 5DF0A 4JTRA 2WJZA 3LN3A 2XISA 3OZMA 4W7WA 2POZA 4GUHA 4H41A 1E6XM 1NQ6A 3AS3A 3CH9A 2PWGA 5ENLA 4MY1A 1BF2A 2FMNA 1H2JA 4FOKA 2D2OA 2F6KA 3FW6A 2DEPA 3EPNA 4MB4A 1SJAA 5H8PA 3VXGA 5CZTA 1BWVA 1CIUA 3OBEA 7REQB 1PCKA 1GOWA 3IARA 2G3IA 4JQ1A 3TCSA