2EXOA

Crystal structure of the catalytic domain of the beta-1,4-glycanase cex from cellulomonas fimi
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,4-BETA-D-GLYCANASE
publication title Crystal structure of the catalytic domain of the beta-1,4-glycanase cex from Cellulomonas fimi.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase (o-glycosyl)
total genus 129
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2exoA00
4UFHA 4TXEA 2W62A 3LPOA 3WKZA 4BQ5A 5M03A 4Q7NA 1TVPA 1PX4A 9CGTA 1MW0A 4ATDA 1NWTA 1XRVA 3VX0A 3OLGA 2BY1A 4S3JA 3N13A 1BGAA 3ALFA 4AZ5A 4XV0A 5JBEA 4H8HA 2Y24A 5EFDA 4PSPA 2EPOA 1P6WA 1UWTA 4U2YA 5CXPA 2C7FA 3QGVA 3CUHA 3MS8A 4P7OA 3A6OA 3FN9A 1CGTA 3UG5A 1Y7VA 4CVWA 1E4LA 1HP4A 1E3XA 3SUWA 1KBKA 1E9LA 3BSHA 1TCMA 2UY2A 1TA3B 3FAWA 3O2LA 3PZGA 1V3JA 5GNXA 3VX1A 1B3VA 3AQUA 1MQQA 2DPEA 5ABFA 5LA1A 2X8RA 5E9AA 1HVQA 3L4UA 2WVVB 3AHYA 1J18A 3WNOA 4OKDA 1U30A 2OWCA 3ECQA 1UH4A 3CUGA 2W63A 2WVTA 5BRPA 3CMGA 5KZ6A 2O9OA 3GYCA 1JYVA 3OLDA 4UTFA 1H1NA 5HOSA 1ODUA 1NWUA 2F8QA 4H8VA 3VGBA 1PX3A 1E0XA 1XSKA 2YDQA 1QNQA 1JF6A 2CETA 4BQ2A 2AOSA 3CZGA 3THDA 3MV01 4AWEA 1WCGA 1E15A 3GTNA 3PHAA 4GI8A 1JF5A 5CGTA 2WC4A 2EXOA 3MKKA 1JZ5A 1HNYA 2G3MA 1GZJA 2J47A 4AD5A 1UR2A 4PTWA 1FFRA 4J27A 3TONA 3U5UA 1QHZA 1FHDA 3AMKA 4B15A 5BXPA 1V6YA 4JKLA 5DEZA 3MUAA 2Z1KA 1JD7A 1JYXA 2D2OA 3CZKA 1SFSA 3WDPP 4MDPA 3UG3A 4X9YA 4AIOA 1E6QM 2WHJA 2UY4A 2PB1A 3MANA 5A3HA 1DTUA 4OBSA 4AC1X 3WENA 2BY0A 4D6CA 3AIQA 2J8FA 4Q22A 3WNKA 4R5EA 4F79A 1PIFA 2BY3A 2Y8VA 1XSJA 2ZX9A 4H04A 3EDEA 3SCRA 2OSXA 3ZSTA 3AIWA 1RP9A 2DH3A 3VGEA 1FH7A 1UD5A 4UFIA 1E70M 4D6EA 1D7FA 6A3HA 4DWSB 4MJ4A 2G4FA 4CD8A 4UZSA 1OBAA 3ZJ6A 1UD4A 1ZBVA 5LA2A 3IJ7A 2OYKA 4J3WA 1AQ0A 3VMOA 3E1F1 3W82A 1UR9A 3AISA 1JZ2A 2E0PA 2GK1B 1XC6A 1CLXA 4WF7A 1KGWA 1V0KA 1JYNA 2WVUA 4J28A 5F7UA 4IUGA 2Y8KA 4KGLA 3T2PA 3BC9A 2YLAA 2WPGA 3KEHA 1J01A 2VR5A 1ISVA 1GCYA 3EMQA 3OA5A 5I5RA 3WDRA 2VOTA 1GJWA 5IHSA 1OT1A 3A3HA 5EMYA 2WHMA 3MUZ1 2BHYA 5GQBA 2BHUA 4TOQA 1GQIA 5CZKA 1TMQA 2FHBA 4UQBA 1X6LA 1TUXA 3ZJ7A 3ZM8A 2ZUSA 3T2QA 4HOWA 4JAWA 2V5CA 2GFTA 2ZUUA 3BMVA 4U5KA 1V3HA 5A8PA 3WH5A 3PZQA 3SUTA 3WNLA 2D0HA 4FF5A 4AEEA 4IPNB 3WUGA 1EQCA 5JBFA 2VI0A 3A4WA 3L4WA 5A8NA 2E8ZA 4GQRA 1B90A 2VO5A 3PZMA 1TVNA 5DT7A 1GOOA 2OYMA 3AHZA 1Q6DA 2VVNA 1YHTA 4QFUA 4IISA 1WDRA 2GJXB 2YL9A 3CLWA 2WKGA 3VIHA 2A3AA 5BYWA 5TD4A 2WHLA 3I3DA 3ALGA 4WK9A 3G6MA 2E8YA 1HN1A 2AAAA 3GXFA 4P7NA 3SCPA 1W3LA 3AIVA 3D3AA 4Z2GA 1OD8A 2PBGA 4GZEA 1MXGA 4EANA 5A1AA 3VD4A 2XVLA 5E0FA 1ZU8A 2EBNA 3AIEA 1V0NA 2C0HA 5AYIA 1CXEA 3PZVA 2VX4A 1EGZA 2BV9A 1CGUA 3LPPA 4QCFA 5FD0A 1C92A 2VCBA 1E3ZA 4UR9A 3RM4A 1VF8A 3O9NA 3A4XA 3CGTA 4LXFA 2EO7A 4CCEA 1DWFM 1XGZA 2VX7A 1QNSA 4WKFA 1CDGA 4M81A 1UA7A 3N12A 2XM1A 1XD0A 3W6LA 4KH2A 1E5JA 2JEQA 3BAWA 4KWUA 1FH9A 4ACZA 1E0WA 3AZRA 5A6KA 1J10A 4UFJA 4YHGA 2WC3A 3EDKA 1RPKA 5ABFB 1E71M 3F5KA 3DHUA 4CN6A 2G3JA 4JIEA 2WKLA 5I3DA 4ZE5A 3BCDA 2WXDM 1VEOA 3AS3A 3VINA 1V02E 1R87A 3IJ8A 2V3GA 3AIUA 1HJUA 3KWXA 1ECEA 2VR4A 2J25A 3W29A 3NUKA 3GXDA 3VDBA 3UG4A 3ZJ8A 1V6WA 3WQVA 2CNCA 2A3BA 3OB8A 1WZLA 2JEPA 5IDIA 5JIWA 1E40A 4OBRA 1O7AA 1PZ2A 4N0RA 1OB0A 2WMFA 1JDDA 2W67A 2X0HA 2DQXA 3SCOA 3ARQA 4JCMA 1UUQA 2BNJA 3RDKA 3PZOA 1Q6FA 1K9DA 2FH8A 3TOPA 1UWIA 6TAAA 1NP0A 2CXGA 1GW1A 4NZCA 1LL7A 1GHRA 1ZJAA 2FHFA 4PCTA 4EKJA 3WMBA 1WP6A 1HKKA 3K8MA 1QVBA 1M01A 5E70A 4BQ3A 1CZ1A 2WLZA 1C8XA 4PMDA 3WEMA 4MB4A 4W84A 3FW6A 2BXYA 2E4TA 3CZJA 1B9ZA 5JIPA 3AOFA 1MQRA 1UA3A 1GOIA 1E43A 1DWGM 3NJ3A 1LG1A 1OT2A 3M6DA 2WB5A 4HA1A 4W7UA 3QOKA 2WMKA 4CD5A 1QBAA 1E56A 2UY5A 1KXHA 3M07A 4J3SA 2D3NA 2ZXQA 2ZOXA 3L4TA 5C71A 2IXUA 3W0KA 4W88A 2X1IA 1FFQA 3MU7A 4PMUA 4D6HA 2VC9A 2X0YA 3VM7A 3TP4A 1E1FA 4U5IA 1NWRA 1W91A 4ATWA 3POCA 1H3GA 3VIJA 1V3MA 3N15A 1WZAA 2WVSA 4TVDA 1R86A 3U7VA 4QLJA 4L4OA 4W7VA 4AZIA 1C90A 1UYQA 3SCWA 1TFVA 2CCRA 1KFWA 3WEZA 3AS0A 3MO4A 5LA0A 4M1RA 2VZSA 3I3EA 3WF4A 4LPCA 4WKAA 2XFFA 3VVGA 1VFUA 4HZ7A 3NSMA 4P7LA 2XHYA 3M7SA 1L0PA 3B9EA 3VIGA 4C7FA 1OGSA 4M8UA 3VIKA 3FNDA 5E09A 4F9DA 2QPUA 5I6SA 2D22A 4L4PA 1RD6A 2IXVA 1UKTA 4PN2A 4YHEA 5CLTA 1CIUA 2VQTA 1YQ2A 4X0VA 4AYSA 1E4MM 2JIWA 1HIZA 1VFFA 4BQ4A 1ZBCA 3WQ6A 5BRQA 1GOQA 2QPSA 5A94A 3WY1A 4AXNA 3W38A 4AD1A 4D1IA 2BVYA 1OSEA 5I24A 1U2YA 3WELA 1HT6A 1WAWA 1DP0A 1QOXA 2JF7A 4J7RA 1HJSA 2VUYA 2D0FA 1E5NA 2VX5A 2JALA 1V6VA 4GI6A 1ZL1A 4MPKA 1JG9A 4U3AA 3VDAA 4D1JA 2XYLA 2W61A 3WF2A 2J62A 2XFRA 1E6PA 3IANA 1W3HA 3RO8A 3W81A 5BCAA 1DWIM 2GUYA 5A6JA 5ECUA 1H0IA 4MJ2A 5ABHA 3BSGA 1W9XA 2XVPA 2W5FA 2OWWA 1V6XA 1W32A 4YN5A 4UFMA 2PF0A 3VU2A 1Q6GA 3N9KA 4MNKA 1KQYA 3VGFA 2WBKA 5GPRA 1UKPA 2WCSA 3AMCA 1JZ3A 3ZR5A 4PTMA 1W9DM 3S2CA 1W1YA 2J8GA 1W2PA 2ZX5A 1LL4A 2XJ7A 1NM9A 4EAMA 3WH8A 3SCNA 3VIFA 1LF1A 1FP8A 5KEZA 3AYRA 4ZEPA 1UD2A 2QV4A 4AD4A 2W92A 3CZEA 2DIJA 4ZXLA 1B3ZA 1VEMA 1GVIA 1KGUA 3W4RA 1WZKA 1DEDA 1HKJA 1MFVA 4LYPA 3VDCA 4TUFA 1V6UA 3WD0A 4UNIA 3POHA 3BLPX 1EH9A 4PUDA 1ISYA 3WQ5A 4ACZB 1LWHA 4GKLA 1TZ7A 5EFFA 1QW8A 1HJWA 1HXJA 1WE5A 3N11A 4GXPA 4PMOA 1H41A 2CBVA 1OM0A 3IK2A 1LG2A 1PBGA 4TTUA 3DYMA 3GNOA 3WNMA 3SCSA 4PMNA 2PWDA 4R27A 1MWOA 5M17A 4CU8A 3I3BA 1MW1A 5IFPA 1UOKA 3NSNA 3BLKA 3K4DA 1HP5A 2WHKA 1J0ZA 1I1XA 1QPKA 3SUUA 2CBUA 2ZUNA 2Y2WA 3F4VA 4AZBA 2MANA 4F66A 3VPLA 4GQQA 1JDAA 1K9FA 3AIRA 4J3XA 1ZJBA 1GHSA 4J3VA 2CITA 2VURA 1GORA 4Z2JA 3GNRA 1BPLB 3K8KA 4TX6A 1Q6CA 2WZIA 1WDQA 5CSUA 3O6AA 3AS2A 1VAHA 3CZ8A 1V3KA 4JKMA 3GZAA 4KMQA 1JNDA 4QCEA 3WMSA 2XVNA 1DWHM 2DDXA 1ZS2A 4UQAA 4X0NA 3HJEA 3OBAA 4HP5A 3CUJA 1GQLA 5LYRA 2XG9A 3CTTA 2DSKA 4M24A 2PWGA 1C8YA 4D6JA 4D6DA 2PWHA 4WLCA 4QDMA 4P7QA 1J0YA 2YJQA 1CGYA 3F5JA 3EYPA 1Z32X 5D4YA 1K6AA 1KB3A 3ZJKA 4M80A 3B9DA 3A4AA 1GNXA 3MSDA 3CMJA 1E72M 2YDSA 2WZHA 2VJXA 1UWSA 2HVMA 1VENA 4OZOA 4D6FA 1W9VA 1UQYA 4HMEA 4D71A 3EDDA 3CPUA 3GH7A 3PZTA 4NRSA 3SCVA 1BVZA 2ZX8A 5EB8A 1BYCA 2XSBA 2ZX7A 4H7VA 1XCXA 3OZPA 4CD7A 5M3WA 4LYRA 5ABEA 3WL0A 1BQCA 3NYDA 4IM4A 1XH2A 3PTMA 4TTGA 2WMGA 1G01A 3IJ9A 3WH6A 1BHGA 4P8XA 3WF3A 8A3HA 3W6MA 2GJPA 2GJRA 1H5VA 4P8UA 4U2ZA 3ARRA 1E73M 4F8XA 1H11A 3WQ4A 1AVAA 5C70A 1VRXA 1GOMA 2J7GA 2F2HA 4TX8A 2XGIA 4GO9A 4OJYA 1UR4A 2E9LA 5A95A 3FHQA 3SIMA 1QNRA 3QHMA 2CERA 2QHAA 3AXXA 3BAKA 5D8ZA 1VFMA 3PTQA 2CKSA 3DYOA 3CUFA 2DH2A 4JHZA 3VMNA 2G3IA 1ISZA 1UH2A 4W8BA 3AFBA 4XZWA 1JZ4A 1W2VA 1VFOA 1GOWA 1M03A 3NDZA 3ZT5A 4MDOA 1H49A 4JFWA 5AC4A 1CGXA 3W26A 4QLKA 1NWSA 1E4IA 3AIBA 1CLVA 1JXJA 1FH8A 4D6IA 1X1NA 5CLWA 3AI0A 3VIOA 3WBEA 3AXHA 4WIWA 1UKSA 4PMYA 2ZIDA 4EK7A 1KWGA 5DT5A 4AW7A 2EPMX 3WDQA 3SCQA 4OIFA 3HMCA 4LQ1A 2WZEA 4WSJA 4FLSA 1SMAA 5A6AA 4H8UA 4WSKA 1IZKA 3CHEA 5A69A 4RL3A 4HA4A 2IUZA 1F4HA 3G6LA 1QW9A 5A6BD 4AZHA 3N18A 3WEOA 2V3DA 1OGGA 4GINA 3EDJA 4JHOA 2FGLA 1US3A 2VL4A 5GNYA 4HZ6A 3L4VA 3OG2A 3DC0A 5IFTA 3VIIA 3BAJA 2J74A 1TR1A 2YOCA 1JXKA 5CPQA 2WMHA 1ZBKA 4W89A 4DM2A 1UKOA 3II1A 3ZT7A 3N17A 1ITXA 2CEQA 1OGBA 3GDBA 1VB9A 2NSXA 2BS9A 1R85A 1EO5A 1DWJM 5D9MA 1W9PA 3T0DA 2ZX6A 5CPSA 4HPHA 3BAXA 3WL1A 3EDFA 1TA3A 3ARPA 1B0IA 4ZXOA 2EPKX 1J0JA 4V28A 1D2KA 1HL9A 3GBEA 2XVKA 3FXYA 3KL0A 1CXIA 4TVCA 1UH3A 3DYPA 2WCAA 4CD6A 4HU8A 2VMFA 1PX8A 1WPCA 2JE8A 2QMJA 1OCQA 2XIIA 2DSZA 2DGAA 3WUEA 2VQUA 4UOQA 2E3ZA 4GIAA 4UQEA 2WC7A 1E4NA 1G94A 1WO2A 4C7DA 1UWUA 4H41A 2ZXDA 1CXFA 2CIPA 4N42A 4UOJA 4U33A 5AYBA 4WKHA 2XIBA 3WNPA 2WAGA 2EJ1A 3GXMA 1R8LA 2YIHA 3K46A 4A3HA 3U5YA 1UD6A 1Q4NX 4GZJA 2NW0A 3EBVA 5I23A 2VCCA 1UKQA 4XZBA 5D9NA 3W24A 1V03A 1R7AA 3T2OA 4ACYA 4W87A 3U57A 1EHNA 4HOXA 2J78A 3VDHA 3UERA 2VZTA 3U7BA 4MNJA 1J12A 2C8NA 2BXZA 4NSBA 1CXKA 2VNCA 1OWQA 3AXIA 2O9PA 2CPUA 1TG7A 4MB1A 1J9YA 2VRQA 1CECA 1E6NA 4OOUA 3WQ8A 3J7HA 3NDYA 1VBRA 1HJVA 2WWDA 1NQ6A 3WDJA 3THCA 2WM0A 3RCNA 4DUVA 5A6BA 3AHTA 2YL5A 4B3KA 4PCSA 1CXLA 3W28A 2WMJA 2XVGA 2TAAA 1AQMA 3SEPA 4AY1A 6CGTA 2O9RA 2EPNA 1ISXA 3IAPA 4A3YA 1E6ZA 2CBJA 1CGVA 1QHPA 4P7RA 2QLYA 4GI9A 4U3CA 1S46A 3PZIA 1XHGA 4CGTA 1KR0A 2J79A 3PN8A 4KRUA 1KXVA 2DEPA 2JIEA 4RE3A 2NT1A 4A4AA 5HDRA 3W37A 1W1TA 1WB0A 1V02A 1D3CA 4RE4A 3GH5A 1E6XM 3RM9A 2VZUA 2GK1A 4JFTA 4FLQA 3AS1A 2YBUA 3MMDA 5JBDA 5A8QA 3WD1A 1PIGA 2DT2A 1B3XA 2ZE0A 4UFLA 4UCFA 3RILA 2WMIA 4HOZA 1C3FA 1JDCA 5A2CA 1HKMA 4CCCA 3OLEA 1QI5A 1HKIA 3L2LA 3ARSA 2WNWA 3B8SA 4M82A 3AMLA 1WDPA 2J7BA 3ARWA 1NOFA 2GDVA 1W3JA 3OZOA 5DO8A 1N82A 3RM8A 1A47A 2DT1A 4W5ZA 2PWEA 1JZ7A 3WN6A 1FHLA 3VD7A 1PJ9A 2YLLA 1KQZA 4PRWA 1BF2A 2OSYA 1EDQA 1UWQA 3CZLA 3TA9A 5FL0A 4M29A 1AQHA 4LX4A 1CENA 1PZ3A 3SUSA 3W27A 1JAKA 4M56A 1H09A 3VMPA 1KXQA 1EDGA 3WH9A 3OGVA 3S6TA 2J75A 5BWFA 3ARXA 3WD4A 2ZUTA 1BLIA 3VIMA 3K8LA 3BCFA 5GNZA 4AIUA 3CBWA 5HPCA 2YDRA 4GPNA 1KCKA 1HX0A 3PZNA 3ZQ9A 4JFSA 4PYSA 4PTXA 4PUEA 5I0DA 3AMDA 3WBAA 1BGGA 4UQ9A 4AZCA 3BAIA 1QI4A 1OINA 2WSPA 2VRKA 3WH7A 3TTOA 4EE9A 4CUCA 1GQKA 2V38A 2PC8A 4QAWA 3T0AA 5AY7A 3KL5A 3ARZA 2XPKA 4YPJA 4BCEA 1J11A 3L4ZA 2RGLA 3ZT6A 4Y7EA 1QI0A 2VCAA 2HISA 3AHVA 4WJXA 2D23A 4AISA 2VZVA 1GONA 1V0MA 4CU7A 3WF1A 1JI1A 4HTYA 4ML4A 4XX6A 2X2YA 1EOKA 1XV8A 3OIHA 4D6GA 2E40A 4ZFMA 3EMCA 1BAGA 2PI6A 4CU6A 1LJYA 8CGTA 2BFGA 2GVYA 4BA0A 1TE1A 5D8WA 4ATLA 4KRTA 3D5HA 5DF0A 2EPLX 1W9BM 4PSRA 2DT0A 1MXDA 5CJ5A 4Z2KA 2XGBA 1K9TA 3ZIZA 1WZMA 2CESA 2V5DA 1KXTA 4JZ5A 2GDUA 3UESA 5A6SA 4MB5A 5FOOA 1CGWA 3WIJA 1IZJA 2VVSA 4OOZA 2VZOA 4DM1A 2ZXAA 2E9BA 3L4YA 4E2OA 1MVYA 5CSYA 4AD0A 3GH4A 4PMZA 1HVXA 4E8DA 1EO7A 2VRJA 1WNOA 1UR8A 1QI2A 1E6SM 1KCLA 5A2BA 1GPFA 4PEEA 4NF7A 1SR0A 2WWCA 4MAZA 1BG4A 1GQJA 5BXTA 1C93A 3JUGA 1E1EA 1UHVA 1BTCA 1BVNP 1Q6EA 3UEQA 2OYLA 2D20A 5BXSA 2Y5EA 3APGA 2YL6A 4CVUA 1ZB5A 2YA2A 2VTFA 4AIEA 1JL8A 2XWEA 3K1DA 4MNLA 2EQDA 2BY2A 1J0KA 2D3LA 2VX6A 4PMVA 1LL6A 4P8VA 3AICA 1OIFA 5CPTA 1PEZA 2J7EA 1QNPA 1SMDA 4UZUA 1IV8A 2J7CA 1O6IA 2FGZA 4BZYA 2FDMA 3M46A 4BF7A 2WYSA 4XUYA 1UR0A 1OIMA 1XYZA 2XM2A 1MQPA 3WDHA 3VD9A 4UQDA 3NCOA 2DIEA 4P8WA 2CBIA 4UQCA 1B30A 5HPOA 2V3FA 2FH6A 3LMYA 1EDTA 1EIBA 1LWJA 3QOMA 1E55A 1V08A 5BXRA 3DHPA 3WDIA 1XSIA 3CUIA 1HJQA 2G41A 2XTKA 3MMUA 3RIKA 1MYRA 3GM8A 3TTYA 5CQ1A 4AD3A 4MADA 2CYGA 2YBTA 2X05A 3TTQA 3T08A 2D0GA 3PZ9A 2XSAA 1JD9A 5D9PA 5DMYA 4XB3A 2YKKA 1I75A 3MUIA 1LLOA 2A3CA 2BHZA 4UFKA 4W86A 2Q8XA 2JFEX 3VNZA 2UWFA 1BFNA 4IPLA 2JF6A 2F61A 1MFUA 5HNNA 3BAYA 2BVDA 3CHFA 3L2MA 2WK2A 1UZ4A 3VGGA 4PBGA 4FLRA 1L8NA 4JKKA 2WMIB 5CGMA 2DSUA 3T09A 4W93A 3KE0A 5I77A 3ZR6A 2WW5A 3T0BA 4LYQA 3EMZA 1KR1A 4UOZA 5FL1A 3CIVA 1VJSA 4NRRA 3N04A 2XUCA 5A8OA 3SCTA 3N1AA 1K9EA 1CBGA 4W7WA 3WUFA 2G3NA 1GJUA 4AEFA 1X6NA 3CHCA 2O92A 3AZSA 3OGRA 2ZWYA 1GUVA 4OUEA 3VOCA 2CKRA 3ZO9A 3W53A 4MTVA 5C8BB 2BVTA 1A3HA 3BXWA 3WMCA 3AMGA 1JZ8A 1FP9A 3AZTA 1AMYA 3WD3A 4GZIA 4BS0A 2WCGA 1JFHA 2EEXA 1ITCA 3OGSA 4DUWA 1UR1A 2QF8A 3VNYA 1HJXA 2PWFA 2DT3A 1J0IA 4TVUA 3VO0A 1I1WA 2Y4SA 5A6LA 7CGTA 5I2UA 3PBGA 1NP2A 1H4PA 1B2YA 3VGHA 1VBUA 2QMKA 3OLIA 1G5AA 3B9AA 1BYAA 2AMGA 3ARYA 1CWYA 3PTKA 4PMQA 5DFAA 1B3WA 3SUVA 1QHOA 2Z1SA 5HBFA 5BROA 1M7XA 1JFXA 1QNOA 5A2AA 3NIYA 4S3KA 3BGAA 1E0VA 4JL1A 4NI3A 1PPIA 4RE2A 4AZCB 1GVYA 1UD3A 3AROA 4Z2HA 4PTVA 3SURA 3QHOA 1ODZA 3WF0A 4Z2IA 2WLYA 1C91A 1FA2A 5HXMA 1RP8A 1CNVA 3NSXA 3WSUA 4JL2A 3FY1A 1H2JA 3RJXA 1MW2A 1B1YA 5EBAA 3MUY1 1G0CA 1XH0A 3AYSA 1J0HA 2VT0A 4DWSD 4DUXA 1MW3A 1ESWA 2CHOA 2O9TA 2RGMA 1NOWA 4GO8A 4HMCA 1EOMA 1JGIA 1CTNA 3WQWA 2OLHA 3UCQA 4HZ8A 4V27A 4QP0A 1FOBA 3VKKA 1LQ0A 5IHRA 2X09A 3GNPA 4PMXA 3QHNA 3VGDA 1KGXA 2PBOA 4U31A 1U33A 1C7SA 4QLLA 2WVVA 5I78A 1QBBA 3KL3A 2ZWZA 2DSVA 3CHDA 4FK9A 4JFUA 3WD2A 4B3LA 2DSWA 3FAXA 4W8LA 5AC5A 2W91A 4CKQA 2WSKA 2J4GA 4C7GA 4J3TA 4AMCA 3UR7A 1VIWA 4HPGA 4W5UA 3KZSA 2ZUWA 2YA1A 4PMRA 3RJYA 3FHAA 2ZUVA 1F4AA 4URIA 3GBDA 1BYDA 4CN1A 7A3HA 1JYWA 1B3YA 1BG9A 1R7OA 3ARVA 4W8AA 3F5LA 2E9MA 3RMEA 2FHCA 5E6YA 1XYFA 1XH1A 1CPUA 3GXIA 4HU0A 1WKYA 1JAEA 3UR8A 1GOKA 3HN3A 2GSJA 4HA3A 1KWKA 4E4PA 1DHKA 4DWSC 3SCUA 3VD3A 1W3KA 1C8QA 1ZBWA 1UWRA 2XFYA 2WANA 4Z2LA 4AZ6A 4LGXA 5FIPA 2WBGA 4E8CA 1KBBA 3LPFA 3WUBA 2B31A 1JNEA 1M04A 3RPMA 3DECA 1EHAA 4MNMA 1CXHA 3VTRA 1V0LA 4K68A 3CH9A 2J7FA 3WNNA 1BYBA 3IAQA 2A3EA 2W66A 3WFLA 1V3LA 5E6ZA 1CYGA 4F9JA 2YL8A 3ARUA 3A47A 1US2A 1W1VA 1NOUA 1UZ1A 4AD2A 3VD5A 2W4XA 1BSIA 1G9HA 4ZENA 2J7HA 4DWSA 1OD0A 5IXEA 3K4AA 4FLOA 1VEPA 1G1YA 4W85A 2YA0A 1WDSA 1JZ6A 4MB3A 1HF6A 1HL8A 5FCZA 1XCWA 5E0CA 4H2CA 3ZOAA 5CG0A 1EA9C 5D9OA 3VIPA 1M53A 3PZUA 5FKYA 2XWDA 5M5DA 1EQPA 3VM5A 2ZXBA 1IT0A 2A3HA 4B16A 1SYTA 2D1ZA 1V3IA 1EXPA 4D72A 1NARA 4CD4A 4FMVA 3VUPA 3BH4A 4MAVA 1PAMA 1DWAM 3CO4A 4HMDA 3QR3A 1E6RA 4KGJA 1VJZA 4J3UA 4ZE4A 3MSGA 1W1PA 4JFVA 3UETA 5I79A 2ZUMA 3BMWA 4V2XA 2ESCA 1W9UA 2OWXA 1JIBA 5JUVA 3MMWA 2J77A 1C7TA 3WFZA 4B9ZA 7TAAA 4AZ7A 1UG6A 1CEOA 5A8MA 1UD8A 3L4XA 1H0GA 3ZSSA 2UY3A 3HU7A 5ABGA 3ARTA 2ZICA 3LPGA 1QI3A 2V3EA 4CCDA 1RH9A 2J7DA 2D24A 2CHNA 1UQZA 3MV11 1XD1A 3AHXA 2NT0A 5A6MA 2OSWA 3AJ7A 4JCLA 3TTSA 1ISWA 2GJXA 4B9YA 2G8ZA 4CN4A 1NH6A 3ZMRA 3W25A 1JI2A 1B31A 4AZGA 3VILA
chains in the Genus database with same CATH superfamily
3GW3A 4UFHA 1EZWA 4TXEA 3BLDA 3A22A 1TPFA 3VOJA 3WKZA 3BG9A 3EB3A 3KWSA 1KRAC 9CGTA 4QR6A 4PODA 3A24A 1NWTA 2OKTA 3OLGA 4GH1A 4NIRA 3TJ4A 4A35A 2PD9A 1YDOA 2PDIA 2FJUB 5EFDA 2QUTA 2EG8A 4ZOBA 4GUJA 2J13A 4WY0F 2QCHA 3QGVA 1GG1A 4F2TA 1FWNA 1QT1A 1I2OA 2ZC8A 1N8FA 2BBFA 3NNTA 2PDGA 1KBKA 1E9LA 3O2LA 3VX1A 1TIWA 1EF2A 5E9AA 3S2JA 2X1UA 2YDAA 5H1WA 3RPTA 1U30A 3CUGA 1XLBA 1DHPA 3LHWA 4PL2A 4QJ1A 2J66A 5KZ6A 3OZYA 1XYMA 3H4GA 2ATSA 3KTSA 1Q6LA 1TO3A 4LUJA 1R3QA 1TMHA 1VFHA 2QVHA 2QDHA 1PX3A 1GKQA 2OEJA 3UA3A 4H19A 1GVEA 1OG0A 2VDGA 4LUTB 2CETA 4RPQA 1GQNA 3MV01 5AOUA 1IT7A 5K7JA 3LB0A 5A8GA 4YCPA 4JEQA 2F6XA 1MI3A 3MBFA 3OZMA 3DIPA 1TQJA 1FHDA 4B15A 5D09A 1VPQA 1S2AA 1UJQA 3STPA 3MUAA 2Z1KA 1JYXA 5AECA 4FX7A 4BI7A 3WDPP 3SR7A 4MDPA 4ZL1A 4X9YA 3BLEA 2UY4A 2PB1A 1A0EA 2X16A 4YCOA 2BY0A 2J8FA 4DEFA 1ZTVA 4R5EA 4LBRA 2Y8VA 4JEJA 3RCYA 3CV1A 4ES4A 1RP9A 1PHWA 3B8IA 4QXIA 4D6EA 3LDVA 4YJ5A 3T8LA 4F0RA 3GD6A 4UZSA 3I6TA 4IFOA 1I0DA 3ZJ6A 3KVMA 1QTWA 3IJ7A 1OYCA 4EPKA 2C14A 3GX9A 4KEMA 2A7RA 3SN0A 3TYUA 3GR8A 5KTLA 3FA4A 2GK1B 3W7HA 2IPFA 1CLXA 4WF7A 1V0KA 3NQ6A 3QH2A 4J28A 3KOWA 1JUEA 2Y8KA 3BC9A 1K8YA 2YLAA 1J01A 2VR5A 4PULA 4UTWA 4DLFA 3BOXA 2VOTA 3KRZA 3NEHA 5IHSA 5GQBA 2BHUA 1JCTA 2DZTA 2OEKA 5K9XA 1TMQA 5BMXA 2FHBA 3GFYA 3A4JA 2XGZA 4MZYA 4GVHA 4MHBA 3T42A 2PGFA 3LXAA 4Q4PA 3P5ZA 4AX6A 3ENLA 2ZUUA 1Q7QA 5H8MA 4QX4A 1V3HA 3WH5A 1D8WA 3SUTA 2H90A 3ZVIA 2OQHA 4MKNA 1EQCA 5JBFA 2OPJA 1J96A 2RDUA 1JCYA 3L4WA 3L9CA 5A8NA 1LM1A 1DJIA 5DT7A 4HBKA 2VVNA 5T26A 1YHTA 2I5IA 4QFUA 2YL9A 1UZHA 2WKGA 3ABSA 3QC0A 2WM1A 1K1DA 1ICSA 2WHLA 1B4EA 3I3DA 3ALGA 4PTDA 4WK9A 5EYWA 2E8YA 1HN1A 3AALA 4RKAA 3GXFA 4P7NA 4LT9A 2HNHA 3D3AA 1RZMA 5DANA 3W7PA 2ZKMX 3LHYA 2PBGA 4GZEA 1POJA 4XZMX 3NO3A 5LIWX 3MVTA 1FWWA 1DKWA 1ZU8A 2EBNA 3SQSA 3U2EA 5HULA 1EGZA 3C2YA 1CGUA 3UU0A 5FD0A 1C92A 1U1UA 5IBXA 3RM4A 1VF8A 3O9NA 2OKOA 2ZZ6A 4LXFA 4RXFA 3S6OA 4G5DA 3C2RA 3W6LA 1Q7ZA 4KH2A 3KRSA 3PSVA 4KWUA 1XLDA 4I9TA 3TFXA 1T8QA 6ENLA 1RPKA 1E71M 3QZ6A 2YFNA 5F4WA 4R88A 2O7QA 2VEMA 3NQFA 4EPEC 3VNDA 4TV5A 3LI1A 4LY4A 1A5OC 5EPDA 1KTNA 3HM7A 1IEXA 3KWXA 1RALA 1BXCA 4DJFC 2PDHA 3GXDA 2FVKA 3ZJ8A 3WQVA 2QXWA 3E2QA 4WQ6A 5SWUA 3W6YA 1XLIA 1E40A 4EOUA 4C6IA 1QOQA 1UUQA 2FH8A 1UWIA 1NP0A 4H9ZA 4JQ2A 4LS1A 1GW1A 1MRQA 2AL1A 2OTDA 3APYA 1PO9A 1XGEA 3HGJA 4EF8A 1A5SA 4ZZ9A 2FHFA 5LNVA 3V0SA 4PCTA 3R11A 3UBPC 3ITOA 1WP6A 1OFDA 1M01A 3BPWA 3MUCA 3FW6A 2BXYA 3HV9A 5JIPA 5FJJA 3G24A 4DJED 3O0FA 1GEHA 1MRAA 5C2GA 4CQ8A 2WMKA 3GXPA 4JIRA 4A3RA 2ACQA 8XIMA 2UY5A 1KXHA 3M07A 2D3NA 4W88A 2X1IA 3V18A 1FFQA 3URQA 2VC9A 1L6WA 5LHEA 1E1FA 4Q8MA 3PP7A 1DJXA 2ZDSA 1W91A 3WLLA 1WAUA 1H3GA 3UPBA 2CZEA 3EOOA 4L4OA 5D2XA 1TTJA 4HQVA 3RMJA 1PKLA 4YWIA 2QDDA 3V1HA 3VDGA 4OQVA 3NSMA 1SR9A 3M47A 4C6NA 1OFOA 1IXQA 3MZ2A 3FNDA 2R24A 4ML9A 3CWOX 1W1ZA 4F9DA 1A5MC 4XZHA 3V5FA 3H7VA 4L4PA 4PN2A 3E2SA 3N4FA 4B2DA 2DVUA 3TW7A 1HIZA 3BLLA 1VFFA 2E6FA 4PUUA 3WQ6A 1WXZA 5BRQA 4Z08A 1GOQA 2BDQA 3W38A 4AD1A 4KBXA 3ATZA 4UTJA 2I5GA 2BVYA 1OSEA 3F2DA 1PL9A 1HT6A 3UY8A 2V2HA 3DBPA 4DI9A 4J7RA 5C9ZA 2D0FA 1FWHC 5E0KA 2JALA 1V6VA 3KRUA 4D1JA 1JG9A 3H26A 2W27A 2Y70A 3WF2A 1ICPA 2J62A 1KBLA 2IKHA 3KTCA 1P0BA 3V36A 3O6YX 5BCAA 3B4YA 1K7XA 2OFJA 5ECUA 4MJ2A 1KBJA 3TVAA 3W1RA 2W5FA 1V6XA 3VU2A 2AMXA 3N9KA 2Y61A 4O11A 3UT0A 3RXZA 3UVAA 3BQ6A 1J4EA 3LTSA 3HPXA 4UUIA 1JZ3A 1TPH1 4PTMA 1Z44A 1FXQA 3S2CA 1W1YA 1KRBC 1OYAA 2ZX5A 1U5JA 1NM9A 2VFGA 4XD3A 2B4GA 3UF9A 1NY1A 4Q33A 5K3VA 3VIFA 3FJ4A 2HV5A 3UP8A 3B8WA 3IV8A 3GVRA 3P3BA 1EC9A 3IWPA 4ORMA 4O0ZA 3P14A 4BHYA 4D8LA 1X38A 1VEMA 4UTTA 1GVIA 2PTDA 1GYLA 3U6WA 3QF0A 4QBXA 4N9BA 1XIEA 5TQLA 1V6UA 3LCIA 2FYMA 5AHNA 4S3DA 1F8IA 3BLPX 4PUDA 1OHLA 4XD6A 5EFFA 2DZSA 3NO1A 4GXPA 1UUOA 1SZRA 4LS0A 4Y8EA 4QG9A 1DPMA 2Z1XA 4IGMA 3URBA 1OM0A 1XUUA 5DBTA 3N14A 1AUSL 4TTUA 3WNMA 3PB0A 3SCSA 1YDVA 2PWDA 4CU8A 1MW1A 5FJIA 3U4AA 5D2TA 3N73A 5GJPA 1T0OA 4BI6A 2MANA 4GQQA 2JKEA 1JDAA 3DG7A 3AIRA 4C6CA 2HS8A 4FOKA 4J3VA 1Y8BA 4Z2JA 1GORA 5J5DA 1BPLB 1TV3A 4HNNA 2VM8A 1WDQA 3BGGA 3AS2A 4KFNA 3TAKA 4DXVA 4Y9MA 3ITCA 4ZB5A 3MKVA 1U5VA 2XVNA 3W3OA 1QWGA 1TRIA 3BANA 4X0NA 1Y5VA 3OBAA 4HP5A 1T6MA 3CUJA 4UNLA 4L56A 5JU6A 1TR9A 3GVWA 3MDWA 2PGWA 2DSKA 2P8CA 3MW7A 4IIHA 2PC4A 3KXQA 2PWHA 4WLCA 4QDMA 4F0KA 3MDUA 1CGYA 4J9JA 3R0KA 1A5LC 3B0XA 1K6AA 5DMMA 5XIMA 3IGHX 3TN5A 3CMJA 1F3EA 3R94A 2YDSA 2HVMA 4OZOA 5FJOA 2RDWA 4HMEA 1M6JA 4QHRA 3QVQA 3NXFA 5CPOA 3L2IA 1DXIA 4H9TA 2GWNA 1BVZA 3WCZA 4GYPC 5LNRA 1PV8A 3BWWA 1TTIA 3Q37A 3CUXA 4DO6A 2Z29A 1XCXA 1OG6A 4PUWA 1MUWA 4CD7A 4EX4A 2Y63A 1IEIA 4V33A 1BQCA 4MKSA 1XH2A 2WMGA 3C56A 3KS5A 3W7LA 4IIFA 3NQEA 1BHGA 1XQLA 4LRTA 1KFLA 2OMAA 2IPGA 2E67A 4AMAA 2JQXA 3EOUA 2FB3A 5HJYA 1EJUC 1ZY9A 3WQ4A 2PDUA 1EPXA 5C70A 3LN3A 3KVJA 3W2JA 1GOMA 1OF6A 2PP0A 2P1FA 2E9LA 5A95A 3IUHA 3FHQA 1DJHA 3GKAA 2IW0A 4PMJA 3WLKX 3UWWA 3S4TA 4QE4A 4Y6GA 3EKGA 3FYPA 5EMJA 3PTQA 5G4HC 2NLYA 3GHUA 3UWYA 4E6MA 1LDCA 3AXMA 2YCJA 4O53A 4M51A 1TJPA 2AAMA 4NZ3A 1UH2A 1LP6A 4O1EA 3AFBA 1XPYA 1ONWA 3NDZA 4MDOA 1ADDA 3WJWA 1Y5XA 1QK0A 3RU8X 3W26A 1X7IA 3WBEA 3AXHA 2D2JA 1I2NA 3TWBA 2ZIDA 2GQ3A 3L67A 1WA3A 3UZXA 4C6DA 1JEZA 3GR7A 1S3TC 2YGYA 1W5PA 1NJJA 1JGMA 1Q3NA 3CHEA 4LAZA 3W7IA 4MPQA 4RL3A 1YE6A 3PPGA 1F4HA 3IPWA 1QW9A 4I6VA 5A6BD 4E5TA 3JW7A 4GKTA 3EDJA 3CYJA 3UJRA 1US3A 2VL4A 4DAIA 2JGQA 3OG2A 3DC0A 3SJ3A 3WK0A 2INZA 1OCNA 3BLFA 4EAYA 5CPQA 3P0XA 1ZBKA 4DJDA 1DL3A 5KZMA 2Q02A 1B4KA 2PDKA 3QV9A 3LLDA 5AYZA 5I3HA 3TJIA 3TJXA 4X3ZA 4MWAA 2ZA1A 4IJRA 4A05A 2PFHA 1VB9A 2AKMA 1O94A 3NZQA 3LENA 1NDVA 1Z69A 3AYVA 1W9PA 2ZX6A 3IJLA 4LVDA 1AW2A 3P82A 5DY2A 3KAOA 2BOGX 5I03A 2VOMA 3FXYA 4ERAA 3GDRA 3N2BA 3L66A 1WXYA 1AODA 3ZLFA 3DFOA 2DGAA 2E3ZA 2WC7A 4AIBA 2DZVA 2E1DA 1WX0A 2HQAA 4GY7A 3M6YA 4N42A 3PUDA 4IG2A 3RG6A 1KNWA 4GX8A 4IJCA 4NP7A 4WKHA 2HXTA 4S2CA 3BQ5A 3IVUA 4S3EA 2WQPA 2R6OA 3Q4DA 2QCFA 4A3HA 4DZ5A 3WBYA 2HZGA 3NEVA 4WOQA 3B04A 2ZZ1A 2J9YA 4XVDA 3T07A 3W24A 1V03A 4W87A 3DCPA 1NDZA 2I56A 3B0PA 3UERA 3U7BA 1J12A 3EWXA 4C6PA 4E4UA 4N4QA 1OFQA 2OX4A 3KLKA 2Y7EA 3DGRA 2NXGA 3EWUA 2O9PA 2CPUA 5GJNA 4MB1A 1J9YA 2CZ5A 1E6NA 3E6EA 1VBRA 1NQ6A 3NOEA 2Z0IA 1P6BA 1EX1A 9XIMA 4B3KA 4FR1A 4MSSA 3PJUA 2WMJA 2XVGA 2YW4A 1AQMA 5HR7A 3SEPA 4AY1A 6CGTA 2HK1A 2EPNA 4HKPA 4M3PA 4ZB0A 3EOEA 4Z1DA 4GNVA 4OFCA 3S1GA 1EJTC 1KXVA 4XQ6A 1K8XA 4EWND 1YBQA 3W37A 2EGZA 4XBKA 1TREA 4JNMA 1WB0A 4YVXA 2VZUA 4GUFA 4GQ0A 1EJWC 2P0IA 5DX7A 1E0UA 3LNPA 4UCFA 5AC7A 2WMIA 4HCHA 1JDCA 2OELA 2WNQA 5FACA 3RU6A 4FS9A 1TPC1 1MEWA 3ARWA 3V5CA 4S39A 3OZOA 2Q71A 1WOAA 3S5SA 3E0VA 4RLIA 2DT1A 3CXOA 1CB2A 4C6BA 3WN6A 1ONXA 4JTSA 1XJBA 1PJ9A 4LVGA 4GXWA 3ABRA 3SGZA 3CZLA 1Q7MA 5H6HA 3P74A 5G2WA 1CENA 1ZAJA 5LKYA 2P53A 4YIWA 1JAKA 3QJAA 5HANA 1KXQA 1SZGA 3QW4B 1VLWA 1GPWA 4ZTXA 1RBOB 3K8LA 1H1ZA 5GNZA 4H3DA 2CWNA 4MJMA 5T8GA 1KCKA 3VUSA 2Q09A 4OT7A 1KFBA 1TYGA 3HV8A 1PUDA 3NPUA 1P4CA 4PUEA 1BGGA 1TX0A 3W88A 2WSPA 3VOIA 3P81A 1KFKA 3QZAA 3WH7A 3TTOA 1ZALA 2YZRA 3VI2A 3N9SA 1HFBA 2PC8A 4QAWA 4GNKB 4N7QA 3KOYA 5CJMA 3ARZA 4BCEA 4B5TA 3HBLA 3L4ZA 1XISA 2DORA 2VCAA 2D23A 4MWAB 1FCUA 3GWQA 3UPMA 1JI1A 1U22A 4ML4A 3ERPA 4A3UA 2Y88A 2WJFA 3P2VA 2VWSA 2E40A 3GC2A 2WZTA 4H6RA 4ZFMA 1LJYA 4UNKA 5KZEA 2BFGA 2GVYA 3E02A 3D5HA 5DF0A 2DT0A 3R43A 4KF1A 5AHIA 1KXTA 2E77A 3E5PA 4MB5A 1CGWA 4ZSTA 1IZJA 2VZOA 3STCA 4XO6A 1P7TA 2H9AA 3C3NA 2E1WA 3L4YA 3GFZA 2GOUA 5K9CA 2QUVA 4XK2A 3PULA 4AD0A 3BZGA 3IV3A 4IG2B 4UMCA 1UR8A 5CGQA 3B8TA 5A2BA 1GPFA 1SR0A 1Z48A 3GUWA 1C93A 1XINA 3HIJA 3N6HA 1BVNP 1TKKA 3B0VC 2OYLA 5I09A 1DIKA 2YL6A 4CVUA 5EMUA 1HKVA 1ZB5A 2YA2A 3MP4A 4H1ZA 2EQDA 3KOXA 4P8VA 2NQJA 5HQEA 2J88A 1IV8A 4F3HA 2FKPA 2FDMA 4ZO7A 3DFNA 3ZS4A 1UR0A 4X9SA 4KFPA 3WQGA 4UQDA 3BLIA 4JYEA 5J8LA 4UQCA 5HPOA 1ZLPA 2QJNA 4TIMA 2X40A 1EIBA 1LWJA 1RA5A 3LQGA 1GT8A 5BXRA 3CUIA 1GVOA 3MMUA 2WOQA 4NZ5A 3TIMA 3TTYA 3EXSA 3W84A 3UJSA 2X05A 3T08A 2HE5A 3BE7A 2R8WA 1NSJA 5D9PA 3CS2A 3TXVA 1UIPA 1LLOA 2QUUA 2Q8XA 4F4RA 1BFNA 4O18A 3TAOA 2V2DA 3WBXA 1AW5A 2JF6A 5HUOA 1BKSA 3BAYA 4GX9A 3CV6A 3KM8A 4FEZA 5L9FA 4GFSA 1UZ4A 3PJTA 2V5BA 2C91A 1LROA 1UMYA 3NR0A 4UTHA 2WMIB 2I9EA 3T09A 2O56A 1ZNNA 4W93A 5I77A 3VKBA 1OQFA 1G4TA 1AG1O 4UOZA 1KR1A 1A49A 3CIVA 4NRRA 1JRBA 5A8OA 1DQUA 3WUFA 1K9EA 3ZLHA 1P48A 3H4WA 2G3NA 4P61A 1GJUA 1X6NA 3CHCA 1IXNA 4J2PA 2O92A 3LGGA 3CL7A 4DYJA 1GUVA 4OUEA 4MJZA 3ZO9A 3W53A 1PVNA 4WX2A 1J5SA 1T40A 4ALDA 2G50A 3THQA 3UJFA 1NTHA 4YU1A 2WCGA 3B06A 2QF8A 5LHFA 2B7OA 3HG2A 3M5XA 4ZO9A 3TEVA 3FYYA 2GQ9A 3W2UA 1J0IA 3VO0A 4F0LA 2P50A 5I2UA 3M41A 4Q7IA 2QMKA 3TZNA 2AQWA 2LLEA 3ARYA 2P76A 5DFAA 4OV4A 1M7XA 2BOFX 3HPFA 1QNOA 1SO6A 1PPIA 4RE2A 4YYFA 3OA3A 4Z2HA 3GTXA 1QWKA 4LEFA 1W17A 2WLYA 1FA2A 1RR2A 3NSXA 2OXNA 1PTAA 3S42A 1XWYA 4A8RA 2ZRWA 2ZRZA 3QY7A 3TFCA 2QPXA 3AYSA 4DUXA 1F3XA 4R7WA 2CHOA 4Z42C 3RLHA 3W75A 3M64A 3S1XA 1DV7A 3CB3A 3WQWA 3UCQA 4HZ8A 1SO5A 3RR1A 1W1B1 4AVOA 1LQ0A 1LLWA 1V51A 5IHRA 3C0LA 1XYLA 2OB3A 1YNYA 2PBOA 1GWJA 1ZJHA 4AX7A 1AMKA 1KCZA 4H6EA 2QCCA 2DSVA 1JR1A 2REQA 1K3UA 5KINA 2QCGA 1LQ2A 2DSWA 4W8LA 2W91A 1XP3A 3AC0A 2J4GA 4C7GA 1A5CA 2XFWA 3UR7A 4C6FA 2ABAA 1S2VA 2ZUWA 4IFRA 4JTCA 1P7TB 3RJYA 2ZUVA 1MEIA 3N2MA 4RJEA 1JYWA 3F2BA 4LEQA 3AWNA 3F5LA 3RMEA 1ENUA 5E6YA 3NQ7A 4GBUA 5HAOA 4GY1A 3WQCA 3M0HA 2DU2A 3UR8A 1UOZA 4FB7A 3PFRA 3TSBA 3V0TA 4YS1A 3SCUA 1SZEA 5CC6A 3DESA 3F4CA 2VENA 4OECA 5EMMA 2PRMA 3BGJA 1UWRA 2XFYA 3SDOA 4U4MA 4LGXA 3GDKA 4E8CA 1J8VA 4YTRA 4JN6A 1TWZA 1EHAA 3CPGA 3IEBA 1S5VA 1CXHA 4K68A 2OZ3A 2AKZA 3HPAA 3BK0A 3CH9A 2H8XA 3G18A 2AL2A 3KBJA 4NNAA 1O4UA 1XYAA 2W66A 3LU2A 4NNCA 1VBGA 3ANVA 3LZ3A 3B8DA 2QCEA 3H53A 2YL8A 3R89A 1US2A 1W1VA 3GZ3A 2YPIA 3W1TA 4DWSA 1OD0A 3D3FA 5IXEA 3K4AA 4W85A 8TIMA 2C15A 4RDWA 4RNIA 1HF6A 2QGHA 5HWJA 1X97A 3O6CA 5HNUA 4H2CA 1EA9C 1JPDX 5D9OA 3OODA 1XRFA 1FKWA 2FTWA 4GWEA 5FKYA 2XWDA 2OLAA 3PPFA 5C7VA 3H6OA 3H2EA 1DTNA 1WBHA 1V3IA 1XFBA 4I5RA 3TR2A 1NARA 3SY5A 4MF4A 3MMTA 2WJZA 1MZRA 1DWAM 3PBWA 1EL3A 2HROA 1E6RA 2PDCA 5HNRA 3VKCA 4I3GA 4JFVA 2QCNA 2EAWA 1J6PA 4RDYA 1NEYA 1UPMB 2P3EA 2ESCA 1W9UA 3W71A 4IPIA 5XINA 3MMWA 3LHUA 3BMXA 1JVNA 3PY2A 3GG7A 1IE7C 3E0WA 4B9ZA 1S2CA 7TAAA 3USZA 4MFEA 4H01A 1LT8A 1VYRA 3L4XA 1H0GA 3SY8A 3G1XA 5ABGA 2ZICA 5BOFA 3UFYA 4I5UA 3MVIA 4GISA 3HPZA 1KKOA 1IIHA 1RH9A 3L65A 3GW0A 1IWAA 3MV11 4I9JA 2NT0A 2Z27A 4CNPA 3TJLA 1ISWA 4WDUA 3ZMRA 4GACA 1JI2A 1AJZA 4C1LA 1SU5A 2W62A 1AD1A 1OX4A 3LPOA 4F40A 4BQ5A 5M03A 1O1ZA 4QG8A 2FLIA 2Z25A 3T1GA 4A3QA 1PX4A 3E9AA 1MW0A 1LRQA 4S3JA 1PDYA 4H8HA 2Y24A 1YIXA 2H8ZA 4PSPA 1EKOA 2EPOA 3LRKA 2R94A 4U2YA 1GZGA 4AY8A 4S23A 2F2KA 5CXPA 4C91A 3MS8A 3FN9A 4NI8A 4DY1A 3GNNA 1CGTA 3UG5A 3C8NA 3AU2A 4Z1YA 1HP4A 3SUWA 5AKQA 1TA3B 3K13A 5GNXA 4FNUA 1B3VA 1M68A 5K9DA 2X8RA 3VCCA 1HVQA 1TB3A 2Y0FA 3L4UA 1X8CA 1J18A 1KW1A 3OYXA 1Z42A 2UV8G 5CH9A 3WNOA 1ZHAA 2PS2A 2REQB 3PPCA 4NKCA 4PBEA 1RXOB 2SFPA 1VBHA 3MB9A 2YXOA 2W63A 1O12A 5FEPA 1IGSA 1G6CA 3QEZA 4AF0A 3GYCA 3OLDA 1M7PA 4UTFA 1Q8JA 1H1NA 1ODUA 1NWUA 2F8QA 4H8VA 1QCWA 5D38A 4XBJA 1XSKA 1L6SA 4DF0A 3W23A 2AOSA 3CZGA 3THDA 4QIUA 4AWEA 3GTNA 2TYSA 3PHAA 1JF5A 3MKKA 1JZ5A 1HNYA 2XU2A 2J47A 1UR2A 3M0MA 4PTWA 1IWPA 4J27A 4ZQCA 3U5UA 3AMKA 3R5EA 4ZBCA 3CZKA 1PWLA 4IPJA 3UG3A 3BO9A 1THFD 1E6QM 2WHJA 3CAKA 1XCFA 4LH8A 1JCMP 1DTUA 3WENA 1XGDA 2PGEA 2AL2B 3WNKA 3S1VA 2OODA 4UTWC 2ZX9A 2J24A 4F2UA 3FDKA 4PUNA 2OSXA 2OZ0A 3ZSTA 1AH4A 3O63A 1J6OA 4XZ9A 1TPWA 3EWWA 2AGKA 3VGEA 3W7CA 1UD5A 4UFIA 3ZZ1A 1E70M 4F2BA 4YTTA 1D7FA 2YBVA 1K7FA 2CLIA 4DWSB 4MJ4A 4HU4A 1PS9A 3R8RA 4CD8A 3QPYA 1OBAA 3LK6A 4YWSA 1AQ0A 3MCMA 1S5MA 2E28A 3EX3A 3LI0A 1X98A 1XC6A 4MWAE 3MHFA 1JYNA 2WPBA 4IUGA 5B7ZA 4NNBA 4KGLA 2CFFA 3DX5A 5D30A 4WEVX 5G2HA 4JGDA 3NAVA 3KEHA 1ISVA 3OA5A 1GJWA 4DUOA 1GZ1A 3HF3A 4HJWA 5CZKA 3RX3A 3QTPA 1DYSA 1XBXA 3MY9A 3O3RA 4B90A 3A9BA 1TUXA 3ZM8A 4HOWA 3VNJA 1VHCA 2VWTA 4HB7A 3SZ8A 4DBSA 3BMVA 5FJUA 2NQLA 1JPHA 4FIQA 2I16A 2PMQA 1SQ7A 3C6CA 5U7SA 4O4VA 4AEEA 4IPNB 2F9RA 4H7CA 5IBXC 4XZNX 4IMFA 2E8ZA 4GQRA 3IUDA 2YB4A 1RCXB 2HS6A 4OV9A 2OYMA 3TTEA 4MUPA 1Q6DA 1QAPA 1TMLA 4IISA 1FBAA 1XL9A 2HK0A 4DJFD 4XG1A 5F1VA 1GVFA 4EPDC 1K4HA 2Q8LA 3TYCA 4W4QA 1OX4B 4Z2GA 3DKJA 3EB2A 2WSYA 2ZTJA 3JS3A 1MXGA 1MNSA 3H54A 3AIEA 4RW3A 1V0NA 5AYIA 3PZVA 5G4WA 2BV9A 2RH9A 4QCFA 2VCBA 1E3ZA 4MZ1A 5RUBA 1SZNA 2J6VA 3FV9A 4UR9A 4CCEA 3TCEA 4QS6A 1X6UA 1XR2A 3BURA 3G3MA 4WKFA 1UA7A 1RY0A 3MKCA 1XD0A 4DNMA 3TU9A 2JEQA 2ZBTA 2PTYA 1E0WA 5DRCA 5A6KA 3PG9A 3AU6A 4ZO6A 5JXQA 3EDKA 3S0CA 3EOSA 3F5KA 4CN6A 3K2GA 4Z0JA 3EA1A 4K8HA 3BCDA 1VEOA 3U2CA 5PTDA 4HHHA 1I2QA 4QJ4B 2ABBA 3L0KA 3RN6A 2ISDA 4DO5A 1VR6A 1R87A 4HU3A 2V3GA 1ECEA 4I6KA 2J25A 3W7NA 4AF0B 2PODA 2CNCA 3H12A 2DVXA 1FVPA 1WZLA 1IHIA 3VOFA 4OBRA 3DUGA 4N0RA 4Y2WA 3SCOA 4NJJA 2VHLA 2BNJA 2TODA 1Q6FA 2FTPA 3E3HA 1WV2A 6TAAA 4HD5A 4BWLA 1LYXA 3FKRA 3GDMA 3CIXA 1OK6A 1ZJAA 1TPVA 4ERIA 2O55A 3WMBA 2YSWA 3LEPA 1HKKA 1Z8AA 1N8IA 4HPNA 1SW3A 1R3TA 1CZ1A 1GK8A 3B0UX 1XIMA 4IZGA 4PMDA 3R0UA 4W84A 1YKWA 2E4TA 1R47A 3TN3A 3NTYA 3B03A 1E43A 1DE5A 2PPGA 4GIEA 5TIMA 3PR2A 1DWGM 4LY8A 1OT2A 2X1TA 3M6DA 1FWBC 2WB5A 4W7UA 3QOKA 3RAOA 1OX5A 5BNKA 2XIQA 4J3SA 1UC4A 3E0LA 2ZOXA 3L4TA 3W1AA 3HGOA 4HNLA 3W0KA 3MI6A 2V6AA 3G1SA 3P93A 3KTXA 4X2PA 3O1NA 5G5IA 4UXDA 4AEOA 2YZ5A 1LBFA 3R12A 5JH1A 2XN1A 1NWRA 5BZAA 5DXXA 4ZQMA 4S3AA 1PYMA 3VIJA 4EIVA 1S5TA 4RCXA 4TVDA 1R86A 4M1BA 3STEA 4W7VA 1XIIA 4TV6A 5HMSA 3WLRA 3M4HA 2V81A 2CCRA 3JZEA 3WEZA 3AS0A 5LA0A 4HMNA 2VZSA 3I3EA 4UMAA 3WF4A 4LPCA 2XFFA 1QK2A 2X42A 3VVGA 2O4QA 2E09A 1BQGA 1OZQA 4HZ7A 2XHYA 3M7SA 4IP5A 3WJXA 4F0MA 2FPYA 3VIKA 1SUXA 3NQVA 2QV5A 3OOQA 2D22A 1UKTA 2VC6A 4YHEA 3F2CA 2E5DA 4X0VA 6ALDA 1E4MM 4J35A 4NHVA 4O50A 1ECQA 2VEFA 2Z6IA 4BQ4A 3UQNA 5G4EA 2GVLA 2QAPA 1F7BA 4ZQOA 3QY6A 4AXNA 3IACA 1UR3M 1WAWA 3H2CA 1DP0A 1J2WA 3KBVA 1V7AA 3WJSA 1HJSA 3DFTA 5FJTA 8XIAA 4U3AA 1Q65A 2XFRA 4NVTA 3HO8A 2R91A 1W3HA 4B5NA 1ZRQA 4UTTC 4IT1A 3W81A 4O1DA 4KWVA 2XDFA 2ZZ3A 5ABHA 2IPJA 1LTDA 5G1TA 5TBOA 1W9XA 4ZA0A 3CTLA 2BOEX 4YN5A 1ZENA 1SM9A 5F2LA 5FSEC 4DYKA 1SO3A 1KTBA 1KQYA 1PXGA 5GPRA 4ADSA 4HNVA 4N9DA 2WCSA 1W3NA 3ZR5A 3O6DA 2J8GA 3RPDA 3ANUA 3WH8A 1CLKA 3V7PA 4RV8A 1LF1A 2FZNA 1JCXA 1B57A 2C3ZA 5DLCA 5KEZA 4RZ4A 4US5A 3AYRA 2PLCA 4ZEPA 1FKXA 4AD4A 2CLLA 3CZEA 4ZXLA 1KGUA 3W4RA 3WFAA 3TR9A 4MGGA 2A4AA 1U1JA 3QYSA 1DEDA 1MFVA 4Z1AA 4DELA 3POHA 1EH9A 3WQ5A 1ISYA 1LWHA 6PTDA 2NUXA 4UIOA 1HXJA 1WE5A 1ZP3A 1A53A 3N11A 4KKXA 1H41A 4R3UA 3HURA 2CBVA 3NQ2A 3H8AA 1VYPX 1FDYA 3GNOA 3GE7A 1QDSA 2Y5SA 2ISVA 1S1PA 5M17A 3HTWA 3LNMA 2CLPA 1UOKA 1BWVA 3BLKA 4NY2A 5MHBA 3FYOA 4FXRA 1QJWA 1F05A 3NXLA 3WQOA 3LV5A 4AUBA 3E49A 5JVLA 3NYZA 4GHRA 4A29A 2CBUA 1TX2A 1H1YA 3HG3A 1OC6A 4PL1A 6XIMA 3F4VA 3KCOA 4H7ZA 4AZBA 2FZ8A 2JBMA 3TC6A 1EYEA 1OX6A 1H60A 1GHSA 4GBDA 3SRFA 4WRHA 3LLXA 3NPXA 3GVQA 1Q6CA 2AGTA 5CSUA 3PNZA 1VAHA 3PFMA 3KHDA 3BDKA 3OHMB 1V3KA 4RDZA 3GZAA 1GTHA 1YNQA 5LIYX 4QCEA 5ENLA 4HSNA 1DWHM 3VYLA 4I8DA 1E51A 1ZS2A 2NWRA 4UQAA 3C3UA 3PK7A 3HJEA 2W6RA 1RLCL 2YW3A 1DQWA 2GSHA 1M65A 4M24A 2CW6A 1YLVA 2PWGA 1C8YA 4AYGA 4D6DA 4JICA 3WJZA 4P7QA 3CH0A 2YJQA 3V35A 4HN4A 1RHCA 1PCWA 3F5JA 2ZADA 1Z32X 4MVAA 1C8VA 4M80A 4DPQA 4C5ZA 3A4AA 5G1MA 2BGNE 1GOXA 2Y7DA 4DRSA 1A0CA 4DX3A 1E72M 7TIMA 1UWSA 4I7UA 1PYFA 1H7XA 4L4MA 4D71A 1MMFA 4NRSA 3OU8A 1F76A 3V0UA 3G0SA 3ISIX 3WMLA 2I5QA 3A21A 1BYCA 3WYZA 3AWOA 1S38A 2ZX7A 1MEHA 3OZPA 1TWDA 5M3WA 2ZQ0A 2NX3A 2PAJA 4LYRA 1K8CA 3WL0A 3NYDA 5BU6A 1G01A 3IJ9A 3WH6A 1KBIA 4E2DA 4P8XA 4S3GA 1L2QA 3MYPA 2GJPA 2GJRA 1KCXA 4GCXA 2QIWA 4M6QA 4U2ZA 3ARRA 3LG3A 1VRXA 1POKA 4TX8A 2XGIA 4IXHA 3IRSA 1QNRA 1RCQA 3W73A 4JTKA 2QHAA 3AXXA 2PTWA 3BAKA 1PKNA 3I4EA 1KD0A 3AYTA 3C2FA 3I7QA 1S5WA 2CKSA 2CXEA 3P67A 1I8JA 4ICNA 3CMFA 4CQ9A 4YVPA 4O13A 1ISZA 3BOFA 3QRHA 3ABZA 4XZWA 1JZ4A 1W2VA 4IQEA 4DJDC 3ZT5A 4C6JA 3LM7A 5AC4A 4XVEA 3LMZA 3CQIA 1NWSA 1KKRA 1CLVA 1MO0A 1PCKA 1FH8A 4MWAC 1PZ0A 2ON3A 1DJYA 4JS3A 5CLWA 3N2CA 4WIWA 4DZAA 3DERA 1GVRA 5DT5A 4AW7A 2X2GA 3HG4A 4L6OA 4OIFA 3W7EA 3HMCA 4LQ1A 3GYEA 2XIOA 4FLSA 4JYDA 5A6AA 3P6LA 4M5PA 4TMCA 3LD5A 4Y9AA 4HA4A 2IUZA 3DFHA 3S2LA 3G6LA 1OCJA 3N18A 3W07A 3WEOA 2V3DA 2VC7A 2P8BA 4QSFA 2H6RA 2CC0A 4HZ6A 3L4VA 1ZGDA 5IFTA 3TNOA 4Q8NA 3BAJA 5LIKX 1EP2A 2J74A 2YOCA 4O15A 3NDOA 4W89A 3W22A 1R9YA 1IIGA 1QW7A 3II1A 4LV9A 3ZT7A 3N17A 4XD4A 3OW1A 4GYJA 2CEQA 3QQWA 3SB0A 1O95A 3M43A 3H7RA 3NZGA 3GDBA 1IR1A 5FF2A 4MY9A 3F1QA 5FSDC 3OP2A 1TIMA 1R85A 3R2GA 1EO5A 1RBAA 3T0DA 3KVKA 3LGEA 1YNPA 5CPSA 4HPHA 4Z1CA 1XLMA 3WO8A 5AFDA 1B0IA 4GJ1A 4R7JA 4ZXOA 4V28A 1N55A 1RY8A 3GBEA 3Q94A 4QEEA 3KL0A 1CXIA 4O10A 3GO2A 4HU8A 1PX8A 1WPCA 2QMJA 5FJPA 2XIIA 4IMDA 1IR2A 4JY8A 1XX1A 4GIAA 1ZP4A 3MYOA 4C7DA 2DJLA 4LOCA 3CIWA 1DQXA 2HBVA 2CIPA 2FGBA 3NFUA 1UROA 1XS2A 3MP3A 1DIOA 4U33A 1AW1A 5A5WA 5AYBA 1TWSA 2PDFA 3WNPA 2PGRA 3M9YA 4QRNA 1GW9A 3U5YA 1QMLA 1UD6A 3YPIA 1Q4NX 2QCMA 4XZBA 1R7AA 3T2OA 1QNVA 1JUBA 1EHNA 4HOXA 5I06A 3MI2A 4WXYA 4V1XA 3SO7A 3SRDA 4JY9A 2GGJA 4UTMA 2C8NA 1OVDA 1NFPA 1DXEA 4Y9NA 3VE7A 1OWQA 3AXIA 3T6CA 1R2SA 4IQLA 1CECA 2V5JA 3WQ8A 4A2SA 3NDYA 1XG4A 4WY0A 3CV2A 3OJGA 4HHLA 3WDJA 4Z17A 3ELFA 3H22A 3PJXA 2WM0A 3RCNA 4PC8A 3LA4A 4PZVA 3T0TA 1WUEA 2YL5A 4HSHA 1W1A1 5CCZA 1J2BA 3SECA 3FKKA 2OGYA 1OF8A 3IAPA 3LRLA 4A3YA 1BWKA 3KP1A 1CGVA 3N4EA 4JQ4A 3Q58A 3GAKA 4PFHA 4QISA 7ODCA 3VCNA 2AQVA 5T91A 4E38A 1GG0A 1KR0A 2J79A 4H2HA 1W3TA 2DEPA 2R1LA 4XD5A 1UC5A 4RE3A 3KZPA 3FJ6A 2PURA 4UCGA 2XZ7A 1RVGA 3NL5A 2FVMA 1D3CA 3QMTA 4RE4A 1E6XM 4GH3A 2GK1A 4GUIA 4IUOA 3L5LA 4FLQA 2O7SA 4LUIA 4M19A 5JBDA 4LAOA 2Y5JA 3O0KA 2PDLA 4PRRA 1B3XA 4DHGA 2GOKA 1ONEA 3G3DA 2TSYA 3RILA 3JZUA 2P5NA 3BV4A 4HOZA 5FI8A 3VA8A 3M7WA 4BF9A 1RQBA 1QI5A 1UMLA 4L6HA 2WNWA 3B8SA 3RUBL 4M82A 1DJZA 3AMLA 1V5XA 1XLKA 4J4KA 1NOFA 2PZNA 4TR9A 3NOYA 3D47A 2PWEA 1KRMA 5DCBA 1FHLA 4RDVA 2RJGA 1BF2A 1UWQA 5FL0A 1KRCC 4LX4A 1PZ3A 5FF3A 4QJ3B 3CPRA 3VMPA 1EDGA 4FXFA 3S6TA 1UASA 2Z1WA 3EOLA 3WD4A 2ZUTA 4CQCA 4R9XA 3BCFA 1DIEA 1XIGA 5HPCA 4DIAA 2YDRA 1R46A 4P2VA 1HX0A 3G1VA 4LSBA 3PZNA 5D03A 3ZQ9A 4PYSA 2PP1A 5K4ZA 5C9XA 4JTRA 4R34A 2C18A 2XN0A 5D32A 3BAIA 3WLHA 4AZCA 1QI4A 1JCLA 1OINA 2BGQA 2DW7A 1A0DA 3UGRA 1GQKA 1YXCA 3FS2A 3O06A 4AQLA 4LB4A 2QQ6A 2IQ0A 2RGLA 3ZT6A 3COTA 3MHGA 3RRAA 1VFSA 1QI0A 3CL8A 2EPHA 4WJXA 4N02A 1XLJA 3W76A 2VZVA 4DXKA 1V0MA 4CU7A 1NFBA 2PDNA 4AWSA 2NQHA 1PIIA 4X61A 4HTYA 2G5WA 3GKFA 1VHNA 1U5HA 2QDGA 3OIHA 3LV6A 4NT0A 4OVXA 4UB9A 1LT7A 4BA0A 4ATLA 5D8WA 4HYRA 5C6MA 4XSMA 5C7HA 1W9BM 1MXDA 3PAJA 4Z2KA 2NX9A 3IIXA 3ZYZA 2CESA 2V5DA 1Q13A 2BODX 3EWYA 2EG7A 1AZ1A 2ZXAA 4DB7A 3P62A 5D2YA 4FXJA 2VFIA 5CSYA 3IGXA 4E8DA 3I7SA 1SW7A 5AYXA 1E6SM 2DVTA 2EHHA 4JIPA 3DZ1A 2PSNA 1RK6A 2BVWA 4LRSA 4MAZA 5BXTA 4HHMA 3GXNA 1R38A 5CAKA 5BOEA 3T7VA 1Q6EA 3UWVA 4GIRA 4E2BA 3OPSA 5BXSA 1BWLA 4MLJA 1JL8A 2XWEA 3T78A 1J0KA 4PMVA 1PE1A 1VLIA 4JTTA 3UG8A 1GVQA 3TXZA 4UZUA 1FRBA 1KFEA 2OCZA 3CV7A 5CPMA 2V2CA 3A3XA 3M46A 1DBTA 4BEQA 1XIBA 2E6AA 4WY0B 2BASA 3VKDA 4TMBA 2JK2A 1OIMA 1MQPA 3VD9A 5CZSA 4O19A 4K6AA 2CBIA 1B30A 1X96A 2DZBA 3LMYA 1EDTA 1L6FA 3AUOA 3QOMA 1E55A 4D8ZA 3ME3A 2POZA 2G41A 3AXKA 3RIKA 3S1UA 2YFOA 3H2MA 1VKFA 4AD3A 4K8GA 2YBTA 2BTMA 1P0DA 3PTDA 2XH0A 1EIXA 3MUIA 3QY8A 3USBA 4DNHA 1HQTA 4UFKA 4GA8A 4W86A 1LZOA 5LZLA 4FI4A 2JFEX 2UWFA 4HCDA 5G2IA 4HK5A 2A2IA 5HNNA 4XO7A 2P0OA 3VAVA 1O60A 4M6UA 2WNZA 4M7SA 4INFA 2OT0A 4FLRA 1VIZA 1CW2A 2PDXA 2CZFA 1KV5A 3M16A 3FSTA 3T0BA 4ENLA 1R3VA 3EMZA 5FL1A 1VJSA 3HG5A 3N04A 4C60A 1H5YA 1CBGA 4GCAA 1QOPA 1XYBA 2ZWYA 3B9OA 1DIDA 3TLLA 3L0NA 3DU0A 4MTVA 2RDXA 4O0KA 1JZ8A 1FP9A 3AZTA 1EJXC 3WD3A 2H3BA 4BS0A 3KOFA 3L68A 1ITCA 3TYBA 2W9MA 3T4WA 5DCEA 1UR1A 3W9ZA 2VD8A 3MCNA 2QEZA 3UA4A 1HJXA 2PWFA 3CQHA 1JCJA 2DT3A 2Z7KA 1RK5A 2QULA 3V5OA 5A6LA 3IVTA 1XBVA 2VEKA 3PBGA 1IT8A 4C65A 1H4PA 1B2YA 1M41A 2HNEA 1G5AA 3B9AA 2AMGA 4GYKA 1B3WA 3SADA 3SUVA 5HBFA 1P0NA 5BROA 3EX1A 1JFXA 2OOGA 3NIYA 4S3KA 3WLQA 1E0VA 1EPVA 3PS7A 4AZCB 1S2UA 3AROA 3SFWA 4F0HA 2V5KA 3ITYA 1C91A 1F74A 3N29A 2PTZA 4GGBA 1H2JA 3OBKA 1MW2A 1B1YA 5EBAA 1C29A 2GLKA 1IEQA 1PHQA 1V8EA 2O9TA 1NOWA 5IM51 1W5MA 4V27A 4QP0A 4LV4A 5FEXA 3QHNA 4LTSA 1EF3A 4MLRA 3PBVA 2NV9A 4LUSB 3QM3A 1QBBA 4ILSA 1EXBA 3UJEA 5HA7A 2WNNA 3GHSA 1JDFA 1SFJA 1DJQA 2QJMA 1R0MA 2A5HA 7ENLA 3WD2A 4PGLA 3S5ZA 4J3TA 3TDFA 4O54A 1VIWA 1HTIA 4M6PA 2DFAA 1VGAA 4FPSA 4HPGA 4W5UA 4KCUA 4PMRA 1XXXA 2L5HA 3BG5A 1WKFA 4URIA 3GBDA 1BYDA 2J6XA 1M1BA 3UWQA 3B8UA 7A3HA 1CCWB 3AUJA 5CG7A 1BG9A 1R7OA 4I8YA 2FVLA 2E9MA 3G5EA 4BY3A 3RLUA 2X41A 4MKVA 3UXLA 2VGBA 2Y7GA 4IQDA 1PZ1A 3ORWA 3U48A 4DF2A 3TUUA 4IGNA 1GOKA 4J1OA 2GSJA 4HA3A 4E4PA 3NQAA 4DWSC 2XZ9A 1UBPC 1KLZA 1ZBWA 4XZIA 1R2RA 2OQLA 4ROPA 1TWWA 2ANUA 3VC6A 1KBBA 3WUBA 3HGRA 1M04A 2FQIA 3HZ3A 4MNMA 3L7RA 3NG3A 1ITUA 1V0LA 5REQA 5I3GA 3EXRA 5D2VA 3WNNA 1FHUA 1BYBA 1FTXA 3IAQA 4DWDA 1G69A 2OR2A 3ATYA 3WFLA 2Y62A 3QV8A 5E6ZA 5BMWA 4UTUA 1K70A 3W2LA 4DZIA 1LOSA 1W3IA 1ME7A 1W56A 3L5MA 3GUGA 2YA0A 2DV0A 2VEIA 1JZ6A 3H7UA 1Y0EA 3BUVA 4NYUA 3OEXA 3T4CA 4JHMA 2F6UA 5FCZA 5E0CA 1SO4A 3E96A 1M53A 3PZUA 1QATA 2A3HA 4B16A 1EXPA 4D72A 2ZRXA 4J40A 3PANA 3HMJG 2MNRA 1XG3A 4MAVA 4HA0A 3OG3A 1H61A 4KGJA 4CNUA 1VJZA 5DCDA 3NQDA 4CNNA 4ZE4A 2Q3RA 3MSGA 4J5NA 3TQKA 2Z4GA 1VC4A 4GVGA 4FX8A 3BMWA 5D2WA 4GABA 3CQJA 2OWXA 3IIPA 4KT2A 3T0CA 1R9ZA 2PWVA 3V1PA 3WFZA 4AZ7A 2INEA 4UWMA 1CEOA 2IPWA 3WBWA 1UD8A 3TSDA 4L9ZA 2ATMA 4JBRA 2QIIA 3LQLA 3VOHA 3SQMA 3O16A 3GVVA 4CCDA 1R6WA 2J7DA 1EWDA 3QR1A 2Y1HA 4UR7A 1XD1A 2HVNA 1Q4WA 1EP1A 4PUKA 1Z41A 4B5UA 1OFAA 2GJXA 1EJVC 1VP5A 2G8ZA 4NX5A 3DI1A 4K3ZA 3W25A 1C9WA 3VILA 2ISWA 1ZSXA 4GGHA 4WUIA 1H7WA 3R8HA 3ONBA 2BZNA 2A6LA 2PLMA 4Q7NA 1Z6KA 2IQDA 5LXXA 3KCLA 5I00A 2ZZ2A 3GK0A 4ATDA 1XRVA 3VX0A 4JTIA 4ZQRA 2BY1A 4W9TA 4O1FA 1BGAA 3M0LA 5EKYA 4XV0A 5JBEA 2CHRA 3SN1A 5B80A 1A5BA 3OVRA 1P6WA 5DRIA 3M44A 2NLIA 3L23A 5BWAA 2C7FA 1GKPA 3MUXA 3LYEA 3CUHA 4PR4A 4P7OA 2C79A 3A6OA 4B5SA 3MI3A 3F4DA 3L21A 3DH7A 4GVFA 1E4LA 3TYZA 1E3XA 3HFYA 3WLPA 4ZOEA 3BSHA 4WDWA 1TCMA 2IKIA 4KIRA 3I6EA 3PZGA 1V3JA 3N4AA 2B7NA 2V67A 3AQUA 4LBSA 3A23A 2QJHA 3FEMA 2FZBA 3AHYA 3ES7A 4UC5A 3W87A 3QPZA 4OKDA 4ADUA 2QJGA 5LGXA 4ORIA 1N7KA 4DN1A 3A9IA 2WVTA 5BRPA 1VS1A 5LSMA 2O9OA 1JYVA 3XIMA 4H4IA 5CBBA 2PDYA 1F3TA 1LOLA 2Z2UA 3ID7A 1A4MA 3U9IA 3E0FA 4PCFA 2Z00A 1AFSA 2YDQA 1JF6A 3H23A 3KFTA 4RNHA 4BQ2A 1ONRA 1AJ0A 5AHFA 4GI8A 1WKEA 3FFSA 1F8MA 2G3MA 3BW3A 4IL0A 4JDBA 1GZJA 5M2FX 3GNDA 2TMDA 3OIXA 3H21A 1FFRA 3TONA 1QHZA 4GY0A 3TW6A 5BXPA 1V6YA 4JKLA 3JVAA 1XLCA 4YMZA 5DEZA 5D04C 5FF0A 1JD7A 2I57A 3WK3A 3NL3A 2D2OA 5KMYA 1PKMA 4Y90A 1SFSA 4AIOA 2Z2BA 4JTJA 5REQB 3H24A 3MANA 5A3HA 4OBSA 3NL2A 1PTGA 3NURA 4D6CA 3AIQA 5LIXX 3CHVA 4Q22A 1B9BA 2GPTA 4F79A 1PIFA 2C71A 3GIQA 3KHJA 3LXBA 4O17A 1AK5A 2DH3A 3WQPA 1FH7A 4A21A 4XZLX 4NG3A 4QAIA 3G8EA 2E6YA 4GQBA 1G7UA 4BI5A 1UD4A 2OYKA 1WOBA 2FZ9A 3E1F1 3W82A 3AISA 4Y9PA 2XSXA 2DW6A 1TV8A 1KGWA 4H6KA 3T2PA 2WPGA 1PWMA 1KC7A 3W02A 3D46A 1I9CB 1IQ8A 1GCYA 5I5RA 2GJLA 3WDRA 1TV4A 2YR1A 1OT1A 3A3HA 4FA3A 2Z24A 4TOQA 1GQIA 1E1CA 3EPNA 1UP0A 4UQBA 4IL2A 2ZUSA 3T2QA 1HUVA 4JAWA 2V5CA 4NILA 2NVAA 4QGCA 1H7NA 4HN8A 5A8PA 3PZQA 1XIFA 1P6CA 1RQEA 1EA0A 2YX0A 3WNLA 3S1WA 2D0HA 4FF5A 3FJLA 3MO7A 5AYYA 3WUGA 3A4WA 4PB3A 3I7RA 1B90A 2XH4A 2VO5A 5CSSA 3LCFA 1E9ZB 3PZMA 1EJRC 4IMAA 4XAFA 4NXSA 3UJ2A 4DZHA 4MUZA 1TVNA 1FWEC 3AHZA 4ZQPA 2GUBA 4RK8A 2HJPA 2F6KA 2GJXB 3CLWA 3VIHA 2A3AA 5DBUA 5TD4A 1GTEA 3G22A 2FFCA 3T44A 3UVIA 2PZ0A 3M5VA 2AAAA 1OYBA 4IXXA 5F1UA 3PB2A 4RNFA 3SCPA 1W3LA 3AIVA 2Q3OA 5F2MA 1OD8A 2HXUA 3DGBA 4EANA 5A1AA 1FCVA 1VCGA 3VD4A 2WJEA 2XVLA 5E0FA 4LW7A 3CAQA 4PUJA 4P5UA 4N9CA 1CXEA 3P7YA 1J79A 2ODOA 3OVQA 3A4XA 3CGTA 1R3YA 3G8RA 2WO5A 1DWFM 2VX7A 5LXEA 4FNPA 1QNSA 1XPGA 4Q8WA 2OJPA 4M81A 4ZMGA 3N12A 7PTDA 1FX6A 3QC3A 1E5JA 1RCOB 1T99A 4R33A 4LC8A 4UFJA 2FPTA 3KP0A 4KFOA 4BWLC 4YHGA 1P1XA 3LZ5A 1QPNA 4JIEA 2WKLA 4ZE5A 2WXDM 2KAUC 2QDEA 3AS3A 5LIUX 3QQ1A 4HK6A 3GTHA 4NQ1A 1OABA 4B2DD 4EXBA 3BW4A 5CZ0A 2R1KA 3VDBA 3C86A 1H7RA 2A3BA 1F3WA 2JEPA 4HGXA 1O7AA 1PZ2A 1OB0A 4CNOA 1JDDA 2W67A 2HE8A 2DQXA 2X0HA 3ARQA 3LY0A 1FWIC 3PZOA 5I3JA 3TOPA 4FIRA 4C6KA 9XIAA 1AA1B 1ALDA 3DBNA 1LL7A 3IK4A 1GHRA 3R13A 2NQZA 4QS5A 3SQLA 1V6TA 4EKJA 2R1PA 3P60A 3S83A 3K8MA 1QVBA 4ASTA 4QSHA 5E70A 3UD6A 1GEQA 4BQ3A 3EA3A 2WLZA 3KRBA 1AL8A 1C8XA 1US0A 3W86A 4MB4A 3FJNA 3CZJA 3L5AA 1B9ZA 2GWGA 3AOFA 1MQRA 1GOIA 2WZMA 4JIHA 3NJ3A 4HA1A 1TV2A 4D9PA 4DBEA 2ZXQA 1D9EA 5C71A 2IXUA 2RKXA 4L1XA 3A12A 3MU7A 1R2TA 3K4WA 4D6HA 1IXOA 2X0YA 4JTHA 4U5IA 2GSEA 4IGHA 4IX2A 3ZVHB 2Y89A 4REQA 4FZIA 3P0WA 4ATWA 4O16A 5AZ1A 1V3MA 1VJIA 5GVJA 2EJAA 4ZVJA 3SCWA 1XLLA 5C55A 4ZODA 4RZ5A 1A80A 4E3TA 3MO4A 1IEWA 3TMQA 4Z0SA 4FOUA 1VFUA 4G2DA 3KDNA 4WXZA 3RYSA 1LCOA 3LBOA 1ADSA 1Q6QA 1L0PA 3VIGA 4M8UA 3FK4A 4DI8A 2PRLA 2VDHA 2IXVA 5CLTA 1CIUA 3OVPA 3MBDA 4AYSA 2JIWA 4QG6A 3CAWA 1E1CB 1ZBCA 1M9HA 5A94A 3RX2A 3WY1A 4FSAA 3V75A 4Q8OA 4D1IA 4O1AA 5I24A 1U2YA 1S3HA 5H2ZA 2HTMA 5AHMA 4UR8A 1XBZA 2EG6A 2VUYA 4ERGA 4GI6A 1XM3A 1FY6A 3HGSA 4YLWA 5ECVA 3IANA 5A6TC 1HO1A 3R58A 2PLJA 3HOJA 5A6JA 1H0IA 4QNEA 1XYCA 1EC7A 3BSGA 2R1NA 4IFKA 4HHPA 2PF0A 2BWGA 3QW3A 2PWUA 3VGFA 3UXIA 2WBKA 1YPIA 1UKPA 4FOJA 6XIAA 4DJEA 4OU1A 1NQKA 3HQNA 1LL4A 5E1QA 3W00A 1Y65A 3R10A 2OO0A 1NFGA 3W83A 1FP8A 3S9YA 2E6DA 1P1MA 1F5ZA 1UBSA 4NZ4A 1UD2A 4QM1A 4K38A 1HW6A 4A6GA 1KLYA 2DIJA 1B3ZA 3NGJA 2YCKX 1WZKA 3UR2A 5DMLA 4DVOA 4IH3A 4LYPA 3VDCA 3H55A 4E0CA 4M7TA 4GKLA 1QW8A 3WLNA 4C1NA 1HJWA 4N6FA 5AC6A 2VFDA 2D73A 3N19B 5F4XA 1UWAA 3C2VA 3FCPA 3DYMA 3VCRA 3PUGA 1B3OA 4R27A 1MWOA 4QITA 3I3BA 4WDXA 1B54A 4YL2A 5IFPA 1TJ1A 3NSNA 4DLMA 3K4DA 1J0ZA 1I1XA 1QPKA 2J9XA 4EACA 6TIMA 4GXMA 2Y2WA 3KDOA 4F66A 1A5KC 3VPLA 2QKFA 1K9FA 1ZPTA 3LOTA 4J3XA 5TNVA 3R6IA 1ZJBA 3VXGA 3GNRA 2QCDA 4TX6A 1P5BA 1FWSA 1N8WA 5JMUA 3CZ8A 4XTIA 2ZC1A 2OLSA 2QUNA 4KMQA 2HRWA 3I65A 3EEGA 4IX0A 1GYMA 2VC5A 4KIEA 2V8ZA 3CWNA 5EBUA 3M0KA 1OFBA 3THUA 4Q4KA 5DMNA 2C16A 3PG8A 4LAKA 4Q8VA 1OEPA 1GQLA 2QW5A 5LYRA 3ITXA 4HZMA 1OC7A 3IJDA 4IPPA 1J0YA 1VCFA 5D4YA 3B9DA 1GNXA 2GZXA 3MSDA 2C1HA 5I02A 4R9OA 3GAYA 2WZHA 5LGZA 4OUIA 4E2VA 4DJDD 1W9VA 3EX2A 3VNLA 4NZ1A 4REQB 3CPUA 3GH7A 3GU2A 3SCVA 3GDTA 2ZX8A 4AWUA 4MWAD 3O07A 1NAL1 2XSBA 1UP3A 4H7VA 5BRBA 1EUNA 1MDLA 3EX4A 2QS8A 3GG0A 5HJLA 2QGYA 3PTMA 3DG3A 4F0SA 4JTQA 5CZJA 3LCHA 5K2ZA 2V68A 1XQKA 4FNSA 3M5YA 5HJXA 8A3HA 3W6MA 4S2BA 2A85A 4Q8TA 1FWAC 2EKCA 4P8UA 1KA9F 1SJDA 3FXGA 2A0NA 1V79A 4FF7A 4XKMA 2J7GA 4Q6JA 4GO9A 3OQ8A 1O1HA 3SIMA 3QHMA 5MKGA 2CERA 4X63A 4JN8A 1KV8A 1VFMA 1F2JA 3ABQA 3A3WA 1DORA 1M5WA 3CUFA 4JHZA 4DXXA 1U83A 1ZCCA 2G3IA 3G77A 3SGGA 4X60A 3SRKA 1H49A 4JFWA 1Q2SA 4PB4A 3V3WA 1C9DA 3AIBA 4D6IA 1YX1A 4IFKB 4YTQA 2ACUA 3AI0A 1UKSA 3VZYA 3WDQA 3W1MA 3C0JA 3SCQA 2Z7GA 3VOGA 1XRSA 2ZFAA 2MUCA 4YNGA 1S39A 1TJRA 4H8UA 4WSKA 2YCLA 1IZKA 4IICA 4GK8A 4HK7A 1OGGA 4GINA 2INFA 1A3WA 2FGLA 2YB1A 2ZA3A 3TK7A 1DJNA 3GXTA 5HK4A 4NJGA 3VIIA 4XKYA 3VFLA 3PPHA 3EA2A 4IJBA 4I7VA 3UZ5A 4DM2A 1UKOA 2VGFA 1ITXA 4IGSA 4O14A 3IGUA 5LNWA 5EY5A 2CLKA 2BS9A 2F38A 1UW9A 1DWJM 4RX0A 1TZ9A 4N4PA 2DZAA 4C1NB 4CLMA 1LLZA 3WL1A 2PU0A 4JTDA 4RE0A 1TA3A 4L80A 1YADA 3ARPA 3PWAA 3U8GA 1J0JA 3KBNA 1HL9A 1XLFA 3R7MA 3DFSA 4TVCA 1UH3A 3DYPA 2OOFA 4CD6A 2TPSA 4O1BA 3FVMA 2JE8A 4L1WA 3SBFA 3I68A 1EWEA 2DSZA 5U4NA 9RUBA 3WUEA 2BGSA 4O8RA 4FNQA 2VQUA 3O7UA 2PLKA 1PKYA 4AHQA 1KM4A