1JXKA

Role of ethe mobile loop in the mehanism of human salivary amylase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
total genus 179
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jxkA01
3TTQA 3AHVA 1EQCA 1Z32X 3SURA 4Z2KA 3EDFA 3L4WA 3WNMA 4CKQA 1M53A 1FP8A 3VGDA 4TOQA 2WCAA 3CIVA 5DF0A 1JIBA 3BC9A 3GNPA 2GFTA 2V5CA 4GI6A 1QWNA 1XSKA 4EANA 3LXAA 1G94A 2TAAA 2FHFA 1NWTA 1NP2A 1HKJA 3W53A 1JYWA 1R75A 4CD5A 3HJEA 3UG3A 1BVZA 1TR1A 4H8HA 3GH7A 3MMUA 1CLXA 3BUBA 3WEOA 2WXDM 2XVGA 1UR0A 3A21A 4FNRA 1G9HA 2E3ZA 3T0DA 3CUFA 3GDBA 3QHMA 1WAWA 3HMCA 1KTBA 3WF3A 5D9MA 1CGVA 4OIFA 3WH8A 3TTOA 4DWSB 1QOXA 3O2LA 5A8NA 2VVNA 6TAAA 1JDAA 1QWUA 3EMQA 3GXPA 4UQ9A 3AZRA 5CGMA 1HJWA 5IFPA 1W3KA 1OIMA 4AD4A 3VD5A 1OB0A 2WMIB 2BVYA 4MPKA 2D20A 2CBUA 4ZE4A 4XX6A 4L4OA 2VTFA 1UD3A 1C92A 4S3KA 3UR7A 2BVTA 4MB4A 4W87A 3VMOA 4J7RA 2CETA 1OWQA 3AXIA 4AEFA 5LA0A 3ALFA 1J0JA 2ZUSA 4ACZB 1VFUA 1R46A 2NT1A 3BSGA 2YFNA 3ZJ8A 2XHYA 1OD0A 1JDDA 3WNNA 5FL1A 4HPHA 3DX0A 1X6LA 2WZHA 3VNZA 1ECEA 4MAVA 3DYPA 1RH9A 4H2CA 3AHTA 3WD2A 1H0GA 2Z1SA 2J7HA 4W5UA 2WHMA 3QHNA 3VGGA 1UQYA 3BAYA 4P7QA 2F7RA 2WMFA 1FHDA 4AZCA 2AMGA 4JIEA 3CH9A 1JYNA 4W8BA 2FDMA 3EJSA 4JHZA 4PBGA 4JFSA 1KBKA 1ISWA 4CVUA 1LQ0A 1QI2A 4GI9A 3B9EA 3F4VA 1W2VA 3EJTA 4F66A 4AZ5A 1NM9A 2F7QA 4PTXA 1XGZA 5A8MA 3PTQA 1E6QM 2WBKA 1VEMA 1AQ0A 1JGIA 2A3HA 3A6OA 1E1FA 1W3JA 2DSVA 5I78A 2Z1KA 3PBGA 5HPCA 3ARYA 2VZTA 1TA3A 1JZ2A 1QNRA 2X2HA 1IV8A 1UR1A 4PUDA 1EHAA 1D2KA 1OD8A 2E9BA 5A6AA 3M6DA 1FFQA 5DEZA 4FNSA 1TVNA 3ZT6A 2WSPA 1E9LA 3W25A 4P8WA 3A47A 5FIPA 4W88A 1JG9A 4H04A 3K4AA 2CXGA 5A8OA 2Q8XA 1NARA 3WD0A 1OCQA 4FNPA 3LMYA 4JHOA 3BMVA 4W8AA 2E8YA 4PN2A 4EK7A 2WK2A 1CDGA 4X9YA 1W32A 5DT7A 1KQYA 1DWIM 1ISZA 5A1AA 1B1YA 1MFVA 2J78A 3BVVA 1ZBWA 3AS0A 1KXTA 4YN5A 2DT3A 1V0MA 5AYBA 2XWDA 3VX1A 3A5VA 3WEMA 2CHNA 3U7VA 2GJPA 4HTYA 4HOWA 3CZJA 4ATLA 4B3KA 1MQQA 2J25A 2XUCA 4CVWA 5ABHA 3BSHA 3AIQA 2OYMA 3WF1A 2OSYA 2MANA 3OG2A 4MNLA 3NSXA 1W91A 4AMCA 2JALA 3VNYA 3OGVA 4F9JA 1M03A 3DX3A 3H54A 1W9DM 4H8UA 5CLTA 3SUSA 4HA1A 2OYLA 3WY4A 2XFYA 3IGUA 4UOZA 4OZOA 3NJ3A 2WHLA 3WY1A 1UR2A 4JFWA 3BUIA 1CXFA 1R87A 2A3BA 1MW3A 1R47A 2XSBA 1UUQA 3SCVA 1C7SA 8A3HA 4UFJA 1JFHA 1PAMA 3K4DA 2VVSA 1G0CA 4UZSA 3OZPA 2JIEA 2PB1A 1VEOA 3N12A 4LYPA 2YLAA 1B0IA 3BCFA 4DO4A 1HWWA 4FNUA 2PBGA 4EKJA 3S5YA 3POCA 4UFMA 2EADA 5D8WA 1B2YA 3N17A 2GJXB 5CPSA 3D4YA 2WVVA 4AXNA 2WVUA 3I3BA 4D1JA 1ISYA 2AOSA 2EPNA 3EMZA 3NIYA 3NDYA 1XD1A 4PUEA 3VIIA 4GIAA 4X0NA 5FCZA 4MAZA 3AI0A 4ACYA 4AD3A 2V3EA 2EBNA 4BS0A 4J28A 1WP6A 2F1AA 5ABFB 4BA0A 5E70A 1KXVA 1E72M 3CZEA 4B3LA 2PBOA 2E8ZA 1J0YA 3VD7A 5D4YA 1LL4A 5KEZA 1NH6A 4GKLA 1H4PA 1AQHA 2ZX7A 3AYSA 1QNQA 4KRTA 3VD4A 2X2JA 1SMDA 1LL7A 4AIEA 3CZKA 4URIA 5A8QA 2GUYA 5A2CA 3E1F1 1WDPA 4E8CA 4D6EA 1SR0A 2Y8KA 4U5KA 3EYPA 4W7WA 1WPCA 2JEQA 2ESCA 4JFVA 4LGXA 1QI0A 2WW5A 1C8QA 2IGTA 3GNOA 1DWHM 3O9NA 1UYQA 1O6IA 1EDTA 3W38A 4JL1A 1V6YA 1V03A 3W0KA 5JUVA 1JXJA 4CCEA 2ZIDA 3B9AA 1XCXA 1KR1A 1QW8A 2ZUUA 1CGXA 4A4AA 4AD5A 4HU8A 2WWCA 2E9LA 2JFEX 7TAAA 3CGTA 3RIKA 4MB3A 1H3GA 4CU8A 1WNOA 1W3HA 2VOTA 4KGJA 4E8DA 1B3WA 5IHRA 1BG9A 3A4WA 1H5VA 1QHPA 2WCSA 2HISA 5I3DA 1QNOA 8CGTA 3CMJA 4BF7A 2YL9A 5A2BA 4HZ6A 1HJXA 4ATWA 3WH5A 2DIJA 3AIRA 1JZ6A 2EJ1A 1FFRA 2EQDA 5GPRA 2ZUTA 1H41A 1R34A 1HIZA 1SZNA 1UR9A 1C91A 3WIJA 3N15A 1NOWA 1G1YA 3L2LA 3BXWA 1VBRA 1GJUA 3VUPA 4KWUA 3WQVA 1ISVA 1QNPA 5D9PA 5FL0A 1XH1A 3CZLA 4MDPA 3VIKA 1Q4NX 3WEZA 4KH2A 3IK2A 4J27A 4J3XA 4F79A 2UY5A 1ZS2A 1J9YA 1X6NA 1WZMA 1E0WA 1CNVA 3BVWA 4CN1A 2VRKA 2EO7A 3A4AA 3OLEA 1BHGA 3NUKA 4GI8A 4GPNA 4CD6A 3BUQA 3IJ8A 3EJRA 3VU2A 1AMYA 5E0FA 1XH0A 4V2XA 2F7PA 1B90A 3QR3A 3VSTA 2WCGA 2WLYA 5A95A 3PZ9A 4JZ5A 4D6GA 2WSKA 4HPGA 3VOCA 2WHJA 3AICA 4PMQA 1CPUA 4OOZA 2DH3A 3DYOA 2AAAA 3CTTA 3UESA 3AIBA 3ZSTA 1JZ7A 3KL5A 3ARSA 4Q7NA 4D6DA 2G3IA 4RE2A 1EIBA 1H49A 3VVGA 1CYGA 2G3MA 2E9MA 3U7BA 2VZUA 3JUGA 3BGAA 5LA1A 1B31A 1JYVA 2ZX9A 3D50A 2XN0A 3AS1A 3AIVA 4UQDA 2XFFA 3ARUA 1LWHA 3ZR6A 1OGSA 2DSUA 4RE3A 3D3AA 4JCMA 3WF0A 2G3JA 1ZL1A 2ZOXA 2DEPA 3ZJ7A 1XYZA 2WNWA 1LG2A 1OGGA 4QLLA 2Y8VA 3BLBA 2XJ7A 1IT0A 1UH3A 3KLKA 2YBTA 1ZBVA 2VC9A 1IZJA 2X05A 1JZ5A 5IFTA 1OBAA 2D23A 1JNDA 2V3FA 1KR0A 4BQ3A 3VIJA 4W93A 1ZB5A 3WBEA 1MFUA 3A24A 4NZCA 3MUZ1 3S5ZA 5EMYA 1S46A 3BAJA 4DO5A 1UOKA 1SYTA 2CESA 3U5YA 3G6LA 4D6HA 2BVDA 2VURA 3B9DA 5CGTA 2VNCA 3CZGA 3GH4A 5CXPA 5E09A 4OKDA 1GOMA 4GQRA 3PZNA 4P7LA 4WSJA 3WH6A 1XYFA 4DM1A 3UCQA 4H7VA 3SCTA 1JYXA 4OUEA 3VILA 2FH8A 1GVYA 1HXJA 2BHYA 2G3NA 5CPQA 1UKOA 4S3JA 4P7RA 2QMJA 3F5LA 2DH2A 1PEZA 2OW6A 3AIUA 5IDIA 4P7OA 1E3ZA 1GHSA 1WDSA 4CGTA 2VCBA 1BSIA 4V28A 2BXYA 5BROA 1KTCA 4HMCA 3WH7A 4RE4A 1E6SM 3SCNA 1E73M 2ZXQA 4PMOA 3VMNA 1ODZA 1RP8A 4GZEA 3WMSA 2F2HA 4B9YA 2J7GA 4IPLA 4TTGA 4J3WA 2UY2A 1WZKA 3SCWA 3GZAA 5BXSA 4WIWA 1GZJA 1QPKA 1HKKA 1LG1A 1QI3A 2O9OA 4JL2A 1HJQA 1R7OA 3BMWA 3WDJA 1V3IA 3L4ZA 1ZBKA 3PZQA 3VIHA 1UKSA 3AMDA 5CG0A 4HMDA 1KXQA 2EXOA 4NI3A 4LXFA 4ZXOA 2PWHA 3THDA 3RJYA 3W6LA 3WNKA 1ITCA 4DUWA 2J75A 3WFLA 1E56A 2DSZA 5A6KA 2EAEA 1HT6A 2VX6A 2O9TA 1B3XA 2D22A 3AHYA 1NOFA 4DM2A 2W63A 4JKMA 2ZX8A 2XM2A 1TUXA 3RMEA 5A8PA 1R8LA 4MB1A 5FOOA 3RM4A 4CU7A 2VRJA 1KWKA 2VRQA 2PWFA 3MI6A 1R33A 4QDMA 1C3FA 5BXPA 4H8VA 3I3DA 3VM7A 1ESWA 1JI2A 4AISA 1GW1A 4XUYA 1ZU8A 1XH2A 1W9XA 1CXEA 3GH5A 4JKKA 3H53A 9CGTA 3VO0A 3T08A 3MSDA 1HF6A 3SCSA 3CUHA 1PIFA 1GUVA 1GHRA 1L0PA 3QOKA 1WDQA 3QGVA 4XZBA 4LYRA 4LQ1A 1UWRA 4F8XA 2XYLA 3J7HA 1E40A 1XSIA 2D24A 1U33A 3BUPA 3NDZA 1WZLA 3UR8A 3ZJ6A 5EBAA 3LPFA 2VZSA 2W4XA 4V27A 3OLGA 3KL0A 2ALWA 4YPJA 2RGMA 1R7AA 2VJXA 1E5NA 2OWWA 2BY1A 2JIWA 3AMGA 1BF2A 4JAWA 3VMPA 2GDVA 2CCRA 3DX4A 4GZJA 3WQ6A 3W82A 1TE1A 1PS3A 3PTKA 4FLSA 2OSXA 4IUGA 3ZM8A 3NSMA 3WQ5A 5JIPA 2YFOA 5M3WA 3N11A 3PZUA 1CXHA 1G01A 2FYVA 3WY2A 3O6AA 1TMQA 6CGTA 5GNYA 1VFOA 4W89A 1ZBCA 3K8LA 4CCDA 1W9BM 1J0IA 3AIWA 3I3EA 4UQBA 3PZOA 3CUJA 2RGLA 2V5DA 1EO5A 3WMCA 4Z2JA 1T0OA 1V3JA 2WKGA 4AC1X 2ZWZA 1MVYA 2PWGA 2F8QA 3F5JA 4C7GA 2QMKA 2CPUA 3QHOA 2FGLA 4HZ7A 2ZWYA 1EH9A 4OOUA 3WNPA 2ZUWA 2D3NA 3BLKA 5CLWA 3BCDA 1JDCA 3VDHA 1E4NA 1LF1A 1ITXA 2J7DA 4MADA 2ZUNA 4B15A 2DIEA 3FNDA 4W84A 1B3VA 2W91A 5JBEA 2WM0A 2XGIA 1W1YA 1UKQA 5I2UA 1EA9C 3FN9A 1BAGA 3AXHA 3KZSA 3WNLA 4B9ZA 2OWCA 4LPCA 1V6VA 1E6XM 4JKLA 4WKFA 3OLDA 5E0CA 4CUCA 4YHEA 3N1AA 3DYMA 4X0VA 3SUVA 5A6LA 1E6RA 1TQVA 4AMWA 1UWQA 1HP5A 2DT2A 2NT0A 3BVTA 2A3CA 4QCFA 1KGUA 3VDBA 3CZ8A 4IPNB 4PMXA 3EMCA 3PZMA 3FAWA 2E40A 2X2YA 2XFRA 1E6NA 4KGLA 2CHOA 4E4PA 1ISXA 3PZVA 4M24A 2J7BA 2BV9A 2WKLA 1B9ZA 5BCAA 2BY2A 1JAKA 3BVXA 2BFGA 5AC5A 4OBSA 4AZIA 4U2YA 1UKTA 4UZUA 4UNIA 1QNSA 2BY3A 4MNMA 2OYKA 3CC1A 1PX3A 4M29A 4Z2HA 3AIEA 3MUIA 2ZXAA 2BNJA 1GQIA 1GJWA 1US2A 1X1NA 1GOOA 1DWAM 2XGBA 1KCKA 1KGWA 4GZIA 4H41A 3HG4A 3W26A 3L4YA 5D9OA 1JL8A 1RD6A 1QW9A 2CBIA 3LXBA 3WDIA 5D9NA 3TA9A 3SUTA 1QHZA 3DHPA 1MW2A 2XTKA 3TV8A 2D0GA 3AMLA 4UTFA 5HPOA 1WE5A 2X0HA 1O7DC 3A3HA 3VGFA 3ZSSA 4M8UA 3IJ9A 2GK1B 2XM1A 3W27A 3APGA 3IJ7A 3RM9A 1GOQA 2F18A 3H55A 1NWSA 3SUUA 2WC7A 3A4XA 4E2OA 5JIWA 1WKYA 4J3TA 5I77A 4LX4A 2JF6A 4TUFA 1GOKA 2CYGA 2J7EA 4D72A 4DUVA 4BZYA 1LJYA 1HKMA 4FF5A 2E4TA 1J0ZA 4PTMA 4MNJA 1OT1A 3DX2A 3SCOA 1L8NA 2J7CA 3PN8A 1W1VA 1E43A 3ZQ9A 1BTCA 2J77A 1GQKA 5I79A 4KRUA 4PMVA 3DHUA 4PEEA 1VBUA 1W9VA 3WD3A 2W61A 4U3CA 1W9UA 2XPKA 1MQPA 3AHXA 1EQPA 1PJ9A 1CGUA 3GBDA 1GQJA 3HN3A 2DDXA 4FMVA 2WC3A 3MV11 1JZ4A 1HVXA 1KXHA 1EGZA 2QLYA 3SCQA 1VAHA 4WSKA 1UD8A 5LYRA 1EOKA 3WNOA 2YL6A 3WUGA 2O9RA 3OA5A 3WUBA 1QBAA 1UKPA 3MMDA 4M1RA 4TVCA 1Q6DA 4PMUA 4BQ5A 2WZIA 4UFHA 3TP4A 1TZ7A 2BHZA 4AZGA 3CV5A 1VJSA 2PI6A 1DEDA 3OB8A 1H11A 4PTWA 2HVMA 5CJ5A 1UD5A 3CPUA 3AXXA 3MU7A 3KLLA 1E0XA 3ZO9A 1VF8A 1MW1A 5CSYA 3ZR5A 1D7FA 3K8MA 1W9PA 4AZCB 1LL6A 2XVLA 2YOCA 3EDKA 3W28A 4XV0A 1Q6GA 1V0KA 5ABFA 3L4XA 1R85A 3RCNA 1HN1A 2CITA 5D8ZA 3UERA 1SMAA 3W24A 1BFNA 3W6MA 1W1PA 3AJ7A 4ML4A 1K9DA 3EDDA 3EJPA 3LXCA 3NSNA 2VZOA 1PPIA 1GCYA 3IAQA 5ABEA 1NWUA 3AROA 1DHKA 1UWUA 3ARPA 2WMGA 2DGAA 4Q22A 2F1BA 1F4HA 3MUAA 2DT0A 5GQBA 4PCSA 4QAWA 3L4TA 2OWXA 3CMGA 1UWSA 4MJ2A 1QI5A 5HBFA 1TQWA 3GNRA 1RP9A 1C93A 3WDPP 4J3SA 4JFUA 5DMYA 1HXKA 1VRXA 3VGEA 2C8NA 1EO7A 5LA2A 4PSPA 1XRVA 1K9FA 5BXTA 3PTMA 5M5DA 3OBAA 3VTRA 1I1XA 5BYWA 4AZ7A 2D3LA 1HL9A 2FE0A 3GBEA 3BVUA 2VI0A 4D1IA 1LWJA 4DWSC 3D51A 2NW0A 2GSJA 2XIIA 1CXLA 1BPLB 1E15A 1KFWA 3WQ8A 1M7XA 2F61A 2WMKA 4P8VA 1MXDA 4NRSA 1TQTA 3PZGA 1KB3A 1V3LA 2UWFA 3CUGA 1JI1A 2EEXA 3PHAA 1O7AA 3EJUA 3QOMA 1PX4A 1OINA 1HVQA 3FHAA 1CXIA 5BWFA 4UFKA 1GNXA 2QPUA 2VUYA 2EPKX 1NP0A 2WMIA 1U30A 3VKKA 3T2QA 4CU6A 2D73A 4HP5A 4EE9A 1CGWA 3AZTA 1K6AA 4PTVA 2VCAA 1NQ6A 4WKHA 4FLQA 3RPMA 4DWSD 3UEQA 2WANA 2CNCA 5DFAA 1PX8A 4GXPA 4TVDA 3G6MA 3HG3A 4A3YA 2D0FA 2J47A 4HOZA 3N18A 3MV01 1OGBA 1VB9A 4NXSA 5FD0A 1PZ3A 2D2OA 1V0NA 3EDJA 2GK1A 4FLRA 2J8GA 3VIPA 4IM4A 1HTYA 2BS9A 4DO6A 1UZ1A 4MJ4A 3BAWA 1TG7A 3AS2A 3DX1A 1BVNP 1C8XA 1GQLA 2J8FA 3B8SA 1JAEA 2D0HA 4AZBA 4D6CA 1MYRA 1UD6A 3WFZA 1V6WA 3GXNA 2A3EA 1CBGA 3GYCA 3U57A 5C8BB 1UH2A 1YHTA 1XSJA 4GO8A 4FLOA 6A3HA 4AMXA 3MANA 4DWSA 1JZ3A 2FGZA 2XIBA 1J10A 5A69A 3NCOA 5E6YA 2J4GA 2VR5A 1XHGA 3WDHA 3SCPA 1TCMA 5HOSA 1QVBA 1MW0A 3K46A 1C7TA 1VIWA 1HJSA 1BGAA 1TVPA 3VPLA 3KE0A 2JE8A 1CGYA 1JF5A 3ZT7A 2Y5EA 1B3ZA 4U3AA 4QLJA 4OBRA 3VDCA 1JD9A 1E4LA 3CHDA 3WQWA 2F7OA 1K9EA 1J11A 1WDRA 2QF8A 5AYIA 1J18A 1HJUA 2VMFA 4AW7A 1ZJBA 4UOJA 2WWDA 1NWRA 4P8UA 2IUZA 1XV8A 3OIHA 1GORA 3HG5A 1BYBA 3N04A 1GOWA 2O92A 4CD4A 2WVSA 3FHQA 3M46A 5M03A 3ZOAA 4R27A 3F5KA 4UCFA 3CBWA 1OM0A 2JF7A 3UG5A 3N13A 4K68A 3GXFA 3N9KA 3A22A 1CENA 1CZ1A 1CXKA 2W66A 3ZIZA 2ZICA 3WENA 3OGRA 5HXMA 3VD9A 4UFLA 1HKIA 2CEQA 1QBBA 3LRMA 1H1NA 5A6BD 3DDGA 4BCEA 1E6ZA 1FHLA 3WD4A 4IISA 1VEPA 2C7FA 4HOXA 1BG4A 3L2MA 4P8XA 1JZ8A 2YL5A 1K9TA 1IZKA 4W86A 1G5AA 1M01A 2BY0A 3UG4A 5GNXA 1U2YA 3GXDA 2W67A 3HZ3A 3TTSA 2IXVA 3CUIA 1CECA 1GPFA 1WO2A 3T2PA 1B3YA 2G4FA 4PMRA 1Q6CA 1V02E 3W37A 4XZWA 3W4RA 4WJXA 1TQSA 1W2PA 2YL8A 3M7SA 3UETA 4AIOA 4W8LA 3THCA 3K8KA 4AD2A 4ATDA 1NOUA 2UY3A 5IXEA 1RPKA 3LX9A 1EDGA 3DECA 1PZ2A 1FA2A 1R86A 4TXEA 3U5UA 1GVIA 1C8YA 4QCEA 1UD4A 3AMKA 1LLOA 3MSGA 3SIMA 3WMBA 2PWDA 4PMYA 4ZENA 2GJRA 3T0BA 2D1ZA 2Y24A 2WLZA 3SCRA 3MO4A 1AQMA 3RILA 3WUEA 4UQCA 1F4AA 2X09A 2B31A 1V3KA 2VT0A 2YLLA 3RO8A 1HX0A 1E4IA 2W92A 2Y2WA 4ZFMA 4NSBA 4FK9A 1EHNA 5ECUA 3FW6A 2EPOA 2VCCA 3AFBA 3MUY1 3WKZA 2WMHA 1Y7VA 2O9PA 2V3GA 4AIUA 4AEEA 5I0DA 2CKRA 4OGZA 2OW7A 1E71M 3WDRA 4WLCA 1DTUA 4BQ2A 4KMQA 1KGXA 4AD0A 2YA2A 4FNTA 2G41A 3M07A 5A3HA 1A3HA 3OLIA 2WB5A 1V3HA 3HU7A 3ZMRA 2JEPA 3CZNA 5HNNA 4CN4A 3VGHA 1XC6A 4D6JA 2XVKA 3BAXA 3S6TA 5DT5A 3LPPA 1J12A 3BUDA 2ZXBA 5AC4A 4AWEA 1AVAA 5F7UA 4D71A 1QX1A 1V6UA 5GNZA 1VFFA 3LRLA 2YDQA 3IAPA 5E1QA 3PZIA 5AY7A 1H0IA 3KL3A 3VINA 3CO4A 3WSUA 1MQRA 4P7NA 4QFUA 5BXRA 2XSAA 2YA1A 3TONA 5E9AA 4LYQA 3GXMA 4Z2GA 1DWFM 1M04A 3D52A 2XVNA 1CWYA 5A94A 1B30A 2J74A 2X0YA 3CHEA 5A2AA 2QV4A 5CZKA 2ZX5A 3VX0A 2W5FA 5CPTA 3AZSA 5CQ1A 3L4VA 3HG2A 3LPGA 5EB8A 4AYGA 2GVYA 1E1EA 4DUXA 2WHKA 4PMZA 2CBVA 4JCLA 5DO8A 4GINA 4NZFA 1E70M 1JFXA 4J3VA 4MDOA 1CLVA 4MB5A 1HJVA 4Y7EA 4Z2LA 1FH7A 3VIGA 4TX6A 3A23A 1Q6FA 1ZJAA 3FY1A 5A6MA 4WK9A 5CSUA 4TX8A 3WH9A 4NF7A 3WL1A 3TOPA 2ZX6A 3AISA 1DWGM 4MNKA 1FH8A 3WY3A 4WF7A 3AOFA 1J0KA 2YDSA 4TVUA 1WZAA 1UR4A 1TFVA 4BQ4A 4PCTA 4UR9A 3AHZA 4F9DA 3GTNA 2VQUA 1CGTA 3AQUA 3VD3A 1WB0A 2QHAA 1UWIA 1Q6EA 3FAXA 3EJQA 2A3AA 1BGGA 4PMDA 4U33A 2ZXDA 3CHCA 3ZJKA 3T09A 2WAGA 3WF4A 4W5ZA 4D6FA 3VIMA 4W85A 4QP0A 3VSUA 2VX7A 3LPOA 1MXGA 2G8ZA 1UZ4A 3D5HA 3AMCA 4U31A 5HDRA 3VIFA 3WUFA 3NYDA 3L4UA 2YJQA 3BAIA 5I6SA 3S2CA 2VR4A 4AZ6A 3POHA 3MMWA 2FHCA 1W3LA 2NSXA 1E0VA 1PIGA 5I24A 1SFSA 4UOQA 3OZOA 2WMJA 5JBFA 1UR8A 2VZVA 3ARVA 2YKKA 3ARQA 4W7VA 4CCCA 4CD8A 1UWTA 2YIHA 3MKKA 4OJYA 4AZHA 2GDUA 4YHGA 4NXKA 3FXYA 1UHVA 1D3CA 4U5IA 2EACA 2WVVB 2YA0A 3BLPX 1N82A 3II1A 2ZUVA 2V38A 4WKAA 2PF0A 3BH4A 1I1WA 1E4MM 1DP0A 1FH9A 3MS8A 4CD7A 2VQTA 3SCUA 1OIFA 3CHFA 3GXTA 3VM5A 4GQQA 3EDEA 1US3A 1HP4A 3IANA 5EFDA 3VGBA 3PZTA 1YQ2A 3AYRA 3ARXA 2DSKA 3VIOA 1HL8A 4HA4A 5C71A 2WPGA 4JFTA 1BYDA 2XN1A 4FNQA 3KEHA 4HMEA 1E3XA 1UA7A 2VO5A 2YBUA 2BHUA 2EABA 3VSVA 3TTYA 1GONA 4RL3A 2W62A 4ACZA 3WQ4A 1CTNA 2XG9A 1V08A 1V02A 5EFFA 3DDFA 1KWGA 1BYAA 3GM8A 1OSEA 1P6WA 4W7UA 5A6BA 3RJXA 3CZSA 4PMNA 1DWJM 1FP9A 3K1DA 5TD4A 1J0HA 1E55A 3ARRA 3WD1A 2WYSA 3WF2A 2J7FA 1GOIA 2CKSA 1W1TA 1TQUA 1C90A 7A3HA 3RDKA 5A6JA 4QLKA 2VX5A 3KWXA 3AS3A 1UQZA 1BYCA 1V0LA 1E5JA 3VDAA 1PBGA 4HZ8A 1J01A 4HU0A 4ZXLA 4XB3A 5BRPA 1E6PA 1EDQA 4PYSA 3BAKA 5M17A 4AYSA 3EBVA 5KZ6A 2E0PA 4AD1A 3DC0A 2C0HA 1I75A 1CEOA 2CBJA 4NZJA 2DQXA 3SEPA 1XD0A 1JXKA 4ZEPA 2YDRA 3W81A 3W29A 2PWEA 2VX4A 1QHOA 2ZE0A 2CERA 1KCLA 4NX0A 3ARWA 7CGTA 1ODUA 1OT2A 2VL4A 1QI4A 2OLHA 3SUWA 3WDQA 2CIPA 3CLWA 4EAMA 1UH4A 3ZT5A 3D4ZA 3LRKA 2X2IA 1VFMA 1V6XA 1BQCA 4C7DA 4N0RA 3OGSA 4PRWA 5JBDA 5FKYA 5IHSA 2BXZA 5I23A 5E6ZA 1XCWA 5I5RA 4D6IA 2OSWA 2EPMX 2DSWA 1EXPA 3ECQA 1BLIA 3WELA 1UD2A 2J79A 2DT1A 1HNYA 1H09A 2WZEA 4AY1A 2XVPA 3GXIA 1CIUA 2DPEA 3WN6A 4HA3A 4N42A 4M81A 2IXUA 2WVTA 1FOBA 3ARTA 4ZE5A 2GJXA 4M82A 2EPLX 4A3HA 4Z2IA 5A6SA 4PSRA 2QPSA 5BRQA 3ARZA 4C7FA 1VJZA 4UQEA 3WBAA 4CN6A 1KBBA 4TTUA 1V3MA 2X1IA 1UA3A 1EOMA 1TA3B 4UFIA 1MWOA 1KQZA 2WC4A 3T0AA 4M80A 1VENA 3T2OA 4U2ZA 2J62A 1WCGA 2ZUMA 4J3UA 4NRRA 2FHBA 4M56A 1A47A 4R5EA 1JD7A 2UY4A 1UASA 2XWEA 2Y4SA 4MTVA 2FH6A 1UG6A 2XN2A 1JF6A 2V3DA 2PC8A 3RM8A 4B16A 4GO9A 1H2JA 5ABGA 2X8RA 3WL0A 2WBGA 4L4PA 5C70A 1JNEA 4UQAA 3ALGA
chains in the Genus database with same CATH superfamily
2ZFAA 3TTQA 5JHLA 4QDPA 2HVBA 3CFUA 2PGEA 4GAJL 5IUSA 3PPFA 1MWAL 4DJDC 4RPQA 3GW3A 3R4IA 3H22A 1T7VA 5KOVC 2BIHA 1FHNA 1BX2A 4PGDB 5IREA 4Y4KD 3CXHK 3O4LB 1IAOB 5EEXA 2XINA 6PAZA 3RLSA 3GB6A 5DU7A 1T1XB 3NJKA 4V2BA 2Z2UA 4G1NA 1S7VA 1RJQA 3IUHA 1BW8A 3EO9H 2GFTA 1CX9A 2V5CA 3EPNA 8FABB 3FOMB 5D7LE 5JR1L 1H6TA 43C9A 4RETB 5L2JB 3LN5B 4QHLB 1T66D 3LXAA 4UQ3A 3UAJD 3L9EA 2FL5B 2VXNA 3R25A 2QTEA 4AY8A 2EPHA 2QKIA 3OGCB 2HJFB 4FQXB 5I8KL 5IJBC 4HJTA 4M3PA 4CA4A 3HJEA 3UG3A 1F6PA 4XKYA 3OVPA 2EE3A 5C0NC 1YEEH 4GSRA 1TR1A 4PQXA 4F0KA 1L6WA 2G3FA 1A5MC 1BBDL 1KMGA 1RVKA 2VW6A 3HS0A 2OCCB 3NP4A 1GKRA 2CLIA 4OFPA 2REQA 3IVTA 1YRKA 4W70A 3VXPB 5GZOA 1W31A 2E3ZA 4LLVB 3CUFA 3QHMA 1KTBA 4N1CA 1CGVA 3NEXA 1CZ8L 2WCPA 3FCUB 1A7BA 3EOBB 4KZEL 3W9EA 4U6XA 1SZRA 3FTGA 3SGKA 3S36X 2DYPD 4NDMB 2O5NA 2QXWA 4GD0A 1RCOB 4IZGA 2XRAL 5A3ID 1QOXA 1WDDA 1XLBA 3IJLA 4X7DC 2MWCA 3W2JA 1MLCA 3TO4A 3IPWA 3MXWH 2FQDA 2HX7A 1RZKC 1IBHA 3PABB 3II3A 5AD0A 3SO3C 4BH8A 4IK7A 1A5LC 1EEXA 2AJ3A 5I1CL 1R24A 1RHFA 2ZCGA 3SB3A 1U8CA 4G8GA 1NU5A 1L6XA 4B5SA 3NIGB 4B9IA 4Z7UF 3UZVB 1WTGT 1UB6B 3N6YA 4PJIB 1NGZA 2VB5A 3Q2WA 5JUEL 1M57B 2HMCA 2QIWA 4X8JB 4AD4A 4X6EB 3ULVE 4XRCA 2QKIC 3K5RA 2Z0BA 2DQDH 1J1PH 4N9EA 1KDJA 4QRRB 1JGVL 4HS3A 4JO4L 5ALCH 2VEFA 3QKEA 4L4OA 4AVNA 1H50A 3UCCA 1I3VA 3GDCA 4AYFB 2Y5QA 3PP3K 1S9VA 3GC4A 3TEVA 1MZZA 2RGSA 1XF4B 3IGLA 3GUWA 4YHOL 4FCHA 5D2NC 3OMNB 3C2RA 4R97B 4ENLA 1P6FA 2WBJB 1KCVH 2IVFC 3OG6B 2PETA 4GIPD 4KXCA 4OLYL 3TO2A 1N7ML 2CETA 3BLIA 4JTDA 4KEUA 2Q20A 3HE7C 3Q0HA 4ACZB 2MTAA 5DLMH 1R46A 2KDYA 2NT1A 5A3IC 1S9YB 2YFNA 4IP7A 3K72A 3FT9A 4CVZA 3B2MA 5HPMA 3OQ8A 4K2SA 3GAYA 3V18A 3RNKB 1IGFL 5BQ7B 5CJOL 2Q86B 2NX5B 5KSBF 5MENA 3LS4L 3VXMB 1DL3A 2GCYA 2IDUA 3NJGA 4ONGH 1LORA 4PMJA 4KEVA 3QNFA 4OZIF 3DDMA 2XG5B 4KBXA 4C5ZA 1ZLWK 1F00I 2MPVA 3VNZA 1DQQB 1A7RL 4YFLF 4S38A 4MAVA 4NBZB 3DYPA 2CU9A 5JQ6L 4RQQB 1BQHG 1RZGB 2N01B 1S7QB 3GIZH 4W9EC 2R8WA 4O4YH 5MHSE 1YYCA 2R1WA 2O93L 4KNUA 2WZPD 4W5UA 1UWAA 4C6OA 4Y4HD 4ES9A 4ZUVA 3W72A 3R4DA 2F7RA 2WMFA 3GNDA 3M47A 4KPHH 4JB9H 1U0QA 3VJ6A 1FHDA 4V15A 1XXFC 3CUXA 4JIEA 4MF4A 1YE4A 2IEPA 3DSFL 2VDNB 3Q2NA 5ERWA 3TU6A 1OK4A 3CH9A 3MP3A 2FDMA 3EJSA 4PBGA 2Q10A 3LAFA 4JFSA 3UAJC 1LQ0A 5D9SB 2FWLB 4PJAF 4BE6A 3GG1A 3QTGA 3AY4C 3URQA 2NY5L 3F4VA 3F5WA 3WBDA 4FA3A 1COBA 3EJTA 2ISSA 4FSAA 5JW5A 2D3JA 3CJJA 4H8WL 4K07A 1MQ8A 3APCA 4LCQA 4ODUA 1T2XA 1L9SA 1NM9A 2MQGA 32C2A 3D6GA 5DT1H 5GIRA 1UOZA 4FOUA 5HDLA 1TTIA 4QYOA 4NY2A 4PTXA 5D7LD 2PP9A 5A8MA 3S5SA 1P7QA 4Z3HA 5LKYA 1LROA 1KIQB 3QA3A 1MEXL 1AQ0A 2V2XB 3CFIC 5C08B 3X11A 4HOMA 1G6VK 3MJ9L 5JOFB 3LHWA 3IU3A 5E2TL 2AERT 4NZ8A 3TNBA 1YEDA 4G8FB 4Y89A 4QOKE 1H1YA 2NY4C 2QSCH 2BSLA 1E9YB 4LEFA 1ZHKB 3QQXA 1A1NA 4NSKB 2BTMA 4B96A 5FLVA 5H91A 1SRDA 1X5FA 2F6KA 3UFIA 2D31B 4F15C 4KAQL 4XN7A 4DKAA 2DSVA 5I78A 4JQ2A 3AG2B 4I48A 4D9RE 2F8OA 3L7EB 1WA2X 5DO2C 2VWEC 3EUUA 5K1VA 1TA3A 4MQSB 4U10A 4NNYA 5GGUA 3X3FL 1QNRA 2X2HA 1M5WA 3S2JA 3TQ0A 5CS7A 2YAMA 1HHJB 1UWYA 1ICSA 1OD8A 5A6AA 2JQAA 2Z1PA 4FABH 1FFQA 2AEPH 2R23B 3KOFA 3U25A 5DEZA 1ZV2A 1N2VA 4JYFA 5BRBA 1USQA 4FJZA 5C9KA 1FUYA 2CM5A 1EEYB 3ARDC 3BP6B 1CFQB 2BVOA 4BZ1L 3KCPB 2A0NA 1OAXH 3GW0A 4R2GC 5FIPA 4RCAA 4G42B 3TZNA 5DRNA 3ULVL 2XY2A 4QO1A 1JNHB 2R2CA 4IFOA 1NGWB 1D6EA 1B4TA 2W79A 4PUMA 4CL7A 1TPXB 4N9OB 3VAEA 3CO8A 4FXFA 1M9HA 2X0SA 1DEEA 4XUGA 1H0DA 2HT2D 5E1IA 1ASQA 1OAUH 1U3HC 4FNPA 4N0YH 4E5XB 2GQ9A 4J2PA 4Y4FD 3BMVA 1KSRA 1G9MH 4KK5D 3Q1SH 3BGMB 4JDVB 1YXCA 4DBWA 2NZIA 3LN3A 4OZHF 3I75B 1WH0A 2WXQA 1OT4A 1W32A 4OU3A 5IMMA 3QAQA 1XIWA 1HOEA 3UEZA 1KQYA 5GS2H 1UATA 3QDJA 3MUIA 4LB8A 3Q67A 5LHFA 5D1QE 2WJ5A 4NZRL 4O16A 3L3OC 3L0NA 1MQKH 3QZBA 1DQJB 4GMEA 1CICB 1AKJD 1MFVA 4OCSH 4KX7A 3PNRB 4WDIB 5C5YA 4OD3L 3TO2B 5C9WA 1KV3A 4N2LA 4KTYA 2QQKH 4M1GH 5IB3A 2DVUA 4IMFA 2NQ5A 4NPKA 4MGGA 2K6ZA 3VX1A 1Q8MA 3QI9A 3U7VA 4ACTA 1RZ7H 4HD5A 2IFFH 4BQ9A 1G7QA 5BRZB 4HK5A 3L3HA 3WO3B 2PWUA 1DBBH 1LLWA 3U3HA 2O5YL 2GGIA 5ABHA 3D25A 3B4UA 5EOCJ 3NEVA 3OJDB 3NCWA 2R69H 1H63A 3V5HA 1UT1A 5AW2B 4H26A 3HHRB 3IJEA 4GQ0A 1QBML 1K4CB 3ARBC 5E2UL 3ZHLA 1BMGA 4HBCL 4DEUA 5K5YA 1UW9A 4P59L 2MANA 1HC1A 1JCTA 4WCYH 2VLRD 3GSXA 2Z4GA 5DD1L 1DDTA 3V4PL 2NW3B 1SPQA 3CSPA 5EBMA 3BOLA 1KENL 5D8JH 5FGBC 5I7GA 1K70A 4YDVA 3ES6B 3I9GL 3MJ8B 1M68A 3BO9A 2VDKL 1YEWA 3H26A 3FLUA 4XE0A 3OX8A 2JALA 3ARGB 2FLBT 4MS8D 1UXMA 4PS8A 2CXEA 2FX8L 4RDZA 1RBOB 2WY3B 1KTNA 5JHDB 4HIBA 4HLZH 1U58A 3NCBB 3MLSH 5IQ9A 2BJML 3QUKB 5CPMA 4PJFB 2OYLA 3AT8A 5AFAA 3L48A 2QGDA 1S5NA 3OPUA 2Y22A 5EC2A 3L66A 3MO7A 4JTHA 4QROA 2A9CA 3GMLA 2ZKHL 4M7TA 3TN4A 2AK4D 3OKNA 2AEOA 3MOBH 3LIZL 1NY1A 5EMKA 3BUIA 1CXFA 5EWIL 4HCRH 5T1MB 1R87A 3LG3A 1SM3L 2XSBA 1BYNA 1UUQA 2CFFA 4Q6JA 4PMEA 4H9ZA 2PU1A 2WJEA 1R4XA 4K5OA 2DQHL 2K45A 4K73A 5FYJD 1DXFA 1XIIA 3ZXWA 7ENLA 3A64A 4CNIA 2WTOA 1BD2D 2OTWB 3FFCD 2HT3D 2VVSA 1JCMP 3C6LD 4WWKD 3NCJL 5H2BA 3ZZQA 3OZPA 4LBAA 4NBXB 4LYPA 1TWSA 2PRMA 4Q7BA 1HWWA 2Q2EB 4H88H 2DLTA 4CW1A 1E1CB 3S5YA 4LBRA 3BKCH 3FTGB 4IIHA 4AM0A 1AG1O 4UFMA 4BJHA 3AC0A 3MV7D 4X8GA 3W7LA 4H9YA 1BLNB 2I7GA 4IBVA 3FJ6A 4XNQA 3P02A 4PGDA 4Z7UB 1SJEA 5FWQA 2Y23A 3I2CL 2J2ZB 3P11H 2VXUL 1J86A 5CD5C 3B2DC 1R9ZA 2JH2A 3GR8A 3NIYA 2PDGA 2EIBA 3N4AA 1G1CA 1EAPA 3IDNA 4UWMA 2R56L 3RVWD 1XIWD 1I3GH 1YC7A 3GD1C 3QUZA 3QM3A 1KTLB 3FYYA 1MI3A 1KRAC 4PWGA 3WLRA 2VXQL 3OGCA 2NY1D 2X9YA 1Z89A 4I9AA 4X0NA 3I85A 1F3RB 4XAKE 3GI8H 4M43L 4AL8L 4D3CH 3WFEL 2ZT9C 1HNFA 5CCKH 4EF8A 1ECZA 3QDAA 2IV8A 4BS0A 4OF0A 1OARL 4H25A 1H3UA 2ITDA 1I1FA 1TV2A 3FSTA 1UWEL 3MBXL 1KZQA 3PAYA 5I09A 5LGHL 5EA9A 1NSNH 4LLQA 1LQSR 3UT0A 1A8JH 4OZFH 3HB3B 1FCUA 4OD1H 4AT6A 4OCWL 4K71C 4LHUG 4MFDA 1I85C 2DWEB 4KKZA 5D4YA 3T4AA 1XYCA 5AVZB 1U8HB 3LKNA 4I0PC 3S98A 4GKLA 4O9HH 2WIIA 3DO4A 4W6YB 4QXUH 2KBGA 3L1GA 4X5WB 5KVEE 3L3DA 3T8VA 4RA0C 2GJZA 1UZDA 1ZV9A 3SURA 3L81A 2XKSA 5I74C 3RG1C 3RWGB 2V2DA 1HH6B 1OQFA 4IFRA 4ABUA 3HFYA 1UXWA 2UZXB 2X2JA 1SMDA 4B3EA 3T77A 1HI6B 4OT7A 1D9KD 4AIEA 3VXME 4EDWL 3LV6A 4HPYH 3DIVA 5A8QA 2GUYA 3EOAB 5ETUB 3UGEA 1UP0A 2ZYRA 2A6JA 4FI7A 4LE8A 4GBUA 4WW1A 5IJKA 3NYZA 4IL0A 4AQ1C 4HV8B 4F8OA 4PUKA 4S3BA 1F05A 3VRLF 4KKLD 1NKOA 3CL7A 3AFLA 4QRPA 1GEQA 1PSKL 2XJLA 4GYPA 1XQKA 3PF3A 5FF0A 1K8IA 1I8KA 1UUOA 2VOMA 5I18L 1DBAH 3FB7B 1OCNA 1I9RL 1UBSA 4KU1A 3DMMD 3FRUA 4P4RA 4W9TA 3STCA 3CUZA 3H7LA 4YS1A 4H4IA 4AEHL 4PJFF 5TNVA 4M61B 1CGSL 2H2SC 3BEWA 1O6IA 1IGTB 1PKQA 4A37A 2ERJC 3VC6A 4ZTPH 2I56A 3U30B 5CCKL 5J06A 2OKOA 4N9BA 3HI6H 4LK4A 4LSPL 5HHOD 1OVZA 5JUVA 2EECA 3G9VA 4MXVE 1X6UA 4S3DA 4OCXH 1LXMA 3GK8L 1KCRL 2ZIDA 1PZ0A 4QHNB 3JVGA 1XCXA 4DBDA 4P04A 1KA9F 1QLFB 2VUKA 2Z1VA 3E6HA 4UB0H 3PPCA 2VGBA 5H2ZA 1MCRA 1BECA 4LBEA 4LNVA 2PDQA 1QW8A 2ZUUA 2H6UA 3GSQA 1QLRB 4Q89A 3GNPA 1W1IE 1IL1A 1W1ZA 1XLDA 5MEOB 2DIKA 3N3MA 1Z6JT 5DMNA 1CGXA 5C0AE 2HZHA 4ZMLA 4A4AA 2YXFA 1JS4A 2IQAB 1L0XA 3PUUA 4HIJB 1OFEA 4AYID 2W0PA 3SYCA 2E9LA 2WWCA 4GUHA 1XBDA 3CVHB 1RJRA 3I50H 4XXWA 4ZZFA 5ITFB 4IRSA 4NN6B 2CLVB 3UTSD 3ZK0A 1H3GA 4L9LC 4BHUI 3GGWA 3ZTNL 3BDYH 1EEZB 3CFTA 4HWZB 1X7IA 3IACA 1L3NA 5AHIA 4AEOA 4WUUA 3HGOA 4F0MA 3VFPB 1WISA 4WO4A 2W9MA 3QXDB 4ZQRA 5KVDL 3WSQH 2AABH 1B0RA 3FN3A 4NQSA 1MVFA 1XS2A 1PF3A 4N4PA 3UJRA 5FPIA 5LO7A 3CMJA 2YL9A 5AVSB 4GQ9L 2X4NB 4HZ6A 2NQLA 1E27A 3MRNA 3JUYA 1R3HB 3AIRA 3WAKA 4JQIH 1ADQH 2UVFA 2EJ1A 2NY0B 1X38A 3R13A 1IXPA 1FFRA 2G60H 5D37A 3LY0A 5J56B 1NAMA 3LY6A 4GBXA 1AQDB 1VKXB 4IRJA 5IR1A 1A2YB 1VFAA 4GG8B 4RRPM 3GSNA 1JFQL 3MRRA 1KJ2H 4HUNB 1R3KA 1FCGA 1M05B 3L9BA 4OCSL 5I1LA 4GLRI 1F3EA 3A9IA 3MMTA 3N15A 4IQLA 1FSKB 2OL3A 3ESNA 4W9HC 4JTCA 4JFED 3HN5A 3L2LA 4GE8A 4HIIA 3BXWA 2NZ9C 4RLIA 3M64A 1ECQA 1GJUA 1U95A 1SJHA 1VBRA 3VUPA 2RA1A 3WQEA 2ETWA 1R3IH 1T99A 4Q9BA 1F2XK 1QNPA 2V7NA 1R24B 1RHHA 3GRWL 3L9YA 4CKVX 4P23D 1AW5A 2HLEB 5BMXA 4MVAA 3O4OC 4LLQB 5BW7C 4RR4A 4X6DF 2QCLA 4LCUA 4JKPH 5DC2A 1WS8A 4RSYA 3ZE2E 4AV0A 3C2YA 4HKJA 4IQJA 4WFHD 3OB0H 5E2UH 3TA3A 1JV5A 4XMXA 4NHUB 1YUKB 3A0OA 4LIQE 1DXIA 3NFPA 2NY3C 1AGDA 5CEXA 3IB4A 5KSUA 4QNEA 4C6JA 3T3MB 3QUXB 4XT1C 3UQNA 3Q6FA 5ACMA 4OVUA 4AOFA 3BVWA 1CF8H 1KEMH 3DOIA 3JU2A 1JHTB 4GG6B 3GIYA 2W0LA 1O6TA 1ONQA 3DPBA 3NUKA 4XCCL 3MKCA 4HK0A 3U2CA 3BUQA 1OF2A 3RWEB 1LRNA 4PTDA 4CD6A 2R1PA 1W17A 3W83A 2VH5L 2PCYA 2UXGA 5E0FA 2FB3A 4BR1A 2J5LC 2ZAGA 4Q6IB 3VSTA 4ZAKC 4DRSA 1YNTB 3DJ9A 1N0XH 4Z7UA 5L7XH 4D6GA 1XPGA 5F6IB 2FGWH 1FG2A 2I25N 3KEDA 4IMKA 2Y0FA 4A67A 3W2LA 1CLYH 2XU9A 4R97C 2D3VA 5FFGA 4ODUB 3S3BB 2QW5A 3AXKA 1DTNA 3AICA 1WAAA 3KS6A 4PMQA 2VDML 4HSCX 1GVRA 3KPOA 3MCLL 4BDVB 1UZGA 4NHVA 2C6QA 4NZ3A 1QKZH 2AAAA 2V5YA 3EW3B 4ZUTB 5I1DB 2O26U 5CZJA 3RDTA 2ID5A 3HUJB 2I9TB 1IM9A 4QRRE 4NYUA 3DC8A 3TPUA 4A7GF 3O63A 1OGTB 2FATH 3F01A 1YMHA 4I9WE 4MAUH 4MD4B 1ZJIA 1UJTA 3MBED 1H49A 1SVDA 4IGSA 5EU6D 1HINL 5IGXL 5D70H 5KJRH 5DZNA 2Y70A 2L4OA 1P7KA 5T3XE 3EOSA 3BGAA 3JUGA 4JTFA 4GMTL 4L6OA 1BD0A 5C7VA 4GYKA 5AZEH 1TR7A 2OMBA 3D50A 4B90A 2CJUH 2PR4L 2FTYA 3AIVA 3TM6A 1QR1B 1OGSA 4OAWB 2R69A 3A13A 4KOCA 5KSVA 4QXVA 4AUJA 3ISIX 1U3YA 3CC5B 3QWQB 3X3GL 3W7JA 3MLTB 1E4KA 5EO9A 4QAIA 1S8DA 1GS7A 3JSSA 2ZOXA 4NC0B 1ZTXL 1EERB 2JKSA 3DROA 3DXAA 1BF6A 2DEPA 2ROXA 3NACH 3HNVH 3ZJ7A 2BX5A 4P57A 2X4OA 5I26A 1UH3A 1OV8A 1PZBA 4KO6A 1EX0A 1O7SA 3FFCE 2HPOA 4EBQL 1ITQA 4QEGA 2X05A 3Q8BA 2XNAB 3IJYA 5HYFA 1JZ5A 1EJWC 3T81A 5IFTA 2QVFB 1OBAA 4LDEB 4FF9A 2V3FA 1KR0A 1SYVB 2O9TA 3QIUC 5C9JB 4WWKC 2IALA 3MRGB 1UCWA 2QDVA 3H2MA 4CQBA 1VZWA 1JZJA 4MVBD 2AQTA 1RKRA 4QHMA 1OARH 2VSMB 3FFCB 1QPRA 1Z41A 3A24A 5DMGD 3BV7A 3I65A 1OQXA 3S6OA 2VR2A 5EMYA 1Q72H 2WINB 3MAWA 3D25B 5JW3L 3VD1A 1Z9AA 3EEGA 4JOMA 5BMFL 1JXDA 2AI0L 4DGYH 5MI0C 4NNPL 5HI4D 3CIQA 5DQ9A 3R7RA 3TO4D 1PUDA 3EEZA 3G6LA 3MRRB 2LLEA 1DN2A 5LXGL 1TITA 2MEJB 1KYOK 4OU1A 2YEZA 4MSSA 4JFHE 1DUZA 3I6SA 4URTB 1T7WA 2KZHA 4NUGH 1OD7A 4WO4D 1NCWL 1KNWA 1B9KA 1B6DA 3SDDA 2KERA 4HIIB 3C5SA 1MVUB 1BQRA 1F42A 4GQRA 4ORZC 4OKDA 2G5BB 3ULVD 1CK0H 3WJSA 3DG7A 3T0WA 1RBLA 1VCVA 4D0DA 4M6VA 4DM1A 1E2VA 3UCQA 3T2NL 3VILA 1DDHB 1RR2A 2FH8A 4MS8C 3MFGB 4F7PA 1HXJA 1UP3A 2GOKA 4TUKL 4JFDB 1UKOA 2B08A 4PVBA 5LGJA 1HG3A 3KFTA 2JKTM 4S3JA 4S3EA 2H1XA 2WXGA 3CVDA 4XODA 2Y62A 3MNZA 2QMJA 3KP1A 5BO1L 4N3TA 2A9MH 4HFUH 3CU1A 5JO5B 3WTUA 2Y1VA 1MFEL 4LU5H 4DAGL 5XIMA 1RLCL 4OQ1A 4P7OA 1E3ZA 2YAEA 1GHSA 2IGLA 2PKDA 4G11A 4MDJB 4WKXA 5JXAL 4R84A 2EH7L 3OXSA 4JFEA 3TCLB 2F5BL 1JWUB 2XT1B 1JVKA 5C0RL 2FECI 3C6LA 5C92A 1EPVA 4WO4B 2GVJA 4OGAD 3GI9L 1F3JB 1TX0A 1G4RA 3L17A 3SCNA 3R79A 3CQIA 4HK6A 3QO1B 2ZXQA 1NCIA 4P5RA 1ZVSB 5J1AA 3IRDA 1ICQA 1YW1A 4BD4A 4Y9GA 5JORB 3B8IA 4IH3A 4KS0A 3WMSA 2C16A 5BRZD 1SEBA 5E1HB 1ZHNA 2KPNA 4UAOB 2Z7GA 1F4YL 5G4HC 1IVTA 5HDBE 4M9PA 1T7ZA 2J7GA 4HB7A 1Q9LA 2ZNWA 2DQEH 2OSLA 3P4OB 1F8IA 2EDNA 2QDHA 1JRHH 2XLLA 4XVSL 4NAEA 1SXAA 2HJLA 1GZJA 3UTSA 1OP9A 1H9DA 1HKKA 4E0RA 1VCAA 1OFAA 1TJRA 4GRWB 2O9OA 2ADFH 1HJQA 3LS9A 4N8CL 2DW5A 4ELMB 4ZUSB 3FTWA 2K7PA 3L4ZA 3KBVA 4AVJA 1UKSA 4M6QA 2AFNA 1XCTB 1NA8A 1WFOA 2OMXB 3DXAD 4NQEB 5EIVA 3WKMH 3MV7A 2HT2C 2UBPC 3G0UA 3VUAA 4XVDA 2A9NH 3DX6A 3NOIA 5F21B 2PA6A 1XGEA 3K13A 3T78A 1SJDA 2IDTA 1IAIH 1V7NH 2B0SL 4FOKA 4JIQA 1HHIA 2C3HA 5BZWB 4EI6A 2Z27A 3FL7A 4N28A 4PRBA 3MGAA 3LBMA 3KHQA 4KK6D 2YPVL 3WTWA 3WNKA 1NDVA 2HK0A 5FAJA 4DUWA 2J75A 3OAYK 1E56A 2B1AL 3GLZA 4OF5A 4OUUB 5B4MC 2DSZA 2JCCF 3ROOB 5FKPA 3DHMA 4MJ6A 1VSCA 2EAEA 1HT6A 4MCMA 3U2IA 2YD0A 2BASA 4FQ1H 2H0JA 2DPKA 2VX6A 3N9RA 4XO6A 4DM2A 3CXHJ 1YYLH 3L54A 1YADA 2CDGA 1M71A 1ZTMA 4MZ8A 3TSBA 4R85A 4ADTA 4DOHE 3RNQB 4ZFOA 4UT6L 5A8PA 2IOOA 3HG1B 1DLHA 1NF0A 3G1YA 4GUFA 4Z3EA 1AZNA 5CM1A 5DVOA 2X3CA 3TBTB 1W37A 3L1EA 4H44C 1LUCB 3CH8A 3C0QA 4O11A 3NQDA 3AUOA 2EINB 1RXLA 1Z3RA 1AGCB 5DZLA 3IJQA 3MI6A 4DVBA 1R33A 4L3AA 4W9LC 1TJGL 4QDMA 1EXHA 4LAJH 5BXPA 2Q01A 4H8VA 1OM3H 5HJXA 1CLOL 2YR3A 1RLDA 4IEFA 3HE6C 3IS0X 3PJNA 1UUSA 1VGEL 1JI2A 2MFNA 3TOYA 3CX5J 1W72A 1GW1A 1ZU8A 4XUYA 4AISA 1CXEA 4ABQA 3W7PA 4F0LA 4HTBA 4QRRD 1TQBC 5I30H 4BELD 5I8CA 4O54A 4X9SA 1HF6A 4WU5B 2ICSA 1X5IA 3G5YB 4PREA 4E9XA 1PIFA 4G6AC 2FK9A 5F7FA 1WBYA 5F9JA 4NAQA 3RGVD 2INFA 3SJ3A 1T7XA 2WYTA 3MJWA 4KNQA 1DFXA 2AQWA 5BVJA 5C07A 5LCVA 3SE8L 1OYBA 2CG9X 4GP4B 4JTLA 2POTA 3QJXA 2IBBA 2KLRA 3O0LA 4UT6A 1QOQA 4XPBH 4EUPG 3KVMA 1T04B 2YD3A 1WC7A 3GK8H 5ID1B 5FYLE 4MA1B 3GS6A 1FFTB 1U33A 5DXXA 3MRBA 1SSGA 3OR6A 3DETD 4PTTB 5FM5O 2AJXL 3F4NA 3VRJA 5CEYB 1JQVA 3WFDL 4O0KA 1ADQL 3CG8A 3UR8A 4YDJB 1JUKA 2JSFA 3CDCA 3BW3A 5EBAA 1HH9B 3T8QA 3ZJ6A 1AO7E 3QZWB 2WLLA 4U6VL 4UV4H 4HUVB 3EKLA 1U3JA 1KFAH 2E76C 4V27A 3AGVA 4HJSA 5FDWB 1A1MB 4GNVA 2H9GA 2H3DA 3CPLB 1A5OC 4L65A 2UYLA 1VESA 3A3XA 3FDGA 4JBSA 2VJXA 3H4FA 2VDQL 1W8NA 1MAJA 2H45A 4MWAA 1ME8A 4IRZH 3P5ZA 3DJSA 3MBWA 1FO0B 1CLKA 3G8RA 4R88A 3AMGA 1KC7A 3PL6C 3M1CA 4OF7A 3NM3A 2G5RA 4ZMYA 4B5UA 3R4RA 1NLBL 3K80A 4R0LC 3VFTA 5J1SC 1TV7A 3KTXA 5ICYB 3NSMA 3PTKA 5EU9A 1IBFA 3B9KD 1R3WA 4UDUB 3W11D 3QO1A 3TIEB 1BQ5A 1QVOB 2YFOA 5DT1L 4NZTL 5M3WA 3N11A 4N85A 1ZHAA 2NLJA 1ORSB 4UU9A 3S42A 3ULUC 1BIHA 2K6YA 5DMLA 4WHBA 2P1YA 4F58L 1YRRA 3MLRH 1TMQA 6CGTA 1T2QL 3HB3C 3EB2A 5GGSA 4UUJA 2I32A 4LCVA 2JKEA 2WPBA 3NRFA 4W89A 4ZX5A 2BNUB 3IETB 2F54A 2H32B 4TNGA 2WKJA 3O3EB 3QWRD 5GS1C 4K7PH 1QPOA 1W9BM 3W0WB 4CCDA 4PE8A 4NAEB 4M48L 1PTZA 5D7JC 3PGCB 1KIRB 3N2JA 2HQAA 3KGTA 3S36H 3UTTB 4YS4A 3SY0B 5DMMA 5GGRA 4O00A 4ONGL 1TJHL 1SO5A 1U8LB 2UWEF 2Z4TA 3DI3B 4H5SA 3BP7A 2P43B 2K70A 3F64A 5C7ZA 1V3JA 2P1FA 1B6UA 4IIQC 2WKGA 4XZNX 3KHJA 3TJLA 1MVYA 4P06A 4HWZA 4PUUA 4MJHA 2X1PA 4EXBA 3IKCA 4TLUA 1D7CA 3VOHA 1P6BA 4FR6A 5G2WA 3SDXE 4R7VA 5IG7B 2QBWA 3LEXA 1A6ZB 1FI8C 4ZUUB 2Y07L 2GSGB 3NA8A 5F1VA 3Q8EA 2DV0A 1OC6A 4JQAA 2ZWYA 4LSQL 3MNVA 4OOUA 4BM7A 5ES4B 5TGBB 5TH2B 5F7HA 1P7TB 2ARJB 4QXTB 2ZUWA 3S36L 3KYKL 1DBMH 1NUNB 2R7EA 4ZXBC 5A7BA 2HE5A 4IBSA 2BP8B 3ERXA 2D3NA 4LBUA 2DJMA 2ITCA 2XN9E 1NTDA 3GK0A 3PGDA 5KOMC 4MPQA 1UZ8A 2E74C 1N64L 4KDTC 5JW4M 1E4NA 3VD0A 2PZNA 4FCAA 3LVEA 5K69A 3UAAA 4P5UA 2E59A 4ZUTA 4KV5E 3P8JA 4HK3J 2DI7A 2FJFA 4J8RB 2XKNA 4LAQH 4WEBL 1HINH 3W71A 4V1DB 2WM0A 2H9AB 2TPSA 1CDHA 3MOAL 3RU8H 3EOBA 1SN5A 3D0AA 3MSPA 1W1YA 3P9LB 4CQ8A 4ONHB 4DP2X 2E47A 5I2UA 1L9OA 4N9CA 2DQUL 5F6HI 1SHWA 3FN9A 3I10A 1BAGA 3AXHA 2GYSA 3MRFA 1URZA 3KYNB 5DI8B 3WNLA 3HS0B 1D5ZA 2X4OB 3MPCA 1XF0A 1TO3A 4JTJA 3EJJX 3BZDA 4B9ZA 3QG7L 5C0GB 5L2KA 1NUFA 3KDMA 4YHYB 5KSBE 3E5BA 4Q7DA 4R7XA 1E6XM 4L1WA 1P4IL 1NC4D 4TSBL 3QFJD 2QJDA 3GDLA 5DUJA 2Z7KA 4IIFA 4CUCA 3FUFA 1GOHA 4IP5A 1IBYA 2NYZA 3N1AA 4KIRA 1RFDL 3W86A 3FUKA 1DANU 1MFAH 4BZ2H 3AWNA 4JRLA 2ZSVB 3CT7A 2YAHA 4QHLA 1HKLL 2ZUYA 5D2LB 3W1RA 1PGRB 1KGUA 1TMCB 3CLEL 1IEVA 3IDJB 2ATPA 2H3KA 2X1XR 2J9XA 3R6IA 1GZQA 4G7SB 5AOJA 3TNNA 3TJPA 1F11B 2JQZA 1JVNA 2ESVA 1GC1C 3S35L 2XISA 5D2NB 3V4VA 3UCRA 1OGTA 1A4JB 1OAYL 2WUBL 2X2YA 5SV3A 3WIHA 2XFRA 1J93A 2GC4C 3ZZSA 1WWCA 1E6NA 4F7MA 4KGLA 1YCSA 5I76A 5F1OB 3HLKA 2XDFA 2ISFA 1J8RA 1K6QL 2VDRL 4GW4B 4A7TA 1B9ZA 4GLRH 2J7BA 3U5YA 4EVZA 2BY2A 4OZFG 5TBOA 4DP9X 3DFQA 1AANA 3TBWB 2BFGA 3L1OH 5AC5A 4A2GA 1KBGH 5CP3A 2G75A 3V6FB 1Z1WA 4UIMA 4XO3A 5E4EC 2WOQA 2Q3AA 4UM8A 5D93C 2Y25A 5KBMA 4OY9A 1G67A 2PDPA 1UKTA 3QVQA 4UNIA 1AOHA 3RUGF 2Y1HA 1RJLB 1R5VB 2PO6C 1DJZA 3WL9B 4LCSA 4MNMA 1BZ9A 3ARFD 2OYKA 4PJAA 5CD3A 4EXAA 1RJZB 4RZ5A 1LO2H 1ZPUA 2WLNA 1LDPL 4PR5A 2YCLB 3RVUC 2MNRA 2HLFD 5B4MD 3HFTA 2X4TB 1GQIA 1GJWA 3G8EA 1BEUA 1R3JA 1X1NA 3PJLA 4FKEA 3BJ91 3S3CB 3ZE2B 2ODOA 3HIJA 4KK6C 5CUSL 2L8AA 2X87A 1ZENA 5JQHC 1Q8AA 3A9BA 4GPVA 1LP9B 2PP8A 2NWRA 1AFVH 3DIFB 5L9DH 4E0RB 3KPSE 1TJ2A 1ZE3C 2J43A 4FFVD 4GZIA 4H41A 3HG4A 5T3ZL 3W26A 1QAWA 1XDTT 4ZUSA 2R0KH 1I1AD 3QUMB 1QASA 2YJLA 1FWFC 1Q5MA 4KWOA 5LXGH 3LBOA 3VWKD 4ZODA 1RD6A 3OJ2C 3WUWB 5F4WA 2HWZH 4JPVH 4I9MA 2HJPA 5EDSA 5HVFB 3ZTEA 3RITA 4AIBA 4AUUA 2BWGA 3SUTA 1QHZA 3DHPA 4AGOA 2ZOTA 3MCOA 3WIHH 3CQKA 3TV8A 5E2JA 3AMLA 4BFNA 4A8LA 2AVFA 4BFRA 4UANA 3RDTD 1MI5E 3S3SA 5JUEH 1NFDE 3V8CA 3BZ5A 3OKKB 1O7DC 1T22A 3QRHA 1D6VL 5IEKA 4UTBA 2BVUA 3VJ6B 1IFHL 2Y6SC 4XTRD 2X70B 3C0JA 2CLZA 4DYJA 3I6KA 1QRND 1I4FB 4M8UA 3ZSSA 5E94B 3ZE1B 5AB3A 2GK1B 1GS8A 4K0OA 4F57L 2Q3OA 2CAKA 3APGA 1SXSA 3IJ7A 3N1QC 4NQCE 4G8GB 2ICWB 4P5MA 3VFGL 4MJIE 4YL2A 3RM9A 4MTMA 2D2CC 4PGZA 1NFDB 1OG0A 3FHEA 43CAB 2NQDA 3H55A 4LL9A 4US5D 4LVOB 4AFYA 1JXGA 1KFJA 2EEDA 3N42B 4EKXA 4E9TA 3QKZA 2WC7A 3W1QA 2IPKB 5DJ2A 3BFOA 3SKOB 4E2OA 1C5CL 1M41A 2ACSA 2R14A 4QCIA 2XWBB 2JTYA 3OSKA 5D72H 3FKKA 1WKYA 4J3TA 4PJDF 3OKLB 1JOIA 3Q5TA 3DV6A 5T1KB 2WGNB 3GTXA 1WJ3A 3FU0A 3SN0A 2CYGA 4P9HL 2J4WH 3LI0A 2IFGA 5B8CB 1NDYA 4BSJA 2NNFA 4DUVA 3LQGA 3MUJA 1LJYA 5EF3A 5DY2A 5FM4A 5I3FA 3TEZA 1LEKA 1OT1A 4AGNA 4JPSA 2ZA3A 4JM0A 1IQDA 3EGSB 4IIQA 2BIMA 5F7YC 1MVUA 4S1QH 2EH8H 5C0FA 1O4UA 5CZVL 3KS5A 3KWSA 4DQOH 1TTGA 3ZKND 5G4OA 4D0DB 35C8H 3UPMA 3TW9A 2VL5A 1KCSL 1I8MA 1AYOA 1YTKA 4MNQA 1ZXQA 3HPFA 3ZQ9A 1UC5A 2ALRA 1ERNA 2GUUA 4BFAA 3IU4H 4JM2D 5I66B 2MIZA 1BOGB 4PMVA 3VU1A 1QFHA 3MRQA 2YUWA 3ULVC 3GBNL 4QHKI 3BG9A 1HE8A 2XG5A 5CSGA 4HBKA 3ATEA 1JP5A 4WGXA 2HTLD 2H90A 5FF2A 1EQPA 3HC3L 3HMXA 4PJAB 3RA7L 4E2DA 3TIMA 1G1OA 3HN3A 5FA4A 2DM2A 3NQFA 4MWAE 4QT5A 1C9WA 4POCA 3JWNC 3P4NA 1IMHC 4ASTA 1HVXA 1EGZA 1LT8A 1HHHB 3O07A 3T42A 1RJYB 4CNUA 5I06A 3PWLA 5I1JH 1IU1A 4LIQH 1UD8A 4KX9A 4ODSH 4LARL 5IT2L 1EOKA 3O3EA 1EJXC 3OA5A 3GS7A 2ACRA 2QJNA 4RFOH 3MMDA 1E51A 4AQ8C 1EUTA 3S37H 1UB3A 3D2UA 4TVCA 3PJSB 4GSQA 1Q6DA 3N73A 4DN4L 1TR9A 2HTLC 2G97A 4N4YB 1YQVH 2NZ1A 2O1AA 3TP4A 3GB7B 4E9QA 1CW2A 2HVJB 4AZGA 2IAAC 2CK2A 2EG7A 2CCRA 3OWEA 2GQHA 3QXUA 2PDBA 2R9HD 1WA1X 2PI6A 3VXRE 4HBCH 3OB8A 1POJA 4WGVB 3CEPA 15C8L 1PNDA 3FT4B 4HD9A 2DORA 1UD5A 4MMXA 3AXXA 3CIXA 4AMAA 1E0XA 4Q8TA 4RNRB 3EAKA 1FGVH 3QJTB 5A2FA 4OBTA 2PS2A 4YHZL 5HR6A 3ZR5A 3U82B 4PJCB 3BFQG 1AR1B 1H6FA 5SWQA 2CNZA 2H8PB 1W9PA 1Q13A 2VLJD 3LNMA 4AZCB 5B21A 2HTKD 2PRHA 1BWWA 3G6JF 3QFJE 4MWAB 3ZDZF 3EDKA 3S88H 2FJHA 4HKZB 1TO4A 2J5WA 3IFNH 3G1FA 3RJDA 5ABFA 4QMEA 1QXLA 1SZGA 3C2AH 5IB1A 1P0SE 1KC5L 4RVBA 4NT0A 1HN1A 2CITA 1EZWA 4PC8A 4F33B 1W1B1 3MCMA 2NNCA 4RX0A 3LTVA 4AVHA 1YSOA 2EGZA 4N24A 1BFNA 1SN0A 2JF1A 4MNQD 3LHYA 3O6MH 3QDMD 1R30A 1R3VA 3TR2A 1RURL 4WGKA 5IT2H 3T65A 3EH5B 3LPWA 3S1UA 3NPZB 1TEYA 4NPYB 1ZCCA 3EDDA 5IW3A 1H8NA 3LXCA 1OAUL 4N0YL 4JYEA 1GVFA 3MNDA 4QKTA 3FSWA 4EN3B 4G1KA 4NRXA 3QJZA 2OMUA 3IAQA 5MEND 3IUDA 1NWUA 1KT2A 3O6FD 4O13A 4R96A 5SX5H 3JZUA 4HMNA 3DO7B 2CGZA 4AHOA 1L9WA 2PP1A 4WU7B 3QPEA 1QBLH 1ZA3A 2HT4C 4Y5YB 1MCFA 1PQZA 2CCLA 2P26A 3BWUF 2E7CA 3MV8E 3CYVA 1F4HA 5DHVH 1A5BA 3QZEA 2FJFB 3MNWA 4J8RA 2YBRB 5GQBA 2PTUA 4C6EA 3DESA 1X5YA 3LKRB 2G0WA 4KROC 2YMTA 1TTCA 4LSTH 4UMBA 3APDA 4QD2E 1H51A 5AEAA 4I2XA 3O2DL 1I1AB 2Y1AA 4Y5XC 2K9UA 3U2ZA 4C6KA 1UWSA 1IKOP 1SDDA 1BXBA 2ZYFA 1TQWA 5FUZH 5HK4A 5EBMB 5AVVB 1P7BA 1JGEB 1SLUA 3EXSA 4CQ9A 2GI7A 2UVEA 1RXOB 2A4AA 1DVTA 3FMGH 3VXRD 3ZRSA 1OY0A 5LNUA 1BBJA 1LCOA 2Q9OA 4ZT1A 1L6PA 1LO3H 1NMCC 4K23H 2LOEA 3S35H 1VRXA 2CKBH 2F53D 4I87A 3V6OE 4XPHH 2C9SA 4ZAKB 3GDMA 3L2IA 3CCHA 4EVNA 3QF0A 5M5DA 2AGJH 4AGLA 3QULB 1P4CA 4ORGA 4PFEA 3UAJA 5AKSA 3G2GA 3HO8A 3M44A 1HL9A 4K8RD 4G56A 3GBEA 1AL7A 5BU6A 1GG0A 3QWOB 3BLOA 3VXTA 3K2KA 3M86A 4D1IA 1TQCC 3QEGL 1XL6A 3MCNA 4G71B 4Y19D 1GGBL 2GSJA 4FULA 4Y2DB 3FTUA 3BSZL 4F15B 4LAQL 4WEBH 1S7TB 5FW6A 3M0YA 2HS6A 1NCJA 4PJ5B 1T96A 4QGYA 1FNHA 2NNAB 2ZRWA 3DHFA 1MN4A 4MKMA 3W2DL 1TQTA 1MEXH 2FEDC 4X9IA 7REQA 1SJXA 1KB3A 1XIJA 1A6UH 4KJPC 3NGJA 5I6KA 1HQRB 1K6WA 2A2IA 1UOWA 3STGA 1A02N 4ODHL 1DR9A 1OC5A 1QVOA 2X38A 3CVIH 3HNTH 3I75A 3QYCA 4UT7L 3OZLA 1J8VA 1F8TH 1FWJC 4DP4X 1H6UA 4AX3A 4QDWA 4FFYL 1OINA 2ZZ3A 1HVQA 4H8NA 1T80A 4HT3A 4HX1B 1F4YH 2Z4QA 4DKFH 2YD1A 4MXWH 3WFHA 2TSAA 4G59C 3MA9L 4R8WL 2Q8BH 3RX7A 4Y1AA 1N64H 4NKMA 3BLDA 1EYWA 4JM4H 3HZMA 1IKNC 2VIRB 2VUYA 5GRUL 1CFNB 1CURA 3K71A 4K7FA 3VCLB 2R94A 4CU6A 1T0NB 2D73A 1IM3D 1G7JB 4MDIB 5ANHA 3AZTA 4FTVA 3RR4A 3DGGA 3TYFB 1OB1A 3U0PA 1VF5C 4EXKA 1L2UA 1PD1A 3RVVD 4KQ4L 4KY1H 2R29H 5C0RH 5G1MA 3T4CA 3W1UA 1LBMA 3SDDC 4HC1H 4LPTA 2CNCA 1PX8A 2G2RA 5DFAA 2AJZB 2NY5C 3EKCA 2CHZA 3ITGA 4Q4RA 1K8YA 3DV6B 1N5AB 1ACYH 4EAEA 3ULVH 3O41A 1FQ0A 4PL2A 1YDPA 1NFPA 4XVOA 4Z3TA 8XIMA 1ADOA 2JLLA 2OXNA 4JTSA 3QDME 1SW3A 2WKOA 4YVUA 4HOZA 3BLLA 3U0TA 1PIIA 4KFNA 1EZVX 4NHCL 5A2LH 1D5BA 2FX7L 5SWZA 4DPPA 4NXSA 1TE6A 3CUGA 5FD0A 2HCZX 4J4PA 1BF8A 2D2OA 2QVTA 1AG6A 4FI6A 4U1KA 5GRXG 2PMZA 2BNUA 2JFCA 4PCYA 4GXWA 4NM4H 1I8KB 5I8EA 1XYAA 1TOXA 2GK1A 4X4XB 2ABBA 4NG3A 2ADIB 1GYUA 3Q3GB 4DKTA 3FIGA 4IM4A 3V7PA 3EO1B 5IY5B 2HCVA 1HTYA 2BS9A 1Z8AA 1CTMA 5DBTA 4GS7C 1E8WA 1XBXA 2DZTA 3VIHA 1IILE 4JTEA 3LN4A 1PS9A 3NZGA 3FO1A 1TG7A 1ZT7A 1T4KB 3LJ3A 2R1MA 4N5UA 2B1HH 3M0VA 5D1ZC 3OC8A 2J8FA 5FEPA 3ULSA 5MKGB 3B8SA 2D0HA 2G9HB 3CS2A 1V6WA 5DTFB 1XF3A 2ZKXA 4HXAH 4LS2A 2L0DA 5F7DB 4KKNA 3C61A 3GYCA 5C8BB 4XX1E 5E8OB 4OHQA 2UWEE 2X12A 2VWEE 3AITA 3L23A 4HAGA 3FVMA 3HI5L 1AZ1A 5F72S 5CGYC 3E0FA 4YHLL 3VW3H 1B4JH 1UVQA 1U5HA 1LK3H 4GO8A 2FBJH 5DZ9A 3HE6A 3LIZH 4L6DA 1ZPTA 4AMXA 3ISYA 3ABZA 3GT6A 2XXGA 4P2QA 3S0PA 1WDWA 4GX8A 3QLLA 2YPLA 2KLTA 4ZSOE 5L0QC 3KAAA 2YPLE 1U8JA 4G7YL 5HHVH 1BZQK 5AL8A 3AXLB 1P1MA 4OCYH 4XAFA 3SY8A 3H4HA 4JRXD 5A69A 1IF2A 2J4GA 1GMIA 1LO5B 4HH9A 3MTRA 4Y5VB 1XHGA 1MAML 2Z8RA 3QPXL 2GFBA 1GPOH 3QDJD 4JPKH 3WDHA 3A4JA 1DQUA 1FYTA 4KVPA 3SCMB 4UMCA 5J4MA 3SPHA 5HATA 5I0ZA 3SCPA 1TCMA 3QJHB 4YHMH 2A1YA 3VE0A 4C6NA 2OMVB 3CQHA 1VIWA 3S8WA 1BGAA 2CO2A 5GGSY 2F5BH 3C52A 3VNJA 2NY1C 4HK3N 3KYNA 4ZFOL 1CGYA 3ZT7A 3FF7A 3ARFA 3UYCA 5FYKU 1TQBB 2DKSA 3SDCD 5E56A 3CD4A 2YZ5A 3ML9A 2VFFA 4JE4B 4LRNL 3WEXB 5BS0B 4OBRA 3YPIA 3SJVB 3S83A 2L7JA 3VDCA 3ZXAC 3LZFL 3P82A 4ZZ9A 1VLXA 1W0YT 5JMRA 3WQWA 2FQEA 4M5SA 1ZGDA 2YB4A 1HW6A 5HDQH 5EBWB 5L88H 5HNTA 1K9EA 3WS6A 5E4AA 3HQNA 3L5XH 1J11A 3OHXB 2XFXA 5HYSB 1WDRA 5AYIA 4DHGA 3QO0B 1FG2B 4MA1C 5GS0L 3R5EA 3AADB 5LN4A 1IEBB 4U1GC 5AVRB 1I3UA 3MDJA 4JZJC 1PNCA 2EUWA 2GWNA 2WWDA 4HG4K 1NWRA 3PVFA 5EUOF 1WX0A 4Z0JA 5I1GL 4C4UA 3QIWB 4PLKD 4S1FA 4LYKA 1Q9WB 4DKEL 2OCFD 4RK8A 1N0XL 3WFHB 2GDQA 4UT6H 4WWOA 2O92A 4NT6B 2CO7A 3R0DA 3MOQA 4OM0L 5AZ0A 5LNVA 2QJMA 3SFKA 4CJ0A 3M46A 3ZVHB 4PLOB 4F20A 2BZDA 4H20L 3NFNA 2IBGA 3FCPA 4ECNA 3F5KA 2B2XL 1XDMA 2W65A 2ZXEB 5ALCL 2RJHA 3UG5A 3N13A 2E7HA 1IFRA 2Q1EA 1JCYA 2EEFA 1HQ4B 3WJMB 4YK4C 1Y18A 3GXFA 3SOBL 5JDJA 3T3PE 2CXKA 3A22A 1CENA 1JJUA 2N59A 1PW3A 3ZMEA 2C1GA 3ZIZA 3SSGA 2QGBA 3Q05A 3OGRA 1WICA 2QFRA 5HXMA 3H0TB 3PGFL 3QARA 1NC2A 1P1ZA 3KDPB 4MBOA 5FO7A 4Z7WA 4TNWF 4X9FA 4FNLH 2J7LA 3U7YH 1VRDA 4XN8A 5DCEA 3RIAF 2ICWA 1E6ZA 3H4WA 1LO2L 3D0CA 3FN0L 4L48A 3WD4A 2CBPA 2C7FA 2HRPH 2WXMA 1T03L 4CMHC 4RZCB 3L2MA 3UBPC 4K7PX 5E6UB 3H3PL 2DQJH 1E30A 1T3FB 5DUML 2OG9A 4W86A 4QE5A 4RSVA 2VSKB 3MUHL 5CN1A 1AKPA 1URLA 4MFEA 4XBSA 4ZAKA 2FIRT 4JZNA 2CMRH 2ROYA 2ABAA 5JQ9A 4U6HA 4W9CC 1N4XL 3NDYE 2IXVA 3CU2A 3V0HA 2FIKA 2FZMA 4YHOH 2VGFA 4MAYB 5DK3A 1BJMA 3D2UD 4M7KL 2DQTH 2OL3H 1ALDA 2AEPL 1Q6CA 1V02E 1HHKA 1MCOH 5CSRA 2VENA 1KB5H 4WJXA 1N0LA 1TQSA 5M95B 1FP5A 1W2PA 3D3VB 3LEVH 4YO0A 4MDJA 4Z0BL 3JWNH 1OX6A 3H3PH 4E4UA 1UXSB 4XOCA 3C3UA 1QO3A 5IXEA 3LX9A 3TYEA 3JTBA 2O30A 4ADSA 1S7UB 1AS6A 1Z9MA 3FU7A 3NJNA 1FA2A 2B59B 1R86A 5CBAA 1KTRL 5HMFA 3QW4B 1GVIA 3V5KB 3CC5A 1GGBH 1QR4A 4NB7A 1A6WH 5I16B 3AMKA 4H8WH 1RQBA 1U6AL 3FO2A 2PSNA 4LANA 1KN4H 2BNRD 1ZA3B 3B8DA 3MSGA 3SIMA 2ZP0T 3V5OA 2IADA 5HANA 3CN1A 4EACA 3ETBF 4I4WA 4OV6F 3STBA 3D39D 5CAKA 1RCXB 2OZ8A 2PZ0A 5MEPB 1AD9B 2HJKB 2WLZA 3RWDA 2J8HA 4J1UB 4NRXB 4Y4FC 3FTSA 4EIZC 1SDYA 5KVDE 3BHBB 1FTXA 1FZOA 2IG2L 2Z26A 2ZC1A 1FFPB 1UBPC 3QPZA 1PCWA 1YMHB 3UP8A 3MO4A 2WQVA 2UV3A 4TMCA 2YEZB 4PRRA 4JQ3A 1HXMA 1M7UA 3QR0A 4B41A 5B7ZA 2YD4A 3L6FB 4NRYB 3TZVB 3UP1A 3S46A 2IH9A 3PDOB 5IJCC 3JV0A 1D3GA 3RO8A 1HX0A 1CR9L 2W92A 3ARDD 1IGTA 1NCCL 3SODB 4F33A 1A9BB 1ASOA 3RVUD 5JPNC 3VVVA 4RWYH 5D7SH 3QG6A 4GSUA 4CADA 3CEUA 2ZPKH 1X5MA 1EHNA 3BT2L 3BVNA 3LDBB 1KM5A 5IBXC 3FW6A 3SSZA 2EPOA 2VCCA 3AFBA 3MUY1 4X7FC 3UJJL 1M3IA 2P48B 5D1QC 5FESA 2FT7A 3MROA 6REQB 4Z5RA 2YDAA 1VPXA 2V9QA 3AWEA 4WCYL 4YDIL 5EZJA 3QEHA 5FIEA 3GMMB 3SKNB 4AEEA 2Y7FA 3ULSB 1OF2B 3KHOA 3ZYIA 2HTMA 3QA3B 4AD0A 2GB2A 4Q0XH 3UJTH 3U36B 4BZ2A 2E6FA 3RWIA 2G41A 5C07E 4IRJD 4MCNA 3SIZA 5CINL 1DJGA 2Z8VC 4ZQTA 5TDOA 1EF2A 3JZ7A 3LA4A 2IDFA 1ZLDA 5HDBB 3H2QA 4KBPA 1SJMA 5JHLL 1FWTA 3ZIYA 4HNLA 3WIFA 2V5TA 4F2MB 4JX6A 3TJIA 2CWRA 5E99H 2JEPA 5IROD 2A6NA 1U1UA 4YDZA 3ASOB 4DBEA 5ESVA 3BKYL 1ZANL 3RAOA 1KGCD 4GG6F 5CC7A 1CYXA 2VC7A 3TS8A 3HBGA 1V4YA 2I9LA 3R19A 1OK0A 1CFMA 3QCVH 4Y9FA 5F2FA 2XVKA 1AG0A 5KBLA 3BAXA 1CC3A 2CZFA 4D6JA 1EYEA 5DT5A 4EDWH 4GEJA 4Q0XL 3UJTL 3P84A 3F3HA 1IX2A 4FQXD 4RRPA 2OKTA 4K7FB 3WN5C 4APQC 1JPTL 2YQGA 1AVAA 4ODVL 4QSFA 5H1WA 2FJGB 4BWWA 1OG6A 3GSWA 1SHSA 3RTQD 4HSHA 1CD8A 5GNZA 4G9DB 5A6IA 2BGNE 3G18A 2PGWA 3GG7A 1C8PA 2C19A 4XBJA 2BH0A 5F1UA 4HX1A 4JO2L 4HWBH 3DKLA 4FEMA 3QN3A 1R3KB 3GHEH 3IAPA 4FQQA 3ATZA 4XC3L 3UTQB 5IHBA 4J1OA 2C5DC 3C09B 2OL3B 4JZNB 4AGQA 1A64A 3O06A 1DQQA 1G6RL 3MREB 3MYJA 4M1DH 3K71B 3CO4A 1R38A 3WSUA 1E6JH 3VXUA 4GKZA 4YQXL 1GTEA 4P7NA 1GYLA 1S9WB 3WXVH 4Q6IC 3Q06A 3GIVA 1FIGH 2QUMA 2I5YL 1YEKL 3FT2A 1H5BB 5FEXA 4B92A 5E9AA 3BW9B 3GXMA 3GRWA 4LYQA 1KBWA 4BQ6A 1DWFM 3VI2A 4Z2GA 3EYOB 4LLMB 2XV0A 1GYVA 1D5XB 3D3VA 3D0LA 4OLZL 1R0AL 2NW2B 2ATKB 5I6XC 1MF2L 4GWEA 1N5AA 4PLNC 3EYSH 2ILLA 4L7ZA 5IUCA 4XIMA 1T1WA 3HR6A 1GL4B 3CHEA 4NUJB 4ZK8A 1JGDA 4NO0D 5FYJE 5HGBA 5GRVL 3E80A 1SEBB 4I3SH 3S97C 5CPTA 2VERA 2YBGA 1EV2E 3AZSA 3L4VA 3QUYD 1YEEL 3LPGA 3GSNL 3O6YX 3O2VL 4GGHA 3LCXA 5CJBA 2CALA 4G9FD 4YZWA 1V5XA 1E7VA 5CR8A 4ZQPA 1BYOA 4ES4A 1A4BA 4PRHA 3O3UN 3EOLA 3VFVA 1P69B 5C0CD 3QIBB 3TVAA 2ZZ2A 4MDOA 2B20A 2HEJA 4PB5A 2FZDA 1ZAGA 1SOXA 4PRIB 4HQQH 2GAZA 3V5HB 3F03K 2P42B 4RBPK 2ZQ0A 3NIGF 1Q9OB 5I1AA 5FGBA 2NY3D 1U6AH 3MRIA 2TMDA 4I3RL 5JPMA 4DEFA 3W74A 2FZ3B 2OGJA 4U1IB 2JKWA 2O72A 3NCJH 2WZ5A 3BOFA 4MJMA 1NIAA 3BDBA 1UOLA 2K7QA 4U6XB 2YSSA 1KFAL 1P0NA 3ITLA 1J87A 4AQ8A 1KN2L 5IW6B 4Q32A 5FYLL 4OLVH 1O9ZA 2WKOF 3ARGA 3D85A 4O0QA 3REQA 1IT9H 1YG9A 4H9TA 2J8OA 4LCRA 3HMXL 2HFFB 1Y6NR 4WENB 1H15B 4TVUA 1WZAA 2QV2A 1TTUA 4PJ7A 1WIUA 5BMFH 1S3HA 1V05A 5CH9A 4LNCA 2NZ9D 4PCTA 2NY2B 4P23B 4TLTA 4UR9A 2O5XL 5AZ2L 3SD5A 3VXNA 1Z9OA 2VQUA 3AQUA 4PP1C 5IJVB 4JNMA 3SKNA 5I19H 1WB0A 2QHAA 4DPCX 3T9PA 4H6EA 3P30H 3FAXA 5D2LE 5IBUG 5B7EA 3UYPB 1CFVH 1RFDH 1GRWA 4Y4FA 3MUGB 5C6WH 3T6ZA 4GUQA 5H4YA 1A0CA 1JPKA 2BX7A 3CHCA 3FA3A 1P9MC 4RZBA 3S9IA 1C5BH 5AYTA 4JPWH 4XAZA 4NKIL 3USBA 4GC4A 1F97A 4NP9A 4BV1A 1DVUA 2NX5E 5ILTL 1YEGL 2XFXB 1WDAA 5GRVK 5E6ID 5BV7C 5HYSA 1QWGA 4OD2B 2B7QA