1JXKA

Role of ethe mobile loop in the mehanism of human salivary amylase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
491
structure length
491
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jxkA01
1UQZA 1JZ6A 4AMCA 4NF7A 1C8QA 3IAQA 1W9VA 1R7AA 5A6AA 2ESCA 3B9EA 1VBUA 1GOKA 1FA2A 2ZUUA 2Z1SA 2EABA 1LWHA 4P7RA 1Y7VA 2D73A 3VDHA 1RP8A 3AIWA 1KCLA 3VX1A 3AISA 2XTKA 1LG2A 3HG5A 1HJQA 2PWHA 2PB1A 2NT1A 2PWEA 1XH1A 2VC9A 3CZ8A 1JAEA 3GZAA 3T0AA 4PMOA 1CXHA 3GXFA 5A8PA 1JYVA 4B15A 1JI1A 1MXDA 4FF5A 1CDGA 3AMDA 2OSYA 1TA3B 1E4IA 2YJQA 4UCFA 3WFLA 4FLSA 3RILA 4AW7A 2EXOA 2GFTA 2XN0A 3WELA 1CGWA 2BXYA 3AJ7A 1L0PA 2XVNA 2JEQA 3ZSTA 3GDBA 3F4VA 4AD3A 1CLVA 2YL9A 1GQKA 3VM5A 3J7HA 3ZT6A 5HOSA 3OLEA 4AZ5A 3F5KA 1JYNA 5D8ZA 1UHVA 3A24A 4GZJA 4P8UA 2BY0A 4AYGA 3OIHA 4KRTA 1H0GA 1KBBA 3WN6A 3ALFA 6TAAA 1GNXA 3W25A 4LYPA 2FH6A 3VIOA 3BCFA 1FHDA 1MXGA 2GDUA 3HMCA 3N12A 1BYAA 2PWDA 1UKTA 3CO4A 4V2XA 3N15A 3IJ8A 3AIUA 5C8BB 3CH9A 2J25A 4OOZA 3WD4A 4CU8A 4L4OA 2VVSA 3VVGA 2X05A 4EE9A 4TVCA 5JBDA 1TA3A 2VI0A 3VILA 2ZUMA 4ML4A 1JXKA 3BVVA 2CHNA 1G0CA 2G3IA 2CBJA 3S5YA 2QPUA 2XUCA 2OYKA 1BVNP 4AMXA 4AMWA 4E2OA 3AZTA 1E6NA 1K6AA 4CU7A 2D2OA 3FAXA 1C90A 4H8HA 1JIBA 1ZB5A 1HF6A 1JD9A 3VIHA 4BQ2A 1OWQA 5E70A 1JZ7A 4AC1X 1PBGA 4P8VA 4AZ6A 3AXXA 2VR4A 3TTSA 3SUWA 1V0NA 3WBAA 1V03A 1J0KA 1QI4A 4JL2A 1K9FA 3MANA 4JHZA 4F79A 4UFJA 2WKLA 3WQ6A 3WDIA 5I0DA 1EH9A 2WMFA 1KTCA 3WDPP 2FHBA 1NWRA 4D6JA 5FL1A 3T0DA 4L4PA 1JGIA 5FD0A 3FHAA 1W3JA 3SCNA 2WLYA 3H55A 3LPFA 1WO2A 2JALA 2GJXB 2ZUWA 4AZCA 3O6AA 3LPOA 5ABFB 4J28A 3EJTA 1GOWA 4GI6A 2WVUA 2RGLA 1UG6A 1EOMA 3SEPA 4H2CA 3DX1A 4A4AA 2ZICA 3ZJ8A 1UH2A 1E1EA 2V5DA 3W53A 2BNJA 2E8YA 1W91A 4MDPA 1OBAA 2PC8A 2C0HA 4D1IA 3CBWA 4HZ7A 1LL7A 4D6FA 5A6JA 1HXJA 7TAAA 3GXTA 4GXPA 1EHAA 1OT1A 1CGYA 1TQWA 2F7RA 4GZIA 4M56A 1J0ZA 4ATLA 4QLKA 4W5ZA 3ARQA 3RCNA 3GXPA 1MWOA 3WENA 1SYTA 2WSPA 3PZVA 1B0IA 1E6SM 1OGSA 2YL5A 3KL5A 1KR1A 4AEFA 1UD5A 1U2YA 1RD6A 3VDCA 3TONA 1H3GA 3PTQA 1OIFA 2A3CA 3AI0A 1BYCA 3TTYA 1E72M 1PX3A 4P7OA 4FNQA 2J8FA 1H2JA 2CPUA 1W1PA 3VTRA 1OGBA 1QHPA 3CTTA 4OZOA 2ZXQA 3W6MA 1V0KA 5AC5A 3PZUA 3GNOA 4S3JA 3VGEA 1R7OA 1ISZA 1WZKA 4PTXA 1VFOA 4WJXA 2WSKA 3MMDA 1NWTA 3GH7A 5M5DA 1QI3A 3THDA 3GXNA 1XGZA 1J18A 1Q6GA 1XCXA 2OYLA 1SR0A 3MO4A 2F7PA 2OWXA 1HN1A 1NOUA 2WWCA 2YDRA 3A3HA 4D6CA 3N18A 1ZU8A 1WP6A 3SCSA 1GHRA 4N0RA 1GW1A 3DX0A 2GDVA 3MSGA 2F8QA 5A69A 1UWUA 1FH7A 1G94A 3W29A 1D2KA 2Q8XA 5D8WA 2WHJA 3DYOA 2WMHA 1MQRA 3ARXA 3S5ZA 4P8WA 4MJ2A 2ZX7A 4S3KA 2J77A 2VZOA 4W8AA 3GNPA 1KXVA 1V6WA 3WFZA 2PWGA 4PMNA 3L4UA 1UD6A 1HVXA 5A6BA 1PIFA 1CXLA 3FHQA 3RPMA 4F9JA 3UETA 4PMZA 1QW8A 4WSJA 3EJSA 4NRSA 3AIQA 4H7VA 3WQ8A 5ABEA 5CGTA 1KGWA 1V6UA 2WYSA 4HPGA 2J62A 3AS0A 2VNCA 1TFVA 2YA2A 2J7HA 3I3DA 2VO5A 2EO7A 1I1WA 2FYVA 3UCQA 1W32A 6A3HA 3SCVA 4UQBA 2J7BA 3WL1A 1V3LA 3RM8A 1QW9A 3DC0A 4FLOA 2HVMA 5KZ6A 3D52A 2W92A 4ZE4A 5CGMA 3VNZA 1LWJA 3BLPX 4JL1A 4AIEA 1GZJA 1EDGA 3CHCA 1BG4A 4D6IA 1J0IA 2YKKA 1W9PA 2G4FA 3EDEA 1KXTA 2VUYA 2OWCA 3OGRA 3W24A 8CGTA 2DSKA 1E6QM 3WIJA 1HJUA 1O6IA 2WPGA 2CETA 2WBKA 3MS8A 1JFHA 3VSTA 1QNQA 4NSBA 1CYGA 3ECQA 4CN1A 1K9DA 1ODZA 3ZMRA 3T0BA 1HP5A 2ZX6A 5DO8A 3WMCA 3WY3A 2WMKA 3DX4A 1HJSA 1QX1A 4C7FA 1UR4A 5CZKA 4FNPA 3UESA 5BYWA 4NI3A 1UR2A 3A47A 3JUGA 2JFEX 3WNPA 3TTOA 3S6TA 4D6GA 3AIRA 2YDSA 1X1NA 4CUCA 1JNDA 3OLIA 1OD0A 2J47A 4PMDA 4CD5A 1UUQA 1GCYA 1MFVA 1XHGA 5DMYA 3SCTA 4NZJA 3PTKA 1CENA 3CGTA 2E40A 3POCA 2V3FA 3APGA 3AXHA 1MW2A 5A2BA 1KGXA 3WEZA 3EMZA 4AEEA 2WANA 3NSMA 1QHOA 3CMGA 2A3EA 4ACZA 1JZ4A 3GNRA 2XGIA 3DX3A 3KZSA 3UG4A 4JFTA 4YHGA 4BS0A 2FE0A 1IV8A 2X0YA 4TVDA 1GOQA 3H53A 3ARSA 3U5YA 1DTUA 4GQRA 5HNNA 3EMQA 3K8MA 3AS1A 1VEPA 2XIBA 2PBGA 9CGTA 1UA7A 1UD8A 1E6ZA 2VL4A 1UWTA 4R5EA 3D4ZA 3UG3A 2CKSA 2BVTA 3CHDA 1JYXA 3VPLA 1VJZA 1E6XM 3KWXA 1WE5A 5A8NA 5BXTA 3BSGA 4HA1A 3AICA 3D51A 5LA0A 2WM0A 4MAZA 2FHFA 3PTMA 2QV4A 3A22A 1OCQA 1UYQA 5A8MA 1GORA 1LL6A 1H41A 4TUFA 4TXEA 2FHCA 3VMOA 1R34A 2EAEA 1JZ8A 1N82A 2E8ZA 4OOUA 2ZE0A 5E6ZA 4PUEA 2E9BA 2EJ1A 1E4MM 1VF8A 4M80A 1GJUA 3ZT7A 5GNYA 1C91A 3BLKA 4UFKA 3EJPA 1QNPA 5TD4A 2VRJA 3SCPA 4D6DA 5CSUA 1E4NA 5A2CA 4CN6A 1GHSA 3ZQ9A 1HJVA 4CVUA 2J78A 1GVIA 3WMSA 4CD7A 3ARZA 2OW6A 4CN4A 1ZBKA 4D71A 1H4PA 1PJ9A 2IGTA 3LMYA 3BVTA 1DP0A 1BPLB 4PUDA 1WDQA 1E0XA 1V0LA 1UA3A 2J7FA 5CLWA 1E3XA 1V3MA 3WD0A 4NZCA 1PPIA 4HOZA 2VURA 2WB5A 4PMYA 3L2LA 4J3VA 5E9AA 3L4WA 1IZKA 5AYBA 4HA4A 1CIUA 2W62A 4WIWA 5A6BD 1UH3A 1OIMA 1R8LA 1VIWA 1E56A 5LYRA 2UY2A 2XM1A 4FNTA 4JKLA 1CWYA 2EPKX 3W28A 1LJYA 1JZ3A 1PX4A 4FLRA 1V3IA 4OKDA 4CVWA 1ZS2A 4JIEA 4HP5A 5A8QA 5BXSA 3ARPA 2QF8A 4FNRA 4ZXLA 2DT2A 2BY3A 2GUYA 1Q6FA 4UZUA 3OA5A 2E9LA 3N1AA 3QR3A 3U7BA 2F2HA 4HTYA 1CPUA 3A4AA 3QOMA 3NDZA 4Y7EA 4MB3A 3EYPA 2WAGA 1WDSA 1F4HA 2DPEA 3OLDA 1YQ2A 1XV8A 3WL0A 4B9YA 1M01A 3AFBA 2YIHA 4IUGA 1OGGA 1V6YA 1TQUA 3E1F1 3WQ5A 4QP0A 2YLLA 3D3AA 1V02E 1KCKA 1X6LA 2YL6A 3NIYA 1UD2A 1UR8A 3ARUA 3DYPA 2G3NA 3WF3A 1J9YA 4WKAA 1ITCA 4U2YA 3PZTA 3BUDA 2DIJA 4HPHA 5F7UA 1JDAA 1KGUA 1XSIA 1V6VA 4E8DA 4AY1A 2XPKA 1XH0A 3AHYA 3CLWA 4GI9A 3MUY1 5DEZA 4GZEA 4PEEA 4YHEA 4JFSA 3VGBA 3RDKA 4PTMA 3MMWA 1G5AA 3FN9A 3L2MA 3DHUA 4Q22A 2F1BA 5ECUA 3MU7A 4UR9A 4ATWA 3K1DA 3MUZ1 5EMYA 2ZWZA 2W63A 1KXHA 1GQJA 4AZCB 2GK1A 1TVNA 3WUGA 2XVLA 1H11A 4D72A 1LF1A 3BVWA 1E1FA 1D7FA 4DO6A 2VX4A 2ZUSA 2DSVA 3BVXA 2VRKA 2WKGA 3CUIA 1CGVA 3DDFA 2AOSA 1M53A 1RP9A 3AROA 2EBNA 2J7CA 2DEPA 3LXCA 1OSEA 3AMCA 3WY4A 3N11A 3LXBA 4IPNB 1CXKA 3WD1A 3A21A 5IFTA 2XFFA 4U33A 3K8LA 1WCGA 2F7OA 5JBFA 1XYFA 2BS9A 1QI2A 1GONA 3U57A 1EA9C 1SMDA 3ZR6A 2VCCA 3M7SA 4HOWA 5FOOA 1PAMA 3AQUA 1FFRA 1W1VA 3PHAA 1US3A 4R27A 2YBUA 3AHVA 1BVZA 1C93A 3TA9A 4RE4A 3VGFA 4CD6A 2D1ZA 2FGLA 1XSJA 4GKLA 1QOXA 5IDIA 3D4YA 3VD5A 3WD2A 2EPOA 3L4YA 1W2PA 3BAJA 4UOQA 4UTFA 3CZJA 2ZX5A 2NT0A 1GJWA 4W84A 3T09A 3THCA 1WZLA 4DUWA 1KQZA 3KEHA 4CD8A 4V28A 2E4TA 1WZAA 4AD4A 3B9DA 3N04A 2B31A 4XZWA 3U7VA 1WB0A 2BV9A 1KFWA 3WNMA 1ZBVA 5A6LA 5A6SA 2YA0A 4AXNA 3MUIA 2DIEA 3OLGA 3WDRA 3LRMA 1O7DC 3F5LA 5BROA 1NOFA 1EO5A 2CNCA 2JE8A 1CGUA 5E0CA 5LA2A 4DWSA 2XG9A 2Y8KA 4HA3A 4H8VA 5I3DA 1E4LA 3PZNA 3NDYA 1B3YA 4AD5A 1EXPA 1HP4A 1HNYA 3B9AA 2J4GA 1J0JA 4CGTA 4LYQA 3GH5A 2X1IA 3GM8A 3FW6A 3KE0A 1UWQA 2EACA 4BQ3A 4GO9A 1TMQA 2MANA 1QPKA 1GQLA 4AD0A 4DWSC 3W4RA 2HISA 3WY1A 3QHMA 1I75A 1JD7A 4JKKA 1JFXA 2G41A 2IUZA 2WHLA 3BUPA 1J0YA 1KWGA 3ARVA 1OM0A 3AHZA 3CPUA 1Q6EA 5GPRA 5BCAA 2DH2A 4QAWA 3PZIA 3G6LA 1VENA 2CBIA 4Z2JA 2F18A 5A3HA 4MADA 5HPCA 4RE3A 4W8BA 4QLJA 2WCGA 1OB0A 2F1AA 2DT0A 3WQ4A 3POHA 3WUBA 3BAWA 2C8NA 4FNSA 4WKFA 1V3HA 3WUFA 4MB4A 4FK9A 1ESWA 2ZWYA 3WF1A 3AIVA 4IISA 1M7XA 1UOKA 1KQYA 1UR1A 4HZ6A 1R85A 5HPOA 1FH8A 4PN2A 1E5NA 3A6OA 3EDJA 3DECA 2AMGA 2XVKA 1B1YA 2XIIA 4QDMA 5D9MA 4URIA 4LYRA 4QCFA 5AC4A 2OYMA 2UY4A 1E0WA 5E0FA 1K9TA 4J3TA 2WWDA 2ZX9A 2YL8A 2JIEA 5AYIA 5HBFA 4PCTA 2PBOA 3CZNA 1J01A 3B8SA 4BCEA 3CHEA 5IXEA 4HZ8A 4ACYA 5HXMA 2J7EA 3IAPA 3WDHA 3QHNA 1ZJBA 2FH8A 3WDQA 2UY3A 3WUEA 1J12A 2DGAA 1GVYA 4CKQA 3W38A 2WNWA 1NWSA 3LPGA 4W86A 1HJWA 2WXDM 3HG2A 5BRQA 4X0VA 4PMVA 1HKIA 2CESA 3N17A 2WC4A 1E43A 3KL0A 2V3GA 1RPKA 4U2ZA 1DWHM 1GOMA 2W5FA 4A3HA 2XN1A 4OGZA 4M81A 5DT7A 2GVYA 4NX0A 3OGSA 5A2AA 1JDDA 2ZXBA 3ZSSA 3ARWA 2J7DA 4BA0A 2D24A 1OT2A 1QNOA 4TTUA 5JUVA 4JKMA 1XSKA 1ITXA 7A3HA 3PZGA 4HMEA 4HU0A 3G6MA 3UR8A 1CZ1A 5A6MA 1D3CA 3QHOA 1EIBA 2WLZA 4ZXOA 2WMJA 1VAHA 3AYSA 4F66A 2VZTA 2D23A 2X09A 4Z2IA 3BAKA 1Q6CA 3ZJ7A 3W82A 1TUXA 1HJXA 3AS3A 2BY2A 4DM1A 1NH6A 1B31A 1TVPA 1W1TA 1R47A 5ABGA 2ZX8A 1WDPA 2YA1A 1I1XA 1B3VA 4MDOA 4Z2GA 3PZQA 4ACZB 4ZE5A 3L4VA 3A4XA 2VX6A 4NRRA 4UNIA 5I77A 4IPLA 4PMXA 1V3KA 2CBVA 1QI0A 2XSBA 2VX7A 5FIPA 5EB8A 2A3HA 5IFPA 4UQ9A 2DT3A 1VJSA 1E40A 1A3HA 1ODUA 4J3SA 1EGZA 4GIAA 3TOPA 2CEQA 4A3YA 2W66A 1HL9A 4B16A 2G3MA 3ZT5A 1DWGM 1G01A 2IXVA 4AYSA 4MTVA 3BUIA 1EO7A 4PMRA 2WZEA 1NWUA 2W67A 3VSUA 1TQTA 4W7VA 3OBAA 1E55A 1R33A 1HIZA 1VB9A 4M24A 2X2IA 4XV0A 1QHZA 2XN2A 2WVSA 2XFYA 1U33A 1R87A 1V3JA 2O9PA 3MMUA 2V38A 2A3AA 3NSNA 1L8NA 1W9BM 2D3NA 3ZIZA 5CJ5A 3CZGA 3LX9A 2BVYA 2YOCA 1B3ZA 4LXFA 3N13A 1OINA 3NJ3A 1J10A 4V27A 1XH2A 4UOJA 4K68A 4MJ4A 1C8XA 1QNSA 4BQ4A 3PZOA 4DO5A 1NP0A 1CNVA 3BMVA 5FCZA 3QGVA 4P7QA 1KWKA 3CZKA 4AD2A 3O9NA 2VZVA 5E6YA 2V3DA 5D4YA 5C71A 4DWSD 1VFUA 3K46A 3VO0A 4UFIA 1J0HA 5M17A 3WQWA 5IHSA 1NM9A 2Y8VA 3WEMA 1E6PA 3IJ7A 3BUQA 3KLLA 4UOZA 3VD4A 4TVUA 3M6DA 1A47A 1LLOA 5JBEA 1DWJM 3MKKA 1JI2A 1HKMA 1RH9A 2VJXA 2X0HA 3W26A 3VDAA 3MUAA 4OBRA 3PZ9A 3AHTA 2JF6A 4CCCA 1Z32X 4UFLA 2PI6A 3T2QA 2WZHA 4JAWA 2D20A 4FNUA 1UKPA 5CQ1A 3DDGA 4AIUA 3PBGA 5DT5A 3T08A 4U3CA 2J75A 3RJYA 5CPSA 1VBRA 1BG9A 4H41A 2YFOA 3T2PA 1M04A 2XGBA 4PYSA 3ARYA 1B3WA 1TCMA 4BZYA 3W27A 3WDJA 1VRXA 4XZBA 3MI6A 1BGAA 3W81A 1C92A 2NSXA 2PF0A 1W2VA 3U5UA 4WK9A 2OSXA 1XRVA 3WF0A 4WKHA 2QMKA 2G3JA 3QOKA 3A5VA 2EPNA 1JDCA 4KGJA 3BVUA 3SCQA 3PZMA 3VGHA 2QHAA 3VIFA 1JYWA 4C7GA 5CG0A 3UEQA 1VFMA 3EJRA 4BQ5A 5C70A 3AXIA 1QBAA 2CBUA 2XVGA 1O7AA 1CXFA 1K9EA 4HMDA 4U31A 1VEMA 3EJQA 1OD8A 2G8ZA 4OJYA 3AIBA 2QMJA 3HZ3A 1BQCA 2J74A 5BWFA 4AIOA 3BAIA 2BHUA 4MB5A 3GTNA 2DSWA 3VMNA 2WC7A 4HOXA 6CGTA 2EEXA 3VIIA 4RE2A 3FNDA 5CSYA 4MB1A 1GPFA 3VX0A 3II1A 4ATDA 3SCUA 1QWNA 4NXSA 2O9OA 3N9KA 1JZ2A 4W89A 3VD3A 4KRUA 5I2UA 3GXIA 1UWRA 4UQCA 2WK2A 4KWUA 1V02A 1AQHA 1VEOA 1V6XA 2GK1B 4D6HA 3WF2A 4W8LA 4MAVA 4P8XA 1BF2A 1CBGA 4WSKA 1GQIA 4GI8A 5I79A 4W5UA 4W85A 3ZJKA 4ZEPA 1FH9A 2BVDA 2CIPA 3BGAA 4OBSA 2VMFA 5FL0A 1SFSA 1ISYA 2TAAA 2VT0A 3VD9A 2JEPA 2EPMX 3MV11 1CGXA 3AZRA 2CKRA 1C3FA 3RM4A 1CGTA 2D3LA 2CERA 2E3ZA 5BXPA 2XM2A 1V0MA 3DHPA 3T2OA 1H09A 1E3ZA 1TG7A 3CZEA 1UKQA 4GINA 4AZHA 4DO4A 4WLCA 3VSVA 2CHOA 3BUBA 1R46A 3BAXA 2EADA 3VGDA 3RO8A 1CTNA 3PN8A 4B3LA 1BTCA 5AY7A 5EFFA 4DM2A 2J8GA 5D9PA 5CPTA 1KR0A 2XHYA 4D6EA 4Z2LA 3UR7A 5HDRA 3I3BA 3L4ZA 1R86A 1US2A 1W9UA 1BYBA 4AWEA 4JFWA 1FP9A 2OWWA 1LL4A 1PX8A 3WH8A 4PMUA 1XYZA 2WBGA 1M03A 3WF4A 4W93A 3KL3A 2E9MA 3WQVA 3FY1A 3WH9A 3UG5A 1C7TA 1NARA 1W3HA 2Z1KA 4J3UA 1J11A 3SUVA 4CU6A 2PWFA 2Y4SA 3BCDA 3SCRA 3UERA 5CLTA 2BHYA 4M29A 1HVQA 1VFFA 2O9RA 2GJRA 1DEDA 3CV5A 4JCMA 2OSWA 1WDRA 4DWSB 3SUUA 3CMJA 4J7RA 1E6RA 4UQAA 1UWSA 2BFGA 2W4XA 1ECEA 2VOTA 1NOWA 2C7FA 2V3EA 5LA1A 1ISWA 1E15A 3WY2A 1IZJA 3ZR5A 4JCLA 1QI5A 1WAWA 4J3XA 1UH4A 3F5JA 3MSDA 3WNLA 3EMCA 3S2CA 2YLAA 2EPLX 2YDQA 3WSUA 1TR1A 3KLKA 2WW5A 1B3XA 1T0OA 1EQCA 3VGGA 4C7DA 2J7GA 3VIJA 1UD4A 5EBAA 4EAMA 3BMWA 4U5IA 1EOKA 1G9HA 5ABHA 1C7SA 3IGUA 4PSRA 1FP8A 4MNJA 2UWFA 2DQXA 2WHKA 1LQ0A 1H0IA 4N42A 4Z2KA 2WMIB 2Y5EA 3LXAA 3BH4A 1HKKA 4P7NA 3W0KA 1ZBWA 3VU2A 2CCRA 1TQSA 3VUPA 1KXQA 3CUHA 2ZXDA 4PCSA 4PMQA 1C8YA 1MVYA 1GUVA 3RIKA 2XSAA 3VIPA 3TV8A 4TTGA 4LGXA 3L4XA 3OGVA 2XFRA 3WH5A 3BXWA 3NCOA 3OG2A 4ZENA 3LPPA 3EDDA 4HU8A 3ALGA 1JAKA 5A1AA 5E1QA 1HXKA 2ZUTA 3EDKA 2X8RA 4W7UA 3SUTA 4X9YA 4JHOA 1S46A 1R75A 3AOFA 4MNLA 1ZBCA 4NZFA 1HTYA 4UZSA 2VTFA 7CGTA 1AMYA 2WMGA 1UKOA 5CPQA 1Q6DA 3M46A 4P7LA 4EKJA 1E9LA 2ALWA 5I5RA 1XCWA 2O9TA 3CUFA 4KMQA 2D0GA 4MPKA 3CUJA 2W61A 1G1YA 4AISA 3WH7A 2XWDA 2WMIA 5A8OA 2Y24A 2GJXA 1AVAA 5ABFA 5D9OA 4B9ZA 1DWIM 1TQVA 1LG1A 4FLQA 4GQQA 3MV01 1EDQA 2J79A 4E8CA 1YHTA 5M03A 1JF5A 1W9XA 4J3WA 2D22A 4F8XA 4Z2HA 1UR9A 3AS2A 1B9ZA 1V08A 1MW3A 1W3LA 3A4WA 1WZMA 1XC6A 2W91A 3VM7A 3IANA 3NSXA 1HKJA 3ARTA 3TP4A 1H49A 2A3BA 2VQTA 1E73M 3HU7A 2DT1A 2UY5A 4H8UA 4JZ5A 3RMEA 1BSIA 3EBVA 4W88A 5IHRA 1FOBA 3GXDA 1XD0A 1QBBA 3CUGA 4TOQA 4TX6A 3ZJ6A 1PZ3A 4X0NA 4UQEA 2FDMA 2CITA 1BAGA 2OW7A 4AZGA 4U3AA 1MQPA 3VNYA 4NXKA 1HL8A 2IXUA 2WHMA 3HG3A 2DSUA 3CHFA 2VRQA 4KH2A 1TE1A 1IT0A 1JG9A 1H5VA 3K4DA 1BHGA 4M82A 3VD7A 4Q7NA 1UR0A 4AD1A 4H04A 1QNRA 4WF7A 2XYLA 2EQDA 4D1JA 5A94A 3OB8A 3WEOA 1UASA 3BC9A 1JL8A 3GBEA 3AMGA 3RM9A 1FFQA 1ZJAA 4FMVA 1XD1A 3BLBA 2X2JA 5FKYA 4JFVA 2JF7A 3VINA 3BAYA 3WNOA 4YN5A 2XWEA 5JIWA 2YBTA 3HN3A 3LRLA 4M8UA 3SIMA 1NP2A 1UKSA 1HWWA 3LRKA 4UQDA 3AZSA 3WD3A 2GSJA 3D5HA 1HT6A 1PEZA 2XJ7A 5I24A 1MQQA 5GQBA 1EHNA 1WPCA 4XX6A 3VDBA 5BXRA 1MFUA 3SUSA 1DHKA 4YPJA 1ISXA 2FGZA 2QPSA 1UZ1A 1UQYA 1PS3A 3SCWA 1TZ7A 1X6NA 4QLLA 1SMAA 4ZFMA 1JNEA 2VCAA 1B2YA 5A95A 4RL3A 3EJUA 1F4AA 3TTQA 3NUKA 3OZOA 1B30A 4M1RA 4BF7A 4DUVA 1KBKA 1CXEA 3K4AA 1W3KA 2X2HA 4E4PA 1E71M 3IK2A 1WNOA 3CIVA 1H1NA 1CEOA 5M3WA 3IJ9A 3SCOA 3M07A 2WCSA 1E70M 2WZIA 3CC1A 3FAWA 5A6KA 1W9DM 5D9NA 5DFAA 4KGLA 1SZNA 3VKKA 3AYRA 4MNMA 3SURA 3A23A 2OLHA 4OUEA 1AQMA 1JXJA 1U30A 4EK7A 3L4TA 3WH6A 3RJXA 1FHLA 3GXMA 4CD4A 2JIWA 2D0FA 2DH3A 4HMCA 3AIEA 3GH4A 1UZ4A 3W37A 1KTBA 5JIPA 2GJPA 5GNZA 1CXIA 1BYDA 1HX0A 5KEZA 3W6LA 3NYDA 2V5CA 4TX8A 2BY1A 3K8KA 2E0PA 4LPCA 3VIKA 2ZUVA 3WNKA 3ARRA 2VVNA 2CYGA 1AQ0A 2YFNA 1UWIA 4PRWA 1JF6A 2VZUA 3CZSA 4F9DA 3WMBA 1E5JA 2XVPA 2BXZA 4W87A 3BSHA 4EANA 4B3KA 3OZPA 2F7QA 4PSPA 2RGMA 1PZ2A 1KB3A 2DSZA 1WKYA 2WVVB 1CECA 2X2YA 1DWAM 1GOIA 4CCDA 2O92A 3HG4A 2WC3A 3AHXA 3D50A 5I6SA 3ZOAA 4JFUA 4OIFA 5I78A 2VZSA 1P6WA 1BGGA 4MNKA 4LX4A 2NW0A 3AMLA 2D0HA 5BRPA 4W7WA 4AZIA 2ZOXA 3O2LA 4UFHA 1MW1A 1E0VA 3EDFA 1MYRA 2QLYA 2WVTA 1BFNA 3ZO9A 5DF0A 2VCBA 2AAAA 1QWUA 2VX5A 3VMPA 1BLIA 4GPNA 1MW0A 4LQ1A 4UFMA 5CXPA 3WKZA 1Q4NX 8A3HA 4PTWA 3VIGA 4QFUA 1W1YA 4GO8A 3HJEA 3FXYA 2WCAA 4AZ7A 2VQUA 3CZLA 3GYCA 2VR5A 1EDTA 1JZ5A 3ZM8A 2Y2WA 1NQ6A 4CCEA 2ZUNA 3I3EA 3WBEA 1EQPA 4PTVA 3H54A 4XB3A 1PIGA 3AMKA 2DDXA 4IM4A 2ZXAA 3DX2A 3GBDA 5EFDA 3VOCA 1B90A 3WNNA 4AZBA 1DWFM 1GOOA 2ZIDA 4DUXA 2CXGA 2WVVA 4U5KA 4XUYA 3DYMA 4QCEA 1CLXA 3VIMA 1QVBA 5GNXA 5E09A 2BHZA 1UD3A 5I23A 1ZL1A 4PBGA 1ISVA 2F61A 4J27A
chains in the Genus database with same CATH superfamily
3NJMA 3NZHH 3SCMD 1EP2A 5JMUA 2JKJA 1S6NA 4X8XA 4XN8A 3OMAB 2UVEA 3NPUA 3PL6D 4HVBA 1LD9A 3CFJB 2GFBB 3GE7A 3DERA 4KDTC 4JFOA 1QUNA 4WHYG 2JCCE 1FFNB 4XN9A 2XTKA 3WQPA 5AOKA 1AH4A 4EIVA 2V5RA 3TYCA 3TW7A 2IMRA 4ELKB 2WLKA 5AWNL 3KXFB 3BKCH 2WN2A 2UZYB 2NSQA 3UOAB 3BLLA 4Y5XB 4UCFA 3NN8B 4RBPK 5ANMB 4XNYH 3EA2A 1CLVA 5JYLA 2OULB 3ZT6A 3N2BA 3F5KA 2HJFA 2VLME 4XQ6A 2C1PA 1Q2SA 3WN6A 1RUQL 3W25A 4CBZA 2B8OT 1IKFL 3B0PA 1FHDA 4XPBL 4PJGA 3IFLL 1BYAA 2P8CA 2QDHA 3QORD 3N15A 2X4SA 1P1ZB 4AK1A 3CAFA 4XAZA 4RNRB 1X5AA 2ENSA 3DX9A 1IARB 1ZK5A 4BUHA 3APNA 4GFTB 3ILDA 3HJ0A 5D70H 4KRNA 1ZB5A 2WPBA 3EB4A 2YRLA 4M4RB 1VCAA 1AHMA 4U1LB 4JL2A 4YDLC 1LE9B 4Z77A 4XB7A 4UTMA 3WQ6A 5FF7A 2NXYB 4L3AA 1QFWH 4A63A 4D6JA 3MRHB 3SCNA 2GJXB 4MLRA 1MWAB 4GI6A 2ZRYA 1ZLUK 1BXAA 3NVDA 1FO0H 3RX9A 3LRSB 3VFRB 2YGOA 1QRNA 4M1CD 1PB0A 1XG4A 3ECVA 4TN9A 1IB5A 4P5RA 4JZJB 4W5ZA 3LZLA 3CN3A 2NQHA 1E6SM 4DP7X 3I6LE 3UQNA 3T2LA 1LP6A 1E51A 2GQAA 4HX1A 3TZVD 2R15A 2NY2C 1HEJC 3CDGA 1E72M 4Z0SA 4WTZA 1DQKA 4EZLA 4DN4L 4HGKC 3NDYE 2ZF8A 3C2VA 5E5MA 2W81C 4HS3B 3VXRE 3KZPA 3DRTB 5DJCB 1TPWA 1ISZA 4WJXA 3UYRL 1CB7B 5M5DA 3LM3A 4YHNA 1QI3A 2M1KA 5K9JL 4PRHB 1BEYH 2R1XB 4C60A 4F58L 3L9EA 2OWXA 1H7WA 5EOTB 4DGUA 5FJTA 2PLCA 3VVWA 4X99B 3THMH 1ONWA 1WFIA 5IRPA 4MDRA 4MRBA 2JVUA 3PQYE 5DRWA 3M44A 3QW3A 2MUCA 4MJ2A 3SCMA 1GKPA 1YY8A 1M6OA 3IDNA 3QZWG 4PTUB 5I30H 2UYLB 1B9BA 5ESQA 2B7QA 1EWHA 4PJ5A 3DK0A 2WYSA 2J62A 5HUOA 4PFHA 1X7TA 2YA2A 4GOSA 4W9GC 4I90A 4HUMB 1YYAA 5IROC 2OJZL 1AR1C 3MB9A 5HVFB 3UCQA 3VXOB 2DZPA 3HVDA 3G1HA 3MBXL 4GG8A 3IF1B 3JYCA 4JL1A 4P04A 4XP6H 1KXTA 4KO9A 2BZNA 5LZLA 2FZ8A 2FGWL 8CGTA 4Q4MA 3K3QA 2AJZB 3W7CA 2ESVB 4I7WA 3B3BA 2NX5E 3THAA 3ECQA 1K9DA 3RHGA 1ODZA 4KKRA 5DQJB 1S7XB 1T1WA 1IJ9A 1IC4H 3TU9A 2IPKB 4WK0B 2XKNB 3C6LD 5BO0D 1U0QA 1A7NL 1VDGA 1AHWB 5B7MA 4FNPA 5BYWA 5JHMA 4QNWA 4G5AA 4PJDA 3OLIA 1MEWA 1RBOB 4EN2A 3NJHA 1F11A 3TLQA 1IEWA 4JN1H 3LSOA 3SHSA 2QJNA 5E9DE 3VNIA 4H8NA 3IMBA 2GJ6D 1WT5C 3H9SD 4AEEA 1TYRA 2VDMB 4KQ4H 4IMFA 3SKOB 3ESNA 4HIXL 2W80C 2QAPA 1KN4H 3SGJA 2BSBA 4XHQA 3Q0HA 2QZQA 5FF0A 4MS8C 3UADA 4QXTB 5DJDA 3VA8A 4D0CB 1SJEA 4LLDB 3LTSA 1AZBA 1LLAA 3MP4A 2DMBA 3CFEB 3MNZB 5F72S 1W5MA 2G60L 4HS6B 3VPLA 4IIQA 4O2FB 3RIFF 4F80A 3GDMA 5BXTA 4H2HA 2PFHA 1ECZA 1YE6A 1XGYH 3KDMA 1E5UI 2NYYD 3A22A 4KOCA 1UYQA 3S47A 4OUUA 4JHBA 5HD8D 1VF5C 3KR3L 3ZKSD 2RFXA 4X6EB 1EJUC 4FERA 4JBRA 4OOUA 4Z8FL 3QW4B 3PAJA 4H8WC 4XXCC 1E4MM 4UIMA 4OJEH 2OBGA 3FU8A 1GSKA 2NNFA 3GMRB 5GISL 1NDZA 5AC8A 2CU9A 2BGQA 3N1GC 3RBGA 4S1FA 5I8EA 2J13A 3F7LA 3Q94A 4AQ8C 3E6HA 2JCCA 4MCZA 5CLWA 1TPUA 1FLRH 3UJRA 2EKSB 3WS6C 1I9IL 1CIUA 3OR7B 5H8PA 3CFDA 2Y5JA 3IS0X 4E8GA 4IJTA 4G3YL 5F6HJ 1PX4A 1NFIB 1ZS2A 1EBHA 2Z7KA 3RGVA 4O18A 1U41A 1BG1A 5JXAH 1RERA 2F2HA 3GS0A 3QOMA 4A8RA 1EZSA 3EA1A 3U1QA 1JRCA 2I27N 4DIAA 1SFJA 3TJ4A 3QUYB 5IQ7H 2AS5M 3G5YB 4LPYA 5C09D 3U7YH 3G3LA 2V7HA 2YIHA 2BRRL 4A7QA 3PXJA 3QN3A 3DFSA 3UZVA 4GUQA 1BF8A 2NRDA 5JXEC 3L3DB 1EBPA 4GRWE 1YE4A 4LL9A 2OS7A 1XIWB 5HMSA 4AY1A 5L88L 3CLWA 5DEZA 5EPDA 1C8PA 4ZODA 5KSBF 5C0ND 4CSSA 2A7BA 4U1GC 4XMKL 4TVPD 4DIXA 4N8PA 3IDGB 3PSVA 5CWSA 5BJTB 1ZFJA 3WUGA 1P6FA 3BVWA 4M6PA 4I77L 1INDH 3IPFA 2X38A 4DO6A 3CL7A 1K5NA 4ZK8A 5BO1L 5DJ6B 5F8RC 3MLRL 5DX7A 1OAYH 1HZHL 2BWQA 3N11A 4LSTH 3QEQB 5ID1A 4Z7OF 3CZFA 1W72H 3SOBL 5JBFA 2ICWJ 3KPRB 3CH8A 1AD9B 3QZNA 5KYWA 3ZR6A 1MI5B 5DK2A 3OR6A 3C3UA 1DR9A 3DIFB 1US3A 2YBUA 2B20A 4IGBA 2FGLA 1TPC1 5BMFH 4LRIC 4PTDA 4YVXA 1M05A 3NWRA 3CZJA 2VKWA 4PGJA 3NXFA 4JZOA 1SF5A 1YJDC 3KMDA 1WZLA 1OSPL 4CD8A 1EJ7L 1WZAA 2J3SA 4HFWA 1A6UL 5L2KD 5H8DA 4ZPVB 2MPVA 1V7MH 1GTNA 2G50A 4LFHG 1URZA 3IXTB 3KBNA 4W9HC 1YEHL 5HGBB 4MZRA 1IGSA 5I66B 4C5ZA 3T40A 3Q6FA 4HJ0D 1UGKA 4FZEH 4A3QA 4CSPA 3UZEA 1NCHA 4FN0A 3NQCA 4IJ3C 4YDJA 2J6XA 3NDYA 1XCQA 4K6AA 3VXRA 3IJYB 2EHHA 2M83A 1ONQA 3KE0A 2VSDA 4S3EA 2E7DA 3NAAL 3UPMA 1U93B 2LLNA 5B3JE 3ARVA 2A9AA 5FJPA 5GPRA 3WLTA 3NSJA 1CCZA 2EVFA 4RE3A 4P2QE 4QLJA 3ME0B 3LTPA 4OLYH 1M6UA 3WUBA 4GGHA 2W0FA 4CADA 4LVDA 3MJ8A 1V3HA 1DVSA 3MXVL 3PQYA 4TQHA 1ASPA 5GSRA 3L3HB 5IEHA 3GMMA 4FABL 2Q20A 1NF0A 4I18A 3CH1B 2WN3A 4P59H 4BSVA 3FCTB 3WJJC 1YLVA 4DP1X 3B8TA 5E0FA 1W6LA 3QO0A 1E8YA 3QFWA 1J8HB 5IWLA 3ARFB 1ZHKB 5CZXC 3BH8A 2H2SC 2WB7A 3HS0C 1MRCH 3QHNA 1Q6QA 4ZZFA 1GVYA 3S2NA 5REQB 2DZXA 3NMEA 3LPGA 5FO8B 1RPKA 4GMTL 3IIZA 2ZZ7A 1QNOA 2GC4C 5AALA 1ITXA 5F2GA 2NX5A 4YBQD 4HMEA 1CICB 4B7IA 3S36L 3GTIA 1UQSB 5BW7A 1D3CA 3QZBA 2MQ3A 1H5BA 3T2NH 1IXOA 3SSJA 1TUXA 2CZNA 4HG4J 3OJMB 2GSMB 4N0CC 4JGJA 1K8XA 4HIQA 3SB0A 4ZE5A 4PR4A 3P62A 3FSVA 3V2AR 1BQKA 4M7ZC 2DJMA 5DMGD 1A3HA 5CJMA 3CNYA 4ACPA 5E9DA 4R26L 4P5TD 2UWEE 3R8GA 3CN2A 1EO7A 2CFFA 3ZUCA 4IKIA 1W8EA 3ZE2B 1JNHA 3ARGB 1BX2A 3E2QA 1BWLA 1UG9A 3BJLA 4IMKC 4NO3A 1NIAA 4ICWA 4JM0A 1L0XA 2A1WH 3LDBB 1Q7MA 1Y18B 1X6UA 4EPDC 3C0SA 5T3ZD 1QSFD 3KWWB 4YGVB 5B1JC 1A6VH 2XPZA 5HK4A 5DZPA 4UQ3A 1SHMA 4LB4A 5I2IB 1AGBA 4DWSD 1K3UA 1DOSA 1KM5A 3P73A 5K4ZA 3NXLA 1A2YB 1TE6A 2EDFA 4DQOL 3Q8AA 3KOYA 3V0SA 4P2QD 2FDBP 3ULVE 5F7KC 4LZKA 3HGRA 3OZYA 4G9DB 3AHTA 4MF4A 1ZTXE 4KKBD 1I8UA 1R3QA 1S38A 3FH8A 2JKAA 3VB8A 1LQAA 1PGRB 2EE9A 2ONEA 32C2B 4ODWA 1MF2H 4AWUA 4EIUA 4KWWA 1K3IA 3GMNB 2GBTA 2PXYA 1PCWA 2BP3A 1LEKA 3VIFA 4C7GA 3RY6C 2RTTA 1IGFH 3F7PC 4JKPL 5CINH 1N18A 4C6KA 4OZGB 2QVFB 1H3PH 4ES8A 5ISZE 5C0BE 1ACYL 5AOMA 3VGAB 3WJMB 3LSBA 3GXIA 1NICA 2VAAA 1AQHA 4C4UA 4D6HA 3KBEA 4ZBJA 3T8XB 5FYJH 2YRPA 5KITA 3WL9A 2TRSA 3T05A 3S5LB 4ZEPA 2B16A 3CUPA 3FVDA 3MBEB 1Q1JH 4JRYB 5FL0A 3UXKA 3TA3B 3GZPA 4E41E 2EPMX 4AYFB 4F7CA 5FA5A 3B1TA 1OC7A 4HS8L 2D4FA 1U5VA 1I3RB 2CHOA 1OCNA 1NIFA 3NCCB 4YEEA 5B7YA 1MDLA 3KJ6L 1CTNA 1JEZA 2B7PA 2XXFA 5EFFA 5JO5A 1TZAA 5EUKA 4XNMB 3HG1E 3HS8A 1EEYB 4ALAH 1W9UA 2AJVL 3LQAL 4AWEA 2C1GA 3Q44A 4JTSA 3WF4A 3W0WB 3WLJA 3C8KB 3KL3A 4J8RA 3FT2B 2NY5H 2Z1KA 3QUML 1FO0B 3TBTA 5GS0C 2WBJC 2F5BL 3LQZA 4WUIA 4YCOA 2O9RA 2PYEB 2WXGA 4OCRH 3B6SB 3ZE0F 4LU0A 4WJKB 3BUYB 4S1SL 4MOZA 4LHJB 1KJ3L 3V6OC 4IHBA 4QJ4B 3O9WA 3WEBA 1L3NA 1DQTA 1KRAC 4J3XA 3WNLA 2MNUA 2O5XL 3BG5A 3QCVL 3N44F 3B4NA 5I1GL 1SJMA 4EN3A 5ETUB 4NCC2 3WCZA 3JW7A 3TVMA 4MMXB 2Y5EA 1OK0A 4YC2C 4QRSB 2FO4B 1EYWA 3T1FB 1NDTA 2ZDSA 3AWOA 1MVYA 3MRMB 3FYEB 1U92B 3ARBB 3LQGA 4NC0B 1GKQA 3WJYA 3B83A 3II2A 3BISA 4ZQPA 2GTWB 2VR3A 3T0EA 4HETA 2UXGA 5DURB 2HXUA 1C9WA 4YSEA 4V33A 5BZAA 3V4VB 4I0PC 4JHOA 3A13A 5MF5A 4JEJA 1GYVA 1R24B 4QE4A 3L54A 3SM0A 1NU5A 3LGEA 1P4LA 3FRPA 4HDIB 4FG2A 5I0XA 3V52L 4JY6B 2WXKA 4XVDA 5C6PB 3EWDA 1S78D 1UUSA 4G1NA 1GKOA 5D9OA 1D6EB 3S5OA 1EDQA 4E8CA 1YHTA 3BGGA 3BGJA 2VLLA 2VENA 5C07B 1U8CA 5EUOE 4GAJH 3P2DA 1BF6A 1D6VH 3E74A 3INUH 2DYRB 2A3BA 1MEXH 3BDYH 1QSVA 1FOBA 3GXDA 1NOAA 3KRUA 2RH0A 4U6TA 4KJQD 2BIOA 1XIHA 3ILEA 4UANA 3H22A 5E5RB 1PZ5A 1RZGA 2APXA 1EPVA 2XSKA 5F7DB 2BP8B 4GISA 2ADAA 2SODB 3SECA 1K4CB 3GSNH 4UT6L 3BXNA 1S7WB 5CHNB 5F1IA 5CP3A 1LEIB 2QJDA 4XHJC 3DTXB 4Z0BH 4C6CA 2QGYA 5TGBB 4AXKA 4JY4B 4XO4A 1VZIA 1A14H 3O81A 4NQVA 2OL3A 2XJ7A 2BIQA 1NELA 2BINA 1N8ZA 3WBYA 3V0JA 3N91A 2OMTB 4DPCX 2UWEA 1MFUA 3SUSA 3FTSA 2YMXH 1LP9B 4ASTA 2ABAA 3BMXA 1ADQA 1IM3B 3L3KA 1XEDA 2DKSA 1ITQA 1TQCB 2CMRL 2VC7A 3NUKA 5I8OL 4A2SA 4A7SA 2I5GA 4KNSA 2JQZA 4QHLA 5D7JA 2XWTB 4GW4A 3FAWA 4L2YA 1SW0A 4RISL 2NXGA 2X87A 2YS4A 4JRFA 5LBGA 1N2RA 25C8H 4H0GA 3A23A 5D71L 3GSUA 5BQDA 3BIBX 4ZB0A 3DHJA 4JB9L 5KYYA 4LLWB 5I16B 5F4SA 1LDSA 5JPNC 4RFEA 3O3AB 2FUTA 1JP5A 4XN4A 3N55A 5AAMA 4ZUUA 3BP4B 4Z6AT 1AZ2A 5DXWA 3SDDC 4DKDC 4BEUA 2H6UA 3E2RA 1HHKB 4M6NH 1BGGA 4IF2A 1S7SA 1OY3B 5F7WC 4K5LA 3PWVB 4KKCC 4GMSL 2NW0A 1DYSA 4WI0A 3VSQA 2ZOXA 1WUFA 4DP4X 4N5EC 4BCYA 3H56A 3OX8A 4FJ6A 1SJVA 4LCUA 4UFMA 3FQXA 5ISZA 4AZ7A 1K03A 4CW1B 5C0BA 1RJZB 4MKMA 1H8LA 4ODSH 4LVOB 5D7IB 1W1IE 3DUGA 1GSMA 2WYIA 3E3HA 2B4CH 4K7PL 4XNDA 4M7LL 3LUTA 4W6XB 3OOQA 3CFKB 1TTIA 3REVB 1UQZA 4MNGB 2LV4A 5DCCA 3KM1A 1DVQA 4DEUA 4E41A 2G3FA 4NJIA 1WYJA 1GOKA 1I1YB 4G59C 4XBJA 2CXEA 1MELA 1TUPA 1KCLA 5HMEA 2B9BA 3WFBL 3BQUA 2ADIA 2EXSA 2NZ1A 2L7QA 2PB1A 1J8VA 5SWSB 3NPSC 3HG1A 3C4UA 1JYVA 4Y16B 4X5QA 1MXDA 3FEQA 4QEGA 4TLKA 1MLCB 2XN0A 5IJKC 4DYEA 1W72B 4R5TA 1L0PA 3EYUH 2VWEE 2WZPA 4MDJB 1PW3A 4GZJA 4OZIF 4ADIA 1M42A 1ZV2A 2NY4D 3GWQA 4QRPE 4RGNE 5HHQB 4XMUA 3CU2A 5HHOD 4HZLA 3ARDA 1XH3B 5AW1B 1NIBA 2AL1A 1C16A 3T6ZA 3JVFC 5E6RB 4HUXB 3RFZB 3JVGA 2OM5A 3EOEA 3MI3A 1LTDA 2X6MA 2MOGA 4CC4A 2Y7MA 2VI0A 4LEOA 3GVWA 1JXKA 2BCKB 3B7RL 5TFSH 3STBA 5JQ6L 2WQXA 3MTXA 4AMXA 3UJIL 3B9KD 2D2OA 3HIJA 3ZKNC 4NNXB 4MXWL 1MCEA 1VA9A 1HF6A 4CBPA 3CH0A 1J48A 4PRIB 3TO2B 2BOLA 3BZDA 1S5IH 4JPKH 4CLMA 1EH9A 2FHBA 4HIJB 3ATDA 1JGIA 5FD0A 1Y6KR 5FJOA 4XCCH 1CE1H 5C8JB 3O6AA 3LPOA 2YEQA 3E02A 2EYSA 5KW9H 4XPTL 4P23B 1HCVA 1U6AH 4DYJA 2FZBA 4OCXH 3B05A 5D30A 1T22A 4BI6A 4HZ7A 3DFTA 5BV7L 1WFTA 3OKEA 5KZEA 1UJ3B 2NDFA 1TIMA 3C5ZA 3B9VA 3MI2A 3NA8A 1IM9A 1SYTA 4C1LA 4NJJA 2YL5A 5EUOA 5AKTA 1U2YA 2IKJA 1QNVA 2NQCA 1ZANL 4BKTC 1ZCOA 5K9OB 2ATAA 3PPGA 3NIFE 5K1VA 3SDCC 3VTRA 1OGBA 4JM2F 5LO7A 1N64L 4P57B 2AK4D 4D3CL 2HTLC 2PDNA 4IHCA 4P9HL 5I07A 4ADUA 4GSRA 2EUWA 4TSAH 4M6OH 1XIMA 5BRZE 1BVKA 2AQPA 4ATTA 3KLHD 2NVDA 3PJLA 3GY1A 3VXSE 1NDMB 4S38A 4PV9A 3W1LA 4JFFD 4PY7B 4N0RA 3PAUA 3JV6A 2R0LH 1A6TB 2FWOB 3QDMD 2Q8XA 3OKOB 5EBWB 2WMHA 1LOLA 2Z1PA 1RJLB 3PBVA 1H3XA 4XZIA 4IH3A 2W60A 1RVFL 1WTLA 1OPGH 4GNVA 4F0LA 1MCPH 4JANA 5KTEL 1N59A 3F6JA 1AK5A 5A6BA 4JDBA 1PIFA 1PDKB 4NGHL 4APQD 1CXLA 4QI3A 3RPMA 4WSJA 2X89A 1H7OA 4L9ZA 1MCOL 1HO4A 2WYTA 2J5LC 2UZPA 5CGYC 3RX2A 2YSSA 1TPVA 2ED6A 4Q56A 1NJJA 1RQBA 3N6HA 3O7UA 3CDFA 1F3DJ 1V3LA 4HKZB 3PJNA 3VOHA 5KZ6A 5CGMA 2PF6A 4A6YH 1MFAL 1GZJA 5TDPB 4WFGE 1J0IA 2YKKA 5AVSB 2J9XA 3W9DB 3GJEA 4BSJA 1EYEA 1NL0L 1WBXA 5F44A 2CETA 2I07A 2WBKA 5J6GB 2CO7B 1ADSA 3RWIA 2NV2A 4Z78B 3VSTA 4CC1A 6REQB 4G8GE 4UTAL 2ZA2A 3MCYA 2E6JA 3S6DA 2WMKA 4WDXA 5CGQA 4DKEL 4J6IA 5DUML 5EU5B 3WQEA 1TQBC 3OGCA 2N01B 3COOA 1NCAL 3PWJA 3L0KA 1JNDA 4MJ6A 3TYDA 1J4EA 2P5WB 3MY9A 4F7PA 5MEOB 1K6QL 2VFHA 1Q7ZA 1A0EA 5HPMB 5A7BA 4FADA 3MRBB 2W9DH 1XYAA 2YPLE 2Y7DA 1CENA 3M1CA 3V36A 5MI0C 2QELA 3AXHA 3TU6A 3IDIB 4C6EA 1JF1B 1KELL 1EIXA 3MLTB 5EO9B 3MODL 1XYLA 1IV8A 1KJVB 4YAQA 3W3OA 5FO7B 1SJHB 1ZLDA 3K8MA 4ZTEA 1CT8A 2REQB 3HI5H 4UTJA 3OPZH 4WI9A 1XX1A 5H35B 3NL2A 3N19B 1YMHA 5D2YA 3D51A 2AJYH 3DTDA 1UCBH 4L8DA 4MD0B 5I15L 2OX4A 1X7IA 3X1FA 2WP3O 3P2VA 3MCNA 5D1XE 4PS8A 3Q1EA 2EJ1A 3UMNA 5FV2A 3D85A 4XAKE 1PLAA 3KBJA 5JHAA 4NJ9H 1C91A 3BLKA 3DO3A 1YECL 4DPBX 4G8FA 1WTGT 2X70A 1IX2A 4QF1A 1NGZA 4LIQE 3B2MA 2OW6A 3MSRA 4JFEB 3MT1A 3RPKA 3LMYA 4G8EA 4ANVA 4AEIL 2PD9A 3CVDA 2VDML 4PUDA 3I50L 2O0TA 2D7TL 4UV7H 4PMFA 1TREA 4UILL 3GMOB 1D5ZB 4PGDA 1ZHBB 3QXDB 2BMBA 1IZKA 4ZYKA 3U7WH 2VDKH 1OAQH 3HOGA 4F0RA 3UROR 1GC1C 3Q48A 1REQB 4FEZA 1CWYA 2IDUA 4YCPA 4BFNA 4FNRA 3NL3A 4OI9A 5KYNA 1PTZA 3DPDA 1JK9B 3QEZA 5F9OL 1AE6H 3VD0A 1YXCA 1KTKE 2TODA 2NW3A 4QRPA 5TQLA 3F64A 4FQQA 5MP6H 1R5VA 3MDJA 3IDXL 3QV8A 3QPQD 4HALA 3S35X 4RIRA 4YO0A 5CEZE 3JWNH 3DPBB 2V5JA 1KGUA 1A6WL 5JDJA 1WRFA 3CLMA 3S6OA 4R53A 3JTSB 3IWPA 3UP8A 4ATWA 2HH0H 3NA4A 5C0DA 4ZTPL 1KXHA 4KZEH 2XVLA 4PUMA 1LO0L 1A49A 1NBZB 2VX4A 3UZ5A 2QGBA 4U4IA 4NAJA 1HNGA 1CGVA 1A0CA 2IKGA 3RCYA 1NMBL 4XTDA 4BFRA 4PGEA 1I7UB 3ZBMA 3LXBA 3P11H 4IPNB 3TK7A 4XMLH 1XICA 5D4IA 2PETA 3RIAK 4ANWA 1XXDC 2I9LB 4Z7OB 3P54A 5AW6B 4XXDA 3N41B 5A6TC 1MVUA 4QITA 1L9PA 3HB3C 3QQ0A 1LMIA 3QAZB 2A3LA 1JGDA 1IT7A 4OIAA 3RWEA 5IQ9B 3IAGC 5C7XL 1G7HA 3AREC 4NUPA 1P53A 2ZX5A 3EO1B 1EPFA 3WKNA 2MIZA 5HHXH 1NTHA 2HRHA 4FQ1L 1FDLH 1K5WA 5FHBL 1WUEA 1PAZA 3QZ6A 2ZA1A 3QLDA 4AGMA 4AXNA 2PLTA 4IL0A 3QIUC 3ZW3A 3F5LA 5LIKX 1RZKH 2BH0A 4LJ3A 2J1WA 5IMMB 3VCNA 3NEOA 3VI3E 4LF3A 4X4YA 4LLAA 4Y2OB 1WFUA 3PRZA 1RFDH 1KXQE 2EINB 3GM8A 1UWFA 3CV2A 2YAOA 4BQ3A 4GO9A 4GSDL 2NUXA 4I88A 3OWRA 5C0EA 2AJSH 4YN3A 5BRZA 3GSNB 2CE6A 2XGZA 2VISA 4LPXA 4DO7A 1UZ6E 1UIPA 1GY1A 3VXSA 4HFUH 2NSOA 3CQJA 2IAAC 4KBXA 3VWJD 3QGKC 4MD4A 2MPAH 4G11A 3BAWA 1KD0A 4IIEA 4V1YA 2CDGA 3WUFA 1T7YA 4K55A 5AVRB 4K94H 3UC0L 3D12B 1GW6A 1RI8A 3NR0A 1B1YA 2Y22A 5C6TH 4QCFA 3QDGE 4UWMA 3MSPA 4PCTA 3ZE1F 1RV8A 4GW5B 1K6WA 5D72H 4MJZA 3RG1C 1RZJC 1B4JL 4FQCL 5EKYA 2UY3A 5IY5B 4Z0XB 1U9KA 4O50A 1E4WL 2WC4A 4NENA 3WD5L 3WHXB 2BOCB 1JWSB 4WU7A 3SPVA 2WLIA 1ET5A 3S5LG 4X4ME 3PZGA 3P7YA 4PB0L 3AAZB 3AYSA 4G8GA 2GQ8A 1JQXA 3WQOA 5HGHA 1AR2A 4C57C 2WINB 3MJ7B 1YBQB 2BX5A 4DNHA 4TQTA 5FFGA 2ED8A 4NKMB 5F93C 4GCAA 2YC1A 3AB0C 1VFBB 2CBVA 1QI0A 1MH5A 4ORGB 3IFPB 1DN0A 1OWRM 4GG6F 4Y8AA 2QR6A 2DVTA 3GO1H 3ESVF 3CHVA 3MFFA 4FXFA 2YPLA 2IMNA 1KLUB 1FWCC 4AYSA 1JRHI 4PUJA 2Y25A 3LLFA 1A9BB 3O6KL 3MXWL 4PP2B 2A83B 1NCNA 3UA3A 4OLXH 2J6EA 2X2IA 3VRJB 1UOLA 1IHIA 3KLQA 4JNZA 3F7QA 1ZS8A 1JUBA 4NRYB 1CZ8L 2H9AA 4V27A 1PLGH 4NRXB 5BOZG 2GQ9A 5TQ2H 3PZOA 4WI7A 2CLHA 3QGVA 2RALA 5IOKA 2GDQA 4O2CB 3S6CA 4I1RA 5BRBA 1Q66A 4KZ0A 2KH2B 3MOAH 5HVWA 2OODA 3MRLB 2XACC 5L4JA 3M88A 5D1XA 3WEMA 2JJVA 4QWWD 4UOZA 3G1FA 5CEYA 1GZQB 1BFTA 1WEJH 3PVFA 3VDAA 3TN4A 4ANKA 2IDCA 2PI6A 3VG9C 4HNNA 4HUUA 1HQTA 2ZJSH 1KLFB 3CNKA 3R7QA 1AAJA 4KK8C 3X2QB 5C3LD 4HZAA 4FNLH 4BZYA 4FEIA 3NRPA 4F1ZA 1DUZB 3T71A 4J1UB 3QOKA 2J66A 5F1KC 4MFDA 3SCQA 4URTB 4PJXF 4PUUA 4PRNB 3VC6A 2MCAA 4GWEA 1YEFL 1I53A 4LBRA 2ISWA 5GGQL 3FTGB 4ZSTA 2MOVA 5B1KA 5FB8A 3W7IA 4E5TA 1FKWA 7FABL 4F15C 2O9OA 3QHZH 1H5YA 3HNTH 3KPPA 4PJ8D 1UPMB 2WK2A 1RZMA 1P9MA 2EEAA 2GK1B 4C1NA 4DCQB 5EU7C 1KPUB 1DCEA 2FZMA 3NZHL 4Z7QF 1FHVA 3NQDA 3F7JA 1T20A 2Q71A 2H8PA 5FUCE 3TJLA 3RDJA 3E6FA 1YIXA 2JEPA 4R84A 3CN0A 1YRKA 5BXPA 1E5ZA 2PD5A 3JZEA 1FI8C 2FNWA 3U6XA 1ILSA 1PY9A 3BAXA 1J88A 4JN7A 5HJ3A 1MO0A 4MYXA 4PRRA 1T03H 2ICEB 3FB8A 3BKCL 4Z1YA 2E68A 5JIKA 1U83A 4R8WH 1YZZA 3ULUH 1Q8MA 5HGDA 2HPOA 4LDOB 4XNYL 1LE5B 4Y9NA 3CSPA 3ES6A 2R2BB 1FWEC 4CNIB 2IF7A 1EVUA 2R9HD 4KPHH 2WZMA 3QPKA 1BA9A 2GJRA 1WDRA 3SUUA 3L95A 1M65A 1GOXA 4E0RA 3KH3A 3ZE0B 3U4BL 1VPOH 4N0FB 3ALPA 2ZYRA 1YPFA 3M0HA 2YDQA 1XX9C 1T5AA 4PJBF 3RURA 1DVFC 1EQCA 2YOAA 4NQDD 4C7DA 3VFVB 4E9SA 3NYZA 3O4LB 5EBAA 4EAMA 4IQJA 5T5NG 5D70L 2HSAA 3CHSA 4E9XA 5CCKH 3VI3A 1LQ0A 3NFUA 3R18A 2E6QA 3E6EA 4YE4H 3S34L 1T2JA 3VUPA 4TNVF 1KXQA 2QBWA 4J4PA 4QRUB 3CXDH 3ML9A 1I31A 3RB7A 1NA8A 5ITBH 2FGBA 4MA7H 4O19A 5A1AA 5D1ZA 1BZ8A 2X8RA 4GKTA 1FO0L 3RWCB 2GJ6E 1Q13A 3H9SE 2FFCA 4U1JA 4PV8A 5T3XD 1QRKA 1OCOB 1EAJA 4OH2A 3D2UA 4XBSA 4Y4HD 3DHDA 4NHCH 1F90L 5IBXA 4E5XB 2O9TA 2A6JB 1RHFA 3CUJA 1G1YA 2VEIA 2EDMA 1Q38A 1ZKAA 1RK6A 4RNHA 2Y24A 1OX6A 3VYPA 3QDGA 4QAIA 2VXSL 1OSZA 3LIZA 2XU2A 2AMUA 1ORQB 3GIPA 1NFDB 2E5EA 1OLLA 4KY1H 3NSXA 5L4MA 3WIAA 4YL2A 5IB1B 4A6YB 5DO2D 1KCZA 1DVJA 4QTHB 3KCPA 4ETYA 4W4NA 2YPKB 2DWEB 4JQ4A 3V4VH 4FQIH 4X4MA 4IIBA 1IR1A 2QV5A 1FNSH 4P4KC 2XI9A 3TIDB 1FWFC 1BXCA 3K6FA 5DD6A 3HG3A 1NAMA 4KH2A 5SX4I 2HK1A 3HE6C 1RUPH 2VDOB 1M9SA 4IMDA 1QJWA 4YFEA 3PL6A 1J5SA 3TYEA 3GBEA 3R8QA 2BNUA 1XD1A 5HHNB 5CFAA 4HVXA 1LYQA 4UT7H 1RSFA 3OKDB 3CV1A 5I30L 1F45A 4GACA 1HH9B 2ZT9C 3U9UB 2PMQA 1EAPA 3AO0A 4LSDA 3E2VA 3QARA 2BOBA 3TE9A 1CURA 1T0MA 4HBKA 2ISSA 2MOQA 4B9IA 1A9EB 3BZ4A 3UGUA 1D5XA 2IAMC 1UZ1A 2XX1A 1GG0A 4X9GA 3M47A 5A95A 3WSQH 3PR2A 3OZOA 2DTSA 5BS0B 1CXEA 2KLRA 5C09E 3K4AA 3WE1A 4RRPG 1TV3A 3VWKD 1E71M 1J79A 1QT1A 1IGIH 4KRLB 4JIRA 3RRAA 3CC1A 4IJBA 3QORA 1T6MA 5A6KA 4WQ6A 1DDHB 1VHCA 1EZVY 1IC4L 4FSAA 4G80A 4PCPA 4PIBA 4MNMA 4KK9D 2GK0A 1WCBB 4HCDA 5JHLH 4TVPE 1KTBA 3SDAB 3EBGA 1CXIA 3PWIA 4DBDA 5C0FA 4PRBA 4TX8A 5G1YA 1RZPA 1L7IL 3GT6A 4JE4B 4JN1L 1IE7C 2VZUA 1XLJA 4Z1AA 2XH0A 4B3KA 1KBGL 1A5BA 3QZLA 5F3HA 3L1EA 4KQ4L 1SEBA 4UM9B 2HJPA 4HNCA 4YHZH 1KN4L 3T78A 4JTEA 4Q9CA 2DWDA 4R7DA 1NINA 1NANI 3M5XA 2ZWSA 8FABA 2OCCB 2D3JA 2VDKB 4GXMA 3B2PA 4OLVL 1YYLH 3CN4A 3HGSA 1MW1A 1XQLA 4YHOL 3D0VA 3CT7A 3TJEH 2L04A 1BLIA 3TYFB 4UUJA 5CKSA 4CC0A 1FWIC 1T1YA 2A9MH 1UUOA 3DRQA 4RNIA 1W6WA 4EUPA 1IGJA 2UX7A 5L2KE 3N34A 3AVEA 2ID5A 2DLTA 2VN4A 2CO6B 1GOOA 3TZVA 4MA1B 3ABMB 2EH8H 5MEQA 2FJKA 2NY0D 3GVVA 4K3EH 5EO1A 3QRBA 2ZSWA 5EPMB 3EJZC 1INQB 4L61A 3LS5L 2G5BB 4I9XA 1S1RA 1W0YT 3CLFH 3Q37A 1Q9KA 4PCYA 2R29H 4MJMA 2MTPA 4KKZA 3AISA 4U1MA 1FLRL 2YSWA 1RZ8B 3W86A 4E4UA 4L3CB 4WEBH 1JPKA 3EOAA 1B0GA 3PM6A 2WNGA 2I85A 5I73B 1A50A 1COBA 4N02A 4WWID 2COQA 5JXAL 4FKKA 4N68A 5LGHL 4QE1A 3GDBA 4UAOC 4AD3A 2F8XC 1F8MA 1JYNA 4JTAA 5IQ7L 5EBMA 1NLBH 2YUXA 2R69L 6TAAA 4YX2H 2OP4H 2Y61A 2DW5A 2B59B 4K1WA 4I7UA 5K93A 5JUEL 4LC8A 4CU8A 4XVEA 5BZDA 2X05A 3CYVA 3MMEB 4PL1A 2ITCB 7PCYA 5AHIA 2AANA 2YJLA 4PREA 4HC1L 3MROA 1HAWA 1INDL 1E6NA 3C6LA 2R4SH 5ESVA 4QSHA 5MKGA 1DPMA 4WI6A 1OAYL 2YYTA 2CO2A 4M19A 3AXXA 4LSTL 1K9FA 3G7TA 1SLUA 2H3NA 4UFJA 4ZUWB 1VGAA 4AQEB 3WDPP 1NWRA 3FTUA 4JDEA 1SHXA 4Z42C 3TWCL 4POCA 3FQUA 5CMAB 3EJTA 1TTPA 2GJ6A 2X6BA 3H9SA 4Z23A 2Z3FA 1R3HB 3CMOH 5BMFL 1AZUA 2M26A 1CFTA 1NBVL 4NAFB 5K5YA 1OBAA 3DK2A 3QY6A 1I9RH 1UEYA 2QKIC 2PGFA 3UU0A 6ALDA 1V7ML 3V5CA 3UYPB 1YN7A 3Q3GA 3QUZC 5F8QC 5T3ZE 1QSFE 3UC2A 2NY1C 2G5UA 1U8MB 2A3CA 2W9EH 3EGDB 4MXVE 4Y4FB 2J8FA 4BHUI 4X60A 2NY3B 3QO1A 1I8AA 2CPUA 2R7EA 2VABB 3CTTA 1PWLA 3W6MA 2GPZA 4PG9A 2HWZH 4TNWF 4GBDA 4GKNB 4KFZC 3MMDA 1KENL 5IB2B 1X38A 3LRHA 2V0TA 4FFYL 1KFBA 1TU2B 4DJED 4PP1C 1WDWA 3DFOA 2RAGA 1E0UA 3L45A 3MSGA 5KANI 3BOXA 4LHQB 4A3RA 3RE0A 4FL4B 4HPNA 1OFRA 3UTQA 3OW1A 5BQ7B 2VZOA 3G6DL 2PWGA 4P59L 1UD6A 3QH3A 4KKAC 3FTYA 1WGOA 1L5GA 1EJ6A 3F6IA 5JORB 1Q0EA 4ORMA 5ABEA 2AFNA 1I1AD 2J7HA 2WUBH 2XX0A 3KGTA 4Z7UB 5HMFA 3SCVA 4PJ9B 3ZL4H 4Y9PA 3DC0A 3BWAB 1U8IB 1SR9A 4Z3GA 3FU7B 2VDQL 2OOGA 4KTGA 5C09A 1A53A 3OGRA 1LWIA 1WISA 1HJUA 2OXGB 5B7EA 3T2NL 4TV6A 3D5OF 3KG5A 3LM7A 3PNZA 3R43A 1TVHB 1XBVA 1AJ7L 3MYJA 4ABUA 3WY3A 1D3HA 2PRMA 4OTXH 3F7RA 2H2PC 1PVHA 2VEMA 5GGRB 3FT4A 1YYMH 5CNHA 5E00A 1OD0A 4MCMA 2YXXA 1ZGLB 2ORBH 3PTKA 1ALDA 4H6QA 4XZMX 4EI5D 4NILA 1U3YA 3OAUL 3WUWA 1BKSA 3PUOA 2R1KA 3EX2A 1S3HA 2WNXA 2YUVA 3QFGA 1PKQE 1OP3K 2E67A 1MHHB 3RJOA 3RZCB 2FE0A 3IACA 1QDSA 4K71B 2A1WL 5DHEA 4C83A 3O8XB 3AS1A 2YD0A 1KY6A 4BELD 4R5EA 2CKSA 4OD2A 3T3PB 2XN9B 3OGOE 1NBYB 1R3LA 1WE5A 4LSBA 2V63A 4UTTC 2WWMD 3TFXA 2FL5B 5L2KA 2PABA 1OCQA 5AW8B 1H41A 4AENA 4KI5C 2EAEA 3SQBA 2EH7H 1AY1H 2YZ5A 3OAYK 4NPKA 1F76A 1E9OB 5T1KB 2BVOA 4V1DB 1P6BA 2IH1B 3VOFA 5G4WA 1I7RA 5HAOA 2E77A 3VFMA 2QCGA 3NPZB 3ZXAC 1P4IH 4Z7WE 4QNEA 4X7SH 2QKSA 3ARZA 4LOUC 1A64A 4JFYB 1A25A 1EEPA 4ENED 1DP0A 4HJGB 3HFTA 4KCUA 1FORL 4LRSA 1UFGA 1E3XA 3N29A 4WO0A 3RUGF 1ZVNA 1I4FB 4WEVX 1OG0A 4OJAA 3BD3A 3LERA 2X0VA 1AS6A 3V9FA 3UGEA 1KCWA 2X10A 2YXOA 1JZ3A 2O6CA 5CINL 4YIQA 1H3PL 2GLKA 4JIEA 1YTEA 4Z9KB 3JSSA 4LBUA 1J6PA 5IVZB 5I7GA 3MA8A 1HZKA 3P8IA 1HXMA 1UUNA 1XL6A 1T1XA 1S3RA 3MCKB 1YEYA 1G7PB 4N2HA 3OLDA 1XV8A 4FQXB 4S2SB 1ZHLA 3WL0A 4HCRH 4X9BA 5TH2B 1TQUA 1JE6A 4LSVL 5AVVB 4QP0A 3KYKH 5FYJL 1QD0A 3FTXA 3V18A 4YR6A 2FVNA 2DM7A 1Y0LA 3IN0A 3WJLA 5J1SC 3ANUA 2QVHA 1Q1JL 5B4MD 1TEGA 2NY6C 3U36B 2MHAB 1W1A1 3LNPA 2F6UA 1U21A 2PURA 4MNHB 2XV2A 2QZ5A 5IB5B 3PY9A 4HHAB 2QCMA 1C5BH 1DQUA 2O5YH 3LLDA 3T9WA 2Q87A 4AVJA 2WIIB 1TTFA 1UUMA 4DKFH 4ALAL 3S8FB 4P49A 3OHXA 4EX4A 4GIPD 2WQSA 4QG8A 2KPNA 2F7OA 1WWWX 2NY5L 3JWOC 4J2PA 4KDVA 4X6DB 5I6XC 1ETZA 3ZHLA 4P5TA 1WFOA 2W3ZA 4C6MA 1TYEB 4F8PA 3RVUD 1XGUA 2Y1ZA 2X53A 3C86A 3WD2A 4CEUC 3EFDL 1MOEA 4HIPA 3IGHX 5CIPA 3GB7A 3ISIX 3EX6A 2J8UB 1NTDA 4A21A 4HUWA 4XZWA 3UTSB 4WGVB 4FYQA 3AM8A 2W95A 4K9EH 5GS2H 1GZPB 2XZAH 4X22A 3U2IA 1QSFA 2DIEA 5E2WL 2FEDD 1NOFA 5T1MA 1TTBA 4L8CA 4HPXA 4HSOA 2JE8A 1LOSA 2ZQ0A 5GRVL 1HHJA 2J1KA 4DWSA 2Y8KA 4S0HA 4F3HA 1X5FA 1HNYA 5LGZA 4XI5D 4UTBH 4O11A 4P2QA 2YCIX 4YHKH 3FQYA 3G22A 3ZTJG 2YR3A 4L3ED 4LLVA 2W65B 3T3ME 5DT1H 3ZUNC 3CPUA 1H3TA 4AYMC 5E24E 1SW7A 5HPCA 5IW1A 5HHME 4MFHA 2J6WA 1C08B 3DOHA 3ZHNA 1ESWA 4H6EA 2JXMA 3BW9B 3QSKB 1ESOA 4GD0A 3EWUA 1A3LH 3A6OA 3RR1A 3CCHA 2AMGA 2JK5A 4R96B 3EPMA 4JREB 2UY4A 5HHPB 2IBZX 2JNZA 4RE0A 1DIOA 2A74B 1AI1L 4DZ8A 4GAJL 5DVMA 1OARH 4LO9A 5ES4B 4ZOCA 1D6VL 4ACYA 3GKAA 5JOEA 4FC3E 1BQHB 3INUL 1MEXL 2OR7A 5CU5A 3QYQA 2Y7QA 4TQIA 4CKQA 4XZUB 5EZIL 2ZKWA 3G77A 3TO4C 3BDYL 4HSQA 2DBLL 1HYSC 3IJHA 2E3VA 1P48A 2ZUYA 2IPTH 1WWCA 4P48A 3EHBB 3ZDXE 2H3XC 1P0DA 4UTHA 4PS4H 2EILB 2I60H 1JJKA 4J2XA 4S3BA 1KCRH 1UM6L 1B4TA 1KFCA 4NP4L 1AC6A 3UZYA 1VH7A 1Z2KA 4Z0BL 4L8BB 5AFAA 1I9CB 4IPLA 3V8CA 1JWMA 2A3HA 5KAQF 1PVNA 1R0AH 3PWUB 5DJZB 1AJZA 5F9JB 1MZYA 5CSZA 4HQVA 2JI1A 3MUJA 1P7BA 4GG6B 2F53B 2IXVA 3B5GA 4ONVA 2YMXL 1TTJA 4AU0A 1HOEA 3SDXF 3ABOA 5FLVA 1PSKH 3N25A 4HHWA 1VB9A 4DF2A 3UYOD 4MWAC 2ZWNA 2GOUA 5CP7B 5BPPA 4QNPE 3NSNA 3ZIZA 3F7VA 1Q9LA 5FA3B 5FUOH 4YQXH 2YEVB 3ZXWA 3WTUA 3FXIC 5HHOE 2PDWA 2YAQA 1J10A 1KTJA 4MJ4A 3QG6B 2WD0A 3IYLW 25C8L 3BZJA 1T7WA 1QNZH 4Q4SA 5C71A 1PFOA 4UFIA 4GAGL 4DJFC 4N1HB 4YXHL 1TPFA 1QLFB 4O0ZA 4G8IA 4RDBA 1MQ8A 5DY3A 3TR2A 3CVIH 4JPSA 5HHMD 1L4IA 4U1NA 3GUFA 2DQJH 3BLIA 4CCCA 2G2NA 3U4KA 2CUIA 4Z7WA 2WZHA 2HX7A 2D20A 1N0XH 1X5GA 1TETL 3QSTA 1EFXB 2H32A 5B8CB 3D06A 4U3HA 2DPKA 1I8KA 1W2VA 4WK9A 3RVVC 2OI9B 4X6BA 3ZRCC 3NZUA 2EPNA 4E5XG 3KHJA 3FTZA 2HT3D 3YPIA 4ZUVA 2H3KA 5HI3C 3LOWA 3EJQA 3VH8B 2BZDA 5EYWA 4B7LA 5K4XA 1JPGB 4BWWA 1D5MA 5B38B 2TSYA 1KB5L 3UL4A 1SUHA 4IHOB 4ODSL 2L0DA 4ZMXA 3SCUA 3ZTJH 2OQYA 5C9JB 3LYEA 4K38A 1DQML 1VEOA 4NZTH 4MD5A 5FWQA 1XGTB 5KZDA 2G3XA 4DOHB 4XP4L 2AK4E 2FLBT 1ISYA 3RNDA 2BSRA 4WW2F 2FTYA 4NVTA 4Q6JA 1KM6A 4Z7QB 3CPGA 4C55A 1TZGH 3RTQC 2V2DA 3O4OB 4JFFE 1H6EA 1XRSA 2OX5B 2KX9A 3A6CL 1XF3B 2B5IC 1HSBB 4IG2A 3QDME 3V0VB 2RQEA 1IBYA 5ADOH 3DARA 2B0MA 4IRZH 2OWWA 2CW6A 5GJTH 2GHZA 5E51A 4FS0A 4K7FB 1NIEA 2OSLA 3SUVA 3IRPX 3LNEA 3RX8A 3PBMA 4LDLB 4BRJA 3W71A 4JCMA 2OSWA 2E28A 4TS6A 1O6TA 5CEXA 4DEPB 3UAJC 1UWSA 2X4TA 4OZHF 2W9LA 5GGSA 4KRPB 1E15A 3PPCA 2R1WA 2FPTA 4KH9A 1A4JA 4L4MA 1OQFA 5TFSL 1T1ZB 3NJXA 2H0PA 5E6SB 3FHEA 1MHCA 5D96C 4MCYB 2WXHA 3DUUA 2R0WL 3VFGH 3IGUA 3APTA 4O54A 1L8PA 4PRAB 2ZCZA 2W0PA 3KP0A 1I9EA 4JPKL 2XSAA 2Z2UA 1HHGB 3NOIA 3EF7A 4HK0A 4OM1H 2HE8A 2O7QA 4CSZA 1LWRA 4XCCL 3ITCA 1CD1B 5G5DA 3EGSB 3Q4DA 4RLIA 2VLKD 1UOZA 2C3VB 1SFTA 1MAMH 3ZHKA 4JZNA 1U6AL 4W68A 4MM1A 4B2DD 1WH0A 4OCXL 3FPXA 3B8UA 2GT9B 1ASOA 4G6AC 3N50A 3E9UA 1CFNB 4DP0X 3GF8A 2WMIA 5LN4A 5HVHB 4Q74A 1LG1A 4GQQA 4U1HA 1LUCB 2F8VA 1HOCB 4P2RD 1E67A 1SFLA 1UR9A 3UZWA 4LEXH 1JUKA 2WSRA 3V5FA 5KYUA 3B3DA 2P52A 4FXGC 2C9XA 4JZ5A 1KB9K 1BLNA 5IHRA 3FQ2A 4NSKA 1QBBA 1MWAL 3JWNG 3I9IA 5DZVA 2ADGA 4U3AA 3VNYA 4TSAL 1S2EA 2ZG1A 2CA3A 1DQDH 3EWYA 3ZVIA 4NJGA 5I76A 5IWLC 2JQXA 1IL1B 3WIFA 2EQDA 2R0LL 2Y36H 5LWYL 3BC9A 1MSSA 1JZEA 1UWGH 3UBFA 1B0RB 4ZXBC 3VINA 5JIWA 3PABB 4M8UA 5FACA 2XH4A 4YBLC 1MEHA 1HS6A 1K8CA 3MUUA 4P99A 3FTVA 1MQQA 3VQ2C 4EOUA 3HPSA 1IT8A 1FL3A 5AG8A 1KKRA 1H5BC 1INEH 1VFTA 4P2CG 3O2VL 4O2EA 2OZ4A 1PS3A 1TZ7A 4GJTB 3IFNH 1EJTC 1SMAA 1JNEA 2ATPA 4K8HA 5IB3A 2A5HA 3Q9PA 1B30A 4RDZA 2Z2BA 1OOWA 2VDOH 1CVRA 3WO4C 1JZDC 5HHOA 1VPXA 3NZRA 3BGFB 1E27A 1RLDA 4I7ZC 2NLIA 4AJVA 3NFPB 1JXDA 1OTUC 5H6HA 3VKKA 1EZ2A 2JIWA 3FOLA 4MZ3A 4X6FA 3QQ4A 5DLCA 4MAYD 4CJ0A 3W6LA 2HTKC 3B9KA 4TOYH 5IHUH 4Y2DC 2E0PA 1NCDH 4S2BA 2ZUVA 3VIKA 3ZVHB 3EKZA 5FYLH 3EAUA 2ALAA 5LGJB 2W9DL 3HMXA 1A5LC 3UVAA 3IJEA 3ZDZF 2MTAA 1NSJA 1SPQA 4W87A 5AVNA 5LNSA 2BSSB 1MHEA 1V7AA 1BVLB 1CECA 4LCYA 1W15A 1KLZA 3MACH 5EU4A 3D50A 3ZOAA 2VZSA 1F58H 3UR5A 4H6RA 2FD6H 4Y9BA 4FB7A 1FNEA 5LXVA 3I02A 4YPGA 3FVMA 3EAKA 4QHUA 1MIML 3HI5L 5BUAA 3OPZL 4I3RH 1NWPA 2AJYL 2VDGA 3O6FB 3G08B 3H12A 4C1KA 2ZRWA 4ERIA 4LU5H 5EMJA 4B2DA 3MBWA 2P88A 3HQ1A 5L2JA 1B90A 4OCNC 2CD0A 1S7QB 3GDCA 1OTSD 4NJ9L 2D2CC 2HQAA 3NABH 2IXQA 3LOTA 3WLBA 5ID0B 2BHZA 1SUXA 1UD3A 4Q4EA 2F61A 2N59A 1WUZA 2AK4A 3R89A 1ROWA 3TN0C 2DW7A 3ISRA 2IWGA 4GIRA 1RK7A 3JRKA 5I18H 1OCZB 2DICA 5I00A 1Y7VA 3MGOB 5AYTA 3VDHA 3MYPA 1CLCA 1ZMYA 3VX1A 4ZTOL 4IK6A 4XBEH 4HCIA 4MHHG 1L6WA 1M7IB 1HJQA 2V2XB 4JFFA 4X5RA 2VDKL 1ICQA 1OAQL 4ICNA 4S23A 3VJ6A 2AJUH 3QDMA 3C60B 5EU9A 4B15A 4FF5A 4OD3H 3V3WA 2W38A 1F73A 5CD3A 4BV1A 4APQA 4PR5B 4QG6A 2G9HB 4GXUM 5FYKL 3T4AC 1FA4A 3IPBA 3MUGB 3OIHA 3ZTNH 4S1QH 5I74C 4AV0A 3DNKA 3JWDH 1E8XA 1KBBA 3C56A 3TCLA 2ZKHH 3OQ3B 3ALFA 4FQLL 1YY9C 4MAUH 4L37B 1W37A 4LYPA 3A4JA 2X88A 3NG5A 1E4JA 1FWDC 3WBXA 5KSBB 3FONB 2CDFA 4YVNA 4Z3HA 4PCFA 1T7VA 3L67A 5FOBA 3D46A 5E56A 5EC1A 2CNZA 2CIIA 5EN3A 2HH0L 1FWRA 1CK0L 1OX4B 3LV5A 4QIUA 1KTDB 4KZEL 2LHAA 3G6JF 2JLPA 1SXBA 5ESAA 3T8LA 3NQFA 5KVMC 3S1WA 5DK3A 4L64A 3VNKA 3TTSA 3P11L 1CD0A 1UVQB 1J9TA 4XXWC 1S2AA 3IVKA 4UNKA 3NIDF 2WXOA 1RK0B 1HGWA 2IO5A 1XZWA 4G8AC 4M48H 1A80A 3D25A 4MGXA 1UXSB 5EU6B 4MY8A 3NL5A 3S4TA 1S9YB 1TYJA 1S5NA 3L1GA 5D1QC 3SE9H 3IE4A 4A29A 2QCNA 5IMOB 1FYHB 3LN5B 5HHXL 1FDLL 2NNXA 2DN7A 3T0EC 5DJYA 5F3BB 4Z3TA 3PGCB 4ZFOB 2OJEA 3BI9X 3WXWL 1RZKL 2AQOA 2XDHA 3QQNA 1Q6LA 1PX3A 1AW5A 3VFNA 4S1DD 1SO5A 5SWZB 3F12A 1XI3A 1U4FA 4YFDB 4R4ND 5CAKA 1RFDL 2XWBB 4AUJA 3PZUA 1UZDA 2XXMB 1LCOA 4IIFA 1FRGH 4PPTA 3FCBA 4TSBH 2XTJC 3OVGA 4GPVA 4KX8A 4HFUL 1JGMA 1EAOA 3MOQA 1PDZA 2H26A 2XTLA 3BRDA 1VP5A 5TE7H 2MPAL 3PFUA 3QI9D 2ZZ2A 1OZMA 4B5TA 5H4YA 3W29A 5JTWA 3GKZA 3QUXD 2NXZC 5DQDH 5D2WA 3P74A 3VKDA 5DD5H 1SXZA 1KIPB 3HIZA 4BCXA 4WY0A 5IF0B 1UWXK 5C6TL 4PMZA 5GGVH 4LW7A 4XK2A 1GYAA 4QS6A 1V6UA 3PP3H 2YBRA 3QXTA 4U6HA 4K3GA 5D72L 5JYMA 3PP7A 3E12A 1KV7A 1K7FA 2QSQA 4BQCA 2HVMA 4WO4C 2LU4A 3GPEA 4I2XE 2R6OA 4PULA 2J57A 4AM0Q 2OWCA 2PWVA 2BNQB 4ROQA 5AAWC 4BH8A 3L6FB 4RFOH 1OAJA 1KJ2H 5AAPA 3CHQA 1Z44A 2BC4B 5CR1A 4CN1A 3E0IA 4L80A 3DFYA 1L7TH 1HJSA 1DIDA 1ND0B 2VD8A 4DXXA 3UXLA 3WNJA 1F74A 3JUGA 2JFEX 3PP4H 2VW7A 3TS8A 1X1NA 4XBMA 3IIVA 3OJ2C 1G4RA 3G6AB 3GO1L 2OZNA 5CD5D 3EXLA 1UUQA 3SCTA 3B7YA 3G5XA 1AMXA 1DBAH 4XO3A 5BVPL 1FX6A 1H7XA 3N85H 5C54A 3TT3L 5T1LD 4OLXL 2GAZB 3VOJA 1XIDA 4JG0H 3MCOA 4YHGA 1SJCA 4L8SC 5I6NA 2D7MA 4IRJD 1KYOJ 1QP1A 4HH8A 2PBGA 1D2OA 1PLGL 1UWTA 1R1CA 4QLWA 5TQ2L 3FCSB 2BVTA 5KSWA 3TT1H 2FQIA 1OYBA 4P3DB 4K0OA 3VI4E 2HCVA 1G6VK 5LA0A 3MOAL 3QNXB 4PJCF 2WJEA 3F2LA 1HL5A 2G2PA 3EG9A 2Q7YB 3D33A 4N2GA 1BBJA 2Y1AA 1R34A 2D2HA 3HE7B 1WEJL 4N9DA 5E6ZA 4NQDE 1O66A 4WI4A 5DSCB 2PO6B 3SR7A 2FX9H 4XVUD 2FYYB 2VSKB 4CN6A 1GHSA 4MVAA 4QD2E 4TULH 3TAOA 3S5NA 4CN4A 4X4XB 2BZ7A 4FNLL 3DC8A 1E0XA 3ITXA 3WLLA 2H6PA 4JGNA 3N4EA 5I1IL 1VQTA 3LGGA 1T89A 4DN1A 1TJ0A 1A6ZA 2KYIA 4J3OC 3VWJA 4HA4A 3N6YA 5T3XE 4N2LA 4DHGA 1DQJA 3B8YA 3KVQA 1Y6NR 1WITA 3IPEA 4O58H 2J8TA 4OKDA 2FZ9A 5BXSA 2KZWA 1Q6FA 3RLGA 3N1AA 5T5FH 5HUPA 1Z9NA 1KDIA 3HPXA 1BQHG 3DJTA 4B41A 1F6KA 1YQ2A 4HISA 3HNTL 1ECYA 2DUAA 1OGGA 5GGUB 1KZYA 3GI8H 1EX1A 3BFWA 4PJHE 4LCCA 5A8GA 2GSEA 3ARUA 3WF3A 1D9KB 1TLMA 4GRLC 2P1YA 1NAKH 3AHYA 4UM8B 1R3YA 4L6HA 2GVGA 4LBEA 4GY7A 3W72A 3K2KA 4V11A 5T26A 3NTYA 4NN5C 4XNQB