1EDTA

Crystal structure of endo-beta-n-acetylglucosaminidase h at 1.9 angstroms resolution: active site geometry and substrate recognition
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
265
structure length
265
Chain Sequence
KQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFTRELYGSEAVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of endo-beta-N-acetylglucosaminidase H at 1.9 A resolution: active-site geometry and substrate recognition.
pubmed doi rcsb
source organism Streptomyces plicatus
molecule tags Hydrolase (glucosidase)
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H
total genus 88
structure length 265
sequence length 265
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1edtA00
3PZIA 3PZMA 4IISA 3KE0A 4R27A 4Q7NA 3WL0A 1R7AA 3T2PA 3I3BA 1E1EA 4AEEA 1UWRA 4DWSA 3RJXA 1GQJA 3OGRA 2DSUA 2J78A 1TMQA 4W5UA 5LA1A 2WMIA 2DGAA 3AOFA 1NQ6A 1LL6A 4ATLA 1VEOA 2G3JA 4UQAA 2Y8VA 1G5AA 1W3KA 1EO5A 3PN8A 2CBIA 4BS0A 3RPMA 1C91A 4UOZA 4D6HA 2VZTA 2ZXQA 2OSYA 1BYCA 4WSKA 2QF8A 4WIWA 4V2XA 5CPSA 3WIJA 1JF5A 1TVPA 2WVVB 1J0HA 3WQ8A 1XYFA 2YL5A 7TAAA 4F9DA 3L4YA 1E73M 5A6AA 4A3YA 4P7NA 2WMIB 3N04A 3CBWA 4U5IA 2G8ZA 1FP8A 1B2YA 5GQBA 1V0NA 3BAYA 3GXMA 3VMNA 4Z2IA 2CCRA 4AZHA 1E55A 2DT3A 3ZOAA 1KR0A 1SFSA 4U5KA 4CU6A 2EPNA 1UWQA 3CIVA 1SMAA 3VM7A 2A3CA 1A47A 1EDGA 5BRPA 1KB3A 4GQQA 5M3WA 4PRWA 1HL8A 2X05A 5TD4A 5ABFB 2WC4A 3E1F1 3BC9A 1JZ3A 4QCFA 2GJRA 1UR9A 2J7GA 1TCMA 4J3SA 3AS0A 2J75A 2VX5A 1IV8A 2O92A 1OB0A 1W3LA 1E6ZA 1DWIM 1WB0A 4BF7A 1US3A 3ZT6A 2BY3A 1V03A 3KEHA 3BSHA 3VIMA 3FHQA 3VD9A 4ML4A 1JD9A 1GNXA 1UWUA 1OCQA 3VIFA 3T0BA 4EE9A 4U3AA 4B9YA 1J9YA 1H4PA 4RE4A 1UHVA 1E71M 4JL2A 4AZCB 1V3HA 4IM4A 2J47A 2GJXB 1ESWA 3L4TA 5ABGA 1LL7A 1PX3A 1JZ2A 2XIBA 4ZENA 4XUYA 3RM8A 4RE2A 3RJYA 3ZJ6A 2G3NA 2DPEA 2DT1A 3WF4A 4FLRA 1B3WA 3MS8A 3T0DA 3GH7A 2UY2A 2VVNA 1CZ1A 4KH2A 5A6SA 7A3HA 1W2VA 1UR2A 1M53A 2E40A 4F8XA 2PWEA 4WJXA 1NWTA 4NF7A 2VRKA 4QLLA 1B31A 2O9OA 3THCA 3M07A 3NJ3A 3BLKA 2CETA 3WNOA 2BHZA 2CKRA 2GK1B 2E3ZA 1TFVA 3EMZA 3WD2A 1IT0A 5DF0A 1B1YA 3SUUA 5BYWA 1UD5A 4EANA 2XFYA 3ARZA 1XRVA 2XVGA 2IUZA 4FLOA 2OSWA 2VVSA 4BA0A 3VGBA 4GQRA 1EQCA 1H2JA 2DSZA 4JFUA 3AHTA 4MPKA 4W85A 5AY7A 3BGAA 1KQZA 1DWJM 1V3LA 3F5KA 3WF2A 2IXVA 5JBEA 1B3ZA 4D6CA 2CYGA 8CGTA 5I5RA 2V5CA 4JKMA 4TTGA 1BG4A 3PHAA 4HP5A 3NUKA 1UKQA 1J01A 1ZBWA 3ZJ7A 3W26A 4TTUA 2WMHA 1ZBVA 3VGFA 4D72A 3WEOA 2VX6A 1EQPA 4W84A 2ZICA 4GZEA 2VL4A 4QDMA 3WNPA 2DEPA 1UZ4A 5FD0A 1E4IA 2XM2A 4GXPA 1VBRA 2C7FA 2J7DA 1F4HA 1PEZA 3MMDA 3AHZA 3UR7A 2V3EA 1W1PA 3WFZA 5ECUA 4JAWA 1E4MM 3WF1A 3L4UA 4HU0A 1PX8A 4AD2A 1E56A 4J3TA 1VBUA 3L2LA 1DWGM 2BS9A 4AD0A 4MB5A 4UQEA 1XSIA 2XSBA 1K6AA 2XVNA 5A2AA 5CGTA 2ZUTA 3SCPA 1UD3A 2Y24A 1JG9A 3WNNA 1X6LA 4HA3A 3UR8A 5CJ5A 3OLIA 1UQYA 3CZEA 1V02E 2VRJA 4AZBA 2A3AA 2UY4A 3AS3A 3GBDA 2WAGA 5ABFA 2WLZA 1GCYA 4CN1A 1W91A 5CPTA 1B30A 3MV01 1EDQA 2FHCA 2YA2A 2O9PA 3SIMA 3VIPA 2BVYA 3PZUA 2PB1A 3CHEA 1M04A 1C93A 2VT0A 2E8YA 3VMPA 1UYQA 3EMCA 3AHXA 4DWSB 1UKPA 3M46A 4NZCA 3W28A 1E15A 3W82A 5HNNA 2CPUA 2A3BA 1XC6A 4U2ZA 1RPKA 1ODUA 4OOUA 1HJUA 5E6ZA 2CKSA 3OLDA 4TVDA 2ZUVA 2E4TA 1PAMA 3FW6A 5A6MA 4W5ZA 1GPFA 3PZVA 4XZWA 3VD3A 1R85A 3RM9A 3AZTA 1CWYA 3PTKA 1GQIA 3S2CA 1VEMA 2IXUA 2J7CA 2W62A 3VX1A 4M1RA 2GFTA 2HVMA 3WDHA 4D6DA 4XV0A 3MV11 3GNPA 2W63A 5A1AA 1G0CA 1UD4A 2J8FA 4ATDA 3W53A 4HOWA 4OBSA 4CVUA 4CN4A 3T0AA 1AVAA 3WD1A 2GJXA 1UKOA 4ZXLA 3RILA 4AMCA 3PZNA 3VGEA 1LG2A 3N9KA 4E8CA 4XZBA 2W91A 1KR1A 1BFNA 3M7SA 3II1A 3VILA 2FHFA 4AISA 3VUPA 3F5JA 1J0KA 4PCTA 2EPKX 3BAJA 1V3JA 3PZ9A 1EDTA 2W92A 2EBNA 1L8NA 1OIMA 4X0NA 1V6WA 4OOZA 3D5HA 3SCRA 4LPCA 4UFHA 1CGXA 2PBOA 3AMDA 5EB8A 1E43A 3VX0A 2D0FA 1H5VA 1NOUA 3GYCA 1CXKA 5KEZA 1UH4A 3BSGA 2Y2WA 5HBFA 3B8SA 3OIHA 4U3CA 2YBTA 1WNOA 1SR0A 1UH3A 1CGTA 1HXJA 3RO8A 4W89A 1CGVA 3CZ8A 1GUVA 2WHJA 3AISA 4P7QA 1FH7A 1AQ0A 1WKYA 4GI8A 1B3XA 5FOOA 3U7VA 3CUFA 2W61A 3CHFA 4CD5A 1GVYA 5HPOA 1LWJA 5IDIA 1NP0A 2WSPA 2VUYA 2BXZA 9CGTA 4B16A 1EO7A 4FLSA 2QV4A 1J0IA 4J7RA 1ECEA 3N13A 2XYLA 4CCEA 2PI6A 4UOJA 1KXVA 1R87A 3WDIA 2VO5A 1OM0A 3B9DA 1NM9A 2EQDA 1QOXA 1W9VA 4UTFA 4A4AA 4P7LA 1K9EA 4S3JA 3ARQA 3WELA 1W9BM 1QW9A 3DYOA 5CZKA 1EXPA 4X0VA 1H11A 4ZEPA 1JZ5A 1E0XA 1KGUA 4B9ZA 3AMKA 1UZ1A 5A94A 4P7OA 1WZKA 1HP5A 3HMCA 3THDA 1BYBA 5E0FA 2GUYA 1E6QM 1GQLA 1VFUA 2D0GA 3VGDA 1PJ9A 2DDXA 1EOKA 1VF8A 2X8RA 2XJ7A 2FH6A 3AFBA 3OB8A 3UG4A 4PEEA 4JHOA 2YJQA 1ISYA 3POHA 2VX7A 1CIUA 1VEPA 3WQWA 1J0ZA 3GBEA 3ZJKA 2JEQA 2FHBA 1MWOA 2VX4A 1PPIA 2CBUA 5IFTA 1TZ7A 4BQ4A 4DM2A 3ECQA 1KXTA 5LYRA 1BHGA 1KWKA 2VMFA 3N11A 1XCWA 2MANA 4HA1A 3UERA 1QI5A 4JIEA 1W1VA 4UQ9A 5A6LA 1H3GA 2NT1A 3L4ZA 5JIPA 1CTNA 1E40A 3SUVA 1HP4A 4L4OA 2FH8A 3QGVA 3QR3A 1JYNA 2JFEX 2BY1A 6CGTA 2ZUSA 2OWXA 5I79A 3ALFA 3FXYA 8A3HA 2XIIA 5EFFA 3QHNA 3AIUA 4PMXA 3DECA 2F2HA 1JI1A 5IFPA 1E6PA 4JHZA 2WMFA 1E1FA 3VPLA 5ABEA 5KZ6A 3W4RA 4HOXA 1JZ4A 5D4YA 2J8GA 3AXXA 3WDQA 2YL8A 3ZO9A 4RE3A 3DYPA 3AHYA 3S6TA 2E9MA 4P8XA 2WHMA 2YL9A 5D9PA 4LGXA 3OZOA 4C7GA 4LXFA 3WKZA 3DYMA 3K1DA 4PUDA 1Z32X 2D2OA 5JUVA 1ISVA 3GNOA 1CEOA 1JYXA 3WDRA 1HN1A 1K9DA 3GH4A 2ZWYA 3EBVA 5E6YA 1EHAA 4CVWA 2EPLX 3NSNA 3OLEA 1HKKA 2VI0A 5F7UA 2EPMX 4X9YA 3WEZA 2WSKA 3WN6A 2VOTA 1US2A 1VENA 1GOOA 2O9RA 2V3DA 3IAPA 4HPGA 5AC4A 2J77A 3F5LA 4JKLA 1C92A 1G1YA 3WMBA 5JIWA 1GOQA 4HMDA 3AYSA 4IUGA 3ZQ9A 2WCAA 4TUFA 3A4WA 3O9NA 1DWFM 4PCSA 1CDGA 3A3HA 2YOCA 1EA9C 1DP0A 1HX0A 4GI9A 3VIGA 3SCSA 2J74A 2WPGA 1QHPA 2X0YA 2ZUUA 3VIOA 3FNDA 4PTWA 4CN6A 4JFSA 3VDAA 2CHNA 1CGUA 2YL6A 3N1AA 1MVYA 3RCNA 2WVUA 4AIOA 4MNMA 2J7HA 2JEPA 3MMUA 4TX6A 4GZIA 4FLQA 2YIHA 4D6IA 1I1XA 3OZPA 3WH9A 1SMDA 1TUXA 2JALA 4WKFA 2OLHA 4PTXA 2F61A 3FHAA 1E6NA 4NI3A 1CENA 3KL5A 2QMKA 3W29A 4UQCA 1ZL1A 4ACYA 3EDEA 1ZBKA 2VZVA 1D3CA 1W3HA 2Q8XA 1J12A 4W8BA 3OA5A 5DO8A 3EMQA 3WH7A 6TAAA 1HVQA 2WCGA 4KGJA 4AD3A 1LWHA 3B9AA 3G6LA 5D9OA 2Y8KA 3N18A 1JNDA 4F66A 2ZX7A 4S3KA 3ARYA 2J62A 1WPCA 1CXEA 2ZUMA 2WCSA 4HMCA 3VNZA 1HT6A 2DSKA 3GH5A 1UD8A 1MXDA 2WMGA 1GVIA 2WMKA 3U7BA 4BQ5A 4TVCA 2WZHA 3CHCA 1C7TA 3PZGA 1OD8A 1W32A 4UQBA 1GOIA 3D3AA 1KBBA 1BVZA 1DTUA 1LQ0A 3MO4A 4Z2KA 2BHUA 2PBGA 3GZAA 4R5EA 3A4XA 1CECA 1BQCA 3SUWA 1FHLA 5A3HA 1MXGA 4GO9A 5BROA 4FMVA 3WUGA 1QNRA 3FAWA 1S46A 1E4LA 2WM0A 3K8LA 4UFKA 2WB5A 3CUIA 3UG5A 1XH2A 4H7VA 1UA7A 4HTYA 1OT1A 2QHAA 3T2OA 2E9LA 3BAKA 3GNRA 1E0VA 1QI4A 5GPRA 4LYRA 1E3ZA 3B9EA 1EOMA 3ZJ8A 3SUSA 4AZIA 3WUEA 5BWFA 5IHRA 1LF1A 3W25A 4AIEA 1H09A 3T08A 3ARTA 2FGZA 5AC5A 3DHPA 3WFLA 4UZSA 4CD6A 2W4XA 2D22A 2BV9A 1MYRA 2J7BA 4F9JA 1G9HA 1BLIA 1NH6A 3WD4A 4J3XA 1JDCA 3CZLA 5GNZA 4Z2HA 4OBRA 4MAZA 3AMCA 5DEZA 2ZUWA 4P8VA 3VD4A 3ZSTA 2VCBA 1E6XM 3AICA 1HJQA 3OGSA 2RGLA 3RMEA 2VCCA 2XVKA 1HVXA 1BAGA 1KGWA 5DFAA 3IJ8A 1E5JA 3VNYA 2J25A 4HZ7A 4EK7A 1FHDA 3I3EA 1W9DM 2VURA 1O6IA 5D9MA 3HJEA 3L4XA 3ARPA 3WDJA 3AYRA 1KWGA 1UUQA 4W87A 2ZX6A 2O9TA 3W6MA 1WDRA 1UKTA 4PMVA 2ZXBA 5I3DA 4UQDA 1VJZA 3NSMA 4AY1A 3GXIA 4MADA 5M17A 3G6MA 1V0MA 1MFUA 5BXRA 4JFVA 4C7DA 2F8QA 3KZSA 2WVVA 5I78A 2WWCA 4A3HA 1VFFA 1FA2A 1R7OA 3NSXA 1MW0A 3RIKA 2V3GA 4CCDA 4TX8A 5HXMA 1Q6GA 3MU7A 1QI0A 4GPNA 1HL9A 2VTFA 5D8WA 4XX6A 1C90A 1R8LA 1R86A 3ZMRA 4AWEA 3BCFA 4P8WA 3K8MA 3OGVA 4PUEA 4DUVA 3ARSA 2YBUA 5CPQA 1LL4A 1M01A 1K9FA 1Y7VA 1J18A 5C70A 1JFHA 3GDBA 3QOKA 1GHRA 5M5DA 4IPLA 4C7FA 4E2OA 2E0PA 2BHYA 2D23A 1JDAA 1GOMA 3NIYA 2ZWZA 3WNLA 4XB3A 1L0PA 4M82A 3WQ5A 1OGSA 1FFRA 1GOKA 7CGTA 3A4AA 4DWSC 1DEDA 4QP0A 3WH6A 3CZGA 1NOWA 2DH3A 3WNKA 2A3HA 2G3IA 5A6JA 4AZ5A 1HKMA 1VAHA 2D3LA 1JL8A 1OD0A 2G41A 1J10A 5E70A 2QPUA 3TTYA 1KXQA 1VJSA 4UCFA 5BXPA 2NSXA 3ARWA 2OYKA 2CIPA 2WZEA 5CLTA 2ZUNA 4FF5A 3WH5A 2BY0A 3EDDA 1FOBA 1V3MA 2B31A 3SCWA 1W9UA 1NWSA 1W1TA 1M03A 2YLAA 2D24A 3QOMA 1ZU8A 4N42A 5A6BD 1D2KA 3CUGA 1E3XA 1XYZA 3A47A 3I3DA 1TR1A 1GOWA 4DUWA 4ZXOA 1JD7A 3VO0A 1HJVA 1JXJA 2E9BA 1Q6EA 4WKHA 4PMZA 2VZUA 3FY1A 3PTQA 4J28A 5BCAA 2OYMA 4J3VA 3IANA 3AIRA 1EIBA 2CHOA 4JFWA 1V0LA 4RL3A 3KL3A 1ISWA 1IZKA 3QHOA 2WVSA 1JFXA 1ZJAA 4V28A 1UR1A 3M6DA 3LPGA 3AROA 5CXPA 1FH9A 2WC7A 2GSJA 3VOCA 2AMGA 3WL1A 4QCEA 4AZ6A 5A8QA 4J27A 2ZE0A 5M03A 5E09A 2J7EA 3CHDA 4B15A 3TOPA 4OIFA 2WHKA 5A2BA 1LLOA 3EDKA 1MW2A 3U57A 2X09A 4MDPA 2ESCA 3ARVA 3PTMA 4KRUA 4W7UA 1UA3A 4TVUA 2QLYA 5A8NA 2OSXA 2DSWA 3HN3A 1H0GA 2VZSA 3BLPX 3K4AA 4N0RA 5AYIA 3AIBA 2VR5A 1LG1A 1UOKA 3WQVA 4AXNA 4AYSA 4ZE5A 3N12A 3TP4A 3AZRA 1XHGA 4DM1A 1KFWA 1V0KA 4PYSA 1JZ7A 4WK9A 5IXEA 4OKDA 3WDPP 3GXDA 1TVNA 4PSPA 5I23A 1GORA 3TONA 1C3FA 4J3WA 5C71A 2G4FA 3WMCA 4MJ4A 3AS2A 2CBJA 4JCLA 3DHUA 4U2YA 1GONA 2YA0A 2DT0A 4W88A 2WW5A 3VM5A 3ZM8A 1UR0A 1XGZA 1CXHA 1QI2A 4B3LA 4M56A 1GJUA 2V3FA 3MSGA 3U5UA 1UD2A 3L4VA 1X6NA 5EFDA 1XD1A 1BVNP 3J7HA 1WZLA 1MFVA 2PWDA 1WCGA 2BY2A 1XSKA 1MW3A 2XVLA 3NDYA 1V3KA 3W24A 3ARXA 1Q6CA 3A6OA 1QNQA 5CQ1A 2DT2A 3LPOA 1B0IA 1XH0A 1H49A 2DIJA 2XTKA 1CXFA 2QMJA 1HF6A 4HA4A 5JBDA 1HKJA 3W27A 3EYPA 2PC8A 2XM1A 3U5YA 3NCOA 4JFTA 1KCKA 2XSAA 1VFOA 2YKKA 1QVBA 4ACZB 1JZ6A 1BYDA 2V38A 4W8AA 4H2CA 3UETA 1CLXA 2WKGA 4TOQA 1UWSA 4AW7A 4D1IA 2AAAA 2XGBA 4H41A 1OT2A 2BXYA 3JUGA 1E6SM 1M7XA 3SURA 3WF3A 1XD0A 4PTMA 1BGAA 3TA9A 2XVPA 1JXKA 4EAMA 2EEXA 1WZAA 3W37A 3VGHA 4GKLA 5IHSA 3GM8A 1UR8A 3SCQA 2J7FA 1WE5A 3LMYA 3VIIA 4MNKA 4AD1A 3KL0A 5I24A 1JDDA 1E70M 1WDQA 4MB3A 3AIEA 2WVTA 4W8LA 4AD4A 2UY3A 2WNWA 1GW1A 3CZKA 1IZJA 2DIEA 3NYDA 3AS1A 3AMLA 1C8QA 3MUIA 1QPKA 1P6WA 4W7VA 2WWDA 3IAQA 1V02A 5EMYA 4HU8A 3HU7A 4JCMA 1W2PA 1GZJA 3ZT7A 4OJYA 2XPKA 2VJXA 1ISZA 4CU7A 2EPOA 2EO7A 1CGWA 3W38A 4M24A 1ITXA 2J4GA 4KGLA 3ZSSA 1CLVA 4EKJA 3VKKA 4M80A 1H41A 1JI2A 4LYQA 1U30A 3ZR5A 3CLWA 2VR4A 2XFRA 5E9AA 1NP2A 1PIGA 3WBAA 5LA0A 5AYBA 4WF7A 4D6JA 3WD3A 1FP9A 3AJ7A 4PTVA 3VMOA 1E72M 1ZB5A 3MUY1 1UH2A 3AHVA 1I75A 1MQPA 1UWTA 4AC1X 4W86A 3SCUA 3DC0A 3VD5A 3ARUA 2UWFA 1NWUA 1CNVA 2FGLA 2G3MA 1TG7A 2XWDA 1MQQA 3ZR6A 5A69A 2EXOA 4YHGA 2GVYA 3K4DA 1YHTA 4YPJA 3L4WA 1BYAA 4M8UA 1HJXA 5DMYA 1EH9A 1E6RA 2CERA 1C8YA 4CD8A 2BVTA 4UFJA 4UFMA 1CYGA 3BMWA 1RP8A 3WSUA 2TAAA 3CZJA 4Y7EA 2A3EA 3WQ6A 5I77A 1DWHM 4U33A 1F4AA 3BAXA 4V27A 5FL1A 2PF0A 3CMJA 2AOSA 4LYPA 1WAWA 4LX4A 4MAVA 2FDMA 3MKKA 3CO4A 4GI6A 3ZT5A 1OGGA 4ZE4A 2W66A 1AMYA 2JIWA 4GO8A 3WUBA 1RD6A 4HMEA 3CGTA 1OINA 5A2CA 3VD7A 1FH8A 1AQMA 2WANA 3W0KA 2WHLA 3SCVA 1UKSA 2QPSA 4H8HA 2YA1A 1NARA 4DUXA 3ALGA 5A6KA 2CEQA 3MSDA 4P7RA 4P8UA 1MQRA 1X1NA 4PMRA 4QLKA 1V3IA 3POCA 3UCQA 1B3YA 1WZMA 3WY1A 5A8PA 1JYVA 4MB1A 1KQYA 4MJ2A 2GK1A 1XCXA 1LJYA 2ZXAA 2WC3A 3WENA 5DT7A 2GDUA 1UWIA 1OWQA 1A3HA 4UZUA 3L2MA 3EDFA 4UR9A 1HJWA 3PZQA 4W7WA 1QW8A 3T2QA 1V6XA 1V6UA 4B3KA 3BXWA 2VRQA 3CUJA 3BMVA 2YDRA 3TTSA 2OWWA 1K9TA 1ITCA 2PWGA 3SUTA 2E8ZA 3IK2A 5ABHA 3AIQA 5C8BB 1B90A 2WXDM 3WF0A 2DH2A 4M29A 5DT5A 4MNJA 4GZJA 4MB4A 3MANA 1HKIA 1QHZA 2Z1KA 3SEPA 3WH8A 2VC9A 1B3VA 3SCOA 2CNCA 1JNEA 2Y5EA 4Q22A 4YHEA 4KMQA 4GINA 1QI3A 2VQTA 3N17A 2V5DA 3CH9A 4UOQA 1JIBA 4D6EA 2WBKA 4ZFMA 1W9XA 5FCZA 1YQ2A 4AZGA 4QFUA 4PMYA 1ZJBA 1TA3B 1V08A 4PN2A 1VFMA 4Z2JA 5JBFA 1GJWA 3WQ4A 4AZ7A 5FL0A 4E4PA 3W81A 1XH1A 1UQZA 4AD5A 2CBVA 2CITA 4BCEA 5E0CA 1BF2A 1QNOA 3SCNA 1GQKA 4AZCA 3OBAA 1PBGA 3WNMA 2W67A 3ARRA 4Z2GA 2XWEA 5HPCA 5CSUA 5D8ZA 1JYWA 1SYTA 1J0JA 4LQ1A 2XGIA 1J11A 2PWFA 3AXIA 1UG6A 4PMDA 3BAWA 1QBAA 1BG9A 4AIUA 1VRXA 2WLYA 3TTQA 3VVGA 3VIHA 3N15A 5I6SA 2NW0A 3CMGA 5A8OA 1E4NA 2D1ZA 4QAWA 6A3HA 1E0WA 2BVDA 2J79A 5I0DA 1XSJA 1Q6DA 3O2LA 3EDJA 4UFLA 4CD4A 5BXSA 1RP9A 1BGGA 1BPLB 4CD7A 4HZ6A 3BH4A 3WEMA 1UD6A 1W3JA 3AXHA 4CGTA 1KCLA 4D6GA 4BQ3A 1CPUA 2X2YA 2WYSA 2BNJA 5HDRA 4UFIA 1CXLA 4NSBA 1C8XA 4D71A 4FK9A 5CLWA 4JL1A 5A95A 4NRRA 1JAEA 1JGIA 5BRQA 2ZIDA 5CG0A 3ZIZA 4MNLA 4BQ2A 1O7AA 2XFFA 1B9ZA 3BAIA 5BXTA 2VNCA 1OGBA 4TXEA 1OIFA 4GIAA 2C8NA 5FKYA 3APGA 4UNIA 3O6AA 1CGYA 2C0HA 3VIKA 4Z2LA 2EJ1A 4MDOA 2X1IA 1Q6FA 2BFGA 1N82A 4QLJA 4PMNA 1DWAM 4PMOA 4JZ5A 5FIPA 3MMWA 1QNSA 1TE1A 5GNXA 4CU8A 1PZ3A 3LPPA 3OG2A 4PSRA 3GXFA 2ZX8A 3CPUA 2JE8A 4WLCA 1E9LA 1H1NA 5CSYA 3QHMA 3AMGA 2ZXDA 1W1YA 3UESA 3KWXA 2HISA 1GHSA 3GTNA 4PMUA 4URIA 5A6BA 4CKQA 4CUCA 4J3UA 1W9PA 2D20A 4M81A 4E8DA 3OLGA 1G94A 1ZBCA 3UG3A 4D6FA 2CESA 4HZ8A 3PZTA 1HJSA 5CGMA 3IJ9A 4F79A 3AIWA 4IPNB 3PBGA 2WMJA 1C7SA 1V6VA 2JF6A 2YDSA 2GDVA 2WK2A 1PX4A 1KGXA 1H0IA 1HIZA 2XHYA 4H04A 3VDCA 3RM4A 1WDSA 4JKKA 3W6LA 1J0YA 2PWHA 5A8MA 1BTCA 4ATWA 3TTOA 2WKLA 1UR4A 2Z1SA 2OWCA 4KRTA 5D9NA 4BZYA 3AI0A 1ZS2A 2D0HA 3WBEA 4CCCA 4OUEA 1ODZA 1VIWA 2DSVA 3CUHA 4MTVA 1VB9A 2VCAA 1AQHA 1JAKA 3SCTA 3WD0A 3AZSA 4HPHA 1JZ8A 1D7FA 1WDPA 3IJ7A 3F4VA 4AEFA 2VZOA 1OSEA 2VQUA 3VDBA 1XV8A 1BSIA 4WSJA 2W5FA 1JF6A 4WKAA 4H8UA 2JIEA 3FAXA 1PIFA 3LPFA 4NRSA 5GNYA 3K8KA 2JF7A 1I1WA 2RGMA 3UEQA 3T09A 2GJPA 4KWUA 3VINA 4PBGA 2D3NA 1NOFA 3VGGA 1KBKA 2YDQA 3VU2A 1QNPA 1HNYA 1PZ2A 2YLLA 4PMQA 3PZOA 4HOZA 1U33A 2X0HA 3VTRA 1QBBA 1DHKA 1MW1A 2Y4SA 1QHOA 4H8VA 1V6YA 4DWSD 3K46A 4K68A 1WP6A 2WZIA 3VDHA 1G01A 2WBGA 1ISXA 3AQUA 1Q4NX 4YN5A 3MUZ1 3NDZA 1CBGA 2XUCA 3RDKA 5HOSA 3MUAA 1NWRA 2ZOXA 1E5NA 1OBAA 4L4PA 3VIJA 2OYLA 1EGZA 1TA3A 2NT0A 2ZX5A 1FFQA 4W93A 4ACZA 3BCDA 2DQXA 2XG9A 2ZX9A 2CXGA 1U2YA 5EBAA 1CXIA 3WUFA 4OZOA 1EHNA 5LA2A 3CTTA 1KXHA 3FN9A 3WMSA 2UY5A 4U31A 4D1JA 1RH9A 3AIVA 1WO2A 5I2UA
chains in the Genus database with same CATH superfamily
4IISA 3KE0A 4Q7NA 3IUDA 3I3BA 4IP5A 4IGHA 3RJXA 1GQJA 2Y70A 2J78A 1I4NA 2INEA 3SFKA 4IG2B 3UNTA 4JQ4A 1NQ6A 1LL6A 2G3JA 3W76A 5LGXA 4UQAA 3MBFA 1XL9A 1IXPA 1GVRA 1O1ZA 3H70A 1VPXA 2CBIA 2PP3A 2PGRA 3WBYA 3STEA 3TYAA 4GJIA 4V2XA 3W1AA 3WIJA 3C8NA 1TVPA 1OADA 2WVVB 3WQ8A 2HWGA 3QSRA 1UCWA 2C3ZA 2YL5A 3QEZA 3ZS4A 1TWDA 4CQDA 7REQB 3CBWA 4JTHA 4ZTYA 2G5WA 5LNRA 1LROA 3BAYA 1BWLA 1EPXA 1KV5A 3VMNA 1RK6A 4Y9PA 4Z2IA 4AZHA 3MP5A 1KR0A 1R2TA 3QXBA 3ITYA 4CU6A 1OFRA 1SMAA 3VM7A 1A47A 3E5PA 1NEYA 1FWNA 3EA1A 2PDPA 4QE4A 5AYXA 5TD4A 4UWMA 2B7QA 3QQWA 4EOUA 3ES7A 4XAPA 4A8IA 1SFJA 3BC9A 5HR6A 4EXQA 4KEVA 1EZ2A 4FX7A 4UNLA 2FYMA 2O92A 1PYMA 3TU9A 3GFXA 2P76A 4HZMA 4TU1A 1EYWA 3BSHA 4O19A 4ML4A 3USBA 4Z0JA 1JD9A 1U22A 3C8FA 1GNXA 1UWUA 4NJIA 4XG1A 4EE9A 5DCEA 4TX9A 3OO2A 2PPGA 4B9YA 2QCDA 2A85A 1FWHC 1H4PA 3UWYA 2EAWA 1KFLA 4RE4A 1UHVA 1E71M 1V3HA 4IM4A 2J47A 2GJXB 1RBOB 1KM5A 2Z27A 4XKYB 2P8CA 3L4TA 4HSHA 1PX3A 3RRAA 4KEUA 4FNUA 4XUYA 2FPTA 2HXUA 4GE8A 3WF4A 2I9EA 1B3WA 3MS8A 3GH7A 7A3HA 1UR2A 4ENLA 1RHCA 1YDYA 4WJXA 1NWTA 4QG6A 3NL2A 3DFHA 3M07A 4HNLA 4UTLA 3WNOA 2BHZA 2E3ZA 4LVGA 1K7XA 3K1GA 2GQ3A 4WJEA 1LDCA 3A5VA 2AMXA 2BP1A 1B1YA 4Q7BA 4EANA 1XGEA 5IRPA 1XRVA 4FLOA 4BA0A 3VGBA 4GQRA 1ZY9A 3B0UX 2SFPA 4PL1A 5D05A 2DSZA 3F7JA 2AAMA 4GD0A 4MPKA 4XBSA 5AY7A 3F5KA 3WF2A 3H7RA 2IXVA 2V5CA 3KZPA 4JKMA 2HS6A 2CLFA 4LAKA 2ZA3A 3NUKA 3H23A 3REQA 3V0TA 3ZJ7A 4J1OA 4D72A 4W84A 3HB9A 3VZXA 2PTXA 2XM2A 3CPGA 2C14A 3VZZA 5KZDA 3B0YA 2J7DA 5AYYA 1W1B1 3UR7A 3BOXA 3CT2A 2NQLA 4DJDC 1C29A 1WAUA 4DJEA 3KBSA 4JAWA 2XIQA 1IXNA 3PSWA 4HU0A 1PX8A 4B4HA 4AD2A 3R94A 1E56A 3F2BA 2BS9A 4MB5A 3NXLA 4LF2A 3QPEA 1SW3A 3SECA 4WDUA 1JG9A 3UR8A 1OFDA 5CJ5A 3CZEA 4R53A 3VOFA 4AZBA 4C91A 5HWNA 1TYGA 3CXOA 5ABFA 5D2XA 3HG4A 3M0KA 4CN1A 1WKFA 1R2SA 4JQ3A 3GNXA 1B30A 1A0EA 2YA2A 1YEYA 3SIMA 3R0DA 4N4QA 3VIPA 4JX4A 1GEQA 5IOBA 2DZSA 2HTMA 1XYAA 1C93A 3WQEA 1QPNA 3EMCA 2NV9A 3O8AA 3EKZA 3W82A 5HNNA 4E3VA 2Z24A 1TSIA 1XC6A 4YXGA 2PGFA 3OJGA 1EPVA 4N7QA 1XUZA 2CKSA 4TVDA 2OFJA 2ZA1A 5EBUA 4JTCA 2V68A 1PAMA 2FKPA 3FW6A 2PU1A 2JQXA 1GPFA 3VD3A 2V9DA 2C18A 1YLVA 1W3IA 3RM9A 3PTKA 3AWOA 4I5RA 2IXUA 2GFTA 4ZL1A 1YIXA 2P0IA 1PVNA 4ZSTA 4XVEA 2VFHA 5A1AA 1UD4A 3KOXA 2J8FA 1XIFA 3G8RA 2CLHA 2POZA 3W53A 4KIRA 5CBIA 4LEQA 3JRKA 2X1RA 4CN4A 2FTWA 5FA5A 2GJXA 5DLCA 3RILA 4AMCA 4NZJA 1DIDA 4C6DA 1JR1A 3T40A 3N9KA 2ZZ5A 5D32A 4DO4A 4XZBA 3OBKA 2W91A 3P14A 4N6FA 3A23A 5C7VA 4PRRA 1BFNA 3M7SA 3UBPC 2FHFA 4UMAA 1HGWA 3F5JA 1GW9A 4PCTA 2NQZA 1ME9A 3TAKA 2P88A 1V3JA 1H7NA 2PWVA 3FJ6A 1QK2A 1TQJA 1VFHA 2PRHA 3SCRA 4JNYA 4GXWA 1CGXA 5H6HA 3VX0A 4GQGA 3A22A 5JQ9A 1ONEA 1UH4A 3WQGA 3BSGA 1PS9A 3OIHA 3EXRA 2YBTA 3DC8A 1HXJA 4MY8A 1IIHA 1F73A 3CZ8A 1XLGA 1M5WA 3RLHA 4WXYA 4XWUA 3AISA 1W6TA 2Q8LA 4GUJA 1WKYA 4GI8A 1OK4A 4QRNA 3CWOX 2W61A 3BL3A 4KS0A 3CHFA 4CD5A 3T4WA 5HPOA 3EEZA 2OEJA 3C3UA 1LWJA 4CLMA 5LNUA 1QAPA 4GCXA 9CGTA 2BASA 4JXCA 2O7QA 1SR9A 5AECA 1J0IA 3GD6A 2QUMA 1R87A 4UMCA 1OM0A 1BEUA 1KFCA 1K4GA 2EQDA 4ADTA 5EMUA 2B4GA 2VXNA 4S3JA 1OX5A 3V5CA 1EXPA 1JZ5A 3P81A 3OZMA 3M7WA 3AMKA 4MLRA 1DV7A 1UZ1A 3UYCA 4IF2A 5AHMA 3B05A 1WZKA 4P7OA 3RO6A 3THDA 3BK0A 4UMBA 2ZVRA 2OG9A 2R1LA 1PTDA 1EOKA 3RG6A 4FB7A 3B03A 1TIMA 2FH6A 2RH9A 1DBTA 4TIMA 4GJ1A 4NZ5A 3OB8A 3UG4A 3QC3A 4PEEA 3POHA 3THQA 3W84A 3AU6A 3UP8A 4JN7A 3WBWA 1J0ZA 3ZJKA 2OX1A 2ZZ3A 2VX4A 1PPIA 1N2VA 2CBUA 4IOTA 3S6DA 1TZ7A 4Q4OA 3LLFA 4DM2A 3W1UA 5LYRA 4TR9A 3N34A 3N11A 4PEKA 5CC5A 2V67A 2C1GA 2OJPA 1I9CB 4JIEA 3MDWA 4JEQA 3PSVA 1CTNA 5FF3A 1HP4A 1OABA 2FH8A 3QGVA 3LERA 4JY8A 1UC5A 3EX2A 1GG1A 3VOGA 3ALFA 3FXYA 1I2OA 2XIIA 3QHNA 3NQAA 3AIUA 4DWDA 4ROQA 4JIIX 1SZFA 3DDMA 5M1TA 5ABEA 2XZ7A 1DQXA 4Y2WA 4AU0A 3QQ1A 3W4RA 4FR6A 1NDYA 4YLWA 3WZ0E 3NQFA 4RJEA 3H7UA 1EP3A 3IV3A 3TR9A 4LUTA 2ZZ7A 3WDQA 2VFGA 3DHFA 3W72A 3LZ3A 3UXLA 4OECA 4Q8QA 3Q2DA 1Y0EA 3IV8A 1EWDA 4YCOA 2WHMA 5HQEA 2QPXA 5D9PA 4LGXA 3OZOA 1AJZA 1PWMA 1Z32X 5JUVA 1X39A 3SIZA 2YCEA 4M6QA 1HN1A 1GTHA 3GH4A 1A3WA 1XLEA 3OBEA 4CVWA 4B2DD 1HKKA 4Q4MA 1LLWA 4MWAC 5DXYA 2O9RA 2V3DA 3IAPA 4HPGA 4C6NA 2J77A 3F5LA 3GDRA 4S2BA 1UOZA 4XSMA 3WMBA 5JIWA 4LNYA 3NOEA 4C6FA 1K7FA 3O15A 4IUGA 4XAFA 3T44A 2WCAA 3W22A 3HURA 4LB4A 4TMBA 2YOCA 1EA9C 1M68A 3TW6A 3VIGA 5EMLA 3SCSA 5HA7A 4KCUA 2ZUUA 3UR5A 3VIOA 4GH1A 3VABA 3DH7A 3M43A 4JFSA 3RCNA 1EFZA 3O05A 4MNMA 3W7CA 4GY7A 2JEPA 3W2UA 4HK7A 3CV7A 4GZIA 4FX6M 2GYIA 4D6IA 1I1XA 1TUXA 4V33A 2RDUA 4FNTA 9XIAA 2CZ5A 2B7PA 3W2MA 1VS1A 1QPOA 3B40A 1Q7MA 2VZVA 1D3CA 3PF3A 2I9UA 2Q8XA 4KCTA 3EMQA 4MWAA 3G77A 6TAAA 3R10A 3IJDA 5C2CA 2R94A 2ATSA 1NIUA 5FI8A 5HMEA 2CZDA 1O12A 4UTKA 2J62A 1CXEA 1G7UA 2WCSA 1MDRA 4UTUA 3SAZA 4DNMA 2PDGA 5I02A 1HT6A 5CC7A 2WMKA 5U7SA 4BQ5A 3CWNA 2BODX 3PZGA 1OD8A 1YPIA 5HANA 4NAFA 4UQBA 2QCDB 1L6SA 2YBVA 4FA3A 2YCIX 3GIPA 2D2JA 4G7EA 1XI3A 3EB2A 4Z2KA 2ZTJA 1BQCA 3CUZA 1W8SA 1FHLA 5A3HA 2A0NA 4FMVA 1W17A 3ANVA 2Z1WA 4K1GA 2V30A 3U8GA 3UCDA 3GE7A 5AYZA 3OHIA 1UROA 4IFRA 5C9WA 3FOKA 4H7VA 3FGCB 2INZA 4ALDA 1EJVC 4GOAA 1FWSA 4LYRA 3N2TA 3PPGA 4JTDA 3ZJ8A 3BO9A 3R8HA 4AZIA 3WUEA 5G1MA 3W25A 3G0XA 4AIEA 1XLFA 1N55A 3NQEA 3ARTA 3R1ZA 3WFLA 2FTPA 1WBJA 3BSMA 2BXVA 2W4XA 2D22A 4I7WA 5EY5A 4C6IA 2J7BA 2GUUA 2ABBA 1G9HA 3TKFA 1NH6A 3N19B 3TC3A 3OA3A 4OBRA 3PULA 4MAZA 4ZO8A 4M0XA 3ZSTA 1TV2A 4XBJA 3OYZA 1Z7AA 3PB2A 1D3HA 4P61A 1RAKA 1LLZA 4XD6A 2J25A 4EK7A 2QJGA 1FHDA 2BTMA 1R3RA 2Y8UA 2PTZA 1REQB 3WDJA 3AYRA 1BXCA 3AJXA 3GDLA 1FWCC 1UUQA 4W87A 4GJJA 2O9TA 1UKTA 4M7TA 3Q94A 1AQFA 4TQTA 5I3DA 1B9BA 1OK6A 2RAGA 3EWUA 3XINA 3HQOA 5M17A 4L80A 1V0MA 1FUYA 1S2UA 1ME8A 5FJIA 1AUSL 3FS2A 3U4FA 3UJSA 3DFOA 4J4KA 5F2LA 4XKMA 3MJYA 3VFCA 3H2FA 4K38A 1MW0A 1QXLA 3RIKA 2VC5A 4QS5A 5AHLA 5I3HA 4R88A 3VZYA 3AXMA 3HA1A 3C0JA 1HL9A 2QAFA 2P53A 3ZMRA 1R86A 3UZ5A 3W2JA 3W9ZA 4DUVA 1GVOA 3ARSA 1I2PA 4Z0SA 5RUBA 3WJYA 2G3FA 3VI2A 3TOYA 1JFHA 1SZNA 1TVLA 2NX9A 3M5XA 1JDAA 4M5PA 1L0PA 3EWXA 3UPWA 3WQ5A 3TQPA 3N2OA 3OEXA 2IQTA 3LNPA 1DEDA 3W88A 3WH6A 2DH3A 4L65A 2CW6A 4FNPA 3BE7A 4O10A 2X42A 1HKMA 3FYOA 3KOZA 4FOKA 1OD0A 5E70A 2Z25A 4UCFA 1R3QA 3B06A 3STCA 2HSAA 5CLTA 5PTDA 4FF5A 5IBXA 2BY0A 2OTDA 3BG5A 2B31A 5A8GA 1W9UA 1GYLA 1NWSA 1B4EA 2YLAA 3D6NA 2EPHA 1P5BA 3N6JA 4ORIA 2DZVA 1HQTA 1OX4B 2QCLA 3LCWA 4HT3A 1EIXA 1D2KA 3CUGA 4O53A 1H63A 1XYZA 1GOWA 1FWJC 1HJVA 2BLEA 1RCQA 2Z7GA 3FY1A 2TMDA 3I4KA 4J3VA 4UTIA 1EIBA 4GABA 3IJIA 4DYKA 3KL3A 4IHCA 4S2CA 2A7RA 3QW4B 3QHOA 1ZJAA 4V28A 2C19A 3EX3A 2RUSA 3LPGA 1GEHA 2PLJA 4AZ6A 5HJYA 3AC0A 1EGVA 1XLHA 3PWIA 3U2ZA 1U1JA 3H24A 1LLOA 2XN1A 3EDKA 3LI1A 4O12A 1QO2A 2QDGA 3PBYA 2WSQA 3ARVA 4MDPA 4KRUA 5CJMA 5HJLA 4TVUA 3W85A 2QLYA 3VUSA 3HN3A 1TV4A 4ONVA 4UCGA 2R8WA 3BLPX 4PCNA 3AIBA 3E74A 1LG1A 4U4MA 3VNIA 4ZE5A 3N12A 3TP4A 3AZRA 4DM1A 1BKHA 5DY3A 1V0KA 5DQPA 1KFJA 3N25A 4WK9A 3VE7A 5DELA 3LYEA 3TCEA 1TVNA 1Y5XA 2E25A 1ZGDA 3IK4A 4C6MA 3KOWA 1E1CA 3NQVA 2R1PA 4MJ4A 2OGJA 5KZMA 1OFPA 3P74A 1UR3M 2R1MA 4JCLA 3DHUA 2J6XA 3L0GA 2DT0A 1EBHA 1SJBA 4Q7IA 4B3LA 1GJUA 1LZOA 3U5UA 4Q4QA 4Q32A 1WZLA 4HD5A 4OV9A 3FJ4A 2E1DA 5JH2A 3GVRA 2P5NA 1XSKA 2E6AA 3UJRA 1H50A 2XVLA 1JCLA 3RPTA 3W24A 1BWKA 3IIOA 1B0IA 2DIJA 2XTKA 1CXFA 2OQHA 1HF6A 2UBPC 4HA4A 1H7RA 4G7FA 4O4VA 5HWJA 4AUBA 3H4GA 4JFTA 1KRAC 3F4NA 4Q3MA 1IYXA 3ZVIA 3TN4A 1JDFA 4DBDA 1CLXA 2PD5A 4WDXA 4TOQA 1VJIA 1OCJA 5C2GA 4ADUA 3HIJA 3M4HA 1XD0A 3R43A 4DLMA 3B97A 2EG7A 3CASA 3NQ2A 4EAMA 1WZAA 3W37A 3PWGA 5IHSA 2QNEA 1UR8A 3EX1A 4ZOEA 3NXFA 4E6MA 5CBBA 2J7FA 3GW3A 5T9BG 2I5IA 4AD1A 4XZIA 3GK0A 3RLVA 4W8LA 1S3TC 4AD4A 1YXDA 2WNWA 1GW1A 1IZJA 4FXRA 1B5TA 1F8MA 4LBUA 1QPKA 3MUIA 3GG8A 4W7VA 2WWDA 4MUZA 1V02A 3XIMA 4M51A 1GZJA 2EGZA 2DJLA 4CU7A 1JCNA 5DANA 3R79A 3LU2A 1X98A 4KGLA 4EKJA 1WDDA 4LYQA 1O5RA 1XUUA 1U30A 3CLWA 2FVKA 3WBAA 4HSNA 4R34A 2ZDSA 2WJEA 4D6JA 3STGA 1F6KA 3PBWA 2I5QA 4CNUA 3VMOA 1E72M 1ZB5A 2O56A 1UH2A 1MQPA 3QQ0A 3DG6A 4AC1X 5DMNA 3DC0A 3SCUA 1XKYA 2DZAA 4ZQOA 4C60A 3BGJA 5GJNA 1TG7A 3ZR6A 1LRTA 4F0HA 4Z1AA 1JRBA 5FJTA 1BYAA 1KKRA 2CERA 2J13A 1LWIA 2ZC8A 3WSUA 2TAAA 4GQ0A 2A3EA 3WQ6A 3ONCA 4U33A 1F4AA 1ZP4A 1TPB1 3BAXA 4K8EA 2NVAA 1QCWA 5C6MA 4LX4A 2VD9A 4GI6A 2GGHA 2C6QA 4LC6A 4WGHA 1AMYA 3H4XA 2QAPA 4HNTA 3CHVA 5XIMA 1OINA 5F2IA 2VFFA 3IUHA 5J5RA 1AH0A 1FH8A 4XAYA 3W0KA 4LALA 4H8HA 4DUXA 4H9ZA 2CEQA 3CAWA 3CYVA 4JY9A 5A6KA 1X1NA 3PPFA 4QLKA 3UCQA 1B3YA 1WZMA 3EWZA 3QLLA 5A8PA 2HVNA 4WY0B 1QWKA 3T8QA 1LJYA 2WJDA 2ACQA 5DT7A 4HCDA 3EPNA 1AODA 1TJ0A 1HJWA 3PZQA 3T2QA 1J2BA 1CCWB 1WKDA 1UJPA 1TR9A 7ODCA 5FF4A 5DRIA 4MB4A 1L6GA 3EOEA 1UUMA 4L9YA 3LTYA 3SCOA 4AXKA 2AGKA 1F5ZA 4KMQA 1ECQA 4UOQA 5D03A 1JIBA 3W71A 4ZFMA 4CQ9A 3RX4A 5H2ZA 5HUOA 1V08A 3L5AA 3EX4A 3M9YA 4X22A 5CZTA 1QUMA 1L6FA 1X8CA 3JW7A 1VFMA 6ENLA 4Y9NA 2VGGA 4GVFA 1IWBA 3TW7A 4HNOA 4U10A 4AZ7A 4HU3A 4E4PA 4F48A 3MCMA 1A0DA 4AD5A 1QNOA 2C13A 3CYJA 3WQFA 5I00A 5D8ZA 3LX9A 3E2QA 3C2YA 3S1GA 1B57A 2QW5A 1QBAA 3EB4A 4AIUA 3W3OA 3VE9A 4DLFA 2OXNA 2PFHA 3VVGA 4IMAA 2NZLA 4WEVX 4RR4A 2Y62A 1YPFA 1V6TA 4QAWA 4N9BA 3REQB 3EOSA 5I0DA 1XSJA 1Q6DA 4HYVA 4GVGA 4JTSA 5FEXA 3E0LA 3EDJA 4UFLA 4HVXA 1BGGA 1EKOA 5DMLA 4FSAA 4XO7A 1JCJA 3MWAA 2XZ9A 3TV8A 1I2RA 4ZSUA 3NZGA 2C71A 4UFIA 1YNQA 2E77A 4NSBA 3N2MA 5CLWA 2ZRUA 4FXJA 4CNNA 3ZIZA 2I14A 4X61A 5BXTA 2J24A 2ZZ2A 2C1IA 2C8NA 3APGA 4JEJA 2C0HA 3VIKA 4Z2LA 2GGEA 1L8PA 3RXZA 3OU8A 2BFGA 4Z1YA 1DWAM 4PMOA 4DF1A 4GRSA 1GYNA 2HS8A 4QEEA 1RQEA 1QNSA 2E68A 3MTWA 1O4UA 3OG2A 3V16A 3NGFA 3DERA 3ME3A 1Q2SA 1A50A 1O5QA 5EL1A 2RDXA 1EWEA 4WLCA 2ZXDA 3IGXA 5D09A 3KFTA 3MSRA 4Z1CA 5CBJA 3SRHA 3UZYA 2PA6A 4AWSA 4PH6A 3QV6A 1XLLA 4PMUA 1ADSA 1Q6LA 3NGJA 4AFYA 4CUCA 3O63A 1ZCOA 4J3UA 5BRBA 4FNQA 1G7VA 2E67A 3S2MA 4IICA 2R1NA 1ZBCA 3UG3A 4D6FA 2CESA 4HZ8A 4JD4A 1NSJA 4F2BA 1EJSC 5CGMA 2Z0IA 1ICQA 4DZAA 3Q67A 3USZA 1C7SA 1S5VA 2YDSA 1KGXA 4WJ8A 4O13A 2PZNA 1W1IE 4IXHA 1VHNA 4Y9OA 3RM4A 1K7EA 3CV2A 4JKKA 4ATWA 1IE7C 5E9XA 2WKLA 1UR4A 5I3FA 5CZ0A 2X1SA 1PDZA 2OWCA 4KRTA 1LP6A 5D9NA 4ZZ9A 1R3WA 1VB9A 2VGBA 4PR4A 1LRQA 2OELA 4LUIA 3H2OA 3SCTA 3BW2A 3AZSA 1CI1A 3QY7A 5LIXX 3CK5A 5AC6A 1A4LA 3CEPA 1Z6KA 4N9EA 4AEFA 2GQ9A 4PTNA 4BHYA 3C5QA 1TJRA 3SW6A 3NFUA 3PJTA 4CQ8A 2BDQA 3GG0A 5XINA 3TXZA 2JIEA 3P8IA 4LS1A 3K8KA 5F4XA 3R6IA 2YXOA 2JF7A 2RGMA 3UEQA 1N7KA 1RBAA 1B54A 3VINA 2YXGA 3LV6A 4PBGA 4DPQA 2VFDA 1KBKA 3MKVA 3VU2A 3KAOA 2NLYA 1HNYA 3RX3A 2YLLA 4HOZA 3M6YA 3VTRA 3CLMA 4ZQRA 3NG3A 1MW1A 2H90A 3BLDA 4JTFA 2J6VA 3G24A 4DQWA 1BKSA 2R24A 3VDHA 3URAA 1H61A 3AQUA 4DAFA 3DFTA 3O6DA 2GUBA 3HPSA 3RDKA 5HOSA 2QXWA 5C9RA 2YX0A 2ZOXA 5FSEC 3QVQA 4L4PA 3VIJA 4WOZA 1EGZA 2ZX5A 4D8ZA 2RFGA 3NZQA 3BCDA 2DQXA 5AZ1A 1KFEA 2XG9A 1TKKA 2ZX9A 3TSDA 3T42A 1U2YA 5HMSA 4U28A 3FN9A 1KXHA 4OUIA 3SJ3A 3Q58A 1Y5VA 3WMSA 3IARA 4DBUA 1FX6A 1I2NA 3VA8A 3WL0A 3MCNA 1UMLA 4AEEA 1XKJA 1LBLA 3GHTA 5LA1A 3APTA 4QDPA 3PP7A 3KCOA 3E49A 2DGAA 4JTGA 4X63A 1PUDA 1DJNA 1FWEC 3WLRA 3UWQA 4IQDA 2B7NA 1VBHA 3DEQA 5HINA 4NNBA 1SSDA 1ZRQA 1VC4A 1W3KA 1R0MA 5EPDA 3A9IA 4Q8TA 4KEZA 2VZTA 3UXIA 3LUTA 1RUSA 1BYCA 4WSKA 3DHDA 4JNMA 4EWJA 3FYPA 4QTGA 2FZDA 1JF5A 1J0HA 4RE0A 3BLEA 2V2HA 3MCOA 2NWRA 5TF0A 3W1MA 3GR4A 1M1BA 4EPKA 4C5ZA 4A3YA 3LHWA 3H55A 3VAVA 1B2YA 3MVIA 3BWWA 5HNTA 5GVJA 1E55A 3ZOAA 1TELA 1SFSA 3TC7A 2EPNA 1TPH1 1TJ2A 2J9YA 3U2OA 2A3CA 1EDGA 1KB3A 4GQQA 3EWDA 1KLYA 3WJZA 3VKAA 4HIBA 5ABFB 1JUBA 2BZNA 3E1F1 3ANUA 1JZ3A 4H3DA 4E38A 4YS1A 3NOYA 4J3ZA 2VX5A 3IJLA 1H1YA 1KBIA 3O0FA 1WB0A 4BF7A 3ZT6A 2C16A 3C2EA 2YCJA 4ZQMA 1TJ1A 3M0YA 3VIMA 1AW1A 4MUPA 3FHQA 3P6LA 3QW3A 4HN4A 2C91A 3VIFA 2NUYA 3SJNA 1J9YA 3EB3A 4NXSA 5F4WA 1ESWA 4H9MA 2NQ5A 1Q5MA 3WYZA 3JZEA 3OTRA 2PDKA 2XIBA 3MSYA 4R9OA 4MY1A 3U48A 2PDBA 4RE2A 4F0MA 4X9SA 2G3NA 4NI8A 5CAHA 4IGSA 5TIMA 2DT1A 1JPDX 2Z28A 3STFA 4FLRA 1T6MA 3B9NA 3T0DA 3FCPA 2UY2A 4H9VA 2Z7KA 1CZ1A 1M53A 4PBFA 3FYYA 4MZ1A 1O60A 1B31A 2O9OA 1EP2A 3GXNA 1EJUC 3NJ3A 4MF4A 2DZWA 5BMXA 2CKRA 2GK1B 4A21A 1TFVA 6XIMA 1VRDA 1PKMA 2O55A 3W2LA 3GAYA 4RUBA 1FQ0A 3SUUA 1Z69A 4G5DA 1UD5A 1S2TA 3NQDA 5HWMA 4DVOA 2GVEA 3QV9A 4GHRA 2XVGA 3PUEA 1RK5A 1EQCA 3DGBA 4Q33A 3ERPA 3GIYA 1H2JA 3RCMA 1XINA 2MNRA 2QUNA 3M0VA 4Y96A 1KQZA 1DWJM 1F2JA 3W7QA 2HDJA 5I5RA 1AL7A 1XQLA 2WKJA 1Z48A 4HP5A 1XR2A 5AHEA 4I8YA 4NAEA 4HU4A 1ZBWA 4L1WA 1HL2A 5I06A 1TE6A 1ZBVA 2VX6A 1EQPA 5G1YA 4HTBA 4WRHA 3Q4DA 4QDMA 3WNPA 1OZMA 1OCNA 2IQ0A 5FD0A 1L9WA 3GRIA 2HVOA 4ERIA 2QZRA 1F4HA 3AHZA 5BOEA 3AUJA 1V5XA 1JCMP 1W5NA 1LOQA 1XIDA 4Q4KA 3QYSA 3GNDA 1IIGA 3NDOA 2JKAA 4LRTA 4J3TA 6ALDA 4NILA 2GGIA 4UQEA 2XSBA 1K6AA 2XVNA 5CGTA 3SCPA 1UD3A 3DX5A 1KLZA 5AFDA 3D0CA 1F3EA 1RJPA 4GYJA 4AC7C 3P2VA 3QY8A 2VRJA 1H62A 1AD1A 3AS3A 3IACA 1QK0A 1GCYA 3AU2A 3GHSA 1SZGA 2FHCA 4MKNA 1XIEA 2Z6IA 1SQ7A 5AHNA 4WR3A 1FRBA 2BVYA 4R7WA 4QEHA 3CHEA 2OO6A 1MEIA 3P80A 3GW0A 1QFEA 3MP4A 4H6KA 1UKPA 2A2IA 4KPLA 1FWAC 1XG4A 2WZTA 4NZCA 1E15A 4U2ZA 1HJUA 1XYLA 3URNA 3OLDA 1A5MC 3P5YA 3T55A 1P1XA 4C1LA 4XZWA 1LBMA 3AZTA 3QN3A 1VEMA 5CZSA 1IEWA 3TQVA 2W62A 2HVMA 4M1RA 3HG3A 1T8XA 3WDHA 4D6DA 4EPDC 2NQHA 3GNNA 3MV11 3M16A 4FALA 1G0CA 2QJNA 2QJHA 2OCZA 4HOWA 2BGSA 3O3RA 2Y1HA 1UKOA 1QWGA 4ZXLA 3H2NA 1AG1O 3PZNA 3VGEA 1LG2A 3GHUA 4E8CA 5CC6A 1FBAA 4XBKA 2P1FA 4AISA 3P7YA 4JTIA 3VUPA 1J0KA 3S3GA 2ZADA 2P50A 2QT3A 1RQHA 4HPNA 3R5EA 1MXSA 3GU1A 3PZ9A 5DMMA 3DESA 2EBNA 1L8NA 1XYCA 1OIMA 2OGYA 4LPCA 2IKJA 4QHRA 4UFHA 5LXXA 3A9BA 3P60A 2HJPA 4S1FA 3TX9A 3N4AA 4FXFA 1CXKA 2A5HA 1ONXA 5HBFA 1CGTA 1R30A 3U3HA 1GUVA 4GK8A 4QJ5B 4XD5A 4P7QA 4TMCA 5EMJA 5DBUA 3U7VA 1N8IA 2G95A 3CUFA 4L56A 5KINA 4AB4A 2FVMA 3SRFA 2E1WA 3W7HA 1RJRA 4JPGA 4ZGYA 1NP0A 3B3DA 4DYJA 3D46A 4B16A 1EO7A 3SSZA 3N13A 3IIZA 4CCEA 1VPYA 4UOJA 3H6OA 4R7JA 4BWLA 4H7ZA 2VO5A 1NM9A 3MBDA 3LV5A 4HK6A 1W9VA 1DXFA 4KETA 1XLKA 1K9EA 4H6QA 3ARQA 1XIBA 3NQ7A 3DYOA 5CZKA 1MUMA 4RDWA 1H11A 3BOFA 3NYZA 4K3ZA 1XLAA 1KGUA 1H7OA 2ZRZA 4B9ZA 4GISA 4MSSA 1A3XA 1VP5A 1E6QM 1GQLA 1R2RA 3G22A 2DV0A 1PJ9A 3DOPA 4EXAA 1DKWA 2PCQA 1AD4A 1ISYA 1F07A 3HBLA 2XH7A 4A35A 5L6UA 1MWOA 3QMRA 4GFIA 1AL8A 1A49A 5CSSA 1OC5A 4XD3A 1XCWA 3E5BA 2MANA 3UERA 4UQ9A 4BJHA 3L4ZA 5JIPA 3N2XA 4N2YA 3SQSA 4BWLC 2JFEX 3MJMA 3TN3A 4K37A 3BARA 6CGTA 3L0KA 2OWXA 5I79A 4O15A 3QFEA 2F2HA 1JI1A 5IFPA 1PXGA 3CM4A 3B04A 3WLIA 3MQTA 3QMSA 3ZVHB 1XJBA 1Z89A 4MFEA 4L6HA 4PA8A 5LKYA 1W5MA 3AXXA 3HO8A 4RNHA 3B0VC 1R47A 2FB3A 3DYPA 5AVNA 4XK2A 3S6TA 4NP7A 2YL9A 1OFQA 4FI4A 1J2WA 4C7GA 4LXFA 3WLPA 2X0SA 2XIJA 3WKZA 1CX9A 2GWGA 4IP4A 4PUDA 3N14A 4S3CA 1AH3A 3GKAA 5CCZA 1ISVA 2CLOA 5K9DA 1JYXA 3WDRA 1F74A 4MLJA 4Y9AA 3V3WA 2ZWYA 3ZYZA 1AMKA 1R46A 3EBVA 4NYUA 4NL1A 1EHAA 5E6YA 3NSNA 3OLEA 4K7VA 3H2MA 4JS3A 5F7UA 2EPMX 2Q3OA 3WEZA 2WSKA 3SFWA 1JDEA 3KLLA 1US2A 1GOOA 3GO2A 3TZFA 5KITA 4C6PA 1G1YA 1GOQA 3C61A 4JTAA 3TDFA 5C2XA 3NURA 1LM1A 3A12A 4IWWA 1DWFM 3TMQA 1K8YA 2RJGA 3A3HA 1YPXA 4GI9A 3W7PA 2J74A 2WPGA 1EGMA 1GGOA 1GTEA 3W7LA 1LOLA 4H7CA 5H91A 3CQIA 4KKXA 4PTWA 3VDAA 2CHNA 4AIOA 1ZSXA 3BZJA 3UF9A 1K8ZA 2IMRA 4FHAA 4FLQA 1FWRA 1GJPA 3OZPA 3GFYA 3B8DA 3TC6A 2JALA 4WKFA 4PTXA 1RVKA 1E6NA 2ZZ6A 3KRBA 2W27A 3T78A 2E6FA 4ACYA 3EDEA 3A5FA 5DO8A 4MGGA 1LRNA 3LQLA 2VWTA 1TTPA 3WH7A 1B4KA 4AD3A 3KDNA 3B9AA 3HM7A 4FNRA 5JXQA 4KCVA 4F66A 2AKMA 5GJPA 3ARYA 4CCZA 1LCOA 3ITCA 2Z1VA 2ZUMA 5SWUA 3VNZA 1IXQA 3EWCA 3UU0A 1UD8A 3QPZA 3M41A 1GVIA 3W7MA 3U7BA 5K4XA 3APYA 3PJXA 1XISA 5AOUA 4LUYA 1GOIA 1YMYA 1EJXC 4US5A 1DTUA 2BHUA 2PBGA 3H21A 1OC7A 3SUWA 2Y88A 4F0LA 5CGQA 3GY1A 4DNHA 3UPMA 3OPSA 5EMKA 5BROA 5MKGB 1QNRA 3FAWA 4M19A 1Z3NA 1DJGA 4UFKA 1F61A 2Q8ZA 3CUIA 3UG5A 3A3XA 3E12A 1XH2A 3GHRA 5I07A 1OT1A 1O68A 3T2OA 9RUBA 2QKFA 3BAKA 2GSEA 3GNRA 5GPRA 5TAOA 1E3ZA 2JKPA 3B9EA 1QW7A 5LIYX 1LF1A 2CLLA 4M7SA 3N4FA 3G0UA 3T08A 1OVDA 1TCDA 2P3ZA 3DHPA 4UZSA 3I10A 5BOOA 5DXXA 1DIKA 1C8VA 2D2GA 5HUPA 3QFWA 3CAVA 4J3XA 1GT8A 4UR8A 1QOQA 3B8WA 3AMCA 3LCHA 2ZUWA 1NVMA 2VCBA 3H8AA 3IIVA 3OGSA 1ZP3A 3OHMB 3ZR4A 1P6BA 5I3JA 4OVXA 3VNYA 3UY7A 3TA6A 3AXKA 3I3EA 1W9DM 2VURA 1O6IA 1IR2A 1QPRA 4E0CA 3SY8A 2HEJA 2WNQA 1ADDA 8RUCA 2YB1A 1XC4A 3WLLA 3PB0A 4AY1A 1J93A 4MADA 5HK4A 4JFVA 4C7DA 4P5UA 1P7TA 2WQDA 3YPIA 4YYFA 4XZLX 4PGLA 2WVVA 3NQCA 4Q8NA 3PPHA 4Z1BA 1WA3A 1R7OA 4O1CA 3NSXA 3KRSA 2PF8A 3T1GA 5HMFA 3RNDA 2V3GA 4NUWA 3GC4A 4CCDA 1Q6GA 3MU7A 4LCQA 3U0HA 1TX2A 2Z00A 4XX6A 1C90A 1R8LA 4AWEA 4P8WA 1EEPA 3TE9A 2Y6ZA 3OGVA 4PUEA 4K8HA 5CPQA 1M01A 4ILSA 5I3KA 1J18A 5C70A 3GDBA 1GHRA 4N9DA 3W7RA 4EAYA 4E2OA 4Q8VA 2NUXA 1PZ1A 2BHYA 1DIEA 2E0PA 1GPWA 4RXGA 3WNLA 2DJXA 4GY0A 5DY2A 3MT1A 4DO5A 1OGSA 1RY8A 3KDOA 3TZNA 1JEZA 1YX1A 3QC0A 4D2JA 2AQOA 4QP0A 3CZGA 2NLIA 4AZ5A 4ZB0A 4REQB 1ZAJA 3W1XA 1VCVA 3QF0A 1JL8A 3N73A 1J10A 3RMJA 3GTHA 1KXQA 3TYEA 1M41A 2YCKX 4QJ3B 3FJLA 3GC5A 2OYKA 1NAL1 2CIPA 4LS2A 1ZAIA 4RNFA 2BOGX 1FOBA 3AYVA 4GC4A 3HTWA 1JJKA 1DJWA 1W1TA 4IX0A 2GVGA 1M03A 3PUGA 3ONBA 4HYRA 4N42A 4HNUA 3CQJA 3I3DA 1TR1A 4EXBA 1IR1A 4LH8A 1WDWA 1JXJA 3L68A 2E9BA 1Q6EA 2VZUA 3PTQA 4J28A 1U5JA 1NF7A 2ZVIA 1SO5A 2CHOA 1V0LA 3ZLGA 3F4CA 3SRDA 3NZ1A 3VNJA 1KA9F 3H54A 4GUHA 3AROA 5CXPA 1FH9A 3GVVA 4O0KA 3WX7A 1XLCA 1A5AA 1DJHA 3VOCA 1TB3A 4QSHA 2AMGA 4QCEA 1JQVA 2DW6A 4Q8MA 4GX8A 5E09A 2X16A 4XISA 3S2LA 1KM6A 4DY1A 4WSHA 1K6WA 1V7YA 4OIFA 3FK4A 4EPEC 5LHFA 4C6LA 3T0CA 4C6CA 4LB3A 1MRQA 3KLKA 2QJMA 3E0IA 1UA3A 3UYIA 2AL2A 4HHMA 5A8NA 2OSXA 2DSWA 1H0GA 3K4AA 4N0RA 3BZGA 3DZ1A 3CL7A 3IGUA 4IUOA 4AXNA 3KRUA 1VZWA 1KFWA 4POCA 1JZ7A 5IXEA 3WDPP 4HA0A 3V35A 2QGYA 1O5XA 3W86A 3KOYA 3TJLA 2IKHA 2DY3A 2C0AA 4J3WA 1TPFA 5C71A 4GLEA 1M7PA 2G4FA 2RDWA 4Z1DA 3WMCA 2R9RA 3H7VA 1D3GA 3CJPA 4U2YA 1GONA 2YA0A 5D2YA 3L21A 4Y9MA 3VM5A 3BMXA 3L5LA 1PCWA 3LNMA 2V3FA 4FIRA 4M6VA 1UD2A 1A5UA 1YDNA 3KCLA 4YU1A 1PWLA 1X6NA 4NASA 5EFDA 1XD1A 3J7HA 3GVQA 2BOEX 4LY4A 3O06A 5EU9A 3WJXA 2WPBA 4RCXA 3K4WA 1Q45A 5BZAA 1MW3A 2IQDA 3KTXA 2YGYA 4L1GA 3R25A 3IRDA 4XAGA 2C79A 2CU0A 2QMJA 4O8RA 1CB7B 4K2SA 1GQNA 3EYPA 3ITOA 5EA9A 3U5YA 3LXAA 2VC6A 1E1CB 2XSAA 4KT2A 2YKKA 3BOLA 1KTNA 2A7NA 2G37A 1ONWA 3KBNA 1JZ6A 5E0KA 2PDJA 4WCJA 4W8AA 2E09A 3C0QA 2W6RA 3RYSA 3S42A 4A8RA 2XIMA 5E1QA 2XGBA 4H41A 3JUGA 1E6SM 3W83A 1M7XA 4FNSA 4WVXA 3OOQA 3TJ4A 3S9IA 4PFMA 4LY8A 2XVPA 4LC8A 3V18A 1W1A1 1JXKA 1Y8BA 4L1XA 3EKGA 3S5NA 1QRQA 2VENA 3LCGA 3SCQA 2OODA 5HATA 2ZCGA 2Z2BA 3DENA 2WZMA 4HHHA 1S2AA 1WDQA 4MB3A 3AIEA 1JULA 3W73A 1FXQA 2WVTA 3FX4A 1ME7A 2UY3A 4XVDA 3CZKA 1C8QA 4MKVA 1P6WA 2A1YA 1U5VA 4HU8A 1W2PA 2H9AB 3GVWA 2XPKA 4BI6A 2VJXA 3SQLA 4AHQA 1ISZA 3LK6A 1S5WA 2EO7A 3IVTA 1J6OA 4M24A 2CXEA 2NV2A 3C52A 1ITXA 3K5XA 2J4GA 3NL3A 4AG0A 4CNTA 1DORA 4RDVA 2VWSA 1TMLA 2XFRA 5LA0A 2I57A 2E5CA 4TV5A 4XQ6A 3WD3A 2QJIA 4O16A 3AHVA 3S1WA 3P0WA 4DF2A 2ZRVA 2XH0A 2NXGA 2P10A 1EB3A 1TV7A 3VD5A 3ARUA 1K4HA 2IW0A 1YE4A 2UWFA 2FGLA 1CNVA 3LA4A 2XWDA 1MQQA 5A69A 2PP0A 4ZQCA 1KTCA 4BF9A 4YPJA 4PUNA 1TRIA 5AKQA 1C8YA 2I7GA 4CD8A 4GBUA 1LUCA 4O0ZA 2BVTA 1P0BA 1DJQA 3SQMA 1P48A 4BEQA 4DPPA 1DWHM 2GGJA 2AQWA 3B8IA 4BF5A 1YRRA 1SUXA 1FDZA 2PF0A 5FL1A 4LOCA 4LYPA 3AWNA 2OZ3A 3EWBX 4MAVA 2FDMA 3MKKA 4CNSA 1M65A 4IPIA 2A6NA 2V81A 3AALA 2V2CA 1RD6A 4HJFA 3SO7A 3CGTA 4LFYA 2WHLA 3SCVA 1UKSA 4MIMA 4F3HA 1EP1A 2QPSA 2YA1A 4ZR8A 2OZ8A 1FDJA 5H1WA 1BXBA 4P7RA 4DBSA 4GNKB 3POCA 3ID7A 4MB1A 1EEXA 4V1XA 3LHZA 3HZ3A 1QO5A 1A53A 2Q71A 4L4MA 4MHBA 2WC3A 2I5GA 1BRLA 1W1ZA 3KVKA 3NTYA 3ZXWA 3M47A 2CZFA 4HBKA 1U1UA 4W7WA 4QJ4B 3TN5A 5F2MA 1V6XA 4YTUA 1EJTC 5CG7A 4B3KA 2DUAA 2VEMA 2TPSA 3BMVA 3TTSA 1K9TA 3DG3A 5C8BB 1GK8A 2V2DA 2W9MA 2WXDM 4O1AA 1JQXA 4V1YA 2FGBA 1XIJA 4GZJA 3MANA 1QHZA 3W7JA 4ADSA 3T8LA 3DU0A 2GPTA 2CNCA 1JNEA 2PAJA 2Y5EA 1A5SA 1AZ1A 2KZHA 4GINA 1QI3A 3N17A 3PNZA 3CH9A 2BG5A 3CL8A 4D6EA 3W1RA 5IM51 1GKPA 3NM3A 1YQ2A 2G0WA 3KP1A 4B92A 2PCEA 3NNTA 4AZGA 4UTJA 4QFUA 1TA3B 3SR7A 3C0LA 3F2DA 1NFPA 4WY0A 2VC7A 1S2WA 5FL0A 4S3GA 1NF0A 3F4DA 2QEZA 4DJEC 4NXKA 4QNEA 4IMGA 3QLDA 2OLAA 2E6YA 2CBVA 1GQKA 3OBAA 3WNMA 3ARRA 4Z2GA 4JN6A 1EX5A 3CIXA 3SRKA 1I0DA 3RLGA 3CQKA 1J0JA 2XGIA 1J11A 1QPQA 3WQDA 1WXZA 3K2GA 2RJHA 3BAWA 1BG9A 2WLYA 3I4EA 3TTQA 3GTIA 3M0HA 3GQYA 3N15A 3MHUA 3ZFHA 5JH1A 2NW0A 1RCOB 2OKTA 5I7GA 3SDOA 2D1ZA 4GIEA 2PU0A 3T4CA 1JCYA 3V5OA 3GUWA 2BVDA 4E4FA 2YXXA 2TRSA 3HQNA 4HPXA 4DYEA 1NU5A 4NG3A 4GKTA 1F8IA 5BXSA 1RP9A 1BPLB 4CD7A 3GUGA 3PAJA 1UD6A 3UY8A 4CGTA 1KCLA 4E2VA 4PODA 3M0ZA 4DJFC 1OX4A 2BNJA 4MJMA 1SFLA 5J5DA 3PFRA 5HDRA 1YNYA 4D71A 4FK9A 2HBXA 3M5ZA 1QMLA 1J5SA 4JL1A 4NRRA 2CLEA 4I7UA 1L6WA 4TV6A 2PTWA 2CHRA 2YZ5A 3RU6A 2VNCA 1OGBA 3C2VA 4TXEA 3PJWA 1J5TA 3O6AA 1CGYA 3GDMA 2EJ1A 1ADOA 3LHTA 4GMEA 3SN4A 1I0BA 3MMTA 7TIMA 3DI0A 5FIPA 3MMWA 2BWGA 1Z41A 1TE1A 5GNXA 4JYFA 4B5XA 1V8EA 3GXFA 4C6BA 4DXKA 3E0FA 2EG6A 4JYEA 2WV8A 3PBMA 1H1NA 1W31A 3UESA 2HROA 2HISA 3TYZA 1UIOA 4PMJA 2KAUC 2VEPA 5GJMA 1KM1A 4URIA 3HFTA 4DELA 2CZEA 1EC7A 1EC9A 2Y5JA 2VGIA 5F2GA 1DHPA 2Z26A 4ZMGA 1V51A 3PZTA 2OU4A 3IJ9A 4F79A 3PBGA 1RBLA 1K1DA 4QX4A 1V6VA 2GDVA 3FA3A 1HIZA 3TLLA 4KCWA 4H04A 4N9CA 3LXCA 4IL0A 4FZIA 1P6CA 2DVTA 5BU9A 2PWHA 5A8MA 2V0TA 1K8XA 5EMMA 4CCCA 4OUEA 3NR0A 2HBVA 1TTQA 2PDQA 1LBFA 5T8GA 2PURA 2J8TA 1JZ8A 4DI8A 3S47A 4LAMA 3IJ7A 3CQ0A 4HNNA 2QF7A 3DKJA 5F1VA 3HGOA 3VDBA 4IZGA 4WKAA 4L6DA 4H8UA 4E3TA 1U83A 3LPFA 5XIAA 2I16A 1I1WA 3FLUA 3NPWA 1HO4A 4I9MA 3CAKA 4KWUA 4RNIA 4RZ5A 3MW7A 1NOFA 3NO1A 4PC8A 4HNCA 1QNPA 3NO5A 3DUGA 3PZOA 3C3NA 2X0HA 1TREA 1QBBA 1A5LC 2E6DA 1DHKA 4F0KA 3K46A 4K68A 1WP6A 2E7FA 3PC0A 1KO0A 2Y5SA 3RR4A 1E51A 3NDZA 1CBGA 3HV8A 2XUCA 1KFKA 1K3UA 3MUAA 1NWRA 2PZ0A 5CZJA 2NT0A 4W93A 4ACZA 3JU2A 2HE8A 5KZEA 1XYBA 3QR1A 4LW7A 1QU4A 2W3ZA 3G1YA 3G3DA 3TIMA 1JGMA 2UY5A 4C6OA 3TMLA 2J88A 1WO2A 5I2UA 3PZIA 4R27A 1R7AA 1V93A 4GUFA 4NJKA 1W5QA 3BLFA 2DSUA 3W02A 4I9JA 1JUEA 1PO9A 4Y90A 2WMIA 4B5UA 3AOFA 2OR2A 1G5AA 3DIPA 2QUTA 4UC5A 1EO5A 3PN8A 3ELFA 4BS0A 4NYYA 2I1OA 1G4PA 4UOZA 2ZXQA 4BR1A 5HJXA 4WIWA 1GZ1A 4IIFA 5CPSA 3UZZA 3UWZA 1DVJA 4LEFA 3LHYA 3BURA 3DGRA 3P0XA 4R85A 4F9DA 3L4YA 1E73M 2DIKA 4G1NA 5A6AA 1E9YB 4JIHA 4P7NA 2WMIB 3N04A 3W74A 2EJAA 3P3BA 2G8ZA 4U5IA 1PYFA 2IPJA 2ASHA 5GQBA 9XIMA 3E0VA 5AVHA 1S5TA 2OQYA 4U5KA 1UWAA 4L9ZA 3LBCA 4L64A 3EXTA 3CIVA 2J27A 2HPIA 1IEXA 4DHGA 5BRPA 2IPWA 3WLNA 2X05A 2IPGA 4ZB5A 2YYTA 3TYDA 5MF5A 2Z4GA 2XINA 4YJ5A 1ICSA 3MPGA 1QR7A 2GJRA 1UR9A 2J7GA 5HAOA 3DFPA 4J3SA 1KD0A 3LHUA 3AS0A 4LAZA 5G2HA 2FJUB 1OB0A 5BMWA 1W3LA 1DWIM 3GFZA 3M5YA 1US3A 4ECLA 1JRCA 2POTA 2BY3A 4O52A 3VD9A 2XFWA 3ABXA 2YCLB 1G4SA 3Q45A 3T0BA 1KC7A 1CLKA 1NTHA 1I45A 2X1UA 4JL2A 5JMUA 2F6UA 3WQCA 3R12A 1LL7A 3NZPA 4ZENA 4IMDA 3W2NA 1YADA 4O57A 3RM8A 3QZAA 3RJYA 2V5LA 2INFA 3ZJ6A 3I65A 1IWAA 2DPEA 1XQKA 3PUOA 1OFAA 1TQXA 3VKBA 2QUVA 1V4YA 2VVNA 4KH2A 1W2VA 2QCMA 6PTDA 4QGCA 5I3IA 4YTRA 2R91A 1XCFA 2VRKA 4JIRA 4QLLA 3THCA 4FOUA 4NJJA 4Q4RA 1VGAA 4AF0A 4MG4A 3EMZA 3U2EA 1Q2RA 1EJWC 3NA8A 5T26A 1FWDC 1KRMA 2YW4A 5DF0A 5BYWA 2XFYA 2OSWA 2CFFA 4H00A 5I09A 4IMEA 2YR1A 3KS5A 3ZZ1A 3IJQA 4KW2A 3S1XA 5KTLA 1FVPA 4JFUA 3AHTA 1MEHA 3NQMA 4W85A 3BGAA 1WXYA 1KW1A 1PTGA 5JBEA 2CYGA 8CGTA 4XTDA 5A5WA 4TTGA 3DFSA 4WUIA 4ICCX 1UKQA 1J01A 1YTKA 4TTUA 2O0TA 3LDVA 2QUUA 2WMHA 3VGFA 3ITLA 2QIIA 1OF8A 1XIMA 1NJJA 2ZICA 2VL4A 2DEPA 4LRSA 1E4IA 4F0RA 3GWQA 4LUSA 1PEZA 3MMDA 3ZWTA 1XX1A 4AWUA 3UGRA 1LYXA 4JQ1A 2Z2AA 3WFZA 5IBXC 2TSYA 4Q8PA 3WF1A 3UCCA 1PCKA 3HGJA 1AJ2A 1O94A 5TBOA 4PBEA 3QZEA 1DWGM 1YYAA 5CPLA 1XSIA 2HV5A 5A2AA 3EAUA 2Y24A 1FCUA 3C4UA 3INPA 4O14A 3W87A 2WO5A 2PDHA 2ZZ4A 3GBDA 1FWGC 2WLZA 3NQGA 1W91A 3EPMA 3RX2A 1EF3A 1EDQA 4JTRA 3HGRA 2O9PA 1AFSA 3PZUA 4YCPA 4GI4A 1PL9A 1M04A 3WK1A 3TNBA 2E8YA 3URQA 3VMPA 1UYQA 3VOIA 5DN1A 3BLOA 3AHXA 2A4AA 1G6CA 1EBGA 1PSCA 2A3BA 3L5MA 2ANUA 3B0XA 3JZUA 1RPKA 1ZUAX 4OOUA 2DVXA 1XFBA 1IEQA 2ZUVA 4NU7A 2FMOA 5BOFA 4W5ZA 1RZMA 3PZVA 4AX7A 3KTCA 1KM0A 4MKSA 3S2CA 2D73A 4AQLA 3UWWA 1J96A 3FVDA 4XV0A 1OZQA 3ABSA 3IGHX 3VDGA 4AY7A 3S4TA 3IGSA 4ZOAA 4I5UA 3DCPA 4OBSA 3W7EA 4DF0A 3WD1A 4DAIA 1YTEA 2DUXA 2FZ8A 3MI2A 1KR1A 4RW3A 2DFAA 1QTWA 1VFTA 5D38A 1RJQA 3CT7A 1R3VA 1TPVA 1E0TA 3LZ5A 4KQNA 3COTA 4FIQA 4DO6A 2W92A 5D30A 4HB7A 1V6WA 1QJWA 4OOZA 3D5HA 4GBDA 4US6A 3W7GA 3AMDA 3OVRA 2ALDA 5EB8A 4C1KA 2D0FA 4G8TA 4QAIA 1H5VA 1VKFA 1NOUA 1L6YA 1HZYA 1XBXA 1QASA 3B8SA 4ZB2A 7REQA 1PHQA 1QOPA 1UH3A 3RO8A 4W89A 1CGVA 4QROA 3PUDA 1S38A 1FH7A 1AQ0A 3S9YA 2PRMA 1A5OC 3N4EA 3FIGA 5FOOA 3LLDA 2R6OA 4QQUA 2R14A 1DE5A 1GZGA 2ZQ0A 4JR5A 1GKQA 2WSPA 3L66A 2VUYA 1TV3A 4FLSA 1K70A 1TJPA 4LVBA 3IIPA 2VDHA 3NPXA 1KXVA 3UJFA 2NXIA 4E5TA 3QSTA 4RZBA 3A3WA 4UTFA 5CJNA 4P7LA 2Q6ZA 1REQA 1THFD 3WELA 3TN6A 2PDMA 2FQIA 1QW9A 4KERA 3MWCA 5K9XA 4B5SA 3S5YA 3CU2A 4OFCA 2H9AA 1E0XA 4QITA 4OV4A 4NKCA 4DX3A 2LLEA 1UC4A 2NXHA 3BLLA 2QULA 2A6LA 1HP5A 2G50A 1BYBA 1I6NA 3UA3A 1VFUA 4XTIA 3VGDA 3LY0A 4LCRA 2H8ZA 1VF8A 4JHMA 2XJ7A 1JPHA 4MZ8A 1Z42A 3S8HA 1TZZA 5G4EA 4J5NA 4CNPA 4JHOA 2YJQA 4ZQNA 2VX7A 1VEPA 4PFHA 3M1ZA 1SO6A 3GBEA 4QXIA 2JEQA 4ZODA 2W79A 5IFTA 3EWWA 1LUCB 3CWHA 2QGHA 3ECQA 1KWKA 4DJED 3RUBL 2VMFA 1POJA 2ADAA 3BUVA 1W1VA 2B0MA 3MB9A 4K6AA 2NT1A 4M6PA 5DRCA 1DJYA 1E40A 3SUVA 3QR3A 2BY1A 3S5OA 3GAKA 1NDVA 2ZUSA 4RX0A 4IFOA 5EFFA 3R8GA 3G5EA 2DUZA 3GB6A 4K8GA 3WBXA 3CS2A 1E6PA 1ZNNA 4JN8A 2WMFA 2GJNA 3VPLA 1ALDA 2REQA 4QBXA 3I6EA 5KZ6A 4LV9A 4S39A 4XIMA 5D4YA 2J8GA 4AHPA 1PTAA 4KFOA 4RV8A 1Q3NA 4ICNA 1DE6A 4OU1A 4GVIA 5LGZA 3L9CA 2E9MA 4P8XA 3E3HA 3DYMA 3KW3A 1HG3A 3IVUA 3K1DA 3UVIA 1MO0A 1EX1A 3UZWA 1CEOA 4NZFA 1K9DA 4IJRA 1S5MA 4JTTA 4QQ3A 2EPLX 1ZCCA 4LNCA 3CB8A 4EPBC 1BRLB 4PCFA 3VOJA 5AC4A 5MHBA 1EJ7L 4JKLA 4Z42C 5REQA 3ZQ9A 1IEVA 1EXBA 3WJWA 1N8WA 2P0OA 5LIKX 3A4WA 3O9NA 3PM6A 4F4RA 3BG3A 2OT0A 1X6UA 2YW3A 1DP0A 3Q37A 3ATZA 4WDTA 1GVQA 1QHPA 1RCXB 2CLPA 2QCGA 3HPFA 4HHLA 3KHDA 4MJZA 4A8NA 5DX7A 2XIOA 3QH2A 1JCTA 2PDXA 4CN6A 1K77A 3N1AA 1X8FA 4R9XA 2WVUA 2DVUA 3MMUA 4TX6A 2OO0A 2YIHA 4LWWA 1YDVA 2WJZA 4DI9A 3TYCA 1SMDA 3CV1A 4US5D 4H2HA 2VDGA 3KBVA 8XIAA 4NI3A 1QATA 1CENA 3KL5A 2QMKA 3W29A 1ZL1A 3KP0A 1J6PA 2P3EA 1B3OA 2X40A 5CC3A 3KX6A 3NVDA 4AH7A 4HGXA 1HVQA 4A2RA 4ERAA 2WCGA 1J4EA 4KGJA 2FFIA 4JIPA 3G6LA 1T41A 3HG2A 3PR2A 2ZX7A 4Q8WA 1ONRA 4S3KA 3OIXA 2Q01A 2QS8A 4HMCA 4FXSA 2PC4A 2V69A 2QQ6A 3VYLA 4OGZA 2F2KA 4TVCA 3CHCA 1C7TA 3UVAA 3EKLA 4BKNA 2YFNA 1P0KA 1BVZA 2GVJA 1LQ0A 4MZYA 3A4XA 1OFBA 1XDMA 3W1TA 1MXGA 4WGXA 2VD8A 3U2CA 6XIAA 1S46A 4IIHA 1E4LA 3UT0A 1ZENA 4RW5A 2YSWA 3TFCA 2FLIA 1RALA 1UA7A 3B8UA 4HTYA 1LT8A 3QGAC 1X7FA 2HE5A 2E9LA 3W7OA 1E0UA 4DO7A 2X1TA 1QI4A 3VC5A 3UNDA 1EOMA 1JUKA 4X2RA 3SUSA 3W01A 5BWFA 4AEOA 1XIIA 2V5BA 1W56A 1C9WA 1H09A 4UTWC 3MHGA 2FGZA 1JCXA 2OZ0A 3S0CA 3LHVA 1HTIA 4GX9A 3G1HA 4F9JA 2OT1A 3MO7A 3A21A 3WD4A 3CZLA 4Z2HA 5DEZA 1MNSA 3VD4A 4JTKA 3AICA 3TYBA 2RGLA 3RMEA 4IT1A 3NZRA 1HVXA 4QNWA 1BAGA 1KGWA 4NAFB 4GIRA 1E5JA 4C1NA 1M3UA 3B4UA 4JTJA 1NFBA 3WLMA 5T91A 5D9MA 3HJEA 8TIMA 1YBQB 4JBRA 1KWGA 1WX0A 4GYPA 3EA3A 2QDEA 5DCBA 2O4MA 1K8CA 3U6WA 1WDRA 4FS9A 4INFA 4KFNA 4PMVA 2XH4A 3MA8A 4UQDA 1VJZA 3G6MA 5BXRA 2F8QA 3KZSA 5I78A 2WWCA 4OBTA 1AA1B 4A3HA 1FA2A 3E2VA 4GUIA 3W7NA 1P0NA 3E96A 3V1HA 3LRKA 5CPNA 3STPA 1U1HA 4TX8A 5HXMA 3MVTA 4ZBCA 4GPNA 1YNPA 5D8WA 3O6YX 1FWBC 3BCFA 2A3LA 3K8MA 2JGQA 4RNJA 4J2MA 1LL4A 3I7RA 4LANA 1H5YA 2Y61A 3QOKA 4S3FA 1V77A 4IPLA 1UMYA 1GOMA 3W1PA 1ZQ5A 3S83A 3UWUA 4R7OA 4IGNA 4PUMA 3OZYA 1LORA 3G2GA 4NY2A 1EL3A 5LHEA 4WX2A 4HCLA 4JDYA 5G2IA 1FDYA 4LTSA 3G8EA 1UUOA 2GL5A 3ZLHA 2D3LA 4CEXC 1J79A 1WOAA 5REQB 2G41A 3GYEA 5D37A 1PHWA 1VJSA 4XO6A 5G4HC 1T40A 3LGGA 4DJDA 3ARWA