4HK7A

Crystal structure of cordyceps militaris idcase in complex with uracil
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
379
structure length
379
Chain Sequence
b'PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLKAELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 136
structure length 379
sequence length 379
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk7A00
1GKQA 1VFLA 4ERGA 2FTWA 1FWFC 4PCNA 4H00A 4LH8A 2OQLA 2HBXA 3FDKA 3F2CA 2VUNA 2EG8A 1A5NC 4ERAA 1V77A 1JGMA 4AQLA 3DUGA 3LNPA 4R85A 3E38A 1M7JA 4HJWA 4M51A 3MVTA 2OOFA 4H9TA 1FWDC 2G3FA 1ITQA 3F4DA 3IRSA 4B92A 1K1DA 1FKXA 1UBPC 3LY0A 3QGKC 3LGDA 4IQJA 1V4YA 4DLFA 4LCQA 4LEFA 3RCMA 2GWNA 2GOKA 2Z2AA 2P53A 4BJHA 3OJGA 3TN6A 3F2BA 1FWCC 3LA4A 4XAFA 4GK8A 1NDWA 2Z2BA 4KEZA 2E1WA 3K5XA 4KF1A 2R1NA 3ITCA 3AU2A 1PTAA 2QVNA 1A5OC 4IFKA 1EJUC 3N2CA 1PO9A 4G2DA 3S4TA 2ANUA 1RK5A 1O12A 4QROA 3UF9A 4H9UA 3S2JA 2AMXA 3LS9A 3PNZA 3ISIX 1A4LA 4WGXA 3S2LA 1KRBC 4AC7C 3SFWA 4XD4A 2VR2A 3UPMA 3E0LA 2DVXA 3IV8A 2KAUC 1FWHC 4UB9A 2Z00A 4H9YA 3T8LA 4F0SA 2D2JA 4J35A 2OB3A 4KESA 4F0RA 1FWGC 1FWJC 3MKVA 4QRNA 1I0DA 1ONXA 4GX8A 2O4QA 4LAOA 1XGEA 3GIQA 3IARA 3LSBA 4QTGA 4DLMA 1ITUA 2UBPC 4DI8A 3V7PA 4QS5A 4XAGA 2E25A 2HBVA 1UIPA 1FWBC 4NI8A 1A5MC 5HMDA 4H9ZA 1RK6A 3GG7A 4KEUA 4YIWA 4IFKB 1EJXC 4EPDC 4H9VA 2Q01A 3CAKA 1XWYA 3K2GA 2ZC1A 3GU1A 3ID7A 3SO7A 4QS6A 3TNBA 4LAMA 4Z42C 3B0YA 1UIOA 1W1IE 2HPIA 4KIRA 3R0DA 4C6CA 3OU8A 3F4CA 1PB0A 1BF6A 1RJQA 4GBDA 4C6QA 2ICSA 4RZBA 1YIXA 1V51A 2Y1HA 3OQEA 4H9XA 1RA5A 4HA0A 3IJ6A 3DC8A 4XAYA 3OVGA 2Z25A 2I5GA 2QT3A 1I0BA 1XRFA 4IGMA 2FVMA 1YRRA 1UMLA 1EJWC 1QW7A 1P6CA 3PANA 4H01A 3URAA 4C5YA 3GRIA 3HM7A 4E3TA 1KRAC 4ERIA 1RJRA 4C6MA 4GC3A 3IGHX 4B91A 1WXYA 2EG7A 4ICMA 4BKNA 3IPWA 2WJEA 1EJRC 2CZVA 3QGAC 4RDWA 4G7EB 2GZXA 4J5NA 3GU9A 1YMYA 1EJSC 1YNYA 2O4MA 2P50A 2Z28A 1A5KC 1EYWA 4C6IA 1R9YA 3EGJA 2GWGA 3LGGA 4DYKA 3TN4A 4BY3A 1J79A 1FWIC 4LALA 4NG3A 3F2DA 4C6EA 2BB0A 4C6FA 2VC7A 1P6BA 1POJA 2Z4GA 3MJMA 2D2HA 3A3WA 3QY6A 1QXLA 1EF2A 2DVUA 3FDGA 3AUOA 4INFA 4GY1A 1GKPA 4B3ZA 2AQOA 3UR2A 2GSEA 1DPMA 4LCSA 4DI9A 4I6KA 1FWAC 2FTYA 3LU2A 4CNSA 3O7UA 1IE7C 3GTXA 1POKA 3GTFA 1R9XA 3HPAA 2F6KA 3PNUA 3MDUA 3MDWA 4XD3A 5E5CA 3E0FA 3GU2A 2D2GA 4RDVA 2YZ5A 3S2MA 1R9ZA 2PUZA 2R1MA 2Z27A 4PE8A 3FEQA 1EJVC 1S3TC 4C5ZA 2Z26A 4C6LA 4TQTA 3D6NA 4CEUC 1YBQA 4ZSUA 4C65A 1V7AA 1FWEC 3NQBA 2FVKA 4L6DA 4XAZA 4CQDA 3A3XA 4EP8C 2Z24A 3T1GA 4DNMA 1HZYA 2YB1A 2A3LA 4LCRA 4C6OA 2WJDA 3PAOA 4KQNA 3MSRA 4KETA 4IG2A 3CS2A 1V79A 1NFGA 3JZEA 3TN3A 4D8LA 4P5UA 3B0XA 4PCPA 5HMFA 3QY7A 2PGFA 3GTIA 4GXWA 4C6BA 4EPBC 1K70A 1ZZMA 4DIAA 4H9MA 4GOAA 2Q09A 5FSEC 2R1PA 3UBPC 4DZHA 1M68A 2DVTA 2YXOA 4C6JA 2UZ9A 1NDZA 4KERA 3NURA 1RJPA 4I6VA 4IF2A 1J6OA 4GYFA 3ORWA 1RA0A 3PBMA 5CH9A 3GUWA 2HQAA 2Z7GA 3LSCA 1A5LC 4XD5A 4DZIA 1P1MA 2HPMA 3EWCA 3T81A 4JOMA 3HTWA 2Z29A 3E74A 4CEXC 2AQVA 1YBQB 3URQA 4CNUA 4CQCA 2OODA 4C6KA 1KCXA 4GX9A 4IH3A 3URBA 2R1KA 4RDZA 4RDYA 4IFRA 1J6PA 4MUPA 2QPXA 4EPKA 4HK7A 4PBFA 4B90A 4F0LA 4DO7A 4IG2B 3WYZA 5G4HC 3C86A 1E9YB 1NDYA 2YB4A 4C6NA 2FFIA 3EWDA 4WVXA 3E2VA 4GY0A 2ADAA 2WJFA 5FSDC 4KEVA 3CJPA 1ONWA 3DCPA 4NP7A 3MTWA 5LXXA 3URNA 2EG6A 2XIOA 2PGRA 3MPGA 3GIPA 4L9XA 4WHBA 2OGJA 3QY8A 4V1YA 4QSFA 3ICJA 4IGNA 4HK5A 3RN6A 1J5SA 5HMEA 1A4MA 4PBEA 3RYSA 3UR5A 4LFYA 2VC5A 2VM8A 1PSCA 4XD6A 3K4WA 1M65A 4J2MA 1EJTC 4GZ7A 4ZSTA 4HK6A 3WMLA 2WM1A 1E9ZB 4V1XA 3G77A 2PLMA 3E3HA 3WZ0E 4CNTA 2W9MA 3BE7A 4GY7A 2R1LA 4C6DA 1GKRA 4EPEC 1XRTA 4LAKA 2I9UA 3NEHA 4RE0A 2VHLA 3GTHA 3AU6A 4CQBA 2QS8A 2BGNE 2RAGA 4LANA 3OODA 3RHGA 4C60A 3B40A 2IMRA 2PAJA 4UBPC 5A6TC 3S2NA 1ADDA 1EZ2A 4IFOA 1FKWA 3O0FA 1KRMA 1RAKA 1WXZA 4C6PA 5AKQA 2HNHA 3TN5A 4G7EA 3MVIA 1KRCC 1NDVA 3IACA 1K6WA 1O5RA 4OFCA 4R7WA 3OOQA 4R88A 3A4JA 3KM8A
chains in the Genus database with same CATH superfamily
1YX1A 4FNSA 1GKQA 1RD6A 1E51A 2JFEX 3VCCA 4ERGA 3USZA 2WCGA 5FESA 4ZVJA 1XSIA 5CZSA 3RX3A 1JJKA 3ITXA 1WYIA 5G1TA 2OWWA 5I3HA 5C2XA 2V81A 2OWCA 3ZMRA 2WBGA 4ZO6A 3QGKC 3SB0A 4AIBA 3LGDA 1MQRA 3G3DA 3GUGA 2VCAA 3PBYA 3XISA 4IQLA 5HR7A 4BJHA 3TN6A 1B54A 4DO5A 3LTSA 1U33A 4I9JA 1W9DM 5E9AA 3ITTA 1OX6A 1U1HA 3OLDA 1NDWA 2V30A 3W81A 1TJRA 1K8CA 4ZXLA 3W71A 4JIIX 1EWDA 4ZO9A 4DYEA 4QG9A 4NF7A 4J3XA 3BWWA 1OINA 3G18A 2EPMX 3SCPA 1KTBA 3N4FA 2ALDA 5DEZA 1LRNA 4FMVA 1S3HA 3QZAA 3S47A 1Y5WA 3OZYA 5JUVA 1MYRA 5CSSA 3KXQA 1VHCA 3NYDA 1KM4A 2D2JA 1NH6A 2W62A 4HHHA 1V7YA 3KRSA 3TLQA 1IGSA 2C14A 3SCWA 1FWGC 1Y0EA 1K3UA 4IWWA 3O0KA 1E4MM 1B4EA 3N2MA 3RJXA 1S5VA 3LSBA 1KR0A 3ARZA 4O1EA 3APYA 1I6NA 4O1CA 3SFKA 3PBVA 3GG7A 4AEFA 1KBJA 3DFHA 1XHGA 1MNZA 4UOQA 5BOEA 3PWAA 4EPDC 1EKOA 1TE6A 1W3HA 3PJUA 2CZEA 1FDZA 1PCKA 3HBLA 3ZJKA 2ZTJA 4EACA 2E6DA 1P0DA 3P81A 4LAMA 3CAQA 2BY1A 1C8XA 1FVPA 2IKJA 1JXJA 1VR6A 2JIWA 2XJ7A 4CCZA 4I7UA 3DZ1A 5AY7A 4UTJA 3OQEA 4PCSA 4CU7A 3F7JA 3DDMA 2P8BA 2X8RA 3GM8A 3WH8A 1GPFA 2FPTA 3H7UA 4Y9AA 3EWBX 4UQCA 3EAUA 3CV1A 4MJ2A 1GOWA 4N6FA 2VFDA 2ATMA 2C16A 2FB2A 1JYXA 4OWGA 4Q4RA 2YFNA 1EQPA 4C5YA 1ONRA 4DJDA 3WF0A 1X8FA 2HS6A 4D6FA 2B0MA 1V3MA 1XBVA 2HK0A 1RSCA 4OHQA 1Y7VA 1FFQA 4ICMA 3N29A 4JYFA 1DQUA 1ZALA 4XUYA 2X05A 3LV5A 1JZ4A 2HE5A 2Z28A 1GHSA 4ROQA 3DYMA 3VIIA 4CQ8A 5D38A 3MHFA 3VFCA 4E6MA 1ML1A 4J2PA 3HGSA 4CQ9A 3D3AA 2D2HA 1F6YA 3QY6A 1PZ1A 3VCNA 4IGHA 2VTFA 3M0LA 1H11A 5A8GA 1X97A 2BVDA 1B9BA 1GKPA 1DL3A 2YX0A 2Z1BA 3I6RA 3W6LA 1NP0A 2IPWA 4AX7A 2V38A 4GZJA 3VUSA 3O7UA 5IXEA 1R9XA 3MYOA 3HGOA 4ZQOA 4R27A 4PC8A 2Z27A 3PUDA 1BPLB 4S2CA 4AWUA 2CBUA 2PBOA 3B03A 2Z26A 4C6LA 1XIMA 3N9KA 3W7JA 5FACA 8A3HA 1MRQA 5KTLA 4WJEA 1ELSA 1ZJIA 4C91A 1S5TA 1QI2A 2FVKA 3A3XA 1DWJM 1XH1A 4XO6A 4ASTA 2FYMA 1CZ1A 4PUMA 1V3HA 4TXEA 4LV4A 3H4WA 5FOOA 3I7RA 1J93A 4JTSA 1OFPA 1HVXA 5HQLA 3ITOA 1PHWA 3BC9A 4Y8EA 3GG1A 3VNZA 1NOFA 1SJDA 1GUVA 3O6YX 2XN0A 3MSGA 3PFRA 1ALDA 1VKFA 4FP1A 3S6TA 1EUAA 5LKYA 2XN1A 1I2QA 3LRMA 5HWMA 4U2YA 1GJPA 1HJVA 4W5UA 1CEOA 4LPCA 3AXKA 3W27A 4OVXA 3UGVA 1X6LA 4MFEA 4URIA 3E74A 1SJCA 4W93A 2AGKA 8CGTA 3U2EA 5CZJA 5H8UA 3VKJA 3GW0A 2MNRA 1KCXA 1XG4A 4RDZA 3UZ5A 5TD4A 3VM5A 1HT6A 2IKIA 2ZRZA 5HJYA 3H2CA 5DQPA 4PL1A 1E9YB 3LPPA 3GW3A 1C7SA 1E70M 2WKLA 5IFTA 1W3JA 2NX3A 1YDOA 5E6ZA 4HPHA 1E5JA 2C19A 2EXOA 4KCWA 3AMKA 2ZXBA 2GDQA 1W8GA 3SRHA 3URNA 5AHMA 2Q02A 2J74A 1JPIA 2HS8A 1MZRA 3VNIA 4X9YA 3OA5A 3QY8A 3I68A 1OVDA 4HK5A 1A4MA 2WXDM 3RYSA 5HANA 3C6CA 4C7DA 2VC5A 2CETA 1E3XA 1AW5A 2OEJA 1V5XA 3WEMA 1E9ZB 1ZJAA 5E6YA 3TSBA 5LNWA 1SZRA 4ZOBA 3M07A 1E1CB 1XRTA 2VGGA 1WKDA 4FLOA 4P8WA 4GVGA 4E2VA 1WBHA 4DHGA 4UQBA 4AYSA 2EPLX 2PD5A 3TN5A 3L0GA 2PDHA 5B7ZA 6CGTA 4GHRA 1NDVA 3VD5A 1L6GA 3O2LA 2YA2A 1QW8A 4ALDA 2BHYA 1OSEA 4GABA 3G1VA 4I8YA 4LH8A 3ZVHB 3D5HA 1N8FA 5LIXX 4V15A 4MJMA 4PN2A 4ZCWA 3F2CA 4Z2IA 5CSYA 4JTIA 2EQDA 3LCWA 3DUGA 2EGZA 2W92A 3MMUA 1R0MA 2XVKA 1YEYA 4DZ5A 2PDGA 2Q3RA 1EO5A 4GG9A 3TOYA 1G01A 2FH6A 3N2BA 3TQKA 3W88A 1XIHA 2QJIA 3AMDA 5BXPA 2GUUA 1MW0A 4F9JA 1XCXA 4FR6A 3WN6A 3P80A 3GDKA 1DHKA 4HN8A 2PCQA 2F38A 4KEZA 1PTAA 1C8VA 4Q4KA 1TV2A 4HA3A 4PTDA 3REQA 1JDCA 2VZSA 4XIMA 3H7VA 1FP9A 5CBBA 5G1YA 1M03A 4Q22A 2NV1A 1S46A 3VD4A 1NELA 1BGGA 3L0KA 4UCFA 2V2DA 1V03A 2FZNA 3C2YA 2AMGA 3UJFA 2Y8UA 3W82A 2OQYA 5ABHA 3K4DA 3T8LA 1GVEA 4JFTA 5HBFA 3W7CA 1QAPA 3RITA 3LYEA 5CC7A 1UZ1A 2QR6A 1V8EA 2Y63A 3PZNA 3TW6A 1XQLA 1HQTA 1NAL1 4LAOA 1TZZA 3QYSA 2E0PA 1A53A 4L9YA 2GQ9A 3M0KA 3KRBA 1RCOB 4XB3A 4US5A 3NDYA 4N4QA 5C9XA 3R8GA 3W7MA 2E4TA 1EX1A 1QNVA 3E2RA 4HJFA 2B7PA 4H9VA 2PSNA 3OVRA 1EEXA 3W7KA 4WDUA 4XG1A 4EF8A 2Z1KA 3VGGA 4IUOA 5EFDA 3WQDA 5FJUA 4Q8WA 3EX4A 4H2CA 4PMOA 1QATA 1JUBA 3FA3A 3QZ6A 2PP0A 2DZXA 2J7CA 3AIVA 1FCQA 2CLMA 4CN6A 4NAEB 4EE9A 3WMSA 4O54A 4AIUA 1WDSA 4LS1A 3PTKA 2J66A 2NX9A 3WLMA 2FIQA 4O18A 1OC7A 3SURA 2Y0FA 4C90A 3W26A 2OWXA 3DHFA 2XH7A 2DZTA 4BI5A 3AHTA 4TVUA 3VE7A 5EMLA 2OYKA 2VT0A 2AL2A 3G1RA 3V0SA 3GZAA 4YYCA 1MEHA 3PS7A 3PPGA 4Q8OA 3MI2A 3RF9A 2QQ6A 2VZOA 1AVAA 3IV3A 1YXDA 4WDTA 3FYYA 4EXQA 2NQ9A 2HVMA 1KM3A 1FWIC 4AD5A 4M6QA 4JZ5A 2BB0A 3UXKA 1B3OA 2HVOA 2VRKA 4QBXA 3VUPA 1D7KA 1QXLA 1XPYA 4HTBA 3RPMA 4TV6A 5HQMA 1VIWA 1QNSA 5AYYA 2RJGA 3UCCA 1LT8A 5C54A 3UR2A 2F6UA 1QNOA 1XW8A 2IQ0A 4OE7A 1U22A 2PCEA 4FAMA 5FJPA 3PNUA 3GU2A 1G7UA 1OIFA 4UNLA 4JTDA 3S2MA 1R9ZA 3GYEA 2YW4A 4Q32A 3STEA 5GJPA 3WL0A 5A94A 3OVQA 4HYRA 4M82A 5I78A 1PYFA 3IK4A 1BYBA 1VFFA 1DJHA 3W0KA 2QCLA 3QXBA 1SO6A 3ANYA 4OV4A 3GAYA 4EWJA 2ZXQA 4HVXA 4DJDC 4P5UA 1JDFA 1XRSA 3PTDA 4J3ZA 3ABQA 4NI3A 1H0IA 4ZB0A 3TXZA 3OLIA 3EWZA 3A9BA 2CC0A 5A95A 2GGIA 1P0KA 2ACSA 3OLEA 1IXQA 3ELFA 5KITA 3CPGA 4LBRA 5F2IA 3LBMA 1FQ0A 4NJHA 4RL3A 2HMCA 3PB2A 4C1LA 4ZQPA 5IM51 5AC7A 3QF0A 2PDPA 1J6OA 5HINA 3LSCA 2ISVA 4ROPA 1UR8A 1FWTA 1VEMA 4FS9A 2VC9A 1KCLA 3HTWA 2Z7KA 3WLLA 3HB9A 2VOTA 2INFA 3VM7A 2DW7A 1BTCA 4IP7A 3MCNA 1JXKA 1OCNA 1WBJA 3AIRA 1UYQA 4ZL1A 2E7FA 1X96A 4MWAB 3NVDA 1MZHA 1UC5A 4KWWA 5M2FX 2W4XA 1UD4A 4O10A 4E3VA 4GY0A 3FFSA 2ATSA 2F84A 2X1SA 3R6IA 3MY9A 2QEZA 3BLIA 4FXRA 2OZ0A 3VC5A 2DP3A 1R30A 4V1YA 4QSFA 1S39A 3RN6A 4NAFB 1DHPA 3C8NA 1CXEA 3TROA 4HK6A 4N7QA 1GOMA 3TJ4A 1MUMA 3EA2A 2XSBA 4LB4A 1J4EA 3CB8A 3QR3A 1JUKA 4LAKA 2VHLA 3LHTA 1Q3NA 1XLEA 3CEPA 5A69A 3OODA 3APTA 4W86A 4PMDA 1NJJA 2Y7FA 1OB0A 2DQXA 3EX2A 1N55A 4IPLA 3W1PA 4OUEA 4IX0A 1H51A 1KTNA 1EHAA 3CHVA 3WDRA 2XZ9A 4GNKB 1JF6A 4GD0A 2C1IA 2EJAA 2P0OA 4AD4A 3BLOA 1V77A 3QRHA 4DYJA 1S2TA 1YPFA 3CEUA 3U5UA 4M51A 2TMDA 3GFZA 1XXXA 2NV2A 1VH7A 1B5TA 3O15A 2H3BA 1V93A 4LCQA 3PZUA 3U48A 1ZJBA 4DF0A 1M3UA 3ZLFA 1Q66A 4LF2A 3LA4A 2J7GA 2OT0A 3CV2A 3I4EA 4G6CA 5TF0A 4FXJA 3L4YA 3K5XA 3O05A 4OJYA 1JFXA 3W9ZA 5D9MA 3PWIA 4P8XA 4CU8A 4N9CA 5AYXA 1HL9A 3ZM8A 2PRHA 2YCIX 3BMWA 3UF9A 2GVYA 4WOQA 4MAZA 1QTWA 1UMYA 4Y96A 4QLLA 1A4LA 1A3HA 1QOXA 3KHJA 4XD4A 3DECA 4AD2A 3CUFA 3GS6A 1ZSXA 3VNDA 3E0LA 2OGYA 3NPUA 2ZYFA 4GFIA 4ZFCA 4BWLA 3LEPA 1EOKA 2EPOA 3S1VA 3UGRA 3HF3A 1F9CA 4Z0SA 3NQ2A 2HDJA 1LLWA 2WM0A 3TZNA 3QLLA 4JTGA 3TWAA 5L6UA 1EDTA 3UESA 3R12A 3T2OA 1VJIA 1J01A 3I7SA 1N2VA 3CL7A 3LGEA 5J5RA 4DLMA 1TJPA 4HNLA 2BZNA 5DCBA 3WF2A 3M0IA 1CX9A 2V0TA 5LGZA 3T40A 3WNMA 1JR1A 5I3FA 1H50A 3LBCA 1IXNA 2V67A 1OFAA 3VKAA 3S5SA 4O8RA 3K2GA 3S5YA 3ID7A 1Q4NX 3C8FA 3H7RA 4L5ZA 3EX1A 1QWKA 3Q4DA 1AW1A 4UQDA 4Z42C 1QW9A 3QEZA 3UZWA 3VZZA 2ISSA 4RXFA 1KB3A 2RDWA 5G2WA 2VRQA 4HHLA 2Y1HA 3INPA 4H9XA 3M0JA 4FIRA 4HA0A 4Q4MA 3IJ6A 4TUFA 4GIRA 4DM2A 3T09A 1HG3A 1LORA 1JCYA 4UNIA 1I0BA 3VI2A 5AC4A 3VABA 1LYXA 2O0TA 4K8EA 2BMBA 2J9ZA 1QPKA 2GL5A 4OBSA 1QASA 3GH4A 1HNYA 3C0QA 5AFDA 3A5VA 5D9NA 3GK0A 1WXYA 4H6RA 2GUBA 5DRCA 4BKNA 1QBBA 1HJXA 1S2AA 3TCEA 4QDMA 5REQA 4LU0A 1EJ7L 2P50A 3P67A 2WZMA 3N14A 1RHCA 1EYWA 3BLDA 2OMAA 2ZFAA 1YKWA 4O8AA 3BCJA 3S1WA 2UY3A 1ZGDA 3A64A 3TUUA 3CWOX 3IEBA 1OCBA 4UTWC 1OGGA 1V0NA 3A3WA 1X1NA 3M6DA 1WAWA 1XX1A 2E6YA 3S5OA 1DBTA 4D71A 4F2UA 4CD8A 1VC4A 3V16A 1V6TA 2WVVA 3T6CA 2WYSA 1W0MA 2G41A 3IJ9A 1JZ2A 2INEA 5C9UA 2DSWA 1JULA 1SUXA 2ZC8A 3GXNA 4DJED 1VEPA 1RCXB 4UFHA 3FEQA 2VDHA 4W85A 3SQMA 1VPXA 1AD1A 4PTXA 2YL5A 3UPWA 1CTNA 3D6NA 4JICA 4JX6A 3K46A 2VMFA 5E93A 3KFTA 1FWEC 2R24A 3L2MA 4W84A 3R94A 4EAMA 3T1GA 3VDBA 2VEMA 4S38A 4Z1AA 3CS2A 2DZVA 4FLSA 5D2XA 1GOIA 4E4PA 2QCNA 3W7OA 3CL8A 4O16A 2CZ5A 5LIWX 1RQHA 1O4UA 3G6LA 4XZWA 3PM6A 3CT7A 5KZ6A 3SW6A 2Q09A 4W88A 4BQ3A 4FK9A 3I3EA 4JTLA 2GGEA 3GR7A 4O1AA 1Y65A 1ZCOA 2YXOA 3VYLA 4B5SA 4BQ4A 2QUVA 3FNDA 3AYTA 1MXGA 4LW7A 1E6ZA 3GDBA 3W2UA 1E56A 4P7OA 2BBFA 3WNLA 1TWDA 4UXDA 1QCWA 4MHBA 3EWCA 3CTLA 1GVOA 4IL0A 3F5KA 4P8UA 1UBSA 4QIUA 4CEXC 4F2TA 3UP8A 4CQCA 1W5QA 2MANA 4ZFMA 2NUYA 2V3GA 3CH0A 4JEJA 4M7TA 4X2RA 4XZIA 1R38A 1BRLA 5U7SA 1J0KA 5A2BA 3TX9A 1SPQA 1SW7A 2QJMA 1W9XA 4DM1A 2RGLA 4QSHA 2ADAA 1MUWA 2PF0A 4R3UA 3AYVA 3T42A 5FSDC 3SN0A 2Z1XA 1UA7A 3HPFA 3C2RA 2PGRA 2I5QA 2TSYA 1Q2SA 5FL1A 3R13A 3PZIA 2FGZA 2B7OA 5DLCA 4Z2KA 1XBZA 4K38A 3DOPA 3OVPA 3FAXA 2ZRVA 3WFLA 2WMIB 4LYRA 4NXKA 1M65A 2YCLA 1JL8A 4JD4A 3WQGA 4RZ6A 1W8SA 5BRQA 4ZQRA 3AIBA 1DIOA 4J3SA 1Q4WA 2BVWA 2J7EA 1PKNA 3OBAA 3DFPA 5ABTA 3VIGA 1LBLA 1UPMB 1S38A 1ADDA 2P8CA 3IIZA 3EEZA 4G1NA 1ECEA 1I8JA 4YNGA 2VVSA 1XLBA 1SQ7A 2Y62A 3QHMA 5LA0A 4Y9NA 3QR1A 3VKBA 5ABEA 4M0XA 4W87A 1W31A 1VFHA 3BAIA 3UJ2A 1P43A 2VL4A 1HIZA 4RNIA 4NYUA 4PH6A 3AXIA 3JRKA 1CLVA 2JF6A 4PMQA 3O6DA 2DFAA 3R0KA 4QR6A 4RPPA 4NASA 4ZBCA 4ADTA 4HJWA 3WIJA 2ZADA 5CGTA 1P7TB 4HU3A 4B92A 4U4MA 2FDMA 5AZ0A 4H8NA 4WLCA 3ZWSA 1NU5A 4N6EA 3IIOA 3ABSA 3PG9A 4PRWA 5BMXA 7REQB 3UY7A 4IPNB 4ZGYA 1MXSA 4A21A 2ZDSA 4FX8A 4KRZA 4Y2WA 2A85A 3N2CA 4UTIA 5KEZA 3HN3A 3OLGA 3NQDA 1DWFM 3N1AA 4MZ1A 4AVNA 3ME3A 1PDYA 1V02A 4J27A 4WIWA 4A3UA 5DT7A 2PMQA 4B5UA 1KWGA 3IWPA 1CLXA 1HX0A 4RXGA 3II1A 5DELA 3TCSA 1GVSA 3MP4A 3WDIA 1R3SA 1KFKA 4UFMA 1NQKA 3UG5A 1VP5A 3AS0A 1C8YA 2X1RA 2H8XA 1UB3A 4NZ5A 1R2TA 3BGJA 1ICPA 1L6FA 1AL8A 1ME7A 5GVJA 4Z17A 5G1MA 1FWWA 4CU6A 1L2QA 4RK8A 4UOZA 3PBGA 3DN5A 3R8RA 3H4GA 2WSPA 2RUSA 4M56A 1L0PA 2DSZA 1VF8A 1QI3A 4YTQA 4WSJA 1SZGA 2X42A 4PBGA 2PTWA 1G4TA 1JNEA 1UJPA 3N17A 1ECQA 5LHEA 4JX4A 3MV11 2Y7GA 4J3UA 4GWEA 2ODOA 4AB4A 3GE7A 5A8OA 3W4RA 4I9MA 1WB0A 3RLHA 4UIOA 2VQTA 3VPLA 4A35A 2IKGA 2JIEA 1KGXA 4PUUA 1YIXA 1B2YA 1GJWA 1OFBA 1T6MA 2IS7A 4NZ3A 4TX9A 3CIVA 1OFRA 4IGSA 3UG4A 3OVGA 3IJQA 4HHPA 4IGMA 2WNNA 3D3FA 4DUOA 4IIHA 1CLKA 4YHEA 1RD5A 4DB7A 3ZJ8A 3URAA 4EAYA 2QGYA 1MUCA 3VNYA 5BXTA 2NSOA 4LS2A 4BWLC 5JIPA 3PZOA 3ENLA 5IDZA 2DZBA 4JGDA 3KCLA 2PODA 3MP5A 3VINA 4E2DA 2L5HA 1H1YA 3A21A 3WQFA 3NQAA 3VNMA 1JCMP 3BSGA 1F7BA 3PVFA 2OXNA 3TYAA 3NZRA 4RZ4A 4NRRA 5DMLA 3KHDA 3RNDA 4HN4A 4LTSA 1XH2A 1WPCA 3SJNA 3IIPA 1YPIA 3FA4A 4QJ3B 4Q33A 3O1NA 1XLIA 3I6EA 3AUOA 4ZTXA 1QVBA 1RUSA 4AZ6A 4K7YA 1HP4A 4FF5A 3LG3A 4FNRA 2I16A 2VEGA 3RLUA 3WK2A 4B3KA 5J5DA 1IE7C 3C3NA 3WLHA 1GHRA 2F6KA 1F4HA 5CPNA 2HEJA 2OJPA 1FH7A 2DEPA 3NZGA 3BMXA 4Q4SA 2R1MA 5I3KA 4JL1A 4KGLA 1N8IA 1ZAJA 1XYZA 1VJZA 3PB0A 3GG0A 4XX6A 4GUFA 4XTDA 4WX2A 4DELA 4BHYA 3VILA 4BEQA 3DKJA 3NZPA 2A3LA 2PFHA 3P14A 4U5IA 3E12A 1A5SA 4B4FA 4KETA 1M1BA 2QCFA 3WO8A 3G2GA 4Y9PA 2OU4A 1IWBA 3M5VA 2X2YA 2P76A 4GXWA 3E0WA 3OZMA 2WMGA 2YA0A 2Z6JA 5E0KA 4JTUA 3S5NA 1BYCA 2YSWA 1HW6A 2BS9A 3BAYA 1NEYA 2D3NA 1M68A 4QITA 4K3ZA 2FHFA 3MZ2A 5AVHA 4PRTA 2JEPA 5K9CA 1GK8A 1UUMA 1SO3A 4IF2A 3RO8A 3NDOA 1GZJA 2H8ZA 4DWSA 5I07A 3GUWA 2D23A 3AI0A 3PR2A 1KXTA 1Q7ZA 4MNLA 1UKTA 4PULA 4C1KA 1F3EA 1ZBCA 3QKEA 1YXCA 4LYQA 3V3WA 2HVNA 5C6MA 1TVNA 3W7LA 2GJPA 4QQUA 2PGWA 3GYCA 1GYLA 4UFIA 4QCFA 4XISA 1U30A 3EWDA 3WDPP 4XWUA 1VBJA 2WJFA 2BODX 4HNOA 4DVOA 3FX4A 2J7BA 3DYPA 3GDLA 2V9DA 4AMAA 4M81A 1FWSA 4YWIA 4TVCA 3W02A 2OGJA 2ZUTA 2DIEA 1MXDA 1JQVA 1EC7A 1V0KA 5HMEA 5DMMA 4KGJA 2VM8A 1IEVA 3TR9A 3WKZA 1XYAA 2B7QA 2CHRA 4AIOA 2Y4SA 1XPGA 5HOSA 3KZSA 4AW7A 4GY7A 3TK7A 3L12A 1E0WA 3NEHA 4ADSA 1SFSA 3VZYA 1MWOA 2G3JA 4O4WA 3RHGA 2EKCA 3TP4A 4UBPC 2W6RA 3OPSA 4GMEA 3TDFA 5A6BA 1HJQA 1KRCC 4JFWA 3CZLA 1TJ1A 1F61A 3YPIA 1V3KA 2QDGA 3ARUA 2BX7A 4AZIA 2QF8A 5D2YA 3GXFA 3BW3A 3GXMA 4H00A 1DE5A 1A5NC 2VXNA 2ZBTA 2JF7A 4HNCA 4ENLA 3LNPA 2FVLA 1YTKA 1SSGA 3TYZA 3EOEA 3VKKA 1JCLA 1UBPC 5LYRA 2ZX6A 4JYDA 4WSHA 4JTEA 4ACZA 4QX4A 5K4XA 3G1SA 4HB7A 4LVDA 4DBSA 1SYTA 1UZ4A 2ZZ3A 3ZWTA 3BLLA 1UA3A 3KOWA 2ANUA 4REQB 5AB3A 1R5YA 5C8BB 2VELA 1JI2A 2BLEA 4LQ1A 3DAQA 2B81A 5IBXC 5CAKA 4ADUA 3PNZA 3IVTA 3JVAA 4AC7C 3GWQA 3A12A 1FRBA 1WV2A 6ENLA 2VR2A 4QXIA 4CUCA 1N8WA 5E0CA 4FZIA 3WDHA 2YCJA 4DAFA 5F2GA 1UC4A 2DT3A 1DQXA 4LAUA 4OV9A 3QBUA 3SN4A 4JTKA 1VPQA 3FKRA 3L5LA 3E0VA 3KUMA 1MW2A 2ZICA 1KNWA 5D33A 1OWQA 4EXBA 2VEKA 3P0XA 4MNMA 4F0RA 4EX4A 2W27A 2Q8XA 4O1BA 1H61A 1E0TA 5GNZA 1LWHA 5FKYA 3AIUA 3NO5A 4D6DA 3NTYA 3RPDA 1WQ5A 2IW0A 4PUNA 3W25A 4KWSA 1U83A 3WK0A 1VFTA 1IZJA 1XLHA 2OO6A 2QCDA 4JY8A 4AC1X 4DJFD 2IXVA 4QG6A 4X9SA 2D24A 3OIXA 2DDXA 3GU1A 1I60A 2A6LA 2ZZ4A 4MWAA 4F0HA 4AHPA 3CQHA 3WBXA 1OYAA 3OZOA 1BF6A 1V6WA 4IMDA 3UEQA 3W6MA 4MMWA 2PDMA 4S3DA 1IEXA 1XCWA 3FHQA 3WUEA 5IFPA 2J27A 4JR5A 3G1DA 4AEOA 3AC0A 1BAGA 1UD2A 1FH8A 1W37A 2F2HA 3S9ZA 1NFBA 1NFPA 3PANA 1KXVA 3GBEA 2OO0A 3HM7A 4UTTA 2XDFA 4OOZA 2EG7A 2FFCA 3M9YA 2FPVA 5HPOA 1G6CA 4GH1A 2PB1A 2VFIA 2VD9A 4DUXA 5A8NA 4S3GA 1SMDA 2VX4A 5KZEA 3BUVA 1YMYA 2NVCA 2O4MA 2D0HA 1DIKA 2E77A 4LVGA 3PZQA 1SU5A 1RALA 3P93A 4AH7A 2W91A 4LC8A 5DCEA 4QQ3A 6ALDA 4MADA 3UT0A 3F2DA 4UQ9A 1FHUA 1AMKA 3KP0A 3HMJG 3LM3A 5XIAA 5U4NA 2DVUA 4W7VA 4GY1A 2BWGA 3G1FA 3IJ8A 3S42A 1OCQA 4LCSA 4A22A 1LJYA 2NZLA 5HNRA 2HWGA 3LOTA 1XLCA 3NA8A 4M19A 3MDWA 3PN8A 2YZ5A 5H2ZA 4GXMA 4JKMA 3VTRA 4EVZA 2A3HA 1SO4A 4PE8A 4NQ1A 1FA2A 3AMCA 1JCXA 3H24A 3A4WA 3EXTA 3GNDA 1Z44A 4GUGA 2YXXA 2FHBA 4CQDA 4JKKA 1LWJA 4XZBA 2YB1A 3ZLGA 4XZNX 3H12A 3SUWA 3FSTA 1NFGA 4FNPA 1F3XA 3THQA 2OLSA 4U33A 3SCSA 5D4YA 4WKAA 3IAPA 2POZA 4WOZA 2EPHA 3QPYA 4M3PA 1RPKA 2XM2A 4CCCA 3VIPA 3RPTA 5CJMA 4B9ZA 3IJIA 5HA7A 4PB4A 2PDXA 5BRBA 1S2VA 5XINA 1PS9A 2WK2A 3SRDA 2WMHA 4XD5A 4DQWA 1C9DA 4PEKA 1C8QA 2YDAA 1LBFA 4Z1YA 1GYMA 3OTRA 3LLDA 4HYWA 4K68A 3W29A 4B5VA 4LNCA 3T44A 4RDYA 2P88A 3KTSA 2QPXA 5I0DA 4WDWA 4YYFA 1CYGA 4GO8A 4F0LA 1QPRA 1UASA 2V5BA 3KX6A 4C6NA 2Z1VA 1YHTA 3EOOA 4ZO7A 1EQCA 4WVXA 3MV01 4P61A 3HMCA 3UVAA 5HJLA 1CENA 1HKVA 4NUWA 1E15A 5AC6A 3VA8A 2QGHA 4JIRA 3OQ8A 1TPH1 3ZFHA 4MKNA 3BQ6A 3WNNA 4UTHA 3TC7A 3ZOAA 5LHFA 2ZTKA 3SN1A 1ME8A 1OF6A 1EJTC 1FXPA 4GZ7A 3WUFA 3DXIA 3FVMA 5EMMA 3G77A 1UD5A 3E3HA 1KQYA 4CNTA 3N6JA 1XINA 2DV0A 3W53A 3PHAA 3E9AA 4LANA 1R3TA 2R91A 2WMJA 3W7IA 4UR7A 1JIBA 1QI0A 2PRMA 2HNHA 3TMQA 3COTA 1PYMA 4MDOA 4QAWA 1K9TA 4K36A 2Q71A 4PMXA 1VFUA 1VFLA 2WQDA 1J0JA 1O5KA 2OQLA 1CB2A 1XIJA 3FDKA 1TYGA 1HL2A 3P61A 1ZBVA 1KFCA 1W91A 1K8YA 4R85A 1BVNP 2Z2UA 3LENA 1E0UA 4M1BA 2CZDA 4PYSA 4K7VA 4TX6A 1WNOA 2AAAA 3UWEA 2G3FA 5KSWA 3AYSA 3MUZ1 1TPUA 2VX7A 1DJGA 2W79A 7ENLA 4DLFA 3SJ3A 1K6AA 1ITXA 1E6PA 3WLTA 1SR9A 4CNPA 1JF5A 3W7QA 3DU0A 2Y24A 1BD0A 3UPBA 1E6SM 2E1WA 4IFKA 1DYSA 1KWKA 3CT2A 2XFRA 3I7QA 3IRDA 4YXGA 2XH4A 1DEDA 2OSXA 3S2JA 4J3TA 5E0FA 4L1WA 4YVVA 3SCVA 1F74A 4WGXA 3S2LA 3SFWA 3KVLA 2W3ZA 2WW5A 1Q6OA 4E5TA 1UZDA 1C9WA 3GSMA 3BZJA 4UB9A 4FO4A 3APGA 2E09A 2W5FA 9RUBA 2VEIA 3NNTA 6REQB 3DBNA 2NQHA 1E72M 3B0UX 3UG8A 1TV3A 1UG6A 5CPQA 2P3ZA 4O50A 2PE4A 5CQ1A 4AXNA 4NNAA 4OECA 1AW2A 1R3WA 2BHZA 1VFOA 3ZR6A 1HKMA 3CHEA 4IMEA 3UWZA 3R58A 3V7PA 2A7NA 2RDUA 1C92A 1FWBC 2MUCA 3PTMA 3IIXA 3VC6A 4LRTA 4D6HA 1RBOB 4LYPA 3REQB 3LBOA 3RCNA 1E5NA 3W1LA 1WZLA 4JPGA 3CAKA 1A5UA 1K8ZA 2NUXA 2PA6A 3GKFA 3EDKA 3SO7A 3TTYA 2PLKA 4HCDA 1KR1A 4PSRA 5AHIA 2HXTA 3HQ1A 3AAMA 1L8NA 4C6CA 1TVPA 1S5MA 3QVQA 3BOFA 3EBVA 3G6MA 1RJQA 4U2ZA 3IGSA 1XLJA 1D3GA 3W38A 3BLEA 3UZZA 2E40A 2PDNA 2I5GA 5D03A 3JZUA 3LHYA 4GLEA 3CQ0A 1P6CA 4S23A 4PMVA 2DZSA 1H49A 3G1XA 5LNSA 3NOYA 3W07A 3MO7A 1R6WA 5TAOA 4ZMGA 1JRBA 3A3HA 2CESA 4NILA 3BW2A 4ORIA 4JN8A 3ALFA 3IPWA 3LUTA 1JZ7A 2A79A 2QDEA 3TR2A 2VRJA 3CWHA 1G5AA 1E4LA 1EYEA 1UH4A 1AQHA 1N7KA 4U3CA 4Q6XA 3CYJA 5DF0A 4IJBA 1J79A 4ZZ9A 4C6EA 5I6SA 4AYGA 1W3IA 3MJMA 5EU9A 1TPVA 2E5CA 2VFHA 4GQ0A 3FS2A 1TJ0A 1FDJA 2C8NA 3EPNA 4UC5A 2HZGA 3FHAA 1W1B1 1P48A 3WCZA 4H1ZA 3WUGA 5KETA 3CHDA 3HPAA 8XIMA 3MDUA 3ARPA 1P7TA 2CBVA 1GWJA 2YJQA 1QMLA 5CGMA 1PBGA 2TRSA 1UJQA 1SVDA 5AHLA 2YBVA 3PZ9A 1ODUA 4HMNA 3MB9A 3HG4A 5FF4A 2WCAA 2PU1A 1CXLA 3GXDA 3FYPA 3HQOA 3R11A 4AD1A 1K7FA 2Z0IA 2Y70A 4L6DA 2ZRUA 4XAZA 4Q6JA 2AL2B 4PR4A 4DNMA 1MQQA 3MA8A 1V79A 2YGYA 3T05A 4D8LA 3W75A 2X0SA 2QUUA 2G5WA 1IEWA 2ZA2A 3LDVA 4P2VA 2NQJA 1K70A 2G95A 5JBEA 1JYWA 1L6YA 4MVAA 2XIQA 2BXYA 4FXSA 4GYPC 4L56A 4LY8A 1GW1A 1KLZA 3WD2A 1XLGA 5C71A 2GYIA 1CGVA 1XGZA 3QMSA 4GUIA 4TOQA 1MSSA 4LJ3A 4A8RA 2XWDA 2V5JA 1WDDA 1LM1A 3UY8A 1XJBA 4YTRA 4KH2A 1GQJA 3SCUA 5J8LA 1QDSA 1NOWA 2ZUMA 3URQA 4CNUA 1OIMA 1BLIA 2DW6A 1JQXA 3A6OA 4LT9A 5FEWA 4OU1A 2PDWA 2IQDA 1OCJA 4GKLA 4LSBA 2G3NA 3B04A 2VX6A 3PK7A 4DBDA 3GFYA 5CPTA 2YB4A 3GR4A 1TV4A 2DSUA 5E9XA 1EF3A 3UXIA 3P2VA 3TWBA 1EDGA 3VCRA 2V3FA 1L6SA 1ONWA 3H6OA 5T9CE 2EG6A 2XIOA 3U0HA 3KRUA 3TSMA 1E3ZA 5CSUA 4YTUA 3WEZA 3FK4A 1IF2A 4IGNA 3EWWA 1J5SA 2GVJA 1NVMA 3B06A 5D02A 1XLMA 2FH8A 1UR9A 4PGLA 1O7AA 3Q37A 4H6EA 5H8PA 5BMWA 2X7VA 2PDLA 1BQCA 1DTUA 3T0BA 1US3A 4MIMA 4PODA 2XHYA 1SFJA 3C0SA 5AC8A 2JKEA 5KMYA 1VZWA 4L6OA 5HWJA 4I9TA 5CAHA 4IMFA 3DKLA 1THFD 5FJIA 2DZWA 1QO2A 3N73A 3NO1A 4RNHA 4R88A 3RILA 1JD7A 3WH5A 3MI3A 2YCEA 2J78A 3R43A 1PIGA 1W32A 3STGA 1WKEA 2HXUA 3M0MA 1HJWA 1AFSA 3DENA 3MP3A 4LB3A 4LVFA 4XBJA 1UR4A 4ES4A 2Y85A 4Q4PA 1RV8A 1AJZA 2CIPA 4O13A 3VMOA 3WD3A 4DXKA 2Y5SA 4GZIA 3WJXA 4KRTA 3WMBA 1TPC1 2GSJA 4KF1A 3ZIZA 4D1IA 3C0JA 3H55A 3GC5A 3GXPA 4QROA 3CHCA 2IQTA 4DUVA 3G1YA 3E49A 1EHNA 2OTDA 4GCXA 1DJZA 1W9VA 4FNUA 4MKSA 2PURA 1AH4A 3RJYA 4UTKA 1UPPA 1DIDA 2Z00A 3WBYA 1G0CA 2CLHA 4I7WA 4TIMA 3GAKA 3MUCA 3QFEA 3T0AA 4M6UA 1FWJC 1AK5A 5AVNA 4M7SA 3W22A 4LUYA 1ONXA 1EUNA 1W56A 3N13A 1Q7QA 4YMZA 4FB7A 4M6VA 1S5WA 2V3EA 2WSRA 3IUHA 1YE4A 4D1JA 5SWUA 2DUZA 4L65A 1VB9A 2DUAA 4XK2A 3WLRA 3CV6A 3CZGA 3SR7A 1XIBA 2PF8A 3BV4A 2WZTA 5DBUA 1I1XA 1XLFA 1XKYA 3F5JA 4QS6A 4N2YA 5T8GA 3AHXA 4JDYA 2ZUSA 3F4CA 1C91A 1KA9F 3KP1A 3M47A 4PB3A 3WQ8A 5FF3A 3P0WA 4JN6A 3QOKA 3DC8A 1CBGA 2VNCA 4HQVA 5JQ9A 3UCQA 4GACA 4IP4A 1K9FA 4I5RA 2FVMA 2VDIA 3MUAA 4PEEA 3E2SA 3W1MA 2FKPA 1A5AA 4FOUA 1X8CA 3GRIA 4IM4A 2O92A 3K8KA 4TMCA 1RJRA 4V27A 4GC3A 2CHOA 5AHEA 1R3RA 1PE1A 1C90A 5PTDA 3LZ3A 3FIGA 4JFSA 3FAWA 3G22A 2XISA 1LOLA 3OEXA 4NYYA 2EPKX 4BCEA 5F7UA 1WOBA 2HISA 1V6YA 2UY5A 1US2A 3LPGA 3CH9A 2INZA 1AH0A 4MNKA 4UTFA 4FR1A 2GJRA 3H2FA 3LX9A 3UA4A 3BQ5A 2A7RA 1H4PA 5LGXA 2W66A 2QJGA 1OQFA 1NWUA 2IKHA 4INFA 1Q6EA 3ITLA 1PV8A 4DO4A 5A8PA 2BP1A 5D37A 3TYUA 4U31A 1OHLA 3LZ5A 3R10A 2YFOA 2AKMA 2E5BA 3QC0A 4HU0A 6TAAA 2WVSA 4DJFC 2F2KA 2DU2A 4LS0A 5D8WA 2PRLA 5REQB 2X40A 2ZIDA 1FCVA 3M43A 4YHGA 2WJDA 1TKKA 3B8TA 3QHOA 1EIBA 3CL6A 2DZPA 2WMKA 2D20A 4C6BA 2X30A 2J8TA 1ESWA 1G69A 1L2UA 4AF0A 1DORA 3FXGA 1AZ2A 3C4UA 3W7DA 1JYNA 2WVVB 1NTHA 1W1ZA 3W3OA 3WG6A 4B4HA 2GVLA 4RW5A 3UYCA 1IR1A 3CPRA 3SQLA 3CLWA 5CH9A 4IP5A 3A4XA 2B7NA 4DZIA 4GZEA 1XS2A 2QULA 3I3DA 4FOJA 1JAKA 1KC7A 4CGTA 3WLIA 5FAJA 4CD6A 1GQLA 5TQLA 1I45A 3WH6A 3ABRA 2R1KA 3LLFA 3MT1A 3V75A 3W73A 4WRHA 4GJJA 2G97A 4PBFA 2J6VA 2V6AA 1LP6A 2QCCA 3WX7A 4YPJA 2CLOA 3TYCA 1J2WA 1KFJA 3LHWA 4KEMA 3B97A 3MTWA 5LXXA 3BGAA 3MS8A 2ZUNA 3K1GA 2O7QA 3W7NA 3VXGA 3TTOA 5I3GA 1EP3A 3F1QA 3K13A 2EJ1A 4IQEA 3TNOA 3K4WA 4D72A 1BVWA 4EXAA 4ZSTA 2H90A 2WC4A 1O1HA 4UFLA 4GKTA 3G8RA 3W23A 1NF0A 3F03K 4IHCA 2E67A 2PS2A 4S3KA 2VCBA 4C60A 3TZFA 2ZXAA 5T26A 4NRSA 8TIMA 2DZAA 1U1JA 3WBAA 2ZUUA 4J3WA 1QK2A 1JDEA 1BRLB 3B8WA 3B9AA 1AG1O 2REQA 1TTIA 5GNXA 9CGTA 3HIJA 1TIWA 1GPWA 3AS3A 4WY0F 4MPQA 3KRZA 3HPXA 1LDCA 1VENA 1KGUA 1KTCA 2QJJA 4MLJA 3BTNA 1FWFC 1BWKA 3BURA 2UV8G 1WCGA 3VIJA 1NOUA 3DI1A 3EX6A 2VO5A 1LL4A 1JZ5A 3KOFA 1JGMA 1TE1A 1XL9A 1JFHA 5FEZA 1PKYA 3F4WA 4CVUA 2Q3OA 1X1ZA 4W89A 4E4UA 1J0YA 4GI6A 3CLMA 2YCLB 3LERA 4Q7BA 3EEGA 3XINA 3ITYA 1LF1A 3R5EA 3QQWA 2WBKA 2WSKA 1A50A 2H9AA 2XZ7A 5JU6A 3QKZA 2Z6IA 4EF9A 4JFUA 4LX4A 1R2RA 2R1NA 3ITCA 1A5OC 2VVNA 1O12A 2XN2A 1EA0A 1M01A 4I5UA 3CZEA 1ISVA 4L6HA 3GNOA 1I75A 4UTMA 3AJXA 5C7VA 1XSKA 1F2JA 1UZHA 3UJSA 1T0OA 1REQA 3O06A 4WUIA 3I65A 1U2YA 3AIQA 4M5PA 5JMUA 2G50A 3H2EA 4S3JA 4YJ5A 5F2LA 3B0VC 2WHKA 3DEQA 4W8BA 4BF9A 3AZRA 3VKCA 4LBUA 5BW6A 1M04A 4Q8VA 3H70A 1WE5A 4GUHA 1UD3A 1KCKA 1R3VA 4W9TA 1WAUA 3ARVA 3QSRA 4XAGA 2E3ZA 2WSQA 2YKKA 2RJHA 4WY0A 3TE9A 1R87A 4ZA0A 4GQRA 2BOGX 4N4PA 5TBOA 4S3CA 1TTQA 1EJXC 2ZX7A 2XPKA 1VRXA 3BAJA 1DWAM 1FBAA 1P5BA 4GCAA 2YZRA 5C0QA 4J9JA 4XAPA 4XSMA 1XIDA 1TIMA 5HUPA 3DYOA 4I5XA 3UZYA 1Y5XA 2QAPA 3S8HA 3AXHA 3AQUA 1XIFA 1ZTVA 1RA5A 1TELA 2YYTA 1SFTA 3IJDA 5AYIA 2HSAA 3JR2A 1O68A 4IIGA 1GVIA 5CXPA 1XRFA 3QMTA 1UMLA 4JFVA 1WX0A 3VDCA 5A6MA 3KBWA 3SUVA 4Z2LA 3PTQA 3I4KA 1RLCL 1MEWA 2YXGA 2GQ8A 1UQYA 4NZ4A 3WH9A 5K7JA 4C6MA 4MSSA 3IGHX 1TA3A 1UR1A 3RK8A 2JGYA 3UR7A 4FA3A 4HSNA 3BXWA 1IQ8A 2PD9A 2WZHA 2NWRA 3SRKA 3T2QA 3GU9A 5DY2A 3CTTA 1GOOA 4NY2A 4OIFA 2DIKA 4C6IA 3LGGA 5CEWA 2GK1A 1GW9A 1NP2A 2WV8A 2VQUA 2BTMA 2NSXA 2VC7A 1EH9A 2Z4GA 3GNPA 1EXPA 2CBIA 3KE0A 4M80A 3SGZA 4H83A 2DQWA 1IZCA 2DSKA 5D8ZA 4TX8A 4OTKA 4CNNA 3THDA 3GTFA 2NLYA 5CGQA 4OKDA 2GQ3A 3NVTA 3WJWA 4P7RA 3E0FA 3ZO9A 2BGSA 3OBEA 3WJSA 1AH3A 2A3EA 3HGRA 5MKGA 4CEUC 4ZSUA 2A5HA 2BV9A 1T7LA 1KBIA 2XU2A 3B3DA 5EMYA 2E5DA 1HZYA 4LCRA 4C6OA 2ON3A 1F6KA 3GIYA 3WQWA 3UQNA 1I2PA 2ZOXA 1PHQA 1EZWA 2AQWA 4P7NA 3W86A 3BV7A 3NSXA 3CMGA 3P84A 2WWCA 1JZ3A 5DXXA 4H9MA 3G8EA 3E96A 1FOBA 2WPGA 1A47A 2DT0A 2R1PA 5FSEC 2JALA 3CZJA 2QPSA 5DXYA 1KO0A 6REQA 5AECA 3MANA 4I9AA 4NNCA 4C6JA 3GC4A 2O55A 3RU6A 2A3AA 4MNJA 4GQBA 4Y9OA 2HRWA 3N2XA 3M7WA 1RPXA 4G8TA 4KRUA 2Y8KA 1LL7A 2HQAA 1V02E 4AHQA 3KS6A 1CW2A 3H26A 4JTTA 2C91A 2RFGA 4E8GA 3I10A 2CCRA 4DBWA 3B05A 1PL9A 3NDZA 4TMBA 2WHMA 3M5YA 1DJWA 3ZT5A 5CC3A 3MW7A 3WDJA 3WYZA 1QK0A 1TB3A 3ARWA 1NDYA 1I2NA 3S1XA 2I57A 4ATWA 1MMFA 3ANUA 1PUDA 5BCAA 4KW2A 4YVPA 1F07A 4A6GA 3LXAA 1XKJA 2OQHA 3UVIA 3B9NA 3RX4A 1ZJHA 3S83A 5D9PA 1TWSA 4HNTA 3VOHA 3UWYA 2XIJA 5EL1A 4XD6A 1O5QA 1TV5A 1DVJA 4PRRA 4Y7EA 1Q6DA 4DWSB 1Q5MA 1T41A 4YL2A 1Z41A 4B2DD 5TNVA 3SY5A 4N9BA 2HK1A 4J3VA 1GEQA 3SDOA 1R8LA 2XUCA 1PAMA 3PFMA 4KIEA 3TW9A 2BGNE 2RAGA 1D8CA 2HCVA 4JDBA 5AOUA 4AAJA 4UTWA 2PAJA 4L7ZA 1V0MA 3HFTA 1TRDA 5BYWA 4IX2A 4ICCX 1IXOA 4R7WA 4HU4A 1YDNA 5G4EA 3MJYA 1AMYA 1QBAA 1OD0A 3DI0A 4HKPA 5AYBA 1EP2A 4B3LA 4R9OA 1XD0A 5IHSA 4NJGA 2A0NA 1XV8A 3T2PA 1M7JA 1JPHA 3KL3A 2QIWA 3WK3A 3MVTA 1Z9AA 3F4DA 1K1DA 1S2WA 3KL5A 1LUCB 1UWQA 2CZFA 3G1HA 4LGXA 3W1RA 1OC6A 3F2BA 3W6YA 4HP5A 3OG3A 4XAFA 4WGHA 3C0LA 1CXFA 2H3DA 1DJYA 3AOFA 1HO4A 2QVNA 3EMCA 1PO9A 4XVEA 1EX5A 1TQJA 2J47A 3QPZA 4QDWA 4JTQA 5HNUA 4JIEA 4H9UA 3C61A 4QJ4B 2VDGA 2JGQA 3DESA 3V0UA 1SO5A 3TYDA 2Z1WA 1O94A 3VKDA 3TC6A 3WLQA 1HN1A 4HPGA 3E5BA 3IV8A 2LLEA 1F73A 3W70A 1GZ1A 1UWSA 4S3BA 3N4AA 3LD5A 2V69A 1NWTA 3OB8A 5D04C 3NXLA 1ZNNA 3HPZA 4GJIA 3NL2A 4AZCA 1GVYA 3CMJA 2DSVA 3NPVA 3L0NA 5FA5A 2CLFA 2UBPC 3DFQA 4ACZB 4QISA 1BYDA 1OFEA 4NI8A 3NSNA 3ZLHA 3BW4A 5DRIA 1XBYA 1ZAIA 5FF7A 2R94A 4AZ5A 1K9EA 2ISWA 1CGWA 4MY1A 2HV5A 1PTGA 1XC4A 4HA1A 1ZU8A 1OFDA 3M4HA 3POCA 2C7FA 1YTEA 1ZBWA 1D3HA 1SW0A 1X38A 4E4FA 3BOXA 3UU0A 1F3TA 1QHOA 1KQZA 5JBDA 4DWDA 5LIKX 1XC6A 1VCGA 4N42A 1J9YA 1V08A 2V2HA 3BG3A 3CUJA 3VX1A 3PUGA 2X1IA 3LTPA 2XG9A 4R34A 2OX1A 3C2EA 4IIEA 2QCGA 4F48A 2EHHA 3U4FA 3AZTA 2XIBA 4HA4A 1VLIA 3ES7A 3L4TA 3LK6A 1CGTA 2VEFA 1CI1A 3FJNA 2VD8A 3GBDA 5C70A 4AEEA 3LHVA 1VBRA 4MM1A 1K77A 4MUZA 1QNPA 2WAGA 4PTMA 2CW6A 3H53A 1G67A 4B91A 2PDBA 4O15A 3WENA 2QCDB 6PTDA 3CUIA 1EJRC 2CZVA 1QR7A 3L4ZA 2E1DA 3TONA 2QAFA 4JQ1A 2CXEA 7ODCA 4J5NA 2G37A 3C5QA 1YNYA 3B0PA 3EDJA 4TVDA 1M6JA 3Q2DA 2R9RA 4MPKA 3A9IA 1UR0A 2DORA 1W1YA 1XYLA 4BY3A 2ZRYA 3GVRA 4DF1A 3RR4A 3QR0A 3P82A 2E6AA 3LCFA 2GPTA 4W5ZA 1C29A 1UCWA 1M7OA 5CG7A 1XLKA 4Q4QA 1ICQA 2AQOA 4JNYA 2D69A 4O28A 3H22A 2XH2A 1FWAC 3TH6A 4HMCA 2ZQ0A 4RV8A 3A4AA 1POKA 3RDKA 3CGTA 3MUIA 1UW9A 4BA0A 3EB2A 2BDQA 4K37A 1W9UA 2PUZA 1I2OA 3CUZA 4J40A 1XIGA 3KLKA 2ESCA 3QMRA 3TC3A 1W5PA 3VD7A 3PZTA 1A5BA 4PUJA 3L7RA 5D2WA 2C13A 1Z8AA 3HPSA 4GIYA 4Z08A 2BSLA 4DJDD 1SFLA 3M16A 4IIBA 4K8GA 2J7DA 3KBMA 4PUWA 1VJSA 4G9PA 4DBEA 1R7OA 3PG8A 3LRLA 3B4YA 3Q94A 3WELA 5CBIA 3MHGA 3FCPA 4GOAA 1Z7AA 4NZJA 3CO4A 4JTCA 3T0DA 4RCXA 2Y88A 1OK4A 3NL6A 3ZQ9A 1GNXA 1PKLA 3L66A 1OFQA 3VO0A 1VPYA 1US0A 3UFYA 2Z7GA 1A5LC 3QGVA 4S2BA 4HPNA 1RR2A 3VIMA 2UWFA 5I03A 1NM9A 4DPQA 4FEZA 4IMCA 3NPXA 1TUFA 2P0IA 4EPKA 3R79A 3RMEA 1M9HA 3K8MA 1A5CA 3Q67A 3C86A 3FEMA 1RLDA 1Q7MA 2A21A 4IT1A 1XYBA 4HHMA 1GOQA 2PWUA 4KEVA 2FMOA 4DN1A 1S2UA 1TTJA 5H1WA 1C7TA 3N25A 1HFBA 4YCOA 2I1OA 4WHBA 3GB6A 4L9XA 4XKYB 2CLPA 4JCLA 4RJEA 3WF1A 2ZVIA 4W8LA 1JRCA 3ZT7A 3NZ1A 1EGVA 3QM3A 4ICNA 4JTAA 4E8DA 3MWCA 3KCJA 4GA8A 3TA9A 1JPKA 3UWVA 1Q85A 1LZOA 4ZOCA 2RDTA 2HE8A 4MWAE 3SCNA 2QS8A 1KKRA 2P10A 2YLAA 4IJRA 3L4WA 4AZGA 1OT1A 4GBUA 6A3HA 3S2NA 4AY7A 4NHVA 4ZB2A 5XIMA 3RAOA 2OELA 4LYKA 5A6KA 2E68A 2Y8VA 3ITGA 3OOQA 1XD1A 3A47A 4JQ2A 4B9YA 4FLQA 1CGUA 3LCXA 3N2TA 5FJJA 1VCVA 2GGHA 2NVDA 4IQDA 2W0UA 1UKOA 2EG8A 4EOUA 3T8QA 4H7VA 2CERA 1UP0A 3GXIA 3WSUA 1B90A 1GOXA 4FPSA 5BXSA 3BVJA 3TEVA 2WLZA 2ZVRA 4H9TA 4IMAA 3A24A 3IRSA 3T78A 4IQJA 5DO8A 5BOOA 1DKWA 1EPVA 1ZBKA 2P53A 3BANA 3KVJA 4D9PA 4Y90A 1ZFJA 3M0ZA 3WLJA 5HMSA 1JGIA 3NQVA 4G2DA 2YDRA 1BEUA 3RIKA 1XGDA 3NWRA 1DP0A 3LS9A 5HDRA 3ISIX 3QQ0A 3V4BA 4D8ZA 4JTJA 1KRBC 2ZRXA 4JQ4A 3F4VA 3NQMA 1ZQ5A 4NJIA 4OQVA 3UPMA 2BY0A 2DVXA 4IPPA 2OLHA 2PTZA 1IIHA 3BARA 5CC6A 1KLYA 3HV9A 4J35A 3EOUA 5EKYA 3WF4A 5HK4A 2ZKMX 4B16A 3WD1A 3UZJA 5D32A 4DI8A 1LL6A 3DHUA 4I7VA 4H3DA 1OYBA 3UJRA 4HIBA 4W7WA 1U5JA 3DG7A 4LF1A 1TUXA 4H9ZA 1EB3A 4IFKB 2D73A 2H6RA 1B31A 1E6RA 3AYRA 4O17A 1CXKA 1GJUA 2GJXA 3W1QA 1WUFA 1H63A 1HKJA 4F4RA 4AHOA 2WNZA 4PFMA 3FGCA 1TWIA 3LCLA 1DOSA 1HVQA 5DY3A 5DMNA 1I2RA 1V6XA 3LLXA 2J7HA 1TPDA 3WK1A 4HBKA 2NT1A 1JG9A 4L4LA 1CGXA 1J18A 4XBSA 5G5IA 4RE3A 4PMNA 4C6QA 4Z2GA 1QT1A 3MUXA 2F61A 3AMLA 1PWLA 3WUBA 2ZZ7A 3SGGA 4PMRA 3DC0A 3PP7A 1T96A 3N9RA 5M17A 4KFOA 2O56A 3V0TA 2G96A 5FD0A 1YRRA 2XFFA 1TWWA 2CITA 3W2KA 1UR2A 1V3LA 2CHNA 3LXCA 4F66A 4H01A 3AWNA 3N4EA 2ONEA 1ZB5A 2QCEA 2XSAA 3W24A 3S3GA 5CBJA 5I09A 3UXLA 3W7GA 3FA5A 3GXTA 2VOMA 4C7FA 4G7EB 4BF7A 2WB5A 2X7WA 4NX5A 2ACUA 2J79A 2VENA 3L5MA 2YYUA 4US5D 3HGJA 2ZE3A 4TU1A 4N02A 4O4VA 4ZOAA 2PWHA 5M5DA 3D46A 5ECVA 5I06A 1FHLA 5BWFA 5DCDA 2PU0A 5CC5A 4W7UA 2NXHA 2BY3A 2GSEA 1IWPA 3W28A 3WD4A 2FTYA 1UH3A 1BQGA 1YNPA 2WHJA 3JUGA 3G24A 3WQCA 2D2GA 2OX4A 5DMYA 3EZ4A 3PUOA 1C3FA 1T5AA 5T9BG 3RR1A 4ZQNA 1QI5A 5FIPA 1EJVC 3GDRA 5IBXA 2AGTA 1TSIA 2W63A 3KWXA 3QOMA 3MYPA 4C65A 4M1RA 1WDPA 5BOFA 1LT7A 4EP8C 3ABOA 2ZCGA 4HNVA 1IT0A 3T9PA 3T4WA 4OBTA 3RRAA 3MSRA 4RX0A 4IG2A 4V33A 3JZEA 4JBRA 4HTYA 1Q6LA 3QY7A 2G3IA 4BQ5A 4B5XA 4BZYA 3UXDA 4OUIA 1TPWA 3STFA 4AY1A 4AWTA 4L9ZA 1PDZA 3BK0A 4QE4A 2QV5A 1LOSA 1H7RA 3WDQA 4WD0A 1U1UA 3GDTA 1LG1A 4YU1A 2WC7A 3ZR5A 1NDZA 4KERA 3G3MA 1X7FA 1VHNA 3MU7A 3NQ7A 1T99A 1EFZA 4D6EA 3IUIA 4Z1CA 2HPMA 1RP8A 4H8UA 2WZIA 3U6WA 4FI4A 2PTYA 4CKQA 3O8AA 4HNUA 4YVXA 3TV8A 4W4QA 2OODA 1GQIA 1QU4A 3W74A 4HZ7A 4KCTA 3T08A 3W7EA 1H09A 3BAWA 2QLYA 3EX3A 2JQXA 1WDQA 2FZ9A 3PZMA 3K8LA 2XGIA 1QOQA 3MUY1 3N9SA 4GGBA 5CZKA 4FLRA 3BMVA 5G4HC 1JCNA 1XH0A 1H41A 4GPNA 4Y9MA 4D6JA 3L2IA 2QUMA 2AL1A 3E2VA 5CPLA 5ABGA 5HUOA 3S1UA 4M24A 3T07A 3DH7A 4H19A 5IHRA 2XM1A 2OKTA 5A5WA 2WNWA 4IISA 2PDQA 4QEHA 3R7MA 3GIPA 1MFUA 3SRFA 3NFUA 4Q8MA 1MVYA 2BOEX 5GNYA 1OABA 1WA3A 1QRQA 4PUKA 3KOXA 3WZ0E 1P0EA 3NM3A 1F8MA 4FX6M 4LBSA 1GKRA 4A05A 5EY5A 3RU8X 1O95A 1AUSL 1W9BM 4QCEA 2XTKA 1OD8A 2ZUWA 1B0IA 4MYAA 4CCEA 2VC6A 4LWWA 1FKWA 2VURA 3HURA 5AKQA 2PTXA 1QHPA 1VEOA 2X2GA 1ZY9A 3KM8A 5I02A 3ARXA 1E4IA 2VCCA 4IOTA 1OFOA 2CNCA 4PMJA 3DHPA 4MKVA 4KWVA 2WANA 2HBXA 1PZ0A 5HXMA 2GQAA 3DBPA 2G3MA 4ERAA 1B3XA 1V0LA 4AQLA 3S46A 3W84A 1HGWA 3B8SA 2X0YA 1H3GA 4GNJA 3L2LA 4XZHA 3SIZA 5C2GA 2DY3A 1BTMA 3UJEA 1OGBA 2E8ZA 4MB3A 1VLWA 2Z2AA 2QCMA 4PSPA 4YTSA 4W8AA 1H62A 5DX7A 1W1VA 2Z2BA 4QG8A 3THUA 3W1AA 4KT2A 1ICSA 4CN4A 2D0FA 1E1FA 3PJWA 4KBXA 4L80A 1W5MA 2PWFA 1LOQA 1R3QA 3LHZA 3V5OA 2HNEA 1W54A 1TPB1 4Q8NA 3DFTA 3CAWA 1YTDA 1HKIA 3WEOA 4JXCA 4WZHA 3N6QA 1GCYA 4MB5A 1XCFA 1DXEA 2X09A 2YW3A 3BCDA 1OZQA 5JXQA 3BO9A 3MKVA 1PX4A 4TTUA 1OK6A 3WBWA 2VJXA 1DXFA 3NQFA 5DFAA 4LC6A 4KS0A 3GIQA 3DG6A 1GYNA 4IXXA 4Y6GA 2NWSA 1XQKA 1G94A 2HBVA 3VGFA 2VI0A 4HT3A 3N19B 1RK6A 1L9WA 5FEXA 3CUHA 1EXBA 2C1GA 3MSYA 1UD6A 4H7ZA 4A3QA 1ISYA 3BSMA 1XWYA 2GLKA 1CECA 2XH0A 4AMCA 2CFFA 3SCOA 3LCGA 3W00A 4MZYA 1KGWA 2ZX5A 4JIPA 1W1IE 3TAKA 3NQGA 2YOCA 1TRIA 1Q8JA 3NGFA 1RVKA 2C0AA 4DJEA 2DGAA 1AQMA 4BQ2A 3L21A 5LXEA 5AHNA 1L6WA 3E02A 3WQOA 2Y5EA 2VUYA 1Q6GA 4XAYA 2Z25A 1ISZA 3MWAA 5LNRA 3L68A 5LZLA 5K9XA 1FP8A 4AVOA 1CDGA 4MGGA 3LNMA 1TZ9A 3LPFA 1DWIM 4E3TA 5HAOA 2PZ0A 3W2LA 5A6LA 2QJHA 3TYBA 2GGJA 3QGAC 1BG4A 2GZXA 3VIKA 3UNDA 4F9DA 4CVWA 4M8UA 1A5KC 3CMFA 2VFFA 3CPUA 3L67A 3FYOA 3W37A 1DTNA 1QJWA 5HATA 1CWYA 2DT1A 2PP3A 2VFEA 2VWSA 1HGYA 4DI9A 3PULA 4QE5A 1O1ZA 4ZQMA 4YTTA 2IUZA 5FJTA 3VVGA 5BROA 3WQPA 3OHIA 5CSRA 4IICA 1MNSA 3LQGA 2CLLA 5E5CA 4F3HA 1LUCA 1P0NA 1Z48A 2CYGA 4JY9A 3G0XA 1UHVA 5JIWA 5I5RA 4XKMA 4JHOA 6XIAA 1WO2A 3VFLA 5C9WA 2FHCA 4QLKA 3H2OA 3ZXWA 2DH2A 4TV5A 2Z24A 1OY0A 1F6PA 3NCOA 2FB3A 5G2IA 5F4XA 1M7PA 4QHRA 1W2PA 2A1YA 3B4UA 3TN3A 3TA6A 2BXVA 3IJLA 4HD5A 5EPDA 3OZPA 4O0QA 3DFOA 3EDDA 1S2CA 2OOGA 4M29A 4DZHA 2CLEA 3IUDA 1OEPA 4RNFA 1G4PA 3IS4A 2C18A 2J8GA 5DN1A 3VGDA 2UZ9A 4DAIA 3RLGA 3NURA 1JEZA 1E6XM 1NY1A 4KFPA 3ALGA 1RQEA 4FHAA 2OCZA 2WZEA 3RCYA 2PC4A 3TJIA 4C7GA 3T81A 1CXHA 4JNZA 4JEQA 1ISWA 2OG9A 4AZ7A 3N34A 3WQVA 1O5XA 3IIVA 3QW3A 3W1XA 3I6TA 3MBFA 2VZTA 4NJJA 4AD0A 3IK2A 3P8JA 1GVQA 3EPMA 3VE9A 1J8VA 1X98A 1WDWA 3BJSA 4MG4A 1W6TA 1GG1A 3GVQA 3C2OA 1KV8A 3WLNA 2TYSA 3GG8A 3BOLA 4X3ZA 1YLVA 2FZDA 2JKPA 2WKJA 4PTWA 3K30A 4BI6A 1VGAA 2G0WA 3STPA 8XIAA 4HYVA 5K2ZA 4Z1DA 4KWUA 4AF0B 5EMKA 1AQFA 1JCTA 3EWXA 3DGRA 4DY1A 2ASHA 4ZQCA 4PBEA 1RZMA 1TFVA 4PL2A 4QJ5B 2GUYA 3E5PA 3DHDA 1PWMA 1OYCA 3NYZA 4EANA 2QJNA 5IOBA 1XICA 3EDEA 1ZUAX 5LNUA 3AFBA 2DH3A 1E71M 3AXMA 1TTPA 1R85A 5B80A 1B1YA 1G4SA 5ABFA 3I3BA 5LSMA 3MBDA 5A6TC 5BRPA 2B4GA 2QF7A 1PXGA 5EGRA 1FFRA 4C6PA 5AHFA 1KXHA 3WFZA 1EOMA 3RG6A 4A3RA 2YL6A 3SSZA 3KWSA 1VBGA 2FTWA 1WXJA 3ARSA 4Q8UA 4FNTA 3EKLA 3IAQA 4NSBA 3FOKA 3SECA 1NARA 4H41A 3THCA 4DEFA 3AMGA 4P7LA 4MB4A 4GQGA 2XVPA 4HSOA 4O52A 1ISXA 2C71A 4MF4A 3RCMA 3AHYA 3A23A 3ZYZA 1TWZA 2ZE0A 4F79A 1LTDA 4FXFA 4GK8A 2BASA 1TCMA 2WCSA 5FCZA 3AU2A 4NU7A 1Q6FA 3QPEA 3KCOA 1SJBA 3CYVA 1ADOA 1K4GA 4D8AA 3M0XA 2REQB 4GYPA 4GIAA 5D9OA 3XIMA 3NSMA 1IR2A 3V5CA 5FL0A 3W2NA 5I23A 3GVVA 4JL2A 3NQEA 4IIFA 3ONCA 3O07A 1GORA 3KTXA 3ERPA 1EEPA 4J4KA 4LUSA 3C2VA 3SM0A 1SZNA 3E1F1 3PBWA 1UWUA 2O4QA 2OZ3A 1XGEA 4CLMA 1IEIA 3IARA 1ITUA 1CNVA 4QNEA 2NXGA 4GFSA 3RM9A 2J4GA 3NEVA 2H9AB 1P6WA 3HO8A 1IYXA 3EB4A 4BFAA 3FN9A 1GTHA 5HJXA 3HG5A 3T4CA 3TU9A 2XGBA 4AD3A 1UD8A 4UMAA 5F1UA 2D22A 2WC3A 1LCOA 1BSLA 2ZC1A 1QHZA 3VZXA 4JIHA 3TKFA 3KDOA 3HG3A 4HMEA 2J88A 3W1NA 3BLPX 2HPIA 4O57A 5CZTA 3WF3A 1H0GA 4Q7IA 4AFYA 1M41A 3QFWA 5DT5A 3NQ6A 4RUBA 3CQKA 3RMJA 1REQB 1Z69A 2J13A 3M5ZA 2XSXA 3TYEA 1KFWA 3EXSA 4HCLA 4HZ8A 4OOUA 3LN3A 4MY9A 2BHUA 2FMNA 3LRKA 4XKYA 4I90A 4MB1A 1P0BA 3GKAA 4GH3A 4HNNA 4Q7NA 1CIUA 3BL3A 3OYXA 1VFSA 4KCUA 2V5CA 4LNYA 3N3MA 4WY0B 1VCFA 1C93A 1HF6A 4LAZA 4X60A 1XM3A 2VEPA 1KD0A 3C3UA 4ZODA 5EFFA 1TMQA 4JX5A 5C2CA 4ATLA 2OYLA 2AOSA 3BCFA 3EGJA 3CHFA 1QPNA 1JZ8A 3RLVA 1XDLA 5G2HA 3NPWA 1AODA 3MKCA 2JKAA 4WJ8A 3TTSA 4R53A 3N18A 3ATZA 4B3ZA 5HPCA 4WQ6A 2X0HA 1DPMA 2QUNA 4WCJA 1B57A 3LU2A 3GTXA 4ONVA 4XZLX 5A2CA 1Q45A 1J0IA 3RGTA 3W83A 1EPXA 3LXBA 3OBKA 4DJEC 5KINA 1PPIA 1TA3B 1Y8BA 3M46A 4C5ZA 1BXNA 1JCJA 4TQTA 1E43A 3SGUA 5KZMA 1YBQA 3PUEA 2ZUVA 3U7VA 4AZHA 3W72A 3QV7A 1PX8A 4JKLA 4DO6A 3SUUA 3HJEA 1PCWA 1OG6A 4R7OA 4KQNA 3H2MA 1JUEA 4UR8A 3NQCA 2GK1B 4PCPA 4Z2HA 4JAWA 2PGFA 1J10A 1BG9A 1DJQA 3NQ8A 2GVGA 3NAVA 2F7FA 2QDHA 4IJCA 3EB3A 5I2UA 5C5YA 1YDVA 2C79A 5CPMA 3FJ4A 4AISA 3THAA 3CIWA 1PZ3A 2Y7DA 3R0UA 4XVDA 1RJPA 1LBMA 1K7EA 2NQLA 2J75A 2OLAA 4AWEA 1V6VA 1KFLA 3SY1A 2Z29A 5I24A 5MKGB 5C9ZA 1OC5A 3NG3A 4C1NB 1B3YA 2WVTA 3ECQA 1F76A 3OW1A 5JH1A 4O12A 5HQEA 1W3LA 3U2ZA 4IFRA 2EO7A 3N12A 1E40A 1J6PA 4MUPA 1O66A 2CLIA 3ARRA 3ZR4A 4O53A 2XVGA 3LTYA 4L4PA 1AA1B 3GNNA 1S1PA 3D47A 1T8XA 3IVUA 1YE6A 3U2OA 2P3EA 3GFXA 4DF2A 3GVWA 2TPSA 1DJNA 1RQBA 1Q8AA 3CXOA 1WOAA 4WKFA 2YBUA 3ICJA 1GVFA 3RRXA 1MQPA 1GQKA 1XFBA 1PSCA 2DIJA 2J8FA 3EWUA 5GQBA 1EBHA 3B9EA 5E1QA 1KBKA 1P4CA 4S1FA 4CNOA 2YCKX 1LLOA 3TFCA 2OEMA 3BE7A 3SEPA 4EPEC 2I9UA 4GC4A 4RE0A 3U4AA 3GH5A 4DX3A 1VYRA 2J6XA 3R4IA 3NOEA 1IHIA 3KLLA 2ZA3A 3S2CA 4G7EA 4DWSD 2OZTA 1B3VA 3G0UA 1LQ2A 3UCDA 3WQ6A 1R7AA 4US6A 3QTPA 3GDMA 3ABXA 2VUNA 1FHDA 1R46A 1EA9C 3VOIA 3T0CA 1M53A 1RBAA 1ZRQA 4XUGA 5M1TA 3N3TA 3C56A 1IV8A 5HNTA 1FWDC 2FZBA 4DJFA 4MTVA 3WFAA 4BEUA 1V4YA 4JN7A 3LI1A 4XZ9A 1DE6A 2VP8A 3W87A 2R82A 3KL0A 4I8DA 1FWCC 4A8IA 3V1PA 1OBAA 3H23A 4FIQA 1R86A 1XP3A 1XFCA 5I3DA 3OGVA 1Q6QA 1EJUC 1Q6CA 5BU9A 1TV8A 2QMJA 1RK5A 1H7NA 1TQXA 4QNWA 2A2IA 2V5DA 5A8MA 3UYIA 1GONA 3KBNA 1SR0A 4PB5A 4LVAA 2ALRA 3VNLA 1ZENA 1A3WA 2YPIA 3ITVA 3S0CA 4MJ4A 4K39A 4E2OA 1FX6A 1RY8A 3JU2A 3H54A 3H8AA 3TJLA 5BNKA 1A0CA 2I9EA 2ABAA 1K7XA 2UY2A 4JIQA 5A6BD 4X22A 1EC9A 3QJAA 4F0SA 5BXRA 3OGRA 1CB7B 3DX5A 2OB3A 2V2CA 1UWTA 2QV4A 2E6FA 1UH2A 2X16A 3M44A 4ZXOA 1LLZA 3ARTA 4A2SA 3FKKA 3MMDA 1UWIA 3EKGA 5GPRA 2GJLA 3U8GA 4HU8A 2PPGA 3EOSA 4AWSA 4HZ6A 1W3NA 2Y5JA 2V68A 3BG9A 4WKHA 4OZOA 2OEKA 5EBUA 3CM4A 5JBFA 1H60A 1H5YA 4KEUA 3CC1A 4NKCA 1EBGA 4H04A 4KMQA 4Z0JA 4UTLA 3RM8A 2PWDA 2PDUA 2Q01A 4Q3MA 3R8HA 1XLDA 4MZ8A 4YWSA 3B9OA 2XFYA 2FZMA 2VR5A 3KVKA 5IDIA 1SM9A 3U57A 2O9TA 2OFJA 5IRPA 3OU8A 4GIEA 4Z1BA 4FOKA 5EB8A 4GBDA 5BWAA 4R9XA 9XIAA 3W2JA 4QLJA 1VQTA 3SAZA 2JK2A 2QPUA 3BSHA 4LY4A 1JAEA 5I7GA 3WLSA 1H2JA 2VWTA 3VX0A 3UG3A 2QT3A 2QDDA 1KM0A 1MDRA 1VAHA 1BKHA 1XIIA 2F9RA 1X7IA 2BG5A 4R33A 3EWYA 1NSJA 1W5OA 4AZCB 4JTFA 3VK5A 4FF7A 1Z32X 2EKGA 4U28A 2YDQA 1E55A 4X0VA 2BY2A 3VGBA 2PGEA 2ACQA 4KCVA 4RR4A 4ACYA 3QV6A 2G8ZA 4F0MA 3M0VA 2E9LA 3P62A 3NXFA 5GJMA 1BXCA 2C15A 5CPOA 2GWGA 5H8MA 1LRTA 3UWQA 3GTNA 3PZGA 5C55A 4E8CA 3DERA 2WNQA 4GI8A 4C6FA 1P6BA 1POJA 3TMLA 2I7GA 4MFDA 4EIVA 4WXZA 1GVRA 3B8IA 4L4OA 1T40A 4BF5A 3WLOA 3EKZA 4HPJA 1YXYA 4MWAD 3WLPA 3BPWA 2F8QA 3SY8A 3V18A 1E73M 3R2GA 2Y2WA 2XWEA 3QV9A 3GZ3A 3Q65A 3SBFA 1ME9A 4PUEA 1D8WA 4DZAA 3WH7A 2QYGA 4A29A 4BS0A 5I77A 1JYVA 3R25A 3QV8A 3ZT6A 1EGZA 1V7AA 1YADA 3DFSA 2PDKA 3RX2A 4OT7A 1AQ0A 2PLJA 4A4AA 3P74A 2WMFA 4O19A 2GJNA 2YA1A 4AU0A 1E4NA 3WL1A 2BXZA 5DANA 1BFNA 2FZ8A 3W7PA 3TTEA 4PMUA 3AJ7A 1JDAA 3CAVA 4PMYA 3AXXA 4H6KA 2GOUA 3KW3A 3DFNA 2DVTA 3VDAA 3W85A 4GYJA 2XVLA 2ZXDA 3O6CA 1KV5A 3LB0A 4V2XA 4PFHA 3ARQA 3BGGA 2GVEA 3LMYA 1SSDA 3EA3A 2FJKA 3V1HA 5AYZA 3VOJA 1E1CA 3CNYA 1M7XA 1UR3M 1LQ0A 1SZEA 1JPDX 1QNQA 1A49A 3KAOA 1CCWB 1VRDA 2AQVA 3T55A 4PCTA 3HOJA 5CPSA 4GX9A 3LMZA 4L4MA 4UMBA 3A13A 2IPJA 2AAMA 1TG7A 2I17A 1HO1A 1TPEA 3TOPA 3U3HA 4B90A 3ZZ1A 5FEPA 3G1AA 3E2QA 4LEQA 3LHUA 1MI3A 1V3IA 1A0DA 5CLTA 3ZVHA 1H7OA 2CKRA 3MZNA 4P8VA 4POCA 4UFKA 3DCPA 2PC8A 3NZQA 3C52A 3LPOA 5K9DA 1YDYA 4ZTYA 3H2AA 4RPQA 2ZZ5A 1B9ZA 2P5NA 3Q58A 4DPPA 4J2MA 1J2BA 3TQVA 4NT0A 3WMLA 1W3TA 3UWWA 4QP0A 1MO0A 3VNJA 4UOJA 5A8QA 1WZAA 1VYSX 2TODA 3N11A 1R47A 4QEEA 3T7VA 4HZMA 1KRMA 4NZ1A 1Z3NA 3MVIA 5JH2A 1PEZA 3TIMA 2W61A 1S5NA 2NUWA 4D2JA 3PBUA 2P1FA 1NIUA 4QGCA 1NWRA 4NJKA 4JQAA 3DG3A 4PCNA 4GE8A 4YCPA 3VU2A 4O1DA 3FJ6A 5F1VA 4YS1A 4FNQA 1QI4A 5F2MA 3PPHA 1E9LA 4LVBA 3AZSA 1DQWA 4GO9A 3SZ8A 2J9XA 4NXSA 2FLIA 3N04A 3HG2A 1SZFA 4B5TA 2OOFA 4CCDA 1GG0A 3VOGA 1ITQA 2QMKA 1TR9A 5A1AA 3LY0A 4A3HA 1XLLA 1EGMA 5D2VA 3BDKA 1ODZA 3MHUA 3CU2A 2DT2A 3K4AA 4K1GA 4QFUA 3VMPA 3M5XA 1I9CB 4GI9A 1YYAA 2OT1A 3S9YA 4NIRA 3P3BA 3S4TA 5EMJA 3ZS4A 5RUBA 2HROA 1MFVA 4PCFA 1L8PA 1ZL1A 3NO3A 1ZPTA 1W1PA 4F8XA 2A7PA 4XSLA 3W1UA 1FWHC 1HTIA 2YL8A 4X0NA 5LIYX 3VIFA 3MKKA 3WNPA 4H9YA 3LQLA 3KBJA 3H21A 4G56A 3KZPA 3PJXA 3FV9A 1K03A 4IIDA 1XYMA 1O60A 3W7HA 2X41A 2IPGA 2O9PA 4KESA 2J24A 1QOPA 3AISA 4NAEA 4QRNA 3B8UA 1D9EA 1G1YA 1IZKA 1TO3A 3BH4A 4WDXA 5D2TA 5F4SA 2VGBA 5EBAA 5AN7A 1TZ7A 3GHRA 1KCZA 1UQZA 1UIPA 1IIGA 1ZAHA 3ZSSA 3USBA 5G4WA 2CBJA 2G4FA 1GQNA 1XDMA 3WNOA 1JZ6A 1XBXA 5A2AA 1Z42A 4LUTB 4A8LA 3M6YA 3GC2A 3PY2A 1E6NA 3TNBA 4AZBA 4S3EA 5F4WA 3B0YA 4LXFA 1QUMA 3L9CA 7TIMA 4KIRA 3V35A 1OZMA 1D7FA 1XYFA 1R2SA 4RZBA 1XLAA 2PP1A 3AROA 4UCGA 4UUIA 4D6GA 1XYCA 1X1OA 4H6QA 6TIMA 1GOKA 4LRSA 3GNXA 1H5VA 1MDLA 1F5ZA 5CJNA 3CB3A 1EJWC 1XG3A 3UD6A 3GD6A 4NNBA 2Y7EA 3UERA 2VZVA 3STCA 4NL1A 2C3ZA 4N9DA 3J7HA 3AO0A 1OX4B 3HV8A 2WJZA 2XIIA 3AWOA 1HXJA 1H7PA 3SCQA 5B7YA 5AC5A 2ZWYA 7A3HA 5J04A 1IWAA 1A3XA 4MOZA 4ZB5A 2WKGA 1IT8A 1K8XA 2NV9A 2GJXB 4MY8A 2FGBA 4DXXA 4IPJA 1RY0A 3U2CA 3FGCB 1HUVA 3HJZA 1R9YA 4JS3A 4UQAA 4Y8FA 2YIHA 3OP2A 4EWND 1VS1A 3UR8A 4NG3A 2F6XA 3S6DA 1HJSA 1FTXA 2PDYA 4WR3A 2Y61A 1J12A 3FDGA 2O9RA 3NUKA 3FXYA 1BHGA 4JCMA 2FTPA 2QHAA 1R3YA 4I6KA 4L61A 5AZ1A 3EMZA 1RCQA 4GVFA 3RM4A 2XINA 4KKXA 1DJIA 3CQJA 2PEVA 4DBUA 4EKJA 3F5LA 3QSTA 4WJXA 2IPFA 4WSKA 4ORMA 2PBGA 1LRQA 2CWNA 4P7QA 1F8IA 3LI0A 3GY1A 1OG0A 4AY8A 2ZX8A 3EMQA 3MMWA 3LV6A 4JHZA