4Y90A

Crystal structure of triosephosphate isomerase from deinococcus radiodurans
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
MQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDATVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y90A00
5E93A 4TMCA 2A4AA 5G5IA 3HGSA 4GJ1A 4IWWA 1YTDA 4ADUA 3L21A 3Q37A 3L68A 1VHNA 2JKAA 1K7EA 1OFPA 3DI0A 4UUIA 5D30A 3W1NA 1EWEA 3PR2A 4LW7A 4AWTA 5G2HA 2DORA 3UNDA 3T4CA 4HSNA 4A2RA 3M5YA 4LVDA 1UCWA 1YXCA 4LNYA 1KTBA 2ZFAA 1EX5A 4E2DA 3NQ7A 5KSWA 3PC0A 4RXFA 3O8AA 2XN1A 2Z1BA 2UV8G 5IM51 1SPQA 3W2UA 1PL9A 3WJXA 4YMZA 1AW5A 3LCGA 3P67A 2YYUA 5IBXA 1I8JA 4GBUA 1FCBA 1QPOA 1LM1A 3CTLA 1LBFA 4QSHA 2GJLA 2VFIA 1FWNA 2ZZ1A 4M7SA 3FFSA 3DFQA 4O57A 1O5KA 3FYOA 2X1UA 3GKAA 3NPVA 3G1DA 4N9EA 1DQXA 4PODA 2Q8ZA 2O7QA 1GEQA 3GNNA 3LBMA 1JJKA 2VKZG 4XUGA 4ONVA 1TV7A 3ATZA 3AO0A 3M5XA 1ZAHA 4FX7A 3R5EA 3R12A 3B0PA 2Y85A 3LI0A 3ZR4A 2ISWA 4JICA 3L67A 3MI6A 1KA9F 4FX6M 2HS8A 2Z6IA 2A6LA 3F03K 1VLIA 4IX2A 5FF7A 2ZDRA 3ZS4A 2DP3A 5CG7A 1H5YA 2QUUA 5K9XA 2IQTA 3HIJA 1JR1A 4QJ1A 3U6WA 3DFNA 4DEFA 1ZJIA 3NO5A 2FTPA 2Y7EA 1W0MA 1W5OA 2VFFA 3MBFA 1JRCA 5AYXA 3W2MA 2WO5A 2B7OA 1AL8A 3W7MA 1UUMA 1SZNA 3NEVA 2JKPA 3STCA 2VC6A 4WQ6A 3PVFA 4O0KA 1QCWA 3L66A 4XQ6A 1W37A 3G1SA 3LRKA 4AVFA 1TPUA 3QSTA 2Y70A 4NU7A 1YDOA 5DBUA 1TJRA 1ALDA 3CEUA 4H4IA 4XWUA 1OX6A 4L4MA 2V81A 3KFTA 1KM0A 2ZTKA 1D3GA 4W9TA 3E96A 1OFQA 1YPFA 3HG2A 1KM4A 4M5PA 2C15A 1VYSX 2NWRA 5G1TA 1OX5A 1LOLA 5LGZA 3THQA 3PBVA 1OYCA 4K6AA 2C1HA 2H90A 3C0JA 1OX4A 3INPA 3LM7A 1OHLA 1LBLA 5TBOA 5HWMA 1YPIA 2QCMA 1L9WA 3H55A 1U83A 2CZFA 2Y63A 1KM1A 1NVMA 2NXGA 2EKCA 4MY9A 3GDLA 2CZEA 2WJZA 2GPTA 3CB8A 1B4EA 2HS6A 3EX6A 3CM4A 4FEZA 4N4PA 5LHEA 2RDUA 4DF1A 1SQ7A 2YX0A 1A5AA 4UXDA 3N2MA 1XL9A 2G95A 3I68A 4JTJA 2A6NA 1W31A 1OFAA 3IIOA 4LV4A 4O15A 4UTWC 4K8EA 3TMQA 4HKPA 1EP1A 3BGJA 2E5DA 4HNVA 1DORA 3A5VA 3A5FA 1FBAA 2ZQ0A 3A23A 3BW3A 4GUHA 1SW3A 4K37A 4E0CA 2B0MA 4GUJA 1TO3A 4IMFA 3GDMA 3GVGA 5HR6A 2YDAA 5CPLA 4HNTA 4LRSA 3VNDA 5DELA 1KM5A 3P82A 1EP2A 3LHTA 4UTJA 3VE9A 1R30A 3EXRA 4YCPA 4ZQOA 4I7WA 3N73A 2YW3A 3EXSA 4UTTA 2Y61A 2NX9A 3C8FA 2PRHA 4QM1A 3W2NA 3TC7A 3N9SA 1ONRA 1MSSA 5D09A 5DCBA 3TDFA 1BKSA 3W74A 3TKFA 3W1TA 1Z44A 4JYFA 5C55A 3W71A 3TJXA 2AGKA 1OG0A 2YFNA 3C56A 2QCHA 1RPXA 4WUIA 3USBA 2CFFA 4JTTA 1IXQA 5HWJA 4YCOA 2YSWA 3BPWA 2ZZ5A 4ORMA 3W7LA 1ZNNA 5DN1A 3LERA 5CPMA 5HWNA 2R14A 3QM3A 1G6CA 4HPXA 3W72A 3GK0A 2FPVA 1KFKA 1TV8A 3LHWA 4HN4A 1DL3A 3QZEA 3G0SA 1NEYA 2CLOA 5EKYA 2J24A 5LZLA 1JQXA 4O50A 4UFHA 1KTCA 1KTNA 3ATYA 4XBSA 1X7FA 4E2BA 3IGXA 3SY5A 2Y7GA 3C4UA 2GOUA 2Y7DA 5AHFA 2E09A 4IOTA 1K7XA 2NV1A 4NUWA 1SFJA 2GQ8A 5GVJA 5F2LA 1I2QA 4NJKA 1KFBA 2YYTA 3LGEA 4MZYA 4ICNA 4Y6GA 2RH9A 3SZ8A 1KM3A 4OE7A 4CCDA 1V7YA 1VRDA 2W79A 5D32A 1XDMA 3CIXA 4FNPA 3HGJA 5AC7A 3UWVA 3LTPA 4IQLA 3PB0A 2QJIA 5FEXA 7TIMA 1M7OA 1ZAIA 3GKFA 5A8GA 3RFAA 3GNDA 3UD6A 4PL2A 4QQ3A 5K2ZA 1F74A 3IIXA 4N9CA 2E1DA 3E12A 3R8RA 3RK8A 4O4WA 5DY2A 2O7SA 3PAJA 4O4VA 1PV8A 3OA3A 3GR8A 4LVFA 4JGDA 2C13A 3W7NA 1H7XA 3TSBA 2WPBA 3LRMA 2VEMA 3MYPA 2ZZ3A 3SECA 3U8GA 4UTKA 1TRIA 3CQ0A 4A29A 1TQXA 2E5BA 1HG3A 5AHIA 3PUOA 3O05A 1EA0A 1I2PA 3W7QA 1ADOA 1DJNA 2DZSA 1Q6LA 3W1PA 2DZWA 3HGRA 5L6UA 1K03A 1TPB1 4FIQA 2Z6JA 5BMWA 1ZHAA 5EMUA 2BTMA 2LLEA 4QNWA 4DPPA 1W3IA 3KRZA 5L9FA 3BLEA 2QAFA 4U4MA 1XUZA 3HQ1A 3JRKA 4O11A 4UFMA 5HULA 4O8RA 3ZFHA 2QF7A 3WJYA 3T78A 1MO0A 2CLFA 3C3NA 1RQHA 4MY8A 3TSMA 1JCYA 2JGYA 4WZHA 1YADA 1KV5A 1W5NA 4Z08A 1GVQA 3G1YA 3MYOA 1EP3A 3TQVA 2TRSA 3QPYA 4Q33A 2DZPA 2X16A 2YGYA 3UXAA 4NT0A 4WOQA 1TCDA 4NJHA 1VS1A 4IXXA 4TMBA 3SIZA 3QC3A 1F6PA 3NQ6A 2X1SA 3S5OA 5BRBA 3QMRA 1CW2A 4GXMA 3NL6A 2CLIA 3M47A 4IXHA 4JTLA 3BG9A 4UR7A 1ZAJA 4YLWA 1GVFA 1VHCA 3KOFA 4YWIA 5KMYA 5AB3A 5AHNA 2ABBA 4EIVA 1PS9A 4H6KA 4UR8A 3NQGA 4MZ1A 1S5TA 1C29A 2CU0A 1GZGA 5C54A 4XTIA 2C6QA 3IIPA 1B3OA 4MJMA 3CEPA 3C2RA 4B5NA 4GUFA 3G0XA 1K8ZA 3SR7A 1TRDA 3W7JA 1X1OA 3N19B 4P61A 4CNOA 2RHGA 3UWQA 3DENA 4MLJA 4RKAA 3NA8A 3UWUA 1NAL1 2FB2A 1H61A 1QO2A 2Z2UA 3L0KA 3JS3A 3GYEA 3G1XA 1TTPA 1B4KA 3TX9A 2OZ0A 4IX0A 4K8HA 3LCWA 5DXXA 5E0KA 3Q2DA 2ATSA 1H50A 3B0VC 1OFRA 4S2CA 3G22A 4FO4A 4DQWA 3HBLA 4O52A 4RZ4A 5FF0A 1TTQA 5HINA 1GTEA 4RZ5A 1MEWA 1VPXA 4NJIA 1WQ5A 3G1VA 4X3ZA 2QDHA 4NZFA 2JGQA 2QCDB 3W2LA 5F2IA 1QR7A 4UTWA 3W86A 2VENA 4FXSA 1A5SA 1SW7A 3PB2A 3PSVA 1P4CA 1RVGA 2Y89A 5G2IA 4BR1A 1RV8A 1PCWA 3P62A 5HR7A 2YFOA 1QPRA 1OK4A 4WX2A 1HO4A 1X8FA 2FB3A 1OF6A 3FKRA 4DPQA 4EF9A 3TAKA 3NPWA 3WK2A 4LC8A 2R94A 4AF0A 3IIZA 4JTSA 1PIIA 1D3HA 2P1FA 3FEMA 5D33A 2A1YA 3I65A 3DFOA 3TC6A 1HUVA 4Q4KA 2V2DA 4ZVJA 2A2IA 4IGHA 3F1QA 4N9BA 8TIMA 1H51A 5K4XA 2KZHA 1GVSA 2ZCGA 1C9DA 4O1DA 3CLMA 2B7QA 3W2KA 5H2ZA 2W6RA 5HQEA 4LUIA 2ZRYA 5I3IA 2Y88A 2CLEA 2YPIA 2PRMA 4O53A 2B7NA 3TAOA 1VCFA 3G1HA 3C2EA 4Z1AA 3M16A 4JD4A 4LVBA 5C5YA 1F7BA 2YW4A 3S42A 3A22A 3EX2A 3TA6A 5BMXA 3QPZA 2WNZA 3DHDA 5DCEA 1X6UA 2RDTA 1LP6A 4Z0SA 2EGZA 1N55A 3LCIA 3UY8A 1YLVA 1NF7A 2NX3A 1D9EA 3T44A 1YTEA 4QAIA 1DKWA 3A24A 4OGZA 4LC6A 1F05A 1RR2A 4DBDA 5DCDA 3NQ8A 4EWND 1GOXA 1JCNA 2NXHA 3RLUA 1P0KA 4DBEA 2WSQA 2VEPA 3P8IA 3H53A 5TIMA 3LLDA 1A5CA 5F4SA 1LROA 2A0NA 4CNNA 1JVNA 2GVLA 4HPJA 1DOSA 1S3HA 2VFEA 3HMJG 5D2TA 4HSOA 5F2GA 3JR2A 2QUVA 3G1AA 1OFDA 2Q3OA 2YCEA 5FEPA 3M5VA 3W1RA 2QKFA 3NGJA 5U4NA 4RJEA 2V9DA 4WXZA 1R46A 1TPDA 5G4WA 2CLMA 1TREA 1WAUA 2B4GA 1VC4A 5CSSA 1EIXA 4FX8A 4MKNA 1XDLA 3S1VA 4D2JA 2NX1A 3S9YA 5F4XA 1IF2A 1TV5A 2FFCA 3TMLA 3G8RA 3M6YA 2A85A 1NF0A 5FF2A 4ZQRA 4O28A 2ZZ2A 3P7YA 3W70A 4JIQA 3DAQA 2CLLA 3R13A 5K3VA 1DV7A 3NM1A 3PBUA 1SSGA 2ISSA 4HHPA 1FUYA 4MZ8A 3O06A 2FDSA 1ZALA 2YZRA 3NG3A 1SW0A 4JIPA 3HGOA 5D2VA 2DU2A 4UTUA 1DJQA 3UZJA 1W3NA 4CQ8A 5FF4A 4JTGA 2QCEA 4Y96A 1TTJA 2G96A 3W3OA 2I1OA 2CLKA 1VLWA 1QMLA 4Z1CA 3GAYA 3UXDA 3DKJA 1W3TA 3MWAA 3C6CA 4GC4A 4O19A 4LVGA 3W7PA 2EPHA 2ZRZA 2ALDA 4N4QA 4O10A 3I6RA 3P84A 1LBMA 4M6VA 5CPNA 3LCLA 3MI3A 4JX4A 3LB0A 1GYLA 4M7TA 4RLIA 2PC4A 1K3UA 1F73A 4FNSA 1XI3A 4JDYA 3S5NA 2V2HA 2NUYA 3B03A 4LS0A 2VOMA 3GXPA 1HTIA 4GE8A 3FKKA 5DLCA 1B57A 3CPRA 3SGZA 3A9IA 3GDKA 5H91A 4OT7A 3W83A 4JTIA 3GLCA 1WYIA 1SU5A 1EWDA 1V5XA 4UCGA 1AK5A 2QCNA 1WXJA 2DZTA 2ZZ6A 3QF0A 3FIGA 4JTKA 5CZTA 4LVAA 5KZDA 4Z1DA 1SR9A 5D2YA 2YR1A 1SZGA 3TSDA 1FWSA 3CIWA 2ISVA 3QEZA 1O94A 1A53A 3TQ0A 3EB2A 3BARA 4PA8A 5U7SA 4FNRA 4DO4A 4UTTC 1BWLA 5D38A 1ML1A 1LZOA 3VI2A 2WQPA 3N9RA 2WSYA 4NX0A 5CSRA 4MYAA 1AMKA 1BWKA 4NXSA 5CKSA 1A5BA 4NNBA 1YDVA 3EKLA 1BTMA 3WJWA 4NJJA 2ZRXA 2WNNA 1T0OA 3SJ3A 2CZDA 4O1AA 3SW6A 4M6QA 4FXRA 1SO5A 2EAWA 1F5ZA 2ZA2A 1Z42A 5C2XA 3EWZA 4ADSA 3O6CA 4DELA 4UMCA 2X2GA 4QNEA 3UYCA 3S5ZA 4UTLA 1ME7A 3S1XA 3PUDA 3W1UA 4FIRA 3NYZA 4JN6A 5LNRA 1G7VA 1KFCA 3N2XA 3PM6A 3STFA 1FDYA 1H60A 4ML9A 3PWAA 1DBTA 4Y8FA 3FJLA 4LS2A 3W1AA 2Q3RA 4P2VA 4K39A 1T99A 1LTDA 3W22A 4NNCA 4BI5A 1P0NA 3FLUA 3QMTA 4HT3A 3W1LA 2D73A 3W76A 4DXVA 3LI1A 3B4UA 3H54A 3E9AA 3M5ZA 3GAKA 3IIVA 4UMAA 1JCLA 1TIMA 4UFJA 2HSAA 2G97A 4AAJA 1TSIA 1TPWA 1R2SA 3E0IA 2V2CA 3W7GA 4CQ9A 3LHZA 3MP4A 5FEZA 4AF0B 3PY2A 2WV8A 1FDJA 2C3ZA 3PSWA 6TIMA 1U5JA 3F4NA 1GG0A 1TYGA 5AHLA 3UY7A 4NVTA 1SO4A 4MUZA 3W07A 3DKLA 2VXNA 1LDCA 3DFSA 4UNLA 1YXYA 3LCHA 4JR5A 3F4WA 2CZ5A 4EVZA 4LRTA 4XZ9A 1VQTA 5E1QA 3QW4B 3NXFA 3UZ5A 4UTHA 2FJKA 2W0UA 2OT0A 1UASA 1AG1O 5BOOA 1UB3A 2ZYFA 3L5MA 2J6XA 3MO7A 3G18A 4X9SA 3WJZA 4O18A 1A50A 4MPQA 4MFDA 1JQVA 2PURA 3P61A 1YTKA 5BW6A 1W54A 1P1XA 3L2IA 4JXCA 5LSMA 2C16A 4C1LA 1LOSA 1F76A 2VELA 5A5WA 1KW1A 3G1FA 1EUNA 2HTMA 2NUWA 1YXDA 1NFBA 4HIBA 1P5BA 4PH6A 4JEQA 4J9JA 3LTYA 1T96A 5D03A 5CZJA 2BWGA 1W5PA 3TE9A 1YDNA 3NOEA 5HJLA 1LRQA 4WJEA 2CLHA 4MIMA 2VEIA 1XXXA 5KITA 5I3JA 2PRLA 1Q45A 1SZEA 1W8SA 4WD0A 3GIYA 3PBWA 4JNMA 4KKXA 3TXVA 3CC1A 1WBHA 1MXSA 2QJHA 4U28A 1H7NA 2TSYA 1MEHA 1KV8A 4MYXA 2DJLA 4E38A 1OX4B 5I3GA 5FESA 3STEA 1TPVA 1W56A 4JTFA 3BLFA 3IVSA 4TO8A 5DY3A 4BFAA 1SSDA 2FPYA 1YYAA 3LTSA 1SO6A 1GT8A 3GDTA 4XKYB 3TR2A 3QQ1A 1N7KA 4NXKA 3NPUA 5LNWA 2QJGA 1EPXA 3HO8A 5AYYA 1T8XA 2A7PA 1F6KA 1KBIA 3CU2A 2XN2A 2OT1A 3I7QA 3L0NA 3TUUA 1QOPA 2PE4A 4FF7A 1LRTA 1TMHA 1LCOA 3WFAA 2ZRVA 4H3DA 1RD5A 1UUOA 3G8EA 3HG4A 3EWUA 2J9YA 1DHPA 1RZMA 4O1CA 2YXGA 4KFOA 3LHUA 1G7UA 4GUGA 3IVTA 5LGXA 1GPWA 4YXGA 3NQDA 1W1ZA 2XFWA 3MHFA 3M9YA 1LYXA 1TPH1 4PFMA 1W5QA 3LHVA 2R91A 1J2WA 2E6AA 1FXQA 4KFPA 3FOKA 3W88A 2FQIA 3THAA 1XKYA 4GRSA 4GUIA 1IIGA 1FX6A 2ZBTA 2BX7A 4UFLA 4I7VA 4KFNA 3NQEA 3G3DA 3WK1A 3LXCA 1EUAA 4RK8A 3N34A 5J5DA 4FNTA 1R2TA 5KZEA 4O1BA 1JUEA 3FYPA 5EY5A 4BWLA 2GJNA 2J9XA 4UIOA 4CCCA 5LHFA 3GXNA 2FPTA 4O12A 3FS2A 1K02A 2BXVA 3KVJA 1GVOA 3TNOA 1ICPA 2WNQA 4IMEA 5BNKA 3CT7A 3HG5A 3OVRA 3R89A 2JBMA 4UC5A 4LWWA 2ZZ4A 1FCUA 1QWGA 1I2OA 3QMSA 1QNVA 4LTSA 3NQVA 4BI7A 2J27A 1LLWA 3OVQA 3BGGA 4JX6A 5T26A 4AMAA 1FWWA 4PCFA 4ZQNA 1TTIA 4LOCA 2BLEA 4N2YA 2C0AA 3DBPA 3S5YA 1DQWA 2NXIA 1JCXA 1AW2A 1C8VA 2RFGA 1PVNA 4CLMA 1L2UA 3W7OA 3NNTA 3HPXA 4JTUA 1L6SA 1G69A 4I7UA 1FY6A 4NX5A 2Y62A 3KVMA 3L5AA 1QPNA 3IGUA 3MMTA 4OWGA 1NSJA 1OF8A 2WKJA 4OV4A 4RV8A 3STGA 2NUXA 4JY9A 3SSJA 3P5ZA 1Q3NA 1QO5A 4R34A 3SI9A 3L65A 3LRLA 5HNRA 3MUXA 2F7FA 3LX9A 4EF8A 3B04A 3RNDA 3P74A 3GZ3A 4QITA 3LV5A 3W1XA 2I14A 4A3UA 3LDVA 2NZLA 3OBKA 1WX0A 4O13A 4Y90A 2BSLA 3S6DA 3B05A 2G5WA 1K7FA 4R33A 3VCRA 4PTNA 3WK0A 2AAMA 2NV2A 2QCLA 3C52A 5K4ZA 3NR0A 1HL2A 2C19A 1GYNA 3T7VA 1LOQA 3B8DA 4OQVA 1M7PA 4NQ1A 1IIHA 3OHIA 4RZ6A 5EA9A 1IXOA 2OCZA 1JUBA 3Q94A 3QJAA 3GDRA 4RR4A 2GVJA 3PF3A 1ZY9A 3KX6A 3IEBA 4AHPA 4LU0A 5C6MA 2GQ9A 2QEZA 4BF9A 3KRUA 1XBZA 4LY8A 1WOBA 3EXTA 3FJ6A 2QCCA 2E5CA 2FLIA 1R2RA 3EX4A 4X2RA 2E68A 2V8ZA 1KFJA 3BLIA 5KINA 3MHUA 3RF9A 1FDZA 3TJLA 1H7PA 2C14A 6ALDA 3BK0A 3QW3A 2V5BA 3UQNA 1VGAA 1Z41A 3NPXA 3HB9A 3C2OA 5IBXC 5HMSA 3W7EA 3NVTA 2GUUA 3QSRA 5D02A 5AC8A 4IUOA 3NDOA 1G67A 1S5VA 5LKYA 1PHQA 1N8FA 2ZRUA 1G4TA 1QPQA 1I2RA 4FHAA 3KHJA 3W2JA 3TFCA 3NQCA 3P80A 3DU0A 1R47A 4OBTA 4POCA 5KZMA 1OVDA 2B7PA 3LXAA 2VEKA 4EOUA 4LUJA 3TW7A 1VYPX 1OYAA 4UFKA 2V0TA 3NZ1A 2QCGA 1H7OA 4ORIA 5K9CA 5G4EA 2H6RA 4CNPA 3CWNA 4N9DA 2GQAA 2JKEA 3BV4A 4BWLC 3AJXA 2DZUA 3PULA 1FXPA 1QOQA 3S1UA 1EB3A 1LORA 3DZ1A 5I3HA 3UPBA 4GWEA 1QFEA 2VFDA 1I45A 3MBDA 3EWBX 1O60A 3QH2A 2X1RA 5G1YA 4UMBA 2X1TA 1M5WA 4QIUA 1SZFA 3I7SA 1VR6A 5HUPA 1JULA 1QDSA 2ZA1A 2FIQA 2QR6A 3U2OA 3HPZA 1EEPA 1H62A 5HUOA 5MHBA 4K36A 2V5LA 3QRHA 4FNQA 4JS3A 4OV9A 3W87A 1MEIA 4C1KA 4KWWA 3W84A 3UWWA 1GJPA 1G4EA 1I2NA 2H8ZA 3O15A 3OEXA 4S1FA 5CGQA 1SO3A 4MY1A 3HJZA 3O16A 4JDBA 3UPWA 3LBCA 4MLRA 2I9EA 4TX9A 4A21A 4RCXA 1ZFJA 4Z1BA 3WJSA 3UWYA 1F2JA 3W85A 1O5XA 1RQEA 1JUKA 1OYBA 3IVUA 3PBYA 5F2MA 3S0CA 2A21A 1H63A 5I3FA 4WY0F 1ZCOA 5LNUA 4OHQA 3LCFA 3TROA 1OABA 4ZQMA 4M6PA 4LV9A 3PG8A 3DGRA 1G4SA 2BZNA 1GQNA 3W9ZA 3W6YA 1IGSA 2EHHA 4K7VA 3VKJA 3NM3A 3WK3A 4Z0JA 1LLZA 4PC8A 4Q32A 1GG1A 3M1ZA 3EKZA 2DJXA 4XTDA 4FNUA 4UTMA 5ABTA 3HF3A 3QQ0A 4JX5A 4ZMGA 2F84A 2Y7FA 5AYZA 4NZJA 4O0ZA 1WBJA 3EX1A 3PS7A 3E49A 3W7CA 4DO6A 1OFBA 3LOTA 3R2GA 4BK9A 5AFDA 3CWOX 4WY0A 3W23A 5F4WA 3DI1A 3V1PA 3TU9A 1WA3A 2P0OA 3D0CA 3NAVA 4AWSA 3KRSA 4WOZA 4N6FA 3W75A 2C18A 3IV3A 3VE7A 1LRNA 5TQLA 1VZWA 5LNSA 1HO1A 4S2BA 3TQKA 2E77A 2H3DA 2TYSA 3KVKA 3BW4A 1CI1A 3NL2A 3LLFA 2A7RA 1VH7A 4A2SA 3ELFA 4GFSA 3MW7A 1TPEA 3MHGA 2R8WA 1L6WA 1OFEA 3T40A 3CHVA 2A5HA 1IXNA 3P8JA 4OU1A 4HNNA 1PE1A 4DF0A 2DZVA 4DF2A 1KFLA 4XBKA 3LCXA 1QAPA 3DH7A 1GTHA 2NLIA 3BG3A 4L4LA 3TCEA 3VFLA 2ABAA 4I9AA 3KXQA 3RU6A 4R7JA 3HPSA 5KTLA 1IXPA 4HNUA 1TB3A 3MI2A 4ZL1A 2P10A 3M41A 1JCMP 3W7RA 3MP3A 3MP5A 1H7WA 1H1ZA 3L5LA 2TPSA 4WY0B 5D2XA 1B9BA 3G24A 5K9DA 4RX0A 4UNKA 2E6DA 1O95A 2ZZ7A 4CQAA 1O4UA 1ZENA 2ZRWA 4MOZA 1H7RA 2E6FA 2Z0IA 4IJBA 3NQ2A 3P60A 4O14A 5AN7A 3W7IA 3W7KA 4AHOA 3TW6A 4AXKA 1THFD 5J5RA 3S1WA 3EEGA 3MJYA 2A7NA 3QFEA 5AHEA 5FEWA 3M7WA 3O6YX 3T55A 1MZHA 3KVLA 1W5MA 3B0UX 2JK2A 4LS1A 3DFPA 1I4NA 1ME9A 1K8XA 3LXBA 4DO5A 1XCFA 4NNAA 5CPOA 3W7HA 1AW1A 5EYWA 1J4EA 3GB6A 4MVAA 4M19A 3P5YA 4ADTA 4MFEA 3NZRA 1SFLA 4N6EA 1VJIA 2OX1A 1XFBA 5AC6A 1XC4A 3O63A 3ZWTA 4K7YA 1OFOA 5FF3A 4TU1A 1XUUA 3IRDA 3W7DA 2CWNA 2ATMA 1PCKA 1FCQA 4JTEA 3BO9A 1VYRA 2QUTA 3TIMA 3P81A 3W1MA 4O16A 4K38A 4GNJA 3I7RA 1UBSA 4PEKA 1XBXA 3OIXA 5LNVA 1KFEA 2NWSA 3V75A 4UTIA 4JYEA 2X30A 1JRBA 4TR9A 2CW6A 4BI6A 4MJZA 2J88A 3N14A 3UWZA 1OK6A 4IMDA 3EWYA 3SGUA 2EF9A 2GVGA 3QYQA 2WOQA 1TPC1 4LT9A 1Q6RA 2QCFA 3TFXA 2DZXA 4R53A 4RXGA 4AEOA 1WDWA 3PUEA 5CZ0A 3FA5A 4G1KA 3TK7A 3BG5A 1ICSA 1KM2A 1RQBA 1BEUA 3M44A 1Z48A 4IPJA 5EPDA 1HFBA 4PL1A 2Y6ZA 4Y9AA 1GWJA 5F1VA 2V82A 3K30A 2RDWA 3ABQA 1S5WA 1Q6QA 5SWUA 4ZQCA 1H1YA 1AL7A 3DXIA 1WOAA 2VFGA 5EL1A 3LV6A 1FQ0A 3TV8A 5FI8A 4O54A 4WXYA 3PG9A 4AHQA 3A21A 1UJPA 2VFHA 3GX9A 1L6YA 2HMCA 1XM3A 3N3MA 3LHYA 4O17A 4UFIA 2E6YA 3G3MA 4IMGA 4X22A 4CCEA 3M0ZA 2OJPA 3TXZA 3NQMA 1KLYA 2ZA3A 3S8HA 3OG3A 4XKYA 3BVJA 1KLZA 1VCVA 2H3BA 3HOJA 3E02A 3DFTA 3C61A 3NQAA 4N02A 3B06A 3RLVA 3BW2A 1TQJA 3GXTA 4KWVA 4JTHA 3W73A 4AWUA 2H8XA 1G4PA 3O1NA 3NL5A 2ZTJA 3NQFA 3GR7A 3HG3A 3O07A 3G0UA 3EX3A 5DXYA 1Y0EA 2QCDA 3SFKA 3ABSA 3KAOA 3O6DA 3W1QA 4IPIA 1FWTA 1PHWA 4YL2A 3RMJA 5AOUA 1KM6A 3TH6A 1OJXA 4QISA 2AQWA 3M43A 3OVPA 1SUXA 2QAPA 2WSRA 4AH7A 1FWRA 1E51A 1TPFA 5D05A 1KBJA 4ALDA 5G2WA 2Q8LA 1XBVA 1CX9A 2XN0A 2OMAA 5D37A 3DHFA 3ABOA 1X1ZA 5K7JA 3ANYA 1JCJA 3C2VA 5DBTA 5D2WA 3IGSA 3EWXA 4IMCA 3NL3A 4NJGA 5I3KA 3YPIA 1XBYA 1WV2A 1DVJA 2QDGA 4JYDA 5CZSA 1J5TA 2RKXA 4AB4A 1ICQA 3EWWA 1ME8A 5F1UA 3ZWSA 4TIMA 5AHMA 4ZQPA 4JY8A 3L0GA 3L9CA 3Q58A 1TJPA 1FCVA 2PCQA 5EBUA 1VCGA 4A22A 5D04C 2J9ZA 1K8YA 1Q6OA 2V30A 2TMDA 4FB7A 3C2FA 1GVRA 4ZZ9A 1M6JA 3ABRA
chains in the Genus database with same CATH superfamily
2HVMA 5G5IA 4GJ1A 4KW2A 4ADUA 3C0LA 4UQDA 3GR4A 3LGGA 3L68A 2CITA 4ACYA 1K7EA 4AD2A 5D9NA 1EWEA 4LW7A 4AWTA 4IPNB 1UOZA 3GVVA 1YXCA 3K2GA 1PIFA 3TZNA 1EX5A 5E0CA 3WQOA 3NQ7A 2RAGA 3VNZA 5A94A 4INFA 4V2XA 1W3KA 3AC0A 4RXFA 4ZO6A 2ZXDA 3UG4A 5IM51 1JG9A 1SPQA 3W2UA 1PL9A 2YYUA 3QR1A 3LYEA 1FCBA 2G50A 2GJLA 1FWNA 1PX8A 2OEMA 3VC6A 4L1WA 3GC4A 4AZHA 5BXSA 2PDPA 3KRBA 3RG6A 3TP4A 5HQMA 2IUZA 4N9EA 1DQXA 3H2MA 5A1AA 2PDKA 2Q6ZA 3QR0A 2ZUVA 1GEQA 2D2OA 3LBMA 4G1NA 3QOKA 4U33A 5A8NA 2VC9A 1TV7A 1XX1A 4PRTA 4E4PA 3M5XA 3H2NA 1ZAHA 1S5NA 3WG6A 3OQEA 4YTRA 3GXFA 3B0PA 1AMYA 5CGTA 4JAWA 4BQ4A 4JIIX 4H9MA 1VPYA 2A6LA 3F03K 4Z2KA 4IX2A 3EMQA 2YL6A 1YKWA 5H8PA 4H19A 4WJXA 2IPGA 1MVYA 2IQTA 4DM1A 4NF7A 4QJ1A 3DFNA 2FTPA 2Y7EA 3IANA 1GW1A 1JRCA 3W2MA 2WO5A 3S1GA 2ACRA 4DO7A 3CYVA 3N4EA 3STCA 2VX6A 2XZ7A 2VC6A 3MVIA 4TUFA 4WQ6A 1KKOA 5JQ9A 2VTFA 3PVFA 1QCWA 3UJRA 1QUMA 4U31A 2Q71A 1Q2RA 1W37A 3G1SA 3LRKA 4JIRA 1PPIA 3QSTA 5DBUA 2XIQA 2W67A 2BY3A 2V81A 3AU2A 5C2GA 1UYQA 1CXEA 1YW1A 2OPJA 4M5PA 1ZBCA 3OU8A 3TWAA 2E40A 1XLAA 4P8XA 2WCGA 1DXFA 5LGZA 3THQA 4B5XA 1C3FA 2H90A 3C0JA 4GIEA 1P6WA 1BWVA 4L61A 5A3HA 1VRXA 5DANA 5HWMA 1YPIA 1CEOA 1KGWA 3URNA 1KM1A 3LPFA 5JUVA 2NXGA 1DQUA 3M0XA 1F6YA 3EX6A 3CM4A 4H8UA 5LHEA 4ZO9A 3G77A 4DF1A 2YX0A 4Q4PA 1EQCA 1OFAA 4O15A 4UTWC 2DSVA 3E2RA 2QUNA 3BGJA 4HNVA 1DORA 1GGOA 2V3EA 1FBAA 1A0CA 4K37A 4HZ8A 3GDMA 1A5UA 5CPLA 1AZ2A 3PZGA 1HF6A 3VNDA 3GSMA 4M51A 3LHTA 1RAKA 2BXYA 3KOYA 3WNLA 4V1XA 3WLOA 3N73A 1TG7A 3EXSA 4PTMA 1HW6A 3VKCA 1MMFA 2AL1A 4DJFD 2E3ZA 3AU6A 1ONRA 5D09A 1C9WA 2F9RA 5DCBA 3TDFA 3W74A 3TKFA 4JYFA 5C55A 4J35A 2AGKA 2A3AA 3NCOA 3AIEA 3SN0A 4J1OA 1RPXA 1E0UA 3LMZA 4A3QA 3WL1A 4EPBC 3S4TA 5B7YA 4JTTA 1ISXA 4YCOA 3T05A 2YSWA 1DYSA 3FAXA 3LERA 5CPMA 5HWNA 3KZPA 2R14A 3FHAA 3QM3A 3U48A 3W72A 2FPVA 4XVDA 3ITYA 4M0XA 4US5D 1KB3A 3GHSA 4O1FA 1WP6A 2J24A 1BF6A 1ZJAA 1JQXA 4O50A 1H3GA 4XBSA 2XISA 1E73M 1WUEA 2Y7GA 3H21A 3RITA 5T9BG 1BKHA 4XUYA 3HTWA 3CMGA 2GQ8A 4GNKB 5GVJA 1XISA 4AISA 3MT1A 2WQDA 1RP9A 1KFBA 2YYTA 2GWGA 4GOAA 4ZE4A 4Y6GA 2RH9A 4UWMA 4OE7A 2I57A 3M7SA 1H41A 1UIPA 3FW6A 2FGZA 3OOQA 2W79A 2GVYA 4LYRA 1XDMA 4FNPA 3HGJA 5A2AA 2O92A 5HXMA 3UCCA 2XH0A 4KMQA 3UD6A 5A2BA 5K2ZA 4N9CA 1XIGA 1XIBA 3E12A 3G2GA 4O4VA 4EE9A 2HNEA 1PV8A 3GR8A 1OM0A 4D8LA 3MYPA 1H5VA 3BZGA 3RX4A 5GNXA 1IR1A 2NSXA 4XD4A 2E5BA 3WF4A 1HG3A 4PUKA 2PI6A 1EBHA 3WENA 3O05A 1JNEA 2CXEA 1ADOA 3W1PA 1J93A 3HGRA 2FTWA 3NVDA 3BJFA 1UZHA 1F3EA 9XIAA 1TA3B 1W3IA 1Q7MA 1R3TA 3KRZA 1GOMA 2QAFA 2YBTA 3CHDA 3PANA 8RUCA 1XUZA 3JRKA 3GBDA 1BXCA 3VD3A 2JGYA 4WZHA 2J47A 3DDMA 4UCFA 1EP3A 2DSKA 1X1NA 2TRSA 1BGAA 3UXAA 4WOQA 4AZ7A 2PFHA 4TMBA 3SIZA 3QC3A 2DV0A 1MUMA 3S5OA 2PDGA 4QEHA 5RUBA 3ZMRA 3M47A 4UR7A 5BROA 2W4XA 1KFWA 2WCSA 5AHNA 3P2VA 3WQFA 2BG5A 3EKGA 3CUHA 5DRIA 1OINA 4H6KA 4UR8A 1HXJA 1Y5VA 3L4WA 4DUOA 1S5TA 1C29A 2QIWA 1UPPA 3BDKA 1XLJA 2IKIA 1J8VA 3HPAA 4XTIA 3KP1A 5AVNA 2C6QA 3CUGA 4J27A 3IIPA 4MF4A 4R5EA 4MJMA 4X61A 1T41A 3G0XA 1B5TA 3SR7A 4F0SA 2HZGA 1IGWA 3VOJA 1WKFA 3CUIA 4XSLA 1PJ9A 3V5CA 4IQEA 4B9ZA 1J0IA 1QO2A 3L0KA 4LEFA 4J28A 1B4KA 2UBPC 1H09A 3F2CA 1BXNA 4HOWA 4MJ4A 1OD0A 4LJ3A 1FHDA 3B0VC 4XAGA 3CTTA 4U5KA 3G22A 2XSAA 3HFTA 2NQJA 1TTQA 1CPUA 4ZBCA 4HPNA 6REQA 4C5ZA 5A6KA 2I17A 2QCDB 3THUA 1YNYA 1EJRC 3W86A 4PUUA 1LQAA 4S3JA 1BYAA 1RV8A 3P62A 3BCDA 1QPRA 2PD5A 1OK4A 3WQWA 3VD4A 1X8FA 3WUEA 3TAKA 3NPWA 4W8AA 2Q01A 3WF2A 3QHOA 1KC7A 5D33A 2A1YA 3DFOA 1U5HA 2H9AA 1HUVA 3E0FA 2A2IA 4IGHA 3S83A 3DYPA 1ZCCA 5HOSA 2A3HA 3TN4A 5K4XA 3F5KA 3WCZA 2ZCGA 1C9DA 1UHVA 3JU2A 4M1BA 2PTZA 2Z1XA 3AJ7A 4A35A 4JIHA 1RVKA 5A6JA 3ONCA 5HQEA 2JIWA 3KOZA 1JD9A 2CBIA 4KEMA 3T8QA 2R82A 3G1HA 2AAAA 1C7SA 3DGBA 5C5YA 3S42A 3A22A 3EX2A 4Y8EA 2JF6A 3OZMA 3QZ6A 5C71A 4JOMA 2WANA 3EMZA 5DX7A 5IHSA 4Z0SA 2GJXB 1IV8A 2EBNA 3UY8A 5E9AA 1D9EA 3T44A 4QAIA 1DKWA 5C7VA 2PWFA 1RR2A 4DBDA 3QZAA 3KCJA 1NWTA 3ZVHB 3NQ8A 1CGYA 1JCNA 1QOXA 3RLUA 1DJIA 2WSQA 3WUBA 3P8IA 1HNYA 3B8IA 5M3WA 2G41A 1NP2A 1A5CA 5F4SA 5DQPA 2A0NA 2ZXAA 1JVNA 1XRTA 1DOSA 1IEQA 3HMJG 3RLGA 5F2GA 3JR2A 2QUVA 2EG8A 3ITOA 2YCEA 3AS2A 3W1RA 5U4NA 2V9DA 1E4LA 4A8NA 1RCOB 2DH2A 2PWEA 2CLMA 3BTNA 1VC4A 1FOBA 4QRNA 3BWWA 1EIXA 4MB4A 4XISA 4MKNA 1XDLA 2GSHA 4D2JA 4R7OA 1TV5A 2FFCA 4K2SA 3T0BA 1XWYA 1TE1A 3WBXA 4O28A 4B5SA 3RAOA 4G7FA 4QG8A 3GS6A 3DAQA 1WDDA 1DV7A 2ISSA 4HHPA 1EXBA 4WHBA 4GYPA 4F0MA 2YZRA 1ZALA 2DQXA 4PUJA 4Q4OA 4H7CA 4C6EA 1DJQA 4EPEC 3HFYA 1JZ6A 2NSOA 3MSDA 5FF4A 1CXLA 2OELA 4JQ3A 1EZWA 2P88A 4Z1CA 1AFSA 4S3FA 1WPCA 2OXNA 4MKSA 4QG6A 4GC4A 3UR2A 3W7PA 2ZRZA 2QXWA 3WH7A 1LBMA 1Q6GA 4JX4A 4M7TA 5IXEA 1O5RA 3S5NA 3AALA 2VOMA 4RNHA 3FKKA 5E70A 3VUSA 1WE5A 5H91A 5BYWA 4JTIA 3FDKA 3NOYA 1WYIA 2VDGA 1EJUC 2QCNA 1WXJA 3Q65A 3E6EA 1W1IE 3TSDA 1SZGA 1FWSA 3QEZA 3EPMA 1LG2A 1F9CA 4C91A 4LYQA 4NHVA 3ANVA 2BY1A 5U7SA 3LZ5A 5D38A 1DPMA 4TX8A 1ML1A 1LZOA 3VI2A 2WQPA 4AUBA 3CAQA 3CL8A 4NX0A 5CSRA 1CLKA 5H6HA 5CKSA 4B5VA 4NY2A 3BQ5A 4NJJA 2WNNA 1UP2A 1K9FA 1VB9A 4JN8A 5D4YA 4B5WA 4PTWA 3EYPA 2ZA2A 1ISVA 1OC5A 3VIPA 1VJSA 2X2GA 3S5ZA 4UTLA 2C8NA 1ME7A 3WNPA 4GNVA 3URBA 4JN6A 4XAFA 5LNRA 1G7VA 3VM5A 1FDYA 1ELSA 1H60A 1LL4A 3PWAA 1S39A 2CCRA 2R1KA 4LS2A 1YRRA 1T99A 3RGTA 4BI5A 1P0NA 3QMTA 3O3RA 2ISDA 3W76A 3VPLA 2J8FA 3A4JA 3LI1A 4PMUA 2QT3A 3B4UA 2PEVA 3LK6A 4FLQA 2YDRA 5A8QA 4PRRA 3A3XA 2VR4A 4YTTA 2J74A 1W1TA 1S2UA 2QVHA 2V2CA 3E0IA 2YKKA 2Y24A 3R0UA 1BPLB 3UEQA 1Q8AA 4ICMA 2QYGA 1FDJA 8CGTA 3BAKA 2E1WA 6TIMA 4OECA 2GGIA 4DI8A 2FH6A 3WD4A 4DWSC 4MUZA 2VXNA 1Q8JA 1V02A 1K8CA 4JR5A 3F4WA 2YXXA 4EVZA 4AIEA 1VQTA 1BRLA 3DYMA 4MKVA 5KETA 4PUNA 4GVFA 8XIMA 3CZJA 3UCQA 4UTHA 2XDFA 1CDGA 1U30A 3OO2A 2OT0A 2Y5JA 1A0EA 1UB3A 3L5MA 2YB1A 4C7DA 3EDFA 2QGHA 4HCHA 4O18A 1DE6A 1JQVA 2PURA 4W89A 1QHPA 3R8HA 1YTKA 3AIUA 5LSMA 3OIHA 3NDZA 4MNJA 3G1FA 2GJRA 1XICA 2HTMA 1YXDA 1NFBA 1KQZA 4PH6A 4JEQA 3VC5A 4GC3A 2CBJA 2BWGA 1W5PA 3N2OA 3TE9A 3WUGA 4DB7A 1LRQA 2VEIA 4F2UA 3TTOA 2PRLA 1PTDA 2XIIA 3WQEA 2GGEA 1W8SA 3NZPA 1ENUA 2P5NA 3GIYA 1W9PA 3PBWA 3CC1A 3PFRA 3NSXA 2XJ7A 1WBHA 1RLDA 3TYBA 3KW3A 1XYZA 1MEHA 2YJQA 5LA1A 4NG3A 1KR1A 1TPVA 3IVSA 4TO8A 2FPYA 4JHMA 3SN1A 4QDPA 3LTSA 5IDIA 3TYAA 1NDZA 4QXIA 4XKYB 1N7KA 3NPUA 3R58A 1EPXA 5AYYA 2XN2A 5FAJA 4G7EA 4FF7A 1LRTA 1LCOA 4H3DA 2A3CA 4BF7A 1RD5A 2ZC1A 1EPVA 4QAWA 1MW2A 3COTA 3EWUA 2J9YA 1TMLA 3A4XA 4GMEA 4KFOA 4GUGA 1P1MA 4FP1A 1E6SM 1E71M 1CGUA 3IVTA 4LUSA 3UYIA 4DJFC 2ZOXA 2WM0A 5BU6A 3MHFA 1TV2A 1KKRA 1LYXA 1SM9A 4PFMA 2J7DA 1W5QA 3A6OA 3LHVA 2R1LA 1BAGA 4ROQA 3ZZ1A 3L2LA 3W88A 2HBXA 1WNOA 2G3MA 3CJPA 1VBUA 5FJTA 4D8ZA 1AZ1A 1FX6A 2ZBTA 5KEZA 4I7VA 5FJRA 3HA1A 1XGDA 3SCUA 3WK1A 3LXCA 3OLIA 3B3DA 3WNOA 4RK8A 4FNTA 1R2TA 5KZEA 4O1BA 3FYPA 1ZJHA 3AHYA 3CHFA 3G1RA 5LHFA 3FS2A 2BXVA 3AIQA 4HNLA 3KVJA 1V6UA 2WNQA 4IMEA 3CT7A 3GRIA 4ASTA 3FAWA 4UC5A 4W8BA 2XM2A 1FCUA 4A3RA 3W25A 5I24A 2Z1WA 1W1VA 1QNVA 1B3WA 2OSXA 4LTSA 3VNLA 5B80A 1DWFM 3DFHA 1NU5A 2CESA 4AMAA 5T26A 1YX1A 3E0WA 1QXLA 3QLLA 1ZL1A 1FWWA 3SGGA 4E5TA 2O9PA 3P6LA 5DMMA 2YLAA 1DQWA 3OGVA 2NXIA 4RV3A 4JKMA 1Q7QA 1WO2A 5FJOA 3CO8A 2J4GA 3AS0A 3W7OA 3NWRA 3MDWA 4JTUA 4YVXA 1L6SA 1G69A 1FY6A 4NX5A 2DT2A 2Y62A 3L5AA 1DHKA 1XYLA 4LYKA 4BA0A 3IGUA 4KF1A 4ZA0A 1YNPA 2Y2WA 5IFTA 1ESWA 4GISA 3F4VA 2FMOA 3GHRA 3STGA 2WPGA 4JY9A 3A47A 4XZWA 2EPMX 3P5ZA 4U2YA 2W9MA 2IPWA 3LRLA 4AZ5A 1F3XA 2F7FA 2P53A 4EF8A 3B04A 4QITA 2ZX9A 3LV5A 4A3UA 4Y90A 4ZOEA 2G5WA 1FHUA 3ALGA 4PTNA 2NV2A 5T91A 5K4ZA 4U2ZA 1HL2A 4J3VA 2C19A 3T7VA 3QVQA 1REQB 5CC6A 1BG4A 3B8DA 4OQVA 4HCDA 2E28A 3W38A 4W84A 3QJAA 3NXLA 1IT0A 3EDDA 4RR4A 3PF3A 1AQ0A 1ZY9A 3RN6A 3OA5A 4LU0A 2QQ6A 5CH9A 2NQZA 2QEZA 5E5CA 1YBQB 2E5CA 1QI5A 2YZ5A 3EX4A 4GZJA 2HROA 3TOPA 1XYCA 5TNVA 1LJYA 4DUVA 4UOQA 4UQ9A 3RF9A 1F8IA 2WZTA 2Z1KA 4F3HA 4ENLA 3SQSA 4QLLA 2Q02A 5XIAA 3C2OA 4H04A 5HMSA 3W7EA 3QSRA 1KBBA 3BL3A 2CXGA 4IUOA 4AMCA 3WLMA 1G67A 1S5VA 4GY0A 1HP5A 4QLJA 3N25A 4FHAA 4NAEA 3AZTA 4OBTA 1V0KA 3P80A 1R47A 2VEKA 3QQWA 1KXQA 1EEXA 4EOUA 2QMKA 4UFKA 2BHYA 1XRVA 3NZ1A 1GKPA 1H7OA 1IHIA 5K9CA 1L2QA 4D6IA 3VD5A 2H6RA 3CHEA 3IRSA 1P0DA 3CWNA 3DHPA 1MDLA 1Z6KA 4C6IA 1E6XM 5CBIA 3BV4A 4BWLC 3AJXA 3P0XA 4QP0A 3MA8A 3VIIA 1LORA 5I3HA 3UPBA 3RPMA 3M4HA 1OC6A 2IQDA 3EWBX 2F2HA 5G1YA 3B97A 1VKFA 1NFPA 1X7IA 3ZVIA 1OSEA 5E9XA 4M1RA 2DUXA 1SVDA 2QR6A 4NAFA 4ZCWA 2BGNE 1N2VA 2V5LA 2VI0A 3IJLA 1UA3A 3W28A 4S3CA 4FNQA 4JS3A 1HJVA 5FA5A 3W84A 3PAOA 1DXIA 2H8ZA 3C2YA 2WZHA 1RA5A 1CT5A 3O16A 4U3AA 4JDBA 2I9EA 4A21A 3LPGA 3MCOA 4DUXA 1RY8A 3WJSA 4GYPC 3PZMA 2O9OA 4HK5A 1YE4A 3ITCA 1MW3A 2YL8A 1TWSA 1FFQA 3WDIA 2HRWA 3IVUA 3PBYA 2JE8A 2HEJA 1XD1A 4L9ZA 2RJHA 1H63A 2ADAA 5LNUA 1BFNA 2Z2AA 4AW7A 1C93A 4ZGYA 1G4SA 4HYWA 4IUGA 3W6YA 3M0KA 2EHHA 4K7VA 4Q22A 1LLZA 4PC8A 3EKZA 3HF3A 4NAFB 3QHNA 3EX1A 1C90A 3PS7A 3VIGA 3W7CA 4D8AA 1OFBA 3SIMA 5C2CA 4CGTA 1BYBA 1QI3A 4L4PA 4WY0A 2FZBA 3DI1A 1E4IA 2PGWA 4AY7A 4WOZA 3NTYA 8XIAA 2C18A 3IV3A 5HNNA 2PDCA 3WKZA 5LNSA 3TJIA 2H3DA 2TYSA 2MUCA 3BW4A 1XYBA 1VH7A 3EOSA 1Q6CA 1RCXB 3ES8A 1TPEA 1L6WA 4MHBA 4XSMA 3GE7A 1EZ2A 1PO9A 4KWOA 1QBAA 2D23A 3AAMA 3SUUA 1JDAA 1R9YA 2FVMA 1V0LA 4DF2A 4XBKA 4UB9A 3DH7A 3SQLA 1LUCB 4O8AA 4WR3A 2OO0A 3KXQA 2DDXA 3CMFA 4S38A 5KTLA 1KO0A 5CC5A 2PDQA 1H7WA 1PKYA 2TPSA 4L7ZA 1MFVA 4GX8A 1O95A 1R9XA 2HE8A 4J3TA 4CQAA 1ZENA 5LA0A 4N7QA 1JI1A 3ARUA 1REQA 2Z0IA 4IJBA 4O14A 1I9CB 3AXKA 4E3VA 1THFD 5ABGA 3EEGA 3MJYA 2A7NA 4OVXA 3QFEA 2RDXA 5AHEA 4C6FA 3O6YX 1MZHA 4IF2A 3KVLA 1Q5MA 1KWKA 4WGXA 4C6NA 5JBFA 3OP2A 4LS1A 1UWUA 1K8XA 3TN6A 4C1NA 3EA1A 4NNAA 3MUCA 5EYWA 3T07A 3NSMA 4MVAA 4MFEA 1VJIA 3M0YA 2OX1A 3RRAA 3ZWTA 5FF3A 2WLYA 3WBEA 1JPHA 1XUUA 3W7DA 2CWNA 3BLOA 2G0WA 1FCQA 2BOGX 1VYRA 1GKRA 2QUTA 3TIMA 2BBFA 4H9TA 3W1MA 5LYRA 1XR2A 1DJGA 4QX4A 1EA9C 3I7RA 1VFLA 3H2OA 5I09A 3FSTA 4ATWA 2EEXA 4I90A 2NWSA 2VVNA 6CGTA 2G3JA 1JRBA 4L6DA 3N14A 3UWZA 4GH3A 3F7JA 3LBOA 2EF9A 3UFYA 2WOQA 1J5SA 1UKTA 1XGEA 4AEOA 1EH9A 2FHCA 1WDWA 3APYA 3PUEA 3BAXA 4W5ZA 1OB0A 1QTWA 4Q4QA 3SCSA 2PP0A 2WHLA 1TVPA 1H1NA 4M81A 4MWAB 3BICA 2BOFX 4LUTA 1XLKA 3WQDA 4PL1A 4Y9AA 3BXWA 5F1VA 2RDWA 3MV11 4IT1A 4CQDA 1TUXA 5SWUA 4ZQCA 5IHRA 1AL7A 1WOAA 4PCPA 3W26A 3TV8A 4GO8A 1RSCA 4MNKA 4EK7A 3GX9A 4X2PA 1L6YA 2YCJA 4EP8C 4UFIA 4X22A 4QCFA 3EPOA 3M0ZA 4DJDC 2F6UA 2WSKA 2XWEA 1HL8A 2UY3A 4XKYA 1S46A 6XIAA 1M65A 3E02A 4YVVA 3WQCA 1OT1A 4GKLA 4IICA 3AFBA 3BW2A 4B2DA 1XLFA 2GUYA 1G4PA 3I3EA 1TVLA 4FPSA 1FP8A 3GHUA 1Y0EA 2WCAA 4W4QA 3KAOA 2AOSA 2Z1SA 1PHWA 4YL2A 1YDYA 4KGJA 1KM6A 1OJXA 4QISA 4D6CA 3K8LA 3BCJA 2FHFA 3FA3A 3M43A 2O4QA 3VKBA 3UNTA 3QBUA 3E1F1 5G2WA 3IS4A 5LIUX 2I16A 2XN0A 3CUFA 2V5DA 3DHFA 3ABOA 3AHVA 1PDYA 1X1ZA 7A3HA 5K7JA 1MNZA 1H2JA 1XLMA 5D2WA 3ARZA 3BSGA 3QGVA 2YCLA 3YPIA 3WBYA 1B3VA 1W3LA 3VU2A 1TA3A 3WBAA 4XV0A 1O1HA 3ZWSA 1P7TA 1W1B1 5AHMA 4ZQPA 4FLRA 4JL2A 4RW5A 4A22A 1K8YA 2QV5A 1Q6OA 5C9UA 1GVRA 2VT0A 4NI8A 3MCNA 4C7FA 4RNJA 2WXDM 4G5DA 3HGSA 4IWWA 1XHGA 1YTDA 3TLLA 4I9TA 4DBUA 3RHGA 1CLXA 2JKAA 1OFPA 5D30A 3AYRA 3W1NA 5C70A 3PR2A 4GABA 5ABHA 4HSNA 3N18A 3WD2A 3M5YA 1UCWA 1DIKA 1DIEA 3RDKA 5KSWA 3O2LA 1XSIA 3O8AA 1WKDA 1Q85A 1X8CA 1X98A 4RPPA 5A6AA 4YMZA 1BG9A 1AW5A 3LCGA 3P67A 5IBXA 4W85A 3T2OA 3V7PA 2OB3A 1LM1A 2G4JA 3GY1A 3GH4A 2VFIA 4YVPA 1AD1A 5DT5A 3LSCA 3ZOAA 4O57A 3GBEA 3OLGA 1NY1A 3GKAA 1ZPTA 4I5UA 3LNMA 3ZR5A 3U4AA 3GNNA 3GH7A 1KCKA 1BYCA 2PTYA 4AG0A 3CV7A 1E0XA 2DT0A 1A5OC 3QV9A 5FSEC 1A4LA 3F5JA 4HMNA 5FL0A 4JICA 4URIA 2BGQA 1JPIA 1PWLA 1VLIA 4XZBA 5FF7A 1A3XA 3ZS4A 3UZWA 1EC8A 4ML4A 2DP3A 4Q8VA 1FWEC 4M3PA 1JR1A 3TTYA 1W0MA 1W5OA 3OZOA 5AYXA 5I77A 1AL8A 4Q4SA 3NEVA 2XVGA 1XLGA 3TQPA 2BB0A 4O0KA 5GJNA 1LF1A 4KERA 1TPUA 1TWZA 1ALDA 3CEUA 1HKKA 4H4IA 1OX6A 1RBLA 4FOKA 2QPUA 4L4MA 1KM0A 2O56A 1D3GA 2XIMA 2ODOA 3KOXA 4W9TA 1W1PA 1BRLB 1KM4A 3OZYA 2JFEX 4UNIA 5A6BD 2NWRA 2VCAA 2VUNA 1GVYA 1OX4A 1HJQA 1E5NA 1LBLA 4IQDA 1F61A 4YN5A 3H55A 3PTDA 4HU8A 2PTDA 1RXOB 2O4MA 2WJZA 3HPFA 2C1IA 2GPTA 1V51A 1B4EA 1BTCA 5REQA 1ONWA 2HE5A 5CCZA 4FEZA 4N4PA 1H49A 1A5AA 4JQ1A 2G95A 3I68A 4JTJA 1A5MC 2ZXBA 1EC9A 2FJUB 5MKGB 1CECA 2E5DA 3PNUA 3A5VA 2QUMA 1KCXA 3S2NA 3A23A 4GUHA 2YBVA 4E0CA 4GUJA 1TO3A 2FZ9A 4QS6A 2FGLA 3KBVA 3CV1A 4GXWA 1TZZA 3VE9A 3N3TA 1OD8A 1TV3A 3O0FA 4UTTA 2HXTA 4ERIA 3DG3A 2Y61A 2Y5EA 3C8FA 2PRHA 3TC7A 3WN6A 4BKNA 1HJUA 1MSSA 4V33A 3U0HA 3DX5A 1KBKA 3D3AA 3W71A 1I1XA 4G7EB 1OG0A 4GI9A 3CIVA 4ZOAA 3VTRA 4A8RA 2CLPA 3AWOA 1KRCC 3KBWA 4NRRA 3VKKA 4ATLA 4QG9A 3B9AA 4FALA 3DECA 3RCMA 5CC7A 2L5HA 4ORMA 3EDJA 1X97A 2J7GA 2YCLB 1ODZA 5DMLA 4LUSB 3M6DA 1G6CA 4HPXA 4B91A 3GK0A 2NT0A 2DGAA 9XIMA 7REQB 2O9TA 5FAGA 3FK4A 3QZEA 1IWPA 1NEYA 5EKYA 4BZYA 1KTCA 3ATYA 1DP0A 4E2BA 4HA3A 3S9IA 3CHCA 1ITQA 4IOTA 5A69A 1I60A 2J62A 2NV1A 4I5XA 3Q45A 2POTA 1UWIA 4LANA 4DX3A 4NJKA 3U7VA 3LGEA 4MZYA 4K1GA 5HMEA 2XH4A 5I03A 1XIHA 3VX0A 5CG0A 4B3KA 1KM3A 1MW1A 2EG6A 1V7YA 1VRDA 2QIIA 3FV9A 1PZ1A 3W4RA 3MZ2A 3CIXA 3W24A 2ZX5A 4F0RA 3LTPA 1UKQA 4IQLA 2J7CA 3PB0A 3REQB 5FEXA 7TIMA 3CNYA 5A8GA 4HU0A 4H8HA 4G8TA 2O0TA 2W3ZA 4QQ3A 1F74A 2E1DA 2VP8A 3R8RA 4LH8A 3ARQA 4GHRA 3RK8A 5CGMA 4O4WA 5DY2A 3WUFA 4DBSA 3PAJA 3IJ6A 4CKQA 4LVFA 3W7NA 1H7XA 1VEPA 3PJUA 5CEWA 1S1RA 3KHDA 1Z69A 2PDYA 4UTKA 1UWQA 1SJAA 1ISWA 3KTXA 4A29A 1UPMB 3H8AA 5H8UA 2BHZA 1EA0A 1FWBC 4IFKB 4E2VA 3W7QA 3S6TA 1XQKA 1DJNA 2QS8A 2XIBA 4DNHA 3VCCA 5EMUA 4DPPA 5L9FA 4LAOA 2X09A 3V1HA 3QYSA 4O11A 4UFMA 3FCPA 3HZ3A 1RQHA 4LQ1A 3ARTA 3CAVA 3GQYA 3RIKA 3CPGA 1JCYA 1IR2A 2XG9A 4Y9NA 1KV5A 3V5FA 1W5NA 4Z08A 1GVQA 2P50A 3MYOA 3Q4DA 2IKGA 4NZ5A 2WYSA 3N2TA 5I79A 2G3NA 2FVKA 2ZC8A 4NJHA 5LA2A 1VS1A 4YTSA 4YS1A 3NQ6A 2X1SA 1VFFA 5BRBA 3L4YA 3G6LA 4GXMA 2WM1A 5REQB 1PEZA 1TKKA 2CLIA 4IG2B 4IXHA 1GVFA 3KOFA 4Y9OA 2ABBA 1HKIA 1V3HA 2J66A 1PS9A 2PC8A 3NQGA 3TYUA 2OU4A 3N15A 1W17A 2PDJA 1UH2A 2EPKX 3CQHA 4QCEA 1UD2A 5LIXX 3UR7A 4J3SA 3VD9A 4MMWA 1B3OA 3CEPA 4B5NA 1EQPA 2W27A 1K8ZA 1TRDA 1X1OA 4Y7EA 2GGHA 3DENA 3AXIA 3NA8A 2I56A 1RUSA 3EGJA 2YOCA 1XYMA 2Z2UA 3V0UA 2D22A 4PULA 4P7LA 3G1XA 4A8LA 1TTPA 2OZ0A 4IX0A 4K8HA 4RNFA 2QDDA 1M3UA 1AQHA 4S2CA 5D9MA 4DQWA 3HBLA 4HTYA 5HINA 3GM8A 1GTEA 4BQ2A 4F9JA 4NJIA 1JDFA 1WQ5A 3G1VA 2QDHA 4NZFA 2CERA 2JGQA 2VL4A 1QR7A 3N6QA 4UTWA 4FXSA 1S2CA 2PDFA 3PSVA 5G2IA 4DZIA 1AH0A 2PDMA 2P8CA 1M68A 4DN1A 2FB3A 4OKDA 1PTGA 2ONEA 1D3HA 3AOFA 3GG0A 3H2AA 7ENLA 2ACQA 4AEEA 4AYSA 2HQAA 3SO7A 1EO7A 2ZWZA 4ZVJA 3HJEA 5EBAA 1H51A 4DYKA 4AQLA 3N2BA 3DFYA 2VD8A 4AFYA 2BXZA 5CPSA 4MTVA 1VFMA 1W32A 1J9YA 4UQBA 1CWYA 2WVSA 4GX9A 4LUIA 3WQPA 2Y88A 1US0A 2VQUA 4H9YA 2PRMA 3RYSA 1VCFA 1KCLA 2F8QA 1F7BA 1PXGA 2X40A 3CWHA 3RILA 3TA6A 3CAKA 3QPZA 3BE7A 4HU4A 1PDZA 1AJ2A 1LP6A 2EGZA 1N55A 3LCIA 1NF7A 2PF8A 1YTEA 1GPFA 4LC6A 1F05A 1CIUA 1TJ2A 1NH6A 1GOXA 1FH9A 3KEHA 5G1MA 2NXHA 2PTWA 3M0JA 2D0HA 2QW5A 3WLIA 2VEPA 3WQ4A 3H53A 5TIMA 3NZQA 5HJYA 2DVUA 4QDWA 3OBAA 5EMYA 1OFDA 4QGCA 5FEPA 3M5VA 3QFWA 2QKFA 2PLKA 4HHMA 3IWPA 5G4WA 3M0LA 1M41A 5CSSA 2YA1A 4G9PA 2PU1A 1PKNA 1IF2A 3TMLA 3M6YA 1E72M 1HJWA 3P7YA 2CLLA 2VCBA 1M04A 1OCNA 5A6LA 5K3VA 1R3QA 2VWTA 4JFTA 2WSPA 1W6TA 3KBJA 1BGGA 2Y4SA 2PPGA 4TVUA 3M0IA 3ZT7A 2IKJA 4PMDA 3BURA 3SY8A 3WIJA 1W3NA 3I4EA 4JTGA 3B9NA 2G96A 3TR9A 2I1OA 4RW3A 3CAWA 3HM7A 4LVGA 2CHRA 2C79A 2J8TA 2ALDA 2C0HA 3R25A 1DJWA 1QI4A 1XD0A 4I6KA 1X96A 5CPNA 3CUZA 3VILA 1MRAA 3L2MA 5I0DA 4FNSA 1Q65A 4JDYA 3GW3A 4C65A 2AMXA 4R85A 4XZLX 4F66A 1HTIA 4GE8A 2HISA 3GW0A 4Z2JA 1VIZA 3WDRA 3CPRA 5HPOA 2XIJA 3ARVA 1A5KC 4RDVA 3W83A 3JZEA 3GLCA 3VFCA 3A12A 3GWQA 1SU5A 1V5XA 4UCGA 2ZDSA 2WLZA 2DZTA 1SFTA 2PGFA 3QF0A 3CUXA 2VRQA 5KZDA 3UP8A 5FJPA 2YR1A 3E2SA 2HPIA 3CIWA 3JUGA 1O94A 3EDKA 1X6LA 2VC5A 2Z00A 2VRJA 3RLHA 4PA8A 4FNRA 4DO4A 1BWLA 1DTNA 3QKEA 4GZEA 3ZO9A 1AMKA 1TFVA 2XUCA 1A5BA 1I75A 3MUAA 3EKLA 1BTMA 4GINA 3H4WA 3WLKX 1TJ1A 2ZRXA 1SMAA 3SJ3A 1XIDA 5CXPA 5FCZA 1ONXA 1GOQA 4C6CA 4HJFA 3SW6A 4PUMA 1SO5A 4GJJA 4XZMX 2EAWA 3U5UA 3R0DA 5FKYA 4DIAA 4F8XA 4ADSA 3O6CA 2GDQA 4DELA 4UMCA 1J0KA 1QASA 3LY0A 3VOHA 2NVAA 1EKOA 3L4TA 4GKTA 1NDYA 4NZ3A 1KFCA 1PBGA 3STFA 4NRSA 1UP3A 1IZKA 3FJLA 4B5TA 2Q3RA 1LTDA 1MNSA 4JTCA 4ERAA 3FLUA 2ZUWA 3W1LA 1C8QA 4DXVA 3H54A 1XH1A 4XX6A 4UMAA 1TIMA 2ZKMX 5HMDA 4LX4A 2VEFA 2G97A 4ZOCA 5AECA 1R2SA 4CQ9A 3LHZA 3MP4A 4AF0B 3T0DA 1KR0A 3PSWA 3CO4A 2IXVA 1IEVA 3RUBL 3F4NA 1TYGA 5GPRA 1SFSA 5AHLA 2WJDA 4ZFMA 3MB9A 1UC5A 2R1MA 4S3EA 3DKLA 1LDCA 5I78A 4NKCA 1YXYA 1FWAC 4V28A 1T6MA 3CGTA 3MQTA 4WGHA 2WMIA 2DSUA 3IACA 3MANA 1HN1A 2A3LA 4KBXA 1V6VA 3NXFA 3UGVA 1EJ7L 2PDNA 3SM0A 3E38A 5D8ZA 2ACUA 2XZ9A 1S5MA 1UASA 3K4WA 2QJNA 2ZYFA 3UG3A 1A50A 1QW7A 3T42A 4MDOA 2A79A 1W54A 2UZ9A 1P1XA 4GQBA 2C16A 5C8BB 1A4MA 1H11A 1F76A 4CN4A 3M46A 1EHNA 5JH2A 1KW1A 3SSZA 2UY5A 4AZIA 2FFIA 1PX4A 1B90A 4PMZA 4JTAA 1EUNA 2NUWA 1R85A 1VIWA 2ZX8A 2QZRA 1GOWA 4J9JA 3LTYA 1T96A 1CB2A 5CZJA 1W3JA 3SCWA 1P0EA 4Q6XA 2WMKA 1PTAA 2XYLA 4NZ1A 4E4UA 2CLHA 4R88A 1LWIA 3CK5A 1XXXA 5KITA 5I3JA 1ZRQA 3VM7A 1SZEA 4D9PA 4PEEA 2PDIA 4DYJA 4JNMA 4KKXA 2VZUA 3TXVA 5CC3A 1HP4A 1AVAA 3URQA 1MXSA 3BH4A 4WKFA 1JF6A 2DW6A 3SCRA 3BLFA 2JEPA 4LB3A 5DY3A 1SSDA 1UD6A 3MUY1 3RX2A 4Z1YA 2VZSA 1ECEA 3QQ1A 5D9OA 2YCIX 3HO8A 7XIMA 3L0NA 1U1JA 2VX4A 3GG1A 3IJIA 1XW8A 3WFAA 3EA3A 3WDHA 4H8VA 1UUOA 3H24A 3G8EA 1M7XA 1ZJBA 2XIOA 1H4PA 4XKMA 3LHUA 1UR8A 1G7UA 4RUBA 2QVNA 1GPWA 4YXGA 5XIMA 3VXGA 3AXMA 1W1ZA 3WEMA 3FYYA 2AL2B 5DFAA 1J2WA 1FXQA 1UZ4A 4KFPA 2BS9A 3PPHA 3E5BA 3THAA 3SEPA 1IIGA 1V79A 4UFLA 5AVHA 3WLRA 5HATA 4KFNA 4YWSA 1RBAA 1EUAA 3VX1A 3H7UA 5EY5A 1HL9A 1GZ1A 4UIOA 3VIFA 4MM1A 4LGXA 1FHVA 5I06A 3VUPA 2FPTA 4O12A 3V35A 3QV7A 3UZYA 3B0XA 5DMNA 1ZZMA 5BNKA 3R89A 2JBMA 2BMBA 1QWGA 4ZE5A 1NQ6A 4HN8A 4F2BA 3AIVA 1C7TA 4Q6JA 3EB3A 3WLPA 3OVQA 3BSHA 3TTQA 4HA4A 3BCFA 3OTRA 1BVZA 4N2YA 4CQBA 3E0LA 1G01A 3DBPA 4GK8A 3S5YA 1JCXA 3RM9A 3H4GA 2X42A 3N1AA 5HBFA 4NI3A 4F48A 4GCAA 3HPXA 2VQTA 1F4HA 4I7UA 1OCQA 3AZRA 3PZIA 3HQNA 3PZQA 1NSJA 1UH4A 1VFOA 4J2PA 3PN8A 2WKJA 3VNIA 4PUWA 2HXUA 1Q3NA 4R34A 3L65A 1EIBA 4GY7A 5HNRA 3MUXA 1POJA 3P74A 5I00A 2C91A 3ZYZA 3UA3A 1OQFA 3GG7A 3ZT5A 2V38A 3OBKA 2VCCA 1MW0A 4Z42C 1K7FA 3TW9A 2AAMA 1WZLA 4FOJA 4B2DD 1OC7A 2G8ZA 5XINA 1Q4WA 3T1GA 2PODA 4GQ0A 1JYVA 4NQ1A 1EOKA 1IIHA 3G5EA 3OHIA 4G6CA 3M64A 2E9BA 3U3HA 1JUBA 3GDRA 4OZOA 2ZUMA 2GVJA 3KX6A 3IEBA 3WH8A 1ZU8A 2GQ9A 4WLCA 4BF9A 2OOFA 3KRUA 1XBZA 2QULA 3KLKA 4HD5A 3HMCA 3FJ6A 4I3GA 2BV9A 1R2RA 3PJTA 1GQIA 1GKQA 4LXFA 3ARRA 1NQKA 4CUCA 1E0TA 5KINA 4PMNA 2OODA 2VDIA 3BK0A 2V5BA 2D2HA 1RLCL 3WDJA 4D71A 3HB9A 5D02A 1AJ0A 3LPPA 3VOFA 3FX4A 1E0WA 3RM4A 5TF0A 3FGCB 2ZADA 2PB1A 4NZCA 1N8FA 2ZRUA 1G4TA 3QY7A 4AYGA 3W2JA 1GOIA 3STPA 2OZ3A 5AC5A 2CC0A 3WF0A 3AYTA 3OYZA 3VGFA 3LXAA 1M01A 4HA0A 3VZZA 3POCA 2QCGA 5G4EA 3SCOA 5JBEA 2JKEA 3CXOA 1FXPA 4KRZA 4NP7A 3IJDA 1EB3A 4RNIA 2AQOA 4GWEA 1O66A 1UG6A 4WVXA 2V67A 1O60A 2G37A 4UMBA 5I02A 3LQLA 3U2ZA 5GQBA 3D6NA 3NDYA 4AVOA 1SZFA 3I7SA 1GOOA 1VR6A 1F3TA 4DAFA 2PMQA 1B9ZA 2FIQA 3U2OA 3UESA 1TR1A 3HPZA 1H62A 3A4AA 5HUOA 4GLEA 5MHBA 3I10A 1UD5A 3WQ5A 3APGA 1V4YA 3QRHA 4OV9A 1ZBVA 3CZEA 1GVIA 3W87A 1MEIA 3UWWA 1GJPA 1G4EA 4DUWA 4LF1A 3WYZA 4GFIA 3O15A 1Q6FA 4HB7A 1FH8A 1O68A 3HJZA 1LQ2A 3WFZA 3UPWA 1O6IA 1ZUAX 1ZFJA 4Z1BA 3RRXA 4CQCA 4HMCA 4M8UA 3UWYA 1XLBA 1XLDA 1O5XA 1OYBA 4CD6A 3TJ4A 5AYBA 1FWHC 4HZMA 2ZIDA 5I3FA 4WY0F 1ADDA 4OHQA 2ZE0A 2QJMA 1KWGA 3RJYA 1NWUA 2BZNA 3CZLA 3OZPA 4CD8A 3W9ZA 2V3FA 3VYLA 1IGSA 1XS2A 1T7LA 3D47A 3W81A 1GG1A 1G94A 2WJFA 3QTPA 1WBJA 3MKKA 3GIQA 4DO6A 3LOTA 2I5GA 3WH6A 5AFDA 1UBPC 3W23A 1WA3A 2P0OA 3VINA 4XD3A 1F3WA 3USZA 3KRSA 3GVQA 3EDEA 5EMLA 3VE7A 1LRNA 4B92A 3OVGA 1MUWA 1US3A 4S2BA 4JNZA 3TQKA 4PMJA 1TZ7A 5IFPA 3ZSTA 1G5AA 1W9BM 2GYIA 2GQ3A 3SDOA 2Z7GA 3MW7A 3RO8A 5FD0A 3MHGA 2MANA 4RE4A 4D6EA 1Q6EA 4WJ8A 3FNDA 3CHVA 2A5HA 3ITXA 4L65A 3P8JA 1XIIA 4OU1A 1D2KA 3ORWA 4C90A 5C9XA 4DF0A 4JBRA 3WX7A 1YBQA 1QAPA 1GTHA 2NLIA 2GGGA 4L4LA 3R79A 2AL2A 3TCEA 4O0QA 3NGFA 3BGAA 4R7JA 4I5RA 1IXPA 3ME3A 4HNUA 3WLJA 1TB3A 3M41A 2AKZA 1H1ZA 3H2FA 5D2XA 1B9BA 4RX0A 3ZIZA 3KBNA 4D72A 2ASHA 4FR6A 1F07A 4H9VA 1QK0A 2ZRWA 3LEPA 4QLKA 3T08A 1O5QA 3DOPA 3VIHA 5BU9A 3NQ2A 4X0NA 1CZ1A 2YIHA 3BUVA 2NQ9A 3AMKA 3M7WA 3T55A 1KXHA 2ZX6A 1KQYA 4MAZA 5FL1A 3NQBA 2JK2A 1I4NA 4DO5A 3PTMA 4H41A 4WDWA 3AXHA 4ADTA 1IYXA 3KCOA 3NZRA 4HK6A 4OBSA 1XFBA 4AD4A 1OFOA 1CGTA 4MJ2A 3GNPA 2ATMA 3SCNA 2E8YA 3HU7A 3W37A 5CQ1A 3VGBA 4C6MA 3AQUA 4L64A 3VNYA 4FF5A 4GZIA 3ZXWA 2XWDA 1ITUA 1UBSA 3PTKA 4PEKA 1MUCA 1XBXA 5LNVA 1KFEA 1EGZA 1U5VA 1EYWA 5HA7A 4JYEA 2PDLA 4TR9A 4HVXA 4NZ4A 4YU1A 1OK6A 1JD7A 3EWYA 4LAKA 4RDWA 3SGUA 1XCXA 2GVGA 6A3HA 3KBSA 1XIFA 2AQVA 3TFXA 2DZXA 1QW9A 4R53A 2V5JA 4MWAC 3EWDA 4G1KA 3TK7A 1BEUA 3M44A 4PTVA 3ARYA 4UZSA 1HFBA 3AUJA 2WZMA 4J3WA 3EPNA 1GWJA 3K30A 3OYXA 3R7MA 3ABQA 2JF7A 2XGBA 5EFFA 3SURA 1C8XA 1EX1A 4KCWA 3MUZ1 4DLFA 1SYTA 3W00A 1QRQA 4J3UA 1WDQA 4AHQA 1RP8A 1UJPA 4GYKA 1OG6A 2VFHA 3RU8X 4FK9A 2HMCA 1XM3A 3U4FA 3LHYA 4O17A 3PZTA 4IMGA 1Q66A 4IL2A 4JKLA 3NJ3A 3NQMA 3S8HA 2Z24A 2GLKA 2H3BA 3HOJA 3ABXA 4K3ZA 2V3GA 4PZVA 3DFTA 3C61A 2VYOA 4H6EA 1DJXA 3W82A 3ZJ7A 3NQAA 4N02A 1CGWA 1TQJA 4KWVA 2J6VA 4Z2HA 3W73A 1DWHM 3QV6A 2DIJA 3O1NA 3N17A 1YPXA 3HG3A 3GR7A 4PCTA 3O6DA 4IPIA 1FWTA 1XKJA 4D6FA 4WDXA 2WZIA 4IJCA 5CBJA 1XQLA 4DBWA 1J0JA 3UF9A 4M24A 2EJ1A 3OVPA 2QAPA 1VBGA 4NAEB 1TPFA 2R9RA 3WBWA 5BXTA 2OMAA 3CQIA 1MQRA 2PP3A 5MKGA 4IZGA 1N82A 3IK4A 3OG2A 2HK1A 4AD5A 2V5CA 2QDGA 5CZSA 1HZYA 4AB4A 1P6CA 1ICQA 1EHAA 1ME8A 3AROA 4TIMA 3E0VA 4B4FA 3L0GA 1SJBA 1W1YA 3L9CA 1C8YA 1FCVA 4XG1A 1MYRA 2J78A 1NDVA 2J9ZA 5D04C 4AXNA 3PTQA 4EX4A 1UMYA 3C2FA 4UZUA 4ZZ9A 3NO3A 2G3FA 4REQB 4TMCA 4NILA 5HNTA 3FN9A 2OEJA 5HQLA 3L21A 3ERPA 3T2PA 5HDRA 3Q37A 1VHNA 4HMDA 5JXQA 4UUIA 3DI0A 3PWIA 3TNBA 1HX0A 1VENA 2DORA 2Z4GA 3UNDA 4A2RA 4F0HA 4W7VA 3WQ6A 2PTXA 1KTBA 1Q13A 2F6KA 4P8UA 1GHRA 3SCQA 4C1NB 1QNPA 3MWCA 2Z1BA 2UV8G 3V36A 3PFMA 3WJXA 5T8GA 4PUEA 3WF1A 3BJTA 1I8JA 4GBUA 1GQKA 3RR4A 2OYLA 3AS3A 4TOQA 3ZT6A 3VOGA 5C0QA 3PJWA 1UR9A 1ZLPA 3TYEA 4M7SA 2C1GA 3DFQA 3FYOA 5A6SA 1G9HA 1GJUA 4PODA 2O7QA 2DIKA 3LA4A 4H8NA 2VKZG 1WKEA 4QQUA 4ONVA 4M56A 2V6AA 3PZ9A 3AO0A 5EU9A 5A6BA 1WXYA 1OADA 4FX7A 3L7RA 3R5EA 3CZGA 3R12A 2VGGA 1RD6A 2Y85A 3LI0A 2XSBA 2ISWA 4F2TA 5BXRA 3L67A 3MI6A 1KA9F 4U3CA 4HPHA 1L8NA 4ZB2A 2X2YA 2ZUUA 1DIOA 1IEXA 3KTSA 5CG7A 3ISIX 1XP3A 3HIJA 1ZJIA 3WEZA 5EMMA 2VFFA 3P93A 3KL5A 1IT8A 3GFXA 2XH2A 4LPCA 3U57A 4DWDA 1UUMA 1SZNA 4N0RA 2HBVA 4TVCA 1F4AA 4FLOA 3L66A 1E6NA 4NIRA 3VZXA 2VJXA 5A95A 4AVFA 1YDOA 4XWUA 5DMYA 4MDPA 4YHEA 3ANUA 4Q8WA 4DM2A 3E96A 4H6QA 2C15A 4KCVA 1SGJA 3O0KA 3FGCA 1K9TA 1VYSX 1W2VA 3EOOA 3GVRA 4Q7IA 3PBVA 2C1HA 3RCNA 3INPA 3JZUA 3LM7A 2IQ0A 3SRFA 1OHLA 4M29A 3KS5A 3V16A 2CWXA 5CZKA 4C6JA 5TBOA 3GUWA 2QCMA 1L9WA 1U83A 1NVMA 4MY9A 3GDLA 5M1TA 2NQ5A 1UZDA 2CZEA 4QTGA 7CGTA 4AZ6A 4GQRA 2RDUA 2Z2BA 1Y8BA 1SQ7A 4UXDA 1XL9A 5HNUA 1PX3A 1BSLA 1Z3NA 4FS9A 1J11A 4XO7A 4MADA 5EB8A 3TMQA 4GCXA 1EP1A 1S38A 3A5FA 4DRSA 4OUIA 2ZQ0A 4Q8MA 4F0LA 3BQ6A 5HR6A 1OGBA 2YDAA 1TWDA 4IIGA 1R38A 1XGZA 3B40A 3TN3A 1XIEA 1XV8A 2NVCA 5AC4A 3IUIA 1EP2A 3GTHA 4UTJA 3UXLA 1R30A 3EXRA 6TAAA 2EO7A 2YW3A 3WLSA 2GK1A 2V69A 4QM1A 3KDOA 2RGLA 3N9SA 3MJMA 2WW5A 1FWDC 2G4FA 1MZRA 3W6LA 4PSPA 1BKSA 3W1TA 1KXTA 3T0CA 4ZSTA 2WMGA 4WF7A 1WAWA 2FMNA 2EPLX 2YFNA 4L1GA 2VNCA 1TZ9A 4L4OA 2QCHA 3BAWA 1UP0A 1UKOA 4WUIA 2GUBA 3H4XA 5BZAA 2CFFA 1K9EA 1IXQA 5HWJA 1FWGC 2DIEA 3BPWA 2ZZ5A 2BHUA 3W7LA 1MFUA 5E09A 3SY1A 1BD0A 5DN1A 4AZCA 3MU7A 4M80A 1DL3A 4HQVA 2PDBA 2Z7KA 4YJ5A 4V1YA 2CLOA 2PZNA 4DJED 1Z8AA 5LZLA 4KWSA 4UFHA 4CD5A 3ZLHA 1KTNA 3AWNA 3IGXA 3SY5A 3C4UA 2GOUA 3LU2A 2J25A 2GJPA 1K7XA 1SFJA 2DH3A 4R9OA 1LWHA 3N9KA 1VJZA 5E6ZA 3VAVA 4ICNA 4K68A 4WEVX 1IT7A 4CCDA 2VUYA 2Y8UA 1ISZA 4TX6A 2QDEA 4GJIA 4LBRA 5AC7A 3T0TA 2HV5A 3UWVA 4JFVA 4W86A 4FR1A 2I9UA 3GNXA 3MPGA 3B9DA 2VR2A 2PBOA 2GGJA 3WNKA 1IWAA 4JQ2A 3IIXA 4MB5A 2OKTA 1E43A 4EKJA 3K5XA 2FKPA 3A9BA 2OOGA 3R94A 4EXQA 3OA3A 4JGDA 3TSBA 3GD6A 3LRMA 2VEMA 1IEWA 3U8GA 1X6NA 3WEOA 1UD3A 3CQ0A 3GXDA 1G0CA 1G1YA 5AHIA 4RL3A 3PUOA 3C0SA 1JZ4A 1I2PA 3W6MA 2DZSA 2DZWA 2BASA 1TPB1 4FIQA 3GU2A 4JTDA 5BMWA 1XDJA 3GXMA 1ZHAA 5GNZA 2ZICA 3AHTA 4WDTA 2LLEA 4QE4A 2OQYA 3BLEA 4U4MA 4D1IA 4AZGA 3GU9A 3HQ1A 2Z28A 5HULA 4BJHA 1UD8A 2PLJA 2QF7A 3UG8A 1MO0A 1Z89A 4A4AA 5FIPA 1RJPA 4KEZA 1VP5A 5AZ0A 3TQVA 1A49A 3QPYA 2X16A 2YGYA 2OGYA 4J3XA 1HIZA 3SBFA 3GXIA 1FFRA 1F6PA 4Y2WA 3O9NA 3QMRA 4BF5A 1CW2A 3NL6A 4PMQA 1W8GA 5DF0A 3BG9A 4YLWA 3TONA 4US5A 4YWIA 5MF5A 3CH0A 3GTIA 1RPKA 2GZXA 2MNRA 4MZ1A 2QV4A 1EFZA 3AS1A 3GUGA 1XSKA 1TELA 3ZLFA 1E6QM 1JZ2A 2OEKA 3DYOA 4GUFA 4A3YA 1E55A 2WMHA 2RHGA 3R6IA 1MWOA 2D20A 4LEQA 4Q8UA 4RKAA 2ICSA 4GI6A 2OLHA 1NAL1 2FB2A 1H61A 2QNEA 4JTQA 4U5IA 5GJPA 2J77A 2X0SA 3LCWA 5E0KA 2ATSA 2HVNA 2X0HA 3OLEA 5FF0A 1FRBA 5BOFA 5F7UA 3H6OA 3LLXA 2NLYA 3EWCA 1MEWA 3ITTA 1JYNA 2DZAA 1MQQA 2VENA 1A5SA 1SW7A 3K13A 1P4CA 1UWSA 3W01A 1Q7ZA 1RVGA 2Y89A 1L0PA 4BR1A 5EMJA 1KGXA 1UC4A 1HJSA 7REQA 4WX2A 1HO4A 1OF6A 3FKRA 4XIAA 3SRHA 3EB4A 4D6JA 4EF9A 3T2QA 1ODUA 2WHJA 1JNDA 1GHSA 4JTSA 4W7WA 3I65A 1GNXA 3TC6A 4IPPA 4Q4KA 5IDZA 1I6NA 3F1QA 4PMXA 1JFXA 4TTUA 4N9BA 2XINA 3ARSA 1GVSA 1H0IA 2UY2A 4O1DA 3CLMA 4P8VA 2V63A 2B7QA 4CN1A 4Q7BA 1J6OA 1JDDA 4H7ZA 5H2ZA 2W6RA 3IPWA 2ZRYA 1POKA 1FWCC 4H00A 1W2PA 1E1CB 1R8LA 2B7NA 2BY2A 2WMJA 2I5QA 4LCSA 4EAYA 3O7UA 1RK6A 3SB0A 4HOZA 4ZB0A 1HGYA 5BMXA 1FVPA 4B15A 3DHDA 5DCEA 1X6UA 2RDTA 4IIDA 2YA0A 1ZBKA 1OIFA 1YLVA 3A3WA 2NX3A 1L6GA 1PWMA 3A24A 4I9JA 1Y5XA 4L80A 4C6QA 5DCDA 2RUSA 2PS2A 2YCKX 4DBEA 1FKXA 2D2JA 3BZJA 2F2KA 4XZIA 3LLDA 1EO5A 3C86A 3MDUA 1QATA 3R0KA 4CNNA 5CSYA 4HPJA 1S3HA 2VFEA 3RPTA 4IFRA 2Q3OA 3WQGA 1D8CA 2CEQA 4L9XA 3AHXA 1TPDA 2Y8KA 4QDMA 1OWQA 1TREA 1WAUA 2B4GA 4FX8A 3JW7A 4EAMA 1DJYA 2NX1A 2A85A 1NF0A 3KTCA 5FF2A 2WVVA 2FZ8A 4ZQRA 4DZ5A 1HKVA 2OZTA 3W70A 4I8YA 4JIQA 4J40A 1BYDA 1UMLA 3NM1A 1GEHA 4MZ8A 5G4HC 5LXEA 3F5LA 1SW0A 3NSNA 4WRHA 4JIPA 5LIWX 2VOTA 3B0YA 5D2VA 4IMAA 4UTUA 3UZJA 3KZSA 2PSNA 4P8WA 5CLWA 4Y96A 1VFSA 1SR0A 4J7RA 1QU4A 3W3OA 4BS0A 1QMLA 3DKJA 4E6MA 2E25A 1W3TA 3MWAA 4O19A 3BLLA 5HAOA 2EPHA 4O10A 3UCDA 3LUTA 3I6RA 3LCLA 4PMVA 4RLIA 1K6AA 2PC4A 1K3UA 4JL1A 1F73A 4Q8TA 7TAAA 2NUYA 4LS0A 3CMJA 3GXPA 4HCLA 2X8RA 5DLCA 3SGZA 2XVLA 3A9IA 4PB5A 3GDKA 5FACA 1DTUA 3H26A 1AK5A 2ZZ6A 4JTKA 4LVAA 1SR9A 5D2YA 4XBJA 1ZBWA 4Y9PA 1A53A 3TQ0A 3BARA 3REQA 2FDMA 2ZUTA 1UUQA 3CLWA 1U1UA 3S2CA 3VIJA 1PSCA 3N9RA 1E9YB 3IUDA 1XRSA 2NV9A 2AMGA 1PZ0A 4MYAA 1BWKA 4NXSA 1UR4A 4Z17A 4GQGA 4B90A 1P7TB 5H8MA 3EEZA 1T0OA