1FH9A

Crystal structure of the xylanase cex with xylobiose-derived lactam oxime inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-XYLANASE
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh9A00
1M03A 1NH6A 2BHYA 1X6NA 3ARWA 3W28A 1J0YA 3AIRA 1QOXA 3W82A 2Z1SA 5EFFA 3T09A 2ZX8A 1UZ1A 1E0WA 1E6NA 1DWFM 2ZX6A 1HXJA 1KQYA 1JDAA 2WMKA 1D2KA 2WVVB 1XD0A 3ZT6A 1JZ8A 1GOQA 4JAWA 4WJXA 2VX4A 3WH5A 2BXZA 5LA0A 4GI6A 4M56A 3WD0A 4X9YA 3WH9A 3MUIA 2BY1A 5CQ1A 1G9HA 3PZQA 1YQ2A 2J7DA 4W8BA 5A6MA 1VAHA 2C0HA 5HPCA 2HVMA 1US2A 3VGHA 5CPSA 1OM0A 1BHGA 1ISXA 2O9OA 4PTXA 1WB0A 1UKPA 3E1F1 3GH4A 5D8ZA 3APGA 4QLLA 2AMGA 3W53A 4P8WA 2DPEA 5LA2A 1QI4A 4Z2KA 2OSWA 4A3YA 6TAAA 3RDKA 4AZ5A 1HJWA 4AZCA 1WP6A 2A3AA 2WLYA 2XIIA 3PZ9A 4E8DA 1GQKA 4UOJA 1ZL1A 2DSUA 3MS8A 1JAEA 4YHEA 1FA2A 3AXIA 1JL8A 4LX4A 4KRUA 3WH6A 2G3MA 2JF7A 3WQ5A 1OD8A 5FOOA 5A95A 2QLYA 4PMDA 4P7RA 4AEEA 5M5DA 3TONA 3SCQA 3KL0A 3SCRA 1JZ7A 5DMYA 1KCKA 3AS2A 5DFAA 1LWHA 4W8AA 4WF7A 1VBRA 3ARRA 1QBAA 4AD0A 4R5EA 1I75A 1LLOA 3TTYA 4EK7A 2Y4SA 1NP0A 3A47A 1QW8A 4GQQA 1E6ZA 4OOZA 3ZR6A 1JZ3A 1C91A 1CGWA 3K4DA 1E4NA 4CN1A 4CD8A 1X6LA 1GJWA 3VD7A 3WNMA 3PZMA 3VDCA 1NWTA 1KXQA 4AD5A 1KXVA 2E4TA 3OZOA 2CBJA 4DUWA 4AD1A 3MANA 3RMEA 2EJ1A 1JXJA 4FLSA 4CU7A 1CZ1A 4B9YA 3F5JA 1GHSA 3WF0A 2UWFA 4OZOA 2WZEA 4N42A 4Z2LA 1JD9A 4W5ZA 3VOCA 3CZJA 1WZKA 1UR0A 2J8GA 1E15A 4AYSA 5CGTA 5HXMA 4TX8A 3L4VA 5E09A 3AHVA 1HJUA 1JNEA 2CEQA 4DWSB 5FCZA 2J79A 1UKQA 1RH9A 3T2PA 2ZXQA 1XSJA 2YL6A 1C7TA 1RD6A 2CHOA 3IAPA 2YLAA 3WY1A 3RO8A 3ZJ8A 1VFFA 1FH7A 3TP4A 3VD5A 1V3KA 1C90A 4HPHA 1NWRA 5FL0A 1HKIA 1CXLA 1TVPA 1NP2A 5AC5A 1WE5A 3LPPA 1BFNA 1KWKA 2V5DA 5AY7A 3EDDA 1B3VA 4ATLA 4U3CA 3U7VA 3PZOA 3AIEA 1HJSA 5KEZA 5IFPA 1ZU8A 1MXGA 5I24A 1EOKA 3A3HA 2ZXDA 2QPSA 1EXPA 5CLTA 1VRXA 3UCQA 5AYBA 1EO5A 3RM4A 4HMCA 3RIKA 1G1YA 1B3XA 2DT3A 3VDAA 4HA3A 4H8VA 1NWSA 1E5JA 2VVSA 3F5KA 3D3AA 1CECA 2J7BA 2DDXA 4W8LA 2CNCA 4TUFA 5HNNA 2VZUA 1HL8A 4ATDA 4OUEA 2OWWA 2YL8A 4GINA 3KZSA 4F66A 4MNMA 2VT0A 1B3WA 2VRKA 4JFWA 4A3HA 1VB9A 1B31A 3VX1A 2VURA 2WC4A 4PMOA 1K9EA 3MUY1 2ZX5A 2EPNA 3VMNA 2G8ZA 2JFEX 2ZXAA 5CLWA 2WCGA 4CCEA 3T08A 3VNYA 4AZGA 3UG5A 2PBGA 3WNPA 4D6IA 2NT1A 4EANA 1W2PA 1QI3A 1WNOA 5A94A 3WUGA 1VFMA 3NIYA 2Y24A 4HMEA 4MADA 2W66A 5TD4A 3TTQA 4UQBA 1NQ6A 3BAXA 4V28A 2YOCA 1GOWA 1OT2A 2JIEA 2WXDM 4PCSA 4HOXA 1B30A 2EQDA 2A3CA 2OSXA 1JNDA 1EDTA 1XCXA 2J4GA 2BHZA 4HZ8A 1GVYA 1JXKA 1QHOA 2DSWA 2WVTA 2Y8VA 3VUPA 2J7GA 2WM0A 3PZGA 2AAAA 4GO8A 2PWGA 1CTNA 3WUFA 2E3ZA 3PZTA 2XFYA 1U2YA 2EO7A 3WDQA 1JFXA 1TA3A 4BF7A 3L4UA 1V0NA 3VGGA 2CHNA 3N12A 2CESA 3WDJA 3I3BA 4UQEA 1R7AA 2CPUA 2ZWZA 3EDJA 2XUCA 3ZOAA 1TR1A 1UR1A 5A1AA 5F7UA 1UD6A 3VD3A 3QHNA 3B9AA 1JD7A 2D3NA 1UR2A 2DSVA 2W5FA 2BNJA 2GDVA 1CXHA 3OLGA 1W32A 1M7XA 1GCYA 5D9OA 3DYMA 3BAKA 3GBDA 1B2YA 2VX7A 1CGUA 4J28A 2ZUWA 5A6JA 1XRVA 1G0CA 5M03A 3WIJA 3AIBA 4PMYA 2F8QA 1GW1A 2NT0A 2VCCA 3UR7A 3CHFA 4ACZB 1MFVA 3VO0A 3W27A 2WHKA 3AYSA 2WYSA 2ZX9A 4UZUA 1E4LA 5A6KA 2VZSA 4HZ7A 2YLLA 3AJ7A 1CGYA 4AZHA 1XC6A 1HJXA 1ZB5A 4AISA 3VGDA 3AXHA 4PTMA 4WSKA 4J3UA 3WENA 2E8YA 2IUZA 4UZSA 4Q22A 5AYIA 3OLEA 4W5UA 3VMOA 3WF3A 4P8UA 4TX6A 2D2OA 5I5RA 1TUXA 4AIOA 1GZJA 4MAVA 1G01A 4BQ5A 1Q6CA 2VO5A 2WB5A 3ARPA 4OIFA 1YHTA 5A8PA 4ZEPA 4D6DA 1HP5A 2FGLA 4LYPA 4E8CA 4GI9A 2V3DA 4GZEA 2VQUA 2WVSA 3AIVA 1V3LA 2OSYA 4D6GA 2FH6A 5A8OA 5M17A 3ZJ6A 1V6VA 4U5IA 1UA7A 4MB3A 2GFTA 1QVBA 4H41A 3PN8A 1XH1A 3ZT7A 2CBUA 3FAWA 1HKKA 3VILA 4UFMA 1J11A 2D0GA 2Q8XA 1KBBA 3CHDA 3AXXA 1CXFA 3UERA 4D71A 1IZJA 2J47A 2YBTA 2GJXB 2RGLA 3UG4A 2DH3A 3PBGA 4LPCA 4PMUA 5E6ZA 1CLVA 1DTUA 1BPLB 3PHAA 2CCRA 3VIHA 1KR1A 1XD1A 4UOQA 3WL1A 3VNZA 4PMXA 1UR4A 2GJPA 1UH3A 4CN4A 4UCFA 1GOIA 3BAIA 4FLQA 3CUJA 4M24A 5BCAA 1BAGA 3ECQA 4CD4A 2ZOXA 4WKAA 3IK2A 4MAZA 1W9VA 4P7QA 3AMGA 2W61A 1FOBA 2CKRA 3AHZA 4JKMA 4CGTA 4UOZA 1UZ4A 3CBWA 4W87A 1UR9A 1G5AA 1KR0A 3A4XA 4UFJA 3BAJA 3CMGA 5JBEA 3LMYA 2WPGA 4W89A 4CD7A 4MNLA 3GNPA 8A3HA 5I77A 2X8RA 3GNOA 1OINA 4AZIA 1Q6FA 3PZIA 1QNOA 3N9KA 2D24A 3UESA 4WSJA 1GVIA 3DYOA 4UTFA 4AIUA 4NI3A 3CH9A 5A6LA 4AXNA 3CO4A 5BRQA 4M29A 5EFDA 3DHUA 3IJ7A 3N18A 4KH2A 4WKFA 2VJXA 4N0RA 2VR4A 1MXDA 4UR9A 4AMCA 4LXFA 2X0HA 2YDSA 5JIWA 1BYBA 2D22A 3ZIZA 4ZENA 1J01A 1H3GA 4GXPA 2V3EA 1WDPA 4GZIA 5E9AA 3VGFA 3ARTA 4L4OA 5A6AA 1EO7A 3DYPA 1JF5A 3BAWA 1FP9A 2XWDA 5I2UA 4QCEA 4CCDA 4PMQA 1GHRA 3MUZ1 5GQBA 3U5YA 5JUVA 2OLHA 2WANA 3B8SA 4FMVA 3AICA 2V38A 3MMWA 3VD9A 1JI1A 2FHCA 3WQVA 2WHLA 2WC7A 8CGTA 2E9BA 3RILA 3WDRA 1OCQA 2JEPA 2WZIA 3BCFA 3W24A 4AZ7A 2BS9A 3NDYA 3WQ6A 1UWRA 1QHZA 1J18A 1JF6A 1MVYA 1ZBKA 4PMZA 2PB1A 1I1WA 1KQZA 5LYRA 2V3FA 4AD2A 5JBDA 4AWEA 1OBAA 2WMIB 4JFSA 1U30A 4DUVA 1VEOA 3WMBA 2D0FA 2PC8A 1VEPA 3W6MA 4HOZA 4NRRA 1JFHA 4P7OA 4Y7EA 1GQIA 3KL3A 1KGXA 4B9ZA 2WWCA 2GJRA 2E40A 1CXIA 5D9PA 3WUEA 3MV11 3GM8A 1MW3A 4GI8A 4YN5A 5D9NA 4B3LA 5FD0A 3CUHA 3IAQA 4LGXA 3FHAA 3QOMA 3ARUA 1BLIA 3OB8A 1PPIA 3WEZA 1UWUA 3ZM8A 4QFUA 1UKTA 2ZX7A 3PTMA 5ECUA 1AVAA 1QNPA 4EAMA 3TTOA 3WDPP 5BXRA 1HVXA 3BLKA 4OBRA 1J0KA 1OD0A 1NWUA 2XVGA 4AIEA 1E6SM 3CLWA 1H4PA 1GORA 1QI2A 1UWTA 1PX4A 2VVNA 3AS0A 2XPKA 4U2ZA 4V27A 1L8NA 2A3HA 1W2VA 1OB0A 1KXHA 2J7FA 3CHEA 5ABFA 4CKQA 1FFRA 2XVKA 3WFZA 4UNIA 1ODUA 3VMPA 3L2LA 3THCA 4YHGA 1OGSA 1GNXA 2WCAA 2XHYA 2YKKA 1E1EA 4KGLA 3QHOA 3BCDA 3VDHA 3GYCA 3WQ4A 1W3JA 1LWJA 2PWHA 3A6OA 1V0MA 1V0LA 3FW6A 2EPLX 2F2HA 3BMWA 2DQXA 3GBEA 3BH4A 3W37A 5IHRA 1XCWA 1TA3B 2Y5EA 1XV8A 2BY3A 1Q4NX 3IJ8A 2XM2A 1FHLA 3N17A 3L4ZA 1PX3A 4XX6A 4PUDA 4HPGA 1AMYA 4PEEA 4QLKA 1NOFA 1QW9A 1JGIA 1MW1A 5C71A 1FFQA 2B31A 5GNZA 1HX0A 3AMDA 3GZAA 2DEPA 1TMQA 2MANA 2XG9A 4CVUA 4HMDA 3AYRA 3VIOA 4CN6A 2VZOA 3FAXA 4PTWA 1C8YA 1LL4A 1J0IA 3M07A 1DWIM 2FDMA 3WF1A 3FN9A 3AIQA 3AZRA 4D6FA 3ZSTA 3AS1A 2YL9A 4UFHA 3A4AA 2XGBA 3QOKA 5A8MA 3TOPA 4D6CA 3MU7A 2WVVA 2J62A 3O6AA 1H41A 4X0NA 4AD4A 1HNYA 3VINA 2J7CA 2ZWYA 2XSAA 2O9PA 3ZQ9A 1UR8A 1EHNA 3B9EA 2WBGA 1ISVA 1ZJBA 2NSXA 2ZUSA 3MKKA 3LPFA 1JDCA 1Q6EA 3SCPA 1JDDA 3CIVA 1PEZA 3QR3A 2VCBA 4S3JA 4U5KA 3GXDA 5DEZA 1JZ6A 3PZNA 3VDBA 3EBVA 2UY3A 1V0KA 3W0KA 4C7FA 3TA9A 1M01A 1DWJM 1MFUA 3QHMA 1Y7VA 4HP5A 3M6DA 2GSJA 4MJ2A 2IXVA 2JALA 1BYAA 3WELA 1BTCA 3RJYA 1NOUA 5EMYA 3T0DA 1GPFA 2EEXA 2ZIDA 3WUBA 2PF0A 1ISZA 2E0PA 1P6WA 3ALFA 4TVCA 4AEFA 4YPJA 3WF2A 1W9XA 2ZXBA 4Z2JA 4M81A 1E6QM 1M53A 1CYGA 1EDQA 1VJSA 4UQAA 1EH9A 5CJ5A 5E6YA 2ZUUA 3W6LA 3SIMA 4NZCA 1XSKA 5BXSA 2JE8A 4GZJA 2QV4A 1QHPA 2YJQA 2WHMA 4MDOA 1LQ0A 2GK1B 1B3YA 4J3TA 4ATWA 4CD5A 3CGTA 1Q6GA 1BVZA 1Q6DA 3TTSA 1AQ0A 5CSUA 2ZICA 3WNKA 4MB5A 4X0VA 4C7DA 3VIIA 4D1JA 1BYCA 3WNNA 3NDZA 4JFVA 5CGMA 1J9YA 1KGUA 2WKGA 2YA2A 1B1YA 2O9RA 3N15A 4DWSC 4FF5A 1CWYA 3MV01 4WIWA 5CXPA 5GNXA 2QPUA 3POHA 1CGVA 1UD2A 3WD1A 3GNRA 1FP8A 5JIPA 4URIA 1WCGA 4UFKA 4AZBA 1KWGA 1R87A 1D7FA 2XSBA 4CU8A 3W25A 1EOMA 1CXKA 3SCOA 1J10A 2VCAA 2J75A 4W88A 1CGTA 2WZHA 2JF6A 1JZ2A 2EBNA 1H2JA 1E6RA 3SCTA 3WMCA 1IT0A 2G3NA 2VTFA 3HU7A 2XWEA 1NARA 2VUYA 3SUUA 1E6PA 4PRWA 2WMJA 5HDRA 1E3XA 1FH8A 2WHJA 3VVGA 5BYWA 7TAAA 5I78A 4UFIA 5CSYA 5BROA 3AIUA 2VRJA 1WAWA 4J3SA 4D6JA 4M1RA 4DWSA 3EYPA 1JYWA 1BG9A 3NJ3A 1UWSA 2VX6A 4MTVA 2GUYA 1W3HA 3WEOA 2VNCA 3IANA 3NUKA 3W4RA 2JEQA 1C93A 2WMGA 2YA1A 1R85A 2G4FA 1TG7A 1UOKA 3VIFA 3MO4A 1RP8A 2GDUA 2J7EA 1EGZA 2O92A 4OJYA 2DSKA 3EDEA 4D6HA 3ALGA 1V6WA 3OBAA 3VGEA 2CKSA 1W1TA 2WMFA 3AHTA 4RE3A 1R8LA 1FH9A 1WZLA 5IFTA 1WPCA 1J0ZA 1WKYA 3SCUA 3GH5A 4PMRA 3RM9A 4H2CA 3L4XA 3OGRA 4JKKA 3F5LA 1BSIA 2XFFA 2F61A 1EQPA 4AZCB 3WNOA 3M46A 3WH7A 1ITCA 3ARXA 1U33A 2XVNA 4IISA 4JHOA 1FHDA 1BGAA 2PWFA 4JL2A 5A3HA 1K9TA 1UD8A 2VOTA 1WZMA 2BVYA 1CPUA 4OKDA 1ZJAA 5D9MA 3VIMA 1HJVA 5DT5A 3AS3A 1L0PA 1LG2A 1OWQA 2D23A 3VD4A 2X2YA 1MW0A 3BSGA 3AMKA 4M82A 1O7AA 3L4YA 5A6BD 3NSNA 2X1IA 1J0JA 3EMZA 2G3IA 4AD3A 3UR8A 3DC0A 2YDRA 2YIHA 2BY2A 4IUGA 3MMUA 2WK2A 3M7SA 3K1DA 4IPNB 1SFSA 3RJXA 1PZ2A 4B3KA 1GONA 1IZKA 1MYRA 1E4MM 3U7BA 2YA0A 3WDIA 5I0DA 3POCA 5IHSA 1E70M 1US3A 5I6SA 4EE9A 1E4IA 1C8QA 4CUCA 3ARVA 4GQRA 1W9PA 1CGXA 4UQ9A 1JZ4A 4PN2A 4PCTA 1QNQA 1KXTA 2VRQA 1E55A 3AQUA 5JBFA 5HPOA 1R86A 2VX5A 2OYLA 1ZBWA 2CXGA 3CUFA 4D1IA 1RPKA 3DECA 1S46A 3O2LA 4K68A 4BA0A 1RP9A 4MB4A 3AISA 3D5HA 1VEMA 4AY1A 2ZUTA 5A8QA 1GOMA 4AZ6A 3KWXA 4BQ3A 3FHQA 4FLOA 2EXOA 1X1NA 1TZ7A 3WD3A 2CIPA 3MUAA 3CMJA 3K8MA 2WMHA 4H04A 3AHYA 3WD2A 1XH2A 1MQQA 1TCMA 4W7UA 1K6AA 1AQMA 1N82A 2CETA 1PJ9A 2XVPA 5BXPA 3LPOA 4QLJA 2QMKA 1EQCA 5HBFA 3J7HA 2FH8A 1PIFA 1V6YA 3WQWA 1V3HA 3FXYA 1UD3A 3SCSA 5CZKA 1V08A 2OYKA 3ZMRA 4IPLA 1ZS2A 5A69A 1DHKA 2GVYA 1A47A 2J78A 5A2BA 2DGAA 2WNWA 3CHCA 1QI5A 3OZPA 1ESWA 5DF0A 2CBVA 2W4XA 4TTGA 1NM9A 5A8NA 2YDQA 1ITXA 1ODZA 2V5CA 4ACZA 5GNYA 1B3ZA 4PBGA 1JYVA 2Z1KA 3SUTA 2FHFA 4W7WA 2WCSA 3I3DA 3CZEA 3OG2A 3T2QA 6CGTA 2OWXA 2EPKX 1HL9A 2E8ZA 1BF2A 1V03A 3OIHA 5I79A 4HA1A 1R7OA 3WL0A 4A4AA 5DT7A 1V6XA 2WVUA 4P7NA 3WSUA 3VIJA 2X0YA 2EPMX 1IV8A 4H8HA 3WDHA 4TTUA 5IDIA 4CCCA 1LL7A 3EDFA 5A6BA 1XGZA 5BXTA 1HKMA 2W62A 3SUVA 3ZSSA 4S3KA 4JZ5A 4W84A 2ESCA 4RL3A 1OIMA 2XYLA 3N04A 1QNRA 2DT1A 2DIJA 1E0VA 4NRSA 1KBKA 5IXEA 4CU6A 3ZR5A 3WQ8A 3OA5A 5FL1A 3SEPA 4M8UA 1CEOA 4Z2HA 4ZE5A 3LPGA 3VM7A 3PTQA 2VI0A 1GOKA 2X05A 1PBGA 3CUIA 1W91A 2Y2WA 3SCVA 2A3EA 1TFVA 2YBUA 5CPQA 3ZT5A 3G6MA 1UWIA 5ABGA 2GJXA 2V3GA 1UKOA 1UQYA 4NF7A 1UUQA 1H09A 1QNSA 1CLXA 2VC9A 3VIKA 1EHAA 1WDSA 1HP4A 3VM5A 1VENA 4J3WA 1UH4A 3SCWA 4HU0A 4P8XA 2WC3A 4HOWA 4H8UA 4R27A 2WWDA 1LJYA 1XYFA 3CZKA 1E6XM 2DT0A 4D6EA 2XVLA 2PI6A 4ZXLA 4U3AA 4BS0A 3OGVA 5D4YA 3B9DA 1B9ZA 3K46A 1GQJA 1C8XA 3BAYA 4F79A 4F9JA 1CIUA 4XZWA 3RM8A 1QBBA 4JCLA 2X09A 1ZBCA 2DH2A 4WKHA 1GJUA 4RE4A 1WO2A 3VKKA 4GKLA 2W67A 2VQTA 1E43A 2PWEA 2O9TA 1EIBA 3KE0A 1D3CA 1HVQA 5E70A 2YL5A 5A2CA 5M3WA 1H1NA 2QHAA 1UD4A 3BC9A 4Q7NA 3CTTA 4LQ1A 5LA1A 3AFBA 3WMSA 2D3LA 4UQCA 3WNLA 3MSDA 2UY4A 4PMVA 3VIGA 4ZE4A 3VPLA 3PZVA 4JHZA 3A4WA 1HIZA 3HN3A 2WLZA 1OSEA 4MDPA 1W1VA 1DWHM 4H7VA 2BFGA 1BYDA 2E9MA 1UKSA 3W29A 2AOSA 2ZUMA 3KL5A 4DWSD 3CZ8A 4J27A 2C7FA 1UH2A 4DUXA 3WBEA 3NYDA 1VFUA 1E72M 4AW7A 2BVDA 5I3DA 1XYZA 1Z32X 4JL1A 2J7HA 2WAGA 1UD5A 4MB1A 1VJZA 4BCEA 4JFUA 3DHPA 2D1ZA 4MNKA 3WN6A 1LF1A 4DM2A 5A6SA 3IJ9A 1UG6A 1O6IA 2CITA 1UHVA 2D20A 1HJQA 3OLDA 1F4AA 2WSPA 1DP0A 5FIPA 2ZE0A 3G6LA 1SMDA 3BLPX 4QDMA 1G94A 1JYXA 3GH7A 1BVNP 5EB8A 3MSGA 1V3IA 2G41A 2WMIA 4TOQA 3O9NA 7CGTA 1JIBA 3UETA 1OIFA 1V02E 4MJ4A 4TXEA 3ZO9A 3W38A 3WF4A 4E2OA 4UFLA 3RPMA 3CZLA 3ARSA 4P7LA 2W92A 1H49A 2XGIA 1B90A 4F8XA 1E1FA 3VU2A 1KB3A 1QPKA 2XTKA 3S2CA 5AC4A 1K9FA 4JIEA 1ZBVA 2PBOA 3CZGA 3GXFA 4U33A 4ZFMA 4HU8A 3THDA 4UQDA 3EMCA 1TVNA 1J12A 4W86A 4FK9A 4TVDA 4C7GA 3NCOA 2C8NA 4KGJA 3F4VA 4PTVA 5GPRA 3HJEA 2BY0A 2D0HA 3VX0A 5DO8A 2QF8A 2EPOA 1TE1A 1VF8A 2QMJA 1MQRA 1W1YA 2J77A 3AROA 3WKZA 1XHGA 3QGVA 4JFTA 1V02A 1WDQA 2VZTA 4HTYA 4JKLA 5FKYA 4LYRA 3JUGA 3AHXA 4FLRA 4AC1X 5EBAA 3K4AA 4XV0A 4D72A 3BGAA 1EA9C 5C8BB 1V3MA 1JG9A 4DM1A 1AQHA 2CBIA 3AZSA 3U57A 2XIBA 2WKLA 3EMQA 1BQCA 1WZAA 4WLCA 4GPNA 2WBKA 3N11A 4B16A 1CNVA 1DEDA 3II1A 2A3BA 4P8VA 3ZJ7A 1SYTA 2ZUVA 1MWOA 1W1PA 2VMFA 3WEMA 3ARQA 3SCNA 3MMDA 1E9LA 2PWDA 1W9UA 1MQPA 4NSBA 1W9BM 4M80A 1C92A 1HT6A 1EDGA 4WK9A 1GOOA 4W93A 2W63A 1DWAM 1CXEA 3I3EA 4Z2IA 3L4WA 3AOFA 3L4TA 1UWQA 3K8KA 4QCFA 1ECEA 3AMLA 4PSRA 4ZXOA 2TAAA 3AI0A 2E9LA 3HMCA 1WDRA 4J3XA 2G3JA 4BZYA 4V2XA 3WBAA 4GO9A 2BV9A 2BXYA 3SUWA 9CGTA 4OOUA 3WD4A 1MW2A 1PX8A 3KEHA 1ISWA 4OBSA 3S6TA 4PUEA 1V3JA 5HOSA 3AIWA 4XZBA 5I23A 1CENA 3AZTA 1I1XA 1E3ZA 4XUYA 1M04A 1W3LA 2Y8KA 1E40A 4TVUA 3VTRA 4E4PA 2J8FA 4XB3A 1H0IA 2VL4A 4HA4A 1UA3A 3WFLA 1KGWA 4MPKA 7A3HA 2CYGA 3U5UA 1E71M 3EDKA 3CUGA 5ABHA 4PMNA 3SUSA 3FY1A 4Z2GA 4L4PA 2WW5A 3BXWA 1QI0A 3T0AA 3W26A 2J74A 3K8LA 5CG0A 3SURA 1DWGM 2XFRA 3W81A 1JYNA 3N13A 3BMVA 3VGBA 1K9DA 2BVTA 4U31A 3PTKA 2BHUA 3PZUA 4PYSA 1H11A 3UEQA 1GQLA 2W91A 1JI2A 2UY5A 1PIGA 1VBUA 4ML4A 4W7VA 1C3FA 1HKJA 3NSXA 4U2YA 4QAWA 4JCMA 2VZVA 3NSMA 5KZ6A 1CDGA 4F9DA 3GDBA 2WSKA 3RCNA 1PAMA 3GTNA 3T0BA 3WH8A 1BGGA 1ISYA 1LL6A 2DSZA 1V6UA 4GIAA 1E5NA 1NOWA 4HZ6A 1CBGA 3OGSA 3GXIA 1B0IA 1VIWA 4ACYA 1OT1A 1KFWA 3GXMA 2XM1A 4RE2A 5BWFA 4BQ2A 1H0GA 1HF6A 1KCLA 1UQZA 4EKJA 3ARZA 1GUVA 3AMCA 4BQ4A 2GK1A 2J25A 1W9DM 2VR5A 4W85A 4QP0A 4B15A 3OLIA 5ABFB 1A3HA 1E56A 1F4HA 2ZUNA 3FNDA 3CPUA 1J0HA 1XH0A 3T2OA 5C70A 4LYQA 2OWCA 1OGBA 4CD6A 2JIWA 1E73M 3ARYA 2CERA 2FHBA 1SMAA 5E0CA 2RGMA 2UY2A 5A2AA 2OYMA 3N1AA 4J3VA 3VIPA 4PSPA 1E0XA 4KRTA 3BSHA 1C7SA 1JAKA 1SR0A 1LG1A 1JZ5A 4J7RA 4KWUA 3ZJKA 3L2MA 3UG3A 5ABEA 1BG4A 4CVWA 1VFOA 5E0FA 1W3KA 4MNJA 1UYQA 5D8WA 1HN1A 5BRPA 1OGGA 1XSIA 2DIEA 2NW0A 5CPTA 2HISA 2IXUA 1H5VA 6A3HA 2DT2A 2FGZA 2XJ7A 4KMQA 1PZ3A 4IM4A
chains in the Genus database with same CATH superfamily
1QATA 2WJFA 1ADOA 2NWSA 3AIRA 5EFFA 1LLWA 4ZZ9A 1E6NA 2ZX6A 3MPGA 4NL1A 1I6NA 2WMKA 2IMRA 2OLAA 3WJSA 1Y5XA 3SFKA 2BOGX 3DOPA 1EZWA 3I4EA 3TW9A 4PB5A 1GOQA 4WJXA 4WZHA 3WH5A 5LA0A 1A4LA 4DJDD 4BI6A 3U3HA 4CQDA 4UNKA 3MUIA 1TPC1 4MG4A 3KTXA 1XLAA 2HPMA 2OO0A 2Z27A 5LNVA 1XDMA 4O18A 2Z1WA 4MOZA 3RN6A 5A6MA 1PO9A 2C0HA 2HVMA 1US2A 1QPQA 4ZQPA 5CPSA 5FESA 2O9OA 4I7VA 4RK8A 4PTXA 3GC5A 1WB0A 3GH4A 5D8ZA 1F3TA 1L6WA 2DZSA 2QZRA 3APGA 3MUXA 1VPYA 4ZSTA 4P8WA 5LA2A 2CXEA 3LV5A 4Z2KA 4BI7A 2OSWA 4A3YA 4HYVA 1PE1A 2PS2A 3RDKA 3WX7A 1I2QA 1HJWA 2A3AA 1RQEA 3ATZA 3MS8A 1JAEA 1ZCCA 3S6DA 4PE8A 3JW7A 2V5JA 4H7CA 3CPRA 4DYJA 1JL8A 1MRQA 3ITYA 3TUUA 4LX4A 3TZNA 3TYDA 2YZRA 2G3MA 1IWAA 3M5XA 5FOOA 2QLYA 3SI9A 1HUVA 2GGJA 2H90A 2XH2A 2ALDA 4P7RA 3PTDA 2VKZG 2DV0A 1LUCB 4FIRA 2G50A 1KCKA 4LY8A 4PR4A 1M1BA 1KFJA 4IIFA 4LEQA 3M0YA 4GY7A 2Y4SA 3MW7A 4F0KA 4EP8C 5ECVA 3A4JA 4JICA 4OOZA 1ZTVA 5C9RA 2FFCA 4EX4A 1ENUA 2P3ZA 2E6DA 4EPKA 2GSHA 4CN1A 1GJWA 3WNMA 1EGVA 4AD5A 4LS0A 3OZOA 2CBJA 4DUWA 3N25A 1YXCA 3MANA 4Q4MA 4MWAD 3TC6A 1GHSA 1IXPA 4K6AA 2EF9A 4NJJA 1SFLA 3OEXA 4KEUA 3GC4A 1YE4A 4M6UA 5CAKA 3VOCA 1FVPA 2J8GA 3IGHX 4E2DA 1VC4A 1ZJHA 3ZWTA 3LLDA 2PRHA 3QMTA 1HJUA 1JNEA 2CEQA 1RH9A 2G4JA 2QV5A 2V68A 1XSJA 2YL6A 1C7TA 2OG9A 3T05A 2YCIX 3A5VA 4XKYA 3ZFHA 5HANA 3G2GA 3RO8A 7ENLA 3ZJ8A 3BVJA 3URQA 1V3KA 3FGCA 2BZNA 1NP2A 3LTYA 1W17A 1PKYA 2V5DA 3PPHA 1B3VA 4O4VA 3SDOA 4ATLA 4KEVA 2Q09A 5CPLA 4JOMA 3BPWA 2ZC1A 1GKQA 5I24A 4NXSA 3QZ6A 1RCXB 5AYBA 4OQVA 4PUNA 4GRSA 1AL8A 3C61A 4GBUA 3S46A 2QCMA 4G9PA 4HA3A 1E5JA 1NELA 3F5KA 1CECA 2J7BA 1VFTA 3CIXA 5A6TC 1HO1A 1Z6KA 3N2BA 4JXCA 4TUFA 5HNNA 2R94A 1P6BA 3W1AA 3CUZA 4OUEA 4JIHA 3KZSA 1SFTA 3IV8A 4UUIA 3TR9A 2VRKA 3LEPA 4A3HA 1TPB1 1B31A 1Q63A 3EOSA 4RR4A 2VURA 8RUCA 1TRIA 4PMOA 1MI3A 1EWEA 2DUZA 2DZVA 2EPNA 2G8ZA 3UQNA 1JULA 4MWAE 2WCGA 1Q3NA 3VNYA 3NM1A 2A7RA 3WNPA 4D6IA 1DXIA 5U4NA 1QI3A 4I9JA 3MVIA 1DYSA 4IFOA 5BU6A 5F1UA 4I7WA 3IEBA 4MKSA 3Q67A 3FKRA 3TSDA 1NU5A 3CASA 3TTQA 3BAXA 2DUXA 4BK9A 3WQGA 2WXDM 2QW5A 3S6OA 2EQDA 4ROPA 3ES8A 3ICJA 2BXVA 1EDTA 1LZOA 4ZOEA 3TSMA 1OFPA 1PWLA 1K8YA 1QWKA 2WVTA 2Y8VA 3TQKA 1QAPA 5F2LA 2YXGA 3NQ2A 4MZ8A 3PZGA 2AAAA 3O15A 1CTNA 2VHLA 2E6YA 3F2DA 1W5NA 2E3ZA 4J35A 3PZTA 2XFYA 2EO7A 3WDQA 4P2VA 1TA3A 1JRBA 5KZEA 3L4UA 3NQEA 4U10A 3VGGA 2CHNA 3PJXA 1DJHA 5C2GA 3I3BA 1XLMA 5G4WA 3EDJA 3ZOAA 1TR1A 1UBPC 3UFYA 2IPJA 2QKFA 3QHNA 3B9AA 2FZ8A 3MVTA 3RPDA 1RA5A 2GDVA 4E5TA 5EPDA 5KSWA 1UUOA 1GCYA 2E67A 4IZGA 4UNLA 4LSBA 3S1XA 4B92A 2Z7GA 3DENA 5E0KA 2VX7A 3BG3A 5A6JA 3N2CA 3SQSA 1PL9A 3GNDA 4F0HA 3NQ6A 3W1XA 3DI0A 1XP3A 3CHFA 4ACZB 1MFVA 4O50A 3C0QA 2HWGA 3KOZA 3B8IA 3D46A 5FEXA 5FF2A 2HNHA 4HZ7A 5MKGB 5I3JA 3AJ7A 1CGYA 5J5DA 1XC6A 4C1NA 4O0ZA 4L9YA 1KM1A 3V35A 1LRTA 3GYEA 5H6HA 4Q22A 4UIOA 4A35A 1RJQA 4UC5A 2PU0A 4MAVA 1A3XA 2E6AA 1CI1A 4OIFA 3PWIA 1XISA 3ID7A 4FOJA 2YBVA 3AIVA 1V3LA 1CLKA 5A8OA 1V5XA 3B4UA 2OGYA 4U5IA 2ICSA 1QVBA 1ZGDA 1XH1A 3ZT7A 3R10A 3OU8A 1FCQA 2DVTA 2D0GA 3CHDA 3TIMA 1IZJA 3FKKA 2J47A 3KP0A 4FI4A 2E5CA 4PMUA 2PDXA 4AX7A 3MKVA 4QNWA 3PY2A 3KUMA 3WL1A 5DBTA 2OX1A 1EX1A 4PMXA 4K37A 1KV8A 4NJHA 3ONCA 3BAIA 4DQWA 5LXEA 3GQYA 4EWJA 5BCAA 3ECQA 3UWUA 1W9VA 2PP3A 1UBSA 2CKRA 4HSHA 3EAUA 1UR9A 3A4XA 4FS9A 5JBEA 2WPGA 4RUBA 4Q8VA 3GXPA 8A3HA 2X8RA 4NVTA 1GKPA 5I77A 4NAFB 1S2AA 1QNOA 1XIHA 5HQLA 2QCNA 4NZ3A 4YU1A 4AIUA 4NI3A 3MBFA 3CH9A 4AXNA 5H8UA 5BRQA 4XZLX 4ZQRA 2RH9A 4C5YA 4WHBA 4WKFA 4N0RA 5EMKA 1C9DA 4D8ZA 4MYAA 1IR2A 2X0HA 2YDSA 2D22A 4HJWA 4ZENA 2V6AA 3PAJA 3ZWSA 2HNEA 3FJ4A 3ARTA 5M2FX 4L4OA 1FTXA 3QY7A 3PP7A 1BQGA 3UYCA 4GVGA 3BAWA 1XRSA 3BJFA 3TMQA 5I2UA 3IRDA 4QCEA 1F8IA 1KM3A 3A3WA 3MMWA 3VD9A 1JI1A 2ZRZA 1IXNA 2R1KA 2WHLA 3FEMA 3RILA 3R8RA 3GG7A 2WZIA 1QHZA 4Z42C 4PMZA 2PB1A 1I1WA 4IGNA 4AWEA 3OODA 4DUVA 1IEXA 3GE7A 6XIAA 2D0FA 4WUIA 4DX3A 3OVRA 4XVEA 3W6MA 3M5YA 4FXRA 4I6VA 1JFHA 1TJ2A 1TVLA 4Y7EA 3BARA 1OK4A 3KCJA 2GJRA 2E40A 4L64A 1YIXA 2PD9A 3E0LA 3GM8A 1EJWC 5D9NA 3V3WA 4V1YA 4B3LA 1Q13A 3CUHA 4LGXA 4H9TA 2NX3A 3TLLA 3OB8A 1PPIA 4ZTYA 3WEZA 4LUTA 2AL2A 2Y8UA 3ZS4A 3PWGA 2HV5A 3ZM8A 2Z2UA 1X97A 3MDWA 1QNPA 4S3AA 5AC8A 2YGYA 4EAMA 4LJ3A 4HA0A 4NUWA 3C2EA 1H5YA 1B4EA 2B7OA 3R7MA 3W7QA 3PBYA 1KCXA 5FI8A 4AIEA 1E6SM 3CLWA 3PFRA 2R1LA 4JYFA 1WUEA 1PX4A 4QSHA 1XIGA 4JHMA 2A3HA 3SM0A 2WZTA 3N4EA 5AHNA 3BLFA 2XVKA 3WFZA 3KBVA 3LLXA 3L2LA 1JGMA 4QM1A 4X2RA 4YHGA 3W74A 3T0TA 2R1PA 1RY0A 1OGSA 1GNXA 1B54A 3GAYA 4IICA 3BJSA 1QOQA 3LSCA 2PRLA 4I5XA 4UTLA 1IYXA 3BCDA 3BLEA 3WQ4A 1W3JA 2ZVRA 3A6OA 5TBOA 1JCJA 3BH4A 2OOFA 3FK4A 1YX1A 2XM2A 4PL1A 1YPXA 3DHDA 3KHDA 3PK7A 4PEEA 3KBJA 1E0TA 1ZCOA 3VA8A 1TZ9A 4QG8A 2B31A 1JPHA 5EU9A 3CPGA 3EPMA 2DEPA 2CLMA 1RZMA 3ZLGA 4HMDA 1A0CA 3LCGA 2VZOA 3GKAA 3FAXA 3STPA 3R1ZA 5RUBA 4LB3A 1LL4A 1J0IA 4IIHA 3MZNA 4JIIX 4O11A 2HEJA 3KVLA 4D6FA 3ZSTA 3AS1A 2YL9A 3A4AA 5A8MA 3MU7A 2WVVA 6ALDA 4RW3A 3THAA 1H63A 4X0NA 1Q66A 2J7CA 4LAKA 2OQHA 1W6TA 2PWVA 2NSXA 4E0CA 3EWZA 3LPFA 1JR1A 3TV8A 4Z0SA 1JDDA 1AQFA 4N9CA 2QS8A 1DXEA 3QR3A 1J8VA 4JTHA 4A21A 2DJLA 2P10A 1WXJA 2NUXA 3GXDA 1JZ6A 3EBVA 3LM7A 1V0KA 3AUOA 3ITVA 4XG1A 5AC6A 1Y7VA 3M6DA 4HNTA 2YX0A 1B57A 4MJ2A 4DZHA 1OCJA 3U4AA 1T8QA 4A3UA 1NOUA 2XINA 3P2VA 3T0DA 1GPFA 3W7OA 3WUBA 1YMYA 2PF0A 2E0PA 1EJRC 2WQPA 4GNKB 2W9MA 3REQB 5HATA 4AEFA 4YPJA 3LQGA 1PKLA 2ZXBA 4YVXA 1M53A 4YLWA 2P8CA 2QDGA 3H4WA 1P0NA 1NTHA 1EH9A 4AF0A 4FX6M 4NZCA 4NQ1A 3S83A 2JE8A 4GZJA 3P62A 3FA5A 1LQ0A 3G3DA 1XLIA 2ANUA 1KM2A 3CGTA 4Y2WA 1ICPA 1Q6GA 1UIPA 1Q6DA 3TTSA 3SECA 2Y6ZA 3TK7A 2ZICA 3BK0A 4MB5A 5D02A 3UXDA 5EY5A 4D1JA 3KP1A 1UZDA 1XRTA 4JFVA 1VPQA 2YW4A 3HM7A 4EPBC 3O6YX 2O9RA 4ZSUA 3N15A 3C0JA 2D73A 2QPUA 5JIPA 2IPGA 3RR4A 3BV7A 5ENLA 4JIRA 4AZBA 1D7FA 1YBQA 3FVDA 2HDJA 4NP7A 1J10A 2J75A 1CGTA 2DUAA 4L7ZA 1WKDA 4Z1YA 3KOXA 1H2JA 1E6RA 3G1FA 2G3NA 2VTFA 1NARA 1KTNA 4LUSB 2VUYA 3B4YA 4PRWA 2WMJA 3DFNA 5HDRA 1W5OA 4DO4A 2J9XA 2B7PA 3UJFA 1BRLB 4U4MA 2FTYA 3QFWA 2PF8A 1M5WA 5BROA 3AIUA 3LCWA 4J3SA 3EOOA 5M1TA 4M1RA 4DWSA 1JYWA 1BG9A 1H1ZA 3NJ3A 2GUYA 1AFSA 1W3HA 2HQAA 2TPSA 1B4KA 8XIAA 1XYBA 2G4FA 1G7UA 2C15A 1TG7A 4WJ8A 3TAOA 1UOKA 2NQ5A 4RDVA 1C29A 3HV9A 4YVVA 3WLRA 2J7EA 2PGRA 3FJLA 4IP4A 2DSKA 1VCVA 1Q45A 1W0MA 1VHNA 1EC7A 3K2GA 2CLEA 1W1TA 4JR5A 2Q3OA 3P80A 1N8FA 3BW4A 1WZLA 1J0ZA 1WKYA 1QW7A 4PMRA 3GB6A 1TE6A 3OGRA 3F5LA 2OQYA 1BSIA 1OQFA 3FOKA 1HKWA 2Y7FA 2V67A 1L2QA 3WNOA 3M46A 3WH7A 1ITCA 4F40A 1U33A 1XL9A 2XVNA 1IQ8A 4UTTA 1A5NC 3R0DA 1BGAA 1K9TA 4WY0B 5D33A 4PUMA 3BUVA 1TTPA 4I9TA 1HJVA 3AS3A 4XIAA 5DANA 3VD4A 2X2YA 5D2WA 4D8AA 3L5MA 3BSGA 3A24A 4C6FA 2NVAA 3NSNA 4AD3A 1GWJA 1E9ZB 3MY9A 4GXWA 4HIBA 2NZLA 2QQ6A 4IUGA 4PH6A 4XK2A 3MHGA 1N7KA 3TWAA 3K1DA 2GQ8A 4XKMA 1L6SA 2QUVA 3U7BA 3JR2A 2NSOA 4JEQA 5IHSA 4AVNA 1E70M 5I6SA 3CQJA 3ARVA 1ELSA 4XBSA 3LERA 1QT1A 4RV3A 2WNZA 5JBFA 5HPOA 1R86A 2VX5A 2OYLA 3TE9A 2Y7DA 2PDJA 4DJFA 3CUFA 4D1IA 5CBIA 1RPKA 4GQBA 4BA0A 2VELA 1RP9A 4GY1A 3B0UX 1VEMA 4I6KA 4AY1A 4DI9A 3QV9A 4DZAA 2EXOA 4GUJA 4Q6XA 2R24A 4XAPA 3M41A 1TZ7A 2XN0A 3K8MA 4F0SA 2WMHA 4H04A 3WQCA 4FALA 1POKA 2WV8A 1EX5A 2OO6A 2CETA 1PJ9A 2PE4A 2QCHA 5DX7A 3LA4A 3L67A 4K7YA 3VNMA 2VFFA 3P14A 1TPDA 3QZEA 4C6IA 4AY7A 1IGWA 1A4MA 1JQXA 2V5KA 3UCCA 5I07A 1YADA 1IWBA 4Q8UA 5CZKA 4O1DA 3WJXA 3WYZA 2OYKA 1ZS2A 2DGAA 3HA1A 4NZJA 2QUMA 3MWAA 5DF0A 2CBVA 5EGRA 1NM9A 2OU4A 5CJNA 2YDQA 1ITXA 1W1B1 1EF3A 1XI3A 4B5WA 1MDLA 3NQMA 3TYCA 4A3QA 2CLPA 1J79A 3NZRA 2Z1KA 4W7WA 3S5OA 3GUWA 1D7KA 4V15A 6CGTA 4PZVA 5J04A 1R3QA 4R3UA 4L5ZA 3OIHA 1VBGA 5I79A 4E8GA 5MF5A 1AZ2A 1R7OA 4P7NA 1G7VA 1J2BA 4O54A 2EPMX 3ANYA 4UXDA 4YMZA 4S3EA 1KM4A 4TTUA 1MUCA 5IDIA 2D69A 5HQEA 5A6BA 1HKMA 5G4EA 1O5RA 1YPIA 3NQBA 1PDYA 2HJPA 1KLZA 2ZRXA 1EF2A 2DIJA 4GWEA 4NRSA 5K4XA 5DXXA 1OK6A 1KBKA 3RPTA 3MJYA 3A64A 3WQ8A 5FL1A 3DFSA 4M8UA 4AFYA 1XYAA 2P53A 3FVMA 3OZMA 1GOKA 3UZZA 1J6PA 1QPRA 3CV6A 3W7EA 3SCVA 5U7SA 1DXFA 3G6MA 1UJPA 4WDTA 2FLIA 2GJXA 1XG3A 2HRWA 5EA9A 3LTPA 3VIKA 1HP4A 3C2VA 4NT0A 3T6CA 4A8NA 1EBHA 4JQAA 4LRTA 3ZLFA 1HW6A 3U2CA 2LLEA 3M0MA 4L1GA 2WWDA 4IPJA 3H7RA 3GSMA 2XVLA 3B9DA 1B9ZA 4ORMA 1DJQA 2MNRA 1Y5VA 4HYWA 1VFLA 4F9JA 1XF0A 1XFCA 4LCSA 3VYLA 1FBAA 4WJEA 1OCBA 1A5BA 3SBFA 3MJMA 2OT0A 4KPLA 1TV8A 3ABXA 3CL8A 2W67A 2ACRA 4FA3A 1EIBA 5I3FA 1HZYA 2C1GA 1GKRA 2H8XA 5A2CA 1H1NA 1UD4A 4TV5A 2VXNA 1ONXA 5K9DA 4UQCA 4XO7A 3MSDA 2UY4A 1TMLA 3NL3A 1YTEA 1I2PA 5EKYA 1HIZA 1U5HA 2WLZA 3FSTA 3LCHA 1DWHM 2E9MA 5FJOA 3W29A 3OIXA 3V5OA 1GYMA 2ZUMA 2NQLA 3DGRA 4ORIA 4J27A 3ZVHA 2J13A 1W31A 2RDWA 5AHLA 5AHFA 1AL7A 3RXZA 3R12A 4IMCA 1G4EA 1Z32X 4JL1A 2WAGA 2FZNA 4QITA 3E49A 4BCEA 2IKHA 3WLKX 3NDOA 4MNKA 2ISFA 5KINA 1UB3A 2VOMA 3STEA 1UW9A 2CITA 1UHVA 4I5UA 5CEWA 2ZE0A 1MUWA 1G94A 1SJDA 3BG9A 2EJAA 2WSQA 1BVNP 5AN7A 3TQ0A 1JIBA 4TXEA 4E2OA 3RCMA 3CZLA 1TPUA 4Q8OA 4P7LA 4O13A 1DOSA 4F8XA 1IXQA 2PDKA 1QPKA 3S2CA 5AC4A 3D47A 1TQXA 1ZBVA 3CZGA 2X16A 2YCKX 3PB0A 1KTCA 1XQLA 4K39A 1IXOA 1G4PA 4W86A 1FCBA 5H1WA 4PCPA 4PTVA 1N2VA 3W7RA 5GPRA 4JN7A 3BICA 1Q6RA 3B06A 3T07A 4MUPA 4RXGA 3VX0A 2Z7KA 2EPOA 3VKCA 4EF8A 1TE1A 4A8RA 3AROA 2J77A 1DJZA 2PC4A 5EBAA 3K4AA 4D72A 2FPYA 2VFDA 1Q6OA 3Q65A 3ITCA 3C6CA 1RBAA 4DM1A 4Q8TA 5AZ0A 5D2YA 3BOFA 3U57A 1PXGA 1PTDA 4POCA 4H2HA 3RMJA 1BWKA 1GYLA 1W5QA 1BQCA 3S4TA 4MM1A 2F84A 4NYYA 3GDMA 4GPNA 2G0WA 3EPOA 2RHGA 3GVQA 3A12A 3A9IA 4GVFA 3VOIA 2O55A 3WLSA 4ZB5A 4DELA 3GNXA 1SYTA 2BB0A 1MWOA 4GVHA 3W7CA 3G0SA 1R9YA 3MMDA 5BMWA 1E9LA 1W9UA 1DL3A 4DYEA 4NSBA 1EGMA 1HT6A 4N9EA 2W79A 5HMDA 3EKLA 5LGXA 2ODOA 4L65A 2H8ZA 4NZ5A 4Z2IA 4Q8PA 4QCFA 4LF2A 1FWBC 1ECEA 1G4TA 3P67A 4PSRA 4ZXOA 4MY1A 4CCZA 4GHRA 3GO2A 4H19A 5D38A 3QF0A 3SUWA 9CGTA 4FF7A 4FXJA 4RJEA 3LK6A 2GL5A 4C1LA 4QISA 4GFIA 1ISWA 4OBSA 1WKFA 4RZ5A 3EWDA 1I1XA 1THFD 1E3ZA 3OHIA 4XUYA 1M04A 3M5VA 5CZJA 4GXMA 1W3LA 2Y8KA 4TVUA 2YR1A 1EUNA 2J8FA 2NXIA 3DDMA 5HR6A 3T1GA 4PB3A 2NV1A 2Z28A 3V7PA 2RUSA 3H4GA 3QRHA 4Y9PA 3WLJA 2IKIA 3PB2A 3KX6A 1ONEA 5ABHA 2QJMA 2DFAA 3TJIA 4PMNA 3SUSA 5I06A 1F9CA 4Z2GA 4L4PA 3STGA 3M6YA 1F07A 3T0AA 1OC6A 4L6HA 3KS5A 1DIDA 2J74A 5C9XA 1PYFA 3SURA 2XFRA 1DE5A 3CQIA 5BOOA 1G6CA 1DKWA 5JXQA 3KM8A 4PYSA 5DY3A 3UEQA 1GQLA 2W91A 1JI2A 2ZRWA 3SZ8A 5AVNA 3M1ZA 2UY5A 3CIWA 1VBUA 1C3FA 3HG5A 2NVDA 2VZVA 1EUAA 3RRAA 4B4HA 1CDGA 4EPDC 4F9DA 3GDBA 4YYCA 2WSKA 4ZTXA 2I16A 3AAMA 3O6DA 3RCNA 1O1HA 1PAMA 4JTAA 3STFA 5FEZA 1C8VA 1XIDA 3WH8A 1LL6A 3NZQA 1E5NA 1DJGA 2REQB 2IQ0A 4ACYA 3S1WA 1OT1A 1EPVA 3IVTA 4RE2A 3COTA 1BEUA 2Z26A 4BQ2A 4EKJA 4OE7A 4BQ4A 2XZ9A 1XLLA 2VR5A 5I3KA 1ME8A 4QP0A 4W85A 2NWRA 3WJWA 1PZ0A 1A3HA 1F4HA 1O68A 4HPXA 1XIEA 1Q8AA 3SRKA 1XH0A 5C70A 3CEUA 2XIQA 3GAKA 2JIWA 1E73M 4MKVA 2P76A 3IGSA 1XIBA 2FHBA 3OA3A 5E0CA 1BSLA 2OYMA 3DKJA 3N1AA 4J3VA 4DJEA 2G95A 4C1KA 5C9WA 2NV9A 2Z24A 2FPTA 2FJKA 2ON3A 3VCCA 3ZJKA 2ACQA 4GX8A 5ABEA 1BG4A 4LC8A 4KETA 1VFOA 1OGGA 2DIEA 5CKSA 4M51A 1AW5A 2R91A 2WSRA 3NL2A 1FXPA 2DT2A 4EXBA 4IM4A 2PD5A 3W82A 1IF2A 3H2NA 2V5BA 5D09A 4YTRA 4GD0A 3UYIA 4GH3A 3E2RA 1P43A 2XGZA 1S5NA 4RLIA 3ZT6A 4JNMA 1UPMB 1LTDA 1QNVA 4HTBA 4JAWA 5HWNA 2VX4A 1H7RA 3N4AA 2ZA1A 1PCKA 3WD0A 4X9YA 1D3HA 3WH9A 4LAMA 1DV7A 1KV5A 4WR3A 3QC3A 1PS9A 5CQ1A 1G9HA 1OF8A 3A13A 4A6GA 3PZQA 2J7DA 4IIEA 1VAHA 2GPTA 5HPCA 3W88A 3TN6A 2DP3A 1BHGA 3DUGA 5A5WA 3TSBA 3E1F1 5F4XA 1J96A 1VRDA 5G2WA 3TEVA 2AMGA 3VFCA 3VZXA 4OT7A 2Q6ZA 1DQUA 2ASHA 4H9VA 1VD6A 1OFRA 4AZCA 3W2MA 2IKGA 3EX3A 2XIIA 4MFDA 2A21A 1ZL1A 2NUYA 4JTDA 3H23A 1R0MA 4F2TA 3V0TA 4YHEA 4LVBA 3AXIA 2DQWA 3DG3A 4JIQA 2XH0A 3GC2A 3WH6A 2KX9A 1PCWA 2WJDA 5G4HC 2VEIA 3WQ5A 1OD8A 2YXOA 5A95A 4KKXA 4PMDA 4PFMA 1J93A 3GVWA 4WOQA 3SCQA 3KL0A 2A0NA 3BQ5A 4U28A 1LWHA 1VBRA 4HU4A 3H7VA 1SW3A 3HGJA 1ZUAX 4G1KA 3NWRA 4EK7A 1KA9F 1K02A 1NP0A 3A47A 4H7ZA 4O17A 5LNWA 4O10A 1RLCL 1S2TA 3EKZA 1P1MA 1OYBA 3NPVA 1C91A 1FWGC 4Z1AA 3E0FA 3VD7A 1LORA 3PZMA 3VDCA 1NWTA 1JXJA 1LBMA 3MA8A 3V1PA 4CU7A 4B9YA 3F5JA 4HQVA 4IP5A 4LUIA 3KDOA 3VOFA 3P84A 1JD9A 1Q8JA 3GR4A 1UMYA 3CZJA 3GG0A 1WZKA 3QM3A 1Q7ZA 1GW9A 4IQJA 5HXMA 2R14A 3AHVA 3MCOA 4S39A 1UKQA 2ZXQA 2D2GA 1Q7QA 1RD6A 4B5TA 3IAPA 3SGZA 2YLAA 4Q8WA 4DJDA 4NASA 1VFFA 5I00A 2Q3RA 3TP4A 3VD5A 1KO0A 1POJA 4LUYA 3IACA 5FL0A 3O3RA 1F6YA 4I8YA 4KS0A 3LPPA 3OW1A 4M6PA 3EDDA 4H6EA 3N2OA 4U3CA 3UR5A 1K4GA 3U7VA 3AIEA 1HJSA 4GGHA 4R34A 1MXGA 3A3HA 5CLTA 3E5PA 4XISA 3UCQA 3W3OA 1G1YA 1SZRA 3GR8A 4GX9A 1EJSC 2C0AA 3Q37A 3HMJG 3G3MA 3D3AA 1NDVA 1EP1A 5FF7A 4W8LA 4MLRA 2CNCA 2TRSA 3C4UA 3W7MA 4NNAA 2VZUA 5CC5A 2GLKA 1B3WA 3TJXA 3DN5A 4KCWA 4JFWA 1VB9A 1FRBA 4ADUA 1SM9A 4JTFA 2ZX5A 1ITQA 4P5UA 2JFEX 3E96A 1T41A 5CLWA 2C18A 3MT1A 1OF6A 4AZGA 3UG5A 4EANA 1G69A 4Z1BA 1WNOA 3R13A 3HQ1A 1UIOA 4TMBA 1SW0A 1VFMA 2BGSA 5DMNA 2Y24A 4N9BA 4HMEA 2FB3A 4MADA 3QTPA 2W66A 3G1DA 4PCFA 4UQBA 1NQ6A 4F3HA 4V28A 3QLDA 5HJLA 4MPQA 3JVAA 1OT2A 3EX1A 3BW2A 2JIEA 3BURA 4H01A 4HOXA 1F05A 1AZ1A 2P3EA 3QQWA 1FWRA 1XR2A 2A3CA 2OSXA 1JNDA 4MWAA 1GG1A 1V93A 2BHZA 4AG0A 1QHOA 2P8BA 2DSWA 1OYCA 4GJIA 3IIPA 3HZ3A 1R3VA 2JQXA 5AYYA 2J7GA 2HTMA 1VPXA 2WM0A 1R47A 2PWGA 3WUFA 2OMAA 1JFXA 1V0NA 3N12A 4KEZA 1RUSA 4UQEA 1R7AA 3FEQA 2ZWZA 4HNNA 5A1AA 1XUUA 3NXFA 1JCLA 5F7UA 3WLOA 3R4IA 1DQWA 2ONEA 4G56A 3WQDA 2HXUA 4H9ZA 3B9NA 1W32A 1M7XA 5D9OA 3GBDA 1B2YA 4RNHA 4S1FA 1CGUA 5CJMA 1UJQA 2NQHA 1XRVA 1O94A 3AIBA 4A05A 3BWWA 4US6A 1HL2A 1L8PA 4QS6A 1VR6A 3UR7A 3W27A 5H8MA 1JDEA 5T9CE 4LBRA 1E4LA 4C6CA 2PDBA 2VZSA 4GFSA 4LVFA 5AKQA 2YLLA 4JTTA 4B5VA 4WSKA 3UWVA 1I4NA 3CAWA 1K7XA 3IJQA 5AYIA 4W5UA 4IFKB 4UWMA 1A53A 1C9WA 1YW1A 2VO5A 3MCMA 4TMCA 1LDCA 4OBTA 3T78A 1P0DA 5A8PA 1XDJA 4LNCA 2A1YA 2A5HA 1TREA 1HP5A 4FX8A 2WNNA 3WBYA 3LHUA 2WVSA 3L66A 4H00A 3MO7A 3O1NA 3R2GA 3R94A 3LMZA 4C6DA 3EKGA 3WFAA 4DXXA 2QULA 1V6VA 4YVPA 2EPHA 3EWUA 6PTDA 1GGOA 3AJXA 3C8NA 1BVWA 3KRSA 4UFMA 2Q8XA 1KBBA 5BW6A 1CXFA 3DEQA 2RGLA 4NZFA 3T4WA 5DY2A 3BG5A 4JYDA 2DH3A 3PBGA 5E6ZA 1CLVA 4JTJA 2OKOA 1BPLB 1X1ZA 3R6IA 1KR1A 3BTNA 4UOQA 3O8AA 3ITXA 5K9XA 4GK8A 2G97A 3U4FA 4KBXA 4FLQA 3CUJA 4K36A 1BAGA 3S1VA 4UMAA 1VYSX 5FAJA 7TIMA 4WKAA 3IK2A 5JH2A 4G7EB 4FNUA 2GUUA 4MAZA 3TROA 5DMMA 4P7QA 3AMGA 3N6QA 2W61A 3O16A 1FOBA 3AHZA 4UOZA 4LCQA 1UZ4A 3RYSA 4W87A 1G5AA 4UFJA 2ISWA 3LSBA 3LMYA 4W89A 3GNPA 4AZIA 1Q6FA 3R79A 4M0XA 4HHLA 3UESA 4L6DA 3Q2DA 3LI0A 4KCTA 1ZJIA 2GJLA 1O5KA 3DHUA 4FR1A 2VJXA 2VR4A 5IBXA 3A21A 2IKJA 3BJTA 3BZJA 1TPFA 3ZIZA 3W1MA 2QYGA 3FS2A 3GDLA 5CBJA 1GVSA 5A6AA 1K4HA 3KRUA 1EO7A 4B5NA 3MP5A 4W9TA 3DC8A 2XWDA 3CYJA 3DI1A 4UCGA 1F5ZA 4CCDA 2OQLA 4PMQA 1GHRA 2J9YA 3P3BA 5DQPA 5JUVA 2OLHA 2WANA 4D8LA 3DERA 3W1TA 3GG8A 4GISA 8CGTA 3EEZA 2OODA 2E9BA 3UCDA 2PFHA 4AZ7A 1R38A 3GRIA 5G5IA 1UWRA 4DY1A 1J18A 2V81A 1ALDA 3QY6A 3RF9A 1JF6A 2XIOA 1FDYA 4PMJA 1KQZA 5F2GA 4AD2A 4X63A 1OBAA 4F0RA 1U30A 4NX0A 4WRHA 3LCLA 1VEPA 1SPQA 3L7RA 3KOYA 4GC3A 4HOZA 3UZ5A 4Y9AA 4M5PA 2GQ9A 3W84A 3QFEA 1WYIA 1KGXA 4AMAA 1U1HA 3WUEA 2Z1BA 5I3GA 4REQA 2YYTA 3MV11 1MW3A 4WY0A 4AYGA 5H2ZA 5FD0A 4DIAA 3IJIA 3LGDA 3PFMA 2Y85A 4LF1A 3SRDA 3O0FA 4Y9OA 3LXAA 1UKTA 3W7NA 4UTKA 5ECUA 1WDDA 1B3OA 2C14A 1MMFA 4HNUA 5DCDA 1DJIA 1HVXA 3BLKA 1XYCA 3I6EA 3NQ7A 3SJNA 1NWUA 2ZVIA 3W1NA 4RX0A 1H4PA 1QI2A 1UWTA 4JQ4A 2XPKA 4U2ZA 1OB0A 1H60A 3GTFA 1LYXA 7ODCA 5HMFA 5ABFA 1FFRA 1HTIA 1ODUA 1J4EA 3V1HA 5KZDA 1ME9A 2PCEA 3L0KA 2ZCGA 2WCAA 2WJEA 4KGLA 4C6KA 3CL6A 3VDHA 1LLZA 3GYCA 1LWJA 2PWHA 3THQA 3UPBA 5HNTA 2EPLX 4ADSA 3BMWA 2DQXA 3AUJA 1N8IA 1R9XA 3NZ1A 4R7WA 1XCWA 1XV8A 1Q4NX 2Y70A 1VIZA 3QQ0A 1AUSL 1FHLA 3N17A 1ZAHA 1PX3A 1Y65A 4XX6A 3G77A 4QLKA 1NOFA 1Q4WA 1V7YA 5C71A 1Q65A 2DU2A 5GNZA 1LT7A 4L4LA 4S3GA 3NEHA 3LU2A 4DF2A 1MEHA 3HQOA 1R3SA 4O1FA 2XG9A 4CVUA 3P82A 4CN6A 5J5RA 1C8YA 3FJ6A 2BP1A 4Q32A 1DWIM 4YCPA 4YL2A 2PDCA 2PZ0A 1TPWA 1W5MA 2E7FA 3AZRA 4IG2A 1F2JA 4N2YA 2YCJA 2PDLA 4C6BA 4LUJA 3IS4A 3O6AA 1H41A 3IVUA 1FKXA 2GJNA 4KWSA 3LRLA 2XSAA 2O9PA 1V8EA 3A9BA 3APTA 3IIVA 4RV8A 1EYWA 4YTQA 3B9EA 1QRQA 4XZHA 4GIYA 1ISVA 1ZJBA 2ZUSA 4RDZA 3MKKA 1VH7A 4YCOA 2JGQA 3SCPA 1PEZA 3H6OA 4S3JA 1GT8A 2Q8LA 3PZNA 2UY3A 3M0JA 3W0KA 4C7FA 1MFUA 4H9YA 3QV7A 1Z3NA 4GQ0A 1LCOA 4HP5A 4IL2A 2AQWA 2GSJA 5CSSA 2X30A 3M64A 2XN2A 1PTAA 4IPPA 2IXVA 4A2SA 2JALA 1BTCA 3RJYA 5EMYA 2PAJA 2ZIDA 1ISZA 3QXBA 1P6WA 1JEZA 4UTWA 4WEVX 3WF2A 3L68A 4M81A 3EGJA 4L1XA 3NOEA 2X0SA 1GVFA 5CJ5A 5E6YA 3HFYA 1FWNA 3EOLA 1XSKA 5BXSA 5GVJA 3H24A 1T6MA 4ZR8A 2ATSA 2WHMA 4QEEA 3UWQA 4RDWA 4J3TA 4ATWA 3KOWA 4CD5A 1WBJA 4FXFA 1IT7A 1BVZA 1EBGA 1AQ0A 1SZGA 1SR9A 1YEYA 4Q33A 1R5YA 2RJHA 3QBUA 1QTWA 3FFSA 5DXYA 1AD1A 3EWCA 1TIMA 2AKZA 1WDWA 4DWSC 4H9XA 4FF5A 1CWYA 3MV01 4WIWA 5GNXA 1UD2A 3MP4A 4UFKA 1R87A 1LBLA 3TAKA 3L5AA 3CAKA 1CXKA 3C3NA 4DBDA 3N9SA 3UZWA 4ZL1A 3E6EA 2WZHA 2JF6A 5CZSA 3V18A 1ZLPA 4XIMA 2OZ3A 4JEJA 2PMQA 4ZVJA 1IT0A 1MUMA 4FB7A 3G1SA 2E5BA 3SUUA 1HFBA 1E6PA 1TYGA 1E3XA 8TIMA 1ADSA 1FH8A 4ZO9A 1OX6A 5F4WA 3RHGA 2A2IA 5I78A 2PP0A 4UFIA 5CSYA 2VRJA 4H8NA 4QHRA 5BRBA 4UTTC 4MTVA 5HUPA 3NQFA 3WEOA 2ZA3A 4GUHA 2VD9A 3W1LA 1R85A 1KKOA 3ENLA 4E3VA 3VIFA 3MO4A 4L56A 1RP8A 1MEIA 2VDGA 1AJ2A 4OJYA 2EGZA 1SW7A 3KVKA 4D6HA 3P0WA 3OJGA 3VGEA 2CKSA 3E0WA 2VC6A 3UA4A 1NF7A 1R8LA 5GJNA 3T9PA 1FH9A 4B90A 1WPCA 3SCUA 1OX4A 4JY8A 2YCEA 2DZWA 2ACUA 1KNWA 1SSDA 2CC0A 2F61A 4BF9A 2XZ7A 3UY7A 1A0EA 2RDXA 3VNKA 3GD6A 1T99A 5FEPA 3CUXA 1WZMA 4IMDA 2C13A 2C16A 2OPJA 2ZDSA 5DT5A 1L0PA 2D23A 2BBFA 2A85A 3AMKA 4M82A 3R25A 4LALA 1LT8A 4IX2A 1QPOA 3EMZA 2G3IA 3CS2A 1V7AA 1TWWA 3LGEA 1XBXA 3MMUA 2WK2A 3M7SA 1NEYA 4IPNB 2QF7A 1S38A 3S5SA 3RJXA 5FF0A 3ITTA 1LOSA 4AWSA 5I0DA 4DO7A 3CAVA 4CEUC 3UVIA 4DXVA 3TA6A 1US3A 1C8QA 1CB7B 1KRMA 1WAUA 1TJPA 4RCXA 3USZA 2C3ZA 4HD5A 3GW0A 3R8GA 1R6WA 1CGXA 1JZ4A 1Q6LA 2PDYA 3TMLA 1QNQA 1KXTA 2H6RA 4KWVA 3W2UA 4IMAA 3B40A 4LS1A 4AU0A 4UMBA 5LNUA 4UBPC 3WQFA 4RZBA 3G22A 3D5HA 1VFSA 3GIQA 4Q4SA 1GOMA 1RBLA 4AZ6A 2VEMA 4DI8A 2UBPC 4BQ3A 3FHQA 3SY8A 3PNUA 3GIYA 4N9DA 3PG8A 1UC5A 1XH2A 1JUBA 1MQQA 3T8LA 3B0PA 2XVPA 2YCLA 5BXPA 4Y6GA 3EB2A 4QLJA 4XKYB 5K9CA 2FH8A 1PIFA 5ABTA 5LGZA 3F2CA 3NZPA 3FGCB 2ZE3A 1UD3A 3SCSA 5A69A 3GDTA 1DHKA 3OYZA 1A47A 1XBVA 2Y88A 3WJZA 3GVRA 1ESWA 2CWNA 4MSSA 2W4XA 2X1TA 2PDFA 4YTUA 1ZP3A 4ZO8A 2H9AA 4D9PA 2WZMA 1H51A 5AYXA 3I6RA 3ABRA 4G7FA 1O5QA 3N73A 1JDFA 3ME3A 1JYVA 3RX4A 3I3DA 3T2QA 3HTWA 1XLDA 1K3UA 5CSRA 2YW3A 4X3ZA 3H2EA 3FSUA 4YXGA 5FJPA 2OEJA 4FNPA 4HA1A 1NQKA 4US5D 5DT7A 1V6XA 2WVUA 3CXOA 3GWQA 5I03A 2X0YA 3R89A 1IV8A 4C6EA 4H8HA 4CCCA 1LL7A 2AMXA 3EDFA 3M4HA 3SUVA 3ZSSA 3UU0A 4JZ5A 1AK5A 2NX9A 1F61A 4RL3A 3N04A 1E0VA 1LRQA 4KWWA 3PPGA 4B2DD 5IXEA 3S9ZA 4CU6A 3ZR5A 3OA5A 3QPZA 4PBEA 3H55A 4Z2HA 2VI0A 1A5SA 5FF3A 4ZQOA 3ZT5A 1JPKA 2O4QA 1OADA 4XZ9A 5BMXA 1XJBA 2VC9A 1UP2A 2Y7GA 1VENA 4J3WA 1UH4A 4LBUA 2GZXA 4AHPA 3EA1A 4WGXA 3SCWA 4DN1A 4HU0A 1F76A 1QUMA 4C90A 4H8UA 4R27A 1GG0A 1E6XM 2DT0A 4D6EA 1R2TA 1EWDA 4IL0A 1BWVA 4ML9A 3W2NA 1GQJA 2HZGA 4F79A 3MP3A 3VFLA 2RKXA 4ALDA 2PODA 3NA8A 4CEXC 1TV5A 2I9EA 4NJGA 2F6UA 4WKHA 1WO2A 4GKLA 3ABOA 3LXCA 1F3EA 2CHRA 1UCWA 5HNRA 1D3CA 1TWZA 4LV9A 4IQDA 4ONVA 5REQA 1S2VA 2QHAA 4K1WA 3BC9A 3TTEA 4JN8A 4GMEA 2CZDA 1X7FA 4LQ1A 4FAMA 4Z1DA 3VIGA 1M7PA 3LOTA 1RQBA 5F2IA 4JHZA 4GLEA 3A4WA 2X7VA 4MDPA 1NFPA 1W1VA 3IJDA 4H7VA 3UWZA 2BFGA 5BU9A 3N2XA 2NQZA 1LROA 2AOSA 2ISDA 4DWSD 2C7FA 3N9RA 3URAA 3M0LA 4DUXA 2BASA 4RZ6A 3WBEA 2HBVA 2GVLA 3TQPA 5I3DA 1SJAA 2J7HA 2P88A 4OV9A 4LS2A 1UD5A 3UZJA 1R9ZA 1LF1A 3RR1A 3NGJA 4FOKA 5A6SA 1UG6A 1IZCA 3E74A 3V75A 4HB7A 3TN5A 4C1NB 3VE7A 2D20A 1F4AA 4HHHA 2C1HA 4HN4A 4MIMA 3U8GA 4PULA 4G6CA 3GH7A 5EMJA 1KM5A 5EB8A 4H9UA 3LTSA 2G41A 2WMIA 1LQ2A 3O9NA 7CGTA 4GIRA 4N7QA 4DO6A 1OIFA 2Q01A 3C52A 3W38A 3WF4A 4UFLA 1BTMA 1A3WA 3RPMA 4ZB0A 1QFEA 4GQGA 2FGBA 1ZY9A 3TQVA 1UZHA 3TXVA 1XINA 1KFEA 3VU2A 4WY0F 2HK0A 3EXRA 1H7NA 2DZBA 3GXFA 4ZFMA 3H70A 1R46A 4UQDA 3EMCA 3I7SA 7REQA 2E1DA 3IRSA 4C7GA 3NCOA 2IQTA 2C8NA 4FNSA 4IMGA 1NAL1 6ENLA 2Z6IA 5DO8A 2EG7A 1W1YA 4R53A 4DEFA 3OOQA 3QGVA 3BOLA 1WDQA 4Q4RA 1Z41A 3E2SA 4LYRA 3AHXA 4FLRA 4AC1X 3B05A 4XV0A 1XQKA 1Z48A 4XQ6A 2P1FA 1X98A 1JG9A 2AQOA 1AH0A 1WOAA 1TR9A 2ZC8A 4C6OA 2EKGA 2FYMA 5HMEA 5FA5A 4QDPA 3N11A 4B16A 3II1A 4A29A 3FA3A 4P8VA 3ZJ7A 1TIWA 3HO8A 4ERAA 4FHAA 2Z2BA 5AFDA 4G1NA 2VMFA 3ARQA 3SCNA 2R6OA 5FEWA 3TKFA 3C5QA 4WK9A 1IEVA 6TIMA 4IPIA 3P5YA 1NFBA 3NPWA 3IUDA 3AOFA 3L4TA 4JBRA 1GK8A 3NYZA 3M47A 3AI0A 2E9LA 5T91A 4J3XA 3ANUA 2G3JA 4V2XA 3ITLA 4NNCA 2BV9A 2BXYA 4JY9A 3T42A 1XGEA 2KAUC 4PODA 3W7LA 1V3JA 4XZIA 5I23A 3AZTA 3GFZA 1EJTC 1AG1O 1A5AA 1FWSA 1E40A 1OFOA 1H0IA 2OZ8A 4Y8EA 1BD0A 4WD0A 3N19B 2XDFA 5C9ZA 1D8WA 1TV4A 3PC0A 2J66A 1PSCA 2E5DA 4MGGA 9RUBA 1E71M 3S2JA 1XLJA 3UXLA 4BJHA 2ALRA 3BXWA 1QI0A 5G2HA 3BGGA 4GVIA 1TTJA 2PDPA 3QN3A 1DIKA 3DBPA 2BVTA 4U31A 1I9CB 3S5ZA 3XINA 3CL7A 4XAGA 1LM1A 4LUTB 4Q8NA 2AL2B 4ML4A 4NAEA 2I14A 4U2YA 4QAWA 4JCMA 5KZ6A 4DJEC 5AC7A 2BVWA 3EEGA 4KESA 5TAOA 3SRHA 3WMLA 4V1XA 3S2NA 3VAVA 4WCJA 2YFOA 1CBGA 1NDWA 3OGSA 1B0IA 5XINA 3GXMA 4WDWA 1UQZA 1IR1A 1VLWA 1PB0A 2GK1A 2VUNA 2IS7A 1W9DM 1FWIC 3OLIA 1BXBA 1E56A 3IGXA 4EIVA 3S1UA 1K8XA 4GCAA 3CPUA 1J0HA 2OWCA 2RDTA 4CD6A 3ARYA 1ME7A 3GU1A 1SMAA 3N3MA 4H9MA 3EWXA 4AY8A 1GZGA 1K8ZA 1C7SA 2QCGA 4JTLA 4KWUA 3VK5A 5D8WA 2QVHA 3GHRA 2PDUA 1XSIA 3T81A 1R3RA 4NJIA 2HISA 4CNPA 2IXUA 2Q71A 2FGZA 4KMQA 3TYEA 1NH6A 1X6NA 3ARWA 3W28A 1J0YA 2FZ9A 2DIKA 2A6LA 2Z1SA 3W70A 2ZX8A 2QCLA 4A22A 2NQJA 4CLMA 1W37A 3EA2A 1KQYA 4D2JA 1JDAA 5KTLA 1FKWA 2WVVB 1MNZA 4HCHA 3LHYA 1R2RA 3M44A 3RITA 1JZ8A 3HG2A 2C91A 5BOEA 3CT2A 3R0UA 4E3TA 4QX4A 4ENLA 2BXZA 4GI6A 5JU6A 1ZSXA 4M56A 4H6RA 3QY8A 3IIXA 2X1RA 1PZ1A 4DNHA 1LOLA 3BDKA 2PGWA 1XKYA 3QSTA 5D04C 3SY5A 2Q8ZA 2OB3A 4O53A 2FZBA 3LENA 1L6YA 4HKPA 4B3ZA 4DPQA 1OM0A 1ISXA 1EJVC 4LW7A 3SQMA 3HPAA 3RRXA 1UKPA 3LUTA 4ZOAA 3GDKA 3H22A 1KM0A 4QLLA 1PWMA 1Z9AA 4F48A 3W53A 1S1RA 3H2CA 2DPEA 4GJJA 5G1YA 5CZ0A 1XM3A 3KLKA 6TAAA 2ZADA 1FWCC 2GQAA 2YB1A 4IQLA 4E8DA 4AF0B 2DSUA 3I4KA 1FX6A 3S47A 3YPIA 4KRUA 2YPIA 5C9UA 4AIBA 4GCXA 5BOFA 2JF7A 1S5VA 2OR2A 4IXXA 1OFQA 5M5DA 1Y8BA 3TONA 2CLOA 3SCRA 3MQTA 2OGJA 2BDQA 3A5FA 3EWYA 3AS2A 5F1VA 2A79A 4WF7A 3ARRA 3FLUA 1QBAA 4AD0A 4R5EA 2P0OA 1FWEC 1SJBA 4R9XA 1WA3A 1GQNA 1LLOA 3VUSA 3TTYA 4HMNA 1P0BA 1QW8A 4GQQA 3R5EA 2TYSA 2OELA 5D37A 2A7NA 3UA3A 1V4YA 4DJDC 1EP2A 1CGWA 1YBQB 1OG6A 3K30A 4CD8A 1OC5A 3W73A 4TV6A 3GNNA 1EEPA 2PTYA 1NFGA 2QJHA 3RMEA 2EJ1A 4KF1A 5AOUA 1CZ1A 3WF0A 3G8EA 4ERIA 2UWFA 1EP3A 3AYTA 2O7QA 3PUOA 1O4UA 4OZOA 3FV9A 2WZEA 4Z2LA 4W5ZA 3QV6A 3EPNA 1EB3A 1KBJA 1UR0A 1E15A 5CGTA 5CCZA 4TQTA 3L4VA 5FAGA 3VDGA 4DWSB 5FCZA 4KFNA 1X7IA 3R11A 4R85A 1PKNA 3W83A 3T2PA 3LNMA 1TJ0A 3MB9A 1Q2RA 3WY1A 4HPHA 1ONWA 1NWRA 4IIBA 3NGFA 4UTJA 1JVNA 1A5CA 5B7ZA 2Y62A 3RU8X 1QOPA 3GVGA 3PZOA 5KEZA 1JCTA 5IFPA 1TQJA 4O8AA 3GTXA 1EOKA 2QPSA 1FCVA 3OVPA 1YDNA 3W1RA 2P50A 1I0DA 1ONRA 1RK6A 2VVSA 3FCPA 5K2ZA 3GZ3A 1AW2A 4ZQNA 4EOUA 1HL8A 4ATDA 2F2KA 5FF4A 2YL8A 4GINA 2OWWA 5T8GA 4MNMA 1GYNA 2QCDA 2CWXA 1XYMA 3VX1A 5E5CA 4MWAC 1VQTA 2WC4A 4AQLA 1KM6A 1K9EA 3MUY1 3TYBA 3P0XA 1J5TA 4O28A 2ZXAA 4QE4A 3W86A 1S1PA 1H7WA 3P60A 2PBGA 2NT1A 1E1CA 1E0UA 3B9OA 1KW1A 1OEPA 5DRIA 3M43A 3C86A 4BEQA 3V5CA 3QYQA 4LBSA 3FA4A 3NIYA 3C2FA 1GOXA 2CFFA 1XBZA 2GQ3A 1S3TC 1I8JA 2YOCA 1KBIA 4Y90A 3PULA 3GHSA 1M3UA 3NG3A 4PCSA 1B30A 4R33A 3RO6A 4GACA 3P7YA 2ZTKA 1MO0A 2I5IA 4HZ8A 1AA1B 5LIUX 1GVYA 1EEXA 1QK0A 4PTNA 5C7VA 1ZPTA 3D6NA 3VUPA 2AGTA 4IMFA 4DJED 4QG6A 4WDXA 4GO8A 1I2RA 4XD6A 1U2YA 3HB9A 1TZZA 3OPSA 3WDJA 1GVOA 4DF0A 1B9BA 3OQ8A 2BMBA 3TR2A 4HK5A 2XUCA 3PAOA 1UR1A 2VWSA 1UD6A 2VC5A 3VD3A 5E9XA 1JD7A 3URNA 3ERPA 5I02A 1UR2A 2B7NA 1N55A 2DSVA 2BNJA 1CXHA 3OLGA 4NILA 4J28A 2ZUWA 1G0CA 4LYKA 3V0UA 5M03A 4NX5A 4PMYA 4ZQMA 4JDYA 3HPFA 1GW1A 2VEFA 4PUUA 3VI2A 2WHKA 2WYSA 2ZX9A 4UZUA 1F6PA 2VGFA 3TW6A 1A5OC 1KFLA 6REQA 3DU0A 2OOGA 1HJXA 3SO7A 4AISA 2OEKA 3G1AA 4NY2A 4IT1A 3AXHA 3VXGA 2PA6A 3WENA 2E8YA 3MHUA 1EIXA 1PDZA 4UZSA 5HK4A 1SVDA 3OLEA 3VMOA 3LBOA 1REQA 4TX6A 1JPMA 2D2OA 1GZJA 5CC6A 1F7BA 1G01A 4QRNA 1Q6CA 3ARPA 4Q6JA 4BQ5A 1YHTA 2RAGA 3P81A 4D6DA 4DZ5A 2FGLA 1XPGA 5IOBA 3UVAA 4E8CA 1AW1A 2VQUA 4XWUA 1S5TA 4XD3A 2FH6A 2PCQA 1AJZA 4LAUA 5M17A 3ZJ6A 1JPIA 3T7VA 4MB3A 1L9WA 3DZ1A 2GFTA 5BWAA 4IGHA 1GTEA 2JKAA 3AXXA 3UERA 4D71A 2YBTA 2GJXB 4ZOBA 3UG4A 3VE9A 3PR2A 4LPCA 3TYAA 1DTUA 4WQ6A 3QVQA 2AKMA 5IBXC 2HE5A 1XD1A 4O4WA 5IRPA 4HHPA 2GJPA 4UCFA 3LG3A 1GOIA 1OABA 3QQ1A 4M24A 1TV3A 4L61A 1RSCA 5HMSA 4CD4A 1QPNA 4Z1CA 5D2TA 3OP2A 4DXKA 1AODA 4JKMA 4CGTA 1DTNA 4E4UA 3W7HA 1TV7A 1F74A 3CMGA 1CT5A 3GNOA 1UPPA 1OINA 3C8FA 3PZIA 3U6WA 3ISIX 3N9KA 2D24A 2QDDA 3CV7A 3GG1A 4PEKA 4WSHA 4WSJA 1GVIA 2PU1A 4QROA 3DYOA 4UTFA 3TC7A 4R7JA 4A8IA 3GX9A 5A6LA 4Y9MA 3CO4A 1EJ7L 5EFDA 1ML1A 4GYFA 5FJRA 4FXSA 4CQ9A 3N18A 4KH2A 1O60A 1MXDA 2ZA2A 4AMCA 3SJ3A 3TWBA 3NFUA 3B8WA 1H3GA 4GXPA 2V3EA 1WDPA 4GZIA 5E9AA 2E1WA 3VGFA 3C0SA 2CU0A 1FWAC 3ZVHB 3GVVA 2NXGA 1O1ZA 2EAWA 1H1YA 3DYPA 2MUCA 1XLCA 3KTCA 1FP9A 4FNTA 2CLHA 2A7PA 2IQDA 3MUZ1 1MNSA 4E2BA 3GXNA 2H3BA 3B8SA 2PURA 3OBKA 1AH3A 4LVDA 1OFEA 3VNJA 4GI4A 2FHCA 3DGBA 2E09A 3WDRA 3DHFA 4K38A 3IARA 2JEPA 3BCFA 3W24A 4HNCA 4OTKA 3NDYA 3WQ6A 1YNPA 2X42A 4JTIA 3W72A 2QJNA 1O12A 1ZBKA 1MVYA 5LYRA 2V3FA 4Q8QA 5JBDA 2W0UA 3W6YA 3S2MA 4RPQA 1VEOA 3N34A 3SN1A 5CPOA 4NRRA 4FNQA 3E3HA 1FDZA 3B0XA 4P7OA 1GQIA 4DAFA 4C60A 4QBXA 3KL3A 4KWOA 5LXXA 3CJPA 1CXIA 4GE8A 4B5UA 3L21A 4Y96A 3PANA 3D3FA 2A4AA 4YN5A 4O52A 3U48A 3DCPA 1SO3A 3FHAA 3QOMA 4GABA 3ARUA 4YWIA 2XSXA 1P7TA 4MVAA 3UJSA 4QAIA 1UWUA 3WJYA 4K1GA 4EACA 2QR6A 2ZX7A 3PTMA 3CWHA 4JX4A 3UF9A 3S2LA 2GOUA 1AVAA 1H7OA 2KZHA 5HAOA 3TTOA 3WDPP 5BXRA 4OU1A 1DE6A 4LT9A 3UPWA 2GGGA 4OBRA 1J0KA 4QQ3A 1DPMA 1OD0A 2XVGA 2PUZA 3LZ3A 4Q4KA 1GORA 1YTKA 2GWNA 4MJMA 2XFWA 4V27A 3SAZA 1L8NA 1WKEA 3OVQA 3PBWA 4ASTA 4HGXA 1H7XA 1M6JA 3JZUA 4AXKA 4UNIA 3VMPA 2WOQA 4MF4A 1RBOB 2QDEA 4K8EA 2W27A 3SGGA 3TJLA 2XHYA 3P61A 1E1EA 1KKRA 3QHOA 4ZOCA 3QH2A 1V0MA 1V0LA 3TFCA 2F2HA 3W87A 3K4WA 4C5ZA 1L6GA 4JNYA 5IHRA 2Y5EA 4OGZA 4XBKA 1VCFA 5D30A 3IJ8A 2QJIA 3L4ZA 4HPGA 1AMYA 4JX5A 1QW9A 1JJKA 3G1VA 1FFQA 2L5HA 1HX0A 3MZ2A 3AMDA 3NOYA 3LCIA 3GZAA 2CLKA 3C2YA 3CWNA 3OQEA 3SGUA 1TMQA 2MANA 3AU6A 3VIOA 1XX1A 4PTWA 3MSYA 3M07A 2FDMA 3WF1A 3DG6A 3FN9A 3AIQA 3ABSA 3E0IA 4R88A 4CNSA 2C6QA 1R3YA 5DLCA 3TOPA 3IV3A 2WO5A 4O8RA 4QS5A 3F1QA 2VYOA 4IOTA 4AD4A 1HNYA 5HQMA 2ZWYA 3O05A 3ZXWA 4JTGA 4O12A 3LB0A 4Z08A 5HINA 3RU6A 1RA0A 5AECA 5F2MA 2VCBA 4U5KA 5HNUA 2VGBA 1K7FA 3VDBA 1TKKA 5TQLA 1M01A 1DWJM 4P61A 2AAMA 3B97A 1BKHA 4H6KA 3DBNA 3LY0A 3PJWA 4GNJA 1BYAA 1WXZA 4KFOA 2F6XA 3WELA 2V2HA 5FJJA 1TWDA 4N4QA 2ZZ3A 2AL1A 3P74A 4HT3A 3HG4A 3UPMA 4LAZA 2PTZA 2EEXA 3BL3A 3ALFA 4TVCA 3SADA 1BF6A 3KS6A 3ITGA 1W9XA 2QJJA 4Z2JA 1E6QM 3NZGA 1EDQA 1VJSA 4Y9NA 5LNRA 6XIMA 2QT3A 3TOYA 2QXWA 4IF2A 4BHYA 2J8TA 3SIMA 1W3NA 4RPPA 2Z1XA 3CYVA 1VYRA 2QV4A 4TO8A 1QHPA 2YJQA 2OJPA 2XH7A 4HNVA 1HGWA 2ABBA 2OKTA 4KIRA 2DW7A 1B3YA 3QKZA 4M6VA 3MHFA 1U1JA 3MYOA 5CSUA 3TVAA 1OY0A 1RR2A 1LUCA 3HURA 3PSWA 3WNKA 3KAOA 4X0VA 4C7DA 2Y63A 3F03K 1BYCA 3WNNA 3KCOA 3UT0A 3NDZA 4ZO6A 2O56A 1J9YA 4HJFA 3HG3A 4M1BA 2WKGA 1WV2A 1RAKA 2YA2A 2I57A 3LHTA 3POHA 4EAYA 3WD1A 1FP8A 3FJNA 5JMUA 2DY3A 2TSYA 3LRMA 4URIA 2CLIA 1WCGA 4DRSA 4CU8A 2BG5A 3N4FA 2QPXA 1EOMA 1UUMA 3RLUA 2VCAA 1JZ2A 1LBFA 3RGTA 3SCTA 3EX2A 3WMCA 4E4FA 2XWEA 1K6WA 2Y1HA 1FXQA 4K2SA 3MTWA 2YDAA 3NL6A 5LNSA 3HQNA 3VVGA 3ZVIA 4GA8A 3UGRA 3R0KA 2C19A 1SO6A 1W54A 4XUGA