1FH9A

Crystal structure of the xylanase cex with xylobiose-derived lactam oxime inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh9A00
4UFHA 6A3HA 1OSEA 5M5DA 1MW2A 3EDJA 2WK2A 3WH8A 4WKHA 1BGAA 3RJYA 2G3MA 7A3HA 3VDHA 4YPJA 2Y5EA 3GNRA 2VOTA 4MB4A 4UFIA 2PWHA 1K6AA 3SCOA 3W26A 1DWHM 3NSMA 4M24A 2BNJA 1CGXA 3OGRA 4EAMA 4LYRA 1WCGA 3A47A 1C90A 3SUWA 4FLQA 1CGVA 2YL5A 1E71M 2G3IA 4S3KA 1UR4A 1WB0A 2DT2A 3T0BA 3SURA 3OBAA 2XYLA 1CBGA 1WPCA 1HKIA 2W91A 2XIBA 1XH2A 2JEQA 4GPNA 4AZ7A 4AD1A 3VD5A 4OOUA 4P8UA 2BHZA 1EH9A 3WF0A 4UNIA 1ZBVA 5FOOA 2A3HA 5E70A 2RGLA 2CNCA 4HZ7A 1SR0A 1W91A 4HZ8A 2CETA 4C7DA 1CPUA 1B3WA 3ECQA 2BY0A 2C8NA 3ZJ8A 4M8UA 5BRQA 1V0LA 4ACZA 3WDJA 1UD5A 2WM0A 1W9DM 4MADA 3MS8A 3WMSA 3W53A 5ECUA 2BY3A 1QNRA 1V6VA 1UZ4A 4E8DA 1F4AA 2WVUA 4H8VA 3CUGA 1NH6A 2VNCA 5CLTA 1WZKA 3RIKA 3CZGA 4MDOA 4CUCA 5I77A 2WW5A 1L0PA 3ARQA 3VPLA 2VQTA 3WENA 3N1AA 1YQ2A 3MUZ1 3EMZA 1K9FA 1V6XA 1W9UA 1JI2A 3AMKA 3IK2A 4D6GA 1OINA 4PMDA 1OT1A 4GQRA 1EXPA 3PZUA 5KEZA 1E4NA 4UZSA 1W3KA 3OB8A 2DIEA 2WMJA 3MMDA 2WMKA 2YIHA 2WSKA 3WQ5A 3AIVA 2W5FA 3BMVA 2UY4A 3K46A 1PBGA 2B31A 1XCXA 2X2YA 1TVNA 1JDDA 3M07A 4MB5A 2WHJA 1US3A 5DF0A 2CEQA 2J4GA 3AIRA 3QOMA 4WK9A 1KR0A 3U5YA 3W38A 1C8QA 2G41A 2WVSA 1KFWA 2JALA 3WDIA 2GUYA 1UR9A 2WHMA 2PWDA 2WCAA 3GZAA 1ITCA 1E70M 5IHSA 3RM8A 1MXGA 2ZUUA 4MDPA 4GZEA 1J0JA 1ZJAA 4U3CA 3WH5A 1GW1A 4JIEA 2Y8VA 1NP2A 4D6JA 3CMGA 2GSJA 1GOMA 1ZS2A 2A3EA 3BAYA 2DGAA 2XTKA 2D22A 2VCAA 3AFBA 3OLEA 4H2CA 4AY1A 5KZ6A 2XHYA 1VFFA 2QLYA 3BCFA 2ZXAA 3KWXA 4ZE5A 1GNXA 2O9PA 1CXEA 1JAKA 1QI3A 4UOZA 1W32A 3AYRA 3ARZA 1V6YA 4FMVA 1KCLA 1MQQA 4GINA 1M7XA 4F66A 1E0XA 1WDPA 1UQZA 3W27A 1HNYA 1CXKA 1D3CA 4JZ5A 4JCLA 1CTNA 4TVDA 1TCMA 5A2BA 4D6CA 1HF6A 2E40A 1X6NA 1NM9A 2OWWA 4OBRA 5CGTA 1DWJM 1MFUA 1JAEA 2VVNA 2XGBA 1QI2A 1TMQA 4AZCA 1VFOA 3DHUA 4CD8A 2W66A 2ZX5A 2YDSA 1V3KA 2WZHA 2VC9A 3L4VA 4WLCA 2JIWA 3VMNA 3GNPA 4MNJA 2DQXA 3N13A 5FL1A 4P7RA 1UR1A 3CHDA 2ZUVA 3ZSTA 3CUJA 7CGTA 4J28A 3W28A 3ZSSA 2IXUA 4HA3A 2ZWZA 3WQVA 2ZX7A 1CNVA 4H7VA 1V0KA 5EB8A 3UCQA 4HOWA 4PTXA 3SCWA 3CTTA 3WUFA 5A8PA 2CIPA 2UY3A 2OLHA 5A6SA 1CXLA 4YHEA 4CD6A 2ZICA 2BVYA 3AOFA 5A8NA 2WMIA 1EA9C 4M82A 1OM0A 2O9OA 4MB3A 4Z2JA 2OWXA 1PX4A 1W2PA 2J8FA 3L2MA 3NDZA 5I6SA 3QOKA 2VL4A 1GHSA 3VDAA 3ZT7A 2ZWYA 1FP9A 4ATLA 3MSGA 5A94A 2WMFA 4NI3A 3VKKA 1N82A 1VFUA 2WANA 3LMYA 4B16A 1UH4A 4W89A 3WF2A 5D8WA 1KXTA 1KXHA 4UFKA 3UESA 5EFDA 2WCGA 1ESWA 4AIUA 5I0DA 4U3AA 3EDKA 5HPOA 3WD4A 4JL2A 5LA2A 2E3ZA 1OIFA 2BS9A 2J25A 4JFVA 3W37A 5GNYA 3WL1A 1KXVA 5AC4A 1US2A 3BCDA 3RM9A 1V3HA 1BYDA 8A3HA 4UQ9A 2VR4A 4PTWA 4QP0A 4AD4A 1HP4A 3VILA 1GZJA 3AI0A 3ARWA 2JFEX 4MPKA 1YHTA 2E9MA 3VMOA 1C8YA 1Q6DA 2IUZA 3AXIA 4UZUA 1LJYA 2VUYA 3NSXA 1I1WA 3S6TA 2WZIA 2E9BA 2VX7A 3LPFA 4CVWA 1B2YA 2GK1A 3W6LA 1FFQA 1SFSA 4QLLA 1RD6A 2BY2A 1JFXA 1W3LA 1WO2A 2ZE0A 1QHZA 1W9XA 3FHQA 4KGJA 1F4HA 1E0VA 3AXXA 3WBAA 1JXJA 4DWSB 3WN6A 4DWSC 2JIEA 4H8HA 2YL8A 4E4PA 2YJQA 5CPTA 3TONA 3DC0A 1CENA 2CBVA 5CSYA 2E9LA 5CG0A 3ZO9A 5DO8A 1CXFA 1GOWA 4S3JA 4PMNA 5IFTA 2E4TA 3CIVA 4DUXA 1EHAA 1R8LA 2WNWA 2YBTA 4W87A 3W4RA 3SCPA 1D7FA 2ZUSA 2WBGA 5I3DA 3ZJ6A 2Y24A 1MWOA 1JF6A 3UERA 1GOQA 3AIBA 1JYWA 2D0GA 5HOSA 4URIA 2G8ZA 4D6EA 1D2KA 2YDRA 2X1IA 1SYTA 4Z2HA 4J3UA 1V3JA 4EK7A 4Q22A 3PZOA 4CN4A 3ZJKA 3AHZA 5I5RA 4MAVA 1JNEA 4CD4A 4NZCA 3BMWA 3VIJA 4JKMA 1V08A 2XFYA 5IXEA 4V27A 1ECEA 1CGYA 4OIFA 1JI1A 4PUEA 2DSUA 1XSKA 1AQHA 1UHVA 3N11A 3N15A 3N9KA 3SCVA 3WQ8A 1E55A 2CHOA 3MU7A 1C7TA 4PSPA 4GIAA 2CXGA 1WE5A 3WMCA 3CHFA 3DYMA 1PIFA 2J62A 2ZUWA 3GH7A 5LYRA 4UFMA 1H0GA 3T09A 2XWDA 1C93A 2WZEA 2NSXA 2JF7A 3PTKA 3EMQA 4M1RA 4M29A 1VBUA 4H8UA 1NWUA 1MW3A 1R85A 5BROA 1H4PA 3I3BA 1W9VA 1Q6FA 4AIEA 3U7BA 2VMFA 1BSIA 1GONA 1MFVA 1AMYA 3VX1A 2AAAA 3WNKA 2PWFA 3AMLA 4JL1A 3POCA 2VRQA 4QDMA 3WKZA 2CBJA 4MAZA 1LL7A 6TAAA 2J75A 1SMAA 3W82A 2EBNA 5ABFB 1EIBA 5EFFA 1JZ8A 1E5NA 5A6LA 2PF0A 1VJSA 1GJWA 1M01A 2G3NA 1ISVA 4UTFA 1OBAA 4Y7EA 1GUVA 1E4LA 3FHAA 4RE2A 2J77A 1JXKA 1PZ3A 3SCNA 1UKPA 1NOFA 1UD4A 1BGGA 1W3HA 2XIIA 4GXPA 4W8AA 2BHUA 3EBVA 1WKYA 1HKKA 1XGZA 1W9PA 3IAQA 4CD5A 1CLVA 2D24A 5JBFA 5D9NA 1C8XA 1JYNA 2V5DA 2F61A 1LG1A 2D2OA 1HJQA 2TAAA 4KMQA 4DWSA 1W2VA 4DM2A 1NOUA 4OUEA 4QLJA 1IZKA 4PCTA 1OT2A 3AICA 1E40A 1ODUA 2WYSA 2J74A 3J7HA 2CBUA 3VM7A 2ZUNA 1E6PA 4CD7A 1UD8A 4F9JA 1GQLA 1BG4A 3WUBA 2EXOA 4U2YA 4GO8A 2QPSA 4HU8A 2YA2A 2FH6A 1RP8A 1HVQA 4P7QA 3LPOA 5A2AA 2VCCA 4PMOA 4FLSA 3VD4A 1V6UA 1QOXA 2DT3A 2X0YA 4CVUA 3TP4A 1UWTA 1H2JA 5HBFA 1HKJA 2BV9A 1H41A 3WNLA 4F9DA 3JUGA 2Q8XA 4GZIA 3CUFA 4GQQA 2WCSA 4AZCB 1FH7A 4UCFA 5HXMA 5E0CA 1BLIA 4AD5A 2FHBA 3T2QA 1EGZA 3ZR5A 1HX0A 5I78A 1KGXA 2OSYA 4PUDA 2XPKA 2DT1A 4QFUA 5A8QA 1UKQA 4XV0A 4P8XA 1H5VA 3GNOA 5HDRA 1DWIM 4C7GA 1ZBCA 2WHLA 3AROA 3GBEA 5BXRA 2BY1A 3VOCA 1U30A 4W8LA 2UWFA 2J7HA 1FHDA 3AZTA 5CQ1A 4XX6A 9CGTA 1EDQA 1GOIA 1HL8A 2WMIB 1LWJA 1HVXA 1I75A 4U31A 5GNXA 3ARVA 5BYWA 3AS2A 3VMPA 5ABHA 4WSKA 3MKKA 2FHCA 4P7OA 3U7VA 4J3SA 3PZNA 2UY2A 1UH3A 1RH9A 3W81A 1EQCA 4ZENA 2BVTA 2J7CA 3PHAA 2D3NA 2VZSA 4CU7A 3SUUA 3RJXA 1VRXA 1WNOA 1MW0A 4PMYA 2A3CA 3PN8A 3WD3A 1CXIA 3GBDA 4CU8A 1TR1A 4B3LA 2GJXA 3ZQ9A 3GXDA 5ABFA 3E1F1 3PZVA 3IJ7A 2PB1A 3AHTA 2BXYA 5ABEA 4D72A 3AYSA 3CZKA 3WH7A 3THCA 1UR2A 3VVGA 1EQPA 1B3VA 2C7FA 1NWRA 3BC9A 4CKQA 1Q6CA 1BAGA 1OWQA 2DDXA 3DYPA 4BF7A 4K68A 3RMEA 1HJSA 1GVYA 4F79A 5FD0A 3VINA 1UWSA 3L4WA 4MJ2A 3WF4A 3TTSA 4UQCA 3A3HA 4HPHA 4W8BA 1UG6A 1LLOA 3BGAA 2GFTA 1FFRA 3AIEA 5A6KA 2ZUMA 3S2CA 1V3IA 1HXJA 3HN3A 4AD0A 2WC4A 4HOXA 3WQWA 1KQZA 1O7AA 1NQ6A 2FH8A 4BQ2A 1K9TA 2V5CA 5CGMA 4JAWA 1XHGA 4HU0A 1DTUA 1H09A 1PEZA 4RE3A 1K9DA 3N18A 4KWUA 4PMRA 1ZJBA 2NW0A 2GK1B 2DSZA 1C3FA 4X0VA 3ZR6A 2O92A 3VIPA 4KGLA 3WL0A 1TA3A 1SMDA 3W24A 1JF5A 4JFUA 1UH2A 2QHAA 3RILA 2WKLA 2JF6A 4J3WA 1B3ZA 5I79A 3CMJA 1V3LA 1Z32X 4MTVA 1R7OA 2EJ1A 3K4DA 1QNOA 3OZPA 4PCSA 4HZ6A 2VO5A 4UOJA 1AQ0A 2JE8A 1BVZA 1VEPA 2QV4A 4E8CA 2V3GA 3U5UA 4GI8A 3WELA 5DT5A 2ZX9A 4D6HA 4ATDA 3SCRA 3CUHA 7TAAA 2G4FA 2YKKA 5CSUA 2EPLX 3T2PA 2CYGA 2WPGA 3BAIA 3WDRA 5E09A 2X09A 3KL0A 3VIFA 1E1EA 4D1JA 3RDKA 3PZQA 1J11A 4HP5A 4P7LA 1NWSA 3VD3A 4PN2A 5F7UA 4UQBA 1OGGA 1JZ7A 4JKKA 1WDQA 1E5JA 2CITA 1B3YA 3MUY1 4A3YA 2Y8KA 2WMHA 3A4WA 5JIPA 1BPLB 1ISYA 1ZL1A 3O6AA 3WEZA 3WY1A 4B9ZA 2ZXDA 1H3GA 2Y4SA 3MMUA 3CH9A 1E73M 3PZ9A 2OWCA 4TX6A 2J8GA 3F5KA 4HMDA 1E15A 1CXHA 1HIZA 1PX3A 5D9MA 1ZB5A 4ZFMA 2VURA 1V0NA 3AJ7A 4EANA 1XYZA 1OD8A 2FGLA 3PZMA 4BCEA 1LWHA 4J3TA 3AIUA 2WSPA 2PWEA 1W3JA 1ITXA 1XSJA 4C7FA 3GTNA 3FAWA 3OZOA 5CPQA 3MSDA 1QNQA 5BXSA 2YDQA 3W29A 1CDGA 3AHVA 4W7VA 2E8ZA 4P8VA 1IZJA 4OZOA 3CHCA 2CHNA 1B3XA 3AZRA 1C92A 4CN1A 2PWGA 2QMJA 3U57A 3AZSA 1G9HA 1GHRA 1TE1A 3L4UA 2EQDA 2CKSA 1E6ZA 1O6IA 1FHLA 3WUEA 3PTMA 4HTYA 3UG3A 3WF3A 4PMVA 1MQPA 1QW8A 3B9AA 4UQDA 5D9OA 5C70A 2F2HA 1VB9A 2VQUA 1OIMA 3CPUA 4PMQA 1HJXA 3NYDA 4LXFA 2PBOA 1XD1A 1XCWA 4W88A 4D1IA 5C71A 4BZYA 2V38A 2FDMA 4D71A 4WJXA 2ZOXA 5C8BB 4D6IA 2CPUA 2E0PA 1DP0A 3FY1A 1JZ5A 3B8SA 3KL5A 4AZHA 4AD2A 3UR7A 1LL4A 3LPPA 4Z2LA 1QW9A 1MYRA 4UR9A 1NWTA 1BYBA 4DUWA 1LG2A 1EDTA 1QBAA 5E6ZA 3WNMA 1CGWA 3VD9A 4XZWA 1HJWA 2AMGA 2OYKA 2W61A 2VCBA 4WKFA 3FAXA 3OIHA 3NJ3A 3L4TA 4YN5A 1FP8A 1HP5A 5ABGA 4TTUA 1BF2A 4PTMA 4H04A 1E6QM 4WIWA 5GQBA 3W6MA 3ZIZA 3AMGA 2MANA 1L8NA 4OBSA 4W7UA 3CHEA 3VO0A 1EDGA 1K9EA 2VRJA 3MANA 4PBGA 3NSNA 1XH0A 1UKTA 4IPNB 4BQ5A 3WBEA 4DUVA 3UETA 3SUSA 2CESA 3VD7A 4XZBA 2GDUA 1C7SA 2XVGA 4YHGA 1J0HA 1W1TA 3CZJA 2CERA 3MMWA 1GOKA 2Y2WA 3KE0A 2VTFA 3FW6A 1NOWA 4N0RA 3AHXA 1H0IA 4CU6A 1B31A 2GJRA 4UQEA 2D1ZA 4TXEA 1UA7A 2Z1SA 4JFWA 4AXNA 1DEDA 3PBGA 2QF8A 2DH2A 5BCAA 3AS0A 2XJ7A 2O9TA 4GKLA 1J12A 2VZVA 3FNDA 4QLKA 4L4OA 2EEXA 1EO7A 1W1PA 1J0IA 3VM5A 1JD7A 2YA1A 3GXFA 1WDRA 3B9DA 1IT0A 3GYCA 2W67A 3BH4A 2XVPA 2IXVA 3IJ9A 4AISA 3EYPA 2WMGA 4UQAA 3WDPP 1M03A 2W92A 2V3FA 2HISA 3SEPA 2NT0A 5I23A 5HPCA 4NRRA 1B30A 1E1FA 4AZBA 2XWEA 1QNSA 2GJXB 4HPGA 2XSBA 3QR3A 4AZ6A 1JYVA 3AQUA 3VNYA 1UD3A 1P6WA 1DWAM 2G3JA 4KRUA 1UD2A 3CLWA 1KQYA 1KWKA 4A4AA 4N42A 4BQ3A 1EHNA 3GXMA 4AWEA 2VZOA 1W1YA 3VGHA 5A6AA 2WBKA 5BWFA 1JIBA 5E0FA 1AVAA 3GH5A 1XYFA 2DSVA 1Q6GA 3ARRA 1CZ1A 3CUIA 5AYBA 5AC5A 1DWFM 2VI0A 2YL9A 3II1A 1V0MA 3SIMA 3FXYA 3IANA 4QCFA 2WXDM 3ZT6A 5I24A 1JFHA 3MV01 4TX8A 4D6DA 3EDEA 1KGUA 3G6MA 2NT1A 3VGBA 3VGGA 2D20A 1WZAA 4Z2IA 1H11A 3L2LA 3BSGA 1TA3B 4J27A 2OSXA 5AYIA 2DT0A 3QHNA 1UKSA 2XFRA 2WLZA 1C91A 3WNNA 2ZX8A 4X0NA 4AEEA 1PIGA 2ZXQA 3DHPA 3NDYA 1UWQA 2DSWA 2VX4A 1PPIA 4P7NA 3SUTA 3ARYA 2ZUTA 2CKRA 3WEMA 2EO7A 1NP0A 1KBKA 3K8KA 1E0WA 2WVTA 3BSHA 5D9PA 1U33A 3KL3A 4Z2KA 4J3VA 1VAHA 4AZIA 4LGXA 1XRVA 2WLYA 3T08A 3QHOA 2YA0A 3MO4A 5GNZA 1E6XM 1QBBA 5TD4A 2ZIDA 4AW7A 2BFGA 3VX0A 5IFPA 3D3AA 3WSUA 1QHPA 3VNZA 1NARA 2HVMA 1TUXA 2Z1KA 4XB3A 3UEQA 2J7GA 2ESCA 1XV8A 1OGBA 3SCQA 4J3XA 3DYOA 1R87A 1PZ2A 4TVUA 4ZXOA 5BXPA 3VIGA 3EDFA 4B3KA 3K8LA 4V28A 1UZ1A 1GORA 1G01A 1BG9A 5M3WA 2EPOA 1LQ0A 1B9ZA 2XGIA 1JZ4A 5DT7A 4W5ZA 3NUKA 2UY5A 4U2ZA 2J7DA 3SCUA 4AIOA 4PEEA 2YL6A 4AC1X 3ARPA 1E6NA 4PMUA 2XM2A 2QPUA 3WFLA 3EDDA 3WEOA 1BFNA 1HN1A 4J7RA 3ARSA 4NF7A 1GCYA 2WAGA 5A8MA 1JL8A 1ISXA 4M56A 4HMEA 3RO8A 5DFAA 3K4AA 3GXIA 2WHKA 1QHOA 1V02E 1UOKA 4R27A 3BAKA 4LYQA 2PC8A 4V2XA 1S46A 4ZE4A 5GPRA 1E3XA 1E6SM 2J7BA 4Z2GA 3IAPA 4LPCA 2D3LA 2EPNA 5DEZA 3PTQA 4BQ4A 1MXDA 1E6RA 5BXTA 3HJEA 1V6WA 5HNNA 2V3DA 3GH4A 2XFFA 3T0DA 2GJPA 2X0HA 4LX4A 3L4YA 3W25A 1HJVA 5FCZA 4PMXA 6CGTA 4IUGA 4MNMA 3VU2A 4H41A 2J78A 1PX8A 1B1YA 1GOOA 4CN6A 3AHYA 3ALFA 3UR8A 1ISZA 1IV8A 4WF7A 3WD2A 3TOPA 3SCTA 1HJUA 4W85A 5CPSA 1KCKA 4AMCA 2J7FA 5M03A 1OCQA 5E6YA 4CCCA 3ARUA 1W1VA 3RPMA 3SUVA 2WC7A 4XUYA 1CECA 1KWGA 1M53A 1E3ZA 3VDBA 2YLLA 1BYAA 3TTOA 1GVIA 3F4VA 2V3EA 3A6OA 3AS1A 4JFTA 4OOZA 3CBWA 1VEMA 2DH3A 1G5AA 2RGMA 1QNPA 4OKDA 3ZMRA 4TTGA 4RE4A 1PAMA 1FOBA 1G94A 1CGUA 1JNDA 1WP6A 2CCRA 3AIQA 4B9YA 3O2LA 1E4MM 1UKOA 5JBDA 1VENA 2WVVB 4W5UA 1WDSA 1BHGA 1DWGM 3ZOAA 3ARXA 1WAWA 1ZBWA 3QGVA 4GI6A 2BXZA 4LYPA 2A3AA 4KH2A 3CZLA 3WQ4A 1EOKA 1FA2A 2AOSA 4UFLA 3AXHA 4TUFA 1EOMA 4JHZA 3TA9A 3T0AA 2C0HA 2CBIA 1I1XA 1VBRA 4Q7NA 1MW1A 5A6JA 1W9BM 2W62A 1TVPA 3N17A 4M80A 4PSRA 4CCDA 5I2UA 1JZ6A 3AS3A 1VJZA 2DEPA 3OG2A 3I3DA 1FH9A 1WZMA 1U2YA 3CGTA 4W7WA 1B0IA 5DMYA 2EPMX 4JHOA 2OSWA 1Q4NX 4MJ4A 4DM1A 2WKGA 3CO4A 4BS0A 4TOQA 3CZ8A 2WC3A 1UYQA 2D23A 3WD0A 3ZM8A 1DHKA 1UWUA 3T2OA 3D5HA 4ATWA 3PZTA 1ODZA 1BTCA 3WMBA 4KRTA 3MUAA 1UQYA 3LPGA 4BA0A 1CLXA 1E56A 1VEOA 3N04A 4A3HA 1OB0A 4JFSA 1J0KA 1XSIA 3ALGA 1HKMA 2X05A 3WDQA 1OGSA 3EMCA 4ZEPA 5JUVA 5A6BD 2XUCA 4U33A 3IJ8A 1WZLA 1MVYA 3WF1A 2YBUA 4TVCA 4PTVA 4AYSA 3ZT5A 1UWIA 2W63A 5LA1A 3N12A 5E9AA 1VFMA 4CGTA 4HOZA 5A6BA 4R5EA 4F8XA 3QHMA 3I3EA 2WWDA 3OGVA 4GO9A 1G1YA 4JCMA 3ARTA 1HL9A 2OYMA 1R86A 3UG5A 2YOCA 1E43A 3GDBA 8CGTA 4MNLA 3OLGA 1JZ2A 1UA3A 1CWYA 4MB1A 3AIWA 3WH6A 2GDVA 3BLPX 4EKJA 3BAXA 1J0ZA 1LF1A 2XSAA 1CYGA 4QAWA 5EBAA 3TTYA 1GPFA 3WNOA 4PRWA 3AMCA 5D8ZA 3OGSA 5IDIA 4L4PA 2D0FA 3BLKA 3VIHA 2BVDA 3WIJA 1RP9A 5EMYA 4EE9A 5CXPA 1J18A 2O9RA 1JZ3A 3VIMA 1J10A 3MV11 1GQKA 4E2OA 1UD6A 3HMCA 1OD0A 4M81A 3VDCA 3B9EA 1G0CA 2QMKA 1CIUA 4FK9A 4AD3A 5A2CA 2ZX6A 3APGA 2WVVA 1TFVA 3NCOA 1BQCA 4AZGA 2DIJA 3UG4A 4AZ5A 3BAWA 1KB3A 1UWRA 2VZTA 4PYSA 4UOQA 2DSKA 3BAJA 2XVKA 3VUPA 1TZ7A 1JD9A 1QVBA 2W4XA 2VR5A 3VIIA 4NRSA 5A1AA 3ZJ7A 4WSJA 2OYLA 1XD0A 3F5JA 1A3HA 3OLIA 1A47A 1VIWA 1BVNP 4GI9A 4IM4A 4FLRA 5JIWA 2WB5A 5A69A 1BYCA 1GJUA 2FGZA 3AMDA 1V3MA 4UFJA 1LL6A 3AISA 3TTQA 1HT6A 1QPKA 4WKAA 2FHFA 2ZXBA 4U5KA 5FIPA 2X8RA 1GQJA 5FL0A 1H49A 5M17A 2J47A 3VIKA 1B90A 2XM1A 4P8WA 3VGDA 1JDCA 4ML4A 1KBBA 1E72M 2VX6A 3MUIA 3KEHA 3WFZA 4FLOA 2JEPA 3RM4A 3VGFA 1J0YA 2F8QA 5A6MA 1JYXA 4ZXLA 4B15A 3L4XA 2YLAA 5IHRA 1J9YA 4CCEA 1M04A 1XH1A 3WQ6A 3FN9A 2J79A 4U5IA 1QI5A 4W93A 3WUGA 4JKLA 3WDHA 4FF5A 3POHA 4PMZA 2EPKX 1XC6A 1KXQA 1GQIA 1E9LA 1ZU8A 5AY7A 3NIYA 4IPLA 4ACZB 3K1DA 1J01A 1CEOA 4HA4A 4RL3A 1UR0A 3M6DA 2D0HA 2GVYA 3VTRA 4W86A 2VJXA 4D6FA 1V03A 3A4AA 5CJ5A 3WD1A 3OA5A 1Q6EA 3VGEA 2VZUA 1Y7VA 1X6LA 3M7SA 3DECA 5LA0A 1EO5A 2VT0A 1UUQA 4GZJA 4AEFA 1KGWA 4IISA 3HU7A 2XG9A 2VRKA 3G6LA 1V02A 1X1NA 1UR8A 3KZSA 5JBEA 3BXWA 1KR1A 3VIOA 4W84A 1RPKA 1MQRA 3WNPA 3PZIA 1E4IA 1PJ9A 3K8MA 1VF8A 1ISWA 5A95A 4MNKA 3SCSA 5CLWA 4DWSD 3RCNA 3W0KA 1QI4A 5CZKA 2WWCA 3GM8A 3THDA 3WH9A 4ACYA 4HMCA 4QCEA 1CGTA 1FH8A 3CZEA 2VX5A 3OLDA 5BRPA 2E8YA 1JG9A 2XVLA 5A3HA 5D4YA 2XVNA 2VVSA 4NSBA 1ZBKA 3F5LA 2A3BA 1QI0A 3O9NA 1R7AA 2BHYA 3M46A 2PBGA 3A4XA 4X9YA 5A8OA 2DPEA 1H1NA 4HA1A 3L4ZA 2PI6A 4LQ1A 1AQMA 2J7EA 3PZGA 5FKYA 1JDAA 1JGIA 4OJYA 1TG7A
chains in the Genus database with same CATH superfamily
2GJNA 2YW3A 4UFHA 6A3HA 1P48A 3VABA 3QXBA 4WSHA 3WH8A 1SUXA 3HGSA 3RJYA 2Y5EA 3W2NA 4DI8A 2DJLA 5G4EA 4MB4A 4ICNA 4UFIA 2PWHA 1SSGA 3MUCA 4PFHA 5CEWA 3NXLA 4BJHA 4C60A 3BTNA 3OGRA 4IGMA 4GWEA 1C90A 3SUWA 1E71M 1XLDA 5JH1A 3GFZA 3SGUA 2DT2A 3MI2A 4XBKA 1WX0A 1WPCA 1HKIA 1MEWA 4AX6A 4JN6A 3GU2A 3CK5A 5G1TA 1EH9A 1LRTA 2B7NA 4UNIA 5FOOA 2A3HA 3T6CA 5E70A 4HZ7A 3G1DA 4C7DA 1XLIA 3RX2A 4Z1YA 4D9PA 1B3WA 4JR5A 3V75A 1V0LA 2ZVIA 1UD5A 4GUHA 3WDJA 2YX0A 3KHJA 4GQ0A 2HWGA 3U0HA 4DJFC 2BY3A 5LHEA 4E8DA 1F4AA 4H8VA 2QCDA 1AZ2A 4MWAA 2VNCA 4E6MA 3S1UA 3KBWA 3CZGA 4MDOA 4WEVX 2WW5A 2HNHA 1EL3A 3H53A 3BW2A 3HGOA 4XWUA 4ML9A 4R9XA 3MUZ1 1K9FA 3A3WA 3PBYA 4ALDA 3AMKA 4D6GA 2GSHA 4L64A 4HSNA 3U4AA 4GQRA 4D8AA 5KEZA 3ITTA 5E5CA 1TV7A 3OB8A 1MRQA 1XIIA 3KW3A 4XO6A 3GWQA 1FWJC 3OP2A 4FX7A 3L2IA 2WSKA 5LGXA 1QT1A 4FSAA 3K46A 3QC0A 2X2YA 3ITVA 1EF2A 4MB5A 2XH0A 1US3A 4MYXA 2CEQA 3OYZA 3QOMA 3QVQA 1DJWA 3APYA 5CBIA 4H6KA 1NTHA 4MM1A 4F2TA 3EWBX 2WHMA 4O8RA 2V5BA 3JR2A 2OMAA 3RM8A 1ZY9A 4MDPA 1O94A 4OBTA 2OTDA 4JIEA 4GJIA 2YSWA 1Q6QA 1WDDA 2V8ZA 1O5RA 1PSCA 4LVGA 2GSJA 2NLIA 2Y8UA 4YCPA 2XTKA 2Y88A 2VCAA 3HPFA 3OLEA 1XBZA 3P14A 3W7GA 3BCFA 3IUDA 4N9EA 3QKEA 3VKDA 4WDTA 1XLLA 2OODA 3TJLA 2FFIA 3SB0A 1J93A 4N7QA 3AYRA 3V5OA 1KLZA 1KCLA 4E3VA 1M7XA 5LIKX 1TJ0A 1WDPA 3W27A 2BVWA 1JJKA 1CXKA 3H2OA 3LRLA 3CQIA 4WCJA 2PGFA 1HF6A 3FA5A 1MUCA 1YPIA 2OWWA 2F6KA 1PHWA 9XIAA 4AZCA 1TYGA 1EJUC 4LJ3A 1VFOA 1K4HA 5BWAA 4CD8A 1DVJA 2ZX5A 4YJ5A 2YDSA 3PUDA 3L4VA 4WLCA 2JIWA 1XDJA 4IIDA 4GFSA 4J4KA 3TYAA 2Y70A 1RBAA 1UR1A 3ZSTA 4B5UA 4R3UA 1PV8A 3KOZA 3W28A 3ZSSA 4IHCA 3GDTA 1XDLA 2V6AA 2O56A 3GW3A 4HOWA 5EB8A 4PTXA 3CTTA 5A6SA 2OLHA 1Q2RA 5HWJA 4C6IA 4CD6A 4ZQOA 2ZICA 2BVYA 1ZTVA 2AQWA 3DGBA 2QQ6A 1BXBA 1XPGA 1EA9C 1G7UA 5HUPA 4O1CA 2WNNA 2O9OA 2FVMA 2GZXA 1PX4A 3SZ8A 1Y65A 2IKJA 2J8FA 2HNEA 5IDZA 2VL4A 4HIBA 1GHSA 3VDAA 3ZT7A 4QJ5B 1R47A 4WUIA 4EXBA 1VBHA 1JCMP 1W17A 4PH6A 4NI3A 1M7OA 4GIRA 4UXDA 3PB2A 3Q65A 4TR9A 2V9DA 3S1WA 3C5QA 1UH4A 4ORIA 5D8WA 1SVDA 3UESA 4JXCA 5EFDA 2BOGX 1LOLA 3E0IA 5I0DA 5HPOA 4OECA 2PTDA 2E3ZA 1F6KA 2O0TA 5T26A 4O4VA 4K8GA 3W37A 1KXVA 5AC4A 3BARA 5D2WA 4LY8A 1T96A 4PTWA 1RLDA 1VYSX 1YE4A 1ECQA 3VILA 3ARWA 3RX3A 3H54A 4RNFA 1K7FA 2C14A 3VMOA 1C8YA 3FFSA 2AAMA 2WZIA 1ADSA 4LCQA 3LPFA 4A3UA 1U1HA 4Y96A 1B2YA 2GK1A 3W6LA 1ICQA 2BY2A 1JFXA 5KZDA 4NJKA 2ZE0A 3C0SA 2A3LA 4YNGA 3WBAA 3KBNA 4AWSA 1QPOA 4DWSC 4H8HA 1MXSA 5CPTA 3H12A 1IWBA 4NJJA 5DO8A 4LAKA 1XGEA 3U48A 7ENLA 1Q5MA 3LTPA 3TC3A 1R3YA 3CIVA 1EHAA 2WNWA 3WQPA 4IFRA 3W4RA 4JQ4A 1GYNA 3FGCA 2XFWA 1W3NA 5I3DA 3ZJ6A 1JF6A 2A2IA 1D2KA 1BEUA 3C8NA 1V3JA 4ZO6A 1EX1A 3P5YA 3PZOA 3ZJKA 3QQWA 4OVXA 4RW3A 5CKSA 4MAVA 1DTNA 4KEZA 3UYIA 1I45A 2YPIA 1SFLA 4OWGA 4JHMA 4FXFA 1V08A 3PY2A 4V27A 1ECEA 4OIFA 3C0LA 5BNKA 2J13A 1UHVA 3YPIA 2GSEA 3QQ0A 1POJA 2PAJA 4MZ8A 3RO6A 3N15A 4YU1A 5I03A 4OV4A 3WQ8A 3BJSA 1WOBA 3H2FA 5G4HC 1QRQA 2Q8ZA 1WE5A 4GY1A 1PIFA 2P3ZA 4NUWA 1EA0A 1KA9F 3QY7A 1C93A 4Y8FA 1ELSA 2NSXA 1FCBA 4H2HA 2JF7A 4M1RA 4PZVA 4Y9NA 1R3SA 3TSBA 2E6FA 2YYUA 3S9ZA 2HRWA 4YWSA 4DVOA 3KBJA 1R85A 5BROA 4MFDA 3I3BA 1W9VA 4Q4PA 2VMFA 1GONA 3WNKA 2AAAA 1TV4A 3POCA 2VRQA 4QDMA 3WKZA 4GVGA 4H8NA 2G5WA 2E67A 1OG0A 3W82A 3WLNA 1NDYA 4N6EA 5EFFA 1QXLA 5A6LA 3FCPA 1GJWA 1M01A 1WKDA 1GKRA 2EG8A 4B5WA 4J5NA 1R9ZA 4C6MA 1CCWB 2IMRA 1GUVA 4Y7EA 3KOXA 1F3EA 4RE2A 2B0MA 4IMDA 4CQDA 3SCNA 5DMNA 4ZSTA 1NOFA 1UD4A 3NFUA 4G9PA 3T4WA 4PBEA 3VKJA 3HFYA 3RAOA 3VZXA 3JW7A 1FHVA 3IAQA 2V82A 5D9NA 3GU9A 3NOYA 1LG1A 2B7QA 1HJQA 2GGEA 3IEBA 3MI6A 4PCTA 2C16A 1OT2A 1UJPA 2BASA 4WHBA 2CBUA 2QIIA 3VM7A 3W7NA 4JS3A 2ZUNA 1E6PA 3PC0A 4NZ5A 3WUBA 4MSSA 2Y1HA 2FH6A 1FY6A 4KCVA 4E8GA 1FWTA 3UP8A 2VDGA 3S42A 2DT3A 2XSXA 3LI0A 4DY1A 5HBFA 3SN0A 5DCDA 2BGSA 3CQ0A 1XINA 3WNLA 2Q8XA 1SGJA 4GQQA 2WCSA 1HTIA 1FH7A 1FKWA 1V5XA 4F0RA 5E0CA 4AD5A 2VELA 4L1GA 2FHBA 3T2QA 1EGZA 3G3MA 3TCEA 2J8TA 3AUJA 3QMTA 1UKQA 3PNUA 4XV0A 3GNOA 2PF8A 3TJIA 5HDRA 3U8GA 3HV9A 3MP5A 3L5AA 4LRSA 1VCFA 3LXCA 3KCOA 2J7HA 4XX6A 1EDQA 4U31A 2XH2A 5GNXA 1YTEA 4PCFA 3NZGA 3AS2A 3DUGA 1EIXA 2I56A 3R79A 3U7VA 4K38A 3LM7A 4C1LA 4UTTC 3W81A 1EQCA 1SJCA 1W5PA 3P82A 4JGDA 4HK6A 2OOFA 3ID7A 3QMSA 3W07A 3RJXA 1A5MC 3NTYA 1VRXA 5H8PA 4E4FA 2A3CA 3PN8A 5ABTA 5AC6A 3SJ3A 3PAOA 3FDGA 3GBDA 4MLJA 4B3LA 3GXDA 2IW0A 3KP1A 1DKWA 1VFHA 3AYSA 3S1XA 4CNUA 3P60A 1UR2A 3B9OA 3VVGA 1EQPA 1B3VA 1NWRA 1EJXC 3N2MA 1BAGA 3I6RA 4NKCA 1F9CA 2VC7A 1SFTA 4RNHA 3NPXA 2BGNE 5B7YA 3A3HA 4A05A 4HPHA 4A3RA 4JTCA 5FF2A 2FMOA 3BLOA 3WQWA 1KQZA 1VR6A 4BQ2A 3THUA 4HU0A 3H23A 2DZPA 4HT3A 4PMRA 5JVLA 1ZJBA 2FPYA 4EACA 2DSZA 3LD5A 3ZR6A 3GYEA 3TW6A 1RV8A 2PRMA 2YCLB 2R94A 5F2MA 3W24A 3ITOA 4JFUA 2OO6A 1QUMA 3ZXWA 2JF6A 1B3ZA 1ZENA 3TW7A 5I79A 3TLQA 3CMJA 4MTVA 1OVDA 2CU0A 3MB9A 3ZS4A 2VO5A 2JE8A 4HKPA 2TYSA 2QV4A 5REQB 2WM1A 4O4WA 3CWHA 3DXIA 4JX4A 5DT5A 1Q13A 1Q4WA 5AHLA 4ATDA 3L7RA 2YKKA 1LOQA 2WPGA 3WDRA 1EBGA 3PJUA 3LNPA 4D1JA 4HP5A 3V3WA 1NWSA 4FNUA 3SY8A 4PN2A 3H2MA 3WLJA 4QRNA 4XAFA 5JXQA 1E5JA 2CITA 3OZMA 4RJEA 4S23A 4A3YA 4IJCA 3LS9A 2QZRA 2QF7A 1BPLB 4L9ZA 1H3GA 2QJMA 3ONBA 2QS8A 1HIZA 1PX3A 4IGSA 5D9MA 1SZRA 1V0NA 3B0YA 1NFPA 4EANA 3C0JA 2FVKA 4ZQCA 2OELA 3PZMA 4K8EA 4NYYA 4Q6XA 3LY0A 2Z1WA 3AIUA 2QCFA 2PWEA 5C6MA 3FAWA 3GVRA 3EOLA 1A49A 1YYAA 3W29A 3AHVA 4P8VA 3DN5A 1IZJA 2NQLA 3CHCA 3VCNA 4GOAA 1B3XA 1C92A 1T8QA 1YE6A 4CN1A 4LF2A 4RXFA 3AZSA 3UGVA 4H6RA 5C2XA 1VPXA 3MJMA 1S3TC 3L4UA 2EQDA 1G4EA 3GFXA 4IQDA 1RVKA 2I1OA 3PTMA 4HTYA 2J6VA 1MDRA 5XIMA 4IPIA 4PMVA 4JQ2A 4W9TA 1QW8A 4UQDA 3W72A 1OIMA 2HPIA 3CPUA 3S5NA 3W7OA 4Z08A 2PBOA 2ZRVA 3N4EA 2DP3A 1KM1A 4IMGA 3ATZA 1F7BA 3FYOA 3OO2A 3P3BA 3CQHA 2ZOXA 1A80A 2AMXA 1VRDA 4DZIA 2CPUA 3SSZA 2E0PA 1JZ5A 3UXIA 2EJAA 2ZTJA 3KL5A 1TIWA 1WKEA 3LPPA 4Z2LA 2Z4GA 4F0MA 1RQHA 2ZZ3A 5IBXC 4UR9A 4LWWA 1BYBA 4AFYA 4MMWA 3S2JA 3VOJA 5E6ZA 1QBAA 1CGWA 3VD9A 3W87A 3QEZA 3H2EA 4UWMA 4I3GA 3L4TA 1VYPX 1DQXA 5D03A 1R2SA 2GOUA 4PTMA 3M0VA 2Y85A 1RLCL 3N2TA 4UTKA 1K70A 5LNUA 3VO0A 1EDGA 1K9EA 1EYWA 3MANA 3WYZA 3NSNA 1XH0A 4G7FA 5K9DA 3UETA 2ZRYA 1Q2SA 2GDUA 5GJMA 3IIXA 3QMRA 1RY0A 3MMWA 1FWHC 5HANA 3G1YA 2I14A 3TXZA 2D1ZA 4LVDA 5H8MA 2CLHA 2G3FA 4FIRA 3K5XA 3BK0A 5BCAA 3UWYA 5I00A 4NHVA 5FF0A 1JVNA 4G1NA 2AKZA 1WBJA 2ZKMX 3KRUA 4WY0A 1J12A 2A6LA 3ZLFA 4QLKA 5E9XA 3G0SA 1E9IA 1J0IA 1H7OA 3JRKA 5XIAA 2NWSA 1R3WA 2PS2A 2NV1A 4XZNX 3SGZA 2CLPA 3GDRA 1IT0A 4DQWA 1TWDA 3HURA 4YCOA 4AISA 3EYPA 3TYDA 3W73A 2W92A 3G1RA 4JTIA 5GVJA 1LWIA 4DO7A 1NELA 3W1LA 3M64A 2XWEA 5BOOA 2GJXB 3TIMA 5JMUA 3WBXA 3N34A 2XINA 2ZADA 3CIWA 1P6WA 1I2NA 1EPXA 3REQB 3V7PA 1N8WA 4V33A 3KRSA 4FALA 3W2JA 5CJNA 4N02A 1B4EA 4N42A 4BQ3A 1DJYA 3TNBA 4I8DA 3C3NA 5A6AA 5BWFA 3UCCA 3M5VA 4AF0B 3GH5A 3H2CA 1XYFA 3PBVA 3M43A 2PDJA 1DWFM 4AMAA 2OU4A 1QATA 4G7EA 3FKKA 2PU1A 5I24A 1PB0A 3NL2A 4D6DA 3EDEA 3PP7A 1F07A 4DJEC 5J04A 2C91A 1H11A 1OZMA 1TA3B 3EX4A 3C86A 1J4EA 3KVKA 3ZWTA 3LSBA 4LC8A 2XFRA 4ZQPA 4P5UA 1XLBA 4AEEA 4AG0A 2ZXQA 1EUNA 3NPWA 4P7NA 2CKRA 1H1YA 1NP0A 4AX7A 2WVTA 3VOFA 4Z2KA 4AZIA 3VOIA 4LGXA 3RLUA 4WOQA 2VFDA 4HNUA 3T08A 3QHOA 5GNZA 4QS6A 1E6XM 1QBBA 4AHOA 2XH7A 2ZZ5A 1XYCA 3WCZA 2ATMA 3KS6A 4FX6M 5IFPA 3WSUA 3VNZA 1NARA 3QYSA 3UVAA 2Z1KA 3GUWA 2J7GA 2C79A 1G4SA 1OGBA 3SCQA 4F0SA 4HHMA 1RPXA 2PDLA 4V28A 1UZ1A 1GORA 1SO5A 3FJLA 1TMHA 2C1GA 3G18A 1RK5A 5SWUA 3R10A 2OZTA 1ZCOA 2UY5A 6PTDA 5CPNA 4AIOA 1MI3A 2HV5A 2YL6A 3ARPA 1E6NA 4S2CA 3TOYA 3BO9A 1W5MA 1P6BA 3F4WA 4S2BA 4J7RA 8TIMA 1NFGA 4LU0A 2J9XA 3S0CA 1PKLA 4HMEA 3RO8A 5DFAA 1J6OA 3SJNA 4LANA 1V02E 4EWJA 2RKXA 4R27A 1OC6A 3LHVA 2PC8A 4C6DA 3O06A 4MHBA 3ME3A 4JDBA 2AQVA 1E6SM 1MMFA 4IIGA 4LALA 3BURA 3EB2A 3CL7A 3A24A 3PTQA 3N19B 5BXTA 1V6WA 2A1YA 2HVOA 3SDOA 2XFFA 1ADDA 1RCOB 1KTCA 2GJPA 4O19A 3M5XA 4LX4A 1BKHA 4QROA 1KFBA 3AHYA 1IV8A 1FTXA 4J2PA 4ZBCA 4NYUA 5F4XA 3SCTA 4W85A 3UZZA 4AMCA 1OCQA 5E6YA 5PTDA 4CCCA 5FJUA 1U5VA 1GYLA 1G67A 2BDQA 1XQLA 1XYMA 4XSLA 4D2JA 1XIJA 2P88A 2YLLA 4RW5A 3TTOA 3QM3A 5EBUA 2FJUB 3F4VA 2PGRA 3A6OA 3EWDA 3ES8A 3T44A 4LUTB 1A3XA 3PUOA 1R46A 4OKDA 4FO4A 1JNDA 5HQEA 3AIQA 1E4MM 4JY8A 4ERAA 4L65A 1UKOA 5JBDA 1VENA 3W76A 3HIJA 1W37A 3G1AA 4O1AA 1N2VA 3QGVA 2GVEA 4XAZA 3CJPA 1RJRA 3W7RA 2B7OA 1DJXA 4LYPA 2A7NA 3F7JA 4UFLA 1FA2A 1XCFA 2YXGA 3QLDA 3IK4A 4QAIA 4TUFA 4XZMX 1N55A 1RSCA 4JHZA 4KCUA 4JYFA 2CBIA 4NAEB 1VBRA 5A6JA 1W9BM 1TVPA 3A21A 4K7VA 5AFDA 2YZ5A 2PPGA 2X7WA 1WZMA 1JPIA 1U2YA 2QCGA 2Y62A 3CGTA 4H6QA 2OR2A 2EPMX 1CW2A 4JHOA 2OSWA 4DM1A 2WKGA 2CLEA 3MHUA 4RPPA 5EKYA 1P7TB 4Q7BA 1DXEA 2V5KA 4O16A 3D5HA 1R3QA 1BTCA 1WAUA 4KETA 2ZZ4A 4JTJA 2I16A 1VEOA 2R24A 4B5TA 1XFBA 3WDQA 3TJXA 3GUGA 2EKCA 3EOUA 4HNLA 1VYRA 2W79A 3TTEA 2NXHA 4QS5A 1JPKA 3WF1A 4DJFA 5LA1A 5HJYA 3DG3A 1VFMA 3FKRA 4EXAA 1DQWA 5A6BA 4R5EA 3FJ6A 1AW5A 2R9RA 4HU3A 3LLFA 3C56A 1FX6A 1S2AA 4JCMA 3ARTA 3H8AA 2VWTA 3RF9A 4JQAA 4RE0A 3FEMA 4LNYA 4QGCA 4IFKB 1S38A 3G8RA 1S2CA 3AIWA 4MG4A 2GDVA 5H6HA 1DIOA 3BLPX 2FTYA 3A9IA 3A13A 3CIXA 3VNMA 1FBAA 3CUZA 4RDZA 4PRWA 3AMCA 5D8ZA 4DXXA 1IEWA 1GTEA 3SRFA 4FNRA 2D0FA 2Q71A 3BJFA 4ZGYA 3KHDA 1EZ2A 4UTMA 4LUTA 1J10A 1FXPA 1GQKA 3NM1A 3PBMA 1OD0A 3VDCA 4DZHA 3B9EA 5MHBA 1QO5A 1GTHA 1XIMA 5AYXA 4M5PA 2DIJA 4S3FA 4AZ5A 2OXNA 3NQ2A 1IEXA 1UWRA 2PCEA 2VZTA 5FJPA 3TROA 1D8WA 2VR5A 2VFHA 4IWWA 3VIIA 4R7OA 3R5EA 4JTFA 4AB4A 3MKCA 1XD0A 3NEHA 3B8VA 3WLKX 1VIWA 5AZ0A 4GGHA 5I3GA 3GAYA 3UD6A 1QPRA 3RXZA 1Z9AA 3AMDA 4UFJA 4C91A 5L6UA 3BJTA 1HT6A 4WKAA 2RDTA 2X8RA 1GQJA 3XINA 5M17A 2G0WA 1IE7C 1W3TA 4LT9A 4P8WA 4Y8EA 2HS6A 3P2VA 4I5XA 5EYWA 2VX6A 1KM0A 3MUIA 4Y9PA 4FLOA 3RM4A 3ZWSA 2F8QA 4PRRA 4ZXLA 2YLAA 2J79A 3LTYA 2OQHA 5K4ZA 2F84A 4W93A 4Y9MA 3FK4A 4IZGA 3WDHA 1SW3A 4PMZA 2EPKX 1XC6A 3TZNA 1E9LA 1YEYA 4PMJA 4FHAA 4CNOA 2V68A 4RL3A 1TJRA 1UR0A 4X63A 2VJXA 1YXCA 2BXVA 3MHFA 3A4AA 3ENLA 4A8NA 3ABRA 2ZCGA 3CMFA 4Q6JA 2FB3A 4MWAC 3NVTA 3VGEA 1Y7VA 2D2GA 3HPZA 3H2NA 3M7SA 3QQ1A 4G8TA 4AEFA 4GFIA 4IISA 1ZALA 4FF7A 3W7QA 3HU7A 4KIRA 3G77A 2J27A 3E6EA 1PDZA 1V02A 5EMMA 3A12A 1R9XA 4O15A 1PHQA 3PG8A 3PWAA 4XISA 3VIOA 3L5MA 4PGLA 1RPKA 2PZ0A 1MQRA 3WNPA 5C0QA 1TPVA 1CB7B 3MW7A 1PJ9A 3UJ2A 1VCVA 1OABA 5A95A 3SCSA 2PEVA 5CLWA 3W83A 3RCNA 1LBMA 3QPEA 5CZKA 3I10A 3WJSA 3S47A 1F6YA 2G4JA 2E5DA 4GLEA 2FTPA 3E0VA 3HBLA 4HMCA 3TSMA 1FH8A 4IL0A 4OQVA 1DPMA 1ZJHA 4DYKA 3MSRA 4IF2A 1ZBKA 3F5LA 5LZLA 2A3BA 3SW6A 1KM4A 1OFOA 1Y0EA 3CYVA 5J5DA 3V18A 2PBGA 3A4XA 3QGAC 3L0GA 3M0LA 2DPEA 4X9YA 1H1NA 4JTEA 4DF0A 3OTRA 2V63A 4O1DA 2C15A 3PZGA 5FKYA 4UIOA 4OJYA 1TG7A 4HSHA 4ASTA 1RBLA 1Z7AA 4QQ3A 4TX9A 3PTDA 2GQ3A 3TZFA 1FWFC 3VZZA 5M5DA 1UB3A 3TDFA 1G69A 2WK2A 3OODA 1GVOA 7A3HA 4YPJA 3GNRA 5TNVA 4DHGA 2X40A 3H7RA 1R6WA 4LYRA 2PZNA 2V67A 5F4WA 1IYXA 3R4IA 3KRZA 4S3KA 1ZJIA 6ALDA 3F1QA 3KX6A 2F7FA 4IQLA 2NQ5A 2GWGA 3LM3A 4S38A 3F2DA 3AWOA 3MTWA 3OBAA 1SJAA 5LIXX 2W91A 3TR2A 1KFEA 3TMLA 2JEQA 3AXKA 4GPNA 4S1FA 4AD1A 5D09A 1R2TA 4OOUA 1PCWA 3WF0A 3NL3A 1JUEA 4K7YA 4Q4RA 2RGLA 1SR0A 2CETA 3A9BA 3HFTA 3ECQA 2BY0A 2RUSA 3R8RA 2VFFA 4JICA 5D02A 2BOFX 1TV8A 4TV5A 3W53A 5ECUA 4F48A 3EEZA 5BU9A 1QNRA 1V6VA 3Q94A 5HAOA 1NH6A 1P6CA 1XP3A 1M9HA 4CQBA 4ZO7A 1WZKA 4LAZA 4B3ZA 3EWUA 1TX0A 4J3ZA 5LSMA 4IX2A 2ACSA 5I77A 4FNPA 3C2FA 3ARQA 3WENA 3CC1A 4NAFB 3BG9A 2Y7EA 3EB3A 5IOBA 1OINA 3UPMA 4NNBA 4WOZA 3WQCA 2X42A 4PUMA 1RQEA 1W3KA 2DIEA 2WMJA 4X2PA 2WMKA 3WQ5A 3LHUA 4DBWA 3G0XA 3BMVA 3ANUA 3I6TA 5CZ0A 2B31A 1L9WA 1JDDA 3M07A 3MA8A 2WHJA 2P3EA 3LSCA 3W38A 1C8QA 2G41A 3C2EA 4MKVA 4PCPA 2VOMA 3WDIA 2FQIA 2H9AB 3DG6A 1OX4B 3GZAA 4M0XA 1E70M 5B80A 3TV8A 1DJHA 4UBPC 4RR4A 5F2IA 4U3CA 1MEHA 3E5PA 1GW1A 1UP3A 1NP2A 3N2OA 3USZA 1ZS2A 1ZHAA 3AFBA 4AY1A 5KZ6A 2QLYA 1GW9A 5C54A 3KWXA 4ZE5A 4LUJA 4XD6A 1PIIA 1CX9A 1T40A 3RLHA 2YBVA 1V6YA 2C1HA 3W75A 2QYGA 1HNYA 3DFOA 4JZ5A 3LGGA 1TCMA 4TVDA 4ROPA 4UNLA 4EPKA 2E40A 1X6NA 1XKJA 1X8CA 4X22A 2PGWA 3HA1A 4Y9OA 5CGQA 2BWGA 1DWJM 1MFUA 2I7GA 1JAEA 2XGBA 2QDEA 1TJ1A 2FZBA 3O05A 3ABZA 4XKYB 2WZHA 5I3JA 4YTSA 1NJJA 1XLFA 3W2KA 2HBXA 4H83A 2HZGA 2YXOA 3S5YA 3M41A 3GSMA 1W54A 5HQLA 3FA4A 4HGXA 2F6UA 2W0UA 3O16A 3WQVA 2ZX7A 4NNCA 1V0KA 2ZFAA 3PPCA 2YDAA 2P0OA 2R8WA 2UY3A 1CXLA 3GR7A 1J2BA 1S3HA 2ABBA 5K9CA 3PBWA 3NWRA 1SJDA 3WLPA 5A8NA 3R0UA 3VC6A 2PDCA 1VHCA 4M82A 4H1ZA 1OM0A 2B7PA 5ECVA 4UTTA 3S1GA 4I6VA 5AHEA 1NEYA 3GDLA 4H9XA 4ZSUA 1S1RA 2A21A 4CNPA 4DI9A 4F40A 3MSGA 3PG9A 1RBOB 1N82A 3R11A 3LMYA 3QW3A 5EMUA 5CPOA 4DO6A 4NAFA 1GVFA 1UP2A 2INEA 1UBPC 4IMFA 4UFKA 4JTDA 4GI4A 1XLJA 2QR6A 3S83A 2D2JA 1OIFA 2J25A 3VCRA 5GNYA 3WL1A 3HG5A 4HTBA 2GYIA 4MKSA 1US2A 3BCDA 4HN8A 1V3HA 3P8JA 1BYDA 1EB3A 4AD4A 3MP4A 1HP4A 3VXGA 1A5SA 4O10A 4US5A 1I2OA 3EPOA 5LIWX 4L1XA 2QIWA 1TPFA 4OU1A 2VX7A 4CVWA 3G0UA 3IIVA 2ACQA 1FFQA 4CNSA 1RD6A 1VHNA 3GZ3A 2ZRWA 1W5OA 3KLKA 2WSRA 3FHQA 1J5TA 1F4HA 3AXXA 3RHGA 4OFCA 4GC3A 5FSDC 2NUWA 4E4PA 5JQ9A 2W27A 3GLCA 3MSYA 3THAA 5DN1A 1QU4A 2NQ9A 3B97A 5IFTA 3PF3A 2E4TA 2RDWA 3DHFA 2KX9A 2YBTA 1MUMA 1R8LA 4W87A 1K8CA 4AVFA 3STCA 4ZQMA 2ZUSA 2WBGA 4GX9A 1EXBA 3UERA 1GOQA 5G4WA 4LH8A 1Q6RA 4URIA 2YDRA 3LV5A 2X1IA 3TWAA 4Z2HA 4J3UA 3WLIA 1M7PA 4M6UA 1Q6LA 2RDXA 2OLAA 4CN4A 2DW7A 3AHZA 1ADOA 4PC8A 2WOQA 2FKPA 3KAOA 1T8XA 4WGXA 2PP3A 2HXUA 3V16A 1E51A 5IXEA 4U10A 1AW1A 2G97A 2QDDA 3N11A 1LUCA 3LHWA 5FJIA 3CXOA 1OK6A 3G8EA 3N9KA 1E55A 1WXJA 3MU7A 2OLSA 4ZO8A 3IPWA 4PUUA 2BB0A 3OVGA 1VFLA 2CXGA 2ONEA 3DYMA 1RCQA 4RZ5A 3TYEA 3GH7A 1ONXA 2R1KA 4UFMA 1H0GA 2XWDA 2WZEA 3TU9A 2JK2A 1EYEA 1YTDA 4M29A 1VBUA 2Z24A 3RNDA 1NWUA 4DYJA 1EUAA 1H4PA 3AXMA 3GU1A 4KWSA 1JULA 1BSIA 3VX1A 3EA1A 2PWFA 3AMLA 5HK4A 1OF8A 2CBJA 2OGYA 4MAZA 1LL7A 3EWYA 4J2MA 3V0TA 5LNVA 2EBNA 3FX4A 3MT1A 4GA8A 2G3NA 4ORMA 1ISVA 1Q66A 1OBAA 4ES4A 3I6EA 3B0UX 3FHAA 3E3HA 3WK2A 5F2GA 1AUSL 4YVPA 1POKA 4W8AA 1N8FA 3GDMA 1K02A 1MNZA 1EEPA 3C8FA 1DE5A 1HKKA 4FEZA 5IBXA 3BOFA 4QQUA 2YCEA 2F61A 1GEQA 3EKZA 1EGMA 3GX9A 4DM2A 4B4FA 3GFYA 1IZKA 3W1PA 3AICA 4LYKA 3BGGA 3GIQA 3J7HA 3EB4A 1T6MA 2WJZA 5HINA 3M9YA 1BG4A 4DAFA 2QNEA 1EJTC 1KTBA 5FEZA 5D37A 5A2AA 4DO4A 3UNTA 3ZZ1A 1DIEA 3TN4A 2PDYA 3VNDA 2XGZA 1UWTA 3B0XA 4ZZ9A 1Q3NA 2BV9A 2GOKA 3QZ6A 4DYEA 1H41A 2V5JA 3EWCA 4H7ZA 4F9DA 4GZIA 1J6PA 3TKFA 4WXZA 3JZUA 3L9CA 1OFAA 3HG4A 5KETA 1KGXA 2OSYA 3F2CA 3SR7A 4ZB2A 2DT1A 1TRIA 4QFUA 3RX4A 4K37A 3IARA 4LUYA 3SAZA 5H1WA 3H21A 3IJLA 4C7GA 4JPGA 1XS2A 4JY9A 2WNZA 3N2BA 1W1IE 3GBEA 4LEQA 5HNUA 1FHUA 3NZ1A 3VNLA 4DAIA 4HPJA 1K8ZA 1U30A 1H7PA 1FHDA 4AVNA 1GOIA 2WMIB 1HVXA 5LKYA 5BYWA 4GKTA 2NWRA 4WSKA 4J3SA 3LG3A 1FWSA 2YR1A 1RH9A 4GYJA 4X2RA 4QG6A 4QG9A 1PXGA 3T05A 3UQNA 2FJKA 1UZHA 4RV8A 3XISA 1WNOA 4PMYA 3WD3A 1CXIA 2RAGA 4X3ZA 3DDMA 2DZWA 4CU8A 1TWIA 4C6BA 1K4GA 4PULA 2EG6A 3H4GA 3PZVA 3IJ7A 1PKMA 5ABEA 5LIUX 3NDOA 2IPWA 4QEEA 1GEHA 3N3MA 3DYPA 1FCQA 4A2SA 3RMEA 1HJSA 1V6TA 4ONVA 4NJHA 2XDFA 3H70A 2CLIA 4JTLA 1UWSA 3L4WA 3WF4A 4UQCA 2XIQA 4RLIA 1ITQA 5MKGB 4FZIA 2DFAA 2PE4A 2Q01A 5A6KA 2ZUMA 2WC4A 3LV6A 4BEQA 1NQ6A 2FH8A 1W1A1 5CGMA 4JAWA 1XHGA 2GLKA 3O15A 1DTUA 1H09A 3BL3A 4M6QA 3W7KA 4DJEA 4JN7A 3HPAA 4GX8A 3ATYA 1NF7A 2BTMA 3RR4A 1SMDA 1KLYA 3I4EA 1OFQA 2YCIX 4DZ5A 2L5HA 1V3LA 1H7WA 2PLJA 1QNOA 3OZPA 3QSRA 2ZBTA 2TPSA 4PCSA 1EF3A 5TAOA 3GXPA 3GVGA 4B5VA 2V2DA 2WSYA 4O8AA 1PUDA 4RPQA 3P67A 3SCRA 3CUHA 2G4FA 5CSUA 2C0AA 3TMQA 2EPLX 3NO5A 1RY8A 2R1MA 2WNQA 1E1EA 1M7JA 4Q8VA 3PZQA 2PODA 2POTA 4O52A 4ZODA 4FI4A 3FDKA 1JZ7A 4JKKA 4OV9A 3M0XA 3PWIA 4GG9A 2Z1VA 2Y8KA 3A4WA 3O6CA 3OQEA 4UR8A 4KT2A 3UGRA 4QNWA 4F3HA 3WEZA 1XR2A 4B9ZA 2ZXDA 5C55A 2Y4SA 3MMUA 3CH9A 5KMYA 1EEXA 1B3OA 1SO3A 5I02A 2RH9A 3F5KA 3BUVA 3F03K 4IIHA 3URNA 4LS2A 1ZB5A 4ZFMA 2VURA 4EPDC 3LX9A 3S4TA 3UZXA 3AJ7A 3RUBL 2FGLA 3NXFA 4J3TA 5AECA 2QXWA 4UTUA 1XSJA 1OEPA 3QV8A 4ZB0A 3GTNA 1QNQA 2QV5A 1OYAA 4JQ3A 4W7VA 2BX7A 4WD0A 1S2UA 3AZRA 1KNWA 3TSDA 3T1GA 4QSFA 4A2RA 1XJBA 1U5JA 2NVAA 1TE1A 4PBFA 3DFTA 2CKSA 1TJ2A 2OKOA 1E6ZA 1TTIA 1X7FA 1FWNA 3WLTA 1ZRQA 2I5QA 5AC7A 1EX5A 4K3ZA 4XD4A 3QC3A 1I60A 1XDMA 2F2HA 1VB9A 1ALDA 3O63A 4FPSA 3OPSA 3O8AA 1HJXA 1XD1A 5M1TA 5MKGA 4M51A 4D1IA 4BZYA 1QK0A 3FLUA 2V38A 5KINA 2ZA2A 1PKNA 3AJXA 1M1BA 1YNQA 3NYZA 1LDCA 1XISA 1DP0A 4DB7A 3MZ2A 4Q8TA 1LL4A 3C2RA 3CB8A 4MY8A 1IT7A 1QW9A 3PM6A 1MYRA 2WV8A 1NWTA 1FWAC 4KERA 1ME7A 3W7HA 1U5HA 5CSSA 3LU2A 1ZZMA 6REQA 4O53A 2W61A 3GB6A 3STEA 3OIHA 2VGGA 4YN5A 2CZFA 3VUSA 1HP5A 1XIHA 4TTUA 1BF2A 1K6WA 4AHQA 2QUNA 4GJJA 4WIWA 3AMGA 2IKIA 3FJ4A 1L8NA 1KTNA 2WJEA 2RFGA 1IEQA 4L1WA 2VRJA 5AHMA 3ONCA 2DUZA 1QJWA 3O7UA 4AAJA 3SRHA 1SQ7A 2JKAA 3PULA 1UKTA 1F3XA 3WBEA 1X38A 4REQA 3GVQA 2CESA 1B57A 3VD7A 2VWSA 3G1XA 3N6QA 5AHFA 4YHGA 4DJDD 1J0HA 1W1TA 4IT1A 2CERA 3SADA 1GOKA 2Y2WA 3TN3A 3P5ZA 2VTFA 3FW6A 4CU6A 3UG8A 4Q32A 1T5AA 2DZBA 1VIZA 2GGGA 4TXEA 1V7AA 2I9EA 3GTHA 3SY5A 2X0SA 4AXNA 3IACA 2QF8A 3W2MA 1LRQA 2DH2A 2WJFA 4E4UA 4Z1DA 2O9TA 4DNHA 2Y6ZA 4F0KA 3UJFA 4ILSA 4FXSA 1XICA 4E2DA 3E0LA 1EO7A 4HU4A 3IJQA 2E6AA 1W1PA 2Z7KA 1W8GA 1E1CB 3TE9A 5EPDA 1JD7A 2YA1A 3BVJA 4AH7A 3V36A 3GYCA 3BH4A 3JU2A 4C5YA 3H22A 1TZ9A 4MFEA 3M0MA 3EX6A 4DF1A 4UQAA 3HOJA 3Q37A 1UWAA 1YTKA 1O60A 4NU7A 5I23A 3EXRA 4NRRA 1E1FA 4FNSA 1QNSA 4AZ6A 5HMDA 1SO6A 3EGJA 1JYVA 4HCLA 5FESA 2VC5A 1UD3A 1A53A 3E02A 4HJWA 1W56A 1DWAM 2VEFA 3O07A 4KRUA 1K77A 1KFJA 1UD2A 4UMCA 1OX6A 1I8JA 3QFWA 3WQOA 3DEQA 2WPBA 3MPGA 2VZOA 1W1YA 3S9YA 1LLWA 5CBJA 4Z0SA 3VGHA 3KBVA 3AO0A 1OHLA 2CLLA 2DSVA 1Q6GA 5DXYA 1CZ1A 5AYBA 3FVDA 3NAVA 2YFOA 2J66A 3II1A 1V0MA 4PUKA 3RU6A 3IANA 3DFHA 9RUBA 4LAUA 4M1BA 4QCFA 1BQGA 3VDGA 4IXHA 4O28A 7REQA 3CV6A 4TX8A 3L65A 1KGUA 5EMJA 3D3FA 1EP1A 1M41A 3VGBA 4F0HA 1WZAA 1M3UA 4TQTA 2HDJA 4J27A 5AYIA 3PUEA 3WK3A 1ZLPA 1O5XA 1C91A 3WNNA 1VH7A 1XL9A 1UR3M 3KRBA 1PIGA 4KEMA 2C6QA 3B04A 2OOGA 3NDYA 3LZ3A 2DSWA 2Z27A 2VX4A 1H7RA 1PPIA 3SUTA 3WEMA 1KBKA 4XKMA 3GG7A 4DN1A 3BSHA 3GKFA 4ROQA 1I6NA 1OJXA 3KL3A 3UFYA 4YVXA 2P0IA 2WLYA 1XYAA 2YA0A 2JKEA 5TD4A 2ZIDA 4WZHA 2E77A 4C6CA 4TO8A 3U2EA 2PGEA 3A23A 4XAGA 2ISWA 4XB3A 3W1RA 4NZ4A 1XI3A 4KWVA 3VAVA 4MUPA 1F2JA 1PZ2A 4JYDA 3T4CA 4C90A 4B3KA 3K8LA 5BOFA 2J9ZA 2OT0A 5D2YA 4N9CA 3UPBA 3AAMA 2XGIA 4GNVA 1JZ4A 3OG3A 3NQMA 5A8GA 1E9ZB 3OHIA 2GGJA 1L6GA 3AC0A 1QCWA 2J7DA 3HGJA 4PMUA 5CC5A 1NDVA 1UPMB 2OQYA 3WFLA 1QOQA 4YTQA 3SBFA 3EDDA 4JTGA 3WEOA 3SIZA 2MUCA 3CHVA 3STPA 1S2VA 2P53A 1H60A 4I8YA 1Q63A 3KS5A 1UOKA 3BANA 3BAKA 4LYQA 1UIPA 1P0KA 5BRBA 4NNAA 4LS1A 4V2XA 1S46A 4ZE4A 1E3XA 2J7BA 4Z2GA 3IAPA 4Q8WA 3O6YX 1EKOA 4UTWA 5DEZA 3U2CA 1MXDA 1E6RA 4O14A 3HJEA 5HNNA 3MHGA 3GH4A 5CBBA 1HL2A 4O0KA 5FI8A 1FQ0A 3B8IA 3L4YA 5FCZA 1VJIA 4PMXA 6CGTA 4IUGA 3VU2A 4H41A 2J78A 4MY1A 1O66A 3TJ4A 2Z29A 4NVTA 5T9BG 1H5YA 2PWVA 3VCCA 5TBOA 2F38A 4R34A 3ZVHA 5CPSA 4G56A 2J7FA 3S5SA 4Q7IA 5M03A 1GPWA 3ARUA 3CU2A 1W1VA 3FOKA 3RPMA 3SUVA 4XUYA 3P6LA 1CECA 1QFEA 4GH1A 3VDBA 1YIXA 1GVIA 2V3EA 3AS1A 1CLKA 4JFTA 3IIPA 4ICCX 1OQFA 1EWEA 3BLLA 2DH3A 1FWRA 3WK0A 1G5AA 2RGMA 4O18A 1KBJA 4LW7A 1JDFA 4TTGA 2CZDA 1XG4A 1C8VA 2BBFA 4DXKA 1WP6A 2D69A 4B9YA 3DCPA 4L61A 2FPVA 4B5SA 1WDSA 2ZE3A 3SGGA 1DL3A 4KRZA 1L6YA 4I5UA 3WQ4A 4GJ1A 3AXHA 1FRBA 3I7RA 3TA9A 1BWVA 2DV0A 2WO5A 4GUGA 1I1XA 4MIMA 4PSRA 4CCDA 5I2UA 1JZ6A 3UXAA 1UC5A 1VJZA 4D8LA 2RHGA 2DEPA 3WJYA 1FH9A 1L6WA 5G2HA 2QCNA 3WQGA 4BY3A 1A50A 3CZ8A 3HZ3A 2FIQA 1TPB1 4EPBC 3L5LA 3P74A 3T2OA 4HYVA 4ATWA 3GNXA 1GKQA 2VC6A 4KRTA 2B4GA 4DJFD 3LCHA 1E56A 3N04A 1J0KA 3DG7A 1BF6A 3ALGA 1EP3A 1OGSA 3EMCA 4BWLA 3LRMA 1KKRA 3FA3A 3LCIA 4GXWA 5A6BD 5JUVA 2XUCA 3IJ8A 1WZLA 1MVYA 3RG6A 1LORA 4UTLA 3UWZA 3S6OA 1MSSA 2CZ5A 4AYSA 3ZT5A 3LENA 2Q02A 4K1WA 1M65A 3N12A 4DIAA 5HR7A 2CHRA 5E9AA 1A0EA 2Q3OA 1S5VA 5FF3A 4F8XA 3TYZA 3I3EA 3PPGA 3OGVA 3ICJA 2Z2BA 3TFCA 3W00A 3IS4A 1R86A 1ZP3A 3DESA 2P1FA 3STGA 1E43A 1RJQA 2X7VA 4MNLA 4FP1A 1TPC1 3L0NA 3LBMA 1SO4A 4XD3A 4QXIA 3UR5A 1J0ZA 3O1NA 3QY8A 1CYGA 1TREA 3I65A 3HF3A 2BOEX 3UWQA 1UASA 1KW1A 1GK8A 3LMZA 5HATA 2BVDA 4TV6A 2QUVA 4GGBA 3DOPA 1LT8A 4NIRA 3CAQA 3FYYA 4A8IA 4E2OA 4PUJA 1SFJA 1XYBA 2UBPC 2NVDA 2QMKA 1CIUA 4ZQRA 4KIEA 5A2CA 5HJLA 1QDSA 3NM3A 1XM3A 3WX7A 4BF5A 3M5YA 4AZGA 2R1PA 2A7PA 3UG4A 3P81A 4PYSA 4JYEA 2QJIA 1TZ7A 1JD9A 4ZMGA 1QVBA 2W4XA 2E7FA 3NPUA 4XO7A 1A5NC 4NRSA 5FJRA 1AG1O 3D46A 3IV3A 3SECA 2Z6IA 4YTTA 3ZJ7A 5KZEA 1TMLA 2G50A 3QPYA 1A47A 4DX3A 4FLRA 1Q7MA 5IRPA 3NQ8A 3H4WA 7TIMA 2FGZA 1V3MA 3QBUA 4H9VA 1LL6A 3TFXA 1JPHA 4KWOA 4U5KA 4JIPA 4S39A 4C6EA 1YNYA 1EC9A 2J47A 3VIKA 1B90A 1AMKA 1SW0A 1E72M 3NVDA 1IF2A 2JEPA 1W3IA 1J0YA 5D2XA 4PFMA 1SZFA 1GWJA 4Y9AA 3R7MA 1M04A 1TTQA 3FN9A 1KM2A 5H8UA 1QI5A 3G1SA 2EF9A 3UXLA 3WUGA 3HM7A 4FF5A 1P5BA 1TIMA 1ZU8A 2BGQA 2Z7GA 5AY7A 1REQB 3GR8A 4ACZB 4OE7A 3E74A 1XPYA 1FDYA 3V0SA 3UZYA 3VTRA 3TR9A 3I4KA 2ZA1A 2V2HA 1FUYA 1TJPA 3LCWA 1F8IA 2VZUA 3CV7A 4NZFA 3DECA 3SFWA 2D73A 3ABSA 4GZJA 1KGWA 4M19A 2ZC1A 1OADA 4ENLA 1GVSA 3K30A 4MPQA 3Q67A 4HHPA 3VE9A 4HSOA 3RLVA 3URQA 2CWXA 1VBJA 4MJZA 4W84A 5AHIA 4C6FA 3LCGA 3QR0A 3HB9A 3DBNA 3PSVA 3SY1A 3CAVA 1VF8A 1DJQA 2FZ8A 3UBPC 4DWSD 4GH3A 3R13A 4NX5A 3EKGA 3GM8A 2ISDA 4L7ZA 1UOZA 4RDVA 1OC7A 4K1GA 4LSBA 4JBRA 3KUMA 2E8YA 1KM5A 3IVSA 4DBUA 1ONWA 5I3FA 2XVLA 5A3HA 4I9MA 3EX3A 3N6JA 4Q33A 1SZNA 2F2KA 3LB0A 4H19A 2X30A 1LBFA 4V15A 4E5TA 4LQ1A 4F4RA 4WY0F 2J7EA 1H61A 1A5LC 4F0LA 2I9UA 4C6KA 3EDJA 4WKHA 1X6UA 1BGAA 2G3MA 3MKVA 3VDHA 3LA4A 4UMBA 1W8SA 2VOTA 2FGBA 3L67A 1PTDA 1K6AA 2NXGA 1YBQB 2QUUA 1ZNNA 1CGXA 4EAMA 3G3DA 1RALA 1CGVA 2YL5A 1KFKA 2G3IA 3CTLA 1RAKA 1UR4A 1WB0A 2V5LA 4FXRA 5FACA 1XLGA 4FOJA 1AFSA 3DZ1A 3DU0A 4FXJA 4TMBA 2NX9A 2ICSA 3VD5A 4EWND 3W7PA 4P8UA 2BHZA 4NT0A 5EGRA 4I9AA 1ZBVA 2OB3A 2CNCA 3N9RA 1VZWA 1CPUA 3ZJ8A 2C8NA 3W1MA 5KITA 3WBYA 4M8UA 4ACZA 1V93A 4NJGA 3RGTA 3OEXA 3WMSA 4Q4SA 3L23A 3S6DA 4C5ZA 3TQPA 2WVUA 3CUGA 3UXDA 4MJMA 5CLTA 3ES7A 2Z2AA 3U9IA 3RIKA 3LI1A 4R33A 3QV9A 1KC7A 4CUCA 1BKSA 4S3AA 1BWLA 2VQTA 1IEVA 4GACA 4WRHA 3N1AA 4I7UA 3EOSA 3EMZA 2PWUA 4MGGA 5FAJA 2O4MA 1GVRA 4PMDA 1EXPA 3PZUA 4ADSA 1E4NA 1K1DA 4UZSA 4YTRA 4XTDA 3MY9A 3KP0A 3QZAA 1KBLA 4LAMA 4Y90A 4GQGA 2Y5SA 2YIHA 4QJ1A 2W5FA 3EKLA 4QE5A 1YXDA 3PK7A 2E5BA 3B0PA 1XCXA 3EPMA 1TVNA 1OFEA 3W23A 5DF0A 5EY5A 2ZRXA 2J4GA 3AIRA 4WK9A 1KR0A 3SQSA 5EMLA 1C29A 2WVSA 1KFWA 4O1BA 3MYOA 2JALA 3NQ6A 3BDKA 2WCAA 1EPVA 4N2YA 5IHSA 3EXTA 4KWWA 2NQHA 2ZUUA 3UXKA 4GZEA 1J0JA 1ZJAA 2QJJA 5HULA 2Y8VA 4J35A 4MF4A 4D6JA 3CMGA 2A4AA 2C1IA 1JCXA 3NQAA 4H9TA 3O3RA 1VFFA 5CJMA 5MF5A 2ZXAA 2PU0A 2CW6A 4P2VA 1JAKA 2ABAA 1W32A 4IJBA 3ARZA 3AWNA 4GINA 1MQQA 1Q8AA 1E0XA 1D3CA 5A2BA 2AL1A 4D6CA 3S8HA 2VEGA 3G22A 2DORA 1VKFA 1H51A 2ZA3A 2VVNA 4I7WA 1QI2A 5C9RA 2YXXA 1PYFA 3B05A 3DHUA 2PA6A 2PC4A 4U28A 1JCYA 4H7CA 4WDXA 3VMNA 3GNPA 4MNJA 1TX2A 3LNMA 4KKXA 4P7RA 3CHDA 3OVQA 3CUJA 1UCWA 4J9JA 3TYBA 2IXUA 3GAKA 2ZWZA 4JTAA 3UCQA 3RFAA 3SCWA 1YDYA 4AY8A 5A8PA 1GQNA 1YXYA 2CIPA 4RNJA 1TPDA 3A5FA 3HQPA 4YHEA 1TB3A 2C71A 4WVXA 4LCSA 2RJHA 2PRHA 1ZFJA 2YW4A 1NFBA 4MB3A 4Z2JA 2OWXA 1YDOA 1XLHA 1UW9A 3E96A 2PDFA 1XKYA 3L68A 2NX1A 3S2MA 3LCXA 3H7VA 4ATLA 1TZZA 5A94A 2WMFA 5EL1A 1VFUA 4H00A 2WANA 3W86A 1DJIA 4B16A 3T81A 4JDYA 1JPDX 1XUUA 1ESWA 2Y7DA 4U3AA 3EDKA 3GXNA 4FAMA 4C1NB 3WD4A 1NY1A 4JL2A 4K6AA 1TWZA 4JIHA 1KRMA 3VOHA 3QSTA 2REQB 1XX1A 4JFVA 3L21A 2VD8A 2OGJA 3ITYA 3RM9A 3S46A 3UNDA 4RKAA 4UQ9A 2VR4A 4QP0A 3SO7A 3CT2A 1GZJA 5C7VA 5I7GA 4XIMA 4MPKA 1VC4A 2E9MA 3BQ6A 1O5KA 1Q6DA 4Y2WA 4YTUA 4UZUA 1LJYA 1DOSA 5CG7A 3S6TA 2IQ0A 1O95A 4LEFA 3H6OA 1SFSA 1AD4A 2YCLA 4IMEA 1QHZA 4BHYA 1TE6A 1W9XA 4KGJA 1JXJA 1UUMA 3WN6A 1TELA 2JIEA 2UZ9A 2YL8A 2PRLA 3O0KA 4W4QA 4NG3A 3IGHX 1W1B1 2QJHA 3OW1A 3DC0A 1JRCA 2CBVA 2RDUA 3H26A 2E9LA 2GGHA 5CG0A 3ZO9A 4S3JA 4FR1A 5TQLA 3M5ZA 4YS1A 3MBFA 5REQA 3SCPA 2QDGA 3FIGA 2FFCA 4GYFA 4RCXA 4YIWA 3P8IA 5EA9A 2VENA 3EWXA 1JYWA 2D0GA 5HOSA 1XLKA 4INFA 1SYTA 4KW2A 4EK7A 5K7JA 3BLDA 3DGRA 2Z28A 2NSOA 3V0UA 5I5RA 1JNEA 3LGDA 4CD4A 4NZCA 5D33A 3UWVA 5DBUA 2XFYA 4XAPA 4PUEA 2QVHA 3TVAA 4QM1A 1XSKA 3I7QA 3WLRA 1AQHA 3ITLA 4QE1A 1GJPA 3CASA 4WR3A 2Y7FA 3KCLA 1HO4A 4DELA 2DQWA 2CHOA 2H3DA 1C7TA 2GQ9A 3NGFA 1GG1A 4PSPA 1O68A 5HR6A 1OYCA 1LBLA 1JCNA 4ICMA 3TAKA 3ZLGA 3WMCA 5U7SA 3RLGA 2FZ9A 1VD6A 2ZUWA 5DY3A 4L4MA 2H3BA 2TSYA 4XZHA 2Y63A 3T09A 2C18A 3WBWA 8XIAA 3PTKA 3EMQA 5AZ1A 2FB2A 4GBDA 3RR1A 4B4HA 4H8UA 5IM51 4RK8A 4ZFCA 5LNWA 3CNYA 2YGYA 1FVPA 1Q6FA 4AIEA 2QCDB 3U7BA 1KO0A 1QASA 4MWAB 3MVTA 3Q4DA 1AMYA 4HPXA 3VZYA 4JL1A 4C1NA 4LVFA 3E49A 2Y7GA 1A4LA 3O6DA 6TAAA 4IUOA 2REQA 2XN0A 2J75A 5ABFB 3UZ5A 4C6JA 1EIBA 5J5RA 1JZ8A 1E5NA 3PANA 2PF0A 3TH6A 1VJSA 1WV2A 4XQ6A 1L2QA 2OZ3A 1TVLA 4X60A 1WUFA 5HNRA 2GWNA 1E4LA 4FOUA 2J77A 3WQEA 1PZ3A 5FEXA 4RV3A 3N2CA 3WZ0E 2TODA 1BGGA 1PL9A 4XZ9A 3NQGA 1W3HA 2XIIA 4GXPA 4XUGA 3KTSA 2BHUA 3C2VA 3EBVA 2QGYA 5DMMA 3WLOA 1W9PA 1S39A 4QEHA 2AL2B 4CD5A 4RUBA 1CLVA 1S5WA 2D24A 4GE8A 5JBFA 3BG5A 1C8XA 3W7MA 1JYNA 2V5DA 1O5QA 2PSNA 1NU5A 2Q3RA 1D7KA 2IS7A 2OZ8A 4KMQA 1KV5A 1W2VA 1NOUA 4PB4A 4QLJA 2C3ZA 2G95A 2GL5A 2ASHA 3BLIA 2OX4A 4BK9A 4BI5A 4GCAA 2WYSA 2J74A 4PEKA 5CZTA 4GHRA 3UCDA 1K8YA 1HW6A 4F9JA 3QW4B 3W1XA 5C7HA 3ORWA 3E0WA 2EXOA 3UW6A 3G5EA 4GO8A 3MP3A 2QPSA 3FVMA 2BG5A 1RP8A 2NX3A 4P7QA 2VFGA 2VCCA 3VD4A 5FAGA 1IIGA 4XBJA 1QOXA 3C0QA 3W88A 1EJRC 1H2JA 2WSQA 2E1WA 2PD5A 3LHTA 4Q4QA 3W22A 4AZCB 4UCFA 4NJIA 3GDKA 1BLIA 4Z1BA 2HCVA 1YADA 3ZR5A 1IXOA 4PUDA 5F4SA 2XPKA 1AZ1A 1WQ5A 3P0WA 1OCBA 3GRIA 4P8XA 1H5VA 1KKOA 1D3HA 4IL2A 3LCLA 1ME8A 1DWIM 4UMAA 3TEVA 2WHLA 1HKWA 4HD5A 3AROA 5BXRA 1MEIA 2Y61A 3VOCA 1P1MA 4DBEA 1EC7A 3AZTA 5CQ1A 3R1ZA 1HL8A 1LWJA 3PPFA 1DORA 2Z6JA 5ABHA 3MKKA 2FHCA 4P7OA 4E38A 3PAJA 1Z69A 1UH3A 1ZAJA 5AVNA 2HE8A 4ZENA 5I06A 2BVTA 3PHAA 2D3NA 1J5SA 2VZSA 4ZO9A 5XINA 5G2IA 3OVRA 2R1NA 3CWNA 2GDQA 3UYCA 1IZCA 1TR1A 2GJXA 5ABFA 3AHTA 2BXYA 4D72A 3CZKA 3IJ6A 1I0BA 3THCA 3REQA 1YDNA 1X1OA 1I2RA 3L0KA 2DDXA 4Y6GA 4K68A 2FVLA 1GVYA 4F79A 3TTSA 2BSLA 3GY1A 1UG6A 2GFTA 2GPTA 2AL2A 4DJED 4AF0A 4MYAA 3S2CA 1V3IA 1HXJA 2DZXA 2E1DA 3HN3A 3IJDA 3G1VA 3RMJA 4AD0A 4HOXA 3APTA 2ALRA 1K9TA 2V5CA 2E6DA 2BLEA 3HQNA 1K9DA 2NW0A 5C2GA 3NO1A 2GK1B 1C3FA 1Q85A 4X0VA 3IGXA 1PCKA 2O92A 3GC2A 5KSWA 3VIPA 3M0ZA 3WL0A 3QF0A 3URAA 1TA3A 3RILA 2WKLA 4Q4MA 3M4HA 3CQKA 3PVFA 1UUOA 4G5DA 2DVTA 1X96A 4GY7A 4XK2A 2QVNA 4UOJA 1BVZA 5A6TC 3TUUA 4HBKA 2V3GA 1XIBA 3C3UA 3B06A 3FGCB 3U5UA 3WELA 5HWNA 2ZX9A 1D8CA 3HG3A 4LRTA 7TAAA 2OVLA 3C61A 4UR7A 1FDZA 3BLFA 5AKQA 5E09A 2CWNA 2PDHA 4IICA 3RDKA 3CEUA 1J11A 3UWEA 3VD3A 3W1TA 3O0FA 4UQBA 1XC4A 4GRSA 1OGGA 3KBMA 3HTWA 1B3YA 4IX0A 2WMHA 5JIPA 4F2BA 5I3HA 3M0KA 3C6CA 1ISYA 1ZL1A 3WY1A 3CV1A 3F4DA 3Q45A 4GVFA 5FF7A 2OWCA 4TX6A 2J8GA 3EWWA 4RXGA 1DJZA 4HMDA 1E15A 4YMZA 1Q65A 3STFA 4LBSA 3DFSA 5K4XA 8RUCA 1M5WA 4B2DA 4BCEA 3DFYA 1LWHA 2VFEA 2KZHA 2WSPA 1W3JA 2V0TA 3GR4A 3OZOA 1A0CA 4O50A 1DIDA 2FMNA 4D8ZA 5I3KA 2Z1XA 4OZOA 4HCDA 4K39A 4GBUA 1VLIA 2GVJA 2PWGA 3U57A 3T8QA 2ON3A 3TK7A 4C65A 4Z1AA 3DI1A 1FWWA 4JOMA 3BCJA 1FHLA 4LTSA 1IT8A 5KTLA 2EPHA 1GOXA 4HHHA 3WUEA 3UG3A 2A5HA 3WF3A 2IKHA 5KZMA 1Z6KA 3I7SA 2YCKX 3RPTA 2VQUA 4ZOCA 1I0DA 3NYDA 4A21A 2XZ9A 1XCWA 1J8VA 5C71A 3BW4A 1H62A 1XBXA 1NVMA 2VEPA 2FDMA 3NQEA 2GVGA 4JQ1A 3GO2A 3B9NA 2AGKA 4WJXA 4AUBA 1QNVA 1KRBC 2QCCA 3GTFA 4GC4A 3FY1A 4N4PA 4AD2A 3UR7A 2FYMA 1ZAIA 4F2UA 4MUZA 3TC6A 4DUWA 1XW8A 2G37A 3EPNA 3HO8A 2VXNA 2P8BA 1YLVA 5AVHA 1I2QA 1L6SA 2HROA 2VCBA 4WKFA 3FAXA 3NJ3A 1FP8A 5ABGA 4H04A 3A22A 3HGRA 1E6QM 5GQBA 3W6MA 3C52A 1ICPA 2HSAA 3CL8A 4OBSA 1U1UA 2NV2A 2PDBA 4IP4A 3DFNA 1I9CB <