4M56A

The structure of wild-type mall from bacillus subtilis
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
559
structure length
555
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQRADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 221
structure length 555
sequence length 559
chains with identical sequence B
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m56A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m56A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m56A02
1H5VA 3N17A 3LPGA 2G41A 3ZM8A 4AISA 3EJTA 1GORA 1K9DA 3CUJA 1TG7A 3WEZA 1E56A 4UQCA 4AW7A 2BNJA 2YL8A 4W7WA 5HPOA 4W7VA 1NOFA 1E1FA 2VRQA 1JYXA 3AHZA 2A3BA 1XH1A 3MSDA 4QCFA 1ODZA 2WC7A 1JAKA 3WQVA 4LQ1A 3MANA 2WVTA 4JKMA 1RH9A 1UHVA 5DT7A 5ABHA 4KRTA 4CN1A 4E2OA 3BUBA 1J9YA 5DT5A 2J62A 2FE0A 1C92A 1E4LA 1BPLB 1MXGA 1ZJBA 4MTVA 4OBRA 1JL8A 2W4XA 3W6LA 1FP9A 3VMPA 2DIEA 1OD8A 2ZUTA 5I78A 3WL1A 3BLKA 3UCQA 4DWSB 3M6DA 1H1NA 2E0PA 4KH2A 4W5ZA 1TQTA 4BA0A 3VOCA 2ZX9A 3CZLA 4YHGA 4TVDA 4J28A 4CD8A 5IHRA 3EMQA 4CCCA 1QWUA 2J7FA 4GI9A 2D23A 2ZX8A 4FNRA 2E4TA 1EH9A 3VPLA 5JBEA 1E70M 3WFZA 2EEXA 1KXQA 5LA0A 3VM5A 3UERA 1MWOA 1JAEA 3TTYA 1WDSA 5ABFB 1TR1A 3DX0A 2VX6A 4JFTA 1S46A 2WZEA 2QHAA 4HP5A 4L4PA 1HVXA 3B9DA 2QPSA 3RM4A 5A8PA 2CKRA 3WIJA 3WNNA 2V3GA 1KGWA 1BGGA 1KTCA 1B30A 4H04A 4XZWA 5IDIA 4D71A 1SMDA 1HVQA 2VMFA 4ZFMA 4WLCA 1BVZA 2V3FA 3L4YA 4AZIA 3WNPA 2WAGA 3UG5A 3D51A 1WO2A 1V6WA 3THDA 1H0GA 1PX4A 3VD3A 1I75A 3DX4A 1HN1A 5A2CA 2XSAA 4X0VA 1GVIA 1WZAA 1IT0A 3KE0A 3BVWA 3WD2A 1KR0A 3RMEA 1DWIM 3LRMA 1W1YA 2DPEA 1QI4A 1E6NA 1QBAA 3ARSA 4Z2KA 2WW5A 2PBOA 1XCXA 3AXHA 4B9ZA 4XX6A 2FHCA 2D0GA 4ZENA 2A3EA 1V3JA 3FNDA 1VIWA 6CGTA 4WKFA 4UFLA 3VIHA 1BYCA 3AICA 2OSWA 4HPGA 4AZCA 1AQMA 5I2UA 4OOUA 3D5HA 3AQUA 3T0DA 2WMGA 2F2HA 4P7NA 1LF1A 4TTGA 4NZJA 3WN6A 4V27A 2YDSA 1GOOA 4JHZA 3WEMA 1OT2A 5AYBA 1JIBA 3VINA 3WF2A 1GJWA 5A6JA 1Q6DA 1XSIA 1ISZA 4FLRA 3BCDA 3WD4A 3N1AA 3LRLA 1B3WA 3HG4A 4UQAA 3QOMA 1AQ0A 1E3ZA 4LX4A 3A23A 2PWFA 4F8XA 2E40A 1K9TA 2JIWA 4JFWA 5ABGA 4W8BA 2HVMA 4NX0A 5AY7A 2WBGA 1W1VA 5I6SA 1MQPA 1VFOA 2ZICA 1EDTA 1HF6A 4HPHA 1LLOA 1CEOA 1H4PA 1WZLA 3L4XA 3ARQA 4MNLA 2X0HA 2NSXA 1QNPA 3DYMA 3W25A 5CLWA 3OLIA 3GNRA 5M03A 3W6MA 2CIPA 1C3FA 1UR1A 3U7BA 3IANA 4IUGA 1W3HA 2WVSA 1GONA 1Q6GA 3WF3A 2OYKA 4AD3A 4KRUA 1UASA 1A47A 3N04A 1CXKA 3RCNA 4DO6A 2W92A 2C7FA 2VT0A 1V3LA 2XVPA 1PX8A 2XJ7A 4MB5A 4AY1A 4ZE5A 3KL5A 3WMCA 1ZJAA 2EBNA 5A3HA 1JXKA 2WHLA 2W67A 4AIEA 4LGXA 1US3A 1UOKA 2WBKA 5A2BA 2XVKA 2XGIA 3CZEA 1JF6A 1M03A 3AHTA 2Z1SA 3CZNA 4ATLA 4A3HA 3BUQA 1BYDA 2WLZA 1E43A 2J77A 3CZKA 2DQXA 3WH5A 1GCYA 3ARVA 1E6RA 2PI6A 2XM2A 4GQQA 2XUCA 4OKDA 3CHCA 4IPNB 1GQIA 3LX9A 2QLYA 3WF4A 4F9DA 2XN2A 4CN6A 4ZXOA 1K9EA 5D9NA 1KXVA 2VR5A 3WENA 2VX7A 2FGLA 2VX4A 5D4YA 1HXJA 3PZVA 4MNMA 1NH6A 1JDAA 2AOSA 4E8DA 3LRKA 3QHMA 3RIKA 3HU7A 1IV8A 2J7DA 1VENA 4PTMA 1NQ6A 2VL4A 2BVTA 4MNKA 3BUDA 2YJQA 4QCEA 1DWAM 2YDQA 4CD4A 1F4HA 3RDKA 1HX0A 2FH8A 1EQCA 4MB1A 2BS9A 4DWSD 1BVNP 1J0ZA 1ZBWA 2XFRA 3VU2A 4MNJA 2WWDA 1GVYA 1MVYA 4PMUA 3W24A 2E8YA 3DHPA 1UWQA 3SCSA 1L8NA 4AZCB 1UD5A 3GNOA 3VMOA 1XH2A 3M46A 3GM8A 3PZQA 5CPTA 4AIUA 3L4ZA 1PPIA 1E15A 1V6YA 4FMVA 4AD0A 1P6WA 2ZWYA 4DM2A 1HJXA 1K6AA 2WCSA 3TOPA 1QPKA 4AC1X 4GZEA 1KWGA 2GK1A 1KGXA 2V3DA 4PMRA 3BXWA 1J0KA 2QMKA 1OGBA 1DWGM 1C8QA 2ZXDA 2TAAA 3IJ8A 1H09A 5DFAA 2OYLA 2EAEA 2VRJA 4XB3A 1JZ7A 1DWHM 2JF7A 5A6SA 3WF1A 1TQUA 3BSHA 4B15A 5F7UA 1KWKA 4PN2A 1CLXA 1C7TA 3PZGA 3OG2A 1XV8A 1FP8A 2Y24A 2X8RA 3BLPX 3T08A 4AZ6A 2XG9A 1HL9A 1JZ5A 1ISXA 1NOUA 2F1AA 2YL6A 2X2IA 3IAQA 2DSKA 2J47A 3LPFA 1JZ2A 3H55A 4J3SA 1UWTA 1R87A 2YKKA 3FY1A 1WDRA 1XYZA 1E4IA 3CTTA 4M8UA 4W84A 2WNWA 3GXPA 3VSVA 1VFMA 3WH9A 2B31A 5E0FA 3L4WA 3WQ5A 5EB8A 1GW1A 4F79A 4TVUA 1I1XA 4D6JA 1KQYA 4H8HA 3ARYA 1QHOA 2PC8A 3GZAA 4W8AA 4ML4A 1H2JA 1GOKA 4RE4A 1YQ2A 3RILA 2BY0A 3AYSA 1GQLA 2CHNA 2CBVA 2XVLA 4PMNA 4DWSA 3GTNA 1VFFA 1B1YA 5HNNA 4UOQA 2VO5A 4R5EA 2RGLA 3PTMA 3HJEA 1QW8A 1XSKA 4FNPA 4JL2A 4LYPA 1CTNA 4MJ2A 1ECEA 1TVNA 4BCEA 1XD1A 3DECA 4NZCA 1JFHA 3U57A 1OIFA 1AQHA 4ZXLA 5A94A 1HXKA 3AS0A 2DSVA 1R47A 2DT0A 4UZSA 3CHFA 2VZOA 1SFSA 3K8MA 2YA1A 2EPLX 2DT3A 4QP0A 2PWGA 4TOQA 1JYWA 5D8ZA 3LXAA 2Y2WA 1B3XA 5DO8A 3EJSA 4Q7NA 1O6IA 3A21A 4D6EA 1CECA 2CKSA 2F1BA 2GJXB 3U5YA 8A3HA 1CXFA 2ZWZA 1C8XA 1UD6A 4N42A 3QHNA 4CCDA 2CHOA 1Q6EA 1OGGA 2GJRA 1R34A 1CWYA 3ZT5A 4QLLA 7TAAA 1W3LA 3I3DA 1WKYA 2X2HA 1V0LA 3OGVA 5A6AA 3M7SA 1UKTA 4FNQA 4PEEA 4DUWA 3ZR6A 1JF5A 4Z2IA 4NRSA 2Z1KA 4UFIA 3DX3A 1EHNA 2F61A 3OA5A 4JKLA 4GINA 1WDPA 3WDRA 4X9YA 3VGFA 1W3JA 2CXGA 4CUCA 1E55A 4NF7A 2YBTA 1HNYA 4ACZA 1XD0A 3LPPA 3MV11 1HKMA 3MI6A 4FLOA 2GK1B 3CC1A 1JZ4A 1J0IA 3WY1A 1VAHA 1EO7A 1EOMA 2J7BA 2ZX6A 1NP0A 3GH7A 5BWFA 1UR0A 4B3KA 2WK2A 1HJUA 1B3ZA 5A8MA 1LL4A 3SCNA 3MSGA 3SCUA 4QLKA 9CGTA 3CLWA 3TV8A 4W8LA 4P8VA 2WC3A 4PCSA 4PYSA 1CZ1A 4LYRA 3ARXA 3M07A 4HA3A 3W0KA 3BUIA 3EYPA 3WFLA 1FHLA 2UY3A 2JE8A 3NUKA 3D4YA 5A8OA 3WNKA 4HTYA 4M81A 1V6VA 2A3HA 1ZBKA 4CVUA 3CMGA 1N82A 3NCOA 2ZXQA 3VIKA 2F8QA 1GOWA 3T2OA 3VGGA 4D6HA 1GHSA 1G94A 3H53A 4BS0A 1HT6A 7A3HA 4M24A 1CGWA 1J12A 3BGAA 3VIMA 1X6NA 3WMBA 4NSBA 5GNZA 2BHZA 3EDDA 4EANA 1B3YA 3HN3A 4C7FA 2F7PA 2OYMA 3OGRA 1GHRA 4D1IA 1W1PA 3N15A 3ARTA 4D6FA 3BAXA 1V3MA 4URIA 2NW0A 1BYBA 4AD5A 3ZQ9A 3CUIA 2IXVA 3K8LA 5CSYA 1FH8A 4OZOA 1JYNA 4TTUA 4Z2GA 5FOOA 4W87A 1UUQA 4HOZA 3UR7A 1E0XA 3L4TA 1PJ9A 1VB9A 2EACA 2ZXBA 3IJ9A 1UR9A 5CG0A 1HJSA 1BG9A 2Q8XA 3HG5A 1M7XA 3MMDA 1JNDA 5LA2A 1D3CA 4V28A 3WDQA 5CSUA 5FL1A 4H2CA 4UFMA 3BVUA 3AHYA 3SUWA 1V0KA 3PTQA 3PN8A 1KB3A 4TX8A 2WKGA 5HDRA 3WSUA 1G01A 3SUSA 3POCA 5TD4A 2CETA 3FAXA 3ZJ7A 1OM0A 2F7OA 2CBUA 3BMWA 4UOJA 2VZSA 2BVYA 3MS8A 3SCRA 2WB5A 1QWNA 1LQ0A 2FH6A 1V6XA 1VFUA 2XIBA 3QGVA 3UETA 3VGEA 1BGAA 2ZE0A 4PSRA 3JUGA 3A47A 4AWEA 1W2VA 2X2YA 1PIFA 1W91A 1E6SM 1PEZA 4UFJA 1O7AA 3RJXA 2IXUA 3ARZA 3PZIA 1QBBA 3AMCA 3NSXA 3O6AA 3KEHA 4EKJA 2CPUA 1VJZA 3CH9A 3VD4A 1M04A 3AYRA 1UH3A 4MJ4A 2E9MA 1NM9A 1V0NA 5I24A 2YIHA 5E6ZA 1D2KA 2D3NA 4ACZB 4BQ2A 5CXPA 1OGSA 4M82A 3KLKA 5GPRA 4U31A 3SCVA 1XC6A 4W88A 5GQBA 3VIGA 4U33A 4JIEA 1UH2A 4AXNA 4J3UA 3WELA 1YHTA 3NJ3A 1EDGA 4JHOA 3VX1A 1SR0A 2WHMA 2JFEX 4PMDA 3BAYA 3BH4A 1E73M 2G3JA 1R86A 3VDBA 1UD2A 1UA3A 4P7RA 1BHGA 5JIWA 4ATWA 3CIVA 4AIOA 3HG2A 3VIOA 3VD5A 3KZSA 3HG3A 4AD4A 2VCAA 3WQWA 2VC9A 4IM4A 2QV4A 1ZB5A 1TFVA 1V03A 1QI3A 4AMWA 3WUGA 3OIHA 3VO0A 5EMYA 1MW3A 2WHKA 1V0MA 3NDZA 3EMCA 3WH7A 1OBAA 2E8ZA 5BXSA 1JXJA 2CEQA 6A3HA 5CJ5A 4IISA 1CENA 2WMJA 4ZE4A 4M56A 3MUZ1 3N9KA 3SCOA 4WF7A 2BFGA 4LYQA 3VGDA 4XZBA 4DO5A 4LXFA 2WMFA 2CERA 1G9HA 4CU6A 2YL5A 4ZEPA 1DWJM 4GI6A 3AIVA 1NP2A 4P8UA 1NWRA 3WY2A 1J0HA 4C7DA 3OLGA 3AI0A 3ARPA 3PTKA 2XPKA 4PTWA 2OW7A 4DO4A 4D6IA 4AYGA 2JF6A 1UZ4A 1DTUA 3WMSA 3ZOAA 3FHQA 5C8BB 3A3HA 4UQBA 3VGHA 4AD1A 2O9TA 2NT0A 4QLJA 3D4ZA 4XUYA 3GH4A 3GXNA 1R75A 4MB3A 1CXHA 1CXEA 2YL9A 1LL6A 1XGZA 4MADA 4RE3A 5IXEA 1AMYA 4GKLA 1HKIA 2EJ1A 2VOTA 4Z2LA 2CNCA 3AXXA 2WANA 1PS3A 3K8KA 1ZU8A 3ZSSA 4U5IA 1UWRA 1CPUA 1WAWA 2VR4A 1MW1A 3PZNA 3OLDA 3OB8A 3WNOA 1PIGA 2F7RA 1TA3B 1UR4A 3RPMA 2MANA 3K4AA 3AFBA 3GXDA 1UD3A 2VZTA 4KGJA 3QOKA 4MDOA 1LG2A 1KBKA 1WNOA 3BSGA 3ZT6A 4DWSC 5A2AA 4N0RA 1TQVA 4AZGA 5LYRA 1ODUA 5GNXA 2D73A 2XN0A 4BQ4A 1HJVA 1GQJA 2WKLA 1B0IA 2D24A 5IFPA 5FIPA 4JL1A 2J7HA 2ZUWA 1FOBA 2G4FA 4HMDA 2XYLA 1OINA 4PSPA 5KEZA 4E4PA 3BUPA 4C7GA 2DH2A 3VX0A 4CKQA 5D9MA 1U33A 3AROA 2D22A 1BYAA 2GJXA 2ZUNA 1GOQA 3D50A 1HP4A 3KWXA 4PUDA 4PMOA 3WF0A 1UYQA 5BRPA 3NSMA 1VF8A 1W3KA 4DUXA 1VEOA 1CBGA 1XYFA 3GXMA 5IFTA 4W86A 5D8WA 3L4UA 3VGBA 4D6DA 2VI0A 3BVTA 1QI5A 5A6BD 3UEQA 4HU8A 1MFUA 1OIMA 1TUXA 2ZUVA 2DH3A 2WXDM 1WB0A 4UR9A 5AC4A 2WLYA 3NDYA 4U2ZA 3EJPA 1UR8A 4Z2HA 5A1AA 4D72A 1X6LA 4KMQA 2VJXA 4CD7A 1XCWA 1UKOA 5EBAA 4PTXA 3MMWA 3CMJA 3LXCA 3BMVA 3IK2A 2VCBA 4JAWA 1GZJA 4W89A 3PZTA 2CYGA 3MU7A 5JIPA 3WQ6A 3A4AA 1NWTA 4W85A 5C70A 4HOXA 3VUPA 1QNQA 1MQRA 3KLLA 4YPJA 2O9RA 2FDMA 3NIYA 1BTCA 5AC5A 1C8YA 5E9AA 4HMCA 1UD4A 3RJYA 1R8LA 4M1RA 1CXLA 1E3XA 1AVAA 4H8VA 1CDGA 1JZ8A 2XWEA 1LG1A 3WY4A 3PHAA 2EO7A 2X05A 1EDQA 4TUFA 2ZX7A 1EOKA 2ZUUA 2XSBA 3D52A 2UY5A 3GNPA 3CUFA 2D1ZA 4UNIA 4WJXA 1Q6FA 3OBAA 1FA2A 1D7FA 5FD0A 5E1QA 2GJPA 3NSNA 2BVDA 2V5CA 2WVVA 1ITXA 4EK7A 2Y5EA 4PRWA 3BAWA 2VTFA 2XTKA 2BXYA 2UWFA 2OWXA 3G6MA 1UQZA 3W38A 1FH9A 5BRQA 4W5UA 4X0NA 5DEZA 4S3JA 2ZXAA 1M53A 1HP5A 1EXPA 3SIMA 1X1NA 4HA1A 3WD1A 4JFUA 5FKYA 2GVYA 2JALA 4AZ7A 3AISA 3II1A 3VM7A 1E5NA 3FN9A 4Q22A 2D20A 4OUEA 1ZBVA 4AZBA 1E72M 3TONA 3SUTA 1GQKA 3CZJA 3L2MA 2EXOA 3WQ8A 3F4VA 3W26A 1V02A 1KR1A 3A22A 3PZ9A 3GYCA 1HKKA 3UG4A 1XH0A 3BLBA 3EDKA 5A6BA 5I23A 5BXTA 5EFFA 3VD9A 2ZX5A 2OWWA 1IZKA 4U5KA 4GXPA 3GBEA 3CBWA 4D6CA 1QHZA 4B16A 5A6LA 5A6MA 4RL3A 4A4AA 1HL8A 3HZ3A 3WNLA 3B9EA 2OLHA 1TZ7A 1W1TA 5A95A 4TXEA 5I79A 3H54A 1JDCA 4JFVA 5EFDA 4AEEA 4GI8A 4P7OA 3IAPA 3TTQA 4GIAA 3F5LA 1PZ2A 1EQPA 1GPFA 3OZOA 3N13A 3KL0A 1QNRA 1ISWA 4P7LA 2YDRA 2HISA 2XN1A 1NWSA 1UKPA 4AMXA 1BQCA 1QNOA 4FK9A 4U3AA 2IGTA 1UKQA 1OB0A 2O92A 2YA0A 1Q6CA 3LMYA 2YA2A 2D3LA 1VEMA 1HJWA 3E1F1 5KZ6A 3F5KA 2WMHA 3TTSA 2VUYA 1KFWA 1B9ZA 2PF0A 1QNSA 5M3WA 4UCFA 3AXIA 1TE1A 2BV9A 1G0CA 3MV01 3DDFA 3LXBA 1E4MM 3DYPA 1XRVA 4M80A 1B3VA 1E71M 1GOMA 5BXPA 1QI2A 1H3GA 3TTOA 4ACYA 1B90A 2GDVA 1E9LA 3L4VA 2WPGA 4YHEA 1V3HA 3CZSA 1UQYA 4AYSA 2D0FA 2BY2A 3WUEA 4E8CA 3WBAA 4TVCA 3I3EA 2D2OA 2DT2A 3AIEA 3SEPA 4KWUA 4J3VA 3AS1A 3VVGA 1VJSA 2AAAA 2XVGA 1BLIA 3S5ZA 4WSKA 3VTRA 5I77A 2VVSA 4FNUA 2FYVA 4AEFA 3SUUA 4HA4A 4A3YA 3W27A 4P8XA 2OSYA 3WD3A 2CBIA 3F5JA 4CU7A 2WSPA 1JYVA 4U3CA 4UQDA 2VX5A 1E5JA 2X09A 4FLSA 2X1IA 4AMCA 1UWIA 3L2LA 3SCWA 2F7QA 2WZHA 2X0YA 3AOFA 1NOWA 2V3EA 1MW0A 1R7OA 1E1EA 3VSTA 2WVVB 1QVBA 3WDHA 1EIBA 5I5RA 5CQ1A 4CD5A 4W7UA 3EDFA 5BCAA 1QX1A 2WWCA 3AZTA 3T0BA 3OZPA 2EPMX 1JZ6A 1CIUA 2VVNA 2XFFA 3CO4A 2OW6A 3CPUA 3D3AA 4OGZA 3EJRA 3WQ4A 1C7SA 1PX3A 3SUVA 3T0AA 4YN5A 2J7EA 4WIWA 4JFSA 2F18A 2UY4A 2DSUA 1KXTA 2XGBA 2Y8KA 3SURA 5HBFA 3WL0A 1R46A 1QW9A 2VURA 4NXKA 2JEPA 1B2YA 3VDHA 5DF0A 1EA9C 1Z32X 1W9UA 1MW2A 2QF8A 4WKHA 2O9OA 4CVWA 3PZMA 4AZ5A 3U7VA 3WDIA 1XHGA 4CU8A 1BAGA 1K9FA 2J78A 1SYTA 1WZKA 2BY3A 4J3TA 3N12A 2EPOA 2FGZA 3T09A 4EAMA 4MB4A 4NI3A 3ARRA 3WY3A 2FHBA 4FNTA 1KQZA 2CESA 4HZ7A 4D1JA 1TA3A 2EPKX 3WDPP 3ZR5A 2DSZA 1SMAA 3QR3A 4R27A 1J0YA 4NZFA 1E0WA 1UWSA 1TQWA 1DHKA 2V38A 2GSJA 5JBFA 4JKKA 2W62A 4GZJA 1JI2A 2FHFA 4S3KA 1HIZA 5CGTA 1UA7A 1OT1A 1Q4NX 3BVVA 3VMNA 5HPCA 3BAKA 4H7VA 1GNXA 4PTVA 1J10A 1E6QM 3RM9A 4JZ5A 3DDGA 4H41A 1RD6A 6TAAA 3WUBA 5FL0A 2YLAA 4U2YA 1T0OA 1LJYA 4QDMA 3WD0A 3A24A 2VNCA 2WM0A 3ZIZA 2WZIA 2GDUA 1FFRA 2D0HA 2W61A 3EJQA 1RPKA 4IPLA 3GDBA 1U2YA 3AMLA 3ARUA 3O2LA 2A3AA 4AD2A 3W29A 5D9PA 4NXSA 3ZJ6A 4GO8A 2BXZA 5C71A 3VNYA 4J7RA 5ABEA 1JGIA 4QAWA 1U30A 1PAMA 4PCTA 2G3MA 1SZNA 2W5FA 2DT1A 3CUGA 2EABA 1WCGA 2A3CA 1V3IA 3TA9A 1Y7VA 4F9JA 3BCFA 5JUVA 2YOCA 3MUAA 1EO5A 2QPUA 1A3HA 2YFNA 3WKZA 1J0JA 3GXIA 3W53A 2E3ZA 4K68A 2WCGA 4PBGA 1CLVA 4HZ8A 1V3KA 1W9BM 4EE9A 2BHYA 2PWDA 1HKJA 4ATDA 5BYWA 1TMQA 1WDQA 2WMKA 1E6XM 5E70A 2CITA 2IUZA 1CGXA 3NYDA 3VIJA 4Z2JA 3K1DA 3AHXA 1V02E 3DYOA 5HOSA 4TX6A 4RE2A 2BHUA 1W9DM 1CNVA 2WYSA 4PMYA 1TVPA 4UOZA 3CUHA 4PMZA 4CCEA 1H49A 4BZYA 3FAWA 1R33A 3T2QA 3ECQA 2BY1A 2CBJA 4CD6A 3AMGA 4MAVA 2J7CA 5DMYA 3O9NA 3PZOA 3AIBA 4F66A 3VIFA 3GXTA 2WCAA 2J74A 4HMEA 2NT1A 4P7QA 1ZS2A 1JDDA 3BAIA 1ZBCA 3AZRA 2DGAA 4BF7A 2GUYA 3WUFA 2ZOXA 5I3DA 2V5DA 3ZT7A 1BG4A 4XV0A 3AS3A 3WEOA 1IZJA 1J11A 1E0VA 3VIIA 3A6OA 1G1YA 1QHPA 1M01A 3ALFA 3J7HA 4Y7EA 1FFQA 4AZHA 4PMXA 1MFVA 1XSJA 1J18A 1C90A 1W32A 2WHJA 2ZUMA 3A4WA 1H11A 3SCPA 4PMQA 1LWHA 4P8WA 4UFHA 2WMIA 1KCLA 3IJ7A 4OOZA 3CZ8A 3OLEA 3UESA 1OCQA 3CHDA 4GO9A 4HOWA 8CGTA 1VBRA 4MDPA 3B8SA 5D9OA 5A6KA 5CZKA 1L0PA 1EGZA 2E9BA 2WVUA 4L4OA 1KTBA 2VRKA 2PWHA 1R7AA 3PZUA 3AZSA 3I3BA 3S5YA 3CV5A 4JCLA 4OBSA 1KBBA 2J8GA 2J7GA 1WPCA 3AHVA 1UKSA 1C91A 4MPKA 4V2XA 3DHUA 2ZUSA 3AMDA 1E6PA 1BSIA 4GPNA 1NWUA 3VIPA 1MYRA 3W82A 1HTYA 2GFTA 2OSXA 2EPNA 3W4RA 2XIIA 1V6UA 4UTFA 2C8NA 4FNSA 1JG9A 4CN4A 3N18A 3FXYA 2Y4SA 1FHDA 4BQ3A 2JIEA 3WNMA 5CGMA 4OJYA 3S2CA 2C0HA 1UH4A 5A69A 3A4XA 4FF5A 4HU0A 1OSEA 3GBDA 4QFUA 3DC0A 4B9YA 3W37A 2YFOA 1TQSA 3BAJA 1UWUA 3EDJA 1E40A 3A5VA 2W91A 1MXDA 4HZ6A 2J4GA 2RGMA 2J79A 1BFNA 3UG3A 1ISVA 3DX1A 4DUVA 2DIJA 1DEDA 2UY2A 4W93A 5CPSA 2XVNA 1DP0A 3EBVA 4MAZA 4CGTA 2XM1A 1EHAA 1ISYA 1WZMA 1GOIA 1WP6A 3UR8A 3WH8A 4FLQA 1JNEA 1HJQA 2ALWA 3VD7A 3SCTA 3U5UA 3CGTA 1CGVA 3ZJKA 2W63A 5GNYA 3VDCA 1VRXA 2YLLA 2EQDA 3KL3A 4KGLA 2ZIDA 4JCMA 1JD9A 5BROA 1BF2A 4BQ5A 3AJ7A 1C93A 1JFXA 3S6TA 5AYIA 4DM1A 1CGYA 3THCA 1W9VA 3AMKA 3EJUA 4WSJA 1E4NA 1NARA 1GUVA 3GH5A 5ECUA 3MUIA 3AIWA 4NRRA 2XFYA 2CCRA 3ZO9A 2J8FA 2O9PA 1UG6A 3HMCA 3OGSA 5LA1A 2PBGA 1OWQA 3ZMRA 2DDXA 4J27A 2WMIB 5FCZA 3CHEA 1MQQA 3MKKA 3PBGA 5CPQA 3MO4A 3MUY1 1CYGA 3GXFA 4UQ9A 3LPOA 4J3XA 5M17A 1CXIA 2QMJA 3SCQA 1VEPA 4J3WA 3EDEA 1H41A 3W81A 1O7DC 1I1WA 3EMZA 3FW6A 3TP4A 3ALGA 4WKAA 4PUEA 2DEPA 3AS2A 3B9AA 5M5DA 1F4AA 3AIUA 1V08A 3BC9A 1ZL1A 1JD7A 3VSUA 3VKKA 3RO8A 1LL7A 4B3LA 1GJUA 3FHAA 1W9XA 4OIFA 2J25A 3VDAA 2ESCA 2EADA 4PMVA 2JEQA 3AIQA 2G3IA 3CZGA 5E6YA 2OWCA 1W9PA 2XWDA 4GZIA 1ESWA 1JI1A 2DSWA 1KGUA 2AMGA 3VILA 3IGUA 1WE5A 5ABFA 2WSKA 3W28A 4H8UA 1LWJA 3DX2A 1JZ3A 5HXMA 4GQRA 3ARWA 5JBDA 1KCKA 1RP9A 2W66A 5E09A 1G5AA 3G6LA 3VNZA 1J01A 5A8QA 1UR2A 2VQUA 3ZJ8A 1PZ3A 3MMUA 2WC4A 5E0CA 4UFKA 3K4DA 2G3NA 5I0DA 1QOXA 1HWWA 5A8NA 2PWEA 1CGTA 4LPCA 1QI0A 2E9LA 2G8ZA 1KXHA 1CGUA 3RM8A 3POHA 1UZ1A 5IHSA 1R85A 1W2PA 3QHOA 5BXRA 3K46A 2VZUA 1FH7A 1ITCA 7CGTA 1E6ZA 2X2JA 2J75A 2PB1A 2VQTA 1VBUA 4M29A 2VZVA 1PBGA 1H0IA 3WH6A 2YBUA 3AIRA 1DWFM 4UZUA 2XHYA 1UD8A 4WK9A 4D6GA 1US2A 3T2PA 3APGA 1TCMA 1B31A 5CLTA 3ZSTA 2VCCA 3WBEA 1OD0A 3WDJA 1RP8A 3BVXA 2Y8VA 4UQEA 3N11A
chains in the Genus database with same CATH superfamily
1U8OA 5HI3D 4POZD 1JGEB 3GU1A 3B9OA 2Y8UA 1XWVA 4RCAA 4MY8A 3OJDB 4BK4A 2YL8A 1OTSC 4HGWB 1TYRA 3O0RH 4PE8A 4HBCH 3QCUH 4J6RL 3R11A 2V2TB 3P5ZA 1SBSH 2WC7A 1FRGH 2OMWB 1YLVA 2CDFB 1C92A 4PD4K 2J9ZA 4RNRB 4QHNA 4FSAA 4XG1A 1JHKH 4B9JA 1AYOA 4QXGH 3JVGC 4X2UA 2A7BA 1B6UA 3M6DA 1H1NA 3RPIA 3L12A 4N9EA 1UOLA 2Y63A 4ERIA 5LHEA 1CBVL 1FDYA 1XPGA 5E8OB 5KZDA 5AN7A 3VTAA 3CZLA 3RZCA 1NDTA 1QWUA 4YS1A 2J1KA 3CCHA 4EO5A 3EPOA 2OX1A 3CUPA 2IXQA 3VPLA 2QVFB 1E70M 1I82A 4WGXA 3TF4A 2WLJA 3DO3A 2DQTL 2O5YL 1KKRA 1K7EA 1FAIH 1SYSB 3M9YA 4PQXA 2AQWA 5TQ0H 2V3GA 3NCMA 4AEHL 2VMFA 2YPIA 1IC5L 3OKLA 4B5NA 4GFXA 2ADJA 3M43A 4Y4KD 3UBXB 5DN1A 1S2AA 3OTTA 1T0MB 1HNGA 3WTTA 3WD2A 3EJZD 3LRMA 1M71B 3SDCC 1G7LA 1V3JA 1H6FA 4WGVB 4HPGA 6TIMA 2VLRA 4UDUA 2JKNA 3ZK0A 4GBXC 3K0YA 1Y65A 5G2IA 3UWZA 2OZ4H 3HFYA 5J04A 4AZ8B 4KKCC 2HQAA 5EBLA 1T5AA 1RY0A 2UUDK 2VKZG 3TN0A 5D1XE 4X4YB 1MNUL 1A02N 1FWSA 1NIAA 2WBGA 4P06A 4NZRL 1MQPA 2ZICA 3PAYA 3ARQA 4DPCX 1CEOA 4K7YA 3ZE1B 3TEWA 3HPSA 1NGYB 1NEZA 4L3EB 3Q43A 1MHPL 4CQDA 5DZNA 3MA9H 3SHSA 4PV9A 3QEHB 1UR1A 4QROA 3IYLW 4Z7VF 5E08L 3S2MA 3CFJA 3HZMA 2EKJA 2QT6A 5B1CA 3BH8B 3MRRA 1H8SA 3AXKA 1WH0A 4JFHE 5DRZA 4C6JA 3IB4A 3WFEL 4DN1A 2GJZB 5JYMA 4FF7A 4NBYB 1FKWA 4BCXA 4G8AC 4UTBA 2WBKA 2BNQE 3CXDH 3GC4A 1HTIA 5EPMB 2GTZB 3NJNA 1BAFL 4DP2X 3IPBA 1UP0A 2FR4B 3PRZA 2NNXA 1BFVH 3LX9A 4V1XA 5HHOA 4HCGA 2WQ8A 3H4GA 1CK0H 1YEEH 5JW4N 1ZLUH 4MNMA 1QWGA 1F6AB 1SFTA 3W1NA 2BVTA 3O6FD 1BWMA 1S7SA 4Z76B 2NWRA 2VLKD 3V4VA 5CSSA 4R7NB 1P5UA 1OP9A 4XP1H 5KYUA 3LCLA 5IROC 5I0WA 1L8NA 3H2QA 4K9EC 3RYMA 4JPQA 2WNXA 1BXUA 2X4NA 1T1WB 4NPJA 4UILL 4ZMPA 1AJZA 4AC1X 3VI3E 4EAEA 2ZSWA 3UZYA 2FECL 4MNQE 2ABAA 2FATH 4L5FE 2NPLX 5JH2A 3TT3H 1BBDL 1JDEA 3VC5A 4LHUA 1WA3A 1PMYA 2JF7A 3NQCA 4QHLA 5FKAA 2R2HB 5CBEB 1Q45A 1OX5A 4MJZA 3MVSA 2XG9A 2QNEA 3ZL4L 3NSFA 4JUTA 2J47A 4FIRA 1XIGA 4K55A 3OHMB 2V30A 1MNZA 3LGDA 5CJQH 1K5WA 2YD9A 1E4IA 5HYSB 1U3HC 2XFGB 2OZ0A 1G4RA 5EBUA 5FO8A 1BFSA 4G6KL 2GOUA 4HDIA 5I0XA 1JK8B 3B9KC 2Z31D 2DKSA 3TBWA 5DI8B 5TGBB 2OSLA 4H4NA 4NKOB 4UOQA 3RVTC 1J1XL 1XSKA 4ZPTB 2F54A 2Z8VC 4MJ2A 4UMSA 5IQ9A 3ONCA 3FQNB 2DSVA 3O11B 3EO0B 3SDXE 5LBGA 5IB3A 1IILE 1FTXA 3PAZA 4E2DA 4LVAA 3CZFA 4A63A 2WSRA 5E2WH 1A7QH 1UJ3C 5J5RA 5I3FA 1OTTD 4JJ5B 4PWEA 3S8WA 2R9HD 3ULVE 3E2SA 5FUZL 1R3LA 3L5XL 1QSFE 2GJRA 3SDAB 3CDZB 3ZT5A 5GJSH 4DGYH 3R8RA 3NPVA 3GSOA 2ZAHA 3IMSA 3FB5B 4OFVA 1U21A 1U3YA 1CT8B 3KRSA 3WO4B 5FJOA 4UUJA 4IGSA 1BMZA 1KCVH 4LAMA 5IJVB 3TVAA 1CGSL 3E80A 4GP8B 1KM6A 3L3DA 4ZX6A 2VAAA 4JN1H 4MJID 1ILSA 1EO7A 4M7TA 5FYKH 3CLWA 5IHHA 1SUJA 1XQ4A 1WG3A 3Q8AA 4R90L 3BWAA 2G96A 1WEJL 5B3JE 1OFDA 4M3PA 4GH1A 1XGUB 5EU6B 4LW7A 4AFYA 1E0TA 4RISL 3M1OA 2OB3A 1KEGH 1B54A 1DE4A 3OX8A 5JHMA 1MJ8L 3ZYJA 4OB5L 3VGGA 2XIDA 4OM0L 1VBJA 1XT5A 4S1DD 3GSXA 2BHZA 3P4OA 2ITDA 4G72B 3S5LB 4LLUB 3ROOA 5TQLA 3VDGA 5GRWA 2WOBA 3DIVA 1GOGA 2EDRA 3DIFB 1TPVA 1UR9A 3NRFA 1NPNA 1DJNA 1E9QA 3ZZQA 1NMCB 2A4ZA 1P4BH 2Y7EA 1AXSA 1S1RA 3SPIA 4J4PC 1BQHA 1PY0A 2OI9C 4K7PL 3BMWA 4IBZA 3NP3A 3PWVB 3U7YH 1QWNA 3T8MA 1VP5A 4H19A 3ZDYE 4LSRL 1UZDA 4M5PA 1QD0A 3IFNL 3QUKA 5D96C 3WJLA 2HFEB 4XXDB 3QO1B 2G5BA 2Q2LA 5HYJE 1O9WA 3FFDA 5AC8A 3S35X 4XXCA 2HDJA 1X97A 3PZIA 3V5CA 2PLKA 3KEHA 3D30A 1Q66A 1A7PL 4M00A 3CH9A 4JQ3A 3GO2A 3NIDE 4F7MB 5TF0A 1GZPB 4R8WL 2V7HB 5I24A 3LZPA 2DYPB 3GNDA 4NQCB 4QRRE 5L8KB 2IANB 2Q0ZX 4HAFA 3B40A 3F2CA 1E28A 4JIEA 4GQBA 1SXAA 4Y7MA 3I2CL 4JHOA 5B38G 2A6DB 1HHHB 4FIQA 5J1AB 1BXXA 3H85A 3OZYA 4WZHA 3CIVA 1DQQA 5HGAA 3DGCR 4ZZKA 3QPXH 2XRAL 4Y1TA 2JJSC 1A8JH 5IV2A 1AW2A 1JCJA 2PCQA 2Z7YA 2QXWA 4ZS7H 2EYRB 5CLYA 4P2RB 2X6BA 5H2ZA 2ZUXA 4Q7BA 2P8LB 4XOAA 3BH9A 4HBKA 1D7DA 1AJ7H 3VXUB 3M0XA 2J8UB 3V4PB 5FO9B 2Q8BH 3MBED 4F40A 1KXTB 2OW7A 4KVCL 4NUQA 4YFDB 4Y4FC 1FX6A 4WFGE 3S37X 3A3HA 4UQBA 2O9TA 4QLJA 3D4ZA 1JV5A 4AH2B 2WNZA 2YL9A 3W7JA 3SDDB 3QDAA 5JOPE 1OZUA 1OM3H 5F9OH 5EZJA 1PS3A 3ZDZB 2Z7ZA 4PHZA 3KPPB 1BG1A 3WI9A 4AM0A 4CILA 2UWEE 1BJ8A 5CS7A 4LCIL 5KTLA 3TJHD 4KRZA 3QQXA 2O7SA 1TPDA 2I27N 3DWTA 4I0PA 2XY2A 3RGVA 2G4FA 3LM3A 4H44C 4PSPA 5KEZA 3K6IA 3FJ6A 1UWXK 3X2QB 4HJIA 3WBYA 3DGGA 1BYAA 5T1KA 4TL4A 2L7EA 5ACMA 4M8QB 4M7JL 3WF0A 4AYFA 3ZLGA 3HI1A 4KIEA 1W37A 1LWRA 1YA5A 5D8WA 3KR3H 4AQAA 5E94A 1L4IA 1URZA 4UR9A 4FYSA 3D06A 1UR8A 3EYSL 5EBAA 3NJIA 1LHZA 1C5DB 4BWUA 3PZTA 5D70H 3MU7A 2DZUA 1O7DE 4AVHA 3DKLA 2FDMA 1QR7A 4PRBB 2R2CA 1YMMA 3RJYA 2FB4H 4A39A 3DTUB 5EO0A 4UTHA 1FFOA 1Z9LA 1XDLA 4H3DA 3S1GA 3V6ZB 3VFNB 3COTA 1H3TA 4YDVA 3SN1A 3THMH 5T9BG 3DI2B 2ZUUA 4XTDA 1PDYA 3PWPA 2QADD 4AGOA 1QRKA 4MOZA 1SO3A 1HS6A 2PDLA 5E1QA 2BVDA 5CO1A 1U8LA 2P45B 4ERAA 3V4PL 3IT8D 5D38A 1WQVT 3KS0H 1UQZA 4NENA 4RZ4A 3O4LA 4QEHA 3IU3A 2RJMA 3FU6A 2EGZA 1DEEB 4P5TC 2YD2A 2APXA 3WTVA 1XIDA 2R4RL 3FN9A 4INFA 1Z9MA 2ADFH 4C6PA 2CR0A 1VKXB 3AITA 4ZS6C 5K1VA 3P54A 4XD3A 1KB5B 3VD9A 1UJPA 1EWEA 4PJAB 4Y19E 3GBEA 3OGCA 1AKJD 2YPLA 4EPBC 1NSJA 1IGTA 1JV2A 4JFVA 4P5MA 3PJWA 3TH4T 1JCMP 3HE6A 3HPLB 2BMKA 2HMIC 5IW6B 4O17A 1VR6A 3US9A 2NSOA 3WFHA 1F7BA 1TPWA 1FNSH 3A5FA 4LAZA 2Y72A 5DQ9B 1E67A 1CL7H 2CIIA 2N7BA 3KDOA 2AGKA 4CW1B 3I7SA 4GUPB 2CU0A 1IT9L 4AIZB 3M88A 2J3SA 3VI4B 1QJWA 1VFLA 3W1AA 3IVKB 3QBTB 1B90A 3FOMB 1KV5A 1FP5A 4E8CA 3W11C 4XCNB 1OB1B 3WBAA 2UY7A 3HPAA 4WO4D 4J3VA 4K8RL 2X4OA 1DLFL 4B0MB 1J8HD 3GHEH 4U3CA 2YHGA 4AIBA 1AHWB 2QUVA 2XXFA 4U1SA 5BCAA 2ENYA 3T0BA 4ESKA 3ABZA 4OTKA 1BF5A 5DJ2A 3WQ4A 5CCZA 4N90E 4JO2H 4WIWA 2YRLA 3BOVA 1IGCL 3NGBB 2FO4B 1AD0B 4NN6C 4NXKA 2VLRD 3JS3A 4HWBH 5E5RB 4X6CB 4ZYKB 4RA0C 3CH0A 3CXHJ 5A6TC 1DBJH 1E8WA 2IOMA 1MH5A 1W8SA 1KB5L 4Q6IB 2ZOKA 1ENUA 2YZRA 3L54A 3RAOA 5E9XA 2CESA 3QFGA 1CLOH 5DRNA 2D2HA 1D5RA 1O95A 4HCRH 4UTLA 5HUOA 5IESL 2NQHA 1TJIL 2EIEA 4BFRA 4OLVL 1GKQA 1HHKB 1F73A 3BVVA 3D85B 2PMQA 4NHCH 4Z0XB 5EMLA 2CLOA 4JZ5A 5BQ7B 3C5ZD 3UPRA 4B3EA 4KOBA 1LP9A 2KBGA 4M3HA 2V9TA 3JWNE 1BX2A 2OMXA 3B6SB 2RHEA 4C54A 1G87A 2CLHA 2BLEA 4BHYA 4ICCX 3ZJ6A 1A0CA 4J7RA 4PJ5A 1JGIA 2ALDA 1DJGA 3UBPC 1QYGL 5JOFA 3KPQB 4GVHA 1ZT4B 2YD3A 1J0JA 4HW6A 3G1AA 1J05A 2F5BH 4EE9A 1TIUA 2WWKO 1MFEH 3VA8A 3U2CA 4PRPA 3Q58A 3VIJA 2B1AH 4NC2B 5I30H 2NW3A 2A9ML 3BVNA 4RGND 4YLBA 1CNVA 4DPPA 2X1RA 4UOZA 6REQB 1I1CA 4DB7A 3AMGA 2Z0UA 3G6JE 4RVBA 1U3ZA 4TS6A 4BQ9A 2QJJA 2CFFA 5KJRL 3A64A 3UCDA 3OZ9L 4HJSA 5AHIA 3KLQA 4URKA 4M62L 2K4AA 2FJGB 3LKRA 2WOQA 4AIXA 3E1ZA 4X6DF 3MR9B 4N68A 3UYPB 3DG6A 3A6OA 5TDNB 4CSZA 3GSQB 3T07A 5C07A 1ZE3H 1AZBA 2WMIA 4G9FA 3CZ8A 3RTLA 4P07A 1NCAL 1S5MA 4K7FB 4M1GH 3NRQA 2CQVA 1ZKAA 5DTFA 1VBRA 1WBZA 3MOAL 1L0PA 2LFGA 1J96A 3N41F 4N24A 3PZUA 5AVRB 1YPXA 5FFLA 1ZTMA 4LF3B 1TJXA 5GGRA 2ZUSA 5EOCL 2IH1B 4IFKB 2REQA 1NMCC 1TJGH 3ZTDC 1NWUA 5G5DB 3DX6A 3D4GA 1YDOA 2J44A 4IS6A 4LCWB 1RKRA 1J5SA 3G6DH 1PV8A 4YJ5A 3UP8A 1W1ZA 1TTRA 2VOMA 1BREA 6XIAA 3ARFA 4PLJC 3ZRSA 4W4QA 1Y18A 1ZK9A 2YW3A 3C60D 3EDJA 3URQA 2B7QA 3DFTA 1XF2B 4NUJA 1XLEA 4XMLH 3KDMA 4IGMA 1Z69A 3VYOA 3CFKA 3TS8A 4L05A 2OVLA 3CIQA 1RV6X 1ZVSA 2ALWA 5SWQA 4WAFA 1VRXA 3NJFA 5IB5A 1FZMA 1L6WA 1NFBA 4ZAKB 2CGRH 3IETB 2YEZA 5L9DL 4LFHD 5AYUL 3V0EA 4L4TE 1C93A 4L4MA 4Y2NA 4EIVA 3EB4A 4F2MB 4F0LA 1OF6A 1EZSA 3MRMA 3VA2C 1XSOA 5ABDE 3UC0L 4FTVE 3HG1D 1OC5A 5AAWA 1N68A 3C2AL 2WAQA 1UG6A 1SXSA 5AUMB 2GBAA 4L5FL 4IRJC 1REQA 1CYGA 1F6KA 1T7XA 3WKQA 4JTRA 1MIML 5L9FA 4J3WA 3UPBA 4PGJA 3W81A 5AL8A 1W1A1 3FW6A 5CCJA 3B9AA 3B8WA 1BIIB 1HJBC 1GJUA 3FHAA 1HSBB 4NT0A 4Y9PA 1WISA 3SDDC 2ESCA 3SQLA 3NZHH 4P3DA 2BFVH 5ITFB 1JZHA 1FVEB 4G7QB 2PPDA 3TJPA 3QO0B 2ZOUA 3EFDH 2UXGA 2EO9A 3DX2A 3GYEA 1KTDB 3V0WL 3ZMEA 1BAWA 3N6YA 1KLYA 2W66A 3QWRD 4F27A 2VQUA 4HUUB 4F33B 5I1KL 2QZ5A 5E0CA 1BLNA 5I0DA 2E9LA 2G8ZA 1KXHA 4ZFOB 1RURH 2DQJL 3QIWA 3GSWB 4MA1B 4UM9A 3NJHA 1MAML 5GJTH 2Z7GA 2AJSL 4QHKI 1WXYA 4Q8NA 4LU0A 4Z3FA 1H0IA 3DBXB 4IK7A 3GHPA 4OZFA 1YEYA 4GQ9L 5HYJB 4KQ0A 1DIOA 3APGA 1WTGT 1FH5L 4PUUA 5F1OB 2OMZA 5JNYA 1J8RA 4DJFC 4BJHA 3NIDB 4K8RC 2ORBH 1TX2A 2HRPL 2C4FU 4DKDC 1DN0A 3TUUA 3K1GA 1OSPL 1TVBA 2Y7FA 4QRRB 4MX7A 3B8UA 1ODZA 4KI5D 3HPJA 3PGFL 3VFCA 4EZLA 2ESVB 1NCWL 3C0SA 5J89A 2W9DL 1EBPA 4P99A 2A7NA 4LLQA 4P4KD 3MB9A 5C9JA 5LN8A 4FHKA 3UIYA 1KLZA 2ZPKL 1N67A 2E0PA 3ESUF 1A2YB 3G04B 4MG4A 1HQRA 2NNRA 4YHGA 2R15A 4J28A 1FCGA 2P5WA 3D7PA 4ALAH 3TWBA 3NABL 2ZXGA 1DTNA 1MWOA 4RAVA 1TR1A 1SEBB 2RCSH 2QHAA 3FTYA 1H8NA 4MUPA 5AZ2H 2YK1L 2CSPA 4CBZA 5C0AE 3WUWA 4FOUA 1I7UB 2DWDB 4YDLB 1QOKA 3H0TA 4Z3GA 1CX9A 3EX3A 1NAMA 3BEWB 1OAUH 5MEQB 4WLCA 1UWXH 1RHHB 2AXGB 3CX5J 4BA8A 4XH2B 3WNPA 4YAQB 3GG0A 3LD5A 1I8IB 5LXEA 5BJTA 1BXBA 1ONQA 2IH9A 4ZFOL 4ZTOL 4EIUA 4L8DA 3URNA 2OLAA 1QI4A 2NQDA 5B22A 5I06A 3OR7A 4UFLA 2IQDA 3D9AL 3NVQA 1URLA 3INOA 1LRQA 5JORA 4PGLA 2ZCHH 3KBFA 2VDMH 2G60H 3WEMA 1OT2A 3ML8A 3QZNA 5J6HB 1Q6DA 1XSIA 1BFOB 5ADPH 3LZLA 3C87A 2P48B 2I17A 1F9CA 2G9HA 3IGFA 5T1KD 4XZUA 3EOBB 4H6QA 5MP6L 5IK3B 1GAFL 2NWSA 4S1FA 1TTBA 4H8WH 1H8LA 1W1VA 3ZYOA 1ECQA 1JGVH 5JXQA 5H4YA 1WBXB 3MZGB 4A21A 2VITB 4U1HB 5CLWA 2YXVA 3OYZA 4HSQA 4DFIA 4OQ1A 2GTWA 5DJXA 5LDSA 5B39G 4YTSA 3OQEA 5GZOC 4KJYA 3Q8EA 3X14A 2DLFH 1FVDA 4XNAA 4MLJA 3TO4B 1G4TA 1IBYA 2RDTA 4ZE5A 3WMCA 1ZJAA 3SOBL 4Y4KA 3NGBC 5A3HA 3QIUC 5JXAL 4FR6A 3B06A 4DGVL 3BV4A 4O9HH 4U1KA 1ZAGA 2IO5A 3WH5A 1IM3B 5LXVA 3VW3L 4HS6A 5D1XC 3QVAA 4IPNB 2QV5A 4Q6IC 4YTTA 2ZKYA 3BL3A 2G95A 1FZJB 5FK9A 3T6QC 2CKBB 1JDAA 3MREB 4JTSA 5H94A 1UFGA 3SKNA 5F9AC 4MNKA 4QCEA 2YDQA 1QPNA 4NX5A 4BCYA 3UU0A 3W0WB 1XF5B 2NYKA 5DSCA 2J9XA 1JVNA 4QM1A 4DJMA 5FF2A 4Y19B 5A2IH 1FL6A 1A3ZA 1Q7MA 3MCNA 3D2TA 1UM6H 4LUTA 1S3TC 3ZE1E 5K69A 4FA3A 5I6PA 2X1UA 2EYSB 4FYQA 4L3EE 4GJTB 3L68A 3HTLX 3O41B 1HWHB 1QPKA 2DV0A 3WG6A 1XIWB 5T3XD 2QMKA 3HOJA 3Q2VA 4RIRB 1H09A 4QXUL 3VD0A 3HI6L 4NM8L 3C5QA 4KT2A 3HF3A 1QTSA 2I69A 2IAMD 1U8IA 1NOUA 4JZNB 3GDTA 1JZ2A 1KCWA 1KBWA 3G5XA 3SCMB 4LSBA 4G1EA 4PJBA 2P44B 4JFEE 3VOGA 4UTWA 3T8LA 4XHJD 4TVUA 4EIZC 1D5BB 1B4EA 1QHOA 4R7OA 1L0YA 4Z7NF 1GMEA 2ICEB 3O6FA 2W9EL 2Z9TA 3TH2T 2VLKA 2BVOA 4EAYA 3PNWB 4FA6A 2GIMA 4AEIH 5AYZA 3NK4A 1PG7L 3ULUD 1G7MB 4DBSA 3TIDB 3JT2A 1EEXA 4PS4L 1NMBL 4ORGA 4WI5A 4JRXD 1BM3H 1WUEA 1FUYA 4XP6H 3VXRB 3K3QA 4HIEB 4Q2ZB 4WW2A 1RI8A 2CKBL 4UT9H 3N40P 3BGFC 3WS3B 4LHJB 3GLDA 4IOSD 4I2XA 1ES0A 1L9RA 3MUGB 3MZTA 1ET7A 3UROR 4HIHB 4QNPE 3HGSA 2IBZX 1WBYA 1XGYL 1XCTB 5TK4A 3KPLA 5IUSA 1W0VA 3ZR6A 2OTWB 5EUOB 4HPOL 1TZGH 1PDZA 4M1DL 2V2CA 2OP4H 1N6UA 2E7LC 1J0IA 1NP0A 2LGNA 2XPYA 4R3SA 1A5OC 4HJJH 2Z31A 2BSED 1OXYA 4FFYA 3EYPA 1SHWA 4BK5C 4JS7A 2QCGA 3FK3A 5E95B 1CICD 4CVUA 1DSWA 5EO9A 3CPRA 1PNDA 4PTTB 3DG7A 5C2GA 2F8QA 4FQCL 3RX8A 2DD8L 2ZNXA 3UDWA 4H9ZA 1H3PL 1G94A 1TNNA 3JRKA 4PRHD 4PJ5D 1X6NA 4I90A 5I16A 4FQHA 3V0GA 1GW6A 4EQ2A 2OX4A 4EJ1C 4ZAKC 2R1WA 1UB3A 1LEGA 1XL4A 3R0UA 4EI0A 1QPRA 5HHXL 1A1OA 1A1NA 1BZ9A 4TVSa 4CA4A 3OXSA 3CBJB 1HH6B 4L1TA 2JIXD 4IQDA 4DJDC 3FQRB 3AVEA 2I5YL 1SOSA 2IPGA 3RUGE 2L8AA 5ICYA 1K2DB 3B7UX 4KDTA 3ZJ7A 4X4KA 1KCUH 4JFPA 4GG6A 3TR9A 3QFJB 3R1GL 4N6QA 5AW9B 2BVQB 4UR8A 3R58A 4AWEA 1E5UI 4K23L 3Q6GH 4JQXC 4QDWA 1OGTB 3FT0A 2NLIA 2VWEC 4GLEA 1B0RA 4RWHA 1VJZA 4GW4B 5EU6E 1U36A 2CAKA 1W8EA 4LPTA 5FKPA 3OL2A 3SSJA 3WL9A 4U33A 1EO8L 1UH2A 3CPLB 5B21A 3MWCA 4RXFA 2PPEA 3VX1A 2JFEX 1T03H 1I9RH 3DRTB 2A4EA 4D8AA 3GZ3A 4MA1C 3QC3A 2HEJA 3F4CA 3H9SB 5DMKA 3QQWA 5BW6A 2DEXX 3KZSA 2WGXA 4IM4A 2BASA 1TOXA 2CMRL 4ECNA 4UWQB 2Z35B 1FWGC 3MUHL 4YN3A 2ACQA 3RDTD 1MZRA 2WMJA 1RVGA 1A7NL 4QE1A 3ARFD 3SQBA 2RAGA 3WN5B 4NUMA 5B1JA 1EX1A 4CU6A 1MHEB 4GG8A 4EZJA 3OLGA 3HBZA 1CR9L 1U8KB 4TKWA 3AU1A 1I1FB 4U1NA 3NGFA 2OJEA 2QPEB 5HHVL 4N9DA 4RGOL 2BGQA 5KSUB 5ICZB 2DQGL 1R75A 4NG3A 5D4IA 1CXEA 4MADA 4UWMA 1AE6H 1IC4H 3GSRA 1DQDH 3VVWA 4R7VA 2JI3A 4RZ5A 2R23B 2IS7A 1SJVA 3U2EA 3HAEH 4L4TB 2GQAA 5JIQA 2ISVA 4NQXA 1PAZA 4ZQCA 3QOKA 2FX8L 4J3OD 3IMRA 1T20A 1TQVA 2JKJA 4HGMA 2VDPL 4NQCE 2IANE 5IFPA 4GXVL 3QORB 3UF9A 4U0QB 1RMFL 1MEIA 3MGAA 5F3BB 1QR4A 1QQDB 3P02A 3KYOB 4JVPA 2HA1A 1XYFA 4W86A 4YDNA 4LRNH 4X9IA 1MFUA 4YDLC 3LRGA 1WB0A 3APFA 4C6CA 3E2HC 4QLRA 1L3WA 3RNQB 4KMQA 1RLBA 1DVXA 3BMVA 3IK2A 3MBEA 4HSNA 5K2ZA 4YHNA 1N2RB 3RIFK 3VXUE 3E0IA 3HO8A 2RMNA 2J8UE 4HUKB 3QQ4B 5AAPA 4XHQA 4DPRA 2IBZY 4F24A 3O4OB 2ADGA 3LSOA 1MUJA 4JHAL 5FGCE 3T55A 4CQ8A 1EDQA 3LEPA 1OCZB 5C0EA 3D52A 3GFYA 3CUFA 1NC4B 4LEXH 1FA2A 3WQEA 3QAZB 5TE4L 4KHTH 1K8DA 4GY7A 3PAOA 3OG3A 3PSVA 2CBOA 1NBZA 3RITA 4F7CA 3QJAA 4N26A 1IGYB 4RSYA 4OJEH 2D20A 2PC4A 1OE2A 4KK8C 1II4E 1BEYH 5MKGB 4W9KC 2HRHA 1J2WA 4FG4A 4CNIB 4HBQA 2J66A 4LPWA 1BXCA 1M1BA 3IJQA 1KV7A 1SJHB 3JVAA 3X12A 4H6RA 4JFXA 4P3CL 1TZ7A 3N42F 2R2EA 2WXHA 5D6DC 2XCMC 3MNWB 4XVJL 3QC5X 1Q63A 2AJXH 2DVXA 3UJEA 2XWXA 4ZO8A 1UKQA 2Y61A 3IJSB 3RA7H 1X39A 5IOBA 1G1KA 1RERA 4DK6A 3APNA 3BFWA 3VXQA 1IHIA 2R1NA 4BYHA 3V1HA 3HN5A 4J23A 3PBWA 4JIIX 4IU2B 3TYEA 3L7FA 5F70A 1Z3NA 2HK1A 2YZ1A 5JW5B 1V3HA 4HJUA 3P2BA 3DOIA 5C0AB 3OBEA 5FA5A 4F8OA 5F1KC 3CVHH 3TW6A 4H25B 4L9XA 4O58H 4L9YA 4RUBA 2AJVH 4NCDA 3TSDA 1S9XA 3DPBA 2HTKD 3KRZA 1KYUA 5F0MB 2DBLL 3P2TA 3UNDA 2R1MA 4PVNA 1AKJA 1U9KA 4CD5A 2EDXA 4PJAE 4O13A 3OZPA 3GD6A 1FE8H 5DHDA 1CF8H 5L2JB 3AQYA 4JVUA 1C7SA 1T22B 3EYQC 3AAZA 4JFSA 2F18A 1RALA 3L08A 3T71A 1YEKH 2JEPA 4AI7A 2AHIA 2IV8A 4Z7IA 3D2UB 3SCMC 4AZ5A 1I7ZA 2HVBA 3ABLB 3OODA 3LJ3A 3SRHA 3QEQD 5IG7B 3CV2A 2BJMH 3TYFB 1CFVL 2FL5A 3DJ9A 4NI3A 5DLML 4IIQA 4QEEA 3BZFB 1SEQL 2ICEC 3VI4E 4U4BA 3QR3A 3TC9A 1DUYA 2YWZA 2ZVIA 3L0GA 2A9DA 2QKIB 5IEHB 5C0IA 1ZFJA 2F8OA 3W1UA 4WO4A 4Z7OB 2CHXA 2HH0H 3DVNB 1J8HA 4JVWA 5IMOA 3GQYA 4LV9A 3A24A 2FZMA 2VNCA 5EZIL 4Y1AB 1U8NA 1NFPA 2VDOB 3DURB 3GDBA 3W29A 1B2WH 3BIKB 5D9PA 2BXZA 1FVCA 5EBMA 1XISA 3V0HA 2JNZA 3FFCB 3DLQR 5CMAA 5H2BB 2F58L 3C75A 1ZLDA 2DQDH 2ZJSH 3NR0A 1OG6A 4XMPL 3VI3F 3SBFA 2UXFA 4JEQA 4DETA 1MY5A 3RTQD 4M6QA 2NQLA 3QQ3B 1H15B 1UYWL 4HN8A 1XIMA 3H7RA 4WCYL 4QNWA 2IDFA 4F7PA 3JSSA 3K4ZA 4X6CE 1U8MA 4O1AA 4ELKB 1VCBC 1DJSA 4JIQA 3SY8A 3RG1C 4WU5B 1EEUA 1SHSA 2CR3A 3SZKC 4TLSA 3B0YA 5J6GB 5D03A 3WD5L 3VIFA 2J74A 2VDRH 3MX0B 1ZS2A 2BVPB 3JWNC 2JK5A 4C4BA 1TJ1A 1ROWA 3EPNA 4RMBA 1X5FA 2ATAA 1P84J 5GGRY 4ZFZA 3I50L 2NDFA 5A5WA 1J4EA 1EJOH 3CN1A 1T2XA 3C5ZA 3ALFA 4D3CL 4HD9A 3WLBA 3ANUA 3ESNA 3BSZL 2QBWA 1B9KA 4ODWA 2NOYA 3NQAA 2NLJB 1UEYA 2LU7A 2Q8ZA 3T05A 4OI8A 2VJ0A 5FDWA 3FBKA 3RGHA 5F21B 2VRKA 2IPWA 3VWJD 4R0LB 1VADA 4Q52A 4FQIL 1ONWA 3SZ8A 4JFEB 4F9PC 3BKJH 3VRLE 3GT6A 3W4RA 4GA8A 1C5CH 1V6UA 2C8NA 4PTUA 3MWAA 4L3CB 5CSGA 5GIRA 4BQBA 1DQLL 4JFYA 2VDOL 4YL9A 4IIBA 3JZYA 2YXOA 3OSVA 4HALA 5KBPA 2OMBA 1MVUB 4O2CA 4L5ZA 3FXIC 1Q9LB 4R9HA 1MFBH 4OKVB 4J6IA 4NQEB 3OJMB 2VR3A 4WNSA 2JK2A 2IDTA 3NZ8A 2YGNA 1E4KA 2YD0A 5H37A 3FJ4A 4LDLB 5F1VA 4DKEL 2XM1A 5KG9B 1MHHB 1XQKA 1WP6A 3L9CA 1BOGB 2DM2A 1EAPA 1A6AA 4XIAA 3Q6FA 4ABQA 3UR8A 3P3UA 1IKNC 4PRTA 4U3SA 4V11A 3RLGA 3ARGB 2VEKA 3EFFB 2H2PD 4IBSA 1W16A 2ZIDA 3KOFA 4NZ4A 3TOYA 5BROA 4XCYB 3EFOA 4E9TA 2FZ3B 5IW1A 5EF1A 4ZW5A 2IH8A 3QFWA 5J11B 5AVSB 1YC8A 3MVTA 2R56L 4EOUA 3WXVH 3SPCA 1SO5A 1XAKA 1FHVA 2XFYA 4C5YA 2J6XA 4M02A 1FDJA 1GCFA 4I6KA 2O9PA 2VXUL 2YPVL 2X4QA 2MPVA 4OR1A 1O5KA 4UQ9A 3LPOA 4LCWE 3WN5C 3KPNA 1OD9A 1KTLA 4G8IA 3VFSB 2ZCKL 3ALGA 4LS2A 3SN4A 1E4JA 3AYTA 1RPUA 4KWSA 4W9FC 3C60A 4FXGA 4C6DA 4PR4A 3NAAL 4JDZB 2PYEA 1R24A 4HAKA 2BDQA 3VDAA 3ZDYF 2EXWC 4XMXA 5IVXE 2QCMA 4RE0A 2EUZA 2PRHA 4FX7A 3C9NA 4X8CA 4M93B 2CO7A 4TSAH 3GO1L 4PG2C 4QRSB 4GKSB 5D04C 4O1FA 5HXMA 4ZFGL 3BTNA 2GOKA 1VSCA 5EA9A 1ZT7A 1RV8A 4IIDA 2WJ5A 4WXYA 4UDTB 2ZWKA 1VLXA 5B3SB 4YX2L 3NM3A 3IDXH 4LFYA 4WVRA 3T8VA 4JE4B 1K8IA 1T1YA 2IH3A 3WFDL 1OSYA 3STLA 4C56B 1JZFA 4U6HB 3RUGB 3MBDA 3HG1A 2E9WA 4F2ME 1QBLH 2J6WA 3M41A 5IMKA 3PQYB 3MRPB 3RB5A 5JIIA 1E9ZB 1LDCA 1WAPA 1BJ1H 3PIQB 5FF0A 4IPJA 3WBEA 1BVWA 4OV5A 2EAWA 4WI0A 3PJSA 1HILB 2IADB 4FZIA 3CQ0A 4JNXA 4LVHB 1YZZA 1INEH 4LASH 4JYEA 3SE8L 4HPXA 4FO4A 2HPMA 5DANA 4E9VA 4PJFA 4APQA 5F7HA 1JAKA 1RH9A 4IKLA 4E2OA 4N0FB 1FA4A 2C1IA 3L6FB 2FE0A 3L3IB 2VWEE 4QEGA 2V2XA 3GNML 4UB9A 1ZJBA 3QAZC 4P49A 1PDKA 3QWRA 3VMPA 3GS7A 1XB8A 2MSPA 3ZO0A 3UGRA 2UWEF 1NMAL 1ETZB 2AABL 3VFGH 3I74A 4JK0D 2FLMA 2N4IA 3ICJA 4QPEA 5DHXB 2ZX8A 5T5FA 1A22B 3O8AA 1ZY9A 1AODA 1H5BA 2EDKA 2Y1HA 3K0WA 4KKNA 5E56A 1OLZA 3WIJA 5JZ7D 4WWOA 4M6NL 5KN5A 1MEXL 2PTTB 3QIBD 3KG5A 4QTGA 4JRLA 4EBQH 4JTGA 1K8ZA 4AZIA 2FX7H 3UG5A 3D51A 1V6WA 1PX4A 4HKZA 3QI9D 5ITBL 2OODA 3GBMH 3NQ6A 4LCQA 1GVIA 4DBDA 4C1KA 3VAEA 1YNYA 1EZVX 1B4KA 3U48A 3FO2B 1IGFH 6CGTA 2J88A 4DGUA 1KEML 3S9IA 4NUGH 2X89D 5GGVH 4P4KA 2ESVE 4PJIF 1T2QH 5AYBA 5E00B 3QZWG 2V8ZA 5G4OA 2AI0H 2XN9D 2LABA 2QVKA 4FDWA 3APDA 3KWUA 5FYJD 3QOMA 3TYBA 4U3XA 3WLRA 1Z9PA 5EZPA 4IL0A 1JSYA 3ILPA 2O4QA 1GZQB 3ZTJG 3TBCA 5IREA 2GJ6B 2X42A 2Y1YA 2MJWA 2AC0A 3V5OA 5LZLA 1ADQL 4YR6A 4KCVA 4E9LA 3CU2A 5BRBA 1DVYA 3QYMA 3N04A 5K39A 1PX8A 2XJ7A 2NXYB 1QP1A 5FGCB 3SGGA 1JXKA 1US3A 4IG2A 1JF6A 3DOSA 3AHTA 3H6JA 4A38A 1R3JB 4JRYB 4PWIA 2YUZA 1G4EA 1CFTB 1X4YA 2UYLA 2WBWB 1QBMH 2A3LA 3E0WA 4F9DA 4R4NC 1CFQA 4FAMA 4QY8B 1QO3A 2QKIC 4J40A 2A3TA 3TBSB 4ADJA 1QO2A 4HJ1A 3QZEA 4AYID 5BV7B 5TDOB 2BS9A 1XQLA 3FGCB 3E5BA 3EGDB 5BPPA 4RZCA 3VU2A 1PO9A 2DQFA 4UB0L 1UWQA 3V0UA 3MLYL 3GNOA 5IHZA 2AVFA 3DEQA 1XH2A 2ZWYA 4DIAA 4DM2A 3I10A 5D37A 2VGFA 2WCSA 1WXJA 4S1SL 3FQWB 4KY1L 3IUDA 1LEIB 2BSSA 1RZPA 5I1IH 2JCCF 4HHAA 5JR1H 5TE6L 1NQBA 1IM9D 2BC4B 1OGBA 1OALA 4LEFA 2HZHA 3UR5A 1OCJA 3EWDA 3CYVA 5A16A 4KERA 1CLXA 4N5ED 2FBJL 2Q86A 1XLGA 1C5BL 3VNIA 2G4JA 4MAYD 4XMKH 3B3IB 3UZQB 1ZXKA 5I66A 1A6VL 1LQSR 1AGDA 5GJPA 4H8HA 1LVEA 4XVOA 1XZ0B 4LSUL 1I85A 4A29A 3V9FA 1OAJA 2AJUL 3K2IA 2XVLA 4PMNA 4HYVA 1VFFA 3W9DB 4G7EB 3W0WE 3ME0A 1XYBA 3I6TA 3ERXA 1MUCA 5IB4A 2ZRYA 1E5AA 1JN6B 2EYTB 4RMWA 1GZ1A 2VZOA 4IK6A 5LNVA 5C3LD 4HWEL 1MO0A 4OWGA 4F7TB 1TQXA 1JYWA 5D8ZA 4Y6GA 2WLNA 4NI8A 2GJXB 4OJCA 4FB7A 4WEUD 4J3ZA 2JLPA 3MACH 1EVTC 4LSPH 3ZTJH 5BV7L 4ZQMA 2ITEA 3D18A 4OZIB 3KVJA 5GGTL 1WKYA 3ZLFA 5FJUA 2IAMA 2N0KA 5E8EB 2YBGA 1OY0A 1MREL 3TWCH 1A4AA 5C5YA 5TF1H 4JKLA 1KIUA 5ILTL 4K1GA 2X6AA 2A77H 4BRJA 1E55A 4KKLD 3WFAA 4ACZA 4HKXB 4OW6A 3LPPA 3MI6A 3D87B 4AMAA 3QCVL 5LGZA 4YO0A 3RY6A 3VE0A 2VE6A 4F3FB 2JKWA 1R5IB 3PGDA 3UG8A 5A8OA 1D3GA 3CVBA 4IMFA 4JX4A 4MHHG 1Q94B 3QJUB 1F3WA 4ZD3H 4JRXA 4HXBH 1M9HA 4GUCA 2VC2B 1HOCA 4IKJA 1XF0A 3X13A 2PP8A 4QR6A 1CGWA 3ARGC 4P2QD 3UAFA 4XNDA 1I7TA 4N2NA 2AGJH 5SWSD 1W1PA 2LAAA 4A6YB 1JCTA 3VXRE 1ZA3A 1BYBA 4GBDA 3DCPA 2I1OA 5CSYA 1OK4A 4IOSA 2XWRA 2QVHA 2APFA 2X4UB 4V1YA 1IGIL 2XFXB 1MEWA 1L9MA 4OCLC 3STGA 1QAWA 2V9RA 3V2AR 5JPMB 4H2CA 3GIVB 3SUWA 2JF1A 3NJJA 2ZG3A 3T2LA 4JQVC 3MRFB 3FAXA 5EUOE 4CRPA 1OAZH 2CBUA 1T04A 2BVYA 3L9EA 1LO2L 4O53A 4X9SA 2WB5A 4HH8A 5GSRB 5DMLA 7XIMA 1KBGH 2A5HA 1UM4L 2X2YA 1XDTT 2BSEA 2B5IB 3QK0A 1O7AA 3M8OH 3IDYB 1P7QB 3CWNA 1CICA 4M93C 2WLHA 3RGBA 4JQIA 3ZIMA 1WV2A 1OK6A 2GUUA 3VNDA 4JO1L 1NM9A 1ZLWK 2Q3ZA 5DJ0B 3G1FA 4PBDA 4DBUA 2FDBP 5CUSL 4PRHA 2ZRZA 1OGSA 2MHAA 3QRHA 1RLWA 5DRIA 1OF2B 4OLYH 3WELA 5L4MA 3SDAC 2J8HA 4ZQOA 2Y7LA 1FIGL 3GJFB 4P7RA 1BHGA 3V0VB 3BRDA 2PCEA 1FUNA 3VIOA 4DZ8B 5GGSB 3VZZA 3WO4C 3TPUB 3KW8A 4XN7A 4JN6A 2CZEA 3P73A 3SADA 1R3IL 2IGLA 4K3EH 5HJBA 3ISWA 5EY5A 2JIXA 1RUMH 5JLZB 1KD0A 1R2TA 5D6CA 1FNLA 3SGJA 1I9CB 4ZE4A 3N9KA 3SJVE 1WOBA 4TVPL 2FCBA 2JJWA 3HPZA 2VEFA 2XZ9A 4PI0A 4A6YL 3GMQA 3TVMA 1S3HA 3CHRA 4C6IA 4B9IA 4LVHC 3ARPA 1A9BA 4DO4A 4XNYH 1GTFA 4IBWA 3QFJE 4OLWH 3VGHA 4GC3A 1JCYA 1INQA 2YGPA 1SXCA 4PP2B 2ZZUT 4NRYA 3BRFA 3EYOA 1HKIA 3OKNB 1IKOP 1XR9B 2NY4D 1MWAB 4Z7QF 2YJLA 1KTJA 4K5LA 4UIKL 4PLOB 3OLDA 1A3LL 1YEIH 4X5XB 1HIMH 4J8RB 1L9TA 3ZT6A 3W71A 3LIZA 2GC4C 2DW6A 2MEJB 2WB7A 2Q6WB 1H7RA 5ACLA 3ARDD 3O6DA 1K3IA 1FOBA 3EWYA 3SN0A 1KLFA 3AWOA 1TTGA 1GOQA 1J8VA 3FCGA 1Z66A 1E6JH 4Q9RH 1A8ZA 3H9SE 5CC5A 3VE9A 4QITA 3RDTA 2VQ4A 3ZHKA 3K80A 1JFQH 4HU8A 1LO4L 3WHXA 4HK5A 4BKSC 1HO1A 3NQKA 4FXLA 5IVXB 5F3HA 2PYED 4LEQA 5FFGA 3H42L 5IT2L 4LY4A 5JIPA 4NYLA 1N0LB 4XPGL 2MNRA 2IWGA 3LV5A 4R34A 1ML0A 1MQRA 1JPST 4M6PA 5D7HA 2PTZA 2QJHA 3ZDXF 3CFEB 2CLRA 1FG9C 2LQRA 2C4FT 1XTMA 3ELFA 3TNNB 1DOSA 5AOLA 3E9TA 2QCHA 1QRNB 3I9IA 4Q4OA 3U0HA 3GNPA 4UNIA 1MEHA 1F1AA 4CNOA 4CVXA 1HKWA 3OBAA 2HZGA 1BWLA 1AGFA 4QHRA 3MDUA 4BV1A 3C8DA 4J1OA 1WFJA 4Y16B 3W38A 3BIAX 1A64A 5C55A 3AUJA 3LNMA 1E0OB 5FKYA 5DBUA 3N9GH 3NQFA 4MZIA 4TF4A 1R3HB 2PCFA 4B41A 2CNYA 3N4AA 1I1AB 1JF1A 1MWAL 1XH0A 2H6UA 2J9YA 2X5PA 1D6VH 3ZYIA 4A1RA 1K4HA 4Z6AT 1S7VA 1KM4A 1BWKA 4B16A 5F44A 3GBLA 4FAAB 2NXYC 4D0CA 4OCXH 1YECL 2WIIB 3TTQA 1SW0A 1S3KL 2Q87A 4APQD 2ZCLL 4ANXA 3F7PC 3DBNA 1NWSA 4FK9A 4U3AA 2YA0A 1Q6CA 3REVB 5EG6C 3W7NA 5EU3A 5KWYC 1E9PB 1WRFA 4NASA 2HRWA 1KENL 4KWVA 3ZQWA 3IJYA 2HRLA 4JRFA 3PANA 1G0CA 3UAJD 4NKIL 2MPAH 3LXBA 4MMZB 4HPNA 3W75A 5HJGA 3VFWB 2XA3A 2WD0A 3CZSA 2FT8A 5BV7C 3P0WA 3CAKA 2CKNA 5B4MD 1NPJA 3GMPB 4AAJA 2VVSA 5E99H 1WCBB 1PUDA 5KZMA 5C3IA 4R2GD 3W9EA 3QDMD 4QO1B 4FP8H 1E1CB 2PR4H 1G1OA 2I07A 2ZTBA 3U25A 1RPQA 3ZWSA 3P80A 3L2LA 1OT4A 3AOFA 5HYFA 4RV8A 3LBOA 2PZ0A 15C8H 4X7FC 3QJVB 2H2SD 2V0TA 1BYPA 4J5NA 1QR1A 2R6OA 2PDNA 1UCBL 3L66A 2XFFA 3HZKB 1HK6A 3UTSA 3RNDA 4Y9AA 4EDWH 4H0HB 3LHPL 1OV8A 1NIUA 4HC1L 4B3ZA 4F2TA 5K9XA 1AH4A 4N2LA 3S9ZA 4HK6A 4YHYB 2RJHA 5E0KA 3HC4L 1XIHA 4A8NA 1SJEB 1NTHA 1Q1JL 2VEMA 4XOCA 1ZGLP 3S3JA 1L5GB 2IKHA 1Q0XL 4Y2DD 3VFPB 5EO1A 3SRFA 2XG4B 3Q1SL 1GNXA 1J10A 3D4CA 2IPUK 4G5ZH 3LCWA 3GI8L 3LSBA 1Q38A 1KJ3L 4K2SA 1K8CA 3NH7L 1LUCB 2NUXA 4YVUA 2ADYA 4LSQL 3G5ZB 1EB3A 2ATMA 1NCHA 2YRZA 4IFRA 5AVXB 1MCQA 2BVUA 1JGDB 1A5BA 1FZKA 4EIBA 1XRFA 2IG2H 1HI6A 1MJJB 3UP6A 2EDQA 2B7OA 4KK5D 3TYGL 3ZE1F 4TQ8A 1DIDA 2WHVA 1JVKA 1L6YA 3MSPA 3WSQH 2A3CA 5GHWH 5HBBA 4Z7AA 3TA9A 1F8IA 1A3HA 2P8PB 2GTQA 4L3FA 4K68A 2APWA 1PLBA 5HMEA 2PW2A 2P24B 4B95C 3E7JA 3WOVA 3ULAB 3NYDA 1GA2A 4RQQA 4WKZA 3LV3A 2XZ7A 3QEQA 3RVUD 2G97A 2WYSA 1SY6A 4FZEL 1HH9A 4KJWD 1I3GL 4ONFL 4YDIH 3O3BB 4PA8A 2EEFA 5DVPA 2YCLB 4S0TD 4WFFD 4IRZL 1IRAY 2YOAA 3VKAA 4YDJA 2ZOXA 3HTWA 1KBLA 1OY3B 1KF9B 4U7SA 4H9UA 3AS3A 1EXUB 1L2UA 1AHWC 1M01A 5FCUH 4Z7OE 2Y22A 5FOBB 2BW5A 4PMQA 5CC6A 4MJ5B 2Z28A 1PF3A 3JWOL 3MV9B 4Y4HD 4B5VA 4Y1AE 4MGGA 1KFCA 2LR4A 4OLEA 4FXKA 3P9LB 2D03L 3VNJA 5LCVL 5AB2A 5I3GA 3FFCE 2AS5M 1UKSA 2YYTA 5I0ZA 1TQJA 3RTQA 3DHUA 4S0HA 2ACRA 4AGNA 1T0NA 5G5IA 5JPMC 1KYOJ 2R69A 3QUYB 3S96A 2OMNA 2AXFB 4YDKH 3GGWA 3G5VA 2Y06H 3WNMA 2C0HA 3UJRA 1UH4A 5A69A 1S5HB 3Q65A 4NDMB 4X7SL 4FQQA 1VGAA 4ZBCA 3AWNA 3BAJA 1QNIA 4HV8B 2A6KB 3IS0X 2B5IC 3A5VA 4XCEA 4DZBB 3IDYC 3H3PL 3B8YA 5MHSE 5MEPA 1ISVA 4DUVA 2I9TB 3RGTA 3UZXA 3I68A 4Z1DA 3JBG7 4A8IA 1FF5A 5AW3B 3G6AA 2B0SH 2DTSA 4JO3L 4XBGB 4MYPA 4YXKH 5FM8A 3AGWA 3WIHA 1JNEA 3TZFA 2R29H 1J87A 3N4FA 5DS8A 1MUWA 4K5OA 2RGSA 1U2HA 3HI5L 1KPUB 1JNNH 3VWJA 5BOZG 3RKPA 4DF2A 3ZFHA 1W9VA 2HJLA 3KDNA 4GKNA 4APXB 3GRWH 3R4RA 2OEMA 1P4LA 3N6HA 2I9LB 1IYXA 3R06B 4HUWA 3U3HA 2XKUA 3EUUA 4OQTL 1WXZA 2Q01A 4O8RA 3EDEA 5DLCA 3S1UA 2PF6A 4OY9A 3ARED 5HNUA 1U95A 4LRTA 5I28A 3EXSA 3W6YA 1JD7A 3RO8A 1AL7A 1LL7A 3E0GA 5BMFH 1I31A 2ADIA 2CLPA 2P5PA 3KOWA 5C2XA 2J25A 3KVLA 4D0DB 4NQEE 4MXVF 4E9RA 3DRQB 4OJFH 4I18A 3JWDH 3VXTB 1TE6A 4G2AA 4DLFA 1T66D 1GGBL 3BAEL 3LHVA 2ZG2A 3DA0A 4I4WB 5DUML 4D9LH 5ABFA 3MTXA 4D8ZA 2PPFA 3F01A 2HVJB 4GVGA 1NLBL 4E8GA 5HANA 3ITTA 5GS0H 2FWUA 1TELA 3BQUD 3GG7A 3K2UL 1VPXA 3JV4B 4NLAA 5EIVA 2XQBL 3HNVH 5DRXA 4YHZH 3RVWD 1K4CB 1N9PA 4LBEA 3OZLA 1QOXA 3BPWA 5E8NB 8TIMA 1I53A 3P81A 1HXYB 3RM8A 4F1SA 3FCTB 1RQ5A 3O3DA 1WBHA 1HINH 1ZLWH 3EGJA 1Z6KA 2PB1A 4NC1C 3U2JA 2ED8A 2Y6SD 3W3OA 3HAEG 3TO2A 3ABXA 4RZKA 4DRSA 2XHYA 1C8PA 3CN3A 4M48L 3TNMA 3WLQA 2ZE3A 1XEDA 5ID0A 2BZCA 4FZ8H 1IBDA 3LPGA 3E0FA 3CN0A 5L8LB 4KPHL 4NNPH 1G6RA 1R3RA 5CF3A 1GGTA 2FIKA 1LO5B 1BZ7B 1FBIL 1G7HB 1SDAB 3BDXA 2DV6A 1DR9A 2IQAA 1GS7A 3CUXA 3QSRA 1DQUA 1RHFA 4HS3A 1ICSA 1LCOA 3DENA 2R24A 3F5WB 1CG9A 4JE0A 4XXWA 2Y07L 3NN8A 2X1WL 5JA8B 5F4WA 3WLNA 5I8KL 4PHXA 2V7NB 3W7LA 2W0FB 3QDJB 5FO7A 2Z65C 3TCLA 3VG0H 4ZSUA 5IHRA 3BEVB 2IKJA 1E4XH 1W72B 3HMWL 2BP0B 3SJVB 5JHDD 3HMXA 4C56E 5DVLA 2L7QA 3PJLA 2VX6A 2G9KA 4UQ2A 1HDMA 2CGYA 1R9YA 4L23A 1JPSH 3PQYE 3T3MF 1FC2D 2J24A 4HZ1A 3KBSA 3DXAA 3TVMD 4GUGA 2AITA 2ARJQ 1KGWA 3P69A 3ZBMA 3MBXL 1NFKA 2Y7SA 3HC3H 6ALDA 5F9JB 3N1QC 3PL6D 1R5VB 3FS2A 1WO2A 2LU4A 1I75A 5LDUA 1D6EB 3ENLA 5L7XL 1TNMA 3RMEA 3MNVA 5CD3A 1T5XB 2FHCA 2D0GA 3FNDA 3Q13A 1M05B 3ZKQD 2OSWA 3RL1A 4P59L 5EU5A 1SRDA 4MMZC 1NSNH 3UTTD 1JIBA 1OCOB 4WK4B 5DA0B 3BCDA 2AAVA 3N1AA 3ZDZF 3HG4A 1OAQH 3ZE0B 1O75A 1AI1L 4F8XA 3U0WH 2DZPA 3EOTH 4QRPB 4UV4H 2PTDA 4H1LA 2IPUG 1IL1B 1H4PA 3HPFA 3GVVA 2D4DA 3IE9A 2QW5A 3EF7A 3W86A 3BP6A 3R18A 3M86A 3QRBA 1Z5YD 4WRLA 4Z1AA 3CDGA 3KLAB 2VABB 1QK0A 5C7XL 4XPHH 3CHPA 3HBPA 4QYOA 4MD5B 3QIBA 2RH0A 1AR2A 1YYLH 4MB5A 4M5YL 3MYPA 3QI9A 5IM7A 4AIEA 5DK2B 1NFDB 1UOKA 1DUZA 1L6SA 1M03A 4ATLA 5HI5D 3MLZL 3WKML 4YHYC 3JWOC 3CHCA 2VDLB 4YXHH 3ZVHB 2X89A 3WCZA 1Z41A 4KWWA 4AJ0A 2XN2A 2B39A 2I56A 1K9EA 3M0MA 3UACA 2XN9A 1POKA 3LRKA 4IBVA 4OLUH 1VENA 4DHLA 2W59A 1DWAM 4CD4A 2FH8A 4U1JA 1I8JA 4FL4B 4DVBA 2EIZA 3FHEA 4GMTH 1SFLA 5HA7A 5FV2A 3DK2A 2FD6L 1G4PA 2ZWNA 1P7BA 1YHPA 5CU5A 2UVFA 3WK1A 1YYML 1RY7B 1DO6A 3MTWA 3L4ZA 2GJ6E 1K6AA 2FDSA 1UXMA 1Q0YH 3ZGIA 4GZEA 2GK1A 5C7VA 4HKBA 2E5EA 3IGAB 4IP4A 3O6KH 5CH9A 1UGNA 1J0KA 1DVSA 5AQ0A 1UB6A 3PF3A 1FGNL 4KQ3H 4L9ZA 3BSHA 4PJAF 3EOOA 3T08A 1M1XB 5XINA 1I8LA 5JUEH 1W0MA 2B59A 1FJ1B 1KXQE 43CAA 4JIHA 5E1IA 1R87A 4JRYE 2YKKA 3FO1A 4OTXL 1NJ9A 1F41A 4L4VB 4XBPA 3IVSA 5E4OA 2ISFA 5DT1H 2JKIS 5D1ZD 3U4BH 2KYIA 5DQDH 5J3HC 4NO2A 3QNXB 1FZOA 1EMTL 4DO7A 1S9VA 4DKFH 2HB0A 2A99A 5KYXA 3FOKA 1QOQA 3NQ8A 1NC2D 5JW3L 4D9QD 4UNUA 2IMRA 3P8JA 5D7EA 4NJGA 1R19A 4OE7A 4WWKD 4JAMA 5ECJE 4K9EH 4XAKD 4BDVB 1W5QA 2ED9A 2QKFA 4FXJA 5INCB 3TO4C 3UJIL 3H9ZA 4N02A 2EXYD 3S36X 3UTSD 1IM9A 4JFOB 1LTXA 2W38A 1AXTH 3TBVA 4PYGA 2MQ0A 3ATEA 4ZNEE 3KBMA 2NX9A 2QULA 3NL6A 4IRSB 4ZR8A 2GCYA 3I3DA 2N7AA 4P48A 1ET8A 3QUYC 2WLIA 1HGYA 4MAYA 5CIPH 4BEUA 2BO0A 3KXFB 5I3KA 1PQZA 4X9YA 5ESQB 1D9EA 1ED3B 5IJCC 2FMOA 4ZNCD 1VRSA 3DETD 3W7DA 2J7BA 7TIMA 1A4BA 4NI6A 3T6CA 3APCA 2FGWL 4Z78B 4ODSL 3CC5B 4P8VA 3WQCA 1QUNA 2OL3A 4XB7A 4HA3A 2AJZA 1VKFA 5AECA 4HIXH 3EB3A 5KYWA 4XP9L 1OPOA 3RY5A 1NGQL 4MRBA 4AG4L 2DRUA 1GC1L 4Q7DA 2PU1A 4KTEL 5CSZA 1XIWC 4DN3H 1TZHA 3DGRA 4M24A 4BKNA 4KTDH 1OJXA 3QUZD 2HJPA 2OR9H 2EDYA 3RHWF 1GPOL 2F68X 4EUPG 1P53A 4URIA 1V3MA 5M95B 4DPQA 3MOBH 4FE9A 1SQ7A 2F53D 2Y36L 1KC5L 3GLAA 4HOZA 1I4FA 2XXGA 5EWIH 5HHQB 4C6EA 3ROLA 5CG0A 1D8CA 1V5XA 3W85A 2D4FA 2O61B 1P0BA 4OZIE 1B4TA 1P2CB 3HR5A 2KKQA 3A4JA 2YUVA 4FP1A 4I13B 2PLTA 4Y9MA 1U8QA 2CDEB 2N1TE 3UYCA 1PYMA 5DHVH 2DQUH 1OSZB 3GS6A 4YDMA