1FH9A

Crystal structure of the xylanase cex with xylobiose-derived lactam oxime inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh9A00
4GO9A 1ODZA 3FHQA 4V2XA 5CPSA 2CIPA 1V6XA 1OBAA 1XYFA 1X6NA 2AAAA 3ZQ9A 2J47A 2VOTA 4MJ4A 3K4AA 4NZCA 2V5DA 2DSVA 2WWCA 1EXPA 3PZNA 3VIIA 1GONA 3PZVA 2GDVA 1LL7A 3N04A 5JBFA 6CGTA 3ARYA 1ITXA 4AZBA 5I24A 5IFTA 3AISA 3CIVA 2A3CA 4KGLA 2CNCA 5JIPA 4C7GA 5CLWA 1CIUA 1XGZA 3AXIA 2BY2A 4C7FA 1HJSA 4E8CA 4AZ5A 3M07A 3BGAA 3W53A 5HBFA 3EMQA 4IM4A 2PI6A 1GQJA 2C0HA 3T0AA 1TMQA 3PZUA 3ZSTA 1BLIA 1KCKA 1G9HA 4ML4A 1W32A 3GH4A 1UKOA 3PZOA 4H04A 4CGTA 3OG2A 1PPIA 1E3XA 1JFHA 4URIA 1GVIA 5DFAA 1G01A 1JZ2A 4N0RA 2F61A 1V3IA 3VGHA 4DWSA 3WQVA 1J0JA 3FAWA 4ZFMA 3WEOA 4XX6A 1UR1A 1KWGA 1L0PA 4EANA 1NWTA 3NSXA 3W38A 1KB3A 1NOFA 3WF0A 3W26A 1E43A 1EOKA 1WCGA 4WKHA 2VRKA 3SCRA 4F66A 1J12A 4JCMA 4W5UA 1BVNP 3PZ9A 3KL3A 2EPKX 3VOCA 1H2JA 3IJ7A 3TTOA 4J3TA 2XGIA 3KWXA 1HIZA 2VZVA 2D20A 2V38A 1XCWA 3WNOA 1HL9A 4PMNA 1O6IA 1UD6A 3AHTA 3AIBA 1J0IA 2VRJA 1KWKA 3PZQA 4HZ6A 2C8NA 2EJ1A 1V6VA 1OCQA 3KL0A 4FLOA 4GINA 3MMUA 3RJYA 3CBWA 3AMLA 2QLYA 3NJ3A 3AIUA 3U5YA 2WVSA 3VNZA 2DPEA 1U33A 3VGFA 1EQPA 4ACZB 4F9DA 3ZJ6A 3AIRA 4PTVA 3F5JA 1DWIM 1KQZA 3MS8A 1X1NA 5A2AA 1KBKA 1RD6A 3J7HA 1B3WA 2CBUA 4UTFA 3PTQA 3OLDA 1I1WA 1B9ZA 2J8GA 2O92A 3U57A 3WBAA 4AZHA 3W29A 3N18A 1E55A 1IT0A 4D72A 2QF8A 2VCCA 4AEFA 1CXFA 2FGLA 3SCTA 1XSKA 2GDUA 1WPCA 1JYVA 4J3XA 5CSYA 1N82A 3GXFA 1NP0A 1MVYA 3AS3A 4W7UA 3PHAA 3EMCA 1LL6A 2XFRA 1TA3B 2WAGA 3NYDA 3F5LA 1BGGA 2XVNA 2E8YA 1JG9A 4WIWA 3TTSA 1M03A 1CXKA 1CXLA 3WEZA 3VGDA 3WIJA 4HA3A 2XSBA 5I2UA 3ALFA 3N11A 3GH5A 2QMJA 4CD4A 3BSGA 3BXWA 1RP8A 2A3EA 4UFIA 4LYRA 2XJ7A 4XB3A 2BXZA 4MB5A 4UZUA 1JDDA 2OSYA 1GW1A 2ZUTA 3BH4A 4Z2JA 2EPNA 4MB3A 4WKAA 1NM9A 2Y2WA 2J7GA 2YL8A 1TCMA 1M04A 2BHZA 4H41A 2DIJA 4IPNB 3WDRA 4QLLA 1B30A 3AHZA 2ZUNA 2E8ZA 1G0CA 3NUKA 2A3BA 1KR1A 1UZ1A 5CXPA 4AZCB 1SMAA 3QGVA 2EPOA 2W4XA 4GO8A 2QV4A 1E6XM 4ATLA 2NSXA 5A8OA 4HZ8A 4L4PA 1EQCA 3OLGA 2UWFA 3FN9A 3MANA 3ZOAA 3VMNA 3WL1A 3VIFA 3VD5A 3CHCA 4HOXA 3GXIA 3UETA 2X09A 5JUVA 2J4GA 4KGJA 2BY1A 2PWGA 3AIWA 1MQRA 3L4UA 4PN2A 1FFQA 2DH3A 4PMUA 1JL8A 4D71A 1E1EA 2CYGA 4AZCA 3AROA 1MYRA 2J79A 4Y7EA 1Q6EA 1HVQA 4UFMA 2VX4A 1B3YA 3W0KA 1OIFA 4AWEA 3F4VA 2XG9A 3EDKA 3QOMA 1GOOA 4J28A 1E9LA 3EYPA 3ARVA 1US3A 1B3XA 6TAAA 2XIIA 1VEPA 5E6YA 4UR9A 4PMXA 2WLZA 5A8MA 4UQAA 1M53A 4P8XA 1VB9A 3GYCA 1VBRA 4N42A 5EB8A 5CGTA 3GZAA 3MSGA 1J9YA 2PC8A 1W91A 3VINA 3WF4A 3OA5A 3ARQA 3VU2A 4AIUA 3MO4A 5HPCA 3WNLA 1TA3A 3A4XA 4OOUA 2PWDA 3OBAA 1PJ9A 1GQLA 5A2CA 4P7LA 3IJ9A 3FXYA 2C7FA 1UQYA 1FFRA 3ARXA 3B8SA 4TXEA 3MUZ1 2X0HA 3RPMA 2E9MA 4OBSA 2WSKA 3BAXA 3WDPP 3AS2A 1LF1A 1MQQA 1XH0A 1X6LA 4PMQA 3GBEA 2D22A 3L4XA 3UG5A 1UZ4A 4CD6A 3AZTA 5GNZA 1KXTA 4RE4A 1ODUA 4RE3A 1IZJA 3AIEA 2VURA 7CGTA 4BQ4A 3THCA 4JAWA 2WCGA 5F7UA 4TVUA 3ZO9A 4PBGA 4BS0A 1E5JA 2BY3A 2D2OA 4YN5A 2BVTA 2PBOA 3N1AA 3WH6A 4PYSA 4M80A 2A3AA 4P7QA 3ZR5A 1HKMA 1H41A 4LPCA 3G6LA 5A6BD 1JZ8A 4Q22A 1NARA 1V6UA 3WL0A 2WKLA 3AYSA 1W9DM 4UOQA 2ZX5A 3SCVA 1MXDA 1HJVA 2OSWA 4CU7A 4AY1A 1JAKA 4OJYA 4U5KA 4E2OA 1GQKA 1BHGA 2VR5A 2YL5A 5BXTA 2WW5A 1ZJBA 3CMJA 5CZKA 2YDSA 1C3FA 2BVYA 3T09A 4DM2A 1JZ6A 1EDGA 2V3FA 4IUGA 4PTXA 5KZ6A 2WWDA 5ABFA 3VX0A 4M29A 3AZRA 2HVMA 1UD2A 2RGLA 5FL1A 1XH2A 1HNYA 4ZXLA 4H8UA 3RIKA 1NWRA 3RM9A 4AMCA 5CLTA 1HKKA 3SUVA 3UR8A 3KEHA 2BS9A 1C7SA 3CMGA 3CH9A 1QW9A 1WB0A 3WDHA 1OM0A 1PX8A 2GSJA 2PB1A 1MFVA 1KCLA 3AIVA 4WK9A 2WVVA 3QHNA 5E70A 4W93A 3KL5A 4PMOA 1HT6A 2XUCA 4QLJA 1XD0A 1FHDA 2ZWZA 2IXUA 3AS0A 2V3GA 3N12A 4KRUA 3WH5A 3RILA 3T0BA 1VRXA 4UFKA 3W81A 1V3LA 4D6GA 1XHGA 1KGUA 3DYMA 2WC7A 3WSUA 2WMFA 1UR2A 3E1F1 4UQEA 1FHLA 3OZPA 3WD3A 1J0HA 2E0PA 4DUXA 1ISVA 2XSAA 1UH2A 2WANA 2CCRA 3WDJA 1W3KA 4Z2KA 3ALGA 3CZGA 1GZJA 1W1PA 2J7FA 3CGTA 2CPUA 5DT7A 2J75A 3BMVA 2OYKA 3MV01 2WNWA 1JZ3A 3LPOA 3BLPX 3AMDA 3JUGA 4CCEA 1QNSA 1WAWA 2J78A 4LYPA 3BAYA 4JFWA 5A8QA 2CBJA 4W89A 1GOMA 1W1YA 1XV8A 5ABGA 1J10A 3HU7A 3AI0A 3GBDA 3NCOA 3WBEA 2G3MA 1WDRA 4W8BA 4ZE5A 1UHVA 5GNXA 1VBUA 1H0GA 1CGUA 4F9JA 3K8MA 4R27A 3W6LA 4TVDA 5A6LA 1EIBA 4XUYA 4CVUA 1G94A 3WD4A 1UWSA 1HJQA 2VVNA 4FK9A 4AW7A 3OGVA 3DHPA 5C8BB 2YBTA 3OGRA 5A6BA 2GJRA 1E40A 1CLXA 2WSPA 4HP5A 1E6ZA 2XYLA 1EGZA 2VCBA 2NW0A 1JGIA 3SCPA 1NH6A 1GJUA 4NRRA 4GI8A 2D3NA 5D8ZA 3PZGA 1UG6A 5BROA 4W84A 3I3BA 5IHSA 3WNKA 3L4ZA 3U7VA 3W4RA 2WMJA 3UR7A 4NF7A 3BAIA 1VJZA 1H09A 2FGZA 1A3HA 3SUWA 1CZ1A 4JFUA 1JYNA 1MFUA 1UWQA 4HPHA 5ABHA 1QHOA 1J18A 3CTTA 1GHSA 3AMCA 5IXEA 1UUQA 1E0WA 4H8HA 3BAKA 3VTRA 3WD0A 4TTGA 2ZWYA 5A3HA 1ISYA 2WMHA 1LLOA 1ZBWA 3WFZA 4OBRA 5FD0A 1HVXA 3SUTA 3TTQA 1LG1A 3CZJA 1HXJA 4HMEA 2VRQA 1V6YA 3L4WA 1JF6A 4CCCA 2GK1B 2X8RA 2WMGA 1ITCA 2Y8KA 4QAWA 8A3HA 3CHEA 1W3JA 3U5UA 2FHBA 3WUGA 4OKDA 1E56A 2IXVA 3AFBA 4MNJA 5CSUA 2VJXA 3EDFA 3ARSA 2ESCA 1ZL1A 3ZIZA 2E40A 4AD3A 1E15A 5A6JA 2WYSA 4NI3A 4QP0A 3T2QA 2DDXA 2FHCA 1JI2A 3TA9A 1E0VA 2PF0A 1QHPA 4D6JA 4AIEA 4LQ1A 2XFYA 1H4PA 4UQ9A 3SCOA 3BAJA 3QHMA 4MDPA 1CTNA 2VZSA 4GI9A 5A6KA 3WQ6A 3GNRA 3OLIA 3THDA 4Z2GA 3VIJA 4A3HA 1AMYA 1MQPA 1A47A 1PAMA 4CN4A 2XM1A 4U2YA 3CUGA 5I6SA 1D2KA 4W8LA 5BXPA 1CWYA 4PMYA 3UG3A 4JIEA 1ZBCA 3VDBA 2WMIB 1OGSA 3VD3A 2ZUUA 2WZHA 4AISA 1E70M 3MSDA 3F5KA 4DWSD 4JKKA 5FKYA 4CD7A 4D6FA 4MB1A 4UOZA 2WBKA 2DSUA 3LPGA 3SCNA 3VDHA 1J0KA 5BCAA 1MW2A 5EFDA 2PWHA 3WH7A 5C70A 1KFWA 3VD4A 5D8WA 1B3VA 5CJ5A 3SCSA 1JDCA 3IJ8A 1ESWA 2VQTA 1W9BM 2VNCA 2RGMA 4WSKA 1EO5A 1RP9A 2UY5A 4E4PA 1K9EA 2WVUA 4K68A 1VFFA 1CEOA 3DECA 3MMWA 1HX0A 1LQ0A 2VZOA 4IISA 5FOOA 2QPUA 4BA0A 5M17A 3ZT7A 4MNMA 1C8QA 4GZJA 4FMVA 1C93A 3VD7A 1K9DA 3RMEA 1WDQA 2YJQA 2J7BA 5A95A 4JZ5A 5I23A 2J74A 3TOPA 2J8FA 1E6PA 3VILA 2ZUVA 5CPQA 5GNYA 3UCQA 2CESA 1V0KA 1DWGM 1TFVA 4U33A 4DWSC 4BZYA 2E4TA 3WEMA 2V3DA 4PEEA 4BQ2A 1CXEA 1XYZA 4MJ2A 1XSJA 3M46A 4DUWA 3BMWA 3HJEA 2WBGA 3WY1A 4MAVA 3WENA 1WZAA 3S6TA 1NOUA 1CXHA 3W82A 4AD5A 1UKTA 5AC5A 3AZSA 3D3AA 1V3HA 1UD8A 2DIEA 4JFSA 2OWWA 4GQRA 4TVCA 2UY2A 4QLKA 1ZS2A 5M5DA 2V3EA 5FCZA 4DM1A 1M01A 1E4IA 1V3JA 2D24A 4PRWA 4NSBA 2D0FA 3WQ8A 3CHDA 2DT0A 5CPTA 3VNYA 3DYOA 2VMFA 1DEDA 4PMRA 3VIPA 3AHXA 1V02A 5AYBA 1KXQA 2W67A 2VTFA 2WMKA 3UESA 4V28A 1W9VA 4C7DA 3VDAA 1OD0A 5D4YA 1NP2A 1PX3A 3UG4A 1WKYA 3LMYA 3POCA 3WMSA 3W37A 2AOSA 1ZJAA 1KQYA 2Z1SA 4D6CA 5HXMA 3RDKA 4WF7A 1PZ2A 1TZ7A 1JAEA 3PTKA 3T2OA 3SEPA 5JBEA 2DSZA 3WF3A 2YA1A 2BY0A 5ABEA 1B90A 5A6SA 5TD4A 1WDPA 1R8LA 4D1IA 3AYRA 1RH9A 1S46A 3NDZA 1JF5A 1E73M 1W9PA 2VVSA 1PBGA 5DEZA 3ZJ7A 1FH8A 2PWEA 2JEPA 3WQ4A 3POHA 1BVZA 4R5EA 3CUFA 1BPLB 4QCFA 4UZSA 4A3YA 1VEMA 4JFTA 4FLRA 1PIFA 3RJXA 4A4AA 2WB5A 2EBNA 1Q6FA 2UY3A 3A47A 3WD2A 4HOWA 2JIWA 1OB0A 4JKMA 3ZM8A 2VZTA 2VQUA 1G5AA 3ZJKA 5EBAA 4D6EA 1EHAA 1BF2A 4HU8A 3DC0A 9CGTA 2J7HA 1JNEA 3T2PA 3EDJA 5I5RA 2WLYA 4QCEA 1C7TA 3ZT5A 5C71A 3N13A 2G8ZA 1JIBA 1QBAA 2Z1KA 4W88A 3ARRA 1Z32X 4CCDA 4M8UA 3G6MA 1C8XA 3WMCA 1HN1A 4JHOA 3LPPA 3BAWA 3FW6A 4MADA 1R7OA 1R87A 5IFPA 1QI3A 1AQ0A 4J27A 1BFNA 1CECA 5EFFA 2PWFA 2YOCA 2EEXA 3WF1A 4D1JA 1OINA 2D0GA 1I75A 4PSRA 4B9ZA 4U31A 2PBGA 4HZ7A 1TG7A 3ECQA 4JFVA 4J7RA 2GJXB 2WHJA 1GUVA 2XM2A 3MUY1 2ZUWA 3GXMA 1QI5A 1PX4A 1MWOA 4LXFA 4M24A 4AC1X 1VIWA 2A3HA 1E4MM 3APGA 1E71M 2YLLA 4M82A 2WPGA 4Z2HA 4AYSA 3VMPA 3IK2A 1OT2A 3T0DA 4W85A 1CPUA 1D3CA 1Q6GA 1HP4A 4B3KA 1V0LA 1JYWA 4BQ3A 4HPGA 2QHAA 5E6ZA 3L4VA 4ZENA 5JIWA 4ATWA 3SUUA 4CN1A 1UKSA 6A3HA 5A1AA 3BSHA 2CHNA 1UKPA 4D6IA 1K6AA 1XC6A 1ECEA 1BYCA 5E0CA 3AMGA 2WXDM 4LYQA 1UD4A 1ZB5A 3OGSA 2BXYA 4XZWA 2VI0A 5CQ1A 3ZSSA 1UQZA 1CBGA 5E09A 1FP8A 4ZXOA 4PTMA 2D3LA 1PIGA 1JXJA 4B3LA 2W5FA 2XVGA 2W66A 4J3UA 2Y24A 1FOBA 2DSKA 3CUHA 1C91A 1D7FA 1HJXA 1U30A 5AYIA 4KH2A 3CZ8A 4W5ZA 2O9TA 2WKGA 1HJUA 1R7AA 3GDBA 1GOIA 2VC9A 2OYLA 2Y4SA 3PBGA 1H49A 1G1YA 2ZUMA 4HOZA 1OT1A 4X9YA 2VO5A 1VEOA 2UY4A 2WHLA 5BRPA 1UR4A 3PZIA 1L8NA 2F2HA 2GK1A 2HISA 5LA2A 4ACYA 3SUSA 1E6QM 4UNIA 1CNVA 2O9OA 1QW8A 3AXHA 1FA2A 1NOWA 3TONA 1V6WA 2JALA 2X2YA 3VGGA 5M3WA 1W9UA 2G3IA 3ZJ8A 1HJWA 1WZLA 4U3CA 3VIKA 5BXRA 3WDQA 1JI1A 1M7XA 4RE2A 4TUFA 1UWIA 2QMKA 4OOZA 1GOQA 5I79A 1ISXA 3VIGA 1BAGA 3TP4A 5IHRA 1E1FA 4CVWA 5A69A 3ARUA 4PCSA 1AVAA 2EO7A 2VX5A 3GNOA 1UWRA 3VGBA 3AICA 3D5HA 4HU0A 3WDIA 3FHAA 1W1VA 2ZX6A 4UQCA 4OUEA 1FP9A 4CD8A 4PMZA 3K8LA 3W24A 1JNDA 3L2MA 3BCDA 2NT0A 4PCTA 1BGAA 4QFUA 3SCQA 1JFXA 3WQWA 3N15A 1KGWA 5HNNA 1WDSA 1ZBKA 3AJ7A 1VFOA 3SCWA 2VX7A 2ZXQA 2WCAA 2CKRA 1F4HA 4MNLA 3GNPA 1CXIA 3CUIA 5FL0A 5AC4A 1ISWA 3A6OA 4P8VA 2BHUA 4HMDA 4RL3A 1B0IA 3WFLA 1DHKA 2J77A 5I78A 2WVTA 5ABFB 1W9XA 1ZBVA 3WH8A 3ARPA 3PZTA 3UEQA 4P8UA 4YHGA 1OIMA 4W7WA 3II1A 2ZICA 4AD2A 4OZOA 4NRSA 3IANA 2JE8A 3QHOA 2XIBA 3MMDA 3CLWA 1UH4A 1UD3A 1GCYA 4W87A 1LG2A 2GVYA 2TAAA 4J3WA 4WLCA 3O6AA 1EDTA 1H5VA 3VM5A 1VENA 2ZX7A 2X05A 4EAMA 1V3MA 1GORA 2D0HA 4GKLA 3NSMA 1BYDA 1HL8A 5D9PA 1V0NA 3CO4A 4AD1A 1B31A 2G3JA 4M56A 5D9NA 3BC9A 1MW3A 4MTVA 1IZKA 1V08A 3K4DA 2OWXA 2GUYA 1H0IA 4UCFA 1B1YA 3I3DA 4S3JA 4YPJA 2ZXBA 1UR8A 2XFFA 4V27A 1E72M 1CGXA 4JKLA 3AS1A 1JXKA 4CD5A 2JIEA 3W27A 1E4NA 1YHTA 3VDCA 2CEQA 1DWHM 5IDIA 1UA3A 1OGBA 3NSNA 3KZSA 2WVVB 3RO8A 1BG4A 1QBBA 2OLHA 2YL9A 2CXGA 3SIMA 1CGTA 4HA1A 2CETA 1TVNA 1LWJA 2DSWA 3I3EA 2ZUSA 1V02E 2AMGA 5GPRA 2W61A 4KRTA 4B16A 2YDRA 2XWEA 3EBVA 1EOMA 1MW0A 3OLEA 1HKJA 1QNPA 2WZEA 2VZUA 5I0DA 3L2LA 3FNDA 4AZGA 3VX1A 4TX6A 4DWSB 4FLSA 3AHVA 5CGMA 2O9PA 5HPOA 2GFTA 4B15A 4L4OA 4LGXA 3WUBA 1QPKA 3SCUA 4B9YA 1BYAA 4GPNA 2ZXDA 4XV0A 5M03A 4AZ7A 4GQQA 3N17A 3WNPA 3VGEA 1QVBA 3VIHA 2NT1A 2WHMA 3W25A 4X0VA 1QHZA 3OZOA 2DT3A 1JDAA 1MXGA 3CPUA 3AQUA 3GH7A 3HMCA 1GNXA 4U2ZA 1HKIA 4UFLA 1JD7A 1UYQA 3WQ5A 4Z2LA 1U2YA 4TOQA 2V5CA 1W2PA 3QR3A 4CU6A 1JD9A 1ZU8A 1FH7A 1NWUA 2OWCA 4GZEA 1QI4A 2W92A 2WC4A 1H3GA 1QNQA 3TTYA 4Z2IA 4WJXA 5DF0A 3HN3A 2YIHA 1JZ4A 5BRQA 4F8XA 2XVKA 7TAAA 1XCXA 3AIQA 1E6NA 2J7CA 3CHFA 2ZOXA 3SURA 1BTCA 4E8DA 1R86A 2YDQA 4HMCA 1LJYA 2YA2A 1GOKA 1LL4A 2JFEX 2CBIA 1QNOA 3VKKA 2O9RA 3ZR6A 1E0XA 1UR9A 2B31A 5D9OA 3W6MA 2XWDA 3GXDA 5BXSA 2CHOA 4IPLA 5FIPA 1WP6A 4GIAA 3WNNA 2DGAA 4MDOA 4AD4A 5A94A 1CGVA 1HF6A 4U3AA 1B2YA 1WZMA 3UERA 1E3ZA 3VO0A 3WKZA 1OSEA 2XVLA 2J25A 1CGWA 1E6SM 3WF2A 3B9AA 5GQBA 2YL6A 3BCFA 1GQIA 1OGGA 2J7EA 1E4LA 1HP5A 2BV9A 4AEEA 2ZX8A 4HA4A 3T08A 3RCNA 3EDEA 5A8NA 1KXVA 1UD5A 1TR1A 3MV11 3L4TA 3L4YA 1DWJM 3IAPA 1ISZA 2YLAA 4ZEPA 4PUEA 3AOFA 4MB4A 1BG9A 1Y7VA 2JF7A 2CBVA 4EKJA 4PMVA 4TX8A 1SR0A 4JL1A 3DYPA 5DO8A 4AIOA 1O7AA 2FHFA 3B9DA 1GPFA 3KE0A 5EMYA 5E0FA 1AQMA 1WE5A 4U5IA 3RM8A 1QOXA 2DQXA 1R85A 2VR4A 2YA0A 4EE9A 4JHZA 1C8YA 1PEZA 4LX4A 5BWFA 3ZMRA 1K9TA 4X0NA 1H1NA 4UOJA 2XVPA 5JBDA 3MUAA 1GHRA 5A2BA 3VIOA 2G41A 4AXNA 2CITA 2G3NA 2FDMA 3A3HA 2EXOA 5D9MA 1RPKA 3M7SA 3VM7A 4P7RA 2W63A 4J3VA 1IV8A 4M81A 4W8AA 1WZKA 3K8KA 1XD1A 2E9BA 1GOWA 4JL2A 4H2CA 2ZX9A 3WUEA 2XGBA 3LPFA 2OYMA 3BLKA 2GJPA 2JEQA 3A4AA 3NIYA 3W28A 3N9KA 1SYTA 3WMBA 4FF5A 1VFMA 4CUCA 2BHYA 2WHKA 5ECUA 1I1XA 4P8WA 5BYWA 4PSPA 2CERA 1CENA 2EPLX 4F79A 2WM0A 1J0YA 3EMZA 1MW1A 3CZLA 3U7BA 3VMOA 4UFHA 2VUYA 2FH8A 1W1TA 2DT1A 2MANA 4S3KA 5A8PA 2GJXA 3VUPA 1BSIA 1JZ7A 3MKKA 3RM4A 1AQHA 2J7DA 3PZMA 4MNKA 1UKQA 1JYXA 3WNMA 1E5NA 1WO2A 2VCAA 1CLVA 4WKFA 1J11A 1TE1A 3B9EA 1DTUA 3M6DA 4KMQA 1KR0A 5I3DA 4PTWA 2X1IA 4XZBA 4J3SA 1H11A 4ACZA 3GM8A 2XPKA 3QOKA 2VX6A 4UFJA 3WN6A 1V03A 1SMDA 3WD1A 3PN8A 3OB8A 1KBBA 5DMYA 1PZ3A 4QDMA 2CKSA 5AY7A 1NQ6A 4GZIA 4MAZA 1VAHA 3DHUA 3O9NA 1VJSA 3FAXA 2WC3A 4ZE4A 3A4WA 1BYBA 1C90A 3AXXA 1UWTA 5HOSA 1OD8A 1OWQA 1NWSA 2XHYA 5HDRA 1W2VA 1XRVA 1YQ2A 1V3KA 3AMKA 3AHYA 2JF6A 1EHNA 3ARWA 1CDGA 4CN6A 4P7OA 4PMDA 2YKKA 3EDDA 5I77A 2EQDA 2EPMX 4WSJA 5A6MA 1EA9C 4UQDA 4YHEA 3PTMA 4GXPA 7A3HA 3S2CA 2ZIDA 5LA0A 3WELA 1DWFM 4GI6A 1W3LA 4OIFA 3WUFA 4KWUA 4PUDA 1LWHA 3ARZA 1XH1A 1TUXA 4M1RA 4UQBA 2BNJA 5E9AA 1K9FA 3CUJA 2BVDA 4P7NA 3GTNA 4FLQA 2WCSA 2W91A 1BQCA 2OSXA 4HTYA 3WH9A 3CZEA 1CYGA 3K1DA 3VIMA 1US2A 4CU8A 1UH3A 1WNOA 2ZE0A 1Q4NX 5A6AA 1QI0A 1FH9A 1TVPA 2WK2A 2IUZA 2YBUA 5DT5A 2X0YA 4Q7NA 1UWUA 2VT0A 1UA7A 4TTUA 4EK7A 4AZ6A 2E9LA 5CG0A 3VD9A 5LA1A 1XSIA 3VVGA 4DUVA 5KEZA 1VFUA 2G4FA 3OIHA 8CGTA 2Y5EA 1EDQA 1JZ5A 4MPKA 1P6WA 1GJWA 2XTKA 4H8VA 4BCEA 1C92A 3VPLA 4W7VA 3IAQA 4CKQA 4D6DA 2J62A 1QI2A 1CGYA 3CZKA 2W62A 4BQ5A 1UR0A 2Y8VA 1E6RA 4AD0A 2DH2A 5LYRA 1VF8A 4W86A 3MU7A 1EH9A 1W3HA 1QNRA 4ATDA 3K46A 1KGXA 1Q6DA 1UOKA 1F4AA 1J0ZA 4H7VA 2BFGA 1KXHA 2D23A 2DEPA 4D6HA 2WMIA 3MUIA 3NDYA 2D1ZA 2VL4A 2DT2A 1B3ZA 3ZT6A 2FH6A 2F8QA 4AZIA 3O2LA 1J01A 2ZXAA 1SFSA 1Q6CA 1DWAM 3ARTA 1EO7A 4BF7A 2Q8XA 1DP0A 3FY1A 4JCLA 2E3ZA 1GVYA 2WZIA 1V0MA 2QPSA
chains in the Genus database with same CATH superfamily
1JCNA 1SJAA 4V2XA 5CPSA 3EWDA 1V6XA 1P43A 2VD8A 3NL3A 1F5ZA 1XYFA 3SQMA 1XS2A 2I16A 1O5QA 1XICA 1XPYA 4W9TA 1KTBA 3ZQ9A 3QPYA 3LYEA 4MJ4A 1TWDA 3K4AA 4QDPA 2WWCA 8TIMA 3B40A 3L2IA 2GDVA 2Y62A 1LL7A 3N04A 1VH7A 5JBFA 3B9NA 2O7QA 4O10A 5I24A 1W54A 4KGLA 2CNCA 2I7GA 1C9WA 1CIUA 4GVIA 3G1HA 5G2HA 4E8CA 3WLKX 3M07A 3EEZA 1G6CA 1GKQA 1DJIA 3BGAA 2D2HA 3W53A 1K8XA 4IM4A 2C0HA 2IKHA 3ZSTA 1G9HA 3IIXA 3CU2A 3A4JA 2G37A 3RCYA 3TX9A 4I7UA 5DFAA 3TYCA 4JYDA 1SPQA 1G01A 1QO5A 2F61A 1US0A 3VGHA 2ZC8A 3WQVA 1MSSA 4RNJA 5SWUA 3WEOA 1UUOA 2OFJA 1XCFA 4F48A 4IT1A 5I3JA 1E43A 1EOKA 2PRHA 1WCGA 2CFFA 4WKHA 1MRQA 1REQA 1ZP3A 1J12A 4JCMA 1BVNP 2EPKX 4QE4A 1WUFA 4J3TA 3KWXA 1SJCA 5J5DA 2VZVA 4LS0A 3FYOA 3OO2A 1XCWA 3WNOA 4DJFC 1PVNA 1UD6A 4P5UA 3LV6A 5G4HC 3G0UA 5BOEA 2VDGA 3OYZA 1OCQA 3KL0A 3T1GA 3MMUA 3RJYA 2BG5A 5HR7A 2OKTA 4MY8A 3M9YA 4ACZB 5M2FX 4GYKA 5HWMA 4PTVA 4ZOCA 1KBLA 3H70A 3MS8A 1J6PA 4XZHA 3DCPA 1XRTA 5J5RA 2IMRA 4WXZA 4H9VA 1RA5A 1YX1A 1LLWA 3EKZA 4UTFA 2O92A 4MG4A 4F0KA 3TSBA 3N18A 2OOFA 2PTYA 5LNVA 2TSYA 3SCTA 2FGLA 4XAYA 1XYCA 1XSKA 4YTUA 3I6RA 5D04C 4J3XA 1DL3A 1MVYA 2WNQA 2XFRA 1TA3B 1BGGA 1XRSA 2XVNA 1JG9A 1LORA 2OX1A 2KAUC 3WK2A 5B7YA 3OVGA 3ALFA 1VLIA 3BXWA 4K8GA 1Z8AA 4UFIA 3AJXA 2BXZA 4MB5A 2Z7KA 3B8TA 3VI2A 1XQKA 2PLCA 2EPNA 4MB3A 1NM9A 1SM9A 3B0VC 3D3FA 2J7GA 4DBUA 1UZHA 3QYSA 5AFDA 4DJDD 4IJRA 1TCMA 3THAA 3U48A 3WK1A 1K8ZA 1O1ZA 1KR1A 4A2SA 2EPOA 5C2XA 2QV4A 1E6XM 2H3BA 4ATLA 2F38A 4XBSA 3RHGA 1AL7A 5A8OA 5K4XA 4HZ8A 3TEVA 4E0CA 5A5WA 3MANA 2INEA 4MLJA 4REQA 1DXEA 1VHNA 3A64A 3VD5A 5JUVA 4EACA 2J4GA 3QLDA 3WYZA 1XLCA 1GJPA 3VCNA 5I00A 4JY9A 1QATA 1JL8A 5JXQA 1FWWA 3OG3A 1L8PA 1SVDA 3ZLHA 2QJJA 1TPFA 3RN6A 1MYRA 2YSWA 3GSMA 3R4IA 3D46A 4KFPA 1GOOA 3BLLA 1E9LA 3EYPA 3DU0A 1US3A 1Z44A 1UCWA 1TKKA 1VEPA 1TPEA 1B5TA 3PFMA 3HM7A 3PULA 4O0KA 4UQAA 1VB9A 4RNIA 1VBRA 1KM1A 3LX9A 4M7SA 5EB8A 5CGTA 2VEIA 3SRFA 3W1RA 3C3NA 3OA5A 3CS2A 4B5UA 5HPCA 3WNLA 3A4XA 4JTCA 1PJ9A 4O0QA 1GQLA 1RJPA 3OOQA 3N2OA 5A2CA 5DELA 1K4HA 1S2AA 2NV2A 3HGOA 3UXIA 2C7FA 3ARXA 3BZGA 1VPXA 1ZZMA 2X0HA 2HTMA 1UIPA 3R89A 2WSKA 3BAXA 3WDPP 1LF1A 1MQQA 2ICSA 4JX6A 3GBEA 4DJED 2R1PA 4DPPA 1KXTA 4RE4A 1ODUA 4RR4A 3KCJA 1Q13A 1PWMA 4PBGA 5FJIA 4BS0A 1E5JA 2D2OA 4HJWA 3W23A 2MNRA 3GUGA 4M80A 4H9ZA 1MRAA 3G6LA 1NARA 3WL0A 4UOQA 1MXDA 1TR9A 1H61A 1OY0A 3N29A 5ENLA 4QEEA 3F03K 5C7HA 1EEXA 3NM3A 1JJKA 2VR5A 1PZ0A 2YL5A 3RPDA 4YTSA 2WW5A 1ZJBA 3KDNA 3SIZA 4DO6A 2WPBA 4CNUA 1EDGA 1TPH1 4WSHA 4MWAB 1ZNNA 1EWEA 2WJFA 5XIMA 5FL1A 1XH2A 3GXPA 5H91A 3TTEA 4UMCA 5GJMA 5CLTA 3SUVA 3UR8A 3IS4A 1XIBA 4GOAA 4WY0B 3CH9A 1OM0A 3TOYA 1KCLA 3AIVA 4WK9A 2WVVA 4O12A 4PMOA 1HT6A 2XUCA 9XIAA 3T7VA 1JPIA 1FHDA 2ZWZA 2IXUA 3PSWA 2GVEA 3QMTA 3BLFA 1X98A 1VJIA 2FMNA 2V3GA 4LAOA 3BARA 4O14A 1XPGA 3T0BA 3C2YA 4UFKA 1XHGA 3E1F1 4UQEA 3TJ4A 1N8IA 3ITLA 1JDEA 3DKLA 2XGZA 1J0HA 2XSAA 3ABSA 1LZOA 1IXPA 1W3KA 2IQTA 4Z2KA 3U2EA 4MUPA 2BP1A 3CZGA 4Q4QA 3TK7A 1VCGA 3MV01 1JZ3A 4D8AA 1WAWA 1FWTA 1I2NA 4GVFA 4Y8EA 5CC5A 1VCVA 4JFWA 4IMGA 1XLHA 1GOMA 1KBIA 2J6XA 1TV8A 3GXTA 1DV7A 5GNXA 2BMBA 2V6AA 4NI8A 2HNHA 4AW7A 3E49A 1S5TA 3BQ6A 3N3TA 1FWEC 4H8NA 1O60A 5A6BA 3R13A 2GJRA 1XGEA 1E40A 3XIMA 2XYLA 4LT9A 1EGZA 2NW0A 3IJ6A 1OABA 3VNJA 3QZ6A 2CLMA 3O16A 2WNNA 2OEKA 1GJUA 2QDDA 3UWQA 3G0XA 2PF8A 3H2EA 1UG6A 4QAIA 4OQVA 1KM0A 4PEKA 3U7VA 1PXGA 3G1AA 2ZVIA 2CLKA 3T4WA 3W4RA 4FPSA 5F4SA 2WMJA 4NF7A 3ITXA 3BAIA 1H09A 4DJEC 4HPHA 3U6WA 4ERIA 4XAPA 1F3XA 1QHOA 5GVJA 3C2VA 3CAWA 1W8GA 3W1TA 1UIOA 2YB4A 4P61A 3QYQA 1EUAA 1LLOA 1ZBWA 4PB4A 2Z28A 5JH2A 1LG1A 4HMEA 4GFIA 1X97A 3NPWA 1R2TA 4QAWA 1LP6A 3GR8A 1W3JA 4B5VA 4NZ5A 4WZHA 1I45A 2IXVA 3DEQA 5CSUA 3EDFA 3T2QA 2DDXA 5J8LA 5K9DA 1QHPA 4D6JA 2E77A 3AUOA 1O12A 4LQ1A 2QZRA 2XFYA 1H4PA 2HE5A 4YWSA 2IQDA 2PRLA 4MDPA 3NQ2A 4CQ8A 3OLIA 4NZ1A 4FX8A 1PAMA 4IQLA 4DVOA 4ASTA 3W1PA 4U2YA 2AKMA 2NUWA 3OVQA 2POTA 3UZYA 3OYXA 1QT1A 5I6SA 4DJDC 4W8LA 1B4EA 5BXPA 3BV7A 1ZBCA 2PPGA 2WMIB 2L5HA 4H9YA 1W31A 1R3TA 4EP8C 4AISA 1E70M 4DWSD 4JKKA 2NUYA 2QCMA 5FKYA 4D6FA 4UOZA 1KCZA 5EMUA 3KVLA 4WDWA 3PUGA 3SCNA 1J0KA 4FR6A 1I0BA 3TC7A 3NZRA 4NYUA 3WH7A 5C70A 4MKSA 5D8WA 2GSHA 3IRSA 1Z7AA 4NVTA 4QXIA 3T55A 4WSKA 1EO5A 3PC0A 4KETA 2UY5A 4LCSA 4E4PA 4DO4A 3BJTA 1AUSL 4C1KA 3DECA 3MMWA 1HX0A 2VZOA 4DY1A 3G1DA 3T05A 4NL1A 4GZJA 2CLOA 5IBXA 3VD7A 1GVSA 1O5RA 1WDQA 3KBWA 1YBQB 2YJQA 1JCLA 1F6PA 5A95A 4WJEA 5I23A 5G1YA 1T96A 1VRDA 1V0KA 1DWGM 1R3YA 4DWSC 4BZYA 2E4TA 3LV5A 3WEMA 2V3DA 4YMZA 1EJTC 2YPIA 4MAVA 2FTYA 3WENA 1NOUA 1CXHA 4YLWA 3FJLA 3AZSA 2OWWA 1C8VA 3PJTA 4YJ5A 2Q3RA 1PE1A 1QAPA 1ZS2A 5M5DA 1JPDX 2VFIA 1A5OC 1P1MA 5FCZA 3QFEA 1VFHA 2VUNA 2D24A 4ZCWA 4NSBA 4FP1A 2D0FA 3WQ8A 5IBXC 5CKSA 1L6GA 2R1LA 3CXOA 1G7VA 2Y5JA 3DYOA 4QX4A 1JULA 4DJFD 2OELA 1V02A 3OJGA 2W67A 1FWCC 4N02A 3UESA 3OVPA 4FSAA 1OD0A 4M1BA 2GJNA 2RJHA 2HEJA 3WMSA 4TQTA 1ZJAA 1DVJA 4KWSA 4D6CA 3C2RA 3RDKA 1I2OA 1EA0A 4BFAA 5DCDA 3QC3A 4YIWA 1TZ7A 3SEPA 2YA1A 3DFSA 1B90A 4QJ3B 1R8LA 3NA8A 1A3WA 3AYRA 1RH9A 5TQLA 1S3TC 1IXNA 3AU6A 1W9PA 4JS3A 4XISA 5D33A 2TPSA 3ZJ7A 1FH8A 1P6BA 3VOIA 4IZGA 3EGJA 1VEMA 1WXZA 4RJEA 3MCOA 1WAUA 4FLRA 3N4EA 1RR2A 1PCKA 2WB5A 4NZJA 3QW4B 3KFTA 1J4EA 4GQBA 1G5AA 5EYWA 1X8FA 2DZPA 2Q8LA 4D6EA 4QEHA 1JNEA 3KOZA 1OCBA 1J8VA 3W2NA 4QCEA 1S1RA 1PDZA 3K5XA 5L6UA 3ARRA 1Z32X 4CCDA 3WMCA 5CGQA 3LDVA 5TF0A 4JHOA 3BAWA 3G1RA 1DE6A 1K3UA 1P0BA 1S5NA 3UFYA 3ERPA 4UTIA 1EC8A 5HMSA 4L1GA 3PWIA 2YOCA 2EEXA 3EEGA 1OINA 4MYXA 4U31A 1YDOA 3WG6A 2PBGA 1TG7A 3ECQA 4E2DA 2XM2A 3MUY1 2ZUWA 1PX4A 1TIWA 2A3HA 2RDTA 1REQB 1ZENA 3N2TA 1AW2A 3HA1A 3IK2A 4HJFA 5T91A 5T26A 4W85A 1Q6GA 3RLHA 2RKXA 1HP4A 2J13A 4B3KA 1V0LA 4BQ3A 2CZEA 4HPGA 2QHAA 5E6ZA 3JS3A 1XIFA 4IG2A 3FGCA 2IKJA 5H6HA 2VDIA 6A3HA 2BDQA 1UKPA 4C6FA 4D6IA 3DGRA 1XC6A 2GUUA 3FEMA 1H1ZA 1TTPA 4GABA 1IGWA 3NZPA 3B0UX 3V5FA 5CQ1A 4EPDC 4PL1A 3BV4A 4FX6M 1CBGA 3SFWA 4LUYA 3GTFA 3WLLA 3UCDA 2Y24A 5GJPA 1QOPA 1FOBA 1U30A 2FPYA 2XN1A 4KH2A 4O4WA 2DY3A 4ONVA 2ZKMX 3S5NA 2O9TA 1EEPA 1UMLA 1HJUA 1GOIA 4GYPC 1ZSXA 1XXXA 2FZ8A 4D8LA 2FDSA 2P0OA 3QF0A 3MBFA 3W07A 2INFA 2Z27A 3BJSA 3OW1A 2VO5A 3C6CA 4LS2A 3WK0A 3QGKC 5G1TA 5JU6A 2W3ZA 4KQNA 2ZTKA 2VEMA 1L8NA 3HPZA 1W6TA 2P3EA 1IZCA 4S2BA 4UNIA 2BZNA 4JIHA 2WV8A 1RQHA 3P7YA 1DXFA 1GW9A 1W9UA 1HJWA 5BXRA 4DWDA 4UWMA 2QMKA 3CIWA 4OOZA 3QM3A 4MPQA 1BAGA 2GVLA 5IHRA 3QTPA 4CVWA 5FF7A 4A2RA 3IEBA 2GQ8A 5C54A 5C6MA 1AVAA 2EO7A 3GNOA 2I56A 3FV9A 1NJJA 1D9EA 1M5WA 3FHAA 2ZX6A 3L9CA 4CD8A 3E2RA 3EXSA 2IPFA 2I5IA 3SCQA 2VR2A 4JNYA 3W86A 2Z26A 1NQKA 1MEWA 5FJUA 4INFA 3N15A 1EJXC 2W0UA 5HNNA 5KSWA 3E96A 2FB2A 3NL2A 4K39A 3ID7A 3UXLA 1YXDA 2WCAA 1Y0EA 1VFLA 3LBCA 3F1QA 1A0CA 4US5A 3A6OA 3W1MA 3IIVA 1SUXA 4HMDA 1B0IA 3IIPA 3C52A 3TZFA 2J77A 5I78A 1TPVA 2PDNA 3NGJA 1DKWA 1ZP4A 3FA4A 1JCTA 4GJ1A 1Z42A 2REQB 3RO6A 3H4WA 3II1A 2ZICA 4DZIA 2PGEA 5XINA 3TC3A 3IANA 3QHOA 3CLWA 4DB7A 1IR2A 4KBXA 2GVYA 1I2QA 4J3WA 4KS0A 1H5VA 1LWIA 2X05A 4Z0SA 3R7MA 3FJNA 1KRBC 4GKLA 3FVMA 4LANA 3H4XA 1EJ7L 1BYDA 1XBYA 4JIQA 1TZ9A 4LOCA 4AD1A 2QIIA 3NO3A 2GZXA 2NVDA 4S3EA 2PLMA 5LXEA 1XYMA 5AC7A 2NV9A 1B1YA 3S2NA 4S3JA 2Y6ZA 5AN7A 1E72M 5E93A 4JKLA 4FNQA 1JXKA 3B4YA 4Z1YA 5FF0A 4NP7A 5TIMA 1DWHM 1EJSC 3RUBL 3V4BA 3KZSA 1FWFC 1VBHA 4L4MA 1QBBA 2CXGA 4POCA 5LSMA 2CETA 4KIRA 4ROPA 1LWJA 2DSWA 3I3EA 4AWUA 4B90A 4IJCA 2HMCA 2ZUSA 1F3TA 4M51A 1GEHA 4KRTA 3AUJA 3MQTA 2YDRA 2XWEA 1TSIA 3I7SA 1MW0A 1HKJA 4WEVX 1QNPA 2WZEA 3LHVA 5I0DA 4OGZA 1KKRA 3WBWA 2JKEA 4TX6A 5EY5A 1EP1A 5CGMA 1YMYA 3TW6A 2FLIA 3Q45A 4PR4A 3TW7A 3PBWA 4ZQMA 4F0RA 3APYA 2RH9A 1QPKA 2C0AA 3QJAA 3KLLA 3RXZA 1ITQA 2R82A 2ZXDA 4GPNA 2NX3A 3W2LA 3U2CA 4AZ7A 4E8GA 1TV7A 4GQQA 3N17A 2XISA 3WNPA 1QVBA 2NT1A 2WHMA 2DV0A 2PSNA 2YR1A 3OZOA 3GDRA 3GYEA 4O28A 2HE8A 5D2WA 6XIMA 3GH7A 1NF7A 1QXLA 2PDPA 1TELA 1WDDA 4JR5A 1BQGA 1HKIA 2WNZA 3GG8A 1OX4A 1JD7A 4Z2LA 4GIEA 1PUDA 5K9XA 1W2PA 4CU6A 1NWUA 5AYYA 2OWCA 2O0TA 1H3GA 3C56A 4Z2IA 2BGSA 7TIMA 5DF0A 3ZS4A 4QSHA 4MLRA 3V5CA 2XVKA 7TAAA 1ZFJA 1ZTVA 3GVVA 4NY2A 4E8DA 3IVSA 1XIHA 1LL4A 2VFFA 2JFEX 4NJGA 4IGNA 1QNOA 3M0JA 1L6FA 2O9RA 3S1XA 1E0XA 5BXSA 4ZOEA 1WP6A 3NVTA 1K4GA 1MMFA 3WMLA 1TTJA 2R14A 2XH2A 3I4KA 4HSOA 4F2TA 3UERA 1WZMA 2WO5A 4F0MA 1MUCA 1SFLA 4IGSA 3VO0A 1EKOA 4GNKB 1OSEA 1UP2A 3GC2A 4LWWA 3B9AA 3CJPA 2YL6A 3BLEA 2F84A 1OGGA 2ZZ3A 1HP5A 2BV9A 1FWRA 5EA9A 4GBDA 4A8IA 4FNTA 1KXVA 5BU6A 4KT2A 3P67A 1DWJM 4MB4A 4TX8A 2H6RA 4U10A 5DO8A 3I6TA 3A24A 1GPFA 3KE0A 4HTBA 3IUIA 3SSZA 1AQMA 3M0ZA 4G7EA 4Y9AA 1L6SA 4IGMA 3Q37A 3PAOA 4XZLX 2DQXA 1R85A 2VR4A 4XVEA 5AYZA 4JHZA 3QR1A 1PEZA 1DHPA 1LUCB 2X30A 3UJSA 4X0NA 1H1NA 4G6CA 3IV8A 3NDOA 2PUZA 2XVPA 5I3IA 2FPTA 4AXNA 2CLFA 1I0DA 3LN3A 7REQB 4QITA 4QJ1A 3BG3A 5FF3A 3BVJA 4EXAA 1KFBA 2FDMA 3LXAA 3LNPA 5DMMA 3KW3A 3SRDA 2WSRA 4IFKA 4GUHA 4P7RA 4J3VA 1IV8A 4XZ9A 1IIHA 1XD1A 1GOWA 4IIHA 4FS9A 2DZWA 3L0KA 2AMXA 4DYJA 2OYMA 4GVGA 3PNZA 3W28A 2DU2A 4FF5A 1VFMA 4CUCA 2BHYA 2C13A 3MDWA 4AVOA 3NZGA 3GDMA 3P80A 4S3CA 2CZDA 2CERA 1AD4A 2QJNA 1J0YA 2WM0A 2VUYA 1FVPA 1K7FA 2Y7FA 4S3KA 5A8PA 4OFCA 2IPWA 2BTMA 4MNKA 1FWAC 1UKQA 4PUKA 1E5NA 1GWJA 2OT1A 4RPPA 3M6DA 2ISDA 1KR0A 4PTWA 1GZ1A 2X1IA 1QW7A 4CEUC 4RE0A 1H11A 2QT3A 5BWAA 1WV2A 2PDQA 1K03A 4GYPA 2VEKA 4ZFCA 3GVRA 3OB8A 1PZ3A 4DZ5A 1SFJA 3DHUA 2G96A 3O9NA 1VJSA 3FKRA 1PWLA 2WC3A 3E38A 3C2OA 3LNMA 1E0TA 1C90A 1A53A 4XSLA 1OFPA 1UWTA 4O1DA 1OWQA 2XHYA 1WKEA 1ONXA 2QUUA 3TN4A 3NWRA 2IPJA 4DZAA 2VC5A 3L23A 4KERA 3QRHA 4IIEA 5D05A 1KO0A 4YHEA 3N2XA 7A3HA 4CQCA 1W17A 2ZIDA 3B97A 2P3ZA 5LA0A 1XL9A 4HD5A 4GI6A 1BXNA 1PSCA 1W3LA 4PUDA 3MYOA 1DJNA 3VZYA 2QGHA 2O4QA 3LHYA 3IRDA 5HUOA 2OSXA 4HTYA 3RLUA 1MDRA 1XW8A 3ICJA 4CU8A 1UH3A 1NSJA 1RY0A 2Q6ZA 4FNUA 3BW3A 3SN0A 5D03A 1QDSA 5A6AA 3CAKA 1TVPA 4AEOA 4JIPA 3S9ZA 1DJXA 3S47A 4U28A 2X0YA 4Q7NA 2VT0A 4RDZA 4C6CA 4AZ6A 1K7EA 4EIVA 3VD9A 3VVGA 4QQUA 4DUVA 4FXSA 5KEZA 5G4WA 4GH1A 4JDBA 2ZZ1A 1D8WA 3I7RA 3ZR4A 1F9CA 1U1HA 3OHMB 4EXBA 1GJWA 3IAQA 2J62A 3CM4A 1CGYA 3CZKA 4DYEA 1YIXA 2Y89A 3ZLGA 4BQ5A 1UR0A 2Y8VA 2CWXA 4DELA 3M5VA 1VF8A 3BLOA 3ABZA 3NQGA 3PBYA 1QTWA 3UR5A 1Q6DA 4RDWA 4GUFA 3FIGA 1J0ZA 4H7VA 1KXHA 3GDLA 5C2CA 2WMIA 2B7PA 2VL4A 2DT2A 1B3ZA 3O6DA 1YKWA 3ZT6A 2F8QA 1QK2A 4AZIA 3A3WA 1SFSA 1Q6CA 1HKVA 1QRQA 3T8LA 2BASA 5DMNA 1GVYA 3CYJA 3B8VA 3KXQA 4GO9A 2X1UA 3FOKA 2WSQA 4X22A 3LGGA 2CIPA 4X2PA 4ZMGA 4Z1AA 1X6NA 9RUBA 1XF0A 3LLXA 2YXXA 4NZCA 2DSVA 4ZO9A 3PZNA 2C15A 3UZJA 4AIBA 5AB3A 4WHBA 2CU0A 3W7RA 1TV5A 4ZTXA 1YPXA 3M0IA 2YXGA 2ZRVA 3AISA 1FWSA 4C7GA 3ZFHA 2BSLA 4O54A 4AHOA 3TWAA 2PODA 3T8QA 1SJBA 3O0FA 5D38A 5HBFA 3EMQA 2PI6A 5DCEA 1TMQA 4LVGA 3P14A 1BXCA 3GH4A 1AG1O 1PPIA 3PB0A 5CBJA 2PGWA 4TV5A 4URIA 3STEA 3HG5A 4RDVA 3VNLA 1XINA 4XIAA 4J9JA 3W7JA 4DWSA 2H8XA 4LJ3A 5XIAA 3DI0A 3ONBA 4GFSA 3QKZA 1ADSA 6ENLA 1UR1A 1KWGA 4EANA 2W9MA 2VC7A 2HK0A 1KB3A 3NSXA 3W38A 3WF0A 3W26A 1JPKA 3TE9A 2OX4A 5KITA 2CHRA 1GTEA 4W5UA 4Q4MA 3RMJA 1P4CA 2B81A 3KRSA 4BI6A 7XIMA 3GIPA 3G3MA 3PTDA 2F6KA 4G7FA 3LTPA 2V38A 3TUUA 1M7JA 4PMNA 1O6IA 4LNCA 4BI7A 3AHTA 1VZWA 2EJ1A 2YX0A 4LEQA 5IOBA 1FX6A 2BWGA 4C6JA 2V2HA 3GNNA 5AZ0A 3AIUA 1XP3A 2ZADA 1XDMA 3VGFA 2FVMA 5BU9A 4NILA 5FSEC 2E67A 3ZJ6A 1O95A 4JXCA 3F5JA 1OCNA 1F6KA 3NQDA 3W7IA 1LUCA 3T42A 2V9DA 5A2AA 3G1XA 1UZDA 4L64A 3IGXA 1B3WA 2CBUA 4E4UA 3W2MA 1I1WA 1B9ZA 1XQLA 1MEIA 3NZ1A 2PAJA 4AZHA 1IT0A 2E25A 2ZRYA 1TVLA 1CXFA 1JYVA 5CSYA 5H8MA 3GXFA 3N2CA 3PHAA 3T40A 1LL6A 4LALA 1EBGA 4QSFA 2WAGA 4MIMA 3F5LA 3GB6A 3NYZA 2X1SA 3KBSA 1Q6RA 1Q4WA 3DBPA 4HA3A 1XYLA 5I2UA 3GH5A 3G1SA 2B0MA 3XINA 1RP8A 2XJ7A 2JGYA 4O11A 1OHLA 1O4UA 3UXKA 1GW1A 2FFIA 4O53A 2ZUTA 1GKPA 4WKAA 4J4KA 2QVHA 4HNNA 3G1VA 2PLJA 2GGJA 4MSSA 3QLLA 4Z0JA 4O1FA 3R58A 4H41A 4GUIA 2DIJA 3WDRA 4QLLA 3AHZA 3C0SA 3DERA 3NUKA 1UZ1A 1SMAA 4I5XA 2YDAA 2OZ3A 3HFYA 2R91A 4R9OA 1JCYA 3B04A 4L4PA 4I6VA 2UWFA 4GH3A 5E5CA 1Q5MA 4IP4A 3CQIA 3VMNA 4HU4A 3GIYA 2DZXA 3U4FA 3CHCA 3UETA 4KGJA 3AIWA 1YTKA 1G4EA 2D2GA 5TNVA 1MQRA 3H8AA 4PN2A 1FFQA 2CZVA 4D71A 2NV1A 4IL0A 2CYGA 3AROA 2YYUA 2ZZ5A 4Y7EA 1FWNA 1HVQA 4IQEA 2QCHA 4E38A 3W0KA 1TPDA 2Y70A 4C6MA 2XG9A 1ME7A 1W0MA 3EDKA 5DRCA 4X3ZA 4IPIA 1K70A 1VQTA 2MUCA 3RPTA 1RAKA 2Z1BA 2I14A 1OK6A 4KKXA 2PCQA 2H90A 1Z41A 1M53A 3F4WA 5FJRA 2P1FA 3ZWSA 4FOKA 1X38A 3BE7A 4N42A 3MSGA 2PC8A 4RW5A 1W91A 4DEFA 3ARQA 4Q8OA 4HKPA 2V5KA 1ME9A 2PWDA 2QPXA 4IPPA 2GWGA 2QVNA 2HQAA 3IJ9A 1EXBA 3H2FA 1UQYA 3B8SA 4TXEA 3MUZ1 1XDLA 5CAHA 1Z6KA 4HSNA 4O8AA 4HK5A 4JTQA 4OBSA 3S83A 4LBRA 4ZBCA 1E9IA 1P7TA 3A5FA 4JX5A 3S6DA 3BANA 3L4XA 3UG5A 1UZ4A 3T0TA 1UJQA 1R46A 3OBKA 4JNZA 3AZTA 2QJHA 3A9BA 3RU8X 4RE3A 1IZJA 2PP3A 4DBEA 3N19B 3UJ2A 2PA6A 5F7UA 4TVUA 3R25A 4YN5A 3L12A 2PBOA 1W5QA 4G9PA 4DI9A 2A3AA 4P7QA 4MJZA 2I57A 4XD5A 4XD4A 1U1UA 3UR2A 3HV9A 4Q22A 1V6UA 2WKLA 3PG8A 1NDZA 4BHYA 4MKVA 4GISA 3SCVA 3L66A 4AY1A 1JAKA 1X6UA 4OJYA 2PDLA 2DVUA 1BHGA 3PBMA 2RHGA 2FTWA 4DLFA 4Q4OA 4R7WA 5CZKA 3ABRA 2ZTJA 2VD9A 2HS6A 4HNTA 4IUGA 2V3FA 1ELSA 2WWDA 4K38A 4M29A 2AQWA 2NZLA 3AZRA 3R6IA 4REQB 1JR1A 1HW6A 5BZAA 4JTUA 3LSCA 3RM9A 1BTMA 1HKKA 3R94A 3S1VA 3KEHA 3CMGA 1QW9A 5JVLA 2GSJA 2PB1A 1MFVA 1DOSA 3HIJA 4PTNA 3QHNA 5E70A 4W93A 3REQB 4J2PA 1LRTA 4ZZ9A 5KZDA 2ALDA 1XD0A 1CLKA 2C91A 3N12A 4X63A 4E3VA 4X9SA 5TAOA 4BWLC 4KRUA 3NR0A 3RILA 4A6GA 3U0HA 1V3LA 4D6GA 3WQGA 5I3FA 2WMFA 1R3WA 1EF2A 1HFBA 2XDFA 3LXBA 2E0PA 2WANA 2CCRA 3WDJA 4GXWA 4M5PA 1U1JA 1GZJA 1W1PA 1G4SA 3TAOA 2CPUA 4Q7IA 1JUKA 5DT7A 3W7MA 3NO1A 3PP7A 2OYKA 4N9EA 2WNWA 1QPRA 2J78A 1VLWA 4H00A 1GYNA 5A8QA 1OFEA 1XV8A 2X1RA 1J10A 3VYLA 3AI0A 2DW6A 3NCOA 3V18A 4ZE5A 1UHVA 4JYEA 1H0GA 3QW3A 4F9JA 4R27A 1F76A 3USZA 2Y7GA 2ASHA 3B05A 2Y88A 3G5EA 1G94A 3K13A 1HJQA 4FK9A 2ZDRA 1K8YA 4IGHA 2PP0A 3DHPA 4WY0F 3M5ZA 5C8BB 2PC4A 4LUSB 3ZVHA 4XAZA 1TB3A 2WSPA 3QY6A 1KM6A 3DI1A 4QE5A 3W6YA 4C6DA 4AX6A 1BD0A 4NQ1A 1EPVA 3SCPA 1NH6A 4FOJA 1VBJA 3U2ZA 5HQEA 1ZCCA 2D3NA 4EPKA 2HBVA 3I7QA 2X42A 3L5AA 4W84A 3I3BA 5IHSA 3GU1A 3M43A 3QV8A 3W1XA 3VC5A 2QV5A 4MGGA 2B7QA 4MFDA 3KAOA 1A5KC 3SUWA 3E0FA 1CZ1A 4JFUA 1XR2A 2DVXA 4V1YA 1UWQA 2DVTA 4ZQRA 3L0GA 5ABHA 1D3GA 4FB7A 1LOQA 3CTTA 2CZFA 4GX9A 3BMXA 1XIGA 2ACQA 3HFTA 4UTTA 3G22A 5M1TA 4K3ZA 3TIMA 2WMHA 4OBRA 5HATA 3SUTA 3EWCA 1E9ZB 1GG1A 5AYXA 2VRQA 1V6YA 4L6DA 3TXZA 2BODX 1IXOA 1ITCA 4XO7A 3TCSA 3SN1A 3W87A 4DUOA 3WUGA 1OF6A 1FDZA 2D69A 4MNJA 2QCLA 2VGBA 2VJXA 5DCBA 2ESCA 3ZIZA 4JIRA 4QP0A 3E5BA 3TA9A 3TSDA 1JGMA 2P10A 3GD6A 4I9TA 4UQ9A 4IP5A 5HJXA 3SCOA 4UNLA 3R43A 1CTNA 1EF3A 2VZSA 1JRBA 2E5CA 4GI9A 2R1MA 3UJFA 4DF2A 1YW1A 3F4NA 4Z2GA 1A0EA 2O7SA 2PS2A 1A47A 3MKVA 3PWAA 3H2NA 1HZYA 1T6MA 1MO0A 3O1NA 4Z1DA 4NZ3A 1GTHA 4AY7A 4MJMA 1OFDA 4PMYA 1KFCA 3UG3A 3WQCA 5JH1A 5PTDA 4JIEA 3T07A 4RUBA 1OGSA 1EP2A 5CPNA 2WZHA 3ZWTA 3W2UA 3MSDA 3TH6A 5EMJA 3O15A 1R3QA 3F5KA 2C14A 4MB1A 4Y2WA 1QK0A 3M0XA 1H63A 3LPGA 3H53A 3OTRA 4H19A 3VDHA 3DGBA 5BCAA 5EFDA 5CC6A 3GRIA 1KFWA 2Y8UA 4GNVA 3KRUA 5U7SA 2VNCA 2RGMA 3P2VA 4E5TA 4YCOA 4HYVA 4ZO7A 1KRCC 3NOYA 2VELA 2ISWA 3GTHA 4A8NA 4MFEA 3ZZ1A 2ZDSA 5FOOA 4RW3A 1V7AA 5M17A 3NPUA 4FMVA 4AYGA 3F2BA 3RMEA 4FXFA 3KS5A 4JN6A 1SR9A 1YNQA 4IFKB 1K1DA 3TOPA 4L6OA 5GNYA 2CESA 7ENLA 3AC0A 2OTDA 1XYZA 4YTQA 5HUPA 1X1OA 2QW5A 5F1VA 3WJZA 3HJEA 2Y5SA 5BRBA 2YFOA 3DDMA 3W84A 4XIMA 3TLLA 3W82A 1NVMA 4QDWA 5C0QA 1UD8A 1EYWA 4GQRA 4TVCA 1LM1A 4IIFA 2ZA1A 1TV3A 3D47A 4DM1A 1PHQA 1E4IA 4HMNA 4B4FA 3P8JA 4PRWA 4G8TA 3EAUA 3NGFA 3GG1A 3TAKA 3M1ZA 4WDTA 3VXGA 3VNYA 3BDKA 2VMFA 2Z7GA 5KZMA 3VIPA 5AYBA 1KXQA 4A3QA 2WMKA 4V28A 2WJEA 3CV7A 3MSRA 5C55A 1ZGDA 2PDMA 3APTA 1RBAA 3DH7A 3LMYA 2AOSA 5KTLA 1KQYA 3A13A 3ABQA 1IHIA 1LBFA 1OFAA 3IJQA 1PZ2A 3CQJA 3SDOA 1ZAJA 4XZIA 2ZBTA 3BUVA 3FJ6A 4Y9MA 5A6SA 5LXXA 3R8RA 4B2DA 1JVNA 1A5AA 1Q2SA 1JF5A 1T8XA 1E73M 3PBUA 4JQAA 4XZNX 2VVSA 3VZXA 1GVFA 1Q6OA 5DEZA 3WO8A 2JEPA 2HRWA 2P5NA 3OBEA 3CUFA 3W1AA 1BPLB 3CEUA 4A3YA 4B5SA 4JFTA 4GYFA 3HQPA 4IMAA 3FVDA 1Q6FA 3C8FA 3PR2A 4IQJA 3WD2A 4HOWA 3GVWA 2JIWA 4CNPA 4UMBA 2VZTA 1VYRA 3K4WA 4UTMA 2VQUA 2GVGA 4DRSA 3B8WA 1EHAA 4HU8A 1Q85A 4EWND 2J7HA 3NO5A 3T2PA 3EDJA 2EKGA 5I5RA 4GIYA 5F4XA 3ES7A 1PTAA 1RJRA 1NDYA 2G8ZA 3VZZA 3ITCA 4RLIA 1QBAA 4W88A 4FHAA 1HN1A 3DG7A 1XLMA 4F4RA 3QXBA 4DJEA 1V8EA 6REQB 4H9TA 1QI3A 2V30A 3G24A 2VENA 3TMLA 3QSTA 4NKCA 4PUMA 4D1JA 3HG4A 1I75A 1IYXA 4FNPA 1GKRA 3TN6A 1TWWA 4L80A 3FK4A 1GUVA 2P53A 4FALA 3H7UA 1QI5A 5AECA 1MWOA 2PDYA 4LF2A 3W01A 1E4MM 1PKLA 3APGA 1XKYA 2WPGA 3QPZA 4AYSA 1S1PA 3REQA 4BY3A 3T0DA 1ZHAA 3MVIA 2EG8A 4FI4A 3KVKA 5MKGB 1TV4A 4G56A 5AHMA 1SW3A 1JYWA 1A4MA 1O66A 4RV8A 4ZENA 4EAYA 5JIWA 3BGGA 1OC7A 4ATWA 5FA5A 2RDXA 4K7VA 1BWKA 4RZBA 1UKSA 3UZ5A 2CHNA 4E2BA 1A3XA 4ILSA 1K6AA 5E0CA 4YTTA 2QDGA 2WXDM 4LYQA 4JNMA 5DN1A 2BGNE 2BXYA 4XZWA 1PZ1A 2VI0A 2BLEA 3ZSSA 1B54A 1UQZA 3BOXA 2DZBA 1Q8JA 1TTQA 4B92A 3S42A 4PTMA 2V67A 4Y8FA 3HF3A 1PIGA 3NOEA 4H9UA 5CZ0A 4HBKA 4B3LA 3WZ0E 1LTDA 2HV5A 2W66A 4J3UA 4HPXA 1TV2A 4ORIA 3KCOA 2DSKA 3CT7A 3PF3A 5AYIA 1YNYA 1GT8A 1R7AA 4JPGA 2E28A 2J27A 1H49A 1XYAA 4HOZA 1OT1A 4X9YA 4MZYA 3CK5A 1VEOA 1EZWA 1FWGC 1EUNA 4I3GA 2ISFA 4DAIA 4UTJA 4E3TA 3KBNA 3PZIA 4GQ0A 5LA2A 1LYXA 4ACYA 3M64A 4NHVA 3ANYA 4L61A 4KWVA 3M41A 2AL2B 1UWAA 1DQXA 4AF0B 4XTDA 2OQLA 3H7VA 3ZJ8A 3P93A 1M7XA 3IARA 4TUFA 2G97A 3FLUA 4IF2A 2ZZ2A 3M0MA 3BW2A 1W56A 4G5DA 3KTCA 2WZMA 1M68A 3Q94A 1D3HA 1KFJA 2Z2AA 2QUNA 5A69A 4PB3A 3WQPA 4CNNA 1P0KA 3AICA 2KX9A 1W1VA 1XX1A 4OUEA 1FP9A 3K8LA 3W24A 3GFZA 2ZE3A 5EL1A 4QTGA 5F2IA 2A6NA 3MI6A 4QFUA 1JFXA 1TJ2A 5G2IA 4QM1A 1WDSA 1ZBKA 3N9RA 2ZA3A 5BOFA 3AJ7A 5C9WA 3TV8A 1F3EA 1AW1A 4RZ4A 4GWEA 3SCWA 1FBAA 4M6QA 4N7QA 2VX7A 5D02A 1I4NA 3B3DA 4MM1A 2CKRA 2BB0A 6PTDA 3WLIA 1R0MA 3GNPA 4MNLA 3CUIA 1PYFA 5HNUA 3FSUA 3KTSA 1TYGA 1RSCA 3VABA 2BHUA 3CHVA 1OK4A 4RL3A 3WFLA 1DHKA 4H3DA 1ZBVA 4L5ZA 4JTJA 3DAQA 1A5BA 2PTWA 4NUWA 2OCZA 1B3OA 1Q63A 1QASA 5DX7A 4HHPA 3HZ3A 2HNEA 3L5MA 5CBBA 4NXSA 4QR6A 4IMDA 2E09A 4HU3A 1U22A 2XIJA 3SY1A 1TPWA 1QPNA 4NRSA 2JE8A 5AOUA 3FYYA 4TR9A 4YXGA 4W87A 4TV6A 3O6AA 3W73A 1RV8A 2ZX7A 4EAMA 1GORA 3JW7A 1EJRC 3M6YA 4KESA 1N8WA 2P8CA 3QBUA 3LU2A 3ZYZA 5D9PA 3I10A 3CO4A 1P0NA 1NDVA 3LHWA 3L7RA 3VFCA 1MW3A 2PGFA 2OWXA 3WBYA 3H2MA 2GUYA 2JKPA 2Z2BA 3I3DA 4YPJA 1ML1A 2ZXBA 4FX7A 4M19A 3DG6A 1G4TA 1CGXA 3WK3A 1SJDA 3AS1A 1IF2A 2JIEA 2V5JA 1E4NA 4PFHA 5IDIA 3GW3A 1OGBA 3R2GA 1TPB1 3NSNA 3RO8A 2CZ5A 3SBFA 4YYFA 1EPXA 2VM8A 3LXCA 2C18A 1HG3A 4MYAA 1TREA 2AMGA 4MZ8A 1TIMA 3SRHA 3QMSA 3N34A 2ABAA 3N73A 3LCFA 4K36A 4HQVA 3RRAA 2DUZA 5IRPA 3G8RA 2V69A 1BWLA 1FKWA 3AHVA 3MO7A 5HPOA 4B15A 1PHWA 2EAWA 3NG3A 2YCEA 4EF8A 3LS9A 3EX3A 1F8IA 4KEVA 1M41A 1NEYA 4XV0A 4JTGA 2FVKA 4ZVJA 3VIHA 4R33A 1KV8A 3WJYA 2QGYA 1YXYA 3DENA 5D2XA 1EJVC 3GG7A 1WOBA 1IT7A 1PB0A 6TIMA 1I2RA 2J24A 2Z1XA 4QGCA 3MVTA 4OV4A 1UYQA 4DF0A 1KW1A 4Q6JA 3LQGA 4S3BA 3WJSA 4PA8A 1KCXA 5HQLA 3HTWA 1U83A 4O16A 4IMCA 4GZEA 1FWBC 3MYPA 1XLKA 5D09A 5BRQA 1XCXA 3AIQA 2DFAA 3LD5A 1E6NA 3CHFA 4XG1A 2PZNA 3TKFA 4DQWA 1Z69A 1R86A 4I9MA 2YDQA 1LJYA 3ZVHB 4LUTA 2V5BA 4FA3A 2CBIA 1H51A 3V35A 3C0QA 3W7QA 4AX7A 1HUVA 3MTWA 1UR9A 2B31A 3MJYA 3W6MA 3MHFA 3GXDA 2A6LA 5FIPA 3NPXA 3GE7A 1SGJA 4MDOA 1TWSA 1LLZA 4K37A 1VGAA 1HF6A 2FJKA 4U3AA 2CWNA 3JRKA 3S3GA 1QFEA 3W1LA 5AC8A 1CGWA 3CUXA 3E0VA 3UA4A 1V5XA 2RFGA 2BOEX 3CUZA 3BCFA 1RHCA 2RDWA 3S9YA 4G1NA 3SGZA 1ZUAX 1JUEA 4QG8A 4LS1A 1UD5A 1TR1A 3MV11 4HNOA 2CLHA 4ZR8A 3S2MA 1LT7A 5C9ZA 3IAPA 5KINA 1FWJC 1TCDA 2YLAA 4L65A 4JIIX 1I6NA 4HN8A 4EKJA 5CZJA 1SR0A 3MSYA 5K7JA 4AIOA 2I5QA 1IEXA 3S5OA 3B9DA 6REQA 5E0FA 1SQ7A 4WX2A 3RM8A 1QOXA 2NUXA 2YA0A 4QG6A 1XLDA 3NURA 5BWFA 1RUSA 4I9AA 5FF4A 3HQNA 1S3HA 1F6YA 4LBUA 4UR8A 2J66A 1GHRA 3VIOA 5D37A 2A4AA 3D6NA 1HGWA 2ANUA 3BG5A 5I06A 4FNRA 4NZFA 2CITA 4LF1A 2G3NA 3A3HA 2VP8A 3IV3A 4WCJA 3VM7A 2IKGA 3TR9A 1DJWA 3GXNA 4B5WA 4IG2B 2E9BA 1A5CA 4A3UA 3BJFA 4H2CA 2ZX9A 1GYMA 2E6YA 3T78A 3BLKA 4JY8A 2AQVA 5FEPA 3N9KA 3W1QA 1SYTA 3WMBA 1VS1A 1ZQ5A 2QULA 1I1XA 4XD6A 2FKPA 1UBSA 5EPDA 5KMYA 4DHGA 3EMZA 3GC5A 3CZLA 1TO3A 4ZO8A 2P0IA 2FH8A 3MP4A 1NU5A 1AQFA 4NU7A 1BSIA 3UF9A 3MKKA 4B2DD 1AQHA 2J7DA 4XTIA 3GUWA 4BF9A 1KLYA 3WNMA 3KS6A 1WO2A 4F40A 2X40A 4LB3A 2O4MA 1TE1A 2ZVRA 2AKZA 3B9EA 5FAGA 2OJPA 4NAFB 3GM8A 2XPKA 2OZ0A 5FESA 1KBBA 4KW2A 1XWYA 5AY7A 1NQ6A 2OKOA 2NXIA 3GAKA 3RAOA 3P3BA 1TJ1A 3T0CA 3A4WA 4UC5A 5H2ZA 4IP7A 5HOSA 4LFYA 4DF1A 3EPNA 1NWSA 3TYBA 1XRVA 2W79A 3N4AA 1EGMA 1GZGA 3AMKA 1AJZA 5I7GA 3NPVA 3GTXA 3T44A 4PMDA 3SR7A 5I77A 2EPMX 4UQDA 3B4UA 3N6HA 3PTMA 4C5YA 4S2CA 1TQXA 4HPJA 1AL8A 3WUFA 1LWHA 4H7ZA 4S3AA 1OYAA 3HPFA 5HWJA 4AWTA 3UYCA 4P7NA 4QJ5B 1V6TA 3LTYA 4HHMA 3GTNA 2EHHA 1AH4A 2DZVA 3R8HA 5DMLA 3JZUA 4AFYA 2GQ9A 1WNOA 4HHHA 2EPHA 1Q4NX 3P8IA 4LVFA 1FH9A 2YBUA 3VE7A 1TMHA 4KEUA 3CV6A 4CQDA 4A22A 2E5BA 3DFHA 4FXJA 1T8QA 1Q65A 3VOFA 3E0IA 4PCPA 4DBDA 3BG9A 2GL5A 1VFUA 3EB3A 1D8CA 4L9ZA 8CGTA 1EDQA 4NIRA 3CH0A 4AB4A 1XG3A 3HPSA 2XTKA 4H8VA 3LLFA 4W7VA 2QJGA 4EXQA 1QI2A 2W62A 4WJ8A 1KA9F 3S4TA 1IQ8A 2ACUA 4LUIA 5LYRA 4ATDA 2FZMA 3AYTA 3QQ0A 4A29A 3MUCA 5C2GA 1YDYA 1F4AA 4O50A 4TIMA 2BFGA 4I8DA 2NXGA 3VKCA 1CI1A 3CWNA 3PJXA 1RK6A 3M44A 2FH6A 1W5OA 3O2LA 2ZXAA 4PRTA 2OGYA 5FJJA 1R5YA 1EO7A 3PG9A 1DP0A 4LSBA 2PDUA 2E3ZA 1V0MA 3M5YA 3NQ7A 3QTGA 4K6AA 1SO3A 3GS6A 3GLCA 3MY9A 4KFOA 1OBAA 1POJA 4US5D 1L2UA 3ITOA 3STPA 1QO2A 1UOZA 2J47A 3M0KA 4XO6A 3LI1A 4GRSA 3CL6A 3STFA 2V5DA 2QCDA 4NJJA 1GONA 2D2JA 5IFTA 1OFOA 3CIVA 2A3CA 1JCJA 3E0LA 5JIPA 3WLNA 5CLWA 3AXIA 2BY2A 2WQDA 4C7FA 1HJSA 4O19A 4C6EA 2PMQA 1K02A 1RVGA 1GVEA 3NAVA 4PUWA 3UXDA 4DI8A 1ZJIA 4LAUA 3TZNA 3PZUA 1H7WA 1K6WA 3E02A 1BLIA 1KCKA 1UKOA 2OZ8A 4LCRA 4CGTA 3FEQA 1E3XA 4C1NA 3AU2A 3LI0A 1KFKA 1W1B1 2OLAA 1YTDA 3TC6A 5LIKX 3HB9A 1J0JA 4GZ7A 1XJBA 5JMUA 1RQEA 3GO2A 4XX6A 4DXKA 3N6JA 3MCMA 1KFEA 2OPJA 1NWTA 2V82A 4WOZA 3CLMA 4V33A 3RFAA 2GLKA 2VRKA 3QN3A 3SCRA 3PZ9A 3KL3A 1NAL1 3OHIA 4O13A 4Z08A 1H2JA 3FA5A 1F73A 4HVXA 4OVXA 4WVXA 3TJXA 3RU6A 5F2LA 2RAGA 2EGZA 3ANUA 1SZEA 3SQLA 1HL9A 4IFRA 3EA2A 3H22A 1J0IA 1KWKA 4HZ6A 2C8NA 5AHNA 2A7PA 3AMLA 2QLYA 3NJ3A 3W76A 2OLSA 1GK8A 3EWWA 2DPEA 1U33A 4E6MA 5I3GA 1QNVA 2PTXA 5C9XA 1EQPA 3V75A 4F9DA 4Q4PA 3ZXWA 1NIUA 2HROA 2OODA 1DWIM 1OFBA 4YTRA 1KQZA 3TQVA 4HA0A 1ME8A 1DYSA 1XLLA 4ENLA 3J7HA 2GSEA 3PK7A 1DORA 2J8GA 3WBAA 3S5ZA 3MW7A 2VXNA 2QF8A 3C2FA 2VCCA 1N82A 1KKOA 1NP0A 3AS3A 4W7UA 1ZCOA 2FIQA 2P88A 4HK7A 2C16A 3CB8A 2PTDA 3NYDA 2OOGA 2PDFA 1P48A 1CXKA 3G1FA 1V51A 1FCQA 3WIJA 3N11A 2QMJA 4CD4A 4WXYA 1Y65A 2IQ0A 4LYRA 3FJ4A 4UZUA 1JDDA 2OSYA 4D8ZA 2POZA 4Z2JA 4F3HA 4WR3A 4BEUA 3MI2A 2E5DA 1H7XA 2VWSA 2YL8A 1NY1A 1P1XA 2XINA 1X1ZA 1B30A 2I5GA 4NNAA 2ZUNA 1G0CA 3Q67A 1MXSA 2A3BA 5CXPA 2F6UA 3QGVA 3UVAA 2W4XA 4GO8A 2ZCGA 3QZEA 4LRSA 3O63A 2NSXA 4P2VA 3CWHA 3NTYA 1EQCA 1ZPTA 4RDYA 3OLGA 1XM3A 3W72A 3TXVA 4F0LA 3VIFA 4Y9NA 2X09A 4Z17A 3EPOA 3NQ8A 4KFNA 1S2WA 3NXFA 1EC7A 3L4UA 3W7KA 5CPMA 2DH3A 2OZTA 1VIZA 4PMUA 1E1EA 3M0HA 2QF7A 1HQTA 2J79A 5HANA 2A7RA 4UFMA 5I02A 1B3YA 3W02A 1OIFA 3WLHA 1YRRA 3GDTA 3C8NA 4LVDA 4XBKA 4EVZA 3KOFA 5E6YA 3HQ1A 4UR9A 2VGFA 3WLSA 5A8MA 2IW0A 1GQNA 4P8XA 3UVIA 5FJPA 5ECVA 4IH3A 3Q2DA 3VU2A 4AIUA 3MO4A 5AVHA 1TA3A 1LBMA 4OOUA 4QS5A 3LZ3A 4RX0A 1IE7C 2GOKA 3NQBA 3TJIA 3A12A 3MHUA 1FFRA 3RPMA 4JTIA 1NFPA 2A85A 1DIKA 1KC7A 1YE4A 3TW9A 2A21A 3AS2A 5FI8A 2VEGA 1X6LA 2D22A 1A5UA 5LGZA 4CD6A 3A23A 2WJZA 4GC3A 1RLDA 5GNZA 3PJUA 2ODOA 3AIEA 2VURA 4WRHA 7CGTA 3THCA 2WCGA 1X96A 3K2GA 4IFOA 1LROA 4QISA 2HXTA 1TRIA 3N1AA 3WH6A 2QR6A 1CX9A 4PYSA 3FS2A 3SN4A 4LPCA 3MMTA 5A6BD 2HS8A 1W9DM 1A49A 5T9CE 2ZX5A 1B4KA 1SZGA 3GNDA 4H6KA 4CU7A 3BICA 1HL2A 2OEMA 2XZ9A 1DIDA 2H9AA 1WXYA 4AXKA 3AO0A 1JZ6A 5REQA 4Y9OA 3KTXA 5ABFA 1XFCA 3DFTA 4AVNA 3WJWA 2XIOA 1P0EA 2HVMA 1VD6A 1UD2A 2RGLA 3DFPA 1HNYA 4H8UA 5C5YA 1NWRA 1J5SA 3UNTA 3ORWA 1C7SA 4DBWA 4Q3MA 4N4PA 1WB0A 1PX8A 3QMRA 4O57A 2A7NA 1R6WA 3AALA 3H21A 1M3UA 1M7PA 1W5MA 3ISIX 4JTSA 4QLJA 1WA3A 5D30A 1TWIA 3LZ5A 3OZMA 1JQVA 3N2BA 1XUUA 5HAOA 2GWNA 4BEQA 4WDUA 3WH5A 3S6OA 4LBSA 1VRXA 4YU1A 1TPC1 3CMFA 1KGUA 2Z4GA 3WSUA 2HVOA 1UR2A 1TUFA 3SY5A 2QDHA 1FHLA 3IIOA 3P6LA 2VWTA 3OZPA 3JVAA 4IICA 2C71A 3WD3A 4RCXA 2Y7EA 4XKYB 4DUXA 1ISVA 2Z00A 1Y5VA 3JZEA 4H01A 1UBPC 2JBMA 3EOOA 3ALGA 2DJXA 3COTA 3CGTA 2J7FA 4I9JA 3WLJA 4YVVA 4IQDA 2J75A 1K77A 3BLPX 3JUGA 1DJZA 4CCEA 1QNSA 4HZMA 1IIGA 3N6QA 1PTDA 3DHDA 2OMAA 3WLTA 4W89A 2C6QA 1W1YA 5ABGA 3AXKA 3HU7A 2ONEA 5AVNA 2G3MA 2QCGA 4DIAA 3CAVA 4B5XA 1SU5A 3K8MA 2OQHA 3R12A 2F6XA 1F74A 3W7HA 4TVDA 1OZQA 4CVUA 3N25A 3S1WA 3KBMA 1UWSA 2Q3OA 3UW6A 3EOUA 2OEJA 2XZ7A 1W1ZA 3UBPC 2YBTA 2WQPA 1UW9A 2V0TA 1XLBA 3MA8A 2E1WA 2XH7A 5HWNA 3VNMA 3QC0A 3UWZA 1BSLA 4US6A 1JGIA 2WZTA 5F1UA 2QNEA 3RLVA 5LNRA 1PKMA 3PUOA 4GI8A 3CL7A 5AHEA 5D8ZA 3LK6A 3PZGA 3TWBA 3KUMA 1PKYA 4G2DA 3M0LA 3L4ZA 2HZGA 2V5LA 2Q09A 3VCCA 5CZTA 3UR7A 3TNOA 3DFOA 2FGZA 4LEFA 3LHTA 1MFUA 3HGSA 1J18A 1XLGA 3TMQA 5IXEA 1UUQA 2RUSA 5KZEA 4H8HA 3BAKA 3VTRA 3UPMA 4TTGA 4ML9A 3SRKA 2ZWYA 5A3HA 1ISYA 2OO6A 4Q4RA 1L6WA 3WFZA 3FX4A 3USBA 3CZJA 3GR4A 3L4WA 2NWSA 2WMGA 3L68A 1RZMA 3TYDA 3VKBA 3KHJA 8A3HA 4QRNA 2Z6IA 4M7TA 1W1A1 4NAFA 3OP2A 3R0UA 3HQOA 4QS6A 4L1XA 1E56A 3AFBA 1MI3A 4CQAA 4IX0A 3ARSA 1ZL1A 1F3WA 4AD3A 4JX4A 1E15A 3FKKA 1FWHC 2WYSA 4NI3A 4BJHA 2FHCA 8XIMA 4GIRA 2PF0A 2Y0FA 4AIEA 2OB3A 3E74A 3W3OA 3QHMA 1OZMA 4ICMA 4V1XA 3GNRA 3THDA 3VIJA 3QV6A 4A3HA 1AMYA 2XH4A 1MQPA 1W37A 4HPNA 3OVRA 4CN4A 2E1DA 4JTHA 2CW6A 3W1NA 3LRKA 3I65A 4K1GA 2OQYA 2XIMA 1TZZA 2VGIA 4ADSA 5K3VA 3TQPA 3G2GA 1D2KA 4O1AA 1CWYA 3VKJA 1JDFA 1GEQA 3BLDA 5FJOA 5TBOA 3VDBA 4PUNA 4ZQOA 5DY2A 2ZA2A 3FSTA 4LVAA 2WBKA 4GCXA 4L4LA 1UPPA 3B8DA 2NVCA 5MF5A 4J40A 3LCGA 1MW2A 4L7ZA 1TE6A 2PWHA 2QEZA 1SW7A 4KRZA 5A8GA 2I1OA 1H7PA 1B3VA 4QROA 1JDCA 3IJ8A 1VFTA 4X2RA 1XRFA 1WBHA 4AHPA 3EX6A 4N4QA 2B7NA 1L6YA 3O3RA 5MKGA 4HSHA 4K68A 4HN4A 5K2ZA 1OCJA 1VFFA 1CEOA 4XKMA 4IISA 1DJYA 3MHGA 1LOLA 1IEIA 3A21A 4BA0A 3INPA 5LIUX 3ZT7A 3W2JA 5AC6A 3RLGA 1OX4B 4PB5A 4H9MA 1IEWA 1C93A 3H55A 3O6YX 4I5UA 4Q4KA 1K9DA 1YDNA 4BKNA 1R9ZA 3CYVA 4JN8A 3R11A 1RBLA 1IR1A 1IWPA 4JZ5A 4DN1A 2G95A 3TYUA 2J8FA 4C6PA 3PPHA 3BQ5A 3UCQA 5LNSA 4U33A 4HNLA 2QKFA 4IHCA 4BQ2A 4MJ2A 3SSJA 1XSJA 3M46A 2ABBA 4DUWA 3W7EA 2WBGA 3EXTA 3EWYA 1WZAA 3S6TA 4OU1A 3B03A 4LAMA 4IOTA 3URNA 3D3AA 1V3HA 5AHLA 1MZHA 2DIEA 2AAMA 4ICCX 4LYKA 4QLKA 2H8ZA 3S1GA 4B5NA 1RXOB 2V3EA 1M01A 3UZXA 1Q66A 3DZ1A 3UGVA 1OYCA 4RZ6A 1CT5A 2E68A 3GTIA 2DT0A 5EBUA 3E2QA 4CEXC 3M0VA 1Q7ZA 3LENA 1DEDA 4PMRA 3AHXA 1F05A 1WKFA 2VTFA 3CB3A 4C7DA 5J04A 5D4YA 1NP2A 3POCA 1E1CA 3LRMA 3PS7A 4W4QA 2Z1SA 5HXMA 5FJTA 1C9DA 3S46A 4WF7A 4H6EA 1JAEA 1QR7A 2ON3A 5HK4A 3M16A 2DSZA 1A0DA 3WF3A 3IJIA 7ODCA 3SGGA 3KVJA 5ABEA 3IJLA 2PU0A 1WDPA 3H7RA 4PE8A 5U4NA 3FGCB 3NDZA 4NASA 4NJHA 3FFSA 1PBGA 2PWEA 3UWYA 1XLJA 3IGHX 1H5YA 1BVZA 4I7WA 4QQ3A 1O68A 2PD9A 2Y7DA 1R2RA 3UQNA 1PIFA 1IEVA 3I4EA 4IJBA 3N3MA 3RR1A 3BLIA 2UY3A 3A47A 4Z1CA 4H1ZA 3NZQA 3RF9A 3ZM8A 2LLEA 3ZJKA 4D2JA 1Q8AA 3DC0A 9CGTA 3IIZA 4L1WA 2QDEA 2PDIA 1X7FA 2WLYA 4X60A 3ZT5A 3C61A 1JPHA 2FB3A 4HNCA 3N13A 4LH8A 1JIBA 4R9XA 4QHRA 3R10A 3DC8A 1ALDA 3SFKA 4Z42C 4JQ3A 3NQCA 3LPPA 1XIEA 4Q6XA 2QYGA 3FW6A 4MADA 3SQSA 3ZVIA 1R87A 2P8BA 2PP1A 1U5HA 1BFNA 1CECA 3VE9A 3C2EA 1P7TB 3WQEA 3LQLA 3WF1A 2D0GA 3E5PA 4PSRA 4B9ZA 5I3HA 3LHUA 4HZ7A 2P50A 4JFVA 4J7RA 1XUZA 2GJXB 2R9RA 4IX2A 3GXMA 1THFD 4KPLA 1EC9A 2B7OA 4LXFA 3ITTA 2NVAA 2YLLA 1OVDA 3LTSA 1KTCA 3UZWA 2HPMA 1CPUA