3M7WA

Crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3m7wA00
2PC4A 2Y6ZA 3MMTA 4UMCA 1ME9A 2TPSA 2AGKA 3M5ZA 4O10A 1VS1A 1QOPA 3GLCA 3QQ1A 4DELA 4JTHA 3W84A 3OG3A 4BI6A 4FX8A 3LHUA 1ME8A 1HL2A 4CQAA 3UXAA 3VI2A 3TC7A 3LOTA 1KM1A 3OEXA 4NVTA 1TV7A 2RDWA 3M5XA 3M1ZA 3PR2A 2FFCA 4CCCA 3TX9A 1OYCA 3W2LA 1VLWA 4N2YA 1BKSA 4LY8A 3HPXA 3TUUA 3LXAA 4B5NA 1YTEA 3NQEA 1TRIA 5HWJA 2A21A 3NZ1A 2KZHA 2H3DA 4YLWA 2V2HA 1H1YA 2H6RA 4R53A 5D05A 3OBKA 4AWSA 1NF7A 4ZQMA 1M7OA 4JTTA 1KBIA 3NXFA 7TIMA 4IX0A 5I3KA 3BPWA 1P4CA 4NXSA 4MZ1A 5CKSA 3FYPA 1G4SA 3M5YA 5K3VA 1TYGA 1VGAA 2JKAA 5F4WA 3S5NA 2AAMA 2FB3A 1IIHA 1JUKA 3T7VA 1T0OA 3A5VA 4UTIA 4RZ4A 3VE9A 1LLZA 3LTPA 1PE1A 2P1FA 2V5BA 4OV9A 3NQCA 5DY3A 4QITA 5AB3A 3NPVA 4KWVA 4LV9A 4LVAA 3TQ0A 4MY1A 2HTMA 1K7EA 3STEA 2HSAA 1HFBA 1PS9A 3PC0A 4PA8A 4K39A 1B4EA 1TJPA 2YX0A 4FEZA 3MWAA 4N9CA 3LERA 3CTLA 1E51A 4AF0B 5K9CA 1EP3A 2FPVA 1TCDA 2VFEA 5K4ZA 2C3ZA 3P61A 1Q6OA 1F6KA 1A5BA 3C8FA 3UD6A 1OX6A 1A5AA 4EOUA 4AHOA 2HS6A 1LCOA 1QO2A 1OFBA 1I4NA 5KINA 3THQA 2YDAA 1M7PA 1QPRA 1TPC1 4RZ5A 5H91A 3BW3A 1NFBA 4JTLA 4Y9AA 1XDLA 3N9RA 4LOCA 4PCFA 4OT7A 5EL1A 3DI0A 3DZ1A 3S42A 3KX6A 4FF7A 3LTYA 2DJXA 5DXYA 5HWNA 3E02A 3NO5A 1YDOA 5J5DA 1VCVA 4FNTA 3W3OA 4YXGA 3GKFA 3S1VA 5D30A 3GXTA 3CEUA 3BG5A 1R47A 4O15A 2IQTA 3G3DA 3TJLA 4MYXA 3DENA 1S5WA 5HR7A 3HGOA 3LCGA 3BGJA 3MI3A 5HQEA 1VH7A 2CLMA 4UC5A 3PY2A 2OZ0A 3W7IA 2X16A 4HSNA 1R2SA 3BV4A 1Q6QA 1KA9F 4CNNA 3A9IA 2DZPA 4BK9A 1WA3A 4ONVA 1FXQA 5G5IA 3W1NA 3LCXA 3W7RA 2CZFA 3QF0A 3OVRA 1FX6A 2ZZ2A 4MY9A 3R2GA 3R13A 2TRSA 1I45A 1TPH1 2A2IA 4S2CA 3MHUA 1RPXA 2A0NA 2EGZA 2Y85A 2ZRZA 1QPOA 1OFRA 4JTJA 4HIBA 4DF2A 2F84A 1Q6RA 1FCUA 3N2XA 1VPXA 3HF3A 3NVTA 2V8ZA 4UTJA 3CT7A 3MYPA 1FXPA 1OX4A 1ADOA 1G67A 1X7FA 1ICSA 3PULA 3L9CA 1JVNA 3O16A 3MHGA 3EWXA 5AC6A 1DOSA 2YW4A 1M5WA 2F7FA 3EWBX 5L6UA 2VEKA 1CX9A 1RZMA 4X3ZA 4Z1BA 3G18A 1KLYA 4K38A 1X1OA 3OVPA 2BX7A 4LRTA 4NJJA 3WFAA 4GUJA 1H50A 3SSJA 3HGRA 3QC3A 4E0CA 3F4WA 4DQWA 3QEZA 2DU2A 3PAJA 1OABA 3CIXA 4JTUA 4R33A 5AOUA 1QAPA 4ZL1A 3PBVA 1MO0A 1K8YA 2R8WA 2W79A 1C9DA 1ZFJA 4ZQNA 1RR2A 1LBMA 4RR4A 2W6RA 3ZWTA 5LNUA 3FJ6A 4ORMA 1WQ5A 5BNKA 2YFOA 2RDUA 3NGJA 1KBJA 4XZ9A 1W3NA 1W56A 5HUOA 3KVMA 3EWUA 3RU6A 5C2XA 3EB2A 3LLFA 4NU7A 4WY0F 3WJYA 3UY7A 2FPYA 4Y90A 3M43A 4N9BA 1AL8A 5CSSA 2Y7FA 4H3DA 2P0OA 4O54A 2B4GA 1GEQA 4O16A 2ZQ0A 3W7HA 5D2TA 3DFPA 4JXCA 3QRHA 3CM4A 1VYRA 2E5CA 3TK7A 1V5XA 1IGSA 5LSMA 3B05A 3P5ZA 4C1KA 4UCGA 1K03A 1KLZA 3QJAA 2YW3A 3LV6A 2GOUA 3B0PA 2RH9A 5FI8A 3INPA 3G0UA 3LX9A 4U28A 3H55A 1DKWA 3L65A 4N6FA 2A6LA 5CG7A 2A7PA 3GAKA 3S1XA 3TQVA 1VYPX 2I1OA 2B7PA 5CSRA 4LV4A 3GB6A 2TYSA 5AHEA 4ADUA 4NZFA 3W7EA 2GQ9A 4PTNA 1SSDA 3DU0A 1P0KA 2CLFA 4UFLA 4MJMA 1H7PA 3HIJA 1YTDA 2CLLA 4WQ6A 3R8RA 2Z2UA 3K30A 5DY2A 3LBCA 5AFDA 3NQDA 4OGZA 3SY5A 2CLEA 3CEPA 5F1VA 3PBUA 3L0KA 5BOOA 4MFDA 4JY9A 1TSIA 1QWGA 2ZBTA 4DPQA 3E49A 3W1LA 3MHFA 2WNQA 1ICPA 1OFQA 2NUXA 4UXDA 4JIPA 2NXIA 2PE4A 3U2OA 1UUMA 5HUPA 2A7NA 3BLEA 4O14A 1QNVA 3LRMA 3HMJG 5EPDA 2ZTKA 2QUUA 3O6DA 2Y63A 2Y7DA 3W85A 4IPJA 3LXCA 3NQAA 1QPQA 2VKZG 5FF0A 1OX5A 3M9YA 4I7WA 5D38A 5IBXA 2QCDB 1XUZA 4PODA 1GVRA 2OT0A 3GNNA 4O0ZA 5G4WA 1L6SA 3G3MA 2VFHA 4HNVA 3SW6A 3CPRA 4JTSA 1K3UA 3TROA 2RFGA 4R34A 3PB0A 1K02A 5HMSA 3GIYA 3EWZA 5EKYA 1L2UA 5DCDA 3NL6A 4POCA 1KV8A 4XWUA 2NXHA 3TU9A 4LS0A 1FY6A 5E93A 1EWDA 4FXSA 4I7UA 3I7SA 4CCDA 4UNKA 4RCXA 1TPFA 5EA9A 3WJSA 3FJLA 3E0IA 3P5YA 3TMLA 2WSRA 8TIMA 2PURA 4FX6M 1VR6A 2G95A 2GQAA 3KHJA 3MUXA 2NUWA 3TSMA 4DPPA 3UZJA 2BLEA 2NV2A 4N4PA 1GQNA 5KSWA 4GUFA 3TAKA 3LCFA 4OV4A 4UTTA 3GXPA 4KFNA 4WY0A 4P61A 1SU5A 3WJXA 3PUEA 2Y62A 1U83A 2CFFA 1VYSX 3ANYA 2VXNA 3ABOA 1H7RA 2CLIA 2J88A 4N6EA 3QYQA 1LM1A 1DQWA 4AXKA 3VCRA 5D33A 5T26A 1PL9A 1N8FA 1JUBA 1O5KA 1FUYA 3L2IA 3C52A 1UASA 3PSVA 4RKAA 4K8HA 2O7QA 2VFIA 3FLUA 3NR0A 3P82A 1O60A 4O12A 1DJQA 3IIOA 4DO4A 1OG0A 2C19A 1ALDA 1SO5A 3THAA 2V0TA 1SO3A 4A22A 4ZQPA 1F5ZA 2NZLA 4JTEA 1TO3A 4WUIA 3I6RA 4O18A 1F05A 4GBUA 2EF9A 4NUWA 4WOQA 3EWWA 3CLMA 4IMCA 1UCWA 3WJZA 3S0CA 5F2GA 1WV2A 1TPWA 2ZTJA 3W76A 5G4EA 3KXQA 3GDRA 2G96A 4Y8FA 3EXRA 2V9DA 1S3HA 5I3IA 2QJIA 3GX9A 1AG1O 3G8RA 1XXXA 1GVFA 1H7WA 4NQ1A 1HG3A 1IF2A 1D3HA 3B4UA 3DH7A 3EXSA 1IXQA 2WV8A 1TJRA 3QMTA 4BWLA 2NX9A 3ELFA 3TFCA 1QR7A 5LNRA 1LDCA 1T96A 3Q58A 1GOXA 4PL2A 3CQ0A 1VCGA 3PWAA 2FTPA 3W86A 2W0UA 4GUIA 1F76A 3C2RA 1G7UA 1B9BA 3C56A 1YXYA 3FEMA 4FNQA 4PEKA 2CW6A 4RJEA 5D04C 2E68A 2E1DA 3TR2A 5LHEA 4GJ1A 5TQLA 4AWUA 1JCJA 4CCEA 5CPNA 1H63A 2C14A 1DL3A 3GR7A 5AC8A 1W3TA 4E38A 3P60A 5BRBA 1VCFA 3W74A 5HINA 1SZEA 1W1ZA 5AYXA 4BF9A 1OF6A 5AHMA 4DF0A 2QAPA 1AMKA 5U4NA 2UV8G 3BVJA 4XTIA 3ZFHA 1AL7A 3TXVA 5F4XA 3O06A 5D09A 3M47A 5D2XA 3JR2A 1A50A 4I9AA 1W0MA 4NNAA 1SW3A 4UFMA 3EKLA 2ZRWA 3NEVA 5F2MA 3B04A 5FEWA 3NDOA 1WBHA 2B7QA 3U6WA 4O1BA 5TIMA 2WNNA 3VE7A 3TW6A 4BR1A 5LNVA 3KVJA 1BWLA 3S9YA 2NX1A 3KOFA 2QF7A 3G1SA 2Y61A 1TRDA 4AVFA 1H51A 1GTHA 3BK0A 1PIIA 3W73A 1LRTA 1QO5A 2E6FA 1SW7A 4AHQA 4RXGA 4CQ8A 1K8XA 5FEPA 2QCCA 5G2IA 3N3MA 3D0CA 5F4SA 3KRUA 5K9XA 3UWVA 4WOZA 4WXYA 3UYCA 1GJPA 3S8HA 3NPWA 3BGGA 3USBA 3NQVA 3DAQA 4IMFA 3TW7A 4UR8A 1KFBA 3ABQA 1FDYA 3DFQA 4LC6A 4MYAA 3LCIA 3G1DA 1IIGA 2BZNA 3HGJA 2Z0IA 3P62A 3BARA 4TU1A 5F2IA 3SECA 3PBWA 4OU1A 1LYXA 1W5PA 2NUYA 2V2CA 1I2RA 1SW0A 4IJBA 4UTWC 1GVQA 1H5YA 5F2LA 2XN2A 1IXNA 5LGXA 3NOEA 3CB8A 1ZNNA 3N2MA 4ZZ9A 3FS2A 3P67A 1KFCA 4JNMA 3NQ8A 3L67A 1FCQA 3TC6A 5D2WA 3RNDA 3H54A 5CPOA 4O19A 3G1YA 4RZ6A 2R94A 4UTHA 3LDVA 3S6DA 4FNSA 2DZXA 4Z1DA 4EVZA 2QCLA 3UPBA 3WK0A 5IBXC 4ZVJA 3ZWSA 3IGXA 3LB0A 3LTSA 1I2NA 1XCFA 3L5MA 3DXIA 1VHCA 1R2RA 3SI9A 1SZGA 3O05A 1ZAHA 4TO8A 1GZGA 5LKYA 3EX4A 2ZA2A 3P8IA 3T4CA 4HNTA 2TSYA 1YYAA 1SO4A 4N9EA 2YXGA 5GVJA 4JGDA 3TQKA 3GDLA 3F03K 1OFDA 5SWUA 1C29A 5C6MA 4JX6A 2BWGA 2GVGA 3LHZA 3PB2A 5CZ0A 4IXXA 3UWUA 1L6YA 3W22A 3U8GA 1NEYA 2Q8ZA 1PV8A 4UFIA 1S5TA 5DN1A 5CZTA 4ICNA 4O1AA 5FESA 4UIOA 3Q37A 2H90A 3N34A 1ZAJA 4UTUA 3SFKA 4HN4A 5D37A 1JCNA 3A21A 3HO8A 4A2SA 2C13A 3YPIA 2YGYA 4UTKA 2NX3A 4OHQA 3W1MA 1DQXA 4AHPA 1FDJA 1ZAIA 4CNOA 1F6PA 2WO5A 1JRBA 4MPQA 1KW1A 1TQXA 2QCHA 4QSHA 5I3JA 4UTTC 3KRZA 3G22A 3TA6A 2JGYA 1XBVA 3P7YA 3CWOX 3EX3A 4OE7A 4LS1A 3CWNA 3W1RA 1VQTA 2FQIA 1XI3A 3IIPA 4FHAA 1SSGA 4UFJA 3T40A 1EA0A 5AHFA 2JKEA 1RVGA 3A24A 2E6YA 4K36A 4MKNA 1OK6A 2Y89A 5KMYA 1ZHAA 3IRDA 4LS2A 1GPWA 1TTIA 3IIXA 1KTCA 4MOZA 1FWSA 1MZHA 2CLKA 4DEFA 1LORA 2PRMA 1XFBA 4XBKA 3BG3A 3RK8A 4IQLA 5FF4A 1EX5A 3CU2A 4JR5A 3NQ6A 5DCEA 3G0SA 2FB2A 5HJLA 2WQPA 4K37A 2E09A 2BXVA 2H8XA 2VOMA 1FWRA 3BW2A 2X1TA 4ZQOA 5HWMA 4IMEA 1LTDA 2RKXA 5A8GA 1Z41A 2C15A 3HOJA 1W54A 3IEBA 3C0JA 4M6PA 3M0ZA 4GWEA 3W07A 3PG8A 3TH6A 3F4NA 5AHNA 1F7BA 3EXTA 1OX4B 5D2VA 4NZJA 3ABRA 2C1HA 2NXGA 1V7YA 1TPEA 2PRHA 4AH7A 4JTKA 4LW7A 3T55A 3C6CA 3RLUA 3DBPA 3LCHA 1K7XA 3O07A 4UMBA 3ABSA 3G1HA 4X22A 2J9ZA 1MXSA 5BW6A 5K9DA 4U4MA 1NF0A 3M5VA 4OQVA 1HO1A 1KTNA 1RQEA 4XKYA 5CPMA 4TX9A 2ISWA 1X8FA 1T99A 4NJIA 5FF7A 3DKLA 2ZZ7A 1TMHA 4H6KA 3R89A 3AJXA 3NA8A 1JCMP 3W83A 4JTGA 2JBMA 3NQ7A 1W5QA 1YPIA 2VFDA 4LVBA 2XN0A 2V30A 3LRLA 4GFSA 4A3UA 1LZOA 5I3GA 3QMRA 2DZVA 4FNRA 2G97A 1XBZA 3AO0A 3IIVA 4KFPA 3N19B 1KV5A 2WNZA 5U7SA 2VFGA 1A5CA 4WX2A 4ZMGA 1LLWA 1QMLA 1ZY9A 4ADSA 4L4LA 4BFAA 4MY8A 3FKKA 3E9AA 1I2PA 4LU0A 5LHFA 2YZRA 1TIMA 5EMUA 3OA3A 1GVSA 2ZA1A 1WAUA 4S1FA 5KZDA 2JKPA 1OFEA 3I65A 5FF2A 2X1RA 5HNRA 4QNEA 3LM7A 4BI7A 1Y0EA 3FIGA 2QCNA 3PUDA 1FQ0A 4EWND 4AWTA 2Q3OA 2QEZA 2ZDRA 4O8RA 5DCBA 1EUAA 2QAFA 2YSWA 2ZRVA 1F2JA 4ORIA 3GDKA 2GJLA 4M6QA 1FWTA 2A5HA 3C2VA 1Q6LA 3MP3A 4EF9A 3GK0A 1EB3A 3UWWA 4YMZA 3IVUA 3KFTA 3NQMA 3QZEA 5DBUA 3W1AA 3W7LA 4HPJA 2VFFA 3ATZA 1S5VA 2A4AA 1HTIA 2B7OA 1O4UA 3L5AA 3G8EA 1WOBA 1SZFA 1WBJA 1TTJA 1TTQA 4TIMA 1KTBA 4QISA 4A2RA 1XBYA 3C3NA 3C4UA 3I68A 3W23A 3LLDA 4HHPA 1YADA 4JTIA 2Y70A 4M19A 4TMBA 4QIUA 4M5PA 3HGSA 5KZMA 4HPXA 4GUGA 3STFA 3EX6A 3SR7A 4PC8A 3W9ZA 3TSDA 1A53A 5E1QA 2FDSA 4UNLA 5L9FA 2ISSA 1TREA 4MZYA 1YPFA 2ZZ1A 3GDTA 3H53A 4IMGA 1GG0A 3HB9A 1SO6A 4PH6A 1LRQA 1PVNA 1WDWA 4DF1A 3ATYA 3LHTA 2EHHA 3W7KA 3VKJA 5CPLA 3W2NA 3CIWA 3HG5A 2B0MA 2CZEA 1YXCA 2J27A 3QW4B 1H7XA 1YLVA 4HKPA 3W72A 4NX0A 1YTKA 1PHQA 3DHDA 1JRCA 3W1QA 4Q4KA 3EEGA 1SPQA 4GXMA 2G5WA 4Q33A 1GVOA 4LNYA 3RLVA 1J2WA 3W71A 2ABAA 2C6QA 4K8EA 1W31A 6TIMA 2VC6A 4E2DA 2Y7EA 1VLIA 3LI1A 2VELA 3F1QA 4IGHA 3BLFA 5DLCA 3S1UA 3PF3A 1VJIA 4QAIA 3O63A 5KZEA 1G4TA 1P0NA 4UTMA 4FNUA 1B3OA 2GJNA 1BWKA 3PM6A 5KITA 2E5BA 5G1YA 4DO5A 2H8ZA 2NLIA 4UTLA 1G4PA 1NAL1 3W1XA 1FBAA 4JN6A 4NJKA 4QM1A 4LVGA 3V75A 2D73A 3A23A 4WY0B 2J6XA 3L68A 1PCKA 2ZCGA 2WKJA 3HJZA 4X2RA 4ZQCA 4AEOA 2DJLA 2X1UA 1SR9A 1JQVA 2ZZ3A 3GVGA 1RV8A 3NQFA 3W1UA 2V5LA 1AW5A 1JCXA 3JS3A 1VHNA 3VNDA 3LBMA 3EKZA 3B06A 3UXDA 4IPIA 1JR1A 4KWWA 3UZ5A 1O94A 3VFLA 3NM1A 4FNPA 3W88A 3P84A 3HG4A 3FFSA 4GC4A 4JDBA 1JCYA 3L5LA 1EPXA 4IOTA 1XKYA 3ZS4A 4K6AA 1LOLA 3E12A 4G1KA 3GAYA 1JUEA 1P1XA 1R46A 3MI6A 2V2DA 4JDYA 5G2HA 4HNNA 2R14A 1VRDA 2LLEA 1UJPA 4W9TA 2Y7GA 5AYZA 3I7QA 1OFAA 1WOAA 3W6YA 3QW3A 5LGZA 4RXFA 1UUOA 2GUUA 1XC4A 3L0NA 4R7JA 3W87A 1GTEA 4HT3A 4GUHA 1H61A 5K7JA 4M6VA 4O17A 3SJ3A 5LNWA 1QPNA 3QQ0A 4O1CA 1EP1A 3MI2A 1BTMA 2Y88A 4JS3A 3G24A 1AW1A 2QCGA 1J5TA 3SGUA 4Y6GA 1DHPA 1XM3A 4IWWA 3B8DA 3G1XA 5HR6A 3UWZA 4NT0A 2X2GA 4S2BA 5CGQA 3W2KA 4IUOA 4MVAA 4KFOA 4PFMA 4K7YA 4C1LA 1TPVA 3CHVA 4L4MA 1B4KA 3LHYA 3LHVA 4J9JA 2NV1A 3TSBA 5K4XA 1MSSA 1XL9A 3QH2A 4DBDA 3GYEA 1DVJA 2J9XA 4D2JA 4HNUA 1TPDA 4DO6A 2DZSA 1DJNA 2ZRXA 2GPTA 4K7VA 1F74A 1GWJA 1QOQA 3NPXA 3MW7A 1EWEA 1QDSA 2J9YA 1JJKA 4CQ9A 3DI1A 3KVKA 1RD5A 3W7GA 4AF0A 4UUIA 3BLIA 5G2WA 4TMCA 3M44A 3FKRA 4IMDA 1ZJIA 1TV5A 2CZDA 3TV8A 2TMDA 4QNWA 3HPSA 1LBLA 5D02A 3IVSA 2WOQA 3W7QA 1KM3A 1NSJA 2YPIA 4PL1A 3S5ZA 3B0UX 3IVTA 1TPUA 3MP5A 2Q8LA 1MEWA 1W5NA 1KM5A 1Z44A 3LGEA 1H60A 3W1TA 4CNPA 1UB3A 4UFHA 2YR1A 2Z6JA 3C2EA 1ME7A 1OFOA 3W7DA 1H7OA 1OJXA 1IXOA 3L0GA 4N4QA 4JEQA 2EKCA 5AHLA 1KFJA 1KM0A 4O0KA 4H4IA 3TIMA 1HUVA 3KAOA 1XDMA 3OHIA 1JCLA 1OVDA 1A5SA 2WJZA 5K2ZA 2HS8A 1YDVA 3P8JA 3STCA 2RHGA 4ADTA 5MHBA 2GVLA 2PCQA 2DZUA 4Z0JA 2NWRA 1LOQA 1KFLA 2CZ5A 4XUGA 5LZLA 3MBFA 3DHFA 1CW2A 1G6CA 3O1NA 4IX2A 2QUTA 2HMCA 1KFKA 5HULA 3W1PA 4Z0SA 4ML9A 2EAWA 4GE8A 4EF8A 1SQ7A 5F1UA 1QCWA 2VEPA 1Q3NA 2WSYA 4LVDA 1NVMA 4O52A 4NNCA 2E77A 3HBLA 1THFD 5C55A 3EWYA 1W3IA 4AMAA 1W5MA 3DGRA 4KKXA 1J4EA 1OF8A 3C2FA 3R5EA 1LBFA 2X1SA 4NNBA 1ZENA 1L9WA 4Q32A 2B7NA 4MLJA 1FDZA 1G69A 3EX1A 2XFWA 4JY8A 2JK2A 3EX2A 4JYFA 4OBTA 5DELA 3W75A 2OJPA 3OVQA 2QDHA 4MIMA 3W7OA 3UQNA 5AYYA 2CLOA 3NL5A 1EEPA 1EP2A 1O95A 1ZALA 5G1TA 1WYIA 3C61A 3FA5A 4XQ6A 4ALDA 4YL2A 1K8ZA 3BW4A 2YCEA 1H1ZA 1KM2A 3I7RA 1GYNA 1N7KA 2BSLA 4LVFA 2DZWA 4RLIA 3W7PA 1MEIA 1ONRA 2ZA3A 2ISVA 4MUZA 3IGSA 1F73A 3W7CA 5CZJA 5H2ZA 4FX7A 3LCLA 3GKAA 3NZRA 4RX0A 4CLMA 4O1DA 5KTLA 3TMQA 4Y96A 3O15A 2YYTA 2JGQA 3DKJA 2FLIA 1DORA 3WJWA 3PVFA 1P5BA 4JX5A 3IIZA 1TPB1 4X9SA 3RF9A 3LHWA 2E5DA 4IXHA 3KVLA 3WK2A 5EBUA 5FEXA 4FB7A 1I2OA 2DP3A 1LRNA 3UY8A 5AC7A 2ZZ5A 4O11A 2QCMA 4E2BA 2A85A 3UWYA 3PS7A 3RFAA 4XBSA 1H62A 5AN7A 3FOKA 3W2JA 3M16A 3LI0A 4NJHA 3RMJA 4MLRA 1R30A 1VZWA 3P81A 4P2VA 4BWLC 5C54A 2QUVA 5DBTA 3W7JA 3NQ2A 3P74A 2OT1A 2C16A 1LROA 1OHLA 4LC8A 3HPZA 2ZRUA 3PSWA 4I7VA 3DFNA 4DBEA 1FCBA 1TV8A 3NNTA 3WK1A 1EIXA 4DXVA 2NWSA 3KRSA 3LCWA 3W2MA 3TNOA 1YXDA 2QDGA 4NXKA 3WK3A 2DZTA 4MFEA 3NM3A 2QCFA 5EYWA 1H7NA 4UMAA 4WXZA 3Q94A 1I2QA 2QR6A 5D32A 5I3FA 4FO4A 4Z1AA 3QFEA 5FF3A 1XBXA 1M6JA 3DFSA 3S1WA 3OIXA 4AB4A 2E6AA 1PHWA 4O4VA 5IM51 1TB3A 2Z6IA 3NG3A 2A7RA 3IV3A 4JYDA 2ABBA 1SFLA 3NL2A 4TR9A 3N73A 1AW2A 5E0KA 4YCOA 1GYLA 3TJXA 4XKYB 3G1AA 2O7SA 1W8SA 1ZCOA 4XTDA 5J5RA 2V81A 5D2YA 1DBTA 4Z08A 2DORA 1PCWA 3M7WA 1TQJA 3A5FA 3T78A 3TE9A 2VEMA 4LUJA 3UNDA 1I8JA 3S5YA 2VEIA 3MBDA 3TCEA 3LV5A 2I14A 1IXPA 1OK4A 3TXZA 1X6UA 1LOSA 2QJHA 3MP4A 1W5OA 3GDMA 2C18A 4RV8A 2YFNA 3MYOA 4GRSA 2GQ8A 3FYOA 4QJ1A 5CZSA 4N9DA 3DFTA 4FIQA 3TKFA 4HSOA 2QCDA 2FIQA 5C5YA 3B03A 3TAOA 2WSQA 3C2OA 1JULA 1AK5A 3QSTA 3QPZA 3QPYA 2J24A 2X30A 4NX5A 3B0VC 4UTWA 3P80A 4LRSA 3GR8A 4MZ8A 3O6CA 3W7NA 4LT9A 4O13A 2ALDA 5LNSA 3STGA 1Q45A 5AHIA 1FWNA 2Q3RA 3NPUA 1B57A 1FCVA 3LXBA 4JIQA 4EIVA 2ZZ6A 4QQ3A 3HQ1A 1T8XA 3N14A 5ABTA 3HG2A 1RQHA 3CC1A 2EPHA 1C8VA 3NYZA 3TFXA 4AAJA 5D03A 4JICA 3E96A 2C0AA 4O50A 2QCEA 2P10A 1G4EA 1MEHA 5BMXA 4WZHA 2XN1A 4A21A 3SZ8A 2BTMA 2ZZ4A 1GG1A 3SGZA 1K7FA 4NJGA 1ML1A 4MJZA 2CWNA 1R2TA 3MO7A 3GZ3A 4YWIA 2A1YA 3O6YX 1SFJA 1OFPA 3QM3A 4JTFA 4OWGA 1D3GA 3LRKA 2ZYFA 3L66A 5TBOA 3NAVA 2QKFA 1UBSA 1L6WA 2AQWA 4JD4A 4N02A 1KFEA 1QFEA 2WPBA 4LWWA 1Z48A 1KM4A 1DV7A 3G0XA 3N9SA 1Z42A 3NQGA 1G7VA 1GT8A 1TTPA 3Q2DA 3SIZA 3O8AA 3IGUA 3ZR4A 4WJEA 2FJKA 1O5XA 3L21A 2OCZA 1W37A 2H3BA 2PRLA 2ATSA 3V1PA 4BI5A 1SZNA 1EUNA 2CU0A 1OYAA 4ZQRA 3G1VA 2ATMA 1HO4A 2V82A 2CLHA 3W7MA 3UWQA 3R12A 2RDTA 3UPWA 2ZRYA 3GXNA 2QJGA 4LUIA 2FPTA 2YYUA 3PG9A 2VENA 5A5WA 1BEUA 1N55A 4RK8A 5EY5A 1LP6A 2ZFAA 1XUUA 4M7TA 4O28A 2OX1A 3QSRA 1WXJA 5BMWA 4M7SA 4Z1CA 2I9EA 3TDFA 3G1FA 1YDNA 5FEZA 1OYBA 3JRKA 1FWWA 3A22A 4YCPA 3S5OA 3HG3A 4WD0A 1X1ZA 3BG9A 1KM6A 4GNJA 3W70A 3M6YA 5I3HA 3NL3A 1VC4A 3PUOA 3MJYA 1WX0A 4O53A 3GNDA 5DXXA 3M41A 2A6NA 3W2UA 4O4WA 4LTSA 3BO9A 3PBYA 4UFKA 4O57A 4JX4A 2OMAA 4A29A 3T44A 4JYEA 4FIRA 1JQXA 2GVJA 2E6DA 1D9EA 2Z1BA 4FXRA 1CI1A 4UR7A 1ICQA 3DFOA 1SUXA 1U5JA 6ALDA 3QMSA 2R91A 1RQBA
chains in the Genus database with same CATH superfamily
2PC4A 4UMCA 2WC3A 4AD3A 4O10A 3ARRA 4DX3A 3ES8A 3QQ1A 4J28A 4DELA 2DZAA 3W84A 4BI6A 4REQA 3CAVA 1B31A 1VFTA 2FZ8A 1V6WA 4ILSA 1HL2A 1QASA 1Q7ZA 3TCSA 2FDMA 2VGGA 1XISA 4XAPA 3PANA 3B9EA 3VKBA 1BKSA 2E40A 3LXAA 1YTEA 3NQEA 5HWJA 1DIDA 3POCA 1FWFC 2OZ3A 2R1NA 2YDRA 1S5MA 4R53A 5D05A 4HMNA 3PBGA 1NF7A 5A8MA 3RR1A 1KBIA 4LALA 2O56A 4MZ1A 3MCOA 3FYPA 4Q7BA 3UEQA 3C8NA 1VGAA 4TV6A 5I77A 1VBHA 2AAMA 2FB3A 3K46A 1IIHA 5FJUA 4E3TA 1EYEA 1Q5MA 3DG6A 3THUA 4ICCX 4KEZA 1BYCA 1UP3A 4GQBA 4QLKA 4BQ4A 1M7XA 5DY3A 5AB3A 3AIUA 1E6XM 2YKKA 2XDFA 4WCJA 5I09A 1CXIA 1OZQA 1K7EA 4MWAC 3PC0A 4K39A 1B4EA 4N9CA 5C7VA 3CTLA 5EFFA 4UQCA 2FPVA 4B92A 3N4EA 5AKQA 1IGWA 3MCMA 2HVNA 1UG6A 4QAWA 1BXBA 1UMYA 4GKTA 4YTUA 4YVVA 1IEWA 2PU0A 5KINA 3THQA 4L5ZA 3D46A 1U1UA 4XAFA 1BSIA 2OELA 3BW3A 1NFBA 4AU0A 1BTCA 2WXDM 4Y9AA 3VKCA 4PCFA 4OT7A 1O5RA 5EL1A 1Y5VA 1XLCA 4F8XA 4FF7A 1E4IA 3SUVA 5EU9A 3TTQA 3E02A 3DDMA 4GQRA 4U31A 3UG4A 2Q71A 1XQKA 4WSHA 4G5DA 3AMDA 3S5SA 1CNVA 1NELA 2DT2A 3W3OA 2FHCA 1VFMA 4IHCA 5D30A 1HGWA 2WVUA 3GXTA 1QI4A 2ZXQA 1R47A 4O15A 2D0FA 1M65A 3LPGA 3G3DA 3TJLA 3GM8A 3PWGA 1EHAA 5A8QA 2PD5A 5T9BG 4L61A 2ZUMA 4J3VA 3HGOA 5LIUX 3K8MA 4JTAA 3BGJA 3MI3A 1W1VA 4DO7A 3WEMA 4Y9OA 1ZBVA 4ONVA 2QGYA 2AAAA 1A0CA 3CPUA 1DXEA 2YL5A 3OVRA 3R13A 3RAOA 3NSMA 1TPH1 4B4HA 1E0WA 1X1NA 4US6A 4S2CA 4FR1A 4Z1YA 1DWGM 2A0NA 2Y85A 1OFRA 5FA5A 1EJ7L 3K1GA 3N6JA 3UZZA 1A47A 4H00A 1Q6RA 1VPXA 1GQIA 3NVTA 2OU4A 2V8ZA 3RXZA 4UTJA 2F6UA 3CT7A 3MYPA 1CIUA 1A5NC 3RRAA 1E43A 3PULA 4UQAA 3L9CA 3ARPA 3M0JA 1FTXA 3WQFA 3EWBX 2VEKA 4M1RA 1R3VA 1CX9A 1JIBA 2W92A 1MDLA 4X3ZA 4Z1BA 3WDRA 1KLYA 2BX7A 3WFAA 4DJFA 3WLMA 3SSJA 3P0XA 2HISA 3TLLA 3BSHA 2CBIA 2JIEA 1OABA 4R33A 4QX4A 5AOUA 3PBVA 4W93A 4W7WA 2W79A 1RCQA 4I6VA 3AIQA 3F5JA 4A3HA 3NSNA 3ZWTA 3FY1A 3FJ6A 3B9OA 1PIFA 3ITYA 3ZJ7A 1U5HA 3ZSSA 4ORMA 4D71A 2YFOA 2RDUA 1CGUA 4NZ1A 4C6PA 3LNMA 5HUOA 3KVMA 1M04A 3Q45A 3A4XA 6ENLA 5KEZA 3TQPA 4Q8VA 3ZLGA 4WY0F 3ZOAA 4GJIA 4N9BA 1IEQA 2PP3A 5CSSA 3QLLA 2P0OA 4O54A 2Y4SA 2B4GA 3SAZA 2WMHA 3LN3A 1LQ0A 3W7HA 1MI3A 3H2NA 1XLFA 1K03A 1KLZA 4OUIA 1BQGA 3LV6A 2GOUA 3B0PA 3QZ6A 1AJ0A 2BXZA 4H2CA 3LX9A 5C7HA 2BHYA 4MKSA 4C1NB 1HVXA 7A3HA 4N6FA 5CG7A 4UR9A 4MF4A 3T0TA 5CSRA 4LV4A 3GB6A 4YPJA 3BJFA 3VZYA 3DU0A 1P0KA 3IK4A 1GKPA 1YTDA 6A3HA 2X40A 2Z28A 3K30A 5DY2A 2VCBA 2I16A 5AFDA 2PDIA 3WIJA 1TA3B 3VD7A 3L0KA 2ZC8A 5HNUA 4GYPA 4JY9A 1TSIA 1QWGA 1RBOB 3AYVA 4DB7A 1ICPA 1OFQA 5CPQA 3ES7A 1UUMA 2A7NA 4XD3A 3HQPA 4AZHA 2QUUA 3DECA 2IQ0A 3ZJ8A 1JNDA 2Y63A 1E9YB 3WD2A 4IPJA 3LXCA 3TOYA 2VKZG 1LLOA 2OB3A 1UWTA 3DC0A 3QYSA 1LUCB 3NXLA 3GSMA 5D38A 1GVIA 4P8XA 2WANA 3SUTA 1GVRA 4O0ZA 1W9UA 1CB7B 3WLIA 2QIIA 5G4WA 4LNCA 4L6OA 4OVXA 3T4WA 4HNVA 1NJJA 2FVMA 3TROA 4YVXA 2HXUA 1D7FA 1QBAA 3WD1A 1GKRA 4YU1A 5HMSA 5DCDA 3NL6A 4POCA 3TU9A 4HK5A 1IT0A 1EWDA 4I7UA 2VYOA 3I7SA 4CCDA 2V69A 1EDQA 2XYLA 4UNKA 4DAFA 5I5RA 1CB2A 1TVNA 2CZVA 1GJWA 4XD5A 4CQCA 4IPNB 8A3HA 2GQAA 2X42A 4LF2A 1GGOA 1NWSA 3KHJA 4H2HA 2NUWA 2E8ZA 1GHSA 4JNYA 3BLDA 3R0UA 3WLOA 2BLEA 3UBPC 5KSWA 5ABGA 3VVGA 4LCSA 3LGGA 5GNXA 2PF0A 1JXKA 4OV4A 3AYSA 1I0DA 2O0TA 3VOIA 4KFNA 1SU5A 2PDWA 3K4WA 1S2UA 3ANYA 3UR5A 3CV2A 2GL5A 4N6EA 1OCNA 3A4JA 1DQWA 4AXKA 3VCRA 1UR0A 1N8FA 5E09A 1O5KA 4Y2WA 3PSVA 4HOXA 3NR0A 4CN4A 4A8NA 2C19A 1E0VA 1F5ZA 2D2GA 4JTEA 1TO3A 2DY3A 4O18A 5BXTA 3EWWA 4XAZA 2W61A 3CLMA 1WV2A 1UKPA 5A8OA 4IQJA 1DTUA 3KXQA 1IZKA 1IR2A 4Y8FA 1KO0A 4HSHA 1S3HA 3T05A 1OINA 1HKVA 1E6PA 3G8RA 1IF2A 3B4UA 5LIYX 3ME3A 3EXSA 3GD6A 5JMUA 4BWLA 1V79A 2NX9A 2E28A 3WLLA 2C0HA 1X38A 3M46A 2V3DA 2DV0A 4R7OA 2G3NA 1T96A 2XGZA 1ZS2A 1VCGA 4C6OA 4GUIA 1QHPA 4CN6A 3C56A 4MNMA 3D5HA 3FEMA 2CW6A 2BB0A 1QBBA 3WQ4A 5LHEA 5CPNA 3N6QA 1DL3A 1ELSA 2VRQA 3AICA 1EZWA 4QDPA 5C9WA 1FOBA 1E9LA 1XIMA 5HINA 4YHGA 3M6DA 4XSMA 2QAPA 2IXUA 4M82A 1EQPA 1EF2A 2VJXA 4L7ZA 4XTIA 3VCNA 1EJRC 1VFUA 4JPGA 1RXOB 1A4MA 3O06A 5D8WA 5D09A 1R3RA 1CZ1A 1A50A 1R3TA 2BODX 3GFXA 1SW3A 4WKFA 1HP4A 2ZX9A 3TW9A 3NEVA 5F2MA 3EPNA 3WQ6A 1XRTA 1V03A 1W9PA 5TIMA 1KCLA 2WJFA 1DXIA 5LNVA 3KVJA 2NX1A 2CETA 2QF7A 3G1SA 2Y61A 3QKEA 4A3RA 3KS6A 1GTHA 4TXEA 1QO5A 2E6FA 4XZNX 5FEPA 2YIHA 4H9ZA 3D0CA 3KRUA 1EPVA 3KWSA 3S8HA 1P6WA 3IPWA 3NQVA 5D9OA 1AQ0A 3DAQA 4P5UA 4J3SA 1LG1A 1S2AA 2CHOA 2HROA 3CUFA 2YB4A 2REQB 1UZDA 4PUDA 2BZNA 2Z0IA 1B3YA 4OU1A 1F8IA 1H5YA 5F2LA 4ZA0A 3WZ0E 3AXXA 3L4VA 4JIRA 3CUHA 3ORWA 3CB8A 1QNSA 3P67A 4JNMA 2VC9A 2AQVA 1H11A 3L67A 1FCQA 1JPIA 2VDHA 1GVEA 4JCMA 1FH7A 2HJPA 3GR4A 2P50A 5LYRA 2R94A 1V3LA 3NTYA 4FNSA 3S6DA 3GC5A 3U48A 1EGZA 1PKYA 1NARA 2W9MA 1RY8A 4B5SA 4CU8A 1RBAA 1XF0A 4TVUA 1R2RA 3SI9A 3O05A 1GZGA 1D2KA 3QGKC 2OSYA 2GJXB 2O4MA 4U2YA 3KOWA 4GY7A 1YQ2A 4D1IA 1PPIA 1C29A 5SWUA 1TR1A 4OZOA 4RNIA 5CZ0A 5XIAA 4TUFA 1PV8A 4UFIA 5DN1A 4O1AA 3Q37A 3DHUA 4UTUA 2W91A 3FEQA 3C0SA 3WH7A 1JZ4A 2DUZA 4ML4A 1JCNA 2INZA 4A2SA 2Y2WA 1I75A 3BAWA 2J7CA 5CH9A 3N04A 3W1MA 2PWDA 1EJWC 1V3IA 3RR4A 4CNOA 4XZHA 2QCHA 5I3JA 4TOQA 4UTTC 3IACA 1RA0A 3KRZA 3G22A 3ITGA 2VZOA 2JGYA 3WX7A 3EX3A 4LS1A 2FQIA 3M7SA 1SSGA 4W87A 1HJWA 3FDGA 3MVIA 3T40A 5AHFA 2JKEA 4BQ3A 1RVGA 2E6YA 1NH6A 4K36A 4MKNA 1OK6A 2Y89A 3C3UA 3QZAA 2J7BA 5M03A 1KTCA 4MOZA 1HNYA 1YDYA 3PHAA 4GIYA 4DEFA 1YRRA 3BG3A 4UQ9A 1BLIA 1OEPA 5FF4A 4JR5A 3NQ6A 4M1BA 5A6BA 1UQZA 3UCCA 1CXLA 2Z7GA 4G7EB 4LAOA 4UOQA 4H04A 2E09A 2H8XA 2P0IA 3PJTA 3PZTA 4ZQOA 3UNTA 4D8ZA 3HOJA 1W54A 3C0JA 4M6PA 2CNCA 2TODA 1S2CA 1OC6A 3QR0A 1V7YA 2ACQA 1J0IA 3T55A 3TR9A 2YBTA 1K7XA 4UMBA 3PK7A 2XG9A 2J9ZA 1MXSA 2XIQA 4GQQA 4XZWA 1XIGA 2DEPA 1N8IA 1PDYA 4PMDA 4ZXOA 1RK6A 4DBUA 4S3AA 1EGMA 5CPMA 1DHKA 1FFRA 4GGHA 1X8FA 1VBRA 4US5D 1RALA 1A5MC 4H6KA 1J2BA 4QG8A 3NA8A 1J11A 1JCMP 4DJED 2EXOA 1IEIA 1W5QA 4C91A 4NSBA 1W2PA 2V30A 4XAGA 2RGLA 4E3VA 1LZOA 4HHMA 4QFUA 3QMRA 4JQ4A 4K68A 2CXEA 4GIEA 5HNTA 3IIVA 4KCTA 1V0LA 5U7SA 4QJ5B 2VFGA 5FSEC 2D0GA 2PLCA 1QMLA 4L4LA 3EA1A 1KCKA 3M0VA 4Q4PA 5EMYA 4CD5A 4J3ZA 4QRNA 1B3XA 2ZA1A 3QV7A 3URNA 2ZUSA 3WDPP 4DI9A 3H2CA 1OFEA 4HJWA 3E0LA 5FF2A 4I6KA 5HNRA 1VIZA 4GCAA 4FOJA 1ISYA 1Y0EA 3FIGA 1L6GA 1X8CA 1E6ZA 3PUDA 5PTDA 4MWAA 2PLJA 4CKQA 1AH4A 4O8RA 1KQYA 3TYUA 1TVPA 3H8AA 3R7MA 1DIOA 3KM8A 5C71A 3C2VA 3N15A 3N3TA 4W5UA 4EE9A 2J77A 4YMZA 1S1PA 3KFTA 3QZEA 5EB8A 2XZ9A 4F0RA 1RHCA 3W1AA 1E70M 1Z8AA 2DW6A 4M6UA 3RX2A 2Z4GA 3LMZA 2BY3A 3L5AA 3G8EA 4NZ3A 3RITA 1WOBA 4H8VA 4LQ1A 1S2WA 1WBJA 4Q7NA 4DM1A 4NAFA 4QISA 3C3NA 3C4UA 5DX7A 1U1JA 3F4DA 2QPXA 4UQBA 3KOZA 4JNZA 2VGBA 3STFA 4H83A 3ITLA 3KTCA 1A53A 5E1QA 2FDSA 4UQDA 5C9UA 3VD9A 2HXTA 3H53A 1WKDA 2J74A 1RK5A 1TZ7A 1PVNA 1WDWA 5HANA 1CGYA 1PSCA 3MKVA 1OBAA 3HG5A 3SUSA 1MRAA 1VEMA 3QW4B 1H7XA 1YLVA 4IL0A 5D9MA 5IRPA 4HKPA 3W72A 4NX0A 1YTKA 5LIXX 3CHDA 3DHDA 3W1QA 5DMLA 4Q4KA 4W5ZA 7TAAA 1FVPA 4Q33A 1XIFA 3RLVA 3QC0A 1GORA 1RLDA 4AC7C 2C6QA 4E2DA 4X0NA 3F1QA 1L2QA 4Q6JA 3VU2A 1RY0A 1XGEA 1JDFA 3O63A 1YMYA 3WSUA 2B81A 2GJNA 5C0QA 4DO5A 1FHVA 2H8ZA 4UTLA 1G4PA 5ABHA 1FBAA 4NJKA 4QEEA 4TVDA 3A23A 1PCKA 3EGJA 2WKJA 4M24A 1UYQA 4X2RA 2DJLA 2X1UA 3OQ8A 1UH2A 4KCVA 3ARTA 2V5LA 4E8DA 3NDYA 3LEPA 1OGSA 4W88A 1BSLA 3EKZA 3TTEA 1UMLA 5CLWA 2FYMA 3W24A 3BLKA 4XD4A 3VFLA 2BXYA 3W88A 3U7BA 5D8ZA 3FFSA 5J04A 2X09A 3L5LA 1OCBA 1EPXA 3OHMB 4K6AA 3O2LA 1DIKA 2D20A 3GAYA 1R46A 2PP0A 2IPGA 3B97A 4GO8A 4HNNA 3HURA 3C86A 5E0FA 5HPOA 2R14A 2LLEA 1FHLA 1O7AA 3QW3A 1XC4A 1SFTA 1GTEA 2POTA 4X0VA 4HT3A 3FSUA 5K7JA 2CWXA 3SJ3A 5I07A 3E0WA 5HOSA 1QPNA 4O1CA 3WO8A 3MI2A 3OO2A 3G24A 1J5TA 1XM3A 4IWWA 2DSVA 4IUOA 2VC5A 2CCRA 2JE8A 4HA1A 2VVNA 1B4KA 1JNEA 2NV1A 4IMAA 5K4XA 4CNTA 5FOOA 1IYXA 3QGVA 1TPDA 5REQB 3REQA 2GUBA 2GWNA 3CQHA 5GJPA 1AVAA 5IHSA 4JHMA 1GOQA 1GWJA 3MW7A 3R25A 1LG2A 3W7GA 4R3UA 4QE4A 4QS6A 1US3A 1TWZA 2TMDA 4OJYA 4D6GA 3AMLA 1OG6A 2QMKA 1KM3A 4GBDA 3S5ZA 1E40A 4AISA 1TPUA 8XIAA 4E2OA 2J66A 1W5NA 2ACSA 2CEQA 4HYVA 1LL4A 3WLHA 3BAXA 3BH4A 1ME7A 4WRHA 5H6HA 5B7ZA 3GRIA 4ASTA 2A3CA 1H7OA 1O1ZA 2OGYA 4GVGA 4RE2A 5AHLA 1V02E 2DZBA 5HMEA 3N18A 3EB4A 5H8UA 3U5YA 1FP8A 3TONA 4S3FA 4HK6A 5T91A 3K8LA 2YCKX 1JCLA 2WJZA 2R82A 2VM8A 3P8JA 3M0YA 3BCJA 4ADTA 5MHBA 3PPCA 1Z3NA 2PCQA 4C7DA 4QEHA 2G3JA 2DSKA 4X63A 4L65A 1CW2A 2DT1A 4G8TA 4P7OA 3SCTA 1BYAA 1KFKA 5HULA 4QDWA 3W1PA 3NZQA 3HN3A 5F1UA 1WZLA 3KL3A 4GINA 2XVKA 1R5YA 1W3IA 2ZX8A 1W5MA 4KKXA 1OF8A 1XLEA 4UCFA 1LBFA 2X1SA 1KXHA 3N17A 1J0HA 3ZR6A 1G69A 2XFWA 4A8LA 2PF8A 3AS0A 3TTYA 3EX2A 4JYFA 3XISA 3W75A 1Y65A 5E6ZA 4C6BA 3AHYA 3NL5A 2WLYA 1E73M 2YCEA 3I7RA 1GYNA 1AQMA 1ITUA 1KGWA 2FGZA 1DJHA 1QATA 3A9BA 3NUKA 4GZ7A 1N2VA 4WGHA 3MU7A 1A5OC 3IGSA 2WMGA 1E0XA 2V3FA 3LCLA 3PN8A 1UC4A 4GKLA 5KTLA 2PFHA 2YYTA 2JGQA 3NVDA 1DORA 3MUZ1 2ZVRA 2E5DA 4PTDA 4R5EA 2WZIA 3KVLA 3PPGA 3U0HA 4MKVA 3T0BA 1P7TA 5FEXA 3QHOA 3E2RA 1I2OA 3ZVHB 4H6QA 5AC7A 4E2BA 4CCZA 2YXOA 2PDMA 1JD9A 4B5VA 1YX1A 2VX6A 3W2JA 3M16A 4H8NA 3BANA 3LI0A 2PP1A 4MLRA 3R94A 3WLNA 4AX7A 1JF5A 3W7JA 4Q8NA 4H9UA 1OHLA 5FIPA 3ABZA 2EPKX 5E5CA 3AROA 3A64A 3L12A 4B5WA 4HTBA 4ENLA 3LD5A 4CU6A 2E3ZA 3W2MA 5HBFA 3IUHA 3FAWA 5A6MA 4NXKA 4DWSB 2DZTA 4NL1A 2E8YA 5EYWA 1OD0A 4H41A 2QR6A 3AI0A 3SN4A 2IKIA 5DEZA 4FO4A 3ZM8A 1XBXA 1M6JA 4JFSA 1GOWA 1VIWA 3DFSA 3ZR5A 3OIXA 2E6AA 3OVGA 3RIKA 1TKKA 3RPMA 4C6JA 1TB3A 2Z6IA 3NG3A 2A7RA 3CJPA 3N2OA 2VRKA 3QV9A 5HQMA 2BHZA 3TJXA 2JQXA 4LB4A 2D3LA 1O1HA 4Z08A 1PCWA 1FWEC 3RLHA 3UA4A 1Q4WA 3ITXA 5LIKX 3T2OA 2VEMA 4LYKA 2BP1A 4LUJA 1ZBKA 1I8JA 3I3DA 4GVFA 3S5YA 4M80A 4IIEA 4EAMA 3WFLA 4UOZA 2WWCA 4DUVA 1ZBCA 1IXPA 3GNXA 3TXZA 3DESA 2QJHA 1W5OA 3D47A 2PTZA 4S3KA 1O6IA 1KXVA 4ZEPA 3PTKA 4GVHA 1NP0A 3FYOA 1EC7A 1M41A 3NGFA 1FWDC 3MANA 3ZZ1A 4N9DA 1C7SA 3GFYA 4Q4SA 1MWOA 1AUSL 2BDQA 2QCDA 3CHCA 3G2GA 3B03A 1OGBA 5LA1A 5D9PA 1AK5A 3V1HA 3B0VC 1JZ6A 3P80A 4MZ8A 4AY8A 3O6CA 3W7NA 5LNSA 2OZ8A 2VVSA 3STGA 2QPSA 1FWNA 3NPUA 1B57A 4CVWA 2GGGA 3OOQA 1UPPA 3A4WA 1MDRA 3WDQA 2WAGA 2I17A 3UR2A 2VD9A 1V3JA 5D03A 5GQBA 3VIHA 2MANA 4KESA 3CYJA 4NHVA 3R79A 3KDOA 1HKJA 3VNZA 4HZ8A 2XTKA 3UG5A 1TJ1A 2FMNA 1GG1A 5AVHA 2Y5JA 2CWNA 1R2TA 3MO7A 1REQB 1SFJA 2Y5SA 1DE6A 2DQWA 4MG4A 3LPFA 4CVUA 4GC3A 3T81A 4JIIX 3RYSA 3EWCA 1ZP3A 5A2CA 2AQWA 4N02A 2HE5A 5IFTA 2XHYA 2VOTA 4LWWA 1W6TA 1GQLA 1MUWA 2XH7A 3NQGA 4B5XA 4IM4A 3AZRA 3O8AA 3IGUA 3ZR4A 4WKHA 1W37A 3H7RA 3V1PA 2GDVA 2CU0A 1OYAA 4ZQRA 3PAOA 2ATMA 3UG3A 1HO4A 5XINA 1TR9A 3W02A 2CLHA 2VGFA 3MMUA 1NIUA 2WMIA 1K6AA 4FLRA 3TWAA 2OGJA 4LUIA 4BF5A 2V6AA 3WUEA 1V08A 1BEUA 1XUUA 2NVCA 3BWWA 4M7TA 2J13A 3QSRA 1HVQA 2EBNA 2I9EA 3GFZA 3V35A 4AD2A 1OYBA 3SGGA 2FVLA 1X1ZA 3BSMA 1CTNA 2EG7A 1IZJA 2IKHA 3UJFA 5I3HA 1B0IA 2JFEX 4IFRA 4KETA 1DWAM 4FXJA 3PUOA 1CXHA 2GJRA 1WX0A 4O53A 1BWVA 3BO9A 4C6EA 1HKIA 1AFSA 3BAIA 1V6VA 4UFKA 3AYTA 4O57A 3GG7A 1WXZA 2I5QA 4PB4A 1NY1A 2OMAA 3BXWA 4FIRA 5CC6A 4LYQA 2GVJA 2E6DA 2PZ0A 3UW6A 4D6FA 2Z1BA 2PTDA 4UR7A 1ICQA 1U5JA 6ALDA 1B3VA 1MFUA 1XDJA 3PZGA 1ME9A 1C8QA 1Q63A 4E8GA 3M5ZA 3H22A 1R86A 1VS1A 4MAVA 3GLCA 3UJ2A 4TTUA 2Z27A 1MZRA 3LHUA 1ME8A 3VI2A 2J62A 2OFJA 2MUCA 4CQBA 1JDDA 2WCGA 2WVVB 4B3LA 1K9FA 5FD0A 1F3TA 5A2AA 3F2BA 4LY8A 3TUUA 4B5NA 5I79A 3CB3A 2Y1HA 3DX5A 1H1YA 3II1A 7REQB 1E1FA 4WJ8A 4ZO9A 2H6RA 1NDZA 1CGVA 4AWSA 3BSGA 4ZQMA 4IX0A 3JVAA 3BPWA 3VX1A 1P4CA 5C2GA 1JDAA 3SM0A 3GTXA 1TYGA 2JKAA 3WQCA 1OQFA 4RZ4A 3NQCA 1NP2A 3AC0A 4Z42C 3WDJA 5CJNA 1E4NA 5A6SA 4D8LA 4ATLA 4LUSB 3STEA 4PA8A 2OVLA 3VC6A 1TJPA 3EMCA 1XYZA 1W9VA 4C5ZA 2A3BA 4R85A 4C7GA 2VFEA 4NYUA 3U4AA 4M81A 5FL1A 2JF6A 1F6KA 2D3NA 5RUBA 1OX6A 3CUJA 1UD4A 4S3GA 2HS6A 2WCAA 4GI8A 3MCNA 3H2AA 2CXGA 3UETA 1BRLA 4FZIA 3RLGA 3I4KA 4AIUA 5JBEA 4N7QA 3R6IA 3VMOA 4JTLA 4M29A 4W84A 3L2LA 3S42A 2R1KA 2PWUA 3W00A 4FP1A 3LTYA 5DXYA 1IEVA 3H23A 2PDXA 5J5DA 1QT1A 1GCYA 2ZDSA 1XRSA 4LJ3A 4FNTA 2FFIA 3S1VA 3JUGA 1QTWA 4KRUA 3UZXA 3PWIA 1RBLA 3ITTA 1M53A 4JBRA 2IQTA 5DMMA 4HPNA 2FHBA 4ATDA 5BWAA 1S5WA 3UYIA 3LCGA 4B16A 3V16A 1KCZA 1XYFA 3KWXA 3W7IA 2X16A 4HSNA 4E4UA 4C6MA 3BV4A 3WNOA 3UA3A 4GZJA 4YN5A 1YIXA 1Q6QA 4CNNA 1PWMA 3OBAA 1XHGA 6XIAA 2G37A 3W1NA 3W7RA 5T9CE 4FF5A 2CZFA 3QF0A 4MY9A 3GHSA 3SCUA 3VUSA 5JQ9A 3VIPA 5ABEA 3TZFA 3QHMA 1KRCC 2AKMA 2X8RA 3L4ZA 1ZTVA 3V0TA 4IPLA 1TMLA 4XZIA 4MMWA 3QV6A 2VO5A 1FCUA 5CC3A 2INEA 4A35A 1ADOA 2PTXA 1ICSA 1F6YA 3QOKA 5AC6A 3VCCA 4IP4A 1XG4A 2YW4A 3IJQA 1M5WA 2F7FA 3CH9A 2WKGA 4DLMA 1RZMA 2PAJA 1X1OA 2VURA 4LRTA 3POHA 4B90A 2ZX6A 3UR7A 3BV7A 3L4YA 1KNWA 3F4WA 2OEJA 4MGGA 1YE4A 1QAPA 3I6EA 1K8YA 2D2OA 1C9DA 6REQA 1ZFJA 4ZQNA 5A3HA 1W1TA 1WZKA 2W6RA 2WWDA 3DBNA 2DSUA 3NJ3A 3K4AA 1E0TA 1NDVA 1W56A 1MUMA 3RU6A 5BU6A 1PZ0A 4GQ0A 1V4YA 3G5EA 3LLFA 1JYVA 1UR8A 2FPYA 1E15A 3M43A 5M3WA 2Y7FA 4P7QA 4D72A 4O16A 4J3WA 2BVTA 5D2TA 1UKSA 1KR0A 5LSMA 1IV8A 3B05A 4C1KA 1W3LA 1R7AA 5MKGB 3QJAA 4WDTA 1TE1A 3G0UA 1R3WA 3MUY1 3ERPA 5FL0A 1BKHA 1JYNA 2XINA 2G41A 1VRXA 1QNRA 3VC5A 2FZDA 2Z1KA 2C7FA 3LBOA 2GFTA 4FLSA 1CBGA 1VYPX 3KP1A 4DJEA 4XKMA 3LA4A 2TYSA 5AHEA 1RJRA 3WBXA 3O3RA 5HK4A 3W7EA 1DE5A 4PTNA 1SSDA 4MJMA 3HIJA 5IDIA 2Z2UA 3M0MA 3PJWA 4RE0A 3LBCA 1Q6EA 3VM7A 2WQDA 3W0KA 5AYIA 4V1YA 2H9AA 1WCGA 3PBUA 3VD3A 1Q7MA 5DQPA 1XIHA 3W1LA 4GNKB 3MHFA 1GOKA 3QVQA 3OZOA 3VPLA 3URAA 2CYGA 2NUXA 4PN2A 1E72M 3GH4A 4GK8A 2PE4A 3U2OA 1XRVA 2P3ZA 3T8QA 2ZUWA 5BZAA 3BLEA 4O14A 4ZE5A 2XSBA 2QF8A 1HP5A 2DVTA 3HMJG 5EPDA 1U1HA 2ZTKA 3O6DA 4U2ZA 4MNKA 4L1WA 3W85A 1KQZA 1OX5A 3KZSA 1XYBA 1QK2A 2FH8A 2I9UA 5IBXA 3ZSTA 4E6MA 1RCOB 4Z2KA 2OWWA 3FGCB 1HF6A 4JZ5A 1EHNA 3CPRA 4X61A 2RFGA 3PB0A 2G0WA 3WLQA 1MXGA 4NG3A 2QGHA 4H7ZA 3EWZA 1KV8A 4XWUA 1SJCA 5E93A 5CJMA 1XH0A 1UZ1A 4RCXA 2DDXA 2DUAA 3WJSA 3FJLA 3WYZA 3P5YA 4C60A 3IARA 3KBMA 1H09A 2PURA 3A12A 4FX6M 2OLSA 4DPPA 1XLLA 3A13A 3SQLA 3KOXA 4AZCA 1DEDA 3W4RA 2NV2A 4N4PA 4G56A 2IPJA 2ACRA 2OQLA 4WSKA 3SN1A 3BMWA 3GXPA 2VTFA 4GD0A 1BXNA 4WY0A 4KS0A 4P61A 3FSTA 1PZ2A 1ZJBA 2Y62A 3PUEA 2AL1A 3AU6A 1VYSX 5BRQA 2ZE3A 3ABOA 1H7RA 2J88A 4Y8EA 3QYQA 1LM1A 5D33A 3ECQA 4QHRA 3UF9A 2WZMA 5HJXA 2Q02A 3TTSA 1QI5A 3F7JA 1JFXA 2VFIA 3L23A 3P82A 4QR6A 4O12A 4ERGA 3IIOA 1OG0A 1DQUA 3P3BA 2V0TA 1SO3A 1TFVA 3VZZA 2YBVA 3GIQA 3S6OA 4F0SA 4GZEA 1U33A 1K9TA 5E9AA 3ARXA 1F05A 4NUWA 1VFFA 2EF9A 3MY9A 3QR3A 3OQEA 2ICSA 3WJZA 3S0CA 1C8YA 1CGTA 1DJYA 2GZXA 3GDRA 3HA1A 4IP5A 3BCDA 1S2TA 4BA0A 3GW0A 1CXEA 1AG1O 3KCJA 1AQHA 1FHUA 1H7WA 3MO4A 4DJFC 4U3CA 3SRDA 3QMTA 3ICJA 1W9XA 2IPWA 2I7GA 3TFCA 1QR7A 4CGTA 1J96A 2GLKA 5LNRA 1LDCA 1WP6A 2PI6A 2OOFA 4PL2A 2BGSA 1XSKA 4MSSA 2W0UA 1F76A 3C2RA 4P7LA 4FNQA 2WW5A 2BASA 3RDKA 1ONWA 4AWUA 1H63A 4PTXA 6TAAA 2HV5A 1LWJA 1FRBA 3GR7A 4IFKA 1W3TA 3P60A 5BRBA 3W74A 2EPNA 1SZEA 1W1ZA 4BF9A 1OIMA 3OZPA 5AHMA 3ZT7A 3VMNA 3V0SA 3OB8A 3VNJA 4E5TA 3LS9A 4D6JA 1Y8BA 3B0YA 3ZFHA 3VGEA 3ZT6A 1AL7A 3N11A 3TXVA 5CC7A 4LYPA 4ZE4A 3M47A 3FA3A 3WLSA 1XH1A 4LAMA 1XIEA 3WQGA 2OKOA 1W0MA 4CUCA 4REQB 4NNAA 2UY4A 4JN7A 4IIGA 4UFMA 2OWCA 1Z89A 4Z2IA 3H4GA 2ZRWA 4S3JA 4XSLA 4RPQA 2B7QA 3HV8A 3KOYA 3R11A 1KC7A 4O1BA 3VOFA 3EAUA 1W8GA 3VE7A 3TW6A 2Z29A 3FJNA 1TRDA 1H51A 3BK0A 1PIIA 1W1B1 3IJDA 1O12A 1LRTA 3V4BA 1SW7A 4RXGA 3VOHA 1K8XA 1NWRA 3U9IA 3CNYA 1JPHA 4QS5A 4AIBA 3USBA 4IMFA 3OJGA 3ABQA 2UZ9A 1DYSA 1FDYA 4LC6A 3FK4A 4C6LA 4RL3A 4GVIA 4KPLA 4GYPC 2NUYA 1HGYA 1SW0A 1I2RA 4UTWC 3VIOA 3MDUA 1HJSA 4XD6A 2OG9A 2QHAA 3TN5A 3NOEA 4JN8A 3VINA 1ZNNA 3U57A 4HMEA 1PWLA 3OPSA 4PMQA 4HU8A 3C0QA 2GK1A 2PDNA 3FVMA 3TC6A 3H54A 1ZUAX 3UJEA 1AQFA 3FNDA 3KEHA 4EPEC 3DG3A 3LYEA 1YBQA 3LTSA 2HWGA 3VNIA 3EKGA 4TO8A 2Q09A 1XGZA 2BBFA 2ZA2A 1SO4A 3K1DA 4HMDA 2VCAA 2YA1A 2FVKA 5C6MA 4IQDA 2BWGA 3P93A 3WF0A 3LHZA 1JPMA 3E0FA 1L6YA 3TYAA 4GJJA 1PYMA 2Q8ZA 3CAQA 4ICNA 3PZQA 5FESA 2PWGA 2W62A 4UIOA 3PBMA 1ZAJA 2NV9A 1FWCC 2C13A 3D6NA 3RMEA 3YPIA 4J3XA 2NX3A 3H24A 4L4PA 1FDJA 4AHPA 2WJEA 4HK7A 2WO5A 1JRBA 4MPQA 1TQXA 3CUIA 1AODA 5IDZA 4RZBA 2P8CA 3M0HA 1IT7A 9RUBA 3W1RA 4G7EA 1EC9A 1XI3A 3MUCA 3T2QA 4L1XA 1ZZMA 4UFJA 4WK9A 1EA0A 3A24A 2NVDA 1MYRA 2HE8A 5KMYA 2Q6ZA 3NDZA 5EBAA 2FKPA 1FWSA 3R10A 4CD7A 4U10A 1MZHA 3D3AA 2PDJA 2PRMA 1XFBA 4NF7A 3APGA 1EDTA 1EX5A 3SCPA 5DCEA 4PCSA 1F9CA 3S46A 3QFWA 1QUMA 3VTRA 2BXVA 2VOMA 1FWRA 1UWIA 2RKXA 4HMCA 3IEBA 4GWEA 4PUUA 3W07A 5AC5A 5D2VA 1EO7A 4NZJA 2C1HA 2NXGA 1TPEA 3KDNA 4M8UA 3C6CA 3DBPA 2HPMA 3LCHA 3AALA 3CZEA 1EJVC 2XIMA 4MWAE 3BJTA 4H19A 4U4MA 4LUYA 3WEZA 2ZXAA 3E2SA 1RQEA 4NAEA 4H9TA 5FAJA 3OW1A 5I02A 1TG7A 1T99A 3DKLA 1S3TC 2I56A 4LB3A 2ZZ7A 2GSEA 2NQ9A 1UIPA 3NQ7A 4KT2A 4LVBA 3GNRA 4H9MA 5I3GA 2IKJA 4J3UA 2C79A 4R7WA 2VP8A 1SJAA 2WNZA 1A5CA 3AQUA 4WX2A 3T09A 1LLWA 1ZY9A 3V5OA 5E70A 4ZO6A 3EA3A 4MY8A 2PDKA 3E2QA 3EYPA 4JKKA 1FWGC 2G3FA 5EMUA 5HAOA 4JCLA 1OT1A 1WAUA 4C6KA 3AYRA 2BMBA 5I6SA 3MUIA 2DVUA 4KGLA 3RU8X 3UR8A 3DFYA 2X1RA 1EX1A 1NWUA 2XFYA 2L5HA 3LM7A 3SUWA 5BXPA 1SGJA 2Q3OA 2QEZA 3B8VA 2VWTA 4JQ1A 3AIBA 5DCBA 2GUYA 1EUAA 2YSWA 3GC4A 2AKZA 1MUCA 2ZRVA 1F2JA 1ZRQA 4JKMA 3GDKA 4W86A 2GJLA 1FWTA 2A5HA 4WVXA 3PUGA 4ZSTA 3UWWA 4PE8A 3IVUA 5DBUA 1P43A 2D69A 2VFFA 4DZIA 1BF2A 3ATZA 3GTFA 1O4UA 1WAWA 4DNMA 2ZUNA 4PUNA 4XK2A 3CQIA 1GZJA 1TTQA 2QYGA 2XWEA 3B3DA 4TIMA 1KTBA 3F4CA 4N0RA 5H8PA 1J0JA 1XBYA 3W23A 1DP0A 4HHPA 1YADA 4M19A 1QXLA 1WNOA 1KGXA 3SO7A 5KZMA 4E8CA 2YLAA 2ASHA 3UZWA 4ZOCA 3DG7A 1P0DA 3TSDA 1UWAA 2Z2BA 4UNLA 4I5UA 5L9FA 3EMQA 2ZZ1A 3CZJA 1EYWA 1XSJA 3C0LA 2GGHA 1ODUA 3CZKA 5GNYA 4IFOA 1UQYA 2OXNA 3ATYA 4LANA 2EHHA 3W7KA 3VKJA 3WUBA 3CIWA 1YXCA 3BQ6A 4HCDA 3OG2A 1KBBA 4J5NA 2ANUA 1NQ6A 1X6NA 3ONBA 4BY3A 2G5WA 3AXKA 4ZOBA 1UC5A 2ZVIA 2E7FA 1A0DA 3KBJA 2O9PA 3V7PA 4IJCA 2DQXA 3W71A 2ABAA 4QJ4B 2Y7EA 4F66A 2VELA 1XW8A 1G0CA 4IGHA 3BLFA 2XGIA 1M3UA 3S1UA 3T0DA 4QAIA 3R4IA 1G4TA 4UTMA 4FNUA 1B3OA 3PM6A 1BWKA 4MB3A 3W1XA 3V75A 4LF1A 2J6XA 3H6OA 3LENA 2ZCGA 1Q4NX 3AAMA 3NZGA 2OO6A 3MS8A 1QW9A 3WD0A 1Q2RA 1AW5A 2J78A 1XYCA 2X2YA 3WUFA 4GYFA 3GH7A 4HNLA 3UXDA 4ECLA 4KWWA 3UZ5A 4FNPA 3P84A 1KR1A 2NVAA 1M03A 2ZWYA 2F61A 4JDBA 2Z1SA 3WCZA 1JYWA 3BAKA 1M68A 1YW1A 1XKYA 3MTWA 4UBPC 1N82A 3MI6A 3W37A 5G2HA 1G9HA 4QE1A 1VRDA 2OQYA 4W9TA 2Y7GA 1ZPTA 4KIRA 3W6YA 1X39A 4F79A 2X0SA 1TV2A 2F8QA 2GUUA 4JFTA 4R7JA 4EKJA 1H61A 4M6VA 4O17A 5LNWA 1R3YA 3VNKA 2NT0A 1XCXA 2Y88A 2OSWA 4TTGA 4ACZA 2OTDA 1AW1A 3SGUA 2VZSA 4Y6GA 3KZPA 3TVAA 3B8DA 3BZGA 1DJWA 5HR6A 3UWZA 4NT0A 3D3FA 4S2BA 1OIFA 1UH3A 3UFYA 2NSOA 4K7YA 1HZYA 3IJ7A 4J9JA 3BICA 3TSBA 1MSSA 3GQYA 1E4MM 3FV9A 2PDGA 4DBDA 1DVJA 4LY4A 3AXIA 4HNUA 1DJNA 4ICMA 2ZRXA 4ZGYA 3OGVA 4PRRA 4JQ2A 4NRRA 3MSGA 4M51A 3H7UA 1L8NA 4Q4QA 4S38A 1NTHA 3DI1A 4DZHA 4LAUA 4PBGA 4AF0A 2CESA 4V33A 4UUIA 5A69A 4IPPA 3VILA 1E55A 1ZJIA 4F9JA 1HJUA 1DWFM 3N2TA 3HPSA 1LBLA 2XVGA 5AECA 3W7QA 1HT6A 1NSJA 5DT7A 3B0UX 3IVTA 3MP5A 1Z44A 1KM5A 5G1MA 3QTGA 4BQ2A 4LEQA 3WF4A 3KBNA 1UB3A 4UFHA 2YR1A 2Z6JA 3C2EA 4H8HA 4HCLA 2GVYA 4NY2A 3KCLA 1JAEA 1WXYA 2YCLA 1EJUC 3L0GA 3ITOA 4GYKA 2YXXA 4GMEA 4O0KA 3SDOA 3W26A 4HZMA 4D6HA 3JZEA 5I23A 3WMLA 5K2ZA 2XH0A 4YVPA 2RHGA 2QNEA 2GVLA 1KBLA 2FZMA 1NFGA 2CZ5A 3EB3A 2VX4A 4XUGA 3DHFA 1HXJA 3O1NA 3SUUA 5B7YA 2WPGA 1BG4A 3G6LA 4IQEA 3CLWA 2WSYA 4LVDA 1NVMA 2Z7KA 1POKA 1XPYA 4AMAA 1J4EA 3C2FA 3R0DA 3R5EA 4Q32A 4MLJA 3EX1A 3W01A 4JY8A 1H0GA 3F4VA 4WSJA 5HMFA 4W8BA 2OJPA 3OVQA 4MIMA 3W7OA 3UQNA 2DUXA 5AYYA 1NOUA 4ACYA 5M2FX 1KFWA 4PSPA 5G1TA 3FA5A 2BHUA 4XQ6A 4XB3A 4PSRA 2BOGX 5A1AA 3W25A 1P48A 3MKKA 4KWSA 4BCEA 5TF0A 1N7KA 1PKNA 1GJUA 3SCQA 2BSLA 4ZFMA 4LVFA 3W7PA 1MEIA 2ZA3A 2ISVA 4MUZA 1H5VA 3W7CA 4EPKA 4FX7A 2D22A 3NZRA 4RX0A 1EC8A 3HU7A 3N13A 3NIYA 1T40A 4IISA 2YCIX 4HPHA 3IIZA 3GC2A 4PCPA 3RF9A 4IXHA 4O8AA 4X2PA 2E25A 2CBVA 3N1AA 1JI2A 2WC7A 3UY8A 4GCXA 4O11A 2QCMA 2A85A 3UWYA 3RFAA 3QY7A 3T1GA 1H62A 5AN7A 1B30A 3VAVA 5A6LA 3LQGA 3RCMA 4GI9A 3ZMRA 1R30A 2A3AA 3P81A 3BMXA 1FHDA 4P2VA 3PZUA 3GW3A 2JALA 5DBTA 3DHPA 4P8UA 4Q8OA 4I3GA 4UZSA 1LROA 2WBKA 1H49A 2WB5A 3E3HA 2ZRUA 4QCFA 3PSWA 3GTIA 4V1XA 4MM1A 1FCBA 4DUOA 3NNTA 1Q8JA 3WK1A 4GFIA 5EFDA 4DXVA 5A6KA 3VNLA 2NQLA 4V28A 2QDGA 1FKWA 3QLDA 2CITA 1PBGA 4PMZA 4MUPA 3Q94A 4C6FA 2XSXA 4S23A 2NLYA 3QFEA 3BCFA 1SZRA 1YKWA 3OZYA 2FTWA 1PDZA 2ZXBA 4AB4A 1DIEA 3WDHA 1JL8A 2EJ1A 5IM51 4UTFA 3MA8A 3FW6A 3B8TA 2ACUA 3IV3A 2ABBA 1A5UA 4TR9A 1JZ5A 1AW2A 4YCOA 1GYLA 3K5XA 1SMAA 4BS0A 1W8SA 4Z2JA 4GX9A 1DBTA 4PRTA 2VMFA 3T9PA 2JIWA 1TQJA 4JFWA 4NILA 4P7NA 1JZ7A 1A80A 4BHYA 4L56A 2BNJA 2VEIA 3MBDA 4JKLA 1EFZA 2I14A 2E0PA 1OK4A 4PMXA 2XIOA 1LOSA 3MP4A 2C18A 2QV4A 1WKEA 3ABXA 2IPFA 4QJ1A 1IEXA 3V5FA 2ON3A 3GDBA 1MVYA 1XP3A 3DFTA 3VOCA 2BS9A 3UXKA 4CD4A 4HSOA 2FIQA 4Q8TA 4TX6A 1JULA 4P8WA 3SY1A 3QSTA 1T7LA 2J24A 2X30A 4UTWA 5J8LA 5G4HC 3MUAA 3GR8A 3IS4A 3IWPA 4O13A 1XQLA 1GW1A 2YA0A 2ALDA 4NP7A 1JAKA 4Y7EA 5AHIA 3CAWA 1UP2A 3HM7A 2INFA 2Q3RA 3GU9A 4EIVA 3TC3A 1QNOA 4E4FA 1YNYA 2D24A 4HGXA 4B5TA 4MWAB 5ABTA 4WR3A 1RQHA 3CC1A 2EPHA 1C8VA 4ZO7A 3OYXA 3CPGA 5I00A 2YZ5A 4JICA 3E96A 2C0AA 2P10A 2VX5A 4HNCA 1Q8AA 1MEHA 4A21A 5E9XA 1S46A 3SZ8A 3CMFA 1GUVA 3SGZA 1UKTA 1XYLA 4NJGA 1ML1A 4YWIA 4DUWA 3O6YX 1XH2A 1OFPA 1JZ2A 4AZIA 2PGRA 3L66A 4NAFB 2QKFA 1UBSA 1WKYA 2EG8A 4JD4A 1QFEA 1VKFA 5KZ6A 3CQKA 2F9RA 1KM4A 1F4AA 2DIKA 1SFSA 4PZVA 1G7VA 1E3XA 1GT8A 1KRBC 3J7HA 5GJNA 2FJKA 2OCZA 1FP9A 3QPEA 2H3BA 1UR4A 1U30A 1QU4A 2A3EA 2V68A 4UZUA 1ISXA 3CV1A 2V82A 3W7MA 2XIIA 3FX4A 3UWQA 5A2BA 2RDTA 3UPWA 2UBPC 2IMRA 3GXNA 4K1WA 4ZODA 1P6BA 4RW5A 2PLMA 1RH9A 2YYUA 2VENA 4KWUA 4XIAA 1LP6A 2AMGA 3PZVA 2OX1A 1CCWB 3AZSA 1FFQA 3SSZA 4M7SA 3G1FA 2W66A 3JRKA 3A22A 3GBEA 3E38A 3S5OA 3OIHA 1KM6A 4GNJA 4J27A 2Z2AA 1NDWA 1VC4A 1UKOA 1GW9A 1XFCA 1EEXA 4JL2A 3FAXA 5CGTA 3P0WA 4LUTA 3M41A 2EG6A 4LTSA 2QJMA 2GDUA 2QS8A 4HU0A 1E6QM 5C9XA 1RLCL 3EMZA 3T44A 4JYEA 4PULA 3CL6A 4S3CA 1FKXA 2OOGA 2G50A 5EGRA 4ZBCA 2DIEA 3H70A 2Y6ZA 1DJZA 4GIRA 5DRIA 2BVYA 1V8EA 4U5IA 4GACA 4JTHA 3OG3A 4FX8A 4CQAA 3TNBA 3UU0A 1J8VA 3LOTA 4EK7A 3OLGA 4NVTA 2O9RA 4I9JA 3WD3A 1TV7A 2RDWA 3M1ZA 3JW7A 3PR2A 1ZLPA 2OSXA 4F0LA 2V67A 5CJ5A 3COTA 1OYCA 3W2LA 1VLWA 3U2CA 1WZAA 5CAKA 4DM2A 3VMPA 4WDWA 2A21A 2KZHA 4YLWA 2V2HA 4WDUA 3OBKA 1UD3A 3SRFA 2ZUUA 3TN3A 3BOLA 1XIBA 1M7OA 4JTTA 3NXFA 7TIMA 3CHFA 1WZMA 4Q8PA 5I3KA 1K70A 4MNLA 4YJ5A 3IGHX 4NXSA 3ALGA 2SFPA 5CKSA 3EA2A 1RCXB 1OCJA 4PTVA 3WLRA 3S5NA 1EA9C 4UTIA 1ONXA 5DRCA 1PE1A 2NSXA 5ECVA 2P1FA 2V5BA 3SB0A 4AXNA 3VD5A 4QITA 3UGRA 3KBVA 3NPVA 3REQB 3WUGA 4HD5A 4LVAA 3TQ0A 4ROPA 4MY1A 4GX8A 4K1GA 2HSAA 1HFBA 1PS9A 4BEUA 4O1EA 2YX0A 1OCQA 3MWAA 3LERA 4DNHA 3AJ7A 4FOKA 4I5XA 1E51A 3PZMA 1EP3A 4HNOA 1TCDA 3MWCA 2C3ZA 4XUYA 3P61A 2PWFA 3KBWA 1Q6OA 3BZJA 3LQLA 1A5BA 3C8FA 4L64A 4AHOA 1QO2A 1E56A 2YDAA 1QPRA 4LH8A 4H01A 3VM5A 4RZ5A 5H91A 1HKWA 3N9RA 4LOCA 5GPRA 1C91A 1GZ1A 2YDQA 1FWAC 5DANA 3A3XA 3DZ1A 2IW0A 4DUXA 3KX6A 2PBOA 2DJXA 3UXIA 1YDOA 5LXEA 1XYAA 4Z2GA 1VCVA 4RUBA 2WBGA 1WUFA 3T0CA 4O0QA 3STPA 1J0YA 3H4WA 1V93A 1ZJHA 1PYFA 3KRBA 4B2DD 1H0IA 3VD4A 4MYXA 3DENA 1CLXA 4DHGA 3AHTA 1T6MA 1XR2A 1MQPA 5BXSA 4F48A 4UC5A 1MRQA 4GGBA 3AUJA 4BK9A 4RDZA 1WA3A 2X1IA 3GTHA 1WE5A 4WHBA 3UPMA 3LCXA 2Z00A 2X7WA 2WMKA 1FX6A 1V02A 3E74A 2ISDA 4AVOA 1I45A 3IANA 1BXCA 3GVQA 1KKOA 3WMCA 4K8GA 1RPXA 2EGZA 2ZRZA 3BTNA 4JTJA 2FZBA 4OTKA 4HIBA 4Q8UA 2F84A 3MKCA 5JH1A 5XIMA 4GY0A 2QMJA 4I90A 2I5IA 5HQLA 1OX4A 1XLKA 4D6EA 1X7FA 1JVNA 3O16A 4NRSA 3MHGA 3WD4A 3K13A 5L6UA 2FJUB 1XYMA 1JD7A 4HHHA 3OVPA 7ODCA 1T8QA 4NJJA 4GUJA 2QJJA 1JFHA 2PEVA 3HGRA 1ISZA 4XO6A 2FGLA 4E0CA 4DQWA 1VF8A 2DU2A 1ITCA 1JPDX 4GPNA 5HDRA 1P7TB 4AIEA 4PTWA 3H7VA 3WDIA 4ZL1A 5FKYA 2XH4A 4C6QA 3AS1A 3SBFA 2YCJA 3I3BA 1LBMA 4HN8A 4RR4A 5BOEA 1ZQ5A 5LNUA 1QOXA 1W9DM 3THCA 2E1WA 1WQ5A 2BV9A 3NGJA 3O9NA 3WH9A 3EWUA 4GXWA 1PKMA 4NU7A 2WHMA 3UY7A 4NASA 4Y90A 4G1NA 8XIMA 3T42A 3S2JA 3WNNA 5DMYA 2ZQ0A 2WJDA 3KL0A 4ROQA 3DFPA 4JXCA 4ERIA 3KP0A 3VK5A 3CM4A 1VYRA 4V27A 3VNYA 3TK7A 2QULA 1V5XA 1IGSA 2DSWA 2PBGA 9CGTA 3P5ZA 2JF7A 3V3WA 4UCGA 1OSEA 3R43A 2YW3A 1OD8A 1FWBC 5FI8A 3INPA 1GK8A 1UZHA 4U28A 2CHRA 4EP8C 4RDVA 1A5KC 2BVWA 1VPYA 3L4TA 3L65A 5FJRA 3H2EA 3VDAA 2A7PA 3LPPA 4MWAD 2I1OA 1BQCA 4B5UA 3AUOA 1R85A 4ZTXA 4ADUA 4NZFA 1XLMA 4Z17A 3CTTA 2GQ9A 2CLFA 4UFLA 1KWGA 1OADA 4HZ6A 3U4FA 3R8RA 4QTGA 3DFHA 3RN6A 3CXOA 4DYEA 2CLEA 3CEPA 2AL2A 3MZNA 4PUMA 2QDDA 2OEMA 3HTWA 5CCZA 2ZBTA 4DPQA 3E49A 2WNQA 2J7HA 3CUZA 4UXDA 4AZ7A 3EOEA 4A3YA 1QNVA 4U5KA 2GGEA 3G1RA 2VWSA 1EIBA 1KB3A 4EWJA 3T0AA 1CXFA 1QPQA 5FF0A 4PGLA 3M9YA 4I7WA 4HZ7A 3QGAC 5C70A 2QCDB 4WDXA 3BUVA 4MDOA 4NKCA 3LK6A 1L6SA 3G3MA 2VFHA 3ZYZA 2DW7A 3SW6A 3WBAA 3SCSA 4JTSA 4R34A 1VAHA 1BGAA 2OLAA 2CIPA 4F4RA 3GIYA 4PEEA 1FY6A 3GE7A 3QKZA 1TPFA 5CXPA 4MHBA 3DCPA 3TMLA 8TIMA 3FYYA 1A4LA 2W27A 1JDCA 3VIFA 4Q8MA 3TSMA 2QLYA 3WH5A 1QNQA 2Y24A 4GUFA 4I5RA 2C91A 3CS2A 3TAKA 4AD0A 3MT1A 3CUXA 4K2SA 3CYVA 2X0HA 3ZJ6A 3KE0A 3WJXA 4XAYA 1EO5A 1F07A 2CLIA 1XKJA 2EQDA 1PL9A 1FUYA 3L2IA 4RKAA 4K8HA 3FLUA 4PRWA 5C8BB 4R27A 1ALDA 2E67A 1SO5A 3UERA 1UD2A 4A22A 4A4AA 3I6RA 4LBRA 2P53A 4WOQA 2V63A 4IJRA 2QVNA 1J9YA 4IMCA 1UCWA 2DFAA 1HL8A 5F2GA 1XX1A 2PWVA 4FMVA 2WZHA 1TPWA 1Q65A 2WMIB 2ZTJA 1XG3A 3B8UA 3W76A 3GBDA 2G96A 1E4LA 4LBSA 5I3IA 1UA3A 3AFBA 4HA4A 6CGTA 1WPCA 3K2GA 1HG3A 4NQ1A 4OKDA 3DH7A 1Y7VA 1IXQA 5JBFA 4J2MA 6PTDA 4GABA 3QY6A 2CHNA 4GH3A 1W32A 3CQ0A 3PWAA 2FTPA 5DF0A 3IV8A 1G7UA 1UR3M 4R9XA 3IJ6A 2XM2A 3KW3A 2IUZA 2E68A 5D04C 4PCTA 3TR2A 3S2LA 4GJ1A 5TQLA 1YHTA 4CCEA 2BGNE 1Z32X 2RJGA 2HBVA 2XIJA 3EPMA 3HV9A 5AC8A 4A8RA 1V7AA 4DI8A 4AYGA 3VX0A 2NQ5A 3NOYA 2HNEA 1XWYA 3FHAA 3L2MA 4L6HA 4DF0A 3SRKA 5A6TC 3SEPA 2VEGA 4GISA 3B0XA 3HQNA 4I9AA 3B40A 3BE7A 3E0VA 2HRWA 3NDOA 1XLHA 1K4HA 3WBYA 4BR1A 2C1IA 2J7DA 4DJEC 2G4JA 5I7GA 4AHQA 4PB3A 4CQ8A 4C6NA 3CHEA 1EBHA 5K9XA 4WOZA 4WXYA 3UYCA 1GJPA 3TYZA 2Z1XA 4A3QA 3MSDA 4UR8A 4XVDA 3DYPA 2BOEX 4H7VA 1IIGA 3HGJA 3P62A 4PUEA 3BARA 5F2IA 1LYXA 1E9ZB 2V2CA 3RX3A 4IJBA 5D9NA 2FHFA 1GVQA 4IGNA 3WMBA 1IXNA 2DH2A 2X0YA 4MB1A 1TE6A 3QV8A 3A3WA 1KFCA 5M17A 3PNUA 3NQ8A 1UR9A 5I03A 2Y5EA 4RE3A 1A49A 5ABFA 5D2WA 1PEZA 3RNDA 4RDYA 3W6MA 2AOSA 3G1YA 3R1ZA 4RZ6A 5C9RA 4RE4A 4UTHA 3LDVA 3BURA 3E5BA 1AH3A 1EZ2A 4Z1DA 5IBXC 4ZVJA 1IE7C 3IGXA 3LB0A 1I2NA 3L5MA 3DXIA 1M7JA 1VHCA 1TX0A 4Z2HA 2BVDA 1OZMA 1SZGA 1Q6FA 3GG0A 5B80A 4IG2A 3EX4A 3P8IA 4HNTA 2TSYA 1E1CA 1V0MA 1YYAA 1BRLB 3BAYA 3VNMA 3F5LA 4N9EA 1SVDA 4BQ5A 2HVOA 2YXGA 4JGDA 5GVJA 3TQKA 3SN0A 1TMQA 2OYLA 1QVBA 3FJ4A 1G01A 4XZLX 3LM3A 4KCWA 4JX6A 2GVGA 3NEHA 3PB2A 3O7UA 4IXXA 5HNNA 1AA1B 1XIDA 3U8GA 1NEYA 4CD8A 4B4FA 1PAMA 3UG8A 5HJYA 1TV4A 3PZIA 1FWIC 4HN4A 3QHNA 5D37A 1BG9A 1C7TA 1E6NA 4OHQA 1BF6A 1F6PA 2WM0A 4QSHA 1KW1A 1N8WA 3TA6A 2AQOA 3SIMA 4OE7A 3CWNA 3WKZA 3U5UA 3TLQA 1X7IA 1UWUA 2WYSA 1XRFA 1ZHAA 3ID7A 3IIXA 4C6DA 4KEVA 1Q6GA