4HK7A

Crystal structure of cordyceps militaris idcase in complex with uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
379
structure length
379
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLKAELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
total genus 136
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk7A00
3CJPA 2Z00A 2VHLA 4GX8A 3MVIA 4HA0A 4C6MA 3PANA 2QS8A 2F6KA 4J35A 3C86A 1PO9A 4QS5A 3IRSA 2OGJA 1NDVA 1WXZA 3MJMA 3OJGA 1P1MA 4V1XA 2VUNA 3OOQA 4LCRA 1FWCC 2Z7GA 1R9ZA 3LGGA 4L6DA 2W9MA 4DNMA 4KEZA 3UR5A 1V7AA 4CNSA 1RJRA 1BF6A 3PBMA 2GWGA 1M7JA 2OQLA 2HQAA 4XD4A 2A3LA 1EJWC 1RAKA 4IG2A 4IFRA 3WZ0E 4H00A 4QSFA 4GK8A 2DVTA 3FDKA 3K4WA 3GTFA 4XD3A 2PGRA 3URQA 2AQOA 4QTGA 4C6NA 5LXXA 2YB1A 4XAGA 4C5YA 3URBA 2D2GA 3FDGA 3LNPA 2O4QA 4LAMA 4KERA 1RJQA 4IGMA 1A4MA 4Z42C 3WYZA 4B91A 4C6KA 4H9YA 2FTYA 1EYWA 4BY3A 3FEQA 4F0RA 2HPIA 1FKWA 1GKPA 4GXWA 4C6DA 4GX9A 4KEUA 1DPMA 2PLMA 2ANUA 3LSBA 1FWHC 3DCPA 4ICMA 4NG3A 3UPMA 3F4DA 1POJA 4KETA 2DVXA 2WJFA 2ADAA 3K2GA 3RYSA 2Q09A 3IJ6A 3UR2A 3IARA 4LANA 2RAGA 3MVTA 3MSRA 1JGMA 1QXLA 4EPBC 2Z2BA 3DUGA 4EPDC 4INFA 1YBQB 2VC7A 5FSEC 4WGXA 2HBXA 1NDYA 4R88A 3LU2A 1YIXA 3O0FA 5A6TC 3RHGA 3F2DA 4DIAA 1S3TC 2YZ5A 1XRFA 2GSEA 3B0YA 4C6JA 3HPAA 1RK6A 4C6PA 1EJXC 3O7UA 4CNUA 1M68A 4LCQA 2FFIA 1YMYA 2BB0A 3AU2A 3CAKA 2EG7A 2VM8A 1EZ2A 1RA0A 1XGEA 3ID7A 2BGNE 2OOFA 3NURA 2GOKA 3E74A 4H9ZA 1FWEC 3E3HA 2YB4A 2QPXA 3N2CA 3GTXA 2R1NA 1KCXA 4IF2A 4LAKA 1FWGC 4WVXA 4LCSA 3GU2A 4IFKA 4H9VA 4C6CA 1FWIC 2UBPC 3NQBA 1A5LC 2Z28A 4KEVA 3OU8A 1E9ZB 3QY6A 4HJWA 2OODA 4E3TA 2Z24A 3IV8A 1V51A 3ORWA 4IQJA 4YIWA 4MUPA 2Z29A 2CZVA 5FSDC 1RJPA 3NEHA 1ONXA 3TN5A 1KRCC 4KQNA 4J2MA 1NDWA 4EPEC 2HBVA 1FWAC 1NDZA 4M51A 1PSCA 4RDWA 3V7PA 3F2CA 1IE7C 3S2MA 4J5NA 4ZSUA 1KRMA 3T1GA 3GUWA 3GU1A 4CQBA 4EPKA 2AQVA 1V4YA 1EJUC 4C6QA 3EWCA 2KAUC 4KF1A 4BKNA 4L9XA 4PCPA 3ISIX 4G7EB 3QGAC 2HPMA 1A5NC 4H9XA 4GY1A 2IMRA 2FVMA 1A4LA 3ITCA 3LA4A 1UMLA 4DYKA 4PBFA 4B90A 2D2JA 3MPGA 1NFGA 3PNUA 4GY0A 3TN3A 1RA5A 5CH9A 3OODA 1K1DA 3GIPA 3TNBA 4PCNA 3SO7A 4C6LA 1FKXA 1M65A 4LFYA 4CNTA 3OVGA 2AMXA 3GG7A 2Z25A 2EG8A 4PBEA 2ZC1A 4DZHA 3MDUA 3UBPC 1K6WA 1E9YB 3R0DA 4C6OA 3EWDA 4NI8A 1KRAC 3GRIA 1ONWA 1O5RA 3GIQA 1ZZMA 4IGNA 4C65A 3GTHA 4CEUC 3IGHX 1A5OC 1GKQA 1V77A 4R85A 1ITQA 2YXOA 4IFKB 1I0DA 4LAOA 3UF9A 4GOAA 4XAZA 4QROA 1R9YA 4AC7C 4RE0A 1VFLA 1POKA 3S2JA 4IG2B 4G2DA 3G77A 2E25A 4CQCA 3HM7A 2P50A 4ERGA 3F2BA 2R1KA 3E38A 2ICSA 1FWFC 4JOMA 4GZ7A 4UBPC 1R9XA 3URAA 1W1IE 2PGFA 2R1MA 2XIOA 1V79A 4GY7A 3S2LA 4R7WA 4QRNA 4I6VA 3B40A 1GKRA 4BJHA 2R1PA 4DO7A 2Z4GA 2Q01A 3DC8A 1UBPC 3TN6A 4C60A 4GC3A 2QVNA 2UZ9A 1RK5A 4B92A 1YBQA 1QW7A 4H01A 1J6OA 3A4JA 4UB9A 2Y1HA 4C5ZA 1XRTA 3AU6A 4DI9A 4ERIA 3PNZA 3MTWA 1P6CA 3QY8A 3SFWA 4RDZA 1FWBC 3TN4A 2I5GA 1KRBC 4XD6A 2I9UA 2FTWA 1PB0A 4H9MA 1YNYA 4GYFA 3QGKC 5AKQA 2Z2AA 1A5KC 4HK6A 4C6BA 4DLFA 4XAYA 3LGDA 2GZXA 4B3ZA 2QT3A 3K5XA 2WJEA 4HK7A 4H9UA 3MKVA 3GU9A 2E1WA 1EJVC 3EGJA 4F0SA 4KIRA 1A5MC 5G4HC 3RN6A 1J6PA 1ADDA 3D6NA 4LH8A 3S4TA 4LALA 1EJSC 4WHBA 4CEXC 4ERAA 4C6FA 2PUZA 4XAFA 3JZEA 3E0FA 3T8LA 1I0BA 3RCMA 3S2NA 1EJTC 1PTAA 1EJRC 2WM1A 3OQEA 2VR2A 1UIOA 4C6EA 2PAJA 2Z26A 4V1YA 3T81A 3IPWA 1FWDC 1P6BA 4DZIA 3AUOA 3E0LA 2G3FA 3ICJA 3E2VA 3QY7A 2Z27A 3WMLA 1ITUA 4IFOA 4PE8A 3A3XA 1WXYA 3BE7A 2O4MA 4KESA 3B0XA 3LSCA 2WJDA 2OB3A 2R1LA 4C6IA 4DI8A 5HMDA 3A3WA 4P5UA 4IH3A 4OFCA 3IACA 4AQLA 2GWNA 4EP8C 2VC5A 4RDYA 4CQDA 3GTIA 1EF2A 4D8LA 4NP7A 5E5CA 4I6KA 4DLMA 1O12A 4H9TA 5HMFA 1YRRA 2EG6A 4TQTA 1UIPA 4GBDA 1J5SA 4LEFA 1K70A 2D2HA 1FWJC 2HNHA 4QS6A 4RDVA 4ZSTA 5HMEA 1XWYA 3HTWA 3CS2A 1HZYA 4G7EA 4HK5A 3URNA 3F4CA 3KM8A 1J79A 3LS9A 4XD5A 2P53A 3MDWA 3PAOA 2DVUA 3LY0A 4F0LA 2FVKA 4RZBA
chains in the Genus database with same CATH superfamily
3NSXA 4Q4SA 1UD6A 1Q2RA 5I3KA 3V4BA 4HA0A 5D37A 2WSYA 2PC8A 2XVGA 4AD3A 3L21A 3C86A 5BRPA 3VIPA 2WVVB 3TXVA 1WXZA 1P4CA 3MJMA 1R2SA 5H8UA 1UUMA 3F4WA 2ZX7A 2CLOA 1PVNA 3IEBA 3TTEA 4JN7A 4DJDA 1VYSX 5FEZA 2XH0A 4H3DA 4CKQA 4ZQCA 4XD4A 2HQAA 5BOOA 1W9VA 4AEEA 3EWZA 4S38A 2FHFA 2E5BA 3UG8A 1EIXA 3P74A 1AZ1A 2O9PA 4M82A 3TYBA 1PL9A 2REQB 4W8BA 2AQOA 1GHRA 2A7RA 2FDSA 3AOFA 4LVGA 2G0WA 3N19B 1XIDA 1PBGA 5LA2A 2O4QA 2HZGA 4MKVA 5FEWA 1ECEA 3OG2A 3W73A 3BOLA 4J3TA 3N17A 3R79A 3TDFA 4A22A 2QQ6A 1HXJA 1BF2A 3AIRA 2J13A 3CYJA 1P0KA 1XLMA 1YNQA 4MDPA 4Y9AA 2GJPA 2XVKA 2FQIA 4LC6A 1JZ5A 4Q4RA 4NU7A 2PDUA 4AUBA 4HNOA 3L4WA 2O9RA 3SRDA 4ICMA 1WUFA 1H1YA 1VQTA 2CBVA 4DO6A 1W31A 4HN8A 7CGTA 2WOQA 4ZOAA 3M0LA 1TPVA 4K8GA 3WQPA 1B57A 1I6NA 1KM2A 4EPDC 4L9ZA 3RDKA 1UKOA 1VKFA 3G5EA 2OJPA 3F2DA 1OD0A 3CLMA 3SB0A 3LMZA 1OEPA 2VFHA 4ML4A 3WF1A 3VIFA 1OFBA 3HPAA 5C9WA 3CUGA 1WKFA 2ZE0A 3OO2A 3W7OA 2TODA 4XKYB 3IAPA 1W5MA 2EG7A 1EZ2A 1EWEA 1QU4A 3VO0A 1GVQA 2IS7A 3EEZA 1GTEA 4X2PA 3F4VA 4Y9PA 4GVIA 2VI0A 4XZ9A 5A3HA 1YQ2A 3N2XA 2PTDA 2R1NA 2VP8A 3CM4A 1OWQA 4LRSA 2E5CA 3GO2A 4CN4A 2ZZ1A 1ZL1A 1R47A 1K02A 4ICNA 3OVRA 5K9XA 5A8QA 5AYZA 2G95A 2CPUA 2Y8UA 3OGRA 1V51A 1BGAA 3O63A 4GVHA 1KBLA 3GVRA 4UTKA 4GISA 1V8EA 4L5ZA 4D6CA 4KQNA 1HL9A 1QJWA 1PKLA 3TK7A 1YE4A 3N04A 4CNPA 4XVEA 3MSYA 1TKKA 3NQVA 1XIHA 4U3CA 4AY1A 4XX6A 4Q8VA 1I60A 4KBXA 5A6JA 3UA4A 2ZE3A 1UD3A 5HOSA 3UEQA 4LV9A 4QEEA 4G7EB 2HS6A 3ABOA 3AROA 4TR9A 4JICA 3QRHA 1GYNA 2D3LA 8TIMA 3NL6A 1EPVA 1AJ0A 3SCUA 4IMCA 2B7NA 1QAPA 4NAEB 3SY8A 3CZ8A 3SCRA 3PJUA 5C9ZA 5I0DA 5FF4A 3SCQA 4LYKA 4PBEA 3U5UA 4DX3A 2DSUA 5D2YA 4FS9A 3VOCA 4WK9A 5C9UA 1HIZA 1VPYA 1RV8A 1VC4A 4W88A 1OX4B 1EDGA 4NZ5A 1WA3A 5FJIA 1CBGA 3W27A 4QEHA 4QIUA 2CHOA 3C0SA 4GLEA 3D3AA 4MYXA 5ENLA 1UOZA 3DFQA 4N6FA 4WGHA 5DCEA 4MWAB 1EEXA 2Y5SA 2PS2A 4ZB5A 4H19A 3T4WA 1AVAA 2XIOA 3G0UA 4PB5A 3VZZA 4MLJA 1XC4A 1Y5VA 3NQ8A 2PRHA 3DC8A 5AYYA 4AZ5A 3ONCA 1W9DM 1EH9A 4FNTA 2DZSA 3M0MA 3MT1A 3E0IA 2BHYA 4MNLA 4AZCB 4XZMX 3NQ7A 4QNEA 4ZQRA 3TW9A 2HE5A 1XCXA 4H7ZA 3P8IA 4ERIA 4PULA 3FIGA 3R13A 1Q7ZA 4W89A 5IDIA 4H9MA 2O55A 4NIRA 1DQXA 1XS2A 4C6BA 1Q3NA 3HF3A 3KL3A 3LGDA 2X1SA 1UW9A 1JJKA 1HKMA 1EBGA 3VX0A 3N2TA 3WUGA 3AIEA 3KRZA 4H9UA 1EJVC 3CMGA 3EGJA 3N11A 1NSJA 1TV2A 4N6EA 1BG4A 1WCGA 3S4TA 1NIUA 5KETA 4YCOA 2ZUMA 5JXQA 4X9SA 4B5TA 1HG3A 1X6LA 4XIMA 3S1GA 5AC7A 3RCMA 3S2NA 2Y6ZA 6XIMA 1MXGA 3AMLA 5I77A 3B8DA 5DRCA 3GW3A 3E2VA 2Y62A 2J47A 2AAAA 1VBJA 1W9XA 3ZQ9A 3DFNA 4U3AA 2RDTA 1F7BA 4YNGA 5HMDA 3Q65A 3P7YA 4AC1X 1AH3A 2GWNA 4WKHA 1JF6A 4RDYA 2YSWA 4DHGA 2JIWA 1F6PA 4NP7A 3V1PA 3ELFA 1CNVA 2EG6A 5E0CA 1GOOA 4Q4MA 5KSWA 4YYCA 3B03A 4LEFA 5EL1A 4UNLA 4WOQA 1S1RA 3P8JA 1XR2A 4ZQMA 3B8UA 1LUCA 4QS6A 5HMEA 4MHBA 2RJGA 3MBFA 3W88A 1ALDA 1KGXA 4UQAA 1NF0A 3ZVIA 4WXZA 1V02E 3CUJA 3LGEA 2PRMA 1E9IA 3VNKA 3K4AA 2X09A 1H7XA 3OPSA 3BOFA 3HQNA 3TYUA 4PUUA 1CTNA 2C1IA 4RNFA 2BBFA 4AZ6A 4L6DA 2W9MA 3KVMA 4Q7NA 4QG6A 5AY7A 2WVUA 4W93A 5JQ9A 2OQLA 1ZGDA 2NVAA 4I5UA 2Y24A 1MMFA 4FLQA 4IG2A 3GC5A 4PCSA 4MUZA 1PJ9A 1XLLA 5E0KA 3U8GA 4DM2A 3VGGA 3GTFA 2XISA 3KS6A 4UOZA 4AD1A 3VOJA 2QJNA 3PR2A 3O3RA 4PMJA 5C5YA 2P1FA 4AEOA 1EYEA 1HFBA 5A2CA 3URBA 2FZMA 1BYBA 4UZSA 5DXYA 2P3ZA 4B91A 4C6KA 1FWSA 1YEYA 4UTFA 4KH2A 3HOJA 5HUPA 5LNUA 1JZ3A 1HJUA 2VCBA 2J79A 5GJNA 2POTA 2ANUA 3PSVA 4E8CA 4NG3A 1W3HA 4JTTA 2D24A 3TE9A 1BEUA 3S6OA 3UR2A 2EPOA 3HPSA 5HULA 4RZ4A 5FACA 5JBFA 3CHDA 1I1WA 1KTCA 4S3GA 1ME8A 4LAUA 4KCWA 3QR3A 1KBBA 3LBCA 3ZT6A 1SJAA 3DG7A 1VFTA 4YYFA 1UHVA 3LZ5A 3UYIA 4O57A 2HBXA 4OV4A 3SR7A 1E6NA 2E3ZA 2JKPA 3GTNA 2E7FA 3TZFA 3WCZA 3B0YA 4M8UA 1ZRQA 3SUTA 3LM3A 5H8MA 3H55A 2YX0A 4XBKA 5F4XA 2XG9A 4BZYA 4LCQA 1NARA 1JFHA 5FJRA 4AH7A 5LXEA 2EQDA 3ID7A 3OVPA 1TPWA 2A2IA 2VT0A 1KM5A 3BMWA 3V1HA 3QSTA 2WSKA 2RFGA 1E1FA 4ADTA 1LDCA 2OYMA 1ZSXA 2BVWA 3KLKA 5K2ZA 4UTMA 1F2JA 4JYFA 4KEVA 1TA3B 3KL5A 3CZLA 3DGBA 1XRSA 2TAAA 3V3WA 4GIRA 4GUIA 3W1UA 1BSLA 4HNCA 3T44A 3VAVA 2OXNA 3LENA 3W2MA 2OLAA 3NM1A 4F9DA 4ZCWA 3CO8A 2Z6JA 1VBRA 3QMSA 3QZEA 2JEPA 2FFCA 4UFIA 2TRSA 3A23A 1W54A 3IIPA 3ARSA 1D3CA 1MEHA 3E1F1 3N3MA 1NAL1 2DUXA 2FPVA 3SCSA 3MA8A 1A5NC 4F79A 1FVPA 3LA4A 4DYKA 4BF5A 4A4AA 4IXHA 1EUNA 1JAKA 3KBJA 1SO3A 4GY0A 3QSRA 4HPXA 4JTKA 1M65A 1O5QA 3IGUA 5TD4A 3OVGA 5E09A 1LLWA 3UWVA 5IDZA 3V5OA 1SO5A 1B9ZA 2ZVRA 3CT2A 3M9YA 4IIBA 1H0GA 1XD1A 5HQLA 1E9YB 3FGCB 4AD5A 2ZDSA 5K9DA 3PHAA 5JIPA 3S8HA 3VKJA 2V3GA 4NZFA 1UUQA 4IZGA 1FXPA 4MPQA 3ARYA 3QEZA 3DHFA 4PFMA 2VEMA 1BTMA 1MNSA 4H6EA 4RNIA 3W23A 3AS2A 4YCPA 1ESWA 3SCOA 2PDNA 1UQYA 1R9XA 4FP1A 4XZLX 3W7KA 1OABA 2TYSA 1FDJA 4XWUA 4PCTA 1QK2A 3K8MA 1MW3A 3VKKA 1HNYA 4Y6GA 2RDUA 4NILA 3HPFA 4BEQA 4DBWA 3PBWA 2OR2A 1JPHA 2HISA 4AD2A 5C7VA 3CQKA 1AMKA 1NFPA 4HPGA 4YWIA 4A8RA 1EXPA 3KAOA 4O50A 3SUUA 3EB3A 3T9PA 5HNNA 4NX5A 1E0TA 2XGZA 3UNDA 2PEVA 4LVBA 2QT3A 3CIWA 3TYDA 1TVNA 3F1QA 4RXGA 3AMKA 4ZR8A 1Q2SA 4ZE5A 5BOFA 1ME7A 3A5VA 4B4FA 3CV7A 4AYGA 2GDQA 3SCWA 4E3VA 3E0FA 4HIBA 5M2FX 2WZMA 1FXQA 4GYKA 3N6QA 1SMAA 3SGZA 5DQPA 1PTAA 2WM1A 2V30A 1K4GA 5DMMA 2C7FA 1YXCA 2PDKA 3VOHA 4TX9A 1BLIA 2RKXA 4PRWA 3ICJA 1KB3A 3NXLA 3W0KA 1O1HA 1QHZA 1EBHA 2BTMA 4IFOA 1VAHA 3BE7A 4QR6A 1EWDA 2Y0FA 5D03A 1W91A 3MZ2A 1EXBA 1BFNA 3VMNA 2VVSA 3QKEA 3GAYA 1BWKA 1BVZA 2IQDA 3MMTA 2OSWA 4P2VA 5HMFA 4UTIA 3EB2A 2OO0A 3T08A 1VYPX 1K70A 4F0MA 3RILA 5H2ZA 3WDRA 4WZHA 2XJ7A 1W3JA 4ZSTA 1KA9F 3E9AA 1O5KA 2V67A 3ZJKA 2J27A 4M19A 2ZUWA 3TJ4A 1XYMA 1QNVA 4C7DA 4HZMA 4MWAC 4H83A 4Q8QA 4G1KA 2QKFA 1IEXA 5LIYX 2ESCA 2WMIA 2Y70A 4NY2A 4M3PA 1A5CA 4MSSA 3IAQA 3ZJ8A 1UZDA 5AB3A 4OU1A 4H04A 3GVQA 4JTFA 2Z7GA 4H6QA 4RR4A 3TYAA 1UWTA 1DJGA 3KHJA 4AD0A 2ZA1A 2OMAA 3UR5A 1JI2A 3B9DA 1RJRA 5HNUA 3TQ0A 2PDQA 4RW5A 1M6JA 2PWVA 3DYMA 5DY3A 3HPZA 1W3NA 2VEGA 4ZVJA 6ENLA 5AC5A 3EWBX 1J93A 1HP4A 2E68A 5CCZA 5CQ1A 2P0IA 4OZOA 1Y8BA 4QISA 4BR1A 1TJ0A 5IBXA 3DFYA 4B4HA 2IKJA 4A3QA 3DYPA 2Z6IA 3NPWA 3GG8A 4AVFA 4ONVA 4PGLA 4TV5A 3NFUA 5F2MA 1CB7B 2I9EA 2QXWA 4GVFA 3NVTA 4E6MA 1O4UA 4UMAA 1HO1A 4IQLA 2OO6A 3PVFA 4UQBA 1SZRA 4IPLA 1TZ7A 4IX0A 4DBSA 2FHCA 2CESA 4WLCA 1I75A 2WK2A 3SUWA 4AF0B 5DY2A 3TA9A 3H7RA 3I3BA 3Q2DA 2JKEA 3OZPA 2D1ZA 2NWRA 3DU0A 5C55A 3C8NA 2QUUA 4QLJA 2G97A 4UTWA 1HUVA 2W6RA 2I1OA 1MDRA 2BVYA 4CD6A 3AYRA 4AEFA 2XHYA 4S2BA 2ZYFA 3MJYA 4C6PA 2A3EA 1YMYA 1HVQA 4DXVA 4R7JA 1DJHA 4GYPA 2ZZ2A 1RA0A 2VOTA 3PJTA 1N82A 2OOFA 5F1VA 4H9ZA 1F6KA 3W07A 3M5YA 3RM4A 3W7MA 4B5WA 4GI4A 3LTPA 3PUOA 9XIAA 3TUUA 3CT7A 1EP3A 4BFAA 3K30A 4HPHA 2WMJA 3WSUA 3WQ6A 2CW6A 4AZ7A 4E3TA 3A4WA 7REQA 1KFBA 2H8XA 1JYWA 4J2PA 5D8WA 1IWAA 2QCCA 1GOIA 3LYEA 3N2BA 1ONXA 4OBTA 2CU0A 1PSCA 3QLLA 4AVOA 4Y8EA 3MMUA 4Z2LA 1OX5A 4EPKA 1PIIA 1Q4NX 4M6PA 2HROA 4HTYA 4Y9NA 3WLHA 3SADA 1XKYA 3EX4A 3KRSA 5E70A 3GHUA 5DX7A 2WC7A 3CLWA 3W82A 1SFSA 1F3XA 3HG2A 2Y61A 3KDOA 2QCEA 3PNUA 3AJ7A 3PFRA 1V6TA 4TX6A 1GW9A 5FJJA 4DUXA 2AMXA 2YFOA 1GVFA 3IJ7A 1PYFA 1PZ3A 4XTDA 3MUAA 2DU2A 3P5YA 1NOWA 2XH7A 1AJZA 3RCYA 4PUWA 2WWCA 1XYLA 4JIRA 2P0OA 3QH2A 4LUTA 1OM0A 1W32A 1EPXA 1KM1A 4RE0A 4WJXA 4E8GA 1POKA 4XIAA 3NZGA 8CGTA 2PDJA 5AZ1A 5HPCA 4CU6A 3UGVA 2RH9A 2XFFA 3MCOA 1RALA 3S2LA 2A6NA 3KHDA 2G4FA 4Z1DA 2OT1A 5HR6A 4NZCA 4X2RA 2QVNA 1V0KA 2H3DA 2YOCA 2X7WA 1L6FA 4A6GA 1GVIA 2CETA 1SVDA 1SM9A 4REQA 2C6QA 1H09A 1BKHA 1EC9A 4YLWA 3S6DA 3UWWA 1HKKA 3OEXA 1K9DA 1YPIA 5CPLA 3BAWA 1ZAHA 3RR4A 1H3GA 4FI4A 4JGDA 3MB9A 4MAZA 2NUWA 3K5XA 2NXIA 3L5LA 3QLDA 4D8AA 2PU1A 1MFVA 1KWKA 1LL4A 3LD5A 4L4OA 3TKFA 3PZUA 3QHMA 1QI3A 3R6IA 3VGHA 4IMEA 3PK7A 4Q6JA 5D09A 3TVAA 4KT2A 2X2YA 4DJDD 2HEJA 1BGGA 4PMXA 3LI1A 3BQ6A 2ZRZA 3NSMA 1PX8A 3NZRA 3GDKA 2G3NA 3OHMB 2YDAA 5D38A 1A3WA 3L9CA 3OIXA 4FNQA 1GQKA 1WXYA 2OPJA 4JDYA 5EB8A 3W28A 1ZCOA 4LS1A 5EPDA 1IXNA 5FI8A 3OB8A 1EQCA 1UOKA 1A0DA 4PL1A 1VCFA 3MP3A 3WLRA 1GYLA 1ISZA 3WD0A 5ABFA 3AZRA 4NAFB 4YVXA 5JBEA 4GRSA 1TQJA 4J3UA 3W87A 2XIMA 3RLGA 4XBSA 1IT7A 1NU5A 3HTWA 2R82A 1LWIA 2WSPA 4S3EA 1UR1A 1OCBA 4XUYA 4Z2KA 2QMKA 4E8DA 6PTDA 2WNQA 1TIMA 1IF2A 1TV3A 3W1MA 4PMVA 3XINA 1UR4A 3L67A 3TU9A 1L9WA 1NP2A 1NDVA 4XB3A 2HK0A 3QYQA 3W7LA 4WF7A 2CEQA 4M1BA 4BI6A 1F3EA 3JRKA 4ROQA 2IXUA 1KXVA 4MTVA 3A13A 3GFXA 1UP0A 1NOFA 3MU7A 3L0KA 2A3LA 2OEJA 4R5EA 5EYWA 4H00A 1G7UA 4XKYA 3ARPA 4S39A 3HPXA 1XYCA 4IQEA 2QF8A 3K4WA 1MWOA 4WSHA 4DWSB 1J0IA 1OGSA 5JMUA 3E49A 2QCDB 2VC9A 4QTGA 1VCVA 5GVJA 3CAQA 3QHOA 3ITVA 2IUZA 1X6UA 3OGSA 4KERA 1N2VA 1RHCA 1J4EA 1XPGA 4AU0A 3TQPA 1LG1A 3JW7A 3FEQA 5E6ZA 1FHVA 1LF1A 3PWGA 2B31A 1TPH1 3EX2A 2WMHA 3WQWA 3ANYA 3I6TA 3KFTA 1KBJA 1I2OA 3PZIA 1SZNA 1EHNA 2YBVA 3MI2A 3ARWA 3L0NA 2QDEA 4QCFA 1O1ZA 4ACZB 4RV8A 4PUDA 3VM5A 3MVTA 2FHBA 1UJPA 3UZWA 1NOUA 2TMDA 3TCEA 3ZVHA 2HK1A 2QW5A 4IXXA 1RUSA 4L1XA 1W9PA 4JTHA 2CLKA 1YTDA 2Y8VA 3N6JA 1IWPA 1VFSA 5A6TC 3SN4A 4YTUA 2XSAA 2AL1A 2KX9A 4IL2A 5M3WA 2W91A 3R1ZA 4FNPA 4XSLA 3ZXWA 1ZS2A 1I8JA 1TPB1 1I2RA 1Q6OA 2ZZ4A 4BF9A 3VNZA 3U2EA 3UVAA 3BMXA 1RR2A 4ZTXA 4AYSA 3ZO9A 2ZWYA 1E72M 3SN1A 3ZWSA 4QP0A 4LUSB 2I14A 4DUOA 2RUSA 4F0HA 1BHGA 3VVGA 3FAXA 4JN8A 3GDTA 3NQBA 4S3BA 1A5LC 2FB3A 6REQA 5HUOA 2VC6A 4J3ZA 2WMGA 3L2LA 3DC0A 3RFAA 4LJ3A 5KZDA 2WWDA 4YL2A 1C92A 3VNYA 3LHZA 4MY9A 4QDPA 3GDRA 2AKMA 2PZNA 3ITXA 3OA3A 2VD9A 5FSDC 1RJPA 3OQ8A 5DBUA 3OZYA 3LTSA 4BWLC 2BLEA 5I24A 3THQA 3PZTA 2VDGA 5K4ZA 1QI5A 2OEMA 3VNIA 3PUDA 3CUHA 4M51A 1UP3A 3TTSA 3LN3A 3F2CA 2EF9A 3S2MA 1DIOA 1BPLB 4J5NA 2ISSA 2VRQA 1KRMA 3R94A 2VGIA 5I7GA 1UWQA 3UXDA 3OVQA 4B2DA 2W67A 3VCRA 3THCA 3KVKA 3UFYA 4XO6A 4AG0A 4N2YA 1T96A 3NCOA 3L5MA 3V16A 1DORA 3MY9A 3PBYA 4B9YA 3WBAA 2GK1A 2CXGA 4B90A 1TV8A 4Q8TA 3MI6A 2PDWA 3TN3A 4PTNA 1F74A 1K1DA 3RX3A 1LOLA 2O9OA 4JTSA 2XN2A 5J5DA 4PL2A 1JZ8A 5E0FA 3MUZ1 3BTNA 3WQ8A 4L64A 1CPUA 1QBAA 3MP5A 5T8GA 2VXNA 2ZWZA 3G1FA 3IGHX 2Z1BA 1E6ZA 3L4VA 3ARZA 1BG9A 2NQ9A 4Q8WA 3EA2A 1DYSA 1IEWA 1TZ9A 3GK0A 4B5SA 4O19A 3O06A 2WNNA 3GNPA 4G2DA 4GZEA 4AY8A 4M81A 2ICSA 2IXVA 3POCA 1NQ6A 3PM6A 4YHEA 3ZWTA 1TWZA 3VE9A 1S5VA 4UCGA 3H22A 3GY1A 2QIWA 4XAPA 1DHPA 3E0VA 4O13A 3ME3A 2X1RA 2J7FA 4QFUA 2QUNA 2RHGA 2EBNA 1ZBWA 4LWWA 1E73M 1AODA 3ENLA 4H01A 4C5ZA 2DZAA 3MTWA 4IPIA 3M6DA 2GQ3A 1E51A 4O4VA 2XWEA 1KRBC 4GPNA 3NAVA 1R7OA 3CNYA 1V3HA 4BHYA 4Q33A 3WH5A 3NEVA 3NDYA 3H4XA 1WAWA 3I4EA 1AW5A 2YXXA 1J0ZA 3C0QA 3IVTA 5I07A 2JALA 4XZNX 3KOXA 3FSTA 4WHBA 4C6FA 1EL3A 1EKOA 4DJEC 3CWHA 3UP8A 2WZEA 4WUIA 3T8LA 1Y7VA 3KZPA 3WLJA 1XDMA 1DWGM 3RPDA 2WCAA 1M7OA 3W75A 5DMNA 2BVTA 3AO0A 1QW9A 4OUEA 3A3XA 4CCCA 1XI3A 4ZA0A 3LSCA 4NSBA 5IHSA 2PC4A 2JIEA 1LBFA 1QO2A 4HPJA 4MYAA 1OFEA 3CYVA 3WBEA 4PRTA 1ZQ5A 1EF2A 1JPDX 1K03A 1LQAA 2YL6A 1N55A 4YPJA 3GC2A 3A6OA 4Q4PA 2AL2B 4TQTA 3ABRA 2B7PA 4J27A 2VGBA 1U5HA 1DXFA 2NUYA 2HNHA 1XWYA 4ORMA 4G6CA 1RBAA 1RXOB 4H2HA 1L6WA 1KLYA 3F4CA 5D33A 6ALDA 3RJYA 3BVJA 3GWQA 3PPFA 4Y7EA 4RZBA 3I7QA 2CBIA 4LS0A 4G9PA 5A69A 5D02A 4GX8A 2J78A 4I8YA 4DQWA 1GW1A 1B4EA 2GDVA 3HG4A 3BAKA 2OGJA 3JU2A 2WCGA 3KCOA 5CPMA 4CD4A 4F8XA 3EXSA 4AWEA 5CZJA 1BF6A 3KL0A 1VF8A 2I57A 4NX0A 5DFAA 1OYCA 4M5PA 6A3HA 1F73A 3G6LA 3F5KA 3TXZA 1YTKA 1KW1A 4JPGA 6CGTA 4EAYA 3LDVA 4MLRA 1VGAA 3FDKA 3AICA 1LCOA 3RM8A 5G2HA 1W2PA 3ECQA 4UQCA 3SCNA 3LG3A 3WLSA 1OC5A 3LPGA 3A24A 3IUIA 3W1RA 2Y8KA 4JTUA 4TVUA 1NJJA 3PUEA 3PFMA 2QJHA 3UR7A 4IGMA 1V3MA 1R2TA 4JX5A 4LYRA 3V18A 1EO7A 4V15A 1KGUA 3UVIA 2VX4A 3UY8A 3UPBA 3FEMA 1KBIA 1TA3A 4JIEA 2ZUNA 3MKCA 2GJLA 4UXDA 5U7SA 1WDSA 5DLCA 3GDBA 3IANA 4C6DA 2YCLB 4M56A 4MZYA 4TX8A 4NZ3A 3APTA 1MW0A 3WDQA 1FWHC 4A3YA 1TRDA 3BLIA 1C8VA 2IQ0A 1PIGA 2A0NA 3TA6A 3FY1A 2Q09A 4QBXA 4JZ5A 1US3A 3PPCA 4O1BA 1V7YA 1XINA 3U3HA 4JFVA 4QE4A 1ZCCA 3WH9A 1OJXA 1PS9A 2V3DA 2ZXDA 1BAGA 3W38A 3BG9A 3NYDA 3DFSA 4PH6A 1JVNA 3GH7A 3S5OA 4IWWA 3EYPA 4DIAA 2QJGA 2MANA 4JTQA 1TV4A 3DXIA 3HMJG 4JNYA 5EU9A 1JDDA 2GSEA 2ZRXA 1Q66A 3HJZA 2NX9A 5ECVA 4DYJA 1FFQA 1XP3A 4CNUA 1M68A 4HA3A 2YPIA 3KP1A 2NSXA 1GQJA 3GZ3A 1K8YA 2FMOA 3C2OA 1AL8A 2BGNE 2DZBA 2D73A 1ODZA 4HZ6A 3SZ8A 2PTWA 2NQZA 4O15A 2YW3A 5LZLA 2XM1A 1QHPA 4YTSA 5C2XA 2MUCA 4DBUA 5HMSA 1W1A1 3NQ6A 5I79A 5G2IA 3NL5A 3RX4A 3BAJA 4HZ7A 1H7OA 2Z24A 2YL9A 3S5NA 3WQ5A 1Q7MA 3BW3A 3WD4A 3AXMA 1P7TB 1XLAA 4DWSC 4BS0A 4NL1A 2V38A 3W7CA 2PWFA 2UV8G 2ZADA 3LM7A 2ZIDA 2OU4A 5FCZA 3MMWA 3LPFA 3QC3A 4IUGA 4DBEA 4C6QA 1NELA 3C2FA 1S2TA 4HHPA 2B7OA 3R25A 1C8QA 5A6BA 1DKWA 3WLMA 3UZZA 3WQEA 7A3HA 1EGMA 4E2BA 3ABSA 4J3SA 1UPPA 2NQLA 5BWFA 4QHRA 3VD5A 4XKMA 3REQB 4M7SA 1G4EA 4C6LA 1M7XA 3H2EA 1UKQA 3GG7A 4LGXA 1N8IA 4GYJA 4U31A 3UESA 3LCGA 4QG9A 3S9IA 2BODX 1L8NA 3V5CA 3BANA 2QJIA 1ONWA 4PMUA 1F3WA 1YTEA 3PUGA 4I9MA 1ZFJA 1E56A 1WE5A 1CLVA 4HB7A 1VEOA 3GNXA 3SN0A 3BGJA 3T8QA 2WQDA 1PKMA 4CNOA 4QJ3B 1U5VA 4F9JA 2Q8ZA 5CZTA 3KVJA 1TVLA 4JIHA 3P80A 1OG6A 1UD2A 3H70A 3U4AA 3WLTA 3U6WA 1JFXA 2J7HA 5IRPA 3QW4B 3ZR5A 1XLHA 2QZRA 4OBRA 3UJEA 4W84A 1WDWA 1IZJA 3WENA 3W83A 3PN8A 4PODA 2ISWA 4K3ZA 3GNDA 1XRTA 1ISXA 3UQNA 4PUJA 4YTQA 4IICA 2F2HA 2QEZA 3NQEA 1LLOA 1CENA 1OFRA 2FTWA 3QZ6A 2F61A 4LYQA 3V75A 1G4SA 1UYQA 4LVDA 4GFSA 4N7QA 3G1RA 4XAYA 3SIZA 2XSBA 1Q13A 3WY1A 3I6RA 2O7QA 3N9SA 1OYAA 3WELA 1OFQA 4B3KA 5LKYA 4F0SA 4I7VA 1A5MC 1J6PA 3B8SA 3DBNA 3RU6A 3OLEA 4FNRA 4LALA 3ARTA 1X97A 1XLBA 4N42A 5D32A 3OIHA 1JQXA 4LUJA 3GNNA 5JU6A 4PR4A 3U5YA 3DDMA 4G56A 4ATDA 1B0IA 2HVMA 2PCEA 2FGLA 2PAJA 1XKJA 4LV4A 3T2PA 1J9YA 4MIMA 3LOTA 4RW3A 2PE4A 3L2MA 3AS1A 2XM2A 2AAMA 3DIPA 2V0TA 4JHOA 3R4IA 4TO8A 4DWDA 1XGZA 4ZENA 1FCUA 2PBOA 3C2YA 3W74A 2R91A 2QDDA 2IW0A 3WD3A 3GBDA 4I3GA 4J3XA 4JL2A 3DH7A 1T41A 1PAMA 2VEPA 3QQWA 3SAZA 2WZHA 1IHIA 2MNRA 4I5XA 1UH2A 2DPEA 1J79A 1RP9A 1OZMA 5CEWA 1H0IA 5FA5A 1V08A 2X41A 2Y2WA 2VHLA 2DORA 2F9RA 1YDYA 3SCVA 2I7GA 2WM0A 3FVDA 2XFYA 5BROA 2JQXA 3B0VC 4EVZA 1SFTA 4LYPA 4OIFA 1E4NA 4V1XA 2GGGA 4MG4A 1J2WA 1DJNA 4IPJA 1K9FA 3AHVA 4M24A 2PCQA 1BSIA 3W71A 1MRQA 1T0OA 1TV7A 3QPZA 5AVHA 2D0HA 3BSHA 4W4QA 3HU7A 3OZOA 4KCVA 4DEFA 3EKZA 2PRLA 2YCJA 1WAUA 1YDVA 2C18A 4UTTA 3OG3A 5GPRA 1FH9A 1L6YA 4LBSA 1YPFA 4HCLA 3A9BA 3S46A 2EPNA 2O7SA 3IIXA 4K1GA 1DJQA 1TUFA 3KZSA 2ZX8A 1OZQA 2PURA 1Y5XA 4MB5A 2A6LA 4PUMA 1A5UA 4CVUA 3CWOX 1BKSA 2EEXA 3BOXA 4DUVA 1C91A 1VYRA 5GQBA 3BG3A 3UJRA 3U0HA 1GKPA 1V6WA 2YYTA 3T0TA 1RH9A 3FXGA 4D6FA 3EOEA 1EFZA 3WH8A 1IGWA 1GVOA 2GJRA 4RUBA 1QWGA 2JE8A 2NXGA 1POJA 3ZYZA 4CD8A 2DVXA 3HFTA 3N1AA 4PB4A 2FDMA 1RPXA 3N9KA 1KFKA 4HJFA 3VGBA 4EK7A 4KWSA 2F38A 3VDBA 3KXQA 1H4PA 3DUGA 1ZU8A 3WNNA 5E1QA 3THUA 1HN1A 1YBQB 2VC7A 4DRSA 1EF3A 2V5LA 3IGXA 2WW5A 2P76A 1NDYA 3TAOA 1VH7A 1FP8A 2YZ5A 5D8ZA 2OELA 1OCNA 2POZA 4GJJA 2VELA 3AMGA 5HWMA 5MKGB 3CK5A 4O8AA 4AISA 4Z17A 4Q8NA 4EWND 5CC5A 2CIPA 1V3LA 2GGIA 4AZHA 3RR1A 4FLSA 1W5OA 1TWIA 1IV8A 2QPXA 4O0QA 4N02A 2BHZA 4WSKA 3P61A 2JFEX 4WRHA 1VHNA 4E4UA 4PZVA 4GQGA 1OIMA 1VIWA 5C2GA 1J01A 3UG4A 5AOUA 2XPKA 1OFPA 3UT0A 4WX2A 1VENA 5F2IA 3ZLHA 4AIBA 2CBUA 4XBJA 3SJ3A 4JN6A 3S1UA 4DY1A 1RSCA 2QGHA 2GGJA 1L8PA 3PS7A 1FWAC 2GL5A 1GCYA 4RDWA 3MUXA 1NH6A 4K8HA 4ZB0A 4PMRA 3O8AA 4H8VA 1P0DA 4QJ5B 3GU1A 2VQUA 4CQBA 1EJUC 5MHBA 1CXEA 3HGJA 3BGAA 1XLCA 1EQPA 1XV8A 4M6UA 4OVXA 4ZOCA 3CASA 3WEOA 1QDSA 1IEVA 2QCNA 3LX9A 3W3OA 2AGKA 1VZWA 1A4LA 2C19A 1GGOA 3ATYA 4M29A 3HG3A 2EJ1A 3EEGA 4PCNA 1FKXA 3WUBA 1PV8A 4GG9A 1TR9A 1WZKA 2V6AA 1GVRA 4TU1A 5KEZA 2OTDA 3CQIA 3EKGA 3UBPC 3GH5A 1JZ2A 1HGWA 4NI8A 5K3VA 4HOZA 3HA1A 4NJKA 1L2QA 3OYXA 4FIQA 1LBLA 4D71A 3LERA 1S5TA 3RLUA 2W3ZA 1EA9C 3IJDA 2R14A 4WY0F 4MJMA 4MF4A 1VFLA 5FOOA 2VRKA 1V6XA 1SJBA 3HM7A 2VDHA 3GHTA 4Z2GA 5KTLA 2VTFA 3UG3A 3O9NA 3IV3A 5CGQA 5GNXA 5AC4A 3RLHA 3PZNA 4AIUA 3A47A 3MW7A 3B40A 2OYLA 3FJNA 5CSRA 1GKRA 3ZSSA 4DO7A 3VNJA 1PHQA 3NDZA 4HU3A 1UBPC 2WV8A 5A2AA 1EOMA 3TN6A 4C60A 4S1FA 4KW2A 2J6XA 2WSRA 1RK5A 2H9AB 1OBAA 1J6OA 3WFLA 5A8GA 3DX5A 1JGIA 2ASHA 4IJCA 3GVVA 1PHWA 3D3FA 4X0VA 1Q65A 3PWIA 3MSDA 5EBAA 3BLLA 1E0VA 1OGGA 2GJNA 1V6YA 2Z2AA 1AQHA 4D6GA 3OBAA 1K9EA 3GZAA 5EBUA 1YNPA 4DAFA 4IP5A 2VENA 3O6YX 1R86A 3TV8A 1S2AA 1X8CA 2DY3A 2E1WA 1TJRA 4R33A 2BMBA 1AQMA 2B4GA 1XIIA 4JX4A 1Q6RA 4JQ4A 2GUYA 5I3FA 3WH7A 3VDCA 3VNMA 3ZIZA 1JDAA 3JZEA 4KWWA 1B54A 4O1CA 4JTIA 1EJTC 3OQEA 1D3GA 2CLHA 2VR2A 3M0VA 2F6UA 4U4MA 3IPWA 2PZ0A 4FR6A 4GO8A 2PD9A 2YXGA 1H62A 3O6DA 1JD7A 2OCZA 2XZ7A 5HQEA 1UP2A 4NXSA 1QNRA 3A22A 4KESA 4GNVA 5FF3A 4N9CA 1J5TA 2WJDA 1BRLB 2R1LA 3PZVA 3A3WA 4I7UA 4CQDA 4NVTA 4D8LA 3SI9A 4P8XA 1ADSA 4UR8A 1RCOB 2CLFA 3MUY1 3NGJA 2D2OA 3RIKA 5I3GA 5CXPA 1NWTA 3WJWA 1W0MA 3NQAA 3B06A 2PLKA 2OOGA 2J7BA 4LXFA 3BLDA 3MVIA 2GPTA 4QCEA 3WL1A 4CN6A 3PZGA 4C6MA 4ADUA 3CMJA 1J8VA 3PANA 4L61A 5AVNA 4IX2A 1XSKA 4J35A 4QS5A 3IRSA 3R0UA 2X0SA 1TTPA 1XIMA 3VD4A 4M7TA 4KWUA 1UQZA 7ODCA 1EGZA 2DFAA 1ZPTA 4GIYA 2VR4A 5DXXA 1TFVA 3LCXA 4EWJA 3H2FA 3GXDA 2DT0A 5G4WA 3ITYA 3M0XA 3W2LA 1QI2A 2WYSA 4LQ1A 4ASTA 3W37A 5EMLA 4L65A 3URQA 3LK6A 4FSAA 4C6NA 2ABAA 1UH3A 1CLKA 2WO5A 1H7WA 1V0NA 5SWUA 4EXBA 4O52A 2FZ8A 3OBEA 4G1NA 1DTNA 2WZTA 3WBXA 2PODA 4CCZA 4MWAD 1CXLA 4KIEA 4DUWA 2PDMA 1FKWA 5FF7A 4N9DA 3QQ0A 3CU2A 3CZKA 2BSLA 2DIKA 1N8FA 4OOUA 1EDQA 3W2UA 4HMCA 4D1IA 3EXTA 3QM3A 1XIBA 2NX3A 3S5YA 4UQDA 5BU9A 1VFHA 3MV11 4X9YA 3PJWA 4C91A 4Q6XA 3YPIA 1XFBA 1JPMA 4INFA 2BZNA 4HCHA 5FSEC 4PBGA 5C54A 4JTAA 5TNVA 2PP3A 4WGXA 1TPC1 3WDJA 4UNKA 1MDLA 5ABHA 3QPEA 4C6JA 2EJAA 3COTA 1XCWA 1ELSA 1ZUAX 2A85A 5JH1A 4UOJA 2FVLA 2ALRA 3AS0A 4NJHA 4JQ1A 2J8FA 2BOGX 1DE5A 3TYCA 1X1ZA 1HJVA 4NNBA 4ATLA 2WKLA 4KCTA 3CWNA 4FNUA 1DP0A 3CHEA 1WKYA 3KOZA 1G6CA 4WDTA 1XXXA 3GH4A 4TV6A 4H8HA 3H2MA 3ZZ1A 4P7NA 3SQLA 3WKZA 4IHCA 2X0YA 1O5XA 2B0MA 3WDPP 5AC8A 3BL3A 3W4RA 2Y5JA 1Z7AA 2SFPA 4ZO6A 3AXHA 3R8GA 5DT5A 3G1XA 2IPWA 2YW4A 2PDHA 4PMYA 4BF7A 4H2CA 3WUFA 4HSHA 4AXNA 1KCZA 2J25A 4PMQA 1V4YA 2YA0A 4Q4QA 5AYXA 4GHRA 4KF1A 2XFRA 2VFIA 1E5NA 1TX2A 3SRKA 1Z42A 4GI9A 3WNPA 2VGFA 5C70A 1AH0A 4GMEA 4ATWA 3EWWA 3SSZA 3QN3A 4ORIA 4Z1CA 3LMYA 1R3SA 3TWAA 2WHKA 3NL3A 1RA5A 3T09A 4D6HA 5D9OA 2HNEA 5I6SA 1JNEA 3S0CA 1XF0A 1MUMA 3U7BA 3GHRA 4RPPA 1EGVA 1E1EA 1UC5A 4IIHA 3WH6A 4FX7A 4GA8A 3LPOA 1QPKA 4WJ8A 2J7EA 3KRUA 4NJIA 3TWBA 1TR1A 2PDXA 2YCIX 5I3DA 4LAOA 4MY8A 4WY0A 1KFLA 2PTXA 2OZ3A 2OZ8A 4RK8A 2CCRA 3P0WA 4GZ7A 3FKRA 1UMYA 3T0CA 1TTJA 5IFTA 3VIMA 4QQUA 1HP5A 5EFDA 4GC3A 4P7OA 5I06A 3EZ4A 4UB9A 3C6CA 3GIYA 1QPNA 2G3IA 4MJZA 2CZFA 1P6CA 4F2TA 5E9AA 2A5HA 4RDZA 3BCJA 1QOPA 4EX4A 5AHNA 1CXKA 3DECA 1UZHA 3L7RA 5I02A 1A49A 3W1XA 3N34A 2AMGA 3F7JA 4UFLA 4DLFA 3TFCA 1M7PA 3FNDA 4IT1A 6TAAA 4V2XA 3CMFA 3BDKA 2C15A 3MKVA 3VDHA 2C3ZA 2DIJA 1XIEA 4X63A 3VOFA 2C71A 4JBRA 4MB1A 4YMZA 1EJSC 3CZJA 1IZKA 2OSYA 2VURA 2PUZA 1CXHA 2ZXBA 4JY9A 2A21A 2GFTA 1Z69A 4O28A 2ZX9A 1PUDA 5BXRA 2GVEA 4IOTA 3LXAA 1P6BA 1LT8A 1UR3M 1XYAA 3LLXA 4E4PA 3WMLA 3WLIA 3QR0A 4MZ8A 2VZTA 2GJXA 1KM3A 1E6PA 1RD5A 4GIAA 3QMRA 2Z0IA 2ZUTA 3FAWA 3FVMA 3QBUA 1CLXA 3FA5A 5D04C 2E0PA 1TWSA 1IQ8A 2PMQA 1YRRA 2J88A 7TAAA 4I5RA 4BQ2A 4H8UA 4UWMA 2YR1A 4FXRA 3R58A 4BCEA 5BRQA 1SW3A 2J6VA 2DZWA 2BGQA 3QOMA 1HZYA 1XBXA 5RUBA 2BY1A 4ROPA 3KM8A 3LS9A 5EMJA 3KCLA 1AW1A 1RVKA 1B3ZA 2YBUA 4F0LA 2YCKX 1H5VA 1QOXA 3M64A 2FKPA 3NG3A 1M03A 3VD7A 5CBJA 2QR6A 4L4PA 4ZL1A 1TWDA 1TZZA 1FH7A 3N9RA 2PDPA 2CFFA 3SGUA 2PP1A 4CLMA 1OX6A 4DO5A 1YXYA 3OJGA 2J77A 2V5JA 1H51A 3W53A 1UCWA 1KV5A 3VIIA 2NLYA 2V5KA 3AMDA 4L1WA 4TIMA 4CNSA 3GR4A 2VKZG 1V0LA 5LNWA 3WZ0E 2DH2A 3B9EA 4RJEA 4MGGA 3BJFA 3ATZA 1ZBVA 2WHMA 3P2VA 4RE2A 2G96A 1C9DA 1AL7A 2ZRYA 4F40A 3NQ2A 2DZXA 3NL2A 3DHUA 1KM4A 1HGYA 3WJZA 2DGAA 3QW3A 2GVJA 2X2GA 3ALFA 1OC7A 3STEA 2X42A 3P67A 3FK4A 7PTDA 1ZJIA 1E4MM 1MI3A 1JD9A 2DUAA 4EAMA 1REQA 3RO8A 4E38A 2NQJA 2GVGA 4IIEA 1TREA 1C8XA 1CZ1A 5MF5A 5KZEA 1NTHA 4LANA 1W1PA 1GNXA 2H8ZA 3ZS4A 4W5ZA 3I65A 4JQ2A 1H41A 4JNZA 4NYUA 3P93A 1V02A 1H49A 3C4UA 1VIZA 3ABQA 3WBYA 2XIQA 2C0AA 2I5QA 1VLWA 4UMBA 5A6BD 1UC4A 1CIUA 4ZXOA 3G1HA 5HANA 1WQ5A 2ZRUA 1KO0A 1RK6A 4UOQA 1T7LA 3G6MA 4UMCA 5M1TA 1SJDA 3EB4A 4C1NA 3S1VA 4C7FA 1YXDA 3KBWA 3C8FA 1M41A 5LSMA 1OHLA 1OSEA 3HN3A 2DSZA 5AHEA 5TQLA 4WVXA 1QBBA 1B31A 5J04A 3BLFA 4ZB2A 4HOXA 3FXYA 2WVTA 2PDGA 1TPUA 3GNRA 1Q6GA 1ICQA 1TJ1A 3GX9A 3PWAA 5EKYA 3IVUA 4HJWA 3C0LA 3GVGA 5LHEA 3USZA 2DZPA 3AXKA 2HXUA 4IQJA 2Z29A 4WDXA 1KRCC 4FF7A 2VVNA 2Y7FA 4DF1A 3RNDA 3H2NA 1NDZA 5LA1A 3V7PA 1QASA 5G1TA 2ATMA 3L4YA 2AQVA 1E6RA 5TF0A 2KAUC 4ICCX 1V0MA 1LUCB 3II1A 2VX5A 3UW6A 1QI0A 2NV1A 1QATA 2QCGA 2JF7A 1H1ZA 1IYXA 4E2DA 2ZICA 3NR0A 5BXTA 4N0RA 2WHJA 4DJFA 2OFJA 3MZNA 2ZVIA 4A3RA 1H61A 4WJEA 1AJ2A 3S2CA 4A8LA 4Z1AA 2NVCA 5FF0A 3WF4A 3MDUA 2GVLA 5AC6A 1EP1A 3UETA 4JHZA 1UB3A 5D30A 4AHPA 3STCA 2ZXAA 2WBGA 1XSIA 3SURA 1V77A 3GG0A 3O6AA 4IFKB 1LQ2A 5LA0A 5A6LA 1SUXA 3OHIA 4IG2B 3CEUA 3GVWA 3TSDA 4P7RA 5KZ6A 1K7XA 4GKTA 3AZSA 3VFCA 3CQHA 1PEZA 3G1VA 4I6VA 4CQAA 4ZOEA 3QHNA 2W4XA 2Z4GA 1TG7A 4L6OA 3VMOA 1DJXA 1G1YA 3K1GA 1ZP3A 4WR3A 4AD4A 4QITA 2H6RA 1Y5WA 3WF0A 2CKSA 1JIBA 2NWSA 2VEFA 1ZAJA 3DKJA 3TX9A 1K8ZA 5C7HA 4JKLA 3DZ1A 3S6TA 1FWBC 3HV9A 3VMPA 1UG6A 1O68A 4WXYA 1C29A 4M6VA 1IIHA 3CL8A 1QFEA 5I3IA 4JTCA 5LNSA 1O66A 2J7CA 3OZMA 3VYLA 4PEKA 2XTKA 3VIKA 3ZT5A 4B15A 4DNHA 3DI0A 1XYFA 3L4UA 3LPPA 5REQA 3B8IA 1MZHA 1XUZA 2FTPA 1D3HA 4D6EA 3LV6A 4QJ1A 4U28A 1VS1A 3H26A 4U10A 1XBZA 3VUSA 5CG7A 2X16A 3K8KA 3D5HA 2HS8A 1K7EA 4HNUA 3G0SA 3ARVA 5M03A 2VGGA 3DG6A 2BY0A 1DL3A 3WNKA 2ZX6A 2O4MA 4OUIA 3PY2A 5G5IA 1OADA 2ZOXA 4LU0A 2FJKA 4AQLA 3M44A 5AZ0A 3UCQA 3R2GA 1OCJA 4RX0A 4J4KA 3GTIA 2OKOA 1VLIA 1QOQA 4W9TA 3KOYA 3RRXA 4DJDC 2PDCA 1J5SA 2D2HA 1FWJC 1X96A 4ML9A 1E70M 3Q4DA 3BLPX 4GXPA 2OKTA 2FYMA 1E5JA 1RD6A 4KGLA 3W25A 1QPQA 3LXBA 3NQMA 1G9HA 1UH4A 5CBIA 1B3WA 4DJED 5AYBA 1XG4A 1HT6A 1S3HA 1XC6A 2QMJA 4OGZA 1RQHA 4GXMA 1QNOA 1P6WA 1J18A 1D2KA 4ZO8A 1QVBA 4TVCA 1F61A 2J24A 5FD0A 5HINA 2E6DA 1LZOA 3PBMA 1S5NA 3VIHA 3ITGA 2XSXA 1M7JA 4A2RA 2XUCA 2Z2UA 3LBOA 3FX4A 3TC3A 4GBUA 1LL6A 2CLEA 1Z3NA 2Y7DA 1CGWA 4XTIA 1O60A 2H90A 2PGRA 1GYMA 3BV7A 3W7DA 5TBOA 4MMWA 5A8MA 2YB1A 4X3ZA 2EXOA 1HVXA 1ZJAA 4LAMA 5CSUA 4Z42C 3BARA 1ODUA 1LQ0A 5HA7A 4LPCA 4BY3A 4F0RA 4PRRA 1QTWA 1XHGA 2P8BA 2ODOA 4D6DA 3G1DA 1ZNNA 5LNVA 4BQ5A 2I5IA 4UR9A 3KCJA 1MFUA 2DJLA 3C3NA 2DW7A 3NA8A 1B3YA 1R5YA 1RY0A 1H5YA 2NT0A 1TPFA 3PJXA 3TLQA 4JYDA 1GVYA 1J11A 6TIMA 4EPBC 4HQVA 3F5LA 3ERPA 2E1DA 3CL6A 1AA1B 1GPWA 4HHLA 4DPPA 3ITTA 3UJFA 1Z48A 3Q45A 3G1AA 4QQ3A 3BGGA 4OJYA 5TAOA 2G5WA 3O0KA 3QVQA 2V8ZA 1FUYA 4O54A 1MEWA 2QDGA 3NPUA 2F7FA 2VQTA 1KCLA 3NM3A 2RDWA 1KTNA 1XBVA 2VL4A 1F76A 1EJXC 3WLOA 2Q6ZA 3K13A 3FFSA 1JULA 2PA6A 4US5A 4O18A 4DPQA 1FY6A 1FWEC 1E6QM 1E3ZA 4HPNA 4AXKA 4RZ5A 4XISA 1SQ7A 3AHYA 4U5KA 2XIIA 3CV6A 2YKKA 4LAKA 4PMOA 5D2XA 4HNTA 3R12A 4BQ3A 4GQQA 3E6EA 2VYOA 4K7YA 1XISA 1TJ2A 3LEPA 4WKFA 3P82A 1H1NA 4MPKA 4Q4KA 1QUMA 1DXEA 4FPSA 1GOMA 1B3OA 1SO4A 2WJZA 2Q8LA 5CPSA 4LX4A 3NNTA 4N9EA 2QV5A 3WK2A 3TJIA 3RGTA 4PN2A 3U2ZA 3TMQA 2UY2A 3DESA 1X38A 3GKAA 3SIMA 1S38A 1GOQA 1GOWA 3SY5A 2Q3OA 2HWGA 2E09A 3LLFA 5CSYA 3WDHA 5DCBA 1WO2A 1NM9A 3BXWA 1XYZA 4MJ2A 4S3DA 1SU5A 3L66A 4RE4A 3TR9A 1KM6A 4FB7A 2IMRA 1WB0A 1V6VA 4WQ6A 3S3GA 3LCWA 1P0BA 3W7GA 2D2JA 4NNAA 4JIIX 2WMIB 3UERA 2WBKA 2OVLA 2QLYA 2Z25A 2A7PA 3SGGA 4XVDA 1A3HA 1K6WA 4JHMA 4R53A 4A21A 8XIMA 3AALA 3C2EA 3GKFA 3F4NA 1ML1A 3W7RA 1AUSL 4IP4A 5I2UA 4EOUA 3E2RA 3T2OA 3NO1A 5BCAA 2E9BA 4AC7C 1CI1A 4DM1A 2JEQA 2P5NA 4TXEA 4R9XA 4CQCA 2P50A 2R1KA 2J9XA 4JOMA 2EAWA 3URAA 2A7NA 4RKAA 3QV9A 3L23A 5CAKA 1FHUA 4GY7A 4B5UA 1YW1A 2Y63A 4BJHA 1TYGA 3TMLA 4XUGA 3A21A 5DANA 1TUXA 1R8LA 3M0IA 3W24A 3NIYA 2Y7EA 1GG0A 2WMFA 1TIWA 4A29A 4EIVA 4DI9A 3NGFA 1T5AA 4NI3A 4TMCA 4IGSA 3I10A 4OECA 5H6HA 4YS1A 4KEMA 4IUOA 4XD6A 3E02A 1PB0A 5EA9A 1M53A 1LRQA 3G3MA 3UZXA 4EKJA 3TTYA 4HK6A 5I3HA 3VZXA 1X98A 4B3ZA 4K2SA 3VDAA 2BX7A 4W87A 1Z32X 3GXNA 1AMYA 1IWBA 4Y96A 3OA5A 4IJBA 3S1XA 3D6NA 5HATA 4RNJA 4M6QA 4HVXA 1F5ZA 3PZQA 5FEXA 2ZZ5A 4ZFCA 4O1EA 4YN5A 1G0CA 3LXCA 3WNMA 3EX3A 3RG6A 1UIOA 3VIOA 2CERA 3IS4A 3K1DA 4DZIA 4LF1A 2P3EA 4QDWA 2V3EA 1U2YA 5F7UA 3ARQA 4PE8A 1JCJA 4G5DA 4IISA 1D8WA 3TONA 3VC6A 5F4WA 3EPOA 3QFEA 1MNZA 2JK2A 4DI8A 2J8TA 3W26A 4FMVA 1KD0A 3HO8A 4I6KA 1AQFA 2DT3A 3STGA 4CQ8A 2W27A 1FCBA 2ZRWA 4TVDA 1Q8JA 3O15A 5BMXA 3O07A 4L4LA 1C3FA 1DWAM 3HGOA 4HK5A 4LB4A 3PBUA 3BV4A 2ZTJA 1KFJA 4ILSA 4E4FA 3CB3A 2EO7A 4WD0A 3CJPA 2Z00A 4J28A 2VFDA 3V35A 1SR0A 2PI6A 2BWGA 3OGVA 2VWSA 4ZZ9A 3STPA 2HTMA 3M7WA 1TB3A 4MZ1A 4WOZA 3LHWA 2PB1A 1DQUA 1XLKA 3W72A 3MBDA 4S23A 2WKJA 4LVFA 3WQ4A 3RF9A 2FH6A 1VPQA 5EMMA 4PTXA 4O10A 1AK5A 3R8HA 4GK8A 5HWJA 5J5RA 3AYVA 3OLGA 3GQYA 4A8NA 1BYCA 3P5ZA 4JKKA 5LXXA 3ZMRA 5DELA 1MUWA 3IK4A 1VBHA 3GDLA 4HD5A 1UWIA 3OTRA 3GG1A 5JBDA 3WLKX 1EYWA 3EWXA 1TQXA 1KFWA 4GH1A 1PE1A 3CIVA 4LUTB 2PF0A 1JEZA 3W6YA 5T9BG 2FZDA 3N3TA 4O0KA 4Q8MA 3UZYA 3CUIA 4MKSA 2BNJA 4GZIA 2ZXQA 2Y7GA 1S2WA 3QTGA 3TW6A 1QNQA 2CHNA 3QPYA 2DEPA 1A0CA 4JFUA 2DZVA 2VCAA 3AHTA 3WF2A 5BYWA 5AHLA 2XDFA 3PSWA 4F48A 4XZBA 4GJIA 1A47A 2D3NA 4O0ZA 5TIMA 3L0GA 3TYEA 3FSUA 4OT7A 3LU2A 3WQVA 4PFHA 4JX6A 3NQDA 5JH2A 3EOLA 2C79A 1WNOA 4HBKA 1M3UA 3HGRA 4A2SA 1W37A 3A64A 3FOKA 1S2UA 3BK0A 2C91A 1ISWA 2WNZA 3PBVA 5XINA 1Z89A 2ZZ3A 3W00A 3WLQA 1BVWA 3A12A 1CGYA 1V3KA 3GTXA 1UD5A 5DCDA 1MQPA 3JR2A 3P60A 3PZ9A 1MW2A 4JCMA 3UR8A 1ITCA 5HJXA 1EHAA 1TELA 2VX7A 1YX1A 1Q6DA 2VZSA 3B04A 5BOEA 3QY6A 3RLVA 3E5PA 1HL2A 4GUGA 1JPKA 2CITA 1R3VA 4MJ4A 1PX3A 5C0QA 1P0NA 2DJXA 4XV0A 4O12A 3EA3A 1IGSA 5ABFB 3BLOA 1DIDA 4ZSUA 3VOGA 2WVVA 3W85A 3LCHA 3GUWA 4K7VA 3VGEA 1VCGA 3TROA 2FGBA 4MVAA 3LNMA 4UFJA 2VX6A 3THDA 2ATSA 4JTLA 3C0JA 1TCDA 4GCAA 1EZWA 3TEVA 1UPMB 4BI7A 3SCTA 3FYPA 1W1YA 4YWSA 4LFYA 2REQA 1UA7A 1EB3A 4CCDA 4JR5A 2EG8A 2ZC1A 1LROA 2VZVA 3VTRA 3MP4A 5DEZA 4TTUA 4ENLA 1PWLA 2HE8A 2QHAA 3FCPA 3UXAA 3GIQA 4QM1A 3QZAA 2YXOA 4KKXA 3UY7A 2VEIA 4GOAA 1M01A 3PB2A 5EFFA 3TSBA 3W1QA 3G77A 2CLIA 2E25A 4HA1A 1MQQA 2VEKA 2J8GA 3MCNA 3T0DA 4L6HA 3UGRA 5CG0A 3VUPA 2TSYA 2WZIA 3RM9A 3R5EA 1B90A 3WLPA 1ZB5A 2R1PA 3EXRA 3WNLA 1J10A 3WLNA 1CT5A 1CGXA 2W63A 1Q4WA 1LL7A 4ZXLA 4GNJA 3VCCA 3LHTA 5BZAA 2VDIA 3NUKA 1Z8AA 1KQYA 3M7SA 2QUTA 2NW0A 2ACUA 1JCLA 3AYTA 4PTDA 3D46A 3TN4A 1MO0A 2GLKA 4S3KA 3GAKA 1R46A 1E1CB 4IL0A 4HMNA 2V9DA 1KKOA 3W29A 3E5BA 4OWGA 1XSJA 1P5BA 4HK7A 4V33A 3TLLA 4AX7A 3CZGA 4I90A 1KWGA 1NY1A 2OQHA 4HP5A 5G4HC 3T78A 1VJIA 2F6XA 4EANA 4O1AA 3ZVHB 1H60A 4HTBA 3TCSA 3DG3A 3OW1A 2FGZA 4V27A 3HQ1A 4XAFA 4O1DA 1QR7A 3WQGA 3WL0A 2HV5A 1K4HA 3DBPA 4DZ5A 3E0LA 2DIEA 3AZTA 4TUFA 2ZCGA 1ITUA 5U4NA 1X7IA 3I7RA 3M07A 1BXBA 4LT9A 2OB3A 1GQIA 2W5FA 4OTKA 1VJZA 4PB3A 4EP8C 3UCCA 5D9NA 3TQVA 4QLKA 4NZ4A 1WBJA 4GIEA 4E5TA 1OIFA 4HSOA 4HYRA 4HMDA 1UIPA 1UZ1A 2J66A 3WJSA 2WAGA 1WDDA 6REQB 3W7IA 3UZ5A 4L56A 1EA0A 1G4PA 1S39A 3CS2A 1MZRA 4G7EA 3CUXA 1T8XA 2WPBA 4W8AA 2VWTA 3HGSA 3CTLA 1ZBKA 1LWHA 3V0TA 2ZUUA 4NAEA 1K77A 1LWJA 3NDOA 5I23A 3BO9A 5IBXC 2JGQA 1MYRA 1Q8AA 5PTDA 1MXDA 4H7VA 3CH9A 3KX6A 3WQOA 1ICPA 1SPQA 1OX4A 1U1UA 4LCRA 4B9ZA 1GOKA 1KKRA 1JUBA 1V7AA 3HG5A 2J62A 3W6MA 3IGSA 3TFXA 3G18A 3GFZA 1EX1A 4JKMA 2GK1B 1EOKA 1W3LA 1I1XA 3MHGA 4MWAA 4JFSA 5AHMA 4I8DA 1DWHM 1UROA 3IK2A 5C71A 2WB5A 1BQCA 3USBA 1FHDA 3WJXA 1R85A 3M0YA 2Q3RA 3FDGA 3N29A 3FV9A 4MM1A 4RLIA 4GNKB 1RJQA 1VJSA 1A4MA 1HJXA 1OFDA 1XRVA 2XZ9A 4H9YA 4AZCA 1BWLA 2AGTA 3N25A 3AC0A 4UTWC 1GUVA 5C6MA 3W7QA 3N12A 4K38A 2ONEA 4EF9A 8XIAA 3GLCA 3UPMA 3F4DA 1E0WA 3CIXA 3LCFA 4GYPC 1DTUA 2EPMX 1VHCA 3IARA 5F2LA 1VBUA 1JZ4A 1V03A 4RPQA 2CYGA 1H7RA 3A3HA 4AWSA 1ECQA 1VRXA 3LCIA 3QXBA 2DDXA 3U4FA 1K3UA 1LT7A 3INPA 1YIXA 3MYOA 1GEQA 3O0FA 3UXIA 4KFNA 4C1LA 3RHGA 4YVVA 1NWRA 2FPYA 2BGSA 2UY5A 4DJFD 4WSJA 1F3TA 2UWFA 1LORA 3Q67A 4W85A 2GYIA 5M5DA 1Y0EA 4JFWA 4PMNA 2OLHA 4QDMA 1AH4A 3G8RA 1CXFA 3KTCA 1JRCA 3AIQA 1PZ2A 5LYRA 3KBVA 4KMQA 4BQ4A 1VPXA 3SW6A 5C2CA 3E74A 4BI5A 4I9TA 1S5WA 4ZMGA 2O56A 3W70A 1KCXA 5ABEA 1DIEA 1FWGC 4PUKA 2VNCA 3QGVA 2E28A 1E71M 4IFKA 1L2UA 5A6KA 1HKJA 1I9CB 3OU8A 1E9ZB 1ZJBA 5LIUX 1DOSA 4S3AA 2YFNA 3GXIA 3ORWA 4KFOA 1XCFA 2HVOA 4OBSA 4DN1A 4K68A 2V2CA 2XH2A 4GCXA 2FMNA 1NDWA 4EXAA 2R6OA 4UTUA 3KWSA 4MFDA 3AJXA 3VD3A 3MANA 3CZEA 4B5NA 4BKNA 2BOEX 4L9XA 1H50A 4N9BA 1EDTA 1HF6A 1O6IA 3AYSA 3GM8A 4H9XA 4IGHA 3TIMA 2FZNA 2VZUA 3ITCA 1AD1A 2ALDA 1GZ1A 1UD4A 4M0XA 1GT8A 1NFGA 3WD1A 4CQ9A 3OODA 1A53A 5IHRA 3EMZA 1PKNA 4NASA 4ZO7A 4CNTA 1EX5A 1WKEA 1DEDA 2D0FA 3ZJ7A 1PCWA 3MC5A 1SGJA 3L65A 5D4YA 4E2VA 1XICA 4RE3A 3B0PA 1KRAC 2YCEA 1WDQA 3EOSA 1PDYA 3PPHA 1NP0A 2WLZA 2XGBA 3C56A 3D0CA 2ZZ7A 3DFHA 3WJYA 2Y88A 3VGFA 1R9YA 4XO7A 3RAOA 4E0CA 3SQSA 1VFUA 3M6YA 2OGYA 3IIOA 3MO4A 1W3TA 2NQHA 2QCLA 4AMCA 4MFEA 5CC7A 3BMVA 1ME9A 5AN7A 5GJMA 3CO4A 1LOQA 1R7AA 3QTPA 4EE9A 4DVOA 4B16A 1XM3A 3DOPA 3W84A 3HFYA 4US6A 4P61A 4AWUA 2G37A 4UQ9A 5FJTA 2CZ5A 4JY8A 4GZJA 2VR5A 4GINA 3H8AA 2IKIA 1XLIA 1NF7A 3NVDA 3C2VA 2GQ8A 2I9UA 2QIIA 1IEIA 1F05A 2PLCA 3GUGA 2J4GA 3I68A 2O9TA 1MEIA 3ZOAA 5CAHA 1W1VA 3LRLA 2WJEA 3T6CA 2FIQA 4HNVA 2X05A 4D6IA 1TTIA 1EEPA 1VP5A 4LH8A 3WBWA 1W3IA 1R3YA 3NQFA 5XIAA 4ERAA 1GJUA 5D2WA 4ZTYA 3UG5A 1IZCA 3VK5A 2V2DA 1EJRC 1QPOA 2QAFA 2Z26A 2XVLA 4U2ZA 4KRZA 4UFMA 4HZ8A 4PMZA 2G3FA 3AISA 1TO3A 2QPSA 5BMWA 3QY7A 2Z27A 3VXGA 1YDOA 2BXYA 1VEMA 2ZDRA 1S2CA 3B0XA 2X1UA 2DT1A 1SFLA 2PF8A 3APGA 2CZDA 4IM4A 4F4RA 3EA1A 2E40A 2WQPA 2PDBA 4P5UA 4IH3A 1S5MA 1DJWA 5HR7A 5G1YA 3CEPA 4W7WA 3BSMA 2PU0A 5DO8A 1UWSA 3S9ZA 1KXHA 2WC4A 4P8VA 1CGTA 4LBUA 1XLFA 4HNNA 3GFYA 1QHOA 5EY5A 1K7FA 2GUBA 4BA0A 2BXZA 4JFTA 1R87A 1M9HA 1R3RA 1TPDA 1A5BA 3PTKA 3R43A 4Q32A 4L4MA 3RJXA 2VOMA 5HJYA 4WCJA 3SRFA 3OLIA 2HSAA 5EMUA 5FEPA 5JUVA 3KLLA 4IMAA 4Q8PA 3CHVA 4P8WA 1GOXA 2QS8A 3A4XA 5A8OA 4ZE4A 3FGCA 1GK8A 3TW7A 5KMYA 5DF0A 4IJRA 1MVYA 1P1MA 3TTQA 1E6SM 2I16A 4W7UA 2QAPA 3AMCA 1W5PA 1QRQA 4KEZA 2QCMA 5BXPA 2TPSA 1E9LA 4PCFA 2GWGA 2CC0A 2BY3A 3V36A 3K4DA 4K39A 4BK9A 1TWWA 4JQAA 1F8IA 3IUHA 2DVTA 4AZIA 1SSDA 1JDCA 4US5D 4MDOA 4JD4A 2OX4A 2A3HA 5BW6A 4ZQPA 4O11A 3N2OA 1M5WA 5AHFA 2NSOA 4NRRA 4KS0A 1IR2A 3LB0A 3LNPA 3LRKA 1JAEA 3R0KA 3WYZA 1BVNP 2VRJA 5I5RA 3AXIA 2FTYA 4Z2HA 1JYXA 5HWNA 3HZ3A 4K8EA 3EBVA 3LI0A 2EPHA 1ZBCA 1W6TA 3W1PA 3DI1A 3BURA 1DIKA 2OZTA 3KRBA 3MKKA 5HPOA 3W76A 2VFGA 4M1RA 3DCPA 2PDLA 4MADA 2PBGA 2V2HA 1ENUA 3IJQA 4GUFA 4J40A 2WJFA 3CAVA 1CW2A 1UZ4A 2FH8A 2VFEA 3W9ZA 1WYIA 2C14A 1JGMA 1AFSA 1IXOA 5A1AA 4LAZA 1RCXB 3SFKA 1W1ZA 3UD6A 3WMCA 1IIGA 3VZYA 3Q58A 4UZUA 1KCKA 3MUCA 4ZEPA 3MCMA 1N7KA 3ES8A 1A5AA 3W86A 2E9MA 5B80A 3TOPA 2WMKA 3KOFA 4H6KA 4NZ1A 3HB9A 1GQLA 1THFD 1XX1A 4GO9A 3KWXA 2X7VA 2EHHA 3M16A 2BP1A 3BAYA 3B97A 4HMEA 1V6UA 3DENA 3IJLA 2BB0A 3V0SA 1O95A 3H6OA 1BWVA 1R2RA 4W86A 2GOKA 4DAIA 2BY2A 3CL7A 3E3HA 4S3CA 1L0PA 2BV9A 4GD0A 3VKDA 3HIJA 4NKCA 4GQ0A 1B5TA 1TMHA 5CJNA 1YDNA 3VNLA 2UBPC 4JYEA 3GR8A 5A2BA 4D6JA 1Y65A 3EDKA 4Q7IA 2V63A 1RZMA 5LHFA 2OODA 5T9CE 3WFAA 3SUVA 2PPGA 5LIXX 1FP9A 3FHAA 3EOUA 4MUPA 5L6UA 5HNRA 2PWHA 1K9TA 1FDZA 1F4AA 1XIJA 2BVDA 3F5JA 4R27A 2QNEA 2XVNA 4AHOA 2HVNA 1VB9A 4O1FA 4M80A 3HBLA 3BJTA 1IE7C 4K1WA 5FF2A 1OB0A 3TTOA 1UD8A 3L4ZA 4Q3MA 2OEKA 2PWDA 1DWIM 3I6EA 3ARRA 3BCDA 1M1BA 3SCPA 1X39A 7XIMA 3UWEA 1UKTA 1WV2A 3CQ0A 3IWPA 3RK8A 3AS3A 3UA3A 3GB6A 2E8ZA 1WDRA 2OQYA 4BWLA 3AWNA 4JAWA 2A3CA 3B0UX 4C6OA 3S47A 5AFDA 1ZZMA 5CKSA 1TMLA 2YA1A 2XN1A 4CEUC 3NZQA 1GKQA 2WANA 1U1HA 3A5FA 4IP7A 2XFWA 4XAZA 4FNSA 4HU0A 4W5UA 1E4LA 4PMDA 2BFGA 2ACQA 2W79A 2Z1WA 1FWFC 1B2YA 2DH3A 2VCCA 2R1MA 1W5NA 1P43A 3CHCA 1V3JA 5CLWA 2BXVA 4R7WA 4QRNA 6XIAA 1DV7A 2ON3A 4LTSA 5K7JA 1EJ7L 5E9XA 4C90A 1F4HA 4AF0A 1OT2A 3WK3A 2OYKA 3GNOA 4G7FA 4IMGA 1UR9A 1SW7A 4IPNB 2DZUA 4B92A 3ITOA 3TP4A 3LCLA 4JQ3A 4EF8A 5KZMA 4Y8FA 2ZZ6A 3O2LA 1YADA 3O16A 4FOJA 1X1NA 3TAKA 1NVMA 5JVLA 4JTDA 1H7NA 2P10A 2QV4A 5FL0A 4LS2A 2C1GA 2QUVA 3A4AA 1QK0A 2H3BA 3NXFA 1UR2A 3B8WA 3RN6A 2I56A 3ONBA 1S1PA 3BLKA 3W81A 3R8RA 3FKKA 4NUWA 4CEXC 1GEHA 1JXKA 4CD7A 1X7FA 3BSGA 2ZA2A 1I2QA 5CBBA 1XLDA 3T81A 1FRBA 1FFRA 3SUSA 1DVJA 3UYCA 2D69A 4QJ4B 3AAMA 3WMSA 4U33A 4UTLA 3AHXA 3XIMA 2G41A 3BH4A 3V0UA 3KOWA 1GVEA 1W9BM 2PP0A 2PLJA 1Q6QA 1WZMA 5M17A 4PTMA 4NJGA 4PEEA 1FX6A 5CJ5A 3CGTA 4CU7A 1CEOA 1UBSA 3ABXA 3P0XA 1O12A 1PCKA 4O17A 1KLZA 2J75A 2F8QA 3WMBA 4DJEA 3B9AA 1JPIA 1KV8A 2PGEA 3TOYA 3VKCA 5LIKX 2WNWA 4Z1BA 4WDUA 2NUXA 3M0KA 2BASA 4DYEA 2OX1A 2Y5EA 4D8ZA 1HW6A 4AW7A 2EKCA 5BRBA 3NTYA 3N73A 2YLAA 3DGRA 4AB4A 3ZR6A 1CDGA 2DT2A 3PTQA 3LHYA 3UZJA 1CWYA 3B9NA 4B5VA 3ARUA 1T40A 4C1KA 1LRNA 4O8RA 3C52A 1RY8A 2C8NA 4S3JA 2F6KA 2INZA 3WNOA 3T0BA 4D72A 3VNDA 3C2RA 3OOQA 2HJPA 4DNMA 3KDNA 1PTDA 3LTYA 1EIBA 3CXOA 3MYPA 5CPQA 2OZ0A 1JNDA 2C13A 2VMFA 1V93A 4W8LA 1OF6A 1XIGA 2A3AA 1U5JA 5B7ZA 3P81A 3ZJ6A 4FX6M 1GVSA 5FAJA 4Q8UA 1E43A 2Z1VA 1RQEA 1D7KA 4NF7A 2DSVA 3VM7A 4XAGA 1OT1A 1JQVA 1RP8A 3HURA 3M5ZA 2OSXA 2DV0A 1QT1A 2XH4A 4DF0A 1GORA 1B4KA 4AZBA 3EPNA 5CZKA 2G8ZA 4AAJA 2PD5A 3H7VA 1H7PA 3FS2A 3BCFA 3JS3A 3ITLA 4GXWA 2D22A 3ALGA 1XD0A 5HJLA 4KEUA 2PLMA 3T40A 1XLGA 1PZ0A 2PTZA 2YDRA 1U33A 1X8FA 3EX6A 1FH8A 1UJQA 2NVDA 3K2GA 3DFTA 2ISFA 3GR7A 1VD6A 3OBKA 3CV1A 4DZAA 3MSRA 3N4AA 2Z2BA 3UWZA 2YZRA 4RL3A 4HA4A 3J7HA 1IT0A 3W1LA 3LV5A 2Y4SA 2CXEA 3EKLA 4ZBCA 1XDLA 1XQLA 3F03K 4RCXA 1W2VA 3PTMA 4A3HA 4YTTA 1G4TA 1C93A 2YGYA 4TMBA 3BLEA 3RPMA 3Q37A 3T55A 3H54A 3EMQA 4JEQA 4CVWA 3CPRA 1FQ0A 1TMQA 2VO5A 4LW7A 2BS9A 1LTDA 3SQMA 4FEZA 1HTIA 3GHSA 2Q71A 4UFHA 5JIWA 3L68A 1XYBA 3R7MA 1KBKA 3N2CA 4NAFA 2D0GA 2EPKX 1E40A 4XQ6A 4LCSA 3HQPA 1R38A 3Q94A 4H9VA 2ACSA 1U1JA 4IMFA 4Y9MA 4UFKA 4R9OA 4Y90A 2X1TA 1EC8A 5E6YA 1FCQA 4UC5A 1J2BA 3GYCA 2ZUVA 4YIWA 3GDMA 2PFHA 3TN5A 1A5SA 2VD8A 1UASA 4J2MA 3W1NA 5G2WA 5FJUA 4MNMA 1KFCA 1OGBA 1U22A 1Z9AA 3U57A 1TSIA 1KC7A 3EWCA 3WF3A 3FHQA 3FJ4A 3U2OA 5FESA 1Q45A 4YVPA 2IKHA 3BAIA 3N6HA 1E1CA 3QGAC 2HPMA 2IPGA 1K8CA 4FOKA 5D9MA 3VIJA 4C7GA 2GQ9A 1FTXA 3ANVA 1X1OA 1Q63A 3GIPA 3VI2A 3TC6A 4DWSA 3PC0A 2XINA 3HMCA 2QCDA 1SW0A 5DT7A 3RUBL 3CUZA 3LRMA 3KTXA 1MXSA 4WKAA 3SJNA 4NYYA 3N15A 3QC0A 3DHDA 3M5VA 4FOUA 3EDFA 1M04A 4FXSA 3LHUA 3GRIA 3RU8X 5CLTA 3W22A 2ZC8A 3WO8A 4C65A 4H41A 2Y89A 5BWAA 3TC7A 1ITQA 4OV9A 3LZ3A 3AIVA 3UF9A 4MNJA 1LG2A 3TYZA 4HU4A 1TJPA 3F2BA 1W56A 3M4HA 3W6LA 4D9PA 2GQAA 4JTGA 4QSHA 1ICSA 4ACZA 4LY8A 2JBMA 3BUVA 2R94A 2WSQA 3THAA 3K8LA 1UWRA 1V3IA 1UUOA 5HNTA 1PXGA 2Y1HA 2HXTA 3B9OA 4J9JA 2E6YA 3M5XA 3NWRA 3QY8A 2O0TA 3ABZA 3NZPA 3PPGA 1T8QA 1C7SA 2QCHA 3KS5A 2V5BA 5A95A 2BHUA 4HN4A 1SR9A 2FZ9A 5AKQA 1WXJA 2ZKMX 5CZ0A 2GZXA 2PDFA 4H8NA 1C90A 4PTVA 3IRDA 1OF8A 4O14A 3W7NA 3S1WA 3NSNA 4OKDA 2QPUA 1BD0A 4MKNA 3PBGA 1HQTA 3N4FA 1BXCA 4NRSA 4LUSA 1DQWA 2DP3A 4V28A 1HKWA 1I2PA 3E2QA 3JUGA 2GSHA 3VX1A 5KITA 1JCXA 3RO6A 4GI8A 1W8GA 5HK4A 4UCFA 3G24A 4Z0JA 3BW4A 2FPTA 1PYMA 4TTGA 4LBRA 4OE7A 2RGLA 4HOWA 1BYAA 1WP6A 1Z44A 2QDHA 3FLUA 3BPWA 3BZJA 1BTCA 1HJSA 2YYUA 2HCVA 4JCLA 1TV5A 1CECA 2ISDA 1R6WA 5HXMA 2OWCA 4RXFA 3KEHA 3H2CA 5I3JA 3URNA 3W01A 1KNWA 2FJUB 2BDQA 4XD5A 2PWUA 1NFBA 2P53A 4UTTC 4NZJA 2E6FA 3WD2A 3VCNA 3H2OA 3BC9A 2XYLA 2OWXA 1D7FA 1Q6EA 4AMAA 3SECA 2PDIA 3H12A 5EGRA 1R9ZA 4AX6A 4GVGA 4JEJA 5K9CA 4MY1A 1BQGA 2DZTA 1F07A 2PWGA 1OYBA 2OLSA 3MO7A 4D1JA 1E3XA 4QSFA 1SJCA 1SSGA 3E96A 3WEZA 4F0KA 3W7PA 7TIMA 3WLLA 4JTJA 4XD3A 4FO4A 1TVPA 2QVHA 1RCQA 3CUFA 3QYSA 3W1AA 2HRWA 4MWAE 1U83A 5C8BB 5LGZA 4X0NA 3A9IA 1OVDA 2HPIA 3P62A 1KR0A 4H7CA 1NEYA 1HX0A 4JNMA 3B4YA 4XZHA 3H4GA 4GQRA 4WY0B 3ZLGA 4XK2A 3EMCA 4N4PA 3S9YA 4GX9A 3L5AA 1FA2A 2HMCA 1QMLA 1HJWA 3TSMA 4GE8A 2BOFX 1KTBA 3BW2A 3ANUA 5D9PA 3WQFA 4KETA 1LYXA 2QULA 2ADAA 3RYSA 3ARXA 3AIWA 1G01A 3AI0A 4XSMA 3DEQA 1JCNA 1C9WA 3VINA 5IOBA 4YTRA 3UXKA 1I45A 3PULA 3DFOA 1YE6A 4DELA 3VDGA 1MSSA 3D47A 3M46A 3CC1A 4K37A 5AECA 2KZHA 2FZBA 5CPTA 3B4UA 4YJ5A 2W62A 3T05A 4OHQA 3T7VA 1UWAA 5HDRA 2CBJA 1F6YA 1PWMA 4KWVA 1XGEA 2W66A 1FCVA 3VU2A 3N13A 1QPRA 1DE6A 3ZSTA 1IR1A 4FX8A 3EDDA 2V5CA 3R89A 1TTQA 2E5DA 4GFIA 4J7RA 2AL2A 4LOCA 3S5ZA 3KVLA 1AZ2A 1R3WA 3VPLA 1E6XM 1Q6CA 3HQOA 3SSJA 4WEVX 5CGTA 1RVGA 5J8LA 4QX4A 5CC6A 2YA2A 1R3QA 1TE6A 3WN6A 3AQUA 4LC8A 4A3UA 3IV8A 1LBMA 3IUDA 2GJXB 2CZVA 1OCQA 1MQRA 4UNIA 4NJJA 4W7VA 3AXXA 2Y85A 3ZLFA 1OK4A 3M0ZA 4BEUA 3SBFA 1XUUA 2HBVA 1XQKA 2A79A 3EX1A 1SZGA 3MHFA 4LVAA 4E2OA 4R34A 3DFPA 1W3KA 2G4JA 4IIDA 4GUJA 4PCPA 4F2UA 4YU1A 1O94A 3MUIA 1K8XA 3WX7A 3I3EA 2NQ5A 2OWWA 2FVMA 4LSBA 3WIJA 1ISVA 1XBYA 4PBFA 3MPGA 2YDQA 2IPFA 5CH9A 1JG9A 1B3XA 2Z7KA 3SO7A 3MSGA 3MI3A 2J7GA 2AQWA 3L2IA 3W2JA 1W5QA 4FLRA 2OG9A 1KQZA 4JTEA 2ABBA 1XW8A 3EWDA 4AY7A 3VOIA 3LLDA 5LGXA 1DJIA 5DN1A 3T07A 3MWCA 1WBHA 4B5XA 3G22A 3W02A 4LNCA 1I0DA 4GKLA 1EP2A 1P48A 2DSKA 3P3BA 3DAQA 3S2JA 1PIFA 2CWNA 4AZGA 2YCLA 3I3DA 1CX9A 4UBPC 4ZQNA