4Y9AA

Crystal structure of triosephosphate isomerase from streptomyces coelicolor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
254
structure length
254
Chain Sequence
RTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYDAVEVAVLAPFTDLRSVQTLVDGDKLKIKYGAQDISAHDGGAYTGEISGPMLAKLKCTYVAVGHSERRQYHAETDEIVNAKVKAAYKHGLTPILCVGEELDVREAGNHVEHTLAQVEGGLKDLAAEQAESVVIAYEPVWAIGTGKVCGADDAQEVCAAIRGKLAELYSQELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVGGASLDSDEFVKIVRFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 89
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y9aA00
2J9YA 1VJIA 3L0GA 1I4NA 4HHPA 5G2HA 4PC8A 2E77A 4FB7A 4N4QA 1JCXA 1HUVA 1OFDA 3RU6A 1WBJA 4C1LA 3CB8A 2YGYA 3TCEA 1H7XA 4WXZA 3QSRA 5HUPA 5BOOA 5J5DA 1QDSA 1ZALA 4LUJA 4QNEA 3DFQA 4KFNA 1IF2A 3KRSA 4X2RA 2J9ZA 2E6DA 2J9XA 5FEWA 3GXPA 3M1ZA 5CPMA 2WNNA 1TMHA 5K7JA 1T99A 3MJYA 5CZSA 3W1RA 1KLZA 2ZBTA 2XFWA 3DHDA 4KKXA 4Q4KA 1WOAA 2PRHA 4M6VA 1RPXA 4LS0A 3WK0A 3P8IA 3PUEA 3OHIA 2UV8G 2O7SA 3C56A 4M6PA 2TMDA 3EWBX 1LRQA 2YXGA 1FQ0A 3L5AA 5BMWA 4DO5A 1W8SA 3E9AA 4O8RA 3G0XA 5AC6A 5I3KA 5BNKA 3GX9A 3G8EA 1JCYA 1N55A 4JNMA 1KFCA 2W0UA 1NVMA 4DELA 4RV8A 2ATSA 3RNDA 4O1CA 2QUUA 3P7YA 3I7SA 4IMFA 3EXTA 3W7CA 1O95A 4PL1A 1WA3A 2GVGA 1DJQA 2QCEA 3F4NA 3HGRA 3NQGA 4Y90A 2WV8A 3M5ZA 3Q94A 4O4WA 3PR2A 1OX5A 3GDKA 5G4WA 1KM5A 3WJXA 4I7VA 1YLVA 3QPZA 4JX5A 3WK1A 3PG9A 3GKFA 3R8RA 4R7JA 6ALDA 3NVTA 5A8GA 3H54A 5K9DA 1EUAA 3W9ZA 2C1HA 3BV4A 4S2BA 3PBWA 1ME9A 2F7FA 4JDBA 1KW1A 5BRBA 3IIOA 1H50A 1K03A 4YL2A 5D05A 4EOUA 2A6NA 2PRLA 3UWZA 2A7NA 4GNJA 3W1TA 3STEA 2A85A 4RZ6A 1YDNA 4NNBA 5FEZA 1H5YA 3QZEA 2PCQA 1LRNA 4WY0F 3C4UA 5F4WA 4MLJA 4IMGA 1O94A 1RV8A 4K8HA 4HSOA 5BMXA 3TQVA 4UUIA 4YMZA 1TPC1 3A23A 3NG3A 3TIMA 2E5BA 2DJLA 1M5WA 1PIIA 4GE8A 1J5TA 1PV8A 4CCEA 5I3GA 3IGSA 2EPHA 1VHNA 4ORMA 5AFDA 5FESA 3EX6A 1YXDA 1O5KA 2NUWA 2G97A 1HO1A 4P61A 3UWYA 4JY8A 4MZYA 3DFSA 1H63A 1IXPA 2QCFA 1I2NA 4MFEA 4JTIA 3NQMA 5HULA 3QH2A 3NPUA 5HUOA 3FFSA 3OVRA 3P80A 3HGSA 1YYAA 5K9CA 1K7FA 4JTGA 4PODA 2BX7A 1W5QA 3CT7A 1B3OA 5AOUA 1MZHA 4E0CA 3LCWA 4U28A 3A5VA 4TMCA 2CZFA 2P10A 4CNOA 2CZEA 4NZFA 4O10A 1SSGA 3OVPA 3QM3A 1SO3A 3Q37A 4NJHA 2ZQ0A 5EY5A 2GPTA 3EXRA 3SZ8A 2YYUA 1Y0EA 4UCGA 1EUNA 2ZCGA 5FF2A 4EIVA 5H91A 1EEPA 1XM3A 3LRLA 1OFOA 1K3UA 5E93A 4H4IA 4OV9A 3PC0A 3W1NA 1PCKA 4N6FA 1OK4A 3CIWA 4Z0JA 3G1AA 4O4VA 3UNDA 4FNPA 4UFLA 5TBOA 4XQ6A 3Q2DA 4UTWC 3TSDA 1TO3A 4ZL1A 1P1XA 2ZRUA 3IVSA 1KA9F 1XBXA 4O54A 3W76A 1KM2A 3FA5A 3ABQA 8TIMA 1OHLA 1OFRA 2FQIA 1W31A 3M6YA 4UNLA 4Y96A 3LTPA 3ABRA 4Q32A 1GVQA 1K8YA 1LBFA 4HT3A 4TO8A 4AAJA 1TPEA 2ZYFA 5CZJA 2QCNA 5D2XA 2B0MA 2TSYA 3KX6A 3S1XA 5KITA 1M6JA 4O12A 4BI7A 2FPYA 2WKJA 3CIXA 3IRDA 4IOTA 3OVQA 4CCCA 1LBLA 5AHEA 2WO5A 2FB2A 5DELA 3NAVA 3QYQA 3LHVA 4MY1A 1GT8A 4XTIA 1O60A 3NQCA 2P1FA 3HG2A 1Q45A 4LTSA 1KV5A 4UFHA 3A21A 2VKZG 3NYZA 3LI1A 5D33A 3UZ5A 2GQAA 4AB4A 5LSMA 4ORIA 4PCFA 1VZWA 3P60A 3W1PA 2JKEA 2QDGA 4QAIA 2X1UA 1C8VA 2Y7DA 4WQ6A 3O6DA 1GG0A 2QCCA 3IEBA 5CSSA 2ZTJA 4NQ1A 1S5TA 4ADTA 3B0PA 4UNKA 4RKAA 3HMJG 2ABBA 3LB0A 2Y85A 1DQWA 4Z0SA 1G4PA 2V5LA 1MEWA 4OGZA 3DFNA 3LGEA 1FDZA 1ADOA 2E1DA 4FIQA 5CPLA 3ATYA 3W07A 3N73A 3P67A 5LGXA 3NQ2A 2BSLA 4PH6A 1TV8A 3GXTA 4NXSA 3BPWA 3MO7A 4O52A 2CLEA 1QFEA 1YXCA 1QO5A 3BLFA 3NM3A 2ZZ3A 3TK7A 1OABA 1WV2A 1JCMP 1Q6RA 3NPXA 2V81A 2A7PA 1G69A 3ANYA 4QIUA 4A3UA 3C52A 3H55A 3W7HA 2C19A 2CLKA 3LCGA 2Y63A 4GXMA 1GYNA 2ZRZA 3V1PA 2QCHA 4MFDA 3NO5A 3MW7A 5DY3A 3MWAA 3CWNA 3JR2A 3PBVA 2ZZ6A 2QAFA 4MVAA 1OYBA 3S1VA 3N9RA 4X22A 4MY9A 4NZJA 1MEHA 2R8WA 3SSJA 1AW1A 1TQXA 1G6CA 2VEKA 3UWUA 3LBCA 1P0KA 4YXGA 3S42A 4IX2A 4MIMA 4DO4A 2FJKA 4WD0A 2QEZA 4FHAA 4LV4A 1XCFA 3TC6A 5DBUA 3G0SA 2ZFAA 3NGJA 4MKNA 1SO4A 2YFNA 4LVAA 2NUXA 2Z0IA 1H7RA 5MHBA 4L4LA 3DBPA 4JD4A 5KINA 3LXBA 4EWND 3EX1A 3LHZA 5F2LA 4FX6M 3FS2A 4DPQA 3G18A 2C18A 4IQLA 2BXVA 1D3HA 3LDVA 3EX4A 3BLEA 1EB3A 1FX6A 1AW5A 3TAKA 1AW2A 2WOQA 4QM1A 4RZ4A 1FXPA 3NXFA 1K02A 4ZQOA 2IQTA 4KWVA 4AVFA 3LHTA 1PCWA 4LC6A 3PS7A 3TROA 5DN1A 2A5HA 1WOBA 3IIVA 1EX5A 3MI2A 4HPJA 4HNTA 1OFAA 1IXQA 1CW2A 3LV6A 4UTJA 3W7NA 4TMBA 1FXQA 1ZAHA 4JIQA 3VE7A 5AHLA 3LBMA 2A2IA 3VNDA 3G24A 4DEFA 4GRSA 3H53A 4CNNA 4Y6GA 2OJPA 3PB2A 3GAKA 3DKLA 3ZR4A 1EWEA 5LNVA 1W5OA 3PAJA 1KBIA 4Y8FA 3U6WA 1WX0A 1MEIA 2HSAA 4OQVA 2RFGA 4ADUA 4BWLC 1H1YA 1I8JA 2D73A 3GDLA 1HO4A 3C2RA 3G1VA 1ZJIA 2H8XA 1OX4A 4MJZA 3C61A 6TIMA 2X1TA 2YZRA 1X7FA 4O16A 3S6DA 1PS9A 3STFA 3F03K 4NJKA 1LLWA 3JS3A 1JJKA 4Z1AA 2WJZA 2QCDA 3A9IA 2WSRA 3W7MA 1VHCA 4ZQCA 5F1VA 4UTTA 2NV1A 4Q33A 2ZA1A 3TW6A 1M7PA 2FTPA 4KFOA 3W23A 1W0MA 4O1DA 4MYAA 5U7SA 3L0NA 2DORA 1TQJA 4O0KA 1H7PA 5F2IA 3KAOA 1LZOA 3WFAA 4QNWA 5D38A 1OF6A 3C2EA 5G1YA 1H1ZA 1UJPA 1A5AA 2VEIA 3A24A 1A5SA 3HF3A 3VCRA 1OX4B 1K8ZA 1XI3A 2DZXA 3GXNA 4FNQA 1HTIA 3FJ6A 2OMAA 3SR7A 1K7EA 2RDTA 3O63A 1JUEA 2Q8LA 2H90A 1DORA 3IIZA 2ZZ4A 2FPTA 1KM6A 3QF0A 1KFJA 4C1KA 3BGGA 3RF9A 2PRMA 3MHGA 3DAQA 2RH9A 5I3IA 2VENA 1SZGA 2B7NA 5EYWA 5ABTA 3TA6A 3PULA 3CLMA 3GDTA 4MLRA 4UTMA 3LXAA 1NAL1 1LCOA 2CLLA 3O1NA 4MPQA 1VGAA 2B7QA 4NJIA 4CCDA 1TTJA 3BW4A 3LTSA 4N2YA 5EKYA 3QJAA 3JRKA 4DBEA 4FF7A 1SZNA 1T8XA 1F2JA 1FWSA 3S9YA 2BZNA 2C14A 1G7UA 5HWJA 1U83A 2CLMA 3K30A 4UR8A 2V30A 2CU0A 3AJXA 3BW3A 3KVMA 3R12A 1VYSX 4JY9A 3GNNA 3W6YA 2NWRA 1EPXA 1WBHA 2DU2A 3W72A 5KMYA 1RVGA 2Y6ZA 2RKXA 4OT7A 3C6CA 2CWNA 3V75A 3FJLA 3S0CA 3PWAA 4HPXA 4Y9AA 4JYFA 4IPIA 3M9YA 1RQHA 2QCGA 4A2RA 4CQ9A 3S5ZA 1FWTA 1R47A 1XBYA 3G3MA 3SY5A 2NXGA 4M7SA 3DZ1A 5CPOA 4Z1DA 3O16A 1L9WA 3I6RA 2EAWA 3NQ6A 3CHVA 1ZCOA 4AMAA 1BKSA 5F2GA 3GZ3A 4NVTA 4UFJA 2Q3OA 3FYOA 3EX3A 2X30A 3N9SA 1RR2A 5K9XA 4FXSA 3FEMA 1NFBA 2PURA 3INPA 1SSDA 3C0JA 2RDWA 1OVDA 3BLIA 4J9JA 1VCGA 4O19A 5FI8A 5HMSA 5K4ZA 3E12A 4R33A 1I45A 3DH7A 5EA9A 1DOSA 1SW3A 1W37A 2BLEA 3TDFA 4PA8A 4ZQPA 3EKZA 1TV7A 4FIRA 4GUJA 3W7IA 2Q8ZA 3L9CA 3W71A 1UUMA 4JTJA 1GOXA 1OFPA 3T40A 1T0OA 4E38A 4OHQA 4LRSA 3TFXA 1QR7A 3CEUA 4HNUA 2GVLA 2VEPA 5H2ZA 3HPZA 1QMLA 2ZRWA 4LWWA 1SFJA 1ICQA 1N8FA 3LCFA 5AB3A 2NX3A 3RLUA 1DBTA 2V2DA 2E5CA 3TJXA 2ZDRA 4AHOA 3B05A 2VEMA 2QF7A 4NNAA 1A5BA 1OJXA 3SIZA 3G1FA 2J27A 1BWLA 3W7GA 4FNTA 4AXKA 2J24A 3CWOX 3L66A 5DY2A 4IJBA 4I7UA 2CLIA 1TSIA 3EKLA 3UPBA 1L2UA 2VFGA 4O1AA 1GG1A 4S2CA 2QDHA 1SW7A 2VFIA 3HGJA 5D2YA 3O6CA 3M16A 2VC6A 3DKJA 4AWTA 1ZFJA 3KVJA 3LTYA 5HJLA 4ONVA 3SW6A 4R34A 1WAUA 3TXVA 3CPRA 4ZZ9A 3QMTA 3QPYA 3OIXA 1CX9A 4MZ1A 5HINA 4A29A 5DXYA 4M19A 1QPOA 3T78A 2YPIA 3SGZA 7TIMA 1TJRA 3PUDA 4YCPA 1OX6A 2QKFA 3ABOA 1LP6A 2VOMA 4NT0A 4TX9A 2JBMA 3P74A 3RMJA 2VELA 4IMCA 1R2TA 3HBLA 4MY8A 2A0NA 1FCBA 3KRZA 2HS8A 2DZUA 1GPWA 1TPVA 5HQEA 1D3GA 3LRKA 5CZTA 1TTPA 3HG5A 2R14A 1JVNA 4JYDA 4ZVJA 1Z41A 4I7WA 3HJZA 4RXGA 3WJZA 3LLFA 1SU5A 3IIXA 1VC4A 4OU1A 4N9EA 1LBMA 1QCWA 1W5MA 1I2RA 1QO2A 2ZRXA 4E2BA 5G5IA 3W2UA 1IXOA 4JTFA 3W1AA 4JIPA 3N3MA 4UTWA 1RZMA 3W1QA 3ZFHA 3BG9A 3PSVA 5DBTA 3F1QA 3QMSA 4ML9A 1L6SA 1I2QA 4UTHA 3SGUA 4O17A 4KFPA 3M5XA 3W1UA 1V7YA 5HWNA 3W22A 4CQAA 4TR9A 4WZHA 3L68A 2G95A 1OF8A 4GUIA 2ISWA 1A50A 3UYCA 1W5PA 2F84A 3B0VC 3FIGA 2YX0A 3EEGA 1TCDA 3S5OA 3TKFA 4JTKA 1OFBA 4BFAA 1H62A 3ELFA 4GJ1A 1U5JA 3THQA 1WQ5A 3W1MA 4D2JA 3EWXA 4N9BA 3TAOA 3P62A 1F73A 4QISA 2G5WA 1TPDA 5LHEA 4JN6A 3NQAA 2QJHA 4XTDA 1PL9A 1QAPA 1G4EA 5FEPA 3E49A 3NL6A 2TPSA 3P82A 2Z6JA 4UC5A 2GUUA 1GVFA 3DFTA 3P61A 4OV4A 3L21A 1F6PA 1KV8A 4LT9A 4QITA 1LOQA 5G2IA 1SUXA 4YCOA 2NUYA 1I2OA 4KWWA 2E09A 3GR8A 1ME8A 1QOPA 4TU1A 2RDUA 3PB0A 4UFIA 1JRCA 1ME7A 2PE4A 2P0OA 3GAYA 3MBDA 3O06A 1F05A 2GVJA 2A4AA 4NXKA 4EF8A 1H7WA 2QJGA 2JKPA 4PEKA 2JGYA 4IXHA 2ISVA 1GVRA 3QW4B 3HPXA 2DJXA 5KSWA 4HSNA 1KTCA 2YSWA 5G1TA 1XBVA 2Z2UA 3PBUA 2DP3A 5C6MA 3SFKA 2YCEA 1ML1A 1WDWA 1W1ZA 4RK8A 5D2TA 2X1SA 4UTUA 2QUVA 1YTDA 3CTLA 4BK9A 4AF0A 2B4GA 3GDMA 4HIBA 2YYTA 2DZTA 1YTEA 2C0AA 2V5BA 3FLUA 4H3DA 4MOZA 1ZHAA 5FF7A 1YADA 3W83A 3MHFA 4LVDA 4N4PA 2W6RA 3B0UX 3C8FA 3MUXA 3MI3A 4RJEA 1ICPA 3PM6A 1SR9A 2Y70A 4XWUA 3O8AA 1GZGA 3W7JA 3LCXA 2OCZA 3KFTA 3NQEA 4LVFA 1LM1A 1KM1A 2KZHA 5LKYA 5AC8A 4K7VA 1IGSA 1TYGA 2FDSA 1KM0A 4IMEA 4JDYA 3TXZA 5EBUA 1FY6A 1UB3A 3W7KA 2RHGA 3W85A 4G1KA 2WSQA 1TPB1 4AH7A 1JQVA 3N34A 2NX1A 5L6UA 3L5LA 2EGZA 3W7RA 5AHIA 1VPXA 3DU0A 3C2VA 3G1DA 1RQBA 3HIJA 4UMCA 3LCIA 4FX8A 1VR6A 1QPQA 4IWWA 4O0ZA 4WXYA 2TYSA 4IXXA 3R89A 1L6YA 2H3BA 4H6KA 2NLIA 3G8RA 3MP5A 5DCDA 1JCLA 3F4WA 3MBFA 3TH6A 4FNSA 5LNUA 3GNDA 3HB9A 1XC4A 2H3DA 1HL2A 3RLVA 4CQ8A 1O5XA 5F2MA 3LRMA 1JRBA 4XBSA 1Z48A 1GYLA 1TRDA 3NZRA 3W73A 3G1HA 1TTQA 3O15A 1J4EA 2BTMA 3UD6A 2GOUA 4PFMA 1VH7A 3UQNA 3IGXA 3QRHA 2ZA2A 1JQXA 1G67A 2H8ZA 4BWLA 2AQWA 3GK0A 4RCXA 3HG3A 5D37A 1AG1O 4WY0A 4LOCA 3VFLA 4JEQA 4LV9A 3C2OA 5D32A 1LYXA 1I2PA 1JUBA 4IX0A 3CM4A 2EHHA 5K2ZA 2Z6IA 2EKCA 3WJSA 1AL8A 3ATZA 3HOJA 4UMAA 4JTHA 3QEZA 4UMBA 5F1UA 3STCA 5FF0A 3A22A 3NQ8A 1ZAJA 4CLMA 3TQKA 1R30A 3M41A 3UPWA 2CFFA 1GQNA 2NWSA 3IVUA 1R2RA 1UCWA 3GVGA 5FEXA 1X1ZA 3O05A 1C29A 3W7OA 5EMUA 4O50A 4GWEA 1DL3A 2DZPA 5HWMA 1QPNA 1FUYA 1W3IA 1PVNA 1DJNA 3W7QA 3N2MA 4O11A 2I1OA 5DLCA 3DXIA 4UXDA 2C13A 4L4MA 2V2HA 4OBTA 4WY0B 2X1RA 4XKYA 5C2XA 3M43A 4LRTA 5IBXC 4P2VA 4RR4A 4YLWA 1A53A 4RLIA 1LDCA 3GB6A 3TJLA 3NDOA 4NX0A 1Z42A 2OX1A 3UY7A 2J88A 2QCDB 3NL5A 1FWWA 4TIMA 2X16A 5D02A 1SZEA 4BI6A 2YW3A 1BEUA 1ZENA 1WXJA 2YDAA 5KZMA 1LTDA 4XKYB 3G0UA 4ZQMA 5IM51 3LHUA 1E51A 1SQ7A 2FPVA 1XDLA 4UR7A 1PE1A 1NF0A 1XUUA 2NV2A 1VQTA 3FOKA 3W74A 3L0KA 4HN4A 2Z1BA 3W1XA 4BR1A 3CC1A 3FYPA 4GBUA 3ZWTA 4AHQA 4WOQA 3U8GA 3I68A 1TB3A 3B06A 1KM3A 5G4EA 3TE9A 3EXSA 3W1LA 3IGUA 2QCLA 3S5YA 1X6UA 2YFOA 2QAPA 1LLZA 3DFPA 2V8ZA 4O53A 1XFBA 3UWVA 4AWUA 1VYPX 4O1BA 3Q58A 3ABSA 1XL9A 5FF3A 3UXDA 1JR1A 2CLFA 5FF4A 2ABAA 3KRUA 4AHPA 4DF0A 1NSJA 1K7XA 1W56A 4K6AA 3LM7A 4N02A 2FB3A 3W2KA 1B9BA 1G7VA 5CPNA 1SFLA 3LCLA 4UFMA 1G4SA 2R91A 3TSBA 1ONRA 1K8XA 1YTKA 5U4NA 3DI0A 2AGKA 1XKYA 4XUGA 2NXIA 1FCUA 1UBSA 1C9DA 1DKWA 1ICSA 1NF7A 1QPRA 4OE7A 3S5NA 4FXRA 3GKAA 1EA0A 4IPJA 2ZRVA 4O15A 2CLOA 4DQWA 1FBAA 1LROA 3W2JA 3TQ0A 4N6EA 2O7QA 3W2NA 2VXNA 3ZS4A 3S8HA 3R13A 1SO6A 3IIPA 4MYXA 3UXAA 2VFFA 2Y7FA 5LHFA 1F6KA 3T7VA 4M6QA 2V9DA 4K38A 2XN2A 5EL1A 4JXCA 3D0CA 3WK2A 3BW2A 2W79A 1VS1A 2DZWA 2Y89A 1GTEA 1HFBA 1RQEA 4NX5A 3GDRA 3L67A 2Y7EA 2C3ZA 1DHPA 1H61A 5E0KA 4HNNA 1OG0A 1TREA 5I3JA 3P84A 3MMTA 3KOFA 3MYPA 4MJMA 5A5WA 3BK0A 4PTNA 1FWRA 1W3NA 2XN1A 2B7PA 4R53A 5HR6A 3OG3A 1YPIA 4RXFA 2JGQA 1TJPA 1ZNNA 4Z1CA 5CSRA 5D2WA 1OFQA 3RFAA 3TSMA 3M47A 3W75A 3W84A 3KHJA 1Z44A 1OK6A 4JR5A 1J2WA 4N9DA 1FCVA 1LORA 2GJNA 3QW3A 5C55A 2R94A 4K39A 4QQ3A 3P5YA 3GLCA 4I9AA 4GFSA 2WNZA 1NEYA 1LOSA 1VLIA 4ALDA 4IUOA 2A7RA 3A5FA 1FDJA 3M0ZA 4O28A 3G3DA 5LZLA 2A21A 3U2OA 1YPFA 3UZJA 2HTMA 2I14A 3TUUA 1XUZA 4DBDA 5AN7A 3QQ0A 2NXHA 2C15A 3L65A 3PUOA 2C6QA 3BG5A 4UTIA 1MXSA 2Y7GA 2NZLA 3ZWSA 1VCFA 2HMCA 4JTEA 3HGOA 5AYXA 3B4UA 2ALDA 5D2VA 3LERA 1VLWA 1P0NA 3T4CA 1MO0A 3DENA 4LUIA 1THFD 2WNQA 4JYEA 5LGZA 3NPVA 4DXVA 2NX9A 1FDYA 4BI5A 3TMQA 1OYCA 3NQFA 2OT1A 1F7BA 2E68A 4YWIA 3B8DA 5AHFA 3WJYA 4WJEA 1O4UA 3VKJA 3LV5A 5L9FA 4K37A 3W86A 2OT0A 3HO8A 4U4MA 3NL3A 1SZFA 1AK5A 1TRIA 2ZA3A 5TQLA 3HPSA 1CI1A 1JCNA 2QJIA 5D30A 1LRTA 5AHMA 5I3FA 2WPBA 1DQXA 3TC7A 1W54A 2HS6A 1Q3NA 3LHYA 4Z1BA 4K7YA 2Q3RA 5GVJA 5AYZA 2DZSA 2EF9A 5DCEA 1KLYA 3L2IA 3W87A 1DVJA 2ZTKA 3CQ0A 2VFDA 3LOTA 1XXXA 4LNYA 1N7KA 2ZZ1A 4LVBA 2Y62A 1VCVA 3LI0A 3HG4A 1H7NA 4NUWA 3I7RA 4ICNA 4EF9A 2A1YA 1D9EA 5G2WA 5DCBA 4UIOA 3NQVA 1AL7A 1XDMA 4M7TA 1TPH1 4IMDA 1QNVA 3W7EA 2CW6A 3T55A 4LS1A 3FKRA 4K36A 1EP2A 1VRDA 1GEQA 1GVSA 5DXXA 2E5DA 2QCMA 2QUTA 3PG8A 2VFHA 1F5ZA 3NQ7A 3OBKA 2GJLA 1KM4A 3W7PA 2C16A 3GIYA 2FLIA 1SW0A 5LNWA 1TIMA 5C54A 1Q6QA 3WK3A 1ALDA 5CGQA 3GYEA 5D03A 1IXNA 3DFOA 1GWJA 4DPPA 3G1SA 3QSTA 1T96A 2WQPA 3G1XA 1QWGA 4W9TA 2CLHA 4XBKA 4X9SA 3NEVA 1OYAA 2ZZ7A 1R2SA 3VI2A 5BW6A 3BG3A 1SO5A 2J6XA 3E02A 3NR0A 5AHNA 1X1OA 3FKKA 5LNRA 3MI6A 3W2MA 2V2CA 5KZEA 1W5NA 3KVLA 1GJPA 3PBYA 1UUOA 4ZQRA 4NJJA 1KTBA 3N2XA 4JICA 3B04A 4O13A 2FFCA 4RZ5A 3I65A 1QOQA 4POCA 2GQ8A 3P8JA 1WYIA 3IVTA 3NQDA 1TPWA 1S3HA 3W7LA 2VFEA 1Q6LA 3PF3A 3L5MA 2Y88A 3KVKA 5F4SA 3CU2A 2LLEA 2E6YA 2B7OA 3NZ1A 3TV8A 3BO9A 4ADSA 3LX9A 1KBJA 3EWUA 2WSYA 3WJWA 2G96A 1AMKA 1EWDA 2CZ5A 1V5XA 4A2SA 4LY8A 1YDVA 4EVZA 3LXCA 1KFKA 3AO0A 5F4XA 1BWKA 4RX0A 1P4CA 1B57A 1SPQA 4NU7A 2ISSA 2ATMA 3O07A 1PHQA 1EIXA 4CNPA 1FWNA 3SI9A 1KTNA 5KZDA 5HNRA 5CZ0A 5KTLA 1OFEA 1YXYA 4O14A 3G22A 3MP3A 4MUZA 3PY2A 4AF0B 4FX7A 4GC4A 4UTLA 3QQ1A 3UY8A 1JUKA 2I9EA 2YR1A 5I3HA 5E1QA 4GUHA 4JTUA 2JK2A 3QFEA 4B5NA 1UASA 1F76A 4JX6A 2V82A 1JCJA 1YDOA 4HNVA 4QJ1A 5D04C 3EWZA 3UWWA 2V0TA 5K3VA 2DZVA 4JGDA 3DGRA 2Y61A 4M5PA 2OZ0A 3R5EA 5C5YA 3PSWA 3TMLA 1GTHA 1H51A 4UTKA 1P5BA 3VE9A 1BTMA 4LVGA 3M5VA 4LU0A 4GUFA 3EX2A 3QMRA 1B4KA 4HKPA 2E6AA 2X2GA 1EP1A 3EB2A 2ZRYA 3W2LA 3C3NA 3OA3A 3W3OA 4WX2A 3TX9A 3MP4A 5T26A 3NNTA 4XZ9A 3M7WA 2ZZ5A 4ZQNA 4S1FA 3BARA 4JTLA 3B03A 4DF2A 2CZDA 4NJGA 2JKAA 2PC4A 5CG7A 1KFLA 3KXQA 2XN0A 3EWWA 4WUIA 3TNOA 3IV3A 1IIGA 2GQ9A 3MHUA 3EWYA 5AYYA 1DV7A 3THAA 4QSHA 3OEXA 3NA8A 3CEPA 3NOEA 3N19B 3T44A 4A22A 4OWGA 4AWSA 3BGJA 1H60A 3SECA 1S5WA 2AAMA 3TU9A 1PHWA 1Q6OA 5D09A 4JTTA 3P81A 3E96A 2YW4A 3DI1A 1A5CA 1W3TA 3G1YA 5LNSA 4FNRA 4DO6A 3I7QA 5IBXA 4Z08A 4JTSA 3P5ZA 1G4TA 4BF9A 5SWUA 4JX4A 3MYOA 1KFBA 3W7DA 3NL2A 4NNCA 5HR7A 2QR6A 3GR7A 5EPDA 2A6LA 3SJ3A 3E0IA 1S5VA 2E6FA 4DF1A 3PVFA 1FCQA 3QC3A 1X8FA 4FEZA 4UTTC 3R2GA 3STGA 3M44A 1TV5A 2TRSA 4X3ZA 1HG3A 3NM1A 1M7OA 4PL2A 4LC8A 5AC7A 3RK8A 4MZ8A 4LW7A 1XBZA 1KFEA 3TFCA 3LLDA 1TPUA 4LS2A 1LOLA 4FO4A 3N14A 1ZY9A 3C2FA 3LHWA 4UFKA 3UWQA 5K4XA 4N9CA 1R46A 1F74A 3DHFA 1JULA 1GVOA 3S1WA 3NPWA 3TW7A 3O6YX 5TIMA 1VYRA 3USBA 1MSSA 4K8EA 4FNUA 4JS3A 3S1UA 1TPFA 1TTIA 3LCHA 2FIQA 2BWGA 4O18A 5CKSA 3M5YA 5J5RA 1IIHA 2ZZ2A 3W88A 4IGHA 1H7OA 1L6WA 4ZMGA 3HQ1A 1RD5A 1ZAIA 4GUGA 3BVJA 1EP3A 3TR2A 1B4EA 4AEOA 4O57A 3YPIA 4WOZA 2H6RA 4A21A 3W70A 4E2DA
chains in the Genus database with same CATH superfamily
2AOSA 3FHAA 1VJIA 1OIFA 1I4NA 3ARQA 4HHPA 5G2HA 4PC8A 2BHZA 1JCXA 1HUVA 2E8YA 4YJ5A 2QGHA 4WJ8A 2VC9A 3T1GA 4WXZA 3EOLA 2WM0A 3F2CA 1FFRA 1UR8A 4JFTA 3RPTA 5A95A 1XRSA 1EZWA 4ERGA 2PTYA 4C6JA 3O6AA 2IPFA 1MFVA 3TOYA 1VBRA 3GXPA 5CPMA 1FHLA 3S83A 1TMHA 3VM5A 4QDPA 3W1RA 5H1WA 3IAQA 4KKXA 4Q4KA 1Q6DA 1V3HA 9XIMA 4C6DA 2FH6A 4LS0A 3WK0A 3P8IA 4I3GA 2WZTA 2UV8G 3C56A 4ATDA 1LRQA 4MNMA 5BMWA 3E9AA 4GIRA 4K3ZA 4B92A 5I3KA 3W01A 3VOJA 1CGUA 4ZCWA 3PBMA 4JNMA 1N2VA 1UZHA 1VFSA 2W0UA 4B15A 4AFYA 1RCQA 1HL9A 2QUUA 2WZMA 1O95A 1ZBWA 2RJGA 1WA3A 5FL1A 1W9PA 2QCEA 3F4NA 3M5ZA 4G8TA 4O4WA 3GDKA 5G4WA 1T40A 2WMHA 3QPZA 4XB3A 3WK1A 1RCXB 1HJVA 1C7SA 1VFUA 1E6QM 3R8RA 5A8GA 1RY8A 1EUAA 3W9ZA 3G77A 1ME9A 4JDBA 5FKYA 1ZQ5A 3BICA 4UQDA 5D05A 4EOUA 3GRIA 4XAZA 4V28A 4IUGA 3G2GA 4TX8A 3D3AA 4WVXA 2A85A 1UD6A 3OTRA 2OPJA 1WZMA 1YDNA 4NNBA 1H5YA 3CYVA 5F4WA 1O94A 3TQVA 1W91A 4UUIA 4YMZA 1HZYA 3H21A 5A2BA 3WDJA 3QHOA 3NCOA 4K1GA 4KEMA 1MQQA 2FFIA 4KGLA 3IGSA 4ORMA 1VB9A 1FWDC 1AZ1A 1ITQA 1EKOA 2NUWA 1UA3A 1PIGA 4MZYA 4D6JA 4MFEA 4PTXA 3R94A 1AD4A 2Y8KA 3QH2A 3A4XA 3NPUA 3OVRA 1E5NA 2DPEA 3HGSA 3P80A 4PODA 1YBQB 3GBEA 3T42A 1A80A 5M17A 3A5VA 3KUMA 4FALA 2PAJA 2C1GA 3QM3A 1SO3A 4P7LA 4GISA 1OADA 2YYUA 1Y0EA 3EBVA 4UCGA 1LWIA 4PZVA 1DXEA 4KRZA 4PE8A 3LRLA 1OFOA 5E93A 4H4IA 1X98A 3T81A 4N6FA 3CIWA 3BC9A 1J96A 1EGMA 4DBUA 1ZP4A 3QR3A 4M51A 3UNDA 4FNPA 4C6KA 2GWGA 4HMDA 4UTWC 1YEYA 1TO3A 3TSDA 1L6FA 1RP8A 2GK1A 3L2MA 1ADSA 5C70A 4DB7A 8TIMA 1OHLA 3M6YA 4Y96A 1EJUC 4PMOA 3ARTA 1JZ6A 1LBFA 6A3HA 1AQHA 1BGAA 3L4XA 5I23A 5D2XA 1OT2A 1NP0A 3WH8A 1ESWA 1HKWA 3UGVA 1TKKA 4BCEA 5I79A 3ZR5A 4XZLX 4WKAA 3CIXA 4IOTA 1XG3A 1LBLA 5AHEA 1UWSA 1K4GA 4CGTA 5A8OA 2IKHA 4RDYA 4LUSA 4L61A 3NQCA 2CZVA 3FGCA 1H0GA 1KKRA 2QJNA 1ONXA 1KV5A 4UFHA 3A21A 1R3QA 4NASA 3UZ5A 4ORIA 2H9AA 3VGGA 2JKEA 3CHCA 4QAIA 5CXPA 3B9NA 3O6DA 1GG0A 2QCCA 1Q65A 3IEBA 3N29A 2V6AA 3VIIA 2CHRA 1W1PA 3LQGA 2FZBA 4JKMA 2V5LA 3GH5A 4AD2A 4AU0A 1YHTA 1J0ZA 3FGCB 2I56A 3LGEA 1JDCA 4LGXA 3KTXA 2VQUA 4GQQA 4WSJA 3NQ2A 5A2CA 1ZBVA 3STPA 3MSDA 2F2KA 4NZ4A 3WH9A 1SJBA 1V6YA 3BLFA 4ZENA 1XH2A 3MB9A 4AYSA 2PP0A 3TK7A 1PTGA 1WV2A 1Q6RA 3NPXA 3MKCA 1LJYA 3PJUA 1G69A 2VGFA 5BWFA 2IXVA 4QIUA 1Q4WA 3H55A 3W7HA 1XPGA 2AMXA 1GYNA 2JQXA 4L9XA 1BD0A 5DY3A 3RYSA 3FW6A 3JR2A 4MVAA 3MCOA 4NZJA 3GIPA 3ES8A 5FJIA 2BOEX 3UWUA 3CZJA 1KGWA 3K4WA 2NV9A 4MIMA 4Q4QA 3VKAA 4HVXA 4B5TA 1J2BA 3G0SA 2ZFAA 3DDMA 1EC8A 1FTXA 2NUXA 5EFFA 5MHBA 1QPKA 4M3PA 4I8YA 4FX6M 3FS2A 4DPQA 1ZB5A 3IARA 4I5RA 4IQLA 3ME3A 1XKJA 3GVVA 2BXVA 1D3HA 3EX4A 1EB3A 1AW5A 3H22A 4KEZA 4QM1A 4RZ4A 1OCQA 1EXBA 4W8AA 2J7HA 4ZQOA 1CGXA 3R25A 4AVFA 3LHTA 4W84A 3VGFA 3PS7A 1MXGA 2A5HA 5A8PA 1EX5A 4L6DA 3MI2A 3A12A 4R27A 1XLIA 1IXQA 3M4HA 4UTJA 1ZAHA 2DGAA 4JEJA 3BAXA 4LCQA 5AHLA 3MJMA 3VNDA 2YB1A 4DJEA 4OECA 2QXWA 6XIAA 4Y6GA 1E43A 3PB2A 4AY7A 2EKGA 3DKLA 5LNVA 1X8CA 1ISYA 3U6WA 1WX0A 2WSPA 2D22A 5IDIA 4J5NA 1H1YA 2F6UA 4F9JA 1D3CA 2D73A 2ZX8A 1HO4A 4O0QA 3SBFA 1EJVC 3GTXA 4E2VA 2QVNA 4HCDA 2UBPC 1OX4A 3PJTA 2PD9A 1MUMA 4O16A 1XD1A 3STFA 3SAZA 3UZXA 4NJKA 1LLWA 1JJKA 4G6CA 4Z1AA 2WJZA 2WSRA 3EDJA 3W7MA 1VHCA 5F1VA 2ZADA 4Q33A 2OLAA 4NIRA 3TW6A 4DWSA 1O5RA 4MYAA 4UZUA 4BZYA 3KAOA 3CZ8A 4IF2A 2WVTA 3K5XA 4P7RA 4QNWA 4GXWA 1PYFA 1RALA 1UJPA 1KGUA 4NZCA 3HF3A 1OX4B 2X8RA 4ICMA 4J2PA 3URNA 4K2SA 2RDTA 1JUEA 2H90A 2ZZ4A 1EJTC 1KM6A 1R6WA 2XGIA 4G56A 2PRMA 4GPNA 5I3IA 2VENA 5EYWA 5H8UA 3WLPA 5ABTA 1C3FA 3CLMA 4UOQA 3LPOA 4UTMA 3CK5A 1DWGM 1LCOA 1J18A 2VVNA 2XWDA 2CLLA 3PPCA 1SR0A 2YDSA 4F79A 3WO8A 1KQZA 2G4FA 1TTJA 4BEUA 2ACUA 2REQA 5EKYA 1ISXA 1O5QA 3QJAA 1MFUA 4DBEA 2KAUC 1T8XA 3GFYA 3GD6A 3GR4A 3PZQA 3A6OA 4TX6A 2OX4A 4UR8A 3W37A 2V30A 3VOIA 1GONA 3BW3A 3ARUA 5DANA 3MCNA 3FXGA 3CV6A 1BAGA 2PS2A 2DU2A 3W72A 2BVWA 1RVGA 3NFUA 2RKXA 3C6CA 3WF2A 3S0CA 3BSHA 3UPMA 3AUJA 4B3LA 4HP5A 1RQHA 4ASTA 4CQ9A 1FWTA 5A6BD 2REQB 3G3MA 3SY5A 3CLWA 2NXGA 5M2FX 3DFHA 3FDKA 4Z1DA 5C71A 3O16A 1I60A 5DF0A 2EAWA 2AQVA 1VFHA 1E6XM 4C1NB 2VJXA 4DAFA 2RGLA 3SIMA 3EX3A 5GJPA 1EF3A 3F4CA 1GZJA 4FXSA 3FEMA 2HVNA 3OA5A 2PU0A 1SSDA 2PLCA 3C0JA 1VCGA 1VFFA 2FHCA 3NUKA 1HF6A 2I5IA 3S6TA 3E12A 5EA9A 1HP4A 2ICSA 2BLEA 3WFLA 4ZQPA 1BG4A 3EKZA 4XZIA 2PI6A 5DMNA 3ABXA 1Q7ZA 1XSKA 3L9CA 2J77A 2XH2A 5FSEC 1DTNA 4E38A 2XFRA 4LRSA 4WDXA 5D9PA 3ZLHA 3CEUA 2VEPA 2WANA 4W85A 3H26A 3XISA 3W38A 2ZRWA 4W5UA 1ICQA 1N8FA 4FXFA 2NX3A 5E6ZA 1DBTA 2V2DA 5DT7A 2BHUA 2E5CA 3TA9A 3M0XA 1GOOA 4PSRA 2VEMA 3RG6A 1FP9A 2HZGA 2J27A 3ALGA 1QBBA 1E1EA 4DXXA 3S9ZA 1ZTVA 4GO8A 1XR2A 1YMYA 2DH3A 3MS8A 3U57A 4GVFA 5T9BG 3EKLA 1EA9C 2O9RA 4QLJA 4O1AA 3T0TA 5D2YA 4B3ZA 1VBGA 2VC6A 5I6SA 2XFFA 5HJLA 3SW6A 1WAUA 1XIHA 5CBIA 3LZ5A 4EACA 1AD1A 3QPYA 1CECA 4IQJA 1CX9A 5HINA 1US0A 1S39A 1RBLA 1CENA 1TWSA 3SGZA 2OO0A 2IPJA 7TIMA 1OX6A 1FHUA 2JBMA 4C5YA 3WBWA 2PF0A 3HBLA 2J7CA 3AHYA 1FCBA 3W53A 1CXLA 2HS8A 2DZUA 1TTPA 1W9DM 4ZVJA 4S39A 4RXGA 3LLFA 4FLRA 1SU5A 1H0IA 1VC4A 2WCAA 3R58A 1ENUA 3T08A 2ZRXA 4E2BA 3VAVA 4US6A 5BRQA 4L4OA 3WCZA 3W2UA 1IXOA 3VVGA 1DJWA 4L1XA 1EQCA 1R5YA 4JHOA 3W26A 3MVIA 4ML9A 1L6SA 4AZCB 4DVOA 4F48A 3SGUA 1H2JA 1TIWA 3GG8A 4KFPA 3M5XA 4PYSA 2VD8A 3W1UA 1US2A 2CBVA 3GVRA 4TR9A 1F4AA 2BY1A 4WZHA 4R7WA 4GUIA 2ISWA 1W5PA 3GUGA 3ARRA 2F84A 5GNYA 4PGLA 4JTKA 1H62A 3N2OA 3O2LA 1EPVA 2RAGA 3QN3A 3PP7A 4PTMA 4CQCA 3TAOA 1W1A1 4FA3A 5JXQA 1JXKA 3H12A 1A5OC 3NQAA 4GD0A 1PTAA 1G4EA 2ZX9A 6ENLA 1LL7A 3AC0A 4EXQA 1C8YA 5HQLA 4GIAA 3DFTA 3R6IA 4YTQA 1W3HA 4D6CA 1GZ1A 5A6AA 4WIWA 4GI8A 1SUXA 4YCOA 4B16A 2XVPA 1ECQA 1IZCA 4F0RA 3VA8A 1NY1A 3T09A 2Y5EA 4AVOA 1QOPA 2MNRA 4TU1A 3PB0A 2GGGA 4XD5A 3TC3A 4UFIA 1X7IA 3S2CA 1VFTA 3AYSA 4GO9A 3MBDA 4LB4A 3K8MA 5LIYX 1EOMA 3KLLA 3WBEA 2D2GA 3O06A 1F05A 4HGXA 4LYKA 2QJGA 2JKPA 1G5AA 1HJWA 2OR2A 2YB4A 3UGRA 2XH0A 2DDXA 3BLDA 4PEKA 1MUWA 2ISVA 2OB3A 2A3EA 2DJXA 3B8UA 2Z2UA 8XIAA 2GYIA 3L23A 3PPHA 5C6MA 3SFKA 2YCEA 1WDWA 3F2DA 1IEVA 3FXYA 2X1SA 2QUVA 1YTDA 3CTLA 1WDSA 3GDMA 3FLUA 4Q4OA 4R5EA 1CPUA 1V3LA 3KRBA 4HU8A 3B0UX 3MI3A 4RJEA 1IT7A 1SR9A 2OOGA 2Y70A 3AXKA 3WQVA 1GZGA 2OCZA 4AZIA 5C9UA 1T8QA 4YNGA 5LKYA 1CGTA 4K7VA 2FDSA 2V5CA 1TFVA 1M03A 2OFJA 4JDYA 4WEVX 3PZ9A 1V4YA 1TX2A 3LENA 1XYBA 2ZUTA 4DHGA 4RE4A 3W7KA 4GZJA 4AH7A 3N34A 2NX1A 4C6EA 5L6UA 3WDPP 3WKZA 3F7JA 3CQHA 5AHIA 1VPXA 4K1WA 4D1IA 1HJUA 2YA2A 1VAHA 3G1DA 1RQBA 3LCIA 4FX8A 3RGTA 1QPQA 4LBUA 2C71A 4O0ZA 3E3HA 4HYRA 4WDUA 2ZICA 1MWOA 1OGBA 2NLIA 2VNCA 5CEWA 3S1GA 4FNSA 5LNUA 1XC4A 5I02A 4CQ8A 4S38A 1O5XA 1JRBA 1GYLA 2Z24A 2C0HA 1VH7A 3UQNA 3H70A 3ITXA 3QRHA 2ISFA 4WY0A 4LOCA 4JEQA 4EAMA 3C2OA 5D32A 2D20A 4ZSUA 1A47A 1JUBA 5K2ZA 2AMGA 2YCJA 5M03A 4B5WA 4DJEC 3ATZA 5F1UA 4RL3A 3NQ8A 1ZAJA 4W8LA 2CCRA 2PDUA 3EOSA 1R30A 4MKVA 1CZ1A 1R2RA 3GVGA 4F8XA 1KB3A 3R0DA 3O05A 4O50A 4GNKB 1FA2A 2OQHA 1EH9A 1ONWA 1KXTA 3W7QA 4O11A 2BMBA 3MZNA 3OZMA 4WY0B 1VIZA 4H9UA 2PZNA 4WR3A 5PTDA 3TWBA 4YLWA 3B9DA 4RLIA 2ZVIA 1FWJC 2D2HA 3TJLA 4HSHA 3NDOA 2OX1A 4AY8A 4CD5A 2QCDB 3NL5A 4FLQA 3VU2A 2PWUA 1SZEA 2W3ZA 4OOZA 4BI6A 2BFGA 1ZENA 4Y7EA 1UR0A 4PUWA 3GDBA 5IM51 1E51A 1SQ7A 1JDAA 2FPVA 4JL2A 4TTUA 3UR7A 2OSWA 2PMQA 3M0HA 3BAYA 1XUUA 1PDZA 4H9XA 5I06A 3I6TA 4GIEA 2PDJA 1ZUAX 1VP5A 4AHQA 3MMUA 5G4EA 4HK5A 4P8UA 3VTRA 1X6UA 2YFOA 2QAPA 3DFPA 3BQ5A 5FAJA 2E40A 3CAWA 3UG8A 2QUMA 1XWYA 1EO5A 4F0MA 1V03A 1KO0A 3OBEA 3XIMA 1JR1A 4JBRA 3BXWA 3HQPA 3URBA 3OB8A 3WLLA 2GJRA 1W56A 4N02A 2FB3A 2R1KA 3WMLA 2YCKX 1R3RA 3LCLA 4K68A 4LALA 1RVKA 4NZ3A 4C7GA 5JIWA 4CNSA 2X05A 2NXIA 1GEHA 1V0MA 1FCUA 5C7VA 5EMJA 3ZJ8A 4J4KA 4KERA 2PLJA 3GBDA 2CLOA 4DQWA 3WNLA 5LIUX 1FBAA 4H6RA 3W2JA 2VXNA 2ESCA 4GMEA 1SO6A 1ITUA 2PLMA 1K9DA 5LHFA 3PPGA 2HVOA 4YPJA 3ITVA 1SJCA 4M6QA 5AZ0A 4LQ1A 4I9JA 5JH1A 2YDQA 2WJFA 1XLKA 3NQBA 1JGIA 1GOKA 3BW2A 3G1RA 2W79A 2DZWA 3RILA 4QG8A 1JF6A 4NX5A 5GJNA 2E1WA 3GDRA 2QS8A 3L67A 1B3WA 1DHPA 5E0KA 1OG0A 3JZEA 4LYPA 1NWRA 3MYPA 4MJMA 5A5WA 5I09A 3TJIA 5HR6A 2PDWA 3OG3A 4GH1A 2ANUA 4RXFA 4WJXA 4Z1CA 1VF8A 1OFQA 3GSMA 2PWGA 3TSMA 2J4GA 4YHEA 3UETA 3W75A 1BRLA 3KCOA 3W84A 3U2EA 2CIPA 1PDYA 4N9DA 1T7LA 3AMCA 1HJQA 2ZC1A 3GLCA 4I9AA 4GFSA 2WNZA 7PTDA 1NEYA 3COTA 3KW3A 4LSBA 5LZLA 5HA7A 2ZX5A 4ES4A 3DESA 3KWXA 2I14A 1UWQA 2VX5A 4PMUA 1Y5XA 1FHDA 3QQ0A 1AH3A 2YOCA 3L65A 4UQBA 5CGTA 2AKZA 4V1XA 1AFSA 1O7AA 1VCFA 2PBGA 4JTEA 3HGOA 4YVXA 1YE4A 7TAAA 3WF0A 5ABHA 1RH9A 3T4CA 1XGDA 2PDPA 3WH7A 5G4HC 1M7XA 3NPVA 1FDYA 3TMQA 3BSGA 4G2DA 1OYCA 2E68A 4A05A 3RCNA 4OTKA 4F2UA 4EAYA 1O4UA 5L9FA 3ZZ1A 3W86A 2OT0A 1SZFA 1TRIA 3HPSA 1QK2A 2PA6A 3CZLA 1JCNA 3EPMA 4BF7A 5D30A 1LRTA 2WPBA 3AFBA 5HMEA 4Z1BA 4K7YA 3WSUA 1X6LA 2DZSA 3F5KA 5DCEA 3L2IA 2ZTKA 2Z4GA 3W4RA 4Q22A 1J10A 3CL8A 1H5VA 4YWSA 2ZZ1A 3POCA 1PIFA 3VDHA 3LI0A 3HG4A 2NT1A 3MVTA 4FZIA 4ICNA 2YL8A 3EDEA 1E4LA 3WLMA 5D9NA 4BQ4A 4LAZA 1D9EA 1JZ7A 3PN8A 4IHCA 4UIOA 1XDMA 4M7TA 1QNVA 3W7EA 3K4AA 1EP2A 3GC5A 1GVSA 3UVIA 1A5KC 3VNKA 3SUTA 4GGBA 4NRRA 3N6QA 3OBKA 3AS0A 4E8CA 1TIMA 5C9ZA 1Q6QA 3EA1A 1GORA 1ALDA 2GGJA 5EGRA 3DFOA 1E1CA 3G1SA 3QSTA 3KOZA 4H8NA 3BJSA 3Q65A 4GKTA 1OYAA 3IGHX 5BW6A 3VI2A 4HPNA 1SO5A 4YN5A 4GCAA 3EZ4A 2OKOA 2PPGA 1KFWA 3FKKA 1PX8A 2XIMA 1QVBA 3VX0A 5LNRA 1R85A 1JPHA 2V2CA 3LNMA 5KZEA 4PULA 4C6OA 4B5XA 3EDDA 3KVLA 1GJPA 4NJJA 5A6MA 1OIMA 3WELA 1KTBA 1MNZA 3WQ4A 2F2HA 3B04A 3GFXA 1DYSA 1E1CB 4MB4A 4JIRA 4POCA 3GG1A 4QE4A 2R1MA 3MSRA 2CKRA 2OO6A 3NQDA 3W7LA 4PB4A 3QHNA 3KVKA 3UR5A 3CU2A 3NZ1A 1OY0A 3LQLA 4ADSA 4AIOA 5BYWA 3QR0A 3VMNA 2CXEA 2CHOA 1YDVA 3WQOA 4EPEC 1BWKA 3BTNA 4DUOA 3GH7A 2D23A 1PHQA 2NQ9A 7A3HA 1FWNA 1F8IA 2KX9A 5CZ0A 4O14A 1YXYA 4LX4A 3MP3A 1SMAA 1XIBA 2VEFA 3NZPA 4UTLA 3DC0A 3QQ1A 3UY8A 2ZX7A 2OZ8A 3CUJA 4GUHA 4FAMA 1UASA 1V6TA 4IGNA 1JCJA 4HNVA 3BGAA 4QJ1A 6REQA 2XYLA 5K3VA 5CC6A 3UG3A 4Z2JA 2Y61A 4M5PA 2CBUA 1TR1A 1XD0A 1YQ2A 4YYFA 1SJAA 3UXLA 3NTYA 2ACQA 2XFYA 4QR6A 4UTKA 5A6JA 1BYDA 3THCA 4LVGA 4LU0A 2R24A 3TNBA 3EEZA 4DY1A 5H8MA 2CXGA 2YZ5A 2WMKA 3W2LA 1A0DA 3BQ6A 4YTUA 4WRHA 5ECVA 5A8NA 4ZA0A 6REQB 3ITLA 4QEEA 4OOUA 3FAWA 3M7WA 4ZQNA 4S1FA 1ZJAA 5CZKA 4DZ5A 2CZDA 2E8ZA 3VGDA 1TR9A 5CG7A 3SSZA 4MJ2A 3RX4A 5EFDA 4QSFA 2E9BA 2GQ9A 3TP4A 1UD3A 5AYYA 4GI9A 4GVHA 1VKFA 3CZKA 1Y8BA 3TN6A 1MUCA 3OEXA 2GQ3A 3T44A 4OWGA 4AWSA 5FA5A 3SECA 3E1F1 4J28A 3USZA 1E4MM 3TU9A 1Q6OA 4MB5A 3SRKA 2Z1SA 3BLKA 4I5UA 1A5CA 5LNSA 2WLZA 2X2YA 4BF9A 1CEOA 2VZTA 5HK4A 3GE7A 4AD1A 4NNCA 5REQA 2A6LA 2YA1A 3E0IA 3PVFA 3CQJA 1X8FA 3M44A 3AIWA 3KEHA 2TRSA 2P8CA 4X3ZA 3UBPC 3NM1A 4GG9A 4PL2A 4LC8A 5AC7A 1RLDA 1BPLB 4PCTA 3TFCA 1TPUA 1R9ZA 4F0SA 5HNTA 3ENLA 1ZPTA 3UWQA 3IJ7A 5EB8A 1R46A 4W86A 3H2MA 3NPWA 3TW7A 4K8EA 2PDQA 4ENLA 4JS3A 3R43A 3S1UA 4KCUA 2BWGA 4O18A 1G9HA 2ZZ2A 4IGHA 1H7OA 1ZAIA 4GUGA 3VZYA 1B4EA 1XLGA 3YPIA 4WOZA 2H6RA 1XC6A 3WQ6A 4B4FA 2J9YA 1XDJA 1DEDA 2PTWA 3PJXA 4D1JA 4E4UA 1OFDA 3T0BA 3DYOA 4DNMA 1H7XA 2J8TA 3QSRA 5HUPA 5BOOA 4EK7A 4LUJA 3SQSA 1LWHA 1D7FA 4OFCA 2J9XA 1IT8A 5FEWA 2B31A 4AIBA 5K7JA 1JG9A 2HDJA 5CZSA 2OWCA 2VZSA 4B2DD 3H7RA 2ZBTA 4Q8WA 1AA1B 2QPUA 3DHDA 2PRHA 4QROA 4U3AA 1RPXA 2XUCA 5DMYA 3PUEA 3WUBA 2CWXA 5HNNA 2FVMA 3S5SA 3K46A 3AS2A 3K1DA 2TMDA 2WZIA 3L5AA 3MUZ1 3SCUA 4FMVA 4O8RA 4XAPA 5BNKA 3GX9A 1JCYA 3CTTA 3C0QA 3CL6A 1UOKA 3GQYA 1BXNA 2WXDM 3E38A 1RSCA 4A3YA 3RNDA 1SZRA 3P7YA 3W7CA 3GTNA 1TV2A 4FXJA 4HQVA 1M53A 3NQGA 3A3HA 2WV8A 4L4PA 1V8EA 3PR2A 2VX7A 5DFAA 3FA4A 2EPOA 4I7VA 4JX5A 2FHFA 4KS0A 5E0FA 4IIDA 3H54A 3AWNA 3A9BA 3BV4A 1EZ2A 4S2BA 1R7OA 1V51A 2F7FA 3W28A 2PDNA 1KW1A 5BRBA 1H50A 1UUQA 2QJMA 2PDHA 2OEKA 3WLHA 2A6NA 1LQ0A 2PRLA 4J3VA 2A7NA 3W1TA 1K4HA 4PMVA 1K9TA 1Y5VA 1KCLA 4RZ6A 2WSKA 2PCQA 1LRNA 4DO7A 3C4UA 1E6ZA 2FTWA 2E5BA 1A5MC 2DJLA 5HNUA 1M5WA 3AICA 1J5TA 3C2YA 2EQDA 3CXOA 1VHNA 3P14A 5AFDA 1UH3A 4BKNA 1YXDA 3L4VA 4IMAA 3CHDA 1RBAA 4JY8A 5ABFA 1IXPA 2QCFA 1I2NA 3HV8A 3BAJA 1Y5WA 1YNQA 3S2LA 2FZNA 5HUOA 3GNOA 1XQLA 2ACSA 4M29A 5K9CA 3GTIA 1FRBA 4JTGA 2BX7A 1B3OA 5AOUA 3WUFA 4U28A 1D2KA 2O92A 2INFA 4TMCA 2Y0FA 4LF1A 3OVPA 4PMYA 2ZQ0A 3H2FA 3EXRA 4JCMA 1BYCA 3SZ8A 2I7GA 3IJ8A 1EUNA 4EIVA 5H91A 3BSMA 1XM3A 1J0KA 3PZTA 1PCKA 1OK4A 3KZSA 5AKQA 4KIEA 3T2OA 4B2DA 4J27A 2HWGA 3WD3A 1CGVA 3UCDA 5BWAA 4O4VA 3RUBL 5JQ9A 4XZMX 1KBKA 3AHZA 3VOFA 1P1XA 1ITXA 4O54A 1KM2A 1KRMA 3ABQA 3FJ4A 2FQIA 1UQYA 1OQFA 1GVQA 3RHGA 1IZJA 5BXPA 1RP9A 1TPEA 2DT0A 2ZYFA 4D6HA 4LCSA 2TSYA 3KX6A 3KL3A 1LG1A 5KITA 2A3LA 3CASA 1WB0A 4TQTA 1CLKA 4CCCA 3WD0A 2WO5A 3MC5A 2DY3A 3OZOA 2V3FA 3AIEA 4Z2LA 4JTQA 4MY1A 1E71M 2WC3A 3MO4A 2IMRA 2EO7A 1BVZA 1O60A 1ZCCA 4GC3A 4Z1YA 1Q45A 4U10A 3WQPA 4LTSA 3NSXA 3NYZA 5D33A 3LI1A 4IPLA 1I6NA 4HZ8A 1F61A 3VNIA 1H11A 2QDGA 1C8VA 2Y7DA 2V3EA 1RJRA 4S3KA 1FHVA 3QV6A 2BHYA 4UNKA 3A3XA 1IV8A 4LEQA 1B3ZA 3HMJG 3WDRA 1RJPA 1IEWA 5C0QA 4JQ1A 1MEWA 4OGZA 3DFNA 1EQPA 1ADOA 3ATYA 2ZVRA 4HPGA 3P67A 3ZQ9A 2G3NA 4PH6A 2HXUA 2V67A 4O52A 2CLEA 3ARYA 2Z27A 3WDQA 5D9MA 3T9PA 2HE8A 2ZZ3A 3WLOA 4P8XA 3RM4A 1OG6A 1JCMP 3FVMA 2P50A 3RLGA 2D0FA 2GDVA 3ANYA 3AU2A 1YRRA 1TV4A 3TW9A 1BQCA 1AJ0A 2CLKA 3LCGA 2Y63A 2ZRZA 2QCHA 4MFDA 2AKMA 3MW7A 3CWNA 3PBVA 2VM8A 5JBDA 3N9RA 3OLIA 1AW1A 1W9UA 1TQXA 3TTOA 2XDFA 4M8UA 4I5XA 4IX2A 1BXCA 2FDMA 4Z42C 2FJKA 3N17A 3DOPA 4WD0A 1QNPA 3IJDA 1VEMA 4LV4A 3RR4A 1W1VA 1U1JA 1SO4A 4LVAA 5A6SA 1J0JA 1H7RA 3UZZA 4WHBA 1R9XA 1HJXA 4I6VA 5BXSA 1MXDA 3LHZA 3WENA 1VJZA 3UVAA 1XLDA 1CCWB 3LDVA 3BLEA 1KR1A 1FX6A 4MWAE 3TAKA 2E9LA 4EPDC 1GK8A 2WOQA 4HMEA 4RDZA 3UJEA 4GI6A 2IQTA 3HPAA 3KDNA 4KWVA 5CLTA 1IEQA 1BG9A 3EYPA 1PCWA 3L4UA 4LC6A 3M07A 5DN1A 2XTKA 4ECLA 3CUGA 3LPFA 1WOBA 2R1PA 4NAFA 1K77A 2J75A 3VDBA 1CW2A 4TMBA 5B7YA 4PB3A 1A3XA 1R9YA 3VE7A 3VM7A 1E6NA 3H53A 3H23A 1UA7A 2G41A 3APTA 1OWQA 4TXEA 3ZR4A 2VP8A 3AISA 5A2AA 1TVLA 2RUSA 3OYZA 1A5UA 1VJSA 2RFGA 1ZSXA 4BWLC 1CB7B 4ROQA 3GDLA 3C2RA 3FCPA 5BRPA 2J79A 2QULA 5JH2A 5JBEA 5E0CA 4Y9PA 4JTCA 2X1TA 2YZRA 1X7FA 1XX1A 2FGBA 1H49A 4UR9A 3REQA 5IHRA 2DSWA 3I6EA 4C6MA 4ZQCA 3P0WA 3AQUA 3PHAA 5LXXA 1C9WA 4CQDA 2TODA 2ZA1A 3W23A 1U1HA 1W0MA 4O1DA 3S2JA 1PYMA 1V0LA 4O0KA 1H7PA 4Q8NA 3WFAA 1J0HA 4S3JA 1A5AA 1A5SA 1PKLA 4IIFA 2Z1KA 1G1YA 2DZXA 4CD7A 1QNSA 1K7EA 3ZR6A 1XIFA 2ZC8A 1YNYA 1KFJA 4I90A 4A3HA 3RF9A 3IUHA 1Q7QA 2VCAA 5CAKA 3BL3A 2B7NA 3DECA 2VR4A 3ITCA 3V0TA 2DUXA 3O1NA 2EPNA 5ABEA 4MPQA 1VGAA 4TUFA 2B7QA 3PZNA 3NXLA 2IUZA 1S1PA 2WVVA 4FOKA 2BXZA 1MI3A 1F2JA 1FWSA 1XPYA 2BZNA 5FJOA 1G7UA 2CLMA 5LXEA 2ON3A 2CU0A 3KVMA 4J3UA 1VYSX 4JY9A 3W6YA 2WQDA 3CZGA 4YVVA 1EPXA 3NDZA 5KMYA 4ZFMA 2V5DA 3FJLA 3BMVA 4HPXA 4MB1A 4MWAA 3U4FA 4WSKA 3VIPA 4IPIA 4A2RA 2BODX 3WLJA 3S5ZA 3GHRA 1CBGA 3AXMA 2PWDA 4XD4A 4HTBA 3DHUA 1EO7A 3DZ1A 5CPOA 3WLSA 1R87A 1UR1A 3I6RA 4ACZB 3NQ6A 5I00A 3QLDA 4DIAA 4E2OA 2CC0A 4AMAA 1UP2A 4E8GA 4QJ4B 4NVTA 4C5ZA 1Z32X 3FYOA 5C9WA 3HTWA 1XLEA 4ZOEA 3MMDA 1NFBA 3M46A 9RUBA 5C7HA 2DVUA 3Q4DA 1JZ4A 1V6VA 3DH7A 1TUFA 1DOSA 2VYOA 4WLCA 1L6GA 2GDUA 2DVXA 4FIRA 3W71A 1PPIA 1UUMA 4JTJA 5A6KA 1GOXA 1OFPA 1T0OA 4ZOBA 4NZ1A 1V02E 3EMCA 3TFXA 3D3FA 1QR7A 3MPGA 3RO6A 3CYJA 1NFGA 1V3JA 3CT2A 4UQ9A 3HPZA 4IT1A 3WD1A 3RLUA 1J6OA 4CN1A 4RE3A 3WQDA 4UOJA 2IW0A 2QF7A 3TYZA 1OJXA 3EOUA 5FD0A 3K2GA 4EX4A 4UQEA 1J11A 3CUXA 4AXKA 1M9HA 2WPGA 1FH9A 3KTSA 3L66A 4CEUC 3C5QA 3E0FA 1R0MA 4B9ZA 1UD8A 1GG1A 2QDHA 1SW7A 3HGJA 1W2VA 2E9MA 4ZEPA 1UH4A 3DKJA 4AWTA 5E9AA 4PUMA 2VWSA 3TXVA 1B2YA 3PZVA 4MZ1A 3FHQA 1NARA 1QPOA 1A0EA 2YPIA 4NY2A 4KH2A 3QY6A 1J6PA 1TJRA 3PUDA 4OJYA 1EOKA 3ABOA 2O4QA 1B3YA 1ZBCA 4TX9A 1XHGA 3P74A 2NQJA 4ZB5A 1TVPA 1R2TA 4YTTA 4DUXA 2J7GA 4EXAA 2A0NA 1B90A 4LAOA 1TPVA 3GU1A 1D3GA 1WAWA 1JVNA 1G01A 4H04A 3AAMA 1Z41A 4I7WA 3HJZA 7REQA 3WJZA 4OU1A 1M41A 4N9EA 1ZLPA 3WMCA 1W5MA 5J04A 1R38A 3BAWA 3L12A 2PDXA 1BFNA 3VC6A 1E6PA 2P5NA 3LMZA 3UJRA 3W1AA 4JIPA 3N3MA 3U9IA 4UTWA 1QJWA 3ZFHA 3PSVA 4F40A 4Z2IA 3F1QA 1I2QA 1WZAA 4FOUA 3RDKA 1D8CA 3VOHA 4JNYA 4L64A 4O17A 1V7YA 1JPKA 3W22A 7REQB 4NYUA 3MMWA 1NTHA 2VGGA 4P5UA 1UKPA 3L68A 2G95A 1JFHA 4LNCA 2J78A 4FS9A 3IJ9A 3UYCA 3FIGA 3NYDA 2PDKA 1QK0A 4BFAA 3ELFA 2A3HA 5CJMA 4QXIA 3THQA 1WQ5A 3W1MA 1IQ8A 1OC7A 1KBBA 3UF9A 1V02A 3DG6A 2BVTA 1PL9A 3EOEA 1JI1A 4AY1A 3TN5A 3NL6A 2CBIA 2JIEA 4L9ZA 3P82A 2Z6JA 3P61A 3ZJ6A 1M1BA 5IHSA 3BH4A 1F6PA 1KV8A 4LT9A 4QITA 4DAIA 1I2OA 4IIBA 3P3BA 2NQLA 3NDYA 1U5VA 1ME8A 4LAUA 1E9LA 4C6FA 2RDUA 1AH4A 1LQAA 1JNEA 3KDOA 3UU0A 4J1OA 2C79A 2GVJA 3THUA 4AZ5A 3NURA 2O0TA 1H7WA 4PMZA 1JFXA 1HGWA 2QJJA 2A3AA 1GVRA 3ZM8A 1UG6A 5KSWA 2YA0A 3PBUA 5FJPA 2DP3A 5LYRA 2O9OA 3XINA 3SURA 3N15A 1ML1A 1W1ZA 4RK8A 5D2TA 1EF2A 1JDDA 4UTUA 4AF0A 4FI4A 2VI0A 4HIBA 1YTEA 2DSZA 3N6HA 2QNEA 4MOZA 3BWWA 3VNLA 1YADA 3GNRA 4QAWA 4N4PA 3BMWA 2R1LA 4IG2B 1ICPA 1P7TA 5M3WA 3LCXA 3AHXA 3VUPA 3NQEA 4LVFA 1PKYA 1IGSA 1OGSA 1QI3A 1TYGA 2WNWA 5TAOA 4JN7A 3PUGA 4IFKA 4H9YA 3TXZA 1XYLA 3EWDA 4HMCA 1FY6A 3PAOA 2C91A 4URIA 4X61A 1JQVA 2HVMA 1XJBA 2ZUWA 4RNFA 4IFRA 3D5HA 1P7TB 1TELA 4G7EA 2XJ7A 1BF6A 1UIOA 3UYIA 2O4MA 4IP4A 4WXYA 4IXXA 1JYWA 3P6LA 1TX0A 3IAPA 4IFKB 1GHSA 3GVWA 5DCDA 4US5A 2UY2A 4S3EA 4L5ZA 4XBSA 5I07A 3V0SA 3W73A 1CXFA 4GA8A 1TTQA 3PJWA 2BTMA 3UD6A 2GOUA 4PFMA 4RE0A 4BS0A 3CHEA 4J40A 4INFA 4G7EB 3T2QA 5DX7A 3WL1A 2QMKA 4ZSTA 2AQWA 1GOQA 4RCXA 2JEQA 1ITCA 1OZMA 4HNOA 5D37A 1OZQA 1P43A 4DN1A 3MA8A 4LV9A 4E3VA 1RK5A 4IX0A 3CM4A 4DRSA 4F2BA 4NL1A 2WMIA 3VNMA 4R3UA 4CQBA 3SADA 4GZIA 5FF0A 3A22A 1F6YA 1S2TA 4WKHA 3EOOA 4CLMA 1W1B1 3M41A 2X0SA 1GQNA 3GZAA 4XSMA 5FEXA 3OZPA 1C29A 3FJNA 4GWEA 1BXBA 1W2PA 4H41A 2DZPA 1QPNA 1W3IA 5DQPA 1PVNA 1DJNA 2I1OA 5HXMA 2DSVA 3DXIA 1V7AA 3WYZA 3E2SA 3KWSA 4L4MA 4OBTA 4S23A 3MKVA 4XKYA 3HQOA 1FVPA 1SFTA 5IBXC 2WMIB 1V3IA 1FWAC 1PJ9A 1FWCC 1ECEA 1UROA 1MRQA 1GOWA 1LDCA 1M3UA 3HM7A 4A35A 1RJQA 4WGHA 4IQEA 1NDZA 4AW7A 1F8MA 1Z42A 3BLLA 2PBOA 1E15A 4TIMA 1E72M 5LA1A 2VDHA 2FTYA 2X16A 3OGRA 3GHUA 1S2WA 2DIKA 5KZMA 2PEVA 5FJJA 4XKYB 4CD6A 1HP5A 4ZQMA 2DT1A 1K6WA 4UR7A 1CT5A 1JNDA 4GYFA 4U5KA 1VQTA 4BQ5A 2Y5JA 3W74A 2X41A 5I24A 3S47A 4GBUA 3U8GA 4G9PA 4PN2A 3TLLA 3UEQA 2QCLA 1ODUA 3GC2A 2YLAA 4DLFA 1YE6A 3ALFA 4HYVA 3V5FA 1XIMA 2VX4A 4DXKA 5CAHA 1VYPX 2VMFA 3Q58A 4DYEA 3ABSA 3UXDA 4J7RA 1TV3A 4QCEA 5FF4A 4Q7BA 1F07A 4DF0A 1YIXA 2W63A 1L2QA 5TF0A 2UY5A 1AJZA 1W9VA 3W2KA 1B9BA 1G7VA 5CPNA 1H3GA 3SQLA 1S3TC 4F0HA 1ONRA 2HRWA 4MWAC 1I75A 3SCOA 2OXNA 2QLYA 1C9DA 1ICSA 1QPRA 1H09A 4QRNA 3B0XA 3S5NA 4FXRA 5C9RA 4J2MA 2ZRVA 3PWIA 3QKZA 4F2TA 2V3GA 3TQ0A 4N6EA 3MT1A 2O7QA 3IIPA 4QG6A 2VFFA 2VDGA 2WKGA 4HJWA 1W8GA 3T2PA 4GABA 4GX8A 2V9DA 1EEXA 2W62A 3V36A 4S3GA 1WKYA 3D0CA 4KCWA 3WQ8A 3AMKA 1VS1A 4JFVA 2Y89A 2P0IA 4WF7A 2CYGA 4GCXA 1GJWA 1N8IA 2Y7EA 2BGSA 4YYCA 3MMTA 3H7UA 3GYCA 2WCSA 1DWHM 3KOFA 4H6EA 1FWRA 3D47A 4YHGA 4R53A 3SN4A 1YPIA 3BZGA 3SQMA 4HOXA 3G5EA 1TJPA 1REQB 3RFAA 3V3WA 3M47A 4Y9OA 1ZL1A 4A8LA 1Z44A 4OIFA 3JVAA 4ZTYA 1CB2A 1J2WA 1LORA 4DJFC 5C55A 1Q63A 2R94A 2I5GA 2J8FA 1BF2A 3VC5A 3V5OA 2WC4A 1CNVA 4ALDA 2A7RA 3M0ZA 1P6BA 2HTMA 1YBQA 1EGZA 2AAAA 4XZWA 3TUUA 3UZYA 4DBDA 4BJHA 3QHMA 4GHRA 1Q2SA 3VK5A 1MXSA 2PDIA 3PTMA 2QIWA 2HMCA 3B4UA 2ALDA 4TTGA 1VLWA 2XSXA 4D6FA 4IJRA 1MO0A 1XYMA 4D6EA 1THFD 4W5ZA 1UWUA 3TYBA 4E3TA 3R8GA 5LGZA 2GL5A 4RNHA 2XM1A 2NX9A 2W67A 3W82A 6PTDA 4BI5A 3RCMA 4C65A 2J6VA 3NQFA 2GOKA 1F7BA 3B97A 4JFUA 3ARZA 3E6EA 3B8DA 3WEMA 5AHFA 5GPRA 4WJEA 3WBXA 1GKRA 3VKJA 3B0YA 4U4MA 1R3YA 2ZA3A 3DBNA 4FR1A 1NELA 4NF7A 3UJFA 4WCJA 5AHMA 1XIEA 3BOLA 2DUAA 3E0VA 3TC7A 1EDGA 2XZ7A 5GVJA 2EF9A 1KLYA 3W87A 2VZUA 1JDEA 2WHJA 3CQ0A 2VFDA 3O3RA 3HPFA 3LOTA 4LNYA 2Y62A 5LIWX 1H7NA 1P0DA 2ZKMX 4PFHA 4GGHA 4EF9A 1J12A 3HFYA 3I4EA 5G2WA 5DCBA 2PB1A 1TE6A 3NQVA 1J79A 2F6KA 1AQMA 4ZO9A 3L4WA 4DJED 1H4PA 4W7UA 3T55A 4ZOCA 4K36A 1VRDA 1DWAM 1ZS2A 1GEQA 2E5DA 2VWTA 2WM1A 3NJ3A 1VEPA 4MUPA 3SRDA 1LLOA 1J01A 3NQ7A 4J3WA 2GJLA 2GGEA 2FLIA 1SW0A 5LNWA 3WK3A 4IGSA 5CGQA 5BXRA 3GYEA 4DI8A 1IXNA 1Q8AA 4DPPA 2VCBA 1T96A 3SRHA 3AZSA 4W9TA 2CLHA 4XBKA 4X9SA 4AZBA 1OCJA 1R2SA 1ZJHA 1HKIA 1TZZA 4QE5A 1VFOA 1IT0A 4L9YA 3LM3A 1EHAA 3SCTA 2VZVA 2YL9A 2AL2B 1LG2A 4GYKA 3BOXA 5HPOA 2EG8A 4HMNA 4DWSD 4DYJA 1EBGA 3PBYA 1UUOA 3AALA 1JL8A 3N2XA 1UWTA 3NVDA 2Z00A 3M0JA 2X7VA 4O13A 2UY3A 4RZ5A 4V27A 2SFPA 1KGXA 4J3ZA 3ITOA 4MDOA 3CQIA 4REQB 1A3WA 1S3HA 4XG1A 2VFEA 4H00A 2YLLA 3PF3A 1JYNA 5JU6A 3AMLA 2LLEA 4QGCA 3TV8A 1GHRA 3BO9A 1LL4A 3EWUA 3WJWA 1EWDA 4A2SA 4LY8A 4EVZA 3LXCA 1KFKA 4PCSA 5F4XA 1OD0A 4GBDA 1TZ7A 5KEZA 1AMYA 2POZA 2ATMA 1EIXA 3WZ0E 1ONEA 1KTNA 1E9YB 2NT0A 3TTEA 1XRTA 3ARSA 3UCQA 5LIKX 3WQFA 1Z8AA 3K13A 3SDOA 1JUKA 2I9EA 2NLYA 5EMLA 1K6AA 4NAEB 5E1QA 6XIMA 4KCVA 3CWHA 4B5NA 1E9ZB 3KM8A 3U2ZA 4D72A 3EWZA 3KL5A 2QZRA 3HMCA 2D0GA 2DZVA 7CGTA 5ECUA 2Z2BA 1QNRA 1L8PA 3R5EA 1XV8A 5I2UA 3CMFA 1ZRQA 3VE9A 3WEZA 5A8QA 5B80A 3M5VA 5CJ5A 1G94A 2G8ZA 5F7UA 4JHMA 3BURA 2VD9A 3H4GA 2X2GA 3VYLA 3M0LA 3MDUA 4W7WA 2ZRYA 3C3NA 2QMJA 4QS5A 2OLSA 4WX2A 5T26A 3NNTA 4XZ9A 3BARA 1UOZA 1OINA 2G3JA 4H7VA 2ZE3A 3AIUA 1TA3B 4LY4A 2HPMA 1SJDA 1KFLA 2XN0A 2NVCA 2NVAA 3EWWA 4KRUA 5BU6A 4X60A 1OCNA 4KGJA 2CBJA 2P53A 2QQ6A 4Q7NA 4A22A 1H60A 3R7MA 2OSXA 1BHGA 2O9TA 1PHWA 1R3SA 1J0YA 1XQKA 3DI1A 3GWQA 3I7QA 3W00A 3AS1A 4GACA 2J7FA 4Z08A 2JF6A 3P5ZA 4W88A 4JX4A 3W7DA 3FN9A 2F6XA 2QR6A 4GZEA 3GR7A 3QC3A 4UTTC 3VFCA 4H2HA 3O0FA 4BF5A 3BCFA 4Z2KA 4O8AA 4MZ8A 4LW7A 1KFEA 4LUYA 4NYYA 4KCTA 2G4JA 1LOLA 3BZJA 2YBUA 3FA3A 4H19A 2PUZA 2OZ3A 5K4XA 1F74A 2I17A 2XVNA 3MDWA 1JULA 1YPXA 3S1WA 4TVUA 2XH7A 1SFSA 1VYRA 3SRFA 1VD6A 3OGSA 1WZLA 2GVYA 5J5RA 3DGBA 3WFZA 3W88A 3OVGA 3WN6A 3UR8A 4RW5A 3TZFA 3TR2A 3WNNA 1PZ3A 4JCLA 3ECQA 4IPNB 1UZ4A 3L0GA 2E77A 4N4QA 1WBJA 2IKJA 3CB8A 5IFTA 5IRPA 2YGYA 3TCEA 4H6QA 3RRAA 4IIEA 4C1NA 2PWEA 3VZZA 3WMSA 3CHFA 1IF2A 3KRSA 4ZODA 2E6DA 3IJIA 3CAVA 4HZMA 4R9OA 3TOPA 2WNNA 3MJYA 5CC7A 1KLZA 2JFEX 1XIDA 3QOKA 2VL4A 5HANA 4IIHA 1WOAA 2YCLB 4M6VA 4GXPA 3DG7A 1VRXA 4LXFA 4UOZA 3OHIA 1P1MA 2O7SA 4AUBA 1US3A 4CN4A 2DT3A 3AYRA 4M6PA 3EWBX 1ADDA 3SY1A 1W8SA 2Z1WA 1O1HA 3I10A 2W91A 3G0XA 4LUTB 3G8EA 3WNPA 4NI8A 4DJDA 4D6DA 1NVMA 4DELA 2ATSA 4O1CA 2VT0A 3M0VA 3I7SA 4IMFA 2QIIA 3GXDA 4WKFA 2GVGA 3KS6A 1DJQA 4LJ3A 4Y90A 3HGRA 4E8DA 3CIVA 3Q94A 1EIBA 1OX5A 1XSIA 3WJXA 4OUEA 5CC3A 3GG7A 1JAEA 3FAXA 3GKFA 1C91A 1NOUA 6ALDA 1OD8A 2E3ZA 2JE8A 3CV1A 3NVTA 5E9XA 1MVYA 1VENA 1Z3NA 4QFUA 2JIWA 4FLSA 1V6UA 4H7CA 4XO7A 3T4WA 4AVNA 1UKQA 1KNWA 3IIOA 1K03A 4DM1A 4YL2A 4HBKA 1E1FA 4HNLA 1L8NA 3G6LA 5FEZA 2PC8A 4PUNA 4Q4SA 4WY0F 4PRRA 3WH6A 4CCZA 4HSOA 5BMXA 3O7UA 2PSNA 2Q02A 2A3CA 4X0VA 1Q85A 1PIIA 5AY7A 2PCEA 4ZB2A 4CCEA 5I3GA 1JEZA 1ZU8A 1O5KA 2A3BA 4JPGA 1HO1A 4H8UA 4P61A 1IR2A 2J47A 1Q6EA 3DFSA 3HJEA 1H63A 4IICA 2BGQA 1E6RA 2EBNA 4PR4A 2XIBA 2GDQA 3FFSA 4WK9A 3N12A 4KESA 1Q6FA 4XIAA 1W5QA 1MZHA 1V3KA 4E0CA 1KCKA 3LCWA 3SCSA 6CGTA 4AZCA 3LNPA 1SSGA 4P7OA 4U3CA 1U1UA 3A13A 3Q37A 2VDIA 5EY5A 1EBHA 4HA4A 2GPTA 4PCPA 1S2VA 2ZCGA 5FF2A 3RMEA 1XFCA 1U30A 2HE5A 1K3UA 1UP0A 3U0HA 4MG4A 3IJLA 2GSHA 1WXZA 3KP1A 2OELA 2QW5A 4UFLA 2WZHA 2FHBA 2J8GA 4ZL1A 4AEFA 2ZRUA 1DJIA 1KA9F 3U5YA 4Q8UA 3W76A 3IUDA 3FA5A 3VD7A 4QLLA 4XZNX 1OFRA 4IM4A 3LTPA 4Q32A 4PEEA 3PTQA 3L4ZA 4TO8A 3TWAA 3KZPA 2B0MA 2VRKA 3CAKA 3S1XA 3VDCA 1M6JA 4O12A 4Q3MA 3E2VA 4XAFA 2WKJA 1Z7AA 2OVLA 1FWFC 1GGOA 3IRDA 2EG6A 3NAVA 4L7ZA 3R8HA 4D6GA 1GT8A 2P76A 3VKCA 5I0DA 1DPMA 3H2CA 3TLQA 1ISZA 2GGIA 3DEQA 4RNIA 2D2JA 1TJ0A 3PBGA 2IS7A 2MANA 4AD4A 2VKZG 3NZGA 1PEZA 5LSMA 2VTFA 3P60A 3W1PA 2HNHA 1B9ZA 4WQ6A 1V3MA 1FH8A 5FJRA 3TR9A 2ZTJA 4NQ1A 5HJXA 3B0PA 4RKAA 3LB0A 2Y85A 1DQWA 4Z0SA 1G4PA 4ZB0A 3BAKA 2BY0A 3L4TA 3ERPA 1FDZA 5T91A 3VIFA 5CPLA 3VNJA 3W07A 3N73A 2DEPA 5LGXA 4QDWA 1TV8A 4NXSA 1SYTA 3VIGA 4D6IA 2R82A 1OABA 3NIYA 5AVNA 2V81A 1UPPA 1GQIA 4A3UA 3NO1A 2C19A 1VFLA 1NWUA 1WP6A 3MWAA 3KP0A 1OYBA 1MRAA 4FR6A 4X22A 5HOSA 2DSUA 1MEHA 2UY4A 4H8VA 3VOGA 4YXGA 3S42A 1HQTA 4XVEA 1J93A 1PKNA 1FKXA 3TC6A 2HXTA 5DBUA 1XLFA 2RGMA 3QV7A 3W27A 4MKNA 2YFNA 4H01A 1XRVA 2Z0IA 3CV7A 4L4LA 1DJYA 1V08A 4H83A 4EWND 2QDEA 2ZIDA 3EX1A 5HJYA 5F2LA 3G18A 4ZE4A 1XF0A 4GIYA 3SCPA 1SGJA 1PXGA 2XU2A 4YTSA 2BV9A 4HZ7A 4HYWA 4QEHA 3WY1A 3NXFA 1U5HA 1K02A 1VPYA 4ERAA 1GCYA 4GJIA 1EJWC 1Q6CA 3TROA 1G0CA 4F0LA 3IIVA 4EXBA 1K8CA 4HNTA 1AQFA 3LV6A 3W7NA 3UA4A 3VMOA 1FXQA 1IWBA 4JIQA 3LBMA 2A2IA 4QDMA 3G24A 1OM0A 4DEFA 4GRSA 4CNNA 3TZNA 3QV8A 2OJPA 1QW9A 4D71A 3UXKA 3APGA 5D8WA 4QS6A 1QHPA 2HSAA 4OQVA 1NOFA 4XZBA 3LG3A 3N2BA 3THDA 3HU7A 1GQLA 3KL0A 1DQUA 3Q45A 3MV11 1DTUA 3KTCA 3MV01 3G1VA 1ZJIA 3CO4A 4A6GA 4MJZA 3C61A 1WCGA 3AYTA 6TIMA 1PS9A 4I9MA 3F03K 3JS3A 3DHPA 2QCDA 3A9IA 2X40A 3S3GA 4IIGA 1E9IA 1R7AA 1PB0A 5FIPA 1F3XA 4UTFA 4KFOA 5CCZA 3L0NA 2DORA 3U4AA 5F2IA 3IJQA 2PDMA 5D38A 2JF7A 4GQ0A 1IYXA 3R11A 3C2EA 7ODCA 1ELSA 3VCRA 1K8ZA 1XI3A 2YDRA 4L80A 3GXNA 2Q8XA 3FJ6A 1R86A 3SR7A 3WLNA 4B9YA 1MMFA 2Q8LA 1DORA 3IIZA 3FNDA 2FPTA 3QF0A 3BGGA 3DAQA 2RH9A 4FF5A 1SZGA 3TA6A 3RITA 3GDTA 4MLRA 3KOXA 2DIEA 2CHNA 2BG5A 2X09A 1JI2A 1EXPA 4NJIA 2CERA 3BW4A 4N2YA 3JRKA 4FF7A 1SZNA 4DYKA 3TTQA 1BGGA 3CUIA 4NILA 5IDZA 2C14A 1EJSC 5HWJA 1GW9A 1U83A 3J7HA 3K30A 1RXOB 2DZAA 3OIHA 3AJXA 3GNNA 4HN8A 4Y9MA 3TYAA 4W4QA 2Y8UA 3V75A 2CWNA 4MAZA 1F3EA 3M0YA 3NWRA 4JYFA 4RZBA 1R47A 1O1ZA 3O0KA 4HA3A 5GJMA 4P8WA 1L9WA 5CPQA 4AZHA 3W25A 5I77A 1I1XA 4MKSA 3OJGA 2DFAA 4A8IA 1ZCOA 1P0BA 3R10A 3TVAA 3T0CA 1FWGC 2Q3OA 7XIMA 2Y4SA 1B0IA 1EC9A 1RR2A 5K9XA 3UCCA 2ZXQA 3UFYA 2ACRA 2PURA 3RRXA 3PFRA 1OVDA 3BLIA 4J9JA 1KR0A 5FI8A 4R33A 2HQAA 1I45A 1SW3A 4DJDC 4PA8A 1GVEA 3QZ6A 1UIPA 3VIKA 3W7IA 3BLOA 1SVDA 1HX0A 3T40A 4MAVA 3CV2A 4AZ6A 3VUSA 4XD6A 5H6HA 4HNUA 2GVLA 4CVWA 3K8KA 1UH2A 4G7FA 4LWWA 2ZUSA 5AB3A 5LA0A 5TD4A 1A4MA 4BHYA 3TJXA 1E4NA 3W02A 4AEEA 4MNJA 1A5NC 1Z6KA 4QBXA 1A5BA 4W87A 3G1FA 1BWLA 3B8WA 3W7GA 4FNTA 3B8SA 1OT1A 4MSSA 2QGYA 3OG2A 3ZVHA 2GVEA 4HHHA 2BY3A 4UB9A 1SM9A 3CWOX 3SUSA 5DY2A 1VBUA 2PGRA 3CUHA 4I7UA 2CLIA 3VIMA 1MDRA 2VFIA 5A6TC 3FYYA 1WUFA 1ZFJA 3FSUA 3KVJA 3RR1A 1YX1A 3LTYA 3U2CA 3PZIA 2GLKA 2YXXA 3CPRA 4MB3A 3AOFA 4ZZ9A 3BANA 1E0XA 4Y9NA 1XYCA 5A8MA 1WPCA 4UCFA 3AXIA 5EMMA 4XSLA 2ZXBA 3ZVHB 2OU4A 4IFOA 1LP6A 1WKDA 1I0DA 2VOMA 2VGBA 1UBPC 2VELA 1XCXA 2Z1XA 3VGBA 2R1NA 4Z17A 3KRZA 2QYGA 5DT5A 1GOMA 1EYWA 3LRKA 5CZTA 5BZAA 4HPHA 3ARVA 1LBMA 5E09A 3S2MA 1QO2A 3ARXA 3T05A 2IKGA 4C60A 1HKKA 3MZ2A 2CEQA 4JTFA 1RZMA 2WZEA 4I6KA 1W9BM 4XX6A 3VOCA 1BSIA 3BG9A 4PMQA 3AUOA 3H4WA 4UTHA 2PWHA 4PMXA 1UZ1A 3VZXA 1A5LC 4C91A 1HIZA 5HWNA 3QQWA 4CQAA 1E56A 4FP1A 4E6MA 1BQGA 1CXIA 3BCJA 1A50A 3B0VC 3UNTA 3LBOA 4LCRA 1TCDA 4XUYA 3S5OA 3TKFA 3BJTA 2CPUA 1W1YA 5IXEA 1U5JA 2GK1B 4GYPC 2Z1VA 3UESA 3NSNA 4C90A 3ICJA 4D2JA 1TWWA 2DW6A 4RPPA 1K70A