3M7WA

Crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
b'KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
molecule tags Lyase
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m7wA00
3L0NA 3G18A 1SO4A 3W72A 2NWRA 5KTLA 1I2NA 2E1DA 3IGUA 4JIQA 2OMAA 3G1FA 3TXZA 3GIYA 3WK3A 3C2RA 4O4WA 4DO4A 2ABAA 5CGQA 3W1UA 3MI2A 5H2ZA 1WA3A 5DBUA 2CLKA 4IWWA 4X2RA 1Q6OA 3EXSA 3IIXA 4MZYA 5C2XA 2ZA3A 1H62A 1O95A 2QDGA 2RH9A 3P84A 3GXTA 3UWYA 1AK5A 1KM3A 4K38A 2ZZ3A 1BEUA 1QO2A 4LV9A 1G67A 2YSWA 4ORIA 1QOQA 3KRZA 2C15A 1EUNA 4UNKA 5HMSA 1I2QA 5U4NA 3M1ZA 3PF3A 1HFBA 3C2EA 1GTEA 1XDMA 1DQWA 1EX5A 2VFDA 4UTWC 2C19A 1JCXA 1X7FA 3TDFA 1H7WA 2CZDA 2VEKA 2CLMA 2A0NA 4M7TA 1GG0A 1QPOA 2NXHA 3TQKA 1JRCA 3E96A 3FLUA 3TSMA 3VE7A 1WOAA 2I14A 3SSJA 4XKYB 3S1VA 3NQMA 2CW6A 3NPVA 4MKNA 3QYQA 4WXZA 3W1LA 2E5DA 1L6SA 3O6CA 3OIXA 4NQ1A 3EWYA 4HNUA 4TO8A 1H63A 1Z44A 3MP3A 3NQVA 4RXGA 5CSSA 2VFGA 1O94A 1EWEA 3TJXA 1V5XA 3CT7A 3QJAA 4NXSA 1FWTA 1HUVA 4O11A 3N14A 3PSVA 3GK0A 1AW2A 4FIRA 3IVTA 4O0ZA 4IMGA 2PRMA 1N8FA 2YZRA 3LERA 1LTDA 1Z48A 5LHEA 3RU6A 2PURA 3UYCA 4IMEA 3W7LA 4YWIA 3SIZA 3E49A 3I65A 3FYPA 1SZFA 3L2IA 3W1NA 3UWUA 3TW7A 3B06A 1XBVA 1FXQA 1U5JA 4ZQRA 1KFJA 3VFLA 2ZZ7A 3DFQA 3DI0A 3PM6A 3HGSA 4E2DA 3RMJA 2UV8G 3I68A 1UCWA 3PB2A 3W1MA 3SY5A 3KVJA 1G4PA 3KOFA 3I7QA 5HUOA 5LKYA 2JBMA 2AGKA 3O15A 4TX9A 5AOUA 4WY0B 3W7IA 2ZDRA 1QPNA 2ISSA 3UWVA 4Q4KA 1S5VA 3P74A 3DGRA 3CLMA 2FPTA 4O1BA 5D2VA 2RDTA 1WOBA 3HPZA 3QW3A 1KTNA 2HTMA 2JGYA 2RHGA 2VEMA 2Y85A 1JCYA 4QQ3A 5CKSA 4JTFA 5D2WA 3S5ZA 1TTJA 2EPHA 4IOTA 2HS8A 3GDRA 3S1UA 1EIXA 4HSNA 4BI7A 3VCRA 3PG8A 4O50A 4CCCA 1H7XA 5DLCA 1O5KA 1DVJA 3FKRA 1ONRA 3ABSA 1VYSX 3PY2A 4JR5A 3TIMA 1C9DA 2ISVA 3HIJA 3MYOA 2G5WA 3GDLA 5G2IA 1YDVA 3BW4A 3TNOA 4UNLA 3TROA 4N6FA 4E2BA 3JR2A 4DF2A 4FX7A 4RZ6A 2QCEA 4ZQMA 1E51A 2G95A 2GQ9A 1KW1A 2GVJA 4JTLA 3S1XA 4ZZ9A 5EL1A 4UIOA 2NX1A 3UWZA 3S8HA 2TMDA 2YGYA 4NJJA 2WKJA 3RF9A 4TIMA 2DJXA 3U8GA 2E6DA 3L0KA 2FTPA 4GC4A 4O18A 1MXSA 2OJPA 1XC4A 1PHWA 1H7PA 2FDSA 1LLWA 4EF9A 1OYAA 1TREA 4CNPA 3UY8A 4FO4A 4M7SA 2ZRWA 2I1OA 3KVKA 1VJIA 1JQXA 1L6WA 2WNNA 3EWBX 2CLLA 5AHMA 5IBXA 3M16A 4FNTA 1FBAA 3L5LA 5ABTA 5I3KA 2X2GA 2WV8A 4O54A 3W07A 5KITA 1A53A 3NEVA 2WSQA 1H1ZA 4JX4A 4PL1A 1LDCA 3L66A 5K4XA 4N9DA 1TQJA 5LGXA 3I6RA 3SFKA 1SSGA 1F6KA 1OABA 1W37A 1ZAIA 1WYIA 3HG4A 5AC7A 3P5ZA 2NZLA 4CNOA 5LSMA 1EUAA 3S6DA 1JCMP 3O6YX 1W1ZA 4I7UA 3QQ1A 2Y7FA 3QMRA 5BMXA 1VLWA 2BLEA 1VQTA 3DFPA 1LOLA 4TU1A 3NGJA 2QAPA 3RFAA 2JGQA 2ZYFA 4JS3A 3NOEA 4KWWA 4MZ8A 1WBJA 2ZFAA 3C2FA 1X6UA 1A5BA 4MJZA 2J24A 4ZMGA 4BWLA 3VKJA 4UXDA 4Z0JA 3OVQA 4JEQA 3CEUA 2BWGA 1FCBA 3UPBA 4YMZA 3IV3A 2ZZ2A 3NPWA 3M5ZA 4BK9A 2V2HA 3EKLA 1PIIA 3W73A 3QMTA 4HSOA 3NL6A 3Q94A 4KWVA 3LHTA 3B0PA 1TPEA 4N4QA 4UFMA 4IX0A 5AB3A 5CZ0A 1NEYA 4HNVA 3LCWA 2NLIA 2ZTJA 1LRQA 4HNNA 1OFBA 1GWJA 4ZQCA 2QDHA 3DZ1A 1XFBA 4IQLA 2HMCA 3NQCA 1TSIA 2A21A 3O8AA 5G2WA 2PC4A 4B5NA 1ZCOA 2CLOA 4JTIA 1L2UA 3Q2DA 1TYGA 2QEZA 3QPZA 3HF3A 4O0KA 4E0CA 3I7RA 2A4AA 2XN1A 3NVTA 4IXXA 4JTEA 1DV7A 1GYNA 1OHLA 1YXYA 4JX6A 1DHPA 2OX1A 5GVJA 5E0KA 5L6UA 5I3HA 3TSBA 4K7YA 1K7FA 4XZ9A 4ICNA 2A7PA 3DKLA 1W3TA 1QO5A 2E5CA 3UY7A 4UTIA 5TBOA 1TTQA 3KVMA 4NVTA 5FF3A 2E6YA 4Z1DA 5U7SA 5FF2A 3HQ1A 4JY8A 4LC6A 4XUGA 3ZFHA 1DJQA 3LHZA 4DBEA 3WJYA 4FX8A 3EWZA 3WK0A 1VR6A 2DZPA 5DY2A 3GB6A 2FFCA 5EKYA 1M5WA 1AL8A 4NT0A 3UWQA 2FPYA 2NX3A 1K7XA 2YW3A 4RV8A 2Y7DA 5HULA 2QCCA 2WSYA 1CW2A 1KTBA 3ZWTA 1G7UA 3W9ZA 3B4UA 3QH2A 4NJIA 2ZZ6A 4O57A 1MO0A 2V82A 1RQEA 2ZA2A 1OF8A 1PVNA 3SECA 4UFJA 1SPQA 4KFPA 3LOTA 4LC8A 1MEIA 4O8RA 4WY0F 3EWWA 1TJPA 3MP4A 4LVDA 1WXJA 4BR1A 3W3OA 3G1VA 3LM7A 5FF7A 1L9WA 1H1YA 4S2CA 2ATMA 3GXPA 2DZXA 2QUTA 3OEXA 4N6EA 4U4MA 1F7BA 3BGGA 5G1TA 2WSRA 4AWSA 2QAFA 3KFTA 4AB4A 1HTIA 4CQAA 1TPFA 4MIMA 4OBTA 4EIVA 3W7KA 5AC8A 1HL2A 3EXTA 3CWOX 1FCVA 3QC3A 1JCNA 2TSYA 5BW6A 3LI1A 1GVOA 1O60A 1FQ0A 1XM3A 4D2JA 1SZGA 3NPXA 4LS1A 2GJLA 3ABOA 2DP3A 1JCJA 1M7OA 3QQ0A 5E1QA 3QZEA 5A8GA 4P2VA 3CEPA 3F1QA 5LNWA 3A5FA 4Z1AA 3G1HA 4K37A 2XFWA 1H5YA 3QW4B 3F4WA 1XDLA 4A21A 3QSRA 1XUUA 3FFSA 4AHQA 1VCGA 4JTHA 4YL2A 1P0KA 4IGHA 1TIMA 3LV6A 4R53A 1J5TA 4ZL1A 5D05A 1G69A 4GNJA 3JRKA 3FJLA 2H90A 5HWNA 3M5YA 1ICPA 1ZNNA 1N7KA 3K30A 1TB3A 4K39A 2E5BA 4RZ4A 3W7PA 5HR6A 5BOOA 1BKSA 2TRSA 2G96A 4FHAA 3N34A 3L0GA 5F4SA 4FB7A 3PR2A 4C1KA 2E6FA 3ABRA 3M9YA 5CSRA 3EB2A 4HN4A 1QOPA 4NJHA 4Z1BA 1G4SA 3W1RA 4JTGA 3W2JA 3TMLA 1BTMA 4I7VA 4H3DA 3LCIA 3NZ1A 4PC8A 3Q58A 3EX6A 2Y61A 3C52A 1B4EA 3W7JA 3O1NA 1S5TA 1R47A 3VE9A 5CPOA 3MBFA 3LXAA 5CPNA 3G1DA 5D02A 2F7FA 1G4TA 1EPXA 1OYCA 1IIHA 3EX4A 3FOKA 5DXXA 1G6CA 4Y9AA 6TIMA 3M7WA 3QF0A 1T96A 3HG2A 3W83A 2VEIA 2CU0A 3P8JA 3W85A 3W2KA 1W5NA 1ZY9A 2H8XA 4PFMA 5EBUA 3CIWA 3D0CA 2VEPA 2YCEA 3TE9A 3MYPA 3W2NA 4LVFA 5A5WA 5TQLA 4Y90A 1IGSA 3HO8A 1JQVA 2C16A 1SU5A 4S2BA 1UUOA 2ZA1A 3GKAA 4IXHA 3PC0A 2Y7GA 5K7JA 1LROA 1MEWA 4UTTC 2CLFA 3B03A 4RR4A 4PA8A 3C61A 1D3GA 3DFOA 1QWGA 1GJPA 3FJ6A 3C3NA 3M41A 3W86A 2V0TA 2QR6A 3L68A 4JN6A 5AC6A 1QNVA 3PG9A 3ZR4A 1C8VA 1GG1A 4M5PA 4WZHA 3NQ8A 4OHQA 2EAWA 4UTHA 3AJXA 1YTDA 2E77A 3LXBA 1XCFA 4AH7A 3TFCA 2VFEA 4AHOA 3DFSA 1RD5A 4JGDA 2QCGA 2ISWA 4K6AA 3T7VA 4L4LA 4YCPA 3C4UA 1WX0A 3PBWA 4RKAA 1K02A 1YTKA 2WJZA 1BWLA 3IRDA 3W7GA 1OFQA 3TU9A 2PCQA 4RX0A 3INPA 1YPFA 2XN2A 2B7NA 1F05A 5I3FA 4UMCA 3DI1A 4LRSA 3NZRA 4LNYA 3NM1A 4DF0A 3MBDA 4HT3A 4WOZA 5DCDA 2DORA 5FEZA 3NNTA 3STEA 4IJBA 4O1CA 3KXQA 4NXKA 2NXIA 1YYAA 3WJXA 1JVNA 4WX2A 2CFFA 2YW4A 4AWTA 3QPYA 3E12A 1H7OA 1H7RA 1IF2A 4P61A 3O63A 3LCLA 3W87A 2OT1A 3MO7A 4NU7A 2DJLA 2C13A 3G24A 3AO0A 3PBYA 1GZGA 4JYDA 1KM6A 1ME8A 2CWNA 3KRSA 3N9RA 1Z41A 4HPXA 2HS6A 3HJZA 2TPSA 4O4VA 4PL2A 4NJKA 4CQ9A 1O4UA 3NQFA 2ZRVA 4IPJA 3DHDA 3U6WA 4UTWA 2YDAA 1FX6A 2LLEA 2FQIA 3RLUA 2X30A 3IVUA 1T8XA 1PS9A 3BGJA 5K9XA 3PUDA 3W1AA 1VH7A 4ZVJA 5HUPA 5D2YA 2YXGA 4FF7A 4LWWA 4NNAA 4NUWA 1AG1O 4UTTA 3EKZA 2W6RA 3A9IA 4TR9A 1Q6QA 1F76A 1OYBA 3QM3A 2ZTKA 3LBMA 3LCFA 5G5IA 3CQ0A 3L5MA 1LBLA 2V30A 3L5AA 4M6QA 3A22A 4GRSA 4MUZA 4DPPA 4N2YA 3TC6A 4MZ1A 4A22A 5HWMA 2YPIA 1TPWA 2PE4A 1F2JA 4UTJA 3DENA 2I9EA 2YYUA 3WK1A 1R30A 3DFTA 4OE7A 2VFFA 3UXAA 1SO5A 3CWNA 2R8WA 5G4WA 4O10A 1DOSA 1R2TA 2OZ0A 3LGEA 3NL3A 3RNDA 1SZNA 1EA0A 3PAJA 3OHIA 1ALDA 3W7MA 2A6LA 5EY5A 2RFGA 3OVRA 1P4CA 4LVAA 4N9EA 2B7PA 3KHJA 4NNBA 3RK8A 1ZAHA 4OU1A 1VCFA 3WJWA 1TPUA 5HNRA 4OWGA 1F73A 3TQ0A 3LTPA 3G0XA 1H50A 4QISA 1YLVA 1OX4A 4NJGA 3U2OA 3P67A 1W54A 4XTIA 1XBXA 3GKFA 3FS2A 4O28A 1LOQA 1TPB1 4AWUA 1YDNA 1IIGA 3IIOA 3P62A 4DO6A 5D33A 4K7VA 1RPXA 4RZ5A 3IIVA 2QKFA 1HG3A 5L9FA 2BZNA 3W7QA 4WOQA 1K03A 2FLIA 3TC7A 1JUEA 4BWLC 3G1SA 3NR0A 3LHUA 1P0NA 1W31A 3DFNA 5D09A 1A5CA 5AYZA 1A50A 1KV5A 3NG3A 3H54A 3TV8A 1LORA 2OT0A 4Z1CA 2C6QA 1OX6A 4AAJA 1KBJA 2J9YA 2Y88A 4KFOA 3HB9A 3HBLA 4Q33A 1PCWA 4WD0A 4K8HA 4M6VA 4XQ6A 4UTKA 1TRDA 3G1AA 1D9EA 3UPWA 1H61A 2GQ8A 3MHGA 4FNQA 1JCLA 1I2PA 5SWUA 4JIPA 3C2VA 1DKWA 2FPVA 2Z6JA 3FYOA 4MVAA 3EWXA 3M5XA 3M44A 4I7WA 5D32A 5LNSA 1Q45A 4LUJA 1EEPA 2ZZ5A 3C56A 7TIMA 1KM4A 4MY1A 1B3OA 4RXFA 1LZOA 3NQ2A 4X9SA 2YR1A 2QCHA 2NXGA 2WNZA 2J6XA 4WQ6A 2B4GA 2V2DA 3T78A 3SGZA 3GVGA 4H4IA 4QITA 1X1ZA 3LXCA 3TAOA 2VOMA 5F1VA 3LHYA 1OG0A 5DELA 4CQ8A 1LOSA 3IIZA 4MFEA 2RDUA 1SSDA 1TV7A 2H3BA 3N9SA 3WJZA 4MOZA 1TTPA 2ATSA 4O16A 3TAKA 3B05A 2P10A 1KM2A 1V7YA 2QCNA 3ABQA 2CZFA 4FEZA 3OVPA 3BG9A 3W1XA 1EP1A 1FWNA 3W7EA 2B7OA 4EVZA 1OF6A 3DXIA 1LRTA 1QPRA 3P7YA 4FNSA 2E6AA 2KZHA 5KZEA 1L6YA 1A5AA 5LGZA 3LI0A 1GQNA 1OFAA 1ZALA 4IUOA 1DQXA 4PH6A 2QJGA 4L4MA 1GVQA 1TPC1 1W5PA 4UR7A 2NUWA 1W5MA 4YCOA 5FEXA 2GQAA 5AHLA 3LLDA 1GOXA 1SUXA 4GUGA 2R94A 1AW1A 1W5OA 4O1DA 2EGZA 3B0UX 1GVRA 2X16A 3PUOA 5BMWA 1QCWA 5MHBA 4FXRA 1K8YA 3QEZA 4JYFA 3W1QA 2WO5A 3O16A 1GVFA 2NX9A 2VELA 3W1TA 5LNRA 4UR8A 1JRBA 5K4ZA 4AHPA 2AAMA 1OK6A 1D3HA 4UFIA 1RQHA 4ADSA 3NQGA 3O07A 5FF4A 2QUUA 5F2LA 1H60A 5KINA 4Y96A 4GJ1A 3IEBA 4RK8A 2VFIA 2XN0A 2JK2A 3O06A 3R89A 1TPDA 1A5SA 3W22A 3O6DA 5KZMA 1FCUA 1NAL1 1UUMA 1XBYA 3SW6A 6ALDA 1RR2A 5H91A 4UCGA 1J2WA 4UFHA 1RQBA 4S1FA 4PODA 5CZJA 2G97A 1QPQA 4WXYA 1YXCA 5D2XA 1JUKA 1DBTA 3IIPA 3DH7A 4JXCA 2GVLA 1MSSA 4QM1A 4ML9A 2ZZ1A 3TX9A 1W3NA 3BK0A 1F6PA 3GAYA 1HO1A 2FJKA 1B9BA 3P61A 2QUVA 4U28A 2Q8ZA 3S5YA 3LDVA 3O05A 1TRIA 1TJRA 4RJEA 3SZ8A 5BRBA 3TJLA 1I4NA 1OFPA 3MHFA 4O53A 3BLEA 3LRLA 3GNNA 1YXDA 3R8RA 3IGSA 2GOUA 4ZQOA 2Q3RA 3GDMA 4ONVA 4JY9A 3CB8A 2QCFA 3UWWA 1ZAJA 2BTMA 4OT7A 4OV4A 1ZFJA 2RDWA 3FA5A 4GXMA 1FWWA 2J9ZA 4ALDA 2ZBTA 1K3UA 1UJPA 3QRHA 4EWND 4TMCA 3BARA 4Z0SA 2WQPA 3PUEA 2NWSA 2JKAA 1YPIA 2DZUA 3R2GA 3TH6A 2V81A 4X3ZA 2Y89A 2FB3A 4UC5A 1EP2A 1GT8A 3MWAA 3G3MA 2VXNA 4QNEA 4R34A 4UUIA 3M5VA 1W3IA 4HKPA 4UFKA 2GVGA 4JTTA 2EHHA 3UQNA 2Z0IA 1G7VA 2A7NA 4JTJA 2QF7A 2NV2A 3BG5A 3ZS4A 3W84A 2CLIA 1ADOA 2WOQA 4N4PA 5CPLA 3G1XA 1ME7A 3QFEA 4GFSA 2V2CA 1R2SA 4O1AA 2E09A 3B8DA 5AHIA 2A7RA 2QCDB 4DELA 3TR2A 1ZJIA 4ZQNA 2DZSA 3MI6A 1VZWA 4E38A 4GUJA 5J5DA 5F1UA 1WQ5A 3KAOA 1SW0A 2DU2A 4A29A 3WK2A 1QMLA 3GZ3A 2C18A 3SGUA 4KKXA 3USBA 5FF0A 1KV8A 1LCOA 5CZSA 3UXDA 2CLHA 3M0ZA 3PULA 1LBFA 2V5LA 2B7QA 5F2IA 3YPIA 3GDKA 3N2XA 1P5BA 1S3HA 2A85A 3G1YA 1LYXA 3DAQA 4UMAA 4BFAA 1GTHA 2H6RA 4CLMA 3NQDA 3W76A 1CX9A 4J9JA 1EB3A 3F4NA 3SI9A 4UTMA 2J9XA 4WUIA 5CZTA 2QCDA 2X1TA 1XKYA 4CCDA 1XXXA 5EA9A 1VYRA 2BX7A 3GR8A 4IMDA 4N9BA 4CNNA 3VI2A 4TMBA 2Y62A 4O15A 1JUBA 1PCKA 1KFBA 2V5BA 2C0AA 1R46A 1CI1A 3LTYA 2R14A 3THAA 1ZHAA 3S5OA 3L21A 1OFRA 4N02A 1NF0A 2J27A 1FDZA 4DO5A 5AHNA 1OFOA 4ADTA 3S5NA 3HGRA 3EX1A 5D37A 2Z2UA 3N19B 4QIUA 3EEGA 3W7RA 1WBHA 4O14A 3W1PA 3BPWA 1JULA 4LOCA 4NNCA 1F5ZA 4MYAA 1FWSA 4YXGA 2QCMA 4A2SA 3NQ6A 4JTSA 1VHNA 4AVFA 3N3MA 1RVGA 1X1OA 4R33A 3HMJG 2Y63A 4HPJA 1SO6A 3THQA 3NDOA 3SJ3A 1XI3A 4LT9A 1JR1A 1KTCA 4DXVA 4UTUA 5G1YA 2A5HA 1UASA 3OBKA 3OG3A 1TQXA 1ZENA 1LP6A 3LV5A 4BI6A 4HIBA 4IMFA 3UD6A 1X8FA 4JDYA 1QR7A 3T4CA 3W2MA 1DORA 4MPQA 1DL3A 4QNWA 3DKJA 5AYYA 4C1LA 2Y70A 4XTDA 4ORMA 2A2IA 2Y7EA 3S42A 1PE1A 4DPQA 4MJMA 1YDOA 3BLIA 1BWKA 1KFKA 2P0OA 3Q37A 1SO3A 4BI5A 1FUYA 2ABBA 1ICQA 4LW7A 3TFXA 3S1WA 5K9CA 1QFEA 3CU2A 4Z08A 3TXVA 4WY0A 4W9TA 1LRNA 4X22A 4IMCA 1SW7A 1OX4B 4O13A 4MY9A 4HNTA 2X1SA 2RKXA 1OX5A 1UB3A 3HG3A 4XKYA 2ZRZA 2H8ZA 3NXFA 5TIMA 4RLIA 2O7QA 2VFHA 3KVLA 3G8RA 3LBCA 3LCHA 3TQVA 4IX2A 5DXYA 5AFDA 4UFLA 5F2MA 3PBVA 3B0VC 1W0MA 3MJYA 3TA6A 2ZRUA 1K8ZA 3W74A 5EYWA 3W75A 3PWAA 5CPMA 4H6KA 5EPDA 5I3JA 2AQWA 4G1KA 1JJKA 1DJNA 2C14A 4POCA 3LX9A 3A5VA 2WNQA 5IM51 1MEHA 2PRHA 3GLCA 1XL9A 3VNDA 4O12A 4MLRA 4DEFA 1GYLA 1TPVA 4FNPA 1VC4A 3HPSA 2EF9A 4WJEA 1Y0EA 3W7HA 2H3DA 4GUHA 1SZEA 4AF0A 3FEMA 3W2LA 1EWDA 1W56A 3LRMA 2EKCA 5HINA 4NZFA 4LTSA 2J88A 1Z42A 1H7NA 2YYTA 1IXQA 2V9DA 5KZDA 2VC6A 1YADA 3NO5A 3GX9A 3R5EA 2W0UA 5K3VA 2BSLA 2NV1A 2ZCGA 2VKZG 5EMUA 2YX0A 4PTNA 3W88A 4Y6GA 1Q3NA 3LHWA 2P1FA 4FXSA 1Q6RA 4FIQA 2CLEA 5HWJA 3STGA 5HQEA 1I8JA 1OFEA 3G3DA 1SW3A 5J5RA 3BLFA 3LHVA 2OCZA 4MY8A 4FNRA 5F4WA 1FWRA 5D38A 5AYXA 4R7JA 4JTUA 2X1RA 4XWUA 1I2RA 2GPTA 4GWEA 5LZLA 3L67A 3M43A 1U83A 2YFNA 2C3ZA 1OFDA 4PEKA 4LU0A 2CZ5A 1TPH1 3P82A 1ML1A 1FY6A 5I3GA 3BO9A 5IBXC 1NFBA 1C29A 1XUZA 3LB0A 5AN7A 1PL9A 5DCBA 4Y8FA 3ATZA 2Q3OA 3NA8A 3TKFA 3R12A 1O5XA 1W5QA 4GBUA 1Q6LA 3EX3A 2Q8LA 1NF7A 5KSWA 1KA9F 1AW5A 3JS3A 1KM1A 1B4KA 3R13A 1K7EA 1VYPX 3DBPA 3PB0A 2PRLA 1GPWA 4LY8A 5C5YA 4KFNA 1FCQA 3CC1A 3T55A 5G2HA 1IXPA 2JKEA 2D73A 1VLIA 4GUFA 3UZJA 2NUYA 4A2RA 1W8SA 3CTLA 2B0MA 4QSHA 2ZRYA 3W7DA 1RV8A 3GXNA 1VRDA 3KRUA 4MYXA 5DCEA 3HPXA 3GNDA 3N73A 2QCLA 4ZQPA 1KM5A 4IPIA 1ICSA 5F4XA 1THFD 1VHCA 3NYZA 5AHFA 3T40A 3UZ5A 3W7CA 3BW2A 3HGJA 5C54A 2QJIA 3C0JA 3H53A 1OVDA 3QSTA 4N9CA 1TO3A 2O7SA 1TCDA 2IQTA 4OV9A 1VCVA 5DN1A 3P5YA 3NQEA 4AEOA 2BXVA 1N55A 3TCEA 2C1HA 2Z1BA 1VS1A 3ATYA 4EF8A 3LLFA 2GJNA 3WJSA 3TSDA 4PCFA 3L65A 3C6CA 3C8FA 1VPXA 2A1YA 1TTIA 3GR7A 5LNVA 4AXKA 5DY3A 3NL2A 4O52A 3MUXA 3NAVA 5F2GA 1AMKA 3S0CA 3STCA 1KFLA 4K36A 3G22A 1SFLA 3GDTA 3W6YA 3A24A 3EXRA 1KM0A 3FKKA 1SFJA 4LUIA 1GEQA 5D2TA 1WAUA 3E02A 3UNDA 3TW6A 3IVSA 2DZWA 1M6JA 3ZWSA 5HR7A 5T26A 3LCGA 3NM3A 5C6MA 1M7PA 1KFCA 3HG5A 1NVMA 1GVSA 3BV4A 3EX2A 1T99A 3M6YA 4BF9A 3BVJA 3W71A 3G8EA 1G4EA 1WV2A 5FESA 1ME9A 3H55A 4NX0A 1H51A 3ELFA 1QAPA 3NQ7A 3A21A 3TK7A 5G4EA 3PS7A 3IGXA 2ALDA 1P1XA 2QJHA 2TYSA 4JD4A 2FIQA 2NUXA 4Q32A 5LNUA 5D03A 2DZTA 1S5WA 3T44A 3V1PA 1AL7A 4LRTA 4QJ1A 5C55A 4GUIA 5CG7A 3PVFA 4NZJA 4JTKA 4DQWA 1PHQA 3EWUA 4DBDA 1WDWA 3S9YA 3TUUA 2FB2A 2X1UA 3LCXA 3MI3A 4JNMA 5DBTA 2ZZ4A 4UTLA 4XBSA 3MP5A 3A23A 8TIMA 3W70A 4OGZA 3STFA 2V8ZA 4FNUA 4JYEA 3CM4A 3I7SA 4UMBA 1YTEA 4AMAA 3W7NA 3WFAA 4GE8A 3P80A 1IXNA 5D30A 4XBKA 1EP3A 1FDYA 1OK4A 5I3IA 1SQ7A 3SR7A 2A6NA 3LTSA 5FI8A 1FXPA 4O17A 3L9CA 4I9AA 1VGAA 4LVBA 4CCEA 5K9DA 1J4EA 1K8XA 3DHFA 4MFDA 4AF0B 2E68A 2WPBA 4K8EA 3W7OA 1KLZA 3N2MA 1TMHA 3E9AA 3MHUA 1I2OA 4FX6M 3W2UA 3PBUA 3V75A 1HO4A 1LLZA 3PSWA 5BNKA 3MW7A 1KFEA 4NX5A 5E93A 3CIXA 3CPRA 3TMQA 4YLWA 2Z6IA 3DU0A 3G0UA 3C2OA 2CZEA 2HSAA 4HHPA 1RZMA 2W79A 4LVGA 1F74A 4ADUA 1FDJA 2F84A 2ZQ0A 2JKPA 3MMTA 4M19A 3BG3A 3B04A 3NL5A 5AHEA 5K2ZA 5HJLA 4EOUA 4M6PA 1QDSA 2ZRXA 2YFOA 4LV4A 1XBZA 3NQAA 3W23A 4A3UA 1SR9A 2DZVA 3M47A 2GUUA 2VENA 3FIGA 3P8IA 3QMSA 5FEPA 4JICA 3E0IA 1KBIA 5FEWA 3LRKA 3HGOA 3F03K 1UBSA 1LBMA 5KMYA 1MZHA 4QAIA 3HOJA 1TV5A 3P81A 3BW3A 4OQVA 1B57A 1KLYA 4O19A 1I45A 1OJXA 1TV8A 3KX6A 3NPUA 5LHFA 1R2RA 4JX5A 4DF1A 3CHVA 3GYEA 3GAKA 4LS2A 2Y6ZA 1PV8A 1NSJA 3ANYA 5D04C 4LS0A 3RLVA 1LM1A 1T0OA 4MLJA 1IXOA 3OA3A 2R91A 3G0SA 4JDBA 4RCXA 3P60A
chains in the Genus database with same CATH superfamily
2ZUVA 3SRHA 6PTDA 3OO2A 3G18A 5A2BA 1UQYA 3QY7A 2DQXA 2E1DA 4O1FA 3E5PA 4I6KA 3G1FA 4Y8EA 1BG9A 1ADDA 3SCQA 2XVGA 1HVXA 4H04A 5CGQA 3W1UA 2HE8A 3AHTA 5H2ZA 2BOGX 1WA3A 2NT1A 4YVXA 1XRVA 4M24A 1KRCC 1Q6OA 1YE4A 3ZT6A 1BLIA 3WLOA 4MZYA 2ZA3A 1KD0A 1H62A 1UPMB 1ISYA 1LL4A 4FXFA 2V3GA 3UZZA 1QOQA 3KRZA 1X98A 1I2QA 3M1ZA 3GD6A 5I00A 3C2EA 4AD5A 2Y8VA 1DQWA 1EX5A 2G50A 3TDFA 2QS8A 2CZDA 3SUSA 2FZ8A 2NXHA 3GW0A 3TSMA 4UQEA 2FJUB 3RO8A 3S1VA 5D9MA 3NQMA 3UG3A 3ZJ7A 4MKNA 1FHLA 3W1LA 3BJFA 3OIXA 4MWAC 4NQ1A 4HOXA 3LU2A 3CQJA 3CQHA 5CJ5A 1FH7A 3TYAA 2ODOA 7ODCA 4HZ7A 1O94A 1CXFA 1ZBWA 3NEHA 1XD0A 3FXYA 3PPGA 4FAMA 4NXSA 2WCSA 3ZJ8A 1HUVA 2ZOXA 3N14A 4J2PA 3GK0A 4XZWA 4FIRA 1KQYA 4WJXA 2W62A 1US0A 2WMIB 2Y5EA 4AZ5A 1AUSL 3LERA 4HMDA 5A2AA 3BWWA 1PPIA 3J7HA 2PURA 3W7LA 4YWIA 3E49A 3WQOA 3FYPA 2PUZA 3TW7A 3B06A 3UVAA 5HJXA 3VFLA 2E1WA 3DFQA 2UV8G 4BS0A 2DT3A 3KVJA 4GNVA 3I7QA 2JBMA 4TX9A 1TMQA 4W87A 2JF7A 2ZDRA 4H9MA 3UWVA 3MCOA 2YL5A 2PDWA 2BXZA 3WSUA 3CLMA 2FPTA 1E9YB 2FZBA 2HPMA 3IAQA 1IGWA 3VNJA 1J79A 1TMLA 1W1A1 4J40A 3U5UA 5D2WA 3S5ZA 3GDRA 2DIEA 2WMHA 3TYZA 4QDMA 4O50A 1ZQ5A 1O5KA 3H23A 2ZX5A 4KEVA 4IL2A 1WZMA 3PY2A 4OTKA 1EJTC 2G5WA 4V27A 1AH4A 1S39A 3GVRA 4UNLA 3TROA 1UD5A 4N6FA 1RCQA 1W8GA 3MMWA 4CNUA 1HX0A 2WC4A 3S8HA 4NJJA 4JTQA 2YJQA 3GTHA 2WKJA 4DAIA 2DJXA 4GGBA 1D7FA 2E6DA 3SSZA 4GC4A 4O18A 4JFUA 1REQB 1MXSA 2OJPA 3D6NA 1SVDA 1XC4A 1XSIA 4YVVA 1PHWA 4EF9A 4IQEA 4HN8A 3W53A 3BQ6A 4M7SA 2ZRWA 3KVKA 5JUVA 4H9VA 4RUBA 4E5TA 1JL8A 4DJED 1L6WA 1QBAA 4Q8QA 3CZEA 3PN8A 3P3BA 2I5IA 4FNTA 5I3KA 2X2GA 4YNGA 5IRPA 3RLGA 4YU1A 2WV8A 4ATWA 5CGMA 1E4LA 1OY0A 3T81A 1LDCA 4S39A 3KL5A 5K4XA 3KCLA 1F6KA 1ZAIA 3EPMA 1WYIA 3HG4A 3WFLA 2NZLA 3WH6A 4CNOA 1EUAA 4W7UA 1JCMP 2BGNE 3O6YX 4DZAA 1ECEA 4AZIA 1UR2A 2BLEA 4HZ8A 4IPNB 1JDEA 4TU1A 3DDMA 4PRTA 3DX5A 3EOSA 3OLDA 2E25A 2OQLA 2FVLA 1JAKA 5LA1A 3H24A 2ZFAA 3C2FA 3RU8X 4MJZA 3VKJA 4Z0JA 2Z7KA 3H6OA 4H8NA 3FGCB 4PTWA 3CV2A 3IV3A 3WENA 3NPWA 1C8YA 4GVFA 4DBWA 1X39A 1NOUA 2V2HA 1UR8A 3EKLA 3QMTA 2CHRA 3Q94A 3B0PA 1TPEA 2WHMA 1X6NA 1XICA 3BUVA 4UFMA 5AB3A 5TD4A 5CC5A 4HNVA 1OT1A 2ZTJA 4A3YA 1R87A 2YBTA 4IQLA 1MXDA 4C7GA 4P8XA 5HMFA 2A21A 3O8AA 1OGGA 3GIPA 3OVGA 2I5QA 2O55A 1AD4A 2VCAA 3RM9A 3EOLA 3QPZA 5DMYA 2QULA 4O0KA 3U7BA 4KIEA 3FVDA 1L8NA 3U9IA 4IXXA 1GYNA 2J7DA 1A80A 1DHPA 3E2SA 5L6UA 1K7FA 5FL1A 1QBBA 2G41A 4ICNA 3LPPA 4PTMA 3PPHA 2VWTA 3URNA 3HZ3A 3UY7A 4UTIA 5TBOA 5FF3A 1C8QA 1DE5A 5ABFA 3PJWA 3HQ1A 4XUGA 3ZFHA 2E8ZA 3OGVA 1U1HA 2PWFA 2OVLA 1VR6A 3CGTA 3GB6A 2C79A 3UWQA 2D2JA 2XZ9A 5DMNA 2Y7DA 4ATLA 2PZ0A 4E2VA 2WSYA 4EWJA 4PUDA 2Q01A 2YDRA 3ZWTA 4HNLA 1E9IA 1GOKA 2ZZ6A 1R5YA 3DERA 4Q4MA 4Z2JA 1LQ0A 4I5XA 4ZCWA 1MVYA 3VC6A 3CNYA 2EKGA 1OF8A 7PTDA 2VHLA 4LC8A 4XIMA 3BLOA 4NAEA 1G1YA 4GLEA 4LEQA 1TJPA 4LVDA 1WKDA 3EDKA 3MCNA 4DJFD 4G7EB 2P3EA 5DEZA 1H1YA 4S2CA 3GXPA 2QUTA 3B40A 3E38A 3AISA 4Y2WA 1EJRC 4NILA 4M80A 4YTRA 4S3FA 5AC8A 3C8NA 4XZNX 1XP3A 2WHJA 3ALGA 4ACZB 4H1ZA 4IF2A 3UU0A 3QY6A 1E0UA 3R8HA 3ZJKA 2DP3A 1JCJA 4JFWA 1UH2A 2R1PA 4J3TA 5E1QA 1GZJA 3QZEA 3CEPA 2XFWA 1HZYA 3QW4B 1MNSA 3SCNA 3F4WA 3N17A 3QSRA 4UQBA 3QGKC 1VCGA 4GYKA 3XINA 1TIMA 3MPGA 4FPSA 2J6VA 4GNJA 1HKMA 3BCDA 1R3VA 2H90A 3AIQA 1ZNNA 3C0LA 4AC1X 1OBAA 4K39A 1E4NA 2E5BA 3EB3A 3OYXA 4GZJA 1BKSA 1UP2A 4RNIA 2TRSA 4RW5A 2RDXA 5F4SA 1E6RA 1OSEA 2V69A 4C1KA 3QGVA 1G9HA 5CSRA 3EB2A 4HN4A 1QOPA 3N6JA 3W1RA 4JTGA 1Z6KA 1BTMA 3NZ1A 4PC8A 1R9YA 1KGWA 3CMJA 2GSJA 1FH8A 4WIWA 1MYRA 1B4EA 5A1AA 3ZO9A 5I79A 2XGIA 4NZ4A 1O1ZA 5FIPA 1EXPA 3SBFA 2FTWA 2Y8UA 1IIHA 1G6CA 1JCTA 1HJWA 4TX8A 2VEIA 3P8JA 3W85A 5FJIA 4V28A 2DUZA 4HTBA 2H8XA 4YJ5A 4DM1A 2VEPA 4HZMA 3TE9A 1GQKA 3AMGA 1YW1A 3RUBL 3KP1A 5A5WA 2VMFA 4FR1A 4D6JA 1JQVA 4IGNA 1UC5A 4S2BA 3GC5A 1UUOA 1R7OA 2ZA1A 2Y7GA 1KCKA 1MEWA 4UTTC 3I4KA 2VGBA 3M0JA 2CLFA 3B03A 2OG9A 3QR3A 1EXBA 1D3GA 2PBOA 5I2UA 4GI4A 5HBFA 5C2GA 5CCZA 2DPEA 4D6DA 4CD4A 1EDTA 1AD1A 2QUMA 3THDA 3U0HA 5C9ZA 4MJ2A 2X0HA 3AJXA 1YTDA 2ZXAA 3LXBA 1EZWA 2XM1A 1RHCA 1RD5A 2QCGA 2R1KA 4HJWA 3WMSA 4YCPA 1I9CB 3G5EA 4ZE4A 1YTKA 4JFVA 2OX4A 3VD9A 3INPA 1S2WA 3ID7A 2QDEA 4BF5A 4WOZA 4PMVA 3MUAA 5EMLA 2Y8KA 2WZMA 4JAWA 5IHRA 1WDDA 4FLRA 4NXKA 1VBUA 2YZ5A 4AZ6A 1Z8AA 3K8MA 1S2CA 1JAEA 3W87A 2OT1A 2PTXA 2DJLA 1B3XA 3ZLHA 2OQYA 2Z1VA 2OSWA 4PSPA 2WVSA 3F4CA 3WQEA 4GIEA 3FAWA 4PL2A 2TPSA 5DFAA 1U1JA 4GVGA 1EYEA 1ITQA 3QKEA 2Z25A 3URBA 4UB9A 3IVUA 4PMQA 3L2LA 2QMKA 1AJ2A 2YBVA 3WQVA 3BGJA 1PS9A 3W1AA 3DHPA 5I06A 4Q4PA 4RDWA 1B54A 4UTTA 4GQRA 1Q6QA 3DYMA 1OYBA 3QM3A 3LBMA 5G5IA 3T2QA 1H09A 4DZHA 1UH4A 1KXVA 2V30A 3N25A 2BP1A 3V18A 3A22A 4DXXA 4GRSA 1TVPA 3T05A 1PB0A 4N2YA 4DPPA 2QPUA 1TPWA 2PE4A 4UTJA 3DENA 2CIPA 3WNLA 3MSRA 1W3JA 3WK1A 1R30A 2VFFA 2ZADA 2OZ3A 1W1TA 3RNDA 2O92A 3KDOA 1SZNA 1EA0A 3PAJA 4MSSA 1JZ7A 1ALDA 2NLYA 2RFGA 1PIGA 3RK8A 5HNRA 1WNOA 4QISA 3CHCA 4NJGA 3U2OA 1FWFC 4XTIA 1FWBC 2ANUA 1XLMA 1Q5MA 3I6EA 4Q8MA 5T8GA 4AU0A 4AWUA 3L2MA 3P62A 1RPXA 5LIXX 1L0PA 3H2FA 2QKFA 4GA8A 1C92A 3TC7A 2HVNA 5C9RA 1BYAA 3LHUA 2VX4A 2AAAA 1KV5A 3TV8A 4IPLA 4ZTYA 4DY1A 4WD0A 2F38A 1PCWA 5A8OA 4O8AA 2V3DA 1H61A 2GQ8A 3R0DA 2JIWA 3BCFA 2NW0A 2B81A 1GOIA 6TAAA 4MDOA 4MVAA 3SQSA 3EWXA 1VENA 4L1GA 1NH6A 1AJ0A 5D32A 4UTFA 2BHZA 3ANUA 2O9PA 2Q6ZA 4ZO6A 1EBHA 2XVLA 1KM4A 3R7MA 2I9UA 4RXFA 4X9SA 1DWJM 3LLXA 2BMBA 2WNZA 3B4YA 4TV6A 3SGZA 3DC8A 4RL3A 4QITA 4HYWA 2REQA 1X1ZA 3LXCA 4HBKA 5DELA 4M8UA 1POKA 4GYPC 2HE5A 1I0BA 1SSDA 1TV7A 4K68A 3N9SA 3VFCA 5C9UA 4O16A 3ABXA 5BZAA 1YHTA 3OQ8A 1V7YA 4J3ZA 1W1YA 3CAQA 1IE7C 3A4JA 3PZOA 4A4AA 1EP1A 1FWNA 3QTPA 1GVIA 5LIWX 4CD7A 2VDIA 2ZX8A 1F9CA 2HRWA 5KZ6A 3AC0A 4HB7A 4HU8A 4DJEA 5LGZA 3ARPA 3LI0A 4NYUA 2WQDA 3M0VA 3FXGA 1DQXA 4IUOA 6XIMA 4L4MA 4KCUA 1FHUA 4Q8NA 3FY1A 1W5PA 4YCOA 3JUGA 6CGTA 4HPGA 4AYSA 1FP9A 3WQWA 3ANVA 1Z32X 1AW1A 4DM2A 2XVKA 3WD1A 4KEZA 4D9PA 3B0UX 2VM8A 4J3WA 3PUOA 5BMWA 5A8PA 3H7VA 5CSUA 1NDYA 3REQA 3QOMA 2NVDA 2NX9A 4IG2A 4JTAA 4UR8A 3HFYA 1P0DA 1RQHA 3ES7A 1XIDA 3NQGA 3QPEA 3O07A 1V51A 2QYGA 5KINA 4RK8A 3MDWA 3FA3A 1MQRA 1A0EA 1TPDA 3FAXA 1A5SA 4P7OA 1BYCA 4A6GA 1PX3A 4W84A 1NAL1 4IGSA 5IDZA 4WGXA 4MB1A 3GU1A 1RQBA 2HZGA 5CZJA 3MCMA 1QPQA 4WXYA 1YXCA 3UPMA 5D2XA 2J7BA 3DH7A 4S3GA 1HKJA 1MSSA 4J2MA 1FFQA 3TX9A 1EC9A 1XYZA 3UJSA 3W4RA 1VFUA 1F6PA 1GQJA 5JIWA 4U2YA 1HO1A 2FJKA 3V3WA 1DJWA 3SN1A 2D69A 3EWCA 3WLLA 4JOMA 2DSKA 1Q7ZA 5C7VA 3O7UA 3S5YA 1TRIA 2ZDSA 3U48A 4RJEA 3MHFA 3EOOA 4PMJA 3LMYA 4M1RA 9XIMA 3KL3A 3LRLA 2EPLX 3GH7A 1YXDA 3CAVA 3R8RA 1S3TC 4WRHA 1JFHA 3RITA 1W32A 4JY9A 3V16A 3CH0A 3H2OA 1VB9A 3QR1A 3GG7A 4OT7A 3FA5A 4GXMA 1FWWA 2J9ZA 3EMZA 1K3UA 1ZTVA 4U10A 4EWND 3SURA 2J7CA 4WVXA 4TMCA 3PUEA 1IZCA 3R2GA 3VMNA 3GXIA 3MWAA 4DWSA 3G3MA 2WZHA 1DJXA 2VXNA 4QBXA 3S6OA 1ISWA 1OINA 2WMFA 3UQNA 2A7NA 4JHOA 1V02A 1E73M 1OGSA 2IKIA 4QHRA 2CLIA 3UG5A 1XLBA 5BOFA 1H2JA 1BWVA 4GFSA 4ZFMA 2V2CA 4AY7A 4O1AA 3B8DA 2VCBA 1D3CA 4ZSUA 3BE7A 3CJPA 3TR2A 4AMCA 2DZSA 1IEWA 1RA0A 1V3LA 1W17A 4A29A 9CGTA 5JMUA 3WK2A 1CT5A 1V8EA 2C18A 1F8IA 3MS8A 4ZO9A 1A4LA 3PULA 1C3FA 3BC9A 1GNXA 3VOIA 4KWSA 3YPIA 1E72M 3RYSA 3DAQA 2J13A 4UMAA 4BFAA 1UKOA 1GTHA 3KLKA 3QKZA 1SJAA 1MI3A 1EHNA 2V67A 4C6FA 4JQAA 4J9JA 3OG2A 2JE8A 4F2UA 3GO2A 4GJIA 4AY8A 6REQA 3TYDA 1VYRA 5C71A 2IQDA 3GR8A 4N9BA 2FZ9A 3FEQA 2C0AA 3UCDA 1VBJA 2YCIX 3K4DA 3LTYA 3THAA 1ZHAA 5A2CA 3AYRA 3S5OA 3P0WA 1NF0A 3T2OA 2J27A 1FDZA 3OZOA 1UR3M 4Z2IA 3S5NA 4C5YA 5CQ1A 4QIUA 2OXNA 4O14A 3OU8A 4UOJA 1JULA 4LOCA 1W9BM 4NNCA 2AKZA 3GXFA 3V7PA 1RVKA 4JEJA 1FWSA 3NO3A 5D9OA 3VGDA 4AVFA 3N3MA 4R33A 1IT0A 2PDLA 4HU0A 4K2SA 4HPJA 1EL3A 4NG3A 2ZXBA 3RAOA 1JR1A 2XUCA 1H1NA 1UASA 4MWAA 3UJFA 1ZENA 2Z26A 1JZ2A 5BXTA 4PBEA 5ECUA 4US6A 4M51A 1DL3A 5CJNA 3DOPA 3DKJA 5AYYA 4C1LA 1UW9A 3SUWA 3A12A 2A2IA 2GGEA 2Y7EA 1PE1A 3FYYA 1JXJA 3GE7A 4LALA 1BRLB 4YTQA 3TN4A 3CU2A 4Z08A 4PMOA 4W9TA 1LRNA 1TJ1A 4CVWA 2REQB 1OX4B 1JD9A 1B90A 2RKXA 3HG3A 4IP7A 2ZRZA 3E0FA 3VIJA 2PDIA 5E09A 5BROA 1KR0A 4W8AA 1A5KC 1W0MA 1QATA 3MJYA 3ITCA 1M65A 3VNLA 4G1KA 1JJKA 1NTHA 1JZ8A 1DJNA 4POCA 4GIRA 3LX9A 1EO5A 3A5VA 3FGCA 4Q7NA 2ZC1A 5IM51 3GLCA 3VNDA 1S2AA 3KRBA 1RSCA 2QDDA 4O0QA 2EF9A 4ZEPA 4IG2B 1DJGA 1EDGA 2XG9A 1J93A 1XKJA 1V77A 1NM9A 1T40A 3LK6A 5HINA 1BF6A 3CYJA 1H7NA 1IXQA 3QLLA 1R8LA 4QLKA 4W5UA 1E9ZB 4G2DA 4HU4A 4XX6A 1JPDX 4AYGA 2YDQA 1Q6EA 1V0LA 1UR9A 4YYFA 5CLWA 3W88A 5I03A 4REQA 3LHWA 4OOZA 4JFTA 4TVUA 3QXBA 2VZSA 4FIQA 1ADSA 3OZYA 5HWJA 2GGGA 4M56A 3VX1A 4B5WA 3H8AA 5DT5A 5C9XA 3WN6A 3BLFA 5F4WA 2A79A 3L23A 5AYXA 5E5CA 8A3HA 1E6ZA 2F6XA 5AYBA 3HM7A 1DIKA 1B31A 4KWUA 1OFDA 4LU0A 1TWWA 3HQOA 4DHGA 1PL9A 5DCBA 4AC7C 4PE8A 3TKFA 3R12A 3NSNA 4GBUA 4OUIA 4C6NA 1EJUC 2X2YA 1V3HA 2WHKA 3JS3A 3R13A 2GJPA 3PB0A 1J0JA 1FCQA 5GQBA 3T55A 5G2HA 1S2UA 3BMVA 4UZUA 5D8ZA 3W7DA 1XLDA 1VRDA 1EYWA 5DRCA 4XO6A 4HYRA 5FAGA 3N73A 4AZHA 3OHMB 1THFD 4LUSB 5A8MA 3VKCA 1YIXA 3O6AA 1NU5A 3O2LA 5T9BG 2A3BA 2IQTA 4OV9A 1VCVA 3AXKA 2J78A 3R0KA 4RDZA 2ZUWA 5DX7A 3GUGA 2D2GA 1VS1A 4J28A 5ENLA 2OWWA 4JQ1A 5E0CA 3VGHA 1Q63A 1A3WA 3JW7A 2BBFA 2VRKA 3TC3A 3M4HA 4O52A 3QZAA 4NI8A 1AMKA 2PDNA 3STCA 3C2YA 4XZHA 1CCWB 4K36A 2PP0A 3H22A 3A24A 1QK2A 3EXRA 3ISIX 3WLKX 4JN8A 3FKKA 4ROQA 3WNMA 1SFJA 1QW8A 2PDKA 2J8TA 1GORA 4HTYA 4A05A 1M6JA 3UNTA 3CUFA 1FWEC 3BJSA 1M7PA 4B90A 4YWSA 1UIOA 2EPNA 1GVSA 1GGOA 3M6YA 3V0SA 6ENLA 3W71A 1CXLA 1ITUA 1ME9A 1S2VA 2YA2A 4NX0A 1H51A 3NQ7A 3A21A 5G4EA 2VZUA 4CVUA 4KPLA 4W85A 1W9XA 4HQVA 1JF6A 3W38A 2QJHA 1H41A 4ERAA 1A3HA 4Q32A 2Z2BA 1BG4A 2IUZA 5C55A 3GFYA 4DYJA 1DTNA 3B9OA 1CENA 4XAYA 3W70A 3GHTA 1GOOA 1WO2A 5TF0A 3N2TA 3SN4A 3H12A 4UMBA 1YTEA 4FLSA 3WLSA 3W7NA 2FFIA 5D30A 1OT2A 1K6WA 5JIPA 3LTSA 5FI8A 1QNOA 2ALRA 4A3QA 1Q2SA 4H9TA 1CLXA 3MUCA 1K8XA 1XPYA 5J8LA 4AF0B 2E68A 5M03A 3NYDA 5I5RA 2XIIA 2PF8A 3N2MA 1TMHA 1OCJA 3E9AA 4FX6M 3H2AA 3ARVA 1LLZA 4NX5A 3CIXA 3W01A 4EXAA 3S2CA 4H19A 1Q8JA 4YLWA 1JIBA 3DU0A 1DIOA 2CZEA 4G6CA 1RZMA 3ITOA 4LVGA 1VJZA 2F84A 3E3HA 2ZQ0A 3B9AA 5AKQA 4GCXA 3NL5A 5K2ZA 3M0IA 3K4AA 3ME3A 2ZRXA 2VCCA 1UWUA 2F6KA 2VR2A 3MJMA 2GYIA 4KGLA 3UR7A 4A3UA 1Q4WA 2DZVA 3KTXA 3RLHA 1UD6A 4AX7A 3P8IA 2HXTA 3E0IA 4LFYA 3N2CA 3HGOA 2DSVA 4QAIA 2PWVA 1TV5A 3OTRA 3P81A 2GSEA 4I90A 1TA3A 1EF3A 1OJXA 2AOSA 1TV8A 3IK2A 4W88A 4YYCA 4DF1A 4GI6A 3GAKA 3G77A 1PV8A 4LS0A 3RLVA 1LM1A 4MLJA 1DJHA 1IXOA 3O0KA 1Q65A 3E0VA 2HQAA 1QI4A 4Q6JA 3L0NA 1SO4A 3VOJA 2Y24A 5A6LA 1YNQA 2BY3A 3ARQA 4PMXA 3TXZA 2G0WA 3WK3A 2OQHA 1J5SA 4O4WA 4OFCA 2ABAA 1BXBA 3V4BA 4M6UA 1ITXA 1O66A 3AIUA 4IPPA 2HPIA 2CLKA 4IWWA 4IL0A 3BOLA 4X2RA 1MW3A 3EXSA 4LUTA 3IIXA 1IT7A 3ZIZA 3HA1A 5C2XA 2D0FA 2QDGA 1LT8A 2RH9A 2BVWA 4D71A 3P84A 3UFYA 2YXOA 3UWYA 4HHHA 3WIJA 1QO2A 4LV9A 1V93A 1EUNA 4LYQA 4DVOA 3SO7A 4GOAA 1O6IA 1GTEA 1LL7A 1OG6A 4UTWC 1X7FA 3FJ4A 4DUXA 1E6QM 2A0NA 2DW6A 4M7TA 2BODX 3CZKA 1UP0A 1PKMA 1JRCA 2WLYA 1JF5A 1WOAA 2WVVA 2I14A 3SSJA 4F0LA 4QJ3B 4XKYB 3OBAA 3LS9A 4JCMA 4L6DA 3RPMA 1L6GA 5CC6A 5D9PA 3SN0A 2E5DA 3VOFA 4BQ3A 4TO8A 3VTRA 1HN1A 3KBNA 4XO7A 4QROA 3WBWA 4RXGA 4YPJA 3WH8A 3N04A 2WZTA 2QV4A 1V5XA 3CT7A 4L5ZA 1FWTA 1MQPA 2QVNA 4C6DA 3AXHA 4WSHA 1KGXA 3PSVA 1AQFA 4B5VA 1JDAA 2PRMA 1AVAA 1H3GA 4JQ3A 5LHEA 3RU6A 1SR0A 2ZKMX 2P88A 5LYRA 5CPSA 4H00A 3UGVA 3CHDA 1GKPA 3PZUA 4WDXA 4Z42C 4ZQRA 1KFJA 4HMEA 1J0ZA 3IGHX 3TTSA 3M46A 3CLWA 4OZOA 2PU1A 4MMWA 1MDRA 3PZIA 4D8ZA 5DRIA 4WY0B 1W9VA 1PJ9A 1UZ1A 4RDYA 2O9RA 2ISSA 2E7FA 1E6XM 1KNWA 3P74A 3Q45A 5EBAA 2VR4A 4O1BA 2RDTA 1WOBA 1N8WA 1QPKA 4CU8A 1YX1A 2JGYA 3M0YA 2RHGA 2XWDA 2VEMA 2GJRA 1JCYA 4JTFA 4RV3A 1OGBA 4IOTA 2EPHA 1VAHA 1RY8A 2D24A 4EK7A 4BI7A 5ABFB 3V1HA 5D8WA 1R9XA 3PTDA 4OECA 5DLCA 4I5RA 4WK9A 4C6EA 5BYWA 4FK9A 1ONRA 1MUMA 5FJTA 3WLRA 3T0BA 4JR5A 3TIMA 2ISVA 3GDLA 1RK6A 3RJXA 1QTWA 4DF2A 1M53A 4FX7A 2QCEA 1E51A 2GQ9A 2GVJA 1KW1A 5A3HA 2CWXA 4JTLA 2YL6A 5EL1A 2NX1A 5T91A 4TIMA 4L4PA 5IOBA 2P8CA 4L9XA 4Q8VA 1E5JA 2OB3A 1EO7A 5HMDA 1J0IA 4LYPA 1OYAA 4CNPA 3LM3A 3UY8A 2I1OA 7ENLA 3WLHA 4QG6A 3WQDA 1VJIA 1EJWC 2FGLA 1X6LA 3VDAA 4G8TA 2CCRA 4L4OA 2CLLA 5JBEA 5IBXA 3BMXA 3M16A 2CHNA 3R58A 1FBAA 2QXWA 4B3ZA 4O54A 5KITA 3TJ4A 3NEVA 3N13A 4FALA 3SCPA 1XISA 3L66A 1SSGA 1M41A 4CKQA 2ZE3A 5AC7A 1HGYA 3P5ZA 4MNMA 1GW1A 4J3SA 5DF0A 4GYPA 3QMRA 2Q02A 1S1PA 1VLWA 1NWUA 1LOLA 3NGJA 2QAPA 3H2CA 5CC3A 4BKNA 4KWWA 4MZ8A 1W9DM 3PUGA 5EFDA 1X6UA 3MU7A 1XRSA 3OVQA 4JEQA 2YIHA 3AMCA 1FCBA 3UPBA 2ZUUA 2HVOA 3MT1A 3VNYA 3M5ZA 2G37A 4BK9A 3JZUA 1MW2A 3DG6A 2F61A 2TAAA 4GK8A 1OCNA 1PIIA 4LXFA 1P7TB 3RIKA 1N2VA 3NL6A 3VOCA 1K9DA 2GGJA 1UR4A 1XV8A 3WLJA 1JDDA 4IX0A 4HA0A 4MHBA 3LN3A 1NEYA 2VWSA 4XD6A 3MKCA 3LY0A 1LRQA 3UCCA 1XFBA 3IJ8A 5E6YA 1GHRA 2HMCA 1WZLA 4LAMA 2PC4A 4EPKA 1ZCOA 4AD1A 3NSMA 3B8SA 1J12A 3RM4A 3LMZA 3HF3A 3OJGA 4E0CA 3KOXA 4JTEA 4F2BA 4F0SA 4H7CA 5GVJA 5E0KA 4XZBA 5H8UA 4A8LA 4Z1YA 4HVXA 1QO5A 4HA1A 2E5CA 1O5RA 5F7UA 3KVMA 4NVTA 1W1PA 5HJYA 3WDJA 2E6YA 2ZX9A 1HKVA 2P8BA 4JY8A 3IJLA 3LHZA 4DBEA 3WJYA 5JXQA 1G94A 2GSHA 1KRAC 3PAOA 2RGMA 2NX3A 3OOQA 1K7XA 3WUEA 2NQJA 3KTSA 1XYMA 3FJNA 3B4UA 3PJXA 3APYA 4NJIA 1UZ4A 1MO0A 3SUTA 1P6BA 1UD3A 3SECA 1SPQA 4KFPA 4HJFA 1KRMA 1A0CA 3DCPA 3GS6A 4BR1A 3W3OA 2G3JA 1X97A 1E9LA 3VD7A 1UHVA 4U4MA 3BGGA 5G1TA 5BXRA 3W37A 2V5DA 1ZBVA 2GDQA 1ODUA 1TPFA 3BCJA 3BAKA 3MSDA 3GY1A 2ZXQA 1XS2A 1C91A 1FCVA 1PYMA 5BW6A 1RCXB 1GVOA 1FQ0A 1HJUA 2X0YA 1WAWA 3IJIA 1QUMA 2Y5JA 2VR5A 3REQB 1REQA 1SZGA 3VIKA 3ABOA 2POZA 2XIQA 5BRPA 3SCOA 2DV0A 1QW7A 4P2VA 2DSZA 3AAMA 2Q8XA 3VM5A 3G1HA 4K37A 1RPKA 4Z1AA 1H5YA 4Z2HA 1XDLA 2XSAA 2PDHA 3GR4A 1BFNA 3APGA 4R53A 1WB0A 3A4WA 2WJFA 3FJLA 5HWNA 1E6PA 3L4WA 3K30A 4BEUA 1PZ3A 4DWDA 4LAUA 3WO8A 4HK7A 5I24A 1FWJC 2MANA 5FJUA 1GKRA 4JTDA 3L0GA 1E40A 3ALFA 3VPLA 7REQB 2BGSA 5DANA 1TVNA 3M9YA 3P0XA 4NJHA 3F5LA 4W5ZA 4Z1BA 2P50A 1Y5VA 1G4SA 4XZIA 1E1FA 4I7VA 3VDCA 7CGTA 1GCYA 3WEOA 7REQA 3SRFA 1P0BA 2ACUA 1S5TA 3NFUA 1R47A 4IIEA 4MKSA 3O3RA 3G1DA 4Q8WA 3GTXA 1S5MA 5D02A 4D8LA 2F7FA 1OYCA 3ORWA 3FOKA 4HCDA 4Y9AA 6TIMA 3M7WA 1T96A 3HG2A 3W83A 1EGVA 1ZY9A 3IUIA 1AMYA 1G0CA 1XLKA 2PZNA 1ZJBA 3QY8A 3BAJA 4F66A 2QNEA 2XZ7A 5E70A 1JNDA 2G3IA 3PZVA 1IV8A 3HO8A 3VGBA 2ZUSA 4TX6A 3MB9A 1SU5A 3MMDA 1ONEA 3GBDA 3PC0A 2DH3A 5K7JA 5IXEA 5FJOA 2PDCA 4HPNA 4PB4A 2VO5A 4RR4A 1GJPA 3VIPA 3M41A 3C3NA 1M1BA 4RE2A 1J9YA 4AY1A 1XYLA 3A64A 1DWHM 3KZSA 3NQ8A 1H5VA 4OHQA 2EAWA 3VGFA 3CPGA 2J7FA 1XCFA 1E0XA 4P7RA 4AHOA 3DFSA 4K6AA 4M81A 4IFRA 2YB4A 1Q85A 3ZR5A 3NZQA 1P0EA 1QNPA 3ZLFA 3KOWA 1OFQA 1T7LA 2XN2A 4E8CA 5GNZA 4UMCA 3DI1A 4AIEA 2VUNA 3NZRA 1JZ4A 3QOKA 3LZ5A 5DCDA 1GOMA 2Z1KA 4XBJA 4GZIA 3UZYA 3WJXA 4WX2A 4AWTA 3SY1A 1UYQA 3U2EA 1H7RA 4P61A 4IIGA 5LA2A 5TAOA 4JNYA 3VCNA 1Q7QA 1NP2A 1GZGA 3KM8A 4JYDA 3KRSA 1JYVA 4HPXA 1Z41A 4U3CA 4W4QA 3U2CA 2E9MA 4O4VA 4KEUA 1W1B1 4J4KA 2OWCA 3CO4A 1XCXA 1NDZA 4IPJA 4QDWA 2PI6A 1TZ9A 3P2VA 3W25A 2GDVA 2D3LA 2R24A 1POJA 4UTWA 3A3WA 3EA2A 3MUZ1 2LLEA 2E40A 3KP0A 1O1HA 2X30A 1T8XA 2QF8A 4LCQA 2VUYA 3S83A 4LWWA 2ESCA 2WC7A 1MDLA 1AG1O 1RUSA 3UA4A 1F76A 2F2KA 1XHGA 3RILA 5AC5A 4HK5A 3LCFA 1W9UA 1F61A 3FHQA 5FA5A 3S46A 2XGZA 3CQ0A 1LBLA 2YA1A 4QXIA 3A4AA 2VTFA 3TC6A 4A22A 5HWMA 1XLEA 4IP5A 2XM2A 3SCUA 4HZ6A 3UXAA 3C5QA 3AWNA 2E9LA 2E67A 1YDYA 2R8WA 4YTUA 5GPRA 1MZRA 3WYZA 2OZ0A 2DUXA 2XH7A 1TZ7A 1WDRA 3NL3A 1XYCA 4MJ4A 1T5AA 3W29A 3W7MA 3WDPP 1ZL1A 3OVRA 4LVAA 4N9EA 2B7PA 1LUCB 1VJSA 1ZAHA 3A13A 1RJQA 1BKHA 3TQ0A 3LTPA 4H01A 1H50A 1PWLA 2HROA 3ITVA 4R85A 1HT6A 3AJ7A 3P67A 3RX4A 4DBUA 1XBXA 3GKFA 3FS2A 1UD2A 2OTDA 1LOQA 3IS4A 1P6WA 1YDNA 4CD6A 5BCAA 2E0PA 5D33A 4K7VA 2SFPA 3VD5A 3IIVA 5L9FA 1HG3A 2BZNA 2PTZA 2HWGA 3W7QA 3EBVA 1TX2A 4LBSA 5CXPA 3G1SA 4WKHA 1W31A 3NR0A 5AYZA 3G6LA 1A50A 3AXXA 1UR1A 4BA0A 1JGIA 1OX6A 3RN6A 3MO4A 3VYLA 5HDRA 4AAJA 4H8VA 3N3TA 2Y88A 3IARA 4KFOA 3CXOA 4Q33A 2O9OA 4K8HA 4M6VA 3CUXA 3U4FA 3U4AA 4UTKA 1D9EA 4MDPA 3N29A 4BY3A 3MSGA 2VEFA 4FNQA 5SWUA 2EXOA 4JHZA 1RBOB 3XIMA 3C2VA 1DKWA 3NDYA 2VD9A 3TJIA 1TUFA 3M44A 2PB1A 3UZWA 4I7WA 2E4TA 1EC7A 2XIJA 1Q45A 1IHIA 1EEPA 2ZZ5A 4MY1A 3NQ2A 4RNJA 4PMUA 2QCHA 3T0TA 5HK4A 2J6XA 3VXGA 4I6VA 4EXQA 2XH2A 3WCZA 4GZEA 5FSEC 3TLLA 5F1VA 1OG0A 3R0UA 4PCPA 4H8HA 3IJ7A 1JDCA 1KR1A 2ATSA 3B05A 1V0MA 3GNRA 3ABQA 4FEZA 4RE3A 2D20A 4XZLX 3IJ6A 4PMDA 5BU9A 3W7EA 2Y2WA 4EVZA 3URAA 1CWYA 3ZSSA 4FA3A 2PGRA 3WNKA 4QLJA 4FNSA 2KZHA 2VC7A 5EMJA 1OFAA 3H2EA 4E2OA 1ZALA 2ZUMA 3B8TA 1GVQA 1TPC1 1I0DA 2NUWA 3VILA 4LAZA 1WPCA 2PAJA 4V33A 4GKTA 1A5NC 1W5OA 4O1DA 5A6MA 3MANA 2X16A 4AISA 3M6DA 1K8YA 2ZVIA 1F4AA 1W3LA 5CBBA 3O16A 1GVFA 3EYPA 5LNRA 1R6WA 1E55A 2FZNA 3WKZA 4C6OA 4AHPA 4AD3A 1B30A 1D3HA 1UWTA 2QUUA 1H60A 2IPJA 3PANA 1H49A 4GJ1A 2C91A 2VFIA 2W61A 2JK2A 2QGYA 3O06A 3R89A 3CL6A 3WD0A 1J01A 1SGJA 3S3GA 5KZMA 1UUMA 1JG9A 2EPKX 3PNZA 6ALDA 1RR2A 1VP5A 4UCGA 3VNKA 1BQCA 3I4EA 5HANA 2G97A 2W4XA 3EWDA 1MNZA 3IIPA 1EJVC 1V08A 4V15A 1AQ0A 5A8NA 4DJEC 2WVVB 1CLVA 1KCZA 1B9BA 5MKGB 3CH9A 2ISDA 3P61A 4GINA 4U28A 4J35A 1OC6A 1WKYA 3LYEA 5BRBA 1A5OC 1ECQA 1OFPA 3UR5A 4GKLA 3BLEA 1NFPA 3E6EA 1YBQA 3R1ZA 5HQMA 4HK6A 2Q3RA 3H2MA 1UD8A 3CB8A 1Q6DA 4AG0A 2BTMA 2JEPA 2V5JA 1ZB5A 4XAGA 4OV4A 2RDWA 2AQVA 3OLGA 2UY3A 4LEFA 2NWSA 1ITCA 3TH6A 1YMYA 1IYXA 4X3ZA 1LL6A 2Y89A 4QNEA 4HHMA 4R34A 4UFKA 3MY9A 4JTTA 2EHHA 3H4GA 3MV01 1G7VA 3VUSA 2CEQA 2ON3A 4RZBA 2QF7A 3BG5A 2VT0A 1GPFA 2BOFX 2VJXA 3W84A 3VO0A 1ZUAX 1B0IA 2CKRA 2PWHA 1R2SA 5AHIA 2E09A 2BV9A 1G01A 4JIHA 4DELA 3R11A 4ZQNA 3KBJA 2IKHA 2ZWYA 4S3CA 1OM0A 2VI0A 4E38A 4LUYA 4AD2A 1NWRA 2OZ8A 3EOEA 2P3ZA 3KAOA 4C6JA 2ACSA 1E56A 1QMLA 4QEHA 3SGUA 3V0TA 4BQ5A 3UYIA 2V5LA 2B7QA 4CU7A 4JFSA 3I10A 4GABA 2I16A 2A85A 1LYXA 4PTDA 2OOGA 2W66A 1V02E 4AD0A 2H6RA 1S38A 3NQDA 2WJEA 1V3IA 3PTMA 1EB3A 3F4NA 3PZNA 4OBSA 4WEVX 5CZTA 1AQHA 1FWCC 1DHKA 1JNEA 4DJFC 1XKYA 2Z1WA 1XXXA 1FHVA 2BX7A 3T09A 3VI2A 5CBJA 3VM7A 4DWSC 2Y62A 4O15A 1PCKA 1KFBA 1X38A 4REQB 1CI1A 4ZA0A 2CC0A 4CD8A 1SMAA 4JTCA 1OFRA 1V6TA 4DO5A 3WL1A 5AHNA 4ADTA 3HGRA 4F0RA 3RG6A 2CKSA 1IR2A 3AXIA 2Z4GA 3EX1A 3L4UA 5D37A 2Z2UA 3N19B 1WBHA 3L12A 4C6KA 5B7YA 2BDQA 4MYAA 1VEPA 6A3HA 4EACA 4YXGA 4CUCA 4ENLA 4A2SA 2EG6A 1J6OA 3EAUA 3IUDA 4XSMA 1GK8A 3ZZ1A 3PWGA 1XPGA 4RE0A 2UY5A 3SJ3A 3S9IA 2TODA 4DXVA 2ZUTA 5G1YA 2A5HA 3OBKA 2XISA 1BVZA 4EXBA 3UD6A 1X8FA 1L6FA 1QR7A 4DNMA 4GQQA 3T4CA 3W2MA 4MPQA 1DWIM 3GQYA 4AZGA 4CU6A 3E74A 4ORMA 5M5DA 1FP8A 4B5TA 1TJ0A 1QXLA 1TV2A 4DPQA 3GZAA 3BLIA 3NJ3A 3AFBA 3F2BA 1KFKA 3A9BA 2P0OA 1L8PA 3Q37A 3RXZA 4DUOA 1FUYA 4LW7A 5ABGA 3TFXA 5K9CA 2OYLA 1DIDA 4X22A 4IMCA 4YN5A 1SW7A 1DPMA 4O13A 5BRQA 1TE6A 1OX5A 2UY2A 5C2CA 3HURA 3VKBA 4R3UA 3WQGA 5TIMA 2VGIA 1LUCA 1CNVA 2O7QA 1F4HA 4P7NA 3IJDA 1NDVA 2NQ9A 3RJYA 2OKTA 3TQVA 4IX2A 2Z1XA 4PRRA 3BLDA 5EYWA 4RPPA 4E4UA 2VC5A 3B9NA 5I3JA 2CESA 3BURA 1KBKA 1E43A 4KESA 1TIWA 4GY7A 4PZVA 1CGTA 4P8UA 1JZ3A 5AC4A 3H70A 4XB3A 4MLRA 4DEFA 1E5NA 5FACA 3HPSA 1OWQA 4WJEA 3KS5A 3E2RA 3QQWA 2H3DA 4GUHA 3EOUA 4FS9A 2WMIA 3ZVIA 3MUIA 3EZ4A 3KHDA 4LTSA 2J88A 5BWFA 5CJMA 1UWAA 3NUKA 3HV8A 2QJMA 1QHPA 4PFHA 1TG7A 5CAHA 3R5EA 2W0UA 5K3VA 1TZZA 2ZCGA 1NY1A 2QUNA 4PTNA 4Y6GA 2P1FA 1VD6A 1O68A 3HV9A 2PLJA 1Q6RA 3BZJA 2CLEA 4WHBA 3AUJA 2CYGA 3ARXA 4LPCA 5HQEA 5HA7A 4DUWA 2OO6A 4GHRA 4DUVA 1ISVA 2XH4A 5J5RA 3KUMA 3W6LA 4C5ZA 1HKKA 5D38A 4EPBC 4QEEA 4R7JA 2PLMA 3XISA 3WH9A 1DQUA 3BH4A 1UD4A 2BVYA 4H9XA 4KF1A 1UMYA 1B1YA 4HMNA 4WJ8A 3VIHA 4C90A 5I3GA 3BO9A 4NIRA 4GXPA 1C29A 5AN7A 3GNOA 3ATZA 1XW8A 3WQ6A 1D2KA 2C8NA 2JQXA 5FKYA 3GDBA 1Q6LA 1NF7A 2WM0A 5KSWA 3U5YA 1AW5A 1KM1A 1B4KA 3OPSA 1WUFA 4DBSA 2PRLA 4D6EA 5C5YA 4LF2A 4ZOEA 5LIYX 2WHLA 3POHA 4A8NA 8XIAA 3BLLA 4BF7A 4A2RA 1W8SA 3BSMA 2ZRYA 3DC0A 2W9MA 1PAMA 4MYXA 5DCEA 4EE9A 4GX8A 4DNHA 2ADAA 1O7AA 2DIKA 3GHUA 1KM5A 1ICSA 5AHFA 3HPAA 3T40A 3UZ5A 3W7CA 3UESA 2POTA 3SM0A 4DWSB 1HP4A 3H53A 3ZVHB 1OVDA 3QSTA 2WXDM 1IWAA 2PDGA 2O7SA 1TCDA 4U2ZA 3B8VA 1XG3A 3P5YA 2OELA 2YLLA 4LH8A 2BXVA 3TCEA 2WMKA 5I3DA 2J62A 3NDZA 1FWAC 3ATYA 2WB5A 3L65A 3C6CA 3C8FA 2A1YA 1GOQA 5LNVA 5DY3A 3NL2A 5GNYA 3MUXA 4CD5A 3LPGA 1V6WA 3NAVA 1P7TA 1KFLA 3LQGA 1M7XA 2XIOA 2NSOA 2D0HA 1YQ2A 3SCVA 4W89A 1U5VA 3QV6A 3ARWA 2NT0A 5H8MA 2VURA 1WAUA 3EA3A 2QV5A 5DQPA 3HTWA 3EDDA 2DZWA 1PTDA 3KZPA 5HR7A 1S5NA 1DWAM 5C6MA 2YCLA 2DVTA 3UR2A 3BV4A 4NZCA 4BF9A 2NQ5A 3BVJA 3E2QA 4JL1A 4MWAD 2PDMA 1WV2A 2PCEA 5FESA 3H55A 2C1GA 2WLZA 3BSHA 3IGXA 4QSFA 2YLAA 4YS1A 2DSWA 4L9YA 2DZTA 3V1PA 1UG6A 4KMQA 4JTKA 4DQWA 4JKKA 3LUTA 2GWNA 3MI3A 1TCMA 3VGGA 4RDVA 3A23A 4HD5A 2W91A 3BXWA 2V8ZA 4Q8PA 4FNUA 3BQ5A 3I7SA 4AMAA 3WFAA 2PC8A 2A3CA 2OPJA 1IXNA 1FDYA 1SQ7A 3SR7A 1WUEA 1RLCL 2PGEA 2VEGA 5K9DA 1VGAA 1V03A 4LVBA 2J8GA 4CQDA 3KEHA 1J4EA 1J0YA 3DHFA 4H6QA 1EC8A 3QHMA 5A6SA 1V6XA 3ARRA 2YKKA 3ZJ6A 3AIBA 4W8LA 3U7VA 3PSWA 3MW7A 2CBVA 1O12A 2NQZA 5E93A 1E1CA 3CPRA 3T07A 1K70A 4K3ZA 1HF6A 4JTRA 5AECA 4HHPA 1B3WA 2VQTA 2DT1A 1K77A 1YNYA 4CNTA 3LSBA 3ITXA 4HYVA 3OW1A 3VDBA 1EPVA 5AHEA 2VOTA 6XIAA 4KERA 2HNEA 3B9DA 4H6RA 5I78A 1HGWA 1XBZA 3NQAA 3NOYA 2O4MA 4UBPC 5HAOA 3GBEA 3AI0A 3WQ8A 3GG1A 4NF7A 4JICA 3UJRA 3MA8A 5FEWA 2BOEX 3F03K 3R25A 1UBSA 1V0NA 2QPXA 4M1BA 3HOJA 1JPMA 1HW6A 1B57A 2IKJA 2V38A 2G4JA 4GI8A 3KX6A 3ZQ9A 4DJFA 1R2RA 5T9CE 4JX5A 3CHVA 1XQLA 2FH8A 2Y6ZA 1NSJA 3DYPA 2EPOA 2AMXA 3OA3A 4IIFA 4JDBA 2EGZA 5BOOA 4LBUA 2XFYA 4H7ZA 3W72A 2NWRA 5KTLA 1RCOB 3IGUA 4LSBA 1AZ2A 2OMAA 1UKSA 1QWKA 3DYOA 1PX8A 1UA7A 4A3HA 3CB3A 1K9TA 4GFIA 3CQIA 1HL9A 3MI2A 4KQNA 3GU9A 5H6HA 2FH6A 3CUHA 2I56A 3GNXA 3T42A 4B92A 1O95A 2YDSA 3GXTA 2DY3A 2ZZ3A 1BEUA 4HU3A 1G67A 4QG8A 3UG4A 2BY0A 4QGCA 3WMCA 3WLIA 4IQDA 3VCCA 5HMSA 3DFYA 3AS2A 3PPFA 2Z2AA 3PZMA 1JCXA 2CLMA 4HSHA 3SEPA 3FV9A 3TQKA 3E96A 2R1LA 3FLUA 3VZYA 1KGUA 2IS7A 2G4FA 3S9ZA 1EOMA 2OLAA 3QYQA 2PD5A 4PMYA 4B4FA 3UBPC 1H63A 1NJJA 1ZJHA 3ICJA 1FFRA 4XKMA 1R7AA 3NQVA 4Q4RA 2IMRA 1PZ0A 4B2DA 5CSSA 2VFGA 4Q4QA 3GC4A 1I1WA 3TJXA 1M7JA 3TTEA 3ZLGA 3ITTA 4GISA 4O11A 2NQLA 3IVTA 1BXNA 1J96A 1N8FA 5I7GA 3SCTA 3WLTA 1DJIA 2XJ7A 3W6MA 3T9PA 4PUMA 1FVPA 4IMEA 1HXJA 3L2IA 2G3MA 4ZENA 3W1NA 3UWUA 1EJSC 3ARSA 1HJVA 3TR9A 1U5JA 4H2CA 2GZXA 4J3VA 2ZZ7A 3DI0A 3ITYA 3HGSA 4E2DA 4FR6A 3RMJA 2GK1A 3I68A 3PB2A 4MB3A 1UZDA 1XYBA 3JU2A 3SY5A 2DT0A 1G4PA 3KOYA 2QGHA 3KOFA 1RP9A 3TN3A 2AGKA 3W81A 3QV9A 2DQWA 1BXCA 1QPNA 4PN2A 1SMDA 1JYWA 4PUNA 2JF6A 5D2VA 1NQKA 3DIPA 4DLMA 4LQ1A 1KTNA 4UR9A 2HTMA 3TWBA 2Y85A 3D3AA 4AVNA 1TR9A 4QQ3A 4U5IA 3LGDA 4AQLA 9RUBA 2HS8A 1EIXA 4WR3A 1Q7MA 1UOZA 1H7XA 3UCQA 1DVJA 2RGLA 2PSNA 3CZ8A 2ZIDA 3WD3A 3HIJA 5C9WA 5G2IA 1YDVA 1Q2RA 3TNOA 4E2BA 3JR2A 3TTYA 2HK1A 4LF1A 1KWKA 3NVDA 5I23A 3UWZA 1ZCCA 2BS9A 4C6BA 3NQBA 5B80A 3IACA 3U8GA 4US5D 3L0KA 2FTPA 3AOFA 1CB7B 3TYEA 1Z89A 4DO7A 1H7PA 1LLWA 4DB7A 1TREA 3T8LA 1UMLA 4FO4A 4I5UA 3S2MA 3EPNA 2RUSA 1MQQA 4D6GA 1Y7VA 1I6NA 2QJJA 3EWBX 4V2XA 3DEQA 3L5LA 1XDJA 4YIWA 2A3AA 5ABTA 1GONA 1W3KA 2YL9A 1A53A 2P0IA 3VNZA 2DVXA 1VEOA 1TQJA 3UEQA 3I6RA 5LGXA 4Z2KA 3EPOA 4NRSA 1OABA 1W37A 4HCHA 1XX1A 4AX6A 5LSMA 3S6DA 1T6MA 3OGRA 1W1ZA 3CK5A 3QQ1A 2Y7FA 1BPLB 4I7UA 4NRRA 3RO6A 1UA3A 1PTAA 1VQTA 3DFPA 3C0QA 2WBKA 5EB8A 2JGQA 3T4WA 5XINA 1B3YA 1YBQB 1DXEA 3NOEA 9XIAA 2YXXA 1TV4A 4L64A 4ZMGA 4BWLA 4UOZA 2JEQA 4UXDA 4EAMA 2QLYA 3CEUA 3RPDA 1J0KA 1PDYA 4LJ3A 3RHGA 3K8KA 3PFRA 2OZTA 4UQCA 3LHTA 4I9TA 4U3AA 3N15A 3BAYA 1ZU8A 3DUGA 3LPOA 4N4QA 3U57A 1EQCA 3LCWA 3EEZA 3BSGA 4L65A 1KWGA 1XLHA 5CEWA 4HNNA 5GJMA 4YHGA 3IAPA 4L7ZA 3M0MA 2WSKA 4C91A 3NQCA 1TSIA 3B0XA 2XVPA 5G2WA 2FTYA 4LYRA 2VGFA 1E0WA 4JQ4A 1C9WA 2CLOA 4DLFA 3Q2DA 3VDGA 4ACZA 2QEZA 2VGGA 4D6IA 4AIOA 1BQGA 2D2HA 3I7RA 3PJTA 2A4AA 2XN1A 3NVTA 4Y9PA 1DV7A 1VBGA 4R7WA 1OC7A 3TSBA 4K7YA 1Q66A 3G1RA 4ZBCA 3GVVA 1BD0A 3R10A 2JFEX 3DKLA 4HNOA 1PDZA 1E70M 1TA3B 3FDGA 4PB3A 2QT3A 1Q8AA 4HOWA 5U7SA 5FF2A 5LIKX 1W9PA 4KCTA 3EWZA 3H26A 1US2A 3V0UA 2DZPA 1LWIA 4DWSD 2FFCA 5EKYA 1M5WA 2FPYA 4W93A 3CT2A 4RV8A 1VFMA 3IJQA 4X63A 1CW2A 1KTBA 1JYNA 1Y65A 2XSXA 3SRDA 3QH2A 4GO9A 1GVYA 1VFLA 4O57A 3LGGA 4XVDA 2OLHA 2V82A 4S3BA 3QV7A 2ZA2A 4I3GA 1I1XA 1PVNA 3WF1A 3LZ3A 3KWSA 1QU4A 3LOTA 1I75A 3DG3A 4WY0F 3MP4A 3WUBA 4LCRA 1QW9A 4EP8C 1WXJA 3G1VA 3LM7A 5FF7A 1BYDA 4AFYA 2PDJA 2ATMA 2DZXA 2Y5SA 5XIMA 3OEXA 4N6EA 3D5HA 3NZPA 4AWSA 2QAFA 3TNBA 3ZR6A 3KFTA 4AB4A 3HMCA 2ZVRA 1HTIA 4CQAA 4MIMA 4EIVA 1HL2A 4XVEA 3QC3A 4XD5A 5RUBA 3LI1A 1O60A 4H9UA 4LCSA 5JBDA 1XM3A 4D2JA 4LYKA 3MZNA 2GJLA 1SFTA 3ARZA 4B4HA 3QQ0A 3QVQA 3F1QA 5LNWA 1E0VA 4FXJA 1NDWA 5TNVA 4H41A 1HP5A 4UNIA 2QVHA 1XUUA 1JXKA 4DJDC 4AHQA 4JTHA 4YL2A 4IGHA 4ZL1A 3LV6A 4NAFA 1A4MA 1G69A 2VC9A 1RA5A 4N7QA 1Q13A 3JRKA 1F3TA 3BZGA 1ICPA 4LANA 1K4HA 4PYSA 1SJBA 3AXMA 1QI3A 3VNIA 3W7PA 5HR6A 4Y9MA 4MWAB 4DJDA 4IFKB 2J77A 4PULA 4FHAA 3N34A 1CEOA 4KRTA 1Y5WA 3PR2A 4MM1A 1LWJA 2L5HA 1O5QA 4HA3A 5C8BB 1K8CA 2YOCA 1B3ZA 1UROA 3FK4A 2VVSA 3WUFA 3WMBA 4HPHA 3EX6A 3POCA 2Y61A 3W7JA 1NIUA 5CPOA 3MBFA 4XIAA 1JPIA 3OBEA 1ISZA 5DMLA 1AJZA 4W7WA 3BTNA 1G4TA 1EPXA 1QT1A 3EX4A 3QF0A 5LA0A 1XYFA 4AUBA 1W5NA 4GPNA 5EBUA 3CIWA 3VGEA 3W2NA 3QN3A 4LVFA 4CCZA 3TA9A 5TQLA 1IGSA 1M68A 2VZOA 4IICA 1Z3NA 1WZKA 2C16A 3KS6A 3KCOA 2F6UA 3AHVA 3GKAA 4ICMA 3WQCA 1LROA 4OOUA 3SCRA 4L1XA 4PA8A 3C61A 3DFOA 4C6PA 1UP3A 3W86A 1A3XA 2QR6A 2J4GA 3L68A 4JN6A 3PG9A 3ZR4A 1C8VA 1GG1A 4M5PA 1A47A 1RP8A 2PF0A 2E77A 4AH7A 1ISXA 3TWAA 2ISWA 3T7VA 3C4UA 3CL8A 4PTXA 3CL7A 3LPFA 1XD1A 3PBWA 1K02A 1BWLA 3ZT5A 3C0SA 3IRDA 4DI8A 1PKYA 4LRSA 1R9ZA 3THCA 3MBDA 4HT3A 4C6LA 2DORA 5IHSA 2OSYA 3NNTA 3ARTA 4KCWA 4QP0A 4O1CA 3ZSTA 2E28A 2NXIA 1ZPTA 1X8CA 1BAGA 2YW4A 3QPYA 1IF2A 4S3EA 2YCLB 3O63A 3MDUA 3LCLA 1XYAA 3GW3A 4V1YA 4WCJA 2C13A 1WDPA 3G24A 2Z24A 1DEDA 4AWEA 2OOFA 1YKWA 3H21A 4BZYA 3N9RA 1BYBA 2HS6A 3HJZA 4GI9A 4NJKA 4CQ9A 2VZTA 3RCMA 8XIMA 1ODZA 2ZRVA 1XCWA 2YL8A 3U6WA 3VNMA 1FX6A 5JQ9A 2FQIA 3WF4A 3ONBA 5G4HC 2C1IA 3QV8A 1UQZA 1YPXA 1KKRA 1E3ZA 5K9XA 3UERA 2I7GA 5HUPA 1KB3A 3S47A 2YXGA 4FF7A 2VQUA 3SQMA 3N9KA 3EKZA 4TR9A 4KEMA 4GACA 3AUOA 1BSLA 3QFWA 2ZTKA 2WWCA 3ZVHA 4B3LA 1CLKA 4M6QA 3HFTA 4KGJA 4XAFA 3VU2A 3RDKA 4S38A 2WKGA 4MZ1A 4DYKA 3E0LA 2YPIA 5I0DA 4XK2A 2W27A 4NKCA 3DECA 5REQB 3WFZA 3VABA 1SO5A 3CWNA 3VOGA 3SADA 2BNJA 2DVUA 1R2TA 2DZAA 3G6MA 2A6LA 5EY5A 3WDHA 4ZFCA 3IUHA 1F73A 3G0XA 3LEPA 1OX4A 3N4AA 3F2DA 1P6CA 3S5SA 5CGTA 3GU2A 5EGRA 1TPB1 1KFWA 1IIGA 1NWTA 3AZRA 4DO6A 4FOKA 4RZ5A 4PUUA 5BXSA 1K03A 2FLIA 3B9EA 4BWLC 2X1IA 1P0NA 1A5CA 2DUAA 3NG3A 2CPUA 3H54A 3B8IA 1LORA 4GJJA 3ABZA 4Q22A 2C6QA 5E9XA 1KBJA 2J9YA 3AZTA 3HB9A 3HBLA 1CPUA 4F2TA 2UWFA 4GVHA 4XQ6A 2CLPA 2J75A 3G1AA 1FOBA 4UOQA 3W26A 3GVQA 1PZ1A 1JCLA 1I2PA 4JIPA 4G9PA 2VX6A 3BAXA 1M3UA <