1FH9A

Crystal structure of the xylanase cex with xylobiose-derived lactam oxime inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-XYLANASE
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh9A00
3U7VA 1UYQA 1UHVA 3WDPP 1E3XA 4ML4A 2XM2A 1DP0A 5HPCA 1ZBCA 1WB0A 3B9EA 2JEQA 1BSIA 5FKYA 1UA3A 2XSBA 1IT0A 3AIWA 6A3HA 4JFVA 4ZXLA 3WEMA 4P7OA 3WIJA 2O92A 1E3ZA 3D3AA 1VBUA 3VIFA 3WH5A 2YIHA 3ZR6A 3AXIA 2J7DA 3GNPA 1XGZA 3FNDA 2F61A 3U7BA 4A4AA 2EPMX 2ZX8A 4AZIA 1BYDA 3AMDA 1ZS2A 3I3DA 3OLGA 2ZE0A 5ABHA 3MO4A 1JXKA 3SCVA 1QHOA 3UR7A 2QF8A 4HPGA 4W88A 4D71A 1GW1A 3NJ3A 3HU7A 5E0CA 3VX0A 1E43A 1E40A 2WHKA 4E8DA 2JF7A 4E8CA 1FH9A 5E0FA 1HIZA 2VR4A 4MNJA 3ZMRA 5IHSA 3UG5A 5C70A 4Q22A 1XH1A 1E5JA 2WCAA 1B90A 3VO0A 3W81A 4HMCA 4IM4A 2C7FA 3GM8A 4J7RA 1US2A 4AD5A 1CYGA 4CCEA 4OBSA 3GZAA 4GO8A 4S3KA 3S2CA 1UH3A 3W0KA 2EBNA 4DUXA 4W5UA 4D6IA 3WNLA 2CESA 3WUEA 1J18A 3E1F1 4CCDA 2XVLA 1GOMA 1FP9A 1GONA 1NOWA 1GOIA 2YA0A 5D9MA 1VENA 1B31A 1UR0A 2JALA 1K9EA 2WMJA 1UOKA 3A6OA 4MNMA 2OYKA 4PTWA 3FY1A 5A3HA 5AC4A 4HOXA 3L2MA 3T0BA 1J10A 3W53A 1GHSA 1OINA 5E09A 3VINA 1R8LA 3BAKA 4B16A 5A1AA 2ZXBA 3KZSA 4ZXOA 1M53A 5I77A 1OIMA 1EXPA 1VFOA 2Y2WA 1NM9A 1BVNP 1Q6FA 3BMWA 3AOFA 4M81A 1ZB5A 3K46A 3WL1A 3WD1A 2WMFA 4AD1A 1MXGA 1JZ8A 5D4YA 4LPCA 3SUWA 3WEOA 2E9LA 4PMRA 4AWEA 3F5KA 4L4PA 2WVSA 5DEZA 1GOWA 1V6VA 4TTUA 3W4RA 2DSZA 1HKIA 3HMCA 3OLIA 1E6NA 1GHRA 4YHEA 1W9XA 4WKHA 1CGYA 2J74A 2C8NA 2CHOA 1UD6A 3ALGA 2J7EA 5BXSA 2PWEA 3D5HA 2GVYA 1KGWA 4MNLA 3T08A 3BLPX 2BVTA 4WLCA 2BHYA 5I0DA 1CXKA 1QW8A 1HJWA 4UQBA 3IJ8A 4WJXA 5JIPA 1CXEA 4E4PA 5BWFA 1MQRA 1UWQA 2IXVA 4GO9A 2HISA 2ZX7A 2V38A 4F9JA 1F4AA 4M1RA 2A3BA 1RP8A 1E6ZA 2F2HA 5FL0A 4KGJA 1DHKA 1C93A 1J12A 2WC4A 2D3LA 2WBKA 3RCNA 1WPCA 3PTQA 2WZHA 3FAXA 3VNYA 4NRRA 4P8XA 4XUYA 1UKOA 3U5UA 4YN5A 4TOQA 1ISWA 4CD6A 3WUGA 1A47A 3DYPA 4PTXA 1BVZA 2FH8A 3WD0A 3VGBA 1V0MA 3WQ4A 1H0GA 2DSUA 3CO4A 2VVSA 7CGTA 1XYFA 4HU8A 4F66A 3GXMA 1M7XA 4KGLA 4MNKA 4N42A 3VD3A 3WNMA 1BYAA 4ATLA 4K68A 2CBJA 4U5KA 4Z2GA 1UZ4A 3FAWA 1IZKA 1CTNA 2J77A 2E9BA 5IFPA 2DEPA 4QP0A 5I5RA 3WL0A 4PMXA 1DWHM 1UQYA 2IUZA 2NSXA 4UFHA 1OB0A 5CPSA 1NP2A 1US3A 2OYMA 3VDCA 1AQ0A 1EO7A 1E4MM 1UH4A 1V6YA 3W6MA 4AZ6A 4GI6A 3MUAA 1GQIA 1CLXA 3OLEA 1AQHA 4WKFA 4MB3A 1ITXA 3KWXA 4U33A 2J75A 4UQDA 2OWWA 3NIYA 2C0HA 3WH9A 1W9VA 2YJQA 1EDQA 5HXMA 2J62A 4ZE5A 1PAMA 4AYSA 4J3VA 1NH6A 2X09A 5HNNA 2FGZA 4ATWA 1XH2A 4PCSA 2WLZA 3VDHA 4CU8A 2O9PA 3FN9A 3CPUA 1BAGA 3VIOA 1H41A 3AMKA 3W82A 4P7RA 4MPKA 1JYVA 3VUPA 3IK2A 1QNSA 3A4XA 1TR1A 1MQQA 1MFUA 3GTNA 1MW2A 3VPLA 3EDKA 4FLQA 3L4ZA 1D3CA 5CSYA 1L0PA 4CN1A 4AY1A 1W1PA 1EQCA 3PHAA 1FFQA 3I3BA 3PZGA 3AQUA 1MXDA 2JEPA 1E6SM 6CGTA 2E9MA 3JUGA 2E4TA 1LG1A 4GZJA 4WSKA 5A6AA 1TZ7A 1HF6A 3AJ7A 8A3HA 4AIOA 4HA1A 3CZ8A 3TONA 1LLOA 2VUYA 4PUDA 2WHLA 3MSDA 2WHMA 2VX7A 3PN8A 5A6BD 1XRVA 2PWGA 3WD3A 3UEQA 5I3DA 4ATDA 3AMCA 2J7FA 3BAYA 5CXPA 1S46A 5E6YA 2V3FA 1EOMA 2QHAA 2A3EA 3FW6A 1KXTA 3WDJA 4EKJA 4JFSA 5DFAA 5A6MA 3DECA 5E6ZA 1UD3A 1QI2A 3AIEA 4HA3A 3WY1A 1WCGA 5A8NA 2XVPA 1C8QA 5A8OA 4OIFA 3QHMA 3GH5A 4Q7NA 4CVWA 3UG4A 2CETA 3W37A 1KWKA 4CU7A 3CHDA 3OLDA 1XCWA 4Z2IA 1NP0A 1TG7A 3WD2A 4AIUA 1J0IA 5LYRA 4UOJA 1KB3A 1KR0A 2RGLA 4OZOA 4RE3A 2D0GA 5CPTA 3QOKA 2MANA 3BSGA 4BA0A 2DT0A 3AISA 5LA2A 3ZR5A 4D72A 1HJXA 3AS0A 2W61A 2BHZA 3KL3A 1UQZA 5CLTA 5A69A 1CNVA 2CERA 4RE2A 5CJ5A 4JZ5A 2EPLX 2BY1A 2VZTA 1LJYA 3AS2A 3BCFA 3VD5A 3VMOA 5EFDA 5A6SA 5HBFA 4H7VA 2EXOA 3ALFA 2AMGA 5CG0A 4P8UA 3WQ8A 3W29A 3N15A 4W8LA 5ABFB 1PPIA 2V5DA 4J3SA 1XC6A 4GZIA 3UG3A 1V3IA 3MUY1 2JIWA 2XG9A 1JFXA 1KQZA 1M03A 1UKPA 2WB5A 1B3YA 2V3EA 4AZ7A 4HP5A 3WSUA 4YHGA 2VX6A 1E73M 4PTVA 4CN6A 4A3HA 3CGTA 3VM5A 1AMYA 1OT2A 2ZICA 5ABFA 2WSPA 1JDCA 2QV4A 3S6TA 3VIMA 1JGIA 1C8YA 4KMQA 4NZCA 3VIIA 8CGTA 1E55A 1ISXA 3RM9A 3WFZA 1FOBA 1E71M 1DWAM 4AD4A 1FA2A 4BZYA 1C3FA 3LPGA 4OOZA 1IV8A 3K4AA 4UFMA 1B30A 2D0FA 4MAVA 1Q4NX 3AXXA 4H04A 3CZEA 1H1NA 1HXJA 1C7TA 2ZOXA 3CIVA 2WANA 3THCA 1CDGA 5DT7A 5DMYA 4WIWA 3BAIA 1XH0A 1HL9A 2J7GA 2WLYA 5M17A 2YA1A 4TX8A 2WW5A 2G41A 1ODZA 3VU2A 2GK1B 1OGBA 1KBBA 1V3JA 4BS0A 1V0NA 2VCCA 1QNQA 2XFFA 3QOMA 4DWSD 1W1YA 4HOZA 5HPOA 3GBEA 1SMAA 3B8SA 2E8YA 1WZKA 2DPEA 3NYDA 5A6KA 3L4TA 4BQ3A 3VGEA 3WBAA 5CQ1A 4AISA 3CTTA 2GK1A 3WNPA 3LMYA 1JDAA 5BRQA 1SMDA 1XHGA 4Z2JA 3ZT7A 2WNWA 4HZ6A 3GYCA 3VGGA 1QHPA 2X2YA 4IPLA 1JG9A 1NWRA 4PMNA 1B3XA 3AS1A 3AS3A 1R86A 4Z2KA 3AIQA 5C8BB 1H4PA 5A8PA 3K4DA 1CXIA 1JYWA 1CIUA 4LYPA 1R85A 2BVDA 3SCOA 3CZJA 2VCAA 1E9LA 4PMZA 3VTRA 4W87A 1WDQA 1FH7A 1GOQA 3O9NA 5LA1A 3N17A 3HN3A 1EA9C 5A95A 3W25A 2W62A 5I23A 3BCDA 3ZO9A 1OBAA 4PCTA 1W2PA 1TUXA 1Z32X 3AYRA 2E40A 5D9NA 3SCSA 1PJ9A 2VZVA 1F4HA 1E0WA 5IDIA 3T0DA 1BYBA 4QCFA 1B2YA 4AXNA 4M82A 2A3AA 4TTGA 1V3HA 3SUUA 2X1IA 2BVYA 2CCRA 5A2AA 1XD0A 2J7HA 1C92A 1EDGA 1E72M 2VZOA 5C71A 1UA7A 1TVPA 4KRUA 1QI5A 2QLYA 1R87A 2CBVA 3VOCA 1LF1A 1OM0A 4JL2A 2ZWZA 2QMJA 4AZCB 1Q6DA 1C91A 4GXPA 4CN4A 1W3KA 3CZGA 3EDDA 1MW0A 3OGVA 4OOUA 3UCQA 4U3CA 2W63A 2YL9A 2WKLA 4AZCA 2GSJA 1GJUA 1UH2A 3ZJKA 4AZGA 2DT2A 1CZ1A 2PBOA 5JUVA 1TVNA 4HMEA 3ARUA 3I3EA 3RJYA 2OSXA 2VI0A 2E3ZA 3EYPA 4KH2A 4JHZA 4FK9A 2WMIB 1Q6GA 3APGA 1W9UA 2VQUA 3CUHA 3CBWA 3MMWA 4Y7EA 1CWYA 5I2UA 2G3NA 4U3AA 4UFKA 3DHPA 3NSNA 1JAKA 1V6XA 2DSKA 1J11A 1MW3A 2F8QA 4JHOA 3G6MA 3WF1A 5AYIA 3QHNA 1UWSA 3WENA 1TMQA 1OWQA 4XZBA 4D1IA 4OUEA 1PEZA 1JL8A 4KWUA 4D6DA 1E6PA 5FOOA 4JKMA 3TTOA 1Q6EA 2NT0A 1FHDA 4AC1X 2Y8VA 2AAAA 1RP9A 3RMEA 3LPPA 5EBAA 1R7AA 2CKRA 3ARQA 2UY3A 4LGXA 2DIEA 1V08A 3A3HA 5JBEA 1V3MA 3T09A 1KWGA 2VO5A 3TA9A 1E15A 1J9YA 1EDTA 1TFVA 1GUVA 1E0VA 1G0CA 2DT3A 4UZUA 1KR1A 2V3GA 1UD8A 1UD2A 2XHYA 2EO7A 4CD8A 3TP4A 4URIA 4MB1A 4M24A 2Y24A 1ZBVA 3SUTA 4PMQA 2YLAA 1UKTA 1OGGA 4ZEPA 1HJQA 6TAAA 2ZWYA 4W7VA 4F9DA 2ZX9A 4NI3A 3ARPA 1QHZA 4TX6A 1UKSA 2CPUA 3UERA 1G5AA 3QGVA 2G8ZA 2ZXQA 3WF4A 4EANA 2J79A 2J47A 4PUEA 1GVIA 4V2XA 1XSIA 4MAZA 1RH9A 1QBAA 4UCFA 2W4XA 1UZ1A 5IXEA 2OWXA 4UQ9A 4PMVA 4ZFMA 4QDMA 2HVMA 1FP8A 3K8MA 2WC3A 2Q8XA 1H0IA 3UETA 4A3YA 3RDKA 4PSPA 5DT5A 1J0HA 4CGTA 2EJ1A 3TTYA 3NUKA 2XYLA 1O7AA 2DSVA 4W84A 5CGTA 3BH4A 3WMBA 1KBKA 5D8WA 3VMPA 5JBDA 3SUSA 1P6WA 2YDQA 5IFTA 3SCNA 2DGAA 4JKLA 4HTYA 1WKYA 2GDVA 1DEDA 1FFRA 2UWFA 4PYSA 1VEMA 5EFFA 1WDPA 3ARZA 3WNOA 1YQ2A 3FXYA 4V27A 1X1NA 4TVCA 2BNJA 3MMDA 3GBDA 1C7SA 2V3DA 3AIRA 1ZBKA 2FHBA 1LWHA 1OT1A 4X0VA 2J7CA 2UY2A 3CHFA 4P7LA 3WQVA 2D1ZA 3AIUA 3VD9A 3ZIZA 4BQ2A 1DTUA 3VILA 5EB8A 2VJXA 1CGTA 3PZTA 1XCXA 3VDAA 3WUFA 1J01A 5A94A 5A6BA 3WD4A 1QI3A 2XVGA 1Q6CA 4MADA 4MDOA 1M04A 3KL0A 4P7NA 1D7FA 3B9DA 3NDYA 2CITA 1CXHA 3RM4A 3VD4A 1V6WA 3LPFA 5ABGA 1OIFA 4W7WA 5HDRA 4LXFA 1FHLA 3WH8A 3IJ7A 2BHUA 1BFNA 3L4YA 1GCYA 4QLLA 4D6JA 1K9FA 2WAGA 4WKAA 2CBUA 2VZSA 1CXFA 2ESCA 2BFGA 4PN2A 1G1YA 3L2LA 4QLKA 2NT1A 3SCUA 3TOPA 2XM1A 1B3WA 1EGZA 4MB4A 4GQRA 4FLSA 3T2OA 3OZOA 1CECA 2Z1SA 1HJUA 3K8KA 5I79A 2YDRA 2O9TA 3MSGA 4P8WA 3ARXA 2BXYA 2X0YA 3U5YA 3BSHA 5GQBA 1WNOA 1VFFA 2X8RA 4F8XA 4X9YA 1UKQA 4LX4A 4DUWA 2G3JA 1ZU8A 1KXVA 2OSYA 1HKJA 3ECQA 1QNPA 4JIEA 3L4VA 2A3HA 3ZT6A 4F79A 1WP6A 1U2YA 2FHFA 4IPNB 1W2VA 2VCBA 5FIPA 2VNCA 4RL3A 3TTSA 1CXLA 3CUGA 4UOQA 1ESWA 2E8ZA 3WNKA 2D20A 2VRJA 2CIPA 3WQWA 1M01A 1QW9A 1XSJA 3F5LA 4WK9A 1JNDA 1BGAA 5FL1A 2PWDA 4M8UA 5DF0A 3HJEA 1LL6A 1UWIA 1V03A 3OIHA 5EMYA 1GVYA 2D0HA 2V5CA 4BQ4A 1IZJA 1MW1A 2ZUMA 1OGSA 3ARTA 1C8XA 1PBGA 1KGUA 2XVNA 1E6RA 5M03A 1JZ7A 3POHA 3PZVA 3DYOA 3LPOA 3RILA 1GOOA 1UUQA 3AIVA 2Y5EA 4D6EA 5FD0A 4ZENA 3EDFA 3NCOA 4PEEA 1BGGA 2FGLA 4GINA 4M80A 2ZUTA 4QFUA 4R27A 5KEZA 1GJWA 3CHCA 3M7SA 1ISZA 2VC9A 4QCEA 3CUFA 1QPKA 1PX3A 2XVKA 5M5DA 1HNYA 2OYLA 1GQKA 4AZHA 4JL1A 1UR1A 2XPKA 1BG4A 1V0KA 1SR0A 3WF0A 5GNXA 4V28A 3L4UA 1I75A 3BAWA 5A2CA 1JNEA 1WE5A 1ISYA 1GQLA 3W38A 3PZ9A 4HPHA 3IJ9A 1TE1A 3UESA 1HKKA 1HP5A 1V0LA 1JZ4A 3ARYA 1FH8A 2WZIA 5CPQA 2BY2A 4D1JA 2O9RA 1ECEA 1TCMA 4BQ5A 2YOCA 1UWRA 2FDMA 2ZX5A 5BXRA 2VL4A 3AHYA 5AY7A 1LL4A 3F4VA 1VJZA 1PZ3A 1K9TA 3IAQA 2XJ7A 3QR3A 4H8HA 1BHGA 4EK7A 4OBRA 2W5FA 1DWJM 1EQPA 1WO2A 3VIJA 1DWFM 3IANA 3N9KA 2NW0A 2WM0A 1D2KA 3FHAA 2EEXA 1VF8A 2G4FA 3A47A 2DQXA 3GXFA 1LQ0A 5CSUA 5JIWA 4UOZA 1VRXA 3ZT5A 4H8UA 4OJYA 3PZUA 1UR8A 1E56A 4AEFA 1WZLA 3GNOA 2CYGA 3CMGA 4NSBA 3GXDA 5HOSA 1E6XM 1VJSA 3WBEA 3GXIA 3CH9A 4U31A 1H5VA 4AZBA 3KEHA 1E4IA 3VKKA 4W89A 3KL5A 1GNXA 1SYTA 3RIKA 2PBGA 4GI9A 2GJPA 2ZIDA 5JBFA 5KZ6A 3WMSA 9CGTA 3THDA 3EBVA 2WVTA 4PMYA 2J78A 1NWSA 3CMJA 3SEPA 4PMDA 3PZMA 2D24A 2BY3A 1JDDA 4W85A 5BXTA 3DYMA 4GQQA 1ZJBA 2XGBA 1H3GA 1JFHA 3VM7A 1KGXA 4DUVA 3MV01 2D22A 2IXUA 4DM1A 5D9PA 1GQJA 4FMVA 3AZSA 4W86A 5FCZA 4UFJA 4PRWA 1X6LA 2WSKA 1W3HA 1YHTA 4UR9A 1C90A 5GNZA 2VOTA 1J0ZA 3TTQA 1MYRA 4AW7A 3MV11 1UD4A 1OD0A 5IHRA 2YLLA 4CD4A 1UWTA 3BC9A 4TVUA 1KQYA 1OD8A 1JI1A 3GNRA 4GKLA 3ZQ9A 1H49A 2VX5A 2G3IA 4B9ZA 3BAXA 3ZOAA 3RO8A 4UNIA 3OZPA 1BLIA 2GDUA 2YKKA 4W8AA 4CD7A 2XGIA 1AVAA 3WELA 1H09A 4MB5A 1JZ5A 1W91A 2WZEA 3OBAA 1MVYA 3M07A 2B31A 3VIHA 3F5JA 5ECUA 1XYZA 2X05A 2Y8KA 4Z2HA 2WVVB 4ZE4A 2GJRA 2W91A 4XV0A 1E6QM 4LYQA 3WH6A 3WDQA 4DM2A 2WBGA 2FHCA 3K1DA 2YA2A 3AMLA 4D6HA 3MKKA 3CZKA 2WVVA 3M46A 4GI8A 1I1XA 4JAWA 2J4GA 2D2OA 3VGHA 5ABEA 2WYSA 3WN6A 1ODUA 2PI6A 1HVQA 4UTFA 2XIIA 2WMIA 5BROA 3VGFA 3BXWA 1JAEA 2CHNA 4N0RA 2O9OA 3ZSSA 1QI4A 1UR2A 1HN1A 1TA3B 2CBIA 1WDSA 4CU6A 5BXPA 1VAHA 2VZUA 1NOFA 1LL7A 3O6AA 2XFYA 4UFIA 4FF5A 1A3HA 4XB3A 3WKZA 2XFRA 1H2JA 2BXZA 1W3JA 1X6NA 1U30A 3N18A 1LWJA 3GH7A 1EHAA 3N04A 1B1YA 1TA3A 3OGSA 2YBTA 1E4NA 2XIBA 3AHXA 5A6JA 7A3HA 3RM8A 2OSWA 1NQ6A 1PIGA 1SFSA 1XV8A 4EAMA 4B15A 2ZXDA 3VVGA 4P8VA 1B3ZA 1G94A 3WDHA 2W66A 2QPSA 4J3UA 3M6DA 4MJ4A 3WQ6A 1BG9A 1QVBA 2VR5A 2JE8A 2WC7A 3ARWA 3CUIA 4W5ZA 1CENA 4UQCA 1HJVA 2XWDA 1V02A 1J0YA 3NDZA 1EIBA 4R5EA 1WDRA 4D6CA 4PBGA 3RPMA 4PMOA 3VX1A 2JF6A 2JIEA 2VMFA 3ZSTA 1ZBWA 5LA0A 4PSRA 3BGAA 1JXJA 3WF2A 4AZ5A 2J25A 4L4OA 1B3VA 5DO8A 3GH4A 2BV9A 4HOWA 4CD5A 3ZJ7A 3PBGA 5BRPA 1V3LA 4NRSA 3N12A 2GUYA 1VB9A 2PF0A 2WWDA 1JD7A 2DIJA 3K8LA 3N11A 4XZWA 2YDSA 3A4AA 1J0JA 1EOKA 2X0HA 1BPLB 1ZJAA 3WH7A 4AD3A 3EMQA 3VMNA 1AQMA 3VIPA 3AHVA 2ZUSA 4TXEA 3T2QA 1VFMA 1E0XA 3EMCA 3OA5A 5BYWA 5F7UA 1GOKA 3SURA 4JFTA 1E70M 1NARA 1ITCA 3BMVA 4JCMA 1KCLA 1QNRA 2YBUA 4GPNA 2EQDA 3WDIA 4AD2A 3VIGA 5A8QA 1JYNA 2J8GA 3WDRA 2EPNA 1JYXA 1W9DM 1V6UA 2VRKA 1XSKA 2D23A 4J28A 4Z2LA 1JD9A 1NOUA 1R7OA 1EH9A 3CZLA 4BCEA 4XX6A 2WCSA 2RGMA 1HT6A 3ARRA 4QAWA 4H41A 3SCRA 2BS9A 1Y7VA 1V02E 4YPJA 4IISA 1HP4A 2CEQA 2JFEX 3MMUA 3CUJA 3WUBA 1JZ2A 1UR9A 3AICA 3RJXA 1VBRA 5I6SA 1VEOA 1VFUA 3J7HA 2ZUWA 1E5NA 4C7DA 2Z1KA 3WF3A 1HX0A 1UR4A 2WCGA 4NF7A 1CGXA 5I24A 5AC5A 2OLHA 3MUIA 4MDPA 3L4WA 3AXHA 5D8ZA 2W67A 1H11A 3AYSA 2WMKA 2ZUNA 2CXGA 3EDEA 4J3WA 2VX4A 1KXQA 2FH6A 1W3LA 4B3LA 2XSAA 1U33A 2VTFA 4RE4A 1JF6A 3IAPA 4J27A 1OSEA 4MJ2A 3SCPA 4UZSA 4U2ZA 3II1A 1B9ZA 4CVUA 3W6LA 3AIBA 2UY4A 2GFTA 1V3KA 2W92A 2ZX6A 5AYBA 1K9DA 1BTCA 3SCWA 1MQPA 2E0PA 1JI2A 4UQEA 3MU7A 2EPOA 1WZAA 2QPUA 3W27A 1K6AA 1MWOA 2XTKA 1NWTA 5A6LA 1G9HA 4W7UA 4M29A 2VURA 1CPUA 3VD7A 1QBBA 4P7QA 4JFWA 1UWUA 2YL5A 2WHJA 2OWCA 5GPRA 3SUVA 4C7FA 4TVDA 4CUCA 3G6LA 3EMZA 1W1TA 2DH2A 1JF5A 1EHNA 4HZ8A 3W24A 1GORA 3GDBA 5TD4A 3ARSA 3AROA 4HU0A 4B9YA 1JIBA 3N1AA 1EO5A 2PC8A 3ZM8A 1JZ6A 3PTKA 5A2BA 2WPGA 5GNYA 3AZRA 1RD6A 3OGRA 3FHQA 4AEEA 1CEOA 1HJSA 4AD0A 5E9AA 4PTMA 3OG2A 4U5IA 1J0KA 1E1EA 2WKGA 1BQCA 3B9AA 3N13A 2CKSA 4CKQA 1BF2A 1DWGM 2VT0A 4X0NA 3PZQA 1PX8A 5M3WA 4UQAA 3PZOA 1VEPA 2J7BA 5CGMA 1ZL1A 3AHZA 1NWUA 5D9OA 3SCTA 4HA4A 3SIMA 4QLJA 4FLRA 2DH3A 4OKDA 2DDXA 4FLOA 2PWHA 7TAAA 5I78A 3MUZ1 3AHTA 3W26A 1CGWA 2ZXAA 4BF7A 1MFVA 1KFWA 4EE9A 3AMGA 4DWSB 4HMDA 3VGDA 4JKKA 3VIKA 2Y4SA 1W32A 1QOXA 4JFUA 4JCLA 1N82A 4MTVA 2DT1A 3DHUA 4HZ7A 1E4LA 1WAWA 3EDJA 5CLWA 2D3NA 3ARVA 1HVXA 2WWCA 1L8NA 3AI0A 2ZUVA 4DWSA 4GZEA 3VDBA 2PB1A 1LG2A 2XWEA 4IUGA 2YL6A 3BLKA 4D6GA 3L4XA 5A8MA 4CCCA 1JZ3A 1I1WA 1E1FA 4W93A 4LYRA 3WQ5A 2XUCA 2QMKA 1DWIM 4S3JA 4LQ1A 2VQTA 3OB8A 4U2YA 2WXDM 3W28A 1KXHA 3T2PA 1PZ2A 4AMCA 1HKMA 3SCQA 3PZNA 1BYCA 1W1VA 3CHEA 1XD1A 3ZJ8A 1B0IA 4WF7A 2WK2A 1VIWA 5BCAA 1PIFA 2CNCA 4J3TA 1G01A 5CZKA 3MANA 2WVUA 1QNOA 2YL8A 1GZJA 2WMHA 1W9BM 4H2CA 1CGVA 3VNZA 2PWFA 1CGUA 4GIAA 2BY0A 3T0AA 3UR8A 3NSMA 4AIEA 4DWSC 1WZMA 3WEZA 3WMCA 3ZJ6A 3A4WA 4PMUA 2TAAA 4TUFA 1HL8A 2AOSA 3PTMA 4ACZB 3QHOA 1UG6A 1RPKA 2GJXB 2VRQA 4B3KA 2UY5A 3CLWA 4E2OA 2G3MA 4W8BA 3MS8A 4C7GA 1PX4A 4M56A 4ACYA 1W9PA 4D6FA 4KRTA 1KCKA 4ACZA 3NSXA 2A3CA 2ZUUA 3WFLA 1CLVA 3AFBA 2GJXA 2VVNA 5E70A 3POCA 4J3XA 3AZTA 2DSWA 2EPKX 3U57A 1O6IA 4UFLA 4WSJA 4H8VA 1OCQA 1UD5A 2WMGA 3O2LA 1QI0A 2J8FA 3PZIA 3DC0A 3WNNA 1GPFA 1ISVA 3BAJA 1CBGA 3KE0A
chains in the Genus database with same CATH superfamily
1PKNA 1POJA 1WOBA 1DP0A 4KPLA 3OVGA 3S4TA 5HPCA 1FXQA 1WB0A 3RHGA 3B9EA 2JEQA 1XLAA 3TYZA 8TIMA 2XSBA 3E74A 4AF0A 3AIWA 3AYTA 2AGTA 2GQ9A 1E3ZA 1MSSA 1VBUA 5FJRA 4K37A 2YIHA 3AXIA 2RHGA 2PODA 1X98A 3GNPA 2F2KA 2FZDA 4DO7A 2B4GA 1ME7A 3W1NA 2EPMX 3M0ZA 4MF4A 1P4CA 3INPA 3NQGA 2QF8A 1UMYA 3USBA 4D71A 1UR3M 3H4GA 5E0CA 3L0GA 3LCLA 2WHKA 4FPSA 4MNJA 3UQNA 5EA9A 3V18A 4DJDD 3KRUA 3USZA 1ME8A 5C70A 3Q37A 2Y7FA 2WCAA 3QQ1A 3VO0A 3KVJA 3W81A 2C7FA 4H9MA 3GM8A 1DJXA 3UA3A 3QYQA 4OBSA 3C0SA 1LQ2A 3S2CA 3W0KA 3DENA 2OT0A 4MYXA 3FVMA 4LS0A 4D6IA 1QFEA 2XVLA 1NU5A 2VGGA 2GGIA 4MZ8A 4QSHA 5LKYA 1OCJA 4Z1DA 5D9MA 4PBFA 1B31A 1UR0A 3T55A 3A6OA 4PTWA 3FY1A 4GI4A 3MCMA 2F84A 3UF9A 4O8RA 1FTXA 1GHSA 3VINA 3CM4A 3KZSA 2DORA 4WR3A 3ATYA 1OIMA 1T0OA 1EXPA 4H19A 1VFOA 1EWDA 1DXIA 3EPMA 4C1NB 3BMWA 4M81A 2X30A 2VEPA 1JZ8A 5D4YA 5AHLA 4GA8A 3SUWA 1JVNA 2FB2A 3LOTA 4O1EA 1L2UA 1V6VA 5E0KA 2ACSA 4LSBA 1PCKA 3B8TA 5G4WA 1W9XA 3HFTA 3SI9A 3IEBA 4WKHA 1CGYA 4MHBA 5BXSA 2OFJA 2R8WA 4YIWA 3ES8A 3D5HA 3BOLA 3H70A 2PDXA 5FAGA 4QBXA 1XDLA 2FPTA 3BLPX 1O12A 4UC5A 3SY5A 3TN3A 4UQBA 1AZ2A 5HJYA 3IJ8A 3R2GA 5JIPA 1OC7A 3GNNA 1ZAHA 3QC0A 3OIXA 5BWFA 3RLGA 1I2NA 1F07A 1MQRA 3B0PA 3QLDA 1UWQA 2R91A 2DUAA 2GGEA 3K2GA 4I9AA 2V38A 2SFPA 1RP8A 2ZTJA 3G18A 3UP8A 4ZMGA 3W2UA 4GYFA 4TU1A 5FL0A 4KGJA 3EWWA 2BODX 2DVTA 3TV8A 4Q8NA 3LTSA 2WC4A 2ISDA 3EX4A 3RCNA 1WPCA 3UPMA 4JXCA 1PKYA 4NRRA 3WLJA 4ZL1A 3P93A 2A1YA 3WFAA 2A7RA 1UKOA 4PUMA 1IEVA 3PANA 2FZMA 1ISWA 4US5D 4PTXA 3TX9A 3O6DA 3PUEA 3N9RA 3IPWA 3WQ4A 1I0BA 1DJWA 2INEA 4UR8A 3AALA 4JBRA 3GYEA 4IQLA 4Z2GA 3ZFHA 1F05A 2E9BA 6ALDA 2QKFA 3S5NA 1AH4A 5IFPA 4QNEA 5I5RA 1K8ZA 3WL0A 4PMXA 1DWHM 3KM8A 2UZ9A 3NQEA 4JEQA 2NSXA 4EPEC 6XIAA 1IYXA 1CB7B 5CPSA 2E6YA 1R30A 3AAMA 4Q8QA 3LUTA 5F4WA 1EO7A 4WOZA 3O6CA 1E4MM 4AZ6A 5C9RA 3TJLA 1KFKA 1VFTA 3OLEA 1AQHA 4MB3A 3W00A 2J75A 3EOLA 2AAMA 3L5MA 3URAA 2E5BA 1EDQA 2QNEA 3HTWA 2PRMA 3BURA 4I8DA 4ZE5A 2OOFA 2X09A 5HNNA 1XLLA 1XH2A 4CU8A 1XS2A 3PAJA 3FX4A 4B2DA 3FN9A 2O4MA 1UUMA 1VPQA 3VUPA 2AL2B 2PP0A 1MQQA 4JY8A 1GTHA 1MFUA 3I4EA 2W27A 2ZZ3A 4O18A 3EZ4A 4NAEB 4XSMA 1V6TA 1W1PA 2F6KA 1FFQA 5BOOA 1FCQA 1TZZA 3JUGA 2WV8A 1LG1A 4NNBA 5A6AA 4FIRA 1HF6A 2BGQA 4KEZA 3N6JA 3VKBA 8A3HA 4GUIA 1R6WA 4JDBA 2VUYA 3TYEA 4PUDA 1FWNA 1GZGA 4CEXC 3UPWA 2BMBA 3PN8A 3UZXA 1A50A 3CB3A 4NKCA 4HQVA 5I3DA 1XYLA 5B7ZA 3N9SA 3BAYA 4ZO7A 2BBFA 4D9PA 3QMSA 3W83A 3MKVA 3W02A 2V3FA 4KIRA 3PSWA 4JTFA 2BOEX 2A3LA 5A6MA 4H9ZA 3QKEA 3WK2A 3AIEA 5A8NA 2XVPA 1C8QA 1XISA 3QHMA 3W37A 3CUXA 4PMJA 3LHYA 3BG9A 4HHPA 2Z6IA 2C91A 2NV1A 4CU7A 3CHDA 3OLDA 3S5SA 3W1PA 4GUGA 4AIUA 1J0IA 4YL2A 4UOJA 2QDGA 4PCNA 3L23A 1IZCA 1U22A 1F9CA 3ERPA 3QM3A 1K70A 3BSGA 2DZWA 3APTA 4D72A 4S3EA 2ZTKA 5CSSA 4HNLA 3AS0A 2BHZA 3KL3A 4QJ3B 4DYJA 4MY1A 4FNRA 4XD5A 1ELSA 2VZTA 1LJYA 5REQA 3VD5A 1F5ZA 1B4KA 3PBWA 1RBLA 3VMOA 5A6SA 4R34A 2EXOA 1ZQ5A 5G1MA 1RSCA 2V5DA 1FX6A 1FDZA 4GZIA 5AZ0A 3QN3A 1XGDA 2XG9A 2Z2UA 1JFXA 2G97A 2V3EA 2VX6A 5EKYA 2VFFA 4HYRA 3U4FA 3W7QA 2XH0A 3VIMA 2GVJA 2P8BA 3F4NA 4AXKA 3R8HA 1I6NA 1A0DA 3SQLA 1AK5A 4BZYA 3R25A 3VC5A 2V5JA 4WRHA 1FDYA 1QK2A 3GTFA 1I60A 3C2YA 1Q4NX 4H04A 4KESA 3M6YA 1C7TA 4C6CA 5AC6A 3BAIA 1XH0A 4TX8A 3BQ6A 2OZ0A 2WW5A 3W2MA 1Q2SA 4YS1A 2A7NA 1OGBA 1KBBA 3LBCA 2FPYA 1QNQA 3QOMA 4HOZA 5D2YA 1T8QA 2ZE3A 3WJXA 3GBEA 3TLQA 1P6CA 1SMAA 5C5YA 2J24A 4LUSB 3L4TA 3CPGA 5DY2A 3NQ8A 4BQ3A 3CYJA 3VGEA 3WK3A 3TZNA 2VENA 4Y90A 1SMDA 3GYCA 4K38A 3N6HA 1JG9A 3QGKC 4JIPA 4PMNA 4YWIA 3AS3A 1R86A 4WZHA 1UPPA 3A22A 1JYWA 4MJMA 3FA5A 4G7FA 1R85A 6PTDA 5B7YA 1D8CA 2OO0A 1A5BA 2OR2A 3VCRA 3EWYA 4PMZA 5F2IA 3H2FA 1GOQA 1H7NA 3O9NA 4ZGYA 5LA1A 1EA9C 3MPGA 3W25A 2W62A 3QV7A 2VKZG 2Y7DA 4QITA 1Z32X 3A24A 2NLIA 4CNTA 3K30A 2H9AA 3E0LA 4MM1A 2OMAA 1F4HA 4XBSA 4C6NA 2WJEA 1U1JA 1E0WA 4J2MA 1B2YA 4AXNA 4ICNA 1V3HA 3SUUA 5A2AA 5CPMA 1C92A 1GVEA 1E72M 2VZOA 1ALDA 1FWWA 5HQMA 2CBVA 1LF1A 2FTPA 3FSUA 4AZCB 3UA4A 1PL9A 1C91A 4PUUA 3CZGA 3HB9A 1NFPA 4WDWA 1SR9A 3EDDA 1MW0A 4IT1A 4PULA 3O0FA 1GVQA 4U3CA 5FEXA 2WKLA 4U28A 3KXQA 1JDEA 2GSEA 3QH2A 2DVXA 3HOJA 2VGIA 5BMXA 1DJNA 1JUKA 2E3ZA 3EYPA 1YRRA 5MHBA 2WMIB 3BDKA 4YYCA 3MMWA 1QTWA 3GK0A 5T91A 4UTMA 3LNMA 2G3NA 1D3HA 2DSKA 4HSNA 4JHOA 3G6MA 3M1ZA 7ODCA 3T0CA 1Z69A 3QV6A 3DFPA 1AJ0A 3H4XA 3PP7A 1PTDA 3BO9A 1PEZA 4KWUA 5CBIA 1E6PA 2V8ZA 5HULA 3SO7A 5CPOA 4AC1X 2Y8VA 2Q01A 2TRSA 1Q6QA 4HHMA 4E3VA 3LPPA 5EBAA 3W01A 1RVGA 5AC8A 2H8XA 2ONEA 2POZA 3A3HA 2QGHA 4IP7A 2ZZ7A 1KWGA 2VO5A 1VYPX 1EDTA 1TFVA 1PYMA 2YSWA 3GTXA 4CNOA 1H50A 2EO7A 2B7QA 1S3HA 3LGGA 4WJEA 5M2FX 1ZBVA 2C1GA 3E6EA 4RCXA 2YLAA 3SUTA 3EOSA 4LAOA 4ZEPA 1J6PA 1KM5A 1LWIA 4PUWA 2V5LA 4MWAE 1M7OA 3RCMA 4W7VA 2JKPA 2WNNA 4F9DA 2QUUA 2Z29A 4JTDA 2TPSA 3UERA 3QGVA 3WF4A 1DBTA 2J47A 1RH9A 1QBAA 1UZ1A 4GRSA 4I5XA 1UCWA 1TWZA 2HVMA 4EOUA 1JPIA 1W54A 6REQA 1XIFA 3W6YA 3UYCA 3QFWA 2W3ZA 4A8LA 4A8IA 1EGMA 2OEMA 2YZRA 3HG3A 4DJFC 5JBDA 4IX0A 1G4SA 4AFYA 4I6KA 3NL5A 3HQ1A 5I3KA 5IFTA 4HTYA 2OGYA 1LLWA 1DEDA 1FFRA 2CFFA 1GT8A 3M5ZA 1VEMA 4RPQA 1WDPA 3ARZA 2V2CA 3FXYA 3NZ1A 4V27A 4M6UA 4GXWA 3E2RA 3IJDA 4ZSUA 3AIRA 1ZBKA 2FHBA 3CWNA 4NYYA 4BI7A 3CV6A 2D1ZA 3AIUA 3VD9A 1ZTVA 4BQ2A 1DTUA 2VJXA 1CGTA 4ZQMA 4FR1A 1XCXA 3VDAA 1Z42A 3WUFA 4K1GA 5C6MA 3UU0A 4LWWA 3B8WA 3UJSA 4MDOA 2OQYA 3PPCA 1FWBC 1D7FA 3S1WA 3NDYA 3RM4A 3E38A 3IJIA 4W7WA 4FB7A 3G1SA 5HDRA 4I7UA 3W7RA 1UUOA 2VOMA 4LT9A 3V0UA 4QS5A 4D6JA 1K9FA 4PZVA 1KFCA 1EF2A 2ESCA 5ECVA 5FF4A 3VK5A 2Z1BA 1KCXA 1G67A 2PLCA 1J6OA 4DY1A 1I0DA 4QLKA 4R85A 3WX7A 5C9WA 3MBFA 4BEQA 1XKJA 2DQWA 4MB4A 3N2OA 1XKYA 3OZOA 3JZEA 2CLIA 2Z1SA 3HG2A 3K8KA 2YDRA 4QX4A 2BZNA 2BXYA 1OX6A 3DEQA 4EPDC 3GUWA 3PPHA 3MVTA 1SO5A 4JIQA 5AHIA 4O19A 3QZEA 1UKQA 3EOUA 1LYXA 3KDNA 5ENLA 3AC0A 4DUWA 1N8WA 1KXVA 2OODA 2OSYA 3K13A 2DZUA 2WNZA 2PLJA 4N9DA 3VZYA 2FHFA 4NP7A 3TAKA 3RRAA 2DZTA 2VNCA 1FWRA 3CUGA 4UOQA 1ESWA 4B5UA 3A21A 4S2BA 2EKGA 1NFGA 2AGKA 2VC5A 2X2GA 4S3CA 1T8XA 3WQWA 3FDGA 1JNDA 4JTTA 5CBBA 5FL1A 1B54A 1LL6A 1UWIA 1V03A 2R1KA 3LZ5A 3MTWA 1AUSL 4JTLA 3GAKA 3H24A 1FWGC 2FVMA 2OPJA 3ARTA 4UXDA 2XVNA 1KGUA 5M03A 3H55A 1I2QA 3LLFA 4LBSA 3BW4A 3DYOA 1PB0A 1UUQA 3S2JA 3VNIA 4PEEA 2NX9A 4M80A 4RDWA 2ZUTA 2EGZA 2E77A 3ABOA 3M7SA 4QG8A 7XIMA 3STFA 4QCEA 4Z1AA 3TYBA 1GQKA 4AZHA 1KM0A 3NZQA 3W7IA 4JL1A 2FJKA 1R3YA 2XPKA 1CI1A 4LU0A 1BG4A 2XIQA 1PZ1A 3KCJA 4V28A 3L4UA 1WE5A 3FFSA 1WOAA 2ACQA 2B7OA 5K9CA 2F6UA 3PZ9A 1MI3A 1TE1A 3UESA 2HNHA 2QJMA 4KWSA 4RUBA 1DJZA 4JTQA 4N6FA 1JZ4A 1S1RA 4HYWA 3ABXA 3ARYA 4GX9A 1K1DA 1YBQB 2R1PA 4PA8A 2WZIA 1O1ZA 4G56A 3IVUA 3C3UA 3RLHA 4MGGA 4S3BA 2J9YA 5C7VA 1NY1A 4Y6GA 1LUCA 1QO2A 5BXRA 2ZADA 1VJZA 2QCCA 1TV8A 2W5FA 4ZODA 1DWJM 1EQPA 1WO2A 4RXGA 1XP3A 3WBXA 1B9BA 3H2CA 3AYVA 4NNCA 4PFMA 4IFKB 3W7JA 2G4FA 4LALA 3MT1A 5I06A 3GXFA 1LQ0A 5LNVA 1CLKA 4H8UA 1Q65A 4OJYA 2BB0A 5H8MA 1E56A 1XC4A 4AEFA 3GNOA 4POCA 4JY9A 3NA8A 3WLIA 1XLIA 3WBEA 4OE7A 3CH9A 4U31A 4AZBA 3GR8A 5CPLA 2VEIA 3OZMA 2NUYA 2X7VA 2X41A 4W89A 4GYKA 3BV7A 2H6RA 1SYTA 5JBFA 4JTKA 4IIHA 2QJIA 4PMYA 4JIHA 3ATZA 3RYSA 2VYOA 1MZRA 4E2BA 1SW7A 1XW8A 2C13A 4GQQA 1XLCA 2XH4A 3LEPA 4J5NA 3T81A 1KGXA 3GVVA 3AZSA 2VGBA 4PRWA 1X6LA 4IXXA 2ISSA 3TR2A 4O16A 4ZQOA 1EX5A 3E02A 3W74A 1LQAA 3PR2A 3TTQA 3MV11 4CD4A 1UWTA 4TVUA 1XLMA 3C4UA 2YCEA 4I6VA 3QTPA 1ICQA 2VELA 3ZQ9A 1M65A 2G3IA 2Q02A 3BAXA 1A49A 3CAVA 3RO8A 4UNIA 2YKKA 4MB5A 2HS6A 4RJEA 1Q63A 3KVKA 1MVYA 3M07A 3GIQA 2C15A 4O10A 3DFYA 1XPGA 1W5OA 4C6PA 5F1UA 5C2XA 2QUMA 1XYZA 4DPQA 1IEWA 3P81A 2WNQA 2GJRA 2NUXA 3AU2A 2Q6ZA 4DM2A 4C90A 2FHCA 3KRZA 1H51A 2HNEA 4Q8OA 2BXVA 5LIKX 2X1TA 4NJIA 3TOYA 5HMFA 2YXXA 3TYUA 4QNWA 5AFDA 3EWCA 1XIHA 5D37A 1I1XA 4B91A 1ODUA 2WMIA 3P7YA 3CL6A 2IKIA 3BGGA 4DXVA 1UP3A 4LNCA 2FQIA 5HWMA 4S38A 1QI4A 3O05A 3QXBA 3LV6A 3HV8A 3NQCA 2P88A 1VAHA 3FA3A 2VZUA 1GKPA 4D2JA 4UFIA 1CT5A 1A3HA 4XB3A 1H2JA 4Y9AA 1K8XA 2GGHA 2XU2A 1LWJA 2GVEA 1EHAA 2R24A 3QV8A 3N04A 5LIXX 7A3HA 1SJBA 3G0SA 3I4KA 1TX2A 4IIFA 2QPSA 3DZ1A 4J3UA 1QASA 1BG9A 1XRSA 4C5ZA 3CUIA 1LRQA 5H91A 1HJVA 5EY5A 1RXOB 3L12A 4OU1A 3CS2A 1AD4A 2X1UA 3QRHA 1LOSA 2O0TA 2RH9A 3TC3A 3BLDA 4QDPA 2BG5A 2JF6A 4JGDA 2C0AA 3ZSTA 1ZBWA 2V67A 3TW9A 2AKMA 1TZ9A 4JTUA 2JQXA 3BLEA 3RF9A 3GH4A 3DI1A 4H7ZA 3MA8A 3U3HA 1TWSA 4HOWA 1IE7C 3WYZA 1JPKA 3LCWA 8RUCA 4RNIA 2WWDA 1Z44A 4XZWA 1UP0A 3OZYA 2AL1A 4AD3A 5CC6A 1DJGA 4HIBA 1R38A 2IQDA 3PG9A 4K7YA 4PL1A 5XIMA 3VIPA 4TXEA 1VFMA 3BG5A 1I9CB 3AXMA 3UW6A 4IGSA 4ADUA 4KS0A 1TTIA 1ITCA 4S1FA 2YBUA 3DGRA 4GPNA 3M7WA 3WDIA 1KTCA 2C1HA 2QIWA 2C14A 4AD2A 3S46A 2J8GA 2EPNA 3CQKA 1JCJA 4NZ4A 3FXGA 3MBDA 3KRBA 4L56A 4RW5A 1JD9A 1XLFA 4NY2A 4EP8C 2EG6A 3MP5A 4EF9A 5HQEA 5JXQA 3TC6A 4Y96A 1SFTA 1YYAA 3GXNA 3ITOA 1XPYA 1SJCA 3ARRA 4GX8A 3SCRA 1V02E 4A3RA 4OHQA 1JZ2A 1UR9A 3C56A 4HN4A 3H2MA 5I6SA 4UIOA 4ZZ9A 4A8NA 3GUGA 4S3AA 4C7DA 4NF7A 3MB9A 4BWLA 2OLHA 2WM1A 3V3WA 3A12A 3AXHA 1FWHC 1A0CA 4C6QA 3EDEA 3HMJG 4DWDA 1GPWA 5D32A 5LIWX 5AC7A 2XH7A 2C6QA 1JF6A 3IAPA 3KHDA 1W1B1 2XINA 1OSEA 4B5NA 1KM4A 1MMFA 3SCPA 3VFLA 2V5BA 1AW2A 4CVUA 4FHAA 2GFTA 4LV4A 3WBWA 5DY3A 1BTCA 1EWEA 5H6HA 3F4WA 3H53A 1IXNA 3MU7A 2QCDA 4XZMX 1K6AA 1MWOA 4LS1A 1G4PA 2PWVA 3G8EA 3GG8A 3OHIA 3GFZA 3CQJA 4W7UA 5CSRA 5FESA 5T9BG 1QBBA 4H2HA 3WJYA 3C2VA 1LBMA 4BWLC 4AWSA 4RV8A 3KWSA 4RZ6A 3TTEA 3LY0A 1VZWA 3CEPA 5F1VA 1BWKA 5D05A 3EMZA 1YXYA 1QMLA 1EHNA 1AODA 2RAGA 5TD4A 4H8NA 4B9YA 1JIBA 1QRQA 3KVMA 3ZM8A 3PTKA 4C5YA 5GNYA 2VWSA 2GOUA 5LIYX 4AEEA 1CEOA 1LP6A 5E9AA 3OG2A 4B2DD 1BQCA 1E51A 2WZMA 2BWGA 3G8RA 1DWGM 5HNUA 4S3GA 3W3OA 3W22A 2OZ3A 3LV5A 3WZ0E 1VEPA 1VBHA 2J7BA 5CGMA 3FJ4A 1ZL1A 5D9OA 1OX5A 5D02A 2I5QA 1JDFA 2DH3A 4OKDA 4FLOA 4JQ4A 3W23A 1O95A 3T05A 1OFOA 4O28A 4UWMA 3AHTA 2VWTA 1MFVA 1KFWA 1EBGA 3QV9A 4HMDA 3KLKA 3VGDA 4JKKA 3VIKA 1IWBA 2IMRA 2P53A 3VI2A 4HZ7A 1UWAA 1WAWA 3G0XA 3KS5A 5CLWA 2D3NA 1JCYA 1RCXB 4DWSA 1WUFA 3NXFA 3N4EA 1VHNA 4H1ZA 4JTJA 3SGGA 4DO6A 4Q7BA 1DWIM 4LQ1A 3OB8A 2PTXA 1P1MA 4U2YA 1KXHA 3T2PA 1PZ2A 2HK1A 1DIEA 3TQ0A 4PB4A 1IF2A 1HKMA 1BWLA 1KKRA 2XN2A 3EX1A 3IRSA 3BLFA 3ZJ8A 4JYFA 3E2SA 3AXKA 1QXLA 4WF7A 2KAUC 2WK2A 3R58A 1R9XA 1PIFA 2CNCA 1D8WA 2QAPA 3D46A 1TE6A 3G22A 5LZLA 4JTIA 3UR8A 3NSMA 3STCA 4IJBA 4AIEA 4DWSC 4YTQA 1WZMA 3ZJ6A 4DO5A 4QRNA 3QHOA 3V5OA 4HNNA 3DIPA 1RPKA 1TQXA 2RDXA 4B3KA 4GGBA 3EA1A 3CNYA 2R1NA 4ASTA 3H54A 1PYFA 4W8BA 3QJAA 4WDTA 5B80A 5TBOA 1M7PA 2A3CA 3WFLA 4GISA 3AFBA 3TQPA 4GACA 4J3XA 2EPKX 1VQTA 5EU9A 1F6KA 3MHUA 4WSJA 5F4SA 2PLMA 2PCQA 1UD5A 2WMGA 4G6CA 1FWTA 4HA0A 3PZIA 1E1CB 4QJ5B 1GPFA 1ISVA 3M5XA 2XN1A 3T42A 3CB8A 3S3GA 1UYQA 3SFKA 2NV9A 1XJBA 2XM2A 4LANA 4PL2A 4IOTA 1VFLA 1I45A 4AHPA 1IT0A 4H01A 3EA3A 5CJMA 4QE1A 1VGAA 3WIJA 3LK6A 2O92A 3D3AA 3D47A 2PSNA 3WH5A 4KCUA 3DXIA 3O0KA 3FNDA 2F61A 1XDMA 4GCAA 1ZS2A 3I3DA 3OLGA 5ABHA 1ML1A 1RV8A 2GPTA 1BTMA 3MMTA 4W88A 1GW1A 4L6OA 1JUBA 3B0UX 2E25A 3NJ3A 3HU7A 1FHUA 1E43A 4E38A 3ABZA 1EJXC 4E8DA 2JF7A 4E8CA 4IQJA 1FH9A 5E0FA 5LGXA 3ZMRA 1QWKA 3QR0A 1QOQA 5HNTA 3GDMA 4C6LA 1XINA 3WK0A 3QFEA 4HMCA 1U5HA 4IM4A 3VZZA 4GD0A 3DKJA 9RUBA 3QPZA 1A3WA 1TX0A 4WGHA 3GDKA 2Q8ZA 1UH3A 2EBNA 4W5UA 5HQLA 3GS6A 4GQGA 4HK7A 4XIAA 5I3HA 3HZ3A 3WUEA 3H2AA 2PDCA 4QJ1A 1NOWA 4F2TA 2YA0A 3E96A 2Q09A 3GHTA 5DQPA 1M41A 4PUNA 4O1DA 2WMJA 5HINA 5AN7A 2NUWA 5A3HA 1K4GA 4FX8A 4IZGA 3G1YA 1J10A 3W53A 5E09A 5HATA 3UGRA 1R8LA 4IFOA 3BAKA 1PDYA 1BVWA 4ZXOA 1QOPA 1M53A 1FKXA 3G2GA 4S3DA 2PS2A 1O5KA 2HE8A 3KP1A 5C2CA 1NM9A 3RLVA 2PDMA 1Q6FA 3AOFA 1NF0A 3MZ2A 1SFJA 3WL1A 4NIRA 3O06A 3O07A 4KEUA 1MXGA 1V93A 2GWNA 3LG3A 4NZ1A 3R13A 5C54A 4LPCA 4NUWA 3HJZA 3WEOA 1RCQA 3TK7A 1P6BA 4Q33A 2E9LA 4DAFA 3PWAA 4UBPC 4PMRA 4AWEA 1RBOB 3F4CA 3F5KA 2P0IA 5A6TC 2XZ7A 2CU0A 2WVSA 5DEZA 4TTUA 2ANUA 4LB4A 3MYPA 1D7KA 2BDQA 2F9RA 4QG6A 4A2SA 1UD6A 3C2RA 3M5VA 2J7EA 1Z41A 1YMYA 1KGWA 1DORA 2BHYA 1CXKA 4MG4A 1T99A 4ZO6A 1HJWA 3N2MA 5FEPA 3CPRA 4Q4QA 2FJUB 1CXEA 2V63A 4GKTA 4E4PA 3WLRA 4INFA 1IXQA 4JD4A 4P61A 1Z9AA 2IXVA 3H21A 1SQ7A 2HISA 4XZLX 4NILA 4V15A 4F9JA 1F4AA 2QUTA 1ADDA 5C9XA 4XAYA 1DHKA 4YTUA 3ZVHB 4H9XA 7PTDA 4GMEA 2D3LA 4XUGA 2PGFA 3PTQA 3VNYA 3WLMA 2E09A 2CHRA 3ITCA 4XUYA 1A53A 3WLTA 4QAIA 1S2CA 3WUGA 2FH8A 1XLJA 3RCYA 3VUSA 3NZPA 4ZTYA 1OY0A 2DSUA 1TTPA 2GUBA 2REQB 2XN0A 3T07A 4DJFD 1XYFA 4MFDA 3GXMA 1M7XA 4N42A 3WNMA 1BYAA 4ATLA 2VEMA 4H6RA 1TWDA 1DQUA 5GVJA 2ZVIA 3ENLA 2XGZA 2R14A 5I07A 2DIKA 3C2EA 1S3TC 1UBSA 1XCFA 1JR1A 1BXCA 1UQYA 2IUZA 4YYFA 4E0CA 3EWZA 3TJIA 1BXBA 1A5AA 2H3DA 1NP2A 2QCFA 1AQ0A 1XXXA 3UT0A 4W9TA 5G5IA 3EB2A 4WKFA 1OZMA 3G1VA 4UQDA 2CZVA 2OWWA 3P0XA 4FX7A 2C0HA 1W9VA 1KFEA 3OU8A 3ITTA 1I2PA 4WY0F 1JULA 1UC4A 2J62A 2ZQ0A 4ADSA 4J3VA 1PIIA 4ATWA 1DE6A 4PCSA 4XSLA 4HNVA 1BAGA 3AMKA 3W82A 4A3QA 1N2VA 4P7RA 3IK2A 4RZBA 5KITA 1TR1A 6XIMA 3GTNA 3EDKA 2TODA 5LXEA 1FBAA 3L4ZA 1D3CA 1S2UA 1V7AA 5GJPA 4M51A 1MXDA 1UJQA 2JEPA 3KRSA 2E9MA 2E4TA 2ABBA 1EGVA 3F03K 1BKSA 2UBPC 2E1DA 2OX1A 4A8RA 4DXXA 3WG6A 3QPEA 3CZ8A 3TONA 1NDWA 2XSXA 3HQNA 3MSDA 2WHMA 3UZWA 2VX7A 2XDFA 3BZJA 4DF0A 1ZZMA 1S5TA 2CLKA 1S2VA 1NJJA 3S1XA 1A5UA 4ATDA 3SAZA 1BXNA 4UUIA 4A3UA 4UCGA 5E6YA 3BUVA 5FF0A 3TQKA 3UVAA 5L6UA 4M3PA 4JIIX 1GKRA 1W3IA 2Z1XA 1WCGA 2VC7A 1AJZA 2VEKA 2Z1WA 5A8OA 3GH5A 3UG4A 2OT1A 3LXAA 3N34A 3JRKA 1P0KA 4N4QA 2PFHA 3B40A 1NP0A 1R3WA 2RDUA 2CC0A 3KBWA 2Z25A 4YTRA 3FGCA 4RE3A 2D0GA 3W7MA 3QOKA 3KP0A 4DYEA 2DT0A 2PU1A 3RNDA 1HJXA 3W7GA 2W61A 1UQZA 4UTIA 4N9EA 2CERA 3G1DA 2ZC8A 2QCEA 4JHMA 4HNCA 5T9CE 4Z1BA 2ACRA 3OP2A 4NXSA 4GNKB 4DO4A 5CZSA 4DBSA 3ALFA 2AMGA 4P8UA 2PMQA 3MHFA 3W29A 3N15A 5TAOA 5ABFB 1I2OA 1IT8A 3TSMA 3GZ3A 3URBA 1XC6A 3UG3A 3THQA 2EKCA 2INFA 5AVHA 2JIWA 2VDGA 3DESA 3GW0A 4HHLA 1F3WA 2GVLA 4YHGA 3PUDA 3AWOA 4FX6M 4IGHA 4PTVA 3APYA 3NO3A 2PC4A 4G1KA 3S6TA 4GY7A 2G3FA 1SFLA 4MKVA 3NDOA 3VIIA 1L2QA 8CGTA 4QE5A 3TU9A 2P1FA 1FOBA 3BZGA 3CT2A 5HA7A 5MKGB 4OOZA 1IV8A 5U7SA 1EUNA 2BP1A 2E68A 3MW7A 1L6YA 4KEMA 2D0FA 1Q45A 4MAVA 4GY1A 4JX5A 3HGOA 1TPUA 1BQGA 3V16A 1H1NA 1CW2A 4BF5A 5F4XA 3NO1A 4D8ZA 4H9UA 4J1OA 3YPIA 1EC8A 2ZOXA 3CIVA 4UTKA 2WANA 4O1AA 4DF1A 4WIWA 4F0RA 2NWSA 1HL9A 2J7GA 5M17A 4CLMA 1VYRA 5HUPA 1TO3A 2QJNA 2GK1B 4Y9PA 1N8IA 1V3JA 5XINA 3BLOA 2VCCA 2Z2AA 1XIEA 1W1YA 1F3EA 4O14A 3SN1A 1Q6LA 4FNPA 1XI3A 3THAA 2YX0A 5A6KA 2I57A 4ORIA 3EOEA 5CQ1A 1UJPA 3CTTA 3WNPA 3M0XA 3TH6A 1K7XA 3NYZA 1DQXA 1XHGA 4Z2JA 1Q66A 2WNWA 4IJRA 1QHPA 3E12A 3DFNA 1C9DA 1NWRA 1O5QA 1P7TB 3CQIA 5JU6A 4PTDA 3AIQA 4UR7A 3CC1A 2PEVA 1M3UA 1G7VA 4FXJA 3H2NA 2J6XA 2BVDA 4J3ZA 1E1CA 3DC8A 4OV9A 3IGXA 2VCAA 1WDQA 1FH7A 2C16A 5DCBA 2OCZA 2A79A 2MNRA 3HN3A 3MDUA 3N17A 2VC6A 5I23A 3BCDA 1HO1A 4O13A 4X61A 1TUXA 1MO0A 1ZAIA 3W1MA 2YCLB 1MUWA 2VZVA 1K4HA 1SVDA 2OLAA 3UZ5A 5BWAA 1C8VA 4QCFA 3G1HA 4M82A 4PTNA 2FPVA 3TN5A 3ANVA 3E0WA 1UA7A 1S38A 4KRUA 1R87A 4JL2A 1O66A 1Q6OA 1MXSA 4KETA 3W1QA 1KTNA 3OGVA 1IXOA 3UCQA 2DU2A 2W63A 2YL9A 2PTDA 3MZNA 2GSJA 1GJUA 1UH2A 4KERA 3ZJKA 5EMUA 3BJSA 4AZGA 3P74A 1A5SA 1TVNA 4JN6A 4DHGA 3E2VA 1OFEA 4JHZA 4FK9A 2OQLA 4LVFA 3CUHA 3CBWA 1HFBA 4AHQA 4MWAA 6ENLA 3SN0A 1M6JA 2QXWA 3QLLA 2TMDA 4HPJA 4U3AA 3UNDA 3DHPA 1JAKA 1V6XA 3DGBA 3U4AA 3HURA 3WQFA 3KBVA 2IQ0A 3WF1A 1E0TA 1H7OA 5AYIA 3FYPA 2QZRA 3H22A 3ORWA 4JTAA 2AMXA 2YYTA 4UMCA 2D2GA 1IGSA 1XLHA 4HBKA 1JL8A 3MVIA 4JKMA 3IIZA 4B5WA 5G1YA 3BL3A 4AEOA 1Q6EA 1LBFA 4G8TA 5IBXA 3KCLA 4Y9MA 5LIUX 1R7AA 5J5RA 2GGJA 2UY3A 5K4XA 2NV2A 3TA9A 3RR1A 1E15A 4MWAC 1KLZA 3W7OA 6TIMA 4GYPC 2DT3A 4CNUA 3WQEA 1UD8A 3V1PA 3ABQA 1HO4A 1UD2A 3UWWA 4CD8A 4Z1CA 2VP8A 4URIA 2FDSA 4ORMA 4JR5A 3GDTA 4MB1A 2CLEA 2Y24A 4PMQA 1UKTA 4I5UA 4CNPA 1OGGA 2NXHA 2LLEA 1DKWA 1HJQA 6TAAA 1UP2A 2ZWYA 4KCWA 1UB3A 2ZX9A 4NI3A 5LNRA 1BRLA 1PXGA 1UKSA 2CPUA 2BGSA 5HWNA 4UTTA 2J79A 5A8GA 4PUEA 3V4BA 1GVIA 2ZDSA 1XSIA 1ADSA 4DN1A 1HUVA 3GVGA 4JYDA 3UETA 2Z2BA 5DT5A 3B0YA 3BANA 3OVQA 4A35A 2I1OA 2QIIA 2EJ1A 5CGTA 2XYLA 1TSIA 4W84A 4C65A 5AZ1A 1Z3NA 2FZ9A 4B5VA 3SUSA 1JCLA 4O4WA 3UFYA 3SCNA 4ADTA 4F2UA 4PUKA 1DJQA 2GDVA 1YNPA 1XIJA 1YQ2A 2BNJA 3GBDA 1C7SA 3NO5A 5CAKA 2IW0A 3HA1A 1LWHA 1OT1A 3OQEA 2O55A 3PBVA 3WQVA 3KFTA 3ZIZA 1HTIA 3VILA 5CKSA 4XZIA 4IGNA 4LUTB 3LXCA 4UTTC 1XQKA 2XZ9A 2FFCA 5A6BA 1T41A 1ONWA 3E49A 3KL0A 5MF5A 4XO6A 1IEQA 3AUOA 3LPFA 3PPFA 4UNLA 3SSJA 4Y8FA 3A9BA 4P5UA 3NM1A 1AG1O 4LCQA 2WKJA 3TUUA 1U5JA 4QLLA 4GBUA 3RR4A 2WAGA 3QMTA 1B5TA 4FNTA 1OCBA 3MQTA 3REQB 4HYVA 1CXFA 2ZVRA 1W0MA 4DI8A 2NT1A 1HGYA 2ZA2A 4LVBA 1VFSA 4PUJA 5FEWA 5HR7A 3R8GA 1Q7ZA 2Y70A 4EIVA 3BARA 4FLSA 4OTKA 3T2OA 5AB3A 3CLMA 5I79A 3DHDA 1O1HA 3A5FA 4GE8A 3ARXA 3U5YA 3BSHA 3OQ8A 4JNZA 1Z6KA 1VCGA 4X9YA 3SM0A 2IPJA 4G7EA 3ZWSA 4TIMA 1ZUAX 4LX4A 1D9EA 1ZU8A 1TPH1 3ECQA 1QNPA 4IPJA 4J4KA 3NQ6A 1LRNA 2GYIA 3R4IA 4L4LA 3ZT6A 4F79A 3IIOA 1W2VA 3FYYA 1JQVA 5DXYA 3FJNA 2Y6ZA 2ZBTA 4RL3A 3G1RA 1CXLA 1SM9A 1JGMA 2VRJA 4KBXA 3TLLA 1SO6A 2CIPA 1SZEA 4ECLA 4JOMA 4WK9A 3IIPA 3UCCA 4M8UA 1NDZA 2WJZA 1ITQA 2YCKX 3OIHA 4GZ7A 4L64A 3R0KA 2GQ8A 3WLQA 5EMYA 3DDMA 1NDVA 4MOZA 3FSTA 3WLNA 2ZRVA 2NQZA 4H7CA 2I17A 2QVHA 3LPOA 3RILA 2Y5EA 4C6FA 3SJNA 3ITVA 3EDFA 2FGLA 4GINA 1HGWA 2Y89A 4QFUA 1NELA 1SU5A 1IWAA 2DFAA 2VC9A 3CUFA 1QPKA 1PX3A 1DJYA 4KCVA 2JKAA 3VNDA 3GRIA 1P0BA 2WPBA 4IMEA 1IHIA 1V0KA 1TQJA 4JQ3A 1I75A 3EEGA 3WLOA 1JNEA 4DLFA 1GQLA 3W38A 1QNVA 2XH2A 1WKFA 3LLXA 2Q71A 3SQMA 4L9XA 1P1XA 3CHVA 3PNZA 3B06A 3LA4A 1V0LA 1KKOA 1TMHA 4JX6A 3E0FA 5DX7A 1TWWA 3S42A 3SB0A 3KS6A 1FH8A 2ZYFA 3PSVA 1ECEA 1TCMA 4BQ5A 3SW6A 1R2SA 2ZX5A 2VL4A 5AY7A 4L1WA 4V1XA 1K9TA 3IAQA 4HK6A 1IR1A 7ENLA 2XJ7A 3QR3A 4EK7A 1IXPA 4GH1A 1YPIA 4X3ZA 3RUBL 3IVTA 3UJFA 4UTLA 2NW0A 1XBYA 2FLIA 3NL2A 3A23A 4NAFB 4WXYA 3TFCA 3FHAA 4AUBA 1HKVA 3U6WA 3ZS4A 1J2WA 1YW1A 2V2HA 5JIWA 1F7BA 1C9WA 3TWAA 4HD5A 3C3NA 4IMGA 1WZLA 2OOGA 4H9TA 2QAFA 3SGUA 3QC3A 1VJSA 3KOYA 3IWPA 3HPSA 4IQEA 1MEIA 3UZJA 4LB3A 3KL5A 1JEZA 2HE5A 2X16A 5CZJA 3OYZA 4DJDA 3LMZA 2PBGA 1H62A 1ME9A 2GJPA 5KZ6A 1V7YA 2QGYA 1IT7A 1NWSA 2FZ8A 3LRLA 4PMDA 2HDJA 3PZMA 4MUPA 2D24A 4XKYB 1Z8AA 1ZJBA 2XGBA 1H3GA 1JFHA 3SADA 3DU0A 1W56A 3PBUA 4QS6A 4W86A 1IWPA 2CW6A 2HMCA 1ZHAA 1YHTA 4DRSA 3NVDA 4YCOA 1J0ZA 1G6CA 1MYRA 3TMQA 5IHRA 1FY6A 1N55A 2PDNA 3BV4A 2YLLA 3PTDA 1REQA 5H2ZA 1DIKA 4GUFA 3U2OA 3EWUA 3W07A 4GKLA 2VX5A 3KVLA 4B9ZA 4NZJA 5J5DA 5IOBA 3W2NA 4WY0B 4JQAA 1BLIA 2GDUA 1LORA 4W8AA 2F6XA 1KM2A 1SO4A 3V1HA 2XIMA 1AVAA 1LTDA 1H09A 1A4LA 1EEPA 2QCLA 1W91A 3GDRA 3S2MA 2WZEA 4HVXA 3GFXA 2B31A 5FJJA 4ROPA 4F40A 2HS8A 3F5JA 2PDGA 5ECUA 1ZP4A 2X05A 4ZQNA 4HSOA 4KFPA 3LDVA 4XV0A 4WXZA 1E6QM 3DBPA 5E9XA 3WH6A 3WDQA 2WBGA 3U2EA 3KX6A 2YA2A 1WXZA 4FS9A 3AMLA 5U4NA 4UTWA 2GDQA 1KNWA 4D6HA 1KRBC 5EMJA 3S9YA 3PM6A 3CZKA 5L9FA 3I6RA 2WVVA 3GNXA 1L6WA 4Z1YA 4NNAA 3RLUA 4GI8A 1XUUA 2Z6JA 1S2AA 3DFQA 4K2SA 2WYSA 3WN6A 4NI8A 1HVQA 3OVRA 4C60A 5BROA 3VGFA 2CHNA 4DIAA 1A0EA 1MRQA 4N0RA 1TRIA 3E0IA 1UR2A 1XFBA 1HN1A 1TA3B 1BSLA 2ISFA 3TAOA 1DXEA 1LL7A 3O6AA 2CLPA 4FF5A 2NSOA 2PDUA 2BXZA 3B8VA 3N18A 1B1YA 3B8IA 3B04A 1E4NA 2XIBA 3AHXA 4I5RA 3MI3A 3RM8A 1SFSA 1ONRA 2XIJA 4CCZA 4XWUA 4B15A 2ZXDA 4YU1A 1EA0A 1G94A 3WDHA 1PWLA 3WQ6A 1J93A 4IL2A 2JE8A 1OEPA 3LGDA 1C29A 2X7WA 3UR2A 2BSLA 2RFGA 1CENA 4CQCA 3TW6A 1FWJC 1S5NA 2XWDA 4GY0A 2PDBA 1V02A 2YCIX 4ZOEA 3NDZA 4R5EA 3LBMA 4OQVA 4IIEA 1K7FA 1OX4A 1GK8A 2BOFX 2HPMA 2JIEA 5LA0A 3QPYA 1W5PA 3P6LA 1J79A 1JXJA 4AZ5A 4L4OA 1B3VA 3R11A 1Y5VA 2BV9A 1VBJA 4CD5A 4H83A 2P50A 2DIJA 1RK5A 1VYSX 1J0JA 1KV8A 1U1UA 3W7PA 4XQ6A 3EMQA 1AQMA 2BLEA 3AHVA 2ZUSA 3T2QA 3ZVIA 3EMCA 1TB3A 5F7UA 3FEQA 4JFTA 1J2BA 3L0KA 8XIAA 1FUYA 1QNRA 3NZRA 1VCFA 3I7QA 4LAKA 3TIMA 2EQDA 2H90A 5A8QA 2JK2A 1RAKA 1QAPA 1JYXA 1W9DM 4QM1A 2DZSA 1PKLA 1EC9A 1V6UA 3LHTA 2OO6A 4YLWA 4J28A 4Z2LA 4WQ6A 2BASA 5D2TA 4XX6A 5G1TA 4JDYA 1GYMA 1KM3A 2BS9A 4IISA 2CEQA 2JFEX 4GVFA 4DAIA 1XRFA 2HXUA 1R3RA 4HJWA 2VEGA 1VEOA 3BSMA 3J7HA 3B8UA 1SGJA 1U83A 3WF3A 2XIOA 2WCGA 1XWYA 4JN7A 3OYXA 4DBUA 4X22A 4F48A 4NT0A 3GE7A 4MDPA 3N2XA 5K2ZA 2W67A 4JIRA 2ZUNA 2A2IA 2CXGA 4J3WA 3T1GA 2VTFA 4HCLA 3QZAA 3UXIA 1Z48A 3LB0A 4U2ZA 3II1A 1B9ZA 1G69A 4PB5A 5AYBA 1MQPA 1JI2A 1SUXA 3AJXA 2EPOA 4XZNX 1AL8A 4V1YA 4AQLA 1WKDA 5A6LA 4M29A 1CPUA 3VD7A 4IG2B 1R0MA 2B7NA 3FEMA 2YL5A 1TR9A 2WHJA 1JJKA 3SECA 3SUVA 1TMLA 4TVDA 1H60A 2R9RA 1KFBA 4CUCA 2KZHA 1W1TA 2X40A 1GORA 3ARSA 3NGJA 2Z26A 3AROA 5JH1A 2IPGA 4L1GA 1IIGA 4S3FA 1AZ1A 5LSMA 1JZ6A 5HWJA 5A2BA 3TW7A 2GOKA 3VABA 3UVIA 5AVNA 2FZNA 4CQDA 2HCVA 5FAJA 4Y8EA 2FTWA 1J0KA 1E1EA 4GH3A 3BICA 3N13A 3M5YA 1BF2A 4X0NA 2VT0A 3GDLA 3PBMA 5M3WA 2G37A 1RJPA 4B92A 3AHZA 3SCTA 4HA4A 3CV7A 4QLJA 4QQUA 1FDJA 3W75A 2DDXA 3L7RA 1ECQA 2PDKA 4WX2A 3LI0A 2PF8A 3W26A 4AWTA 4EX4A 1CGWA 3LHUA 4LVDA 4WDXA 3EGJA 5G2HA 2Y4SA 2EJAA 4O1CA 3VAVA 4JFUA 1N82A 4R7WA 4LAZA 4TMCA 2G95A 2WWCA 4GZEA 2NWRA 4YCPA 4D6GA 2YL6A 4ZR8A 2OKOA 4LV9A 3BPWA 3TWBA 1WQ5A 2A85A 3RXZA 1TVLA 4W93A 3N3TA 1ONEA 3NQ2A 4S3JA 3O3RA 2VQTA 4N9BA 4JTRA 2WXDM 3SSZA 3N4AA 3PJTA 4AMCA 4BR1A 1AW1A 3SCQA 1RY8A 4QROA 1IGWA 3HPFA 3MCOA 1W1VA 3CHEA 1XD1A 1RZMA 3I6TA 3GLCA 3H7VA 3EAUA 1H7RA 4IQDA 3GAYA 1YLVA 2PTYA 1VKFA 5FJTA 3TXZA 3ABRA 1QNOA 3SY8A 4ZVJA 1R3VA 4Q4SA 3VNZA 2PWFA 4GIAA 2BY0A 2ZRWA 3DH7A 5E1QA 3P82A 3EWXA 1X7FA 1GGOA 3HBLA 3WEZA 3WMCA 3A4WA 4MMWA 4NAFA 3BJTA 3W86A 4ACZB 3PVFA 4X2PA 2VRQA 4IMDA 2R6OA 2UY5A 4ICCX 4ACYA 1W9PA 5F2GA 4D6FA 4HU4A 1KCKA 1KO0A 5FSEC 1TPFA 5CCZA 1EJVC 3W2JA 2Y1HA 5XIAA 1SZNA 2GJXA 3POCA 3BW3A 2FKPA 2E67A 3U57A 4D8LA 4ZBCA 3F2BA 4H8VA 5FF7A 1OCQA 1PTAA 3HQOA 2BVWA 5CG7A 2J8FA 1ZGDA 4AF0B 3WNNA 3PG8A 3NPWA 3GSMA 2VR2A 3KE0A 4PC8A 5D2WA 4AWUA 1TJPA 3UWEA 7REQA 1ZBCA 4HMNA 4I9TA 3URNA 4OECA 5FKYA 1UA3A 4B90A 4ZXLA 3S1GA 4H6QA 2YFOA 3QR1A 1CB2A 4ZOBA 3GVRA 2J7DA 3JU2A 1XLKA 1DV7A 5I3JA 4AZIA 3P5YA 3AMDA 2ZZ2A 3A5VA 2ODOA 2ZE0A 3UXAA 3QQWA 1JXKA 3SCVA 5HMSA 3UR7A 4HPGA 2I7GA 1XIBA 3FLUA 1E40A 3NPVA 4WJ8A 3VOHA 1HIZA 2FMNA 2VR4A 2ZC1A 5IHSA 5AYXA 2H8ZA 1E5JA 2OB3A 1B90A 5FJIA 1A80A 3QY6A 1US2A 4AVFA 4AD5A 2ZRXA 4B3ZA 3KW3A 1CYGA 1VS1A 4CCEA 5LNUA 1T6MA 4S3KA 1B57A 1LBLA 5I3FA 4N02A 1A5MC 4DUXA 3U2CA 1XQLA 1J18A 1KC7A 1GOMA 1FP9A 3B0VC 4AX6A 3XISA 2HJPA 1GOIA 1E9IA 5G2WA 4MNMA 2OYKA 4FI4A 2O56A 3R79A 3PB2A 1VFHA 1OINA 1OFBA 4KKXA 4XBKA 5A1AA 2ZXBA 5I77A 3E3HA 2P8CA 4RV3A 4E4UA 3MWAA 3GNDA 1BVNP 2A6NA 4JTGA 5CBJA 2VXNA 1SW0A 2ZCGA 3NQAA 3L66A 3QTGA 5EMKA 1TV5A 4ZO9A 4C1NA 4EPKA 3QW3A 3LTYA 3W4RA 3WLPA 2ZRYA 2JBMA 1HKIA 3HMCA 1GHRA 4YHEA 4DJEA 3TA6A 5TF0A 1W6TA 4WOQA 4IL0A 1K6WA 1XBZA 2C8NA 3L65A 3ALGA 3WQGA 4KIEA 1EB3A 2GVYA 4MWAD 4AB4A 3T08A 4WLCA 4IPPA 3RX3A 4MLJA 3LCGA 1QU4A 1YPFA 4WJXA 5KZEA 4F0KA 2ATMA 4NU7A 3LI1A 3P0WA 3N3MA 1GJPA 1X8FA 4U4MA 1P0DA 3SRKA 2ZX7A 2VFIA 4YVPA 3S6OA 4M1RA 1VR6A 1ZNNA 4I90A 1E6ZA 3TNBA 2F2HA 3UGVA 1C93A 1J12A 2WBKA 2BX7A 4Q8UA 3FAXA 3NQDA 1A3XA 4H9YA 4DJEC 4JNMA 4HB7A 3LENA 3UJ2A 4BKNA 4CD6A 1A47A 3MI6A 3QBUA 1V0MA 3ITXA 5DMLA 2OELA 3FV9A 1H0GA 3CO4A 3DKLA 1TPC1 1F61A 7CGTA 1XM3A 4H3DA 4HU8A 4KGLA 2C1IA 4MNKA 4QGCA 1VBGA 1TV4A 2J77A 3PFMA 3W1XA 3N4FA 4Y2WA 2DEPA 4GNJA 1U5VA 3THUA 3WMLA 1OB0A 1RLDA 1US3A 3VOFA 1GQNA 3VDCA 1UH4A 1V6YA 3W6MA 4PE8A 3V5FA 2C18A 3MUAA 1GQIA 2JGQA 3KWXA 3NOYA 5BRBA 4U33A 4M19A 4NQ1A 4NX0A 2NQJA 3UD6A 5CC7A 1XG4A 3UYIA 5HXMA 2PDFA 1XYAA 5EMLA 3MO7A 4MVAA 4AYSA 1NH6A 2J9ZA 2FGZA 3VC6A 4J9JA 3VDHA 3VIOA 2IS7A 2NQ9A 1TPB1 3LU2A 1Q5MA 1MW2A 3VPLA 3TNOA 1VPYA 3WLSA 4CN1A 4AY1A 4LC8A 2ICSA 3PHAA 4LCSA 3PZGA 3AQUA 1E6SM 6CGTA 2CLHA 4I9JA 2AL2A 4GZJA 4KFOA 2RDWA 4WSKA 3AJ7A 2Z27A 4HA1A 1FQ0A 2QW5A 1LLOA 3T6CA 3CO8A 5FA5A 1YX1A 4NAEA 2WHLA 4OV4A 1KD0A 4GIRA 5A6BD 3S9ZA 1FWEC 2GUUA 1I8JA 1DYSA 1O94A 2G0WA 3AMCA 2J7FA 4HHHA 5CXPA 2NX1A 1TJ2A 3EB4A 1M7JA 2EAWA 2Y85A 4QEHA 1EOMA 2QHAA 3FW6A 4JQ2A 3WDJA 4KW2A 4EKJA 1XBXA 1TPEA 3TN4A 1UD3A 1AFSA 4HA3A 3W1LA 5FEZA 4OIFA 4CVWA 1JUEA 1XX1A 4GFIA 3FKRA 1F8IA 1KWKA 3CJPA 2EPHA 3ITYA 1XCWA 3EEZA 1AQFA 3LD5A 4Z2IA 1F8MA 1TG7A 5TNVA 3EOOA 3WD2A 4BHYA 2PDPA 1FWIC 3HM7A 2RGLA 4OZOA 3HQPA 4GC4A 5CZTA 5LNWA 5CPTA 2I14A 3BWWA 5REQB 5GJMA 4DELA 4BA0A 1CBGA 2E6DA 4M6QA 4AMAA 3AISA 3ZR5A 3FA4A 5A5WA 4MKSA 3H2OA 3UY8A 1OYCA 4NG3A 4RE2A 5CJ5A 4JZ5A 4KWOA 1DXFA 2EPLX 4IP4A 4O0KA 3R94A 4C1KA 3JVAA 4O0ZA 1QPOA 3BCFA 3NG3A 7TIMA 1DHPA 1J8VA 5EFDA 5HBFA 4H7VA 3LLDA 5CG0A 3WQ8A 2RUSA 4RLIA 1PPIA 3IIXA 4J3SA 1FCBA 3M0KA 1V3IA 3TCSA 2CWXA 2BGNE 2Y7EA 1M03A 1KQZA 1UKPA 2WB5A 1B3YA 1K3UA 1Q2RA 4HP5A 1OK6A 3WSUA 3N19B 3CGTA 3VM5A 2A21A 1OT2A 4B5TA 2WSPA 2HZGA 1JDCA 2QV4A 4AX7A 1Q8JA 2V5KA 4NZCA 3TJ4A 3S5ZA 3CQHA 3PS7A 3DG3A 3RM9A 3STGA 1E71M 2WJDA 1DWAM 4UTJA 1JPMA 2F7FA 3EXTA 1C3FA 3LPGA 3K4AA 3Q4DA 1J4EA 1KRCC 3PBYA 3TVAA 3W1AA 3CZEA 4GBDA 1XLBA 4OBTA 1HXJA 4YNGA 3FOKA 2PDWA 3M0MA 3THCA 5DMYA 3W7CA 5DCDA 1F6YA 2WLYA 5E5CA 3W7NA 4RNJA 1H7XA 3H7UA 3GU2A 4EXBA 4BS0A 1V0NA 2PLKA 2XFFA 1DIDA 3KBJA 5FJOA 2QR6A 1XICA 3B8SA 2E8YA 1WZKA 2DPEA 5KSWA 3OBEA 4IFRA 4AVOA 2FFIA 4LEQA 3ITGA 3WBAA 3NAVA 1EZWA 1F6PA 3ZT7A 4HZ6A 3VGGA 2X2YA 4IPLA 4AC7C 2DP3A 4LUSA 4R7JA 5IDZA 4L6DA 4Z2KA 5C8BB 5A8PA 4XD6A 4LW7A 1XIGA 3RG6A 1CIUA 1BKHA 3KTSA 1M1BA 1WV2A 3A64A 5KTLA 1FWDC 3CZJA 3IJQA 4OT7A 4V33A 2H9AB 4W87A 3NL3A 3TSDA 1H61A 3ZLFA 4F2BA 2QDDA 5A95A 1ZALA 1OBAA 4PCTA 4JX4A 3AYRA 3QSRA 5D9NA 1PJ9A 4LBRA 1OK4A 1R3QA 3B4YA 1PO9A 3E0VA 5IDIA 3T0DA 1BYBA 2A3AA 2X1IA 4QISA 2CCRA 3R8RA 1XD0A 2J7HA 3URQA 3NVTA 3DG6A 3KOXA 3VDGA 4B5SA 4E5TA 2QLYA 3DUGA 3GHRA 5GJNA 2QQ6A 4B4HA 2FYMA 3B8DA 3SR7A 1Q6DA 1UW9A 3WK1A 3QYSA 2GJLA 4GXPA 4CN4A 1W3KA 5CAHA 5KINA 2QCHA 3QMRA 4AZCA 1S1PA 4IJCA 3N25A 4RNHA 2DT2A 2PBOA 3UCDA 5JUVA 4HMEA 3ARUA 4E3TA 3RJYA 2OSXA 2PDHA 2VI0A 1VC4A 1ZJIA 1EUAA 4Q8MA 4RX0A 1XIDA 3L67A 1CWYA 3UJEA 1WKEA 5I2UA 4LH8A 3SFWA 4UFKA 4R9XA 1J11A 1MW3A 2F8QA 4C6EA 1V79A 4HGXA 3QHNA 4AY7A 3NZGA 1TMQA 1QCWA 4ROQA 4XZBA 4D1IA 4YXGA 3CAWA 3U0HA 4O4VA 4FAMA 4L1XA 2D69A 1DQWA 1OYAA 1RUSA 3T0TA 3W70A 2NT0A 1FHDA 2DV0A 2IKGA 1RP9A 2CKRA 4AAJA 4K39A 5HNRA 3ZR4A 4LGXA 2V6AA 4HPNA 4F0HA 1V3MA 3T09A 1J9YA 3CIXA 4LTSA 1GUVA 3LERA 1G0CA 1KR1A 2X42A 3DX5A 2V3GA 5FF2A 1W31A 3H12A 2NXIA 1R2TA 1A5LC 1R3TA 1WBHA 4FXFA 4LRSA 5CC5A 2EG8A 1Q7MA 1ZLPA 2PDIA 4Q4MA 2DZXA 3S9IA 2YCJA 5CZ0A 1R2RA 4WGXA 3MJYA 1YE4A 3ZWTA 4FP1A 2HWGA 4F3HA 4O53A 3ARPA 4TX6A 4AU0A 1G5AA 2G8ZA 2WZTA 4CQAA 6REQB 4K8EA 4DBDA 1XL9A 3C0QA 4PGLA 3OW1A 5IXEA 4NZFA 4UQ9A 1A4MA 4PMVA 4ZFMA 2DUZA 5HMDA 4ZB2A 1FP8A 1TELA 3T78A 3K8MA 2WC3A 2Q8XA 4A3YA 5LGZA 3RDKA 4PSPA 1NTHA 3TTYA 1DL3A 3NUKA 1O7AA 4LBUA 1KBKA 1ZRQA 1AJ2A 2PP3A 1FHVA 3EXSA 4G5DA 3W7LA 1JCTA 4Z17A 2OU4A 2HVOA 3H8AA 5EFFA 1ZSXA 3WNOA 2J13A 3D0CA 1FCVA 1X1NA 4TVCA 3XIMA 4BFAA 2VFEA 4X0VA 3CHFA 3LM3A 4P7LA 3VNJA 1PVNA 4L9ZA 1NSJA 4HNUA 4M7TA 3FS2A 2HTMA 1J01A 5A94A 5HANA 3HPAA 2XVGA 1Q6CA 5I00A 3SRFA 5LNSA 4E6MA 1OYBA 1SPQA 3Q2DA 1ITUA 3LX9A 1CXHA 2OKTA 1AMKA 5BW6A 3IK4A 5FI8A 1VJIA 2Y62A 1V6WA 1OIFA 4L4MA 5DRCA 4LXFA 1FHLA 1R9YA 3WH8A 3IJ7A 3T7VA 2V69A 2QCMA 4FF7A 1GCYA 1UASA 3CUZA 5C9UA 1RBAA 1M5WA 2OJPA 4CNSA 4LC6A 3V75A 4MZYA 2GJNA 1MNZA 3NEHA 2BFGA 2DZAA 4ZO8A 1R5YA 3SCUA 3TOPA 1PHQA 1B3WA 1EGZA 4GQRA 1ONXA 3A13A 3TCEA 2Y88A 4P8WA 1T40A 1GG0A 3PUGA 5I3IA 2X0YA 1U1HA 2I5GA 1LM1A 2X8RA 4F8XA 3HFYA 4X2RA 1NDYA 1HKJA 1TRDA 3EXRA 1OF6A 5ABTA 2A3HA 3LHVA 2UV8G 1WP6A 1U2YA 3VNKA 3VNMA 4IPNB 4L7ZA 4W4QA 5FIPA 3P8IA 1KRMA 3FJLA 4HKPA 3W84A 1QWGA 3WNKA 2D20A 1QW9A 1XSJA 3F5LA 3PAOA 4Q6XA 3FCPA 4YTTA 4HU3A 5CC3A 1V5XA 4DPPA 1P5BA 3P2VA 3EX6A 1TV2A 1TV3A 1GVYA 4MY8A 2V5CA 4BQ4A 3CEUA 1OCNA 4KFNA 5CPNA