4HK7A

Crystal structure of cordyceps militaris idcase in complex with uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
379
structure length
379
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLKAELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 136
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk7A00
1A4MA 3E38A 4H9TA 1ITQA 2AMXA 1PO9A 2FTYA 2Z7GA 1GKPA 4QS6A 4GY0A 4LCSA 3IJ6A 1UBPC 1WXZA 1WXYA 1K1DA 1YNYA 4H9YA 4GK8A 1NDVA 3RCMA 3FDKA 3FEQA 4LAOA 2YB1A 4EPBC 4DIAA 1RA5A 4XD6A 1EJSC 1I0BA 1J79A 4KETA 4R85A 3LSCA 2Z24A 3FDGA 5CH9A 2XIOA 3GTIA 1NDWA 1FWEC 2D2HA 1QXLA 1J5SA 4C6PA 4B92A 4C6NA 2OODA 1FWIC 1ONXA 4OFCA 4C6FA 3MKVA 3MDWA 2EG6A 3E3HA 2VC7A 1EZ2A 1PTAA 1ADDA 4RDZA 4AC7C 3LU2A 3IGHX 3OVGA 4KESA 2QPXA 2D2GA 3QGKC 3GTXA 2DVTA 4NP7A 2QVNA 3K5XA 2VR2A 1RK5A 1FWBC 1ONWA 3B0XA 4GXWA 2DVUA 1NDYA 4H9XA 5HMFA 3K2GA 2Z25A 4HJWA 1P1MA 3MPGA 3URBA 2R1KA 4BJHA 4CQBA 3QY6A 4R88A 4HK5A 2BGNE 4CEXC 1EJRC 2GWNA 1A5NC 2FTWA 1VFLA 1EJTC 1UIPA 3QGAC 3GU2A 4L6DA 4IGMA 1R9ZA 1NFGA 4QRNA 4C6MA 3N2CA 2IMRA 3S2LA 1UMLA 1KRAC 3BE7A 4IFOA 1XGEA 3OODA 4AQLA 4BKNA 4JOMA 2BB0A 4DYKA 2Z28A 1J6OA 1KCXA 4I6VA 2CZVA 1J6PA 2VHLA 4LCQA 4C65A 1PB0A 4DI9A 3HTWA 4UBPC 3PBMA 4IGNA 4H01A 2DVXA 1BF6A 4F0RA 4ERIA 2ZC1A 3TN6A 3LGDA 4C60A 4C6IA 2Q09A 4HK7A 4HK6A 1A4LA 2P53A 3GIQA 4LFYA 4LALA 4XD5A 4KIRA 2Z29A 3IACA 1RJQA 3TN4A 4C6LA 4LANA 4CNSA 3LNPA 5FSDC 2EG7A 1NDZA 4ZSUA 3F2CA 1JGMA 1O12A 2PAJA 4H9UA 1A5KC 2AQOA 3G77A 4GX9A 1W1IE 3NQBA 3S4TA 4LAMA 2Q01A 2W9MA 3CAKA 1XRTA 3RN6A 1GKQA 2WJDA 2Z27A 3O7UA 4ERAA 2OGJA 4IFRA 4H9VA 3RHGA 3AU6A 5HMDA 2Z26A 3UBPC 3ITCA 4UB9A 3MTWA 4GZ7A 1EJUC 2I5GA 3UR2A 1E9YB 2WJEA 3E0FA 2PUZA 3MJMA 3NEHA 1KRMA 4LCRA 3QY7A 2YB4A 4E3TA 4GX8A 3O0FA 1YMYA 4CQDA 3C86A 2WM1A 1P6BA 2HBXA 2QS8A 3GG7A 3A3XA 4ZSTA 1DPMA 4LAKA 4EP8C 4IFKA 1A5LC 4B3ZA 2FFIA 4C6KA 1YIXA 1EJXC 3MDUA 4LH8A 4XAGA 2GZXA 4GOAA 4D8LA 2O4QA 3TN5A 3PNUA 3AU2A 2QT3A 3URAA 1P6CA 3OOQA 3TNBA 3PNZA 1KRBC 2E25A 5LXXA 3QY8A 2AQVA 3GU9A 4G7EA 3DCPA 4CQCA 4CNUA 2VM8A 1ZZMA 3R0DA 3WYZA 3OQEA 1UIOA 2OOFA 1RJRA 3DC8A 3UF9A 5A6TC 2O4MA 3GIPA 4RDVA 4CNTA 1PSCA 4C5ZA 2ANUA 3S2NA 2HQAA 2PLMA 1FKXA 2PGRA 1YRRA 3F4CA 1M68A 1M65A 4R7WA 4QROA 1EF2A 4TQTA 4WHBA 1POKA 4C6DA 2WJFA 4C6EA 5G4HC 2UZ9A 2ICSA 3B0YA 4PCNA 3WMLA 3MVTA 1IE7C 3HPAA 3V7PA 4DNMA 3ISIX 4GC3A 4RDWA 4G7EB 3URQA 3IPWA 3NURA 4B91A 1R9XA 3CJPA 3LGGA 4INFA 3T8LA 2A3LA 1YBQA 2Z2BA 3MSRA 4KERA 1A5OC 4DLMA 4I6KA 3EGJA 4F0SA 3DUGA 3E74A 4C6BA 1KRCC 4H9ZA 4H9MA 4C6JA 4MUPA 1RJPA 3OU8A 3F2DA 4EPKA 4KF1A 1GKRA 2RAGA 1FKWA 3B40A 4GY7A 4J2MA 4V1YA 3GTFA 4H00A 4GY1A 2EG8A 2VC5A 3TN3A 1FWGC 1HZYA 2D2JA 2YXOA 4QS5A 4KEUA 1YBQB 4RZBA 4GBDA 4IF2A 4NG3A 2VUNA 1K70A 2GSEA 2OB3A 1RK6A 2GOKA 4DLFA 1V51A 2R1PA 4PCPA 4EPEC 3ORWA 4J35A 1XWYA 3F2BA 1E9ZB 3T1GA 4XD3A 4PBFA 3MVIA 4M51A 1FWFC 2KAUC 1O5RA 2R1NA 3ID7A 3URNA 4WVXA 3SO7A 4J5NA 2GWGA 4C5YA 2HBVA 2FVMA 1FWCC 2PGFA 3IARA 3WZ0E 3LA4A 4PBEA 3A3WA 1EJVC 4GYFA 2OQLA 4P5UA 3OJGA 4RDYA 3GRIA 4IG2A 4DI8A 5FSEC 3AUOA 1S3TC 2YZ5A 2I9UA 1K6WA 1XRFA 1RA0A 2P50A 4Z42C 3S2MA 3RYSA 3EWCA 2E1WA 2FVKA 1EYWA 4KEZA 3HM7A 4C6QA 3GU1A 3E2VA 1FWAC 2F6KA 4QTGA 4C6CA 3LS9A 2HNHA 3LY0A 4IFKB 2HPIA 4IG2B 4B90A 3PAOA 1R9YA 2HPMA 4DO7A 4ICMA 4NI8A 4EPDC 3SFWA 1V79A 1V7AA 5E5CA 4CEUC 1A5MC 4DZHA 4LEFA 4L9XA 1ITUA 4RE0A 1FWDC 3GTHA 3IRSA 4DZIA 1RAKA 2Z4GA 3ICJA 3A4JA 4XAFA 4XAYA 3F4DA 3CS2A 4C6OA 2R1MA 3KM8A 3IV8A 1POJA 3K4WA 4QSFA 4PE8A 5HMEA 1EJWC 4XD4A 1FWJC 4YIWA 3JZEA 3UPMA 1FWHC 2Z00A 2R1LA 1V4YA 4XAZA 2ADAA 2Y1HA 3GUWA 1M7JA 4ERGA 4KEVA 2Z2AA 3LSBA 4BY3A 1V77A 4IQJA 1QW7A 1I0DA 2UBPC 3UR5A 3D6NA 4G2DA 5AKQA 4F0LA 3EWDA 4HA0A 4IH3A 2G3FA 3T81A 3E0LA 4WGXA 4KQNA 4V1XA 3PANA 3S2JA
chains in the Genus database with same CATH superfamily
1ESWA 4B9ZA 4JBRA 4E4UA 1CGYA 4O54A 4ES4A 2XVLA 4PBGA 1GOIA 4L56A 1WXYA 4O13A 2E7FA 1FCBA 4C91A 1IR1A 1CDGA 1PWLA 2C19A 3Q94A 2QV4A 2Y4SA 4AX7A 3ZT7A 2EO7A 2J24A 3CYVA 3SQSA 4KETA 3WG6A 1YTDA 5DMLA 3SURA 2GDUA 1HJWA 2XIOA 4KCTA 4JTRA 4H1ZA 3TYUA 2XM2A 4O1FA 4PMRA 5HMSA 4LVFA 4JTCA 4OFCA 1LP6A 3COTA 3TXVA 1RLDA 5BCAA 2JALA 1FP9A 3SADA 3G8EA 3POHA 2CLPA 3AMLA 2WXDM 4WUIA 3CZLA 4LF1A 3WQ6A 1ONWA 2I57A 5JIPA 2QHAA 1AMKA 1I9CB 2XM1A 3KCJA 4F66A 3MPGA 4G8TA 4CQBA 2JEPA 5IBXC 4C1LA 2VZVA 5F2GA 2W6RA 3SRHA 4CEXC 1GOOA 2WZTA 3R7MA 1GOXA 5A2BA 1F4HA 2D2OA 2GDVA 1VP5A 1QVBA 3L68A 1D8CA 3ZOAA 1H7WA 1QCWA 4RE2A 4PMUA 4RPPA 2QJHA 2ZUVA 3GXFA 3DG3A 1HTIA 3M0YA 5CSRA 1XUZA 2EPLX 2NUWA 5CGTA 1VJIA 4S3AA 2NLIA 1W54A 1UKTA 2OWCA 2FLIA 1XH2A 1YE4A 2TSYA 1OIMA 3LHWA 3W2NA 2IKJA 4ONVA 4W89A 1TCDA 3KE0A 5CGQA 3W7LA 4S3JA 4UCFA 4OU1A 4C6IA 3DI1A 1ZU8A 3KW3A 3VX1A 4FEZA 3EDEA 1KTBA 2IW0A 4ZVJA 3IACA 3TFXA 3N4EA 1WKFA 1LLZA 2YLAA 1A5KC 3G77A 3NQGA 1SFTA 3S4TA 1NQKA 2WPBA 2HXTA 2W9MA 1NJJA 3RN6A 5DCBA 3PBWA 2GUBA 1AL8A 4WDTA 3VGHA 5EA9A 5HMDA 1UH4A 4H19A 3UBPC 5DEZA 1PCKA 2POZA 3OLEA 5A94A 2CHRA 1Q4WA 2YB4A 1GJUA 2WO5A 1XF0A 2VGGA 1P6BA 1EWEA 1GYNA 3RX4A 1X96A 3GG7A 4GVGA 4X3ZA 2HNEA 1S2VA 2J7HA 3GY1A 3RDKA 1QASA 2JK2A 3TSBA 4C1NB 4HSHA 3SCTA 1JI1A 3LG3A 4AY8A 5D9OA 3ZYZA 3U5UA 4DF0A 3DGBA 3TN5A 1W31A 1OC7A 3URAA 1QHZA 4JR5A 3FVDA 4ZOEA 2DIJA 3A22A 1XUUA 3CEUA 1MW2A 3CUIA 3DN5A 5AYZA 4GUIA 1KLZA 1OB0A 1ZP3A 1QRQA 2PLMA 4XZBA 2QJNA 4PUNA 3GW3A 3PZIA 1Y5WA 1C7SA 3R4IA 4WHBA 2PTZA 1E0XA 1X1ZA 2V82A 2GSHA 1LWHA 3NL3A 3CAVA 4CGTA 4AU0A 4PMQA 1Q2SA 3FA5A 3T8LA 3A21A 2Z2BA 1R46A 4JTFA 3BZJA 3EGJA 1MZHA 3UCCA 1E1FA 3E74A 1F7BA 4OECA 1RJPA 1BEUA 4JYDA 2XTKA 2GGEA 5DXYA 3GNOA 3BLLA 4QFUA 3H12A 3GTFA 1GOQA 2ZRXA 4GY1A 1CTNA 2J77A 4AXKA 2D2JA 4CN6A 2YDAA 1B57A 2ZYFA 4UZSA 4KS0A 1YX1A 3G1FA 4CQAA 1QPKA 1W1PA 2V3DA 4GKTA 3F2BA 1BWVA 1E55A 1V5XA 4HB7A 4NX5A 3LPOA 4HNTA 2A3EA 4DWSB 1FHVA 3WLIA 4UXDA 3O07A 1B3WA 1AMYA 2FH6A 4W86A 2XFRA 2REQA 3KHDA 2XGIA 1BYBA 5EFDA 4PRWA 2VD9A 3R5EA 2OQLA 4KBXA 3UWZA 2PLCA 4HCDA 3W7EA 3HMCA 4H83A 3G22A 7ENLA 3V35A 3EPMA 4ZBCA 1HL9A 3LGEA 3V0TA 5CPOA 3BLPX 3O8AA 4OKDA 1Z48A 2VC9A 2CZ5A 4IIBA 2VCCA 4O14A 3SR7A 5U4NA 5AVHA 5I3FA 1RZMA 1HVQA 1C7TA 1JPHA 4NY2A 4X61A 3UY7A 4GCXA 3QFEA 2P0IA 1Z3NA 1OYBA 4H41A 4HCLA 1DKWA 1AQHA 3T09A 1RD5A 2VWSA 3TC7A 2EBNA 1KBKA 4AZ6A 1BQGA 3CK5A 1J0JA 3WLTA 2BMBA 3KHJA 4AWEA 3KM8A 2OQHA 3PUEA 2GUUA 3BC9A 4UTKA 1TPFA 3W7QA 1QWGA 3ZJ8A 3HOJA 4KEVA 4QDMA 4QAIA 2WZMA 1XLCA 3W2UA 4QG6A 3EWDA 4HA0A 3ZMRA 5JUVA 2NQJA 2J62A 3QW3A 3T9PA 1GQNA 2FTYA 4HYVA 2Y5EA 2VP8A 3QR0A 1OFBA 1G4SA 1UBPC 3NO5A 3WBXA 3U5YA 4JYFA 1E9IA 1WNOA 2VFFA 5HANA 1E3ZA 1NDVA 4LAOA 2YB1A 4E3VA 1BF2A 4IMCA 4XD6A 4HA3A 1W5MA 5EGRA 3CO8A 3FGCB 4H3DA 4OQVA 5G1MA 2AMGA 5FIPA 1I6NA 3I7RA 4L65A 4YTRA 2G4JA 3FXGA 3M6DA 2BXYA 3MY9A 1GW1A 1HKWA 3O6CA 1QNVA 1PKYA 2D20A 1G0CA 4PN2A 3VM7A 3NG3A 1XQKA 1K4HA 3DFQA 3GTXA 4FK9A 1A3HA 3APTA 3TP4A 5A6SA 1VLIA 2ZRYA 4DJEA 3THAA 2VGIA 1V0LA 4HMNA 5E70A 2Z25A 2E5CA 2DZWA 1IEVA 1TUFA 5BWAA 3LCLA 2GJXB 3H23A 3D46A 3LZ5A 3PUOA 4Y2WA 3H2MA 3LV5A 2BG5A 1OCQA 3M0MA 4Z2LA 3HIJA 4FF5A 4HVXA 3W6MA 4NZCA 4BWLA 1Q6EA 2CZEA 5A2CA 1REQA 4PODA 3EOOA 1BRLA 3BG5A 3U2ZA 3QGAC 4A2RA 2XSBA 4ZEPA 3A47A 3AO0A 3LMZA 4IGMA 4YS1A 1ISZA 5E6ZA 3VIMA 3BCFA 4FXJA 1OFQA 4QCEA 4DYKA 1SR0A 4M82A 1S1RA 3EX2A 1GWJA 1JNDA 4NNCA 1KV8A 1E4IA 1RH9A 2QCHA 1MRQA 2LLEA 1K9TA 5AECA 4DI9A 4YWIA 3W7MA 4Y8FA 3PZGA 3E2SA 1PX3A 5TAOA 3ARVA 3P93A 2HVOA 4A3YA 2BXVA 1LG2A 3OQ8A 4F0RA 1W1B1 3OYXA 3O06A 1B54A 3P67A 5IXEA 4PTMA 3D47A 1UUMA 2FTPA 1E4NA 3VOJA 4ZQCA 5BWFA 3RJXA 3ARWA 3TJXA 5I6SA 1DJXA 3CWOX 2YBTA 4S3FA 1H51A 2OSYA 3WJYA 3EOLA 1P7TA 3LLDA 2BVTA 4CNSA 3AMGA 4L1WA 4PYSA 4JL1A 3C3UA 6CGTA 1X1OA 4GQ0A 2PE4A 1UR2A 3T40A 2CXGA 1ZBWA 4PUWA 3RM4A 1CGWA 3F4WA 3LXCA 2CKRA 1XRTA 1CXHA 5D2XA 2NX3A 2WJDA 2WSPA 1GPWA 4UMCA 2VFHA 2Z26A 2GQ9A 4M0XA 1GYMA 3G1SA 1QPOA 3QSRA 3PK7A 4A3RA 2PUZA 7REQB 3SCQA 3G8RA 3LLFA 4GX8A 3AIWA 4IIGA 4CQ8A 2NX1A 3FCPA 3VCRA 3FJLA 2GJRA 1XYCA 1V8EA 4G1KA 2VEIA 3WDPP 2IPWA 4FNRA 2FZDA 2XH2A 2J75A 2W4XA 2AL1A 5B7YA 1V93A 3CMJA 5CPTA 1HQTA 3TNBA 4BQ5A 1NWUA 1D9EA 4HD5A 1XDJA 3SW6A 1YLVA 4O1BA 1TUXA 3UG3A 3IGUA 1L2QA 4OE7A 3W7RA 1PYMA 3HPZA 3A4XA 5J5RA 5DMNA 2WOQA 2DH3A 3DC8A 1F74A 3P74A 3W73A 2E6AA 2DZVA 3S2NA 5HOSA 1M68A 3TYDA 4AHQA 1ME9A 4QROA 3V3WA 2PFHA 2P10A 4JNMA 3NXFA 3B0YA 2I5QA 1CGTA 3VOCA 3O0KA 4U28A 4K3ZA 1XR2A 2B7QA 3P84A 3GSMA 1FBAA 2DZAA 3O15A 4DO6A 1QK0A 4YLWA 4DELA 3NSMA 4KEMA 3AIRA 4LC8A 3OW1A 1B3OA 1KRCC 1V0MA 4NJKA 4A3QA 3VNZA 3EWXA 1E5JA 1QPQA 2J4GA 1IV8A 2X0HA 1CGXA 3CB3A 4NJJA 4GIYA 2QXWA 1EP3A 1IXQA 1Q7ZA 1J2WA 2YXOA 2QDDA 2ZE0A 4AY7A 4ZMGA 3GVQA 1MUCA 4MFDA 4E2VA 2GLKA 3ABXA 1F9CA 3KP1A 1HUVA 2V69A 2H8XA 1E9ZB 4L6HA 2HXUA 2BDQA 4QE4A 5GNZA 1J18A 1QAPA 3CU2A 4E6MA 2Q8LA 4M19A 1FH7A 4JKKA 4UQEA 2J8GA 1R7AA 3AS0A 3TJ4A 3R8GA 5LGZA 5D03A 3W7OA 2PGFA 3ZLGA 1O95A 3I65A 3IJQA 5FJOA 4WSHA 5M3WA 1XSKA 3NDOA 3QM3A 2I56A 5AOUA 2E1WA 4M29A 1DXFA 1CX9A 3L2MA 4HT3A 1TPUA 1EB3A 3GR4A 2Q3OA 3HM7A 4M8UA 5AC4A 3L65A 3LS9A 4CLMA 3T08A 2FZMA 3FEMA 1Q65A 4IFKB 4JIEA 1YTEA 4BA0A 3A5FA 3BUVA 5LIKX 2YCEA 2X1IA 4J3VA 2ISVA 3AAMA 2UWFA 5E5CA 4AFYA 1VLWA 1LT8A 3I7SA 4LVDA 3GXIA 3VZZA 1ITUA 4LY4A 3PSVA 3VIKA 3QR3A 3DFTA 4XAPA 4I9JA 1TPC1 4BI6A 2EPOA 3IV8A 4CCZA 3P6LA 4XD4A 3AXIA 4PSRA 3V0SA 3LHTA 5EMLA 1BD0A 4OOUA 3NPVA 2ACSA 3LSBA 4U31A 4JIPA 1I0DA 3N14A 4Z2KA 2CLHA 6REQB 2OZ0A 2YCLA 1L8PA 2HE8A 3UWYA 4LT9A 2QYGA 3MO7A 3PBUA 2OEMA 4UTMA 3DKLA 5L9FA 3CPRA 3UCQA 1H11A 2CLMA 4GXPA 1UR3M 4FLSA 3W7IA 4US5A 3FDKA 2GGGA 3RU8X 1J79A 3BJSA 1GOMA 2P76A 3TH6A 1XCXA 5JIWA 4PMOA 1XH0A 3U6WA 5HJXA 4LGXA 1WAWA 3L4YA 4Q8TA 3K46A 1EPVA 2FH8A 3A23A 4P7NA 1QW9A 1TTIA 3C0JA 3AIUA 4HYWA 1I1WA 2PDYA 1GEQA 2WHJA 1H0GA 3FJ4A 3UYIA 4P61A 2QCFA 2WHLA 4OT7A 2FHBA 4N6EA 4E0CA 5DLCA 2PDXA 3BLIA 4BF5A 4DWSD 1NDYA 1VEPA 1MW1A 4JTGA 1V6XA 4M5PA 1NOFA 4Y9OA 3FN9A 1OX4B 1YNPA 1Q85A 1U33A 1TREA 2FGBA 1PKNA 3WCZA 1Q6QA 3E2QA 3QC3A 3HJEA 1MDRA 2INFA 3NWRA 1EJRC 3SN4A 2WNZA 1TQXA 1SJBA 2FJKA 1JF5A 3R11A 3C61A 3PTDA 4O17A 3W7GA 4QRNA 1JQVA 4WJ8A 3NQMA 3ES7A 4IOTA 3PF3A 1EBHA 1WBHA 4ZCWA 1WKDA 5CZKA 1KCXA 4QCFA 4ALDA 2ACRA 3UEQA 4EE9A 1AJ0A 1UZDA 4O4WA 2QDEA 4O1DA 3GR8A 1I2OA 4OTKA 3TQKA 1OK6A 1M01A 1CB2A 3RR1A 4BS0A 4WDUA 5I23A 4KFPA 4C6LA 4AHOA 5KINA 4I90A 1I2PA 4FNSA 2QUMA 1CPUA 3PWIA 3ZJ6A 4CD7A 1W1IE 2V9DA 4R7JA 4N42A 2G95A 4GYPA 4ROPA 3LQLA 3TQ0A 1XI3A 1W91A 2TPSA 4IFRA 3RNDA 1OX5A 1HGYA 1EWDA 3E0FA 1PZ3A 5HBFA 5K9CA 1IT0A 3I68A 5F1VA 2Z1XA 1O5KA 5B80A 4AZBA 2HBXA 3ITTA 1X7IA 3OGVA 3VI2A 2FPYA 4Q4OA 1A5LC 3M43A 6A3HA 2YW4A 2A3HA 4U10A 1R30A 1IIHA 4DQWA 4XG1A 2BOFX 3PNUA 4ENLA 1WOBA 2G8ZA 3AI0A 4QHRA 2OX4A 2PRHA 2WBGA 3W38A 3C0SA 1SO6A 1XLIA 3TAKA 3N13A 3LCHA 1YXDA 4MWAB 4HSOA 3JZUA 3GIPA 2YA0A 3VNDA 1H0IA 1BYAA 1JYNA 4KWSA 1Q4NX 4QLLA 3UJ2A 1FA2A 1R85A 5DRCA 3NUKA 1IE7C 1XIFA 4JFVA 3K4DA 4GC3A 4HPXA 4RXGA 3N15A 4IQDA 2BTMA 4NASA 1BG9A 1Q66A 5BMXA 3LGGA 4CN1A 3PJXA 4AH7A 4JQ2A 1UR4A 3W1TA 4F0SA 3U8GA 3T0BA 4N6FA 4F9DA 2J6XA 4Q8MA 1W1A1 4UMAA 4W93A 2E4TA 2DZUA 1H41A 4H2HA 2BZNA 4GY7A 4KCWA 2ZUWA 3WJWA 3ZQ9A 1PJ9A 1RQBA 1S2WA 2VGFA 3HURA 4RNFA 1KGUA 1T6MA 4DM1A 1OCNA 4U5IA 1P4CA 4CU6A 4Z1AA 5G5IA 4YWSA 4LSBA 3C8FA 4WDWA 1LRQA 4QJ5B 3P14A 1TV2A 2FPVA 2PZNA 3BOFA 1XWYA 3S5YA 3WF1A 5DT7A 2ZX9A 5GNYA 2V5LA 3IJ9A 4M51A 1P0NA 3W88A 4IQEA 4H7VA 5KZDA 1LJYA 2VFIA 3MA8A 4NT0A 4J5NA 4J9JA 1IR2A 4KPLA 3IIXA 3POCA 3RU6A 3A3WA 4GYFA 1ZJBA 3QGVA 2WSYA 4WOQA 2VDGA 5KTLA 2DUZA 3GVGA 1O1ZA 4HN8A 2Z6JA 1TWSA 2DIKA 2FVKA 1UWQA 4IX2A 4GIRA 3S9ZA 3FIGA 4DF2A 3E5BA 1FHUA 4QDWA 4MYXA 1QK2A 3DKJA 4S2BA 1QU4A 2BNJA 4MB3A 1QI3A 2HPIA 3TROA 4LQ1A 3DFHA 2HPMA 2GJPA 3WKZA 1UD8A 3TNOA 1I4NA 1JCTA 4J4KA 3O05A 4PFHA 2ZICA 1OEPA 1TG7A 4HZ6A 1WQ5A 3IEBA 4Z2JA 2WCAA 1W8GA 3ICJA 4EVZA 4TX6A 3OGSA 4Q4QA 1NOUA 3PZVA 4MF4A 1XSIA 2BLEA 1B3ZA 1LUCB 4UFIA 1CXFA 4H2CA 3LXBA 4GABA 4PTWA 3WNLA 1PUDA 3R10A 4GNVA 3VC5A 4CD6A 1E0VA 1FX6A 1ZHAA 3GXTA 2YFNA 4R34A 1HGWA 5AKQA 2XU2A 3PS7A 3WBEA 4HOZA 4KWOA 3UR8A 1J9YA 1TMQA 3H6OA 4OVXA 3R13A 3WO8A 4LCSA 3EEZA 3IJ6A 3B9OA 1M53A 1FQ0A 3BLFA 4AC1X 4JX5A 1X38A 1H1YA 4EPBC 1RA5A 1F4AA 3DFNA 4ZA0A 5BRPA 2FHFA 1DWAM 1UP0A 1VYSX 4J3SA 4MSSA 3FKKA 3QHOA 2VDHA 4D6EA 1GOWA 4P7RA 3N2OA 1GQJA 1Q3NA 2ZX6A 2O9RA 1E5NA 3MJYA 4NX0A 4F48A 3E3HA 3F7JA 4YVVA 2ZRWA 2G3NA 1TA3B 3SUSA 1EGZA 3NVDA 3QV6A 1J4EA 2PC8A 4REQB 3ZT5A 4DJFD 5BROA 1H62A 4O0ZA 4GI4A 3KBSA 3WD3A 5DF0A 5I77A 1P0EA 3TSMA 3CBWA 1QOQA 1G4PA 1XRSA 1RQHA 5BXTA 3H7RA 1TYGA 5LSMA 1KQYA 3MBDA 1PAMA 1GTHA 1GJWA 2FTWA 3KTCA 1ENUA 4WEVX 4B5SA 1IGWA 2CBVA 1K02A 3VKKA 2D73A 3BE7A 4C7FA 2HS8A 1M04A 3TU9A 4A05A 3J7HA 2CZVA 4HMDA 2PP1A 1B4EA 2YA1A 1UOZA 3DHDA 4I5XA 3APYA 3MUIA 3G2GA 2GSJA 4DB7A 1AA1B 3R8RA 4FOUA 2Q09A 2CLEA 4HK7A 3LTYA 1LOLA 2ZQ0A 7XIMA 3WDJA 3RM9A 3TYCA 4GH1A 3WNKA 4LALA 2PDHA 3TN4A 3VD9A 5I00A 2FFCA 4CNOA 1HJQA 1OC6A 1VIWA 3F2CA 3EWUA 4LUIA 3UZZA 3GNPA 1KR1A 2NV2A 3NQBA 1M1BA 1EZWA 2XG9A 1B4KA 3GXNA 4F79A 1SSGA 1OD0A 3BOXA 4GA8A 3AS3A 3A24A 2BODX 3WNOA 3N04A 1J5TA 3GAYA 2JF7A 3PPGA 3KOZA 2AGKA 3MTWA 4GZ7A 1K77A 3KOYA 2Y7DA 1W32A 2EXOA 3WENA 3QY7A 4G9PA 3OP2A 4GD0A 3LN3A 3VKAA 1DJNA 1SJDA 3WDQA 2YCJA 4UTWA 1NAL1 5CBBA 5E9XA 4DUWA 1WDDA 1XDMA 1WX0A 4GUGA 4TX8A 2YCKX 5I3IA 5EFFA 4HU0A 8CGTA 3AMDA 3QPEA 1LQ0A 1PBGA 3BGJA 1HXJA 1QOPA 4BK9A 2B0MA 2D24A 2ZA3A 1FTXA 1UC5A 5DFAA 4W7VA 5LXXA 4FOJA 2DP3A 3LLXA 1WZKA 3GS6A 3G6MA 3AHTA 3U4FA 5A6TC 3WQEA 4PMXA 3VKJA 4JTSA 2J79A 2WCSA 5CAHA 3WX7A 3ANYA 1M65A 3VNLA 4TQTA 4FB7A 3H4GA 5FA5A 2ICSA 1TV3A 2VZTA 1J96A 3W1MA 4D6FA 2E9MA 1XLDA 3M07A 1ICSA 3A4AA 2VDIA 5JU6A 5C7VA 1UASA 4ATWA 2G50A 5CZJA 4MUZA 2PDBA 2ZVRA 3UXIA 3ABSA 1Z9AA 4FIQA 1EA9C 4JKMA 1ME8A 1W1ZA 3K8KA 5FACA 1A3XA 4MAVA 1E6XM 4ROQA 2Y5JA 1VFSA 1S2AA 2ATMA 2OLAA 4CCCA 4DY1A 2Y63A 1FKWA 2YX0A 1KM2A 1A5AA 1W56A 2NWSA 2ACQA 5GJMA 4TVCA 2P8CA 1TSIA 1ODUA 4Q32A 5LA2A 8TIMA 4PRRA 5G4EA 3AFBA 1PZ0A 3N73A 1EIBA 1TPWA 4AMAA 2E6DA 1J0IA 3BAIA 1A0CA 2V67A 2J25A 2J78A 4F9JA 1FCVA 2YBVA 3CV2A 4ZOBA 3CH0A 5MKGA 3D0CA 3E02A 4AXNA 3STCA 3W85A 3TX9A 1KGWA 1F3XA 1JD9A 4ZZ9A 1TJPA 4WVXA 2W67A 3LB0A 3ME3A 1P0BA 3GBDA 2GWGA 4EK7A 1GVQA 3CQIA 1FWSA 3EX3A 2A79A 3N18A 1FCQA 3IARA 3AMCA 3CUHA 4GQBA 2UY2A 3KXQA 1D7KA 1H1NA 1YADA 2DJXA 1JF6A 4JTAA 5H91A 5D2TA 4RV8A 1UUOA 3QN3A 1XGDA 1W3JA 1EYWA 4HYRA 4A6GA 1T8XA 3OVPA 2VXNA 1WE5A 4BFAA 2P3ZA 5I3JA 2VZUA 4JS3A 1JDDA 3VYLA 4NI3A 1OFEA 5AZ1A 3Q2DA 2YJQA 3FSTA 3S9IA 1UROA 3E96A 3UJEA 2DSKA 3OVRA 1V7YA 4AD2A 3G0XA 3VNJA 2VOTA 1JGIA 3IRSA 3EPNA 2J13A 3BLKA 1ZJIA 1W9UA 3A4JA 3PHAA 3I3DA 3KOWA 2R1MA 3GFXA 3CNYA 4O16A 2C1GA 3GZAA 1H7PA 4DXKA 4MWAD 5LIWX 4MNLA 1PZ2A 2GVEA 4IQLA 4JN7A 3VGGA 1VPYA 1SR9A 2C79A 1EUAA 4N9BA 1ZFJA 3DERA 3E38A 3PG9A 1XD0A 2C14A 3ATYA 1TJ2A 3VIFA 3L4WA 2ZE3A 2WMJA 3ARPA 1YNYA 5D09A 1O68A 3AHYA 2PI6A 4B3LA 2HWGA 1T8QA 1EJSC 1PV8A 2UV8G 4R5EA 2PB1A 2VD8A 4Z1DA 5A2AA 3W6LA 1SO4A 3DZ1A 3EWBX 1ICPA 3TE9A 4FA3A 4GO9A 2D2HA 4C6PA 4LY8A 4YVXA 5AY7A 6ENLA 3TA6A 1LLWA 3VABA 5D9MA 3KCLA 3W87A 1RP8A 5CQ1A 4IPLA 4KRUA 1UKQA 5TNVA 3A4WA 2VZOA 2DVTA 1ZQ5A 3K5XA 2VR2A 4HNUA 2HVNA 3GBEA 3MV11 4LYRA 3ALFA 4LX4A 4NNAA 1BTMA 4GO8A 3V0UA 4DJEC 1X6LA 4LAUA 3LTPA 1JUKA 1V6WA 3ZSSA 2X40A 3WF2A 3JR2A 1G7UA 1L6YA 1RBLA 4IHCA 3PPHA 3QRHA 2B7NA 3Q65A 5E93A 3ZWSA 2Q6ZA 5FF2A 3GE7A 1Q5MA 4UCGA 4QLJA 4QIUA 1IZCA 4Q22A 4UR9A 3UW6A 4Q4RA 4JN6A 3QPZA 3AIVA 4BWLC 5EB8A 3QZ6A 2IMRA 1OFOA 1KRAC 4FLOA 4K1GA 4I8DA 1EIXA 2BASA 1O6IA 1J6OA 1MWOA 2WMGA 3N19B 4I6VA 5HWNA 3GUGA 3HTWA 3NYDA 1NH6A 2ZXAA 4QSHA 1JZ2A 3WQVA 4IP7A 2V5KA 4C60A 2X8RA 1KTNA 1MDLA 2ZVIA 3T2OA 1UZ4A 2PURA 3SB0A 3UGVA 3ITOA 3VK5A 1TR9A 4YU1A 4LAZA 1WPCA 3WQWA 2OSWA 3B9NA 2PAJA 1DE5A 3EKZA 4LB4A 4MLJA 4UR7A 3A3HA 2VEKA 3G5EA 3SDOA 3GB6A 1T41A 3VTRA 1MXGA 2UY3A 4ERAA 5K4ZA 3QOKA 4C1NA 3TWBA 3ITCA 4DHGA 5F4SA 3RPDA 3GFZA 5TQLA 2QMJA 3OA5A 3FV9A 3MJMA 3WF4A 4E3TA 1HO4A 2IKGA 4W8BA 3O0FA 4M6QA 4K37A 1YE6A 1WDSA 3ZVIA 3C2RA 1PIFA 2J8FA 1VCVA 2VX7A 2DV0A 3AS2A 3TOYA 4JTDA 4FNQA 5AYBA 3O6YX 3FA4A 3QC0A 3GDTA 3ABQA 1Q6GA 3AZSA 1JYVA 2PTDA 3OB8A 2G37A 3G3DA 1QNQA 1TV8A 5HUOA 3MHFA 1JDFA 4GIEA 4BQ3A 4PTVA 2GJLA 3M5ZA 3IK2A 2PWHA 2C8NA 1XIJA 5JXQA 1HKKA 4A22A 3UG8A 3SCNA 5AN7A 1VHNA 3REQB 2XZ9A 1FUYA 3OQEA 5CJNA 3W7NA 2Y7FA 3CL8A 1GJPA 3R0UA 3CQHA 1JQXA 1LRTA 4MIMA 3R8HA 3FW6A 1VHCA 4HKPA 3TW7A 4C6EA 4PCNA 4B5NA 3VOHA 1JCNA 2DSWA 2ONEA 2V0TA 3WUEA 2RUSA 1OF6A 2ZCGA 4B91A 2A4AA 3T0AA 1J2BA 5DX7A 4DLMA 4I6KA 1Z41A 4JIIX 2ZZ1A 4LUSB 3WF0A 5CC6A 1KFLA 4GVFA 1E9LA 2D0FA 5BOFA 4J2MA 5CC7A 4DWSA 4J3ZA 1Z7AA 3GHRA 2HE5A 2WC3A 1M5WA 4CD5A 1JZ4A 1RVKA 3SCPA 3IUDA 3FFSA 1PKLA 1G1YA 4O57A 4LF2A 4NG3A 5EYWA 3RMJA 3GZ3A 2RGLA 1V51A 1Y7VA 1FDYA 1GHSA 3OG2A 4W88A 3SUTA 3T4CA 2CC0A 2UY5A 4HHMA 4S3BA 4XD3A 2YYUA 3LERA 5CLWA 3MVIA 3HGOA 4U5KA 3KLKA 4GI6A 3OZPA 4P8UA 1RR2A 4GE8A 5HNUA 1UH3A 3KBNA 1Z44A 4WKAA 3NEVA 2WVUA 1S3TC 7A3HA 1C9WA 2Y70A 3ZJ7A 1HFBA 3UCDA 1ONRA 3S2MA 3TLQA 4ZTYA 4CCEA 2QAPA 3T05A 1PE1A 4AEFA 1H7OA 1C3FA 3BSMA 1OD8A 4C6QA 5D8ZA 4MTVA 2ISDA 1PKMA 4D71A 2YLLA 4D6JA 2FZ9A 4AZCB 2XSXA 3E1F1 1XYZA 2XYLA 3PBVA 4A21A 3CZ8A 4DWDA 5CXPA 1K8CA 1CLKA 2ZKMX 9XIMA 3CH9A 3TYBA 3K8LA 1XS2A 4S3EA 4WSKA 4K1WA 3ZR5A 2ISWA 3GTHA 3U57A 3ERPA 3RCNA 3GM8A 3F4DA 4Z08A 4N9EA 3DXIA 4W5UA 2XFFA 1POJA 1FXQA 4YIWA 3JZEA 3OHMB 4HN4A 4GISA 4XAZA 3U0HA 1XHGA 1WUFA 4AWSA 3TIMA 4J27A 2VQUA 3RG6A 3H21A 3CMFA 3S2CA 1U1UA 2G4FA 4MAZA 3W1PA 3HMJG 1GQLA 4TXEA 3FGCA 4NZ3A 1NQ6A 4FLRA 3DG6A 1RALA 1DP0A 2UY4A 1GZ1A 4IIHA 6TIMA 3SY1A 3O3RA 1M7XA 4H6QA 4UFLA 1XLJA 5FJPA 1K1DA 1V08A 3VMPA 2ATSA 3FEQA 4JHMA 1YEYA 3SI9A 4GG9A 1S2TA 2W5FA 2VCAA 4R27A 2Z24A 3AMKA 3HN3A 3SUWA 5D9NA 4BEQA 3SBFA 4ZL1A 3R94A 3L4XA 4B92A 1KD0A 5AC7A 1RSCA 2ZZ2A 4ACYA 3CIVA 3M0VA 2GJXA 3G1HA 4YPJA 1UG6A 4FXRA 3WQ4A 3IGHX 3WQ5A 4KESA 3B05A 3E6EA 3RFAA 3TTSA 3SGUA 1SW3A 1FWBC 1HKJA 4GJ1A 5HMFA 1AW5A 2FGLA 1CGVA 3RM8A 3D3AA 5EBAA 4HJWA 5PTDA 4Z1YA 2PU1A 1B1YA 1C8YA 1XLEA 2Y88A 1V3IA 1XIMA 4HK5A 4QR6A 1W5NA 4HTBA 2VR4A 1ZNNA 9XIAA 2E28A 3AWNA 4G7FA 3NL2A 4D6HA 4CVWA 2DZPA 1OWQA 3E0IA 3RAOA 2NQLA 1FP8A 3ARXA 1QO5A 1R3SA 2ZRVA 1UYQA 3FX4A 1JPKA 1OG0A 2ZA1A 3DBNA 1TIWA 3SCWA 2ZZ7A 4TVDA 3VX0A 1IEIA 4H01A 3N9KA 3QH2A 1O7AA 4AD1A 2A3CA 4KMQA 4UTLA 2ABBA 3R6IA 4P7QA 1M7OA 4UFMA 1NFPA 4LEQA 1A4LA 2SFPA 1JXJA 2Z29A 4WD0A 7REQA 1JDEA 4XUGA 2NQ9A 1JULA 4JTUA 2V3GA 1WAUA 1BWKA 1WOAA 4DO5A 1KTCA 4XTIA 1LQ2A 1KXTA 2FKPA 3NM1A 3BAWA 2Z27A 1K8YA 4MZ1A 2IXVA 3BW3A 2JKEA 4JNYA 5CBJA 2Q71A 3H22A 4FALA 3PAJA 3NZQA 4ECLA 1X7FA 3OLDA 3MDUA 5A6AA 1Q6LA 4RUBA 5T9CE 1HNYA 5AHMA 4NZJA 1IZKA 3QLDA 2PS2A 3CT2A 1V02E 4JTEA 1FWTA 1Z8AA 1P6CA 3UG4A 3MUZ1 1NF0A 1L6SA 1TE6A 4CQCA 3CT7A 1TV7A 3WL0A 3MI6A 3WYZA 5ABEA 1PSCA 5A1AA 2HQAA 2PGRA 1YRRA 1AG1O 2J66A 4R7WA 2EKCA 4EF8A 1KWGA 3T42A 2G3JA 3VDCA 1UKOA 2ZIDA 4LYKA 1UD3A 1UOKA 1R9XA 4AYGA 1W17A 3S1XA 2TMDA 5BZAA 2V8ZA 4Z17A 3UFYA 1HVXA 4EACA 1UQZA 3G24A 3BW2A 2H3BA 4QJ3B 1GKRA 5ECVA 4MDPA 4AX6A 5HQLA 3HJZA 4H00A 1LQAA 4DJFA 2J6VA 2WSKA 4MNMA 1HZYA 2OLHA 1BXNA 1PZ1A 4MPQA 4DPPA 1V02A 3VIJA 5HWJA 4E2BA 3W7KA 2BY0A 3RLUA 3CIXA 3MANA 3TTOA 2VJXA 2F6XA 4GZIA 3T6CA 4WJEA 4U2YA 1W9XA 4MFEA 3KZSA 2NT1A 2R1PA 4EPEC 2ZZ6A 5A8QA 4MY1A 3HO8A 2YDQA 3VMNA 1MQRA 3NSNA 5DELA 3W1UA 4WQ6A 3PVFA 3V5CA 1KFWA 4UFJA 4M7SA 3EMCA 4AAJA 4OUEA 1BPLB 1GCYA 3LI0A 3BCDA 4BZYA 3MI2A 1VFHA 1XC6A 4S3GA 1Y0EA 4LUJA 1OK4A 3WQ8A 3FOKA 3DESA 4PBEA 4OBSA 4RDYA 4WDXA 2J7CA 3AJXA 4WY0F 1DBTA 3IJ7A 1K6WA 1H61A 2CITA 1HIZA 5AFDA 1W37A 1QNRA 2V6AA 1OCJA 3RUBL 3H24A 3IIOA 4KEZA 3NAVA 1XG4A 3N2BA 3TK7A 4H8HA 1XLHA 4JAWA 3VD7A 1QFEA 3IGXA 1EXPA 3GH5A 1TX0A 4E4PA 3OVQA 2YW3A 3IJDA 5M2FX 2WWCA 2A6LA 2QMKA 3A9IA 4L5ZA 1CXIA 1JR1A 6REQA 4ZE4A 3TUUA 1RAKA 1PXGA 3W74A 2IPFA 3NOEA 1GNXA 3L2IA 3B9AA 4V2XA 4ZODA 2KZHA 2Z00A 1V4YA 1VD6A 3K30A 3AWOA 4XK2A 1XCFA 4ZGYA 2NQZA 1BVNP 4Q7BA 3TYEA 2V30A 2J74A 4PRTA 3HFYA 4O53A 1O66A 2MNRA 3CUGA 2VCBA 3PB2A 1SSDA 2PDJA 2XHYA 5I3GA 2OWXA 4CU8A 4JYEA 3VIOA 5CPQA 1C8VA 1H4PA 2ZZ5A 1NOWA 3U4AA 2NUXA 3GNRA 2F7FA 3H70A 1XLAA 2JEQA 3WLLA 3MHGA 5J5DA 1EHAA 3N1AA 4BCEA 3WL1A 3L4VA 1OZMA 2VX4A 3ES8A 3FA3A 1T5AA 4EXBA 2GFTA 3BDKA 3BLEA 3NXLA 4LPCA 3SY5A 3S5SA 5D30A 1FWEC 2WSQA 1F76A 5TD4A 4CD8A 1CB7B 3AZTA 1DJGA 2G3MA 3KOXA 3F4NA 8XIAA 1OX4A 2QIIA 3IVTA 1D3GA 2QPXA 1NP0A 2D2GA 4XB3A 4NZ1A 4B5XA 3EEGA 4MHBA 4QE5A 4F4RA 5KEZA 1KXQA 1QATA 4XUYA 3UGRA 3O16A 1B5TA 1Q6RA 3DENA 3M47A 1XLMA 1ZAIA 4L6OA 3AALA 4IMGA 4R88A 1JYWA 3GVVA 3OBEA 1Z69A 5AZ0A 5A8GA 3CYJA 4NUWA 1MEHA 3DEQA 3LCIA 3TQPA 3B0PA 3W75A 1AD1A 2NVCA 2AKMA 3OODA 3DFYA 2Q8XA 3C2FA 5KZMA 1UZHA 4MWAE 5CPSA 2OFJA 2VHLA 4YTTA 3CUFA 1E6RA 1SPQA 1CECA 1E4LA 3LCXA 2DT0A 2J9XA 4DBSA 5JBEA 2WMFA 2YPIA 3M0KA 3LGDA 1K9FA 2CFFA 2Z1WA 1PL9A 1DYSA 2CIPA 2I17A 2BY2A 1BKSA 4YMZA 4POCA 3RLHA 3KUMA 4PTNA 4ZSUA 5A8OA 1UUQA 3CAWA 4GX9A 4AMCA 3W53A 3VNYA 5E9AA 2QCDB 4ZO8A 1L8NA 4TV6A 5D05A 3RMEA 1P43A 2HEJA 2OLSA 3EA3A 3MZ2A 2NV9A 4O10A 2NXHA 4WRHA 3KL5A 1A49A 3WK3A 4F8XA 4O8AA 3NZPA 4IISA 3L67A 4RJEA 4Q33A 3P7YA 1AODA 3RCYA 4UTWC 1EUNA 3WD4A 2EQDA 4MWAA 3VPLA 4RE3A 2R8WA 3R25A 3WELA 4D8LA 1UJPA 2Q02A 3H26A 4WOZA 3A12A 2W62A 4WLCA 3DCPA 1MXSA 5DMMA 3T0CA 5BNKA 2V38A 5K9XA 4W85A 1BHGA 3WJZA 1ZCOA 3NQ7A 1EC8A 4YL2A 4WKFA 1OINA 1DWHM 1IGSA 1W8SA 3AICA 4ZE5A 4C6DA 2E8YA 1KNWA 1S38A 3TVAA 1MEWA 2UZ9A 5CJMA 3MVTA 2WSRA 1VGAA 5TBOA 3SIZA 6TAAA 1KXHA 1UWTA 4U3CA 2A2IA 1UC4A 2A3LA 3GK0A 1VBHA 1KFBA 2XZ7A 2EF9A 1HL8A 5I79A 4TR9A 3OLIA 5LNUA 1W1VA 3NM3A 3S46A 1UB3A 2B4GA 3O2LA 1T7LA 3GLCA 3FVMA 1JZ3A 4S39A 3MBFA 3CC1A 4HU8A 2WKGA 3CM4A 2AOSA 3QZAA 1DIOA 2CETA 1B0IA 4DX3A 5H1WA 4HMCA 3P2VA 1Q6CA 1RK6A 1AZ1A 2GK1B 2WWDA 2G41A 2WM0A 4PL2A 5HNNA 3W23A 3IANA 1R2SA 1T40A 1N8IA 1DOSA 3GC4A 2J47A 4A8RA 4J7RA 3LUTA 2DDXA 5FEXA 3W07A 1VEOA 1XXXA 4U2ZA 2YOCA 3BAYA 1FWFC 3S1VA 2R1NA 5C70A 1ISWA 5D37A 3EWZA 4NIRA 3VGBA 3F5LA 2Z1SA 1EDQA 2CWNA 2HBVA 1XINA 1WDWA 2Y0FA 5EY5A 1BAGA 1XYBA 1JCYA 4XO6A 2CNCA 1DWFM 3IVSA 3BQ6A 4P5UA 2VX5A 3WNMA 3QYSA 1BG4A 2PDCA 1YNQA 2H8ZA 3EB2A 2PWUA 1LTDA 4PR4A 2W27A 4K8GA 5AB3A 4JFSA 3NQDA 1GVOA 4JTJA 5TIMA 1BXCA 3PTMA 2C16A 5DY2A 1E0WA 3B8UA 4QTGA 4X0NA 3M46A 4Y9PA 2NV1A 3O63A 5M5DA 2CLFA 3WQGA 4IG2B 1LUCA 2GYIA 1R9YA 1YDYA 3FAXA 4AVOA 1G5AA 3G1VA 4EPDC 4MOZA 3C0LA 4XQ6A 3G1DA 2I1OA 1X97A 1KA9F 1DJHA 3VNKA 4LEFA 4JEJA 1AD4A 2H6RA 3VCCA 1J12A 2BXZA 3W82A 3CL6A 1LLOA 4XAYA 2GVGA 3EYPA 1WDPA 2X16A 1TELA 3N4FA 4QSFA 4PE8A 1EJWC 4O52A 1DIDA 1VKFA 4RE4A 3TW6A 1ADOA 3DGRA 4J40A 7CGTA 1L6GA 1JNEA 3C2VA 4S3CA 4WXZA 2HJPA 1QDSA 3R1ZA 1V3HA 3FYYA 3KRBA 3T81A 4KWUA 4WGXA 1CXKA 5A95A 2YYTA 3W70A 2Z7GA 1RQEA 3LM3A 8A3HA 4QG8A 5CZ0A 1IT8A 3UXAA 1VH7A 1X6NA 4LUTB 2C91A 3I10A 1GOKA 4JIRA 2NSOA 1TWWA 1UWRA 1XQLA 2BY1A 3S1WA 2YDSA 3QEZA 5G1YA 5C0QA 1DJYA 2E77A 1TA3A 3AXXA 1E0UA 4AEOA 5KZEA 4DN1A 7ODCA 2VVNA 3OTRA 1NARA 4QQ3A 3U2EA 3NQEA 3CV6A 4REQA 3W2KA 2PD5A 1TCMA 4PZVA 2VNCA 5LNSA 3KVMA 1PDZA 4ILSA 3UA4A 4JZ5A 5T9BG 3BGGA 4LC6A 4QJ1A 1PTAA 1K03A 3E49A 3V75A 1JDAA 3GDKA 1QNOA 4GXWA 1W3LA 5FAJA 1ML1A 4PC8A 4LXFA 3WEZA 2P0OA 3VA8A 4GMEA 2OKOA 5HUPA 1GHRA 1QO2A 3NYZA 1RVGA 4LWWA 3FKRA 3MUXA 4BJHA 1F05A 1BGAA 3U7VA 1I2QA 1EKOA 1A5NC 3HZ3A 4CNNA 1DQWA 4AIEA 1F73A 4AHPA 3WLKX 3KL0A 4Q4KA 2XUCA 4MB4A 1FWNA 3F5JA 1VJZA 3S8HA 1WKEA 3LEPA 1NVMA 1BLIA 5FJRA 3SFKA 4XZIA 4KRTA 3WMCA 1J6PA 3W00A 4PUJA 1JFXA 1XYLA 4JIQA 1NF7A 3VINA 1C9DA 1RBAA 1R8LA 1L6FA 3N4AA 3ITGA 1XL9A 5IM51 2XGZA 4PMDA 3Q37A 1E1EA 4HK6A 3VKBA 5HXMA 3CZEA 2I14A 4X63A 1S2UA 4MMWA 4XD5A 1YPXA 2QW5A 4DNHA 2JKAA 4RZ5A 3CLMA 4HNOA 3GNNA 3PTKA 1QI5A 1IEWA 3AIQA 1GK8A 4GPNA 4AIBA 4GKLA 4IMDA 4MZ8A 1SW7A 5I78A 4MJMA 5AHLA 1R0MA 3BJFA 4US6A 1GORA 1HL2A 2BV9A 1JVNA 2OCZA 1OZQA 2WMIB 4GFIA 3IJ8A 2PDQA 4H9VA 5A6BD 1OSEA 1VS1A 3O6AA 5E0FA 4XSLA 1KRMA 4B4HA 1MW0A 1NFBA 4MJ4A 3W0KA 3SCSA 3HB9A 6ALDA 2WKLA 4UOJA 3G0UA 4LJ3A 2QS8A 1VF8A 3PZ9A 1SQ7A 1OX6A 1YIXA 3WNNA 5K2ZA 4GOAA 2O4QA 5RUBA 2CXEA 1YQ2A 3GU9A 1PTGA 1ZL1A 4I7UA 2ALRA 1ZZMA 5I07A 3ARZA 1UIOA 2VYOA 1AZ2A 2C15A 4F0HA 2ANUA 1IWPA 1FKXA 1Q63A 4PUUA 1DTUA 4ZFMA 3NQ6A 2PWVA 5HR7A 2ISSA 3ISIX 4RDWA 1EPXA 1E6SM 1FH8A 3URQA 3NURA 4ZOAA 3UU0A 5AYXA 1DVJA 2WANA 2JGQA 3CHEA 5LA1A 2R9RA 1T0OA 4JNZA 4AW7A 4LRTA 1E51A 4H9ZA 1J0YA 3M7SA 3OU8A 3ABRA 4EPKA 2ZRZA 2AQWA 3L21A 3WQOA 2NXIA 4MKSA 3BZGA 3KBWA 2YCIX 3XISA 2PA6A 3FS2A 2GQ3A 3HPFA 2GVLA 1D8WA 2BVDA 4DWSC 2BFGA 1VFMA 5CCZA 4QS5A 3WDIA 1TE1A 3WK0A 1MI3A 2BOGX 4B2DD 1KCLA 4WK9A 2OB3A 2GOKA 1M6JA 5E6YA 3W84A 3TTEA 2WPGA 2OKTA 3T2PA 2EJ1A 2D0HA 3NQVA 1I45A 2PWFA 3HG3A 3ID7A 1DORA 3VFLA 3SO7A 1AUSL 3A13A 1PTDA 3NZRA 2FVMA 4GQGA 4R7OA 2OWWA 3HQNA 1LL7A 1OT2A 3CZJA 2QZRA 3KP0A 2B81A 3OJGA 5DANA 5ECUA 2VWTA 5FSEC 3VUPA 3VKCA 3H54A 4R53A 2J88A 2RDUA 1LWJA 3RYSA 4KFOA 3EWCA 3GHTA 1IHIA 1OGBA 2QKFA 4IMAA 3PWAA 2HTMA 3CWHA 5HWMA 4TTGA 1FWAC 2WZIA 2PCEA 3V36A 4BI5A 3GC5A 1KFCA 3UZXA 3QZEA 2ODOA 4D1IA 5CGMA 2PWGA 3FHQA 4LTSA 2ZC8A 2XWEA 4U4MA 2E5BA 3PJUA 4XIMA 1V79A 3WNPA 4AZ5A 3G1AA 5C2CA 2VFEA 1C93A 3W6YA 5ABHA 1WDQA 4YHGA 3W9ZA 5FF0A 2Z4GA 2PU0A 1GVYA 2BGQA 4E5TA 1GUVA 1LF1A 3G1YA 2BSLA 4O1AA 1Q6DA 1B3YA 4N4PA 4W8AA 2C18A 2YL5A 3WK1A 3CEPA 4AIUA 2ADAA 1JUEA 1XBXA 5EMKA 3AISA 5FCZA 3GC2A 4NAFB 4OV9A 4LW7A 4NAEB 1OM0A 2CW6A 3UR5A 4IM4A 4LOCA 1US3A 3EOSA 1VFOA 1CCWB 1XKYA 4YTSA 1HN1A 4XTDA 3QSTA 3K8MA 1K7XA 3N2XA 2QULA 3TLLA 3S6DA 3CPGA 3DG7A 3RCMA 3ATZA 4L1GA 1WZAA 3G18A 1C8XA 3TSDA 2C0AA 4UTTA 3BMVA 3LSCA 1JCLA 4Z2GA 3A9BA 5F2MA 3GVRA 3M5YA 4PUEA 3AROA 2OEKA 3WFZA 1RY8A 2V81A 2QV5A 3LNMA 4HZ7A 5BMWA 4BF9A 2EG6A 2VC7A 5A8PA 1EZ2A 1UBSA 4ZO6A 3GG8A 1LBLA 1JCXA 3M16A 4NP7A 3T44A 5I03A 3B0XA 2DVUA 5KMYA 3IIPA 1E1CB 4J2PA 2G0WA 1XIBA 3FNDA 3GDMA 4UFKA 3CB8A 2XFWA 4P8VA 4PMJA 1PYFA 1Y5XA 4DVOA 3B06A 1ZPTA 5DN1A 2XIQA 3DFPA 4JQ1A 2J8TA 3E12A 1BYCA 2BGNE 1JL8A 3MYOA 1EO5A 4O1EA 2VT0A 4MJ2A 1AVAA 1EJTC 1TRIA 1DIKA 1WP6A 3S6OA 4LNCA 4S3DA 5HULA 4O15A 1IF2A 5CZSA 4WCJA 1O4UA 4EWND 1K9DA 1T96A 4DZ5A 2Z28A 1ZAJA 3W1QA 4GXMA 2DSZA 1ZJAA 4D6CA 3CO4A 4LS1A 3WSUA 1ICQA 3MCOA 3WJXA 3UZJA 3T8QA 2Z1VA 2D1ZA 1QMLA 1L6WA 3SM0A 5DMYA 3HQ1A 4PMNA 4DM2A 4I5UA 3TMQA 2P53A 3LI1A 1W3IA 3QHMA 2X1TA 2A1YA 1NDZA 3QPYA 1OBAA 3KS6A 4S23A 5XINA 3TOPA 1EGMA 3F03K 3EXRA 2F2HA 2E6YA 3NA8A 2Y7GA 4A4AA 3DI0A 3BV4A 4FF7A 2X1RA 5F4XA 4M81A 3L12A 2I5GA 3UR2A 1XBYA 1JD7A 3VAVA 3IJLA 4LCRA 4LV9A 4Y96A 3ARRA 4WR3A 2V5DA 3MP3A 3C86A 2X7VA 3REQA 1V0NA 2NQHA 2PDWA 4EP8C 3M0HA 3SCRA 2QDHA 5BXPA 3F4VA 1UWAA 1BQCA 5JQ9A 4JFUA 2TYSA 4Y90A 3H4WA 4DJDD 4UQBA 4IP5A 3PZOA 1PVNA 1QR7A 3QY8A 2VFDA 3GX9A 1VRDA 4CNUA 3PR2A 4FI4A 3THUA 1PHQA 3ZWTA 4DAIA 5CKSA 2F84A 4LUSA 2QQ6A 4XVDA 1VZWA 5HK4A 4E4FA 3PPCA 4IXHA 3S6TA 2WJFA 2Y6ZA 3B0UX 5G2IA 4KT2A 2E67A 1MO0A 4NVTA 3UG5A 3CJPA 4O50A 4ZR8A 4IWWA 2O56A 4OV4A 3THQA 2O7SA 1AH3A 1IEQA 4GLEA 1SZGA 1TVLA 4C6JA 3WFLA 1BVZA 1IWAA 3GDBA 1SJAA 3IIZA 1KWKA 3N2MA 2VELA 4E38A 1KO0A 3EX1A 5A69A 3CV1A 3F5KA 1LBFA 1MNSA 1GT8A 2QUNA 3NPUA 3GIYA 5AYYA 3H7UA 2EPKX 3SJ3A 1VPXA 4WIWA 1BGGA 4DJFC 4IGHA 5CPLA 3L4TA 4MNKA 3RPMA 4AZIA 3M0LA 4ZXLA 1A50A 1WYIA 3LCGA 1EC7A 4IL2A 3SGGA 4UTFA 2YSWA 5C6MA 5EMYA 3BG3A 2ISFA 2RDTA 3KOFA 4NYUA 3ZLFA 3U48A 1O5RA 1AH4A 2V2HA 3GH4A 4M24A 5BU9A 2QCGA 1E70M 2O9PA 3P62A 4OGZA 3STFA 4QQUA 3B3DA 4PMVA 2AGTA 3T55A 1R38A 3FJ6A 4PA8A 4AZCA 3ZM8A 1GZGA 3KRZA 3VILA 1HX0A 4IPPA 2WC7A 2F8QA 1R3YA 4FLQA 2QUUA 2PMQA 1TTPA 2JF6A 4HPJA 1UKSA 4XBKA 4N9DA 4C6CA 1BXBA 2DU2A 1XH1A 1D2KA 4PGLA 1I75A 2PWEA 4DO7A 1PWMA 3RXZA 1Q7MA 4ICMA 3S83A 3MCMA 1XX1A 2RDXA 5DRIA 3RK8A 5AYIA 2W91A 1JFHA 3QKEA 2XIMA 4DZIA 1C90A 4Q8QA 4WF7A 4Q6XA 1XD1A 3ZXWA 4FHAA 2WNWA 3KVLA 1A5BA 1ZENA 4IX0A 3HGRA 3CS2A 3CTTA 5I3DA 3IK4A 2WVVB 3NO1A 1XBVA 1FWHC 5FEWA 3MCNA 1M7JA 3RRAA 1RPKA 1S5VA 4ERGA 4PMYA 4K7YA 5DCEA 1V6UA 1TMLA 1QW7A 1IIGA 2WKJA 2YBUA 1JI2A 3D6NA 3DC0A 3NOYA 4EX4A 3SAZA 2D3NA 4G56A 2A0NA 3WD2A 1Q7QA 1HKMA 4JN8A 1X39A 2E09A 3UZYA 3LXAA 1M03A 4HIBA 1VBUA 4P7OA 4K2SA 4XKYB 3EMQA 2OQYA 4Q4SA 3EWWA 2XVGA 4W87A 3UVIA 1VCGA 5IHRA 5LIUX 2WVSA 1VRXA 3MZNA 4QP0A 1IQ8A 1QI0A 3ANVA 2HV5A 4QDPA 2JIWA 1KFJA 4HZ8A 2CU0A 2V3EA 2O92A 4KFNA 1NDWA 2VENA 1J5SA 2QDGA 1MEIA 4ICCX 4C6NA 1Q45A 1ONXA 5BOEA 3MDWA 4O0QA 4PMZA 2D22A 2CLLA 4O19A 1ADDA 4F2TA 2V5BA 3H2EA 3BG9A 4AIOA 4X22A 2W61A 4ZB2A 3RX3A 3BH4A 3S0CA 5CSSA 1KV5A 5FJIA 2FHCA 3EAUA 4QISA 3WQFA 1SZEA 3KL3A 3EDKA 2ZUSA 1YDNA 1DV7A 1JPIA 3S47A 1PCWA 1S39A 3CUJA 4O8RA 4GNKB 5D4YA 2Q3RA 2DUAA 3FJNA 1LM1A 1TWIA 3STPA 1EH9A 1J93A 4HQVA 3ZVHB 3W26A 4CD4A 4EAMA 2WJZA 5LA0A 4J3TA 2Y89A 3UY8A 2GJNA 5J04A 4HZMA 3GU2A 4YJ5A 1RY0A 4U33A 3S2LA 1J0HA 3TAOA 1RPXA 4UTJA 2OU4A 2GVJA 2WV8A 4Z2HA 4MYAA 2OYMA 3SCUA 1JCMP 5A8NA 1UR9A 3QFWA 4RZ4A 3ALGA 3KFTA 2VL4A 4QNEA 1JUBA 3M0JA 3P61A 3R0KA 4DYEA 3EDJA 4AD4A 4AB4A 3GDLA 3GQYA 4JTHA 5CLTA 4LFYA 3W1XA 1A5CA 4LANA 4GGHA 3KTXA 3P5YA 4P2VA 4MB5A 2VEFA 1MQQA 2FDMA 1ZUAX 1YXCA 4M1BA 3ITYA 4HPNA 2ZUMA 1QOXA 1H63A 2PF8A 2XVNA 4OBTA 1V3MA 4Y8EA 1XPGA 4KWVA 2PDNA 1EEPA 1XW8A 4HHLA 3KRUA 4FXSA 4J3WA 1JYXA 4CU7A 1B9BA 1E9YB 3CHFA 3H2OA 2BBFA 4XBSA 4X9SA 4H7ZA 4CVUA 2ABAA 4XX6A 5HQEA 3TWAA 1R3QA 2PDUA 1QUMA 1H3GA 1XSJA 1Q6OA 4GACA 5C2XA 2I7GA 3LMYA 4B3ZA 2FFIA 4C6KA 3ZZ1A 2RH9A 4P7LA 5T26A 4JIHA 5M1TA 4MWAC 3NGJA 4GYJA 3F1QA 3M44A 4KCUA 1HP5A 1EO7A 4IPNB 3ECQA 4ZO9A 3UWWA 4JX4A 2Y7EA 1RHCA 3P81A 5G2HA 5GNXA 1DXIA 3VIGA 3VGEA 1EYEA 4O4VA 2E25A 3WEOA 3W3OA 1E15A 4RCXA 2QIWA 3VCNA 3HA1A 1NM9A 2O4MA 2O9TA 4KCVA 3L5LA 3MMWA 1PPIA 1OIFA 3F4CA 4IJRA 2PC4A 4B5TA 3GNXA 4GUHA 2PBGA 3WMLA 3NQAA 4IUGA 1RD6A 3W4RA 3TFCA 1ZGDA 2R91A 4N2YA 5LKYA 1S2CA 1QT1A 4X60A 2FZNA 3DOPA 4A35A 2XN0A 4GUFA 1F6PA 1LYXA 1VAHA 4C6BA 3HF3A 3A6OA 1NWSA 2P8BA 4CKQA 3S1UA 1ISVA 2QGYA 2YL9A 1IWBA 1ZLPA 4R3UA 4CN4A 4ZO7A 1S46A 2DT3A 5DQPA 9CGTA 1SW0A 1YBQB 3P8JA 2DEPA 3AS1A 2CLOA 1TVNA 2ZTJA 3BXWA 1MVYA 3PP7A 2A7RA 1K7EA 4HTYA 3SCVA 3VOIA 1DEDA 5DXXA 3EOUA 3NQ2A 2X2YA 1ME7A 2O9OA 3AIBA 3BTNA 3ITLA 1ALDA 2DH2A 3V5OA 1EBGA 4XO7A 1DWGM 1ZRQA 4WY0B 3C3NA 1OQFA 2CKSA 3TC3A 4CCDA 5LZLA 3SUVA 1OFDA 2MANA 1UCWA 3EX4A 3WZ0E 2AL2B 4D2JA 2OR2A 5I7GA 2QJGA 1R6WA 5D32A 3AUOA 3WUBA 1O60A 3WY1A 1JXKA 4QEEA 1R7OA 2QCEA 1RA0A 1GONA 2NX9A 4RX0A 2BX7A 1LRNA 4K8EA 4H4IA 1CXEA 1B30A 3E2VA 4XZLX 3SN1A 4Q7IA 5LNVA 4MPKA 4GINA 3VIIA 5HDRA 1O94A 2ZUNA 3W22A 4QNWA 2L5HA 4B90A 3UNDA 2V2CA 1OGSA 4E8DA 1C91A 2GPTA 3UP8A 1XP3A 1YXYA 3UWVA 3W76A 5FESA 3CWNA 3CQ0A 1VBJA 1XBZA 3KWXA 5A6JA 4Q8WA 2YKKA 3PJWA 3VE9A 4CQ9A 5A6BA 4JX6A 4EXQA 4RW5A 1XLGA 4XAFA 5A6MA 1B90A 3KVJA 5LHEA 4W8LA 3WQDA 4A3UA 1WO2A 2XWDA 2WB5A 2Y1HA 3INPA 3WLSA 2P5NA 3UESA 1V6YA 3VVGA 4BY3A 3WH7A 5C5YA 3FHAA 5ABFB 2FDSA 4F0LA 4IH3A 5HPCA 5C9ZA 3LV6A 5D02A 4V1XA 4B5UA 5A6KA 3S2JA 1PO9A 2BVYA 4JKLA 5EMUA 4UC5A 4LYPA 4P8XA 1GKPA 1M41A 4GY0A 4MADA 4L64A 2EPMX 3RO8A 2E9LA 1CENA 1F6YA 1CEOA 1AH0A 4WXYA 1CW2A 1VBGA 1S5NA 1TPDA 2Y8UA 4E2OA 3FDGA 4P8WA 1FY6A 4KW2A 3S5NA 1OY0A 3C6CA 5MHBA 4GCAA 4PUMA 3SQMA 3ITXA 2C1HA 3VO0A 2CBIA 4ACZB 1FWRA 1VFTA 3QMRA 1GZJA 2J7DA 4LBUA 1HJUA 3MC5A 4GBUA 3ANUA 2X05A 3NQCA 9RUBA 1P0KA 3E9AA 3VIPA 5C71A 3G1RA 2WK2A 5JVLA 3HG2A 3B9DA 1H7RA 4DBUA 4H9XA 4Y9NA 1Q8JA 3LHZA 2GGHA 3QXBA 3HQPA 6XIAA 1UQYA 3NCOA 3HU7A 1MQPA 3RPTA 4IIDA 3SIMA 1EEXA 4B2DA 2R1KA 3STGA 1TQJA 1B2YA 5H6HA 3KDNA 5FEZA 1X98A 4LVAA 2VX6A 2IQ0A 3QBUA 3N11A 3BAJA 1VFLA 3OPSA 1EGVA 4M6PA 2FB2A 4I7WA 2VVSA 5HNTA 3QV9A 4Q8UA 4L6DA 4ATDA 1NFGA 3ZIZA 1XGEA 4AQLA 3RO6A 3WH9A 3H7VA 2BB0A 1FWWA 1QHPA 2ZUTA 2CERA 5TF0A 3L0GA 1E3XA 4AD3A 3V1PA 4UQDA 3ZFHA 2VZSA 1BF6A 3RLVA 2QCDA 1HJVA 1SYTA 3TN6A 1D3HA 4Q8PA 2JE8A 3UZWA 2XN1A 3U2CA 1G94A 3MKCA 4RKAA 4AF0B 1V03A 4PB3A 1RJQA 1VIZA 3LNPA 1GTEA 2H90A 1JGMA 1D3CA 1V3KA 3M4HA 1W3TA 1JAKA 2NW0A 4L4MA 3WLPA 1AJZA 5IHSA 5I3KA 2PDFA 3S5ZA 1AJ2A 5DT5A 2FZBA 1E6PA 1W9VA 5D2VA 1KBIA 4UB9A 4GIAA 1EJUC 2BHUA 3WLJA 3I3BA 1W5QA 3B9EA 1XYFA 3LHUA 1W0MA 4NSBA 4RNIA 3GDRA 1JDCA 3WLHA 4NILA 2A7NA 1K8ZA 3HGSA 3CPUA 5M03A 3MV01 3FY1A 4Q3MA 3OEXA 4J1OA 4IJBA 3M0IA 2DIEA 3JVAA 1AK5A 5CPNA 2PBOA 5HPOA 5EBUA 4DZAA 1RXOB 4M56A 1G67A 4IXXA 1ZSXA 4H7CA 1N55A 1TKKA 3PBGA 1JEZA 1F3TA 1GVRA 2WLZA 1QBAA 3MHUA 2XH4A 1EF2A 1S3HA 2WHKA 1F07A 4AWUA 3G0SA 3JU2A 3HPAA 3UETA 2BY3A 1GG0A 3T7VA 3WEMA 3W83A 3WBYA 1KM5A 5REQB 3IJIA 4INFA 1TMHA 3W2MA 1ZJHA 3THCA 3WQPA 3SRFA 3O9NA 4N02A 2GK1A 1TIMA 1DQXA 4K7VA 4FO4A 1SFLA 1RUSA 1UR8A 2QCNA 1I1XA 2A3BA 3E5PA 4UNLA 3TQVA 1TFVA 5C9RA 4PCTA 1FWGC 1M7PA 1LORA 4OBRA 2KX9A 1R3VA 4TMCA 2QJMA 5K3VA 3OZMA 3H8AA 3IGSA 3L5AA 4ORIA 1YYAA 1X1NA 4KH2A 5A8MA 2QR6A 1GVEA 4G1NA 4RK8A 2KAUC 3UJRA 1TWZA 4Q4PA 3QLLA 3PY2A 3NL6A 4GI8A 5EKYA 3NZ1A 4J3UA 1IT7A 1R86A 3GH7A 3SZ8A 3AYVA 3EMZA 4IG2A 4K8HA 3WDRA 3C2OA 4ZENA 2YZ5A 3BK0A 4GYKA 3IV3A 4K38A 4Z42C 3TTQA 1M3UA 4PEKA 3UD6A 2YA2A 1CT5A 4KKXA 3HPSA 1KGXA 1W3NA 3QQWA 2F6KA 1H5VA 2ZXDA 4DYJA 4IUOA 4TTUA 2A21A 4WX2A 1FDJA 1NY1A 2WMKA 3GXMA 3DBPA 3LY0A 1P5BA 1UPMB 1KCZA 3K1GA 3QHNA 3KVKA 3GXDA 5C54A 2CPUA 2JIEA 3AXHA 1OYCA 2ASHA 3A5VA 1TTJA 2FZ8A 4L9XA 3RR4A 1UR0A 3L2LA 4D8AA 3N9SA 3Q4DA 4GNJA 1P48A 1ZBCA 3NFUA 3T78A 3VXGA 4DXVA 5HR6A 3BL3A 2ZX7A 5DO8A 3ZS4A 4FMVA 4JICA 2IPJA 4LUTA 4JGDA 3MSGA 1BSIA 1UPPA 2HMCA 2Z2AA 4Z0JA 2BVWA 2IKIA 4IQJA 4QGCA 2UBPC 2YDRA 4AY1A 1W1TA 2V3FA 2I16A 4DJDA 4W7UA 3RITA 2AMXA 1LG1A 2P1FA 4HCHA 1YDOA 3QW4B 4DUOA 1Z89A 4HPGA 1SGJA 4QM1A 1KB3A 5HNRA 2O7QA 5D2WA 1GW9A 5CZTA 2NZLA 4H9YA 2R24A 3GKFA 4GK8A 3VDBA 3W71A 2ZTKA 4EOUA 4PB4A 3BLDA 2IKHA 3WDHA 3VZYA 1EDGA 1ZALA 4UTTC 4YYFA 5I06A 3PZNA 3PB0A 2X1UA 1G9HA 4NRRA 2PSNA 5HQMA 1W5OA 4LVBA 4NNBA 4DEFA 4X2RA 4JQAA 1FCUA 2HDJA 3LENA 3IVUA 3MKVA 4ZTXA 3DECA 4A2SA 1UKPA 3WFAA 1NWTA 2PDMA 2DORA 1A0EA 2FMOA 1HKIA 4Q8OA 3GHUA 2DFAA 4RW3A 2CZFA 2OELA 1A47A 5FF3A 1DHPA 3QF0A 1XDLA 1MSSA 4A8IA 4QBXA 3EKGA 3UJSA 1E6NA 4LB3A 3VU2A 4YTUA 4PSPA 1XIEA 1E4MM 5F2IA 1Z32X 3SGZA 5CPMA 2PRLA 1SZNA 2F9RA 1DE6A 1X6UA 1OHLA 2H9AB 1A0DA 3OA3A 3W1LA 2OSXA 3NQFA 4V15A 3MWAA 3K1DA 1SZRA 1R9ZA 3RRXA 4AG0A 3N2CA 4QX4A 4C1KA 4BF7A 4KGJA 4NYYA 3SEPA 2XFYA 3HPXA 1BSLA 2OZ3A 1EHNA 2HROA 2DY3A 3WMSA 4UBPC 3SQLA 1US0A 3GO2A 1DJZA 4IGNA 4PFMA 2DVXA 1ONEA 4XZHA 3C5QA 2WMIA 1FRBA 5FAGA 3MKKA 4YTQA 5CSUA 3AC0A 2X7WA 4LYQA 1WCGA 3KAOA 3BAXA 5FSDC 2EG7A 1T99A 4ZB0A 2HCVA 1OVDA 4JCMA 3M1ZA 1H2JA 2W0UA 1UHVA 2G96A 2PDGA 2VEPA 4M1RA 1IZJA 2WC4A 1Y65A 3W7PA 2PCQA 1TR1A 4BHYA 1VFFA 5BYWA 1MXDA 3GYCA 4NKCA 1WUEA 3WBWA 1KQZA 4Y7EA 3NGFA 1KBBA 1UD2A 4M6VA 4D8ZA 2F61A 4RNJA 1TJRA 1TJ0A 1X8CA 2WM1A 4Z1CA 4IPIA 2OPJA 3A3XA 3UT0A 4ZSTA 4EXAA 2OEJA 4ATLA 1V0KA 3QOMA 3ZR4A 4A8LA 3MU7A 1ITXA 3M0ZA 1ODZA 4IIFA 3FLUA 1I60A 3AU2A 2R94A 1JAEA 2PPGA 3CHVA 2Z0IA 2D23A 2WMHA 4M80A 3PWGA 3PNZA 3UYCA 3V1HA 3WH5A 3LRMA 3BQ5A 4K68A 2QAFA 2ZUUA 5EMMA 3VFCA 5BOOA 2V5JA 1RJRA 4S2CA 4HJFA 2GGIA 4OJYA 2TODA 1TV4A 4GZJA 3DFOA 2OZTA 2PGEA 4FP1A 1EL3A 3PC0A 2DZTA 3BMWA 3V7PA 7PTDA 1CYGA 2ESCA 4S3KA 4G7EB 3LZ3A 4X0VA 3FSUA 1EFZA 4DO4A 1DIEA 4PL1A 2YXXA 4KERA 3RX2A 3WLOA 2G97A 5IFTA 4M7TA 5LNRA 1FDZA 4KF1A 5GQBA 4V1YA 4AISA 4ICNA 1YTKA 2EPNA 2YIHA 4PULA 5F4WA 3L66A 5AC5A 2OG9A 1KFEA 3W24A 4JQ3A 4OHQA 2GVYA 5C7HA 1FHDA 4IF2A 5E1QA 1WV2A 5BRBA 4DLFA 5FI8A 4DUXA 1QBBA 4LS0A 3R89A 3GHSA 4J35A 1X8FA 3T1GA 4K6AA 1E71M 3VDHA 2RJHA 4PBFA 4ZFCA 1NIUA 4E8CA 4LBSA 2WQPA 5IDIA 4TU1A 3FK4A 1FWCC 4URIA 1GG1A 4RXFA 2DQXA 1YHTA 2JKPA 1UA3A 1XIHA 3JUGA 3LA4A 3TCSA 1EP2A 1ISYA 4FPSA 5FJJA 5H8UA 3Q58A 2I9UA 4NQ1A 2A5HA 1OYAA 1PHWA 1KM1A 1XRFA 3HV9A 2PEVA 1QJWA 4V27A 1XG3A 4HHPA 3WF3A 5B7ZA 1S5MA 3OYZA 2VEGA 5H8PA 1FHLA 4GQQA 1SO5A 1LWIA 2X0SA 3II1A 4S1FA 3O6DA 1SMDA 2ZWZA 4XZMX 3VGDA 1AFSA 2Y8VA 3S9YA 1TZZA 4AYSA 3DX5A 4UZUA 2IQDA 4NAFA 3MUCA 3GYEA 4NAEA 4RE0A 3CZKA 3P3BA 3SSZA 1PX8A 1YPFA 1KFKA 3I6EA 4AD5A 4NJHA 5CC5A 3RF9A 3ZSTA 1P6WA 5CAKA 4ADUA 1QNSA 5KITA 1QWKA 3L4ZA 2WZHA 3WH8A 2CESA 3QTPA 3KDOA 1V77A 4X9YA 2PP0A 3WUGA 3UXLA 1TVPA 1TZ7A 2BS9A 4G2DA 5HJYA 3W01A 2HVMA 1N8WA 3TYAA 1SZFA 3PANA 2OOGA 1SU5A 3AHXA 1CWYA 4RV3A 3M0XA 2ZZ4A 3M6YA 3EWYA 3U7BA 3ZJKA 3QV7A 1I8JA 4A3HA 4O12A 1KBJA 1VFUA 4UMBA 5M17A 2E6FA 3H2FA 4UQ9A 4DIAA 4Y6GA 1I0BA 1W9PA 3SRKA 3PFMA 3HG4A 4HU4A 5HAOA 4PCFA 4HNCA 2IS7A 3WBAA 3CXOA 1E1CA 3CGTA 4GYPC 1JG9A 2INZA 3P0WA 4DBEA 3W02A 2X2GA 1J10A 2OODA 1FWIC 1QW8A 2ON3A 4HU3A 3LU2A 4NHVA 3OIHA 3DIPA 2WAGA 3QGKC 3V4BA 2TAAA 1L2UA 1SVDA 4KRZA 3LOTA 4A29A 4ZQPA 3JRKA 1E0TA 3C56A 3E0WA 3ARUA 1DWIM 1MRAA 4IICA 2R14A 3DYOA 1DXEA 1N7KA 1VYPX 1YDVA 4FIRA 5C9XA 2VR5A 2XJ7A 1KR0A 2B31A 1GQIA 2BWGA 5AC8A 4JPGA 1ELSA 1FXPA 3IUIA 3QY6A 2CBUA 3CIWA 2CLIA 5DBUA 1FFQA 4S38A 1UIPA 4D6IA 1OFAA 5FF7A 4DAFA 2V68A 4C6MA 4N7QA 2Y2WA 3TJLA 2ZOXA 4EKJA 1UMLA 4IFOA 4YN5A 3USBA 1SUXA 4BKNA 5D38A 1GVIA 1ZP4A 3NDZA 2YR1A 2VOMA 2Y62A 2GOUA 4Q6JA 4C65A 5I3HA 1AW2A 5IOBA 1GPFA 4ZQOA 3PBMA 4LVGA 2A85A 4QAWA 3VD5A 2JFEX 2ZC1A 4HMEA 2ZADA 2EPHA 1CZ1A 1ECQA 4X2PA 2RHGA 2YL8A 2CYGA 4HNNA 1XLLA 3T2QA 3YPIA 4MY9A 4F2UA 4H9UA 2AQOA 1TJ1A 3BMXA 1C29A 5FJUA 3M7WA 5T91A 5CJ5A 1TPH1 3I7QA 3NJ3A 1HO1A 2QCMA 3QYQA 4UTHA 3RHGA 3LK6A 3AU6A 2PF0A 3LPPA 4LNYA 2WJEA 2QUVA 2VI0A 5AHEA 1H5YA 3NQ8A 7TAAA 3L5MA 4GUJA 4FSAA 2ZRUA 1L0PA 1MW3A 1KKOA 3RILA 5HA7A 4XZ9A 4ML9A 4D72A 2VTFA 1KM4A 3PG8A 3N3TA 4N4QA 4IFKA 2Q8ZA 2B7PA 3QQ1A 1XRVA 3PZQA 1WKYA 1V3LA 1W2PA 3L23A 4UWMA 4H8VA 1EOMA 1LZOA 1DL3A 3CQKA 4YNGA 1KRBC 1W5PA 1R3RA 3DHPA 5C2GA 3W86A 3AYTA 4EAYA 3R0DA 2C0HA 1J0ZA 7TIMA 1B3XA 5A6LA 1EX1A 1U5JA 4RDVA 2VUYA 4AUBA 5C55A 1RCQA 1U5VA 3KWSA 1O1HA 1AQFA 4R33A 5G4HC 1WDRA 4HPHA 4B5VA 6PTDA 1EDTA 2RGMA 1CGUA 3ARQA 2NXGA 3MP5A 4IZGA 3TR2A 3C52A 6XIMA 4A8NA 1A5OC 3GTNA 1R5YA 1JZ7A 4YCOA 3NL5A 3DUGA 3JW7A 5E0CA 1J0KA 5BU6A 4V28A 5E09A 3R79A 4KIEA 1OF8A 3HBLA 4ADSA 4H6KA 4WZHA 3B40A 3A64A 3P82A 1IXPA 2WCGA 2EG8A 1B3VA 1FOBA 3H2NA 1F2JA 1UW9A 3VGFA 3EX6A 3LM7A 2XPKA 4KEUA 4BI7A 2VRJA 5I2UA 1ZB5A 4UFHA 2J27A 5K4XA 4L80A 2IPGA 2W3ZA 3WLNA 4PEEA 4FXFA 3ORWA 3H4XA 2VGBA 2X41A 3V18A 2DPEA 4TO8A 4FX6M 3U9IA 1XGZA 2NT0A 3BVJA 3URNA 2GQAA 2OGYA 2V5CA 1PS9A 2POTA 4C5YA 1RBOB 2F6UA 4XIAA 1KW1A 1WB0A 3BANA 1R3TA 1VB9A 3EXSA 1EJVC 1SM9A 5F7UA 2ZWYA 4DI8A 3L0KA 4F3HA 2I9EA 2HZGA 4RPQA 3SJNA 2P50A 5C9WA 1O5QA 4XISA 4JFTA 1V6TA 1ZAHA 4GH3A 1E6QM 3ELFA 4RNHA 4HSNA 2REQB 1A3WA 1JZ5A 1CNVA 1F61A 3PZMA 3B8VA 4W9TA 1US2A 5I0DA 3VOFA 1KC7A 2WVVA 2OZ8A 3AQUA 2W92A 4NI8A 2XVPA 5K7JA 4CEUC 4DZHA 2V2DA 3VM5A 3HGJA 3GG1A 4I7VA 4EF9A 1P0DA 4XV0A 1FWDC 4JHOA 2WW5A 3BICA 1NWRA 4L9YA 4MKVA 3AOFA 2HSAA 2QLYA 1ZS2A 4C6OA 3W7JA 2OO0A 5FOOA 2NQ5A 1E72M 2QJJA 4GZEA 2FGZA 2JQXA 1FWJC 2E0PA 5LYRA 4XKYA 1G4EA 3N3MA 3B8WA 2VC6A 3MO4A 1V3JA 2QUTA 5I24A 2J7BA 1KCKA 4BEUA 1L9WA 3ITVA 1A4MA 4H9TA 3ARYA 3S3GA 2ZFAA 5CSYA 4H6EA 1KM6A 1F3EA 2VMFA 1DQUA 4N0RA 3B0VC 3VD3A 4C7GA 3N17A 1VEMA 3L4UA 3NO3A 4RZ6A 3ZT6A 4QXIA 2NVDA 2Y61A 1VQTA 3AHVA 4JL2A 2HK0A 3UERA 1UD5A 3H53A 2ZX8A 2I5IA 2WBKA 5XIMA 4UQCA 4LV4A 1ZBVA 1OABA 3PUGA 5D9PA 2RDWA 1OFRA 4NF7A 4GFSA 1THFD 3N6HA 3DU0A 1BFNA 1XISA 1XLBA 1VYRA 1FH9A 4TOQA 3PJTA 3HFTA 3UWEA 3OVGA 2YGYA 2A7PA 4IPJA 3BJTA 3EDFA 5T8GA 3LCWA 3ZVHA 3ZO9A 3Q67A 1RK5A 3P5ZA 3QR1A 1Q13A 4JD4A 1JPDX 3T0DA 8RUCA 1XCWA 3SN0A 2XH7A 3MQTA 3VKDA 3BAKA 3K2GA 1MNZA 2RFGA 4O28A 3URBA 5I5RA 5IBXA 5F1UA 3NDYA 4WJXA 3OO2A 4XSMA 4ORMA 2GWNA 3N6QA 1WZLA 1XFBA 1W6TA 2HS6A 3DYMA 3D3FA 2VKZG 5EMJA 2PZ0A 3W81A 1UWUA 4B9YA 5JMUA 3MS8A 1XLFA 2X42A 3W1AA 2QVHA 4TUFA 3MWCA 3DAQA 4OOZA 3KRSA 3UR7A 4JDBA 1C8QA 1Q8AA 1IXOA 2CEQA 3W1NA 4Y9MA 1R3WA 2CBJA 1H7NA 3CV7A 2XINA 3ARTA 1JRBA 4YYCA 3LHYA 3LRLA 4GRSA 4UUIA 4GC4A 3C0QA 5AHFA 1REQB 3ABOA 2AAMA 3N25A 4DUVA 1BRLB 4PUKA 1U22A 2PGWA 3KZPA 2DQWA 3QTGA 3TEVA 1O5XA 5D8WA 3VE7A 3RJYA 3EPOA 3BV7A 3QQ0A 1PDYA 3M9YA 3L0NA 3CZGA 3BARA 1XKJA 4XKMA 5G2WA 3GVWA 2QF7A 1NP2A 3BSHA 3P8IA 4M3PA 4TX9A 3B8IA 2DUXA 4F0KA 2D3LA 4GJJA 2PLJA 3CAKA 2YFOA 1K9EA 4AVFA 2OGJA 1E40A 2FVLA 5DBTA 1XM3A 1MFUA 2DT1A 4IJCA 1OADA 1JZ8A 2RKXA 3OGRA 1E73M 1P7TB 3EZ4A 3HG5A 2IUZA 3EDDA 2Z1KA 2R6OA 4F2BA 2VURA 1LL6A 1ITCA 4ZQMA 2PD9A 4YCPA 2PP3A 2GQ8A 1PEZA 4LH8A 2OJPA 5GJPA 2GZXA 3KBJA 2DSUA 4I8YA 2AQVA 1G69A 4MKNA 4Q8NA 2PDKA 1PIGA 3MI3A 4G6CA 1GGOA 1E6ZA 2Y85A 4GWEA 2OOFA 3UF9A 1J11A 4C5ZA 1KKRA 2OYKA 3STEA 1NU5A 1CBGA 4E2DA 3OZOA 1OFPA 5C8BB 1POKA 4BR1A 4ZOCA 4U3AA 4HGXA 4QEHA 2IXUA 5JH2A 3IPWA 5IRPA 1ECEA 2ACUA 3GNDA 1YBQA 4BQ2A 1SFJA 5LGXA 3DH7A 3M5XA 1D7FA 4MUPA 3F2DA 1RLCL 3BURA 3TZF