1JXKA

Role of ethe mobile loop in the mehanism of human salivary amylase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
491
structure length
491
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
publication title Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase
pubmed doi rcsb
source organism Homo sapiens
total genus 179
structure length 491
sequence length 491
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1jxkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jxkA01
1JXJA 1KCKA 3H54A 5CGTA 1E70M 2G8ZA 1ZJAA 4UQBA 1Q6DA 2PWFA 1HJVA 3VSVA 1NM9A 1E6NA 4ZE5A 2XN1A 1E3ZA 3CZGA 5FL1A 4GZEA 1MQRA 3VINA 2DEPA 3VD4A 1WZKA 1XCWA 1OINA 3POCA 1CEOA 3WNMA 2W5FA 3WL0A 1WP6A 1ESWA 5BYWA 5ECUA 3RILA 1MQQA 3WEZA 5A6BD 4AD5A 4J28A 3CZSA 3OBAA 3MSDA 1Q6EA 1KB3A 2F1BA 1JNEA 1UQZA 6CGTA 3RIKA 3MSGA 2XUCA 4W5ZA 4ZENA 3S6TA 4BCEA 2JIEA 3ZJ7A 1UD2A 1MQPA 3SCSA 1T0OA 3OLDA 1ZJBA 4AD2A 2VT0A 1K9TA 3BVUA 1WDQA 4AD3A 3UEQA 3SUTA 1GCYA 2XVNA 3QHNA 4Q7NA 1XHGA 1FHLA 1BQCA 4WSJA 1HN1A 1TE1A 4B3LA 1F4HA 2OWCA 3PZQA 4UFIA 2G4FA 4J3UA 2CHNA 1HKIA 1RD6A 1W2VA 1A3HA 3WQ8A 2WVTA 2QF8A 1BSIA 1DEDA 1OB0A 1EDTA 1KBKA 3WNNA 2BFGA 1EHAA 4CU6A 3DX1A 1B1YA 1HJXA 3MUZ1 4UOJA 3CHDA 1U30A 3BSGA 3WIJA 1R47A 1FOBA 3WH7A 2YL8A 2W67A 3ZO9A 3ZQ9A 4UFLA 3TOPA 4CD7A 1JZ7A 1R33A 1QNOA 2BY0A 4MAZA 4CD8A 5EB8A 4PMYA 4WJXA 3EDKA 3T2PA 3IJ7A 1QBBA 1QNQA 4CGTA 1ZBVA 2ZUNA 3WD1A 2YOCA 1TCMA 3FAWA 2VX5A 4KWUA 4BQ3A 3WSUA 1JYNA 1Q4NX 1LJYA 2YA1A 4RE4A 1TUXA 1UHVA 1XGZA 4CN4A 3U5YA 4AY1A 3T0BA 3AS2A 2DSWA 1MYRA 3AI0A 3O9NA 2YL9A 5CZKA 2XJ7A 1KXQA 1HVXA 1IZJA 3DYPA 2A3AA 3AS0A 4B16A 2EABA 3MUAA 4DWSA 4MNLA 1ODZA 4AZ6A 4QLLA 1VFFA 2CETA 4Z2JA 3F5JA 1MFVA 1B0IA 4AMXA 4HPHA 1PJ9A 2ZUVA 1QOXA 3KWXA 4DO5A 3SUSA 1CGUA 4RE3A 3CZNA 1EIBA 3BUIA 1GOMA 2OLHA 2GJXB 1V03A 2XN2A 1US2A 1CZ1A 1PIFA 4QAWA 2MANA 1E1EA 3L4TA 2DT0A 2WVVA 5A8QA 3NIYA 1NOUA 3II1A 2VVSA 4JKLA 4P7RA 3BLPX 2XIIA 3TTQA 4AZ7A 4C7FA 3AICA 4W88A 1KR1A 1GONA 4ATWA 2E0PA 1B9ZA 1HJQA 1JIBA 4ATDA 5I79A 4HU0A 1LLOA 3CMGA 4GXPA 3WBAA 1TVPA 3IAQA 4ZEPA 1E43A 3WEOA 4YPJA 2BY3A 4W89A 3TONA 5DT7A 1K6AA 4NZJA 4WKFA 1K9EA 1MVYA 2XG9A 2VZUA 1UWQA 2XM2A 3UR7A 2ZX6A 5D9OA 1CXLA 2WWCA 4GPNA 4UTFA 3S5ZA 4OKDA 2BVDA 2Y4SA 1RP8A 2EADA 1C91A 2J7FA 4DUVA 1TQVA 2WLZA 4E2OA 1VFUA 1LWJA 3OLIA 4D6JA 3WD0A 3N11A 2DT3A 2YDRA 5JBFA 3VD3A 3BAYA 2WC3A 3LRLA 2QHAA 5C70A 4X9YA 1SMAA 4AC1X 1UQYA 1HL8A 3EBVA 4IUGA 3U7VA 3K8LA 1EDGA 1J0YA 5E1QA 3ARQA 3NDYA 2ZIDA 1TQTA 2WHLA 2E4TA 4KMQA 3A22A 4QCEA 2VZVA 3I3DA 1I75A 1BLIA 3SCPA 1V6XA 1P6WA 3N9KA 2GJPA 4DWSD 2Y2WA 1R46A 3B9EA 4GO8A 1JZ3A 1G01A 4PMQA 1G0CA 3BMVA 2WHMA 3NSXA 1W9PA 4IM4A 3IGUA 5ABGA 4GINA 3A47A 3CH9A 2ZX9A 5IFPA 3VGDA 1E56A 2GVYA 1CTNA 3LRMA 1UD3A 3GBEA 3GXTA 1O7AA 4U2ZA 4WK9A 1EDQA 1UD5A 2XFRA 1QBAA 2OWXA 3WH9A 4CD6A 3UR8A 1ZU8A 4J3XA 1HWWA 1MW2A 3BC9A 1HVQA 1G9HA 3W4RA 3LPGA 2YIHA 4FF5A 2A3EA 4JFTA 4NRRA 3BVXA 2VX7A 3BUBA 1CXIA 1WDSA 1XH1A 1GVYA 2J62A 3WN6A 4DWSB 1CGVA 1W3JA 3AYRA 3GYCA 4PYSA 3GDBA 4F79A 2VI0A 3U7BA 1R86A 1QW8A 3MKKA 4HOWA 2WBGA 1E6RA 4KGJA 2XSBA 2VZOA 3KZSA 2XVKA 1G5AA 4PTMA 1B3WA 3H55A 2IXUA 4D6EA 4D6HA 4GZIA 2Y8KA 3LPFA 3GTNA 4AZ5A 2FHFA 1MWOA 3T2OA 3GNOA 2WVVB 4UQCA 2XPKA 3FY1A 1VFMA 4PMZA 2OWWA 3VIHA 4DM1A 4CKQA 3T09A 5DMYA 3RO8A 3W82A 4TVCA 4H2CA 1VRXA 1Y7VA 1OD0A 1ISWA 4W5UA 4AWEA 1C8XA 3WDQA 2C7FA 2VOTA 2WZIA 5JIPA 1BG4A 3PN8A 4NX0A 1CECA 3K1DA 3AHTA 4WF7A 1J0ZA 3RM4A 3HMCA 5JBDA 3WUBA 5JUVA 2BVYA 2X05A 1QI0A 3SUWA 4GZJA 1GPFA 4WIWA 4N0RA 5LYRA 4UOQA 4WKAA 2DH2A 3K4AA 5A8OA 1NQ6A 2F7RA 3NSMA 5A2AA 2ESCA 2PWGA 4JL2A 5E6YA 5C8BB 2F18A 4TX8A 1DWGM 3IAPA 4XB3A 1M53A 2W4XA 1X6LA 5I23A 4D6CA 1MW0A 4Y7EA 1UUQA 1SZNA 5E09A 2VX6A 4S3JA 3VDBA 1IZKA 5D8WA 3FNDA 1UYQA 1XV8A 3BVWA 1QHOA 3MUY1 3D52A 2J74A 4TVDA 2UY4A 3L4ZA 3CC1A 1J12A 1TMQA 1GOIA 3CHFA 4AMWA 3SUUA 1FP8A 3SCVA 3ZSTA 3VO0A 2DIEA 3W38A 1B2YA 1JXKA 1FH9A 1HP5A 4UOZA 5I6SA 3SCTA 1TQUA 1J0IA 1UWRA 5A6MA 5BXRA 3WD3A 4AZHA 3EJUA 4B15A 5AC5A 2CHOA 2PI6A 4W7VA 4HA1A 2YL6A 2J7BA 3EMQA 3ZM8A 1OT2A 3PZVA 1WZAA 3BGAA 4CCDA 1LL4A 2WB5A 1C8YA 3POHA 4D1JA 3WNPA 3BMWA 1HKKA 4U5IA 2WKGA 4H04A 5BXPA 3HG2A 2W62A 2FYVA 2BXYA 3ZMRA 3WY4A 2XFFA 3OZPA 5HBFA 4PCSA 1NOFA 1WAWA 4Z2IA 1OBAA 4N42A 3WMSA 1W9BM 4BA0A 3CUJA 2X2YA 2D0GA 5IHRA 4EE9A 1UKQA 5HPCA 3KL3A 4HP5A 1WDRA 3B9AA 3J7HA 3RM9A 2V5CA 4PMXA 3WMBA 3TA9A 3VNYA 3DYMA 1FFQA 3AHVA 3QR3A 5GNXA 2XGBA 3DX3A 5F7UA 8A3HA 3LPPA 1BAGA 1KWGA 2Q8XA 4OZOA 4UZUA 3K8KA 1JYWA 2ZUMA 2Z1KA 1JAEA 1L0PA 1OIFA 1TR1A 4W87A 5A2CA 2CIPA 3BLBA 3E1F1 3VPLA 1ECEA 1LF1A 1GQIA 3A23A 1TG7A 1SMDA 4M82A 3SCNA 3W37A 3EDFA 1VAHA 5D4YA 4XX6A 1MXGA 5KZ6A 4BQ5A 3VD7A 4UFKA 2A3CA 3WQ5A 3GXDA 3LPOA 3TTYA 3BXWA 1GUVA 1TVNA 1KBBA 1E72M 4M29A 5FKYA 2W92A 2D73A 3RCNA 1EO7A 4AEEA 3NSNA 1TA3A 4HZ7A 5DT5A 4J3SA 3ARYA 5IFTA 4JFVA 4E8CA 2Y24A 2A3BA 1NOWA 3VIJA 1NARA 1BGAA 3BAKA 3DX4A 4IPNB 3L2MA 1K9DA 4W8BA 4JKKA 4MTVA 2X0HA 3BLKA 2BXZA 4AMCA 1XSKA 3AZTA 1UR9A 5LA0A 1O7DC 3SCUA 3EJPA 3ZJ8A 4ZXOA 1KQYA 3VGEA 3VGBA 1CDGA 1BPLB 2O9TA 2DGAA 5FCZA 3K46A 4XZBA 2GJXA 2Z1SA 3G6MA 3VUPA 4NRSA 4DO4A 1J11A 2PBOA 5A8MA 3DC0A 3PZMA 5M5DA 3SIMA 4MJ2A 2WLYA 4EK7A 3UG4A 4JFWA 2G3JA 3CHEA 4D6DA 1W9DM 2DPEA 2VCBA 1E6SM 2JE8A 3WD4A 3A4AA 4LYPA 4IISA 1DWIM 2EPLX 1JDCA 1B3ZA 3GXPA 3ZR6A 2CYGA 3W81A 1XRVA 1HP4A 1GOWA 2ZOXA 2ZICA 3GXFA 1BYDA 3CO4A 4QLJA 1JZ4A 2FE0A 1D7FA 3OIHA 4CVUA 1E40A 1ZL1A 2CBIA 1VB9A 2WZEA 3AIVA 5M3WA 1CGTA 4LGXA 4TUFA 4D71A 1RP9A 1BG9A 1UD4A 3T2QA 1KCLA 4JAWA 1DWJM 4UFMA 3AHXA 3EMZA 2X2HA 2O92A 1GZJA 3OGVA 3N1AA 4GI6A 3WY1A 1EA9C 2E3ZA 4WLCA 3GXNA 4FNTA 1XH2A 4HA3A 3NDZA 1LQ0A 5HOSA 2AOSA 3L4XA 1GHRA 1J18A 3MUIA 4K68A 2BHZA 3KL0A 1EXPA 2IUZA 2YDQA 1VEMA 4AIEA 4AD0A 4BQ2A 3ARZA 1LL6A 3RJYA 4TTGA 3PZOA 1PEZA 5D9NA 5A8PA 5A1AA 1E4NA 3BAJA 2OW7A 4AISA 3RJXA 1E5NA 3U57A 2V3FA 2EPMX 4AZGA 2XGIA 2VURA 4F8XA 3N04A 4PMVA 3K4DA 1EQPA 3D4ZA 4BZYA 5EMYA 1M7XA 2VZTA 3AIQA 4AIUA 5CLTA 2UY3A 4MDOA 3F5KA 3CV5A 1W1YA 1XSJA 4OOUA 1E1FA 4M80A 1JYXA 3VNZA 1CGWA 2QLYA 2JFEX 3BCFA 2ZX8A 3FHAA 1TQWA 4J3WA 3WKZA 1GQJA 3BUDA 1BYCA 2VC9A 2EBNA 1C92A 4TXEA 1TA3B 4DM2A 1W1PA 4E8DA 4U2YA 2WANA 1AMYA 2J75A 2WHKA 3ARXA 4Q22A 3WFZA 2F7OA 1HTYA 1QNRA 1UOKA 2WMKA 2FHCA 7CGTA 1H11A 1H4PA 1B90A 1AQMA 3THDA 4HZ8A 2DQXA 1I1XA 5FOOA 5IHSA 1XH0A 2J25A 2OYLA 3M6DA 3WF0A 5BXTA 3WDHA 2D3NA 2WSPA 2ZX7A 4UR9A 1ZBWA 2ZXBA 3IJ8A 5DEZA 1UWTA 3ARWA 4H8HA 4PTWA 3EJRA 4AD4A 3ZJ6A 2WCAA 3WH8A 2NT1A 1V02A 3GXIA 2E8YA 3UG5A 1MW1A 1E15A 2A3HA 5I2UA 5D9PA 3VIPA 3LXBA 2Y8VA 3G6LA 4YHEA 1W1VA 4W8AA 2JIWA 1PAMA 2VUYA 2VRKA 3O6AA 4JHZA 3VGGA 3VDHA 1JDAA 2J79A 3ARSA 3W28A 1DWFM 3T08A 3SUVA 1QVBA 3CPUA 5GNZA 1HKMA 1VBUA 3BAIA 1D3CA 3A21A 1UKSA 1J10A 1J0JA 3WNOA 2DT2A 3IJ9A 2CESA 5A3HA 4FLQA 4S3KA 1I1WA 4NSBA 3WMCA 1JGIA 1ZBKA 2VCAA 1A47A 5E0FA 4BF7A 4D6FA 1FH8A 1UZ4A 1VF8A 2VQTA 1CGXA 1UA7A 3AIBA 4PUEA 1HJSA 1KXVA 1JFHA 1K9FA 3UESA 2D3LA 3CZEA 1V3KA 1OGSA 1ISZA 3ZR5A 2YLAA 7TAAA 2FHBA 1WCGA 1QI4A 1EHNA 4H8VA 2BV9A 1XYFA 3AHYA 4JKMA 4TOQA 1C7TA 2ZXDA 5AYBA 2DSKA 3VKKA 3WQ4A 1F4AA 5GNYA 4NXKA 1HJUA 3FW6A 3L2LA 5I5RA 1E4IA 1E6XM 3FN9A 4W7WA 1CIUA 4OGZA 1OGGA 3M46A 3DHUA 2GK1A 8CGTA 4WKHA 3DHPA 4HMDA 2D22A 1UWIA 5AYIA 4ML4A 1GOQA 3AROA 5CSYA 1E0VA 4UFJA 4TTUA 3W24A 4HPGA 4PMRA 1PS3A 3TTOA 3QHOA 5CPQA 4JIEA 2PWDA 4LPCA 4U3CA 2HVMA 2RGMA 3OB8A 3VD5A 1JF5A 2ZUUA 1YQ2A 3AMDA 3PZGA 2V3DA 4ACYA 1RPKA 3EDJA 2C0HA 2VR4A 4PSPA 4H7VA 2BNJA 3A24A 1O6IA 1H49A 3FHQA 5A95A 2V5DA 4XZWA 1RH9A 1FP9A 4M1RA 1UH3A 1HXJA 1V3LA 1QHPA 3ZJKA 4FNSA 2OSWA 2DT1A 3WQVA 2WKLA 1JDDA 1C93A 1U33A 1OSEA 3RPMA 1ISYA 2XIBA 3HG5A 1UWUA 4FNUA 4PEEA 1W9VA 1DP0A 3N15A 1W3HA 1E9LA 3WDPP 4CD5A 2DIJA 3JUGA 3KLKA 1GQLA 6TAAA 3AHZA 3ZT6A 1R85A 1B3YA 3W6MA 3A4WA 2FH6A 3AJ7A 2GFTA 1C3FA 3W29A 1MW3A 3CUGA 2YBUA 1GQKA 1JAKA 1H0IA 5ABEA 1NWRA 1B3VA 1JZ2A 2WMIB 4Z2GA 4W93A 1UR4A 2WMFA 3VTRA 3VSUA 5FIPA 2DSZA 2XM1A 4A4AA 4OOZA 3MMWA 2NSXA 3LXAA 5FD0A 1CXFA 3PZ9A 3N12A 1S46A 1KWKA 2UY2A 5E0CA 4P8UA 1NWTA 1PBGA 4OBRA 1ITCA 4D1IA 2WVSA 4V27A 3VU2A 4GQQA 2F1AA 2X2IA 5A6LA 1FA2A 4MADA 4ZXLA 1H41A 1PX3A 3NJ3A 4D6GA 5HXMA 3PTKA 5GPRA 2BHUA 1GHSA 3NUKA 4GO9A 1TZ7A 2GSJA 5CG0A 2F7PA 1VFOA 1KXHA 3W26A 2ALWA 3WUFA 2W63A 2C8NA 3VD9A 2OSYA 3CZ8A 3ARTA 2XVPA 5JBEA 2DDXA 1UKPA 4QCFA 2W66A 4E4PA 3WH5A 1WB0A 5BRQA 2WWDA 4F9DA 3A3HA 3VDCA 1J9YA 4XV0A 3A5VA 4U3AA 2D20A 4X0VA 3VIIA 2GK1B 3LX9A 1VJZA 4FLOA 5BROA 3U5UA 2DH3A 2XHYA 1FFRA 3VIKA 1JD9A 4M56A 1CNVA 3GZAA 2F2HA 4ZE4A 5CSUA 3KL5A 1B31A 2YL5A 2WNWA 2WZHA 1DWAM 3QHMA 1GVIA 2CPUA 2J7CA 5DO8A 4RE2A 3SCWA 4FMVA 1H0GA 3GH5A 4PMDA 1LG1A 4TX6A 2XVLA 2ZXQA 3CLWA 5EBAA 2G41A 1XC6A 2ZWYA 3ALGA 2D0HA 2XTKA 2QMKA 3MV01 5IXEA 2G3MA 3EJSA 3B8SA 4NZFA 4PN2A 1UH2A 2JF7A 2PC8A 4CUCA 1E4MM 4F9JA 1UR8A 1NWSA 3AIEA 4V28A 3RDKA 1KFWA 1BVZA 3MS8A 1TFVA 1H1NA 2CKSA 3EJQA 1QPKA 2X0YA 4UQDA 1R8LA 3VDAA 3CUFA 1WNOA 3MO4A 3QGVA 1XD1A 1R7OA 1E55A 3AIRA 1V3HA 3EYPA 5CPSA 5HPOA 5CJ5A 1LWHA 2E40A 1E4LA 2J47A 1H2JA 1G1YA 2QPSA 2JEPA 2YFNA 4DO6A 4P7LA 2CXGA 3FAXA 4MB1A 3ZOAA 5A94A 1W9UA 3VILA 3S5YA 2D1ZA 4D72A 5BWFA 5I24A 4J3VA 5LA1A 1CLXA 3THCA 1UR1A 4BS0A 2VRJA 3ARUA 3L4VA 1E5JA 3AQUA 3HJEA 2WMJA 4B9YA 2VMFA 1NP2A 2GDVA 4GKLA 4U5KA 1V6WA 4ZFMA 1NWUA 1JF6A 3QOKA 2ZX5A 3W27A 7A3HA 2F7QA 3AOFA 4MB3A 2EAEA 3CTTA 4HU8A 3ARVA 3B9DA 2CNCA 4MPKA 3L4WA 4PCTA 4NI3A 3AZSA 2DSVA 2CEQA 2WBKA 3MU7A 1GJWA 2J8FA 2E8ZA 1VBRA 3VIMA 1SR0A 3WQWA 2ZXAA 5AY7A 4J3TA 3WL1A 5GQBA 3W53A 4W84A 3WF4A 4C7DA 2J78A 2YKKA 4MNJA 4AEFA 3WUGA 4MAVA 1GNXA 1FH7A 1BVNP 4IPLA 4JFUA 1EQCA 1E6ZA 1V3IA 3VIGA 3ARRA 1V0KA 1ISVA 2VR5A 3AMKA 3IK2A 4YHGA 3W6LA 2VJXA 1C90A 3CMJA 2F8QA 1TQSA 3HG4A 1G94A 1R75A 5AC4A 1JNDA 3PZNA 2CERA 3ARPA 1E0WA 4CN6A 1V0MA 1BF2A 3CZKA 1UKOA 3VGHA 2VZSA 3KLLA 5HNNA 2ZE0A 4KRTA 2BS9A 4LYRA 1J01A 1W32A 3RMEA 2WC7A 2W91A 1GOOA 1CXHA 4QP0A 2WAGA 2ZWZA 3ECQA 3K8MA 4LYQA 2OYMA 3SEPA 3BSHA 4AZCA 1WKYA 4AIOA 4MB4A 4R5EA 2YA0A 5BCAA 5M03A 2WXDM 2FGZA 2BY2A 5E70A 1GW1A 4PBGA 5I77A 5I78A 1R7AA 2WHJA 4HMCA 3VIOA 3LRKA 4AZBA 3BUQA 1KGUA 2J4GA 3D4YA 1V0LA 1SYTA 2TAAA 1J0KA 2AAAA 1WE5A 1QNSA 1PZ2A 3IANA 4L4OA 1PZ3A 4JZ5A 1HL9A 1AQ0A 2J7HA 3WF3A 1UA3A 1ZB5A 3VIFA 2QV4A 1NH6A 4P8XA 1JFXA 1V6YA 1BTCA 2D2OA 1NP0A 2E9BA 3VM5A 4M81A 3VVGA 3WEMA 1JYVA 1OD8A 4AD1A 1Q6GA 3WD2A 3M7SA 4NXSA 1X6NA 3WENA 2EJ1A 3AIUA 1HJWA 3I3EA 4P7QA 1W3LA 1US3A 4W8LA 3AYSA 1DHKA 3WDIA 2GUYA 2EEXA 4UQ9A 1ZS2A 1LG2A 1OWQA 4KH2A 1VIWA 5DFAA 2PBGA 3WBEA 5C71A 1QW9A 4FLRA 4QLKA 1WPCA 3AXHA 2VO5A 3OLEA 4CD4A 2D23A 4HA4A 1E6QM 3WF1A 1HKJA 3HU7A 2VNCA 3BUPA 1QNPA 2ZUSA 3PHAA 4A3HA 3HG3A 4CU7A 2YA2A 3AFBA 2CCRA 1AQHA 2VTFA 4UZSA 1L8NA 1UWSA 1JI2A 4AYGA 4HZ6A 3LXCA 4DWSC 3VSTA 3GH4A 1UZ1A 4P8VA 2J8GA 3AMCA 1QX1A 1XYZA 3CUIA 3GM8A 3CBWA 1VEPA 1JZ5A 4FNPA 3W25A 4GI8A 3AMLA 4ACZA 3DYOA 1WO2A 3WQ6A 3AMGA 3AIWA 3WY3A 2X09A 4JCMA 1HNYA 3L4YA 2WMIA 4HMEA 1JZ6A 4OUEA 3EDDA 4UNIA 2V38A 1OT1A 1QI3A 3I3BA 1UH4A 4XUYA 1WZLA 3SCRA 1EH9A 2BHYA 2EO7A 3AXIA 4EKJA 1M04A 3DDGA 3BCDA 1JZ8A 5A6AA 3UETA 1HF6A 1KTCA 9CGTA 1UR2A 5A6KA 2O9RA 4P7NA 2D0FA 4MDPA 1ZBCA 4PMNA 5BXSA 2BY1A 4CN1A 1E3XA 1PPIA 1QI5A 1IT0A 3WDRA 1CLVA 3F5LA 2PF0A 3N13A 2WCSA 1V0NA 3UG3A 3GXMA 3WFLA 3WNLA 5A6JA 4CU8A 4FK9A 4UQEA 4GIAA 1Q6CA 1EGZA 5CPTA 2PWHA 1BYBA 4EAMA 3VMPA 4HOZA 2XVGA 2EQDA 4AZCB 2DSUA 1VENA 4A3YA 3PTQA 1E6PA 1KXTA 3TP4A 5D9MA 4MNMA 2ZUTA 2CBJA 1QWUA 2VVNA 1HXKA 3OZOA 4CVWA 1R87A 3MMUA 3SCQA 4M8UA 2FGLA 4J7RA 1CENA 1EOKA 2J7EA 2YJQA 2CKRA 2EPKX 2VL4A 1IV8A 1FHDA 5CGMA 2JEQA 1B30A 2EPNA 2WW5A 1MXDA 1BYAA 5D8ZA 3T0AA 4PTXA 5TD4A 1H5VA 2PB1A 4Z2KA 1CYGA 3UCQA 4ATLA 2J7DA 2AMGA 3GH7A 3W0KA 1E0XA 1YHTA 3VOCA 3PZUA 2OYKA 1N82A 4CCCA 4Z2HA 3CIVA 3KE0A 5CLWA 1OIMA 4MB5A 3FXYA 3MI6A 1ITXA 3A4XA 4UCFA 2GJRA 3S2CA 4V2XA 3T0DA 1M03A 4AYSA 2YLLA 3M07A 4U31A 1BFNA 3VGFA 2EACA 4F66A 3CZLA 4PSRA 4OIFA 1ODUA 2CBUA 4P7OA 5ABFA 2WCGA 2CBVA 3CGTA 3AISA 2Y5EA 1GORA 1V6UA 1C7SA 4JL1A 2XWDA 1M01A 3D5HA 3EJTA 3BVTA 4PMUA 1AVAA 2YFOA 1HX0A 3WH6A 5KEZA 4ACZB 3WUEA 1MFUA 5ABHA 1V3JA 1OGBA 4NF7A 3DX0A 2O9OA 3O2LA 3OG2A 1DWHM 5LA2A 4JCLA 1JG9A 2NT0A 1KQZA 5EFDA 4PRWA 2GDUA 1PX4A 2E9MA 1KGWA 3KEHA 5A6SA 4DUWA 1LL7A 3PBGA 3OGRA 4J27A 3AS3A 1WZMA 5EFFA 1WDPA 3PZIA 4HTYA 2G3IA 1UD6A 3LMYA 4Z2LA 3MMDA 3SURA 1OCQA 3CUHA 3VMOA 4D6IA 3AS1A 3F4VA 1JI1A 4NZCA 3HN3A 2WMGA 2QPUA 4URIA 4LQ1A 1W91A 2EXOA 4QFUA 1JL8A 2VRQA 4YN5A 2VQUA 2E9LA 5DF0A 3A6OA 2B31A 2QMJA 1J0HA 1PX8A 5A8NA 1JD7A 4JFSA 4R27A 1UR0A 1QI2A 2O9PA 3DX2A 4DUXA 2IGTA 1B3XA 3OGSA 1EO5A 1CWYA 3CZJA 2XWEA 2XYLA 2JALA 1XCXA 5I0DA 1VJSA 4L4PA 1CXEA 2J7GA 1UKTA 4B9ZA 3VMNA 2WVUA 3PZTA 3HZ3A 1V6VA 1Z32X 2XN0A 3N17A 4PUDA 1XD0A 1PIGA 3SCOA 4B3KA 2WYSA 3VX0A 2W61A 3RM8A 5E9AA 3WY2A 4H41A 3NCOA 1VEOA 4TVUA 2IXVA 4WSKA 1W3KA 5I3DA 2CITA 1QHZA 5M17A 2YBTA 3ALFA 2V3EA 3D3AA 3GBDA 1KGXA 1HIZA 3GNPA 1W9XA 3QOMA 4AZIA 2J77A 2FH8A 3OLGA 3NYDA 4BQ4A 1C8QA 4PTVA 2X2JA 3AXXA 4AW7A 2WSKA 3ZT7A 1V3MA 6A3HA 3EDEA 2XSAA 1UD8A 1W1TA 2ZUWA 3TV8A 1BHGA 1CGYA 3H53A 5CQ1A 3ZIZA 3OA5A 4OBSA 4MJ4A 2VCCA 3DDFA 1H3GA 2FDMA 3PTMA 5ABFB 1Q6FA 2YDSA 4U33A 5HDRA 4MNKA 5IDIA 3VX1A 4LX4A 5A2BA 1X1NA 1E73M 3CHCA 4RL3A 4FNRA 1V02E 1UG6A 3DECA 5CXPA 2BVTA 3D51A 5FL0A 4OJYA 1DTUA 3BVVA 4FNQA 3ZSSA 4FLSA 3TTSA 3MV11 3WF2A 3EMCA 5A6BA 1OM0A 1BGGA 1CXKA 2V3GA 4JHOA 3GNRA 2WMHA 2D24A 3AZRA 5E6ZA 4LXFA 2JF6A 3L4UA 1EOMA 4H8UA 4PMOA 4CCEA 2VX4A 4M24A 1H09A 1V08A 2PWEA 1CPUA 2HISA 2WC4A 4W85A 4W86A 1HT6A 1QWNA 4UFHA 1KR0A 5A69A 2UWFA 3N18A 2WK2A 3WELA 1CBGA 3D50A 1ISXA 4KRUA 3MANA 1XSIA 1UASA 3BAWA 4EANA 4QDMA 1U2YA 2X8RA 1D2KA 1GOKA 2WPGA 2XFYA 2OW6A 3ZT5A 3APGA 3BH4A 4P8WA 4C7GA 3BAXA 4AXNA 3WNKA 2EPOA 2UY5A 2WM0A 4GQRA 4W7UA 3UERA 2NW0A 1SFSA 1R34A 3WDJA 2RGLA 1GJUA 5BRPA 2OSXA 3VM7A 1E71M 1KTBA 4GI9A 2X1IA 4UQAA 2G3NA 4X0NA 1W2PA 2F61A 5JIWA 4HOXA 4KGLA
chains in the Genus database with same CATH superfamily
2XH2A 2F6UA 1TTJA 2WNQA 1E70M 3O16A 2PC4A 3CO8A 2FEDC 2PP7A 2PWFA 4U6XB 4LEOA 1TZ8A 4IGNA 3RNQB 1I3GL 3GMPA 5HDBE 2OJZL 3W1RA 2HTKC 4QSFA 4G56A 4E9QA 3QQ0A 5ECUA 2KAUC 3QRLA 1KV8A 3EBGA 3NFSH 3MSDA 3RIKA 4PQXA 1YMYA 2BSSB 4AD2A 3BVUA 3V6BR 4EIBA 1A8JH 1A7PH 4AUUA 2A73B 3TO2A 3SCMB 2O6FA 4DJDC 2PZ0A 3M1ZA 1YY9D 1JNNH 3S4SG 3UTQA 3IAGC 4YIQA 3MV9E 1NEYA 4RZ4A 3QXBA 3MPCA 3ARGB 2BFGA 1HJXA 2CLRB 5SWQB 4AVIA 2YXWA 2QADC 2BY0A 4HJTA 1YEJH 2DEXX 4QT5A 4Z95L 2OKTA 1ULVA 1ML0A 3G1FA 1F58L 4PGBB 4OCNC 4BY3A 1ELSA 3C87A 4J6IA 5HHNA 2ID5A 4QGTA 1PV8A 2EABA 2KC0A 3DETD 1EJTC 3MBXL 5JW3H 3E6EA 1CZ1A 2PXYD 1OFBA 3V9CA 1FDLH 2Y1HA 3QN3A 4LSBA 2XZCL 2ZAHA 4M1GH 2VAAA 1TTCA 1KR1A 2E0PA 2XWCA 4DEUA 3D4GA 1PZ5A 4GC3A 1O1HA 4HU0A 1Q94A 4GGHA 3RX7A 2BY3A 2KDGA 3ANYA 4IGHA 4GB9A 5DVOA 1EGJH 1AZNA 3W7MA 1KPVB 2WWCA 1ZTXL 2CHWA 1QTYT 4OGXH 5C2UB 5BMXA 5LG1A 3F4DA 3QPZA 1TQVA 3WO8A 4Q7DA 4CADB 4JFXB 1QCWA 1XPGA 1KTDA 5ISZA 5DJ2A 3C5ZC 3LRLA 2AABH 2AMUA 4X9YA 3WLLA 4AC1X 4F0HA 2VHLA 2UYLA 1ZLEA 2IH1A 3MRQA 5E1QA 3P62A 3GKAA 4K0OA 2GSGB 1MFAH 4FPSA 2IMRA 1N0LB 4JPWL 1GEHA 2GJPA 1FXQA 3FRUA 4YIWA 1WBZA 1U1JA 4ZYKB 4LCCB 4MMXB 3NZ8B 1OOAA 1WX0A 1GKOA 1ZXQA 3RWEB 5HHXH 2Y6SC 4YDKL 4QNEA 3CH9A 2JWYA 1IC5L 3THUA 2X30A 3AWNA 2YUZA 3LGEA 4I4WB 3KVMA 1OM9A 2NXZB 4CD6A 3LPGA 3O8AA 2YN5A 2W0LA 5HI4D 3VK5A 5CHNA 3SBQA 3VZYA 3NCXA 2ZWLT 5DQPA 3KFTA 2HPTA 4LL1A 3GYCA 1ZCCA 4L9LB 4N2OA 5KS9F 4OFYD 3WLTA 2VUOA 3KD4A 2F38A 4XVEA 1D5MA 4Y5XB 3S42A 1GK8A 1CBVH 3UH8A 4AYDC 1WBYA 2K7PA 1IEQA 2DEWX 4X6DF 5GSRA 2D4DA 1A9BA 4IRJB 2Y06H 4FQQA 2QFPA 2VOTA 2D9QB 4NX0A 5L4MA 4JRXB 4UR7A 3HMCA 1WICA 2X05A 1XF4A 4WO4D 1ETZA 4Z1PA 3BJSA 1U8NA 3VKDA 4O17A 3KHOA 1KBJA 2VDMB 2DJLA 1GZQA 2OVLA 1ES0B 4XNUL 4TX8A 4QRBA 3CUZA 4K5MA 1X6LA 1ADQA 5HDBF 3FNDA 1EVTC 2ZQKA 3JWDC 2VWEC 1TT6A 5DR5L 1QAWA 1U3HD 1TMQA 3W1PA 2WWOA 4C55A 1UWRA 4P2OD 5I8OH 3LSCA 3D2UD 3M8OH 4PTUA 1AGDB 1KPRA 4KC3B 3U2EA 4P5UA 5D7KE 3VE0B 4LNRB 4FD0A 1PKMA 4XZUA 3SJVE 3BGAA 2V2DA 3NRQA 3UXFA 5I28A 1HIMH 2WXQA 5HVHB 3GLDA 4FZ8L 2BTMA 3GXUB 4XMPL 3I9PA 3GSVB 3ZBMA 3HN5A 4RSVA 1NOFA 4JY6B 2A9NH 2DQGL 1WK0A 5JQ6L 3KL3A 5I15H 1VADB 2Y2YA 2VFGA 1AS6A 5E2VL 1POJA 4BQ6A 3RVTD 1B2WL 3BPCB 4NIRA 3QLLA 4JMNA 2F53D 4Q6JA 3LQAL 1GQIA 1OHQA 3FSOA 3WAKA 1DSWA 5FEWA 3V5DA 1GIGL 5AW8B 4XBEH 3QM3A 1WSST 9PCYA 1XIDA 4C60A 3BXWA 3GBLA 2R1PA 4PH6A 5FKYA 2D73A 1EO7A 2NDGA 4JUTA 4YVNA 4IPNB 4CRPA 3BLKA 2MMXA 1JGDA 1L6PA 4FIRA 3VXUA 3EJPA 4BZ2L 4XGZB 4TPRL 2AV1B 4DN4L 5C0BB 4FKKA 3CX5J 1AD4A 2PTXA 2PPFA 1CDGA 4POZC 3C5SA 3PANA 4XZBA 3LEYH 5F4WA 4MJ5B 4H19A 5EBLB 3LSOB 2PBOA 1GVRA 4IBZA 4KMLB 3CHEA 1ROWA 3QV7A 3FO2A 2MNUA 1VCFA 4KBPA 4D8OA 4Z8FL 5EDXA 3NURA 1XRVA 4FX7A 5EV7A 3A4JA 3OIHA 2KLSA 4RNIA 2QSCH 1ZL1A 1E0OB 5L8LB 2FZ3B 5IWLC 3CFKA 4B7LA 5D1ZI 1CDIA 1EBHA 1PGRB 3NA9L 4A04A 2H1LM 2UXVA 3NCYP 1GHRA 1KLUA 5C7XL 3S0CA 1BXCA 2PF6A 5SWZB 3GSRA 4MMYA 2YSTA 4KKLC 1PEZA 2VXSH 4K7PH 2I5YL 2A77L 3HZMB 3LUTA 1UTDA 2NXIA 1QFUL 2EPMX 5I19L 1U93B 1E4XI 2WTRA 1QOQA 4PD4K 1LT7A 5FA3B 3FT9A 2YRPA 3E8UL 4DPCX 4BZYA 1TREA 4RK8A 1QBML 1IJNA 3QJHB 3VNZA 2JCCF 1GG1A 2VLKE 4KETA 5FUZH 5E9DD 3TW7A 1Z1WA 4E8GA 2EKGA 4G59C 5FUCE 5LBSL 2AJZB 3NAAL 1JZIA 4AIXA 1HTYA 5TE7H 1YEHH 3QXWA 1OYBA 4YSSA 2FTYA 2NY7L 3EJJX 4B9KC 4A2GA 2H32B 3UD6A 2OGJA 1NC4D 3FUFA 2I60H 3ARDB 2X6UA 2WJZA 1SW3A 3KX6A 4J2MA 1ZBWA 3NL3A 1ZV9A 3SKNB 5DK2B 1RQ5A 3EJRA 3I7RA 3RIFK 1N2RB 4QWWD 2UV8G 3ULAB 1UUSA 4ZFZA 1MW1A 4M4RB 4LU5H 4YXKL 4XP6H 4QRTA 3R7QA 4O53A 1TKKA 4G5ZH 1F3WA 3IDGA 5IW6B 1EL3A 3VGGA 3VDHA 3SIZA 4AJYV 1TJIL 3MC5A 3WS3B 3FFDA 4NQTA 3VWKB 4ZFCA 1RR2A 4NUWA 4Q4PA 1QVOA 1PYWA 5KUKA 4Z7WB 5KS9A 2CESA 3ALWA 5D32A 5TGBA 4D6FA 3LNMA 5K9DA 4P99A 5JMRA 4WSHA 4XWUA 3KBJA 4X6DA 1GGBH 4Q2ZA 3CXHK 3D85D 1A3ZA 3QXAA 1C8PA 3WQ4A 4PJ8D 4NO0A 1FYTA 1CIUA 3COOA 4Z5RB 1DJNA 2H47C 5KVDL 3WGUB 5CEXA 1EFXB 5AYIA 5ESVB 2K4AA 2R1XA 5D1XC 4HPOH 1D6EA 4X9SA 4TTUA 4PR4A 2VDOB 1PS3A 2XBTA 5EPDA 5B7YA 3L5WA 2R1NA 5DXYA 1X5KA 4R4BB 4HJEA 4OE7A 2PSNA 5F6IC 4A7VA 2V3DA 3KYKH 2EG7A 4G6ML 3H26A 1R4XA 3O6LL 1K3UA 1VESA 1YN6A 4P0DA 3EWXA 2EXSA 1ACCA 3WQVA 3WU1A 1BM3H 4JG1H 4MQXD 2HVKB 3RPMA 1Q0XH 3TBYB 1KRCC 1MHEB 5EPMA 3B0XA 2EVGA 1KB5H 1IE5A 5BUAA 2CKBA 2W95A 3QTGA 3W6MA 3MV9A 3TH2T 2E27L 4QBXA 3WG6A 2VW4A 4JRYD 1RCXB 4YWGH 5MHBA 1TWDA 4GY7A 1F11A 3D07A 1U8MA 2YAOA 5HK4A 1ZSXA 3K3QA 5FEPA 1CD8A 1CFNA 2IF7A 3US1A 1QATA 1CXFA 1BJ8A 5CD3B 4I88A 5FYKU 1QAPA 1TPUA 1VD6A 4P8UA 5D7JD 3AWOA 1E7UA 5FGCB 1YDPA 4KROD 3WFAA 3PTKA 3LRSB 2XBZA 3LQAC 3E0VA 3K5RA 1AQDA 4LBAA 4L23A 4XBGA 1UXSA 2RHEA 4YOKA 2DDXA 3QRGL 5AFDA 3VVVA 4HS3A 3LH9A 4M56A 3ZTNL 1ZAGA 4XQ6A 2B0SH 3TNOA 1XDTT 4X8XA 2J7CA 1KYOK 3QC3A 2ZWSA 2NYZA 1LG1A 2XVLA 3H3KA 4AQ1C 3MUJA 1RD5A 4U1JB 3MUCA 2QSQA 1J5IA 5IXEA 3TZNA 1ASOA 1IKOP 3PQYE 5DMIL 5B1BB 1AH1A 3BZFA 1XCTA 1HILB 3V8CA 3MZTA 1M7UA 3EJQA 2B7QA 2FGBA 4NQDB 1IM9B 4Y9CA 3TC9A 4KO6A 2X1SA 1JPIA 3ATZA 4PMEA 3QZAA 1SHXA 1PTAA 3CQFA 4RMRA 1UJPA 3JXAA 4YBLB 5J1AA 1IGIH 1OCNA 2OMVB 2GDVA 1QR1A 2NQZA 1Q65A 5FF0A 1FL3A 3KW8A 1T7WA 3NJXA 2YCJA 4NM8H 2IKJA 4O2FA 4IK7A 4N0FA 1HZHH 1A1MB 1IL1B 1XZWA 4F9LA 2XQBH 5ACZB 1VLIA 1I7TB 1I1RA 1FO0B 4OLUH 4RJEA 3GJFB 1N4XH 5ICZA 4Y2WA 4MPKA 4TLUA 1Z48A 3W86A 1NFDE 3QUKA 1FFOA 4PJ5E 4AYID 1ONQB 2HT4C 2JCCA 2JTDA 2NY6C 1UB5A 1DVFD 4FSAA 5HNUA 1WFJA 4HKBA 1R3KB 2H2PD 5G2IA 4YDVA 5KYNA 2YCEA 1LK3H 3TN0C 1BVKB 4XZIA 3KS0J 2VR5A 3GMRB 1X5XA 1AO7E 4GRWB 5I3GA 4RFEA 4MMZC 2GZXA 3DX5A 1RK6A 1RK0A 2ZKHH 3IUIA 1CXHA 2E25A 1DBBH 3TVMD 3HPSA 2FZ9A 1LLAA 4WNQB 4M5TA 4MJID 2ZYFA 4P07A 3DUGA 4M1DH 3NEVA 2BY2A 3QQ4B 1U8JB 2BS8A 3DIFB 3IGHX 2YD6A 2Q3AA 2J88H 4HIPA 1J0KA 3PDOB 4OZIF 2YAEA 1B57A 3MBED 5I8CB 4Y9EA 3EFDH 5KSUB 1KTKE 3ESUF 1W5MA 3PJXA 5EMUA 3SJVA 1A7QL 2Z0UA 4OI9A 3GEWB 4K5NA 5DJ0B 1MDTA 1KCUH 1HE7A 5KSAD 3AGWA 4LDOB 3RLUA 3E0GA 1Y0LB 3H42L 1GYMA 1DYSA 1G7JA 4HA4A 5JPMA 5HYSA 1KF9B 1FSKC 5GGQH 2J73A 2IQAA 4CU7A 4LCWE 3WJMA 4OLWH 4YSCA 4LAMA 1Q1PA 4Y4FB 5E5UB 3HQNA 2R23A 3CV7A 1FWWA 3OB0K 2LAGB 4L4LA 4IW4C 4XP1L 5FYKL 3VYOA 4LVOB 2OX1A 1CE6B 4P23C 5GGSB 4XBMA 2EO7A 3ULUE 5AZ2L 3UTOA 4BD4A 2BSTB 4B6ZA 2HE8A 1C8VA 4DI8A 3DENA 1FWSA 3STPA 5A6JA 1W80A 3IGKA 2XCMC 2N59A 3LV3B 2EH7L 4UI2A 1KIPB 4PJXF 4DPRA 1C5DB 3LB6D 3ZL4L 1C16B 4X83A 3EPNA 3CVCA 1CU4L 5CJOH 4AAJA 2FO1A 3CQPA 3T0AA 5JW5B 4GJIA 4O11A 3P4OB 5LNRA 3BGFB 2ZYSA 3HB3C 4M8RA 2JVUA 2LV4A 5FI8A 3P77A 2YUVA 5EYWA 4AY7A 1D3HA 3VOCA 4Z2HA 1I8IA 5IG7B 3WLMA 4C6BA 4PUWA 4XCNA 1U8IA 4CSZA 4J8RB 1QFOA 4PYGA 4M5PA 4JEQA 1M9SA 1ZK9A 5DQJB 4FZEL 3PGCB 3QC0A 2XKNA 2K4WA 4F66A 4WWNA 1U8PA 4YXLH 3ATBA 2BGNE 2C3XA 3UPBA 3WEAA 5CWSA 5CBBA 2CUMA 5CC5A 3DTXB 1PLBA 2EE2A 4FG6D 3BVTA 1NFDF 5KJ7E 1R5WB 1ADSA 3O2LA 3QDHA 2VLKA 2NT0A 1DXFA 1KQZA 5EFDA 5BVJB 2E9MA 5AYZA 2P5EE 1IFRA 3SQMA 4FF9A 1OGAD 2X1WL 4YHKH 4Z2LA 1UM4L 3AS1A 2Z0IA 1FGVL 5ALBH 4LP8A 4XNYH 3LNHA 3QNFA 3ZKMD 3SDXE 4P3DB 4GAJH 3GSNL 4XKMA 2ICWI 3QQXA 5IFHH 4JVWA 4L9ZA 4B5ZA 3VXTB 4KW2A 3ZRSA 4OAWA 1KJ2L 1EBAA 4G8EA 1H60A 3NCOA 2EYTB 4WSKA 3GHTA 6REQB 1QHZA 4EPDC 4NAEB 2Y7NA 1W16A 3GNPA 3S6DA 3EJZD 4JGDA 4S2BA 4MKSA 4D2NA 1CIDA 3C60D 1I8MB 1UD8A 3Q5TA 5HGAB 4XB7A 3ZKNC 3H53A 5KVDE 1NAKL 2NQLA 3DDFA 4UTLA 3S1WA 2EINB 4B97A 4LX4A 1OZTG 4RMBA 2WNZA 1OC5A 1H6TA 1RA0A 1V02E 3DECA 1SYVA 1EUUA 1F4XL 1PZDA 4EN3A 3WF2A 5TQ0L 3MRDB 3SYAA 2NMSA 5FEZA 2VXTL 2WLLA 3HPZA 1W1B1 1T21B 5EEVA 1AI1L 3B1UA 3QH3B 4M24A 5ECVA 4GUCA 1UP2A 4OBTA 5D2NE 5I5MA 1CPUA 3JV0A 3VCLA 2WC4A 5L4IA 3NO3A 5I5JA 2WK2A 3O4OB 1KLFB 1QZ1A 4QHUB 2UBPC 5CCJA 4KJWD 4HQQH 4EANA 3THMH 2NCEA 3INOA 2HN7B 3HPAA 2CQVA 1GOKA 5F9WC 2FX8L 4HYRA 5K2ZA 1Y6KR 4C7GA 1ITBB 1KIQA 1J5OL 3OBEA 4XKYB 4C90A 5FECB 5TJWK 4G5AA 3WDJA 2RGLA 2GDQA 5LJYH 2FYYA 3QUYD 1RZIB 2BC4A 4J1UA 4RRPA 3QW9A 3KGTA 2V9UA 4D0DA 1HJVA 1NCOA 4UQBA 4HUNB 1E6NA 5FL1A 1V7ML 1KJ3H 4GBXD 3TXAA 1SUJA 3O6DA 1LHZA 4TVPH 5HVFB 5KG9B 4IXHA 1XCQA 4MNQD 4J28A 1DIEA 1G9EA 3ZJ7A 1PWLA 4DVBB 1T0OA 4WAFA 3SUTA 43CAA 3RLVA 4L0YA 1RZJL 4KOBA 2ICWJ 3HS8A 2J8UF 1NZRA 1F4HA 3NACL 4ZUVB 4J3UA 3C2VA 1AJZA 2CHNA 1DO5A 2CH8A 1S2EA 4HALA 2RFXB 4HCHA 2XZQL 5EBWA 1OB0A 1WBXA 5JR1H 4Y9GA 4U6VL 3WK0A 4CU6A 3EGXA 3MUZ1 4XZLX 3CHDA 1BZOA 3VOJA 1BD2E 1NUDA 4L1HA 4LGSB 3S36X 5LAPA 2PYEA 4WJXA 4N4QA 2OOFA 1A25A 4GI4A 1MJ8L 4BEIA 1K8CA 3UGXA 5IOPB 2W9LA 4BQ3A 4R9HA 3MOAL 5BV7H 3EOUA 3S1XA 1ZSHA 1M57B 4YHOH 4XWGH 5F89A 1QO2A 1YPXA 1NGYA 2NZ1A 2OMYA 3AS0A 1PLGH 2DD8L 1ODZA 2AVFA 2AXJA 4KEVA 3IDUA 4Y2OA 4AMXA 4S10A 3GZKA 3N3TA 4B9CA 4Z7OB 4ZQMA 4LSPL 3GLCA 4R7VA 3RCMA 3SDXF 3WK1A 3UTPE 5D5MB 4CVXA 1TR9A 3O15A 3TTQA 4ATWA 1B9ZA 2ZRXA 3PG9A 4MFEA 1TTGA 5F7WC 1I9EA 4GXPA 4N8VB 4P2QB 4B0MM 4IBWA 2IAMA 2PE4A 5D9OA 3FUEA 2R0ZL 5KYXB 4UTFA 4WW2F 1NDMA 2IPTL 2CLEA 4U1SA 3W7QA 2WXNA 1NICA 3WD0A 2WAHA 2FT8A 5JBFA 1R3IH 1O9VA 2C15A 1S5HA 1WD8A 1NFDA 4TQIA 4PJ5A 3GC4A 2HRLA 1BLIA 3GMOA 4DWSD 2UXGA 3LEVH 1TLKA 2YBGA 1G01A 1IXQA 4WJG3 3RHWF 1JZFA 3CN0A 5ABGA 4X4KA 5F9JA 3KCPA 2VQ1A 2R2BB 3GIPA 2PUQT 3KDMB 4YVPA 2H4EA 5B1KA 3AREB 2A3EA 1EDHA 3IVKA 3DHFA 1AQ8A 5IESL 1YYLL 4ZDHA 3O3EA 1WA0X 2XVKA 4O4YL 2Z4TA 2EC9T 3CCHB 1XFPA 1FN4A 3GTNA 4C6NA 4QXUH 3G1VA 3IMVA 3E74A 1JCMP 3PUDA 1KG0A 4HUUB 4W4OA 3LHUA 3UXIA 2R0KH 5D38A 5D6DC 4OFQA 1C8XA 2PDWA 5KYYA 3IDXH 1TPVA 4F80A 3WUBA 2QTVA 4AH2B 1NCCL 3AACA 3US0A 5LYRA 4DB7A 4UOQA 1TFHA 2EZ0C 3K4AA 1A4JB 1IEBA 3UFIA 3NSMA 3L7FA 5IMMB 5C8BB 4FFYH 3B0YA 1TU2B 2DLHA 2APTA 1A6VH 4E9VA 3X3GH 4K39A 4QRFA 3PBUA 2IPJA 1ZT4B 4RV3A 2GC4C 2VR7A 5KMYA 2BMKB 5ESQA 4LCWA 1E9IA 2EUZA 4EXQA 1R3TA 4EE2A 1O94A 3WD3A 3BN3B 4B15A 2VLRB 2OV0A 4OU3A 3NIDB 5G4EA 4BZ2A 4BE5A 4XIAA 3JWOH 4DKFH 3BICA 1H5BC 4H04A 5BXPA 2H9GB 1VPYA 3HURA 1NEZA 3OZPA 5ENWA 4AGMA 2VM9A 4HD5A 3Q2DA 2ZE3A 2JSFA 4KI5C 4HFUH 1QBLH 2QUTA 4H40A 1MCEA 1AGBB 4GG8B 3AHVA 1SJBA 2ICEB 4I8YA 3SY8A 3Q8CA 4PV1C 3QUHA 5ITFB 3S35L 1YBQB 3T8XA 5A2CA 2X41A 1ECEA 3NJHA 2L4OA 1DZ0A 4K73A 4JG0L 4XX6A 3PRZA 1SM9A 4G6KH 4L3ED 4UFKA 3HJ0A 3CC5A 2WLKA 3VFOA 4NNPL 4UUJA 3LHYA 1MIML 3G6AA 1QSEB 3IU4H 3V0SA 4ATTA 2C4FT 2AS5M 5D6CB 1U83A 5LIYX 1FJ1B 1OAXL 1LNUA 3UJIH 4KXDA 1D5BA 4Z1DA 3CSYA 2OP4L 4JAMA 5A2IH 1EDYA 5KZDA 4FP8H 2O9TA 3TXVA 5C07E 2J8UA 5F7AA 1S5IL 3W9EB 1W1A1 4MJ2A 2ERJB 1FZMA 4GISA 5LBSA 3ZLFA 3NL6A 1DWIM 3UWUA 1THCA 2B1OA 1PKYA 2DMCA 4JPKL 4LLDB 2GYSA 3GHRA 4MMZA 5BMFH 1F00I 2W0UA 1BZQK 4MJZA 5IROD 5HYJB 5AHLA 1BG9A 4WY7H 1DANU 2P43B 4JGJA 2FZ8A 4XC3L 3ARBC 2GIXA 4FQIH 3V6FB 2PWVA 4A68A 3OGVA 2BSDA 3GXNA 3DU0A 1PSKL 1QA9B 3LOTA 3ZVHB 1L0XA 3TFKD 4PRPD 1UB3A 4TTGA 2B2XL 5JXED 2B39A 2BSED 3SDXA 4AISA 3R0UA 4F8QA 3BOXA 3MZ2A 4PRIE 3CUPB 1A3XA 1ZDQA 3QJXA 3P67A 2V2XB 3L54A 4LY4A 2AI0H 4TXEA 3VH8G 1L9SA 2V5MA 4UT9H 5DS8A 4WW2A 2J75A 2WHKA 5FAGA 1D2PA 1A7RL 3BE1L 3MRLB 2HFGH 3L5IA 5C0CB 2C14A 3CXDH 1O95A 5IHSA 3IJEB 5EO0B 4UTCA 3UP1A 1M6OA 3QXDB 3T8VA 2V5JA 2YJLA 2FQGA 4P4KC 4LC8A 4YDZA 4X5WB 3BZGA 4MKNA 4HNCA 2G97A 5DC9B 1T4KA 1V02A 1ZTMA 1ZHBB 2ED6A 1EXHA 5DEJA 2JIWA 1E2WA 3EYSL 4P2RB 3UWEA 3FN0H 5AWNH 3NZSA 3ZDXB 1K8DB 4OLEA 1DWFM 2FIQA 3CPUA 5HWNA 5D2NA 1M1XA 5KW9L 2K7QA 4YFEA 1E42A 5F93C 2OMUA 2QDWA 4RGOH 4BCYA 3MO1A 1ZBKA 2QIIA 12E8L 4KPLA 2IPUK 2X4QA 1Y6MR 1AD0B 1XM3A 3AT8A 2C13A 1P7QD 1XYFA 2GJNA 3ZRCC 2CCVA 2Y7EA 1ZENA 4M02A 4E42B 2ZXDA 3TZVB 4LV4A 4L29B 3QVAA 1F90H 1FVPA 4ELMF 3L3IB 3MRMA 3OJDA 3IFOB 1SZGA 2V2TB 5CP3H 1QFWL 4GAYB 3AYTA 4G8TA 4LL4A 5KAQG 3E02A 2QGDA 5CJMA 3CPRA 3VD5A 2WOYA 1EHLL 4TLSA 3PNUA 1I8KA 4K3EH 4ZXBD 2IDSA 4A38A 1HOCA 1UJTA 1AXSA 1T5XA 3JWNC 1TCRB 3ZJKA 5IM7A 1C93A 1OQOA 4R96B 2FQDA 4ZO8A 4GJTB 3O4LD 4DYJA 5H8MA 2COVD 4NO2A 4X2RA 1G0DA 5GGUB 2HRPL 2ISVA 3CSPA 4ZNEE 2NV9A 1CQYA 3EOSA 1HGWA 2Z7WA 3W11D 5IHUL 5B3NA 5EZJB 5AHMA 1BAFL 1BD2A 1D7BA 4AJWA 1S7TB 4LNYA 2X6AA 1WH0A 3RGHA 3CIQA 4TTDC 3H9HA 5C08D 5K93A 4C6KA 3VYLA 3PWPE 4WHBA 1EPVA 1CB4A 5FHAL 4BCZA 1PQZB 4EOWH 3RK8A 2NLIA 3H0TA 3T40A 4RBPK 4C47A 1KACB 4ZL1A 1A5BA 2VL5A 4GNJA 2ALWA 1A7OH 2HAZA 2C8NA 3IT8D 3RIAF 3ARTA 2YBVA 4XV0A 4XXWA 2GVLA 2D20A 5E94B 2GK1B 1VZGA 3GNDA 3F85A 3QIWC 3TBSA 1FBIL 4GUPB 2K0RA 3LKOB 5LBGA 3P14A 4LZKA 1CD1A 1HOEA 4APQD 3QAZC 3H23A 4RE2A 2JMRA 3WD5H 2OL3H 2YD4A 3X1NA 2GG1A 2V4LA 4ZUWB 5EBAA 2F6KA 2FZBA 1CW2A 1N8IA 3R6IA 3VXSB 5LHFA 3QQDA 3MV01 2VERN 5TFSH 1W72H 4LJ3A 3SDCB 1I85A 4WCYL 4F9JA 3ZTJH 4NENB 4A7SA 3AIEA 3JWDL 4ZMNA 1WNOA 4IUOA 3PWLA 5J7CC 4NPYB 2QPSA 3D2TA 4UANA 3U7WH 5BWFA 3OR7B 1B5TA 2VC6A 1HS6A 4G72B 1YMME 4O00A 1MHCA 3I6RA 4JFPA 4FTVB 3QQWA 4IKLA 3PF2A 3ZTJG 4GKLA 1OFOA 3BLOA 5FS5A 2CBOA 1BDYA 2ENJA 1LEIA 4WKZB 3LZNA 4AV5A 7A3HA 2DFAA 2AK4D 4NQQA 5GIRB 4MGGA 3C0SA 1XF1A 1Q4WA 4N1HB 4HU8A 3ARVA 8RUCA 2P8MB 1DBKH 4N6FA 1HHGB 4G6FB 1ZHKA 1XIWA 3GHEL 4H1LH 1GJWA 1BQHA 1QP1A 1VA9A 2A74B 4WTXA 2V33A 4ZAKD 3PUOA 5G2WA 2P10A 2QQNH 3MGOA 1FVCB 2W0FB 1K4GA 4JM4H 1FYTE 4Q8QA 2BOLA 4K5PA 2NY1D 4HFWA 5GS1A 3NTCH 4I18A 4BFAA 1GYCA 1K4DB 1X5AA 4XP9H 3I2CL 1JRBA 4GYPC 1RIUH 4Y19B 2QGYA 2Z6IA 4Q8OA 3UAFA 4H1LG 3DLQR 3FQTA 4XXDB 1J01A 4QG9A 2ORBH 2CJUL 1DUZB 1DN0B 4IJCA 1TJPA 4AL8L 2QXWA 2OYMA 3BJ91 3QORA 2BDQA 1DLFL 2KYIA 2KX9A 4AIOA 3V4VA 5B1JC 4YTSA 4WW1A 4M51A 2HNEA 3DI2B 4N8PA 2ESVB 1WA2X 2TAAA 5J1TC 3B9NA 5DSCB 5AOMA 3VOFA 2DV0A 2Y36H 3VFVB 1DOSA 2PTTB 3O9WB 2IC2A 1I7RB 2WM1A 2HCVA 3KPOA 1JYVA 1OD8A 4FQPA 1Q6GA 2P0OA 2B16A 3NJFA 2GPTA 4PVNA 5BO1L 3LHPL 5I6KA 3BZ5A 5INDB 4HEPG 1LG2A 5E8DL 3QIUC 4ES8A 1EC8A 3MOQA 3MGTA 4MWFB 2RA1A 2A6NA 3AO0A 3WF1A 3U9UB 3GB7A 5LBVA 2VE6A 1N6VA 2F19L 5ITBL 1IEXA 1A1NB 4B50A 4NQED 5TDOA 3WIIH 3TROA 4POCA 2FVMA 1XYZA 4Q9QL 5FJRA 3N41F 4LT9A 5MHSE 1NPJA 1DQML 4F7TA 4GAGH 2N0MA 3L4YA 3M0YA 2VDNH 2WY3B 3MCLH 2J21A 4IGBA 3P73A 1RPXA 3DSNB 1OT1A 4QXGL 5K9CA 4XUYA 5BQ7B 4PRHD 5CSSA 4YHLL 1HF6A 2FWLB 4MJHA 4REQA 3CAVA 3E6FA 4CN1A 5D2LF 4JO2H 5CILL 3KJ4B 4FFZH 3GVGA 1KIUA 3IUHA 3PHOA 2ZTJA 4FK9A 1RKRA 2K1MA 4HOZA 4RMQA 2IEPA 5C07A 1TEFA 3IJQA 1E6PA 1YUHA 3GUTA 1LEKA 1WYJA 3OMZA 4ZW3A 2V6HA 3FIGA 1DDHA 2J7EA 4QNWA 3A6BL 4AGLA 3RDTB 5AZ0A 1AR1D 1MI5E 3UYOD 1YA5A 2X4RA 1NLDL 3LZ5A 4RMUA 2PB1A 3MCNA 3N9GH 4ZD3L 2J7DA 4JFFD 3EKCA 3L3KB 3ESOA 1D7DA 2A4ZA 2Z1XA 3ABZA 2A9BA 3TEWA 4ZMLA 3STLA 2IH9A 1PWMA 1KJ2A 3BD4A 4OIFA 4ZSOE 2WQWA 4N2EA 2WNKA 1ORSA 4V1YA 5ERWB 2PO6A 2JCCE 2R0LH 5CBEB 3VUSA 4JL1A 4PRIA 2FK9A 3KLHD 2YFOA 4EMZA 3WH6A 3WUEA 5JTWA 1OGBA 2AC0A 3WQEA 3OG2A 15C8L 3LGGA 5FEBA 4YDIL 4Z7VB 1MREL 5E8EB 3LZFH 1C9DA 3WFDH 5C0JA 1KW1A 2QKIB 3H7VA 4XNDA 3NABL 1PZSA 2CZVA 3CUHA 1NCAL 3F4VA 2DLFH 3R0NA 3BI9X 5B1AB 4YO0A 3MI2A 1F3JB 3IRDA 5BRZA 1MHPL 5DYOA 4YHNB 2FLIA 1DE5A 4NDMA 5JDJA 5MENE 1I7ZB 2IGTA 1H5BA 3ULVH 1AG1O 2O55A 1WUZA 4CMHC 3P4MA 2V7HA 3U4FA 1OSYA 4KKRA 3KP0A 3QHFL 1BWVA 2XIOA 3VX0A 1X7TA 2B7NA 3SDOA 3H3PL 3BK0A 4B9GA 3ZDYE 3EJCA 4WI4A 2JGYA 3WIFA 4TSAH 5E03A 1ZVSA 3CH0A 3NZPA 3P84A 5J06A 5IGXH 3UIYA 6FABH 3TV8A 3QA3B 4K4KA 1HSBB 1YNKL 2WXIA 2PDUA 5MEPB 3FCSA 1E73M 2VIRB 4M6OH 3S3DB 4FB7A 5AN7A 4R9XA 1J5DA 5DBUA 1J9RA 3Q01A 1BGGA 1WKDA 1IHIA 1SBSL 5MKGA 3AZRA 2IFFL 1OG0A 2JF6A 5IBUB 2Z7GA 1OPGL 4HS6A 2HVOA 4BH8B 2QJGA 4PMOA 4MZ3A 1G4EA 4NFDA 5JNYA 2OELA 5F7EL 4K23H 3PGFH 3V95A 3REWB 3GMNA 2VDQB 5A2KH 4PJ9A 3BAWA 3DURA 4AL8C 1D2KA 3EYVA 4EQ2A 3ZT5A 3H4WA 2EKSB 3G1SA 2VAJA 5C0IB 4XPHL 4JYDA 1YJDH 3U7YH 1YPZB 3PS7A 1IKFH 4L3FA 2A85A 4HOXA 1TVHA 1CD0A 3WXVL 1TZGL 2R9HD 4FXGA 4ZNEA 3MLRH 2WYTA 4N1EA 3WFBL 3CZGA 1XISA 2ENQA 1LLWA 1SBBA 1YXDA 3G04B 1JPGB 5FF2A 1F8TH 4HUMB 3R4IA 2FVLA 3OBAA 2A4AA 4L64A 6CGTA 1ONWA 3W1ZA 3PWPA 1N26A 2RGSA 3OLDA 3SCSA 2G2PA 1RK7A 4NZUH 1NMCC 2NW3B 4HXBH 1WDQA 4AD3A 5DQDH 4N6EA 1SVDA 1A4KB 2PYFA 1BQCA 1SO5A 4UT6A 1EFQA 1Z69A 3RAJH 5LQBL 2H9AA 2QAFA 5DHYA 1TWSA 1Z7JA 5DC2A 4S3FA 3WNNA 1SDDB 5IQ7L 2R0WL 1R47A 1A6TB 4BK8A 3UC0L 3SY0A 5LO7A 3V1PA 3RI5F 2E68A 2C19A 1FRGH 4CGTA 4MWAB 2HV5A 3CLFH 3FAWA 1OC7A 3WSUA 2VWEE 3CUXA 2EEFA 3URBA 4PGDB 2ITCB 1MYRA 4P3CL 5GGTL 4QYOA 1SJAA 1TTRA 4LUJA 3CFUA 4WDIA 4PL1A 4U1KB 4NN5C 3BD3A 3O6YX 2VDMH 3CZUB 4FQJH 4X5QA 5A5WA 1FKWA 4G8GE 5L88L 2IV8A 4O57A 3W7EA 5M95B 7TIMA 3LN9A 4JJ5B 4UTTA 1UXWA 3PXLA 1Z6KA 2O4MA 3HO8A 1E43A 1XG3A 1TPDA 1JF1A 1EJSC 4F33A 3SW6A 1YMMA 2NY3C 3VXMB 1FHUA 4GSUA 4OKDA 2IOOA 2BVDA 4NAFB 3ZDYF 3R19A 1DVUA 5G5DA 3GVQA 4IRZA 1MDRA 3NK4A 1LWJA 3W75A 1IGWA 4PJ6A 4L0ZA 4HD9A 2WTOA 4KK5D 4JKWA 2VR6A 3IE4A 2GW5A 3D87B 5CIPB 1TV8A 4Y96A 3IE9A 4OZHF 4B5NA 3FYYA 2ZIDA 4D9RD 3VQLA 2WZTA 1JTTA 1TIUA 3R06A 4PB9H 4JGMA 4PEKA 1KCRL 4GO8A 4B5XA 4S1QL 4WRHA 1TV3A 4HIHA 5FGBC 1FXPA 1A7NH 5IB4B 5FJJA 5KSBF 4FIQA 3PIQB 2OQJA 2I14A 4O02L 1QWKA 4FS9A 1PSCA 2C7UA 3LTSA 1TMLA 3OQ8A 1DUYB 5F1SA 1SJDA 3H21A 3IIVA 4LFHD 4OZIE 5LHEA 2YXXA 5DJZA 5EA0L 2RAMA 5HGHA 4GY1A 2BVPA 4UQCA 1IIIA 5ICYA 3JUZA 3VIHA 3UTTB 3W82A 1SUHA 1UM6L 2ZOKB 5ISZD 1INQB 3LXUX 3HKZA 4MRCA 1RZQA 3RM4A 5FYLH 3GDLA 4WKAA 4NKDA 1NQ6A 3PFQA 4GFXA 3HGRA 5DZAA 3U1SH 2BNQE 4Y2NA 1MY7A 4JL2A 3UABA 2TRSA 4N24A 4J3ZA 3WEBA 4KVPA 3ZDZE 2KPNA 5FKPB 4GXFA 4C6JA 3VG0H 1VZIA 2GCYB 5DDHA 3L4ZA 5HDQH 3NQIA 3JVGC 2WBXA 3WJXA 3D0VB 4UOZA 2UXTA 1WCQA 4Y0GA 2IKGA 2PI6A 3EJYC 1ZTXE 5HHMB 3QZWG 4HU2A 2J1KA 5FIEA 5T33L 4J40A 4XPAH 2PYEE 3OR6B 3LI1A 1KLGA 4KK6D 2YARA 5K9KA 4BA0A 4ONHA 2D0GA 2GEQA 3ZFHA 3PJUA 1REQA 4L9XA 4D8PA 3EO1B 3KYOA 4QJ3B 1M7DA 3N2TA 3DX7A 2CLMA 3DX3A 4PG9B 1DL7L 2A79A 1KLZA 3OZLA 4PJXE 4TNWF 3NCMA 4R7JA 5DD3H 3L5AA 3TBCA 3B43A 3P3SA 3TL5A 5GS2H 4NPJA 3MHGA 2H32H 1US0A 2Q8BL 4AM0A 3VD7A 4A55A 3GXDA 3TTYA 3FSVA 2UV3A 3O45B 1I4FA 4I1NB 4GQ9H 1NBVH 2CK0L 1NOWA 4DCQB 5ADPH 2PP3A 3GKFA 3FOLB 4U1LA 3FB7B 5EN2A 1MI5A 3LBCA 4LHUB 1UCBH 4L8BB 1GMEA 2XFXB 4AMCA 3L81A 2FD6L 5AYUH 3DROA 3MVTA 1HI6A 3PR2A 4EPEC 1XYCA 5EORH 3P5ZA 2GJXA 3G6MA 5ILTH 4PLKD 2CGRH 4WUUE 5I00A 3KDOA 3R0MA 4ACPA 5FYJL 4ZSOA 2VDPL 1LOLA 2C9UA 5D1XE 4TIMA 1HUVA 4JN6A 4LYPA 4IISA 5GGRB 1EWHA 1FNLA 1CB7B 3ZMEA 2XWBB 2FR4B 3PWGA 2YKLH 5IEHA 1BYDA 4F7KA 1Q6QA 4ZMXA 2HDJA 1LROA 3K6DA 4AMKL 3K71B 2CU0A 2JKIS 3GAKA 1BIIB 3VFCA 4PJFE 5I1JL 1RLBA 3N43F 3EMZA 2E75C 3ARFC 4EOUA 1GZJA 3C08L 5J04A 2E3ZA 4QHLA 1DIOA 3JV4B 5EB9A 5B1JA 2YD5A 4LRSA 2ZWKA 4KVCL 4UAOB 1SY6A 1GYLA 3A4FA 4AD0A 3NIGB 4DJDA 5HR6A 4C8XA 3VC6A 3QFDB 2VDOH 4GAFB 5E4IA 1H7WA 1F0LA 5MENA 3UMNA 3IV3A 4QRPB 3VXUD 3ITYA 5DZVA 1YNPA 3QEGL 4G8AC 4ZOAA 4CNUA 4IICA 5IVNA 3NOEA 1W1PA 2AJUL 3Q7JA 3GNXA 1DIDA 3ZUNC 1AA1B 1X5LA 3AFLA 1JNHA 4WFED 4KFNA 4EVNA 1A9VA 1VP5A 4NRZA 2H0EA 3URQA 1T2QL 4OZHA 3U36A 3QGAC 2ZOTA 1EEZB 3MRPA 3M16A 1GSKA 3HFMH 3W88A 1SZFA 3ENEA 3KWWA 1XICA 3ZDZF 3QPQD 5I76A 3RYSA 3TTEA 3GMQA 3A4EA 5FJUA 3GEFA 3CHQA 2BNUA 2ADIB 4MA1B 4I2XE 3PGDB 5F1OB 3NTYA 3BIKB 1WC7A 3TE9A 3HTLX 4R8WH 3QDGB 3FQWB 2CRIA 4FKHA 4Q8WA 5KSBA 3I9GH 5J1SC 3C5ZA 3SY1A 3IM1A 2DQDH 2VXVL 2YSSB 2PTWA 1FPTH 3D39A 2PDBA 5FKAA 5HHQB 3H56A 1YDNA 1J8SA 1AW2A 4TVSa 4YHPA 5DMMA 3GSUA 1D8CA 3B2VH 1NIUA 3IEAA 1Z5LB 3ID7A 1ISZA 2YLAA 1J1XH 2A99A 4H4IA 3L8QA 2Y0FA 3NZGA 1WT5C 4JNYA 2XZZA 4L4MA 3DTDA 3FN9A 3UCRA 1RZMA 5GSVB 4WHYH 1CE1H 1YQVL 1LO0H 4XI5D 4L7ZA 4IKIA 5DTFA 4F57L 1LQAA 1TJHL 2EXWD 5I17B 4PGEB 4LSTL 2WIIA 1G7HB 2PWDA 2R7EA 2OXGA 5DCEA 4U1HA 1URZA 3OZ9L 1CFSB 5E2WL 2J8UE 5A95A 3WNJA 2CBTA 1G7QA 1G4TA 4WHYG 1XFBA 4NUQA 3G5EA 4K15A 4B9JA 2QS8A 5FO8B 1M71B 5D7LB 1ENUA 1WFUA 5KETA 5H37A 5I3FA 1KENH 3ZT6A 5GJMA 4XCCL 4YBQD 5G4MA 5C0RL 1FO0H 1M68A 1AZZC 3GJFH 1LBFA 3A4WA 1OX4B 4Y7MA 3W29A 1ETA1 4JPIB 5G4OA 4DZIA 1QMLA 1NGPL 1YXCA 2CDGB 3KM1A 4UTBH 3VXNA 3VTRA 1YRKA 2C6QA 5C9JB 3GNMH 3Q6GH 4FTDA 1CN4A 2ODIA 4BI7A 4PJFF 2WWNA 3LXAA 3SDDD 2QCEA 1EZLA 4FG4A 4NO0D 4EBQH 1AY1H 3VU2A 2WJFA 3IKCB 1GTHA 4S38A 3EWZA 4GRWH 5HXMA 4AZUA 5J6HA 4GO9A 1PBYA 4DH2A 4G8FA 2OSYA 3DGGB 1ZANL 3RNKA 4G8GA 1LRNA 1WB0A 1KKOA 3QDJB 1J9YA 3UZEC 5IUSA 2FECL 5DWUL 1JD9A 1XGPA 3S36H 3KL5A 2WNWA 2J20A 3SM0A 2JH2A 1P7BA 1MCPH 1KXQE 1H0GA 5IQ9A 1X7QB 1BXUA 3CLWA 1OK8A 3UPMA 3MV9D 2XQ0A 1M41A 5E1GA 1RURL 2H90A 3VD2A 1TITA 4PLJC 3TNNB 1HYSD 3UNTA 4TULH 3WTVA 1D5ZA 1V10A 1BVZA 3E2SA 1T66C 3QY8A 4UQDA 2ENSA 3MLWL 1OCWH 5DUPH 3QUMB 2F8IA 3AAZB 2ZCHH 3DVNB 3V2AR 4P7LA 3P0YH 4Q56A 4X9FA 1OFQA 3S5YA 3V0TA 4UDTB 5K9QI 3ZYZA 1C1EL 1JGUH 1CLXA 3W7DA 5EZIH 2IQ9H 3TNBA 1RI8A 2ATMA 4OCRH 1TTQA 1R3VA 3RPTA 5E00A 3BO8B 3NA4A 3DTUB 3FU3A 4PRDA 3D34A 4H6RA 2VXQL 2WLJA 3AG3B 4DBEA 5B3SB 3UR5A 4FQLL 4PRBB 3WLSA 3W76A 5ID0B 2PFHA 4RXFA 3RTQC 4NI3A 3AZSA 5B38B 2DSVA 4FG0A 4DAGH 2CEQA 5JQ9A 8TIMA 4LSVH 2HVJB 5IWLA 4QHMB 1OJXA 1PU0A 4OZIA 3UWQA 1NELA 5DUML 2PDPA 5DJDA 4XCYB 1IBYA 1V3IA 3U3HA 3DDMA 1S9XA 4KJPD 4P5MA 4ILSA 3QW3A 1QO5A 1ASPA 3GHBL 3PPCA 4LCIL 5BO0D 2HA1A 2VZSA 3UTSB 1G7VA 3WX7A 5JOFB 2BNQA 4KU1A 1R3LB 3ZE1E 5I1CL 5IBLC 3T7VA 3SD5A 1RZ8A 4Z3GA 3WEXA 4R5EA 5I8KH 4LASH 3CDYA 5LGKA 5FCSH 2QVFB 2BXVA 3HAEH 2A83B 2X7LA 3QEUB 5IP4A 1Q7ZA 1S9KC 4AM0Q 1QNSA 1PZ2A 3EBIA 2VUNA 4JZ5A 2J7HA 3WF3A 4JREB 2BPBA 1V6YA 1DQDL 5J12C 4Y8FA 3TKFA 3N9RA 4M81A 4IBUA 4JPSA 1ID5I 1UZ8B 1JHLL 2DLTA 2P5NA 3WENA 1M1BA 4ZUUB 5KVGL 3IFPB 4Q9RL 5HHOE 1AH0A 4LLQB 3Q6FB 5FO7B 3HAEG 4C56B 5DMGD 3GSQA 1U8QA 1BZ7A 2X4PB 1HKJA 2VISB 4RAUA 1AQHA 4PJXA 1HXYA 3VSTA 4GQ0A 2FEJA 3TOYA 2Z1VA 4P5TB 6ENLA 3A3XA 5DJYA 4MAUH 1SEBA 3NEEA 4ACZA 1LP9E 5EZPA 1KO0A 4A21A 4E4UA 3WFEL 3WTUA 3GK0A 3SPHA 2WUBH 2Y3NA 1N59A 3P9WB 2Q6WB 2L0DA 3SCRA 2WUCH 3MRHB 2AJYH 1PDKA 4BXSV 4WI6A 3TIDA 1OFAA 3DFSA 1IBHA 5AQ0A 4LLUB 1E3XA 1MZZA 5FC9A 3NPVA 1A5UA 5D7KD 3VFUB 4OJFL 3SJVD 1A4CA 2KI6A 3IVTA 5L2KB 2UZYA 3TO4B 5K9QG 4GHRA 4WUUA 1P7KA 5KN5B 5F1VA 2NNAB 3MYPA 4M62H 4M0XA 3ML8A 5D1XA 1NMAH 2V7NA 4QY8A 1YEEH 1M5WA 4Q8TA 1CENA 2N7SA 3SE8L 3DO7A 2Y7MA 3QF0A 2VDGA 1EZSA 4X6CB 3KS6A 4HK3N 1MRAA 5AKSA 2I57A 2FZNA 4PJFA 3U0PB 4IHBA 1AG0A 1G7PB 3MI6A 1ITXA 3LTYA 4PE8A 3PLYA 4QRSB 2UY6B 4Q32A 2CO7B 4P9HC 5I6XC 4B5WA 4NZDA 4QISA 1YEGH 4E9TA 4TYUA 4QLWA 1P43A 1UJQA 3HG1E 4ZS6D 5JDSA 1OD7A 4KZCA 1HHIA 4R7NB 5F3BA 5D9SB 4LOUD 4NJ9L 3G77A 2MQ3A 3W0WB 4IOTA 4MM1A 4LAQH 3D48R 5GGVY 1YPFA 5DHXB 2Z91A 1U8LB 1RCQA 1SJVA 3K72B 3BFOA 4ODHH 1UEYA 5DLMH 2XKSA 2PDHA 1JGVL 4Y16C 1FYHB 1A6WH 3QUZB 2ATKA 2B31A 4UM9B 1AW1A 5FYKE 1PX8A 3RVXC 1QI2A 2O9PA 5D93C 4HULB 5IQLA 2YR3A 3DX9A 4S2SA 2XWEA 3ZE1F 1YNQA 3EZ8A 4IGMA 4IX2A 4PUBH 2IDCA 4ODUB 4NZ4A 1T7LA 1CXEA 2OX5B 3P30H 2ZAIA 3EWBX 4OLZL 1VFBA 1H19A 2WYSA 4UMAA 4I2XA 3FU5A 1O68A 3LEXB 1SXZA 4TVUA 2QDDA 5K7JA 5AW9B 3W39B 4PG2C 4AQ1A 2CITA 1NQKA 1AKJA 2BFVH 1L6FA 2DN7A 2BDNH 4POUB 1KGXA 3ROLA 3OIXA 3RGVC 1GOGA 5E99L 3T65B 2GFBA 4BQ4A 4E5XG 1BTMA 2OR9H 1PYMA 3TSDA 5CN1A 2MCMA 4OCSL 3QFJB 3NBNA 3C61A 2P47B 2XXMB 2DQEH 2GI0A 2IALA 2VLKD 4U0QB 4QROA 2GGJA 3QIBC 3S9DB 4BSVB 2J57A 1MZRA 4JUSA 4LRTA 2PTUA 2X1XR 3QZNA 1MPAH 5GGVL 5GJTL 4DAIA 1JTPA 4AWSA 3BRFA 3D51A 1A80A 1PLCA 1BGXL 3TSMA 4ELME 5E8NA 2WBJB 4PCKA 3FTGA 2AKMA 3WIHL 3HI5H 4BRVA 1GTNA 3GB6A 4FQCL 4MYPA 1TE6A 3SO3C 2AP2A 1LP9F 3ATDA 2X44D 3BKMH 4DP4X 3E6HB 3LHWA 4NYLB 4R4FL 1RZKH 2I07B 2FB4H 2W65B 1NDYA 1TVBB 2XT1B 3OKOB 5HJDA 5K39B 3O3AB 2WZ5A 1O5KA 3TT1H 2EPOA 4FX8A 3TN0A 32C2B 4P5KA 3S8WA 2VJ0A 3IDIB 3JTTB 3SKMB 1QTSA 4MPQA 3W7RA 4JKPL 3TQPA 3RPDA 4M6NL 3GTFA 1BBDH 3NPXA 4N8VG 3UL4A 1UB6A 1JDFA 2ZC8A 2N1KA 1OM3H 4HWUA 1ZTVA 3F4NA 3MJ6A 2PDYA 3MKGA 4GW1A 2IGFL 4LANA 4YSOA 3HBGA 4EN3D 2O5ZL 5DI8B 4HN8A 1OZMA 1S7RA 1YTEA 2XUCA 4B2DA 4NG3A 1K9TA 5I9QC 1EHKB 2VKZG 5EU6E 2E9WA 2VYRE 3L3JB 1GVEA 3WKML 3HBQA 4KTGA 5EU3B 2DQTH 1ZDSA 4IQLA 4Q4KA 3TOPA 3HFTA 2IKIA 5TQLA 3T2PA 4RZ5A 3LDVA 3MVIA 3MNWA 3CK0H 3HUJB 3LZRA 3W22A 2YQGA 4EZKA 4CN4A 2XIJA 3WCZA 5IQOA 1E5UI 2FSEB 2GTWB 1KXQA 2HP4A 3O2DL 1KLYA 1ZHLA 4QTIH 1BZ9A 4OT7A 5KITA 4HBCH 1N8FA 2CETA 2W0KA 2Z4QB 5BRZE 3PWVA 3WHXA 3KWXA 5M2FX 3FYOA 3ELFA 2V9QA 4HJUA 2OFJA 2CRYA 5B39G 3MJ7B 5LGZA 4OF7A 1PIFA 4QAWA 3EGSA 1E3FA 4PWGA 4CC4C 3OJMB 1X7FA 4P23A 3WO3B 1ZIAA 3GFUA 5EMJA 4L56A 4NKMB 4KI5E 2XYCA 5E7BA 2W5PA 3GSWB 4ZEPA 4KKCC 1K9EA 2VZUA 4X6BA 3QW4B 2Z35B 3ZHFA 2RB8A 1E1CB 1F1DA 2C18A 4GPNA 1PCWA 2PXYB 1TJ0A 1E4KC 4KK9C 3SDYH 4WV1C 1WZ1H 3NSYA 5EZLA 1R3YA 3LVTA 3C86A 2DT3A 1YEFH 3I85A 2PYED 3FB8A 1FWBC 3K8LA 1MCJA 3MRCB 3I4KA 3QUXC 1EDGA 4KDTC 3GDCA 2APSA 1ADDA 3I7QA 3FA3A 5EZOH 1P5VB 3BLFA 4DEWA 3FS2A 3C6LC 3HW7A 3B9EA 1RA5A 3CFMA 5BOOA 3UR2A 2XH7A 3MRBA 5HJ3B 3WLBA 3FYEB 4QRNA 2I26N 1X4ZA 1NJ9B 5CBAB 4HYWA 3PQYD 3HHSB 1BOYA 1UD5A 4MNGB 2OWXA 4MKVA 2XWXA 1DORA 3NM1A 3LENA 1G9HA 3WN6A 3QC6X 3CB8A 3G0UA 1Z3GL 4KGJA 5HGBA 2QQLH 2IXUA 2IAMD 1DVYA 4D6HA 4HUXA 5KVGE 1UA6H 1E27B 1VRXA 1B4JH 3QWOA 1X9UA 4QCIB 4F37F 1BG4A 3D0LA 4DWHA 3RR4A 5JUVA 3G6JE 3BKCH 3V8OA 4S3GA 4DN3L 4PJ5D 5K1JA 3E0WA 1L7TH 2D4FA 4WKXA 2HS6A 3UYPB 2MCPH 1M53A 5HHOA 3B7SA 2ATPB 2R6OA 1KM2A 1SZNA 4EEEA 3ILDA 1INEL 1XV8A 1MFEH 4QHNA 2R94A 3RZWA 1SFLA 1JUKA 3UZEA 2VABA 1AO7D 1D7KA 2J9XA 4WO4B 2PTDA 3F6JA 3KCWA 1EAPB 2DQCL 4XO3A 4XWOC 3IMTA 3W3OA 2BWDA 1GGYA 4HK0B 1RQHA 2VQ4A 2X7WA 1LP9A 5IVXB 3WMPA 1HKKA 4U5IA 5I2IA 2MHAB 3ZL1A 3NPSB 1MFBH 3EH4B 3VI3B 4YHYC 4C1NB 4H20H 2DIBA 1U3HB 5D2LE 5T1MA 2ADYA 4CEUC 1MEXH 1OO2A 4P2OB 3D2UB 1E0TA 3VKCA 4ODTH 3FQ4A 4HYVA 4DZBB 1K7XA 5AUMA 5DD1L 1ZEAH 2AK1L 4XB8A 4XD5A 2VEPA 2TSBA 2KZKA 3DC8A 2I85A 2ZWNA 5A2FA 1L6YA 3L0KA 5I1HL 5LNVA 4R53A 4JFOA 5FHBH 2ALDA 2EIZB 2E7BA 2VEGA 1IFHL 4MJMA 3RCNA 4YDLB 4LRIC 3BH8B 2F84A 4LCWD 1KV3A 2D8KA 1PTZA 2F53B 4MHBA 4KI5F 2BXZA 2YAHA 1S1PA 3C3NA 2EECA 3IGXA 4WR3A 2QVHA 1U95A 4PJCF 1F13A 3FUIA 3HC2A 4Q9BA 5D7IF 3RPBA 5ID1A 3ZVVA 1FFNB 2HJLB 1S3RA 1MCFA 2XPGB 2HKHL 4G1MB 4PJGB 3K6FA 3TF4A 2VELA 4BM7A 3UG4A 4LVNC 2PCQA 2OKMA 1FG9C 3ULUD 3PB0A 2IADA 1B3ZA 2VN3A 2RKXA 2TODA 3HG1A 4GW4B 3L5XH 3FJTA 5GVJA 1W3NA 1E40A 4BH7B 1M1SA 5LXGL 2AEOA 1X5JA 1AXIB 4LEXH 1NL0L 3PAVA 2ZYIA 3ATEA 4ADIA 3DN5A 1OE1A 2AQ1A 4G1NA 3F00A 4GI6A 2C1GA 3BQUC 2O1AA 2CZEA 1Q1JH 3MT1A 3JWNE 4HA3A 1XH2A 3AABA 4M7JH 2B9BA 2Z28A 2BP8A 4X6FA 2YDQA 2DZUA 4LOVA 2NUXA 5FEXA 3UO1H 4DI9A 2HMID 5A1AA 3W83A 3RLSA 3HVDA 4CCZA 2IWFA 4L5ZA 2QKFA 1W0WB 3D0AA 4BQCA 3VXGA 5K33A 5B7FA 1JCKA 4DXKA 4CDGC 5L9DL 1I9CB 4GSQA 1YY8B 3PHSA 2NYYC 4IZGA 1T2XA 3RWHA 1YLVA 4QTGA 5E1AB 4LHJB 1LD9B 1Z44A 3S6CA 3D33A 1UC4A 4ELDA 3KLQA 1UOWA 4FQHA 4IDJL 2E7FA 1AYOA 5FK9B 3G6JF 1PFOA 1GTFA 1H1YA 3I68A 3TMQA 4WWKC 4XAPA 2JI3A 2YGOA 1HSAB 2NQCA 5FX3A 4WGXA 5E9DB 2OT1A 3LQLA 3EFFA 2RDTA 3IJ8A 4S3EA 5DEZA 3FQ1A 5DRZB 1KFBA 2P5ED 3ARWA 4FYTA 2K9FB 2I7OA 43C9A 4XC1H 2W59A 4M9OA 2W1NA 3NZHH 3ZE0F 1A0QL 4KXBA 4LLMB 3WGVB 3C0LA 4PBEA 3W2LA 1UWEL 4ELMA 1NC4B 1UCWA 5TK4A 4HT1L 4X22A 3NRFA 3W7NA 4I3RL 2WXOA 3APDA 5HJBA 3T08A 1QVBA 1NFIA 4JGNA 1HKMA 4Z7QF 3TYGH 4NP4L 4KRPD 4U6YB 4LCYA 2R8SL 5A3HA 4NEHB 2FL5B 5FESA 1J5CA 1F7BA 3K1GA 1CGXA 1UA7A 2AGJH 2CXEA 3EOTL 5I1AA 1OARH 3FH5A 3IBOA 3DIPA 4OIAA 1TZOA 3TM6A