4HK7A

Crystal structure of cordyceps militaris idcase in complex with uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
379
structure length
379
Chain Sequence
b'PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLKAELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
molecule tags Lyase
source organism Cordyceps militaris
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
total genus 136
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk7A00
4LEFA 3RCMA 2CZVA 1FWBC 1V79A 1FKXA 2PAJA 2WJEA 4B90A 3QY7A 3QY8A 2OOFA 4V1XA 1FWFC 2YXOA 3E74A 1FWAC 2R1MA 4DZIA 1YMYA 2GWGA 2R1PA 5FSEC 4UBPC 4DIAA 3IARA 1RJRA 3MPGA 1YIXA 1W1IE 4KF1A 3O7UA 4J35A 2VR2A 4P5UA 2QS8A 4PE8A 2QVNA 2OQLA 4H9ZA 4DNMA 3F2BA 4RDZA 4QS6A 3E2VA 1DPMA 4V1YA 3AU6A 4EPBC 4C65A 1EYWA 1EZ2A 2D2HA 3IRSA 3SO7A 3E3HA 2ANUA 1EJVC 3K4WA 2Z4GA 3T81A 3TNBA 3DC8A 1GKQA 4RDWA 1FWIC 4KEUA 2HNHA 4GBDA 4GYFA 4KETA 2I9UA 4JOMA 3URNA 3SFWA 4PCPA 2GWNA 2HBXA 3K5XA 4GY1A 1PTAA 4C6CA 4ERIA 3MTWA 1UBPC 2E25A 3K2GA 4LANA 4C6MA 4HK6A 1P6CA 1KRMA 4KQNA 2Z24A 3HPAA 4LCRA 2OGJA 2ZC1A 4C5ZA 4CEXC 4XD3A 1NFGA 1ZZMA 2Z00A 4HK5A 3F2DA 4AQLA 3F4CA 3WMLA 1FWCC 2EG7A 3UR2A 4C60A 2D2GA 1I0DA 3ISIX 4H9TA 3NQBA 3CS2A 2W9MA 3PNUA 3CAKA 4XAYA 4IFOA 3WZ0E 3LA4A 4CQCA 3FDKA 2VHLA 2DVXA 2QT3A 4ZSUA 3R0DA 4J5NA 1GKPA 1J6OA 4GOAA 2QPXA 1FWJC 4I6KA 1ADDA 4XAGA 4WHBA 2YB4A 3URQA 1UIPA 3IV8A 4ICMA 4XAZA 5G4HC 1KRCC 1KCXA 4R7WA 3LSCA 4YIWA 1VFLA 3EGJA 3S2MA 4LFYA 2GOKA 2PGFA 4XD4A 3D6NA 4RZBA 2D2JA 3TN3A 1R9YA 5AKQA 2GZXA 4IH3A 3UF9A 5A6TC 4ERAA 4GXWA 2PLMA 2Q01A 4DYKA 3GG7A 3AU2A 1POJA 1BF6A 1NDVA 3URAA 3GTHA 1A5NC 3F4DA 1J5SA 2HPIA 3QGAC 2EG8A 3ORWA 1A4LA 3T8LA 4H9UA 1O12A 4R85A 1EJRC 4NG3A 3TN4A 4NP7A 4GX9A 4IG2A 3A3XA 3MVTA 4Z42C 4C5YA 1R9XA 1A5LC 1RJPA 4LCSA 1YBQA 3GU2A 4G2DA 2UBPC 4MUPA 1FWGC 4C6JA 2AMXA 1RAKA 1QXLA 3B0XA 3ICJA 4WGXA 4C6QA 1EJTC 3F2CA 4F0SA 2AQVA 3JZEA 1M65A 3TN5A 4B91A 3G77A 4E3TA 3HTWA 3HM7A 4DLMA 3B40A 4BY3A 4QROA 4QTGA 2HPMA 4G7EB 4CEUC 1GKRA 3EWCA 4I6VA 3GU9A 1ITUA 2R1LA 1K6WA 2OODA 3MDUA 2I5GA 4H01A 2FTWA 4IGMA 3IJ6A 3MSRA 1XRTA 3NURA 2OB3A 2Z27A 2YZ5A 4KERA 3UBPC 2RAGA 2Z25A 2WM1A 1WXYA 4D8LA 4GX8A 3V7PA 2VM8A 4H00A 2R1NA 2EG6A 3FEQA 4C6LA 5FSDC 2FVKA 3A4JA 1UMLA 3MVIA 4GY7A 1WXZA 1EJWC 3LNPA 4IFKA 4C6KA 3LY0A 4H9MA 2VC7A 3RN6A 2PUZA 4PBEA 1E9ZB 4EPDC 3PBMA 3OQEA 3O0FA 4RDYA 1A4MA 4F0LA 3CJPA 3BE7A 3E0FA 2AQOA 5LXXA 4BKNA 2DVUA 4C6EA 4CNTA 1R9ZA 1HZYA 1V7AA 3S2JA 1E9YB 1FWHC 4ZSTA 1NDWA 4RDVA 4QRNA 2Y1HA 2VUNA 4IG2B 3S2NA 3A3WA 4C6PA 1FWEC 3UPMA 1V4YA 3GTXA 1QW7A 2O4MA 2Z2BA 4XAFA 3C86A 2BGNE 2F6KA 4C6NA 1JGMA 3PANA 3WYZA 2Z28A 4KEVA 4CNSA 4LALA 5E5CA 4NI8A 1M7JA 1A5MC 3URBA 3LGGA 3GRIA 4PCNA 2Z26A 4GC3A 1RK6A 1J6PA 3PAOA 2R1KA 4DI9A 4KESA 1V77A 4WVXA 2FVMA 4LAOA 2Z7GA 4C6BA 3MDWA 1XRFA 4IF2A 2VC5A 1RA5A 3MJMA 4C6OA 4C6FA 1NDZA 1XGEA 4CQBA 4CNUA 4H9XA 4IGNA 1K70A 2Z29A 3E0LA 3GU1A 3GIPA 4LCQA 4L9XA 3NEHA 3LS9A 2PGRA 4HA0A 3E38A 1EJXC 1M68A 1S3TC 2HQAA 4IFRA 1P1MA 5HMDA 4EP8C 1PO9A 3RYSA 4QS5A 1ONXA 4C6IA 3IPWA 2E1WA 2YB1A 4G7EA 2FTYA 4IFKB 2GSEA 4XD6A 1KRBC 1EF2A 4DI8A 3OU8A 4UB9A 4IQJA 1YRRA 5HMEA 4EPKA 3B0YA 4LAKA 4GZ7A 2P50A 4DLFA 1XWYA 3S2LA 2HBVA 2XIOA 3GTIA 3MKVA 2KAUC 4XD5A 3QY6A 4KIRA 2WJDA 4H9VA 3RHGA 2UZ9A 3S4TA 4F0RA 2FFIA 4OFCA 4R88A 1I0BA 4DZHA 3PNZA 3OOQA 2ICSA 1YBQB 4DO7A 1O5RA 2Q09A 2Z2AA 3LSBA 4H9YA 3GUWA 1A5OC 1P6BA 1POKA 3FDGA 2A3LA 2P53A 4AC7C 1RA0A 4BJHA 1J79A 3LGDA 4M51A 3OODA 4C6DA 2WJFA 3DUGA 3OJGA 1EJSC 2O4QA 3AUOA 3QGKC 4GY0A 4HJWA 1RJQA 1FKWA 3IGHX 3GIQA 3ID7A 1YNYA 3TN6A 1IE7C 2BB0A 4RE0A 1A5KC 4ERGA 4INFA 1PB0A 4LAMA 4PBFA 4B92A 3ITCA 1K1DA 1EJUC 1FWDC 1UIOA 4TQTA 3GTFA 3IACA 2ADAA 1NDYA 4L6DA 3UR5A 3N2CA 5CH9A 4J2MA 2DVTA 3DCPA 3LU2A 2IMRA 4EPEC 3OVGA 1ONWA 4QSFA 4GK8A 3T1GA 3KM8A 1KRAC 4B3ZA 4KEZA 4CQDA 1V51A 1ITQA 1RK5A 1PSCA 2G3FA 3EWDA 5HMFA 4HK7A 4LH8A
chains in the Genus database with same CATH superfamily
3R0KA 1NFPA 3N9KA 4ZE5A 3R1ZA 3QKZA 1FWBC 3N2MA 1V79A 2B81A 3BANA 1D9EA 3P67A 1XV8A 1KFEA 2J6VA 2RH9A 2ZUSA 3DFYA 1ZJIA 3QY8A 4B3KA 4E8DA 2G37A 4S3JA 1ZJBA 3MCOA 4UQEA 2R1PA 3QQ0A 2I17A 3MANA 2OJPA 3LPFA 5CZ0A 2QS8A 1E0TA 3CLWA 2XVLA 4QDWA 2QVNA 1XIGA 1HKWA 2QUTA 3M6YA 5B7YA 1UKOA 5I3HA 4MKVA 1SQ7A 2ZZ2A 1PKNA 3WLJA 3R4IA 4D6CA 5ABGA 5E70A 2E5DA 1EZ2A 3CZJA 3IRSA 3KTXA 3RPDA 3NUKA 2WMKA 2MANA 1RVGA 5BYWA 1R3RA 5CPOA 2HRWA 4Q4KA 1JZ8A 1BG4A 1PTAA 2WVSA 3RILA 1FXQA 1G7UA 3ZJ7A 2Z1SA 2ACSA 5CGTA 2OGJA 3W02A 1BTCA 5D9MA 2V3FA 2W3ZA 4XD3A 4GVIA 3WLQA 4WR3A 3UR7A 1RXOB 4HPXA 4H7VA 4FZIA 3LXCA 5HNRA 3WNOA 1MW1A 3I7RA 1XCFA 2QT3A 4WQ6A 3QTGA 4MKNA 4F0MA 5DMYA 8RUCA 2QPXA 2WNWA 1FWJC 2WCGA 4HN8A 3SBFA 1TG7A 5CG7A 4XAZA 4LAZA 1WAWA 2FPVA 4DF2A 2CXEA 2O0TA 1AD4A 4MYAA 1E1EA 4RZBA 5AKQA 3TJIA 2H9AA 1EYEA 2JEQA 1CLKA 4MB5A 1PX4A 2AL2B 3S5NA 4L65A 4AX6A 1XYAA 3S1XA 4MMWA 1YKWA 1ZFJA 1UD2A 5IBXA 2EG8A 3KW3A 1I1XA 3COTA 1QFEA 3T8LA 3UPBA 2ACRA 2IQTA 3Q65A 2XGBA 4O1AA 5REQB 4GNJA 4GD0A 4MB3A 4JIEA 4S3CA 2WVUA 3WQEA 1PX8A 2VC9A 3B0XA 3ICJA 1N2VA 3AXKA 1TV4A 3AS3A 2WWDA 1E0XA 3CUIA 3H23A 1QMLA 2CWNA 2WJZA 1DE6A 1GQJA 4Y9PA 1J9YA 3OA3A 3LCGA 3QW3A 3HM7A 1WDWA 4QTGA 4PMNA 1N55A 3EAUA 1DJXA 4JKMA 3L5AA 3RR1A 4J3UA 2JALA 1ITUA 3L65A 3LHUA 1XH1A 3LI0A 3NZQA 1HJWA 2FIQA 1TQJA 4J2PA 1CB7B 2X2GA 1XRTA 1EB3A 3LMZA 4IWWA 3ZMRA 3BAKA 1KLYA 2QCCA 3HV9A 3CV6A 4MAVA 3TLQA 3W22A 4E8CA 1GORA 4IL0A 4Z2IA 4DBSA 1NY1A 2OLSA 5I7GA 1F8IA 1K8ZA 1XYMA 4NNAA 3IJ9A 4URIA 3AYSA 2C3ZA 2VGIA 4AZCA 2ZXBA 1EJWC 1I75A 1ZB5A 5G5IA 4RKAA 5HULA 1ZENA 4XWUA 2VGBA 2KX9A 1E9ZB 3PBMA 3KBNA 4QP0A 2HMCA 6ENLA 3V3WA 4U5KA 4IICA 2IPGA 3U9IA 5DN1A 3GVRA 2VUNA 4KKXA 2E6DA 4DO6A 3VX1A 1EOMA 1FWEC 2XZ7A 3GTXA 2WZHA 4AZHA 2BG5A 2RUSA 5G1MA 3GHTA 4I5XA 5EB8A 3SAZA 2I9EA 2X2YA 2WMGA 3URBA 2WSQA 2C0HA 1KM4A 4FP1A 4A3HA 1G0CA 1R3SA 2GVLA 2E28A 4O1FA 1JD7A 3ZVHB 3HPFA 3GG1A 3SJ3A 2DIKA 2W91A 4ZOBA 3EB4A 5HR7A 4JQ2A 3UXDA 4JYFA 5KINA 3WH5A 4N42A 4EACA 3ZIZA 2V2CA 2D23A 3C2EA 1ONXA 1VEOA 3KDOA 3WJSA 1EF2A 2X09A 1AH3A 1G4PA 3MCNA 2ZDSA 1JGIA 4QE1A 3ITGA 1B57A 1SR9A 4NJGA 4TU1A 1R38A 1PKLA 3B8DA 5KZEA 5D2TA 2KAUC 5AFDA 1LG2A 1P0KA 9XIMA 1BSIA 4H8HA 3BLIA 2CFFA 4I5UA 4DAFA 3O3RA 5K9DA 1FHVA 4DZHA 3ITOA 1YBQB 4IJBA 1Q7ZA 2WSPA 2XM2A 1SMAA 1EHAA 3CQ0A 2VZUA 2WPGA 2ATSA 2WWCA 1RA0A 1J96A 1QOQA 4Q7IA 2VEMA 4C6DA 3E5PA 3VIIA 3W70A 2PDYA 3EYPA 2O4QA 4YNGA 1KC7A 5F4XA 1BFNA 2BLEA 1TA3A 4S3GA 2RKXA 4YTQA 3WQVA 2EPKX 1HX0A 3VYLA 1S46A 2DORA 3DI1A 1W8SA 2C1IA 1A53A 3ITCA 1FWDC 4IIBA 1O94A 1TV3A 3AIRA 3CPUA 1DEDA 1GOIA 4FPSA 3UR5A 4ZQPA 3ZM8A 1NWSA 1V6VA 3DI0A 2DVTA 5HR6A 4EPEC 3A24A 4NRSA 4QQ3A 2BODX 2PDKA 1MRQA 2V5CA 1XFBA 5A6BA 3IIZA 3KRUA 1N8FA 3ZVHA 5F7UA 1SSGA 2GOUA 3CL7A 1O6IA 1TX2A 3RCMA 3M0KA 2CLFA 5A8PA 1P1XA 3RX4A 4CUCA 2YDRA 1V3MA 4M7TA 2Y4SA 2AGTA 4DO4A 4DZ5A 1V3HA 3TW6A 3BOFA 1H09A 1US0A 3NJ3A 1VPXA 3RNDA 1QPOA 2VR2A 1TPUA 1D8WA 3QH2A 1CNVA 1AFSA 4DWSB 4DNMA 1RY0A 3BCDA 3KEHA 2ZIDA 4W9TA 1GVIA 5AOUA 4W4QA 4DQWA 3FFSA 2DT0A 4BQ2A 2YCEA 5IFTA 4N7QA 2CITA 3VOCA 1FWIC 3A21A 3L2MA 1JCJA 4GQRA 3URNA 2PB1A 5G2HA 3K5XA 4GY1A 3W6MA 4HK6A 2Z24A 1N8IA 3P60A 4IGHA 3AIQA 3E0IA 5DF0A 1XYCA 3PSVA 1L0PA 1CXIA 3UWVA 3ZYZA 4XG1A 2D2GA 1G1YA 2X1IA 4O10A 3TU9A 3ES8A 3HFTA 2CIPA 2YZRA 5I77A 4OKDA 4MTVA 4HOZA 7PTDA 1GEHA 4A3YA 3TCEA 3V5OA 3UZWA 3DKLA 4DEFA 3NGFA 1B5TA 1OX6A 1TR9A 4L4LA 4A6GA 4UFLA 1W37A 2PGFA 4XD4A 1BYAA 3P80A 4JTIA 1OX5A 1SW7A 4KH2A 4IP4A 5HMSA 1X1NA 3TDFA 4DYKA 1BD0A 3LCLA 3E0WA 2QJJA 2GJPA 1XKYA 2CLKA 2J7GA 1IHIA 3F4DA 2PTWA 3RLUA 3U57A 3LHTA 3R5EA 2R94A 4CNOA 4AW7A 5ABTA 2XU2A 3ERPA 2ZRWA 4PB5A 5C2CA 3CPGA 3KTCA 2VT0A 3XIMA 1WKYA 2EJAA 3IUIA 4QE4A 1OADA 2UBPC 2PPGA 4AUBA 2EPNA 1K02A 2NWRA 1IEIA 5CSRA 5CAHA 4PTMA 3MKKA 1J0IA 3H24A 3TN5A 1IR1A 5E6YA 4GG9A 8TIMA 3HTWA 4GI8A 2P10A 1VYPX 3CWNA 1IZKA 3B40A 1CXEA 3N19B 1BYCA 4KWWA 4M1RA 2QIIA 2PC8A 1DTUA 1GKRA 5EGRA 1Q2SA 3TK7A 4R9OA 3CQJA 3TA6A 2Y8KA 2Z6IA 3ITXA 1UZ1A 3ITYA 2PCQA 5LIYX 4O19A 1LL4A 2QCGA 4IQLA 2WBGA 1ZU8A 3NL5A 5AHIA 1AQFA 3WN6A 2Y7GA 5F4SA 1NELA 1Q2RA 4XTDA 3WDQA 2YGYA 2EAWA 2NLYA 2VM8A 3AO0A 4H00A 2DQXA 1OGSA 2EPMX 2FDMA 1A3WA 3IGUA 3ZT5A 4GJJA 4TX8A 1ONEA 4GXMA 4U2YA 2WYSA 1G67A 3M0VA 2HV5A 3DHFA 1HL8A 4LUSB 2CU0A 2ZOXA 2E68A 4XIAA 1F07A 3UFYA 5FESA 3CJPA 1ZY9A 1EBGA 4JX4A 1FFRA 4FB7A 4EOUA 1U2YA 4C6EA 4CNTA 4C7DA 3NTYA 2DZPA 1FWHC 4YLWA 3RMEA 3OBEA 5G2WA 2BNJA 1UP0A 3NSMA 3M5ZA 1EH9A 5CPNA 3VOFA 5CC5A 1TX0A 2J9ZA 3KVLA 3DG7A 1CT5A 2OSYA 4C6NA 3VX0A 1AW1A 1V08A 3WLSA 1BKSA 2JIWA 3QMSA 3AAMA 4ADSA 4GNVA 4V28A 4JY9A 1KTCA 2DJXA 2X0YA 2UY3A 3L4YA 1HKJA 3SN0A 3AOFA 2JBMA 1TIWA 3JUGA 3KS6A 4DJDD 1UP3A 1VPQA 3VNIA 1XC4A 1VFFA 5HNNA 5DANA 4ALDA 1XSIA 4N6EA 1IXNA 2P1FA 2ISSA 3C5QA 3TOPA 2GDUA 3PTQA 1BEUA 1UZ4A 1VAHA 4Y9MA 3W7KA 4U10A 2NT0A 1CDGA 3IWPA 3VIOA 3VGFA 4LYRA 3AIWA 1KRBC 1DJQA 1YE6A 3A9BA 3GXMA 2X05A 1BGGA 4LV4A 2VEIA 5GPRA 4MY9A 5MF5A 4KIRA 1GVOA 4KFOA 4NX5A 3S4TA 1WPCA 1XI3A 4IP5A 1DQUA 1J01A 5CPLA 4K37A 1Q63A 3PNZA 3P74A 2TMDA 3U6WA 2ALRA 2ISFA 4NAEB 2P53A 1AZ2A 1VHNA 3SUTA 2GVEA 2RGMA 1EOKA 1W9PA 4LRSA 4TXEA 1EGZA 4AXNA 3N29A 3U5YA 4FNQA 3GR7A 2VDHA 4DM1A 1OFRA 4N02A 3N1AA 1ZP3A 1JD9A 4WGHA 2W6RA 1J8VA 2J66A 2WMHA 4AVFA 4LS0A 1QNPA 3SGUA 3NQ6A 1UR0A 1WDPA 4MWAC 2CW6A 1KM3A 2B31A 4KCVA 3L4TA 1US2A 2OSWA 1HJQA 3ARXA 1ONWA 3BTNA 4W7VA 3CHDA 5H6HA 2PWGA 3T1GA 2PWFA 2ZX6A 4TV5A 4FX7A 2BBFA 2VVNA 1UKPA 1A49A 2ZTJA 1NF7A 1V51A 1P0NA 3D47A 3P7YA 1VC4A 3C4UA 4ZB2A 1XIMA 4ZQNA 2W61A 4NNBA 4N0RA 3L0KA 2PAJA 3OW1A 1WCGA 4KFPA 4MOZA 6CGTA 1HKVA 1YMYA 5FA5A 1XBXA 5I00A 1E6SM 2HXUA 4KF1A 5C55A 4P5UA 4PE8A 5DCDA 2C15A 2EPLX 4WKFA 6ALDA 2HROA 2INEA 3LEPA 1FP9A 5H8PA 3FXGA 1Z32X 1TPEA 4HTBA 3QPYA 2VFEA 3AMCA 1E15A 3BCFA 4ML4A 5KSWA 1B54A 3JRKA 3KCLA 4XSMA 2GGEA 1KB3A 3QPZA 3T81A 2Z4GA 5K4XA 1H7WA 4A2SA 5FEXA 3CHVA 3SFWA 2DZVA 3LTYA 3REQB 4KQNA 3AISA 3GVWA 4C5ZA 2VNCA 3IUHA 1E0UA 3FAWA 5E6ZA 2ZUNA 3F4CA 3CV7A 1JDDA 1QT1A 3TVAA 2QCLA 3NAVA 4NT0A 4H9TA 2C8NA 3VO0A 3GW3A 1W9XA 4ZSUA 3TTQA 1XIBA 4WY0F 1I2OA 1DORA 3DFPA 1XRVA 3T09A 1KXTA 4Z0JA 2YB4A 4HSNA 1WOBA 4P8WA 1F6PA 3IV8A 4QNWA 1KCXA 4PRTA 2QMJA 3PBYA 4Y9AA 5A6TC 1E0WA 2Y61A 2V3EA 4EAMA 3GG7A 3AHYA 3GHUA 4QEHA 3EDFA 4H83A 3URAA 3WD1A 2CPUA 2XH2A 4E4FA 1E72M 2AL2A 2XVNA 1CGXA 1OFPA 4NZ4A 1J0KA 5D09A 3GK0A 1L6GA 3W7LA 2QCMA 3MVTA 1B31A 1GVQA 4H1ZA 1XLAA 4J3WA 4QXIA 3TQPA 2E5CA 3TW7A 4WSHA 1X39A 2EKCA 3UCCA 2DT1A 4FS9A 1Q8JA 3F5JA 3I3DA 4KW2A 4I9JA 1VGAA 2GGHA 3IJDA 4JCLA 2PTDA 2V0TA 4RLIA 5EFFA 3W71A 1LWJA 5JBEA 1N8WA 1E43A 1TA3B 4NJKA 4MHBA 4IMCA 2J9YA 1K8CA 4NXSA 2V2DA 2Z27A 1AMYA 1EZWA 2NV1A 1WUFA 4WLCA 3A64A 4IJRA 3WFZA 1H7RA 3QV8A 2PZ0A 5EMYA 3TZFA 4K2SA 4C6LA 1W8GA 1VBRA 1YNPA 4O1DA 5C9UA 4B2DD 4F3HA 4I7WA 3TR9A 1H7PA 3N3TA 1GCYA 4Q4MA 3O0FA 4RDYA 2DZUA 2V67A 3I7SA 5T91A 3S1VA 3R13A 4Y8EA 3DHUA 1R85A 3GD6A 3FS2A 4EIVA 1PKMA 3GC5A 4D2JA 1H5YA 4ZSTA 4A8RA 2ZXDA 4V15A 1V3KA 4IG2B 1NWTA 1JXJA 3CLMA 1ZTVA 3QYSA 1TZ7A 1KNWA 3BLEA 1UUQA 4YWSA 2Y8VA 4F9JA 2O4MA 5C54A 1XW8A 3KVJA 3VKJA 2OEJA 3QMRA 1PYFA 3WLLA 2VWTA 1CIUA 2A3CA 3W2UA 3BSGA 1R2RA 4ECLA 1E1CB 3AUJA 4DJFA 4PUJA 1DWJM 1I6NA 4HBKA 4LS2A 3TOYA 3EKGA 3N2BA 5U4NA 1LRTA 3B06A 2IPFA 3R79A 3RYSA 1A0DA 3C0QA 2VUYA 1IGWA 3TMQA 5BXTA 3KRZA 2I7GA 2FHCA 4R27A 4MKSA 2DZBA 2OOGA 1XLLA 4XBKA 4H41A 2GGIA 3BO9A 3W84A 4HN4A 3BH4A 2QPUA 4AZ5A 5LIKX 1I8JA 3H4GA 2BY1A 2BVYA 4O54A 3GTNA 3U4FA 1NIUA 4RR4A 1A5OC 3W7RA 4A3UA 1H1NA 2YA0A 1UUMA 2ZXQA 1OWQA 5BZAA 4BJHA 1ADOA 1OQFA 3BMVA 3PF3A 4S23A 3AFBA 3GR8A 4LXFA 3CWOX 5SWUA 5DRIA 1Y65A 1P0EA 3C8FA 2XM1A 3NM1A 4AEEA 2QCDA 1YYAA 1GTHA 1RJQA 3NQAA 1L6WA 3MMTA 3PC0A 4O52A 4NAFB 4TOQA 2NVDA 4RE0A 3HF3A 2PBGA 3WQ8A 4LNYA 4MJ4A 1S1RA 4HNUA 2NQ5A 2P8BA 2V8ZA 3ZR6A 1EJUC 3IACA 3O05A 1FBAA 3WQOA 2OTDA 4UTHA 1JDAA 3QZAA 5EMKA 1V6YA 3MA8A 3ARTA 4WF7A 3NA8A 2VX5A 2EPOA 6XIAA 1RR2A 1GYNA 2C0AA 3T0TA 2PODA 4D1JA 3HMJG 3MUY1 1A0CA 3NYDA 4TV6A 1TCDA 3WBWA 3DBPA 2DT2A 5CPSA 2R1MA 1J0HA 3LZ3A 1ZUAX 2D20A 5DMLA 1RJRA 3QV6A 3J7HA 4B9YA 2OT1A 3SECA 3WBXA 2OLAA 1WYIA 5A5WA 1AQHA 3NGJA 4L61A 2OMAA 5TNVA 3F2BA 4AY8A 4EPBC 1D2KA 2HWGA 4DWSA 3SO7A 4WEVX 3TNBA 1WDDA 4FR6A 2ZFAA 1UR1A 1FCQA 4KETA 1FX6A 4GYFA 3RITA 3UWYA 2NT1A 1UCWA 2ZICA 1OD8A 1MXDA 2Z6JA 2E25A 3HO8A 5F1UA 5AHLA 2IW0A 5AB3A 4LCRA 3V1HA 3UGRA 1PZ0A 3PULA 4IPJA 4CEXC 1L2UA 2Z00A 3VK5A 1E4IA 3GNOA 4RE3A 1ICPA 4P7QA 3RLHA 1O7AA 2ZYFA 3VNLA 4ZO7A 1SYTA 3BLKA 1S5TA 3L0GA 1XPGA 3N13A 1EBHA 2DJLA 3UYIA 3HOJA 5GNZA 3H26A 5HWJA 3BC9A 2FGZA 5BOOA 5G4HC 4N4PA 4C91A 1F5ZA 1NQKA 1B3VA 5DXYA 2XFWA 1TV7A 5EKYA 1BVNP 1WOAA 2D2JA 2OWXA 2ZE0A 1W6TA 4GXWA 2IXVA 3CL8A 5FAGA 4XUGA 5C5YA 5D2XA 4MNKA 2FGLA 3V1PA 2Y7DA 3G8RA 3CUJA 4U2ZA 1UJPA 3OZYA 4JIRA 4HOWA 4AX7A 3W7PA 3G3MA 2H9AB 5C0QA 1GHRA 1V0NA 3WDJA 2OELA 3A3XA 1OEPA 5D37A 5LIWX 2YCJA 1EUNA 4I8DA 1JYNA 1RCOB 4XZHA 5DELA 3AS2A 1OB0A 1ZAIA 2F7FA 2WLYA 1J0YA 1HIZA 4IPNB 1GG0A 2ZA2A 3GKFA 2ZX8A 1HJVA 3FX4A 4QJ3B 3STCA 4IPPA 3EEZA 4GJ1A 1TTQA 1OC7A 2PDPA 3BOXA 3GNNA 5DY2A 3TYCA 4ZFMA 4RZ4A 5D04C 3R10A 3MDUA 3M44A 4D6FA 2ZA1A 2J88A 2WHJA 5D32A 4KPLA 1XINA 4X0VA 1XH2A 1WX0A 3W2NA 2JE8A 4OUEA 4KERA 3ZR4A 2Z25A 3AWOA 4KT2A 2QJHA 4PUDA 4K3ZA 3KDNA 2X1SA 3SCUA 3VD7A 4JKLA 3QC3A 4UFIA 2OKTA 1M7OA 3SSJA 3VINA 3LY0A 2FPYA 5DEZA 4Z2HA 3H2NA 3WJYA 3SIZA 3ARQA 4AU0A 2OG9A 4N9BA 1KFLA 1RZMA 5I24A 1D8CA 1WBHA 2Y89A 3PZMA 4LVAA 3CQIA 2CHOA 4P7RA 1UH3A 3WNMA 1HZYA 1QI4A 4L1WA 3W88A 3BG3A 3S83A 4DYJA 4RDVA 1T99A 2Y1HA 4H7ZA 1NWRA 1XLDA 2DZWA 1QVBA 4QHRA 3EPMA 2Z2BA 3U2ZA 1FWSA 2WZTA 3A5VA 1JGMA 4CNSA 1VKFA 4GUHA 1M7JA 1EDGA 2CWXA 3MC5A 4LY8A 1GVSA 4M82A 1J6PA 1OYBA 4XBJA 1GTEA 2ABBA 2BVDA 2FHFA 3W6LA 5I3GA 3IGXA 1E4NA 1I2NA 1DVJA 1TWZA 2FVMA 3O1NA 2VZOA 3NOYA 1XGEA 3DC0A 4GCAA 3CO8A 4Q33A 2YSWA 4AVOA 1VFSA 1X7FA 2IQ0A 2WKJA 3FJ6A 3R25A 2ABAA 2V38A 1P4CA 3H54A 3WH9A 2QUNA 4C6IA 4G7EA 2CKRA 4JX5A 2C18A 2J6XA 3ABQA 3SGZA 2F84A 4R9XA 1XFCA 1GVFA 1QI0A 2HISA 4HZ7A 4H9VA 3RHGA 3Q58A 4F0RA 3QRHA 2NXIA 3IEBA 3LCWA 3RCNA 3QC0A 2C19A 1RCXB 1JYVA 3SR7A 8XIAA 1W3JA 2PDMA 4KIEA 2WMJA 4DYEA 3FDGA 3H4WA 4AC7C 1UJQA 1T96A 3CYJA 4IMEA 1KM6A 4MDOA 1TSIA 2D1ZA 1WP6A 1H0GA 2CLPA 1F2JA 3AUOA 4FALA 4F48A 2OKOA 4UTMA 1JZ2A 4OV9A 2FH8A 4Q6XA 2CETA 5D30A 4LAMA 5M5DA 5FJRA 2V30A 5GJMA 4FXRA 3VIFA 4R3UA 4J2MA 3MUCA 4G1KA 4IX2A 2PGWA 3N4EA 4IPIA 4QSFA 1S5NA 1KRAC 4K68A 4B3ZA 3VMOA 4WJEA 3FVMA 1JCYA 1ADSA 2PWVA 2DEPA 3GC4A 5F2LA 3QW4B 3LLDA 4LEFA 1R0MA 3CM4A 2GYIA 1I9CB 3TMLA 2VFIA 4Q4PA 1N7KA 3H70A 3W38A 5T9CE 4UBPC 4JHZA 3WX7A 3WK0A 4QSHA 2O55A 4J35A 1Y5WA 2DIJA 4QLLA 4XUYA 1FOBA 1H7XA 1O1HA 3NZRA 3P84A 5HQLA 1TVPA 3CAVA 4G56A 4PCFA 1Q6RA 4RDZA 4HNCA 2ZRZA 4NAFA 4HIBA 3CUGA 2OPJA 3UJFA 4AZIA 4BWLA 1TUFA 2BY3A 2XN2A 3CO4A 3USZA 3N2OA 4XZNX 2V5DA 2PF8A 4KEUA 2P0IA 5T8GA 3JR2A 1W1B1 3W74A 5GNXA 4DUOA 1JQXA 4FXFA 2CESA 1UQYA 1J5TA 3K2GA 4C6MA 4DXVA 3HPAA 4GPNA 3DXIA 3RPTA 1BRLA 5M2FX 1X8FA 1UD3A 1F4HA 2DUXA 1SO5A 1ZZMA 3BV7A 1FVPA 4HK5A 5I79A 1UWRA 4C7FA 1S39A 1JZ5A 4DM2A 2EG7A 4J3XA 4ZO9A 1VENA 3NQBA 2W9MA 2DH2A 3UD6A 4FSAA 1UWUA 2NVCA 3CIXA 5A6JA 4YYFA 3MSDA 4L4OA 4AZCB 1LORA 3G1HA 3RJYA 3VVGA 3ZSSA 1DOSA 1G7VA 1JRCA 3N2XA 3AIVA 3M16A 3MKCA 3L4ZA 3EX2A 2FYMA 3C52A 3IIVA 4AD5A 3B9NA 4YVPA 1R2TA 2ONEA 1XG3A 1EPVA 4A29A 3B3DA 3NXLA 1RQBA 3WF3A 1KLZA 2G8ZA 3WFAA 3ARZA 3GO2A 1IQ8A 3MB9A 3EOUA 5HWMA 1YBQA 3ARSA 3HFYA 4MIMA 1UROA 3WLIA 4XSLA 1UBSA 3S1UA 5HJYA 3DYOA 2V82A 4V33A 3DESA 1O66A 1MFVA 2X41A 3G1YA 3L68A 1PAMA 2J78A 3IVSA 3WCZA 3SY5A 4MLRA 2BXYA 4AMAA 1NVMA 4BHYA 3MQTA 1MVYA 1AQ0A 2OT0A 3KBJA 4DJED 4P8VA 3WUEA 3R6IA 1B30A 3TTSA 5J5RA 7REQB 1E5NA 2OQYA 2WLZA 3AMKA 2PDWA 3H6OA 1B3XA 3BOLA 4NY2A 4LY4A 3MCMA 3VDAA 4O1EA 3CASA 4MJMA 3I6TA 4O15A 3LMYA 3VZXA 2O9TA 3GVGA 4L64A 3WBAA 2ZZ3A 4W85A 1CXFA 3N17A 3H2EA 4RX0A 4KRTA 4HHPA 4JX6A 3T0AA 1WXZA 5LIXX 4GMEA 1Q7MA 2D69A 1NOFA 3VIMA 1MXGA 3GHSA 5KZDA 4AWUA 2EJ1A 4IT1A 4A8LA 5BCAA 2DV0A 2VURA 3LXBA 1U1HA 5LYRA 1X1ZA 4MZ1A 1XSJA 4Z1BA 2BY2A 1MO0A 1F76A 3O6DA 1E9YB 4OV4A 3KVMA 2HSAA 1Q66A 1UHVA 4US5A 4FLSA 1EEPA 3DFTA 3EKLA 5JIWA 1AL8A 3IK2A 4XAFA 1LLWA 1LCOA 1G4EA 2I5QA 3U3HA 4Q8WA 3W9ZA 5XIMA 5E09A 1K77A 3AIEA 4WVXA 3QHOA 5GJPA 3NQVA 1LJYA 3FN9A 2CCRA 4FAMA 5E0KA 1RA5A 1U22A 4Y9NA 5FKYA 3DX5A 3JS3A 4LNCA 2D73A 5EMUA 3M0JA 3GU1A 4L9XA 2HS8A 1MW2A 3ANYA 2ZZ7A 1LL6A 4W8AA 5DT7A 1WBJA 3UA4A 1M7PA 4K38A 3AZSA 5D05A 1IT7A 2VO5A 2X42A 1IGSA 4HNLA 3UG3A 2IS7A 1S5WA 3K8MA 4QS5A 3IPWA 2FTYA 3AIUA 4B4HA 2GSEA 4DI8A 3GIYA 3PPHA 1DJYA 4LAKA 1FUYA 5A8NA 4HU8A 1XUZA 4ADUA 3R2GA 4MFEA 1NEYA 2BGQA 4U3CA 3MKVA 1IF2A 4D6EA 1XLBA 4C1KA 4UTKA 3U0HA 2NQZA 1I0BA 3A13A 1PL9A 2POZA 1X6LA 4IZGA 2YDSA 3BK0A 2OZ3A 1UW9A 2PS2A 2XH4A 4LYPA 1KO0A 3LRMA 5ABEA 5I23A 1JCLA 2NX1A 5CPQA 4XZ9A 4UZUA 2R8WA 2G4JA 4Q32A 2RDWA 1RV8A 1A47A 1TV2A 4JNYA 5IM51 5DO8A 3G24A 5JVLA 2YJQA 2X30A 1A80A 4QG6A 2ATMA 3EDEA 4D8AA 4IMAA 3W1PA 3OLEA 4O4VA 3N6HA 3ZJKA 4EVZA 2CKSA 3VDGA 3ARUA 3WENA 4L6DA 3EX6A 4LF1A 4X63A 5CH9A 3GXIA 1YPFA 4WUIA 1X1OA 3TH6A 2PDFA 1XYFA 4Y9OA 1E0VA 4QEEA 2PGEA 4JFWA 4P8XA 1PSCA 3IIPA 2NZLA 3HGSA 5DX7A 1F9CA 2FMOA 1X8CA 4M0XA 3PZTA 2UY5A 3SRHA 4NHVA 3M7SA 3VZYA 3THQA 3BZJA 1E56A 4LVGA 4FXJA 3GVQA 1GQLA 1JPMA 1H49A 3B9OA 2VJXA 3O7UA 3KHDA 3KZPA 1VBUA 3NQ7A 2A5HA 2VZTA 4DNHA 2PWDA 2WK2A 3GDLA 1YXCA 3VOHA 3SW6A 3ZOAA 1QHOA 3O15A 3GW0A 4MZYA 3II1A 5AC6A 3VCRA 1B90A 3I7QA 3DFSA 1XLFA 3HQPA 3KBWA 3VAVA 3DC8A 3TC6A 4ZXOA 2VCBA 1MQPA 4X9SA 1JCTA 1R3QA 1CXKA 3G6LA 1KBBA 2GWNA 5EBUA 1S2AA 3S0CA 3ENLA 2A6LA 1OCBA 2C16A 4ORMA 5D2YA 3SM0A 1NOWA 1B4KA 1OGGA 4BQ3A 3UXAA 1OFDA 3V4BA 4WZHA 2YBVA 1TB3A 5JBDA 2I16A 3ISIX 4PEEA 3GYCA 3WZ0E 1UC5A 2Z1BA 3UT0A 3FDKA 1BYBA 2ZTKA 1CGUA 1CYGA 3FA5A 1E6QM 5BMXA 1KV5A 3KBSA 4WJXA 4H04A 1DIDA 5ECVA 1T6MA 2Q02A 1W3TA 1XD1A 4AZBA 2E6AA 2VEPA 3VFLA 1XISA 4GO8A 5HNTA 3BJSA 3CC1A 3OZPA 3WEMA 3W2KA 4I8YA 1HXJA 3S1GA 1BF6A 3AMGA 3PWAA 2J27A 1RPXA 3MBDA 3B8TA 6XIMA 1V3JA 3TYEA 4FA3A 1QPNA 4NZ5A 3UCQA 8CGTA 4H6QA 1DXEA 1ZSXA 1PYMA 4HNTA 2O9PA 3VIKA 2WMIB 1Q6OA 2YW3A 3M46A 4AD2A 4EXAA 2VEKA 2PE4A 3UYCA 1WDRA 4E3TA 4HQVA 1MXSA 1LTDA 3R58A 4FHAA 1W17A 3KOFA 2ACQA 4M6QA 4G7EB 1FA2A 4IIFA 5J8LA 1J0JA 2V9DA 5IFPA 3VU2A 4R5EA 4HHMA 2HVOA 1MEHA 4H01A 5DCBA 3CWHA 1PUDA 3E9AA 3OIHA 2JIEA 3CUFA 3M5XA 3BG5A 1PV8A 3ZO9A 3MUXA 2MUCA 4LUIA 3MWAA 2Y62A 1W5QA 4E6MA 4GYPC 3LX9A 4D8LA 1W5MA 4S39A 3TTYA 2X0HA 2ZQ0A 1OYAA 5JQ9A 1M53A 4REQA 1C7SA 2ZRVA 1T7LA 3V5CA 5FEZA 4JQAA 2YDAA 3WF4A 3TROA 2W67A 4LJ3A 5A94A 2CZFA 4C7GA 4W5ZA 5HXMA 3TXZA 1XIFA 3AXIA 3GFZA 2OWWA 1W54A 4LUSA 5HAOA 2D0FA 5C9XA 4X9YA 1E40A 1KFWA 1HN1A 2PRMA 3BW4A 2J24A 4PSRA 3T6CA 4S3BA 3FKRA 2DUAA 4FLRA 4GUJA 4LVDA 3PFRA 1DV7A 2VZVA 3D5HA 1LBLA 3K4DA 3R8HA 1ODZA 1GK8A 4JDYA 3ATZA 1PVNA 5KITA 4HNVA 4NZ1A 4KEVA 1XIJA 2OEMA 3QOKA 3I6EA 1O1ZA 4NASA 4ZQMA 4K1GA 4NIRA 2FFCA 1KFCA 2F61A 2PDIA 2PWEA 2WZMA 4OECA 3N9SA 3IJIA 2QKFA 3LV6A 1PCKA 4FNTA 3NR0A 4KGJA 4UMBA 5CBJA 2B0MA 1UWAA 3ZQ9A 1DWHM 4CNUA 3GLCA 3GR4A 2XVGA 1AZ1A 2OZ8A 3B8VA 3M5YA 5F4WA 2H8XA 1EHNA 1R3WA 2WNQA 4RUBA 2G50A 2V3GA 5AZ0A 5M3WA 4Q22A 3APTA 2NQ9A 3NVTA 1QI2A 1M7XA 3UZJA 1SFTA 4BI7A 2BXVA 2J77A 1YRRA 1G69A 5HA7A 5HMEA 2W63A 3PFMA 4HA4A 4ZOAA 1QUMA 1H0IA 4X61A 1KTBA 3DYPA 4HZMA 4Q8NA 4ZOEA 3B0UX 2ZUMA 3M4HA 4YN5A 2NXHA 3RU6A 2VENA 4KCUA 3STGA 4QAIA 1SZNA 5HK4A 3SZ8A 1W2VA 1W5NA 3R43A 3QFEA 3WEZA 2NW0A 4L56A 5I5RA 3E49A 3FW6A 1W3LA 1KQYA 3FIGA 3HMCA 5C8BB 1HKMA 1AQMA 1K9EA 3THCA 1JYWA 1TZ9A 2ZCGA 4GY0A 4POCA 2BOGX 2WKLA 1PXGA 5EMMA 3GIQA 3LXAA 3UY7A 4UQDA 4INFA 1ME9A 5JBFA 4PBFA 3ZXWA 1R3VA 1W9BM 4OT7A 4ZB0A 4AYSA 4ZMGA 5CBIA 3KZSA 1UIOA 4TQTA 4IJCA 3VD9A 1AL7A 5F2MA 2QJIA 2IMRA 1S38A 1W5OA 2BHUA 3STEA 2VL4A 1EA9C 1SJCA 1WZLA 3OLDA 7TAAA 2NUXA 4RJEA 3DZ1A 4RV8A 2OX1A 2G3FA 2XGZA 3H2CA 1MNZA 3NQCA 4LH8A 4RXFA 1YDOA 3P2VA 2IKJA 4BQ4A 4F0HA 3MYOA 3PPGA 1X7IA 1MUWA 2YXOA 5ENLA 2E8ZA 5B7ZA 1IXQA 1IEQA 5FSEC 4PMVA 1Q65A 4TMCA 4H6KA 4BR1A 3PWIA 2XIJA 2EBNA 4NX0A 3WK1A 3R8RA 1T8QA 3N12A 1KXVA 3PZNA 2V63A 3P82A 3WK2A 3RJXA 2QCFA 2XSAA 5E1QA 3PPCA 2XG9A 3HPXA 1GKQA 4JTUA 3BV4A 1ECQA 1XDMA 2DZSA 3LI1A 1TPB1 4PCPA 5G4WA 3PM6A 3CB8A 2EQDA 5BOFA 5FJIA 4J1OA 4A8NA 3VD3A 3VUPA 3MMWA 4XIMA 3FEMA 4OBRA 5K7JA 3NQ2A 2INZA 3NFUA 1WAUA 3QN3A 5IBXC 1ZHAA 3GZ3A 1U5JA 4DBUA 2VOMA 4XAYA 1F8MA 5GNYA 4J5NA 1OK4A 5DXXA 2AMGA 5A8GA 3D3FA 3EOLA 3NQDA 1ZLPA 3W0KA 2AKMA 2PTXA 1QW8A 3LSCA 4Q8PA 4RXGA 3S6TA 3VDBA 2OZ0A 3KL0A 3T42A 1JF6A 4WK9A 2EEXA 1OM0A 3L7RA 2Q01A 4ZGYA 3FOKA 1MDLA 4WDWA 1VCFA 1MW0A 4PL2A 3C0LA 1PWMA 1W1VA 3BAXA 3DERA 3T0BA 5L9FA 3W7CA 3CGTA 3DKJA 2HPIA 3H2MA 5FEPA 1X97A 4Z2JA 5E0FA 3W72A 3V35A 3CU2A 2QF8A 3M6DA 3N4AA 5JMUA 4LCSA 2NSXA 2PDJA 2WHLA 2AMXA 3QJAA 1BTMA 1RAKA 1JG9A 4ZB5A 3NSNA 1XR2A 4GZJA 4DPPA 5BW6A 4F0SA 3W7EA 3JZEA 1I4NA 2A4AA 5K4ZA 3QTPA 3DHDA 4MFDA 3F1QA 1C8YA 1Y5VA 4IL2A 4BY3A 4LAUA 5HUPA 4PBGA 3OTRA 4GABA 4CEUC 3KL3A 1TMQA 4PMJA 5LKYA 3LPOA 3PJTA 3RLGA 3OO2A 4HMEA 5A3HA 3SJNA 1QNVA 3S8HA 1O5KA 4DAIA 1DYSA 1VB9A 4HYWA 3LG3A 3NURA 1KFBA 3A47A 3SUSA 3GH7A 3OBAA 4GACA 3AWNA 1KM2A 3FCPA 4GQ0A 3B4UA 1REQA 2G95A 4YVXA 1WXYA 4FEZA 5IXEA 2Q6ZA 1WDQA 3WIJA 4L5ZA 1LOQA 1C91A 4M19A 4YS1A 1K03A 1BQCA 4GY7A 4K7YA 4HNNA 1A5CA 3A3HA 4RZ5A 3VFCA 3W2LA 3AMDA 3BW2A 3LZ5A 4MUZA 3RLVA 1EGVA 3TEVA 4EPDC 3FYOA 3MO4A 1SVDA 5A1AA 4L4MA 5L6UA 2A7RA 1H3GA 1WO2A 2G3NA 1OHLA 4ENLA 1NP0A 2J79A 5HATA 3TE9A 5EYWA 4HKPA 2ZVIA 1RD6A 2QPSA 3S2JA 3EA3A 1KBJA 1SO4A 4QJ1A 4P7OA 1VBGA 3WLKX 3BICA 4E4UA 1AD1A 1R7AA 1F73A 2YCKX 4JTEA 4H8UA 2TSYA 1UG6A 3ES7A 3HU7A 4CCZA 2PSNA 4GC3A 1RK6A 4ZA0A 4WXYA 4WSKA 2YXXA 3FV9A 2R1KA 1EQCA 3KCOA 1XLEA 1XP3A 4YMZA 3MO7A 1GPFA 1GT8A 1ONRA 4UC5A 3GXPA 3TYUA 1FWRA 2XIIA 3UWQA 2Z29A 2NSOA 3VIJA 2W5FA 5CZTA 3QKEA 3VC6A 1FY6A 4UR7A 1V6UA 2X0SA 4E2VA 3P61A 4WRHA 1LWHA 1CGTA 2WCAA 3VGHA 3OHIA 1VZWA 3SUVA 3TX9A 1O5XA 4JY8A 3NPWA 2PDNA 2YX0A 1DJHA 3EWZA 4HMCA 2GJLA 1PE1A 3QHNA 4GGHA 5EBAA 4FLOA 1E6ZA 2CHRA 1XD0A 5TAOA 1AUSL 1OBAA 4E2BA 3C2RA 1SFLA 5EMLA 4V2XA 2ICSA 1R86A 2Q09A 1DQXA 2RDUA 1M3UA 2Z2AA 1IV8A 2G3MA 1H41A 1WKFA 1QAPA 3WBEA 1FTXA 3WLTA 1Q13A 4YXGA 5HQMA 3VNZA 4EWJA 2REQB 1PTDA 4JD4A 4JTTA 3EZ4A 2XSBA 4UOQA 1SPQA 2QQ6A 4UQBA 4YWIA 1DJWA 4AHQA 1QBBA 2EXOA 3R0UA 1FWWA 4GLEA 5DBTA 4ICCX 3DH7A 4FF7A 2J7FA 2J47A 4PEKA 4PMRA 1D7KA 2E1DA 2VKZG 3NPVA 3S1WA 3GTFA 3WH7A 2C13A 4GISA 1TO3A 3L2IA 2A0NA 1LQAA 4RPQA 1C93A 3IS4A 4LUTA 4V27A 4CQDA 4C1NB 5MHBA 1MFUA 1RK5A 4N6FA 4DPQA 3HQ1A 3CV2A 2DW6A 2VMFA 2CZVA 5BNKA 1CECA 4RPPA 4DO5A 3G1RA 4NZJA 4B5XA 4X2RA 1TV8A 1EPXA 4IMFA 3K1GA 1CX9A 4EX4A 1CBGA 3PTMA 4DZIA 2GWGA 2O9RA 4DIAA 3UXKA 2XIBA 1V8EA 1IWAA 3UXLA 3BQ6A 2ZRYA 4S2BA 3C8NA 1C9DA 2BHYA 2E6FA 4KCTA 2E3ZA 3MY9A 3TC3A 4QR6A 4QS6A 1DPMA 1XXXA 4A22A 3WNNA 1S2UA 4LYKA 3VMNA 1SU5A 4IUOA 1BF2A 2D2HA 3K13A 2X16A 1VEPA 4DX3A 3L12A 4A05A 5I09A 3TONA 3TQVA 2XFFA 4WXZA 4D6GA 4US5D 3MZNA 3I6RA 4LANA 1GOXA 1P6CA 4GE8A 3WLRA 3UPWA 3V0SA 4Q8TA 2P5NA 1OFAA 2FZ9A 4FX6M 2CLMA 2QUVA 2H8ZA 3DAQA 1YHTA 1W1ZA 3TKFA 3LHZA 4LB3A 2A21A 3KOYA 3FSUA 1KKOA 1ZBKA 4IFOA 5H2ZA 1J10A 4NL1A 3IVUA 3WD0A 3NDZA 3ZSTA 1XLJA 3G1DA 2ZBTA 3VM7A 1VCGA 1MEWA 3W1LA 2YYTA 4WIWA 4PMDA 4CVUA 1Q4WA 2TPSA 1I2PA 1JL8A 2DSWA 3TW9A 5CG0A 1JI1A 2GZXA 3RF9A 4CN4A 3LQLA 1FWNA 1V6XA 5IDIA 1OFEA 3AU2A 3AZTA 5AVHA 3UA3A 3UWUA 4XZLX 4DN1A 4H9UA 1IXPA 3RO8A 3M0LA 2O7QA 1XDLA 4UTUA 4IG2A 5I0DA 1YX1A 3L0NA 1SJBA 2SFPA 3CMGA 4JFTA 3KAOA 4G2DA 1GONA 1OT1A 1XUUA 4R53A 5A2CA 1EJTC 1XM3A 3ABZA 3RM8A 2AQVA 2VFFA 3T05A 4D72A 2YL6A 3W7NA 3LBMA 2QLYA 5AECA 1B1YA 3TSBA 4H2HA 1EKOA 4J27A 1XX1A 3E5BA 3TTOA 1Q6GA 3WD4A 2OCZA 2E9LA 5BRBA 2BDQA 3G0SA 2BZNA 4O28A 3W1AA 4PRWA 5C2GA 3JVAA 3KWSA 2OX4A 4J28A 3OVQA 1IEWA 1RP9A 2Y8UA 2WM1A 4ICNA 3RO6A 3CHEA 9CGTA 3TJ4A 4JCMA 3L4WA 3W7MA 5ABFA 3IUDA 1RP8A 1OY0A 1E51A 3GB6A 3N15A 4UCFA 4PUMA 3MHGA 3ZJ8A 4JFUA 4F2BA 1CWYA 4Q8QA 6PTDA 5AC8A 3ALFA 3LNPA 1OFBA 4PBEA 4UQAA 4NZFA 3OA5A 3NQFA 1S5MA 3O2LA 2VFDA 4DELA 3E1F1 3HA1A 1JPIA 4MDPA 4IQDA 1V7AA 5CAKA 2ISVA 2QXWA 5FEWA 3PZUA 2Y85A 1X98A 3IANA 3UNDA 2FZDA 1TYGA 2VEGA 2BOFX 1WA3A 3AJXA 3WYZA 1UH2A 1XKJA 4RNJA 1GW9A 5BXSA 5E5CA 2QAFA 1PEZA 5BRPA 5C9ZA 1HKKA 2D2OA 2PU0A 2Z26A 3OP2A 3FYYA 4UNIA 2F6XA 1TPH1 2W92A 3PAOA 4PN2A 4DJDC 2E77A 4UNLA 2QMKA 3BAWA 4CQ8A 2Z7GA 4QM1A 4LEQA 3MJYA 2V5JA 1AJ0A 1E4MM 4H9XA 3NZ1A 2CXGA 4AY7A 3S9YA 4FIQA 5A95A 2ZVRA 3LHVA 4Z17A 3GXNA 1LDCA 3NO3A 2AQWA 2DZAA 3EEGA 1QNQA 3GQYA 3FGCB 2QUUA 2YR1A 2HE5A 2WPBA 3OU8A 5D8WA 3HB9A 3WUFA 4AD4A 3V0UA 4AY1A 1NFBA 1Z89A 3DFOA 4GZ7A 3VNYA 3W24A 5BOEA 1GWJA 4S38A 3CBWA 1P48A 2V2HA 3NL2A 1XQLA 3M5VA 2WJDA 2WW5A 4JTSA 3AHVA 4PR4A 2ZUVA 5JH2A 4E2DA 5LNRA 4MWAE 4MWAB 3CZEA 3OOQA 3UJRA 2R9RA 5AC4A 3QZEA 1YDNA 1BQGA 5D33A 5HBFA 3WEOA 1NAL1 4Q7NA 2PD5A 5EMJA 2VD8A 1PBGA 3AJ7A 4M24A 3P6LA 3OQ8A 4TVCA 4TUFA 3LBCA 3UZYA 3DEQA 1SR0A 1V03A 1SSDA 1H63A 2OEKA 4QGCA 4P7LA 2DUZA 3KP1A 3A4WA 4HMDA 3OBKA 4Y6GA 6REQA 3ID7A 3QEZA 1A5KC 4ERGA 4D71A 1ISXA 1NQ6A 1R47A 1G4TA 7ODCA 2CHNA 3S9IA 3PWGA 4HPNA 1KWGA 1EC8A 2JGYA 4H3DA 5CGMA 3U7BA 4K7VA 1W1PA 2VVSA 2OO6A 4JHOA 1ODUA 1TJ2A 3ALGA 4H6EA 3NM3A 2YFOA 3CIVA 4RV3A 3NSXA 1K8XA 2QGYA 3THUA 3SUWA 5FJPA 1FDYA 2P76A 4WCJA 1YDYA 3IAQA 1DHPA 2R24A 3ARPA 3EWXA 3POCA 2XJ7A 3E74A 1FWAC 2Y5EA 3PTDA 2BWGA 5CC7A 1R2SA 3KUMA 2D22A 2RJGA 4LUYA 4AMCA 4HU0A 4U33A 3NCOA 3S5ZA 3NXFA 4FOKA 1VBJA 2YA1A 1Z3NA 1XBVA 1E3XA 4MNMA 1LL7A 1GW1A 2J74A 4RL3A 1PS9A 3CT2A 4MY1A 3LCHA 3E2VA 4B5UA 5G4EA 3FA4A 3GBEA 3KBVA 3MP5A 4J3ZA 2OR2A 2VEFA 5LHEA 2ZKMX 3UU0A 2GK1B 3K4WA 3CUHA 4UFJA 1ME8A 4O53A 2ZC8A 4GFSA 4B4FA 1GZJA 1GPWA 4PTDA 3UP8A 1LBFA 3T9PA 1VH7A 1DXIA 2XFYA 4LVBA 2G96A 2VR4A 3HG4A 2FJKA 3ANVA 2VWSA 4A21A 2VTFA 2PU1A 5FF7A 3ABSA 4Y7EA 1NFGA 2C1HA 1KKRA 4UUIA 2PP1A 3WLPA 1JFXA 3N25A 1HW6A 3VE7A 1BXBA 1ZAHA 1L9WA 3VI2A 6REQB 4AZ6A 3CAKA 3LA4A 4UTWC 1KA9F 3MHUA 3VD5A 1JCMP 4O14A 5CLTA 1UASA 3BCJA 1XG4A 1ZBVA 2NQLA 3KL5A 3LLFA 1YXYA 4M5PA 3NVDA 2AGKA 4YCPA 4YIWA 2GQ9A 1FXPA 4IH3A 1TE1A 3RX2A 2HS6A 3T40A 4PMYA 4ILSA 1E6RA 3RM4A 3M0ZA 3PK7A 2X7VA 3FKKA 5D2WA 3H2FA 4ZE4A 3T55A 3U2OA 4MGGA 4QG9A 1JZ7A 5CZKA 3UQNA 1DWIM 3FY1A 4KS0A 3BARA 4PB3A 1H61A 3VGEA 2PZNA 1YEYA 5XIAA 1U33A 2A7NA 3WQDA 3NDOA 1EDQA 3PUGA 1V3LA 1E1FA 4O1BA 4C6JA 1UR4A 1QXLA 4WGXA 4Q3MA 1HFBA 4KMQA 4GH1A 1KFKA 3DFNA 5AZ1A 2IKGA 4LYQA 4QROA 1ITCA 1E4LA 4TX9A 5CPMA 1AJZA 2IPWA 5I3IA 1H50A 1X6UA 3R94A 3T44A 2I5GA 3GAKA 2OO0A 2PI6A 1F4AA 3W1UA 2OB3A 3W7JA 2YZ5A 5FD0A 1ZPTA 3L4VA 3MI6A 3MU7A 4JS3A 4RNHA 4IXHA 4S3EA 3V7PA 5IRPA 4J40A 3A4JA 2IPJA 1UMLA 2UY2A 2Y5SA 3KHJA 3MUIA 5AC7A 4LOCA 1VIWA 2CC0A 4KWOA 4TVUA 3RN6A 2BGSA 1U5VA 1PZ1A 4DHGA 3PZIA 4QITA 3OHMB 4RE2A 3WLHA 4E4PA 1JR1A 3CHFA 3HGJA 4J3TA 3MBFA 3NPXA 1BKHA 3NIYA 3CEPA 2FDSA 2HTMA 3VDCA 1A5BA 2ZUUA 1H5VA 3UPMA 1MDRA 3OB8A 3SCTA 2QIWA 3VKBA 4A8IA 3PANA 2A3HA 3Q2DA 1SZRA 4LUTB 4NI8A 3UWEA 1W1YA 3W1TA 1O95A 3LGGA 4XZMX 3I10A 2X1TA 5C70A 2O9OA 1K4HA 4BI6A 3BLFA 5LA0A 3BAYA 1QU4A 4WSJA 1KBLA 2XIMA 1Q8AA 3EB2A 2Q3RA 1H51A 4O18A 1XRFA 3R11A 4LX4A 1G4SA 3MJMA 2OU4A 5FJUA 1NDZA 2WV8A 2BMBA 3K8LA 1SW3A 5F1VA 3GYEA 3QM3A 3TFXA 2YBUA 1NM9A 4HA0A 4US6A 1HVXA 3M0MA 3A4AA 4FK9A 2BFGA 4WY0A 4JTCA 3O9NA 2DQWA 3N18A 3AC0A 4C1LA 3VKCA 3HIJA 3EA1A 3NWRA 4NYUA 1Q5MA 2QJNA 2GVJA 4PCSA 4AWEA 1XWYA 1OIFA 4HSHA 2BY0A 2HBVA 2NVAA 4AHOA 1V02E 3SCVA 1PZ3A 2DFAA 4OTKA 3UG8A 4CU7A 4YJ5A 4EK7A 3L9CA 5FACA 2WXDM 3CL6A 3H4XA 4JTQA 1R8LA 2VZSA 4WDUA 3I4EA 4FNPA 2DPEA 3R12A 4IP7A 4L9YA 1OFQA 3KX6A 2AL1A 1GQIA 3NNTA 2PDLA 3DUGA 1UR9A 3TWAA 4HGXA 1QASA 2QCDB 1DE5A 3GAYA 3M0XA 2ON3A 3QGKC 2DSKA 4U31A 3ZR5A 4EXQA 4HJWA 2CLHA 3IVTA 4DJEC 4GIEA 1IE7C 3W27A 1PB0A 2CBJA 4LV9A 4O1CA 4FF5A 1Q6LA 3BLLA 1XQKA 3MUZ1 3QR3A 1PTGA 2V3DA 1KGUA 2WB5A 1T8XA 3W1NA 2PDBA 1NDYA 3MS8A 1BVWA 3F4NA 3LU2A 5JXQA 1UYQA 4O8RA 3RU8X 3W07A 3KM8A 1TQXA 3CT7A 3ANUA 2WQPA 1ITQA 3UWZA 3UVAA 5LXEA 3EWDA 2A85A 1UKQA 5HMFA 4GQGA 2YCLA 1SFJA 4DJEA 3HG2A 3ITTA 3O8AA 1EA0A 2V68A 3VNDA 2GGJA 2Z1KA 1WB0A 1LLOA 3G1XA 1W1IE 3DFQA 1HUVA 4YHGA 1GVRA 4WX2A 1Q85A 3TSMA 4O11A 2NUWA 1EXPA 4N9DA 2ZRUA 1FH9A 4J3SA 3PUOA 2FZNA 4ML9A 4O57A 3TYZA 3GZAA 4C65A 6TIMA 4FNRA 1R46A 3NO5A 3Q67A 2YL5A 4LT9A 3NQ8A 1FP8A 1M1BA 1A5UA 3LTSA 5HJXA 1EGMA 3W7DA 2J7HA 2UV8G 1YDVA 1WZAA 1PWLA 1JUBA 4NVTA 4PL1A 1OCQA 2CLLA 3EKZA 1B3YA 4OJYA 5C9WA 4KGLA 1DIEA 1QDSA 2YCLB 1M04A 3FAXA 3SDOA 1R5YA 3O0KA 4BWLC 2FZMA 3BG9A 1S2WA 2PP3A 1XBYA 4LBSA 2VI0A 4IPLA 3T0CA 1HL2A 1EP1A 2G97A 4F79A 3T0DA 2VYOA 3SGGA 4CQCA 2WOQA 3UJEA 2DVXA 2VRJA 2CBIA 2AOSA 2YXGA 1WKDA 4KCWA 3A5FA 5I02A 4JL2A 4YTRA 3HN3A 7XIMA 1US3A 3EGJA 5CLWA 4NJHA 3TWBA 3WSUA 3D6NA 4HMNA 3PZ9A 4UTIA 3M1ZA 4JN6A 4LVFA 3QBUA 2HEJA 3N73A 2PLJA 1MUCA 3GH4A 3ZWTA 4DUVA 2QDEA 1TPC1 1GYLA 4HCLA 4JFSA 3CUXA 4UMAA 2DIEA 3OIXA 2YCIX 1F7BA 4JEQA 1Q3NA 1A4LA 4GQQA 4UTJA 1X6NA 4R85A 4OBTA 4FMVA 4MM1A 3DU0A 1M9HA 1HJXA 1EO7A 4C5YA 3T07A 3VE9A 1R9XA 1PDYA 4N9CA 5CJNA 1JPDX 3MP3A 3MZ2A 3QR0A 4XISA 2XINA 4XBSA 1J0ZA 3F7JA 2XISA 1RBAA 4ZTYA 1KXQA 1MW3A 3APYA 1M65A 3G18A 4GVFA 4P8UA 4Q8OA 3G77A 3LNMA 1LOSA 2H90A 4E2OA 4DLMA 1EC9A 4E5TA 4HTYA 2J7EA 3A4XA 4MJZA 4S3FA 4J9JA 3W73A 3VOGA 2HDJA 1TWWA 3RMJA 2J62A 4D6DA 1JULA 2IUZA 4NJJA 5A6KA 3GUGA 5A69A 5E93A 3WG6A 1QR7A 1S5VA 3UBPC 3QQ1A 1V7YA 4MWAA 1V0KA 3LOTA 2ZADA 1VFHA 1UR2A 4GFIA 1RUSA 4CCDA 1GHSA 3RIKA 3MW7A 4IM4A 3H2AA 3THAA 2A2IA 1VRDA 3MVIA 3T2PA 2VELA 4CN1A 1W56A 1RPKA 3PB2A 3N6JA 4HA1A 4BF7A 3UERA 5DY3A 2NX3A 5DQPA 4BI5A 1IWBA 3H8AA 4Q4RA 4L80A 3UZXA 4UWMA 5LXXA 2NV9A 4HU4A 3U5UA 3VNJA 2EKGA 3BMXA 4PYSA 3LN3A 2D3NA 1XICA 2EGZA 1K8YA 2QAPA 2G3JA 1MMFA 1EUAA 1LP6A 2WBKA 4W84A 1TZZA 3W23A 3KWXA 3A3WA 3KRBA 4W8BA 1P0DA 4F8XA 3TYAA 1IIGA 1ISWA 1SW0A 4M8UA 1JAEA 1JXKA 2VFHA 3FJLA 4XQ6A 3WQ5A 1F3TA 5AY7A 3G1SA 4A4AA 1NF0A 2GK1A 1HKIA 2VDIA 4JQ4A 1RD5A 4FI4A 5U7SA 3WL1A 2AAAA 4Q7BA 1DHKA 1I2QA 2O92A 3BSHA 2RHGA 3UZ5A 1JZ3A 1ESWA 3T78A 4A35A 5H8MA 5LSMA 1ITXA 5TD4A 3NEHA 2AKZA 5BWAA 3P0WA 5LHFA 1EJXC 3K30A 5BMWA 4Y2WA 4FOJA 4K1WA 3NQGA 1BGAA 3B04A 2J7DA 5D9PA 4YU1A 3WL0A 2YB1A 4H4IA 4Y90A 3O63A 3B0YA 1SZGA 4QDMA 1V6WA 1M41A 4XAPA 3GTIA 5G1YA 1U83A 1UWIA 3T08A 3BAIA 2FHBA 4X3ZA 3W4RA 3BJFA 1YQ2A 4HNOA 3W6YA 4Z2KA 3AS0A 4K8GA 4XKMA 3VCNA 4MY8A 5AHMA 1GVEA 2PA6A 3SQMA 3RCYA 4AEFA 1GZGA 2A3LA 4UZSA 5BXRA 1TMLA 4CCCA 3EX4A 2VRQA 1EQPA 3PBVA 2NV2A 1EIXA 3V75A 4GYKA 3TIMA 1GQNA 7CGTA 4GUIA 1MNSA 4CD8A 3IGHX 1F74A 3PSWA 1RSCA 3WJXA 3OYZA 2W66A 1KBKA 4B92A 5H1WA 3DECA 3LDVA 4OGZA 4JGDA 3MSYA 3HQOA 1KXHA 4JKKA 3HV8A 2WQDA 1VS1A 4LBRA 4DWDA 4ZO8A 3LQGA 1WKEA 1GZ1A 4D6HA 3GVVA 3SQSA 1ZCOA 5HUOA 2VQUA 3M9YA 3EA2A 4QNEA 1Q7QA 1Z8AA 5BROA 2WHMA 3POHA 2GJRA 1GEQA 4B90A 1VP5A 1UD8A 3G1FA 4ZOCA 2OOFA 1R6WA 2GSJA 3VKKA 4GC4A 2ZX5A 1J2BA 1H60A 1UD6A 3DBNA 1C7TA 3KOWA 4U3AA 4CU8A 3IJ7A 3EWUA 3TLLA 3N6QA 2ODOA 4I9AA 2WNNA 4X22A 1TTIA 3NEVA 1VFMA 4LSBA 4MNJA 3UJSA 3PJWA 1TPVA 3W7HA 1YTKA 3LK6A 3BQ5A 3WF2A 3T7VA 3TA9A 1F05A 2OQHA 4ZL1A 5IHSA 4JOMA 4Z08A 3EXSA 1NJJA 1UH4A 3LLXA 3WQPA 4NNCA 5A6LA 3KXQA 1IYXA 4PSPA 2A1YA 3B0PA 2TYSA 4Z1AA 3PS7A 4I7UA 3ONCA 3A22A 3G2GA 4DWSC 1TJ1A 4AQLA 1XLCA 2XPKA 3BLOA 4FR1A 2ZZ6A 3LBOA 1V3IA 2PD9A 1F3XA 4JIQA 5EPDA 4ZO6A 1AMKA 4UIOA 3KLKA 1DIOA 3P62A 5LNWA 2WO5A 2VHLA 3BMWA 2PC4A 1IZJA 2G0WA 3O07A 1QOXA 1Z9AA 3UY8A 4I6KA 1QPKA 3AYVA 4PMXA 4AHPA 5IHRA 4CD7A 5BWFA 4OHQA 1WNOA 1W1TA 1XSKA 3AHXA 5HPCA 2C7FA 1UZHA 4H7CA 1H7OA 1RQHA 1J11A 4ERAA 3S3GA 4AIBA 2GQAA 1MWOA 1U1UA 3GY1A 4M6VA 3ZT6A 3PP7A 3VCCA 4UTTA 4QBXA 2YW4A 1TUXA 1O12A 4F9DA 3LUTA 4NG3A 4FOUA 3C61A 1O5QA 4Z42C 3ARYA 3B0VC 4S2CA 1RJPA 1TVNA 4GA8A 3AS1A 2J7CA 1F6KA 4R7JA 3GU2A 4UOZA 4ORIA 1HP4A 1OABA 4MUPA 4W93A 3S5OA 4EXBA 4PFHA 3USBA 5KZ6A 2KZHA 1E5JA 4B91A 5KZMA 3WD2A 4ZEPA 7TIMA 2H3BA 4D9PA 3BPWA 3ZT7A 5PTDA 4EANA 3EMCA 1N82A 4ZR8A 3G1VA 2HPMA 5JU6A 3I3EA 4WKHA 2A6NA 3TR2A 2Y6ZA 1QI3A 3NPUA 4YTUA 1TRDA 2INFA 4PUWA 4JBRA 1UA7A 4YHEA 1HTIA 2FTWA 3H7RA 4JYEA 2FTPA 1B9BA 3AHTA 3OGRA 3CTTA 2HVNA 3TTEA 3G5EA 1M5WA 3REQA 2YBTA 2FGBA 4O0KA 1BWVA 3CYVA 4BA0A 3FEQA 4PH6A 3H7VA 2OSXA 2R14A 2QGHA 2UY4A 4G8TA 1MYRA 3EBVA 3PZGA 1SGJA 4DBEA 3VGBA 4XB3A 4C6KA 1TPFA 3HURA 4JHMA 3TV8A 1YLVA 1K9FA 2NUYA 3VIHA 3ZFHA 1QNRA 3C2FA 4HCDA 4IIGA 3M43A 1I2RA 3ZWSA 1WUEA 3W26A 3LHWA 3QR1A 4FIRA 1NDWA 3RPMA 3E0VA 1VJSA 1YADA 4G6CA 4ONVA 3WQWA 4IHCA 1B3ZA 3AROA 1K9DA 1ZNNA 2PDGA 2BX7A 3H21A 1E70M 3B8UA 2A3BA 4GVGA 1KTNA 1WV2A 4UR8A 5HWNA 1A5MC 1G9HA 4YPJA 4AD0A 5AHEA 5K2ZA 4MF4A 3L23A 3SQLA 1LF1A 2HK1A 4X0NA 5D4YA 5CZJA 3TYDA 1TMHA 3S5YA 1G5AA 4DI9A 4DF0A 3C56A 1V77A 3DIPA 3WQ4A 1TVLA 3IAPA 3MDWA 1KM1A 1IWPA 4C6FA 2GUBA 2XTKA 4Q4OA 1QWKA 4P61A 4EKJA 3WLMA 1HQTA 2PTYA 1NSJA 3SUUA 1UB3A 2PRHA 4RE4A 1CZ1A 4IISA 4QCFA 3PPFA 3W2MA 3I65A 2NXGA 1XLIA 3F5KA 2J25A 4A3QA 3MUAA 2GDQA 4I90A 4UB9A 3G6MA 5FOOA 4Q4SA 2B7OA 1TWDA 3LERA 4K8EA 1SJDA 3B9EA 3W00A 4XD5A 4JIHA 3VA8A 7A3HA 3SCSA 4GHRA 3PG8A 3WMCA 5D38A 3GG8A 1I1WA 2WHKA 4L7ZA 3WJWA 3PY2A 5H8UA 2WC3A 3WQGA 4H9YA 4W89A 4ZTXA 4AH7A 4AIEA 3WQFA 1B9ZA 1KFJA 2B4GA 2ZDRA 1W0MA 3EMZA 1J79A 3OODA 1YE4A 4PGLA 1QW9A 1AH0A 1Z44A 3W76A 1E3ZA 2DT3A 1LZOA 1CPUA 1B3WA 4UNKA 3B8IA 1HG3A 1K1DA 3GXFA 4QLJA 3KRSA 3D3AA 2D24A 3WDRA 2ALDA 4BK9A 1TWSA 3HJEA 3N2TA 3IJQA 3EXTA 1XCWA 1FFQA 2HXTA 2H6RA 2V81A 3UESA 4AF0A 2JF6A 2QUMA 2J9XA 4QCEA 1O68A 3WK3A 1JIBA 1P7TA 3G0XA 5LA2A 1Z6KA 4ZBCA 2W0UA 2DSZA 2WSKA 3BLDA 4G7FA 4GZIA 1UA3A 4J4KA 2TAAA 4ZQCA 5HDRA 2GPTA 2FKPA 1P43A 3NQMA 4ZQOA 3VPLA 2A7PA 2QNEA 2YOCA 3A9IA 1HNYA 1HT6A 4PUKA 2BOEX 1KGXA 1Q6EA 4W7WA 1HGYA 1V02A 1X96A 4H9ZA 1H11A 1TTPA 4QLKA 2PWUA 1WZKA 1F6YA 2IQDA 2O7SA 3AU6A 2ZZ1A 5J5DA 5DMMA 3ELFA 4Z2GA 1TPDA 3MMUA 5K3VA 2D0HA 1TJRA 4BS0A 4GBDA 5D9OA 4KFNA 4HT3A 5REQA 4UFKA 1TJPA 4AIOA 3CAQA 1VPYA 1BYDA 1ZBWA 2W27A 4OUIA 5HOSA 3MTWA 3PUEA 3NZPA 3G8EA 4RNFA 3RRXA 3A12A 4ZCWA 2ZC1A 1D3GA 3FXYA 1K7FA 5EL1A 5MKGB 3Q45A 4U5IA 3ZVIA 1FWCC 3MSGA 4XO6A 5A2BA 3C2VA 1V6TA 4F2TA 1AODA 1TELA 2YYUA 5EA9A 1JUKA 3S6DA 5DBUA 2R6OA 4NZ3A 5AYZA 4QG8A 3WF1A 5LNSA 1GKPA 4B5SA 3M47A 4GOAA 3AI0A 1ADDA 4LU0A 4XAGA 4D8ZA 1UIPA 5CJMA 3OZMA 2CERA 4R7WA 3IJLA 3W7IA 1VFLA 2X40A 1W9DM 2WAGA 4KBXA 1BWKA 2PWHA 5LIUX 2ASHA 5GJNA 5TQLA 3TN3A 4CQAA 1CGYA 4LS1A 3SCOA 4F2UA 4PUEA 2J8FA 1R3YA 3BJTA 1VLIA 1POJA 2Y88A 2BS9A 1UR8A 3C0SA 4O12A 3PG9A 4AAJA 3GTHA 1UWQA 5CC6A 4HPGA 1J5SA 4LGXA 3QGAC 2DDXA 3ORWA 1J2WA 5E9AA 1EJRC 1XL9A 3VIGA 2Z1WA 2ZZ5A 1C90A 1VYSX 3F4WA 2WCSA 4UTLA 3E2SA 5CGQA 2X8RA 4AD3A 1BRLB 3T8QA 1W9UA 3GC2A 2RDTA 4JXCA 2A3AA 4LPCA 4NAEA 3TNOA 1JJKA 2TODA 3W7QA 4A3RA 4ZQRA 3P81A 4JL1A 3VGGA 3AYRA 3SN4A 3I4KA 4FXSA 3EWCA 4PMOA 1LQ0A 3LENA 3V16A 3VNMA 4F66A 3O6AA 2OODA 1P6WA 1KWKA 3KFTA 3E6EA 3LPPA 4PCTA 4ACYA 1CLVA 1O60A 3FNDA 4L4PA 3W85A 2E9BA 4LC6A 4E8GA 1JF5A 2Y0FA 5CSSA 4PMQA 4TVDA 1FQ0A 4GIRA 3APGA 3H55A 2XH7A 3CQHA 5C6MA 4IIEA 4TTUA 1C92A 1OINA 2HK0A 2JKEA 2Y7EA 4CLMA 5A6MA 4PUUA 3GDTA 3B03A 4B2DA 2WZEA 2P0OA 1JI2A 1JEZA 2F9RA 3GDMA 3H22A 1SO6A 1VYRA 1AG1O 3QMTA 2QCEA 4JIIX 1JDEA 1EC7A 4KWUA 4UQCA 4YYCA 1M6JA 1A4MA 1VR6A 2EHHA 4F0LA 2WNZA 4M29A 3BE7A 3CNYA 5I03A 1XYBA 1NH6A 1AW5A 4XK2A 2E09A 4MG4A 5AVNA 4Q8VA 4YTTA 4QRNA 4MPQA 2VC6A 3H7UA 5I78A 3B9AA 1QW7A 4ZODA 1NWUA 1DTNA 4GI9A 1SJAA 3C86A 2WKGA 2Z28A 2HE8A 3W87A 4JEJA 1XIEA 3GRIA 4PCNA 4B9ZA 4NYYA 4Y96A 3VOIA 1DKWA 2GQ3A 4MSSA 1GGOA 3VKDA 1UC4A 3WH6A 3QPEA 3I3BA 1GOMA 1S1PA 3AXMA 3GH5A 1EP3A 2PTZA 4W88A 4IF2A 2VR5A 4ROPA 4IOTA 3ZLGA 1OC5A 4LCQA 3GIPA 4Q4QA 3M64A 1VJZA 2Q8XA 1ZAJA 2NX9A 2GDVA 3P3BA 2YIHA 3E02A 2HCVA 2HQAA 4EP8C 1TV5A 4D6JA 3JU2A 4JTAA 4Z2LA 4UFMA 3GNXA 1I60A 1C8XA 3T4CA 1LRQA 1A50A 1CTNA 3G22A 3KCJA 1ECEA 5LZLA 5HANA 2CZ5A 4M1BA 3DGRA 1FCBA 4H8VA 2FFIA 2WSRA 3VDHA 1YNQA 3QSRA 1LOLA 4CQ9A 1O5RA 4LF2A 3NL6A 4M56A 1W1A1 4YTSA 5HJLA 4BFAA 1OZQA 3RG6A 1P6BA 3SN1A 3AIBA 1TJ0A 2OZTA 2OYLA 2PLCA 4JZ5A 2YFNA 2E67A 3OJGA 2FZ8A 6TAAA 3LPGA 3KTSA 1V5XA 3O6CA 3FYPA 1P5BA 5F2GA 3HGOA 1YNYA 2FPTA 2XIQA 3OGVA 1KR1A 1W2PA 1H1ZA 2W79A 4LTSA 1M03A 3B97A 3VOJA 1JCNA 3Q4DA 4PUNA 3OVGA 3H2OA 3WY1A 3DOPA 3TAOA 1CI1A 1W3IA 3YPIA 1LG1A 5LGZA 4JTKA 1E6PA 3R8GA 3EDKA 4I7VA 4KEZA 1UOKA 1XPYA 2G5WA 2CLOA 5CZSA 5A6BD 3DFHA 4HK7A 4MB1A 3CXOA 4G1NA 3PBGA 1XYZA 3PZVA 1S2VA 3SCRA 2XVPA 4JTHA 3TXVA 2VX4A 4AB4A 1UR3M 2LLEA 2QHAA 1YIXA 1S2TA 4JTRA 2QVHA 4RW5A 4ACZB 2QV5A 3WLNA 1ISVA 3S2CA 2VX7A 2X7WA 3UJ2A 4B5TA 1F3EA 2Z1VA 3R7MA 3BAJA 1P7TB 2J7BA 4IMDA 2C6QA 3UETA 4DWSD 1XBZA 1EYWA 3L21A 4GUFA 3HPSA 4JDBA 1QO2A 1XGZA 4GYJA 1LT7A 4GUGA 3MYPA 4RDWA 4Z0SA 5M1TA 1J93A 3EOEA 3QLDA 5I2UA 3W1MA 4GBUA 4C6CA 1NU5A 3LD5A 4GCXA 5JIPA 3RUBL 2QR6A 4L9ZA 3TJLA 4YVVA 2X1RA 4UMCA 3TQ0A 1WE5A 3GDBA 1YPIA 1EXBA 3AMLA 4E38A 4JFVA 2A3EA 3WELA 2QJMA 1ALDA 4PRRA 2E9MA 3WMLA 3HBLA 4UTTC 4XKYA 4PTNA 3PJXA 3CQKA 4C60A 5FF0A 3WH8A 2PCEA 2D3LA 4B16A 5BU9A 3EWBX 3EPNA 3QZ6A 3WDHA 4H8NA 1GUVA 1ZBCA 1JDCA 1WQ5A 1CXHA 4FO4A 1XC6A 1J6OA 4WHBA 4U4MA 2HVMA 2PFHA 5E9XA 3LCFA 5KEZA 1FCUA 1L6YA 3K8KA 1ZALA 5FF2A 3UF9A 2PLMA 3SCWA 2XGIA 4O16A 1RQEA 1A3XA 2A79A 1GJUA 1TTJA 3N14A 5AHFA 3RDKA 3CHCA 3TAKA 1BHGA 4AD1A 2Y70A 1L6FA 2OVLA 1LYXA 1W9VA 3W01A 5F2IA 3B8SA 4NP7A 3W7GA 2PLKA 5I3DA 1LBMA 1H4PA 5FJOA 1YPXA 4AZGA 2E4TA 5G1TA 1E6NA 2Z1XA 2ESCA 1FWGC 3HPZA 3WQ6A 3S46A 5IDZA 3OG2A 3L5LA 3D0CA 1DBTA 2Q71A 3FJ4A 4LRTA 1SUXA 2QDDA 1Y8BA 4QIUA 3CK5A 2JKAA 5AYXA 1OCJA 3WDPP 1MZHA 1UPMB 3GU9A 1B2YA 4AG0A 1RLDA 4GWEA 5B80A 4JTDA 2DP3A 1RCQA 2PURA 3STFA 3MSRA 4XZIA 1Z42A 1IT8A 3K46A 2GUUA 3ECQA 1VIZA 1IR2A 3XINA 4GX8A 1QNOA 5LNUA 2Y24A 2Q8LA 3SRDA 2G4FA 1Q6FA 4QISA 3GE7A 1VRXA 1HVQA 3OVRA 4GRSA 4F40A 3WDIA 4HB7A 1RLCL 1NARA 1VQTA 4Z1YA 2CZDA 2XDFA 2QJGA 3R89A 4LQ1A 2QF7A 1UD4A 2QCHA 1PCWA 2AQOA 3QLLA 2RGLA 3TYBA 3P93A 4BKNA 1XYLA 4AISA 2YPIA 4UTFA 3FK4A 3NZGA 4CNPA 3KLLA 1QPRA 4J7RA 1XIDA 4C6PA 4NUWA 1V4YA 3HG5A 2PDQA 4OIFA 2BASA 1UP2A 1BLIA 1GNXA 4LALA 2JQXA 3NDYA 7ENLA 2PBOA 2B7PA 3SEPA 2DW7A 1GOQA 4ZZ9A 4C1NA 4KESA 4LBUA 4HA3A 4MB4A 1UUOA 4IX0A 4C6OA 1XLMA 1PPIA 1RBLA 1UWTA 4CQBA 4GYPA 2YLAA 1K70A 5GVJA 3PB0A 4CCEA 2PGRA 3C3NA 1HGWA 2L5HA 4OOUA 1TKKA 9RUBA 1S3TC 3NO1A 4B5VA 1FRBA 3S9ZA 1PO9A 3TSDA 4GI6A 5JUVA 4N9EA 2NWSA 4JIPA 2BP1A 4IQJA 3BSMA 2IKIA 2YLLA 3GNDA 4P7NA 3U8GA 3DENA 1JNEA 3FA3A 2XIOA 2RJHA 4QQUA 4XZWA 4CNNA 3QY6A 3D46A 3TZNA 3PHAA 3QF0A 3RM9A 3ZS4A 2UZ9A 3PN8A 2FH6A 3VGDA 2YL9A 1U5HA 3LV5A 4JTJA 4L1XA 3LSBA 1R30A 2J4GA 3GDRA 2F38A 1HJSA 5CJ5A 1Q4NX 3EX3A 2ISDA 3SCQA 1MRAA 4F4RA 2R82A 4XVEA 1WZMA 1DJGA 2OWCA 3WUGA 3PR2A 4Q6JA 2HJPA 1FKWA 1JPHA 4GJIA 5TBOA 3TN6A 1XDJA 4TTGA 3LM3A 5DFAA 5GQBA 4NSBA 2ADAA 1H7NA 2GGGA 3P5YA 1QPQA 3HQNA 3FSTA 2VDGA 4Z1CA 1RALA 4BCEA 1UQZA 2D0GA 4UOJA 1CGVA 4GK8A 1JQVA 1GJPA 2ISWA 2Z0IA 3WJZA 2IXUA 3DG3A 4XKYB 2JF7A 1ML1A 3GFXA 4DVOA 2W4XA 3IV3A 4ATWA 2B7QA 2CYGA 2PDCA 3IK4A 1DJZA 1V93A 1M01A 3U7VA 1OYCA 3QY7A 3C2OA 3C6CA 1XIIA 3G3DA 5BU6A 1XH0A 3N34A 2GSHA 3FVDA 3IARA 2FQIA 3MPGA 4B5WA 4NJIA 4X2PA 3UW6A 2QDHA 1DP0A 3LHYA 3S42A 4QDPA 1RH9A 4GQBA 2YDQA 4ATLA 4I5RA 1QBAA 1EJ7L 4IIDA 3RRAA 4C90A 3HG3A 2XSXA 4DXKA 1VCVA 2ZE3A 5AC5A 1QJWA 2JKPA 2YL8A 3CAWA 3BGJA 3ZLFA 3H12A 5FI8A 1JZ6A 1D3CA 1C29A 2HBXA 4HCHA 1F3WA 2J13A 2AAMA 2CZEA 4K6AA 1T5AA 5CPTA 1T41A 5I3KA 1Z69A 4ZENA 2BV9A 1GYMA 1IIHA 1MQRA 1K7XA 2YKKA 3T4WA 3N9RA 2ZX7A 1CENA 3RGTA 3BW3A 1IXOA 2DU2A 3F2DA 1GG1A 4PTVA 3KE0A 1TFVA 4JN8A 3CUZA 1GQKA 2QCNA 2C1GA 3CS2A 1QNSA 1IZCA 1OIMA 3TCSA 3UEQA 3BL3A 4YCOA 3TQKA 4HYRA 5KMYA 4D1IA 3QHMA 1ZP4A 3URQA 4ACZA 1XCXA 2FVLA 4PFMA 3DHPA 5FF3A 1S2CA 1E55A 1JRBA 2QYGA 3S2MA 1Z7AA 4OOZA 4LFYA 3FHQA 4HYVA 1JCXA 1R9YA 4FNSA 1OF6A 3EOOA 2PEVA 3PBUA 2JEPA 5AYIA 1YTDA 1NDVA 1QO5A 1KV8A 3XISA 4OZOA 2XWEA 1A5NC 3INPA 3ARWA 3PUDA 5IOBA 3S47A 2DZXA 2CEQA 3PBWA 4DJFC 2DGAA 1G01A 1A5LC 1BAGA 1BPLB 1OD0A 1KCZA 2J75A 2CLIA 5CXPA 2BHZA 3P0XA 4O13A 3BZGA 4FNUA 4OU1A 3CB3A 1UD5A 4W7UA 3BDKA 3L66A 3ITVA 2GVGA 1KR0A 4O0ZA 3NOEA 4CU6A 3BGGA 4AWSA 1XGDA 1K3UA 3CZGA 3L2LA 1DWAM 1OG0A 2FB3A 4M6PA 4E0CA 4JQ3A 3RK8A 3GDKA 4NRRA 2P3ZA 3TFCA 4PZVA 4I6VA 5A2AA 1ZCCA 3AYTA 2GL5A 1K6WA 1PHQA 1KW1A 4EAYA 3SRKA 4QJ5B 5T9BG 2PMQA 2Y5JA 1XHGA 1KGWA 3WF0A 1OSEA 3UCDA 1MQQA 1C9WA 4I3GA 2NLIA 5HPOA 5FCZA 1K9TA 4J3VA 2E40A 2R1NA 1ZJHA 3OEXA 3VUSA 5FSDC 2OYMA 3SURA 4BEQA 1XIHA 4IQEA 2E5BA 1XS2A 3ARVA 4MAZA 4H9MA 4HD5A 4DJFD 1J12A 5HQEA 3TC7A 4HVXA 3GS6A 2V5KA 1Z41A 2QW5A 3EPOA 1E73M 4N2YA 3E12A 1VF8A 4CKQA 2DVUA 1R9ZA 2V6AA 4MJ2A 1JYXA 5A6SA 1UMYA 2VQTA 4L6OA 3W29A 3S2NA 3U48A 3SSZA 4CD5A