3M7WA

Crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m7wA00
2XFWA 3IVSA 4RZ6A 4UTTC 1LOQA 2X1TA 4WX2A 3O63A 5MHBA 3HIJA 1O5XA 2FB2A 3R13A 1FCVA 4PA8A 4ADTA 1JCNA 1UJPA 3EX6A 4X2RA 5H2ZA 3BARA 3M43A 1XM3A 2DU2A 2ZZ7A 1W3TA 3QSRA 1VCGA 4O0ZA 3FLUA 5EKYA 1TPWA 2A1YA 3I68A 5HMSA 1GVSA 3W7PA 4QISA 3TMLA 3NXFA 3SR7A 4IUOA 4LU0A 2Q8LA 1MO0A 5E1QA 4MZYA 4L4MA 4Q32A 5F2MA 1BEUA 1GYNA 4Q4KA 1B57A 3WJXA 2WSQA 3DBPA 3O06A 3PF3A 3W7HA 5I3GA 3Q58A 1L2UA 3WJZA 5T26A 3W1PA 2KZHA 5AC6A 3W1TA 2TYSA 5LSMA 5AFDA 4S2BA 3ZS4A 5KZDA 4FB7A 5AHNA 3N9RA 3NQ7A 3DU0A 5KINA 5FEXA 1H61A 1YDNA 4FXSA 3LHVA 1T0OA 2EGZA 4N4QA 3UWWA 2NLIA 1W5MA 4QM1A 5LHFA 1M7OA 3DH7A 5K4XA 1KTBA 4JGDA 5I3FA 4UTUA 1JCXA 2Y85A 3I6RA 4C1KA 3NR0A 3PBVA 1A5BA 2A2IA 1OK6A 1VYRA 1H7NA 4IXHA 3DFTA 1W31A 3RNDA 4TU1A 4UTWA 4AXKA 2I1OA 3QEZA 1BTMA 2P10A 4UXDA 4O1AA 4LTSA 4QQ3A 4A2SA 3M5ZA 3GB6A 3LRKA 4X9SA 4Y9AA 1N7KA 2NX9A 4O57A 3B4UA 1LBMA 1OX4A 2PC4A 1TPDA 1TB3A 1TPC1 4BK9A 2CLIA 1UCWA 4FNQA 1Q6RA 2R14A 2TSYA 3T7VA 3S5ZA 3QSTA 1A5SA 2J9ZA 4J9JA 4LVAA 2J27A 3G0SA 3LCHA 4MJMA 5HINA 3W7KA 3W2UA 1TMHA 2QUUA 4AHOA 2QAPA 4O13A 1RR2A 3L0NA 1O94A 2Y89A 5BMXA 4UIOA 3KXQA 4JTFA 3NL5A 3PUDA 2DZSA 1SFLA 2DZUA 2EPHA 1W5PA 5LGXA 3C6CA 5G1YA 3L0KA 5DBTA 3BG9A 1E51A 4K8EA 5DBUA 3D0CA 1XUZA 1YXDA 1UUOA 4QAIA 3DKJA 3THQA 3PS7A 3STFA 3KFTA 2WV8A 1IIHA 4AHQA 5KZMA 3AJXA 4RJEA 3UY7A 5G2IA 1DJNA 3KRZA 3NPUA 1S5TA 4JX6A 5K9CA 1NSJA 1Q6QA 1MXSA 4PODA 2YW4A 3LLDA 1EP2A 3MMTA 4HNTA 1ME8A 1NFBA 4EF9A 3P84A 1NAL1 1KBIA 4I7UA 3FKRA 2CLKA 4XKYA 3S6DA 1U83A 1IXOA 3W2NA 1FXQA 4IMDA 1EP3A 4W9TA 1TO3A 4FIQA 2E5CA 1T8XA 2GOUA 3ABOA 4OV4A 4O1CA 4P2VA 2V0TA 1K7FA 3E49A 5DXXA 1WYIA 1AMKA 5DXYA 2FB3A 3W1NA 3MHFA 3QFEA 3PAJA 3M5XA 4DXVA 1EUAA 3P82A 3QJAA 4NNAA 2VENA 2A7PA 1XBYA 1OFEA 1MEHA 4GXMA 3N2MA 4DF1A 4ADSA 4IQLA 3NYZA 4O16A 2G95A 1XDLA 4LC6A 5HJLA 3G0XA 3LCGA 1CX9A 5F4XA 3W75A 1JRBA 2ZYFA 4JD4A 4JDYA 4ZMGA 3TNOA 2CLOA 4MZ1A 1ICQA 1RZMA 1JQVA 3GKAA 3RLVA 1LORA 4LWWA 1C8VA 1JJKA 2A21A 2YR1A 1S5VA 3W2MA 2Q3OA 1SZGA 3S5NA 4ICNA 2DZVA 5KSWA 2ZZ6A 2NX3A 4LS0A 2Y7GA 3QMSA 3E12A 4ZQPA 1KFLA 3T78A 5LNWA 3TXZA 3GIYA 1GTEA 2A6LA 5D09A 2Y7DA 2FDSA 2C15A 2C14A 3GLCA 1FWWA 2ZRUA 3SFKA 3PSWA 3KRSA 2ABBA 1ADOA 2QR6A 5IBXC 3S1VA 4IMCA 1I8JA 3VCRA 5AN7A 3W73A 4MJZA 3KVMA 1F05A 3STEA 3TCEA 4PH6A 3M47A 3WK2A 3NQDA 4NQ1A 3MBDA 1SZFA 2CLLA 2DP3A 1KTCA 3SZ8A 1K02A 2QCCA 3LGEA 3W23A 1G4TA 1O5KA 2WSRA 3NGJA 2Y88A 2E77A 4JICA 1NF0A 3NG3A 4WY0B 4TR9A 3TUUA 1K8YA 4JYFA 2E09A 1PS9A 4OE7A 5A8GA 4EF8A 4HPXA 1IGSA 5FI8A 3SSJA 5FF3A 3TE9A 3VI2A 1GJPA 1GVOA 2H6RA 3ANYA 4H4IA 1G4EA 2QUVA 3O6YX 3HQ1A 2ATSA 2J6XA 3W3OA 1LCOA 1OFBA 2NV1A 4N9DA 4Z0JA 4DBDA 5AOUA 1EUNA 5D30A 3EKLA 3DGRA 4BR1A 3EX1A 3DENA 4FNSA 3TJXA 3W7QA 1ZY9A 4QJ1A 4R7JA 1X7FA 4EIVA 1EP1A 2YW3A 3PR2A 1ZAHA 4HT3A 3QMRA 5BW6A 5KTLA 1I2PA 1FWSA 3TQVA 4JIQA 3W87A 3NQFA 4MFEA 1RPXA 4UTKA 4LV9A 2I9EA 3HOJA 5CPMA 4K7VA 3OG3A 1VJIA 4IX2A 3UYCA 1ME7A 2TMDA 1SSGA 2ZDRA 4CCEA 3L21A 3FYPA 2VFHA 3NQ6A 1PL9A 4WJEA 5FEZA 1FY6A 3Q94A 4HPJA 3MHGA 1D3GA 3LHUA 2QCGA 3A5VA 4ZQCA 3SGUA 5DY2A 5HNRA 3C3NA 2QF7A 1R2SA 3DI1A 3LRMA 2BWGA 3H55A 2JGQA 4NT0A 5C2XA 3M0ZA 3P81A 2ZA1A 3IIPA 3NA8A 3DFSA 3LTSA 1VR6A 3S5YA 1Z42A 2ISWA 4Z1DA 3NQ8A 1U5JA 1ONRA 3W07A 3WK0A 1FXPA 3CU2A 5K4ZA 2G97A 4HSNA 3TU9A 1Q6LA 3LTYA 1LTDA 1KBJA 1QMLA 3P7YA 2FTPA 1Y0EA 2B7PA 3UPWA 3PY2A 4IX0A 1LOSA 3LCXA 1EEPA 2VC6A 1BWLA 3CC1A 2ZZ5A 4NJKA 4NVTA 1OF8A 4JNMA 3W2LA 4O14A 1QOQA 2NXGA 2X30A 3H54A 4I9AA 4O18A 4YL2A 4JTKA 3FOKA 1VRDA 2R91A 4GRSA 4MY9A 5F1VA 3INPA 3PB2A 1QOPA 1ICSA 3W85A 2WPBA 3W9ZA 4XBSA 1KM6A 1ZCOA 3EWUA 3G1AA 1FCQA 4ORMA 5A5WA 2YPIA 5E0KA 4IXXA 1S5WA 2HMCA 4RLIA 2VFGA 2E5DA 1B4EA 1TPEA 1VPXA 1H1YA 3T4CA 4TO8A 3JS3A 4KFPA 1TJRA 1GPWA 1KFKA 1K8ZA 5FESA 2W0UA 4LV4A 3LV6A 3PG8A 4DO4A 4LUIA 3FYOA 5TQLA 4XWUA 4UNLA 3HG5A 2QDHA 4EVZA 2PRMA 1WBJA 3PG9A 3W7OA 3UZJA 4OV9A 2QUTA 2G96A 3F4WA 1W5QA 2GUUA 4AAJA 3QQ1A 1TTQA 4MPQA 3BO9A 4UC5A 4ZVJA 3LCLA 4O15A 4JTGA 3L68A 3NEVA 3L0GA 1SQ7A 3TC7A 2WQPA 1R2RA 2RDUA 2VFFA 3TAOA 1A50A 2C16A 1TPB1 1JULA 4GWEA 3SI9A 2Z6IA 4QIUA 5D02A 2TPSA 1JRCA 3CPRA 3LXCA 2P1FA 5BMWA 1KV8A 2DZXA 5D38A 5LNUA 3PUOA 2E6AA 5G2HA 4DELA 2FPYA 2Z6JA 4M5PA 3TXVA 2DZPA 3PBWA 1BKSA 1D9EA 4YXGA 1GOXA 4Z1CA 3KRUA 3SIZA 3FS2A 3O07A 3OHIA 2RHGA 4FX6M 3VKJA 5HR7A 1QPNA 3OA3A 1T99A 2Y62A 3W7RA 2BLEA 4JR5A 5FF7A 1V5XA 3TR2A 1UBSA 4ALDA 2OT1A 1GZGA 5LNRA 3NZRA 2ZRWA 4TIMA 2GPTA 1OG0A 5SWUA 3EKZA 4UTLA 1W3NA 1HFBA 1WOAA 3G0UA 4O1BA 3W7JA 3BG5A 1FDJA 3ABSA 4Z0SA 2ATMA 4JTSA 3SECA 2C18A 4UUIA 1OJXA 4QNEA 3IIZA 4M6QA 2QCDB 2JBMA 3NL6A 5HUPA 1IIGA 3L9CA 3M44A 4I7VA 3SJ3A 3TSMA 1I45A 3L67A 2ZZ4A 4FNRA 3EX4A 1OYAA 2X16A 5D2WA 3NM3A 4HHPA 3QC3A 5G2WA 2EF9A 4N4PA 1EB3A 2YCEA 4NX0A 1F6KA 2WNNA 2GQ8A 2BXVA 1LLWA 3RK8A 1DL3A 2VEPA 2QAFA 3HBLA 4WOZA 4LOCA 4YLWA 3Q37A 3MP3A 2GVGA 1G67A 3W72A 3KVJA 4H3DA 4N6EA 1OX5A 3MYPA 5U4NA 1C29A 5D32A 2ZRXA 2XN2A 2Y61A 3DFNA 3N14A 4G1KA 2H8ZA 2CU0A 2V9DA 1FCUA 3HGJA 1W5NA 1K8XA 2NX1A 1LROA 1L9WA 2Z0IA 2J9YA 3KHJA 1DORA 5LGZA 3IIVA 1FX6A 3W2JA 4UR8A 1Q3NA 3W86A 3BW4A 4FHAA 1VCVA 4PC8A 4U4MA 3OVRA 3HGRA 3N73A 3MYOA 1GQNA 4FNUA 2CW6A 1Z41A 2YFOA 2GJNA 2VEMA 2A7RA 5E93A 3A22A 1VZWA 4K6AA 3UWYA 3MUXA 3PBUA 2XN0A 2WJZA 5FF4A 4ZL1A 5AHIA 3PWAA 4FX8A 3EXRA 5LNSA 4WXZA 3A24A 3S9YA 2PCQA 4GUIA 4XUGA 3N2XA 3W1AA 4LS1A 5I3JA 4JY9A 4IGHA 1J5TA 1OK4A 2NV2A 1XBXA 3TX9A 2VELA 3P8IA 3IVTA 4AB4A 1RQHA 3EXTA 4GC4A 1GG0A 4FNTA 2OX1A 5IBXA 3B0VC 1XFBA 4UMAA 4WD0A 5AYYA 1VLWA 3C0JA 1P5BA 3S1WA 1SU5A 1FWNA 1R30A 3GNDA 1K03A 3WFAA 4JX4A 4GUJA 4IWWA 3NM1A 3NQ2A 1ZFJA 1RVGA 3LX9A 2GVLA 1YLVA 3HB9A 3G8RA 4N6FA 3W70A 2BX7A 1QAPA 2DZWA 3ABQA 1HL2A 3LBCA 4MLRA 5HR6A 4P61A 2VFIA 3KAOA 1VH7A 3MP5A 3DFPA 2OT0A 2J88A 2CZEA 4R53A 2QJGA 1LBLA 4FNPA 1MSSA 2OJPA 5CKSA 3WJYA 2NUXA 4XTIA 4UR7A 1H7XA 1SO3A 1KFCA 3KX6A 1SFJA 2GVJA 2RKXA 4KKXA 4JXCA 1DOSA 4NX5A 3CM4A 1EA0A 4A21A 4XQ6A 3LI0A 4FX7A 3TH6A 3ATYA 1OFOA 3G1SA 5L6UA 2RFGA 1D3HA 5ABTA 3GAKA 4GFSA 4UTJA 1WAUA 5C6MA 1F73A 3LDVA 1F74A 1VHCA 3UWVA 3TQ0A 3UZ5A 3TFCA 4O53A 2ZTJA 4QITA 5DCEA 2B7NA 5F1UA 4WY0F 3B8DA 2CZDA 2A4AA 2V82A 4JN6A 3M16A 3BK0A 3W1RA 4O8RA 3PULA 5I3KA 1PCWA 1MEWA 2ZA3A 3CT7A 3S0CA 1KLZA 1VQTA 4NJJA 4K37A 3TK7A 3KOFA 3CLMA 3GXTA 1LOLA 2NUYA 1QDSA 3N9SA 4NZJA 1JVNA 1OABA 1G7VA 4GUFA 3DI0A 3U6WA 1GVFA 2VFEA 1G69A 2X2GA 2WO5A 3IGSA 4K7YA 1X6UA 3IGUA 4NZFA 3W6YA 3EXSA 2DORA 4ZQNA 3HG4A 3RF9A 2EHHA 4JTTA 1WXJA 4CQAA 3LERA 3GXPA 5EBUA 4DBEA 5DCDA 2VXNA 1OFRA 1DHPA 1F2JA 4B5NA 2DJXA 4OBTA 1YPFA 3MWAA 3RMJA 3FJLA 3MJYA 2QCLA 1OVDA 4U28A 4S2CA 4O52A 1TRIA 1DVJA 4O12A 1TV8A 2UV8G 3RLUA 3W7EA 5H91A 3W1XA 1X8FA 3W1LA 1LZOA 4K36A 4R34A 1O95A 4Z1AA 1HO4A 1BWKA 5LKYA 3T44A 1N8FA 4CQ8A 4NXKA 1ALDA 2E1DA 3PC0A 4OU1A 3B0UX 1QR7A 3C2FA 2YZRA 2ISSA 2YYTA 2X1UA 3QYQA 4AWSA 4PL2A 2J9XA 1ML1A 2BTMA 5G4WA 4K38A 4RXFA 1H5YA 1XL9A 1VS1A 3PVFA 1TV7A 1FWTA 4JY8A 1JUKA 1K3UA 1HO1A 4I7WA 2AGKA 5AHLA 4IJBA 2R8WA 4MFDA 3G1HA 4DF2A 1LLZA 3LXBA 3M5VA 2YGYA 3BGGA 1AW5A 4PCFA 6TIMA 4TMBA 1IXQA 3BW3A 4KWVA 1H51A 3CEUA 3CIWA 4MOZA 5AYXA 3O6DA 5L9FA 1M6JA 3UWUA 5GVJA 2H3BA 1JR1A 4LUJA 4N02A 3GR7A 4DPPA 3SGZA 1YXCA 3P67A 3OVPA 2Z1BA 3E0IA 1XKYA 5CGQA 2ABAA 2EKCA 2Y7FA 1EX5A 5FEPA 3I7QA 1QCWA 3AO0A 3P74A 1FDZA 3EWYA 2E6YA 4N9BA 3HG3A 2CZFA 1YPIA 1O60A 4MKNA 3A21A 4UFMA 3GXNA 1KA9F 3W83A 4M6PA 4UCGA 1M7PA 1W54A 3UWQA 3EWBX 2C19A 2P0OA 4O4WA 3UPBA 5LZLA 4O11A 4DEFA 1ZJIA 5BOOA 1AL7A 3K30A 1ZENA 3O6CA 4Z1BA 1SO6A 3GDTA 5KITA 1TTPA 2ZZ1A 4AF0B 1I2OA 3I65A 1I2NA 3R89A 5LNVA 5J5DA 3LCWA 2C13A 2V8ZA 1KM0A 3BV4A 3DKLA 1ZHAA 1JQXA 3JRKA 3C2OA 4AH7A 3L2IA 3GX9A 5HWMA 2WKJA 3NAVA 3F03K 3O1NA 2QJIA 4M19A 3LXAA 2NWSA 3N3MA 3ZWTA 3G18A 1JUEA 3OVQA 3M1ZA 3M7WA 4N9CA 4UNKA 4Y6GA 4WOQA 3GNNA 4BF9A 2W79A 3QM3A 4DF0A 3BPWA 5DLCA 1TIMA 4R33A 4WUIA 4LW7A 2XN1A 1LRTA 2V2DA 1Z48A 2LLEA 3Q2DA 1Q6OA 1WV2A 1TPH1 3TC6A 3STGA 3TKFA 1OFQA 5KZEA 3MW7A 1FWRA 1OFPA 3TSBA 3LRLA 2Y7EA 1AL8A 4UFKA 5G1TA 3GDLA 4RKAA 1XCFA 2C3ZA 3NQMA 3E02A 3CQ0A 4CQ9A 3TAKA 8TIMA 3V1PA 4JDBA 2OCZA 3NQEA 4LVGA 1GT8A 2ZRZA 4CNNA 1QPOA 2HSAA 4O50A 2PRHA 2HTMA 1TJPA 2D73A 4HIBA 3W84A 3GDKA 3B05A 4ZZ9A 3H53A 1YDVA 5DCBA 1WBHA 4HSOA 4FEZA 2Y6ZA 4WXYA 4Y90A 5HWJA 4IOTA 5AHEA 4Q33A 1CI1A 1AW1A 3BLEA 3M5YA 4O4VA 1OFAA 3R12A 5K9DA 3N34A 1A5CA 5D05A 1UB3A 1W37A 4ML9A 2V2HA 1XXXA 4O19A 3QW3A 2AQWA 1P4CA 3TSDA 2X1SA 4XKYB 4LC8A 1NVMA 3HF3A 5AC8A 2GQ9A 2RDWA 2E68A 4JTIA 4Y8FA 1TPUA 2E5BA 2E6FA 4Y96A 5CG7A 1S3HA 4RK8A 1DKWA 3TIMA 4YCPA 1XUUA 3HGOA 2B7QA 1LDCA 3MO7A 1I4NA 5D2XA 1LRNA 5CSSA 1VYSX 4AF0A 3TMQA 3THAA 4E2BA 1SW7A 1P0NA 3ATZA 2BSLA 1F76A 3P61A 4CCCA 1PHWA 1RQEA 2V30A 4YMZA 3VNDA 3I7SA 1G7UA 4ZQRA 3F1QA 5EY5A 1KM2A 3QPZA 4MYAA 3CWNA 1SO4A 1YYAA 3NQCA 3WK1A 4A29A 5LHEA 2W6RA 3NL2A 4NU7A 3QRHA 3P62A 1TREA 3CB8A 1FQ0A 3B03A 4CLMA 1XBZA 1JUBA 4UFIA 5D2YA 2JK2A 2YX0A 3IV3A 5F2GA 4XZ9A 1PHQA 5FEWA 3O05A 1OF6A 2JGYA 5F4WA 3EEGA 1DQXA 3T55A 3G1XA 3CIXA 4MIMA 3UQNA 2ZCGA 3IIOA 5TIMA 4UFJA 1VC4A 2Q8ZA 1W8SA 2FQIA 4NJGA 3TJLA 3W88A 1IXNA 5EA9A 3NPXA 1H7WA 3QW4B 3IIXA 4OQVA 1RQBA 3PSVA 1SSDA 1W1ZA 4JTJA 5J5RA 3ZFHA 4RV8A 1G6CA 2VEKA 3M9YA 5DELA 1P0KA 3GVGA 3O16A 4LRTA 3HG2A 4NJHA 2Y63A 5HUOA 3GYEA 3L65A 5FF0A 3LHTA 3NVTA 2QCHA 3MI2A 5BRBA 3NOEA 3BVJA 3DHFA 5G5IA 1SW3A 4X22A 5EL1A 4KFOA 2QKFA 4E38A 4O10A 1UUMA 3HO8A 1F7BA 2ZFAA 2J24A 2F84A 3P5ZA 1K7XA 2Q3RA 1ZNNA 3TDFA 2BZNA 2Y70A 3SW6A 4BI6A 1VCFA 4OWGA 1RD5A 1TPFA 2O7QA 1KFJA 1UASA 1B4KA 3G8EA 3OEXA 1NF7A 5U7SA 2PURA 1H1ZA 1IF2A 2HS8A 3NZ1A 3G3MA 3GR8A 3FIGA 4ORIA 1JCJA 1GTHA 3W7MA 5CZSA 2VKZG 4GUHA 3LM7A 5D03A 3W1MA 1ZAIA 5EMUA 2Z2UA 3LI1A 5DY3A 4S1FA 3NDOA 2HS6A 2YYUA 5TBOA 2NXIA 4MVAA 3UXAA 3QH2A 3NQAA 5K9XA 2FLIA 5I3IA 1V7YA 1WOBA 3L5LA 2C0AA 4RZ5A 3USBA 3LOTA 1H7RA 4A2RA 3LTPA 4JTUA 2O7SA 2YDAA 4MZ8A 5K3VA 3NNTA 5D2TA 1FCBA 2QJHA 3HMJG 4MUZA 1F5ZA 1G4PA 2G5WA 3TA6A 4UMBA 1VGAA 4TMCA 2GJLA 3T40A 1G4SA 3ABRA 3UXDA 2QEZA 3W76A 3GKFA 1EPXA 3VE7A 3P60A 4OGZA 1WX0A 2FPTA 1W0MA 1MZHA 1KM1A 5D2VA 3VFLA 3OBKA 3HPSA 2QCFA 3NL3A 4OT7A 2ZQ0A 5HULA 5D04C 4E2DA 4JTLA 1QO2A 5F2IA 3EB2A 2FIQA 4AEOA 4FO4A 1THFD 1TSIA 3LBMA 1YXYA 5K2ZA 1LBFA 2PE4A 3E9AA 1J4EA 3M6YA 2WNZA 1XC4A 3BG3A 4PL1A 1H62A 3G1FA 1KW1A 1TPVA 3QZEA 2CFFA 1YTKA 1DJQA 5AC7A 1SZEA 3STCA 3ZR4A 4JIPA 1MEIA 2B7OA 5CSRA 1KLYA 2OZ0A 4M6VA 3R5EA 3GAYA 2ZRVA 2YSWA 1TYGA 4AWUA 3L66A 2JKAA 4MYXA 2VEIA 3G3DA 3LB0A 2ZZ2A 4NUWA 3B06A 1DBTA 1SZNA 1QPRA 3W22A 3DAQA 1L6SA 2QDGA 3DXIA 4QSHA 3GDRA 1FBAA 5CPOA 3CTLA 3W7GA 3ZWSA 4NJIA 2V81A 4ADUA 1PV8A 1A53A 3LLFA 3P80A 4GUGA 3YPIA 4O0KA 3VE9A 3MI6A 1SO5A 2CLFA 3FJ6A 3LHZA 1AK5A 2DJLA 1VHNA 2B0MA 3IGXA 1YADA 2V2CA 3CEPA 1GYLA 1JCLA 2RH9A 4O17A 4BWLC 5EYWA 3B04A 5CZTA 3TQKA 1W5OA 1I2RA 3G1YA 2A85A 2FPVA 3A23A 4NNCA 3TFXA 1H50A 3GK0A 4M7TA 3S5OA 2VOMA 3S42A 7TIMA 3GDMA 3WJSA 1TQJA 4CNOA 4UTWC 1H7OA 3KVLA 4EOUA 2ZTKA 4AVFA 1QWGA 3E96A 2A0NA 1H63A 1WQ5A 3F4NA 5G4EA 1TCDA 2EAWA 3C8FA 1EWEA 4KFNA 3MI3A 1YTDA 5D37A 3C2EA 1B3OA 3C56A 1GG1A 1EWDA 4FXRA 1NEYA 2CLMA 1AW2A 2GQAA 3LCIA 4UTMA 5I3HA 1GWJA 4JX5A 1J2WA 3W2KA 4QNWA 3B0PA 3MP4A 1KM5A 1TV5A 1XI3A 4MY1A 1QFEA 2FFCA 4D2JA 5DN1A 3QQ0A 4N9EA 1W56A 4A22A 4LVFA 4LNYA 4JYDA 1OX4B 3P5YA 3C2RA 4JYEA 2A5HA 4M7SA 4ONVA 4YCOA 4L4LA 3RFAA 4JTEA 1ZALA 5AHMA 3ELFA 3OIXA 2QCMA 2E6DA 2TRSA 3C4UA 3G1DA 2OMAA 3C2VA 4UFHA 3R8RA 1TTJA 2NWRA 4IMEA 1DQWA 1O4UA 4Z08A 4FIRA 1SR9A 1T96A 4CNPA 1VLIA 3QMTA 1PE1A 5BNKA 4LRSA 3EWXA 1F6PA 2X1RA 4PTNA 4RXGA 4BI7A 2JKEA 3L5MA 1WDWA 4ZQOA 1KFEA 4GNJA 2CZ5A 4O28A 4H6KA 3PBYA 4AHPA 4NNBA 3W7NA 1M5WA 3HPZA 2YXGA 4ZQMA 1W3IA 5KMYA 1OHLA 5C55A 1B9BA 2AAMA 4XBKA 3HJZA 1FDYA 2CWNA 3JR2A 5CZ0A 4K39A 4UTTA 3NPWA 3IEBA 5C54A 3SY5A 5HQEA 3W71A 3GZ3A 2F7FA 4GBUA 2CLEA 2FJKA 4POCA 3W1QA 2IQTA 3G1VA 5AB3A 1R47A 4WZHA 1R2TA 2CLHA 3FEMA 2H8XA 2C6QA 4JEQA 2JKPA 2NZLA 1TRDA 4NXSA 3A9IA 4LVDA 3W7DA 2ZRYA 1LM1A 3UD6A 4GE8A 3S1UA 1H60A 1LYXA 3DHDA 1OX6A 2R94A 3LHWA 1FUYA 2H90A 3TW7A 3NPVA 3C52A 3LCFA 3V75A 3L5AA 5CPLA 2ZA2A 4N2YA 5HWNA 2H3DA 3M41A 1TTIA 4YWIA 4RR4A 1LP6A 3I7RA 3DFOA 1SPQA 2A7NA 4JTHA 2V5LA 1KTNA 1SW0A 1X1ZA 3O15A 2QCEA 2I14A 1QNVA 3S1XA 1PIIA 3FFSA 1L6WA 2V5BA 1I2QA 4LY8A 4AMAA 2ZZ3A 1KV5A 3IVUA 4IPIA 1YDOA 3WJWA 4A3UA 1P1XA 5FF2A 2WOQA 1IXPA 4LT9A 3NO5A 1PCKA 3MHUA 4WQ6A 1C9DA 5K7JA 1ME9A 1KM4A 2ALDA 4RCXA 5EPDA 1XBVA 4JS3A 1X1OA 1K7EA 4DO6A 3C61A 4DO5A 2PRLA 1CW2A 4DPQA 4XTDA 1VYPX 4E0CA 4RX0A 4BWLA 5F2LA 3HGSA 3CWOX 4PFMA 3UY8A 3U8GA 1PVNA 2WSYA 2B4GA 2WNQA 3EWZA 4BFAA 3NQVA 3BGJA 5CZJA 2ISVA 3MBFA 3PM6A 3TV8A 4MY8A 3UWZA 3G24A 1JCMP 3W7IA 5F4SA 4IMGA 3CHVA 1N55A 3R2GA 5IM51 2C1HA 1TQXA 5AHFA 4KWWA 4LS2A 1RV8A 1ZAJA 2VFDA 4HKPA 3FKKA 3DZ1A 1HTIA 4EWND 4X3ZA 4GJ1A 4UTHA 1GVRA 1HUVA 1WA3A 3O8AA 3BLFA 3P8JA 1HG3A 3G22A 1YTEA 1A5AA 3WK3A 1AG1O 1QPQA 2ZBTA 3FA5A 3HPXA 3KVKA 4HNUA 1GVQA 3TW6A 1EIXA 3S8HA 3EX2A 3W7LA 4AWTA 2DZTA 3PUEA 4HNNA 1XDMA 2NUWA 4IMFA 4LVBA 1QO5A 3IRDA 3QF0A 1Q45A 3LHYA 5AYZA 4HNVA 3NQGA 3BLIA 1OYCA 3EWWA 4O1DA 6ALDA 1KFBA 3N19B 4BI5A 4FF7A 4OHQA 1GEQA 3QPYA 4O54A 4RZ4A 3U2OA 1SUXA 2A6NA 4K8HA 3A5FA 4CCDA 3W1UA 4HN4A 1OYBA 4UFLA 3EX3A 2NXHA 5CPNA 4IPJA 3W74A 4WY0A 3RU6A 1KM3A 2YFNA 3DFQA 1OFDA 2QCNA 2QCDA 1H7PA 4TX9A 5D33A 3TROA 2RDTA 3BW2A 4UMCA 3LV5A 4UTIA 3UNDA 3PB0A 4DQWA 1JCYA 1R46A 1DV7A 4MLJA 4PEKA 1L6YA 1Z44A 1LRQA 1ICPA 5C5YA 4C1LA 3W7CA
chains in the Genus database with same CATH superfamily
2D2HA 2PZ0A 4UTTC 3QLDA 4WX2A 3O63A 4J5NA 4DBWA 3RJXA 5MHBA 1FCVA 1UJPA 1WB0A 1JDDA 5JU6A 3QZ6A 3D47A 4GK8A 9XIMA 2DU2A 2ZZ7A 4JCLA 3G1RA 3IAPA 1EQCA 3ITGA 3KCJA 5EKYA 5BXSA 4GPNA 3U7VA 1FH7A 3H26A 3I68A 1EJTC 1KCLA 2CHOA 4JPGA 3SR7A 1KRAC 4LU0A 3FYYA 5E1QA 4MZYA 4Q32A 5F2MA 3U2CA 4Q4KA 4C7GA 1QHPA 2OYLA 1Q8AA 3WJXA 3DBPA 4DAFA 3MC5A 3W7HA 5T26A 5AC6A 2KZHA 5LSMA 4S2BA 3CNYA 3IJQA 4OKDA 2WLYA 2GDVA 1PXGA 4GJJA 5KZDA 5AHNA 3DUGA 1H61A 1QNOA 4JHZA 4FXSA 3ARSA 2DT0A 5A6KA 3WG6A 2AL2A 2NLIA 2QJJA 4QM1A 2P50A 5LHFA 5BROA 1X6NA 5K4XA 3WBEA 4JGDA 2VZUA 3CV2A 6TAAA 4C1KA 1DP0A 4ZENA 3UJRA 3PBVA 1A5BA 4F66A 2DSWA 4REQB 1KQYA 1R3YA 1G5AA 4GYFA 1LF1A 2I1OA 3QEZA 4QE4A 2P10A 4O1AA 3RX4A 4A2SA 3LRKA 1N7KA 3EAUA 4NZ4A 4BS0A 3TLQA 3P93A 3ZLFA 2PC4A 3CUZA 1ITCA 3WF2A 4BK9A 2WJFA 3ZZ1A 3VOJA 1QI5A 2CLIA 2YIHA 4IIHA 4C6IA 4C6KA 2J9ZA 4GI8A 3LCHA 5HINA 3W2UA 1TMHA 1W9PA 4AHOA 3IJLA 3L0NA 5BMXA 5I03A 3N2CA 4UIOA 3KXQA 2PDQA 3NO1A 2PTWA 4XD3A 5DMMA 4MWAC 4H6QA 4K8EA 1ISVA 1XUZA 2L5HA 1YXDA 2WVTA 2W63A 3PS7A 5FL0A 2DZAA 4S3JA 3UG8A 2WV8A 4Y2WA 1HKMA 4H8VA 1TWWA 1T6MA 4RJEA 4E2VA 3T81A 3UY7A 2VMFA 5AZ0A 1DJNA 2VZOA 2I5GA 4DJDC 2WK2A 4PODA 1DWHM 2ISFA 4PMJA 3MMTA 1NFBA 4EF9A 4H8NA 2XIMA 1IYXA 4E4PA 2CLKA 3LY0A 4AD1A 4WJ8A 1FXQA 1M9HA 4C6OA 3WMCA 1EP3A 5DO8A 5DQPA 1T8XA 1V02E 1EZ2A 3R0DA 4OV4A 4P2VA 1EO7A 1K7FA 3E49A 1FWCC 2VYOA 4J3ZA 4KT2A 2PDKA 3W38A 4M3PA 2JE8A 1C91A 3URBA 1A0EA 4GYPA 2VDHA 3P82A 2VENA 1XBYA 1OFEA 3N2MA 4C6CA 1EGVA 3B8TA 4O16A 2YLLA 1PX8A 3WH5A 1UR1A 3I6EA 5BU6A 1ZJHA 3K5XA 2QMKA 1P43A 4JD4A 4JDYA 4QLKA 3TNOA 3CUXA 2Z7GA 1W3JA 3BLLA 2BASA 5B7ZA 2EKGA 3WQCA 1ZS2A 5I09A 4P7QA 2NV9A 3RLVA 1MYRA 1LORA 3KOXA 3C5QA 1C8VA 1S5VA 3BICA 4UZSA 3W2MA 3WLSA 2J7HA 1S2VA 4RNJA 3MSYA 2Z00A 5KSWA 2NX3A 3ITXA 3OLIA 3E12A 3CPGA 1KFLA 4MM1A 5D09A 2Y7DA 2FDSA 4PUKA 5A2BA 2A3HA 1JGMA 1FWWA 2ISDA 1UP2A 2HROA 1HJWA 3UG3A 2ABBA 3SCTA 2QR6A 2Y4SA 3S1VA 5DEZA 5AN7A 4PH6A 3NQDA 4NQ1A 3SFWA 4YVVA 3LPGA 3T07A 1KTCA 1V6UA 2WMHA 3W23A 1PB0A 2Y88A 2E77A 4FR1A 4BQ3A 1JPIA 3NG3A 4DWSA 2NQHA 4TR9A 4C6DA 4F3HA 3TUUA 5FACA 1FTXA 4OE7A 3W81A 4HPXA 3H2NA 2WPGA 3BQ6A 1QOXA 5LIYX 5FI8A 2VVSA 1GJPA 4B92A 4PRRA 5FCZA 1U1UA 3L4VA 5EBAA 1G4EA 1XLDA 3B0YA 2J6XA 2R1PA 2NV1A 1P6BA 1ZJAA 1NOFA 1EUNA 1Q85A 3MJMA 2GGEA 3QGVA 1PZ1A 2V3DA 3DENA 3VD7A 4OJYA 3SEPA 3ZJ6A 1X7FA 1EP1A 3PR2A 1FHVA 5BW6A 3W29A 4ZE4A 1ZGDA 4QBXA 3R11A 1ITUA 4QEEA 4LV9A 3VIHA 1J0KA 4JQ4A 2PTDA 1YHTA 4IX2A 4QG9A 2J6VA 1ZP3A 3SJNA 1ODZA 3FYPA 3EEZA 4FR6A 4R5EA 2OFJA 3OTRA 3RU8X 1GOOA 1O5RA 1Y8BA 3A5VA 1XV8A 5HNRA 1AH3A 4CNUA 1R2SA 3VYLA 4PRWA 3P81A 1O66A 3A4AA 3IIPA 3M0ZA 1VFFA 2YCLA 4UQEA 4O0QA 7REQA 3S5YA 1A5LC 3N13A 2VP8A 4INFA 2OQHA 2Z26A 5JBDA 1QATA 3ZR5A 3GFYA 3SRDA 1ECEA 1ONRA 3W07A 2HEJA 3KL3A 2G97A 4E8CA 1IE7C 1RPKA 1S2WA 1BRLA 1LTDA 4AMCA 3AIEA 1ONXA 3GFZA 2R1NA 3P7YA 5JQ9A 3QR1A 3PY2A 3U57A 3GYCA 3LCXA 3KDOA 4JFSA 1W3LA 3NDYA 2VUYA 4XB3A 1CWYA 2ZZ5A 4NJKA 2XM1A 3VM5A 4HMNA 1IWBA 1OF8A 5C9WA 2EG8A 2NXGA 2QULA 4O18A 5EMLA 4LBUA 4YL2A 3N4AA 3FOKA 4I9JA 1VRDA 4MB5A 4KW2A 1E6QM 3TYAA 1VKFA 1ICSA 1X96A 5FJIA 2WMIA 1ZCOA 1IHIA 1RAKA 3G1AA 1FCQA 1XYFA 4LAOA 3OGRA 4WDWA 5A5WA 2O92A 2WWCA 3WDIA 2HMCA 2VFGA 2PP3A 1TPEA 4MAZA 4PGLA 5CPSA 3BAYA 3JS3A 2GUYA 3GFXA 1TJRA 3G5EA 1EX1A 5FESA 2W0UA 4KGJA 5JIPA 4L1GA 3MU7A 3CMFA 1IZCA 5CAHA 1R9YA 4QE1A 4PMOA 3L7RA 2A3AA 3QVQA 4KF1A 2DIJA 1WBJA 4HA1A 3BANA 4AAJA 2GUUA 3QQ1A 3CJPA 1V7AA 3L68A 3VNJA 3L0GA 4AU0A 3TC7A 5C9UA 2RDUA 3TAOA 1XYZA 1XYCA 4QIUA 1S38A 4Y9OA 1JRCA 3CH0A 3CPRA 1I1WA 3PPCA 3B97A 1BKHA 3PUOA 5G2HA 2CC0A 3VD4A 2DZPA 3PBWA 5I78A 1BKSA 1D9EA 2BNJA 4Y7EA 3FS2A 2QIIA 3OHIA 1W91A 4FX6M 4H41A 1QPNA 3OA3A 1V3IA 4JR5A 5FF7A 1CGVA 3TR2A 2OQYA 4ZE5A 3TTYA 2OT1A 3UA3A 3I3DA 4LAZA 2GPTA 1OG0A 3VTRA 2VRJA 3G0UA 4O1BA 4AX7A 3BG5A 3IWPA 3W82A 2QXWA 4X2PA 1FDJA 2ATMA 4S3FA 2OYMA 3LM3A 5C8BB 4PFHA 4DVOA 3NL6A 4S39A 2CKRA 1G1YA 4I7VA 2ZZ4A 3MSRA 4G6CA 2XZ9A 3UNTA 8RUCA 5A6SA 5LIUX 5D2WA 2RGLA 1OT2A 5EMKA 4N4PA 1HP5A 1M41A 3RILA 1LWIA 4PMXA 3GTXA 3FDGA 1XKJA 3KVJA 1OX5A 3MYPA 3QR3A 4NZ5A 1JGIA 1BYCA 2D3LA 2Y61A 3GXDA 3DFNA 4MNMA 4CNSA 5BXTA 4R7WA 1X7IA 4G1KA 2FZBA 5JMUA 4IQJA 1IEVA 2F61A 3TTQA 2PPGA 2CU0A 3HFYA 3CZLA 2UZ9A 2NX1A 1TZ9A 2J9YA 2YL5A 3KHJA 4YYFA 1DORA 2X8RA 4CN6A 1ADDA 1FX6A 1E0XA 4UR8A 4HVXA 1Q3NA 3W86A 3BW4A 1NJJA 2E25A 2CKSA 5BZAA 1TUFA 3HGRA 4EK7A 2CW6A 2NVDA 2YFOA 2GJNA 3T0AA 4U2ZA 3E6EA 5CGTA 1R9ZA 4B91A 3T08A 4HNLA 5FJOA 3PBUA 1EYEA 3WBAA 3PNZA 1Q65A 2QV4A 1IT8A 3EXRA 4EP8C 3GTFA 1WDSA 3MCMA 3AHXA 3N2XA 1JD7A 5I3JA 5E6YA 2V6AA 1J5TA 1XBXA 3TX9A 3EXTA 2DUAA 1RA5A 3C2YA 4GC4A 2JEPA 3WNPA 4FNTA 2R82A 5IBXA 4WKHA 3B0VC 1XFBA 1Q2RA 3N6JA 1U2YA 2EPNA 1DHKA 3BQ5A 2ZDSA 1R3QA 1W8GA 3S1WA 3S1GA 5EMYA 3W53A 4JX4A 3LX9A 3LMZA 3NQ2A 1MNZA 3G8RA 3H7UA 2BX7A 5AYBA 2DZWA 1CZ1A 4S3AA 5HR6A 3B3DA 1Z8AA 2WC7A 1IEQA 3L4WA 2OT0A 1I0DA 2CZEA 3JUGA 1R8LA 1W9XA 2OSXA 4RW5A 3IV8A 4FNPA 3UPMA 4XTIA 3ARRA 1H7XA 4DUXA 2NQ9A 1V51A 5ABHA 4MKSA 3AMCA 4JXCA 2E67A 1EDQA 1EA0A 4A21A 3E0VA 3TH6A 3ATYA 1J11A 1D3HA 3NVDA 1ZBVA 3DGBA 1WAUA 4AZGA 1F74A 1D8WA 1K6WA 2WVVA 1N8WA 3WLPA 3TFCA 1O6IA 2XIIA 4GCAA 4XZIA 5F1UA 1V77A 1UP0A 3KBNA 4MNJA 1GUVA 4LY4A 2CZDA 2A4AA 4JN6A 3M16A 3BK0A 4GBDA 5I3KA 2VD9A 4NF7A 1PCWA 4QGCA 4GX8A 4JKMA 3CT7A 3W4RA 1VQTA 4QLLA 1OCBA 1YNQA 1LOLA 3E0WA 2NUYA 1QDSA 3N9SA 3F2BA 4GUFA 3U6WA 1W9BM 3BAXA 1N82A 1TV2A 4D1JA 3WD1A 1QXLA 3BCDA 4WK9A 3IUIA 2RDXA 2IXVA 3XIMA 2BV9A 2VRKA 3GXPA 1W1PA 4XD5A 4QEHA 4YTRA 1XLLA 2DFAA 1KGWA 1YPFA 3HPFA 2QCLA 4U28A 2QNEA 4S38A 1FKXA 4PBGA 3W7EA 4PBFA 2WCSA 3W1LA 4Z1AA 1HO4A 1R9XA 3CQHA 4WCJA 5C7HA 3N29A 2DIEA 3A4JA 2YZRA 1CIUA 2YYTA 1TE1A 3QYQA 4AWSA 4KERA 2J9XA 3P0XA 2BTMA 5G4WA 3BZJA 9RUBA 2PWVA 3L2MA 3AISA 2E3ZA 5AHLA 2R8WA 4MFDA 1LLZA 2G37A 3M5VA 6TIMA 4YTTA 4QJ5B 1CLKA 1DE5A 3HTWA 3UGVA 4LUJA 4AC7C 4A3HA 3GR7A 4DPPA 3CAVA 5GNZA 3PTKA 1VAHA 2MNRA 4DJDD 3E0IA 5CGQA 2Y7FA 5FEPA 2DQXA 3SN1A 3P74A 2WMKA 1YPIA 4M6PA 1TR1A 4XX6A 1W54A 3UWQA 4LFYA 2BOFX 1UWSA 3BWWA 4C90A 1F3WA 1DJHA 5T91A 3ITTA 5LZLA 4KEZA 4DEFA 1VBUA 4DXKA 2OR2A 3O6CA 2CETA 4D6CA 1TTPA 4TV6A 5A1AA 3WENA 4ACYA 1E6RA 4ZFCA 3DKLA 2OWCA 4GZJA 1JQXA 3QOMA 3L2IA 2W61A 3VNKA 3GX9A 3F03K 3LU2A 5E09A 1E6ZA 4AC1X 3RPDA 4D8AA 3M64A 4XISA 4XZBA 1MQPA 1Q63A 3G18A 2BFGA 3M7WA 2W3ZA 3LZ5A 5A3HA 4UNKA 5JH2A 3ARUA 3GNNA 3UJFA 3RM8A 5EMJA 1S5MA 1CLXA 1Z6KA 1SMAA 1K8CA 3M07A 4AIOA 4CU7A 2V2DA 3XINA 3IJ9A 2NW0A 1TWSA 1FH8A 4M29A 3STGA 3UCDA 4ZSTA 3O7UA 3EWDA 2WHJA 3LN3A 3MW7A 3HU7A 1FWRA 2OXNA 3TSBA 5M5DA 2YL8A 3DG7A 2YDSA 4ES4A 5AY7A 3E02A 3CQ0A 1PIFA 5JUVA 3KS5A 2BVWA 4JDBA 2OCZA 4DJDA 3T0CA 4ZEPA 3EMZA 5CLWA 2CLPA 1B54A 6XIAA 4WSJA 1F9CA 1TJPA 4HPNA 2D73A 1H49A 3OGVA 4XVEA 3W84A 1R86A 3B05A 4ZZ9A 4RUBA 2OVLA 1FFQA 2DH3A 4LANA 4ZB0A 1W1VA 1IZKA 4A4AA 2OWXA 3EA2A 3MSDA 4B2DA 5HMFA 2HZGA 1UB3A 2QDDA 3SCNA 3QW3A 4TXEA 1P4CA 3BXWA 3OGSA 2DZBA 4LC8A 1NVMA 5AC8A 3IK2A 1EEXA 3QHNA 2E5BA 2YBTA 3TIMA 4L80A 4RPPA 4Q8MA 4AF0A 3THAA 4MNLA 2FTWA 4E2BA 3AIRA 4JHMA 4JIEA 1RQEA 4ATLA 3W37A 1FWDC 4XAZA 4Q8TA 5E5CA 4WKAA 3QPZA 3WDPP 1CLVA 3NQCA 3WK1A 2PDBA 3L4XA 4HZMA 5LHEA 2W6RA 4GH3A 3P62A 3BC9A 3H6OA 3QBUA 1UWAA 2DW7A 4Q8QA 1LT8A 1VENA 1BYDA 4QRNA 2DSUA 5FEWA 1DWAM 2OSWA 3O05A 5F4WA 1DQXA 4Q4MA 3CIXA 4PMRA 4V27A 3UQNA 3PNUA 5TIMA 4CQBA 4UFJA 2PAJA 4HTYA 3AHYA 1W8SA 1FP8A 5M2FX 1IXNA 1R3WA 3CZEA 3NPXA 4D6DA 3MSGA 3TTOA 5I2UA 3QW4B 3PSVA 1W1ZA 4JTJA 4U33A 2JALA 3GXFA 4J4KA 3GVGA 5A8PA 1UR0A 4OIFA 3AIVA 5FF0A 3FEQA 1FWEC 2OLHA 2TAAA 3PZ9A 3RLHA 3OO2A 1PKMA 1PX4A 2QKFA 3EDEA 1QRQA 2FFIA 4E38A 1F7BA 2J24A 1QI3A 4W8AA 4L1XA 3CHEA 1H2JA 1K7XA 2Q3RA 3EDFA 3SUSA 5J04A 1VCFA 4QCEA 1PO9A 1JPMA 1TPFA 1KBLA 2O7QA 2V38A 1B4KA 3OEXA 2IPFA 1H1ZA 3RPTA 3IUHA 2OZTA 1JCJA 1XJBA 4Q7NA 3UR5A 4V15A 1ZAIA 2FMOA 2PS2A 5TBOA 4CD8A 3QH2A 1XRTA 2VWTA 2UY4A 3MO4A 3LOTA 4IP7A 5CLTA 2O7SA 4AZHA 5K3VA 5D2TA 1B90A 1FCBA 2QJHA 2PP0A 4C1NB 4GISA 1G4PA 1L6FA 3I10A 1VGAA 2GJLA 3ABZA 2BY3A 3MCNA 3UXDA 3W76A 1DTNA 1JL8A 3GKFA 4J2PA 3MZ2A 5D2VA 4PSRA 3VFLA 3HPSA 1AJ2A 1JZ7A 2EQDA 2QT3A 3NL3A 4YWSA 2ZQ0A 1WUEA 3QKZA 2FIQA 2JIWA 2E9BA 1P0EA 1C8XA 1GVIA 1GEHA 1YXYA 1E0UA 3TNBA 3VIOA 1Q13A 1J4EA 3FXYA 1TZ7A 4PMNA 2OODA 1XC4A 3BG3A 3HQOA 4PL1A 3G1FA 4ZOAA 5CC6A 4QAWA 2CFFA 1DJQA 4FK9A 3STCA 5JXQA 3IJIA 4JHOA 4JIPA 4Q4RA 4I5UA 2B7OA 5CSRA 3GAYA 4PUDA 1TYGA 2VEIA 2F6UA 2G3IA 1CGTA 2Z1SA 3WLNA 4X0VA 1QI4A 2I16A 1F07A 4FLRA 4K1WA 1KCXA 1QPRA 4W84A 2VGFA 4UNIA 1L6SA 2W67A 2ZE0A 4QSHA 1V0NA 4YJ5A 5CPOA 1JG9A 4PCTA 4NJIA 2FVKA 1Q6CA 3GS6A 4LEFA 2RAGA 4OUEA 3LLFA 1AFSA 4GUGA 3YPIA 3VE9A 3MI6A 3CUFA 3ARVA 1GHSA 1UWUA 1BTCA 3LHZA 1X38A 3EBVA 3CL8A 3POCA 2DJLA 1VHNA 1EH9A 1XLCA 4Q22A 2XVGA 4O17A 1US0A 3TQKA 1KWGA 3G1YA 2FPVA 3CK5A 3GK0A 4JOMA 4UOZA 3ZT5A 3WJSA 4UTWC 4BQ4A 2WJEA 4XO6A 1MW2A 3HJEA 2Y0FA 3FCPA 3WCZA 5CAKA 1H63A 1WQ5A 2BS9A 5G4EA 2EAWA 1EWEA 4HPGA 1YTDA 2KX9A 3C56A 1UROA 1ADSA 1EWDA 4L56A 4H8UA 2CLMA 3VPLA 1AW2A 3LCIA 4XG1A 2RGMA 3RR4A 1KM5A 1TV5A 5I07A 5H8PA 2JF6A 3PN8A 1TWIA 3R79A 4A22A 4LVFA 1N2VA 1OX4B 3P5YA 4LAUA 1YX1A 1A3WA 3LQGA 4H9MA 1P1MA 2A5HA 4HA4A 4Q8OA 1D7FA 1NWSA 5HBFA 1UOZA 1YE4A 3ELFA 3OIXA 2QCMA 1V08A 5CJNA 1U5VA 2BGSA 2GGGA 4UFHA 1QW9A 4W88A 4IMEA 1HP4A 3OB8A 4FIRA 4MJ4A 4NI8A 4LUTA 4L61A 1BYAA 1F6PA 2X1RA 4GVHA 1WDWA 4GOAA 2VO5A 4S3EA 1KR0A 2CZ5A 3SIMA 4NNBA 1M5WA 2V5CA 3HPZA 1HJXA 3R10A 2X0YA 3THUA 1OHLA 2ZUMA 1VIZA 1FDYA 2CWNA 3ZYZA 1MQQA 1UR2A 3NPWA 4CGTA 4W7UA 4GBUA 1HJUA 3V16A 2FJKA 3HA1A 1QW7A 3L4ZA 4FOJA 4POCA 1V93A 3G1VA 1R47A 4WZHA 3UXLA 3FEMA 9CGTA 1E0VA 1TRDA 4NXSA 2XGZA 3VX1A 4LVDA 1DXFA 2XU2A 5DRCA 3ZIZA 2PDCA 4GE8A 3S1UA 1H60A 4UQAA 3NPVA 1HL9A 3C52A 3LCFA 3ZJ7A 5A6BD 1V3JA 2PP1A 2HNEA 4YWIA 4MKVA 3ARXA 3I7RA 2A7NA 1UMLA 4YTSA 1NP2A 3UXIA 2V5LA 3O15A 3A4XA 2I14A 1EJVC 1PIIA 3FFSA 1I2QA 4MWAE 2ZZ3A 2DSVA 3WJWA 2WOQA 1IXPA 2J77A 3GH4A 3WLIA 1HVQA 4G7EB 4B3LA 3LNMA 3ZO9A 4U31A 6XIMA 2G3NA 1K7EA 3C61A 1XINA 1CW2A 2B81A 1C8QA 3HGSA 3A13A 3VGGA 1KGUA 2C1IA 1IT0A 3IGHX 2B4GA 2OLSA 4DJED 4E5TA 4BFAA 3NQVA 2X41A 5CZJA 2ISVA 1V3KA 1GQIA 3TV8A 2G3JA 4MY8A 5GJPA 4JNZA 4XAGA 1JCMP 3HM7A 3OIHA 3VDAA 8A3HA 2C1HA 5A69A 4L9YA 4KWWA 4UOQA 1RV8A 1ZAJA 4HKPA 2FZMA 3U2ZA 3FKKA 3DZ1A 3AWNA 4K3ZA 3QTPA 2X09A 3GD6A 3CQIA 3K4AA 1YTEA 3D46A 3WK3A 3VZYA 2W5FA 1FVPA 1NARA 1AG1O 1QPQA 4HOZA 1KO0A 3KVKA 1RH9A 4JIHA 1GVQA 4XD4A 3TW6A 1UZ4A 4AWTA 3U7BA 1MUMA 2NUWA 1JAEA 2XHYA 3GSMA 3IRDA 3GVVA 2YCLB 4GXPA 3QF0A 1TVPA 3R58A 2FGZA 2CXGA 1KFBA 4FF7A 1GOWA 4GACA 4QS6A 1VFSA 3GUGA 4RZ4A 4W89A 3U2OA 3W1UA 2DUZA 1QWKA 2NXHA 3W74A 1KM3A 3A3XA 3EOUA 5AC5A 1HX0A 2QCDA 4OVXA 1XSJA 3MDUA 1IEIA 4TX9A 1WDPA 3TROA 2NVCA 3LV5A 3PB0A 1X6LA 1R46A 4CCZA 4CN1A 1C9WA 4R3UA 1E0TA 4W8LA 1LRQA 2BXZA 1HGWA 3T0BA 3W7CA 1JXKA 2ZWZA 2XFWA 4IP4A 1LOQA 1EZWA 1MW0A 3KP1A 3T9PA 4ADTA 3LZ3A 5H2ZA 3BARA 3JZEA 3WF4A 3WSUA 1XM3A 3UZWA 3QSRA 1VCGA 4MDOA 3FLUA 2VRQA 2A1YA 2V67A 3W7PA 4ICCX 4QISA 4IUOA 5I77A 3P3BA 2Q8LA 4L4MA 1BEUA 2GWGA 4PR4A 1B57A 2GZXA 3N25A 4TVDA 3NJ3A 3PF3A 4LQ1A 1NELA 3VDBA 5MKGA 4WGXA 5I3GA 2YOCA 3Q58A 1BVZA 1L2UA 3ARYA 5GJNA 2TYSA 3VD3A 1POJA 1GZJA 5KINA 1W1A1 2FH8A 4B90A 1T0OA 1FWGC 4E8GA 1M7OA 1MDLA 4GY1A 1GOQA 4PTDA 5CZKA 1KTBA 2WB5A 5I3FA 3H12A 4UTUA 1JCXA 1JXJA 4F79A 4DLMA 3V5FA 1OK6A 1VYRA 4XZLX 3VM7A 2W27A 3RNDA 5HPOA 2ZVRA 2ZUNA 1BTMA 3GB6A 1AA1B 4Y9AA 1KGXA 4O57A 3H4GA 1LBMA 3AUJA 1OX4A 2VL4A 2PDWA 4PUJA 3VAVA 3AUOA 4GQQA 4DJEC 3KBMA 3T7VA 5DMLA 4LF2A 1VFUA 4IIGA 2O9OA 2QUUA 4RZBA 1VFMA 2Q02A 2QAPA 4PCSA 5RUBA 2DZSA 2DZUA 1W5PA 1KWKA 5DT7A 5ECVA 3L0KA 1XIDA 3ZSSA 4TX8A 3MKCA 3DKJA 3CAKA 4LYRA 1IIHA 4XUYA 3H70A 3V7PA 3TOPA 3AJXA 4YS1A 3ME3A 2XVLA 2PDUA 5G2IA 3BAKA 1S5TA 4C7FA 1BXCA 4JX6A 4XBJA 3UGRA 2WZMA 3KW3A 3LLDA 1PKYA 3A64A 1EP2A 2JIEA 2VC7A 3N6HA 2R24A 2RUSA 3P84A 3V35A 1KBIA 4XKYA 4ACZB 2JFEX 3CV1A 3A12A 4S3DA 2XIBA 3W2NA 2G41A 1WO2A 4W9TA 4IPPA 1SFSA 3ABOA 1PZ0A 4O1CA 5GQBA 4EXBA 3WH9A 3FXGA 2D0FA 2WVVB 2XSXA 3W25A 1E6XM 2FB3A 4H83A 3PAJA 1EUAA 2A7PA 2Z7KA 3MS8A 1S46A 4GXMA 2Z4GA 4DF1A 1XDLA 4IM4A 4HHLA 3TYDA 5F4XA 1JRBA 2ZYFA 4U3CA 4UTFA 4W87A 3L4YA 2GVYA 1F4HA 3GHUA 4IIEA 4QLJA 3II1A 3ECQA 4LWWA 1BFNA 4Z2GA 4JAWA 3NOYA 1ZU8A 3N2OA 4DZAA 2WCGA 4JN7A 3H4WA 5CPTA 1MI3A 3W28A 4LCQA 3LNPA 2NSOA 1Q4NX 3S5NA 3KZPA 4LS0A 1MRQA 1C92A 2CPUA 1Q5MA 2PC8A 3T78A 3GIYA 2A6LA 2J8GA 4BCEA 3SFKA 3ISIX 3QLLA 1ADOA 4IIDA 4PB5A 3VUSA 3PWGA 1I8JA 4QG6A 4MJZA 5C9RA 3N04A 1J96A 5I3DA 4KCUA 3ONBA 2XH0A 2DP3A 2VT0A 4IUGA 4Y8EA 3LGEA 3N1AA 3T2QA 4JTCA 3NGJA 3G2GA 4FF5A 4A8IA 4W5ZA 3SN4A 4BF5A 1VFTA 4RDZA 1XYAA 1A47A 1PS9A 2C91A 3AHVA 5A8GA 2Y8UA 4EF8A 7TAAA 1EGZA 4FP1A 1M04A 5FF3A 2AOSA 1GVOA 4PMQA 1JPDX 2QUVA 3DDMA 1LCOA 1OFBA 1Y65A 4N9DA 4Z0JA 3WQOA 4DBDA 1S1PA 5D30A 1R6WA 3EKLA 3DGRA 2HVMA 3CBWA 3W7QA 3IANA 2BY0A 3U3HA 4PUNA 3WYZA 3EA3A 4LALA 1OZQA 4HT3A 5KTLA 1I2PA 1OCJA 3TQVA 1VFLA 4MG4A 1RPXA 4UTKA 4X61A 4HZ7A 1XISA 2I9EA 1Y5WA 4PBEA 2ZC1A 5CPMA 3UYCA 1ME7A 2W4XA 2ZDRA 3L21A 1ZSXA 3NQ6A 1PL9A 3WUBA 4LAMA 3Q94A 4F9JA 4AIBA 2QCGA 2E40A 4MHBA 3SGUA 3DHPA 4W4QA 2BWGA 2WJDA 2Z24A 4J1OA 3TEVA 4KWSA 3FA4A 2XYLA 4GC3A 2WM1A 3EPOA 4ML4A 1U30A 1Z42A 3WDRA 1GQKA 2PWGA 1U5JA 1FXPA 3GHRA 3CU2A 3ES8A 5K4ZA 3TU9A 1NDVA 1XPYA 3WQ8A 3K1DA 2FTPA 1Y0EA 2B7PA 3UPWA 2WZIA 3AOFA 2JEQA 2VC6A 1BWLA 1A4MA 4NVTA 4NZCA 3EOEA 1QOQA 4WEVX 4EKJA 2FZDA 3IRSA 3BE7A 2R91A 4GRSA 3INPA 1I9CB 1WKYA 3CMJA 3L4UA 4GX9A 3ONCA 2WPBA 5DMNA 3W85A 4D6FA 5CBJA 4XBSA 3MY9A 4L65A 4ORMA 2XFRA 3CL7A 3GW3A 1P6WA 5LIXX 1S5WA 4KIEA 1M03A 4RLIA 1B4EA 1F61A 3KTXA 4Q8UA 1VPXA 3T2PA 1AZ2A 4B5XA 1GPWA 4NY2A 1LT7A 3BURA 3LV6A 4DO4A 4LUIA 4GA8A 3GO2A 1ISYA 3HG5A 2QDHA 1UA7A 3MMWA 4EVZA 2ZX7A 3PG9A 3UZJA 2G96A 3F4WA 1W5QA 4ZO8A 3WQPA 5M03A 1TTQA 2GUBA 3CUGA 4ZVJA 4O15A 1SQ7A 3UXKA 2WQPA 3H2FA 1XQLA 4AD3A 1M1BA 2A79A 4MMWA 3LXCA 4Y9PA 3MV01 1DWIM 2DZXA 5LNUA 3CIVA 4DELA 2FPYA 4ZCWA 3TXVA 4H7VA 4YXGA 4Z1CA 1AVAA 3SIZA 3BJTA 4DN1A 2RHGA 3VKJA 3VKCA 5HR7A 1JEZA 1C7TA 3R8GA 4EPKA 4LBRA 2VOTA 3NZRA 3WH8A 1RJQA 3BOLA 4TIMA 3AMKA 2WYSA 5SWUA 3VNYA 3EKZA 3PPHA 3W7JA 2VX6A 5I5RA 3WF3A 1UWIA 3AS0A 4KEUA 3AS2A 4Z0SA 3FAWA 4U5KA 2C18A 3SCWA 4M6QA 2QCDB 2VEGA 2JF7A 4P7RA 4EWJA 1I45A 4KQNA 4NYYA 1KNWA 1Z7AA 2X16A 4HU8A 4FMVA 2EF9A 3EDKA 1XGZA 4GCXA 3W02A 3PHAA 4H19A 2WNNA 1LLWA 3RK8A 1XLKA 4FXFA 2VEPA 2GGJA 1AJZA 3APYA 2WZHA 4WOZA 4LUSB 1KQZA 1XCWA 1HQTA 1G67A 3GBEA 1C29A 4UB9A 3E5BA 2ZRXA 2XN2A 2PWFA 1EHAA 1V3LA 3N14A 1E1EA 1JI1A 3KLLA 1LLOA 4FA3A 5AVNA 5CSUA 1XYLA 4N42A 1XW8A 3CYJA 2TODA 3HGJA 1PIGA 1OB0A 1L9WA 4KWOA 4JNYA 4KESA 3KOWA 3IIVA 3W2JA 3GY1A 1S3TC 3C8NA 4HB7A 4QX4A 1F6YA 4J3SA 2PODA 1P0BA 3E2SA 3N73A 1HL8A 4I90A 2X0HA 3QN3A 1GQNA 4FNUA 3RX3A 2ZVIA 1V79A 3IJDA 2YDQA 2YA2A 2VEMA 5E93A 3A22A 3W0KA 4K6AA 3UWYA 1S1RA 3H21A 3WDQA 3MUXA 4O8AA 3MTWA 1R3SA 1SJDA 4IP5A 5FF4A 5I24A 4D6IA 4ZL1A 5FL1A 5AHIA 5LNSA 4WXZA 3NGFA 1EJUC 4LS1A 3GUWA 2ODOA 2GQ3A 4IGHA 2O9PA 1Z3NA 3P8IA 4AB4A 1GK8A 1RQHA 3UEQA 1GG0A 2OX1A 3TWAA 4AZBA 4UMAA 5D9PA 2GFTA 2C71A 2Z1VA 3C0JA 3TOYA 3WFAA 3OW1A 2BOEX 3VNMA 2GVLA 2OO6A 2XDFA 1BGGA 3B9EA 2OU4A 3GH5A 3MP5A 1UHVA 4XK2A 4MUPA 3DFPA 1P48A 3MZNA 2J88A 3WQFA 4R53A 3BUVA 2QJGA 1DPMA 1LBLA 3BSGA 1AQHA 4UR7A 1KFCA 2GK1A 1SFJA 4I8DA 2UWFA 2RKXA 4NX5A 1YRRA 4AIEA 5IDIA 2AAAA 4XQ6A 5E9AA 4UQ9A 5L6UA 3MA8A 2RFGA 2NQJA 1E70M 3B0XA 1PX3A 3GAKA 4GFSA 4UTJA 3AYVA 3LDVA 4IFKB 3UWVA 3TQ0A 3UZ5A 3ICJA 4IFRA 1AH4A 3ITOA 8CGTA 3QV9A 2ZUWA 3B8DA 3CPUA 3ZR6A 2DY3A 4LX4A 1NDYA 3SN0A 4O8RA 3E0FA 3CQKA 3VUPA 4KEVA 3KRBA 3QHMA 3KOFA 1FP9A 1HZYA 3CLMA 3CUHA 3GXTA 4IPNB 1ZLPA 2I56A 2PWDA 2J74A 1GVFA 1G69A 2X2GA 3TJ4A 6CGTA 1RD6A 4M56A 4NZFA 5ENLA 4ZQNA 4S3GA 4CD5A 3MVIA 3RF9A 5DRIA 2XWEA 5M1TA 5T9CE 3WLHA 3LERA 4CQAA 1Q6FA 3I6TA 2VXNA 3PUGA 3EOLA 2DJXA 3NEHA 2G3MA 3FJLA 5HPCA 4QXIA 4O52A 4O12A 3PZIA 2UY2A 4L6DA 1UUQA 1ZP4A 3RLUA 5H91A 1X8FA 1TE6A 1O95A 1LJYA 3LPOA 5E9XA 3BLKA 5A6JA 3T44A 2V3FA 4ZBCA 1QBAA 3B0UX 4GZEA 2INEA 1X39A 1G9HA 1I6NA 2X1UA 2XISA 2ALRA 3GNRA 4K38A 4RXFA 3VFCA 3SUWA 1H5YA 1XL9A 3MANA 1TVLA 1PDZA 4HU4A 1J18A 1K3UA 4OBRA 1HO1A 4IJBA 1M01A 3H2OA 3G1HA 4CD6A 4DF2A 3LXBA 4WDUA 2HWGA 1AW5A 4PCFA 3H2EA 3CEUA 4D6JA 5HNNA 3RCYA 1NM9A 1AD4A 3CMGA 2PGFA 2VQUA 4Z1YA 2X42A 3WIJA 4N02A 3SGZA 1MRAA 3PZNA 7CGTA 1I0BA 1FWFC 1JCTA 2ABAA 1QCWA 4F0KA 2RJGA 2OGJA 2E6YA 2XVPA 2CZFA 6A3HA 1XSKA 1O60A 2XPKA 3A21A 4AW7A 1YPXA 2QQ6A 1BAGA 2C19A 3EWBX 2BGQA 3LPFA 1XC6A 3UPBA 1UD5A 4R27A 4R88A 1AL7A 2YBVA 2ZADA 2PDXA 4ZFMA 4Z1BA 1GPFA 4AF0B 1TFVA 3I65A 3MWCA 5B80A 3R89A 1Z32X 3UG4A 1OC6A 4E2OA 1QK2A 1ZJBA 2V8ZA 3TN4A 1S5NA 4JIRA 2WKJA 2VR4A 3O1NA 3MUIA 1ZB5A 3B9DA 3LXAA 2NWSA 1EJSC 3N3MA 2Z1KA 4MB1A 1JUEA 3OVQA 4N9CA 3RGTA 1GW1A 4BF9A 4D6EA 1B3VA 1WPCA 3PJTA 3BPWA 1TIMA 2I7GA 2XN1A 1LRTA 1Z48A 4L6OA 1QNRA 3DC0A 1Q4WA 3GVRA 1TUXA 5T9BG 4RE0A 1OFQA 4BQ5A 4NI3A 5IHSA 4WF7A 4UFKA 5G1TA 3ZOAA 3GDLA 4UQCA 1R3RA 1I60A 4CQ9A 3H7VA 3ZLGA 8TIMA 4WGHA 1QNSA 4ASTA 1AODA 4LVGA 1GT8A 4L7ZA 4AXNA 3AYRA 4R85A 2HTMA 1UD3A 2FMNA 1A3HA 3H53A 5DCBA 1WBHA 4RDYA 3U5UA 4C5YA 4WXYA 2QPUA 4Y90A 5FJUA 2CEQA 2YDRA 5HWJA 5AHEA 4C65A 2P8CA 4OBSA 3M5YA 1PDYA 1Z69A 1UKQA 4O4VA 4X9YA 3N34A 1A5CA 1F8IA 3GNOA 5D05A 2XJ7A 2V2HA 2AQWA 1U33A 2X1SA 4Y8FA 1TPUA 4E8DA 1TMQA 1VFOA 4RK8A 1DKWA 4KBXA 2Z25A 4PUMA 4E4FA 3MO7A 1KB3A 2J62A 4XKMA 1E3ZA 1VYSX 2R1LA 5BRQA 1P0NA 3ATZA 4PN2A 4H7CA 3SCSA 4U2YA 1OSEA 4GYJA 3VNDA 3AAMA 3WLJA 1KM2A 3K8LA 2HE8A 2R1MA 1YYAA 3LA4A 2J7EA 2YA0A 3CT2A 4NU7A 3QRHA 3UVAA 3VOCA 1TREA 3CB8A 6PTDA 4GZIA 3WLQA 3WUFA 4UFIA 5D2YA 2JK2A 3WNOA 4DJFA 2FZNA 1XH1A 4M51A 2E9MA 2PFHA 4REQA 3LQLA 3WD3A 4JQ3A 1FWAC 1EDTA 5E70A 1CTNA 3FAXA 5D9OA 4C60A 3WQVA 1KXHA 5EA9A 4B16A 1RQBA 3R0KA 2DT3A 4RV8A 3FGCB 4JCMA 2J13A 5DELA 1MFUA 2QZRA 3O16A 1J10A 3HG2A 1X98A 5HUOA 1WZLA 1PTAA 4ERGA 2QCHA 1UZDA 5G5IA 1SW3A 2ACUA 1YEYA 5GNXA 1A5UA 4MPKA 1EJ7L 3QY7A 3HO8A 3TYUA 5CEWA 3P5ZA 1BG4A 3HN3A 3SW6A 3EYPA 4OWGA 2QPXA 1RD5A 5I79A 3WNLA 3AU6A 5D9NA 2HJPA 3K8KA 1IF2A 2HS8A 2WCAA 1KBBA 3G3MA 4HZ6A 1JDFA 3VIJA 2A3CA 3WEOA 3W7MA 3NFUA 3Q45A 1YW1A 4AY7A 1MQRA 1HKJA 2VKZG 5CQ1A 5JBEA 3S9ZA 1XLAA 1RBAA 3TQPA 3NDOA 4ZTXA 2HS6A 2WHMA 4MVAA 4FALA 3NQAA 4J35A 2FLIA 1RBOB 5I3IA 1C3FA 4RZ5A 2C0AA 3USBA 4LUSA 1ZBWA 3QKEA 3OZPA 1KXTA 4JTUA 4MZ8A 5KETA 3WQ5A 3CZGA 4MUZA 1HGYA 1A5OC 2G5WA 5FSEC 4HA3A 5A8MA 3R4IA 3S5SA 1CXEA 3ABRA 2HBVA 1ISZA 1EPXA 3P60A 1QNQA 2ANUA 4IL0A 1KM1A 4GI4A 2HVNA 3Q4DA 1RCOB 1JFHA 4HA0A 4OT7A 1Q8JA 1BG9A 4JL1A 4JQ2A 3QFWA 3EB2A 2GOKA 2QDEA 4XIAA 1THFD 1TSIA 4Q7BA 3VKAA 4K1GA 3A3HA 1AUSL 2PZNA 1DTUA 4A8LA 2D2GA 3E9AA 3LSCA 4PYSA 2DSZA 1YQ2A 4C6QA 5CCZA 2WNZA 1L6GA 4Q8WA 1KW1A 3BMVA 4HOXA 1A0CA 3GG7A 2IW0A 5HJXA 4JFVA 3OLDA 1EDGA 1SZEA 1SFTA 1W3HA 3F4CA 3ZR4A 2PDLA 3UYIA 1KLYA 2OZ0A 3R5EA 4NKCA 5CBIA 2ZRVA 4GYPC 2YSWA 3ARWA 4YNGA 2QGYA 4MYXA 4EPBC 1PTGA 3SUVA 1M3UA 1YIXA 2ZZ2A 4NUWA 2NT1A 1E6NA 5IRPA 5EB8A 3UZXA 4K68A 4AX6A 1DBTA 1SZNA 3GRIA 4JFUA 4WVXA 1CDGA 2CBJA 5HJYA 2NLYA 5I7GA 1FBAA 4IG2A 4AG0A 2V81A 4GD0A 5C9XA 1PV8A 2PTXA 1KD0A 4GXWA 4YTQA 4UQDA 1B3ZA 2A3EA 1KKRA 4YTUA 1YADA 2YZ5A 2DW6A 4GFIA 1JCLA 4PTMA 5IFPA 3HFTA 4BWLC 5EYWA 3VIPA 3W26A 3A23A 4NNCA 4US6A 4D72A 3N4FA 4M7TA 5HXMA 4Y9MA 1TA3B 3NSNA 2PA6A 2VOMA 3S42A 3UW6A 3SQLA 1TQJA 4CNOA 4TQTA 1E40A 3VK5A 3E96A 2A0NA 4W93A 3F4NA 1TCDA 2D69A 3C8FA 3WLOA 4O1FA 5A8QA 3MDWA 1RK6A 5KEZA 3VKKA 1T7LA 1PZ3A 3OA5A 1W3KA 2Y2WA 2O4QA 2VNCA 2GQAA 4GJIA 4G9PA 1GWJA 3O0KA 2ZX5A 4QNWA 3MP4A 4NILA 2E8ZA 1NY1A 4C91A 3ALGA 4LNYA 4JYDA 2VTFA 5FJRA 2XFYA 1V03A 5IFTA 4JYEA 3AXMA 3THDA 3U2EA 4L4LA 3RFAA 1ZALA 5AHMA 4LUTB 1VPQA 2TRSA 3R8RA 1TTJA 3SSZA 3EB3A 4GZ7A 4ILSA 1RA0A 1PE1A 3SCVA 5BNKA 2YXXA 4PTNA 3L5MA 4DY1A 3VNLA 3M0MA 2OO0A 4GNJA 5C71A 3RUBL 4O28A 4H6KA 4AHPA 4Z2JA 1B30A 3P14A 5A8NA 4DI8A 2AAMA 3JR2A 1J5SA 3PP7A 4K39A 1XLGA 2PTZA 3IEBA 1XH2A 2F7FA 2CLEA 1IR2A 2B31A 3UT0A 4ZO9A 2NQLA 2G4JA 3DYMA 2C6QA 2FKPA 1EA9C 4EE9A 3W7DA 1LM1A 5A2CA 3DG3A 2IKJA 2C8NA 3MMUA 1E71M 3SCOA 2QYGA 3DHDA 3GTIA 1W6TA 2R94A 3LHWA 1FUYA 3TW7A 2YCIX 2DH2A 4NP7A 3F7JA 4W85A 5CPLA 5AZ1A 4N2YA 3UF9A 3C0QA 5HDRA 1SJCA 4RR4A 1YMYA 1LP6A 3U5YA 1EHNA 2ZXBA 1KTNA 1SW0A 3VIIA 1X1ZA 1VRXA 4J2MA 2QCEA 3ZMRA 1GQLA 4NAEB 4OZOA 4B3KA 3EPMA 4TV5A 4LY8A 4AMAA 3BOXA 5FF2A 1LQ2A 1V6YA 2D1ZA 2ACSA 5E0FA 3N2TA 2O9TA 3ERPA 3NO3A 1ME9A 1KM4A 1TWZA 2ALDA 4JS3A 4CD4A 2QVNA 4DO6A 3FVMA 4DO5A 4XTDA 1VYPX 3K8MA 4BWLA 3KP0A 3U8GA 1J93A 1PVNA 4RE3A 1XYMA 1XDJA 1H0GA 1B1YA 1Q6GA 1UKPA 3EWZA 3RN6A 3UU0A 3BGJA 4H6EA 3CH9A 1UC5A 3CXOA 1P7TB 3UWZA 3VOGA 3G24A 1CGYA 4IMGA 3CHVA 3TN5A 5CG0A 4LS2A 1BF2A 2VFDA 2PU1A 4FLSA 3VOIA 3D3FA 2FGBA 1GVRA 3TLLA 2WANA 3WD4A 4KGLA 3S2MA 1WA3A 3RRAA 2FTYA 4PULA 2EEXA 1Q66A 3VOFA 3S47A 3FA5A 3USZA 4HNUA 1EIXA 2HNHA 4QP0A 4LB4A 4HNNA 3W6LA 1E15A 4IMFA 4ERIA 1DWGM 3N4EA 3LHYA 3E3HA 4HNVA 3NQGA 1UQYA 4BEQA 4DZ5A 3P6LA 1XLFA 5BU9A 4O54A 1EC9A 3M0VA 1JIBA 1SUXA 1TMLA 2A6NA 3A5FA 4HN4A 7PTDA 4UFLA 3EX3A 4WY0A 3RU6A 1OFDA 4P7LA 2RDTA 2J47A 1DIOA 4UMCA 1J0ZA 4DQWA 1DJZA 4NHVA 2WVUA 1DV7A 1EF2A 2CERA 4CD7A 1Z44A 2VGGA 3QV8A 5C5YA 4C1LA 1V6TA 3Q67A 4RZ6A 2X1TA 1HKVA 1XLBA 2FB2A 3KM8A 3EX6A 1BF6A 3NUKA 4V2XA 3SY1A 3M43A 4YHGA 4O0ZA 4LSBA 1TPWA 1QTWA 2E28A 3TR9A 5HMSA 2HISA 1ZRQA 3TMLA 1L8PA 4DXXA 3NXFA 3IAQA 1MO0A 1GYNA 2BGNE 2PD5A 2O9RA 4YVXA 3NTYA 2WSQA 3O06A 3OZMA 3VKDA 1O5QA 3WJZA 1XIJA 3WNKA 1IQ8A 1RLCL 5AFDA 4OOZA 3TN3A 4HOWA 2W62A 3N9RA 2MANA 3DU0A 4M1BA 1N8IA 3AXIA 5C7VA 1BVWA 4NIRA 2EGZA 2WBGA 3KHDA 3PANA 4N4QA 3TC3A 2I5IA 4DJFD 1W5MA 2CWXA 3DH7A 5C70A 1REQB 1OWQA 3PWIA 1E1CA 2FH6A 5FJJA 4CU6A 2DDXA 1EXBA 3FNDA 3BTNA 3LS9A 1H7NA 3GBDA 3TYBA 1DIEA 1TVNA 4NYUA 1W31A 3TCSA 2DVTA 4TU1A 1ENUA 3DERA 4UTWA 4AXKA 4XZWA 4LTSA 3ALFA 3M5ZA 1UP3A 3BDKA 3E2VA 2NX9A 1GOKA 1RP9A 1QI2A 4F0MA 1TPDA 1TPC1 1C93A 1TA3A 4YYCA 2ZC8A 4L9ZA 7XIMA 4PMUA 2TSYA 3S5ZA 2EBNA 1R5YA 1A5SA 1MZRA 4J9JA 4LVAA 2J27A 2PMQA 3W7KA 4KPLA 1C8YA 4O13A 3T1GA 1O94A 2W91A 3CAWA 1XIBA 2WBKA 4JTFA 3NL5A 5I0DA 3PUDA 1SJAA 1SFLA 4Q6JA 5D9MA 1E51A 3AZRA 5DBUA 2Y1HA 1UUOA 4QAIA 1FWJC 3THQA 2INFA 2DT2A 1TV3A 3COTA 5HQMA 3STFA 4AHQA 5KZMA 1PBGA 3CO4A 2C7FA 1X8CA 3NPUA 3R25A 1MW1A 2YBUA 1NSJA 1MXSA 3S2CA 3EZ4A 5CJ5A 4UR9A 3EOOA 4HNTA 1ME8A 3AXXA 1W32A 1NAL1 3FKRA 2EG7A 4PRTA 1A5MC 3T09A 2CZVA 3L2LA 1TO3A 3ITLA 4FIQA 2E5CA 2FHCA 3WMBA 1HKIA 1MXGA 4IF2A 2V0TA 3JW7A 5DXXA 1WYIA 2DEPA 2BP1A 2J8TA 3ZJKA 5DXYA 4AQLA 4QFUA 3QJAA 1MEHA 2QGHA 2YCJA 1NWRA 4H9TA 4IQLA 1KC7A 4HYVA 4C6EA 2G95A 2NT0A 3ITCA 1W1B1 3R6IA 4IFKA 5HJLA 3G0XA 3LLXA 3P0WA 3W75A 3G77A 3TA9A 5HOSA 4ZMGA 1VB9A 1CNVA 1UD6A 4IFOA 2VQTA 1FHUA 3ZT6A 2BOGX 1ICQA 1RZMA 1JQVA 5BOFA 3VZXA 3ZLHA 2VHLA 3BSHA 4M24A 2A21A 1UD4A 3BCFA 3APTA 1EC7A 2ZUVA 2D23A 2GGIA 1CPUA 1E4IA 1FWBC 2DZVA 2ZZ6A 1B9ZA 2Y7GA 3QMSA 3ZT7A 4RL3A 5LNWA 3T0TA 5EU9A 4DX3A 1XH0A 3WBXA 3KRSA 3PZTA 3VCRA 3WH6A 5BYWA 1LWJA 3CHCA 3STEA 3RYSA 3M47A 3DESA 4H2CA 1SZFA 2WHLA 4GKTA 3RXZA 1K02A 1VEPA 2QCCA 2DUXA 4S3BA 3VCNA 2WSRA 2VCAA 4C6BA 1NF0A 4WY0B 1RY8A 1UH3A 3KWXA 3LD5A 3V0TA 2WMIB 5H8UA 1IGSA 5BWFA 1VEOA 4JZ5A 3TE9A 1XIIA 2H6RA 1LG2A 4H4IA 3M0XA 3O6YX 2ACQA 1GHRA 3W3OA 1JF6A 8XIAA 2YJQA 4V1YA 5AOUA 4S3CA 1K9EA 2DPEA 4BR1A 3EX1A 4GIAA 4FNSA 1E55A 2G50A 1ZY9A 2OWWA 5G1MA 1FKWA 2BY2A 2V5KA 4QJ1A 4R7JA 4EIVA 3GWQA 2YW3A 2INZA 3PZUA 1ZAHA 3QMRA 1FWSA 3NQFA 3TTEA 4MFEA 2XH2A 4IH3A 3V4BA 4HNCA 5JH1A 4K7VA 1VJIA 3OJGA 1TKKA 3WLLA 3EDJA 4I5RA 4W7VA 4CCEA 1SR0A 3PZGA 3KOYA 5DF0A 2VFHA 3ARPA 3RCMA 3CTTA 5FEZA 1FY6A 2P3ZA 4HPJA 2VCBA 4DWSB 1D3GA 5TF0A 2QF7A 3LRMA 4RNFA 1DXIA 4A3YA 4ZODA 1XX1A 3H55A 2JGQA 4DYEA 4NT0A 5C2XA 4LB3A 2ZA1A 2X40A 2ZX8A 1M53A 3DFSA 4IGNA 4OECA 3CV7A 1WKEA 1LUCA 2ISWA 1XF0A 2PTYA 3WL0A 1J6PA 1UMYA 1K70A 3PFRA 3WK0A 2OOGA 1JYXA 1DJYA 4HSNA 1Q6LA 2EPLX 2VGIA 4Q3MA 2ONEA 4FI4A 1KRCC 4UCFA 1PWMA 3K46A 1ISWA 4IJCA 3URAA 4XVDA 4IX0A 1LOSA 1RVKA 3CC1A 4NAEA 4H04A 2PB1A 3W2LA 4O14A 3GZAA 4HJFA 2X30A 3B4YA 5A6TC 4XV0A 3H54A 3VVGA 3GU1A 5ABFA 3LSBA 3KE0A 2XIJA 1UKSA 3NXLA 1CXFA 4MY9A 5F1VA 1SGJA 3V3WA 2XH4A 3ZXWA 1S2AA 4YPJA 1WKFA 1BSLA 4IL2A 4P8VA 1XPGA 2FJUB 3EWUA 3TN6A 2D24A 4S3KA 4J3UA 3PTQA 1OQFA 4D9PA 2P53A 1DEDA 4M6UA 4GI9A 4TO8A 4KFPA 1GCYA 3UFYA 1KFKA 4Z17A 4LV4A 3GQYA 2HPIA 1AQ0A 5LA2A 5TQLA 4GNKB 1VD6A 3L23A 4AD5A 3SRFA 4QROA 2PRMA 3W7OA 2Q01A 2QUTA 4OV9A 1B3WA 4DWSD 4D6HA 1R3VA 3GE7A 1EYWA 1S2TA 4MPQA 3BO9A 1E0WA 4UC5A 3LCLA 5C0QA 4JTGA 3NEVA 1F8MA 4HGXA 2PF0A 1CENA 2VURA 2VFFA 1K4HA 1TPB1 5GJMA 1JULA 3T05A 3SI9A 2Z6IA 5D02A 4EPDC 3WO8A 4KCTA 1KV8A 4BHYA 3ABXA 3KRUA 1ZBKA 3CUJA 3O07A 1NWUA 1IEXA 1WDRA 4O1EA 2Y62A 4DBSA 3B8IA 2BLEA 1K9FA 4LUYA 2VVNA 1V5XA 3UA4A 1UBSA 1GZGA 4XSMA 4PZVA 2ZRWA 3QZAA 3MQTA 2WC3A 2P76A 3T0DA 4UTLA 1HFBA 4AEEA 1T5AA 4LEQA 5EFDA 4DIAA 2ZXDA 4JTSA 2BVYA 4UUIA 1W9VA 6ENLA 1QI0A 3H8AA 3R94A 3VDHA 1IIGA 1J9YA 2P5NA 4JTDA 1Q7QA 3FW6A 1E5JA 3TSMA 3AMDA 1OD0A 3M7SA 3L67A 2FVMA 4FNRA 4YIWA 4JL2A 3NM3A 3NSXA 4L64A 5G2WA 3EMQA 1MMFA 1EB3A 2ZICA 2YCEA 4NX0A 2GQ8A 2BXVA 1OGBA 2GDQA 2E0PA 2QAFA 1VEMA 4QCFA 4LOCA 2GVGA 3M4HA 3W72A 3SO7A 4N6EA 4L9XA 1OC7A 3B8SA 1VJSA 5U4NA 5D32A 4XD6A 4QDWA 7ENLA 2VI0A 1OINA 3B9OA 3DN5A 2H8ZA 1J79A 3FA3A 3TTSA 1ITQA 2QV5A 1LROA 1HKKA 2YL9A 2GLKA 5FJPA 2HCVA 1BXBA 1EGMA 5LGZA 3WLKX 3AZTA 1MNSA 1IV8A 1NIUA 1LL7A 3GTHA 4U4MA 3MYOA 1UW9A 1QJWA 1XLHA 1WCGA 1Z41A 1OT1A 4M8UA 2A7RA 4H8HA 1GONA 3J7HA 2XN0A 2IUZA 2ZWYA 3REQA 2DGAA 1QUMA 2CHNA 3A24A 4Q8NA 3S9YA 1JZ5A 1VBHA 4NG3A 2J75A 1LQAA 4XUGA 3SURA 3Q65A 2GJXA 4JY9A 1WXZA 1OK4A 2NV2A 3BAWA 4HHMA 2VELA 3IVTA 2WKGA 4A3RA 4V1XA 4HPHA 2CHRA 4GIEA 3ARQA 3LGDA 4MF4A 5AYYA 2V5JA 3GXMA 1A80A 1SJBA 1P5BA 4JKLA 4NAFB 1R30A 4AZIA 3GNDA 3SY8A 3MT1A 3CUIA 2OKTA 4GUJA 1ZFJA 4PMVA 1YLVA 3HB9A 4GABA 4B9YA 2V68A 4JQAA 1QAPA 5LA1A 4MLRA 1I1XA 4P61A 1OGGA 1M7XA 2CIPA 1XICA 3KAOA 1VH7A 4H01A 4NASA 1E9IA 4AD2A 4JEJA 2G0WA 5H6HA 3CZKA 4DWSC 1MSSA 3UJ2A 2OJPA 3K4DA 5JIWA 5CKSA 3WJYA 2NUXA 1SO3A 3AWOA 4F2TA 4XZMX 2C79A 2GVJA 1DOSA 3MVTA 4PCNA 4GO8A 1EPVA 3G1SA 1ZL1A 5ABTA 2XM2A 2EJ1A 2WZTA 1VHCA 2ZTJA 4QDPA 4QITA 4TX6A 5DCEA 1JNEA 2JQXA 1UQZA 4A05A 5FKYA 2V82A 4DNHA 2F6XA 3AFBA 4A6GA 3PULA 4Q4PA 1H4PA 2ZA3A 1UYQA 3S0CA 1LUCB 2F38A 4NJJA 4K37A 3TK7A 1TG7A 1FWIC 1K77A 4DZIA 2WW5A 3T8QA 4PTWA 4NZJA 1JVNA 5J8LA 1G7VA 4H2HA 3ITVA 3KZSA 1R87A 5BXRA 2VFEA 2WO5A 1U1HA 4H9YA 2GDUA 4K7YA 1X6UA 3W6YA 1IWPA 3HG4A 4KEMA 1JD9A 4JTTA 1WXJA 2POTA 5DCDA 1HVXA 2J66A 1F2JA 4B5NA 3MWAA 4G2DA 1V0KA 2YL6A 1DVJA 1TV8A 3FY1A 1B3YA 3BH4A 4AUBA 4K36A 3OLGA