2EXOA

Crystal structure of the catalytic domain of the beta-1,4-glycanase cex from cellulomonas fimi
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
312
structure length
312
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,4-BETA-D-GLYCANASE
publication title Crystal structure of the catalytic domain of the beta-1,4-glycanase cex from Cellulomonas fimi.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase (o-glycosyl)
total genus 129
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2exoA00
1HJXA 3FNDA 3AS3A 1M7XA 1E3ZA 2G3JA 2VQUA 3NCOA 2AOSA 5BXPA 3SUWA 3WNKA 2Y4SA 1UR4A 4DUVA 5A8QA 3AHZA 2WKLA 1QNOA 3I3DA 1O6IA 1XYZA 2BFGA 1TFVA 2FHCA 4J3VA 4PUDA 3OIHA 4P8WA 1CYGA 3AS0A 3ARXA 5IHRA 3WELA 4R5EA 2EPMX 5D9NA 5A6BA 2XFRA 1CGWA 1Q4NX 1CXLA 3DC0A 3SCOA 2BY0A 2Y24A 4D72A 1ZB5A 4V2XA 2WHKA 4CUCA 5C71A 1CGUA 3AHTA 4M80A 2NW0A 1Z32X 4PUEA 4KGJA 3AMLA 2E9LA 3KZSA 3VD5A 1JAKA 1E5NA 3OLEA 2CEQA 1TVNA 3AIQA 4LQ1A 2W91A 3PN8A 2PF0A 3N13A 1W9BM 5A6LA 1H5VA 3KWXA 3CUIA 3UG5A 3GYCA 1J0KA 4FLRA 1RPKA 2XHYA 4PMDA 1C8QA 5A6MA 3VOCA 1C3FA 3SCWA 4XV0A 5E0CA 1LL6A 1V08A 1HNYA 4AD5A 5A8PA 5FIPA 3VDCA 5HBFA 5I78A 4JCLA 3NUKA 3HJEA 3QOMA 1V0MA 3CZKA 2IXVA 1WO2A 3TA9A 2WMJA 1JZ6A 1OCQA 3SCTA 5BCAA 4J7RA 1CZ1A 2DDXA 4AZCA 1PZ3A 3VNYA 3BC9A 5AC4A 1KBKA 1MQRA 4PCTA 1MWOA 4TX8A 1B3YA 1WP6A 1FFQA 4U5KA 3W6LA 3T2PA 4OZOA 2GSJA 4W87A 3W27A 4ZENA 5I23A 5HNNA 3WIJA 4CD7A 1J0JA 4JL2A 4U33A 4CKQA 1W91A 3PHAA 1G01A 4ZFMA 4AD0A 4Z2GA 3GXDA 2GJXB 2WZEA 3PTMA 2XVLA 3CUJA 1EIBA 2ZUNA 4UZUA 1XCXA 2X1IA 4Y7EA 1UOKA 1FP8A 2VJXA 1VFFA 2G4FA 4WSKA 3UR7A 1E15A 2WCAA 1BVNP 5A94A 1K9TA 2ZWZA 2XGIA 2D0GA 4W93A 2YLLA 3GBEA 1QNPA 3THCA 5DO8A 1GHRA 3GH4A 1C7TA 2O9OA 4GIAA 3OLGA 2XUCA 1MQPA 2VI0A 4YN5A 5GQBA 1BYDA 2J77A 3GDBA 2BY2A 5CXPA 5CLTA 2WMIB 2TAAA 1E40A 1KR1A 1GJUA 1UR8A 1OM0A 4AZBA 2DSKA 3WQ4A 4H8HA 2XSAA 2VVNA 1US3A 1UZ1A 2E40A 4UFKA 1FOBA 3WD4A 1KWKA 2PI6A 4X0NA 2E0PA 2YDQA 4D6JA 3GXMA 1R7AA 1QW8A 2WMHA 4CN1A 3ARSA 4P7QA 1HJWA 1JF5A 1W1YA 1OD0A 1CGYA 3CBWA 3D3AA 4TUFA 4J3UA 5D8ZA 4A3YA 4BA0A 2A3AA 5ECUA 3MMWA 1EA9C 2CKRA 2O9TA 3BAWA 3CZJA 4MB5A 2ZX5A 1CLVA 4F79A 3TTSA 1HVXA 1BG4A 1QI5A 2PWDA 1IT0A 1ZJBA 4X0VA 2DGAA 1VBRA 2G8ZA 5JBFA 2XIBA 3ARYA 3VIJA 1VF8A 4C7DA 3AZTA 4M24A 4CCEA 3ARZA 4AZ7A 1FH8A 1C91A 4OJYA 2WBGA 2FGLA 4AMCA 1U33A 3VIHA 2Y5EA 3WNPA 3LPOA 1GQLA 3T09A 4TTGA 5CPSA 2WZIA 3EDFA 4MJ2A 3OLIA 3OZPA 3PZ9A 5HDRA 4N42A 1H41A 5EFDA 3N12A 1JFXA 8CGTA 5LA0A 3VIGA 1JL8A 5D9OA 3K8KA 2D22A 3SCQA 3K1DA 1VRXA 3AROA 3II1A 2GUYA 3PZQA 4RL3A 2CBVA 1SYTA 4NI3A 2W61A 1VJSA 1H4PA 1CIUA 3VX1A 2WAGA 1R7OA 1JDAA 2Y2WA 1XD1A 3MUY1 4PTMA 1PX8A 3VKKA 3BAIA 3T2QA 4M82A 3WFLA 2XSBA 2VR4A 1GW1A 3F5JA 4W86A 2W62A 2BVDA 4J3SA 3SUTA 3PTQA 1KGXA 1C8XA 1E5JA 3GM8A 2OWCA 3WNLA 3MMUA 1WDPA 5CGMA 2JFEX 2XTKA 5I0DA 2VR5A 1LL4A 1LLOA 1NARA 2CBJA 3PZUA 4L4OA 3GNPA 2ZX8A 2WYSA 3OGRA 1QI2A 2O9RA 4IPLA 4PSPA 1HT6A 3A4AA 3QOKA 1H09A 1MW1A 1K6AA 1FHLA 4JCMA 4HU8A 3MMDA 3T0DA 2WVTA 1HJQA 4MPKA 4KWUA 3O2LA 3WH7A 4UQEA 1LWJA 4IPNB 1IZJA 2VZOA 5A8MA 1CXEA 3BCDA 3VM7A 4W89A 3VIPA 1A3HA 5I6SA 3PZTA 4GZEA 7A3HA 1XSIA 3OG2A 1TE1A 3N11A 5A2CA 4B3LA 3SCSA 2J7DA 2VT0A 4FLQA 4PMQA 2GVYA 3M7SA 1HKKA 4KRUA 3FW6A 1IV8A 5GNZA 3W25A 2A3HA 1J0IA 4ATLA 1TA3A 4WKAA 4PMOA 1XD0A 1NOUA 4CD4A 1XCWA 3ZJ6A 2EQDA 2OYMA 1E43A 2ZICA 2J7CA 1WDSA 5A6SA 4J3TA 2DH2A 2W4XA 1QBAA 3BMWA 1E6ZA 3FHAA 1E73M 3BSHA 1YHTA 1E4IA 2J4GA 3CTTA 2YDRA 3AIUA 2ZUSA 4V27A 3W37A 5I2UA 5HXMA 3WY1A 3WUEA 1ZL1A 1WCGA 1MXGA 1SFSA 3HN3A 1UWSA 4UQBA 1J0YA 4OBRA 4HA1A 3CHFA 2WPGA 1GONA 3OA5A 4UFLA 1S46A 1TMQA 3VM5A 3ZQ9A 1BFNA 1UKSA 3W29A 3ECQA 4TX6A 4Z2IA 1CGXA 4ZE4A 2B31A 4D6FA 4J28A 4MNKA 4GXPA 1EDQA 2W66A 3A3HA 2PBGA 4WK9A 4HOXA 3VD9A 1Q6CA 3OZOA 1DP0A 3MU7A 3VGDA 3PZIA 1LL7A 5IXEA 3WUBA 2ZUTA 3A4XA 5FKYA 4U3AA 4UQCA 4GPNA 5LYRA 4H41A 4M1RA 3SCVA 3D5HA 1E6SM 1LQ0A 2A3CA 1HJUA 4FMVA 5I79A 4AZ5A 5E0FA 1G0CA 1UR1A 3OGSA 1UD2A 4CU7A 2NT0A 4TXEA 4AD4A 4S3JA 4TVUA 1QNQA 3ARRA 3ZR6A 5I77A 4CD8A 4DUWA 3RCNA 4MJ4A 2E9BA 3RIKA 2VRJA 2GK1A 4BF7A 1B90A 1UWUA 1JIBA 2WW5A 1RP9A 4HPHA 1XH1A 4W8BA 3N17A 8A3HA 5KEZA 1KB3A 1UKPA 2EEXA 2G41A 1OD8A 5D8WA 1YQ2A 3WMSA 4PTWA 1Q6EA 3B9EA 2JEPA 3T08A 1C93A 2DT0A 4PYSA 4KRTA 3WQ6A 2CBIA 3ZM8A 1KXTA 2QLYA 3GNRA 2J25A 4UFIA 1I75A 3RPMA 2XGBA 3SCRA 2QMKA 2V38A 2X09A 3RJYA 3MANA 4FLSA 4D6HA 3T0AA 1QHPA 3KEHA 1LF1A 1JD9A 3BLPX 1M53A 1V6YA 2VMFA 3WNNA 2EPKX 2C7FA 1WZAA 4MDPA 1B3WA 4PN2A 1E6QM 4CCDA 2WMFA 5EB8A 1L0PA 3T2OA 1TCMA 1J0HA 1BYCA 2J75A 3W0KA 4D6IA 4AXNA 2VZVA 1E4MM 1EHNA 1PAMA 2UY5A 3UERA 2CHOA 2WCGA 2VQTA 4JFTA 4MAZA 1C8YA 2WVVA 4MNMA 4HZ8A 4KMQA 2O9PA 3CHDA 1V6UA 2QHAA 4Z2KA 2EBNA 2XWDA 2J7HA 2CYGA 2VZSA 1UD3A 3MV11 4M81A 2DPEA 2DT1A 2ZXBA 1WDRA 1FFRA 4GI6A 2JF7A 5ABGA 1KXHA 3T0BA 1ISVA 2J74A 4FLOA 3WEZA 4PMYA 1V03A 1DWAM 2E8YA 1JZ3A 4WF7A 2J8GA 3ZOAA 3AHYA 1XGZA 2CHNA 5IHSA 1BVZA 1JYXA 3WD1A 4ZEPA 4QAWA 4U5IA 2BXYA 2VTFA 3AMGA 4P7RA 3ZO9A 3GZAA 4AD3A 4JAWA 3EMQA 1GJWA 4UOJA 5F7UA 1UR2A 1UD8A 3LPPA 1EO7A 1R86A 3OB8A 4BQ5A 4GINA 5JIWA 4GQRA 4H04A 4AC1X 4D1IA 1W3JA 4M8UA 4HMDA 2OWWA 1R8LA 2ZUMA 1D2KA 4J3WA 1GVIA 2J7BA 4WSJA 1E6XM 1E72M 1JI1A 1G1YA 2ZXDA 3W53A 4MADA 1JD7A 1EQCA 4UNIA 2IUZA 1LG1A 1W1TA 2D2OA 1NWRA 3CIVA 4M56A 2BNJA 1WAWA 3AMDA 4D6EA 2HVMA 2J7EA 2OSXA 4UFHA 2ZOXA 1KCKA 4JIEA 1GUVA 2WC4A 1H3GA 1VFMA 4BZYA 2PBOA 5CPTA 4AD1A 3EMZA 4WLCA 4TTUA 5CJ5A 3VGBA 4W5UA 4XUYA 4NRSA 1E56A 4BQ4A 4W7UA 1VEOA 3VILA 3WD2A 3SEPA 3WMCA 2GJRA 3ARUA 1FH9A 5CLWA 3RM8A 1QW9A 1DWGM 1ZU8A 3SUVA 1QI3A 1W3KA 1G94A 3W82A 1WE5A 3WDPP 3ZJ8A 3WBEA 3KL3A 3SURA 1SR0A 3M07A 3L4WA 3MKKA 3WEMA 4URIA 3THDA 1F4HA 3WH5A 4PMNA 4PTVA 1FA2A 5E6ZA 1VEMA 4KH2A 1OGBA 1JZ2A 3VMNA 4P7OA 4RE3A 2CESA 5FOOA 3CHCA 2WC7A 2X0YA 2GJXA 1DTUA 4V28A 3KL0A 5TD4A 1PIFA 2WLZA 3SIMA 3WF2A 4B9ZA 4N0RA 5ABHA 1LG2A 1AMYA 3UCQA 1KXQA 1QBBA 2E3ZA 5A8NA 2EJ1A 3BCFA 4UOQA 2ZUWA 2D3NA 3QHOA 4AWEA 3CUGA 1NWTA 5A6JA 2WMIA 1N82A 2WHJA 4MNLA 1OT2A 5GNYA 1BSIA 1EO5A 5C70A 1GOWA 4H8UA 5BYWA 1HJSA 3FN9A 3VINA 2BXZA 3U7BA 5E6YA 2FGZA 2XPKA 4DWSB 3A47A 1AVAA 1ZBWA 3N04A 1G5AA 2C8NA 1OGGA 3MUAA 3QGVA 3VPLA 4D6CA 3ARQA 2BHYA 1DWIM 4MB1A 4OUEA 2MANA 3SCUA 4GI9A 4GO9A 3AIWA 5ABEA 2DT2A 3SCPA 1OB0A 3G6LA 3U5YA 3BAKA 5HOSA 2VX5A 1D3CA 1E1FA 1MW2A 3WEOA 5IFPA 1GORA 2VOTA 4PMUA 3WH9A 3VNZA 3PZVA 2D23A 1ODZA 4ATWA 1UQYA 3APGA 4W5ZA 1JYNA 4MB4A 3F5LA 4ACZB 1ISZA 1JG9A 1NQ6A 1HKMA 3VD3A 1TG7A 4EANA 1UZ4A 3IANA 5AYBA 2JF6A 2WBKA 3L4YA 3W81A 1MQQA 1BYAA 1CECA 4LYRA 3L4UA 1Y7VA 3TTYA 2GDUA 2XVKA 4YHEA 2OYKA 1E3XA 3OLDA 1JYWA 1TZ7A 5AY7A 3CZGA 1K9DA 1GOOA 3PBGA 4AIEA 1HN1A 4PRWA 2JEQA 3DYMA 2YA0A 1E6RA 1HL8A 1BG9A 1E71M 3DHUA 2J79A 3W38A 5A3HA 5I3DA 2YL8A 1JF6A 4UZSA 2ESCA 1V3JA 3MS8A 3BAXA 3BAJA 4HOWA 3UG4A 4ZXLA 2DSVA 4MNJA 5DMYA 5M5DA 1JZ4A 1X6LA 2IXUA 2D20A 3N18A 4MTVA 2X05A 5JIPA 3TOPA 3IAPA 2Q8XA 4PMRA 6CGTA 4B15A 1V0KA 3MUZ1 5E70A 4HMCA 3IK2A 4AY1A 3SCNA 1UH3A 1V3KA 4Q7NA 3U7VA 2CPUA 5ABFB 2WHLA 1BLIA 3B8SA 3FY1A 2J7FA 1Q6GA 1JXJA 3VIIA 3L2MA 3WDJA 4HP5A 3AISA 5BXSA 4DUXA 4B3KA 3WQ8A 5ABFA 3ZT7A 3BGAA 3E1F1 4JFUA 4XX6A 5FL1A 1ZS2A 1PIGA 1QI0A 3TP4A 1KXVA 4MB3A 3WNOA 1TR1A 1W3HA 3F5KA 1FH7A 1E9LA 3CPUA 4WIWA 3AIBA 1VAHA 2OSYA 3BXWA 1JZ5A 1ISWA 3EYPA 3CZLA 3HMCA 2BVYA 2XFYA 2YBTA 2UY2A 1B1YA 2A3BA 4UQAA 2WLYA 1ZBVA 5LA2A 3BAYA 4AW7A 1BQCA 4HU0A 3SUSA 1PEZA 1QVBA 1E1EA 1XC6A 1JZ7A 1NWSA 3A4WA 2F61A 2ZUVA 3I3EA 4UFJA 3JUGA 3K8LA 3W28A 1GOMA 3AI0A 1UHVA 4AD2A 3WENA 3PZNA 2WVSA 4NZCA 1K9FA 4HZ6A 4JZ5A 1TVPA 4OOZA 5CPQA 1CLXA 3WF0A 4OKDA 2QPUA 2QMJA 1KGWA 2F8QA 4H8VA 1PX4A 5DT7A 1J01A 2E8ZA 1ISXA 2XG9A 1C90A 1R87A 3VIMA 2YIHA 4LPCA 2J8FA 1EGZA 3FHQA 4LX4A 1EDTA 3AMKA 2VZTA 3GBDA 2FDMA 2JIEA 2ZWYA 1CENA 2XYLA 4S3KA 2BHUA 4UCFA 1HKIA 3WF3A 4JHOA 2XWEA 1CDGA 3IAQA 1EOMA 3CZ8A 2YJQA 4U2YA 2JALA 4J3XA 4W8LA 1JNDA 3MO4A 3MUIA 4CD5A 3F4VA 2X0HA 3AXHA 5FL0A 1M04A 3WSUA 2EPNA 4LGXA 3L4TA 4GI8A 3AICA 3L4VA 2CCRA 2VX7A 2VL4A 4C7GA 2CERA 2WNWA 3WDQA 2YL9A 1MVYA 2EPLX 2YA2A 1VBUA 1M03A 3NJ3A 1V02A 1UWQA 4AZIA 2RGMA 4Z2HA 1GZJA 2O92A 3AXIA 1MFUA 2DSZA 2G3NA 1HKJA 1GQJA 3RDKA 1W9XA 1CTNA 3BH4A 3CMGA 1SMDA 3W6MA 1OSEA 3VIOA 1HL9A 3ARTA 1CXHA 1CXKA 4TVDA 2G3IA 3MSGA 3ARVA 3CZEA 5DEZA 5HPOA 3AOFA 3RILA 2DIEA 2Z1SA 3OBAA 2W63A 1UQZA 4CCCA 5BXRA 2XFFA 3CUFA 1QI4A 3ALGA 5BWFA 3UR8A 3VGFA 1UWTA 5A95A 3WDRA 3TONA 3TTOA 4U2ZA 1GPFA 3CH9A 3K46A 1MFVA 4MAVA 3VGHA 4CN4A 1E6NA 4CVUA 2XM2A 4NRRA 3ZT6A 1ODUA 5A6AA 2WWCA 5GPRA 1B3ZA 1W1VA 1MW0A 5CSUA 5M3WA 1GOQA 3WUGA 1H0IA 4AZHA 4FK9A 2W92A 4BQ2A 2D0HA 3NDZA 2GFTA 3AHXA 4UQ9A 5I24A 2YKKA 2VO5A 4YHGA 1UKTA 2XVNA 1OBAA 1X1NA 1X6NA 4UOZA 4B9YA 1JDCA 3ZT5A 4HA3A 4WKFA 1JNEA 1PX3A 1CPUA 2XIIA 1JZ8A 3BLKA 4K68A 5D4YA 3WH6A 2NSXA 3NSMA 4P8XA 4W84A 3AS2A 4MDOA 4PMZA 3B9DA 1UH4A 2CNCA 2E9MA 1B30A 4F9DA 2VZUA 3CO4A 2J7GA 3LPGA 4BQ3A 5A6KA 2V5CA 1JFHA 4LYQA 1B9ZA 4E8CA 2Z1KA 3NSNA 1ITCA 1ZBKA 3VIKA 2C0HA 3QR3A 5EMYA 1MYRA 3VGEA 4M29A 1FP9A 1B3XA 1UWIA 1JDDA 1TUXA 3BMVA 1GOIA 3NIYA 2V5DA 4ACYA 3RMEA 4L4PA 2WXDM 2DIJA 1RH9A 2D24A 1XSJA 2WWDA 3MSDA 2XVGA 4P7NA 1GVYA 3GH7A 3S6TA 1XH2A 2QPSA 3KL5A 3W24A 3CLWA 1UA7A 2EXOA 4W7VA 1HP4A 3WBAA 2WM0A 3ZSSA 4AZ6A 2DT3A 3K8MA 1KQZA 3VX0A 1KCLA 4QCFA 3KE0A 2WK2A 5FCZA 1DHKA 4GQQA 3S2CA 1SMAA 3PZOA 1WB0A 4HA4A 3O9NA 3WMBA 4R27A 1KBBA 4EK7A 3UETA 1CNVA 3POCA 4HMEA 2FHBA 3M46A 2VCBA 4CN6A 4PSRA 4QLLA 3ZSTA 4TVCA 1V6WA 1HIZA 2VUYA 4XZBA 1H0GA 1HVQA 2RGLA 4D6GA 2ZX7A 1V3LA 4FF5A 1OGSA 4BCEA 5GNXA 5IDIA 1DEDA 3WQVA 5I5RA 1RD6A 1R85A 3B9AA 3ZMRA 3DYOA 7CGTA 3N15A 4F66A 4PEEA 3AS1A 1CGVA 1UKQA 1KWGA 2QV4A 1UWRA 4PBGA 3AJ7A 2FH6A 2AAAA 4KGLA 2V3DA 3NYDA 4RE4A 4AZCB 1H2JA 1E0WA 2EPOA 5D9PA 1E4LA 1C92A 1F4AA 3AZSA 1NOFA 9CGTA 4QP0A 4DM2A 4GZJA 3WFZA 3L4ZA 2CBUA 1P6WA 2X8RA 3UESA 4W85A 3EDEA 3WUFA 2YL5A 3AYRA 4CU8A 1VFOA 3IJ7A 2ZXQA 2V3FA 1HX0A 3AFBA 4AIUA 4P7LA 4U3CA 1KGUA 4HZ7A 4DWSC 2CITA 2JIWA 3NDYA 5CGTA 1QHZA 1A47A 3ALFA 4LYPA 4Z2LA 1L8NA 4A3HA 3BSGA 3CHEA 4LXFA 4JFVA 4U31A 3SUUA 3AIEA 1EHAA 4PTXA 3WD0A 2YLAA 1JXKA 1BAGA 1WPCA 1AQHA 3FXYA 3WH8A 5D9MA 4ZXOA 4GKLA 2D3LA 2PC8A 1PPIA 2DEPA 3WQWA 2PB1A 7TAAA 1ITXA 2GDVA 2WKGA 3POHA 1NP0A 6A3HA 2BV9A 1ECEA 4EE9A 2J78A 3RM4A 5A8OA 2VRQA 1OT1A 1GNXA 1ISYA 2XJ7A 1JAEA 1VB9A 1BGAA 2BY3A 5BRQA 2NT1A 1EDGA 5CG0A 1H11A 1OINA 2WMGA 4CU6A 1V3MA 1E0XA 1V3HA 4DWSA 1EQPA 3QHMA 1E0VA 6TAAA 5CQ1A 1GCYA 4E4PA 2ZX9A 3AXXA 2WCSA 1DWFM 1U2YA 2WC3A 2D0FA 3RO8A 1VFUA 2J47A 5EBAA 3ZR5A 2PWGA 1CXFA 1BTCA 2BY1A 2HISA 1JGIA 2DQXA 2PWHA 4JKKA 2WMKA 3W4RA 3DYPA 5M03A 4H2CA 2DSUA 4E8DA 3UEQA 3EMCA 2QF8A 1D7FA 4GO8A 4IM4A 4AZGA 3PZGA 1QNSA 1GQIA 1BYBA 5BROA 5DF0A 4UR9A 3VU2A 3EBVA 1AQ0A 1V02E 1W9UA 3VO0A 3W26A 4JFWA 3RM9A 3WL1A 3WDHA 4ACZA 2BS9A 4TOQA 3VTRA 4A4AA 1V3IA 2WANA 5JBEA 3VD4A 2ZE0A 4D1JA 5IFTA 3AYSA 4W7WA 2YOCA 5AC5A 1CEOA 2JE8A 1Q6FA 1XYFA 4D71A 1NWUA 5A69A 4OIFA 1E4NA 1QHOA 3WNMA 1VIWA 4C7FA 1NP2A 1EXPA 1E55A 3VDBA 4W8AA 2WZHA 3VMOA 4H7VA 3PZMA 1U30A 5BXTA 1OIFA 1WNOA 3VVGA 1B31A 1HXJA 2ZX6A 3I3BA 3LMYA 3L4XA 3FAXA 4NF7A 1J0ZA 4QLKA 5JBDA 5CZKA 3M6DA 1XRVA 4DM1A 3N1AA 5BRPA 2WHMA 4CVWA 5A6BD 3AIVA 1JYVA 1B0IA 4PMXA 1ZJAA 1NOWA 1UG6A 2V3GA 5DFAA 1CXIA 2WSPA 2OWXA 3VGGA 2VVSA 2DH3A 2VX6A 4AEFA 2VC9A 1PZ2A 3GXFA 4NSBA 5FD0A 2GJPA 2V3EA 1W32A 4PCSA 1UH2A 4F9JA 1HP5A 4P8UA 1UD5A 1VEPA 5E9AA 1WZKA 2VCAA 1MXDA 3AZRA 5AYIA 3EDJA 3GTNA 1UR9A 3OGVA 4XB3A 3WQ5A 2A3EA 1BHGA 1EOKA 3IJ9A 1W9PA 3DECA 1AQMA 5EFFA 1W2VA 3U57A 1GOKA 3QHNA 3HU7A 1GHSA 4PMVA 5DT5A 2VCCA 4HPGA 3TTQA 3CUHA 2UY4A 1BF2A 3PTKA 3WKZA 1UD6A 2VURA 4Q22A 1TA3B 4EKJA 5CSYA 4BS0A 4EAMA 2UY3A 5KZ6A 3U5UA 1BPLB 3L2LA 4ML4A 3VD7A 3ARPA 2YBUA 5LA1A 2FHFA 1MW3A 1V6VA 1QOXA 1V0NA 3EDKA 1UA3A 4QCEA 4WJXA 2BHZA 2OSWA 3CMJA 4J27A 3WN6A 3WF1A 4UQDA 1WZLA 2G3MA 2VRKA 3A6OA 1J10A 4AISA 3GNOA 4AIOA 4IUGA 1E6PA 3VUPA 1DWHM 1XHGA 3O6AA 4Z2JA 4P8VA 1US2A 2BVTA 1UKOA 3K4AA 4OBSA 4GZIA 4W88A 5A1AA 5A2BA 4XZWA 1M01A 3GH5A 4AYSA 1WDQA 2VX4A 1J11A 4JFSA 5HPCA 1V0LA 2Y8VA 2FH8A 3DHPA 2YDSA 4OOUA 1KFWA 3WF4A 4ATDA 3ZJ7A 5C8BB 1CWYA 1XV8A 2E4TA 2XVPA 2D1ZA 4HOZA 2WSKA 5E09A 1UD4A 3AHVA 4F8XA 1H49A 2ZUUA 1J12A 1QPKA 3LPFA 4YPJA 2YA1A 3ARWA 1B3VA 1J9YA 1UR0A 2AMGA 3AIRA 1PBGA 1ESWA 1NH6A 2CXGA 3J7HA 1W2PA 2X2YA 5JUVA 4ZE5A 5M17A 1IZKA 1H1NA 4DWSD 2OYLA 4CGTA 3WL0A 3ZIZA 3NSXA 2W67A 2DSWA 4JL1A 2GK1B 1V6XA 2ZIDA 1HJVA 1VENA 1W9VA 1K9EA 1VJZA 1OIMA 4JHZA 1HF6A 1WKYA 1CGTA 3FAWA 4QDMA 4JKMA 2UWFA 2PWEA 3UG3A 4D6DA 1DWJM 2CIPA 1W9DM 4UTFA 2WVUA 2XM1A 1BGGA 1G9HA 1KQYA 1QNRA 4X9YA 3WD3A 4HTYA 4JKLA 4AEEA 2F2HA 4UFMA 1LWHA 3IJ8A 1I1XA 3AMCA 1CBGA 3CGTA 4WKHA 2W5FA 2Y8KA 4IISA 1I1WA 3VDHA 1E70M 2VNCA 4QLJA 3WDIA 3EDDA 1UUQA 1W3LA 1NM9A 4B16A 4E2OA 1W1PA 1Q6DA 3K4DA 1JI2A 2J62A 1C7SA 3MV01 3ZJKA 1XSKA 2EO7A 1J18A 1WZMA 3G6MA 2YL6A 3VIFA 1EH9A 1KR0A 4RE2A 2PWFA 1PJ9A 2CETA 4CD6A 1OWQA 2OLHA 2WVVB 4QFUA 1O7AA 3RJXA 1RP8A 3GXIA 2WB5A 2CKSA 3AQUA 3VDAA 1LJYA 1XH0A 1GQKA 1UYQA 3VMPA 2ZXAA 3N9KA 1FHDA 5A2AA 1ZBCA 1B2YA
chains in the Genus database with same CATH superfamily
1HJXA 2E6YA 4O4WA 2G3JA 3T07A 3WNKA 1JCYA 1UR4A 4DUVA 1OK6A 2Q09A 1ECQA 3IGHX 2TSYA 1O6IA 3R8GA 1PHWA 1TFVA 4J3VA 4NJHA 4JIHA 3UVIA 2OQLA 3UGRA 3WELA 3G1RA 1CGWA 5F2LA 1FDJA 3I68A 1UJQA 2F6UA 2YCEA 3EWYA 1QPRA 1ZB5A 4N6EA 4ZOAA 4V2XA 4LUSB 1OADA 4NX0A 4CUCA 5C71A 1CGUA 3AHTA 4M80A 4PUEA 2RHGA 1GWJA 3LHYA 3C3UA 5I09A 3IGUA 3KZSA 1JAKA 1DJZA 1E5NA 2YFOA 3KS6A 3MA8A 1TVNA 4ZL1A 4JYFA 3DFTA 1LOLA 1DIEA 3PN8A 1OF6A 1H5VA 1QXLA 1XFCA 3UG5A 3FV9A 3T78A 1RY8A 4YLWA 3GYCA 3ZXWA 4D8AA 4AH7A 3PAOA 1RPKA 3LM3A 4WGXA 3W1NA 5E0CA 1QAPA 4AD5A 1OVDA 3QOMA 3KTSA 2QAPA 1DJIA 4DB7A 1V0MA 2NLYA 3A13A 5EKYA 1VIZA 4HK6A 1ZLPA 3WK2A 1WO2A 4LYKA 3SCTA 4NASA 5BCAA 3H2MA 1DJNA 2Y6ZA 3VNYA 1M7JA 4WGHA 1SUXA 4TX8A 2V2DA 5G1MA 1W31A 1NIUA 5G1YA 3W6LA 4OZOA 4W87A 4IIDA 3OVPA 5I23A 4UWMA 4CD7A 3O15A 2Z0IA 3P61A 2Z4GA 4U33A 2OQHA 2HZGA 3PHAA 2HPIA 3W75A 3GXDA 3UZJA 4OQVA 3AYVA 1Z7AA 3BDKA 2PTZA 1LOSA 2XVLA 3CUJA 4F3HA 4UZUA 4EOUA 1XCXA 3PVFA 4PTDA 2VFEA 3UR7A 2WCAA 1UP3A 2YLLA 3GBEA 1QNPA 1H1YA 1IEQA 3GH4A 3N19B 1C7TA 2O9OA 4FR6A 3DFOA 4GIAA 2QKFA 3USBA 2VI0A 5HUPA 1BYDA 4HB7A 3BQ5A 3BOFA 2VR2A 3NQ6A 3W2UA 4JNZA 3KCLA 2DSKA 4H8HA 4JGDA 1UZ1A 1GVQA 3PS7A 3APYA 4X61A 2PI6A 5DY2A 4X0NA 1EX5A 1XC4A 3BTNA 2Y7EA 2LLEA 2QUUA 1GYMA 1QU4A 2ACSA 4AWUA 1W1YA 1OD0A 3CBWA 2V5BA 3NG3A 4TUFA 4J3UA 2PLKA 3NQBA 3REQA 2P10A 1GJPA 1EA9C 3MMWA 3CQIA 5DLCA 4MB5A 3NA8A 4HSOA 1CLVA 4F79A 3H7VA 3PWAA 4JEQA 2OO6A 5JBFA 3UCCA 1PDYA 4PFMA 2XIBA 3W7DA 4C7DA 1UMYA 3AZTA 4M24A 3HZ3A 2F7FA 4KWSA 4L64A 3VKAA 3QV8A 3GU9A 3AAMA 3MQTA 3VZYA 5CBJA 3CEPA 4GX8A 1G6CA 3VIHA 2Y5EA 4ZO8A 2WZIA 4HNTA 4MJ2A 8XIMA 4JNMA 3OLIA 4H8NA 3OZPA 1TTIA 3OA3A 5HDRA 1YE6A 5EFDA 4AG0A 3WYZA 2REQA 5LA0A 1JL8A 1Q4WA 3K1DA 3AROA 1ML1A 1R47A 4RX0A 3G0XA 4PGLA 3PZQA 5B7YA 2X40A 2QJJA 5K2ZA 4EPBC 4PUUA 1SYTA 5FACA 4NI3A 4O0QA 1H4PA 1CIUA 3CPGA 5LZLA 1VLIA 3WX7A 5CBIA 1ONWA 3MUY1 4GUJA 3VKKA 3BAIA 3WFLA 3CQ0A 3UW6A 4DBEA 5DN1A 2W62A 4J3SA 4JTQA 4NZ3A 3KVJA 1C8XA 3GM8A 3NEVA 2OWCA 3GSMA 3MMUA 3P62A 4WXZA 1EFZA 3FJ4A 4NAEA 3W7PA 2VR5A 1LLOA 2CBJA 4IF2A 1SW0A 3PZUA 4L6OA 4L4OA 4J1OA 4GK8A 2VWSA 3LYEA 1R2RA 4JCMA 1SU5A 4HU8A 1N55A 1WUEA 4AXKA 4BI6A 1KV5A 3O2LA 5G4EA 3LOTA 4HPXA 5ENLA 3BW2A 1KRAC 1LWJA 5A8MA 3W2JA 4W89A 3VIPA 5EA9A 3KRBA 1AW1A 4GZEA 4QGCA 7A3HA 3OG2A 3N11A 5A2CA 1FWHC 3R4IA 3SCSA 5D37A 2J7DA 1HKKA 4G8TA 2Y7DA 2I14A 2YFNA 3FW6A 3R79A 4C1NA 3L5MA 2A3HA 2A79A 1JCMP 1NTHA 5LNRA 1XD0A 1VD6A 1XCWA 5I06A 2RAGA 2OYMA 1K02A 2J7CA 1WDSA 2DH2A 2W4XA 1E73M 1E4IA 2Z1XA 4S39A 1TV3A 5FF4A 3C8NA 4NXSA 3WY1A 1H63A 4EAYA 1WCGA 1MXGA 1A5CA 1UWSA 1QOPA 4OBRA 1GT8A 1F3TA 1UASA 3BLDA 2WPGA 4XIMA 3BPWA 4UFLA 3M0VA 1KCXA 3ZQ9A 1GG1A 1VCFA 2XSXA 3I10A 1YKWA 3BARA 3ECQA 4TX6A 4KCUA 2CZFA 4ZE4A 4YNGA 3MVIA 2AL1A 4J28A 2H6RA 4GXPA 4I9AA 5RUBA 1J79A 3VD9A 2R6OA 3BJSA 3MU7A 2YSWA 1TQXA 2QIWA 4DWDA 1TO3A 5IXEA 3PG9A 5KETA 4S3BA 3T05A 2E7FA 4U3AA 3JR2A 3N2XA 4A3RA 4DN1A 3KS5A 2QW5A 3D5HA 1W0MA 9RUBA 4MIMA 2A3CA 1HJUA 4GA8A 3OOQA 4XVEA 5E0FA 3NXLA 4FP1A 1UD2A 1VFHA 2AQOA 4GG9A 1TJRA 4S3JA 4IT1A 4CD8A 4DUWA 3RCNA 5KZMA 3P84A 4GBUA 4MJ4A 2GK1A 1VLWA 4BF7A 2OX1A 1XH1A 4W8BA 8A3HA 2G50A 3P7YA 1KB3A 2R14A 4N9EA 3FGCB 4GUIA 1OD8A 3LENA 4XO7A 2ZA2A 5D8WA 3M9YA 3WQEA 4FXSA 3Q2DA 1Q6EA 4UTHA 3KXQA 1E51A 2DT0A 4PYSA 1KM2A 4KRTA 3WQ6A 3PWGA 1KXTA 2ISWA 2J25A 3CMFA 3W1QA 4DO7A 1LUCA 1I75A 2FMNA 3B9NA 3L2IA 4GYFA 3VCNA 1LCOA 3RJYA 3N9SA 2QVNA 4FLSA 4LNYA 1DJGA 4D6HA 2ATSA 6REQA 1JD9A 2P53A 3JS3A 3WNNA 4US5D 2EPKX 2C15A 2WSQA 4MDPA 1E6QM 3NFUA 4L6DA 3N4EA 4OV9A 4PRRA 4Q4PA 3BGJA 2IPJA 2R9RA 1JGMA 1EHNA 3H8AA 1DXFA 1Q85A 1PAMA 3TQVA 1HTIA 4NG3A 2WCGA 3H6OA 4UTMA 2VQTA 2WZMA 4AFYA 2UZ9A 2WVVA 1THFD 3P0XA 3GNXA 3W07A 4HZ8A 3SR7A 1V6UA 3W85A 1G7VA 4H6QA 4H4IA 3QF0A 2XWDA 2IW0A 1ZCCA 3U8GA 4LFYA 5D2YA 1F3WA 5AHIA 4GI6A 1FFRA 2FFIA 3QY8A 4FX6M 3EPNA 1ISVA 2QGHA 3HIJA 4GC4A 3N2BA 4DNHA 1J96A 3CXOA 2DZTA 2OU4A 3L0NA 4XZ9A 3KOYA 3ZOAA 1U5VA 3AHYA 1XGZA 1BVZA 1JYXA 1S1PA 4ZEPA 2RH9A 4P7RA 1JQXA 2J9ZA 4H9UA 3GZAA 4RNHA 3KP1A 1OG0A 5F7UA 3KRZA 3NO1A 4LW7A 1Q6QA 1TB3A 1W5QA 1EO7A 3R7MA 3OB8A 2GGIA 4H04A 3BSMA 3WMLA 5FJPA 1SW7A 1D2KA 1P0NA 1GVIA 1JI1A 1G1YA 2ZXDA 3QPYA 5C9ZA 2WM1A 4MADA 2GVGA 4ZSUA 1DE5A 2IUZA 4WDXA 1O1HA 2D2OA 4M56A 4Z0SA 1MUWA 5CZJA 4D6EA 2HVMA 2J7EA 2OSXA 4UFHA 1KCKA 5EBUA 2C16A 1H3GA 1EKOA 1EZWA 2CZDA 4O1CA 1TX2A 5KTLA 3H70A 1YBQA 4ZB2A 4GY0A 3VGBA 4W5UA 1Z48A 1AD4A 4XUYA 5K3VA 2FIQA 3VILA 4QJ4B 4AEOA 4DF1A 1XDJA 2WNQA 4MPQA 3RM8A 1SZFA 5F2IA 5MKGB 1ZU8A 3GNDA 1QI3A 4FX7A 3B8VA 5E5CA 3WDPP 1T96A 3KL3A 3QYSA 1NDWA 1SR0A 4HIBA 3L4WA 3MKKA 4MWAC 3WEMA 3MO7A 4URIA 1UPPA 3THDA 1XISA 3NZ1A 4RDYA 4K8EA 2OKOA 4KH2A 1JZ2A 2B4GA 2CESA 3QRHA 1DTUA 4V28A 3KL0A 4PUMA 2Z7GA 3LCIA 3CB8A 3A24A 3V3WA 2Q02A 1ZCOA 1VBGA 3QZAA 4DVOA 5AKQA 4PR4A 2PAJA 4RW3A 3OODA 2G4JA 4IMDA 1KLYA 3R10A 1A49A 4NJIA 1KRCC 3CO8A 2OPJA 3UCQA 5A8NA 1ITUA 2EJ1A 2HSAA 4JDBA 4R7WA 2D3NA 4HNUA 1VBHA 4C90A 3W7EA 5CPNA 1X7FA 4MNLA 2IKHA 1A80A 3LBOA 5FJUA 1HJSA 3GTFA 3FN9A 4IQLA 2OZ0A 3D0CA 5H8PA 3K1GA 4PFHA 2I17A 3RUBL 4DWSB 1AW5A 3E0WA 3A47A 1AVAA 4YU1A 5F4WA 2C79A 5DCDA 2E5BA 1DL3A 1UB3A 5T9BG 4I9TA 3LEPA 3LM7A 3ZVIA 4FZIA 5LGXA 3OEXA 3EOUA 4NL1A 4GO9A 3AIWA 1CB7B 5ABEA 3SCPA 1FWCC 1OB0A 3G6LA 4GFSA 1IZCA 3BAKA 4I5RA 3VNDA 1D3CA 5IFPA 2HS6A 3NL5A 3TYUA 4B4FA 2VOTA 3WH9A 1VFTA 4DNMA 1TR9A 4Q6JA 1EIXA 2D23A 3PPCA 5DBTA 1RA0A 1ISZA 1NQ6A 1TG7A 3IANA 3G2GA 3MYOA 2Q01A 3QQWA 1MQQA 4IQDA 1K7EA 1PS9A 2WO5A 5I3GA 4ECLA 4XD3A 3L4UA 4LBUA 4YHEA 5LNSA 1DV7A 3OLDA 4DELA 1S2WA 5AY7A 1KBJA 1MNSA 1DQXA 3SQSA 1K9DA 1GOOA 3PBGA 4AIEA 3W87A 2MNRA 5D32A 3DHFA 3INPA 3OYXA 4YCOA 4FNRA 1RPXA 1HL8A 3M16A 3CQHA 1E71M 2J79A 3W38A 5A3HA 3RU6A 4DJEC 1LLWA 1GTEA 5HAOA 4ES4A 2ESCA 3OJGA 3DEQA 3YPIA 4M5PA 2DSVA 3NVDA 3DZ1A 3IJIA 1W3IA 1I2QA 1Z41A 1JZ4A 1X6LA 2YXGA 4P2VA 4DZHA 5C2XA 4L9XA 5K9XA 3TOPA 3PANA 2Q8XA 4PMRA 5DELA 6CGTA 4U28A 1AH0A 4JTKA 1ELSA 4DBSA 4DO5A 3SCNA 1UWAA 4AWTA 5AC7A 3E0VA 3LHVA 5ABFB 1C8VA 3N2MA 2J7FA 3WDJA 3L2MA 3NVTA 5BXSA 4DUXA 3TH6A 4B3KA 3BGAA 3S1UA 4RZ6A 4XX6A 5GVJA 4M6PA 1QI0A 3TP4A 3HGRA 4MB3A 1TR1A 1XUZA 3EPMA 1FH7A 3MKCA 5DBUA 4C91A 1VAHA 2OSYA 1JZ5A 4QX4A 3CZLA 2PGRA 2O55A 3TIMA 3PB2A 2YBTA 4XD5A 2UY2A 2A3BA 4UQAA 1XDLA 3S46A 5LA2A 1BQCA 3W1TA 2R82A 3W02A 1P48A 3ISIX 2EHHA 2J9YA 2PEVA 1EXBA 3IRSA 2F61A 4ASTA 4HCLA 1X96A 1UC5A 3JUGA 4YIWA 2WVSA 4JZ5A 4LOCA 1TPEA 3WQGA 4OOZA 1YDYA 1R38A 2DP3A 3LRKA 5CPQA 1CLXA 4H6KA 2A7RA 3NDOA 1WUFA 5C0QA 2GVEA 3ITTA 1XXXA 1PX4A 4S3FA 1GK8A 1UJPA 4WSHA 2E8ZA 3U2OA 3JRKA 1QPNA 2CZ5A 1ISXA 2F2KA 1SFJA 4MOZA 1FWWA 5AB3A 1EGZA 1MO0A 4Q7IA 4LX4A 3V7PA 3AMKA 5B80A 3EX3A 2JIEA 4S3KA 1DJWA 2BHUA 3SN4A 3T0TA 4AIBA 4HCDA 4W8LA 3KCJA 1XIGA 3MO4A 4CD5A 3R1ZA 1N2VA 2I5GA 5FL0A 5HWNA 2AMXA 4HJWA 3M0MA 3M5YA 3L4TA 1EJ7L 3B8IA 3AICA 4KCTA 2VL4A 1DKWA 4UCGA 2CERA 2GOKA 3KAOA 4QG9A 3WDQA 4Y8FA 5IOBA 2VELA 1FXPA 1WXJA 2NZLA 1M03A 2FB2A 2FB3A 3DN5A 4AZIA 5FSDC 1PV8A 2O92A 4JX4A 2G3NA 5SWUA 1GQJA 3RDKA 1W9XA 4BEUA 1TVLA 1SMDA 3VIOA 1CXKA 3LQLA 2G3IA 2CLFA 1JPHA 2EJAA 1RCQA 4C65A 1SVDA 1FCUA 1QWKA 2DIEA 3G1FA 1W3TA 2EF9A 3GAKA 1P0DA 3DFPA 3LHWA 4NAFB 4K39A 4X3ZA 2QYGA 3IWPA 1OEPA 3BLIA 1I2RA 2XH2A 3MP4A 3PUOA 4QJ5B 5A5WA 1GPFA 1SSDA 4WDWA 2Z00A 4M3PA 1TIWA 4CN4A 2XM2A 4NRRA 1H0IA 1PKLA 4XBSA 3NDZA 5I24A 4AF0B 4O15A 2BOEX 4O18A 5GJPA 5C9XA 4UOZA 1D3GA 1JDCA 1DJYA 4HA3A 4WKFA 4DJDC 3I4KA 3CS2A 4FOUA 3B8DA 1J2WA 3W2KA 3RGTA 3BLKA 3FJNA 2CLMA 4P8XA 4UMAA 4GC3A 1EBHA 3AUJA 1TX0A 4JIRA 2CNCA 4JTRA 3C3NA 3UXLA 4BQ3A 1IWPA 1ONXA 2FVKA 5MHBA 2XZ7A 1OQFA 2Z25A 4BHYA 8RUCA 4E8CA 2V82A 4O28A 1RQBA 2A6NA 2BOFX 2ZVRA 3VIKA 5CG7A 1IEXA 3MJYA 1FP9A 4JIPA 3BW4A 3EZ4A 1TUXA 2ISSA 3BMVA 3H53A 3NIYA 3HQ1A 3RMEA 4L4PA 4RPPA 3WBWA 3FDGA 2D24A 4N7QA 2CLPA 3HPFA 4UTUA 4DJDA 1GVYA 3GH7A 4E6MA 1XH2A 3OIXA 4FNSA 4IIHA 1ZP4A 1FWEC 2EXOA 1EF2A 4AHPA 1KQZA 3FEMA 4XAFA 1TPH1 2XH7A 4S2CA 2Q8ZA 3UQNA 4K36A 1KFCA 1DHKA 3IARA 4LC6A 4A29A 1OX6A 3HTWA 3PZOA 1WB0A 4PB4A 4HA4A 3NQ7A 4EK7A 3NL3A 3UETA 1CNVA 4I7VA 3POCA 4YVVA 2ZZ5A 4HMEA 2FHBA 2A7PA 3M46A 3NWRA 2VCBA 5HMEA 3EWBX 4YYCA 1V6WA 1OC6A 4XZBA 1QR7A 3EWUA 3VDGA 1KRMA 4GQBA 1GTHA 4BCEA 4XSLA 5GNXA 4K2SA 3OZMA 2C3ZA 4KETA 3WQVA 3K4WA 2A0NA 3DYOA 1LYXA 1A4LA 3N15A 4F66A 4PEEA 4H7CA 3AS1A 1CGVA 1KWGA 5KZDA 3S8HA 3KVLA 4GY7A 3IGSA 3O6CA 1XR2A 2VEKA 4KW2A 3NYDA 4AZCB 4ALDA 3FFSA 1LT7A 1H2JA 4NYYA 4EP8C 5JH2A 4LB4A 1KFEA 4QP0A 1SR9A 3TV8A 3TN3A 3W1MA 3R0KA 1NELA 2CBUA 3CEUA 4XO6A 3I65A 4JTDA 5HANA 4MUZA 1FCVA 4QDPA 2NQ5A 1T40A 4PA8A 2YL5A 3L66A 5LNWA 1Q6RA 2XISA 5TQLA 2ZXQA 3EX6A 3RPDA 2OTDA 2X1TA 5CGTA 2JK2A 3ALFA 3KBWA 4Y9AA 4FXRA 2QULA 3SUUA 2PC4A 3AIEA 2ZZ3A 2VDHA 1H61A 4DZIA 1R3SA 4KEZA 1BAGA 4QSHA 4E0CA 1NEYA 3WH8A 2I5IA 2PC8A 4KEVA 2ABBA 1AODA 7TAAA 1YYAA 2WKGA 4C6PA 4CLMA 3WLQA 3F2CA 3PNUA 3RM4A 1OT1A 1GNXA 4UTTC 3WQCA 3VI2A 3MTWA 1O94A 1I2OA 4JDYA 2GVJA 2AAMA 2BY3A 4FIRA 4LUTA 3UA4A 1H11A 2WMGA 3RLGA 1E0XA 1V3HA 4C60A 4FNTA 3QSTA 2QCDB 1E0VA 4A8IA 1F8IA 5CQ1A 1GCYA 4E4PA 2EG6A 3AXXA 3HG3A 2WCSA 1U2YA 3DGBA 2AL2A 2J47A 5EBAA 3ZR5A 2PWGA 1CXFA 2DQXA 2VXNA 4C5YA 1XIFA 3DYPA 3S5OA 5CC6A 3CYJA 2DSUA 3OW1A 3EMCA 2P8BA 4OFCA 4K8HA 3HM7A 2PTDA 1BYBA 5BROA 4DPQA 3EB4A 2FTYA 4UTTA 2PDKA 3WL1A 2X0SA 3S5ZA 1EJVC 3T6CA 2BG5A 4O1BA 3MUCA 1XYCA 1J5SA 2YOCA 1QTWA 2VHLA 1YNPA 4R9XA 1Q6FA 1BTMA 4E2BA 3NQVA 5A69A 1DJXA 1E4NA 1QHOA 2VC6A 2OJPA 1W56A 3UXDA 2WZHA 3VMOA 3E0IA 2DZPA 1R9YA 1J5TA 4Z1BA 2BWGA 1G69A 1HXJA 3M7WA 2YCLA 3L4XA 7PTDA 1J0ZA 5C54A 1XRVA 4DM1A 2WHMA 3AIVA 3C2OA 3F03K 2C6QA 4PMXA 4YJ5A 2C18A 1TSIA 2Z26A 1CXIA 1UPMB 2NV9A 1W37A 3A23A 2VVSA 4WDUA 3C61A 1PWLA 3H23A 2DH3A 1U1HA 3A3XA 1EWDA 2VC9A 1RLDA 1FVPA 4NSBA 2W79A 1E1CB 2PDUA 5E9AA 3WLNA 4B2DA 2C13A 4ZB5A 1WZKA 3PJUA 1MXDA 2OGJA 3AZRA 4NHVA 3GTNA 4KT2A 3CK5A 2DUXA 3M0ZA 1BHGA 4Y2WA 3DKJA 3DECA 1GOKA 3BMXA 3NQCA 4B90A 4PMVA 3LQGA 4F0HA 2CFFA 2OZ8A 2DW6A 3EWXA 1DJQA 1UCWA 2D2HA 4GJ1A 4IG2B 3CUHA 2UY4A 5CSSA 3TR9A 3LS9A 1Z8AA 2AKZA 3C56A 4GNJA 4EKJA 3QFEA 4PCFA 4BS0A 4EAMA 5BRBA 3HQPA 3LDVA 3GRIA 5LA1A 2E6FA 2ISDA 1MW3A 3QC3A 1T7LA 1QOXA 1RBOB 5DCEA 1KM5A 5LIWX 1E9YB 2OSWA 3CMJA 3GDMA 4J27A 1O12A 3QW3A 4QAIA 3WF1A 1WZLA 4RDVA 4YXGA 4GUHA 3GNOA 4INFA 4IUGA 1ME8A 2ICSA 1E6PA 1SZEA 2JKAA 3VUPA 4I7WA 1DWHM 1REQA 1US2A 2ZRUA 4Q4QA 4O50A 4OBSA 3QPZA 5G4HC 4JTTA 1HGYA 4W88A 4K7YA 4AYSA 1WDQA 4JFSA 3BG9A 3B04A 2FPTA 2PLMA 3QJAA 3G1AA 2ABAA 2YDSA 4OOUA 3C2YA 4ZOCA 1FWNA 4A8LA 3GZ3A 1XV8A 2HMCA 4GNVA 3S1VA 1UD4A 4F8XA 1H49A 5CJMA 2YA1A 4LAOA 3WQPA 2AMGA 1PBGA 1NH6A 3ANUA 2VGBA 3IIOA 2X2YA 3EOEA 5M17A 3O6DA 4DWSD 4K37A 2OYLA 4CGTA 3UPMA 2ZTJA 4WVXA 3NSXA 3S5NA 3DU0A 1HUVA 5AYXA 1RD5A 3KZPA 4JL1A 1V6XA 1XBZA 4XAGA 1OIMA 4WR3A 1GKRA 2E25A 1CGTA 3FAWA 4QDMA 4PZVA 4JKMA 3UG3A 2ZZ4A 4DI9A 3VK5A 2CIPA 2PRLA 3BGGA 1EC9A 1BGGA 1QNRA 1JCTA 3RU8X 1JDFA 1WKEA 3UNTA 3LCHA 3QEZA 1Q6LA 3NPXA 3IJ8A 6ALDA 4WKHA 1X6UA 2Y8KA 3XINA 1LP6A 3NURA 1RJPA 4IISA 2EKCA 3GK0A 5FA5A 1P0KA 3WDIA 4LVGA 3VKJA 1UUQA 1W3LA 4WJEA 3O6YX 4CCZA 1JI2A 9XIMA 4HHMA 1HG3A 2J62A 3C0SA 2PGWA 1C7SA 1SO3A 4LNCA 1J18A 5AHLA 1WZMA 5CGQA 3L65A 1EH9A 1XICA 2PP3A 4RE2A 4US6A 4CD6A 3B97A 4QFUA 1O7AA 2ISVA 4GVFA 2WB5A 2O0TA 3NQFA 2VEIA 1LJYA 1XH0A 3VMPA 4AAJA 1FHDA 1F6PA 1ZBCA 3SSJA 1RCXB 2P8CA 4KESA 3FEQA 2A4AA 3ZWSA 3MYPA 1M7XA 2VQUA 1MDLA 3G1HA 1XBVA 2AOSA 3DUGA 4EACA 5A8QA 3AHZA 4Q8QA 4E3TA 3M44A 3AYTA 4PUDA 3TJXA 3V1HA 4A2SA 3AS0A 2W27A 3ARXA 4A05A 1XF0A 1PZ1A 5IHRA 1Q66A 4R5EA 5D9NA 2XFRA 1K8ZA 1Q4NX 1CXLA 3NQAA 3GVQA 2PDIA 2YDAA 3A9IA 3BG5A 3O05A 4QROA 4J40A 2ZFAA 3HFTA 2WHKA 2QT3A 5D05A 1QK2A 1R3VA 4OGZA 1W5OA 2DZUA 3OU8A 1X38A 4AX6A 1TZ9A 1LBFA 2P1FA 2PTYA 4ZODA 1I9CB 1QDSA 4DUOA 4A35A 3SECA 1TPUA 4F4RA 2W91A 2QDEA 2PF0A 4PL1A 1W9BM 3KWXA 3B8TA 4IFRA 1AH4A 2XHYA 1C8QA 1SJCA 1EYWA 3CTLA 4J35A 3VOCA 1C3FA 4XV0A 1EB3A 1HNYA 3IIXA 2IKJA 4DAIA 5HBFA 3NUKA 4ERGA 3LG3A 3CZKA 3TA9A 1JZ6A 4JTJA 2BLEA 2HE5A 1CZ1A 4FX8A 4EXBA 4IFKB 1B3OA 5HWJA 4C6JA 1HGWA 3BC9A 5AC4A 1F5ZA 1KBKA 4L80A 1FFQA 5BNKA 1M7OA 3T2PA 1K77A 3UGVA 2GSJA 1KLZA 1OG6A 2FGBA 3SO7A 2GLKA 3E0LA 4ZTXA 3WIJA 2VFGA 3UWUA 3UNDA 1W91A 3ZLGA 4JD4A 1G01A 1EC8A 1A4MA 3M41A 3COTA 4GGBA 2GJXB 2WZEA 2VFDA 3EA2A 3IK4A 3A3WA 1EIBA 2ZUNA 4ZO9A 3Q67A 4BKNA 2X16A 4Y6GA 1UOKA 4CQAA 1J6PA 1P7TB 3GVGA 1E15A 3MW7A 1BVNP 2XGIA 4W93A 3E96A 3KOFA 5DY3A 1PIIA 3THCA 5DO8A 5D04C 5CCZA 2J24A 3OLGA 3NPVA 4YN5A 5G2HA 2J77A 2OCZA 4XZHA 5CXPA 3WQDA 1E40A 4EIVA 4MSSA 4C6EA 5AC6A 3KFTA 2ONEA 4AZBA 3LLXA 1UOZA 3GHSA 1US3A 1FOBA 3RHGA 1OFQA 2E0PA 2YDQA 1XLLA 2P3ZA 1XLJA 1SZRA 3QKZA 2PDWA 2XZ9A 1R7AA 2WMHA 4CN1A 3ARSA 1JF5A 3M5XA 3F2BA 3T44A 1CGYA 2RDUA 1Y8BA 1BRLA 1QMLA 1IXPA 2PTWA 2O9TA 3BAWA 3CZJA 4RNFA 1FWRA 5CZTA 1NVMA 4CNSA 1BG4A 1XI3A 2PWDA 2DGAA 1VBRA 1KNWA 1IIGA 5FEWA 3B0PA 3NM3A 3ARYA 3TZNA 4Z1AA 4JTUA 4IP7A 1EL3A 4RK8A 3W01A 4OJYA 2WBGA 4IIGA 1S2TA 3S9IA 3E6EA 2UBPC 3H4GA 2V63A 4LAZA 3PZ9A 2DIKA 1H41A 3EKLA 3GDLA 3BE7A 3EWCA 2D22A 1T99A 4OUIA 4J4KA 1VRXA 3GIPA 3IUIA 4HBKA 4A3QA 2GUYA 2OEMA 4NI8A 4G7EA 3TU9A 3LRMA 3LCLA 1OY0A 3I6RA 1VJSA 2VOMA 3IRDA 2OELA 1GKPA 1LRNA 2Y2WA 5FEPA 3V4BA 4M82A 2ZCGA 4NJKA 2GGHA 4DY1A 3F5JA 3PTQA 1KGXA 4GRSA 2DJLA 1TMLA 1R6WA 5CGMA 2JFEX 1F76A 2HVNA 2CW6A 4GJIA 4HPJA 1EGMA 3OGRA 4C6KA 1JULA 3FIGA 3EX4A 3QOKA 1H09A 1K6AA 1FHLA 1NFPA 7XIMA 1P1XA 3PSVA 1A5BA 3MMDA 3T0DA 2Q3OA 2WVTA 3IPWA 2H9AA 4KWUA 4MJZA 1WXZA 4ICMA 3S47A 3PJXA 3PJTA 1WBJA 3JW7A 2VZOA 3VM7A 1M68A 2ALDA 1TE1A 1M7PA 3QLLA 4HSHA 2VT0A 4HMNA 3M7SA 1W6TA 1EX1A 2QVHA 1S3TC 3G22A 3TJ4A 3PAJA 4BWLC 3SJNA 4WEVX 3HOJA 3NQDA 4WKAA 3HGOA 4ICCX 4LF2A 1GEQA 4PMOA 5J5DA 1NOUA 2Y89A 1E0TA 4GQ0A 1E43A 2Z24A 4JPGA 3W7LA 2ZA3A 2CLEA 1RJQA 4J3TA 4NJJA 1Q7QA 4FNUA 3BSHA 2Z29A 2J4GA 3IUHA 3CTTA 4QS6A 2YDRA 3MWCA 3GG0A 5HXMA 3WUEA 3RAOA 1ZL1A 1SFSA 1TMQA 3GYEA 3PBUA 1HQTA 3WLMA 1WA3A 3DERA 1UKSA 4I5XA 3UD6A 3W29A 4NY2A 3PBMA 1QATA 4V15A 4O8RA 3TA6A 4MNKA 3L68A 1EDQA 5HK4A 1F74A 4BWLA 2NQJA 4MLJA 4WK9A 4HOXA 3TXZA 2WPBA 4LS2A 4K7VA 1LL7A 4LC8A 4F0KA 1PSCA 3UCDA 5DANA 2ZUTA 3WUBA 3A4XA 1BWKA 3TQPA 3MCNA 1A3WA 3PBYA 1DJHA 2OT1A 4GPNA 4IIFA 1E6SM 1LQ0A 3OYZA 4Q33A 1G0CA 1UR1A 3OGSA 2P0OA 3PP7A 4QR6A 4TXEA 4AD4A 2HWGA 4XTDA 1EZ2A 1QNQA 3ZR6A 5CZ0A 3RIKA 1PYFA 1B90A 2WW5A 2ISFA 5KEZA 4UTWC 4WY0A 1UKPA 2EEXA 3NXFA 3FS2A 3LCGA 4O11A 1QFEA 1UMLA 3EX1A 2HROA 3B9EA 1LRQA 2JEPA 3LGEA 3T08A 3W00A 1C93A 3W72A 4K8GA 2QLYA 4UFIA 3SCRA 2V38A 3TCSA 5LHEA 3LXAA 3FYPA 4JTHA 4MFDA 3Q94A 2NUXA 1LF1A 1EJRC 1WYIA 3TNOA 3QYQA 2QJHA 3BLPX 2ACQA 3M0HA 5JMUA 2A1YA 1M53A 1V6YA 2PS2A 1BXBA 2E6AA 1R3QA 4M7TA 3M0JA 1B3WA 4FPSA 1L0PA 1FWBC 3T2OA 1J0HA 1XIJA 5C5YA 3M0YA 4NP7A 4UTWA 3TW6A 3UERA 1F3EA 4N9DA 2EPHA 4JFTA 2NWRA 2P5NA 1C8YA 1L6GA 3S6OA 1O5QA 4KMQA 3GC4A 3OO2A 3BOLA 3CHDA 2QHAA 4O13A 4FOJA 4Z2KA 2CYGA 3W1UA 1ADOA 3DAQA 2DPEA 2GWNA 3RITA 2DT1A 3RCYA 2ZXBA 2ZRXA 3V36A 4PUWA 2JF7A 1KXHA 2NQ9A 3LBMA 1DWAM 3N4AA 3CIXA 2GWGA 4IGMA 1M5WA 2E8YA 1JZ3A 1MI3A 1D3HA 1R0MA 2J8GA 3CUZA 3S3GA 5CH9A 2CHNA 3QTGA 1LLZA 3WD1A 1MXSA 3AMGA 4PH6A 3ZO9A 4AD3A 2D2GA 2NXIA 3EMQA 5I3JA 3BV7A 2GQ9A 3AWOA 2EG8A 2J6XA 2Y5SA 4HNVA 4IICA 6PTDA 1F07A 1R86A 4GINA 4Y9MA 1KV8A 1R8LA 4EXQA 1BWLA 1OFPA 4J3WA 5LXXA 3O16A 1JCLA 4EXAA 1XX1A 2J7BA 4O0KA 1E6XM 1E72M 1SJBA 1AUSL 1FTXA 1Y5WA 2QCMA 5J8LA 3U48A 4UNIA 2W3ZA 5AVHA 1NWRA 1V51A 2BNJA 1WAWA 3AMDA 3CLMA 3G1XA 5E9XA 2ZOXA 2PDNA 3QH2A 1MSSA 1GUVA 2WC4A 1VFMA 2ACUA 4BZYA 3PUDA 4AD1A 3E74A 2GQ3A 2SFPA 1D9EA 3RYSA 1E56A 4W7UA 3WD2A 3SEPA 2GJRA 3ARUA 1FH9A 3FDKA 5AOUA 5CLWA 4JYEA 5I7GA 3GG8A 3N4FA 3IJLA 3SUVA 3UT0A 5AN7A 2GJLA 3CL8A 1WE5A 5CKSA 3SURA 8TIMA 3PPFA 1HO4A 1F4HA 3TEVA 4PTVA 4G1NA 1OGBA 3VMNA 3NGJA 1EUAA 3MSYA 1PIFA 2WLZA 4DQWA 3IEBA 3ONCA 3U0HA 3SIMA 4KPLA 4B9ZA 5ABHA 4B5UA 3WLIA 4WZHA 2HXUA 3QZEA 1AMYA 3QY6A 5CBBA 3UJRA 1XRTA 3T4CA 1KC7A 2ZUWA 3QHOA 5HATA 4AWEA 4DBUA 4RNJA 4H83A 4MWAB 1GOWA 5K4XA 4DXKA 1DBTA 3S2MA 3VINA 1F61A 2BXZA 1S1RA 1S2VA 1K70A 5E6YA 2FGZA 4BF9A 3FKKA 1L2UA 4HGXA 2V9DA 3AXMA 1XP3A 1S5NA 1ZBWA 4V1YA 1G5AA 2C8NA 4O1FA 3SY8A 3DFNA 1OGGA 3MUAA 3QGVA 3T55A 4D6CA 3ARQA 1N7KA 1V4YA 3A22A 2MANA 3SCUA 4WDTA 5BWAA 2NQZA 4L9YA 2DT2A 2VD9A 6ENLA 3DX5A 3H2CA 2DFAA 1V93A 4IWWA 5BMXA 1MW2A 2HNEA 3WEOA 3IVTA 1WDDA 3SZ8A 4F40A 4PMUA 5HR6A 3LI1A 4KS0A 3VNZA 5AHFA 3WLRA 4H9VA 2QUNA 1ODZA 4ATWA 1UQYA 1JYNA 4IPJA 4ACZB 4IJCA 1HKMA 2YPIA 1UZ4A 4H19A 3W1LA 4MLRA 2WBKA 5F1VA 4R7OA 1BYAA 3ES7A 4HNNA 3TTYA 2OYKA 1Q63A 4XTIA 4CNOA 2GSHA 4NUWA 4JR5A 1TZ7A 3BLLA 1XRFA 3SJ3A 2QJGA 2PDFA 2WSRA 2YA0A 1E6RA 3EWZA 1BG9A 3VNKA 3HPAA 2Y1HA 3DHUA 1FHVA 5I3DA 1I0DA 1V3JA 4PRTA 3MS8A 3GHTA 3SGZA 1WOAA 2FQIA 4HPNA 3PBVA 4ZXLA 1XBYA 1GQNA 3ATYA 1Q45A 2IXUA 3I7RA 2D20A 3N18A 4O14A 1OJXA 2W9MA 1TWDA 3I6EA 3U6WA 4DJDD 3MUZ1 3BOXA 3IK2A 3AWNA 4AY1A 1V3KA 4ZBCA 3WLTA 4I9JA 1UBPC 3JVAA 3FY1A 2Z2UA 1JXJA 2F6KA 3BZJA 3VIIA 4HP5A 3ZT7A 2ZRZA 4ORMA 1QUMA 3K2GA 3VOHA 5FL1A 1ZS2A 2ZZ1A 1KXVA 2FPYA 3F5KA 3CPUA 1F7BA 2PCEA 3VOFA 3LLDA 3IACA 3FVDA 3BXWA 4V1XA 1ISWA 2FZDA 3EYPA 1VS1A 2BVYA 1VP5A 1LRTA 1I4NA 1IT8A 1ZBVA 3B4UA 2FJUB 4HU0A 2OMAA 4YL2A 2DZXA 3E0FA 3SUSA 4JTIA 4O57A 1JZ7A 1Q7MA 3A4WA 2TMDA 1POKA 3AJXA 4LEQA 4RV8A 1TVPA 2V2HA 4NZ4A 2WJZA 2YCIX 3WF0A 2QPUA 3CYVA 1ZSXA 4F48A 5HJXA 1JQVA 1R87A 4DEFA 2YCJA 3E3HA 3FHQA 4OVXA 3SRDA 2VZTA 3GBDA 2ZWYA 1CENA 2NLIA 3F4CA 4UCFA 3GC5A 3WF3A 3R89A 5LGZA 3K5XA 4NXKA 2XWEA 2D73A 2YJQA 4XVDA 2HS8A 3STPA 3AU2A 1ZHAA 4RZ5A 2X0HA 4A6GA 2CWNA 3AXHA 1PTDA 3VNLA 2OXNA 3WSUA 4NZFA 4LGXA 2C0AA 1FWAC 4N4PA 4DZAA 2CCRA 2Z7KA 2WNWA 5CPOA 3LU2A 1U1UA 1MVYA 3ES8A 3V1PA 2DV0A 1VBUA 2O7SA 1KFKA 3V5CA 3UJSA 2RGMA 1GZJA 3DG6A 3F1QA 3D3FA 3L21A 2R8WA 4RZBA 2DSZA 1HKJA 1LBMA 2GZXA 1OSEA 1F9CA 3ARTA 4FXFA 1TWIA 1NF7A 1U1JA 3CZEA 3CM4A 4JTEA 2PP1A 4QXIA 2W63A 1UQZA 3FGCA 4IMAA 4J9JA 3UJFA 3CAVA 2XDFA 2MUCA 5BWFA 3UR8A 1VQTA 4O12A 1LBLA 1UWTA 5A95A 3W1RA 3HURA 4DI8A 1QPQA 4JTAA 4KERA 5AZ1A 2OQYA 1Q65A 3NYZA 2WNZA 3TK7A 1VPXA 3K46A 1E6NA 2PWUA 1ODUA 5A6AA 5GPRA 1B3ZA 5CSUA 5M3WA 1YE4A 2W0UA 4ZQCA 1FKXA 3WUGA 1ONRA 1IEWA 3KDNA 4AZHA 2QF7A 2D0HA 1TWSA 4PULA 3ITOA 2GFTA 4UQ9A 2VO5A 4YHGA 1X1NA 3T7VA 4DXVA 4B9YA 4FO4A 1EPVA 3NEHA 1K7FA 1VFLA 4L1XA 1BKSA 4QIUA 3QV7A 4XKYB 1C9WA 1ICQA 2CZVA 3TAOA 5HQLA 3H54A 4XKMA 3PBWA 4LBSA 2NSXA 2E28A 3R2GA 4MDOA 4B91A 2KZHA 4FALA 1UH4A 4V33A 2E9MA 1GGOA 4F9DA 1A5UA 2VZUA 3CO4A 2RKXA 3O0FA 5A6KA 2V5CA 3SGGA 1JFHA 1NF0A 4I8YA 2OLSA 3URNA 3M64A 4XAYA 4KWWA 1TPB1 1L6SA 5LXEA 1FRBA 2DW7A 4B3ZA 1WXYA 4MZ1A 1E9IA 1ZAJA 2Y85A 4PCNA 2V5DA 2J13A 3M0IA 1XSJA 2NX1A 4B2DD 1EP3A 1YPFA 4P7NA 3R25A 4OECA 3KL5A 3W24A 4DZ5A 1H7WA 4C1LA 3WBAA 2WM0A 4UUIA 4Z42C 3GE7A 3KE0A 4GQQA 3S2CA 4OU1A 1N8FA 4BFAA 1TIMA 4AVNA 4NZJA 3O9NA 4XIAA 5C6MA 4POCA 3M0KA 4RDZA 3SY5A 2YB1A 3W23A 4PSRA 4QLLA 1HIZA 3CPRA 3LHUA 1ZAHA 3T81A 2E5DA 1TCDA 3MCOA 3LSBA 1XL9A 1K3UA 1V3LA 1OGSA 4ICNA 3WLOA 1YDOA 5L6UA 5EMMA 5G1TA 3W74A 1R85A 2FDSA 1ENUA 2I16A 4G7FA 5HMFA 1UKQA 2PDPA 2QV4A 2V81A 3EOSA 4PBGA 2QUTA 3LHTA 3H55A 2AAAA 1EJWC 2V3DA 2D69A 4Q8VA 4RUBA 2TYSA 1OYAA 4LVDA 3TQ0A 1BEUA 2E77A 1NOFA 9CGTA 2PDCA 2CZEA 4DM2A 1X1ZA 3WFZA 5MKGA 3L4ZA 1P6WA 4O17A 3C0QA 4Q4SA 4W85A 1O5XA 3DG3A 4R33A 3WUFA 3N3TA 4XUGA 4E8GA 3VKCA 1VFOA 3CB3A 3WJWA 2FFCA 3AFBA 4AIUA 1Z6KA 3TR2A 2DZVA 2IKGA 3EX2A 5E1QA 2XH0A 4DWSC 1K7XA 1B4KA 1T8XA 4Z2LA 5LSMA 3SDOA 1UUMA 2P0IA 4KCVA 4U31A 3B8UA 1RR2A 1D8WA 4Q4MA 1LTDA 2DUZA 3SAZA 2YLAA 3W86A 1AQHA 5D9MA 4ZXOA 2D3LA 2Y7GA 2IS7A 4FAMA 1PPIA 4JBRA 2TPSA 2PB1A 2GDVA 6A3HA 1NP0A 1ECEA 1U5HA 2VKZG 3ITVA 2INEA 1PTAA 3KBVA 2NT1A 3WQFA 1EDGA 4QTGA 1OINA 4BJHA 2BGNE 1WKDA 1V3MA 4DWSA 4LBRA 1EQPA 3QHMA 3I4EA 4Y9PA 1SW3A 2TODA 3TYCA 3WK0A 1DWFM 2D0FA 3FYYA 5C55A 4MMWA 1T8QA 1AH3A 3S6DA 1JGIA 1JPMA 5KSWA 1AZ1A 1IT7A 2PWHA 1BF6A 4HYRA 1LORA 2YW4A 1FCBA 2CLKA 1PL9A 3KRUA 4L1GA 2OX4A 4S23A 4LT9A 1Z42A 5H8UA 5M03A 3ANYA 3ATZA 4AVFA 4GO8A 4WD0A 3PZGA 2DU2A 1DQUA 4UR9A 3VU2A 3URBA 1AL7A 3VO0A 4JFWA 3W1XA 4LSBA 1L6FA 3L12A 4TOQA 2P88A 2QCCA 1V3IA 2WANA 5JBEA 4UR7A 4FHAA 1TV8A 2GJNA 5HUOA 3AYSA 1IGSA 5AC5A 1CEOA 5FF0A 5I3KA 4D71A 4OIFA 1TTJA 1M9HA 3KVKA 3WNMA 3F2DA 2QS8A 4MZ8A 1VIWA 3W7QA 1EXPA 1UP2A 5T8GA 3VDBA 4W8AA 4S3DA 4H7VA 1U30A 5BXTA 1PE1A 5AZ0A 2X1SA 1I2PA 3I3BA 4LVAA 3LMYA 4GI4A 3IV3A 3FAXA 5JBDA 4GVHA 5FJIA 1ZJAA 1NOWA 3GVWA 1UG6A 1IQ8A 2OOGA 4LF1A 2WSPA 3VGGA 1KTBA 1TPFA 3KBNA 1MEIA 4AEFA 1AL8A 2V3EA 1UH2A 4YTRA 1XYMA 5EU9A 1O95A 3CWOX 2NV2A 1ALDA 3P81A 4ZSTA 4MJMA 1V79A 2QGYA 3NQ2A 1UR9A 4REQB 1XIIA 4DLFA 1Y5VA 1AJZA 4M7SA 3VFLA 4QBXA 1SFLA 5AFDA 1A5LC 3U57A 3UVAA 1LZOA 5I03A 5DT5A 2A7NA 1MUCA 3BCJA 2WSYA 1XQLA 3B0YA 4C6FA 1BF2A 3WKZA 2J27A 1UD6A 4Q8WA 1O66A 1BKHA 2PDLA 4R53A 1NFGA 1TA3B 1K8YA 3LZ5A 3U5UA 3VD7A 3L2LA 1PWMA 3ARPA 1H5YA 2PODA 3K13A 3L0KA 3MDUA 1H7NA 3LGDA 2EAWA 1UA3A 1RLCL 1OC7A 4UQDA 3P0WA 1VYSX 1J10A 5CPLA 4M6VA 3B9OA 1TTQA 2ZC8A 4GCXA 1SO5A 4TQTA 4X22A 3FXGA 4LAMA 1A5MC 1XHGA 4Z2JA 1DYSA 3LMZA 5KMYA 2Q8LA 4Z1DA 5A1AA 1QRQA 5A2BA 4XZWA 1M01A 1R3WA 3O7UA 1B9BA 4XQ6A 2VX4A 1J11A 5HPCA 1V0LA 2X7WA 3QQ0A 4UTLA 1ZPTA 1KFWA 3WG6A 3GR8A 3WF4A 4A3UA 3XIMA 2NSOA 1A5SA 3S5SA 3WCZA 2XVPA 4KCWA 1J12A 4YPJA 1LDCA 3U2CA 3AIRA 3PPHA 2WNNA 4LCRA 4XBKA 5FJJA 1IZKA 2V8ZA 3VC5A 3ZIZA 4ROPA 1TMHA 2W67A 3WLHA 2DSWA 5HNUA 3OZYA 2ZIDA 1HJVA 4NVTA 1K9EA 1OZQA 2NX3A 2UWFA 3TOYA 3N2CA 4N6FA 1NY1A 1DWJM 3PM6A 5HA7A 1G67A 1W9DM 2PP0A 1LROA 2XM1A 1MEHA 1BWVA 1CCWB 1G9HA 4NAFA 3WD3A 2AGKA 3LTSA 4IIEA 3UZWA 2QCGA 2F2HA 4UFMA 2C14A 3BWWA 1EJSC 1GKQA 3GU2A 1TKKA 5H6HA 2GUUA 3UWEA 1E70M 4QLJA 4QG6A 3HG4A 4MKNA 4B16A 2O56A 1FWTA 1M6JA 3ZJKA 4EF8A 1XSKA 3ELFA 2EO7A 3DI1A 3I7SA 2QNEA 3LZ3A 2Q6ZA 3LCXA 1FWJC 2P3EA 1KR0A 1PJ9A 2CETA 1OWQA 3QGAC 4M6QA 3RJXA 3WLKX 3GXIA 3VDAA 1KM6A 4YCPA 3VZXA 2PSNA 4QNEA 4ILSA 1W1B1 2P76A 3FNDA 2J8TA 1E3ZA 2HJPA 2J66A 4KFNA 4Y8EA 3QPEA 3NCOA 5BXPA 2Y4SA 1JCNA 1V7AA 4WXYA 1QNOA 2BFGA 3OIHA 2VYOA 1CYGA 3STGA 1T0OA 4NZ1A 2ZRYA 2EPMX 5A6BA 1G4TA 4KIRA 4IMEA 3HMJG 4UBPC 2RJGA 1EA0A 3EA1A 2Y24A 4D72A 4L6HA 4GYPC 2XGZA 3UZXA 2NW0A 4KWOA 3BG3A 3CWNA 3QMRA 4QS5A 3AMLA 1ICPA 5E93A 1K6WA 4F0RA 3M6YA 3AIQA 5CAHA 7ENLA 3NL6A 4JN7A 3MP5A 3G1VA 4LQ1A 3N13A 3DBNA 3O63A 2EGZA 4BI7A 2FVMA 4FLRA 4GMEA 4PMDA 3GTHA 3SCWA 1LL6A 3OHIA 4DYJA 5FIPA 1TPC1 4JCLA 3TKFA 3HJEA 2ZZ2A 4JTLA 3UR2A 3C5QA 3LN3A 3GWQA 2WMJA 5DMNA 4J7RA 4CNUA 2DDXA 3NO5A 4GYPA 4AZCA 1WX0A 4KRZA 2AQWA 4NT0A 2IPWA 1MQRA 3N3MA 3STCA 1TE6A 4MGGA 1F73A 2HXTA 5I00A 3E2QA 4L61A 3W27A 4ZENA 1BD0A 3CUXA 5HNNA 4AY8A 1NJJA 1XLGA 3R13A 1J0JA 2Z6JA 4JL2A 3B0XA 4CKQA 3R6IA 4P5UA 1YDVA 4UNKA 4ZFMA 4AD0A 2DVUA 4IIBA 3DHDA 4KBXA 4O54A 5AHMA 1L6WA 4KFOA 3TWAA 5D2VA 4HK7A 2VFFA 2PTXA 5A8GA 2YCKX 3LD5A 2G4FA 4Q8TA 1KTCA 3OQEA 5A94A 3NTYA 4JYDA 2D0GA 3TC6A 1FWGC 4PBEA 4GXWA 3CAWA 5D2TA 4FNQA 1X39A 3TYZA 1Z89A 4GISA 2ALRA 3MP3A 2BY2A 3OTRA 1QJWA 2WMIB 1KR1A 1UR8A 4X63A 3QMTA 3WQ4A 4AYGA 2XSAA 3FJ6A 4MUPA 3I6TA 2VVNA 4EVZA 4UFKA 3WD4A 1KWKA 2ZYFA 4LH8A 4D6JA 4XWUA 4N9BA 4WHBA 5TAOA 1HJWA 3CH0A 4PBFA 3UJEA 2QCDA 4KKXA 4ADUA 1M41A 2BZNA 1UP0A 1B5TA 2RFGA 4JIIX 2D2JA 3D3AA 1JCXA 2WQPA 4GUGA 4ZGYA 1NU5A 4JQ3A 4A3YA 4BA0A 3IS4A 5ECUA 1R5YA 2CKRA 5U4NA 2I9EA 1XKYA 3MKVA 3TC7A 5HNTA 1QI5A 1IT0A 1ZJBA 4X0VA 2G8ZA 4JICA 1XQKA 5CC5A 5AYYA 1YXDA 4AZ7A 1FH8A 1C91A 3GVVA 2OGYA 4AMCA 2E68A 5AHNA 3LPOA 1GQLA 4TTGA 3EDFA 4EF9A 3A64A 2VFHA 3MMTA 4DXXA 4H9XA 4J5NA 4N42A 3ENLA 3N12A 1AMKA 1V7YA 5HWMA 4G9PA 3VIGA 5D9OA 3K8KA 3SCQA 4C6IA 4IXHA 4L4MA 3KLKA 2QDDA 4MVAA 4RL3A 3FK4A 3OBEA 3TLLA 3L0GA 1PCWA 3RO6A 3LA4A 2CBVA 1T41A 1XPYA 1AJ0A 4GVGA 2B7QA 1SFTA 2HDJA 3VX1A 1UIOA 2WAGA 1R7OA 1G7UA 3GXNA 2Y0FA 4GACA 3MT1A 5BU9A 1XD1A 3CV6A 3JZUA 3QLDA 4PTMA 2QDGA 3T2QA 4JS3A 4DJFC 2VR4A 1GW1A 4W86A 1UR3M 2BVDA 1ZENA 1GG0A 1ME7A 1WDPA 2NUWA 4UTJA 2J9XA 1LL4A 1NARA 1LM1A 2NQHA 2ZX8A 2WYSA 4GGHA 3N25A 1QI2A 2QJMA 1EBGA 1E1CA 2ADAA 1HT6A 1MW1A 3KTCA 1WOBA 2CLLA 1HJQA 3IVSA 4HKPA 1RBLA 1TJPA 3PPGA 3LNMA 4UQEA 4IPNB 1IZJA 1CXEA 1X98A 3E02A 5F4SA 4LANA 6XIMA 1A3HA 4DO6A 5I6SA 3PZTA 1XSIA 4DJFA 1ZRQA 4FLQA 3SY1A 4TIMA 3E2SA 3OVQA 1DIKA 4KRUA 1AK5A 4BK9A 3DC8A 3W25A 4OT7A 3KBMA 3P74A 1VZWA 4ATLA 2EKGA 1JJKA 4A21A 3N2TA 4CD4A 3FSUA 2POTA 2C19A 3TCEA 2XINA 5XINA 3N14A 3BMWA 4FR1A 1YHTA 4YTUA 4IL2A 2ZUSA 2PU1A 3G3DA 3W37A 5I2UA 1VHNA 3RCMA 2DVTA 3PFMA 1XYAA 4NNCA 4UQBA 4AC7C 3N6QA 1J0YA 4HA1A 3CHFA 4HJFA 1GONA 3OA5A 4GIRA 4AHOA 3KWSA 1S46A 1OYCA 1J93A 1DQWA 4K1GA 1XKJA 4AY7A 5BOFA 3PB0A 1CGXA 2F6XA 2PD5A 4D6FA 1K1DA 3G18A 5IBXA 3C2FA 1QO5A 2W66A 3OBKA 4EWJA 5HQMA 4MKSA 1TPVA 5DXXA 1R9ZA 4ADTA 4P61A 3TSBA 1DP0A 1YTEA 3D6NA 3VGDA 3PZIA 1HKVA 3DXIA 4PB5A 3DG7A 5FKYA 5LHFA 3CAQA 4NU7A 4QQUA 3VE7A 3C0JA 4WOZA 3TN6A 4UQCA 3U3HA 3T0CA 4JQAA 4PUNA 4H41A 4XG1A 1TJ1A 4XISA 4CQ8A 5I79A 4AZ5A 2YGYA 1Q7ZA 3H21A 3RLUA 2V0TA 2ZRVA 3H26A 3LGGA 4TVUA 1VHCA 5I77A 2GVLA 4LRTA 1Q5MA 4O53A 1OF8A 1JIBA 1GEHA 3D46A 4UB9A 1SO4A 3RLHA 1XLKA 1NAL1 3W83A 2ZDSA 3IUDA 2G41A 4R9OA 4PTWA 1V8EA 3SIZA 5HULA 1C9DA 3BURA 4A2RA 3RK8A 3GB6A 2CBIA 3L5AA 5REQB 5DXYA 3VUSA 3GNRA 1XIMA 4TMCA 1W5NA 3RPMA 3SBFA 3TQKA 3HQOA 4GXMA 3GUGA 3T0AA 2X42A 3HA1A 2ZTKA 3P60A 3GKFA 2VMFA 4Q8NA 1V6TA 1WZAA 3N6JA 4PN2A 2CC0A 3TAKA 1P1MA 2FZNA 2OFJA 3ITLA 1TCMA 3EXSA 1G4SA 1PXGA 4LUIA 2J75A 2ACRA 4D6IA 3RPTA 2VZVA 3VCRA 2VEFA 3W7NA 4GOAA 2NX9A 1UIPA 4H1ZA 2Q3RA 1XS2A 5I07A 4AMAA 3H4WA 4D8LA 4MNMA 1XBXA 3THAA 1I0BA 1S38A 2J7HA 1DOSA 2VZSA 1UD3A 3MV11 4HHHA 3W70A 1FWFC 1NDZA 1WDRA 1OFRA 5ABGA 3T0BA 3EB2A 3N6HA 4FLOA 4O4VA 4PMYA 4EPEC 1NSJA 4XZNX 4JX5A 4WF7A 3PR2A 4OV4A 1E0UA 3PK7A 4H6EA 3AO0A 2IKIA 5F1UA 1M65A 4GVIA 4ZCWA 3PULA 1LOQA 4MKVA 5KINA 2FKPA 4JAWA 1XIDA 1EPXA 3BQ6A 3H2EA 2I1OA 4MYXA 2VC7A 4UOJA 3IIVA 4JQ4A 1UD8A 4IUOA 1MZRA 1KW1A 2DY3A 4IJRA 5EL1A 4GQRA 2HPMA 3UYCA 1W3JA 1KFLA 4M8UA 3LERA 4NNBA 3LNPA 2ZUMA 3FJLA 3RR4A 3ZVHB 3MC5A 5D02A 3NR0A 5XIAA 2PA6A 1SQ7A 3MHFA 3W53A 1JD7A 1EQCA 2WJFA 4N02A 1KFJA 4F0SA 1LG1A 1M1BA 1P43A 4KWVA 3U9IA 4G5DA 4QE4A 3QR0A 2PDBA 2VEMA 5FAJA 4JIEA 1W8GA 4LUJA 2B0MA 3ONBA 5CPTA 2X1UA 4IFKA 4NX5A 3TC3A 4UXDA 2Z27A 4HNLA 2YYUA 4PMJA 1DWGM 3UWVA 4L1WA 1W3KA 1SM9A 1G94A 3ZJ8A 3WBEA 2PCQA 3VE9A 4C6QA 3MB9A 3PY2A 5E6ZA 5K9CA 5MF5A 4P7OA 1HW6A 1FDYA 5FOOA 3QZ6A 3CHCA 2CLIA 3QVQA 2WC7A 2X0YA 2GJXA 4UTIA 2RDTA 4IGNA 2F9RA 5HMSA 3OPSA 1P7TA 2I57A 3WF2A 1A5AA 3VFCA 3QQ1A 1S39A 3BICA 2PLJA 1TJ2A 1KXQA 3NAVA 3BCFA 1ADSA 6TIMA 2VGFA 3VNJA 4A8NA 3SGUA 4UOQA 1MDRA 4JTCA 2J6VA 5JU6A 1NWTA 1R2SA 4O10A 3MI6A 1EO5A 4H8UA 5BYWA 4MYAA 3WLSA 2G37A 3CC1A 3USZA 3PF3A 1JUKA 4DYEA 2OEJA 3N34A 1OX4B 2C1HA 3QGKC 4CQBA 1PZ0A 3GW3A 2VDGA 1J6OA 1W5PA 4QSFA 3V75A 4AHQA 2R1LA 4LV4A 2OOFA 5HJYA 4ROQA 4NQ1A 4IP4A 3VPLA 5HINA 2JKPA 1QASA 4MB1A 4OUEA 4Q8OA 3TE9A 1P0BA 2TRSA 4GI9A 2QIIA 3W9ZA 4ZQPA 3U5YA 1MUMA 5HOSA 1VGAA 1F2JA 1E1FA 3NL2A 1D8CA 3P3BA 2BTMA 5BZAA 3SQMA 1GORA 7ODCA 1WV2A 5G4WA 3M43A 3BO9A 3APGA 4W5ZA 2Y62A 4MB4A 2XFWA 3WJSA 4EANA 3UG8A 5AYBA 4MY9A 4JQ1A 3W81A 2QCFA 1SO6A 4FNPA 3QFWA 2GDUA 5HNRA 1E3XA 1RSCA 1JYWA 2OZTA 5K7JA 3T8LA 5U7SA 3CZGA 1HN1A 3H24A 3LTYA 1YEYA 2Y61A 3DYMA 4KF1A 1ONEA 3KDOA 4HN8A 3A4JA 1JF6A 2PLCA 3MCMA 4UTKA 3BAJA 4HOWA 3UG4A 1YRRA 3S42A 4MNJA 3ZZ1A 2HEJA 1UZHA 5M5DA 4QJ3B 5FJRA 3NO3A 3UZYA 2ZQ0A 2GSEA 1BQGA 1Y0EA 1TWWA 5JIPA 1ZQ5A 1FKWA 1V0KA 3WO8A 3W76A 1UH3A 1BXCA 1XG4A 3U7VA 2CPUA 3LI0A 2NVAA 2WHLA 2IPGA 3QW4B 2PMQA 1Q6GA 2PE4A 1KM0A 3WQ8A 3E1F1