1JXKA

Role of ethe mobile loop in the mehanism of human salivary amylase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
total genus 179
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jxkA01
3PTKA 3ARTA 1LWJA 5HOSA 1UWTA 4C7FA 3QHOA 5BRPA 5M3WA 2WVUA 1CZ1A 1UD2A 3IAQA 3L4YA 4HU8A 5F7UA 1J0ZA 1JZ6A 1UYQA 1HIZA 1CGTA 4HMCA 3UG3A 1BHGA 5D8WA 1KR1A 4D1JA 1GOMA 2XVPA 4PMDA 1E0XA 1V3LA 5I3DA 3VDHA 1OGGA 4DWSD 1WDSA 1MQRA 4D6JA 1KBKA 2OSXA 1UR9A 2JF6A 1J12A 1UKTA 5D9NA 2XFYA 2WVVA 1R86A 2WXDM 1E1EA 3BAIA 1R8LA 2ZXBA 3CC1A 3AMLA 4FNTA 2D20A 3WD0A 1MFUA 1HX0A 4PCTA 4GO8A 4QAWA 1B31A 2J74A 1A3HA 3RMEA 1E40A 2D3LA 3MI6A 3VM5A 3ZO9A 1KFWA 1W2PA 4UFKA 4AW7A 1DWJM 5D9MA 2IXVA 1E15A 3T0BA 4AIOA 3ZT6A 1EO7A 3AOFA 4NXKA 1H41A 1XD0A 1QW9A 2WMHA 1CDGA 1TFVA 2YFOA 5BRQA 1VF8A 4HA1A 2Y8KA 1E72M 2YJQA 3ARVA 4F8XA 4JFUA 6A3HA 2D23A 3I3DA 3OG2A 4QFUA 5LA1A 4NSBA 2OSYA 1CTNA 3U7VA 3RJXA 4GZEA 4JZ5A 4Y7EA 4J28A 2QF8A 3VMOA 1HJWA 2VTFA 4D72A 1U2YA 2VVSA 2VRJA 4CCDA 3W81A 2OYLA 1XSKA 2C0HA 1GJUA 3WF4A 4DUWA 3WDRA 4HZ6A 4D6GA 2WSKA 1PAMA 3EJRA 5CLTA 3WH8A 1FH8A 3GXDA 1X1NA 1JDDA 1GW1A 1ZU8A 3UERA 3UR8A 1JZ3A 1EQPA 1JL8A 1BPLB 3L4WA 3A3HA 5DMYA 2C7FA 2AOSA 2FHFA 4QLLA 1ECEA 1KQYA 4TX8A 2D22A 2BY2A 1EQCA 2NW0A 1UA7A 3AHTA 1PIGA 3AS0A 3RM8A 1L0PA 1HXJA 5FL1A 3CZLA 1J01A 3I3EA 1UR4A 1UWSA 4WJXA 5ABGA 1GONA 1HWWA 1MW0A 3WH6A 2QHAA 2VRKA 1CIUA 2WPGA 4JFVA 1QBAA 4BCEA 1FP8A 3VIOA 1XCWA 5E70A 2VZTA 2VJXA 2J7BA 1UG6A 1GNXA 4WKHA 3B8SA 3QHMA 3PZMA 3WEZA 4FNUA 1NWTA 4Z2JA 3T2OA 5E1QA 4E4PA 3DX1A 4FNQA 2YDSA 2QLYA 2FH6A 4LGXA 1V08A 4W85A 1E56A 3SCRA 1W9UA 1V6UA 2EACA 2BVYA 1VEPA 1FH9A 2J75A 5I24A 2YL9A 5E6YA 1LF1A 5BWFA 3S2CA 1NM9A 1W1PA 2O9RA 4BQ3A 1JFHA 4W8BA 4CD4A 5A2AA 1HP4A 3K8MA 3VPLA 4OKDA 2YDQA 3PZQA 4R27A 2DGAA 3H53A 2WWDA 3ZR5A 2VR4A 2O9TA 2XSAA 4BQ4A 4J3SA 5D4YA 1X6LA 3UCQA 3EDEA 4HA3A 1UKQA 4P8VA 4UOQA 1VAHA 1MW3A 4W8LA 1HJVA 3UG4A 4AD1A 4BA0A 5I2UA 2UY5A 3AHYA 2JE8A 4NZCA 2WBGA 3ZQ9A 1NWUA 4H41A 3HG3A 3AMGA 1V3MA 4CD5A 4HMDA 3NYDA 1PZ3A 2ZUTA 2J25A 3VVGA 1ISWA 2QPSA 5A8MA 3VU2A 4A3HA 2WC4A 2BHYA 3ARXA 4PSPA 1E9LA 1LG1A 1FA2A 4LQ1A 4GKLA 1K6AA 4ZXOA 3GH5A 3SUSA 3GXMA 1UD6A 5DEZA 4C7DA 3CUIA 1R46A 3W27A 3RDKA 2VR5A 1UQYA 2ZXDA 2DH2A 2FHCA 1JZ4A 2F61A 1C7SA 1KB3A 1UD8A 2VUYA 4WF7A 3CZNA 1VEOA 2GK1B 3DX2A 1BSIA 2WMIA 3T08A 6CGTA 2EADA 1JYXA 1BG9A 1GOOA 3I3BA 4TTUA 1XSIA 4A3YA 2W91A 2V3GA 4M29A 1KTBA 1ZBKA 4Q22A 3AXHA 1UKOA 2YA1A 1WB0A 2WCAA 1UH2A 1FHLA 3D52A 3CMGA 1DWAM 4CN4A 1RPKA 4QCEA 5EFFA 2WBKA 3UG5A 3ALFA 4MTVA 5ABFA 3RIKA 2CERA 4WSKA 3OBAA 1PJ9A 3PHAA 3WQ8A 1EHNA 1XH0A 2VRQA 3B9AA 2E9LA 3WH7A 4FK9A 2YBUA 3FAWA 2OYKA 1NP2A 1SR0A 1E6ZA 1QNQA 5DF0A 3BAXA 3S5YA 4AZHA 3WNOA 2VT0A 1FH7A 3HJEA 5A94A 3BCDA 2NT1A 2GJRA 2E40A 3VIJA 1PX8A 1G5AA 2G41A 4BQ2A 3ZJ7A 2GJXB 1EGZA 2QV4A 3WNPA 1HJQA 3AROA 3GNOA 2XVKA 3SUWA 3ZT7A 3WD2A 3A4XA 3HN3A 3VTRA 2ZX9A 4BZYA 4EANA 3DYPA 4MB1A 2A3EA 3BH4A 1RP9A 2YIHA 3BLKA 5FKYA 4CGTA 3TTQA 2EABA 3BAYA 4AC1X 4M1RA 5CXPA 4CD8A 3A24A 4ML4A 3WNLA 4U2YA 2YLAA 5CQ1A 5I79A 2YA0A 5JBFA 4RE2A 4TVCA 2VCCA 1KXQA 1CGYA 1VFMA 2ZE0A 2DPEA 3SCTA 5GPRA 1PS3A 2ZOXA 3K4DA 5A95A 1V3HA 3AMCA 4HOWA 3D51A 3EJQA 1H1NA 4HZ8A 1NH6A 1CXKA 4RE4A 4AZCB 5CGMA 3APGA 1QNPA 5A6AA 5JIPA 2BY3A 2VOTA 4NZJA 4ATDA 1PEZA 5E0FA 3WEOA 3BUDA 2D0GA 1KGUA 3DX3A 2IXUA 4W93A 4X0VA 4OOZA 3ARQA 1CENA 1CXIA 2RGMA 4J3TA 2W61A 2A3CA 2CBJA 1CXHA 4V27A 1W9XA 1GZJA 2OWXA 3BLPX 4URIA 2X2YA 2VVNA 2X2JA 1OM0A 3BVTA 3D50A 3AISA 4M8UA 1JAEA 2FH8A 1B30A 1V0MA 4J3WA 4HMEA 1BVZA 1DHKA 2ZX8A 3MMWA 3RPMA 3AIUA 1E4NA 4W88A 2DIEA 1XYFA 4W89A 2BVTA 2FGLA 1LG2A 1WDRA 5CSUA 2YL5A 1H09A 1QX1A 3A5VA 1OSEA 3II1A 1WZLA 3UR7A 1PZ2A 3BC9A 4KH2A 4OOUA 4IUGA 1MQPA 1OB0A 1B3YA 1JAKA 3FHQA 1CGUA 1GVIA 5CG0A 1KBBA 3KE0A 1QVBA 3NSMA 3AMDA 1JI2A 2CCRA 1BYCA 5A6KA 4MB4A 4AZIA 3BVXA 4YN5A 4GI6A 3L4UA 2YLLA 4HTYA 1ISVA 1JF5A 1JGIA 2F1AA 3VIMA 3N13A 3CZSA 5DO8A 4H8HA 4W8AA 5A6JA 3LRMA 2W63A 1ZJBA 3GXFA 3ZOAA 4W5ZA 1HJXA 3MMUA 3WFZA 4HA4A 3SURA 4UZSA 3WNNA 1JXJA 4EK7A 3OGVA 5I0DA 1ITXA 2QPUA 1I1XA 3ARRA 1H2JA 1W3KA 4DWSB 4U5IA 1QI3A 3WQVA 3NCOA 3CHFA 3GXNA 2GSJA 1NP0A 3LMYA 3PZNA 5A8QA 4CCCA 4GXPA 4DO6A 1PBGA 1XD1A 2UWFA 3EJUA 1OINA 3CZJA 4U2ZA 1WPCA 3ARZA 1B3WA 4GI9A 2XM2A 5HDRA 1JF6A 2E3ZA 5FOOA 2J77A 2G3NA 3WY4A 5IHRA 2Y5EA 5A2CA 3FY1A 4M80A 1TR1A 1G1YA 3DYMA 3VGFA 3W26A 3D4YA 1UD3A 1J0KA 3VGHA 4H8UA 3WUBA 2A3BA 4TVDA 2V5DA 1BTCA 1R85A 4AD2A 1V3KA 2WMKA 4HU0A 4Z2LA 1BLIA 1B1YA 3NDZA 2XVLA 3H55A 2PF0A 4MNMA 2DEPA 3ZT5A 1T0OA 3POCA 1C7TA 1C8YA 3A4AA 4J7RA 4JFSA 4S3KA 5ABEA 3GNRA 4X9YA 5JUVA 1W9PA 2CITA 4S3JA 2WLZA 1NOWA 4MB3A 4TX6A 2WWCA 2WMJA 2V3DA 4MDOA 3EMZA 1B90A 2CKSA 2J62A 4UQAA 3VNZA 5CPQA 3AS3A 2JEQA 3OLDA 4UQDA 3VIPA 4E2OA 4D6FA 5HPOA 1V0KA 2V5CA 1CGXA 3SCVA 4DM2A 4XUYA 3S5ZA 3WH9A 5E9AA 1EOKA 2Z1SA 4OUEA 1XHGA 1E3XA 2PBOA 1NOUA 2YBTA 1UH4A 3GM8A 1W3JA 3VNYA 1R47A 3EDDA 4MPKA 4B3LA 3HU7A 1EDTA 3IAPA 2GDUA 4WIWA 1TCMA 4GIAA 1Q4NX 1OWQA 3AIBA 1U30A 3QR3A 4AD5A 2G8ZA 4DM1A 1JZ7A 4XZBA 3THCA 3UEQA 1BVNP 1KXTA 1HKMA 3ZJKA 1BG4A 4OBSA 1XRVA 1QHOA 4LYQA 4W87A 3O6AA 3SCWA 2FGZA 2XN2A 3AS2A 2W67A 3WMCA 1UWQA 3L4TA 2J7EA 3U57A 3DC0A 3B9EA 4PUEA 4H04A 3WD4A 2D0HA 1J9YA 1QNRA 2WZEA 4R5EA 4AMWA 1J18A 3IJ7A 1E0VA 3UESA 2BY1A 4OBRA 1C92A 1M03A 4LXFA 2F7PA 3N15A 3AHZA 4H8VA 2E9MA 2VZOA 3WQ6A 1WCGA 5E09A 1DWIM 3TV8A 2YFNA 5A6LA 3MSGA 2X05A 3CBWA 3CZ8A 3F5KA 1HP5A 3AIQA 2X0YA 4OJYA 5CPTA 4MADA 5I5RA 3OZPA 3GH7A 2DSVA 2CBVA 3GXPA 2VCAA 3MO4A 1FOBA 4UOJA 2VX4A 2WSPA 1WDQA 1K9TA 4Z2GA 1CLVA 4Z2KA 1VB9A 3ZIZA 1G94A 1GVYA 4F9JA 3SUVA 4H2CA 1E6RA 1PIFA 1XGZA 1KGXA 1UR8A 4AWEA 3T2QA 1S46A 2Y24A 2BY0A 4JKLA 1CECA 2VQTA 1HXKA 4UQBA 4V28A 2VL4A 2ZICA 2VZUA 2PWEA 3OGRA 1B3ZA 5AY7A 1WAWA 1VENA 4ACZB 1XYZA 4A4AA 2W4XA 4GINA 5ABHA 1MXDA 2UY4A 1SMDA 1N82A 3RM4A 4MAZA 3BAKA 2OLHA 1V02A 3TONA 2CNCA 4LX4A 2E0PA 3T0DA 4B3KA 1WNOA 1VJZA 3SCUA 3BVUA 3PZUA 1FP9A 3MUIA 2D0FA 4MNKA 2W92A 4LYRA 1QPKA 4B16A 2XVGA 2O9PA 4C7GA 3DYOA 3CUFA 1UWIA 2O92A 3MUZ1 3SCQA 2ZXAA 2G3MA 1ISXA 3KLLA 4AMXA 4Z2IA 2DSZA 4ATWA 4K68A 1E3ZA 1SMAA 2EXOA 1JD9A 8CGTA 5BXSA 3L4XA 1MWOA 3CZKA 2ZUSA 2ZX7A 3PBGA 3A21A 5CGTA 1GOWA 1ZB5A 2ZUUA 1DTUA 3L4VA 5GNYA 2D2OA 3MV01 1E6SM 1M53A 2X2HA 2D3NA 3QOMA 4N0RA 3NJ3A 3LXAA 3W38A 5AYIA 1QNSA 3SCPA 1H0IA 1JDCA 1V3IA 3CUHA 1GHRA 3HG4A 2Q8XA 1MVYA 3W6LA 1KXHA 3AXXA 2IGTA 3NSXA 2WM0A 1BYBA 2J8FA 1W9VA 3W53A 3M07A 3WUFA 3G6MA 3BUBA 4ZENA 3WSUA 3U5UA 2CKRA 4LPCA 1H4PA 4UQEA 1ISYA 2J47A 4W7WA 4ACYA 2XUCA 4FLRA 3WDQA 2NT0A 4YHGA 5FCZA 1G9HA 4JKKA 2WCGA 1NQ6A 4QLJA 2OSWA 4U3AA 3W29A 3CZGA 3VDAA 2JEPA 1ESWA 3BAJA 2ZX5A 3DX4A 4UZUA 1ZL1A 5C70A 2WHLA 4DO4A 3ALGA 1VEMA 2OYMA 2XWDA 1EH9A 1I75A 1QWNA 3KWXA 3WF2A 4M82A 2BS9A 3FAXA 3VOCA 3VILA 2DH3A 1NWRA 2BHUA 3AIEA 4AISA 4J3UA 1BF2A 2HVMA 7CGTA 3F5JA 2GJPA 1EA9C 3N04A 2J7FA 2Y4SA 1GPFA 3N18A 4KGLA 2VZSA 4KGJA 3T0AA 4JL1A 2CHOA 1D2KA 2XPKA 3CLWA 1HN1A 4UFMA 1H5VA 5BXPA 3KZSA 1E1FA 3CZEA 3TTOA 1Q6GA 2DT1A 1TVNA 2CPUA 2QMKA 4P7LA 4PSRA 1TQWA 3VD4A 1KTCA 3AICA 2PWHA 2F7RA 1UKPA 4XB3A 1UZ1A 3VO0A 2YOCA 5C71A 1W1VA 4UOZA 1W2VA 4PTMA 2EPKX 1YHTA 1K9DA 5E6ZA 1JNEA 1AQHA 3AYRA 2ESCA 2WC3A 4D6CA 4X0NA 3PZVA 4B9ZA 5I23A 1HT6A 2CBIA 1JZ2A 3F4VA 3WENA 2WB5A 2WLYA 3ZSTA 3BXWA 4NRSA 2J7CA 4PTVA 1VIWA 3WY1A 1H0GA 1SYTA 1UWRA 3GDBA 4UFLA 1KQZA 1UQZA 3GZAA 1VFFA 2A3HA 5AC4A 3TTYA 2W62A 2GK1A 3GXTA 3WQWA 4FMVA 1H11A 4PMZA 1GOQA 1HKIA 3K8LA 5BXRA 3T2PA 3VD7A 4AD4A 4UR9A 4Z2HA 2D73A 2FE0A 4HP5A 4UQ9A 4D6EA 2DSKA 2DQXA 4J3XA 2G3IA 4CN6A 2J79A 1UD4A 3PZGA 3ZSSA 1E6NA 2XSBA 4W7VA 4B15A 4AD3A 3M6DA 4AY1A 4L4PA 1B3XA 1QOXA 3ZR6A 3KL3A 4WKFA 4FLQA 3U7BA 1BYDA 3VMNA 5DFAA 3WY3A 4EAMA 2VI0A 5CLWA 4B9YA 2WHMA 1XCXA 4UCFA 5LA0A 2XN1A 3K4AA 2WMGA 2PWGA 1WP6A 4CKQA 1EDGA 2GJXA 1TA3A 1WDPA 3WDIA 3BUPA 1MQQA 1R33A 4W84A 3NSNA 2A3AA 1EHAA 3M46A 1V6VA 4U31A 2BNJA 4FNPA 3PZTA 3MKKA 1V0LA 6TAAA 4F79A 2FHBA 1CGVA 1IZJA 2EPOA 3RCNA 1J11A 2WAGA 1J0HA 4W7UA 2YDRA 3EMQA 5JBEA 1C91A 1JYWA 3WH5A 3KL5A 3EDFA 2GFTA 2HISA 1M04A 3BGAA 2CEQA 5HBFA 3VMPA 1W9DM 4FF5A 2XIBA 3CH9A 3SCSA 1FFQA 2EBNA 4D6IA 1RP8A 1O7AA 1GJWA 4WKAA 4F9DA 2XG9A 1OT1A 1JI1A 3VM7A 1E4LA 4UNIA 1VJSA 2JALA 3LRLA 1MYRA 1X6NA 4P8XA 4MJ4A 3OA5A 5M5DA 1ZBVA 3LPGA 1UR2A 2XFRA 2XFFA 3UETA 1KR0A 2VQUA 5FL0A 3BVVA 3CTTA 3AIRA 3VIFA 4PUDA 1C8XA 2OW6A 4CN1A 4TVUA 4TOQA 5FD0A 1EXPA 3EJTA 1HJUA 2EO7A 4WLCA 2EAEA 2ZWYA 3LXCA 5I77A 3BAWA 3LPPA 2DT2A 8A3HA 2VX5A 3CIVA 2F8QA 1GQJA 3VGGA 1OBAA 2J7HA 1J0IA 2ZIDA 1R7AA 3ARYA 1I1WA 1XC6A 4AZGA 3N11A 3HG5A 4MJ2A 1BAGA 4HPHA 1U33A 3A47A 3O2LA 1GQIA 2OW7A 2WVVB 2Z1KA 3WKZA 1TE1A 3VDCA 2V3FA 2IUZA 4P7QA 2CXGA 3AS1A 4PMRA 4AMCA 4GZJA 5DT5A 1E6XM 2ALWA 5A6MA 4F66A 3DDGA 3WF3A 1AQMA 3ARSA 7A3HA 1BGAA 1W9BM 5CPSA 3FW6A 5A6BA 2PB1A 1LL7A 1E43A 2OWCA 5EBAA 1E55A 4JHZA 2B31A 2OWWA 4HOXA 3OZOA 1QI2A 1EOMA 3AHVA 4AYSA 1ODZA 3S6TA 5A1AA 2CESA 1TZ7A 3PZOA 2ZUVA 3N17A 1OIFA 2V38A 1H49A 3HG2A 1P6WA 3HZ3A 3L4ZA 1ZJAA 2XM1A 1TUXA 4P8UA 5A8PA 2WK2A 1GHSA 4PYSA 2WMFA 1JXKA 3W37A 3GH4A 3FNDA 3AI0A 3W25A 4N42A 3SUUA 1NWSA 3BMVA 4M81A 4IPNB 3VX1A 1HNYA 2PWFA 2XIIA 2Y8VA 3KEHA 3IK2A 1CGWA 5BXTA 1JD7A 1JDAA 3CV5A 5A8OA 4NZFA 5HNNA 3K46A 3A22A 3WD3A 1UASA 4IPLA 3L2LA 3CHDA 1E73M 1GQLA 3VGEA 1US3A 3D5HA 3EMCA 3MANA 3VUPA 3SCOA 2WVTA 4UTFA 2V3EA 2BVDA 3DDFA 3WY2A 4FLOA 4UQCA 3QGVA 3AXIA 2FYVA 4TXEA 9CGTA 1UHVA 4PMVA 5ECUA 1UWUA 2CHNA 3AZTA 1C90A 3ZM8A 4LYPA 2PC8A 3VGDA 5D9OA 1SFSA 2YA2A 1G0CA 4QDMA 3W28A 3LRKA 1QBBA 2WYSA 1JYVA 2GUYA 1FHDA 4MNJA 1EDQA 3IJ8A 1OIMA 4U3CA 1V6YA 1KCKA 4PN2A 2BXZA 4UFHA 4AZ6A 4CU8A 4CVUA 4NXSA 1HF6A 3D4ZA 4J27A 3OLIA 3VDBA 4CU7A 1Y7VA 2DIJA 5C8BB 4PMXA 1E4IA 5HPCA 3MV11 1B2YA 1E6QM 1YQ2A 3NUKA 5A3HA 1B9ZA 1DWGM 3E1F1 5D8ZA 5GNZA 5A6SA 1AVAA 4U33A 3BUQA 1VBRA 4JCMA 3ZMRA 4TTGA 2DT0A 1GUVA 4FNSA 2XGBA 2E8ZA 4MAVA 1HKJA 5EMYA 4JCLA 3IJ9A 1TQUA 3HMCA 1FFRA 3IGUA 2E9BA 2XHYA 1DWFM 2YKKA 3CHCA 1CPUA 3MUAA 2GVYA 4EE9A 4PEEA 2DSWA 2VO5A 1OCQA 2VNCA 3KL0A 1C8QA 2ZUMA 4J3VA 5JIWA 2VX6A 4DUVA 3VIHA 1AQ0A 3J7HA 2VCBA 4CUCA 3OB8A 3BSGA 3LX9A 4MNLA 4P8WA 2XVNA 4QCFA 2XGIA 3AZSA 2ZWZA 1ITCA 2WW5A 3WMSA 1CLXA 3PTQA 2EPNA 1W3HA 3DECA 3RILA 2X2IA 2AAAA 4PTWA 1H3GA 5A2BA 3ARWA 3WD1A 1LWHA 2UY2A 4U5KA 3OGSA 3MS8A 3RJYA 4PBGA 1R75A 1WZMA 4BQ5A 1QW8A 1QI0A 1BYAA 2F2HA 1ZBCA 2WMIB 4JKMA 1UA3A 1W3LA 3VD3A 2E8YA 3WF0A 3VGBA 4BF7A 3AMKA 3B9DA 5EFDA 4KMQA 3WQ5A 4ZFMA 1MFVA 1PPIA 4GZIA 5GNXA 3FHAA 2EEXA 2D1ZA 5ABFB 5BROA 2CIPA 5BCAA 3CUGA 3AIVA 3WQ4A 1QI5A 2ZXQA 1UR0A 1WZAA 5IDIA 2XWEA 2CBUA 1V02E 4P7NA 1CNVA 5AYBA 1XSJA 1M01A 4P7RA 3VX0A 2DSUA 4KWUA 1E0WA 3D3AA 2ZUNA 2J8GA 1WO2A 1CXFA 1NARA 5E0CA 1TQVA 5A6BD 1OGSA 4PMUA 5AC5A 2TAAA 2WANA 5CSYA 1VRXA 3NDYA 4JFWA 5EB8A 4ACZA 4JFTA 2UY3A 2WKGA 4PMQA 3AIWA 4H7VA 4AD0A 3QHNA 1CXLA 5I6SA 4NRRA 1US2A 1W32A 3K1DA 1UZ4A 1CBGA 3POHA 1V6XA 2DT3A 4UFIA 2JF7A 5GQBA 3LPOA 1PX3A 1BFNA 5A8NA 2VC9A 4XV0A 3SCNA 4OIFA 2PBGA 1XV8A 1DEDA 2WKLA 3OLGA 4D1IA 3CHEA 2CETA 1TVPA 1JG9A 1E4MM 3VIIA 1UKSA 3WUGA 1LL4A 5IFPA 4WSJA 1CYGA 3WMBA 1JZ8A 3PZIA 4Q7NA 1UR1A 3PN8A 4CD7A 1E71M 3MU7A 3RO8A 1V6WA 4HOZA 1ZS2A 3THDA 3EJSA 2E4TA 1CEOA 3CO4A 4PMYA 3FXYA 2J7DA 2NSXA 2EJ1A 3BVWA 4WK9A 3W24A 4AZCA 4FLSA 2QMJA 3BSHA 1E5JA 1J0JA 1TQSA 1MXGA 4W86A 2PWDA 4AIUA 2RGLA 1B0IA 3WUEA 1LQ0A 1CWYA 4ZEPA 3SIMA 2J78A 3VIGA 3WBAA 3OLEA 3MMDA 4IISA 3VD9A 3T09A 1M7XA 2G4FA 2XN0A 4ATLA 4AEFA 3AZRA 3JUGA 2YL6A 5M17A 3DX0A 1W1YA 1C3FA 3IANA 3VIKA 1HJSA 1HVQA 4MB5A 1GCYA 1HL8A 5M03A 3NIYA 4L4OA 3BUIA 3N12A 5BYWA 4CD6A 2FDMA 2JIWA 3WL0A 4QLKA 1AMYA 3VD5A 1JYNA 3FN9A 1LL6A 1B3VA 4JHOA 2X8RA 3W6MA 1R87A 3ZJ8A 1UH3A 1GQKA 2XJ7A 2EPMX 2VMFA 4PCSA 4D6HA 1OD0A 1HL9A 1MW2A 2PI6A 1R7OA 1E5NA 2WZHA 1WE5A 3DHUA 2EPLX 1R34A 3AHXA 3AYSA 3PZ9A 1G01A 4RL3A 3MSDA 5A69A 1VFOA 4V2XA 2BHZA 1W1TA 2O9OA 2DDXA 3PTMA 4M24A 1F4AA 4JIEA 3N9KA 3MUY1 1RD6A 3WEMA 4AXNA 4QP0A 2XTKA 2J4GA 3WL1A 1DP0A 4MDPA 5FIPA 4DWSA 2VZVA 2W5FA 1IV8A 1Q6FA 2ZX6A 4RE3A 1KXVA 1LLOA 1VFUA 3WDJA 3WNKA 4XX6A 1QNOA 1XH2A 4AZ5A 1SZNA 1TQTA 3W82A 3VSUA 2CYGA 4IM4A 3GBDA 3VINA 3AFBA 7TAAA 1K9EA 3TTSA 4KRTA 4NI3A 2WZIA 4AZ7A 3W4RA 1UUQA 5KEZA 3AQUA 1IZKA 1JZ5A 1ISZA 1GOIA 2WC7A 3WELA 4TUFA 1MW1A 3N1AA 4E8CA 3WDPP 2JFEX 3F5LA 1DWHM 1V03A 3WDHA 4AIEA 2EQDA 1TMQA 4ZXLA 3GNPA 3VKKA 3LXBA 1HKKA 1L8NA 1V3JA 4GO9A 4XZWA 3SUTA 1ZBWA 1Q6EA 5TD4A 4PMOA 3H54A 1KCLA 1LJYA 3EYPA 2VX7A 5LYRA 2VURA 2JIEA 4BS0A 4W5UA 1F4HA 3TP4A 3BCFA 3W0KA 4GPNA 4HPGA 2WVSA 4DUXA 3KLKA 5KZ6A 4GQRA 2F1BA 4GQQA 3A6OA 3GTNA 1OD8A 5DT7A 4JL2A 2ZUWA 4HZ7A 3ZJ6A 1HVXA 3EBVA 1GORA 4PTXA 4UFJA 4NF7A 1C93A 1WKYA 2BFGA 5LA2A 3CGTA 2F7OA 1BGGA 1TG7A 4JAWA 3RM9A 3L2MA 1E70M 2WHKA 4CU6A 4AEEA 3U5YA 3O9NA 1CXEA 1UD5A 2MANA 1KGWA 3AJ7A 3WN6A 3VSTA 2X09A 3GBEA 2XYLA 1EO5A 2J7GA 5CZKA 4PMNA 5IFTA 2F18A 3ECQA 1HTYA 4OZOA 4M56A 2X1IA 4FNRA 4GI8A 1TA3B 5JBDA 1QWUA 1Q6DA 1IT0A 2D24A 2F7QA 1EIBA 3OIHA 5IHSA 1QHZA 5HXMA 3CUJA 3A23A 2G3JA 4DWSC 3A4WA 1RH9A 1W91A 5CJ5A 3QOKA 3GYCA 1JNDA 3G6LA 4AZBA 4CVWA 3WF1A 3GXIA 1XH1A 3BMWA 1KWGA 4D71A 1Z32X 3TA9A 4YHEA 4P7OA 1KWKA 3WIJA 1GOKA 1J10A 1NOFA 4OGZA 2BV9A 1JIBA 1QHPA 2W66A 4PRWA 1UOKA 4NX0A 5I78A 4AYGA 1O7DC 3WBEA 2WNWA 4DO5A 1PX4A 3LPFA 2X0HA 4D6DA 2WCSA 1D3CA 1WZKA 3VSVA 2C8NA 2GDVA 1JFXA 1OGBA 1ODUA 1BQCA 3M7SA 3TOPA 1Q6CA 4ZE4A 3CMJA 4E8DA 4EKJA 3K8KA 1VBUA 3DHPA 3WNMA 3ARUA 4KRUA 1QI4A 2AMGA 1E6PA 1O6IA 3EJPA 4ZE5A 3WFLA 3EDKA 2BXYA 3BLBA 2YL8A 4YPJA 3SEPA 1V0NA 4CCEA 1K9FA 3ARPA 1A47A 1J0YA 1D7FA 2Y2WA 1OT2A 2WHJA 3CPUA 5D9PA 3EDJA 5IXEA
chains in the Genus database with same CATH superfamily
3MJ9A 1LWJA 4FQXB 3KYOB 5DYOB 3U6RA 1UWTA 3K2GA 4HH9A 3SDAD 5FI8A 3BOVA 3VXSB 5IHWA 2QKIA 4MNHB 5GZNA 1E9YB 1NIUA 3QHOA 5ICZA 3IAQA 1NCCL 3ES8A 4EN3A 5F7UA 3PGCA 3BYYA 2RCSL 1UYQA 5KSBA 3DPBA 3O9WD 4HMCA 5DMGD 4ELDA 4A2SA 2HT4C 3R4RA 4WI6A 1LK2B 1OW0C 4AYFA 5D8WA 1V4YA 3LSOB 3SDDC 3GMPA 2ZKMX 3TYDA 4D1JA 1BFVL 4FNLL 3US0A 1E0XA 2YGQA 3MLUH 5I3DA 1ZRUA 5EO9B 1H61A 5F0PB 2J43A 5LQBH 1KBPA 1R5VA 4D8OA 5I19L 4UBDC 1KBKA 4QHMA 3ULUD 3P0VL 3Q06A 2JF6A 3TO2A 3WNJA 1LE5B 1KY7A 4CW1A 5IEHA 5ILTH 3OAZK 3Q6GH 1OAUL 2AQWA 4HJIA 3B8UA 1YEIH 2UZIL 1R86A 3WLMA 2CHXA 4HCFA 5HDQH 3VXNB 5CJQH 2IEPA 1M7DA 1A53A 3V0GA 7PAZA 4PP1C 1OZTG 2DQCL 2YCEA 4V1XA 3RVTC 4NKIL 3SQOH 3STFA 4MQ7B 1QLFB 3KWWB 4Z18A 3R0NA 1C8PA 3KOZA 2DMHA 5IVXF 5BOJA 2UZYA 4EUPH 3EH2A 7FABH 1ZANL 1N2RB 4LBAA 3ENEA 3ZBMA 1B31A 3IMBA 3KJ4B 4GMTL 4HT1L 3D46A 3D18A 2K1MA 4TR9A 1HQRB 1E40A 6REQB 3PWNB 5B3JF 5ABDE 3ZO9A 1KFWA 1W2PA 4FFVC 4PS3A 3QK0A 1UA6H 4M8VA 3P3SA 5DZVA 5FYKD 5J4MA 3L5AA 1PLCA 2ZCHH 3DSFL 5E8EB 5T1MA 3C6SB 4HIEB 1BF8A 1PAZA 2IXVA 4G7YH 1W16A 1U93A 2WO4A 3UJRA 4NUPA 5HHOD 4A7SA 3ES6B 3AGVA 4FXKA 4XNMA 1H41A 1BGXH 1TTIA 1Z6KA 1QNIA 1XD0A 1KLYA 3QCUH 4R0LC 2ZWSA 4L8DB 3X12B 5CJ8A 4XOBA 3GFYA 4JO1H 4LUTB 1TFVA 3LKNB 1CVRA 2V2XA 3PFUA 5I1JL 4TQPA 5I0YA 1RJYB 1BECA 5LHDA 4Z3JA 1KB9K 2H0FA 2IFGA 2R9HD 4Z8FH 5FGCE 2MNRA 3AAMA 3OPUA 3O7UA 1BZOA 1T0PB 3QEUA 4Y5YA 4YC2B 1WIOA 3T8XB 4LTSA 2DW5A 4N2LA 2DQHL 4DJMA 2FTYA 4AF0A 3IJSA 3DXAA 4JQAA 4HIPA 3Q67A 1CGSH 4NSBA 3CZFA 4QFUA 1V51A 1QHQA 2DU2A 2FNWA 3RWHA 1GVRA 5DUBB 1CTNA 1U3HA 3ZE0B 4DOHE 1XC4A 1G6RL 3PPFA 2HFEA 4W1TA 1F9CA 2WSQA 4GZEA 2CZ5A 3O05A 4J28A 2X7VA 5CZTA 1W3TA 5LIXX 25C8L 3QO1A 3QWRD 1LEKB 5BV7L 2X4OA 4BXSV 3M41A 2CO2A 3KRUA 2VTFA 4JHWH 5GSVB 5IJKA 1SJEB 1CE6A 3II3A 2YGNA 1U2YA 3GWJA 2OFQA 2FX9L 2ZKHL 4NC2B 4Q9BA 1Q1PA 4XN8A 3BT2L 5MEPA 1VCVA 5HI5C 2VRJA 2OYLA 1KFGA 3ILQD 4IUOA 4CCDA 2C0HA 1W8NA 1ZA6A 4G8IB 4WJ5B 2F58H 1H0DB 5DRNA 1M3JA 4DQWA 3WDRA 4Q7DA 4ZODA 3T0VA 5JOEA 1QRNE 2F54D 3TA4D 1AIFB 1ZT1A 2WSKA 4HIBA 1PKQE 3EBIA 3C8KB 4HZ6A 3EJRA 4LU0A 1XBZA 3UBFA 4DEWA 1FH8A 5D7JC 3OPSA 1V7NL 1I1AD 4XKYB 5TQ0L 2VXSL 1GW1A 4QE5A 2CW6A 3B06A 4IBWA 1VZIA 2XWRA 3KHQA 5C0GA 1LO5A 1GR7A 3PWUA 2JNZA 3BAEH 2NXZB 5C0JB 3TEWA 3KS6A 5DHVB 5DMYA 5EU6E 2ZCLL 2FIKA 3OSVA 1XICA 5DFWH 3A3HA 3MY9A 3OO2A 7ENLA 5F9OL 4QLLA 1ETA1 5EPMA 3VI3B 1W8GA 1SM3L 5HHVH 3SM0A 1L9MA 2GQHA 1ECEA 1EXUB 5MKGB 3CFUA 4OZFG 4X8JB 1NCTA 1PSKH 2UZPA 3QFJB 4MS8D 5SWZA 3WO4B 3H12A 4RR4A 1PNCA 5FM4A 2O1AA 1SXSA 2OZ4H 4NGHH 3W7GA 1VPQA 1TQCC 3UFIA 3O8XA 4M3HA 1AL7A 1OFRA 4RFEA 2W9EL 4PHZA 2JJSA 1HXJA 3CZLA 3I3EA 2OX4A 1QSFD 3B1TA 1EJOL 4JQVA 1SDDA 4WJXA 5ISZD 1KA9F 2X1OA 4P5TD 1PY0A 5IBUB 1MW0A 3O41A 1A6AB 4E9YA 5D7JA 4K3EL 2DZPA 4JFXB 2QHAA 3QW3A 3BICA 5GJPA 1YPFA 3WLSA 2YD7A 4PWHA 3WD5H 1BJMA 2WPGA 3OVUB 1MHEA 5B3NA 1F4XL 1TTFA 3KDMA 3MP3A 2FZ3A 5LBVA 5IOBA 4PJ8C 4PGBB 1CCZA 5AOJA 3S3CB 4ZR8A 2NUWA 1NCCH 1SFJA 3R25A 4LSQL 4LCYB 1VGEH 1EX0A 2XZAL 3MQIA 5E94A 4UUIA 4UTAA 4XVSH 1QEXA 2WN2A 1EJUC 2NQZA 2VJXA 3B0PA 3BGFC 1TF4A 4DJDD 4WKHA 4AKPA 4MDJB 3WTXA 2FQEA 3P8IA 4YHOH 5DU7A 3OW1A 3H9ZA 3ARDD 2MCPH 2F38A 4FNUA 1NWTA 4G8FB 3SOBH 5EU4B 4TSCL 4A7GF 1RUML 1Z3GH 1A22B 1SUJA 1XR2A 5KTEH 4PBXA 5F1NA 4E4PA 7REQA 4FNQA 1YAIA 4U1NB 4QHUA 1WA3A 5JXEA 4E3TA 2X10A 1IZCA 3SCRA 3VE0B 2H2SC 1W9UA 4LRSA 3RNDA 2X16A 1AQ8A 1IR2A 3IIZA 4MA8L 4EN2A 4IJ3C 1VEPA 5KSAA 4HZLA 3PRZA 1TZZA 2WBJC 1DYZA 2YWYA 3A12A 4OCWL 2NV2A 2UXTA 4E41A 4MZ8A 2Y1VA 1JNHA 1Q0YL 2GJZB 5D9SB 3W5MA 5D04C 1NM9A 1W1PA 5AC7A 2O9RA 1W72H 3DOSB 4QXGL 1QFPA 5EOCH 2FQFA 4C5ZA 2MNJB 3MRDA 3IU3A 1JFHA 3SHSA 4H4NA 3QUZD 4BQBA 2CRYA 3E9AA 1QFWI 3FH8A 1O6VA 4DZHA 5ITFB 1Z5YD 4YVVA 4DKFL 5AECA 5I1HL 2A0LD 3K8MA 3NDYE 5TQ0H 2PYED 4A7TA 5HYJA 1Y0LB 3UAAA 1I8JA 3VPLA 6ALDA 2YDQA 1F8TL 5E8NB 5F7KC 3O3DB 3PDDA 3UACA 3AYVA 2LE9A 1SY6A 3ZR5A 3WBWA 1OM9A 3CX5K 1QRQA 3MGTB 2FO8A 4ZMVA 4D72A 4Y9PA 1YEJH 2H45A 2Q2LA 4U1HA 3UTSD 1IIHA 2YKLL 1ITQA 3TYCA 3H6AA 3L6FB 4FZEH 4RMWA 3PWPB 1DUYB 4AIXA 1F6YA 5CPOA 5XINA 4ZMNA 4E0CA 1HJVA 2C3HA 4JTEA 3Q45A 3ESPA 5I2UA 4RV3A 1A50A 1LTDA 3GBNH 2ZJSH 2REQA 4RNHA 4Q74A 3ZQ9A 2OO0A 2BM3A 3EEGA 4BK4A 2BMKA 4KXBA 3KVQA 4FE9A 3V4BA 3HG3A 2RUSA 2HCZX 5L4MA 2FRGP 4YHIB 1OK0A 4LBEA 5BU6A 3UVIA 3VXGA 4KEUA 4HMDA 3MI3A 2LR4A 3QS2A 2JJVA 2WQ8A 3W9EB 2YPLE 4A6YA 6FABH 2DL9A 3CDZA 2ZUTA 4UTBA 3KJ6H 2VN3A 3H9HA 5FHAL 2QPSA 4IBTA 4W6WB 3F6LA 1ISWA 2HWZL 2QAPA 4JDBA 4R33A 5FFGA 5IP4A 1CFQB 2DWDA 4G6KL 5AL8A 2KS0A 3DJTA 3RWCA 4XBPA 4BQ8A 4EZKA 1V8EA 3QZ6A 1JZHA 2CAKA 1K6AA 2CCWA 1LBLA 3S1VA 4N2BA 1H3PL 1T5KA 2IOIA 4Q4IA 2BJML 2OSLB 1P7TA 1G9NL 4XXDB 2ADAA 3CIXA 4P57A 3ZN6A 2RH9A 4LVBA 3W27A 4BFAA 2E74C 1ZVNA 1BXCA 4CA4A 2ZXDA 3JWNG 4PCKA 5IDZA 5LAXA 2FHCA 1JZ4A 1F05A 4X0KB 5D5MB 3MJMA 3CHPA 1KB3A 5IJVB 1BQHG 3CZNA 1VEOA 3WYRA 4MNQA 1OF0A 3DX2A 4PBVC 4C56B 2OKOA 1SJMA 3V5CA 1EV2E 3O11A 5IQLA 4L4LA 4PBFA 2H6PA 3MRJA 2I25N 3BIBX 3MV9E 1JYXA 1BG9A 4G7FA 1OY3B 3KYMA 3G8RA 5D09A 5HD8C 1CS6A 4G8GB 4GAFB 3DURA 1L0XA 4P9HH 3OG3A 4P5MB 4LS1A 3BLDA 4NZ4A 1OZQA 5A2LH 3DX9A 4BJLA 2GI7A 3AT0A 1EJ7L 2POZA 3M4HA 3GDKA 5GJNA 4HIJA 2IPTH 1K6WA 2ADJA 1TLKA 1I53A 2DQFB 3AXHA 3DX7A 3EH1A 1CFTA 1L6PA 4YFLI 3SCMB 1UKOA 3GD6A 1A1NA 4KFMA 3UWQA 3EWYA 1XLEA 2VXVL 1GYLA 4M3KB 3B9NA 3BUYB 3BD3A 3APCA 5I8KL 4CN4A 5IJBC 3EX1A 3LK6A 4KFNA 2CGRL 3WS3B 2PZ0A 5FCUL 3B04A 1GKQA 4LBUA 2P88A 4YAQA 1S9XB 3IXTB 4KY2A 1XIWD 4O00A 5SX5H 3UG5A 3ALFA 4OE7A 2EVFA 4Y2DD 3ZDZE 4N9EA 2A7PA 3MWAA 3OBAA 4NUJB 1PJ9A 2X9ZA 1BVOA 2Z93B 1E6OL 2DQDL 3H7LA 5JPMB 1FZKB 3FCSA 4DF2A 1PZBA 2VRQA 3MJ8A 4OSUL 4N3TA 1QRNA 2F6AA 3L4CA 4GKOA 5D72L 2YBUA 3ITOA 1IM9A 4LU5H 4X2UA 2JTDA 1NP2A 1F02I 3IPEA 1A5UA 3P14A 1GW0A 4Y2DB 3BAXA 4AZHA 1G6CA 4TU1A 4FAMA 1I3RA 2CH8A 4JO1L 4U1MB 2NY3B 2CKBH 1JDFA 4ZMZA 4LLWB 4KDVA 1RZ8A 4DCQA 1DSWA 4OW6A 3HJEA 5KETA 3QDGB 4QRFA 2OZ8A 2DQIL 2X4UA 5IQMA 5J9PA 2GJRA 2WO2B 1YVLA 3O06A 1YDOA 5K9JL 5ISZE 2X6VA 1ENUA 1CFNA 1N10A 4Q9RL 4YZWA 1U1HA 4BWLC 2VR8A 3W7LA 1NIAA 1A6WL 3K5XA 3ZJ7A 1NMCB 5IHUL 1LEIA 2GJXB 3FFOA 5E4EB 4BQ2A 4TUOB 2AQOA 4RESB 2D7OA 2K6YA 4J1OA 5I5JA 4HHAB 1KZYA 3EO0B 4O18A 3ZLGA 3ABLB 1UJ3A 3M5VA 2CHRA 3JT0A 2HE5A 1MNZA 4NWTH 4IQJA 2XVKA 3SUWA 1W3NA 3KBPA 1B4KA 2OI9B 2XHNA 1WQVT 3BT2H 2A1YA 4K3GA 3WD2A 2JB6A 2E5BA 3WFHB 2ZX9A 3PJLA 4OIIH 3P02A 4BZYA 4EANA 3DYPA 2LGNA 3QQ9C 1XGQB 3QDMD 3TT1H 4BSVA 2A4CA 5I73B 3GVRA 3CFMA 2NUTB 1R38A 3PV6B 4HUXA 1AW2A 3P3RA 1Y18B 2A4EA 1GMIA 1BQLL 1XDTT 1G9MC 5TBOA 4XPGH 5IHBA 2EDOA 1U8IA 3QUXD 1MSSA 4ZRGA 4YR6B 1UCBL 3AFLA 1U8HA 1ONRA 5IB3A 1NEYA 3DUGA 1HH6B 2Q9OA 4I2XE 3WNLA 1JPFA 4ANXA 5I79A 2YA0A 3G5WA 5E95B 2DTSA 1DIKA 3SRHA 4Z77B 1KXQA 1ROCA 3AREB 5EC2B 2GGJA 1A0QH 4PFMA 3SE8H 3UPCA 1MUJB 5IESL 1S3HA 1FO0B 1HILB 4YHPA 4AMAA 4GW1A 4OI8A 2DPEA 5F7NC 5C0BD 1PS3A 4JN2A 3C0LA 5A95A 1UFUA 3UAJA 1TTRA 2HFTA 3S36L 4ENEC 5HHMB 1SEQH 1H1ZA 4E9XA 3D51A 3QUZA 5E23A 1ET5A 3NZGA 3RR1A 5DFVD 5EUKB 3FO9B 3UMTA 2R24A 4L9XA 4AZCB 3MJWA 4AH2A 4LSTH 5I8CA 4NYYA 3RKDC 1FBIH 1IAKA 4QRPD 5FA3A 2YXMA 5DZPA 3GVWA 4HYRA 3VWJA 1JPTH 1T66C 5EUOB 5GS2D 3HQNA 4PEKA 2QCMA 2KLSA 3VFRB 5K39A 2JGYA 2XIOA 4B3EA 2D0GA 1KGUA 2IXUA 2BGQA 4W93A 5FJRA 3ATAA 3NQIA 2IPUK 3HCVB 2XPGB 4L05A 1KTNA 3FOMB 3AYTA 1CENA 1CXIA 1QSFB 3T81A 4LL1A 5CLXA 3H8NA 2FVLA 1G4PA 2H90A 5AB3A 2F08A 4AVJA 2OJ1A 3BX7C 4YNGA 1I0DA 4G80A 1CXHA 4F7EB 4XCYA 4EF3A 1FV1A 4YGVA 5C2BH 4EXAA 5SWSE 3W2JA 5HMFA 1FTXA 2ATPA 4KV5F 4PLJD 1PGRB 3M1OA 4FI8A 4R26L 3SPVB 1WC7B 4AWTA 3I68A 5KVEL 1YN7B 3BVTA 2MQGA 4MJ6B 1OM0A 1DVZA 3ARBC 4XH2B 3SKOA 4JIHA 3UZJA 3FT2A 2FH8A 5DHYB 4O0KA 4AEOA 4TIMA 4HMEA 4MD5B 1BVZA 3MNWA 5BOFA 3EOLA 1A6UL 3RPMA 4HS6A 4PJHB 1MFAH 4PV9B 4W88A 1BOGB 4BJHA 3VTAA 3EYQC 1PYWB 1AH0A 3BT0A 1XYFA 2WZPD 3IGXA 2Y36H 3HZMB 2FGLA 4W89A 1D5ZB 1ICTA 1IIKA 4OFDA 2M83A 1WDRA 4DP6X 4YFEA 1DCLA 4J3BA 1QX1A 1OSEA 3AZUA 3H3KA 1WZLA 1S5HA 3NIGF 3NCWA 3NSDA 1XF1A 1DEEB 2C4FT 4IU3A 4X6CE 5D2NE 3PJWA 2HG0A 3V10A 4K3DL 5GS1B 4XMXA 1Q72L 1SYVB 2Q8BL 4HCGA 3BC9A 4KH2A 2CWRA 5CU9A 4AXWA 4OOUA 4RMBA 3AYRA 4GBXD 4LSPH 4FXRA 2H32H 5KZDA 1JAKA 2GAZA 1QWGA 3NCMA 4TQTA 4ZX5A 4NZDA 1T4KA 4PJEA 1JCNA 4A3UA 4UB9A 4JS7A 1TZ8A 3TN4A 5DCEA 1MWAL 1JI2A 4OKVB 3G04A 3LN3A 3DIDA 3TYGL 1HSAB 1U8MB 2P46B 3L48A 5JIHA 1ZEAH 2W8CA 3MRIA 4D0BB 5ANHA 3GJFH 4GIRA 4H9UA 2CBMA 3BVXA 3CE1A 3FUMA 3OB0K 5ACZB 1U91A 1MNSA 1Q3NA 2R82A 5CSRA 5H35A 2YD1A 2UY7B 2OTUB 4HTYA 4JRXD 3DTXB 2DV0A 4EIVA 2H0JA 3O2DH 3RIFF 3S5LB 2WXMA 4PWFA 1FJ1A 5ETUB 5CHNB 1JF5A 3G1HA 3QXAA 4L8SC 3G18A 1T41A 5HJBA 4F40A 3UYOD 2HCVA 3TBCA 3NVDA 4CQ8A 5C97A 1Q6LA 4G6JL 1XLLA 3GB7B 3I85A 1KBWA 3SJ3A 5D1ZC 2IH1A 2W63A 3GY1A 5DT1L 2WTRB 1Q9LB 4W5ZA 3QZBA 5AALA 3HBZA 4HA4A 3BWUF 3D05A 4R84A 2BXVA 1EHLL 3W73A 1VFLA 4N6RB 2MCMA 1BZEA 1CR9H 1XF4A 3RY6A 3LHAA 2PGWA 4EPBC 3HEIB 5I0DA 1ITXA 1I1XA 4OVVA 4WUKH 2O4QA 1JCMP 4DWSB 4L5ZA 1YQVH 1OFOA 2YGYA 5HJ3B 3DWTA 4TSCH 4DKAA 4ELKA 3GXNA 4GRWE 2PDMA 1ZY9A 2C9QA 1NP0A 3SQMA 1OT4A 1NBVH 5T33H 3LMYA 1G7HA 5F2MA 4CCCA 4YSUA 2GLKA 2IPKB 3RFZA 3B5HA 1SGJA 1ETJA 1HQTA 4GRSA 4XP6L 1NCBH 2HLAA 3GSWB 3HC4L 3QUMB 1FZJA 1MHPH 3MMEA 2AW2A 4KU1A 4QUOA 4WI9A 4NAEB 2WB1A 3GB6A 4N02A 4KVPA 2C9PA 4U6VH 1S3KH 3M17A 2CA3A 3SKNA 3DGRA 3EJUA 2BVQB 2I5YL 3HR5B 5GSRB 1FDYA 1OINA 3KWTA 4PJ9A 2WM1A 4PRPD 1GEQA 3O81A 2R1MA 4KK9C 1ONWA 5DQJA 4OFYD 2PR4H 4IRSC 4IGBB 4IQEA 2IG2L 1T6MA 5LGHH 4OUUB 2XM2A 3LHVA 2F5AL 3BWZA 3ASOB 4PJEF 1PKYA 4JTJA 2OULB 4FQCL 1JUEA 5IY5B 3D85A 3LTYA 3NA9H 4OB5L 3G24A 3UR5A 2JKWA 1NMBL 2IS7A 3D3VE 2CRMA 1B2WL 2OJEB 3H6JA 4NPYA 1JCJA 4Z76B 2WSYA 1G1YA 1FORH 2CDFB 4JO3L 3ZDZF 4BD4A 5HA7A 3L3DA 4XO3A 1RD5A 1BIIB 1BX2A 5EUOE 5IBTH 3VGHA 3B8DA 1XRTA 3LHZA 3IWUA 4TVDA 4AX6A 1SEBB 4RFOH 1R85A 2YN5A 1XF5B 1QA9B 4Q8VA 5IMLB 1Y07A 1YTDA 4LT7A 4XCEB 3IDGB 3NDZA 5FF6A 1YEKL 2YMXH 3DOHA 4Y4HD 2PF0A 4NP7A 4HZ1A 1YQVL 3ZT5A 4HZAA 1NCUA 3QZWA 4NM4L 3OX8A 4E0RB 1AS6A 2M2DA 3U82B 3GVGA 3LBOA 4TNWK 4Y4FA 1FL3B 3W71A 3A6BL 3SYAA 1JV5B 2V5JA 5EPDA 2YAOA 3TNBA 4YNYB 4F7CB 4H8WC 1K8IB 1MVUA 5CJBA 1A7NH 2OMBA 4TTDC 2ROYA 4X9YA 1N6QH 1W9PA 4YL9A 1S2CA 2GVEA 4S3JA 1P5UB 2TMDA 1NOWA 2B08A 4MB3A 5E7BA 2WWCA 2ZZ5A 4JM2F 4U1LB 2XIJA 4MDRA 3FSTA 3EX6A 5I1GL 3EMZA 1B90A 2BLEA 4UQAA 3UC0H 5AOUA 3VFMB 3AS3A 1M56B 2NYYC 4MJHA 4DP1X 1G6VK 3A0OA 3VIPA 1GJPA 2EPHA 4E2OA 2A6DA 3OF6D 1V0KA 4HWUA 5CD3A 3RGVD 5HJXA 4B90A 1IU1A 1NLBH 4JY9A 4N2NA 5I6PA 4C47A 4H9VA 3W3OA 2R2CA 4PUUA 3MLVL 1EJ6A 3MA9L 3CT2A 4HSQA 5C9WA 2XG5B 1OCWH 1AKJB 2H9AB 4J3OC 2FLRT 2FK9A 4YXKH 4NAJA 2CHZA 3IDIB 4MCYA 1W5OA 1OX4A 3C08H 4S0SD 1UH4A 4B41A 4XZ9A 3EO1B 1TKWA 5DSCB 4EDWL 1DQWA 4UTHA 5I3GA 1W3JA 1ACYH 1HI6A 3VNYA 4QTHA 2HRHA 2P43B 3BKMH 4X6EA 4MA3A 3W07A 5E8DL 3BEVA 1OKEA 1MZHA 1OCBA 5GRZA 1S5IH 3R7QA 4H7ZA 2VLKA 1K4CA 3VFTB 4NUGL 1U8CB 3QTGA 1C12A 3G08A 2BLFA 2JIXA 4I7VA 4H9XA 1MAML 2V4LA 1EDTA 3C8DA 5D2LE 3HG1B 1MZRA 2GDUA 4WIWA 1GGUA 3BJSA 1VCBC 4KROD 3SGKC 5HYEA 4GJTB 4LEEA 1HH9A 1KFAH 4OJDH 3VFSB 4AQ1A 5JORA 3SN1A 4AD5A 4DM1A 3APYA 4L2LA 1BF5A 4L1DA 2CLZA 2HKHL 4HKXB 4LLUB 5J6GA 2QGDA 3W0WD 4A2HA 3P77B 1NAMB 3BVNB 4JQIH 5JIQA 1ORQA 2ZOKA 3ZJKA 3O3RA 4EVNB 1J05B 4FQ2H 1Q8JA 4XGZB 4BZ1A 4OBSA 4DH2A 5JVLA 4TUJA 2ADFL 2OMWB 4LYQA 2RQ8A 5L2KD 4XVUC 4C6LA 4WI3A 4YC2C 3LZFH 4W81A 2FGZA 4YUEL 1PBYA 1B0GB 3WMCA 3WFCH 1UWQA 3NN8B 3Q8AA 3L4TA 4HD5A 4CSZA 2J7EA 1T21A 2KPWA 1XBRA 2DQIH 3V0EA 3GIYA 4A3RA 1T83A 3HA0A 3OKKB 2A73A 4JTIA 4X60A 1ANUA 4PYGA 1QNRA 4M48H 3RLGA 1KG0A 4XMLH 4PG2A 1GVFA 2UXFA 1EZ2A 1SQMA 3UESA 1A6VL 4GAGH 3DFQA 4F2BA 3HRZC 5H2BB 1DBMH 3A67H 5T1LD 1UVQA 4Y9AA 2XPZA 1C1EH 3QW9A 2I7GA 1F6FB 4PLOB 3RG6A 2EC9U 3G0UA 1K6QH 3C5ZC 4UM9A 4LVDA 1M6OA 2FO4A 1DE4A 3EKZA 1NA8A 4C6CA 2VH5H 5DDHB 3LKPA 2NQCA 2OMTB 5FJTA 1DUZB 2IV9A 2HSAA 4HK5A 4IDLA 2VZOA 1KM3A 3JWDH 4KXZH 5IFPA 4HVXA 2DUAA 2ZTBA 4ANKA 3NZPA 2PUQT 3BKJL 3INPA 4HETA 3W6YA 2X05A 2QSCL 3SBFA 4O9HL 1J9RA 3IF1A 4OLUL 5ECJE 3T8MA 1N7KA 3AIQA 3KPNB 4KK8C 5BMFH 1PDZA 4W9ZA 4XBMA 3PF3A 1M1XB 2J6EA 4IIQC 3FU7A 2B20A 4O02A 3CUZA 4I18C 2E47A 3BHBB 4L37A 3W57A 1U1JA 3B3IA 4FHJA 1XLCA 4AV0A 3OZPA 2D2GA 1ZS8A 1IEHA 3VB8A 4NCC2 4XNUH 3CSPA 3VRLF 1NUDA 1V8HA 4M7LL 2NTFB 4C54A 4US5D 2EDQA 2PLKA 3KDNA 1UADC 1H8OA 4IIGA 2DZVA 3BLIA 5JDJA 5MEOA 4Z2GA 2A74C 4Z2KA 4HS8H 5F88B 3D4GA 1TZHB 1GC1C 3QDME 5E2VH 2KZKA 4DF9A 5BQ7A 3GRWH 1K72A 2H3XC 4WY7L 4BSJA 1FDZA 3RN6A 3SUVA 3HPJB 4XI5C 3MXVH 5LGZA 4H2CA 3V6BR 5DYFA 4P9HL 3QJXA 4GAGL 3MKCA 1E6RA 3QCTL 1R0AH 1PIFA 3TYFB 4DJED 4CADB 1BZDA 1C5DB 1U36A 3RDTD 3MYPA 1KGIA 1MFEH 3T2QA 1S46A 2MRYA 4CL7A 1XLKA 2BY0A 3E8UL 4PJFF 5CO1A 3DENA 2P8MA 4YUEH 1MJUL 3TDFA 4M7ZC 4ZS6D 4N25A 3WKYA 2PDXA 3G0SA 4XPHH 3UC2A 3DGDA 1AHWC 4XHJC 3B05A 1FNEA 2VZUA 4OGAC 1RBOB 1Z9OA 3PS7A 4XP1H 1NSJA 4KC3B 1XL9A 4RISH 3OGRA 4MNQD 1NGYA 2XTJB 3DPDA 3MLYL 5C0RH 4YXLH 2W60B 4FJ6A 3GT6A 4ACZB 2WP3O 5FB8B 5LNWA 4F37K 1XYZA 1X5JA 3H0TB 3H4HA 3TZNA 3DBXA 4GINA 5JW4R 3JW7A 2UY4A 4ORMA 1SMDA 3FA4A 4S23A 3RM4A 5FW8A 5EBLB 3BAKA 1V02A 4WFEE 5DJDA 2MNWA 4LCWD 4AW4A 1BWWA 1T1YB 2AXFA 4KXDA 5IUCA 4GH3A 4LX4A 2GT9A 2MQ3A 3X17A 1TRIA 1IGIL 3NIFB 3U36B 3LYEA 4NILA 3FFDA 1ZSHA 5JZ7D 3LQLA 4MNKA 1MAMH 2PO6D 1RH8A 3KS5A 1XGRB 2WZ6A 3PP3K 4OCNC 3TC3A 5FOBA 3LXUX 1U8QA 3ZWSA 4LVOC 2VW4A 4LYRA 6TIMA 4XAZA 1L6ZA 1M3IA 4JGJA 3EADA 4G3YH 3RPIA 1XIBA 4B16A 2O9PA 1MFDL 3IE4A 4WVXA 3G6JE 3GO1L 1XG4A 2VHLA 4MKMA 3QNZB 3CUFA 5FYKU 1UWIA 3O6LL 4JHVA 5GRVL 5BS0E 5J06A 3MUZ1 3NQKA 1E9OA 1MCOH 3E74A 1XL4A 3X1BA 2YPLA 1TVHB 4R97C 1FRGL 4M9PA 5DD6B 3WLWD 2I9TA 1MRFL 1EGMA 1N8IA 4UZGA 1ZVSA 2D2JA 2PAJA 1T80A 5IEKB 4RGOL 3QYSA 1TENA 3N3EA 1ISXA 1E9ZB 5AW6B 3P6LA 5H4YA 4NL1A 2PXYA 1JWUA 4L3FA 4BCXA 4I1PA 3U8GA 4PRPA 2DSZA 4J2MA 1TJMA 1UWEH 4GY7A 3I6TA 5JQIB 2Y6ZA 2RMNA 2O6FA 4AJWA 1E3ZA 2WYZA 2YXWA 3SPGA 2YPLD 3OXRA 1LDPH 1H62A 3HZYA 5KZCB 4MF4A 4Q4MA 4FDWA 2P26A 1MWOA 2DMGA 3OGCA 4LOFA 4EKXA 4MMXB 5LVEA 2V81A 2VUNA 4KNTA 2RHGA 3CFDA 3KPOA 2KBGA 2ZUSA 4U3HA 3X3FL 3PBGA 3V9EA 1K8DA 5B38B 5LDUA 3A21A 4JB9H 1ZB5A 4E9WA 1N5AA 1A4KB 4N2HA 3L4VA 1HESA 2DN7A 2INFA 1HEZB 3N1GC 1FVDA 4HU2A 1S4IA 2ENSA 5AW3B 3HBPA 4P2OD 2X1XR 5DRCA 1DQKA 2GK0A 1LTXA 3GIZL 1E9PB 1QPQA 2XU2A 1UB6A 2AERT 2P5ED 1UTDA 3QOMA 3O8AA 1O7DE 3WE6A 3LN5A 4J3OH 3SQBA 4HSOA 4LY8A 4GG8B 4TN9A 4N9BA 3W7JA 1CF1A 3TH4T 1JTOA 1CG9B 1YPZA 2DYPA 2HVJB 3FB6A 3NIYA 3G3MA 3UIYA 3PVFA 5ALCL 2Z31D 1TPH1 3P0WA 3OKLB 1N4XH 4TPRL 3SCPA 4OLUH 2BSBA 2HMID 1V3IA 2VC2L 3IJEB 3H21A 3OKOA 3SZ6A 3GJFK 1FNHA 1VGEL 1AYOA 2XZAH 3WL9A 1H6FA 1SSGA 2CC0A 5KVDE 1NC4D 2BNRB 1GW9A 3S97C 1UC6A 1G7JB 3PNWA 1MRDH 3W6LA 1IGYA 3QR2A 1TJXA 1X7FA 1NBCA 1WAEA 1WIUA 1BYBA 3L5WA 4ORZC 1TJPA 3C5SB 1OF2B 4Y16D 4I1NB 3VXUB 1W9VA 4IOTA 3STLA 2H6OA 2N56A 4YVUA 3T55A 5D7KD 3W53A 1KT2B 3QZPA 1X9LA 2VM4A 2WJDA 3BUBA 4DGIL 1AIZA 2G0LA 5EEXA 1LYXA 1U22A 3WSUA 5H2ZA 3RQ3A 4BELD 1P6AB 2MIZA 1S8DB 1AH4A 1LP6A 1U5JA 2PP1A 1GZPB 3LRSB 3MUXA 1IKNA 1U3NA 4UQEA 3AJXA 3Q13A 3JZUA 1FSKB 3TXZA 3DFOA 4I2XA 1A4CA 2BVEA 2FIQA 2XOTA 5HP5A 4OZFA 2J47A 4ROPA 3D4CA 3CFEB 1JPKA 4AZ8A 1QOKA 3CVCA 1U0QA 4IOSA 4ZFZA 4I18B 4RMVA 4DK5A 2V7HB 2I7SA 3CX5J 2E4FA 5T3ZH 1QUNA 4YHGA 4PJ7E 3T78A 1G9HA 2WXKA 3ZXAC 2HVNA 1XGYH 3MUCA 2CO4A 4Q2ZA 4NZUH 3SKUD 3QQ0A 3P4NA 5IIEB 3UZXA 2K3TA 5DC9B 2VDNL 1A7BA 3QMRA 3TW7A 4QLJA 2VLKD 3MV7D 2C9UA 5LN8A 3RVVD 3VDAA 3TNMB 5L88H 2ZRWA 4ICCX 1E67A 1KGJA 4TQEL 3BOLA 1U2HA 2ZX5A 1L7TH 4P3CL 2Q76B 2GDQA 3K2KA 3T4AC 3C56A 4WGVB 4WFHD 2VL5A 5K5YA 2FGBA 3MRMA 2HFFB 4UZUA 1KSRA 2ZXEB 1ZL1A 3NURA 1GC1L 5CKSA 2QGBA 4HNLA 1AD4A 5IHUH 1UZDA 2EKGA 2XWDA 2V0AA 3ZGHA 1QWNA 3CZUB 3IDXH 5IFAH 1XLFA 4U10A 3WF2A 2AQ2A 3D39D 4PY8I 1S2EA 2OCFD 3GK0A 4YU1A 5FA5A 1SF3A 1AXTH 2DH3A 2YZ1A 3QXDA 1EP1A 3S9DB 1NWRA 5EWIL 5FK9B 4RWYH 3AIEA 4XBEL 4F2FA 5D7LA 1SLUA 3PK7A 1BF2A 4JX5A 1FYHB 2Y2YA 3TROA 4LF3A 5DGRA 3DOPA 3QI9D 1LK3L 4YHNA 3N04A 4JPWL 2J7FA 2Y4SA 1NM4A 5M94B 2JJSC 3DZ1A 4F58L 5ECVA 2JLPA 4FB7A 1QOPA 3VWJD 1AZCA 1EJOH 3URQA 2ZCHL 2ZYRA 4DWDA 4K7PH 3V9CA 2LLEA 1TJ2A 3IRSA 2XPKA 3MLVH 3CLWA 1H5VA 3IWPA 5BXPA 5BVJA 1V77A 1RUPH 4G8GD 5FYJU 1FQ0A 4PREB 1QR1B 1UCBH 2XBTA 3FT3A 5HHQA 4YOKA 4O12A 4ZL1A 3QTPA 4JFDA 5E00B 3SDYH 3VD4A 4G83A 4KO6A 3KG5A 4YMZA 4XZ4A 4DBEA 2VO8A 2F7RA 5CEZL 1EPXA 1SLWA 1UKPA 5EO0B 5I1DA 3UWYA 1Y5VA 2ZA1A 1UZ8A 3QHFL 4NO2B 3VO0A 1EX5A 1NFDB 2BW4A 3WV0A 5C71A 3WFDL 2OA9A 3ZE2F 5MERA 4R2GB 3QNXB 2XKNB 1A5KC 1NEUA 4AWJC 3TSMA 2IQ9H 4WO4A 2ESCA 5FGBC 4K9EC 3B4YA 3GUTA 4U1JA 4D6CA 1S5VA 4UTUA 4YO0A 3GXUB 3U0WL 3V5DB 4B9ZA 2W5PA 4M6NL 4HS8L 4UAHA 5I0ZA 1JZ2A 3TEZA 2QUMA 3GDTA 4Y9OA 1TZ9A 1PDKA 2D7PA 4M7JL 5D8JH 4A7GA 1ZZMA 4X22A 2WLYA 4N8CL 1MY7A 1RVFH 4H8QA 4QRSB 4IMCA 4N9DA 3U2SB 1IAIM 1NGQH 3CD4A 2EDBA 4XN2A 5HHPB 1EAPB 3WUWB 3QZLA 1H50A 3WLLA 3WY1A 1UWRA 4TUUA 2EYSB 3GNML 5HGAB 1SFTA 1UQZA 3OEXA 3U9UA 4HGXA 2FB3A 3Q2VA 4OFCA 1QT1A 3VQLA 2P1YA 3ISYA 3QIWD 2JKRM 3TTYA 1AHMA 1K7FA 2W62A 5K2ZA 3B2DC 3TBWA 1J7VR 5DO2D 2G37A 1SQ7A 4WZHA 3WQWA 4KO9A 2H4EA 4I8DA 3U4EB 5KVDH 2WJ7A 2ICEB 4P4KB 4KZEL 4K1WA 4B2DD 2NVAA 3W7NA 2CJUL 1FBIL 4P46C 4LU5L 3KRZA 12E8H 3K8LA 1SJHA 1QNZH 3LAFA 4RXGA 3BPNC 3FRPA 4JFDD 3LI0A 3FQWB 3CVIH 3PJSB 2BIMA 1Q63A 2G4EA 4K3ZA 2D73A 2FE0A 4WW1B 4EE2A 3SKMA 4UQ9A 1SR9A 1KD0A 2PDYA 4D6EA 2GZXA 2DSKA 4IRZH 4Z1YA 1GRWA 3AXLB 2ACQA 1KRAC 3UWUA 1Q94B 5TE6H 3N42F 2IOOA 1AGEB 4M1CC 2J79A 1QQDB 3FRUA 4KKCC 4ERSL 5I1KH 1TWZA 1CLYH 1A4JA 4PRDA 3N25A 1ZUAX 2FL5A 4MZ2A 1TJGH 4ZDHA 4ZT1A 1RY8A 3OJDA 2XSBA 5I6XB 1EGJA 2Z8SA 1R17A 5CWSA 1A2YA 5GS1C 2QPEB 1MNNA 1EKOA 4MKSA 3KCWA 1TJ1A 2BFVH 3VOGA 4HIHA 2FSDA 5J1AA 1QOXA 2MNUA 4LCWB 2WWMD 1OSZA 3GKZA 3UP8A 4XP4H 5HGDA 3OWEA 4U6TA 5EO1A 3G6JA 5M7QA 1FNSH 3CJJA 3LZLA 4H9ZA 4GOAA 4P3DB 2NZ9D 2VDKL 1NGPH 3Q0HA 1FZOA 1V7MH 1S7WB 3S5OA 4IIHA 4GG6E 5DFAA 1SNRA 4ELMA 5MI0B 3T0WA 2J56A 3QEGL 2X4PA 4JO2L 3V6OE 2C16A 2R4SL 4HX1A 2VI0A 4KQ4H 3CXOA 2IMRA 2ZD0A 1OGAB 4QYAA 4UCFA 3EFDH 2LAAA 4HC1L 5AYTA 4YHYB 4L9LA 5AHMA 1RHFA 5E8OA 1N68A 32C2A 1AY1H 1D7CA 2FJGB 3UO1L 4CMMB 5IHLB 1QSVA 2PWGA 3P30L 4M7KH 4CKQA 1XLAA 2HJPA 5KOMC 4NNBA 1EDGA 3EJZD 1JV2B 4L8BB 3MCLH 1WDPA 3WDIA 4GRWB 1I4FA 1U8OB 1R33A 2PLTA 3N50A 4LAZA 2OPCA 3L1GA 3K2UH 4PW4A 1ZT4A 2OQJA 4IRJA 5GRJH 4EXPX 1EHAA 2A3AA 4XVJL 5IGXL 2ZXCA 5CJXC 5HI3C 1HO4A 3MYJA 5HBBA 2VN4A 4JPWH 3GSXB 1TB3A 2QR0A 3HAEA 3P0YL 2Y8UA 3BQ5A 4H26A 4WI0A 1VHCA 1I2OA 1CICA 1SEQL 2Q3RA 3XIMA 2FHBA 2BW5A 2R27A 4F79A 2B81A 2Q7YB 4IIBA 4BKTC 2VD9A 3QFJD 3OM3B 4A68A 1A3XA 5FACA 4QX4A 3PWJA 4PVMA 4UTBH 5CP7B 4TVPL 4WKXA 1C9DA 2V0TA 4LOEA 3S5NA 4G6FD 4W7UA 3QIBC 4A7VA 1C5BH 3BPOB 4K71B 1XB8A 2IVFC 2V5SA 5DEFA 2YDRA 4DJFD 3RFZC 1S7TA 3B2VH 3V75A 4IOIA 4GZ7A 5JBEA 3C09C 3EGXB 3WJYA 1INEL 2GFTA 5CSZA 4UC5A 3LKQB 4M43H 2F53B 1T8QA 4G6FB 3VXME 3WSQL 3NQVA 4FF5A 3T0TA 1CJYA 1KFJA 1P4CA 3CH9A 3GSUA 4X63A 4D8PB 4YK4B 2AXWA 1FIEA 5E7FA 1MPAL 4NC1E 5KYNA 4R26H 5DHMC 5IKCB 2WXRA 3Q6GL 5CZRA 2P47B 4BQCA 2AEPH 4WGWB 5F0MB 2BERA 2VDGA 3ECBA 2X7LB 1LL1A 1I8LC 2DM4A 3NQCA 1R3IL 4NPJA 3PBVA 5I1EH 4UNIA 4L1SA 1WT5A 1KM6A 2R0WH 2JALA 2EYRA 3LRLA 4XOAA 1X6NA 4CDGC 4F9LA 1MYRA 3HMXL 1WCBB 2PCXA 5KSVA 2H8ZA 3I6LD 4P8XA 4LDLB 3VI3E 3IRPX 4JTQA 2OMXB 4MSWA 3UAJD 3OODA 2NZ1A 3SO5A 1RA5A 1UR2A 4C58B 5CIPH 3RK8A 4PJIB 4N5ED 3VRIA 3OQEA 5JW5A 2XQYK 3TA3D 3FC8A 5FL0A 2YAEA 2ZZ4A 5IVZB 5L2KA 3CTTA 1ETZA 1TTAA 5BS0B 3PANA 2MPAH 3DIVA 5ESQA 2DZTA 4LUSB 4DVOA 4N8PA 1O5XA 3D39A 3QRLA 4TVUA 2RKXA 4KIEA 4TOQA 2YXFA 4JLRA 4AK1A 2ALDA 4QNEA 3C61A 4DELA 3EJTA 1HJUA 4WXZA 2EO7A 3MBWB 3TCXA 1R3SA 4PGDB 3KBMA 1CLKA 4R7JA 3GK8L 5DJZA 1GSKA 3OPZL 2DT2A 4Y9FA 3TZVD 4HKBA 1AXSB 5JLZB 1FHUA 5G4EA 1QUMA 3C6LB 2WJEA 3C2AL 5CJMA 2EIZA 1OBAA 3SZKC 4OSUH 2JLLA 4LSRH 1GPWA 2X3AA 2C79A 3VG0H 1R7AA 3IUHA 1I1FA 5A2KH 3T0CA 5E9XA 4IIZA 3ARYA 4K8RL 3R0KA 3WBDA 1JCLA 4NRXA 4RAUA 2GOUA 2ZYHA 2NWRA 3TJ4A 3WTTA 3I6RA 5T3XL 1SZEA 3LGDA 4MJ2A 1BAGA 2HXUA 3PSVA 2IADB 2X0WA 1UATA 1DN0A 5GHWH 1XIWA 1PQZA 4H1LG 4HXBL 4HPHA 4E9RA 2EH7L 3A47A 5C9JA 5I1AA 4KXCA 4B97A 2RDWA 2C34A 3MACH 3H2OA 1GQIA 1I0BA 2Z1KA 4P49A 1EBHA 1XIFA 1TE1A 3IUIA 3GFXA 4G7EA 3WKZA 1GL4B 5IROC 3B8VA 3NQ7A 3JYCA 5C0IA 5F2IA 4KT2A 1F90H 4P7QA 2CXGA 5KJ7E 1KCSL 1AZNA 2ITDB 2I5QA 1EEYB 4GZJA 5EUOF 4PMRA 3U2CA 3K6SA 4DQOH 2FR4A 2DY3A 3VNMA 2ALWA 1LP9F 4U1GB 3L3KB 2JF1A 2DQTL 4WNJA 1Q6QA 5LSMA 5K9KB 3WCZA 3QJSB 5A6IA 3ZL4L 1S7UA 4OD3H 5HHOB 1W0WB 3V0SA 3KXFE 4XD5A 3TYBA 3FFCB 3E0GA 5A6BA 1G1OA 4JZNA 4BDVA 2IALA 4GP8B 4PV8A 2OTWB 4JHBA 1FKXA 5JOFA 3IIPA 1PO9A 3KPRD 2AV7A 1AZBA 4LKXB 4DFHA 3K7UA 3FQRB 3VXTA 3QULB 3SGKA 2V30A 2YD2A 3QORB 4N2EA 5EZLB 4AB4A 5CEYA 1I7TA 1W54A 2OWWA 1S9VB 4HOXA 4FFWC 4P23C 1NKOA 4GYKA 4OWGA 4QG8A 1FYTA 1OSYA 1DCEA 5FM5M 3ZTJH 3AHVA 2ZSVA 2X6UA 4NEHB 1S2TA 2NW2B 2WLNA 1MRDL 2IBZY 1V27A 3MPCA 4JKPL 3HPFA 3KBSA 4WUUE 2CESA 3BANA 1BWLA 3ASWA 1I8LA 3D0VA 1KFBA 4MJIE 4Q0XH 1X4YA 3N17A 1KEGH 1OIFA 2F5AH 1PD1A 5SWSA 5KSBF 1FO0H 3L4ZA 1ZJAA 3TBSB 4JFOA 1TUXA 1WH0A 2HX7A 4RGNC 1XTLA 4QOKB 3FSOA 4AL8C 1EF3A 5C8JB 3ULVE 1E4JA 1GVEA 1MXSA 4Q58C 1ZWIB 5DMNA 4JTTA 2ID5A 2CM6A 3S8FB 2FLIA 4EWND 4H01A 4WEMB 2B7PA 3FNDA 4DIXA 1ZHBB 4B3VA 3N73A 3W75A 2A9AA 1G69A 1RQHA 3TM6A 4K39A 3AUVA 1TRDA 4EJ1C 1E1CA 4HLZH 4M6PA 4JX0A 4XO4A 3VX1A 4CC4A 1G9MH 5MENB 1HNYA 3LS4H 2D2HA 3TK7A 3VWKA 1WBZA 4GUQA 3FO2B 2QJGA 2XIIA 2WUCH 4HMNA 3IK2A 3F2CA 2JV6A 4IFKB 1OAYH 5KS9A 3PWAA 1PY9A 5IMMA 1JDAA 5A8OA 4NZFA 5FO9B 3PJNA 4UANA 1QTPA 2PO6B 3K46A 1MCSA 2GABA 1P84J 1Q9OA 3A22A 1SN5A 3KYAA 3UBXI 4OV9A 7ODCA 4ZO6A 2NZLA 5CBJA 3TO4B 1FYTE 1ONQA 1ID5I 4EZMA 3L2LA 3LSBA 2VXTL 1E73M 1GQLA 3VI4B 4PVBA 1WFOA 1E8ZA 1FL6A 2ZAHA 2EEBA 1KN2H 3EFOB 1H5BB 3OHXB 3PCYA 4QD2E 4RA0C 3D5HA 3QIBB 2GJNA 2ISFA 3MANA 4D9LL 4RW5A 4HIIB 3HMXH 4ODSL 1S3TC 3MYOA 3SCOA 1CLCA 2V3EA 3A4FA 3L7FA 4IEFA 3BH9B 5GS3A 4XP9L 3VH8A 5C0FB 1QO5A 4FOJA 1IGCH 1N64L 1PS9A 1ZSDA 1YEFH 3DDFA 3HHSB 4QHNA 3WY2A 4MD4B 5CJNA 5HGGS 1XF0A 3BEWA 4UQCA 3VFOB 3V0WH 1J79A 5L8KB 4P2RA 3G5XA 5HVFB 4HSCX 1TIWA 2WYIA 1VKFA 3CNYA 2O0TA 2CO7B 2FYVA 1KJMA 2CQVA 3MSPA 1PLGL 4H8PA 5IMKA 4CVXB 9CGTA 2D7TL 2NCEA 3DRQA 5KINA 4K7FB 4GIEA 1UWUA 2BWGA 1J9TA 2QPDB 4E3VA 1NDGB 3RRQA 5CC3A 3SDXA 3VGDA 5D9OA 4GEJA 2FECI 1DQDH 3G2GA 3GSRA 3RVXD 1K4GA 1A5FL 3V36A 3UPRA 4NQDB 5IB5A 1COBA 3G5ZB 4LW7A 2WBJB 1NAKL 3MJ7A 5EIQA 1ICPA 1DFBL 1XLDA 1Q72H 2Q8BH 3JV6B 2VKWA 5FKAA 5GGRA 2GUYA 3TJEH 1DO5A 1NDWA 1TEGA 4QEGA 3JZEA 2AKRB 2QDDA 3X3GL 2Y3AA 1H6UA 3QZWG 4LH8A 2NY2D 3ESVF 5EEYA 1V6YA 1BFOA 1OB1A 4UU9A 4OLEA 3VXRA 4JXCA 1NQKA 2PA6A 2Y63A 2BXZA 4J23A 4U05A 2W0PA 4CVUA 2FTPA 2G9KA 1BAFH 7PCYA 4NXSA 1GVOA 4K7VA 2WZAA 5DN1A 1JTTA 4ZB0A 1F5ZA 1D9KA 4ZTOL 1WAPA 3VDBA 1X5KA 5LCVL 5MEQB 1RMFH 3JR2A 2YR3A 2CZEA 5C8BB 4LZKA 3MV11 3WK3A 5JHMA 1KRMA 1UIPA 3M8OH 3RIAK 3AU0A 1DWGM 2INEA 1F4YL 1S3RA 5GNZA 5KUKA 4XOEA 2GJ6A 4IMEA 2CA4A 4N2MA 5TK4A 3CIAA 5L2KE 2FSEB 4YE0A 1Q66A 2GG1A 3FQ4A 3UXIA 2R7EA 1P53A 4XWGL 1J5TA 1KIRA 4FNSA 5DI8A 3V4LA 1YMYA 3LEYL 5I15L 1BIHA 1P84K 3HE6B 3PP4L 3IK4A 4DPQA 2Z7GA 5E0QA 4JDZA 1SXCA 4JAMB 4LUJA 3T65A 3ARGB 4N90D 3QG7L 4P05A 4WVRA 5H91A 1TQUA 2CWNA 3EJYC 4RNIA 3TN5A 1H6EA 4LVEA 4V1YA 5H4ZA 3H3PH 1FDLH 1KJ2A 1BEUA 3I2CH 5CKGA 4DBWA 4PTTA 4X7TB 4PJEE 1K4DA 2YKKA 1H9DA 1QXLA 2CIKB 3LQAH 4N68A 4X4YA 1MCOL 2B8OT 4R7DB 2C1OA 2GVYA 5IFHL 2VMDA 2ZVRA 1KW1A 1EEUA 1KYOJ 2VO5A 1KXTB 3L1OH 1HINH 3QUMH 4F37F 2HTLC 3GU9A 1TYJA 5D02A 3MOBH 4HJTA 1C8QA 1QVOB 1MRAA 2HRPL 1WBJA 2ZUMA 2ADYA 4UNKA 2F53D 4J3VA 3RJOA 1E5YA 4KK5C 2O6DA 4OV5A 3PJTA 4HCRL 1A66A 4MLRA 3L2NA 5J6HA 4IRZL 4JZJA 5E8DH 3ZKND 2OZ3A 1F3WA 1R24B 3D34A 2BRQA 4Y5XC 2CUHA 5TGBB 4E41E 4LOUC 4NQQA 3TEUA 1J5OH 1MHHA 3QQ4A 2HJKB 1OP3H 5DBUA 4GG6A 3EGDA 4Y9GA 4WWPA 3JV0A 5I16A 1ITCA 1CFSA 1JMXA 4Q0XL 3A6CH 2CLKA 1RJZA 2BZDA 1TCRB 5FGBA 1N26A 2OK0L 5KS9E 2VXVH 4M61A 3SCMC 4PTWA 4U6VL 1A25A 3STCA 5AW5B 3FK4A 4LPTA 1TPXB 5CD5C 3V0IA 4IHOA 4YLBA 4O17A 1LWHA 4L3CB 5IGXH 4JJHA 4TYUA 2OX5A 5ITBH 4E9TA 4F2MB 1OVDA 4WJ8A 4O02L 4IJTA 4BQ5A 3U0TA 1QW8A 4OV4A 2D69A 3UCCA 4D9LH 2Q6WA 1AE6L 2R2BA 1JPGA 2FEJA 35C8L 4Z7UE 1W3LA 1QG3A 2FB4L 1T22A 2GTZA 4M6NH 2E8YA 5E1HB 5C0AD 3T0EE 4D2NA 2YD8A 1B4TA 4QO1B 1A0CA 1TJRA 2DWXA 2IDQA 1V79A 4F48A 2W0FB 4P9MH 1IC7L 1WFMA 1Z0MA 3FUJA 1LD9A 3WXWL 3BW9A 1UUMA 2GGHA 2OG9A 3BN9C 3AMKA 3B9DA 1EUNA 2GUUA 2BP8A 3MRRA 3DUSB 1DVXA 4NCC1 4TUKH 4P46A 3N41F 2OT0A 4JQ1A 4ZVJA 3P73B 3ZHLA 2IAAC 2L4OA 4WW2A 3HB9A 3GTHA 3QH3A 3NQDA 4PJCE 1LP9E 5K69A 3G6DH 4RUBA 4GZIA 3X1EA 3FHAA 3TKFA 1NDMB 1KB5B 3NIDB 1WAAF 2V2WB 1KN4L 2V5TA 5DJYB 3WH7A 2EKSB 1PZDA 2VITA 4DAIA 4DO7A 1MFCH 4WCYH 4ACPA 5BROA 5ACLA 2Q5BA 3PAVA 3IDYC 4FJYA 3F01A 1XZ0A 4OLZH 1BFTA 5BCAA 5L6YL 3AIVA 1QI5A 1UZGA 2DDQL 1OFQA 1UR0A 2H7WA 4G43B 1EEZB 5IDIA 1IC4L 2NX5A 2A6JA 2XWEA 1XSOA 4XCCL 2MKWA 5LGJB 4B7IA 2ED9A 4L6HA 4P7NA 1PKQA 1XSJA 1L3NA 4AGPA 1M01A 5CN3A 3H6OA 3W87A 4U3XA 4KWUA 4F5CA 2XBDA 3UTZA 2IWFA 1CURA 2B7NA 1PMYA 2DLHA 1MF2H 2I16A 2J8GA 1YCSA 2CK0L 4GXUN 4JDEB 5GZND 2QEJA 4XMZA 2YRLA 2XXFA 1YY8A 1OGSA 4WUUA 3VCLB 4BK5A 2VH5L 1ZGLM 5FFOA 5I02A 3GTFA 5D1QC 3KPQB 5ANMB 3IIVA 2NY0B 2TAAA 4IKJA 4B95C 2WANA 3VFLA 5CSYA 2VGLM 1W3IA 1KBJA 4P4KD 4D94A 4XSMA 5EB8A 4N5UA 3QFJE 3L67A 5IFAL 2UY3A 1IWAA 4JZJC 4KJYA 2HRLA 3LI1A 4PRNB 3B5TA 4KFOA 4H7VA 1FXQA 5IF0A 4ZTPH 4NAFB 1MNUL 1VADA 3T2LA 3PTDA 5IB4A 4DB7A 3IJHB 1A6TA 3DGCR 4AC2A 1ZTVA 5HWNA 2ON3A 2BPBA 2E59A 3IVKB 3M0HA 1V7YA 2WOYA 2CBOA 4I9JA 5EL1A 4KQ3H 4Z3GA 4B9JA 3F62A 1EC7A 1JHTA 3LGGA 3MR9A 3SI9A 4C6BA 5L88L 4LS0A 3S8HA 3DBPA 3S37X 5FW6A 2V5MA 5GQBA 3IDJB 3QEGH 4IBQA 4JO2H 1PX3A 2JF7A 4QOKD 3EBGA 4HK3J 5JO5B 4PB0H 3DUUA 4APXA 4PG9A 1Y6MR 2BNQA 5E5UB 3S0PA 1IF2A 3TXAA 2ZP8A 4UYQA 3Q4DA 2CHDA 4LPWA 2VC9A 4OFPA 2PBGA 1XV8A 1DEDA 1VSCA 1REQB 5GHWL 4EDXA 2R4RL 2VFFA 4F5CE 3L7RA 4PE8A 2H8PB 4ICNA 1OGTA 4M02A 4UT6A 4WHTA 4ABUA 4DZBA 1Z69A 2XI9A 1FFNA 1HKLH 4Z78B 4WAFA 1BLNA 1A4MA 5C86A 2PD9A 3OBEA 3KYNB 3VIIA 1KZQA 3M1ZA 3UBXA 3U9IA 2AI0L 4RZBA 3MLTB 5AB1A 2OOGA 2X6BA 4IBYA 4M6AA 5EU6A 3QHFH 3OKEB 1UPPA 2KX9A 4TQIA 1UR1A 1JZGA 3PZIA 3QMSA 4Q7NA 4CD7A 3S3GA 4GQPH 3V0VA 3N44F 4L8SB 1A49A 3RO8A 1I7RB 3H7BB 1YEGH 3GBNL 4XHQA 3WZ0E 3QB7C 4DBUA 5IQNA 4DGVL 3QDGD 1I60A 1JVNA 3THDA 3G6AB 4X7SH 2KYIA 3KVDD 1F0LA 4YSRA 5I76B 3V79C 1CEOA 3NPXA 4CC0A 4PJCA 4LALA 2GIYA 1RUPL 4D7BA 1F4XH 3JWDC 2I07B 3Q37A 1CN4A 3MRGB 1EC8A 1EWEA 2QMJA 1NCBL 2J5LC 3HC4H 2H26A 3ZZSA 3VXQB 1JK8A 1GTFA 2B1AL 4IPJA 4FKEA 3N4EA 4ZAKC 4ERIA 5TTRA 1FLRH 2JCCA 3EO9H 2KDYA 4X7FC 4YN3A 2YSTA 4JKPH 1R5YA 1G7QB 1HOCB 1UG9A 4NGHL 2CNCA 2W0KA 3NCJH 2NY4B 4GAYA 4JTRA 3SIMA 4HPNA 3RHWK 4MCMA