4M56A

The structure of wild-type mall from bacillus subtilis
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
559
structure length
555
Chain Sequence
b'EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQRADLKSISLKPYEAVMGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 221
structure length 555
sequence length 559
chains with identical sequence B
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m56A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m56A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m56A02
4PSPA 4MJ4A 1QNSA 2PWHA 4U5KA 1VJZA 2NW0A 1HKKA 1CXIA 1YHTA 2WK2A 3T0AA 2WAGA 3OG2A 1E4MM 3I3EA 3CZEA 3WD2A 2JIWA 3MU7A 1UWSA 3A47A 4A3HA 4Z2HA 1QBAA 2X1IA 3AZRA 3CUIA 4PMOA 3O2LA 1B90A 2WC3A 1DWAM 3ZOAA 2WVTA 1UUQA 4UQCA 3TA9A 2EO7A 2E9LA 2JE8A 2OSXA 3WUEA 4GXPA 1TA3A 1CDGA 4GQRA 1ITXA 5D9NA 2XVKA 5CQ1A 4Y7EA 4IISA 1G01A 1NWUA 3MMDA 1CLVA 4AZCB 2DEPA 3AMDA 2EPOA 3W37A 3AIWA 3WUGA 4Q7NA 3W4RA 1MQPA 2WKLA 2UWFA 3A22A 5A69A 1QI3A 4UFMA 4KMQA 1VAHA 5I5RA 3PZGA 4FNQA 1GONA 1D7FA 4FLRA 4KRUA 3ALGA 5ABEA 1HWWA 4CU7A 2E8YA 2FHCA 2VQUA 2JEPA 1ISXA 1E9LA 1US2A 1R86A 3L2MA 3CHEA 2XYLA 3FAWA 4FF5A 4AC1X 2VOTA 3FAXA 3PZTA 1AQMA 1PZ3A 4MNJA 1VFMA 2WMIA 4MB4A 1IZJA 4GINA 2J25A 3UERA 2J7GA 2Y8KA 3RIKA 3ARYA 1QI2A 4FLOA 3WQWA 2WHMA 4GZJA 2GVYA 1W9XA 1JI2A 4AMXA 3UR7A 1VJSA 2J7FA 3WENA 2EACA 3N15A 5A2AA 3U5YA 1BGGA 3ZJ6A 4AYGA 4BCEA 2VUYA 3VM7A 4V2XA 2HISA 4JAWA 3ZJ8A 1VBRA 1CWYA 3VGFA 3VX1A 1CTNA 4QLJA 1JG9A 5I78A 3BLKA 2VR4A 1LG2A 1BG4A 5GPRA 4PEEA 4GI6A 2IXUA 4TTGA 2XJ7A 4MADA 1G1YA 4GO9A 5HDRA 3WN6A 3WD3A 1N82A 4QLKA 3EDKA 1QHOA 1TG7A 5GNYA 3VSUA 3I3BA 4BQ3A 3MI6A 3AIEA 1HIZA 2VC9A 1W1PA 5A6JA 3EJPA 2A3HA 4GI9A 4W84A 2A3EA 2XTKA 1IT0A 4CCCA 1OIFA 4AD2A 3H54A 1SZNA 2X2IA 4OJYA 5CZKA 1VEMA 3DC0A 4Z2IA 4IUGA 4P7NA 4RL3A 4D6FA 1FP9A 3HJEA 1PX8A 1XYFA 1QWNA 3A3HA 1Q6GA 1GQKA 3MUIA 1TQUA 3M6DA 3WF0A 4NSBA 3SEPA 1Q6DA 3AOFA 3WKZA 1VB9A 1E15A 3WIJA 4N42A 1AQHA 4X0NA 1XV8A 1C8XA 4AIEA 3ARWA 5A6LA 3DECA 3WQ4A 1BYAA 3KL0A 4M1RA 4XV0A 1PAMA 2JF6A 4OOZA 4YHGA 3RM9A 1JYWA 1E0WA 1QI4A 1PEZA 3IGUA 1BFNA 1NWTA 2W63A 1AMYA 1JD7A 4HZ7A 2GJPA 3CHFA 3N11A 5BRPA 1V08A 5D4YA 4IM4A 3HU7A 2DPEA 3OA5A 1E70M 1R33A 2GDUA 4ZE4A 4DUWA 5I0DA 3ARRA 5LA2A 5BXSA 4JFVA 3VO0A 2EXOA 2D0GA 5HPCA 4F79A 4LX4A 1HJXA 1QVBA 3PZNA 2YDSA 4HTYA 2W61A 2F18A 3PZIA 5BCAA 2OW6A 2W67A 4QCFA 1GQLA 5A6BD 3ZT7A 4YHEA 3BUBA 2WHKA 1U2YA 2EAEA 4ATWA 2E0PA 2ZXQA 4OGZA 3FN9A 3GXDA 1ZBVA 2DQXA 4BF7A 4W8BA 2CBUA 2WVVB 2PWGA 1KTBA 4PN2A 2AOSA 4C7GA 1PZ2A 5CSYA 1NP0A 3ARQA 2WMKA 1Q6EA 3VIIA 3W27A 1TZ7A 4MNLA 4J7RA 2GK1B 3MANA 1X6NA 1ZJBA 2VVSA 5FL1A 3W53A 2CNCA 1OGSA 2W92A 2ZUWA 3AMKA 3J7HA 3UG5A 2J4GA 3WY1A 1LF1A 4CU8A 3ALFA 4TUFA 2Y24A 3K8KA 4M80A 5M5DA 4CVUA 5M17A 1E3ZA 4PTWA 1CPUA 2V3GA 2ZX5A 4EAMA 2J7EA 1QHPA 3WL0A 5I3DA 4CCDA 3W38A 3T2PA 1LWJA 3D51A 1B3YA 4ATLA 3BAJA 4M56A 3HMCA 4QDMA 2IUZA 4MTVA 2DIJA 4JHOA 3IAQA 3BSHA 2WSPA 1GW1A 1ISWA 3BCFA 1EDTA 1TFVA 5A8MA 1U30A 1QWUA 3CUJA 3ZJ7A 3DYMA 3IANA 1B3ZA 3SCPA 4F9JA 3ARTA 1V02E 2VCAA 3G6LA 3A5VA 4GKLA 2E3ZA 5EFDA 1GCYA 5D8WA 3UESA 1JF6A 2J8FA 1IV8A 1FH7A 1UKPA 3DYOA 4HU0A 4ML4A 1R85A 4PCTA 4D72A 4QLLA 4B16A 4JFTA 2O92A 3PZ9A 1OT2A 4TVDA 4D6JA 5EMYA 2D20A 2BVTA 5A8PA 1EQCA 4AXNA 1FOBA 2DH3A 1XRVA 1BHGA 4ACYA 3T08A 2VJXA 1JDCA 5A3HA 3AMGA 2Y5EA 5BXPA 1LQ0A 1ZBWA 4CCEA 1TR1A 1R75A 3BMVA 4W5UA 4D6HA 1J9YA 5AC4A 3VTRA 4AEEA 2ZUMA 4P7RA 5JBFA 3FXYA 1KQZA 3SCNA 4B3KA 1TQVA 2QF8A 4L4OA 4F66A 1DTUA 2UY4A 3CH9A 4EE9A 1VBUA 3SCVA 5GNXA 4B15A 3A23A 4LYPA 4C7DA 2DT3A 3WH9A 1UR8A 5HXMA 1OCQA 1K9FA 1DP0A 3WDJA 3VGGA 4CN4A 2YDQA 5ABGA 3WDQA 4BQ5A 2BHYA 1GOWA 1SR0A 1HP4A 2YLAA 3CC1A 2CHNA 1TCMA 1TA3B 2ZUNA 1MW0A 2GFTA 4PBGA 3GYCA 3WD1A 1LLOA 1D2KA 1GQIA 3AZSA 4V28A 1E71M 2GJXA 2YOCA 2VNCA 3H55A 1GVYA 3WNPA 5LA0A 3VIFA 3K8LA 3VIGA 2D24A 2V5DA 1JAEA 1CZ1A 4M8UA 4PRWA 4CD4A 2DT1A 4OBSA 4CKQA 3HG4A 2VMFA 4P8XA 2CERA 4D6IA 2BY3A 4UOJA 2BVYA 4W93A 1O6IA 1TQTA 4LYRA 4D6EA 3CGTA 1E5JA 1UHVA 3VGDA 3BVXA 4ZXOA 3BAYA 1JYXA 1BAGA 4UR9A 1PJ9A 3WQ8A 3U7VA 5CSUA 1RP8A 2PWFA 4H04A 3K1DA 1BTCA 1UH2A 3L2LA 2F8QA 3OBAA 1UOKA 4PTXA 4M29A 1FFRA 4TX6A 1HVXA 3OLDA 5GNZA 3U57A 3WFZA 3D5HA 5TD4A 1EGZA 2CHOA 3HN3A 1UR4A 3EMQA 2ZE0A 1IZKA 1J0HA 3H53A 2X05A 1EO5A 2X2HA 3VU2A 3WY3A 2BY0A 3ZT6A 4MJ2A 4OIFA 1LL6A 3DX1A 4HOZA 4JL1A 1PS3A 1OINA 1TVNA 3CIVA 1TUXA 1XHGA 3MSGA 3F5LA 4CVWA 4UZUA 4HOXA 4P8VA 4AZHA 3VILA 2WZHA 3GM8A 3ARUA 2E8ZA 1R46A 2XFYA 4JKLA 4DWSA 3BAWA 3MV11 3CHCA 3BVTA 2PB1A 2WC4A 3AXXA 3ZO9A 3QGVA 1UQZA 3IJ9A 1WDQA 3RM4A 7A3HA 3O9NA 1XH2A 4R5EA 4ACZA 1GOMA 5D8ZA 2CBJA 4NI3A 4CN6A 5F7UA 1QW8A 1I1XA 5M3WA 3LXCA 1XD0A 3N1AA 4PMXA 1J11A 2OYKA 2X2JA 1EH9A 1MFUA 5HPOA 1E4IA 2G3JA 1W9BM 1P6WA 3TOPA 1H4PA 2G3NA 4J3TA 1KBKA 3WQ6A 4DWSD 1UH4A 1WDPA 3VINA 2DSUA 3U5UA 4U2YA 3EJQA 3ARZA 4W5ZA 3NCOA 2Q8XA 1ODZA 3AI0A 3MMWA 1B30A 5I79A 4X0VA 1HN1A 4H41A 2ZWYA 2CKRA 4U3AA 5A6MA 5IHRA 4WSKA 3MKKA 5IXEA 2D0HA 1RP9A 4UOQA 4M24A 3GH4A 4U2ZA 3WDIA 3BSGA 4NZCA 5IHSA 5IFPA 4GZEA 5DFAA 1BSIA 3IJ7A 1KCLA 3SCTA 2XIBA 4J27A 2OLHA 3OGSA 5I77A 2D23A 3RDKA 3ZM8A 4WF7A 1CXEA 3WH8A 5CPQA 5HNNA 2WB5A 3PTKA 1WZLA 3AQUA 1UASA 2WMFA 4AEFA 1ZBCA 2F2HA 2FDMA 3WFLA 3II1A 2A3AA 1KGWA 5JBEA 1JFXA 4LXFA 2OWXA 5CPSA 1MW2A 2EADA 1CGWA 2G4FA 3VSTA 1KFWA 1E6XM 2VURA 4URIA 1CLXA 3SCOA 2J62A 3W6MA 1DHKA 2DT2A 3FY1A 1V3LA 3WELA 5AYBA 1V03A 2XVLA 1ISZA 1DWGM 5BWFA 1E6PA 3VGEA 4OUEA 4TVCA 3GBEA 2PWEA 2ZWZA 6CGTA 1J0YA 3KEHA 8CGTA 1L8NA 4CU6A 4UFJA 2WHJA 2G8ZA 2JIEA 2WMGA 3B8SA 4GI8A 2OSYA 3ARXA 1JZ7A 1Y7VA 1UKSA 2E4TA 3SURA 1B31A 1OM0A 1GJUA 2BV9A 1G5AA 3AMCA 3D4ZA 1NH6A 4DM1A 4DO4A 1XSKA 2VVNA 3OGRA 1A3HA 4AD3A 3LPPA 3CO4A 4GZIA 4H8VA 2WCSA 2XHYA 3VDCA 1VFFA 1R7OA 3WQVA 1QI5A 3WSUA 1JZ8A 2J7CA 1LWHA 3EJUA 3W28A 4ZEPA 5BXTA 3UG4A 3VOCA 3BLBA 2VX7A 4RE4A 2UY3A 4C7FA 1O7DC 2ZXDA 3L4WA 2WM0A 3K4DA 5DO8A 4CD8A 1HX0A 4PSRA 3ZR6A 2J7DA 3RPMA 1GOIA 2J7HA 4FNSA 3NJ3A 3BGAA 2NT0A 3T0DA 2Z1SA 4DUVA 1B9ZA 2WMJA 5FCZA 1QBBA 2VL4A 2OWWA 2YFNA 2WBGA 3PHAA 1XH1A 1WDSA 3WY4A 1EDQA 5E0FA 3LPGA 1EQPA 2ZIDA 3N17A 3WF4A 1R7AA 5D9PA 1KB3A 1XGZA 2X2YA 3BAXA 4HP5A 1VEPA 3N13A 3AHYA 2BVDA 4U3CA 1XCXA 3APGA 3AS1A 4JCLA 2F1AA 3CZKA 1J0ZA 3N9KA 4J28A 2RGLA 1C8YA 1HP5A 2IXVA 4QFUA 3U7BA 5GQBA 4UQDA 3W26A 4AD5A 1KR1A 1XH0A 3AHZA 1MWOA 4UQAA 4AZ6A 1V0KA 1E4NA 3W25A 4MNKA 2QPUA 3AIUA 3AZTA 2F7RA 1R47A 3NUKA 3LXBA 4FMVA 4XX6A 3CUFA 3RILA 4F9DA 3WEZA 1V0MA 5E70A 1CXFA 2FHBA 1OWQA 2WWCA 4Z2GA 1UD2A 1ZU8A 1E55A 1H0GA 1JFHA 3BXWA 3SUSA 3PZOA 1FH8A 3DX3A 3D52A 2WYSA 3WQ5A 1KXTA 3VIKA 1V0LA 2VT0A 1US3A 5FKYA 4KWUA 3MUY1 3NSMA 3TTQA 4MB3A 3VDAA 1K9TA 3EMZA 2MANA 3I3DA 3POHA 4BZYA 2GJXB 4HPGA 2O9TA 2EPKX 3GDBA 4PMNA 2F61A 1WCGA 5A6SA 3VM5A 4Z2KA 2D0FA 4DO6A 2E9BA 1EIBA 2OYLA 1HL9A 4J3WA 4EKJA 4R27A 3GNOA 4P7QA 2W4XA 1W9PA 1QNPA 1Q4NX 2F1BA 1KGUA 1JYNA 1W3HA 2WLYA 3DYPA 2FH6A 3BVUA 3PN8A 2ZUTA 4D1IA 2WPGA 1JZ4A 1NWRA 3UETA 2UY2A 1V3JA 5D9MA 4AZBA 3VD7A 2YL9A 4CD7A 1E5NA 2J75A 1JXJA 1NM9A 4H7VA 1NARA 1OGBA 1WE5A 1W1VA 4Q22A 4E8DA 5BXRA 4MDOA 3A24A 1E0VA 4NXKA 5FL0A 4W8LA 3ZT5A 2YJQA 1E6SM 3IJ8A 2VZOA 3VDHA 4HOWA 1PX4A 5DF0A 3A21A 2CYGA 4BQ2A 1J0KA 3AIRA 1NOFA 1M7XA 3OLGA 1TMQA 4JFUA 4D1JA 5A8NA 3NDYA 5JIWA 2G3IA 2JALA 4UNIA 3AXHA 4UTFA 2WSKA 2ZX8A 4A3YA 1AQ0A 3DDGA 1KWKA 2WVSA 2X8RA 5JIPA 4DWSB 4F8XA 1KGXA 1H0IA 3AHXA 5EFFA 4D6DA 4PMDA 4TXEA 2BY1A 4E4PA 3S6TA 3WF1A 4GPNA 3N18A 1J01A 3VGHA 5JUVA 1M01A 1A47A 4ACZB 4H2CA 1BPLB 3FHAA 2XFFA 3RJYA 2TAAA 3GXIA 1RD6A 3G6MA 4AZGA 1E56A 4NRRA 1CGYA 1H09A 1HF6A 3E1F1 4L4PA 1KXHA 1GHSA 3VNZA 3K4AA 2WANA 1UG6A 3M7SA 4NF7A 3WEOA 3AMLA 5C71A 3EJSA 1HXJA 3A4XA 2OYMA 1OD0A 3MUZ1 2AAAA 2ZICA 3VX0A 2Y2WA 2VO5A 1ZBKA 1AVAA 4UFHA 3BVWA 5I6SA 2AMGA 3WF2A 1GOOA 2JF7A 3T0BA 3S5YA 4H8HA 4IPNB 1KBBA 2VCCA 1ECEA 4FK9A 2PF0A 2X0HA 1ISVA 1CEOA 1QW9A 1K6AA 1F4HA 4NXSA 4QCEA 5ABFA 4PTVA 2YIHA 3THCA 1J10A 3EBVA 1OD8A 1VIWA 2ZX7A 1J12A 1WKYA 4AISA 2FH8A 3AS3A 1VEOA 1HJWA 1E0XA 3AIVA 3WH6A 2VX4A 1MYRA 3AIQA 1FA2A 4PMUA 3HZ3A 1HJSA 2ZOXA 1CGTA 2QLYA 3MS8A 1V6VA 2UY5A 1UKQA 2PC8A 1UD6A 2WHLA 3M46A 4U31A 4JL2A 3WNNA 2YLLA 3VNYA 1GJWA 1PPIA 1W1TA 1UWRA 4CUCA 1CGVA 5LA1A 2WBKA 1M53A 1XCWA 3O6AA 1HJQA 2C8NA 1SFSA 2EBNA 1UWUA 1E40A 2VZTA 1JAKA 5A6AA 5A8OA 2QMJA 1JYVA 1KQYA 3OIHA 1ZB5A 5AY7A 3GNRA 1FP8A 4XZWA 3LMYA 3CZJA 3RM8A 2PWDA 4B9ZA 2NT1A 3WBEA 4PMRA 1UWQA 4MAVA 3WBAA 3WD4A 3RJXA 4TOQA 1EHNA 5ECUA 3VIMA 1VENA 3WUFA 1OT1A 7CGTA 1GUVA 3UR8A 4MDPA 3DX2A 3WDHA 1UWTA 1W1YA 1HVQA 3OLIA 3QOMA 3PTMA 4K68A 4LQ1A 1NOUA 2E9MA 1DWJM 2EPMX 4WJXA 4JFSA 5E09A 2G41A 2WZEA 4LPCA 3MV01 1CECA 1HNYA 1KXVA 1WPCA 4KGLA 4ZFMA 3W0KA 1V6XA 5C70A 3AHTA 1KCKA 4ZXLA 3AJ7A 1EO7A 3WY2A 3BVVA 1V6UA 1FHLA 3LX9A 4NRSA 2X09A 1XYZA 3BUDA 1X1NA 1RH9A 1MVYA 5I23A 1JDAA 3ZSSA 1V6WA 1HTYA 1V02A 1HL8A 3W29A 4PUDA 3VMNA 2VRJA 3A6OA 4J3XA 1BYBA 1HJVA 2B31A 1HXKA 3BLPX 1C91A 2WZIA 3BUPA 1NQ6A 2CBIA 4OZOA 3TTYA 2GSJA 3CTTA 3HG5A 2ALWA 1GHRA 5BRQA 4E8CA 2J8GA 1O7AA 3GXFA 2D1ZA 1JZ3A 4TTUA 1V3IA 3L4ZA 2XGIA 3PZMA 2DT0A 3AISA 3VVGA 3GNPA 1G0CA 3MSDA 3WMBA 3SCUA 3CV5A 5C8BB 3ZR5A 4OKDA 2V38A 2BXYA 3CBWA 4JCMA 3KLKA 3TV8A 3THDA 4A4AA 4FNUA 1W91A 2XSAA 4TVUA 1F4AA 2EPNA 3AYRA 1WNOA 2PBOA 2YL5A 4V27A 5E0CA 1DWHM 5FD0A 1UH3A 4AZ5A 3B9AA 2D73A 2WW5A 3ZIZA 1LG1A 3CHDA 3NIYA 2ZX6A 1V6YA 3D50A 1W3LA 2WC7A 4OBRA 3TTOA 1UD4A 1BQCA 3WD0A 3KE0A 1W2VA 4AD1A 1QNRA 1QNOA 4LYQA 2PBGA 4UZSA 5DEZA 3SIMA 1JZ6A 2BFGA 4UCFA 3A4AA 3CUGA 3OZPA 1UA3A 2D3NA 2QV4A 3WDRA 2XWEA 1ZL1A 1HJUA 1QHZA 1V3HA 4DO5A 3AROA 3CUHA 4P8WA 1WZKA 3CZSA 1I1WA 1JGIA 3UEQA 1TQWA 1U33A 1B3VA 1EA9C 4UFLA 1NWSA 2BHZA 4YPJA 3SCWA 2XM2A 5CJ5A 2IGTA 3NDZA 4W7WA 1FFQA 1LL4A 3QR3A 2YFOA 3VKKA 2D22A 2GDVA 1J0IA 3BMWA 2ESCA 4NZJA 1GORA 2XN1A 2PI6A 4W87A 2DSWA 3VIJA 1BVNP 3AS0A 3NSXA 4PMVA 1JD9A 2HVMA 1R34A 2YA2A 2XGBA 4HU8A 3WNOA 1E1EA 3KLLA 2Y8VA 2E40A 2XUCA 4J3VA 3EDEA 1XC6A 1W32A 2FHFA 4PYSA 1WZMA 5BROA 1SYTA 3FW6A 2CIPA 1L0PA 1UQYA 3EJRA 3RCNA 2XM1A 4FNRA 1EHAA 5LYRA 3BCDA 4DWSC 2ZUVA 2VCBA 4BS0A 3ECQA 3KL5A 2QMKA 2FE0A 6A3HA 1BYDA 3BUQA 3OB8A 1OBAA 1XD1A 3KL3A 2W62A 6TAAA 3FNDA 2CITA 3L4VA 2XN2A 2WWDA 2Z1KA 2O9PA 3ARVA 4P7OA 1GOKA 4X9YA 5I24A 2JEQA 3AIBA 3WUBA 5D9OA 4J3UA 2BS9A 3QHNA 1OSEA 1UYQA 3K8MA 4W88A 2CETA 1E43A 3SCSA 4HA1A 1LJYA 4WKHA 3L4XA 2O9RA 3BAIA 2C0HA 1WZAA 1C7TA 2VZUA 2XG9A 4HZ6A 3SUUA 5I2UA 4P8UA 4FNPA 4QP0A 1HT6A 4AMCA 4JZ5A 3CZNA 1M04A 4YN5A 1EOKA 1QNQA 3CZLA 2ZXAA 4HA3A 4GO8A 2A3CA 2CESA 3QOKA 3AXIA 5FIPA 1NOWA 4PUEA 1VFOA 4AD0A 1CXKA 3ZJKA 1CENA 4AW7A 1JL8A 1K9EA 4MB5A 1E3XA 3VD3A 3EYPA 3L4UA 4DUXA 4UFKA 5AYIA 2BNJA 2G3MA 2VRKA 2DDXA 1W9VA 5ABFB 1WO2A 3ARSA 1PIFA 3HG2A 1TVPA 1CXHA 3VMOA 2YBUA 3L4YA 2EJ1A 2J74A 1G9HA 5A2BA 5AC5A 2DSVA 1SMDA 1JIBA 3GXNA 3S5ZA 4JIEA 3MMUA 2CEQA 1KTCA 3EJTA 3WNLA 3F5KA 3CZ8A 1MFVA 1E4LA 1D3CA 4HMCA 3PZUA 4BQ4A 2RGMA 3DHPA 2ZX9A 4WK9A 5EB8A 2V5CA 3SUWA 1OB0A 1H2JA 2DSZA 3LXAA 4BA0A 2DIEA 3K46A 1QPKA 4B3LA 1H49A 1GPFA 5A6BA 4LGXA 3T09A 3LRKA 3UG3A 1CXLA 1GQJA 3PZVA 1BG9A 1V3MA 1VRXA 2XFRA 4WSJA 5A1AA 3IK2A 1B1YA 1CIUA 3PBGA 1UR1A 1JZ2A 4QAWA 4EANA 4D71A 1C93A 4U5IA 1HKMA 3VMPA 4OOUA 4W85A 1BLIA 1WAWA 3FHQA 2VR5A 1EOMA 2V3FA 1UD5A 3CLWA 3AHVA 2YA0A 3AFBA 1DWIM 1E6QM 4XZBA 4EK7A 2O9OA 2DH2A 1MW3A 3QHOA 5DMYA 1JNDA 2YKKA 1W3JA 3VPLA 4KRTA 1C8QA 3GH7A 3M07A 3LRMA 1EDGA 4RE3A 3KZSA 1UA7A 4GIAA 4FLSA 3LPFA 1DEDA 1MQQA 3B9DA 2D3LA 2GUYA 2WXDM 4AZCA 5CGMA 1UD3A 3WL1A 4W7UA 1B3XA 1UKOA 4UOZA 1PX3A 2ZUSA 4UQBA 5CLWA 2ZUUA 3WNKA 1RPKA 1OGGA 2WNWA 3KWXA 1UWIA 2OWCA 1LL7A 1W9UA 3MUAA 1UZ4A 2DGAA 1VF8A 4GQQA 3BH4A 3MO4A 1QI0A 4ZENA 4RE2A 3WH5A 1GVIA 4W86A 2YDRA 4UQ9A 3W82A 1H3GA 5DT5A 1KR0A 2XWDA 5KEZA 3W24A 2WKGA 4AD4A 1BF2A 5A94A 3GXPA 2FGLA 3AICA 5CGTA 5IFTA 3EDFA 5BYWA 2WVUA 1C92A 1I75A 4AY1A 2WLZA 3DX0A 1H5VA 5E6YA 1XSIA 4B9YA 1UZ1A 1EXPA 4S3KA 2BHUA 2VZSA 4D6GA 1CNVA 1C3FA 3SCQA 1ITCA 4WKAA 3W81A 3VDBA 1R87A 1X6LA 4AZ7A 1UR9A 2F7PA 2BY2A 1S46A 4JFWA 3ZMRA 1OIMA 7TAAA 2J79A 1BGAA 2W5FA 5IDIA 4H8UA 2D2OA 2OSWA 3D4YA 2VQTA 2BXZA 2F7QA 3GH5A 3B9EA 4KH2A 3ZSTA 3D3AA 4W7VA 3RO8A 2Y4SA 5A8QA 2VTFA 4XUYA 1WDRA 2F7OA 1SMAA 1PBGA 4WLCA 3VIPA 4AZIA 4AIUA 3GXTA 3TONA 5FOOA 2NSXA 1HKJA 3JUGA 1JXKA 3ZQ9A 1C7SA 2YL8A 4S3JA 4CGTA 1UR0A 3GZAA 2W91A 1ZJAA 1UR2A 4W8AA 4AIOA 5HBFA 2QHAA 4AWEA 4CD6A 1KXQA 1GOQA 3CPUA 1Q6CA 2YA1A 1C90A 1T0OA 4HMDA 1UD8A 1ISYA 2YL6A 5CPTA 2WCGA 1E73M 3CMJA 1E6ZA 3ARPA 3PTQA 2XIIA 1V3KA 3T2OA 4WIWA 1YQ2A 2OW7A 3PZQA 2CPUA 2C7FA 1E1FA 3AS2A 1MXDA 2EQDA 2JFEX 1GZJA 1KWGA 4AMWA 2J77A 1HKIA 3OZOA 2W66A 1W2PA 2GJRA 3BC9A 1MQRA 3POCA 3VIOA 3VIHA 2VRQA 1FHDA 4HA4A 4PMYA 3EDJA 1E6RA 3HG3A 3QHMA 4M82A 1ZS2A 2FGZA 3GXMA 1XSJA 4HPHA 2XPKA 3OGVA 1CYGA 4KGJA 3SUVA 3DX4A 3F4VA 1CBGA 4DM2A 2CCRA 2XVPA 4JKKA 4WKFA 1E6NA 2X0YA 3W6LA 2J78A 2V3EA 3EDDA 3CZGA 3VD5A 3S2CA 2J7BA 4N0RA 5A2CA 1TE1A 5JBDA 4XB3A 2WVVA 1JDDA 1J0JA 2V3DA 1PIGA 3VD9A 2WMIB 4MPKA 1H11A 1B0IA 2J47A 5EBAA 2CXGA 1B2YA 2GK1A 1QOXA 2WCAA 3VD4A 1MXGA 3LPOA 2CBVA 4HZ8A 2XN0A 4P7LA 5E6ZA 1DWFM 4U33A 1MW1A 3DDFA 1E72M 1GNXA 4Z2JA 1W3KA 4IPLA 3DHUA 2XVGA 5A6KA 1Z32X 3WNMA 4MB1A 3SCRA 3VSVA 8A3HA 3LRLA 1Q6FA 5ABHA 4CD5A 1H1NA 4ZE5A 4UQEA 1M03A 1K9DA 1R8LA 5KZ6A 2A3BA 4MNMA 4ATDA 3NYDA 1V0NA 2EEXA 4TX8A 3TTSA 3SUTA 3WMSA 4J3SA 1W9DM 3A4WA 3N12A 4MAZA 4Z2LA 4FNTA 5E9AA 3VGBA 1ESWA 4JHZA 2WMHA 1VFUA 1H41A 1JF5A 4M81A 5CXPA 1QX1A 1BVZA 2ZXBA 5CLTA 1JZ5A 4FLQA 3TP4A 2EPLX 2VI0A 3GBDA 4NX0A 4NZFA 3RMEA 1G94A 3T2QA 2CKSA 2VZVA 1FH9A 2VX6A 4PMZA 3EMCA 4PTMA 1J18A 4CN1A 5CG0A 1NP2A 5M03A 2YBTA 3F5JA 2FYVA 3CMGA 3UCQA 3WF3A 9CGTA 1WP6A 3WMCA 5A95A 4D6CA 1TQSA 3AYSA 3NSNA 2XSBA 2EABA 4W89A 1BYCA 1ODUA 1JNEA 1B3WA 4PMQA 1CGXA 4UFIA 5HOSA 4E2OA 3IAPA 3L4TA 4JKMA 3WH7A 4HMEA 2DSKA 2XVNA 3GTNA 1JI1A 1UKTA 3VUPA 1CGUA 3BAKA 3WEMA 5DT7A 1WB0A 4PCSA 3OLEA 5E1QA 2VX5A 2QPSA 3BUIA 3N04A 3WDPP 4AYSA
chains in the Genus database with same CATH superfamily
2X1SA 1T40A 3RR4A 2A1WH 4BZ1H 1ZY9A 1S78D 4A3HA 4HHWA 1T41A 2PXYD 2N1TE 1XT5A 1HO4A 4P59H 3GVQA 2JE8A 3TN5A 3LJ3A 4R3SB 2OMWB 3T9WA 2FO4B 3GPSA 3MMDA 1EUNA 4WEUD 2DFAA 3GWJA 1EC9A 5G4HC 4ONHA 4AEHL 5ENWB 3PZGA 5FESA 1W1B1 1QPPA 4UWMA 1N67A 3GC2A 3SDYL 4PJEF 5FYJH 5CM1A 3WL9B 3GJFA 3A9IA 2J2ZB 2J7GA 1SFJA 3C8NA 2Z1PA 1XWVA 1QI2A 2DZBA 5KVFL 1EX5A 3B1UA 5MHSD 3CVCA 1S9VA 1KB5H 3L08A 4DYJA 3NSCA 4KKCC 3RP1A 4PYGA 3TJIA 2VUYA 4K8RC 2EG7A 4KBXA 3DRQB 3F65A 4X8XA 3VX1A 4OZHF 3Q0HA 3SI9A 4C6JA 3BLKA 2EECA 1BG4A 4PJ9A 4LDLB 3P9LB 4AH7A 5C09A 3WUWA 4G7RB 4J4KA 1AJ2A 3TFKC 1A6AB 2J6WA 5LBSL 3NAAH 5TQ0H 4JYDA 2GW5A 5A6JA 4M7KL 3DN5A 1AP2B 3L4CA 4XKYB 2BB0A 4CCCA 3OBKA 4OJYA 2CIKB 4RL3A 1CFSA 4CC4C 4AUUA 2G0KA 2RR3A 1Q6DA 3RIFF 3V0GA 1E15A 3TX9A 2HPOA 3G77A 4XD5A 2NXIA 4P05A 1TV4A 1XAUA 4DPRA 3VXMD 3DXAA 4LPTA 1U8PA 1P7TB 2M2DA 4S39A 5I0DA 4BI7A 4JFVA 2EXOA 4ZMNA 3EOTL 3RU8H 2YXMA 2PSNA 1QVBA 3NACL 3RO6A 2F53B 5ITBL 3SY0B 2J8HA 2WJ5A 4JFFB 2EIJB 1LLWA 4ILSA 4PQXA 1E65A 4NNPH 2B7OA 2PGWA 3PJTA 3GUTB 3SDAB 1AIZA 4E2DA 4XP9H 1WV7T 3IU3A 3CM4A 2QIIA 1QT1A 3TPKA 4D8PA 4Y19D 5GGTH 4KWVA 5HNUA 4BF9A 5DVMA 2HT4C 4RZ5A 4Q8VA 2QGBA 4TUJB 2HT2D 2HFFB 2EG8A 3V79C 1SY6L 4DF2A 2O5ZH 1QYGL 3AU2A 1QHPA 3WL0A 3W38A 1MLBA 1TX2A 4NWUL 3MNZA 1XI3A 1FNAA 2LW3A 1ILUA 1HJCA 1MNUL 4KJWC 1XGTA 1VPYA 1PZ0A 2OFQA 3QMRA 1S5VA 4OT1H 2Z00A 2CGYA 4OLYL 2XYCA 3EYOB 2NUPB 4AMKH 1A3XA 1GCYA 1NSNH 4IFRA 5JZ7D 2NY0B 1AHWC 5MP6H 4MJ5B 3CHPA 3PZ9A 4M7LH 2BVTA 1FOBA 2HH0H 4G8EB 5AUMB 1KYDA 5ANMA 3ITLA 1IGMH 4JOMA 3BV7A 5BUPA 4F37F 3PHOB 3GDTA 3H2WA 3BPLB 4NZRL 1A7QL 3DGDA 2AMXA 2ISDA 4PGBB 2FYMA 1T0MB 3QUZC 2EDMA 4WW2B 4ECLA 4F66A 2FPTA 4PBFA 4PJBB 4LYPA 4N2DA 1GYMA 4YWGH 2DT3A 3PDDA 1QFOA 4K3JH 1O68A 5ID0A 4ABQA 3HRZA 1KCSL 3T6XA 2JJVA 4GQPH 4TUOA 4WK4B 3TC6A 4NO5A 1W0WA 3VFGH 1ESOA 3VXRA 1D2KA 3N9GL 2EVIA 4WJG3 4GQ9L 3Q44A 3MVSA 3HB3B 1PXGA 1JAEA 4PRWA 3QRGL 1TYJA 1GGIL 5GIRA 1NFDF 1N5AB 1N0LA 1QTYT 1FNEB 2EE2A 3DOIA 3ATDA 3H7BB 4LO9A 4JZNA 2FIQA 5HJ3B 3KH3A 4HT1H 2NY3B 3MLXH 1BAGA 3UACA 1G1KA 1GZPA 5DTFA 3S4TA 3NSDA 3FT0A 4NBYB 1UOKA 2DWXA 4RK8A 1FFRA 1T89C 2OXNA 4HX1A 1E9PB 4NDMB 4LSRL 3MLSL 4JFQA 5MHSE 4LALA 1PB0A 3HS0B 1RUKH 2C15A 3VVVA 4Q9QL 1XHGA 4HOXA 4P8VA 5DX7A 1PG7L 4FKKA 1Q9WA 3LNIA 1LDPH 4TIMA 1DQXA 3G1HA 1ERNA 1G7IA 3ZDXB 4JO4L 3LNFA 1T3FA 2WC4A 1IC7L 2VITB 4WJ5B 5F7DB 3PFQA 3AZUA 1WITA 3M88A 5FJOA 2NR6A 1NKOA 2QKIA 2PKDA 1JZJA 1FFOB 2HXUA 1L6GA 3GRBA 2CDGA 1SLVA 1A5UA 4DELA 4QRQB 4R2GC 3JR2A 4MJZA 1OFRA 2VCOA 4M8QA 2BLEA 1V54B 4MGXA 2FYYA 2Q8XA 4YSCA 1YPIA 3FU7A 1Y65A 3TN0D 4GRLC 3VXME 4RDYA 2D0HA 3MGOB 2JB6A 1I1RA 1MFEH 3TXVA 4J3OC 3MI2A 1WTGT 3AWOA 43C9A 1KCLA 2OX5A 3OGSA 3K6DA 2D23A 3MMTA 1ET5A 2X4PA 2YK1H 3G8EA 3T8XB 1PG7X 2X4RA 4NP9A 1JCJA 1S7QB 5GSVB 3P62A 3PREA 2JJSC 1EJ7L 3WQDA 4BUGA 3CDZB 4RGOL 2EKJA 3WAJA 4F9PC 1BAFL 3QFJB 3BSZL 1NL0H 3BOFA 1FNLA 3TH6A 1AXTH 4Y19E 1DJXA 1PFOA 3SZ8A 1NU5A 3NGBB 5FEBA 2EAWA 1KLGB 1RIVL 2INEA 4Q89A 2G0WA 2E9IA 4JTGA 5BXTA 2AITA 4MMXC 3O6FB 4U4BA 5C0GB 3MRRB 2R1WA 2ZG3A 4K9EL 2AJVL 5DD1L 3ZR6A 2J7DA 2WZAA 5EC2B 1DHPA 3PGCB 4DI9A 4MQSB 4KEUA 2J5LC 4Q58C 1HESA 4FNSA 4JRYB 4B9CA 3RK8A 1Q0XL 4PG2A 1I9JH 4FA6A 2OWWA 2DYPD 2GJ6A 1TVBB 5CC3A 1SZRA 1KM1A 4OF0A 1PYWA 2DL9A 4B5WA 1RHHB 1VEPA 3P3BA 2RBLA 4BWUA 4PHXA 3EOEA 2PC4A 3N9KA 4LUSA 4H5SA 1OGTA 4BUHA 4RNRB 4DN3L 1RUQH 4AD5A 5D7JD 4ADUA 1A7RH 2CUAA 1ZCCA 2Y61A 4XXCC 5DWUH 4C6FA 3H3PH 4HIHB 2W9EL 4KS0A 2HG5B 2B4CL 2Y25A 4Z7IA 2CHWA 1E55A 4MCMA 3SPVB 4NT0A 3E9TA 2P47B 4H88L 1F58L 5KSUB 1XIWD 4GMEA 4JFXA 1C8VA 3NSMA 1XLKA 3BHBA 4XPGL 4A04A 2QQQA 1EHLH 1TJMA 2A6IB 3KOFA 5JUEH 3G1RA 1I3UA 1KULA 4X98B 3VG9B 1UQSA 2X28A 1ZAIA 5E9DB 3NP3A 4YLCA 4R83A 1S7XA 2EYTB 2F1BA 4Y2OB 5ESQB 3WFBL 1TUFA 3S2JA 3UJEA 4JZOA 1PE1A 2J75A 4H7VA 3UJSA 4CEUC 1DFBH 3GSOA 1VFLA 5KYNA 4LEOB 2VE6B 4E2VA 5I30L 5A2IH 5DF0A 3A21A 2HTMA 3W57A 3WMQA 3AY4A 5DMKB 2ZZ4A 4LVOB 2OZ3A 1TMQA 3MSYA 4FLHA 3EGXA 1D7DA 2NDGA 1G7HB 1BJMA 5AWNL 2CHDA 4PFHA 5EO0B 2FJUB 2AAMA 3A64A 4KDWA 2FX7H 2NY7L 4L4TB 2FZ3B 4MWFA 5T5NF 3N18A 2BMBA 1OLLA 2IDUA 1ZAHA 4UU9B 3N73A 2I9UA 3FO2B 5FJPA 3WFCH 4G7YL 3BKYL 4W9FC 1DN2A 1ZMYA 1DJNA 1U95A 2VWEE 3UPRB 3TO4B 2VDPB 3WEOA 3AMLA 3QEQE 3HI1A 4IIFA 1R3WA 1FKXA 4YQXH 1VGEL 5DLML 1IEHA 1E2VA 3L48A 5LNWA 3DVFA 4LPUA 1K85A 2FB4H 2GSIB 4QCEA 4CJ0A 2NY4D 1KBJA 2ZX7A 4KUZL 2IPTL 3AS3A 2FD6H 2X3BA 4XXWA 2VZ3A 3OZ9L 1E7VA 1I3RB 1RUML 4NGHH 4YDKH 1BVKB 4JG9A 1QO3A 5KSAD 2KI6A 3EHBC 1UD6A 1JWUB 3HC3H 1T5WB 2DQGL 2Y72A 5AYTA 4QHKJ 1GJWA 1W1TA 3HR5B 3DTDA 4XNYL 4CUCA 4GMSH 2BZCA 5JLZB 3RNKB 5DVPA 2HJFB 4ETQB 3DSFL 4MA1B 5DJ6A 2VZTA 2DQDL 4K23L 5C2UB 1KQYA 5BRZA 2QKFA 4ZUUB 2PDLA 5FHAL 3CO8A 3ZE1B 4IGBC 1RY8A 2G60L 1ZIBA 3CX5K 5HYIA 1SQMA 4KXAA 3UZQB 5B39B 5TJWK 1H3PL 4XUGA 3TCTA 4FXJA 2DLTA 5LNRA 5C2GA 3DRTB 4A21A 4DZIA 4X6FB 1XSOA 1VBGA 2EPMX 3V18A 4B9PA 3BPNB 2WZEA 5CPNA 5E94A 3P77A 2BCKB 5DD6B 1RL1A 1R3LB 5L0QC 4OFYA 1DN0A 5SV3A 3UTQB 5GS0H 4C90A 5DQDL 1X1NA 4EUPA 1JGLL 5I23A 3RVVD 3OG6B 5DRNB 3W88A 2ZBTA 2DUXA 2YXFA 4NC1E 4MA3B 4ONVA 1XGUA 3TH3T 4QRRA 1G7MA 1MI5B 1LO0L 3VNIA 4YIQA 1UB6A 3SQOL 5JYMA 3BKMH 3AO0A 2XUWA 1SFHA 3X3GH 1A5AA 4YS1A 3REQA 4HH9A 4GY4A 4KDVA 4TSBH 4W4OA 5D5MF 2NSQA 2DT0A 4QRFA 5I6MA 4KK6D 2BFVH 2Y5TA 1ZVYA 2NVAA 4FNUA 4PJ5D 3UPBA 3BRGC 2HPTA 2V4LA 1MLCB 2EG6A 4I3RL 1HSAB 4E3VA 1SEBB 3KPPA 2K3TA 3TTOA 4A6YL 3WD0A 4GYBA 1T0PB 3MOAH 2NXGA 3RA7H 2A4ZA 2G3XA 4YHLL 2R27A 2J88A 5EZLA 3FJ6A 2VIRA 5C2CA 3O3UN 2H2PC 4B5XA 1XYCA 2FNBA 5EUOA 1POJA 4QNEA 2QSVA 5I6XB 1UROA 1FNSH 1SGKA 4AJWA 1VBJA 4X7CC 1KN2L 1HCYA 1NC2D 5J6HA 4UR7A 2ZOKB 4LUYA 1KKOA 3B2XA 4KZEH 4M7TA 4RGMC 2EDHA 4HHAB 4M6MH 1RCYA 3T1FA 5CIPH 4OZ4B 1EO8L 5I8EA 3UGVA 4K9JA 5FYLL 3P2BA 4MDJB 5DS8A 4BFOA 2JKLA 1XD1A 2XPZA 3KL3A 3AT0A 2CITA 5IMMA 4UNVA 1DOSA 4DKDC 4FXLA 4M6UA 3CXOA 1I3GH 3SCSA 2NX5A 4US6A 3L4XA 1VFBA 3KNBB 4Y4HA 1E4JA 4DGYL 4YBHA 3SQBB 4K8HA 2H32A 2V2WB 3ZVHA 4ESKA 3CDCA 1OPOA 1NICA 4DUXA 3KWTA 4GIEA 5D9SB 4LU0A 4F7TA 3SGDI 2VRKA 2YD3A 4XZUA 5LJYH 1OARL 1FDJA 4WX2A 3APDA 1G9HA 4JFEA 3MP5A 2CWNA 1JXFA 3N2MA 5AC5A 1ZHBB 3IDNB 3MNWB 4JIEA 5EOCH 3GRIA 3QYMA 2K8QA 2EZ0D 3ZWSA 2EVGA 3K2GA 3ZKXC 1JEZA 1VFAA 2B7QA 1QPKA 1A3LL 1YTEA 4F5CA 4ZXBA 2GY5A 5I8OL 2J6EH 5G55A 4RZ6A 4U6VH 3J2PA 3KGSA 3P61A 2I9LA 2CG9X 3W0WB 2ODHA 4QOKB 1N8OE 1Q3NA 2A9NH 1YY8B 3SSJA 1D6VL 1G4RA 3KRSA 1RQEA 2DH2A 3QHOA 1B5TA 1KBVA 1ZDQA 3D2TA 2PU0A 2Y3NA 5ESVA 2CKBL 3ULAB 4W9IC 3MV7B 4BH7A 2IG2L 4XN5A 2FEDC 5CSGA 4I6KA 4A2MA 1UKOA 4BK5A 5ALBH 1RPKA 4XPBH 3EYSL 1GVIA 5F21B 1YLBB 5KEZA 3PU7A 4QHLA 1Q38A 3O8XD 2KH2B 1SZGA 3MNVB 1S3KH 2IBBA 5DQJA 3AICA 4PW4A 2MQ0A 3NA4A 1WK0A 2GC4C 4PTTA 3UFIA 1JRHL 4K39A 2OLAA 3TR2A 2RFXB 1S7UB 1PV8A 4KI5D 4BSJA 3IRSA 4PJ5E 1OIMA 2W79A 2FTWA 4FFWC 1X8FA 3S34H 1PHQA 5F9JA 4QYAA 1JZIA 4GW5B 5LBVA 3VFOA 5I19H 3GH5A 4WW2F 2C9PA 4H1LB 3BIBX 4IQDA 3IRPX 1EJOL 4HSAC 4UZGA 3AVEA 4KRPC 1KBIA 1GS6X 5EUOF 3H2OA 3EJZC 3IUIA 1L0YA 5FOOA 4NEHB 3PF3A 5EU5B 1JHLH 3RRXA 4FAMA 3CWGA 5E6IC 5F2IA 3GSRB 1QQDB 3B7UX 3RDTA 1DR9A 3CPUA 2IS7A 1KDJA 3CLEH 1RZIA 3QC0A 1V3KA 2B9BA 5GGSY 2VDLH 3NT0A 2CPUA 1M3UA 4WJEA 3KWVA 3MRGA 5KJRH 1F11A 3NZ1A 5CMAA 5DJAA 4AVHA 1ZTXH 2BSRA 4P2QD 1ZS2A 4P4KD 1SF3A 2XTJC 2VMEA 2AK4A 3M7OA 3F1QA 2CO4A 2J7BA 2MOGA 1AQFA 5F1IA 1KCUH 1KCXA 3S3BB 1B2YA 4WFHD 2WCAA 3P9MA 4OCLC 4HXBL 4J6IA 3TT3L 3WN5C 1IXQA 1IHIA 1HILA 4GCAA 4CD5A 2BP8A 1H1NA 4UT6L 3HPZA 3BZEB 3F2CA 5AFAA 3QJFB 4ZZKA 5A3ID 4E38A 3CQFA 4BSWA 3QUYA 1LRNA 3N12A 4LY4A 2HJPA 1WFMA 3EB3A 1CICD 1R5VB 1LWIA 1QRQA 2G75B 4G6ML 2BNUB 1RBOB 3KXFB 3HGOA 4F7EA 3BQUD 4Z7VE 3ME3A 1S7WA 5CG0A 4B5EA 3WLSA 3QK0A 2P8CA 4QDWA 1Z0MA 1WP6A 2DD8H 2OL3H 1JNEA 5T1LA 2Z31A 2GFBA 3URAA 4AKQA 1U92B 3QW4B 3QDAA 4LGRB 1EZUA 3GK8L 1NOAA 5DT7A 4GIOA 4LVNB 3QNXB 2PWHA 1MVUA 1E4MM 3V4UH 4JO2L 2JIWA 3HPLB 2DQMA 1AH0A 4IHCA 4L65A 1JN6B 3X11A 3KCWA 3HAEA 4GOAA 5E4OA 4UQCA 1C08B 3GSMA 4MX7A 3WUEA 1CDGA 1UOVA 1KFEA 4OIIH 3C6LB 4PULA 4U1JA 4FRWA 4G6AC 1CLVA 2DICA 1AL7A 2G9HA 2IALA 4Q7NA 3W4RA 3SDXA 2NYZA 3MLRH 1E51A 1ZK5A 3EBIA 4PGEB 1WFTA 3LKQB 1U22A 1US2A 4HIIA 3K5RA 4QRSA 1SSGA 1AQMA 1OAYL 1MHPL 1VFMA 4HZ1A 4Z3TA 3ARYA 1VF5C 4DYEA 3K74B 3WQWA 3IFLH 4GZJA 2Z1BA 4PJEB 1KB9K 3ZTNL 1VJSA 4FTVB 1TTQA 4WWOA 1EPVA 1CWYA 1DQLL 4KI5E 4F8TA 5E00A 1YO4A 1ZLVH 4A2EA 3WK2A 2OMVA 4IPPA 2XJ7A 3VFWB 3VH8A 4L5FL 3WN6A 1QHOA 2HCZX 1MREL 4XR8C 3LZNA 4LASH 1IWBA 4WJKB 4OZHB 2VC9A 3VXSE 1MJJA 3LNDA 4XOCA 3WFDL 1F3JA 4O18A 3QEUB 3VWKD 3O41B 4D0BA 1CFVH 4JDVB 3IJLA 1PSCA 5MENA 3FYOA 4FP1A 4JREC 4AGOA 4KX8A 3N3EA 4QTIL 1DQQA 2ZCKH 4X0NA 5CSRA 1NSJA 4X0KA 1HL5A 2NXYC 4YHGA 3RM9A 2K70A 1E0WA 1OTSD 2CLFA 1ASPA 4Y9EA 4IICA 4DUWA 4RMVA 2QGHA 2CZNA 2AXFA 5BXSA 2IKHA 3JSSA 5D1QC 1I2PA 5IHWA 5E2VL 5GGUB 4B2DD 4F57L 2X89A 1X4ZA 3KPNB 4LAOA 2ORBL 1FRGH 3WUZA 5I16B 2WHKA 4MAYB 2VSDA 1AO7A 3GXDA 2DI9A 1LK3H 3SODB 3W27A 2YUVA 1ZJBA 1XGRB 2PPCA 4DEUA 2VLMD 4LAQL 2XXCB 4CU8A 3GG1A 3MMEA 3AAZA 4CVUA 1UENA 2IW0A 1EFQA 3LHWA 1FAKT 3VGAC 2UY6A 4CCDA 1UPPA 4QY8B 4J1UA 1ACYL 1R5WA 2MTPA 1S5TA 4RV8A 1XLAA 4F7KA 4F9JA 1V02E 1UACL 4FA3A 1IV8A 3QZNA 3V52H 1IC0A 1DDTA 4E42B 4NSKB 4JFTA 2OV0A 1JE6A 3FSVA 5C55A 1LVEA 1E5ZA 1AA1B 1JK9A 4ZL1A 4ACYA 3IDMA 4XBJA 4Z5RA 4MDIA 4C47A 4R7DA 1AL8A 1SYSB 3S98A 3WIIL 4IRSA 1TUPA 2X42A 1QUNA 5B3JF 4X6CE 2VXUH 1U42A 1EEQA 4YLWA 4PFEA 5C0IA 1Z8AA 4JQ1A 4F40A 1XX9C 1WAUA 4YDIL 3A23A 2YD5A 2EUXA 4PWIA 7PAZA 4WWID 3TAOA 4R26H 3STGA 2YLAA 4RV3A 1Z3GL 1MW0A 4XBEH 3LTPA 1NIEA 2A9ML 1WV2A 1E71M 4UM9A 3H55A 3ZTEA 3KTXA 3B8VA 2D24A 3QJHA 1AQDA 2PLJA 4ONHB 4NUQA 2PO6D 3B9OA 4UOJA 1US0A 5BW7C 4QUOA 1OIOA 2IADA 2AGJL 3GU1A 1K72A 4K7FA 2JIXD 4S1FA 1KZYA 2PP1A 3GJFB 2XH2A 2OX1A 1F4WL 2DLFL 1HVXA 3V0AC 2VERA 4YYCA 1S9VB 1UM6L 4AENA 1UR4A 2ZE0A 1FYHB 4LBEA 2YD1A 3JW7A 4ZK8A 4P5KA 2QJNA 4MMZA 3CSGA 4A1RA 3VU2A 4LAUA 3U4KA 5D2YA 1JXGA 3CIVA 1N18A 3O2VH 4PJ9B 1UUSA 3GZPA 1ADQL 1LORA 3QRLA 2OA9A 2E8ZA 3OF6D 5C09B 2XFYA 3WUWB 2M8XA 3TZVA 4DWSA 4NIRA 5HDQL 1G6CA 3FK3A 4RSYA 2EICA 1CLYL 2D69A 1K4HA 3QG7L 3T77A 3LXCA 2HWZL 4P5TD 4TUUA 3WQCA 2O5YL 3TTEA 4L8CA 2FECI 5DMIL 1BQLL 3DXAB 1HN1A 1XLDA 1QAPA 1EJVC 4WSKA 1U8PB 2UWEE 2E47A 2XWZA 5IFPA 5HYQA 2WQDA 1BM7A 3G04A 1JCYA 3ZM8A 1A5FL 2FX9H 4JK0D 3M47A 2IPJA 4BFIA 3B8IA 1F3XA 1RIHL 4Z7AA 1QP1A 4RDWA 5C0BA 3IU3B 1CGWA 4NC0B 2YRZA 4HPOH 2J62A 1DHKA 1P7BA 1OAJA 2ITEA 4X5QA 4D8PB 5HJXA 5C8JA 3AM8C 2D8KA 4FQ1H 3EWUA 1VKFA 4YL9A 4AQOA 5DJCA 3D4ZA 2FZ9A 1WAAA 4S38A 1VZHA 1S3RA 3H9SA 1MLBB 4JM0A 3MNZB 2ZCLH 4IJCA 1XGTB 5I18L 2CGZA 3RFAA 1TETH 1PY9A 2O5NA 1XICA 1QSEE 5FM8A 4TU1A 4JHBA 3CFJA 5IJDC 3T5WA 2HKHL 1PLAA 1EAPA 1MUCA 4AITA 3BD3A 4N26A 1ZK9A 4Y7OC 3FN0H 2XG4A 4XMZA 4IP5A 2ZIDA 4BZ2H 2HX9A 3GD6A 5ANMB 3AHYA 3OKEA 3BGFB 4QXIA 3RZCC 1J0ZA 4J28A 1PAZA 1PZSA 2B20A 4G1MA 3OMIB 2RJGA 4XMLL 3QSRA 4ZQNA 3Q2VA 2EDKA 4GRWH 3H6AA 4RSVA 3W7DA 3SUSA 5ID0B 1XF3A 3QJVB 2HRWA 3HRZB 2NQHA 4TUOB 4XP5H 4NO2A 1I9RL 1V0LA 4NO5B 1W0WB 1T20A 3VXRB 3VA2C 4OUUA 3V4VA 1FQ0A 3O4LD 1XUUA 4U10A 1BW8A 1WFOA 1C1EL 1SO4A 3VQMA 5GIRB 3GIQA 4JYFA 4EKJA 1N0LB 2A6LA 4NZUL 1R3RA 2KPWA 4M7LT 1KCZA 4JZNB 1QNPA 4HGMA 4JN8A 5H94A 3D0AA 3WEAA 4XO5A 4TN9A 1GZPB 5DTFB 3U6XS 3LD5A 3V5HA 1RK1A 2ZADA 4EI5C 4JTTA 4YL2A 5DVOA 4ZMQA 3VWJD 4C4KO 4HX1B 5TH2A 2VQ1A 4JFQB 4JNZA 1PX4A 3ETBF 2XC8A 1GEHA 5CR1A 4LPXA 3VQLA 2DVUA 1HUVA 1X5HA 1I1AC 4P07A 1YXYA 1N0XL 1Q9WB 2XQ0A 1Q6RA 2WQRA 3Q8BA 1G7IB 1AKJD 1T3FB 4LSPL 1BXCA 3VG0L 2QKIB 3VGHA 3NIGF 1M01A 1G69A 2TAAA 1KDIA 4PH6A 4M7JL 2CDGB 4L4PA 3SDCA 3LCGA 4MMYA 3UCCA 1ZUAX 3N6JA 3A4XA 3I9AA 4M8QB 4JKPL 2FYYB 3S5YA 2OOGA 3FU7B 2W60B 4H9ZA 2JB6B 2AFNA 1WZ1H 1KNWA 2A99A 1U3HC 3IEAA 2OX5B 2QNEA 4L4VD 3H26A 2X4PB 2AQ1A 3FA5A 2CHZA 2X4RB 2WO2B 4UTMA 1ZD6A 2DV6A 5EEYA 2NY2C 3TJHC 4IBZA 2ACUA 2UY5A 3LN3A 5IBXA 1EXUA 3BAEL 5FF4A 5HNTA 3TLLA 1KJVB 4RFEB 4R5VA 4RZKA 1WAAF 3HE6D 4NAEA 2ITDA 2C8NA 2GK0A 2XA8H 5KAQG 3SOBH 1FY6A 1X4XA 2QADD 4YSRA 1HXMA 3RVXC 3PAOA 4O52A 1L8PA 4W6XB 3VDGA 2F8XC 2AXJA 1BIHA 3APFA 3M64A 3LOWA 3M5ZA 1F1GA 1OD9A 1FUYA 1LBFA 1HGYA 4HJ0C 4OF5A 2RJHA 1ZLUH 4GP5B 4JQ3A 3S1XA 2R1WB 3QH3A 4I8DA 7ODCA 1W1YA 4QSHA 3HFML 4YHKL 2GIMA 1OK4A 5E09A 5CUSH 5KW9L 3VW3H 4ZODA 3MJ6A 4U3SB 4Q9RH 3BJSA 1V6XA 4JO1L 1F4XL 2GJ6B 3NVDA 1NBYA 3AJ7A 4ZTXA 2DZEA 3ZY7A 3ABLB 1ADSA 3ZSSA 1CE1H 1HTYA 1V6WA 4LH8A 1PYWB 4ZPTA 1W8OA 4ZR8A 3A6OA 3I6KA 1YA5A 3EGJA 4RA0C 1C91A 4H00A 4LUSB 2FDSA 2J3SA 4H5SB 1OGTB 5JMRA 1JHTA 5T9BG 4PWGA 1BFVL 4C6IA 3ETSA 4B9JA 5DK3A 1SEQL 2BOLA 3ULUF 4LNCA 1L6ZA 3VKCA 3CWOX 1FC1A 1UP2A 2PP3A 3HC0A 4X8JA 1WG3A 1AMXA 4JG5A 3KLKA 2BIHA 1RBAA 2XIMA 1IUZA 3KLHD 3FA3A 1FVPA 1YEGH 1WNOA 5D5MB 1UH3A 1KT2A 4KU1A 3GSQA 1DANT 3A5FA 1RJCA 4JPVL 1NUFA 4JFXB 1UG9A 3BHBB 5F8RC 4GW4A 3O4LE 1QNRA 5FEZA 4YJ5A 3SIMA 3CUGA 3T8VA 1ZL1A 1UQSB 5DC9B 3HN5A 1S7XB 1OABA 5BS0A 4XPHH 4CC4A 4ZQCA 5HA7A 4AE1A 2PD5A 1MY5A 5EU6A 3BMWA 4JZOB 2QHLA 5IDZA 4AH2A 3GSOB 3FJLA 2QVNA 4I3SH 2JGYA 3T2NL 1JUFA 3CN2A 2NWSA 3EO9H 2XUCA 5E56A 1W32A 3ILQC 2GJLA 3EGXB 4FR6A 3NSFA 5C9UA 2TRYA 3Q48A 4G8GA 1B3OA 2QMKA 6FABH 2R29H 5F7BA 3I4KA 1HW6A 2WWDA 4MWFB 4JUTA 3QIUC 4CMHB 3D85D 5AAWC 2Q2LA 3Q1SH 4HA1A 1XLCA 3L3KA 4QX4A 1WFNA 3E6HA 3CXFA 1R2RA 4GNJA 3BDBA 4QP0A 2HK1A 3HI1B 3AADB 3ZDYF 4NUGL 1OCRB 1ML0A 1RLCL 1O4UA 1F6KA 3UAJD 3ZE2F 5LHFA 4AD0A 2BSTA 3FQYA 1M9WA 4DAGH 2TSYA 4MASA 3MJYA 4I18C 3FTVA 1O5QA 2XGZA 1ML1A 3RLHA 4F0KA 3ROOA 1SXAA 4L4VE 1ES0A 2P0OA 4YHML 1BWKA 1FYTA 4Q56A 4PB0L 4RR4A 5F72S 3MMUA 5EOTA 3MREA 3VXTA 4OIBA 1ICPA 1AHWA 4JRXD 3U3HA 3MYPA 1DXIA 1TG8A 3AW5A 2VC2L 1RJLA 2BX5A 4Q7BA 4DN1A 2EXTA 3M5YA 3W00A 1K8CA 1CDYA 1CXLA 3OGOE 2ZKXA 5DJ6B 1VRXA 4XNXH 1GIGH 4WSJA 5BRZB 4XNUH 3QUZA 4QAWA 4LGSB 1WTLA 2YA0A 5F96L 3DX7A 4J4PC 4US5A 4YVXA 2P1FA 3U7AA 1YUHA 2QQ6A 5I8KH 3IGKA 1EDGA 5I3JA 5FDWA 5E94B 3P77B 1H19A 4FLSA 1DN0B 5HI4D 1KTRL 3E2SA 4QNPE 5ENLA 4XOBA 4EUPB 1UWIA 3TYEA 4GQQA 5KETA 1XGUB 2E7LC 3BE7A 1QNIA 1URLA 4YIQB 1UB6B 3SJVD 1JPSL 5A94A 3L5MA 2IH9A 3WCZA 5IOKA 1F3RB 5C0QA 3REQB 4HH9B 2FBOJ 3GFYA 4GUCA 1CNVA 3C5ZD 2P5NA 1T89A 2Y5TB 4NL1A 5D93B 2JBMA 2FJFA 3WS3A 3A6CH 4B6ZA 4FS0A 4PUMA 3GYRA 5D05A 1B88A 2OX4A 3KPPB 5J3HD 4IMAA 3C2OA 2PMQA 5I1AA 4HWNA 1A7NH 1W8EA 3EF7A 1T7LA 5I1DA 3TC7A 1QOPA 2F7OA 3A9BA 5EZLB 4DGIH 4WLCA 4AZIA 3BWUC 3SJ3A 2VIRB 2A9AA 1HEHC 2D7OA 4ZUVA 4RNFA 5EUOB 1V27A 4BA8A 3HLKA 3O45A 1TPDA 2V37A 3GSWB 5J6HB 3VRLE 1FWCC 1PL9A 1E73M 3P67A 3ARPA 2L7JA 5DZAA 1FGVH 4UBDC 4OM1L 3QY8A 2E4FA 3RKPA 1BVOA 1FHDA 4AZ8A 4XNBA 4B5TA 3T1FB 3MBXH 2FGZA 4EZMA 4J6RH 1J1XH 3OGVA 1NANI 5I8EB 4FFZH 5DRWA 5DS8B 4ZO6A 3SBRA 2JJSA 3ZFHA 5IMMB 4PEKA 2BS8A 15C8H 1YIXA 4F9PA 5KANG 1WKDA 2CBVA 4N5ED 1VFBB 4HLZH 3ZW3A 4QJ3B 1XBZA 1PO9A 2R4RL 2XVGA 3PFRA 1MAML 3AWNA 2H32B 1IXOA 2YD9A 2F38A 3CH1A 4LLAA 3ZVHB 3RX2A 1KLYA 4Y2LA 4IGSA 1N26A 4F7TB 4MMXA 4XZUB 1UOZA 2W9DL 4BFBD 2GAZA 4JFEB 1J9RA 3MRIA 3RMEA 3AB0C 3II2A 3DK2A 1TZIA 2VSCA 5KVGH 4CN1A 1GVFA 3EH5B 3QEQD 3F5JA 4JRXE 5EHFA 1A1NA 4AM0Q 3HNSL 1VFAB 5DZ9A 3OJGA 4XN7A 3NSNA 1KV7A 3D69A 4ZXBB 2ICWI 4JHMA 2EDEA 2DSKA 2HFEA 3MV9A 3C8KA 5B8CC 3G6AA 2I9LB 5GSRA 1JF1A 1LEIA 3WDPP 3R10A 3NJLA 4XXCA 3UWZA 4M6OL 2J9ZA 3OG2A 32C2B 3BW2A 3UZVB 1KC7A 2NXZB 5I1HH 4LSSL 1UT1A 2AQVA 4KK8C 4IMGA 5FGBC 5ESVB 2E27L 3L1GA 2POTA 3ZRCC 1LHZA 2ZRVA 3GG8A 4BH7B 5HMEA 1YLVA 2HVKA 2C7UA 4AT6B 3A4DA 2EPOA 1YEDA 5BU6A 4KOCA 1MQPA 4HWEH 3Q06A 5AVQB 4ONGH 1Q65A 2TSAA 2NZLA 3O9WD 2BINA 1NCGA 2W38A 4QHLB 1DCEA 5CEXA 3SJVE 3FAWA 1U6AH 3R0MA 5DQJB 4YE4L 3W7MA 4KO9A 3T4AC 4O57A 2Q5BA 4UT9A 2FWLB 2YSSA 3B2UC 3HHRB 4BQCA 2VEMA 4PTTB 4PHZA 4R33A 3QNZA 1IZCA 3MODH 5HANA 5AZEL 4FQLH 2EHHA 3BPOB 2VN7A 4R5XA 3JWNE 2ROXA 4QLJA 4BRJA 1JG9A 1IXPA 1R9XA 4FQXC 2VDQL 5F9JB 2A83A 3HIJA 2HNEA 2F8VA 3WLMA 3X13A 4GO9A 3VFOB 3SCMC 3WD3A 2E7HA 4FQJL 3FCGA 1HDMA 3QHFL 2PW1A 3BEWA 3CVHB 4JNXA 3GC3A 1JHKH 1GYVA 4R8WL 1SZNA 2B39A 2BP0A 2X1XR 4HPYL 4FB7A 1Q6GA 4HVXA 5FC9A 2EE9A 4Q6YA 1RVFH 4FYQA 4IRZH 3GU2A 4S0HA 2XZAL 3RDTB 3DFTA 2GWGA 2AEWA 1T1ZA 3QPXL 1S8DA 3RY6C 2C9QA 2OM5A 5CINH 1SUHA 1I7UA 4Y1TA 2O4EA 5LA2A 4D8AA 3MRGB 1F11B 2D0GA 3TW9A 5DJAB 5T3ZH 4OBTA 1KPRA 4TV6A 2OW6A 4QGYA 4NN5B 4AWTA 1F7BA 1FDZA 4EF9A 2AK4B 2P1YA 4Y9OA 4RDVA 1RZ7H 4W8BA 4ZQOA 3UXDA 1E4XH 1PZ2A 4TULL 1T5XA 2FEEI 1A65A 5F1IB 3FH5A 1NUNB 3P9MB 4AUJA 3ESPA 3QUXD 3VFTA 1YKWA 3GKWL 4BUQA 1HILB 2BP8B 5E1HB 4WCYL 1FWXA 3LXUX 1O9WA 4IGBA 4TSAL 5I3DA 4BSWB 3QUYB 3OHIA 1GHFL 4K9EC 3TJEL 4R7WA 4QDMA 4P9HL 5C0AD 3HR6A 3NCMA 5DR5L 1EDTA 1RMFH 1QWUA 1X7QA 1K6QH 1B3ZA 4FXTA 4QNWA 3A5VA 4HLZG 5F0LB 5EBGA 5CGYC 4PRIA 1RHCA 4XP4L 3ZXAC 3AXLB 4PR4A 1S7WB 1F56A 3K2UL 1DE6A 3SRHA 4WK2B 1YMHA 2APTA 3HNTH 4GAGL 1EXHA 2QL1A 1EQCA 3TV3H 1QFWH 3R5EA 5T1LB 2Z31B 4GZ7A 3WTWA 3LS5H 2YCEA 3U2OA 1QZNA 2B59A 1FBAA 4XZLX 4P7RA 4XVSH 2FWUA 2B4CC 5DJDA 3NL3A 1KA9F 1VBUA 5IQNA 1B2WL 1NMCB 3RVTD 2JMRA 3WH9A 4EPKA 1O5XA 3N0AA 5JW4N 3WDJA 3X11B 4O4VA 1YADA 3HAEB 4NQSA 4MX7B 2HWGA 5G1TA 2XDFA 1PLBA 5JR1H 3LD8C 5CWSA 2P80D 1DSYA 1C16A 4U1JB 5C0JA 2G9HB 2V5DA 3BZGA 3SDXB 1H7RA 2ZOOA 1AE6L 1HI6A 1FBIL 1L7TL 4DQOH 3FSWA 5LNDA 1Y1UA 3R19A 1Q8JA 5F3BA 4AK2A 3FUKA 3NJHA 3P11L 1RZKH 4POYA 3VGDA 4K7VA 4HIIB 2VLRD 4QRSB 1PJ9A 5B38G 3QUHA 1AFSA 4NT6A 1M7IB 5HYFA 2XV0A 1W3TA 3RCMA 4GBUA 1IMHC 3OLDA 1J5DA 4K1GA 2CHOA 5TDPA 4L61A 3EMQA 1N59A 2FJHA 4PB4A 3H53A 1EO5A 4LLWA 3I6LE 4OSUH 5E00B 3I02A 4OIFA 4HWBL 2PDGA 4TMBA 2OMVB 5AL0A 2EIBA 5FF6A 3VH8B 2L5HA 5CN3A 3QDJD 3PG2A 2LTQC 2Y07L 1MJJB 2CLOA 3QXVA 1UQZA 4N02A 1QEWA 2R56L 5E2WH 1SW7A 1F3JB 2F2KA 3U2CA 3O9NA 1FF5A 5KSBE 4D0BB 5MENB 3TQPA 1A7OL 5ACMA 5M3WA 4YTTA 1DQQB 4E5XA 5CAHA 4X0KB 2G3NA 3KBPA 2WLLA 4WWPA 4Y9CA 1E50A 3NCOA 1MFAL 2D7TL 3DX5A 2CKRA 5D2VA 5IXEA 4QHUA 2D3JA 4GZEA 3QVQA 3ZKQD 2X1TA 3P84A 4UF7C 3T0TA 4X50A 5DJZA 1AC6A 3Q7JA 1CR9L 4Q3MA 1TVDA 3NXFA 2IH3A 2A85A 2M83A 2ZYRA 2AQWA 5DHDA 3GHUA 3WFLA 3MX0A 1FPTH 1O12A 3ILDA 3NPXA 2RDWA 3QZWG 1K5WA 1Z48A 3SCOA 5ITFA 3TSDA 4HS6A 4ODHH 1UYWH 3KH4A 4MNQD 3MMEB 3AAZB 1NAMA 3LRHA 4F0HA 2VXVL 3IWPA 4G8FB 3U0WL 4EXQA 2UY6B 2XHYA 4KJPC 4L9XA 1QI5A 3WQVA 4J1UB 3EJUA 1T7YA 1R5WB 3BLBA 4KNSA 1ZLSH 2PGRA 2BSED 2XFGB 5C0AE 2H6OA 1U2HA 4LEXH 4IXXA 1IQWL 3SYOA 3N25A 3FBKA 4ALDA 2ZF8A 5HVGB 3D07A 2DDQH 4GBXD 4RDZA 2ZRZA 4LDEB 3H2MA 2VXQH 2YXWA 4NQVA 1OSYA 5I1KL 5E0FA 1EKOA 1PVNA 3LLDA 3OG4B 2OOFA 3UY8A 3IPFA 3DFQA 3IDMB 4Z5RB 4MDIB 4R7DB 1Q2RA 4IRSB 4O5LL 4NYLA 2J1WA 4TTDC 1QUNB 2DW5A 4IJ3B 5CHNA 5E99L 2B14A 4KKBC 4E9XA 5C0IB 2QDWA 1T2JA 3ES8A 3IMVA 4NO0D 3HV8A 4HUCA 2E74C 1JFQL 3EZ8A 3V4PA 5DZNA 2P8MA 4HNOA 4YIWA 4E36A 4BV1A 2WWMC 3LKPA 2RQ8A 3D52A 3GTFA 4OQVA 1CDHA 2OCFD 4XODA 1QLEL 2DZAA 4UM9B 2PP7A 3RN6A 2C1IA 3QJHB 1AQDB 2NY5L 4DO6A 1HL9A 4LPVA 4YHOL 3GNOA 1OW0C 3BISA 3UP1A 3RJOA 4HUWA 5GGVL 4OCSL 4J2XA 3WHE0 2V5JA 2IADB 5E6IA 2FH6A 3UGEA 1HJBC 2VLRE 4K7FB 2BJML 2QQNH 4H8WH 1WE5A 4CNSA 2FDBP 2ENYA 2VKWA 1QK0A 4AENB 1JGUH 2YDAA 1UCBL 4LBEB 2CH8A 4JRWA 1QRNA 4P5KB 4MMZB 2FKPA 3HLAA 1F45A 1T8XA 4JFUA 2AQNA 2QVMA 1QZ1A 2X8RA 3TZVB 4DWSB 3FS9A 3QDJE 4PJ7E 3D2UA 3H2CA 2AGTA 3KDMA 1N4XH 3W1AA 3TCSA 1RAMA 4MZ8A 3T77B 4I1NB 1W56A 4ES8A 4XWGH 4FNLL 1M2OA 3NIGB 3T6ZA 1EEPA 4AQ8C 5GGRY 4JN1H 3RWIA 3WN5A 4L8CB 5ANHA 4I3GA 2ICWA 5C6TH 3G1AA 4H8HA 3QJTB 5AOIA 4O02H 1TSRA 3SOTA 2ENJA 3QI9C 3ULVD 4FXSA 5HYQB 1AGBA 3G04B 2OTWA 3VXSD 5DQ9A 3CB8A 3THCA 1AJ7H 1W3IA 5B7EA 2XH4A 3TW6A 2OMBA 1OD8A 1VIWA 2TODA 4BFIB 5K4XA 1A7PH 1D2PA 1EZSA 3PUEA 2QPDB 5DUML 2J7LA 2VDMB 3VB9A 3AIQA 4PMUA 5CAYB 3ETTA 3HZ3A 4DPQA 1CL7L 3CFQA 5C0BB 3CYVA 1PKMA 2GABA 4XAPA 1A9EA 1EVTC 2B7DT 1RLDA 3MLVL 3UCDA 2H9GA 2VW7A 3BFOA 5C0FA 4Z1BA 3EX3A 2B1HH 1HJQA 4FG0A 2EBNA 4JDEA 5C8JB 3UD6A 3SE3A 4R3UA 4MNQE 1R0AL 5DJCB 1TPEA 4FC3E 4G11A 5E1IA 2GHZA 2WV3A 2ZUYA 3C60C 4GAYA 3H9SB 1C12A 3WD4A 5IBTH 2APWA 2PR9A 1VENA 3HQPA 1FVCA 1D9KD 2ITFA 3FLUA 1LO2L 4B41A 3HCVA 4KK5D 4K94L 4LMQI 3RX4A 4N8PA 4XX5A 1I82A 4JFSA 3TYGH 4NHVA 3BWWA 5DS1A 3CFJB 2BG5A 1M1SA 3GRWL 4NM4H 3SGJC 1EAPB 2B2XL 3LZRA 2HA1A 1KLUA 3I74A 1RA0A 2XG4B 3D3VD 1LXMA 4JPQA 4YNYA 4YXKL 3IVUA 1RIUL 3EUDA 3S8FB 3IT8D 1J48A 5U7SA 2AABH 3OKEB 1I1CA 1T7ZA 1NQ6A 2B3IA 1FDLH 5D70L 1CB7B 2ALWA 3BUTA 3U30B 3ECBA 4G1MB 3QWRA 3LCXA 4ODWB 5GISL 2AS5M 1S7VA 1DBKH 1GKEA 2UZYA 3CV5A 4P4RA 1ZE3H 1U5JA 2HMID 1P5BA 2F54A 4DWDA 1OAZH 4RGNC 1YECL 4NPYA 3AYRA 1XF3B 4G8IA 3QJRB 3MRMA 2ISVA 4NO2B 3B9AA 4EPSA 1SU5A 3NIYA 4ZW5A 1W3LA 4UIMA 4OUUB 3V4VB 4LSDA 2N59A 2R4SL 3P4MA 3V5KA 3KVLA 1UB3A 3DX8A 1G9EA 5HHXL 2XX0A 1M7OA 3G6DL 4YNGA 3Q43A 4DO5A 3CUHA 3LH8A 1HKFA 2ACRA 1A8ZA 3QG6A 1JGIA 2BP5M 4C65A 4OFPA 1WBJA 3UZYA 5H94B 4JN2A 2MTAA 4P2OC 3OZKA 4W7WA 1FFQA 4PMEA 3V5HB 2GDVA 2XQYK 1RK1B 2DSWA 4N8VA 3NZ8A 1O95A 3M0HA 3I84A 4BFFA 3C8HA 3SE6A 5TH2B 2VQ1B 3KLLA 4UINL 1OGAD 4CW1A 3K80A 1BM3L 3CFUA 4LPYA 5BROA 3SRDA 5D1QA 2GJNA 4H20H 3ABZA 3I50L 3E3QC 2W62A 3HIZA 1U3YA 5AAMC 1KIPA 4J3UA 2NY6D 4CADB 5I5MA 1JPEA 3SDCB 4BFJA 4MMYB 2C0HA 4W4NA 2W0FA 1ZHAA 1K7XA 5EORL 3IFPA 1M04A 3ZDZE 2RDXA 1VPOL 3N9SA 3P30L 2XFXA 5D32A 1VFOA 3ZJKA 1KJ2L 1K9EA 1H0DB 3O4OB 5DBUA 1IAIL 4ZNEA 3ZDYB 2VC7A 2AEQH 3ULVE 4IIDA 2G3MA 3ZE2B 4XVOA 2V8MA 3S6DA 1QWHA 4M1BA 3S5ZA 5AZ2L 2HLFD 4DWHA 1MN4A 3ELAT 1GPWA 4QROA 2ZX9A 1EXUB 4UTIA 3ZHKA 4WDXA 3QN3A 3CIXA 4NAEB 5I3IA 2ITDB 2V68A 4U1SA 2GK0B 3R58A 2XFRA 4BQ8A 1X4YA 1EIXA 4WI0A 3R7MA 3QE5A 2ILLA 1IGIL 3W56A 2IQAA 1HXMB 3UL4A 3DBXA 4OOUA 4Y89A 2Q3AA 3HBQA 2J43A 1F42A 3UBXI 3AFBA 4Y5VA 2QR0B 4TS6A 3WTVA 5CEYA 4UTBL 4TYUA 3QH3B 1JNDA 3PL6C 4LHUD 3AXKA 3X1GA 3QORD 4NCC2 4P23D 1DEDA 1NBYB 3MLTA 3B9DA 4C6KA 2EDNA 4Q14A 5B4MD 5IQLA 2PU1A 1GKQA 4KCTA 3D3VE 5K9OA 4WZHA 4ZPTB 1GOHA 3I6KB 3CFDA 3ML8A 3R1GL 3UF9A 5BW7A 3MDJA 3ABKB 3W24A 4JEGB 1IQ8A 3NN8A 4X80H 2ZC8A 3GXPA 3L1OL 4YSQA 1GGCH 3O7UA 2WN3A 3DMMD 1JHTB 2X4SA 1OAUL 5E6YA 1OK6A 5C07A 2PYEA 2N7AA 3W76A 4JTIA 1SJCA 4PTNA 1QSED 4PUUA 1N64L 5EMLA 4BJLA 4I0PC 5FOJA 3HC0B 4X8JB 4IU3A 4X6BA 1XLBA 2OP4L 3COTA 1A0CA 3ARBD 2JKEA 3DFPA 5AVWB 2UZIL 4K36A 1FLRH 2H90A 1KT2B 3FCSB 3GSQB 3MJGX 3F4DA 2XT1B 3BJ91 3WXVL 2Z65C 4UIKH 3NQBA 4GW4B 1E28A 3QSTA 3RO8A 2PTUA 4HCRL 2DQ6A 3LCFA 4H26A 1TQBC 4EQ3A 4JQXC 2ADJB 3QEGL 4ZO7A 4AGPA 4WI9A 5BS0B 3G1SA 5CU9A 1XW8A 1FSKC 4ODSH 5EU6B 2Q8ZA 3HGSA 2PDJA 3UP8A 4RWYL 4HB7A 4PWKA 2ZWNA 4AH2B 1F02I 3SDXF 3TE9A 3CQJA 2K9FB 2RAGA 2C7FA 5BOEA 1JUFB 4N90D 1GAFL 1OGAE 3N43F 5F4WA 4R6UA 2IOOA 3QMSA 3RFZC 3MKVA 4NVTA 2FGWH 1A5KC 3R0DA 2YAQA 4G8GB 1CBGA 4HUVA 3GNXA 3R12A 2X0YA 2R59A 4ZX6A 4CDGC 3SFWA 1Q2SA 5JBDA 5D72H 3VD9A 1B57A 2CXGA 1NDTA 1FA4A 1HHGA 3L3KB 3DDFA 1GNXA 1K3IA 1ACZA 4Z2JA 1ZLWH 3BLIA 3E6HB 4IMKC 2HFGH 1AGFA 4MB1A 3AM8A 2IQ0A 4WY0A 4UQEA 1M7DA 2VOMA 5KZ6A 1DQML 3W7KA 4ERGA 3GVGA 4PN6A 3NQ8A 2BSTB 4GUGA 4FMKA 1BZ9A 1YE4A 1WICA 1H41A 3TKFA 5KVEE 1V5JA 5LXGL 2XQYA 1QX1A 2LLNA 2MPAL 3ROOB 1ES0B 4HBKA 5EF0A 1FYTB 3TP4A 3APCA 4X4KA 5HGHA 3URBA 2O6PA 5EOTB 1HNFA 1CFSB 3MREB 3VXTB 4XGZA 2GKIA 2KS0A 1AHWB 3K2IA 5M03A 1XQKA 3ELFA 3ZKNC 3BT2L 4H9MA 4IUOA 4U3HA 1CGSH 4GS7C 4XRCA 1RJLB 3AYSA 4W9GC 3ZL4H 3H2NA 2N56A 4LT7A 3H9YA 3GFXA 1O9VA 3BYTA 3RZCA 1G5GA 3AYVA 5LDUA 4AYMC 3A6BH 1AYOA 3QUZB 2GPZA 3GLCA 3TEYA 1IU1A 4OQTH 2PTYA 2XLLA 4XP1L 3O6KL 3MU7A 3DX7B 5DEFA 1U83A 5F71A 3E8VA 1W6LA 1YUHB 2B15A 1DWAM 3DERA 5E4AA 2EO7A 2GSHA 5BZDA 2JKTM 3S3SA 5FDWB 4KUCF 1I45A 1YNTA 1M4KA 4PAZA 2B9AA 2FVMA 2XSXA 3GWQA 5DA0B 4JIHA 2V5YA 4RZCA 6PTDA 4H7ZA 3W37A 4G9DA 2WKLA 4AV4A 4S3DA 1CQKA 4IX0A 4MF4A 4ZQRA 5SX5K 1HWWA 4B3EA 1KYAA 1ISXA 3CHEA 4EI6A 1I9EA 3M0VA 3ABMB 3ME0A 4IQJA 1JERA 3B2VH 1IZJA 1H7OA 1CTOA 3RIKA 4EI5A 3ITVA 4C6LA 1CBVH 2VXSH 3OL2A 4PP1C 3RX7A 1IM9D 3HBZA 3ZJ6A 4IJTA 2FJFB 3WS3B 4Q4MA 1OZTG 4JTUA 4H2AA 5JW4M 4DUOA 1UA6H 1LG2A 2XV2A 2FBJH 3LNMA 1NIFA 1I1AA 4TF4A 4F80A 3O2DH 2F58H 8TIMA 5I1AB 5C9KA 4O2FA 5XIAA 3I3BA 1D7BA 2WBJC 5I1DB 3MI6A 2GIYA 1INDL 4NQXA 4S11A 4ORZC 1XLEA 2MHAA 3QUML 3LCWA 1II4E 2QSCH 4IUGA 2YQ3A 4D7PA 4FZ8H 2FX8L 1A4JA 4KROD 4ZUVB 5TPWL 3DO3A 3G3DA 5F7MC 3O45B 2J5WA 3LNEA 1I31A 4NKIL 1TJ2A 2Z1XA 3SW6A 3OA5A 3GVWA 4DPPA 4N90E 1U3HA 2CDEA 3IGHX 3MI3A 4FS9A 4PMFA 4AZ8B 2AV1A 1XLLA 2O61A 3BIAX 1MJUH 3IRCA 2BIOA 5DRWB 5KVMC 5F1SA 1EEUA 3UC2A 3FONA 4K3EH 1S7SA 4IJRA 4OTXL 4IMFA 4PN2A 4C7GA 4WY0F 2YQGA 4JEJA 3S2AA 2J72A 4XI5C 2APFA 4YMPA 2IQ9L 3GSUA 3V7AE 3K8KA 5SWSE 3VYOA 5M5DA 1QBLL 2HRPH 3CH1B 5KWYC 1A66A 4QHRA 4BK8A 1OOAA 1ZTMA 2F1EA 4RRPM 1B3YA 3GYEA 2X3AA 3QPQC 4MMXB 2IUZA 3IAQA 3KOYA 2D9CA 1L9WA 1BV8A 2FIKA 4JIQA 4FX7A 4LSUL 2J5LB 3MRIB 4ZW7A 3ALXA 2J8FA 1A14H 1TZIB 5LAXA 3STFA 4NAQA 4X83A 2O92A 4HUKB 1A1NB 4HU2A 3BKJH 3F01A 1NMBH 4Y9GA 4MJIA 2BVOA 3D69B 1AS8A 3S1VA 4CCEA 1MCNA 1DQDH 2WWKT 2HFEB 1J9YA 3MV9B 3VTRA 1E5UI 3C8KB 4WUKH 4AEEA 5C97A 2UZ9A 3G6AB 2E6JA 43C9B 4B3KA 5GSRB 1JF1B 3OGCA 1LEIB 3W5MA 1YNTF 2YAMA 5DD5H 1OCQA 4NRXA 4C6MA 5DLLA 2VEGA 3MJMA 4BQ5A 2BHYA 4G59C 4XP6L 1JNJA 5D2LE 2ANUA 3DETD 3URNA 4LARL 4OJAA 3H23A 1GQIA 1TPFA 4IRJD 3WNPA 4S23A 3K8LA 3VIGA 4HMNA 4CD4A 4FCAA 1D5ZA 3ABRA 2Q01A 4L05A 3QLLA 1FE8L 2Y6ZA 1PUDA 4LYRA 3TVMD 4YGVA 5CEXB 1NGQL 3FDKA 4EWJA 1HZHH 2PWFA 2QQKL 3SDDD 1YYMH 2YSSB 2YRLA 2EKCA 2ZKMX 2F7FA 3QNZB 4JY6A 3UWVA 3KBHE 1XGYH 2Q6WA 1XVSA 4FQQA 5HDBB 3K81A 1NLDH 4Q4KA 2XIQA 4P9MH 3F5WA 1SZEA 1PZDA 2A3TA 4FYTA 4GISA 4EIZC 2H8PA 2VEIA 2ZTJA 4LVBA 2A83B 4JDTH 3KPQA 1A6TA 4XAFA 4UOW1 1GQNA 4G56A 4AZHA 1CT8A 3VILA 3X13B 2HPIA 2Z9TA 5CJ8A 4AUBA 1HDMB 4JKLA 1K02A 5JA8B 5XIMA 5IESH 1NPJA 3BEWB 4F9LC 3LQAL 2G2PA 3UGRA 2DQHH 4Q0XL 2BP0B 4IKNA 3QIUA 1KC5L 5AAWA 4ZZ9A 3ZYOA 3ELQA 3KUMA 1CVSC 3RKDD 4M93C 1SVBA 3WTUA 3TOPA 4J3TA 1T1ZB 2ZD0A 1S8DB 3GJEA 3EA3A 3LQGA 3D48R 5LDSA 1NAL1 4UOQA 2WXPA 3G3LA 3GH4A 5AVHA 2Z28A 1KUMA 4X9HA 5IHSA 3NIFE 1I7UB 4Z1CA 4WU7A 5GS1C 4I18A 4OQ1A 1YEKH 1RURH 4XTRD 3UBXA 1ITUA 1KPRB 1RSYA 2EYRA 2YR1A 4KZDH 2FATL 5GZOD 1KN4H 4AEFA 3QPEA 3VOIA 1X39A 1KGWA 1I60A 4QWWC 3EHBB 5T91A 3QULA 3WXWH 1T5XB 2IIJA 4Z9KB 2Z7YA 2VHLA 2DT2A 4P46D 5LKNA 2EPHA 2YYUA 2IBGA 5AYBA 1Y1DA 1SN0A 3KEHA 1TMHA 5H8MA 3VFTB 3HKFA 1CC3A 3D33A 1OM0A 2NNAA 4GXMA 4W9LC 4IGBB 3N2JA 2Z93A 1H9DA 2R1YA 3UXLA 1EZVX 3CAFA 4J4PA 1KJMA 5FI8A 2I60L 3WJWA 3VFUA 4BEUA 4LUTA 1X7QB 2XWBA 4LVDA 4XD4A 1T6BX 4PRIB 3OYZA 3PHAA 2E6DA 1JGMA 1YMHB 2VDPH 1U95B 5LNUA 1BTMA 3WF4A 4HQVA 2RH9A 2HBVA 1GGBL 1DIKA 3VD2A 1OV8A 2BVDA 2E7LA 4Y5XC 2PXYC 5MKGA 1WBZA 2RGLA 3QW9A 1OP4A 4V11A 3DJRA 1XBDA 2B59B 3U7BA 2QJHA 5DVLA 1XH0A 1OXYA 3K71A 4TQPA 3W25A 3FQUA 5DJDB 2NCEA 5CC6A 3CUPA 5HQLA 4PIRF 5I8CA 3LS4L 1OWQA 1UD2A 2FLMA 5JORA 4Y1SA 5D2XA 1QO3B 3EXLA 4KFOA 5I3KA 1QPNA 5DUBA 1US3A 5CEZH <