4Y90A

Crystal structure of triosephosphate isomerase from deinococcus radiodurans
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
b'MQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDATVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y90A00
3U8GA 3HF3A 1T8XA 3BG3A 1GEQA 3FKKA 3NM1A 1YADA 1K8ZA 1RQHA 2ZTJA 4WX2A 1OX6A 4M19A 1XBVA 3IV3A 4LW7A 3C52A 2B7OA 2EGZA 4GC4A 1YXDA 2HS8A 3NL3A 1GWJA 2Y61A 3TC7A 3FYPA 4JX4A 3UY7A 3FFSA 3IGXA 2I9EA 1O5XA 2VFEA 1WQ5A 3NNTA 4NJKA 1T99A 1OYBA 1VC4A 4UC5A 1LOLA 3LI1A 2GQ9A 4NVTA 2E5CA 2R14A 3KRUA 1Q6OA 2Y62A 1A53A 2E6DA 1W3IA 2YPIA 1EPXA 2GJNA 1SW0A 1BWKA 1RR2A 3DKLA 4N6EA 4OBTA 1RZMA 1C9DA 2E1DA 4BFAA 5EPDA 2CZEA 1ZENA 1LBFA 3PULA 3GDTA 3GDMA 2H8ZA 1B9BA 1FDJA 1F6KA 3PBVA 4FX7A 1P1XA 3TH6A 1W5MA 4UMCA 1M7PA 3M6YA 3LXBA 4AWSA 4L4MA 4FNUA 1OG0A 2V2HA 1FQ0A 3OVPA 4G1KA 3W2JA 2VFDA 4JTLA 3SECA 2Y88A 3PBYA 3I7RA 3QM3A 1DOSA 1TPFA 1L9WA 3Q94A 1LORA 3FYOA 2CZDA 3CEUA 4QAIA 3LTSA 4NJIA 4N9DA 5EY5A 2PE4A 3HQ1A 4K6AA 4YLWA 4M6QA 4POCA 3O06A 5EBUA 4PL1A 3S42A 2ABAA 3GKAA 1T0OA 2GOUA 5KMYA 3VI2A 2V82A 4I9AA 3L21A 3G22A 1XM3A 3TCEA 3QH2A 4GNJA 4XTDA 5HNRA 3N9SA 3LDVA 1TRIA 5G1TA 2VFFA 5F2LA 1GVOA 3SIZA 3NQGA 3QRHA 1C8VA 1KV5A 1QPNA 2BTMA 2TSYA 3CM4A 2EHHA 2OT1A 1R46A 3GLCA 3QMTA 5D30A 2WSRA 2VXNA 1LBMA 3W7DA 3FA5A 2XN1A 4JTKA 1TPC1 3W85A 5LNSA 4JYFA 2CLEA 2O7SA 2VOMA 2TPSA 1LROA 1U83A 3S6DA 1FXQA 4FXRA 4FO4A 2VEPA 1TTIA 2A7PA 3HG4A 1JCLA 4WXYA 3Q37A 4CNPA 1JVNA 4O4VA 4NJJA 3M1ZA 1WX0A 5TBOA 4JY9A 1RPXA 3KRZA 2G5WA 2FIQA 4UCGA 2B7PA 5FF3A 3T44A 2RHGA 2NLIA 1W3NA 2E09A 1M7OA 4CCCA 4NXSA 2Y7DA 3LX9A 3NA8A 3G18A 3SI9A 4A3UA 1ZCOA 1YDNA 1YLVA 1WAUA 4UTMA 2NWRA 4UTJA 5HQEA 1QO5A 4A29A 3GAYA 3MO7A 3UWQA 4HHPA 4WY0B 3SGUA 3ZR4A 2A0NA 3W83A 1R2TA 3LHUA 3NGJA 3YPIA 2AQWA 4GRSA 4AVFA 4MJZA 1F7BA 3N14A 3EEGA 3G0UA 1I2NA 2NX3A 1B3OA 1X1ZA 2G95A 1X8FA 1AG1O 1H60A 3S1WA 3W75A 1XI3A 4XBSA 1EB3A 3W7IA 3Q2DA 4JTHA 3W1NA 3JS3A 3M7WA 2JKEA 4M5PA 2FB2A 3I6RA 3ZWTA 2CLKA 2ZRXA 3CB8A 2JGQA 4HNTA 1WBHA 4FX8A 5FF0A 3NPUA 1DJNA 2QUUA 4K7VA 5FEPA 3MMTA 1BTMA 3HPZA 1JR1A 1SZNA 2NXIA 4MY8A 1DVJA 1QDSA 3SW6A 1Q3NA 2X30A 2ZDRA 3IIZA 2V30A 4YCPA 3GXNA 1DQXA 2FJKA 2O7QA 3HGOA 3I68A 5F1UA 3ATYA 3WJZA 1AW2A 3QPYA 3G0SA 3LM7A 4PL2A 1XBYA 2PCQA 1IIHA 1MO0A 3WJXA 3EWWA 5F2MA 3W7KA 5D02A 4DELA 2H90A 3SFKA 1H7XA 1FX6A 4WUIA 3SSJA 3UD6A 4TR9A 3P62A 3GVGA 2V0TA 1JCXA 3E0IA 2GQAA 4FNQA 1SU5A 3L67A 3N34A 3B05A 3PUOA 4FNPA 3W87A 3W76A 4O28A 5A8GA 3VE9A 5BOOA 1QCWA 3S0CA 5FF2A 5CZJA 4Y6GA 1ZNNA 2F7FA 5LNUA 1UASA 3G1AA 1VR6A 3VNDA 2DJLA 1SFLA 1N55A 3TXVA 2QCEA 2W0UA 2DJXA 3LCFA 5FI8A 5HULA 4E2DA 1EEPA 4IMEA 4NNBA 3NL5A 4JTGA 1L2UA 3C2FA 3NM3A 3BO9A 5CZ0A 1GVSA 5GVJA 4Z1DA 3NXFA 2VFIA 3NQCA 1GTHA 1HFBA 3NDOA 4N4QA 2J6XA 1KM0A 3W7LA 3IRDA 2X1UA 2GUUA 3MYPA 4RV8A 1KFEA 4JTEA 3UXAA 2QCLA 3GR8A 5F2IA 1B57A 4K39A 4UNLA 5K9CA 4HN4A 3P7YA 2OCZA 3UNDA 3B0VC 4Y90A 1AW5A 5LNVA 2HS6A 3TW7A 4ZQRA 4DXVA 1XDMA 4PFMA 5CPLA 4NJGA 4NXKA 1SZEA 1IXQA 2NXGA 3BK0A 3B06A 4WD0A 2OMAA 3TK7A 4RJEA 3CC1A 3TMLA 3TX9A 4R34A 4L4LA 3KHJA 3O6YX 2YW4A 2EPHA 3H55A 3ELFA 4FEZA 3W1XA 5D2YA 5TQLA 2GVGA 1OF8A 3WK1A 5DELA 4BK9A 1M6JA 5EKYA 3W22A 3TDFA 4EF8A 5I3JA 3E02A 2J24A 1HO4A 3S1VA 1GTEA 1VYPX 3UZ5A 1LRNA 5D05A 3NZRA 1TO3A 2ZA2A 3PR2A 3D0CA 4JNMA 1SZGA 3LHZA 5CGQA 3LCXA 2BLEA 1ZY9A 2B4GA 4MZYA 1GVFA 3I7SA 2EKCA 4PCFA 1HG3A 3R89A 3KRSA 3F03K 4GE8A 4MOZA 4X22A 2ZA3A 3MHGA 3P67A 3T40A 4HNVA 3LTPA 2GVJA 3CHVA 1UJPA 1R2SA 4K37A 4IMCA 2NUWA 3S5OA 1SZFA 1ZAHA 3WK2A 3JR2A 1WV2A 1H62A 3M43A 1EP2A 1I2RA 4O1CA 3V1PA 3CEPA 4IX0A 3U2OA 1ICSA 3W1TA 1PCWA 2F84A 1W31A 3PB0A 3STCA 4O13A 4IJBA 2V81A 2C0AA 3BGGA 5LHFA 3DENA 4Q32A 3A9IA 3TQKA 3QSTA 3QYQA 4IPJA 2Z0IA 3M5VA 5FF7A 4O0ZA 3EWYA 4NZJA 4CQ8A 4Z0JA 4JTJA 4O1DA 4PC8A 3FIGA 2RDUA 5ABTA 3VFLA 3O6DA 4Y8FA 4LVBA 2NZLA 4RK8A 3V75A 1LZOA 4JXCA 1QPRA 3NQAA 1L6YA 2QF7A 5KZMA 2GPTA 3NOEA 1P0KA 3GDRA 1K7EA 3CTLA 3Q58A 3FJLA 1GPWA 3WK0A 1J4EA 2BXVA 2E6YA 3HJZA 2ZTKA 1KFLA 3W7OA 5AFDA 3INPA 1X6UA 2CWNA 4UTIA 4WZHA 1W5PA 4M6PA 4YMZA 1LDCA 4UFIA 2C14A 4JX5A 3NL6A 4BF9A 1TPUA 5D09A 4H6KA 4MZ1A 4GUGA 1TJRA 4UMBA 3BG9A 2YXGA 3GZ3A 3THQA 2E68A 4W9TA 3O15A 2Y7GA 4FIRA 4QNWA 4CNNA 2EF9A 3EX6A 2GJLA 2VEKA 2WV8A 3ABOA 3B8DA 2C19A 5AC8A 3QW4B 1DHPA 3GYEA 5I3GA 4Z0SA 4GUFA 1OF6A 2VENA 4M7TA 1XCFA 1RVGA 1MEWA 3PC0A 3U6WA 4EVZA 3OBKA 2RDTA 4QIUA 4WOZA 5J5RA 4UTWC 5D2XA 1GYNA 1Q45A 1G4SA 1KTCA 2VEIA 3B0UX 1KBJA 4S2BA 5L9FA 3NPVA 1VPXA 3BVJA 1OABA 5AHMA 2W6RA 3P8JA 4AB4A 1K02A 4GUJA 4XUGA 3FLUA 3QZEA 2Y63A 2A6LA 2IQTA 1JRBA 1ML1A 4O52A 2WJZA 6ALDA 1WYIA 1SPQA 2VKZG 3CT7A 4BWLC 4OT7A 3W1RA 1I2OA 2C16A 1MEIA 3P8IA 5MHBA 1K7XA 3O1NA 2YR1A 3DGRA 3RMJA 5LNWA 4M7SA 3IVUA 1LBLA 3GXPA 5LGZA 4TU1A 1CI1A 5CSRA 4HNUA 3M9YA 4FIQA 1F6PA 1ZFJA 1GOXA 4NQ1A 1SQ7A 1IF2A 3L5AA 3W1LA 5CPMA 4NX0A 1UUMA 4MPQA 3TFCA 3SR7A 1O95A 4H4IA 3FOKA 4HSOA 4IWWA 5AYYA 4FHAA 3LLFA 3UPWA 3S1XA 1LOSA 4FB7A 4MIMA 2BZNA 2YDAA 4LVDA 5T26A 3MHFA 2WSQA 1JULA 1FCBA 5K4XA 1MXSA 3GB6A 1PHWA 2V8ZA 2QCHA 3MP3A 4ZMGA 3G8EA 5D03A 2CLOA 3LHVA 5E93A 3W70A 4UFKA 1BEUA 3PAJA 3NG3A 4KWVA 5G2WA 4K8EA 1FWSA 3C61A 5F2GA 4FNTA 3LCIA 1RQEA 2WQPA 3C6CA 4D2JA 4AF0A 3TXZA 1EX5A 5H2ZA 1KTBA 3PS7A 2P10A 3TSMA 4UXDA 4HPXA 1Q6QA 2A5HA 5DBTA 4JICA 1Z41A 4WOQA 1L6SA 5HWMA 4TX9A 2NUXA 5LZLA 2XN2A 3W7PA 1UUOA 3LTYA 4MLJA 4QQ3A 4AHPA 4EF9A 3GXTA 3SJ3A 3EXSA 1H1YA 3C4UA 2H6RA 3EX1A 2GQ8A 3L9CA 3M47A 3LCLA 5LHEA 3NQDA 5HUPA 4JD4A 1A50A 1YYAA 3G8RA 3R13A 3R8RA 3TMQA 1TQXA 2ZRVA 3RLVA 2Y70A 2NX1A 1DL3A 4LOCA 1ADOA 2JKPA 2PRMA 1TYGA 2C1HA 2A4AA 1OK4A 2JKAA 3DFPA 4GUIA 3F1QA 3L68A 1WBJA 2QCDA 5AC7A 3KOFA 2QUTA 4ORIA 4RR4A 4ADUA 4YXGA 3NAVA 1X1OA 3GAKA 1TCDA 6TIMA 3ZS4A 4O1BA 4OE7A 8TIMA 5G1YA 4O16A 3TUUA 1EWDA 4DO6A 5G5IA 3S1UA 4X2RA 3E12A 4RZ6A 4UFHA 1K7FA 4LS1A 4O14A 3AO0A 3M5XA 2YCEA 1TPH1 3WJSA 1VLWA 2Z2UA 1P5BA 4LVAA 3I7QA 3KFTA 3LBCA 2TMDA 2YFNA 3BLEA 5CSSA 4MUZA 1DORA 4O57A 3K30A 4CCEA 1NFBA 1GT8A 4O11A 2E5DA 4KFPA 4XQ6A 5E0KA 3W7QA 3DH7A 4JGDA 1XBXA 1B4EA 3LXAA 3T55A 1YTDA 4K36A 4UTLA 1A5BA 1XFBA 1ICPA 1KLYA 5AHNA 1SFJA 2A6NA 1Z44A 4HNNA 1KFBA 1FBAA 1PL9A 4FXSA 5I3IA 3P82A 4E2BA 1VHNA 2QJHA 3EKZA 3W2LA 1YTEA 2DZTA 4RCXA 4WY0F 2RKXA 3SGZA 3M16A 1IXPA 3LB0A 1O60A 4IMFA 2FB3A 4IPIA 5DCEA 1OYAA 1YXYA 3DHFA 2A7NA 4ZQNA 4WXZA 1QAPA 3DFSA 1RQBA 3OEXA 5HR6A 2CLFA 3W7EA 3W9ZA 3G1VA 1F05A 1LP6A 4U28A 1THFD 3PG8A 2VEMA 1BWLA 1SO5A 4KFOA 3GK0A 1PHQA 3QMRA 3C2VA 2LLEA 3CU2A 1B4KA 2YX0A 4MYAA 3ABQA 1AL7A 3LGEA 4HPJA 1XUZA 1FWWA 1QWGA 3BLFA 1GVQA 3ZFHA 2ZCGA 3W7NA 1DQWA 2CZFA 4IMDA 1LYXA 1DV7A 1JJKA 2BX7A 1G7VA 3C2OA 2V5BA 1OFAA 4AWTA 2ZQ0A 3F4WA 2NUYA 1FXPA 5HMSA 3HG3A 4B5NA 3W2MA 4P61A 4IUOA 4MLRA 4IXXA 1OHLA 4K7YA 1Z42A 1OFEA 3O8AA 2FTPA 3TROA 4UTTA 3VKJA 3L2IA 4O50A 5AC6A 4MFEA 1G4PA 2R91A 2QDGA 2W79A 4JYDA 4GFSA 4OGZA 3W1UA 2PC4A 4XWUA 1O5KA 3WK3A 1XUUA 1W0MA 3TNOA 3G1HA 4QISA 1SO3A 3W3OA 3TJLA 2Y89A 2P1FA 1EIXA 4RXFA 2CFFA 3BG5A 4O54A 4AHQA 1QR7A 4J9JA 3S9YA 1NF7A 3CIXA 1HL2A 1GZGA 1OVDA 2CLLA 3W2UA 3UWZA 5EA9A 1TPB1 3SY5A 3G1XA 4Z1BA 1OK6A 1H50A 4I7VA 3NQ2A 2ISWA 3TR2A 1VCFA 2TRSA 4JIPA 4AEOA 1G6CA 3HO8A 1I45A 4JDBA 4UR8A 5AB3A 1HUVA 2FFCA 4RZ4A 2G96A 4DF1A 2J9YA 2Q8ZA 2QDHA 3OA3A 4CNOA 2FDSA 5C2XA 1H63A 3HIJA 1KTNA 4Q33A 5H91A 4Y9AA 3NQVA 4N9CA 4YL2A 4UMAA 3L65A 1HTIA 2FPTA 4XTIA 3EXRA 2CU0A 1SO4A 4FNSA 4P2VA 3TFXA 1ZHAA 2QJGA 4HT3A 3TIMA 1H7NA 2DORA 2ALDA 1ZAIA 3T78A 5C6MA 5DCDA 4ZQCA 3G1FA 1FDZA 4X9SA 4TMBA 4DF2A 3W2KA 2ISVA 2Q3RA 1I2QA 1JCNA 3PUDA 1V7YA 3UWYA 1H7WA 3OVQA 3MJYA 4RLIA 4AAJA 4I7WA 4LY8A 1QNVA 5EMUA 4UTKA 1XDLA 1W3TA 1WOAA 1DJQA 5DXYA 4R7JA 2YZRA 4YWIA 3LRMA 1T96A 4LUJA 1GYLA 4ZVJA 3HG2A 4ZL1A 3BW4A 3O07A 3F4NA 2QCNA 3L0KA 1KV8A 3HGJA 4N9EA 3I65A 3G24A 3A21A 4EIVA 4UFJA 2X1RA 5I3HA 3LHTA 1OFDA 2CLIA 4R33A 2H3DA 3TQVA 2YYTA 1R2RA 3MI3A 3IVSA 3T7VA 1LLWA 3W07A 2WPBA 4DO5A 3IEBA 4UTHA 4LTSA 3NQ6A 5AOUA 3WFAA 4H3DA 4U4MA 2XN0A 3LBMA 1NVMA 2ZRYA 3B4UA 4JS3A 2ZRUA 2NX9A 1IIGA 3CWOX 3MWAA 4AXKA 1IXNA 2HMCA 2VFGA 3IIOA 4JTIA 3NPXA 1PS9A 1KFKA 3FJ6A 1CX9A 1YPFA 3L66A 5DLCA 3W74A 2PRHA 2Q3OA 3UPBA 3N9RA 5DY3A 4AHOA 3CPRA 3A24A 4N2YA 3NVTA 1WA3A 3LOTA 5AYXA 3O16A 1O4UA 4KKXA 1SO6A 2DZWA 1TRDA 2I14A 4A2SA 4MKNA 1FY6A 1NF0A 1K8YA 3WJWA 2OZ0A 3P61A 3RK8A 3IVTA 4R53A 1D9EA 3DFNA 4ZQMA 2OX1A 4DO4A 4MZ8A 2WNNA 1NEYA 1W54A 1WDWA 3LV6A 5FEZA 3NQFA 2H8XA 2ZYFA 1AW1A 5FEXA 2FPYA 3EX2A 1KW1A 2WNQA 1IXOA 3TW6A 5G4WA 1GJPA 1QO2A 2RH9A 1TV5A 4UTTC 3USBA 3DHDA 3W7HA 2Y6ZA 4UTUA 4A21A 4MFDA 3LERA 5HR7A 1P0NA 3A5FA 4LV4A 3MUXA 2FQIA 3LHYA 4JTTA 5L6UA 3PY2A 4I7UA 3HPSA 1VLIA 3DKJA 3G3MA 1TMHA 3P80A 1VJIA 3MBFA 4LRTA 3MYOA 1OX4A 2WNZA 1GG0A 5KZEA 3MI6A 2YW3A 5CG7A 3TC6A 2V9DA 1FWTA 3GDKA 2QAFA 5FESA 2B7NA 1SW3A 4UIOA 5BMWA 3PM6A 3MI2A 3TSBA 2WSYA 4O15A 3W71A 2CW6A 2YGYA 2DZPA 1A5CA 2QCCA 3GNNA 4PA8A 1WXJA 2I1OA 1QPOA 4N4PA 2WOQA 2Z1BA 1YDOA 3MW7A 3DBPA 3OIXA 4FNRA 4OHQA 3W72A 3BLIA 1S3HA 2NXHA 1JCJA 5HUOA 4BI7A 4X3ZA 3H53A 1KM5A 5K4ZA 2J9ZA 3PSVA 1TPDA 2J27A 3P81A 1JCYA 4TIMA 3B04A 2G97A 4ALDA 3UXDA 4JIQA 2ATSA 5I3KA 3QF0A 3L5LA 5IBXA 1OX4B 3DI1A 3OG3A 1KA9F 3QFEA 4IQLA 4NT0A 1Q6RA 1UB3A 3KVKA 5CKSA 4LUIA 5BNKA 3NQ7A 4FF7A 2E5BA 2A1YA 4UFMA 2NV2A 5E1QA 3ANYA 4O10A 5D33A 3ATZA 1YPIA 1XL9A 1W5QA 3LI0A 4XBKA 1H1ZA 4PTNA 4LRSA 3LXCA 2Y7FA 5HWJA 4RKAA 4IX2A 2ABBA 4Z08A 4UFLA 1O94A 4WJEA 2Z6JA 4PEKA 3TA6A 1JRCA 1PCKA 1TV8A 3TU9A 3H54A 4YCOA 1CW2A 4QJ1A 1YDVA 4LNYA 4WQ6A 1D3GA 1SR9A 5K2ZA 1FUYA 2X1TA 2CLMA 2OJPA 3PSWA 3B03A 2QCFA 4QITA 3FS2A 4CLMA 1EP1A 2R94A 3A22A 3BPWA 2DZUA 1VS1A 1LTDA 2QUVA 3GX9A 1AMKA 4E38A 1J2WA 4NNCA 1M5WA 1Z48A 2KZHA 1A5SA 2V5LA 4ONVA 4JEQA 1ONRA 3TE9A 1LRTA 2HSAA 2VC6A 2P0OA 5CZSA 3P84A 3PBWA 3KX6A 3UZJA 2ZZ7A 3W1MA 3E96A 3IGUA 1TPVA 2QEZA 1FDYA 5D37A 5KITA 4ADTA 3IIVA 5TIMA 4O19A 1MEHA 5LSMA 4ZQOA 3MP4A 3P5YA 1EA0A 4PH6A 4LV9A 3LHWA 3O63A 1I4NA 2DZVA 1ZJIA 3NR0A 4LT9A 5AHLA 3A5VA 2ZZ6A 3SZ8A 3G3DA 4AF0B 1TREA 2A21A 5BW6A 1F5ZA 3STGA 3VE7A 3HG5A 4C1KA 2AAMA 4JY8A 2ZFAA 4WY0A 1LOQA 3PF3A 4IMGA 1TPEA 1TTJA 2QCGA 3N19B 1W5OA 3W86A 3UY8A 3N3MA 4UNKA 1XXXA 1VCGA 1KBIA 3NQ8A 3IGSA 5EYWA 4DPQA 4RX0A 1Y0EA 1TV7A 1TIMA 3A23A 3G1DA 2QKFA 4NNAA 1P4CA 4A2RA 3CWNA 3KAOA 1TB3A 2QAPA 3QSRA 3FEMA 1TPWA 3L0NA 3P60A 3DZ1A 1VHCA 5G2HA 1JCMP 1SW7A 4M6VA 2V2CA 1DKWA 5FF4A 2QCDB 2DU2A 3E49A 1EP3A 4E0CA 5K3VA 3W2NA 4O17A 4RXGA 2A7RA 3S5NA 1Q6LA 4DBEA 1ALDA 1LLZA 4MJMA 4NZFA 4NUWA 4NU7A 5U7SA 3HBLA 4LS2A 3LCGA 2C6QA 3G0XA 5KZDA 3E9AA 1NAL1 3HOJA 3UWUA 3TAKA 5LKYA 4JN6A 5C5YA 7TIMA 3C2EA 5D2WA 1PVNA 2YFOA 3W1AA 3M44A 5J5DA 1XC4A 4GJ1A 3C2RA 5F4XA 5HINA 1FWNA 3VCRA 4HKPA 4LWWA 1VQTA 3O05A 4MYXA 5F4WA 3NO5A 1TJPA 1PE1A 2Y85A 4LS0A 2OT0A 1JUBA 4O8RA 4EWND 5C54A 2ATMA 3LRLA 3PWAA 4O4WA 4DEFA 2Y7EA 1KM2A 1GG1A 3W7GA 1W37A 3P5ZA 4O0KA 1K8XA 3QQ0A 3BGJA 3W23A 3PUEA 3DAQA 1TQJA 1KM3A 3CLMA 2B0MA 3CIWA 4XZ9A 2A2IA 1TTQA 3C0JA 5EL1A 3QJAA 2DZSA 1OJXA 3KVLA 3LCWA 1QMLA 4S1FA 4Z1CA 3THAA 4EOUA 5IM51 1QOQA 1VH7A 2ZZ5A 1RD5A 5IBXC 3C56A 3R12A 5LNRA 3CQ0A 2ZZ1A 4MVAA 3W7MA 2E6FA 2ZZ2A 4ADSA 2X2GA 5DN1A 2FLIA 4JDYA 1EUAA 4TMCA 3IIPA 4BI6A 1LRQA 4DF0A 3M5YA 4OU1A 1W8SA 1LM1A 3EWUA 2ZA1A 3NL2A 4GWEA 3M5ZA 3W84A 4UR7A 3HB9A 3MP5A 4Y96A 4O1AA 3N73A 4QNEA 1FCVA 4LVGA 3DI0A 4OV9A 3ABRA 3PBUA 3NZ1A 2X1SA 4JX6A 3TV8A 3GDLA 4BR1A 5BRBA 5AHEA 4O12A 3EKLA 5D38A 1WOBA 5F4SA 5DXXA 1UCWA 5D04C 1JUKA 3UWWA 2WO5A 2ZZ4A 4UTWA 3GR7A 1V5XA 1OFBA 3W6YA 1HO1A 3MHUA 2XFWA 4FX6M 3EX3A 2DZXA 3QC3A 4AMAA 2H3BA 2Z6IA 2CZ5A 2JBMA 4NX5A 1FWRA 4PODA 1W56A 1YTKA 1AL8A 1C29A 1JQVA 2A85A 1S5VA 2FPVA 4BWLA 3OHIA 1AK5A 1W1ZA 4IGHA 3R2GA 4CQ9A 1VYRA 1KM6A 5C55A 1OFPA 1TTPA 3BW2A 1MZHA 3DU0A 3BV4A 3NYZA 4ML9A 5G2IA 3QPZA 4K8HA 1JQXA 1SSDA 3S5ZA 3EWZA 4Z1AA 1K3UA 1RV8A 3DFOA 5KINA 3HGSA 4Q4KA 2R8WA 1H7PA 3AJXA 2B7QA 2EAWA 3TSDA 5BMXA 3EWXA 4N9BA 1FCQA 2C15A 1FCUA 3DXIA 4KWWA 1VCVA 3ZWSA 1F73A 3STFA 3TQ0A 1SUXA 1QOPA 1H7OA 2GVLA 3EWBX 3LCHA 5KTLA 4N6FA 3PVFA 2JGYA 3LLDA 2BSLA 3R5EA 5K9XA 4OWGA 5G4EA 4HIBA 4RZ5A 5D32A 4A22A 2E77A 1G4EA 3UYCA 5HJLA 5SWUA 4CCDA 2ISSA 3N2MA 3LV5A 5HWNA 5D2VA 2X16A 4GXMA 4MY1A 2ZBTA 1OYCA 3G1YA 4ZQPA 3UWVA 4C1LA 3NEVA 1H7RA 1N7KA 3IIXA 4JR5A 1R30A 3BARA 2NWSA 4AWUA 5DY2A 3QMSA 3N2XA 3LRKA 2QJIA 4ORMA 4GUHA 4QSHA 5CPOA 3C8FA 4S2CA 3RFAA 5CPNA 2J88A 4XKYA 3W73A 2BWGA 4NJHA 1ZAJA 1XBZA 4LC8A 2ZZ3A 2UV8G 3PG9A 5U4NA 1EUNA 1NSJA 3EXTA 5AHFA 1I8JA 2QR6A 1IGSA 4LVFA 3RF9A 4DPPA 1J5TA 1W5NA 1XKYA 4MY9A 1PV8A 2PURA 3RNDA 5DCBA 4OV4A 3DFQA 2Q8LA 4ZZ9A 1JUEA 1LCOA 1EWEA 1E51A 1MSSA 2AGKA 2ZRWA 3OVRA 4IOTA 2DP3A 2RFGA 4TO8A 3NPWA 4JTSA 2V2DA 5A5WA 5F1VA 4LU0A 3HPXA 1G67A 3KVJA 1OFOA 4CQAA 1GQNA 1H5YA 2CLHA 2NV1A 3W7CA 3RU6A 4UUIA 1ME7A 4O18A 5AN7A 3KXQA 3T4CA 3DFTA 4QM1A 1KLZA 3RLUA 1VGAA 5AYZA 3NQEA 4N02A 1TSIA 1N8FA 1U5JA 3HGRA 3UQNA 4HSNA 3HMJG 1VZWA 3NQMA 4XKYB 1OX5A 2RDWA 1F2JA 2C13A 1S5TA 4OQVA 3STEA 3W7JA 3JRKA 5AHIA 3C3NA 1GVRA 4KFNA 2PRLA 3TJXA 1YXCA 2JK2A 3EB2A 5I3FA 3S8HA 3W1PA 3BW3A 1F76A 1F74A 3MBDA 4JTFA 1ME9A 3M0ZA 5K7JA 5LGXA 5KSWA 5FEWA 1BKSA 1KFJA 4DBDA 1A5AA 3WJYA 5DBUA 2C18A 2HTMA 1S5WA 1H61A 1KM4A 1DBTA 1QPQA 2ZRZA 3TKFA 3G1SA 1G7UA 1G4TA 3W1QA 1R47A 3QEZA 3P74A 1K03A 2QCMA 2WKJA 3O6CA 2VFHA 4DQWA 1ZALA 3W7RA 1ICQA 2D73A 1VRDA 4AH7A 3FKRA 1SSGA 4IXHA 3GIYA 3TAOA 4JTUA 3L0GA 1QFEA 1I2PA 3ABSA 1UBSA 2E6AA 4JYEA 3M41A 3S5YA 1H51A 1PIIA 3KVMA 1D3HA 1VYSX 2C3ZA 1OFQA 4O53A 4BI5A 3QW3A 3B0PA 2J9XA 2YYUA 3PB2A 4LC6A 5D2TA 4GBUA 3GNDA 3EX4A 1G69A 2YSWA 1OFRA 3QQ1A 1ME8A 1L6WA 5K9DA 1X7FA 3L5MA 3W88A 2VELA 5CZTA 1KM1A 2TYSA 1KFCA 3GKFA 4K38A 4ICNA
chains in the Genus database with same CATH superfamily
4KT2A 3W0KA 1XRFA 4F2BA 1JCTA 4G56A 1T8XA 1F9CA 1K8ZA 3AFBA 4PTVA 4WX2A 1XBVA 3IV3A 3C52A 2CXEA 1C90A 2B7OA 5JBFA 1B90A 3KBSA 2WAGA 1XIDA 1EL3A 1TZZA 2OOGA 3SQMA 1AJ0A 1R3WA 3A4WA 1Z3NA 2VFEA 4NJKA 3MUZ1 1LT7A 3VGFA 2REQB 2GQ9A 2E5CA 2R14A 3IAPA 3KRUA 1R9YA 2Y62A 2J7BA 5AY7A 2E6DA 3BICA 3W28A 4X0VA 3DKLA 3GRIA 3RM9A 1XLHA 1ZENA 3PZUA 2GGEA 1LBFA 3CAQA 3IJ6A 3PULA 3GDTA 4K1GA 2H8ZA 1F6KA 3PBVA 3SBFA 1UWTA 1NU5A 4A3HA 3FYYA 3ANVA 2Y88A 5HMFA 1PTDA 2BHYA 1LORA 1I0BA 3T9PA 1UP0A 3AI0A 1OB0A 3HQ1A 3B8SA 1TJ0A 4PL1A 3VGEA 1AZ1A 1GORA 5KMYA 1KRCC 1NOUA 4Y9PA 1ZQ5A 4YHGA 4I9AA 4R88A 3G22A 1XM3A 1ESWA 4AZHA 4GNJA 4HHLA 4XTDA 4GZJA 1TRIA 2ASHA 5G1TA 3H26A 5F2LA 4QLJA 1MFUA 2ZUUA 4ERAA 3U4FA 3WLTA 1V0MA 1C8VA 2WBGA 4FXFA 1L0PA 1M65A 1YKWA 4DB7A 3QMTA 5CLTA 4KRZA 1LBMA 3W7DA 3FA5A 4S23A 1AQ0A 4JTKA 1DJXA 4B3LA 2O7SA 2TPSA 1V3MA 2IKGA 4FXRA 4LUTA 1PKYA 3M0XA 3W25A 3TJIA 3WUBA 4QAWA 4JQAA 3E0VA 4OOZA 3S4TA 3SCSA 2G5WA 2FIQA 1UQZA 2HDJA 5FF3A 3T44A 2RHGA 3WLLA 4H9XA 4KW2A 4A3UA 2H9AB 3GTNA 1YLVA 4C6PA 4UTMA 1JPMA 3PFRA 4U2ZA 4HHPA 1M04A 2IPWA 3LHUA 3YPIA 1PX4A 3O3RA 4RDYA 4GRSA 2R1MA 1J79A 1I2NA 4QSFA 4W84A 1B3OA 4I8DA 2G95A 2JFEX 2BY1A 3ZLFA 3AXKA 1AG1O 4FP1A 4C5ZA 1A5OC 3FA3A 2HVNA 4N7QA 1E56A 3EAUA 3MA8A 1A4LA 3AIRA 1ZGDA 3CZGA 3KTSA 4JIIX 5CJ5A 4NI8A 2VHLA 3V4BA 3V18A 1XGZA 1V02A 3VOFA 2NXIA 1QK0A 3SW6A 2R24A 2ZDRA 1QW8A 1XRSA 1MZRA 3EB4A 3HZ3A 4HCHA 1GQLA 1YQ2A 4DBUA 1F4HA 2OXNA 1ZBWA 4TX6A 5F2MA 1KXHA 2ZX5A 3NCOA 2BHZA 1XLJA 3WLOA 1JCXA 1VEOA 3W02A 1JZ2A 4CQDA 4FNQA 1SU5A 3L67A 3N34A 1Z89A 5EU9A 3S0CA 5CZJA 3U9IA 1ZNNA 5TNVA 3EKGA 3WH5A 3ZSSA 1SFLA 3TXVA 3N1AA 4TV5A 4XIMA 3LCFA 5HULA 5ECUA 3WF2A 4IMEA 2C71A 4RE2A 4JTGA 4F9DA 5GVJA 3SGGA 3DC8A 2YL5A 5MKGA 3NXFA 3AJ7A 4ZODA 2OWCA 3NQCA 3NDOA 1K9EA 5DX7A 2AMXA 1A3WA 3W7LA 3IRDA 1JZ4A 4L80A 1QHPA 2OLHA 4PULA 4RV8A 3USZA 5F2IA 3OJGA 1K4HA 4K39A 2AL2A 3U2CA 2PODA 4LYQA 4HN4A 3B0VC 1OEPA 3UNDA 1AW5A 2NT1A 1XDMA 1BVZA 3R0DA 2VX4A 3BSMA 3FVMA 1IXQA 1FP9A 3C5QA 3WFZA 2W4XA 4WD0A 2OMAA 3TK7A 1W9PA 3TX9A 4L4LA 3BLLA 4FEZA 2GVGA 3H2FA 4QS6A 5DELA 3Q45A 1UWUA 1XX1A 4UOQA 3W22A 2NQZA 2BOEX 2AMGA 1NWRA 3S1VA 4LGXA 3VA8A 1GTEA 3UZZA 1VYPX 1XIGA 3BZGA 3QXBA 5I09A 4CU6A 3BURA 3D0CA 1BFNA 1SZGA 2ZX6A 3E74A 3LCXA 3E2VA 3WQVA 1GVFA 1S5NA 4PCFA 3HURA 3R89A 4C6KA 3F03K 2IXUA 4MOZA 2XH4A 1JYXA 2ZA3A 3SRFA 4PMVA 1V3IA 3H4XA 1L6GA 4HYRA 1PAMA 4IMCA 3H70A 2W66A 3S5OA 2PWGA 2BFGA 2G37A 1TJ2A 1J0JA 1E6NA 1I2RA 4QP0A 4JQ4A 3U2OA 3T08A 3ZT6A 2DIKA 2XZ9A 1WXZA 3C0SA 3IJ7A 4IQJA 4KCWA 4KRTA 3PB0A 3J7HA 5CAHA 4O13A 2YBUA 1RJRA 1XW8A 2WMFA 3LZ3A 3Q67A 4H9MA 3TQKA 3STPA 3TJ4A 5FF7A 2ZXAA 1OGBA 1S2VA 4RDZA 5BOEA 3GH4A 2E67A 4WKAA 3CHEA 3KBVA 8XIMA 1UBPC 3FDKA 4L61A 1LL6A 2RDUA 3VFLA 4Y8FA 1KQYA 3TTEA 1K77A 2NZLA 3NQAA 2RJGA 5D8WA 1WDDA 2HZGA 3CTLA 4YWSA 3ARQA 1ZB5A 2E6YA 3LGDA 3D3AA 5HK4A 2W91A 3W6LA 3R10A 4RV3A 3S9ZA 2CWNA 3GU9A 4PB5A 4UTIA 2I9UA 4M6PA 3QGVA 5D09A 2QDDA 2W27A 3C2YA 2ISFA 3BAJA 2PBOA 3GY1A 4GO9A 4AFYA 4HMEA 2DDXA 4FIRA 4CNNA 3EX6A 3U7VA 4XSMA 3TR9A 3B8DA 3BZJA 2AGTA 5AC8A 2R6OA 2XYLA 1DHPA 2OQLA 2EXOA 3FN9A 2WJEA 2RDTA 1Q8AA 5J5RA 2VX6A 4ROQA 1Q45A 3SURA 2VEIA 3A3HA 4Z2LA 3VNIA 3NPVA 4AB4A 1K02A 3GC5A 4JPGA 1KFWA 4O52A 1WYIA 1SPQA 1I0DA 1UKPA 3N18A 2VKZG 4QFUA 3VGDA 3CT7A 3KW3A 1V8EA 3QGAC 4OT7A 1BSIA 4RDWA 1I2OA 2GGGA 1FA2A 3VU2A 3P8IA 3CUXA 3O1NA 1GOIA 1ZSXA 4TU1A 3AMKA 3QBUA 4B16A 5FCZA 4OTKA 4UQEA 2YB1A 5CSRA 4RNHA 1ITCA 5FAJA 4NQ1A 2G4JA 3W1LA 3TTYA 3GTIA 4AZCB 5CPMA 1MWOA 4NRRA 1ISZA 1O95A 2DIEA 3S1GA 4IWWA 3GVVA 3LLFA 3PJUA 2OZTA 3UG3A 4WF7A 5IHRA 3WMCA 5KEZA 1CB7B 2BZNA 4LVDA 2WSQA 2WC4A 1JULA 2PS2A 5HQMA 5IRPA 4ZMGA 3G8EA 1XH0A 5BU9A 4Q8QA 4JEJA 3ES8A 5D03A 2E4TA 5XIMA 1OWQA 3W70A 4UFKA 3PAJA 4KWVA 3M0MA 3KL3A 2E25A 4Q8PA 5G2WA 1R3QA 4R9XA 4OOUA 5F2GA 2OYLA 1Q8JA 1Q6CA 2WQPA 4MNLA 4AF0A 4GXPA 3PS7A 5AECA 4ZA0A 3GSMA 4PBEA 4IP5A 1LT8A 3E5BA 4EF9A 4ZSTA 3QHOA 4W88A 2ZADA 2H6RA 2GQ8A 3LCLA 5LHEA 4D1JA 4KRUA 3R8RA 1TQXA 3RLVA 1X38A 4GO8A 1UR8A 2Z28A 1A0EA 2PTYA 1DL3A 3THDA 5BU6A 4UQAA 2C1HA 1W91A 1OK4A 1WE5A 4GUIA 3F1QA 1RY0A 2GDUA 3UESA 4YXGA 5FD0A 6TIMA 1TCDA 3F5KA 1BXBA 2ANUA 5G1YA 3V7PA 2WZEA 1WXYA 4OFCA 4BQ2A 4LB3A 1QI5A 3APYA 3S1UA 3ZR5A 4X2RA 4RZ6A 1K7FA 3GNPA 3K8MA 3WJSA 1MYRA 2Z2UA 2Y0FA 4MUZA 3H2OA 4O57A 1UIOA 3K30A 1FWHC 3H23A 3GXIA 4XQ6A 5DEZA 4YTTA 5C9ZA 2KX9A 5LIUX 4IZGA 4D8LA 5I02A 2DT0A 1A5BA 3A6OA 1ICPA 1KLYA 5AHNA 4UWMA 5I00A 2A6NA 4A4AA 3WMLA 3DG7A 1FWGC 4IQEA 4FXSA 5I3IA 1P1MA 4E2BA 1TE6A 1PX3A 5A6BD 4RNFA 2DZTA 4EPBC 3WLNA 3H2EA 4S3JA 3DOPA 3LB0A 5DANA 2DY3A 3NDYA 2F2HA 3VIGA 2YL8A 1GOMA 3SCOA 2E40A 2A7NA 2VR2A 2P53A 1X39A 2X7VA 2Z25A 2D0FA 1QAPA 2OQYA 3OEXA 4H9ZA 4AIOA 2GGHA 4PR4A 4GQRA 1MI3A 1JEZA 3IUIA 3G1VA 1JAEA 1HKJA 3PWGA 3ISIX 2DH2A 1EPVA 3ARTA 4TVUA 2E9BA 3K5XA 5GPRA 4KFOA 5IHSA 2LLEA 3CU2A 3DHPA 5EGRA 3ABQA 4Q4RA 2QQ6A 3VIPA 3IJ9A 1XUZA 4PTXA 1OT2A 5A8OA 1GVQA 3NJ3A 4A8NA 2FHCA 1FH9A 2CZFA 1GOKA 3OB8A 3FHAA 1DV7A 3SCNA 4PMDA 1TJ1A 1F3WA 2NLYA 2ZQ0A 3F4WA 1XYZA 4D71A 2ZXBA 4B5NA 3F2CA 1UD4A 1VPQA 4IUOA 1XLAA 1HW6A 7REQB 1HJQA 2FTPA 3TROA 4B9YA 1TV4A 1PKNA 4IMAA 4L6HA 2YCKX 2INFA 4GI9A 3HJEA 1QW9A 1BVWA 3ZJ8A 2WVSA 3DESA 2D23A 2O9RA 2E0PA 3OLGA 4MWAE 3F4CA 4DUVA 1JF6A 4GVFA 1UOZA 3V35A 4RXFA 4O54A 3VIJA 1ECEA 1E0WA 4LJ3A 3S9YA 1NF7A 3CIXA 4FOKA 3W2UA 3K1GA 4Z1BA 3FCPA 1OK6A 4O8AA 3TR2A 1B3VA 2TRSA 1G6CA 3HO8A 1I45A 3WNLA 3IWPA 5AB3A 1P43A 1AVAA 1PWLA 4YYCA 1TZ7A 3A12A 1R8LA 4NF7A 2NQLA 2YL9A 5C2XA 1H63A 4Q33A 4YL2A 1DP0A 1VBHA 4MTVA 4ZOAA 3L65A 4M51A 3SCWA 3PK7A 2CU0A 3XIMA 4FNSA 3TFXA 4ZXOA 5D9NA 3RX2A 4FMVA 2BNJA 4TMBA 1YE6A 1FWBC 4UR9A 3B40A 3ITOA 3QQWA 4TUFA 3E2SA 1H7WA 3PPCA 3OVQA 4AAJA 4UTKA 3N2BA 1E9ZB 1XDLA 1W3TA 3BH4A 4NAFB 2DT2A 4R7JA 5M3WA 3V3WA 2P8CA 4HK7A 2OELA 1EYEA 2BV9A 3GFYA 3Q4DA 2GYIA 4ZVJA 3HG2A 4ZL1A 4GY7A 4H41A 4DUWA 2OEJA 4N9EA 2ICSA 1G94A 1TA3A 4DO7A 4EIVA 2VX7A 3DG6A 1QJWA 3IJQA 4R3UA 5I06A 3AU6A 3W29A 2WCSA 1LLWA 2QLYA 2WPBA 4Z2GA 4W5UA 3IEBA 4GYPA 4LTSA 1MW0A 3T2QA 2UY4A 3NQ6A 3RX4A 4CKQA 2DT3A 1KR1A 3OQEA 3LPPA 2FGLA 4U4MA 3OYXA 3VYLA 3LBMA 1NVMA 2ZRYA 1K6AA 3TLQA 4HA3A 2NX9A 1MNSA 4H9UA 2PDKA 1A47A 2Y4SA 3K8LA 3F4DA 5FL0A 2HMCA 4A35A 3OOQA 3IIOA 1N8IA 2GQ3A 4GACA 1CX9A 1YPFA 4H2HA 3GHSA 3W74A 1T6MA 5RUBA 1AJ2A 2CYGA 2XIMA 2VM8A 3N9RA 5DY3A 3VILA 4AHOA 4N2YA 3CPRA 3DN5A 1Q63A 4C90A 4IGNA 4EPKA 1TRDA 1UKOA 3MSGA 1FY6A 3WD2A 2DUZA 1AFSA 3WF3A 3RK8A 9XIMA 3P3BA 2RJHA 1D9EA 2I5GA 3KWSA 2OX1A 4Y7EA 3KRBA 2PDQA 3CL7A 2WNNA 4GQGA 1WDWA 3GHRA 3B9EA 3EX2A 1EJ7L 5A6BA 1KRBC 5G4WA 1J9YA 3KWXA 1QO2A 1Y8BA 3LENA 3DYOA 3DHDA 1Y7VA 3PZMA 1NFGA 4KEMA 3IV8A 3LERA 4HN8A 1P0NA 2FZNA 4HMNA 1GEHA 4E8DA 2FQIA 5CGTA 4JTTA 3O0FA 4FI4A 4UZUA 4KCTA 1M7JA 3D47A 4PB3A 4E4UA 3TC3A 3T05A 3UR7A 3GDKA 5FESA 4QROA 5A3HA 3WH9A 1EQPA 4ZE4A 4DYKA 3ZXWA 3EDDA 3TSBA 1EKOA 1ZS2A 2AKMA 4CVWA 1CXLA 1DE6A 4PTDA 2REQA 2CW6A 4GZ7A 2X42A 4ZOCA 2DZPA 1A5CA 2ZICA 3RCNA 2QCCA 1WXJA 3GH5A 1RHCA 1BF6A 1QPOA 2WOQA 2QUMA 1WKDA 4RW3A 2Z1BA 4CEXC 4A3RA 4LEQA 1D2KA 3M0HA 3BLIA 1S3HA 4L9ZA 4BEQA 2NXHA 3TYDA 1OGSA 4BI7A 4X3ZA 2PZNA 3R0KA 1IR1A 3GXDA 3RCMA 3BAXA 1JCYA 3P81A 4TIMA 3KS5A 1CXHA 3L5LA 4FR1A 1OX4B 2QJNA 3DI1A 3OG3A 1KA9F 5CCZA 3UJFA 1Q6RA 4DAFA 2ZE0A 2J8TA 2OSYA 4Q8TA 5CKSA 2NW0A 3AYRA 6XIMA 2EG8A 2BMBA 1SMDA 5E1QA 1U1UA 1XL9A 3REQB 1XC6A 1H1ZA 2Y7FA 2BBFA 5HWJA 3CHCA 1ZBVA 2I16A 2PC8A 2ABBA 3ARZA 2IQ0A 1Z9AA 1JRCA 1R9XA 3M7SA 3TU9A 1V3KA 1CW2A 4GYKA 1D3GA 3APGA 2OJPA 2QCFA 3B3DA 4B4FA 4LSBA 1M68A 2DZUA 3CS2A 1VS1A 2UY3A 2OYMA 1O6IA 1J2WA 4NNCA 3OVGA 4H7VA 3CV1A 1F3EA 1A5SA 2W5FA 1TWDA 1VFOA 1LRTA 2HSAA 3AIQA 3KX6A 3UZJA 3UNTA 4ZGYA 1EGMA 3NFUA 4ATLA 4PBGA 3RAOA 4ADTA 4C6QA 1QXLA 1MEHA 5BXTA 4LF1A 3O2LA 3WNNA 3EDFA 1XRVA 1I4NA 5AHLA 3WDPP 3A5VA 1TREA 1MXGA 2H9AA 1FWEC 3HG5A 4C1KA 4ZTYA 4QCEA 3PF3A 1B1YA 3AU2A 1XP3A 1CENA 2QCGA 1DIDA 3W86A 4HVXA 4UNKA 4IICA 1KBIA 3NQ8A 1QBBA 1PIFA 1V0KA 4J3XA 4I6VA 3G1DA 2FHFA 2QKFA 2FVMA 1DWHM 2BXYA 1VHCA 2WHMA 4Q8NA 5G2HA 1SW7A 3EOOA 2QCDB 1ZP3A 2UY2A 3E49A 1Z7AA 2A7RA 3WLPA 2J7CA 1Q6LA 1LLZA 4NZFA 1XWYA 4NU7A 5U7SA 4S3CA 5KZDA 2VOTA 3UWUA 5LKYA 4JN6A 3D5HA 4GZEA 4M81A 4RPPA 3WMBA 1F8MA 3M44A 3T81A 4MF4A 1FWNA 2FVKA 1VQTA 5F4WA 4MYXA 1PE1A 2Y85A 1HQTA 1BTCA 4EWND 2J7EA 4O4WA 2Y7EA 2IPJA 1KM2A 1GG1A 3T0CA 4GCAA 4LCRA 1W2VA 4XKMA 1UH2A 1RBOB 3KOZA 1RCXB 4U2YA 2C8NA 4GX9A 3DAQA 2HBVA 1TQJA 2GJXB 3CIWA 3CLWA 4AVNA 4GINA 1EC7A 2A2IA 4LCQA 3V16A 4PMUA 3H12A 2L5HA 2DZSA 4GXWA 4H8HA 1RH9A 4EOUA 2Z7KA 5IM51 1J0YA 5JUVA 3C56A 2ZZ1A 2HCVA 3ZJ6A 2X2GA 1NDWA 1D8CA 1XLIA 4D6DA 1VFFA 1EUAA 4TMCA 3IIPA 3K1DA 4AX7A 4OU1A 1LM1A 3EWUA 1JPHA 3CQHA 4KCUA 2ZA1A 5HPOA 3W84A 2PWFA 1TR9A 2OU4A 4UR7A 1UP2A 2JQXA 3H2CA 1X96A 2F61A 1UUQA 3WLIA 1H5VA 3NTYA 3UGRA 4GJJA 2G50A 3EDKA 1UD6A 2C91A 3TV8A 5AHEA 1UW9A 4C1NB 5F4SA 1NTHA 5D04C 3WL1A 3UWWA 3CAKA 3SUTA 2VTFA 3AALA 1R38A 2HROA 2DSZA 2G3MA 3EDEA 1SFSA 4U5KA 2X0HA 3NDZA 4AMAA 4DM1A 3QY6A 1DPMA 5KETA 1RPKA 1ITQA 3CUGA 3WO8A 5JIWA 2PI6A 1W56A 1RP8A 3B9OA 1C29A 2A85A 4ATWA 4XZNX 4MWAC 2X2YA 3GHTA 4IGHA 2P50A 4D6GA 4RE3A 3AC0A 1KM6A 4M80A 3DU0A 3RN6A 4XVEA 2EKGA 3I4KA 3PUGA 1RV8A 5KINA 1CDGA 1ZZMA 5I24A 2EAWA 1TIWA 3EWXA 2C15A 5LIXX 3ZVIA 3AWOA 3ZWSA 3ALFA 4GH1A 4LFYA 1QOPA 2BASA 1WNOA 1BF2A 3GXFA 2BSLA 3R5EA 5D32A 4MKSA 1AD1A 4C91A 5GJPA 4KESA 3LV5A 4B5WA 2ZBTA 4I5XA 2G8ZA 2ZXQA 1EA9C 1OYCA 3G1YA 4IJCA 1A4MA 3NEVA 4GH3A 4GYJA 1ZJHA 1UZ4A 3DBNA 3AMCA 3BARA 3QMSA 3RO6A 2QJIA 4X63A 4QSHA 4MGGA 3QKZA 1KGXA 4S3EA 1AA1B 1EEXA 2QV4A 4LBUA 1IEWA 3WLSA 1EUNA 1W1YA 1I1WA 4OBRA 3LPFA 3AS2A 1PZ2A 3BLDA 1KCXA 3M46A 3BC9A 1WZLA 2WLYA 3WEOA 4YTQA 1MSSA 2OSXA 4NHVA 3QTGA 2V2DA 3OZMA 4XAZA 3BLPX 3W26A 1VRXA 1IR2A 2XWEA 3RU6A 4AEEA 4Q6XA 1BG9A 1ME7A 3AUOA 4C6FA 3KXQA 5AC5A 3LUTA 3DC0A 5AYZA 1C7TA 1TSIA 3UQNA 3HMJG 2X1IA 1VZWA 1GVIA 3NQMA 5ABEA 2OLSA 1S39A 2VC9A 1CPUA 1S5TA 4OQVA 3STEA 3OZOA 1H1NA 4XAYA 3FK4A 3VVGA 1YXCA 2JK2A 1F74A 1P6BA 3M0ZA 3ZMRA 5DBUA 2C18A 3TYZA 4C65A 2WB5A 4H2CA 4TTGA 1A80A 3G1SA 1QNOA 3W1QA 4GG9A 3T8LA 3QEZA 1UMLA 4BS0A 3P74A 2QCMA 5FJJA 2VZVA 2VJXA 1W3LA 4Z2HA 1JFHA 2D73A 5T91A 1JDAA 3BANA 3T42A 1QFEA 1UC5A 4FLRA 5CSYA 3TEVA 3V5FA 2OGJA 3S5YA 1KC7A 1D3HA 1OFQA 4O53A 4BI5A 2CBIA 2FZMA 3BLKA 3VGHA 2J9XA 4LC6A 2VGIA 4BQ5A 2YSWA 2C0HA 4DHGA 1X7FA 4WGHA 2QXWA 1U33A 3W88A 1HJVA 2HVMA 5CZTA 1UIPA 3GKFA 2GDVA 4PMNA 2F6XA 3NM1A 1MQRA 2ZTJA 3RM8A 4M19A 5CEWA 4JAWA 4GVGA 4FLOA 3WF0A 4GC4A 2OVLA 2HS8A 4CNUA 1LG1A 3NL3A 5FACA 1DIOA 3FFSA 1JXKA 3WDJA 5H6HA 1O5XA 4GVIA 4EK7A 1J5SA 1T99A 3BL3A 1VC4A 1YRRA 4UC5A 3WF1A 2HNHA 4HA1A 4NVTA 1SM9A 1HP4A 4LBRA 1A53A 3ZIZA 1W3IA 4QEHA 2NQHA 3ANUA 3A4JA 1Q2SA 4N6EA 4ZBCA 3IUHA 2OB3A 4FR6A 1C9DA 4Z17A 4M56A 4DBWA 2YCIX 2G41A 2QMJA 3MV11 5HMDA 1VFUA 3E5PA 3TH6A 1W5MA 4DIAA 5C9UA 2G4FA 1BYCA 2X0YA 1EXBA 1E9IA 3N4FA 3R94A 4W7UA 4C6OA 1FQ0A 1XGEA 4JTLA 3PBYA 1JYVA 3CB3A 2BOGX 3I7RA 3RRAA 2WYSA 3TN3A 5LA2A 3POHA 3LLXA 3WD0A 3CEUA 3M4HA 5T9BG 2Z26A 4NJIA 4N9DA 4B9ZA 3VIOA 4M6QA 3WD1A 3QV9A 2OR2A 3URBA 3S42A 3T8QA 3GKAA 1T0OA 5C0QA 2GOUA 4L9XA 3VOGA 5HA7A 3L21A 4KBXA 3H4WA 9CGTA 1E3XA 3TCEA 3QH2A 3WNKA 5HNRA 3N9SA 2YKKA 2VFFA 1GVOA 5H8MA 3NQGA 2UY5A 3MWCA 4DZAA 3CAWA 4US5D 4PRTA 3WCZA 5C71A 1E4MM 2OT1A 3FX4A 2HV5A 2QULA 3S2LA 2PD9A 4WDXA 4W93A 4WJXA 1V3LA 2V6AA 3W85A 1CZ1A 4HTBA 2CLEA 4HK5A 4HCLA 3S6DA 5HJYA 4F8XA 4AW7A 1TTIA 3A4XA 2A7PA 3HG4A 3ARYA 4WXYA 3Q37A 4HA0A 1JVNA 2CCRA 4RZBA 1VENA 3AICA 2G0WA 5TBOA 4PUNA 1RPXA 3KRZA 4UCGA 1MFVA 1XIBA 2P3ZA 3IJIA 1M7OA 3WQ6A 4GIRA 4CCCA 2Y7DA 3SI9A 2J8GA 4JNZA 1ZPTA 3R1ZA 1EGVA 4BKNA 3ABZA 3CQKA 3UWQA 3SGUA 3M0YA 3ZR4A 1DWIM 4CVUA 4IFOA 1R2TA 1F3XA 1R0MA 3ZT7A 4PCNA 4Q4PA 3N14A 3G0UA 1RXOB 3UR8A 3R8HA 3BAKA 4YTUA 1T40A 1YNYA 1H60A 3AXHA 1PKMA 1EB3A 2PWUA 3Q2DA 3MSRA 3WLMA 3U48A 7REQA 3M7WA 4LUTB 2JKEA 3TTOA 3ZWTA 4Q3MA 2CLKA 3ZZ1A 2ZRXA 4HNTA 1HVQA 3N29A 5CC3A 1DJNA 2QUUA 3MMTA 5A6MA 5G4HC 5EBAA 1JR1A 1DVJA 4L5ZA 3IIZA 2WMIB 1JF5A 4P7RA 2EQDA 3HGOA 3HM7A 4X60A 1RK5A 5F1UA 5ECVA 2CNCA 2XIQA 1XBYA 5ENLA 2PCQA 1MO0A 3EWWA 4MAVA 1V0NA 2H90A 4WUIA 4DBSA 3BTNA 3SSJA 3UD6A 1LQ0A 2V0TA 4V28A 3DFYA 1DWJM 3E0IA 2GQAA 5M5DA 4GI4A 3PUOA 1CTNA 1DWFM 3W76A 5GNXA 3VE9A 5BOOA 1LF1A 1KB3A 2PTWA 2O9TA 4XBJA 2QCEA 3URQA 1W1TA 5FI8A 3R6IA 2GFTA 4J5NA 2BY2A 3NL5A 1L2UA 1VIWA 3BO9A 5CZ0A 2WMGA 4LUSB 3VNJA 3N25A 1GVSA 2ACQA 4Z1DA 1HFBA 3AYVA 4U5IA 2YDRA 2J6XA 1CT5A 2GUUA 4B15A 4P8VA 1J10A 4GYFA 2BGNE 4KWUA 3OU8A 1B57A 4UNLA 1NP0A 5CBBA 3P7YA 4IIGA 1PB0A 4GC3A 3KLKA 2HS6A 4DXVA 4PFMA 4NJGA 2Y8VA 1SZEA 3HFYA 3BK0A 3WQDA 5DRIA 3ZLHA 4HP5A 4C7DA 3IANA 3S47A 4E3VA 4I8YA 3KHJA 4L65A 3FY1A 3LSCA 1M3UA 2EPHA 1OCJA 1R5YA 1RA5A 5EMMA 5D2YA 5TQLA 3W1XA 4Z2IA 1CLKA 4BK9A 1M6JA 3E02A 1LQAA 3PTDA 1HO4A 1MQQA 3VKCA 3OYZA 1FHLA 1S5MA 2GOKA 2VGGA 3S6TA 3WUGA 5A95A 3LHZA 3HN3A 3PFMA 5CGQA 2NQ5A 1Y5WA 1S46A 2VVNA 2B4GA 3WBYA 4XZMX 2PWVA 2EKCA 5HXMA 3BOFA 2VP8A 2BVWA 4P8UA 3KRSA 4GE8A 4PMOA 2R82A 4X22A 4HNVA 3LTPA 1GHSA 3CHVA 3HV8A 1R2SA 2PDWA 4F0SA 4JTDA 2NUWA 3QLLA 1ZAHA 2PBGA 3JR2A 1SZRA 4URIA 2PTXA 3AS1A 1H62A 4A8IA 3VX0A 4AD3A 8RUCA 3V1PA 3VNZA 2JIWA 3SUSA 2BVYA 4MMWA 4IX0A 2F2KA 4US5A 3W1TA 1OGGA 1ADSA 2F84A 4AWEA 4HZ7A 1OADA 1YW1A 3N4AA 4XX6A 5CPSA 4NY2A 2C0AA 5LHFA 1UROA 4Q32A 4G2DA 1SJDA 2A3HA 3QYQA 3EOSA 2Z0IA 4IPJA 3M5VA 3IAQA 2WVUA 4TTUA 1KWGA 4Z0JA 1BG4A 2Z29A 2DQXA 3FIGA 3N6QA 3O6DA 2EEXA 2XIIA 2XH0A 1S2CA 3CL8A 4HQVA 1GJWA 1AODA 3SCPA 3GDRA 3Q58A 1BLIA 1GPWA 1HJWA 1EJSC 2BXVA 3HJZA 3WQWA 3G2GA 3T2PA 3WDIA 4GHRA 1K9FA 5C9XA 5HPCA 2FKPA 3PAOA 4YMZA 3NL6A 4BF9A 4H6KA 2XVPA 3R79A 4GUGA 5E09A 3RCYA 3BG9A 3KL0A 4XD6A 2ONEA 2YXGA 3IJDA 1E0TA 3SRDA 3THQA 2E68A 2Y7GA 3C0QA 2VEKA 2WV8A 3UT0A 3QW4B 3UW6A 2AAAA 1HNYA 5I3GA 4Z0SA 1OF6A 4BJHA 4M7TA 1MEWA 4QJ4B 3GWQA 1V3JA 4EVZA 5D2XA 3B0UX 1KBJA 1V79A 2XVGA 2W6RA 3GDBA 3T0BA 4GUJA 5TD4A 3SN0A 1NWSA 1Q5MA 3MO4A 2Y63A 3QR3A 2R9RA 3REQA 2EPOA 3LY0A 2G3NA 6ALDA 7ENLA 4N42A 3GS6A 1JZ6A 2C16A 3QHNA 1MEIA 4J35A 2HBXA 5MHBA 4U3CA 4LNCA 4W86A 2YR1A 2ZIDA 3IVUA 3PBMA 1LBLA 3CZJA 5LGZA 3TP4A 1R9ZA 1CI1A 1XYBA 4HNUA 1JD9A 3KZPA 3AXXA 4NSBA 3VZXA 3AAMA 4DRSA 2YZ5A 1WZKA 1UUMA 2FZBA 3QVQA 3FOKA 3EMCA 4JCMA 4ICMA 3S1XA 3CIVA 1JI2A 5I23A 4MIMA 1J2BA 4EWJA 1RSCA 4JHOA 3VKKA 4W85A 5K4XA 1MXSA 2WC3A 1JPDX 1PHWA 4GQ0A 4Q4QA 1S2UA 2GSHA 2C1GA 3MP3A 1EDGA 1X1NA 4K8EA 1FWSA 4C7GA 3HQPA 5M1TA 3LCIA 4NAEB 1RP9A 4C6JA 3UR2A 3KL5A 4UXDA 3HPAA 5HATA 2EG6A 3ARVA 2A5HA 5DBTA 3SY8A 1Z41A 3RHGA 1WZAA 3SY1A 1EJWC 4TX9A 3W7PA 4JIRA 3LTYA 4MLJA 4AHPA 1Y5VA 5BCAA 1H1YA 3K4AA 1XDJA 3M47A 2B81A 3P0WA 3CZLA 3IACA 5HUPA 1YYAA 3G8RA 3R13A 3N12A 1R3YA 3RIKA 2DSKA 3BE7A 1AQMA 3AROA 5A6AA 2PRMA 1TYGA 2A4AA 3DFPA 5JVLA 4GJIA 2DUXA 2QCDA 2D2JA 5CGMA 2QUTA 3NAVA 1X1OA 2NVAA 3ZS4A 1JGIA 4O1BA 4F79A 2VWSA 4OE7A 1A5KC 5D4YA 4DO6A 4MB3A 1XIFA 3BAYA 9RUBA 3UCDA 4A8LA 4L6OA 3E12A 1J6OA 4UFHA 4O14A 4NZ3A 2XM1A 1VLWA 1EYWA 1MUWA 4LQ1A 4WLCA 3KFTA 3LBCA 2YFNA 5CSSA 4BQ3A 4DZ5A 1DORA 4NL1A 4OUIA 1NFBA 5A6TC 4O11A 3W7QA 3PZVA 5D8ZA 2V5DA 5T9CE 1PUDA 4WRHA 4OKDA 3T55A 1YTDA 1HJSA 2XDFA 2F6KA 1XFBA 1B2YA 4GIEA 1KFBA 4AZIA 4MJ4A 4L64A 3EKZA 4EANA 2RKXA 2BHUA 5IFPA 4XD5A 2GJXA 1O60A 2FB3A 4J40A 2WK2A 1C93A 2XGIA 2F38A 2W63A 2FH8A 2WMHA 1RQBA 4N0RA 5HR6A 4PEEA 4RUBA 3TQPA 3W7EA 3W9ZA 4HSHA 2YXOA 2XFYA 4GABA 2YCJA 1F05A 5DMMA 1LP6A 3OGVA 2P88A 4OBSA 3QMRA 5TAOA 2YX0A 4MYAA 1AL7A 3LGEA 3WF4A 4HPJA 4CEUC 1DJYA 8CGTA 3KDOA 3BLFA 3ZFHA 4U33A 3ME3A 1SR0A 4IMDA 3SN4A 1VD6A 1ZJAA 2INZA 3C2OA 4AWTA 2VZUA 4Q7NA 2NUYA 3RPDA 4HNCA 5HMSA 5FJPA 4C1NA 1UR3M 3BMXA 1RLDA 1QW7A 3W2MA 5IXEA 1OHLA 1Z42A 1OFEA 1YMYA 4D6IA 1BD0A 2E28A 4MKVA 4U3AA 2V63A 1G4PA 4J3UA 3AIWA 3KDNA 4JYDA 1QI3A 1XLBA 4OGZA 3W1UA 1IZKA 2PC4A 4XWUA 3TN4A 3CUJA 3TNOA 1SO3A 4QG6A 2Y89A 1EIXA 3N6JA 1E0VA 5AVHA 4UZSA 4WKFA 1ZJBA 1QVBA 2FFIA 3KBJA 4C6LA 1OVDA 2CLLA 4E4PA 2J62A 3SY5A 1TPB1 3GFZA 2ISWA 1P48A 2X7WA 4F4RA 1YNQA 3CTTA 5IDIA 2OEMA 1MDLA 4RZ4A 3H6OA 2Q8ZA 2QDHA 3RG6A 4CNOA 3F5LA 2FDSA 2WLZA 3TA9A 3HIJA 1GKRA 4CNSA 1KTNA 3WLJA 2D3LA 4N9CA 4L1GA 3PNUA 1WDRA 4F0MA 4BQ4A 1YDYA 4ZE5A 1X8CA 2PWDA 4H7ZA 2Q8XA 5C8BB 3WG6A 1UMYA 4P2VA 1FKWA 1ZHAA 5CC5A 1H7NA 2ALDA 1POKA 4MNKA 4ZQCA 1FDZA 3L4ZA 4RDVA 1B3ZA 1BYDA 4E6MA 4IH3A 3E3HA 1EDQA 1W1VA 3E1F1 4JHZA 2YA2A 4B5SA 5DMYA 1WOAA 3GW3A 2WMKA 1DJQA 5DXYA 3AWNA 2YZRA 4YWIA 5CH9A 1YBQB 1YE4A 3WLQA 4MPKA 3BW4A 3O07A 3AHYA 3F4NA 3CASA 3L0KA 3JZEA 3I65A 2YLLA 5CJNA 4AIBA 3A21A 1GNXA 2GUBA 3GC2A 1GONA 1UH4A 2IXVA 4JFTA 1VB9A 3LHTA 3CQIA 4R33A 3MV01 1UR1A 3EB3A 5HANA 1I60A 2H3DA 4HYVA 3TQVA 3VDHA 2YYTA 1R2RA 3MI3A 1DTNA 3MDUA 4NILA 4HPHA 4DO5A 1O12A 1GQJA 3NO1A 1FOBA 2YDQA 4DLMA 4GVHA 1IEVA 4JKLA 4H3DA 3CJPA 1OCQA 1HKMA 5E9XA 4JS3A 3KTXA 3ECQA 4AZGA 1CXKA 1IIGA 4AXKA 1KCZA 1J11A 3LA4A 3VDGA 1PS9A 4C6CA 2PRHA 1YIXA 3UPBA 1TWIA 1TA3B 3MKVA 4Q7BA 4IT1A 3CMFA 4YNGA 1HKIA 2I14A 4A2SA 3TW9A 5CZKA 4MKNA 1GCYA 1K8YA 1XSIA 5CSUA 1V6UA 2OZ0A 1Y5XA 4IPPA 4EP8C 3DFNA 5BRPA 4DO4A 1NY1A 3TWAA 4M6UA 1NEYA 1P0BA 3XISA 4DWSC 3AXIA 1OBAA 5FEZA 3L4TA 1OC6A 3MANA 3T6CA 2V3GA 2DQWA 1AW1A 2PZ0A 4KWSA 2FZ8A 2FPYA 2WNQA 2OKOA 3TN5A 1XD0A 2RH9A 3OLEA 3USBA 4GFIA 4AC1X 4A21A 2Z24A 4AU0A 1P7TB 3A5FA 3PPGA 4PUWA 5H1WA 4ZSUA 1VLIA 4IP4A 1GQIA 5ABFB 3G3MA 2XWDA 3P80A 3VD4A 1VJIA 2OOFA 1EDTA 3OODA 2WSKA 1RCOB 3KTCA 5J04A 1OG6A 4WJ8A 3CXOA 4MDOA 1O5QA 1Z8AA 1E5JA 2QAFA 2B7NA 4F0RA 4ES4A 3I6EA 4UIOA 1EZWA 2XIBA 2XIJA 1AZ2A 3W71A 3FXGA 2WZIA 3DUGA 1W3JA 1AUSL 3GNNA 3SUVA 1TX0A 2XTKA 5C7VA 4V33A 5TF0A 1CXEA 2XVLA 4CD4A 3DBPA 3LEPA 4OHQA 3BCJA 3DFHA 1UWAA 4IGMA 5HUOA 1CGUA 3LU2A 4NASA 2MNRA 1KM5A 5K4ZA 1QUMA 3MMDA 3PSVA 1TPDA 2J27A 3WYZA 3UXDA 2WANA 2XU2A 2P3EA 2VVSA 3A9BA 4AG0A 4B92A 4HB7A 1UB3A 1DYSA 1M9HA 3KVKA 5BNKA 2EPMX 3NQ7A 1HL9A 5H8UA 3BDKA 3HV9A 2A1YA 2ACUA 2FMOA 1R3SA 4ML4A 3ANYA 4HOXA 1W5QA 4XBKA 5AC4A 1QTWA 1W3KA 1A0CA 4LRSA 3LXCA 2GDQA 3SDOA 1HGWA 4IX2A 4B3ZA 4Z08A 4XV0A 4M1BA 2Z2AA 1O94A 4PEKA 1PCKA 1TV8A 5C7HA 1PZ1A 1BGAA 4AD2A 3LMYA 3OO2A 4QJ1A 1YDVA 3DCPA 3TYBA 4S3BA 3CYJA 4U10A 1PZ3A 3FS2A 4CLMA 1GOOA 2E3ZA 3FVDA 3OLDA 1LTDA 3OZYA 2YCLB 1M5WA 4I9MA 2KZHA 1UZDA 2V5LA 4AEFA 4JEQA 3BAWA 3TE9A 2P0OA 3P84A 1R85A 2QIIA 3IGUA 2QEZA 5KITA 4I5RA 3WH7A 5TIMA 5LSMA 4L4OA 2Q71A 1MDRA 3MY9A 3WLHA 3UA3A 3VNYA 1KBBA 3K4WA 3STGA 4HPGA 2AAMA 4INFA 2QJJA 2ZFAA 2DUAA 3ARSA 3RO8A 4NZCA 3I10A 4IMGA 1TPEA 1C8YA 4MWAB 1J01A 4XAFA 1V93A 3N3MA 4AZ5A 1VCGA 1PWMA 1XCXA 3IGSA 5EYWA 1WP6A 4DPQA 4RX0A 1TV7A 1B3YA 1G0CA 1TIMA 1TG7A 1WPCA 4A2RA 3CWNA 3KAOA 1DE5A 1PIGA 3QSRA 3FEMA 2G3FA 1Q6FA 3II1A 1EHNA 3CZKA 1WUEA 2V2CA 1EJTC 1DKWA 5FF4A 3QC0A 4DZHA 1U1HA 1EP3A 3THCA 2WCAA 2OO0A 4PTMA 2QVHA 1XSKA 4MJMA 4NUWA 1ONXA 1IGWA 1H3GA 1LL7A 3H4GA 2C6QA 3G0XA 5JH1A 3E9AA 2WMIA 1CGXA 1CBGA 3C2EA 3L4VA 5D2WA 2R1KA 2YFOA 3UXKA 2HJPA 4GJ1A 4NIRA 1E0UA 4O1EA 4LWWA 4FK9A 4XG1A 3BSHA 1U1JA 1XIHA 3AZTA 3AIEA 2HRWA 2AOSA 3PWAA 1PZ0A 2WCGA 4Z42C 2AKZA 3WZ0E 1J96A 2PDLA 3QFWA 2PWEA 3B9DA 1K6WA 3TZFA 3CLMA 3ZM8A 3AISA 1UD3A 2J66A 3KCOA 2VUNA 1HJUA 1H0IA 3QJAA 1WKEA 4HU4A 1OJXA 1QMLA 4Z1CA 3THAA 1Q7QA 1D7FA 2NSOA 3UZWA 3WN6A 2ZZ5A 4GY1A 1TE1A 3SADA 4LUSA 4MVAA 3W7MA 5I77A 3VNKA 4ADSA 3U7BA 4M3PA 2GUYA 4BI6A 4DF0A 3M5YA 4OUEA 2PUZA 4HGXA 1FCVA 2P5NA 1PYMA 3DI0A 1R3VA 2FGBA 2YDSA 4WCJA 3ABRA 2GSJA 3NZ1A 3SEPA 5M17A 1P0DA 1UCWA 1JUKA 3M0JA 2ON3A 3ICJA 3UFYA 3MHUA 4REQB 5M2FX 1FFQA 3N4EA 1T41A 1FWDC 1AL8A 2DVTA 1JQVA 2FPVA 3OHIA 2VCAA 4I9TA 4CQ9A 2HK1A 2VZOA 3BW2A 1MZHA 1E1CB 4K8HA 1VBRA 1OC7A 3P0XA 3V5CA 3MUCA 1JQXA 4DYJA 3EWZA 3GR4A 5DMLA 4Z1AA 4LY4A 4ACZB 3PPHA 2R8WA 3AJXA 3AZRA 4GQBA 4JHMA 5BMXA 3LPGA 4N9BA 4W7VA 4HOZA 2HE8A 1VCVA 2V67A 4YN5A 3TQ0A 1H7OA 2GVLA 3B0XA 2CEQA 3OBEA 3PZ9A 3PVFA 2JGYA 3LLDA 5K9XA 4HIBA 3HTWA 5IFTA 4RZ5A 4A22A 5FJIA 4PE8A 4Q7IA 4FAMA 4GPNA 1CCWB 1XPGA 1G4EA 3VCNA 4Q8WA 2HEJA 4GXMA 4MY1A 4I3GA 3EDJA 3EEZA 4L1WA 1W2PA 3M0VA 2VWTA 4PGLA 4C1LA 3L12A 5FJUA 3U57A 3WX7A 3MKKA 1MVYA 1GVYA 4S3AA 2QDEA 4B5UA 4A6GA 3P2VA 5DY2A 3SSZA 2ZUNA 5CPOA 3C8FA 5CBIA 4ACYA 4XKYA 1QHZA 1JZ8A 4DJFA 4UQ9A 3W73A 1GK8A 1ZAJA 2PDMA 1XBZA 3HMCA 2ZZ3A 3PG9A 1NSJA 5AHFA 1GZ1A 5A1AA 1IGSA 3RF9A 1S1RA 2V3DA 1J5TA 1W5NA 3OTRA 2PMQA 1PV8A 3RNDA 1VPYA 5AYIA 1M7XA 4S3KA 4OV4A 1TV2A 1EC9A 1KQZA 2AGKA 4FZIA 4C6EA 3I4EA 3NPWA 4QGCA 4JTSA 4LU0A 3UBPC 3KVJA 1OFOA 4OIFA 1H5YA 2ZUTA 3W7CA 2HE5A 3WQ8A 4IJRA 4C7FA 2VDGA 4YPJA 3DFTA 3B4YA 4UNIA 1T8QA 3NQEA 1N8FA 1CLXA 3LK6A 1O5RA 2OPJA 4HMCA 2EPKX 4E8CA 1Y65A 1F4AA 1JPKA 2OODA 4LUYA 3JRKA 4CU7A 5AHIA 3C3NA 1GVRA 1UR2A 4HJFA 3TJXA 1VBUA 1W1PA 4PMJA 1QNQA 5I3FA 3S8HA 1Q4NX 3BW3A 1KRAC 3MBDA 3U2EA 5K7JA 5KSWA 4W7WA 3WJYA 4AYGA 7XIMA 4HZ8A 1QI2A 4YVVA 2XISA 1KM4A 3BMWA 2WJFA 2VGBA 2VYOA 3VMOA 2WKJA 3LM3A 3E2QA 2VFHA 1X6LA 4AUBA 4IXHA 4LX4A 4G9PA 3ARUA 1YNPA 3QTPA 3UU0A 3ABSA 1A3HA 4JYEA 2Z00A 3M41A 4A3QA 3L23A 2GJRA 4XO6A 2J8FA 2C3ZA 3SAZA 3QW3A 5D2TA 1G69A 4HOWA 2UBPC 1IZJA 3CMGA 3QQ1A 1ME8A 1TVNA 1VFSA 2YA1A 4M82A 5K9DA 3L5MA 2NV9A 2VELA 4QDMA 4QEEA 4ICNA 3UETA 2Z1VA 3PTKA 3HF3A 3H8AA 2J74A 3BG3A 1GEQA 4IF2A 1ZCCA 4IHCA 4C5YA 1RQHA 2ADAA 4LW7A 2EGZA 4ZFCA 1W1A1 2PPGA 3CV2A 3TC7A 1VFMA 3EPMA 2Y2WA 3UY7A 1IV8A 2I9EA 1WQ5A 4S38A 4NAEA 1OYBA 4RNIA 3BSGA 3DG3A 3WMSA 1UC4A 4F9JA 1Q6OA 3H7VA 2CBUA 1SW0A 1NJJA 1RR2A 4ZCWA 2Q09A 4OBTA 4PSRA 1RZMA 2E1DA 4BFAA 4J2MA 3APTA 5DF0A 3WQOA 3N17A 2E8YA 3GDMA 4CD8A 1VEMA 1B9BA 3PZIA 2Q6ZA 4V27A 2FDMA 1M7PA 2YBTA 3M6YA 4AWSA 4L4MA 3GBEA 4FNUA 2EO7A 2W9MA 1OG0A 2V2HA 4TVCA 4G1KA 3W2JA 1O1HA 3SECA 1XF0A 4JFWA 1TPFA 5GNZA 4B90A 1XH2A 1E71M 2PDYA 4AIEA 2PE4A 2A79A 3O06A 5EBUA 3H24A 5J8LA 4DJFC 1JNDA 1QPKA 2VRJA 5CG0A 5HMEA 1UWRA 2V82A 1A49A 3CH0A 4JQ2A 3A3WA 1JIBA 1Q6GA 3SIZA 4GX8A 4YHEA 3QRHA 3QV6A 3VKAA 2CWXA 1KV5A 1LJYA 2OG9A 2Y24A 2TSYA 1X97A 1QBAA 3CM4A 1E6RA 1R46A 3GLCA 1OZQA 5JIPA 5DO8A 2WSRA 2MUCA 2VXNA 5BXPA 2QYGA 1MUCA 1TPC1 5LNSA 3W38A 3GIPA 2O55A 3VMNA 1U83A 4K2SA 2DZBA 3OHMB 2GWGA 4FO4A 1IWAA 2VEPA 1H2JA 4EAYA 2PLJA 1HGYA 2WWDA 2P8BA 3CZEA 3GXMA 3TVAA 7TAAA 1LWIA 2B7PA 2NLIA 3WBAA 1EIBA 4UTFA 2QW5A 2VEFA 4QR6A 3CGTA 4AIUA 1ZCOA 1YDNA 4QE5A 4UTJA 3M0KA 5HQEA 5JQ9A 4A29A 3GAYA 4WY0B 2A0NA 3B9AA 3W83A 1B54A 4AVFA 1EJXC 3EEGA 2NX3A 1X1ZA 2Z1KA 4MNJA 2XFFA 1LWJA 1XI3A 2VX5A 4XBSA 4F0KA 4JTHA 3M64A 3JS3A 1LL4A 4M5PA 2FB2A 3I6RA 2D0GA 5CQ1A 4W8AA 4DNMA 2JGQA 1WBHA 3NPUA 1QNPA 4QDWA 7PTDA 5FEPA 1BTMA 3HPZA 1SZNA 4HU0A 3GM8A 4MY8A 3VMPA 4EXBA 1Q3NA 1V77A 2OFJA 2O9OA 2V30A 3AHZA 4YCPA 3GXNA 5GJMA 4QDPA 1S2AA 3CO4A 3ATYA 1TWZA 1T7LA 3WJZA 3QPYA 3D46A 4KF1A 5JBEA 1ISWA 3H2AA 3WJXA 4GCXA 3C8NA 2D2HA 3W7KA 4DELA 1H7XA 1FX6A 4JN7A 4TR9A 1SJCA 3P62A 3UG5A 3GVGA 3ITLA 1OC5A 2I7GA 1UG6A 2BGQA 3B05A 3W87A 4O28A 1QCWA 4UQDA 4Q8VA 5FF2A 2F7FA 1UASA 3HU7A 1IZCA 2FZ9A 1VR6A 3VNDA 5LXEA 2DJLA 4PBFA 5T8GA 5CPQA 3QY8A 2W0UA 5JU6A 5AZ0A 1UPPA 4XISA 4NNBA 2JIEA 4O0QA 4LALA 3C2FA 5AYBA 3VC6A 1CYGA 4WIWA 1PBGA 3VIMA 1M41A 4LAUA 5LA0A 1GYMA 1GTHA 6ENLA 4JNYA 4IPNB 1B3XA 5A6KA 3MYPA 2ISDA 4AY8A 4ZTXA 2PDJA 2QCLA 4PRWA 3GR8A 1YBQA 3FJ4A 1I9CB 5K9CA 1VFTA 3T4WA 2FGZA 4B5VA 2EBNA 4Y90A 3K46A 4MWAD 1MW2A 1DJHA 3TW7A 2AL1A 4MAZA 4JBRA 2XINA 2E9LA 3U3HA 4IL2A 2PDHA 1A5NC 1UYQA 4PCSA 4AMCA 4AXNA 1AH4A 2JALA 4JQ1A 3B06A 4XZBA 3EA1A 4RJEA 5HOSA 3CC1A 3TMLA 1IEXA 4R34A 1NELA 4L9YA 3O6YX 2BG5A 3FJNA 4NI3A 2XM2A 4DJEC 2BB0A 3TDFA 4EF8A 5I3JA 2DEPA 3P6LA 3SN1A 1DEDA 4J3SA 5GQBA 4J1OA 1S3TC 4QLLA 1LRNA 4XB3A 4JTRA 2ZA2A 4JNMA 4Y8EA 5PTDA 2VZSA 2Q02A 3EPNA 2Q01A 2PTDA 3MVIA 1ZY9A 3V1HA 4S3GA 4MZYA 4J3VA 1XLEA 1JDEA 2O56A 1HG3A 3H2NA 4JFVA 4WSJA 1S1PA 2PP0A 3P67A 3GNOA 1GW9A 2DT1A 2GVJA 4ZB0A 1KWKA 4FALA 3BOXA 4ICCX 3PZGA 3FDGA 3H22A 1V02E 3ZLGA 1QHOA 1XLFA 2J7HA 3RJYA 3S5SA 3NOYA 2FH6A 5I7GA 4YU1A 3SFWA 4HMDA 5I5RA 3VDCA 4K8GA 1EP2A 3QV8A 3NSMA 3ARRA 1GPFA 4FOUA 1M1BA 1RA0A 1SFTA 3DECA 1PCWA 4OZOA 4IM4A 1W31A 4E2OA 5A2CA 3WELA 2CHOA 2V3EA 3UWEA 3STCA 3BGGA 3BWWA 3DENA 1TV3A 3A9IA 3QSTA 1PO9A 1P7TA 1BYBA 4O0ZA 3EWYA 4NZJA 2VQTA 4O1DA 5ABFA 1EO5A 4F40A 1EGZA 1H0GA 5B7ZA 4JFUA 4LVBA 4FLSA 4KIRA 3V75A 4Q4MA 2PWHA 1L6YA 5KZMA 1XPYA 2CZVA 3MMUA 5HNNA 4E5TA 4LYPA 3NOEA 1P0KA 1K7EA 3FJLA 3V0SA 3WK0A 3BMVA 2ZTKA 2FYMA 2GL5A 5I03A 5AFDA 1RLCL 1W5PA 4M1RA 5I78A 3G6LA 3T0DA 2VQUA 4JX5A 3AIVA 3VGBA 3AS3A 1JDCA 3GTHA 1RAKA 5REQB 3N13A 5A8MA 3IK4A 3QGKC 3ABOA 2C19A 4GUFA 4GMEA 1TR1A 1F61A 2VENA 3N15A 1RVGA 3PC0A 1Q65A 1T5AA 3OBKA 3T0TA 4WOZA 1PTGA 4UTWC 1ONEA 4YYFA 4DI8A 1GYNA 1KTCA 5BRQA 5I07A 4S2BA 5L9FA 2WWCA 3BVJA 2XPKA 5AHMA 1DWAM 4KQNA 3P8JA 4Z2KA 4LB4A 2I5QA 4XUGA 4JIHA 3QZEA 4G7EA 2A6LA 2IQTA 1ML1A 1NOWA 3RYSA 3H21A 4BWLC 2QV5A 3POCA 4PTWA 4H6RA 1NFPA 4V15A 5IDZA 1EO7A 1OY0A 4H9VA 4EXAA 1I75A 5A6LA 3LNMA 1K7XA 3RMJA 2QPUA 5LNWA 3RMEA 1LG2A 1W1IE 3Q65A 3WQGA 3JUGA 4B4HA 1ZFJA 1GOXA 4FLQA 3L5AA 1W9UA 4Z1YA 4NX0A 4MPQA 2IPGA 1XLDA 5FA5A 4ZENA 5AYYA 2JEPA 3WKZA 2YCLA 3MU7A 1LOSA 3BCDA 2VRQA 4FB7A 2A3CA 4GGHA 3LQLA 2YDAA 3O0KA 1G1YA 3MHFA 3S2JA 2Y5SA 1HL8A 1Q6EA 3GB6A 2V8ZA 1UH3A 3EA3A 4B5TA 2IQDA 2HNEA 1F6YA 3LHVA 4JCLA 2WBKA 4GIAA 2BVDA 3VOHA 3C61A 5EMLA 1X98A 1CGWA 4D2JA 1D7KA 6PTDA 4PCPA 2P10A 4UCFA 3TSMA 2PU0A 4HPXA 3U5UA 2CKRA 1Q6QA 4PUKA 3NIYA 5HWMA 1L6SA 1BRLA 2NUXA 4JFSA 2XN2A 4MWAA 5LZLA 3DYMA 3GXTA 3EXSA 1E6ZA 3C4UA 3EX1A 3VOCA 4YTRA 3HPFA 4G7FA 3NQDA 4MADA 1CNVA 3TMQA 5CAKA 4R85A 2HK0A 2XJ7A 4W4QA 2ZRVA 1OCBA 1RY8A 2NX1A 3IGHX 3JVAA 3GQYA 3KP0A 1ADOA 4QX4A 2JKAA 5AC7A 4ORIA 3GAKA 3WEZA 3SB0A 8TIMA 2F9RA 4O16A 3MUIA 1W8GA 1EWDA 3QZ6A 4F0HA 3VAVA 4QRNA 2QPSA 1XG3A 3M5XA 3I3DA 2YCEA 3MMWA 4XZIA 1P5BA 3I7QA 2TMDA 3BLEA 3NYDA 5XINA 2J47A 4CCEA 1GT8A 1XRTA 4IIFA 4NRSA 2E5DA 5E0KA 3DH7A 1XBXA 2G3JA 4K36A 3PBGA 3QN3A 1SYTA 4HTYA 1H4PA 1SFJA 1M01A 4HNNA 1TKKA 1FBAA 1EHAA 3CV7A 3ERPA 2WVVB 1YTEA 5HNUA 1A5MC 1XFCA 2P76A 1IXPA 1ECQA 3L4WA 2WMJA 1IYXA 4IPIA 3LPOA 1OYAA 3CWHA 1YXYA 3FEQA 4V2XA 4ZQNA 4Q8UA 3U4AA 4LAKA 3DFSA 2EJAA 5DT7A 4XAGA 3S83A 2CLFA 3OG2A 4MB5A 2O4MA 4GNVA 4U28A 3I6TA 1THFD 3GUWA 3GK0A 4RNJA 3W81A 1PHQA 3C2VA 4D6CA 3WQ4A 1NOFA 3BJSA 3NZPA 2ACRA 4HBKA 4MB1A 2WKLA 4X2PA 2GZXA 1QWGA 4WGXA 3T0AA 3W7NA 4D6HA 4DWDA 1UA7A 1LYXA 2BX7A 3CZ8A 4CGTA 2WQDA 1LWHA 2V5BA 1FXPA 3E6EA 1U5VA 1XISA 4V1XA 4P61A 1L6FA 3WUFA 2WHKA 3SQLA 3O8AA 3LD5A 4REQA 3UJSA 3L2IA 5AC6A 2RAGA 2VDIA 4IP7A 2OO6A 4MFEA 2R91A 2QDGA 2W79A 2XH7A 4X0NA 1CXFA 1JL8A 3SUWA 3SIMA 1O5KA 4KH2A 3WK3A 1XUUA 1W0MA 2POTA 1OZMA 3G1HA 4QISA 3TJLA 3VDAA 1E1CA 4AD0A 3M0IA 4AHQA 1VJZA 1ISVA 4J9JA 2MANA 3VOIA 4ACZA 4ERIA 1GZGA 3UWZA 1TUXA 4DWSB 3CUHA 3MCOA 5C2CA