4M56A

The structure of wild-type mall from bacillus subtilis
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
559
structure length
555
Chain Sequence
b'EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQRADLKSISLKPYEAVMGISI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
molecule tags Hydrolase
source organism Bacillus subtilis subsp. subtilis
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
total genus 221
structure length 555
sequence length 559
chains with identical sequence B
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m56A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m56A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m56A02
1JG9A 3CZNA 5IXEA 3SCPA 3QR3A 4J3UA 2OYKA 3W53A 4CN6A 3HZ3A 3AZRA 3PZNA 4R27A 1KTBA 2J7EA 3T2PA 3VUPA 1KXHA 5KEZA 1B90A 4LYRA 3DHPA 1QNQA 2DT1A 1PIGA 1D2KA 1B2YA 3WNKA 4DUXA 3VINA 2NW0A 1UD5A 2YL8A 4UQDA 5E9AA 4F79A 1PJ9A 3VD3A 4MNLA 1V0KA 3D4ZA 3PZUA 1US3A 3OB8A 2ZIDA 3AICA 2VCBA 1DTUA 3FXYA 2VI0A 2X2JA 1WDSA 1EHAA 1E4IA 2WXDM 4AMXA 1E4MM 3M46A 1XH1A 4NZFA 3BUBA 5A95A 3NYDA 2WVTA 1ECEA 3VIGA 1VFOA 3MU7A 1GCYA 1TQVA 1LWHA 3WY2A 2BXZA 1J0IA 1V6UA 3BAIA 1E6QM 1GORA 5IDIA 1QHPA 1BGAA 5IFTA 1CGVA 4AD1A 1BGGA 2BY1A 2WHKA 3L4XA 4UFHA 1HP4A 4HPGA 3N11A 1NP0A 3I3DA 1CGXA 4ZENA 2WCSA 1C8XA 1Z32X 4B3KA 4AMWA 1GUVA 1FH8A 3TOPA 3RO8A 4AWEA 4OOZA 4FNQA 2VUYA 5DEZA 3N04A 3EMCA 3WMCA 5BRQA 4GIAA 3EDKA 3ZT6A 4UFMA 1OT1A 1O7AA 5FOOA 1FFQA 4YHEA 2JE8A 3AHXA 1XC6A 4GKLA 2V5CA 1MXDA 5E1QA 2JEQA 5CGMA 2YDSA 3BSGA 5DF0A 3CZSA 2PI6A 3WIJA 1UASA 3WSUA 1GVYA 1BF2A 1HTYA 1GJWA 2YIHA 2YL6A 3GH4A 3GDBA 4CCEA 3EDJA 4KRUA 2IXVA 3QOKA 1JNEA 1X6NA 3VO0A 4Z2JA 4D1IA 4AZ6A 1V08A 3BXWA 3W25A 3AFBA 2XWDA 3WENA 2FHFA 4LQ1A 4U2ZA 4CCCA 4H8UA 2VO5A 3J7HA 1LLOA 4WIWA 1E9LA 1HKMA 4W8AA 2A3HA 4NF7A 3AHZA 3DC0A 1ZJBA 1E55A 1DWAM 4MB4A 1XRVA 3GXDA 4IM4A 1VBRA 3MUIA 3EJRA 2OLHA 4AEFA 3VM7A 4CN1A 5M5DA 2Z1SA 4N42A 3TTOA 4GO9A 5FIPA 5A6BA 2ZE0A 3K8LA 1B3ZA 2BVDA 2X0YA 1US2A 4CD6A 3CZ8A 5DT5A 1QNSA 2YA1A 1MXGA 1LL4A 3UESA 2VX7A 3ZR5A 2XYLA 2VC9A 4R5EA 2GFTA 2XVLA 3M07A 2QPUA 3EBVA 1FHDA 4P7OA 3KEHA 1SFSA 3AMGA 4W86A 2IGTA 3DX3A 4ML4A 4CD7A 1BVNP 1K9FA 4CD5A 2JEPA 5GQBA 1CYGA 1J9YA 2WMIB 3HG5A 1H0IA 3PZVA 3ZJ7A 1J0HA 2A3AA 1CDGA 1M53A 1UYQA 3IGUA 1QX1A 4U2YA 3TV8A 3CGTA 3WUBA 3A4WA 1PBGA 4JFUA 1NOUA 1JZ3A 1BVZA 4GXPA 1JDDA 1V3LA 3GNPA 2XSBA 2NSXA 5CSUA 1GOKA 1GOWA 3QHNA 3T2OA 1QWNA 3POCA 2O92A 2WK2A 1H5VA 5DMYA 4W85A 2ESCA 2DIJA 2V3EA 3DX4A 2F7PA 4JHZA 5CLWA 1FA2A 4MTVA 2DSUA 1NOWA 2VT0A 1JYXA 3MANA 1B1YA 4KWUA 3GXTA 3EDFA 1MW1A 1HJSA 2E8YA 1W1YA 3W6MA 3WBEA 2JIWA 2X2YA 4D71A 4NRRA 2E9BA 1BYCA 1BAGA 1LG1A 2J8FA 5E0FA 3AMCA 3AIRA 4JAWA 2DSWA 3WQ5A 3L2MA 2UWFA 5IHRA 3MUY1 1UR8A 3ARRA 3OLDA 3ZT7A 3SCWA 5JBDA 5A6JA 3OGRA 2WVUA 2WMJA 2VRJA 2YBTA 3VD9A 1NOFA 4JFVA 5CLTA 1JGIA 3UCQA 1G0CA 2J75A 4OBSA 4PCSA 3FW6A 1UWRA 2D23A 3F5LA 5ABFB 1UWQA 3BGAA 2DH2A 2VOTA 4Z2KA 5LA2A 1W3LA 1VEPA 1E4NA 1NARA 3FHAA 2EO7A 1WZMA 4ZXLA 1V6XA 2XGIA 4E2OA 2VX4A 4U33A 1BG4A 4C7GA 1NWRA 3WD0A 5I77A 1UR1A 1F4HA 2ZX6A 1VFMA 4AZ7A 3VGFA 1KWGA 4M1RA 1GJUA 2CETA 4MADA 3U7VA 4E8CA 4HZ8A 3WFLA 2WAGA 3DECA 2J47A 1K9TA 1YQ2A 3U7BA 3FAXA 5A6AA 1NM9A 4H7VA 3GH7A 3VGEA 1E40A 2WSPA 2Q8XA 3VNYA 4MNJA 1U30A 1HIZA 1M04A 4H41A 4IISA 3BVUA 1E0XA 4FNUA 3QHOA 3SCSA 2ZXAA 2J7HA 1CXIA 2EJ1A 2MANA 4W7VA 2XFRA 3VIMA 5ABFA 4UQCA 2G41A 4AEEA 3A6OA 4YN5A 4JKMA 2V3DA 2VRKA 3K4AA 5A2BA 2Y8KA 4EK7A 3WNLA 3GXFA 3BUPA 2XVGA 4W7WA 3HN3A 1LL7A 3TTQA 1MYRA 4J3WA 4W84A 1HL9A 3IJ7A 2BY2A 2WC7A 5JUVA 1V0MA 2XIBA 3TTSA 3DX0A 4Z2HA 1A47A 4PMQA 2GDUA 5F7UA 5AYBA 2D1ZA 3RM8A 3MUZ1 2PWHA 2BY3A 1JZ5A 1DP0A 4E8DA 2VL4A 4FNRA 4GZEA 4J3XA 4URIA 2PWDA 3WDQA 1B3XA 1J18A 3FNDA 3MS8A 1M01A 2UY5A 4M29A 1KXTA 4AD3A 5A8OA 3IAQA 4DM1A 1MW0A 2O9OA 4J3VA 1W9XA 5AC5A 1HKIA 5HOSA 5BXTA 4B9ZA 2WCGA 3VGGA 3SCVA 4HP5A 2PWFA 1J0ZA 4JKKA 1N82A 2WLYA 3AIWA 2WMIA 1VAHA 2QV4A 4PTXA 3ZT5A 4BCEA 1JZ7A 2Y24A 1W9BM 4MNKA 1PX3A 5E0CA 1TQSA 4X0NA 3S2CA 4D72A 3GZAA 5IFPA 4PUEA 3NDZA 4K68A 2EACA 2AAAA 1E73M 2CBJA 1WE5A 4DO6A 2ZOXA 1NWTA 3THDA 3UERA 5DFAA 4IPLA 3II1A 1O6IA 1E6NA 3FAWA 4WJXA 1U2YA 1VJSA 4AW7A 1GVIA 2F1AA 1E5NA 2W61A 2FHCA 2WW5A 6TAAA 4KH2A 1QI0A 1IT0A 5HBFA 4BQ4A 4PBGA 2A3EA 3BH4A 4LYPA 4PEEA 4HOZA 3EMQA 4PYSA 4QCFA 3A4AA 1B3VA 2BS9A 3WY3A 1E3XA 1FP8A 3S6TA 5I5RA 5ABHA 2CHOA 1YHTA 1B30A 3VD4A 1EDQA 4JKLA 3QOMA 2WNWA 3IK2A 2Y8VA 3W26A 1TA3A 3B8SA 1QI2A 3OLGA 3WDIA 2WHLA 3PZMA 1Q6DA 3GH5A 3WEOA 1E3ZA 5I6SA 4OIFA 5A6LA 3BVVA 4FF5A 3WKZA 3OA5A 4D6GA 4Y7EA 1XCXA 3LXAA 2WPGA 6CGTA 4ZXOA 1FH7A 2W63A 2YOCA 4A3YA 2D3LA 3ZJ8A 4GPNA 5TD4A 4PMUA 3AHVA 1ISVA 3MKKA 2E3ZA 1OIFA 2RGMA 4AYSA 5JIPA 5EBAA 5A1AA 4UCFA 3L4WA 1BG9A 2X05A 5CJ5A 3VPLA 1JDAA 1CXFA 4J28A 1NP2A 3W27A 3ARZA 1PPIA 3PZ9A 3WH5A 4EE9A 4J3SA 3T08A 8CGTA 1UR2A 1MQQA 2F7OA 1UD4A 1UWIA 4U3CA 2WCAA 1EDGA 2XSAA 2WLZA 4JCLA 2JIEA 1GPFA 4MJ2A 5I2UA 3VDBA 1HNYA 1RD6A 3CZJA 1ODZA 1R33A 5A8MA 4ACZB 1R8LA 1TQUA 2JALA 2WANA 2XVNA 3NSXA 2J7CA 3AQUA 3APGA 4DO4A 3WF4A 4D6CA 2DGAA 1AQ0A 2VNCA 4M56A 1HJXA 3ARWA 1I75A 1ITXA 4DWSB 3WL1A 1CTNA 5D9MA 5I0DA 3OGVA 3K46A 4TVUA 1JNDA 5CZKA 2BY0A 1PEZA 1HF6A 3ARPA 1UH4A 3BAWA 4CUCA 1DHKA 1MFUA 3D4YA 1XV8A 1JD7A 2VZSA 1C92A 4B3LA 2CYGA 1Q6FA 1EXPA 5HPOA 2XN2A 2ZXDA 5CQ1A 3VGBA 3QHMA 2EPOA 2FHBA 4WSKA 1KCKA 3LPFA 1H49A 4OZOA 2CITA 2C0HA 4DWSA 2XIIA 2TAAA 5HXMA 1UR9A 3CZLA 3DDGA 4AISA 1KB3A 2X8RA 3BLPX 3VIJA 2CNCA 1UR4A 3TONA 9CGTA 5AY7A 1WZKA 3L2LA 3RJXA 1CGTA 2CHNA 2J62A 3HG4A 4GO8A 1JYWA 4UQ9A 4JFSA 3KLKA 2EPMX 3K8MA 3VX0A 2DQXA 1VB9A 4D6FA 2W4XA 3TP4A 4MB1A 3PZIA 3AHTA 3NCOA 1JZ4A 4W5UA 2DH3A 3OZPA 2XPKA 3WUFA 1K9EA 3NSNA 3ZSTA 5CPTA 3GNRA 1BLIA 4LPCA 2B31A 5DT7A 4L4PA 3NIYA 3U57A 4ZE4A 2HISA 3AIQA 2JF6A 3F5KA 4PTWA 1CECA 2VZTA 4D6EA 1HVQA 3ZOAA 2BVTA 2EQDA 3VMNA 3VSUA 2YA0A 3ZQ9A 1W9UA 1ESWA 4U31A 4AZBA 2EEXA 3CHCA 1MVYA 3AXIA 3WY4A 2GVYA 3B9DA 3PTKA 2AOSA 2VJXA 3WMSA 2WC3A 2DEPA 3JUGA 3WEZA 1EO5A 2CBIA 1TA3B 1UD8A 4PRWA 2WM0A 2EPNA 2WYSA 1Q6CA 2OSYA 4FNSA 4CKQA 1BYDA 4Q7NA 3CIVA 1BYBA 5I24A 2WC4A 2ZUMA 2EBNA 1NWUA 1VRXA 2NT1A 1CXKA 2G8ZA 4HZ6A 1C7TA 2D73A 1HJUA 4HU0A 4P7QA 2CCRA 1XD1A 3A5VA 5A8NA 3CHFA 2WVVA 3W38A 3A4XA 1R34A 5CPSA 2Y4SA 2CBUA 2XN1A 2GSJA 4JL1A 2J74A 1B9ZA 3AMLA 3OG2A 1DWFM 4UR9A 3T0DA 4AC1X 1G1YA 3IAPA 3BMVA 1TQWA 2UY4A 2WMFA 1W2PA 3MO4A 4JFTA 3EYPA 1VEOA 1QHOA 2VX6A 4M24A 1W3KA 3CUJA 1B3YA 4YHGA 4ATDA 2YL5A 4WLCA 3AIUA 2AMGA 1OGBA 1CNVA 4CU6A 8A3HA 1IZKA 1B3WA 3PBGA 5AYIA 4ACZA 4W5ZA 1C93A 3VKKA 1CXLA 4A4AA 3SUTA 1PZ2A 2X2HA 2WSKA 2VVSA 1UD6A 2WVVB 3PHAA 5I3DA 5DO8A 2CBVA 3WNMA 3AZSA 4UFJA 1QWUA 3GNOA 3UR7A 1UD2A 3VDAA 1WP6A 1VFFA 1V6VA 1QW8A 4UZUA 3WDHA 2YFOA 2OWCA 4TUFA 1WKYA 2YA2A 2VCAA 2VVNA 1VENA 1CLVA 3VVGA 1WDRA 4NX0A 3ZJKA 1JI1A 1OINA 2ZX8A 4JCMA 4WK9A 4JFWA 1QHZA 1JXJA 1R47A 1UR0A 5C71A 2HVMA 1R85A 1E15A 1EQCA 3IANA 1KGWA 4XV0A 5CXPA 4S3KA 2EPLX 5ECUA 3THCA 4JZ5A 3L4TA 4PMXA 3VSVA 1HP5A 3OBAA 3VSTA 3N9KA 3NUKA 3AS1A 3BMWA 1F4AA 3O2LA 3G6MA 5M03A 2QHAA 4CD8A 1WB0A 1V6WA 1Q4NX 2J7DA 3OZOA 2BHYA 3ZSSA 2G3IA 1S46A 3WH7A 2W92A 1W3JA 1VBUA 3NDYA 1WDQA 3LMYA 5A69A 1WO2A 1E1FA 4AY1A 4U5IA 1HT6A 3H55A 4UQEA 1R7OA 3UR8A 1UA7A 1OBAA 4M80A 4EANA 3VIFA 2QMJA 2F61A 2DT2A 4S3JA 1M7XA 1BFNA 1OCQA 3AMKA 4MNMA 4AD2A 4UQBA 5FD0A 1XSIA 4KRTA 1E5JA 2ZICA 3D5HA 2E9MA 4BQ3A 1ZL1A 1AQHA 1B0IA 1J12A 3T2QA 1T0OA 3VDHA 1NWSA 2OYMA 1XH2A 3VIHA 4BA0A 3LXBA 1QNOA 1WZLA 1GW1A 2XHYA 2EXOA 4BQ5A 2VURA 4HTYA 6A3HA 5LYRA 4Q22A 1FOBA 2ZWYA 3WUEA 1EOKA 1MW2A 4KGLA 5FKYA 1UA3A 3IJ8A 2WWDA 2VZOA 4H8VA 1JI2A 5I23A 3GXIA 1JFHA 3L4UA 3WD1A 4NSBA 4AZIA 1GOOA 2DIEA 4XZWA 4F9DA 4FLQA 3N1AA 1KGUA 3CUGA 1MWOA 1XSKA 1K6AA 4UNIA 4P8UA 1RP8A 2D0GA 3SUVA 3BCDA 2XM2A 4PTMA 5C8BB 3RILA 3SUUA 4PSPA 4AZGA 3PZGA 4CCDA 3VGHA 3SIMA 5CSYA 5A94A 3LX9A 5D8WA 4W8LA 4ZFMA 1UZ1A 4LXFA 1E6XM 3TA9A 3AS2A 3VIOA 2J79A 4XUYA 1OT2A 2OSWA 1UD3A 4HPHA 2QMKA 2FGLA 3WD4A 5JBFA 3KL3A 4QAWA 1E6RA 4FLOA 3WQWA 1R75A 4FMVA 4W7UA 2X2IA 4BF7A 1HVXA 4ZE5A 3FHQA 1XCWA 3BAYA 3LRMA 3KL0A 4GQQA 1H1NA 2D2OA 4XZBA 2VQUA 3KLLA 4IUGA 1KFWA 1J0KA 1SR0A 3PZQA 2QPSA 5HPCA 3AJ7A 2BNJA 3L4YA 2BV9A 2PC8A 3K8KA 1KXQA 2VR5A 1DWGM 5A2AA 1XD0A 2DSKA 4WKFA 2YFNA 1QBAA 3EJTA 5A8PA 4CVUA 4H8HA 4M8UA 1CEOA 3WN6A 2PWGA 3TTYA 4NRSA 3D52A 4AZCA 3LRKA 2W91A 2ZUNA 1TMQA 2F7QA 4HMCA 3ARVA 5EFFA 1CENA 4BS0A 1CXEA 4UOZA 4P7RA 3G6LA 3S5ZA 3MV01 4NZJA 3W81A 4D6JA 3GBEA 1W1PA 2XN0A 1FP9A 1Q6GA 4FNTA 4LX4A 2XUCA 4MAVA 2JFEX 4AIEA 2X0HA 1TVPA 4KGJA 3PZTA 2VZVA 3L4VA 3K4DA 4KMQA 2OWWA 1QVBA 3KWXA 1PX4A 5HDRA 2J25A 1I1WA 3UG4A 1V3KA 4DUVA 4L4OA 1ZB5A 5CPQA 2OSXA 1MW3A 3MMWA 4RE4A 4AYGA 4AZCB 2YDQA 3VX1A 1TG7A 3ALFA 2ZUWA 3AI0A 4D1JA 4EKJA 1M03A 3EDDA 3N13A 7TAAA 3SCQA 1OIMA 2WHJA 1H0GA 4BZYA 2BXYA 3AISA 2E8ZA 2YBUA 4RE3A 1W32A 3BVWA 1KR1A 4HU8A 3GXMA 5M17A 4WKHA 1ZBCA 3WF3A 4IPNB 4XX6A 3N12A 1DEDA 3D50A 2J77A 4TX6A 4TTGA 5E70A 2F8QA 4ZEPA 1W2VA 1GNXA 1WCGA 3VD5A 4MB3A 5E09A 5A8QA 3W37A 4TX8A 3L4ZA 1JF6A 4TTUA 1Y7VA 3W28A 2PBGA 3A22A 3ECQA 5GNYA 3DX1A 4CD4A 4PMOA 4QLJA 3CPUA 1UWSA 3QGVA 1PX8A 1JFXA 1E71M 5BROA 1BPLB 2FH8A 1EHNA 2J7BA 2WZIA 1J0YA 4HOWA 1NQ6A 4JIEA 1C7SA 2J4GA 1V02A 1JAEA 4HMEA 1P6WA 3N18A 2ZX9A 1MQRA 1LJYA 2FDMA 4F8XA 3AMDA 3CV5A 4H04A 1ZBWA 3AHYA 5C70A 2WWCA 3WD2A 3LPPA 4J7RA 4AZ5A 1HKKA 4MJ4A 1VEMA 2C8NA 3DHUA 4NI3A 2DSVA 2QLYA 3UEQA 2WB5A 5D9OA 1JL8A 1J0JA 1R46A 2J78A 1E6ZA 3RJYA 1SZNA 3KL5A 3ARTA 3WF1A 3H53A 3ZJ6A 1TZ7A 3RIKA 4GZJA 4CU8A 1AQMA 2D0HA 2WVSA 5D9NA 3A21A 2V3GA 2D24A 1E43A 3VU2A 4WF7A 3K1DA 3DYOA 1ZS2A 3BSHA 3CZGA 4W89A 4UQAA 2O9TA 4GI9A 1VJZA 5I78A 4J3TA 1TCMA 1E6SM 3VIPA 2YDRA 3A23A 4CN4A 1V0NA 4QLLA 4QLKA 2Z1KA 1ISYA 5A3HA 4H2CA 3DDFA 2X09A 1J11A 3WH8A 1PZ3A 5EFDA 1AVAA 2G3MA 1OD8A 3SCTA 5I79A 1V02E 3FY1A 3VOCA 2ZUSA 3VDCA 2ZXQA 3AOFA 1W1VA 5BWFA 3PTMA 2ZUVA 4OJYA 2A3CA 1E1EA 1VIWA 3VTRA 4FNPA 1PS3A 3PZOA 3W4RA 4MDOA 1KBBA 1HWWA 2CKRA 1X6LA 3UETA 4OUEA 3U5UA 3HJEA 2DSZA 1O7DC 5GNXA 2UY2A 5IHSA 1W91A 1WPCA 1OM0A 2EABA 4PSRA 4AIOA 1U33A 4M82A 3RPMA 2E40A 5GNZA 4ACYA 1EGZA 3RDKA 4P8WA 3ZR6A 3ARQA 2EAEA 2YJQA 1G01A 4AD4A 3VGDA 2E0PA 1BSIA 1I1XA 1H41A 4F9JA 3MSGA 4ATWA 1ZBKA 4PMYA 1QOXA 1QNPA 5A6MA 4V27A 2IUZA 1V3IA 2FYVA 3CHEA 1W1TA 4HA1A 2GDVA 5CG0A 1EO7A 3T0BA 1V6YA 2XGBA 3KZSA 1RPKA 1UH2A 3WNOA 1SMAA 1E72M 3EMZA 3BAXA 2F1BA 1JD9A 2IXUA 4TVCA 1DWIM 1SMDA 3ZIZA 1WDPA 1LQ0A 1VF8A 4MB5A 3OGSA 5E6YA 1UKOA 2UY3A 1EDTA 4LYQA 1HJVA 2W66A 2V3FA 2ZXBA 3CZKA 1X1NA 4UFKA 3WNNA 4LGXA 2GK1A 4B9YA 1V0LA 4AIUA 1C91A 1HKJA 3A24A 1HX0A 1C90A 2D22A 2WKLA 2W5FA 1C8YA 3GTNA 3EJUA 2Y5EA 2XFYA 1UHVA 4XB3A 4PMDA 3WH6A 1H09A 4X9YA 4B16A 1CGYA 3LPOA 2OYLA 1GQKA 1XYFA 4AD5A 4DM2A 3HMCA 1G9HA 1K9DA 3CMGA 3M7SA 3CUFA 2XG9A 3VNZA 1NH6A 4PMRA 4QFUA 3FN9A 3ARSA 4CU7A 5LA1A 4J27A 3B9EA 3AROA 2YKKA 3ARYA 1WAWA 3WDPP 3AZTA 3T0AA 1KQZA 3VMOA 2GK1B 3DYPA 4PTVA 5M3WA 4CVWA 1JYVA 1KWKA 2CERA 3MUAA 2DT3A 2OW7A 1FH9A 4HMDA 1ZU8A 1XH0A 2CXGA 4P7LA 3CUIA 1LF1A 5A6BD 4ATLA 3BLBA 4DWSD 1OGGA 1CPUA 3SCNA 2DDXA 4PMNA 2WBKA 3WQ6A 4E4PA 1EA9C 5D4YA 3WQVA 4C7FA 2J8GA 2VCCA 3CMJA 1UWTA 2QF8A 2PF0A 3BAKA 1GHRA 1B31A 3A3HA 1JXKA 1JZ8A 1TUXA 1HJQA 2WZEA 1CXHA 4QCEA 4TOQA 3EJSA 1XYZA 1W9PA 4MDPA 3DYMA 2O9RA 4OBRA 2ALWA 4OGZA 1CWYA 3ZM8A 4P8XA 3W82A 1GOQA 3WY1A 3E1F1 4PN2A 1C8QA 4WSJA 3VD7A 3AYRA 1EH9A 2O9PA 5EB8A 3WD3A 1E6PA 1BTCA 1UQZA 3HU7A 4OKDA 3WELA 1HXJA 5LA0A 4HZ7A 4OOUA 2VZUA 4X0VA 3DX2A 3CHDA 2GJXB 2JF7A 3O9NA 1QI3A 1HXKA 2XVPA 5EMYA 3HG3A 1HJWA 1FHLA 1KXVA 2GJRA 4Z2GA 4U3AA 5BYWA 2A3BA 3RM9A 3D3AA 4UOJA 4HA3A 1W9DM 2FGZA 1L0PA 1R87A 5BCAA 1JIBA 4HOXA 3HG2A 2X1IA 3ZMRA 4C7DA 3D51A 5E6ZA 1KBKA 3LRLA 2XJ7A 3KE0A 2YLAA 3CBWA 1PIFA 1GQLA 4Z2IA 1QW9A 1G5AA 1OD0A 4FK9A 3T09A 4A3HA 2GJPA 4W87A 3WF2A 4GINA 1IV8A 2VMFA 3VM5A 1D3CA 1TQTA 1J01A 2VR4A 1IZJA 4DWSC 4CGTA 1JAKA 1W9VA 3ARXA 2DT0A 3GXPA 2WBGA 1RP9A 3AS0A 3RCNA 1DWJM 1PAMA 1CLXA 5FL1A 3GBDA 1UQYA 2VRQA 2E4TA 3RM4A 3W0KA 4AZHA 3VIIA 2ZUUA 4P8VA 3MSDA 2G3JA 2XM1A 1KR0A 1UOKA 4F66A 1V03A 3W29A 1ISZA 4UFLA 1GQIA 5ABGA 3AS3A 3AIBA 1GONA 3I3EA 1H3GA 1GHSA 1XGZA 2OW6A 1H2JA 1E0WA 5A6SA 3AYSA 3PN8A 3VIKA 1LG2A 2VTFA 2GUYA 2WHMA 1KCLA 1DWHM 3SCRA 3SUSA 1A3HA 1AMYA 1L8NA 3AXXA 1FFRA 4NXKA 3MI6A 1RH9A 5BXRA 1ISWA 5A2CA 4D6IA 3SEPA 2D20A 3PTQA 3WMBA 1V3JA 1ZJAA 2V5DA 4RE2A 2G3NA 2PWEA 3W24A 3WQ8A 1HN1A 1CGWA 4BQ2A 1JZ2A 3NJ3A 1UKPA 2PB1A 5AC4A 4TVDA 2CESA 2V38A 1OSEA 3BUIA 2XTKA 1H11A 4DO5A 1V3MA 1CBGA 2D0FA 4AMCA 3IJ9A 3WQ4A 5BXSA 4V2XA 4GQRA 2F2HA 3ALGA 1V3HA 4RL3A 2BHUA 2DPEA 2XVKA 3BUDA 1GOMA 2CKSA 1LWJA 2XFFA 4P7NA 4PCTA 2WMKA 1UG6A 3CTTA 3O6AA 1UWUA 2Y2WA 3AIVA 1GOIA 4D6HA 3WDRA 4MAZA 3F5JA 3U5YA 3GXNA 4HA4A 2F18A 1OGSA 2CIPA 4QDMA 3OLEA 4PUDA 1WNOA 1ZBVA 3WF0A 4U5KA 2CEQA 2C7FA 2F7RA 1E70M 3H54A 4WKAA 4AD0A 7CGTA 3AIEA 3NSMA 3W6LA 5ABEA 4W8BA 3MMDA 4N0RA 1QPKA 3WDJA 1J10A 3F4VA 1UKSA 2WMGA 4FLRA 1UH3A 1BYAA 5CGTA 3BUQA 4DUWA 5JIWA 1UZ4A 2BFGA 3ZO9A 3MV11 1VFUA 2E9LA 5KZ6A 5D9PA 3WNPA 4UFIA 1XSJA 3WBAA 3RMEA 3OIHA 3BCFA 3B9AA 3A47A 1HL8A 3LPGA 3GYCA 3CLWA 2PBOA 1ITCA 1JDCA 1R86A 1TR1A 3S5YA 3BVTA 1JZ6A 4Z2LA 1H4PA 4GZIA 3M6DA 1C3FA 4TXEA 5HNNA 1SYTA 2G4FA 1E0VA 3BC9A 2VX5A 3GM8A 1EOMA 3CUHA 3UG5A 4PMZA 4FLSA 1LL6A 5BXPA 2GJXA 3MMUA 3SCUA 4UZSA 4M81A 1QNRA 4JL2A 2WMHA 3EDEA 2J7GA 3BAJA 1KGXA 1QBBA 1TVNA 1D7FA 4GI8A 2W62A 1TFVA 2ZX5A 3LXCA 3WEMA 1CIUA 2FE0A 3BLKA 2BVYA 2WZHA 5GPRA 1EQPA 5BRPA 3CO4A 1BHGA 3AXHA 3WFZA 1MFVA 1TE1A 3SUWA 1UUQA 1QI4A 3N15A 2J7FA 4QP0A 3SURA 2FH6A 5A6KA 2ZUTA 1GQJA 1KQYA 4UOQA 1G94A 4W93A 1WZAA 2NT0A 2RGLA 4PMVA 3WUGA 1JF5A 4GI6A 2YL9A 4UTFA 3BVXA 5JBEA 2VQTA 1JYNA 3ARUA 5FCZA 4NXSA 5D8ZA 1OWQA 1W3HA 1R7AA 1ODUA 2WKGA 2ZWZA 1QI5A 1UKQA 1BQCA 4EAMA 1Q6EA 1UKTA 4W88A 3CH9A 2XWEA 3UG3A 2EPKX 1KTCA 3POHA 1XHGA 1E4LA 3VILA 4V28A 1E56A 4AXNA 3CZEA 3OLIA 2OWXA 1EIBA 2ZX7A 1CZ1A 4D6DA 3WH9A 3EJPA 1MQPA 2YLLA 3EJQA 5FL0A 7A3HA 1ISXA 3SCOA 3VMPA 3I3BA 4JHOA 4MPKA 2BHZA 2EADA 2CPUA 2W67A 1GZJA 4B15A 2D3NA 1OB0A 3N17A 3CC1A 3WL0A 1CGUA 4YPJA 4NZCA
chains in the Genus database with same CATH superfamily
3NAAL 3MJ8B 4L8BA 1XLKA 3C08L 2R1YA 1DFBH 1RJLA 4XVJH 3CZNA 3L5MA 1NPJA 4M4RB 2FBJH 4BKTC 4J3UA 3VH8G 5JXEA 1WUFA 3B8IA 3SCPA 1QA9A 1I0DA 4FQ2H 4F0MA 3HZ3A 4YGVA 3UGXA 4EXAA 4MGGA 4PJ9C 1I6NA 2R1NA 2W60A 5CD3A 4ADUA 3BVNB 3EHBC 2CGRH 1M7IA 2HP4A 2H2PC 1GS7A 2WZPA 1J8SA 2YD2A 4MAUH 4WJG3 3HHRB 3QNYA 4I48A 4AYFB 4PG9B 1IQWH 2DQUL 4P5TC 3ME0A 3S3CB 1QU4A 2VXQH 3FRUB 3MV7B 3HR6A 3IPWA 4GKZA 4DUXA 4KQ3L 1PVHA 3E7JA 4XNZB 2YL8A 3MZNA 4UQDA 5E9AA 3W7LA 1PHQA 3MOQA 5EEXA 2OZNA 1PJ9A 4N0CC 4G80A 5IBLC 4MNLA 3HBGA 1MFAL 3D4ZA 3TFKC 5CLYA 3S9YA 4R4BA 3O9WB 1SHWA 4BH8B 2J1KA 1J96A 5JVLA 1K2DA 2K7QA 3FCSA 3CL8A 3PPHA 4KBXA 1MRFL 2X2JA 3ABGA 1M3UA 2POTA 4MQ7A 4QOKB 5DDHB 1Q94A 3QUMH 3V5DA 1RZFH 5IR1B 4XAKE 1WDSA 4QY8A 5F21B 1ZLPA 2FZMA 3DXAA 2I7GA 4GG8B 2FATL 5ITBH 3PWNA 4K15A 1E4IA 1UB6A 3C0QA 2JI3A 2SEBB 5HNUA 5FEZA 3DOIA 3ZXWA 2WXDM 4FXKA 4IBVA 3EOTL 1CICA 4LESA 5G4WA 2QQ6A 2RJGA 1RUQL 1FP8A 4ZTOH 2CFFA 5EU5A 1JHLH 2CCLA 1FZOA 5HHMB 2R1YB 3AM8C 4OGXH 3VIGA 4JGDA 3O6ML 1WWCA 4M4RA 4KFOA 1KGCE 3MU7A 3VFWB 1XGPA 5BRZB 1D5BA 2Z31C 1G6VK 5GZOA 1RZGA 4Y5YB 3FFCE 4BFKA 1OSPL 2D7QA 1D5IH 1CYXA 3BZ4A 5ESVB 2BSCA 2X1UA 1GORA 2A77L 1BJ1H 1YEJH 4JTEA 3FB6A 2XLLA 4DT2A 4QRBA 4XN8A 1UTDA 2J6VA 4NASA 5CJNA 1RZKC 1IM9D 1ZGDA 2BY1A 4AD1A 5GS0D 3F2CA 5CJXC 5C08E 4RBPK 1U3ZA 2WAHA 2Z29A 1I3GH 4FL4C 2HAZA 1EZUA 1KBPA 3AAMA 3I7QA 1NP0A 2R56L 1NFIB 4YWIA 2WCSA 1CLCA 2XPYA 5CUSL 2N4IA 3S34H 1C8XA 1VC4A 1O7VA 5MEQA 3C5ZA 2O55A 5D7IB 5LB1A 1K2DB 3FCSB 3MLWH 1GYCA 1EFXD 2VAAA 2X6UA 1RMFL 2P88A 4MQ7B 4QOKA 5DDHA 2AXFB 2E9GA 1CFQA 4WW1B 3V5DB 5IR1A 1INEH 1BJ8A 1Y18B 5AZEL 4FYSA 2H90A 3ZE1F 2VEPA 4OOZA 4E9TA 2IO5A 2J8UF 1XAUA 1VA9A 3MV9A 3PWNB 4LLMA 3EMCA 1V79A 3K2IA 4WCJA 3WMCA 4HAGA 2IQ9H 4Z0XA 4JTTA 4B9KC 5AYUH 2J6EA 2JSFA 4UFMA 1XISA 1OT1A 2DMHA 2CM6A 1T4KB 1GYAA 2YPLA 2AQOA 4GE8A 4DTGH 2JE8A 3AHXA 1QEXA 3KW7A 1XC6A 3M41A 4XZIA 1XGPB 4R6UA 5IRPA 1MXDA 5E1QA 3LTSA 1EO8H 1B4TA 2CG9X 2PDQA 2QTEA 2XPZA 3T4CA 1DN0B 1H19A 2E09A 43CAB 3UVIA 2GY7B 5FV2A 3MZ2A 1FO0A 2L7UA 5F6HJ 4WI4A 4I0PB 4M43L 4MVAA 1GOHA 3FB6B 4BQ6A 4P2RA 5LGKA 5I74C 3LNEA 1IXPA 2FJHA 3MXWH 5JOFB 1O75A 3O6YX 3MACL 2B81A 4Y2OA 3D69B 2I16A 3H7BA 3U0WH 2B3IA 3S1GA 3BUTA 3RIAK 4ALAH 1ZVNA 4H9XA 4HQQL 5DVOA 2JCCF 5E8OB 1XKJA 1X6NA 3CWNA 4YVVA 1LEGB 3HS9A 4D1IA 2OT0A 1LLZA 4KIRA 5E9DD 5DCBA 3B9KB 7XIMA 4GO6B 3G1VA 1OAZL 2K1MA 4N8VG 1V08A 5JPMB 3KRZA 4PRIA 3WLBB 3X11A 2GKIA 2XWDA 5KYUB 3LVEA 1RJPA 3WENA 2BDNL 2DQUH 3MROB 5K1JA 2DWTA 2D31A 4I1NB 3QUML 2FHFA 4LQ1A 3LHPH 1KPVA 5A8GA 3UFIA 5REQB 3VD2A 3MV9B 1LLOA 1QK0A 4PRNB 3SDYH 1ESOA 2QVHA 4Q6YA 2CLEA 4Z0XB 4YX2L 4Q33A 3UDWC 3BQ6A 1MFAH 2F0CA 4Z23A 3V4UH 1RLBA 1W56A 5JA8B 2H6RA 1ODAA 3FSWA 5DUBB 1T4WA 4EF8A 5MENE 5DJ2B 2VJ0A 2IGFH 4WO4C 3DC0A 5DQDL 4F92B 3WTXA 4FS9A 2MKLC 4H25B 1TSHA 4R8WH 2J8TA 2ERJC 4JHBA 4N0FB 1DWAM 2YCLA 4EN3C 2Y7GA 4QHKI 3MP5A 4WXZA 3ID7A 3VFGH 3U4BL 5D70L 1IEQA 4M1CD 3LKOA 2DWXA 3NJXA 4I0PA 5DLLA 1JCMP 4LKXA 3JV6B 3LZOA 4AYDC 4GQ0A 4IM4A 1RJQA 1N6QH 2VDPL 4FFWD 4HHGA 4EDWL 1WIPA 4OAWA 4CN1A 3X2QB 4NN5C 2PPAA 5JQ9A 2CQVA 3GK8L 3VFNB 5U7SA 1OL0A 3TC9A 3QUMA 4JNXA 5D1XE 2B7OA 2OVLA 1WBHA 5A6BA 2BVDA 1OCWL 1BIIA 2X0YA 1NBZB 4UIOA 4CD6A 1N6VA 4X98B 5CSBA 2J9YA 3UL4A 4PJCE 1LL4A 5F9AC 5C0CD 2VX7A 3MLUL 3UESA 3FO9A 2YXWA 5LGHH 4JG1L 5ID0B 3BI9X 4LUTB 4M6PA 3GPSA 2QQNL 4WVXA 2QPUA 4X9IA 2V8MA 4P7OA 1RZMA 2X6BA 1SFSA 4X9HA 3LOTA 4W86A 1LE5A 4FAMA 2NW3A 1GGCH 1ZHKB 4XMWA 1Z7JA 4ML4A 3TLLA 4CD7A 2V8LA 1K9FA 2Y5QA 3R8RA 1AK5A 2J88L 4FQXA 3LN9A 1OV8A 1CU4H 2GOUA 2PCEA 3CXDH 4LCCA 5DUBA 3WO4B 3K2UH 2WMIB 3DX7A 1HH6B 3LNPA 4FOUA 4JQ2A 3GRIA 1KXVC 3OWEA 3BP4A 4DW2H 5FLVA 4OFVA 3IGXA 2Y5SA 3DWTA 1UYQA 2BNQE 3K7UA 4D94A 1WITA 3MPCA 5F9OL 1NDYA 3Q1EA 2VC5A 3TJXA 3QB7C 3TV8A 1VR6A 1YQVL 4GSDH 4GYJA 4Q8PA 3UMTA 1IWPA 2CLVB 3A4WA 3WUBA 2BP5M 2A7BA 1FHUA 4E0RB 3TFCA 4LB4A 3RX3A 3LKOB 1A4MA 4OZGA 4YHNB 3QQ9D 4HH9B 1QFEA 3OKLB 3SY8A 3SQOL 2NY1B 2NXZB 4WDXA 3MUXA 3GNPA 5ITFA 25C8H 1MCWM 2BSSA 2D3JA 1TR7A 3UTSE 1SZRA 3QEQA 2F6UA 4A29A 5HVHB 3QHNA 1ORQA 3QUYB 2P3EA 1P9MA 5FJJA 1NEZG 2EDLA 3VYNA 2EZ0D 2WBXA 4L37A 1XZ0B 3UBXI 4HXAH 3ZY7A 4L9LC 1ZZMA 2WK2A 2O4EA 1L9TA 2YR3A 3JTSB 3MNVB 4HETA 4RH4A 3HBZA 5E8EB 2G75B 1H5VA 2QEZA 2J71A 2DIJA 3FO9B 4DP2X 3HNSH 5D09A 1X7TA 2F7PA 4ZMXA 2D7TH 2OPJA 2ZTBA 1EEYB 2WINA 4JHZA 1ADQL 1JWSA 1N18A 4PJHB 2DSUA 1HGWA 5CWSB 2A6DB 4R84A 2OEJA 2YYUA 1MHEA 3NZUA 2VUNA 2GGJA 4KWUA 5I1EH 4KWOA 4U1MB 1ETZA 4AKQA 4GY1A 1G43A 1W1YA 4G6FD 5IW1A 3W6MA 3WBEA 4ZFCA 3DV6B 4NO0D 1DBAH 4ZXBB 1MJ7L 3ULUE 3Q94A 2AK4B 1CI5A 4TX9A 1P6AB 4ZZFA 1OEZW 1UQSA 4AM0A 1THAA 3LS5L 1ZPTA 4HNTA 5KVEE 1RVKA 2J8FA 2E7FA 1IVLA 3AMCA 4JAWA 3WQ5A 3L2MA 4RWYH 4HJGB 5DHYA 1VYSX 1BQHB 1UR8A 3OF6A 3V6ZA 4E36A 3OLDA 3P69A 5L2JB 1IAKA 5FO2A 2ZVRA 2W0FB 2FWOB 4Z7OB 4O50A 4DF9A 5JBDA 1G9MH 3H2WA 4HNNA 2WVUA 3U2ZA 1A6PA 1ZLUK 4LFHG 1B3OA 2VRJA 2GAZB 2YX0A 2HX8A 4ELME 2MNUA 1ICPA 1BBDL 4A8RA 2DEXX 1A5FL 3PDOA 3AFBA 1FG2A 3JXAA 5T1DH 4HUVA 3H56A 4RFOL 1F4XL 2WQUA 1YEIL 5CLTA 1LO5B 4X4XA 4W9IC 3EWWA 3CC5B 3TZNA 3QC6X 5M2FX 1AGBB 3ARGA 4HSHA 3F5LA 2F54A 4KJPD 2GK0B 3BZEB 2VOTA 5T1LA 4ADGA 1B4KA 4Z2KA 1MQ8A 3ZQXA 3JTSA 3MNVA 2EIKB 1G5GA 3DRQA 4RCXA 4ZXLA 1CK0L 1TITA 2CRMA 4JM4L 1V6XA 3MLYL 2FZ3A 4E2OA 4IRSB 4KDTC 3ZKMC 1TETH 4G8FA 2E27L 1TV8A 3IGAA 2WZTA 1A7BA 4YL4A 5AUMA 2QJDA 4QI3A 4DIXA 4PU2A 4A7QA 4C7GA 1AZ2A 1NWRA 3WD0A 4A2RA 3TWBA 2DLHA 1TJIL 4C60A 3M7WA 1E4KC 4M1RA 1KCUH 3UY8A 1BVNT 5CAKA 1KB9K 4ZSOB 1NEUA 1MPAH 1S3RA 2AEPL 3UJTH 1MFCH 2EUWA 5EU6D 2ZRWA 4NKQB 3FJ6A 4E8GA 3WFLA 2WAGA 4PJ5D 3UY7A 4HS6B 3Q5TA 2J4WH 1YQ2A 2NQDA 3IDJB 4LLUB 2Q86B 1C5DB 4AQ8A 2JGYA 3GH7A 5DMIH 1CW2A 3QP3A 3V6ZB 4LK4A 1BMGA 1K6QH 1ED3A 1F8TL 1IAKB 1HW6A 2ZCGA 3NQEA 1KTJA 1U8PA 3SGJA 3VNYA 1DJZA 1U30A 3FMGL 4MNJA 3WHE0 3ZLQC 3BVUA 3TA3C 1E0XA 3QARA 3PDOB 1MVFA 4JQXA 1V7AA 3CN3A 2BJMH 5MENB 1FQ0A 1OAJA 1J5OL 5DFWH 4N90E 1CXIA 3C2EA 3OKKA 3V0AC 3GSXA 2EJ1A 3CC5A 4QRFA 2H6OA 2XFRA 3VIMA 1UP2A 3ABRA 4JRXA 1A6WL 3CAWA 5ISZE 4UNKA 2ARWA 2Q8AH 5T1LB 3NG3A 1AD9B 4X4KA 5DGRA 1Z89A 1XB8A 1NDMA 4NN6C 1R6VA 2BK8A 2PO6C 2DQWA 3G18A 3DRQB 4BZ1L 1EPVA 3BMXA 4EXPX 2Z7UA 3I6RA 4WO4B 3QJAA 1P4UA 3EPNA 5A2BA 4QR6A 1RVFH 4IRSA 3BCJA 2GITB 3EF7A 4F5CE 5B3SB 3TMQA 3I10A 3ZZLA 3PM6A 4IPIA 4IT1A 2IMMA 2FATH 4WEMB 4KH9A 4M5TA 5C0FB 3L66A 2OXGB 3LGGA 3L3OA 4O2EA 2HFGL 2AEQL 2WC7A 2VGBA 3EOUA 3QIBA 3FIGA 4RDYA 1SSGA 1FH2A 4AGNA 4CGUB 3WSQH 1PG7W 5D4JA 4ENED 3CHRA 1P0DA 3SECA 3PWAA 5HGAB 3MJ7B 4YIQB 2K6ZA 4B5EA 4D0DB 1L6WA 2J44A 2V5SA 3CDZA 4G6JH 4MDJA 1A47A 4XNAA 2QBWA 5J1AB 3JWNC 4UTBL 3U2SB 4PS7A 4BRVA 3BH9B 2P24B 3JT2A 3QO1A 4XPAH 3FCTA 1SLWA 4XD5A 3ZE0B 4L5FL 4GCXA 1PKOA 3FT4A 4D7PA 2C1IA 5D7JA 5LAXB 2ODHA 3RM8A 2DB8A 3UTOA 4TSAL 5LVEA 2Z4QA 5D72H 1JGVH 4LWWA 3FO0L 4OCSH 2GJLA 3CUXA 1FZJB 1O9ZA 2VL4A 3BE1H 4YZFF 4FNLL 1TQCB 3MLYH 4J3XA 2PWDA 3ZUNC 4URIA 4G3YH 3FULA 4AH7A 3RIFF 3E9AA 1J18A 1G9ML 4JRXE 4KQ4H 4JB9H 2ZOKA 1FNFA 4R26H 5EZJA 4GG6F 3W0WA 4LH8A 2B2XL 3M1OA 2GSIA 4M29A 1EFQA 3P02A 3D7PA 3MYJB 4BZ2L 2Q2EB 3MNZB 3IMVA 3FEMA 5DUML 4QF1A 1HO1A 4TL5A 3HC4H 3PL6C 3U7YL 3WIIL 3IAQA 3N4AA 2R82A 4QAIA 2J2ZB 4J3VA 3CHOA 2P44B 2EUVA 1GK8A 1W2KT 1UJ3C 1W9XA 4K3EL 3FOKA 3L3OB 5AC5A 3U79A 1HKIA 3AB0B 5KBDA 3QMSA 2NY1C 1IMHC 3WFCL 4FJZA 3WHXA 4N68A 1MRDH 2Q2LA 1E0TA 3MCNA 4JN7A 5C0BD 1WIOA 1DDHB 1OCZB 3PPSA 4HP5A 1PKLA 2CLHA 3CDZB 1DQDL 4JKKA 1MCPH 1N82A 1U1HA 3AIWA 4ZOCA 1VAHA 2BMKA 2QV4A 3RY4A 3ZT5A 4PTXA 4BCEA 2GJ6E 4JGNA 2XH0A 4PZVA 1PX3A 1KV3A 2ZCKL 1A8ZA 1OQOA 4K9JA 3V5KA 1TPC1 4ETYA 3QG6A 3VB8A 2HK1A 3ERXA 4D72A 3BD3A 3GLDA 3DVNB 4G59C 5IFPA 2ISSA 1AKJB 1RZJL 4QHKJ 3QRFM 2QGYA 5C0BE 3VG0H 3PWLA 1X9LA 4YTQA 3PNWB 4GOSA 4MLSA 5GRUL 1WE5A 2JWYA 3CNKA 1GGUA 4I0PC 4F8NA 3F84A 1NWTA 2JLLA 4MWAB 3ITYA 2DFAA 4X8JA 1W15A 4XMZA 2HMCA 2A0NA 4PUKA 2YD4A 2Z7WA 5DFAA 5F71A 1LUCA 1Q0XH 5E08H 2VXTL 1H3WM 1O6IA 1AD0B 3QIWD 3S46A 1U2YA 4F80A 2XJKA 1GVIA 3FRPA 4IJCA 2F1AA 2R15A 5D72L 3MNZA 4Z1CA 2NYYD 4ORIA 4UU9A 3VFMB 3U7AA 4HXBL 3UYOD 5LDUA 1ZJIA 3RX2A 1LK2B 5I1CL 3HZYA 4ELMA 4XP5H 2A3EA 4PBGA 1RIUL 3CN4A 1SO6A 2E5BA 4QQUA 1J5TA 4I4WB 5HGBA 2EG7A 3EMQA 1MZRA 3UIZA 1B3VA 1T96A 4M1DH 3WHXB 1HJBC 1XIEA 4NUJA 2BS9A 1TYRA 3QGKC 3QYQA 4Y9EA 3QH3A 4QJ4B 2HBXA 3BANA 2XX1A 1QPNA 1E3XA 2N01B 3NSJA 3QK0A 4IRZH 3WSQL 3FNKA 5CGBA 2YZ1A 4WUUB 4CW1B 3LIUA 1I1AC 4I9XA 5I5RA 3ENLA 4NENA 3S6TA 4AZ8B 5DJCB 4QISA 1U0QA 3L3HB 4Z7WB 5J6HB 2JCCB 1B30A 1FCUA 3V5KB 4ZMPA 2QXWA 4YFDB 1DXEA 3HURA 1U3HC 4X8GA 2WNWA 2EAWA 2VLJE 3IK2A 2Y8VA 3RRAA 1EJRC 2H26A 3B8SA 3S3DB 4P9HH 4UV4L 2NUXA 3LQAL 1SFJA 2FEJA 1CVSC 5FHAL 4MUPA 2LABA 3AZUA 3OXRA 5A40E 2VGFA 2WHLA 3QBUA 5E8DL 1S78C 4QRRD 5A6LA 2PTUA 2RMNA 2YN3A 1DLFH 3MRIB 4PUBL 1P0EA 4B9GA 1EXUB 1INQB 3U2OA 4Q4KA 1CF8L 5I1HL 4LNVA 1FWDC 4ZXOA 4GJJA 4OLYL 2W63A 3NZRA 4B9JA 2HXAA 1AZCA 3MO1B 1FVCB 1UT1A 2VM9A 1VFAB 3HFMH 4UM9D 3GUTB 5EKYA 1A1OB 2D3LA 4GPNA 4UU9B 4ODXA 1XF1A 4PMUA 4DJFD 5C0RH 5BMXA 1YDVA 3LZRA 3N0PB 5EO9B 2PLJA 4TVPD 3HPZA 2ICEA 5DMKA 2FEDC 1F0LA 5AVVB 5HWMA 2R2EB 1TTQA 2AV7A 1KTDA 4ROQA 2PDWA 4XKYB 4UCFA 4R4FL 2PDKA 3LB6D 2CJTA 3VXSE 5DT1L 3MR9A 1GZPB 1QJWA 4I7ZC 2H3BA 4O1EA 5G4NA 4ZTPH 3TM6A 4G7SB 1ZGLP 3CQIA 3THQA 3GZQA 1HESA 2AJSL 3BJ91 4Q6KA 1LWIA 2PLMA 3X3FL 1OTTD 4JR5A 4DBEA 4AXWA 1JVNA 3WO3B 5FWQA 4NENB 2NY4D 3SGDI 3T6QC 1AJ2A 1Q9KB 1EP2A 3R58A 4PV9A 4ANUA 3PZ9A 1FIEA 1G7MA 5IWLC 4UWMA 4TNWF 3WH5A 3KLAA 4JZNA 1JV5A 2GHZA 1MCHA 3PWPD 3UGEA 2EDYA 3BKJL 1Z66A 2OK0H 4INFA 1Q72L 2EE2A 3QUZC 1Q9OA 4K4KA 3SYQA 3UABA 3MACH 1ML1A 5E94B 1UR2A 8FABA 2EDTA 1MQQA 3C0JA 3GS6A 5DZVA 2F7OA 3LHPL 4PMFA 1G6RH 4U3CA 3MV7D 1WC7A 5I8EB 1DANU 4QXGL 1EDGA 1TLMA 1NFKA 4JIPA 2B4CC 1T0NB 2FD6L 3TK7A 2ADIB 3MRIA 5LAPA 4BFBD 1HHGB 1TQJA 2FQGA 3QDJB 4JCLA 1RERA 2AV1A 5KSAD 2PETA 1T66C 3T9WA 2MTPA 5K9JL 1GPFA 1OYCA 2HXUA 2ZZ5A 4PJAA 4RIRB 4GIRA 3EH4B 1P4IL 3WE1A 2NXGA 1X7SA 1GPOL 1XL4A 4NQCE 5A8MA 4ACZB 5EEVA 3C5ZC 2BIQA 2NY3B 4NHUA 3LKSB 4XCFH 4XOEA 3T3PB 5CR1A 1TKWB 3EOYG 2WANA 5D6DA 4DTGL 1XLLA 4DGYL 5FFOA 2VGIA 2VUOA 4O16A 3MXWL 3NSXA 2ICEB 5DMKB 1OXYA 4OT1L 3AQUA 4DO4A 1RQBA 3OIXA 4N28A 4MA3B 1IAII 2A6LA 1AQ0A 2NNFA 4OJDH 2AK1L 1HHIB 1U58B 3WIHL 2BCMA 5E4EB 1CL7L 2Z8WC 2LLGA 2ZYSA 1CTNA 5CN1A 4XRCB 4AGQA 4YXGA 2OS7A 4XN2A 1QWHA 2DMBA 3AU0A 3QMTA 4C65A 5I0DA 4FDWA 4P99A 1U1UA 4TVUA 4MJIE 1TZAA 4QTFA 1JNDA 4NM4L 5SWQA 4QAMB 4MASA 4AXWB 5AFAA 1BD2E 1CLZH 1IBDA 2L7JA 2YSSB 1T03L 1MEWA 1T0MA 2DZUA 3EEZA 4F2BA 3QDME 3B2MA 3ILEA 4OV5B 4LCRA 2B7DT 3ARPA 3O6LL 3KLAB 1K8DB 1RSFA 1AH0A 2HB0A 1HF6A 3BAWA 4CUCA 2IH8A 3D4YA 3O0LA 1FWBC 3FO2A 1B57A 2E46A 5D1ZC 1QFPA 1RBOB 1NIFA 1EJOH 4Z3IA 1MSSA 2PCXA 1NUGA 4WEBL 1IM9B 1EGVA 3O4LE 4ERGA 4UIMA 4Z7UE 1ETJA 3UT0A 3WKQA 2ADIA 3QUKA 4EI6B 1PKMA 2ATMA 5D5MA 2CXEA 1YEEH 5DEGA 3OAUL 1FYTB 3H2AA 3QDMD 2CYGA 2VWTA 2QDEA 2NUYA 4XO4A 3BYTA 4K71C 1EXPA 3C0LA 4PWEA 4GB9A 1H51A 3C6SA 4ETQB 1UCBL 4ERIA 4EN2A 2CKBA 2Z00A 5B39B 1XUUA 4U0RC 3LKSA 1R3QA 5FEPA 1TKWA 1W6LA 4Z0SA 3ZYOA 5CQ1A 4X6EB 4H3DA 3O4LD 4MNQA 3VGBA 2VFGA 4K23L 2PGFA 2P45B 3TWYA 3GMMB 4FSAA 4MA3A 1UURA 1Y6MR 2ZUQC 5I28A 3B83A 3WQEA 3QDGD 3KAOA 1P4BL 2PP1A 1FFPA 2GPZA 2W1NA 5D1ZA 3WLJA 4WUUE 4KIEA 4P48A 2XIIA 3EO1B 1O9VA 3QYNA 4JX0A 5DK2A 4NQCA 1UR9A 4Z0BL 1NCCH 5DZJA 2X8RA 9RUBA 1JZHA 1AYRA 1YXYA 2NSMA 2RR3A 4ZYKA 2YSSA 5JW4M 1NFDE 2DI7A 1N8IA 5F96L 1FL6B 1B4RA 2YPIA 1ORSA 3CIWA 3RJXA 1CGTA 4RR4A 1TZOA 2CHNA 3TWAA 2YQGA 3BKCH 4JPKL 3ES7A 2ETWA 3RLVA 4HIJB 4FFZH 4UQ9A 3ULSA 3L6FA 5FUZL 1URZA 2VE6A 4KXZI 4L5ZA 5KSVA 4BV1A 4Z1BA 2E9JA 1YCSA 5D2NB 3M0ZA 3VX0A 3ZL1A 3KRBA 5F6IB 3WI9A 4UIMB 4FX7A 4XSLA 1FXPA 3VNIA 3QUKB 4EI6A 2ZG3A 2ADYA 2QZRA 4HU3A 4FALA 1T1XB 2CALA 4YBQC 1Y5XA 4KTDL 1C16B 4W5UA 2DH3A 4KJWD 5A2KH 2WXMA 3SBWC 3RVTC 1NF7A 2XV6B 2AXHA 3HI1B 4BY3A 1TTJA 3GNRA 1L7TL 4FXJA 2HUEA 3CXHJ 2E86A 2K45A 2B31A 5DT7A 1NIUA 3KPSD 1EJWC 1N64H 4JOMA 5ETUA 4DQWA 1FA4A 2QSQA 2H3DA 1UB5B 3T07A 3U57A 3UTSA 4A22A 1G4EA 2HKAA 2YMOA 3B1TA 1BM3L 2VZTA 4U1JA 4QBXA 3LEVL 1HVQA 4HZ1A 3ETBF 3ZOAA 3AREA 4L61A 1UCTA 2CGYA 3TYFB 3VSUA 2I5IA 1D9EA 3VNDA 4PCPA 2GFBB 1IGFH 4JFHE 3MJMA 2NY2C 2XA3A 4U31A 4R97C 1MDLA 1G4TA 2Z28A 1UM4L 2EEXA 5KZ6A 3CHCA 4LLVA 4MA1B 1Y0LB 3K4WA 3AXIA 3ZHLA 2G4EA 2IOIA 4HGKC 2GVYA 1NCHA 1EBHA 4LSUL 5C8JB 3KYMA 4IGSA 5I6XC 3CH0A 3QQ3A 2AJ3B 3IWUA 5EZOH 3S98A 4LHQB 1SQ7A 2JGQA 5CCGE 2P5WE 5I00A 4Q8BA 1OZMA 2MNRA 4XCFL 2WC3A 4A68A 4ZSOE 5MEPB 4P2QB 1TA3B 5GJNA 4DK6A 4PLOB 1RIHH 2IH1A 1FWHC 1XGDA 3GVGA 3HGRA 3M0JA 7PTDA 3M1CA 3MRNB 4N0YL 3VOIA 3GU2A 2E6JA 3EYUH 4ZFZA 2R9HC 4V1DB 1FWIC 1Q2RA 4GVIA 5CEXB 3ATYA 4JY5L 5LXGH 3TWCH 2TODA 3HPJA 1LT7A 2ZUMA 1IU1A 1K7FA 2EBNA 5BVJB 3VI4A 4UB9A 3G5XB 1RVGA 5LBSA 1DSFH 1MNUH 1YMMD 2EIMB 4GXVH 3KPNB 1A02N 2G8ZA 1SHXA 4Q8VA 3MA8A 4WTXA 4HU0A 1B3IA 3KBPA 5ICZB 2J6EH 2OCFD 1TJ2A 3W11C 1JFQH 3QZPA 4YDKL 5T5NF 3RGVC 4UT9L 2HT2D 2UZXA 3TBVB 3STPA 4ANVA 3QUZA 3W38A 4H0LC 4GNVA 4ANKA 2Y8UA 3IRSA 4ZOBA 3GMPB 5FO8B 1R3IL 1SYSB 2W95A 1K8ZA 2VIRB 4FP1A 2XN1A 1YEKL 4IKIA 2GSJA 1RLDA 5CBIA 3MOBL 4FI7A 4HUXB 4LSDA 5FECA 5KJRL 3S6DA 2XFXA 1YN7A 1FC1A 3HB3C 4QYAA 5CFAA 3WTUA 4JL1A 1F7BA 4FPSA 3W1PA 1DWFM 3G6AA 4FLHA 4ZOEA 4TN9A 2DVTA 5AHIA 4AC1X 3UPRB 1G1YA 1M05A 5XIAA 2IFGA 3KYMB 4ALAC 3T3PF 1W2PA 3O7UA 4V1YA 3NZSA 5FSDC 1A1MA 2P43B 4WSGA 3B7RL 5GGRY 3MSYA 3UOAB 3OQEA 3EX4A 4JY8A 3BLDA 3CUJA 3EEGA 5A16B 4RZ6A 1IAIM 4OHQA 2WGNB 4Z3JA 3U0PB 3DSNB 5FPIA 4O5LL 4I1PA 2IH1B 4OFPA 1B3YA 3TH6A 4NI6A 5E8NA 3O6KL 4WI0B 3WLLA 1BDYA 4OLWL 4N2FA 4NEHB 4YBLC 3RGVA 1I3GL 1NBYB 2AMGA 2QVNA 1DVZA 1CNVA 1I53A 1AGFA 5HDBE 3RGBA 2J21A 1OGAA 4C90A 3LERA 5M94B 1Z9MA 5TDNA 3ZE0E 4M48L 3QYSA 4AOFA 5CC3A 5CBAB 1B3WA 1XIHA 1Q2SA 2Q76B 3G5XA 3AUOA 3DVFA 1MRAA 1HKLH 4X7EC 1R3YA 4ZJ9A 1AQKL 1C93A 3EGDA 1SPDA 5GIRB 1T21A 2ADFL 2ENPA 1ZA3B 3M17A 2J1XA 4OQ1A 1PZ2A 4ZXBD 5C2BH 3KDMB 2UWEA 5KBNC 3TR2A 1UD6A 5I3DA 5FB8B 4JQAA 4AQZA 3LHUA 4OCXH 3SRFA 3VH8A 4HJWA 1WKEA 3NEEA 4OLEA 1CD1B 4D0BA 4HKPA 4BF9A 5D71H 4L1WA 2VLKB 4LVHB 1P84J 2PDLA 1EAJA 3IRCA 3EOLA 2E7CA 5FECB 4ZTOL 5KVGL 1VFFA 5DQ9B 4JFHD 3QORC 3ASWA 4KK8C 4DGWC 1V6VA 2AJYL 3KX6A 1H7NA 3G6AB 2QDDA 1G7PB 1QW8A 1I7UA 1U92B 5LGJB 4M00A 1IHIA 4TUFA 2VLJA 3JWDC 5EN2A 3ENEA 5FWRA 1VENA 2CUMA 2VCAA 2YD7A 1WDRA 2QGBA 4IQEA 3WLTA 5E6IA 5FIEA 4N22A 3RX7A 4L9ZA 3GI9H 1WBYB 3QR2A 3NPVA 1X1ZA 3K4ZA 4LF2A 1VFBA 2YD8A 5H6HA 3ZJKA 3CPGA 3S9DB 1JNHB 4OZHA 2ZX8A 2O1AA 3NRQA 3DSNA 1UIOA 1HQRB 5D7KD 2ZZ4A 4CNUA 4DEFA 2WLLA 1IGIH 1UENA 1AXTL 5E8NB 5AW0B 3V4VA 4F1SA 3E74A 2Z91B 2DIBA 4YHKL 1NBYA 4QSHA 2KDGA 5IEKB 1S2EA 5DRZB 1F5WA 1OGAB 4Z0JA 4XPGH 4KX8A 3O3AA 5DD3L 5DYFA 3UWWA 2AKMA 2IMNA 3H1ZA 3WCZA 3D39A 4HIXL 4DGIH 1XIGA 3FA4A 1FVPA 3LGEA 5DRNA 5IW3A 5EOCL 4G5ZH 3IANA 3P4NB 3DDMA 3QV8A 4GFXA 4J1UA 5CXPA 1KO0A 5T33L 4R7VA 2WKJA 4S3KA 4ZSTA 5CBJA 5D1XB 5AOIA 5GS2H 4PB3A 5EOTB 2FQDA 1NICA 3BGMA 4G7YL 4HUUB 4FO4A 5FYLH 3I50H 3L4TA 3VWKB 2WYZA 2UZYA 3VSVA 4G6CA 4ZVJA 3HW7A 3ZE2E 3DOHA 5JLZB 3P4OB 4CRPA 4A2HA 1S2VA 2QSTA 4PJEF 3G1AA 4D0BB 3BMWA 3D87B 1MRDL 3C5XA 1EXHA 4CD8A 4XH2A 2XWZA 1WB0A 4NKOB 1V6WA 5L4IA 1VH7A 1SDAB 4OZ4B 1OCOB 2WO2B 2YGQA 6ENLA 1G7PA 5LGJA 4U3SB 1PNCA 4YS1A 3U2JA 3PWVB 3OZOA 5LIUX 1AE6H 5DVKA 3G22A 4WRHA 1PCWA 3BP5A 1T6VN 1S46A 2E9WA 2BNUA 2V9RA 1FL5B 4JE0A 1VFBB 2W92A 5FHAH 3QS3A 4YWGL 1VBUA 1W3JA 2FMNA 4G42B 5C9RA 3WGVB 3LMYA 1XLJA 3KVLA 3GG1A 3VCCA 4S1FA 3UXDA 2J20A 4X5WA 4LCYA 2XKNB 3V4VB 2NRDA 3SQSA 4MKNA 5BMWA 1ENUA 3M88A 3VXPA 1XDTT 4YHPA 2V9TA 2QHRL 3BE1L 3L7FA 1AGCA 3C87A 3Q0HA 3WIFB 1OBAA 1I85C 1OPOA 2QMJA 4M80A 4WV1A 5K93A 4IRZL 3VIFA 3MYOA 4PJIF 1WUEA 4MY9A 1E67A 1E2WA 2F61A 4KO7A 3VKJA 5I6XB 1NA8A 2XTJE 2X4UA 4Y9CA 4HCFA 2EYSA 3ESOA 3FQWA 4CVZB 4EZKA 2DT2A 3V4PL 3O6FA 4G1NA 1Z9NA 4KKLD 1M7XA 3LD8B 2XKUA 3FQNA 4Q4EA 4M6OL 1BFNA 2E7MA 2P1FA 2V2DA 1GS8A 1K8XA 4A6YB 1RUKH 3TZFA 1F8MA 2H1XA 4TYUA 4AT6A 3PF2A 4MVBD 4BQ3A 4Y9FA 4PRPB 4NZDA 2EEBA 1B0IA 4YFEA 5KYYB 2DZSA 2AS5M 3MBED 1BVOA 3V5OA 4NKOA 5D7KE 5SWSE 5HGDB 4L1BA 3QN3A 4FP8H 2IPUK 2OJEB 1S9YA 3RVVC 4KK5C 1LP9F 5AVSB 4PLKC 5K9DA 3LB6C 2C4FT 3DU0A 1WZLA 1GW1A 4M3KB 4GRWE 4YC2C 4HTYA 4N9CA 4WJKB 4LO9A 3BYYA 4JLRB 3S97C 1FOBA 5LYRA 3SQMA 3CBRA 1ZTXE 2VDLH 4PJ8D 4FQ1H 3RWGA 1MW2A 2JIXB 4OZFA 5C7VA 1PEWA 4KKCC 1YPZF 1CN4A 3A5FA 3PHOA 1EUTA 1S5NA 1V10A 3LVTA 3UX9B 1CD9B 3GMQB 4JS7A 1JI2A 3QI9D 2EC9U 3VXPB 4WFFD 1H6FA 3NPSC 1D8WA 4X61A 1AGCB 2VMJA 3LYRA 4G8GD 2FT7A 1JCVA 3V95A 4E2DA 2C15A 3KVMA 4PBVC 4QHNB 4XZWA 4AZIA 1M41A 3RMJA 2FL5B 3N1AA 2YGVA 4JN1L 4XTRC 4HGXA 3VNKA 2X9YA 3FGCB 3C5JB 4AL8H 1POJA 1XSKA 3MHFA 3WU1A 3DBXA 1UVQA 4QMEA 4MFDA 2PCPA 1RUPL 1HSAA 3DGBA 3SUVA 3BV4A 4PTMA 4C83A 3RPIB 5HANA 4S3EA 3VAEA 4BH7A 4I7UA 1LMKA 3TAOA 2E5EA 3Q13A 1TV3A 2NQLA 3G6DL 2PE4A 2I7OA 4HX1A 1PZ5A 2JB6A 5C7ZA 4F3FA 4Y4HA 4YXKL 5B1AB 1KXQE 3C6LB 1SR9A 4PJHF 2OJEA 3VFOB 3KHDA 2WM1A 3KBNA 2KX9A 3THMH 1DUYA 4OD1H 2R2HA 3UZEC 3H6JA 3TA9A 2X28A 3BXNB 2KZWA 4H88H 4KO5A 3STEA 4L8CA 4PJHE 2H8ZA 1OT2A 1S5TA 4FFVD 2VITB 2P80D 2QMKA 1OZTG 1WT5A 4YFLF 3RY5A 4JLRA 3BG3A 4HU2A 4L1LA 3SY0B 3N25A 5KYXA 2WBJB 5IHHA 2OTUA 2C1HA 2AEOA 4QXUH 4QAWA 1IFHL 1ZFJA 4UTWA 3HE7D 1A6TA 4NM8H 3KVKA 4L4VD 2ZA3A 3MOAL 4K2SA 1RK0B 2V5MA 2FX7H 3G6DH 2NTFB 3ISYA 3TFBA 1NM4A 5IB3B 3O3UN 4PTDA 2X89D 4E8DA 2BOFX 4E3VA 3UZXA 3P30H 1Y1UA 3KPQA 4HMNA 2QV5A 1RHHA 4KFPA 5ABZA 3LRMA 4GQQA 2R9HD 1B0RB 3MNWA 4NQXB 1KDIA 2QNEA 4XZBA 3FB8A 4BCZA 1ET8A 5DY3A 2OMNA 4GFSA 3PZQA 4EF3A 5KVEH 3GKZA 4KU1A 2CWNA 2GGGA 1HSAB 3EB2A 2BV9A 4HHWA 2WTRA 2PC8A 4ZPVA 5IQLA 5F1NB 5FGSA 1XD0A 4PGEA 5GS0L 4FZEH 2ZJSL 2YW3A 3GTFA 1SXBA 1NGZB 2V33A 4D3CL 3TF7C 1R30A 2DSKA 4WKFA 5EBGA 1UR3M 1QBAA 2EKJA 5AW7B 4LBEA 5K39B 3VFOA 3MXVH 4RESB 5EFIA 1JULA 5ERWB 3IVTA 1YYML 1UWFA 3WN6A 3CFTA 4N90D 4WNQB 1X9RA 2PWGA 4Y4KC 4NRSA 1H3PH 5J8OA 4NYLA 3BXNA 4XCYB 1U5VA 3XINA 1AHWB 3ABZA 4Y16D 3QQ1A 1JVKA 3BWAB 3LRKA 2W91A 1EEUA 1PZCA 2ZP0T 4ODVH 1EWEA 3JV0A 3LM7A 5SX4I 3Q67A 4EOWL 2ZUNA 5F97E 3GHRA 4QX4A 2PP8A 3ZDXF 2F7QA 3FQYA 4P2YA 4HMCA 5AFDA 3G24A 3BICA 1A14L 1S7UA 1SW0A 3D0CA 4FFTA 4DYJA 4S1DC 2H8XA 2IPJA 5GGTH 4IGBC 1RK0A 4LOUC 1K6QL 1NLDH 1NCIA 5GGRA 2YUZA 8TIMA 4ZB5A 4B5WA 1ZLWH 4BK8A 3S5ZA 1ZTVA 3ZRSA 5IKCB 4S39A 4IEFA 2A6NA 4LEQA 1FP9A 5C0JA 5J9PB 2DIAA 2JFEX 3FB8B 2X0HA 3HB3D 3HUJB 1VPXA 3F4NA 5HYFA 2HPIA 5HWNA 3N2MA 4M5SA 2O6DA 3ZKQD 4DJDA 5E99L 3H4FA 2PMQA 4JANB 4PRAA 4E4FA 4NLAA 5GGVY 5AHFA 4NKMA 3PZTA 3L4VA 4G11A 2XG4A 3MCOA 43C9B 3ZTNL 5EORH 3JWOH 3KD4A 4GIPD 4P9ML 1KLGB 4OU3A 1J8KA 1FBIH 3BG9A 3EYUL 4RW3A 1CU4L 4HFWA 1V3KA 4DUVA 3CB3A 3TSBA 4X4ZA 3QG7L 5K39A 2VEGA 5MHBA 3QJRB 4ZSUA 5IQOA 1MUWA 4W68A 4LVBA 3MMWA 2X1RA 2SFPA 4AYGA 4NYLB 4XCYA 2JH2A 3QCVH 5EN3A 2WP3O 4FC3E 1O5PA 2WTOA 5IQNA 3W1ZA 4KK6D 1T8QA 3N14A 1JCTA 4HKXB 2X1QA 4P23B 2F84A 3ALFA 3AI0A 2YXXA 3M5ZA 4PJEB 5DTFA 3EDDA 3OKMB 3L9EA 3AG3B 3KYKL 4ENEC 1SVCP 4S3BA 5GJMA 1U8JB 2IH9A 4U3XA 3V0UA 1ZHBA 4NN5B 2GWGA 2WHJA 1UUNA 5KSAB 4NFBA 3HZMA 1H0GA 1AY1L 1QPQA 1OW0C 4MZIA 2BXYA 3L45A 5AZ2H 3AISA 3TTEA 4NQUA 2VQ4A 1RJYB 1XF3B 2DQGL 1JGUL 2E8ZA 2CU0A 1I1AA 5HATA 5EO1B 3RWFB 1D5ZA 3SCMD 4OJEH 3SGKA 4Z95L 4EDWH 3BVWA 3TN0A 2EUZA 4HU8A 5I71C 5M17A 4UILL 2IADB 2B4CH 4LSQL 2WO3B 3ZDZE 4WKHA 4F4RA 4JREB 5AYQA 5IM7B 4G1EB 2HE5A 1TJGH 3SB3A 4XX6A 3VC5A 4B5NA 3HPAA 2C3VA 2GJ6B 2J77A 3SOBH 4ZFFB 4DKDC 5E70A 3WTTA 3BOFA 2X4NB 4HS3A 2W27A 3GW3A 2B39A 2FLRT 2OCCB 3K6NA 4J3OC 2PW1B 1MAKA 4NKMB 3ZHNA 5DU7A 1GCFA 1USZA 2J12B 3L4ZA 5KSBB 1JF6A 4AK1A 3KS6A 1BEYH 3L7EA 4IIQA 4TTUA 1JRHL 1FIGH 1OY0A 2ZAHA 4AGLA 1BVKA 3W28A 4ZUSA 1VLXA 3A22A 3ECQA 3AO0A 4X6CF 3W7HA 3O05A 4NO3B 2R59A 3KPMA 3QJHB 5FKAB 4E6MA 4WWKD 1THFD 5HYEA 5F1SA 3GTTA 5E5CA 3QQ9C 3RY6A 4XXWA 3ZTJH 1VP5A 3NACL 5CZXD 5C2XA 2Y5TA 4R3SA 3UPAA 2A2IA 4IQDA 1I7ZB 25C8L 1RK1A 4JQVC 4P23A 3F2DA 4QS5A 4PJGB 4RMQA 3ZVVA 4HOWA 2ENQA 4MMXB 1JHTA 5CMAA 3V9CA 1F00I 1G7LA 3CVCA 4MMZA 3QAZB 4XB8A 3R7QA 4JIEA 4O14A 3G5VA 1C7SA 2VDKB 2EYTA 4AYBA 2XZZA 1N8ZB 1UZ1A 4HMEA 2FB4L 2ZX9A 1WBZB 4PRDA 2VDOL 4G9FA 1M9HA 4YHYB 1DL7H 1XF3A 3AMDA 4AG0A 1XLIA 4C7DA 2QGEA 5LWYL 2XYCA 1AGEB 3CV6A 5LSMA 2R0WL 4K37A 3WD2A 1FWCC 2Y3AA 3GSWB 3FUHA 3WK2A 4F2TA 4DPBX 4J7RA 2PUZA 3Q6FA 5CPMA 4N2DA 1SXNA 3GVRA 1NC2B 3V0SA 1HKKA 2VWSA 1Y0EA 4EKXA 3FCPA 4I9AA 2QLYA 1TNMA 2X4QB 4NWUL 4AQEB 1R3WA 4OQVA 1FL3B 3FU9A 1JL8A 3LQAC 2PW1A 5FF4A 2BCKB 2VABB 4S0TD 2QQNH 4L8SA 3OSKA 1J0JA 1TPFA 4M8VA 3RX4A 3ZR4A 1LILA 1UCBH 2FZBA 1NFGA 3CFBB 5I17A 3CE1A 1ZHAA 3QCTL 1OAYL 1GRWA 3JVGC 3PQYA 3EKLA 3QJHA 3ETSA 3GHPA 3TZVA 3CSBA 4LEOA 2C3XA 3LJ3A 4DH2A 4GZJA 5T5FH 3UPMA 3ROOB 3T65A 1KFKA 1AQMA 1AG0A 3NEVA 4ZA0A 4XZMX 1RK1B 2JCCE 3K80A 4E9QA 4XX1G 3TYUA 4AX6A 1RJZB 2V3GA 2D24A 4MMXA 1A7OH 3VU2A 1T5WA 5AN7A 4LOFA 5DEJA 5BOJA 3DYOA 5C07A 2EXSA 2V0AA 4W89A 1SEQL 3UZ5A 3GJFA 3WBXA 4UQAA 1MWAB 1VJZA 5HGHB 3TQ0A 4J3TA 2LAAA 3IXTB 5I78A 2YDRA 3AWOA 4O13A 4ZX4A 4N8CL 1KCRL 3P9WB 1HEHC 5AOLA 3S88H 4ADJA 4UIKL 3CWOX 4JFOA 4F91B 4AD4A 4O00A 4UR8A 2Z1KA 1OF2A 2G5WA 2X09A 3DDFA 4B27A 1H15A 1J11A 2BXVA 2RKXA 4TU1A 3WH8A 2HVNA 3TF4A 3GMNA 3FF7A 4C6QA 2K6YA 3KNBA 3FY1A 4AVIA 4NQSA 3M45A 3VOCA 3SKNA 4AQEA 1IRAY 3BO9A 2OV0A 5J3HD 4XZ9A 3OX8B 5AD0B 5DCEA 5MKGA 3H12A 3NO3A 1OGAE 2R0ZL 5C7XL 2I5YL 3OG6B 5DI8A 1P4IH 3H85A 2ZUVA 5HSFA 1AA1B 2INEA 5JW4N 4JFDB 3ZKND 2A3CA 2NLIA 3CYJA 3KPRA 3HOJA 1G6RB 4FNPA 1PS3A 4XOBA 1D7CA 2HUHA 1WWBX 1UW9A 2IV8A 3LK6A 3DXAD 2G5BA 1HWWA 5FW7A 2CKRA 4A04A 3QUHA 2WXPA 2O4MA 1IGTA 3WMQA 3GNNA 3U5UA 3HJEA 5LIWX 1TX2A 3UYRL 2B9BA 1JGLH 1RA0A 1SFHA 3UTQB 4AH2A 4AVFA 1WPCA 4BQCA 4NAMA 1KJMA 4AIOA 1OAQL 2IBZX 1AKJD 2YD1A 3FTVA 5J3HC 1DTNA 2WSRA 3GRBA 4PGBB 4M82A 4XIAA 1CC3A 5DA0B 1TVHB 1SEBA 5GNZA 1ECYA 4JTGA 3HPSA 2FJFA 3ZR6A 2NYYC 1KCRH 2YJQA 2EAEA 2VXQL 3GB7B 3N1QC 3N40F 3LN5A 3QO0A 2WQSA 2V5YA 1MY5A 5ALBH 5JIHA 4FQQA 5GS1C 1H41A 2RQ8A 1JWUB 1HL5A 4HHPA 4EACA 3VI3E 5BV7L 1H5YA 3N41F 1Z8AA 2PDNA 4AEHL 3MSGA 3ISWA 2DLGA 1OF2B 3NOYA 4MS8C 2LQRA 4D7BA 1QNPA 1BX2A 5A6MA 3TYEA 3WKZA 3GMNB 2IQ9L 2BSED 1C8VA 3CHEA 5G55A 1ID2A 4OKVB 3T8VA 4ENZA 3MA9L 1N5YH 2C9AA 4FQ2L 4NIKB 1L7TH 1MCJA 4H13C 5DJAB 3SKNB 3T0BA 3MHUA 4Y6GA 5K4ZA 5JZ7C 3TT1H 4ESKA 3TQPA 4PQXA 3WHE1 1OCNA 3AWNA 1JPTH 3SSGA 2DZBA 4GH7B 3UVAA 3C08H 3MX0B 4M6NL 1E72M 1QSEA 3BAXA 2XC8A 2F1BA 4EXBA 2VC2H 4R90L 5E7FA 2YWZA 3LKRB 5H37A 4RETB 4L1XA 3PGCB 4QOKD 3M0IA 1PLAA 1R5VB 4JZJC 4KNTA 4MY1A 1ZV2A 1SMDA 3BW2A 3TX9A 3RWJB 3F8UB 1WDPA 3EPMA 3JWDH 5DRWA 3K71B 3V6OC 4A67A 3KJ4C 1LQ0A 1A5OC 3GTXA 1S4IA 2XFGB 1WYJA 2HKFL 4E9WA 1BFVH 1EDTA 1U8NA 3DPBB 2OMXB 3HS0A 3RI5K 3FUIA 3W9EA 5KVMC 1HJVA 4KT2A 3C09C 3AG1B 1ET7A 3GS0A 2YPLD 5MEOB 4KEMA 1YYLH 3T0CA 4P5TB 4LGXA 5I3IA 3NABL 4QRQB 1RFDL 1JV2A 1VKXA 4O02L 4UOW1 4XP6L 5EMJA 5E5LA 4N85A 1SXSA 1HQ4B 3PR2A 1BWLA 1M1BA 1WFMA 5DMLA 3LYEA 3RFRA 4PYHA 2TRYA 2N7AA 2ITDB 4K8EA 3G6JA 1DQIA 4N5UA 4UM9B 1HX0A 2P76A 5XIMA 5AVRB 5I1IL 1C90A 3FKRA 4C6JA 3M0XA 2W5FA 2QR0B 3R1ZA 4GH1A 5E51A 4CSSA 2QCDA 2NQ5A 4Z7WF 3BWWA 5F0JB 3ONCA 3S8FB 3MRKB 1UHVA 4LB8A 4U1NB 3AQYA 3ZPDA 4HWEH 1DCEA 3IJ6A 1DANT 4HEPG 4M62H 3KYNB 4PRTA 4N4QA 4NIRA 4HLZH 1MCLA 1CGYA 1Y6NR 1YEEL 3E0VA 5FAAA 2HKHL 3OVUB 4L29B 1R9FA 3LKRA 4KVNH 5I19H 1GQKA 1XFCA 1KYUA 3HMCA 4G2DA 4DM2A 4K7PH 4Z3TA 3CG8A 4QDPA 4J6RH 4NRXA 1R5VA 4QDWA 4LU0A 1C1EH 1X1OA 2NZ9C 4K55A 3UDWA 1NTHA 3HAEA 1RY0A 2NXIA 3T0ED 1VCFA 1AZUA 2PNDA 3OC8A 2WZMA 1D9KB 3FN9A 1XDLA 3VW3H 3FJNA 5DZLA 4H7ZA 3TE9A 4JFQA 3LHTA 3QWRA 4JHWH 4WUKH 4PJ9D 5LA1A 1XBZA 4GS7B 1F5ZA 3PK7A 2MCAA 2ZSWB 2EDJA 4GSXA 3HBQA 3EX6A 4MWFA 4JG0H 4J3OG 3AZTA 4IX0A 5HI3D 1QOPA 3T0AA 3FTXA 2DWEB 3VXUD 5C9KA 5HYQA 1XO8A 3PXLA 4OIIL 2QKIB 3MBFA 4IMDA 3H2EA 1HQ4A 3WK1A 4CVWA 5M3WA 1ONQB 3KCPB 4JFED 4LAOA 4FYQA 3W87A 2BW5A 5DD5H 3RJQB 2YC1B 1JYVA 4PCFA 1DV7A 3W1QA 4OT1H 3SE8H 1P1MA 4TUOA 2WXQA 4FG2A 1YXDA 1E27B 2DT3A 4O18A 3O6FC 1WBJA 3MC0A 1ZU8A 4A66A 4DJDC 3OD3A 2QCDB 3IKCB 4TUKL 5E8PB 5JYMA 1CBJA 1YNTB 4P57B 1AQFA 2FQIA 1WWWX 1YYAA 2R8WA 4PBEA 1U8CA 1L2QA 3UU0A 1LF1A 1UZGA 3GKFA 3FFOA 3WYRA 3W2DL 1OF8A 2CC0A 3C86A 1YXCA 4ATLA 1TZGH 3RUGB 3TVAA 3YPIA 1CCWB 5DVNA 3BLBA 3B2VH 1PTZA 4DWSD 3IFLL 1CMOA 3RF9A 5C6MA 3SCNA 3T81A 2INFA 1NMAL 6PCYA 2IOOA 1XGEA 1IILE 4XTIA 5DQJA 1IKFL 1WICA 3LSOB 4NRXB 4RGNC 1WQ5A 5D7LB 4FNLH 1EWDA 1XBXA 2QVTA 2EEAA 5EO0B 3WQVA 4G8EB 4NT6A 3HMXH 4LGSB 4Z76B 3MI3A 1D9KA 5K9OB 3S2AA 3V0EA 2ZSVB 4Z8FH 4YCOA 4I3SH 4LCIH 4LQFH 5IREA 1OWRM 2A0LD 1UWTA 2NX1A 3KPLA 4QHLB 5D93C 3ZTEA 1GYWA 1B31A 3BDYH 1KFGA 3A3HA 1R3KB 2TRHA 3VTMA 3EW3B 1W17A 3SPIA 3DG3A 4G7EA 1Q9WA 2GJNA 4JO4L 4BK5C 3WLKX 2LLLA 2W80C 2HJFA 3H9SB 4MA8H 2BGQA 1FQ9C 4U10A 1CXHA 4KZEH 3MU3A 4GQ9L 4LEEA 4BFEA 1V55B 3EJSA 4K5PA 5CILL 3WEAA 4MMZC 1W9PA 1YMHA 3B4UA 3CDCA 2I9LA 3DYMA 4FQCH 5EIIA 3V0VB 2LW3A 4HPYH 5DHDA 4XC3H 5K5YA 4HG4K 2OOFA 3ILPA 3IJLA 1KZQA 1NC4B 1NINA 2YRPA 2ALWA 1KEMH 2HFGH 1CWYA 4JTAA 3ZM8A 1KPUA 2M1KA 4AL8C 5A2IH 3E5PA 3ESUF 2FJGB 3WY1A 1C8PA 3DKJA 3VFPB 3E1F1 3B8UA 2R7EA 3TFKD 3H9ZA 3CQ0A 4Z18A 4ODVL 1C8QA 2UXTA 1M56B 1F4YH 1U8CB 1PYWB 4IJ3C 5BZXA 3AYRA 4MMWA 2B16A 4PEKA 1RZ7L 4YDJA 5EB8A 3WD3A 4CNPA 4M7SA 4DK5A 3HU7A 3GINA 4YQXH 5IM51 5LA0A 1HXJA 1CF8H 4HZ7A 4OOUA 2FNBA 3CX5K 1HEZB 1KGCD 1IBYA 1RKRA 2WMPA 2VZUA 2Y7OA 3DX2A 3IU3A 3QFJB 4CNIB 1VYPX 1I3VA 5I73C 3B8WA 4JFPB 3CHDA 3O9NA 1QI3A 2A9BA 1I1FB 1XHHA 3II3A 3I6EA 2WO4A 3LZFH 5C97A 1KZYA 5FGBC 2YAOA 2DV0A 1HJWA 5C0DA 4GC3A 4NBZB 1KXVA 3TURA 3CSYB 3LN4B 4Y8DC 3RVTD 4BFIA 4UR9A 4Y9MA 1PYFA 4PJ8B 1TWIA 4YNGA 5DC0A 5LGYA 2WXOA 3R94A 4F0KA 1KLFB 2B9AA 3C6EA 3CFMA 1O6VA 4H2AA 4KJWC 4FZ8H 1W9DM 5C6PB 3W71A 1O7DE 5CH9A 3LS4H 1L0PA 3EXTA 1CFVL 4UMAA 5C0AD 2CU9A 1JIBA 1F8IA 2A74B 1BAFH 2DLFL 1H1ZA 1ZHNA 1FAIH 4I87A 4AV0A 3P30L 4YSEA 3I9GH 4GAGL 4TV3A 3CQKA 4Q7IA 5F2GA 1UXWA 3D51A 1W0VB 3ECVA 3FXGA 4HLJA 1WDDA 2B3RA 4ZOAA 1QLEB 4B95C 3LRLA 3LRHA 1M6OA 4XE0A 2YGPA 4H1ZA 2J8UB 2XTJC 4LPXA 1KPUB 5CFHA 2ZDRA 1TJIH 4U7KA 1SY6H 3VFPA 4K36A 5J0BA 2XISA 4HF5H 4XGZB 3H22A 1BEXA 2AMUA 1W0MA 3U9PL 3WF2A 3WZ0E 5G4HC 1KCVH 4ICWA 3ARGD 2VMFA 1PYWA 3MCMA 1AP2A 2G0LA 5FA5A 1U42A 4YDJB 5E08L 4XAWH 4B5ZA 1MHPH 5CHNA 1R5WA 3V4LA 1TZHA 4CGTA 4YHIB 4NAFA 4P04A 3AS0A 4EN3A 3NA8A 3RCNA 3VFVB 1I1FA 4UTAL 1CLXA 4LSTH 3GBDA 1UQYA 1MFMA 4W9CC 2P42B 2VRQA 4H26A 4L0PB 1Z9AA 3TC7A 4Y4KA 3W0KA 3DMMD 2IQAA 1TMLA 4PI0A 2W81C 3MLSL 4NO5B 4MNGA 4UAOC 2Y62A 4OGYL 4P8VA 4YYFA 1KIQA 3BH8B 4N20A 5JOEA 1A5FH 2VLLB 1KR0A 4NO0B 3P0YH 1JNLL 3OL2A 5DHVA 3CMFA 3K5XA 4LNRA 3T1FB 5E7BA 2AAVA 2HXTA 2CUAA 4KY1L 2NW0A 3W29A 2WLHA 4Q4OA 1MFEH 4BFAA 4K9EL