1FH9A

Crystal structure of the xylanase cex with xylobiose-derived lactam oxime inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh9A00
3NSMA 4W85A 5DEZA 3FAXA 4E4PA 1E6QM 3VOCA 1H2JA 3WDPP 1X6LA 2J25A 2YOCA 1P6WA 3CPUA 1PX8A 6CGTA 4NI3A 4P7LA 4UCFA 1GJWA 2B31A 3W4RA 1V6UA 4Z2IA 4IPLA 2BHZA 2CIPA 6A3HA 2GVYA 3BC9A 4EKJA 1VAHA 3HMCA 4ATWA 1JFXA 1BTCA 2YIHA 2DIJA 2V3FA 3SIMA 3F5JA 1JI1A 3WD2A 1NM9A 4OUEA 2WHMA 3PZQA 1GQJA 2XWEA 1O7AA 2UY5A 4AD4A 5JUVA 2C8NA 1L0PA 2VCAA 4QLJA 2W92A 4GI9A 3POHA 3OB8A 3DC0A 4MPKA 2FGZA 2J77A 1V6XA 4JKMA 2WMGA 5F7UA 2OYMA 1ZB5A 2YA1A 2CHNA 1PPIA 3BH4A 3WY1A 1UR4A 1H09A 2YL8A 2XUCA 4X0VA 5A69A 5HPCA 1E4LA 3WF3A 5DMYA 2VCBA 1HVQA 1JXKA 4AEEA 1BGAA 4CD6A 5FL1A 4W8AA 3FY1A 1DTUA 1W9XA 3VIHA 1J0ZA 4ATDA 4U31A 3OLIA 5GPRA 1DWAM 1I75A 2BVDA 4CVWA 4JIEA 3VIOA 2A3EA 5D9NA 3WNKA 2W63A 4UZUA 4A4AA 4TTGA 3THCA 2XFRA 4PMYA 4MDPA 1JF5A 1E40A 4Z2HA 2J7CA 5JIWA 1XC6A 4BCEA 1DP0A 1FH9A 3CH9A 1R7AA 2Z1SA 1UWRA 1XYZA 3RCNA 3T2OA 4PEEA 1RP8A 1PX3A 1JI2A 1C3FA 4WKAA 2OWWA 4WSJA 4UOQA 2JIWA 2W62A 3WENA 2CKSA 5I0DA 2OSYA 3WMSA 2BY1A 2GDUA 3AXXA 5A6AA 3WUGA 3L2LA 2EPOA 4D1IA 3GXDA 1IV8A 3AIQA 3K4DA 2D1ZA 1ITXA 1UR0A 4GIAA 3ZT5A 4DWSB 3FHAA 2DSWA 5BROA 5ECUA 2YLAA 4J3WA 1NWTA 3AHYA 2VZUA 2WCGA 1UD3A 2FHCA 1D7FA 1UWQA 1WZMA 2VL4A 3ALGA 1FHLA 2J7GA 4W86A 3T2QA 2ZXQA 1NWSA 4PMUA 5A2BA 1KQYA 3UR7A 4P7RA 2XVNA 2E8YA 1B2YA 5LYRA 2WSKA 4D71A 4F79A 1QNRA 1XCXA 2G4FA 2Y2WA 1XHGA 3SEPA 2DSZA 2EQDA 1EGZA 1CEOA 3VILA 1UH4A 1E6XM 1VBUA 2ZUMA 3K1DA 4FLQA 3CZLA 1CXIA 1MYRA 1JDDA 1H3GA 2QHAA 1J18A 1W1YA 3VUPA 1J11A 3WF2A 2PBGA 2QLYA 3VD7A 2DT1A 2JF6A 3WH7A 1Y7VA 1UZ1A 2VNCA 3AMDA 3LPPA 3WBEA 1WCGA 1QHPA 2WC4A 1WDRA 5JBEA 1W1TA 3CO4A 4C7FA 2ZE0A 2G3NA 5EB8A 1HIZA 3EMZA 2GJXA 3AYSA 3N11A 3A47A 4X9YA 1JYNA 3WQ4A 1E43A 1JZ6A 4KRUA 3DHUA 4TTUA 3AMCA 4H7VA 2Y4SA 3ZJKA 2PC8A 1EO7A 3W37A 3VIFA 3VDCA 1HN1A 1OT2A 3LMYA 2FHFA 4MJ4A 3SUTA 3WD1A 4M80A 4PYSA 4N42A 4Z2KA 2PWDA 5HOSA 1ODUA 3WNMA 4CD5A 2G8ZA 2VVNA 3VIPA 1PIFA 1QI2A 4AD3A 3FW6A 3N12A 1W91A 4E8CA 3PTMA 1BF2A 1A3HA 3GBDA 2VUYA 1LQ0A 3B9DA 4K68A 2GDVA 1XGZA 3PZIA 3VGBA 3U5YA 3NYDA 2UY2A 2GJPA 3II1A 1EHNA 1QI4A 4QP0A 3VX1A 2DH2A 2CITA 4GI6A 1KXHA 4UZSA 2EPNA 1G1YA 3EDEA 5DT7A 1XD0A 2WHJA 3ARTA 1OSEA 3QOMA 4UOZA 1EDTA 1US3A 4ACZB 3BAWA 3AHTA 1C91A 3O9NA 4J27A 1CXHA 2X2YA 3SUVA 2BFGA 3BLKA 3RIKA 3MUIA 1M04A 1V0LA 3K8LA 4PTWA 1QNQA 2PB1A 3SCTA 1W3KA 4M24A 1WZKA 1R85A 4MJ2A 1UD6A 3W81A 3N04A 3WN6A 1VEOA 2WK2A 4AD2A 2PI6A 3GNOA 1FH7A 1GCYA 7TAAA 1ITCA 2XFYA 3VINA 1I1WA 5ABFA 4ZE4A 1C8YA 2D23A 1KCKA 2VRJA 2DDXA 1KWKA 4NZCA 1W9DM 3EDJA 3ALFA 4AZIA 5I6SA 3U7VA 1JAKA 4W8LA 2G3JA 1NOFA 2V5CA 3CUGA 1JXJA 1WDQA 3LPOA 3AS1A 3PZNA 2BS9A 4UR9A 3RILA 2WZEA 1HX0A 1E6ZA 4UQBA 1MXGA 1W9VA 3EDDA 2WBGA 1E73M 1UD5A 4U3CA 5KEZA 2WVVB 1KQZA 3W53A 1XH2A 3W27A 4PSRA 2BHYA 1HNYA 1EXPA 1B1YA 4FMVA 4IISA 4F66A 2J4GA 5AY7A 1EIBA 4W88A 2VQTA 1WDPA 1ZU8A 4XX6A 1JIBA 3N18A 5FOOA 1WNOA 4W7UA 4MNKA 5E70A 1NH6A 1KXTA 1GONA 5CSYA 3EYPA 5BXPA 4P7OA 1J0IA 4NRRA 1OT1A 3WF4A 4HA4A 5LA2A 3S2CA 3THDA 1U2YA 1B3XA 4U5IA 2PWHA 5BXSA 2QV4A 4CU6A 1H49A 3OGVA 2DT3A 5LA1A 1KGXA 2D3NA 4LGXA 1ZBWA 1B30A 1QBBA 3MUZ1 1ZBCA 1QNSA 4R27A 1OD8A 3SCSA 4AMCA 4YHEA 1LWJA 1MVYA 2XG9A 4HA3A 3HU7A 2E3ZA 1V0KA 1HJQA 3WBAA 4UQEA 1UOKA 1UYQA 4PCTA 4W84A 4DWSC 3AHXA 3ARPA 3CTTA 3BAXA 3EMQA 3IJ8A 4D6DA 3FAWA 1VF8A 3W38A 3VPLA 2Q8XA 4GZIA 3CHDA 2YA0A 4D6FA 2J7DA 1WE5A 1GOQA 7A3HA 2W91A 3OZPA 4MNMA 1W32A 2D0HA 4N0RA 1X1NA 4U33A 2WYSA 1JFHA 1O6IA 3SCUA 2CCRA 5M3WA 2NT0A 4MNJA 5ABEA 1HJWA 3GXIA 1TVNA 2FH8A 3VDHA 1ZS2A 1CENA 1Q6CA 3KL3A 2O9RA 1H11A 2CBVA 3GH4A 2ZXAA 3NIYA 1B9ZA 1UR9A 4GO8A 3KZSA 2XTKA 2VURA 2WB5A 3AZSA 3AFBA 4AIEA 2WSPA 2WMFA 3WD3A 1N82A 3D3AA 3WDJA 1HVXA 1BVNP 3PZMA 4J28A 3AMGA 4MAVA 1U33A 2YDQA 1W1PA 1CGWA 2W5FA 1CTNA 3AHZA 4HPGA 1V3KA 2QMJA 3QHOA 5E09A 4HP5A 2WC3A 2DH3A 4BF7A 4EE9A 1CBGA 1FP9A 5E9AA 4GPNA 2XWDA 3TOPA 3CBWA 8A3HA 1KGWA 1TFVA 1XV8A 3UG3A 3L4VA 3CHEA 4JFTA 2FHBA 1E3XA 1JDAA 1PBGA 5IXEA 2BXZA 2YLLA 3AI0A 1Z32X 4PUDA 3VGEA 3IAPA 1AQHA 3EDKA 4D1JA 2J7EA 3DYMA 4WK9A 3UESA 3WUBA 4H8VA 5A6LA 3CUIA 1B31A 2WWDA 3ZM8A 4UQDA 3GBEA 3GXMA 1VJSA 1Q6GA 3PZGA 2RGLA 3PBGA 2AOSA 4WSKA 1UUQA 1EQCA 3UERA 4WF7A 1QVBA 3NDZA 3AQUA 1EOMA 1TG7A 4UFHA 3AICA 4M81A 3AIVA 3WD4A 1IZJA 2XVKA 2D3LA 1LF1A 3AXIA 1VBRA 2OSXA 5A8QA 1UHVA 2WVVA 1FP8A 1TCMA 5DFAA 3HN3A 3PHAA 4M56A 1JD7A 4AZ7A 4DUWA 1JAEA 4CN4A 2DSUA 1E9LA 4PTVA 4HOWA 5AC5A 4GQQA 5FL0A 1H4PA 2PF0A 1AQ0A 1KBBA 4UTFA 3ARYA 3VIKA 3ZT7A 3VTRA 1R7OA 3TTQA 3PZOA 1E0VA 4AD1A 3CUJA 2CPUA 1GOMA 1CGTA 4ZFMA 1OWQA 4CU7A 2J47A 2VZSA 1W2PA 2EEXA 4J3TA 4AZGA 4Y7EA 1KFWA 4V2XA 5JIPA 3E1F1 2XGBA 4WJXA 5CG0A 1HJVA 3OA5A 1GQIA 4XZWA 3WEOA 1E5JA 3BAIA 5EMYA 1GPFA 1C93A 3WDQA 1WZAA 4E8DA 1TA3A 4DM1A 3W26A 2ZUWA 1MWOA 1BG9A 2DIEA 3VDAA 2D2OA 3GH7A 1J01A 5I78A 5BCAA 3BSHA 2BVTA 2A3BA 4CN6A 1OCQA 3VM5A 4HMEA 3W25A 4UFIA 2E9LA 2F2HA 3CZ8A 3VD3A 4F9DA 1B3VA 1MXDA 1G9HA 3AIBA 1R8LA 3GNRA 2X05A 2Z1KA 5A3HA 2C7FA 2WKLA 1KGUA 2PWFA 5GNYA 1ISZA 2UY4A 3F4VA 2G41A 2VX4A 4PTXA 5I23A 5IHSA 3RJXA 3VDBA 1ZJAA 5BRQA 3QHNA 2CERA 1W3LA 3W0KA 5EFFA 3M07A 4H41A 3VD9A 3W24A 1AQMA 1BYDA 1GUVA 4YN5A 1GHRA 8CGTA 1E71M 3NSXA 3SURA 1UKSA 5I79A 3SCRA 3RPMA 1QW8A 1W3JA 1GVIA 3CMGA 3GZAA 2J8FA 3HJEA 4ATLA 4PRWA 1AMYA 3A6OA 1WO2A 1CXFA 3WDIA 4TVCA 4U3AA 3EMCA 2GJRA 4JL2A 5A94A 1BPLB 4M82A 2BV9A 4F9JA 3I3EA 3QR3A 5FCZA 3WQ6A 3K8MA 3F5KA 4W93A 1VFMA 2GUYA 3SUUA 2BNJA 3ARUA 1DEDA 3M7SA 4H2CA 5A1AA 2NSXA 2GK1A 2J62A 3L4ZA 1H5VA 2WNWA 4LQ1A 3WEZA 2VR4A 1KBKA 3N9KA 3OLDA 3IJ9A 2XM1A 1R87A 3ZT6A 3AMKA 1TMQA 1WZLA 2E8ZA 1BLIA 5D9OA 1NP0A 1GVYA 3MUAA 3VU2A 2XVLA 5LA0A 2V3DA 1UD8A 5D9PA 4LYPA 3ZJ6A 3O2LA 3M6DA 4V28A 5CQ1A 1V0MA 1TR1A 2ZX6A 4IM4A 1HJXA 1KR1A 3OZOA 1K9EA 4TX6A 3VKKA 3VMNA 3WQ8A 1QHZA 3OBAA 4W89A 5HBFA 2PWGA 1M7XA 4HA1A 3AIUA 2Y24A 1EA9C 3FXYA 2OLHA 1NQ6A 4MAZA 1IT0A 3MMDA 4A3HA 1GNXA 4W5UA 4PMZA 2A3CA 3VGFA 1BFNA 2VMFA 1D3CA 2EJ1A 3AIWA 1LG1A 3MV01 1ZJBA 1JZ4A 3QGVA 3BSGA 3L4YA 1WP6A 1MW2A 3BGAA 1FOBA 3VX0A 4LX4A 1PZ2A 2CETA 2XM2A 5I77A 2JALA 2O92A 3BAJA 4UOJA 5IHRA 1K6AA 2ZX5A 5M03A 1WDSA 3T08A 1HXJA 1RD6A 1RPKA 2GJXB 1JG9A 4W5ZA 3ZJ8A 2BY2A 3U5UA 3L4XA 4P7QA 4B16A 1W2VA 4M1RA 1C92A 4PMQA 4D6EA 1DWFM 1F4AA 1XH0A 3MMWA 1FA2A 2ZX8A 4U5KA 1OD0A 3VGDA 4CD8A 3IAQA 1OIMA 4D72A 4AIUA 1JL8A 1UWUA 3SCPA 4PCSA 3W6LA 2WCSA 4JHZA 5M17A 1M03A 3CLWA 1ZL1A 4MADA 4J3UA 3VD4A 3AISA 1WB0A 4H8HA 4AXNA 3WMBA 1CXEA 3PTQA 4PMNA 1HKMA 5BXRA 3JUGA 4BQ5A 4BQ4A 4AZBA 3RM8A 2NW0A 2YJQA 2VO5A 4JAWA 3K8KA 3O6AA 4CD4A 2D0GA 1HT6A 4HU0A 4KGJA 2D20A 5CGTA 5IDIA 2OWXA 3OLGA 4C7DA 1JZ3A 1E5NA 1CIUA 2X8RA 3BMVA 3NUKA 2JF7A 1JYXA 1TUXA 3VIIA 1LL4A 3CMJA 1W9PA 4ZEPA 3LPGA 4TUFA 1ISVA 4J7RA 1H0GA 3WH9A 3VGHA 4DUXA 2VX5A 4DUVA 1JZ5A 2GSJA 2UWFA 1E6PA 4WKFA 3BCFA 4P8WA 4F8XA 4L4OA 4EANA 3MSGA 2E9BA 5CGMA 2JIEA 4OOUA 2X0YA 3VGGA 2VR5A 5C8BB 2EBNA 4WLCA 4JFSA 2PBOA 3WQVA 3WH5A 5A8PA 1C8XA 3UETA 3I3BA 1QNPA 2XPKA 1UQYA 4OOZA 5A6JA 1GORA 2C0HA 4ZXOA 2EO7A 1BSIA 1CGUA 3W28A 4TXEA 3KL5A 2VZVA 1TE1A 1BYAA 1G94A 1CWYA 1VFUA 4QCEA 1EH9A 5CLWA 2WMKA 1XYFA 5GNXA 4AZCB 2XFFA 1OINA 3MSDA 1I1XA 4EK7A 3VVGA 2ZUVA 4AD0A 2Y5EA 2IUZA 4NF7A 4PMOA 4QAWA 4B15A 1NP2A 3ARWA 3VD5A 2ZXBA 1NWUA 4GI8A 2WMIA 3AMLA 3U7BA 3AJ7A 2WVUA 2CYGA 4KWUA 3MKKA 1CZ1A 1DWHM 4R5EA 4AW7A 3KWXA 2ZWYA 2EXOA 3G6MA 5IFTA 1GHSA 1PX4A 1UQZA 2YDRA 4PMRA 4XB3A 2DT0A 4ZENA 3WQWA 3WFZA 4HMDA 3DYOA 4URIA 5CXPA 3KEHA 1JNEA 2HISA 1H1NA 1FHDA 3U57A 2VZOA 5I24A 2XIIA 3OIHA 1MFUA 1OBAA 3AIRA 2WAGA 4UFLA 3L2MA 3AS0A 4MB5A 1KWGA 3WFLA 4FLOA 4FK9A 4AISA 1US2A 2DPEA 3VIGA 1VFOA 1JD9A 4P8UA 2DQXA 3WDHA 5A8NA 2EPMX 1QHOA 5JBFA 2W61A 1B0IA 1XRVA 4JFUA 4RL3A 3CHFA 4AZ5A 1V6WA 2WVTA 2O9PA 2CEQA 2DSKA 3CGTA 3N17A 4Q7NA 4P7NA 4P8VA 5BWFA 5D4YA 2JE8A 4X0NA 4KH2A 3T2PA 3ZSSA 5EFDA 3K4AA 4UQCA 1EDQA 2A3AA 1OM0A 3BAKA 4JZ5A 4NRSA 4AY1A 4DWSA 1GOKA 3L4WA 2JEPA 1Q6FA 5BXTA 3PTKA 1F4HA 1UG6A 1PZ3A 5A8OA 2VI0A 1UA3A 4BQ3A 4JCMA 2HVMA 3GYCA 4CVUA 2IXVA 2VTFA 5E6YA 1J9YA 1UKOA 2F8QA 5A6BA 2VQUA 4TVDA 4AWEA 3WH6A 5E6ZA 3N15A 4MB1A 5BRPA 3A4WA 4GZJA 1NARA 1E56A 2G3IA 4XUYA 1HKJA 1CXKA 4YHGA 2ZXDA 1V6YA 5AYIA 5A95A 1GZJA 4U2YA 3ZR6A 4CCEA 2QPUA 3NJ3A 3W6MA 5FIPA 3W82A 2ZUNA 1QI0A 2VRQA 1BQCA 3F5LA 2AMGA 1D2KA 5D8ZA 3N13A 4LPCA 1UKPA 1NOUA 1UKQA 3WUEA 3WUFA 2VOTA 3ZMRA 4B3KA 3KE0A 1J0HA 1BGGA 2CNCA 2YBTA 2OWCA 4J3XA 1V3LA 4QCFA 1K9TA 4GZEA 4U2ZA 3WQ5A 3WELA 3BCDA 2FGLA 2E0PA 1H0IA 3T0AA 3SUWA 5DT5A 3WEMA 1UWTA 1WKYA 4W8BA 2J7HA 1UD2A 1OGGA 1B3ZA 3VIMA 1GOOA 2VZTA 3RM4A 5E0FA 4C7GA 1BYCA 1S46A 1VEPA 3ZQ9A 4D6IA 1K9FA 1W9BM 4JHOA 3CUFA 2V3GA 3TTYA 3BXWA 4ZE5A 3ARXA 3TA9A 4M8UA 1W1VA 1GOWA 4AIOA 3WNOA 2EPKX 2XJ7A 4UFKA 3CZEA 1PIGA 4HZ8A 1XD1A 3FNDA 1LWHA 5GQBA 1BG4A 1HJSA 3CZKA 1QPKA 1YHTA 3ZO9A 4AZCA 4DM2A 4WKHA 1VFFA 1Q4NX 3MU7A 1JZ7A 2F61A 3SCWA 1FH8A 1BYBA 1MQQA 1HL8A 2WXDM 2D22A 2BVYA 4RE2A 4JFWA 2ZUTA 2J8GA 1JF6A 4OJYA 1SYTA 3FHQA 4BA0A 2WW5A 2OYKA 3BAYA 1B3YA 5I5RA 4AC1X 1ISYA 1HKIA 2QF8A 1LJYA 2RGMA 2V38A 3GTNA 5IFPA 1EOKA 1E72M 1V02E 1UR2A 3OGSA 1X6NA 2PWEA 3CUHA 5AYBA 1Q6DA 3AYRA 4MB3A 3BLPX 4BS0A 1FFQA 3TTSA 4QLLA 5E0CA 5A6KA 1EO5A 2DSVA 3APGA 3CZJA 4MDOA 9CGTA 4M29A 2BHUA 3L4TA 4UNIA 2ZUSA 3VMPA 1IZKA 5A8MA 3A3HA 3MUY1 5M5DA 2G3MA 4GINA 4HZ7A 1VIWA 1E15A 4BQ2A 4HPHA 3K46A 4B3LA 2YL6A 2E9MA 4OIFA 4WIWA 3SCNA 1CNVA 5CLTA 4FLSA 5CPSA 1R86A 3AZTA 4TVUA 3MS8A 1JYWA 4B9ZA 3OLEA 1KCLA 2ZICA 4HTYA 1BAGA 1C90A 1ZBVA 2CBUA 5C71A 4AZHA 2E40A 3G6LA 1KB3A 4Z2LA 3EDFA 3A4XA 4UFMA 1MW1A 3DECA 3ECQA 1E1EA 4XZBA 3ARRA 2VT0A 4JL1A 2V5DA 1RH9A 3CHCA 2D0FA 4QFUA 1C7SA 3WSUA 1UR8A 2TAAA 3UG4A 3IK2A 4QLKA 1CYGA 1GJUA 3LPFA 2XHYA 2YL5A 4MB4A 1JZ8A 5D8WA 1MFVA 3WNPA 1EQPA 4IPNB 1VJZA 1BHGA 4CCDA 3RO8A 5KZ6A 2QPSA 1CGXA 1UD4A 3ZSTA 1ISXA 3UEQA 5ABGA 1CLVA 1PJ9A 1OIFA 2CESA 1G01A 2CHOA 4JFVA 1UZ4A 4EAMA 1FFRA 2W4XA 4J3VA 1QW9A 1XCWA 4UQAA 3VNYA 1EHAA 1MW3A 3A4AA 3ARSA 4CD7A 3WIJA 2NT1A 5CSUA 5A2CA 3T0BA 2XVPA 2CKRA 5DF0A 4P8XA 1E0XA 2J74A 1E1FA 3AHVA 2ZUUA 2IXUA 1GOIA 4GXPA 4XV0A 2Y8KA 3OG2A 2WANA 2J78A 4ACYA 1J0JA 2UY3A 2GK1B 2ZOXA 1SMDA 3QHMA 1E4NA 5CPTA 4PN2A 3UR8A 2O9OA 2ZX7A 1LL7A 1J10A 1DHKA 3IANA 3MO4A 4FLRA 2WBKA 5A2AA 1QBAA 2WWCA 3PZTA 2E4TA 2WLYA 5I2UA 2WHLA 5HNNA 3WF1A 1ISWA 1ESWA 4HU8A 1E6RA 1JZ2A 1UKTA 1V3JA 3POCA 1QOXA 1E55A 4MTVA 1UH3A 3RDKA 2W67A 3WF0A 3T0DA 1HP4A 4LYQA 1V03A 3VNZA 4PUEA 4ACZA 5D9MA 2EPLX 3OGRA 1CGYA 1XSJA 4L4PA 3SCVA 3QOKA 5A6SA 4LXFA 3GM8A 2WZHA 2YL9A 3WD0A 3PZVA 4V27A 2WHKA 5HPOA 1TA3B 1A47A 2V3EA 1RP9A 2JEQA 2W66A 1JGIA 3RM9A 3MANA 3SCOA 5C70A 2BXYA 4UQ9A 4YPJA 2VJXA 4CKQA 3W29A 4GO9A 4AYSA 4Q22A 2XYLA 2BY0A 2VRKA 3GH5A 5ABFB 1CECA 4LYRA 3CZGA 2O9TA 1JNDA 3KL0A 1W3HA 1CXLA 2MANA 2WVSA 3PZUA 2DT2A 3RMEA 2YA2A 2OYLA 4JKKA 5ABHA 3GXFA 2X1IA 4HOXA 1VENA 1UH2A 1E4MM 2ZWZA 1SFSA 5HXMA 3AZRA 4RE4A 4J3SA 1E4IA 3VIJA 4H8UA 1GQLA 5EBAA 1E70M 1QI5A 1CDGA 1GW1A 5CJ5A 4TX8A 5TD4A 1QNOA 1J0YA 1OB0A 3ZIZA 3DYPA 1JYVA 3NSNA 1UA7A 2AAAA 5AC4A 4HZ6A 2J75A 1M53A 3WL1A 5FKYA 1C8QA 4PMVA 5CZKA 4PMDA 1V3IA 1TZ7A 1KXVA 1UR1A 4W7VA 4Z2GA 3AIEA 4TOQA 4S3JA 1B3WA 5BYWA 4KRTA 3FN9A 4UFJA 2X09A 4RE3A 1HL9A 1LL6A 1XSKA 1U30A 1E6NA 3WKZA 1HKKA 4S3KA 2CBJA 1ODZA 3AROA 4FF5A 4IUGA 3GDBA 1WAWA 4HOZA 2Y8VA 3IJ7A 4D6CA 3WL0A 3AXHA 4PMXA 1Q6EA 2DGAA 5JBDA 1OGBA 2WMHA 1V3MA 3L4UA 3WMCA 3ZJ7A 1NWRA 1K9DA 4W7WA 1PEZA 3ARQA 4CN1A 1W9UA 1V08A 3TTOA 2J79A 1HP5A 3UCQA 3MMUA 2YKKA 1MQRA 5I3DA 1MQPA 3ZR5A 2XGIA 3RJYA 1NOWA 1E0WA 5DO8A 2VX7A 3UG5A 4OBSA 4D6GA 1LG2A 3D5HA 3SUSA 4CU8A 3T09A 5FD0A 2FH6A 4H04A 5HDRA 3B9EA 5A6BD 2J7BA 3AOFA 2A3HA 4ML4A 1ECEA 2WZIA 3M46A 3WDRA 4BZYA 2OSWA 4AD5A 4HMCA 3B8SA 2J7FA 3B9AA 4MNLA 3CIVA 1VB9A 4DWSD 2WKGA 4D6JA 1B90A 1H41A 2CXGA 3I3DA 1L8NA 4A3YA 2WMIB 2X0HA 3SCQA 1WPCA 4D6HA 3DHPA 1JDCA 1E6SM 2ZX9A 3PZ9A 2ESCA 3NDYA 3WNNA 2WLZA 3WH8A 4GKLA 3BMWA 2YBUA 2GFTA 3AS3A 1DWJM 4GQRA 2WM0A 1V6VA 4CCCA 3AS2A 2CBIA 1G0CA 3VMOA 4AEFA 1OGSA 2XVGA 3TONA 2WMJA 2VCCA 1GQKA 1MW0A 4B9YA 2FDMA 2VX6A 3S6TA 3MV11 4PSPA 1ZBKA 3J7HA 2VVSA 7CGTA 1CPUA 1XSIA 1YQ2A 2QMKA 1SMAA 1V02A 5CPQA 4OBRA 4AZ6A 1SR0A 2YDSA 4QDMA 1EDGA 1HJUA 1C7TA 4JCLA 4ZXLA 1VRXA 3VO0A 2ZIDA 2DEPA 6TAAA 1E3ZA 1AVAA 4CUCA 1KXQA 4E2OA 3EBVA 5GNZA 1J0KA 3GNPA 2D24A 2VC9A 4CGTA 1V3HA 2XIBA 1DWIM 2WCAA 4KGLA 4Z2JA 1HF6A 1TVPA 1J12A 4OKDA 3NCOA 1QI3A 4PTMA 3ZOAA 3PN8A 1PAMA 1UWIA 3ARZA 2XSBA 4JKLA 5A6MA 1CGVA 1BVZA 2XSAA 4KMQA 2WPGA 4W87A 4NSBA 4PBGA 1CLXA 1KR0A 1LLOA 1DWGM 1G5AA 3ARVA 1XH1A 2WC7A 3N1AA 3WNLA 4OZOA 1M01A 1VEMA 3VM7A 3TP4A 2BY3A 2JFEX 1UWSA 1V0NA
chains in the Genus database with same CATH superfamily
3DKLA 2WJEA 3UGRA 3UWEA 3WDPP 3WLPA 1Q3NA 1P6WA 1NDVA 4S3FA 2Y7EA 2YZRA 1GJWA 3W4RA 1V6UA 4Z2IA 4IPLA 4I90A 1X97A 2GVYA 1IE7C 1VAHA 4ATWA 3RYSA 1TE6A 2DIJA 2OQLA 3WD2A 4OUEA 1PS9A 2GGGA 2I9UA 3RMJA 1VPQA 2D73A 1K6WA 4DJDC 5JUVA 2ACSA 2C8NA 2C13A 4QLJA 3T8QA 3IV8A 3O0KA 1FKWA 3B03A 2TODA 1DTNA 3POHA 3OB8A 3S6DA 2PF8A 2FJUB 2J77A 1V6XA 4JKMA 2OYMA 4JR5A 5K4XA 4L1XA 3BH4A 1UR4A 1H09A 4RDWA 5H6HA 2QUNA 5HPCA 3TYBA 3VZYA 1HVQA 1JXKA 5LIYX 1BGAA 2E25A 1J0ZA 4U31A 3PJWA 5GPRA 4CVWA 2A3EA 3KOYA 4Z1AA 3A64A 1JR1A 3C0JA 3CU2A 2Z1WA 4MDPA 4AVFA 1VR6A 1XLLA 4I6KA 2R24A 3KDNA 2J7CA 4GA8A 1XC6A 3I6EA 4NZ5A 3CH9A 1R7AA 5C7HA 3RCNA 1RP8A 3USBA 4WKAA 4UOQA 1Y8BA 2W62A 5CZJA 3CYVA 3PUOA 1A5OC 1AA1B 4UTUA 4B2DA 4DBEA 2QVNA 3WQPA 3XISA 3AIQA 3K4DA 2D1ZA 1H50A 4US5A 2PDYA 1ITXA 1XIHA 4DJEA 3NQ6A 5HNTA 1DIOA 5T26A 3N2BA 4PRRA 3SI9A 2FPTA 2VZUA 3OZYA 4H9ZA 2OCZA 3DFYA 4DJDD 3ALGA 4QDPA 4E2VA 4LUTA 3T2QA 2Q09A 2NUWA 1ZAHA 1KQYA 2I57A 3PJUA 4H2HA 4EF9A 3DENA 2YSWA 4DELA 1LQAA 1QNRA 1KBJA 3BDKA 3BPWA 4OT7A 1XCXA 5C6MA 2G4FA 5J5RA 2GWGA 1EGZA 1CEOA 2J9ZA 4E3TA 1K4HA 3L7RA 2OXNA 3K1DA 5D32A 4Q8QA 3SIZA 3CZLA 1XS2A 1MRAA 1VBJA 5KMYA 3UYCA 3BO9A 1Q6LA 1OCBA 2PBGA 2DT1A 2JF6A 3N34A 1GG1A 1UZ1A 4GX9A 3LPPA 4DJFC 1QR7A 1QHPA 2HVNA 1WDRA 3RU8X 1XGDA 2CZVA 3N4EA 3N11A 4ERIA 3WQ4A 1JZ6A 3IV3A 3N4FA 3AMCA 5E93A 4H7VA 3ZJKA 4L61A 3DBNA 3GQYA 4MJ4A 3LMYA 1Q7ZA 1Z42A 3O7UA 3MHGA 4FX6M 1X6UA 3C8FA 3WD1A 4M80A 3GG0A 4JQ1A 1PDZA 2PWDA 3IIPA 5HOSA 1ODUA 4EPKA 2VVNA 1BRLA 1Y5XA 3QRHA 5CPNA 2XH0A 3FW6A 3N12A 1W91A 2W79A 1YDYA 3PTMA 3IJLA 1I60A 1A3HA 3FA3A 3ITYA 4MSSA 4ZQMA 4NZFA 3GBDA 3E5PA 2VUYA 1LQ0A 5T91A 5J5DA 4L7ZA 4FF7A 1K7EA 3DFHA 4LAOA 2DJLA 3II1A 3VX1A 1KM4A 5XIAA 4LAZA 3B8UA 4GI6A 4AC7C 4QS5A 2EPNA 3H8AA 4UOZA 3DG7A 1EDTA 4MM1A 2H6RA 1JRBA 1CXHA 3SUVA 3MUIA 4PTWA 2PB1A 3LUTA 3KRSA 4M24A 4LCQA 1JCNA 3W81A 3N04A 3K13A 4F0RA 3L12A 2INEA 1IEIA 3IWPA 4EPDC 1YBQA 1FH7A 1Q2RA 3IUIA 2XFYA 4RX0A 4I5UA 3V0SA 2D23A 1KFEA 3B4UA 1KWKA 3T4CA 3TYCA 1DL3A 2OX4A 4W8LA 3TROA 3QC3A 1TRDA 2PWUA 1NOFA 1WDQA 3LPOA 4HJFA 3W73A 3QPEA 3QY7A 1A5CA 4M6VA 2ZZ4A 5HAOA 4AY8A 5DMNA 3KLLA 1KTNA 1W9VA 2F7FA 1FWNA 1E9IA 3FEQA 1HNYA 4A8IA 4F66A 5AY7A 4W88A 4LY4A 4XX6A 4JBRA 3N18A 1WNOA 1VPXA 4MNKA 4OVXA 1RV8A 1NH6A 2FIQA 1QT1A 1GONA 1KFJA 1J0IA 3HPZA 3P82A 4IIFA 4G2DA 3WF4A 2CLLA 5LA2A 3S2CA 4YU1A 1OFEA 4QITA 5DN1A 1B3XA 2F2KA 4U5IA 5BXSA 6TIMA 5HK4A 2QAFA 4CU6A 5PTDA 3WJWA 2NV9A 1UB3A 4K1GA 3HQ1A 1YXDA 1XYAA 2D3NA 3GLCA 3MO7A 2E5CA 3GAYA 4GCXA 2I5QA 4RV3A 1QBBA 1RBOB 2BGSA 3GD6A 1RAKA 3QV7A 1LWJA 1Z69A 4UB9A 3HU7A 3KHJA 1J5SA 3CAQA 4L9YA 4UQEA 4QAIA 2XN1A 4ZOBA 3CUZA 3AHXA 4D6DA 1R3SA 4WY0F 3W38A 2Z2AA 2RH9A 1UOZA 3EA1A 3O07A 2J7DA 4DO6A 7A3HA 4NAFB 4MUZA 3GVVA 3QSRA 1WKFA 2H8ZA 5AHEA 5DXYA 5TQLA 3I7QA 1Q2SA 4LY8A 1W32A 2D0HA 2GQ3A 4N0RA 5I06A 2AGKA 3LTSA 4MNJA 3BLFA 4F0MA 4UMBA 4NAEA 1DIDA 1IXNA 2HTMA 3KL3A 3NL3A 4AU0A 2O9RA 4B5UA 2CBVA 3GH4A 3NIYA 3FV9A 2XTKA 3AZSA 4C6PA 3LZ3A 3IRDA 3E6EA 1DORA 3MJYA 5JXQA 2RFGA 4B5VA 4Y96A 3OVRA 1HVXA 1JGMA 4CLMA 4MAVA 2X1TA 4KFOA 1XW8A 2Q8LA 1QATA 1W54A 1RCXB 3QQ1A 2PDLA 1KM0A 2WC3A 3B97A 2XWDA 1G7UA 3LSBA 8A3HA 1GZGA 4ZOCA 3UG3A 3EX1A 4NNBA 1AW2A 3CHEA 4YTRA 1E3XA 3MP5A 1JDAA 1XI3A 4LAKA 2BXZA 3RX2A 2YLLA 3Q37A 1PWMA 1GK8A 4RDYA 1F07A 2X42A 3UESA 1YKWA 5BZAA 1ZQ5A 2QIIA 4U28A 1L6YA 4FR1A 2PLCA 3DX5A 2ACRA 3ZM8A 1DJIA 2FZNA 4O17A 4UQDA 2TPSA 4RJEA 3C56A 1VJSA 3PBGA 3Q94A 3SGZA 1T99A 3AQUA 2OKTA 3O6DA 5EGRA 1EGVA 3AICA 3UWQA 3QFWA 1OFQA 1JUEA 3RO6A 2WVVA 4I9AA 5DFAA 3UWVA 3HN3A 4UMCA 3UF9A 3S5SA 1JAEA 4R3UA 2DSUA 4G56A 3R7MA 4QEEA 4XSLA 4HOWA 2YDAA 1H4PA 3VXGA 3S9IA 3W88A 2BWGA 3AWOA 3VOGA 4HNOA 2XZ9A 5K3VA 3ZXWA 1P6CA 1RY8A 1H7XA 4AD1A 4PA8A 4ZB0A 3IACA 4GH3A 1J93A 1J4EA 2J47A 3NQBA 4RV8A 5C2CA 2HK0A 2Z7GA 2WNQA 2Z6IA 5CG0A 3NYZA 1R3WA 4XZWA 1GVOA 3NZQA 2FZBA 1E5JA 5DRIA 2QCDB 1EPVA 1TA3A 4DM1A 4UNLA 3NQAA 1G4SA 3BGJA 2DIEA 2PLKA 5I78A 4S39A 3TC3A 4AEOA 3WCZA 1HGYA 4CN6A 1OCQA 3VM5A 2C16A 2A4AA 4XVEA 2F2HA 3ZLGA 1CB7B 2R82A 3W1UA 3VCNA 2ON3A 4ZR8A 3ENLA 3T42A 5DLCA 2TMDA 4KETA 3WLRA 1E0TA 2NX1A 4M7TA 2WKLA 4DNHA 3LXAA 5D37A 4B4FA 5I23A 5CPMA 3WK0A 3W75A 1R2SA 2I14A 3F2CA 5AHNA 3W1AA 1W3LA 1AQFA 4J35A 4H83A 2CHRA 1H7RA 1BYDA 1GUVA 1VFLA 3GZAA 4WVXA 4PRWA 4GY7A 2OPJA 4X2PA 3C61A 2C71A 4PUMA 3VOHA 1BPLB 2GJLA 2R1MA 2IMRA 1TPEA 2Z24A 1WXJA 2NWSA 3I3EA 1X96A 2F84A 3RX3A 3TYDA 3AUJA 1VFMA 2QYGA 3MI6A 1A3WA 1FTXA 3P61A 2DV0A 1T40A 3K1GA 1T96A 3N9SA 4ECLA 2NSXA 2GK1A 2X16A 1VD6A 1VIZA 1JUBA 3OLDA 5D9OA 1NP0A 1GVYA 3MUAA 4FR6A 3UGVA 5D9PA 5GJPA 4IIHA 2ZTJA 3C3NA 5CQ1A 1TSIA 3ISIX 4F0KA 2J9YA 3U2OA 4IM4A 1YTEA 3TKFA 2NXGA 1KA9F 1XM3A 4KWOA 2QJNA 4QE1A 3WQ8A 3OBAA 2PWGA 4FXRA 3AIUA 4MF4A 2Y24A 3RG6A 2B7NA 2OLHA 4WD0A 1IT0A 3NQVA 1I8JA 1SGJA 1GNXA 1Z48A 3N6QA 2Y7DA 4MZ1A 3WLTA 4PMZA 2A3CA 4RZ4A 3WQOA 1J96A 1I9CB 2EJ1A 3HGRA 3AIWA 1LG1A 3MV01 2ZDRA 1W0MA 5JH2A 3L4YA 4G7EB 2VC7A 3PR2A 3E9AA 1FOBA 4LX4A 1U5JA 4KFNA 2CETA 2XM2A 5I77A 1SJAA 1ITUA 4NAFA 1RD6A 3FA4A 3ZS4A 4DN1A 2RJGA 4YLWA 4AY7A 3ZZ1A 1TPC1 4P7QA 3KRZA 1J5TA 2YYUA 4M1RA 1TMHA 4AH7A 4K1WA 2VWTA 3GR7A 4GUIA 3M16A 1O95A 1FA2A 2ZX8A 3VGDA 2ZRWA 1S5VA 3AU2A 4LYKA 3N29A 3LV5A 2PRMA 5M17A 4H00A 1S5MA 4J3UA 1ZNNA 3SR7A 1EJ7L 1ONEA 2HXUA 1NEYA 3N2MA 2ZDSA 1V79A 2NSOA 1QPNA 2ADAA 4EXQA 4BQ5A 4NVTA 2Z27A 4FIQA 3G1YA 2HCVA 3FDGA 2VO5A 3LHUA 4R7OA 1SM9A 5IDIA 2OWXA 3OLGA 4HBKA 2VFDA 3PPHA 2HVOA 3T6CA 2YXXA 1P4CA 1TUXA 1W6TA 4TIMA 3LPGA 1KBLA 4HD5A 1ISVA 1H0GA 4DUVA 1JZ5A 2GSJA 1PWLA 1KRMA 3TMQA 4R33A 1G4TA 4L56A 2UWFA 3GG1A 2RUSA 3MSGA 1A5AA 3D47A 1N7KA 3VGGA 2OELA 3PBMA 3WQVA 5G1YA 4US6A 5A8PA 1C8XA 4G7FA 3UETA 1QNPA 4H9TA 1UQYA 2C0HA 4ZZ9A 3W1XA 4ZXOA 3UCCA 3B0PA 3H2NA 4L4LA 3TN3A 3HPFA 1TE1A 1G94A 3CL7A 5BU9A 3LOTA 1VFUA 4QCEA 3WBWA 4NYUA 4JY8A 4MFDA 2F6XA 1XYFA 4AIBA 1FHVA 3IEBA 1Q6QA 3M41A 2Y5EA 4JTAA 4GD0A 1MMFA 2V5KA 1C9DA 3ARWA 3VD5A 4FA3A 4GI8A 2AGTA 3U7BA 2FZ9A 2ZE3A 1KM5A 1WQ5A 3KHDA 3MKKA 4AW7A 1FKXA 3TYAA 3NQEA 1O5KA 2W9MA 3OZMA 3B0VC 5H91A 4E6MA 2VFEA 3CAKA 3GTIA 3G6MA 1GHSA 4XB3A 4DIAA 3PPFA 4EXBA 3CHVA 1FVPA 1SFLA 4JGDA 2OZ0A 1JNEA 3LHWA 2ZRVA 5DELA 1GJPA 4Q4MA 1W5OA 2XIIA 3W7JA 4FEZA 1NFGA 4RNHA 1SZRA 3A22A 2WAGA 2V6AA 1K7XA 2ATSA 3AS0A 3HBLA 4DXXA 1QCWA 1W5PA 1FWTA 4C6BA 3GHRA 2DPEA 4IQEA 1IXQA 3U0HA 1JD9A 4P8UA 3REQB 2DQXA 4MYAA 1UP3A 1AD1A 2EPMX 1AUSL 2VEPA 4QJ5B 2W61A 3FKRA 4K36A 4AZ5A 1V6WA 4A3QA 5BOFA 3BZJA 5BWFA 5BW6A 1LT8A 5LNUA 3GRIA 3NO5A 1FUYA 3P60A 4X0NA 3ZSSA 3SQMA 5EFDA 2IQ0A 4NQ1A 1EDQA 2A3AA 2DY3A 4DO5A 4AVOA 3SY5A 1P1MA 1VFTA 4C6NA 3H4GA 2RHGA 1I2QA 1F4HA 3T55A 2VI0A 4BQ3A 2WSQA 1F8MA 1KC7A 4CVUA 4KCWA 4XZNX 1UKOA 3THQA 1PSCA 2O7SA 2VQUA 1FWSA 3FGCB 5E6ZA 4QBXA 1A0EA 5BOEA 3W2UA 5BRPA 2G3IA 2PODA 4Q6XA 2YCLA 2VEFA 4IZGA 3N2TA 4DZHA 5A95A 2QDEA 3ZR6A 3UVAA 4CCEA 3W6MA 3C3UA 5FIPA 3W82A 5MKGB 2VRQA 3GXTA 3QYSA 2CLHA 5D8ZA 3WJXA 4LPCA 3QN3A 2Z00A 1C29A 3WUEA 4F40A 1O60A 3BSMA 3KE0A 4QNWA 2YBTA 2XSXA 3TN6A 2CLEA 4CQAA 4U2ZA 4AFYA 3SBFA 1UUMA 1RK6A 4HSHA 2PC4A 1X1ZA 2DZXA 3T0AA 3SUWA 3G1HA 1XLEA 5MF5A 2ZADA 2CLMA 1UWTA 2AL1A 5J04A 4HHMA 3FVMA 1OC7A 4OGZA 3S9YA 1OGGA 1B3ZA 4HHLA 3VIMA 3QV6A 3RM4A 1OF6A 4C7GA 2VUNA 1K9FA 2X7VA 2DORA 1ZLPA 4GXMA 2A6LA 3HPAA 3TTYA 4CQ9A 3KXQA 3ARXA 2HDJA 1GOWA 1HO4A 3CZEA 4JD4A 1HFBA 2WSRA 2EHHA 3C4UA 3FNDA 3CZKA 1HJSA 2CZ5A 1AMKA 5JU6A 3EA2A 1IR1A 3ONCA 1Q4NX 4WDXA 4KCTA 3SCWA 1MQQA 1HL8A 2BVYA 3QM3A 3CT2A 3PY2A 1JF6A 2OO0A 2VR2A 3FHQA 3SSJA 4BA0A 3N14A 5C2GA 4JTCA 1LUCA 2AKMA 2QUVA 1B3YA 3P8IA 5J8LA 1HKIA 1YX1A 3W6YA 1EOKA 4Z0SA 2J88A 1HQTA 1V02E 1X6NA 2PWEA 4N02A 1KV5A 5AYBA 1TZZA 2O0TA 3QYQA 3UNDA 1EO5A 3CUXA 3WJSA 3APGA 3CZJA 3V5CA 4M29A 2BHUA 4FNQA 4NX5A 2A3LA 5HWJA 1DXIA 1ZP4A 5A8MA 2QUTA 3BLOA 4P5UA 5FEZA 9XIMA 3KW3A 3AJXA 5DCBA 2QCHA 1F76A 1TIWA 5G1TA 8XIAA 4B3LA 2YL6A 1R2TA 4OIFA 4AWTA 2C3ZA 1YPXA 4WIWA 3VUSA 3PP7A 2ABBA 5CLTA 2FVKA 1R86A 1UIPA 3AZTA 3MS8A 4C1NA 3OLEA 4J5NA 1KCLA 2ZICA 1BAGA 3R79A 5C71A 4AZHA 2DVXA 2E40A 2TYSA 4IXXA 3A4XA 2R1PA 4LUSA 4JTEA 4JTTA 5KTLA 3DECA 3EOUA 1DHPA 1E1EA 8RUCA 2RDXA 4J3ZA 4BF9A 4JL1A 4KS0A 2G5WA 1C7SA 4QFUA 3KOWA 3UWYA 2V5BA 1B3OA 3H2OA 5KITA 3CQHA 1JZ8A 3BLEA 3F03K 4GGHA 5D8WA 2HRWA 4MOZA 4ZQCA 2Z25A 1J6PA 1BHGA 4CCDA 1UD4A 2ANUA 3CV2A 5FJUA 3DKJA 1LCOA 4F4RA 3E2SA 2GZXA 4EAMA 4FXJA 2W4XA 1XCWA 3DXIA 4IWWA 3W9ZA 4NUWA 3V35A 3A4AA 3VNDA 4CD7A 3W1LA 1L6FA 7REQA 2RDWA 1BXNA 1FWWA 3QLLA 4UNKA 3WLLA 1YMYA 1OF8A 3LS9A 5D09A 3BV4A 4GJ1A 1TV4A 3DN5A 1H1ZA 3AHVA 2ISDA 2ZUUA 2IXUA 4DLFA 1GOIA 4PCPA 2DZPA 2WANA 5JVLA 1J8VA 2GK1B 3A3XA 2ZOXA 3QHMA 4QQ3A 5D05A 2ZX7A 2ALDA 4UTHA 5G4WA 5H1WA 4IHCA 1J10A 1DHKA 3DI1A 3IANA 4XBKA 3RLVA 1DXEA 5EYWA 2GUBA 2WLYA 5CH9A 2OEKA 1ESWA 1T7LA 2XIJA 4O11A 1ITQA 2AQVA 4H3DA 2H3DA 4K8GA 3ATYA 4MTVA 4QR6A 1UC5A 3WF0A 3SRHA 1HP4A 4LYQA 4PUEA 3E96A 1BXBA 2NQZA 3KP1A 4C6MA 3CYJA 3SCVA 4IX0A 3L68A 3QMSA 5A6SA 1TCDA 3PZVA 2Z7KA 3E3HA 1GWJA 3BW2A 2JEQA 1JGIA 3RM9A 3SCOA 4YPJA 2R14A 1OK4A 1NDWA 3I10A 2QCNA 3WJZA 4IP4A 4PB5A 1POJA 2VRKA 1CECA 4LYRA 2O9TA 3RX4A 4IJBA 5FJOA 3PAOA 1A5NC 4C6DA 2IPFA 1S39A 4XIMA 1I2OA 1QNVA 2DT2A 1FY6A 4XVDA 1BWKA 1UC4A 2R8WA 3OU8A 4W4QA 2X1IA 4HOXA 1UH2A 1R9ZA 1SFSA 2PDIA 5HXMA 3UZZA 3LA4A 3VIJA 1NFPA 4LU0A 4IGHA 5EBAA 1OY0A 3LB0A 1TR9A 1CDGA 4PRTA 4UUIA 3FGCA 1B9BA 3G0UA 1Q63A 3TZFA 3IJDA 3F4DA 3A3WA 1OB0A 2YCLB 3DYPA 4NJHA 4FXFA 1XICA 2J75A 1QO5A 2OODA 5U4NA 3ZLFA 3WL1A 1H7NA 3LHVA 1Q65A 4PMVA 5CZKA 2CLKA 1V3IA 4HCHA 4JTSA 5CPOA 3O6YX 1UR1A 4W7VA 3UZWA 3AIEA 4LEQA 5BYWA 1B3WA 4BFAA 2X09A 2J13A 3WKZA 1XLGA 2E6DA 1K70A 3O6CA 4HMNA 2NQJA 2Q8ZA 4IFKA 3OA3A 4PL1A 1TTJA 4D6CA 3AXHA 3E2VA 1Q6EA 3RNDA 1FRBA 1R30A 3B8WA 5D02A 3KP0A 1EJTC 2E5BA 4RDVA 3V75A 1NWRA 4U4MA 3L0NA 3VZZA 1PEZA 4E8GA 3KBNA 3ITGA 3V5FA 1W9UA 4GQBA 1XPYA 2J79A 3JW7A 4WSHA 1HP5A 5A6TC 4EPBC 3HQNA 1MQPA 1SW3A 2XGIA 3FS2A 4JTGA 4M5PA 2VX7A 4D6GA 1LG2A 3BCJA 1TZ9A 4NZJA 2Y1HA 3CPRA 2WQDA 1F6YA 3T09A 5FD0A 4IQJA 3UBPC 5HDRA 1XPGA 3AOFA 3FJLA 1TV2A 5F2IA 3W07A 3M46A 1K3UA 4AD5A 2OMAA 3B8SA 3KVMA 2WO5A 1AJZA 2OGYA 3UVIA 2WKGA 4KWSA 4D6JA 1H41A 3OHIA 4H6KA 1Q6OA 2X0HA 1SFJA 5I02A 1E6SM 1WOAA 2FGBA 2ZBTA 2WLZA 1T6MA 4AUBA 2E6AA 1RPXA 4BI6A 3F7JA 3W7PA 1DE6A 3EWWA 4O1CA 3RHGA 1A5KC 3VNKA 1SFTA 4CCCA 3AS2A 2CBIA 4BWLA 3G3DA 3VMOA 3LXCA 2VCCA 3EWDA 4B9YA 3PULA 4JTFA 3S6TA 2XGZA 1E0UA 5G2HA 3FX4A 3J7HA 4IPPA 4B5NA 4C6CA 7CGTA 1CPUA 4R34A 1YQ2A 4M51A 2QMKA 4E2DA 3QZAA 3URBA 4OBRA 2VKZG 3HM7A 1HJUA 1C7TA 3FJNA 4HYWA 1QUMA 4ZXLA 2FJKA 3FYOA 4H6EA 4E2OA 3EBVA 2D69A 3IVSA 4CGTA 3QLDA 2D24A 3UG8A 5FA5A 3MB9A 1DWIM 5CCZA 4M6QA 3FLUA 1XIFA 4KGLA 2QF7A 4Z2JA 4H01A 1J12A 3W7QA 4OKDA 3ZOAA 1A3XA 3G3MA 1PAMA 1UWIA 3ARZA 4LANA 5DXXA 5FAGA 4QM1A 1GTHA 4OECA 3GIYA 1CLXA 1KR0A 4LS2A 1RHCA 1LLOA 1UZDA 5HR6A 5I3FA 1TV3A 2FZ8A 4G5DA 1M01A 1CI1A 6ALDA 3VM7A 4NZ1A 3TP4A 4QG6A 2O4MA 3BOLA 2OFJA 2TSYA 2PPGA 3P6LA 4ICNA 3FAXA 4LBRA 4FP1A 1H2JA 2A0NA 1X6LA 4DF0A 2J25A 2YOCA 2YZ5A 1XDLA 4LVAA 3MBDA 3CPUA 3WLQA 2PA6A 3QY6A 4P7LA 4O0ZA 3NDOA 3BJSA 4UWMA 1AW1A 3KS6A 3CL8A 3BC9A 5C9WA 4Q32A 3HMCA 3O63A 8TIMA 3BK0A 3SIMA 4INFA 1J2BA 1FCUA 2GSEA 1GQJA 1U22A 1H61A 3E38A 1L0PA 2VCAA 2W92A 4XZMX 4EF8A 4JDYA 2QJGA 3BJFA 1TKKA 4WXZA 1R3QA 4MPKA 2FGZA 1O12A 2BVWA 3IIVA 3VKCA 1I2NA 4FOJA 1EGMA 2YA1A 1PPIA 3RRXA 4UTIA 2XUCA 4X0VA 1M6JA 1E4LA 2VCBA 2YFOA 1V8EA 4GUJA 3I7RA 4LUIA 2E6YA 4CD6A 1AK5A 3S46A 1IXPA 1GKPA 2CU0A 1U1UA 1TX2A 4ATDA 4TQTA 3NG3A 1I75A 2BVDA 1OX5A 3VNLA 1UBPC 4TMBA 3VIOA 2CWNA 1EUNA 4MWAE 4NX0A 3ZVHA 1Q6RA 4O0QA 4S3BA 2W63A 6PTDA 4HKPA 4A2RA 4DYEA 4GYPC 3THCA 2XFRA 3G1RA 4KEUA 3UXLA 3KM8A 1F3EA 5JIWA 3EB2A 4BCEA 4WY0B 5FESA 1K1DA 4DQWA 5AFDA 3T05A 2VEKA 1BF6A 1BVWA 2PWVA 1JI2A 1C3FA 1K8XA 2OWWA 4WSJA 2B0MA 4IQLA 1PHQA 5EL1A 4IGSA 2BY1A 2GDUA 3AXXA 1QDSA 1W5NA 3WUGA 4ICMA 2EPOA 1IV8A 2NQ9A 3ZT5A 3SN1A 2OQYA 1TPWA 2OU4A 3FHAA 1REQB 4JX6A 2V63A 4ZO6A 2YLAA 4J3WA 3AHYA 1W5QA 3GO2A 2WCGA 3EZ4A 4QG9A 3MKCA 1FHLA 2J7GA 5JMUA 3AUOA 4I8YA 2PGFA 4P7RA 3M9YA 4K2SA 1B2YA 3NL5A 4C1NB 5C9ZA 1RUSA 1U83A 1NSJA 5I3IA 2FQIA 4DJFD 5SWUA 2Y2WA 3TSDA 4GJIA 1O68A 2EQDA 2GWNA 4L1GA 4O50A 3KDOA 1VBUA 3SGGA 3B8DA 5FEPA 4FLQA 3E0VA 1CXIA 3HZ3A 4O1AA 3NGFA 4QROA 2QHAA 1J18A 3UZ5A 2X1UA 3SZ8A 1PKNA 4MIMA 4GX8A 3WQEA 4DYKA 1Y7VA 5CBJA 3ATZA 3CV6A 2WM1A 1NELA 3QW4B 3MSYA 3DHFA 2WC4A 2VHLA 1XBZA 3LM3A 5JBEA 3DGRA 1XF0A 1W1TA 3AYTA 3EMZA 4DB7A 3AYSA 2PDWA 3EAUA 3WK3A 1E43A 4TTUA 1IWAA 2Y4SA 2YR1A 2PTDA 3UA3A 1I0DA 3VIFA 2IKIA 3W37A 2QS8A 3NOEA 3MI3A 1OT2A 4DJEC 1OC6A 2FHFA 2L5HA 2IKHA 4XKMA 3P0WA 2ODOA 4JICA 1JCXA 4Z2KA 2XZ7A 3B8IA 4CD5A 1WV2A 1TVLA 4LWWA 1PIFA 4E8CA 5F2LA 4GK8A 3LGDA 3REQA 2Z29A 4L4MA 2QW5A 2UY2A 1O1ZA 2WPBA 2QT3A 4K7YA 1EHNA 2OOFA 2Q71A 5FSEC 4GQ0A 2CITA 1V93A 1HKWA 2A2IA 2BSLA 1KXHA 4UZSA 2WHJA 3QOMA 2YCEA 3MT1A 4IMEA 2PU1A 1IIHA 3AHTA 3O9NA 2X2YA 3BLKA 3E0WA 3K8LA 4N9CA 3SCTA 2PDPA 1W3KA 3NM1A 2FFIA 3QFEA 5HUOA 4IL0A 1VEOA 5D2XA 2IS7A 4AX6A 3HV9A 4AD2A 2PI6A 5D04C 2EG7A 3VINA 1R3VA 5ABFA 4UXDA 1W9DM 4M19A 4E4UA 1E9YB 4AZIA 2QDGA 3EWXA 3U7VA 2V82A 3CV1A 2G3JA 4HCLA 2V5CA 3NOYA 3Q67A 3D0CA 1F9CA 2EPHA 4LVGA 6REQB 2EKGA 4EAYA 2BS9A 3QZEA 1F6PA 1NJJA 4UR9A 1V5XA 4A3RA 2WZEA 2VP8A 3L67A 4UQBA 2XN0A 4Q4QA 3EDDA 2IKJA 2WBGA 3GC2A 4B4HA 1E73M 3ZVIA 4HNVA 1KQZA 4I7UA 3W53A 1UP2A 1R3TA 3WLMA 3W27A 3HPSA 1B1YA 4FMVA 4NIRA 4QX4A 4WGHA 1JIBA 4C6QA 4RK8A 5FOOA 5RUBA 4HHHA 3BURA 5E70A 2WJZA 3IVUA 1TPVA 5CSYA 1KRCC 3I68A 3ANVA 3T78A 1OT1A 4HA4A 4NNCA 5H8PA 2PMQA 1EWDA 2GDQA 3CQKA 1Z41A 1JPDX 1H49A 1M41A 5I7GA 3M5ZA 2DT3A 2V9DA 3UZXA 4IJRA 1L6SA 4RPQA 1GZ1A 1EJUC 4V15A 3G8EA 3MJMA 1B30A 4X2RA 3H53A 3MUZ1 2JBMA 2GGEA 5AC7A 1ZBCA 2YCIX 1R47A 5LIKX 4GRSA 3CB8A 4YHEA 1ADSA 1MVYA 2QQ6A 4HA3A 1EEPA 1PKYA 2E3ZA 1V0KA 4JX5A 1HJQA 3WBAA 1EP2A 4JN6A 3LD5A 4W84A 3ARPA 4A8RA 3EMQA 3TLQA 1LUCB 3U48A 2OLSA 1VF8A 2HPMA 3M43A 1PV8A 3VPLA 3E2RA 2JK2A 3CHDA 1Q7QA 4WX2A 3URNA 1GOQA 3QW3A 3PUGA 2W91A 2QAPA 2BDQA 4MNMA 1X1NA 2QEZA 4UBPC 2G96A 4XSMA 1O6IA 2CCRA 5M3WA 2D2HA 2YCKX 1TVNA 1QK2A 3B0XA 3W7NA 1QASA 2INFA 4QSHA 4XTIA 1ZS2A 2JQXA 3W7OA 4ADTA 5BMWA 3CLMA 3DESA 4HT3A 1LLZA 3Q2DA 2OVLA 1W1B1 2VURA 2WB5A 2KX9A 1XLDA 4G9PA 2WMFA 3HIJA 3QMTA 1FWGC 1N82A 2QGYA 3PZMA 4Q4OA 3B9NA 3IRSA 4MZYA 3LBCA 1WDWA 4EIVA 3MTWA 3NXLA 3H23A 2QCEA 1DXFA 2J66A 1ALDA 2QMJA 2P3EA 1KM3A 3NZGA 4EE9A 4O1FA 1FP9A 4GPNA 3HG2A 4OTKA 3TOPA 3DU0A 4O19A 3PNUA 3MP4A 4JFTA 5LNSA 2FHBA 5D38A 1NF0A 1PBGA 4MWAB 3LCIA 3MPGA 3OVQA 3DI0A 4LVBA 1Q66A 3GVRA 3B8VA 3VGEA 3IAPA 3TV8A 4ZQOA 3EDKA 3IJQA 3WUBA 4H8VA 3VCRA 1KFCA 3R8GA 3TDFA 3IPWA 1H5YA 4O53A 3MCNA 1MNSA 4PUUA 3GXMA 1Q45A 2I5IA 4WSKA 2AOSA 1T41A 1EQCA 3NEVA 3UERA 1EOMA 3WBYA 4UFHA 4KEVA 4M81A 3USZA 3WD4A 2XVKA 3UCDA 2D3LA 1LF1A 1FWCC 1US0A 2A7RA 1VBRA 4GMEA 1M7JA 4DI9A 1TCMA 4RXGA 1FXQA 2E67A 3STCA 3P2VA 3P0XA 4ML9A 1W3IA 3PB2A 1D3GA 4YVVA 3SAZA 1E9LA 3W70A 4PTVA 4EWND 1O4UA 1OG0A 3NFUA 4IPJA 5LSMA 3NQ7A 1AQ0A 3TNOA 4GVIA 1GVSA 1KBBA 4JNYA 3SB0A 5FI8A 4S3EA 2NQHA 2W0UA 2NLIA 1MZHA 2NZLA 3PZOA 1E0VA 3CUJA 3EKZA 1OK6A 3H7UA 3OHMB 4DBDA 4QS6A 1G69A 2DQWA 4Y7EA 5DMMA 4Q8OA 4V2XA 3E1F1 2XGBA 4MY8A 4LRTA 4WDUA 4QRNA 1M65A 2YW4A 4ZODA 4YYFA 4YIWA 3BAIA 4LF1A 1GPFA 3WDQA 5E9XA 3WJYA 4E8DA 2HMCA 3W26A 1D9EA 1JEZA 4L6OA 3QV8A 2D2OA 3N4AA 3GH7A 2PD5A 2BVTA 2A3BA 3SW6A 3FKKA 5HJLA 2VWSA 3W25A 3GFYA 4QG8A 3ZYZA 4UFIA 4YCOA 1ZAIA 4F9DA 1B3VA 1IQ8A 3C5QA 1PYFA 1TPB1 3C2FA 2NQLA 4DBWA 3AIBA 3KVKA 4GNVA 3GNRA 4PUNA 1YNQA 2OQHA 5FJIA 3LQLA 2V30A 2FPVA 3U2CA 1KGUA 1N8IA 2PWFA 1LYXA 1ISZA 3RR4A 4PTDA 3LRLA 3H54A 3VDBA 5BRQA 3R43A 4MKNA 5D2WA 3TJ4A 4A6GA 5EFFA 1WUFA 3M07A 4H41A 4N7QA 4FB7A 1YADA 3NSXA 4UTWA 3SCRA 1YPFA 1AL8A 1QW8A 1V77A 1W3JA 1SU5A 2J8FA 1IR2A 1AMYA 3ITOA 3QH2A 1WO2A 1CXFA 4O4VA 2OZ8A 1GYMA 3EMCA 1QOPA 5A94A 4PH6A 3S1XA 1W1A1 4A22A 4EP8C 1Q8AA 1WXYA 4F9JA 1B4EA 1ZP3A 4RW5A 3K8MA 3MWAA 3SUUA 2BNJA 2X41A 3ARUA 4C5ZA 3R8HA 2B81A 3M7SA 3BICA 2GQAA 4H2CA 2BOGX 3SRFA 3TQKA 4E38A 4IFKB 2PDMA 4LQ1A 4KPLA 1KBKA 1K77A 4H9MA 3IJ9A 3PB0A 3LU2A 2FFCA 3LK6A 1WZLA 4ZGYA 2E8ZA 1BLIA 5REQB 3VU2A 2XVLA 5FF7A 4LYPA 3ITLA 4DX3A 1B57A 1IHIA 3TNBA 3OZOA 1JPKA 1SJCA 4IP7A 3VMNA 4HA1A 4GCAA 3WLJA 3KBSA 1LM1A 2ZQ0A 3UD6A 3ELFA 1NQ6A 3L0GA 4H9UA 4PFMA 4K39A 3PG9A 4A3HA 4O52A 3DZ1A 5G2WA 1BWVA 1BFNA 3ZLHA 3EXSA 1JZ4A 3GKFA 3BSGA 3BLDA 4N4PA 3GR8A 2JALA 2O92A 5IHRA 1K6AA 4Q8PA 5C7VA 1WDSA 2HK1A 3T08A 3CAVA 1RPKA 3C2YA 2GJXB 4FIRA 1JG9A 4RW3A 3A23A 3IVTA 4R7WA 1XFBA 3MHFA 2W6RA 3L4XA 2V2HA 2ZZ6A 1KKRA 1C92A 1TJRA 3OTRA 2F6UA 2E1DA 1F4AA 2Z2BA 3EWCA 4CEXC 3A4JA 3BQ5A 4CD8A 1OD0A 4IT1A 3CQ0A 4GFSA 2J6VA 3S2LA 3SQSA 1UWUA 4I7WA 3SCPA 2Q3RA 2WCSA 3OOQA 4JHZA 3EXTA 4TU1A 2BODX 5C55A 4GNKB 3SY1A 4MADA 1RQBA 3APTA 4H8HA 5AYXA 4GXWA 4DRSA 2HQAA 3PTQA 1HKMA 1PHWA 3BLIA 3GVWA 5C9XA 3PWAA 1PB0A 4A05A 4QQUA 4BQ4A 1GKRA 2BOEX 2GLKA 4K7VA 4ZO9A 2NW0A 2ABAA 5JQ9A 2OEMA 3GS6A 1O66A 4KGJA 2D20A 4Q6JA 1O5QA 2DFAA 1E5NA 2X8RA 3BMVA 2JF7A 1YNYA 1W1IE 3U2EA 3WH9A 3F2BA 4DUXA 1OYAA 4JTDA 4WKFA 3BCFA 2BGQA 2JIEA 5DCDA 1BQGA 2X0YA 3VE7A 3NPVA 4WLCA 3M0VA 3CQIA 1ZJIA 3QTPA 4JFSA 2PBOA 2FZMA 4I5XA 3F4NA 4HGXA 5CKSA 4LC6A 5EBUA 3IS4A 4GIEA 4TXEA 3KL5A 2VZVA 1BYAA 1R2RA 6REQA 3TU9A 1P7TA 3CT7A 3LCXA 4I3GA 5CLWA 5GNXA 4FOUA 1P48A 2XFFA 1OINA 2FVMA 3EWYA 3STEA 4Q8NA 2ZUVA 2QCCA 4Y9OA 4NF7A 2NQ5A 4B15A 1NP2A 1PUDA 1KW1A 4KERA 3O05A 2ZXBA 1NWUA 2WMIA 3IGXA 3MDWA 4XZIA 1VFHA 2CYGA 3P8JA 3ITXA 1SO3A 4UTWC 1XGEA 4H9XA 2VD8A 4O13A 1TJ0A 1XDMA 1RQHA 5IFTA 2PAJA 1PX4A 1UQZA 2YDRA 4JTRA 5C9UA 1JUKA 2IQTA 4FNRA 1UWAA 4HMDA 3LLXA 1XKYA 5CXPA 1GTEA 3TSMA 3N2XA 1DQUA 1JJKA 1H1NA 5LIXX 1FHDA 3U57A 2JGQA 2VZOA 4D2JA 3DFSA 3AIRA 4UFLA 1RJPA 4L5ZA 4TMCA 5I09A 1KWGA 2V2DA 4FK9A 3EPMA 4AISA 1US2A 3ABSA 1GPWA 2FZDA 4D8LA 3GW0A 3KS5A 1D8CA 5A8NA 1KRBC 5AECA 3LGEA 5JBFA 1CLKA 1B0IA 4JFUA 3CHFA 3NQCA 1MDRA 2O9PA 1TV5A 2DSKA 2ZA2A 3G0XA 3N17A 5AVNA 4F2TA 1IEXA 4IFRA 1IWPA 1V6TA 3QBUA 4WDTA 3T2PA 4UQCA 3W83A 1AJ2A 4FNPA 5AKQA 4HNTA 1F7BA 4JZ5A 4LFYA 4XUGA 3TN4A 3RUBL 1CT5A 1Y5VA 4LW7A 3EWZA 4FI4A 1UG6A 1PZ3A 4IMGA 4CNTA 3QKZA 3WLHA 2IXVA 5E6YA 1WUEA 2F8QA 2WQPA 5A6BA 4MB1A 4UCGA 3STGA 3U9IA 3A4WA 2VEMA 1E56A 5CJMA 3L2IA 3GTXA 4YHGA 3N3MA 1V6YA 3NJ3A 3GWQA 3HFYA 1WBHA 2C0AA 3N13A 3DFNA 2PDQA 4B3KA 4CNSA 1FDJA 2CNCA 2OWCA 3THAA 3C2OA 3GHUA 2B7OA 3BG5A 1KBIA 3BGGA 2E0PA 3ITTA 1H0IA 3ZR4A 3I6RA 4MWAA 3WEMA 4HSOA 1WKYA 2YFNA 1GQNA 4W8BA 3DAQA 3W2LA 1UD2A 4C65A 3W7IA 1VCGA 2VZTA 3O1NA 2PDBA 5E0FA 1LRNA 1S46A 4D6IA 1W9BM 1XYMA 3NURA 2V3GA 3INPA 4CQDA 2QJHA 5DRCA 3MYPA 3KBJA 1A49A 3PBUA 4IICA 3W7CA 3TUUA 4C6IA 4LTSA 4AG0A 4AIOA 2PTXA 2XJ7A 4UFKA 4JTJA 1O5RA 1S2AA 4HZ8A 3H24A 4WUIA 2UZ9A 1J6OA 3ZO9A 4AZCA 4DM2A 4M3PA 1VFFA 3N9RA 3MI2A 2WJDA 3GG7A 4DXKA 1JZ7A 2F61A 2VC5A 1LTDA 5ABTA 1LBMA 2WXDM 2J8GA 4OJYA 1ZRQA 3UP8A 4DJFA 4IXHA 4EWJA 3BAYA 4AC1X 4YJ5A 2QF8A 1UR2A 1DKWA 2DUZA 4K6AA 4RXFA 2PTWA 4S3CA 3A12A 4NU7A 3DFPA 3L4TA 4UNIA 2CZFA 3NVDA 3A3HA 3CXOA 3HV8A 4JTKA 4RKAA 4HZ7A 1SO4A 1F3XA 4HPHA 3K46A 3SO7A 4WR3A 2E9MA 2C1HA 3GKAA 3AC0A 4QE4A 1CNVA 3IIZA 4FLSA 3VZXA 3D46A 2PU0A 4V1XA 2RDTA 4HK7A 1JYWA 4FHAA 2ZRZA 5LGZA 3TFCA 1C90A 3IUDA 2J8TA 1KB3A 3LTPA 5HNRA 3AXMA 3SSZA 1MW1A 3NPXA 3LNMA 2JGYA 3GDTA 1TTPA 3ANYA 2V5DA 1VHCA 2D0FA 3R58A 3WSUA 3LY0A 1UR8A 3UG4A 3C6CA 4QLKA 4PZVA 1XXXA 4O4WA 1GJUA 3N25A 2B7QA 3UT0A 1XP3A 1MFVA 1OCJA 3QC0A 3CASA 1HG3A 5F4WA 3UEQA 4HU4A 1OZMA 2CESA 4QSFA 1Z3NA 1UZ4A 4J3VA 4UQAA 1EHAA 1KFBA 2GJNA 2Z26A 1M7PA 1AZ1A 4HYRA 5CSUA 4WEVX 2GYIA 2XVPA 3T0BA 5G2IA 1YIXA 5DF0A 4DBSA 4P8XA 1QOQA 3PBVA 3FIGA 3KTSA 3S4TA 4XV0A 3OG2A 1U5VA 2J78A 4ACYA 3EB4A 3H70A 2UY3A 2VFHA 5CPTA 4NJGA 1ENUA 1FX6A 1XLKA 4DNMA 3NQDA 1T5AA 5REQA 3UR5A 5I2UA 2WHLA 3PFMA 1ISWA 4IP5A 4HU8A 6XIAA 2QCMA 1JZ2A 3DHDA 1UKTA 3POCA 4O8RA 3PJXA 3T0DA 4LS1A 3F1QA 1JULA 1V03A 1XUZA 4AQLA 2EPLX 1XSJA 4L4PA 3GW3A 4DZ5A 1VLIA 3QOKA 1EX5A 1EJVC 4O1DA 4V27A 2VFIA 1FWDC 5HPOA 1EC7A 1TA3B 3K30A 1RP9A 1DVJA 3MANA 2BXYA 4O10A 2VJXA 4CKQA 3GTFA 3W29A 4QISA 4KQNA 2XU2A 4GO9A 3W1NA 4B5TA 4AYSA 3B05A 2SFPA 3GB6A 2VOMA 3NO1A 4K8HA 1GVRA 4BI7A 1RCQA 2RAGA 2NV1A 2J9XA 3GDRA 3PZUA 1PKMA 4H19A 1LOLA 4O16A 4G8TA 5ABHA 3HTWA 1VENA 1OADA 1VRDA 5HANA 2GGHA 3R89A 2O56A 1MNZA 1P0NA 1DJXA 1EP1A 1E4IA 4XAFA 2PP1A 3O3RA 3BL3A 1TV8A 4GUGA 3TW6A 1EA0A 1GW1A 2C1IA 2Y6ZA 1HKVA 3WLOA 5CJ5A 3OQEA 4TX8A 4NASA 4CNPA 3TCEA 4JEJA 4KF1A 1QNOA 3QVQA 3ZIZA 3HMJG 2AAAA 1EWEA 3A5VA 5FKYA 5I3KA 4PMDA 1RJRA 4DUOA 1TZ7A 1GOXA 3QKEA 4S3JA 3T9PA 3V4BA 4UFJA 4RE3A 3CIXA 5AYYA 3KZPA 1LL6A 1XSKA 2PZ0A 1E6NA 2ZC1A 2P53A 4GFIA 4EPEC 1RA0A 1ODZA 3PUDA 4IUGA 1GKQA 2Y8VA 3IJ7A 4S2CA 3WL0A 4PMXA 4AB4A 2DGAA 5JBDA 2WMHA 4PFHA 4QXIA 4NT0A 3L4UA 4CNOA 2HBVA 3CM4A 3TTOA 3UCQA 2FTWA 3WQGA 3QGAC 2I9EA 5AHIA 3UG5A 1VCVA 4FOKA 4OBSA 1A53A 5FJRA 3D5HA 5GJNA 3SECA 3SUSA 1NDYA 3GNNA 2PEVA 3HURA 3VABA 4S38A 4N6EA 2FH6A 4H04A 5A6BD 5AOUA 3RLGA 3V18A 4NL1A 4ML4A 3VFLA 5KZDA 2OSWA 4HMCA 4DWSD 1JQVA 3I3DA 5HINA 4G7EA 1XCFA 4JQ4A 3SCQA 4JDBA 3GX9A 3DDMA 3PWIA 1JDCA 3PZ9A 1BKSA 4YS1A 3L23A 3WH8A 2FDSA 3W01A 4OE7A 4GKLA 3BMWA 1XISA 2YBUA 2GFTA 4WOZA 4UMAA 2G0WA 3UXKA 1G0CA 4PB3A 4PBEA 3TONA 1YPIA 1GQKA 3VKDA 3SDOA 2FDMA 3RF9A 4AWUA 1BEUA 3MV11 5B80A 1ZBKA 4ZBCA 3QMRA 2J24A 1VCFA 1W8GA 1YDNA 1P6BA 4Y8EA 4AZ6A 2Y88A 4Y9AA 3VA8A 1VRXA 2QR6A 2DEPA 3H2EA 1E3ZA 4L64A 4XAPA 1SW7A 1F3WA 2VGGA 5GNZA 5E5CA 2VC9A 2O7QA 1HF6A 3NVTA 3SJNA 1QI3A 4C6EA 4XWUA 3W7KA 3MQTA 5A6MA 1MXSA 4BEUA 5K2ZA 4IH3A 1I4NA 4PBGA 2ZTKA 1ZCCA 3GVGA 1G5AA 1H62A 3T4WA 3TW7A 3TN5A 3N1AA 3KVJA 1ONXA 3S1VA 4IIDA 3HQPA 3V0UA 1FCBA 4W85A 4E4PA 3IGUA 5F2MA 3VOCA 2H9AA 3DGBA 1HTIA 4O12A 3UZYA 3CWOX 4DYJA 1GVEA 4UCFA 1AG1O 2B31A 2E77A 3DG3A 2CIPA 4M1BA 3V1HA 2F9RA 4EKJA 1OCNA 1JFXA 1BTCA 5I07A 2YIHA 2V3FA 1DQWA 1XBVA 1JI1A 1NM9A 1DJQA 3NL6A 1K8ZA 2WHMA 2UY5A 4YVXA 1F5ZA 3T44A 3OIXA 3TK7A 4GI9A 4B90A 3BV7A 4NNAA 3PJTA 3SRDA 3I6TA 3GHSA 2WMGA 5F7UA 4ZOAA 3WY1A 5HA7A 1OFBA 3PS7A 4DAFA 4UTKA 2YPIA 1H63A 3WF3A 5DMYA 1MRQA 3M7WA 1I45A 4AEEA 4LF2A 5FL1A 1KV8A 4GYPA 4W8AA 1DTUA 1W9XA 2Z2UA 4M6UA 3W7RA 4PE8A 4MYXA 3GIPA 3SJ3A 1IEWA 4S23A 3W1TA 4PMYA 1VKFA 1JF5A 1E40A 1KLZA 1LRTA 1XIDA 3GXNA 1DP0A 2XIOA 1ECQA 4N2YA 4RE0A 5LGXA 4DXVA 1XYZA 3T2OA 4PEEA 4G6CA 1PX3A 4IMAA 4IIEA 3WENA 4Y9NA 4I6VA 5I0DA 3VDGA 4MY1A 3WMSA 5T8GA 5A6AA 3ABQA 4LV9A 4D1IA 3BOFA 3GXDA 1KNWA 2Y62A 4GIAA 1UR0A 4W9TA 2DJXA 3FJ4A 2VDHA 4ADSA 2VENA 4IX2A 5ECUA 2V0TA 5AN7A 4LBUA 4GISA 1M68A 3EEZA 3W7LA 1UD3A 2FHCA 1D7FA 1UWQA 2VL4A 4DJED 4W86A 1W8SA 1TWSA 4QJ3B 1NWSA 3EWBX 5A2BA 1Q13A 1XYCA 4LB3A 2ZZ7A 5LYRA 4M7SA 4FSAA 4D71A 4DF2A 3NXFA 4I5RA 3B9OA 4KEMA 4HPXA 3O15A 1VLWA 2BX7A 4N9EA 1PZ0A 4OV9A 1XHGA 2Y5JA 1XLMA 3SGUA 2VFFA 4K38A 5B7ZA 3OVPA 4NKCA 1P7TB 2TRSA 2YXOA 3PSWA 1MYRA 4MMWA 3EA3A 3VUPA 3T81A 4KFPA 2QVHA 2QLYA 3WH7A 1I2RA 4YMZA 3TC6A 2VNCA 3AMDA 4IGMA 4YWSA 4C6KA 3EEGA 1UASA 2V67A 4EXAA 3MCOA 4KIEA 5HQMA 4GZ7A 4C7FA 2G3NA 3MBFA 5EB8A 4LUJA 3A47A 1LWIA 4KRUA 2Y63A 2Z1BA 1EO7A 1MEWA 4XIAA 4R53A 3VDCA 1HN1A 2G97A 3THUA 3VYLA 4UTJA 1VS1A 4N42A 4M6PA 3C0QA 3UWUA 4WDWA 2Q01A 1BKHA 4BWLC 5XIMA 3GC5A 4AD3A 1BF2A 2PLJA 3G5EA 4XTDA 2QKFA 4DY1A 1QI4A 2GVJA 4TR9A 4D8AA 4IIBA 2DZBA 1H7OA 5DT7A 1XD0A 3ARTA 1US3A 3BAWA 4YWIA 5AVHA 3RIKA 3CL6A 4RZBA 1M04A 1V0LA 5H8UA 1QNQA 3M64A 2CLPA 3GU9A 1ZPTA 4MJ2A 1UD6A 4GBDA 5IRPA 4O54A 2XH4A 3WN6A 4FALA 3GNOA 1GCYA 7TAAA 1ITCA 1MSSA 3TAOA 1I1WA 3MWCA 4ZE4A 1A0DA 1TYGA 1C8YA 3FYPA 2VRJA 2C79A 1Z7AA 3M0YA 3ALFA 3TMLA 5M1TA 5I6SA 3C2VA 1JAKA 1VZWA 2Z0IA 4PCNA 1XC4A 2MUCA 2OZTA 2FB2A 3ZWTA 1HX0A 2EJAA 1E6ZA 1S1RA 2GOUA 1MXGA 3EOLA 3V3WA 1NFBA 4MY9A 1AH4A 4DBUA 4H1ZA 2BHYA 1B4KA 3GE7A 2J4GA 4GABA 1WDPA 4HB7A 1ZU8A 1R9YA 3KLKA 1SPQA 4W7UA 2CLFA 1X39A 3VC5A 1KXTA 4GC3A 1WAUA 3E5BA 3EYPA 5BXPA 4NRRA 3CC1A 4P7OA 4ZQNA 1RR2A 4IIGA 4JYEA 3TQPA 4OQVA 5AZ0A 7REQB 2PWHA 1PTGA 1K4GA 4BEQA 4F0HA 4H7CA 3OGVA 2ZA1A 4QNEA 5LA1A 3M0LA 4DO7A 1KCZA 2QDHA 4N9DA 2HS8A 2GOKA 4LGXA 1ZBWA 1M1BA 3G8RA 1SUXA 3PNZA 4R27A 3TR9A 5FF0A 4AMCA 7XIMA 1RSCA 1FWHC 1FWRA 5FJJA 1TIMA 1BXCA 3KOZA 1UOKA 1UYQA 1IGSA 5HR7A 4DWSC 1QU4A 3CTTA 3BAXA 3WQCA 4NJIA 3FAWA 3COTA 3NZRA 2Q8XA 4GZIA 4DWDA 4QJ4B 1WE5A 3U2ZA 1H7PA 1S5NA 1JRCA 5AC6A 3W02A 3G1XA 3NM3A 2HV5A 4U33A 4E5TA 1F8IA 2WYSA 1JFHA 3SCUA 3GXIA 1KKOA 2ACUA 4LALA 4PGLA 1F74A 2ISVA 4JEQA 2XFWA 4G1KA 1B9ZA 5DMLA 1T8XA 1OFAA 3W84A 1S3TC 1JCMP 1OX6A 5DCEA 4AIEA 4DPPA 3LSCA 1P0BA 4Z1CA 3WDJA 2XDFA 4J28A 3AMGA 1W1PA 4K8EA 4F3HA 4L1WA 2W5FA 1CTNA 1V3KA 4HP5A 4BF7A 3L5MA 2V5JA 2EGZA 2VDIA 1KM6A 3TE9A 4QIUA 4LCRA 5K9XA 1KGWA 3LHZA 1XV8A 3L4VA 3H26A 5FJTA 2QUUA 2XISA 1GW9A 4KESA 5AC8A 3MMTA 2IPJA 1JCYA 3BW4A 5EKYA 3OBEA 3SM0A 2UBPC 1EJXC 1Z32X 5LXEA 2NUYA 3T8LA 1S5TA 1AQHA 4D1JA 3DYMA 4WK9A 3TCSA 2VEIA 4Q4SA 1B31A 3W1PA 4YTTA 3B4YA 2WWDA 4HA0A 4N9BA 4RCXA 3GBEA 3DFQA 3DC8A 3PZGA 2RGLA 3CK5A 5I3GA 3HGJA 1TG7A 5FSDC 3AIVA 4OV4A 1TRIA 1IZJA 2ZKMX 2BMBA 1UW9A 4ERAA 3UWZA 2F6KA 5A8QA 1UHVA 1XIBA 2PGRA 3MP3A 1FP8A 4RLIA 1IYXA 3PHAA 3BG3A 3KFTA 3G1DA 1DQXA 1K7FA 3QGKC 2PDUA 2R1LA 5AC5A 3H6OA 3UFYA 4NJJA 3LMZA 3KOFA 4YYCA 3ARYA 3ZT7A 4LEFA 3VTRA 1RA5A 3JVAA 5BU6A 1S2UA 4XZ9A 4PUKA 2OR2A 3GDLA 3LLDA 3NWRA 1GOMA 3G22A 1Z9AA 3LLFA 1P1XA 2VGIA 4LAUA 2GL5A 4DJDA 2VZSA 1W2PA 2EEXA 1V51A 4J3TA 3CS2A 4AZGA 3PBYA 1TWDA 3XINA 1DIKA 3OA5A 1GQIA 3M4HA 3JZEA 3WEOA 2P8BA 2ZRYA 3AO0A 2A85A 5EMYA 1C93A 1WZAA 4MVAA 3T7VA 1FWIC 3EOSA 1ZHAA 2ZUWA 1BG9A 1OC5A 1T8QA 5HMSA 3BSHA 1LORA 2YXGA 5G4EA 3S47A 4A8NA 2OG9A 4HMEA 4OFCA 3TQ0A 2P10A 3AXKA 1A4LA 2PD9A 4UR7A 2HZGA 1G9HA 1R8LA 4JNZA 3A21A 3H2MA 1LT7A 2X05A 2VFGA 4I8DA 2BP1A 3PM6A 2C1GA 3MC5A 2Z1KA 5A3HA 2C7FA 1VPYA 5GNYA 4I9MA 3F4VA 3P5ZA 2G41A 2VX4A 4PTXA 5IHSA 1P43A 3RJXA 3K2GA 1KRAC 5LKYA 1ZJAA 3QHNA 2BB0A 4O15A 2CERA 4GBUA 3W0KA 2VYOA 2BBFA 3W24A 3UZJA 1AQMA 4YN5A 8CGTA 1E71M 3SURA 5I79A 3RPMA 3BMXA 2PS2A 2QCLA 4ATLA 1AFSA 4ZTYA 3FA5A 1HW6A 2V2CA 4YNGA 3RPTA 3GVQA 4U3AA 2GJRA 4RNIA 1XR2A 3B3DA 3TOYA 2HROA 4HCDA 1RXOB 3CB3A 3S5NA 3V1PA 2BV9A 4KW2A 1XUUA 3LI0A 3NTYA 5FCZA 2XINA 3WQ6A 4A2SA 2GUYA 3KBWA 3LHTA 1UBSA 1DEDA 2Y8UA 3ME3A 5A1AA 2FKPA 1Q7MA 2J62A 1H5VA 2VR4A 3KWSA 3N9KA 2C19A 3W1MA 1R87A 3ZT6A 1TMQA 3W87A 3UYIA 5LA0A 2V3DA 3ES7A 1E9ZB 3O2LA 3M6DA 1TR1A 2ZX6A 3C8NA 4PR4A 1K9EA 4TX6A 1V7AA 1EUAA 3W1QA 1XLIA 1EX1A 2XIMA 3UPMA 4XBJA 4JXCA 5FAJA 1K03A 3GU1A 5FJPA 5HJXA 1QXLA 1I6NA 2W3ZA 3DUGA 2OJPA 1RQEA 5CG7A 3W00A 1D3CA 3M47A 2P1FA 2YW3A 4GQGA 2AQWA 1WP6A 4ONVA 1MW2A 3G2GA 3B0YA 3C52A 2GQ8A 1PZ2A 4NILA 4AAJA 3RITA 5F4SA 3BAJA 1FWFC 1YTDA 2ZX5A 1XDJA 4AYGA 2OGJA 4MFEA 1HXJA 1TJPA 1CB2A 8XIMA 4W5ZA 5HJYA 4D8ZA 3W2NA 3U4FA 1W2VA 3ZVHB 2HXTA 1YLVA 2PDJA 4Q4RA 1X38A 3GUWA 4D6EA 1DWFM 1XH0A 3IAQA 1OIMA 3R6IA 4D72A 5KZMA 2X2GA 4RPPA 4B5XA 3RR1A 2I16A 4PCSA 3W6LA 3CEPA 1M03A 3HPXA 4JIRA 1K8CA 4JQ2A 1IT7A 1LRQA 1LZOA 4AXNA 5CAHA 5E0KA 3W2JA 4PMNA 4V33A 3T0TA 4HIBA 2IKGA 3Q58A 5L9FA 4JIPA 4HNCA 4GE8A 1OFOA 3NQMA 4AZBA 1RVGA 4J4KA 3E02A 5EMMA 3OVGA 3A9BA 4Q7IA 2YJQA 4JAWA 2QPXA 4BJHA 3K8KA 3O6AA 1XIIA 4HU0A 5CGTA 1D8WA 1PZ1A 2G4JA 5LNWA 2NVAA 1JZ3A 1ZGDA 1JYXA 4ZA0A 2A1YA 3ORWA 2HS6A 4FX8A 3VIIA 1LL4A 1W9PA 5H2ZA 1OFRA 4TUFA 1M3UA 3EWUA 4J7RA 2VX5A 5DY3A 2UV8G 3P80A 4XKYB 3E0IA 4Q8UA 1KM1A 4F8XA 4L4OA 4EANA 4JQAA 2E9BA 3P93A 5CGMA 4OOUA 5I03A 2VR5A 3P74A 2H9AB 2EBNA 4TV6A 1OEPA 3WH5A 4FAMA 2ZRXA 3I3BA 2XPKA 4BY3A 4OOZA 1GORA 3CO8A 2NX9A