4Y9AA

Crystal structure of triosephosphate isomerase from streptomyces coelicolor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
254
structure length
254
Chain Sequence
RTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYDAVEVAVLAPFTDLRSVQTLVDGDKLKIKYGAQDISAHDGGAYTGEISGPMLAKLKCTYVAVGHSERRQYHAETDEIVNAKVKAAYKHGLTPILCVGEELDVREAGNHVEHTLAQVEGGLKDLAAEQAESVVIAYEPVWAIGTGKVCGADDAQEVCAAIRGKLAELYSQELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVGGASLDSDEFVKIVRFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
total genus 89
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y9aA00
3OHIA 3Q2DA 2A21A 2X1UA 3MYOA 3W07A 1JVNA 2Q3RA 3U8GA 3GK0A 2QAPA 1ZY9A 2QJHA 4OBTA 1SO6A 4O0ZA 1KV8A 5FF2A 4AEOA 4FNRA 1I2NA 3EWUA 5G2HA 2NX3A 2A7RA 1HG3A 4ZQNA 4O4WA 1VHNA 2ALDA 2VEIA 5HR7A 5K4XA 3W6YA 1K3UA 3ABRA 3C3NA 3MWAA 5BMXA 1FWSA 3C0JA 3IIZA 3GZ3A 3BO9A 5CZSA 4A29A 2GQ8A 2V2HA 4FNTA 4M5PA 2V5BA 2E1DA 3DI1A 1Q6QA 4LT9A 1PS9A 5AN7A 3UXAA 2VKZG 3LCIA 4YMZA 5FI8A 2ZZ6A 3DFPA 1YDVA 3ZS4A 3OVQA 4JDYA 4O8RA 5C55A 1FCQA 3VFLA 3PC0A 2Y7FA 4YCPA 3W7RA 4YL2A 2VFGA 1OFDA 1RQHA 2W6RA 4XTDA 1NF0A 3W2KA 1UUOA 4POCA 4NXKA 1KFEA 3BV4A 3STEA 1VLWA 4K8EA 3L67A 1F73A 3EWYA 3OG3A 1UJPA 2FFCA 3GNNA 5CPOA 3GXNA 1C8VA 3PSWA 4RXGA 3UWWA 4IMCA 5AC7A 3W23A 3KVMA 1AW2A 1XUUA 2BX7A 1LRQA 4XTIA 4JTHA 3LHWA 4O10A 5D09A 1TYGA 4IGHA 1LTDA 3DI0A 4CQ9A 1PHWA 2DZPA 2TYSA 3KVJA 3M9YA 1KM4A 1VYSX 3PG9A 2YFNA 4DBEA 2Q8ZA 1SU5A 3LHVA 5CKSA 4YLWA 5AHLA 4MJZA 2WPBA 3MI6A 2G96A 2E5DA 2ATSA 3HMJG 3A5FA 4E38A 1LORA 3C61A 3P84A 4AWSA 4X9SA 1ZFJA 3A22A 3L68A 1IF2A 4KFPA 1AK5A 4N4PA 1VLIA 2HS6A 4DO4A 2QEZA 4ZQMA 1A5CA 2C18A 3QW4B 4CCCA 7TIMA 3BG3A 4FHAA 1X8FA 5D02A 5D38A 1W3IA 4BI5A 5D2YA 1XDLA 2FB2A 3N19B 4JTJA 2ZA2A 3VE9A 2I9EA 3KOFA 2OT0A 4O53A 3W72A 2CLOA 3G1VA 5AHNA 3GXTA 5CGQA 2OX1A 3UPBA 4UXDA 4IPIA 4NJGA 2X2GA 1FDZA 4OT7A 2E5BA 1YXCA 3MP3A 2Z0IA 3GIYA 3NL5A 4S1FA 3N9RA 2QCHA 4XWUA 1KA9F 3TKFA 1RV8A 3UYCA 1SZEA 3KFTA 4LRTA 4KKXA 5FEWA 4B5NA 5AHEA 3O15A 1TJRA 2DZWA 4AH7A 1I8JA 1EWDA 3H55A 3W7QA 5KZEA 5EA9A 1QCWA 4FNUA 5AC6A 3CEPA 2D73A 2EPHA 3FIGA 3F1QA 2XFWA 4O1AA 3TSMA 1TPEA 4O18A 1GG0A 5DY2A 1PE1A 4FNSA 1MEHA 4Z0SA 2J9YA 4AMAA 1GZGA 3SGUA 3R5EA 2Y61A 3QPYA 4MFEA 4FX8A 3UPWA 4FX7A 1OVDA 1XI3A 1ZALA 4ADUA 4JGDA 1Q3NA 3NPUA 4JTKA 1XUZA 4M7TA 3TC6A 1SW7A 3RLVA 1VR6A 4S2BA 1GEQA 2YR1A 1LRNA 4HNVA 4GUGA 3CT7A 1KFCA 3R89A 2R14A 3C52A 5KSWA 3NQCA 3TW6A 1H7WA 2CW6A 1EP2A 4LUIA 1U5JA 3NNTA 3WK1A 1QPNA 2WKJA 1OJXA 1DORA 1ZNNA 3DZ1A 4IMDA 2RHGA 1O5KA 3EWBX 1AL8A 4G1KA 3MBFA 4AHQA 1A5BA 2DZXA 1LBFA 2Y70A 1DHPA 4IUOA 4E0CA 3G3DA 1MXSA 3IVSA 4UR8A 2Z6IA 3C2FA 1W5QA 4ZQPA 1MEIA 3W73A 2OMAA 2A2IA 4OU1A 3HQ1A 1KM5A 1VCGA 1W3TA 1H7NA 1GOXA 4GFSA 1SFJA 4C1KA 1LLWA 3CWOX 4MJMA 4P61A 1SZGA 1LM1A 1QAPA 5A5WA 5C5YA 4LVDA 2JKAA 4TMBA 5F1UA 4I7UA 4JTLA 4MFDA 2C19A 3GKFA 4MLRA 3G3MA 3NEVA 5D32A 3RK8A 3LI1A 5F1VA 1K7FA 3M1ZA 3P60A 4PC8A 4FEZA 1J5TA 1OF6A 1DBTA 3TXVA 1O5XA 1KBJA 3AO0A 3DFNA 2E5CA 2GJNA 4K8HA 2Y7DA 3EWZA 2Y7GA 3I7RA 1MSSA 4R53A 3VNDA 3QFEA 4GRSA 3TAKA 3NOEA 3SFKA 5I3HA 3WJWA 1KFKA 2GVGA 4JY9A 3G22A 1AMKA 1J2WA 1JRCA 4OV4A 1DOSA 2ZTJA 1ONRA 1OFEA 4TR9A 3NA8A 1FXQA 3R12A 4H4IA 1JUKA 3G1YA 2H6RA 4R7JA 1SO5A 5F4XA 1FY6A 4BK9A 1TTJA 2V2DA 4BR1A 3TROA 2Y6ZA 3ABQA 3V75A 3TMLA 3DENA 4U28A 2GQ9A 5LZLA 1GPWA 3TSDA 3G1XA 2QCMA 3FYPA 2PRMA 1KM2A 2VELA 3ABOA 1EUNA 3G1DA 4MYAA 4MZ1A 4DO5A 1YXYA 3NQ7A 3ZFHA 2YX0A 3C2OA 5G4EA 1TO3A 2I1OA 5HINA 3SW6A 3G1AA 3M47A 1UBSA 4XBSA 3W22A 4GUIA 2C1HA 3LI0A 4FIRA 5I3JA 3FKRA 3C56A 4KWWA 2WO5A 3CHVA 3W84A 1OFPA 1AW5A 3W85A 5K3VA 4ZVJA 2OT1A 4GUFA 3PAJA 5D03A 4QAIA 1TTPA 1F76A 3GVGA 3L21A 3P61A 3DBPA 4D2JA 2O7QA 5AHMA 3HPXA 1SQ7A 1P5BA 4GXMA 1XDMA 1AG1O 3JS3A 2HMCA 3CM4A 4EIVA 3BW3A 2J24A 1YPIA 2CZDA 3UXDA 5BW6A 3SSJA 3NQEA 4IMGA 3VCRA 1OFRA 5LNUA 2NV1A 1WOBA 1JCNA 1LOQA 1RQBA 8TIMA 1SO4A 1N7KA 3YPIA 4MZ8A 3N9SA 3F4NA 2H3DA 4FF7A 5KZDA 1EB3A 1OFBA 3UWQA 2QAFA 1ICQA 1XKYA 3L0NA 2YW3A 3CWNA 1B4EA 3INPA 3LDVA 1FDJA 3W1NA 3AJXA 3SECA 3GKAA 3W1RA 4NNBA 2GUUA 1R30A 3PS7A 3RNDA 3DFQA 1RD5A 3PB2A 2X16A 2ZRYA 3JRKA 2V30A 5J5RA 1TPWA 3N34A 1L2UA 3LHYA 2X1RA 3OIXA 4PODA 2W79A 1YLVA 4NJJA 3IEBA 1VGAA 4QIUA 2WNZA 1EEPA 2TMDA 5CSRA 5E1QA 3NO5A 4WX2A 3H54A 3M5YA 3GNDA 3QMSA 5U7SA 3P8IA 5AHFA 1XBYA 3M6YA 4WY0F 3G8EA 3L5AA 4H6KA 5A8GA 3C2VA 3O6DA 1PVNA 1IGSA 5D37A 2G5WA 1YPFA 3F4WA 3MYPA 3IV3A 1M5WA 2A0NA 2E09A 3LX9A 2ZRZA 1WA3A 3RFAA 1BTMA 2Z6JA 5CZJA 2X1TA 5C6MA 4XZ9A 4BFAA 2YDAA 5EKYA 4FNQA 3LCGA 1DV7A 3W2UA 4HSNA 1GWJA 2AQWA 3DHFA 1EA0A 3STCA 3DHDA 4IWWA 4JY8A 3LOTA 3W87A 1R46A 3EWXA 3W7HA 1I2PA 3S5YA 1TB3A 2ZDRA 4YXGA 3W1TA 3W74A 4UTMA 4RJEA 4LS0A 3CIXA 1YTDA 4NU7A 3LXCA 3HG4A 3QW3A 3EX6A 1X1ZA 2A7PA 3CTLA 2C13A 2TRSA 4MOZA 4QJ1A 3L0KA 1LBMA 1KFJA 1H51A 1JUEA 1OYCA 4O14A 3NPVA 4IQLA 5EYWA 4UTWA 4GC4A 3M44A 1DKWA 3HG2A 4WZHA 5LNVA 4C1LA 4TX9A 3L5LA 5F4SA 3C8FA 2E6AA 1XBVA 5BMWA 2CZ5A 1ML1A 3LBCA 3EKZA 4MY8A 1Y0EA 3M7WA 5K2ZA 4BWLC 1F74A 5FF0A 5BNKA 4DELA 1P4CA 3S6DA 1GJPA 2C15A 3QMTA 3TX9A 1RPXA 2CWNA 4HHPA 5DN1A 3H53A 1RVGA 1O95A 5G1TA 1V7YA 2CLIA 3WJZA 3C2RA 2J9XA 2ZRWA 4QNEA 3A5VA 5HWJA 3HF3A 4WQ6A 1TQJA 2VXNA 3LRKA 3NQMA 3PSVA 4IMFA 1KM0A 3M41A 3V1PA 6TIMA 5FEZA 3B0VC 4M6VA 3HJZA 3PG8A 1GVFA 3MUXA 1XBXA 1S5TA 3W3OA 1AL7A 2A6LA 1A50A 3DU0A 3TFXA 5LHFA 4NJIA 3NL3A 3O05A 3NGJA 3W7MA 4GUHA 4JYDA 2GVJA 3W1QA 3R8RA 4WXZA 3UWVA 5DELA 2GQAA 3RU6A 4TU1A 3HG5A 2QDHA 3E9AA 4UNKA 3TQKA 3MHFA 4JTUA 5EY5A 2ZZ7A 3TDFA 2EF9A 4ML9A 4YWIA 4JXCA 5E0KA 3NAVA 4LV9A 1I4NA 2QCEA 4LW7A 3WJSA 2X30A 2HTMA 3W1AA 3G0XA 4AWUA 4O54A 3ELFA 3EEGA 2UV8G 2C3ZA 1OK6A 1PHQA 4WOZA 1CX9A 2F84A 2I14A 1TPC1 5CZ0A 3NDOA 1VHCA 5LKYA 3NM3A 4O12A 2YZRA 3EXSA 4XKYB 2XN0A 3O8AA 3W70A 5IBXA 1HO1A 1FX6A 3QRHA 1CI1A 5K4ZA 4ZZ9A 3L9CA 3GXPA 2V9DA 2VC6A 4HPJA 4PL2A 1J4EA 4HPXA 4X22A 2CLEA 3IGUA 1Q45A 2JGYA 3NXFA 1IXNA 1OYAA 2CLLA 2ZA3A 3BGGA 4JNMA 3GR8A 1F5ZA 1JQXA 4LV4A 3GDKA 2J88A 2ZRVA 2Y88A 3B03A 2PRHA 3QZEA 3TMQA 4GNJA 3GX9A 3M43A 1TV7A 3EX3A 4WUIA 4UTTC 3I65A 3TW7A 1FDYA 1H7OA 4MUZA 1IIHA 1Q6RA 5AB3A 5EMUA 1LYXA 1LZOA 2G97A 6ALDA 3M16A 3UY8A 5LGXA 3F03K 4RZ6A 3OA3A 1TTQA 1YXDA 5G1YA 4RK8A 3LTYA 5AHIA 5T26A 4K36A 4O57A 4TO8A 4UFKA 3VE7A 3QH2A 2V0TA 3FEMA 3ZWSA 3UNDA 5E93A 2ISWA 1WYIA 3TSBA 1RR2A 4XKYA 1TREA 5KINA 4PA8A 4GE8A 4Z1AA 4M6QA 2QCLA 1EP1A 4KFNA 1SR9A 4PH6A 1B3OA 1FXPA 5G5IA 1JULA 3GDMA 2AAMA 3I7SA 4RR4A 4IX0A 3MHUA 3TH6A 4RZ5A 4Y90A 4CNPA 4GUJA 3LGEA 4NQ1A 5KTLA 5HWMA 1W5OA 2P1FA 3KHJA 3TC7A 1B9BA 1F6PA 3UY7A 5FESA 3S9YA 5FF7A 4DF0A 1WV2A 3WK2A 1ICSA 1QOQA 4MVAA 4MKNA 1TTIA 2Z1BA 3DFSA 3LTSA 5AFDA 3PUEA 3MMTA 3NM1A 1K7EA 1TPH1 4N9BA 2VEPA 5L6UA 4WD0A 3TCEA 2WV8A 2E6YA 1H1YA 5CSSA 2B0MA 1E51A 1H61A 2A1YA 2ZBTA 5F4WA 1S3HA 4JX6A 1AW1A 3MP5A 1VQTA 5BRBA 5HQEA 3B05A 2DORA 3IVTA 3DKLA 4BI7A 3L66A 1CW2A 4O11A 4GJ1A 4DF2A 1O4UA 1VYRA 1Z41A 4AWTA 2BLEA 1PIIA 1GVQA 3OVPA 4L4LA 4BI6A 4FIQA 1A53A 3LV5A 4DPPA 4GWEA 2GPTA 2FTPA 4EWND 3LB0A 4PTNA 4OE7A 2CLMA 3CEUA 3T7VA 2NUYA 3DH7A 1GT8A 1L9WA 3T4CA 1EIXA 2QDGA 4MY1A 3EX4A 3W76A 2NXHA 1WBHA 1YYAA 2E6DA 3LLDA 3W2JA 5HR6A 4QM1A 3E0IA 2GVLA 4BF9A 3NPWA 3UQNA 3TIMA 3KRZA 2BTMA 4K39A 1GYLA 5HNRA 3HB9A 2A4AA 2H8XA 4M7SA 5HUOA 3NQAA 4E2BA 2DP3A 1LROA 2F7FA 5HJLA 4LRSA 3P8JA 4UTHA 2NUXA 1GVSA 3E12A 3KRSA 2KZHA 1K8XA 1TCDA 3PBUA 4DXVA 3CB8A 1OX5A 5CZTA 1W5MA 2YYUA 1FUYA 1LOLA 1S5WA 3PBVA 4PL1A 3A24A 3P74A 3TU9A 2ZQ0A 4IMEA 3RF9A 3QMRA 3NG3A 1IXQA 1W54A 4NNCA 2QCCA 1H5YA 5D2XA 1C29A 1PV8A 3S5ZA 1QNVA 1G69A 3TXZA 1OF8A 3LV6A 4LWWA 3UZ5A 1OG0A 2QR6A 1QMLA 3ATYA 1DL3A 2EAWA 1WXJA 2E68A 1JJKA 1LRTA 5FF4A 3RMJA 2BSLA 4A3UA 2QCDA 2YCEA 1TV5A 3SY5A 3UWUA 1NAL1 4O19A 2WSYA 1U83A 3NQGA 1YDOA 3MBDA 4NX5A 1JCXA 1H62A 1KTBA 3W2MA 4ICNA 3LERA 2B7OA 1UUMA 3EXRA 2Y89A 3B4UA 1TRIA 2E6FA 4LOCA 4IX2A 1HL2A 2ZZ5A 1P0KA 1P1XA 1A5AA 1S5VA 3CPRA 4CCDA 4I9AA 1VCFA 3R13A 2FQIA 2WSQA 1I2RA 1Q6OA 1JCLA 4UCGA 1TMHA 2PC4A 2Y85A 1N55A 3M5VA 1R2SA 5J5DA 1FCUA 4Z1BA 4AAJA 3BLEA 4JS3A 2VEMA 4JTTA 3PM6A 4AHOA 3A9IA 2WJZA 1JRBA 1HTIA 2VEKA 1JUBA 2YYTA 4JX5A 5K9XA 2ZRUA 3EX2A 5LHEA 3LHUA 1BWKA 5CG7A 1D3HA 3G1FA 4K38A 1THFD 1KM6A 3OVRA 1Z44A 2V82A 5G2IA 1JQVA 3O63A 3W2NA 1SW0A 3GDLA 2RFGA 4ZQRA 2Y62A 2YPIA 4MYXA 3SI9A 4MZYA 1L6WA 3S1UA 4UR7A 4UFLA 3W1UA 1O60A 4Z08A 4O28A 4DF1A 1K02A 1W5PA 2OZ0A 2V81A 1XFBA 4RKAA 3TJXA 4LVAA 2NLIA 2CLKA 3MW7A 1OHLA 3HGRA 5C2XA 3I6RA 3ZR4A 1OK4A 1BEUA 4UMCA 4CCEA 4QSHA 4CQ8A 2Y7EA 3HG3A 4O13A 2JKPA 4O1BA 4EOUA 1SSGA 1QO5A 4IJBA 3C4UA 2AGKA 4ZQOA 3KVKA 4ZMGA 2RDUA 3LCFA 2ZCGA 2J27A 3S5OA 1XC4A 2DJXA 3LCHA 5K7JA 1ME9A 1B57A 1OX6A 5H2ZA 3W7LA 4K6AA 1SZFA 3TK7A 4DEFA 1KBIA 2YSWA 1H60A 3CC1A 4GBUA 1KV5A 1Q6LA 4NJHA 3S0CA 4PCFA 4WJEA 5I3KA 5D33A 2CLHA 2C14A 5F2MA 1RQEA 1KTCA 1DJQA 4Y96A 4M6PA 3IGXA 2G95A 2NX9A 3EWWA 4AXKA 4I7WA 3NL2A 3MI3A 3GLCA 2IQTA 2J9ZA 1YTKA 5K9CA 1T0OA 3BGJA 3B8DA 5ABTA 2FB3A 4X2RA 2NUWA 4JTFA 5K9DA 1UB3A 1K8ZA 1TIMA 4LUJA 1JCMP 2QUTA 2FDSA 1W8SA 4UIOA 4LU0A 4UMAA 2W0UA 3LTPA 4XUGA 4HT3A 2NX1A 4K7YA 1M7PA 2FLIA 3HBLA 4UTIA 5FEPA 3GB6A 4AF0B 4JTIA 2ZA1A 1WX0A 4RX0A 4P2VA 3GR7A 2JGQA 3G1SA 3N14A 2A6NA 1M6JA 4Q32A 3TE9A 1SSDA 3L5MA 2V2CA 4CNOA 4O50A 1ZAIA 3DXIA 3LLFA 2NWSA 2CLFA 3THQA 1MEWA 1TPUA 2J6XA 3ANYA 1IIGA 4O15A 3QQ0A 1T8XA 4RXFA 4KFOA 3B04A 4Y8FA 4ALDA 1TRDA 3E96A 3USBA 4JYFA 3I7QA 2QUVA 3GAYA 5U4NA 1L6SA 2A7NA 1QOPA 1GTHA 3GAKA 2C6QA 1FWNA 4OGZA 1QPRA 2VFHA 3OBKA 1GTEA 2WQPA 1GYNA 5AYZA 5D30A 3Q58A 1F2JA 2FPYA 4LS2A 4Y9AA 4FX6M 1DJNA 3C2EA 1QDSA 1LLZA 4AF0A 1XM3A 5BOOA 1EWEA 2EKCA 5D04C 1ZJIA 3IVUA 2DZSA 3FLUA 2EHHA 3LXAA 4JN6A 3FS2A 3QSRA 3U2OA 2VFIA 4K37A 4UFHA 5HWNA 3W7JA 4ONVA 1N8FA 4KWVA 3C6CA 3LBMA 3M5ZA 4NXSA 4AHPA 4LS1A 4RCXA 1UCWA 5I3GA 1TJPA 3S42A 4A22A 3W7EA 2O7SA 3PUDA 3NPXA 4UC5A 3S1WA 1JR1A 4UTJA 3M0ZA 1PCWA 3P5YA 3CIWA 3W83A 1R47A 4JIQA 1R2RA 3DFTA 3ZWTA 3WFAA 2RDTA 4IXHA 1KTNA 3P62A 4LVFA 2NZLA 2CZEA 3TQVA 2ISVA 1X7FA 1PCKA 3NR0A 3M5XA 2B7NA 2R94A 1LBLA 1ZAJA 4WOQA 4O16A 4CQAA 1C9DA 2QCFA 2RKXA 1R2TA 3W7NA 3QM3A 5LNWA 3MJYA 3LM7A 3NQVA 3B0PA 1KLZA 4PFMA 3L0GA 1X1OA 1XL9A 2GOUA 1QFEA 3QQ1A 3NQDA 2WSRA 3LRMA 4OQVA 5D2VA 2HSAA 1OFQA 1PL9A 3IIPA 4EF8A 2YW4A 3PWAA 1W5NA 1ZAHA 4QISA 1FWRA 4IPJA 3BG5A 1H7RA 3CLMA 3PUOA 4FNPA 5DCDA 4HSOA 3QJAA 1OX4B 2QUUA 3G24A 1OYBA 3NVTA 1XCFA 3EXTA 2DZVA 3TFCA 3CU2A 4NJKA 4CLMA 2A5HA 3NQFA 1ME8A 1ZCOA 2FJKA 3PB0A 5KITA 3STGA 2R8WA 3K30A 4DBDA 1G4PA 2WNNA 4JTEA 4N9CA 1DQWA 3S1VA 3T40A 1YTEA 3W7IA 3O6CA 3RLUA 4JTGA 1QR7A 3STFA 2BWGA 1XBZA 4NUWA 1OABA 1L6YA 2ATMA 1EP3A 2ZYFA 4UTUA 3GDTA 4X3ZA 5DCBA 3NL6A 3CQ0A 1ALDA 3A21A 4Y6GA 5TIMA 1W56A 3HO8A 3WJYA 2JK2A 3HPZA 1SUXA 2JBMA 3W7CA 4ORMA 2ZZ3A 5FF3A 1LCOA 4UTWC 1F05A 4Z1DA 2V5LA 1P0NA 1W37A 3SGZA 2FIQA 4N02A 4OWGA 1FBAA 2PURA 4YCOA 2X1SA 1OX4A 3A23A 3KAOA 3TNOA 4TIMA 4ZL1A 4L4MA 4NVTA 3VI2A 3TJLA 3W7PA 1NSJA 4DQWA 3BG9A 1H7XA 3ATZA 1H50A 4RZ4A 5KZMA 4O1DA 2C0AA 5IM51 5DY3A 5DXYA 3DGRA 2H8ZA 1QPQA 2ABBA 4JTSA 2Q3OA 3BW2A 1H63A 4ADTA 5TBOA 1TV8A 5I3FA 4ADSA 3O06A 3BPWA 1TPVA 4HKPA 1KW1A 5EBUA 4AVFA 3W86A 5L9FA 5DBTA 4UTLA 2YFOA 5DLCA 1VH7A 2VOMA 3UD6A 1EX5A 2ZZ1A 2DZTA 3JR2A 2ABAA 1DVJA 3DAQA 3ABSA 4JYEA 1K03A 5LNRA 2ZTKA 2CU0A 4LY8A 2VENA 1BKSA 3MHGA 4QQ3A 2QCNA 3B0UX 1VYPX 4OHQA 3PR2A 4NZJA 3TUUA 1HFBA 3W75A 4IXXA 4U4MA 1G4EA 4M19A 5SWUA 1FWWA 4TMCA 3TAOA 2NWRA 4LVBA 3HPSA 5HUPA 3FA5A 3PULA 3W1MA 3BVJA 4UFJA 2PE4A 4LC8A 3G0UA 3NQ6A 2CZFA 1FWTA 3FOKA 3HOJA 3N2XA 3HGSA 3R2GA 2OJPA 1GVOA 4MPQA 3BARA 4H3DA 3NQ2A 5AYYA 3PVFA 3WK3A 3IIOA 3QF0A 4E2DA 4Z1CA 1WOAA 3HGOA 3QEZA 4FB7A 4UTKA 2LLEA 2RDWA 1F7BA 1TSIA 4CNNA 2Y63A 2QCDB 5DXXA 1KM3A 3MO7A 3LCWA 4FXRA 4XQ6A 1HUVA 1QPOA 4J9JA 1WBJA 5IBXC 2DZUA 5G2WA 3W71A 4XBKA 3W7GA 3G8RA 4R33A 1W0MA 3N2MA 5F2IA 5D2TA 4A2SA 4WXYA 3SIZA 3TQ0A 1BWLA 3G1HA 3KVLA 3B06A 5MHBA 1LOSA 1ZENA 2ISSA 3TA6A 1O94A 4HNNA 4R34A 3L65A 3BLIA 3IIXA 2WOQA 2BXVA 4QNWA 5DBUA 1W1ZA 3THAA 1IXPA 1XXXA 3P7YA 4FO4A 3UWZA 1YDNA 3HGJA 3BW4A 3LCLA 5AYXA 3PBYA 1K8YA 1I2OA 2PRLA 3TV8A 1B4KA 3NZRA 5LSMA 4EVZA 4OV9A 3PBWA 4N6FA 4N9EA 3I68A 3G18A 3WK0A 1IXOA 3UWYA 3E02A 2XN2A 5F2LA 3IGSA 3GYEA 1OFOA 3Q37A 3T55A 1VRDA 4NX0A 4A2RA 1H1ZA 1ME7A 1SFLA 1EPXA 4JX4A 1NVMA 3LXBA 2V8ZA 2ZFAA 1TPFA 3EB2A 4HNUA 4N9DA 1GG1A 4ORIA 1Z48A 1TPDA 3KXQA 5HMSA 5CPMA 2H90A 3EX1A 5FEXA 1TPB1 3QC3A 4NT0A 5HULA 2QCGA 4N4QA 3NZ1A 1W3NA 4O4VA 3BLFA 1QWGA 1KLYA 3SZ8A 4HIBA 4HNTA 2B7QA 4N6EA 2FPVA 1WAUA 5AC8A 3N73A 3EKLA 4JEQA 2CFFA 3WJXA 2B4GA 4UNLA 4MY9A 1WQ5A 4BWLA 4DO6A 1D9EA 3PF3A 4LVGA 3W9ZA 2DU2A 3KRUA 4Z0JA 3SJ3A 1UASA 4JR5A 3FYOA 1JCYA 1ZHAA 1QO2A 1VCVA 2DJLA 3SR7A 3T44A 3O07A 5CPLA 2EGZA 4UFIA 2WNQA 1KFBA 1VZWA 1SZNA 2JKEA 4UMBA 3T78A 3W2LA 1VS1A 2Z2UA 3P5ZA 3OEXA 2TPSA 2ZZ2A 4Q33A 4IOTA 3LCXA 4JIPA 1G7VA 2B7PA 1KFLA 5CPNA 4JD4A 4RV8A 1NEYA 3QSTA 5LNSA 3FJLA 4O17A 2QKFA 2A85A 1ICPA 4MLJA 4N2YA 1T96A 5C54A 1X6UA 2BZNA 3QYQA 2YGYA 3TR2A 3LRLA 5G4WA 2H3BA 3QPZA 4JICA 5LGZA 1RZMA 4UFMA 3LHZA 3HIJA 2HS8A 1SO3A 1GVRA 3VKJA 4MIMA 3S5NA 4WY0B 1JCJA 1WDWA 3NQ8A 1D3GA 2R91A 3GDRA 1FCBA 1K7XA 5F2GA 1ADOA 1HO4A 1MO0A 1LDCA 1T99A 2YXGA 3MP4A 3W7DA 2VFEA 4NZFA 1DQXA 2ZRXA 1FQ0A 1H7PA 2GJLA 1YADA 5D05A 3O1NA 5TQLA 3FJ6A 4S2CA 2P0OA 3W88A 1F6KA 4LC6A 2Q8LA 4UUIA 3W1PA 5EL1A 1I45A 2NV2A 4O1CA 3LHTA 1GQNA 5H91A 2TSYA 4LNYA 3P67A 1A5SA 1VC4A 1G7UA 2E77A 1G4TA 2VFDA 1I2QA 4LTSA 1V5XA 3G0SA 3S8HA 3E49A 4K7VA 3P80A 2P10A 3MI2A 3DFOA 2RH9A 3FFSA 3FKKA 4W9TA 5GVJA 3U6WA 5I3IA 1NFBA 4UTTA 3P82A 2QJGA 3O6YX 4WY0A 4EF9A 1M7OA 4FXSA 1G67A 3S1XA 4I7VA 3P81A 1Z42A 2QF7A 3O16A 3NYZA 5KMYA 1W31A 4O0KA 3KX6A 5D2WA 1FCVA 1KM1A 4ZQCA 3PY2A 3L2IA 1EUAA 3IIVA 3Q94A 4PEKA 4Q4KA 4QITA 2ZZ4A 1G4SA 5AOUA 2XN1A 2PCQA 4JDBA 1VJIA 2QJIA 3N3MA 3D0CA 3DKJA 1SW3A 3W1LA 1VPXA 4RLIA 4O52A 1G6CA 1NF7A 4NNAA 1TQXA 1SPQA 1OFAA 2C16A 1MZHA 2NXGA 2FPTA 5EPDA 4DPQA 3W7KA 3IRDA 4A21A 4HN4A 5DCEA 3UZJA 1LP6A 3BK0A 3W7OA 3W1XA 4AB4A 2NXIA 2OCZA 2VFFA
chains in the Genus database with same CATH superfamily
2RJHA 5FJTA 3MYOA 4WLCA 4ZE4A 4E6MA 3CH0A 4O0ZA 3ZT5A 4OVXA 4AEOA 1I2NA 4H7VA 2NX3A 4HNOA 3DDMA 3W24A 5HR7A 2H9AA 4M81A 3S1GA 3UG4A 3CNYA 1LWIA 3V5FA 3B9EA 1F8IA 2IMRA 4PMZA 1EO7A 3GZ3A 2GQ8A 3WKZA 1EZ2A 3UR5A 2CITA 2V5BA 1JZ6A 3LYEA 3DI1A 2V63A 5A8NA 1IWAA 2OO6A 4GIEA 3UXAA 1PDZA 3F2DA 1YDVA 3SDOA 3VFLA 3MCOA 4F0MA 3RO6A 1E9LA 1EHAA 2J7HA 2XH7A 1NF0A 1R3QA 3GU1A 4B15A 1UUOA 3WEZA 4KF1A 4NXKA 3GU2A 3VUPA 2FFIA 1N2VA 2PLKA 3MKVA 1L6FA 3WD2A 1NELA 1UJPA 3SBFA 1W3JA 4HMDA 5A6BA 1U1UA 3PSWA 4RXGA 2BXYA 4Q7NA 2IKGA 4IMCA 3MS8A 2Q09A 3W23A 1POKA 2GL5A 1OGGA 1U33A 1M1BA 2CKRA 4O10A 1TYGA 1MZRA 5C70A 1CXIA 3OHMB 1Q6GA 1T40A 2GGIA 2G4FA 1I0BA 4CQ9A 2DZPA 2TYSA 3ANUA 3PG9A 5JBFA 3WQDA 1EH9A 6ENLA 4YLWA 4LCRA 3DBNA 3MZ2A 4LB3A 3MI6A 2E5DA 4J3UA 3ITOA 4E38A 5LXXA 1BTCA 5CG0A 3A22A 3L68A 1V3HA 2G4JA 4GPNA 3CS2A 3TC3A 1V77A 4CU8A 2QEZA 4ZQMA 1A5CA 2XHYA 7TIMA 4FHAA 2GWGA 5D02A 1TWDA 1YNQA 4GGHA 1W3IA 4JTJA 1J0IA 2I9EA 1Q7QA 3G1VA 4NJGA 1A80A 4KESA 4OT7A 1YXCA 2OO0A 1OZQA 1ECEA 1WZAA 3CZ8A 2Z0IA 3TYDA 2QCHA 1F61A 4JNYA 5KZ6A 2AQOA 4G9PA 1SZEA 3S2LA 3UETA 1OT1A 1Q6CA 3EDFA 3VKDA 2GLKA 1Q6FA 1BVZA 1TJRA 3KZPA 4AH7A 3H55A 3B8VA 5EA9A 5FSDC 2VX5A 4H6QA 5CAHA 2XVKA 9XIMA 3T2PA 4AG0A 5DX7A 4FLSA 2O9RA 5I00A 1PE1A 3AS1A 2VMFA 2OQYA 2J9YA 2B31A 1GZGA 5HMFA 5CC6A 4DN1A 3QPYA 1LWJA 3STPA 4FX7A 5CPQA 4E2VA 2PFHA 3NTYA 5TAOA 2VZVA 1NP0A 3TC6A 3RLVA 1IHIA 3CT7A 3TYCA 2D1ZA 2EG7A 3QV6A 3IGHX 4ZOCA 4LUIA 1U5JA 1JI2A 1UIPA 3NNTA 4HCLA 1I9CB 4PCSA 2XM1A 3DZ1A 1DJIA 3FJ4A 4IIEA 3GW3A 2DZXA 1LBFA 4E0CA 3G3DA 1CECA 3C0QA 3E5BA 1B30A 1W5QA 5I79A 4X0VA 2OMAA 1VCGA 1XYMA 3H7RA 3HPFA 5AECA 1GOXA 4GFSA 1W1PA 1BD0A 1TR1A 3BJTA 3CWOX 3GNOA 2WJEA 1SZGA 1LM1A 3WNMA 4MGGA 5A5WA 3EPNA 1NDZA 1UIOA 3B9OA 3F5KA 4I7UA 3S9ZA 5CBBA 2C19A 3GKFA 1ZSXA 3NEVA 5D32A 2VX6A 4TX8A 4B5WA 3RK8A 1K7FA 2EPOA 2VVNA 4ACYA 4LANA 1VFFA 1DBTA 2YDRA 4R9OA 3A47A 3DFNA 4EWJA 3EWZA 5FD0A 3T08A 4P7NA 1A0DA 3QFEA 5LIWX 4AD1A 5A6TC 3UJRA 4UR9A 1H3GA 4Q8UA 4U2YA 1DOSA 1BF6A 5CLTA 9CGTA 4OECA 3KP1A 3NA8A 3WDHA 2QIIA 4H4IA 1SO5A 4IIGA 5BU9A 4BR1A 3TROA 1J12A 4OUIA 3DENA 1MW0A 4U28A 2ZVIA 2QCMA 1J2BA 2PRMA 1KM2A 2R1NA 2VELA 4LUSB 3IJ6A 4MYAA 4DO5A 3AS0A 1WDDA 3TZFA 3NQ7A 2XINA 2PWUA 3C2OA 2V5CA 2PA6A 4QG6A 2YOCA 5HINA 3GVWA 4XBSA 2QPXA 3W22A 1UBPC 4PB4A 3C56A 7REQB 4IJRA 4GUFA 3DHPA 3URAA 1BYAA 4QAIA 3GVGA 3L21A 1FWAC 3DBPA 1CXFA 1SQ7A 2OEJA 4IFOA 1E6PA 2PC8A 3WIJA 1UW9A 1XDMA 5IFPA 4DX3A 3TLQA 4JHOA 4LALA 2HMCA 1UMLA 3WD1A 4P8VA 1YPIA 2CZDA 3SAZA 4IMGA 4LUSA 3UXLA 3VNKA 4Z2GA 1EGZA 3VD5A 1XKYA 3LDVA 3W1NA 5HATA 1JDDA 3AJXA 3GKAA 3W1RA 4GX8A 3DFQA 3PB2A 2V30A 2ZE0A 2BHYA 4ZBCA 2QLYA 1NTHA 3WD4A 1UUQA 2PDKA 2QHAA 2WVVB 3LA4A 1HKWA 4MWAD 1E5NA 3PPCA 5E1QA 4V27A 1XFCA 3H54A 2YL9A 5AHFA 1XBYA 3M6YA 1AQHA 4C5ZA 3ZR6A 3C2VA 4HHLA 1PAMA 1IGSA 4JNZA 1H2JA 5HDRA 1EDTA 2E09A 2A0NA 3OYZA 3RFAA 1BTMA 2X1TA 2X05A 2YDAA 4U3CA 1DV7A 3EDJA 4EPDC 5FOOA 1CGUA 3AIVA 2R24A 3DHDA 3UXIA 3KBSA 1OD0A 4M0XA 4IWWA 4JY8A 1SJBA 1HW6A 3WLNA 3AWOA 1TB3A 3QC0A 1FWJC 3W1TA 4YXGA 2WVVA 4S3JA 1PX8A 4LS0A 2TAAA 3HG4A 1B3XA 2P88A 2R82A 2G8ZA 2C13A 4MOZA 1W1B1 3OB8A 3IAPA 3VOCA 4C6BA 3L0KA 1KFJA 1ZJHA 2AAAA 1JUEA 1OYCA 2V38A 3GVVA 5BXSA 3I6TA 2JALA 1EQCA 1IR1A 4GC4A 4B5XA 1DKWA 4WZHA 4IPPA 4TX9A 2QZRA 4IQEA 4MWAE 2P53A 1C90A 4LFYA 5F4SA 3C8FA 3CJPA 4KWOA 1DXIA 1Y0EA 1F74A 1P4CA 3ORWA 2HJPA 3OLGA 3RDKA 1HQTA 3ITYA 1RPXA 4B90A 5DN1A 3H53A 4QJ3B 6XIMA 2CHRA 1V7YA 4AZCA 4AZ7A 3CV2A 4C6MA 4OZOA 2V67A 2ZRWA 3B8TA 3K46A 4RE4A 3GWQA 3A5VA 3AHTA 4WQ6A 4IM4A 2VNCA 3LNPA 3LRKA 3UEQA 3TN5A 1KM0A 2DEPA 2VWSA 3EB3A 3HJZA 1ZUAX 2CKSA 3PZGA 1XBXA 1S5TA 2X09A 3UERA 2DIEA 1A50A 3MANA 4PR4A 1E72M 3UG5A 2ON3A 2IXUA 3O05A 3RUBL 3K1GA 3UWVA 5HNUA 3HG5A 2GJPA 7ENLA 2WCAA 1RA5A 2PP3A 2WHKA 2PF0A 3WUBA 1N8IA 2X7VA 3E6EA 5AYBA 3NZQA 4YWIA 4JXCA 1JZ3A 4UQAA 4K1GA 1I4NA 3BLDA 5M2FX 2FMNA 2X30A 4N7QA 4LAMA 3EOSA 2R1MA 3MMWA 4TTGA 3UESA 1FKWA 1QI2A 4J1OA 4JQ4A 1E4LA 1VHCA 3GH5A 4O12A 1TWSA 2PU0A 2D24A 1HO1A 1R38A 4C1NB 1CI1A 3OOQA 2V9DA 3KOXA 2OSXA 2CLEA 4XZBA 1Q45A 2JGYA 3WZ0E 3RPMA 1F5ZA 1JQXA 1E6SM 3GDKA 4KBXA 1XRSA 1E4NA 3QZEA 3U2EA 1K1DA 3M43A 4A3RA 3EX3A 4H9YA 4WUIA 1E1CB 5H1WA 3SIMA 1TJ2A 3TW7A 1H7OA 1HL9A 4S3BA 4FXJA 1Q6RA 1FHVA 4Q6XA 5AB3A 5EMUA 1LYXA 6ALDA 3M16A 4RNIA 2VT0A 3OA3A 1R3RA 3LTYA 1J9YA 1UWTA 2WVTA 2I57A 2OYLA 4UFKA 4LF2A 4HGXA 3WDIA 2IPFA 2V0TA 4V1YA 1R6WA 3QHMA 1F9CA 1BQCA 2ISWA 3CIVA 4H9ZA 5A8QA 3SRKA 1TREA 2HEJA 4GE8A 4Z1AA 4C1NA 3U5UA 2CHNA 1MFVA 2YLLA 2DW7A 4BA0A 2QDEA 3IUHA 1EC9A 3NYDA 2IXVA 4RZ5A 2DPEA 4QS6A 4Y90A 3H4GA 5KTLA 2VC7A 3NSMA 1XLFA 1W5OA 4UQ9A 3KHJA 4CNTA 1B9BA 1F6PA 1E1CA 5FESA 4HOZA 1JG9A 4UB9A 1UD8A 1RD6A 3OQEA 3F4DA 1GPFA 1ICSA 2E25A 3LTSA 3MMTA 3K8MA 1E0TA 1XIMA 3M0YA 2VEPA 3K5XA 1IZKA 2Z27A 2WV8A 1XLCA 2R1LA 2E6YA 3CMGA 3BCDA 3T0AA 2B0MA 1QU4A 3HFYA 2ZBTA 5F4WA 3MVTA 3AICA 3U3HA 1E9ZB 1TG7A 4L9YA 1S3HA 2Y8KA 4EP8C 1UH2A 1VQTA 5BRBA 3T8QA 3FSUA 4DBUA 5BWAA 2DORA 3IVTA 3L66A 1CW2A 4GJ1A 1O4UA 1QUMA 1Z41A 4J35A 4OJYA 3ES7A 4FIQA 2J4GA 4KIRA 3ZOAA 1IV8A 4PTNA 1JF6A 4OE7A 3KOWA 4GCXA 2F2HA 3T7VA 3L2MA 4IFKA 2QJJA 3T4CA 2QDGA 1GONA 2NXHA 4YIWA 4H7CA 5HR6A 1W1YA 3GVRA 2OZ8A 3NPWA 1PIFA 1S46A 2DVUA 3HB9A 4ZO6A 3R8GA 4E2BA 3B8WA 3BXWA 3AMKA 1XLBA 2IPJA 2NUXA 4QG9A 4DXVA 3VCCA 1LOLA 3WBXA 3PBVA 3RLGA 3W00A 3RPDA 3TU9A 3IV8A 3WF0A 2OSWA 3RF9A 3A3HA 1BKHA 1FH7A 1W54A 2DT0A 4NNCA 2ZWYA 1C29A 3S5ZA 1G69A 1OF8A 3LV6A 3C5QA 4RZBA 3UZ5A 1OG6A 1XG4A 2OZTA 2QR6A 2PDUA 1UC5A 1JJKA 2VR5A 3FXGA 2ZICA 3M07A 3C8NA 3SY5A 6CGTA 3QOKA 2WSYA 1MW3A 1JCTA 4HSHA 3AAMA 3QXBA 3W4RA 4NX5A 3W2MA 3LERA 2JEQA 2YA0A 4XO6A 3B4UA 2E6FA 5XINA 1PX4A 1A5AA 3P14A 2W63A 1I2RA 1Q6OA 1JCLA 4PFHA 1TMHA 5BRPA 4Q8QA 3VDCA 4XVEA 4ZB2A 5CGTA 3WH9A 1K77A 2WXDM 2Z1SA 1M7XA 2X41A 3IWPA 4C6DA 3BLEA 4AHOA 3A9IA 4BEUA 5K9XA 4UBPC 4RV3A 2IQDA 1EEXA 3G1FA 1XD0A 2VJXA 3KOZA 4ILSA 1JQVA 3O63A 4INFA 1VFTA 2BY2A 2EQDA 4CN6A 3SCPA 2Y62A 2YPIA 4UTFA 4GIRA 4MZYA 4Z08A 3GXFA 3LY0A 5I6SA 4BS0A 2OZ0A 2V81A 4LVAA 4HYVA 1OHLA 5C2XA 3ARPA 3I6RA 4DAIA 5LIXX 1XW8A 4CCEA 4W85A 2DFAA 4DUVA 3MZNA 4O1BA 1NOFA 4IG2A 2V68A 4EOUA 1SSGA 1LT7A 4H9UA 2OOFA 5K7JA 4K6AA 1DP0A 1SZFA 3TK7A 1KBIA 3VD3A 5C9WA 1KCXA 1KV5A 3S0CA 2IKHA 1FWCC 5F2MA 1KD0A 4Y96A 5E9AA 2Q71A 1V6WA 3EWWA 7A3HA 3CT2A 1BSLA 3HA1A 2IQTA 4TUFA 1A3WA 1YTKA 5K9CA 3BGJA 3B8DA 1ITQA 3AXMA 4X2RA 2NUWA 1CXLA 4JTFA 1TIMA 5C2GA 4LUJA 3T0CA 2QUTA 2FDSA 3GC2A 3I3DA 3PZQA 3LPFA 4LU0A 4J28A 2W0UA 1BF2A 3ZLFA 3ITTA 2BP1A 3HBLA 2Z2BA 1B9ZA 2HVMA 4RX0A 4P2VA 3G1SA 3VUSA 4JTAA 2QUNA 1X38A 1LLOA 2QW5A 3TE9A 4A8LA 3WNPA 3SCQA 3MUY1 5A6BD 1BG4A 3ZIZA 1JYWA 2POZA 5FCZA 2UZ9A 1XSKA 5DMMA 1UG6A 3SQSA 5C9RA 2D2GA 3AUOA 2IS7A 1LUCB 1XRVA 1OY0A 2P76A 1XYCA 3KTSA 1EDQA 4Y8FA 3W27A 4OOZA 1EXPA 4JYFA 4CKQA 3L23A 1DEDA 1W9VA 2A7NA 2P5NA 2C0HA 5A6AA 4W8LA 1GYNA 1EYEA 3UVIA 2INEA 4FX6M 2CBVA 3B8IA 3E74A 3C2EA 4F9DA 3N13A 3UR8A 4D1JA 5D04C 4GABA 2NT1A 2DZSA 2EHHA 1Q65A 2CNCA 2CXGA 4K37A 3DG3A 3S2MA 1R85A 3H70A 3UZYA 3HFTA 4NXSA 1WZMA 4AHPA 4LS1A 3ITGA 1P0BA 3PUDA 1LUCA 1XINA 2XU2A 1KWKA 1SMAA 2VQTA 2HK0A 3VKCA 1TZZA 1XLAA 4Q7IA 4DBSA 2CZEA 4NSBA 1X7FA 3NR0A 2R94A 4WOQA 1C9DA 1ZLPA 3SUVA 2WHJA 3R11A 3ZSSA 3WLRA 5LNWA 3MJYA 1VEOA 3B0PA 4HQVA 1J93A 1L0PA 5FJIA 3E38A 4A8IA 1XPGA 4LAUA 4Y7EA 1FWFC 1IWBA 1CPUA 4LCQA 1OT2A 1E6ZA 4EF8A 5ABGA 1YMYA 1W5NA 4I9TA 3GBEA 5EU9A 4QS5A 1FWRA 4S3AA 4HOXA 3BG5A 4FF5A 3GTXA 1OCQA 1X39A 3KTXA 5FJRA 1PZ1A 1ZP3A 3QJAA 2BOEX 3G24A 1XCFA 3T2OA 2DZVA 1OBAA 1IT0A 3VMNA 3THUA 4AZGA 2GSEA 1ME8A 4GQ0A 2FJKA 4V2XA 2CBJA 3PB0A 3STGA 1J5SA 1H41A 4H04A 3VDHA 2WNNA 4JTEA 1DQWA 5EFDA 5A94A 1XBZA 4F0KA 1OABA 4ROQA 4OIFA 3CMFA 1MFUA 2ZYFA 3GDTA 1XYBA 3O3RA 4RUBA 4LYPA 5CSUA 3MU7A 1YQ2A 3GFYA 4D6IA 2J75A 1KXTA 3HQOA 3HO8A 3WJYA 3W28A 3TTEA 4ERAA 4PMRA 4ORMA 5FF3A 3PZOA 3UXKA 5DT5A 4UTWC 1F05A 3H4XA 1US0A 3WMSA 3BOXA 1L8PA 3AUJA 2FIQA 4Q4SA 3SURA 2PURA 3AS3A 4YCOA 4I5UA 3KAOA 4PZVA 1QNOA 2BG5A 1G94A 1F4HA 1NSJA 3BG9A 1VF8A 4O1DA 4X61A 4US6A 3H2CA 5DXYA 3FA3A 1XRFA 5FAGA 4GACA 2ABBA 4QE1A 2WZIA 4ZFMA 4L64A 3VINA 1TMLA 1TV8A 4ADSA 3O06A 3OIHA 5ABFB 3FSTA 4HKPA 5EBUA 4C6FA 1TZ7A 5DLCA 1VH7A 3VIPA 4PCPA 3CASA 3UD6A 2ZZ1A 1PWLA 4BQ3A 3I6EA 3JR2A 2ABAA 4B4FA 1H09A 4LAOA 1DVJA 4YWSA 2D0GA 3ABSA 2PD9A 4Z2LA 4CQBA 3SJNA 1PYMA 2G3JA 4HBKA 4LY8A 2VENA 4QQ3A 2VZUA 3WLLA 3PR2A 4NZJA 3W75A 4IXXA 4GY1A 3TJIA 3V36A 4GG9A 3CV1A 4M80A 1VEPA 1ADSA 3N25A 2PE4A 3IAQA 3M0MA 1OINA 2CZFA 2EG6A 3AZRA 3HOJA 3FOKA 3LG3A 4BKNA 3HGSA 2I56A 3R2GA 2OJPA 4U5KA 1OC7A 3BARA 5T91A 5ABFA 1DWIM 1FWGC 1QNPA 1K9DA 5I24A 3CV6A 1S2UA 5I03A 1WOAA 4FB7A 2LLEA 1F7BA 1TSIA 5MF5A 1JPMA 2Y63A 5HNTA 3LCWA 4FXRA 4LYKA 3V16A 4HVXA 4J9JA 5IBXC 3W71A 2J8GA 4KWSA 1JPDX 2I9UA 1UP3A 1JNDA 3M0HA 2BHUA 2YBUA 3B06A 1O94A 4U2ZA 1DJHA 3IIXA 3LEPA 4MHBA 3NSXA 3GHRA 1IXPA 3QQWA 3LCLA 3ID7A 4I5RA 1P6WA 1I2OA 4AXNA 4ZSTA 2PRLA 1TV3A 5A6SA 1HKMA 3NZRA 1XIFA 1GJUA 4N6FA 4N9EA 3I68A 3WK0A 2CEQA 1QI3A 2PDXA 3UWYA 2XN2A 3KBWA 3P6LA 1OFOA 3Q37A 3T55A 4HMNA 1LF1A 1QW7A 3L4VA 3MUIA 1H1ZA 1AFSA 3LXBA 3QOMA 2YA2A 1R86A 1GG1A 5B80A 1Z48A 1W3KA 3M0XA 1KBBA 5HMSA 4I8DA 3WLPA 3LPOA 5FEXA 2Z26A 4NT0A 3FDGA 1WUFA 2QCGA 4RPPA 2JQXA 3CUHA 1YEYA 1BGGA 1QWGA 1MYRA 2F9RA 2Q01A 2B7QA 2E9LA 4N6EA 1V3MA 3ZYZA 3GUWA 1WAUA 3N73A 4JEQA 3PNUA 4U3AA 2PPGA 1UD5A 1MDLA 1WDQA 4UNLA 4L80A 1WQ5A 4WKFA 4DO6A 3FV9A 3G1RA 1C3FA 3PF3A 3DGBA 2DU2A 1KR1A 4RE2A 1IYXA 3FYOA 4ES4A 4QP0A 3SR7A 2VZSA 1PBGA 1XYFA 1VZWA 3OA5A 3RCNA 2JKEA 5EMYA 4AEFA 3OEXA 2TPSA 4XZNX 3LCXA 3EA3A 1G7VA 3ZM8A 3WF2A 4JD4A 4RV8A 2FH8A 3FJLA 2XZ7A 2ANUA 3ZJ8A 1XCWA 4IMAA 2A85A 1ICPA 2DSWA 5IHRA 2EJAA 1X6UA 2BHZA 4GVGA 4G7FA 3LRLA 2GDUA 2ZUVA 5HMDA 1UWIA 5LGZA 1L8NA 4A4AA 4UFMA 3N29A 3VKJA 2C91A 1TWWA 1S2AA 2WLZA 1JPHA 3L4TA 1QNQA 1XD1A 3DYPA 1XGEA 3GTHA 4NHVA 2R91A 1AH0A 3E2VA 3IK4A 2REQB 9XIAA 2HROA 1PKLA 3R25A 5F2GA 1LDCA 3W7DA 1FHLA 1RAKA 1DQXA 1FQ0A 3SRDA 2GJLA 1YADA 2D22A 3RJXA 5TQLA 4S2CA 3W88A 1BXNA 1XH2A 2CCRA 1KXQA 4CEUC 2NV2A 3G6MA 3CB3A 4O1CA 3LHTA 1BYBA 4A3QA 2TSYA 4RNFA 1VFLA 1VC4A 1JPIA 1G7UA 2VCAA 3AWNA 1EYWA 4BQ5A 4YYCA 4PN2A 3TTOA 4K7VA 1TIWA 2W62A 1E4IA 2CC0A 1WO2A 1BYCA 5A8OA 3WBWA 3LPPA 3L4WA 2PS2A 1G67A 3PAOA 1QHZA 3AYVA 2ICSA 4I7VA 1AD4A 3APTA 3P81A 2REQA 3O16A 1M3UA 5KMYA 1RY0A 3KOYA 3RM8A 3KX6A 5BOEA 1Z69A 3IIVA 4DRSA 2XYLA 4IT1A 4R27A 4PEKA 1CLXA 2ZZ4A 1G4SA 2OWXA 3PFMA 1J0KA 1UWUA 2XN1A 3CQIA 1IR2A 1EC8A 2F6XA 3ZR5A 1SW3A 4ZXOA 3W1LA 4CN1A 1XRTA 4QLJA 4V33A 2FPTA 5EPDA 3IRDA 4HN4A 3AIQA 2E67A 1BVWA 2VFFA 2X1UA 4MM1A 2F8QA 3GK0A 1ZY9A 2QJHA 3OJGA 1J6PA 3TN6A 3VGEA 3WUFA 1KCLA 3EWUA 2EO7A 1VHNA 2WHMA 2WMGA 2Y0FA 2YL5A 1E40A 1QTWA 3W6YA 5EBAA 5BMXA 2GFTA 3C0JA 1TWZA 4GJIA 1WE5A 3IIZA 2HPMA 3BO9A 5CZSA 3AHVA 2E1DA 3FCPA 3HURA 1PS9A 3TWAA 2VKZG 5I23A 4I90A 5FI8A 2GYIA 4ZCWA 3OVQA 5C55A 1FCQA 4HP5A 3BCFA 4YCPA 4HU3A 5M17A 3W7RA 5TNVA 2VFGA 1OFDA 3ZXWA 1C8YA 4POCA 3S2JA 3FNDA 3L67A 1F73A 3OG3A 4WSKA 2DW6A 3CHEA 4XSLA 1NJJA 2VP8A 3OLEA 1C8QA 1NARA 4L56A 1C8VA 1JXJA 3T0DA 3AZTA 4XX6A 4IFRA 5AC7A 1OIMA 3VGFA 1UKSA 3KVMA 2X40A 2JEPA 1XUUA 1YDYA 4XTIA 3VGBA 4H7ZA 4FS9A 1V93A 1PHWA 1KM4A 1VYSX 2VL4A 4DBEA 2BXZA 2Q8ZA 2XSAA 4YVPA 3LHVA 5CKSA 5AHLA 1B3YA 2G96A 4IP7A 4DNHA 2ATSA 4AZ5A 2GVYA 3A4WA 3C61A 4H83A 3P84A 4X9SA 3DHUA 4QEEA 5C7HA 3TYAA 2CBIA 3CUFA 1XIHA 1IF2A 4KFPA 1WZLA 1VLIA 2WMKA 4D8AA 1MW2A 5CJMA 3PN8A 1CEOA 2E7FA 1X8FA 2X0SA 1FKXA 4PBEA 4BI5A 4Q8WA 1GVEA 3M7SA 1IE7C 1XQLA 2OX1A 3CO4A 4IPIA 1RSCA 3ANVA 2X42A 1GVYA 3QVQA 3MP3A 4XZIA 3N9RA 4XWUA 3H2AA 4DJEC 1WXYA 3O7UA 2FHFA 4GVHA 4CD5A 5HXMA 3KFTA 3UJ2A 2VHLA 5E6YA 7CGTA 5FEWA 2CHOA 3ES8A 2BFGA 1I8JA 3CUIA 4JFSA 2XDFA 1PTDA 2D73A 3FIGA 2WZHA 2CERA 2XFWA 4O1AA 3TSMA 2PWVA 1EJUC 1MQRA 4FNSA 1MEHA 2Z1VA 1AA1B 3HPAA 3GRIA 4AMAA 2J7FA 3UR7A 4LGXA 5ENLA 4J3WA 2VC9A 1VBGA 4ZENA 4JGDA 4PMJA 1Q3NA 2O55A 3NPUA 1SW7A 2YR1A 1KFCA 2XFRA 2NSOA 4NZ3A 4QFUA 3SCSA 4C6KA 2R14A 5KSWA 3RILA 3NQCA 3FX4A 2XUCA 1EP2A 2NV9A 3T81A 2WKJA 1OJXA 1D7FA 1ZNNA 1GKQA 1PZ0A 2W92A 4XG1A 3WLTA 1AL8A 4G1KA 3MBFA 1VFOA 2Y70A 1TUFA 2F6UA 3AXHA 4M24A 4JIHA 1XJBA 2A3EA 3WL1A 4UR8A 2DGAA 5HA7A 1WP6A 1MMFA 1B1YA 3W73A 3BV7A 3FN9A 5E6ZA 4OU1A 4AX7A 2BGNE 3HQ1A 1H7NA 3FGCB 4FMVA 1EA9C 1LLWA 2OXNA 1DE5A 1FVPA 4MJMA 4MB3A 1H0GA 2ZKMX 1QAPA 2XIQA 4BHYA 4G5DA 2JKAA 5F1UA 4AC7C 4MLRA 3G3MA 1V3JA 1W6TA 1AODA 3LI1A 3WYZA 3NDYA 2FZ9A 3TXVA 3ZT6A 5A6JA 1E3ZA 2FMOA 5CBIA 3O0KA 4K8HA 2Y7DA 3DFYA 1BHGA 4L9XA 3AIWA 2Y7GA 2W66A 2D3LA 3VNDA 4GRSA 4JAWA 3NOEA 4Y9PA 5I3HA 3U57A 1KFKA 1JRCA 4IGMA 4I9JA 3UR2A 2HZGA 3EDDA 3JU2A 1FXQA 3R12A 2H6RA 4J27A 4LF1A 2BVDA 3FGCA 4BK9A 3GS6A 4L9ZA 2FDMA 1JXKA 2Y6ZA 3V75A 3TMLA 5LZLA 3W53A 1AQMA 3TSDA 3G1XA 3W38A 6TAAA 1REQB 4CU7A 4MZ1A 2G3MA 2UY3A 3G1DA 1I1WA 1YXYA 3ZFHA 5FJJA 2QS8A 1GYMA 2YX0A 3GHSA 4DVOA 1QVBA 2VDIA 2BV9A 3G1AA 1UBSA 3FVDA 3BMXA 3NURA 2DZBA 1RLDA 3W84A 3ARTA 1DQUA 1AW5A 5K3VA 1ZJAA 3BURA 4ZVJA 2OT1A 2X2YA 4BZYA 5D03A 5G4HC 1TTPA 2EEXA 4AEEA 1F76A 4G6CA 1ZBVA 3GH4A 2CETA 4A35A 2O7QA 4UQDA 1H5VA 3HPXA 4UWMA 4E2OA 2GZXA 4KRZA 4GXMA 5E5CA 2WM1A 2FGZA 1IEIA 3CM4A 4EIVA 3BW3A 3CLWA 2Z28A 1RBAA 3WH8A 4WJ8A 3B8UA 2OYMA 1EX1A 5FKYA 3S83A 4GKTA 1REQA 5LNUA 3VMPA 4GY0A 1JCNA 3G5EA 1PDYA 8TIMA 6PTDA 1VB9A 1SO4A 1N7KA 2QXWA 4FF7A 1OFBA 1ICQA 2XVNA 2OWWA 3UW6A 4PUWA 2YDQA 2SFPA 3INPA 5HPOA 2NQ9A 4NNBA 3PS7A 3RNDA 1RD5A 3QPEA 1R7OA 1YW1A 2X16A 3HQPA 2D3NA 3JRKA 2RUSA 4GKLA 2Y8VA 3LHYA 2X1RA 1YLVA 4DI9A 3WQCA 1J6OA 3QR3A 1ITXA 2R9RA 3M5YA 4NILA 4J3ZA 3JW7A 3LQLA 3CZLA 4E8DA 3EOLA 1L6GA 5A8GA 3RR1A 4ZA0A 2PDIA 3AMLA 2HXUA 3SQMA 5C2CA 1SFTA 5D37A 4S39A 1YPFA 3F4WA 3MYPA 3UVAA 1WA3A 2V3GA 2Z6JA 4AUBA 4BFAA 3WG6A 3GNXA 5EKYA 4FNQA 3WF1A 1OEPA 3O6AA 4B91A 1GWJA 2AQWA 2ADAA 2WVSA 1EA0A 3ARWA 3WD0A 3MMDA 4D6GA 1O12A 1UHVA 1F6YA 4L4OA 5T8GA 3W87A 1FWHC 1PPIA 2VR2A 3EWXA 1I2PA 2ZDRA 1DXFA 4ZOEA 5IHSA 3CQHA 4RJEA 2OU4A 1LT8A 1YTDA 3EX6A 4GQRA 2PZ0A 3GHTA 2TRSA 5PTDA 3IUDA 3BSMA 3NPVA 4HA1A 1UZDA 4F48A 2ACSA 4UTWA 3WF4A 4IJCA 3TJ4A 3QLLA 4J40A 1VP5A 4TV6A 3UWEA 3GFXA 2BY0A 1F07A 3L5LA 4JTCA 3BMWA 1D8CA 2E6AA 4HB7A 4E4UA 1ML1A 3LBCA 4GINA 4MY8A 5K2ZA 3M7WA 3KS6A 1AUSL 4JKKA 3VGDA 5ABHA 3VD4A 3S6DA 2YCJA 1GJPA 3TX9A 3QMTA 4HOWA 4HHPA 1AJ0A 5G1TA 4ZE5A 2W5FA 4QNEA 2PWFA 1MI3A 2IKJA 2BVTA 4P7OA 1JGIA 1JL8A 4H9TA 3RN6A 3V1PA 5FEZA 3B0VC 3PTKA 5AYIA 4AYSA 3W3OA 2PZNA 3DU0A 3TFXA 5A69A 3H23A 4XO7A 2ZXAA 2QJNA 3AIBA 3W7MA 4ZODA 3VOFA 2I7GA 5AC5A 4WXZA 3T09A 1HVXA 4TQTA 3RU6A 2FVKA 4TU1A 2QDHA 3REQB 1U30A 3MHFA 3SUTA 3IUIA 4JN7A 2ZZ7A 2HVNA 3TDFA 4ML9A 2W4XA 3ARUA 5E0KA 3WQ6A 3NAVA 4LW7A 3WFLA 3WJSA 4DZIA 2ZC1A 5J04A 3B4YA 3G0XA 4AWUA 4O54A 3BGAA 3TTYA 3ELFA 3EEGA 2UV8G 4KEUA 3LGDA 1Y7VA 2F84A 2I14A 3FY1A 4H8UA 3H2FA 2JE8A 3R0KA 2NVAA 3AIRA 3EXSA 3O8AA 1E73M 2I17A 5IBXA 4GYPC 1FX6A 3CZEA 5K4ZA 5RUBA 1A5KC 2VC6A 4HPJA 4PL2A 1J4EA 4HPXA 1XYLA 3IGUA 3E2RA 1EJTC 1EIBA 2J74A 2ZA3A 5J8LA 3GR8A 3N12A 1JYVA 4HMEA 3ITLA 3REQA 2PSNA 4C7FA 3RYSA 1E71M 3B03A 3KCJA 2PRHA 2GSJA 3GX9A 2Z29A 1EJXC 3I65A 1QNRA 3WLQA 1FDYA 3FK4A 4EPBC 4MUZA 3IARA 2Z1XA 3CO8A 4M51A 2G97A 1YNPA 1JD7A 1YXDA 5G1YA 2DVXA 4RK8A 4S3KA 1C91A 5T26A 4DYJA 1AZ1A 2HBXA 3JZUA 4RPQA 2ESCA 3FEMA 3ZWSA 1BRLA 3AXIA 2I5QA 3TSBA 1YX1A 1HKVA 3BAYA 3S9IA 4PA8A 1B3ZA 2QCLA 4PH6A 1B3OA 3BZGA 4E3TA 5E09A 4PUNA 4MNLA 2AAMA 3I7SA 3FAXA 3L12A 4IX0A 5XIAA 4C60A 4TV5A 3AYTA 4NQ1A 3FVMA 4F0SA 1DJZA 4KERA 1UR4A 3S9YA 3GBDA 1UP0A 3T0TA 2HDJA 3BQ6A 3AXXA 1W1IE 3WK2A 4UZSA 4BEQA 4AMCA 1QOQA 1UKQA 4MVAA 4MMWA 3ZJ7A 2ODOA 1XWYA 1K7EA 1TPH1 3WQGA 4N9BA 5L6UA 4WD0A 2PLMA 3ECQA 3V0UA 3TLLA 1RBLA 2VEGA 2YIHA 1OZMA 1E43A 1E51A 1CENA 3W02A 3CXOA 3WQPA 4V15A 4GA8A 4XV0A 4S3DA 3CL7A 4ZEPA 2ZUNA 2WMIB 3N9KA 3U7VA 1KO0A 4O11A 1UOZA 3PPGA 3WDQA 2VWTA 4JN8A 3KL0A 2R6OA 3OVPA 3VDGA 4BI6A 4GNKB 3PP7A 2GPTA 4HJWA 3LB0A 3R7MA 3QBUA 1ELSA 4OKDA 1E55A 1RUSA 2OGJA 4ATDA 3QR0A 4A3YA 1GT8A 1WPCA 1L9WA 1H49A 3VNJA 4MY1A 1WBHA 3LLDA 1RCQA 2PTZA 1B5TA 3W2JA 4QM1A 4P5UA 3CGTA 4V1XA 4LEFA 3E0IA 3UQNA 3IJ8A 3CUGA 3TIMA 4K39A 5HNRA 4XBJA 1AMYA 2DP3A 2F7FA 2AMXA 3P8JA 3KRSA 1GVSA 1R0MA 3CK5A 4PUMA 3N2TA 3EEZA 1RVKA 4QSFA 3CB8A 1EBHA 2AL1A 1OX5A 3Q4DA 3N11A 3QGAC 1OIFA 5GNZA 1S5WA 4PL1A 4IP4A 3P74A 7TAAA 4DY1A 1JPKA 5AVHA 3SRFA 1EBGA 1U5VA 3QMRA 2Q02A 3NG3A 3CYJA 4EXQA 3WLOA 3UP8A 2WZMA 4C7DA 2QCCA 4Y9OA 5JH2A 1QNVA 1ISXA 3TXZA 3KDOA 4IICA 3CHCA 1OG0A 4PBGA 1QMLA 4CQDA 2YB4A 1DL3A 1ENUA 2EAWA 1WXJA 4XD3A 5IDZA 1LRTA 1P6CA 3RMJA 2BSLA 2J8FA 1RJPA 2YCEA 6REQB 4ZR8A 1EJ7L 2DZAA 3CAWA 5C8BB 1LQ2A 1V8EA 1U83A 2A3HA 3NQGA 2BY1A 4W4QA 4F0LA 1KTBA 3PTDA 4CD4A 2B7OA 4DYKA 4LOCA 1TRIA 7XIMA 4IX2A 1HL2A 1ZS2A 1P0KA 1QPKA 4CCDA 3GM8A 4TOQA 1AD1A 1VCFA 2POTA 1XC6A 2OSYA 3W26A 2Y5SA 2Y85A 1N55A 3M5VA 1D7KA 3R0UA 1MQQA 1R2SA 2DH3A 1C7TA 2OR2A 4D8LA 1KWGA 4Y9MA 4FAMA 5ABEA 2VEMA 4JTTA 4D6FA 1JI1A 2G37A 1HTIA 4JX5A 2PDNA 2PBOA 4LEQA 1MUMA 4K38A 1THFD 1KM6A 4W8AA 3W2NA 1PX3A 6REQA 4MYXA 3ERPA 1L6WA 3W1UA 1O60A 1K02A 1W5PA 1XFBA 4ML4A 4AZBA 2CLKA 3S47A 1OK4A 1BEUA 4GK8A 3E0WA 4QSHA 3K4DA 4XISA 4CQ8A 4GYFA 1YKWA 4ZOBA 5CC3A 4PMDA 3W82A 5A2AA 2WYSA 3VOIA 4IJBA 2J7DA 4ZQOA 3GG7A 3KVKA 2PGWA 2ZADA 1BAGA 3M0VA 1XC4A 1W3HA 4PTMA 1NM9A 3PZ9A 5I7GA 5H2ZA 3JVAA 1VJZA 2W67A 4DEFA 3N6JA 2OWCA 1GW1A 4Q4QA 2BVYA 1VBUA 4F2UA 2QYGA 4QTGA 1SFSA 4F8XA 1RQEA 1KTCA 1DJQA 1XYAA 4M6PA 1BXCA 3IGXA 1LG1A 2NX9A 3NL2A 2KX9A 2J9ZA 4YN5A 4Z2JA 3WSUA 1DIKA 2FB3A 2ZWZA 5CGMA 5REQB 4HNCA 1QW9A 5HOSA 2OEMA 4NI3A 3AMCA 1TE1A 4UMAA 1DTUA 1UD3A 1VFMA 5A8MA 2R1KA 4FLOA 3LTPA 2PGRA 3E2QA 2BDQA 4MNJA 1M7PA 4DI8A 1RP9A 2WMFA 3GR7A 3N14A 1EF3A 1UZ1A 1SSDA 2V2CA 4CNOA 3MPGA 1QXLA 3DXIA 4X63A 4US5D 2NWSA 4AQLA 4DYEA 3UCCA 1Q66A 1MEWA 3ITXA 1TPUA 2J6XA 2VOTA 1IIGA 4O15A 1ECQA 2R1PA 3A3WA 4P7LA 1TRDA 3BSGA 3USBA 2GGHA 2DUAA 2G3FA 5REQA 5F7UA 2VTFA 2ZOXA 4X2PA 2C6QA 2HPIA 1FWNA 4OGZA 1QPRA 4DJEA 1B54A 1GTEA 1XISA 5I07A 1V0NA 2QULA 3SUUA 3GY1A 2FPYA 1MDRA 4Y9AA 1AZ2A 2DQXA 3Q67A 2GUBA 3TYBA 2ZXQA 3WENA 1YHTA 2ISDA 3DIPA 2V6AA 1EZWA 4KS0A 3EAUA 3LXAA 2J7GA 3AXKA 3QSRA 3U2OA 4ICCX 4MNKA 4UFHA 4IPNB 2GK1B 3GXIA 3NVDA 4QJ5B 5CXPA 3GHUA 5I3GA 3S42A 4A22A 3RX3A 3NPXA 4UC5A 1JYXA 3P5YA 1DWGM 3CYVA 1R47A 4JCMA 1R2RA 3DFTA 4IGNA 3WFAA 4CN4A 1ZPTA 3N17A 3VK5A 4LVFA 1S5MA 2ISVA 3QN3A 5FAJA 4GI9A 4O16A 2RKXA 1R2TA 4D6CA 1QT1A 4I9MA 3QM3A 3VKBA 3UJFA 1VEMA 3VIMA 1B0IA 3NQVA 1KLZA 4PFMA 1X1OA 1MW1A 4ZFCA 2D20A 2PEVA 2GK1A 3BANA 4H19A 4QISA 2ZUSA 4UOZA 3BH4A 1HF6A 1FHDA 4FNPA 5DCDA 4C6IA 1OYBA 5JUVA 4UNIA 3NVTA 4PE8A 2PUZA 3D6NA 4GQQA 1WNOA 1JEZA 3N6QA 1ZCOA 3AHZA 3U2ZA 1FHUA 4MAZA 3GVQA 4CCZA 5M1TA 3KW3A 1G4PA 3S1VA 3T40A 2E9BA 1IEQA 1QR7A 4LUYA 1MRAA 3CWHA 4H2CA 1DE6A 2ATMA 4MAVA 4UTUA 3GG8A 5DCBA 2O9PA 4GZEA 1ALDA 3XINA 2QMJA 4Y6GA 1K9TA 2HV5A 2QQ6A 3W7CA 4DIAA 2AKMA 2VRJA 4IUGA 3KL5A 4Z1DA 5DANA 4E4PA 4M1BA 1M04A 1P0NA 3WELA 3N15A 1EFZA 4N02A 3VAVA 4NYYA 5HPCA 1Q8JA 1QBAA 1M7JA 3TNOA 1XIIA 3W7PA 3GIPA 3TONA 5KZMA 3BOLA 1K6AA 3AC0A 5IM51 3LS9A 4LCSA 4I8YA 2ZC8A 3SY1A 4JTSA 2Q3OA 3BW2A 4ADTA 4EXBA 1EHNA 1R5YA 4I6KA 4HYWA 4YTQA 4GMEA 3NDZA 3VIHA 4JFWA 2PDYA 4XSMA 3OG2A 2PDJA 2YFOA 1HXJA 3CZKA 4DJDC 3LMZA 1ZCCA 3COTA 3OU8A 3V35A 5CEWA 1Z89A 4JYEA 1TA3B 4HNLA 4WK9A 2J66A 1XCXA 3GG1A 4IHCA 2DSUA 1SMDA 4OHQA 3TUUA 1HFBA 1KNWA 4Z42C 2J6VA 1TE6A 3FYYA 1FWWA 5CSYA 5FL0A 4TMCA 3TAOA 1ISYA 4D72A 4XKMA 4KCVA 5HUPA 1V02E 2OB3A 3BVJA 4DUOA 4Y8EA 2DDXA 1GVOA 1RJRA 1IWPA 4H3DA 3NQ2A 3RX2A 2JFEX 5AYYA 4UOQA 3EWCA 3UF9A 3WK3A 3IIOA 3WLIA 3EA1A 4Z1CA 4UTKA 3QEZA 2RDWA 8XIMA 4CNNA 2C71A 2DIKA 2QCDB 3CV7A 1GOKA 3W7GA 2J78A 3G8RA 1MQPA 1W0MA 2VO5A 4WXYA 2ZUTA 2F38A 3TQ0A 4F40A 4N0RA 5MHBA 1ZENA 2ISSA 4CD6A 5EMJA 4R34A 3R10A 3TYEA 1GCYA 1ZJBA 4JQAA 5HQLA 2BXVA 5DBUA 3KCOA 2HE5A 4Q8TA 3TW9A 1YDNA 1AQFA 3BW4A 3HGJA 5AYXA 3PBYA 1K8YA 3UT0A 4QXIA 2P8CA 4WKAA 2YDSA 1IZJA 1FH8A 3HU7A 5LSMA 1MXGA 2XTKA 1BPLB 3G18A 4QEHA 1Q7MA 3AFBA 5F2LA 3IGSA 3PZVA 2EBNA 3WO8A 3URNA 4A2RA 1SFLA 1VBHA 1HX0A 2ZFAA 1TPFA 3EB2A 4N9DA 3MVIA 3H7VA 3M6DA 2VUYA 4E3VA 1U5HA 3KXQA 5ECUA 1XGDA 3WQ4A 3EX1A 1QI0A 1CIUA 4LXFA 4N4QA 3POHA 1S1PA 2FTWA 4LBRA 3UZZA 4LH8A 5A3HA 5AC4A 1KLYA 3SZ8A 4HIBA 2FPVA 1YRRA 3VFCA 3EKLA 2CFFA 3SADA 1BLIA 4MY9A 2WMHA 3NZGA 1WKEA 4LVGA 1A5LC 1RJQA 5FL1A 1ZHAA 2DJLA 3UG8A 4LBSA 1E1FA 2WNQA 2AL2B 4Y9NA 3VX0A 1SZNA 3K2GA 3T78A 4LJ3A 3W2LA 4GJJA 1UQYA 2WWDA 2WC7A 2ZZ2A 4Q33A 4FPSA 2AGTA 3BAWA 1KFLA 4CVWA 3QSTA 1IEXA 3RU8X 3HTWA 2WC3A 1LJYA 3A4AA 5HMEA 4MLJA 2OYKA 5C54A 1Q85A 1UOKA 1CGWA 4XIMA 2CXEA 2D2JA 4L4PA 2C8NA 1VFHA 2H3BA 3EGJA 5B7ZA 1A3XA 1X7IA 3FEQA 3ICJA 2HS8A 1JCJA 1I0DA 4S3CA 4ZB5A 8RUCA 4Q8NA 7REQA 1WDWA 3R6IA 4HPHA 3UYIA 3GDRA 4DO7A 4RW5A 1K7XA 2AL2A 1RK5A 3GQYA 4HTYA 1TWIA 1DHKA 1T99A 1ADOA 3K4AA 3MP4A 3OZOA 3RRXA 4NZFA 1TVNA 4D6DA 1DPMA 2HISA 4NRSA 2WCSA 3FJ6A 1GZJA 5T9BG 3V5CA 1UA3A 4UUIA 3W1PA 5EL1A 4GYPA 4NZ5A 3BAKA 1A5SA 4TX6A 3VIOA 2E77A 1UWQA 1ITUA 3E49A 3P80A 3SCVA 3DFHA 4GI6A 3MI2A 3TP4A 3FFSA 5BXRA 4W9TA 4GGBA 5GVJA 4GYJA 3S6OA 1CBGA 1US2A 3WLKX 3GTIA 2WSPA 2MUCA 2WMJA 2ZIDA 4K1WA 4LPCA 2F6KA 4NZ1A 2OQLA 1OC6A 4ICMA 3PBMA 4Z17A 2FVMA 1EUAA 4XAPA 1S3TC 3Q94A 1TV2A 1RALA 1PIGA 4WJXA 3L4YA 5AOUA 3AYSA 3OGSA 4NAFB 3PJXA 3ZLGA 3N3MA 3D0CA 1VPXA 4RLIA 1G6CA 1NF7A 1A47A 1TQXA 4CD8A 2C16A 3TTQA 1PUDA 1IT7A 5DCEA 4M29A 2XGZA 3W7OA 2VVSA 3W1XA 3LZ3A 4B3ZA 2XGIA 3PM6A 3OHIA 2A21A 1JVNA 1ESWA 1Q4NX 3WNNA 4GY7A 2QAPA 4C90A 1IGWA 2C1GA 4OBTA 3B0XA 1SO6A 3ARSA 1JDCA 2HXTA 5G2HA 2XH0A 3SO7A 3W37A 4FOKA 1H0IA 4ZQNA 2VQUA 4O4WA 1M68A 5K4XA 2FZNA 2XVLA 3A12A 3GU9A 3ZVHB 3T42A 4M5PA 1A4LA 2VCCA 3BOFA 5E0CA 3EPMA 4NAFA 2YA1A 1RK6A 1Q6QA 1VD6A 4LT9A 2Z2AA 1UR2A 3SM0A 4YMZA 2ZZ6A 3DFPA 2EKGA 3ZS4A 2Y8UA 4JDYA 4O8RA 4A8NA 4JHMA 3WBEA 4PB5A 3LNMA 4ECLA 3VPLA 2W6RA 1IT8A 4XTDA 3BV4A 1FWDC 1VLWA 4K8EA 4ZOAA 4XD5A 1UH4A 3SQLA 2QUMA 1C93A 3AALA 1KRMA 2FFCA 5CPOA 2XVGA 1GOOA 1JYNA 1ODUA 3GXNA 4KT2A 1AJ2A 4BQ4A 5ECVA 4PMQA 4JTHA 3W0KA 2PTXA 3LHWA 4IGHA 2PLJA 4L6DA 3BWWA 3E3HA 2E9MA 5FJOA 3M9YA 2YFNA 3MQTA 1SU5A 1EOMA 3WQ5A 1PKYA 1VIWA 3TOPA 4MJZA 1Z32X 2WPBA 3TZNA 3A5FA 4AWSA 2J77A 2OOGA 2YLAA 3KUMA 2FGLA 2VD9A 1AK5A 2BODX 4N4PA 2NQJA 2GDQA 4RNHA 4GVIA 2OKTA 3KCLA 2C18A 3QW4B 4CCCA 5C9XA 3EMCA 3TQPA 1A5NC 5D38A 1Q2RA 5D2YA 2FB2A 3SN4A 3VE9A 2ZA2A 1NH6A 3KOFA 3W72A 2CLOA 4GZJA 3RGTA 5AHNA 3CBWA 3W6MA 2PTDA 3JUGA 4NP7A 1FDZA 2E5BA 4S1FA 4NRRA 1KA9F 1OQFA 3CH9A 1NQ6A 4WR3A 2XG9A 3MSGA 3UYCA 2BASA 2UBPC 3VDBA 4LRTA 4KKXA 2YKKA 4B5NA 1X8CA 5AHEA 1QRQA 4Z1YA 1EWDA 3W7QA 1K4GA 2W3ZA 4TVCA 2G3NA 4FNUA 3CEPA 1UKTA 3F1QA 1B90A 4IIHA 1O1ZA 2V5DA 1J0YA 5DY2A 4C5YA 4Z0SA 3QLDA 3R5EA 2Y61A 2BB0A 4MFEA 4FX8A 3VVGA 4B16A 4DB7A 1OVDA 1XI3A 3DYOA 1JZ4A 3HM7A 4M7TA 1LRNA 4HNVA 2IKIA 4GUGA 3ALFA 4JFTA 3NUKA 3OTRA 3PFRA 1VIZA 3HV9A 3C52A 3TW6A 1H7WA 5BRQA 5LA1A 1QPNA 1Y65A 1DORA 4HZ6A 4AD0A 4L1GA 1JZ7A 4IMDA 1EPVA 1ITCA 1O5KA 3HV8A 1CXHA 2OKOA 1P48A 4MTVA 3VIKA 1DHPA 1Z6KA 3IVSA 1PSCA 1R9ZA 3QZ6A 3KLLA 3MB9A 2V69A 2FZDA 4UCFA 4QLKA 2NQHA 3T4WA 2DIJA 2A2IA 1KM5A 1W3TA 2P0IA 4QDMA 1GOWA 1XIEA 2UY4A 1R9YA 2Q6ZA 3GC5A 5GJNA 3APGA 4G1NA 4G7EB 3CAQA 4AD3A 3ZMRA 3CZGA 2CESA 4TMBA 2ZDSA 4Z2HA 4JIIX 4JTLA 2C79A 4MFDA 4PUKA 4YHEA 2ZVRA 3M1ZA 3P60A 5FACA 4FEZA 4B2DA 1OF6A 1KBKA 1O5XA 3TN3A 1KBJA 3AO0A 2QGYA 2X8RA 4AFYA 2WNWA 1MSSA 4R53A 3SFKA 1H11A 4JY9A 4Q6JA 2BVWA 1J2WA 1HZYA 4L7ZA 4TR9A 3BC9A 1UR1A 1JUKA 1Z8AA 4PTWA 3RXZA 2PU1A 1FY6A 3WQVA 1TTJA 2V2DA 1K9FA 2XM2A 2HK1A 3VD9A 1GOIA 4G7EA 4FR6A 4LAZA 2DSVA 3MSDA 1NY1A 3ABOA 3QGVA 1GORA 3WNLA 5G4EA 1NOUA 2I1OA 3SW6A 1OCNA 1E5JA 4GUIA 3LI0A 4FIRA 4DLFA 5I3JA 3FKRA 4KWWA 4QHRA 3CHVA 1V79A 2P50A 3BCJA 3NOYA 3W85A 2Z00A 2VZTA 1GVIA 3FHQA 2QF8A 5AHMA 4OOUA 3BLOA 1AG1O 3JS3A 1SYTA 3NZPA 5HJYA 1SR0A 3NQBA 2J24A 1W17A 4IP5A 5FSEC 1RH9A 3NQEA 3M4HA 1ONXA 3AYRA 1VPQA 4JOMA 1OFRA 2NV1A 1WOBA 4J3TA 4MG4A 1LOQA 1RQBA 4KEMA 1QOXA 3N9SA 3F4NA 5KZDA 2J7EA 3UWQA 2QAFA 3UU0A 4DWSC 1EC7A 3L0NA 5M5DA 3CWNA 1FDJA 2YB1A 1KXVA 3SECA 1EL3A 1R30A 1O66A 1JZ2A 1X97A 3P0XA 4DJED 3VX1A 1TPWA 1S2WA 1LWHA 3VM5A 4GVFA 1L2UA 1WKDA 4KRUA 3WQWA 4PODA 1HJUA 2I5GA 1RA0A 4P8WA 4B4HA 1VGAA 4QIUA 2HRWA 3QTPA 4F2BA 4HJFA 3NO5A 4WX2A 5A2CA 1UYQA 3QMSA 5U7SA 3P8IA 2GGEA 1V6VA 4EPKA 4NF7A 4HZ7A 1K9EA 3LSCA 1VKFA 4WY0F 3G8EA 1DWJM 3O6DA 1SJCA 1PVNA 4MUPA 2V3FA 4M56A 4B9YA 4KCTA 2G5WA 4QROA 1OGSA 1M5WA 3LX9A 4LX4A 2EPLX 5FA5A 1S2TA 3AHXA 3CQJA 4AZHA 1VFUA 2XFFA 3W2UA 1J8VA 4M8UA 3GXDA 1UROA 1KQZA 3DHFA 1J79A 1IZCA 1XGZA 3STCA 1ZTVA 1U1HA 4AVOA 1XS2A 4AIUA 1UQZA 1Z7AA 1R46A 3W7HA 4ACZB 4DUWA 2O9TA 3QY8A 4HA0A 3W74A 4AW7A 1XP3A 4PYSA 4HPGA 3LXCA 3QW3A 3S6TA 2A7PA 3CTLA 3V18A 5CBJA 3N4FA 1J0HA 4R9XA 4IQLA 5EYWA 3M44A 2RGLA 4NY2A 1GGOA 1A0EA 4AU0A 2Z1WA 4PCTA 1O7AA 1OD8A 4E5TA 1BVNP 2ZXDA 3LM3A 3S5SA 2X1IA 1XBVA 4A6GA 3SEPA 1WDRA 3EKZA 4JIEA 1FFQA 4FALA 2DH2A 4I6VA 1QHOA 3M0JA 5FF0A 5BNKA 4DELA 4AWEA 4FR1A 3BZJA 3N04A 3DECA 2C15A 2CWNA 5GNYA 3V7PA 1RVGA 4NASA 3WJZA 4ACZA 3KE0A 2J7BA 3C2RA 2J9XA 3QTGA 5HWJA 4G56A 1TQJA 4LBUA 3PSVA 2Y1HA 4IMFA 3M41A 4CU6A 4HTBA 6TIMA 3MKCA 3WBYA 4DJDA 2VGGA 1KRBC 1Z3NA 1AL7A 4NJIA 2WPGA 4MJ4A 2UWFA 4I3GA 4GFIA 3B97A 4GUHA 2GJRA 2GVJA 1PXGA 3ITCA 4ZO7A 5DELA 2VRKA 1GUVA 3SCWA 3E9AA 3TQKA 1S38A 4PMVA 2XH4A 3ISIX 5EY5A 2EF9A 3L7RA 2FHBA 4LV9A 3RPTA 1I60A 3DC8A 2RGMA 3U2CA 2PDMA 4AD2A 2C3ZA 1OK6A 1Q5MA 3PANA 1CX9A 4YVVA 3NDOA 5LKYA 3NM3A 2YZRA 4PSPA 2XN0A 1KKOA 3W70A 3QRHA 4ZZ9A 3L9CA 5DEZA 3W81A 3AZSA 3H6OA 4U33A 3NXFA 3MDUA 1IXNA 1ZL1A 3QFWA 1VFSA 5JQ9A 3EA2A 1QI5A 4D9PA 4GLEA 3QY7A 2ZRVA 3KP0A 4GNJA 5JU6A 4UTTC 2VUNA 4J3VA 1IIHA 4RW3A 1LZOA 1NWSA 3UY8A 5LGXA 1TTQA 4ZGYA 2CYGA 3OGVA 5AHIA 4K36A 4O57A 1M41A 4TO8A 3VE7A 3I3EA 3QH2A 4FLQA 4W88A 4WSHA 3VC5A 1RLCL 5CZKA 3UNDA 1WYIA 2NLYA 1FP8A 1RR2A 3HMCA 1OC5A 3ZT7A 5KINA 2XSBA 4HCDA 4M6QA 1E6RA 4KFNA 1KGXA 1SR9A 1FXPA 3ZJKA 4W87A 1JULA 3GDMA 5A6MA 2Z24A 3RAOA 4RR4A 3TH6A 1CT5A 4A8RA 2Z4GA 3LGEA 1OGBA 5EMKA 5I2UA 4HU0A 5CJNA 1ZBWA 3TC7A 2XFYA 3ARQA 1H4PA 4WVXA 4DF0A 2PDQA 1W91A 3WNOA 4MKNA 2Z1BA 1K4HA 1W9DM 5AFDA 3PUEA 1R9XA 2MNRA 3MDWA 1MUCA 5I0DA 4WDUA 5CH9A 3TCEA 1JZ5A 3PTMA 5DF0A 4X0NA 5CSSA 3H22A 3KTCA 1H61A 2A1YA 3MC5A 5JMUA 2VM8A 1RCOB 1M01A 3EDKA 1ODZA 2PP0A 3RIKA 1B31A 4L6HA 4JTRA 5HNNA 5HQEA 2ACUA 1NWUA 1BWVA 4BI7A 3PPHA 4DF2A 1VYRA 2A3BA 4AZIA 5I09A 2BLEA 3AIUA 2DVTA 1Q7ZA 4GOAA 3LV5A 4DPPA 3WQ8A 4GWEA 2INZA 3VNIA 4QCEA 2FTPA 1XR2A 3P2VA 3QHOA 2CLMA 3CEUA 1XLGA 3DH7A 2JF7A 3BMVA 3EX4A 2V3DA 1M53A 2J62A 3VO0A 1OB0A 2E6DA 2PD5A 1D2KA 1G1YA 4HU8A