2EXOA

Crystal structure of the catalytic domain of the beta-1,4-glycanase cex from cellulomonas fimi
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic domain of the beta-1,4-glycanase cex from Cellulomonas fimi.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase (o-glycosyl)
molecule keywords EXO-1,4-BETA-D-GLYCANASE
total genus 129
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2exoA00
3F4VA 1EA9C 1Q6DA 1KBKA 2EBNA 4TX6A 1UKPA 3VOCA 1CDGA 2WVVB 3WMCA 1WPCA 4CD8A 2E0PA 1H0IA 3N1AA 1CGXA 1UD4A 3NSNA 2YBUA 3BSGA 2VQUA 4NF7A 3SCWA 2BY0A 1OT2A 2BVYA 2GDUA 3TOPA 4H8VA 1OWQA 1ZU8A 3UETA 1V0MA 2EPMX 4PMQA 1G01A 3THDA 4OJYA 5IFTA 1ISXA 3KZSA 3QHOA 3AS0A 1VEPA 4CU7A 3BAKA 2YBTA 1C7SA 5GQBA 1BLIA 4JKLA 1UD5A 4AZCA 1WDRA 3B8SA 3VMPA 4W84A 3SCVA 2DEPA 3L4XA 4GINA 5CGMA 3QHNA 1NWUA 1CIUA 4MADA 4PMDA 4E2OA 2F2HA 3QR3A 4U3AA 4B15A 1EDQA 4AISA 1HJVA 1XYFA 1G9HA 3SCSA 4QDMA 2XTKA 3VNYA 1KR0A 1UKSA 4F9DA 4N0RA 1BPLB 1JZ5A 1W9VA 5CGTA 4WF7A 1TA3B 3AS2A 2DT0A 2ZX8A 1NWTA 3ZIZA 4MNLA 5M03A 1WZKA 3W38A 3MMUA 5E0CA 4J3XA 1SMDA 1G94A 4AC1X 2BFGA 2RGLA 3MV01 4NRRA 1GCYA 2WSKA 1R7AA 1M04A 1XV8A 3EBVA 2G41A 3VIMA 1CZ1A 1NQ6A 4C7FA 2DSWA 1VIWA 1QNPA 4KH2A 1V6UA 1J11A 1SFSA 3BLKA 3LMYA 4GZEA 2WZIA 4W7WA 1UKOA 1W1PA 5HNNA 1ESWA 1MXDA 5IHSA 5BRQA 2Z1SA 1E4NA 1OCQA 1Q6EA 1VRXA 5CPQA 5IDIA 5EBAA 1OD0A 1TG7A 5LA1A 3PZVA 2AAAA 5CSUA 1E0WA 1L8NA 3AFBA 5A8NA 1JFXA 1E71M 2D3LA 4L4PA 1XRVA 3WIJA 4JIEA 2VRKA 1GONA 2QLYA 2CKRA 3WQ8A 1LF1A 1Q6CA 4MB5A 2WZEA 5DO8A 3WBAA 5KEZA 4KWUA 4TVCA 1C91A 5D9OA 2VR5A 1R85A 1FOBA 3E1F1 2ZXBA 1UA7A 2Z1KA 1BHGA 1UWRA 1QPKA 3CUHA 4CD4A 1XGZA 3VD7A 4CN4A 1ZJAA 2CBUA 2G8ZA 4QAWA 2WMKA 3W37A 3FW6A 2ZXQA 4GO8A 5LA0A 1ISWA 4GO9A 3PN8A 4MJ4A 3CO4A 1GOQA 1CNVA 3BAXA 5CSYA 1BG4A 1BTCA 3RO8A 1PZ3A 4NI3A 1W91A 1E6ZA 3EMZA 4XZWA 2A3CA 4TUFA 2V38A 3NJ3A 1CXHA 3BSHA 1B31A 4C7DA 2WAGA 2BY2A 3VGEA 2J4GA 1GHSA 2CBJA 4GI6A 2VURA 1MFUA 2D3NA 5KZ6A 1U33A 1UD2A 1E1FA 2NT0A 3SCUA 2WLYA 4DM1A 5EFFA 3W82A 5ABFB 3WQ4A 3BAJA 3OGSA 3VX0A 2IXUA 1UYQA 3PTQA 1XD1A 4UR9A 5LYRA 5CQ1A 1UR8A 2NW0A 4M81A 3GM8A 2VR4A 3TTQA 1IZJA 3VIHA 5LA2A 3GBDA 4Q7NA 2ZIDA 5FIPA 3T2QA 4QFUA 3PZ9A 3WF0A 1EXPA 3GNRA 4KMQA 1TUXA 3D5HA 1QHZA 1H5VA 1W9XA 4UFLA 4J28A 2NSXA 2J25A 1GHRA 2A3HA 2YL9A 1E70M 2DIJA 1V6YA 3FNDA 2G3MA 3MMWA 3ARZA 1B1YA 1IV8A 1MQPA 3VIJA 4M8UA 3W81A 1BGGA 3QOKA 4AD1A 1Q6FA 5I77A 3EMCA 1XH2A 2PBGA 5AY7A 3ZJ6A 4AZ7A 3EDKA 2XYLA 1HT6A 3JUGA 1UZ4A 1E72M 3WNLA 1E5JA 4Z2GA 2A3EA 5JIWA 1B90A 3MSGA 4CKQA 3GH4A 3NSXA 5D4YA 5FD0A 5GPRA 1V03A 2O9OA 3RIKA 4D6EA 4GI8A 2DSZA 2BXZA 4RE4A 5CG0A 4Z2LA 1W2PA 1GQKA 2X8RA 3RPMA 4ZXLA 4AY1A 3TA9A 4JHOA 2V3EA 2D20A 2WHMA 1NOUA 1BAGA 2V3FA 4NZCA 4P7NA 1YQ2A 2XG9A 4CCDA 3WDPP 4IUGA 1KR1A 1MYRA 3CPUA 3BMVA 5I5RA 2UWFA 2WWCA 2CYGA 3A4XA 4U5IA 3ARWA 2CHOA 2XSBA 5FCZA 3CUJA 4UQ9A 3MUZ1 1GOMA 3A4AA 3VGDA 1GUVA 4DUWA 1QW8A 2JF7A 3ZR5A 4H04A 4AMCA 1AQMA 2DH2A 3AMGA 5AC5A 1ZS2A 4OZOA 4HP5A 2OSYA 3BGAA 1XD0A 4AZHA 1CEOA 4NSBA 1R86A 4QP0A 1OIMA 3NDYA 3OLIA 3WF3A 1C8XA 3WNOA 2ZUSA 4FK9A 4HPHA 3VDAA 3SCPA 1DEDA 3VGGA 2J7CA 4DUVA 3WBEA 1JIBA 1ISYA 1JI2A 2DSUA 2WKGA 4OOZA 3N18A 2W4XA 1KBBA 3I3EA 3O9NA 5E9AA 2E9LA 1PX4A 4S3JA 3SEPA 2VO5A 1CLVA 3A4WA 2PWDA 3K4AA 1VFUA 1OGGA 2X1IA 3WNPA 4HOZA 1VJSA 1JZ2A 3FXYA 1HKMA 2JALA 4HU0A 4PMUA 1RPKA 1TZ7A 3M07A 4KRTA 3DYMA 3APGA 4J3TA 2YL5A 2JEQA 4PCTA 4H2CA 1HJUA 5A8MA 4DUXA 1BVNP 3WY1A 3ZJKA 2DT1A 2V3GA 3VUPA 4BS0A 3M7SA 4J7RA 4CCCA 4KGLA 1CPUA 4AZCB 2DDXA 1H09A 3MUY1 1OGSA 1WDQA 3PBGA 1B3VA 3N13A 4FLSA 4IISA 4YN5A 2O9TA 1VEMA 2WHLA 1HF6A 3W27A 2JE8A 4P7LA 1E9LA 2WKLA 4PBGA 1PX8A 3I3DA 3F5LA 4ATLA 2XVPA 4BQ5A 3CH9A 1EGZA 3CHFA 4W86A 5A6MA 2X09A 2ZX7A 4Q22A 4JFWA 2ZUTA 4JFTA 3MO4A 3FHAA 4UFIA 1HXJA 1U2YA 3B9DA 2F61A 1VJZA 1GJUA 4J3SA 2YL8A 1EH9A 4X0VA 1H1NA 3CHCA 2XGIA 1E6PA 4E8CA 4H8UA 1JDAA 3AHTA 3SUTA 3WQ5A 5TD4A 2XM2A 5I3DA 2VX5A 5A6JA 2ZWZA 3ARUA 5A6AA 3VD4A 1GOWA 1AVAA 1E40A 5A69A 3BAYA 3OA5A 3SCQA 3THCA 4TTGA 4OOUA 1ISZA 1BYBA 5C70A 3ALFA 4JAWA 1JDDA 4PMRA 4CVWA 3VD5A 1QNQA 1R7OA 4H7VA 3CUFA 3VIFA 1J12A 4S3KA 2J78A 1EIBA 3W6LA 1OINA 1EHAA 2BHUA 1LQ0A 1X1NA 2ZX9A 1HX0A 4M24A 1HJSA 4MAZA 5HPOA 2OYKA 1C8YA 1P6WA 1LWJA 1M03A 2GFTA 1G1YA 1EOKA 2ESCA 1I1XA 2GDVA 4FLOA 4ZENA 1GQIA 1D7FA 4D6DA 3WD3A 4UTFA 2XUCA 5FKYA 2G3JA 2QV4A 1UD8A 2WHKA 3S2CA 2D1ZA 4HOWA 4UFHA 3WEZA 5CZKA 3WH6A 5C71A 1XCXA 1Q6GA 3CGTA 3ZO9A 5I2UA 3WUEA 4B16A 3BAIA 3RM8A 2CBIA 3B9EA 3GH7A 5EB8A 5BROA 4ZFMA 4PMVA 1R87A 2J8GA 3L2LA 2PB1A 3BC9A 5DT7A 2VT0A 6CGTA 4UCFA 2PC8A 2E4TA 1WAWA 2VVSA 3CIVA 2PWHA 1W9PA 5D9NA 2VUYA 4TXEA 4AZ6A 1H49A 3FAXA 3CZEA 4PMXA 1GOOA 3MUAA 6TAAA 4AEEA 3WNNA 4OBSA 3CUIA 2C0HA 3T09A 3WQ6A 1WDPA 3SCRA 4D6FA 3PZQA 4CVUA 1E5NA 2J7HA 2QMKA 2EPNA 2E8ZA 3L4UA 1CWYA 3RM9A 3IJ7A 2EEXA 4PEEA 1LL4A 4HZ6A 5A8OA 3FN9A 5FL0A 1OIFA 1MFVA 1QHPA 3SUVA 3GXIA 3NYDA 2VZUA 4PUDA 5E0FA 3DYPA 4LGXA 3AIEA 4C7GA 3NCOA 1W9UA 3WD0A 2CHNA 2PWGA 2CITA 1LLOA 4JCMA 1HJXA 4H8HA 1UQYA 1OT1A 3DECA 1QOXA 2A3BA 1E0VA 2E9MA 2D2OA 2XVLA 4HMDA 4GQQA 1XSJA 1EO7A 1DWIM 4ZEPA 4HMCA 1DWGM 1V08A 4UZUA 3A47A 1JYWA 5BRPA 4D6JA 2J7GA 3L4VA 5DMYA 3W0KA 3BMWA 5A3HA 3S6TA 3AHVA 2BXYA 3VINA 3WENA 4F9JA 5BXRA 4AYSA 3AI0A 4RL3A 2Y8KA 1JYNA 1CYGA 5BXPA 1J0JA 3AXIA 4V28A 3F5KA 1HJWA 3OIHA 1W9DM 3I3BA 2DSVA 1E4MM 3CZ8A 1MXGA 2ZICA 2G3IA 3J7HA 1XC6A 2JIEA 3KL3A 3KL5A 5IFPA 2WB5A 1JAEA 3VD3A 1Z32X 2ZUVA 2GUYA 3SCNA 4PUEA 3K1DA 3N17A 1WB0A 4P7RA 1BSIA 4LQ1A 3WH7A 1I1WA 3KEHA 4D72A 4LYPA 1X6LA 1OSEA 3VGBA 1ZBVA 4HPGA 3VX1A 3T0AA 4BQ2A 4WSJA 5IXEA 2G3NA 4BQ4A 3LPPA 4U5KA 4LYRA 1JD9A 3L4ZA 2BHYA 2J7EA 4CU6A 3AZRA 1GNXA 1VENA 2X2YA 5GNZA 3ARPA 4PMZA 4F8XA 3DC0A 2WMGA 1AMYA 1C92A 3BCDA 1BYDA 4TX8A 4ACZB 1WCGA 5JBDA 2VX4A 4EKJA 5M3WA 4OIFA 1CENA 3IAQA 3AYRA 1V3IA 3U57A 4YHGA 3T0BA 3O2LA 1RH9A 1V0LA 1E6SM 1JNEA 1KCKA 1TCMA 2O9PA 4HA3A 2E40A 4PTXA 2EQDA 3WELA 5JBEA 1UR2A 1XH0A 2VI0A 5AYBA 3AIWA 3HJEA 5EMYA 1J0IA 5I23A 1E56A 2J7BA 3EDJA 2VRQA 1JAKA 3TTSA 3ARVA 3A6OA 1EDGA 1OB0A 1KFWA 4HA1A 3PTKA 4AXNA 1V3LA 4P8UA 2AOSA 3VMNA 4GZIA 3VTRA 4WSKA 3AHXA 1RP8A 1R8LA 2J77A 3ARQA 2XJ7A 2VRJA 3WD1A 1PEZA 1K6AA 2XHYA 4MNJA 2OLHA 3PZTA 5A8PA 2WNWA 2Y4SA 1DWHM 1BYAA 2ZUMA 4MDPA 2BVTA 3MS8A 4PTVA 1S46A 4W88A 3GNPA 3WQVA 4RE3A 1NOFA 1E3XA 1CBGA 2VJXA 5E6ZA 1O6IA 1MWOA 5CLWA 3VDBA 4IPLA 4JL1A 4U33A 1TE1A 1JG9A 5DT5A 1SMAA 2W91A 5ABHA 5C8BB 1H4PA 1J0KA 3SCOA 3AMCA 4M1RA 1N82A 3WN6A 3AHZA 1C8QA 3AIVA 3WMSA 4AIOA 4BQ3A 4Z2KA 3MSDA 5I0DA 5CJ5A 4HTYA 4P8XA 3WH9A 4WKFA 1CGYA 2VOTA 5AC4A 2J7FA 1CGTA 1W32A 1E6NA 4D6CA 4ATWA 2JF6A 1AQ0A 5ABFA 1YHTA 1B3YA 4DWSC 5AYIA 3AOFA 2VCBA 3BAWA 1LJYA 4X9YA 4XX6A 1C90A 4J3UA 3VILA 4JKMA 1FH7A 3W6MA 5A6BD 5HDRA 3WNKA 3IK2A 2WYSA 1UWSA 3AISA 1HN1A 3AICA 3CZGA 2XFRA 3WF4A 4PCSA 4M80A 3DHPA 1VB9A 2E8YA 3L4YA 1CTNA 6A3HA 3KWXA 3ZOAA 2WVTA 1NH6A 2D0FA 1HKIA 2O92A 2DSKA 2E3ZA 4GZJA 2CKSA 2YJQA 2BVDA 2X05A 1V3MA 3NDZA 1JDCA 2WZHA 4F79A 3N11A 3SIMA 1E15A 4A3YA 3GZAA 1TR1A 5GNYA 4DWSA 1ECEA 3AQUA 1DWAM 5CPTA 1JZ3A 1OM0A 2W62A 2WCAA 3VKKA 4ZXOA 3IJ8A 3VMOA 4H41A 1MVYA 1FP8A 4QLJA 5A2CA 2FGLA 1IZKA 2D23A 1JYXA 2ZWYA 4RE2A 2V5DA 1UG6A 1KXQA 2PF0A 3VDCA 3ZM8A 5BCAA 2ZX6A 4UFKA 1US3A 2FH6A 2J47A 2CPUA 2EPOA 3K8KA 3W53A 1H41A 1TMQA 4CU8A 1UKTA 1BFNA 2A3AA 2VMFA 3RDKA 3UERA 5D8WA 3ZJ8A 2W5FA 3AMKA 2UY4A 4N42A 2V5CA 8A3HA 3CUGA 1QVBA 4D1JA 4B3LA 4V27A 2YDSA 1G0CA 1JYVA 4AEFA 2O9RA 4HZ8A 3WFZA 3A3HA 3UR7A 1B3ZA 4JFSA 5I24A 2W67A 2WM0A 4CN6A 3U7BA 4JCLA 4UOZA 3O6AA 1UKQA 4MB3A 1BGAA 5D9MA 1CECA 1E1EA 1H3GA 4PYSA 1LL6A 1QI5A 3MANA 1GJWA 1UR4A 4D6IA 1GVIA 4BZYA 2OSXA 5IHRA 1JZ6A 1HNYA 1KQZA 1UWQA 1V3KA 4W5ZA 2OWXA 1B3WA 3GH5A 1C93A 1LG2A 1MW3A 1V6WA 1JF6A 7TAAA 1BQCA 4EAMA 3SCTA 1UWIA 3NUKA 1XHGA 4ACZA 3KE0A 2GVYA 4BF7A 1DP0A 3WEOA 4A3HA 1QNRA 2J79A 3N12A 1NM9A 1HKKA 1D2KA 2YDRA 1HL9A 3WUGA 1UUQA 4LYQA 4PTWA 4TTUA 4CD6A 2WVVA 2CESA 3RILA 3GBEA 3W28A 3TTOA 5BXTA 4GQRA 2XVKA 3PHAA 1BVZA 1ODUA 1KQYA 1ITCA 3WL1A 3PTMA 2OWWA 3WD4A 1PAMA 2Y24A 4UOJA 1UR1A 1OD8A 4WLCA 5FL1A 3OGVA 4R27A 4CGTA 1W1VA 5EFDA 4Z2JA 1FFQA 4E4PA 1QNSA 3AHYA 4AZ5A 1SYTA 2VZOA 2XVNA 1ODZA 1B3XA 3K8LA 4PMNA 1VAHA 1L0PA 2YDQA 4ATDA 1W3HA 4YPJA 1PX3A 4E8DA 1JGIA 3W29A 3WF2A 2OYMA 3WUBA 3DYOA 1KGWA 4J3VA 2YLLA 3L2MA 3OLEA 2FHCA 2XFYA 5DEZA 1PZ2A 4IM4A 1F4HA 1JXKA 1NOWA 3M6DA 3GXDA 4LPCA 2Y5EA 4UQEA 3WNMA 2VCAA 2CETA 3U5UA 1EDTA 4JHZA 3VGFA 1XSIA 3IJ9A 3AMLA 3GNOA 3VO0A 4PTMA 1QBBA 1E4LA 5F7UA 1J0YA 1EO5A 1W1YA 2XWDA 3WEMA 2PBOA 1HJQA 2IUZA 3CMJA 2OSWA 3WFLA 2D24A 1DWFM 3PZMA 1CXLA 5I79A 3OLGA 4AZGA 3AS1A 5CPSA 4LX4A 4AIEA 1UA3A 4EANA 2WVSA 3PZNA 3WF1A 4U31A 2YIHA 1M53A 3MMDA 1VEOA 3EDFA 1EQCA 4HOXA 1KXTA 1V3HA 3AIUA 2WANA 2DPEA 1JL8A 4PRWA 2W92A 1V3JA 1HP5A 4K68A 2WW5A 8CGTA 2BNJA 3CZKA 4B3KA 4MNKA 4D6HA 3SUWA 2VTFA 3CHDA 5D9PA 2GJPA 4W8BA 4FF5A 5A1AA 4P8VA 3ARTA 1WDSA 1NP0A 2QMJA 3ARXA 3AROA 4MAVA 1VFFA 4J3WA 3AYSA 3ARYA 2QPUA 5A2AA 4D71A 2WMIA 4W89A 1E6RA 1HIZA 3UG5A 3ZT6A 2WC3A 2ZUNA 2FGZA 5CXPA 2HISA 2J62A 4P8WA 3AXXA 1ITXA 3N9KA 2YA1A 1CGWA 3SURA 1A3HA 4W8AA 3UESA 4UQAA 3FY1A 4KGJA 1HP4A 2ZE0A 2C8NA 2WXDM 4OBRA 4XB3A 4JL2A 3VIPA 3ZT7A 2Q8XA 1E0XA 3WMBA 1UOKA 1NWSA 3PZUA 3T2OA 4ZE5A 3UG4A 4GIAA 3CBWA 3VIGA 3F5JA 1W3JA 1M7XA 4DM2A 3VU2A 2CEQA 2BHZA 2GSJA 2VL4A 1MW2A 1FH8A 2CCRA 1RP9A 4BCEA 3GTNA 1WZMA 3GYCA 3WQWA 2YA0A 2HVMA 4PSPA 3RJXA 3EMQA 3M46A 1WP6A 3AIQA 1QI2A 3HU7A 3K46A 4JFVA 1UH4A 2WC7A 3W26A 3OGRA 3TTYA 3ZR6A 4TVDA 1FA2A 3OB8A 4IPNB 1HVQA 4XV0A 7CGTA 3CZLA 5ABEA 2VNCA 1TFVA 1MW1A 3VM5A 1GZJA 3WDHA 2XFFA 2QPSA 1CXFA 3MU7A 5A6KA 2IXVA 3EDEA 2XIIA 1E43A 1E6QM 1UWUA 5JIPA 2B31A 3K4DA 2RGMA 5BYWA 4W87A 3WL0A 3HMCA 3T0DA 2DT3A 3VGHA 3UG3A 2WPGA 5I6SA 2VX7A 3POHA 2D0GA 1DHKA 1VFMA 5JBFA 1JZ8A 4MTVA 4ACYA 3OBAA 1PJ9A 4L4OA 4W7VA 3VIOA 1Y7VA 1LG1A 3VVGA 1JZ4A 3POCA 1KWKA 4CN1A 3ARRA 2TAAA 3NSMA 4CCEA 4TVUA 3N04A 3AXHA 4YHEA 4HZ7A 1KGUA 2W66A 3LPFA 4FLQA 1QI4A 2ZOXA 5E6YA 3ZMRA 2ZUWA 1V6VA 4UQBA 5GNXA 1DTUA 2CNCA 2UY2A 1J18A 4UQCA 4AD4A 4Z2IA 3VD9A 1V02E 2MANA 3CZJA 1EOMA 3AZTA 1QHOA 4W5UA 3AIRA 2FHFA 4OUEA 4QCFA 1H0GA 4W93A 3BCFA 3BH4A 4AZIA 1CGVA 5A6BA 1OGBA 1BYCA 3ECQA 3LPGA 1G5AA 2FH8A 5E09A 1VF8A 2UY3A 4F66A 1K9DA 4CUCA 1WO2A 1XH1A 1W9BM 1BG9A 1NWRA 1NARA 3CHEA 2WVUA 2VX6A 2YL6A 2FHBA 4AD5A 1KCLA 1FP9A 1GQJA 4AD3A 1CXIA 3NIYA 4PMOA 2XM1A 2WMHA 2YA2A 3U5YA 2E9BA 3QGVA 2JFEX 2FDMA 3WDIA 4PMYA 1V0NA 1EHNA 3SUSA 3MV11 4DWSD 1CLXA 2PI6A 2PWFA 1E55A 1VBUA 1ZBWA 1ZB5A 1ZBCA 1HKJA 3ZQ9A 4AZBA 1KXVA 1KXHA 2J7DA 3PZIA 1QBAA 1M01A 1ISVA 2V3DA 3AZSA 3GDBA 2CXGA 4X0NA 2J75A 1TA3A 2JEPA 1KGXA 1MQRA 2WC4A 1MW0A 3AIBA 5E70A 1O7AA 5BWFA 1NP2A 4W7UA 5HPCA 3L4WA 3RM4A 1JNDA 4WKHA 2C7FA 3G6MA 1X6NA 2GK1A 4A4AA 1BF2A 4JFUA 3PZGA 3WDJA 1UD6A 1GORA 3II1A 3LPOA 2EPLX 4MPKA 1WNOA 2DGAA 2XIBA 4UZSA 2OYLA 1E3ZA 3MKKA 2YOCA 4ML4A 2XPKA 4WK9A 1Q4NX 3WKZA 3CLWA 2WSPA 5HOSA 4MJ2A 3W24A 3WD2A 4WJXA 4R5EA 3CTTA 1WKYA 2VZSA 3PZOA 2WHJA 4GXPA 5A94A 2WCGA 1J10A 4UFJA 2J74A 1I75A 1DWJM 5A95A 4UOQA 1SR0A 5HXMA 2WMFA 1GOKA 1VBRA 2VCCA 5D8ZA 2XGBA 2WMIB 3IANA 1C3FA 3AMDA 4P7QA 1WZLA 1W3LA 5JUVA 3QHMA 4BA0A 1UR9A 4D1IA 4W85A 4Y7EA 2D0HA 5DFAA 3ZSSA 4AW7A 3QOMA 1W3KA 1E4IA 3GXMA 3WUFA 3WH8A 4M56A 1QW9A 4WIWA 3EYPA 1GVYA 3W25A 2QHAA 3T2PA 3BXWA 3U7VA 1FH9A 4WKAA 4U2YA 9CGTA 1CXEA 1KWGA 1CGUA 3OG2A 1FHLA 1LL7A 1QI0A 2DT2A 4MB4A 5A6SA 1ZBKA 3CMGA 4EK7A 2VZTA 2WLZA 4PN2A 4UQDA 1KB3A 1J0HA 1K9FA 3RMEA 1ZL1A 5A8QA 3UEQA 1GW1A 1XYZA 1XSKA 2J8FA 1PIFA 4XZBA 5BXSA 5FOOA 5M5DA 3FHQA 3D3AA 1UZ1A 1MQQA 1V0KA 3G6LA 4OKDA 1HL8A 5A6LA 1US2A 1J9YA 1A47A 1JI1A 5HBFA 1AQHA 3WDRA 3AS3A 3HN3A 2DIEA 1TVPA 1B2YA 2WBKA 4QLKA 3ZJ7A 4KRUA 2VZVA 1PPIA 2WK2A 3ARSA 1VFOA 3UR8A 1FFRA 1UHVA 4U3CA 2VQTA 1B0IA 1CXKA 4P7OA 2BV9A 4MNMA 1JZ7A 3KL0A 1JD7A 2D22A 4HU8A 3SUUA 3RCNA 2ZXDA 4PSRA 2QF8A 3L4TA 4GI9A 2BY3A 4MDOA 4TOQA 3ZT5A 2EJ1A 3VPLA 1H11A 2ZXAA 3ALGA 2XVGA 1FHDA 2CBVA 5DF0A 2G4FA 5M17A 1OBAA 2AMGA 2X0HA 2F8QA 2EPKX 4DWSB 1B30A 2EO7A 2Y8VA 1PBGA 2Y2WA 1RD6A 3BLPX 3TP4A 4LXFA 4JZ5A 2W63A 2XSAA 4QLLA 3B9AA 3VDHA 2OWCA 3WSUA 2X0YA 2WMJA 4HMEA 3ZSTA 1E73M 3EDDA 1GPFA 4UFMA 2ZUUA 1EQPA 3UCQA 3FAWA 1QI3A 1V02A 2EXOA 2VVNA 4B9YA 1PIGA 4XUYA 1K9EA 4AD0A 2UY5A 1JF5A 3K8MA 2GJXB 3RJYA 3IAPA 1C7TA 1GQLA 3WH5A 1W1TA 4FLRA 1E6XM 3VM7A 1UD3A 4JKKA 4AIUA 2GJXA 1D3CA 1ZJBA 2VC9A 4HA4A 1XCWA 1QNOA 3OZPA 2YKKA 3VNZA 1H2JA 3AJ7A 1V6XA 2CERA 4AD2A 1UR0A 1UWTA 4CD7A 1GOIA 5ABGA 2DQXA 4AWEA 5I78A 2PWEA 1K9TA 4UNIA 4M82A 2NT1A 1WE5A 2CIPA 1F4AA 4CD5A 1J01A 3VIKA 4D6GA 1JFHA 1IT0A 2W61A 1JXJA 4U2ZA 4GPNA 4Z2HA 2WWDA 3MUIA 2YLAA 4GKLA 1UH3A 3T08A 1UQZA 3VIIA 4QCEA 1W2VA 2BY1A 2WCSA 1LWHA 1WZAA 2JIWA 3WDQA 5CLTA 3N15A 4V2XA 5A2BA 3OLDA 4J27A 2GJRA 1J0ZA 2XWEA 3W4RA 2WBGA 4MB1A 4B9ZA 4M29A 1TVNA 5ECUA 4FMVA 3OZOA 4W8LA 1HVXA 2ZX5A 3DHUA 4NRSA 2GK1B 4ZE4A 4EE9A 1UH2A 4URIA 2BS9A 7A3HA 2DH3A 3GXFA 3TONA 1U30A 1B9ZA
chains in the Genus database with same CATH superfamily
5LZLA 5FAGA 4LW7A 2ADAA 3G8EA 4QJ4B 3PULA 3S9ZA 1KM2A 2H8XA 1KBKA 3SY5A 2PURA 4TX6A 2FTYA 1UKPA 3VOCA 4J1OA 3C4UA 3PUOA 1N7KA 3KX6A 2PDKA 3USBA 2VQUA 2P8BA 1ZRQA 3RX4A 1E0TA 2BVYA 4HB7A 3H4WA 3W1NA 3TOPA 4HHMA 3JU2A 3QPEA 2ALDA 3GWQA 1C29A 1H5YA 1G01A 3O05A 4OJYA 3T0TA 3H2CA 4I9AA 1AZ2A 3AS0A 4V1YA 2BB0A 5GQBA 2PDJA 4R88A 1UD5A 1EC8A 3OTRA 3SCVA 4YTQA 3L4XA 5AZ1A 4GINA 3SY1A 3QHNA 1CIUA 4GBDA 3M5VA 5LNVA 1N8WA 4U3AA 4B15A 2VGIA 1T99A 4KBXA 3LD5A 3B8DA 3PP7A 1O5XA 4UTMA 2PLCA 4QDMA 3O6CA 1EWEA 1H7PA 4DO7A 3WK1A 3OVGA 4YLWA 1JQXA 1M68A 1S2TA 1W9VA 4KFOA 4Q32A 2ZX8A 2B7OA 5G1YA 3WJSA 3KVKA 1ONRA 2C0AA 2EKGA 1RVGA 4J3XA 1EPVA 4QROA 2YCEA 3UPWA 3VOIA 3MV01 3AYTA 1ZPTA 5LNSA 1R7AA 2PDHA 3UY8A 3EBVA 2GGEA 1QFEA 3VIMA 1CZ1A 3MVIA 4H4IA 1L2UA 1XLHA 1QNPA 4KFPA 3IARA 4M7TA 4HBKA 1EJXC 3R8HA 1SGJA 1SFSA 2WZIA 2A4AA 2X1RA 3GDKA 1BWVA 1E4NA 1Q6EA 1VRXA 3A4JA 3I10A 3WK0A 4Q8MA 3GX9A 2QJJA 1FWNA 4GJ1A 1L8NA 4QHRA 1JFXA 1E71M 2D3LA 4FHAA 1XRVA 3WIJA 4JIEA 5REQA 4R34A 1RCQA 1Q6CA 5DO8A 3EB3A 3WJYA 1O5KA 3TSBA 1J79A 1K03A 1R85A 2HWGA 3E1F1 3NQCA 1O60A 4M0XA 3DZ1A 3NQDA 1BHGA 4I7WA 3CUHA 3TJXA 3E49A 4CN4A 4MZ8A 1KFEA 1U22A 1U5JA 1PCWA 4US6A 3TR2A 3W37A 4O1EA 3FW6A 2CLKA 1XICA 1RLDA 1O95A 1GOQA 1BG4A 3RO8A 2ODOA 1IXOA 5DXYA 5DN1A 5IBXC 4AQLA 3RHGA 1XLKA 3GUGA 3TYUA 2DV0A 4C7DA 1OK6A 2EG7A 4Z17A 2F2KA 5KZ6A 3MCOA 2FZBA 5C0QA 5D33A 3TUUA 4PUWA 3GC5A 4DM1A 3W82A 5BU6A 4XAGA 3PTQA 5LYRA 3VOJA 4IWWA 1PDZA 3GM8A 2R9RA 2VR4A 4DI9A 1W17A 3FVMA 4Z42C 1IZJA 3RYSA 1XRFA 2XN2A 3VIHA 3GBDA 5KITA 5FIPA 1XLEA 5AC6A 3PB0A 3ITVA 3T2QA 2H3DA 4AH7A 3V18A 1TUXA 3D5HA 1H5VA 4NX0A 1FWFC 2YL9A 1V6YA 2G3MA 3MMWA 3ARZA 2CLFA 5JH2A 5BMXA 3W02A 2WJDA 2WO5A 3B0YA 1T41A 1XH2A 3UXKA 4JIPA 4DX3A 1FRBA 1HT6A 3WNLA 4AU0A 1XC4A 3C2RA 4Z2GA 2A3EA 4GNJA 4CKQA 4GQBA 1TPFA 4REQB 3EX3A 3S9IA 1DJYA 2DSZA 5CG0A 4GIYA 1NF0A 3JR2A 1W2PA 2OTDA 3EA3A 4FSAA 6XIAA 3A9IA 4F2UA 4JHOA 2D20A 4WY0B 2WHMA 4PCFA 3PVFA 1NOUA 1A5CA 4N6FA 2V3FA 5FJRA 1YQ2A 2XG9A 3PPHA 4DRSA 5PTDA 3WBXA 3TAKA 1KR1A 4GG9A 4O8RA 4X3ZA 2B4GA 1KFLA 2CYGA 4QG9A 1F8MA 5HULA 5FCZA 3MUZ1 3A4AA 1PE1A 4Q8WA 4GJIA 3MP5A 4U28A 1GUVA 3O0KA 1P0KA 4DYKA 3VNJA 4AMCA 3CT2A 1E1CA 5LNWA 2JBMA 5G4WA 4OZOA 4X2PA 3UT0A 2F6XA 4AZHA 3VKDA 3QLLA 1CEOA 3W74A 2Y0FA 4XO6A 3OLIA 4HIBA 2VEIA 1REQB 4HPHA 2YCJA 4AF0B 3MTWA 3VGGA 4TO8A 2J7CA 4DUVA 1Q6LA 3WBEA 4QIUA 1DJHA 2OR2A 5HJXA 4NG3A 3SADA 3BVJA 1YTEA 5DY3A 5E9AA 2XH2A 2VO5A 5FAJA 3SN0A 1LQ2A 1GVQA 1OGGA 3E0WA 2O0TA 3U2ZA 3FXGA 1JZ2A 3FXYA 3LZ5A 4PMUA 4LAOA 4TU1A 3M07A 1P4CA 4KRTA 3NQ2A 4O12A 4GGBA 1BWKA 3M0HA 3ZLGA 1OHLA 4PCTA 1A3XA 3WY1A 4J7RA 4JN6A 4M1BA 1EB3A 4NY2A 3TLLA 1B3VA 2OFJA 4IISA 1W8SA 3QRHA 2QCCA 2WHLA 4C6EA 3IGSA 4HPJA 5HWJA 3WK3A 1E9LA 1LWIA 1V77A 3I4EA 4LAUA 1PX8A 4WHBA 4I90A 3VOHA 2XVPA 3BLLA 5EGRA 4BQ5A 4HZMA 4GHRA 4K1GA 3MUXA 3CHFA 1TV2A 4MY9A 3HZ3A 3CL7A 2ZX7A 3TVAA 4Q22A 1AL7A 2YXXA 1KM6A 3FHAA 4O15A 4A3QA 2GLKA 2O7SA 1EIXA 1GJUA 4AAJA 1EX1A 3QYSA 3SO7A 4L64A 2P3EA 1JDAA 4L4LA 3M0VA 3EOEA 4LVFA 5T9BG 4RZ6A 3WZ0E 3WQ5A 2GQ9A 2XM2A 5A6JA 3ARUA 1SQ7A 3BQ5A 3W6YA 1B3OA 1EBHA 1AVAA 1X8CA 3CYJA 1E40A 5G2HA 3B9NA 1DIEA 1G4SA 4TTGA 3ALFA 1GYNA 4PMRA 5T26A 5C9XA 4QTGA 5SWUA 1PKYA 4XVEA 1BD0A 1XXXA 2HBXA 2J78A 4CQAA 4E2DA 2VM8A 2BSLA 1KKOA 2X42A 4H19A 4HSHA 4XBSA 4JTCA 1NDVA 5GJNA 4KPLA 2GFTA 1LLZA 4QS5A 1I1XA 2GDVA 4HNOA 4ZENA 1RALA 4R3UA 4B4HA 2XH7A 5FKYA 4D8LA 2G3JA 3DHDA 1UD8A 5HUPA 3TQPA 2D1ZA 4HOWA 1SSGA 3LHUA 3UGRA 4QR6A 5I2UA 1SVDA 4Z1CA 5K4ZA 1P0DA 1LBFA 4B16A 4DJDA 1ZJIA 5AB3A 2ZCGA 5EB8A 2P88A 2J8GA 2ZRVA 3GW3A 5DT7A 2QDGA 1E9ZB 4MWAA 4HPXA 3WX7A 4LYKA 3CIVA 1WXJA 1GTEA 2PWHA 2ZDRA 2PDUA 2WPBA 3M5YA 3AU2A 3S1UA 3G5EA 4PMXA 2VP8A 3HFTA 2X1UA 4GVGA 3MUAA 2WOQA 4AEEA 2Y7FA 4OBSA 5I3HA 1V79A 1NFBA 1FVPA 3GNNA 3ONCA 3LCXA 3WQ6A 4D6FA 1VPYA 4LRTA 4CVUA 2QDEA 3UNTA 3BG5A 4RE0A 3W1AA 3RM9A 4ADTA 4H9TA 4MKVA 2ATMA 1OQFA 1Z41A 4HZ6A 5A8OA 1OIFA 1TWDA 3CWNA 3GXIA 3HPFA 3UYCA 5E0FA 2VZUA 2BVWA 2Y5SA 1AL8A 4UR7A 3CHVA 2RHGA 2PWGA 2CITA 3NURA 2HTMA 1LLOA 1TUFA 2HVNA 5JH1A 2OO0A 3LTSA 1KCZA 1UQYA 2QUUA 1TZZA 1TKKA 2HV5A 3L2IA 3P2VA 3CL8A 1W5NA 3NDOA 2YCLA 4I8DA 4ZEPA 1DWGM 1P5BA 4I5RA 2HMCA 3W1RA 4NX5A 1TPEA 1V08A 3TEVA 2DZXA 3BMWA 3M0JA 4BKNA 3S6TA 5AHMA 4F9JA 1W5QA 4NJHA 2CHRA 3TN6A 4FZIA 2VOMA 3LLXA 3S47A 3UVIA 1CYGA 4XIAA 1WOBA 3F5KA 1HJWA 3OIHA 4KIEA 4AB4A 2R1MA 1E4MM 2GVEA 5EMKA 1QTWA 1T7LA 3KBMA 4DAFA 2WB5A 1M65A 3CEPA 1JAEA 3TZFA 5G1MA 2ZUVA 2GUYA 3NTYA 1M41A 4YCOA 3HGOA 4NILA 4LUJA 2I56A 3W84A 3O63A 1BSIA 3WH7A 1ITQA 3NQ6A 1R38A 4L1XA 4HPGA 3G18A 3VX1A 4EPEC 5L6UA 3T0AA 2MNRA 3WMLA 4W4QA 1JD9A 3L4ZA 2WNNA 2X2YA 2XN0A 2H9AA 1KCXA 3ARPA 4RNFA 1TWSA 3DC0A 1AMYA 1C92A 2FIQA 3IV8A 3UZYA 5E9XA 3V5FA 4ACZB 4MYXA 1WCGA 1A53A 5JBDA 1A80A 1KV5A 1WBHA 1XRSA 4OIFA 4XG1A 1CENA 3IAQA 3ZFHA 3TU9A 5JMUA 4GA8A 3BW4A 5HMSA 2RDTA 4PTDA 4YHGA 3O2LA 1RH9A 4Y8EA 1JNEA 2O9PA 2Y61A 4PTXA 3SECA 3SSZA 4IX2A 4FI4A 5EMYA 3R6IA 1E56A 2FPYA 2VRQA 1JAKA 1VCGA 2QGHA 3N34A 1OB0A 3I7QA 1V3LA 1EC9A 3SQMA 3VMNA 1UB3A 3IPWA 2SFPA 3W86A 4MWAC 2D2HA 3AHXA 3VZXA 3ARQA 2VRJA 1TR9A 1JR1A 4JHMA 1IXPA 2VWSA 5DX7A 1TTJA 4MNJA 1AH4A 4UMAA 4LBRA 4S3DA 2C14A 4MDPA 4PTVA 4GX8A 3WQVA 1XDLA 2WSRA 1L6WA 1NDWA 5AC8A 1E9YB 3MKVA 4XTIA 1BVWA 1MEHA 3H23A 4A6GA 1YW1A 3H53A 1CBGA 2PDBA 5E6ZA 3S3GA 2DY3A 3HGRA 4LOCA 1EYWA 2GGIA 3G24A 1MRAA 4NNBA 4MUPA 2W91A 3LGGA 2BGNE 4RDZA 3SCOA 4CNUA 4IHCA 3N25A 3WN6A 3U48A 3QYQA 4XAPA 1VBGA 1TZ9A 3SR7A 4AIOA 3A13A 2VWTA 1ME9A 3ENLA 4HTYA 4LCRA 1AD1A 1CGYA 1RAKA 4B92A 4IQDA 2Q3RA 5AC4A 2J7FA 1R3QA 1W32A 3TCSA 2FMOA 1PIIA 2YYTA 1H7WA 3ZLHA 1MUMA 3R4IA 4J3UA 2EF9A 3EX4A 3WNKA 2YCKX 3IK2A 4AX7A 3IK4A 2WYSA 3TJLA 4PFHA 4PCSA 2QCMA 3S6OA 1Q7MA 1F2JA 3L4YA 1F05A 3GU9A 1YX1A 3KWXA 2BGSA 1NH6A 1HKIA 3I7SA 3WQDA 1R30A 1JCYA 3W2NA 1G4EA 2YJQA 2OEJA 4Y9AA 3PBVA 4F79A 4IMCA 5HANA 1U5HA 1AH3A 3SIMA 3BTNA 3XINA 3M0LA 3AQUA 1BSLA 4NZJA 1OM0A 2WCAA 3VKKA 3SRFA 3QQWA 4H41A 1MVYA 1ITUA 3NPUA 4CEXC 4QLJA 2GPTA 2D23A 2V5DA 1R0MA 1UG6A 2E68A 4BF9A 4ZQMA 2QIWA 3MKCA 3FVDA 3W53A 2JK2A 4C1KA 1UKTA 1BFNA 2VMFA 3QW3A 2B7QA 2PDFA 3ABXA 1SZFA 3AUOA 2WNZA 4DJFC 1LBMA 3UD6A 2XIOA 3QGKC 3WFZA 3A3HA 2V67A 1GW9A 2W67A 4GK8A 3U7BA 2GQ3A 3O6AA 1UKQA 1OF6A 3E96A 3M0IA 1E1EA 1QT1A 1OZQA 1QI5A 3LCFA 1XUZA 1UR4A 2I16A 2BOEX 4BZYA 4GYPA 2AKMA 5LNRA 2CZVA 5H2ZA 2XU2A 4RDWA 1KQZA 4BEUA 1UWQA 3SQLA 3R0UA 4DXXA 1JF6A 5GJPA 3KBJA 3HG4A 1OABA 3B05A 2BASA 1XHGA 3UG8A 3KE0A 5L9FA 3KCOA 3ME3A 1QNRA 8XIAA 3IRSA 4GYFA 1YDNA 4IPIA 4CNSA 2YDRA 4OTKA 2X30A 4LYQA 2ZZ5A 2WVVA 2BLEA 5K7JA 3UWZA 2I5IA 4OHQA 4GQRA 5FEZA 1KQYA 3CQHA 3NZPA 1PS9A 2OWWA 3QPYA 3WD4A 2Y24A 4UOJA 4WJEA 3T78A 4WLCA 5FL1A 2QNEA 4R27A 3W9ZA 4JX5A 5F2MA 3VABA 4O4VA 3IJ6A 1UBPC 2XVNA 3N6HA 5DRCA 1W3HA 2E5DA 2DJXA 5KINA 5EMLA 1RQHA 1G4TA 1PX3A 9XIMA 4O14A 2GGHA 1A4LA 3W29A 1S5MA 3WUBA 3DYOA 4YVPA 4BWLC 1R6WA 3ORWA 4LAMA 3FA3A 3OLEA 1OADA 1F4HA 2ZFAA 3M6DA 3W1PA 3ABOA 2Y5EA 1A5OC 1KRAC 3OVPA 3VGFA 3VO0A 4I7VA 4GWEA 4IGSA 1EO5A 3C2OA 1XCFA 4IFOA 1KA9F 4Q6JA 1DKWA 1KRBC 5CPSA 1LOQA 3TQ0A 4LUSA 2WVSA 4S23A 4KWVA 1B57A 1EF3A 1EQCA 1KXTA 4HOXA 1JL8A 3FOKA 4WR3A 4PRWA 1N55A 4K68A 4IXXA 1LYXA 3HO8A 8CGTA 3OODA 3CZKA 4FALA 4GX9A 3SZ8A 4N9DA 4P8VA 1WDSA 1EGMA 4RPPA 1NP0A 3AROA 4K3ZA 3UVAA 1SW3A 4PH6A 3URNA 4JPGA 4GY0A 3ARYA 2DZWA 3S46A 3VCCA 1RHCA 3H12A 1AODA 1UP2A 3TE9A 3KDNA 5HQEA 2V0TA 1O5QA 3AXXA 3FA5A 1IE7C 1CGWA 5AKQA 3M5XA 3R8GA 4UQAA 3B03A 1F3XA 4JL2A 4LC8A 4E2BA 2Q8XA 2PA6A 5K9XA 1UOKA 2G97A 4ZO9A 2PGRA 4GIAA 4LVGA 4C6IA 3VIGA 3P8IA 1M7XA 4DJEC 2CEQA 3TJIA 1T5AA 1MW2A 2CCRA 4AC7C 4Z08A 4NAEA 2PDNA 4Y8FA 2YA0A 2AQVA 3IJLA 4XO7A 1F6YA 1DIOA 3GXTA 3M46A 1WP6A 1QI2A 4Q3MA 3K46A 2PGEA 3P3BA 5HNTA 1S2AA 3BZJA 3RITA 4DJFD 3P8JA 1WA3A 3BK0A 4TVDA 3OB8A 4XV0A 4A29A 3WFAA 1GZJA 3SQSA 1ADOA 3EWDA 2XFFA 3PUEA 1CXFA 2QDHA 1TTQA 3MU7A 3OOQA 5K3VA 1E6QM 4MZ1A 5JIPA 1SJAA 4Q4RA 4XZMX 1KFCA 4W87A 5B7ZA 1DJQA 3K2GA 3SFWA 3VGHA 3AXMA 3TW6A 1ZCCA 3POHA 1JCTA 5HWNA 3OBAA 2PLKA 1VLWA 3GDMA 3HGSA 4H6KA 4L80A 1WKFA 1TPDA 2FLIA 1FDZA 2PU0A 4Q7IA 1P43A 1NDYA 4CCEA 3EZ4A 4TVUA 1WDWA 4NYUA 4QEHA 2W66A 1GVOA 4KEUA 1CCWB 4Q4PA 5CPMA 5E6YA 5FESA 1SR9A 1V6VA 2I9UA 3T07A 2UY2A 1J18A 3BQ6A 2NX3A 2OKTA 4FAMA 2VD9A 4PEKA 3BLFA 3VD9A 1V02E 3W23A 4A8LA 1UR3M 5H6HA 1LORA 2FGBA 2Z28A 3RK8A 2Y5JA 4OUEA 3WG6A 3PNZA 2V5BA 3KOYA 1CGVA 1BYCA 3LPGA 2FH8A 5E09A 4F66A 4H3DA 2NUXA 4CUCA 5BWAA 3TA6A 1EX5A 3WBWA 3CHEA 3LMZA 2E6FA 4CNTA 4RNJA 3ITLA 1GEQA 2QIIA 4AD5A 1IEIA 3S5SA 1JUKA 3U5YA 1KM5A 4NAFA 2FDMA 1L6YA 2E25A 4PMYA 1EHNA 3SUSA 4DWSD 2PWFA 3GNDA 4KS0A 2X16A 1ZB5A 4DY1A 3TSMA 3MYOA 2J66A 2W79A 4AZBA 4ZO7A 2OZTA 3NQGA 3PZIA 1M01A 3GHTA 2FFIA 3VOFA 4DLMA 2V2HA 3PTDA 2OZ3A 1F7BA 1S5WA 2NLIA 4NKCA 4QEEA 4X0NA 1TA3A 2JEPA 3WLOA 1MW0A 3P14A 5E70A 2VKZG 4QE1A 4W7UA 4EPBC 3L4WA 3RM4A 4WKHA 4GZ7A 2XIQA 1ADSA 2B7PA 1TQJA 1Q65A 4N9EA 4A4AA 4JFUA 1W8GA 3WDJA 5AZ0A 4ZMGA 2I9EA 2XIBA 1E3ZA 3LG3A 1OFEA 3MKKA 4DLFA 2XPKA 4WK9A 1Q4NX 3S83A 3CLWA 4RLIA 1Q8JA 3KOZA 4AUBA 3BURA 2VZSA 4HNVA 3RO6A 4GXPA 1QOPA 3EOUA 1VQTA 1V4YA 2PP0A 1SR0A 1FKWA 1VBRA 2XGBA 1K02A 3BUVA 1ONXA 2VHLA 5JUVA 3GVWA 4BA0A 4DZ5A 4Q33A 1M7PA 4F4RA 1D8CA 1UR9A 3S2MA 3QN3A 1GYLA 3D6NA 3WUFA 1J93A 1JCLA 1GVYA 4WJ8A 3VC6A 3L0KA 2QHAA 3T2PA 6ENLA 5FF4A 3U7VA 4JTSA 2NV9A 1FH9A 4U2YA 1SW7A 3UXDA 1CXEA 4XTDA 1KWGA 3OG2A 2DZAA 1MO0A 3SBFA 3BARA 1ZBKA 3TC7A 4EK7A 3NOYA 4PN2A 1DYSA 4GCAA 3B8WA 4FX8A 3UXAA 1KNWA 4O0QA 2YZ5A 1ZJHA 3O16A 1JDEA 3M44A 3P5ZA 5FSDC 1TSIA 1XSKA 3R7MA 1PIFA 4XZBA 3OYZA 1XLJA 1EJWC 3F4CA 1TJ1A 1US2A 4G7EB 1IXNA 1S3HA 1RCOB 4LJ3A 2A6NA 2AMXA 3AS3A 3HN3A 2QPXA 4KRUA 2VZVA 1PPIA 4LAKA 3W07A 6XIMA 2IPFA 3H7UA 3ARSA 1UHVA 1TVLA 4H7ZA 5AHFA 1CXKA 3TXZA 1ALDA 1PKMA 1JD7A 2P8CA 3TC3A 3SUUA 4KWWA 4MDOA 3W87A 2Z1VA 2Z29A 4TOQA 3W70A 3QMRA 4JTEA 4FR1A 1VH7A 3QVQA 4JTTA 2ZXAA 2CBVA 4QQ3A 2NQ9A 2G4FA 3UPBA 4EOUA 4AIBA 5KSWA 1RY8A 2HNEA 1EKOA 3TJ4A 6PTDA 3QXBA 1RD6A 3TP4A 3GAKA 4LXFA 1W5PA 4JZ5A 2W63A 2CZ5A 5XIAA 3FDGA 2OWCA 1ONWA 4A8RA 4EP8C 1RPXA 4RNHA 3EDDA 1GPFA 3FYPA 1W1A1 3MA8A 3HFYA 3RUBL 1KO0A 3OA3A 3DI1A 4NZ5A 3FAWA 4H2HA 4N6EA 4XUYA 2ACUA 1W54A 2PLMA 4AD0A 2O7QA 3R94A 4CLMA 3ITXA 2V81A 3IAPA 1C7TA 4MKSA 3UY7A 3E2SA 1AG1O 1W1TA 1MI3A 3N6QA 1UD3A 1ZJBA 2VC9A 1O66A 1QNOA 2G50A 2YKKA 3TX9A 2OQYA 4QJ5B 1AH0A 4PL1A 4AD2A 4F2TA 1YTDA 2WSYA 5HINA 1S38A 3CNYA 4AWEA 5I78A 4IL0A 2PWEA 2IKHA 4UNIA 4M82A 4DVOA 4NNCA 3AUJA 2YR1A 1ZY9A 3ZS4A 3KM8A 2W61A 3TZNA 1NDZA 2OT0A 3MUIA 4GKLA 3VIIA 1SO3A 3AJXA 1UASA 1IIGA 2WCSA 1WZAA 1JCXA 3PJXA 4FS9A 4V2XA 1X98A 1XJBA 3OLDA 4LVBA 1QPQA 1JCMP 1J0ZA 1Z48A 3KTXA 3W4RA 4MB1A 4M29A 5ECUA 4AF0A 7PTDA 3DCPA 2BS9A 4ZR8A 4RXFA 2DH3A 1R3TA 4LUYA 2J24A 4UNLA 3F4VA 3MI6A 3L67A 4IMEA 1Q6DA 2OOFA 2PP3A 1CDGA 3S9YA 2XISA 5AECA 1UD4A 3KRUA 4HPNA 2X2GA 3UWEA 4NF7A 3SCWA 1LZOA 3M0ZA 3A5VA 1OT2A 1VCVA 4ZOBA 4Q8UA 4W9TA 3CPRA 2Y88A 2C71A 3OEXA 4FX6M 1BKHA 1ZU8A 1WDDA 4PMQA 5C9ZA 1Q6OA 5IFTA 1ISXA 4QJ1A 3UQNA 5HQMA 2I7GA 3QHOA 2EAWA 1YDVA 3BAKA 2YBTA 1C7SA 3KFTA 3ISIX 1WDRA 3FCPA 3WLIA 2FB3A 2DEPA 5LKYA 5CGMA 3C3NA 2PTDA 1YNQA 4CQCA 2HCVA 2PPGA 2F2HA 2NQJA 3QR3A 1EDQA 2PGWA 1XYFA 3PFMA 1LUCA 3HOJA 2Y8UA 5C7HA 2Z1XA 3OW1A 2PLJA 1AK5A 1VIZA 2XTKA 3VNYA 1FWJC 4F9DA 3N2XA 1JZ5A 2YPIA 1YE4A 3ZIZA 3TW7A 5M03A 2XDFA 3H2AA 1CB2A 3W38A 3BLOA 4O17A 5E0CA 3L9CA 3BLIA 1SMDA 2DVUA 3MP4A 1G94A 4QSFA 4C5ZA 1O4UA 2YW4A 4N02A 3P81A 2G3FA 1XV8A 3IS4A 2G41A 3CC1A 2DSWA 4XZHA 1VIWA 3GS6A 3QGAC 4R33A 4V15A 3NZQA 3LMYA 4GZEA 5G2WA 4GLEA 5HNNA 4LWWA 5IHSA 2Z1SA 1OCQA 2FKPA 3GHSA 4XD5A 5IDIA 1E9IA 4GJJA 2PMQA 1KBIA 4L56A 5LA1A 1OC7A 3TCEA 5A8NA 1YADA 1LROA 1EEXA 3EXTA 4O1CA 3GE7A 2QLYA 1HZYA 3E38A 4DELA 4MB5A 4U4MA 2WZEA 5KEZA 3WJXA 4TVCA 4PGLA 2NXIA 4FOKA 1FOBA 4B5XA 2ZXBA 3QV9A 3W7GA 3G1FA 1UA7A 3NO1A 4L7ZA 1QPKA 4O28A 5TIMA 5DANA 1RJRA 2C3ZA 1K6WA 3H22A 4GO8A 2ZTJA 1ISWA 1RJPA 3GIYA 4UTLA 2E09A 3CO4A 1JULA 4PODA 1KBJA 1CNVA 4NI3A 3BMXA 4AY8A 3SSJA 4MG4A 4B2DD 4TUFA 1CXHA 3BSHA 3RXZA 3MDWA 4HN4A 2BY2A 4Q8OA 2J4GA 2HBVA 3N4FA 4FNQA 1GHSA 2VURA 2D3NA 1OFOA 3ZVHB 1EP3A 5EA9A 3LCLA 3V5OA 3V0SA 3SCUA 2WLYA 5AHIA 5EFFA 5ABFB 3WQ4A 3OGSA 3C3UA 5C5YA 3NVTA 4JX6A 4UR9A 1PUDA 5CQ1A 1UR8A 4A8IA 2NW0A 1K8YA 1YDYA 3V3WA 4JN8A 3QV8A 3O8AA 3OQEA 4S2CA 4G8TA 1XDJA 1FWTA 4HNCA 1IGSA 4L1WA 3QKZA 1EXPA 3L0GA 4TIMA 1TJ0A 2QUNA 2BGQA 4UFLA 4MLJA 4GOAA 4J28A 1DTNA 2DIJA 1KRCC 3KVLA 1B1YA 1MQPA 3QMSA 1XQKA 4M8UA 2GJNA 3G8RA 1VS1A 2DVXA 3GU2A 3RLVA 3IUHA 3EMCA 2PBGA 1FWAC 3ZJ6A 1AJ2A 2G0WA 5G4HC 3EDKA 3NM3A 4H7CA 1UZ4A 1V8EA 1E72M 2Y62A 3UXIA 2QJIA 3FDKA 3MSGA 3NO3A 3K13A 3GH4A 1FUYA 3NSXA 5FD0A 5GPRA 3RIKA 4GI8A 2PTYA 2GZXA 4Z2LA 3NQFA 4UTUA 3RPMA 2HS8A 2VGBA 3TA9A 2V3EA 3H4GA 3P80A 4R9XA 5D04C 4ASTA 3FIGA 3GY1A 3S1WA 4DB7A 4FB7A 4IUGA 1VFTA 5C2GA 4FA3A 2UWFA 3VNKA 3LBMA 3ARWA 2XSBA 1K8ZA 4FNTA 3W88A 1CLKA 4AWSA 3VGDA 3LENA 4ZQNA 1UIOA 2Q02A 3ZYZA 1QW8A 2JF7A 3GAYA 4H04A 1R2RA 3MY9A 1AQMA 1DJNA 1GKRA 2DH2A 3AMGA 4YXGA 4RJEA 3IEBA 4HP5A 3UWWA 2OSYA 3B8IA 4PCNA 1HQTA 1PTDA 2NVCA 4NSBA 4QP0A 3LHVA 3WNOA 4AG0A 2ZUSA 1US0A 2HS6A 2C1HA 3CQKA 4TMCA 4GXMA 2QUVA 1JI2A 1I0BA 2DSUA 3LRLA 2WKGA 4X2RA 4OOZA 3W7IA 4O57A 3LA4A 4S3CA 2IPWA 3I3EA 4RW3A 4S3JA 2I5GA 3A4WA 1Z44A 2IKGA 5HAOA 4EWND 1S2WA 2X1IA 3WNPA 3RN6A 3TQKA 3C61A 3LK6A 4DF2A 1TREA 2A7PA 1EJRC 1C9DA 4RDYA 3IV3A 1PDYA 4J3TA 1B9BA 2YL5A 3NPXA 2V3GA 1UROA 3VUPA 4BS0A 3KBWA 4ORMA 3A24A 2OEMA 5F4XA 4AZCB 3PPGA 2DDXA 1H09A 2DUZA 1POJA 3MUY1 1KC7A 5H91A 4EX4A 1O12A 3B97A 4FLSA 3THAA 1VEMA 4NZFA 1HF6A 3W27A 2JE8A 3QPZA 1XRTA 3P61A 1R2TA 4PBGA 3QZAA 3UU0A 3I3DA 3U0HA 3CH9A 3ZZ1A 4W86A 1XYLA 4BFAA 2VXNA 2HNHA 4N9BA 2JKEA 3UBPC 3FYOA 1Q8AA 4L6HA 4N2YA 2ZUTA 2ISSA 4UFIA 1MNZA 1U2YA 3JW7A 4J3SA 1HO4A 4EIVA 2VFDA 1EH9A 2ZRXA 2J13A 4X0VA 3CHCA 2XGIA 1E6PA 4H8UA 3GO2A 1XPGA 1K77A 5LIUX 1R47A 4E4FA 5I3DA 5AN7A 3W7PA 3GFZA 4DYEA 2F84A 1RBLA 2V9DA 3OA5A 3SGGA 1OX5A 1JPMA 3NQBA 4O16A 1S1RA 3SCQA 3THCA 4OOUA 1ISZA 5E93A 4JQ4A 4JTJA 4JAWA 1YPFA 4CVWA 4H7VA 3U2OA 3VIFA 1V51A 1KFBA 4S3KA 5D32A 3W6LA 1EHAA 2BHUA 1LQ0A 3OZMA 2XGZA 3Q94A 4PUMA 5HPOA 2OYKA 1MUWA 1M5WA 4E4UA 4I9MA 1P6WA 2VR2A 5D2XA 1LWJA 1G1YA 2ESCA 4FLOA 3GB6A 2BG5A 4P2VA 4FXSA 3CYVA 2QV4A 3S2CA 9RUBA 5K9DA 4HK5A 5CZSA 1OF8A 4UFHA 2GDQA 3WEZA 2JGYA 3NGFA 3WH6A 3N73A 1XCXA 1Q6GA 1Z69A 2GVJA 3E2QA 3WUEA 4ILSA 1ECQA 1W5MA 4GY1A 4IFRA 3RM8A 1ME8A 1PB0A 2C91A 3MWCA 2HPMA 4I5UA 5BROA 4ZFMA 4F48A 4I9JA 3L2LA 3QM3A 1D3HA 6CGTA 1PO9A 4UCFA 4F0SA 2PC8A 2Z6JA 1MZHA 2VVSA 4I9TA 3GG8A 1EJ7L 3FGCB 2GSEA 5RUBA 4TXEA 2R1KA 4AZ6A 5MF5A 3CZEA 3KBVA 2IKIA 3V5CA 6TAAA 5CC3A 4QGCA 4PB4A 3PSVA 3T09A 2J7HA 4S3GA 2EPNA 1SFLA 1W6TA 2E8ZA 4LVAA 5FEWA 3IJ7A 2EEXA 4PEEA 4R9OA 2Y7GA 4ALDA 2OPJA 1QWKA 3UR2A 5F2IA 3DFNA 1LLWA 4TMBA 5EYWA 3MC5A 1A5LC 2GQ8A 2D2GA 4WXYA 2OXNA 3AIEA 4C7GA 3BZGA 3WD0A 3G77A 2CHNA 2ABAA 4JCMA 3SJNA 3PWGA 3DECA 1FCVA 2GOKA 1QOXA 2PRLA 5HK4A 3KZPA 1A5SA 4B5SA 2E9MA 1XLDA 2D2OA 3F4WA 4XZ9A 3M41A 3N4EA 4B5NA 2Y7EA 1EO7A 3SDOA 4HMCA 1L9WA 4LY4A 1G7VA 3KVMA 3GZ3A 4PTNA 4QDPA 4UZUA 1JYWA 5BRPA 1EJSC 1HKWA 3WQFA 3W0KA 2EG6A 5A8GA 5A3HA 1XBVA 5HQLA 3AHVA 3QY6A 5BXRA 2R1LA 3AI0A 2CFFA 3OHMB 2O4MA 1LBLA 4GCXA 1J0JA 3AXIA 3ICJA 2DSVA 1F3TA 4J3ZA 2G3IA 3J7HA 3U3HA 1FCQA 2JIEA 2Z1WA 3CUXA 4I8YA 3RU6A 2Y7DA 3DFHA 3BE7A 3SRKA 3VD3A 3NEVA 3SCNA 1EJUC 1BTMA 1WB0A 4UTTC 4C6PA 4US5A 1I1WA 3DFQA 4O1AA 4R7OA 3SRDA 1OSEA 3KBNA 4MY1A 7XIMA 3PNUA 4RZ4A 4BQ2A 1Q13A 4G56A 4LALA 3PR2A 3GFYA 2ACQA 3AZRA 1GNXA 1VENA 3I4KA 1QK0A 4PMZA 3GRIA 4WUIA 4MFDA 3W1LA 1DJXA 3KXQA 3GHUA 4LC6A 4IPPA 4FX7A 1U1HA 1QPNA 3AYRA 5TAOA 1SUXA 3B04A 3P84A 4LS2A 3W7CA 1KCKA 1TCMA 3LYEA 4BJHA 4DZHA 2E40A 4LB3A 5BW6A 1IEVA 2EQDA 2DVTA 1UR2A 2VI0A 2ZBTA 3HJEA 4WGHA 1J0IA 4P61A 3ZXWA 1FHVA 3R2GA 4NI8A 1EP2A 3A6OA 3C2FA 1A5NC 1EDGA 1PSCA 1KFWA 4HA1A 4M6QA 5TQLA 5E5CA 1P6CA 4GGHA 5D37A 4EXAA 4ZSUA 4Y9NA 4QQUA 1RP8A 4M3PA 4M7SA 4Z0SA 3DFTA 3WD1A 4LANA 4MSSA 1PEZA 5BNKA 2ZC8A 3LLDA 2GUBA 4DQWA 5A8PA 3KP1A 3VXGA 2Y4SA 1BYAA 4CCZA 1LRTA 4XKMA 2FTPA 4IX0A 4XZIA 1S46A 2HSAA 3HA1A 3C0LA 1FWSA 4MZYA 1T8QA 4RE3A 3GG1A 3IACA 5H8MA 4MUZA 4LEFA 1E3XA 5LGZA 4BF5A 4D2JA 1QNVA 5DQPA 4JQAA 4U33A 5DT5A 3Q2DA 1SMAA 1DIKA 1J0KA 2DP3A 4B4FA 3AMCA 4M1RA 3FJ4A 1C8QA 2IQDA 6REQB 3ZLFA 4BQ3A 4PZVA 4ZQCA 3MSDA 1OFAA 4P8XA 3ABZA 2VOTA 1XYAA 1WXYA 1SM9A 4D6CA 2JF6A 3S5YA 5ABFA 1YHTA 2QQ6A 4IFKB 3E6EA 3QW4B 2A1YA 2E77A 3QEZA 2PDCA 4AY7A 2EJAA 4Z1AA 5A6BD 5HDRA 1IYXA 2VDGA 2DZSA 1UWSA 1GVSA 3AICA 1LQAA 2RJGA 2QW5A 5H8UA 2QCEA 3OHIA 2RDWA 3H21A 1XBXA 1NSJA 1VB9A 2VEGA 3PFRA 3O1NA 4FOUA 3O0FA 2O92A 4LRSA 4B91A 3VYLA 3U4AA 1IHIA 1QASA 2ZADA 3MWAA 3NQEA 1V3MA 3N2MA 4LT9A 2WZHA 3WLMA 3UGVA 3DH7A 1FWRA 3TLQA 1TX0A 3EA2A 4HSOA 1GT8A 5FEPA 1LP6A 3DERA 1VYSX 2GUUA 4GQ0A 1XS2A 4FO4A 1V6TA 3IJ8A 3RCMA 5BOEA 5A2CA 2EPHA 2FGLA 1IZKA 1W1ZA 4A22A 1OFBA 3ZM8A 5BCAA 1YRRA 1B54A 4MWAB 1TMQA 5EMJA 5K2ZA 3UERA 4UTIA 3C8NA 3GFXA 5EKYA 2Z26A 3AMKA 3EXRA 3IJDA 5CC5A 5F2GA 1YMYA 1G0CA 3CU2A 2OKOA 1BEUA 4HZ8A 2HROA 4NUWA 2DFAA 1B4KA 1XWYA 4JCLA 5LIKX 1PHWA 5D9MA 3NZ1A 1H3GA 1P1MA 3PUGA 4PYSA 3S1VA 3N2CA 3MANA 1GJWA 4MWAE 2QJGA 3S0CA 1DE5A 4OGZA 4ZB2A 3A9BA 3B4UA 4QBXA 1HNYA 2HDJA 3C0QA 1NFGA 5CZTA 1DVJA 3O3RA 1V6WA 3UXLA 2ZKMX 1BQCA 3HV9A 4EAMA 5BU9A 3NUKA 4C6QA 5F4SA 3EB4A 1VCFA 4BF7A 1DP0A 3WEOA 2J79A 1HKKA 5LXEA 4Z1DA 4IP4A 1Q7ZA 1HL9A 3LLFA 3PS7A 4GC3A 4ERIA 2CESA 2VELA 1IR1A 4GNVA 3RILA 3W28A 3TTOA 4RR4A 4XSLA 2XVKA 2Z2AA 2VC7A 3N2BA 3UJRA 1BVZA 1CT5A 3DG7A 1XLGA 2J6VA 3PTMA 5FJOA 3GDRA 3O06A 1FXPA 3LCHA 4WRHA 4JEJA 3MVTA 1UUMA 4ES4A 4YTUA 4F0RA 3EEGA 4JQ1A 4PC8A 3IRDA 3DENA 1X6UA 3VE9A 3F2BA 3G1XA 3EWUA 3Q65A 2A0NA 2KAUC 4LAZA 2V2CA 5EFDA 1VC4A 3MCMA 3NFUA 4AZ5A 1SYTA 2BX7A 2VZOA 1ODZA 3QJAA 3K8LA 3CIXA 1VAHA 5G4EA 4YPJA 1ME7A 1Y8BA 4IQJA 1TV4A 4HA0A 4GMEA 3TN5A 1JGIA 3WLHA 2MUCA 1AZ1A 1R9YA 2CXEA 3HTWA 3NXFA 4J3VA 1RSCA 3L2MA 3DGRA 1S39A 1PZ2A 4IM4A 4RZBA 2CETA 3U5UA 4H01A 3GNOA 2QCHA 4PTMA 1E4LA 1KW1A 5F7UA 4XBJA 1W1YA 4XUGA 1Z7AA 4DBDA 4PBFA 1UMLA 2PBOA 3WFLA 2YB4A 1DWFM 5E1QA 3PZMA 5I79A 1CXLA 2HQAA 3KUMA 4ICCX 2X0SA 3AS1A 4EANA 3WF1A 1DIDA 1U1UA 3B0XA 3IJQA 4JTLA 1F74A 3AIUA 1V3HA 3W75A 9XIAA 2WANA 1FX6A 2W92A 1CW2A 1V3JA 3H55A 7TIMA 2X1TA 3N29A 4D6HA 1NF7A 5I3FA 2GJPA 4W8BA 3HMJG 1SZRA 3ARXA 1VFFA 4LB4A 3AYSA 3GUWA 3EOSA 4D71A 4O53A 4JTHA 3JS3A 1HIZA 1YIXA 4IP7A 4QDWA 4DBEA 2WC3A 2FGZA 5CXPA 2J62A 1W56A 3R43A 1TJ2A 3IVUA 4J2PA 4JQ2A 2QCDA 2J9ZA 2CZFA 3P5YA 4DJDC 1HP4A 4LY8A 4ROPA 4OBRA 1BKSA 3VIPA 5M2FX 3ZT7A 4YWSA 1EJTC 3WMBA 4A2SA 3PZUA 3T2OA 4ZE5A 1HW6A 4UTWA 2RH9A 3Q58A 3CBWA 4JIIX 3F5JA 4OV4A 4HTBA 3ANVA 1AW1A 3TXVA 2VL4A 1FH8A 1IZCA 1O1ZA 1RP9A 2TYSA 4BCEA 3TSDA 3BOLA 4QNWA 1XIEA 4UTHA 1I45A 2VFGA 1ICSA 3URAA 4HSNA 3ZVIA 1UH4A 2WC7A 4JFVA 4C6OA 2QXWA 4DZAA 5I3JA 1RJQA 3TTYA 1K4HA 3SGZA 1HVQA 1P6BA 7CGTA 3CZLA 5ABEA 3RPDA 1TFVA 2I17A 3VM5A 4K8EA 1K4GA 3VKJA 1H50A 2IXVA 3EDEA 4XBKA 1E43A 1F07A 3CJPA 1I60A 3U8GA 3K4DA 3RCYA 4NIRA 4JTFA 2RGMA 5BYWA 2PS2A 1JUEA 4GBUA 3FJLA 2VGFA 1F3EA 3GKAA 2WPGA 3MZNA 4DXKA 2VX7A 3PBWA 3W7NA 3P60A 1VFLA 5JBFA 3NL3A 4ACYA 1PJ9A 1R3SA 3HPZA 4N9CA 2FJKA 2VENA 4W7VA 3VIOA 4KEMA 5LGXA 4A8NA 4HGXA 2ACRA 4Y6GA 4L61A 3KOWA 2ZVIA 3NL6A 1VFHA 1F6PA 1JJKA 2FZMA 3VFCA 2AAMA 2EGZA 4FLQA 1IXQA 1XIIA 1ZP4A 2ZOXA 4PL2A 3ZMRA 2ZUWA 1DTUA 2CNCA 2ZC1A 3HG3A 2YCLB 3TROA 4UQCA 5LIWX 1Q85A 4BWLA 1EOMA 2FPVA 4W5UA 3ANUA 4I5XA 3NQAA 2E6DA 4AZIA 1P7TA 3ECQA 4OECA 1VF8A 3G1YA 3RGTA 1QDSA 4JYFA 4HYVA 3N6JA 1NWRA 2E1DA 3GG0A 2FHBA 1JQVA 1FP9A 3CB3A 1CXIA 2X7WA 3NIYA 1RLCL 3LRKA 2YA2A 4DF1A 2ONEA 1M1BA 1DXFA 5AYZA 5EL1A 1TPB1 2YX0A 2PI6A 2GVGA 2V30A 1ZBWA 2A5HA 1XKYA 1RR2A 4E2VA 4IP5A 3ZQ9A 2QGYA 1TO3A 2J7DA 3LCWA 5EBUA 1ISVA 3CV2A 2PTXA 1OZMA 3MUCA 3LNMA 1W3IA 4Q4MA 2J75A 1KGXA 4ICNA 3AIBA 3TYDA 4FF7A 1X6NA 5U4NA 4PR4A 1Y5XA 3THQA 2GOUA 3II1A 3RF9A 4LFYA 4NNAA 3KLKA 4HNTA 1WNOA 3QY7A 3V1PA 2Z1BA 4ML4A 3TNOA 3S42A 1NAL1 4ZO6A 3ATYA 3PBMA 2JQXA 4C6BA 1WQ5A 4WSHA 3ABSA 5A5WA 1QPOA 3PZOA 1J10A 4JOMA 2OJPA 5HXMA 1GOKA 4IICA 1FY6A 5G2IA 5D8ZA 2WMIB 4E3TA 3W1QA 4P7QA 3NZGA 2QV5A 3RU8X 2Y85A 3DIPA 1VPQA 3UR5A 1FTXA 2AKZA 4ONVA 1VYRA 3S1XA 4Y7EA 1XX1A 3QOMA 1E4IA 3PG9A 4WIWA 2W27A 3EYPA 4AVNA 3BCJA 4G1NA 1A0DA 4HU3A 1LOSA 3N19B 2RKXA 2XN1A 4XZNX 1LL7A 2IKJA 1XM3A 2WKJA 2DT2A 1VPXA 4MB4A 4F40A 3LGDA 5HMFA 3WLQA 3T81A 2DUAA 1K9FA 1QU4A 4GQGA 3RMEA 5EPDA 4Y9MA 3HQPA 2XH4A 5HUOA 3STPA 2J8FA 3PPCA 5BXSA 1PL9A 4FNSA 3KS5A 3D3AA 4A05A 1YXCA 5DBTA 2A7NA 3B8VA 3W1XA 3VAVA 3V7PA 2HK0A 1J9YA 1JI1A 1AQHA 3WDRA 3CMFA 2DIEA 3CASA 1TVPA 3ZJ7A 1QOQA 3T8QA 3W7JA 2POZA 1JRBA 3FLUA 2WK2A 1XI3A 2W6RA 3UR8A 5CG7A 1B0IA 4P7OA 4QG8A 2BV9A 4MNMA 5AVNA 3UCDA 4ADUA 3RCNA 1GZ1A 4MVAA 3LBOA 4GI9A 1QXLA 3W2MA 1OX4B 4LCQA 1A5BA 3REQA 2EJ1A 3VPLA 2FDSA 3DU0A 2KZHA 3BOFA 5IBXA 2OGJA 5M17A 1TIWA 3RR4A 2AMGA 3W7MA 5G1TA 1A0CA 2F8QA 6ALDA 5I3GA 3DFYA 2EO7A 2Y8VA 2Y2WA 4ZTYA 3BLPX 3QTGA 2XSAA 3B9AA 3LEPA 3BW3A 3VDHA 1I2QA 5EMMA 4K37A 1OCJA 4S39A 5KETA 1DJZA 1PYMA 4HMEA 1Q7QA 2PWUA 1P1XA 4UTWC 3T0CA 3UPMA 1V02A 2EXOA 2VVNA 3W3OA 4B9YA 3RR1A 3BV7A 3K8MA 2GJXB 3T1GA 1OG6A 1TPC1 3N9SA 1GQLA 1GG0A 3R79A 4O1FA 2JKAA 3KHJA 5DELA 4JKKA 3PG8A 5KTLA 4HA4A 4PMJA 1XCWA 4JIRA 3OO2A 2I5QA 3LM7A 4KCTA 4O0KA 1I2RA 4X63A 3BANA 2ON3A 4GUFA 3JZEA 1H51A 4CD7A 3CV6A 1GOIA 3STFA 5ABGA 3EOOA 2Q8LA 3QQ0A 3USZA 1WE5A 2CIPA 1F4AA 1NTHA 4CD5A 4IGMA 3VIKA 1IT0A 3I6EA 1JXJA 4U2ZA 4Z2HA 2WWDA 4QXIA 1UH3A 1Q6QA 3R12A 1HL2A 3WDQA 5CLTA 3N15A 2E7FA 1J8VA 3RPTA 2CZDA 4UCGA 3TWBA 4J27A 2GJRA 3N2TA 1K8XA 1H7OA 3I6TA 2YFNA 1A49A 2ISDA 1IEXA 3OZOA 3MJYA 1HVXA 2GK1B 4Y9OA 3LHYA 4EE9A 4Q7BA 2R1NA 3GXFA 1B9ZA 3QKEA 1M3UA 3P82A 3INPA 1OEPA 2FVMA 5CC6A 2EBNA 3WLLA 4JNZA 3W7KA 2WVVB 1OFPA 1WPCA 2NWRA 4CD8A 3SFKA 1UC5A 3N1AA 3ITTA 3BSGA 5LHFA 2GDUA 4JTGA 3LZ3A 3LERA 1TB3A 4H8VA 2FZ9A 1O94A 4ZODA 3FV9A 2Z7GA 1QWGA 3HURA 1V0MA 3UETA 2EPMX 4ZCWA 3IIPA 3THDA 4S3EA 1RA0A 4C1NA 3FKKA 2OT1A 4CU7A 1GK8A 5TF0A 1XIFA 4JKLA 4MKNA 4M6UA 4AZCA 3B8SA 1ZCOA 5AHNA 3VMPA 4W84A 4WEVX 2FZ8A 2C1GA 1NWUA 4L9XA 4MADA 1DE6A 3DEQA 3RLHA 2VFHA 3QFEA 4E2OA 3KBSA 1I2PA 4EPDC 4JR5A 3IIVA 1HJVA 1E0UA 3TQVA 1C9WA 4AVFA 1G9HA 1EBGA 4LBSA 3LQLA 5B80A 3EB2A 1KR0A 1UKSA 1WV2A 3UWVA 3JZUA 3G1RA 2NXHA 4WF7A 4B90A 3AS2A 1X96A 2DT0A 3S5OA 3CWOX 4Q4OA 5D03A 1P0EA 3R89A 3M16A 2RAGA 3MMUA 1MMFA 1PHQA 4HCLA 1ZUAX 3APYA 3W73A 8XIMA 4OBTA 2WJZA 4J40A 4NRRA 5CAKA 1MSSA 1REQA 1YPXA 3C8FA 1JVNA 1Q3NA 2A3LA 5HA7A 4C7FA 1NJJA 4KH2A 1M6JA 4N4PA 1V6UA 2VUNA 3CEUA 4IIEA 5C55A 1CX9A 4PULA 4W7WA 1PKLA 1ESWA 5BRQA 5EBAA 1XUUA 1OD0A 5F1VA 4IMAA 2OZ8A 3PZVA 1OCNA 4ZOAA 1E0WA 5CSUA 3AFBA 1LOLA 3DOPA 3R11A 1RK6A 4L4PA 4DO4A 3IIZA 2A7RA 1GONA 4GUIA 2CKRA 1EXBA 1FWGC 4C5YA 4YTSA 3PF3A 3TYCA 1C91A 4K7YA 3KCLA 1Z8AA 3SW6A 2Z1KA 2TSYA 4GVHA 1UWRA 1VYPX 2R82A 1XGZA 3ELFA 3VD7A 2YSWA 1XIHA 1L6SA 1ZJAA 2G8ZA 5EU9A 3ATZA 2C15A 2ZXQA 1UCWA 5LA0A 4GO9A 3PN8A 4MJ4A 1FWIC 4KWOA 5CSYA 3NWRA 4Q8VA 4F0HA 1W91A 4XZWA 3D3FA 4H6EA 2V38A 3H70A 3NJ3A 3GC2A 2E67A 1PVNA 1X8FA 5D2WA 4D8AA 4DZIA 4JTQA 4GUGA 2CBJA 3STEA 1MFUA 4HMNA 2IQTA 1S5VA 1U33A 1UD2A 4IL2A 1FBAA 2NT0A 3LSCA 3LQGA 2OX4A 7REQA 1PWMA 3D46A 3BAJA 3GTXA 1YE6A 4WGXA 2IXUA 4Q4SA 1UYQA 3GSMA 2WV8A 4H9VA 4M6PA 4JBRA 3RLGA 3BOXA 3N4AA 2ZRWA 3TTQA 1AW2A 4MYAA 2UV8G 4POCA 1UP3A 3KCJA 2ZIDA 3EWWA 2GWGA 4QFUA 2IS7A 2PUZA 3MQTA 2DQWA 4GYKA 5DBUA 3DFOA 5HJLA 1QHZA 4X60A 3UJ2A 1W9XA 1R3RA 2NSXA 1GHRA 3RX2A 1IV8A 1L2QA 2CLEA 2R1PA 3G0UA 4M6VA 1W37A 1BGGA 3QOKA 3KRSA 1Q6FA 5I77A 1S5NA 5AY7A 2HK1A 1W1B1 4AZ7A 2XYLA 4HNNA 3NNTA 1E5JA 5IM51 4FXFA 1B90A 4IT1A 5D4YA 1V03A 4D6EA 3QZ6A 5FF3A 1QCWA 2X8RA 2INEA 4ZXLA 5FA5A 2QCLA 1IEWA 4D9PA 1PV8A 2VEPA 2X41A 4O52A 4P7NA 2E5CA 2H8ZA 1ADDA 3W2UA 1XLLA 1YTKA 1TIMA 3SM0A 1MYRA 2QF7A 4TX9A 3QC0A 1GZGA 2WWCA 3P93A 3QF0A 3IIOA 4UQ9A 4ZSTA 1GOMA 2W3ZA 2YXOA 4LUTB 4DBWA 5CCZA 4IIFA 3HGJA 4DUWA 3TW9A 1ZFJA 3TC6A 3PUDA 2W9MA 4HCHA 3B0UX 1XLCA 2HPIA 5AC5A 5DLCA 2OO6A 3GU1A 3BGAA 5JXQA 3UZ5A 3IVSA 1YBQA 4FK9A 4C6FA 3VDAA 5I00A 1VGAA 2ZZ3A 4GYPC 3ERPA 3NVDA 2JGQA 4QE5A 4KCWA 2W4XA 5M1TA 1DJGA 3E5PA 2E9LA 3CV1A 1PX4A 1JPKA 4TR9A 4J9JA 3NYZA 1XIGA 3BGJA 3CB8A 3K4AA 1I4NA 4HOZA 1VJSA 1SSDA 1HKMA 4R7JA 4HU0A 3GHRA 4JDYA 1RPKA 4FOJA 3UA3A 3DYMA 1WBJA 5A8MA 4GISA 1BVNP 4US5D 2DT1A 2PAJA 1AUSL 1G4PA 4KGLA 1CPUA 1OGSA 3BICA 2NZLA 2X40A 5AHEA 4L9ZA 5MKGB 3UWQA 4YN5A 2O9TA 4A2RA 3O6YX 2PODA 3E2RA 3F2CA 1S2CA 4LEQA 4ATLA 1EPXA 1FXQA 1EGZA 5A6MA 1A0EA 1TV8A 4NJGA 3MO4A 3SN4A 1VD6A 3WO8A 3KP0A 1KM3A 1H60A 1TRDA 1H1NA 1EF2A 3AHTA 3NQ8A 4ZGYA 1S5TA 3W1MA 4LF2A 5TD4A 4JIHA 3O7UA 4ZQRA 2TRSA 7REQB 3VD4A 4XKYA 4JTKA 3M0KA 5A69A 1JDFA 3BAYA 3SY8A 2IPGA 4PA8A 4ZO8A 2ACSA 5C70A 3VD5A 1R7OA 2O4QA 1J12A 3A12A 3COTA 5XINA 1EIBA 1OINA 1SJCA 4YIWA 5EMUA 4N4QA 5MHBA 1X1NA 1Y5VA 2ZX9A 3BLDA 1H62A 3CAWA 3H2OA 4QM1A 4M24A 1K3UA 1HJSA 3WCZA 2ABBA 1WUFA 5I02A 3QR0A 3GXNA 3MPGA 1M03A 4GIRA 2QCDB 3WJWA 4K2SA 1GQIA 2ATSA 1D7FA 1GGOA 3MHUA 3OVRA 4D6DA 2XUCA 2ZVRA 1Q45A 4UXDA 2OODA 3GR8A 5CZKA 5C71A 1MRQA 3U2CA 3SIZA 1CI1A 3P7YA 2CLLA 4G1KA 5AOUA 2HVOA 3BAIA 2VC5A 2CBIA 3GH7A 1A5UA 4PMVA 1R87A 2UBPC 1SFJA 1R9XA 2PB1A 5CC7A 3T42A 4LH8A 2VT0A 3FGCA 3S5NA 2E4TA 4AHOA 2W0UA 2WJEA 1W9PA 4AFYA 5D9NA 3EX1A 3SRHA 1H49A 1PTGA 3FAXA 3TMQA 1GYMA 1QO2A 1YPIA 3GKFA 1ML1A 1VKFA 3WNNA 5AHLA 2PDIA 2BZNA 3VNDA 4Z1YA 1IGWA 1WDPA 3MT1A 4H6QA 1H1ZA 3L4UA 5G5IA 1X7FA 4DI8A 1FWCC 2F38A 3P0XA 5FL0A 3LXBA 4IIBA 3VNIA 1MFVA 2AGTA 5JU6A 2YZRA 1XLAA 3NYDA 4PUDA 4LGXA 3DYPA 2CLHA 4KEVA 4DBSA 3W7RA 3NCOA 1MXSA 5FF0A 4A3RA 4ZZ9A 1SO4A 1HJXA 3MSYA 1OT1A 1UOZA 1PWLA 1E0VA 3VZYA 4GQQA 4KW2A 2G96A 3A47A 4O54A 1NVMA 2RFGA 2YB1A 3BO9A 4X61A 3B06A 4REQA 3MJMA 1SZEA 2NSOA 1DPMA 4F0KA 1IEQA 5D2VA 1RQEA 3WENA 4AYSA 2V5LA 4RL3A 2Y8KA 4BEQA 1RQBA 3VNLA 1JYNA 3GVGA 4GNKB 1EUAA 4KF1A 5BXPA 4V28A 1FKXA 2VDIA 3AWOA 1W9DM 4CQBA 4CNPA 3LN3A 5C2CA 3CZ8A 1MXGA 1XINA 2YXGA 1X1OA 1XBYA 3KLLA 4DNMA 3KDOA 1LCOA 3PAOA 3W7LA 1RBOB 4BK9A 5IFPA 3E0LA 4GIEA 1Z32X 2DZUA 3L7RA 2J8TA 1J5SA 1KM0A 4B5TA 3N17A 4H00A 2J9YA 4LQ1A 1NQKA 1EC7A 2DJLA 3KEHA 3Q45A 2ZA2A 4IQEA 2DZVA 3P74A 4D72A 2CLIA 3NM1A 1GJPA 4DF0A 1S2VA 3R0KA 1I8JA 4WSJA 5IXEA 1X97A 4BQ4A 3V4BA 4U5KA 2PFHA 2PZ0A 4CQ9A 2J7EA 2WZMA 4RZ5A 4CU6A 3CT7A 3K4WA 4GUHA 1KTCA 1F3WA 4HU4A 4UNKA 4F8XA 3GTFA 2WMGA 3BCDA 1PTAA 2VX4A 4EKJA 4I3GA 3U57A 1D9EA 1JPHA 5F1UA 3T0BA 1V0LA 3SAZA 4H1ZA 4HA3A 1EFZA 1TPUA 4IGNA 1TPH1 2HE5A 3A22A 3NO5A 3WELA 4A3UA 3M64A 2NUYA 1Q6RA 3AIWA 3QC3A 2J7BA 2HZGA 1QATA 5KZDA 1OVDA 2AQWA 3ARVA 4IIGA 4AXNA 3VTRA 4B5UA 4O1BA 2PF8A 4NHVA 3V16A 1K6AA 3OP2A 1DWHM 4ZOEA 5REQB 3MS8A 4ZQPA 3ZWSA 5HMDA 4W88A 3GNPA 4GH1A 4LVDA 3VI2A 4KETA 4AWTA 4S3FA 4IH3A 1GWJA 4IXHA 4B5WA 1XGEA 1O6IA 5CJMA 3VDBA 4IPLA 3EX6A 2PCQA 1TE1A 4E5TA 2I57A 5AVHA 5C8BB 3EKLA 1H4PA 3R25A 3AIVA 4ICMA 3P62A 1J6OA 4WDUA 5I0DA 5CJ5A 4HD5A 3WH9A 4WKFA 5I3KA 1OJXA 3EKGA 3CO8A 4ATWA 1AQ0A 4K6AA 3T8LA 5AYIA 2PRMA 5I03A 4J4KA 1YXDA 1HO1A 3PK7A 4X9YA 1MZRA 1C90A 3VILA 4G7EA 1FH7A 3D0CA 3TKFA 1XLMA 3AISA 4XAFA 2XFRA 1W3TA 1T8XA 2P0OA 4G5DA 4OU1A 4IJRA 1GQNA 2E8YA 3P0WA 1VP5A 6A3HA 4ERGA 3ZOAA 3VK5A 2D0FA 1IQ8A 1LRNA 4IGHA 3DUGA 2DSKA 2E3ZA 2TMDA 1DXEA 2ZA3A 2BVDA 4UBPC 1JDCA 4H83A 5XIMA 2VGGA 2V5JA 4Y96A 4A3YA 1A4MA 1TR1A 2ZRZA 5GNYA 4DWSA 1W5OA 1DWAM 1JZ3A 4IIHA 2W62A 3UYIA 4ZXOA 1Q66A 4KFNA 4IIDA 2NV2A 1ZQ5A 2ZWYA 4RV3A