4Y90A

Crystal structure of triosephosphate isomerase from deinococcus radiodurans
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
MQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDATVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y90A00
4UFKA 5KZMA 4LVAA 5AN7A 1LBLA 3ZR4A 3CTLA 4XZ9A 5D2TA 2RFGA 4Q4KA 1VC4A 1DHPA 4N4PA 4N6EA 2HS8A 4NT0A 2FB3A 1JCLA 1IGSA 1TPVA 3HB9A 3W1NA 3IGSA 4KKXA 5AYXA 1MEIA 3W7NA 3GKAA 5AC8A 3W72A 5E0KA 3G1SA 3P61A 3LCLA 3FLUA 3R89A 4OV4A 2YX0A 1JCNA 4QISA 4AAJA 4A22A 1O4UA 6ALDA 3HO8A 4UMCA 3T40A 5F2MA 3O6DA 5G2IA 1RZMA 2FPVA 6TIMA 1H1YA 1TRDA 1G6CA 3B8DA 1KFBA 3TE9A 3BW4A 3NZRA 3V75A 1O94A 3CEPA 4O1BA 2B7PA 1T8XA 4N9DA 3G0SA 3MMTA 1I45A 4GUJA 1KV5A 4JS3A 2Q8ZA 1SO3A 2AAMA 4JYEA 3QC3A 3GK0A 3TSBA 1XUUA 1K7FA 3DKLA 3EXRA 3P80A 1KA9F 4WJEA 4FB7A 2QCNA 3DKJA 1GQNA 3TXZA 1BEUA 2I9EA 1GOXA 3FKKA 4PFMA 3QZEA 3S1XA 3WJSA 2CZFA 4Q32A 4A2SA 5I3GA 3PAJA 3GNDA 1IXPA 4PC8A 3IVTA 2V0TA 4PA8A 2PC4A 1LTDA 4PCFA 2D73A 2GJNA 4JX5A 5TBOA 3TSMA 3DGRA 3BGJA 4I7VA 5I3KA 3KVJA 4JNMA 3NDOA 4UMAA 4ZQOA 2ZTJA 2FFCA 1H63A 1AK5A 3LV6A 3PSWA 4O1DA 2I1OA 1VGAA 3G3DA 5HWJA 4FX8A 4A3UA 3M5ZA 1IF2A 1EWEA 2GVGA 2RDUA 1W5NA 3IIXA 1CW2A 2FB2A 3TFCA 4OQVA 4O10A 3L65A 2OX1A 3KOFA 1SO5A 4OT7A 1ZENA 1N8FA 2XFWA 3EXSA 4Q33A 3FS2A 1OYAA 5IBXC 4RZ5A 3M44A 4UTTA 4UTHA 4NZJA 4R7JA 1FBAA 4FHAA 3C2RA 3C0JA 2VKZG 4LV9A 4DELA 3HPZA 4LS0A 1RQBA 4JY8A 4GFSA 3S5ZA 3TH6A 3EKLA 1W5PA 1FWTA 2GVJA 2A6NA 8TIMA 2H6RA 4O0ZA 4CNNA 4PTNA 1JUBA 1KBIA 5HMSA 3W7KA 1OJXA 2OT0A 4EIVA 1GT8A 3B4UA 2QUUA 1VYSX 1H51A 3W1PA 3E49A 1JUKA 4LU0A 4O52A 3PUDA 3UPBA 2C13A 2FDSA 3DHFA 1EPXA 4JTEA 3WJXA 1PIIA 3W9ZA 2WSRA 2Y6ZA 1LZOA 1THFD 5K3VA 1H7XA 4KFNA 1O5XA 1ZHAA 3M16A 5G2HA 4FEZA 1H5YA 1T0OA 1FDYA 5D2VA 4IWWA 3MYOA 4FXSA 3TK7A 4U28A 4CCDA 1SZNA 1TPDA 3HG3A 1K8XA 3RF9A 4MJMA 2OCZA 1F76A 4XKYB 5HQEA 2HS6A 3P62A 3FJ6A 5LGXA 2NV2A 4LT9A 2V2DA 3V1PA 3H54A 3L2IA 5EA9A 1E51A 2YW4A 3QQ0A 1FWSA 4WY0B 1PCKA 4O19A 1WX0A 1VJIA 2Y7FA 1VRDA 1EUAA 1DOSA 2YYUA 4NX5A 1Q6OA 2QCCA 1SZGA 4S2CA 3DFOA 2Y61A 4CQ8A 2H8ZA 2ZTKA 3GDKA 5KSWA 1P5BA 2QJHA 3N14A 1V7YA 3PBVA 1LCOA 3ABQA 1GYNA 1N55A 3A9IA 2B7QA 4ADTA 1KBJA 3GIYA 4E2DA 3W2UA 2JGYA 3FEMA 2DJLA 5AHNA 3I65A 3T55A 3PUEA 4AEOA 3LHZA 3R5EA 3FA5A 5DLCA 3A21A 3N3MA 1MO0A 1KM3A 1DQWA 3PR2A 3LGEA 2E5DA 3ABRA 1R2SA 4K39A 1HFBA 4O8RA 1PL9A 1Q6LA 1VHCA 1KM0A 3P7YA 1BKSA 3IVUA 1VS1A 3LBCA 4FXRA 4WX2A 3KVLA 2PRHA 2WV8A 3GX9A 2GQ8A 3MP4A 3BLFA 4JYDA 5MHBA 3QJAA 1QPRA 4YXGA 2CLEA 4AH7A 3STFA 5FEXA 2E68A 2GOUA 4UCGA 3UZ5A 1F73A 1Z48A 3KVMA 3P60A 1TPWA 3GAYA 3M9YA 3O8AA 3W76A 1M5WA 2NUWA 4Y90A 4N4QA 3EX4A 1I2PA 4DBDA 1EIXA 4RZ4A 2J88A 1G7UA 4JDYA 4N02A 3QMSA 1RQHA 3NGJA 2QCFA 4DF1A 3IIOA 1TREA 3QH2A 2P1FA 1QDSA 3B05A 4IMDA 1QOPA 3TXVA 4AXKA 1LDCA 2RDTA 3E9AA 3EX3A 2X1UA 1WYIA 5D04C 3EX1A 5HULA 1H7OA 3RFAA 4K36A 4DBEA 5HUPA 1TJPA 1FCBA 4TMBA 1YTEA 5F4WA 4Z0JA 1FY6A 3C3NA 4Y8FA 3C8FA 3PG9A 5FF2A 3HJZA 2RKXA 3UWWA 3HGJA 1K02A 4Y6GA 4RCXA 2FLIA 4YL2A 3B03A 4LUJA 4ZQCA 1KM2A 5U4NA 3NQ7A 3W7JA 2X1RA 1I2QA 5BRBA 3W7QA 3QMTA 3CM4A 3GDLA 2QCHA 2ISVA 4EOUA 1B9BA 2ISSA 5CZJA 3P67A 1YXYA 3KFTA 3GAKA 3W1LA 3A5FA 2DZSA 2ZQ0A 1TQJA 1EB3A 1YYAA 1Q6QA 3C61A 3DFPA 3CIXA 4MFDA 1I2NA 3LRLA 2H3BA 1YDNA 3NOEA 3MUXA 2QUVA 2ZRZA 3CU2A 4AMAA 4O28A 2A7RA 4QQ3A 1G7VA 2C18A 2VFGA 5D37A 1WA3A 2C6QA 4AWTA 3RK8A 3UXAA 2C1HA 3R12A 2J9YA 4UUIA 3VKJA 3T7VA 3R13A 4FF7A 1OX4B 3W7MA 1M7PA 3MBDA 1QO5A 4DQWA 4EVZA 3BK0A 3DI0A 4O14A 3EWBX 3KX6A 1XCFA 5EL1A 3ANYA 1OK4A 4IJBA 5G1TA 3RMJA 3VCRA 2QAPA 1HL2A 1DV7A 1SSGA 1FDJA 3W2NA 5HJLA 1W5QA 2TYSA 3N73A 2GUUA 3LXCA 2NWRA 4POCA 1RQEA 4HNUA 5A5WA 4LRTA 1EP2A 4LUIA 2CLKA 1S3HA 1ME8A 1A5BA 3I7SA 1OFQA 2HSAA 2A0NA 3UWYA 1VQTA 3I68A 4UTJA 4XUGA 3BG9A 3NQVA 3W1QA 3AJXA 4MOZA 5HNRA 4PEKA 4UFJA 2FQIA 1SU5A 2H8XA 4IX0A 2O7QA 1ZALA 2VEMA 3LV5A 4JTLA 3HIJA 3KAOA 3G22A 5AHIA 1VCVA 4A29A 2YFNA 4RR4A 4YCOA 1F74A 2G5WA 3NQDA 1FX6A 4MY9A 4WXYA 1WOBA 3CQ0A 4PH6A 5KTLA 1BWLA 1F05A 4R33A 2ZZ3A 4FNUA 3FIGA 5ABTA 1OFOA 1WBHA 3DAQA 3S5YA 4TIMA 3W7LA 4DPQA 4C1LA 2AGKA 4O53A 2O7SA 4IUOA 3NEVA 3W74A 4LS2A 5LZLA 2VFDA 5EYWA 4MUZA 2X2GA 2NXIA 3LCHA 2KZHA 2BX7A 5EBUA 4JICA 3DFQA 1TTJA 1WBJA 3GXPA 1P4CA 3IIZA 3UNDA 2PURA 5BNKA 2ZCGA 4HNTA 3WK0A 5FF7A 4B5NA 1Y0EA 2J6XA 3S1VA 3QW3A 1AW1A 3G3MA 4I7WA 1ICSA 4MJZA 1B4EA 1LRTA 1GVFA 3MP5A 4LVFA 3C52A 3TROA 4OBTA 1LM1A 2DORA 2A21A 3QQ1A 4IMCA 1UUOA 4MFEA 2CLMA 1X7FA 3PUOA 2VFFA 1VLWA 4FNQA 1VLIA 3P5YA 1CX9A 1IIGA 1KM5A 3PULA 4YWIA 1IXOA 4O11A 2NX3A 3MI2A 3KVKA 2QCGA 3IIPA 3L21A 3O06A 1V5XA 1XM3A 4CCEA 2PCQA 3ZFHA 1DKWA 3W7IA 4LWWA 3ATYA 2WQPA 1X1OA 4UTTC 4FIRA 3NM1A 5EY5A 2WNNA 2J9XA 2DZXA 1OYBA 3N19B 1JUEA 1W3TA 5KITA 4CQ9A 2G95A 4FX7A 1W3IA 2QCLA 2P10A 2Y7GA 3KRSA 4ZVJA 1ONRA 5D05A 1QOQA 4ZZ9A 2DZUA 3VFLA 1IXNA 4UTIA 4MIMA 5D09A 5CPNA 1W5OA 1WXJA 3SR7A 4M6QA 3JS3A 3BLEA 1H62A 5F1VA 3TW7A 2C14A 3GXNA 3NQCA 2GVLA 3G8EA 3Q94A 3W2LA 1TPB1 1OX6A 4M6VA 1OF8A 2PRMA 1SR9A 3CWNA 1OX5A 3BW2A 1KFCA 1G67A 3E96A 4XKYA 3M5XA 3THAA 2YZRA 4GUHA 5HWNA 5AFDA 2H90A 5CG7A 3EWZA 3PB0A 4NJIA 4RK8A 4X9SA 4WY0A 3P8JA 1KM1A 3C2VA 1SSDA 4ZQPA 3QYQA 4N9CA 1SZFA 3G1XA 3HF3A 5I3JA 4UMBA 3OVPA 2ZZ4A 1L2UA 1G69A 5DBUA 5AYZA 4OU1A 1R2RA 1FDZA 5J5RA 1F6PA 3FKRA 4XBSA 2ZA1A 2W0UA 5HINA 4DEFA 4H6KA 3U2OA 2A6LA 5I3IA 1WAUA 3GZ3A 4JIQA 4M5PA 3O63A 3LERA 5A8GA 4BR1A 3B0VC 1B4KA 3MW7A 5DY3A 2NWSA 3NVTA 3NO5A 4ZL1A 2ZYFA 4XQ6A 2OMAA 1LRNA 3CB8A 3CEUA 3PG8A 5SWUA 3MI3A 1GJPA 3WJYA 3A22A 2DJXA 3S42A 1FXQA 3CC1A 3W75A 2A2IA 3LI1A 4ZQMA 5IM51 1C8VA 3TQ0A 1J5TA 3UWQA 1ZY9A 1L9WA 1W5MA 1XBYA 4TR9A 1XBXA 2ATMA 3LRKA 1FUYA 3S8HA 4S1FA 2HMCA 1LOLA 2YR1A 1AW2A 1KLZA 4UXDA 1ZFJA 5FEWA 4UTWA 3G24A 3L5MA 4AHPA 5D38A 2EGZA 4MYAA 4AHOA 2GQ9A 5FF0A 4RXGA 3A23A 5CKSA 3W7CA 5HR7A 5LNRA 3PBUA 3EX6A 1YADA 5K9DA 3UY8A 3LLDA 2E09A 2A4AA 4K38A 1K7EA 3T44A 2Y89A 3TC6A 2QJIA 1FXPA 3ELFA 3ATZA 3W86A 1WOAA 4DF2A 1HO4A 2ISWA 3L9CA 3LCIA 1ML1A 4MKNA 4O1AA 1PVNA 3KRZA 1WDWA 1QR7A 2PRLA 5CZTA 2ZRVA 4GUFA 1N7KA 2QCEA 3IRDA 2V5LA 3SJ3A 2ZRWA 3TAOA 2VFHA 2J27A 3P8IA 4IMGA 1HTIA 3SGUA 3KHJA 3M7WA 1SFJA 2F7FA 4JR5A 1OVDA 4JTKA 1QPQA 3WJWA 1PV8A 1DQXA 1TCDA 4OE7A 3NM3A 2VEPA 1KFJA 5C54A 5GVJA 2YCEA 2X1TA 1ICPA 4JY9A 1YTDA 3C4UA 1KFKA 4GBUA 4IXHA 3UYCA 1ADOA 4JTFA 3BPWA 1JRCA 2XN2A 1K8YA 1AW5A 2YFOA 1KTCA 1VYRA 5TIMA 3DFTA 3UWZA 2VFIA 1B3OA 4O1CA 4HSOA 4W9TA 4TX9A 1F2JA 1TYGA 1LP6A 1R46A 3U8GA 3W22A 3M5YA 2Q3OA 5G5IA 3TKFA 2DZVA 3M47A 5EMUA 2QF7A 3EEGA 3LCFA 3DBPA 3NA8A 5CGQA 2NZLA 1XKYA 2Y70A 3W7GA 2BWGA 1UB3A 3MI6A 2JKEA 5U7SA 2BXVA 5K9XA 3NQMA 2DZTA 1YLVA 3OEXA 4K8EA 2V9DA 3M6YA 2JK2A 2QUTA 4JTJA 1L6SA 1MSSA 2V2CA 3P84A 1TV8A 3BGGA 3IIVA 3QW4B 4MLRA 4L4MA 4FNRA 3SI9A 2NXGA 2WO5A 2XN1A 3FFSA 3T78A 2VXNA 2PE4A 2CWNA 3CIWA 4UTMA 1PE1A 1AMKA 4JTGA 4GJ1A 4KWVA 3UZJA 1JULA 1X6UA 1GG1A 2YXGA 3NZ1A 1OX4A 5H91A 3USBA 1KTBA 4BI6A 1JRBA 4ORIA 3L0KA 4M19A 1KV8A 2V8ZA 1TPFA 3PS7A 3PBWA 1IXQA 2Y62A 1LORA 4MY8A 2E1DA 5DCDA 2EHHA 3I6RA 3N9RA 3HG5A 2Z0IA 1ALDA 2GJLA 2ZBTA 3C2FA 2E6YA 3W3OA 1NSJA 3HGRA 2V5BA 3W23A 3LX9A 2CLHA 2ZRUA 2DP3A 3GDTA 1R2TA 1TSIA 3ZWSA 1WQ5A 3B0UX 1TTIA 4A21A 5D33A 1LYXA 4G1KA 1Q6RA 3P5ZA 2V30A 1RD5A 1TQXA 3WK2A 3RLVA 2GPTA 1QMLA 4LVBA 3DI1A 1KLYA 1GVOA 4EF8A 5F2LA 5KMYA 3NQGA 3HPSA 3C6CA 5F1UA 4E2BA 1OG0A 4Z1CA 1OFEA 3HOJA 4XTDA 4FO4A 4H4IA 5D30A 3TQKA 3MHFA 5K7JA 3JRKA 4HKPA 1FCUA 3O1NA 4UR7A 2F84A 2RHGA 1C29A 1W8SA 4NNCA 5AOUA 2C3ZA 3N2MA 1GVQA 2TPSA 3GYEA 3TMQA 4YLWA 5D03A 5DN1A 1S5VA 4TMCA 1R30A 2WNQA 4HPXA 4GUGA 3G1VA 2B7OA 5BW6A 2Z2UA 4L4LA 5L9FA 4O17A 3F4WA 4K37A 5K2ZA 2AQWA 4NJHA 3F1QA 1KFEA 3TJLA 4OHQA 1J2WA 4Z08A 3SECA 1GVRA 1LLZA 2BZNA 5I3FA 4JX6A 2Z6IA 4N9BA 2OZ0A 3NL6A 2B7NA 4HIBA 3O05A 5I3HA 1MXSA 3TIMA 4LVGA 4QAIA 5LNWA 3UWVA 3LBMA 1ZCOA 3M5VA 4FNTA 1ZNNA 4NXKA 2FIQA 4LC8A 2V2HA 1TTQA 1T99A 3OG3A 5HWMA 1EP3A 1XBZA 3TJXA 3OIXA 2R8WA 2CW6A 3LOTA 2WSYA 4UTLA 3M0ZA 4NJJA 2E5BA 3W7HA 3L5AA 3T4CA 2WKJA 3W1XA 3S9YA 3EX2A 4ICNA 3JR2A 2OJPA 3IEBA 1VCGA 1K03A 4NNBA 5HUOA 3N9SA 3W87A 1SPQA 1QAPA 2EPHA 1TPC1 5E1QA 3LB0A 1F6KA 1P0KA 4CCCA 2X30A 1JQVA 5K4XA 2Y63A 3W7RA 1CI1A 2WSQA 3UY7A 5LNUA 3LXAA 4NU7A 5D2YA 5LNSA 4QSHA 4O4VA 5DXXA 3EB2A 5G2WA 1NAL1 2TRSA 1Z42A 3INPA 3PVFA 2JGQA 1XBVA 3VNDA 2YDAA 3KRUA 1I2OA 1I4NA 1X8FA 4ORMA 3G1FA 4IXXA 3W85A 3LI0A 4O12A 3DFNA 1QNVA 1SO6A 4NXSA 3GR8A 2Y88A 3LM7A 3NL5A 4RZ6A 1SQ7A 4PODA 3NQ2A 2ATSA 1LOQA 4PL1A 4ADUA 4LC6A 5FEZA 2QCDA 1JCYA 3EWXA 1XI3A 4IMFA 1PCWA 2V81A 3ZWTA 4LTSA 4D2JA 4IGHA 2NUXA 4NUWA 2W6RA 3PSVA 2A85A 5KZDA 3FYPA 1EWDA 4XTIA 4EF9A 1ZAJA 2C15A 4KFPA 3W1AA 2CU0A 3W1UA 3W70A 2A7NA 4CLMA 3STCA 1S5TA 1GG0A 4ALDA 3WFAA 3I7RA 4LNYA 5G4WA 3W71A 4N6FA 4ML9A 3G0UA 4DXVA 4K8HA 3FJLA 4WQ6A 2WOQA 3I7QA 4WXZA 3G8RA 4U4MA 1HG3A 2YYTA 3EXTA 4RKAA 1P0NA 3DZ1A 4I9AA 3MHUA 2G96A 3G1HA 4WY0F 1TV5A 4M6PA 1JCMP 2WJZA 4OWGA 1TV7A 1K8ZA 1B57A 2OT1A 1DJQA 3W7DA 5KZEA 1F5ZA 2VEIA 3O6CA 2Z1BA 5H2ZA 3LCWA 2ZRXA 2ZZ7A 5D2WA 3M41A 4JXCA 4HNVA 2VENA 1OFPA 1LOSA 3RU6A 3N2XA 3LHUA 3HQ1A 3CLMA 3E0IA 3PBYA 4DPPA 3O6YX 3C2EA 5C6MA 5C5YA 3LHWA 2ZZ6A 2Z6JA 4HT3A 4MZ1A 2YW3A 3P74A 1T96A 2RDWA 4NJKA 4IQLA 3LHVA 3NG3A 5FF4A 3L66A 3O15A 1LLWA 1A5SA 2E5CA 3STEA 2CLIA 4O54A 1AG1O 4DF0A 5F2GA 1LROA 1XXXA 3FOKA 3R8RA 5LKYA 3UD6A 4UTWC 3S1UA 3S5NA 5AC7A 3TCEA 3TV8A 4CQAA 1QO2A 3IGUA 4QIUA 3C56A 3TNOA 2EAWA 1OHLA 3EWUA 2GQAA 4GE8A 4P61A 1XDMA 2NXHA 4O16A 1VYPX 4CNOA 5LGZA 3A5VA 3Q2DA 1NF7A 4JX4A 1KM6A 3W6YA 5CSSA 1YDOA 4UR8A 3SY5A 3P81A 4MLJA 2C16A 1GTHA 1NVMA 2DZPA 2YPIA 2WNZA 4X3ZA 2QCDB 1VCFA 3P82A 4BWLA 1GZGA 2QCMA 4UIOA 4TO8A 2G97A 3G18A 1XFBA 4JN6A 4NQ1A 5L6UA 3MYPA 3OVQA 4C1KA 1SO4A 4E0CA 3IV3A 5HR6A 1LBFA 1W3NA 2UV8G 5TQLA 3NQ8A 4AVFA 2ZRYA 3QM3A 5J5DA 5T26A 4QNEA 1VHNA 2ABBA 2CZDA 3R2GA 4UNLA 1F7BA 3YPIA 1XDLA 1D3HA 1L6YA 2BSLA 1O95A 1A53A 1UBSA 4UFMA 1Q3NA 4YCPA 1TIMA 4R53A 4BF9A 5AHFA 1JVNA 2VEKA 4HHPA 3L68A 5DY2A 2B0MA 4QM1A 1J4EA 3EWYA 3QEZA 5DBTA 3W1MA 4JTSA 1S5WA 3RNDA 1GWJA 1OYCA 4AF0B 1AL8A 1OFRA 4FX6M 4WOZA 1KTNA 2TMDA 3L5LA 4NNAA 2I14A 5C2XA 1Q45A 1W54A 4FNSA 1KW1A 4MY1A 3QSTA 4LV4A 4LW7A 3MWAA 1QFEA 3GDRA 4UFLA 4LS1A 1TJRA 1TPH1 4WUIA 3TW6A 1TB3A 3WK3A 2VFEA 1Z41A 3LCGA 4K7VA 1DJNA 4HSNA 3U6WA 1X1ZA 4JGDA 3SZ8A 3G0XA 3LLFA 1OFBA 3H53A 3NQ6A 3N34A 4IX2A 4LRSA 4Y96A 3TAKA 1VH7A 1ME7A 1YDVA 3K30A 4JTTA 3W88A 1PHQA 1W37A 3MJYA 2JKAA 2IQTA 5LHFA 3NPUA 3TQVA 3CHVA 2QDGA 3BG3A 3GB6A 4JDBA 4O15A 1H60A 1YPFA 3SFKA 2NLIA 4N9EA 2RH9A 1TPEA 2A7PA 1W56A 2W79A 2ALDA 2X1SA 5LNVA 3S5OA 1D3GA 4LVDA 1BTMA 4JTHA 4WZHA 4ONVA 1A5CA 1L6WA 3OVRA 3QFEA 1HUVA 2QDHA 3LHYA 3DENA 4ADSA 1G4TA 3W07A 3SGZA 3LCXA 2ZA2A 2NX1A 1VZWA 3GDMA 4IMEA 4DO4A 2VC6A 4O13A 1IIHA 4K6AA 1FWRA 1GEQA 1Z44A 1G4SA 2E6AA 3D0CA 5DELA 3HG4A 1D9EA 4BK9A 4KWWA 1U5JA 1I2RA 1UCWA 1U83A 3WK1A 3W2MA 5DCEA 3LHTA 3LDVA 2NX9A 3QPZA 4H3DA 3W1TA 7TIMA 2FTPA 3NNTA 5F2IA 2J24A 5CPLA 3KXQA 3S1WA 4UTUA 2ABAA 2Y7EA 3MHGA 3STGA 1MZHA 3H55A 1EEPA 2BLEA 2CZEA 1JCJA 1JR1A 3L0NA 1ZAIA 5AHEA 4GNJA 3BARA 3G1YA 4O50A 4HNNA 4J9JA 2C0AA 2DU2A 2ZA3A 3NQEA 2LLEA 1YTKA 5E93A 4BI5A 3MO7A 5K4ZA 1OF6A 1TMHA 3TU9A 3VE7A 4RV8A 4NVTA 3BO9A 1H7RA 1QCWA 4OV9A 2ZDRA 4GRSA 5CPMA 3OHIA 2H3DA 4LOCA 3NPVA 4FIQA 4MZYA 2CZ5A 5BMXA 1RVGA 1H50A 1SZEA 2R14A 1R47A 5IBXA 4KFOA 3TA6A 3TSDA 1HO1A 3S0CA 3W2KA 2TSYA 3UXDA 2FPYA 1TO3A 1FWWA 2CLOA 4MPQA 1RPXA 3OBKA 5DXYA 1TTPA 2B4GA 1H7WA 3ZS4A 3G1AA 2ZFAA 5C55A 3DHDA 3BLIA 1GYLA 2CLFA 1VPXA 4Z1BA 4Z1AA 5BMWA 2ZZ5A 1NEYA 1UUMA 1O60A 5AYYA 3LXBA 1K3UA 4IPIA 4JYFA 2A5HA 3DU0A 4RLIA 2EKCA 3HMJG 1QWGA 1WV2A 4YMZA 5CZSA 3TR2A 2ZZ1A 1OK6A 2V82A 4ZMGA 1LBMA 3QMRA 3NXFA 1XUZA 4Y9AA 3W2JA 4P2VA 3MP3A 1UJPA 5CSRA 5AHLA 2NUYA 4AWSA 1JJKA 2XN0A 2DZWA 3W1RA 1RV8A 4MYXA 4HN4A 1G4PA 3S6DA 1GVSA 2BTMA 3IGXA 3LTYA 3HPXA 3QSRA 2FPTA 1M7OA 5K9CA 2Q3RA 1FWNA 2E6DA 3NR0A 4WD0A 1I8JA 1DVJA 5EPDA 3THQA 2YSWA 3O07A 3W73A 2Y85A 4QNWA 1EUNA 1ZJIA 1QPOA 3NYZA 3PY2A 1SW7A 2VOMA 4N2YA 3GR7A 5BOOA 5D32A 5LHEA 1TPUA 4A2RA 2CLLA 3C2OA 4DO6A 4RXFA 4LY8A 1SW3A 3W7PA 1KM4A 2P0OA 3GXTA 2C19A 1H1ZA 3PM6A 2QEZA 3PWAA 2R91A 3B06A 2Q8LA 3TX9A 4CNPA 5AB3A 4UNKA 2HTMA 4JEQA 4IOTA 2QAFA 3BVJA 3UPWA 4JTIA 2Y7DA 5FEPA 4GXMA 3TMLA 4X22A 3B04A 3BW3A 1W0MA 3GVGA 1H61A 3GLCA 1H7PA 1G4EA 4Z0SA 2A1YA 1SUXA 1SW0A 3Q58A 1OFDA 1EA0A 4UTKA 4UFHA 4DO5A 3WJZA 4K7YA 4ZQNA 1ICQA 3OA3A 4UFIA 2R94A 4GWEA 4O18A 1YPIA 3SSJA 4GUIA 3GNNA 4O4WA 3W84A 2CFFA 4MZ8A 3SIZA 1DL3A 5D2XA 2ZZ2A 3NAVA 4FNPA 1UASA 1H7NA 5F4SA 4BFAA 2E6FA 5DCBA 3GKFA 4ZQRA 4I7UA 2QR6A 4NX0A 1A5AA 1AL7A 3DFSA 3CPRA 3HBLA 1W1ZA 1OFAA 3M43A 4OGZA 1EP1A 4NJGA 4NZFA 5CZ0A 4JIPA 1JQXA 2EF9A 4XBKA 1P1XA 5G1YA 4GC4A 3W83A 3NL3A 4AHQA 3NQFA 5G4EA 5FF3A 3AO0A 1XL9A 1VR6A 3CWOX 1PS9A 3PC0A 1EX5A 3F4NA 1FCQA 4PL2A 3W7EA 4AWUA 3RLUA 1K7XA 3QF0A 4UC5A 5FESA 3DXIA 2JKPA 1XC4A 2NV1A 2WPBA 3E02A 3TC7A 3W7OA 3TUUA 1ZAHA 4BWLC 3QRHA 3EKZA 3HGOA 3E12A 1GTEA 3MBFA 1BWKA 1SFLA 4XWUA 4RX0A 4X2RA 3QPYA 3LRMA 3VI2A 4HPJA 3B0PA 4IPJA 4O0KA 1O5KA 4M7SA 4AB4A 4RJEA 1YXDA 3ABSA 3L0GA 2E77A 2VELA 1DORA 2FJKA 1GPWA 4QITA 1NFBA 3NQAA 1OABA 2X16A 1YXCA 3VE9A 5D02A 4BI7A 4MVAA 1PHWA 4S2BA 3M1ZA 3SW6A 3ABOA 4M7TA 5EKYA 5AHMA 2JBMA 3PB2A 4Z1DA 5KINA 3PF3A 2YGYA 1RR2A 2QJGA 5CPOA 4EWND 1W31A 4QJ1A 3NPWA 1A50A 5LSMA 1DBTA 1FQ0A 3O16A 3UQNA 3Q37A 1LRQA 3EWWA 4AF0A 3NL2A 3BV4A 1C9DA 3NPXA 3L67A 5AC6A 4JTUA 3TDFA 1M6JA 3A24A 1ME9A 1FCVA 3TFXA 2J9ZA 1NF0A 3DH7A 1MEHA 3UWUA 4O57A 3LTPA 3FYOA 5FI8A 2QKFA 3G1DA 3F03K 3HGSA 3LTSA 3IVSA 1KFLA 4R34A 3BG5A 1TRIA 4TU1A 4E38A 3CT7A 1JCXA 3HG2A 5F4XA 1MEWA 4WOQA 4JD4A 1QPNA
chains in the Genus database with same CATH superfamily
4CN6A 1F07A 4KCTA 2PDPA 5KZMA 4LVAA 3N6HA 4XZ9A 4N7QA 3HMCA 4PUWA 4FLSA 2VT0A 1VC4A 3OYZA 2FKPA 4L6OA 3KE0A 4W93A 3K8LA 2OLHA 2DSUA 2QXWA 4M8UA 3IGSA 2DPEA 1K9EA 3AHYA 4BQ3A 1E0VA 3GKAA 3W72A 3FJNA 3G1SA 3R89A 5BYWA 2HDJA 2I56A 2Z1KA 3GFXA 3IV8A 6ALDA 4MNLA 1DIDA 3BLKA 3GFZA 1TX0A 3OBAA 4EXAA 5A3HA 1S2UA 4XSLA 5A8NA 3TE9A 1CDGA 4MWAD 1P6WA 4K3ZA 1ISVA 3EDFA 3N6QA 1H4PA 3VUPA 3B8UA 2OOFA 3VD4A 1MUCA 3GK0A 3TSBA 8A3HA 2HISA 3DESA 3DKLA 4TOQA 4PMXA 3D6NA 1KA9F 2WCSA 4C60A 7ODCA 1GQNA 1BEUA 3LY0A 1J0ZA 3WJSA 1PZ3A 4Q32A 5I3GA 1MUWA 3PAJA 4DYEA 2NQLA 1M41A 1UD8A 1AFSA 4PA8A 2PC4A 4PCFA 4IP5A 3OZMA 2GJNA 5DX7A 3DGRA 4I7VA 5I3KA 4JNMA 4FMVA 1AK5A 3LV6A 4KMQA 3PSWA 2FZ9A 4O1DA 5LIUX 3DEQA 2FHCA 3G3DA 4AMCA 1CWYA 3M5ZA 2YCLA 1CB2A 1JIBA 1BRLB 1IV8A 4O10A 2V5JA 2PZNA 1EC7A 2WKLA 1XLMA 3DGBA 1QI2A 2XFWA 4Q33A 1DXFA 4G2DA 4KCVA 3M44A 1E9ZB 3LLXA 4R7JA 3H26A 2W9MA 4TV6A 3QV7A 3A4XA 3WQ5A 3C2RA 1QHZA 1VBJA 4V1XA 1KRCC 4AC7C 4DELA 3VD9A 4EANA 4JY8A 1BSLA 1QHPA 2WZTA 3EKLA 1W5PA 2A6NA 1E4LA 2H6RA 4O0ZA 4PTNA 3W7KA 1GT8A 2QUUA 3APGA 2WMJA 1JUKA 3DOPA 2BVDA 4AX6A 4LU0A 4O52A 3BZJA 1I75A 1F4HA 3JUGA 1AH0A 3QZAA 1XIHA 4DYKA 1AA1B 2WSRA 1R7OA 1UD5A 1J18A 4JN7A 1ZHAA 1SJBA 1T0OA 1FDYA 2PLCA 5D9OA 4AY7A 3TK7A 1TPDA 1UPPA 1V4YA 3AZSA 3HG3A 4HVXA 2WMGA 1J96A 1XPGA 1F76A 2HS6A 2NV2A 2R82A 4NIRA 1FWDC 3L2IA 1J2BA 2YW4A 3WLOA 1E0TA 4WY0B 1PO9A 4LY4A 4O19A 3GHUA 1VJIA 3V35A 1VRDA 4WR3A 1DOSA 2YYUA 2QLYA 1L6FA 3H2FA 1G0CA 3LU2A 4XV0A 1CXIA 2WB5A 3G6MA 4HNLA 3H2AA 2H8ZA 1P0BA 1DTNA 4D1IA 5KSWA 2QJHA 4GG9A 4REQA 1L8NA 1WZKA 1V7YA 4GJIA 3ABQA 1N55A 1K9FA 3LPGA 1AJ0A 2B7QA 1UC5A 4U3CA 4E2DA 4DI8A 2V6AA 4HYWA 3T81A 1LQAA 2FGZA 4AVNA 1I9CB 5AHNA 2D20A 2Z7KA 3R5EA 3NSXA 1W3LA 2ZOXA 4V2XA 3SCPA 4ZCWA 4RPQA 1X7IA 4O8RA 1Z9AA 4M3PA 2ZX7A 3WBWA 4W5UA 4FXRA 4WX2A 4H9UA 5LIWX 4IIEA 3WDQA 4Y9NA 2Q02A 2PDCA 1M3UA 2GWGA 4AH7A 1QT1A 1GQLA 4UCGA 4LSBA 4XUYA 3A9BA 3OLEA 4F8XA 3KVMA 3RCYA 3B3DA 3GAYA 4IFKB 3SUTA 3TWBA 1OGSA 3TN4A 4JEJA 1M5WA 2NUWA 4Y90A 4N4QA 4WGHA 1EIXA 4KPLA 2J88A 1G7UA 4N02A 2YDQA 3N4AA 3NGFA 4JIIX 1VFMA 2W27A 1TREA 2AQOA 4W8LA 1QDSA 2EPNA 4IMDA 4NAEB 1QOPA 3CV1A 1LDCA 4OZOA 3EX3A 2PLJA 5D04C 3EX1A 1BYDA 4Z17A 5ABGA 2CKRA 2DIKA 4A8RA 5I3DA 1S2CA 4NKCA 4KH2A 1X6LA 4JFTA 4U2ZA 1Q6FA 2NVDA 4Z0JA 4Q8PA 2WHJA 4NG3A 5CBJA 3HJZA 1V93A 3S2NA 4F9DA 4RCXA 2FLIA 3B03A 3W7JA 4REQB 2TODA 4D71A 1EL3A 2DQWA 2QCHA 1VEMA 1B9BA 2HE5A 5CZJA 1ECEA 3P67A 4QP0A 3KFTA 4GKTA 3QHNA 3GAKA 3D46A 1R3VA 1LL6A 4WCJA 2OOGA 3AYTA 2PZ0A 1E55A 1I2NA 3MCNA 4PB4A 2H3BA 3BAWA 1YDNA 4O28A 1UR1A 4QQ3A 1VIWA 1G7VA 2PWDA 5C9WA 3OU8A 3CL8A 4RDVA 3RK8A 1VJZA 3H8AA 4NZ5A 3R12A 2ZKMX 3VKJA 2VZVA 4HA4A 1Z6KA 3RPTA 1NOFA 3WH7A 4WSJA 1YPXA 4XAPA 4UOJA 4DQWA 1ELSA 1IZKA 5D8ZA 4IPPA 1W2PA 3EWBX 1E15A 1FRBA 1C8XA 2PGFA 5DMLA 4IJBA 4YS1A 1C7TA 1QVBA 1E3ZA 2BY3A 3VCRA 2EG8A 1SSGA 3E74A 1IEWA 3QLDA 4POCA 1Q6EA 3TYUA 1EOMA 1ME8A 1WXYA 2Z27A 3NQVA 3W1QA 1WP6A 1B3VA 4PEKA 1GZ1A 4UFJA 4B5TA 4DHGA 2G3IA 3VK5A 1SU5A 4PRTA 3AXIA 1JD9A 1PKYA 3E2SA 3SCWA 3KAOA 1NIUA 3S83A 4RR4A 3KBSA 4YCOA 1FVPA 4U31A 3ZXWA 3E1F1 4B16A 2AL2A 3RXZA 1GOKA 3MQTA 1SGJA 5ABTA 3GTFA 4C6FA 2V5DA 2GGHA 4TIMA 4IUOA 3W74A 1OCBA 4UCFA 5H1WA 4B9YA 3CAVA 4P8XA 5LZLA 3KDOA 4MUZA 4ICCX 2W66A 3LCHA 2CXEA 5JBEA 1B5TA 5CQ1A 1WBJA 3IIZA 4GXWA 1Q7MA 2WAGA 3PTDA 5DFAA 2J6XA 3QW3A 3GU1A 1TV4A 1ICSA 4I7WA 4GVHA 2IUZA 5HNUA 4OBTA 1LM1A 3S2CA 2A21A 4IMCA 2QPUA 3QGAC 2HQAA 2DT2A 1X7FA 1BVNP 3RYSA 1XH2A 1CX9A 3OJGA 1KM5A 1TWWA 3PPCA 4GPNA 3KZPA 2GDQA 4AQLA 2WK2A 1CGWA 3MI2A 3KVKA 2QCGA 3IIPA 1HZYA 3L21A 4CCEA 2PCQA 3RITA 4LWWA 8XIAA 3V1HA 4DYJA 3KCJA 4TUFA 1EQCA 4RDZA 4DUWA 1S2TA 1JUEA 1UROA 4U2YA 4FX7A 1RBLA 2QCLA 2P10A 2FVKA 1RA5A 4MUPA 1MMFA 3KRSA 1VFHA 3F4VA 1OC7A 5D9NA 2DZUA 3VFLA 3R43A 4GZJA 4MIMA 3CZEA 4ML4A 1E56A 2DZAA 1JZ3A 5CPNA 1XYZA 3RO8A 4M6QA 1P1MA 5H8PA 3MVTA 2PPGA 1KFWA 2VNCA 3GXNA 2GVLA 3AS1A 3SSZA 3W2LA 1TPB1 4NSBA 2PRMA 1HJUA 1SR9A 3AIWA 3CWNA 4B2DD 1VB9A 1SJDA 3EPMA 3WLSA 3DN5A 1G67A 1ISYA 4XKYA 3THAA 2YZRA 3N29A 5HWNA 4ZEPA 3OGSA 3OZYA 3BWWA 3LNPA 3EOEA 2DV0A 3V7PA 1SSDA 2JFEX 4PUMA 2XHYA 1L2UA 1FDZA 5J5RA 3O0KA 3WQ8A 2QVHA 4D8LA 4XBSA 3MY9A 4H6KA 3KTXA 2A6LA 1WAUA 3GZ3A 4M5PA 4FOJA 3RO6A 1Q8JA 3VKBA 6ENLA 1XD1A 3COTA 1XIMA 3NVTA 2OQLA 2FGLA 3BDKA 4ZL1A 4URIA 6CGTA 3W02A 1SMDA 1LRNA 1RCXB 3PJUA 3PG8A 4X60A 5SWUA 3ITXA 3WIJA 1UR3M 3WJYA 2PF0A 3S42A 3TYEA 1T8QA 4PB5A 2PDMA 3ZJ6A 3K4WA 1L9WA 1W5MA 1XBYA 1Q7ZA 1C90A 1PBGA 5M3WA 1FUYA 3S8HA 2G8ZA 4S1FA 2OSXA 3PZQA 3DYOA 1MW0A 2E4TA 1BXNA 1E4NA 1IZJA 2GSHA 4MYAA 2CNCA 1QBAA 1C8YA 4X9YA 5LNRA 3RR4A 3PBUA 3EX6A 1YADA 4PMYA 3LLDA 5AZ1A 3WUBA 4PMOA 2ACRA 3IUIA 3MANA 2BV9A 5HPOA 4PB3A 3KOYA 3W86A 3VOGA 5I79A 1EJWC 2EPKX 3QY6A 4E5TA 2Y8KA 2ZRVA 4H01A 2CKSA 3VNKA 2W3ZA 1DP0A 3FGCB 2G3JA 4GY7A 4W88A 3HA1A 3S6OA 3TAOA 5I7GA 3TN5A 2VX4A 1PKLA 3P8IA 4IMGA 4H6QA 1KCLA 4DBSA 3UR5A 1XYFA 4JR5A 3WJWA 2HBVA 1PV8A 1TCDA 3PP7A 4LB4A 3FCPA 4YTUA 4J3TA 2VVNA 2X7VA 3CUFA 2VC7A 3WD4A 3AMKA 3C4UA 4IIFA 1WDSA 2XVGA 3BPWA 4G56A 3OGVA 3R10A 5TIMA 3DFTA 3UWZA 4AZGA 2WLZA 4HSOA 4GCXA 2Q01A 1F2JA 3AMGA 3RAOA 2Q3OA 5G5IA 1TWIA 1Q85A 3B8VA 4J27A 4L7ZA 2QF7A 4D9PA 2NZLA 4GI8A 4WK9A 2IW0A 4GQGA 4DI9A 5AYBA 2MANA 4CD8A 5IHSA 5MF5A 1L6SA 3BGGA 1CXLA 4MLRA 4FNRA 2VXNA 2WVVB 2QT3A 5BOFA 4J3UA 2PE4A 4OECA 2HNEA 3BGAA 1B3YA 3JW7A 3UZJA 2YDSA 1OX4A 3VKCA 1JRBA 2V8ZA 1AQ0A 2QIIA 3PS7A 3FA4A 5DCDA 2EHHA 3I6RA 3VA8A 3KBNA 5A6BD 1E4MM 3CK5A 2HJPA 3FVMA 3W3OA 1NSJA 4GMEA 3C5QA 2DP3A 5LYRA 4YTTA 3B0UX 2J25A 2INFA 1LYXA 2J47A 3GNXA 1X8CA 3VOCA 1RD5A 1OCJA 1TQXA 4UQAA 3WK2A 2GPTA 4GINA 1N8WA 1QK0A 5HPCA 2BOEX 2L5HA 4Z1CA 4FO4A 4H4IA 2FDMA 3TQKA 1TZ9A 3I4EA 3JRKA 1EJVC 1FCUA 3H2EA 4IGMA 1XKJA 4B90A 1W8SA 3N2MA 1GVQA 4MHBA 4IQJA 2IKIA 3A13A 3RN6A 4TMCA 2WNQA 3VZXA 3G1VA 2G4FA 1RXOB 5BW6A 5EMLA 3T2OA 2QQ6A 5C9XA 4K37A 2JIEA 5K2ZA 2O0TA 3TJLA 2VCBA 1G1YA 3SECA 2E9LA 4W4QA 2FVMA 5I3FA 3ZSSA 3VNZA 2YBTA 4GIYA 2OZ0A 4WDUA 3KM8A 1ADSA 1MXSA 3TZFA 2A3EA 1ZCOA 3M5VA 4HU0A 3UXKA 4NXKA 1SVDA 2WCAA 4KEMA 3GTNA 2JE8A 2VZOA 2PU1A 4KEZA 4UNIA 2XZ7A 3TJXA 1PX3A 1HJXA 3CT2A 4ZR8A 3AZTA 3RU8X 2WSYA 3FN9A 2QV4A 3VGEA 2WKJA 3HM7A 3WLTA 3NZPA 4HNCA 1E6RA 3N9SA 4TV5A 1E6XM 4AY8A 3AMDA 4AD5A 4JHOA 1TPC1 5E1QA 4NASA 1F6KA 3D47A 3RG6A 1DJZA 3VMOA 1H11A 1QI4A 2Z7GA 4C65A 2PP1A 1A0DA 1ZJBA 1CI1A 1JDEA 2WSQA 3AQUA 2OPJA 1B2YA 2PWHA 2UY2A 4H6RA 4B2DA 4ZOEA 3SGGA 1FHDA 2GWNA 5G2WA 4MNKA 1Z42A 3BOXA 3ZYZA 2YDAA 1R3TA 4ORMA 1HP5A 2ZXDA 3DFNA 1SO6A 3GR8A 5A8MA 3NL5A 3WDHA 4ACYA 3WMSA 3G6LA 1SQ7A 1EFZA 2ATSA 5FEZA 3URBA 3EWXA 4IMFA 2BMBA 3BLDA 2OEKA 3TZNA 4GY0A 1EHAA 2GOKA 1WO2A 2A85A 3FYPA 4D72A 3N04A 1L0PA 3W1AA 2CU0A 3W1UA 3UPMA 2JEPA 2FYMA 4TX6A 2GSEA 2W91A 2IPWA 1SFTA 3W71A 3VM7A 3PPGA 3A3HA 4ML9A 1QTWA 4NP7A 4WQ6A 3PZGA 1GK8A 3G8RA 3UFYA 3B0XA 2J7GA 2YYTA 1FWJC 3MDWA 3W27A 3MHUA 4IPNB 3GHTA 1TV5A 4GK8A 1DXIA 1TV7A 3W7DA 4QE4A 5KZEA 1F5ZA 3PZVA 1BXBA 4OOUA 2PDIA 3M41A 4HNVA 2ESCA 4AWEA 1KXHA 5FIPA 3ITLA 2ZUSA 3C2EA 4BJHA 5C6MA 5C5YA 3LHWA 2ZZ6A 4GQRA 5HJYA 4IQLA 4JIHA 3EYPA 3CB3A 4Q4OA 3UR8A 3L66A 5BU6A 3O15A 2E5CA 4O54A 3UJEA 1LROA 4FF5A 2EQDA 1T6MA 4QCEA 3RX2A 4H8VA 4UTWC 3S1UA 1UKOA 1XLKA 2NQZA 2D2HA 3IGUA 2ZE0A 4ZB5A 1HNYA 3TNOA 1J10A 2VRQA 4I9MA 1XDMA 2NXHA 3AAMA 5FD0A 4JN8A 4PUNA 4JPGA 3A5VA 2OYKA 1NF7A 4FLRA 4QTGA 1K9TA 2BY2A 4MLJA 2C7FA 2C16A 2ACQA 3ZR5A 2YPIA 3ARTA 4BWLA 1GZGA 1PKNA 1XFBA 4NQ1A 2D3LA 5L6UA 3OVQA 1JZ6A 1SO4A 4E0CA 5HR6A 2CCRA 3M4HA 1W3NA 2UV8G 3NQ8A 2X09A 3SCQA 2ZC1A 3FVDA 2Z24A 1HGWA 1HXJA 1O7AA 1VHNA 2P50A 5A2CA 2FZDA 2R1LA 3KOXA 4G7EB 2I5QA 5F7UA 4H9XA 4QS5A 3VOHA 1E6PA 1A53A 1GKQA 1XLHA 3WBAA 2XFRA 1TZ7A 5AHFA 3ZR6A 2V67A 2VEKA 3L68A 1PYMA 4QM1A 1LL7A 3ZMRA 3FXGA 5A6BA 3R58A 4YN5A 4NNAA 4WDXA 4LQ1A 1W54A 2JQXA 4PMUA 2ZUTA 2VD8A 4MY1A 3OODA 1Q2RA 1TPH1 4HU3A 4JZ5A 3TW6A 3LCGA 4K7VA 1DJNA 2VR2A 1GVEA 1EJRC 3U6WA 4Q7IA 1GOOA 1CEOA 2D0FA 5A95A 2CC0A 4IX2A 3TAKA 4R27A 1YDVA 1A3HA 4PYSA 1PHQA 1NP0A 2PC8A 3MJYA 1RCOB 3NPUA 2QDGA 4G5DA 3GB6A 1ZJAA 4JDBA 3H7UA 4O15A 3QY8A 2Z29A 4N9EA 3CQHA 4YTQA 2W79A 1US0A 1D3GA 4GO9A 4WZHA 1DQUA 1L6WA 3OVRA 4AZIA 5I78A 2VQTA 2PTZA 3DECA 4J35A 3LCXA 4QRNA 2NX1A 1NDVA 3GDMA 4DO4A 2VC6A 3CZ8A 4O13A 2GGEA 4EPBC 4KBXA 2J7HA 2E6AA 3DYPA 1MDRA 4B3LA 3OYXA 1OD8A 5AECA 3HG4A 1YNQA 3T0TA 4WIWA 5I23A 3EWCA 2Z26A 1U83A 3AIVA 1RBAA 4M80A 3LHTA 3LDVA 2NX9A 3QPZA 7TIMA 3NNTA 2XINA 4ZO9A 1C7SA 1EEPA 4GYKA 1JCJA 4KCUA 1JR1A 1RH9A 2DIJA 1ZAIA 5AHEA 4O50A 1XIBA 1XCWA 3P0XA 4J1OA 4HA1A 2LLEA 3MO7A 4WGXA 3D5HA 3DHUA 3BO9A 1H7RA 2ZADA 3LZ5A 4M51A 4OV9A 4I3GA 2VM8A 4X61A 4RE0A 4XZWA 4MZYA 4D6FA 4B4FA 2PSNA 3VX0A 3L4TA 3PJWA 4KFOA 3TA6A 3MZNA 4NYYA 2DEPA 4IP7A 3N25A 3IJ7A 1EHNA 4DUOA 3MMDA 2QJMA 4I5RA 1JYVA 5DXYA 1TTPA 5LIYX 3G1AA 1NOUA 1ZRQA 2ZFAA 4ZOBA 1JF5A 2CLFA 4KETA 5FKYA 3FW6A 5BMWA 2DW7A 1UQYA 4XSMA 3TJ4A 3AXXA 1UUMA 1O60A 5DMMA 4AVOA 3LXBA 4IPIA 4RLIA 4JKLA 2EKCA 1RD6A 3HMJG 1QWGA 5DT7A 1WV2A 3CUHA 6REQB 2XFFA 3AS3A 1BLIA 1DJHA 4DJFC 5JQ9A 4P2VA 2IXVA 1UJPA 3MP3A 1DE6A 2NUYA 3UZXA 1JJKA 5XIMA 2DZWA 1BQGA 4MYXA 1G4PA 1XRVA 3IGXA 1UWIA 1D8CA 1KO0A 3QSRA 1WNOA 2PDHA 1M7OA 2E8YA 1C9WA 5EPDA 2YSWA 2CZVA 5HATA 1ZJIA 2PWGA 1VBGA 3MA8A 3NYZA 1XLCA 1GVIA 3EBVA 2PDUA 3AALA 1OBAA 4AZCA 3SFWA 2CLLA 2FMNA 5H8MA 1OM0A 4RDWA 4KQNA 3MV11 5CLWA 1KBBA 2P0OA 2C19A 1H1ZA 3BICA 3PWAA 2BG5A 1PXGA 4C6MA 1UR9A 4CNPA 3T0AA 2HTMA 4JEQA 3BVJA 3UPWA 1GOWA 3PN8A 1LT8A 5FEPA 4UQBA 1XSJA 3NZGA 4GXMA 3GVGA 4HZMA 5AVHA 1H7PA 1ISZA 3GZAA 1AH4A 1XYLA 1SW0A 5ECUA 3FDGA 1EO5A 3WQ6A 4UFHA 3WJZA 1WUFA 4KESA 4S3JA 1ICQA 3OA3A 4UFIA 3WG6A 4TTGA 3GNNA 5JUVA 2CFFA 4MTVA 1KWGA 1RY0A 3RM4A 1Z7AA 3TTSA 2CBJA 3SIZA 3ZVHA 3O0FA 1DL3A 4KIEA 4LYRA 1JYWA 1EGMA 4ZOCA 3JVAA 2XSBA 1R3YA 4ZQRA 2HRWA 4GGHA 2Z2BA 4Q8VA 3GW0A 2C1GA 3AI0A 4NZFA 2CITA 1JQXA 3KDNA 3CUZA 2WWDA 4S3DA 1POKA 4WJ8A 4PCPA 3F4DA 1LL4A 3CWOX 1FCQA 3W7EA 4AWUA 9XIMA 4R5EA 3PWGA 4UC5A 3DXIA 2SFPA 3TCSA 4LF2A 2JKPA 1XC4A 2NV1A 3FHQA 4S3EA 1AJZA 3E02A 4H00A 2EPOA 1CGUA 3TC7A 1GOIA 4DM2A 4P5UA 1ZAHA 4C7GA 3E12A 3MBFA 3C2YA 2J8FA 3MZ2A 4RX0A 5I09A 4O0KA 3IJLA 5LA2A 1UKTA 3WDPP 1O5KA 5I06A 4M7SA 1YXDA 4XZNX 3L0GA 3IACA 1DJIA 3FA3A 3U4FA 1YXCA 4BI7A 1JNDA 4LUYA 4S2BA 3T6CA 2XGBA 3UXIA 2VX7A 1W17A 3C0SA 3APTA 4Z1DA 1VFLA 1SM9A 1BYCA 5CAKA 2J6VA 1A50A 1DBTA 3Q37A 1LRQA 4AF0A 3BV7A 3XIMA 4CN1A 3LPFA 4MWAE 3AXHA 3CMJA 1HVXA 2OWXA 3L67A 5AC6A 4JTUA 2DUZA 4P7QA 4PSPA 1NF0A 4MKSA 4AIEA 5C0QA 5FI8A 2PWVA 1OINA 1KFLA 3BG5A 3PWIA 4E38A 1MEWA 1HF6A 4WOQA 5LIXX 5CJ5A 4UFKA 2PBGA 5C7VA 3RX4A 1J9YA 3ZR4A 1Q8AA 4XD4A 3N15A 3A3WA 2X0SA 4UTFA 3QR1A 1NDWA 4XB3A 1TPVA 1J93A 5IRPA 3WQEA 3ZQ9A 3N3TA 3KUMA 4J3XA 5AYXA 3QLLA 1GW9A 3NZQA 3P61A 4DBUA 3FLUA 2QULA 5JIPA 1JCNA 4QISA 4AAJA 1O4UA 3W6LA 3HO8A 4HP5A 5KEZA 1XIGA 2ZUNA 4PSRA 5G2IA 4H9ZA 1FWCC 2FPVA 2Z25A 6TIMA 1TRDA 1BGAA 3B8DA 3ZIZA 4WF7A 1FWIC 3NZRA 5CPQA 3V75A 4O1BA 1OGBA 3PZMA 4GUJA 2G4JA 1V6UA 4HZ8A 2Q8ZA 4LB3A 2G41A 2AAMA 1LG1A 4Z2JA 1XUUA 1NWTA 1P43A 1KCZA 2PMQA 2OR2A 4HZ7A 1XIEA 3S4TA 1D2KA 1S39A 1K6AA 5A6TC 4FB7A 3TXZA 3DKJA 1GOXA 3PANA 4PFMA 3GXFA 3AIBA 1V6TA 4CVWA 7REQB 1WDDA 3ERPA 1IXPA 1GONA 4Q6XA 4PC8A 3BSHA 4GVIA 2ACUA 3TSMA 4S3KA 2GVYA 3KVJA 1DIEA 4ZQOA 1H63A 1V03A 4P8VA 3BMVA 3SCVA 1UMYA 1VGAA 4C6NA 4CNUA 3VDCA 3WNLA 1EWEA 2OKOA 1Y5XA 2GZXA 3DG3A 4PMQA 5CSYA 3L65A 4MB4A 2IKGA 2OX1A 2D23A 3TR9A 4DWSD 4OT7A 3VILA 2AMGA 3OPSA 4Y7EA 3ORWA 3MV01 4ICMA 1F61A 1OD0A 1OYAA 1JL8A 5HQMA 2VP8A 1F8MA 4NZJA 2VZTA 3M0HA 4FHAA 2A3BA 4GYPC 3HPZA 4KF1A 4HQVA 1ESWA 2OO6A 1L2QA 4CNNA 1JUBA 4AXNA 4ERAA 3QVQA 4EIVA 1I0DA 3S2LA 1H51A 3PHAA 3W1PA 1RK6A 3VDBA 3E49A 4DZIA 4GD0A 4EWJA 5ABHA 2IPFA 3FEQA 3PUDA 4QDMA 4Z2HA 4WKAA 1L8PA 5FOOA 4GY1A 2WM1A 3WF3A 1PKMA 1THFD 2EG7A 4KFNA 1QJWA 4HHHA 4F40A 1YQ2A 3GIPA 4FXSA 1M65A 3L12A 1RUSA 4DJED 1K8XA 3FHAA 3P62A 3FJ6A 5LGXA 4H8HA 3VD5A 1F8IA 4AYSA 4Y9OA 1U1UA 3VDAA 3H54A 3U7BA 4JFSA 1LQ0A 2ZC8A 1PCKA 4GC3A 3QN3A 1TVPA 1ZSXA 2Y7FA 1PPIA 1Q6OA 4WSHA 4S2CA 1FWHC 3GTXA 2HVOA 1P5BA 3UJRA 3TTYA 2F6UA 3N14A 4XAZA 2CESA 4F48A 3GIYA 4QG9A 5HMDA 4LAZA 5EU9A 2YA2A 3J7HA 2DJLA 1FFQA 1K4HA 4AEOA 1Q4WA 5DLCA 2P76A 1REQA 3A21A 2VL4A 3DCPA 4K2SA 3ZJ7A 2J7DA 3DYMA 2HCVA 3ABRA 4BCEA 4HTYA 2OU4A 5ABFA 4C91A 1RJPA 4BEQA 4Y9PA 5A1AA 2DDXA 1HFBA 2NSOA 2ZUWA 1PL9A 4U10A 1VHCA 1BYAA 1KM0A 4ROQA 1SR0A 3KVLA 3H7VA 2WV8A 2XUCA 3TTEA 3VNJA 4MWAC 3QJAA 3N4EA 1QNRA 4YXGA 2QJNA 2UY5A 2G3NA 3STFA 1KQYA 1LUCB 3R6IA 3P60A 2O9RA 5E0FA 4H2CA 4CUCA 2REQA 3O8AA 3CO4A 4W85A 3ZVIA 5XINA 1I2PA 3W6MA 4DBDA 3VNMA 4ATDA 1EX1A 3VYLA 4JDYA 3QMSA 1XP3A 5CSUA 3CPUA 3IIOA 2WMKA 3E2QA 1XSIA 2FZBA 3WF4A 1KBLA 2WC4A 3P93A 4JL2A 5D4YA 4NRSA 4AXKA 2V3FA 2RDTA 4YPJA 1ZU8A 2PDFA 3VGBA 2AOSA 1H7OA 2OSYA 4C6QA 1H1NA 3RFAA 4K36A 1T5AA 4F4RA 2NLYA 2VDIA 2J7EA 3QR0A 5F4WA 3C3NA 4Y8FA 5FF2A 1P7TA 3CQKA 3QGVA 1JD7A 2RKXA 2FHBA 1WB0A 1CXFA 4LUJA 1KM2A 1W91A 3DBNA 3GS6A 3W7QA 2ZVRA 3QMTA 2XVPA 3KP0A 2Z1WA 2ISVA 4EOUA 2ISSA 1KCXA 3UETA 1YXYA 5M5DA 2BVTA 3DERA 3W1LA 3UJ2A 4F79A 3A4JA 1X6NA 1EBHA 4LX4A 2ZQ0A 1REQB 2GGGA 2XVKA 4AZ5A 4LANA 3LRLA 1V3HA 4V1YA 3NOEA 2QUVA 2ZRZA 3BH4A 4AMAA 2I17A 1HL8A 2QIWA 4QLKA 2A7RA 4O1EA 3XINA 5I6SA 1WA3A 2C6QA 4AWTA 4DLFA 3A3XA 4DZAA 2WYSA 2C1HA 3RRAA 3FY1A 4ZBCA 2DSKA 3R13A 1HKJA 3MBDA 3PZ9A 3BK0A 5CC3A 1EXBA 4ZFCA 3LPOA 3RCNA 4MDOA 2CXGA 4ENLA 1X1NA 1XCFA 1JZ5A 4L6HA 3ZZ1A 1EOKA 2YXXA 3DFYA 2QAPA 1QWKA 1UOZA 5HJLA 2TYSA 3UZYA 3VIJA 4LUIA 7XIMA 3GIQA 1JPHA 3WDJA 3VU2A 3GUWA 1BKHA 2HSAA 3UWYA 4WDTA 2V3EA 3GVWA 1YBQB 5HNRA 3SQMA 4P7NA 1IYXA 1RLCL 2QV5A 1TA3A 4IQDA 4JTLA 4QLLA 2WHMA 3G22A 4H6EA 1XR2A 3DX5A 1IR2A 1K77A 1EPVA 1FX6A 1KXTA 4MY9A 4WXYA 2UBPC 2PDGA 1U5HA 4PH6A 1F05A 1T41A 5CC5A 1O1HA 4JQ1A 4FNUA 3FIGA 1OFOA 4P8WA 1P7TB 1R6WA 3AIUA 1KD0A 2W62A 5KZ6A 3WL1A 4O53A 2O7SA 3NEVA 1NWUA 4QR6A 3WX7A 1IT7A 5FSDC 2VFDA 5EYWA 3CHEA 2J66A 2X2GA 4FXJA 4GNKB 2NXIA 5EBUA 3DFQA 3HN3A 3WELA 2BY0A 2RJHA 4GQ0A 2PURA 4LCQA 1TJ1A 5BNKA 2YL5A 4HNTA 3WK0A 1N8IA 1VJSA 1Y0EA 1C93A 3W37A 1B4EA 2HXTA 1UUOA 3BAIA 3OHMB 3PUOA 4PCTA 2FH6A 3VM5A 4RNHA 2QUMA 1VF8A 1QNOA 3LSBA 4NF7A 3B97A 3VINA 3I10A 5E6YA 4O11A 3GH4A 2OTDA 1V5XA 3E3HA 3ZFHA 5BXSA 1N82A 4X0NA 1QASA 3ATYA 4EP8C 4AY1A 1E1CA 2NQHA 3B8TA 2J9XA 2GYIA 2ZXBA 4JL1A 1W3TA 4CQ9A 1UP2A 4L4PA 2BB0A 2OB3A 1XLIA 2G3MA 4PCNA 1X98A 5B7ZA 1HKWA 4ZVJA 2PDNA 1ONRA 4IF2A 2A3AA 3F2BA 1YNPA 3DHPA 4UTIA 1HW6A 2XG9A 3WF1A 1O1ZA 1W5OA 3RPDA 3PUGA 1NU5A 4YYFA 1QI0A 3SR7A 2OODA 4L1WA 3URQA 1IGWA 3SRHA 4OOZA 1OGGA 3ITCA 2XTKA 3W29A 1OX6A 4M6VA 3S3GA 4YVVA 1OX5A 2Y8VA 3GBDA 3VKKA 3E96A 3ZJ8A 1BWVA 1LWJA 3BSGA 2E9BA 3ME3A 4O0QA 5JIWA 5AFDA 2HK1A 2QDDA 5CG7A 4DJFD 4PRRA 1QK2A 2E8ZA 3QYQA 3IPWA 2WWCA 4N9CA 3G1XA 5I3JA 3ANUA 1J0IA 5DBUA 1G69A 5AYZA 4OU1A 5BWFA 1F6PA 2ZA1A 1LWIA 5HINA 3T8QA 4DEFA 7PTDA 3U2OA 3RM8A 4HOZA 3S46A 2IKJA 3MSGA 1SJAA 3NXLA 4JIQA 4WKHA 2XIMA 4NHVA 1KXVA 3E0LA 4K68A 2NVCA 3DDMA 3NO5A 2ZYFA 3WUFA 1EJXC 4L4OA 4W84A 2P3ZA 3GD6A 1XGZA 1S2VA 2A2IA 4XISA 2E3ZA 4CKQA 3WY1A 3TQ0A 1XBXA 2ATMA 3IRSA 3LRKA 2VX5A 3WMBA 3UA4A 2PODA 3UU0A 2OG9A 3WH9A 4H7ZA 2YR1A 1AW2A 4H7CA 1KLZA 3WNKA 4JCLA 1W1B1 4UTWA 3UR7A 3L5MA 5D38A 2EGZA 1GJWA 2YB4A 4CN4A 4RXGA 3A23A 3KOZA 4FXFA 3RLHA 3PNZA 5HR7A 1K1DA 3MSYA 1G94A 3T2QA 4K38A 2YL8A 4PTMA 2Y89A 1Z3NA 5EB8A 3TC6A 3ELFA 2Q6ZA 4ZGYA 1OZQA 4DF2A 1FKXA 1JFHA 3MUZ1 3L9CA 3LCIA 1XD0A 2D0HA 1QR7A 5CZTA 4MSSA 1X38A 2E7FA 3ITVA 1N7KA 4GUFA 3AXKA 5FJOA 5AY7A 5JMUA 3EGJA 4FPSA 4MMWA 2V5LA 1Q13A 3OTRA 4FZIA 2VFHA 5E09A 5REQA 1OVDA 4JTKA 1QPQA 4AD1A 1XC6A 4M29A 1A47A 1DQXA 4GISA 3VNYA 1BXCA 4OE7A 3NM3A 1GVYA 4PR4A 1J0HA 3C86A 2VEPA 1GW1A 2X1TA 1ICPA 2VCCA 1IWAA 1EXPA 3TLLA 4BHYA 1TR9A 4JTFA 3PNUA 4LJ3A 2Y4SA 4ZE4A 1ZUAX 5CJNA 2YFOA 1VYRA 1D7KA 3E0VA 3HPAA 3S47A 4G7FA 4W9TA 5T9CE 1TYGA 3U8GA 3REQA 2A3CA 3M47A 4E6MA 3ZSTA 1RPKA 1R9XA 4KT2A 2Y70A 1CZ1A 2BWGA 3MI6A 4GH1A 2HNHA 5K9XA 4Z2LA 4GI6A 1FHUA 3E38A 3TA9A 3PTKA 2V2CA 3P84A 3AS2A 3CH9A 1Q7QA 3IIVA 3QW4B 3AMCA 2NXGA 1O66A 1MQPA 5IDIA 1H0IA 3MWCA 2EO7A 2RGMA 1PE1A 5C71A 4JTGA 1UP0A 4KWVA 1TX2A 4WLCA 4OVXA 3SO7A 2GK1A 1FTXA 3UYIA 3PBWA 1IXQA 3ES8A 2F6KA 2GJLA 4MB1A 1UKQA 1UR2A 1EC9A 4PUUA 3SUVA 4JTRA 2NW0A 3GDTA 3ZWSA 1R2TA 1WQ5A 3PBMA 5D33A 4CQCA 3SRFA 2KX9A 3RLVA 1QMLA 2GDUA 3QC0A 4C6BA 1PWMA 4L1GA 2HVNA 1XPYA 5KMYA 3NQGA 3C6CA 3M64A 3WUGA 4IIBA 1TIWA 1M9HA 2FTYA 3CQIA 4LPCA 2GDVA 2F8QA 1V77A 4UOZA 1OFEA 5D30A 1W9DM 5JXQA 1NWRA 5DEZA 4E8GA 1ZBKA 4ZXOA 3ZLHA 4HKPA 2WSKA 4JAWA 2F84A 3E0FA 1KGWA 1C29A 1CYGA 4Z1YA 4YLWA 1E40A 5D03A 4F2BA 3GFYA 5DN1A 2CBIA 1R30A 4GUGA 2DFAA 3VABA 1TR1A 4CD7A 1R3SA 2AGTA 4IFOA 4NJHA 1J2WA 3WCZA 1GVRA 1LLZA 3B0YA 3SB0A 2B7NA 2G0WA 4W86A 5HXMA 4DIAA 1AQMA 4LVGA 4QAIA 4OUIA 3UWVA 3T0CA 3UZWA 3AHTA 4AEFA 4M6UA 1OCNA 5C7HA 2W4XA 1TTQA 2XM1A 1CENA 1EP3A 1XBZA 3OIXA 2R8WA 2CW6A 2WMIA 4NJJA 4JIEA 3S9YA 3AROA 1KNWA 4PUDA 1O68A 4ROPA 4BKNA 3IEBA 1K03A 2WC3A 3W87A 2GJXB 3WEMA 3WD2A 1P0KA 3I6TA 3ARUA 5K4XA 1E3XA 3UCCA 4LF1A 5JVLA 1UWUA 3NO3A 3TEVA 4C5ZA 3VOJA 1VEOA 4A35A 4O4VA 2PU0A 1V6VA 3O2LA 3EB2A 2YCIX 2W5FA 2DSWA 3GH7A 2GUYA 2JGQA 1XBVA 3VNDA 2DT1A 4JBRA 4DJFA 1Q2SA 1TMQA 1I4NA 3EA2A 1WUEA 2HROA 4O12A 4XZLX 1R85A 3K4AA 1QNVA 4UR9A 3SEPA 1WKFA 3C3UA 5HA7A 4RZ6A 2J75A 4PL1A 1LOQA 4ADUA 4LC6A 3IJ8A 1JCYA 1XI3A 1F3WA 1NDYA 1TMLA 3BLPX 1PCWA 4JTAA 2BGSA 3ZWTA 4PTWA 4JIRA 1US3A 3PZNA 3MMWA 2NUXA 4NUWA 2BXYA 3HV8A 2W6RA 2R24A 3PSVA 4NY2A 5KZDA 1EWDA 1ZAJA 2C15A 1DJWA 4JFVA 3W70A 2Y8UA 3STCA 2W61A 5ECVA 1S5TA 3DUGA 4LNYA 5G4WA 1QHOA 2OQYA 1J6PA 1Q6GA 3KHDA 3CAWA 5FAJA 4DXVA 1J12A 4WXZA 1ONWA 1UD6A 3R1ZA 1NY1A 3BCDA 1P0NA 4KGLA 2ADAA 4Q22A 2Z2AA 2G96A 3L4YA 3G1HA 2PWFA 4WY0F 5M1TA 5I02A 2XGZA 4M6PA 4OWGA 4C1NA 3CL6A 3KBJA 2Z1BA 1XYAA 1XLAA 3EWDA 3LCWA 2ZZ7A 3ALFA 2VENA 2QYGA 3RU6A 1JZ8A 3AYRA 1W3HA 3AHXA 3HQ1A 3CLMA 1ZPTA 3E0IA 1PTDA 2XPKA 1OC6A 1QPKA 4EPDC 3N6JA 4B5VA 4DAFA 2J8GA 3W25A 2WVTA 4R7WA 4ASTA 3WBYA 3GNOA 3LHVA 3VGFA 5FF4A 2CWXA 3W26A 3SCTA 5F2GA 3WLJA 2W67A 4GBDA 1CNVA 2Z1XA 2DT3A 3SUUA 3S5NA 4CQAA 1WAWA 4QIUA 1NFPA 4DX3A 1ISXA 3EWUA 1JZ4A 3LMZA 1OC5A 1TWDA 4GABA 3BJFA 3QBUA 1DIOA 3WLIA 3GG7A 3FK4A 4UQCA 1YDOA 2PCEA 3SY5A 2INZA 9CGTA 4JQAA 2VC9A 2WNZA 3P82A 3POHA 2J7FA 2QCMA 3EKGA 2IMRA 4I5UA 3Q67A 1UD2A 3IV3A 4DM1A 3ZT6A 5TQLA 1ZLPA 1WDRA 2ZRYA 4LAKA 4EKJA 5IFPA 3R2GA 3K1GA 1F7BA 1XV8A 2ASHA 3B40A 3NQBA 3U4AA 1XDLA 3VC6A 3WH8A 1E72M 1UBSA 3OZPA 4UFMA 4BF9A 3K8MA 5BRQA 4C6JA 1JVNA 2X40A 1PWLA 2B0MA 1G01A 1LJYA 1EGZA 3QEZA 5DBTA 4JTSA 3RNDA 1GWJA 3AMLA 1FKWA 5C8BB 4WOZA 1KTNA 1XISA 2TMDA 4O1FA 3UF9A 5C2XA 2WMHA 2IPJA 4FNSA 1I6NA 4LV4A 4S3FA 3GY1A 4UFLA 4LS1A 4WUIA 3RR1A 2WJEA 4HCHA 4HSNA 3F5LA 2Z1VA 3SY1A 4JGDA 3I3BA 3G0XA 4NYUA 1OFBA 1Y7VA 3VIFA 3NQ6A 3N34A 4LRSA 4Y96A 1QOXA 2DVUA 1W37A 4L6DA 2JKAA 1AH3A 2IQTA 3H12A 4NI3A 5LHFA 1FH8A 3CHVA 3H22A 2BVYA 4W8AA 1H60A 1YPFA 3SFKA 3VCNA 2DUXA 2RH9A 1TPEA 4ZODA 4GIEA 1BVWA 1QATA 1PZ1A 2X1SA 3S5OA 1FP9A 1E5NA 2WZEA 1BTMA 3QR3A 1R5YA 2YCJA 3ITGA 1A5CA 1HUVA 1IR1A 3ICJA 2J77A 5EMJA 3DENA 4ADSA 1F3XA 3RIKA 3A6OA 2NT0A 1JF6A 2F38A 5JBFA 1MDLA 4CQBA 3ONCA 3M0KA 1FWRA 1F3TA 3TP4A 1Z44A 1TUXA 2X2YA 3WBEA 1P6BA 2QPXA 5BXTA 4HYVA 3TYBA 2IQ0A 3QKZA 3R7MA 1I2RA 3SCSA 1V0NA 4EPKA 3W2MA 4D8AA 1A5OC 1FWFC 4H3DA 3RJYA 5EMKA 5CPLA 2AQVA 4PUEA 4FS9A 3PJTA 1JI2A 2FZMA 2Y7EA 3MHGA 4UTUA 2OFJA 3H55A 3O7UA 2CZEA 1V3KA 4AYGA 3L0NA 4BQ4A 3G1YA 1FA2A 1U2YA 4J9JA 1PYFA 4RDYA 1ZL1A 4IG2A 2DU2A 2ZA3A 3NQEA 4QG6A 1WDPA 4F0MA 2OXNA 1YTKA 4BI5A 3WLQA 3TU9A 4ZA0A 2ZDRA 3LUTA 4HB7A 5JU6A 2H3DA 3OHIA 5T8GA 3S6TA 2YCLB 3NPVA 4X0VA 4FOKA 2V68A 3CV2A 1H50A 1XYMA 1R47A 4LEQA 1UH3A 3W2KA 2OKTA 2TSYA 3UXDA 2FPYA 1BFNA 3N18A 5AVNA 4RNIA 1FWWA 5EMMA 3UP8A 4AC1X 3LQGA 2Z28A 2BS9A 1RPXA 1XQLA 2WMFA 4GYPA 4I9TA 2B4GA 1H7WA 3BAKA 3B8SA 2VZUA 4ZO7A 5C55A 3BLIA 4OIFA 1UOKA 4E3TA 2ZZ5A 4KGJA 4H41A 1TV2A 4JYFA 4J7RA 4DWDA 3TR2A 3MB9A 3WMLA 3QMRA 1Q6DA 3BJSA 3NXFA 1XUZA 4Y9AA 1YKWA 4NI8A 5CSRA 5AHLA 4CD6A 3HURA 1TUFA 1IHIA 3W1RA 1US2A 4HN4A 4HTBA 3S6DA 3HPXA 3WF0A 3NURA 5K9CA 3UEQA 5GJNA 1I8JA 1H3GA 3W73A 1XLJA 1KXQA 4OKDA 1QPOA 4Q4SA 1SW7A 5BOOA 4U33A 5D32A 4CU7A 2WJDA 1TPUA 3N11A 4DO6A 2VEFA 1XRTA 2PD5A 3W7PA 4H19A 4A8NA 3GXTA 4F9JA 1GQJA 2OQHA 2QEZA 1YE6A 2V5CA 1UIPA 3B06A 2Q8LA 1GUVA 2WVUA 1JDCA 2O9PA 4PULA 1XGDA 1YMYA 5AB3A 2OEMA 3MCOA 4TXEA 4C6DA 4IOTA 2HK0A 3N17A 5CLTA 2POZA 3SQLA 3TYDA 3B04A 4XZMX 3BW3A 1SZRA 4HSHA 1KKOA 1D8WA 3KL0A 2O56A 1G4EA 1FH9A 2A1YA 2X05A 1C92A 3VCCA 2WXDM 4MNJA 4UTKA 4DO5A 1YX1A 4ZQNA 4TTUA 3N4FA 2ZX8A 4O18A 1YPIA 2OGYA 4K8GA 2XH7A 4H04A 4O4WA 3RX3A 3AOFA 2DUAA 4MZ8A 3SUSA 3HJEA 4NILA 5D2XA 2ZZ2A 3NAVA 3V16A 3CZLA 2E6FA 4FP1A 1P48A 3GU2A 3PFRA 4DXKA 3EDEA 4L1XA 3VZYA 1AL7A 3CPRA 3HBLA 1UR8A 1W1ZA 4G8TA 1E9LA 2POTA 4MWAA 3KWSA 1EP1A 5CZ0A 1UC4A 4GNVA 2EF9A 3GC4A 1P1XA 1B31A 5G1YA 4GC4A 5CEWA 1HVQA 3W83A 3NL3A 4AHQA 4S3AA 1EX5A 3BLOA 3F4NA 4A05A 3RLUA 4C6CA 3STPA 1PAMA 1KBKA 1MFUA 4RPPA 5I77A 2I16A 2BGNE 3KLKA 2EBNA 1BQCA 3W53A 3GHSA 1SFLA 4XWUA 4X2RA 5J04A 3QPYA 1O5RA 4GYJA 5G4HC 4IPLA 4AB4A 4C6EA 4RJEA 2GGIA 1A4LA 3H2OA 1EDQA 3THCA 1GPWA 1OABA 5D02A 4QS6A 4UB9A 2VEGA 3PZTA 1ODZA 2I57A 3M1ZA 4Q7NA 2D2GA 4ZSUA 1TE1A 3WEZA 3V5FA 1PDYA 1CXHA 3UJSA 5KINA 2QJGA 3OB8A 4EWND 4YJ5A 2EKGA 5DANA 3EOUA 1BPLB 1IEIA 3ABZA 3NL2A 5FL1A 3A4AA 4PBGA 4I6KA 3TDFA 2ZUMA 2BOGX 3CYJA 3MJMA 3VDGA 3TFXA 1FCVA 2J79A 3IUHA 3DH7A 4AZ6A 4PTXA 3P3BA 4WHBA 3HGSA 3GTIA 4IL2A 3LM3A 3AUJA 3IVSA 3BMWA 3WLKX 2EPMX 4AZHA 1T7LA 2VDGA 5HNTA 3PAOA 3MO4A 4GIRA 4RNFA 1LBLA 1IQ8A 3CTLA 3F4CA 5D2TA 2RFGA 4JHMA 4Q4KA 2YLLA 4HMEA 1R8LA 3ZM8A 4NT0A 1A3XA 1JCLA 1IGSA 3HB9A 3W1NA 2YL9A 4B5SA 1MEIA 3TTQA 5AC8A 1XQKA 3LG3A 4D6DA 3WLHA 4OV4A 2YX0A 1UIOA 4J5NA 1Y8BA 4P7OA 3O6DA 1H1YA 4HU4A 1O94A 3CEPA 1AD4A 4AX7A 4YTRA 1T8XA 3QYSA 4N9DA 3M07A 3UCDA 1UZ1A 1UR4A 2ZX9A 3MMTA 1KV5A 3NJ3A 1SO3A 3L23A 3LEPA 1NELA 5C9ZA 3QC3A 1K7FA 9RUBA 3V5CA 3P80A 3WQOA 2XWDA 1A5NC 2AL2B 1PX4A 5TD4A 2ZVIA 3T2PA 1ITQA 2CZFA 3UCQA 4I8YA 1JZ2A 3GNDA 4UZSA 5C9RA 1DE5A 3CUGA 3IVTA 2V0TA 4KWSA 1LTDA 4IFRA 1KQZA 4JX5A 3T05A 1R9YA 2Y5SA 1E6NA 1PTGA 2WBGA 3BGJA 2QPSA 3Q45A 3NDOA 3IANA 4UMAA 2ZTJA 5M17A 2VGBA 1DXEA 3WH5A 1D3CA 4PMJA 3WUEA 2GVEA 5HWJA 4A3UA 3CH0A 2CHNA 1IF2A 4CVUA 4XD5A 5CC6A 1W9VA 2RDUA 4X2PA 1CW2A 2FB2A 2D24A 2F2HA 1RALA 2O4QA 3KOFA 3UW6A 3U2EA 1N8FA 2PWUA 4PEEA 5DO8A 4C90A 2OYMA 4QSFA 2CBUA 5MKGA 4UTHA 3GC2A 3SN1A 5C2CA 3DC0A 3W82A 1KB3A 4LV9A 1TFVA 2X42A 3B8WA 4LFYA 4GFSA 3S5ZA 4XIMA 4YTSA 1LT7A 2GVJA 3IARA 4S3BA 1E9YB 1EBGA 1V6WA 1OJXA 1BYBA 1XX1A 5CZKA 1NM9A 2AAAA 3NDYA 2UY3A 3K4DA 1J11A 3UPBA 3OIHA 2C13A 2FDSA 4XD6A 3DHFA 1EPXA 4ZB2A 2GGJA 4GKLA 3W9ZA 5I2UA 1FHVA 1LZOA 5K3VA 1H7XA 4J4KA 3M16A 5G2HA 1H5YA 3GU9A 4Q8UA 5BXRA 5D2VA 1XYBA 3MYOA 4CCDA 1SZNA 5CBBA 1D7FA 1BD0A 3RF9A 4XKYB 3L2LA 1W9PA 5DRCA 4LT9A 2CBVA 2XVLA 5EA9A 3IK2A 3R11A 3DIPA 1BAGA 1FFRA 1Q6CA 3GBEA 1PIGA 1PIFA 4N42A 3VC5A 3WD1A 1SZGA 3DFOA 4LCRA 1EDGA 4CQ8A 1O12A 3GDKA 2QDEA 4M1RA 3PBVA 1LCOA 3A9IA 4B9ZA 4ADTA 1MRQA 1U22A 3GW3A 4HCDA 3W2UA 4KWOA 5HANA 3CAKA 4NZCA 3T55A 3LBOA 1OIMA 2ISFA 3FA5A 2DVXA 3LYEA 4Z2KA 4JOMA 3N3MA 1MO0A 4AIOA 1KM3A 1MI3A 4IH3A 3PR2A 3LGEA 1M03A 5GQBA 2E5DA 5MKGB 1GCYA 5J8LA 1I0BA 2V5KA 3CZKA 1Q6LA 3ZLGA 3V0TA 2J74A 2VWTA 2V69A 2VWSA 3P7YA 4EXQA 5IHRA 3IVUA 1VS1A 1J0JA 3BMXA 3FDKA 3LBCA 4C6OA 2MUCA 4OJYA 2Q8XA 3BLFA 4JYDA 1PB0A 4XVEA 5MHBA 1GOMA 1QPRA 2CLEA 1K70A 2E68A 2GOUA 3OLGA 1F73A 1AD1A 4E8CA 1TPWA 3KW3A 3W76A 1V02E 2XIOA 1G5AA 4RZ4A 4HOWA 5HMFA 4IQEA 1RQHA 4DF1A 3QH2A 4AD4A 4M82A 2CYGA 4QROA 4NRRA 1UR0A 2V63A 2X0YA 1AUSL 1RLDA 1OT1A 3L4WA 1UUQA 1JGMA 3E9AA 4Q8OA 2J13A 1RA0A 5HULA 3MUY1 2D22A 3PZOA 4DBEA 1XIJA 4TVDA 1FCBA 4PBFA 1HJQA 3PG9A 4PMRA 3IGHX 1XCXA 3BAXA 1KC7A 3F5KA 1TV3A 1CT5A 3K13A 4Y6GA 4YL2A 4GVFA 4QBXA 4HHMA 4Q8MA 3T4WA 3WD0A 4DWSC 1TZZA 3GDLA 3T09A 4P7RA 4AG0A 1NH6A 3A5FA 2DZSA 3HTWA 2XJ7A 3PTMA 2D2OA 3DFPA 3H70A 1OEPA 4F2TA 2ODOA 3MU7A 2E25A 3MUXA 1M68A 4KS0A 1BF2A 1PZ2A 3BOFA 5CXPA 4DO7A 1HJSA 1CLKA 4F0SA 2J9YA 4W7VA 3T7VA 5LXEA 1OX4B 3W7MA 1M7PA 4D6EA 4FA3A 2PFHA 1QO5A 2WW5A 4EVZA 4IGSA 1ITUA 1LQ2A 3DI0A 9XIAA 3KX6A 4XZIA 3CZJA 2PLMA 3ANYA 4JNYA 4H7VA 3MCMA 3RMJA 5BROA 1DV7A 1J0YA 3W2NA 1W5QA 3N73A 2GUUA 4ATLA 4R7OA 4DJEC 2EXOA 3GH5A 4HPNA 4HNUA 1B3ZA 5A5WA 4LRTA 1EP2A 2QHAA 2Y1HA 3RUBL 3QHOA 4LAMA 3I7SA 1VQTA 3I68A 4UTJA 5DMYA 1QW7A 1UWTA 1BTCA 2FQIA 2H8XA 1BG4A 4IX0A 2O7QA 1ZALA 4B5UA 2VEMA 3LV5A 4NZ1A 1CGXA 2J8TA 5GNYA 1WZLA 4IJCA 3ARZA 5AHIA 2Z1SA 3M0YA 5EBAA 1F74A 1E5JA 2G5WA 3E0WA 3NQDA 4QEHA 1YNYA 1GHRA 1WOBA 3KBWA 3CQ0A 1BWLA 4R33A 5D9PA 4DLMA 1JEZA 3H4XA 1BGGA 5D9MA 4A3RA 4C1LA 2AGKA 4Y9MA 4F0KA 1IT0A 3FXYA 1Q63A 4J2MA 4Q7BA 3R8HA 2KZHA 4UOQA 3M0MA 1W1VA 1TTJA 1NTHA 4DJDD 1P4CA 3UNDA 2ZCGA 4OTKA 3S1VA 3LENA 1VEPA 1AW1A 1JPKA 4FALA 3GRIA 1RJRA 3QQ1A 4F3HA 1R3QA 3H6OA 2VFFA 1VLWA 1VLIA 3MUAA 1TELA 5BCAA 3P5YA 4JQ3A 3WLMA 1UWRA 1IIGA 4GX9A 2GL5A 4YWIA 2CHRA 1IXOA 3KP1A 1V3JA 4CEXC 4J2PA 3O06A 4LH8A 1XM3A 2GJPA 1MW1A 1DKWA 3W7IA 3H4GA 2ZUVA 3UNTA 2WQPA 3R0KA 1X1OA 4UTTC 4FIRA 2Y5JA 2PA6A 3B9AA 5EY5A 3UG4A 2WNNA 1E0XA 5A6LA 3UGRA 1HN1A 1OYBA 1EYEA 4Q4PA 5KITA 4PMDA 1W3IA 3O9NA 3BCFA 4LGXA 1XJBA 3TONA 4AU0A 4UQDA 3T8LA 2QS8A 2Y7GA 1AVAA 3W0KA 4Z2GA 5B7YA 3HU7A 3EDDA 2FTWA 1IXNA 1XYCA 1UD4A 2Q71A 2G50A 2JEQA 3HQOA 1JNEA 3UVAA 4ZE5A 1WXJA 4L9ZA 3BLEA 1H62A 1GPFA 4E4UA 3ES7A 3NQCA 5HNNA 3Q94A 2WC7A 2HXUA 1OF8A 3QTGA 3BW2A 1EA9C 4W87A 1H0GA 3R8GA 3M5XA 2OZ3A 4GUHA 1R86A 3NYDA 2H90A 1OQFA 2R9RA 3EMZA 4X9SA 4WY0A 1KM1A 5BZAA 4ZO6A 4ZQPA 1SZFA 3HF3A 4CQDA 3AXMA 2ZZ4A 1W1A1 4XO7A 4WJXA 3FKRA 3NTYA 4AZBA 2W0UA 2Y0FA 2AMXA 5I3IA 2GFTA 1EYWA 2XVNA 4YNGA 5A2BA 2ZXQA 3O63A 3LERA 5A8GA 4J3WA 1JYNA 3B0VC 2NWSA 2XSXA 2INEA 4XQ6A 2QNEA 1F9CA 3CB8A 5T9BG 2DJXA 3VOIA 3W75A 3WMCA 4ZQMA 1C8VA 1S5MA 4DAIA 1J5TA 3NSNA 3UWQA 1ZY9A 4FLQA 1DWGM 3M6DA 3EMCA 5EFDA 4GFIA 2PGWA 5CPTA 2XYLA 2BDQA 1DWJM 3VFCA 1SMAA 1VBRA 2OELA 3A47A 2X8RA 5CKSA 1YEYA 2XH4A 1A4MA 5K9DA 1S2WA 3UY8A 4QLJA 1MNZA 2A4AA 3EOOA 2PP0A 1E6QM 2QJIA 1FXPA 3HFTA 1CGTA 3VIMA 1HO4A 2ISWA 3BTNA 1E1FA 4IFKA 3WL0A 3M0XA 1PVNA 1V0LA 1WDWA 4HPGA 5FL0A 3LA4A 2QCEA 3MDUA 2VHLA 3OP2A 4GOAA 3P0WA 2OZTA 2J27A 3SGUA 4NAEA 5E9XA 3N12A 1J79A 3AFBA 3PZIA 3RDKA 1KFJA 2D3NA 2R1MA 2O92A 1KFKA 4GBUA 4IXHA 3UYCA 4B92A 1ADOA 1PTAA 1NP2A 3ARXA 4QJ5B 6PTDA 1K8YA 1GZJA 2PWEA 1UD3A 1DPMA 5E9AA 5CJMA 1MW3A 1LP6A 2F61A 4H83A 4C7DA 4DUVA 1A5UA 3FV9A 3EZ4A 2J7CA 2YL6A 3VGDA 2DZVA 1R0MA 3CGTA 1A0EA 3EEGA 3F7JA