4HK7A

Crystal structure of cordyceps militaris idcase in complex with uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
379
structure length
379
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLKAELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
total genus 136
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk7A00
1KRAC 4LEFA 1YRRA 4YIWA 1FWGC 4H9ZA 2GSEA 1ONXA 4LAKA 4C6FA 2A3LA 3QY6A 4L9XA 1KRCC 4C6NA 1GKQA 3WYZA 4EPBC 2VM8A 2Q01A 2OGJA 3TN4A 2YB4A 4LALA 1ITUA 3IARA 3LU2A 1W1IE 2GWGA 2HPIA 1A4LA 2PGFA 4INFA 2XIOA 1RAKA 4WVXA 1V4YA 2WJFA 2KAUC 3QY8A 4IF2A 1J79A 5A6TC 2EG6A 1A4MA 4XD5A 4C65A 3OQEA 4CQCA 1A5LC 4DI9A 4IFKA 3K2GA 4Z42C 3IJ6A 1M7JA 4C6KA 1KRMA 5AKQA 2G3FA 1J6OA 3QGAC 2D2JA 4GX9A 1XWYA 3D6NA 2FTWA 4G2DA 1R9YA 2GZXA 1XRTA 3NQBA 3RCMA 1NDYA 2CZVA 1R9XA 4C6JA 1FWHC 4H00A 3MKVA 3UR2A 3CAKA 4DO7A 4H9TA 1O12A 3NURA 1JGMA 2R1KA 3T81A 2QPXA 4HA0A 1DPMA 2O4MA 4DZHA 2Z25A 2ADAA 3GG7A 3IGHX 4WGXA 1V7AA 2ICSA 3SFWA 4DYKA 1V79A 3OVGA 2HNHA 1E9YB 4C60A 1WXZA 2QS8A 4QSFA 3B0XA 4EP8C 2VC5A 4HK7A 2OOFA 4CQDA 3GIQA 1RJQA 2Z7GA 3CJPA 1EJVC 2P50A 4BY3A 2FTYA 2FFIA 3WZ0E 3E74A 2Z28A 2UBPC 3LY0A 4KEUA 2HBVA 2YXOA 1YNYA 4OFCA 4XD3A 3OOQA 1V77A 1KCXA 3FDKA 4IGMA 4QRNA 5HMFA 2PGRA 4JOMA 4LAMA 1EJUC 3DUGA 1WXYA 4AQLA 3O0FA 3ID7A 1EZ2A 3HTWA 1GKPA 1ONWA 4H01A 4PCPA 1UMLA 1EJSC 4XD4A 3ICJA 4LANA 1FWIC 3TNBA 4H9YA 2R1NA 3AU6A 1UIPA 4J2MA 4ZSUA 2OQLA 4NP7A 4GOAA 4HK5A 3SO7A 3URQA 2YZ5A 4DI8A 2GOKA 3AU2A 2GWNA 4KETA 3K5XA 2VHLA 3GTHA 1BF6A 2I9UA 2QVNA 4J5NA 2R1MA 2Z2BA 3S2JA 4CNUA 3PNUA 3OU8A 4EPKA 4KESA 3MSRA 4KQNA 4R7WA 2AQVA 3GU1A 1RJRA 2QT3A 4B91A 4ERAA 2F6KA 4GY7A 4V1YA 2ANUA 2OODA 4C6PA 2BB0A 3F2BA 4NG3A 4LCRA 2HQAA 3IV8A 1FWBC 2DVUA 3LSCA 3PANA 3IPWA 3MVTA 4G7EB 4DIAA 4XD6A 1YBQA 3TN3A 3A4JA 1ITQA 3UR5A 4XAFA 1PB0A 1PO9A 4F0RA 2WJDA 4QROA 4LFYA 1YMYA 3B0YA 1K70A 3RN6A 2VC7A 3S2NA 3LS9A 1PTAA 2EG8A 2UZ9A 3EWDA 2AMXA 1FWDC 4C5YA 2Z26A 4C6QA 4GY0A 4HK6A 4ERIA 4IQJA 4IG2A 4EPDC 4CEXC 5LXXA 2WM1A 3C86A 1RK5A 3AUOA 2WJEA 3WMLA 3MVIA 3MJMA 5CH9A 2E25A 3QY7A 4I6KA 4GY1A 4PBFA 5FSDC 3URNA 3CS2A 4QS5A 1A5NC 1FKXA 1FKWA 4C6IA 2Z4GA 4RDYA 1J5SA 4IGNA 1EJWC 2VUNA 4GK8A 4M51A 1RK6A 4GX8A 3MDUA 4TQTA 4DLFA 4C6CA 3K4WA 3EWCA 2HBXA 4H9XA 1QW7A 4BJHA 4V1XA 3LA4A 1YIXA 2Z2AA 4H9VA 4H9MA 4DNMA 1A5OC 5G4HC 4KEZA 4I6VA 4IFKB 4R88A 4GYFA 4AC7C 4C6MA 4G7EA 5E5CA 3RYSA 3T8LA 2Y1HA 2D2HA 3BE7A 3E3HA 4RZBA 3S4TA 1FWCC 3O7UA 3MTWA 4GC3A 3LSBA 4C6OA 3PBMA 3GU2A 3S2MA 3FEQA 4CEUC 4B90A 3GTFA 1ADDA 3E2VA 3S2LA 3E0LA 4KIRA 4PE8A 2EG7A 2HPMA 3MPGA 1YBQB 4GZ7A 2Z29A 1EF2A 4BKNA 1RA0A 1E9ZB 1HZYA 2ZC1A 4P5UA 1A5MC 3KM8A 4XAYA 2IMRA 3T1GA 3GUWA 1M65A 4ERGA 4C5ZA 3F4CA 1NDZA 1I0BA 4XAZA 1P1MA 2I5GA 4QTGA 3LGGA 4UBPC 2DVXA 4C6LA 4ICMA 2PUZA 1FWFC 3B40A 3OJGA 3F2DA 4KF1A 2YB1A 4D8LA 4LH8A 4QS6A 2Z00A 3GIPA 1K1DA 1NDVA 4KEVA 1FWEC 3E38A 4HJWA 4B92A 4C6DA 3LNPA 4CNTA 1O5RA 3ORWA 3F4DA 4XAGA 1XGEA 4RE0A 1ZZMA 1UBPC 3PAOA 3UBPC 1FWJC 1RA5A 3DC8A 1POJA 1M68A 3GTXA 3IACA 3GU9A 1RJPA 4H9UA 1A5KC 3HPAA 4F0SA 1EYWA 3PNZA 4DLMA 3F2CA 3HM7A 2P53A 2DVTA 5HMDA 2RAGA 1NFGA 1P6CA 1XRFA 2VR2A 4C6BA 4CNSA 4DZIA 2E1WA 4KERA 1K6WA 1VFLA 1POKA 3V7PA 3URBA 4RDWA 2Z27A 3E0FA 3R0DA 1UIOA 4B3ZA 2Q09A 3UF9A 1FWAC 3QGKC 3URAA 4CQBA 4IH3A 4LCQA 3A3WA 2O4QA 2PAJA 1R9ZA 4WHBA 3UPMA 1V51A 3DCPA 3JZEA 4NI8A 4PCNA 3A3XA 4ZSTA 4PBEA 4IFOA 4RDVA 2FVMA 2R1LA 3NEHA 2PLMA 4J35A 2FVKA 1KRBC 3MDWA 4IFRA 4UB9A 2AQOA 2R1PA 3N2CA 2OB3A 4L6DA 1EJTC 4MUPA 5HMEA 2Z24A 5FSEC 4GXWA 1NDWA 3GTIA 4LAOA 3TN5A 4E3TA 4RDZA 1EJXC 4LCSA 3ISIX 2D2GA 1S3TC 3ITCA 3GRIA 1J6PA 1GKRA 2W9MA 3RHGA 4EPEC 3G77A 4C6EA 3EGJA 1P6BA 3LGDA 4GBDA 4R85A 3OODA 3TN6A 4IG2B 1EJRC 1PSCA 3FDGA 2BGNE 1QXLA 3IRSA 1IE7C 4F0LA 1I0DA
chains in the Genus database with same CATH superfamily
4JGDA 1XDJA 1DWAM 4NXKA 4Q6XA 3SY1A 3QW3A 2A6LA 4GRSA 1V93A 2VEFA 2I14A 3PUDA 5LSMA 5SWUA 3E12A 2OGJA 4UTTA 1S1RA 3LRKA 2XGIA 3P5ZA 5EU9A 2QW5A 1L6FA 4HU3A 3SCOA 5D38A 1VPYA 3B03A 4O1AA 4KMQA 1XXXA 6ENLA 4JICA 4GPNA 3HG2A 1V4YA 3B4UA 3TTSA 1QK2A 1ZENA 2ZRZA 3WQ5A 2Q71A 1A5UA 1S46A 2GDUA 3BCJA 4DAFA 2RGLA 3W6MA 1F6KA 2FTWA 2EPLX 1TJRA 2YPIA 3A4XA 3EOUA 4BWLC 1B3VA 2V38A 3VI2A 1GW1A 2WHLA 4AY7A 3THDA 4YJ5A 3M0HA 1UZ4A 2R1KA 4FMVA 2YL8A 3KOFA 5KETA 1V0NA 2GUYA 3IGHX 2R9RA 5CC5A 3CMGA 2A79A 4CD8A 4ICCX 4WY0B 1KWGA 2HVMA 5B80A 9XIMA 4HK7A 1C7TA 3CAVA 3ANYA 1XPGA 2QJGA 1SZNA 4NZ1A 3VKAA 3AXMA 3ECQA 3BXWA 4FXRA 4QISA 4YYCA 1ZTVA 4AWTA 4MWAD 4Q8NA 3WF3A 4JIQA 1PAMA 3XIMA 1PJ9A 4JBRA 1P0KA 3ABQA 3G1SA 3H2CA 1F2JA 4Y9PA 3KBMA 2BVDA 3CZGA 3HTWA 3PZVA 4FIRA 4LUJA 1FBAA 4UTWC 2OKOA 1ALDA 5CSSA 3SCUA 1HP5A 4MFDA 4NP7A 1JDFA 1EC8A 3SO7A 4GYPC 4UR8A 4AIUA 1VEOA 2WO5A 2QVNA 4PTMA 3W75A 1US0A 4P8VA 3VM5A 4KESA 4JTJA 1Q7ZA 4F79A 4RE2A 4IXHA 4GC4A 3KOZA 5ENLA 4LCRA 2OCZA 3AS3A 2QULA 3I10A 1T96A 1KD0A 5DMLA 4HZ8A 2X16A 3CQ0A 1PB0A 1DJQA 1J10A 3C2YA 6ALDA 2XWDA 5IBXC 4LS2A 2UZ9A 1DJWA 2UV8G 1CECA 2P10A 1GVIA 1OCQA 1QW9A 3NQEA 1FH7A 2PDQA 2OSYA 3L4TA 3RXZA 2DH2A 3QZAA 2E5BA 1P4CA 2FZ9A 2X1UA 4ZOAA 3LI1A 2AQWA 2GQ8A 1DIKA 4W7VA 3KBJA 1XYAA 3CZLA 1NWSA 1XGDA 2CBJA 4GK8A 2AGKA 4UQEA 4C6CA 1XIEA 4ILSA 2VOTA 4F2BA 4RNJA 3QPEA 2PDHA 3S5OA 1EGMA 3MQTA 2QAFA 3EOLA 2BP1A 2WZIA 4R88A 1JQXA 4XVEA 5LNWA 4C6MA 1QNOA 2Y1HA 1SZGA 3E3HA 3D46A 4HVXA 1Q8JA 5C71A 4UMBA 1F3XA 2ASHA 3T42A 3KLLA 2BY3A 3F4WA 1IEIA 3CMJA 3VE7A 4UTUA 2BNJA 1JI1A 2OQHA 1XCWA 1OG0A 3L68A 5LA0A 1KC7A 1FWTA 2XVNA 5LKYA 1M41A 6PTDA 1XCXA 1UKPA 3T1GA 1A0DA 4RZ4A 5A69A 3IVUA 4ERGA 3KOWA 1U1HA 4DJEC 2VX6A 2PWEA 3KWXA 2OGYA 4UBPC 3CLWA 3A4AA 3LBMA 4TVUA 1MNSA 4PFHA 1GPWA 2YW4A 1AQMA 3F1QA 4J27A 3OJGA 5EBUA 2DZWA 1AJ0A 1EDTA 3N2MA 4JTEA 3PJXA 1L2QA 4NZ5A 4KEVA 5DN1A 1KXHA 4EAYA 3UXAA 3M43A 3ABZA 3K1DA 2IPJA 3PAOA 2JGYA 3P93A 3UVIA 3PBYA 3UBPC 1QWGA 3Q67A 4X22A 1P0EA 1UUMA 1DEDA 4L1GA 1M68A 1PVNA 3BLOA 4XBKA 1TPFA 4JQAA 1A5KC 5A6LA 3PNZA 4DJDD 3UWZA 2BBFA 4DJED 5AOUA 2RAGA 1PTDA 2H3BA 1TREA 4KWSA 4Z2KA 2OOGA 3ALFA 1JCTA 5BNKA 1WKEA 2ZRUA 1V03A 3M5VA 5CPMA 2DUZA 5XINA 3V5CA 1VRDA 1FH8A 3LPOA 3VINA 1QOQA 3EX3A 2WC7A 4IMCA 5CJ5A 1EUNA 3WY1A 3E2RA 3QMSA 3KRUA 4NI8A 2ESCA 2C1GA 3I3EA 3TYUA 3WELA 5CSUA 3WH5A 3I4KA 5FESA 2L5HA 1FCQA 2VRJA 4YVVA 4US6A 3IK2A 4UB9A 1YX1A 1S5NA 3W01A 1IEWA 4DHGA 2OB3A 2X8RA 2HRWA 2DSZA 2OWWA 1LTDA 3AFBA 3N12A 3ZZ1A 3BH4A 4YMZA 1F8MA 3GRIA 2CZFA 3RF9A 2A7NA 4JHZA 2ZXAA 1IWAA 2PDKA 5EMYA 1ITXA 4RUBA 2J25A 1KM1A 1W5OA 3E0IA 4K6AA 1S2VA 3WL0A 4GJJA 4H9ZA 2OT1A 5MF5A 4NZJA 4I7UA 3LHYA 1OZMA 4O4WA 5DMNA 3P7YA 1E55A 2NVDA 1HVXA 1ICPA 1TA3A 3W74A 3S6DA 5D04C 1TRDA 2ISWA 2Z1VA 4C1LA 3S46A 2DW6A 4INFA 1UR3M 2V5LA 4BWLA 4G6CA 3KBNA 2EG6A 3CUZA 1FWRA 4CQCA 1W8GA 3F4VA 1W37A 1F07A 6TAAA 3ARZA 1OGGA 3O9NA 5FJPA 1B54A 1Q45A 2A21A 1I75A 1XRTA 3LEPA 4YTUA 4LS0A 3NQBA 3AUJA 3GLCA 3H12A 4Z2JA 3WMCA 3I6TA 2X2GA 3AO0A 3UR2A 1EWEA 4K1GA 2PD5A 1XD0A 1A49A 3ANVA 4NKCA 3TSDA 2G4JA 3TYAA 4N4QA 2ZXDA 1IXQA 3ERPA 4CQ8A 4KKXA 1KM2A 4MLRA 1S1PA 2Y7GA 1DJZA 4C60A 1BVNP 1PKMA 2TMDA 3RPMA 4JTDA 3RO6A 3ES7A 3CJPA 1ODZA 3KEHA 2W61A 3L4XA 4DBDA 2FFIA 3B3DA 1DIOA 1W91A 2VGBA 3LY0A 4PRRA 2Y8UA 3FSTA 5HMFA 2ACRA 3AS1A 2ONEA 1ADOA 1UW9A 1AZ2A 1VBHA 1IT8A 1HNYA 4X2PA 2PODA 1BSIA 3AMKA 1ITCA 2BHYA 2CITA 1F9CA 1EJSC 3NR0A 4TU1A 3T0CA 3LHUA 1XYZA 2R1NA 2QUTA 2V2HA 3VM7A 1JR1A 4HPXA 3CQHA 5A6MA 4GOAA 3DHDA 4HMEA 2XIIA 5JVLA 2GWNA 4S3CA 4LYRA 1BHGA 3AZRA 1W3TA 2EPMX 1E0UA 4K7VA 1EGZA 3EDDA 3TWBA 4CNOA 1CGWA 3ZS4A 4ERAA 2WHMA 5A8OA 1IIHA 4C6PA 4PMUA 1W3NA 4UR9A 4M5PA 4G1KA 1YXCA 1BQCA 2YJQA 3KXQA 3ZJ7A 2Y6ZA 2E6FA 4PMYA 1TO3A 3R10A 1WKYA 2WKGA 3CZJA 4D2JA 3GDMA 4A3RA 2DZUA 4NAEA 4LFYA 4MLJA 5DMYA 2VVNA 1YQ2A 4X0VA 1E0TA 1PTAA 5GNXA 4WOQA 4AZBA 3YPIA 3RILA 4X0NA 1KV5A 2VZOA 1VKFA 1MW2A 1Q63A 5HNTA 5LXXA 1JAEA 2B7NA 1J8VA 1VBGA 4JIEA 4EACA 1TIMA 1QFEA 5CPOA 2ZKMX 5BMXA 1TYGA 3TEVA 1D2KA 4KBXA 4JIRA 4JHOA 4XKMA 5BCAA 4JL1A 1XDLA 4IX2A 2QUVA 4KGJA 9RUBA 2IUZA 1J5SA 2C18A 3V18A 3ITVA 3O05A 2HE8A 2WQPA 3SZ8A 2Y24A 3GFYA 3VZZA 4KEZA 3BLPX 4I6VA 3UW6A 1NSJA 2WSQA 4HU4A 4HYWA 5HNNA 5K3VA 3M5YA 3UWVA 4UQ9A 1KXQA 3L23A 1TFVA 1VFTA 2VFHA 3R58A 1FWCC 4RXFA 3S1WA 2QDGA 3R79A 3S42A 3TC7A 1VEMA 5AZ0A 3DG3A 1TCMA 8TIMA 4D8ZA 4ZMGA 1W5PA 5FJIA 3G24A 1ZP4A 1JXJA 3U4AA 1I60A 3MUXA 2BHZA 4XAYA 4WGHA 1D3CA 4O17A 1XGZA 3UXDA 1XF0A 3THQA 4FNPA 2I5GA 3FY1A 1UWAA 1EJ7L 3F5KA 5HAOA 1JD9A 1A5CA 1FWFC 4O16A 1IHIA 3QOKA 1C9WA 1KBBA 2OSWA 2Y8KA 1QPKA 3A47A 1QBBA 4KWVA 1FWEC 1W3KA 3BV4A 4O11A 3UNDA 4JFUA 3B9EA 3V1PA 4JEJA 5D33A 3H6OA 1RA5A 3ARQA 5CSRA 1FFQA 3Q94A 1W1VA 2NW0A 1H0GA 4P8XA 1JF6A 1ISXA 4JTGA 1ZJHA 1EYWA 1NY1A 4WX2A 2YLAA 3TONA 3E2QA 3HM7A 1PZ0A 2QIIA 5C7HA 5DX7A 1LDCA 5CXPA 4DM1A 4FK9A 2REQB 3QYSA 5FL0A 3UF9A 4HN8A 3M0XA 1YKWA 1EO7A 3LQLA 3DHFA 3N2XA 1PX8A 3JZEA 2YBTA 4RDVA 2P88A 4DJEA 2QV4A 1SVDA 4FNRA 4MWAB 2WVTA 3ATYA 1T8XA 3H7VA 4FF7A 3PSWA 5KZEA 5FF4A 2GVGA 3APYA 1E1CB 3W7NA 3PZIA 1GTEA 4LAOA 5DXYA 3EKZA 1Z3NA 5F1UA 3VGBA 1H61A 3PFRA 1SM9A 4C6EA 1W31A 1FX6A 4GBDA 2PDNA 2WBKA 2VENA 1KO0A 4F8XA 5G1TA 2C8NA 3CASA 3WX7A 1OG6A 3ES8A 3PULA 3LXCA 5A2AA 4DWSA 2RDWA 1ZALA 3IRSA 4QLJA 2XM2A 1I45A 2CZ5A 3MUY1 1O5QA 3VKDA 1JVNA 2CLKA 1TR9A 3GY1A 5A5WA 2IPGA 2V82A 3DENA 2J27A 3FHAA 1UJPA 3W1MA 4WF7A 5KZDA 1R8LA 3TLQA 4KPLA 3RJYA 1H5YA 3HGOA 1WDSA 3WLJA 4JFSA 3TQVA 4AMCA 1V3MA 3B04A 2PI6A 3WQCA 3HIJA 4N02A 1GEQA 5D05A 2ZFAA 3ITGA 1CGXA 3NOEA 4PUDA 1W1ZA 3DFHA 3SRHA 2DT2A 3W2KA 1SUXA 4XZIA 1UR0A 3JUGA 2ZZ6A 3WFAA 4RW3A 2TPSA 4G2DA 3C3UA 5M5DA 3LPPA 3VGGA 4JNMA 5IRPA 5G1YA 3KDOA 1PBGA 4AZCA 2HXUA 4OV4A 4BI7A 1TPB1 4LQ1A 1BXNA 7ENLA 5LIXX 3GVWA 2VI0A 4MJ4A 3NEVA 3OLEA 5AFDA 1JZ3A 2QPXA 2XFYA 3LB0A 1FHVA 3B0VC 2F38A 2Z6JA 4S3KA 3LQGA 2OLHA 2P0OA 3COTA 1XH1A 1V7AA 4CN6A 3BSHA 3SUTA 2DZPA 1LORA 5HK4A 3GNXA 5A6JA 1O1ZA 4MGGA 3VD7A 4ZOBA 4E2OA 2NLYA 1EJVC 5BXRA 4LS1A 4KFOA 1AL8A 1IT7A 4UNKA 2WSKA 1PHWA 2BODX 1KFCA 2HSAA 4EOUA 3MWAA 1UB3A 4WLCA 2W62A 3CUHA 4GXMA 4JIHA 1DKWA 3OLDA 4B5TA 1H09A 4LAMA 4GVFA 1UP0A 3DUGA 2ZE3A 4JKKA 4ZL1A 4G8TA 2YCLA 1ONWA 1THFD 1UMLA 1MO0A 2PD9A 7PTDA 1FWIC 4U4MA 1D3GA 1GQKA 3KL3A 1OX6A 2ABAA 5FAJA 1KCKA 2P3EA 4WKAA 5D9MA 2FHCA 5LHEA 5JH2A 3CC1A 3IIVA 4IUOA 4HSHA 3ONCA 4M80A 3KW3A 4UOQA 1PKLA 4PMDA 1JPMA 4XX6A 1M7OA 2FZNA 2ZRVA 3QV6A 1US2A 1QTWA 3B8DA 6XIMA 1TA3B 1IXOA 3DFYA 4W4QA 4IP4A 4DIAA 1G7VA 4LV9A 2I56A 1UD6A 1QW8A 3OGSA 4U2ZA 3MT1A 3LRMA 4QROA 4O0KA 3VMPA 1VS1A 3DH7A 3S2NA 1O6IA 2OR2A 2W79A 3S5ZA 4F0KA 4A4AA 3ZLHA 3EZ4A 4L6OA 3QEZA 3DFPA 1IEVA 4S3BA 1WZMA 3NL2A 4GJIA 2ATSA 4NQ1A 2WJEA 3TX9A 3WH8A 2JE8A 1E0XA 1YW1A 4CU7A 1CXEA 1B5TA 5HJXA 1E4MM 3LOTA 1KGWA 3NO1A 3DIPA 3P67A 3VMOA 4E8GA 1A5NC 3SY8A 1FKXA 1A3WA 2CBVA 4A8LA 4D6CA 3W26A 4YCOA 1M3UA 4DVOA 2PDBA 3MYOA 4IJBA 3PAJA 1PHQA 3RRXA 3EWCA 4W8BA 1KLZA 3UPBA 1E4LA 1KXTA 4XO7A 1ZRQA 2QJMA 3APGA 5AC7A 4XSLA 2E9LA 3MW7A 5I5RA 3ZT5A 3KX6A 5FL1A 3BE7A 4XUGA 4RZBA 4IXXA 2ZWZA 4O1BA 1JQVA 4RJEA 3GU2A 3QKZA 1VYSX 3PF3A 4W87A 2V5DA 4JFWA 1OC6A 4LUTA 1SO6A 3GM8A 3PR2A 1GORA 1Q6QA 3UCCA 4W84A 5I23A 2ZC1A 3U57A 3NO3A 3UA3A 4GMEA 3S9ZA 4DJFD 2DP3A 2C79A 3IWPA 3ZJKA 1EF3A 3LK6A 3MKCA 1D9EA 3H23A 4G1NA 1P5BA 3EPMA 4QIUA 1VC4A 5F4SA 2E77A 1SO3A 4YHGA 3UJSA 1ODUA 3SI9A 2HTMA 2YB1A 4FR1A 2VO5A 2Z0IA 3NGFA 4QS6A 4DY1A 1TWIA 1RBAA 1NDVA 1TR1A 3AMLA 3CH0A 1TE1A 2IXUA 5D09A 1OFRA 4GYPA 4XAGA 1PZ1A 5H8MA 5HUPA 4I9MA 1KCLA 1FWJC 3DERA 5G4EA 1PZ2A 1AD4A 4TX6A 4B9YA 4WRHA 3UFYA 3ME3A 3FK4A 3TA9A 3L4WA 4IT1A 1VLIA 5A2BA 4MNLA 4KERA 1XINA 1Q6FA 1X38A 6CGTA 4Z1BA 1JNDA 1PIGA 3LGEA 1SW3A 4FI4A 2GGJA 2WVSA 1B9BA 3KBSA 3NZQA 2PU1A 2FQIA 4JNYA 3WQFA 1MFUA 1R38A 2V5CA 2E8ZA 5D2WA 2C7FA 4Y96A 1E1FA 4EE9A 4PCNA 3A3XA 2TODA 4Q7IA 3GBDA 3UG3A 3NEHA 2VUYA 2FVKA 4H3DA 1RLDA 5HULA 2VEIA 3B8VA 5ABEA 3GG0A 1NDWA 1E1CA 4IMEA 3BG9A 3P8JA 4EWND 3ISIX 3WLQA 3TCEA 3G1AA 3INPA 3DFSA 4JXCA 1XIIA 3WNNA 3VE9A 3MI3A 4GNKB 2Q3OA 1DJHA 3F03K 2QUNA 4H8NA 2D22A 2NSXA 1R3QA 3RMEA 3CHDA 3WUBA 1UR8A 3T40A 4DUVA 3VCCA 5CPQA 3C8NA 3A4WA 4UIOA 4XO6A 3CLMA 3GHSA 3WYZA 3CIVA 3WLSA 1DVJA 2Z2UA 2ISSA 3WNKA 5M3WA 4W5UA 3QR0A 1GVEA 4KW2A 3WL1A 1UZHA 2PGFA 5DBTA 2ZUUA 4XUYA 1YYAA 1AL7A 3VIOA 4DBEA 4AISA 3K2GA 3PUOA 3EKGA 3KVLA 4Z42C 2RDUA 3WIJA 2BDQA 4OV9A 3IV3A 4JKMA 5CBJA 1BGGA 4GI9A 2OLAA 1LQ2A 4BQ5A 2YDSA 2PTDA 2EJAA 1KM0A 4GH3A 3PFMA 4E8CA 1JUKA 3HFTA 3GC4A 3LCWA 3OO2A 2BX7A 3UZ5A 5FOOA 3H53A 1JFXA 5GPRA 4B3KA 1GYMA 1N8WA 2VC6A 4JYEA 4EWJA 2D73A 4QNEA 4AVFA 4Z2IA 1R3SA 4OIFA 2G3MA 2PDLA 4UZUA 2PDYA 1TVPA 4ZOCA 5DRCA 1W5MA 2FHBA 3BW2A 2ACSA 3QBUA 3N2BA 4HYVA 1LZOA 2C13A 4KEUA 3AHXA 2HBVA 3WQ6A 4GI8A 4OFCA 4JN6A 3FNDA 1EOKA 3MCOA 1RQHA 3L2LA 3HV9A 3U5UA 4GFIA 1E6RA 1QWKA 1SZRA 3THUA 3WF0A 4ORMA 3KRSA 1KQZA 4GUHA 2FPVA 2BXZA 3IIOA 2QCDA 1U5JA 4WXYA 2WMFA 1CW2A 1UIPA 2W27A 3HA1A 1EC7A 5EMKA 2ZUMA 2NV1A 2PWUA 1E56A 4RL3A 4QQUA 3WQ8A 1JYVA 2PZ0A 3AU2A 4C91A 4P7RA 1E3XA 4A21A 1XX1A 1BF6A 3AIWA 3VDBA 2XWEA 5E0KA 2PWFA 4I3GA 4EPKA 3WQPA 2WMJA 3N13A 4HNUA 1F6PA 2IPFA 4I7WA 3HGRA 5HJYA 1QNQA 3GR7A 1IR1A 1GQJA 3QMTA 4TX9A 5A3HA 1CIUA 5HWMA 2NQ9A 5H91A 4GKTA 4FLSA 2ISVA 3GVRA 2ZC8A 1XLDA 5D9NA 1BKSA 3HPXA 3UU0A 3ZYZA 4NAEB 2ZWYA 4JN8A 3M1ZA 1KLYA 1PUDA 3R12A 3B0YA 5F4WA 5LGZA 3GDRA 1OQFA 3W6YA 3I4EA 3G1HA 2GDQA 1UA7A 3N3MA 3WLHA 3D0CA 3VOHA 4DEFA 1PKNA 3PWGA 3T44A 2DW7A 2GUUA 4X9YA 3M0YA 3QC0A 5FSDC 3B8SA 2HMCA 4FNSA 1AD1A 1FKWA 4KT2A 3SN4A 3W1QA 1RK6A 3LRLA 3MZNA 4E2BA 4NF7A 4S3AA 5HA7A 3GNNA 2G3NA 4FOJA 4MAVA 5FF2A 1A5OC 4AWEA 2GVLA 1HUVA 3VUSA 2WJZA 2OZ0A 1ZJBA 4UNLA 1OT2A 3EDFA 2J9ZA 1ZBVA 5E5CA 3BAYA 2ZRXA 4LB3A 1O68A 4H6RA 1MEWA 5C2GA 3GNDA 4Z1YA 4H2HA 2RKXA 3BANA 3NZPA 5GVJA 4JL2A 2Y62A 5BWAA 1O94A 4B90A 1XJBA 4JZ5A 3TDFA 4H8VA 1VH7A 1H1NA 2VVSA 1RA0A 1XBZA 4MB5A 1SQ7A 3MMUA 2Y70A 3U7BA 3OLIA 3ARPA 1JDAA 3RITA 5CPLA 1Q2SA 5C7VA 4C1KA 2BV9A 4NZFA 3BARA 3E9AA 2DJLA 5I03A 4LH8A 1MDLA 3SIMA 4DWSC 2ZX8A 3G1XA 4JTSA 3W1NA 4UR7A 1S2CA 2ZUVA 4B5VA 1IF2A 2ZDSA 1SR9A 2D2OA 3RR1A 1E51A 4A8IA 1BWKA 3H4XA 4Q4OA 1C29A 4EKJA 3FW6A 1SFJA 1TTQA 3NVDA 1G1YA 5I3FA 3KS5A 3O6AA 1WOAA 1P6CA 3GG1A 2F9RA 4MWAE 3QMRA 5FJUA 4B5SA 1ENUA 1NVMA 3TVAA 3V7PA 1QAPA 3GO2A 3QHNA 2V6AA 5DFAA 4H2CA 4UMCA 3WD0A 2XGZA 4PZVA 3FYPA 2W5FA 3G1YA 2VCCA 5LHFA 3SSZA 5A6AA 3SB0A 1GZ1A 4K8HA 2POZA 3TCSA 1BFNA 3N2CA 1CXFA 3NOYA 1EJTC 4HNVA 4GXWA 3GH4A 3BGJA 4RDZA 3ITCA 4PUUA 1MW0A 4ZTXA 7A3HA 4R85A 2B7PA 3FDGA 2A85A 2VWSA 1HGYA 4QXIA 8RUCA 4RPPA 3W7OA 4W7WA 2VEMA 1XUUA 1YRRA 2I5QA 2D0HA 2C1IA 5G2WA 1Z8AA 4C6FA 2G41A 4H8HA 1MNZA 3A21A 4IPLA 1LRQA 3WJWA 2C0AA 2O7SA 1B1YA 3AOFA 3OEXA 2VL4A 4PB5A 5K9XA 1E4NA 4HNLA 1EH9A 1RBLA 1MQRA 2YIHA 5E0CA 3TJ4A 2ZZ3A 1NAL1 5KZ6A 2H3DA 3KOXA 3IJ6A 1M7JA 2WV8A 4PRTA 5AKQA 4AF0A 3QGAC 4LSBA 2J74A 4LNCA 4R5EA 1A3XA 1ZGDA 3T0DA 5JQ9A 2J8FA 2HZGA 4JYFA 3NZRA 1LOQA 4NRRA 4ZENA 3MKVA 1R7OA 3OZPA 3PWIA 1O12A 4J3TA 5E6YA 2YBVA 3H54A 1U1UA 3O6CA 4XZNX 3TXVA 3W02A 4WDTA 5F4XA 2ICSA 2CLOA 3W7LA 3SFWA 4QEEA 2JEPA 4DZ5A 2BVYA 1SPQA 3KBVA 4HA1A 2VEGA 4CQ9A 1H1ZA 1UYQA 4BCEA 3NA8A 1I8JA 3RM9A 2FGLA 2DZVA 2ZVRA 1XCFA 2NZLA 3GR8A 3WUFA 1KM6A 5K4ZA 4U28A 4LAUA 3SCWA 2NV2A 2GYIA 1YE6A 4XD3A 3HB9A 3ZWTA 1TV2A 4UTLA 5DMMA 4WKHA 3TQPA 4K39A 1LL4A 3O0FA 1EZ2A 3CV7A 3V5FA 2JGQA 4ADTA 1PZ3A 1GOMA 3QPZA 1CGVA 2JKAA 1WDRA 2J7DA 3H26A 2J7CA 3SN0A 2QUUA 3SCPA 4Z1AA 2OQLA 2ZVIA 1BTMA 2W0UA 5C8BB 1BVWA 3IJ8A 3OIHA 3ELFA 4J5NA 4WDXA 2A4AA 3PBVA 4L9ZA 5LYRA 3VIMA 2QJNA 3KUMA 3NQDA 3HG4A 2OODA 1BSLA 3RGTA 3ABRA 1C8VA 4PA8A 3H21A 3VNIA 3VDGA 3BJSA 5FAGA 3A4JA 1ITQA 2JK2A 2B7OA 3QV9A 3EWBX 3CPUA 4XSMA 3CWHA 3N17A 3POCA 4M6VA 4O50A 3OIXA 1HJWA 3G22A 4ZE4A 4Y9NA 2OEKA 3H8AA 3T8QA 3QV7A 5ABGA 5F7UA 5DELA 4W8LA 3L21A 3LN3A 4OE7A 3R0UA 5AHFA 3IJLA 3AUOA 3LERA 3LXAA 1TZ9A 3GC2A 4AD4A 3G1FA 1HTIA 1ZP3A 3GD6A 3VNLA 1EB3A 1MRAA 4JTLA 3HMCA 5EY5A 1FWNA 1RHCA 3WH9A 1ZJAA 4NJJA 5HUOA 4FNTA 1TV5A 4M56A 1V3HA 1QNVA 3R7MA 1HFBA 2MUCA 4TQTA 1XLKA 4V1XA 4IQEA 3GB6A 4HQVA 2YCKX 2GDVA 3NJ3A 4DJFA 1WCGA 4L5ZA 4NASA 4O1DA 4E2DA 1AK5A 4MZ8A 3W53A 3QV8A 4IQLA 1VD6A 4HN4A 2D2HA 2FB2A 1GTHA 2D1ZA 3CNYA 1C9DA 1J0HA 2QCLA 2DZBA 4S38A 1SW7A 1YPFA 3V0UA 4CN4A 1TZZA 3L4YA 1X96A 4FX6M 4X61A 1RP8A 4CD5A 1PX4A 3SUUA 4OBRA 4GINA 2HE5A 4HMCA 1AVAA 3VIIA 4DNHA 1TCDA 4GVHA 2IMRA 2NX9A 3P2VA 3DU0A 4C5ZA 3B97A 2QPUA 1YE4A 3AS0A 3ARWA 2GK1B 1TJ0A 3HO8A 5CC3A 5DY2A 1DXIA 4Y8EA 5TAOA 2PPGA 1HL2A 1Z7AA 2Y61A 3ZJ8A 4MB3A 1OT1A 4XZHA 4OBTA 3KL0A 3GZAA 3QC3A 1EX5A 1V02E 1V0LA 4U3AA 3SY5A 1NARA 5C9XA 4Q8WA 3K1GA 4QE4A 3UZYA 4MYAA 2YL5A 4FEZA 4F0SA 1NFBA 5CZ0A 1MFVA 2QCCA 3M9YA 3FGCA 1XRFA 5IDZA 1SSGA 3T07A 4CD6A 1H62A 1FHDA 4WSJA 1KBKA 2J7FA 3H22A 7ODCA 1FOBA 3STGA 3LZ3A 3E6EA 1C91A 3W2JA 3PG9A 2VX4A 2CHNA 3HPSA 1WO2A 4ATWA 1MWOA 1V51A 3LCGA 3T09A 4XKYA 1Z41A 2WMIB 3WK3A 3WNLA 3PHAA 4CNPA 5C0QA 1IZKA 5BU6A 3GSMA 1UP3A 2XVLA 4M6QA 5C70A 5ABHA 5HMEA 5FSEC 4DQWA 1PTGA 3LM7A 4U2YA 1IWBA 2R8WA 1HKIA 3OB8A 4AG0A 1GOQA 1O5XA 2W92A 2D24A 5CJNA 1JZ2A 3GR4A 4IG2B 4K68A 1F6YA 3S5NA 3DXIA 2JKEA 1OSEA 2OT0A 4F40A 2ZA3A 1UOZA 3UWEA 1RVKA 1AQ0A 3EB4A 1QHZA 3LBCA 4D6GA 1FWGC 5I0DA 4MWAC 2IXVA 1ONXA 2RJGA 1QT1A 2BXYA 5I24A 2GGIA 4H19A 1LCOA 3L2MA 2Z1SA 1OYBA 3VKJA 4O28A 2HVNA 2R91A 4LF1A 3WG6A 4QG6A 3CZ8A 1I2NA 1XLLA 4AZ6A 5A6SA 4URIA 1IGSA 1W5NA 3RCNA 1T40A 2XM1A 4HSOA 3P6LA 4C6KA 3OP2A 2QEZA 3UGVA 4GX9A 4F2TA 3NAVA 1JJKA 1K8XA 3B4YA 4YCPA 4M24A 1SSDA 3RIKA 5CGMA 1EZWA 4R34A 4L4PA 2R14A 3QPYA 4A2SA 2F84A 1JGMA 3TZFA 2B0MA 3DYMA 2UY5A 1O66A 2IW0A 1RPXA 1X39A 1V6XA 1KFLA 1AODA 1ISZA 1KTBA 2A3HA 4ONVA 1HQTA 1QRQA 4GH1A 1V79A 3W70A 3L7RA 2YZRA 1H7XA 3QOMA 4ATLA 1DXEA 1BQGA 3ZFHA 1XHGA 3S9YA 2HEJA 3SFKA 5C2CA 2J24A 3N18A 2PGEA 4GJ1A 1OCBA 1XH2A 2QCHA 1OD8A 3PBGA 3SEPA 4PTNA 1H1YA 2VEKA 2DSVA 2PGRA 1XSKA 4NJHA 4HP5A 1WDQA 1B9ZA 4Y8FA 1CNVA 3ITLA 1JL8A 4D71A 3ID7A 3GYEA 3WD2A 3VNMA 4IWWA 2XU2A 4G9PA 3ICJA 2GL5A 1DJYA 1AA1B 3H7UA 1FXPA 4LANA 1DP0A 1J2BA 4Y2WA 4OQVA 3C3NA 1MYRA 1P43A 4U5IA 1HJUA 4KETA 2Y5SA 4Z2HA 5AECA 4M1BA 2GVEA 4D6EA 4GQRA 5LNUA 1Q6LA 1UKOA 4QCFA 2YW3A 7TIMA 1C8QA 2Q02A 1SO4A 4DWSD 1RJRA 4IIEA 4JY9A 4GUGA 1FTXA 4TMBA 3K8MA 4P8WA 2QCMA 1X97A 1FWBC 5FACA 3AXKA 4FALA 3PC0A 3QFWA 2VD8A 3WSUA 4KWUA 1TPUA 3U6WA 1W1TA 2VDGA 5EMMA 5AC5A 2V5KA 2GJXB 4MY9A 2DZAA 3BGGA 3BPWA 3TKFA 3GHUA 3GNOA 1BYAA 3S1VA 3VX1A 3Q58A 5A6BA 4O53A 2ZX7A 3UXLA 2CWXA 2J6XA 2V0TA 2HISA 2E0PA 4HK6A 2GGEA 1QPOA 1X6NA 2PLKA 3AMCA 3M0JA 4AZ7A 2ZCGA 1KBIA 3B8IA 3WQWA 4Q8OA 4O8RA 4ALDA 4E5TA 3VD5A 2FLIA 3SGGA 2OLSA 1UHVA 3NCOA 2VR4A 2PB1A 3BLDA 2IQTA 4Q4RA 1LLWA 1OC5A 3IUIA 4UCFA 2IKJA 2PBOA 4L1XA 4M6PA 2QYGA 4P7NA 4O1FA 1I6NA 3QTPA 3VGEA 1RVGA 3BJTA 1H60A 2VURA 1AZ1A 5HINA 4CCZA 5AHLA 2WWCA 2REQA 1K9TA 1ZY9A 2PU0A 4ZB5A 3T8LA 4V33A 3IGXA 3C2OA 1QI2A 2DZSA 4DM2A 1EA9C 3PG8A 5CSYA 1ONRA 3CZEA 5HJLA 3ZQ9A 1KA9F 2NT1A 3C2RA 1UKQA 4Q8PA 1N2VA 2FDMA 3GTFA 2WW5A 2BY2A 5J04A 4JN7A 4IMFA 2PRHA 2BGQA 1FFRA 2HPMA 4I9TA 5CGQA 4J4KA 2PBGA 3OA5A 2FJUB 3FS2A 2PDXA 5I7GA 3SGUA 2W91A 5FEPA 3P5YA 3NQ6A 2XZ7A 2CNCA 1BLIA 3LTPA 1TWZA 1ONEA 4GGBA 3KS6A 3B40A 4XWUA 3W7CA 1KGXA 1SZEA 3W38A 1F3WA 3D47A 4MNKA 2ZXBA 3NPWA 3GXPA 3G1VA 3L0GA 1UZ1A 3EPOA 4DYEA 2WQDA 3K4DA 5FJRA 1XH0A 5I06A 1M5WA 1NOFA 3DC8A 1XG4A 4U3CA 1V0KA 1QOPA 2XVGA 3LHZA 4HOWA 3RM8A 4MPKA 1AJZA 1GVOA 3IAPA 1T8QA 1EOMA 4MB1A 3DYOA 3EOOA 4UUIA 1WV2A 5CAHA 3N2OA 3JW7A 2ZRYA 2EJ1A 1IR2A 3VKBA 2Y89A 3N9SA 6TIMA 5LNSA 3WNMA 3GXIA 3KWSA 4Q33A 4GO9A 5A6BD 3VABA 1GPFA 3SN1A 3ZXWA 1A80A 1OFPA 1EIBA 3DI1A 2F61A 1GUVA 4HMNA 4S2CA 2HS8A 1QNRA 2CZEA 1JG9A 3UPMA 2YYUA 2ZX6A 3AALA 3DGBA 4AVNA 4FSAA 1FXQA 2FZ8A 2NVAA 5T8GA 4HCLA 4QGCA 2QF7A 1A0CA 1UROA 4L6DA 3MJYA 5CZSA 4N0RA 2WHKA 3GIYA 1N8IA 4B2DA 2WVUA 3MY9A 4L4OA 3V75A 1M7PA 2IKGA 2V3GA 4M1RA 1OWQA 1KR0A 3ITXA 3S5YA 1J12A 4CLMA 3WDQA 3WF1A 4RPQA 3WMBA 4GZIA 3GFZA 1XD1A 1V5XA 3M0VA 2H9AA 1GJPA 3DGRA 3AZSA 3BLLA 3OTRA 2NSOA 4DZAA 3BW4A 3TSBA 3WMSA 1R2RA 3OVRA 1IGWA 1D3HA 4LUSB 3FN9A 3MV11 4ZZ9A 5H8UA 3W7HA 4PEKA 2PF8A 1P1XA 1XFCA 1EC9A 2IQ0A 3LUTA 1UWSA 4BI6A 3B9OA 1E6PA 3NWRA 1KTNA 1SFSA 4PCSA 4AF0B 2VXNA 1KRMA 2WMIA 5K2ZA 1LROA 4CGTA 2PZNA 4H6EA 4MJZA 3WK0A 3G18A 3RCMA 4H00A 2NQZA 3HQNA 3EXRA 4H9TA 4AAJA 4ROPA 3FA5A 3LPFA 4KCUA 1TJ1A 3L2IA 1M53A 1U5VA 1WB0A 3GG7A 1OJXA 4HPJA 1MEHA 2WB5A 4L1WA 4MKSA 5IHSA 3OVGA 5KSWA 4JTAA 1WXZA 2QS8A 4QSFA 2XDFA 4EP8C 1ISWA 4WOZA 2E7FA 2ZUTA 3TAKA 3IGUA 1X7IA 4PFMA 3ARYA 1CEOA 4ZTYA 1X8CA 2W67A 3V3WA 3GC5A 4U33A 3GUGA 2XINA 1S5VA 1XYCA 5CBBA 2WM0A 1MEIA 4B3LA 4EIVA 3NDZA 3VTRA 4DBSA 3CTLA 3WDRA 1HJSA 5K9CA 3CTTA 1YTDA 3M41A 1V08A 2DQWA 3VOGA 1R47A 3K46A 3PPHA 3EMZA 5A6KA 3GH5A 3TNBA 2PTYA 4I9JA 2QZRA 5FD0A 1CENA 1MW3A 4MG4A 4ZSUA 3GFXA 2QNEA 4KWWA 2WPBA 1XLAA 4HK5A 1KNWA 4J28A 3GDTA 3BK0A 5CLTA 3GTHA 4R27A 1W3LA 2Z2BA 1UUOA 4NIRA 1TJPA 1PDYA 3QR3A 1SU5A 4UFKA 4ROQA 1JEZA 1NF7A 4C90A 4Q4SA 5TD4A 2AQVA 4NNCA 1XLGA 3W28A 1GVRA 1GVFA 2BB0A 4NG3A 4OWGA 3HQ1A 4LYKA 1KCZA 2WLZA 1JZ6A 3RJXA 1T6MA 5B7ZA 3QLLA 4MY1A 2GFTA 2P8BA 1RH9A 2W63A 4Q4PA 2XPKA 1RPKA 1UOKA 1G6CA 1T5AA 3MI2A 3TJIA 3HPFA 3NQ2A 5EMLA 2WNWA 3LS9A 3PZTA 3GE7A 3VDAA 5CKSA 3W82A 1H2JA 5CEWA 5K4XA 3B8TA 5LIYX 2NLIA 3CB8A 1XLMA 1XLJA 3GXNA 2WM1A 1DIEA 2Z1BA 1EYEA 1E6QM 5DF0A 3TUUA 4TR9A 4GA8A 4NYUA 3FAWA 5BU9A 1JIBA 1P0DA 2B81A 3WH6A 2VZSA 4R9XA 4FLRA 4GY1A 2J77A 3AJ7A 3GYCA 7REQB 1FQ0A 3IVTA 4FO4A 1E71M 1DE5A 4LYPA 2ODOA 1EFZA 2E67A 1J2WA 1QI3A 4AEFA 1QW7A 4I5UA 1YIXA 1F61A 4H9MA 5TNVA 2WMHA 2AL1A 4ZO9A 2I1OA 3AHVA 2YA2A 1IV8A 2J47A 1NM9A 3RYSA 4HPNA 1TPWA 2D20A 3MP4A 1LP6A 2BFGA 2HK1A 2PRMA 1QNPA 1HW6A 2OX1A 2YCLB 4PMJA 1EIXA 3APTA 3A5VA 3VFCA 1NP0A 1HF6A 3UQNA 3W2MA 2XIJA 1NQKA 3SUWA 5A95A 3MYPA 3MPGA 1YBQB 2ON3A 2D0FA 5FI8A 4LC8A 2QXWA 2GPTA 4JDYA 1ZBKA 3H2EA 1V3KA 3RU8X 1M65A 4BQ2A 4R3UA 1A0EA 2WCGA 5HATA 3H2FA 4NX5A 5FEXA 2VWTA 1GG1A 1FH9A 1E0VA 4DUXA 4CU6A 1PS9A 4HMDA 3NDYA 4EAMA 1EHNA 3EOEA 2QHAA 2Y7DA 1Y5WA 3UT0A 5C55A 3CHEA 3ORWA 1X8FA 3FHQA 2GSJA 1SGJA 3FJNA 1B57A 5D2TA 3W7IA 2ZZ1A 1WKFA 4IMDA 1PYFA 1PL9A 4GKLA 1R85A 1VCVA 3IK4A 2O0TA 4PTXA 3CV2A 2X1RA 4LVFA 3T55A 1OK4A 2XISA 3TV8A 3BMWA 3TOYA 3NQAA 2V5JA 2EPOA 4DZIA 4NY2A 2GQ9A 3UA4A 4A35A 4C7DA 1W9DM 3KCLA 2TSYA 4M3PA 2DY3A 1GOWA 4HZ7A 5C9ZA 4IIGA 2OG9A 3TROA 1PCWA 1IYXA 1KTCA 4YN5A 4RV8A 5I78A 2QDEA 4A3QA 1JZ7A 1H49A 5LNVA 8A3HA 1F74A 1PCKA 3TLLA 1NWUA 2VRQA 3EDKA 1R5YA 5I3HA 3WUEA 5BWFA 4IFRA 3TR2A 3FIGA 3W24A 4JQ3A 3E0VA 4QFUA 5IXEA 4GI6A 2JKPA 3W7EA 3EEGA 1CB7B 4ZEPA 1VIZA 3HMJG 3G77A 4FOUA 3ZWSA 3W7PA 4TVDA 5F2GA 2X42A 3TTQA 1V3LA 3CV6A 3LGDA 4J40A 1TVLA 3VVGA 4UXDA 3BGAA 1RV8A 1WP6A 4MKNA 1KRAC 4LEFA 1MDRA 1LUCA 4QE1A 4FZIA 2CERA 1QHOA 4O10A 4O1CA 4LAKA 1G4TA 2EKCA 4LAZA 4GACA 1QPQA 2BVTA 3ZIZA 2OYKA 3NYDA 2G97A 1U33A 2Q01A 4BZYA 2VQTA 4TV5A 3KZSA 3RK8A 2XGBA 1L9WA 1XLCA 1N8FA 1S39A 2KAUC 2WJFA 3TC3A 3WH7A 4PTDA 3S47A 2TAAA 4TUFA 4U31A 1Q3NA 3QW4B 4O12A 4OBSA 4CVWA 4DN1A 1TWWA 4XISA 1QUMA 2ISDA 3VIHA 4J3ZA 3TJLA 3NSNA 3T9PA 2MNRA 5M03A 2XYLA 3A24A 2QGYA 1XKJA 1FA2A 5ECUA 1OFQA 1H4PA 1WYIA 1ME7A 3WJXA 3SUVA 4PMVA 3T81A 3W1PA 1LWJA 2X41A 3VOIA 3KP1A 3PBWA 1KQYA 4MJMA 1S5WA 2WANA 1DPMA 5E9AA 1JZ8A 3VC5A 4D8AA 3BLEA 5GNYA 3AQUA 5CZTA 3R13A 3CQIA 1X7FA 5HNRA 1LUCB 5AYXA 3NYZA 4IUGA 1OFAA 4AXNA 3N29A 3I68A 4CQDA 4QITA 2J9XA 3H7RA 3O6DA 1LT7A 1RZMA 1EO5A 3FAXA 1GQNA 1FCVA 3VGHA 4LY8A 1V77A 5AYYA 4JCMA 1RALA 3LCHA 4LJ3A 5AHMA 4H7VA 1ZAHA 3P74A 1QR7A 4O52A 3IVSA 4K2SA 3TU9A 1UC4A 3AHTA 4GIYA 4Q7BA 2XIMA 2QR6A 1QK0A 4O1EA 1EPVA 4JFVA 1IXNA 1JZ5A 4YWIA 2NVCA 1K4HA 1CI1A 4XVDA 3N34A 1B0IA 3CZKA 2OKTA 5MKGB 3BMVA 4Y7EA 1GVYA 1UWIA 1ADSA 3QFEA 3AYSA 3WBWA 1SYTA 3SSJA 1YTEA 3MSRA 3AHZA 4UMAA 5EFDA 2I5IA 4PUJA 4V1YA 5G2IA 2E4TA 1V3JA 3SUSA 4EXAA 3KTXA 1YDYA 4J3SA 2RHGA 4WZHA 4O8AA 3M0LA 1BG9A 3PANA 5FCZA 4F0HA 2BLEA 4YVPA 1PO9A 1TMQA 4QHRA 2WCAA 3KRBA 4HCDA 4R53A 5EFFA 1KFWA 4F0RA 3UYIA 1KBJA 5KZMA 1VBUA 2OQYA 2E8YA 1JDEA 4C5YA 5U7SA 3VD4A 5BRBA 3N11A 4RR4A 3NXFA 4KGLA 5AC6A 2O9PA 2VCBA 1BEUA 1RK5A 4GUJA 1UD5A 2QPSA 5FIPA 2IPWA 4IGSA 3W2NA 3MA8A 1YADA 3HPZA 4MSSA 4I6KA 1GJWA 4DJFC 4QS5A 4C6IA 4O15A 2G95A 4J1OA 4LVGA 1FDZA 3S9IA 3VKKA 2D69A 2D23A 5DCDA 2HBXA 3IANA 2WHJA 3OYZA 3BICA 4F48A 4Z2LA 3QZEA 1K9DA 1E6SM 1OF6A 3H2OA 3VK5A 4H41A 2B4GA 1GNXA 1YPXA 5FEZA 3GBEA 2A0NA 2DIJA 1LLOA 4GC3A 1TELA 3M4HA 3FEQA 4DJDA 3E2VA 3CHCA 3O0KA 1E73M 1WZKA 3SCRA 4WD0A 1NH6A 2CLEA 5I02A 2DZXA 4GZ7A 1DYSA 2XSXA 3NSMA 3VKCA 3HOJA 4P5UA 3ARXA 3O15A 4B9ZA 5HPOA 5GJNA 5J5DA 1TKKA 2Z1WA 5BW6A 1PV8A 3W1UA 1NDZA 1I0BA 4MYXA 4DO6A 1W6TA 4D1JA 2XH4A 3ITYA 3ARTA 4K1WA 2WC3A 4UQCA 3EPNA 4LW7A 1XM3A 3AIQA 1AH3A 3QSTA 1BYDA 1SZFA 2A3EA 3L0KA 5E1QA 1TX2A 3PZQA 3RO8A 1UZDA 3NDOA 3BZJA 3I6EA 4U5KA 5AHNA 4JQ4A 3DEQA 4BFAA 4PUWA 3SECA 2BG5A 4JX6A 4DF1A 3HU7A 4N7QA 2OZ3A 2WK2A 1GT8A 4QR6A 2P53A 4UOJA 3WNOA 1IQ8A 2J7HA 3A9BA 2P3ZA 3MCNA 3Q2DA 4HKPA 1K6WA 2VFGA 3N3TA 2SFPA 3PWAA 1KM5A 1TPDA 2GQ3A 1G4EA 3QGKC 3URAA 4CQBA 2WVVA 1C8XA 3T2PA 3MKKA 3S6TA 3ALGA 1EDQA 4DUWA 4X60A 4IP5A 2AAAA 4FA3A 3WJZA 1EPXA 3CIWA 1M1BA 3O16A 2AL2A 2VDHA 5D37A 2E40A 1XIBA 2WWDA 1WBHA 2Q3RA 1IZCA 2ZZ4A 3BOXA 3P82A 5L9FA 1EDGA 2W9MA 3QTGA 1ML1A 3WQGA 3UWWA 7REQA 3U2OA 3FV9A 1B3YA 4Q32A 3I7RA 1ZL1A 4YTSA 1GOXA 3CH9A 1K8ZA 1T0OA 2V63A 1N82A 3U2CA 3D3FA 4JY8A 2VQUA 4LBRA 2JFEX 4L9XA 4C6NA 3MUZ1 3EB2A 3NZ1A 2PDUA 1OCNA 2P0IA 2WBGA 2YB4A 3VU2A 3L4ZA 1TWDA 1QI4A 1RAKA 3V0SA 4RE3A 3M46A 4WVXA 1K9FA 1PXGA 1TRIA 2OMAA 4K36A 4JX4A 3OQEA 2VFIA 8CGTA 4IPIA 4DI9A 1I2RA 4DBWA 4P7LA 1N55A 2PP1A 2ZRWA 1VB9A 1E43A 2DFAA 1HGWA 4R7JA 2VELA 1E6XM 3D6NA 2NXHA 2EGZA 3GDLA 3ZLFA 3ZR6A 1WPCA 2IQDA 4OTKA 2GJRA 3DFQA 4Y9AA 4IPPA 3TTOA 2E5DA 1FWHC 1Q4WA 5A8NA 3A9IA 2QCDB 2Y2WA 1XPYA 3WLKX 4JFTA 1IEXA 4G5DA 4ZXLA 1EGVA 4S23A 2O7QA 3JR2A 3SQLA 4E0CA 4HA0A 4ZCWA 2E6DA 4GVIA 2J9YA 1ZB5A 4ZGYA 1XLBA 4DBUA 4LUSA 3U5YA 2HNHA 1E9YB 3W7DA 5FF3A 4HNNA 3RLGA 1RJQA 2CLIA 4LEQA 1EX1A 4O0QA 5C54A 3E74A 2C19A 4AW7A 1MXSA 4QG9A 4D6DA 1VFHA 4QRNA 3N9RA 3U8GA 4MNJA 3PTQA 4CVUA 2ALDA 3KCJA 4AQLA 2PWVA 2EPNA 3FFSA 1U83A 1ESWA 3H2NA 2YGYA 3EWYA 3NSXA 4XD4A 3SRKA 2J6VA 5H1WA 3WN6A 4J2MA 5FJJA 4N2YA 1S3HA 1VCGA 4OU1A 3WFLA 4AD0A 2CETA 3PPCA 3GG8A 2CXEA 1G5AA 4LVAA 1R87A 3WEOA 2GK1A 1R2SA 3T7VA 3NNTA 1F3TA 3EWUA 4W8AA 3AYTA 3GDKA 5D9OA 3ABOA 3BTNA 3IJ7A 3BG3A 1F76A 2PMQA 3W07A 3DESA 1DQXA 4X3ZA 3IPWA 3UJRA 2GUBA 1MQPA 4I90A 3MP5A 3O3RA 3PK7A 3GKFA 2XVPA 1OGSA 2O9RA 2VC7A 4MOZA 2FIQA 2J7GA 1PEZA 1CWYA 5JIPA 3BJFA 2GJLA 3C52A 4C6QA 1Y0EA 1EBHA 1UR4A 5CC7A 2ZBTA 3ONBA 4EPDC 3D3AA 1BKHA 3C86A 3TA6A 3LENA 1H5VA 4ZA0A 3VYLA 4L56A 1XYMA 4XB3A 4L61A 2WZEA 4Y6GA 2V68A 4NUWA 4RDYA 1HKJA 2AKZA 1DHPA 4I8DA 3OYXA 4NZ3A 4QLKA 4DLFA 3TQ0A 4AWSA 2VZTA 3FJLA 3NM1A 2Z2AA 2WXDM 5JIWA 5G1MA 1HX0A 4FXSA 2X1IA 4DNMA 3XINA 1S2WA 4F0MA 3OBEA 4GYFA 3PN8A 1PDZA 3NL3A 2FPTA 3VOFA 1UC5A 3ITTA 3EEZA 2PC8A 3CPRA 2CLFA 3IIPA 3O7UA 1WE5A 3LSBA 4C1NA 3AXHA 4HZMA 4CEUC 1NF0A 3UWQA 2CYGA 5IM51 1LL7A 3HGJA 1K4GA 2VFDA 3EA3A 3P84A 4Z08A 3GQYA 5CZJA 3CUFA 3DHUA 1JGIA 1NOUA 5TIMA 1LL6A 3HBLA 4MDPA 1P6WA 1J4EA 2Y5EA 3BOFA 4IQDA 1FWSA 5LNRA 3DKJA 4D8LA 3NVTA 3STFA 4LV4A 2WSYA 4B92A 4C6DA 3AIRA 2OO0A 3KOYA 3E0WA 2VR5A 3G3MA 1B2YA 3SJ3A 3A64A 3EX4A 1HO1A 3AI0A 4XK2A 1TPEA 3G1DA 2Y85A 2EPKX 4LRTA 2OZ8A 3WLPA 2E68A 3OGVA 5CJMA 4HBKA 4IL2A 4JD4A 2H9AB 4Q8UA 1UJQA 4NJKA 2WOQA 4AZIA 1E0WA 4FAMA 2EKGA 2E1WA 1BGAA 2QV5A 4JS3A 4KFPA 3UCQA 4B3ZA 2Q09A 4PUEA 3S0CA 2ZX5A 4AD3A 4PCFA 4WHBA 4XV0A 1QDSA 4M82A 3RPTA 4IFOA 4EVZA 1YTKA 1S2TA 2FVMA 2PS2A 3FSUA 2PLMA 3IIZA 4AZHA 4NU7A 4LYQA 1HIZA 4UFJA 4HHMA 4RK8A 4JTUA 4AWUA 2OZTA 3VPLA 1WXJA 3GTIA 1TPH1 1EJXC 1S3TC 5HQLA 2YA1A 4L80A 1ZHAA 3LD5A 3B8WA 1QPNA 1Q65A 4L9YA 4AXKA 2GOUA 3PS7A 3WQOA 4YHEA 5AZ1A 1VQTA 2OYLA 3CAQA 5AYIA 1TJ2A 3WQ4A 1WBJA 2WMKA 3BDKA 1Y5XA 3QRHA 5E0FA 3MBDA 3AIEA 2CXGA 2Q8XA 4ZBCA 2VMFA 3AMDA 1LG2A 4PL2A 5KITA 3LG3A 3Q4DA 5A8PA 2G3JA 2YYTA 1W9UA 5DBUA 1XLEA 4O14A 3QHOA 1ITUA 4Y9OA 4QG8A 1DE6A 3ARVA 2GWGA 2HPIA 3PTKA 1MXDA 3UYCA 2XIQA 2E9BA 3OBKA 4FB7A 3UPWA 3R8GA 3MI6A 3W86A 3UWUA 1WAUA 3GVVA 3CUIA 1QO2A 4MFEA 3WQDA 2WZHA 1LYXA 4JHMA 1EQPA 3V36A 2IKHA 1W5QA 3WLNA 4FNUA 3BL3A 4RKAA 3KVJA 4IIDA 3P14A 2IKIA 2CU0A 2XIBA 2A1YA 4F3HA 3AMGA 3T4CA 2ADAA 4KWOA 3TYBA 3N14A 3VIGA 3H55A 2Y7FA 4AB4A 4OUEA 1JD7A 2CIPA 7TAAA 3B0XA 4ZO7A 1MQQA 2OXNA 3II1A 2V2CA 2OOFA 3WD3A 1PWLA 4HPGA 4ADUA 3WUGA 5CAKA 1SMDA 4BY3A 1OADA 2INZA 1Z44A 2BTMA 1WX0A 3G0SA 2JF6A 3FDKA 4RZ5A 4N9EA 2PGWA 4M19A 1EJUC 1UPMB 3ZT6A 3IS4A 5HQEA 5I3JA 1ZBCA 1ZFJA 3OVPA 4NHVA 1H0IA 3E02A 1UKSA 3TFXA 1K7XA 2QIWA 2WCSA 5DQPA 4AX7A 3URQA 3SQMA 3QQ1A 4QQ3A 4S3DA 3K5XA 2V30A 1I2PA 4MHBA 5C2XA 4OGZA 4GQGA 4TO8A 2NXIA 3PNUA 4NAFB 2ZTJA 5CPSA 4KQNA 4NL1A 4R7WA 3C56A 3N04A 4YPJA 4B91A 2F6KA 2ZOXA 2BOFX 2ANUA 3W84A 4XAPA 5HDRA 3NPVA 4H04A 2PTWA 3PUGA 1MVYA 4CUCA 3MVTA 2DGAA 1YBQA 1BXBA 1X1NA 3MSGA 3KTCA 4YTTA 5JMUA 3NQMA 1EKOA 4OECA 3UG5A 1P0BA 2I16A 1B90A 1Q4NX 1YMYA 4AH7A 2I9EA 3K8KA 4FXJA 1JPIA 3NQFA 3QGVA 5T26A 4F4RA 2AMXA 5EMUA 4HHLA 1YLVA 2Z26A 3ZVHB 3VOCA 4IQJA 1GQIA 3TOPA 4CEXC 5EYWA 3M0ZA 1RD5A 3AJXA 3KAOA 1W1B1 3QR1A 4UTHA 3VNKA 4IIBA 1HO4A 1EA0A 2YOCA 2JIWA 1JFHA 1C93A 2Q8ZA 2ACQA 3LCFA 1DWFM 1Y8BA 2Z4GA 1UA3A 3T4WA 3WLLA 1EBGA 3S6OA 1CGTA 1R6WA 2GQAA 1UQYA 3P61A 1XLHA 5M1TA 5I09A 3O6YX 1WZAA 2PP3A 3EA1A 1MRQA 5A8GA 4JIIX 5HPCA 5BXPA 4GWEA 4BS0A 5LA1A 4NX0A 1UD4A 6A3HA 1S38A 4WKFA 2VZUA 3MSDA 4QJ4B 3EWZA 1A50A 4XKYB 2PDMA 4AMAA 3W4RA 4YU1A 2X05A 4RNIA 5JBEA 1LWHA 4IISA 4YLWA 4J3XA 3MTWA 3OQ8A 2HNEA 4C6OA 5HOSA 5LIKX 4V27A 3S2MA 4M8UA 1LBMA 1Z42A 2Z29A 2A7RA 1EF2A 3STEA 3NG3A 3FYYA 1JF5A 4WDWA 1J0KA 3WBEA 1AQFA 4LPCA 1VFFA 4UFHA 4HTBA 4EANA 5BRPA 4LC6A 3F4CA 5D2YA 2OTDA 2Z1KA 2J7BA 1XICA 2QJHA 3AISA 3CQKA 4OVXA 4HHHA 1QVBA 4C6LA 1E40A 5XIMA 1SFLA 3CWNA 1JDCA 2XN2A 3GIPA 1AH4A 1TUFA 5HMSA 2VD9A 3SJNA 4CNTA 1M01A 3WBYA 1UD8A 1GYNA 1BF2A 2W66A 3W87A 4ZQOA 3T2OA 1KFBA 3TYCA 4K8EA 3TP4A 4JYDA 3NFUA 2QDDA 3GTXA 5BXTA 1BVZA 3W7GA 4H9UA 5DRIA 3EWXA 2QGHA 3R43A 8XIMA 2DVTA 1E6ZA 1ZS2A 2X0YA 1DOSA 2WAGA 2PSNA 4IICA 4XZMX 3Q45A 1J93A 4WCJA 1IZJA 1V6VA 4GGHA 1K8CA 4RDWA 2I57A 4A8NA 2BWGA 4PB3A 3LTSA 1HJQA 3FGCB 1YDVA 1E6NA 4IH3A 3SRFA 4JCLA 4PYSA 2ATMA 4F9DA 1KW1A 1Y5VA 1F7BA 1JRCA 4UZSA 1UASA 1RUSA 1TWSA 3BG5A 4J35A 5AN7A 4MIMA 2R82A 3W00A 4JX5A 2OEMA 1W2VA 2EBNA 3DDMA 4LB4A 1VEPA 5MKGA 2G0WA 3MMDA 4UCGA 1EP2A 3TN5A 5FF0A 1VJIA 4H6QA 1GKRA 2DDXA 1TV4A 3BZGA 3QF0A 1GGOA 3MUAA 4LBSA 4ICNA 3W0KA 4HGXA 1A5SA 4IJRA 2VFFA 4YIWA 4LWWA 1BWLA 1EUAA 2DEPA 2GSEA 2PDFA 2RJHA 3NXLA 5GJPA 3MHFA 4GVGA 3SQSA 4US5A 1NJJA 3K30A 3WEZA 3QY6A 3FLUA 3SR7A 1TV3A 1ZPTA 9XIAA 1AUSL 1V6TA 4E2VA 4EPBC 2VM8A 1W9XA 4LALA 2VYOA 1G4SA 3LU2A 3GXTA 1XP3A 1MZRA 3DX5A 3AWNA 2XIOA 3UESA 2PTXA 1GJUA 2R94A 3OZYA 1J79A 4CD4A 2HK0A 1R3WA 2A2IA 3R8HA 3PB2A 1KFEA 1QU4A 1J6OA 1XWYA 1KFJA 3TYZA 1Q6OA 1ZQ5A 4DF0A 3M5ZA 3DFTA 1UR2A 2KZHA 4LT9A 4XBSA 1R9XA 2IS7A 2Z1XA 2CC0A 1NFPA 4ZB0A 1DTUA 1NEYA 4D6JA 1QHPA 4JTFA 3MSYA 3VAVA 1OF8A 3CUXA 4LX4A 4DZHA 1H50A 3B0PA 3LMYA 2H8ZA 2YBUA 3KLKA 4XZLX 3VIPA 2FDSA 1Q13A 1NWTA 4XQ6A 1Q6EA 3HJZA 3MMTA 4GYJA 3ZOAA 5CCZA 1NIUA 2VGGA 2ZUSA 2DIEA 2QVHA 4EXBA 1LRTA 2XN0A 3PTMA 4NVTA 1X1ZA 4HNTA 3WZ0E 2UWFA 1YNYA 3ZR4A 1H7PA 3GDBA 4Z2GA 3VCRA 1B3ZA 3HQOA 2CKSA 2ZADA 3E2SA 2O55A 1WUEA 3R1ZA 3BAWA 3EYPA 3MZ2A 3M7SA 2DPEA 3ZJ6A 1CYGA 2BSLA 2XUCA 2PDCA 1GKPA 4IP7A 3W37A 4PCPA 2FZDA 1UP2A 3UWYA 4MVAA 1XRSA 3TC6A 3MBFA 2PE4A 4REQB 1M03A 2NUYA 1UD3A 1PYMA 1R3VA 2VJXA 1UH2A 1UWQA 1V6UA 2VHLA 4H4IA 2I9UA 2BOGX 1F4AA 1AMYA 3S2JA 1VJSA 2O56A 3OU8A 4KEMA 2VGIA 3G6MA 1J11A 1DWJM 3W3OA 3LHWA 4QDWA 3F2BA 3L66A 2HQAA 4ZVJA 2DVUA 3O63A 1PIIA 1F5ZA 3T2QA 1FY6A 2I7GA 3LM3A 4O13A 4XD6A 3VZXA 3Q37A 1XIFA 4IL0A 2Y4SA 3GVGA 3TSMA 5CLWA 2PP0A 4J3WA 5D30A 4GCAA 1E70M 1W3HA 2C6QA 4FR6A 4KFNA 4UC5A 5F2LA 1LOLA 5JXQA 5HXMA 2QJJA 2J62A 5I3KA 1UCWA 4HOXA 2BGSA 3GHRA 1FWWA 4A8RA 3G5EA 4CU8A 1XR2A 5GJMA 1GWJA 1QI5A 4S39A 4AIEA 3WLOA 3WMLA 3P80A 1VZWA 3UJFA 4XIAA 2E1DA 4UTFA 2E25A 2J7EA 2G4FA 1AH0A 1VBRA 4H1ZA 3KBWA 3N6HA 3UCDA 3A5FA 4O18A 3RDKA 2AGTA 2QCFA 1JCNA 3KZPA 3C2VA 5D2VA 2V67A 1U2YA 1GOIA 3G8EA 1H7OA 5G4HC 3W1LA 3PB0A 1EXBA 3VDHA 1BRLA 4AC7C 4HTYA 4LUTB 2CLHA 3QH2A 1W3IA 4MUZA 3OHIA 4BQ3A 3W22A 5T9CE 2ALRA 3NTYA 2E5CA 4N9DA 5AYZA 1VHCA 3DKLA 4XBJA 3QLDA 3AXIA 3HURA 1XIHA 1JAKA 3MC5A 4B4HA 3BWWA 4KIRA 4QDPA 1FVPA 2I17A 1YNQA 1KR1A 3D5HA 4BKNA 1E9ZB 1RCXB 5JU6A 2V3DA 1HZYA 3LI0A 4MY8A 1XRVA 5DCEA 2ZXQA 1PX3A 4GNVA 3WFZA 1HKKA 3BC9A 5EL1A 3HFYA 2G96A 1TTPA 4XAZA 1V0MA 3BW3A 3TXZA 4GZEA 3QQ0A 3W1AA 3EA2A 4M0XA 1XIDA 5A8MA 2AL2B 4ICMA 3V5OA 3FJ6A 2H6RA 3FA4A 3I65A 1YEYA 1SFTA 3GNPA 2Y0FA 3E38A 4HJWA 2BZNA 8XIAA 1X6LA 4Z1DA 4AZGA 5U4NA 2RDTA 1M04A 1UBPC 1WDWA 1UD2A 2QDHA 3LTYA 3DC0A 1Z9AA 3IIXA 4FS9A 5T9BG 1D7FA 5XIAA 3CU2A 4GXPA 5HNUA 3EDJA 3TH6A 3KL5A 1ICQA 1ISVA 4A22A 1SMAA 3VA8A 3GNRA 1NFGA 5JBFA 3UZWA 1W0MA 4C6BA 2GJXA 1MXGA 3LLDA 4W9TA 3R5EA 1POKA 3W85A 2CFFA 3DFNA 3VGDA 1HJXA 3AYRA 2Z27A 3M0MA 4EF8A 3VNJA 2V69A 3CEPA 4Z1CA 1CX9A 1VLWA 2NV9A 3LCLA 1JRBA 2OU4A 4PR4A 4JR5A 3RNDA 3GW3A 1A3HA 4O54A 4FX8A 4WSKA 3DCPA 5D4YA 5F2IA 5E9XA 4KRTA 4MNMA 5J8LA 1W56A 3DFOA 2WKLA 2RH9A 4NNAA 5EMJA 3TQKA 3EX6A 4JPGA 3IRDA 2FMNA 3M6YA 1GOKA 4MPQA 2QLYA 3WK2A 1XLFA 2P8CA 1ZCCA 2DORA 1ISYA 3IUDA 2XFRA 5BXSA 2FPYA 1TTJA 1LM1A 1Z69A 2BGNE 4YL2A 1MUWA 4PBGA 4CN1A 2NQLA 4RXGA 1G01A 1TPC1 1I0DA 2YSWA 1S5MA 3O06A 3GH7A 3SIZA 1W8SA 1NQ6A 1OZQA 1KKRA 3PZ9A 5A8QA 2CLMA 4M81A 1KB3A 3LNMA 1F73A 3LX9A 3NZGA 3BMXA 1Z89A 3W6LA 4D6FA 3R8RA 3L65A 3TMQA 3VIKA 4DO4A 4AEEA 1X6UA 2FFCA 1OFDA 3FVDA 3T0TA 3IJDA 3PVFA 1XBXA 3TK7A 1TG7A 1B3XA 1OY0A 3CPGA 5C9UA 3W88A 5HBFA 1PIFA 2Q8LA 1UH3A 1Z32X 3TYEA 4HA4A 5ECVA 3RCYA 2H8XA 5D02A 2GGGA 5AYBA 2EF9A 1GVSA 2JQXA 1R9YA 1E15A 2UY3A 2V9DA 1FRBA 3C61A 1X98A 4W89A 3WDJA 2F2HA 4C6JA 1R86A 4MDOA 4X63A 3W2LA 1DJXA 1P7TA 4O4VA 4FXFA 2XFFA 4MF4A 3DOPA 3CB3A 1O1HA 1CXIA 1DIDA 3THCA 3XISA 2YCIX 2Z25A 2VP8A 1E1EA 1KBLA 3DZ1A 3CL6A 3K8LA 3PM6A 2YKKA 5HQMA 3NPXA 1VYPX 4NJGA 5ABTA 3PZUA 2E6AA 5IOBA 5KEZA 1CZ1A 4NILA 3IJIA 3VO0A 2G37A 3PJTA 2ISFA 4ZODA 4F9JA 5LGXA 3CGTA 2FTYA 2E9MA 2UBPC 2YXOA 2CW6A 4HYRA 2X30A 5H2ZA 1KCXA 2TRSA 2V81A 4P7QA 4UQDA 1EP1A 3FCPA 2DUAA 2P76A 4B5UA 1JCYA 4QX4A 1AMKA 3S1GA 2JBMA 3G1RA 3WF2A 2BHUA 4ACYA 3RG6A 1G67A 2EHHA 4A3HA 2EEXA 5G2HA 1J9YA 3C0SA 4EF9A 1PWMA 4GUIA 4DI8A 3RLHA 3FA3A 3CYJA 1M7XA 5F1VA 3TIMA 2BMBA 3MV01 1VHNA 5I77A 1VYRA 3TJXA 2DT1A 4WR3A 2JIEA 4GY7A 4C1NB 1WOBA 1G94A 4WQ6A 2J8GA 4AIBA 1UPPA 1AW5A 1H3GA 4Q8QA 3H2MA 1W1PA 1D7KA 1I9CB 1FP9A 5BOEA 3MANA 4A3UA 2V3EA 3EAUA 4OZOA 1C8YA 4DXXA 1M6JA 3CWOX 4JTKA 3GZ3A 5JUVA 1S2AA 1VJZA 4DJDC 5CGTA 4GIEA 1DV7A 3JRKA 1GQLA 6REQA 4ERIA 2DT0A 5DT5A 1T7LA 2MANA 1XG3A 3M0KA 3EMQA 3FYOA 4JKLA 3E1F1 1J5TA 3SW6A 2X40A 1ZUAX 4Z0JA 4L65A 3BSGA 4O57A 1OVDA 4GQBA 3CS2A 4KRUA 1OFOA 3VZYA 1GHSA 1W2PA 4YS1A 3USZA 3IGSA 4IGNA 4IMGA 2ZQ0A 1EJWC 1LJYA 1A5BA 1S2UA 2ZICA 5DXXA 3BQ5A 1CDGA 3J7HA 3LCXA 1JCLA 3K4WA 4GUFA 4H9XA 1J0JA 4REQA 4RNHA 1KGUA 1W32A 2NQ5A 4KRZA 3CT7A 3WNPA 3EKLA 5AHIA 1J18A 1ZNNA 2ABBA 4NNBA 1TQXA 3GTNA 3TR9A 3CM4A 1DWHM 2PDJA 4CCCA 2ZA2A 3BAKA 4N42A 1CLXA 1V6YA 4A29A 5I00A 3S4TA 5E6ZA 1RXOB 2YXGA 4BF5A 4TOQA 4CCDA 1LQAA 4B2DD 5IBXA 4GYKA 3WEMA 3WK1A 3G0UA 3S2CA 5I3GA 3KM8A 3KCOA 2G5WA 3VDCA 3NQ7A 1R3YA 4C7FA 3IUHA 3LGGA 4N6EA 2CHRA 3U2ZA 1FCUA 1OCJA 3RPDA 2C15A 2QCNA 3V16A 4QDMA 4TTGA 4BHYA 1K03A 2VX7A 2YL6A 3HG5A 3KDNA 3VC6A 3L9CA 1TX0A 1Q6CA 1UR1A 2CWNA 2BASA 3UZJA 5AC8A 1L2UA 1BWVA 3N4EA 2A6NA 3WQEA 4IM4A 5EBAA 4ZQPA 1POJA 4AIOA 2J78A 1DWIM 2F6UA 1A53A 3L4VA 2QKFA 1HKWA 4Q4KA 3F2CA 4PUNA 2VR2A 3FJ4A 2OWCA 1Q7QA 3W27A 4CNSA 3O1NA 1NTHA 2W4XA 2LLEA 2A7PA 2PWHA 3M5XA 1SW0A 3N25A 5E09A 3MCMA 3A23A 3E0FA 1VR6A 1LRNA 3NGJA 1E3ZA 4DPQA 2QCGA 4UFMA 1R9ZA 4J7RA 1GVQA 1DHKA 2VFEA 4MB4A 3W81A 3SRDA 2PWDA 2HROA 2WNQA 3G8RA 3EMCA 4P7OA 1RCOB 1UWUA 3W7RA 4GQ0A 1B30A 2J75A 3H4GA 2ZTKA 2HCVA 4MUPA 2Z24A 1L6YA 5LIUX 3QVQA 2V2DA 1C3FA 1U30A 3LLXA 4LCSA 3EGJA 3TW7A 4GZJA 1P6BA 3JZUA 4GBUA 1K02A 1EJRC 5EPDA 4FHAA 3W25A 3HGSA 2XN1A 2DQXA 2NWSA 4NRSA 5CG0A 3C4UA 4XG1A 1JCMP 1N7KA 3FXGA 2A3LA 2ZDRA 1KRCC 5M17A 3SCTA 4LY4A 3WD4A 5BRQA 4OKDA 5JBDA 3IARA 1W1IE 4YTQA 1MUCA 2XTKA 2VGFA 3VIJA 1ME8A 2ZE0A 1P0NA 1BG4A 1UKTA 1OX4A 5A6TC 3UJ2A 3W7QA 1U1JA 5BYWA 1JPDX 3ENLA 1EEXA 4PB4A 3VOJA 3R6IA 2G3FA 3WLMA 1I1WA 2D2JA 2GJNA 3S3GA 4D6HA 2C0HA 2GZXA 1QMLA 3BCFA 2ZZ5A 2JALA 1JUBA 3MUCA 2X1SA 1WNOA 1CLKA 4IPJA 3T05A 3UZZA 1RP9A 3K4AA 2V8ZA 4TV6A 2FZMA 1ZBWA 3IAQA 2PDWA 1EHAA 3QXBA 4R7OA 3GIQA 4HIBA 2Z7GA 4DPPA 3DI0A 3GXFA 4N9BA 4Q7NA 1TE6A 1ZAJA 1TMHA 3I3DA 3P8IA 1CLVA 1NU5A 2W3ZA 4ZE5A 1V02A 3WDIA 2X0SA 1ZJIA 1LWIA 5IDIA 4HNOA 4LXFA 1WXYA 4H8UA 3VUPA 4AD5A 4WSHA 2FJKA 2VZVA 3B9NA 4RLIA 5BZAA 1IT0A 4N6FA 3CUGA 4H01A 3W2UA 4S3JA 4AYGA 4NAFA 3DG7A 3RUBL 3AU6A 1B4KA 1BPLB 2DV0A 2PTZA 4IPNB 3Q65A 3NPUA 2DZTA 3TNOA 1E72M 3P60A 1K6AA 2GOKA 2YDAA 4WJXA 4WJEA 5D32A 4Z17A 5B7YA 1W3JA 3W1TA 3AIUA 4FP1A 1LT8A 1HP4A 2VTFA 4CCEA 1VCFA 4IIHA 1B4EA 4JTCA 3TTEA 4KS0A 3W73A 1JYWA 4ZOEA 4J9JA 1EWDA 3ZR5A 1HL9A 4IIFA 1ME9A 1R30A 2QQ6A 2HS6A 3O8AA 4OJYA 4XAFA 3AS2A 3K13A 4QE5A 1XBVA 3M6DA 1BD0A 4CKQA 3VNZA 3M44A 4MADA 1YNPA 3N6QA 4PULA 1FWDC 2YCEA 1W9VA 4E4PA 3WLRA 9CGTA 4IG2A 2P5NA 4QJ1A 2WKJA 2DU2A 3U48A 4GLEA 1SJAA 1ZAIA 4RV3A 4OUIA 5CH9A 3QY7A 4XIMA 1B31A 5AY7A 1XSIA 3RM4A 5I3IA 3RU6A 3URNA 2ACUA 3N6JA 3LV6A 3T0AA 3E49A 4GIRA 4O0ZA 3RLVA 4AZCB 3BVJA 3RR4A 5TQLA 4M51A 2YDRA 1VF8A 4ADSA 2TYSA 2Y5JA 1QJWA 1XSJA 5E70A 1F05A 3LA4A 5D03A 3QKEA 1JPHA 1TV8A 3GAYA 1VFOA 2ZA1A 4GNJA 4IX0A 4KCTA 4LBUA 1QNSA 2B31A 3KVMA 3M64A 4GI4A 3CL8A 3GAKA 3R11A 5LIWX 1EXPA 3NL6A 4EXQA 1UG6A 1H63A 4RCXA 3L5MA 2WYSA 3AYVA 4BF7A 2Z6IA 3PBMA 2CPUA 4Q6JA 3WF4A 4TIMA 2F7FA 3ZLGA 4FX7A 4BI5A 6XIAA 5H6HA 4P2VA 1CXKA 2D3NA 4HHPA 4JQ2A 3SADA 1K77A 2E28A 1A5MC 4PUMA 4BQ4A 3ZM8A 5A94A 3N9KA 3TE9A 2WZTA 3W83A 1G0CA 2NT0A 5G5IA 3N1AA 4UFIA 2HJPA 1P1MA 4K3ZA 3EDEA 4M7SA 2DVXA 3L4UA 4AU0A 2FTPA 4A05A 2PA6A 4TVCA 1D8CA 1KXVA 3JU2A 4AHPA 1TUXA 2PUZA 3TAOA 2FGZA 3KRZA 4CQAA 2ZZ7A 3AHYA 3PPFA 2YA0A 4DF2A 1K1DA 1OX4B 2F2KA 2CHOA 4S3GA 3SAZA 3F4DA 3S1UA 4GIAA 1E5NA 2HV5A 1ZZMA 3GWQA 4RE0A 1XYFA 4D9PA 1WA3A 1HT6A 1I2OA 1E9IA 1I1XA 1LG1A 3VNDA 1TVNA 3FKRA 5EGRA 4IHCA 3STCA 3GU9A 3BOLA 2OSXA 1H41A 3SM0A 2XH2A 3LLFA 2O9OA 4S3FA 4FIQA 3QM3A 4QCEA 3E96A 6REQB 2VT0A 1B3OA 3UD6A 1YXDA 2VEPA 2FHFA 4KH2A 4GE8A 4Q22A 1TIWA 3H24A 3BUVA 2X2YA 3VGFA 1AJ2A 3M7WA 2OFJA 1U5HA 5C6MA 3BAXA 1M9HA 3CO4A 1UWTA 5HWNA 5D9PA 4ZQRA 4AVOA 1RLCL 3EBVA 1DXFA 4HCHA 1L6SA 4WY0A 2PURA 3I3BA 3SCNA 4R33A 3DECA 3QN3A 4JTQA 2DSUA 2D2GA 2E3ZA 1XFBA 1DL3A 1FCBA 2GVYA 1VFUA 4HT3A 1W9PA 4GHRA 4PL1A 2AKMA 1UQZA 2DJXA 4EX4A 5C5YA 3TYDA 1L0PA 3UG4A 4P8UA 4DUOA 1KWKA 3M07A 3V35A 4AX6A 2WLYA 3JVAA 1OFBA 4W7UA 4WIWA 5LZLA 1B3WA 2FH8A 4BF9A 1Q66A 3TN4A 3WJYA 5LXEA 1UBSA 5I2UA 1MI3A 4OOZA 2GVJA 3CUJA 5KTLA 3QZ6A 2VX5A 4ASTA 3AIVA 1ECEA 3OBAA 1XC6A 3GKAA 4W88A 4XD5A 4HSNA 2J13A 1ELSA 2J79A 4IFKA 1K8YA 1TMLA 1XW8A 1JCJA 4BEQA 4DWSB 3WO8A 1NDYA 3E5PA 3EXSA 4TTUA 3CV1A 2F8QA 2PF0A 4MMWA 1SO5A 1XQKA 1H7WA 3U3HA 5IHRA 5TBOA 2X7VA 3UZXA 2Z7KA 2DSWA 1C92A 3A12A 3MP3A 1Q5MA 3P0XA 4L4MA 3WBXA 1JDDA 4HOZA 4DRSA 1SJCA 3ZT7A 3HJEA 4MWAA 4XZBA 5F2MA 4FNQA 5AHEA 4G7FA 3IJQA 5FF7A 3MHGA 4UTIA 3HF3A 2P50A 1C90A 1BTCA 2ZUNA 2Z28A 1V3IA 4NZ4A 5I3DA 4NSBA 1J96A 1G4PA 4KCVA 3MO4A 2Y88A 4EK7A 2FVLA 3QSRA 1W9BM 4JOMA 2QMKA 1V6WA 4S2BA 2ZZ2A 2YXXA 2QCEA 1UR9A 1U22A 4QNWA 3EB3A 4BEUA 3PZMA 4UNIA 1XC4A 4MM1A 4D6IA 4LVBA 5DANA 4S3EA 3TFCA 4HU0A 4H9YA 2NXGA 2DT3A 3GX9A 3FEMA 3WDPP 2PDGA 2J8TA 2YZ5A 4PMZA 2VDIA 3QHMA 4N9CA 1Y7VA 1L8NA 1DTNA 2INEA 3GW0A 2EAWA 4I9AA 3UETA 4DXVA 3NM3A 1BAGA 1GEHA 5FJTA 1LLZA 3NL5A 2XG9A 4CD7A 1JUEA 4BK9A 1US3A 1W17A 2W6RA 3OGRA 1YHTA 2PDPA 1EQCA 2XH0A 3L0NA 3W9ZA 1C7SA 3G0XA 3TN3A 4NXSA 2WPGA 3DBPA 3H70A 3UGRA 2VRKA 3VCNA 4AYSA 4WDUA 4B15A 2YL9A 3FVMA 3RN6A 3UERA 5I79A 2R24A 3V1HA 2EG8A 1RCQA 4HNCA 2OX4A 3OW1A 5FKYA 3L67A 2YFNA 3IJ9A 2WMGA 4ZXOA 1NOWA 3OA3A 2RUSA 3PP7A 1CT5A 1VFSA 4GCXA 3ARRA 3HV8A 3POHA 2CLPA 4BA0A 1NP2A 3TTYA 4W5ZA 3EX1A 2YR1A 4NZCA 2QF8A 3F7JA 3OLGA 3GK0A 4ZO8A 2YX0A 4DYJA 3OVQA 3WQVA 1GW9A 2PCEA 1V7YA 3EWWA 5PTDA 1QASA 1T41A 3GS6A 5C9WA 3OPSA 2CCRA 1CCWB 3R4IA 4P61A 3BSMA </