4Y90A

Crystal structure of triosephosphate isomerase from deinococcus radiodurans
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
MQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDATVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y90A00
5KITA 3DH7A 4NNBA 3U2OA 4HKPA 4O4WA 1T96A 3RLUA 1I2QA 3S6DA 5FF2A 4AWTA 5EA9A 1KA9F 3VKJA 3DBPA 3OVQA 3TH6A 2QCFA 3TIMA 4I9AA 3NXFA 3TJLA 3B0UX 1WV2A 2PCQA 2B7QA 1SW0A 4LWWA 4YWIA 5DY3A 2VELA 3PB0A 2QAPA 2VFHA 3GAYA 4XBSA 4OWGA 4AVFA 3TSBA 4MPQA 1AG1O 1SW3A 1QR7A 4MY9A 1T99A 2NZLA 3EWZA 2Y89A 4YXGA 4P61A 1VRDA 3R89A 1KM0A 1UB3A 4ZL1A 4FB7A 3G18A 3W2LA 2QCLA 3CM4A 4WD0A 3LRLA 1TPDA 1YXDA 4NQ1A 4IXXA 3FJLA 2QR6A 4NNAA 3W7CA 1QO2A 1ADOA 3V75A 3CWNA 4LNYA 1B9BA 4MYAA 4LT9A 1R2SA 3C3NA 1G4EA 3DFTA 3PR2A 4QISA 2I1OA 4XTIA 4CLMA 1OX6A 1TQJA 4R53A 5IM51 1XXXA 1G7VA 5G4WA 4UTJA 4I7WA 4IOTA 3C56A 4LTSA 5LZLA 1JCXA 4RXGA 3HG4A 2WJZA 1TTPA 3LTPA 4A22A 4EF8A 3NQMA 3RLVA 4BWLA 5E93A 2TRSA 3UPWA 2EAWA 4TR9A 7TIMA 4N9BA 3EWWA 1AL8A 3BLEA 4Q33A 2FIQA 3E02A 3T4CA 3S1UA 5G5IA 5FEPA 4UTTA 5D37A 3RF9A 4O8RA 3PUOA 1PS9A 4O13A 3P84A 4LVGA 3M41A 3UY7A 2LLEA 1JQVA 1H1YA 2TYSA 5A8GA 5E0KA 3ATZA 4NJIA 2WNNA 1TPB1 1FQ0A 5D33A 2Y61A 2NUYA 1Z44A 1QFEA 2W6RA 4K36A 3L0KA 1YXCA 4O17A 1T8XA 1LDCA 5CZSA 3O63A 4LRSA 2BSLA 2ZRXA 5BOOA 1WOBA 2FLIA 4JYFA 3LHTA 2P10A 5F2IA 5U4NA 5KZEA 3CWOX 1M7PA 2YW3A 3CT7A 1GWJA 2OMAA 3G24A 3W70A 4ZZ9A 3EWBX 4X3ZA 4XTDA 3KFTA 1TPEA 3MBDA 3NPUA 1I2NA 3NOEA 3E96A 3QMTA 4Z1AA 1LRQA 1J5TA 5D2YA 3LCGA 3S0CA 1FCVA 2QJIA 3GX9A 5KTLA 4NT0A 4AF0A 4Q32A 2VFGA 3FYPA 4FF7A 3E0IA 1H50A 3TXZA 4G1KA 3DI0A 3S1XA 5LNRA 2CLLA 3HPZA 5D38A 3W1AA 5LNVA 3KXQA 5F4SA 3IVUA 2QCDA 2GQAA 3P61A 1R2TA 3G0XA 3JRKA 3ZWSA 3W7RA 3W71A 4UUIA 4BR1A 2F7FA 4ORIA 4HHPA 3OA3A 1G69A 3ATYA 3T55A 1SFLA 1XM3A 1YPFA 4DF2A 5G1TA 1QCWA 1L2UA 2HTMA 3G0SA 1Z41A 1RR2A 1SU5A 1EEPA 1CI1A 1Z48A 2C18A 2RHGA 2ZTJA 4C1LA 3M44A 3LLDA 1U83A 5F2GA 3GR7A 4HIBA 4HNVA 3W1RA 2ZRUA 1FX6A 4MLJA 3W74A 1FXPA 1RQHA 1TTIA 4UTKA 2VFFA 2Q8ZA 3LV5A 3AJXA 4LVDA 1WXJA 1ML1A 4LOCA 1LBMA 5DXXA 5MHBA 4UNKA 3MBFA 2VEMA 1W5PA 4QAIA 1YYAA 1IIHA 3NAVA 1OF8A 1FWWA 1HUVA 3TC6A 3TUUA 4ICNA 1KTNA 2YYUA 3C6CA 2VEKA 4OV9A 1R2RA 5HUOA 3W2KA 2CZEA 2OZ0A 3UWWA 2NX1A 5D04C 4UFJA 3W23A 4K6AA 3NQDA 4Z0SA 3EKLA 3L21A 5CPMA 4R34A 5KSWA 2Z1BA 2BZNA 1Q6OA 3PBUA 3FLUA 3TROA 3TR2A 5K7JA 2Z6JA 5AC8A 1KFJA 4JTFA 3PSVA 4FHAA 2ZZ4A 1LROA 1QWGA 3LCXA 2R14A 2RDTA 1SR9A 3B03A 1WQ5A 1KM4A 1QOPA 3LCHA 2QUVA 4XKYB 3S1VA 5F4XA 4IWWA 5AOUA 3THAA 4MYXA 3LXCA 5H91A 4OQVA 3TV8A 4EIVA 3PVFA 5H2ZA 5DCBA 4UFHA 2W0UA 1OX4A 1LM1A 4KWWA 2CLIA 1RD5A 3F4NA 4S2BA 1GVFA 1XUZA 3W07A 2QUTA 1I2OA 3NQ6A 1D9EA 3GAKA 5L6UA 2X16A 3TC7A 3KAOA 3EEGA 3VCRA 1NSJA 2ZZ5A 2ABBA 4RXFA 3UWQA 1EUNA 4WQ6A 4BF9A 1Q6RA 3S42A 3W84A 1OG0A 2EKCA 4RX0A 4N6FA 2WNQA 4UTLA 2PRMA 2E77A 4MZYA 4OE7A 1TJRA 2WKJA 4A3UA 3TSDA 1EB3A 1YXYA 2QDHA 3QEZA 3S9YA 4Y8FA 3S5NA 1VH7A 4POCA 1JULA 4UFMA 3CEUA 3LHWA 2V2DA 3WK2A 4WXYA 1C8VA 2GJLA 2GVGA 3HJZA 3INPA 4GBUA 3RNDA 2DZSA 1P0NA 1YTEA 1ZALA 3QZEA 4NZFA 2NLIA 3QJAA 3GDMA 2DZPA 1FWTA 2C6QA 1M6JA 3T44A 2P1FA 1F7BA 1IIGA 1GVSA 3SJ3A 1DV7A 3L66A 2YFOA 4JTLA 2V30A 3CC1A 1HG3A 3W2NA 1TIMA 1OX5A 1FDZA 3TNOA 1RQBA 4LW7A 3R13A 4WY0A 3PG8A 4MLRA 4EWND 3EX3A 3W7HA 1F05A 2ZBTA 3W7KA 2XN2A 3THQA 3S1WA 5DY2A 3C2RA 4JIQA 4LV4A 4JTJA 2ZRVA 4AF0B 3L0GA 2ZZ7A 1D3HA 1KFEA 1O94A 5AHNA 1ICPA 4O1AA 1K8XA 4JYEA 3W1XA 4DEFA 1GTEA 4GE8A 4UTHA 4I7VA 5F2MA 4EVZA 1XUUA 2W79A 2GQ9A 1MZHA 2GPTA 1VYPX 1KM5A 4ZQNA 3QW4B 2KZHA 2DZWA 1NFBA 3L5AA 3P67A 4PEKA 3R2GA 1HO4A 2Y7FA 3BG9A 3O15A 2BLEA 3H54A 4HNNA 3G1YA 1ICSA 3LXAA 3LRMA 2ZA1A 4FNQA 4M6QA 4UXDA 1N7KA 3NGJA 3GKAA 3AO0A 3C2EA 3CIXA 1S3HA 5G1YA 3OVPA 1A50A 4CQ9A 1YTDA 3L2IA 3BV4A 5DN1A 1OYAA 3RMJA 2CLOA 5EKYA 4UIOA 5HWJA 5D02A 2FPVA 1LLZA 1W31A 3M7WA 2ZQ0A 1KM6A 4QNWA 5HWMA 2B7PA 4AEOA 1W5MA 4NJJA 4N2YA 5U7SA 3I68A 2ZRWA 4D2JA 2CW6A 3N9SA 3O6DA 4K7YA 4FEZA 4RCXA 4E38A 2OJPA 2VXNA 4FNRA 3IIPA 2V9DA 4JX4A 1QO5A 5AHEA 2O7SA 1WBJA 1JUEA 5HJLA 3IGSA 1Q3NA 5DELA 3SFKA 5D32A 4GUFA 3EWXA 1K3UA 1GYLA 2EPHA 1LRTA 1YTKA 4OU1A 1JCYA 1X7FA 2OCZA 5C6MA 3W88A 2ZCGA 4JTUA 4O4VA 5TBOA 4UTWA 5CGQA 2VFIA 2A1YA 2DP3A 2NWRA 5J5RA 2NXIA 1OK6A 1SSGA 5BMWA 4FXRA 4AH7A 3CHVA 1KTCA 1SO4A 4JTEA 1OFQA 5J5DA 1W3IA 1H1ZA 2H6RA 3O06A 4E2BA 4JR5A 1TYGA 4JD4A 2CLFA 4UTTC 4LC8A 1LBFA 2QEZA 3B4UA 3W1NA 2H3DA 1FXQA 3IVTA 2Y6ZA 3TX9A 1FY6A 5LHFA 2YR1A 3EXRA 3OIXA 4IGHA 4AXKA 1IXOA 5K9DA 1QAPA 1YADA 4KWVA 3P5ZA 4M5PA 4N4PA 4CCEA 1QPRA 4QSHA 1OFRA 3PBYA 4TU1A 4HN4A 1GTHA 4O0KA 3LRKA 1JVNA 1JQXA 4JY9A 2WSRA 1H7OA 5E1QA 2R91A 1XCFA 3W76A 2BTMA 3TE9A 4Y6GA 3IGXA 1TV5A 4N9CA 3U8GA 4UCGA 3DGRA 1YLVA 3LERA 4AAJA 3W1LA 2P0OA 1KLYA 1AW5A 2J88A 2QCNA 3L5LA 3YPIA 1TPH1 5LNSA 1HTIA 1TTJA 1Y0EA 1P4CA 3W75A 2B0MA 2NXHA 3QC3A 2A0NA 1UASA 4MUZA 3QQ1A 3LM7A 3IIXA 3BW4A 1MEWA 3IIVA 5CZJA 1XBVA 3DFQA 4FO4A 3DU0A 2YFNA 5F1UA 4TMBA 1TRIA 2E6DA 1ME8A 2Y63A 3DENA 4XKYA 4BK9A 4N9EA 4GC4A 2ZZ1A 5AC7A 3T7VA 1SO6A 3NM1A 4GUIA 3E49A 4GFSA 4ML9A 3QFEA 4NJKA 3TA6A 1DQXA 1JRBA 5SWUA 3A9IA 3N9RA 4O14A 5F2LA 3L0NA 3NQEA 3CU2A 4JTSA 3S5OA 3U6WA 3UY8A 2FFCA 1SZGA 1SZNA 3MWAA 4HPXA 2OT1A 1C29A 1PCKA 1JCNA 2C19A 1JCLA 4FX8A 3QMSA 5CPLA 3QPYA 3WJWA 1X1ZA 1YDVA 3NDOA 1M5WA 3OHIA 1TV8A 1TV7A 5C55A 3W7NA 3MI3A 3EX1A 3NM3A 1LZOA 1ZAIA 3O07A 3CQ0A 1O5KA 5G2HA 2A6LA 1B3OA 2NXGA 4O54A 4CCCA 3KRSA 5EY5A 2ATMA 3KRUA 1B4EA 4AHPA 5AHIA 1OVDA 1MEIA 2B4GA 2A7NA 4BI7A 2A7PA 3ABQA 4AWSA 5D09A 3NA8A 3G8RA 4M7TA 3SZ8A 1SPQA 1OJXA 4FIQA 5AC6A 3V1PA 3P5YA 4A2SA 3KVKA 1KV8A 3QPZA 2QCEA 1AMKA 3NZRA 3IV3A 5HMSA 3S5ZA 5D05A 5AHLA 1I4NA 1EPXA 3NL6A 3HQ1A 2C13A 3DFPA 3HGOA 1VR6A 4JDYA 4OBTA 1S5WA 4U28A 3WJYA 1F76A 3I7RA 1C9DA 5FEWA 2ISWA 4AMAA 4R7JA 3BK0A 1F6KA 5CZTA 2FPYA 3GXTA 4NNCA 1KFKA 3W1QA 5EYWA 4MFDA 3GLCA 2Z0IA 1R46A 3NQAA 2E68A 1TJPA 5FEZA 3W6YA 2YSWA 1ZJIA 1KM2A 3STCA 3KOFA 1OFBA 1DQWA 4O19A 1JCMP 1K7XA 3WK3A 1LP6A 1PCWA 2ABAA 2QCMA 1W5NA 5ABTA 4XZ9A 3MMTA 4O1BA 4O50A 1EP1A 3ABSA 4IMFA 3UXAA 4O28A 1SO3A 2JGQA 4GUHA 3I6RA 3I7SA 3QH2A 2J6XA 3M6YA 3TQVA 1IXPA 4KFPA 3VE9A 4LS2A 4H4IA 4XBKA 2RFGA 3PWAA 2EGZA 1HFBA 5DCDA 5K2ZA 5K9CA 1RPXA 4LUIA 1L6SA 3NL2A 2V5BA 2NUXA 4LC6A 4DBEA 4PTNA 1TPFA 4O15A 1VYRA 4WJEA 1H7NA 1VCFA 1ALDA 3H53A 4OGZA 5CSRA 1AK5A 1P5BA 2BX7A 3W7EA 3KVMA 1XDLA 3O1NA 3TSMA 2CZFA 3DFNA 4RZ6A 3PG9A 4B5NA 1XDMA 2YX0A 3EKZA 1PV8A 5I3JA 4JN6A 3M5XA 1G6CA 4JX5A 3TAOA 3GVGA 2V82A 3GIYA 4IPJA 1CW2A 1NAL1 4RZ4A 1YDOA 2ZA2A 1T0OA 1SZFA 4DXVA 3ANYA 3CIWA 1FCUA 3NEVA 1G67A 1KTBA 2WSQA 3A5VA 4LS0A 3K30A 1W1ZA 1PL9A 4K38A 2QF7A 2E5BA 1VYSX 2TPSA 3O8AA 1A5AA 3GR8A 1K03A 2GOUA 3NVTA 1LOLA 4KKXA 1OHLA 3NL5A 2J24A 2FPTA 3I7QA 2A2IA 3B05A 4Z1DA 1NEYA 4GJ1A 2Z6IA 2QUUA 2XN0A 3PUDA 3MP3A 2HSAA 4YL2A 3HGSA 1VGAA 3W7QA 3C2OA 4JS3A 1THFD 4NUWA 6TIMA 3HPSA 3W2JA 2A21A 4ADUA 4FIRA 5D2WA 2E5DA 4IMGA 3MHUA 4O53A 1QNVA 3N3MA 2Y7DA 1SQ7A 3R5EA 1TPC1 3QMRA 1O60A 2PC4A 3HG3A 3DHFA 2Y7GA 2GVJA 3TJXA 1ZY9A 3BGJA 1SUXA 3NR0A 1KLZA 4BI6A 5C2XA 4NX5A 1TPUA 3MYPA 3BG5A 4CCDA 1SO5A 3NQFA 2JKEA 3MJYA 1BKSA 3CTLA 3UZJA 1EUAA 2HMCA 3Q94A 4J9JA 1UUMA 2RH9A 2YDAA 1TCDA 5DCEA 3TQKA 4X22A 3MP5A 4JGDA 5AFDA 1M7OA 3WJZA 2ZYFA 1ZCOA 3LI0A 1L6YA 2GQ8A 5HULA 1QPNA 4DF0A 3QQ0A 1ZAJA 3PULA 3WFAA 3NPXA 3UXDA 3Q37A 1UBSA 1K8ZA 5LSMA 1GVQA 4AB4A 3W1MA 2NUWA 3W7JA 1A5SA 2CFFA 4PODA 4IMEA 4O18A 2ATSA 2DZTA 1GZGA 3B06A 4BI5A 4LRTA 3EXTA 4Y9AA 2ALDA 3M43A 2J9XA 3P62A 5TIMA 3PY2A 1KM1A 1PVNA 1WX0A 5FF0A 2NV1A 2C16A 3LXBA 5K4ZA 8TIMA 1TSIA 1AL7A 1FWSA 3UNDA 3NPWA 4QM1A 4GRSA 4WY0F 4O0ZA 5FF7A 1YDNA 3W86A 4ZQPA 4Z1BA 3T40A 1VC4A 3PF3A 5EL1A 1QPOA 5K9XA 2HS6A 2WPBA 1EP2A 4JTHA 3SY5A 3P60A 3ZWTA 4XUGA 3UD6A 3GXNA 3STGA 4ADSA 4JDBA 3DI1A 3W9ZA 2V5LA 3G1DA 4UMBA 2EF9A 4LVAA 3UWVA 4KFOA 3BGGA 5AYXA 2TSYA 3KVLA 1VHNA 3DXIA 1Q45A 5C5YA 1KW1A 3HPXA 4LV9A 4A21A 1JR1A 4ZQMA 5HWNA 1UCWA 3N34A 3O16A 2I14A 3OG3A 1ME9A 2A7RA 5DXYA 4UR8A 2BXVA 2X2GA 3TDFA 3P74A 1FDJA 2B7OA 2JKAA 5AYYA 1RVGA 4O57A 5LNUA 4N9DA 1XBXA 4MVAA 2BWGA 1XKYA 2QCGA 4JEQA 4TO8A 4JTGA 4X9SA 1PHQA 3DKJA 1KFBA 1W37A 1NVMA 4H6KA 2ZTKA 5D03A 1EA0A 2WOQA 2CZDA 4PL1A 1I2PA 3TXVA 1IF2A 4IXHA 3VFLA 1J4EA 3N19B 2J9ZA 3LHVA 1ONRA 1XBYA 1G4PA 4MOZA 4ALDA 2E5CA 1IXQA 3GXPA 4OT7A 4UTWC 3SI9A 1FWNA 5FF3A 1LCOA 3G1SA 2CWNA 3NQ8A 1W3NA 4QNEA 3NQ7A 2RDWA 2CLHA 4HPJA 4UFIA 1OYBA 4FNSA 1FBAA 1NF7A 3STFA 2Q3RA 1A53A 4JTTA 3TW7A 2VENA 3PBWA 2WO5A 4MY1A 1F74A 3FS2A 1DL3A 1RZMA 3IEBA 3W7LA 3FKRA 5DBTA 4BWLC 1LRNA 4O12A 3MI6A 2DORA 2H90A 2QJHA 3GNNA 1I2RA 1ZAHA 1OFDA 2JBMA 2PURA 3W83A 3NQVA 1TMHA 2V81A 3TU9A 5BW6A 4FXSA 1RQEA 2X1UA 4PA8A 3C2VA 4K8EA 4TX9A 4XWUA 1LOSA 3FJ6A 3LV6A 3BG3A 3GDLA 3TMLA 3D0CA 2RKXA 3CB8A 3L68A 3N2MA 3P8IA 3G3DA 5CSSA 1GQNA 2VFEA 1PHWA 3NPVA 2VOMA 2QCHA 1KBIA 3O6CA 3C52A 1IGSA 1E51A 1QPQA 3GK0A 4LVFA 3EWYA 3W7DA 3C0JA 4MJZA 3OEXA 1W5QA 3DHDA 4UTIA 4WOZA 3IVSA 3C61A 1CX9A 3NQ2A 3O6YX 3RFAA 4NJGA 4NZJA 3LCWA 4N02A 5FEXA 4K8HA 1G7UA 2ZZ2A 4DELA 1VLIA 2CLEA 2G5WA 1XC4A 4I7UA 5I3HA 5HQEA 3W87A 1EWEA 1DVJA 4IX0A 3EX2A 2I9EA 3ABOA 5LGZA 1EWDA 3W7MA 3B04A 3Q2DA 1A5CA 3N2XA 2GVLA 3LTSA 3PUEA 2XFWA 3QYQA 3M5VA 5KZDA 4A2RA 4H3DA 3R12A 3FOKA 3TW6A 1DORA 4IMDA 5FF4A 5IBXA 4CNOA 2Q3OA 4JX6A 4YMZA 3G1FA 2VEPA 3IIOA 3SSJA 5LGXA 1G4SA 1F6PA 3G8EA 3W1UA 3PC0A 1GJPA 1SW7A 1VCVA 4NXKA 3HF3A 5I3KA 5KZMA 1D3GA 1UJPA 4BFAA 4ZQCA 1W3TA 3P81A 3SGUA 1ZNNA 4TIMA 4HSNA 3M16A 3PB2A 2OX1A 2GJNA 5HR7A 3W7IA 4DO6A 4C1KA 4FX6M 5K4XA 3IRDA 4MIMA 4HNUA 2C3ZA 1DHPA 2CZ5A 1VHCA 4ZQRA 2DU2A 4YLWA 4QJ1A 3RU6A 3BVJA 2QJGA 5EMUA 3WJXA 1K7FA 1Q6LA 2DZUA 3M9YA 3MUXA 2VEIA 1VCGA 1TPVA 3DFOA 3KVJA 2C15A 3TK7A 4AWUA 3P82A 2FQIA 4MZ1A 3W1PA 4LUJA 4RLIA 3W7OA 1IXNA 3LCFA 2A6NA 3HB9A 4E0CA 1I8JA 3UYCA 2YXGA 3SECA 1GEQA 4U4MA 1G4TA 1HO1A 2A5HA 3GKFA 3KRZA 3C8FA 4YCPA 4RV8A 1ZENA 4Y96A 3W73A 2WV8A 4KFNA 3W72A 4LY8A 2E1DA 2FB3A 4FX7A 1XFBA 2ZZ6A 4OHQA 2ISSA 4GUGA 2ZFAA 3P8JA 1FCQA 2C14A 5AHFA 5DBUA 4E2DA 1U5JA 4IQLA 4M6PA 3BLIA 3NO5A 1N8FA 3HG2A 1OF6A 4ZVJA 4UMCA 1TB3A 1O4UA 1VJIA 4DPPA 4PC8A 4PL2A 4RJEA 2G95A 3LHUA 2UV8G 2PRHA 2X30A 3NYZA 5CG7A 1KM3A 4NU7A 1ZFJA 3MHFA 4WOQA 2GUUA 2B7NA 4N6EA 4O16A 5A5WA 4UFLA 3B0VC 4K7VA 1KV5A 1H7RA 2H8XA 3W7GA 1WAUA 1W5OA 3LHYA 4M7SA 5CPNA 1AW2A 3F4WA 4Q4KA 3H55A 2QCDB 1KBJA 1X8FA 3BPWA 1TTQA 3W7PA 2Q8LA 4LU0A 3WJSA 4DO4A 3LBCA 5C54A 1BTMA 4HT3A 2A4AA 2X1TA 3VI2A 4Z08A 4YCOA 5I3FA 1MEHA 4W9TA 4O1CA 5GVJA 1NF0A 2VC6A 3KHJA 4OV4A 1JUBA 1X6UA 3ELFA 4UC5A 2H8ZA 3I65A 1EIXA 1F73A 5LHEA 4QQ3A 3NL3A 3HOJA 4M19A 4TMCA 4CNPA 3LLFA 2WQPA 3LX9A 5TQLA 3NNTA 1VLWA 2E6FA 1ICQA 5FESA 3NQGA 4JIPA 2R8WA 1QDSA 1OX4B 6ALDA 3IGUA 4UTMA 4LVBA 3TMQA 3PAJA 4N4QA 3F03K 3MI2A 3C2FA 3LHZA 4PH6A 2V2HA 4IX2A 2E6YA 1ME7A 4M6VA 2QCCA 3BLFA 1W54A 3HIJA 1K8YA 3L9CA 4WXZA 3WK1A 3M47A 2V2CA 5LNWA 3ABRA 4IJBA 3G1XA 3G3MA 3FA5A 4DF1A 3O05A 3UZ5A 5AYZA 1O5XA 1H7PA 4UMAA 1GG0A 2FB2A 1F2JA 1W56A 1V7YA 1EP3A 3EWUA 4FNPA 2D73A 4S2CA 5D30A 1VPXA 1WYIA 5BNKA 1OFOA 3TFCA 4Y90A 5BRBA 4O1DA 5BMXA 2Y62A 3BW2A 3UWYA 1YPIA 3S5YA 2ZRYA 1F5ZA 4IUOA 3JR2A 2DZVA 4ORMA 3HBLA 5I3IA 5K3VA 5I3GA 3A22A 4GNJA 4AHQA 2QDGA 4Z0JA 1JUKA 4JTKA 5HNRA 3GDKA 3L65A 4PFMA 2EHHA 3A24A 1S5TA 2WSYA 2QAFA 3W2UA 3FEMA 2X1SA 4NJHA 2FDSA 1UUOA 4MY8A 5CKSA 2ZRZA 1P1XA 1MXSA 3A21A 4ZQOA 1JRCA 2A85A 1XI3A 2F84A 4O10A 3N73A 3QSRA 5F1VA 3LTYA 3MW7A 1H63A 3UWZA 4L4LA 4P2VA 1K7EA 2V0TA 1GYNA 5LKYA 3EB2A 3S8HA 1PE1A 2H3BA 3GDRA 5HR6A 4X2RA 5AN7A 1BEUA 3GB6A 3QSTA 1K02A 5IBXC 1GVOA 3HGRA 3LI1A 2WNZA 2JGYA 1B4KA 4O52A 3QF0A 4CNNA 4ONVA 4AHOA 4RKAA 1LOQA 3M0ZA 2RDUA 1HL2A 1H5YA 4FNUA 4O11A 1O95A 4DPQA 1WDWA 4RZ5A 1Z42A 3DZ1A 3F1QA 4DBDA 3GNDA 2E6AA 1GT8A 3WK0A 1JCJA 3BARA 1TO3A 1W8SA 2G96A 1WOAA 1H61A 1H7WA 1FWRA 4MZ8A 1OYCA 5EBUA 5D2XA 1H51A 3W85A 3IIZA 5G2IA 1GVRA 3PM6A 1TREA 1LLWA 2DJLA 3NZ1A 3G1VA 1P0KA 1OFPA 3R8RA 4ZMGA 4WZHA 5EPDA 3NG3A 3HMJG 4S1FA 5G4EA 2CLKA 3GDTA 1GPWA 2C0AA 4EF9A 3ZS4A 3LBMA 1DOSA 3FKKA 2Z2UA 4UFKA 3EXSA 4DO5A 2QKFA 1DBTA 4WY0B 3ZR4A 4Z1CA 2YYTA 3MYOA 2NX9A 3EX4A 4QITA 3LGEA 5F4WA 3VNDA 2NX3A 2YW4A 2Y70A 1SSDA 4CQAA 3NQCA 1R30A 3LDVA 3HG5A 3JS3A 4FNTA 1BWLA 3CLMA 1MSSA 2NV2A 2XN1A 4NVTA 3UWUA 3G0UA 5AB3A 4JY8A 1H60A 3VE7A 3FFSA 4A29A 1DKWA 1TPWA 2YPIA 3USBA 3FYOA 3W2MA 3G1HA 1GG1A 1FUYA 3A5FA 1A5BA 5L9FA 3E12A 1FCBA 3KX6A 4GUJA 2CLMA 4ADTA 3B8DA 3CEPA 3PS7A 3SIZA 4K37A 3LOTA 3LCLA 3SGZA 1XBZA 3CPRA 5CPOA 2E09A 3GZ3A 1OABA 4GXMA 3E9AA 3G22A 3EX6A 1WBHA 3T78A 3MP4A 2R94A 3OBKA 4EOUA 2NWSA 3TQ0A 1KFCA 3DAQA 2OT0A 4QIUA 3B0PA 4IMCA 1LORA 1TRDA 3L5MA 1L9WA 4R33A 2J27A 2ISVA 3C4UA 2JK2A 3TKFA 1OFEA 1R47A 1WA3A 3BO9A 3L67A 4JICA 1SZEA 2CU0A 2C1HA 4L4MA 1VQTA 4UR7A 4LS1A 4JXCA 5G2WA 1FDYA 1MO0A 2AAMA 1JJKA 4NXSA 4JTIA 4CQ8A 1VZWA 1LBLA 2PE4A 3P7YA 3TFXA 5DLCA 3MHGA 3BW3A 1S5VA 4UTUA 2YZRA 3UPBA 1EX5A 4MKNA 1SFJA 2IQTA 1DJQA 1QMLA 1W0MA 1B57A 3HO8A 1KFLA 4JNMA 3G1AA 4GWEA 2DZXA 5D2TA 2DJXA 3W22A 4HNTA 5D2VA 3MO7A 3QW3A 1LTDA 1AW1A 4RR4A 3GYEA 1BWKA 2YCEA 1PIIA 4WX2A 2V8ZA 2FJKA 4DQWA 1DJNA 3W3OA 1TQXA 5KMYA 5KINA 3DFSA 3A23A 3M5ZA 1LYXA 3RK8A 1ZHAA 3OVRA 1QOQA 1I45A 4RK8A 2Y85A 2AGKA 3QRHA 3TAKA 1L6WA 1XL9A 2O7QA 1H62A 1OK4A 3LB0A 5AHMA 2ZDRA 2VKZG 4PCFA 2J9YA 4MJMA 2G97A 5FI8A 1X1OA 4MFEA 4K39A 3P80A 2FTPA 3FIGA 1OFAA 3M1ZA 1RV8A 4JYDA 5CZ0A 1VS1A 3STEA 5T26A 2Y88A 5HINA 4WUIA 2ZA3A 4HSOA 3HGJA 2ZZ3A 2VFDA 4NX0A 3QM3A 1Q6QA 3PSWA 3SW6A 4XQ6A 3M5YA 2X1RA 3Q58A 3UQNA 3PBVA 2JKPA 3ZFHA 2HS8A 4UNLA 3LCIA 2YGYA 3W1TA 3N14A 2AQWA 3DKLA 2TMDA 2PRLA 4IPIA 3SR7A 2Y7EA 1N55A 1GOXA 1V5XA 3TCEA 1H7XA 1J2WA 5HUPA
chains in the Genus database with same CATH superfamily
2I7GA 3GM8A 2PP0A 3UVAA 4O4WA 2A3BA 5FF2A 2OX4A 3DBPA 4K3ZA 1PXGA 3BSGA 2HNHA 5E9XA 1UC4A 1Q63A 3B0UX 1WV2A 1FH9A 1RCOB 4MPKA 1UKPA 2PI6A 2VZUA 1ZTVA 2XVKA 5DY3A 3PB0A 2VFHA 3GAYA 4NAEA 3RR1A 1CGYA 1T99A 3EWZA 4YXGA 1VRDA 4J7RA 1UB3A 1UP0A 4H04A 5XINA 4FB7A 3OTRA 3G18A 3N12A 2VRKA 1XRVA 3LRLA 1YXDA 3R94A 4IXXA 3TEVA 3REQB 2XU2A 4NNAA 1QO2A 3ARPA 1ADOA 3UR5A 1EQCA 4IG2A 4LNYA 1V6VA 1GVIA 3C3NA 3DFYA 2DIEA 3VFCA 1GQKA 2I1OA 3K8KA 5I07A 2CHOA 2YCIX 1OD8A 2VD9A 4S3BA 3KCJA 3B40A 3C56A 2GJXB 3GVRA 3WH8A 3HG4A 3Q45A 1ADDA 4CCZA 4B15A 3LTPA 4QJ5B 4EF8A 2IKGA 3RLVA 2EPMX 3UPWA 1BD0A 2EAWA 1IV8A 1ZCCA 3EWWA 5E9AA 1T5AA 3BLEA 5JBFA 2FIQA 4E4PA 4RDWA 3T4CA 3S1UA 1QI5A 2YCKX 5FEPA 3GTNA 4Z42C 2WKLA 4O8RA 4PYSA 4O13A 3UCDA 4LVGA 3U48A 1BXBA 1MYRA 4DY1A 6XIAA 2DUXA 2LLEA 1JQVA 3AI0A 3U5UA 3CMFA 3KS5A 1GUVA 4NJIA 4KMQA 3BJFA 2NUYA 3USZA 4J2MA 4K36A 4L61A 1E3XA 4O17A 3LG3A 4HA3A 1I9CB 2BSLA 2ZRXA 1Z89A 5DRIA 4GVHA 2P10A 5F2IA 2J62A 2ZOXA 2WAGA 2YXXA 5BXSA 2P76A 4QR6A 4PMUA 3BUVA 4DBWA 4X3ZA 1EEXA 1W6TA 1V6YA 4QS5A 4TX8A 1VENA 4YTRA 4QXIA 3NOEA 3OB8A 3E96A 5M2FX 4D8LA 2DSZA 4FMVA 1PB0A 3XISA 1HVXA 4KGJA 3S6OA 3GX9A 3CH9A 4Y8EA 1YNYA 1H50A 3BMVA 3DI0A 1IWPA 5LNRA 4C6JA 3AIVA 3R0DA 3VYLA 4D6JA 4ZTYA 4L9ZA 3OZPA 4V27A 1I75A 4H9MA 2OQYA 1E1EA 3E0LA 1G69A 1BSIA 3ATYA 2R1PA 3H21A 4DF2A 3WBAA 3WF4A 4TV6A 3U7VA 1E9IA 4IQDA 2QQ6A 3BXWA 3SQLA 2ZUNA 2ZTJA 3PN8A 1RXOB 2JFEX 4JTCA 1UROA 1N2VA 1XSKA 3VDCA 1PKNA 2YKKA 4H6RA 3RPMA 5MHBA 3QGAC 2VEMA 2DVXA 4QAIA 1XCXA 4QROA 4FPSA 1FWWA 2J7BA 3OIHA 1VFSA 3H26A 3FYYA 1IEIA 2VEKA 4OV9A 2B81A 5E5CA 1XG4A 5HUOA 3H2CA 1TVLA 2XZ7A 1UWAA 1LQ0A 1XYAA 4Z0SA 1J0JA 4UCFA 3EKLA 3WH9A 4GY7A 2JEQA 5CPMA 4IP7A 2R9RA 4B5XA 3AXIA 1IGWA 2E9LA 3UU0A 3PBUA 3TR2A 5K7JA 5AC8A 1BYCA 1KFJA 3WDIA 4JTFA 1GGOA 3PSVA 1FFQA 2MNRA 3N4EA 1EDQA 1F61A 1QPKA 3ZLFA 1KM4A 1QOPA 4HYVA 4J3WA 3S1VA 3SQMA 4IWWA 5AOUA 2XINA 4BEQA 4MYXA 1W9VA 3AHZA 4IFKB 4RE0A 5H91A 1JI1A 2W0UA 2CLIA 1RD5A 3F4NA 1GVFA 3GG0A 1I2OA 1V02A 1VIZA 3GAKA 5L6UA 4NIRA 3CV2A 3SN1A 2X16A 3TC7A 2I5QA 3N18A 1NSJA 3EWCA 2NLYA 3UWQA 1A0EA 1EUNA 4WQ6A 1JG9A 2D24A 2GJPA 1K70A 4N6FA 2NVCA 2WNQA 4UTLA 1XICA 1A5KC 1MW3A 1TJRA 1M3UA 4A3UA 1A0CA 3TSDA 4G7EA 5IHRA 2QDHA 3QEZA 2WWDA 3S5NA 5H8PA 1OGSA 5EGRA 2HPIA 1JULA 3CEUA 3MS8A 1DPMA 3LHWA 2V2DA 3DOPA 3H7UA 4WXYA 2GVGA 4GBUA 1OADA 1FTXA 2FKPA 3VNLA 3VTRA 4UOZA 1JAKA 1E72M 2NLIA 4NKCA 3QFWA 3GDMA 3WSUA 2PU0A 4Q7NA 2PTWA 4D6FA 3SJ3A 1AD1A 2YFOA 4GX8A 1A5NC 4BQ5A 4NAFA 1MRAA 1TIMA 1FDZA 3TNOA 4NZ4A 3UCQA 4HU8A 1MDLA 3AJ7A 3PZQA 1W1A1 4A8IA 3W7HA 2ZBTA 4CEUC 3LQLA 2ALRA 1E1CB 1AA1B 3DYMA 3C2RA 3PK7A 2Z00A 4LALA 2I5IA 4LV4A 4B2DA 4GABA 4OOUA 1KCZA 4RL3A 3L0GA 4AF0B 1KFEA 1W9BM 4AD4A 4D6EA 1T6MA 1XLFA 1G94A 1XHGA 4DEFA 1GTEA 1ZBWA 4AIOA 5ABFA 4UTHA 4I7VA 4EVZA 2Z25A 1MZHA 3LYEA 3WENA 1VYPX 1KM5A 3SCPA 1YMYA 3QW4B 5I23A 3P67A 3R2GA 5BRQA 3BG9A 4FAMA 3WQVA 2J8GA 2G50A 1PEZA 2FVKA 3AIEA 1AFSA 4JIIX 3LXAA 3NEHA 1RJPA 3SCRA 4FNQA 1QRQA 1MQRA 1LLOA 4F48A 1Z32X 4DNMA 2E7FA 3KWXA 5G1YA 3E74A 5GNZA 5DN1A 1W1IE 4YN5A 5EKYA 2ZQ0A 4QNWA 1M7XA 2B7PA 1OY0A 3PZGA 3C8NA 4N2YA 2OPJA 1UR3M 2HVMA 4MF4A 5DQPA 4D2JA 2W3ZA 4YYFA 4PR4A 2OJPA 4XSLA 4BF7A 2MUCA 3CHDA 5AHEA 2O7SA 3SFKA 4DWSB 5D32A 4GUFA 1XLHA 2EPHA 4QSFA 3WG6A 1U1UA 1R87A 1OC6A 5CGQA 2EPNA 2VFIA 2A1YA 1WDQA 4GXPA 4E2OA 4KIRA 1D7KA 2OWWA 2CWXA 3O06A 3ALFA 5DT7A 2CLFA 3WEMA 1XLIA 4LC8A 1JD9A 3B4UA 1KB3A 3SCQA 3OIXA 1US3A 4J1OA 3NZQA 1QAPA 1DIEA 4S39A 4KWVA 1W1PA 4M5PA 4CCEA 3BANA 1QPRA 2FH8A 1N8WA 1E4MM 1XYMA 1V6TA 1JVNA 4I5RA 1H7OA 2QGHA 2R91A 5I03A 4FR1A 3SY8A 9XIAA 4N9CA 1XH2A 3SJNA 2EG8A 3BAYA 4HBKA 3WMLA 4TOQA 1HTIA 3ME3A 4UQCA 1MZRA 2A0NA 4MUZA 2BY3A 2OQHA 5ABEA 4QFUA 4G9PA 1WZKA 1RK5A 1WZLA 4V2XA 5CZJA 1DJYA 1XBVA 1VFLA 2V3GA 1KCKA 2GK1B 5F1UA 4O0QA 3L4TA 4RNHA 1TRIA 3C0QA 4XIAA 3C0SA 1ME8A 3E0FA 4Q8UA 1PIFA 4OKDA 4XKYA 4BK9A 1UIPA 3PFMA 2PWFA 2JQXA 4A4AA 3E49A 1YRRA 4NJKA 1RLCL 3ZJ7A 3WDJA 4NAEB 3N9RA 4PB5A 1HL8A 4A3QA 3L0NA 4JTSA 4JCMA 3U6WA 3UY8A 2EXOA 3WELA 1S2WA 1PCKA 2NQ5A 2C19A 4M8UA 1JCLA 5CPLA 3QPYA 1JL8A 1HGWA 2P50A 4M0XA 3ECQA 3O07A 2PDJA 1V8EA 1XGDA 2A6LA 4QBXA 2Z2BA 2HBVA 4AZBA 1B3OA 4C5YA 2ATMA 3T0DA 3KRUA 2GL5A 4EPEC 1GOMA 1KR0A 4BI7A 4HCDA 4PCNA 3KOYA 2INFA 3ES8A 5AVNA 3SZ8A 3UG8A 2C8NA 2A3LA 4FIQA 5AC6A 3TTYA 3V1PA 3KZSA 4A2SA 2QCEA 4LUSB 5HMSA 1PJ9A 1F9CA 4HPGA 5HQMA 4RPPA 1EPXA 2VGIA 3DFPA 3HGOA 3CAQA 4OBTA 1S5WA 4U28A 1F76A 3I7RA 1MQPA 3O2LA 2FPYA 1F3EA 1J0HA 1KXQA 4HK7A 1XLCA 2E25A 2Z0IA 1NWTA 1V3JA 2YSWA 1ZJIA 1E0TA 2WHJA 4GLEA 7XIMA 4PTDA 4CQCA 1IE7C 2GGIA 2OEKA 2ABAA 2FVMA 2BGNE 3MMTA 1UP3A 5FSEC 1YNQA 4O50A 4GGHA 3GHTA 2DDXA 4OTKA 1JYVA 1JXJA 3A9BA 4A6GA 2FGZA 4GUHA 1BWVA 2OB3A 3CLWA 4GGBA 4HNLA 4HHMA 2DQWA 1UR4A 2FZMA 3F2BA 5J8LA 4U5IA 5T9CE 2RFGA 3URNA 3PWAA 2EGZA 1RPXA 1T40A 4LUIA 3VINA 1WCGA 1JCTA 3UR2A 2PDFA 4PTNA 3SURA 3WH6A 2OLSA 1RVKA 1XYCA 1VCFA 1ALDA 3H53A 4GISA 5CSRA 2BX7A 4B5NA 1XDMA 3O0KA 1V3LA 2WSPA 1FWCC 3GNRA 2DT3A 3ZLHA 2V82A 3GIYA 4MB4A 4IPJA 2PP3A 1NAL1 4JQ2A 3B8SA 1YDOA 2OSXA 1TV3A 4ZODA 3S9ZA 1FCUA 4GI8A 1FHVA 3H24A 1W1ZA 1VP5A 2HROA 4Y2WA 4K38A 1KWGA 2E5BA 2TPSA 3IUDA 3MU7A 3OYZA 2YL9A 3UW6A 2GOUA 3NVTA 1LOLA 2PDXA 4HYRA 1B2YA 1LQAA 3FVDA 2FPTA 1D3CA 2A2IA 3B05A 1NEYA 2HXUA 1F3XA 2XN0A 3PUDA 3IPWA 3B9NA 3OGVA 4F0HA 4QHRA 2WM1A 1GOKA 4J3ZA 2E5DA 4O53A 1QNVA 2J66A 3N3MA 1UD5A 3N29A 3B9OA 1TPC1 4RE3A 2OZ8A 3GVQA 3VIPA 2PC4A 1BYDA 4B16A 2QGYA 2GJRA 2Y7GA 3TJXA 3FXYA 1ZY9A 1BG4A 5HMDA 1PO9A 1UD3A 3NQFA 1BKSA 4JBRA 3IJIA 1UUMA 1B0IA 3B9DA 1UKTA 1G1YA 4Z2GA 1IT0A 2PUZA 3MZ2A 1M7OA 1DJGA 3WJZA 2ZYFA 3AIWA 4WSHA 3LI0A 2YL5A 3WQWA 1ZAJA 3RILA 2CEQA 1R86A 3Q37A 1IQ8A 4BJHA 1GVQA 1Q7QA 4RE2A 2CFFA 3UFYA 4O18A 1LWIA 2ATSA 2FZDA 2BFGA 2PDCA 3ITYA 4LRTA 3P62A 2QJNA 3OVGA 2GZXA 4B3LA 4MWAB 5FF0A 2C16A 4Y9NA 3V35A 2YBTA 1YPXA 1PKMA 1YDNA 2AQOA 4Z1BA 3TN5A 5EL1A 2HS6A 1EP2A 4JTHA 1TV4A 3R4IA 4UOQA 3KBSA 2FZNA 2VO5A 3P60A 3ZWTA 2W9MA 1OBAA 3EYPA 4ZB5A 1HKVA 1FHDA 1VAHA 2BP1A 4LB4A 4JDBA 1OM0A 3W9ZA 4EPDC 4HN8A 1JZ3A 1Z6KA 4FZIA 4UMBA 3SRDA 5AYXA 4B3KA 2GUYA 2Q8XA 1QU4A 3RM9A 1KW1A 1HJVA 3QOMA 1OGBA 1TFVA 3QC0A 4S38A 3N34A 1DXFA 1EYWA 3OG3A 1W17A 2WLYA 4Y9OA 4UR8A 2D2HA 1E3ZA 3AHTA 3R8GA 4LYRA 2QNEA 3TDFA 3P74A 3WMCA 1FDJA 3S5SA 4JHMA 3QY7A 5AYYA 4O57A 2UBPC 1ISXA 1FWAC 1P7TB 3IUIA 3LSCA 4HD5A 1KFBA 4LAMA 3KBMA 2JEPA 4MWAE 1EA0A 4MWAD 3ITGA 4YVXA 1IF2A 4MG4A 4CUCA 1AH4A 1JI2A 4KESA 2J9ZA 3ORWA 4R88A 1G4PA 4MOZA 2E5CA 3PZIA 3QYSA 1FWNA 1WKFA 1LCOA 3G1SA 1DQUA 4DLMA 2QHAA 1LQ2A 3F7JA 1OYBA 4ACZA 3FSUA 1FBAA 3MMWA 3STFA 3JZEA 1V93A 4JTTA 1F74A 2X0YA 4B5VA 4W8AA 2ADAA 4QX4A 4O12A 3MI6A 3GFYA 3GNNA 1EH9A 1I2RA 1OFDA 1GQLA 3W83A 1OQFA 4HJFA 4M80A 3NQVA 1UWQA 3LSBA 1QW8A 2DV0A 3TU9A 2VDIA 1E6XM 1RQEA 2X1UA 4PA8A 5A95A 4XWUA 4M1BA 1LOSA 3R79A 4O1EA 1HKWA 3GDLA 2O55A 3G5EA 2RKXA 4US5A 5LA2A 4HJWA 3L68A 4DYKA 3BSHA 1RP9A 3NIYA 1EA9C 3VDHA 2VOMA 2QCHA 1H4PA 3GK0A 4C6BA 3BOXA 3GG1A 3SCWA 4XO7A 4WK9A 4D6IA 3CZJA 4UTIA 2WJDA 3APTA 4WOZA 2VVSA 3NQ2A 3HU7A 3O6YX 3LCWA 1QI4A 4KGLA 4N02A 4K8HA 4V28A 5EMYA 3MSDA 2FJUB 1G7UA 2ZZ2A 4DELA 3OHMB 1V77A 3EOUA 4QLJA 3MCMA 3PWGA 1OCQA 1A47A 4S3KA 1WKEA 3UBPC 1GONA 4GIRA 5I02A 2ZUTA 1DVJA 3AUJA 3EX2A 1UYQA 2ZXQA 1F4HA 3N2XA 3F5KA 4XD4A 1FWBC 2YCLA 2WHMA 3M5VA 4GNKB 1FH8A 2HK0A 4H3DA 3FOKA 5T8GA 3TW6A 3VU2A 3G1FA 2J6VA 1RBAA 1IZJA 5RUBA 1G4SA 1SW7A 5I3KA 1IWAA 1UJPA 2V68A 4BFAA 4HQVA 3SM0A 4EWJA 1EGMA 1ZNNA 3FEQA 4TIMA 4NP7A 2ICSA 4DYJA 4DO7A 3BCFA 2ZIDA 4LY4A 5FCZA 4FX6M 4MIMA 4OUIA 3CZKA 5FOOA 4XZIA 2CZ5A 1VHCA 3WLQA 5HPOA 4ZQRA 3BVJA 4S3JA 3APYA 1Q6LA 2VQUA 3TK7A 2R1KA 1V08A 2FTYA 3W1PA 3BICA 1M01A 1XH0A 4IIDA 1VEMA 2WANA 4PMNA 3GW3A 4E0CA 3VNYA 3SECA 1JIBA 4F2TA 1BRLA 1OIFA 4QS6A 1HO1A 4IPPA 1XYZA 5CBIA 4YCPA 5JBDA 1E55A 5DMNA 1ZENA 4JTDA 1SR0A 3AMCA 4Q7BA 4NY2A 2FB3A 3VCCA 3S2NA 4REQA 3ZT5A 1XFBA 4OHQA 1XJBA 1H49A 3F4DA 3VOCA 4HOZA 3CV7A 3K5XA 3P8JA 2C14A 5AHFA 5DBUA 3LK6A 4M6PA 2WMKA 3OBEA 4C90A 4UMCA 1NDVA 1O4UA 2Q6ZA 1QHOA 4XAZA 3OLDA 2PMQA 2PRHA 2X30A 3NYZA 1QNPA 4UNIA 5A6JA 1ZFJA 1GZ1A 1K77A 4L9XA 1Q85A 4O16A 4J4KA 2H8XA 3F4WA 3SUVA 2DVTA 1X8FA 3W7PA 1TTQA 3QGKC 4L6DA 2Q8LA 1UG6A 4HT3A 2X1TA 3VI2A 1R3WA 4Z08A 4YCOA 5I3FA 3FXGA 5LIUX 3MKKA 1NF0A 2VC6A 4OV4A 3V1HA 1EZ2A 1UPMB 3I65A 1BXCA 3CZ8A 5LHEA 5BOEA 1E6NA 4NI8A 3T8LA 1XR2A 4TMCA 4JKMA 2WQPA 4GINA 3O9NA 1RH9A 3RITA 3NQGA 2C91A 4B90A 1J8VA 1CB7B 3IGUA 2P0IA 3TMQA 3PAJA 4W89A 4N42A 3N4AA 4AD0A 2E6YA 1MW0A 1K8YA 1E40A 4ZOBA 2D2OA 3ABRA 1EKOA 4WDTA 3O05A 2FZBA 5HBFA 5AYZA 2FVLA 3N4FA 5GJNA 3NO3A 4PMOA 4ILSA 2FB2A 1F2JA 4JIHA 5EMLA 4FNPA 1VPXA 1WYIA 5BNKA 1OFOA 2OKOA 1DJHA 1KGXA 1W3JA 1E9ZB 1EDGA 2D3LA 2F2HA 2XIJA 5A6LA 1F5ZA 4IUOA 2DZVA 4ORMA 3HBLA 5I3IA 4W86A 4GYPA 3SCTA 4HMEA 5K3VA 3QHOA 4GNJA 4EXAA 3H4GA 2OR2A 3EDFA 4JTKA 3PZTA 4UZUA 1ZP4A 3FAXA 2QAFA 3RG6A 4NJHA 4XVEA 3WL0A 1UUOA 4MY8A 2ZUWA 5DT5A 3A21A 2VNCA 4GKLA 2A85A 3JW7A 3ABXA 3N73A 1M68A 3QSRA 2VC7A 5LXXA 2O9PA 5F1VA 1Q65A 3HQOA 3BAKA 3MW7A 2E28A 2RJHA 1P7TA 3UWZA 2UZ9A 2V0TA 4HGXA 3EB2A 1E4NA 4MNJA 4OJYA 1PE1A 2ZXDA 2H3BA 3GDRA 5A94A 4X2RA 1K02A 3IV8A 5IBXC 4C65A 4DM2A 2R24A 3KCOA 3ITOA 3N04A 3ZLGA 3BQ6A 3ARSA 3CAKA 3MZNA 2JGYA 2TAAA 1UA7A 1M1BA 2CESA 4DWSC 1W32A 2VCCA 3QN3A 4U2YA 1TCMA 4TXEA 3UZZA 1XW8A 2WPGA 4RZ5A 1UMYA 3AYTA 4LB3A 4J27A 2Z7KA 1P48A 1ZPTA 4GY0A 4DWSA 2VDGA 1TO3A 1H61A 3WLTA 1VBGA 3MB9A 2V3FA 1CCWB 4CD5A 3TP4A 3PM6A 4Z2JA 1MWOA 4ZMGA 2XFRA 3VC6A 5BU9A 1SYTA 2ACRA 2X0SA 1VFHA 3TYUA 4EF9A 3ZS4A 2QKFA 4Z1CA 2YYTA 2NV9A 2NX9A 2WB5A 4QITA 3DBNA 2BY2A 2NX3A 4HCHA 5D9NA 3CLMA 3TTSA 4G7EB 4OFCA 1H60A 3GBEA 4A29A 1TPWA 2JF6A 3NVDA 2ODOA 3FYOA 3W2MA 1GVEA 3NJ3A 1FUYA 4PRWA 1LG2A 1A5BA 5L9FA 3SB0A 4H7CA 4WGXA 1OD0A 3SIZA 2Z7GA 4K37A 3SGZA 4W85A 3DG3A 1TZZA 1Z7AA 2DFAA 1VIWA 1PZ1A 3GZ3A 1OABA 1RBLA 4GXMA 3WNLA 1GHSA 5GNYA 1WBHA 4H2CA 3WBEA 2ZVRA 3LENA 4GJJA 4BS0A 3OBKA 4Y9PA 5CH9A 1P6WA 3TQ0A 2OT0A 4AX7A 2VEFA 1K8CA 2JK2A 4ROPA 1R47A 4LBUA 4U31A 2CU0A 4UR7A 1FDYA 1XPYA 2AAMA 2WHLA 2CYGA 4I8DA 4PCPA 1VZWA 3H2NA 3MHGA 3BW3A 5CXPA 2IPJA 4GHRA 4UTUA 1KXHA 2Z4GA 3UPBA 2BY1A 2CC0A 1W0MA 1AH0A 1V0LA 3WF2A 1C91A 1J10A 2VM8A 5ENLA 2DJXA 5D2VA 1AW1A 1V0KA 2EPOA 3BE7A 3BLKA 4WX2A 1FP8A 4F8XA 1Q6EA 2F2KA 3RK8A 3L4VA 3GHSA 4D9PA 4RK8A 2AGKA 3FA4A 2BBFA 3IJ6A 4DXXA 1IEXA 2WVSA 1NQ6A 2WC7A 2X09A 1J96A 4M56A 4QE5A 3H12A 3JU2A 4ZO9A 1OK4A 3CUGA 4QE1A 4AVNA 1HXJA 2G8ZA 1X1OA 4K39A 3P80A 4HTBA 3FIGA 3OLEA 4GXWA 4JYDA 2GSJA 3M4HA 4P8XA 4D6DA 3HZ3A 1ONEA 3TJIA 3AS3A 4EACA 4HSOA 2VFDA 3KBJA 1GKPA 1JDCA 3UGRA 4GPNA 1AQFA 1Q6QA 4XQ6A 4B3ZA 1DIKA 2X1RA 2JKPA 1QT1A 2OZTA 3N14A 1Q6CA 3CUIA 3DKLA 4D6GA 2TMDA 4IPIA 4U3AA 3KP0A 4AD2A 2FH6A 1ISVA 3S47A 2PDUA 3I3EA 2POTA 1R3SA 3DH7A 5AY7A 1QNOA 4HKPA 1T96A 1EHAA 4J5NA 4JZ5A 1C93A 4D8ZA 3LMYA 3T0BA 3VKAA 3TH6A 3NXFA 2D1ZA 1SFTA 1SW0A 4YWIA 4YTQA 3P2VA 4QDMA 1NJJA 4I9MA 4XBSA 3BMWA 3TSBA 4MPQA 3EMQA 1FWFC 1SW3A 4PCSA 4MY9A 2NZLA 4JFVA 4P61A 1NARA 1MFUA 3W2LA 4WD0A 2VCBA 4JN7A 3KWSA 4WDXA 4Q7IA 5A2CA 3ONBA 3V7PA 4Z2IA 3QTGA 3N17A 3GUWA 3CWNA 2W4XA 3GH4A 1R2SA 2QPUA 3DFTA 3GH7A 4QISA 4XTIA 1NWUA 2DSKA 1QI0A 4Z1YA 2GYIA 1JPIA 1TQJA 5IM51 1XXXA 1G7VA 4IOTA 4C1NA 3NOYA 1GEHA 5D8WA 4RXGA 1TTPA 3CHFA 3XIMA 4A22A 5E93A 4TR9A 7TIMA 3IAQA 4N9BA 2HK1A 4Q33A 7ODCA 1AQ0A 2ESCA 1KGWA 1R3QA 3ZSSA 3SRFA 3CL8A 3EMCA 1WO2A 5E6ZA 1GPFA 4Q22A 3RF9A 3P84A 2VC9A 1FWEC 3URQA 2DVUA 2TYSA 5LA1A 3ATZA 2YBVA 2WNNA 1TPB1 1X39A 4IH3A 5D33A 3ZJ8A 1Z44A 3L0KA 1YXCA 3ZOAA 3OQ8A 2KAUC 4ZCWA 2D0GA 3D6NA 4LRSA 3UEQA 3DEQA 4LF2A 5BOOA 3BLOA 1H41A 5U4NA 5CZKA 4UZSA 5KZEA 3CWOX 1J11A 3B97A 1XLEA 3CT7A 3V18A 4JAWA 1GWJA 1V51A 3WF3A 4ZZ9A 4ZB2A 3EWBX 3EOOA 3KFTA 3W00A 1TPEA 1O1ZA 3MBDA 1WE5A 1FHLA 1I2NA 3WH5A 4XD3A 3QMTA 5M17A 4Q8OA 1J5TA 3ZVHB 1NFGA 2WNWA 1EX1A 1QK0A 3AOFA 2QJIA 2AAAA 4NT0A 1UH4A 4Q32A 2EPLX 3GNOA 3TXZA 4G1KA 3S1XA 3F4VA 9XIMA 3W02A 3MANA 1B3VA 2Y1HA 3E6EA 2I5GA 4DAFA 3CO8A 3R0KA 3P61A 5FJRA 4W8LA 3U9IA 3AICA 1JZ6A 2GWNA 3PZUA 4AZ7A 1AUSL 5REQA 1ISWA 4NZCA 2A79A 2FTWA 1SJDA 2EPKX 3MTWA 5DF0A 2BVTA 1SFLA 3VZZA 6REQA 1XM3A 1VFFA 3WF1A 1QCWA 2J74A 1L2UA 2ACQA 1B1YA 3Q4DA 1RR2A 4TTGA 4O8AA 1GNXA 3ARQA 1Z48A 2RHGA 4C1LA 3LLDA 2XHYA 3ISIX 4JN8A 5F2GA 1DIDA 1FX6A 3W74A 1FXPA 1RQHA 2Z1WA 2XM1A 1ML1A 4LOCA 3V5FA 4UNKA 2W62A 1W5PA 1YYAA 1PKYA 3E0WA 1IIHA 2CXGA 4IMAA 1HUVA 3U4FA 3ZVIA 5C9WA 1IEVA 5A6BD 3TC6A 3TUUA 1KTNA 3SDOA 4E2VA 2CZEA 3UWEA 2CNCA 2NX1A 4UFJA 1EO7A 3T6CA 3L21A 2UY2A 4HMNA 3T07A 1EHNA 2DIKA 4R34A 2PGWA 4W88A 2Z1BA 1Q6OA 2Z27A 3LBOA 1ZUAX 3IJ7A 2OYLA 3H7VA 2WBKA 2Z6JA 4W7UA 3TTEA 4P7RA 2Y5JA 3TN4A 3ZJ6A 2VZOA 2ZZ4A 4FHAA 2HE5A 3S3GA 2D23A 1KKRA 1XLKA 4I5XA 3O0FA 1U1HA 3NYDA 1NDYA 1E6RA 4JQ3A 4XKYB 3HQPA 4J2PA 3N1AA 2WCAA 5H2ZA 5DCBA 2WMHA 4KWWA 4S2BA 3M0KA 1XUZA 3NQ6A 3TNBA 4BQ4A 2X40A 3ERPA 2W92A 2WVTA 3EEGA 2ZZ5A 2ABBA 3TVAA 3EOLA 1Y7VA 3BWWA 3S42A 1TWIA 4OBSA 1CGTA 5REQB 2EKCA 2PRMA 1MUMA 3W6LA 2QZRA 1CNVA 3MY9A 2WKJA 4GO8A 1EB3A 3S9YA 3MUAA 4Y8FA 4POCA 4DI8A 1A3WA 2GVEA 3E2VA 1IYXA 4WF7A 3RNDA 4Q8VA 1YTEA 5DFAA 3QZEA 4CQBA 4P8VA 3KTXA 3WUEA 2ACUA 4IL0A 2DZPA 1BSLA 2C6QA 1M6JA 5GJPA 3VD5A 1DV7A 2CERA 2QJMA 2XIOA 2R82A 4US5D 4G1NA 1RP8A 3RJYA 4RZBA 4U33A 2WZIA 2V63A 4JTRA 1OX5A 2DEPA 5A8MA 3K8LA 5I7GA 3QLDA 3ITXA 2OQLA 4DX3A 4MLRA 4E8GA 3OBAA 3W7KA 1VD6A 3P0XA 3VC5A 4EKJA 2ZZ7A 5I00A 3B9EA 3LA4A 1O94A 1L8PA 1MDRA 1KKOA 4JYEA 3RPDA 3A13A 1VFOA 2EBNA 5F2MA 2W79A 3ONCA 4R9XA 4P5UA 2KZHA 2J25A 5C71A 3MJMA 1HO4A 1XINA 2E4TA 2Y7FA 3NURA 3L12A 3O15A 4Y9MA 1Q66A 2BLEA 2CBIA 3G1YA 1ICSA 1XRSA 3LRMA 1I0BA 1AQMA 2ZA1A 4M6QA 5CJNA 1N7KA 3S1GA 1GJWA 4IJRA 3L4WA 5HPCA 3CIXA 1A50A 4REQB 4CQ9A 2ZVIA 3L2IA 3BV4A 3RX2A 3RMJA 4JFTA 3NTYA 1XGZA 3V5CA 4UIOA 3POHA 3P93A 4MMWA 1LLZA 5HWMA 1NOUA 1E15A 1W5MA 4XVDA 1XISA 4MGGA 1CXHA 1KO0A 1R9XA 1LL7A 3O6DA 4E38A 4AISA 3IIPA 1OEPA 4JX4A 1QO5A 3LZ3A 2BOEX 1WBJA 5DELA 3M0HA 5D8ZA 3EWXA 1K3UA 4F0SA 2OCZA 4TVUA 1DJZA 3NGFA 3W88A 3S9IA 4JTUA 1UQYA 4UTWA 2WJFA 3VIHA 3KLKA 2Z28A 2NWRA 5CC5A 2NXIA 3IGHX 3WD1A 4AH7A 1B5TA 1JXKA 2ZADA 1SO4A 4JTEA 5A6MA 5J5DA 1JDFA 4PUWA 2H6RA 4F3HA 2VRQA 4E2BA 4JR5A 2J47A 3KLLA 1LBFA 1H0IA 1FXQA 3W53A 1XCWA 3IVTA 3TX9A 3EEZA 1FY6A 5LHFA 2YR1A 3EXRA 4IGHA 4AXKA 1IXOA 5BYWA 5K9DA 9RUBA 2ZUMA 1YADA 2XIBA 1SFSA 4XX6A 1OFRA 2CZVA 4O0KA 3LRKA 1EGVA 1JQXA 3BV7A 5E1QA 1O68A 3TE9A 2PFHA 3IGXA 3DGRA 1XX1A 2WKGA 2O92A 1AW5A 1RK6A 2J88A 2QCNA 3L5LA 4MJ2A 3GRIA 1P4CA 3W75A 4KERA 2YA1A 3WNNA 2NXHA 1P0DA 4MNKA 1DTUA 1X6NA 2JIWA 3IIXA 2OOFA 1MEWA 3WQ5A 3DFQA 1NDWA 5M1TA 1QNQA 2NQLA 3AMLA 4LUTB 4GYPC 2E6DA 2J7DA 1XQKA 4RNIA 1Q2SA 1SJCA 1AODA 2Y63A 3DENA 2X05A 3PAOA 1CXIA 3T7VA 3NM1A 1GOOA 5EMMA 8RUCA 4GFSA 4ML9A 1DQXA 1GKRA 5SWUA 3RJXA 1E6PA 5HA7A 3A9IA 1H5VA 1KNWA 4O14A 5F2LA 2PDLA 3W26A 4S3CA 2FFCA 4U3CA 1SZGA 4HPXA 2PGRA 3VIIA 4AXNA 1C29A 1UZ4A 2D0HA 1PSCA 2E40A 1X1ZA 1M5WA 2QIWA 3B8UA 3W7NA 3MI3A 5C2GA 3NM3A 1QBAA 3AZSA 4JIEA 1UUQA 1ZZMA 1ZBCA 5G2HA 2ZC1A 4KQNA 1MNSA 5JMUA 2W91A 5EY5A 1W91A 1B4EA 2AKMA 4XAGA 1ZSXA 4EK7A 1MEIA 4X63A 1FKXA 2B4GA 5FAJA 3WIJA 1YEYA 2A7PA 5CC6A 3NA8A 3G8RA 3QVQA 4Q4PA 4LSBA 1OJXA 2XFYA 2VZTA 3P5YA 4P7OA 4GIYA 1EGZA 3MV11 1I4NA 4H9YA 3HQ1A 4DJDC 1VR6A 4JDYA 4G5DA 4GZEA 3UERA 4AMAA 3BK0A 1GQIA 3KTSA 3GXTA 4NNCA 1KFKA 3O6AA 1B3XA 3W1QA 2BGSA 3NQAA 2E68A 1TJPA 5FEZA 3LPFA 3W6YA 3ABZA 3E1F1 1KM2A 4FP1A 3HV8A 3KOFA 1JCMP 1XD1A 3WK3A 4A8NA 1EOMA 4PUMA 3WQCA 4BZYA 3NUKA 4JEJA 4LFYA 5AYIA 3ABSA 4IMFA 3ZT7A 3UXAA 3WCZA 3PTMA 2PB1A 1O6IA 3QH2A 2PDYA 3TQVA 1IXPA 5FJOA 3PZ9A 4RUBA 5K2ZA 2J79A 5C0QA 3NL2A 2NUXA 4LC6A 4LUSA 4DBEA 5A6KA 3BCJA 1CENA 4WJEA 4CU6A 4OGZA 1UD4A 3SCUA 3W7EA 3WD0A 1YNPA 4GD0A 3SRKA 3TSMA 3DFNA 2IXVA 3ARTA 3GUGA 1PV8A 1G6CA 1P0BA 4JX5A 2PDWA 2G3IA 2PPGA 3A4WA 3BAXA 3AISA 1XRTA 2BS9A 4RZ4A 3I6EA 1BYAA 5BZAA 1T0OA 2OEJA 2UWFA 2WCSA 3EB4A 4R5EA 2WMIB 1KTBA 1HF6A 5A6TC 3A5VA 1PL9A 4PGLA 4HMCA 3DDMA 3QY6A 1A5AA 1ZQ5A 3RRAA 4E6MA 1Q7MA 4KKXA 1OHLA 2J24A 4HU4A 4GJ1A 1F3WA 2QUUA 4J40A 1RJQA 3MP3A 2HSAA 3H4XA 1DEDA 1VGAA 3W7QA 1UH2A 4IP5A 4NUWA 1NP0A 6TIMA 2J7EA 2A21A 3R0UA 3UT0A 2GGGA 3WBYA 5AC4A 4AG0A 2OWXA 2WMGA 3R5EA 1V03A 1UMLA 3EKGA 3H2OA 1NU5A 8XIMA 3IS4A 4RDZA 3DHFA 4YPJA 2CCRA 2GVJA 1B3ZA 1SUXA 3EGJA 4X60A 5C2XA 1TPUA 4P7NA 1GK8A 1V3KA 3ES7A 3BG5A 1ITQA 4IGSA 1EJVC 1EUAA 3UR8A 3MMDA 3TQKA 4AX6A 1TR1A 4X22A 3UCCA 4C5ZA 5AFDA 4AZIA 3FW6A 3TW9A 4QG6A 5HNNA 3WFAA 3EOEA 4ACYA 3UXDA 1Y65A 1UBSA 1EPVA 3W1MA 2NVDA 2WC4A 1A5SA 4LXFA 2BODX 1GZGA 1MUWA 3CHEA 3EXTA 3K46A 3BQ5A 2PDKA 3M43A 3H2FA 3W27A 2O9TA 1KM1A 4ES4A 1ZJBA 4QCEA 1MNZA 3VKKA 4LJ3A 3LMZA 2MANA 1TSIA 3UNDA 5CEWA 4GRSA 1C8QA 1NELA 4WY0F 5FF7A 4AD5A 3AXHA 3LNMA 3AIUA 1VC4A 2OO6A 3ARUA 1XSJA 2R1MA 1UC5A 1FOBA 5FJTA 3OU8A 2UY4A 3WQEA 2PWUA 3AQUA 4DHGA 3GXNA 3PJWA 4ATLA 3IK4A 3STGA 2XJ7A 3G1DA 4C7DA 3BJSA 1CTNA 2EF9A 7A3HA 2EG7A 3KVLA 3OZMA 2I9UA 3MVTA 3WD3A 5M5DA 4PRRA 1Q45A 2Q71A 5C5YA 1YX1A 4ZQMA 5HWNA 1UCWA 3O16A 5T91A 4QEHA 5C9XA 4PMQA 1TUFA 4HHHA 4CU8A 4DJFA 2BXVA 3RPTA 2X2GA 3GS6A 1ECQA 5LNUA 2ZUVA 2Z2AA 4Q6JA 2R1LA 1EBGA 4MVAA 2BWGA 4JEQA 3GC4A 3GBDA 4TO8A 5CSUA 4FSAA 1W37A 2ZTKA 1K4HA 2CZDA 1I2PA 1Q6GA 3ARVA 2WWCA 3AXKA 1J4EA 1AZ1A 3KE0A 4HSHA 3N19B 2GFTA 4ALDA 1TA3A 3N9KA 4GACA 2ZXAA 5BCAA 3N15A 5JIPA 3DHUA 4UTWC 4C7FA 2CWNA 1W3NA 3NQ7A 2RDWA 4UFIA 2CLHA 3VABA 4FNSA 3FSTA 4MTVA 1RCXB 3FDKA 2PDQA 2G41A 1O5RA 3UGVA 3IAPA 4HK6A 3WO8A 4BY3A 2QW5A 3MWCA 2OEMA 2GOKA 3M07A 3U3HA 4GI9A 2H90A 1IZCA 3CUJA 2PURA 5B7ZA 2FDMA 2V81A 2VL4A 4FXSA 3C2VA 4K8EA 3OP2A 1B54A 3NZPA 3K8MA 1PX8A 1N8IA 2OGYA 2YDRA 5HANA 1F8IA 5CSSA 1GORA 1PHWA 1V3HA 1S39A 1KBIA 3C52A 2D3NA 1E51A 1QPQA 5DRCA 2ZX6A 4PTMA 1UKQA 4LVFA 1FWHC 2CXEA 1M03A 3C0JA 1KWKA 3VIFA 3OEXA 5HMEA 3KOXA 1CLKA 2C79A 4AC7C 3IVSA 5FKYA 1XIJA 2IPWA 1RA5A 3KW3A 4QG9A 1RAKA 3DN5A 3EA1A 1NWRA 1H09A 4A3HA 2CLEA 1BHGA 1XC4A 4I7UA 1ITXA 3UR7A 5HQEA 2VX6A 4B91A 2BXYA 2J7HA 4IX0A 1YDYA 3VD3A 4X2PA 1E1FA 3B04A 3ZYZA 3Q2DA 1A5CA 3PUEA 3QXBA 4FS9A 3WLKX 4A2RA 1BF2A 4PULA 3Q65A 3R12A 3W4RA 4J3VA 4IMDA 3SUSA 5FF4A 3UG4A 4CNOA 4JX6A 3IIOA 2HNEA 2VEPA 1DYSA 2DPEA 3WMBA 1DWHM 3LPOA 3PC0A 1TG7A 1WXZA 1JF5A 5GQBA 1D3GA 4JQ4A 4W87A 4NAFB 3P81A 1UA3A 4MJ4A 3SRHA 3SGUA 1TE1A 4B9YA 3WQ8A 1E5NA 2FYMA 3GHRA 3PB2A 5LIXX 1EF3A 5JVLA 1LL6A 1WB0A 1Q4WA 1E0WA 4DO6A 5K4XA 3IRDA 2Y5EA 1MQQA 3WD4A 3E38A 1DHPA 3QPEA 2AOSA 3DFHA 4GZ7A 3T2PA 4YLWA 3GTXA 4QJ1A 1ZBKA 3RU6A 5EMUA 1DE5A 3WJXA 4CN6A 1Z69A 1V4YA 4H8NA 4AWUA 1HT6A 4QEEA 4MZ1A 4LUJA 3GWQA 3GNPA 4RLIA 1IXNA 1J01A 5IDZA 3HB9A 1US2A 1I8JA 3TWAA 1GEQA 8XIAA 1G4TA 2A5HA 3M0YA 3AHXA 3C8FA 4RV8A 2YXOA 4Y96A 4ML4A 4UTFA 4KETA 5CPQA 3W72A 4LANA 1J2BA 1QHZA 1PWLA 4FX7A 1HL9A 2E9BA 2ISSA 5HOSA 3AC0A 3AHVA 4UQEA 2HBXA 3A64A 2ZFAA 4MDOA 4IQLA 4LYQA 5E0CA 3HG2A 3VCNA 2YIHA 1TB3A 1H3GA 1VJIA 4DPPA 3ZR5A 5CG7A 2CBVA 4NU7A 2P8BA 3VPLA 3BTNA 3MHFA 1JF6A 3DC0A 4NILA 2GUUA 4N6EA 5A5WA 4UFLA 3CB3A 1KV5A 3B8WA 1WAUA 1W5OA 3LHYA 2QMJA 1AW2A 2F38A 2QMKA 2ACSA 1M53A 3H55A 2QCDB 2WYSA 4MM1A 4AUBA 3BPWA 1ZL1A 2WZEA 1XGEA 3MSYA 2CHNA 4LU0A 4XG1A 4H9UA 3WN6A 4DO4A 3LBCA 5C54A 1BTMA 2VX7A 1EFZA 5D9PA 2VRJA 1PTGA 2EG6A 1TUXA 1PIGA 4IG2B 1TWZA 2HV5A 1FH7A 3ELFA 3PPCA 3NL3A 4HVXA 1ZBVA 1V6UA 2PTDA 1FKWA 4WLCA 5CAKA 4HOWA 3HQNA 1ICQA 5FESA 3SN4A 3THUA 3TYAA 4PMYA 4U5KA 3F03K 3KL0A 5BXPA 2RUSA 3MI2A 4PFHA 3C2FA 5I3DA 4IX2A 4M6VA 3B0YA 4L5ZA 3ZMRA 1QHPA 1EJTC 2VC5A 3CGTA 5CSYA 4WXZA 1VB9A 1W1VA 4IJBA 4DF1A 1X6LA 1TZ9A 3TZNA 4E4UA 5XIAA 3OG2A 4ZXLA 4UMAA 4MNMA 2PDNA 3ZT6A 1W56A 1V7YA 1RSCA 4AU0A 2NQZA 1MRQA 3LGGA 3TFCA 5BRBA 2CIPA 4MADA 5BMXA 1OC7A 4GG9A 2XVLA 1YPIA 2ZRYA 3ZIZA 4NZ3A 4BHYA 3JR2A 3MPGA 4QP0A 1XIEA 2QDGA 3TOYA 3ITLA 1L6FA 1S5TA 4MNLA 3BAJA 5CKSA 3WUBA 4ZQOA 1JGMA 1JRCA 1IR2A 1XI3A 2F84A 2GSEA 4O10A 1UWTA 2BVWA 1H63A 3RMEA 4RDYA 2XH4A 3RXZA 3S8HA 3ID7A 1DP0A 5I77A 2PWVA 5AN7A 4GYKA 1BEUA 3FJ4A 4WSJA 4I90A 1QATA 1J93A 1GVOA 4K68A 3FK4A 4O52A 1QI2A 4CNNA 1JFXA 4AHOA 3R11A 5KETA 1LOQA 3M0ZA 2RDUA 3OO2A 1HL2A 1H5YA 4FNUA 1O95A 3JVAA 1WDWA 2XYLA 3K2GA 1Z42A 3DZ1A 3CXOA 1C3FA 4P7QA 5JBEA 1JCJA 1XLAA 3BARA 4L9YA 1W8SA 3QZ6A 1CXFA 1B90A 1OYCA 4C6DA 3R58A 5DANA 3CPUA 3IIZA 3T81A 3L23A 1TREA 1TVPA 4JTAA 3R8RA 3NG3A 3HMJG 4S1FA 5G4EA 2CLKA 3GDTA 5CJ5A 2CLPA 4F0RA 1DOSA 2R6OA 2Z2UA 4UFKA 3EXSA 1PKLA 1M7JA 1DBTA 1NTHA 4WY0B 4OVXA 3HFYA 5AVHA 4GVGA 3TA9A 2Y70A 5I0DA 4C91A 1R30A 3KBWA 1S5NA 2YB4A 3JS3A 5HMFA 4FNTA 1JGIA 1MSSA 2NV2A 2XN1A 4NVTA 2HZGA 2D0FA 3K4AA 5D4YA 4JFWA 3SEPA 2XWEA 3MCOA 3EDJA 3HFTA 4X0NA 3WLSA 3E12A 3AFBA 3PJUA 2CLMA 4GI4A 3B8DA 3PS7A 3LOTA 3OLGA 1REQA 4PZVA 3EDDA 4HCLA 1XBZA 3CPRA 4Q4MA 5CPOA 5CGTA 3DGBA 3EX6A 4LAKA 1JEZA 5CJMA 3G1RA 5KZ6A 3MP4A 4YHGA 3U2CA 4EOUA 5DMMA 1JDEA 3B0PA 1LORA 1L9WA 4A8RA 4R33A 2J27A 3H23A 3ARWA 1BTCA 4YYCA 1WA3A 4JICA 2GQ3A 1WDSA 3ZJKA 4LS1A 5G2WA 3WMSA 3IANA 1XSIA 1JJKA 4ASTA 4CQ8A 3P7YA 3W81A 2ISDA 1S5VA 4NZ1A 3PANA 1SFJA 1IT8A 1DJQA 1B57A 1J9YA 5C2CA 3G1AA 1R9ZA 2PD5A 2SFPA 3GC2A 1VPYA 3MO7A 3AWNA 1WZAA 1BWKA 5CC3A 3AS0A 2A3HA 4DAIA 1BGAA 1KCLA 1NIUA 1DJNA 2VCAA 1EXBA 4TQTA 5FIPA 5M03A 1E70M 2OFJA 4AZCA 1I45A 1CEOA 1TZ7A 1XYFA 3F2DA 2Y85A 3TAKA 1L6WA 1XL9A 2O7QA 5PTDA 1A80A 3RGTA 3VGGA 3IWPA 3LB0A 4Q4QA 4A8LA 2ZDRA 2VKZG 3H4WA 4H6QA 5FI8A 2ZKMX 2NSOA 3AIBA 3L7RA 2VVNA 5ABGA 3STEA 3RN6A 5EMJA 2ON3A 1V0NA 5T26A 4LCRA 4ZFMA 4WUIA 1XS2A 3MV01 5MKGA 2X8RA 1KBLA 1D2KA 3LUTA 3SO7A 3QM3A 1QUMA 1HKMA 3PSWA 3SW6A 2D2GA 3Q58A 3PBVA 3AXMA 3ZFHA 5H1WA 2NSXA 5C70A 3LCIA 1UOZA 3I6TA 2PRLA 1V02E 3M0XA 4E5TA 1N55A 4CD6A 1GOXA 5CLWA 3CL7A 1J2WA 4EIVA 5HUPA 1KRBC 4L1XA 4NNBA 3RLUA 3T05A 4AWTA 3XINA 1KA9F 4DUOA 3W29A 4WRHA 1G9HA 2QCFA 4I9AA 3W25A 3TJLA 3R25A 2PCQA 4GVFA 3TLQA 3CQKA 2WW5A 2VELA 1XIDA 1BG9A 1PZ3A 4PUJA 3CZLA 4EXBA 2Y89A 3LGDA 3VOHA 1KM0A 3V0TA 4ZL1A 2ZX9A 4RDVA 3I4EA 3PPHA 3E3HA 4XSMA 1X98A 2RGMA 3FJLA 2Z29A 2QR6A 1R9YA 1UQZA 4XZNX 5B7YA 4R85A 3BMXA 1B9BA 3LM3A 4LT9A 1P6CA 1G4EA 4H00A 3L4ZA 4CLMA 5G4WA 3WBWA 2C0HA 4I7WA 3ARRA 1JCXA 4PTWA 2WJZA 5CBBA 3NQMA 4BWLA 4MDPA 3EWDA 3SUUA 2VEGA 4A3YA 1EXPA 3E02A 4YWSA 1S1PA 5G5IA 3VGFA 4AZ5A 4UTTA 8CGTA 3FX4A 4AD3A 3WFZA 3NDYA 3PUOA 1B9ZA 2P88A 3QR0A 1UR2A 4FOJA 4I8YA 3UY7A 4ZR8A 1NP2A 4PMJA 1H1YA 1IT7A 5E0KA 1FQ0A 4H6EA 1U5HA 5BOFA 4CKQA 1QFEA 1UJQA 1LT7A 1T8XA 1LDCA 3O63A 4DBUA 1EJ7L 4AMCA 4L4PA 4KRZA 2FLIA 4JYFA 3LHTA 2XDFA 1RALA 3VOGA 3SGGA 2OMAA 4WDUA 3W70A 1E0XA 1UBPC 4XTDA 3BLDA 2QF8A 4F0LA 3A47A 3NPUA 2VX5A 2PLJA 3LCGA 3S0CA 1DIOA 1IEQA 2NW0A 5KTLA 3FYPA 4FF7A 3E0IA 3ICJA 1W9DM 3PTKA 2OODA 1A5MC 2CLLA 3TN3A 3HPZA 4DNHA 4QG8A 4NSBA 4XZMX 3KXQA 2OWCA 2VYOA 3IVUA 1GOQA 2QCDA 2A3EA 3JRKA 4PUUA 2WSKA 1J0KA 1DWAM 3W71A 4UUIA 3D47A 2GWGA 2F7FA 4ORIA 4HHPA 3OA3A 4GIAA 4NI3A 3IACA 3T55A 1UP2A 4K2SA 1YPFA 5G1TA 4UQDA 3I10A 4HNCA 3MCNA 2HTMA 3G0SA 1Z41A 1Y5WA 1P1MA 1EEPA 3WY1A 2WZHA 2NQJA 3M44A 1U83A 2O56A 3EB3A 1CLVA 3W1RA 2DUAA 1NOWA 2ZRUA 2VFFA 2Q8ZA 3GU9A 1M04A 4LVDA 1O66A 5A2BA 3WLRA 1LBMA 1UD2A 3MBFA 4MKVA 3UG5A 4UQ9A 3PFRA 3DUGA 5A8OA 4ICCX 4FLQA 1NFPA 1OF8A 4HHLA 4PCTA 3GFZA 2HJPA 3C6CA 2GLKA 2VOTA 3W2KA 5C8BB 3PZMA 2IPFA 4LCSA 2WK2A 3W23A 4K6AA 1HIZA 4Q8WA 1JZ8A 4B92A 1V6XA 1CGUA 3TTQA 3GVWA 3BOLA 3WUGA 3FLUA 1KQZA 1R7AA 4J3SA 2Y0FA 1TJ1A 1Z9AA 3CTTA 1QWGA 3LCXA 2R14A 2RDTA 4IM4A 5FACA 3PUGA 3B03A 3LCHA 2QDDA 5E70A 4ZBCA 1E4LA 1LJYA 5CG0A 3DERA 3VKCA 3LXCA 1BFNA 3ENLA 4PMVA 3TV8A 3PVFA 4UFHA 1V3IA 1OX4A 2J78A 1LM1A 4G2DA 3W07A 2QUTA 4C1NB 1S2VA 1UWIA 3M46A 5A6SA 3KAOA 4XO6A 4ACZB 5ECUA 4W84A 3S4TA 5HATA 4NYUA 4MB1A 3FNDA 1U22A 3WKZA 3N2BA 1ITUA 3GY1A 4BF9A 4AY7A 3L4YA 3ITCA 4G7FA 1OG0A 3CYJA 4RX0A 5HJXA 4LAOA 4OE7A 4W7WA 1E6QM 5A2AA 1WP6A 3MSGA 1SJAA 1WPCA 2F61A 1VH7A 4KCVA 1S2TA 1MW2A 3VX1A 4UFMA 1UZHA 1XIBA 4PUKA 3GXMA 4S23A 4L1GA 1C8VA 3WLHA 3INPA 2DZSA 1P0NA 4NZFA 3E2RA 4XB3A 1JYWA 4DZAA 3QJAA 1A4MA 3WLJA 4Z2HA 1FWTA 2OU4A 3T44A 2P1FA 4L80A 2OYMA 1IIGA 1GVSA 5CAHA 3L66A 2YDQA 2XM2A 1UHVA 7TAAA 2L5HA 4Z2LA 4EE9A 1RQBA 3R13A 3MQTA 4WY0A 4ERGA 3QV6A 2NQ9A 4EWND 4EP8C 3EX3A 1F05A 3R1ZA 3KCLA 4HZ7A 4RPQA 2VD8A 3WQ4A 3THQA 2BHYA 1JD7A 1FWDC 5I09A 3F2CA 4H01A 1Z8AA 1D3HA 5AHNA 1K8XA 1ODUA 1OGGA 2FGLA 1GCYA 2VP8A 1XUUA 1JYXA 1LUCB 1E73M 2GPTA 4ZQNA 3N2CA 2VI0A 1ITCA 2HRWA 1R3VA 3L2LA 4IJCA 2XH2A 2BV9A 1NFBA 3GDBA 6XIMA 2DGAA 2CKRA 3H54A 4MB3A 2ZXBA 2PDMA 1ONWA 3RAOA 3A3XA 4UXDA 3BAIA 3GKAA 4HZ8A 3AO0A 3V36A 3C2EA 1FWIC 1S3HA 3A3HA 3VDGA 1QOXA 2XGIA 3KUMA 3VM5A 3T2QA 2OOGA 3DESA 5HWJA 5D02A 4OZOA 4UBPC 4AEOA 3AZRA 5U7SA 5CGMA 3DG6A 1S38A 3EDEA 2CW6A 4K7YA 4RCXA 2VXNA 1D7FA 4ZE4A 4FNRA 4QLKA 2Z1VA 3CH0A 2V9DA 1HJSA 3N2TA 5HJLA 1JUEA 1Q3NA 1CECA 5E09A 1SVDA 1LRTA 3W37A 1YTKA 2ANUA 4W5ZA 1RUSA 5AECA 3VNIA 1BVNP 5GPRA 4O4VA 5HJYA 1C9WA 2DP3A 5J5RA 1YHTA 3KZPA 3WH7A 1OK6A 4GX9A 4HK5A 3U2ZA 1SSGA 1VBJA 5BMWA 1W9UA 2DSVA 3CHVA 3GTHA 1OFQA 3GVVA 4IZGA 1W3IA 1KC7A 2F8QA 1OZMA 4ERAA 4JD4A 4XD5A 5LYRA 2V5CA 5BU6A 3W1NA 1UPPA 2H3DA 2O9RA 2Y5SA 3B3DA 4N4PA 3TTOA 4QSHA 3PBYA 4TU1A 1R0MA 2WSRA 4AEFA 4CVWA 3W76A 2BTMA 5JH2A 4UCGA 3LERA 4AY1A 1KLYA 3YPIA 1LWJA 5LNSA 3V16A 3H70A 4C7GA 1Y0EA 2B0MA 2EEXA 3WDQA 3VUSA 4H8UA 5DMLA 1AMYA 3LM7A 2I16A 3BW4A 3TQPA 4ERIA 4KEUA 3VUPA 3IIVA 5I24A 7REQB 4B5TA 1RY0A 2PZ0A 5EB8A 1XLGA 2ZZ1A 1EJXC 4GUIA 4H8HA 3TA6A 3MUIA 4BKNA 1JRBA 2Z1XA 3CV1A 1KBBA 2YJQA 5ABHA 3S5OA 3AS2A 3VMOA 3MWAA 3FJNA 2NQHA 3JZUA 4D6HA 1JCNA 4FX8A 3QMSA 1PTDA 3THDA 2UY3A 3GU2A 3UA3A 3VKDA 3ZQ9A 1DXIA 3D3AA 5HQLA 3WLLA 2DUZA 2IMRA 3BH4A 3REQA 3EX1A 1LZOA 1ZAIA 1O5KA 4MKSA 1JAEA 2YL6A 2FMNA 4A35A 4K8GA 4CCCA 4AZ6A 3S6TA 2XG9A 4AHPA 4KS0A 5AHIA 3URAA 2IXUA 3UP8A 3JUGA 4AWSA 5D09A 2GDVA 5IFTA 1W3LA 1SPQA 3PZNA 4LUTA 3A6OA 1DWIM 3KVKA 1KV8A 1PYFA 2RGLA 3OZOA 1AMKA 1VRXA 3IV3A 3NZRA 1R7OA 2NVAA 3S5ZA 2C13A 3WJYA 5JH1A 1W1B1 2DY3A 1C9DA 5FEWA 4WJXA 3POCA 2VWTA 1TE6A 3BZJA 3L4UA 4G8TA 2YA2A 4OUEA 3VILA 1RY8A 4DIAA 3ITVA 4GQGA 4NYYA 4C6EA 4I6VA 4J28A 3NSMA 4ZXOA 4AIBA 2XGZA 3STCA 2OLAA 4O19A 4CD7A 1K7XA 1LP6A 1VJZA 2PEVA 1EQPA 3SCSA 1DWFM 2QCMA 1W5NA 4F2UA 5ABTA 4XZ9A 2ZE0A 3D3FA 3N6QA 4YNGA 4ZOAA 4O1BA 3WQ6A 1Z3NA 1EP1A 4O28A 4LAZA 1TMQA 3I6RA 3I7SA 1K9TA 1W9PA 2PA6A 3M6YA 4BA0A 2FZ9A 4KFPA 4LS2A 4H4IA 3I3DA 5DCDA 4V1XA 5K9CA 1L6SA 3FN9A 3V5OA 4LUYA 2V5BA 3RO6A 4B2DD 4C6FA 4HOXA 3GTIA 4L1WA 1HJXA 2ZWZA 3QV7A 4CNUA 4DJFD 1P5BA 3NXLA 3KVMA 3CUFA 1E9YB 3M7SA 2P3EA 4FLSA 5D9OA 5I3JA 3M5XA 3TAOA 2CBJA 5CPTA 1CW2A 3WLMA 5HK4A 4PMDA 2JF7A 4IIFA 4E3VA 5CPSA 1SZFA 4DXVA 3ANYA 1G67A 1W8GA 4LS0A 2PSNA 2FZ8A 1XH1A 2VWSA 2GDQA 2QF7A 2WMFA