4M56A

The structure of wild-type mall from bacillus subtilis
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
559
structure length
555
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQRADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase 1
publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 221
structure length 555
sequence length 559
chains with identical sequence B
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m56A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m56A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m56A02
4H04A 2VJXA 1XH0A 4PMDA 5DF0A 2ESCA 1LQ0A 1HP4A 2DGAA 4Q7NA 3RO8A 4QAWA 3BAKA 3L4VA 1E6ZA 3GXFA 3TV8A 2AOSA 5DFAA 2WMIA 2PWEA 3WF0A 3WQ4A 3KL5A 2CHOA 4B3LA 5GNXA 2CBIA 4E4PA 2WBKA 2VO5A 3W25A 2ZWZA 1D3CA 1GOQA 3ZJKA 1J11A 1KCLA 1OIMA 3NSXA 1ZJAA 3VUPA 3SCRA 3T2PA 1E55A 2C8NA 1E15A 3VIHA 3EMZA 2D0FA 2W5FA 1ZB5A 1LLOA 3A22A 3MSGA 3T09A 5AYBA 5GNYA 3TTOA 5FL0A 2CXGA 2WSPA 1TQWA 3WQ8A 2WKGA 3DX2A 1HJSA 1BG9A 8A3HA 2YLLA 2YL9A 4CU8A 3VIGA 2VOTA 3IAQA 4PMXA 1CXIA 3DX3A 3UG5A 4WKAA 1G0CA 4UFLA 1KWKA 3DYPA 3CMGA 3NUKA 2YFOA 2GFTA 1HTYA 1QHPA 3AIVA 3CPUA 4HOZA 2D1ZA 3CZNA 1QNRA 4D6HA 1HJQA 3W26A 1CXEA 3WNMA 3PZVA 4A3HA 3AIBA 3ALFA 2D24A 2VI0A 2XTKA 2UY4A 3WH6A 2A3CA 3B9EA 5A8OA 1CGWA 1I1WA 2GJXB 2DSKA 4XUYA 3FHQA 3PZMA 1CXLA 3WQ6A 5CGMA 4M81A 2XPKA 4W85A 3UEQA 1UA7A 1B3YA 1UWUA 5CSYA 1JDCA 1DWGM 5BRPA 1EGZA 1KGXA 3NJ3A 4AISA 3OGVA 4KRUA 3HJEA 5GNZA 4PMUA 5A6BD 4OOUA 5ABGA 1WDPA 4AZCA 2OYLA 3LRLA 2OWCA 3VGGA 3PZTA 1UWRA 5A8PA 3BUIA 1DWAM 3MS8A 1GVIA 2VVNA 2JEQA 4JIEA 3T0DA 2E9LA 4Q22A 3AMCA 5A6JA 2WAGA 2BHZA 4LYQA 4AD1A 3SCWA 2QMKA 5FL1A 3GZAA 4ATLA 1WAWA 2GK1B 3SCNA 4YHGA 1KWGA 5E0CA 5HDRA 1HNYA 5AC5A 4PBGA 1EH9A 3AI0A 1OCQA 3KZSA 1B31A 4CU7A 2D20A 4Z2IA 3KL0A 2G41A 4AZHA 1V6UA 3HN3A 1HXKA 3F4VA 1NWSA 3EMQA 3BUBA 2X0YA 4MNJA 2CYGA 2ZICA 1FH7A 5HNNA 4WF7A 3QOMA 3GNRA 5JUVA 3AROA 5GPRA 4C7DA 2V3DA 1R33A 3WD1A 4OOZA 3WDJA 3WY1A 3E1F1 2X05A 3M7SA 1V6VA 1QNQA 1JIBA 4MNLA 2X09A 3W6MA 3CIVA 4P8XA 4LXFA 4JKKA 1QPKA 4IISA 1AQHA 1SMAA 1FH8A 3PZNA 1XGZA 4J3VA 1MFUA 2VNCA 3W82A 4DUXA 3WD2A 1W1VA 2CKSA 2CESA 1W9XA 1EQCA 4JKLA 4CD7A 1V3KA 1WPCA 2XSBA 2XYLA 3W6LA 4TVCA 1UZ1A 5BXPA 3WSUA 2MANA 1WZMA 1QI3A 2ZUWA 3EJQA 4XV0A 1H4PA 4J7RA 3LRKA 3O2LA 3AFBA 6TAAA 1G5AA 1AMYA 4B9YA 4W86A 4PTVA 3ZJ7A 2PB1A 4GZIA 4BF7A 1WE5A 5CPSA 1OM0A 1JXKA 4FNUA 1UH2A 3LPOA 2D0GA 2J78A 3H55A 3WMBA 3AICA 4GI6A 3OIHA 1RP8A 1E73M 2DQXA 2JALA 3D50A 3WDHA 4CKQA 3EDEA 2VZVA 1ODZA 2G3JA 4PMVA 2W63A 1QVBA 1FH9A 1WP6A 2WHKA 4CN1A 4W7WA 2DH3A 2FHCA 4X0VA 1X6LA 1KR1A 3KL3A 3AIWA 4D6JA 3IJ9A 1M04A 3DHUA 4LX4A 2J25A 2E40A 1F4HA 3POHA 3MMUA 2W62A 3PTKA 4GQQA 2VX4A 4JFUA 1GZJA 2DSZA 4AXNA 3K4AA 2G3IA 1GONA 1EDGA 4D1IA 2XFFA 4OJYA 1XH1A 2DT1A 1IZJA 1OT2A 1R34A 2ZUNA 1QI0A 4FLRA 4DWSD 2YA0A 2WLYA 2X2HA 1UKQA 1HVQA 1KTCA 1BGGA 2Y5EA 1KGWA 1K9DA 4HA1A 3TTSA 1PZ3A 1C3FA 3F5KA 2J7EA 2XFYA 1CEOA 3CHFA 3VD7A 2X1IA 1JYXA 1JI2A 2WC7A 1O7AA 4P7OA 1O6IA 1GJUA 2FDMA 1BF2A 5CLTA 2JIEA 3WQVA 4F8XA 4GI9A 1MVYA 3K46A 5E6ZA 1ITCA 1BG4A 2G8ZA 1JZ6A 5I24A 3UG4A 4R5EA 1E1FA 3N15A 5E09A 1XYFA 1LG1A 3AS2A 4OBRA 1HN1A 1B0IA 4CN4A 4HMEA 3VTRA 4MB4A 2WLZA 1C93A 2DIEA 1GQIA 3PN8A 1VRXA 4URIA 5A6MA 3AXHA 1R47A 4HTYA 3TA9A 1HT6A 1W3HA 2ZIDA 3EJSA 3ZMRA 2BXZA 3RM9A 4H41A 3VGDA 3SUTA 3BVVA 3CTTA 4Z2LA 2CKRA 1H49A 3H54A 2VX5A 2EPLX 2RGLA 1J18A 2WPGA 4PMZA 1CDGA 1KB3A 1V0KA 3MMDA 1D2KA 3CHDA 2XFRA 3ARWA 4PMNA 4AD4A 3ZT5A 4OUEA 4YPJA 3M6DA 1HJXA 1QI4A 4M24A 5ABEA 1HP5A 1GOOA 1UWTA 5CQ1A 4OBSA 3ZQ9A 4OGZA 2VCBA 4ATDA 3LMYA 1A3HA 4E8CA 3VIOA 5CG0A 3MU7A 4J3XA 5ABFB 1OT1A 1CLXA 2VCCA 4OIFA 3GXTA 3NIYA 4W8AA 2D22A 2DDXA 3VDCA 2V3EA 4UNIA 1CTNA 3UR8A 3T0BA 1EXPA 1A47A 3LXBA 3A47A 3SIMA 4MNMA 2QMJA 1LL6A 4DWSB 3ARZA 1W2VA 2J7FA 1HKJA 1DHKA 3CGTA 5JBFA 3SCUA 1V6WA 4M56A 5HBFA 4M29A 4AW7A 3QHOA 3SCPA 4GZEA 2DH2A 1KTBA 2DSWA 1CYGA 3DC0A 5E6YA 3T08A 2JF7A 5HXMA 2V5DA 3SCOA 5BYWA 3IK2A 1JZ4A 1SMDA 1EOMA 4TX8A 3IAPA 4PMQA 3VD3A 1B2YA 2VT0A 4ATWA 3VGFA 1B3VA 3SCTA 3PZOA 5A94A 4NZJA 1E6QM 2ZXAA 2Z1SA 1VEOA 4NRSA 2PF0A 3S5YA 5I79A 2ZX7A 4GKLA 5A6LA 4QLLA 1GNXA 1EHNA 1J0IA 2ZXBA 5BRQA 4J3TA 3BUQA 3ECQA 3AMLA 4JL2A 3CV5A 4W7VA 3GXPA 2D23A 4U31A 2OLHA 1XSJA 1MW3A 2NT1A 3GTNA 3RILA 1GHSA 2TAAA 2VMFA 3L4TA 5A8QA 2XVNA 2YIHA 5DT7A 1KBKA 2XUCA 2EXOA 3BXWA 2WSKA 1HWWA 1CBGA 3VGHA 4W88A 3WEZA 1CXFA 2J77A 2J7HA 4FNTA 3BVXA 4BZYA 3VDAA 3GDBA 1CGVA 4UOJA 4PCTA 1HKKA 1PBGA 1QHOA 1R7AA 4N0RA 2WHJA 3GNPA 2YA2A 3LXCA 1EQPA 8CGTA 4EAMA 1UD3A 3ZT6A 3L4ZA 3KLLA 2BVTA 2PWHA 1RD6A 4UQDA 5BWFA 2WC4A 1DEDA 3VGBA 1NWUA 2CBUA 1J10A 1UG6A 4DUWA 3PHAA 4AD2A 2GSJA 3IANA 2VZOA 1KGUA 5LYRA 4HMDA 3CH9A 1XH2A 3WD0A 4AD3A 2WXDM 2Z1KA 4UR9A 4D6GA 3VDBA 2BV9A 2E9MA 2JEPA 1LL4A 4A4AA 2C0HA 3WY3A 1EA9C 2ZXQA 1X6NA 1Q6GA 1YHTA 3PTMA 1K9FA 5D8WA 4E8DA 3HZ3A 1XSKA 2O9PA 3A23A 4MADA 2CERA 2FYVA 3LPGA 1MW0A 3N1AA 3KE0A 1U30A 5E9AA 2CNCA 1E71M 3MUY1 4HZ7A 5FIPA 1GOMA 1UQYA 1EDQA 1UD2A 1E6SM 2D73A 1JAEA 1JDDA 4M8UA 3CZ8A 1U2YA 1ZBCA 1SFSA 5BCAA 2VQUA 1KXTA 1MFVA 4WSKA 3M46A 2O9TA 5D9NA 1JD7A 3U7VA 3BLKA 3BSHA 3K8MA 1VF8A 3EJRA 1ZBVA 2XG9A 4F79A 1TE1A 1M53A 3NSMA 5D9PA 2ZUSA 2DT3A 3FW6A 4HOXA 3WY4A 3RDKA 5F7UA 1Q6FA 3DYMA 4WJXA 3BVUA 5HOSA 2X2IA 3HG2A 3MV01 1BVNP 1HF6A 2F7OA 3SCQA 1TQVA 2BY1A 2XWDA 2WZHA 4B3KA 3KLKA 1R7OA 2XM1A 3VNZA 3RCNA 3OLEA 3B9AA 4F9JA 4AMXA 1UKSA 1JYVA 3SEPA 1B30A 3MUZ1 1E3XA 1PS3A 2CPUA 2X2JA 2WZEA 1VEMA 1V3MA 2DIJA 1NWTA 2XWEA 3BUDA 3ZSTA 4AIOA 1E5JA 5IHRA 3AHTA 4PMRA 4C7GA 4TTGA 4PEEA 5A69A 1W9BM 1UR1A 3EDJA 1V6XA 3W38A 2WW5A 1GJWA 1XSIA 2GJPA 5IXEA 3OA5A 2ZUUA 3VMNA 2XJ7A 1ZL1A 5EB8A 4ACYA 3ARRA 1HL8A 1M7XA 4FLOA 2WHLA 3CZJA 3AHZA 3N17A 3HMCA 3AS0A 5C71A 2OSXA 3ARVA 2VZTA 1GW1A 3UESA 1QBAA 4HPGA 4XZBA 2F1AA 3D4ZA 1GVYA 3GYCA 5LA1A 3GXNA 3FXYA 3WUGA 1GOWA 3WNOA 5A2AA 1JNDA 4IUGA 1W1PA 1HVXA 3WH8A 2XVLA 1KCKA 2OYKA 1CZ1A 5I78A 3AHVA 2VC9A 2CBVA 4NRRA 3JUGA 4P8VA 3W24A 3FN9A 1SZNA 3DYOA 2YL5A 1BPLB 4X0NA 3TTQA 4J3SA 1H2JA 1JD9A 1FA2A 3K8LA 2A3HA 1VEPA 4FK9A 3OLGA 2VZUA 2X8RA 4UOQA 4H8VA 2WMFA 1V3JA 3WF4A 1EOKA 1SYTA 3THDA 1TA3B 3MO4A 1QI2A 3VM5A 2G3MA 3AMKA 4TXEA 5E1QA 1G1YA 4XB3A 2WYSA 3U57A 3L4WA 3MMWA 2NSXA 2J75A 5I77A 1XYZA 1R46A 1B1YA 1J01A 1OD8A 3WNLA 4AMCA 1V03A 3W28A 3MI6A 4MJ4A 1VB9A 1QHZA 3VOCA 2J7BA 3L4XA 1DWJM 2WM0A 3WUBA 1FP9A 3D3AA 2D0HA 2IGTA 1E6NA 4KH2A 3UERA 2ZX8A 3WH9A 1V08A 3ZOAA 3EBVA 1FHLA 1MXDA 2JIWA 4JHOA 2YA1A 2W61A 4DO6A 5HPOA 4U2YA 4EKJA 1WNOA 1TZ7A 3BC9A 1NQ6A 2GJRA 2FHFA 4RE2A 3KWXA 3UCQA 1QWNA 1JI1A 1NWRA 3BH4A 1UD5A 2XVGA 7CGTA 5JIWA 2ZX6A 5M3WA 1E0VA 1W9DM 4F9DA 3WBEA 5KEZA 3L2LA 2VRJA 2GJXA 1ITXA 3N04A 3CZEA 3VIPA 2WCAA 2AMGA 3AIQA 1B3XA 5JIPA 4WIWA 1DTUA 4RE3A 3ARQA 1UR2A 2JE8A 4CCCA 2XSAA 1BYDA 4QCEA 1H5VA 1TFVA 1WCGA 2EJ1A 2WANA 3QHNA 2WCSA 2G3NA 1UKOA 1LWHA 4AIEA 3VILA 3WMCA 1DWHM 5D9OA 4MJ2A 4NSBA 4D71A 1PJ9A 4WSJA 1US2A 2VX7A 1R75A 2UY5A 3AS1A 2EBNA 2VTFA 3FNDA 3A6OA 1I75A 5A2CA 1IT0A 4BCEA 2YKKA 4WLCA 4KGJA 1XD0A 1CWYA 3BAXA 5FD0A 1T0OA 1G01A 4R27A 4KGLA 1VAHA 4GXPA 4MPKA 3AXIA 6CGTA 1UUQA 6A3HA 2BHUA 1UYQA 4H2CA 1PX8A 3WNPA 3GXMA 4JFSA 2VR5A 2PI6A 3EMCA 1BYAA 2BFGA 5M03A 3K4DA 5BXRA 5A6KA 2ZUTA 4UZUA 4U5KA 1UOKA 2J7DA 5D4YA 2ZE0A 2WKLA 3CLWA 2O9RA 1XCWA 4TTUA 2VR4A 4U3AA 2ZXDA 5A1AA 3WIJA 4CN6A 4Z2HA 4GINA 1TQTA 4PTXA 2XN2A 5CLWA 3VSVA 3WDPP 5FCZA 4UTFA 2J7CA 1HIZA 3BAIA 2Y24A 3APGA 3IGUA 4Y7EA 3T2OA 4AWEA 3A5VA 4HZ6A 4HOWA 4UFKA 2ZOXA 2CITA 3BLBA 3N11A 1MYRA 3S5ZA 4M80A 4GIAA 1Q6EA 3CUHA 3W37A 2WZIA 4QCFA 3D4YA 2WB5A 1MQQA 1UD4A 1MWOA 1UWIA 1OWQA 3MV11 1OGGA 2YDQA 2XHYA 2YOCA 1KXQA 3WF3A 4U2ZA 2IXUA 3WENA 4AZ7A 1L8NA 4UOZA 2EO7A 4GZJA 4M1RA 4AZIA 3WL1A 2D3NA 3WF2A 1ZBWA 3POCA 2EPKX 3U5YA 5A8NA 5C70A 4JZ5A 1UWSA 2BY2A 3EJPA 2NT0A 4NX0A 1OSEA 2F61A 3DECA 2DSUA 4CUCA 1WDSA 1EDTA 1E4NA 1JXJA 1OGBA 2CEQA 2EPNA 1E9LA 3AHXA 4D6FA 3WD4A 3WN6A 2A3BA 4UQBA 3BCDA 2OWWA 5I0DA 1CXHA 4UFHA 1PPIA 1JGIA 3AOFA 5CSUA 4S3JA 3WKZA 3TOPA 4FLSA 2WNWA 3ZSSA 3AZRA 3VD5A 3ARPA 4DWSC 3G6LA 5BXSA 4X9YA 2VZSA 3D52A 2Y4SA 1GPFA 2PBOA 1OGSA 2XN0A 4WKFA 4ACZA 2DT0A 1UQZA 4HPHA 3ZT7A 1JFHA 4BA0A 4WK9A 1PIFA 1C90A 1GUVA 1W9VA 3BAWA 3OB8A 1NM9A 4NZCA 1J0JA 5DO8A 4UFIA 1LL7A 4EK7A 3GBDA 2CETA 4CCDA 3CUJA 3F5JA 2W92A 2ZX9A 2WVVA 3VU2A 2BVDA 4EE9A 3G6MA 3KEHA 3SUSA 3A21A 1EO5A 1CECA 1BAGA 3ZJ6A 1JG9A 1NOWA 4XZWA 3WDRA 3CZKA 2QPUA 4TX6A 1AQ0A 1Q4NX 1UWQA 3RIKA 3WFLA 4J3WA 3MSDA 4D6IA 4LYRA 1JZ2A 2W91A 1L0PA 3WQ5A 4IM4A 1S46A 2A3AA 1R86A 2WVUA 3ARTA 2YBTA 2XN1A 4HA4A 4ZEPA 3AISA 3CUFA 3OG2A 2D2OA 4PTMA 4JAWA 1R85A 2CIPA 1WDQA 1V6YA 2FE0A 1DP0A 4MAZA 2EABA 1PIGA 4UFMA 3MUAA 5JBDA 1XCXA 2BY3A 3GXIA 5IDIA 1W3KA 1SR0A 2OSWA 4MB1A 4FLQA 1VFOA 1C8YA 4W87A 1C7TA 1LWJA 1K9EA 5M5DA 4S3KA 3RPMA 3NCOA 2OW6A 3WUFA 2WMIB 5EMYA 1QNPA 1RH9A 4BQ4A 1ISXA 2W4XA 1KFWA 2BY0A 3PZUA 4CVUA 5D9MA 4EANA 2E9BA 3BAYA 3VIKA 3MUIA 5A8MA 5CZKA 4OKDA 3HG5A 2GVYA 4GI8A 3OZOA 1MXGA 2XM2A 1TQSA 2ALWA 1BFNA 1UR9A 4JCMA 4D6DA 3GH4A 4MTVA 3J7HA 3L4YA 4MB5A 5BXTA 3FAXA 1LJYA 3WEOA 1UD6A 2IXVA 2UWFA 1E0WA 3CZSA 1V0NA 3N12A 3W0KA 4JL1A 3GBEA 2YDRA 3CBWA 4KRTA 3DHPA 3LX9A 3CUGA 2GDVA 2WBGA 1KXHA 3W27A 3NSNA 3ZR6A 3VKKA 4HZ8A 1E70M 1F4AA 3MANA 1TVNA 4GO8A 3VM7A 3L2MA 5LA0A 3LPPA 3M07A 5GQBA 3AJ7A 4JCLA 2V3FA 1FOBA 1BYBA 3ALGA 2DEPA 3EJTA 1HKMA 4J28A 1XV8A 4D6EA 2XVKA 1E3ZA 4JFVA 3DX1A 4PUDA 1H3GA 3AHYA 4QLKA 5FKYA 3U5UA 4H8UA 3A4WA 1HXJA 1JL8A 2YDSA 4CD5A 2AAAA 2J79A 4W93A 1JZ5A 3VIIA 1AVAA 1UKTA 3OBAA 1E6RA 4Z2GA 1E6PA 3PTQA 1E56A 4NXKA 4J3UA 3VVGA 1VBRA 1M01A 1Q6CA 2VCAA 1HJUA 3II1A 3NDYA 1ISYA 1BTCA 3WELA 4MDPA 4JKMA 3VIFA 4JFTA 2WVTA 2YL6A 1BGAA 4MDOA 5AYIA 3VSTA 3AYSA 5ECUA 4CU6A 5LA2A 4K68A 1WZLA 4AZCB 1B90A 3AQUA 1E40A 4JFWA 2GDUA 5ABHA 1M03A 3VPLA 2YL8A 3AZTA 1UR0A 1OD0A 1XC6A 1TUXA 3WH7A 5DMYA 1K6AA 2XVPA 1P6WA 2VURA 3GNOA 4NXSA 1W1YA 4HP5A 2V5CA 4QDMA 1ECEA 1MW1A 1J0ZA 3DDFA 4IPLA 3CZGA 1WDRA 4P7QA 3OZPA 1BSIA 2DPEA 3N13A 1HL9A 4UQCA 1B3ZA 3W53A 2J7GA 3LXAA 2EACA 2HVMA 3T0AA 3AYRA 5D8ZA 1CGYA 3U7BA 2FHBA 1UHVA 3RJYA 2WMJA 4W8LA 1E4IA 2EAEA 5I23A 1LG2A 5CPTA 3ZM8A 2VUYA 3QHMA 2E8YA 2F7RA 4L4OA 1JZ3A 4AMWA 3GH5A 4GQRA 5CJ5A 4C7FA 1W91A 1NOFA 1TR1A 5AY7A 4V27A 3S6TA 4FNSA 4ZFMA 3S2CA 1VJSA 1XRVA 4P8WA 1HX0A 2CBJA 1V02E 1D7FA 4W84A 3AS3A 3WD3A 3GXDA 3RM8A 1KQYA 4CD6A 1EO7A 2J4GA 1W3JA 1TQUA 2QPSA 2BVYA 4BQ5A 4HU0A 4CGTA 1OBAA 1EIBA 1CENA 5A95A 1KXVA 1VFUA 3PZGA 1H0IA 2WC3A 2NW0A 3IJ8A 3WL0A 1K9TA 1JDAA 3OGSA 1R8LA 4YN5A 1X1NA 3MKKA 2RGMA 3N18A 4CVWA 1LF1A 1TCMA 1C91A 2O92A 3HG4A 1G9HA 1UZ4A 5A3HA 1QI5A 3CZLA 3VSUA 1JF6A 1PX3A 2PWDA 3HU7A 2FH6A 1XHGA 3A4XA 2FGLA 2PC8A 3QOKA 1V3LA 4AZ6A 1CIUA 1UASA 2OWXA 2G4FA 1CGXA 2Q8XA 2F7QA 3WBAA 1UKPA 4D6CA 4L4PA 3CHEA 3WNNA 1OIFA 2WMKA 4H7VA 4PMOA 1Q6DA 3AIRA 4TVUA 4ML4A 2EQDA 2YJQA 4XX6A 2PWFA 3VGEA 3VINA 5E70A 1QNOA 3A3HA 4AD5A 2QV4A 3EJUA 1ISWA 2PWGA 1ZBKA 3BVTA 5CGTA 1WB0A 4A3YA 1V02A 2JF6A 4B15A 3BSGA 3OLDA 4MNKA 5I2UA 2W67A 1WZAA 1W1TA 2F2HA 4H8HA 1I1XA 4V28A 1JZ8A 1V0LA 4ZXLA 2V3GA 3RM4A 3DX0A 4FNQA 4N42A 4D1JA 1QWUA 1E6XM 1H11A 1J9YA 1C92A 3CC1A 1DWFM 4E2OA 4ZE5A 3UR7A 3VIJA 2XGIA 2EPOA 3PZQA 1RPKA 4DUVA 4KMQA 2IUZA 1KR0A 3K8KA 4FMVA 2YLAA 3SUUA 3QGVA 1CPUA 4PSRA 4LYPA 2Y2WA 2BNJA 4P8UA 5IFPA 3FAWA 3EDDA 3B8SA 2F7PA 2CCRA 4HMCA 1PEZA 1GQLA 3SUWA 3TTYA 4LQ1A 1YQ2A 1MQRA 2UY3A 4F66A 1GOIA 1WKYA 2FGZA 3CMJA 1TA3A 3D51A 1JYWA 3VNYA 3IJ7A 4ZXOA 1BLIA 3W81A 1VIWA 3VDHA 2GK1A 4RL3A 1Z32X 5M17A 1JFXA 2F8QA 2J47A 4CCEA 3WEMA 3AIUA 1UH4A 1JZ7A 2B31A 1H0GA 5A6AA 3EDFA 4PTWA 5I3DA 1E1EA 5E0FA 1NARA 1GHRA 4PRWA 1PX4A 2VVSA 1PAMA 3BCFA 5I5RA 3VD4A 1QOXA 1GCYA 4AYSA 1QW8A 3NYDA 1FP8A 2ZUVA 1E4MM 2F1BA 3ARYA 2WK2A 2JFEX 4RE4A 4AEFA 5C8BB 3OGRA 3F5LA 3BAJA 4AY1A 3NDZA 2WMHA 2BS9A 1CXKA 4ACZB 3CHCA 1WZKA 2C7FA 4W8BA 1EHAA 1J0KA 2WVSA 3D5HA 5EFFA 2EEXA 3WFZA 1GQKA 2A3EA 4M82A 1CGTA 3UG3A 2VRQA 3VMOA 1MQPA 1IZKA 2ZWYA 2O9OA 4IPNB 4U5IA 1C7SA 1W9PA 1ISVA 1UD8A 5BROA 4BS0A 4DM2A 3AZSA 1CGUA 1B3WA 3AIEA 2HISA 2WVVB 2WWCA 4PCSA 3LPFA 4B16A 4Z2JA 4D72A 4W89A 3BMVA 5DEZA 1U33A 4AC1X 4AZGA 3THCA 1ESWA 4PYSA 1W32A 1NH6A 1QW9A 5A6BA 1MW2A 2VX6A 3SURA 4UQAA 2E0PA 3B9DA 3BMWA 4TOQA 4UFJA 3VIMA 1J0HA 4UQ9A 1G94A 2J8FA 2J8GA 4TUFA 4BQ3A 1NP2A 2E3ZA 4ZENA 1HJVA 4FNRA 1N82A 1W9UA 5CPQA 2VL4A 4NF7A 1FFQA 1E4LA 3T2QA 3SCVA 1J12A 1GOKA 1JAKA 2OSYA 3RJXA 3QR3A 1J0YA 4J27A 1GQJA 4CD4A 3EYPA 3L4UA 1VFFA 4GO9A 4LPCA 1VJZA 5EBAA 5CXPA 3GM8A 3EDKA 1KQZA 1PZ2A 3VMPA 3FHAA 3SCSA 2WWDA 1E0XA 3ZIZA 3I3EA 4PUEA 5KZ6A 1OB0A 1TVPA 1C8XA 4HU8A 2QLYA 2QHAA 4NZFA 5AC4A 2VRKA 2YFNA 4V2XA 1AQMA 2J74A 1RP9A 3O9NA 5IHSA 3ARUA 2GUYA 3W29A 3AMDA 2X2YA 3CUIA 1VBUA 1GORA 3O6AA 3ZR5A 1BHGA 1OINA 1E5NA 1W3LA 5DT5A 2BXYA 3TP4A 1JYNA 3OLIA 4B9ZA 4P7RA 1NOUA 2WHMA 3VX0A 5I6SA 1JNEA 4CD8A 2F18A 2EADA 1R87A 2XGBA 3LRMA 1ZU8A 1H09A 1UR8A 5JBEA 1CLVA 2OYMA 1QBBA 2YBUA 2E8ZA 2DSVA 3PZIA 4DO4A 1E43A 4W5UA 3WQWA 4TVDA 2BHYA 1KBBA 1O7DC 5EFDA 2EPMX 4U3CA 2X0HA 2DT2A 3CO4A 1DWIM 1C8QA 4AD0A 1BQCA 1US3A 7A3HA 4NI3A 1HJWA 2Y8VA 1TMQA 5IFTA 3DX4A 3PBGA 3K1DA 3A24A 1FFRA 3WDQA 5TD4A 1UH3A 1IV8A 1UA3A 1WO2A 4UZSA 3ARXA 3AMGA 1NP0A 2ZUMA 3DDGA 4AEEA 3WH5A 3HG3A 2VQTA 3WF1A 9CGTA 2FH8A 3A4AA 1H41A 4BQ2A 2XIIA 4WKHA 2CHNA 4KWUA 4UCFA 3ARSA 2D3LA 4AZBA 1HKIA 1Y7VA 3WUEA 4GPNA 1QNSA 3VX1A 3BLPX 1H1NA 2OW7A 3RMEA 5HPCA 2QF8A 4DM1A 2Y8KA 4QLJA 4AZ5A 1FHDA 3BUPA 2XIBA 4OZOA 3VO0A 4DO5A 5A2BA 1W2PA 4P7LA 4HA3A 1ZJBA 5ABFA 3I3DA 7TAAA 1V0MA 2WCGA 4Z2KA 1UR4A 3ZJ8A 4UQEA 2E4TA 3BVWA 4QP0A 4DWSA 3WNKA 2UY2A 3GH7A 1QX1A 3SUVA 1V3HA 1ZS2A 1B9ZA 3ZO9A 4ZE4A 3UETA 1ISZA 2J62A 4JHZA 4FNPA 3VD9A 4PMYA 3H53A 3W4RA 1TG7A 4AIUA 4FF5A 1XD1A 3WY2A 1BVZA 3PZ9A 3WDIA 2ZX5A 4W5ZA 2PBGA 3FY1A 4QFUA 4LGXA 1ODUA 1VFMA 2V38A 3TONA 2W66A 3I3BA 5A6SA 1CNVA 4P7NA 5FOOA 4MB3A 4W7UA 3BGAA 3AXXA 4PN2A 1V3IA 4MAVA 3N9KA 3WMSA 4U33A 1BYCA 1VENA 4AYGA 1E72M 1JF5A 4YHEA 4PSPA 2WMGA
chains in the Genus database with same CATH superfamily
1YBQB 2VJXA 1QSEB 2Z64C 4CMMA 1N2RB 2F8IA 3P30H 4R7DA 1TIMA 2EDKA 4LCYB 3UL4A 1XQ4A 2OB3A 5CN3A 4LLYB 1XX9C 1HWHB 3P93A 5BMXA 2ZCGA 4APQD 3RO6A 4RMVA 2G5WA 3EH2A 4F15B 5IMMB 3WTVA 2OTUB 4IGSA 2IWEA 3VWJA 4NZUL 1WWBX 1GOFA 5HYEA 3NA8A 3DX2A 1BG9A 2VLKB 2VOTA 3UG5A 1XXXA 2IV8A 3NQFA 4B6ZA 1QHPA 1SM3L 5BZWA 1XF5B 1NPNA 1FVEA 1JPMA 4BWTA 1PYMA 2CHZA 7REQB 4CC4C 3I6LD 2XXFA 5CGMA 1A2YA 3GRWA 1YRRA 4L9LB 1D3HA 4W85A 4GG6A 3Q8AA 3LZ3A 1EGZA 5DO2C 4HCGA 4HH9B 2XVBA 5HHPB 4OOUA 1I8IA 4OLVH 4XVTH 3B2MA 1DWAM 3RU8L 2XG4B 3V0SA 5FOBA 1WKEA 1WK0A 4I3SH 4N8UA 4S3CA 4PJ5B 2WAGA 2BHZA 4TSCH 3O3BA 1ZJIA 2Y9RT 4L56A 3KBVA 4PYGA 3ZK0A 2VD8A 4CADA 4HKXA 4HV8B 2BOBB 4FP8L 2FYYB 2F19L 2YYUA 4ZS7L 1NC4D 3AROA 5CCHE 3X1GA 3WD1A 1SBSL 4L3EE 4WHYG 2VUOA 4MNLA 1AGDB 4S1DD 4DNHA 4LP8A 4LXFA 1PD0A 2BVEA 1ASQA 1HZKA 4AGOA 3KX6A 3AU6A 1KPRB 2ENQA 1EQCA 2HLAB 4G6JH 1CQKA 1JPIA 1D8CA 3GC5A 2FZBA 3RZCC 3KPRA 1MCHA 2C3XA 1F9CA 1H3UA 1B4LA 1B0GA 3HKFA 1AGCB 5C9JB 4JQXC 2HRHA 2D0GA 4LCRA 2IQTA 5E99H 4GI6A 3OIHA 1UM4H 3EZ4A 1A80A 1GKEA 2VZVA 1YNPA 1E7VA 2W63A 2A74B 3AYTA 1SYVA 4CN1A 5CCZA 1TR9A 4DETA 2O1AA 1NEYA 3GLCA 4FJYA 1HCFX 1LO4H 5KSAC 1BA9A 3C6SA 2R24A 1E1CA 1Y0EA 2VELA 3O6MH 4GS7B 1PQZA 5DD3H 5GGUB 1OGTB 1XLFA 5HDBE 3I9GH 3MLYH 4C6OA 3DOSB 5DCCA 1XH1A 3T4WA 1WFUA 2FATL 3LN9A 4EI6B 3TEUA 1X7QA 4FL4C 5CIPH 5J11C 2R8WA 5CZJA 3L5LA 5E8PA 5MI0C 4POZD 8FABB 2CZFA 1EFXB 4K5OA 1YADA 4NP9A 4ABUA 1PY9A 1KEML 2F6KA 1S2CA 1GQIA 3PN8A 1FYTA 3FS2A 4MWFA 3ZR4A 6PTDA 4BSVB 4YTQA 3EOSA 3FF7A 4YSTA 2CCWA 5J13C 3WLLA 4WHDA 4HZ1A 1L8PA 5DHYA 2H1PL 4OLUL 5TPWH 1DXIA 4EVZA 2ATKB 2G75A 1V7NL 4N90D 3F7PC 3QNFA 4D7PA 3E02A 4YPJA 4UM8B 3ID7A 2YEQA 1WA0X 4OF7A 1E4XI 3V6OC 3F65A 4J3XA 2NXIA 2AS5M 1AFVL 3PL6C 5CJBA 3NZ1A 2J7FA 1DHKA 4DEPC 3EUDA 5B8CA 2BCKB 1A8JH 3QA3B 4HUKB 2VC6A 3FSUA 3F2CA 1WLHA 1XRFA 1B3JA 4DQOL 3G0UA 3QZNA 4WW2F 1DTNA 4ATWA 2P53A 2P52A 1JK9A 3LD8B 1U3JA 1DLHA 5D1QC 3S5YA 3KOWA 5BOJA 3WQFA 4LCQA 1N0XH 2APBA 1EHNA 1FORL 3PG2A 4OCXL 2ZXBA 3T2LA 5F7NC 1D5RA 1B4EA 1K6WA 4AL8C 3ILQD 5A8QA 4JQ4A 3QDJA 3SY6A 4RWYH 4GHRA 3S96A 3QUMH 1HWWA 4Q9QH 3CN0A 3WEAA 1PYWB 3BVXA 4ZXBC 1SFLA 5T9BG 1F4WL 2VW6A 1A1MB 2ZUYA 3M5ZA 5IWLC 5CZRA 4XNQB 1DEDA 4J23A 1YN7B 3S37X 3A4FA 4MA7L 1HQTA 4AD2A 4WEMB 2DQFA 3VFMB 5AWNL 1JGDB 1P7TA 3QBUA 1N6QH 4LSVH 2VDKL 2C15A 3LN4B 3EBAA 5E0KA 4M48H 4AEIH 3T0EB 4QO1B 3T8XA 1PCWA 2GJZA 3V4BA 1Q9WA 3PAZA 2ANUA 3A23A 1WKFA 2E7MA 2VL5B 4FI7A 1KENH 4XPHL 5DMKA 1XFCA 4P23B 3R94A 3I10A 5FAJA 4R3SB 4ZFOL 3M46A 1FNSL 1YCSA 3BSHA 5JQ6L 2ZUQB 5T3ZL 4KQ0A 4HOXA 4OF0A 2X2IA 1U9KA 3VD0A 4MJ5A 2E7FA 3MJ7B 2DORA 3DBPA 4DT2A 3CMOL 2WZEA 2YBRA 3ZHDA 1VEMA 4XAKE 5AFAA 4BHUA 2E74C 1A3RL 1RU9L 4TTGA 3JTSB 4OI8A 2IMMA 3IU4H 5IXEA 4HETA 2X1XR 4LIQH 3OA5A 3ULVF 2QVIA 4K5LA 2P8PA 2NVCA 4A3RA 1NCBH 3VNMA 3AS0A 3BP4A 1KOAA 4DY1A 4EX4A 1JQXA 5EKYA 1YEIH 1QUNB 4QTHA 4QOKE 1R6WA 3GYCA 1FWDC 3LIZH 4O13A 4XNMA 2WTOA 3CUPA 3FQRB 4PJFA 1CICA 1CQYA 3VAEA 1L0XA 4I3GA 4PMEA 3P8JA 3W0WB 1H2JA 1FA2A 3UJJH 1FWHC 4K6AA 5E2VL 1VBHA 4NNPL 4H8VA 4A38A 2OFJA 3PAUA 1Q6QA 3P40A 1MUCA 5DRNB 1SYTA 2ESVA 3HFMH 5E1QA 2WYSA 4XCYA 4F3HA 4EPSA 1VB9A 4HPOH 3WUBA 1SF5A 1OX4B 1EYEA 2YZ8A 3D3VD 2Y7QB 3WH9A 3RWIA 1FHLA 5HMDA 5JHLL 2YWZA 3DV4B 2JIWA 5BZXA 4HKBB 4OI9A 3IE9A 3VXUE 2Q71A 5ISZE 4B50A 3VA6A 1EGMA 5M3WA 2Y89A 2ADJB 2WNQA 2LFGA 3TLRA 3ARQA 1BYNA 4RA3A 2A77L 3IDJA 3U25A 5KSVA 3ZL2A 1TFVA 4BFRA 2Y7MA 4GMSL 5SWSD 2F15A 3QHNA 5KBDA 1BMWA 2PW1B 3X14B 4EKXA 4MJ2A 1BQ5A 2VDPB 3NO5A 4E4FA 1EFQA 3EWZA 3P8IA 1G7IB 3WCZA 1KXQE 2OMXB 3P4OA 3PPHA 3C2VA 1SEQH 1OQFA 5F93C 1KPVB 5A2CA 4JGUA 1DEEB 2NSQA 3LQZB 5G4HC 1GK8A 4KPHH 4FJ6A 2RDUA 3TO4A 6A3HA 3CSTA 4KXDA 3NSJA 1XR2A 3DVNA 3KH3A 3B8TA 5M03A 4IBWA 4LLUB 3WFCH 2K9FB 2LU7A 5CJXC 3BIBX 3EH5B 5F6HJ 4A2SA 2HCVA 4PTXA 3ARFD 2IDTA 3VSVA 5EF1A 4DVBB 2CBTA 3FB5B 1BGXH 3VG9C 3SRHA 3QQXA 2DWSA 2PCFB 4OIAA 1A5NC 3TJLA 1DQTA 5CJOH 4AWEA 4LMQI 4YGAB 3LTSA 4JFZL 1S7RA 4WJEA 2OFQA 3BLBA 3NK4A 4YHIA 2JTYA 4O58L 3TM6A 3V5KB 4RFOL 4LUSB 1S4IA 2V33A 3DXIA 1M7IB 4CNPA 3QJHA 1EMTL 4JM2D 3WENA 2DAVA 4H1LA 2H45A 1T8XA 3NURA 1PS9A 4HHMA 3ILPA 5HYJE 5JXEC 3FOLB 5AKTA 3L3JB 1HINL 5AYUL 1DBTA 1WDSA 1U8JA 1KJ2L 4G8GD 4JPWL 3TOYA 4Z76A 2R56H 2XIOA 3UTSB 3FU7B 2VITA 3ZIMA 4FX5A 4EI5B 3D52A 5EDSA 1OGSA 1UQZA 2GUBA 4RZCB 3UYOD 1E0OB 2AAMA 4JZOB 2EKSB 2DJ4A 2GT9B 5DMNA 1KTDA 3CFJB 1UXWB 4IRZL 4EK7A 4OGXL 3MW7A 1H7PA 4MY1A 3EFOA 3F5JA 2VDOL 3NQGA 1EZVY 2ZKHL 1IVLA 3IBEA 1E6OL 1KCSH 3KEHA 4EIVA 5INDA 3ESNA 4REQA 2BVOA 5KYUA 2GTZA 2IPJA 4FFWC 3WFLA 4UU9A 3DROB 3KP1A 4NQ1A 4Q14A 4UV7H 3T04D 4MXWH 4YDLC 4PTMA 2BIMA 3E2HC 3C08L 3B8WA 4Q8PA 1CBVH 4K4KA 2XWTA 2H6PB 3T1WA 3P7YA 3SY0B 1BEYL 3VOHA 3PQYD 2UVEA 4N0UE 1D5ZA 3QZBA 1FY6A 3UPMA 5HHOA 2O55A 1QSED 4FX7A 1ISXA 4RMSA 3KVPA 4W70A 3DZ1A 3HZVA 2E9BA 2F54A 3UY8A 3B06A 3HG5A 2GUOA 5B1JA 3F4NA 1POJA 3GH4A 3W7RA 3V4LA 1U8IB 5DS2A 1XPYA 3BESR 3EAKA 4GUCA 1I53A 2EDYA 1SLVA 1L3NA 3KPSA 3JV6B 4NQQA 3DUSA 3L2MA 4OFYA 4BJLA 4LLWA 2PCQA 1YC7A 2W38A 2AABH 3C9NB 4CVZB 1G7HB 4WW1B 4TULL 1S2EA 1G4SA 2G2RA 4RLIA 1HXJA 4P4RB 3TYGL 3IVKB 4OV5B 1A6ZA 5D7IF 3EYOA 3CSYB 5I2IA 3QEUB 1TXKA 3II1A 4UCGA 5K9KB 4AV4A 4HLJA 4LSPH 4FTVB 2AQWA 3WELA 1PNCA 5AW9B 4MDPA 4M6AA 3KYMA 3FUIA 4OKVB 3RX4A 4CU6A 4MMXA 1HEHC 1NSJA 3A6CH 3VCNA 3LDBB 3AQUA 3EOBA 2NYYC 3RFRA 3NZPA 1JP5A 1TMLA 4ENED 4D9QE 4Y19A 4JB9H 4XBGB 4Z5RA 3WH7A 2RAMA 3BZ5A 4PJ5D 4HEME 2EVFA 5JDSA 1UZ8A 4JY5L 2DPEA 2F58L 4JG0H 5C0NC 4LSUL 3W01A 4OJFH 2FCBA 4K3JH 4CLMA 2KI6A 1UA6L 3PREA 3RFZC 4W8LA 2R4SH 2F7RA 4OUUB 4LMQE 3CVBA 3XINA 4C59B 1P4BL 4S11A 1UZHA 1W91A 4YHMH 4HAGA 4V27A 5BVJB 2J6WA 5CWSA 4D9RE 4ZFMA 5IWLA 4UQ3A 1S7VB 5D1XC 4PJXF 3LAFA 1R0AL 2QQ6A 1DQQA 1EC7A 3TPKA 4XMXA 2Z1BA 4CGTA 4HBQA 5A95A 1KULA 3LHWA 5JHDD 1EDYA 4WUUA 4PCNA 3U6RB 1M7PA 4PW9A 2P49B 4ZMTA 4DN3L 2X3BA 4RQQB 1KGCE 3T44A 5TF1H 3ITOA 1CG9A 2NLJB 5JQ9A 5CBJA 3BSZL 4L4VE 1QACA 3WTUA 3W7CA 3PUEA 2XX0A 4NS0A 1R2SA 4PUKA 4D6CA 3WJLA 1MUJA 4Z7NF 4H9UA 4L4TE 1QOPA 2F53E 3CFNA 1S5IL 3S5OA 2B3RA 3QPYA 3MHFA 2VDLL 1CDHA 1ISWA 2G5RA 1ZBKA 5CGTA 1J96A 3CFEA 5CP3H 1OALA 2HJFB 3OLDA 4RW3A 1CUOA 4XBEH 2EDJA 2F2HA 4TQPA 3W11C 1HZYA 1I1XA 4X80L 3ELAT 1A7NH 4NJKA 4RGMB 3LKQB 4P4KB 3RM4A 4KROB 2I5YL 4PGDB 4PCPA 4QHPA 1DWFM 5H8MA 2EYTB 3GMQB 4PUJA 5REQB 2E6FA 3CPLA 1NBCA 3SYAA 4DERA 4KMQA 3F7JA 3M17B 3HPSA 3RJQB 3HR5B 1DBBL 3QAQA 2F7PA 1N0LA 1EB3A 3TTYA 4JDBA 3CMJA 1WBXA 1EFXD 4JY4B 4ZXOA 3E12A 5LNGA 3NM3A 3VXNA 4KFZC 4H2HA 1UUMA 4NLHA 3QIUA 1WDAA 4A67A 4BR1A 2MHAA 3APYA 3VE0A 2VFEA 1TQJA 5E4OA 1NKRA 3PGFH 2NUYA 3BCFA 3E0LA 3QTGA 2XJLA 3UDWA 1IC0A 3UTTB 3H6JA 5FGRA 1LRTA 3DOIA 1BEUA 4K8RC 4IMEA 3H12A 3DO4A 2EGZA 1L7TH 1WZKA 2IS7A 3OKDA 4RDZA 3QSRA 2J43A 4UMAA 3GJFK 4OVUA 1UD8A 4Q4PA 5E51A 1EEZB 5HJYA 2OM5A 2N7AA 3GSWB 2EDDA 3TJ4A 3THCA 4EF8A 1KNOB 2B16A 5EEXA 4LARH 3SURA 3MRQA 2EH8H 4Y1AD 1S7UA 1NINA 3MSRA 3BEWA 4C54A 5F71A 4I2XB 3S1UA 3UBXG 1JAKA 3NOEA 5IFAH 3K30A 4OY9A 1BRLA 1ZJHA 1CK0H 4JY8A 4LY4A 1MRFL 1FXQA 1IKFL 4HIIA 3KBSA 1G9EA 2QXWA 3L3HB 4B41A 1OG0A 4NZ1A 4PUEA 5LGHL 5HHMB 3V4VA 4LF3A 1J8HE 1D5BA 1CLCA 3IDIA 3APCA 1WS8A 1XMEB 2LQRA 4J2PA 4O00A 1F6AA 2BWDA 1GVSA 1NOUA 3NRQA 1EJUC 3P73A 1FCCA 1JNLL 5T5FA 1NJ9B 4PV1C 3OKMB 1EZVX 1I1FB 4ZTOL 4LP4A 1F3TA 4O2FB 5F9JA 5C8JB 2EPMX 1U21A 3LZFH 4L9XA 2AITA 4AD0A 3T0ED 4K94C 4OFCA 7A3HA 2Z4QB 4R96A 4D8PA 4AQOA 3TF7C 1RJYA 3HIJA 2CJ3A 5FJUA 5K9XA 4Z78A 2ADIA 2AKMA 2W07A 5ACMA 1KT2A 4HK0B 2WZPD 4P23D 3N55A 1HL4A 4WHCA 3AZUA 5D7IE 1C8VA 4OJEH 3IDXL 1S7WA 2CHNA 3MYOA 2PLMA 1XCQA 1KFLA 4G5DA 4S2SA 1RAMA 2IAMD 4ONGH 2QF8A 2P1FA 4NZRH 2VZ3A 1FHDA 3BUPA 2AGTA 1QPXA 2J6EL 2ILLA 3MLXL 1VACA 5CJNA 4P3DB 5HGDA 3ZKXB 3T0VA 3TPUA 4KIRA 4QP0A 4JRFA 4WKXA 5FB8A 1Y0LA 3S2NA 1T2JA 4HB7A 1KIQB 4F3FA 3WFHB 1EBHA 3OG3A 3KXFD 4MS6A 5HJ3B 4ZFQA 4G70B 2A38A 4FF5A 5SWZA 3V5OA 2CQVA 1FO0H 1ZA6B 3EH1A 4DESA 4MKVA 3D0LB 5DEGB 1A1OB 2DMHA 3U9UA 2VLMD 1WBZB 5FOOA 4MB3A 3ZDXE 2GTWA 3EJYD 4LSTL 1V3IA 3LTPA 4R7WA 2P5EE 3N9KA 3DKLA 3VXTA 2MFNA 5HWJA 3NFSL 3MRFB 5FLVA 3GXUB 2I9LA 3MLSL 4XO8A 5AB2A 1MFEL 1OEPA 3L4VA 3QJAA 4S3EA 3LHTA 3KL5A 1A1NA 5GNXA 1BP3B 3T4YA 2ENPA 3CTLA 2JV6A 3QG7H 3NSXA 5IGXH 5JW4N 2QIIA 3ZX1A 1ZSHA 4OFQA 2IDSA 3W74A 2ZTBA 3B6SB 1NLBH 3MLPA 4A2RA 3FTZA 1ZB5A 3T09A 2WBJC 3D30A 4CILA 3US1A 4Z7NE 4RLDA 1UB5B 3IVTA 3FPXA 2VXQA 3SN4A 4NQCA 1RZIA 1BVKA 4EXBA 4WKAA 4DZ8A 4Y9MA 4BDVB 3CMGA 3NUKA 3U2CA 4RAUA 4TNEA 4AHOA 5K33A 5GRZA 2DWEA 1PD6A 5DQ9A 2FJHB 4EDWH 2DWTA 1JV5A 1RUPL 2DSKA 3D8MA 3AALA 2Q8BH 5FYLH 4FQXA 4Y9FA 4L6OA 4G9FE 3VQ2C 4PMUA 2R8SL 1VGKB 2B2XL 4ODUB 5JUEH 2YAFA 2YCJA 3Q58A 3E5PA 4DQAA 3RURA 5EU5B 2NNCA 4R0LC 4U3SA 5CKSA 3C6LB 1OYAA 3SDXF 2P42B 1QFWM 1AXSA 2JEQA 2E67A 4XPTL 5A6JA 2RGSA 1VZIA 1BX2A 4YQXH 4ATLA 2AQ3A 3N6YA 4L9YA 1OCQA 1B31A 4CU7A 2NWRA 1SZEA 5F0PB 3WEXA 5JHBA 5E4AA 2IQ9H 1K2DB 1MO0A 2FO4A 3MRDA 5BS0E 3QFJE 3HV8A 5I8KL 2OI9C 3OAUL 4C7DA 3STFA 3GIYA 5C0IB 4OOZA 4AYEC 3GTHA 3BLDA 3FO0L 2NY5L 3I4KA 3ILEA 3FUMA 5KBMA 5AVZB 1GYUA 1QPKA 3W2NA 5I1KL 3ITTA 3MZTA 3HNTL 3M86A 3R8BB 2CESA 4XOAA 1UWAA 3D2UB 5GXBB 4E3TA 3P4NA 1CN4A 5D1XA 4MD4B 5EU6B 1YNQA 1UC5A 4FZ8L 1ZT1A 3CHRA 4QJ4B 1OM0A 3T1FA 1MQKL 3WK0A 2ARJB 3PXLA 5JR1H 3IKKA 4W6YB 4FXLA 1E73M 1I7RB 4IMAA 4OZGA 1Z69A 5GRJL 2YQGA 3TR2A 3K6FA 4MNGA 3C2AL 3UTSD 4BV1A 3SPHA 2V81A 1AYOA 3V79C 1EHXA 1HO1A 1OM9A 1N67A 2D4DA 3OD3A 3L23A 3BQUD 4OLWH 1NC4B 1LNUB 4PS7A 4NO3A 2ATSA 3WLTA 4X4XA 3KVJA 3ZMEA 1WWAX 4X6CF 1IE5A 4NDMB 2AEIT 1EHLH 2Z35A 1A6WH 2UWEB 1RQBA 3I6KA 4PU2A 2DLHA 4YHOL 4IBZA 1FNFA 4MJMA 1EERB 3P9LA 1MCSA 4NSKB 4M1DH 3PWLB 2JKXA 3BE1L 4XOEA 1MVYA 2GVJA 1KRAC 1ND0B 1ZKAA 3G6AB 4BFFA 5I24A 3AS2A 4P2QA 1Y5WA 4MB4A 4DJED 4UDTA 2CKBL 3NACH 1FAIL 3O07A 1RULL 4HTYA 3FRPG 3VDGA 5IBTL 2E9GA 5JIIA 3SUTA 4W81A 2CKRA 2JK2A 5D4QA 1N68A 2Y2YA 2EPLX 5EOCJ 3ARWA 4FX8A 2TRYA 4GXMA 3ZQ9A 5E2WH 2VCBA 3WTXA 4QHKI 3CVIH 2X70B 3RITA 3V4UH 5SV4A 1Z42A 2V3EA 4H83A 1N5YL 3TIEA 3QC6X 4WFFD 3ULUF 3LKSA 2E76C 3SCUA 4CDHA 4V15A 3WBYA 4IOSA 4P9ML 4G43B 2HFEA 1K3UA 2H6UA 1G9MC 5G2NA 5BYWA 1JZ4A 3W70A 1LWIA 2B59B 2WNNA 3QIBC 3DENA 3W9DA 4NKOA 2A9DA 1E6QM 5EEVA 4Q4OA 1LVEA 3BRGC 2J12B 3HBLA 5ESVB 4ZUVA 1QFWL 4B4FA 3AMLA 1EZUA 1QMUA 2R1XB 2LTQB 1ET8A 2XZQL 2OLHA 4PS4L 2X1WL 1CGSL 1G7MA 4YYFA 2PP9A 5TFSH 4HN8A 2K3TA 2BMBA 1CXFA 1TJXA 4FNTA 4JTQA 5I3FA 4NN6C 3G08A 2K70A 4JN1L 4MAYA 3GNPA 2PCXA 3SM0A 2V5MA 1V93A 3X11B 1U1HA 5B22A 3WHXB 5T3XE 1QCWA 4B5NA 3RP1A 2VZOA 5C2GA 5J12B 3Q4DA 3UXDA 2DL2A 2FPVA 5DMIL 2WXDM 3HZKA 1Z2KA 1D9KC 4UR9A 1ZV9A 2Q7AA 4XN1A 4A4AA 2CLEA 1WAAF 1VYRA 4BELD 1DZ0A 5D8WA 4K37A 3TJEL 1MQ8A 2CR6A 3DFNA 5PTDA 4PJHB 4GCXA 4WDWA 4WSKA 2JQZA 3PWPA 2VP8A 4X7DC 2RDXA 1PLBA 1TE1A 3UWUA 7FABL 5KZDA 4A8IA 2Y22A 1A5SA 4H26B 4PMFA 1VYSX 1SYSB 5HOSA 2I57A 1DXFA 2F7OA 3LHAA 5I76B 3D09A 1OABA 3E6EA 3B7RL 3U4FA 3OP2A 3CT7A 4F9JA 4R4FH 2HSIA 3CNYA 3LQLA 3T0CA 4H1ZA 5BXFA 2WMPA 4N24A 4PLKC 4NZ3A 3QUMB 4LL4A 1UR1A 1HH9B 4MMYA 2QJHA 4H88L 3K71A 3EOYG 3GS0A 1JPKA 4NQDB 2IXQB 1EJRC 4KXBA 4TYUA 1MAMH 1XVSA 4AJYV 2VZTA 3TBTA 1GW1A 3OSKA 2I9TA 4P4KD 4KROD 5IV2A 4XPAL 1WQ5A 3DURA 4WKZA 2GIXA 4HGWA 4O1DA 1S2VA 5J57B 3AHVA 1GGTA 1EUUA 1HQ4B 1RZJH 2PWVA 1N59B 3FN9A 3L5XL 5HMEA 1GQNA 1KM6A 3D39E 3N14A 1KN2H 4XHJD 2X16A 2Q76A 2X8RA 2X89D 2OMUB 4QHMA 4HUVB 4H25A 4G8EB 3INUH 2A6JA 1EWHA 1B57A 1G9NL 3AG3B 1R46A 3Q1SL 3WLWC 1LRQA 1VFSA 4K7VA 1BVLA 4C6FA 1V03A 2GCYB 4M7ZB 4JTFA 3U7WL 2BW4A 4MJ4A 1GGIL 4JQIA 3VC6A 5DRWA 5KTLA 1ED3A 4Q6KA 2R4RH 1NAML 5B7ZA 2W9DH 5JHAA 5HGHA 3P3SA 5LGKA 3P3YA 4RSYA 3H9SB 2HJLB 3THAA 2ED7A 3QY8A 5D7KE 3OOQA 2XVGA 1THCA 3QV9A 1TUFA 4N2OA 2H3DA 2DLFL 1W9DM 2HFFA 1K8DB 4UIKH 3IN2A 5DI8A 1IEQA 3VI3B 4ZO6A 1WS7A 3LH9A 4J3OC 2NR6D 1LO5A 3PHSA 3V95A 1ZHBA 3WXVL 2PXYC 5K59E 4M0XA 3VILA 1LWHA 2C14A 4RNRB 4B97A 3RLGA 2J21A 2WPBA 1W5OA 2DQIH 3A6OA 2V5SA 4TRPH 1ZHLB 4X6BA 4BBWA 1TETL 1L2UA 4N2CA 1O6SA 1ZHKA 12E8H 4TU1A 4GP8B 5IHUH 2FUTA 4R0LA 4UIMB 5HHMD 3OHXC 3ZTCC 4KMTL 5A6TC 3P0VL 3RL1A 3G04B 5CG7A 3P84A 2OJEA 5DCBA 1TJ1A 2YXFA 4G7FA 4NT6A 3EA1A 3H3PL 3PY9A 1TJGL 3N50A 1RUQH 2ZOXA 1THFD 2Y2TA 5LBVA 4GIAA 4NWUL 3CUHA 3R8HA 1QBML 2PDUA 1A53A 2HH0L 3SE4C 1YXCA 3WJXA 3RVWD 1PTGA 5I75B 5AHLA 1G67A 5SWSB 4LVOC 3SKNB 3T65A 2BK8A 3WG7B 1UGKA 2IQDA 1ZBWA 4B9JA 5C70A 3HOJA 3BZ4A 4XSLA 4F7MB 4UMBA 4HJWA 3GLEA 1LDCA 1A6TB 4OD1L 1EDTA 4NJGA 2ZRWA 2DQGL 4NC0B 1TF4A 1BBJB 4UFHA 2VC7A 3DRTB 3BP5A 1MREH 1P6BA 4HCFA 3QXTA 4LVEA 5DFTA 4C56B 3Q2CA 4CRPA 4XP9H 5CEZE 5BRZB 4CNSA 5IBXA 3Q5TA 3BGMA 4TLSA 2ZRUA 4JOMA 4CCDA 1CF1A 1FZOA 2W92A 2HB0A 1DVFA 1AH3A 3R06A 3VU2A 3NQDA 2AEQH 1JHTB 1NDGA 4DO7A 4ZFGH 1EAOA 1LBLA 1JG9A 3WN5B 4IQLA 1UWQA 2GGIA 3QHFL 4D6IA 2Q9OA 2A3AA 3M7OA 1ADSA 3RPIB 4ATTA 5H35A 5FGSA 1JNNL 2D2OA 3QSTA 5CGYD 2HT4C 3LH8A 4M6ML 4JN2A 3M9YA 1OAZH 2X4OB 5G5DB 2WBXA 3UBXB 4KWOA 4L8DB 1XGPA 5D6CB 3PB2A 4KRPC 3ZE1F 4W87A 1K9EA 3ESUF 3MA9H 3WUFA 4NAMA 3TFXA 5A2IH 3HRZC 3CHVA 4UTBA 4BZ1L 4L5FE 2HXTA 1KTLA 1NAKL 4UI2A 4WI6A 4R7OA 5FYJL 1V0NA 2X1PA 5DVNA 1KEGL 1TWDA 4JR9L 3H2AA 4O1EA 2ALAA 3ES6A 4YX2H 4O02L 4Z08A 2R82A 4X3ZA 3NEHA 1DUZB 1F4AA 4TLUA 3BKML 4KWSA 2UYLB 4H44C 2ZOLA 1X1ZA 1R24A 2XVKA 1NEUA 1EUTA 4MCNA 3AHYA 5D2LB 2YDSA 5I5JA 4W93A 1HQRB 1JZ5A 4JY6A 2AI0H 3K0YA 3ZL4H 3PTQA 4FQLH 4J3UA 5IQ9A 3AC0A 1BTCA 2RMNA 4JKMA 1T4WA 4XZHA 1XF2A 5FUZL 1R4XA 5E9DA 2EJAA 2WXLA 1WZLA 4PJCA 2ITEA 4RETB 3KBHE 3MO7A 1XLKA 4OZIB 4X4YA 2GTQA 5EU7E 4H8QA 2GC4C 3GQYA 3Q2NA 4J2QA 5I28A 3GVQA 1P6WA 3C6LD 4ZUTB 4AHQA 3HE6A 1F13A 2ZJSH 2QZRA 1NIAA 4HSOA 5I19L 4KOCA 4P7QA 5BV7B 5F3HA 1UUOA 4NM8H 4ELMF 5K7JA 4K8HA 4R7NA 3M5XA 1TYJA 3CFBB 3TC9A 3ITYA 4QHUB 5DQDH 4URKA 4HCRL 5TDOA 5CPTA 1B0RA 1ZWIB 5D2NA 2PDPA 2E5BA 5K1VA 4AMWA 1FH5H 2EYRB 3HEIB 2RALA 4LEBA 5D4HA 3GAYA 3VFGL 1EVTC 3GKFA 3U6XS 2DLGA 3FA3A 4LGRB 3GK0A 3FQNA 2AV1B 4P9HL 2JK5B 2E56A 2CNZA 1Z9OA 1JMXA 1LXMA 3N2MA 5FA3A 1AR1B 3D2UD 1TZGH 5GS3A 3IFNH 3U79A 4KJPD 2FL5A 1CYWA 1S5VA 3SB0A 1ZNNA 4JRXE 4XVUD 2ZC8A 5EU6D 4W9HC 4M61A 1PZ1A 3RWEB 4R90L 1CGXA 4LC6A 3EG9A 3NTCL 4KC3B 3ZKND 3W7EA 3Q3GA 4F7PA 2I5GA 3N5AA 5LNWA 3VFSA 3O05A 2QGCA 1WB0A 4NRXB 3TURA 2WJ5A 3G18A 5C6TL 3LEXA 3MBXL 3MGOA 3MP3A 4O2EA 3LCXA 4QE5A 2CALA 1V27A 4V28A 3PDOA 1RVKA 5H6HA 4D8OA 3KJ6H 1NGXB 3D06A 2Y0SA 5HQMA 2DI7A 3MXVL 3NL3A 2QJGA 3I85A 5EOTA 3JWOH 4ZD3L 4UTLA 3PZQA 1KIUB 4P04A 5SX5K 5JHDB 5I16B 1DPMA 2AK4A 4PFHA 4PJGF 1CPUA 4IBTA 2ZDSA 1NBYB 3LKRB 3NSDA 4HMCA 1GQLA 3OVQA 4LLQA 2UY3A 5T33H 5GS1B 4US5D 2JKJA 3GNMH 3U1SH 1BLIA 3KW3A 2J5LB 4JCWA 3CXHK 4DGIL 2V9UA 4WSHA 1W3TA 3AIUA 4XD5A 1T04B 5K3VA 4K3HA 3R8QA 4QD2E 3KXQA 1MNZA 1NCHA 1TTBA 4YK4B 4Q2ZA 1PAMA 3VCLA 1WGOA 5LAXA 5GGVL 3VOIA 2ZUVA 3ARYA 4G9DB 3UP1A 4YHYB 4AY1A 3PY2A 3FQ4A 2C7FA 5FW6A 1UWGL 4XNDA 4LCCC 4MCZB 5ADOL 3D5HA 1J05B 4UT9A 1N3NB 1AHWC 3QJRB 2QV5A 1JJKA 4JX5A 1T5XB 4FQ2H 3TCTA 3NQCA 2ADFH 1EGVA 1S3RA 4EACA 5GSVB 4GG9A 3D25B 1UM4L 4HT1H 3UA3A 2PRLA 4AQEB 1UEYA 1AZBA 1VLIA 5TDPB 3IPBA 1D9EA 1FIGH 4ZENA 4P2RB 4N6EA 1JCJA 3U2IA 1W15A 1U93B 4J27A 3BZEB 5HVWA 1GHFL 4M6PA 4HIJA 5AG9A 5D04C 1XICA 2FVMA 3OU8A 3FHAA 2WWDA 2CXEA 1GWJA 3ZIZA 5F4WA 4FULA 2BOCA 3VXRB 3ZE1E 4OQTA 4XZMX 4NAQA 4XZIA 3HZMB 4LKCB 4BSJA 4JS7A 1KZYA 5FHAL 4Y2DC 2RQ8A 3G8EA 4HGMA 3IJHA 4P5RA 3VX0A 1R87A 4EXQA 4J6RL 4W4OC 35C8L 3LMJL 2YBUA 5GS0H 2FVKA 1YLVA 4KX9A 2GDQA 4FZIA 2CIIA 5EC1A 3TZNA 1GOXA 5TDNA 4Q6IB 3RPBA 2OMVB 4Y1AB 1S78D 4M5YH 1DWIM 1H8LA 3V5HB 1TKWB 4R4ND 2JIXA 2HKHL 1ZE3H 5GS0D 2IKHA 3QV7A 2ZWNA 5E5MA 2P28B 1ETA1 3SE4A 2FR4B 5D7LA 4YNYA 1X39A 3DRQB 1BWWA 1HE8A 3FRPB 1QTWA 4WKHA 4LL9A 1OSYA 3TYEA 3CFIC 5B38A 2GIYA 3SQOL 3USBA 3KJ4B 4AZ5A 3IDGA 5E2UH 5ABZA 3EXLA 2JKWA 1T66C 3U46A 4P7LA 4DNLA 1NTDA 1A4JA 1ZJBA 1ZP4A 3C4UA 1UR4A 1JHKL 4MD5A 4XN8A 5KS9F 4RWHA 1INQA 5ACZB 4C57C 3S3BB 2FEEI 3GIVA 4OFKA 2WKJA 5KBNC 3EHBC 3WSQL 1IEVA 5E8DH 3H53A 4NQDD 1ILUA 1E0TA 4LGSB 3QCTH 4IGBC 4LGXA 2EXYC 1I1CA 2V38A 4IKJA 4JKPL 3H42H 4XPGH 3LCHA 3LZ5A 3WJMA 3JZUA 3ML9A 4TS6A 2GIMA 3QZOA 3HGSA 2DQMA 2OX1A 3H2CA 4R26H 4XT1C 3RO8A 4WFEE 3TV8A 3TROA 3FB7A 5IQLA 3OAWA 1ZALA 3GMMB 2EIDA 1YXYA 4EBQH 3B7SA 1OWRM 2V2WA 3K2KA 2R23B 4BIKA 3ZZ1A 2IAMB 2XISA 1ZT4B 2YSSB 4O53A 2SEBA 1MCKA 1ZHNB 2CA3A 1VH7A 1DJQA 4HZMA 3DUGA 3RTQC 3Q45A 1Q65A 1JN6B 3TC7A 3NPVA 1T4KA 3HRZA 5T91A 3FJ6A 4FG6D 4GUPA 2FIKB 3BHBA 4ZMNA 4LQFL 2YGOA 2DBLL 2V68A 1FDJA 1WVZA 3CXDH 5K69A 3MLTA 5E1HB 3KXFB 4JTCA 1QXLA 4WI2A 1ZVYA 3H9SD 3P2DA 2QULA 3K13A 4I9AA 2YPLA 1WBYB 3PP4H 1I1WA 2UZIL 2GJXB 3FHQA 1DHPA 2VXTL 1JUEA 3E0IA 2CUAA 4KVPA 4F8NA 1ZENA 3B34A 1IAOA 3V16A 1GA2A 1G6RA 3UXKA 1IXNA 5D1ZI 1DDHB 2VKWA 2HT3C 1FO0B 2FB2A 1VKXA 3VXQB 3FSWA 4WV1B 1DBJL 4PJGE 5DHMC 2YMXH 2HCZX 1ORQA 3PUDA 3ARDA 1Q94A 3FUHA 4NEHB 3AB0C 3HC0A 2DQJH 2VERN 2Y7SA 3UP8A 2BGSA 3ROOA 1U5HA 3CG8A 1KIPA 2ATMA 1HNYA 5HATA 1YEIL 4POUB 1V6UA 4EF9A 1HXKA 1VPYA 1UADC 1WIUA 5E7BA 3P74A 3D46A 3STLB 5HNNA 3D0CA 1B5TA 3S36X 1HIML 2P24A 1A7PH 4CA4A 4U10A 3U0TA 4JPIA 5U7SA 1JIBA 2N7BA 4MNQB 4OZHA 3O1NA 4YSSA 4D9LH 2PNDA 1FH8A 4G42B 3HFML 4J3VA 3EW3B 3QRFM 2WINA 5JH2A 4K55A 2P5WA 4Y16C 1QYGH 1DO5A 2PN5A 3WSUA 4PRPB 1IGTB 3K0WA 3IJSB 3BT0A 4FYTA 4U7KA 2IMRA 1NBZB 5F96H 4CC4A 1WE5A 3FSTA 1JXKA 3I9IA 1TTAA 3FSAA 5BOPA 1Z0MA 3PR2A 2IV9A 4ECLA 3T9WA 3BG9A 3WJJC 4YHZH 4JRWA 3BVNA 4ODXA 1NGYA 1EJFA 3HUJF 4X0VA 3RHWF 2AQVA 3BOXA 4A8NA 4C56D 2VGFA 2ZKXA 4YVPA 5F3BB 4Y4HC 1Q66A 4UTAH 5BRZD 1P0SE 4WY7H 3L1FA 4TPRH 3CFCL 2XFFA 4A7UA 2EG8A 1RUMH 1T1XB 3QH3A 4U4IA 3PG9A 1I9JH 4Y4KC 5KW9H 4IICA 1LOSA 4TLKA 1AZNA 1JUKA 4LOFA 4QTIL 1IRAY 1HXYB 5ABTA 2WC7A 3TH2T 4HNNA 5DD5L 1ITCA 3ZLGA 4U6YB 2ZRZA 1HN1A 1BQUA 5DRXB 4LFHG 3MOBL 1I1RA 1AE6H 2EDEA 2C34A 2OMBA 4WJ5A 3R4IA 3LLFA 1B2WH 3W72A 2WLIA 2R2EB 1YNKL 3TBWA 5FW8A 4IKLA 2OXHA 4XBPB 4XP5L 5KVGH 5C09A 1MG3C 4XH2B 1A0CA 3RZCA 3BAEL 8XIMA 1QASA 3WQCA 1DJSA 4X5QA 3DV6A 4MHHG 1YEJH 3TWCH 4HIPA 5BUPA 4PMNA 2ZOTA 1CD0A 3QK0A 1RCXB 3BQUB 4DRSA 3M6DA 1HJXA 4JQXA 1RZQA 3DOHA 5ABEA 2IKJA 3O4OC 3LMYA 4IRJC 3Q8CA 5C0DB 5AKRA 3O4LE 3LEYH 2L7JA 4WDIA 1UPPA 3A47A 1AD9B 1XL6A 5KANG 3SZ8A 1CDYA 4PY7A 1ZCOA 2BLFA 5U4NA 2VDHA 5KSAA 4GLRH 4LPVA 2CUHA 1QLFB 2J88H 2FNWA 3UZWA 5ENLA 3MNVB 1U8KA 2BC4A 5DHVA 3VFRB 4BKLA 2FWOA 3MX0B 4P57B 4XVEA 3QVAA 3Q06A 1TV7A 3ECQA 4Q4SA 4JL2A 4HKPA 3LQMA 1ZTMA 3T8MA 5I71B 2NT1A 2AQQA 4AYDC 1H6FA 5GRVL 5BV7H 2YIHA 3QQ1A 3UWZA 3IS0X 1J5SA 4KNQA 1BKSA 1RCYA 2BOEX 1VS1A 4AKPA 3WIAA 4O2CB 1R7AA 2YA2A 5KVFH 5L2KE 5C0AE 5IVZA 4XODA 2PWHA 2XTJC 4FQ1L 2E5EA 2UZYB 2DMKA 1FHVA 4YNGA 5ADPH 2B81A 3K5SA 5DK2B 4X0KB 1TJMA 5DJ8A 1KXVC 2PDNA 4FA7B 2Y70A 3C6EA 5B4MD 3HTLX 2E9MA 4XG1A 1H63A 4F48A 4Y2DA 3GJEB 2XA8H 3FO9A 2IH3B 3ULVE 1MW0A 4HPYH 2XKSA 4MQ7B 3V6OA 3ROLB 3VU1A 2VH5L 4HZ7A 3QF0A 4OLEA 1EDQA 3RGTA 3PL6A 3FSVA 3WLBA 1JD7A 3BK0A 2XG9A 1AR1D 2WQAA 3ZKSD 2C19A 1SLUA 4M43L 3G5WA 4DEWA 3A3XA 4KVCL 3URAA 3BVUA 5MHSE 2DTSA 3V8OA 1HEJC 4GRWF 4PL2A 3EXTA 1Q72H 2DW6A 5C55A 5GJTH 5D1QA 3C60C 3MR9B 1PZBA 1HSAA 5GRWA 3SEPA 4GW5B 3KPPB 1FWJC 2CPUA 3F6LA 5T9CE 5A16B 3W7IA 3ABRA 1GGCH 2BVQB 4IBUA 3BUDA 1IGYB 5I9QB 4AVHA 3B2PA 1QMLA 3EDJA 4JHBA 3EO1B 5M95B 3UFIA 1UWEH 5JZ7D 1GJPA 4H6KA 3UP6A 2P48B 4ZXBA 3Q05A 3GRBA 3CFDA 1M7XA 2GYSA 3HZYB 1IEIA 3MA7B 4AJVA 2CSPA 4M6OH 2IVFC 5C71A 1IT7A 3ARVA 3Q6FA 1JXGA 3BWUF 1B3OA 4I5RA 4ELKB 2C1HA 1UM6H 1IM9D 3O7UA 1GOWA 4N0CD 5EORL 4HJJH 3FT0A 5E6ID 3M0KA 2XVLA 3GFUA 5I1CL 5I78A 5IR1B 4HMNA 3OZLA 3W24A 1SZNA 3BCJA 1DQUA 1AJ7H 4X0NA 4IGBA 1CLYH 3NIGF 3P0WA 4ZMAT 4J3SA 5HPMA 2JWYA 4PFEA 2WMFA 3HPJB 1W2KT 3JW7A 4O4WA 3QEHB 3DTUB 1OD8A 4KW2A 1T20B 5AVWB 5ETUA 1JUFA 5LNRA 3H4HA 2ZXCA 2IGTA 2NOYA 4ZMZA 5KYXA 4JHOA 5HPOA 5ICYB 2IF7A 4X8JB 5IHLB 4L1GA 1ETZA 3ARBC 2DRUA 2DTML 2WQWA 1XIBA 3TX9A 3EPMA 1DTUA 4YHLH 3X12A 3QUYD 5D5MA 4TNVK 3GR8A 3TN0C 4XE0A 4QROA 3R18A 4FA8A 1R5YA 3B2VH 3O6KL 4P2RD 4YAQA 3QQ9C 3JZEA 3IXAB 3MCNA 3UZQA 2DKUA 4I9TA 5FD0A 2GJNA 3K91A 3LEVH 4R27A 2A6KB 2FDBP 4MPKA 3VXOB 3VNIA 2HWZH 4N6RA 3NCJH 1QSFA 1A25A 4G6FB 2H3XC 3TEVA 1BYAA 2PYED 4I5BA 3VXRD 2QJNA 2ZUTA 2O9RA 1AW1A 3FFCB 3T0TA 4Z2HA 1M1XB 4GINA 1NVMA 2WWKT 5E03A 5C0CD 2WLKA 2J7CA 4G71B 2X4RA 1HIZA 3BJFA 2C1IA 1A14L 3LQAL 1FZJB 5DRZB 1MI5B 3E6FA 1LUCA 1OTTD 1FE8L 1ELSA 2YOCA 4MD0B 2CE6A 1NUNB 3EIFA 4IYKA 4M62L 2BP0B 3P14A 2LOEA 4YXLL 2PO6B 3PWAA 1PHWA 4FX6M 5GGSY 2ISSA 3SR7A 1F05A 5CSUA 3WKZA 1DIDA 3TOPA 1SNRA 2Y4SA 2CDGB 4HIBA 4HIXH 4YSPA 3F85A 1UZGA 4YEFA 4YSEA 3CUJA 4F58H 5I15H 2Z4GA 4BUQA 5D33A 2B1HL 4EE9A 2ZZUT 4ZSOB 3OAYK 1E9ZB 4I0KA 2XICA 1NOWA 2WSQA 4P3CH 2VR2A 1FGNL 2RB8A 2ZCKH 1SXAA 4UOW1 4LYRA 2DZBA 5CJXA 5LNVA 3AT0A 5FEWA 1NCDL 4KESA 3CASA 1M1BA 3TYUA 1WA3A 4G7VL 1UIOA 2OX5B 1Q1JL 4F57L 5I74B 2X4PA 3TA4D 1FH2A 3MUAA 4X5WB 4K9EH 4MBRA 2F5AH 2XQBL 1WA1X 1ZSXA 3NQ8A 4KFPA 1A64A 2O93L 4CMMB 2D03H 4UOW0 2ICWI 4BQ4A 3CU7A 4R7DB 4WR3A 4EANA 4B9GA 5JXEA 4W9DC 4GRWE 1REQA 3P3BA 2FTPA 2OJ1A 3P67A 2QFPA 3FT2B 3UTPD 5LCVL 3KPMB 2QPFA 3VWJB 2R0LL 1NFAA 1ZLWH 4X6DA 3IGSA 3PWNA 3MCOA 5DZPA 3M07A 3R8GA 5I0VA 1G7QA 1Z3NA 3BEVA 1L6GA 4PZVA 4H40A 4G7RB 4N0YH 5J6HA 5BZWB 1FWIC 1WXJA 2X4UB 3F83A 4PRHA 3RE0A 5AW3B 1LLZA 3TNMA 1SY6L 1UKTA 1E56A 4AH7A 1HJUA 2CO1A 4PJXE 4TVPH 4WNSA 1OTUC 4HTBA 3CO8A 3W7OA 5DFVC 4QHLA 3FJNA 3NOYA 3C5QA 4UT7L 5LA2A 4QRPB 3ZE2B 4GUQA 4U1NA 1E4KC 2J20A 2YRBA 3G5VA 3VPLA 2XNAA 3RF9A 3PPCA 1WV2A 4OD3H 3L3KA 1JNHA 1GAFH 3DK0A 3ITVA 4WIQA 4TVPD 3DDFA 5MP6H 3O3BB 4RDQG 3GSOA 4NZTL 1FFPB 1BSIA 3R89A 3PGDA 3S4TA 3HV9A 1I8MA 3GSQA 4HKXB 4UQCA 1ORSB 4V1DD 5F1OB 2PTVA 1BXCA 1HH6A 5E24E 4UV4L 3PSWA 4KEZA 3SYQA 1UHVA 1LG2A 1AGFB 2Z2UA 2HMIC 2Y36L 3KBNA 3NYZA 2WJZA 2E7LC 2APTA 3N2OA 1I3RA 3IIZA 1IHIA 3NBNA 3AS3A 1FCGA 1EV2E 3R12A 1YY8B 1EO7A 3TV3L 4I90A 4RBPK 5ESQA 4MNQD 2X6AA 2O5XL 2X4TB 3MO1A 1KXVA 1L9RA 3S9YA 1CVRA 4L5ZA 2YPVL 5JIMA 1KPUA 3IGXA 3BWZA 1KLGB 1AFSA 4HC1H 3MKKA 3BDYH 4PRPD 3KPRB 4UWMA 2ITFA 1KYOJ 2WUBH 5AEAA 4ONVA 4OIBA 1AIFA 2EEBA 1CIUA 5FYLD 3JRKA 1XX1A 4LVDA 5DJAA 1ZXKA 5GSRA 3CL6A 4H7VA 1KYDA 4JGDA 2VDPL 5AOUA 1KV8A 3D9AH 3S35L 2JF6A 4F2TA 1UR3M 2NQ3A 3C6SB 2OSLB 4PGZA 3GHSA 4NYYA 2QVMA 1AHMA 3RAJH 1PQZB 1JRBA 4ZXLA 4N9GB 1S39A 4IOIA 4OJAA 1QFWI 1NUFA 3RU8X 1X7QB 1J9QA 3RFZA 2LFEA 3DX9B 3QZMA 5E8PB 3TN3A 5K5YA 8RUCA 1M6JA 3HHSB 4GABA 3VAVA 3WKYA 5IVXF 2A3TA 3WO4B 5DJCA 3EWXA 4DH2A 1XLHA 3L5MA 1WV7T 5HGAA 4ODHL 3NYKA 5LBGA 1FYTB 3V6ZA 3R79A 4MWFB 4B95C 5B7MA 1D5IH 1LE9B 1QOXA 1YEFH 4PJ6A 4BGLA 4D0CA 4RE4A 1XI3A 3FU6A 4I85A 4ACZB 3CHCA 4AITA 1AGEB 2FKPA 2KDGA 4RIRA 1OGAA 4UTTC 1B3WA 4IFRA 5AYZA 2J66A 4KHTH 3OSVA 3PV7A 4AZGA 3VXME 1F1DA 2CJUH 1RZMA 5B8CB 1MW2A 3HBQA 1K8XA 5ACLA 1G94A 2IPFA 4Q9BA 3B56A 3ZKMC 4JZJC 1DLHB 4CD4A 4ZFZA 1XIEA 3VZXA 5LLIC 2I9UA 4GO9A 4LPCA 1YMYA 3M8OL 2ZA1A 5EBAA 4KRZA 3IWVA 2Q0ZX 3EDKA 4NIRA 4OR1A 1F1GA 3TN0A 1KCXA 1I1AD 1E0XA 1OB0A 3GFZA 1TLMA 2YRZA 1YNYA 2C1PA 3IXTB 2C9AA 3L1GA 5EOCH 3E49A 2PLTA 3O6AA 4PODA 1TFPA 2OL3H 1E5NA 1YEEH 1DUYA 2DKSA 2YD9A 2N56A 4CBZA 2YC1A 2NQZA 4OT1L 3TFBA 1PO9A 1MEXH 1EGJH 2DQFB 4YSUA 1TO5A 2E8ZA 3FUFA 1P7TB 1F42A 4QXWA 1FWGC 2Q02A 3PAOA 2GJJA 4M8QA 2DI9A 3ZFHA 1DQML 3V5DA 5K93A 2A9NL 2CBQA 1RSCA 5LBSL 2GLKA 3UAFA 2L0DA 5I17A 2Y8VA 5DMKB 3EPOA 2OXNA 3NJFA 4I0PC 4YWIA 1T7YA 1RMFH 1EWDA 1UJ3C 2CGRH 1L9WA 4Z6AT 3LXUX 1HKIA 4DWHA 3V0GA 4V11A 2EVJA 3O3DA 4Q8WA 2ZRYA 2C6QA 4OBTA 5C07E 3I3DA 3GDRA 2CW6A 4AX6A 3E3QE 4XPFH 3UETA 1IFHH 2Y3NA 1U3ZA 3PGCB 3Q37A 3DJSA 1MLCB 4FJZA 4HQVA 3GKZA 2A85A 1M3IA 4GMTL 3QQDB 3N25A 4AF0B 3T3MB 4N2MA 4WZHA 4W7UA 3FEMA 4FFZA 4WI5A 4DKAA 6TIMA 2XHNA 3KCWA 3CUPB 5IB1B 3EH4B 2A0LD 3VFUB 1QNZH 2YBVA 2VEMA 1J9TA 3TW7A 2QGBA 1XZWA 1A9EA 1XKJA 3PWVA 2XV6B 3KYAA 5HQLA 1QOQA 1IR2A 1J79A 5BO1H 3HBPA 4PAZA 5G4MA 2ESVB 4X6EB 4XCYB 1GS6X 4RNIA 1QFEA 3SE8H 4Z0BL 3SDXE 3SGDH 4YJ5A 4FFYA 1QEWB 3TSDA 1RSFA 5JMRA 4CU8A 1MKFA 1CXIA 3RWIB 4KS0A 4XP1H 4E42A 3GRGA 4E36A 4LS1A 1NICA 1A6AA 1NGPL 1M7DB 4KKRA 2C13A 5J3HC 3W26A 1NL0L 3RX2A 3HQPA 1D2PA 4HKZB 1VD6A 3WLOA 3ESOA 4XN5A 3TWAA 4XUYA 1S3TC 3TYFA 3IDYB 2WLNA 1F61A 1M9HA 3MV9A 3N40P 1JDCA 4OM0H 5KSVB 1YMMD 3OGVA 5GNZA 2V67A 4AZCA 1E9QA 1YDOA 4UXDA 2AL2B 4ZW8A 4CSZA 3KLHD 1AW2A 3ATEA 5LGXA 2CXKA 3BUIA 3O45B 2OMWB 3MS8A 4NENB 1GVIA 3P4OB 3T0DA 1M41A 5IVXE 1IJNA 5I5MA 5EULV 1A3ZA 3GGWA 1MCQA 2QDHA 5EU3B 3RX5A 4MYWB 2D7TL 3HN3A 1GTHA 3UEZA 1E4KA 4G6FD 1U4FA 3FFOA 3DGDA 4MJHA 3DX5A 3CPGA 2V3DA 1PVNA 3FFCD 3DMMC 1RHCA 2I56A 1IKOP 3E1F1 3Q6GH 3LCIA 1KN2L 2XV2A 4FALA 2HBVA 4F8LA 1HYSC 2WBJA 1RZKL 2DM7A 3VYPA 1S7RB 1A7RL 1CDJA 3UPRA 1AJ0A 2A21A 4DUXA 2IGLA 4X6CE 1YMHA 1ZLVH 3TK7A 1MI5D 3NJIA 4WTQA 1QRNA 5AALA 2IPUK 2NVAA 1A6VH 5C2XA 1DXEA 1B6UA 2W9DL 5E9NA 3ILPB 2UXFA 4KVNL 1QLEH 3W7HA 1ZTXL 3PFRA 4Z3JA 1F11A 3V4PH 1P48A 2PO6D 3D50A 3EDEA 1ODZA 4R83A 1O5KA 1Q9LB 5ERWB 2VITB 4WENB 3NH7H 3TS8A 1PSKL 3ARED 3PWUA 3AXMA 4GQ0A 2V9TA 2W62A 4GQQA 2QJJA 4AXNA 2QVKA 2AVFA 3N73A 1BFTA 3FO1B 2H3BA 5F9WC 4S0TD 5INDB 3ABOA 1NOAA 4REQB 1A8ZA 1KGWA 5KYUB 4I77L 2PD5A 4ES8A 3BDXA 5HHVH 3W1LA 1IGFH 1F8TL 3IPEA 5AVNA 4AGQA 3ULUE 1NC2A 3LA4A 4HGKC 3DX6B 4YTRA 1CF8L 5I6LA 3JT0A 3BDBA 4CN4A 1P84K 2XWTB 4Q9RL 3QUGA 4ELDA 4Z3TA 1VRXA 4LAUA 4I3RL 2PZ0A 3DO3A 4RMTA 5A6MA 3AXHA 2AC0A 4QGYA 1Z41A 4X61A 3HAEA 4O5LL 1GZGA 1W3HA 1K85A 3NABL 5HHOB 3L7FA 2Z29A 4XXWC 4D0BA 3CTTA 1X4YA 3B83A 1FG2A 4N2NA 3HZVB 2DYSB 2GUOB 4AD4A 2CDEA 2PE4A 5KJ4A 1PY0A 3ZIYA 5F89B 4L8BA 4BFOA 1BZDA 3VWJD 3GXTA 2DDXA 3UR8A 3KPSB 1ONWA 3G1DA 4ZW3A 2YEZA 4WFGE 1P4IL 4LLWB 4M56A 4DP4X 4M29A 3SCPA 2OS7A 3CQFA 3GRWH 2NRDA 1H6TA 2IPGA 4CKVX 2WV3A 4HIEA 1YRKA 4YC2B 5MENA 4F2ME 1RHHB 4UTTA 3S1WA 2G2RB 4AJ0A 4YS1A 4M3HA 32C2B 4NZJA 1RIVL 1WAAE 4AVJA 1A6ZB 2XY2A 4Z7UF 4NQXB 2XFXB 5I2IB 3SBRA 1YPIA 3F3HA 2NZIA 5TQ2L 1WH0A 1XDLA 4GKNA 4KZDL 2VMDA 5T1DL 3KYMB 1ME7A 1ZPUA 3R13A 2WSKA 4QRPD 3OGCA 2J7HA 4MRBA 1VRDA 1NMBL 3I74A 2AJSH 4RESB 1F0LA 4JZJA 4BZYA 3PJXA 1EPVA 1HKKA 4HUNB 4LRIC 4XTIA 4NM4L 1OLLA 3W7KA 1A5LC 3L9EA 3IEAA 4LVAA 1H8NA 3ZT6A 5GJSL 1UZ8B 3KLLA 2BVTA 2YB4A 2DOCA 5HJBA 2DJSA 1C08B 2E27H 3TO2B 4JDVB 2BB0A 2BO0A 2GGEA 2XIQA 1H0DA 3T40A 1YEKL 4NAFB 1QFPA 4UQ3B 3SKJH 4GH3A 3HZ3A 3B40A 2AL1A 2YD8A 2L3BA 5C08E 1VBJA 1U2YA 2IGFH 4WUUB 4YX2L 1WHPA 3K8MA 1M05A 4RGNC 4E9TA 1UTDA 3FMGL 3QDGA 3RDKA 1GMEA 1CG9B 4IDJH 3NEVA 3N06B 3MODH 3Q5OA 3KPRD 3QIBA 4I0PA 3VXSA 2BPBA 2VCOA 3OLEA 4HUCA 2C9PA 4JG1L 1MUJB 4JFEE 3UJFA 1LCOA 5F9OL 1O5RA 1F73A 4B3VA 1JWUB 3ZSTA 2G96A 2WLMA 4U6HA 2J13A 1HHHB 3CFEB 1DANT 3H8NA 3W1UA 1YA5A 2Y6TE 3NCMA 1SJEB 2FUQA 4FMKA 3HMCA 5KUMA 3V7MA 1KBVA 1QBAA 3URNA 3P30L 1VA9A 2E9JA 2F1AA 3CU2A 1ZSDA 5EN2