3M7WA

Crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m7wA00
3LTPA 1Q6LA 2WQPA 3G1DA 1J2WA 1TV5A 3BO9A 4UTJA 3QJAA 2QDGA 2Z1BA 2ZA1A 3TQVA 3L68A 4IUOA 1XDLA 4HNVA 1VC4A 4PTNA 3N9SA 2C0AA 4RK8A 3W87A 2ZZ5A 4OV9A 3LB0A 2CLHA 3QYQA 5LNVA 2QJGA 1UB3A 1KFKA 1NVMA 5AHMA 3NPUA 6ALDA 1K02A 3CIXA 3UWWA 1H7WA 4A3UA 1OYAA 1WXJA 3PB0A 3LHTA 4O19A 2CLKA 4OHQA 3NPXA 4MJMA 3IGXA 4FX6M 4NQ1A 1J4EA 2Y62A 1R47A 2VFEA 3BARA 1LOSA 4GXMA 3DKJA 4NUWA 2B7PA 3M5ZA 5D03A 4FO4A 4AVFA 3QW4B 5KMYA 3UPBA 1U5JA 2YCEA 3TA6A 1WYIA 4POCA 3A9IA 4LOCA 1L2UA 4O15A 1S5WA 1WX0A 3T44A 4K7VA 2QCHA 4O1DA 1P0NA 3E02A 3PB2A 1KFJA 3Q37A 4I9AA 3TROA 3W7NA 1M7OA 1JRBA 1F2JA 5C54A 4XQ6A 3CTLA 1CI1A 4Z1CA 3TAKA 3W7LA 5H2ZA 1FWWA 3HG2A 3LV5A 1DORA 1I2PA 5AYZA 1NAL1 1LORA 4JS3A 4CNNA 2Y61A 2Q3RA 3P74A 3BGGA 4Z0SA 2FPTA 1XBXA 4RLIA 1NFBA 1VPXA 4LVGA 4EF8A 4LVAA 3CHVA 4XBSA 2I14A 4RCXA 3KHJA 4ZMGA 1FX6A 5K9DA 2B0MA 4D2JA 4IPJA 4R34A 4X22A 4GUHA 2GJLA 4GUFA 3PG9A 1H7PA 2ALDA 2NXGA 1XBVA 1J5TA 2A85A 1B3OA 3M6YA 5AN7A 3STFA 1W54A 3M5YA 3TUUA 3TKFA 4N4QA 2E09A 4UFMA 3G8EA 2GUUA 3W1UA 3E9AA 4MLJA 5LHFA 2XN1A 3L67A 3B4UA 3MW7A 3VE9A 3LCHA 3PVFA 5BMWA 3JR2A 4Z08A 2QCEA 3W7DA 2P10A 3OVRA 1KFLA 2VKZG 3SR7A 1ZALA 3G1SA 4M6VA 3TIMA 1ZCOA 5FF0A 1P5BA 4WX2A 1DV7A 3NL3A 2KZHA 4YCPA 1KM2A 4N6FA 4DO6A 2GQ9A 4XKYB 1JCLA 1PE1A 4ICNA 2E6YA 2ABAA 5CZTA 2Y88A 4ADTA 5KITA 1WA3A 2ZYFA 5GVJA 3WJSA 5FF3A 3QMSA 5IBXC 4HNUA 1KM0A 4UFKA 1OK4A 3DU0A 3NQCA 2ZRZA 3K30A 1WV2A 4AF0A 1W3TA 4O11A 5HWMA 1LCOA 3ABQA 2Y7FA 1EPXA 2YYUA 5K7JA 1VH7A 3KVKA 3W2UA 3PWAA 3CEPA 1DVJA 1O60A 3DFTA 2E6AA 2GOUA 1XXXA 2J88A 4KFOA 5C5YA 1TPUA 1L6YA 1A5BA 1TTPA 1LBMA 4ZQNA 3W75A 3P84A 2NX1A 4HSOA 1JQXA 1SU5A 3USBA 3SIZA 1A53A 3C2VA 4BI7A 4RKAA 2EHHA 2QCDA 1AL7A 1W5NA 5DN1A 3P5YA 2D73A 4LW7A 5FEPA 5HQEA 2EF9A 5LHEA 1ICQA 2CLEA 2NZLA 3RMJA 1TSIA 3DZ1A 2B7NA 1ZAJA 3BV4A 5LNUA 5AYXA 1IGSA 1FQ0A 4I7VA 1XI3A 5DY2A 4DF2A 1MSSA 2RHGA 1YXYA 4DEFA 3STEA 4QSHA 3BPWA 1ICPA 1GG1A 2OX1A 2ZFAA 1SUXA 4UTUA 1W5OA 3G8RA 5CG7A 3EWYA 1G4EA 4GUJA 4QIUA 2V2DA 5KTLA 4IXXA 5CPMA 2NX9A 3LHUA 4NJJA 1KV8A 2W79A 4BWLA 1H5YA 3EWWA 3MP5A 3SSJA 5KSWA 4N02A 3VFLA 4O14A 3T4CA 1WAUA 1FCVA 3M41A 4U4MA 1N55A 1OJXA 1GOXA 2VEIA 1EWEA 4WD0A 3TJLA 1D9EA 2GQAA 5D32A 5FF2A 1IXOA 1VRDA 2P0OA 5DCEA 1JULA 4B5NA 2ZTJA 5I3FA 1SO5A 1OYBA 3BW3A 2JBMA 4LV9A 4FXSA 1IF2A 1W56A 1EA0A 1H1ZA 1OFPA 3SGZA 4YCOA 1IXQA 4Z1DA 3LLDA 5FEXA 4QNEA 3LCLA 3W7GA 2QCNA 2WNZA 3CEUA 2CZDA 1FDYA 4UR8A 2X16A 1PHWA 5J5RA 1TPC1 4ML9A 3GNNA 1GVFA 4PCFA 4Y90A 1TPWA 3L9CA 5AFDA 3LCWA 3TAOA 1H51A 3LHZA 4ZQRA 1B9BA 3EXRA 4O18A 2J27A 3N19B 2QCCA 5DCBA 1VQTA 4EF9A 1SFLA 2BWGA 3MHFA 5KINA 3M0ZA 3LCXA 1SW3A 4K6AA 3HPXA 3G3MA 3GK0A 3OEXA 1UCWA 2V30A 1MEIA 2QCLA 1IXPA 1KBJA 2HS8A 3I68A 1QO2A 2QEZA 3V1PA 1YXDA 4PA8A 3WK0A 2C13A 2YYTA 3NPVA 5KZDA 1X8FA 4DF0A 4Q4KA 1W0MA 1KM1A 3NXFA 2C1HA 3L5MA 4EOUA 3KRSA 4TMCA 3PC0A 1AW2A 3ANYA 2BLEA 4JTHA 4MY8A 3W86A 1IIHA 1GJPA 3G0UA 2Z2UA 1BTMA 2VFFA 4JYFA 3NG3A 3IIXA 3C52A 3LI1A 2ZRXA 5DELA 4N9EA 4ZQMA 1I2RA 5E1QA 1V5XA 3QW3A 1K8ZA 4JD4A 1GVSA 1TQJA 2YXGA 4YLWA 1HL2A 5HMSA 1VHNA 4J9JA 4K37A 2X30A 1V7YA 4Q32A 1SZNA 4M7TA 1GVOA 3LCIA 4CCEA 3A21A 3G1VA 1LROA 1UJPA 1Q6RA 1SZEA 1SZGA 4QQ3A 1S5TA 5LGXA 3BG5A 5D02A 4O53A 3E96A 4K38A 4AWTA 3SZ8A 3W7EA 3GYEA 1GYLA 4AF0B 4DO5A 3H54A 4JXCA 4MKNA 2BX7A 2ZZ2A 3E12A 3W7CA 4MFEA 3VKJA 2A4AA 1OHLA 3GDLA 3NZ1A 2FB2A 3FEMA 3VNDA 1PCKA 3IIOA 1L6SA 3T78A 3Q2DA 5HUOA 1YDOA 1TTQA 5KZEA 2NUXA 3ZWTA 3NM3A 3ABOA 1FWSA 1AW5A 2CZFA 5AHIA 1MZHA 1JQVA 3HG4A 3FJLA 2NUYA 5FEWA 1KTCA 3STCA 4LY8A 2J9XA 1XUUA 5DBTA 3DFSA 3B0PA 5D38A 4DO4A 5LZLA 1RR2A 2PRMA 1YPIA 3G1FA 4P2VA 1W3NA 1LTDA 5DXXA 2QCDB 4LC8A 4GUIA 5HNRA 4CLMA 4FB7A 1LM1A 4ZQPA 2EKCA 3L65A 3HJZA 3EX2A 4RXFA 5D30A 5BMXA 4ZQCA 1XDMA 3NDOA 3FIGA 1W5PA 3ATYA 3M43A 4BWLC 5CPLA 4R33A 2QUUA 3SGUA 3DI0A 5F1UA 1XFBA 1SO3A 3PULA 1TPDA 5G1TA 2Q3OA 3OG3A 1H50A 1BWLA 4O12A 4WJEA 3BW2A 1DJNA 4HT3A 1JVNA 3HOJA 3LLFA 2FTPA 3QQ0A 1KLZA 3S1UA 3NQVA 1CX9A 1JR1A 3WJYA 1ZAHA 5CPNA 3W71A 1W5MA 4LT9A 1VCGA 4CNPA 4N9DA 2ZA2A 2VEPA 1QPOA 4NZJA 1SW7A 2CLOA 1K8XA 1ICSA 1NSJA 1S3HA 2A7PA 3NQAA 3QM3A 3OA3A 1TQXA 2QR6A 1FY6A 3GR8A 1VS1A 3LV6A 1ML1A 3LXBA 2Y7EA 2V5BA 2Y63A 3BW4A 3LBMA 4MYXA 4FF7A 3W07A 1SO4A 5AOUA 2FQIA 1GEQA 1OYCA 1TJRA 3R2GA 3GDTA 4JTUA 4YXGA 3IVUA 2TSYA 4LS0A 3M7WA 2J9YA 4NU7A 5F1VA 4C1LA 4CQ8A 1F7BA 1QAPA 2FIQA 2X2GA 2YZRA 3PBYA 2W6RA 1Q6QA 3QF0A 1YDVA 4DXVA 4BK9A 3RNDA 2ZRYA 3D0CA 4UTHA 1QWGA 3P60A 4GUGA 3W7RA 1O5KA 3LX9A 3DFPA 5I3GA 4RX0A 1H60A 2CFFA 1X7FA 1WOBA 1RVGA 3WJXA 3PY2A 1YTKA 2RDWA 3HGSA 3RK8A 4IJBA 2GJNA 3CIWA 3T55A 2A6LA 1RD5A 4H3DA 3LHWA 1EEPA 1QOPA 2JKEA 4BI5A 8TIMA 1YPFA 3NL2A 4TX9A 3S42A 5IM51 3F03K 5G2HA 1TPEA 3C2RA 3TH6A 5TQLA 3MBFA 3O06A 3PBUA 1HO4A 3MYOA 3N3MA 2WPBA 1CW2A 1I2OA 4Q33A 1XBYA 1K03A 4AH7A 4MVAA 2OJPA 2ISSA 1GQNA 1TTJA 2PURA 2W0UA 2X1RA 3NL5A 4NX0A 3EX1A 3Q94A 3KAOA 4O13A 2E5BA 4OV4A 1HO1A 1OFOA 4JICA 4OQVA 5HULA 1TO3A 2QF7A 4O4VA 2DZWA 4JTIA 4UTIA 3LBCA 4UTTA 4FIQA 2WOQA 3QPYA 3G22A 1TREA 2VFIA 1AG1O 3CPRA 4ADUA 1R2TA 1E51A 1OFRA 5I3HA 3TQ0A 1BKSA 3MUXA 4RZ5A 1IXNA 3TFXA 4OBTA 4HPXA 4JGDA 4OT7A 2YFOA 3GDKA 3KVLA 4CCDA 1T8XA 5EL1A 4LVFA 2NLIA 2OT0A 3I7RA 3ZFHA 2ZCGA 3UXDA 1WOAA 2Y89A 3W7MA 4LNYA 2FDSA 1S5VA 3WJZA 3R12A 5D05A 3A5VA 1SQ7A 5EA9A 4FX8A 3YPIA 1L9WA 1YDNA 2CLFA 3THQA 3BLIA 3I65A 2TPSA 3FS2A 1K7EA 3W84A 2DJLA 2P1FA 2ZRWA 2YX0A 2YW4A 2H6RA 4MOZA 4K36A 5KZMA 5FF7A 2V2HA 3NQFA 1WDWA 3P8IA 2C14A 1FWNA 2ZZ6A 3IIPA 4O10A 2YW3A 1MEWA 3TMQA 4O57A 3C2OA 3UY8A 2Y70A 5D2XA 4RV8A 4LTSA 1QOQA 5F2LA 4A2SA 3W22A 1QCWA 1R30A 4QAIA 1GVQA 1RZMA 1TPFA 5DCDA 3EWUA 3UZJA 4K39A 1OVDA 3W74A 3DHDA 4PODA 2DZUA 3UYCA 3I6RA 1Z41A 1ZY9A 4UCGA 3I7QA 3L0KA 1KM6A 2V8ZA 3S6DA 2H3DA 4AMAA 3NGJA 2FPVA 2B7QA 2C3ZA 1KTNA 5F2GA 4DQWA 4JTFA 1JCNA 1FDZA 5CZ0A 1EIXA 3UD6A 2JGYA 5ABTA 1K7FA 4WXZA 3U6WA 3MHUA 3LRLA 3F4NA 4FNSA 3TR2A 4BI6A 5HINA 3NVTA 2B7OA 3WJWA 4PEKA 3AJXA 1G6CA 4LUJA 4O1AA 4O17A 4AHQA 1W3IA 4NX5A 4Z0JA 3TCEA 3ZWSA 2RDTA 3LHVA 4UMBA 4AB4A 1G4PA 3G1AA 3QSRA 4JTTA 5K4XA 3MI6A 3GAYA 4UFLA 2XFWA 3PR2A 3NQ7A 1ZAIA 2TMDA 1H61A 3LTYA 1FUYA 5CSSA 2AQWA 4FX7A 3KVMA 3G0SA 3N2XA 4PL1A 3SW6A 3W7IA 3BGJA 4ALDA 4LRTA 1OF6A 5EYWA 2V0TA 4MZ1A 4UNKA 3FJ6A 2NXHA 3HF3A 3G0XA 2E1DA 3DENA 4R7JA 3GAKA 1RV8A 1ME8A 1PIIA 3TFCA 3MP4A 2VFDA 2OT1A 3NOEA 1ZJIA 1VCVA 3ZR4A 2Y7DA 3LTSA 1L6WA 4UTTC 4M19A 2C15A 4JN6A 4A29A 3SY5A 2PRHA 3B8DA 3NQDA 3O16A 4JTJA 3DH7A 1Z42A 3L0NA 1Z44A 1XBZA 1YLVA 4PL2A 3C0JA 3HG5A 4KKXA 3P61A 1A50A 3W23A 4EWND 4YMZA 3O63A 2R94A 1XL9A 4LV4A 2G97A 4LVDA 4K8EA 3R13A 4O1CA 1MXSA 3TNOA 3L5LA 4GWEA 5K9CA 3MI3A 5HJLA 1G7VA 1QPNA 2ZQ0A 3GXNA 1NF0A 3GXTA 3UZ5A 3DFNA 4FNQA 3NPWA 2J6XA 3O6CA 1D3HA 5K3VA 5A5WA 5E93A 1Q6OA 3WFAA 1JUBA 3AO0A 2JKPA 3LCFA 3VI2A 1N8FA 1X6UA 1XM3A 4LS1A 1SSGA 1GPWA 1VGAA 1FXPA 1RQEA 3IGUA 1UASA 4UMCA 2XN0A 1PCWA 4K8HA 1TPB1 4KWWA 5DY3A 1SPQA 2WSQA 3W76A 4M6QA 3QRHA 4I7UA 3N14A 4Z1BA 1B57A 4UTMA 5G5IA 3L0GA 5AYYA 1P0KA 4YL2A 3TSDA 5EKYA 3M1ZA 2E6DA 2NWSA 3KXQA 3L5AA 1JRCA 4H6KA 3NQ2A 2X1SA 1BEUA 4N6EA 1H62A 2DZXA 1XCFA 5D09A 5LSMA 5EBUA 3G1YA 4IX0A 3TDFA 3LRKA 2WKJA 1THFD 3TSBA 1JUKA 3BG9A 4YWIA 1YTDA 4HKPA 5G4EA 2DU2A 4O28A 1NF7A 2O7SA 3P80A 3PBWA 2PC4A 3W72A 5F4XA 1LOQA 1DKWA 3EKLA 3S5NA 5CGQA 3TC7A 5AHFA 3G3DA 3FOKA 5AHEA 2CZ5A 2E68A 1VZWA 1QO5A 2WO5A 5C2XA 2A7RA 1YYAA 1TYGA 3JRKA 1ZHAA 2NV2A 2Y6ZA 2FFCA 3ATZA 4FIRA 2G96A 2QUVA 4CQ9A 4IMEA 2QCGA 4L4LA 2AGKA 2NX3A 4CNOA 4O8RA 4DPQA 2J9ZA 4S1FA 2VOMA 1U83A 1VJIA 3CT7A 3EEGA 1YXCA 3TSMA 2QCFA 3PBVA 4FNRA 4ZL1A 2B4GA 2HSAA 4LRSA 2VXNA 3W2JA 3W2LA 1OFEA 3W7HA 4O0KA 5D2WA 3CB8A 1KBIA 3MHGA 2ZZ7A 3HMJG 4QISA 1IIGA 3CLMA 3OIXA 1GT8A 3PF3A 3E0IA 2A7NA 2EPHA 4HIBA 3W85A 2PE4A 4UFJA 3DHFA 1VYSX 1R2RA 2DZPA 5EY5A 2LLEA 4O1BA 1H1YA 1F5ZA 1OFDA 3N34A 4ZZ9A 1DL3A 3IVTA 1W8SA 3TXVA 4O54A 3EWZA 5HR7A 3DGRA 3GX9A 3B0VC 1G4TA 1AW1A 3PSVA 1N7KA 1H7OA 3A23A 1DQWA 3DKLA 1TJPA 3TW6A 4LUIA 4AWSA 3O15A 3EX4A 5HWJA 4IMDA 4R53A 5LKYA 3N2MA 4NNCA 3RU6A 2QAPA 3IV3A 1QNVA 3UWUA 1AK5A 2Z6JA 3ELFA 3W3OA 3NQGA 3KRUA 5A8GA 3FKRA 1ADOA 3CQ0A 4UIOA 4UTWA 3W70A 2H8XA 3W1LA 3LI0A 5H91A 4JIQA 2Z6IA 1TV8A 1KM5A 4NJGA 2ATSA 4RJEA 1FCUA 3CWNA 3PUEA 1SSDA 5DXYA 1A5CA 1EP3A 4X3ZA 1Q3NA 2A1YA 3W1TA 2PRLA 4JTLA 4K7YA 4C1KA 3HGRA 4IPIA 1TMHA 5CZJA 5U7SA 4IQLA 3M5VA 3L66A 1B4EA 3C2FA 4MFDA 2YGYA 2Q8LA 4RXGA 3UWZA 4N4PA 3RF9A 4GFSA 1TCDA 2TYSA 4Y96A 2CU0A 3S1VA 1XC4A 2E77A 3NA8A 4NXSA 2E5DA 3HO8A 4TIMA 4LU0A 3C6CA 4PC8A 5I3KA 3HBLA 2F7FA 1OK6A 3PUDA 4AEOA 3LOTA 2WJZA 3TW7A 4XUGA 1PV8A 1JJKA 5F4SA 3QZEA 1W1ZA 4IOTA 3RFAA 1JCYA 4Z1AA 4JDBA 3G24A 2QJHA 2H8ZA 1SFJA 1QDSA 2V82A 3THAA 1QR7A 3EXSA 3P8JA 3RLVA 5LGZA 3C56A 4XBKA 3HGJA 1KTBA 4ZVJA 2ZDRA 4IMGA 1Y0EA 3TXZA 4M6PA 1OABA 5T26A 4ONVA 5LNSA 2ZZ4A 2AAMA 3GNDA 1WQ5A 4FEZA 5G4WA 5HWNA 1SO6A 3HQ1A 5CPOA 3LGEA 3TE9A 1T96A 2C19A 4NXKA 4QNWA 4G1KA 4OGZA 3M5XA 3SJ3A 3W7PA 5IBXA 4IX2A 5F2MA 2FLIA 3O6DA 3WK3A 2C16A 2ZBTA 3M47A 4GE8A 4CCCA 1QFEA 1KFEA 5FEZA 1PVNA 2GVLA 2H3BA 3KOFA 3BLEA 4UFIA 4JYDA 4QM1A 3CC1A 1NEYA 1TTIA 4HNTA 4NVTA 4HHPA 5AHLA 1VHCA 1LLWA 4NT0A 4NNBA 5HUPA 5EPDA 3A24A 1GYNA 3NL6A 3G1XA 4A2RA 1LLZA 5BOOA 1JUEA 1TRIA 5E0KA 1TIMA 1XUZA 3Q58A 4DPPA 1DOSA 1H7NA 1PHQA 3T7VA 1KW1A 2F84A 4FHAA 4I7WA 4OE7A 3SFKA 4ZQOA 2A21A 2QJIA 4FNPA 5AHNA 4P61A 3DFOA 3GDRA 2H90A 4GRSA 4CQAA 3PSWA 4N9CA 2X1TA 2DORA 1A5SA 1M5WA 3ABSA 1KV5A 3B0UX 2O7QA 3NAVA 3GLCA 5BRBA 3NQMA 3N73A 4W9TA 1B4KA 5BNKA 1W37A 4NJKA 4MY1A 2ZRUA 3MJYA 2X1UA 3GIYA 3TJXA 3V75A 1LDCA 3HG3A 1LYXA 2G5WA 4H4IA 3FLUA 3IVSA 2ZZ1A 1ZFJA 1MO0A 3P5ZA 4X2RA 3W9ZA 2JKAA 4BFAA 1QPQA 5F2IA 1LOLA 4UTWC 3HB9A 4JEQA 1A5AA 1BWKA 4TMBA 4MPQA 1M7PA 2ZTKA 1LZOA 4Y8FA 5D2VA 4M5PA 5AC6A 2C6QA 2JK2A 3W73A 4GNJA 4DF1A 4XTDA 3GDMA 3INPA 2CLMA 1O94A 3SECA 1HG3A 2A0NA 2VELA 4MZ8A 4O0ZA 5TIMA 3EX3A 4JTKA 1XKYA 1K8YA 1MEHA 3A5FA 1TRDA 4MJZA 3OBKA 4JYEA 3BG3A 4HPJA 3MMTA 1C29A 1ME7A 1EUNA 1ZENA 5K9XA 3S5OA 2CLLA 1G4SA 3LDVA 1TPH1 3TMLA 1UUOA 1OX4A 4LC6A 4WZHA 1VLWA 3QPZA 2NUWA 1HUVA 2CZEA 3W88A 3S5YA 2Z0IA 2J24A 4S2CA 4E0CA 3LXCA 5FI8A 5CSRA 4LVBA 3C61A 2E6FA 1R46A 2FB3A 3QEZA 3NO5A 4O16A 4EVZA 5K2ZA 4AWUA 4JTGA 4UR7A 2FPYA 5D37A 2VFHA 3VE7A 3P67A 3U2OA 1AMKA 1RQHA 3GKAA 2VENA 1EP1A 2QKFA 2VFGA 1Z48A 4WXYA 3NZRA 1LP6A 4UMAA 1KA9F 4JY8A 1KM3A 3O1NA 3BK0A 3NQ6A 5L6UA 3L21A 4E2DA 4RR4A 5DLCA 3OVQA 5F4WA 4DBDA 1LRNA 4KWVA 3M9YA 3LCGA 1KFCA 2ISVA 1GG0A 5L9FA 3OVPA 1SW0A 5TBOA 4JX6A 1LBFA 3W7OA 4KFPA 1QPRA 1OX5A 2GPTA 3GZ3A 2TRSA 1VCFA 2WSRA 3CU2A 1FDJA 1GZGA 5U4NA 3GXPA 4GJ1A 2R8WA 4JIPA 3SI9A 4OU1A 3UXAA 4O52A 1HFBA 5D04C 2JGQA 1FCBA 4TO8A 2OMAA 2ZRVA 1P4CA 1C9DA 4O4WA 1I45A 1EWDA 3UWQA 1F6PA 3QSTA 3BLFA 4TR9A 3LERA 1VLIA 4NNAA 5AB3A 2XN2A 5K4ZA 5C6MA 4O50A 4ORMA 1FBAA 2YR1A 3HPZA 1DHPA 3C3NA 3R8RA 4N2YA 3MP3A 5G2IA 1SR9A 1GVRA 1JCMP 3KRZA 4GC4A 2C18A 2QCMA 2WSYA 2G95A 2V5LA 3P81A 3M44A 5FESA 3B05A 2RH9A 4Y9AA 3CM4A 2FJKA 1T99A 3OHIA 4DELA 3PAJA 4HN4A 1C8VA 4RZ6A 1OX6A 5CKSA 1I8JA 3HIJA 3W1RA 3B06A 2VC6A 3F4WA 2E5CA 4WOQA 2A6NA 3HGOA 1H63A 3NYZA 1FWTA 4IMCA 3TX9A 5AC7A 2GQ8A 1LRTA 4E2BA 1ONRA 2V2CA 2HMCA 1X1OA 2R14A 3PS7A 3VCRA 1I2NA 3C4UA 3EWBX 3UWYA 7TIMA 3DBPA 2RKXA 1QMLA 4AAJA 4WY0F 2DP3A 1X1ZA 1FCQA 3C2EA 5G1YA 4DBEA 4FNUA 4N9BA 6TIMA 3H53A 3R5EA 3O07A 1EP2A 3QMRA 3W1XA 3W2NA 2OCZA 3LRMA 4NJHA 3FKKA 3I7SA 3KX6A 2HS6A 1OF8A 2BXVA 2DZTA 3PG8A 3KVJA 3U8GA 2V9DA 4UFHA 1EUAA 1G67A 3P7YA 4OWGA 3MWAA 3S5ZA 1WBHA 1K7XA 3C8FA 3MYPA 1K3UA 1G7UA 1TB3A 3S0CA 3W1PA 2PCQA 1PL9A 2QUTA 3E49A 4WY0A 4UTLA 4MYAA 1GTEA 5LNWA 3H55A 3W1MA 1YTEA 4LWWA 1OX4B 5HR6A 1KLYA 3IRDA 3NQEA 3W6YA 2NWRA 3NEVA 4IXHA 3WK2A 4MIMA 5MHBA 1ZNNA 2ZA3A 1O4UA 1UBSA 3BVJA 1VYPX 3A22A 3NR0A 4MZYA 3EKZA 4QJ1A 3HPSA 4WQ6A 4AHPA 4IWWA 1EB3A 4JR5A 3NNTA 2CW6A 4PH6A 2EGZA 1Q45A 3CWOX 3MO7A 3DFQA 1O95A 3GKFA 1SZFA 3TK7A 2I9EA 2RDUA 3O05A 2YSWA 2RFGA 5CZSA 1VYRA 5I3JA 1OFBA 4UUIA 2VEKA 2GVJA 1F73A 4BF9A 2UV8G 4RZ4A 3M16A 4FNTA 1F74A 5EMUA 2BZNA 3S1WA 3GVGA 1W5QA 5G2WA 3L2IA 3LXAA 3W2KA 1JCJA 1F6KA 4L4MA 3GB6A 3FA5A 3W1NA 1VR6A 3W7QA 4GBUA 1FWRA 1JCXA 1LBLA 4KFNA 1HTIA 3UPWA 2DJXA 2Y85A 4WUIA 3IIVA 1YADA 3TV8A 1I4NA 4TU1A 3P82A 4MY9A 4FXRA 5SWUA 1I2QA 2V81A 5D2YA 1T0OA 4Y6GA 2GVGA 2DZSA 3FFSA 2YPIA 2A2IA 4JTSA 4XWUA 2IQTA 2BSLA 3TU9A 1GTHA 2EAWA 2WV8A 4UXDA 3WK1A 3W7JA 2QDHA 1W31A 1F05A 5LNRA 4XZ9A 4ORIA 3EX6A 1WBJA 4NZFA 4IMFA 3B03A 3NQ8A 5BW6A 3LHYA 1FXQA 3FYOA 3IGSA 4JX4A 3MI2A 4A22A 3EB2A 4XTIA 2ATMA 2WNQA 3W2MA 4BR1A 1H7RA 3LM7A 1UUMA 2A5HA 3G18A 2WNNA 4A21A 1G69A 3UWVA 2NV1A 5I3IA 1DJQA 5J5DA 2QAFA 1RPXA 1RQBA 3QFEA 1DBTA 3PUOA 4WOZA 4QITA 2CLIA 3DXIA 1R2SA 2DZVA 3QMTA 4IGHA 3NM1A 4E38A 1ALDA 1KM4A 3G1HA 3P62A 3N9RA 4JTEA 4AXKA 3W83A 4S2BA 2ISWA 3TQKA 3MBDA 4JNMA 3ZS4A 3W1QA 2ZZ3A 3R89A 4XKYA 5DBUA 4EIVA 4HNNA 3IIZA 5D33A 4JX5A 4HSNA 2HTMA 1EX5A 4M7SA 5AC8A 4AHOA 1F76A 1H7XA 2BTMA 2ABBA 2NXIA 3W1AA 4JDYA 4LS2A 1GWJA 3TC6A 4U28A 2VEMA 4MLRA 2YDAA 4MUZA 2Q8ZA 1TPVA 5FF4A 3EXTA 2R91A 1P1XA 3O8AA 2OZ0A 3S8HA 1D3GA 1LRQA 1O5XA 1TV7A 3UQNA 4ADSA 3STGA 3UNDA 3S9YA 3JS3A 3DI1A 2YFNA 3PM6A 1OFAA 3B04A 3S1XA 3W7KA 3KFTA 1M6JA 4UC5A 4JY9A 2Y7GA 1OFQA 3QH2A 3FYPA 1PS9A 3RLUA 3O6YX 3GR7A 3ABRA 4NJIA 3QC3A 3DAQA 2CWNA 4X9SA 1AL8A 3EWXA 4PFMA 1ME9A 4UNLA 5C55A 3T40A 1KFBA 3QQ1A 5D2TA 1OG0A 4UTKA 3IEBA 3UY7A 1DQXA 3F1QA 2I1OA 4WY0B
chains in the Genus database with same CATH superfamily
4LX4A 1A3XA 4JIEA 1Y5WA 2QDGA 4C6DA 2Z1BA 4HCLA 4HNVA 1LT7A 1WPCA 1VC4A 4RK8A 3RILA 1ESWA 1KCLA 2QJGA 5LNVA 5C2CA 2VGBA 5AHMA 1H7WA 4MDPA 4F4RA 1A0DA 3H7UA 1WNOA 5CQ1A 1MDLA 4DYEA 1F4AA 4O19A 2CLKA 3LZ5A 4LB3A 3NPXA 5CGMA 9XIMA 1EGMA 4HYWA 4FX6M 1J4EA 1RCOB 3DKJA 1ADSA 1EHNA 5D03A 2R82A 3ABZA 4H8NA 3VU2A 3GXFA 3USZA 1WYIA 5I02A 1NM9A 2QCHA 4M24A 2QULA 3PB2A 1KFJA 3ARUA 3AWOA 2REQA 3CTLA 4NAEA 1I2PA 4K8GA 1NAL1 3UXIA 3O2LA 3VM7A 3CAWA 3CZEA 3QZAA 4GH3A 3UJ2A 2FPTA 4RLIA 4JIIX 2PWFA 1I1XA 2YDRA 3E5PA 4YYCA 4R34A 4Q8UA 3E5BA 3WQ8A 4GUHA 1WZMA 2GJLA 4GUFA 3UG5A 4I8DA 3PG9A 4WDWA 2Z1WA 3SB0A 3VOJA 1J5TA 3STFA 4YVXA 3TUUA 5RUBA 1NARA 1OQFA 4UFMA 2RGLA 3PAOA 1PKNA 1YIXA 2XVPA 4AIBA 3TVAA 3L67A 4H1ZA 1R6WA 3MA8A 1UR0A 1WUFA 3UJRA 1V7AA 2QCEA 5FJTA 2P10A 5CAHA 1A47A 3SR7A 3TIMA 3KBNA 3PPGA 1JXJA 5FF0A 1P5BA 3WZ0E 4I8YA 3EOUA 3T8QA 3WF3A 4R9XA 3ZOAA 3I6TA 4XKYB 1V0KA 1JCLA 1J6PA 4KEVA 2E6YA 5EBAA 1DWIM 5CZTA 1BXBA 1FWBC 1WA3A 4B5VA 5FF3A 5HPOA 4JFSA 2ZVRA 3NQCA 2ZRZA 5TAOA 4AF0A 1ZBVA 1VENA 4PMJA 1EF3A 3ZLGA 3ABQA 1K4GA 4J4KA 2YYUA 1MQQA 3W2UA 2DVXA 1JDFA 2E8ZA 3CUIA 2AGTA 4HPNA 3VDBA 3GE7A 5CC6A 1XF0A 1TTPA 4ZQNA 3CHDA 4D1IA 3VIFA 2YL9A 1JQXA 3WNPA 4JHMA 3OPSA 1A53A 3WNNA 4H8VA 2QCDA 1AL7A 1ISXA 1GNXA 3U4AA 2D73A 4ZO6A 2EF9A 4CD4A 3EB4A 3AXXA 1TFVA 2CLEA 2NZLA 5BXPA 1TSIA 4PMXA 1E1CA 1ZAJA 1C8XA 1JZ3A 1GJUA 1XYMA 4M1RA 5DY2A 4DF2A 4W4QA 3N4EA 1XX1A 1MSSA 4BA0A 1CB2A 1XRTA 1PX8A 3UJEA 4NHVA 4LY4A 4H6RA 1RHCA 1SUXA 4UTUA 4PBGA 1G4EA 5DMMA 4GUJA 4QIUA 1FWAC 3AS2A 2HVOA 4IXXA 4JQ4A 5M17A 2NX9A 4PGLA 5G4HC 1ISYA 5F7UA 1H5YA 4KBXA 4H9YA 1POJA 3WD2A 2VJXA 4ZGYA 3M41A 4JIRA 4K2SA 4U4MA 2Y24A 1GOXA 4ZODA 2GQAA 4GOAA 5D32A 3ITLA 1IXOA 4NY2A 1HT6A 1JULA 1UPMB 3UT0A 1UC4A 3U0HA 3DYMA 3C8NA 5GPRA 3H2MA 4FXSA 3MWCA 1TCMA 3SQLA 3SGZA 2PDNA 2EJ1A 1IXQA 4Z1DA 1O6IA 3ZVHB 1TZ9A 5FAGA 2J13A 1DWFM 1AMYA 2WNZA 2CZDA 1ISWA 3IJQA 4HTYA 4UR8A 2JF7A 5J5RA 4ML9A 4PCFA 1UR4A 1RBLA 1TPWA 3GNPA 3VO0A 3TAOA 1H51A 3CPUA 1H09A 4V28A 2VRJA 5XIAA 1CWYA 1E43A 5DCBA 3GW0A 3SUWA 2BWGA 2WHKA 4C1NA 3HPXA 3MANA 3OEXA 3NZQA 1GHRA 2YA0A 3VMOA 3HURA 4FP1A 3VTRA 5JXQA 2NQ9A 2V30A 3DGBA 1HIZA 1QO2A 3V1PA 3WBXA 4L7ZA 4S3BA 1X8FA 1W0MA 1E73M 2C1HA 3FVDA 3ANYA 4MY8A 1IIHA 4L1XA 4DB7A 2Z2UA 1BTMA 2DUAA 4CEUC 1Y5XA 4BEQA 4KCWA 3AI0A 5CEWA 5CLWA 1JGMA 5E1QA 2G50A 2PTDA 2D3NA 2TAAA 1AD1A 5HMSA 1BG9A 1V7YA 1AJZA 3U7BA 1S1PA 1GVOA 4RNFA 2YOCA 3G1VA 1UJPA 1Q6RA 1SZEA 1XIGA 1SZGA 1KGUA 4QQ3A 1S5TA 3BG5A 1VEPA 3H6OA 4O53A 3E96A 5EU9A 4AWTA 2R1NA 1B54A 3ZT6A 1N8IA 3BC9A 2BX7A 2ZZ2A 2BHYA 4W88A 2A4AA 1OHLA 1F4HA 4IQDA 3IIOA 3IK2A 4P8XA 4IP5A 2Q71A 4PRTA 4IGMA 2J4GA 3ARPA 3E6EA 2XG9A 1MZHA 3VD5A 3BCFA 4CU6A 2ADAA 3E74A 3STCA 2J7CA 3RRXA 3WF4A 5DBTA 3AIQA 4OZOA 1NIUA 1RR2A 3ARYA 4G2DA 3UJSA 1IZCA 3VKAA 4OOUA 4P2VA 1YBQB 1LTDA 5DXXA 4XZHA 4GUIA 1T41A 5HNRA 4CLMA 1KWGA 1XIDA 1EBGA 4B3LA 5HK4A 4ZQCA 4J3VA 4I6KA 5CPLA 3LNMA 4R33A 2QUUA 3SGUA 2J7GA 2IXVA 3DI0A 3KZPA 1XFBA 4BJHA 1PXGA 3OG3A 2WCGA 3RLGA 1LQ0A 1XIIA 3CMFA 1DJNA 4HT3A 1JVNA 1Q6EA 3LLFA 2Z27A 1OIFA 3S1UA 1XLIA 3W71A 4JQAA 1ZZMA 1W5MA 4L65A 4URIA 5JIPA 1QPOA 1L6GA 2AKMA 2CLOA 1K8XA 4H7ZA 3ZJ7A 1FRBA 1R85A 4Q4OA 4UQDA 4KGJA 5A6KA 2F38A 1TQXA 4GIYA 3LV6A 4PMDA 2V5BA 2NQZA 4YTUA 3RX4A 3BOXA 4YTRA 4KCVA 4LUYA 1GEHA 2C0HA 4MYXA 4Z2GA 4FF7A 3W07A 3GDTA 3IVUA 1UP2A 1F7BA 3RLHA 2BXZA 3PBYA 3OGSA 4Q8MA 1Q6QA 3AIVA 4DXVA 3HMCA 4D72A 2VCAA 2ZRYA 2YCKX 3TC3A 4EPDC 3P60A 1JCTA 2ZKMX 3W7RA 5I3GA 4B3ZA 2CFFA 4AW7A 3K4AA 3EDJA 4GQ0A 2RDWA 3HGSA 3CIWA 3H70A 1CZ1A 3BL3A 1ZJAA 2A79A 1YPFA 3NL2A 1Y7VA 3S42A 3COTA 3Q4DA 2IQ0A 3TH6A 1KKOA 3GXMA 1HQTA 4PULA 4Q4SA 1YE4A 4LCQA 1P1MA 4Y7EA 3N3MA 4GPNA 5BU6A 4QDMA 1XBYA 4GQQA 4C65A 3KBSA 3VOHA 1B3VA 5BCAA 2X1RA 2D20A 3GSMA 3L4UA 4OV4A 1BXCA 4N7QA 3R7MA 3GG0A 4B15A 4C6QA 2Z2BA 4H6QA 3F2CA 4W8BA 1J10A 5CSYA 2RUSA 1EFZA 3DCPA 4WIWA 3TQ0A 1BKSA 2A3EA 2GSEA 4K1GA 4LUSB 4BY3A 3TFXA 3WLJA 2ZXDA 4OBTA 5HQMA 3MCMA 3RO8A 4OT7A 2QW5A 2BMBA 2W27A 4LANA 1TR9A 5EL1A 1E1EA 4LVFA 3ZIZA 2NLIA 1HN1A 3ZFHA 3T2QA 5AVNA 5E09A 3R12A 4FX8A 1UUQA 3OBEA 1L9WA 2YIHA 1YDNA 1TVPA 1QI5A 3THQA 1CYGA 3I65A 4NIRA 3RM9A 5BRQA 2DJLA 3U5UA 2I57A 1YDYA 4MOZA 3LEPA 1W6TA 5KZMA 5FF7A 4Z2IA 2DDXA 1O66A 1WDWA 2G8ZA 1TWZA 3CZLA 4PCNA 2C14A 4CKQA 3UG8A 2OODA 3WH8A 2WVVA 3ZM8A 3WLKX 3GG7A 3VZXA 2PC8A 2CBVA 1MEWA 4ZO9A 4ZA0A 2L5HA 1XD0A 5D2XA 3FHQA 4XG1A 2P3EA 2CCRA 1Z32X 4WKFA 1GVQA 4RNHA 1RZMA 5DCDA 1GZJA 3EWUA 3IPWA 4AZIA 4X2PA 4K39A 4UCGA 5T9BG 2Z1VA 1HVQA 3K13A 4AIEA 2PTYA 3UZWA 4MTVA 1Q85A 2R1LA 3S6OA 3NGJA 2C3ZA 3SUVA 1KTNA 4JTFA 1JCNA 1FDZA 2DSKA 3UD6A 3PWIA 3NQBA 4GH1A 4AD4A 3U6WA 2VTFA 3LRLA 3F4NA 4FNSA 2VURA 5HINA 1SR0A 4R5EA 2HROA 4KGLA 4PEKA 3VZYA 2NSXA 1ISVA 1G6CA 3ECQA 3ARSA 4LPCA 3CQJA 4PFHA 4TV5A 5HAOA 3N3TA 1Q63A 4KH2A 4O17A 5I3DA 4AHQA 4R88A 1VKFA 4ZOEA 4MG4A 4JTTA 1T40A 4DJEA 3D46A 3GAYA 1FWJC 4ROPA 4JFWA 3B8SA 3NQ7A 1UZHA 2AKZA 3TLQA 1ECEA 4TVDA 2VVNA 3N2XA 4KERA 3W7IA 2PGFA 4M1BA 2BG5A 3WUGA 4H00A 1UP3A 2YDQA 4UNKA 4FOUA 3G0XA 3TONA 2E1DA 3ZQ9A 4U33A 4XAFA 2PWEA 1ME8A 1PIIA 3MP4A 1TVLA 3NDZA 1QBBA 3ZR4A 3M0IA 1BGAA 2XU2A 5IHRA 4H8UA 3NO3A 4WRHA 4XX6A 4A4AA 2PGEA 3B9OA 3GZAA 1Z44A 1XBZA 1YLVA 3L4YA 3RU8X 3PZUA 3C0JA 3HG5A 1S3TC 3P61A 3W23A 3NJ3A 4YMZA 2PBGA 2VDIA 5IXEA 3R13A 1MXSA 5HJLA 2ZX5A 3WD0A 4HJFA 1U5HA 4B2DD 4ATDA 3UZ5A 3DFNA 4FNQA 1ZBCA 3O6CA 1D3HA 4MNLA 5A3HA 1P43A 2XHYA 3R10A 3BLDA 1XM3A 2D2JA 1E5NA 1SSGA 5M1TA 1JF5A 3IGUA 1RQEA 3RDKA 2P53A 1UASA 1JZ5A 4G7EB 2XN0A 1PCWA 1XDJA 4KWWA 3RR1A 4FAMA 3W76A 3PJTA 1OCQA 2WANA 3AMLA 3BAIA 4YS1A 5T91A 3L0GA 3MDWA 4YL2A 3TSDA 5BRPA 1JI2A 4ZFCA 1B3YA 2XJ7A 4H6KA 3NQ2A 1T5AA 1J12A 2GL5A 4KESA 2DW6A 4QQUA 5D09A 3ZT5A 1CXEA 3WLRA 3AYRA 1IEIA 5JBEA 2WLYA 2F6XA 4OUEA 3GTXA 1YMYA 3LRKA 3QGKC 3QYSA 1UR9A 4CD8A 4PMNA 1JUKA 5CXPA 4IPLA 3WL1A 3GNRA 5G4EA 2O7SA 2PC4A 2INFA 1ZL1A 2A3HA 2VGFA 3FOKA 3U2EA 1E56A 3O7UA 3AWNA 5C2XA 4J35A 2OPJA 2EJAA 1YYAA 4DI8A 3IAQA 2QHAA 2NV2A 2Y6ZA 1QI0A 3DYPA 3ATZA 2VR2A 4IMEA 4BHYA 2IPGA 4PTMA 2AGKA 4O8RA 3FXGA 5AY7A 3RX2A 1MQPA 3TSMA 2QCFA 4NYYA 4ZL1A 4DJEC 3W2JA 8CGTA 3SRHA 3W38A 1B3XA 3GTNA 2DSUA 3MHGA 4F48A 2V3DA 1VFUA 1J11A 2XFRA 2GLKA 3VKKA 2NT1A 3K8MA 4F0SA 1RD6A 2VUYA 2ZE0A 4UWMA 4O1BA 1H1YA 1GOKA 3N34A 1OFDA 4AY7A 4ZZ9A 3N6HA 4X0NA 5HANA 4DXXA 1HGWA 2C1GA 4GIRA 5HR7A 1RXOB 3H2FA 3B0VC 5A8NA 1N7KA 1L8NA 1HKKA 1DQWA 3UNTA 5A94A 3TW6A 2I5QA 1V0NA 2JEQA 3LN3A 1DEDA 2QF8A 3T09A 4GKTA 2QAPA 1AK5A 1FWFC 5B80A 4AZBA 2FVMA 2IKGA 5HMEA 5HNUA 2NQHA 3GHSA 3KRUA 2VD9A 1W3KA 4OBSA 2XIIA 1CXLA 3I3BA 3MKCA 1OD0A 5H91A 1KGWA 2HE5A 2OO0A 1AQMA 1QBAA 2OEJA 2MANA 5I78A 3PUEA 5DXYA 5IHSA 3WD4A 1EP3A 2XIBA 5HXMA 3W1TA 3HV8A 3OZPA 5HJYA 4K7YA 3GS6A 3CMGA 4C1KA 5A6AA 4IPIA 4YTTA 2PTZA 4TUFA 4IIEA 5CZJA 5U7SA 3L66A 4HMCA 4MFDA 4AD1A 4N4PA 1PYMA 4GFSA 2QJJA 1DE6A 3STPA 2FKPA 3HO8A 3L7RA 5TNVA 3NXLA 3C6CA 4FS9A 1MQRA 1A4MA 2F7FA 5HA7A 2G3MA 1W9BM 4XUGA 4ENLA 1JJKA 1J93A 3RITA 1A80A 1XIHA 1ZP3A 2QT3A 2ZADA 1BF6A 3EXSA 3P8JA 3RLVA 1GVIA 2V5JA 4XBKA 1OBAA 2W62A 3WQGA 2ZDRA 4Z2KA 1Y0EA 2PU1A 3CHCA 5T26A 4Y2WA 4F2UA 5LNSA 2ZZ4A 3GNDA 1WQ5A 4YIWA 5HWNA 3CH0A 2C19A 4NXKA 4W86A 2D3LA 2OQHA 4HJWA 2BXYA 3ITCA 4QNWA 4OGZA 3S6TA 4G8TA 5HOSA 3WK3A 3M47A 1W1YA 5FEZA 2I5IA 5EMYA 1WUEA 1XYAA 4ROQA 1NEYA 2OKOA 4NVTA 3TQPA 5AHLA 1LLWA 1QUMA 2WVUA 3UZZA 4GACA 1U22A 1GYNA 3RN6A 3GUGA 3G1XA 5AVHA 1JUEA 2Y0FA 1TRIA 1XUZA 3VNZA 1TELA 4DWSB 2F84A 3AZSA 4FLSA 4JHZA 4FHAA 3SFKA 3LUTA 2VUNA 4FNPA 5AHNA 1KQYA 1ZLPA 3KOYA 2EO7A 2PP3A 1W2VA 2QYGA 1M5WA 3SN4A 4AX6A 3NQMA 4L9ZA 1W9XA 3AS0A 1B4KA 4NJKA 4MY1A 1IE7C 3NCOA 2R6OA 2VD8A 2X1UA 1AUSL 2YA2A 3TJXA 1T6MA 4INFA 3GIPA 1LDCA 3HG3A 3FLUA 1ZFJA 1OCNA 2JKAA 1EOKA 1A5AA 4TMBA 2PF8A 1V3IA 3W28A 1IR1A 1LZOA 1UG6A 4Y8FA 1NDWA 1UKTA 5DT5A 2C6QA 1TUFA 4GNJA 2PDWA 4DF1A 4XTDA 2WK2A 3SECA 4ZFMA 1CXKA 4O0ZA 3LENA 1XIMA 2AL2A 4MJZA 3WH6A 3OBKA 4JYEA 3RJYA 4ZENA 4ACZB 2V69A 1XLCA 2H9AA 1G4SA 5BROA 4C7DA 1OX4A 1Z6KA 4RE4A 3K1DA 3DN5A 4LC6A 4WZHA 3QPZA 1HUVA 4FR6A 1EJVC 1GOOA 4IISA 1X6LA 2YCLA 4E0CA 5FI8A 4DJDA 4QR6A 1HNYA 4LB4A 1QNPA 1GQKA 1R46A 3OGVA 2ZUTA 1XLMA 2FB3A 3UG3A 3NO5A 5KZ6A 4EVZA 4AWUA 2VFHA 2WW5A 3VE7A 3P67A 4HMNA 3WELA 3D5HA 1DIDA 4Y9OA 2WCSA 2VENA 3DG7A 2VWSA 4L6OA 1EP1A 4YPJA 4GQBA 1YNPA 4UMAA 4WSJA 2I16A 4MWAD 1UD2A 4Q8VA 3BK0A 3NQ6A 1W8GA 2F61A 4RR4A 4C5ZA 4ZOBA 2GGEA 3OHMB 1KFCA 4CNTA 3ID7A 5L9FA 3GC2A 4A8IA 5TBOA 3WD1A 4QG8A 2GPTA 2WSRA 3CU2A 2HV5A 5A2AA 1BF2A 1F07A 1GZGA 3HM7A 4CUCA 2X1IA 5U4NA 4AFYA 3RYSA 4JIPA 1XP3A 1EZWA 4O52A 4AD2A 5BXRA 1X8CA 3DFHA 1M7JA 1XLBA 4O4WA 3UWQA 3BLFA 2QUNA 2X0SA 1P6WA 5AB3A 1RPKA 1PDZA 3GY1A 4MAVA 4C6JA 3EKGA 1FBAA 2YR1A 3IRSA 3KCOA 4XAYA 3U9IA 5GQBA 5FIPA 1Q6DA 4QEHA 3MP3A 5IDZA 1GVRA 4E8DA 4KWOA 2DT1A 2G95A 4ZB5A 3CL6A 3B05A 2RH9A 4GFIA 4Y9AA 4ZE4A 3FDGA 3OHIA 3WLIA 3GG1A 2OQYA 2DSZA 5JMUA 3BTNA 1TA3B 3RHGA 2NV9A 2A6NA 4DX3A 4Z17A 3TZNA 1BG4A 6REQA 4IMCA 1Q7MA 1LRTA 1V6VA 3C3UA 4GKLA 4XSLA 3EB3A 2V2CA 2BNJA 3GHTA 4L1GA 2NVCA 2R14A 1I2NA 3C4UA 7TIMA 3DBPA 1H0GA 4LYKA 4EPKA 2DP3A 5FJUA 3C2EA 3PFRA 2Z26A 3O0KA 4N9BA 3H53A 5I00A 3TTOA 1XINA 3UZYA 3QMRA 3OVGA 2O4QA 1C7TA 3W2NA 2OCZA 3LRMA 2HS6A 2BXVA 2DZTA 3PG8A 4NI8A 4F0LA 3KVJA 4WCJA 4GQRA 2V9DA 2W61A 2WMGA 3L4XA 4HNCA 4Q8TA 4DJDC 1JI1A 3MYPA 3QHOA 3RJXA 4XZNX 4U2YA 1K3UA 1G7UA 4KWSA 4XIAA 4NSBA 2GWGA 3OW1A 4MYAA 1GTEA 5LNWA 1BHGA 3H55A 1JYVA 4JKMA 1YTEA 2OTDA 3P3BA 4LWWA 4R27A 2QNEA 4IXHA 3WK2A 3HV9A 2BV9A 3KE0A 1Z9AA 3V0UA 1ZNNA 2ZA3A 3BVJA 3A22A 4QJ1A 1HJQA 3UR5A 2Z7KA 4WQ6A 4FSAA 4QJ4B 1EB3A 2CYGA 3NNTA 4PH6A 1EDTA 3MO7A 3MQTA 5C8BB 1C91A 3O05A 2V5DA 2YSWA 1K9EA 2E4TA 5CZSA 5H6HA 1MNSA 5DF0A 1GW9A 4BCEA 4ATLA 1F74A 3LZ3A 1GJWA 2FTYA 2DIEA 3LXAA 4L4MA 1S46A 4WJ8A 1EQPA 1W9DM 1O5QA 4WUIA 3IIVA 1KGXA 1PYFA 4MY9A 2BHUA 4BQ4A 1HP4A 1I2QA 2V81A 1V3LA 4TV6A 4HGXA 4GCAA 3WFZA 4Y6GA 3FFSA 4XWUA 4OKDA 1RK6A 4DJFA 5A1AA 2OVLA 3AXMA 2EAWA 2WV8A 1WB0A 4XUYA 4RDYA 4TXEA 5M03A 1W31A 1F05A 3TN4A 4F9JA 5LNRA 4WDTA 3WQ5A 4ORIA 1WBJA 1RVKA 3FN9A 2CPUA 3FYOA 1R3WA 4JX4A 3WLHA 4XTIA 2ATMA 3W2MA 1BSIA 1O5RA 4E2VA 1G69A 3BLLA 4YU1A 4OJYA 4MSSA 5J5DA 1RPXA 4R3UA 2BY1A 5FAJA 1DIOA 2PAJA 3I4EA 3NM1A 3G1HA 3WH5A 4DZHA 3N9RA 2XVLA 1YNQA 2ISWA 3GXIA 2PDFA 3WSUA 4I5UA 2ZZ3A 2YBVA 4LF1A 3IIZA 3V1HA 4MJ4A 3LGGA 2CBIA 2FDMA 1H7XA 3WNMA 5T8GA 2BTMA 3MMWA 2ABBA 2NXIA 3WMCA 4TVCA 4JDYA 4LS2A 3LNPA 1MFVA 3A4AA 3APTA 1B90A 4MLRA 4DZ5A 1P1XA 4MAZA 4LH8A 3S8HA 1D3GA 1DXEA 1LRQA 1TV7A 1PAMA 3STGA 1JDEA 3VD9A 2VQUA 2YFNA 4PUMA 3S1XA 3KFTA 1TMLA 4JY9A 1OFQA 4C6IA 5HNTA 3QH2A 1PS9A 3ABRA 3H7RA 3K8LA 3EWXA 3TYBA 1ME9A 3ES8A 3CS2A 4J27A 3GR4A 2QGYA 3BAKA 3IEBA 1JYWA 3SRFA 5I77A 3F1QA 4AD0A 4EE9A 1Q6LA 4D8AA 5BXSA 7REQB 1J2WA 3EYPA 1GCYA 1RH9A 1FTXA 3P14A 4PRWA 3BV7A 4NRSA 4HU4A 3TZFA 2C0AA 4FOJA 2PCEA 4OV9A 4PB3A 3LB0A 2CLHA 2X40A 4IICA 1HJVA 3NPUA 1K02A 4A3UA 3UWWA 1OYAA 2IW0A 1WXJA 1N8WA 4TOQA 2DV0A 3LHTA 3U48A 1Z89A 4OHQA 4GJIA 2QDEA 4AISA 2Y62A 4LAZA 1LOSA 2ZUUA 5FOOA 2B7PA 3M5ZA 5DX7A 5JH1A 4DJFC 5MF5A 1ONEA 3R0DA 4HCHA 4IG2A 3UPBA 2B31A 1XW8A 1VAHA 2YCEA 3TA6A 2P76A 4POCA 3NEHA 1H1NA 2GQ3A 4QAWA 1JPKA 4H9VA 1NWUA 1ZCCA 2BBFA 1M7OA 1F2JA 2W91A 3TAKA 4Z1CA 5HBFA 5H2ZA 1KXVA 3LV5A 1DORA 4J2PA 4IQEA 1IT8A 2WAGA 1WAWA 2VX7A 4JS3A 3F2DA 4DN1A 4KT2A 4CNNA 2Q3RA 3BGGA 4Z0SA 1DWAM 1UOKA 3LM3A 4S3GA 4LVAA 3KOZA 4XBSA 3EDKA 2I14A 4RCXA 4WJXA 2ZX6A 3FDKA 3KHJA 4ZMGA 1ITUA 5K9DA 2CZVA 3UPMA 3WNOA 2FZ9A 2J8TA 3MU7A 1EJWC 1EJXC 1H7PA 2NXGA 2PMQA 1FH8A 4PMVA 3R1ZA 2A85A 1B3OA 3M6YA 5AN7A 1V4YA 3T81A 1CB7B 2CESA 3LPFA 3M5YA 1E0TA 4N4QA 1LG1A 2A3BA 4PUEA 3W1UA 1BRLB 2WKGA 5LHFA 4H7VA 4UB9A 1IV8A 4QXIA 1TE1A 3MW7A 3VE9A 3LCHA 2NW0A 1Y8BA 4HYRA 4UBPC 3JR2A 4Z08A 2PWVA 3QFWA 3W7DA 3CQKA 2D23A 2VKZG 1ZALA 3G1SA 4E6MA 2Q02A 2XISA 3QKZA 4F0HA 1KM2A 5AYIA 3W26A 2GQ9A 3FVMA 3GBEA 2HJPA 4ADTA 5KITA 3WJSA 4EAYA 2P8BA 5IBXC 1KM0A 3KBWA 3ITOA 4UFKA 3VXGA 1WV2A 4O11A 1EC9A 2QJNA 1EPXA 4F0KA 5K7JA 2GJXB 2RJHA 2E6AA 1UH2A 3REQA 4UQCA 1JGIA 2GOUA 5CBIA 2J8GA 3GRIA 1X39A 1RCXB 3QOKA 1HKMA 2ASHA 4KEZA 4KFOA 3KL5A 5C5YA 4AC7C 1UIOA 1CGWA 1A5BA 5CG0A 3W75A 3P84A 1ZU8A 2OSYA 4O1EA 4HSOA 1UYQA 3WD3A 4CD6A 4F9DA 3M0HA 4Z42C 4YVVA 5EFDA 6TAAA 3THUA 1W5NA 4HOXA 1AQFA 2YL6A 1UOZA 1ICQA 1VBJA 2V5CA 1V3MA 3NTYA 3EA2A 4B3KA 3DZ1A 2B7NA 5LNUA 2Y4SA 1KR0A 1RA0A 1REQB 3CGTA 1DYSA 4S39A 2P3ZA 2ZE3A 4F66A 3WMLA 1KXHA 3BICA 1UR1A 2V5KA 3SRKA 1HP5A 3T0AA 4IP4A 4CU7A 4MNJA 4B90A 1GG1A 1EQCA 1KBBA 2W5FA 4HK6A 3AMKA 5CG7A 3AIWA 1D8CA 1XG4A 3CQIA 5KTLA 4C6FA 4QBXA 3CL8A 5FCZA 4BWLA 3VIJA 3MP5A 5KSWA 2ODOA 2Z7GA 4N02A 4O14A 3TJIA 1WAUA 3VUPA 1N55A 4PCSA 2VEIA 4WD0A 3TJLA 3UW6A 4GNKB 2GGJA 2VGIA 1X38A 1K9TA 4F3HA 1SO5A 5E6YA 2OLAA 3BW3A 5A2CA 3TNBA 1PZ2A 3RPDA 4GYKA 4IHCA 1IF2A 1EA0A 1OFPA 3ICJA 2OG9A 2EPNA 4EXAA 2QCNA 3H7VA 5CCZA 1GVFA 4Y90A 1MW0A 4P7QA 3LCWA 3MTWA 4ZQRA 1CXHA 1FOBA 1KKRA 1OY0A 2J27A 1VQTA 3ZT7A 4Q8OA 1QTWA 3ZVIA 2GVEA 1SW3A 1A5UA 3WDQA 4AZ7A 3EGJA 4B5SA 5A6LA 4B5WA 2QCLA 2HS8A 4IIHA 4O0QA 5JBDA 1MMFA 3WK0A 3NPVA 3KP1A 1SJCA 1KM1A 5BZAA 1W3JA 3KRSA 2BLEA 1FP9A 1UKOA 2PWDA 3GBDA 1LWHA 3NG3A 1UWAA 2BY2A 3C52A 4BF5A 5DELA 3V16A 1XWYA 4L61A 1K8ZA 1BQGA 2NLYA 3EMZA 5C9RA 4GC3A 2UWFA 4JD4A 1GVSA 1TQJA 1K6AA 4DJED 3EDFA 1SZNA 2HNEA 1XRSA 3LCIA 4CCEA 3EPMA 5A8PA 4H9XA 1YKWA 3SZ8A 1GYLA 3M6DA 2DUZA 3H54A 4MKNA 3E12A 3W7CA 4MFEA 2PDCA 3PFMA 3NZ1A 1LQ2A 1PCKA 3EOEA 1XIEA 4DNHA 1JF6A 1TTQA 2XIOA 2NUXA 1HZYA 3R8HA 3ZWTA 3TWBA 4IFRA 2PTWA 1YW1A 2NVDA 3FJLA 2NUYA 2DUXA 3E2QA 4W84A 3B8VA 3DFSA 3B0PA 3T1GA 4DO4A 2PRMA 3EDEA 4IFOA 3OG2A 1M41A 1X97A 3IV8A 2C1IA 2PDJA 2Z29A 4LC8A 4JL2A 1LM1A 2GJPA 4ZQPA 5CH9A 4RXFA 3EX2A 1F8IA 4K3ZA 5BMXA 1XDMA 5REQB 2DVUA 3LMYA 4EPBC 1W5PA 3ATYA 4BWLC 4C91A 4WKAA 2ALRA 5F1UA 1UH3A 1BXNA 2XH2A 3TN6A 1ZJBA 3ITVA 2XIJA 3PULA 3N6QA 4MB3A 5G1TA 2Q3OA 2Q8XA 2ISDA 1BWLA 3S2MA 4DO7A 4O12A 4WJEA 1DWJM 2YZ5A 1UQYA 1TR1A 3HOJA 2PLJA 3QQ0A 1KLZA 1CX9A 1JR1A 4LT9A 1VCGA 1K6WA 3OLGA 4CNPA 1SW7A 5JIWA 1VRXA 1S3HA 3NQAA 2JE8A 2YKKA 1OADA 4LCSA 2QR6A 4LFYA 1FY6A 4ZCWA 1E0UA 3GR8A 1ML1A 2CKSA 1V8EA 2MNRA 2FH6A 1KXQA 1PB0A 1HKWA 3LBMA 4ZTYA 4QDPA 1GEQA 3R2GA 1EEXA 4HZ7A 2TSYA 7ODCA 1JZ2A 4LS0A 2IPJA 4LUTA 1WDSA 7ENLA 4NU7A 4CQ8A 4C1LA 1E3ZA 1M3UA 2FIQA 2X2GA 2W6RA 3QF0A 1YDVA 4QG9A 4WEVX 3BOLA 2GDQA 4OUIA 4BK9A 5EMJA 3D0CA 3HZ3A 2Z00A 4ATWA 2WC3A 1B1YA 4W8LA 1AQ0A 3DFPA 4FK9A 1WOBA 1R5YA 5A95A 1VJSA 2EXOA 3RK8A 2GJNA 3DBNA 4UZUA 3T55A 3WBAA 2A6LA 1RD5A 4G56A 1S2VA 5FD0A 4H3DA 3LHWA 1ZTVA 4D9PA 2JKEA 8TIMA 1Q2SA 4TX9A 3CZGA 5G2HA 1J18A 4E2OA 3RAOA 3N4FA 5TQLA 3S2JA 4I9TA 3DIPA 3O06A 3PBUA 1HO4A 3HA1A 5H8UA 1TWSA 1CW2A 1I2OA 4Q33A 3HQOA 1PPIA 1VFFA 2OJPA 2ISSA 1GHSA 2PURA 2O4MA 4NX0A 2EG8A 3CZJA 3EX1A 3Q94A 3K4DA 3S5SA 4O13A 1M01A 2HRWA 1HO1A 2Z2AA 4JICA 5HULA 4QS6A 2QIIA 2QF7A 3VIKA 4UTIA 4UTTA 1F6YA 4FIQA 4KIEA 1R9XA 1QW8A 1AG1O 3CPRA 4NZ5A 1IEQA 4ADUA 4MB5A 5BXTA 5I5RA 1R2TA 1E51A 5I3HA 4ICMA 2EPMX 3MUXA 1W3HA 4EPEC 4JEJA 4RZ5A 4XB3A 1RUSA 1CGTA 4HPXA 4JGDA 4REQB 3LU2A 3N2OA 3QKEA 3KVLA 3VNYA 1IZJA 3URAA 3O3RA 2ZX8A 3UXDA 2Y89A 3W7MA 3E2VA 4LNYA 2FDSA 1S5VA 3WJZA 4UTFA 1DE5A 2EEXA 3QV6A 4YYFA 3YPIA 3R94A 3BLIA 3WUFA 1OC5A 3MPGA 2TPSA 1LUCA 1PX4A 2J7DA 3KUMA 2PD9A 2P1FA 2ZRWA 1XG3A 5ABHA 3M0MA 2H6RA 1V6XA 2IQDA 1G1YA 1K77A 1FHVA 2JIEA 2V2HA 3UERA 3P8IA 3S1GA 2YW3A 1IYXA 3RCYA 3SCTA 1S5MA 2Y70A 5ABFA 2VEGA 1QOQA 4A2SA 1U1JA 1R30A 1TPFA 1P7TA 3OP2A 3UZJA 1DXFA 3L12A 1OVDA 3W74A 4DZAA 3BDKA 1FWIC 1ZY9A 3SN0A 3L0KA 3S6DA 2P8CA 2HISA 2FZDA 3G5EA 1R86A 2ZXQA 1E6ZA 2JGYA 3ALGA 3ES7A 1GQIA 3GFZA 3P0XA 2GGIA 5ABTA 3MHUA 3GU2A 3QLDA 1F3EA 2I56A 2EQDA 3SEPA 3TR2A 3CV1A 3NVTA 3VYLA 3QR1A 3VKCA 1Q66A 1VPYA 3BQ5A 4HB7A 4Z0JA 3S2CA 4AY1A 4UMBA 3G1AA 2F8QA 5K4XA 3MI6A 4JIHA 4AVOA 1O12A 3LTYA 4YN5A 1BYAA 3SW6A 1MUWA 4ALDA 3IGHX 1NFGA 5BWFA 3RM8A 1OF6A 3AIBA 3T0BA 4Z2LA 3FJ6A 3HF3A 4I90A 2NVAA 3VOIA 1RV8A 1S2WA 2OT1A 2PDIA 5CC7A 1ZJIA 2HZGA 1VCVA 2I17A 3VGDA 4UTTC 3LSBA 3AXIA 2OWCA 3NQDA 1JAKA 2HK1A 3DH7A 3M0JA 1DJYA 1Z42A 4QP0A 3UFYA 2V67A 3VFCA 2FZMA 3A13A 4GI4A 3U4FA 1A50A 4GZJA 4YWSA 1YQ2A 2R94A 3PZOA 4LVDA 3H2EA 3TNOA 3L5LA 5K9CA 1NQ6A 4H01A 1QPNA 1J6OA 1OWQA 2WZHA 1CBGA 3NPWA 3WDPP 2GWNA 4MF4A 5K3VA 4HVXA 3TOYA 8XIAA 2WMIA 3MSDA 4LS1A 2PFHA 1IHIA 1GPWA 2VDGA 1E3XA 1E4LA 4K8HA 4V1YA 1TPB1 4B5UA 3QRHA 1FFRA 1XLGA 1EOMA 3BLKA 3VM5A 5EKYA 2C71A 3KXQA 3L5AA 3LSCA 1BEUA 2DZXA 4MKVA 4US6A 1RLCL 3VC5A 3TDFA 2WKJA 3ERPA 3AXHA 3TJ4A 4CQDA 4IQJA 4PSRA 1YTDA 4HKPA 4DUOA 3F2BA 4BKNA 4R85A 2O9RA 1LL7A 2E8YA 3PBWA 3W72A 1HX0A 3IS4A 3UCQA 3S5NA 5AHFA 1XQKA 3G3DA 5AHEA 2CZ5A 2IKIA 1VZWA 4CQBA 2A7RA 3JRKA 1QPKA 1ZHAA 1EHAA 2VZUA 2PS2A 3V3WA 2G96A 4MNMA 1HL8A 4L4LA 2NX3A 4CNOA 1DWGM 2J9ZA 1XISA 3GUWA 2BGSA 4U2ZA 4AZHA 4N42A 3PBVA 4FNRA 4UQBA 2HSAA 2VXNA 1FH7A 1WKDA 3N29A 4WK9A 3W6MA 3W7HA 4O0KA 3PNZA 3B8TA 2HDJA 4QISA 4IPNB 2V38A 4Y9PA 2CIPA 3CLMA 4P7NA 2A7NA 4Q6XA 3SBFA 2EPHA 1OD8A 3JZUA 4KRUA 3DHFA 3B8IA 5LYRA 1S1RA 1MWOA 2DZPA 3W25A 1F5ZA 2JALA 3VNKA 2VZOA 5IDIA 3DGRA 1G4TA 2OYMA 5I06A 2IKHA 3PSVA 4V33A 1R3SA 3A23A 2G3IA 1J2BA 3MVIA 4IMDA 1LT8A 5LKYA 3RU6A 3N2BA 4JNYA 2IMRA 4DM1A 2DT0A 3F4CA 3IV3A 3WBYA 4JQ1A 5MKGA 2GGHA 3DFYA 3LGDA 3W27A 3SUUA 4DBWA 3FKRA 3CQ0A 3W70A 5GNZA 3LI0A 3W1LA 5C7VA 3GIQA 3MZ2A 3EA1A 1JFXA 2BVYA 1SSDA 1D8WA 3NWRA 1AH3A 1MXDA 4H6EA 1NJJA 2A1YA 3MCOA 1CENA 3A3XA 1OT1A 4HK7A 4IQLA 1BYDA 3C2FA 5HMDA 3UWZA 3RF9A 3NA8A 4NXSA 1AJ0A 2VEFA 3IJ6A 3CO8A 5I3KA 3HBLA 2P50A 3E0LA 3KTCA 2XWDA 3E1F1 1PV8A 3IAPA 4IOTA 3CUXA 4AG0A 3RFAA 1JCYA 1DWHM 2XGZA 3F4DA 3WH9A 4K1WA 2V82A 3THAA 2HK0A 2QPSA 1WKYA 4BF7A 3C56A 1NWTA 5H8PA 3T9PA 4WKHA 4LAKA 1UBPC 4AZ5A 3PHAA 3TTQA 3AHTA 2V3GA 3QQWA 3TXZA 3ONCA 1ISZA 2J8FA 1GYMA 5G4WA 5CPOA 3LGEA 3CH9A 4JN8A 1KC7A 4G1KA 1FKXA 1GVEA 3GTFA 1A49A 2OR2A 1EA9C 1CGXA 3M5XA 5DO8A 3SJ3A 3V4BA 3IUIA 2QLYA 1DQUA 3BANA 3N2CA 4KEUA 3FA4A 1KFEA 5I07A 2ISFA 4DAFA 4QM1A 5D9MA 4D6EA 4NT0A 4NNBA 2IXUA 5HUPA 3NL6A 1ZB5A 4A05A 5BOOA 5C0QA 2CERA 4V2XA 3WEOA 4C6NA 3Q58A 4DPPA 4JL1A 1DOSA 1PHQA 1KW1A 2DGAA 3LK6A 3D3FA 3ENLA 3V35A 2QJIA 2O92A 4M80A 3SY1A 4GRSA 2Y5EA 2VRKA 2X1TA 2WMFA 1E9YB 1A5SA 2DORA 2BVTA 1EX1A 3URBA 2J7EA 3CUGA 2X42A 2DVTA 3C0SA 2P5NA 3BAXA 3T07A 5CBBA 3GIYA 3CHFA 1DIKA 4H9MA 2G5WA 3P5ZA 2GK1B 1UP0A 4X63A 3W9ZA 1QPQA 3DERA 3Q67A 4LGXA 4JEQA 5HJXA 3HN3A 4DJFD 4G9PA 1EJRC 5AC6A 3CPGA 1MUMA 4NL1A 1BVNP 2BGQA 1HG3A 2A0NA 3LPGA 4Q7IA 1XIBA 2YB1A 4FI4A 1K8YA 3EAUA 3ZSSA 1QI4A 4J3ZA 4C6OA 2NT0A 3NURA 1EZ2A 3VINA 3BG3A 1LQAA 1C29A 1GOWA 2NSOA 2UBPC 3TMLA 3QPEA 1UUOA 4J28A 4PMYA 3APYA 1EL3A 2NUWA 5LXXA 4MM1A 1K8CA 3W88A 4L6DA 1N2VA 1VIZA 3LD5A 4S3KA 1F3WA 4PB5A 2Z0IA 1C3FA 2P88A 1NY1A 5CSRA 3SM0A 1OC7A 3WDHA 1W1PA 4IP7A 2PA6A 3C61A 2E6FA 1IZKA 4GINA 4L4PA 2X0HA 2PDUA 3QEZA 4O16A 1CLKA 1QNSA 2FPYA 4UR7A 3OB8A 5IFPA 2PWHA 2D2GA 4IIBA 1AMKA 2QIWA 4WGHA 1SZRA 4GVHA 4XVDA 3BWWA 5AKQA 1Z48A 4WXYA 1M03A 4LAOA 1VB9A 4JY8A 4NAFA 3FGCA 5ECVA 3L21A 1QXLA 5DLCA 5F4WA 4BS0A 1L0PA 1LRNA 3M9YA 1D3CA 1AVAA 1GG0A 3WO8A 3OVPA 3W7OA 1LBFA 1OX5A 2J77A 3GZ3A 2TRSA 4BEUA 1TX2A 1FDJA 2EPLX 1SMDA 3BJFA 3AHYA 3GXPA 1KNWA 4OU1A 3H12A 1A3HA 3VIGA 7CGTA 2PDBA 1P4CA 1UZ1A 4CNUA 3NIYA 4HMEA 2XN2A 1UH4A 2XZ9A 3ORWA 5C6MA 4PE8A 4YNGA 4ERAA 1XYFA 3VA8A 2IUZA 3HPZA 1E6PA 3R8RA 4N2YA 1W9VA 1JCMP 2WSYA 2WM1A 3CYVA 5I23A 3NZGA 1XLLA 2V5LA 3P81A 4PUNA 2FTWA 3M44A 5C2GA 3BZGA 4IIDA 4JFVA 3OQ8A 3ZR6A 3S4TA 3QC0A 3CM4A 2FJKA 1CGVA 4DELA 4J3SA 3NSMA 3PAJA 1PTGA 3OLEA 4HN4A 2DSVA 2PP1A 1OX6A 5CKSA 5AZ1A 5LIXX 5CLTA 3MT1A 3B06A 3RMEA 2VC6A 4ZR8A 3EPOA 2DZAA 2DH2A 1H63A 3KHDA 4HA3A 4L5ZA 4HU8A 4K68A 3NYZA 4IFKA 4Q4MA 3CIVA 4UQEA 3UETA 1P6CA 4S3EA 3Q65A 2HMCA 1X1OA 3PS7A 2I9UA 3EWBX 1EBHA 1B31A 4L4OA 3VIHA 1QMLA 1R8LA 3A6OA 3CAKA 2VYOA 3BSGA 1V3HA 1G01A 4KIRA 2XFFA 3VGBA 4H41A 1C92A 4DLFA 1KD0A 3FKKA 1HKVA 2O9TA 4HHHA 1G67A 1ZBWA 2EBNA 4PUDA 3PUGA 2WCAA 3V5FA 1EXBA 1UROA 3HJEA 1Z69A 1TB3A 3S0CA 4OVXA 3W1PA 4E3TA 5GJMA 1W1B1 4H04A 3PPHA 3W1MA 3DESA 1GONA 1A0EA 2QUMA 2E67A 2X8RA 3QR3A 2C79A 3VX0A 4KCTA 4U31A 1JD7A 1EH9A 1XIJA 5MHBA 3PZQA 3VGFA 7A3HA 2HVMA 1VYPX 4MZYA 4Z2JA 3HPSA 1PJ9A 4IWWA 4JR5A 3KLKA 1Q45A 3G1RA 1SZFA 5CSUA 1VYRA 3HPFA 1B2YA 1OFBA 4UUIA 2AMGA 2VEKA 2GVJA 2ZWYA 3NFUA 3THDA 3ZJKA 3XISA 5DRIA 1XFCA 1UC5A 2UV8G 2HWGA 3M16A 4FNTA 3VDHA 1MW1A 5D9OA 3S1WA 3TP4A 4KEMA 3VNIA 2OLHA 5G2WA 4GIAA 3UU0A 4C7FA 1EJ7L 3RCNA 2RDXA 1IQ8A 3GB6A 3S9IA 1GOMA 1ECQA 4UZSA 3W1NA 1FWRA 2XFYA 4KFNA 2DJXA 1F3XA 2Y85A 2CEQA 3WBEA 4TU1A 4GY1A 3P82A 3N04A 3WLLA 1T0OA 3BZJA 2WVTA 1W3LA 2GVGA 2DZSA 2YPIA 2A2IA 3IJIA 2IQTA 3ZLFA 5AYBA 1X98A 3CWHA 3B4YA 3POCA 2W4XA 4H2HA 3EX6A 4X0VA 4IMFA 4DWDA 1SVDA 2VQTA 1JZ6A 3MI2A 4BR1A 3VABA 1J0ZA 3WNLA 4FXJA 3LM7A 3G18A 4A21A 3HFTA 3TYCA 3UWVA 2NV1A 2QAFA 1RQBA 1XLJA 3RIKA 3DXIA 4QHRA 3MUY1 1ZPTA 3T2OA 4JTEA 4IT1A 3J7HA 3TQKA 1RSCA 3MBDA 1M65A 4XKYA 1TJ0A 1G94A 5DBUA 2C91A 4A35A 1QOXA 2O55A 3RXZA 5ABEA 4JX5A 1TJ1A 2HTMA 3AROA 4AHOA 4J3TA 1HJWA 1XS2A 2ACSA 4XVEA 4DYKA 1XH1A 4GO9A 2ZXBA 1HXJA 4IJCA 3TC6A 3CT2A 1QASA 2Q8ZA 2R91A 3AISA 3W0KA 4ZBCA 3UQNA 3UNDA 3GG8A 2FJUB 3PM6A 4ZOAA 3PTKA 4QLLA 4Z2HA 4OECA 1HKIA 2DT3A 4X9YA 3FYPA 2YA1A 3L2LA 3QC3A 3UGRA 2Q01A 3MSYA 4MJ2A 2ACUA 1VF8A 2R9RA 3T40A 3SCNA 4QSFA 2OLSA 1OG0A 4UTKA 3V18A 1DQXA 4NI3A 2I1OA 1EXPA 4WY0B 3XINA 3LTPA 2JF6A 3G1DA 4PYSA 3V5OA 2DQWA 3BO9A 2OX4A 4CCZA 3UR8A 3T6CA 1VD6A 4C90A 4GMEA 2INEA 2ZA1A 3SN1A 3TQVA 1P0EA 3L68A 4EWJA 1WXYA 4PTNA 3W87A 2ZZ5A 2PWGA 3PN8A 3QYQA 1I9CB 1UB3A 1KFKA 2QV4A 4L64A 4GYFA 3CIXA 4ZSUA 5M5DA 4ILSA 3P93A 4HZ6A 2XTKA 4QLJA 4RZBA 3M0YA 1DXIA 3IGXA 2VZVA 4Q8QA 1R47A 2VFEA 3BARA 4CEXC 3ZXWA 1KO0A 1KCKA 4GXMA 1JZ4A 1EC8A 1XRVA 1UZDA 1B0IA 3QW4B 1U5JA 3AALA 1JNEA 3A9IA 4LOCA 3W00A 1L2UA 3MUZ1 4O15A 3V7PA 3T44A 2CETA 3ARXA 2J66A 1P0NA 1WDRA 4GXPA 3T08A 3TR9A 3W7NA 1JRBA 1IEXA 4XQ6A 3GWQA 1FP8A 1CI1A 4AYSA 1UWTA 3HG2A 1DTNA 3ZVHA 1RP8A 3FSTA 1LORA 1Z3NA 4FR1A 4RNIA 2Y61A 1UWQA 2F2HA 1XBXA 1MFUA 3TOPA 4V1XA 1BVZA 3MMDA 1FX6A 3GNXA 4D2JA 4X22A 1XH2A 1OM0A 1K4HA 1XBVA 1J79A 3P0WA 4QTGA 3TKFA 5H8MA 2E09A 5CJNA 3WDJA 2GUUA 4MLJA 3WQ4A 1WXZA 2XN1A 3N15A 4ZEPA 2WHMA 3TCSA 5BMWA 4WVXA 2WHLA 4QJ3B 4W5ZA 4AD3A 3OVRA 3H4WA 4MDOA 4M6VA 2OZ3A 4WX2A 1DV7A 1D7FA 2V3FA 1S2TA 1PWLA 4N6FA 1YPXA 4QS5A 4UOJA 2VOTA 4DZIA 3KWXA 2Y88A 4AZCB 2CNCA 8XIMA 3EZ4A 3B9DA 5GVJA 1R38A 1OK4A 4E8CA 3DU0A 1VP5A 3K30A 4D6IA 1IWBA 5D9PA 1W3TA 2C8NA 5HWMA 4MWAB 2Y7FA 2QQ6A 1SMAA 1E1FA 1VH7A 3KVKA 4D6HA 2PDLA 4Q8PA 2ZC8A 4F40A 1O60A 2ACQA 2RGMA 3DFTA 3CQHA 1XXXA 3W81A 5I0DA 1TVNA 2GUBA 2D2OA 2NQJA 3OZOA 4H9TA 4MUPA 3OYXA 4MPKA 3W53A 4GVFA 4M81A 2NX1A 1E72M 5I2UA 2OEMA 5M2FX 1SU5A 9XIAA 4AXNA 3GVWA 3DECA 3MY9A 3C2VA 4BI7A 1YBQA 3AHXA 2VCCA 3P5YA 1UMLA 1TE6A 3KTXA 3RMJA 3SSZA 3WL0A 5AYXA 1FQ0A 3VDGA 3FXYA 4HPHA 4I7VA 2R1PA 1FHDA 3N2TA 5AECA 1TV2A 3W29A 4FMVA 2CBUA 1D2KA 1GKQA 2Y8VA 2QV5A 3BPWA 1S2UA 4EX4A 1W5OA 3G8RA 3AUOA 3FK4A 3TYEA 3A3HA 1Z8AA 3VCNA 1YHTA 2V2DA 3DEQA 5CJ5A 1JAEA 4IUGA 1KV8A 2X05A 3EWWA 2YLAA 3SSJA 3N9KA 3T4CA 3WF2A 1FCVA 3THCA 3H8AA 2VI0A 4Q8NA 1D9EA 3AAMA 5FF2A 1VRDA 4QLKA 2P0OA 4B5NA 4JTRA 3ABXA 3ME3A 2VR4A 3CNYA 3CHEA 3HFYA 4IL2A 1GKPA 2JBMA 2REQB 3KWSA 1GORA 1TMQA 1FHLA 1NU5A 4NAEB 1H1ZA 3PZTA 3ISIX 4U10A 2XZ7A 4YCOA 3LLDA 3XIMA 1E0WA 4QNEA 1FDYA 1A5LC 1J96A 2X16A 1TPC1 3LHZA 2PF0A 1UIPA 3EXRA 4GVGA 3N19B 2YDSA 2WZIA 4EF9A 3V36A 3R8GA 4M56A 5KINA 1ZGDA 2INZA 3NSXA 2DSWA 3G3MA 1A4LA 2BHZA 3WQ6A 2PGRA 1X7IA 3PTMA 3DDMA 4JZ5A 1MEIA 4US5A 3G2GA 4KETA 1KBJA 1ITCA 4LBRA 2QEZA 4PA8A 2YCJA 1NWSA 2C13A 1GOQA 1H2JA 3K1GA 4Q4KA 1V6UA 2YL8A 3L5MA 1KB3A 3PC0A 4QE4A 1AW2A 1E70M 4JTHA 1AODA 4PTXA 1QW9A 2WQDA 4JYFA 4J40A 4QFUA 3KL3A 2ZRXA 4C5YA 3PPCA 4ZQMA 1I2RA 4CQCA 1V5XA 3QW3A 4XBJA 1J0HA 4LUSA 2YXGA 4J9JA 2ZIDA 3EA3A 1J0KA 3BLOA 4O1FA 1EDGA 2IPWA 3RR4A 3A21A 2PUZA 1LROA 4LEQA 4HCDA 3PJUA 1DJIA 5LGXA 5D02A 3SUSA 3W7EA 1IEWA 4GD0A 4AF0B 3F5JA 1E15A 4JXCA 2FZ8A 3VKJA 2DH3A 1GQJA 4V27A 3VOGA 3AXKA 3T78A 3Q2DA 1YDOA 2DIKA 5D8ZA 5KZEA 5A6TC 2ZXAA 1AFSA 1H49A 3VD4A 3ABOA 1FWSA 1S2CA 5AHIA 1JQVA 1R9YA 2CITA 2PZ0A 2ZUSA 3HG4A 2WXDM 1E55A 2J25A 3EOOA 1KTCA 2J9XA 3GU9A 1XUUA 4HNOA 3AIRA 5LZLA 3LMZA 4L9YA 1YPIA 3FA3A 5GJNA 1ZS2A 2QCDB 4XZLX 4FB7A 3QGVA 2EKCA 3L65A 3HJZA 5D30A 3BJSA 3M43A 1I60A 1E1CB 3SURA 2JEPA 3U2ZA 2XVKA 1TPDA 8RUCA 1E40A 4H83A 1DP0A 3BW2A 3NQVA 4ZXLA 4U5IA 1GK8A 1ICSA 1NSJA 2PP0A 1DJXA 4L9XA 3OA3A 2OO6A 1VS1A 3R4IA 3GYCA 3ZSTA 2Y7EA 3KL0A 1L6FA 3AC0A 3B9NA 1ONWA 1PZ1A 1ZUAX 1HL9A 2G4JA 4R9OA 1SO4A 5AOUA 2O0TA 2FQIA 1TJRA 3M7WA 2J9YA 5CC5A 4F0RA 2I5GA 5HATA 2YZRA 1PWMA 4F79A 4MGGA 5ABGA 2PDYA 1TWDA 4GX9A 3RNDA 1QT1A 4HU3A 4MB4A 3OU8A 1QWGA 1O5KA 5GJPA 2KX9A 4QJ5B 3PZGA 1UKQA 4RX0A 2TODA 1BVWA 1RVGA 5XIMA 3TN3A 1B30A 3BUVA 3MC5A 4M82A 2Q6ZA 3WLOA 3IUDA 2JQXA 3IJ9A 4XO6A 1WO2A 1V08A 2XSAA 3RX3A 1QHZA 1EEPA 4TVUA 1J8VA 1QOPA 5HNNA 4BI5A 3BMVA 1E71M 3WLPA 1SYTA 4DM2A 4C1NB 1TPEA 1XLEA 1UD5A 3HTWA 3MBFA 1I0DA 5DT7A 2AQOA 3MYOA 5FL0A 4RPPA 2DIJA 1SFTA 5A2BA 2CBJA 3LBOA 1FWEC 1VFLA 1E6SM 2J75A 1TTJA 2W0UA 2WYSA 3BAYA 2OZTA 3PZMA 1R7OA 4FLQA 4N0RA 2E5BA 1S2AA 5KEZA 4OQVA 1TO3A 2HVNA 5DANA 4O4VA 2DZWA 4HA1A 3H2CA 1B5TA 2WOQA 2VFIA 2DPEA 1RALA 5DMYA 1HGYA 4IPPA 3KLLA 4J5NA 3FAXA 5FSEC 1DJHA 2YFOA 4G7EA 4FA3A 3GDKA 4UQ9A 1DJWA 2OQLA 4L1WA 3JZEA 3PTDA 3F5LA 4G7FA 5FSDC 1W9UA 3QHNA 5D05A 3A5VA 1SQ7A 2RAGA 5I7GA 3WQCA 2FGLA 1WZAA 2VMFA 2WHJA 1K7EA 4H2CA 4JKKA 4H8HA 3W84A 1VFOA 2YW4A 2CXGA 3TTYA 4JFUA 1I75A 3MDUA 1XSKA 4K36A 5C9ZA 4C6MA 4GZEA 3OYZA 4EACA 3NQFA 3VIMA 3TN5A 1FH9A 4KCUA 3OZMA 1KXTA 3IIPA 4RE0A 4W87A 2XSBA 3IARA 1JDAA 4O57A 3C2OA 3MS8A 3FX4A 3MV01 4AYGA 4LTSA 1O7AA 3W22A 1QCWA 2PSNA 4QAIA 3LA4A 4RNJA 3SCUA 3IJ8A 3OGRA 4PODA 2DZUA 3FCPA 3RO6A 2WJDA 1Z41A 3I7QA 4MWAC 3SCOA 1KM6A 2V8ZA 5E9AA 2PB1A 2H3DA 4BZYA 4DUWA 2FPVA 2J6VA 2FVKA 4CGTA 4DQWA 3F7JA 4M8UA 1EIXA 2Z4GA 3GW3A 2WLZA 1E9LA 1K7FA 4WXZA 4IM4A 4P8UA 4XKMA 4I5XA 1H3GA 3WJWA 2D69A 4PUWA 4JHOA 3AJXA 2WB5A 5AC4A 3WF1A 3UXKA 4O1AA 3QBUA 4GGHA 5J04A 1B3WA 2BB0A 1BTCA 4NX5A 3LHVA 5AZ0A 3QSRA 3C5QA 1P0DA 1S5NA 2Y8KA 4UFLA 1VPQA 4C60A 4GI6A 4FF5A 1I0BA 3GHRA 1FA2A 1ZAIA 2TMDA 1H61A 4HTBA 5E9XA 1FUYA 5CSSA 2AQWA 3DG3A 4LYRA 4XD4A 4HNLA 4FX7A 4PUUA 3BGJA 4RDWA 3WIJA 4GCXA 4MZ1A 4LNCA 4I3GA 3SAZA 3DENA 4R7JA 3GAKA 5G1MA 2CC0A 3ITGA 3NOEA 3B9EA 2OZ8A 1NOFA 4FLOA 2D0GA 2Y7DA 3BXWA 1L6WA 4M19A 5C70A 4JN6A 1XQLA 2W63A 3VD7A 3O16A 2BFGA 2BY3A 3QY8A 3PBMA 3TTSA 2OU4A 4PL2A 2D1ZA 3QR0A 3WENA 3RM4A 4EWND