3M7WA

Crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m7wA00
3S1XA 3P82A 1I45A 4O11A 4ICNA 2QDGA 3YPIA 2Y89A 3TKFA 1SO6A 5IBXA 1GQNA 3BVJA 1TV8A 4Z0SA 3BW2A 4MY1A 1UASA 2V82A 4UFJA 3DFNA 1A50A 1I2RA 4UTJA 3W7EA 1PE1A 2AAMA 3QSRA 4JDYA 1XKYA 4M6QA 2QCDB 3RMJA 2O7QA 3VI2A 4E0CA 4Z0JA 2C3ZA 2A6LA 3TFXA 3VFLA 3LGEA 1H7PA 4GUGA 1W3IA 3NZRA 2NXHA 5FESA 3DKLA 5D38A 1O95A 4GUFA 2H8ZA 4O52A 2GVLA 3S1WA 4Y96A 5K7JA 2FFCA 2YYUA 3CQ0A 3NQEA 5D32A 1G7UA 3PF3A 4ZQMA 2LLEA 3W1RA 2RH9A 1TB3A 3M5VA 1H51A 1R2TA 3N2XA 4BI5A 1SFJA 1VHNA 4JY8A 3IGUA 1DVJA 3TXZA 5DCDA 3OIXA 3UXAA 3FKRA 3MMTA 5F1UA 4GUHA 3BGJA 3NPXA 1RVGA 3KFTA 2ZTKA 2G97A 3FIGA 4K7YA 3I7QA 1OX6A 1YYAA 3PUOA 2Q3OA 5TBOA 1XDMA 1DHPA 4DO5A 3DFPA 1H7NA 2CWNA 4JXCA 1TREA 1XXXA 3W76A 4S2CA 1QO2A 3PUEA 5D2WA 4JTKA 4CNNA 1G67A 4GRSA 3L0NA 3W2NA 1U5JA 4N6EA 1FWNA 1JCNA 1P0NA 3HGSA 4K7VA 3LCHA 1X1OA 4K38A 1YDNA 4KFOA 2ABBA 4JTIA 5CGQA 3R12A 3OG3A 3QQ0A 5IBXC 2QUTA 5CSRA 2ZRWA 4MYXA 4AWUA 5I3FA 1FDZA 1AL8A 3P62A 4XZ9A 1A5CA 1TPB1 1OJXA 5FEWA 3UWYA 3GB6A 8TIMA 3GDMA 5HMSA 1XM3A 2X30A 3W7DA 3C2RA 2QAFA 1GEQA 3LCXA 1KV5A 3VKJA 4AWSA 2QF7A 2CLKA 1FWRA 4IMGA 1CW2A 3G0SA 3LV5A 3TSDA 3MHFA 2QCCA 3E96A 1KLYA 3OVPA 1S5VA 4R7JA 3DH7A 2CW6A 4UNKA 3GKAA 4O8RA 1IXNA 2TRSA 1I8JA 4JTTA 3T4CA 2W79A 4JX6A 3GK0A 3SZ8A 1LDCA 1TTQA 3DU0A 1ZAIA 3W7IA 3LRKA 2DZUA 3W2LA 4UCGA 1SFLA 2ZYFA 3QM3A 5FEXA 5G4WA 3H54A 4PODA 3O05A 3BW4A 5AHFA 3FJ6A 3GXTA 3MP4A 1JULA 4JN6A 1OFQA 3PBVA 5CZSA 1DOSA 3KVMA 1GWJA 4N2YA 1HL2A 1V5XA 2ZBTA 4JTLA 1LBFA 4LVDA 1H7RA 3L21A 3ZWSA 1Z44A 2GQ8A 3S5YA 3IIVA 4FF7A 2ZZ4A 4O1AA 5FF4A 3G24A 4YMZA 1B9BA 3E0IA 2A0NA 3IVUA 5KZDA 4DF2A 5LHFA 1LRQA 4DO4A 3O06A 1N7KA 4EF9A 4LUIA 1TPC1 1N8FA 2AGKA 4OV9A 3V75A 5KMYA 1G69A 2WO5A 1GPWA 1TRIA 4RX0A 4DPQA 3M9YA 1XUUA 3VE7A 1ZNNA 3O6CA 2B7OA 4JTJA 4JTEA 4K8HA 2WSQA 3MI2A 5J5DA 4XWUA 4FNQA 2FJKA 2C6QA 3NG3A 1NFBA 4X9SA 2A85A 3E49A 2C14A 1GVRA 3ZWTA 4QJ1A 5EA9A 1NEYA 3SECA 5D37A 3OBKA 5CSSA 1LRTA 1ZY9A 1QPOA 2YFNA 2OZ0A 3QW4B 3BG5A 3QH2A 5LZLA 1SW3A 1X7FA 3KHJA 4AEOA 5G2HA 5CZJA 2CZFA 2E6DA 1M6JA 4DELA 3TC7A 3TAOA 1OFOA 2EHHA 3VNDA 3CTLA 2WNZA 1AK5A 1UCWA 3CEPA 3W88A 2J24A 3N14A 1QR7A 2EAWA 3LTSA 5F4XA 3QC3A 2Q8LA 4FB7A 4WD0A 1F76A 1KM5A 2DZTA 1Z41A 3B04A 1LYXA 2R94A 4UFKA 4JR5A 4YCOA 4KWVA 2E6YA 3FLUA 4I9AA 5I3GA 3W6YA 1WV2A 4HPXA 3SI9A 3QMSA 3W23A 3STGA 2QR6A 4K8EA 3UQNA 4TIMA 3EKZA 1E51A 2Q8ZA 2R91A 1W3TA 4CNOA 3LX9A 2VEKA 3ABOA 4QITA 1JCXA 2VEMA 5SWUA 2H6RA 1TTJA 1OFRA 3DKJA 2RDUA 3FEMA 3OA3A 1SR9A 4O12A 4FXSA 3M1ZA 2B7NA 2RDTA 2A5HA 3P8JA 4ORIA 1LP6A 3T7VA 5CPLA 3F03K 1K02A 4HKPA 3MYOA 4ZL1A 1BKSA 1OK4A 2GPTA 1EWEA 4IJBA 3TQ0A 3LOTA 7TIMA 3B0UX 4ZQNA 5D02A 3LB0A 5L6UA 3C2FA 1ME7A 5E0KA 1M7OA 1LLWA 4W9TA 3I6RA 1B57A 5EKYA 3NNTA 1J2WA 1TRDA 4O53A 1QOPA 4FXRA 4RZ5A 3OVQA 3G1DA 4UMCA 3RNDA 2RDWA 3W7MA 4ORMA 4ZMGA 1L6SA 3S5ZA 1ZENA 1YDVA 4XKYA 3LCLA 3LLFA 4CQ8A 1GYLA 1JVNA 1NSJA 2ZRUA 5KTLA 2QUVA 1TIMA 3GXPA 1F6KA 2ISWA 5LHEA 2NWSA 4CCCA 1RQBA 1KFCA 4ZQOA 1SZEA 3O07A 5HWMA 4CCEA 2ZA3A 4IPJA 5I3HA 1XI3A 2YYTA 2ZZ1A 3G22A 1QDSA 3NQCA 3P74A 4ALDA 3W7QA 1BWLA 3IIZA 2GQ9A 4LUJA 2DJXA 4M7TA 2Y7EA 3LBMA 5CPMA 1LCOA 1FCVA 1H1ZA 5G2IA 4HNNA 4FX6M 5K9XA 4DBEA 2J9XA 4QISA 5IM51 2F7FA 2E5CA 4QQ3A 3BV4A 1WOBA 3FFSA 4FIQA 1OHLA 2X1UA 1OF6A 3PY2A 3LCGA 4GUJA 2E68A 2NUWA 4R34A 1OYBA 4AHPA 3NQVA 3EX6A 1X8FA 2EPHA 5FEZA 3G8EA 3BPWA 3QZEA 2R8WA 4U4MA 3NAVA 4E38A 2IQTA 2EF9A 2YPIA 4Z1DA 3W84A 5I3KA 1QO5A 2ZTJA 5F2GA 1TPWA 2QCDA 2NUYA 2JBMA 3ABQA 1VC4A 4QSHA 3GDLA 1JR1A 1SO4A 5G5IA 5C54A 1TPUA 4IQLA 1K7EA 4RZ4A 3KRZA 1B3OA 1GG0A 2RHGA 2ZRYA 1KFJA 1S5WA 1O60A 3S5OA 3L5AA 3LHZA 3W22A 3FA5A 1UJPA 2GJNA 1WA3A 3EEGA 1H61A 3HPXA 1I2QA 3NL6A 3SSJA 1HFBA 5U4NA 2E5BA 1TV5A 3MP5A 3NQMA 3E9AA 3ELFA 1FBAA 3N73A 1Q6OA 5F4WA 1VZWA 1YADA 3HF3A 3DZ1A 1W56A 2X2GA 3C2EA 3W85A 3DFTA 1LRNA 1GYNA 5A8GA 3G1FA 1XL9A 5D04C 5D09A 2H3BA 5E1QA 3P7YA 1TTIA 2TMDA 2GVJA 2GQAA 4O17A 3W1AA 4BI7A 4MZ1A 4WXZA 2E77A 4ZVJA 3W71A 2BX7A 4YLWA 3MP3A 2JKEA 4JX5A 3R13A 1LM1A 2NZLA 4IMDA 5GVJA 2HS8A 2ZZ5A 3UPWA 2CZ5A 2VFHA 1O4UA 4LWWA 5DY3A 5J5RA 4ZQCA 3INPA 2DP3A 5CZTA 1L6YA 2ABAA 2P1FA 4O0ZA 4JYEA 1B4KA 5AC7A 4DBDA 4LY8A 1P4CA 3W1NA 4BK9A 4PL2A 4UTHA 1MZHA 4LS1A 3IRDA 1CX9A 3CWNA 3PBYA 4UTIA 1SO5A 3UWUA 1EWDA 2JK2A 1H50A 3PSVA 4MOZA 3UWQA 3L65A 4O1BA 4ADSA 2WJZA 2VFEA 3W86A 2OCZA 1JCYA 4HT3A 3L68A 4I7UA 4QM1A 4A2RA 4M5PA 2HS6A 1AW1A 3TE9A 3HJZA 3N2MA 3O6YX 3Q58A 1GZGA 4UR7A 4UIOA 3NDOA 4J9JA 1G6CA 2E6FA 1EB3A 2FTPA 3C52A 4ADTA 1MSSA 1OFEA 2Y7GA 3P60A 5D2XA 4OT7A 5K9DA 3BW3A 3TMLA 1J4EA 3PVFA 3W7LA 3FS2A 1FWWA 1OYAA 3O8AA 1WYIA 4NNBA 3TX9A 4K36A 2QJIA 4MVAA 4YL2A 1EA0A 3M41A 3TK7A 1WDWA 4YWIA 1G7VA 3PBWA 4NNAA 3LRMA 1VR6A 2W0UA 1FWTA 1QCWA 3W7CA 1VHCA 5MHBA 1OG0A 5D2TA 3TXVA 3W7RA 1VPXA 4IMFA 1MXSA 3T78A 3KRSA 4NT0A 3HQ1A 4UFIA 4O1DA 2R14A 3G1YA 2C0AA 5FEPA 1QFEA 2Z6IA 3U6WA 3EWWA 4A21A 1W1ZA 3CLMA 1YDOA 3HIJA 3EX1A 3PS7A 1P5BA 4FEZA 1WOAA 4LRSA 4MJMA 4Z1CA 2QCNA 1K7XA 3S1VA 3C2OA 2WKJA 4JEQA 1SW7A 5AYXA 4NJGA 1EIXA 4Z08A 3DBPA 1PL9A 3NL3A 4EIVA 1ME8A 3MBDA 2BLEA 2ZZ2A 5DBTA 3LHYA 2A21A 1ICQA 5CKSA 3HG2A 1KM2A 2CZEA 3NGJA 4LTSA 3HOJA 1VLWA 3SFKA 2CLHA 1KM3A 4HNVA 1ADOA 1B4EA 3S42A 3WJZA 5TIMA 2TPSA 3R2GA 4UMAA 3W07A 2Z0IA 1BTMA 1JCJA 1HO4A 2YX0A 3O16A 1JUEA 2FPTA 2ISVA 3F4WA 3K30A 4EF8A 3M5XA 2VKZG 3DENA 3LV6A 5I3IA 4O19A 3T40A 1RQHA 4AWTA 5D03A 1OYCA 4K39A 2YW4A 1SUXA 3P80A 1I2NA 1RV8A 4YCPA 2NV1A 3DAQA 3P61A 2Z6JA 3W70A 4IX2A 2JGQA 5HUPA 1GVQA 1XCFA 5F1VA 1P1XA 3R5EA 2E09A 3C56A 4O4WA 3B0VC 3O63A 4FNTA 4WY0A 5HULA 3SGZA 2WOQA 1F73A 3NL5A 3W1XA 1DKWA 1NAL1 1OFDA 3HGOA 4Z1AA 3SW6A 5EL1A 1XBZA 3NXFA 3RLUA 4LOCA 1F7BA 3CEUA 3WK2A 2ZZ3A 1I4NA 2V2HA 3TAKA 3CIXA 3H55A 1IF2A 2Y61A 1K8ZA 4K37A 3NQGA 5FI8A 4KFPA 5C2XA 1LLZA 3LXAA 4N9BA 5HJLA 2A1YA 3G1SA 4LVGA 1FXQA 3W2KA 4HN4A 2AQWA 2Y85A 1K8YA 3G8RA 3TA6A 2YDAA 1SZFA 2BXVA 3N34A 3GAKA 5G4EA 4NZFA 4Y8FA 1ZHAA 3NYZA 4UTTC 4NJKA 1KV8A 1KM4A 1DV7A 5LNSA 4HIBA 3FOKA 1JRCA 1MEWA 1TJRA 2VFGA 2VELA 4FIRA 1D9EA 2DZXA 1XC4A 4LNYA 3P84A 3P5ZA 1OX5A 3H53A 4LT9A 4WOQA 2VFDA 3IEBA 4FNSA 1PCKA 4PH6A 4MFDA 2CLOA 4NX0A 3PSWA 3UNDA 5HR6A 1ZALA 1PS9A 4AHQA 4LS2A 5AHLA 4RV8A 4IGHA 2ZA1A 1YPIA 1YXDA 1HTIA 5CPOA 3W75A 3N9SA 5LNVA 4X3ZA 3G3DA 4O18A 3EX2A 3DXIA 2Y7DA 1OX4B 3AO0A 3V1PA 3RLVA 1D3GA 3BLIA 1JQXA 4MPQA 4O13A 2DZPA 1QAPA 4UUIA 3FYOA 4NZJA 3CHVA 4GC4A 4O0KA 3LERA 4O4VA 4Q32A 3W2MA 1A5SA 4A2SA 3BARA 3MYPA 3S9YA 3QMTA 1LZOA 3WK0A 2QJHA 2VC6A 2C18A 3SR7A 4AHOA 2CLMA 3O15A 4AB4A 4HSNA 3L0KA 4GNJA 4WQ6A 1GTHA 4H6KA 4UC5A 2NX1A 4XTDA 1TYGA 5D2YA 2C13A 2H3DA 2YZRA 5FF2A 2OMAA 1UB3A 3W1TA 5C5YA 1J5TA 4NXKA 2G5WA 3B03A 3LXBA 3PUDA 2X1SA 4DXVA 4FO4A 1A5AA 3NQAA 4WJEA 3UPBA 5DY2A 3M16A 2NUXA 4R53A 4JYDA 2FPYA 4GFSA 1GVOA 1QOQA 3NPUA 4OE7A 1G4EA 4RK8A 1NF0A 3TC6A 2KZHA 2YXGA 1VJIA 2V8ZA 1Z48A 1ICSA 3C2VA 4L4MA 5LGZA 1K8XA 3SGUA 5KZMA 3KVJA 3KX6A 2XN2A 3ATYA 4Y9AA 3C8FA 1M7PA 2DJLA 3SY5A 2VXNA 1V7YA 5HQEA 4ML9A 1RR2A 5BOOA 1XBXA 4RR4A 1R30A 1TPVA 1DBTA 3GAYA 3CU2A 3L0GA 2DZSA 3G1HA 5DELA 3W7PA 2V2CA 1KTCA 1IXQA 1HG3A 6TIMA 3MW7A 1YXCA 3LI0A 5E93A 1QPRA 3KRUA 3M44A 3MI3A 2GVGA 4N02A 3B06A 1FDYA 3MHUA 4LV4A 2ZZ7A 3BLEA 4UTUA 3FYPA 4E2DA 1DQWA 2TYSA 2YFOA 2CLEA 2H90A 4LVAA 5HINA 2NLIA 3GDTA 2ZRZA 2DZWA 3PG8A 2NX3A 4O15A 3T55A 4LC6A 3EWBX 3GR7A 3MWAA 3OVRA 5KINA 4E2BA 2PCQA 4G1KA 2OJPA 1HUVA 1SZNA 3LDVA 3PBUA 1KBJA 2WSYA 4O10A 4RKAA 1G4TA 3W87A 2Y62A 3A9IA 4MKNA 2PRHA 2QCEA 3ZS4A 2FDSA 3HO8A 2PE4A 3TNOA 3DHFA 1F05A 3M0ZA 4S1FA 4OQVA 2ZRVA 4UTKA 3NL2A 3KAOA 3GDKA 2V5BA 3C61A 5KSWA 4HNUA 1WAUA 3I7SA 3DFSA 2X1TA 3QFEA 3RF9A 5K9CA 2WV8A 4O28A 1VCGA 1VYRA 4FHAA 4IPIA 4N9DA 2ZQ0A 5G1YA 2Y6ZA 3QSTA 3NVTA 2NXIA 5KZEA 3LM7A 3UY7A 1QMLA 3NQ2A 4BWLA 3W7NA 1RZMA 3CT7A 5BNKA 2P10A 1H62A 2W6RA 4MYAA 1Q6RA 3U8GA 1C29A 1VRDA 4ZQRA 3NQ8A 5D2VA 2FIQA 5LNRA 5D30A 3S5NA 4A22A 3L67A 1TCDA 1K7FA 3LHUA 2QCHA 1JUBA 1VS1A 1Q6QA 1TTPA 3S0CA 3KXQA 1G4SA 4DEFA 1UUMA 1HO1A 1AG1O 2ALDA 3W2JA 3S1UA 2B0MA 1OFAA 4LC8A 2NWRA 1C8VA 3ANYA 4O54A 3W74A 1EP1A 1G4PA 1KFLA 4HNTA 4WY0F 1XUZA 1Y0EA 3TW6A 1C9DA 2C1HA 3A5FA 3UYCA 3QPZA 3G18A 1FCUA 4BF9A 2JKPA 3TROA 3A5VA 1GVFA 2EGZA 2I1OA 3QPYA 3FJLA 3THQA 3GYEA 4PTNA 3W1UA 4XBKA 4RCXA 1TPDA 2WNNA 1Z42A 4OGZA 3LHWA 4NJJA 4AF0B 3VE9A 1F74A 1TPEA 3MBFA 2WSRA 5EBUA 3CPRA 2Y63A 3P67A 1OFPA 4EOUA 2X1RA 3I68A 3MHGA 3PG9A 2C15A 2XFWA 3ABSA 4JD4A 2YCEA 1JQVA 2CLIA 1T99A 4UNLA 3E02A 5AFDA 4N9EA 4AMAA 4UTMA 4CCDA 5FF7A 1YTEA 3BO9A 1TSIA 4UFHA 1KM0A 1I2PA 1X1ZA 2WQPA 2TSYA 4XKYB 1W54A 2YGYA 3P5YA 1L2UA 4JTUA 3TDFA 2YSWA 2QKFA 4L4LA 3EX3A 3B4UA 4UFLA 3LTYA 4BWLC 3CC1A 2Q3RA 4NJIA 3WK1A 2DU2A 3GXNA 4ADUA 3STCA 3B8DA 3O6DA 1H5YA 2YW3A 2C16A 5LGXA 1KFKA 3MJYA 4POCA 2FQIA 3AJXA 1SQ7A 5AHEA 1A53A 1VQTA 4NQ1A 1PHWA 3F1QA 3NPWA 3STFA 2ZFAA 1IIHA 2V81A 3UZJA 4TR9A 3N9RA 2J6XA 3HG4A 1KFEA 2Y7FA 4R33A 5HNRA 1L9WA 2PRMA 4IOTA 4JS3A 4LW7A 1GG1A 2B7PA 3NQ6A 3EXTA 3NM1A 1TV7A 5DBUA 4ZQPA 1BEUA 1YXYA 5I3JA 4UTWC 2O7SA 3W1QA 1NF7A 4JDBA 2V9DA 3M6YA 1H7XA 1TJPA 2V0TA 4I7VA 2Z2UA 3B05A 1KM6A 4JIQA 5CPNA 1H63A 3TCEA 1T8XA 1Q6LA 5LKYA 1W37A 4GUIA 3QJAA 1SSDA 4FNRA 3HPSA 1SSGA 3W83A 1XDLA 1LOQA 1IXOA 5H2ZA 4MJZA 3PAJA 3UXDA 1VCVA 3TV8A 5F2IA 2NV2A 1W3NA 4M19A 3N19B 3IV3A 2OX1A 3EXSA 3IIOA 3GX9A 3M7WA 3IGXA 5AYZA 1DORA 4HSOA 3NM3A 3UD6A 4FNUA 4PA8A 4A29A 1QWGA 3W1MA 3TW7A 1OX4A 3HGRA 4XQ6A 3HPZA 2GUUA 1AL7A 1NVMA 3G0UA 4UTTA 3W9ZA 2PURA 2WNQA 1PIIA 4N6FA 3EXRA 4CQ9A 4TX9A 4NUWA 4M7SA 5AYYA 1JJKA 3W7GA 2RFGA 1W5NA 4KWWA 3A21A 4Q4KA 3P8IA 3TH6A 1XFBA 1VYSX 4K6AA 3N3MA 4O14A 4TU1A 5D33A 5BRBA 3NQ7A 1ALDA 5C6MA 4JNMA 2J27A 4H4IA 1R46A 1WBHA 3MI6A 3RFAA 4OBTA 4UR8A 1EX5A 4P61A 1EEPA 3PWAA 1O5KA 5EYWA 3S6DA 1I2OA 2V2DA 4LV9A 3LCWA 3WJWA 4NVTA 5ABTA 1F6PA 3L5MA 1EP3A 2QUUA 4LRTA 6ALDA 3WJXA 4X22A 5AB3A 3IGSA 1AMKA 3LBCA 4O16A 1FQ0A 4CNPA 2HSAA 4X2RA 1VCFA 5DLCA 1KW1A 4IXXA 5KITA 3HG3A 1L6WA 4JTFA 1TPH1 4UFMA 5FF3A 5A5WA 3M5YA 3UY8A 1GTEA 3Q94A 1FCBA 3W1PA 1SU5A 3C6CA 1BWKA 3HB9A 3QYQA 2A4AA 5HUOA 4N4PA 3NPVA 1SW0A 3NZ1A 1W8SA 3GVGA 3IIPA 4H3DA 2J9YA 2P0OA 4MY8A 2QDHA 1OFBA 3DI0A 2Z1BA 3B0PA 3PB2A 3TQVA 4WZHA 4ONVA 1W5OA 1A5BA 2CU0A 3JRKA 4Y90A 1SPQA 1KFBA 2GOUA 1P0KA 2QCMA 5F4SA 1XBVA 4GBUA 4GE8A 5AN7A 4OHQA 2BWGA 1W31A 2VEPA 3GKFA 1T0OA 4P2VA 4S2BA 2RKXA 4JGDA 1QNVA 3EWXA 1N55A 2V5LA 1LOSA 3FKKA 4MIMA 3GLCA 5DN1A 3HMJG 2NXGA 3L9CA 3PR2A 3ABRA 4N9CA 3WK3A 2VOMA 2H8XA 1QPQA 4WOZA 1IXPA 2YR1A 3GR8A 3NR0A 3KVKA 3QEZA 3LTPA 1KTBA 1DJQA 3RK8A 1GOXA 1JUKA 4IUOA 3A23A 1H7OA 1KBIA 4JY9A 3TFCA 4IMEA 4LS0A 3A24A 2I9EA 1VGAA 3TJXA 2ISSA 4QAIA 1JCMP 4KFNA 4TO8A 2CFFA 3LHVA 5H91A 2VFFA 4BFAA 3GDRA 4C1KA 2UV8G 5AC6A 2A2IA 2OT1A 4TMBA 5U7SA 4Z1BA 4JTSA 1RD5A 4M6PA 4IXHA 2F84A 3M47A 1EP2A 5G1TA 3VCRA 4IWWA 3O1NA 3LRLA 1WBJA 5C55A 1VH7A 3LI1A 1YPFA 2FB2A 3TR2A 1H7WA 2I14A 5LNWA 2QJGA 1ME9A 4PFMA 2E1DA 4EVZA 4OU1A 1OF8A 5AOUA 2CLFA 1D3HA 1PV8A 2CLLA 3G0XA 4MFEA 2VENA 4BI6A 1LROA 4AH7A 5BMXA 3W7HA 2V30A 2A7RA 1S3HA 1ZFJA 4GWEA 4AAJA 1LORA 1MEIA 2A6NA 2PRLA 3DHDA 3T44A 3EX4A 3TJLA 4LVBA 3BK0A 3TMQA 4U28A 3IVTA 2FLIA 4I7WA 5HWJA 1YTKA 1ZCOA 2BSLA 3QMRA 1IIGA 3QF0A 1WXJA 3L5LA 3PC0A 4O1CA 3RU6A 1W5MA 1X6UA 3UWZA 4IX0A 2ATSA 3W7OA 4NU7A 4XUGA 4CQAA 3W1LA 2VEIA 2JKAA 3HG5A 3A22A 3C3NA 2ZA2A 1THFD 3LCFA 1S5TA 4O50A 4WY0B 1T96A 4DPPA 3W7JA 3USBA 4RZ6A 4RJEA 1FX6A 1UUOA 5K4XA 3EWYA 1ICPA 1O5XA 3EKLA 2QCLA 4MY9A 2C19A 3GNDA 1M5WA 5BMWA 1TPFA 1JCLA 2J9ZA 4FNPA 5EY5A 3W7KA 1DQXA 1AW2A 4QIUA 3WJSA 4JIPA 2EKCA 1U83A 4MUZA 5TQLA 4AF0A 2ATMA 3CM4A 3TU9A 3CB8A 5K4ZA 1ZAHA 3EWZA 4UTLA 5DCBA 4MZYA 3P81A 4RLIA 3PB0A 4Y6GA 1ZAJA 5LNUA 4KKXA 1XBYA 4JTGA 2BZNA 3LXCA 2FB3A 3BGGA 3LCIA 1SZGA 3R8RA 3I7RA 1ML1A 1IGSA 2Y88A 4QNEA 4OWGA 1GJPA 2HTMA 5FF0A 3C0JA 4WUIA 3UWWA 3BG3A 1AW5A 1TMHA 1O94A 3BLFA 4WXYA 5D05A 4EWND 4BR1A 2QCGA 1SO3A 1LBMA 4LVFA 4RXFA 1PCWA 4JYFA 1OABA 4JICA 1JRBA 1LOLA 2HMCA 3PM6A 1WQ5A 2J88A 2WPBA 3THAA 2QCFA 1MO0A 1UBSA 3L2IA 4QNWA 1KLZA 4O57A 1DJNA 3EWUA 3OHIA 2FPVA 3M43A 3KOFA 3KVLA 5HR7A 1EPXA 3TQKA 3CWOX 3NO5A 1GVSA 2ZRXA 2OT0A 5T26A 3S8HA 4GJ1A 2E6AA 1TO3A 3L66A 3NEVA 2ZDRA 1CI1A 2E5DA 3G1VA 4FX7A 1MEHA 1FY6A 2QEZA 1WX0A 4UXDA 1EUNA 3QW3A 3DGRA 3HBLA 3UZ5A 1Q3NA 5CG7A 3GNNA 3SIZA 3W73A 1KTNA 1YTDA 4OV4A 3TUUA 3U2OA 1H60A 4XTIA 3DFOA 3GIYA 3HGJA 2VFIA 1K3UA 4LU0A 4XBSA 3Q2DA 3BG9A 3I65A 3NQDA 2A7PA 3NOEA 3QQ1A 3G1XA 1DL3A 3CIWA 5BW6A 4TMCA 2BTMA 3SJ3A 3OEXA 1FWSA 1YLVA 4NNCA 3C4UA 2NX9A 4FX8A 2B7QA 3MUXA 3LHTA 1FXPA 2XN1A 3UWVA 2G96A 3M5ZA 3IVSA 4UTWA 2B4GA 2CZDA 4DQWA 5L9FA 1FUYA 1H1YA 3E12A 4NXSA 4B5NA 4DO6A 4Q33A 3F4NA 4HHPA 5K3VA 4M6VA 4IMCA 4DF1A 1OK6A 4CLMA 4HPJA 1Q45A 2ZZ6A 2DZVA 4JX4A 4PCFA 3PULA 4MZ8A 1LBLA 5DXYA 3IIXA 1W5PA 1KM1A 4N4QA 4RXGA 2DORA 3TIMA 5HWNA 2D73A 4NJHA 2Y70A 3MO7A 1ONRA 5EPDA 4PEKA 1KA9F 4AVFA 4WX2A 3ZFHA 4PL1A 3ATZA 5AHIA 3QRHA 2GJLA 1LTDA 1TQJA 4MLRA 5F2MA 3W72A 3TSBA 2XN0A 1F5ZA 4UMBA 3R89A 4A3UA 3NQFA 2JGYA 3JS3A 1PVNA 1QPNA 2ZCGA 4ZZ9A 3LLDA 2PC4A 3EB2A 2G95A 5K2ZA 1W0MA 3Q37A 1K03A 3JR2A 3WFAA 4MLJA 5DCEA 1FCQA 3W3OA 4C1LA 3W2UA 1R2RA 1RPXA 4YXGA 2X16A 4AXKA 1OVDA 1FDJA 3WJYA 5G2WA 1VYPX 4DF0A 3D0CA 3TSMA 3ZR4A 1R47A 4NX5A 5AC8A 3G1AA 3STEA 1TQXA 1ZJIA 1RQEA 3DFQA 1VLIA 4PC8A 1R2SA 1EUAA 1PHQA 1GT8A 3G3MA 4GXMA 5CZ0A 5F2LA 1W5QA 2A7NA 5DXXA 5LSMA 5AHNA 2QAPA 3DI1A 4D2JA 5AHMA 1F2JA 3NA8A 3GZ3A 4JTHA 5EMUA
chains in the Genus database with same CATH superfamily
3S1XA 1XS2A 3NO3A 4O11A 1H49A 4IP5A 4ICNA 3F2BA 2QVNA 1UD4A 4H9TA 2ZX5A 2V3DA 1BYBA 1SO6A 2J74A 4ZSTA 2FDMA 3BVJA 2XWDA 1V3KA 1A50A 1I2RA 7ODCA 4UTJA 4XD4A 1PE1A 1XKYA 3ARPA 3VI2A 1B30A 1HT6A 4E0CA 5XIAA 3GBDA 6PTDA 1QNRA 2F8QA 4PE8A 2XVNA 5CBBA 2INEA 2O4MA 5D38A 1MNZA 2GVLA 3VCNA 2Y1HA 3B8VA 1KFWA 4Y96A 3NDYA 1I60A 2YYUA 3CQ0A 3NQEA 5D32A 3WQ6A 1RCOB 1QI4A 3CUHA 1H51A 5JXQA 3IGUA 3WBXA 3BGJA 2YBVA 1MNSA 2GK1A 3LPPA 2QIWA 2C1GA 3I7QA 1C92A 3Q65A 3V0SA 1XDMA 3U2CA 3DFPA 3GIPA 3E2QA 3FAWA 1JZ3A 1TREA 3DUGA 3VVGA 3H7VA 4LH8A 4FALA 1QO2A 1G67A 4GRSA 1XRSA 3MY9A 4N6EA 1P0NA 4GIYA 4EKJA 4JIEA 1CXLA 1X1OA 4K38A 4KFOA 4IGNA 2POTA 4JTIA 2VRKA 4Q4QA 2QUTA 5CSRA 4M6UA 4MYXA 3CYVA 1FDZA 1AL8A 4LEQA 4G8TA 3AROA 1TPB1 2O4QA 2JIEA 4C60A 3VDHA 3GDMA 1KRBC 3C2RA 4DUXA 4D8AA 1KV5A 3VIFA 3E0LA 4AWSA 1FWRA 1MRAA 3G0SA 3WD4A 4MJ2A 1IXNA 3GU1A 5GJMA 1VJSA 3L2MA 3ARZA 4F4RA 2W79A 5M2FX 3SZ8A 1LDCA 3EDFA 4BA0A 3LRKA 2DZUA 3W2LA 4GQGA 4JEJA 1GOIA 1OGSA 1XSJA 1EHAA 5AHFA 4XZHA 4JN6A 2G3MA 3KVMA 2YIHA 2HV5A 1E9YB 2WMGA 3A6OA 2HE8A 3ZWSA 4O1AA 2VJXA 4AEEA 2OOGA 2W63A 4YMZA 5KZDA 5LHFA 1LRQA 2ISFA 3UG5A 6REQB 2GJPA 4I5XA 3NVDA 3AIQA 2AGKA 4OV9A 5KMYA 1NP2A 2UZ9A 3TNBA 3GW3A 1VEOA 4DPQA 5I79A 4K8HA 2WSQA 3E0WA 5M1TA 1XH2A 4FNQA 1ZRQA 5G4HC 1HJVA 3BSGA 3E49A 1GVRA 3RG6A 2EJAA 3OBKA 2Y5EA 4AD1A 1HL9A 2XDFA 1KNWA 1S2VA 2DSVA 2GQ3A 1SW3A 3KHJA 4H7CA 3BURA 5G2HA 5CZJA 1KC7A 4MNLA 1W9BM 4JFUA 1I0DA 1P7TB 3TONA 4LPCA 3W81A 2FZ9A 5F4XA 2Q8LA 2DZTA 3F2CA 2XGZA 4QCEA 3A13A 1JDCA 4JR5A 4YCOA 2YA0A 1WDRA 1K9EA 3TYEA 4QS5A 1E3ZA 3W6YA 1WV2A 4HPXA 3QMSA 4DJDD 4K8EA 3N13A 2JALA 3DN5A 3EAUA 4TIMA 2QZRA 3DIPA 4NI3A 1W1YA 2R91A 1W3TA 2WJDA 4CNOA 3AIVA 3GTXA 2VEMA 5SWUA 3GNOA 3KCOA 4GQQA 4WSJA 1YQ2A 4Y7EA 1SJCA 4O12A 3T0DA 1B3ZA 3WH5A 1LP6A 3F03K 1K02A 5AY7A 3AISA 1EWEA 3TQ0A 3EWCA 1B3XA 3B0UX 4HK7A 2HVOA 3C2FA 3GG7A 3CL8A 1M7OA 1QUMA 3I6RA 3GH7A 5EKYA 3PFRA 3WQVA 5KETA 3A4AA 4UMCA 1ZENA 1UD2A 1YDVA 4XKYA 1XSKA 4CQ8A 1TWIA 2ZRUA 1S5NA 2XIIA 2ZOXA 4M29A 5D4YA 5LHEA 1RQBA 1KFCA 4ZQOA 4CCEA 1XI3A 4KWUA 3M46A 3G22A 3W7QA 1BWLA 4GA8A 4HYVA 4W87A 4WDTA 2J7GA 4DYEA 2Y7EA 1F9CA 3B8UA 2BXYA 4GFIA 1M7XA 5LIWX 3S2JA 4HPHA 4HNNA 5CEWA 5H8PA 3WBWA 4DBEA 2J9XA 3K4AA 4GVFA 4QQ3A 1EBGA 3VKDA 3CZEA 4ERAA 4FIQA 4KCVA 5HPCA 4AQLA 2AQOA 2Q71A 1OF6A 4GUJA 3LG3A 4CGTA 1UPMB 1CENA 3QVQA 1VD6A 3IACA 4YPJA 1X8FA 3U4AA 1KO0A 2MANA 5FEZA 4NRRA 4RE4A 5EMMA 1E72M 2OTDA 2ZX7A 2HWGA 2R8WA 3QZEA 4GKTA 4PUNA 1EH9A 4AD0A 2IQTA 3WDQA 3NGFA 1QO5A 1XYCA 3N25A 2ZXAA 2DSWA 4QSHA 3QR3A 1JPMA 5C54A 1BQGA 4PCTA 1A49A 1QNPA 5ECVA 1KFJA 2PF8A 2OX4A 2GJNA 1AQMA 1CGXA 2ZX6A 3WF1A 1TV5A 3NQMA 3E9AA 1FBAA 3S2CA 4Q3MA 3VNMA 1T8QA 4DB7A 4ZTYA 3HF3A 4L6HA 2INFA 3W85A 1LRNA 3WIJA 3IPWA 4A8NA 5D04C 2PUZA 3RM9A 2NT0A 3P7YA 2GVJA 3SY8A 3S3GA 3W1AA 1PPIA 3W71A 4JTAA 1UR1A 4QHRA 2WM1A 3OLEA 2NZLA 4Q8PA 4HZMA 2BB0A 3IK2A 4IMDA 2HS8A 1E56A 2CZ5A 2PZ0A 5DY3A 4DWDA 3SGGA 3INPA 2CXGA 2WYSA 4LY8A 4BK9A 4UTHA 1AZ2A 1MZHA 2E8ZA 3IRDA 1U30A 2JEQA 1KQZA 1TR1A 2W5FA 3BQ6A 4H9YA 3UWUA 3P3BA 1Y8BA 3VNKA 3BWWA 4O1BA 4LBSA 3BLKA 1K8CA 2J75A 1RP8A 3WLTA 1V6YA 3DYMA 4GVHA 4M5PA 3N2MA 3MUIA 2WPGA 5AZ0A 4UR7A 2OLSA 2OEMA 4J9JA 1EB3A 3C52A 4ADTA 3RYSA 1OFEA 2Y7GA 5D2XA 1J4EA 1VENA 3W7LA 1FWWA 1OYAA 3O8AA 4NNBA 3TX9A 2QJIA 3M41A 3TK7A 1P6BA 4YWIA 4YVXA 1G7VA 1B0IA 1FWTA 1QCWA 3RU8X 4PUJA 1E9IA 1IV8A 2C0AA 1L8PA 3WLJA 3BLLA 5FJTA 4O0QA 2QGYA 4A21A 2E9BA 3SEPA 4FEZA 1WOAA 4MJMA 2QCNA 3DFYA 2PWUA 1SW7A 1EIXA 4B91A 1A3HA 3MUZ1 3MUAA 2YDSA 2XIMA 2QDEA 1C8YA 1ICQA 2HXTA 2R9RA 3HG2A 1HNYA 3WMCA 1AH4A 3NGJA 2HK0A 1MDRA 3AXIA 4CU6A 4HNVA 1J96A 1ADOA 1ZLPA 3CTTA 3S83A 4JQAA 2Z0IA 4YS1A 4QJ5B 1OGGA 1HO4A 3O16A 2FPTA 2ISVA 3F4WA 4F0RA 1US2A 4YYCA 5C9UA 2NVDA 2OQLA 1TFVA 3CYJA 4O19A 2YLLA 4GQRA 1RQHA 4KPLA 1OYCA 4MKVA 1DPMA 4IUGA 1WNOA 1P7TA 1B1YA 4L65A 3L7RA 1HQTA 2D69A 1RD6A 2Z6JA 3P61A 3UESA 2JGQA 1GVQA 1PZ1A 3H7UA 1P1XA 1ZP4A 3TN5A 2CERA 2X0YA 4DI8A 1VBUA 2NQLA 4O4WA 3T09A 3WLIA 3QPEA 3SGZA 3FVMA 1NAL1 3NXFA 4AG0A 4E2OA 4LOCA 1F7BA 3TAKA 1FWGC 4F48A 4X61A 1K8ZA 4N9BA 1EBHA 5CGMA 1ZS2A 3G1SA 4WHBA 1UH3A 1R3RA 2WC3A 1CLXA 1J8VA 1H4PA 4YVPA 3VU2A 4MB3A 3VINA 4C6JA 1SZFA 3G1RA 1K77A 3VIGA 5G4EA 1Z3NA 4NZFA 4Y8FA 1ZHAA 1Q4NX 4JCMA 4LYRA 1CGVA 4I8YA 3NTYA 4GIRA 1AODA 2PDWA 1BSLA 2Q01A 4GOAA 1XG3A 4FIRA 4MF4A 2DZXA 1XC4A 3CV6A 4KWOA 4LNYA 1OX5A 3QHMA 3FJ4A 4WOQA 3AWOA 2XISA 3IEBA 1NU5A 3ARYA 2PDUA 1XIGA 4PH6A 2ZE3A 2DDXA 1HJSA 2WC4A 1J79A 3VIPA 1K4GA 3PSWA 3VD3A 1F4AA 1ZALA 2J7DA 3HQPA 4LS2A 4AHQA 3QBUA 2VC7A 5A6JA 3CMJA 3PUGA 1YPIA 4D6GA 1D8CA 2PC8A 4X3ZA 3LZ3A 3G3DA 3M0MA 1G1YA 1EXPA 3PTMA 1QI5A 1VEMA 1VB9A 4W88A 4OZOA 4MPQA 1A5OC 3FYOA 3P14A 1V6VA 4O0KA 3RAOA 1A5SA 3B4YA 1W91A 4A2SA 3URAA 2D3NA 3AWNA 3T6CA 1N2VA 3QMTA 2QJHA 2VC6A 2CLMA 4PTMA 2OZ3A 4AB4A 3L0KA 4H6KA 3BICA 5D2YA 5FF2A 2EXOA 3WEOA 3MCMA 3SSZA 3VOCA 1CNVA 4NXKA 3LXBA 4DXVA 1A5AA 3SCSA 4DJFC 3T0TA 4NSBA 1T40A 1KKRA 4JYDA 5EGRA 5A94A 1FWHC 3M0KA 1QOQA 4UQ9A 1FWEC 2EQDA 2YXGA 1VJIA 4L4MA 1ICSA 3C2VA 3IARA 1K8XA 1MW0A 2FTWA 2XN2A 4E2VA 3C8FA 1M7PA 1MQRA 3SY5A 5A3HA 3UFYA 3AOFA 4M0XA 4F40A 5HAOA 5BROA 1DBTA 3VX1A 2FVLA 1BYAA 1V0NA 2DZSA 3W7PA 4PTXA 3VD5A 4NP7A 3HN3A 2D0HA 2VMFA 1QPRA 3KRUA 2P76A 1XYMA 4B5UA 3UXKA 3POHA 3W82A 1TUXA 1ECQA 1X8CA 5GNZA 1UJQA 2VZSA 1RJPA 3AYSA 4ENLA 1XD0A 3FYPA 2TYSA 2YFOA 3WQPA 2CLEA 3TW9A 1CB2A 3NCOA 3XISA 2J4GA 4L5ZA 4WKAA 1IWBA 3PG8A 5CC6A 3EWDA 2NX3A 4XVEA 1DIKA 4LAOA 3W24A 1EKOA 3UCQA 3EWBX 3ABXA 1W9UA 3S1GA 3GXMA 1S46A 3MWAA 4E3TA 3OVRA 5KINA 4E2BA 5HQMA 2ADAA 2VQUA 4O10A 2VOTA 4PMUA 4MKNA 2PRHA 2QCEA 3N2BA 3RX2A 4S1FA 2ZX8A 4GYKA 3AZTA 4OQVA 4UTKA 1BVZA 3NL2A 9RUBA 4UB9A 2R24A 2WV8A 3ZVHB 3LUTA 2Z29A 1VCGA 4FHAA 4IPIA 1Q2RA 5G1YA 4PMRA 3AIRA 3QSTA 4AX6A 2HISA 3NIYA 2WZIA 3HA1A 3ABZA 3UY7A 1QMLA 2ZUSA 3PTKA 3CT7A 1JGIA 1H62A 2UWFA 1LWIA 2QJMA 2V38A 3U8GA 3NQ8A 4MWAA 1DWIM 3PJTA 3ALFA 2J66A 5FKYA 1S2WA 2W27A 2Z00A 3LHUA 1JUBA 1G0CA 4GCXA 2PDPA 4XK2A 1UUMA 1HO1A 2B0MA 1ISXA 4HMEA 1CPUA 1F3XA 3ANYA 4XD5A 4O54A 1DE6A 2ISDA 1KFLA 2HRWA 4IHCA 4HNTA 3CQKA 4JCLA 5A6MA 4US5A 1J2BA 1FCUA 4CD8A 4CN4A 2RJGA 3UR5A 2I1OA 3PTDA 3A12A 3GYEA 4PTNA 4BKNA 5DT7A 4RDYA 3QN3A 4H6RA 1Z42A 4NJJA 3B8SA 1VIWA 4XD3A 4QLKA 3VE9A 1F74A 4E8CA 1MQQA 2HVNA 3GH5A 3I3EA 5E6ZA 1V0KA 2J7FA 7REQB 3VD9A 2Y63A 2NQ5A 2C15A 1KBKA 3ABSA 1EPVA 1A4LA 4UNLA 4N9EA 4AMAA 4UTMA 1LUCA 1A0DA 2BVYA 1YTEA 1EA9C 4GY7A 1TSIA 2Y8VA 3P93A 1UR8A 1KM0A 2VC9A 1REQB 4XAPA 3CUIA 2FGLA 1I2PA 3WF0A 3I3DA 3ERPA 1XIDA 4P8XA 1W54A 1XJBA 4ML4A 2YGYA 4GH3A 4JTUA 1L2UA 1S38A 1X98A 1H0IA 3R0KA 1JD9A 3LTYA 3ORWA 4NJIA 3WK1A 2VUYA 4ADUA 3B8DA 3QTPA 4EK7A 3O6DA 1QBBA 1H5YA 3QY7A 4DRSA 1KFKA 4IPPA 4RPPA 2BP1A 1H11A 3H2OA 2FYMA 4XZWA 2VHLA 3NPWA 2O55A 1IT0A 3CIVA 1UH4A 4OFCA 2J6XA 4PUKA 2WC7A 4JHMA 4R33A 3RILA 4OUEA 3UJFA 1LL4A 4JS3A 1TX0A 4M81A 4LW7A 2B7PA 3GZAA 3WDIA 3DFHA 3EXTA 1XYFA 5I3JA 2O7SA 3W1QA 1NF7A 4JDBA 2PTZA 3GE7A 1H7XA 1TJPA 2V0TA 4I7VA 1IZJA 3B40A 3R10A 1U5VA 4YIWA 4DJFD 1ZJHA 3WUGA 5CPNA 1Q6LA 3ITCA 5LKYA 2DEPA 4GJJA 3HPSA 3E3HA 3THDA 1XDLA 1LOQA 1IXOA 5H2ZA 3PAJA 4GI6A 3TV8A 5F2IA 2NV2A 1W3NA 1NQKA 1UWQA 5HMEA 5LYRA 3RRAA 3EMCA 3EXSA 3GX9A 1BXBA 4JPGA 3OGRA 1S39A 1XYZA 4BQ3A 1AUSL 1YRRA 3GG1A 4PMNA 3NM3A 4PA8A 3UCDA 4A29A 1OCNA 3ES7A 3FY1A 1JF6A 3W1MA 3HGRA 3G0UA 4UTTA 3BE7A 3W9ZA 4NHVA 1W32A 3V5OA 4IPNB 2RFGA 4MG4A 1RXOB 4W93A 4KGLA 1W9VA 3URBA 4AUBA 2WZEA 4AIUA 1XFBA 1XSIA 2GJXA 3EDEA 3BOLA 1UKQA 2NQJA 1MUCA 4O14A 2FHCA 4TU1A 5D33A 2QV4A 2PDGA 4JNMA 3RFAA 3BL3A 4H8HA 2DUAA 1I2OA 3LK6A 3PZVA 4LV9A 1HKWA 4LB4A 3CWHA 4HJWA 2R82A 4L1WA 6ALDA 4LRTA 1W9PA 3IJQA 1DXFA 3IGSA 1FQ0A 4B4FA 5BRPA 5C71A 5DLCA 3PZOA 4GY0A 3KRBA 2V5KA 1TPH1 4UFMA 5FF3A 4Q4OA 3M5YA 5A5WA 4WK9A 5E70A 3ZJKA 3W1PA 1D2KA 1SU5A 1NDYA 2X2YA 4KMQA 4QEHA 1EFZA 3VZXA 4JIHA 3VOHA 1NWRA 2J9YA 2P0OA 5CJNA 4MY8A 3ANUA 3TQVA 2ZC1A 4ZOAA 1PX8A 1UR4A 3R25A 2Y24A 1W5OA 2OU4A 1JPKA 2PP3A 1A5BA 1UMYA 3QYSA 4Y90A 1Z9AA 2GVEA 2GOUA 3K4WA 2QV5A 5F4SA 4D6HA 1XBVA 3EKGA 1JXKA 1T0OA 4NRSA 2RKXA 1MFVA 3EWXA 2A3LA 3T05A 1XLKA 2FH6A 3T0CA 1PXGA 3L9CA 4FXFA 1IWPA 3NSNA 1YNYA 2PDQA 4Q8TA 3M0HA 4U3CA 3KDNA 1XDJA 2SFPA 4C6MA 3GNRA 4BS0A 3KVKA 1OG6A 2XVLA 1KTBA 1GOXA 1HX0A 2OO0A 2P8BA 2GWGA 3E0VA 1H7OA 2VCCA 1HKVA 1KBIA 2V5DA 4IIBA 3A24A 4X0NA 3UGRA 3MVIA 2YCJA 1W1A1 2ISSA 1VFFA 4ZENA 4KFNA 4Z2IA 3LHVA 1XLBA 5H91A 4C1KA 5C9WA 3W00A 4H7ZA 1RALA 5D8ZA 3WFZA 1EZWA 2OT1A 1AVAA 3IUDA 1CIUA 2G50A 2Z1WA 1KBBA 1KR1A 4M6PA 4WSHA 4HK6A 1Q5MA 2Z1SA 5IXEA 4S3KA 3TTOA 1VH7A 4GZJA 3LI1A 1VFMA 1CLKA 2FFIA 2BS9A 1DE5A 2WMIB 4OU1A 2VENA 1E1FA 1LROA 5CC5A 2Z1KA 3A3HA 2QJNA 4ZFCA 1S3HA 1UOKA 4AAJA 3HQOA 5FSDC 3LPFA 2OSYA 4LVBA 1TZ7A 4I7WA 2FLIA 5HWJA 4M1RA 4LJ3A 1ZBWA 4KS0A 1DTUA 3VDCA 3SCQA 3L5LA 3PC0A 3B8IA 4C6QA 3SCVA 1MFUA 4P7OA 3HG5A 3R43A 3U5UA 1THFD 1XF0A 1D3CA 1ADDA 1V3HA 1EF2A 4PMQA 3KOWA 1OCQA 3SUSA 4DUWA 2R6OA 1FX6A 1UUOA 1W1TA 1QI2A 3QQWA 4GX9A 1EC8A 4C6LA 5ABGA 2YXOA 4F66A 1M5WA 4HU8A 5BMWA 5I0DA 1VKFA 3RO8A 4FNPA 4MAVA 1VF8A 1AW2A 1RPKA 4QIUA 4JIPA 1MQPA 2WCGA 4KT2A 4MUZA 5TD4A 5TQLA 1E6ZA 4W7UA 3VKKA 3AUJA 3B0YA 1W1PA 4NZ1A 3CM4A 3TU9A 3CB8A 3PPHA 1ZAHA 3RRXA 1B9ZA 3EWZA 2Y0FA 4LQ1A 1TMQA 1GKQA 4R5EA 3PB0A 4TUFA 4Y6GA 3KTSA 3D6NA 2ACSA 4KKXA 3BCJA 2I5QA 4RNJA 3VUPA 8XIAA 2O9PA 3LCIA 1SZGA 3R8RA 1REQA 3MZ2A 4QNEA 4AX7A 3POCA 4OWGA 2HTMA 3WQ4A 3C0JA 3SCRA 4H8NA 1TMHA 1O94A 3BLFA 3A4XA 4PTVA 4S3GA 3EMZA 3KHDA 5HMFA 3QV6A 4KF1A 2HMCA 3AAMA 2WMKA 2J88A 1RK5A 2GYIA 3WZ0E 4QNWA 3FDGA 4NF7A 1EGZA 1DJNA 3F2DA 1UR3M 4JQ3A 3KVLA 5HR7A 4HZ6A 3TQKA 4IIDA 1GVSA 2ZRXA 1Y5VA 3EBVA 4GJ1A 4CQCA 3ARUA 2E25A 2P0IA 4ZB2A 3QZ6A 3NEVA 1S2AA 4RE2A 3G1VA 4FX7A 5DMLA 1WX0A 1Q7ZA 4UXDA 3DGRA 3UZ5A 5CG7A 3VNIA 1GJWA 2WVVB 3BJFA 1CBGA 2GSEA 2W61A 1KTNA 2PWHA 3U2OA 2VZUA 3GFZA 4KBXA 1IEXA 5I07A 4YNGA 3VOJA 3Q2DA 3I65A 1XR2A 2G3FA 2R1NA 1AQHA 2PFHA 4MNMA 4TMCA 1A5LC 3SJ3A 4DJDA 2D20A 2D0GA 3CMGA 2B7QA 4C1NA 3HFTA 3SB0A 2XN1A 3UWVA 4UTWA 1J01A 4DQWA 1FUYA 4NXSA 1XPGA 4L61A 2OSXA 2R1MA 4WJ8A 5K3VA 3T9PA 4M6VA 4CLMA 3ZR6A 2VGFA 1RLDA 1OC7A 1OEPA 1QOXA 2EG7A 5AKQA 4HCHA 2QHAA 2IXVA 5DXYA 2NQHA 1W5PA 3E2VA 3H2NA 3B97A 4N4QA 4KCUA 1PB0A 5HWNA 4NJHA 2Y70A 3TQPA 1QU4A 4AVFA 3N12A 1XLEA 2CHOA 5FL1A 3WN6A 1R3QA 5AHIA 1ONWA 1UKSA 3VD7A 4PUEA 3R89A 2AGTA 3IWPA 1LF1A 2JGYA 3UVAA 4ZZ9A 3GHRA 3L23A 1EZ2A 3LLDA 4M82A 1HJWA 2PLJA 3GTFA 3JR2A 1Y65A 4C1LA 1YBQA 2F6UA 4J3UA 1EDQA 1NTHA 1VYPX 2F2HA 4DF0A 1Q6FA 1GHRA 3D0CA 3APYA 1GW1A 1R47A 2HCVA 3VAVA 1ZJIA 1Q2SA 2CKSA 3B9EA 4P8WA 1RQEA 1V8EA 4MMWA 1A5UA 1AJ2A 1EUAA 1PHQA 5CZ0A 4Z2LA 2A7NA 4DBUA 1DIDA 2CHNA 3QOMA 3CHDA 3OG2A 1XLHA 5AHMA 1F2JA 3EZ4A 3C5QA 3N6JA 1WDDA 2DSUA 4Q4MA 3TKFA 3K8KA 2CC0A 3PZIA 4Q7NA 2GUBA 1K70A 4ZA0A 3VMOA 1TV8A 1XCXA 3BW2A 3VZZA 3LBOA 5I00A 1E6NA 1UASA 5KZ6A 3QOKA 2V82A 1US3A 1POJA 3MV01 3QSRA 4JDYA 4UOQA 4M6QA 3FHQA 4A6GA 5A95A 2C3ZA 1XCWA 2A6LA 3S9ZA 5D9MA 1YW1A 4B3KA 1KBLA 4B5SA 1PYMA 2NXHA 3N4AA 5FESA 4BEQA 1F61A 4GUFA 4O52A 2OLHA 4L9YA 5K7JA 2W91A 1BPLB 1EQCA 5EMYA 3ARWA 1AD1A 1G7UA 1HGYA 3PF3A 4H9ZA 1RHCA 4J7RA 4CD5A 3MCNA 2RH9A 3N2XA 4C5YA 1SFJA 1S3TC 4E8GA 4HJFA 1XYLA 4ICMA 1KRCC 7ENLA 2RDXA 5I23A 3OIXA 3UXAA 3LMZA 3NPXA 2DUZA 2G97A 3FIGA 3OLGA 1YYAA 1R7OA 2Q3OA 3VO0A 1RUSA 5TBOA 4GVIA 3IAQA 4OVXA 1EQPA 1DHPA 2IS7A 2V67A 1RBAA 1ENUA 4F0LA 2UY4A 3PPCA 2CWNA 1T7LA 3FHAA 3VGHA 4UQCA 3W76A 1KXQA 3PUEA 2REQB 5D2WA 1XWYA 3S6OA 3W2NA 1JCNA 2X1IA 3TJIA 3KS5A 3LCHA 1IEQA 2YL8A 3LQLA 2XSAA 3ZVIA 1O6IA 3H24A 4UTFA 1W6TA 4XZ9A 2QMJA 1XIBA 3WLQA 5FEWA 1XHGA 3GB6A 1XM3A 3W7DA 1JPHA 2QAFA 4HA4A 4HYRA 2E0PA 3LCXA 5EFFA 3VKJA 1VFLA 2QF7A 2CEQA 5BWAA 1AFSA 2WMHA 3LV5A 3VKCA 3MHFA 3WDPP 2J7CA 1KLYA 3OVPA 3AYTA 1PKNA 4HOWA 1C90A 2FVKA 3NXLA 3KLLA 2TRSA 3T4CA 3AUOA 1JG9A 3GK0A 2PB1A 2ZDSA 1FH8A 3DU0A 5DF0A 1F3EA 4V15A 3W7IA 2DV0A 4UCGA 1QWKA 5G4WA 5CAKA 3OODA 2FGZA 4PODA 3O05A 3BW4A 1E1CB 3FJ6A 1JFXA 1PZ2A 1MW2A 2BHYA 3TVAA 4MSSA 5FAJA 3GVRA 3VM5A 5BU6A 2ZBTA 3BZJA 3GYCA 4GLEA 1T5AA 1LBFA 1ZGDA 3M0YA 3RX3A 2GQ8A 3IIVA 2ACUA 1S1PA 2IKJA 3G24A 3L12A 3IVUA 4W7VA 5JU6A 4Y9PA 5CSUA 3O06A 2CBJA 5ABEA 1G69A 2C7FA 5C2GA 9XIMA 1MDLA 3G6MA 3M9YA 2VD9A 4UQAA 5HNNA 1ZNNA 3USZA 4LEFA 3O6CA 4L7ZA 1W2VA 1J12A 5J5DA 2FJKA 1NFBA 2F6XA 3N6QA 2VRQA 1NEYA 3BJTA 1LRTA 1BAGA 4GIAA 1QPOA 4OKDA 2OZ0A 1JZ2A 3QW4B 4TX8A 2ZUTA 3WX7A 3BG5A 2WVVA 3QH2A 5LZLA 1MUWA 2BOEX 3WDJA 1FKWA 2CZFA 1M6JA 3TC7A 3TAOA 3ICJA 3VKBA 1CDGA 3GY1A 2WNZA 4PMXA 5C8BB 3WL0A 2OG9A 2EPOA 4XUYA 1KM5A 4ZO6A 1LYXA 3WENA 3H2EA 2VCAA 3FNDA 4TVCA 5JIPA 2XVGA 2PTXA 4PUDA 4I9AA 2VR4A 4XG1A 1BGAA 1UZ4A 5I3GA 4JQ4A 5JMUA 3SI9A 3VK5A 3W23A 2WNWA 3UQNA 1MRQA 1H41A 3NUKA 2VEKA 2Q8XA 1TTJA 1E4NA 1OFRA 3DKJA 4MM1A 4J3XA 2HQAA 3OA3A 5T9BG 1N8WA 3KOXA 1E73M 2B7NA 4J1OA 4JFSA 2A5HA 2PMQA 4WGXA 5CQ1A 3UPMA 5I2UA 1XLIA 1PSCA 4HKPA 3MYOA 2OQHA 1XYBA 1BKSA 4ZL1A 2G0WA 1ESWA 1PZ0A 2GPTA 2HK1A 3VGDA 3LOTA 4LF1A 2A3AA 2VL4A 2FMOA 3SIMA 2OKOA 4PMYA 1LLWA 3ARVA 1B57A 3CH9A 1J2WA 1TRDA 2G3JA 4FXRA 4P8UA 3RNDA 3IUIA 2V69A 2E7FA 3LCLA 4PSRA 2WZMA 3TN3A 5E6YA 1NSJA 2QUVA 3PWGA 1TV3A 1V03A 2VZOA 4HTYA 3O0FA 1F6KA 3VGBA 4CCCA 1M65A 5FL0A 3O07A 1Z69A 3U9IA 4DZIA 2ZA3A 4XSLA 3M0VA 1DJWA 4LUTB 1SMAA 4V1XA 3K8MA 3P74A 4ALDA 3URNA 3IIZA 4B9YA 3JZEA 2DJXA 1WZAA 2WMFA 1FCVA 4AZ5A 4D6CA 4FXJA 5BCAA 3TLLA 3ITYA 4QISA 4C6PA 4DWSC 4Q8VA 3ALGA 1WOBA 3FFSA 4GJIA 2AAAA 4AZCA 3PHAA 1A5MC 2E68A 2NUWA 3W4RA 4FLSA 1VBHA 4MHBA 3NQVA 1FWJC 1TUFA 1A4MA 2EPHA 3BPWA 1JCTA 4L80A 3O7UA 3N29A 2A3EA 2BY2A 1M41A 1DIOA 2DT3A 3OP2A 2G37A 4OUIA 5AVNA 5BU9A 3K5XA 5F2GA 3UNTA 3K8LA 4M1BA 2JBMA 3OGVA 3OLIA 1E3XA 1RA5A 2J47A 5G5IA 2VEGA 5DMNA 1V02E 1N8IA 1TPUA 2IXUA 1K7EA 4GISA 4EE9A 4QRNA 1MW1A 1K9DA 2RHGA 2ZRYA 4AVOA 2I57A 3S5OA 5G1MA 1UJPA 1IEWA 1SJDA 1WA3A 4P7LA 1BXCA 3SN0A 2PDFA 3G5EA 2ZUWA 3UCCA 4FZIA 2E5BA 4YTRA 1Q6OA 2VM8A 3PFMA 4ACYA 1PIFA 1YADA 1V6WA 3V3WA 7TAAA 3DFTA 3K1GA 1GYNA 5LXEA 1XL9A 3V16A 2Z25A 5D09A 2H3BA 4HHLA 5E1QA 4FLQA 4BI7A 4WXZA 2E77A 4ZVJA 2BX7A 1PUDA 3R13A 1LM1A 3SRHA 4JKKA 5GVJA 4OECA 3EYPA 4LWWA 3U7VA 4K8GA 4S3BA 5CZTA 2ABAA 2P1FA 5EFDA 4O0ZA 5AC7A 4DBDA 1P4CA 1W9XA 4LS1A 1HF6A 4J3WA 6TAAA 1MXDA 4DO7A 4UTIA 2GSHA 2WHMA 1UC4A 2QJJA 3UR8A 3L65A 4C6BA 2ZVRA 4ADSA 2WJZA 2VFEA 4G7EB 4QLJA 2OCZA 3EA2A 3R94A 2B31A 2WLZA 3SCOA 4U5IA 4QM1A 3L68A 4A8RA 1DYSA 1UKOA 3CQIA 1VRXA 4P7RA 4MWAC 4UR9A 4UIOA 3NDOA 1G6CA 2FTPA 3WQEA 1DJZA 2OZTA 3P60A 1JEZA 3FS2A 2VYOA 4NAFB 4YL2A 3H4XA 4S3EA 4LFYA 3THUA 2YA2A 2NVCA 1SMDA 3KOZA 2W0UA 3W7CA 1VHCA 5MHBA 3W7RA 3WYZA 1JYVA 3WH9A 3ENLA 1E1CA 4NT0A 3HQ1A 4O1DA 2R14A 2E40A 4AC7C 5CLTA 1F07A 1QFEA 3U6WA 2Z28A 2XIJA 3CLMA 4KEUA 1A0CA 1DWGM 4LRSA 5FCZA 3NEHA 1PL9A 1QTWA 1DJXA 4E6MA 3DBNA 3CZ8A 2BLEA 2E4TA 1VPYA 2YCLA 2ZZ2A 1FWCC 3T0BA 1CGWA 1R9XA 1UD6A 4JIRA 4W5UA 1KM2A 3LN3A 4CNTA 2CNCA 2WJEA 2CLHA 4QJ3B 4AZHA 3S42A 5TIMA 3R2GA 1G9HA 2TODA 3W07A 3BMXA 1BTMA 4RDWA 2MNRA 6XIMA 4AFYA 1JUEA 5A8OA 1E0TA 3M5XA 2VKZG 3DENA 4A4AA 1E0WA 1UKPA 1J9YA 5I3IA 6CGTA 2BGQA 4AWTA 4I90A 4C65A 3RO6A 4IISA 4WKHA 3SJNA 4CD6A 2WVUA 3UA3A 3PJUA 2BNJA 5PTDA 1I2NA 4D6DA 3OPSA 1GOOA 3DAQA 1M03A 5FJIA 5HUPA 2O9TA 3FVDA 3U3HA 5EB8A 4JFWA 1S2CA 3C56A 2I17A 4FNTA 2WOQA 2BVDA 4RDVA 4MWAE 5EL1A 2VWSA 3IS4A 3WK2A 1M53A 1I4NA 2V2HA 3AMDA 4DM1A 2WM0A 4R85A 1TKKA 4DWSD 4XAFA 5J04A 4RPQA 4ZODA 3ITVA 1V79A 3LXAA 2A1YA 2HROA 4A35A 2OOFA 4LVGA 1FXQA 4AZGA 1EC7A 3W2KA 2Y85A 3TA6A 2BXVA 4H6EA 3ZT6A 4DJFA 3ISIX 3B8TA 4UTTC 2G4JA 4G6CA 1V08A 4K2SA 1KM4A 5J8LA 4W8AA 4DYKA 1JRCA 2WSKA 4B92A 3WD1A 4WKFA 3H53A 2VFDA 1IHIA 4H00A 4JL2A 3HM7A 2HVMA 3UNDA 1SYTA 3N6HA 5AHLA 4RV8A 5A8PA 4IGMA 2ZA1A 2X09A 4JHOA 4XZBA 1FFQA 1YNPA 1J0ZA 3W75A 4JKMA 4O18A 2Y7DA 2V5CA 1H1NA 1OX4B 3V1PA 2WB5A 1QATA 3RJYA 3L4UA 3BLIA 4NZJA 4A8LA 3UVIA 3VMNA 4GC4A 4Y2WA 4URIA 3TWBA 1RSCA 2XGBA 4E4FA 3BC9A 1JGMA 2A3HA 4AHOA 2ZUMA 3GH4A 4ZXLA 4GNJA 3UBPC 4GI9A 3PNUA 4UC5A 2NX1A 4XTDA 1TYGA 2C13A 4D6IA 2YZRA 3B8WA 4Z1YA 4DJEC 3W1TA 1J5TA 2G5WA 3PUDA 2GDVA 3NSXA 2X1SA 1FKXA 3VOGA 1FFRA 1JZ7A 4FO4A 3LGGA 4ZXOA 3EB3A 5HNUA 3N18A 5C9RA 4R53A 4Q8NA 5HNTA 1GKPA 3SCWA 2ZC8A 2FPYA 4GFSA 1NDVA 2XZ7A 3NPUA 1P48A 1UQYA 1E71M 1JZ4A 5A1AA 3UERA 3P0XA 2HNHA 2E9MA 3V36A 3XINA 4MWAD 4MUPA 1UD5A 3PZUA 3KX6A 3ATYA 4Y9AA 2DJLA 1XBXA 1DWAM 1R30A 3MC5A 2VNCA 2WKGA 3MDWA 3GAYA 1TR9A 5DELA 2ZWZA 4KIEA 1M04A 1HJQA 2V2CA 1KTCA 1IXQA 3F7JA 4F0MA 3MW7A 1YXCA 3SUTA 4PFHA 5E93A 3CZLA 3DG6A 1ZP3A 2GVGA 3GVVA 1GVYA 4HTBA 3JZUA 3B06A 3MHUA 3CGTA 2JF6A 5LXXA 2ZZ7A 4UTUA 1DQWA 3T8QA 3CS2A 2XYLA 4HA0A 2H90A 5A2CA 2RAGA 1JF5A 3KP0A 3LM3A 1CYGA 4IH3A 4QGCA 1V4YA 2PTDA 1NP0A 3K13A 2QMKA 1HUVA 1OCBA 3KBSA 1EDGA 3LENA 4XISA 1KBJA 4GYJA 2G41A 4WCJA 3JU2A 3UT0A 3UR2A 1R3WA 4RKAA 3H7RA 1BRLB 1V0LA 4KW2A 4EXBA 1LG2A 2ZXQA 3WBAA 3ZS4A 3GSMA 3TZNA 3OHMB 2VX6A 1F05A 1TG7A 5JVLA 1VEPA 5M3WA 4X2PA 3GDKA 3C61A 3ARQA 3C0QA 4HNUA 5CC3A 3I7SA 3LYEA 3DFSA 2X1TA 3G2GA 4D9PA 2PDMA 5CC7A 2QPUA 2WKLA 5I06A 7XIMA 1GNXA 2AKMA 3L4XA 1CXHA 3ZSSA 2VI0A 3WLSA 3NVTA 1E1EA 3LM7A 4WSKA 1NOFA 3OB8A 4MDPA 4QCFA 2YA1A 3WNNA 2D2GA 4HU0A 2X0HA 1XLJA 1Q6RA 1UQZA 2D22A 2PU0A 1VRDA 4B3LA 2CIPA 2VGGA 5D30A 3S5NA 4HOXA 2PTWA 3H2FA 1E43A 4G1NA 2QCHA 2RJHA 5E5CA 3S0CA 3KXQA 2ZUUA 3W2JA 4YTUA 2PAJA 4LC8A 2NWRA 1A5NC 1G4PA 4QDWA 4PRTA 1F4HA 1XUZA 1JFHA 3W53A 1CEOA 1E5NA 1IWAA 4GNVA 1VFTA 1DJHA 1OY0A 4F0KA 3TYBA 3A5VA 3QPYA 3W1UA 4MTVA 1TPDA 2VT0A 1B3VA 1IEIA 3MUCA 2PDHA 4PGLA 4OGZA 4W85A 2Z1VA 1LQAA 2OWXA 1XRVA 5JUVA 3LZ5A 3VABA 2XFWA 3QV9A 4JD4A 3GM8A 2DT0A 1U22A 1VIZA 3VIKA 3AMCA 5A69A 3MZNA 2GOKA 3UU0A 5HK4A 5FSEC 1X1ZA 2WQPA 3VTRA 4CUCA 1V0MA 2TSYA 4XKYB 4HD5A 2I5GA 1IZCA 3P5YA 4L4LA 3EX3A 1ZJAA 3AIWA 1JNEA 1XGEA 3G77A 1OQFA 2IPJA 1UBPC 2DU2A 3GXNA 4GH1A 4H2CA 3T4WA 4GZIA 1CWYA 3GC5A 4POCA 2FQIA 1SQ7A 4S3AA 5AHEA 4HU4A 3B0XA 3STFA 4I5UA 2WLYA 1IIHA 2IKIA 4TR9A 3PPGA 3DERA 2XFYA 4IZGA 3UA4A 1U33A 4M80A 4DJDC 2D3LA 1GG1A 3NQ6A 3ITLA 1X97A 5DBUA 7CGTA 4DJED 2D2OA 3L4VA 3S4TA 4UTWC 1UWAA 2P88A 1JYXA 3M6YA 3SCUA 3W6MA 3NYDA 4FOJA 1W8GA 2YL5A 4JIQA 3GNXA 1H63A 4UQBA 3VOIA 2UY2A 3ZO9A 3QJAA 4FNRA 3S2MA 1SSGA 4GI4A 3TTEA 3KLKA 1E4MM 2OYKA 2G3NA 4XZIA 3IGXA 8RUCA 2Q02A 3MTWA 1DORA 4HSOA 3AS0A 4FNUA 5BXRA 1OX4A 1NVMA 2DVUA 2WNQA 1PIIA 4L64A 4N6FA 4CQ9A 5JH2A 4Q7BA 1LG1A 1JXJA 3BAXA 4NUWA 4M7SA 4I9JA 4DUOA 3W7GA 4BCEA 1DQUA 1PTAA 4Q4KA 3LNPA 1F8MA 2ON3A 3N3MA 3WQWA 1S2UA 3AMKA 4JFTA 3MT1A 1SFSA 2PWVA 5BRBA 3NQ7A 2V6AA 1ODUA 1WBHA 3MI6A 4UR8A 1EX5A 4W5ZA 4P61A 4D8ZA 2Z26A 1O5KA 3PWAA 4HHHA 4ZB0A 1IQ8A 3NSMA 2CESA 2PWGA 4FMVA 1QT1A 3N2OA 4D6JA 2PDBA 4EX4A 1F6PA 3L5MA 2QUUA 1H3GA 2OR2A 4O16A 1R3TA 2TAAA 2VZTA 4X2RA 4AVNA 4F9JA 1KW1A 4O1EA 5KITA 4KRZA 4JTFA 4GKLA 3O3RA 3UY8A 3Q94A 3I6EA 1VBRA 4F0SA 3C6CA 1BWKA 3HB9A 3OQ8A 4N4PA 4LBUA 1EYEA 1R85A 3UYIA 5JBEA 1BWVA 1OADA 2OFJA 4GABA 2QDHA 1UP0A 2Z1BA 2BGSA 1X6LA 3WLKX 3DYPA 4NY2A 3WDRA 4ONVA 4KERA 3H26A 1OSEA 3AZSA 1FP9A 3CUFA 1KFBA 1RLCL 3N15A 1MMFA 2QCMA 3WMBA 1OD8A 5A2AA 1EJRC 5HANA 3UWEA 5AN7A 3RLHA 2PWEA 3FX4A 3GKFA 1NH6A 4BF7A 4E8DA 2CLPA 1N55A 3WF2A 4U10A 2QLYA 1LOSA 3D3FA 3FKKA 3GLCA 5DN1A 2DFAA 3PR2A 2PTYA 1XH0A 3F4DA 2VOMA 4J35A 1QPQA 4WOZA 1IXPA 3GR8A 2WHJA 3QEZA 3MANA 4YTQA 1R8LA 4QXIA 1TV4A 3ARRA 4XKMA 2PDLA 3UZYA 2OWCA 3Q67A 1I75A 2JE8A 3Q45A 2Z27A 4PEEA 4IMEA 3S9IA 2AL2B 3O6AA 3BAKA 3TJXA 3RIKA 1BRLA 2GGEA 2INZA 3GDRA 5AYIA 4AIEA 2ZX9A 2A2IA 1MXGA 4NZ3A 1E6RA 3VCRA 4I9TA 3LMYA 1YPFA 1H7WA 4GHRA 2I14A 8A3HA 5LNWA 3VKAA 3FXYA 5REQB 1WCGA 4PFMA 2QS8A 1QNOA 1TJ2A 2Z4GA 2CLLA 1PV8A 3G0XA 4BI6A 1BXNA 1OC5A 1HKIA 2V30A 3D47A 4Z42C 2BMBA 4GWEA 3C0SA 4Q8QA 2C0HA 1MEIA 4ZBCA 2HDJA 3TJLA 1CTNA 3T44A 4CQDA 3TMQA 1C93A 3S2LA 5GJPA 1YTKA 3GTHA 1IIGA 4E4UA 4EPBC 3RU6A 5IFPA 1X6UA 3HPFA 4IX0A 3W7OA 4XUGA 3UW6A 3W1LA 3IRSA 4UZSA 1TVNA 3LCFA 3A22A 2DVTA 4PR4A 3N11A 1T96A 3VIMA 1UG6A 3USBA 4U31A 1O7AA 2O0TA 1NELA 1A80A 2I56A 3LQGA 4RZ6A 3AI0A 1ICPA 1O5XA 1NWTA 4D8LA 3PK7A 1C3FA 5C0QA 3GNDA 4N7QA 2YJQA 5A6KA 5EY5A 4XAZA 3W7KA 1TZZA 1FWFC 5GPRA 3WJSA 2B81A 4BQ5A 4DX3A 2ATMA 4B90A 2VX5A 3QFWA 3TOPA 4UTLA 4MZYA 5A8NA 1AJZA 4RW3A 3WNOA 4RLIA 2JQXA 3OZPA 2R1PA 4LAKA 1RK6A 1XBYA 1U1HA 4JTGA 2BZNA 3VM7A 1ML1A 3CPGA 1JZ6A 4WUIA 3UWWA 1AW5A 2HEJA 3VNZA 1IR1A 4XBJA 4Z17A 4JYFA 2BY0A 1LOLA 1R7AA 1HGWA 1WQ5A 3PM6A 2UY3A 3DHPA 2WPBA 1MO0A 3P0WA 3AHZA 1XP3A 2AMGA 2HNEA 3OHIA 4KCTA 3KOFA 1NFGA 3BXWA 3A47A 5T26A 1EOMA 1PTDA 3VOFA 5TAOA 2E6AA 1TO3A 5DFAA 3L66A 3TJ4A 1CI1A 2E5DA 1Q4WA 3SM0A 3R1ZA 3BOFA 2NW0A 2EO7A 1EUNA 4QLLA 2KX9A 3FA4A 3HBLA 4YU1A 4J3VA 3GNNA 2J78A 3SIZA 1FH9A 3W73A 1GCYA 2O56A 4A3QA 1H60A 2XTKA 3DFOA 3HGJA 3PZTA 1K3UA 2Y8KA 4LU0A 2XIQA 3TR9A 2VQTA 3BG9A 1TV2A 4J2PA 3E38A 4UOJA 4FAMA 4PMZA 1YLVA 3RN6A 1P0BA 2RGLA 5CLWA 3LHTA 1FXPA 2G96A 3DYOA 3M5ZA 4DWSB 1WKFA 3IVSA 2B4GA 3VGFA 2P8CA 3I4EA 4L4OA 4XIAA 5I7GA 5L9FA 1H1YA 3E12A 2AL1A 4Q33A 4HHPA 1CXEA 2PCEA 1XLMA 2X05A 4MKSA 3P2VA 3WLLA 4DF1A 1OK6A 4HPJA 5H6HA 2E28A 2X0SA 4DN1A 4MZ8A 1Q8AA 2XZ9A 4LANA 5HDRA 4CQBA 1E55A 2DORA 5EPDA 3MO7A 3E6EA 1ONRA 3CL6A 4F3HA 1G94A 4PTWA 3ZFHA 4PL1A 3ATZA 2W3ZA 1PEZA 3QRHA 3UG4A 4UOZA 1I9CB 4CD7A 1GUVA 3ZSTA 2XN0A 5CBJA 3MKVA 5D8WA 3MUY1 3PAOA 1E6XM 1PVNA 1QPNA 3DG7A 1OM0A 3DC8A 1SFTA 2DT1A 5MKGA 4YVVA 4ERIA 5K2ZA 1W0MA 3Q37A 1K03A 3BLOA 3ITGA 1FCQA 1Q7QA 3W3OA 3SDOA 1E9LA 1R2RA 3GNPA 1RPXA 4AXKA 4JTRA 3N4FA 3VX0A 4KWSA 5IHSA 3PBMA 4WR3A 4PRRA 3M6DA 4PN2A 3STEA 1TQXA 3TWAA 3M7SA 2A3BA 4RW5A 3M0JA 1WUEA 4PC8A 9CGTA 1R2SA 3KS6A 3APGA 2VCBA 3G3MA 1CECA 4R9OA 5AHNA 2QAPA 4Y9OA 3GDBA 2WCAA 4US6A 3NA8A 4L9XA 2WCSA 1I45A 2IMRA 1KGWA 3LPGA 4LCSA 4U5KA 1EDTA 4ZO9A 3RM4A 4Z0SA 1A0EA 4GO9A 4MY1A 1UP2A 4L56A 4IL0A 1WXYA 3DFNA 2QUNA 4HGXA 3DEQA 2AAMA 2QCDB 3RMJA 4W84A 2O7QA 4KESA 2I16A 2BFGA 3VDAA 4L9ZA 1EF3A 2AQVA 3TFXA 3H12A 4NKCA 1Q85A 4MWAB 5AC5A 3IK4A 4FLRA 2VWTA 4GUGA 1W3IA 1SR0A 1XGZA 1TE6A 2H8ZA 2AL2A 3S1WA 4N0RA 4HSHA 3WD0A 2V3GA 4GQBA 4ZQMA 5IDZA 5I77A 4C6KA 2LLEA 4KETA 3OBAA 1TB3A 4BI5A 1R2TA 1E0XA 5CPTA 2OLAA 4XB3A 1YPXA 3V35A 1VHNA 2J6VA 4JY8A 1DVJA 2WVTA 3TXZA 3ARXA 1ZBCA 5DCDA 5BYWA 3FKRA 1CCWB 4GUHA 2GGHA 3KFTA 2ZTKA 4K7YA 1OX6A 1WZMA 1UIOA 1ZU8A 1X39A 1EO7A 5REQA 7A3HA 3EA3A 4M8UA 4JXCA 4UQEA 4BZYA 3GXDA 3E2RA 3WNKA 2VP8A 2XU2A 3L0NA 1Q6DA 3HGSA 4K7VA 3LSCA 3S6TA 1LUCB 1YDNA 3QHNA 5CGQA 3OG3A 5IBXC 4ERGA 1JZ8A 5M03A 4AEFA 4FLOA 4DI9A 1YDYA 2JF7A 3VIIA 1L0PA 1B3WA 3UWYA 3LY0A 1IGWA 4W4QA 5HMSA 4HP5A 2X30A 4GZ7A 1S1RA 1GEQA 4IFKA 3CV2A 1UR0A 3TCSA 1DIEA 3LD5A 4DLFA 1CW2A 3TSDA 4H8VA 3E96A 3KCLA 4R7JA 1UA7A 2J25A 1XIMA 2CW6A 1VP5A 1GORA 4CNUA 3GKAA 4O8RA 3S47A 5JQ9A 3CH0A 4ZGYA 4W8LA 1ZAIA 4FR6A 3FDKA 5A8QA 1SFLA 3QM3A 2OYLA 5AZ1A 3R8GA 2PD9A 5HA7A 3ITXA 1JULA 1OFQA 3PBVA 3LSBA 4JKLA 4B2DA 4N2YA 1HL2A 4V2XA 1XQKA 1V5XA 3FW6A 4JTLA 4H04A 1V02A 4Q4RA 3U0HA 4LVDA 3WUBA 3P6LA 1Z44A 2PGRA 4AY7A 3S5YA 5FF4A 1XYAA 2QVHA 1B9BA 2A0NA 5CBIA 2C8NA 3AXXA 4J3ZA 3FGCB 4DO4A 3WH7A 3V75A 1N8FA 4JQ1A 3UXLA 4CVWA 4RX0A 1JPDX 1PIGA 3WLPA 3MI2A 2XG9A 4XWUA 2XH0A 2C6QA 3CBWA 3RJXA 1M01A 2A85A 3BTNA 2C14A 3ZWTA 4QJ1A 2XJ7A 3SECA 3SQSA 1ZY9A 2GJXB 3FEQA 3PZMA 3AU2A 4JNYA 2MUCA 3SFWA 1UP3A 4LAMA 3VXGA 5ECUA 3TYUA 2GGJA 4JOMA 4AEOA 5JBDA 1D8WA 2E6DA 4J5NA 3BAIA 2EHHA 3R7MA 3VNDA 2IKHA 1AK5A 2Z7KA 4GPNA 3H2MA 4QG6A 5CH9A 2CKRA 2J24A 3N14A 5ABHA 3LTSA 1NWUA 3SO7A 1F76A 3WSUA 3B04A 2R94A 4UFKA 3QR0A 4D1JA 3KL5A 4TTUA 2IQDA 4IG2A 1YE6A 4DWSA 3WH8A 3ZJ7A 2QR6A 1YKWA 3CZKA 1TCMA 3EKZA 4O1FA 1E51A 3LX9A 3ABOA 4QITA 1JCXA 4ZO8A 2FTYA 2J8TA 1HP4A 2RDUA 1PZ3A 1PKLA 3ZT7A 1KR0A 4H7VA 2PEVA 2NSXA 5CPLA 3PANA 3BMVA 5LIKX 1RP9A 4HCLA 4JAWA 4PSPA 4TOQA 7TIMA 3FSUA 4ZQNA 5D02A 3LB0A 5AYBA 4GYPA 1WDQA 3NNTA 4O53A 2PLCA 3UEQA 3ZLHA 2ZE0A 3C0LA 3A64A 3UETA 2DSKA 3OVQA 3G1DA 4QROA 5DRCA 5I78A 2RDWA 4ZMGA 4H1ZA 3S5ZA 3JVAA 1WKYA 1GYLA 1JVNA 3NO1A 5KTLA 2VURA 1TIMA 2NWSA 3MMDA 4ZE5A 1WPCA 1V3IA 1SZEA 4IPJA 3FSTA 2PP1A 5I3HA 4CN1A 5C9ZA 4CEXC 2ZZ1A 4XZLX 2D24A 1QDSA 2XH4A 4GG9A 2ACRA 1CLVA 2YBUA 2WWDA 4LUJA 2J79A 4M7TA 5DMMA 4PBGA 3LBMA 3M0IA 3MVTA 1VJZA 3CHCA 1GOKA 3IJ8A 5IM51 4AIOA 2F7FA 4WLCA 3DGBA 3BV4A 1QVBA 3EDDA 4L6OA 3RPMA 3ZLFA 1OHLA 3GUWA 2D2JA 2X1UA 3LCGA 3OZYA 4IJCA 4R34A 3HTWA 5T91A 4Q8UA 4AHPA 3CJPA 3EX6A 2HBXA 2OGJA 3HFYA 4A05A 5B80A 4B9ZA 1OIFA 2W62A 1M3UA 3PZ9A 4Z1DA 1XV8A 3WEZA 5CG0A 2QT3A 1LQ2A 3EDJA 2QCDA 3STPA 3T2QA 1UR9A 1SZRA 1R3SA 5AECA 1VC4A 3AHVA 1EX1A 4UBPC 3GDLA 1JR1A 1SO4A 1XC6A 2E3ZA 1L2QA 1FWBC 2PBOA 4RZ4A 3KRZA 1B3OA 1GG0A 2YBTA 2R1LA 4HNLA 1R3YA 2VDGA 1O60A 3WQ5A 1Y7VA 3HPXA 3NL6A 3I3BA 4ROQA 1KB3A 1HFBA 1HKMA 2BBFA 5U4NA 1HIZA 4H9VA 3MP5A 2FJUB 5FJUA 5F4WA 4WRHA 5IHRA 3S5SA 1VZWA 3DZ1A 1W56A 2IQ0A 5A8GA 3TYZA 3WKZA 5E9XA 2J8GA 1TTIA 3C3UA 2TMDA 2GQAA 4O17A 1GKRA 3QY8A 5HMDA 4MZ1A 3WNPA 3FN9A 3ECQA 4YLWA 2JKEA 4PBEA 4JX5A 2ZZ5A 1O5QA 5GNXA 3UPWA 1RY0A 1ZUAX 4F9DA 4NIRA 5J5RA 3WNLA 4EXQA 2DP3A 4C7FA 1L6YA 4RNIA 2ZXBA 1JI1A 2A3CA 4JYEA 3ZXWA 3M0XA 4GCAA 4E3VA 1KCKA 1CX9A 3NZPA 3CWNA 3OGSA 1SO5A 2E9LA 4X60A 2F61A 3AXHA 4M56A 4V33A 1H50A 4MOZA 3UWQA 2PF0A 5LIXX 3W86A 1JCYA 4HT3A 4I7UA 4A2RA 4PYSA 1OCJA 1RCXB 4BY3A 3TE9A 1XLLA 3O6YX 4QE5A 1I1XA 2NQZA 2E6FA 3BAJA 4FOUA 1MSSA 2GLKA 4OT7A 2DGAA 3TMLA 4ZE4A 3PVFA 1WDWA 2E1WA 2C79A 3PBWA 3LRMA 1VR6A 1ITQA 1OG0A 1UWTA 5D2TA 4C7DA 3TXVA 5DANA 4UNIA 1VPXA 4C6CA 3KRSA 5AC4A 4UFIA 3GO2A 3G1YA 3TTQA 5A6BD 5FEPA 4XSMA 2Z6IA 4JIIX 2XVKA 5DQPA 3PPFA 1W1ZA 3QC0A 3PS7A 3HIJA 3EX1A 3L4ZA 4Z1CA 5E09A 3S1VA 5CAHA 5IDIA 4KIRA 3DBPA 2WXDM 2YOCA 3FGCA 4LCQA 3AXKA 4IP7A 4C1NB 5DBTA 3LHYA 4Y9NA 2A21A 4GXPA 2V5JA 1VLWA 2YB4A 3SFKA 3WF3A 1KM3A 4GK8A 1B4EA 3GVQA 3CV1A 3WJZA 3IAPA 3T1GA 2BOGX 4RNHA 3U2EA 4B5XA 4MADA 3LV6A 5CGTA 4PCSA 4E5TA 1FWAC 2DIEA 3GFXA 5D03A 4HPNA 5M5DA 5BZAA 4K39A 1SUXA 5I03A 3RCNA 2CITA 3P80A 1RV8A 4YCPA 2NV1A 3W70A 2DQWA 1XCFA 4CN6A 3SAZA 3R5EA 2E09A 2WHKA 1L6FA 3B0VC 3O63A 3BV7A 4WY0A 4PB4A 2XFFA 2EPNA 4X63A 3AXMA 4Z1AA 3WL1A 3SW6A 3HJEA 2GVYA 2ZZ3A 2Y8UA 3CNYA 1YBQB 3T81A 3CAQA 3H55A 4LBRA 2VDIA 2Y61A 5FI8A 4KFPA 5HJLA 2A79A 4IIFA 2BY3A 3VNYA 4HN4A 4UZUA 4DJEA 1QK0A 3V1HA 4RE0A 1XPYA 3N34A 1L8NA 4QE1A 5B7ZA 1J10A 1S5MA 4ATLA 4CVUA 3FXGA 4NJKA 4F0HA 1QHOA 1DV7A 4HIBA 3FOKA 3EPNA 1MEWA 3EPOA 1TJRA 2VFGA 2VELA 1M1BA 3U57A 3WLOA 1D9EA 4REQA 1OINA 3P5ZA 3P84A 3EOSA 3V5FA 4FNSA 1PCKA 4MFDA 4FSAA 4PTDA 4AD3A 4NX0A 2E8YA 4D72A 1BHGA 1PS9A 1GONA 1LWJA 1YXDA 1HTIA 4JHZA 2PGWA 5CPOA 1RCQA 3N9SA 3GTIA 3UF9A 3EX2A 3AO0A 3CAKA 4OJYA 5JBFA 1D3GA 3F4VA 1WP6A 3CUGA 3GG0A 1JQXA 3GWQA 3BMWA 4O13A 5HATA