4Y90A

Crystal structure of triosephosphate isomerase from deinococcus radiodurans
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
MQTLLALNWKMNKTPTEARSWAEELTTKYAPAEGVDLAVLAPALDLSALAANLPAGIAFGGQDVSAHESGAYTGEISAAMLKDAGASCVVVGHSERREYHDESDATVAAKARQAQANGLLPIVCVGENLDVRERGEHVPQTLAQLRGSLEGVGADVVVAYEPVWAIGTGKTATADDAEELAAAIRGALREQYGARAEGIRVLYGGSVKPENIAEICGKPNVNGALVGGASLKVPDVLGMLDALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y90A00
2X2GA 3M5VA 2E6DA 1G4TA 1QDSA 3QMSA 3HGSA 3LI1A 1R46A 4A2SA 1MSSA 3L68A 3P8JA 4NX5A 4ZMGA 3NL6A 3SJ3A 1SSGA 1MEIA 1R47A 5KTLA 3MHGA 4O17A 2CLEA 1AL8A 1LBMA 2GQAA 4M6QA 2DZWA 5KZDA 3A22A 3LV5A 1KM5A 4DO4A 2R8WA 5FI8A 4JTUA 4UFIA 1FCVA 3S5ZA 3HQ1A 1K8ZA 1SO5A 3TU9A 4PFMA 4XBKA 3I68A 1EP3A 4E2DA 1JULA 3G3DA 1YADA 3W7OA 3GYEA 4IQLA 3C2OA 3BV4A 3M6YA 4UUIA 3MP3A 2ZA2A 2J9ZA 4WY0A 4UTUA 3B8DA 2ZTKA 1IIHA 3R13A 1H7XA 3BG9A 3G8RA 3GDLA 5DY3A 4OT7A 4MZ8A 5HINA 3NA8A 3P74A 5FF7A 4O53A 1ZAJA 3W6YA 4HN4A 5AHLA 1PHWA 1AG1O 1SPQA 3NGJA 4M6PA 4UXDA 2RDTA 1VLIA 1OFAA 3PULA 4GBUA 3SECA 3F4WA 3I6RA 1GVFA 5T26A 8TIMA 2VFGA 1S5VA 1F5ZA 1KFLA 5AHMA 3UWZA 1I8JA 4IWWA 3GKFA 4AWTA 1EUNA 4XKYB 1Y0EA 1PVNA 5J5RA 1WYIA 1EWDA 4I9AA 4DELA 4ZQRA 2Z6IA 2EKCA 3GB6A 2Y7EA 4O28A 3QRHA 1PE1A 1EEPA 3DHFA 3G0XA 2NXIA 2FLIA 1FWSA 2ABBA 3G3MA 3NQEA 4UTTA 1FY6A 1FCBA 1GG1A 1O94A 2VFDA 3Q94A 4NJGA 2A5HA 4OGZA 2C16A 2VFFA 2ZCGA 1ICSA 1XI3A 3M1ZA 5HUOA 1TB3A 1TPB1 1Q6RA 5J5DA 4QITA 2NXHA 2CZEA 4FXRA 4K6AA 1ADOA 1YDNA 4KKXA 1M5WA 2TSYA 1WA3A 2O7SA 1G69A 2FDSA 5HUPA 4ALDA 1GVSA 5F4SA 2XN0A 3P84A 3A24A 1KBIA 3HG2A 4UR8A 3IIXA 2CLHA 1T8XA 1JUEA 2H90A 1XUUA 5D02A 3MO7A 3FKRA 1OYAA 1I2RA 3DFPA 4UTTC 1K02A 3SFKA 2JKAA 3LX9A 3LLFA 1R30A 1K7XA 3N73A 4K36A 5DXYA 3JRKA 4S2BA 1I45A 1C9DA 5DBUA 1ICQA 1SO6A 3D0CA 2QF7A 1UUOA 1XBXA 3PBYA 4RZ6A 1F05A 4O0ZA 4DBEA 1SR9A 1B3OA 3N2XA 4BI5A 2Y63A 1JRCA 1RPXA 3SZ8A 3GR8A 5HNRA 1L6WA 3CIXA 3LHYA 4P2VA 2WO5A 5D2XA 3W71A 2VEIA 1MEWA 1QOQA 3W74A 1VLWA 4PA8A 3EB2A 5CZJA 4PC8A 1ME8A 2QJHA 2WSQA 4M5PA 3PWAA 4O16A 5CSSA 1OFPA 1XUZA 4NNCA 4LVDA 3TCEA 4TMBA 2J24A 2FB2A 2JKEA 2VFIA 1L2UA 2E6FA 3P8IA 3GNDA 2F84A 2I1OA 4CCDA 4Z1BA 3W87A 3GK0A 3DKJA 3VE9A 3PG8A 1ME9A 3L0NA 4TO8A 1OX5A 4NQ1A 3W7HA 3IGUA 3M7WA 3EX2A 5H2ZA 3W7PA 4GE8A 4QM1A 3W23A 1OX6A 3DI1A 5HWMA 2A85A 3EWWA 1IGSA 2J6XA 3WK3A 3GXPA 3BG5A 3A23A 4GC4A 3W86A 4GWEA 3NXFA 1TPFA 4O10A 2ZZ4A 1VPXA 1TV7A 1X1ZA 2Y62A 3EX4A 2B7NA 4Z1DA 1Z48A 5GVJA 5G1YA 1TPEA 3W7KA 1R2SA 2XFWA 1VYRA 4OHQA 2A1YA 2DZTA 2P1FA 3EWBX 1YXYA 4R34A 4WOZA 4UTJA 1DL3A 3O1NA 3BLFA 1JCYA 2OX1A 3PY2A 4UTLA 1LROA 1XDLA 4AEOA 1H5YA 1GTHA 2ZZ5A 4C1LA 1FQ0A 2CLOA 3MJYA 1F6KA 1B57A 4DQWA 3ELFA 1O5KA 1UCWA 3LLDA 5D38A 1VCGA 1H60A 4X2RA 1FCQA 2Y89A 3HMJG 3PR2A 3N9RA 3C0JA 5AHFA 3KVKA 1FWNA 1N55A 3W1MA 1QPQA 3O07A 3GZ3A 1I4NA 2HSAA 4S1FA 4HHPA 2X30A 3NQVA 1ML1A 4K39A 5KITA 1A5AA 1UJPA 4LY8A 4ONVA 4ORIA 4KWWA 5AOUA 3T44A 4DF0A 4K8HA 3FJ6A 3B0UX 4UNLA 3KAOA 3O6DA 2V2DA 1X6UA 4E38A 4GXMA 4GFSA 1TPH1 3NPXA 1EWEA 1ZENA 2WOQA 3CIWA 3S5NA 3W22A 1ZAHA 4ZQCA 2V8ZA 3O63A 3SI9A 4PH6A 5K2ZA 2NLIA 3HGRA 2V2HA 4LOCA 1YDVA 3BW2A 5D33A 3F1QA 3BG3A 4JTTA 1FWWA 3RMJA 4AAJA 4PL2A 4NU7A 3TC7A 3TQ0A 4AXKA 3E02A 1AK5A 1FXPA 1R2TA 2E6AA 3G1VA 1NSJA 2B7QA 3PS7A 3EWYA 3MP4A 4O8RA 3PG9A 4IMEA 4IMDA 1KA9F 2Y7FA 4WXZA 4BFAA 3NYZA 5ABTA 1ZHAA 3DU0A 4DO5A 1B9BA 1L6YA 1H7RA 3LOTA 3OEXA 3W7QA 3P62A 1EP1A 3DENA 3WJZA 4OE7A 3UY8A 4FNSA 2ZRYA 3NNTA 4FNRA 4N9CA 3LERA 1FX6A 4GNJA 2B4GA 3TW7A 3LRKA 5TQLA 5D09A 5LNVA 2QCDA 2ZZ1A 5AHNA 1Q6QA 5AFDA 1TV5A 5MHBA 1QPRA 3WJXA 4UFMA 3QQ1A 2NUXA 4NJHA 1U83A 1GEQA 3Q37A 1W5NA 3GVGA 2E68A 2QCNA 2BX7A 3CEPA 4UFHA 3M5YA 2NZLA 1I2QA 1BWKA 5L9FA 3GAKA 2CFFA 3W1UA 1QWGA 5I3JA 3HB9A 3W1TA 4BI6A 3OVQA 1YTDA 4XQ6A 3W1LA 4JX6A 4GRSA 3W70A 3TC6A 2ZTJA 2QJGA 3T4CA 3LHWA 3W88A 4MY9A 1Q6OA 3PUDA 4FF7A 2YX0A 4PEKA 3FIGA 3EX3A 5G2IA 1HO1A 3S1WA 1HUVA 4RX0A 1TPVA 3MI3A 1PHQA 4WD0A 5DCDA 5HMSA 3TXVA 1DQWA 5CZ0A 1Z41A 4L4MA 1JQVA 3I7RA 2DP3A 1GYNA 4XUGA 1TPWA 2YXGA 4RV8A 1HTIA 3NQFA 3OVPA 1T99A 3ABQA 3C61A 3R89A 3ZWSA 1LDCA 1J5TA 5CKSA 3KVJA 1K7FA 3PM6A 4AHPA 3MBFA 4ADTA 2WPBA 2YFNA 2BWGA 3TSMA 4H4IA 4O15A 2OCZA 1XM3A 3LHUA 3NL2A 3GLCA 1A50A 4MOZA 2NX9A 5K4XA 2QCDB 1VZWA 2VOMA 3LRLA 3NEVA 3O15A 1VC4A 2J27A 1EX5A 3UPWA 2A7NA 3C3NA 3PAJA 4UFKA 2D73A 1NAL1 4FNPA 1ZAIA 4OV9A 4GUGA 3TIMA 3CQ0A 1GZGA 1GVRA 1HFBA 1KTCA 3L65A 1JR1A 1H1ZA 1OJXA 2WQPA 2W0UA 3AJXA 5DELA 3VI2A 4MKNA 4ZQMA 3ABOA 4Z0SA 2E6YA 3W76A 3USBA 3CT7A 3O16A 4JS3A 3LHZA 3NAVA 3N14A 3VKJA 3UQNA 3G0UA 1W5PA 5DY2A 1VRDA 1EPXA 4G1KA 3GIYA 5FF4A 3TW6A 5HWJA 3C2EA 3SIZA 4FXSA 2Q3RA 3EWZA 5K9XA 1D3GA 1G4PA 4JYEA 3LCHA 5LHEA 3P5ZA 1O5XA 5F2LA 1RR2A 4JGDA 5SWUA 3LB0A 2BZNA 2NWSA 2C13A 3LDVA 2QR6A 1KBJA 1QMLA 3CB8A 5E93A 5FF3A 3S6DA 1GYLA 3BARA 2ZZ3A 1F74A 4O1DA 4N2YA 2TPSA 2FPVA 4IGHA 2HTMA 2YGYA 3NVTA 5CZTA 4NZJA 4IX2A 3W7EA 4JY9A 5DLCA 1SU5A 1KM0A 2ZFAA 4QSHA 3G1HA 5KMYA 2EHHA 1GWJA 2GQ8A 1KM6A 2C3ZA 1UUMA 1TSIA 4XTDA 4R33A 4RK8A 3N3MA 3LBCA 2VEPA 3KRUA 2Y70A 3KRSA 4CLMA 4LV9A 1DBTA 4ZVJA 4XKYA 4XWUA 1R2RA 4A22A 3GDRA 5CZSA 1GVOA 1KFJA 4HIBA 4S2CA 1GT8A 2VEKA 4O4WA 3UWQA 3MWAA 3W7IA 2YR1A 1OHLA 3S5YA 1SW0A 1HO4A 1W5QA 1WXJA 3W7CA 1PCKA 5F1UA 3UNDA 4EF9A 4YCPA 5CPMA 4HNTA 2ZRZA 1ICPA 4O12A 3GXNA 1W0MA 2PURA 4MFEA 1SZNA 2A0NA 5HWNA 3GXTA 3UWWA 1K03A 4WXYA 3TFXA 4MYXA 2Q8ZA 2FQIA 3RU6A 2VENA 3B0VC 2QCLA 2C15A 3IIOA 3FS2A 3FKKA 2CZ5A 3EX6A 4AF0A 2OZ0A 3UWVA 3EEGA 2LLEA 1JUBA 4D2JA 1UASA 5TBOA 3AO0A 4CNPA 4FNQA 3H53A 1XBYA 5D04C 1LCOA 3CWNA 4FHAA 4EVZA 1MXSA 1JVNA 2V2CA 3QQ0A 1THFD 5TIMA 1UB3A 2ABAA 2GPTA 1UBSA 3G1SA 2QEZA 1H7OA 1W5OA 4HT3A 1OYBA 4O0KA 4JTFA 2HMCA 2A21A 4NXSA 4Z1AA 1DQXA 1TCDA 3IIVA 3OA3A 3LHTA 1OF6A 5F4WA 3RFAA 3NL3A 1XL9A 3P61A 3TH6A 1L6SA 3SGUA 4JNMA 3DKLA 4OV4A 4PL1A 2NUYA 2H8XA 5AC7A 1FXQA 5I3IA 4I7VA 3BLEA 3W7DA 4J9JA 3O8AA 1LOLA 1OFEA 1OF8A 4AHQA 4NJJA 3T78A 1TJPA 2C6QA 3B04A 2A2IA 4N02A 4GUJA 3LRMA 2HS8A 3PBVA 1H50A 2DJXA 3HGOA 4TU1A 4OWGA 3INPA 3BW4A 5AHEA 3FA5A 1IIGA 5BOOA 1GTEA 5C2XA 3L5MA 3IVSA 4WUIA 2ISWA 3HJZA 5CPLA 3O6YX 3TFCA 4AF0B 3WJYA 1T96A 2V5BA 4YCOA 4A21A 4LS0A 1LLZA 3M5ZA 4LUIA 2GUUA 1SO3A 1RV8A 4QNEA 2X1UA 3A21A 1EA0A 3STEA 1TRIA 3UWYA 1XKYA 2X1RA 3QZEA 3THQA 2CLKA 3N34A 3G1AA 4AVFA 3FFSA 2WKJA 5BMWA 1FCUA 1KLYA 3F03K 1X8FA 3DFOA 4JR5A 1G7VA 3O6CA 3ZS4A 4ZQPA 1X1OA 3PUOA 5BRBA 1DOSA 3S1UA 3KXQA 2DZVA 2YDAA 3TAKA 3NPUA 5AYYA 3NPWA 2JK2A 1TMHA 1MZHA 2G97A 1NVMA 3ATYA 2B7PA 1GPWA 3PBWA 4LVGA 2DJLA 3LV6A 1JCMP 1WAUA 3PB0A 4JICA 4JIQA 3EXTA 2QCHA 1D9EA 1LYXA 4JDYA 1GG0A 2C1HA 5EKYA 3EKZA 2PRHA 3NQAA 2AQWA 3C52A 1LM1A 4K37A 3DBPA 5G1TA 5K4ZA 2QDHA 1LOSA 3CPRA 3HG3A 1WBHA 1I2PA 2JGQA 5K3VA 4RR4A 3TQVA 5CGQA 1JCXA 1TTJA 3M44A 4QAIA 1OFDA 4UTHA 1M7PA 5LNUA 4YXGA 2Y88A 1K3UA 3C56A 5LHFA 1KFEA 3DFQA 3G18A 3G24A 1M7OA 4WX2A 1LLWA 3S42A 1ONRA 5D2WA 1FDJA 1H63A 1W54A 2ATMA 2C14A 2GVLA 3HO8A 2QKFA 1S5WA 5D30A 4RJEA 2QAFA 4Z08A 1NEYA 3TR2A 4QNWA 1GVQA 5G5IA 2E1DA 3KVMA 4NX0A 1B4KA 3CC1A 3OBKA 4UNKA 4NNAA 4P61A 4NXKA 1BWLA 3W84A 1O95A 3GX9A 3TSDA 2EPHA 4HNUA 4AHOA 4RZ4A 1TO3A 3G1FA 4NUWA 3QJAA 4LV4A 5I3GA 3LCFA 5C54A 3CU2A 4N9DA 3E0IA 3S1XA 4JY8A 1IXNA 3ZWTA 3RLUA 3QSRA 5G2WA 2OJPA 7TIMA 1TYGA 1B4EA 4FX8A 2VEMA 3P82A 2QCFA 3C2VA 4ZQOA 5E1QA 3TX9A 2VFEA 3HPSA 3P60A 2BSLA 3L0GA 4MY1A 3FOKA 5AYZA 1A5SA 3IVUA 1SQ7A 1QNVA 4JTEA 4PODA 2G5WA 4JTGA 4U4MA 1VCFA 1IF2A 3MMTA 4UFJA 4XZ9A 4UTMA 1OG0A 3NQ8A 4X9SA 4UTKA 5A8GA 4IMGA 1DVJA 1TQJA 2J9XA 3EKLA 3W2MA 1P5BA 1F7BA 2I14A 2W6RA 1Q3NA 1IXQA 3E9AA 1Q6LA 1OK6A 2YPIA 4ZQNA 3VNDA 1SFLA 1OFRA 3W7RA 1GJPA 1A5CA 4TIMA 3NQ6A 1RQEA 4PCFA 2Z6JA 3NZRA 5EL1A 3IEBA 4O57A 3BK0A 2P10A 5IM51 1N7KA 3MHFA 3I7SA 1RZMA 3A9IA 3QEZA 3R5EA 2VFHA 3ZFHA 2YYTA 3TSBA 1SZEA 2OT0A 2ZRVA 1VYSX 2C0AA 2IQTA 4O1BA 3EXSA 1F2JA 2ISSA 2RHGA 2BXVA 3BPWA 4X22A 5G4EA 2CW6A 3ATZA 1LOQA 3GKAA 3NQ7A 3W1NA 5I3KA 5AN7A 3VE7A 4TMCA 1LP6A 4Z0JA 4A3UA 2CLMA 2B0MA 4MZ1A 3S0CA 1YYAA 2DZSA 3U8GA 4M19A 1H7NA 1SFJA 1FWRA 2GOUA 3NZ1A 1EB3A 3MYOA 5CSRA 1O4UA 2GQ9A 5HULA 1DHPA 2WJZA 3LM7A 1DKWA 4AB4A 4X3ZA 1LZOA 1TTIA 1LTDA 3NPVA 1BKSA 3DFTA 5F2IA 1QCWA 4A29A 1YPFA 2JKPA 4AWSA 1LORA 3R2GA 3MYPA 1AW2A 1K7EA 4CQAA 3W73A 2QCEA 5EY5A 3B0PA 5D03A 4DEFA 1XBVA 3L67A 3NM3A 3LTPA 4AH7A 2R94A 1KM4A 1RQHA 1TREA 4O18A 3W7LA 4N9BA 2ZZ6A 2V82A 4K38A 1KFCA 1JCLA 4JYDA 4RLIA 3DFNA 2C18A 4O14A 3A5VA 4NT0A 5K9DA 5LKYA 3N9SA 3L0KA 2I9EA 3FJLA 1W3TA 3G22A 5IBXA 2GVGA 5EMUA 5CPOA 4Y8FA 3KHJA 4FX6M 3RK8A 2VELA 4O11A 1VYPX 3B03A 4M7SA 1QOPA 4IJBA 4NZFA 2B7OA 2QAPA 4Y90A 3WK2A 1CX9A 1KW1A 1L9WA 1YDOA 3W07A 3TXZA 3WJSA 1PS9A 3M41A 1NF7A 2WSRA 4L4LA 1EP2A 1G7UA 4H3DA 5LNRA 2ZRXA 3UZJA 3THAA 3BO9A 3DHDA 4DPPA 3W2LA 3BLIA 5D2TA 3UD6A 1ZFJA 3EWXA 3CEUA 4MVAA 2O7QA 2W79A 2EAWA 4DF1A 1RQBA 3B06A 4QJ1A 3TA6A 3W75A 3Q58A 3UZ5A 4YWIA 4PTNA 5IBXC 2CLLA 1OX4A 1JJKA 4MPQA 1CW2A 2YCEA 3LXAA 3C6CA 3GDTA 3P67A 4LUJA 4ADUA 3ABSA 1EIXA 2GVJA 1PCWA 1OVDA 2PCQA 1RVGA 5KZMA 5CPNA 2OT1A 3W85A 5LSMA 4HKPA 3QMRA 3EXRA 4FNTA 3HPZA 3QPYA 1TPC1 1V5XA 3O05A 1WX0A 1FDZA 5G2HA 1JCJA 4RCXA 3DI0A 4JD4A 4JTIA 3LCWA 4Y96A 5H91A 2KZHA 4HPJA 4DO6A 3QSTA 4N9EA 2DU2A 5DBTA 3LCXA 5K7JA 3UWUA 3OHIA 4YLWA 1WDWA 1P1XA 2QCGA 5AHIA 1JCNA 5FF0A 3N2MA 3STFA 1TQXA 3GDMA 4FEZA 2PRMA 4RZ5A 3TKFA 2PRLA 3IRDA 1WV2A 1G67A 4LNYA 1VR6A 3E96A 3SY5A 1MEHA 3MW7A 3C8FA 1GOXA 4UC5A 1DORA 2ZBTA 4IXXA 1W31A 1NFBA 3BW3A 1OX4B 3A5FA 5D37A 5AB3A 3KOFA 3QFEA 2FFCA 3CWOX 3S9YA 5D32A 1LBFA 3W7MA 1LBLA 3WK0A 4R7JA 4O4VA 2H3BA 2CU0A 3ZR4A 4IPJA 4IX0A 3GDKA 5HR7A 4HPXA 1W5MA 3LI0A 1YPIA 3GAYA 3R12A 2Z0IA 4H6KA 3G8EA 1F76A 1W8SA 1KLZA 2TRSA 4LT9A 4C1KA 4HNVA 4N4PA 4O13A 4POCA 4LS1A 4MLJA 5FEXA 3QC3A 1M6JA 3B4UA 3IIPA 3W7NA 5KSWA 5HJLA 2AGKA 3ANYA 3C4UA 3PVFA 4I7WA 4GUFA 3P5YA 2YW4A 2UV8G 3L5LA 1YTEA 2CZDA 4IMCA 2QUVA 1TV8A 1YXCA 4Z1CA 3TDFA 3OVRA 3LGEA 2Y61A 4ADSA 2Y7DA 3S5OA 2R14A 5KZEA 2V0TA 2TYSA 5L6UA 2RH9A 1KTBA 4OU1A 3IVTA 3T55A 1PIIA 1P0NA 2YSWA 2YYUA 3LBMA 1JUKA 3QM3A 4O54A 2ISVA 3G1YA 1T0OA 2JBMA 4JIPA 4CCCA 3PB2A 1I2OA 2A7PA 1LRNA 3VFLA 5LZLA 1SZGA 2VKZG 1EUAA 4CQ9A 3T7VA 3PSVA 3LXCA 1OFQA 1TIMA 3NQGA 5U4NA 3SGZA 5DN1A 2ZDRA 5I3FA 4GUHA 5BMXA 2R91A 2DORA 1QPOA 3FLUA 5F2MA 4MUZA 4NJIA 3V1PA 3TAOA 4ICNA 1DJNA 1OFOA 3PSWA 1TJRA 2EGZA 1U5JA 4JTKA 3HBLA 2FB3A 1WOAA 1ME7A 1VHNA 2TMDA 1X7FA 4K7VA 3OG3A 3E49A 5AC6A 1YXDA 4QIUA 3NQCA 3HPXA 2E09A 5A5WA 3G0SA 2QCMA 2PC4A 4DPQA 2ZZ7A 1XDMA 2J9YA 3STCA 3TV8A 4Y9AA 4Q4KA 4JX5A 2Y7GA 4JEQA 4DXVA 4WJEA 2FJKA 3SR7A 3UYCA 3TNOA 1I2NA 5FESA 4WY0B 2WNNA 4JTHA 1VGAA 3M16A 1W37A 3M9YA 1K8XA 5F2GA 2PE4A 5EYWA 3MUXA 4MYAA 1SUXA 4O1AA 3STGA 3W72A 4MIMA 1KTNA 4O52A 4TR9A 2OMAA 2A7RA 4JDBA 4UMAA 2CLIA 1VHCA 1G4EA 2DZXA 2JGYA 6ALDA 3EX1A 4JTJA 2HS6A 3I65A 4AMAA 4QISA 5C6MA 4BWLA 1AW1A 5LNWA 5FEWA 1P4CA 3NL5A 4HSOA 1GQNA 5BNKA 1H62A 1W3NA 4LU0A 4MJMA 3DFSA 3KRZA 1QAPA 3PC0A 3KX6A 4O1CA 3W2UA 3WJWA 3GR7A 3M5XA 3JS3A 1VCVA 4UCGA 1BEUA 2V9DA 2XN1A 5C55A 2QUUA 4GJ1A 2Q8LA 3W1QA 4UMCA 3UXDA 1HL2A 1IXPA 2NV1A 3NOEA 1KFKA 2Z1BA 3HG5A 1S5TA 5EA9A 1MO0A 3W83A 4QQ3A 3U6WA 4Y6GA 5F4XA 2ATSA 1Q45A 3R8RA 3M47A 1OFBA 4BWLC 2VC6A 1G6CA 3MI6A 4YL2A 3UY7A 3W1PA 4WQ6A 4BI7A 3C2RA 1RD5A 2WSYA 5DXXA 4FIQA 3CHVA 5CG7A 2J88A 3QMTA 4K8EA 1TPDA 3HGJA 1CI1A 1LRTA 2RKXA 4N4QA 3IV3A 3NQDA 4IPIA 3DXIA 1VJIA 3S1VA 4B5NA 4EOUA 1KFBA 2NWRA 1H7WA 3ABRA 1JRBA 4JTLA 1AW5A 2Q3OA 3W2NA 3WFAA 2ZA3A 3W9ZA 3I7QA 1WBJA 1JQXA 3HF3A 3LCIA 2E5DA 3M43A 5LGXA 2YW3A 4FO4A 1XXXA 5DCBA 1KM1A 2RDWA 1QFEA 2YZRA 3W1XA 4Q33A 3P81A 4O19A 2NXGA 1SSDA 1H1YA 3W7GA 4JN6A 4LVFA 1TPUA 1NF0A 2F7FA 4BF9A 4GUIA 1C29A 2GJNA 4TX9A 4HNNA 2CLFA 2V30A 4IUOA 2A4AA 1VS1A 4LVBA 1H51A 5LGZA 2ZA1A 5G4WA 3L5AA 3MP5A 4FB7A 1H7PA 4ML9A 4ZZ9A 3UPBA 1ALDA 2FIQA 1W1ZA 4E0CA 1DV7A 2X1SA 3PUEA 3CTLA 1ZNNA 2NX1A 3KFTA 4UTIA 4EIVA 4DBDA 5K9CA 2VXNA 2Z2UA 1AMKA 4UIOA 2NX3A 4R53A 2ZYFA 3PBUA 3BVJA 1VQTA 2ZZ2A 4NNBA 2QCCA 4FNUA 1SW3A 4KFNA 1H61A 1ZCOA 4JTSA 1FWTA 4LW7A 5KINA 2V81A 2QUTA 2CZFA 3TROA 5HR6A 4EWND 3G1DA 4OBTA 3WK1A 5EBUA 3G1XA 2BLEA 1ZJIA 1FUYA 5E0KA 1LRQA 3FEMA 3LXBA 3TMQA 2YFOA 5HQEA 1SO4A 3RF9A 3S8HA 5AYXA 1V7YA 4UFLA 1WOBA 3NR0A 5FEPA 3BGJA 3H54A 2A6LA 3L9CA 3QW3A 4BR1A 4O50A 4U28A 2NV2A 3LTYA 3L2IA 1TRDA 1A5BA 1FBAA 1D3HA 1SW7A 1PV8A 2P0OA 3DGRA 1Z44A 3IIZA 3NO5A 4WOQA 3Q2DA 2FTPA 1QO5A 4MLRA 4FX7A 2E5CA 5D2YA 3OIXA 2ZRWA 5D2VA 3TJXA 3TMLA 3SW6A 3W3OA 2FPTA 4RXGA 4MZYA 2Y6ZA 3NG3A 4OQVA 4CNNA 4W9TA 3RLVA 2WNQA 3B05A 5F1VA 2DZPA 3TJLA 1QR7A 6TIMA 3NM1A 2WNZA 3F4NA 4M6VA 3QW4B 4JX4A 4K7YA 2CWNA 4I7UA 3CM4A 3HOJA 1KV8A 3W1AA 1FDYA 1N8FA 1E51A 1ZALA 4NVTA 1Z42A 3DZ1A 1K8YA 5LNSA 5FEZA 2RDUA 3H55A 3T40A 1ZY9A 4YMZA 3VCRA 1OYCA 1YTKA 4RXFA 2C19A 4LC6A 1AL7A 1P0KA 3K30A 1KM3A 2GJLA 4AWUA 1PL9A 4MFDA 1VH7A 1J4EA 3TQKA 1WQ5A 3NQMA 4IXHA 2A6NA 3P7YA 2XN2A 3LCGA 4M7TA 5I3HA 3FYPA 5U7SA 3W2KA 4MJZA 2QDGA 2G96A 2V5LA 1HG3A 4LWWA 5FF2A 2ALDA 3MI2A 2Y85A 2QJIA 4ZL1A 3CLMA 2BTMA 3W7JA 1OK4A 1YLVA 4KFPA 4HSNA 1BTMA 3GNNA 4MY8A 5C5YA 2H8ZA 3QF0A 4ORMA 4DF2A 3LTSA 1SZFA 5BW6A 4RKAA 3DH7A 3SSJA 3L66A 1W56A 3O06A 3QPZA 3NDOA 4IMFA 1W3IA 3IGSA 2H3DA 3W2JA 3DAQA 5AC8A 2FPYA 4N6EA 1A53A 3QH2A 4Q32A 3C2FA 2X1TA 1S3HA 3JR2A 4LS2A 3MHUA 1OABA 4LRSA 4LVAA 1C8VA 5D05A 2E5BA 3TE9A 3BGGA 4KWVA 4CQ8A 1KM2A 3E12A 3P80A 1TTPA 5DCEA 5EPDA 1G4SA 4WZHA 4N6FA 1QPNA 3KVLA 4LTSA 1F73A 4UR7A 1J2WA 2DZUA 3HG4A 1IXOA 2NUWA 4UTWA 4CNOA 1KV5A 2H6RA 3FYOA 3RNDA 3QYQA 2G95A 3LCLA 2ZQ0A 3UXAA 1QO2A 3EWUA 3MBDA 1O60A 1F6PA 2X16A 4JYFA 2EF9A 1DJQA 3M0ZA 2RFGA 4CCEA 4FIRA 1XFBA 4BK9A 2AAMA 3U2OA 4IOTA 4WY0F 3YPIA 2E77A 3N19B 3LHVA 3PF3A 4UMBA 3NQ2A 3V75A 3W1RA 1XCFA 4LRTA 4JXCA 4KFOA 2ZRUA 1XC4A 3TK7A 4XTIA 4NJKA 1TTQA 4XBSA 4LC8A 3HIJA 3L21A 4E2BA 1XBZA 2WV8A 3IGXA 4UTWC 4EF8A 3TUUA 4A2RA
chains in the Genus database with same CATH superfamily
2HCVA 3TTEA 1G0CA 1G4TA 3A3HA 3QMSA 3HGSA 1FWHC 3LI1A 3L4YA 4Q4QA 4AUBA 3AUJA 4C7DA 4WDXA 2VZSA 4Q4PA 1B3WA 4CN6A 5KTLA 4O17A 2CLEA 1LBMA 2DZWA 4AD4A 1HW6A 3LV5A 4HP5A 4JTUA 4UFIA 1FCVA 1SO5A 1RBAA 2CNCA 3L4XA 2RGLA 1BGAA 4ZO9A 4E2DA 2OU4A 3T6CA 4UUIA 2J9ZA 3B8DA 2ZTKA 4GIAA 3R13A 3LYEA 5EB8A 1EJ7L 3EOUA 4MZ8A 3A4AA 4YVPA 3QV7A 1DE6A 2ACRA 3REQB 4W84A 1AA1B 3NGJA 2DUXA 1S2CA 2BGQA 2RDTA 3Q65A 3I6RA 1GVFA 1S1RA 1S5VA 3MUIA 5AHMA 3FSTA 2W62A 4XKYB 1Y0EA 1PVNA 4TX8A 4EE9A 3MT1A 5J5RA 2IW0A 4I9AA 4JFVA 3IK2A 1IR1A 4W85A 2Z6IA 3ANUA 3U0HA 4Q4MA 3A9BA 3G0XA 1TVPA 1UR4A 4HA0A 1FWSA 2CBUA 3G3MA 2XG9A 4QJ5B 1FY6A 1O94A 2VFDA 2J66A 1CEOA 2VFFA 1DWAM 3TTQA 4CD8A 3M1ZA 5HUOA 3IAQA 2ZADA 1XP3A 3CO8A 5HDRA 3D47A 3FW6A 1AQMA 2CZEA 5LXXA 4K6AA 1QNPA 1ADOA 1YDNA 4JNYA 1XGZA 1DJWA 2D2HA 4DM2A 8A3HA 1WA3A 3P2VA 1G69A 2FDSA 4R7OA 1G01A 3P84A 2IMRA 1EHNA 1FH7A 3A24A 3HG2A 2OEMA 4UR8A 3ARPA 1FVPA 4GX8A 3QPEA 1UPPA 1T8XA 1JUEA 1F4HA 2XVKA 1XUUA 5CQ1A 3VMOA 3TJ4A 3FKRA 3K13A 1KRBC 4C65A 4JNZA 3IWPA 5CH9A 3BTNA 3N73A 4CN4A 4JFTA 4CVUA 4H9UA 3L4TA 1JPDX 4XD3A 1HGYA 4OOUA 2ZXDA 1IT7A 2F8QA 1DTUA 1UUOA 2D0GA 5ABEA 2UY2A 1SR9A 4LUSB 1BYAA 1XYZA 3GR8A 3I6EA 3LHYA 4PULA 4P2VA 2WO5A 4IICA 5A2CA 1MEWA 3S83A 3W74A 3LZ5A 1NOUA 3QN3A 4ENLA 4W87A 2OEKA 4E3TA 4M5PA 3WENA 3TCEA 5CPQA 1E6NA 2WQDA 1L2UA 3E3HA 3P8IA 3GNDA 3GK0A 2G50A 3PG8A 2VQTA 4MKSA 3RAOA 1ME9A 3QQWA 2DV0A 3IGUA 1EH9A 3UPMA 1QK2A 2E8ZA 5AC5A 1OX6A 3DI1A 2NV9A 2GFTA 3ITCA 1PWLA 3CL8A 4GWEA 2VC5A 5DF0A 1PKMA 1IZKA 2ZZ4A 4JCLA 2VDIA 1JDFA 3B0YA 3EX4A 2V67A 4GVIA 1Z48A 5G1YA 3W7KA 1E9ZB 1Q65A 3B8UA 1JCYA 1JAEA 4UTLA 1LROA 2POTA 5KZ6A 4DJDC 2ZZ5A 1FQ0A 2CLOA 1VFTA 5BWFA 1MFUA 1B57A 4DQWA 1Y7VA 4C90A 1UCWA 3NIYA 1HQTA 4AD5A 4ZTYA 2J13A 3CBWA 1Q7MA 1PZ1A 1P0DA 5AHFA 3KVKA 1FWNA 3OZPA 2WZMA 1QPQA 2HSAA 2OKOA 4HHPA 1VENA 5TF0A 1K6WA 3GRIA 4FI4A 4MWAB 4M3PA 3UXLA 3OO2A 1YNQA 2V3DA 1PTAA 1QJWA 3VKKA 1GGOA 2CHOA 2V2DA 3I3DA 3WQCA 4E38A 3QYSA 4GXMA 3EWCA 4DZHA 1WUEA 1ZENA 2WOQA 3S5NA 3T05A 1ZAHA 3W22A 1A5NC 5K2ZA 2DT3A 3AZTA 5D33A 3BG3A 5A2BA 4AAJA 4NU7A 3TC7A 3OLGA 1AK5A 1FXPA 3QKZA 1L2QA 3SUSA 2OO6A 4IMDA 1KA9F 3LD5A 4GK8A 4MJ2A 5JH1A 4WXZA 4HTBA 1L0PA 1OC6A 1ZHAA 3DU0A 4DO5A 1WKYA 1EP1A 3LG3A 4B3KA 1XV8A 1TMLA 2WMFA 2OKTA 3NZGA 2XGBA 2O0TA 1PDZA 2EPLX 5LNVA 4JQ1A 5AHNA 1GJWA 1Q6QA 5AFDA 4JTRA 4QROA 1W5NA 1MRQA 4S3KA 3AMLA 2YJQA 3UJSA 4PB3A 4PE8A 3M5YA 4ZO8A 4CKQA 4AZ6A 4GYKA 3TLQA 3CHDA 5DRCA 3W1TA 3IGHX 3OVQA 1YTDA 1Q6EA 4RE2A 3W1LA 4IZGA 3CV2A 4JX6A 3SDOA 2RAGA 2ZTJA 1TKKA 3T4CA 4MY9A 5CSYA 3E0LA 3FIGA 5CGMA 5G2IA 1LWIA 3VMNA 1HUVA 3A64A 2HQAA 4AIBA 1EBHA 5HMSA 3TXVA 3CYVA 4AISA 3VIHA 3I7RA 2DP3A 1OGSA 4XUGA 2REQB 1HTIA 4PUDA 2J7DA 1T99A 3C61A 3IJ8A 5IOBA 3AIVA 3ZWSA 2R82A 1J5TA 1RPKA 1KFWA 5CKSA 1WDPA 3ENLA 4AHPA 3FK4A 1TZ7A 3MBFA 2WPBA 3ME3A 2HEJA 3GW0A 5H8MA 1XYCA 3V1HA 3LHUA 4HMNA 3GLCA 2UWFA 4Z42C 1VZWA 2VOMA 5JH2A 5ENLA 3SRFA 4GA8A 3AC0A 3NEVA 4EX4A 3UPWA 2D73A 4V33A 1NAL1 3XINA 1HJVA 3E74A 3K8LA 4FNPA 3CQ0A 4AEEA 4ZCWA 2J77A 5FA5A 2OB3A 2PP3A 4GGBA 5E6YA 5DELA 5T9CE 3VI2A 2WLZA 3ABOA 1S2TA 3BJSA 2YXOA 2NQ9A 4AIUA 1TMQA 4I8YA 3LHZA 1UD8A 1FHVA 3DN5A 3UQNA 3ZMRA 4IM4A 3GIYA 4IFKA 5HWJA 1UKPA 4H01A 2Q3RA 3D6NA 4RE3A 2XVGA 5LHEA 1FRBA 4GG9A 3P5ZA 4IF2A 3HJEA 1RR2A 4HB7A 5FSDC 2V38A 4D6GA 3LDVA 1VFLA 3KBVA 4PRRA 3CB8A 4H00A 9CGTA 4KQNA 1OM0A 1EDQA 4O1DA 2TPSA 4MB1A 2OFJA 4MAZA 4IX2A 3M46A 1ODZA 2AKMA 4XSMA 4U3AA 3M64A 3AHYA 3TYEA 1XLJA 2DVUA 1GWJA 3OLIA 1KM6A 3ITOA 4CD7A 6REQA 1TSIA 4XTDA 4CU7A 1K4GA 4RK8A 4WRHA 1XPGA 1KBLA 3KRUA 1EXBA 2Y70A 4CLMA 2E1WA 3BSGA 2IS7A 4LF1A 4A22A 2VRKA 2VGIA 2VEKA 4O4WA 1V02E 3W7IA 4I6KA 4K68A 1OHLA 1HO4A 1W5QA 1WXJA 1ZZMA 1FWFC 1PCKA 3UNDA 4J35A 2PSNA 4MFEA 1K03A 1V77A 1J2BA 4IPLA 2C15A 1V03A 1Q2RA 3BLLA 3EX6A 3WBAA 4U2YA 4AF0A 1AD1A 1GVEA 1JUBA 3KL5A 4X9YA 2PDKA 4FHAA 5I78A 3HQNA 2V2CA 2XYLA 3V18A 1D2KA 2GPTA 1UBSA 1V3JA 3WEMA 9RUBA 3LEPA 4HT3A 1EO5A 3ZOAA 3OU8A 4Z1AA 2FGLA 1XD0A 3N4FA 3LHTA 4ZOEA 2QYGA 2PTWA 3NL3A 1DYSA 5HQLA 1XL9A 1XH2A 3DKLA 4PL1A 4WHBA 1FXQA 1GW9A 4KPLA 3UEQA 5DMLA 4I7VA 5E70A 2ASHA 1BVNP 1OFEA 1A47A 4C6IA 3URBA 3UG4A 4NJJA 3RITA 4LX4A 3TWAA 3T78A 3B04A 3GM8A 1HKKA 4N02A 4Q8NA 3ZVHB 4O1EA 3LRMA 4IMAA 2FH6A 3AS3A 1OT2A 3OHMB 4GVFA 1JD7A 1BTCA 4TU1A 2HRWA 3INPA 3BW4A 5BOOA 5C2XA 1V3HA 1ZGDA 4IISA 2ISWA 5CPLA 5AY7A 4PMXA 3TFCA 1UBPC 3APTA 1EGMA 3CUJA 3WJYA 3OODA 4DWSA 4YCOA 4LS0A 3NCOA 4GO8A 5A6SA 1W3HA 1SO3A 2X1UA 5DRIA 1IEWA 3ARRA 3G2GA 4QAWA 3WH6A 1XKYA 3QZEA 3R0KA 3VOGA 3TN3A 3G1AA 3TC3A 4J40A 3FFSA 3CT2A 5BMWA 1KLYA 1XLDA 3F03K 2XU2A 1V6UA 2BHYA 2FKPA 4JR5A 2VX5A 3ZS4A 1X1OA 1NWUA 4YJ5A 4XV0A 4Q7BA 2OQLA 3A4WA 3I3EA 4WJ8A 3SRHA 3M0LA 3F4VA 4ACZB 3F4DA 3NPUA 5AYYA 1VFFA 4ZR8A 3GUWA 2Y8KA 1TMHA 2VEGA 4FLRA 3DESA 3NWRA 3EDFA 1ZCCA 4HZ7A 1VBGA 3DDMA 1JCMP 1CXKA 4L4OA 2J7EA 1Q66A 3QY6A 3UGRA 1DWHM 3NQAA 4D6HA 3C52A 2F6KA 4K37A 3DBPA 3EMQA 5G1TA 2IPJA 1PJ9A 3PTMA 5D9MA 4HCLA 5CGQA 4LCSA 1M7PA 4UQCA 4LNCA 4PMDA 2O55A 4IPNB 1K3UA 1E1FA 2OEJA 5LHFA 1C8YA 3DFQA 3DERA 5A6JA 3G24A 1M7OA 1Q8AA 1LLWA 1YBQB 5D2WA 4ZFCA 3I10A 1H63A 2C14A 3HO8A 2HVMA 3BCJA 4P7RA 4RJEA 3TR2A 4MWAC 2ZXBA 3DYOA 2HE5A 4U2ZA 3SQSA 3VAVA 1V51A 1BRLB 4UNKA 1XH0A 3W84A 2V68A 4YTRA 1A0EA 2EPHA 4AD1A 3G1FA 4NUWA 3IJQA 3CUZA 3QJAA 5AZ1A 1XLKA 3LCFA 5C54A 2UZ9A 3SN1A 1SJAA 1WDDA 3S1XA 4JQ4A 1LQAA 1IXNA 3BOLA 5I79A 1RCOB 3RLUA 2XH0A 2OJPA 7TIMA 2WCAA 4FX8A 3PANA 1MDLA 3T0BA 4XKMA 5AECA 2F2HA 3P60A 2BSLA 3NJ3A 3FOKA 1A5SA 3MO4A 4DYJA 1RP9A 5CPTA 4W8AA 2G5WA 1VCFA 4NRSA 4DWSD 3MMTA 4UTMA 1XIEA 3NQ8A 4P8XA 2X7WA 1NWSA 1R3QA 1TQJA 2J9XA 3E0FA 3ARYA 1P5BA 2XFRA 2I14A 3E9AA 5CC6A 2IPWA 1OFRA 1MFVA 1D8WA 4IIHA 1GOWA 5BCAA 2OYMA 2PGEA 5M3WA 1W1YA 4M6UA 5JXQA 5EL1A 3ES7A 3IEBA 5IM51 5HPOA 3CH0A 3AFBA 5REQB 2X8RA 4TOQA 4LAOA 3SRKA 1ZPTA 5LIXX 3LN3A 2ZRVA 2OT0A 2ISSA 2F6UA 4KWUA 2RHGA 1JI1A 2BXVA 4X22A 3SN0A 2YA0A 2CW6A 1BPLB 2PGWA 3U5UA 3MMDA 5AN7A 3WLOA 2CLMA 1Z3NA 1GKRA 1KCXA 2B0MA 2DZSA 3U8GA 3ZLFA 1YPXA 2GOUA 3NZ1A 1YKWA 5HULA 3LM7A 1QNQA 4N7QA 4MF4A 1CGVA 1LF1A 5C9RA 3WLHA 1MVYA 5C9XA 4CD6A 1QI4A 4KGJA 3KBJA 4A29A 1ZBVA 4AWSA 3R2GA 1K7EA 4CQAA 2PC8A 2P88A 1EJVC 5D03A 1M7XA 1XBVA 1HL9A 3L67A 2KX9A 1JNDA 3SN4A 3K5XA 1JGMA 3VA8A 1RQHA 3ZLGA 1VEOA 4N9BA 4AX7A 4JYDA 5LA2A 2ZX8A 2VQUA 3PTQA 4O14A 5J8LA 3N9SA 2P0IA 1UPMB 2I9EA 2ZVIA 3WQ5A 3G22A 4ICMA 2GVGA 5CPOA 4Y8FA 3O0KA 1GQJA 3KHJA 4FX6M 1GW1A 3N15A 1VYPX 4BKNA 4Q7IA 4W88A 2QAPA 3B8IA 3LPPA 1T7LA 3VGFA 4G56A 4Y90A 3WK2A 1K1DA 3UCCA 1TELA 3GU9A 3UT0A 2ZOXA 4F0LA 1LUCA 4L4LA 4AD0A 1CLXA 2ZRXA 3SURA 3IS4A 3THAA 3BO9A 3DHDA 4DPPA 4GCAA 3UD6A 1FP9A 1I75A 1QW9A 4WIWA 3CEUA 4MVAA 3WDJA 4H7ZA 4DWDA 3B06A 2PDGA 3WD0A 5C70A 4EPBC 2FDMA 4H04A 1A3WA 4YVVA 1JJKA 1CW2A 1W17A 3C6CA 1MW3A 4NAEB 1E72M 1AFSA 4S3CA 3ABSA 5JMUA 1PCWA 3OA5A 2HJPA 1OG6A 1JZ4A 1GZJA 5CPNA 4KS0A 2OT1A 3A3XA 1E6ZA 3C0LA 2XIIA 2XPKA 3KW3A 3HPZA 3QPYA 1V6XA 1UKQA 3O05A 1EDGA 3RPTA 4HMDA 2GDVA 2P5NA 1FDZA 1NDWA 1JCJA 2WC4A 3DI0A 4JD4A 1R7AA 1V3KA 1S1PA 2KZHA 4IHCA 4HPJA 8XIAA 2IPGA 1OQFA 4N9EA 3CUHA 5D9PA 2Q02A 3LCXA 1TVLA 3UWUA 2I5GA 4KRTA 3OHIA 3MA8A 2QCGA 4HOXA 1UJQA 1XYAA 4W5ZA 1JCNA 2PAJA 1XGDA 3I4EA 2F2KA 3L4VA 4FEZA 2YDQA 4LNYA 4GQGA 1B90A 4BF5A 3C8FA 1GOXA 2WK2A 1DORA 4YNGA 1NFBA 3BW3A 4A8NA 1EEXA 3WLKX 1MWOA 3P3BA 4YTTA 5D37A 3KOFA 3QFEA 2FFCA 3S9YA 3DC0A 4IH3A 1UC4A 4XZIA 3WK0A 1US2A 4PEEA 3FYYA 4S23A 2PBGA 3AIRA 3JVAA 2CU0A 3B0XA 3ZR4A 4JIRA 3WG6A 1W5MA 1LQ2A 3EEZA 2VL4A 3HZ3A 2Z0IA 4H6KA 2AMGA 3G8EA 1W8SA 1M01A 1Z8AA 2TRSA 4ERAA 1N82A 1XRSA 3CL7A 3F2BA 3U4AA 5FEXA 2BBFA 1K9TA 2PU1A 3CTTA 4I7WA 3VD9A 4GUFA 2BMBA 3P5YA 3BV7A 2PDMA 1LWJA 2UV8G 1MDRA 1OIMA 1DWJM 4HSHA 2GGIA 2X7VA 4IMCA 3NSNA 3HA1A 1KGXA 3OVRA 1XHGA 2ZVRA 2Y7DA 5BYWA 4IL2A 2R14A 2PDJA 3M0KA 5KZEA 1KTBA 4ZENA 3IVTA 4WGXA 3LBMA 1T0OA 3H6OA 4ZOAA 1R9XA 5LZLA 4B5SA 1XIHA 3PZUA 2VKZG 2WZTA 1RK6A 4QJ3B 4F0SA 1AD4A 5U4NA 1EF2A 1E3XA 2V5KA 2ZDRA 3OGRA 4PB5A 3CAWA 4DBSA 3TAOA 3DCPA 5CXPA 3CZGA 1DJNA 2VWSA 2VHLA 3CQJA 3PSWA 3C5QA 2A3HA 2GYIA 3HBLA 1N8WA 2R1MA 3GTIA 2TMDA 4D6DA 4K7VA 2GJXA 1XIIA 5GNYA 3KOWA 4Q6JA 1YXDA 5PTDA 4ZE4A 3NQCA 2OZTA 3QVQA 5C7VA 4JHMA 1JXJA 1UYQA 2BFGA 3RDKA 4RV3A 4JEQA 4DXVA 3CHFA 2FJKA 3SR7A 1I2NA 4NZ3A 5FESA 1H09A 4IL0A 5A6MA 1W37A 3F2CA 1I9CB 1KD0A 3CUGA 4Q7NA 3KP0A 4O1AA 3S46A 1TIWA 3STGA 4XO6A 4MIMA 3B8WA 5EFFA 1MQRA 3TA9A 1WXYA 1YE4A 3TWBA 2DZXA 2JGYA 3RJXA 4AMAA 4XX6A 5C6MA 2YBVA 4AW7A 3VIKA 4M51A 5B7YA 3NL5A 4HSOA 1GQNA 4HGXA 3DFSA 3KRZA 5A6LA 1QAPA 3W2UA 3WJWA 2BVTA 1JD9A 4UCGA 3VUSA 1XICA 2ZX6A 4IGNA 5C55A 3M0XA 1A5OC 2AL2B 1HL2A 1X8CA 2D20A 5DFAA 3NOEA 3HG5A 4LH8A 5CC5A 3U6WA 3OZYA 1PKYA 3KP1A 2OO0A 3WUGA 1VJZA 1HZYA 4PCPA 4S3GA 3UY7A 3LM3A 3W1PA 3T0TA 3GO2A 4HNOA 2CBVA 3GVWA 2XIBA 4XD6A 2WSYA 4XVEA 5CG7A 2J88A 3HN3A 1HL8A 2WMGA 2EJAA 1J96A 2GWNA 4LBSA 1F61A 2Z2AA 3DXIA 1VJIA 1V0NA 3TONA 5I07A 3GU1A 2NWRA 4QXIA 3HV8A 3NVDA 4HBKA 1SFTA 3GBEA 4J3VA 1AW5A 2Q3OA 3N4EA 2IQDA 4K1GA 2ZA3A 3W9ZA 1P7TA 4DZAA 3E5PA 2QT3A 4E2OA 3NFUA 4ATLA 3O6AA 1UZDA 5FOOA 3V0SA 4NG3A 1B5TA 3PFRA 4UCFA 4TVDA 2D1ZA 3LU2A 1W9UA 1O1HA 2YZRA 4GHRA 4XIAA 2V5DA 1H1YA 2OZ3A 3IV8A 4JN6A 4NHVA 3UFYA 1TPUA 1NTHA 3B9EA 4GUIA 1C29A 3QBUA 4QE4A 2NLYA 4UBPC 2A4AA 3T0DA 2D24A 4LVBA 3HPAA 4GYPA 1TV3A 3KCOA 4GQRA 3MP5A 2EPKX 3N4AA 2CIPA 3CL6A 4P5UA 3CGTA 3CV1A 1KXQA 2FIQA 4P7QA 1W1ZA 1TWWA 4E2VA 4DBDA 5K9CA 3E2RA 5DQPA 2Z2UA 1AMKA 4GQBA 1WE5A 2NX3A 2PTYA 1DJYA 1VQTA 3TTOA 4K1WA 4NNBA 1J8VA 4W5UA 4F66A 2HBVA 2P8CA 1FH9A 4KFNA 3EGJA 3RMEA 2HK1A 4LW7A 1EL3A 5KINA 1UA7A 5FJTA 4JIEA 4O1FA 4R7WA 3TROA 1K9DA 3C3UA 1GOQA 3PJTA 4Z2KA 2I57A 2VURA 4PRWA 5M03A 2BLEA 1VJSA 1RALA 2OELA 3FEMA 3H4XA 3PZQA 2VCBA 3AQUA 4WDUA 1EIBA 3VPLA 3LY0A 1NY1A 4RL3A 3T0AA 4HYWA 2WM0A 3W38A 3BGJA 4N0RA 2AQVA 3H54A 3BQ6A 3VNKA 4X61A 3VIJA 1R8LA 1PSCA 2NV2A 2PLMA 3LTYA 1D3HA 1SW7A 2B31A 4RDYA 1Z44A 4X0VA 1TR9A 3QR1A 4P8WA 4WOQA 3Q2DA 4KIEA 4ATWA 5LA0A 1QO5A 4ZO6A 3OIXA 3BDKA 3TJXA 2PZNA 1ITXA 3TMLA 4NASA 4XZMX 3NG3A 4W9TA 4F0HA 2XFYA 2WNQA 3B05A 2DZPA 2XWEA 3TJLA 6TIMA 4G1NA 3F4NA 3NM1A 3RYSA 4K7YA 2CCRA 2ZKMX 3EOLA 3CM4A 3W1AA 1X1NA 3ARSA 3FXGA 3DZ1A 2WVVA 3UVIA 3KBWA 4U31A 2KAUC 2WWCA 4JKMA 2G8ZA 1YTKA 4MG4A 2C19A 1O6IA 1WUFA 4WLCA 3WMLA 4L6DA 4AWUA 4L7ZA 2DPEA 4MFDA 1VH7A 3S2CA 1T40A 3A3WA 3QGKC 3WFLA 1J4EA 2PDPA 3LBOA 1WQ5A 3NQMA 1MZRA 4QS5A 4IXHA 3P7YA 2PDIA 2VP8A 5U7SA 3WLLA 4MJZA 4AWEA 5FF2A 1CXLA 2FFIA 5ABFA 2Y85A 4GVGA 1JDDA 2BOFX 3SEPA 4REQB 2FMNA 5DANA 1V6TA 1UW9A 3GNNA 4M1RA 5C5YA 1EJRC 2H8ZA 1FP8A 3SJNA 1SZFA 4GY7A 3SSJA 3BAXA 5I0DA 3RGTA 3NDOA 1OADA 3ISIX 1JZ8A 1RJPA 2WNWA 2D3LA 4J3ZA 2PWUA 4CNTA 3U5YA 1EPVA 4I9MA 3MHUA 1OABA 4HPNA 3V16A 2J74A 1O66A 5D05A 2QGYA 3MKVA 1AH3A 3P80A 1TTPA 4LEFA 5EPDA 1G4SA 4N6FA 2G0WA 3KVLA 5JBDA 4UR7A 1O5QA 4UTWA 1GCYA 3FYOA 1UC5A 3QYQA 3DG3A 2G95A 1BXCA 3UXAA 3BURA 3FAXA 3EWUA 3P14A 2DQXA 3KOYA 1N8IA 2DQWA 1DJQA 3VD7A 3VFCA 3RUBL 3WEZA 4FIRA 1EFZA 2O4QA 1WPCA 4IG2B 4WY0F 4MAVA 3LHVA 3O9NA 4UMBA 2D69A 5A8MA 4BQ5A 4KFOA 1ZBCA 3GH5A 4HOWA 1J11A 1TTQA 3HIJA 1JZ2A 1XBZA 2Z24A 3AWOA 2BVDA 1F07A 4BEQA 4EF8A 1B2YA 4C7GA 3TUUA 2G37A 4FR6A 4GH3A 1FH8A 4FS9A 4GIYA 4D9PA 1IWPA 3M0VA 4A2SA 3GTNA 3L68A 3P8JA 2JF7A 1EZ2A 1MEIA 4Q4OA 1NP0A 2FZMA 4HHLA 4ROQA 3SUVA 3WDHA 3LLXA 3R1ZA 2R8WA 4JQ3A 4C6NA 2GDUA 5C7HA 3TU9A 3SY8A 4XBKA 4L56A 1EP3A 2QHAA 3G3DA 1E0TA 4J28A 2J7GA 4WY0A 3LNPA 1W9DM 4F4RA 1QI5A 3LQGA 5DY3A 3NA8A 4O53A 4ILSA 5AHLA 1SPQA 4Q8MA 4UXDA 1VLIA 1OFAA 1I1WA 3SECA 1CXHA 2XIMA 1A3HA 2VFGA 2FHFA 3UWZA 2WSKA 1FWGC 3UW6A 2AMXA 1WYIA 5C9ZA 7A3HA 3UZZA 2QUNA 2VR5A 3VOIA 3SCWA 3OIHA 3BJTA 1A5UA 4LF2A 2NXIA 1XQLA 4Q3MA 2DUZA 2ABBA 3G5EA 3Q94A 4NJGA 2A5HA 4OGZA 1CB7B 4QGCA 1KGUA 1ICSA 1LJYA 1TE6A 1GNXA 4QITA 5CBJA 1KQZA 3LPOA 2O7SA 5HUPA 3TYBA 1V3IA 5F4SA 2XN0A 5IHRA 3BAJA 2IXVA 8CGTA 3IIXA 4BJHA 3GU2A 2CLHA 4NKCA 1R3VA 3PZTA 4KESA 2WHMA 2H90A 5D02A 3WNLA 3MUCA 3JU2A 1I2RA 3DFPA 4UTTC 1K02A 3SFKA 2JKAA 3LX9A 1K7XA 4BQ4A 3JRKA 4A8RA 3T8QA 1C9DA 4LAMA 5DBUA 2VCCA 1ICQA 3VZYA 1XBXA 3PBYA 4RZ6A 4O0ZA 3SCPA 4K8GA 1B3OA 4IJRA 4Z17A 1JRCA 1RPXA 3WDPP 4F2TA 5HNRA 4BZYA 1L6WA 3FY1A 4JTQA 2A3LA 1ZP3A 2XWDA 3NQBA 3BOXA 3TTYA 3DBNA 4PA8A 3BL3A 1PZ0A 1JDEA 3R0UA 4J4KA 1ME8A 2WSQA 1P0BA 4CEUC 3EA3A 3PWAA 4LVDA 2FB2A 2JKEA 2W27A 1AUSL 2VFIA 2E6FA 2WXDM 1OCJA 2GL5A 5J04A 3PWIA 4JZ5A 1Y5VA 1O12A 2HDJA 4Z1BA 3DKJA 3I4KA 3ARTA 5LA1A 3E5BA 4OZOA 4F8XA 2J7FA 2Y1HA 3EX2A 5H2ZA 1FHLA 2WJDA 2IXUA 4R85A 4DJDA 4YHEA 5HWMA 3POCA 2A85A 2NVCA 4C6CA 4KEUA 1OZMA 3THDA 1PPIA 4C6PA 4R5EA 3NXFA 3GY1A 3PFMA 1VPXA 2C1GA 2Y62A 3WCZA 2B7NA 5GVJA 3WD1A 3NOYA 4F9DA 3DGBA 2GSHA 2WMHA 6A3HA 4OHQA 2P1FA 3EWBX 4GI4A 3MSRA 3L7RA 2OGJA 3GC4A 4PSRA 4QR6A 1XDLA 4AEOA 4C1LA 3N3TA 3VIPA 2PTDA 3VDGA 3SCUA 1M9HA 1E6RA 5D4YA 1FCQA 2YZ5A 3UXKA 3C0JA 1N55A 4E8DA 4AYSA 3O07A 3GZ3A 1I4NA 4S1FA 1XQKA 2QPSA 1ML1A 2VX7A 4K39A 5T8GA 1UJPA 4MDOA 3H2NA 4KWWA 3VNIA 3CK5A 3DECA 1UH3A 1X98A 3RR1A 3FJ6A 3SB0A 4UNLA 2DIKA 3O6DA 2L5HA 4FLOA 4TV6A 1TPH1 2G4JA 3S6TA 3NPXA 4UOJA 4ZQCA 3SI9A 2NLIA 1VEMA 4N42A 1YDVA 4DJEC 3F1QA 3RMJA 1U22A 4S3DA 3APGA 4AXKA 4PTXA 3MDUA 3V5FA 2E6AA 3C0QA 3PZ9A 3PS7A 3MP4A 4GMEA 4IMEA 3RILA 5B7ZA 2J7BA 4ZO7A 3A4JA 3NDZA 4BFAA 3NYZA 4H1ZA 1C8QA 3POHA 3OEXA 3W7QA 4LYKA 3P62A 4OE7A 2F9RA 3SCQA 1KRMA 2PI6A 4QE5A 4FNRA 4N9CA 1U5VA 4GNJA 4F3HA 2QCDA 1CDGA 3WDIA 1QPRA 3R25A 3WJXA 3RLGA 1V7AA 3S9IA 1QNRA 2E68A 1I60A 2BX7A 4PSPA 4WSJA 3BZGA 3GXFA 5L9FA 3GAKA 1CTNA 4ZXOA 4EPKA 1DWIM 1QWGA 3HB9A 4XD4A 4XQ6A 1TX0A 5A95A 2BDQA 4L6HA 2VR4A 1YRRA 2QJGA 3GHRA 1ZSXA 1ISYA 3W4RA 3LHWA 3VGEA 3W88A 4DJDD 3PUDA 4FF7A 2YX0A 2G3FA 5DCDA 1TPWA 2YXGA 1UWQA 1R3SA 3OVPA 1KXHA 1Q7QA 4KBXA 1XYFA 3R89A 2MANA 1K7FA 4ADTA 4C91A 4JHZA 3TSMA 1DP0A 1JZ3A 2ODOA 4MHBA 4MOZA 5K4XA 4WDTA 4GXWA 3WNMA 1EX5A 1CGTA 3UNTA 2QIIA 4EPDC 4DLMA 4OV9A 4US5A 1MYRA 1E6XM 1ESWA 2DW6A 1XISA 5HNNA 3N1AA 1SMDA 3ARZA 4PUUA 1B9ZA 5IDZA 1JR1A 2VGBA 1FA2A 1JDAA 2W0UA 4MKNA 4ZQMA 2E6YA 3ONCA 3TEVA 1FTXA 1C92A 3EMZA 5I09A 3CT7A 6PTDA 3N14A 2FHCA 1U1HA 3WQ4A 4US6A 3U4FA 1VRDA 4G1KA 3TW6A 4FXSA 4WSKA 5K9XA 4WF7A 1G4PA 4XISA 1UWUA 3OTRA 3LCHA 4JAWA 1YQ2A 3F5JA 4LAZA 4M82A 5F2LA 2Q6ZA 4DUXA 3WLRA 5SWUA 3WH5A 2BASA 1KBKA 2J7HA 2QR6A 1QMLA 2XSAA 4XB3A 3RPDA 4N2YA 5H6HA 2FPVA 1H49A 2PWFA 1LL6A 2HTMA 4EACA 1VKFA 3W7EA 5DLCA 1SU5A 1TUFA 4V15A 4S3EA 3CAVA 4QSHA 2FZNA 1QU4A 2NVDA 3RG6A 3RRXA 2EHHA 1JG9A 4AD2A 1QPKA 4B5UA 2PDXA 4R33A 3N3MA 3LBCA 2VEPA 3KRSA 1JL8A 1L8PA 1DBTA 4KGLA 4XKYA 4QX4A 3LK6A 4P7OA 1E1EA 1GVOA 2CITA 4S2CA 4IGMA 2WKGA 3L4UA 3MWAA 2YR1A 1YMYA 2X0SA 4L1GA 3W7CA 5F1UA 3R0DA 1TE1A 1UWAA 5A8OA 2GGJA 4O12A 5M2FX 5I6SA 2Q09A 3WIJA 3TFXA 3ITTA 2VENA 3B0VC 1Q63A 3FKKA 1V0MA 2YBTA 4A35A 2OZ0A 2EPMX 3ITYA 1UASA 3EA2A 2SFPA 2VI0A 1XBYA 3MV11 3UCQA 2J62A 4ZFMA 1JZ5A 2DY3A 1THFD 1XLBA 5TIMA 4U5IA 3ZIZA 1FOBA 1WO2A 2BNJA 1H7OA 4RNJA 1OYBA 4GQ0A 5FJUA 2HMCA 3OW1A 1C93A 1DQXA 3T9PA 4HHHA 1CGUA 4H9TA 3OA3A 1OF6A 5F4WA 3RFAA 1WKEA 1HKIA 3P61A 3PZMA 2NUYA 5AC7A 4LUSA 4PCTA 4EK7A 3BLEA 1OF8A 4XO7A 4AHQA 1UD5A 4INFA 1C9WA 1AQ0A 1DEDA 2VRJA 2ZUNA 4LBUA 4H8VA 5AHEA 3FA5A 3PAOA 5BOFA 3IVSA 4M81A 1DPMA 4WUIA 3HJZA 3O6YX 1PKLA 4AF0B 4Y9NA 1PKNA 1EHAA 3ZQ9A 4AY7A 3QLLA 4M29A 2V5BA 3DOPA 4PMUA 1DIDA 1SVDA 1WAWA 3MKCA 2Z7KA 3A21A 1XIJA 5HANA 1EA0A 2YIHA 1TRIA 1QTWA 1J0ZA 2X1RA 4PBGA 1X8FA 3KRBA 3DFOA 3VVGA 3GG0A 4HPHA 3PUOA 5H1WA 1EGVA 1F6YA 1DOSA 1F3TA 1NOFA 3KTSA 3S1UA 3WBYA 2JQXA 2ZUMA 3R94A 1YNYA 4TQTA 2WHLA 4ZA0A 3IACA 3WQ6A 1XDJA 3HTWA 3AZRA 1XD1A 4MNMA 3FHAA 1MZHA 3MUY1 4D8LA 4V27A 1PO9A 3H8AA 2BG5A 4TX6A 2XTKA 2B7PA 3PBWA 3LV6A 4C6OA 1GORA 3MSGA 4JICA 1VRXA 3EXTA 3ITLA 4H19A 3WLSA 2VWTA 3ES8A 1GG0A 5EKYA 3EKZA 2AQWA 4D6JA 4MWAA 4I6VA 5JBFA 4X63A 4B15A 5K3VA 3S2LA 4RR4A 2NW0A 1JCXA 3WYZA 1L6FA 1CBGA 4YTSA 1OFDA 3DIPA 5LIWX 2CERA 2D3NA 3E0WA 3AISA 3SIMA 1HJUA 3SQLA 3F4CA 3N2CA 3AAMA 1ONRA 2BGNE 3LMZA 2QKFA 1Z69A 3WQFA 4Z08A 1NEYA 4PB4A 1GQKA 2Y24A 4HYRA 3W6LA 5G5IA 4NX0A 1B4KA 1TG7A 3OBKA 3UJEA 4NNAA 1BWLA 2XUCA 1O95A 4V2XA 3BZJA 3GX9A 3UGVA 4OOZA 5TD4A 4LV4A 1RVKA 5I3GA 3W0KA 3CU2A 3SAZA 3KBSA 1GQIA 4F0KA 3FXYA 3ZWTA 4QLLA 1KRAC 4DJFC 3WH8A 2VEMA 2V5JA 3K1DA 3UZWA 3CMGA 4CQCA 5BU6A 2QCFA 1EJTC 2ZX9A 5E1QA 1XLLA 1VFOA 3L0GA 4E6MA 3IVUA 1UWRA 4C6JA 1QRQA 1QNVA 3II1A 4JTEA 4JEJA 4MB3A 5HNUA 3EOOA 4XZ9A 4X9SA 3N25A 2GQ3A 3UR2A 4F2BA 4DXXA 3EKLA 3D3FA 1Q3NA 4DHGA 2CWXA 1Q6LA 1OK6A 1W6TA 2FTYA 3VNJA 5FJJA 3QR3A 3NYDA 3PZOA 3ZXWA 2I16A 3CASA 4KCTA 4TIMA 1RQEA 4PCFA 3NZRA 3VKAA 2P10A 1V8EA 4YN5A 3MHFA 3IUHA 3QEZA 2OSWA 2VFHA 3ZFHA 4GIEA 5M17A 2UBPC 4O1BA 2IQTA 1GHRA 1EO7A 1GJUA 3GG8A 5E9XA 4TMCA 4LSBA 1LP6A 2OR2A 3S0CA 2FJUB 1F8MA 1PZ3A 3VNMA 1SFJA 2OTDA 3H12A 1NP2A 1SR0A 1ZU8A 4MB4A 1DKWA 3GC2A 3VDBA 4MWAD 1H0GA 3TVAA 4MADA 1YPFA 2XFFA 4QG9A 2JKPA 3CUFA 4K3ZA 2OQYA 3MYPA 4Y2WA 1GKPA 1EDTA 4XAFA 1PUDA 5EY5A 4DEFA 1S5NA 1CT5A 1DWFM 1KM4A 2XVLA 1PYFA 1TREA 1TR1A 2QPUA 3W7LA 4YVXA 4K38A 4AYGA 1C8XA 3NTYA 3VD4A 1SGJA 1KFCA 1UP3A 3DFNA 3KOZA 1W2VA 1E0VA 2TODA 2YL6A 4AZ5A 4NT0A 3ARVA 4BY3A 4E8CA 3L0KA 3W26A 4MDPA 5AVNA 4GH1A 2J79A 3GFXA 1E4IA 5GJPA 5LYRA 2VELA 2BB0A 1HIZA 3FJNA 3B03A 2X09A 4IJBA 2ZWZA 5EBAA 2E40A 2ON3A 4B5VA 1OGBA 2BY1A 3KTCA 1L9WA 1YDOA 3AIQA 4NRRA 3W07A 3SCOA 3TXZA 5BWAA 1PS9A 3M41A 4ZXLA 1NF7A 5LNRA 1DIEA 1C7SA 3W2LA 2NQLA 5D2TA 3WX7A 3FAWA 4NSBA 1ZFJA 4LJ3A 3EWXA 4PRTA 2EAWA 4DF1A 1RQBA 3F5KA 1ISWA 3UZ5A 2HXUA 5IBXC 4M56A 1OX4A 3VNLA 4DN1A 2HVNA 4MPQA 3RO8A 3AIEA 3GDTA 1W3JA 3F7JA 1EIXA 4QJ4B 3MDWA 4V1YA 3CZ8A 1VFUA 4LB3A 1RVGA 5KZMA 3ID7A 4LY4A 2J8TA 4HKPA 3DG7A 4HVXA 3VDAA 3EXRA 1S2VA 6XIMA 1BSIA 1XRVA 4H7VA 1V5XA 2HWGA 3KL3A 4B4FA 4JTIA 3LCWA 4Y96A 3UJRA 2Y0FA 1T41A 4DO6A 3AZSA 2HE8A 1Y65A 5K7JA 2Z2BA 4KH2A 1GK8A 4YLWA 3SADA 3T09A 5D9NA 5AHIA 1U1JA 1HGWA 4HU8A 4QQUA 1TQXA 3GYCA 1KQYA 4O0QA 2PRMA 4RZ5A 3TKFA 4QDPA 1G67A 4NZ5A 4Q8PA 3WMBA 3DC8A 1MEHA 1J79A 3UZXA 3VXGA 3WF1A 2PMQA 2XJ7A 5HMDA 2ZBTA 4NYYA 3RX3A 3T1GA 1Y8BA 4HD5A 3GH4A 3CWOX 4C6BA 5D32A 1BVWA 1LBLA 3ZVHA 4LYQA 3AIBA 1IQ8A 4DIAA 2PGRA 3LI0A 2PS2A 1YPIA 2CBIA 3K4AA 4HPGA 1MW1A 1XKJA 1MMFA 3TYAA 3B8SA 1V4YA 3I3BA 3AXKA 3BC9A 1MUWA 3B4UA 3IIPA 5HJLA 2AGKA 3ANYA 5GJNA 3C4UA 2WBGA 3WF3A 4ICCX 4GY0A 1IV8A 4FR1A 1W1PA 3VNZA 3VUPA 3VD3A 1PYMA 1E9LA 1TV8A 3NO3A 4Z1CA 1REQA 4J27A 3LGEA 2Y61A 4ADSA 1B3YA 1BSLA 1S5MA 2TYSA 1E0XA 4CCZA 2EO7A 3T55A 4PUNA 3LGDA 2DW7A 2YYUA 1B31A 1JUKA 5I24A 1B3XA 2ISVA 4JIPA 4CCCA 2E25A 4ACZA 2QLYA 2G41A 1VIWA 1SZGA 6TAAA 1EJSC 1HNYA 1BF6A 4DB7A 3UZYA 3RR4A 1JEZA 4PN2A 1V6YA 3N6JA 3SGZA 3AXXA 2Z1XA 4XBJA 2R91A 2DORA 3MWCA 5F2MA 2NT1A 1KXVA 1W3KA 5HQMA 3PPGA 1WCGA 2P53A 1WKFA 2ZE0A 2QJMA 4BHYA 1UWTA 4JTKA 4QG8A 5DT5A 5ABGA 5CC3A 3EDKA 2XISA 3ZLHA 3CQIA 1QT1A 2Z7GA 3KBMA 1HVXA 4O8AA 1UD4A 3CYJA 5FAJA 3WNKA 3WMCA 1PBGA 3GXDA 2VUYA 1G1YA 4DPQA 1XDMA 2J9YA 3STCA 4Y9AA 4Q4KA 4JX5A 2GUYA 4Y9OA 3GBDA 2WNNA 1H41A 1VGAA 3MZNA 1RUSA 5LIKX 3M9YA 4JFSA 4G7EB 2PE4A 2XH7A 3MUXA 1YHTA 4PTWA 3EPNA 1E73M 3GTXA 1KTNA 4CN1A 2OMAA 3BXWA 5LXEA 1BRLA 4QLKA 5GQBA 4B5WA 3BLPX 3EX1A 4JTJA 2DIEA 3S4TA 3I65A 4JQAA 3TN5A 1HXJA 4IP7A 3GUGA 1S39A 2E9LA 3VYLA 5HATA 1W3NA 3KWXA 3JS3A 2V9DA 3WUBA 2XN1A 4JIHA 1HJXA 5EMYA 3IUDA 5XIMA 1KFKA 2Z1BA 3W83A 3GVVA 3GC5A 4HMEA 4JKLA 2GJXB 2WM1A 1Q4WA 2ATSA 1Q45A 2VT0A 1A0CA 3HURA 4IJCA 2E9BA 3R8RA 3M47A 2QGHA 1RBLA 5A8PA 3MI6A 4FK9A 5MKGB 3WN6A 4HNCA 3M7SA 1F9CA 3GDBA 3VNYA 1RD5A 4QCEA 2IPFA 4FIQA 1XLMA 1NH6A 5CAKA 4HTYA 2XSBA 1TPDA 3QV8A 1C3FA 4RDVA 1KXTA 2R1LA 5REQA 1Q85A 4W4QA 4N4QA 3IV3A 4L6OA 1KFBA 3EZ4A 3ABRA 3FA3A 1JRBA 4JTLA 3R11A 3H2OA 4LGXA 4Q6XA 1IE7C 3W2NA 3WFAA 1XSIA 1WBJA 3ITGA 3HF3A 4H2HA 3VX1A 4AD3A 1YIXA 4DBUA 3M43A 2OXNA 2ZX7A 2CHRA 4FO4A 4PBEA 3QZ6A 3LQLA 4IQEA 3ERPA 5DCBA 1KM1A 2B81A 1QFEA 3WZ0E 1SZRA 3VO0A 1QWKA 2NXGA 1BYDA 4QLJA 4JCMA 2VO5A 4WDWA 3GNOA 3KOXA 4LVFA 2F7FA 2YL5A 4HNNA 2VC7A 4B9ZA 2V63A 5JU6A 4IUOA 1VS1A 2WHJA 3E38A 4MNLA 1FFQA 3OPSA 1H51A 3IJDA 4OUEA 1R86A 4GC3A 4RW5A 2Y2WA 1IT8A 4DRSA 4ML9A 4YU1A 2OSYA 1ZJHA 4KCVA 4S3FA 4G9PA 3DG6A 2NX1A 3MSDA 1GQLA 3W25A 3ITXA 4GJIA 4I3GA 4GY1A 1R6WA 4UIOA 2GOKA 3WDQA 2ZZ2A 3T2OA 3P6LA 1RAKA 4FNUA 4JTSA 5DMYA 1GVIA 2ZUSA 3DHUA 2WLYA 4DLFA 2V81A 1RLCL 3WUFA 3TJIA 5HR6A 3RN6A 1PEZA 3U2ZA 4OBTA 1CPUA 1ISXA 4XAPA 1UKOA 1ZJIA 2QDEA 1GYMA 2V3EA 5E0KA 3MANA 5IRPA 2GJPA 2IKHA 2RJGA 2YFOA 3S8HA 4NP7A 1KWKA 1XCXA 5AYXA 1V7YA 4FOUA 2A3AA 2YLAA 3NR0A 2GGEA 2A6LA 3L9CA 3QW3A 5IFTA 1JFXA 4O50A 1XG3A 1XWYA 3WD3A 4FLSA 1U33A 3KBNA 4DUWA 4ZEPA 3BQ5A 4FX7A 2DIJA 2ZRWA 4IIDA 4CVWA 4ZB5A 1I1XA 5I23A 4RXGA 3PZGA 2WANA 3Q45A 1QR7A 2PODA 3QW4B 4JX4A 2AQOA 1F3EA 3RCMA 2CWNA 1R3TA 1KV8A 5C71A 1NDYA 1K8YA 3WDRA 5FEZA 3H55A 1ZY9A 3VCRA 5A6BA 1OYCA 2Z1SA 4RXFA 1ITUA 1P0KA 1KM3A 3ARUA 1IEQA 5A6AA 2GJLA 3TQKA 2DZBA 2A6NA 4FALA 4YPJA 4H83A 3FA4A 4LWWA 1HG3A 3E0VA 1L8NA 2Y5EA 1A80A 2W63A 1OK4A 3AMCA 3EDDA 4PZVA 4HSNA 3CLWA 1A4MA 1MXGA 2ICSA 3OYXA 1S3TC 4MY8A 3MTWA 4KCWA 1MUCA 3JW7A 4RKAA 4C1NA 3L66A 1W56A 1IEIA 2VYOA 3B9NA 3O06A 3IGSA 3S2MA 1A53A 1YNPA 2FVMA 2X1TA 1UH4A 1M03A 1S3HA 3A12A 1UMLA 4LRSA 4AVOA 5GNZA 3PTKA 1XLAA 2I56A 4KWVA 4CQ8A 1KM2A 3E12A 2WVVB 3Q67A 1J6PA 2HBXA 3VK5A 1R85A 1GUVA 4JIIX 5EMMA 1F73A 3S1GA 5HOSA 1J2WA 3HG4A 3PUGA 2H6RA 4FLQA 4H9XA 2VVSA 3LCLA 2ZQ0A 1QO2A 3DFYA 3MKKA 1O60A 1F6PA 2W61A 2X16A 2GK1B 4HK6A 1EJUC 3M0ZA 1DJXA 4CCEA 1XLEA 1XFBA 2AAMA 3U2OA 2CETA 3ZSTA 3YPIA 3N19B 1EC8A 4OUIA 3PF3A 3NQ2A 1RLDA 3W1RA 1ITQA 3N17A 1NIUA 1NDZA 3CV7A 3EB4A 1XC4A 4QE1A 1TJ1A 1B0IA 2WV8A 2PTXA 3AHVA 3H2EA 4ACYA 3VILA 1W1TA 3WH9A 1IZJA 1ZQ5A 3M0MA 2R1KA 2YL8A 3M5VA 1Q8JA 1QDSA 2A3EA 1R46A 3UP8A 3OYZA 4ZMGA 2X42A 1R47A 1UZ4A 2JEQA 1IGWA 2D2OA 1AL8A 4J3XA 3GIQA 1JDCA 1W9VA 3AIUA 5KZDA 2PWGA 1KM5A 3PZNA 2JFEX 3THCA 1K8ZA 4RPPA 5I02A 1IWBA 2DT2A 3I68A 3N2BA 4J2PA 1YADA 3GYEA 3C2OA 2ZA2A 4UTUA 3PTDA 5A6BD 5A6TC 1M1BA 3BG9A 3B40A 3G8RA 3GDLA 4I8DA 4OT7A 1QBBA 5HINA 4A3YA 1ZAJA 3ORWA 4R9XA 4J3WA 1PHWA 3TP4A 4PUWA 2VGFA 3H2CA 4WR3A 4B2DA 3PULA 4GBUA 2EPOA 1Z32X 1XPYA 1XIGA 3N18A 4GOAA 5H8PA 1F5ZA 1KFLA 2ZX5A 4IWWA 3GKFA 3IRSA 3M0JA 3SCVA 3IAPA 2EG7A 2XZ7A 1EWDA 1ODUA 7XIMA 3AHXA 4ZQRA 5TAOA 1UP0A 1XIDA 2EEXA 1BVZA 2EKCA 2Y7EA 4O28A 3QRHA 1PE1A 3UG8A 4A3QA 2AL2A 1ONWA 1YEYA 2ALRA 2GZXA 4GD0A 3NQEA 4UTTA 5CC7A 1GG1A 2YCLA 4UOQA 2C16A 1H2JA 4MJ4A 1TPB1 4DNHA 2WC7A 5BRQA 4KKXA 1XJBA 2DSKA 2TSYA 1E6QM 4ALDA 2QNEA 1GVSA 1BG9A 1E9IA 5XINA 1KBIA 1QBAA 2Z1KA 4L1XA 1DXEA 3OG2A 2PBOA 5C9WA 2PDWA 4Z2IA 2WVSA 1SMAA 3MO7A 3KDNA 1UROA 1PX4A 4AZHA 1R30A 3AMKA 3OGVA 5DXYA 4I5XA 4S2BA 1I45A 3ZVIA 2EG6A 1NWTA 2GUBA 4KWOA 4F9JA 1RA0A 2BS9A 3RX4A 1LQ0A 1BYBA 4BI5A 3RHGA 2Y63A 3SZ8A 1I6NA 1NOWA 1XLHA 1E0WA 3CIXA 4GZIA 2J78A 1J01A 3U7BA 2VEIA 3VKBA 3KZSA 1QOQA 1VLWA 3EB2A 3AS1A 4I5UA 5CZJA 2QJHA 1NFPA 4O16A 4NNCA 4DM1A 3QHNA 3FDGA 4TMBA 2VZUA 1XW8A 3L23A 4DI9A 1CCWB 3T0CA 4XSLA 1UZHA 2Y5JA 2I1OA 3JZUA 4ML4A 4CCDA 3W87A 1J0KA 3VOCA 4TO8A 2YL9A 5A2AA 3VKCA 1OX5A 2HZGA 2BY0A 4NQ1A 1A4LA 1UIOA 3OB8A 3W7PA 1UR0A 3H2AA 4A3RA 2FVLA 4W7UA 2J6XA 3CAQA 4A4AA 3GXPA 3W86A 4O10A 1TPFA 2OYKA 3NSMA 1TV7A 1X1ZA 4Z1DA 3PBMA 2Z00A 1TPEA 3GFZA 4U3CA 1R2SA 2ZIDA 1X38A 1YXYA 1I0BA 3S6OA 1DL3A 3CQHA 1ZS2A 2OX1A 1PTGA 3H4WA 2PD9A 1H5YA 2A79A 3BMXA 4WK9A 3SUTA 1FKWA 4KMQA 3VM7A 1FWDC 1O5KA 4DJEA 5D38A 3KM8A 3HMJG 3PR2A 4LPCA 3LA4A 3W1MA 3VD5A 1AH4A 4C5YA 4L64A 4HK7A 1OB0A 5KITA 1A5AA 2O92A 4ORIA 4LY8A 4ONVA 3T44A 3FV9A 1Q6GA 4LB4A 3LSBA 1W9XA 3KAOA 4AZGA 4Q8QA 4KIRA 4DYEA 7PTDA 4QSFA 1EWEA 3CIWA 4D8ZA 2V8ZA 5KETA 3TYCA 4LOCA 3BW2A 1XX1A 4CNUA 1FWWA 4PL2A 3TQ0A 2PDBA 4H2CA 3E02A 1R2TA 3G1VA 1NSJA 1AVAA 1BHGA 4O8RA 2BXZA 1NQKA 3UESA 4AFYA 2FTWA 1L6YA 1XS2A 1H7RA 1DE5A 3UY8A 4D6FA 3MC5A 4FNSA 4NZ4A 2ZRYA 3RX2A 3LERA 3QZAA 2XIQA 3MCNA 3TW7A 4JPGA 5D09A 1EC9A 4TVUA 1HP5A 1WP6A 1TV5A 3MJMA 5MHBA 4RNFA 3QQ1A 3UETA 1GEQA 4MPKA 1J0HA 3GVGA 3VOFA 1JFHA 2QCNA 4REQA 4IIGA 3CEPA 2Z25A 2PLCA 1E5NA 1I2QA 2NZLA 2BOGX 2W4XA 2CFFA 1V93A 3W1UA 5I3JA 2VM8A 1UMYA 4HJFA 4BI6A 4LXFA 1WXZA 4GRSA 3TC6A 2QDDA 3GNXA 3ITVA 1E1CA 1HP4A 3VC5A 3BH4A 2ISFA 1HO1A 2CZVA 3P93A 3NURA 2PCEA 5BRPA 1PHQA 3FCPA 5CZ0A 1Z41A 7REQB 4IIBA 4AZCB 3DEQA 3G6LA 3KWSA 4MSSA 4RV8A 3NQFA 4OFCA 3ABQA 4DXKA 2X40A 4KF1A 1LDCA 1Z89A 5CAHA 1UR2A 4NAFB 4AMCA 2BWGA 1GOOA 2GWGA 3KTXA 6ENLA 2OCZA 1XM3A 1B3VA 4FAMA 4W89A 2NX9A 3WLTA 1BQGA 2QCDB 3WLJA 1LLOA 2H9AB 4IG2A 3GXIA 3O15A 2A7NA 3C3NA 1F3XA 4TUFA 1UR8A 4DJED 2PP1A 4GUGA 3T07A 1GZGA 4X2PA 5E5CA 4Q8OA 3L65A 3VU2A 3ZZ1A 4ZTXA 2VEFA 4GXPA 3N29A 2FZBA 1UUQA 1KCKA 5FJPA 1JPHA 4JTCA 1R3YA 4Z0SA 1W9BM 4NI8A 3R43A 3W76A 3W81A 3PWGA 3NAVA 2BVYA 3VKJA 1O5RA 1W5PA 3CZJA 1EPXA 5FF4A 3C2EA 4IGSA 1VP5A 3SIZA 4NZ1A 4F2UA 3EWZA 1D3GA 3VM5A 5C2GA 3LB0A 4DO7A 2C13A 1CLVA 2Z26A 2WKLA 1GYLA 2ZZ3A 2VDHA 3CPUA 1JCTA 2E28A 4ATDA 4QDWA 4KEMA 4IGHA 2W91A 2YGYA 3NVTA 4NZJA 2HK0A 4RZBA 4D6IA 2WZIA 4DY1A 2INZA 1AJZA 5AYBA 1EOMA 5KMYA 1BXBA 4PMZA 1TVNA 2C3ZA 1OWQA 1UUMA 1E43A 1HKWA 3LGGA 2DVTA 4KWSA 2AGTA 1FWEC 4ZVJA 4XWUA 3CXOA 4GGHA 2OWCA 3GDRA 5CZSA 1KFJA 1UQYA 4IUGA 4PMOA 2PPGA 3CUXA 4L9YA 5HA7A 1VIZA 3S5YA 1SW0A 1A5MC 4KW2A 3UJ2A 4OIFA 3ZR6A 1ECQA 1TWIA 5CPMA 4HNTA 5RUBA 1SZNA 3B9DA 4AG0A 1XCWA 3SRDA 3UWWA 3GR4A 2Q8ZA 3RU6A 4R88A 3B4YA 1ZB5A 3IIOA 3FS2A 2CZ5A 1CIUA 1Q4NX 4J7RA 1Y5XA 2YA2A 4LUYA 2UY4A 3FGCB 3UWVA 2WSPA 2E0PA 2LLEA 1Y5WA 3S2NA 1XSKA 2PF0A 5TBOA 3AO0A 4FNQA 3BWWA 3CB3A 5D04C 3RCYA 1XIFA 3CWNA 1D3CA 1JVNA 4QFUA 1Q2SA 3G1SA 1O68A 2QEZA 2HNEA 1IT0A 2ZUWA 3BICA 4JTFA 2A21A 4BQ3A 4L1WA 3CIVA 1TCDA 3IJLA 3W82A 3IIVA 1OZQA 2Z1VA 4NIRA 3BAIA 3TH6A 3STPA 1L6SA 3SGUA 4E8GA 1UR3M 5HK4A 1EJXC 3NSXA 3KS6A 3WBXA 3KL0A 3W53A 2I17A 3O8AA 1LOLA 2J47A 3N9KA 4W7WA 4IT1A 1TJPA 2C6QA 3E2VA 3PHAA 3R79A 4GUJA 4M0XA 1V0LA 5I5RA 2G3NA 1JXKA 3R6IA 3HQPA 3SCTA 1J6OA 3HGOA 2Z29A 4OWGA 1BGGA 4UZUA 3S2JA 1MNZA 1GTEA 3L5MA 1OD8A 5JVLA 1TFVA 3A4XA 3O2LA 2YCJA 3VOJA 4A21A 5A94A 4GISA 4PFHA 4QHRA 2JEPA 1RV8A 4Q8VA 4S3BA 3AWNA 3G77A 4HCHA 2JIWA 1OT1A 4B3ZA 4J3UA 2CLKA 3N34A 3THQA 4AVFA 1DJIA 2WKJA 4YS1A 1FCUA 2JF6A 2CXEA 1BYCA 2E3ZA 2WW5A 3O6CA 1B3ZA 1WDQA 4ZQPA 1Q5MA 1WNOA 1K77A 3TN6A 2DZVA 2YDAA 3VCCA 3AHTA 4RNHA 1E55A 2QW5A 4RNIA 2DGAA 2INEA 3QGVA 2JK2A 3MZ2A 4PBFA 3V3WA 4L65A 2G97A 5FJIA 1NVMA 3ATYA 3H7VA 1GPWA 3L4WA 4MWAE 2DJLA 5M1TA 4JFUA 1WAUA 4S3AA 3PB0A 4H9YA 4JIQA 3TN4A 1TA3A 1D9EA 1GHSA 4JL1A 4YHGA 3SY1A 2C1HA 3RO6A 9XIAA 5HMEA 2QDHA 1WBHA 1I2PA 2JGQA 1UOZA 1BWVA 1XINA 3TQVA 5G4HC 1TTJA 4UQ9A 4UTHA 3THUA 1KRCC 4G7FA 3WF2A 4YXGA