1JXKA

Role of ethe mobile loop in the mehanism of human salivary amylase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
total genus 179
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jxkA01
2YFNA 5A3HA 1ISVA 1CDGA 1W3JA 3RPMA 1NH6A 2V3EA 3K8LA 3A24A 4UQEA 3RMEA 4UNIA 2W5FA 5CGTA 1OD8A 1SFSA 1V02A 5A6BD 1QNPA 3EJQA 1C92A 4E8CA 4DWSA 3T2PA 1W9DM 3OLGA 1W1TA 4U2YA 3WUBA 3AYSA 2WCGA 1UKOA 3N15A 4D6IA 5HDRA 1IZKA 4PBGA 3S5ZA 3OGRA 3EDKA 3TTYA 4CKQA 1VEPA 4UQCA 4J28A 1QI4A 3POCA 4JFVA 2VRKA 2ZOXA 5A8PA 1JF5A 3K46A 1TR1A 4IUGA 1QI3A 1E3XA 3VUPA 5IFPA 1EA9C 4J3UA 1JFXA 3BC9A 1KCKA 1HIZA 4H7VA 3VNZA 4U3AA 3ZJ8A 1KB3A 1MW2A 4JHOA 3BSGA 4YN5A 3M07A 4CCEA 4TVUA 1GHRA 3SUUA 1E4LA 1B9ZA 1V3MA 1TQVA 2XYLA 3CHDA 2XVLA 2Y5EA 2E8ZA 4M24A 4D1IA 3A4WA 4JCMA 4MTVA 1MW1A 1DEDA 1IT0A 1ZBKA 3VIKA 1DWIM 5CLTA 1GCYA 2RGMA 2XWDA 3M7SA 1BG4A 3LPOA 3PHAA 3QHOA 4FF5A 3RM9A 4JKMA 4OKDA 5D8WA 3VDHA 1OT1A 2ZUUA 1M03A 1CXKA 1DWGM 2PB1A 3B9EA 2XFFA 1TZ7A 4X0VA 1K6AA 1US3A 3PZOA 1LL7A 2W91A 3AIQA 3QR3A 1E71M 4AISA 4PN2A 1R87A 1ITCA 3DX3A 1J0KA 1GORA 1G0CA 1UWUA 1JYNA 2WVTA 3ZT6A 3BAXA 5FCZA 3U7VA 3SCUA 4J3WA 1W3LA 1W2VA 1CGVA 2DT3A 2G4FA 5LA1A 5C8BB 2CKRA 3DHUA 3OZPA 1GJWA 4W88A 1HVXA 1Q6FA 1WB0A 1DTUA 2DEPA 1QOXA 1UWQA 4J27A 1TA3A 1I1WA 5JBEA 3NDZA 3UR8A 3O2LA 4CD8A 3VDAA 3DECA 3H55A 3EDJA 4D1JA 4OJYA 4LQ1A 3LPPA 3ZM8A 3MUAA 3CUFA 1B0IA 1BHGA 2A3BA 3HG4A 4TX8A 1UQYA 2UWFA 1JGIA 3N13A 4MDOA 3HN3A 1C7SA 3VX1A 3NCOA 2XN1A 5I5RA 2DSWA 1ISYA 4PEEA 1NOFA 1G5AA 2J8GA 2ZXBA 3RDKA 3PZMA 3BXWA 1V0LA 3AZSA 3AIUA 1UWIA 3ARSA 1WO2A 4NF7A 3GH7A 5C70A 1UZ4A 1JDAA 2J25A 2NT1A 3WY2A 1KWGA 1HTYA 1W1YA 4WLCA 1Q6DA 3DYOA 4ZFMA 2WMFA 1JDCA 1V0NA 4WJXA 3WKZA 1W91A 3CHFA 2GJXB 3FN9A 1R85A 4UZSA 3WDIA 4BA0A 2QV4A 4Z2HA 1ZBCA 1WZAA 3ZJ6A 4GZEA 4AIEA 3WN6A 3MUIA 3IAQA 3BAYA 2DSZA 2PWGA 1RP8A 1UQZA 1J12A 1XRVA 4AW7A 1TUXA 3L2MA 5A6LA 1EO7A 2QHAA 4W7WA 4W8LA 2VO5A 4D72A 3I3DA 1V3IA 4W5ZA 3ZIZA 1R86A 4TXEA 3F5KA 4W5UA 2C8NA 1W9XA 1EOKA 2WMJA 2E0PA 2VL4A 5A95A 2PF0A 3MSDA 2YBUA 5IDIA 1HP4A 1Q4NX 1K9EA 4RE2A 3M6DA 3W26A 4MDPA 1CGUA 4ZXLA 3W82A 3BVXA 1J0ZA 5GNYA 2A3HA 2W61A 2UY3A 1W2PA 4AEFA 1ZBVA 1UASA 1PZ3A 2WM0A 5EFDA 3AXXA 3FY1A 2J62A 1JZ3A 2EPMX 3H54A 4XZWA 1KR1A 2D1ZA 3HU7A 5CPTA 5IXEA 1V03A 3MV01 4HMEA 3WMBA 3POHA 4WK9A 1EDQA 1EIBA 3SCNA 4PMOA 1NWTA 1KQZA 1FHDA 3PZQA 5JBFA 2PWHA 1AQHA 1NWUA 1UD5A 2ZXDA 3MU7A 1MQQA 4H04A 2WCAA 2WMKA 2J47A 3NDYA 3ARWA 1QHZA 2J74A 5FD0A 1BVZA 3WL0A 2EBNA 5F7UA 1GONA 4JFTA 2OYLA 3SCTA 4XX6A 4QLKA 4W85A 4DUVA 1OB0A 1SR0A 4F9JA 1AQMA 5I79A 2WAGA 2CITA 1CIUA 1SZNA 1OIMA 5E0FA 4W93A 2WMIA 2C0HA 3MUY1 1XD1A 3FW6A 2J7EA 4Y7EA 2QMJA 1HJQA 2GK1B 2FHFA 2YJQA 2EPOA 3ARVA 3OGVA 1MW0A 1JD7A 1QI0A 1QNQA 3CZ8A 4J3TA 1U2YA 1JL8A 3L4WA 3LMYA 4FNPA 4CN1A 3CC1A 3ZSTA 5CSUA 1WP6A 4W89A 4AZIA 2BHZA 3ZT5A 1UH3A 2J77A 4LX4A 3DDGA 3WL1A 4KGLA 4H2CA 3D50A 3A47A 2F7PA 2X0HA 1W32A 2XVKA 1UG6A 1AMYA 1ZJBA 1DWFM 5E6YA 3WUGA 1LWJA 3N12A 1B31A 5FL0A 4B9YA 4BQ4A 5D9MA 4D71A 1J18A 8A3HA 2OSYA 3SIMA 2CYGA 1BAGA 3VDCA 2XTKA 1E6XM 2JE8A 3T2OA 1OCQA 3AZRA 1PJ9A 2F7QA 2WC7A 2YL9A 1K9FA 1KXQA 2VJXA 2QLYA 1BVNP 2XN0A 1TMQA 2QMKA 1J10A 4JFSA 1EQCA 3BVTA 2VX7A 1E56A 3WMCA 1JXJA 1FOBA 5JIPA 3IGUA 1V3JA 1E1EA 4XZBA 4UTFA 1MVYA 5CLWA 3EDDA 4DM2A 4TVCA 1QWUA 1S46A 1UR8A 5BRQA 8CGTA 1OIFA 1E6QM 2VR4A 4L4PA 1KGUA 4KRUA 2Y24A 3VSUA 3VIOA 2VURA 5A2BA 3UG5A 1HX0A 3OZOA 3CZJA 2WSKA 3PZNA 1H1NA 3IAPA 4JL1A 4RL3A 1KCLA 1V6YA 4ZXOA 2WPGA 3WNPA 3WQ6A 3W6LA 2OSXA 4PUEA 2GSJA 1V08A 3WEOA 3F5JA 1UZ1A 2AMGA 2J8FA 4AD4A 3VIIA 3AHZA 5A1AA 3BVVA 3L4YA 2GDVA 2J7CA 4CVWA 2XFYA 3WBAA 4UFKA 2G3MA 2FHCA 2YLAA 1UD2A 4DM1A 1H41A 4MADA 1GOKA 5HPCA 1VJSA 1PEZA 3HJEA 4OBRA 3WD0A 4FMVA 2XVPA 1LG2A 4LYQA 5BXTA 2VVSA 3AHTA 4ZENA 1CXHA 1UWSA 2WMIB 1RH9A 2FH8A 4LYPA 3WEMA 1O7AA 3K1DA 1I1XA 1UR9A 5EFFA 5D9NA 3BMWA 2EACA 4BQ2A 4Z2LA 2ZIDA 1BGAA 1GVYA 1ZU8A 2YL5A 2TAAA 3WF3A 3A22A 3GXIA 9CGTA 3AHYA 2MANA 4F66A 2WWCA 1QNSA 3D51A 3BAIA 3KL5A 2WHJA 1PAMA 3D3AA 3NSMA 2Y8VA 4FLOA 5EMYA 3FAXA 3JUGA 3SCRA 2JFEX 1EXPA 2VCBA 2GJPA 1JNEA 4CU6A 2EQDA 3WSUA 3OIHA 4BS0A 1EQPA 2JEPA 1WNOA 3G6LA 4D6CA 5M17A 4F8XA 3MI6A 5E70A 4GPNA 2WWDA 1KTBA 1BYDA 1HKJA 4QFUA 2E8YA 3VKKA 2WNWA 2BY1A 1M01A 4GI9A 1BYCA 3L4TA 1J01A 3CHCA 2VT0A 1KBKA 2PBGA 4NRRA 4JFWA 2EPLX 3SUTA 1E4NA 1MWOA 1OBAA 1X6NA 3T08A 4EKJA 5A6JA 4AC1X 1HJWA 4W7UA 4YHEA 2Y4SA 2VX6A 4HPGA 1UR0A 2XSBA 4AIUA 3FXYA 1IV8A 1UYQA 3AHVA 3O6AA 3ZQ9A 1JZ6A 4L4OA 2YLLA 2A3CA 4PSRA 4PRWA 4CN4A 1E6PA 3AROA 1RD6A 2EO7A 4PMYA 1XSKA 2EAEA 1CGTA 1JI1A 2DGAA 2X2HA 5I6SA 1LJYA 2GUYA 7A3HA 4NXSA 2VQTA 3TTQA 3T0DA 1XH2A 4OBSA 1C90A 3EBVA 3BVWA 5HNNA 4V28A 1E3ZA 2W92A 1CZ1A 5CZKA 3WNLA 4PTWA 3PBGA 5ABFB 4LYRA 4UQBA 1OWQA 2VX5A 3GNRA 1NP0A 3GDBA 2ZX8A 1FFQA 4J3XA 4M80A 2WCSA 3MMDA 4V2XA 1BPLB 3WD3A 5ABGA 2QPUA 2E3ZA 4DUXA 4JL2A 3W38A 4ACZB 3WQVA 2DIJA 2CERA 5AY7A 1VAHA 3K8MA 2J78A 3AICA 2ZX9A 2D20A 1UD8A 3AISA 4MPKA 1J0HA 1U30A 2UY5A 5ABHA 1HN1A 1VFOA 3PTKA 3UEQA 1FH8A 2F1BA 3WD1A 2CKSA 3U5UA 3VGHA 1KQYA 2WANA 1TVNA 2ZUWA 3T2QA 4B3LA 4IM4A 3ARPA 5DMYA 3TV8A 1NWRA 1ESWA 4QP0A 5GNZA 3AZTA 3WDPP 2WVSA 1UH4A 3L4XA 3FAWA 2D23A 1HJUA 1MFUA 1M7XA 1XH0A 5FIPA 3ZO9A 1JAKA 1UKPA 3KE0A 4NRSA 1JYXA 4GZIA 1H2JA 1C91A 1JZ8A 3CH9A 4IPNB 1HT6A 3BLBA 4ZE5A 5I0DA 3A3HA 3WY3A 3WF2A 4Z2GA 4WKHA 5A8QA 1HL8A 1OT2A 3ARZA 2GFTA 1N82A 2G8ZA 4UOJA 1XH1A 1BTCA 2WVVA 3KZSA 3EJPA 3VD5A 3PZVA 4DWSC 3CUGA 1HJSA 4JKKA 4CCDA 1CXIA 3THDA 2V3DA 2G41A 4AZBA 3THCA 4MAVA 2VR5A 1UKTA 3TA9A 2EPKX 1ITXA 4CCCA 1VF8A 1JZ5A 2F8QA 4JKLA 3NYDA 4A4AA 2ZX7A 2CHOA 3OB8A 4HMDA 2CHNA 5ABEA 2D24A 3NSXA 3CPUA 2BVTA 3WQ5A 2BHYA 3EJSA 3CZGA 3VGBA 2VZOA 4GZJA 1BFNA 4CD4A 2CESA 3EDFA 1V6WA 1FP9A 7CGTA 3VVGA 3DX0A 2WKLA 4QCFA 4S3KA 1FA2A 3NUKA 4XV0A 1TQUA 1X1NA 3GTNA 3DYMA 2VZVA 2B31A 2QF8A 1J0YA 4M56A 5I2UA 4HP5A 3L2LA 1JZ4A 1YHTA 2E9MA 3VIFA 3AXIA 2JF6A 1IZJA 2BS9A 1UR2A 1VFUA 1H09A 2VCAA 3A21A 4HTYA 3T0BA 3VMOA 4IPLA 4AD2A 3VGEA 1QW8A 3OLEA 4WKFA 1E6ZA 3WH7A 2BXYA 2JEQA 3WD2A 3DDFA 3AIBA 5AC4A 1GVIA 4P7QA 1E4IA 2WBKA 1G01A 1JAEA 3RM4A 3ZMRA 3CO4A 3W81A 4U31A 2J7FA 3AJ7A 1OINA 1UD3A 4B9ZA 1PX3A 3GNOA 3EMCA 4H8VA 4Z2KA 4DWSB 3MANA 4GIAA 3UCQA 4D6HA 4P7OA 1ECEA 4MNJA 4A3YA 2E4TA 5A2CA 2OYKA 1ZJAA 3BCFA 1V6UA 5IHSA 1LL6A 2XPKA 3RILA 2DPEA 1WAWA 2BY2A 2OSWA 1L8NA 2V3FA 4FK9A 2WXDM 1E6SM 3GXMA 5IFTA 4ATWA 5I77A 4UQDA 2YDRA 2XWEA 1NOUA 5BWFA 3BVUA 3BCDA 4NZJA 2WHLA 2CBIA 1CXEA 2XGBA 1KXVA 3WY4A 1GQKA 4MJ4A 1E0WA 4N0RA 1H0GA 1VB9A 2J4GA 2J79A 4FLQA 2XUCA 1JDDA 3WD4A 3LX9A 1B30A 4RE4A 3VIHA 2WMGA 1GPFA 2YL8A 2YBTA 1VBUA 1BF2A 3B9AA 3N17A 2VZTA 1QBAA 4AZCB 2ZUNA 4OGZA 2J75A 3GXPA 2O9TA 1E5NA 3CLWA 5GPRA 2V5CA 5CJ5A 5A6AA 2BY3A 1VBRA 4PUDA 1OSEA 3LXCA 1W1VA 2BXZA 1NWSA 1DWAM 1R34A 2PBOA 2AAAA 4FNQA 1H4PA 3W25A 4BZYA 3AXHA 3U57A 4UFIA 3SUSA 3UG4A 3MMWA 3ALFA 3RCNA 1KBBA 4EE9A 4FNUA 3BSHA 1QW9A 4TTUA 4Z2IA 2VUYA 2X2JA 3BAWA 4F9DA 2CBJA 1CXFA 4P8VA 5ABFA 3A4XA 1C8QA 1CLVA 2VCCA 1GOMA 1PX8A 1CECA 1UA3A 4U5KA 2WMHA 3DX4A 4JFUA 4AEEA 3ARUA 1B3VA 2BVYA 2CBUA 3AIEA 2PC8A 3WQ8A 5CG0A 3AIWA 4JZ5A 4W7VA 1OM0A 1B1YA 3WF0A 2ALWA 4PMVA 3ECQA 2W62A 1KXHA 3SCVA 1W3HA 2ZXQA 3PTMA 3WELA 2WKGA 1GJUA 1VRXA 5AYBA 1SYTA 3SUWA 2XFRA 3ZR5A 1A3HA 4GO8A 4UOQA 3ARXA 5FL1A 2O9RA 3HG5A 1JIBA 2F18A 1E15A 2F1AA 4W86A 1SMDA 2X0YA 3D4YA 2EJ1A 1BQCA 5IHRA 5A6MA 5BYWA 3WNOA 1WCGA 3CV5A 4AY1A 1D7FA 4X9YA 3W37A 2GDUA 4KWUA 4PCTA 3CUJA 3VILA 3WFZA 2D0GA 1SMAA 1EO5A 2BY0A 1F4HA 4QLLA 1E1FA 3H53A 4PSPA 4U5IA 1W9VA 3BUBA 2XGIA 1BGGA 1MYRA 1I75A 3G6MA 3D52A 1CTNA 4TVDA 3WDHA 3UR7A 1DHKA 4PMNA 1TFVA 1ZS2A 3AFBA 4UR9A 4URIA 3RJXA 3WBEA 4S3JA 1G9HA 4OOZA 1R7AA 3T0AA 3WFLA 3KEHA 3CHEA 3I3BA 3UESA 3KLLA 1UWRA 2WHMA 3WQ4A 4FNRA 1DP0A 4BQ5A 3OLDA 3U5YA 1ISXA 3PN8A 1H49A 4U2ZA 2PWDA 2OWCA 2ZUMA 5BXRA 4TTGA 1BLIA 2VI0A 4CVUA 4GI8A 4MB3A 1J0IA 1M04A 1ZBWA 4MAZA 4HA3A 5M5DA 1XYFA 2V5DA 5A8NA 1XCXA 4AMXA 1JYVA 1UH2A 1NP2A 2XN2A 1TQTA 1HKIA 3LRLA 3PZ9A 3II1A 1WE5A 5FKYA 2YIHA 1WPCA 2WW5A 4HMCA 3S5YA 4MB1A 3VX0A 1HJXA 1UA7A 4OZOA 1J0JA 2JIWA 2O9OA 3PZUA 1PIGA 3AMCA 4DO5A 4LXFA 3S2CA 1W9UA 4EK7A 4J3SA 3KWXA 3WY1A 4AD5A 1W9BM 2YDSA 5A8OA 5I23A 6CGTA 1HKKA 3BLPX 2GJRA 1Q6EA 4CGTA 5EBAA 5E0CA 3EYPA 2GJXA 2HISA 1XSJA 5HBFA 4JIEA 1QNOA 5LA0A 4PMXA 2DT0A 4J7RA 3CGTA 2IXVA 1ISZA 3ZR6A 1QHPA 3ZT7A 4PMQA 2XSAA 1PIFA 1V3HA 1E70M 1KGWA 4AD3A 3ZOAA 4W8AA 4PMRA 5E1QA 2UY2A 4CD5A 1BSIA 1W3KA 2VX4A 2OLHA 1GOIA 1DWHM 3SCQA 1PBGA 3HG3A 3GZAA 3AIVA 4E2OA 3LXAA 4C7GA 1B90A 1VEOA 2Y2WA 3SUVA 1EHAA 1KFWA 4M1RA 2WZEA 4J3VA 4WF7A 3VIMA 4MNKA 4MNMA 4WKAA 3VNYA 4P8XA 4PTMA 4HA1A 3BMVA 5HXMA 3AMDA 4MB4A 5CPQA 1F4AA 3A5VA 2VRJA 1XC6A 1KWKA 2EABA 3TOPA 3VU2A 1GW1A 3VTRA 4AZHA 4BCEA 3WUFA 1LWHA 3WENA 3AMGA 4CD7A 4DO6A 1K9TA 3QHMA 2YL6A 1C8XA 4P7RA 4M8UA 2CBVA 2JF7A 1LLOA 4ATLA 2G3IA 1C93A 2ZICA 5CSYA 4GI6A 1ODUA 2F2HA 4HZ8A 3WNKA 3O9NA 4UQ9A 3A6OA 3APGA 5D4YA 2DSKA 4ATDA 3DC0A 1QI5A 1E40A 7TAAA 5CPSA 2D3NA 1BG9A 4D6FA 4P8UA 3AIRA 3ARYA 1EGZA 1Q6GA 3GXFA 2WSPA 4LGXA 1CXLA 3EDEA 3MS8A 2WK2A 3CTTA 4AZ6A 4HZ6A 4HPHA 2CNCA 1B2YA 3EJRA 3LRMA 3KLKA 2GK1A 3CZEA 3GM8A 4MB5A 4JAWA 3OG2A 4JCLA 4GINA 2EXOA 4KGJA 3E1F1 1E43A 5BXSA 1D2KA 3I3EA 1MXGA 4D6EA 1QPKA 1V02E 5LA2A 3OLIA 3M46A 2V38A 1T0OA 5DEZA 2IUZA 2VZSA 3IJ7A 3PZIA 4TOQA 2J7DA 1EDGA 5C71A 4NX0A 1XSIA 3AS1A 4UCFA 1R8LA 3VPLA 3GH4A 4AZCA 1WDQA 3N9KA 5A6SA 3VD4A 1GOOA 4WIWA 2ESCA 3SCPA 4GO9A 1C7TA 2D2OA 5BCAA 2D3LA 2HVMA 2XM1A 1NARA 5A6KA 3W24A 2A3AA 3VM7A 3FHAA 2DT1A 3VM5A 3AS2A 2BNJA 2FH6A 4AD1A 2G3JA 2WZHA 2DSVA 3CIVA 3EMZA 1GNXA 1FH9A 2D73A 5DT5A 1LG1A 2NSXA 5I24A 3EMQA 1R47A 1AVAA 1GZJA 3ARRA 1VEMA 5E9AA 3OBAA 4N42A 2XHYA 1EDTA 4P7NA 2PWFA 5LYRA 3VGFA 2FGLA 3K4AA 3VDBA 4PMUA 1CNVA 3GXDA 2WBGA 1E9LA 3VD3A 2DIEA 3AS3A 2X8RA 1W9PA 4HZ7A 3DX1A 1QHOA 4GQRA 4TX6A 1FP8A 1XGZA 2OWWA 1O7DC 1VFFA 4M29A 3VSTA 3DHPA 1CPUA 1JI2A 2Z1SA 2QPSA 3FHQA 2FYVA 3IANA 1UUQA 1CGWA 1BYAA 4H8UA 2FDMA 1EHNA 3N11A 4D6DA 1AQ0A 4Q7NA 3UERA 1KXTA 5KEZA 3VO0A 4KH2A 1UD6A 2J7GA 1RP9A 4CU8A 2E40A 3MUZ1 3WDQA 2C7FA 3VIPA 5CQ1A 1WDPA 3GNPA 3BUPA 5CGMA 1C3FA 4GXPA 1UR1A 3GBEA 2OW6A 3BAJA 4AIOA 1MW3A 3NIYA 1TCMA 3KL3A 5D8ZA 3ARTA 3CMGA 3N18A 5CXPA 1X6LA 5ECUA 1GOWA 3VMPA 3QHNA 2W63A 3BUQA 2WVUA 4H8HA 4X0NA 4FLRA 5DF0A 5A8MA 1EH9A 1QNRA 1US2A 1G94A 2ZWYA 3RIKA 1WKYA 2BHUA 1XV8A 1HP5A 5A69A 3W53A 4AZGA 1GQLA 1V0KA 3S6TA 4C7FA 1TQSA 4D6JA 1HWWA 1OD0A 2NT0A 3VGDA 2DQXA 4CU7A 1V0MA 1UHVA 5GQBA 1KGXA 1OGGA 1VIWA 3WH8A 2D22A 5AC5A 4OIFA 1VJZA 3MO4A 3A4AA 1H5VA 1G1YA 1Z32X 1CEOA 1HNYA 1TA3B 1UOKA 4MJ2A 3NSNA 3WH5A 4BQ3A 4Q22A 4CUCA 4QDMA 4UOZA 3BAKA 1H11A 3GXNA 2VVNA 4W8BA 1HKMA 5KZ6A 2BVDA 5BRPA 1B3XA 1HJVA 3SEPA 4IISA 1QX1A 3LRKA 4HOZA 2WLZA 4DWSD 2VC9A 3WQWA 3UETA 2XM2A 3VSVA 1JD9A 6TAAA 1GHSA 2BFGA 3W27A 1E6RA 2VTFA 3K4DA 1QI2A 3W28A 1U33A 3B9DA 1JNDA 3WF4A 3OGSA 2X2IA 4LPCA 3WUEA 1WZMA 1JXKA 3AMLA 2E9LA 1ISWA 1PZ2A 2VQUA 4DUWA 1A47A 2VNCA 2DSUA 5JBDA 2F7OA 3ZJ7A 3WDJA 5BXPA 5FOOA 6A3HA 1CGYA 3LXBA 3N04A 3ZSSA 2NW0A 1MQRA 3MSGA 4PMZA 4R27A 4AD0A 4EAMA 1LQ0A 4DO4A 2W67A 5AYIA 4ACZA 5E09A 2UY4A 3AI0A 4NSBA 4UZUA 4ZE4A 2O9PA 4H41A 4P7LA 3CBWA 3RJYA 3VINA 2DH2A 1FFRA 3PTQA 3GYCA 1KTCA 4YHGA 3UG3A 3HG2A 1B3WA 1VENA 4F79A 1HL9A 4BF7A 2DDXA 2XVNA 3VD9A 1E73M 3PZGA 4PYSA 5GNXA 1M53A 1NM9A 1CGXA 3VOCA 3TTOA 4AZ7A 3WF1A 2CCRA 1CLXA 2Y8KA 4E8DA 5E6ZA 3PZTA 1D3CA 3VIJA 1XD0A 1FHLA 3CZLA 1PS3A 5HPOA 2WZIA 1O6IA 3WIJA 4NXKA 3ZJKA 2WC4A 1P6WA 4AYGA 2V3GA 4Z2JA 2ZXAA 2ZX5A 5D9PA 3BGAA 1J9YA 4XB3A 3L4UA 4HU8A 2XIBA 1E0XA 4RE3A 2YFOA 4NI3A 3U7BA 5BROA 3EJTA 2ZUSA 3B8SA 2X09A 1E5JA 2ZWZA 1R7OA 4NZCA 1GUVA 2CETA 3T09A 1CYGA 2E9BA 5TD4A 1QVBA 3D5HA 3W4RA 2EPNA 2XG9A 1JF6A 1WZKA 4U3CA 1Q6CA 2EADA 3SCWA 2OYMA 1TVPA 1L0PA 3NJ3A 4YPJA 4OUEA 2A3EA 3ARQA 1JZ7A 2VMFA 3N1AA 3LPGA 4NZFA 1JZ2A 2JIEA 3W0KA 1ZB5A 1HF6A 4ACYA 1JG9A 4AZ5A 1UD4A 3EJUA 4D6GA 1WZLA 1V6VA 3BUDA 2F61A 4HU0A 2YA2A 1V3KA 2G3NA 3F5LA 4KRTA 2CPUA 1NQ6A 3GBDA 2YA0A 4HA4A 4W84A 3IK2A 5A94A 3BLKA 2ZUVA 3CUIA 4K68A 1CENA 1VFMA 3D4ZA 2VOTA 2X05A 3HZ3A 2ZX6A 1TG7A 4ML4A 1MQPA 2PI6A 4P8WA 1LL4A 1UR4A 3SCSA 4KMQA 5A2AA 4AXNA 1YQ2A 4HOWA 2J7BA 3DX2A 2Q8XA 3W29A 3MMUA 1W1PA 4JHZA 2X1IA 2CXGA 4UFMA 1TQWA 4AWEA 1MXDA 5HOSA 2WC3A 1QBBA 4R5EA 3WH9A 4AYSA 5M03A 2WB5A 4M82A 3AQUA 4AMWA 3OA5A 3MKKA 2EEXA 3TTSA 5EB8A 2ZE0A 4ZEPA 3RM8A 5I3DA 3AS0A 3WNMA 1B3ZA 4M81A 5I78A 4OOUA 2FE0A 1JYWA 4FNTA 1WDSA 1GQIA 4MNLA 2DT2A 3SURA 1K9DA 3TP4A 1GOQA 3GXTA 2GVYA 5M3WA 3CMJA 1EOMA 2CIPA 1H3GA 3WMSA 2XJ7A 2XVGA 2YKKA 2YDQA 3VMNA 2OWXA 2X2YA 4GKLA 1PPIA 1Y7VA 3SCOA 1CBGA 2IXUA 3CZSA 3QGVA 3W6MA 2DH3A 3L4VA 1XHGA 2W66A 2VZUA 3KL0A 3TONA 1PX4A 3AYRA 1FH7A 1E55A 1E6NA 3F4VA 2J7HA 1DWJM 5DO8A 3QOKA 2BV9A 3K8KA 3LPFA 4TUFA 4V27A 2FGZA 3GH5A 1MFVA 1XYZA 2CEQA 3AHXA 1LF1A 3WNNA 1C8YA 4XUYA 1TE1A 3ALGA 2D0FA 1H0IA 4PTXA 4B3KA 2YA1A 1JFHA 2XIIA 3FNDA 3VIGA 1R33A 3WEZA 2WHKA 1UWTA 2JALA 1QWNA 1OGSA 1CWYA 1V3LA 1XCWA 4E4PA 2Z1KA 3AOFA 4EANA 3HMCA 4FLSA 4GQQA 1HXKA 4HOXA 3BUIA 1V6XA 3CZNA 3J7HA 1RPKA 1B3YA 1GQJA 4UFLA 4UFHA 1OGBA 3WH6A 2OW7A 3AMKA 2ZUTA 3IJ9A 2YOCA 2WVVB 1R46A 1UKSA 5JIWA 4PCSA 1R75A 5DFAA 2FHBA 3CZKA 5JUVA 1KR0A 5A6BA 3BH4A 4U33A 4CN6A 1E4MM 1HXJA 1ZL1A 5D9OA 3WDRA 1E0VA 4PTVA 3L4ZA 3MV11 3QOMA 3VGGA 5DT7A 1WDRA 3CUHA 4CD6A 1HVQA 2AOSA 4QAWA 3IJ8A 1ODZA 4C7DA 4WSJA 4A3HA 4QCEA 2IGTA 4FNSA 4UQAA 1E72M 1UKQA 1J11A 2RGLA 3RO8A 2F7RA 2O92A 3VD7A 1NOWA 2PWEA 4W87A 2D0HA 4B16A 3A23A 4QLJA 2W4XA 4PMDA 2WYSA 4UFJA 1BYBA 2WLYA 4B15A 4AMCA 4WSKA 2VRQA 3DYPA
chains in the Genus database with same CATH superfamily
3HZYA 3KBHE 1ISVA 3EYVA 5KSBE 2SEBB 5MENB 4NZ1A 5J5DA 5F89A 4IG2B 2CM6A 1HHHB 1YA5A 2FNBA 1JNNH 5I8KH 1I45A 3K8LA 3G1XA 2GGEA 2UVFA 2WNZA 2IDUA 4NNCA 1A4LA 3M43A 5C0GA 4IRSC 2WTRB 1OD8A 3IPFA 2DYPB 3SE8L 1FGNL 2DJUA 2PCXA 2Y2TA 2YAHA 3UMNA 2GI7A 3NFSH 3WUZA 3ARGD 3QQ4B 3T2PA 3AXLA 3F7VA 5KVDH 2V2CA 3GSNH 2QZRA 1E5ZA 1OSPH 4O4WA 4RV3A 1DBBH 1KTLA 4MQSB 4UTUA 3EYQD 3C6SA 4G6JH 4U2YA 4IGMA 4LSDA 1RVFH 3GRIA 2Y5TB 2VGBA 3PWLA 2WUBH 3N15A 5F70A 2OR8A 3LIZL 4NC2B 5DEGA 2F9BT 3HUJF 1T83C 3LNIA 1F00I 3WGUB 1IZKA 3L1OL 4B9KC 5CP3H 2VYRE 3B7SA 5IIEB 4FFZL 1NTDA 5J9PB 3MGTA 5L4JA 2HAZA 2GQ8A 3UYOD 3QDJD 5JNYB 1HSBA 3BYTA 4I0PA 5D09A 4X80H 1M9WA 5AKRA 3B6SA 5CJOL 2OOGA 3OQ8A 2NW2B 2VRKA 3A6BL 2POTA 1LTXA 3RGVC 1O0VA 4C55A 4KTDH 4Z7UF 3IV3A 3MJYA 1TR1A 1ADWA 1QI3A 2VDPB 5HGAB 1HZLA 1RZGB 3NQIA 3SPVA 4X5PA 3KFTA 4NQEB 5I8OH 3U2SB 1XBDA 2X1UA 4IX0A 1ONQA 2QFRA 1EA9C 2R0WL 4ODWA 4LRSA 4J3UA 4YXHL 3L17A 4JUTA 2VDQL 4N2AA 3IS4A 4X6FA 4LF2A 2UZIL 4N8VA 1F6KA 3UY7A 5ACLA 1JJUA 2F53B 4KK9C 4WI2A 1A6WH 2DQDL 5JPNA 1KB3A 2X38A 4JHOA 2IXQA 1CE6B 3V7PA 4O2CB 4YN5A 5HAOA 5JO5A 2R83A 3QDJB 3RGTA 3KVLA 1H3WM 3TJPA 2FX9L 4B2DA 2CKBH 2VW6A 2E7LC 4AFYA 2OL3H 4IBLT 3IWPA 1TQVA 1AIFB 5FYLH 4QDPA 1Q0YH 3CHDA 2GQHA 2Y5EA 4LEOA 4TU1A 4DN1A 1CFMA 3GO1L 4XNMB 1SW3A 3X1NA 1T96A 5CMAB 1LO5A 4ODHL 3RGHA 4MRBA 1YAZA 3MFGB 4BDVB 4JCMA 4TTDC 4ALDA 3LQAC 2EYRA 4MTVA 1H5YA 3PHQA 3RWGB 1U1HA 3TMLA 3QC3A 4LBRA 5E1GA 1TPXC 4HYRA 8XIMA 3LIZA 4YHIB 1DWIM 4ZOCA 4FYRA 1TSRA 2XWBB 5K9QG 3URBA 5DD1H 2PD5A 4N8CH 4NVTA 2WLLA 3DWTA 4Y19D 5D7IF 3QDJA 1S3RA 3QHOA 1LDSA 2FX8H 3HPAA 4W9GC 6XIAA 4YPGB 1QATA 3GVGA 1H60A 3VDHA 1JSYA 4TVSa 2ZUUA 1DQLH 4JREC 1CXKA 1M03A 3EX1A 2ZTBA 2JCCE 2POZA 3JWDC 4I87A 5FKAA 2QFPA 1E9ZB 4ETYA 4OECA 3EOLA 1FRBA 5C7HA 1J8KA 3UJEA 2WXNA 4I9TA 1ONXA 2HVJB 5JOPD 2W07B 3UXLA 3AIQA 2BWDA 4XBMA 2EEDA 2WZ6A 5FF7A 3VXSE 2P8MB 5SX5H 2RCSL 1R87A 1J5DA 4B4FA 5GGSB 2OCZA 2E75C 5BZWA 1BOGA 2DEYX 2E86A 2P53A 1EDYA 5JNYA 3V1PA 2UV3A 4HUUA 4A7SA 1IR2A 4Z5RB 2AQ2A 1A4MA 3ULUF 4N2CA 5I6PA 4ICNA 4IUOA 2BX5A 2R9HD 3SCUA 1MREL 3SKUD 3IJSB 2DT3A 3WHXB 4DPCX 1GGUA 1MHEB 2CHZA 2H9GA 1EPXA 2DZTA 2G4FA 5LA1A 2CGZA 4EUPG 2GGIA 2CKRA 5C08E 1KPRA 4JQXC 4PG2C 1ZFJA 4LEOB 3CPRA 1G7PA 2IKGA 4GAYB 1KEGL 4GXMA 1DTUA 3FIGA 1QOXA 3RY6A 3H22A 4XI5C 1UWQA 3OVPA 4FX8A 1I85C 2XZZA 5E8PA 3FC8A 3TZFA 3L7FB 3R4IA 4MPKA 1JGDA 5I8EA 3CYJA 3HA1A 4RWHA 1A5BA 2BCMA 1GGOA 1YQVL 3QARA 4R4FL 3O2LA 3UR8A 4X83A 2V8MA 4N4QA 5XINA 1HO1A 4PRPD 2PYFB 4ZQKA 4QJ4B 4WW2F 4D1JA 1KCUH 4X6FB 3UPCA 4N2MA 3RGBA 4BF9A 3LPPA 3H4XA 4D8PA 2P52A 4N26A 4LAQL 5D93B 2NY5H 2VO8A 4BZ2L 2BIHA 1JGMA 3CUFA 1QACA 2OBGA 2GY5A 1DVQA 1I8IA 2PP7A 1B0IA 3QHZH 1SGJA 4NJIA 3TQPA 4Z7WB 3NEHA 2PDJA 1U91B 5HA7A 1GA2A 2ZUQB 3JWNE 1UXSA 1Z7JA 2DQMA 2QKIA 3QUZA 5SWSB 2OQYA 2UWFA 3MFFB 1DFBH 3BSZL 4PJGE 4QTHB 4YBLC 3NQCA 3HN3A 4KAQH 4PJ6A 4LSUH 5IM51 3KOYA 4G70B 4I0PB 4XN7A 2DSWA 2NQLA 4MCZA 5MEPB 3X1GA 12E8L 4PEEA 1CFBA 1TJIL 2C14A 1E2VA 2NQ9A 5C5YA 5DUML 1EX0A 1KIPB 1KXVC 2ED9A 4CBPA 4PJIF 5JW5A 1AW1A 1CD0A 3U0PA 1EUUA 4PJAF 3AZSA 2X6BA 4K71B 4ENED 1A21A 3LQAL 1LD9A 4G8GA 3PWNA 4RWYL 2FPYA 4KCVA 3VZXA 1WO2A 4UF7C 3VXPA 2BJMH 1RY0A 4J1OA 4YTRA 4H8WL 1JDAA 4CADA 4AIBA 4I5RA 2J25A 1XCTB 3DIFA 2IH8A 3QCUL 3QQ4A 4KEMA 2R8SL 3XISA 3DV6A 3RWFA 1HJCA 3UZ5A 3NIGF 4LEQA 3QNYB 5K3VA 3F62A 4AIXA 3ECUA 4ERSH 2QGEA 3IUDA 3C60A 2RB8A 2MQ0A 4LWWA 1M1XA 1Q94A 1WCQA 1OTUC 4JN2B 1NCAL 2JB6A 5AB9A 3CUZA 3UTSE 4LBEA 1FNAA 1RUAL 2E6DA 2YCKX 3MP5A 3SSGA 3E9TA 4P2RA 2ZOKB 4FADA 4HLZH 1JMZA 5GZND 2WMFA 4JJOA 4PCFA 1BECA 3Q0HA 3CMOL 4F7CB 1U8NA 2QJGA 4LBSA 3I2CL 4J3ZA 4HS6A 1P9MA 2AJ3B 4I1NB 4MTMA 1MCPL 2GJ6D 2VXVH 4PJFF 4OGYH 4WK4B 4M1DH 1OAUH 4DCQA 5CJNA 3QXBA 1W91A 4XIAA 1MEXL 2GHWB 3KJ6H 4PJDF 4P4KD 4ODTL 1EJUC 4I77H 4LVHC 4PN6A 3WDIA 5AG9A 3WLWC 4PU2A 4QHMA 4LCQA 1R3RA 1ZBCA 2NCMA 1FNHA 1UYWH 4JGNA 4UDTB 4DH2A 4GG9A 3UXDA 4AIEA 3MUIA 5ID1B 1S7VA 1WGVA 2NUPB 3GK8L 1SO4A 3KTCA 2FATH 2R91A 1FQ0A 1TQBC 1X9LA 1FZKA 2JLPA 4Q8BA 3K72B 1LM1A 1ONQB 2DSZA 4HHMA 4Y9CA 4ZW3A 3EZ8A 2XN9D 3SQOH 3WHE1 3ORWA 4XMTA 1HXMA 2GKIA 1MG2C 3FUFA 3KGTA 3MR9A 4S1RH 4ZS6C 4G8GD 4E41E 4UILL 3VW3H 1TUXA 4KW2A 1BEUA 3AU0A 5LIYX 5E99L 2YEVB 1OF2A 3NSDA 2V7NB 1MFCH 2FX9H 1XDMA 5J5RA 4CSZA 2YAOA 4EPSA 1A6VH 2AEWA 5F7FA 5DRNA 3DJ9A 3WL9A 4G8EA 5HJ3B 4AYFA 1PW3A 4MKSA 5FW7A 1JPMA 4BWWA 4TXEA 3F5KA 1NFAA 1XF3A 3X3GL 4C59B 3UABA 2WNXA 5E6ID 1RCXB 5H94B 1YEIH 1R6VA 1Q0XL 4G56A 1XR9A 3IFOA 4U1MA 4CC0A 1A5KC 3KLAB 1TIMA 5A2LH 1TTBA 1XIMA 3SO7A 1YYML 2OJEA 2WBJB 4RBPH 1KRMA 3NSFA 2ROXA 1G9EA 3OKDA 2PF0A 4MFEA 2B7OA 2WXFA 2A2IA 2YBUA 5IDIA 3KAOA 2QHRH 5EC2A 2CLHA 2C79A 2PCFB 1QRNB 1TV5A 4WZHA 4UTBH 2BRRL 5HBBA 1U3HA 3M6DA 4Q74A 5DD6B 4BQCA 3GBMH 5I1KH 3F58H 4UDUB 4YN3A 2MCPL 1EX5A 2PTXA 3KH3A 5E7FA 4GT7A 5CGYD 2KH2B 3W82A 4FFZH 3LEPA 4LB3A 2A3HA 2G60H 2KPNA 2W61A 3L9RB 3ZQWA 1I1FA 3L5AA 3QN3A 3TIDB 3O4OB 2Z31B 2VDGA 1V7NH 1UM5H 3B3BA 1DFXA 1FVEB 1MHHA 2P5EE 4YOKA 1RHHB 4LLAA 2WLNA 1ZPUA 1EHKB 4N85A 5A3ID 5HJLA 2ED7A 3CFDA 4LPYA 2DV0A 2C19A 4KVCH 3RY4A 5J0BA 1DBJL 1BPVA 3L68A 3MLUL 3MCG1 2AHIA 4JXCA 1S7RB 5IEKA 3QEHA 2CIKB 4U0QB 4QLWA 5JXEA 1NCUA 3E7JA 1IM9B 2HFEB 5F7DA 2QT6A 2O55A 1UCBL 4EF9A 1C9SA 4HMEA 4MGGA 3KPNB 3G8EA 3POHA 1FFTB 4JTCA 4KITB 4PJ8C 3ZDZE 5CEXB 4L18A 4EWJA 1L7TH 1EDQA 1EIBA 4G8IA 1C5CH 1CK0H 3RWCB 4MSWA 1NWTA 3VQ2C 2PWHA 4IQLA 2APWA 4C90A 3L3GB 2QQNL 1DVYA 1UD5A 4OZHF 3WTYA 3FU9A 3H2NA 1OD9A 1XGTA 3RCYA 5DWPA 3CDFA 4IQEA 5IB3A 1EJ8A 2FJFB 2ZCHL 3A5FA 4MX7A 2JKRM 1A3LL 4RRPA 3RVWD 4JFZH 3RYMA 5DHMC 3VFGL 3VWKC 5I1LB 4LIQE 2WCAA 1HHGA 5GSVB 2WMKA 4Q8NA 1Q0EA 3QQXA 5BS0B 2CWXA 1KLFA 3ARWA 3CUPA 4Y1AA 3DEQA 5E5CA 1JZHA 2VDML 1DVXA 4NPJA 1HOCA 5CIPB 4UTMA 1PAZA 5FD0A 5JLZB 4IOSA 1SJBA 1L7IH 2NLJA 2CR0A 3ZUNC 3SCTA 3TXZA 3HS0A 4BUQA 4YBQC 1P7TA 2Z1VA 3NBNA 1KLUB 3OMIB 4DUVA 4IMAA 6ENLA 4RDQG 1F0LA 1N0XL 3ZZLA 2HVKB 2IEPA 3I6GA 3H85A 3SJVB 1RFDH 2ZYRA 1RK6A 4ANWA 4HNLA 4GMTL 2CITA 1Q90A 1YIXA 4WY0A 3P60A 4H25A 1CIUA 3VNJA 5DJXA 3TR9A 4OFPA 3W00A 2P8PA 3MUY1 5BO0D 1XD1A 4FHKA 1JP5A 3HS9A 4KX7A 4F27A 5JXED 1HJQA 4LHUB 3M0XA 3SQMA 5DC2A 2Q09A 4K6AA 3GSXA 1A7BA 4XHQA 2BIOA 1BXXA 3STLB 1FJ1A 1MW0A 1OAQH 4R6UA 1FNLA 1QNQA 4PJHA 1G5GA 4F0KA 2XWTB 4YDIH 2Q7NA 3H3KA 3LKSA 2VOMA 5EPMA 1TJMA 3G8RA 4FS9A 1KLFB 1FC1A 4WTZG 4JLRA 5C0BE 2DQJL 3ZYZA 4ZL1A 3PP3K 5IOBA 1O5QA 2HT2D 1U2YA 3RKDC 3EJZD 4MXQC 2DF3A 4FNPA 3ZSTA 4AEOA 2V17L 3VFPA 1RVGA 1T0PB 4YHOH 1IGJA 1ZGLB 1UBSA 2P47B 5JW4N 2IPKA 3ZS4A 4MSWB 5IBUB 1NAMB 3PULA 4PRRA 3KCPA 3KBSA 4HH9B 4LHUD 2PYED 4GEIA 1PFOA 3QIBC 4PJ8A 4XMUA 3EYFA 3ZHLA 4PR4A 4QITA 3OKOA 3S9ZA 4F58L 5HHQB 2FVMA 4JYEA 1WAEA 4IOFD 1R2RA 2K9UA 4I5BA 4A6GA 3V0SA 2FPVA 2XGZA 1JPSL 2AXJA 2O5ZL 3EJYC 5D7LE 1W32A 3F00A 2CIKA 4YFLF 1DWFM 1A4AA 5E6YA 2F19H 4TNGA 1I1AC 3BQ6A 2IALB 1PGRB 5E4EC 1LWJA 4NFBA 3N12A 3QBTB 4AQAA 4QG8A 5D2WA 3APYA 3SPCA 4BQ4A 2AXGB 3QR0A 4UINH 3SB0A 1O66A 4BK5C 4TL4A 4D71A 3QZWG 4FP8L 2J66A 5E0KA 1T6BX 1DORA 4E36A 2OSYA 2A6KA 3MLXH 3SIMA 1L6GA 3MOQA 4FMKA 1OC6A 2JE8A 3HMWL 3GFXA 4C5ZA 3PPEA 3JUZA 4GMTH 3DMMB 5LJYH 1S9WB 1NF7A 2NTSP 2PCPA 3AZRA 4D94A 2VFGA 2E47A 3C2EA 3M16A 1ZHNA 4S1RL 3TYBA 2I85A 3LKRA 1AZZC 1P4LA 4TYUA 2F8VA 2OR7A 2X1QA 2LHAA 3DJTA 5KANG 2VM9A 2EEFA 2KHAA 4FQ2L 4JJ5A 4AG4H 2VJXA 1GVQA 1BVNP 2C18A 4WI7A 4MA1C 3DRQA 1ZGLP 3FO0L 1JV2B 2QMKA 2B08A 5DVPA 4Z3EA 4JFFD 3KLAA 1IC7H 3VFTA 4F2UA 5LBGA 1WHPA 3UZVA 4WI0B 4A7GF 4PS3A 1J5TA 1W5QA 2HTLC 2P8CA 5BW7A 2WN3A 3FU3A 1E56A 3PPHA 1FOBA 2BOBA 3IGUA 3X3GH 4LNYA 4XZBA 4JFEE 2PXYD 4QM1A 1X9UA 4GIYA 4UTFA 3WCYA 4HIPA 3IMBA 1U5VA 4V11A 4FXFA 2AJXL 4JY9A 1U36A 2YPKB 5CLWA 4PRNB 3TT3H 2GZXA 2OKOA 2YCJA 3N25A 2G5RA 2CZVA 3DFTA 1N9PA 2X3CA 1DVZA 3BPNC 5C3IA 2FQEA 4IOTA 2CLLA 5TE6L 4PW3A 4QIUA 5BRQA 2NZIA 4FQXA 4GG8B 3TBWA 1UADC 3CB8A 4HX1B 1KGUA 4N9GB 2ADFH 3L9RA 4Q7IA 3UG5A 2GABA 4UR8A 4XAYA 2QQKH 2IV9A 1G0YR 2FLBT 1FO0A 1HU8A 4M1GH 4R8WH 3B2MA 2ODOA 6TIMA 5F7KC 3O45A 5H37G 3CWOX 4RL3A 2VDKH 4QRFA 5EU7E 1VLIA 3ROLA 4P2QD 4E9YA 4W9CC 2HRHA 1QYGH 1KCLA 1F11B 4IJTA 5FYLD 3V4PL 4B9FA 4JTEA 2WPGA 5EC2B 2BP8A 3KUMA 3C0LA 2YOAA 4EDWL 5HDOA 3ENLA 3W6LA 3WLTA 3FHEA 1K02A 3HGOA 1WG3A 1GGCH 3FSZA 4I88A 3UZXA 2GPZA 2IWFA 4HWNA 5DYOB 5CEZE 2VGFA 3K2MC 5D2NE 3QFDA 2HNEA 1NDGB 4K3EL 2J88A 4ZUUA 1YXDA 3R06B 1UWEH 1CIDA 3AHZA 3ESMA 4YIQB 5F6HJ 3VIIA 2JCCB 2R9HC 5A1AA 3TO2A 1OP5K 1PLGL 2G2RA 3BFQG 1HILB 4UILH 5F7BA 1O94A 2J7CA 4RFEB 2DKSA 1ZALA 4KS0A 2BIMA 4X9HA 4BFAA 3GTTA 1G7JA 1PWMA 1D9KB 2Y1VA 3WBAA 2YLAA 1UD2A 1X5HA 1SBSL 1P6CA 4QRRE 4IRJA 1JCMP 3QUMB 3PWJA 1GOKA 3RJOA 3LZ3A 1LT8A 1Y0LA 3KJ6L 2FO4B 5JIDA 3NO5A 3UVAA 3NRQA 1TTAA 1KCUL 2ZD0A 3NZ8B 4DF1A 1VJSA 4EXPX 2XRAH 3QJVB 1BFOB 5T9BG 3W07A 4JM2C 1EUTA 1TIUA 4GZ7A 5JXAH 1XGUB 2CBOA 4MLSA 3VFWA 1LG2A 3MWCA 1R5IA 2F8OA 2R4SL 4LNVA 3BPCB 5DWUH 1LHZA 2R29L 1BXVA 3DMMC 2XUWA 3PUEA 4BFFA 2AMUA 3AHTA 1CXHA 1DVJA 2OMVA 3NOEA 1KGCD 2OMYB 1M05A 4TNEA 2WMIB 3LCLA 3BH9B 3THMH 4RISH 3F1QA 1J6OA 5J13C 4KOCA 1F3WA 1LRQA 3UADA 3GDCA 1Q4WA 2EIDA 3LQGA 2YSSB 3GGWA 3H2FA 3STFA 3TDFA 4A3UA 4U49A 3VG0H 3T8MA 1EBHA 3NEOA 4NCDA 5GS0H 3NGBC 5DJXB 1BDYA 4KKQA 4Z2LA 2H6RA 2VSCA 3O6FC 3BEVB 2Y5QA 1R3KB 1BGAA 2J88L 1KCWA 1GVYA 3BLDA 4JTUA 4Z17A 4N5ED 2OAAA 3SJVA 5AKSA 2H8XA 3KVQA 1Q85A 2IAMC 3A22A 3GXIA 1FE8L 9CGTA 1ID2A 1OCBA 1XLDA 3AHYA 5FEZA 3K6IA 4DZ8A 1RA0A 3GFZA 5F7MC 3O06A 4K7PL 4E0CA 1YUHA 2CJSA 2DD8H 4FABL 1OE1A 1ZHKB 5DC9B 2X30A 3KL5A 3OVRA 1PNDA 4HXAH 3UCRA 2NXZC 2WHJA 1NC4B 2OTPA 1LD9B 3DPBA 2NSMA 3QI9D 5EMYA 3FAXA 2ZZ2A 4XAWH 3SCRA 1VZWA 5JIMA 3UWVA 2DW6A 3L1GA 2VCBA 1A7RL 1OF0A 3ARGC 3Q48A 1JNEA 1VPOH 2YMOA 4B41A 4GQ9L 2ZYFA 1C16A 3WSUA 1OPGH 4HUUB 3R0KA 3HE6A 3OC8A 4AXWB 2OT0A 5GZNC 5L4IA 4S3BA 3SFKA 2MMXA 3W71A 1KJVA 4OM1H 3TH6A 1EQPA 4B3ZA 4BS0A 1MELA 3G7TA 1OO2A 4LU5L 1WNOA 4I77L 3MFFA 4QTHA 4M02A 1TTFA 1V5JA 5M17A 3WD5L 1U3HC 5REQA 3JBG7 5CCGE 3SO5A 2NW3B 3T8QA 1NANI 3C12A 1CICC 3MRGB 4E9SA 3LOTA 3ZTNH 1H61A 4GPNA 3S83A 3IE4A 1PTZA 2TRSA 2PU1A 2WOYA 3NXLA 3LEYL 4L8SB 1FWXA 5AW9B 2NX5B 3MBWA 2DZWA 1T89C 3VKKA 4YS4A 4B2DD 2VW7A 5D2NA 1BVLA 1AW5A 2BY1A 5LG1A 2VUNA 4I0KA 3E9AA 1J01A 5F2FA 3CHCA 2VT0A 1TZ9A 4N3UA 1KBKA 4PBXA 5F9OH 2DYSB 3CFDB 1B6DA 1F4YH 1G7LB 2I32A 3BD5A 4FG6D 3ZDYE 3SUTA 3WYZA 4E0RA 3OMNB 3UGXA 4AYMC 2CRMA 4JQ2A 3T4AC 4M6VA 3K0YA 3T08A 2ON3A 2YRZA 3TEUA 3TO4B 1I1FB 4HD5A 4EKJA 4ZMTA 4ADJA 3A9IA 1A8ZA 1MWAH 4OI8A 4OVXA 4AC1X 5A6JA 4GXVL 3H7LA 1AD0B 3QS3A 1QQDB 3MOBH 1LLAA 3PABA 4FR6A 5E2TH 4LLUB 4P0DA 4HPGA 4HBCH 2DM2A 3GDMA 3E0LA 2JSFA 1JHKL 3FXYA 2QCDA 5EBWB 3MX0B 4Y9EA 1VR6A 3KDOA 4JTFA 4O54A 2LU7A 5F7AA 1CB4A 4MZRA 2CLOA 3O6AA 5LGKA 2OM5A 1JZ6A 3SM0A 4L4OA 4DPRA 2C15A 3QI9A 2A3CA 4PSRA 5IESL 2W0FA 4PRWA 1I2OA 3VI4F 1M71A 1BZ9B 4HAGA 2ZVIA 3QYQA 2X7LB 7XIMA 3USBA 4HK3J 3RUGF 3NVDA 5DANA 1CGTA 1JI1A 2XWCA 3B7TA 3F7PC 3HE6D 5ID0B 2VLRA 3GBML 5I1KL 3MDWA 2VQTA 1K3UA 3U4FA 4XPTH 2FBOJ 3DSNA 2HVJA 1CT8B 1C90A 3BVWA 4MDRA 4Q52A 3WFBH 4V28A 2NXHA 5CSGA 2IAMA 2ITDB 2V5MA 2XSKA 4YZWA 2ZE3A 4G7EB 4GUGA 1AO7B 3CFBB 3X12A 2AL2B 1SEQH 4FXKC 4RSVA 4GGHA 3N0PB 2F19L 1EEYB 1YMMD 2OV0A 4U1JA 2DWEA 4IJ3B 5DQ9B 1JHTB 3GSOB 3S3SA 2Z00A 3QYSA 1BZ7A 2HJLA 4NN7C 2VX5A 4LKXA 1OE3A 1J9QA 1DIKA 4QEGA 3LZLA 3BCJA 3DENA 3UWEA 4GBXD 1PYWA 3NZUA 3TCLB 2ZX8A 4WKZA 2ISSA 1FFQA 2YXFA 2MOVA 2GTQA 2O5XL 3P0VH 3SZKC 3K2GA 4M80A 5AYUH 2B14A 2YKLH 2MRYA 5ABGA 3NQBA 4EI5C 4QJ5B 4JQ3A 4W6WB 3UAJA 5I1AB 1ZY9A 1W8SA 1FWFC 4YHOL 2KC0A 4H8QA 4O02H 5CBEB 3W38A 4I9AA 2QQNH 2Y5TA 3WQVA 4E68A 3QDGE 3BKYH 1X1OA 3OZ9H 2DBJA 4DTGH 1TNMA 5IJBC 5I1HL 1EUNA 2D20A 2PSNA 4GRWB 1K3ZA 5FCSH 5E08H 1QO2A 2VN4A 4ELMF 5JORB 3HE7B 1ONWA 4ELMB 1F8TL 2I57A 4PRHB 2CZEA 2NUXA 1KCZA 3VUAA 2ZWLT 3QUYC 1BX2A 3VD0A 3LGDA 5AVVB 3FZUC 3G9VA 3MOBL 3NCCB 4LCCA 5JDSB 1D7BA 2BERA 4MJ6A 3UPWA 2F1BA 3WD1A 1DVFB 1YCSA 2B1HH 3T4AA 4GCXA 4TUJA 2VLJE 5B3JF 4ICWA 4HD9A 4F0HA 2WANA 3VOFA 3N3EA 1K1DA 1ND0B 1JZJA 2YQBA 2ZUWA 1RZ7H 3CFTA 2AGTA 3M9YA 5T9CE 1FWJC 2EKSB 1MUJA 1ZLSH 2X4PB 5B8CA 3F84A 4WOQA 4Z3GA 3OL2A 2QGHA 4XP1H 3DXAA 2B5IB 4OGXL 4Z0XA 1RZGA 1NWRA 3SBFA 4BH8A 3ZWSA 3KXFE 5FO2A 4FJ6A 4HS8L 4K3DL 5E6RB 5MEQB 1RHCA 2NV1A 3AZTA 3FA5A 4RE0A 4X22A 5F2MA 3MV7B 3WDPP 1UWFA 4OZIF 4HK0B 4LAOA 5EZJA 2HLFD 2TSYA 2CBQA 4JDVB 3WIFB 1KKRA 1YW1A 2EILB 2I7OA 4FNLL 2B20A 3FFCD 1HJUA 5EIIB 4CAGA 5DJCA 3GW3A 4DAGL 1XH0A 3MGTB 4Z0SA 5C7XH 3IIVA 3OXSB 3ZO9A 3PIQB 4KQ4H 4JG5A 4NRSA 1SY6H 4GRWH 4C4UA 1QNZL 2KX9A 4NKDB 4X0KB 3NP3A 1C91A 3G3LA 3UIYA 4O2EB 2HKAA 3OD3A 1RLCL 5G4HC 1TEYA 1WK0A 3C6LD 3BLBA 1CF8H 5C2UB 2VQ1B 4HIEA 5HHVL 5I0DA 5EUOA 4Z0XB 3TFXA 3A3HA 5KZDA 3II2A 3Q37A 5JW4R 3WF2A 4S10A 1Y6MR 4M9PA 2CIIB 1XGRB 2R2HB 4KUZH 1HQ4A 1ZNNA 1LLWA 5A8QA 5D7LD 1B4RA 4FABH 3LSBA 4ZYKB 5IMOA 2WZTA 4MYXA 3NIDB 5L4MA 1ACZA 3ARZA 1IIGA 1K4HA 1WUEA 2V4LA 1YADA 2FSDA 2GFTA 3GUWA 3KZPA 4U4BA 1DCEA 1P84J 2GTZA 5JDSA 3IJEB 7PAZA 2E7FA 3KZSA 3GMOA 4PJCA 4I2XE 1NIUA 1EWEA 2E9JA 5D4QA 3E0WA 1M7OA 2HX7A 4OLVL 5GRYA 1IT8A 3NCJL 4HWBA 2VXQL 3VD5A 5J6GB 1YDOA 1KRBC 2BTMA 1G4SA 3GK0A 3MBEC 3RWDA 3R8QA 1HJSA 3OSKA 2F38A 3UR2A 2A0LC 3SN4A 2IH9A 2TSAA 4H44C 4MQ7A 2V3DA 3EIFA 4AZBA 5IVOA 4ZFGL 3JT0A 3THCA 2GT9A 1KTNA 3ESVF 1GKEA 2L4OA 3TKFA 4C6KA 2WBJC 3GHBH 3ZU8A 2EPKX 3P4NB 4DEFA 3GU2A 3BARA 3I6EA 4GKZB 3S36H 3FCSA 3QJOA 1KG0B 2VDOB 3ZDWA 1XB6A 4AJWA 3VQMA 4JKLA 1OPOA 1LILA 2R69L 3QIWC 2ZNWA 4QKXB 3F6LA 2R1YB 5EU6A 4XPFL 3ILQC 2CHOA 4H6EA 5E1HB 1F41A 1XEUA 1MH5B 3H26A 4X2PA 2UBPC 3LXUX 4K3EH 1Q45A 5AW2B 3AYVA 5E9DB 4XIMA 3CPUA 1M6OA 1NPJA 3ARFD 1TZHB 3MRNB 5IT2L 3WQ5A 4NEHB 3F2BA 3MP3A 4JFPA 4QTGA 3P67A 4ODSL 3FEMA 3KDMA 1KW1A 1DE4B 4QXWA 4H8WC 3QZAA 5F4XA 4CD4A 1LMIA 2KKQA 3EDFA 3GW0A 2ADJA 4K0OA 2ZZ3A 2AEIT 2VDLL 5KSAC 3IMUA 1B3OA 1MWAL 4GW5A 2CKBB 4KQ4L 4XBPB 4IL2A 3D18B 3DX0A 3OR7B 1BCIA 4WWNA 4KWSA 5SWSE 3UJSA 4KXDA 4UNTA 2ISFA 4ZQTA 1E9OA 5E2TL 4AK2A 1T7ZA 1XYMA 4M8QA 5J06A 2BJML 3CIWA 4XV0A 1FHVA 3S3BB 2MKWA 3O6YX 3GTNA 2OGJA 2X4UA 3O41B 2FLIA 3FU6A 4JHWL 2J3SA 4OSUH 4LSTH 4R0LB 5I66B 1H7WA 5LNUA 4LP8A 1ZPTA 2AGJL 3TFCA 4N2KA 4C4BA 5L4FA 5D33A 5DWUL 3S2JA 3ARFB 3PDOA 5IK3B 1XIWC 1P7HL 2RHGA 5IW6B 3WQEA 5I2UA 4HP5A 1ECZA 2ZKHH 1JZ4A 2FUTA 1GKQA 3WLRA 1RVFL 3PWPB 1IWPA 4ZPVB 4NJAH 4P3DB 5AVUB 4JN6A 1E28B 4NWTL 3P54A 4JEJA 5KSUA 4LLUA 2GFBB 4XBEH 1KCRL 2ATMA 5EWIL 5SWZD 1H09A 1V7AA 3BGGA 3N73A 5K4XA 4U4MA 4JPKH 2JBMA 1MFEH 4PB0L 4ZNCD 5DUPH 3T0BA 1LEIB 1GXEA 4OV6F 3K5RA 4GD0A 1GC1C 1PBYA 1WIPA 3VG0L 4D8ZA 2BVOA 1B9KA 2PP1A 2XSXA 3WH7A 4UTAA 3VNMA 2CCWA 5AAPA 4JZNA 4UBPC 1G1CA 2Y36L 4IIZA 3ONBA 3WMLA 1GVIA 2I07B 1UVQA 2WBKA 4I48B 3AITA 4WTWA 1JAEA 4MUZA 3ZMRA 1Z1WA 5AW7B 3LCWA 3WQCA 3KPMA 4PR5B 1OEPA 1E27B 1GOGA 5ITBH 3BN3B 3SE4A 4NCC1 1CB7B 4NQEA 2YKLL 1UD3A 3MO1B 4LSQL 4HH8A 4NQDD 3U2SA 2F5AL 3GD1C 4HXAL 4DVRL 5SWZB 3SDDB 3EHBC 1I60A 2YPLB 4BWLA 3QZOA 3GQYA 5D96C 4FQIH 1CYXA 4H8VA 4Z2KA 3GUTB 4ZZ9A 3HMXH 3MBEB 3X3FL 3SDAA 3SE6A 1KBVA 3WO4B 4P7OA 5D9SB 4IKKA 1ECEA 1MNUH 3IIZA 1DQMH 4FOKA 2G2RB 3QEQD 4MNJA 3W70A 5C6WH 4HFWB 2E4TA 3FRPB 4K3HA 5G55A 4BFJA 3LEXB 3HC0A 5FV1L 4PJDE 3VE0A 5DRCA 1UC5A 2WYTA 4JPWH 4N87A 3L5HA 1LL6A 2XPKA 4MJIE 4MA1B 3LLFA 4PB4A 3C6SB 1H5BC 5K1VA 2A6JB 4US5D 3N3MA 3RKPA 1FH2A 4HLZG 4PGLA 1T04B 4FEIA 3AJXA 5D05A 2H3BA 1EL3A 1NCWH 5JQHC 2YCEA 3LRGA 4PREA 3BIKA 3FQWA 4AK1A 3A4EA 1F11A 1NCGA 1S5VA 2ATKA 2F6UA 4LLVB 4NNXB 4PW4A 4XP1L 3V5CA 2XWEA 1UWAA 1NOUA 1J1PL 3BCDA 3CPLB 4NZJA 1N67A 4OFIA 1ASQA 3RFRA 1HH6B 1CXEA 1BVWA 4GPVA 5I5MA 3ES6A 3QUMH 2R1XB 3P0YH 4JBSA 1AS6A 5JUEL 2B7QA 3FO2A 5TBOA 4XO8A 3FCBA 1GVOA 3WZ0E 3W0WA 1HCYA 1U3JA 5GS0L 2VDRL 3IXTB 2J4GA 3B9OA 3S0CA 4PJEB 2INEA 4XG1A 1ZLUK 4XUGA 1LQAA 3P77B 3T77A 2HFGL 1VPYA 3MLWL 1FTXA 2J79A 3W9ZA 3GQFA 3VWJD 3DBNA 2IBZY 4FFWC 3MPCA 4WNJA 1YXCA 3WD4A 3UZZA 4JD4A 3IFPB 4FYTA 3LX9A 2EVFA 3MLRH 3EJJX 4BK8A 3BE1L 4K9EL 3WN5A 1Q8JA 3GC5A 1EZLA 4PLKD 3BP4B 2XTJC 4NQEE 4GGBA 3RFZB 3N17A 4B5XA 2JKLA 3AWOA 4LH8A 2XETA 4Y1TA 1MDRA 3GB7A 1F6AB 2CCVA 3R10A 4ERAA 4JUSA 1W2KT 3TYGL 4QGTA 3GR7A 2A1WL 3PNZA 4N0UA 4I3RH 5E51A 2VLRE 3NDOA 3P4OA 2BW5A 1L9WA 5E8OA 5A6AA 2P10A 4R3SA 3CVHB 4M7KL 3IVKB 4JGUA 5F97E 5T1DH 4PUDA 1OSEA 1G9NH 3LXCA 4LEEA 1UGNA 5FYJD 4E9WA 5B8CC 2NQ3A 1W1VA 3HPZA 5D1ZA 4XN4A 1VQTA 4ZQRA 2UY6A 2VXQH 3MZGB 4BGDA 2NX9A 2PBOA 2Y7QA 3W25A 3S5SA 3L08A 3S34L 3DPDA 3F7YA 4RX4D 2IBBA 1X5XA 3EOYG 2DVUA 3WBYA 3R0DA 1N2RB 4ODVL 3U57A 1NUGA 4HJEA 1KEML 3KRBA 3NIFE 1KJMB 1Z0MA 1DV7A 2AXGA 5DFVD 1UA6L 4MXWH 3RCNA 1IIIA 4TTUA 2AEPH 3Q9PA 1OYBA 3OHXB 7PTDA 1XXXA 2FR4A 3P82A 4F9DA 4GAFB 3RWHB 1QTSA 2CBJA 4FLHA 4P8VA 4QXVA 2WMPA 5IR1B 8XIAA 4HSOA 5BOZG 2ZRVA 4JFFA 2D69A 3FKKA 3MMTA 3I50L 4OLXH 3K2KA 1GOMA 5DK2B 5L0QC 1GOFA 3UJIH 5C0CE 4H88L 4KDWA 2YXVA 3BLLA 4O11A 4XZLX 1UA3A 4ODSH 1SLWA 1QLFA 1YEJH 2RMNA 3CBRA 3CFEB 4PRAA 3ARUA 5E8OB 4XMXA 1PSKH 4DVBA 1AAJA 3L4CA 5EEYA 2NWRA 1DQDH 2CBUA 5CZ0A 2G75A 3TA3D 3QV6A 3WLOA 5LNRA 3IJQA 3WQ8A 3KBVA 3F7QA 4M7LH 3ABMB 3EOBA 4LSVL 4TSAH 5G5DB 1R3IH 3QZWB 2HBXA 2APXA 4N9CA 4XD5A 3QIUC 5CBIA 3PY2A 4OF3A 1L6XA 3O6ML 1XAUA 3KXQA 1Q6RA 2MWCA 4PGJA 3WF0A 4JLRB 2XN9E 4OSUL 3QORC 3RO6A 4HWBL 2ERJC 4KOBA 3ECQA 1JVNA 5LCVL 2ZXEB 3S4SA 3W2NA 4PJXA 4NERA 1ZGDA 1OGAD 2TODA 3PTMA 4LAKA 1NCBH 3QUHA 5HINA 4DELA 5DGQA 3L95A 2ATPA 3ZR5A 1SYTA 2PD9A 1QBMH 4L4VB 4XMLL 4O2FA 4NZ3A 2QKSA 3D5OF 1A3QA 1SW7A 1TMLA 2MNWA 4TLSA 5MP6L 2ZZ5A 3MRJB 3TX9A 3P77A 3KPRE 2AI0L 2DIAA 2F18A 3FJTA 5IBUG 3ABOA 4Z76A 2F1AA 2MPVA 3IGHX 3DOHA 3HHMA 4H25B 4DP8X 3CMFA 3QI9C 1SMDA 5ITFA 2J6EH 3DH7A 4WGKA 3MOAH 4PI2A 3AT8A 3W2KA 3T4YB 3W01A 1MLCA 1WBXB 5F71A 3R2GA 2HPTA 5ICYA 1S6NA 2A77H 5EU7C 5BYWA 3WNOA 4MFDA 1Q72L 2DLHA 4Q4MA 2V33A 2JKJA 3P0WA 4EPKA 4NJHA 1G6RB 1A7QL 3PCYA 4DGYL 3AREA 3I9AA 1CICB 4MIMA 3RZCA 4ZA0A 1CDIA 5FDWA 5CD3B 1U8IA 2GDUA 5GJSH 3RL2A 3R18A 4MDJB 5AQ0A 3G6DL 4WO4A 4AWSA 1ADSA 5BNXD 2A6JA 3R13A 4TXVB 4ML9A 4XKYB 4Q9RH 1SMAA 3C2SA 1TJXA 2BY0A 2RIKA 4M6UA 5I73C 2I9LA 3H53A 4JRYA 5CJXA 4Z77B 3WEXB 1F73A 2F58L 4MS6A 4BA8A 4F1ZA 1MYRA 5E4IA 4XP9H 4GE8A 1E6OL 1OE2A 3KJ4B 3NL3A 5FJTA 4L8DA 1AZBA 4TVDA 1IEAB 4M6QA 3FZUD 3WDHA 2APBA 5FUZH 2VRAA 3DZ1A 5D2XA 2JCCF 2YW3A 2NY2D 3G6AB 4F2MA 1CD8A 2LLEA 3O9WA 2AQQA 2OR9H 4I48A 4N8UA 5BW7C 3LGGA 3S36L 1CDUA 4QG9A 4F8NA 4UR9A 2X44D 4OGXH 2WNKA 5AAWA 3LRSA 4URIA 3P3SA 1EGVA 2V2XA 3Q6GL 4GMSH 4KFNA 1ZV5A 5ERWB 4IT1A 2EIMB 1G9HA 4QRAA 3ZYIA 3EB2A 2DQIL 2WLKA 1QR1B 5IF0B 2EKCA 3QPKA 1XLEA 4K8RC 4P57B 5JHBA 4TUOB 3U46A 4H4IA 1BXUA 4XTRD 4YGAB 5D6CB 4AYEC 5EEUA 1FSKB 3TYFB 3FSWA 3FFOA 2QF7A 1PDKB 3V4PA 4GKTA 4LAUA 1U8KB 1QFWM 1UCTA 4P9HH 5E6SB 5MP6H 3OLDA 5C7XL 3SBWC 5DUPL 1ILUA 4HIJB 2ZP9A 3MNVA 5L2JA 4X8XA 5D32A 3N85L 1UP0A 4Y5VC 3CT7A 2QADB 4PUNA 4G71B 1CD9B 2F7IA 4FQCL 2FDSA 4XPBL 4PLJD 3BWUC 3LQAH 5KS9B 1TX2A 4GC3A 3QB7C 4XVTH 1E9PB 1H49A 2CO6B 4PS4H 4Q4IA 4Z78B 2ZUMA 3SKOA 1IGYB 2HRWA 2ZZ1A 4J2PA 4GI8A 2VEPA 1BIIA 3E8VA 3JWDH 5CZXC 4WTZA 3LLDA 4TULL 1MCFA 4PLJC 3QPQD 3MJMA 4C54A 3FCTA 3OVUB 1XCXA 2NY6B 1OK0A 4MCYB 1UH2A 2P43B 4WAFA 4GG6E 1S1RA 2XN2A 2CHRA 3DIPA 5G5IA 1W8OA 4WW2C 4YXKL 3U4EA 1WCBB 3B37A 3II1A 5GRVK 4J3OH 1ZKAA 4XCEB 4A38A 3WTWA 1XIDA 5FKYA 5JQIB 3O2VL 1YJDH 3ITXA 2QSVA 3JYBA 3OBEA 4NX5A 2PODA 4QCIA 4CNSA 3S5YA 4A6YL 2MQGA 3GTHA 2IG2L 2JK5A 1EP1A 2VXVL 5HJBA 2VJ0A 1HJXA 1LWIA 4MD5A 5C55A 3BZ5A 2DJLA 4OZOA 1HXMB 3MR9B 5A6IA 2BCKB 3B2DC 2BNQD 2K3TA 4A7VA 1TYEB 2JMRA 2JVUA 1R2TA 3MN8A 4XC3H 2VMCA 5I07A 1PF3A 2Q3AA 3Q2VA 2PGFA 1VADB 4J3SA 5GRJL 1C5DB 4BHUI 5FUZL 4LFHG 1LP9F 3OMAB 1EO8H 1RJYA 3F7RA 4L9YA 1KY6A 1U92B 5B7EA 6CGTA 5I23A 2IBGA 4EDXA 4YTQA 1HKKA 1AODA 1BIHA 2FATL 1C29A 4Y4KD 1YNTF 2VEMA 3BLPX 5FYKL 5GS1B 2Z24A 4S39A 1Q6EA 4HEMA 5LIKX 3QEHB 4DX3A 3JS3A 5JPNC 4GKZA 3DI0A 3AFLA 4QJ3B 3RF9A 3ZVIA 1NGZA 3HUJB 3IGLA 1J05B 1BD2A 1I2RA 3OX8B 1A5SA 4Y4FA 3KPOA 5HVFB 2VC5A 2NY3D 3B2PA 4ISVB 5M7QA 4HIQA 2J13A 2IXVA 3BOXA 3LM7A 1PZAA 2DZUA 4NAEA 1E8XA 3QHTC 1MNUL 1A0DA 4LVNB 3RWDB 2UUDH 3KR3L 4AC2A 2C3WA 5IKCA 1J4EA 2YMTA 2ZDSA 3ANYA 4PMQA 5TFSL 2Y6SC 1Q3NA 4BWLC 3BV7A 3OBKA 1S5IL 4NPKA 5IOPB 3U0WH 2I1OA 2QAPA 3OPZH 4PMRA 3VI2A 1JV5B 5HHME 2BGSA 3NYZA 4O1DA 5DJ0A 2LU5A 1WA1X 1XISA 2VX4A 2DFAA 4NJJA 1N5AB 1XLHA 3SQBA 3ZDZB 3PPCA 1BOYA 2Y6ZA 3E0VA 1DWHM 2X70A 1INEL 1O5XA 3HG3A 5DZNA 4JRFA 1EJTC 2W0UA 1FKXA 3QY6A 2Q8AH 4KT2A 3BGFC 2ZYIA 4LF3B 3NSYA 5JW5B 4C7GA 1QBML 4H0HB 4EN3B 2VKZG 4Q8QA 2XTSA 4RDWA 3D39E 5KSVB 1A7RH 1GTNA 1HGYA 2ITCB 4I90A 4M1RA 2WZEA 1VGEL 4R90H 3S3JA 4MNKA 2H6PB 3K2IA 3MNZA 5I17B 5SWSA 3UNDA 2VABA 5I8CA 4PB9L 1S9KC 2EF9A 5K2ZA 4XWUA 3ZXWA 3B9VA 1NMCC 2DQUL 5EORH 3V0GA 4MA7H 4EI5D 5HXMA 4ZDHA 5JIIA 1CFQB 1S5MA 4GYFA 4QE1A 4X7DC 2OA9A 1EJVC 1P0DA 3GTFA 4KPLA 4O10A 3MJ9A 4OR1A 3BE1H 1WDDA 2GQ3A 4Y9AA 3LMJL 3TOPA 4Y4FD 3VTRA 2J21A 4IBTA 3S2LA 1ZVNA 3WENA 3AMGA 1ITQA 2CZFA 3IDYB 3NNTA 4OLWL 2IOIA 1K9TA 4QHMB 4DO6A 1IO4C 1ZCOA 1WFMA 2YL6A 3DKJA 1TKWA 4LCCB 3F04A 4J1UA 2CBVA 4I3GA 4TUJB 1MAMH 1E8ZA 1C93A 4BHYA 5HHOB 1R5WA 3WFHA 3LBOA 2PTUA 4JGDA 4G8TA 2F2HA 3OQ3B 3QV7A 3D3VE 5FOBB 2ZOWA 3MCLL 4UQ9A 2EE0A 2CRIA 3FUHA 5FKPB 1X7TA 2F0CA 3QDGB 2Q6WA 1R3SA 4OFVA 2IF7A 3S5LA 5LHDA 2DSKA 3DC0A 3VXOB 5D4YA 3LQZA 3CSFA 4P5SA 1K6QH 4WIQA 4W9IC 3ITGA 4LBEB 4Y16D 3SOTA 5I9QB 1DBML 4IRZA 5G1MA 2D3NA 1ZWIB 1BG9A 4Z5RA 1SXCA 2AQPA 3F2LA 3W11D 1T5AA 2H9AB 1L6FA 4L23A 1M1XB 1Q94B 1NCWL 1KY7A 2HLEB 4Q14A 4F92B 1Q6GA 3AIRA 3MROA 4HBQA 3CPGA 4GBUA 1GMIA 4NY2A 3SQRA 1ONRA 4DQWA 3EDEA 4RGND 2XIQA 4OCMC 5F96H 3MS8A 4X98A 4FIQA 2F54B 3P0GB 2BOGX 1DBBL 2R24A 3TN4A 3H2PA 3OAYH 4UT9A 3CFUA 3D6GA 4NM8L 3NH7H 4O13A 1X5AA 3MLTA 2J5WA 2AJSH 1DJWA 1RSYA 3K74B 3GM8A 4P46D 4MB5A 4J3BA 3U0PB 4PP2B 3B9KA 3EBGA 4IGHA 1RZ8B 4FCAA 1JRHH 4JCLA 1ALDA 1LNUA 1D7CA 2QQKL 2EXOA 1ULVA 3MLYH 3SD5A 2FTPA 4YMPA 3C56A 1KNOB 2R4RL 5CJOH 4NBZB 3SN6N 5BV7C 3PGDB 4Q0XL 1EC7A 3A67L 3ILEA 2XG5A 3DG3A 2ZVRA 2IPUK 2XJKA 4G7QB 4MJHA 1BZEA 4APQC 3BRGC 4OD1L 1MXGA 4O02B 1QCWA 1RQ5A 2PP0A 3EX2A 3F03K 4Z7WA 5GHWL 2W0FB 3W7MA 2ACSA 4HJGA 2TRYA 4NC0B 5LUMA 1G67A 3ZYOA 1R3TA 5ISZD 1E5CA 3IJ7A 3O6CA 4NNPL 1S3KH 1A1NB 3IDJB 5EU4A 3V3WA 4NDMA 1EFXD 1FNGB 3MACH 4G6AC 4IQHA 2KZ1B 5JIHA 5C71A 1E1CB 3HS8A 1DXIA 2Z9TA 3OZYA 1MI5E 3BEWA 4M93B 3GH4A 4NQXA 3HFFA 4P49A 4QS6A 4DKEH 2DQHL 4GEJA 2XKNA 4R83A 1GOOA 3N9KA 1DIOA 1OK6A 3OG3A 4L1GA 4QBXA 1C7TA 1I3GL 4A8IA 1RY7B 4P5MA 4A7TA 2WNQA 4PJ9B 2IDQA 2HVMA 2XM1A 2ONEA 3NEVA 2K6WA 5EF2A 3B2VL 3W24A 4OFYD 5EU6D 1LO4L 3VM7A 1QFWI 4Q4EA 1A5AA 3FHAA 1A5LC 1TPFA 3VM5A 4W9FC 2BNJA 1H50A 3I68A 4A8LA 3QFJA 5F9WC 5KINA 1ED3B 4PV9A 3DV4A 3IIPA 4QHNB 1SLUA 1GJIA 2BSLA 5ESAB 4BCYA 1V77A 4PJ5D 2NYYD 5I6OA 5DLMH 1EAOA 1WIOA 2X6CA 3P2BA 4JFDA 2Y0SA 5IGXL 2DSVA 1M42A 1X8CA 4UWMA 3IFNH 3U36A 1A9EA 1EV2E 4MMZC 5DT5A 5FM8A 4ZUVA 2NSXA 1EJ6A 1Z6KA 3O2DA 4E9VA 1M7DA 2AJSL 4H88H 1AVAA 3DIVA 1WYJA 3EGSB 1KXQE 5EC1A 2AMXA 5DS2A 3W57A 3EOSA 3N6JA 1E6JH 2YGOA 3NK4A 4K37A 5HNUA 3MRRA 2D2GA 5MERB 1YEEH 3EX4A 2XHNA 3OBAA 3PWLB 4UWQB 4X7EC 4N42A 4FMFA 3Q8FA 1H19A 4HKJB 3P80A 2QSCH 3GXDA 5CZSA 1T89A 2WBGA 3TFKC 2F5BL 3P9LA 4P23A 5AAMC 3T6VA 4U1IB 4TULH 2LE9A 2Q76A 2LU3A 5LIUX 1AGBA 2XWBA 1A7NL 1PFCA 1MREH 1OIOA 2Z7UA 2CGYA 3RJQB 3E3HA 5KBKA 1IKFL 1RK0A 4JTTA 1NL0L 2OWWA 3CEUA 1O7DC 4C83B 1VFFA 4O15A 4MAYA 4IJCA 3D09A 4YX2H 3GC3A 3Q13A 3DHPA 3E38A 1CPUA 1EJFA 4O00A 4WGVB 1RA5A 4CQ9A 3HZYB 1KBPA 3EF7A 2DWDA 4GRLA 4MLJA 4R85A 2HXTA 1FVCA 2YD2A 2FYVA 3PHOA 4YDVA 1FAKT 1JK8B 1HESA 3KPLA 1KO0A 5DZJA 3FQXA 3SGZA 3HGRA 4RIRB 3REWB 3M5ZA 3BFWA 4H8UA 4NO3A 2C9SA 4URKA 1NQBA 5D6DA 3GMPA 3JTSA 5D03A 5L2JB 1H7XA 1T0NA 2FDMA 2DOCA 4DLMA 2CHXA 4UTIA 2FTWA 1KXTA 3SGEH 3FOLB 1OCZB 4HJUA 3VGAB 3U46B 3VTTA 4YE0A 4GKNA 4LCWE 2J7GA 3GVWA 3O3RA 1XGUA 2YUWA 2BGNE 2OMZA 4F0LA 2YN3A 4K3GA 4EUPH 4K8GA 3TCEA 3QE5A 4Z95H 3SE4C 5I19L 5I3JA 1YY8A 1MRAA 3TXVA 2GBUA 1TLKA 2AQNA 2FQDA 5I76A 2D7QA 1FNEA 4AKPA 4ZZKA 1CDHA 2HG5B 2AKRA 1QRQA 3FOMB 3GJEB 4NQTA 1UR1A 4QISA 1EXBA 4H9TA 4WDTA 3BAJA 4GJTB 1UOWA 3RZWA 4QRBA 2ARJA 3ZBMA 1B4LA 3WQOA 3C6LB 1HILA 4PJFE 1I1YA 1W72A 1Q0YL 1WLHA 2AEQH 2G5BA 3EHBD 5FK9B 1MCSA 1XFPA 5E1AA 4DUOA 5D37A 4WFGD 1EF3A 3BURA 3WIHA 2VC2B 4Y9NA 3CMGA 3N18A 5A2FA 4PJCF 5CXPA 1HUVA 1T2JA 1ZWIA 3TYEA 4FTVB 4U1NA 3T9WA 4N0YL 1F3XA 4WVXA 3SJNA 4IIQB 2QDGA 3ABSA 5ADPH 4LSSH 5D7SH 5D93C 4X0NA 3CK5A 1IE5A 2KI6A 4M19A 4FLRA 2F6XA 1EH9A 4UNUA 4IMCA 4JN1L 1US2A 1QZNA 2FSEB 4X4YB 2CU9A 4QRRD 2XQ0A 2AK4A 1WKYA 1S2UA 2FZ8A 2PTDA 4FS0A 2JKTM 2BMKA 4OFDA 1FNSL 2ICWI 1TTRA 2VLKD 3ORJA 1OY0A 1V0KA 4C7FA 3WUWA 4B9JA 3MTXA 1IXOA 4D6JA 5GZOC 4NWTH 4ERIA 1BQGA 3QV9A 3OKMA 2VDNL 3WFBL 2SEBA 5MENA 2A7NA 3SN0A 4C6OA 2NT0A 4PULA 2FIKB 2WLJA 4ADGA 1EWHA 1U8OB 3B34A 5F44A 3TM6A 2V67A 1XIIA 3QWOA 4I4WB 2WUCL 1M9HA 2VD8A 2GK0A 4LQFL 4QS5A 3IU3B 1BZOA 1KN4H 4K7FA 3QRGL 5JHDE 5LBSL 2SFPA 1UT2A 3VXSA 3ISIX 5EORL 4MSSA 1WC7A 4OUOA 4QJ1A 5H8DA 1X38A 4BZ1A 4GC4A 1A6AA 3VCRA 5F4SA 4XSMA 3PR2A 3VXGA 4OIFA 3MSPA 4JPSA 1JE6A 1NDMB 2V5SA 3NCFB 3GMRA 5EBMB 1H5VA 1XPYA 3B0YA 3BK0A 4Z6AT 1WBYA 1ZLDA 2P80A 3KS6A 3UZVB 3BW4A 5I7GA 1S5TA 1LOSA 2FKPA 2VB5A 3GXNA 3QDJE 1H11A 4IXXA 3W02A 3IRZA 1J5OL 3DUSB 4NO0B 5LZLA 5BRPA 5AENA 2H2SD 3EXJA 1IBBA 1QSFA 1WQVT 4I3SH 5CBAB 5B1JA 4LNRB 4YDKL 2XFXA 1OHQA 3W5NA 3WLWD 3C08H 4QRRA 4FG4A 4E9TA 1UIPA 1GVRA 2WSRA 3MHZA 4HG4J 4JFFB 3DURA 4S0HA 1QPNA 4MMYA 3NJVA 3CXDL 6TAAA 5EZIH 2GBAA 5TDPA 3U0TB 1A3RL 1GH7A 4KRMB 4ZG1A 3NM1A 4UB9A 1EBAA 3SE3A 2REQB 1IVTA 4ZO9A 2FT6A 2ITFA 4HVXA 4AY8A 3P74A 5KVDL 3ELQA 4G9DB 1NIAA 4N1EA 3WF4A 3LN5A 1K8IA 3BVNB 3EKZA 1FFPA 1JPGA 3WUEA 1N2RA 5AL0A 3TA3A 1J8VA 1WZMA 4EIVA 3GO2A 4ACPA 4N2IA 2FDBP 3LEVH 5JR1L 4ADIA 1IEBB 5C0AA 5D55A 1AG0A 5AW8B 3V9FA 4LCWB 3Q8EA 1AQDB 4APQA 2PPGA 4Q0XH 3QNZA 1E50A 4M5SA 1L9SA 3U0WL 1TZ8A 4NUQA 5LBSH 1M65A 2DAVA 5KS9F 3ZJ7A 3EO1B 3MYJA 3HI5L 1HQRB 1IGJB 4HU4A 2M83A 4ECLA 3EOUA 1IKOP 3LXBA 3KBPA 4PY8J 3TCXA 3MO7A 15C8L 3UTPE 2NW0A 4KROD 3MSGA 5T1KB 4HSNA 3WN5C 3THUA 3TZNA 3S98A 4QCIB 3E96A 3US9A 1IE4A 1CG9A 3APDA 3NZ1A 3ABRA 4NSBA 3BHBB 4ZZFA 5GVJA 1YNLL 1PZDA 4JMXA 4F8QA 4J3OD 3FUIA 3CBWA 4H20L 1ADQA 5LNSA 3NN8A 4HZLA 4JO8A 4J5NA 4XNXH 2HSIA 1B4EA 3PTQA 1MVUA 3TWCH 3GYCA 4NQSA 4ANKA 5CP7B 5BRZD 4FQLL 2C1OB 4MA7L 4HKXA 3UG3A 2LT9A 4J3OC 5C0EA 1WXZA 3LHZA 1FFPB 1GWJA 3VYPA 3KTSA 1LEKB 1VENA 1WA3A 4HHPA 2J9ZA 2DDQH 3SY0A 5JOFB 3VD9A 3HRZA 3KLQA 1UYWL 2NLJB 3G08B 5DK0A 3GJFB 1FZMA 5ADOL 2Y22A 1M53A 2AQOA 4K4KA 2RUSA 1CGXA 3K80A 5AZ1A 1P7TB 4XCCH 4AZ7A 2JKWA 3TTOA 1NC2B 3MDJA 2Q8BH 1DL3A 2NSOA 4P06A 3BPWA 1G69A 1W1A1 5IT2H 1H5BA 1D3CA 4JQ4A 3VIJA 1LROA 2AJZB