4M56A

The structure of wild-type mall from bacillus subtilis
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
559
structure length
555
Chain Sequence
EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYEKFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGSIFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIGSISKYTDFPDYETRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFEHMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAKAFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHARTPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQENDPQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQRADLKSISLKPYEAVMGISI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Change in heat capacity for enzyme catalysis determines temperature dependence of enzyme catalyzed rates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase 1
total genus 221
structure length 555
sequence length 559
chains with identical sequence B
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2013-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4m56A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4m56A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 4m56A02
4FNPA 1FP9A 1UH3A 1TQTA 3A4AA 1KXTA 5HPOA 1QI0A 5KZ6A 1X6LA 3OLIA 4JKMA 4CVWA 1AQ0A 2GJPA 4XZBA 1JZ3A 3BVTA 1CYGA 3QR3A 5D9OA 1QNQA 3RDKA 5A1AA 1CXFA 2WVTA 1QI5A 1GOMA 1V6WA 2EO7A 1CXEA 1NWSA 5I77A 5E70A 2E4TA 4Q7NA 2W63A 2DT3A 1J0YA 2J8FA 2BY3A 1XRVA 1ITCA 4W85A 4TOQA 4U31A 1QW9A 1WNOA 3B9AA 1Y7VA 2WYSA 1KXVA 1UR1A 3AMDA 3FNDA 4E8CA 3VU2A 2J7BA 1JL8A 3PZNA 3QOKA 1US2A 4AZIA 3VTRA 3FW6A 4JHOA 2PWEA 6TAAA 4BQ3A 3N13A 5CSUA 1VENA 1UD5A 4N42A 1OGGA 4UFIA 2GFTA 4GIAA 3GXNA 2OW6A 1GOIA 1UZ4A 1R87A 2A3AA 1UUQA 1TQVA 3O2LA 2PWGA 4PMDA 1QBAA 4JKLA 4DWSD 3II1A 3AMGA 2VVSA 4B16A 3WDIA 5IFTA 3PZMA 2FYVA 2GJXA 2E9MA 3AMCA 4U3CA 1XD0A 3WY3A 4XB3A 5I23A 3JUGA 2QMJA 1LWHA 3ALFA 5FL1A 1BF2A 3MUIA 3D52A 3I3BA 1ESWA 1HX0A 3AS3A 4OIFA 2IUZA 2FE0A 4FMVA 3MV11 3CO4A 1VRXA 3BGAA 1E5NA 3W37A 2ZXQA 1B3VA 4MB5A 4HOXA 2GK1B 1I75A 1V08A 1XHGA 1GONA 1JF5A 3CIVA 3VMNA 1KCKA 3SUVA 3NIYA 3H54A 4P7QA 4W7VA 3ARSA 1DWGM 2BY2A 1MFVA 5LYRA 2BY0A 4BQ4A 6CGTA 3WF3A 4MDPA 4TX6A 1BAGA 3QHNA 2YKKA 5JIPA 3L4XA 3O9NA 1LWJA 4OBSA 3HZ3A 2DGAA 1HJWA 3M6DA 1WAWA 4R27A 4ZXOA 2FH6A 3M7SA 1B31A 1CXIA 2UY4A 1XC6A 2NSXA 1V3KA 4JCMA 3SCUA 3FAWA 1E71M 1H0GA 3K8KA 3VD9A 1XSIA 3AI0A 3A24A 3SIMA 3OGSA 2A3EA 1Q6GA 2XJ7A 1IV8A 3VD5A 2XVNA 2QHAA 3WUEA 2WLZA 3WFZA 2DSZA 1SFSA 1W9DM 1C7TA 5A3HA 2GJXB 3KE0A 2VX6A 3VGEA 4NRRA 2JIWA 2EPNA 4HZ8A 4AD0A 3D4ZA 2WMJA 5JUVA 3CUHA 1J11A 2DT2A 1NM9A 2EACA 1QW8A 2F1AA 3BUQA 3VVGA 3DX1A 1HP4A 4GPNA 1QHPA 4ZEPA 4B9YA 4E2OA 4NF7A 2O9OA 5JIWA 3PBGA 2OSYA 1FP8A 4LYQA 4L4PA 3UESA 3EBVA 1VFFA 1E6NA 2XFRA 1UR0A 3AS0A 1BVZA 5BXRA 2W67A 2OYKA 3UERA 3CHCA 4A4AA 2G3MA 1FFRA 1MW3A 2VCCA 1L0PA 3O6AA 3TOPA 3T0DA 3ARPA 3BAIA 3WDHA 4JFWA 1KCLA 1PX3A 1J01A 1TFVA 2EXOA 1TA3B 3UG3A 2ZUUA 3GXTA 3WNLA 1H1NA 2Z1SA 3A23A 4FLRA 4WF7A 4EKJA 1DEDA 5C71A 4M82A 4P8WA 1JZ7A 4ZE5A 2ZX6A 4OJYA 5A8MA 1UR8A 5A8NA 4WK9A 2V3FA 3ARWA 2W5FA 3WQVA 3L4TA 4GZEA 4U2YA 1JD9A 2WXDM 4FLSA 4HOWA 3MUAA 2BS9A 3VGGA 1L8NA 2CYGA 3W28A 1GPFA 3WL0A 2OWWA 3ZJ7A 1JZ2A 3F5LA 4S3KA 3T09A 4D6CA 1K6AA 3EJRA 4FNTA 1KWKA 4HMDA 1TQUA 5A69A 3WN6A 4Z2JA 3SCVA 1GOOA 2VUYA 1LQ0A 2CKRA 1UR4A 1NWRA 1UD6A 2EPMX 3VMPA 3AMLA 2J7CA 3AHZA 3DYMA 2BHYA 3WF4A 1OGBA 3F5JA 1ZL1A 3SEPA 2CHOA 4WIWA 4AZ6A 1IT0A 3VUPA 1GNXA 4UTFA 3CUGA 3ZR6A 4IUGA 1EOKA 1GHRA 1W2VA 3FHQA 1VJSA 3G6LA 5BROA 4CU6A 4GI9A 3GXIA 4EAMA 3U7VA 4DUWA 1E40A 1PX8A 4NX0A 3A4WA 3VM5A 3VSUA 1E6XM 3BUPA 4AD3A 3EDFA 2ZUTA 3WD1A 3CMJA 4AZ7A 5IXEA 2WZEA 1NH6A 4JHZA 3EMQA 4QLJA 1D2KA 2OSWA 2VZUA 5I78A 2ALWA 4CCEA 3CMGA 1V03A 3BAJA 2X09A 1VFUA 2DSVA 4PN2A 5LA1A 2WANA 4BCEA 3AYRA 1VBUA 2EADA 2E0PA 1C90A 2IGTA 2J77A 1RP8A 1TE1A 3HG2A 4L4OA 1W1PA 2J78A 1AQMA 2XVKA 1E6ZA 3EMCA 2V38A 1CTNA 5CLTA 1OCQA 1E0WA 1GZJA 2VX5A 3AIWA 3SCWA 4HMEA 1TA3A 2ZXAA 1E4MM 2EQDA 3BUDA 2EPKX 4IISA 1XH1A 3VD4A 5BCAA 4WSJA 1EIBA 4UFJA 1UH4A 2O9RA 1OSEA 3PZVA 1HNYA 3NUKA 4P7RA 1LLOA 4GO9A 1QHOA 3FN9A 3M46A 1ZJBA 4QLKA 2V5DA 2CPUA 2W61A 1GQLA 1BGAA 1ODZA 1K9FA 3VDBA 2GVYA 4CGTA 2J4GA 4JZ5A 3FAXA 2WMHA 2EABA 1H2JA 4MB1A 1W1VA 1ZBWA 3WEMA 1JGIA 2WLYA 4M24A 1BG4A 3LRLA 4UQDA 4AEEA 7TAAA 4UFKA 5CJ5A 1HKJA 4OOUA 5I2UA 1JYVA 2YDQA 1V3MA 2YL6A 1KQZA 2CBUA 1G0CA 1V0KA 4V28A 1JYNA 3ZT5A 3VSTA 1HVQA 4GZJA 3GH4A 3A5VA 3CZSA 2C7FA 3DHUA 2W62A 2VMFA 1CXLA 1TVNA 3MMUA 1V0MA 1JYWA 4W93A 1FFQA 4C7DA 1Q4NX 2WSKA 5CLWA 1JXJA 4CCCA 2Z1KA 5EFFA 1B3WA 3HG4A 2WHJA 2DT0A 4AYSA 3N12A 1RPKA 3VM7A 3NSNA 4ATDA 5CSYA 3DHPA 2X05A 5M03A 1GQKA 1ISWA 3WD4A 1CLVA 5GNZA 3AHVA 2WWDA 4MPKA 1BG9A 3PTQA 4CU8A 2DT1A 2G3IA 3W38A 2NW0A 1FOBA 2NT0A 1Q6CA 2CETA 3W81A 4MNLA 1UD8A 3WH9A 4NZJA 4CN4A 1J0HA 1P6WA 4HPHA 1R34A 2BHZA 3MO4A 5FKYA 1B90A 4P8XA 5CPSA 3GDBA 2ZX5A 3VIIA 1XCXA 2VVNA 2XPKA 4FNSA 3D5HA 2ZUSA 4MJ4A 3WBAA 1NARA 1KR1A 1QVBA 4PYSA 4GINA 3GXMA 1ISVA 3HJEA 2FDMA 3BLPX 2VOTA 3DX3A 1LG2A 1XGZA 2X0HA 4PTWA 2VQUA 4OZOA 1V3IA 1R46A 1U33A 3RM4A 1A47A 3PN8A 2YJQA 3WEZA 3T0AA 1NQ6A 2DDXA 1WZLA 1H11A 4WKHA 4BQ5A 4LXFA 3LPPA 5GPRA 1QI4A 3VIFA 1GW1A 2WMGA 4U5KA 3VIOA 5D4YA 4XV0A 5A6MA 4DUXA 2YL9A 1WZAA 2FHBA 4FNQA 4V2XA 3DX0A 3WF1A 2WHKA 2HISA 4TVCA 5DEZA 3WQ4A 4JFUA 3MSDA 1H3GA 1UWRA 4PTMA 3FY1A 2W4XA 2G41A 3EJPA 2AMGA 3WUFA 2J7FA 4OGZA 1LL7A 4W86A 1VFOA 3L4YA 2D0HA 1XSJA 4AW7A 4UFLA 4NXSA 1G9HA 2ZX8A 3AXHA 1UQZA 1V6YA 1H4PA 1OM0A 1WCGA 3CC1A 1UKOA 2ZUMA 3K4DA 3DYOA 5FCZA 3OG2A 2QLYA 4PSRA 3UG4A 1QOXA 4X0NA 2YFNA 4H04A 1Q6DA 5DF0A 1QBBA 4ATLA 2E8ZA 3N18A 5BXSA 1WDPA 4BF7A 4AZBA 3PZQA 3VDCA 3OLDA 4Z2LA 2XFFA 3AXXA 4F66A 1QNPA 4HA3A 4UR9A 3FXYA 4KGLA 2A3BA 4CUCA 3VNYA 1QWUA 2Y8VA 4RE3A 2GSJA 2EBNA 3DYPA 2D3NA 5A8QA 3ZJ6A 3UEQA 4WLCA 1UKTA 5AY7A 3H53A 4H8VA 3EDEA 1UR2A 2YLAA 4JL1A 1CLXA 3TONA 4N0RA 1SMAA 5BXPA 4AD5A 4IPNB 4RL3A 3W25A 3AROA 2GK1A 2ZX7A 2J25A 2XVGA 1XCWA 4M81A 3WDPP 1CGTA 2DH3A 2FH8A 5A6BA 5CPQA 1R7AA 1D3CA 2CERA 1PAMA 2VRQA 2ZICA 1NWTA 3GH5A 4PUDA 5AC4A 3N15A 3KLKA 3GM8A 4W8LA 3W4RA 1K9TA 1PZ3A 4H8UA 2WC3A 1JYXA 4PEEA 2Y8KA 1KXHA 4AZHA 2FGLA 2J7HA 1BYCA 4LYPA 1PPIA 1DWJM 2XN1A 3SUSA 4DO4A 3RILA 1XH0A 1ZBVA 3CH9A 4P7OA 1CBGA 3CZNA 1ISZA 2ZWZA 1BSIA 4HZ6A 4GI6A 4WKAA 2QPUA 3S5YA 5CQ1A 1JNDA 2YFOA 3WUGA 1DWHM 3AHXA 3GBDA 2VI0A 4AMCA 1V3HA 2ZX9A 4AZCB 1O6IA 3VGFA 3WMSA 2A3HA 2ZXDA 2WHLA 4HU8A 3VILA 3ARVA 3CUJA 1CGVA 4KWUA 3WMBA 3VX0A 5LA0A 3MMWA 7CGTA 1HIZA 3AIVA 3BC9A 3EJQA 4D1JA 5ABEA 1UWUA 3U5YA 1E0XA 4XUYA 2XUCA 4AD4A 1B3YA 3AOFA 7A3HA 5A6LA 2VR4A 2IXVA 4TX8A 1QPKA 2CITA 2CEQA 1KR0A 4P7LA 2J7EA 1DTUA 1EH9A 1MYRA 1EDTA 3WH6A 1RH9A 2F61A 4GI8A 1G94A 1HN1A 1LJYA 1M04A 1HTYA 1BFNA 1BYBA 1EHAA 3HG3A 4GKLA 3K8MA 2CESA 4FK9A 3VKKA 3EDDA 3CBWA 4ATWA 1JZ5A 3D3AA 1V0NA 1PIGA 1EQCA 4KRTA 1W9UA 2G3NA 5A6KA 4D6EA 4M1RA 4AZCA 1ECEA 1JDAA 2OWCA 3ARXA 2YA1A 1R85A 5HPCA 1KBBA 3N04A 1CGWA 5A2AA 2WM0A 3TTQA 1I1XA 4BS0A 3LXBA 3VGDA 1W2PA 4B3KA 2PF0A 5A94A 4AMWA 4F9DA 5I3DA 1YQ2A 1JAEA 3AHYA 4TTUA 5CG0A 4IM4A 2WVVB 9CGTA 1E3XA 4UQ9A 1N82A 1WE5A 5IHSA 3OLGA 5AC5A 1UYQA 1ISYA 1C93A 4AYGA 1TQWA 2VRJA 4YN5A 5HDRA 1WB0A 3BVUA 1ISXA 3TTSA 3SCSA 1IZKA 3ZT6A 1XD1A 4TVUA 3IAQA 3RM8A 3T2QA 4HA4A 1B1YA 1NOWA 4M80A 5CZKA 3AXIA 2F8QA 3WENA 4UNIA 1OGSA 3CUFA 3MV01 2V3DA 3BXWA 4EE9A 4MTVA 3AZSA 3UETA 1UA3A 5E6ZA 2XM1A 5AYBA 2YL5A 3UR8A 1CENA 3VIMA 1B0IA 4HPGA 3EMZA 3TV8A 5HOSA 1FH8A 1QNSA 4B15A 3BCFA 3UCQA 1DWIM 2V5CA 4J3VA 5D9NA 4C7GA 3GBEA 3GXFA 1HJSA 4GZIA 1B30A 2B31A 2CCRA 1KWGA 2CHNA 2D20A 3VIGA 1V3JA 3FHAA 2D2OA 2F1BA 3CUIA 4QLLA 1C91A 3L4VA 4FF5A 4A3HA 2VQTA 4QCEA 3RM9A 5FIPA 1FHLA 3BCDA 2VC9A 1I1WA 4M29A 1UKSA 1J9YA 5E09A 4CD6A 2VJXA 4NRSA 2Y5EA 1PX4A 2V3EA 3WDRA 3CLWA 3DDGA 2WMKA 3NCOA 1KTCA 3DDFA 3CZLA 2WMFA 3N17A 1UD2A 1EXPA 2WVVA 1ZU8A 2G4FA 4X9YA 1DWAM 4QAWA 3W6MA 2VZVA 4MB4A 5DMYA 4DWSC 4MB3A 5DT5A 4UOQA 5JBEA 3BLKA 1VBRA 5GNYA 3QHMA 3TP4A 2YIHA 4EK7A 2ZUVA 3NSXA 4PBGA 3BH4A 2XGIA 4M56A 1GOQA 3WQ5A 3EDKA 4NI3A 3IJ8A 4E8DA 1B2YA 5CGTA 2XSAA 4U33A 1US3A 1KQYA 2DIJA 1GQJA 3U5UA 2XG9A 3MUY1 4UZSA 2YA2A 1WKYA 1MQPA 5M5DA 1FA2A 4PTXA 4QFUA 2WKGA 2PI6A 3DECA 3N9KA 3K4AA 1ITXA 2EPLX 2C8NA 4J7RA 2XHYA 1ZB5A 2J75A 4CU7A 1UD4A 1E55A 4D72A 2Y24A 1JZ6A 2VO5A 3AISA 2WKLA 1W9BM 3GNRA 3VDAA 2QV4A 1V6VA 4UQAA 3K46A 1GHSA 2VZTA 5I5RA 3PZOA 1Z32X 4F79A 4MNKA 4ZFMA 3NDYA 4Z2KA 5D9MA 1VFMA 5A6SA 2GDVA 2YOCA 1XYFA 2F7OA 1GOWA 4U3AA 4UZUA 1UKPA 2CIPA 3BUBA 1EQPA 1CEOA 1DWFM 3VX1A 3M07A 3L2LA 4FLOA 4HTYA 1W32A 2DPEA 3EYPA 4GQRA 5BXTA 4W8AA 4J3SA 2V3GA 4Z2HA 2E8YA 5E0FA 4ML4A 4W88A 4ZXLA 3N1AA 2BVTA 2BHUA 1V02A 1QI3A 1HKIA 5A8PA 2D73A 3LX9A 3AIQA 1S46A 3ZO9A 3THDA 1UR9A 5I24A 3WF0A 3WELA 1BPLB 1JDDA 5C8BB 5E6YA 5FD0A 6A3HA 2OW7A 2VURA 1KFWA 4UQBA 3BVXA 2BVYA 1JFHA 1V02E 3WD3A 1SMDA 2ESCA 3WKZA 4PCSA 3PZTA 1RP9A 3U57A 4YHEA 2UY2A 1HKMA 1OD8A 2WZHA 4PTVA 1H49A 4NZCA 4P8UA 4J3TA 3WDQA 3CGTA 1M7XA 1MVYA 1G1YA 1QNOA 1TR1A 4ACYA 3ARRA 1R86A 2VL4A 4UFMA 1HJXA 5BYWA 3CTTA 2WVUA 3S2CA 3NJ3A 2D0FA 2BV9A 3WEOA 1BTCA 3UR7A 1R33A 1B9ZA 3KL5A 1O7DC 2QF8A 1HT6A 5M3WA 3EJSA 3ARYA 1VEPA 4AIOA 3LXAA 1E4LA 2A3CA 1EGZA 3MSGA 4DO6A 3DX2A 4V27A 5IFPA 1UQYA 4CCDA 3AFBA 1DHKA 1V6UA 2UY3A 3PTMA 1BQCA 5I0DA 1JZ4A 1EO5A 1V6XA 2WMIA 1PJ9A 4AZ5A 4MADA 1XH2A 4W8BA 4LGXA 1JIBA 5D8WA 3T0BA 3A47A 1QWNA 4CD4A 4ZENA 3MKKA 1TQSA 3WY1A 1MXDA 3VMOA 3LRMA 1NWUA 1IZJA 2CBIA 4XX6A 3CHEA 3PZ9A 1EO7A 1OWQA 3VSVA 4KMQA 3WY2A 2WWCA 3GNOA 1TVPA 2X2HA 1VJZA 4TTGA 1G01A 1EHNA 3VDHA 4J27A 1OB0A 4JIEA 3KL0A 3WH5A 1CXHA 2JFEX 3MUZ1 1E43A 1J10A 1VEMA 2ZUNA 1GJWA 3MU7A 5TD4A 1HL9A 1CNVA 3WQ8A 4GO8A 2X2YA 3T2OA 1CXKA 2JALA 1WZMA 1OBAA 3WD2A 3NSMA 1U30A 2D3LA 1GUVA 1OIFA 3OIHA 1EOMA 1WDQA 2MANA 1H09A 3GZAA 4PCTA 4NSBA 2FGZA 1UZ1A 2DSKA 4JCLA 1JXKA 1HP5A 5AYIA 3WF2A 5A6BD 3AIUA 4TVDA 2GDUA 1TUXA 4DUVA 2ZWYA 1JG9A 2EPOA 2GJRA 2EEXA 1J12A 2HVMA 3AS2A 4J3UA 5GNXA 1OT1A 3F5KA 2JEPA 2D24A 3GYCA 3KEHA 4OBRA 1UKQA 1BYAA 3ARQA 2D1ZA 4H41A 3VOCA 4QCFA 4UQCA 5BRQA 2OLHA 2O9PA 3H55A 4HZ7A 4E4PA 4F9JA 4MNJA 5HXMA 2YDSA 2D0GA 2YA0A 1HXKA 2WC7A 1KGUA 3KWXA 1BGGA 3W24A 1MFUA 5ABFB 5GQBA 1CGYA 4Z2GA 3ZQ9A 1HWWA 1A3HA 2OYMA 4RE4A 4DWSB 3S6TA 1E9LA 2GUYA 2EAEA 2VR5A 3PTKA 3IGUA 4PMXA 4LQ1A 2E9LA 1WZKA 3APGA 1CGXA 2DH2A 3SURA 1M03A 4JFVA 1OIMA 4MNMA 1KGWA 1WDRA 2WCGA 4KGJA 4UFHA 4OOZA 3CHFA 4P8VA 2VX4A 3KZSA 3MANA 3LPOA 5IHRA 1DP0A 3F4VA 1LL4A 1C8XA 3ZT7A 1VIWA 3TTYA 5FOOA 5EMYA 3CZEA 4AIEA 2VZOA 3PHAA 3BAXA 1JI1A 2JF6A 3BVVA 2PBOA 4W89A 2XN2A 4YHGA 3G6MA 1ODUA 1W3HA 4CN1A 4PMRA 4AD2A 2J74A 4AISA 3L4UA 3AMKA 1AQHA 1EA9C 1GQIA 2J47A 1NOUA 4W5UA 2JEQA 1E6RA 2ZE0A 2DQXA 3WFLA 4NZFA 2XSBA 4W5ZA 2Y2WA 1QNRA 2UWFA 1GCYA 3L4ZA 3AYSA 5E9AA 1OD0A 4ACZA 2X8RA 4S3JA 1W9PA 1GJUA 2BY1A 4PMVA 3HN3A 3WSUA 3ZR5A 3SCPA 3CHDA 2XIIA 4AZGA 3LRKA 1SZNA 1WDSA 3ZSTA 2BXYA 3VIKA 3MMDA 2O9TA 2XIBA 1TZ7A 3CZJA 4LYRA 4MAZA 1C8YA 3WNMA 3UG5A 2W91A 2EJ1A 2XVPA 3POHA 3ALGA 1VAHA 5KEZA 2YL8A 5EB8A 4AMXA 3OZPA 3BSHA 1ZBCA 1H5VA 2WNWA 3RJYA 3D4YA 1PBGA 5A95A 3J7HA 2ZXBA 1JF6A 1FH7A 2PWDA 5C70A 3VIJA 4Q22A 4JL2A 4MDOA 2VCAA 3BAKA 4AY1A 3VINA 4QP0A 3ZMRA 4Y7EA 2OYLA 2D23A 4PUEA 4XZWA 3HU7A 1W3KA 3SUWA 3VD3A 1CPUA 2CXGA 2X2JA 3A22A 3BSGA 1JAKA 4H7VA 4LX4A 4NXKA 3L2MA 1ZJAA 3B9EA 3WD0A 3POCA 1Q6FA 4F8XA 1J0JA 1W9VA 4MJ2A 2CNCA 4K68A 1X1NA 3CV5A 1J18A 3MS8A 4UOJA 1V0LA 3VO0A 5ECUA 1UD3A 2DEPA 4DWSA 1UA7A 4FNRA 4HU0A 1MWOA 3VGBA 1E72M 1E56A 1JNEA 3IK2A 1MW0A 3BAYA 2BNJA 4UQEA 2O92A 1QHZA 1E73M 3WBEA 2X2IA 1CWYA 3AIRA 3WDJA 3ARZA 2PB1A 3SCQA 2WSPA 4U5IA 3CZ8A 2J7DA 1XV8A 1C3FA 3IJ7A 4OUEA 4JFTA 3LPFA 2WBKA 3B9DA 1XYZA 4AC1X 1UASA 3IANA 2QPSA 1R8LA 4W7WA 3RIKA 3ZOAA 2XN0A 1LL6A 4D6GA 1RD6A 3WQ6A 2X1IA 8CGTA 1TG7A 4D6JA 1J0KA 3DC0A 1JD7A 4D71A 3WY4A 4KRUA 3ZSSA 1CDGA 5A6AA 5E1QA 4B9ZA 1VB9A 3TA9A 3AICA 4CD8A 3AZTA 1E15A 4TUFA 5LA2A 1W3LA 2BXZA 2AAAA 1D7FA 2PBGA 5JBFA 3QOMA 1E4IA 1WP6A 4PMOA 3T2PA 1MQQA 4UCFA 1HXJA 2OWXA 1OT2A 1QX1A 2WK2A 3SCTA 4J3WA 3HMCA 3WL1A 3EJUA 4AXNA 2XWDA 1OINA 3IAPA 3QHOA 3SCOA 1FH9A 3BLBA 2XM2A 2JIEA 1O7AA 5A2BA 2CBVA 3I3EA 1J0ZA 2J8GA 2QMKA 1E6PA 3U7BA 3CZGA 1GOKA 5CPTA 1MW1A 5DT7A 1YHTA 3W0KA 2FHCA 4WSKA 2VRKA 3MI6A 1MW2A 3OA5A 4AEFA 4A3YA 2VNCA 5D8ZA 1W1TA 2F7QA 1UG6A 2J79A 3RCNA 1VEOA 3AIBA 2VT0A 3RMEA 1PZ2A 2WVSA 4YPJA 4CD5A 2G3JA 1HJQA 1H41A 5HBFA 3WH7A 3A3HA 2WW5A 3WIJA 2WHMA 2VCBA 4J3XA 3OB8A 3D50A 3AS1A 3WNPA 4OKDA 2DSUA 3ARTA 3BMWA 4D6IA 1KBKA 2F7PA 2X0YA 1M53A 4D1IA 3THCA 4ACZB 4M8UA 1B3ZA 3NYDA 3A21A 3LMYA 1BYDA 1UWSA 1ZBKA 1B3XA 2VTFA 1E70M 2E3ZA 3SUUA 4DM2A 1HJUA 4GXPA 5DFAA 2BVDA 2G8ZA 1CGUA 5EBAA 4U2ZA 1HVXA 4W7UA 1AVAA 3K1DA 1UWTA 3T08A 3AZRA 3SUTA 2J7GA 1PIFA 4HOZA 1UWQA 1J0IA 4BA0A 4R5EA 4QDMA 3IJ9A 4KH2A 3DX4A 4HA1A 3VIHA 4LPCA 1JI2A 3OLEA 3WNNA 3WUBA 5I6SA 1C7SA 3W26A 1E6QM 1H0IA 4AD1A 1Q6EA 4CVUA 5A6JA 3QGVA 1E6SM 2WBGA 3W29A 2ZUWA 5IDIA 3TTOA 3OBAA 1K9DA 2WB5A 1W91A 1NP0A 1E0VA 2J62A 1GVIA 4W84A 3W27A 3ZIZA 4DM1A 3SCNA 5CGMA 4W87A 3BUIA 1CECA 5FL0A 2YBTA 4AWEA 4HMCA 3KLLA 2WZIA 4J28A 3LXCA 1TMQA 1HKKA 2W66A 5DO8A 5HNNA 1HL8A 4JKKA 3OGVA 1UH2A 3GXPA 3E1F1 2XFYA 4D6DA 1C8QA 1XSKA 1C92A 3PZUA 3AIEA 2RGLA 4MAVA 5ABHA 2DIEA 2FHFA 3GNPA 5BWFA 5CXPA 3AQUA 2PWFA 1W9XA 1U2YA 4PSPA 4C7FA 4PMUA 1UOKA 4CKQA 5EFDA 4PMNA 3AHTA 1QI2A 4B3LA 3GTNA 2F2HA 2YDRA 5JBDA 3K8LA 2ZOXA 1SYTA 1BLIA 1R7OA 2XYLA 3ECQA 5E0CA 3CZKA 2XVLA 2PC8A 4TXEA 2BFGA 3VGHA 2ZIDA 1WO2A 3AJ7A 3HG5A 3GH7A 1PEZA 3EJTA 2AOSA 4JAWA 3BMVA 3WQWA 1BHGA 3N11A 2Q8XA 2YBUA 2XGBA 1JDCA 1V3LA 4ZE4A 3L4WA 2DSWA 4BZYA 1W3JA 3KL3A 4PRWA 3PZGA 3A6OA 4RE2A 4EANA 2IXUA 2WCSA 1JZ8A 1JFXA 3GXDA 1SR0A 5BRPA 4GQQA 1MXGA 3EDJA 2WC4A 1GORA 1BVNP 4URIA 1X6NA 1CIUA 5F7UA 2F18A 1NP2A 1KB3A 3S5ZA 2OSXA 2D22A 5A8OA 1W1YA 3ARUA 1EDGA 1FHDA 3D51A 1EDQA 2WPGA 3NDZA 3WH8A 4PMZA 2TAAA 4X0VA 2E9BA 3PZIA 3RJXA 3WMCA 4D6FA 3OGRA 3A4XA 3WNOA 2XWEA 5M17A 4WJXA 1KTBA 1R75A 2W92A 4P7NA 1T0OA 1E1EA 2JF7A 3VNZA 3VPLA 3ZJ8A 4CN6A 4UOZA 1LG1A 2YLLA 3LPGA 1UWIA 4JFSA 3VD7A 1AMYA 1E3ZA 2CBJA 5D9PA 2PWHA 8A3HA 4HP5A 1G5AA 2NT1A 1HJVA 2WCAA 4FNUA 1F4AA 3I3DA 2RGMA 1R47A 1E5JA 2Y4SA 2VZSA 5ABGA 4PMYA 1CZ1A 2E40A 1UHVA 3W53A 4H8HA 3VIPA 4H2CA 1PS3A 1NOFA 1GVYA 3CPUA 1TCMA 2UY5A 2WMIB 3SCRA 3ZM8A 4BQ2A 4CD7A 1VF8A 1HF6A 3BVWA 3WNKA 2WAGA 3W6LA 1KXQA 3ZJKA 1E4NA 2JE8A 4FLQA 5ABFA 1ZS2A 4Z2IA 1KGXA 2VX7A 4D6HA 4AIUA 1E1FA 3BAWA 3RPMA 5I79A 4WKFA 4PMQA 2CKSA 2C0HA 3W82A 1MQRA 1LF1A 1WPCA 3RO8A 2XTKA 1M01A 3OZOA 2F7RA 4DO5A 5A2CA 1F4HA 4IPLA 1K9EA 3B8SA
chains in the Genus database with same CATH superfamily
1LK2A 1RJYA 4CC4C 1CLCA 1JK9B 2L0DA 5CUSH 2ZWKA 3QEGL 1AMKA 1B0GA 3OYZA 4W4OC 3HF3A 5GGSA 5HPOA 1QI0A 3RY6C 1KULA 4JFQB 4BRVA 5AD0A 2Y23A 1MCNA 5IMLB 4JTFA 4LS0A 2P44B 2CJTA 2EUXA 1VRDA 3O2DL 4Q6XA 2ZTBA 3KYKH 5D1QE 5I6LA 3SGDI 1G7JA 15C8H 3RUGA 1GG1A 4YS1A 2CGRH 1BWVA 5DT1L 1JZ3A 4Y9MA 5C0CA 3CMFA 1LD9A 1ND0A 4AM0Q 5TQ2L 1QNQA 3QYQA 5IP4A 1F3DH 2Z64C 4LSRL 3S36H 3UO8B 1RCQA 3NZGA 2NY3D 1D5ZA 3M7OA 1QOQA 3GAKA 3IJEB 3QKZA 1CXEA 3NVQA 2E27H 3D3VD 2D31A 3CHPA 3ES6B 5I77A 4GY1A 4Y2WA 3UIYA 1I8MB 5DRCA 2IAMB 1M7JA 1DCEA 2DT3A 1J0YA 2I14A 2W63A 2J8FA 4MLJA 3IE4A 3S4SA 4F9JA 1VQTA 4HBQA 1WIOA 1DLFL 4QRQB 4Z7WF 2L7EA 3NAAL 3VNLA 3UPMA 2ZRVA 4URTB 3V36A 4Y5XA 3GMQA 2OT0A 4LCCA 3LCYA 4QR7A 3QJZA 4XUGA 1ASOA 3VU2A 1KBGH 4E8CA 2APFA 4GBXD 3PZNA 1UOWA 3S0PA 1A5KC 3QOKA 1ZE3C 3BYYA 3UR5A 5HSFA 4OHQA 4U1HA 3UACA 3G8RA 3W7NA 3RDTC 2BLFA 2Z1VA 1QWHA 1KRBC 5JORB 3FW6A 1OW0A 2VWEC 3D25A 4FHJA 1AW1A 5BO0D 1V8EA 1NINA 2H3NA 4JHOA 4PV8B 4UB0H 3Q06A 3BK0A 4O52A 4LB4A 3ZKSD 4WDXA 1NDMA 3FCTA 4Y9BA 1VENA 1FCQA 4Y4FB 3TAKA 4N8CH 3V5HA 1OYAA 4MNGE 1IQWL 3LKSA 6ENLA 4YIQA 2QJNA 5DQDL 5CR1A 1GOIA 4HWEL 3BKYH 3BZFA 3E6FA 2KT6A 1JEZA 4IXHA 2WSDA 1G6RA 5GJPA 3BIKA 4O12A 2VN6A 2H8PA 3RIAK 2A3TA 3R89A 1QBAA 5AB2A 4KNQA 4F37K 3RXZA 3AWEA 1AIZA 3UTSE 1DJQA 1E0TA 1KIRA 1DKWA 3LQGA 4EO5A 4DWSD 5J5RA 1WEJL 5D7JB 2CLHA 1RK5A 3OMZA 5HVHC 4PU2A 1HEZA 3O8XA 4XPTL 3VC6A 3W7LA 4AHPA 2OQYA 3MJ6A 3N5AA 4FN0A 3MPCA 4ZJ9A 1YEYA 1EA0A 3T40A 5FPIA 3QG7L 2ZTJA 2ZCZA 3BGFC 1K8IB 4JFZH 3TXZA 3AXLB 3S7GA 3HQ1A 2AEPL 4XB3A 1WDWA 2XXFA 2ATPB 4QKTA 5FXCH 2FVKA 1SXZA 4DBUA 1FZMB 4LSTL 4JFEB 1MRQA 5H1WA 3ATFA 3CN0A 4EVNA 1LWHA 3S98A 4RMTA 1GZGA 3MUIA 2XSXA 1A4KA 4NO0D 1ESWA 2NYYD 3UDWC 3AS3A 1H7XA 4XKMA 2ZCKH 5DZAA 3GDMA 1IIIA 1ZANL 1E9QA 1RV6X 1E9QB 1S2AA 5DUBA 4Q8WA 4WDTA 3MV11 4QEGA 3MRBB 4KKLC 5SWQA 3TWCL 3CO4A 3RK8A 3ETBJ 5AAPA 1E5NA 1QW7A 4FL4C 4CVZA 1B3VA 4MB5A 2CW6A 4OF7A 1Q8JA 1RJRA 2GK1B 5I1KH 2MCPH 3WLQA 3HC0B 1V08A 1KZQA 1XHGA 4F2UA 3HMJG 4YNGA 3DENA 3TW9A 3O6FD 2WQWA 1GAFH 4KJPC 4TQ8A 5EOCL 4O11A 3VMNA 4ELME 3BP7A 2P5WE 1XLHA 4DJFA 1KB5H 4QSFA 5EEVA 3W1AA 5BW6A 4K8RC 5AEAA 1DWGM 3WQOA 1HZYA 4FHAA 1R3QA 5LYRA 2B4GA 1OK0A 3RAJH 3COOA 3O8XB 2QHRL 3WF3A 1PLCA 3W7IA 4MDPA 5K1VA 1BAGA 1HKVA 1XLAA 2X7WA 4UQ2A 3QHNA 4WI4A 1IGML 1QR4A 5DEGA 3WD5L 1UJPA 2NQHA 5LSMA 2X1TA 4F2BA 3MV7D 1FYHB 4MFHA 3SKJL 4B41A 4HPOH 2OMVA 4GPVA 5D7KE 3RURA 3LGEA 4DJED 5L9FA 3NRPA 1C12A 2JELL 4R27A 1NMCB 3X14A 1LRQA 4ENLA 1GTHA 1Z9LA 1CCZA 3ZKMC 1JZIA 4CNTA 5DMMA 1KBLA 2WUBH 4ZMYA 4M5YL 3NSJA 1HKLL 1L7TL 4NQEE 5ENWA 1DQXA 4JO2H 1CXIA 2CBMA 3WAJA 3FKRA 3LQZB 1U3HD 1BXBA 2C91A 4JCMA 3ZDYE 5SWZD 3FAWA 1E71M 3IUIA 4H9TA 3K8KA 3SN1A 5DHYA 3BZ4A 2NXYD 2R0LH 4GG6B 2XJ7A 2KHAA 2OR7A 1YDPA 1FVEB 4WI6A 5DMGC 3I75B 2AJUH 4P2QD 3HFFA 1TO5A 5GGUB 3V0WH 3ITTA 5D71H 5BJTB 2AAVA 4K3JH 3AABA 4IJ3B 3ZIMA 2FX7H 3VH8B 1IO4C 3GR7A 1QFOA 5C7ZA 4F2MB 1A50A 2CLZA 3TIEB 4MJMA 2DSZA 3WBYA 5C2XA 5AVHA 1XINA 4Z7QE 5BVPH 3U2EA 1JPGA 4KROB 4V11A 3SE3A 1BEYL 4BXSV 4BGDA 4YK4B 1ONWA 2N4IA 4LUTA 5C0GB 1C7TA 1IGIL 3QQXA 2GJXB 3VGEA 1T1XB 3ES6A 1XF2A 3PDOA 2GEQA 1K7EA 3B8WA 2DWTA 4L48A 1X5GA 1O5PA 4KDWA 4WGWB 2DLEA 3D4ZA 5E6IC 4BEIA 4CVXB 1SVBA 2YUVA 2EKJA 2Z8RA 4BK5A 4CLMA 3ARGD 3GSQA 1A02N 1AHMA 2VLKB 5CEXA 1WWCA 4A6YL 2WLHA 3X14B 9PCYA 1G7JB 2V9UA 4JTKA 4ZNEA 1ZK5A 4BM7A 1E4XI 2DJUA 2WZPA 4AEIL 1HAUA 5E23A 3DDMA 4GQ0A 3DX1A 4HTBA 5TAOA 2DWEA 3UU0A 1UM4L 1N64H 4I87A 5EWIH 5EDSA 2A7PA 3RX3A 4GPNA 1WAEA 3VZXA 2MH4A 3KGTA 1OANA 3PXLA 4NSKA 5B7MA 2ODIA 1OFRA 5TBOA 2OTDA 2XZAH 4EN3C 1QK2A 3PBGA 2YS4A 2CDGB 2Z8WC 1GMEA 4L4PA 1OPOA 5B1AB 1MF2L 5IJBC 4IPJA 2CLRB 3UADA 4ZB0A 4YU1A 2PW1A 4O4WA 3EBVA 4WHBA 4G83A 3SECA 2BSTA 1C1EL 4F7EB 2XFRA 2GJZA 1FWAC 1NWPA 2I17A 3EYVB 3W1NA 4KK8C 5BXRA 2PCFA 5JZ7D 1GOHA 2IF7A 2QDVA 4N2NA 2OYKA 3UERA 2QGYA 1Z7AA 6XIMA 5HWMA 3ORWA 4TULH 4A4AA 5T5FA 3FKUS 2APVA 1MW3A 1N6UA 3SKOB 5D2NA 3IGHX 2BNQA 3BQ5A 3O6AA 1QZ1A 3TOPA 2BNRE 2AXFB 1DJIA 2BIIA 1Q6LA 1V7MH 3ARPA 1T7ZA 3S88L 3H26A 3ATEA 3BAIA 1KT2B 4PUBL 3VXSA 5DA4A 1M6OA 2E7HA 1KCLA 4L0ZA 4CADB 3RI5K 3L23A 3M0MA 2OMWB 5D2LF 4Q4RA 1MREH 1PX3A 2Q0ZX 1LUCB 1TFVA 2ACRA 5J8LA 3MRLB 3TYZA 4M3KB 2ZUUA 1V27A 1I4NA 3WNLA 5MEPB 1RZJL 1KCSL 2MKLC 4HJGB 3ETBF 4WWKD 3RKPA 4N28A 2ICWI 4ZS6D 4EUPG 5IROC 4JFEA 3ZE2E 1F1AA 2NQ3A 3VA2C 3ZYJA 2QJHA 3ESVF 4P8WA 3BW2A 2DEYX 1UUMA 1CLYH 4P5KA 4HYVA 4HCRA 3PVFA 3WLKX 3W2LA 3HCVB 3FTUA 4GGBA 5A8NA 3NEHA 3MTWA 5F1VA 4X8JA 1XS2A 4WK9A 2V3FA 2B15A 4C1KA 3RUGE 4B2DD 4NP4H 5DFVD 4K73A 5IROA 2QDWA 1ETJA 1AH0A 2O7SA 5I74B 2GQAA 2CO2A 3U83A 1GZPB 2CHXA 3NSYA 4NP4L 2QIWA 5GRJL 3C5ZC 1WFIA 4H1LA 5C0NC 3PG2A 4FLSA 1YLVA 1KIRB 1ZQ5A 2GTWB 4BFOA 2DM7A 2CJ3A 2O5ZL 4C57C 5FOBB 1HC1A 1N2RB 2CR6A 1AQKH 4HHAB 5CBAB 3GC2A 5C3IA 3W28A 4X8CA 3NPUA 2FO1A 2NWRA 3ZIYA 5MP6H 4Y1AE 2RTTA 3E9UA 3VKAA 1OQXA 4IUOA 3TJLA 1GMIA 4UMGA 3MVIA 3F5LA 2V17L 5AW9B 4XTDA 2QPEB 3LZFL 3EEGA 1F42A 3EJJX 4P5UA 2NY5L 4H8PA 3X3GH 1XG3A 1OKEA 2W3ZA 1UZHA 1KYDA 1XQ4A 1P4BL 2ITDA 4HHWA 4NPYB 1ZLDA 3DBXA 2C6QA 1MFMA 2V7HB 5AW5B 3OZMA 3BH8B 1UR3M 2CKRA 2GABA 1UR4A 5H37H 4PJIE 3WN5B 3CWGA 4OLWL 1BF8A 3CC5A 3BLLA 5JMRA 1MJ7H 1QJWA 3V4PL 3Q1SH 3W85A 2BHYA 3IJDA 3WF4A 3SEPA 2WXQA 3CVIL 2CJUH 3LEYH 4POZC 5HJLA 5F3BB 2UYLA 1M1BA 1PJWA 3NJVA 3EH2A 4UAOC 1ZT4A 2AEOA 3LEYL 4FQHB 4UM8B 4PW4A 2CJSA 5D5MF 3RTQB 4IUGA 2D31B 2NX3A 2KLRA 3HPFA 3GXIA 2WQSA 3PGFH 3KNBB 1OY0A 5C0AA 3BLFA 1GZQB 1TV4A 1PX8A 4XWOC 1S7TA 3GDTA 1ZE3H 3QJUB 2YD9A 3VM5A 4QRSA 1KRCC 1WCQA 4XT1C 2YZ5A 2P28B 2ENPA 3ABKB 4MASA 4JAMA 3VA6A 5E6IA 4CAGA 5GGRY 5T33L 2XYCA 1ML1A 4RDYA 4RUBA 5HQMA 3CH0A 4AZ7A 5GGSB 2OTPA 1B0GB 1PDZA 2OB3A 2WZEA 1FIGL 4JHZA 4AXKA 5E9XA 1NBZB 3EMQA 3IKKA 4KZDL 3IPBA 3B9VA 2OSWA 3DRTA 5DQDH 4B5ZA 5I1DB 2EG8A 5I78A 4FQXB 4LKCA 1MIML 2B8OT 2VRAA 2RHEA 3GJEA 4KHXH 3ZX1A 3CQKA 4WI2A 4YN3A 4F7PA 5B1CA 5F7WC 5C0RL 4C6KA 3P0YH 3S6OA 2X09A 1V03A 2R2BA 2QSCL 1VFUA 1BZ7A 2JJUA 2OQLA 4GAGL 2BSBA 4HX1B 3TJEL 2K70A 5BZAA 4Q9QL 3E3QE 3EO1A 5T5NF 1RK1A 4LK4A 5AAMC 1S2TA 1XPGA 4M1CC 4JY9A 3TU9A 3Q44A 3CQHA 3P67A 4EE2A 5F0MB 3HN8A 1RUSA 4FTVE 1FGNH 1W1PA 1EAJA 4WEMB 3GTTA 5AZ2H 2YYUA 4PCFA 1LP9E 2PO6B 5J4MA 5IB5A 4XAWL 3WN5A 2XKNA 3W2JA 4MDIB 1T7WA 3PWAA 5IHLB 3SZ8A 3VI3E 4RX0A 3SDAA 4EN3A 2O56A 1KIPA 1T0NA 2Q8BL 4PJXE 3KRBA 4RDWA 2VXQA 3PB0A 1E4MM 3DHDA 1UMYA 3O6DA 5ICYA 1A65A 3RJQB 2Z6FA 3EGDA 4KI5D 5KVMC 4IISA 1S5HA 1Z9SA 1JPMA 2OMAA 4WSJA 1MH5A 2VFHA 4HKXB 5CJQH 3ARFD 5HYSB 2VSDA 1TEGA 4MMWA 1HNYA 5FWQA 4G9DB 5ANME 2IQAA 1I1AB 3QJXA 1HJBC 3PF2A 1LLOA 3DEQA 1A6AA 4MQXD 4Z7VA 1WUFA 1UQSB 3VKJA 3M46A 4OQ1A 4YDLC 2OCJA 1E6JL 3FTWA 3QEGH 4WNSA 1Z9PA 4YR6B 4LS2A 1NCUA 4N2KA 1QNZH 4V1DD 3EKLA 2N1KA 1DL7H 4M7JL 1TYGA 1BGAA 1ODZA 1S2CA 1IGJB 2WXOA 1QSZA 4FG6D 3ATYA 5AENA 1QNVA 3N2BA 2GVYA 3LKOB 4CGTA 2V8ZA 1AKJB 4IP4A 4WCJA 4DYEA 3I50H 3Q5OA 3DJSA 1RAMA 2LV4A 4DYJA 2GQHA 2RCSH 4KCTA 1JGIA 3QUHA 3RAOA 2V2XA 3NL6A 5FV1L 5CCGE 5CJ5A 3E74A 1NLBH 1OJXA 4GUQA 4KRPD 4P48A 3AFLA 1JYVA 2YK1L 4ICWA 3QVQA 5C08E 5LG1A 2X6CA 1EYWA 4GG9A 2WLMA 1V8HA 4FL4B 4XNUL 1G0CA 3T71A 4V28A 1G9NC 2WAHA 5LCVA 4L2LA 4NBYB 1JYNA 3QEQA 3PS6A 3LH8A 3LZLA 4P4KA 5AZEL 2CM5A 4XNYL 4DJFD 1OAXL 1HVQA 3M45A 2K7QA 1U41A 3T0XA 3A5VA 2F54D 3CZSA 2C7FA 1ZLUH 3GH4A 3TFBA 3HLAA 4BK4A 2GPZA 2PP9A 1PZCA 1WBJA 3V0VA 2HQAA 3M43A 3URNA 5F7BA 3ZKXB 3TO4C 5F9DC 4GXMA 3W9DB 5T3XE 5FJPA 1OSPH 4P59H 3MLXL 3QORA 1JYWA 4ZYKA 3N9SA 4S3DA 3SPIA 1O5XA 5CZXD 3SPVB 5KUKA 1BG1A 3RPKA 4C7DA 2IS7A 1OFDA 1DVQA 1KV7A 1EZLA 2E68A 3TYFB 5CLWA 5JDSB 4FDWA 2PDQA 5EFFA 4KVNH 4M5ZL 3HG4A 1LLWA 2R1PA 2PW2A 2KDGA 3FT1A 2WHJA 1LNUA 4XGZA 2Z7WA 2REQB 5T1LA 3IDGA 2UZXA 2ZKYA 3EYVA 5ADPL 1I2PA 2AI0H 4JY4B 3F12A 1NF0A 2ATSA 4XNAA 1ETA1 5FACA 1RPKA 3VM7A 2NX5E 2B9AA 3MC0A 4HPYL 3FT3A 1TLKA 4V2CB 4GMEA 3DHPA 2B7PA 5HUOA 2J5LC 5DURD 3HNVH 1H6FA 1JGDB 1X4ZA 2E1WA 2Q09A 3QNYA 3H7RA 4GB9A 1XAKA 1PY0A 4ALAL 4S1SL 2W80C 1M7DA 2WWDA 3SJ3A 1E8YA 1RULH 4HLEA 4CMMA 1FRBA 5IBTH 1W16A 1WOBA 1KV5A 5I5JA 1HZHL 2XVBA 3HZMB 1NTDA 3PQYE 5JR1L 1MXSA 3QORD 1YVLA 3IM1A 1YMMA 1A6TA 2FL5B 1G69A 3TNNA 3TNOA 3AREC 5CZ0A 1FOBA 4IJ3C 2AGTA 4RNIA 2PEVA 1ED3A 2Z93B 4UMAA 3MLZL 3PABA 2NT0A 4WDUA 3S3SA 3GSQB 2UXGA 1EX1A 2ZVIA 2F5AL 5KYWA 2CETA 2QKSA 3WL9A 4KROC 5KSBB 4HGWA 1VACA 1XL6A 4S1QL 4CN4A 3X11B 2GDQA 5BQDA 3QV8A 1GYNA 3BQVA 4PJXB 3C8KB 4XMKL 4HPHA 1KM4A 4JTSA 2M8XA 3CH8A 1T3FA 3ISYA 4NFBA 1YG9A 3BW9A 1M3JA 4JZJC 5CPSA 4G70B 2IVFC 1M5WA 1OFAA 3U2JA 1E5UI 1DIOA 2GZXA 1G6VK 2UX6A 4QT5B 4D2NA 3P4LA 4ZPTA 3RFZA 2VVNA 4HK5A 1ZVNA 3TR2A 3WU1A 2XINA 4MJ4A 1Z3GL 3P30H 4HISA 1HGWA 2RHGA 2IH8A 1FVEA 1I85C 2C1GA 1B0WA 3VC5A 3DIFB 1KR1A 2EDHA 4IBZA 4Q4KA 1QR7A 4QHLA 1NCTA 2F9BT 3P3UA 3PWJB 5DHYB 5FGRA 2FDMA 3BLPX 3DX3A 2NW3A 1EHXA 1NCDL 1SO6A 2J8UB 4X2RA 1GW0A 2VQUA 1F6FB 4JBSA 5EA0H 5BRBA 3QEUA 2YXGA 3SPJA 3TBVA 2BP0A 2B20A 1AD4A 4PTTA 3KWVA 4J1UA 4OV5A 1IBHA 1A47A 5EBLB 1UP0A 1TJXA 5CSZB 5C8JB 4J1OA 5D72H 3VXGA 1GSMA 4P23B 3T0AA 1Z2KA 2EH7L 1NQ6A 1Z5YD 2KZHA 4OF6A 2V0TA 1H11A 4PQXA 2QPXA 2FJHB 2VD9A 2OMVB 2QZ5A 3ARDD 4KKAD 3VIFA 3VXUD 3ABXA 1KPUA 3A6CH 4X83A 4E2VA 1GXEA 3LAFA 2VDNB 4ODVL 3FQYA 1DPMA 2HRLA 4Y19A 5D4YA 3IU4L 5I0ZA 1BX2B 5F8RC 3ISRA 1Q4WA 5DS1A 2AEQL 5DQ9B 4FNQA 5IB1A 2EDDA 1U4FA 5DMIH 3DX0A 3OKMB 1UZDA 1RZMA 4AUJA 4ANKA 3A6BL 2H3KA 4S3CA 4H20L 4R97C 7TIMA 1F02I 1UWXK 4LARL 2EO9A 1LDSA 4YYFA 5IBUB 3B56A 3FRPG 3C2FA 1WC7A 4HJ0C 4JG1L 4LYKA 4KJWC 3LG3A 2G5WA 3NYZA 4E9WA 4IGNA 1E8XA 1OE1A 2O6CA 3EFDH 4XMWA 1ZEAH 2LT9A 4IGBD 3XIMA 3V35A 4ETQB 5B38A 3ULVD 3WUFA 3GRIA 1AZZC 1IM9B 4DGWC 1LL7A 1VFOA 5AVUB 4JNYA 2NSQA 4X9HA 4XVDA 2GJ6D 3TN0C 1N7MH 4PN6A 1MFNA 5F1KC 1V6TA 4XD5A 2VDHA 5KG9B 1XSJA 4AW7A 3INUH 1L6FA 4JGMA 3HC2A 4OLVH 5F9JA 1TKKA 4XRCB 4G5ZL 4H9MA 3WFEH 3KBFA 3V9EA 3EA1A 2R1MA 1TCRA 2VJ0A 2J66A 2FMNA 3R6IA 4J3OH 3LCWA 4PJGB 3J27A 3C5ZB 1C16A 1HHGA 3HEIB 5KSWA 3TN0A 1BECA 2DZXA 1XF3B 2Z7YA 4ZB5A 4QAIA 2COVD 4JRYA 3OG4B 1G7IB 2QLYA 3KXFE 4PSRA 1QOXA 5KSVB 3MUXA 2C9QA 3CFDA 4P3CL 5DJXB 1O94A 3PQYB 4HAKA 3NXFA 1A5SA 3TPUA 3EX1A 4RXGA 2ADGA 3OPUA 4NHUA 5DF0A 3P77B 4I5RA 4MS6A 5IG7B 1GKRA 2R0KH 4HJTA 2K6ZA 2IALB 1N7KA 2NV2A 1GKEA 3HS0A 2GUOB 3ML9A 3T4YA 2NLYA 4K7YA 4O1AA 4BF7A 4AZBA 1A0CA 1XRFA 5HTSA 4XBMA 3PZQA 3QUYD 1X39A 3AXXA 4LAKA 4PS4H 1WUEA 5B38G 5GSRA 2YC1A 1QNPA 2Y1AA 5FUCE 3F03K 4I9TA 1TYRA 2X89D 4ADIA 1DVUA 1K8YA 1UZ6F 1GW9A 5EZLA 3DI2B 5EEZA 2GSJA 3MRIB 2ZOWA 2WNNA 1Q9OB 2PF6A 2D3NA 2NX1A 1G7QA 5F1NA 2OLDA 2O6EA 3UO1L 1VLWA 1FG2A 3UTSA 1JV5A 1OTUD 4OZHF 1I8IA 3UEQA 4BQBA 2NX5D 3CUPA 4UAOB 1GC1C 2JB6A 1UBPC 4IOTA 5HDBE 1FFTB 3RTQC 4EMZA 3QR2A 4YXLL 5BUAA 4E0CA 3TONA 1G4SA 3EG9A 2ZYHA 3QULB 3CMOH 1SMAA 1Z1WA 1FNSL 1FZKA 1KV3A 4XP5H 2DUZA 3VFWA 3W2MA 5HMFA 1NSNH 3ZTCC 1ZALA 3WIFA 3CSPA 1GOXA 2WYTA 4MZ1A 4PRBA 1FSKB 5CJBA 4MA7L 4TSAH 4F24A 3G77A 3P4MA 4MNHB 2XQ0A 4UT6L 4XAYA 5IM51 1FCCA 2YUZA 4KWWA 4KWSA 2XVGA 4M1GL 4A35A 2KLTA 1KJVB 1XQLA 2YEQA 5JO5B 1U8PA 2FH8A 2VR9A 2Y1ZA 1IC4H 5I1KL 1QFEA 3M0JA 1INDL 5CPQA 1D3CA 3BFOA 4QHPA 4FB7A 1CQKA 1JCMP 3KOYA 3KVDD 2PS2A 2CBPA 4PUDA 5D1QA 1W6TA 4MYPA 3V1HA 5AB9A 5I3FA 4KTDH 4W8LA 4FXJA 5E1IA 1RSFA 2E9GA 2WC3A 1JYXA 2IC2A 2OKTA 5CZSA 4DP0X 1B54A 2Y8KA 4PVLA 4XN4A 5AYQA 1EEQA 4S0SD 4BWTA 2AL2A 3IEBA 3WJYA 1UXSA 3T6WA 1MHEB 2J5WA 4Q4EA 2BW4A 2J7HA 1PPIA 3CS2A 5E5UB 2GKIA 3QXBA 3ILPB 2UXTA 5KBNC 4HWBA 4HIIA 2AL1A 2Q8ZA 3SUSA 1T66C 1QYGH 4IMEA 4MVAA 1TTIA 1EEPA 5I1AB 5HR7A 2P5WB 1PS9A 4FRWA 3RILA 5KZEA 3CH9A 2A73A 4PRHB 2R1KA 4Y6GA 1RVGA 2V5MA 4AE1A 4DBWA 3IVKA 1T5XB 5AWNL 2YD7A 1FYTD 2OBGA 4G9FB 2FIKB 1D9KA 4JHUA 3L95A 2RDWA 5ECVA 1TCRB 4V1YA 3O2VH 3C2EA 4M8QA 3MVTA 5CQ1A 4LF2A 1JNDA 5DZJA 2YFOA 3AHXA 5CMAB 3RGVD 2E5CA 5IQMA 1P4UA 1QPPA 1X5AA 5AOZA 2YSWA 1KLYA 1QOKA 1JK8B 4QG9A 4X9SA 1IFHL 2Q2EB 5G2WA 1I7ZB 4W1TA 4OZGB 4HFWB 4H01A 1SPDA 4QE1A 3IETA 4AV5A 1AC6A 4ZUSA 3G18A 3O6CA 5EC1A 4A04A 1TJ1A 4YTUA 5FYKD 3QQDA 4N0CD 6PAZA 3KJ4B 2YPVH 4Q6JA 4MRBA 3VX0A 3MMWA 1RUQL 1EF2A 1S5VA 5JHAA 4YDLB 5K9OA 1NVMA 3BC9A 3AIVA 2DM3A 4YPGB 4YWGH 4LSQL 4R7DB 1G9NL 5IJCC 5ABEA 4NI6A 1JXGA 3N44B 1IGIH 3WIHA 1SPQA 4X2PA 1D9KB 4DXVA 4MXVE 5MEQB 2XUCA 4JTUA 3CN3A 5SWSE 3HQOA 1B3YA 2YPLB 4JREC 1XLBA 2VR4A 1ALDA 7A3HA 3QIUB 3L1FA 3P4OA 4Q33A 2WZPD 1WCBA 2DMBA 1CGSL 2WGXA 2LU4A 2PWVA 3LZ3A 1WAAA 1ZHBA 1HCVA 2XN9D 4G5AA 5E9DA 1KR0A 2QJIA 4ZQRA 2VGLM 1DLHA 4JTCA 3WE6B 1EH9A 1G1KA 2QUMA 3T2NH 1VPOL 3IT8D 1MHEA 1AGCA 1D5BA 2B14A 5EC2A 1IWPA 1N0XH 3KZ8A 2F61A 4LVDA 4GI8A 3ONCA 1G94A 3U1PA 2F54A 4G9PA 2Z7UA 3BOVA 2D7MA 2HFEB 2C7UA 1HTYA 4PWGA 3FB7B 1H7OA 1ZK9A 4PTTB 1BYBA 5F4SA 2BP0B 2TMDA 1N55A 4U1MA 5LGJA 1CB4A 1LWIA 1EEZA 1KGYE 4HBCL 4OD3L 4DVRL 2CESA 5H2BB 5LQBH 4AWJC 3K2UH 4AG0A 1FZOB 2NW3B 3ZKXC 1DYSA 4EBQL 4ERSH 1P6CA 3CBWA 2LOEA 3LN9A 2YOAA 3D3AA 4QBXA 1L4IA 1FHGA 1V0NA 1P5UB 3KPPA 1W9UA 3OO2A 4KRTA 4LFHG 1V4YA 2BNQD 3NIFB 3NIGF 4R5VA 4FPSA 1AG6A 2IANA 4A37A 5IW6A 2H8ZA 4JTRA 5E08H 5PTDA 5F8QC 1AH1A 4YL2A 5A6KA 1T7YA 3CXDH 3RNQB 2MNJB 3TZVC 2INEA 4M1RA 4NT0A 3ML8A 2PO6D 1ECEA 2OWCA 4KJYB 3W7RA 3JT0A 2AP2A 5HYQA 1X5JA 1FA4A 3ARDB 4X80L 2ED7A 3R8QA 3TTQA 3T07A 1I1XA 3F2BA 4BS0A 4YL4A 3L3JA 4YS4A 5A16A 4JM2A 2H32A 4ZO8A 1GGTA 1I8IB 2RGSA 3ZL4H 2PF0A 4JBRA 1JHTA 3ESPA 4UT7H 3L5XH 5I3DA 1YQ2A 3H9SE 1JUEA 5L6UA 1LP9B 1S7VA 4K7PY 4XO9A 3NIDF 1JR1A 3AHYA 3FEQA 3GHBL 3B03A 2BNRB 4O13A 2WVVB 1BQSA 2R59A 4WKZA 2VDPH 3K5RA 1N82A 4MWAB 2WIIB 1WE5A 1WIPA 1QWKA 1CLYL 5KYNA 2XWXA 3RPTA 3MXWL 1UEYA 1Z9AA 1YNKL 1UYQA 4JGJA 1C93A 2QDGA 1GVOA 5LGKA 4YN5A 4GW4A 4ZNCD 1A3ZA 3QFEA 5DD1H 1L9MA 3B8YA 1WX0A 2P80D 3BVUA 4IIHA 3TTSA 4ATTA 2MTAA 3DGRA 1YNTA 4AQLA 1IZKA 1JHKH 1IAKB 3RIAF 3IMBA 4NHUB 3RWIB 3U46A 3GZKA 4JY4A 3UCRA 1MVUB 1SJHA 5E6RB 1FL3B 4A2DA 2KQNA 5F21B 4XPFL 5I71C 2V37A 3CUXA 4HA4A 2EYTA 1ZMYA 3CFDB 3N1QC 4M80A 4L18A 2X4OB 5F3FA 4J35A 2JK5A 4UNIA 4O10A 5I06A 1TEFA 4PY7B 3WTTA 3MV01 1X5MA 1HHGB 1NTHA 1REQB 1HNFA 4LCWB 4Y9CA 2OQHA 3AZSA 4O5LH 1BQLL 1HGYA 2C18A 2FFIA 3FHEA 2ZKWA 4FFYA 1GG0A 4KTGA 3G5ZB 5AYBA 4ODWA 5FSDC 4QRRB 3ZE0F 1D8CA 2ILLA 2QUNA 4Z5RA 1C08B 4L4MA 1EXGA 3UR8A 3PV6A 1D6EB 3VIMA 2FQIA 2BOEX 3M1CA 4KDVA 2HVKA 2X5PA 5T5FL 2B7DT 2J6XA 2JELH 2JI3A 4WQOA 3OZYA 4C6BA 1HYRC 3VUAA 3DO3A 2ZP0T 5F6IC 3QG6B 1DWIM 2V5CA 2XWRA 4B5TA 2ZKXA 4HPOL 4S3FA 2B4CC 2QVIA 2X1QA 3P4NB 2P80A 3EYFB 1FCGA 1JV2B 2AXWA 4P4KB 3FZUC 5I1CL 1UJ3C 2WZMA 3MCNA 1N3NA 2ZAHA 3AADB 3MGOA 2FJUB 4JRYE 4JN7A 3S5OA 3TA3A 4Q3MA 1WGVA 2H2SC 3EPOA 2ZRZA 2XZCH 3WX7A 4D9PA 1OAZL 2ODOA 4PW9A 4ICCX 3H8NA 2YGQA 3CQIA 3BZ5A 4KX7A 4JIRA 3X1FA 5I76A 3AAMA 1V3JA 3FHAA 3O6KH 3PHOB 2V33A 3CUIA 1VPYA 3LYEA 1JWMA 4G7VH 3L0NA 3NZHH 4UB9A 1Z42A 3R19A 4G8AC 1J4EA 2O0TA 5GJTL 2A85A 4ZNEE 1U42A 4QCEA 1YNTF 3E2QA 1SLVA 5KJ4A 3KBSA 5CR8A 3K6SB 1HOCB 3TPKA 3GRWL 3PP3K 4Q8PA 1FHLA 4MWAC 4J5NA 3VCLB 4NQ1A 1UQSA 3LNMA 3KLSA 1M2OA 4RRPA 1FWRA 3KXFB 4B5SA 4XVUD 2AZUA 1UKSA 5CSZA 5C8JA 2BNQE 1EGVA 1ZLUK 3NAVA 3RMJA 4NKIL 4GGHA 2GBTA 1FIEA 1O7DE 2E59A 5E09A 4CD6A 3WCYA 3NOEA 1T89A 4R26L 5AKQA 4JO3L 4DF0A 3GG8A 1NFPA 4YE4H 1E9YB 2X7LA 1OCNA 5K9QG 5J12C 3V6FA 3SJVE 1V51A 3WDRA 2FEDD 3QYSA 2ZPKL 4HJ1A 3WV0A 2WMKA 3LKRA 4PRHD 5CEZL 4GG8A 5CU9A 3CLEL 4HB7A 3U4FA 2XKNB 3QUZC 4FQXD 3NA4A 4ZFOA 4A66A 3N17A 3JV4A 2KPNA 1RZIB 1UD2A 4Z7QB 2NZ9C 3IDIA 1JXFA 5IBXA 4NG3A 3QLLA 3B4YA 1EXPA 4XVTL 1ZU8A 3NVTA 4X9YA 2WOYA 2P5NA 2V7NB 4QAWA 1NICA 4JLRB 3RB7A 4NWUL 3IFPA 4S39A 1XZ0B 5CAKA 1QPXA 3JVGA 2Y63A 3C8KA 5MEOA 1FYTB 1E4XL 2YLHA 3FO9B 1YN6B 4UOQA 4LSUH 1MEIA 3RX2A 3QHMA 4OI7A 3SD2A 3UROR 3ULAB 2EEAA 4UV7L 5L2JA 5KYWB 2HMIC 3CL8A 3V4PA 1MZYA 3C2AH 3HRZA 1O6VA 4XWUA 1ADQL 2W95A 4R2GC 3N29A 1JUKA 3OPZH 2F1EA 1LT8A 2R69H 3BLEA 5GZNA 3W0WE 2ZUVA 5GRYA 3NSXA 3W5NA 1PZUB 1BKHA 1ZTXE 2HFTA 2CLLA 2Z6JA 3DERA 3UG8A 1KGIA 2F6UA 4XVSH 3B7YA 1YW1A 3PNUA 4X9BA 4HIQA 1WZ1H 3LH2L 4NI3A 2G75A 1H8NA 1B2YA 3Q8AA 1UM6L 4JRLA 3OKOB 2ZOOA 4MXWH 4W68A 1X7IA 3QCTL 1DQQA 1E28B 5L4MA 2XACC 1U4EA 1KQYA 2P46B 3FB5A 5DTFB 3WUWG 5ERWA 1PHWA 1KCBA 4GE8A 4NKCA 3VKDA 4QRSB 3NJHA 1OAUH 5C0BA 4PB0H 1PYMA 5FWRA 3H7VA 2G37A 1WWAX 2UZXB 2YA2A 1A5OC 4ROQA 2CK2A 3ARGB 5CCKL 2EVGA 1WIUA 2AGJL 3RTQA 2WKGA 1W17A 2PI6A 4RSVA 4WO4A 3HPSA 4JXCA 3ZLQC 3G5VB 2XHYA 3RU8H 1ZB5A 4TUJB 4CU7A 5LXEA 2ADJB 1M68A 4MQ7B 4AEOA 2P3ZA 3QORB 4JPVL 3N41B 2ZOKB 3APCA 1PE1A 3C2RA 4D72A 3SSZA 4MJ6A 4IS6A 5DUPL 4EAEA 3BN9D 1JZ6A 4TVPD 1L9RA 1OP3K 1P9MA 2MSPA 4XPBL 3HMWL 1ZRQA 1FWCC 4LPYA 4NO0A 3GU2A 1W9BM 2X4NB 2WY3B 1H5BA 2Q76A 3GB7A 4FFVC 4U3XA 3DHFA 2QV4A 1V6VA 3BDXA 4DRSA 5I1CH 2X3BA 2QUUA 1BJ1J 2VZTA 4M9OA 4NJ9H 2VYRE 3IGXA 4OGQC 4F7MA 1NCIA 1T80A 4FP8L 4F79A 3TQ0A 4TQIA 5MP6L 3M9YA 5K59F 4J6RL 2HZGA 4DF1A 2WQVA 3H4FA 2G2NA 4LNRB 5D9MA 1PCKA 4O57A 3KLHD 2PYEB 1IT7A 2HPMA 5SX4I 4O4VA 2FK9A 2ZD0A 3EJZD 2VDGA 4EQ3A 1U8QA 2J73A 3O6ML 1JN6B 2NUYA 5LBVA 2AJVL 1N2RA 2F7OA 2WXIA 4HHAA 3VB9A 2CIPA 3D47A 4HLJA 4YHZL 1DWFM 1NBVL 2FCBA 3EOAA 3MA7B 1AXIB 2Z28A 3GK8H 4DY1A 2EIMB 2PDBA 4GQRA 1AP2A 1BOGA 4ZMVA 2VR7A 5EF1A 1VBJA 1KFJA 2VWSA 4YDVA 2HLAA 1W72B 3QWOA 5E0FA 4CBZA 3IDNA 5B39B 4WNQA 2O55A 3R4IA 1IYXA 4ML4A 2VDRB 4W88A 3Q2NA 1M9WA 4E0RB 4IBWA 1NCWH 2ZOLA 3RGVB 4NVTA 2GIYA 1V02A 3PAUA 4NNCA 3MODL 2AJUL 4D8PB 5IF0B 1R3JA 2M83A 3PP3H 3OF6D 3GIVB 4NC2B 1TTQA 1YEJH 4JX4A 4UDUB 3VRJA 3M5YA 4FG0A 1IARB 1S5HB 1Z9SB 1S46A 3T3MB 3THMH 3QPXL 3AIQA 4ZUUB 3DN5A 4HK7A 1WISA 3HUJA 1NBCA 1RLBA 1K8DB 3JV6A 4JE4B 1T0NB 5FYJD 3PL6A 5T1MA 3T8XA 1IM9D 4RRPM 5KVFH 5INCB 3WF0A 1VFBB 4YFDB 4CJ0A 5JXEA 2NUTA 4DP8X 2Z3FA 3GHBH 1FN4A 1J87A 1D9KC 5DJAA 3Q6FA 3ZKND 3GUGA 5E6YA 5KSAC 4NY2A 3QI9B 3TIMA 1TO4A 3I2CL 1ZY9A 2NNAB 3CZFB 5TE7H 4DK5A 2EC9T 3B8VA 1IVTA 3P3SA 2Z31C 3QXAA 1F5WA 3HE6C 1KFWA 3CFMA 3NCBB 3BVXA 3X12B 4A29A 3WD3A 4WUUA 1JQXA 2X16A 1KV8A 1OGAD 3SKOA 3WKZA 1IAMA 1VGKB 3INPA 3AALA 1TPVA 1RP9A 3II2A 5F9WC 5D1ZA 3EO1B 3ASOB 1HKMA 1CDJA 2YXWA 2ICWJ 3MREA 2CO7A 3OXRA 1DR9A 3R43A 1KM1A 4U4IA 3HUJE 4Y4KD 3RWDB 1XBYA 3SGGA 4DJDC 4P8UA 3CGTA 4K2SA 3KWUA 4EI5C 1U8LA 3CYJA 4X6FA 4HS6B 2Z4QA 3H2CA 3VZZA 4NPJA 1Q94B 4BKNA 1E4KC 4ACYA 3CAKA 1BREA 2DQCL 3ARRA 2GVJA 3VRLF 2PDGA 1R86A 2N0KA 4PODA 3WO8A 1ZVSB 3P7YA 1TZZA 1GSKA 1HESA 4UBDC 4FXKA 4LO9A 3W9ZA 4Y5VC 4NM4L 4KXZI 2FPVA 5EBUA 2GAZB 4P2QB 5DD5H 3WEOA 2FATL 1ZOXA 2YGPA 2V2TA 4DPQA 5I2IB 1EFXB 3KL5A 3AITA 2QF8A 2VLKA 4XCFH 2FDBP 3CV2A 3ARYA 2MCMA 3QEHB 3KG5A 4B27A 3QDHA 4WIQA 3VCCA 3MZTA 4UYPA 3EXLA 5GJSL 3U7AA 2FO4A 4TVPE 4W9IC 3O3AA 4V27A 3S5NA 4P9HC 4Y4KA 3C0QA 4HSNA 4PFEA 2Z91B 3MGAA 4KQ3H 1NQKA 1RK0A 5ILTL 3MNVB 3QRGL 4ODHL 3I6RA 5IFPA 1FLTX 3TIEA 2OMYB 4S3AA 3TIDA 3BD3A 1V6UA 2ACQA 2UY3A 5CEYA 3PTMA 1TNNA 3BPNB 1J1OL 1TVHB 2A6JB 1L3NA 4ODHH 3W56A 1F6YA 2C34A 3KDPB 3IJIA 1EEUA 1G5GA 3I75A 4NQUA 3P62A 3RYSA 1W3NA 3V4VH 4MADA 4PGEB 2V7HA 1HSBA 1D6VL 2VAJA 2NCMA 3DBXB 3O4LB 4HWZA 2VM8A 2YO3A 4OCRH 1BRLA 3BPLC 1XF5A 5BU6A 2EECA 2V17H 4G8TA 1JIBA 4JG0L 3MJ9H 1NGZB 3R1GL 3ZE1F 4MMXA 4LSQH 3SDCC 4E42A 1TQSA 3ENLA 2FX9H 4QDPA 5DX7A 2VLKD 3AWFA 4HV8A 1FXPA 5G2NA 2HS8A 1RUQH 3I4KA 3LRMA 1DE6A 2AQ2A 2QR0A 2VC2H 4YC2B 4DEUA 2CBIA 2HJKA 2JF1A 3NL2A 4F7TB 4DXKA 4ZFZA 3GMOA 5INDB 1J5IA 3GMLB 2UWEF 4Q14A 2F7FA 4KMQA 4W6XB 3BT0A 3M0YA 3TROA 1YECH 4RA0C 1XL4A 2NY1B 3MUHL 5DEGB 4AJVA 1S3HA 2WWCA 4R7NA 5HPMB 3FT2B 2RIKA 1XH3B 1GZPA 1VLXA 4TTGA 1QRND 4GAYB 3L5IA 1G01A 4JANB 4LAQL 4DNMA 1DJGA 1WGOA 5E94B 2J4WL 4J27A 3MBFA 1GPOH 2PRMA 2WTPA 5ISZA 5DJ8A 2BOCA 1IGCH 5AW7B 3TO4A 1E43A 3HCVA 4ZUWB 2PRLA 3Q94A 1VEMA 4UNVA 5E5MA 4ZW7A 1VYSX 4GKSB 5DZNA 1MLCA 2J8UF 2ZUNA 3GVGA 3MU7A 3CIXA 4YVVA 1U92A 3RITA 4PI0A 2WQPA 1WWWX 4NOFA 3S4SG 4PLNC 3O3DA 5TD4A 1CNVA 3EOSA 5D2NE 4N6RA 1YEIL 2XOTA 1CDBA 4JM0A 3T2OA 5MEPA 3VACA 5FECB 3SGDH 4W9EC 4HPYH 3L08A 1WZMA 3VWKA 2I9TB 1OBAA 2HRGA 3NSMA 3FXIC 3EIFA 4HQQH 2AK4D 4LOVA 1XRSA 4B4HA 3LEVH 3SKNB 1EC9A 1GUVA 4ABVA 4K2UL 2E5BA 4M7KL 5HYFA 4DZAA 1E2ZA 1WDQA 4AC4A 3ZTJG 5HHQA 5I1JL 5D2LA 4WGVB 2BSRA 2XFGB 3PDGA 4PCTA 3UGXA 4NSBA 1YEJL 2FJGB 1NCBH 2XV0A 2W60A 1PCSA 5FYKL 1JXKA 2BP3A 2Y1YA 2F2KA 3CK0L 2IKJA 1MCKA 3V6OE 4MA3A 3THQA 3AIUA 5A6BD 3EW3B 3ZHKA 2OPCA 5B21A 2NNRA 1TUXA 2ATPA 1KFEA 4K3DH 3OODA 3MP4A 3B7RL 1A2YA 2GJRA 2QVHA 1U8JB 1H62A 3FSOA 1A5FL 3M8OL 1J12A 2H6RA 5DYFA 1SM3H 3AS2A 1DVFC 1A3QA 1N8OE 2MKWA 4YZWA 3D0AA 1T96A 2OSLB 1QA9B 3MRNB 4WTZA 3F5KA 5DHVH 1I53A 3PTDA 4KFNA 4XD6A 5J12B 3GYCA 1TWSA 1DQDL 4GW5A 4MBOA 4OBRA 3LERA 3ARQA 4NZRL 4DELA 4EWND 3TSMA 4QCFA 2UY6A 3GINA 3C3NA 5BRQA 2XY1A 4R96B 4JRXA 1C5CH 2DWEB 1HJCA 2P88A 4L0PB 5C9JB 4NCC2 1RFDL 2H2PD 3QUZB 2YDSA 2F38A 4IMLB 1QYGL 2XN9B 4QYOA 4IRSA 1KJ2H 5MHSD 1FFNA 4DP1X 3C5SB 3NCOA 3MBWA 3PAVA 5LGYA 1W8GA 3O8XD 4H19A 2Z92A 4U1NA 1TTPA 4AU0A 5KSUA 4D8LA 1A3HA 2ZXCA 1R3KB 3PDOB 2Q86A 1T1WB 5I8KL 3WKYA 3GG1A 1UZ8B 3MJ8B 5EUOF 4M19A 1M6UA 4X9FA 5IT2H 1KYFA 3PTKA 3GSNL 1E5ZA 4LIQH 2GC4C 4XAPA 4PP1C 4O2FA 4APQA 3APGA 3DX8A 2HPIA 3MACH 2IQTA 2P48B 4FA6A 3VH8A 4FX6M 3QNXB 3FQWB 4PJHE 4XE0A 2YEVB 3D07A 4Q4QA 3BKJL 2F53D 4TPRH 1TWWA 5CJQL 2OV0A 5EUKA 4WWKB 4KGJA 5DWUL 3VTAA 3PBWA 1F58H 3RU6A 4RZCA 1NCNA 2A5HA 1J1PL 4QY8B 3MANA 3FJ4A 2Y62A 4U1GC 1I8MA 1E5AA 2C9VA 5B3JE 2FBJH 4FQLL 5IHRA 5LBSL 1EO8L 5EN2B 4F5CA 4X5QA 4UT6A 5F0PB 4ABQA 2JJVA 3PREA 3EFDL 1IEXA 5AZEH 1LL4A 1LT7A 3HG1E 3ZT7A 2B3RA 3IVTA 5FCZA 3B04A 3MHGA 1XGRA 3F7KA 4ZQKA 4NNXB 5DJZB 4ELKB 4ZXBA 3CV7A 4HNNA 2XN9A 3GT6A 1O66A 1IXPA 1OZTG 1EP1A 5HHOA 4X6BA 4DI9A 2ESVE 3VG9B 4AC2A 4AZ8B 1TQCC 3ESOA 1XIEA 1Y65A 2QZQA 2DFAA 3MCOA 1FFOB 3MCMA 4FO4A 2AEWA 1JI1A 4IIQA 4JFPB 4UQ2B 1ADOA 1EWDA 3BVVA 3QI9D 3R1GH 2QAFA 2BS8A 4CC1A 1W3HA 2GGGA 3HB3B 3OAWA 4HXAL 1VBGA 4M62L 1U93B 1SBSL 3HR5B 5DVMA 4AYMC 2J74A 3L4UA 1AQHA 2VLMD 4XVJL 2DI8A 3WJLA 3MRJB 1NMAH 3UBXA 2FJKA 2VEIA 1W0YT 3DUSA 3NESA 4TV3A 3VH8G 3APNA 3U79A 3WIIL 3A4DA 4Q4OA 4FQIL 5LAXA 1G67A 1A3XA 3O81A 1ZSHA 4I8DA 1HCZA 3D33A 2N7AA 3S96B 1ZXKA 2VERA 4PJDA 3HPXA 1SJEA 2CJUL 3VCRA 2H9GB 5FW7A 1Z6KA 2XSBA 3G1DA 1VCFA 4WGXA 5E8DL 4I1PA 1QNRA 2PTTB 5IK3B 1UP3A 4KITB 2QBWA 2OR9L 1KOAA 4N2BA 5E1AA 5C6PB 4Y4FD 3BZEB 3Q8FA 1F3TA 1HSAA 4NU7A 4I89A 1Q6RA 1FAIL 2ZP8A 4JHWH 3VSQA 4D8OA 1U5VA 4K3EH 1W9PA 3T3ME 4RK8A 4ILSA 4F92B 1QLEL 1OF6A 4OIIL 1INQA 5F7YC 3GDKA 1NIFA 3BGMA 3BO8B 2P3EA 3CHDA 4MLIA 4Q0XH 4WQ6A 4FG2A 5IQLA 2WINB 5KETA 4HNCA 5ANMA 5AZ2L 3VIKA 2FZBA 5HJYA 2O9TA 2XIBA 4C56E 3DAQA 1XTLA 4WJKB 3CZJA 5A6IA 4OV6F 2RD0A 4U3HA 1GGCH 1F4XH 3VFVB 3VE7A 1S2UA 1MELA 3CIQA 5E5MB 4ODXB 4X5LA 5BOPA 5EB8A 5AVYB 2UY7A 1NFIB 5H94B 1WV2A 3MMEB 3DUSB 4K1GA 1DJYA 3MRJA 3TH6A 1ZBCA 4KT2A 1DBBL 1OF0A 4Z95H 2V6HA 1IM3B 3D4YA 5JPNA 4EF9A 2AK4E 3VYOA 1TIUA 3W87A 4P9HH 1TPWA 1MEXL 5CKAA 3FONA 5KAQF 1I45A 4YJZL 1QNIA 1FDLL 3GSOA 2EVJA 1QBLL 3U4BH 5A95A 1HW6A 4JM4H 2GVLA 3KW3A 4DW2L 2H8PB 2MCG1 3BIKB 4TSBL 4XC1H 2VCAA 4GC4A 4ZFZB 2X1WL 1AFVH 3ASNB 4YFLI 3HI6H 4XVTH 2VDLB 4WI9A 5IBUG 3H2PA 4XC1L 3A5FA 1XGRB 4EI6B 1GHFL 4M5SA 5FYJL 4WUUD 4Y7EA 3BV4A 3Q0HA 4PUEA 4P5TD 2NQLA 3BUYA 4E42B 3UVAA 4JIIX 3FB8A 4BZ1H 1SXCA 4WTXA 4XP9L 2Y72A 4QYAA 2DJSA 3RPBA 4IJRA 1PL3A 3BWWA 1S9VB 2ICES 3MHFA 1B88A 5CPOA 2BOBA 1JWUB 1NFDB 3A22A 1WS7A 4PZVA 5F70A 4F8OA 1KYUA 2BK8A 2WYIA 3L2MA 2IDUA 1AXSB 1CR9L 3QJFA 4EI5B 5D05A 3DCPA 4F0MA 3NFPB 4IOSD 5F7KC 1Q6FA 1W9VA 3RZCA 2EKCA 4HQVA 3F7YB 2CNCA 1X1NA 4XVEA 5CC6A 4N2AA 2Q7NA 3T4AB 4G7YH 5FLVA 4UOJA 4F1ZA 2R2CA 3VO0A 3QE5A 1K3UA 5ECUA 1MWAA 1XGUA 3FCBA 3H4HA 4BF9A 1LLZA 1LK3H 1ZUAX 1T1WA 4K8HA 2YQ2A 2XIJA 2WXFA 1OAUL 1MWOA 1XGQA 3BKML 1E72M 3MROA 4RMSA 2YMTA 1NQBA 1OLLA 1Z66A 3MBWB 3KYKL 3OKEB 3U0TB 3UAJC 4HJEA 4OQTA 1SU5A 3GZ3A 1AGDB 2DWSA 3H0TB 1HINL 1THFD 5IBXC 7PTDA 3WBEA 2VUNA 5BRZE 3NQEA 4BK9A 2W0FA 3KLDA 5D7EA 2XG5A 4F3FB 1AQDB 2MOGA 5AD0B 2PB1A 4OZHB 1RZKC 4OGAD 4Z7VE 4ZSOA 1CBVH 3F01A 4YSRA 1IQ8A 4RLIA 3S5LG 2UZYB 2Q01A 3RX4A 4L1HA 1RJYB 3IRCA 2E46A 2AVGA 3ITYA 1XV8A 2A6KA 3MT1A 5FEXA 2DZSA 3DIVA 2YPKB 3QZ6A 3NEEA 5REQB 4U28A 1JFQL 1DUYA 4WFGD 2FZ3A 1ACZA 4GQ9L 2NPLX 4XTIA 2NNFA 4PR5A 4G6JH 5JLZA 4I5BA 4O28A 4TSCH 4UIOA 5CSSA 3VZYA 3B9DA 3WLTA 1XYZA 2NY2B 2MPVA 3MREB 4OIBA 3WFDH 4Z7WB 2WBJC 3PGCB 3BUTA 4DF9A 3GVQA 2C4FT 2QJDA 1R8LA 1Z89A 4KV5E 4LLUA 1OQOA 4BZ1A 4IU2B 3STBA 3ZOAA 3TFCA 3QXAB 4XH2B 2YCLA 3MYPA 4D6GA 2R0ZL 3MKGA 3LCHA 4Y1AD 2X1IA 3DC0A 5I26A 5HULA 2YZRA 3Q8CA 1P0NA 4OAWB 3RVTD 3W07A 5KZCB 1PZ1A 2NY7L 2KMWA 3NACH 1B3IA 4J2PA 5INCA 1VCVA 3T44A 1XG4A 4BHUA 2XA8H 4BHYA 1QVOB 3VXPA 4RZ6A 3KPNB 2F5BL 4H6EA 1AD9A 1VB9A 3IIOA 1WA1X 2Y8UA 5ALCH 4AM0B 3GIZL 4F8NA 3AICA 4CD8A 4XXWC 2OR9H 3T81A 1HHIA 3FO2B 1XP3A 3E2SA 4WI7A 3EXSA 3DMMB 4YZFE 2BXZA 2AAAA 1N5AB 5L7XH 4M7TA 3M1OA 5H4YA 4ODUB 1D7FA 2VC7A 1N10A 3JT2A 4PG2C 5HDBF 4O9HL 4AVFA 2Y6SC 5DBUA 3ES7A 3VFGH 1MWAL 1H3PL 4YDVB 4DERA 1JPTH 1E65A 4NO5B 1DBJL 3L5XL 5HMEA 3FRPA 3GRBA 4X60A 4Y7MA 5I8KH 4J3WA 4U0RB 1P5BA 3LHVA 3TVAA 3QCTH 3S8FB 3WNJA 3DROB 4ZOBA 4L3CB 1EF3A 2DIBA 4XBPB 2WPBA 1RSYA 3EJUA 4IPPA 4LBSA 3WL1A 1X5IA 1IEAA 3NCYS 4AXNA 4LSBA 4U7MA 3M4HA 1SF5A 4NQCA 1YJDH 3FCSB 4YSTA 5T3XD 3T04D 4R0LB 2YAHA 5J9PB 3GFZA 4BD4A 2XM2A 5KZDA 4HULB 2YWYA 4MNQD 4O51B 3M7WA 4PRTA 3EYSH 3DFQA 4FR6A 5D6CA 4ZMPA 2QMKA 4A38A 1E6PA 1QT1A 1VSCA 1UIOA 4N9EA 3U7BA 1AZBA 1GY2A 3CZGA 5C0IB 1XBZA 4QQ3A 4ZB2A 3BQUC 5IOPA 2GJ6B 1R0AL 1L9WA 2JKAA 4NO0B 2FWOB 2CK0L 2YD5A 1L7IL 1GYVA 2A77H 5I1HL 1I60A 1BGXH 4TL4A 5FYKU 4OZFG 3HMWH 3MI6A 2FB4H 5D7LA 2DRUA 4ZMLA 1Q9LA 1ZPUA 3B2VL 1Q85A 5T26A 3RDTD 3L65A 2X1PA 1W1TA 2EIEA 3R0MA 5EU5A 2F7QA 2P5ED 3G5VA 4PVMA 3RIFK 3SD5A 2J79A 3RCNA 4LSTH 1VEOA 3DVNB 3KYAA 2QDHA 3O3AB 1OB1A 3G5EA 4J4KA 2BJMH 3KPMB 2WVSA 1R3LB 3WFEL 1Q0XL 4UTJA 4DB7A 4CD5A 2G3JA 3ZZ1A 1HJQA 1OGAB 3S42A 4U6YB 3FKKA 4KUCD 4PRPE 1T4WA 5DJ0A 5I66B 5J11C 3K6DA 4NCC1 2N56A 2WW5A 3A3HA 3WIJA 5HDLA 3TEYA 1NBQA 2PXYC 4GXUM 4BV1A 4C55A 1QK0A 3CWOX 2GAZA 2NX5B 3GI8L 4P2QA 2I07B 1IR1A 5C07E 4OGXL 3FRUB 3H4XA 1N8ZB 2F7PA 1M53A 5JW4Q 3THCA 4JG1H 4M8UA 3S3PA 1B3ZA 3SSGA 2BCMA 2WO5A 1JZGA 3ZGHA 1G0YR 4JHMA 3L17A 1FC2D 2HT2C 1T0PB 4QTHB 3CDGB 2PDPA 1BYDA 3RLHA 4PCNA 4GRSA 4MA1B 3PUUA 1RK6A 2BZCA 2OZ4A 2BCKB 3MV9B 2WBXA 1HJUA 4GXPA 3QJHA 1N2VA 4U7KA 1GPOL 2BVDA 4PBWD 4N2FA 5EBAA 2PR4L 3P40A 1GVFA 2OX5A 3V4PB 3FQ2A 3ZE2F 1OGAE 3DBSA 2FEEI 4NENB 5JIQA 1E9ZB 4KKXA 4WXYA 3SSJA 3WQEA 4TNFA 4NZTH 4FCAA 4H0HB 1FYTA 5IGXL 3NFSL 2C16A 2R7EB 4R33A 1FVDB 1WBXA 2H1PH 2A6DA 3CX5K 2QGCA 1HL4A 4GW1A 4WUUB 2X38A 2V7NA 1PIFA 5GISL 1R3IH 2VDRH 2ICEC 3WKNA 1QUNB 4NO3B 4I3RL 3WJJC 1JCTA 3OVQA 3N6JA 3DG6A 3CZFA 2OQJB 2QW5A 1KC7A 3C86A 1NJ9A 5EZOH 4NRYA 1DYZA 3MRPA 5BZDA 2OP4L 1BQHB 1KEGL 4HJJL