1JXKA

Role of ethe mobile loop in the mehanism of human salivary amylase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jxkA01
2NT0A 1G9HA 4U2ZA 2D2OA 4AMCA 3GXDA 1Y7VA 1H1NA 4PTMA 1B3VA 5DT5A 4W8AA 2YA1A 1IT0A 1KFWA 3U5YA 2VT0A 3QR3A 3EDEA 1UD5A 4KWUA 1ODZA 3MMUA 4PEEA 2VVNA 5A6LA 3EMQA 4FLRA 1H5VA 3WSUA 3BGAA 4EANA 2J7CA 5CGMA 4JAWA 3DDFA 3BMVA 3PTQA 5ABFA 5IHRA 3SCPA 1QHZA 1H0GA 4UQ9A 3L2LA 4LYRA 2UY5A 2OWXA 3ZM8A 2WKLA 2DSZA 4C7FA 1EHAA 4MNKA 3CZJA 1DHKA 1OIFA 1NM9A 2DIJA 1V3MA 2VX5A 3WD0A 1JZ5A 2XIBA 2QLYA 1PEZA 3RDKA 5AY7A 1ZJBA 3BMWA 4B15A 5GNZA 2CERA 3OB8A 2XPKA 3CHEA 2WANA 1QI0A 4UQDA 1BFNA 4NRSA 4XUYA 1WB0A 1WAWA 4W5UA 1XSJA 3VNYA 5CXPA 2DH2A 2G4FA 3VMNA 2W62A 3RMEA 3BVTA 1B3WA 2WMFA 3BSHA 2EO7A 2XTKA 2WK2A 4HTYA 1R75A 2OW7A 2BHYA 3BSGA 1B9ZA 4MB3A 2J7HA 1X6NA 1H49A 3PZNA 2WWCA 4LQ1A 3AZTA 1XV8A 2DT2A 2X2HA 4PMDA 3EJPA 2WVTA 3CZLA 2GUYA 4TTUA 3WNNA 2CEQA 2Z1KA 1J0ZA 2YL9A 1BHGA 3CPUA 3CBWA 2D0GA 3S5YA 1GQJA 3ARRA 1L0PA 1PPIA 1HKIA 4J7RA 2F18A 1O7DC 3GH4A 1GJUA 1KXVA 5CG0A 3WF3A 2G3JA 1UHVA 1JAKA 1GJWA 1W9UA 1WZKA 1UR0A 4WIWA 2ZXBA 2EQDA 3I3DA 1CXHA 3VO0A 4AEFA 2BVYA 3PZTA 3SEPA 2D3LA 4WSJA 2WLYA 3WIJA 3D50A 2PB1A 4MDOA 3VIKA 1C90A 4HZ7A 1LWHA 1BG9A 3TTSA 1V03A 4LGXA 1A3HA 1DWJM 2ZUSA 3TONA 1R7AA 4FNSA 2J8FA 4PMNA 1F4HA 4F9JA 1U33A 1XD1A 3IGUA 4GPNA 2DSUA 1JI1A 4FNPA 3VIMA 3WDQA 4D6JA 3WBAA 4PBGA 3WBEA 3MU7A 2AMGA 1FH7A 1DWFM 2X1IA 1B0IA 1GNXA 2E40A 3M07A 3L4TA 3IJ8A 3G6MA 3T0BA 2X0YA 2J4GA 1CZ1A 1GONA 3W82A 1VF8A 1Q4NX 3UG3A 2DSVA 4CN4A 1V0NA 2Y5EA 2VCAA 2W92A 2WZIA 2ZXAA 3VIIA 1NARA 4TTGA 3T08A 1AMYA 3QOMA 2Y8VA 3OGRA 3B9EA 2WVVB 5M5DA 1P6WA 3BUIA 3MSDA 3UCQA 3BLBA 2XWDA 2WM0A 1XD0A 4Q7NA 4QDMA 3FAWA 3ARXA 2J75A 3WQ5A 1NH6A 4AXNA 3VDAA 3D5HA 2OSYA 3LXCA 4LYQA 1R33A 4AZBA 4IUGA 2D24A 4PMZA 1XH0A 4HU0A 1E6RA 1HL9A 3WD3A 2JIEA 3VGDA 2QF8A 2UWFA 2F1AA 2VZUA 4UQAA 5BXSA 1SYTA 3WY3A 3GBEA 1ISYA 1J0IA 3BAIA 1W9PA 3SUSA 3VD4A 1WO2A 3PHAA 4PUEA 7A3HA 3A6OA 1UH4A 4JIEA 2J74A 2OYMA 1WP6A 1TUXA 2WCAA 1GHRA 2A3CA 4NZCA 1K6AA 1CGXA 4TX6A 3VD7A 3LMYA 4U5KA 5FKYA 2WZEA 4MTVA 1CXIA 5EMYA 2FHBA 3ZJ7A 3CHCA 3FY1A 2CITA 4LYPA 4AIUA 4JCLA 2CBVA 2XVLA 3QGVA 1EH9A 5CPSA 1EA9C 2E8YA 2E0PA 1CXFA 5KZ6A 2WMJA 4UQBA 2ZOXA 3RM4A 4UFJA 5HOSA 4GI8A 4NXSA 3AJ7A 2VCCA 3ZJ6A 1KGUA 2CKRA 4QLLA 1E0WA 1GQLA 3W27A 3VX0A 5I3DA 1QNOA 1FP9A 4H8UA 1CDGA 3VM5A 4GI9A 1HP5A 1E1EA 3D51A 2VURA 1UWIA 3ARVA 2AAAA 3WNMA 3GH7A 1ISWA 3CV5A 5C8BB 2YA0A 3EDJA 2G3MA 2YBUA 3N12A 3UG4A 2BY0A 3MV01 4TVUA 6CGTA 2FYVA 1EO7A 2X8RA 1FH8A 3KEHA 4FMVA 1JG9A 3WL1A 1MXDA 3POHA 2XWEA 3UETA 1R47A 2O9PA 1HKMA 5E9AA 4UFLA 4BF7A 1YHTA 4PYSA 3OLGA 1PZ2A 3CUJA 1LWJA 2ZX6A 5JIWA 1GOMA 2WVVA 3O2LA 1W3KA 3BAYA 5A2AA 2C8NA 3WNOA 5GNYA 1HJVA 1HWWA 4GQRA 1HNYA 1JL8A 4EE9A 2DH3A 2VCBA 1UOKA 4W86A 2GFTA 1W32A 1JXJA 2G3NA 3VUPA 4B9YA 4LX4A 1WNOA 2VZSA 3UEQA 1YQ2A 3VIPA 1CLXA 5TD4A 4B9ZA 1BG4A 3G6LA 1WZLA 3UESA 4D1IA 4RL3A 1H11A 4GZJA 5LA0A 4W7WA 5E6ZA 3S5ZA 4P8VA 4D6CA 1KWKA 2JE8A 2UY3A 4K68A 1VFFA 4UR9A 2CETA 3WDPP 4D1JA 1MW1A 1D7FA 2F8QA 1PAMA 3W6MA 3CIVA 2ZWZA 3L4UA 2GJRA 3GYCA 5LA1A 3WMBA 4PCSA 4HMDA 2VOTA 2NT1A 3VU2A 1EDGA 2BV9A 3GNOA 4JKMA 5EFFA 5E1QA 1BLIA 4Z2GA 3K8MA 4AW7A 1HJUA 1VFMA 2FHFA 1B2YA 1MW0A 1ISVA 2IGTA 1KQZA 4OUEA 5HXMA 4P8XA 1KGWA 3BVWA 1NOWA 3ZQ9A 3WY1A 4D6FA 1GQIA 3AICA 2VQTA 4JHOA 2FGZA 1GQKA 1Q6GA 2WNWA 1XYZA 2J8GA 1VAHA 4CD6A 3L4ZA 2XFFA 1EHNA 2G41A 1TQVA 3A3HA 1ZBKA 5BCAA 4JFWA 3VINA 3UERA 4Z2IA 3OA5A 2WSKA 3PZIA 4GO8A 3VNZA 4ZXLA 1R87A 3CUFA 4N42A 2W5FA 4W87A 8CGTA 3GXPA 4MAZA 1GW1A 3AS1A 2X2IA 1E72M 1EDTA 4AD3A 2JF6A 1MWOA 1J0KA 4P7NA 4UCFA 4UFMA 2EXOA 4JFVA 2EPOA 2VJXA 2V5CA 3N11A 4RE3A 1LQ0A 4QP0A 5D4YA 3AFBA 1J0JA 3AS3A 3TA9A 1E6NA 1GUVA 2OW6A 4WLCA 4TVDA 4J3WA 3CMGA 3EJQA 4TOQA 1G0CA 5I23A 3ZT5A 4CD4A 4PTWA 3W25A 3WY4A 2XVKA 5IFPA 2ZX8A 3ZSSA 4GO9A 2XG9A 4DO6A 4Y7EA 4HMEA 2Y24A 4HOXA 4NZJA 4CCCA 3ZMRA 2V3DA 4MJ4A 1CENA 4RE4A 5FOOA 1EXPA 2X2JA 3WUGA 2JIWA 1B3ZA 3HG3A 1ECEA 1US2A 2XSBA 4J27A 3FN9A 3U7VA 2CHNA 3AHYA 2FH8A 5D8ZA 1UH2A 1QW8A 1UZ4A 2VO5A 3BAJA 2WXDM 3SCNA 5I5RA 1ZBWA 3WFLA 4AZGA 2YL8A 1E6XM 1CYGA 5M03A 1NQ6A 4ZE5A 3NDZA 3W81A 1VJZA 3PZQA 2FHCA 1PBGA 2BS9A 1QHPA 4N0RA 1W9DM 5D8WA 3VIHA 3WH6A 2EPLX 3GBDA 3KE0A 3FHQA 2OSWA 4W8BA 1W9VA 4M80A 3WQ6A 1CXLA 1UD3A 4YHGA 1W3HA 4J3SA 1E43A 4WSKA 3ZR5A 2WBKA 3K46A 3ECQA 5GPRA 3RPMA 1NWRA 1UWRA 1JDCA 1UKSA 1ZBVA 3KLLA 2WYSA 1IV8A 3VD5A 4MNJA 1TQWA 3WENA 2PBOA 1CGVA 3D52A 2XGBA 1KCLA 4WF7A 1H2JA 4PN2A 4P8UA 4J3VA 2WKGA 2CYGA 3NSMA 4B3LA 5A8QA 1TQUA 1EIBA 3PN8A 4AMXA 2C0HA 4PMRA 3BUQA 1SZNA 4C7GA 3CO4A 1H41A 3AIQA 2J77A 5ECUA 1E6PA 1BGAA 1FA2A 2CBJA 3WF0A 1GOQA 2YL6A 1NP0A 4X9YA 5A6SA 4CD8A 1PIGA 3I3EA 4E4PA 1LL4A 5BXTA 4CU7A 9CGTA 1Z32X 1XCWA 2V3FA 3CUHA 2PI6A 4JHZA 3T2QA 3BVXA 2DT3A 5HBFA 4QCEA 1TQTA 3LRMA 4GKLA 3HZ3A 1UYQA 3AI0A 4X0VA 1RP8A 4HOZA 3MUAA 2XVGA 2XN0A 4PTXA 4AZHA 1BYDA 1ZJAA 4P7QA 4QFUA 3SCVA 3HG4A 4HA3A 3OG2A 1V3LA 3EBVA 4B16A 2WHJA 3EJUA 2E8ZA 1UD2A 1JD7A 1OT2A 3VDBA 3SUWA 1RPKA 1HIZA 4PMUA 1HTYA 4AYGA 2JF7A 1ODUA 3DX3A 3FHAA 4ML4A 1TMQA 1GCYA 2J7BA 2EACA 1JF6A 1OGGA 4OJYA 1W2VA 2VQUA 3WEZA 4UOQA 2EBNA 3ZOAA 2EPKX 3EDKA 5A69A 3N15A 2BHUA 1TA3B 5AC5A 3WY2A 1US3A 2Y2WA 4W7UA 2EAEA 3A4XA 3ARZA 1FOBA 3MO4A 2A3EA 5AC4A 2GSJA 3LX9A 2VC9A 4UOZA 4UTFA 1KBBA 4OKDA 1C8YA 2YA2A 3NYDA 1KB3A 2EEXA 1DP0A 1UD8A 3F5KA 8A3HA 2VZTA 1CGTA 1FHDA 2DT0A 1KTBA 5CSYA 4HOWA 3OGSA 5A2BA 4CGTA 2FH6A 1HL8A 4CVWA 4KH2A 1VFUA 4AZCB 5CQ1A 3D4ZA 4WKHA 1E4MM 4P7LA 2J79A 2J7DA 2WB5A 3VIFA 1R7OA 4M24A 2O92A 4AZ7A 3WEMA 1K9TA 3MANA 3VSTA 3MI6A 4M8UA 1BYAA 4Z2HA 3LPGA 3DDGA 3EMZA 5DMYA 1QI4A 4XV0A 1E55A 1E0VA 1QNSA 1EOMA 4L4OA 4WKFA 3MUY1 2XYLA 5IFTA 1UUQA 3AMDA 3MS8A 2PWDA 4OIFA 3VM7A 4GIAA 1XH1A 3THDA 4DWSD 3ZIZA 1UQYA 5CGTA 1E4NA 5I6SA 3L2MA 2WZHA 3WL0A 5HNNA 1KXQA 3AROA 3TTYA 1CGWA 5GQBA 2ZUMA 1HT6A 1GVYA 4EAMA 1J11A 1V0MA 1WCGA 4AD0A 3FNDA 2CIPA 4H41A 1C3FA 1BVNP 1QWUA 2F61A 1JZ7A 2F7RA 1WZMA 2F7PA 1I1XA 4OZOA 3WUEA 4CVUA 1ITXA 3GZAA 4EK7A 2UY4A 4UOJA 1WE5A 1KR0A 2E3ZA 2DSKA 2UY2A 2WVUA 1SR0A 3AHVA 1QWNA 4H2CA 3OGVA 1VEMA 1PX8A 4AD2A 1JFHA 1TCMA 3AQUA 5A3HA 3ARQA 1JZ8A 3RCNA 2W4XA 1OGSA 5I2UA 2E9BA 1ZS2A 1W1TA 3WUFA 1J18A 1ESWA 1E5NA 1LL6A 5E09A 1EO5A 2OYKA 4L4PA 2ZUWA 1NOUA 3KZSA 3WQ4A 1V0KA 1CXEA 1TA3A 1GZJA 3B9DA 4YHEA 5JBFA 1VRXA 4ATLA 1B3YA 3CZEA 1ZU8A 5FD0A 1W1VA 4AIEA 4AD1A 3H53A 4PSRA 1HP4A 1BYBA 2YDQA 3DYPA 3O9NA 1HX0A 5M17A 2QMJA 3WH9A 4JKKA 3HG2A 3PTKA 1QNRA 4S3JA 4H7VA 3BLPX 1KXHA 2EJ1A 2A3AA 3AMLA 1R46A 1OIMA 4CUCA 2RGMA 3T09A 4AIOA 1CLVA 5A6KA 4PMVA 4AC1X 4ZE4A 3RO8A 3RM8A 3DX1A 3A5VA 4E2OA 4UQEA 3B8SA 3ZJ8A 4AZCA 2G8ZA 1UA3A 4DWSB 3VMPA 3N1AA 4CD7A 5BYWA 1VJSA 3VOCA 5E70A 4GXPA 2DDXA 1PX4A 1OWQA 2VI0A 3GXMA 2G3IA 4U3AA 1U2YA 2XJ7A 4AZ6A 3W53A 1UQZA 4UFKA 1UASA 4XZBA 1BQCA 1V02E 2EPNA 3RIKA 2E4TA 3BVUA 2V3EA 2CBIA 4IISA 1HKJA 3E1F1 1K9DA 3WQ8A 4WJXA 2YFOA 3NSXA 5AYBA 2WHMA 1VBUA 1UR9A 1CWYA 1GOOA 4YN5A 3WNKA 2XFRA 1E70M 1EQPA 1GHSA 3I3BA 1LF1A 4AZ5A 1EGZA 2BXYA 3VVGA 1JDAA 2FGLA 4HP5A 4U31A 1RP9A 5A6JA 2GVYA 1LJYA 1QW9A 4V27A 5IHSA 3OLEA 3BH4A 2OLHA 3T0DA 2JALA 3ARWA 1BGGA 1C93A 4LPCA 4DUWA 5A6MA 4QLJA 1NWSA 3AXXA 5LA2A 2WSPA 1I1WA 3N18A 2X2YA 4W84A 3RILA 1GVIA 2NSXA 3B9AA 4W93A 2VNCA 3CZNA 3VX1A 4MPKA 1HVQA 4KRTA 1Q6DA 1XC6A 3W24A 3DHUA 2D0HA 3CHDA 2XGIA 3WF1A 3M7SA 1UWQA 4LXFA 2D0FA 4W88A 1TFVA 1E6SM 3AIWA 5IDIA 3BAXA 1E56A 4PUDA 3DECA 3VGBA 4FF5A 5BRQA 4BQ5A 3DYMA 1BVZA 3DX2A 4MNMA 2WPGA 4HZ8A 3QHMA 3SCTA 4CN6A 2BVDA 3WQWA 3MUIA 1B31A 4BCEA 3RJYA 2HISA 1G94A 1OT1A 2A3HA 5A1AA 2WVSA 2VZVA 1JZ2A 1N82A 5I0DA 1W1YA 2VL4A 1I75A 3AIEA 1WKYA 3W28A 1VEOA 3SCOA 3EMCA 1M03A 3DX4A 3VGGA 3L4VA 4HMCA 2VX7A 4TX8A 4S3KA 3PZ9A 5ABHA 1CXKA 4DWSA 2CXGA 1QVBA 2W61A 4QCFA 1UH3A 3MUZ1 1LG1A 1BTCA 1QX1A 1FP8A 1QI2A 4AWEA 5C71A 3VDCA 1JGIA 4Z2LA 2ZX7A 2WC7A 2YKKA 3GTNA 5DFAA 3AYSA 3PZGA 2WMGA 3GNPA 4UFIA 3L4WA 3BXWA 3BUPA 1NP2A 3VGFA 3WDHA 2XHYA 4UQCA 1WZAA 3IK2A 4AYSA 3II1A 1M04A 5CSUA 3BAKA 1J12A 3ZSTA 3AMKA 2F2HA 5CPTA 1JYVA 1UWSA 1MYRA 2J7GA 3SCUA 4MJ2A 4HPGA 3SCQA 3CC1A 1C7SA 4CU6A 3LPPA 4MAVA 4W85A 4MB4A 4KRUA 1BAGA 2E9MA 2WLZA 4HU8A 2BY2A 2D22A 1V6YA 4AEEA 1D3CA 4FLQA 3AZSA 3DC0A 1GOIA 4J3XA 3EDDA 1MW3A 1R85A 5DEZA 3M6DA 3SUUA 3WH7A 1ISXA 1UR1A 2D23A 1W9BM 5BROA 2VX4A 4CU8A 3UR8A 3NIYA 5A8OA 4D6IA 3ALGA 4JL2A 7CGTA 3ZO9A 2CCRA 3ZT7A 4V2XA 1K9EA 1FFQA 1E5JA 1XSKA 4E8DA 1WPCA 1XRVA 5CZKA 3BC9A 1CGUA 2QMKA 5IXEA 2XN2A 1T0OA 1OM0A 2BFGA 3AMGA 2W66A 4CN1A 3CGTA 3ARTA 3HG5A 3D4YA 1H4PA 4FLOA 2QHAA 2J62A 1CNVA 3T0AA 1V3IA 3IJ7A 4UZUA 3VKKA 4GZIA 7TAAA 2FE0A 1E0XA 3F4VA 5A8MA 2A3BA 1J0HA 4R5EA 1E15A 1W3LA 1TVNA 1KBKA 3ZT6A 1QBAA 3A21A 3T2PA 4AMWA 3T2OA 4FK9A 3AIUA 1GPFA 1V08A 3WH8A 3NDYA 1E3XA 1B90A 2OYLA 3JUGA 1X1NA 1DWAM 3KL3A 3U57A 1MVYA 1O7AA 2XM1A 4D6GA 1E40A 1UKTA 5C70A 5D9MA 5FCZA 5I79A 1O6IA 2DGAA 4DO5A 4H8HA 1EDQA 1KTCA 3PBGA 3VIGA 3WDRA 4HPHA 4OOZA 4BQ2A 1UR2A 3HU7A 3NUKA 1HJQA 4KGJA 3SCWA 1QNQA 1ZL1A 1PS3A 2VRKA 1CTNA 3LXBA 4PRWA 3IJ9A 2J7EA 1KGXA 5CLTA 3ARUA 2XVNA 1H3GA 3F5JA 4IPNB 3BVVA 5I78A 1MW2A 1IZJA 2Q8XA 3M46A 2E9LA 1XSIA 4C7DA 1BSIA 2ZWYA 2ZXDA 1C91A 3GXFA 2D20A 2O9TA 4Z2JA 3A22A 2W63A 4ACZB 4JFSA 3BLKA 4AY1A 5E6YA 3WF4A 3SIMA 3K1DA 2VZOA 4HZ6A 2VR5A 2X09A 4PSPA 1JIBA 4W5ZA 1FH9A 3LRKA 3N9KA 2J47A 1AQ0A 4TXEA 1V02A 4NZFA 3D3AA 3BUDA 4P7RA 3L4XA 1R86A 3MMWA 1OSEA 4OBRA 4MB1A 1V6UA 1UG6A 3AHZA 2PWHA 2ZX5A 4J28A 1GOWA 1DWGM 2IUZA 3KL0A 4W89A 1Q6FA 3AYRA 3RJXA 1V6XA 4JZ5A 1Q6CA 3UR7A 4GINA 2PF0A 2VRJA 3VIOA 3AHXA 2V3GA 2WAGA 1OCQA 2OWCA 2TAAA 2B31A 3SUVA 2Y8KA 4WK9A 4P7OA 1CEOA 4U5IA 1EOKA 3N04A 3VDHA 5HPOA 1AVAA 5CPQA 3W0KA 4BQ3A 1WDSA 3J7HA 1MFVA 2AOSA 2ZICA 4GI6A 3TP4A 1H09A 3A24A 3WF2A 1JI2A 3W38A 1JYWA 2QPSA 1HJWA 5JBEA 3OIHA 4KGLA 3TTOA 3GXIA 5A2CA 3A47A 2GDUA 2XSAA 3AIBA 5CLWA 4M29A 1TR1A 4UFHA 4ZENA 3WQVA 5I77A 4W7VA 4YPJA 1VIWA 2BHZA 1DEDA 2OWWA 1QHOA 1XH2A 4AD4A 3QHNA 1AQMA 2WHLA 1W3JA 2X05A 3VSUA 3WDJA 3W29A 3TTQA 1U30A 1V0LA 4MB5A 2O9OA 2CNCA 5F7UA 4E8CA 1NOFA 1W91A 4FNRA 3GH5A 2VTFA 3WNLA 3H55A 4XB3A 2XVPA 3RM9A 2ZUVA 1J01A 1J10A 3VMOA 4BZYA 1H0IA 1JFXA 4D72A 1G1YA 4V28A 2YDSA 2WHKA 3U7BA 1G5AA 5HDRA 4TUFA 3MV11 1JD9A 4MADA 4ZEPA 1HXKA 2OSXA 3OLIA 4OOUA 1JNEA 2IXUA 3WELA 3VGHA 2YDRA 4QAWA 3GXTA 1LLOA 1JZ3A 1Q6EA 3WH5A 1R34A 2XFYA 2ZUNA 3AIVA 2GJXB 1JXKA 3MKKA 4ACZA 1HKKA 1E3ZA 4Q22A 3PTMA 1WDPA 2D1ZA 1PJ9A 1SFSA 3ARPA 2Z1SA 2WMIB 2VX6A 3KL5A 1M01A 2WW5A 5DO8A 4CCEA 3VSVA 1C7TA 5KEZA 1QI3A 3EYPA 1E73M 4UZSA 4D6EA 5DF0A 3LRLA 3VTRA 4F79A 2W91A 2PC8A 4PTVA 4ZFMA 1V3JA 4IPLA 2YBTA 1G01A 3VD3A 2ESCA 3ALFA 1WDQA 2O9RA 3L4YA 4JCMA 3AXIA 4AISA 2DEPA 1A47A 4Z2KA 3CZ8A 5E0FA 1JDDA 1M7XA 4XX6A 3SCRA 3UG5A 4BA0A 4UNIA 1FHLA 5FL0A 1UZ1A 2VR4A 4RE2A 3WKZA 2DSWA 5ABEA 2BY3A 2NW0A 4EKJA 3GXNA 5AYIA 1B3XA 5D9OA 1XYFA 2YJQA 3VGEA 3MSGA 3OZPA 2Y4SA 2PWEA 1L8NA 3QOKA 3THCA 1QOXA 3FW6A 1OINA 4BQ4A 2XN1A 3S6TA 1KQYA 1OBAA 4DUVA 3BAWA 4TVCA 2V38A 4F9DA 4QLKA 3KLKA 3S2CA 2JFEX 3NSNA 5BRPA 3N17A 2CKSA 1R8LA 4CCDA 1V6WA 1DWHM 3CUGA 1TE1A 3CMJA 3VPLA 3CLWA 3IAPA 3OLDA 3F5LA 5JIPA 1MQPA 2V5DA 1NWUA 3SCSA 3AOFA 2ZE0A 4F8XA 2YIHA 3N13A 2F7QA 1UR4A 1K9FA 3WFZA 1LG2A 5A6AA 1VEPA 1XCXA 4PMOA 5JUVA 4DM1A 1C8XA 1M53A 4OBSA 5A8NA 1V3HA 4M1RA 3VIJA 1GOKA 1ZBCA 1S46A 2W67A 1E6ZA 1C8QA 3CH9A 3GM8A 3DHPA 1OD0A 3CZGA 2GJXA 5GNXA 2EPMX 4U2YA 1V3KA 3AMCA 2F7OA 4FLSA 3MMDA 2WCGA 4P8WA 1BYCA 4IM4A 4BS0A 2WMIA 1MQRA 4ATDA 4ZXOA 2VRQA 3K4AA 2XM2A 3IANA 3A23A 3BCDA 3VILA 3DX0A 5A6BD 3A4WA 1HN1A 2GK1B 3AXHA 3WDIA 3BCFA 4FNTA 1E71M 3AS0A 3CHFA 3AHTA 4M56A 5BWFA 1QBBA 2WCSA 4PCTA 4J3UA 2BXZA 2WMHA 3LPFA 1MXGA 2CESA 4JFUA 3BUBA 1DTUA 4NXKA 1IZKA 4H04A 2ZX9A 1UD6A 2GJPA 3W26A 1C92A 2CHOA 1NWTA 3EJTA 4A3YA 5I24A 1CECA 2WC3A 5D9NA 5HPCA 1HVXA 2EABA 3PZVA 1V6VA 3KWXA 3WMSA 3WD1A 2DIEA 5BXPA 4MDPA 5A94A 2YOCA 4DWSC 3HN3A 2FDMA 1B30A 4NF7A 3OZOA 1CIUA 1TZ7A 3EJSA 4HA1A 4JFTA 3AIRA 1B1YA 1F4AA 2PBGA 1AQHA 4PMYA 1CGYA 2YLLA 5BXRA 1XHGA 3IAQA 1ITCA 4B3KA 1XGZA 5E0CA 1OB0A 2DQXA 3AZRA 4KMQA 3EDFA 2MANA 4A4AA 5EFDA 2ZUTA 1ISZA 1JNDA 4XZWA 3FXYA 1SMAA 1CPUA 2C7FA 3WNPA 4M81A 4D71A 1WDRA 4CD5A 1VENA 1W9XA 5JBDA 2J25A 5EBAA 1W1PA 1E4IA 2CPUA 2RGLA 3OBAA 3W4RA 3SURA 3ARYA 3TOPA 1KCKA 3K4DA 1CBGA 5LYRA 1HJXA 2ALWA 3ZR6A 2ZXQA 3ARSA 1J0YA 3LXAA 2VVSA 3VD9A 3WUBA 2JEQA 3CZKA 5ABGA 3HJEA 2WBGA 4DO4A 1X6LA 3O6AA 1BF2A 3A4AA 1QPKA 4JKLA 5M3WA 3WN6A 4PMXA 3CZSA 3W37A 1DWIM 6TAAA 1VB9A 1W2PA 1E4LA 4F66A 3K8LA 4U3CA 1RD6A 5FIPA 2QPUA 2DPEA 2YLAA 3NJ3A 1ZB5A 6A3HA 3U5UA 1JYXA 2BNJA 1KXTA 2GK1A 1PX3A 3DYOA 4PMQA 4DM2A 3HMCA 4J3TA 4NSBA 1EQCA 1E1FA 4ATWA 1UKOA 1TQSA 3AS2A 4NRRA 5ABFB 1QI5A 1VFOA 1JF5A 4HA4A 1JZ4A 2EADA 2WMKA 1KR1A 2HVMA 4DUXA 3FAXA 1RH9A 2F1BA 1MFUA 1J9YA 4OGZA 4URIA 3PZMA 3CUIA 2ZIDA 2JEPA 2J7FA 1UWTA 5A95A 2YL5A 4AD5A 3POCA 1JZ6A 1UKQA 1UR8A 4FNQA 2IXVA 1JAEA 4NI3A 4NX0A 3QHOA 3SUTA 1BPLB 3WMCA 1FFRA 2WWDA 4FNUA 3APGA 1E6QM 3PZUA 4AZIA 4WKAA 1TG7A 2X0HA 4GZEA 3WD2A 3NCOA 1PIFA 1HF6A 2PWGA 2XUCA 2BVTA 1KWGA 4W8LA 1OGBA 4CKQA 3TV8A 5CJ5A 4MNLA 3ZJKA 3WEOA 2ZUUA 2D73A 1MQQA 5D9PA 3EJRA 3LPOA 4R27A 1LL7A 2WC4A 5A8PA 2DT1A 1E9LA 2VMFA 3WD4A 2PWFA 2CBUA 1JYNA 3AISA 2VUYA 1UWUA 2GDVA 1SMDA 5A6BA 2YFNA 1OD8A 3GDBA 4JL1A 5EB8A 3H54A 4U33A 1UD4A 2XIIA 4X0NA 3CTTA 2BY1A 4A3HA 2D3NA 4ACYA 2QV4A 4D6DA 1GORA 2J78A 1UKPA 1HXJA 4M82A 1TVPA 3PZOA 5FL1A 4GQQA 1QNPA 5DT7A 4H8VA 1VBRA 1HJSA 3W6LA 4D6HA 3K8KA 1PZ3A 1D2KA 3GNRA 1UA7A
chains in the Genus database with same CATH superfamily
2NT0A 3X11B 1RZGA 1OAXH 4W8AA 1QT1A 1IT0A 3U5YA 5CSSA 5EF1A 3SE8H 2B0SH 5C0EA 1ODZA 4R0LA 4M6AA 1KGJA 2XTJC 2PU1A 3C8DA 3QIUB 5EO1B 4AX3A 3M16A 3PQYD 2R82A 1RUPL 2WTOA 3QUXB 2OWXA 3N73A 4EVNA 1GC1H 5LIYX 5J5EA 1KTJA 5E1IA 5DLML 1QTSA 3BMWA 3MHZA 3AALA 1IXNA 4LUTB 1WRFA 2F15A 4D9LL 2YAOA 3VMNA 3V4PA 1FNFA 4K38A 1NZRA 4C4KT 1MCPH 1SFHA 4I77H 2W65A 2X7WA 3EB3A 1H6EA 4NU7A 3EYVB 1INDH 3C52A 1UWGH 3S5YA 1KW1A 2J9ZA 2KC0A 3U3HA 3UWQA 3FT4A 5CILH 1D5XB 2F18A 3EWYA 3GM0A 3A3YB 4Z1PA 3NDOA 5DVOA 1P84K 4XWGL 1RLCL 1T5KA 1WG3A 2D3LA 1YMHA 4KXAA 3WUWB 1BX2A 2FYYA 5C2XA 2XWBA 4MYAA 1X5MA 4EN3D 4D6JA 4JNZA 1OM3H 5DEFA 3EYOB 3PTDA 2VXSL 3O41B 2VDMB 3T0BA 1XISA 2JKPA 4XAFA 3UBHA 1ROWA 3MRGB 3FVMA 3DPDA 3EGSA 3GC3A 4L1SA 3REWB 3R11A 3C6LC 2XPZA 5T8GA 4YHZL 3WV0A 4MJIA 3VDAA 1F8TH 2OSYA 4ZMWA 4KQ4L 5EPMB 4AVKA 1J87A 3MLYH 1SFDA 2DV6A 4UF7C 2AC0A 4Z3GA 3WL9A 5EBGA 1NDMA 4J6RH 4WEBH 4KRPB 3A6OA 3V7PA 3IDIB 5J3HC 1KB5H 1JTTA 3VFWB 4W4QA 1HFBA 2QVIA 3PHQB 5TAOA 4OZGE 4IQDA 3VD7A 2Z8WC 3UTSB 4FQJH 4TPRH 3SGKC 3JZYA 4MS6A 1DBMH 5DJZB 4JCLA 1BKSA 4DI9A 4DWDA 3SPCA 2HSAA 1CXFA 4IBLT 1Z89A 4U4MA 3W9DB 4GIYA 5DFTA 1NQBA 5DO2C 2X89D 3MA9L 2Y06H 5I6XC 1XCFA 4QLLA 4M7LT 5EHFA 2XI9A 1QFUL 2HG0A 4GIPD 4GP8B 3K74B 4K5PA 2GJJA 1MEIA 1B0WA 4O58L 4XC3L 1Z48A 2YBRB 1FJ1A 3UTTE 2BY0A 3UWUA 5AVUB 2X8RA 4B9GA 5IB2B 4Z7AA 3WL1A 3NQDA 1RV6X 2BWIA 2M83A 1ZIAA 3FFCA 4POUB 3LEXB 4UFLA 1NFIB 3TEWA 1WAAF 3U9PL 1J48A 1CDJA 2X53A 1I45A 1XSOA 1RUMH 2CUMA 3ULVH 4GP4B 3HBGA 3LMJL 3D09A 5FYLD 4WNSA 5FSEC 4XVUD 4Q9CA 1PZSA 1R5WB 5DS2A 3VWKD 2FZBA 4BJHA 4D6CA 3V16A 1WWCA 3K6FA 4CRPA 3CL7A 4DFHA 3WDPP 5DFVD 4WI8A 1J79A 5IM51 2NR6A 1QOKA 1YEEL 3CIVA 2NTFA 3RIFF 5EU5B 4L4TE 1DFBH 5HDQH 2Q87A 2KZWA 3RGTA 3GNOA 5DMMA 1JUEA 5C6TH 4NQCE 4O9HL 1KJVB 4EP8C 1SO5A 1II4E 4IIEA 5L7XL 2ZP9A 3AICA 5HHVH 4UM9A 2EUVA 2WNWA 3N44B 3OWRA 5T3XD 3NZHH 2OQHA 2RH9A 4HWZB 5BCAA 4XNMB 2UZYA 3VINA 5FEXA 1BD2D 3VNZA 1CURA 1RZQA 3HQNA 3C2OA 2ARWA 1K6WA 4L3EB 4ROQA 3V4PL 3DSFH 1K6QL 1JXFA 4OD1H 3DBNA 1J0KA 4UCFA 1HHGB 2QSCH 4L1LA 5KWYC 4GSXA 4ZB0A 1R24A 1LP9A 4QP0A 1TEFA 5C2BL 4MJ5A 2ITCB 1DR9A 3CSTA 3ZTNL 3CN0A 3VXGA 2HK0A 2AKMA 3S34H 1FIGL 2JB6B 4ENED 2XIJA 4O18A 2JI3A 5CLXA 4QGCA 4NY2A 2Y24A 1GL4B 2V3DA 3B2UD 2ID5A 1XF3B 2PXYA 1FWAC 4K2UL 1WWWX 1S8DB 2P5WB 1IL1A 3EFOB 4YX2L 3F6JA 3QT2A 1KCRL 1XGYH 2BWDA 5IF0A 1XR2A 1PVHA 4K71C 3C86A 4PRPD 4QF1A 3G2GA 1YPZA 3UA4A 5D8WA 5SWZA 2FRGP 2EPLX 1DVFB 3GBDA 1DJHA 3BD5A 5C55A 2FQGA 1U5HA 4UILL 4R0LC 4TS6A 4BRJA 5CAHA 2NXIA 1J5SA 4JDTH 3WENA 1GPWA 3KXQA 3FU9A 4AZ8B 2IH1B 4GYBA 1F7BA 2XZQH 1A6ZA 1YHPA 2CYGA 5A8QA 4V2CB 2XX1A 3D0VA 5GGUA 1YAZA 1H60A 1KC5L 1ADSA 1D5ZA 4MA8L 3NTCL 1OGAA 4UWMA 1MNUH 1UCBL 4LS1A 3SJVA 2ODIA 1IE7C 2UWEF 1TQTA 3RZCA 4JKWA 4U4IA 1P6BA 1CT5A 5AZ2H 2CK2A 3SSGA 2DKSA 5JMOC 3L5JA 4H4NA 3SY8A 1QMLA 1E6JL 3DETD 3NA9H 3HG4A 5LHEA 2X7LB 5FGRA 4KCWA 1JD7A 2GY7B 3IFPA 2QGDA 1L9MA 4HFWB 4UQ3A 3DX3A 4LWWA 2WO3B 2ZXWB 4DXKA 2E9GA 5EN3A 3D47A 1HZYA 2EBNA 3EDKA 4H9UA 3OKDB 2Y2WA 4ZMAT 3UXDA 4PGLA 3T0TA 1M7JA 1GTNA 1CLYH 1ZLVH 1XT5A 3EA2A 1DVQA 2RALA 4MJ6A 1G1CA 1DJWA 4JTEA 1O6SB 4AZCB 1ZE3H 1K8DB 1SUJA 1OC5A 3P69A 4YL9A 2CG9X 2D2HA 3TYZA 5E9XA 3CCHB 1GKQA 1R7OA 3GZKA 3DSNB 2GHWB 1BWWA 3A9IA 2EF9A 1BYAA 4RRPG 3QPKA 4PRHD 4UTWA 3FTGA 2V6AA 1VH7A 4XVDA 1A4JA 1OAQH 3TX9A 4N2AA 2ZSWA 4UTAA 3V4VH 2QQNL 3RCYA 1WWAX 3FSAA 1WOAA 1OP9A 1URIA 4HK7A 3EA1A 1L6PA 3JV4B 4OZIB 5IB1B 5D1XA 3OBEA 2ZWKA 1P5UB 1CLCA 2C3GA 1D3GA 3HC2A 1RBLA 4A3UA 7FABL 3EJCA 2MKLC 2XH2A 2UV3A 4IGBD 1Q90A 4JDBA 4X2RA 1BFVL 1EJWC 1TMLA 4I5BB 4QRUA 4Y4KA 1X5FA 1YNTB 4L4PA 4DW2H 3LZLA 2ADYA 2ISFA 3KYNA 2UYLB 3HZVB 5B22A 4AIEA 4AEIH 4UIKL 5J6HA 4ZX3A 4OI8A 4X4XA 3PUEA 4ODTH 1OEPA 1O95A 3PDOB 2WJ5A 3BQUD 4PJ7A 4DWSB 5C7XH 4IJTA 4X60A 3CV1A 1ZHLA 2YRBA 1I7RA 4U3AA 2XJ7A 4AI7A 1YPXA 4IDJL 1QA9B 1R2TA 4ZUVB 2EPNA 3DO7B 2H90A 1AGBA 3PAOA 1S3RA 2CO6B 4IISA 3SOBL 3IGAA 1BLNA 1EZ2A 5C0CD 4U6XB 2C9PA 2ICCA 1XC4A 3QIBB 1X5GA 1GHSA 1UVQA 2UXVA 2Y7GA 4HUKB 1K4CA 1RL1A 1JUFB 4PJGE 3T0VA 3NYZA 2JMRA 3OKEB 1RLDA 4F3FA 2JALA 2WO2B 4N2IA 4QLJA 4LOUC 1TJMA 3MHFA 4YSSA 2NR6C 1B9KA 5F2GA 3ECBA 3MXVH 2IANB 3J2PA 1JCMP 4LVAA 5C0IA 1Q6DA 2W38A 4KWOA 4DFIA 3CHDA 4FHKA 1O5PA 3IVSA 1BVOA 1E6SM 5GZOD 3AIWA 2DAVA 3P9LA 1S7TB 3BP7B 3BAXA 4NGHH 1J1XL 2LE9A 4U10A 3APFA 2DQEL 1OAUH 3G5WA 2Y2TA 3GSRB 4LVNB 2VUOA 5HYSA 4G7FA 3OPSA 1AFVH 5H35B 3NH7H 4Z7UF 2WMPA 3PGDA 1F90H 4A04A 4JFFD 4XP4H 1A7RL 3QARA 4LDEB 5SX5K 4RAHA 3GJFK 1NMAL 4EI5D 1EERB 5T5FA 4GKOA 1AZNA 1O7DE 4QOKE 3GNPA 2W0FA 2RDUA 2ITFA 1ZT4B 4HLEA 2RJGA 3ZKXB 3WDHA 1F02I 3GUFA 3TA3A 4O2FA 5DA0B 3WAKA 4GXMA 3R94A 3HUJA 1T1YA 3TCTA 2CE6A 1VFTA 1VHPA 3S83A 1ETB1 4WK0B 5DCEA 1UYWH 4MAVA 3P40A 1X38A 1F56A 2GGGA 1LE5A 4LLMB 4AX6A 1J88A 1AE6H 2JKEA 3SI9A 3DC0A 4GSDH 1V55B 1VPYA 1R85A 4HU4A 3WNJA 3HQ1A 4URKA 4AQLA 5FACA 3SODB 5A6TC 3BLFA 4C4KO 4ZTOH 2WLKA 3FB6A 3ZT7A 1G7UA 1XSKA 5I17A 4KV5F 3QORA 2WB1A 3C2RA 5C9WA 4YHML 3K2UH 4N02A 1BRLA 2A0NA 5FA3B 4F5CE 4KKNA 3TPKA 3LB6C 2WBJB 2OVLA 4GUIA 3F4VA 4HHAB 2FZNA 4FJYA 3IDMA 3T4YA 9PCYA 2EXWD 3NAAL 3RVXD 4UTAL 2D69A 3QAZC 5AW8B 5C0QA 1B4KA 4UTJA 5EA0H 4OE7A 3WJJC 3SCMD 3TJIA 5I1CL 4LKXB 4M6ML 1GVOA 2TRYA 3RZCC 1OPGH 5D4HA 4UBDD 1PS3A 1G7LB 3TR9A 4Q56A 3ZDXB 2J27A 3HLAA 4KMTL 3QY8A 4HWNA 4KK6C 2Z4TA 2Y7QB 2CR3A 4LSUH 5CUSH 2EXYD 4N2BA 2X0WA 4JLRA 3OL2A 1NICA 2HSIA 1S2CA 1SW3A 2Z8RA 3QV9A 4RX4D 3P9MB 1RVKA 3HW7A 3DHMA 4X6FA 2WQXA 5EO0A 3WIHH 5EOTA 5LBSH 2H47C 3D2TA 4FIRA 4QBXA 4IOTA 1OFRA 4XNQB 1IE5A 3OF6A 3WD5H 1I3UA 4LBSA 3RJXA 1E8XA 4F58L 3ZW3A 4ONVA 3LD8C 5IK3B 3FCPA 2PF0A 2NY0C 3VIOA 4JG1H 2V3GA 1O1ZA 2TAAA 2Y8KA 1EOKA 1AVAA 4FYRA 4OZ4B 3RGVB 1WDSA 3NO5A 4MXQD 1FI8C 5HVHC 2KI6A 3C6EA 4UTWC 5A2CA 4X6DF 5FDWA 2XSAA 1TR1A 2Y0SA 3QHNA 3VI2A 2LOEA 3GG8A 5KINA 5DZAA 3SPVA 4XNUL 4FF7A 3BGMA 5I1AA 1S2UA 4GBXB 3PY2A 5FYLH 2QPDB 1J10A 4OZHA 1T5WA 3WJYA 4OUUB 2YDSA 5ICUA 4MADA 5JUEL 1TELA 1ZHBA 5D1XC 1LLOA 3S6CA 2QVNA 4NAJA 4N8CH 3NR0A 4OLWL 3DUUB 4AYBA 4WFHD 3KW3A 1QMUA 2VX6A 4I5UA 2WW5A 4QHMB 3C2FA 4CNTA 4M02A 2DZVA 3VXMD 4BZ2A 1T1ZB 7PCYA 1KIQB 3FQWB 4PGEA 3FKUS 3CBRA 1ED3A 3O15A 1V3JA 2BWGA 4JO1H 4P5RA 2R4SH 2O9RA 1F3DH 4JCMA 2MKWA 3QZOA 4LF3A 5GGTH 3V0WH 5T5FL 1S9KC 5T3XH 2QKIB 1UZ1A 2D8KA 4G8GE 2OK0L 3OODA 1R3JB 4YJ5A 4DY1A 2XKNB 1EK3A 1PB0A 4CQAA 3OVPA 3C5JB 3UC0H 3B40A 1R3SA 5TK4A 1ZGLB 2GTZA 2AVGA 3IU3A 4EXQA 1T2JA 1OC7A 1J8KA 1RLWA 3BPOB 4EDWL 1DWHM 3EGXB 2CR0A 3O3DB 2ADFL 1OSPH 1RJRA 3H56A 2ZVIA 4A7GA 5ICZA 3MBEA 4BDVB 3IJ6A 1MJ7L 4ZUTB 4XBJA 4QRPB 1TSHA 1F4YL 4XO5A 1KCZA 1F6FB 2F8IA 3PABA 2AEIT 1IGFL 5IW3A 2BXVA 3MCG1 3LH2L 4U2YA 1V3KA 4PHZA 5KVFE 2Y0FA 4DELA 5IW6A 1PYWA 3B7UX 1FLRL 4EXKA 3CDFA 3RWDB 1CB7B 1OWRM 1MJUH 5TH2B 2XFWA 3QIWA 5BWFA 3MDWA 2MUCA 4F40A 5HDBE 4J1OA 2YRPA 1DTUA 4B41A 4JPSA 5E4IA 1HS6A 4FXJA 1N18A 4HPXA 3OKLB 5F0MB 2WC3A 4XTIA 2N3JA 4H9MA 1V7ML 1W1IE 3DTDA 5ICXB 4NF7A 4XBKA 1A4MA 4TU1A 1P7QA 5I71C 2PBGA 2FEDC 4K3JH 4KMQA 3OHXA 3TA3C 1IC7H 2BSEA 2DKUA 4OCRL 2GPTA 3PXHA 1VENA 3HC0A 1XIHA 3ARDA 3IMRA 3HNTL 3V7AE 4F0RA 4NO0B 3BPNC 1RQEA 4XGZB 4GUGA 1TWWA 3SIKA 2G5BA 4AVJA 4G7EB 3FS2A 2AV1B 4JAMA 4MF4A 4LNRB 1X6LA 4QE5A 3VZXA 1X8CA 1QZNA 4W4OA 3MHGA 4MMZB 3QORC 1SDDB 2FQDA 3U2SA 1EGVA 3QKZA 1F4WL 1CB2A 4C56E 3VNKA 2OXNA 3HTWA 1E0OB 3EADA 1ET5A 3C60A 4KY1L 3O05A 3L13A 4PV8A 4YDIL 5BVPH 1KR1A 4QXGL 4AJWA 2XU9A 4G5AA 3IS4A 2IV8A 5FJRA 2DVUA 5D2LA 3CPGA 1OJXA 4AD5A 3HIZA 1ELSA 3RNDA 1UKQA 2IXVA 1OPOA 2Z92A 4NX0A 3FO9A 2MTPA 2V8ZA 1EV2E 1T5AA 3KTCA 1NOLA 1HJCA 1E9PB 1JGVH 5JPMA 1OAKL 3F7QA 3PFUA 4HIPA 2GBVA 5IB4B 2AK1H 2BVEA 4PGBB 3A4JA 3TV8A 2R8SH 5CJ5A 3O8XD 4MNLA 4Q4QA 2D73A 2YC1B 1I8MA 1IC1A 2Z1PA 5EOQH 2X1UA 1DUYA 2CJUL 3MTXA 4BZ2L 1OFEA 2J24A 5IT2H 2Z4GA 4FS0A 5AOJA 1VR6A 1S2EA 2WJFA 4JJ5A 1OD8A 1T6MA 5KS9A 4GHRA 2C3XA 3H54A 4R90H 3APMA 4U33A 3QQWA 2VN6A 4P23D 4D6DA 4NO3A 2QFRA 3MNMA 3PZOA 2J4WH 2VERA 1I3GH 5BV7C 1XBVA 2JV6A 5HD8C 4GY0A 2GAZA 3S1XA 1T04A 1AR1C 4U2ZA 5C09B 4YDJB 3QR3A 5D37A 3V0VA 3WTXA 2IBZY 3CHRA 2PCPA 2I9TA 4NM4L 4XH2A 3NZUA 4GUOA 2D3VA 3QO0B 1V51A 1XYMA 3ZLFA 5AHNA 3AYVA 4NC2B 1E4JA 3BWAA 4LYRA 5E08H 4DJFC 5AUMA 4G7VL 4DPCX 1NEZG 1DHKA 2HNHA 3V6FA 4R33A 5IW1B 1V5XA 1JZGA 3M5ZA 1ZJBA 2VN5A 1SEQL 1TKWA 3CHEA 3AXMA 1QI0A 2PWUA 2SEBA 4OV5B 1H3PH 4E68A 3RMEA 4RZ4A 3W88A 2O4MA 3NCXA 2PZ0A 2DZSA 4DQAA 3ROOA 2P49B 1XYCA 4PJAB 4F8TA 1U3HA 5FA4A 1P5VB 5FYJE 5ITBH 2KYIA 1XV8A 1KBVA 3REVA 1FNLA 4ORGA 1K3ZA 2GUYA 2DEWX 3EPMA 4LP4A 3DJRA 1L0PA 1G4TA 4EOWL 4HUCA 4QXVA 2X40A 4RRPM 2CW6A 2OL3H 2KMWA 5BS0D 3MKVA 1J8HD 1R3KA 2VXUL 1ORSB 3AWGA 3PLYA 4I9WD 1WEJH 2NUTB 4EXAA 1OHQA 4NASA 2B14A 4G9FD 2ZD0A 3TTSA 4P2OD 2ZPKH 4PJXB 3WBAA 1KM1A 8PAZA 4IK7A 3PPHA 3LEVL 2IALA 2J44A 3W82A 4BIKA 3HS9A 2ASHA 12E8L 3UG3A 2P3YA 1XP3A 2JJVA 1MCBA 3WXWL 2QCFA 5HI3C 2OXHA 4IMLA 2EIZA 3T08A 3QOMA 5F8RC 2R94A 4AJVA 3MJ6A 3PB2A 1GGCL 3GLZA 1S2WA 5IVXE 5DRCA 2WWNA 5CBIA 5DQDL 2JCCF 3FRPG 3GRWA 3LXCA 4D9QD 1DCLA 2Y70A 2CD0A 1E6RA 2ZOLB 3WD3A 5HWMA 3J07A 3MBEC 3UYRH 4DIXA 5BXSA 4LSPL 3VXTB 4XB8A 3H6OA 4BI6A 4FNLH 3GMOB 7A3HA 2YLKA 1WUFA 1TUXA 1YN7A 4KIEA 1LO4H 3RFZB 3NIFF 5F1VA 2H1LM 2HKFL 4TUJB 3CXOA 3PL6A 1SZRA 1G4EA 4JZOB 5F7NC 1NFKA 2WZEA 2X28A 3N2XA 2V4LA 1HAWA 4LRTA 5G1YA 4HJGA 4KY2A 4HUWB 2CITA 4ICXA 3PWPA 2CBVA 5BO1L 1EA9C 3QIWC 1YEKL 4ZQRA 3WEAA 4WEUD 3NG5A 4N5EC 4YTQA 2C5DC 2LAGB 3FFSA 4H8UA 4YE4L 1O1HA 2FDSA 2SODB 1NFPA 4GLRI 2DLTA 1EPFA 4P4KD 5CJMA 5AB2A 3GIVB 5CHNA 1HH6A 1AS8A 2ZZ4A 3F4CA 6CGTA 1QAWA 1F1AA 1IKFL 3OHXC 1KEGL 4IRSB 5CZTA 4H26A 2WVVA 1RJLB 3O2LA 4G8EA 2DMHA 4GG6A 1UB3A 4KC3B 3AADB 3ARDC 3MTRA 1VZHA 4H1LG 5AWNH 3KG5A 3UZZA 4KJQD 1UJTA 2UZIH 3QZ6A 3PBWA 3MJ7B 4Q7BA 3KPLB 1T4KB 3CVHH 3S96A 4UV4H 3KPRE 3UESA 4ICWA 4CSTA 1SHWA 1U6AH 4IM8A 1OTTC 1YRKA 4UR9A 4ZPTB 2AERT 3SKUD 1MCSA 1YIXA 1A9BA 3WMBA 4Z6AT 2IMNA 5EFFA 4GAAA 4S23A 3ULSA 2NXZC 2RBLA 2VAAB 1ISVA 4X99A 3CH1A 2WZPD 1I1AA 3IJEA 5GGSA 2ATMA 1D5IL 3BEWB 5IHWA 3WO4B 3UBXA 1PG7H 3GHRA 4OV9A 3RKDC 3C60C 1G4PA 1Y6KR 1H5BA 1KENL 3QFJE 3KWTA 2XFFA 4BZ1A 2CKBB 5FO8B 1TTRA 4QTIH 4I9JA 1KFAH 1EDTA 1KRBC 3E6FA 5H37A 5F97E 1A6AB 1EJOH 3FO1B 1AD0A 2I9LB 1LQ0A 3TBYB 3RNKA 1I9RH 1E90A 3AFBA 2J21A 3AITA 4J3WA 4QQUA 5T91A 3GVGA 2CWNA 3HFFA 1G0CA 4CD4A 1NUFA 5M1TA 2ZX8A 4Q97A 4YWGL 1MF2H 5JR1L 3SJ3A 1FNHA 4RE4A 3OA3A 2AW2A 3VNIA 3QYCA 1ZVHA 4PJBE 4JFEB 3MCKA 1GPOH 2Y7LA 3BAJA 2NPLX 4D2JA 3ABZA 1ZBWA 1IWPA 3MLVL 1OHZA 1H7NA 5D4JA 1CYGA 4M7LL 3PWUA 4OIIL 4WUIA 1TV7A 5ID1B 5CF3A 2FHCA 1OF0A 4GG8B 4N0RA 2NYZA 3WN5B 5BW6A 3WH6A 1UEMA 3UIZA 3BK0A 2Q86B 2XGZA 3TU6A 4DESA 4AM0Q 1PTZA 5GPRA 2B1AL 1JDCA 5J1AB 5BUAA 5CZ0A 4O0QA 5EIIG 1TQWA 3JWNE 3PGCB 1KACB 2QV2A 4AB4A 4K9EH 2X6UA 2X4OA 4FP8L 1U8PB 4IU2B 3UJIH 3NFSL 5C9JB 3ZVHA 3OR6A 3CO4A 3GRWL 2X3CA 3ULVD 3MV8E 1QR1B 1LUCB 9RUBA 3KPSB 3XISA 3MV9A 3RWGB 4CMMA 1LK3L 3W57A 2FIKA 4YAQA 3SKOA 3HG1B 1QRNB 3ISYA 4BK8A 5CFHA 4I7VA 4I13B 2XVGA 1HCZA 1RMFH 1UP0A 4GUHA 2NX5D 1ZVYA 3HKFA 1U3HC 5ANMB 3FN0L 4MHBA 4PRAB 1SBBA 2DQTH 3TWYA 1EVUA 4CNSA 3UP1A 5HGBA 1TLKA 3F7YA 5LNWA 4DYEA 1A2YB 1PSCA 4NN6B 3OGCA 3UZVA 3N0AA 5AC6A 3UCCA 2E6JA 2XZ9A 3WEZA 4PJXF 3Q67A 5I16A 4H01A 2R2EA 1QSED 1AQ8A 2UZ9A 2N7SA 2B2XH 4UOZA 5J12C 1NFDA 4C58B 1W0YT 3NYDA 1V79A 4XCYB 4QRSB 4JE0A 4NCDA 2BCKB 1HL8A 1VFUA 2R0ZL 3FZUD 3QCVL 4ERSL 3GPEA 4GC3A 1BIIB 2J7DA 2WB5A 3SRKA 3WBWA 3ESMA 1YECH 1NMBL 2QHLA 3LPGA 1NF7A 3MJYA 1V7NH 4LIQH 1EOMA 4L4OA 3HPJB 3R79A 1A6PA 2X70B 4AT6B 1LEKA 1U3ZA 3UPMA 1UUQA 4OIFA 4O2EB 2I25N 5I2IA 5DHYB 4FGMA 5M2FX 3L2MA 2YXOA 3ZK0A 4L1TA 1V05A 1OCZB 2CDEA 3TIEB 1B6UA 4IH3A 2FB4L 1IGTB 3CN3A 3SHSA 3UTPE 1V0MA 2FVKA 1WCGA 2CIPA 3TBWA 1JZ7A 2F9BT 3PWVA 2C9SA 3PL6C 4KHXL 1OSZA 3QYQA 4H9ZA 5EBWA 3FOMA 3GR4A 2APWA 5B8CA 5D33A 6REQB 2DMCA 4LNVA 1TCMA 2XZAH 3FOLA 3FGCA 4XBGA 5L2JB 1QVOA 2OYKA 3DUSB 2CZDA 4GKNA 3NCJL 1XGDA 3NABH 1FVCA 2PW1B 3IDJA 5D93C 1TYRA 5FD0A 4BZ1L 2I5YL 2A1WL 1HP4A 3D4CA 1Q2RA 5CIPA 3DYPA 3VD2A 1G1OA 3N85H 3GSXA 4JKKA 4DCQB 3BLPX 4WY0A 3AMLA 1CLVA 1KIUA 1I8KB 2A0LC 1WYIA 2SFPA 3A5VA 1OF2B 4GS7B 5GSVB 5CPLA 2WBXA 3VRJA 5HR7A 3LSBA 4MD0B 3LZ3A 4Z23A 1ZANL 3WLBA 2V67A 1ZNNA 3G6JF 4PBXA 2FX7H 1PCWA 4XZBA 3LHWA 3E2QA 4Z77B 5AYBA 3HGJA 2OP4H 3G9AB 5F1NB 1P1XA 5HATA 5ICYA 3CHVA 3CMOH 1EQPA 2IAMC 4XCNB 4Q8WA 1Q66A 3FH7A 2R29A 2VW6A 1LJYA 4V27A 2X1SA 8FABB 5DUPH 3T0DA 3FKKA 3VCNA 4HA0A 3ZDZE 5FLUA 3MDUA 4WY7L 4HWUA 1A7NL 4DHGA 2Y07H 1ETZA 3TUUA 2X2YA 4YLWA 2XQYA 3CHQA 4L4VB 5D1QE 3QDMD 3B9AA 3VFNB 2X1RA 1NCIA 2NCEA 4O14A 1T1WB 1EC8A 3LV3A 3ZVVA 4LZKA 1QBML 2PDKA 5CSZA 3OR7B 2KUTA 4N8UA 1FL3A 1I1AC 4BBWA 1UA6L 4U1IB 5IOKA 1TFVA 3KHDA 5J0BA 2AJYL 4PHXA 2VKWA 4N90D 3VGBA 5AYUH 4KVNH 5MI0B 4HZ8A 1H5BC 3I2CL 4EF8A 3RYMA 4ELME 2Y7FA 3R13A 3Q2CA 4HK0B 1V10A 1TCDA 1EUUA 3DJTA 4RESB 2W81C 4BFJA 1KBIA 3L4VA 2BSCA 4HMCA 1T21A 1LO2L 3CK0L 1EYWA 1CXKA 1N64H 3KPQB 2FL5A 2D9CA 3PPFA 3N2MA 2IH8A 3QZNA 3EX4A 3UVIA 2XCMC 2CZEA 3QI9D 5CP3A 3NN8B 4RGOH 4A3RA 5CEYA 4CC1A 2PE4A 4AYSA 3UP6A 4LARL 3ZSTA 3RF9A 2MQGA 5G2HA 4O57A 3C8KB 4QDWA 3P77B 1C7SA 1ILSA 5FOJA 4MB4A 4LEOB 2XG5B 3WLHA 1X9UA 3V79C 2BY2A 1TPEA 3DWTA 1JF1A 2YKLL 1C12A 2WBWB 3TNMB 3IB4A 5L0QB 4TSBH 4MNGB 4G9DA 2WO5A 1ZQ5A 1ZLWH 1XLGA 3JW7A 4JL2A 4JPGA 3VE0B 1J1OH 2JELH 5MEPA 3Q2VA 2VXVH 4K3HA 2YB4A 1S3TC 3R10A 2NLYA 3F7KA 4F2BA 4Q4IA 1JGUH 3HG5A 3AGWA 1N70A 3MU3A 3RVVD 2Z91A 1RJCA 4C1KA 2FE0A 1E15A 2NXYB 1MZRA 2GITA 3V5HB 3RDTD 3LRSB 1JHTA 4YTRA 4JB9L 2ABBA 2EDQA 4OM1H 1B90A 1XLKA 3H2QA 3JUGA 2WOYA 4NJAH 4R2GB 3E0GA 3N9GL 2DGAA 1JK9A 4PJCE 1ACXA 3U1SH 4HPHA 5IHBA 5FJUA 2RAGA 3LN3A 3HU7A 4I7WA 4KGJA 2FZ8A 4A2LA 1ZL1A 1IX2A 4YSOA 2PS2A 3MCMA 2EDDA 3O6DA 4ZDHA 3QNXA 4HPJA 3OXSB 4BKNA 3EGDB 3TU9A 2EEFA 3WE6B 4G43B 3QP3A 2WZ6A 1CUOA 5ISZB 3NSDA 2ORBH 2IKJA 3FXGA 2ZAHA 2Y3NA 5TQ2H 5J5RA 1CE6A 1UMYA 3MC5A 4AAJA 3WJMA 2C4FU 1A3LL 1OTUD 3O11A 2VENA 3AYRA 4GYKA 4JZ5A 1OCWH 3UR7A 3AHXA 5HHOE 3TZVA 3DX6B 1JPFB 1RXOB 1BM7A 4HIIA 2YZ1A 1EEQA 4XPTH 4TNFA 3OQEA 3E2HC 1SGKA 5ALBL 1M7PA 1A0QH 3AC0A 5FJTA 5KUKA 5JOFB 4HGXA 2UWEB 4I8DA 2KDGA 5KSVB 2R29L 2OFJA 1JDEA 3GWJA 1R5YA 1QKZH 2ZTBA 4GEJA 3V0EA 2JB5H 2OMZB 1Q6EA 1EZSA 3O63A 4M5PA 5D4IA 3EYFB 5B8CC 3KS0H 3CEUA 4YTUA 4IGHA 1MI5B 3KBMA 5D5MA 2QTVA 2QAPA 3EYPA 1E73M 1KJ2H 1ANUA 3VXUD 3BANA 2DY2A 1CCZA 3S7GA 2QDWA 1NFAA 1VFAA 5I1DB 1RPUA 3THUA 5E6IA 2V17L 1V27A 3WFEH 2F58L 3GJFA 1QTWA 4REQA 4GYPC 4AVIA 2VC2L 4EI0A 4PJDA 4O2CB 1S5NA 1DE4A 4IOSA 3KNBA 3Q1SL 1RAKA 1OINA 4GAGH 1KN2H 4HIBA 4HXAL 1G6RB 1L3NA 4S3DA 4TM9A 3T3ME 4YZWA 3T0EA 2F9RA 4QHLA 3V7AG 3F58H 3L3GA 3D06A 3QA3B 1WGVA 5DURD 2PODA 1AXSA 5IMOA 1TPUA 1FH5H 1BJ1J 4HIHA 3TN0D 2P26A 5E99L 4KO5A 3OM3B 2J1KA 3H9ZA 1ZV5A 3GS4A 2L4OA 1RQHA 3HE7D 3QNYA 1EXUA 6PAZA 3O9WA 4UINL 4K7FA 1AXTL 4QRAA 3DAQA 3QEQE 3SM0A 5JIQA 3L1OL 4RFOL 1MQRA 5ITFB 5I1GH 2VRQA 1L9NA 3A23A 2BSDA 3MA8A 1SVDA 2GK1B 4AUBA 3FSTA 1E3FA 3WDIA 3UBPC 4FNTA 3Q06A 4NP4L 3FT9A 3RE0A 3X1BA 4RNRB 5D7JA 4MD4A 1O75A 3U0WL 4K4KA 6FABL 4E4UA 4NSKB 4DZ5A 3GKWL 3W7LA 2YCLB 2PGFA 4H20L 5GJSL 3W75A 3DGGA 3TFKC 1EYEA 4A3YA 2FEJA 1N12A 1LT7A 2WZ5A 1AY1H 2DI8A 4KKBC 3HN3A 2VGIA 1XIBA 5IMKB 4PA8A 4D7BA 3MI2A 2V2TB 3PWJA 4S1DD 5BXRA 3H85A 1KPRB 3UPRB 3EBAA 2GSIB 3K5RA 4FHBD 4KFZC 5CZXC 4E6MA 3W7KA 2XBDA 4JY5L 2OCFD 3RO6A 1S78C 4L37B 1FFNB 1IAKB 3GPSA 2NV9A 1E4IA 5DHEA 3OBAA 4G70B 4WJKB 4EZLA 4KNQA 1HJXA 5CC5A 3E96A 2HVKA 5JQHC 2BX5A 3CFIC 4F15B 1H0DA 5DK0B 2A4AA 3NPVA 3O6AA 4XMPH 5DVKA 4RQQB 3TQ0A 4PMXA 5IB5A 4IHOB 2O5XL 4PFHA 3VOJA 4ZUUA 1XF4A 3HO8A 3CB8A 1RD6A 4TQTA 4PMFA 3A6BL 1F18A 3GK8L 4L3CA 3LKRB 1BREA 2FX9L 2RFXB 4HEMA 4XSLA 5CPMA 3GLAA 1X98A 4Z7UB 5CZVH 4GRMB 4C6KA 5ADOL 3U30C 1VSCA 3BP5B 1C8PA 4NNXB 4YHPB 3BZ4A 4RW3A 2EADA 1FL6B 4O5LL 3EO0B 2F19H 2AKZA 1MFUA 4N2MA 2FR4B 2KT6A 1FVEB 2D7TL 3RRAA 5T3ZL 2ZIDA 2HJPA 3L6FA 5FAGA 2XZCL 4U1MB 5DK2B 4KXBA 1F6LL 5JMUA 4KNSA 4OGAD 4B7LA 3WD2A 4TULH 4J2MA 4NO5B 2NUXA 2BVTA 2F54E 5CU9A 2IQTA 1INQA 3EO9L 1C1EL 2P50A 2Z2AA 2XJKA 4XMKL 2GUOA 2WC4A 5KJRH 5D7LD 2VMDA 5KSBA 1FVPA 4INFA 4KX8A 2PWFA 3RX9A 3JU2A 2XQYK 2CRZA 2BOCA 2OSLB 4X0NA 4N9GB 3R8QA 3UR5A 1W1ZA 1GORA 2V7NB 1L6SA 4MNQD 3VFTB 4IP5A 2R27A 1GSMA 4ZO9A 2IIJA 2PTUA 4M9PA 1UA7A 4LL9A 4X5XA 4FQ2L 4LSQH 5AW2B 5LGKA 1RJYA 5C0BD 5JDSB 3L5HA 4KWUA 3TZVC 3BZEB 1H5VA 5KANI 5EKYA 4FABL 3C0JA 2J7CA 3QFWA 2V0AA 1S3HA 1ZPLA 2J3SA 3L2LA 2WQVA 3DRTA 5DELA 2YPLA 3NQ7A 1FCBA 5E5MB 4MWAD 5EU6A 2P5EE 1KLZA 3PPEA 1RQBA 5AY7A 1I3VA 4OZFB 2V37A 4N2FA 5HHNA 2WANA 3RRQA 4P3CH 1WB0A 1XSJA 1KTLB 4G6ML 3C2SA 3GMQB 3UAJA 2MOQA 1W5PA 3THML 1V93A 4Y19B 2FJHB 5GRXG 5MERA 4RZCA 4Y1AE 4XKYB 2X2HA 1COBA 4KTYA 1J0ZA 3NOEA 2JKIS 1Z5YD 4RNHA 1HKIA 2F7IA 4NUJB 5IHUH 1I8LA 2A6JA 3AT9A 3MP5A 3LRHA 4FQXB 2QHRL 4HF5H 3QV6A 3C12A 4NAFB 3WIIH 3M0LA 5I1JL 1UOZA 2Y1YA 3QY7A 3IAGC 3B1UA 4HKBA 4L8SA 5DZOA 4FNSA 1F4HA 1U33A 3BLDA 2J71A 2R1XB 4UTTA 3WMLA 2AMGA 2X1IA 2E40A 4G3YL 2X88A 3WK3A 3QUYB 3DXAE 2X0YA 3LHPH 5B7FA 5GSRB 4H9XA 4GRLA 2LV4A 4BFKA 5KYYB 1VF8A 3SDDA 2ESVA 4X6DB 1SBSL 3TVMB 4NKIL 4FXRA 1AR2A 5F89A 5J7CC 3ZTDC 4OFCA 3MSDA 2G3XA 1CICA 1TU2A 5D7KD 2GOKA 1OP4A 3VWJA 4HUMB 1R3RA 3FAWA 4UUJA 3G5XA 1KV7A 4DAGH 4Q7IA 3USZA 2UWFA 3V6ZB 3WLTA 4GXFA 3EX1A 3BH8B 2BIIA 4N0CD 5TF1L 1YYML 1UH4A 1H7RA 4JTLA 1OGPA 1YY8A 4LEQA 3IRCA 2X2UA 4TX6A 1TZOA 4PCPA 5FKYA 1R9FA 4XE0A 2LLGA 3EJYC 2QJDA 5JH2A 5KVEH 4P2QD 3GB7A 5LAXB 1XIWA 2HROA 4H9YA 4GI8A 1W3IA 3ZJ6A 5IZ7A 1GVEA 3EWUA 2WQPA 4H0HB 2BFVH 3DKLA 5C07E 4GLEA 2HA1A 3SKNA 1EXHA 1PQZA 5E93A 4N2EA 3V5DA 1U3JA 3RLHA 2KH2B 4HGKC 4U6VL 4NC0B 5KJ7E 4MRCA 2XWEA 1GEQA 3UW6A 3CX5J 4NQ1A 3UJTL 1W3KA 1ND0B 2HWZL 3VC5A 4GQRA 3II3A 3ITCA 1R4XA 5IP4A 5LKYA 1VESA 3BOLA 5I8EB 3RX5A 1DQTA 4B9YA 4KTEL 1YQ2A 3BGFB 5TD4A 4WEEA 4KFOA 2C1PB 3MRKA 4HN8A 3W1AA 4W7WA 3IPEA 3OG3A 3FB8A 2ABAA 3AQDA 25C8L 3DUHA 4XN1A 4GG9A 2NT1A 3SYQA 4XO8A 2BV9A 3S1VA 3TASA 3MA7A 1HYSD 3QB7C 1KQZA 4Q9QL 3JWNG 3BVWA 4ODHL 3QW9A 4XG1A 3IFLH 1ZSDA 1VAHA 2QVFB 4QHRA 4MA3B 1N7ML 2D31B 1TQVA 4L23A 1RIUL 4DP9X 1OKEA 1AKJD 1PSKL 3U79A 4UAOC 5EORL 1PLGL 2A9DA 3QZWG 1AJ2A 2WNKA 1GAFL 3LKPA 4F7PB 1B4EA 1VA9A 2PXYC 4UYPA 2EXOA 4TR9A 1JZFA 3CQHA 3CTLA 4M7TA 5DD1L 5KANG 1S9XA 1GHFH 5DMIH 4QAMB 2CLZA 5JIKA 3QG6A 3PUOA 3QJVB 5FUOL 2D2GA 4WAFA 3W25A 2OMWA 1SQ2N 4I4WA 4Z7WA 3B37A 4ERGA 3JUZA 1Z9PA 3QTGA 3MRDA 1NLBH 2PRMA 3HG3A 3M47A 4J3OF 1GGIL 1XINA 3U7VA 1E9QB 3TPUA 2P47B 3V8OA 4EBQH 4CW1B 4FFVC 1FRGL 4W70A 4AZGA 5LGJB 3N25A 5E94A 4OQTA 1L9QA 3PZQA 3D46A 4LU5L 4H00A 1O6VA 2ZRZA 5CEWA 3Q2WA 4Q14A 1RAMA 2HLFC 5TK2A 4WWKB 2EH7L 4X9FA 4L4LA 2HJFA 2EVGA 1UWRA 4DP7X 4P59L 5FUCC 4FTVE 4JN2B 5AVSB 3U7AA 3QXAA 1NAMH 4DUOA 4CQDA 4OSUH 1QR7A 3UJJL 1HSAA 1A22B 3MRRA 2HRLA 5DU7A 3C0SA 2ITDA 1C5DA 4J6IA 5ECUA 3GSOB 2AEQL 1IM3B 1NANI 1QFHA 2NVDA 4YHOH 4BFEA 3LY0A 4E4PA 3GSMA 1LL4A 2JTDA 4V2BA 4ZSOA 3PHOA 3CUHA 2AJUL 4WJEA 1BEYL 3UAJC 1IGCH 1BYOA 3VOGA 1TPXC 1QNIA 4F7EB 1QSFA 2J8UB 1BYDA 4IHCA 1F0LA 4NFBA 4P7QA 2K3TA 3MR9B 1JPGB 1V3LA 2ZAIA 2E8ZA 1UZ6F 3P9WB 4ZW6A 4ZS7H 4N6FA 4ZQMA 5AOKA 3LZFL 1ZENA 2G5UA 1HTYA 3R8BB 3LHVA 2BVPA 3XIMA 1I8LC 1JGLH 5JW3H 4P2RA 1X7QB 4P2CG 2EACA 1E9IA 3KLHC 4IICA 1RU9H 1XIJA 5A69A 2H2PD 3N15A 3M5YA 3HE6A 2UZXB 2OMUB 2E76C 3E12A 4WUUD 1G7JB 3CPLA 3ABXA 3QPXL 2W0LA 4L8SC 1J5IA 4Z7OE 1XGRA 2VQ4A 4HD5A 4UTTC 2A6IB 2HKHL 1KTBA 2DI7A 3ZHKA 4CGTA 5GGVY 1NTDA 2E56A 2OELA 1A5NC 1DZBA 3D4ZA 4GRLC 4NOBA 3SDDC 1WA1X 4L5FL 3VSTA 3T07A 1K02A 3U6WA 3X11A 3EMZA 1CICC 3BV7A 4JFZH 3VWJC 3FDWA 3G8RA 2R1LA 4BV1A 5EO1A 3SDYL 4N9CA 2UUDH 1OF8A 1E4NA 5E7FA 5AVNA 3WL0A 3NZ1A 2OR9H 3S8GB 2WLJA 4Y4KC 2XN9A 4FG2A 4BCYA 2YD3A 4XP5L 5IFAL 4Y7MA 2Z24A 1BJ8A 4AD0A 2J6WA 1T5XA 2F61A 1TIMA 2F7PA 4OLVH 5D7IF 2OPCA 1DXFA 2UY4A 4YSDA 2HLAB 3IDYB 1N19A 4QGYA 2JK5B 2Z8VC 4ES4A 4XXDA 3AQUA 4FO4A 2V7HB 2GW5A 5A3IC 3RCNA 5IOBA 2E9BA 4LOVA 4Y2DD 4EUPA 2PWVA 2AQNA 3A4FA 2WJ7A 2EG6A 3QQ1A 4YHEA 3B9DA 4W68A 1XIWC 2IXQB 4ATLA 4HAFA 3SSJA 3B9KD 2Z00A 3ZRSA 2AK4D 4DQOH 4OF7A 4IPIA 3IJSB 3RVTD 3JV6A 1SNRA 2KERA 2EIKB 2H1PL 4CD7A 1LDPH 4R9XA 4GXPA 1FLTX 1PX4A 4N9EA 3DBXA 3UZXA 3WYZA 5IIEA 1UQZA 4LLYA 2YXFA 3FYIB 1EHXA 4LTSA 3NZSA 2JCCB 4U1GB 1NC2A 3FK4A 1VPXA 2WJDA 3NSFA 5JQIB 2PETA 3O41A 1AGFA 1MLCB 3FU8A 2A7RA 2Q8AH 3W7JA 4Z0BL 4HKZA 4LLQA 1RERA 1N0LB 2H5UA 1Q1JL 2E74C 2XTJE 2JIXD 1A4CA 4AMAA 4OQTL 5DJDA 3NIFB 5IBLD 4I87A 3FU6A 1C93A 4WO4B 4AJ0A 3VCRA 2A2IA 3VQ1C 2WSPA 2WQAA 4J1UB 1C5CH 3UC2A 2OPJA 1VGEL 2YJLA 2PW2B 3BGJA 2G37A 3GHBL 3OAYK 3VX1A 5E23A 3LZOA 2JBMA 3CFJB 3MNWB 4LCYA 2A74A 5I1LB 2DQCL 4FHAA 4ENLA 2QR0B 3NQ6A 2IMMA 4FF5A 5FWQA 3DX2A 5L2KD 2JKJA 3GGWA 2BVDA 1KFEA 4F9PA 1U83A 5DHMC 3SQOH 5FEZA 3DBPA 4FX5A 3O3BB 3VGGA 4AKPA 4QPEA 2PP1A 1IM9A 4YHNA 1FGVL 4EAYA 1A50A 3QJFB 2P53A 3N2CA 3CC5A 4TUKH 3GTNA 4WJ5A 3CN1A 3TC7A 2QKFA 4M7KH 2A4EA 1HGYA 3DOSA 1FYTA 2HTLC 2XHYA 3CXFA 2PAJA 4L7ZA 2L8AA 5AYXA 4ZMTA 1TKKA 1W72B 4FPSA 3S35H 3ZL1A 3U9UB 3LPPA 4GKZA 3H42H 4W85A 3GMLB 4ZBCA 2E9MA 3GMPB 1UXWA 3VKCA 3EYSH 4FLQA 2MH4A 2AITA 1W5NA 3K71B 4IPJA 1MLBB 5F6IC 1SPQA 5HHPB 1CE1L 3IJLA 1LO0L 4S3AA 3QPZA 4XCFL 1POJA 2VHLA 3TWCH 1IEWA 5CZKA 2DMBA 1A5MC 2OMBA 4NT0A 4LSBA 5LGYA 2D03H 2GFBB 3V7MA 3OVUB 4U1JA 1E0XA 2R9RA 2AJZB 5HTSA 1KCVH 4A63A 1W3LA 2GT9B 4OQVA 5F1IB 1X5YA 4UCGA 5EWIL 3VI3E 1Q7MA 4IRJD 1UQSA 1DANT 3EFDL 5FYJU 4QR7A 4DKFH 1ADOA 3X14B 1YCSA 5C70A 2J8UF 4JPIB 1YO4A 4NT6B 1AJ0A 1T66D 1TZIB 3VIGA 1DVTA 2X4TB 2HYMA 4XCEA 1GW6A 4GH1A 3AFLA 5SWSB 5HYJB 4N0UE 4F27A 3W7MA 1DBAL 1NKOA 2IFFH 1BM3L 2XXFA 3KX6A 1IZJA 4HWZA 2XC8A 1OK6A 4GUCA 2E68A 3T6XA 4NKMA 4HU3A 5E2TH 3OAZK 1J9QA 4R84A 3GNXA 2VZOA 4HZ6A 1US0A 4XNXH 1Q4WA 1HI6B 5LXVA 3MKCA 3HE6C 2ITCA 5C7HA 5D1ZI 1AGCA 3QDJE 4NZFA 4DB7A 3MMWA 4LBEB 2JB6A 1F6YA 3FK3A 2PWHA 4KF1A 4D0BA 4JTKA 3OU8A 2RAMA 1XF3A 4UDTA 1MREL 5I1IH 1RIHH 4CC0A 3LV6A 1F86A 2DQUH 4U5IA 3SAZA 4V1YA 3VDHA 3NACH 3A3WA 4RGMC 4PPTA 2IS7A 3A3XA 2Z0UA 5FIEA 3TP4A 4V1DA 2F2KA 2QUMA 3CN4A 3VFRA 4KQ3H 1VS1A 4PJIE 3BQ6A 2I7GA 5JBEA 5F2LA 4KGLA 3DOHA 4M29A 3QQ0A 5IR1A 4R4FL 3ERPA 1XGUA 2FWOB 2QEZA 3NCFB 4ZR8A 3TJEL 2ZKHH 3AUJA 3DVIA 2BNRD 3NYKA 4E8CA 4K0OA 4JO5A 5EC2A 3MLZL 1KPUB 3B3IA 4PLKD 2FZ3A 5MEOA 3LJ3A 4LHUB 4E8GA 2XRAH 4TOYH 2WUBL 3SDXA 4AV4A 1LOLA 2QTEA 3L9YA 1XLBA 3IKCA 3DVNB 4JIRA 1MFBL 4Y8EA 2VQ1A 2GJXB 3UP8A 5I30L 4QRTA 4LVEA 5E8OB 4POZC 2AEWA 1WDPA 1PJ9A 5I8OH 4PJ9B 1SFSA 4LVBA 2W88A 3H2WA 5HDWA 4OM0L 4JS3A 2WXLA 5C7ZA 5C08E 5AVQB 4GMSH 3RLGA 5KAQG 1E28A 3QFDB 3CAKA 1TQCB 2R51A 1S7QB 4E42B 5CEZL 4PTVA 4ZFMA 2X7LA 3RUGF 4IPLA 4ZO8A 1PD6A 1FKXA 4G5ZH 4FQPA 1WIUA 4ZUWB 3LZ5A 3MYPA 5E6RB 4B96A 4KKCD 4DN4L 4KVCH 1YTEA 2B1OA 3RVWD 3KW8A 3W9EB 2DV0A 4YXHH 2V38A 4F9DA 1O66A 2C7UB 2OTWB 5B1BB 1R8LA 1DQDL 1V6WA 3EG9B 4J12A 2JKRM 4HJ0C 3VI4B 1NGYA 3F5WB 1R17A 3KYKL 1JE6A 5TE4L 4HWEH 4GUFA 2FT6A 1D6EA 4X4ZA 3ZQXA 3DSNA 5ENLA 5FKPA 4EIZC 3H6AA 3VIJA 6ALDA 3GR7A 5DS8B 1ASQA 4L8CA 4CCZA 3CM4A 1CTOA 5JLZA 2I60H 4ONGL 1QYGH 1T03L 3MVIA 3RGHA 5C0JB 2VWEC 2A74C 1E5UI 1J05B 2LVEA 2HH0H 1MSPA 3DIDA 2WCSA 2QKSA 5I66B 1P5UA 4BXSV 4JFUA 2P3EA 1ECZA 3LSOB 5JW4N 2E6AA 4N7QA 1IEAB 4PGDA 3MT1A 1AD9A 1T0NB 3T6CA 3AACA 3T8QA 5J6GA 4I5BA 4BFNA 3G6JB 1YNTA 2VEFA 4GMTL 3EJSA 3T4AA 5E03A 1TZ7A 3NXFA 4NQED 2CZFA 2FJSA 1F4AA 2X0SA 4E0CA 3BDBA 3JT2A 2YLLA 1F3XA 2K7PA 3IAQA 2XH7A 1DQXA 1H7PA 1FGNH 5AW3B 3CT7A 4OT1H 1AQDB 4XZWA 3IDGA 3PDOA 1WFIA 4D71A 1UFUA 1DEEB 2EC9U 3DIFA 2ZRYA 5ESAA 4WQ6A 4W4OC 5IKCB 1OCRB 2E5DA 3VQLA 5TDOB 5FC9A 5I9QB 1Z44A 5J13C 3BSZA 4PAZA 4ERAA 1HAUA 4YBLB 1CD1A 1KUMA 4NQDD 5B38G 3ANVA 4M6OH 1LRNA 3QIBA 3W37A 2E7LA 4MJIE 4GD0A 3U5UA 4P5TA 1ZHNB 2F5AH 4E5XG 3LOTA 4XR8C 3UADA 3LS5H 2WV8A 2Y36L 1I7UA 1G6CA 3WLWD 3KBPA 1UOWA 4NRRA 1UR3M 2AL2B 3CD4A 4R4BB 5JPMC 4EXPX 4CGUB 1ZJHA 2NV2A 4DT2A 3TYUA 3SO3B 2XWTA 2IDUA 2PCYA 2YK1L 4O4VA 5D7SL 3O45B 3V5OA 3JTSA 3ROLB 4RMTA 4Z95L 5ACLA 2MNWA 5B1CA 3TT1L 4G2DA 3WMCA 5HY9A 4HBQA 1JCVA 2YPKA 4F7MB 5G55A 3OQ8A 2PWGA 4FQLL 5H35A 4E41D 1EXGA 3GRIA 3TZFA 4B5ZA 3GI8L 2IGLA 1MQQA 4HWBH 4WDTA 4ZXBA 2EYTB 1LL7A 3OJGA 3TH3T 2CBUA 5TE7H 3MJ8B 3ES6A 1TJPA 5T1KA 1UD4A 3L5XL 2XIIA 1U1UA 3B8WA 1WFNA 5CJQH 4XAWH 4K8RH 1OE3A 3E6HB 3FFCE 3S3CB 4PB0H 4OI9A 4B2DD 1I82A 4ADTA 4LBUA 3VFOA 4AG4H 4LLMA 1EEZB 4S1RH 1IGML 4BGLA 4WKXA 5FFLA 3ZL4H 3FSUA 2TMDA 4PEEA 4AVHA 5HJLA 1N2RB 2WM1A 3HS0B 3VUSA 3EYQD 3DFQA 5ABFA 1UC6A 1GOGA 1H0GA 43CAB 1XR9A 3MCOA 4A8IA 3RWJA 2YGPA 3GNNA 2CLLA 3JTTA 3SQBA 2DN7A 1U41A 3C9NB 2ISVA 1A49A 3P1VA 5J11B 1SZGA 2A85A 2XTKA 4ONFH 4QRNA 4KRZA 4LQ1A 1ES0A 2FJGB 4PV9A 3EXLA 4OTXL 3G04A 4WCYH 3DN5A 4POCA 4Q2ZB 4BSVB 4MSWB 3I68A 1PPIA 4WI4A 3F12B 3C5ZA 3LLFA 4A6YB 4XZNX 4KKXA 4QS5A 1GJWA 1TV8A 3FCTA 3QUZB 3DFSA 3TIMA 1ZVSA 1CXHA 3PZTA 1LP9E 4WSJA 3TEYA 2Y7QA 4EQ3A 5DBUA 2J8FA 1FP5A 4OH2A 4F9JA 4FR6A 3KR3H 5IFHH 2WB7A 4AQAB 1ICSA 2DL9A 1G7HB 1KY6A 3M07A 5KSAA 1YYLH 3MODL 3P9MA 2ZA1A 4PBEA 4QRRD 3TEUA 2AI0H 3NQMA 1M7IA 2PTXA 3VI4F 3BP4B 1L2UA 4XNQA 4RE0A 4HALA 1AJZA 1T6VN 3O2WH 3B4NA 3QEUB 1DLHB 3BLBA 1YPZE 3R4IA 2IAAC 5SWZE 1A65A 3ARXA 2J75A 4KEVA 3BSZL 2XTLA 3GTVA 4PMZA 4NNCA 3VGDA 3C2AH 1SJAA 2HXAA 2F53B 1W9PA 2Q8BL 3VD4A 3ZHNA 4NZ5A 4LYKA 2JJSA 1OHLA 5BU9A 2IKGA 1Q63A 4CC4A 4M61B 4M8RA 5IMLB 3H9SB 4PY8I 4JNXA 1ME9A 5CSGA 3PNWA 5HJ3A 1MFAL 4GBXA 3UZYA 1U92B 4TSAH 1OGAE 4PB9L 4MAUH 1NGXA 3VXSA 1Q6QA 4A1RA 3SJVE 2CSPA 1F4XL 5BNKA 5FUCE 1M1XB 4H25B 1BFTA 1DBBH 1IC4H 1RSFA 4ODWB 3UZ5A 2ZOXA 3BQVA 3RM4A 4QNPF 4FOUA 3B5GA 1PF3A 4MAYB 3TL5A 2CKRA 3MJWA 4RCXA 3L95B 3MBXL 1CDGA 4IG2A 1G7IA 1E1EA 1EX5A 1UWIA 2OI9B 4QHMA 3MREA 3NFUA 1XKYA 4JFQB 3T4AC 2G3MA 4IU3B 2Q8ZA 1SOXA 4K3EH 2WXRA 4TVUA 3B4UA 2CDGB 2JQAA 4RIRB 1KBGH 2Z0BA 5IBUB 3I74A 4PYSA 3FQTB 4KKAD 3OHMB 1KMGA 4WHYG 5JOPD 2P5PA 3S48A 2A9ML 2QKIA 3EZ8A 2TRHA 4C1NB 3TO4D 1HOCA 4IBWA 2R0LL 4MDIA 4R7VA 1PZAA 4DX3A 4O1FA 5CNHA 3IV3A 1WZLA 3UTOA 3M1CA 3ZR4A 4PG9A 2JE8A 3ATAA 3L9BA 1J5DA 4YDZA 2WKOA 2PO6A 4IBQA 2YSWA 5HUPA 3G6DL 1UXLA 3W6MA 2DDQL 3EGXA 3ID7A 3GYCA 4XBSA 3VFLA 4N3TA 2E7LC 1RCQA 1R3IL 3W1UA 1EDGA 3FYYA 2AJVH 4Z2GA 2OZ0A 4BDVA 5LIKX 4P5TC 1IBBA 3UPAA 1H63A 3RPDA 4OUEA 4MKMA 3EB4A 1OABA 3UH8A 3C2VA 2ESVE 3EH5B 5AVHA 1BV8A 4CEUC 1TQXA 5IJCC 4Z76A 2JLPA 1JCYA 5D1XE 5C0ND 2G41A 1GW9A 4A7QA 1R87A 3WHE1 4MS8D 1JVKA 1YEDB 1G84A 1Z3GL 4M5ZL 1IXOA 1E67A 4HS3B 5C0DA 4CNPA 2R2BA 4YL2A 4I7UA 4L8BB 4Y90A 2I9EA 3BI9X 4JFVA 2VJXA 1BQHG 1J0JA 2DM7A 4AWTA 4PRID 4Y0GA 1H62A 3T8XB 4DO6A 4HMEA 3KPMA 3RK8A 3C8HA 2DM2A 4C47A 5FOOA 1B3ZA 4PJ7E 1UWXH 2XSBA 3UBXG 4DGVH 4LS0A 1UM5L 4YEFA 2NY4D 1K3IA 4NQXA 3GJEA 3KBWA 2WXDM 4RGND 4JYDA 1HZKA 4R26H 4B3EA 4Q9RH 1OO2A 3DIVA 3WIFB