2HDJA

Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with nadp(h)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
322
structure length
322
Chain Sequence
DSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
publication title Crystal Structures of Mouse 17alpha-Hydroxysteroid Dehydrogenase (Apoenzyme and Enzyme-NADP(H) Binary Complex): Identification of Molecular Determinants Responsible for the Unique 17alpha-reductive Activity of this Enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2hdjA00
4ASTA 1AH4A 4JTQA 4YVVA 4ICCX 4IJRA 4GA8A 2HVNA 3ONCA 5HA7A 1S2AA 1X96A 3BCJA 1ZGDA 2ALRA 2PEVA 3UFYA 4WDUA 3WBXA 3FX4A 3R43A 3V0UA 3CAQA 2PDLA 1EKOA 4XZNX 1ADSA 4WDWA 2F38A 1Z3NA 3R94A 2QXWA 3RX3A 5HNTA 2PF8A 3S3GA 2ACSA 2PDKA 3C3UA 2I17A 1RALA 2PDMA 3RX2A 2PDWA 3H7RA 4XVDA 2HVOA 5LIKX 4GQ0A 3FJNA 2PDQA 3B3DA 2IPWA 3CASA 4PR4A 2PFHA 3V0TA 5JH1A 2WZTA 1EF3A 1M9HA 1ZUAX 1SM9A 2PDFA 3MC5A 1S1RA 3M0IA 3N2TA 4XZLX 4NKCA 4YU1A 4PRRA 4JIHA 4WDXA 1T41A 4JIIX 4EXAA 3LNMA 3WBWA 1VP5A 2P5NA 3COTA 4JQ3A 4JIRA 4H8NA 2PDNA 4JQ2A 3V35A 3QKZA 1UR3M 3UG8A 2BGQA 5HNUA 1XF0A 1AH3A 1PWMA 2PDPA 3LQLA 5LIYX 3LUTA 3ONBA 5DANA 4XZMX 5AZ1A 3H7UA 4GABA 1RY0A 2FGBA 4DBWA 1LWIA 1OG6A 1Z9AA 2PDCA 5LIUX 3R6IA 3GHSA 1X97A 3G1RA 1US0A 4GACA 4WGHA 4HBKA 3R7MA 1PZ0A 3G5EA 5KETA 3M4HA 4YS1A 3R8GA 1RY8A 4PRTA 2IKIA 2R9RA 4LBSA 3LQGA 1AFSA 3T42A 3DN5A 3GHUA 4XZIA 1J96A 5AZ0A 3WCZA 4Q3MA 4IGSA 2FZDA 2IQDA 4WDTA 2HEJA 3M64A 2HE5A 2PDIA 5LIWX 4JQ4A 1R38A 4F40A 2FZ8A 3LN3A 4GIEA 3ERPA 3GHRA 1HW6A 2IS7A 2F2KA 3N6QA 3VXGA 3CMFA 2ACUA 2PDXA 4FZIA 4JTAA 4XVEA 5M2FX 4FAMA 1Z89A 1MI3A 3GUGA 3D3FA 3LEPA 2FVLA 4G5DA 1VBJA 1YNQA 2IPFA 2HV5A 2DUXA 2A79A 3EAUA 3H4GA 2IPGA 3KRBA 4OTKA 1Q5MA 2WZMA 1EL3A 3BV7A 3O3RA 3MB9A 4XK2A 2PDGA 4HMNA 2FZ9A 2PDYA 1X98A 4JTCA 3UZXA 5C7HA 2PD9A 4MHBA 1T40A 3RX4A 3WBYA 2INZA 1A80A 1PWLA 1IEIA 3BURA 4JQ1A 3UZWA 4IJCA 3CAVA 3UP8A 1QWKA 3EB4A 1MZRA 3F7JA 2HDJA 2I16A 4L1XA 3NTYA 1GVEA 3LBOA 2ACRA 4LAUA 4LB3A 4XO6A 1Z8AA 2DV0A 3R58A 3LZ5A 4QBXA 3EB3A 1S2CA 1Q13A 2IKGA 4FALA 4LBRA 1AZ1A 1MRQA 3LZ3A 2ISFA 1YE6A 3O0KA 3V0SA 2C91A 5LIXX 4LB4A 4RPQA 4JTRA 4GCAA 3Q65A 3V36A 1LQAA 4XO7A 2PD5A 3UYIA 4QR6A 4YVXA 4JQAA 3R8HA 4ZFCA 1FRBA 4EXBA 2HE8A 4XZHA 3P2VA 3WG6A 1QRQA 2J8TA 3Q67A 5JH2A 2PZNA 3UGRA 3UWEA 1ZQ5A 1PYFA 4YVPA 4DBSA 2DUZA 2R24A 3BUVA 4I5XA 1S1PA 1YNPA 3LENA 3UZYA 2ACQA 1EXBA 4L1WA 4AUBA 4PMJA 4DZ5A 2VDGA 1JEZA 1YE4A 2BP1A 2IKHA 2PDBA 2PDJA 2NVDA 1PZ1A 1XJBA 2CLPA 4WEVX 2NVCA 4H7CA 4JTDA 4Q7BA 1K8CA 1HQTA 3CV6A 1ZSXA 1C9WA 2INEA 4QXIA 1AZ2A 4FA3A 4QX4A 2AGTA 4DBUA 1AH0A 2IQ0A 3DOPA 2PDUA 2IPJA 3UZZA 4PUWA 1XGDA 3GHTA 4XAPA 1IHIA 2PDHA 3CV7A 3LD5A 2FZBA 4R9OA 2BGSA 3U2CA 4GQGA 2IKJA 4LAZA 4PUUA 4WRHA
chains in the Genus database with same CATH superfamily
2CCRA 3UJRA 3AIQA 3H4WA 1WNOA 3FA5A 1ME7A 1EJRC 4FNRA 5I2UA 4JTIA 4BI6A 2Y2WA 1CIUA 3W7NA 2GK1A 4WOQA 1WAWA 3FXYA 2MUCA 4IP4A 4HU0A 3M0ZA 1D8WA 3HG5A 3VOHA 3L5LA 2GQ3A 3V0UA 1GYNA 2Y6ZA 2OG9A 3OVPA 4AU0A 4LS2A 2Z1BA 4NF7A 4Z1CA 4HP5A 3VGEA 2NUYA 4C1NB 4JZ5A 5H2ZA 4PMUA 4JY8A 3QR3A 1UKTA 1HJXA 3S1UA 1E1EA 4ATDA 2B7QA 2D0FA 1IWBA 4MSSA 3EGJA 1QNOA 2H8ZA 2ABAA 3W27A 1AK5A 2CXGA 3VDCA 1YTEA 1K7EA 2TAAA 1XP3A 2OLSA 3CB8A 2V30A 3PNZA 2AAAA 3M07A 3QOKA 4Z2IA 3N2TA 3ARVA 3OGRA 1YX1A 5FL1A 4GC4A 1ESWA 2BY1A 1EO7A 2DJXA 4UR7A 3MU7A 2XVNA 1PIFA 3DFNA 4M3PA 1M7OA 4DM2A 1GOIA 3KOYA 3MZNA 1MXDA 1P4CA 1PKLA 3TQVA 4XTDA 1VYSX 4JIRA 3T81A 5G1TA 3LM7A 3WJYA 2PDNA 1VS1A 3JW7A 1CGXA 1YPIA 1F4HA 2J75A 1UHVA 4GZIA 1DJXA 1XD1A 1XF0A 1AH3A 2JKEA 3W7PA 1ZL1A 2WC4A 3EB2A 3R8RA 2RFGA 3TJIA 1SJCA 1M65A 3G1YA 4C60A 4F3HA 4B5TA 2GJRA 3L65A 3K4DA 4FMVA 5REQB 3P80A 4WGXA 3FFSA 1OFDA 3I6RA 2OO0A 3GB6A 1V0KA 1P43A 2J7DA 3T8LA 1KFEA 4M1RA 4LC6A 4P7RA 1QDSA 1F74A 1HO4A 5JUVA 1Q65A 3W7EA 1E5NA 4BZYA 4LBSA 3RN6A 3WDIA 5G4EA 2PWVA 2ZZ1A 4NYYA 3ATYA 5LHEA 3GHUA 4JCLA 1UJPA 5AZ0A 4AYGA 2H3DA 4Q3MA 2NX1A 3G1VA 4MUZA 3M64A 3RILA 4JFUA 1Z6KA 1DXEA 1Y0EA 4KRZA 5CSRA 2OXNA 2C79A 2CYGA 2VNCA 1IE7C 3CHFA 4JYDA 1O1HA 3PY2A 3IJQA 1G1YA 3KEHA 1EJUC 1FCVA 4GH1A 3T4CA 3O8AA 2HS8A 2WCAA 3M41A 1NWTA 1ZCCA 5MF5A 1KBBA 3BAIA 3U6WA 1ZENA 2JK2A 3O6DA 2HCVA 5HR7A 4JEQA 3GNOA 4DRSA 4EXQA 2VWSA 1JF6A 1L8NA 3GS6A 2VUYA 1KFCA 1GNXA 3W7KA 5FAJA 2CWNA 2RUSA 3H6OA 3MY9A 1L6SA 4B91A 4PRWA 3AHTA 4HNTA 1WDWA 1U2YA 3K5XA 2NWRA 4XK2A 4W88A 1IF2A 3PBUA 5CGMA 1OFQA 2VC9A 1GOXA 5XIMA 4BWLA 3PJWA 3CO4A 1T40A 4GMEA 4I7VA 4LAOA 3BURA 3WH5A 1POKA 3V7PA 1V3JA 4ACYA 2YXGA 4CCCA 4HOWA 3H7VA 4I6KA 1FDZA 4UZSA 4UNLA 1EA0A 2HK1A 4IX0A 4OV9A 3AROA 3TFCA 1SJAA 3E0WA 1ZJBA 4L6OA 3K13A 1RR2A 3NPUA 4GGBA 2XZ7A 4RR4A 2E9BA 4BY3A 3VTRA 3DXIA 1KM5A 4Z2KA 4JAWA 4TU1A 3W2UA 2XM1A 1P5BA 3TTOA 2IXUA 2PP1A 1E1CB 3LV5A 3T40A 2CWXA 4LBRA 5DT7A 4JR5A 4AEOA 3TROA 2BXZA 4TMCA 3UNDA 1MDRA 1SFJA 3K8MA 3HG3A 3M7WA 4CD7A 1HGWA 3UA3A 3KOZA 4OECA 3LLXA 5D2TA 2PTYA 3TAKA 4R7JA 3E02A 9XIAA 3GD6A 3URNA 3GR7A 1A5BA 2C19A 2WWCA 4YVXA 1GHSA 1T8QA 2V81A 5JQ9A 4EKJA 3U2EA 5HBFA 2NLIA 2B81A 4UBPC 4CU6A 2JGQA 3WG6A 1XYMA 1F7BA 4PULA 3Q67A 4AX6A 4NI3A 4TVCA 4QDWA 2DW6A 4IMCA 1KWGA 3FGCA 3P6LA 4F0MA 5EGRA 3IJ7A 2QQ6A 5ABGA 2VZSA 1KM6A 1P6WA 3DIPA 2XIOA 4HOXA 3HF3A 1DJWA 4LAKA 3I4EA 4AISA 4ZOAA 1A0DA 3IUDA 3UZYA 2WKLA 6REQB 4FLOA 3N6JA 1QATA 2YCIX 1RAKA 3R12A 4ADSA 1ICSA 2WBGA 2PDJA 4AY8A 4LVAA 1XJBA 2G95A 1EFZA 3W7MA 4PL1A 4NZCA 1ZSXA 4RZ6A 4Y8EA 3W3OA 1J2WA 3LOTA 3IACA 4Q8MA 5AFDA 3A24A 1TB3A 5CPLA 1WAUA 4RL3A 2QDDA 2VM8A 1XLCA 3DOPA 7TIMA 2RDXA 5FA5A 4PMZA 1FDYA 2BXYA 6ALDA 3CV7A 2GGIA 1W3HA 2QUVA 4MPQA 3VGHA 4Q4MA 3U2CA 3MBDA 1H1NA 2QGYA 1ZBKA 2FHCA 4A05A 3BDKA 1XV8A 4PCFA 2G8ZA 1MQQA 1VIWA 3WMLA 4S3BA 3STCA 1PO9A 3MS8A 1Q8JA 1TE1A 5BOEA 1W8GA 2FTWA 3UA4A 1GOQA 3IJ6A 4A22A 2GL5A 4QDPA 2GSHA 3A22A 2OU4A 4LC8A 3BMWA 4FLSA 4ZBCA 4C6LA 5BMXA 4FEZA 2ZOXA 1PVNA 1EWEA 3G77A 1BTCA 6XIAA 4YPJA 1Z69A 1LOQA 3WK3A 1AQHA 3OIHA 2ATMA 3DGRA 4GX9A 3TCSA 1E6QM 2PAJA 5JMUA 1JDAA 2CBVA 1UKQA 4HZMA 5FJUA 5I3HA 4N4QA 4NNAA 1QPRA 5A94A 1UKPA 3W71A 5LIKX 3TNBA 2IPWA 2OO6A 4EPDC 1CGYA 2YFNA 4DWDA 2VZTA 3HQNA 1K02A 2FFIA 4BEUA 3VNIA 2VFDA 3CUFA 5CQ1A 4BF5A 2VR2A 4FF7A 4FNUA 2QYGA 2YLLA 2VC7A 3T78A 3R0DA 2WBKA 1XXXA 2EKCA 4NX5A 1OGGA 4K1GA 1MQPA 3S2NA 1W5PA 3CZEA 3L4XA 3BVJA 4PMVA 2J9XA 3LLDA 1JGMA 1VH7A 3KVKA 1OZMA 1H1ZA 3BJFA 3DHDA 3AMGA 2ZZ5A 2B7NA 2VI0A 2PTXA 5BMWA 1Q63A 4J9JA 4DWSD 1EQPA 2OX1A 3M0LA 2FGBA 2QW5A 2PDCA 3QZAA 1Y5XA 3B8DA 1ZAJA 3N14A 4JIEA 5I3GA 3UG5A 5K4ZA 4RLIA 1QPOA 5C71A 1V3MA 5XIAA 2O0TA 4NIRA 3MUAA 1G9HA 3ARPA 2X42A 5DMYA 4L5ZA 5E6ZA 3GDBA 4EPKA 3G1HA 2DT0A 2IMRA 3ISIX 3AO0A 3FIGA 1OFPA 1E9YB 1IWPA 4Y2WA 5CSUA 1QPNA 1TPUA 1UWQA 2QLYA 3H8AA 2OZ0A 2WZIA 2OSXA 1UG6A 4KCVA 4UTKA 4CVWA 2VD8A 2RGMA 3PPCA 4Z17A 2P8BA 1TTQA 1ZBWA 1EP1A 4GIEA 5LNUA 3NDZA 1PV8A 3FEQA 4IQEA 3NL2A 3PULA 4Y96A 2F2KA 2JKAA 4S1FA 3REQB 3E3HA 3CIXA 1K7FA 2GJPA 5FEPA 3SQLA 2CLHA 2ZTJA 1EXPA 1Q66A 1UYQA 1V08A 3C86A 3O6CA 4PMOA 3SB0A 3OLDA 3B9OA 4RNHA 4AIEA 4ZTXA 1HNYA 3WH8A 5HUOA 2QMJA 3F5JA 1SMAA 4PUDA 5C54A 2VELA 4DI9A 4GYPA 1TIMA 4HKPA 1UH2A 4HMNA 4EIVA 3KL5A 3H2CA 3AYVA 3BO9A 2OT0A 5A8MA 2J62A 1XLBA 2A3BA 2VRKA 3KBJA 5D4YA 3VKAA 3G18A 2QJHA 2Y0FA 5I7GA 5TQLA 4UNIA 3ITVA 3QQWA 4AFYA 3UP8A 1J0IA 1EP3A 3WLPA 3WNPA 4GJJA 3LCFA 1GUVA 3AYSA 1YHTA 4M0XA 2ADAA 3NO3A 1E71M 3IEBA 3THQA 1SJBA 4XO6A 1R3VA 1S2WA 1H5VA 2P3EA 4DJEA 3N9RA 5TBOA 3P93A 2ZUTA 5C9RA 2BVDA 1IGWA 1O7AA 1G01A 2P53A 3PZVA 3HFTA 1HT6A 2Z1KA 1OK4A 3WQFA 1LQ2A 2ISFA 2WC3A 3CS2A 3O0KA 3GFXA 3OG3A 3V5CA 3FSTA 3AMCA 4GVIA 1FWCC 1IXOA 1ISWA 4EANA 4FB7A 4JQAA 4TO8A 1JRBA 2HXUA 4M7TA 1KM0A 3AS2A 3LG3A 4ZQNA 4MB1A 2P0OA 1M01A 1F3TA 3UPMA 3W73A 5EMUA 1ONRA 2DPEA 2PWUA 4HSHA 1X7IA 1SO6A 3CWNA 4EACA 3VDBA 3MWAA 3KP1A 3FSUA 3ZLFA 5CGTA 1Y65A 3KL3A 3BGJA 3WLLA 3SADA 3FS2A 1TFVA 1A5MC 5M1TA 1CECA 3KS5A 2J7CA 5JU6A 1J01A 4LYRA 1V3KA 3WLNA 5FIPA 3N29A 4PCNA 5CZKA 2PLKA 4PMJA 1Y8BA 3VIJA 4PSPA 2QMKA 4FR6A 4RE3A 3ZR4A 3TFXA 4DUWA 1Q6DA 2CZVA 3GQYA 3PUEA 3AS3A 1PZ1A 3O06A 1UJQA 1GPFA 1P6CA 3GR8A 1OQFA 1HQTA 4IQJA 1OINA 3WK2A 2H8XA 3MSRA 1UWUA 5D32A 3MPGA 1VRDA 5I06A 4PH6A 2AGTA 2TMDA 1AVAA 4S38A 1AQ0A 3LTPA 4WQ6A 1LBLA 3VABA 2YLAA 4AEFA 4EAMA 3NVDA 3LD5A 1NSJA 3GUWA 4N9EA 1GVYA 4HOZA 1VFOA 2I57A 4AWSA 2D2HA 6XIMA 1QUMA 3UESA 3O15A 4PUUA 4D9PA 1VRXA 1WDDA 3FDKA 4O8RA 4UFJA 4H8VA 2YL8A 2G41A 4JS3A 2OYLA 1NP2A 2XYLA 1HKWA 1TELA 3UPWA 2DSZA 4LS0A 4DVOA 4ZB2A 3ENLA 3RLGA 4GA8A 4M24A 1S2AA 4CNUA 2PURA 4M1BA 2ZUSA 3OVQA 4NUWA 3CL8A 4RNJA 5KSWA 1ZB5A 1FWNA 4H9YA 1LP6A 3W29A 4JNYA 1LZOA 4KH2A 3E2SA 5F4XA 1XYFA 1EB3A 1MW2A 1X6LA 1DEDA 2PDKA 5M3WA 2ISDA 2GJXA 1WV2A 3LTSA 3M0MA 1GVSA 4JTHA 2NSXA 2QZRA 4ZOEA 1E9IA 3ZLGA 1MVYA 4TV6A 1KQYA 1N8WA 1T5AA 4JFVA 3ZT7A 2F6XA 3BW4A 1JZ4A 2E9LA 2OZ3A 4QJ4B 4ZOCA 4IP5A 2WKJA 7REQA 4IFRA 2OQLA 4Y8FA 4PMXA 1JD9A 3M47A 4JIHA 4XWUA 1U5JA 4XV0A 3LGDA 1PX4A 2OZ8A 2WSYA 2CESA 1PL9A 1TR1A 4GZJA 5HQLA 4MWAB 4J4KA 3TSBA 1S5NA 1K3UA 3E38A 1LG2A 4PTVA 1YKWA 6A3HA 3PTKA 2DH2A 5AC4A 1UKOA 4L9YA 1US2A 3EKLA 4NVTA 2HMCA 3LQLA 4E4PA 3GZ3A 4CN6A 1ODUA 4FIRA 3H7UA 3PUGA 1XLEA 1Z9AA 2WMFA 4HJWA 2NQ5A 2Q71A 3SY8A 2YIHA 3GNDA 3NDYA 1DORA 4N9DA 4NX0A 3ORWA 4O16A 4UTUA 2VDHA 3LSCA 4W93A 4J3SA 4NHVA 2QCMA 1JUEA 4QJ3B 3M4HA 2DFAA 4NYUA 5J5RA 4C1KA 1TQJA 3PJTA 1JPMA 1W54A 4PRTA 1GVIA 2HBXA 2HROA 1TPEA 2NX3A 4DWSA 3RM4A 3MTWA 3KOFA 3TJLA 2KZHA 1VQTA 5G4HC 1LLZA 4GG9A 5AYZA 3AICA 3BGGA 2IQDA 4X9SA 3QMRA 2EPHA 2HE5A 3C4UA 4TX6A 3WLHA 3M43A 3RDKA 1D7KA 2PWHA 3UWZA 2JF7A 1OX4B 1SO4A 1FH9A 4OKDA 3H4XA 4XAZA 3CHVA 1JI2A 1OCBA 3LPOA 3EDEA 4LBUA 2ZUWA 4FXRA 1JJKA 2QEZA 4W84A 3CJPA 4GVFA 1PS9A 2A3AA 5EMJA 1VBJA 4MAVA 3VOGA 4W7UA 3TP4A 4IMEA 5D2XA 1UMYA 1J79A 1E6XM 3NSXA 3UR5A 2W79A 4PTMA 1TKKA 3LCIA 3WLQA 1H5YA 1JAKA 3GG1A 3H2AA 3EBVA 3HA1A 4MHBA 4E5TA 1KBJA 3D6NA 3VZXA 1IEIA 3IIZA 3GX9A 3FYPA 4U33A 5C7VA 3CAVA 5FJJA 2BASA 1QWKA 4QCEA 2CC0A 3TMQA 5I78A 2XISA 1E0TA 2BFGA 3CHDA 2QJMA 4UQAA 4O1EA 3RXZA 5BOOA 3VZYA 3L67A 4QBXA 1TMHA 3NDOA 3PTMA 4H6QA 3JU2A 3GY1A 4Q32A 5BXTA 2WK2A 4JTKA 4BKNA 2OR2A 1EA9C 3NL6A 5GQBA 1Z32X 2BOGX 1MEIA 5FJOA 3MT1A 4GCAA 2JGYA 3OA5A 3GR4A 3EDKA 4S3KA 4MJMA 1K9EA 2Q8XA 1PTDA 1GVQA 2Z6IA 3WNLA 1JCMP 2ZC8A 2X0SA 1EQCA 3VDGA 4HN4A 1DQUA 3SR7A 4XD4A 3EMZA 4NAEB 1I60A 4CVUA 3AYRA 2DQWA 4GIYA 1JUKA 2UY3A 3AJXA 3ZR6A 1JPIA 4XAYA 4GYJA 1V4YA 2W63A 4GWEA 4LANA 3S83A 3A3XA 1UP2A 3CQIA 5K2ZA 3STEA 3PN8A 3LENA 2GVLA 1QASA 2QJGA 3DERA 4HMCA 2FTPA 1RSCA 1XH1A 1H7PA 3APYA 1MEHA 1VGAA 4CGTA 2VZUA 5KTLA 1ZBCA 3GIYA 4CD4A 1VBGA 3WD0A 3KWSA 4E8CA 3M0HA 1RXOB 1H62A 4B3LA 2FVMA 3AMDA 1ZY9A 1T6MA 1V6YA 1K4GA 5CPTA 1PPIA 5CBIA 1M3UA 2W92A 4E4UA 2OKOA 1ONEA 2UZ9A 5EMYA 2A3CA 3LX9A 4RXGA 3W2LA 2INEA 2VWTA 4XTIA 1CEOA 1XLHA 4V27A 1ZALA 4RX0A 1DWFM 3BOLA 4BR1A 1G94A 5GJPA 2QPSA 3DFHA 4PUWA 2AQWA 3PJXA 4IOTA 1W3IA 5ABFA 4OGZA 5LNRA 4LGXA 5I07A 3LI1A 3MHFA 5FL0A 3KHDA 4BI7A 5JBEA 1S2UA 5DF0A 4J28A 1FUYA 2XH2A 2Z0IA 3T6CA 3U7BA 4HNVA 4PGLA 1VFTA 4LV9A 4IPNB 5DMMA 3FKKA 3TMLA 1XRVA 4GFSA 1KFKA 4GJIA 1U22A 4JEJA 4S3AA 5FEXA 4ERGA 2D2GA 3CAQA 2WSQA 3W2KA 4AF0A 1UASA 1TPC1 3CK5A 5HJLA 3SFKA 1R3WA 4HCLA 4B5NA 4MUPA 2CW6A 1A4LA 1OVDA 5D2WA 3SQSA 4TTGA 1GKQA 1VZWA 1XL9A 4NG3A 1ICQA 3B4UA 1FY6A 2PDMA 3K8KA 3IGHX 5AY7A 2WC7A 4UMCA 2PF0A 3EWWA 1YXYA 2C1GA 1PSCA 4Y7EA 5IHRA 4D6DA 4AY1A 1TPFA 2XH7A 2GPTA 1S1RA 3ZLHA 4OBSA 3WLRA 2WCGA 1HXJA 1J6PA 4IFOA 1YRRA 3W23A 3S2JA 1G4SA 4QAWA 3W6LA 3ZIZA 1Q3NA 4KESA 1QBAA 3SCRA 4JIIX 3IJLA 3WBWA 5M17A 3F2BA 3MVTA 3QV8A 2WHKA 2VFIA 1EZ2A 3TE9A 3BLDA 1XPYA 2NX9A 3G1AA 1KTNA 3RMEA 1OBAA 3W28A 3ZYZA 1E3XA 3L12A 4LUIA 1TTPA 1TV8A 2ONEA 1QI4A 1IGSA 1SVDA 1FWHC 1FQ0A 3SUWA 3LUTA 3ONBA 3WJZA 2DZBA 3ITLA 1GTHA 2XVGA 4WIWA 5HINA 3OHMB 1XISA 2WJZA 2HK0A 1XIDA 3N19B 3LRKA 1UR1A 2A7PA 1A3XA 1X97A 1US0A 4GACA 4JTFA 1E4NA 4HBKA 3UERA 3R7MA 3LXAA 1XYBA 2VVSA 1DKWA 3OQEA 2VEMA 2ABBA 5JBFA 3W25A 4JHZA 3DC0A 3RAOA 2IKIA 1PX3A 3WDJA 2FVKA 3PZTA 7A3HA 3S5OA 3F4NA 4Y90A 1KO0A 4NZ4A 1SYTA 4LF1A 4GGHA 3R89A 4JKKA 4ORIA 3DG7A 2J9YA 3I7QA 4XSMA 4DXKA 2C0AA 1CBGA 1R38A 2Q3RA 3W75A 4C6PA 4Q22A 1B54A 3H2OA 5AVHA 1UOZA 4MFDA 4ALDA 3W7RA 4I9TA 4IG2B 1HJVA 4EK7A 4GUFA 1E15A 3QY6A 3SGUA 2G3MA 4ZO6A 1OX5A 1XICA 1ALDA 4RE2A 2ZXQA 3C8FA 1HJWA 2R1MA 3VC6A 3KL0A 4JIQA 3LEPA 3W4RA 2WVTA 4G5DA 2VEGA 1U30A 3LHVA 3PPFA 4I90A 4D71A 3WQCA 1ZPTA 3V3WA 3O3RA 3MB9A 2XTKA 3V75A 2PDYA 4QJ1A 3GM8A 5K9DA 3M5YA 3LSBA 1YDVA 2B7PA 2INZA 2Z2BA 1ZZMA 4JQ1A 4ERIA 3ZJ7A 5B80A 1CW2A 2YL5A 4JY9A 4ZOBA 3SUSA 4LNCA 4JFWA 2Z2AA 1EPXA 4R7OA 2QNEA 1MW3A 3C2OA 3SCQA 5AB3A 3H2EA 4JOMA 4ZL1A 3H22A 3AHVA 4GQQA 1OZQA 1IXPA 3TZFA 5F2MA 2ON3A 4N4PA 4C6NA 4R27A 2DZAA 1PIIA 3LBCA 4RKAA 2X7VA 2HPMA 4MGGA 1MRQA 3QZEA 1ISXA 4IFKA 3UR2A 2VQUA 1A5UA 4EF8A 3W0KA 4QG8A 3NO1A 3W85A 1YNYA 1OABA 2YR1A 4IGNA 2PD5A 4GUGA 4ENLA 1NQKA 4KBXA 2P8CA 2GVEA 4O10A 4U3CA 2A2IA 2BWGA 3S9IA 1AQFA 4MAZA 3FAXA 3GDMA 4XZHA 2W4XA 5ECVA 4RDWA 4Z1BA 3GRIA 3GKAA 3NZGA 4CN1A 3G2GA 2QS8A 3RR4A 3OEXA 4Q8WA 4ZR8A 4UTWC 2UWFA 3H2FA 4BA0A 3HGSA 4UMAA 2PBGA 2H9AB 4Q4KA 3GDTA 1BYBA 2YZ5A 2AQVA 1GJPA 2WW5A 4C90A 4G56A 3STPA 4Q8PA 2Y5EA 3GH5A 4FPSA 4D6FA 1JFHA 4DZ5A 2QDEA 3RM8A 1L2QA 3LCLA 3BWWA 1I45A 3AMLA 3UWVA 3W88A 4OBRA 1QPQA 1UD5A 2P3ZA 3W7LA 3KTSA 1BRLB 4DO5A 2GGEA 5CLTA 2VP8A 1WZMA 4IM4A 1IT8A 1BWLA 1ECEA 3RRAA 4HYVA 2P76A 3EX4A 1YBQA 1J6OA 4IIEA 2DVUA 2IQ0A 1EBGA 4MY8A 3WYZA 3M44A 1ZAIA 4M81A 1SW0A 4XAPA 3GBDA 1XR2A 4IT1A 5TIMA 2ODOA 3TC6A 2QUTA 1DWJM 5BROA 1VR6A 4ZQMA 2A21A 4LAZA 4OBTA 2YA2A 2GSEA 1P0BA 5DQPA 8XIAA 4HVXA 1BXNA 1RLCL 4FXFA 4MOZA 3MV01 4HK5A 5E0FA 3TXVA 5A8PA 2PEVA 1W2PA 3RCNA 5C70A 3DAQA 4EWND 3ZVIA 2ZX9A 1JVNA 4O1FA 1OFRA 4CCEA 2NXGA 1SR9A 2YSWA 2BMBA 1ME9A 4ZODA 3ABZA 5EY5A 4AZBA 2JFEX 4Z1DA 4U2ZA 1XI3A 3EYPA 5H8MA 1WZKA 2YXOA 1KNWA 3WQDA 4R33A 3BAYA 4Q8TA 2O92A 4K39A 3BAXA 3GNRA 3O9NA 1F07A 3E1F1 2E5BA 1ZNNA 3T2QA 2C15A 1YLVA 2CETA 4YHGA 1X8CA 1N7KA 1WB0A 1F8IA 3M0IA 3VDHA 4GVGA 3NOYA 4LW7A 1VJZA 3UG3A 4YU1A 1HKIA 5KZ6A 2J13A 4JICA 5C5YA 1AD4A 5U4NA 4AWEA 3BANA 3B9AA 3PPHA 4UTTA 1ISZA 3L4WA 4MFEA 3FW6A 3PAJA 3P81A 2ZRXA 4O1CA 4CNTA 1IR1A 1B2YA 2A7RA 4OUEA 1WKFA 5F2GA 1KRCC 3C2FA 3ID7A 2CKRA 3TTEA 2QCEA 1IEWA 3GE7A 1S5TA 1RQBA 3LU2A 2VEIA 3WENA 4XUYA 1HKVA 2FFCA 2VGIA 4LVDA 3PB2A 3IVUA 5E0KA 1JDEA 5A8OA 3APTA 3RJYA 4IXXA 3G5EA 2WKGA 2HBVA 1NFGA 4D6IA 1MXGA 1RPKA 2Y4SA 5LXEA 4HNNA 1YPFA 3UG4A 5GJNA 1ISYA 3OP2A 2HS6A 1I2QA 4GQRA 3NSNA 2VVNA 1BQGA 4ZSTA 5DMNA 4OFCA 1PBGA 1VJSA 3CT7A 1CENA 1SR0A 2HEJA 5HWMA 4PZVA 5JXQA 3ES7A 5MKGA 3WQPA 1H49A 3LN3A 2XN1A 3UCQA 3ERPA 1R30A 1B4EA 3KM8A 4W8BA 1TPH1 2V38A 4H83A 3DFQA 3RFAA 4KFOA 4AVFA 1UWRA 1PE1A 1GT8A 3OO2A 1XLLA 1TZZA 4QCFA 2EEXA 1Z89A 4XZWA 1QCWA 3HPZA 3DFYA 3VK5A 4MNJA 4GCXA 1YNQA 3DG3A 1CDGA 1QNRA 3UZ5A 1E55A 3SO7A 2FZMA 3URQA 4PBFA 4IHCA 1LYXA 3OZMA 3MVIA 2D3LA 3BV7A 4PC8A 3GDRA 1MDLA 1W6TA 1L6YA 1RCXB 3UZXA 5C7HA 4E3TA 1PHWA 2PD9A 3WFZA 1XDJA 3EMQA 3E2RA 2V2CA 3RM9A 3GW3A 1XCWA 4CNOA 1RBOB 1UWTA 1CPUA 3SUUA 4J40A 2ESCA 3SEPA 1BYCA 1XH2A 2VX7A 4Q6JA 1QOPA 3B8SA 2VCCA 2FYMA 1NJJA 4Q8VA 3H2NA 1WX0A 1A5KC 1XYLA 2DQXA 3O16A 1UQZA 4G2DA 1UD6A 4YLWA 4YNGA 1E4IA 3G3MA 4W7VA 4JKLA 3WLIA 3W1PA 5GPRA 4J2MA 4E0CA 3BAWA 3H24A 2VFGA 4W86A 1KQZA 2VDIA 3QHNA 2VRQA 5D9NA 2A3LA 4JHMA 2W3ZA 3SJ3A 3BJSA 4J35A 1JQVA 4POCA 3A12A 4IQLA 1WUFA 3UXIA 4B5WA 3HB9A 1UIOA 2ZX5A 2CXEA 1EUAA 3NQCA 4W5ZA 1B9BA 2EAWA 4U3AA 4AAJA 4GNVA 1I1WA 3WEOA 3JVAA 2E77A 4C65A 1BG4A 1ZJHA 3IK4A 2GQ9A 1GHRA 3UGRA 4NAFB 1IR2A 4MLJA 3B0PA 1SSGA 1MMFA 5C8BB 2C6QA 2QCDA 4NL1A 1GYLA 4Z2GA 4MDOA 4CD5A 3UF9A 4H9VA 4AZHA 1TX0A 3W7JA 4NRSA 2XINA 3LMYA 1TA3A 5ABTA 3WJWA 2FMOA 4UFIA 1AL8A 3APGA 1DE6A 2VDGA 1JEZA 1BWVA 4PTXA 4B4HA 4RDVA 2PDBA 4AD1A 4PMDA 1NIUA 4PB5A 4XB3A 4L64A 5D9PA 3SSZA 3WH9A 1UBSA 3LI0A 1M7XA 3RU6A 1M53A 3FCPA 3WSUA 3GG0A 1XLGA 4QX4A 5HDRA 4IFKB 1F73A 3BJTA 1DWAM 1I0BA 1FDJA 2PSNA 5CJ5A 3W83A 5HAOA 3UWQA 4J1OA 1E9ZB 4AW7A 1A5SA 4MMWA 4UTLA 2FGLA 3VNMA 3PZMA 3V1HA 1YIXA 4QE4A 3BL3A 1XW8A 3TK7A 2D23A 4DAFA 1IXQA 2BY2A 3OG2A 2GWNA 3VO0A 3NOEA 4IPJA 2EXOA 3NQGA 4LEQA 5CZTA 3KHJA 1LTDA 4ICCX 1XUZA 2PODA 1WKEA 1KCLA 4BQ5A 3ZJKA 1E6NA 5F4WA 1DPMA 2NUWA 4KQNA 3CGTA 1SFTA 3TN5A 1C93A 3R43A 4HJFA 4MYXA 1L9WA 3QV7A 4LS1A 3EOEA 3BLFA 2BOEX 3G1SA 2WVVB 3CUZA 3ZJ8A 2DZTA 4WY0B 3DFPA 3URBA 3WF2A 4KWOA 3ZWTA 3QQ0A 1V79A 4UTHA 2W61A 2DORA 2FDMA 4GQ0A 1H50A 4PR4A 5KMYA 2Z24A 2ZVRA 4B4FA 1UMLA 4RK8A 4GH3A 4J7RA 2A6NA 1ZUAX 3GAKA 3MC5A 3SFWA 4MIMA 3UR8A 3ZT5A 1XBYA 1NEYA 1XG3A 2ZIDA 3ITCA 3V4BA 1XWYA 4LYKA 3RPDA 3VNZA 5RUBA 3PFMA 3SAZA 1ZU8A 4P61A 2Q01A 4GPNA 1DE5A 1VFFA 4QJ5B 1GG0A 2DVXA 3QKZA 4F4RA 4HA0A 1QFEA 4F0SA 3TC3A 3KFTA 4C7DA 1J5TA 1VYRA 3VM7A 2GSJA 1NOWA 1OGSA 4O0KA 1TWSA 1LBFA 3QPEA 1OG6A 1E6PA 1POJA 3CMGA 5BXSA 1C90A 3KBWA 4HK7A 1CTNA 4ZE5A 4L4OA 4PEEA 1OSEA 1W5QA 4N2YA 5BZAA 3TX9A 2CFFA 4HHMA 3CLMA 4L4PA 4M8UA 1QK2A 1E6RA 2L5HA 2Y7EA 5A2CA 4XD5A 2V2DA 4DM1A 5D2YA 3T07A 1RJQA 3F1QA 1SMDA 3STFA 4HZ8A 4XZIA 1FKWA 1QO2A 2BGNE 5AHLA 3MUY1 1ME8A 1KV5A 1VHNA 1HJUA 4FX8A 5FEZA 3RLHA 2X41A 2PDIA 3ITXA 5A6KA 3B97A 4PUJA 5BWAA 3WZ0E 2NV9A 5E5CA 3IJIA 2PBOA 4JXCA 1GZJA 2VFFA 4MB4A 3WJSA 3T7VA 3CMFA 2GYIA 2GGHA 2OZTA 2PCEA 1TMQA 3S1GA 2NT0A 3VCRA 5M2FX 3OLEA 4GI8A 3SRDA 4UQCA 3QLLA 3IJ9A 1MI3A 3D3FA 1FWSA 1WA3A 3BG9A 5F1UA 2PE4A 4A6GA 3SN0A 5CG0A 1X6UA 2QCHA 1Q4WA 4H4IA 3OHIA 5FOOA 1UWSA 3A21A 3OGVA 4KGJA 3U4FA 1VFMA 2W66A 3A6OA 3MO7A 2Y7GA 3MV11 1JPDX 1ITXA 3R11A 1TWWA 1TQXA 1IXNA 2VR4A 1LUCA 4S23A 2BY0A 4BEQA 1QMLA 1WUEA 4P7QA 2Q8LA 1AUSL 3TJ4A 1E0XA 2NSOA 3VMOA 1LRNA 5LNSA 4CD8A 4I5UA 4R5EA 2WB5A 1GVEA 1ZP4A 2OEJA 3N4AA 4LAUA 3VMPA 4BWLC 2V5CA 1C91A 3WMSA 3DKLA 3NIYA 1B3XA 3O6AA 5DMLA 3UCDA 2DV0A 4JGDA 3R0UA 4G7EA 3SI9A 3MP4A 3TW9A 1Q13A 2TYSA 2BXVA 1YDYA 2D3NA 1UD2A 3W02A 3IARA 1CWYA 3VIIA 3VI2A 1BSIA 3S9ZA 5K9CA 2O9PA 3ZMRA 1TCDA 4AIOA 4XO7A 1US3A 3E6EA 3RLVA 2E6DA 1EGZA 3EWXA 4A3RA 3SW6A 2WHLA 3T8QA 4LAMA 3GC2A 3PWIA 1MFUA 4QM1A 1EDGA 5G1MA 3DFTA 4XQ6A 2JQXA 3ZVHB 1ZLPA 3QHMA 2OYMA 3ZZ1A 4HTYA 3EWZA 4B5UA 4AC1X 2DSUA 2ZZ4A 2OLHA 3RNDA 3MP5A 3UZJA 5A8NA 2E6YA 2VL4A 2PB1A 2I9UA 3N17A 4XZBA 4LVGA 3S1VA 1PX8A 3ZSSA 1LT7A 2PWGA 3OYZA 1W0MA 3EPNA 3NQDA 2AMGA 1CLVA 3QLDA 4DN1A 3NM3A 5E1QA 3CAWA 2YYTA 1UW9A 3M0VA 4PN2A 1XBZA 3JUGA 2XGZA 4WSJA 5HULA 4NNBA 1Q6GA 2WMIB 3EX3A 4QAIA 4FA3A 2J74A 1RJRA 1UD8A 4IH3A 2R1LA 4FX6M 4WCJA 5FKYA 3HTWA 2PDHA 1OCQA 1TV2A 2WLYA 1KRBC 2ZC1A 2QCLA 4GQGA 4W7WA 2O55A 1LL7A 4PUKA 3PB0A 1QW8A 2PUZA 4AD2A 3Q2DA 1F3XA 4YWSA 1TCMA 4M56A 4JTQA 1GQIA 4W5UA 4Z0JA 5F2IA 1MO0A 2QULA 4XG1A 4MWAC 4ZO8A 2OEMA 2TSYA 2X40A 3CL6A 1O5XA 2OODA 4JHOA 5CG7A 2QHAA 2YW4A 3BOXA 4NQ1A 3NCOA 1XD0A 1Z3NA 3GU1A 4OOZA 3ZSTA 4UXDA 1GQKA 3ABSA 1XBVA 2P1FA 1KC7A 3S3GA 4DLFA 3A9BA 4BF7A 1B9ZA 1NTHA 3I6TA 3QC0A 2J7FA 3J7HA 3H7RA 2QPXA 4U2YA 3FJNA 2PDQA 4C1LA 5D04C 3HJZA 5D38A 2DSKA 3GK0A 3B8IA 4F2UA 1M9HA 5F2LA 2WANA 4D6CA 3NQFA 4MTVA 1RH9A 2CLEA 4E38A 2CHOA 1K9FA 3TDFA 3H12A 4DJDC 3AZSA 3R5EA 4CLMA 4ONVA 4NJIA 5E0CA 3L0GA 4JQ3A 4PODA 1JCYA 5I6SA 2GQ8A 1XM3A 4RE4A 2REQA 4JQ2A 2OTDA 2CLOA 3UG8A 9CGTA 3GXDA 3L0NA 5HNUA 3U5UA 3T0AA 5EKYA 4HIBA 3ANUA 4LCRA 3L2IA 2ZDRA 1SUXA 4UFMA 3VNKA 3K1GA 5AZ1A 1UR2A 4DBWA 2FMNA 1LRTA 1UP3A 1YTDA 3IIVA 1T0OA 4K7YA 4QITA 5EB8A 3UJEA 1GKRA 1D8CA 4UFKA 4A3HA 3MP3A 3BCFA 4D6JA 4UOZA 5HXMA 5CSYA 3GDKA 4DPQA 1H41A 4F79A 1W3NA 3R8GA 3LCWA 5LNVA 1ONXA 1KGWA 1W9XA 3GVWA 2I56A 1SZGA 1F76A 2R9RA 4Z2HA 1ZTVA 2QAPA 3T42A 3L4TA 1BF6A 2HWGA 2Z29A 1C8YA 7XIMA 3OW1A 1C9DA 5D03A 5LA1A 1R86A 3M5ZA 3UWUA 1CNVA 3B8UA 5LIWX 4JQ4A 4H19A 2ZKMX 3KTXA 4GZ7A 4MM1A 1F8MA 4R9XA 2DZVA 2DJLA 2Z7GA 5HMFA 1B4KA 3VXGA 3ABOA 3QM3A 4Y9MA 1H4PA 4ZSUA 5HWNA 4JTAA 1SZEA 3ARXA 3W6MA 1YPXA 3EZ4A 3L4UA 4FF5A 3P82A 3W84A 2JEQA 3T0TA 1ZHAA 2V82A 2ZE0A 1I0DA 3PR2A 1JZ8A 1N82A 3ITGA 1OF8A 1YW1A 3N3TA 1X8FA 4ZXLA 3OZYA 1UR0A 2JIWA 4M6PA 1RUSA 4V33A 3VKCA 3BZGA 3W1AA 3EKGA 3WBYA 1R7OA 1A80A 1M6JA 1W1IE 4XAFA 3S0CA 3FVDA 3E0VA 1UPMB 1BEUA 5AC6A 1RVGA 2Z1XA 2A7NA 3WJXA 4GKTA 2PGWA 5EL1A 4UR9A 3W6YA 3IVSA 4QQUA 2Y62A 1XH0A 3LBOA 3RR1A 3PBYA 1L6FA 1R9YA 1VKFA 4W87A 1RCQA 2YCEA 5DEZA 1ZFJA 1W91A 2A6LA 1E5JA 3GYCA 1AZ1A 1QHOA 3ZO9A 1TWDA 5H91A 1A5AA 4W4QA 3DUGA 1BVNP 2DT3A 3W72A 4FOUA 1H7NA 2X16A 1LCOA 5EFFA 5EBAA 1HVXA 3USZA 6TAAA 1L0PA 3MO4A 2Z25A 4DJEC 5CJMA 2PLMA 5H8UA 3EXSA 3TN4A 1E0WA 3CT2A 4AD3A 1W5OA 1V0NA 5EBUA 4ZFCA 1E51A 4K38A 2E0PA 3OPSA 1RP8A 3TN3A 3FV9A 2OYKA 3FJ6A 2GZXA 5FACA 2ZADA 3T0BA 4ZO7A 4HCHA 4A2RA 2E7FA 1L8PA 1WDQA 2V5JA 1TPDA 2VHLA 3AISA 4R3UA 3ME3A 4W89A 3T0CA 4H04A 5HMDA 2CITA 3T2PA 5C2XA 2FHFA 3KAOA 2OVLA 3HPFA 2CLFA 3NURA 4O15A 1GKPA 4IXHA 1TX2A 3AI0A 3NL3A 2R91A 4O28A 2FTYA 1RA5A 4MG4A 4ZMGA 4FNPA 1HKKA 4H8HA 2NVCA 1BTMA 4ZGYA 3W1NA 2QUMA 3DG6A 3LGGA 1E4LA 5G5IA 4KFNA 1ISVA 2DIKA 3ZS4A 1UZ1A 4WK9A 1JDCA 4GISA 4H2CA 4FSAA 1N8FA 1EH9A 2D24A 3QYQA 2R1NA 3ARYA 3L21A 2IPJA 1NDYA 4DB7A 4RE0A 2E1DA 4R9OA 4NJGA 1CGWA 4AZCA 2QV4A 1KKRA 3WY1A 4BK9A 2P88A 1Z48A 2V6AA 4Q6XA 4BJHA 1AH4A 1OT2A 2XFWA 4IGHA 5LKYA 1XQLA 4I9JA 2VUNA 4IJRA 1DJNA 2UV8G 5CSSA 3LMZA 4KCWA 3T0DA 1TVLA 3RCYA 4F9DA 1G7UA 3AIRA 1ZGDA 4H2HA 2Q6ZA 2ZUUA 2OEKA 4UTIA 2VGGA 4P8UA 2ZWYA 4IF2A 5I3IA 2C7FA 2BOFX 1I4NA 3MBFA 4XSLA 3ICJA 3ZJ6A 4KW2A 2YDAA 3RX3A 2PF8A 2VCAA 5D8ZA 2QF8A 1C92A 3EWUA 1P7TB 3WQOA 3HU7A 2I17A 2WMHA 1ZBVA 3M5XA 2YCJA 4H00A 1U83A 1JPKA 4W9TA 4AD4A 1N8IA 2HRWA 4Q4PA 1PTAA 4I8YA 4LUYA 1BQCA 1IZCA 4A35A 3F2CA 3C2EA 5D2VA 3AWNA 4GE8A 1Q7QA 1LQ0A 1JZ2A 1RP9A 1P0DA 5DBTA 3NPVA 2YJQA 1K6WA 1UB3A 3VIOA 3GXIA 4B16A 3QMTA 1EOKA 4B9ZA 1XIJA 4KEMA 3THCA 2VOTA 3EWYA 5T8GA 3HQPA 3KBSA 5C6MA 1O6IA 3MSYA 5FCZA 4H8NA 1W3JA 4TX9A 2QAFA 3SM0A 2XIMA 3TUUA 3QQ1A 4L7ZA 3TA6A 1Q4NX 1WBHA 1KBIA 3MKCA 1CLXA 2YCKX 3I7SA 4PCTA 1BLIA 1UD4A 2QKFA 4Q4SA 2AGKA 4XBJA 4KIRA 4L80A 1WXYA 4U31A 5GNZA 3NM1A 3M46A 4N6FA 4UQDA 2AMXA 3F4CA 1REQA 1QI2A 4RNFA 4QHRA 4HZ6A 3AAMA 2J27A 1DWIM 4UQEA 4E2BA 3S46A 3MDWA 3FHAA 5CPNA 3TIMA 3I3DA 5FESA 3TONA 4MB3A 3WL0A 1OIFA 4KT2A 1N55A 1DHPA 4LOCA 1E56A 8A3HA 3G1XA 2VCBA 2V3GA 4I9AA 2E1WA 3HBLA 3LHWA 4S2CA 3E12A 4EOUA 4ZO9A 1KRMA 5HOSA 1V93A 2QIWA 3PZQA 4F40A 4LUSA 3B0XA 5A2AA 2GFTA 2V3DA 4C6OA 4DJFD 1R47A 3HURA 3NVTA 2AL1A 4WD0A 4ZFMA 4ACZA 1EDTA 3WL1A 3W7IA 3KBVA 2WPGA 2BG5A 4PCPA 2X7WA 3NPXA 1O95A 1DOSA 3AOFA 3N3MA 1HKMA 3TW7A 4OTKA 3AMKA 1DXIA 4GOAA 4WXZA 1DTNA 2ZBTA 4EF9A 2PDGA 2VGFA 2QPUA 4RDZA 3CHEA 5IOBA 1RK6A 4NASA 4NI8A 5I03A 1TO3A 2ISSA 3AXIA 1VBHA 5BRPA 4R7WA 5JVLA 2CERA 4GX8A 1PWLA 3W7DA 2DZXA 1ZP3A 1V5XA 2WHMA 4B2DD 1DXFA 2AL2B 3SJNA 3BV4A 3N25A 3VD3A 4JTGA 2Y61A 5BXPA 1DWGM 2I16A 5XINA 1DJHA 1W32A 1Q6EA 2V9DA 3P5YA 3ZWSA 3CZGA 3D0CA 3EEGA 5FJIA 3U2ZA 5D33A 4HMDA 1MNZA 5AKQA 4ICMA 3UNTA 1I75A 2UY4A 3XIMA 4LUTA 7ODCA 3PBWA 2X1IA 3V0SA 2PCQA 3ARRA 4JX5A 1PYMA 3CUXA 3QY8A 1UZDA 1V6VA 2VX4A 1Z41A 4AHQA 3ARSA 3O63A 2OX4A 4PB3A 1G4EA 2F7FA 1BYAA 3ZQ9A 1NDVA 4DZAA 1Q7MA 2WLZA 1O4UA 3QW4B 1XS2A 2WNZA 2ZUVA 4QEEA 3AIWA 2I14A 2GGGA 1XIFA 4QSHA 1W9VA 1Y7VA 3P0WA 1PJ9A 2AOSA 2GDVA 1QRQA 3W7HA 1TWIA 3VMNA 5JH2A 2PZNA 1D9EA 1SGJA 4NJJA 4EAYA 1CCWB 1D7FA 3ZFHA 5AC5A 5CC7A 3QV9A 2O9TA 8CGTA 4L4LA 3EX1A 3OBAA 3R25A 2WYSA 4C91A 2R1KA 5KZMA 2PTWA 4HNCA 3T2OA 1VCVA 4H8UA 3TQPA 4KIEA 5HWJA 1FHVA 3STGA 2O4QA 4IPPA 1QJWA 5HMEA 5DT5A 4MLRA 6ENLA 3MJYA 4J2PA 4E3VA 3MANA 1LWJA 4H6RA 1YE4A 2IKHA 3ALGA 5BXRA 3RYSA 1W9BM 2G96A 1QW9A 3HGOA 2Z6JA 3FKRA 1FTXA 4TVDA 3MYPA 2X05A 3PUOA 1TUFA 2Y5JA 4MNKA 3S1WA 1C7SA 4PTDA 3GFYA 4KGLA 3CMJA 2BLEA 1FWRA 4FNSA 4R88A 5DN1A 5IXEA 1HO1A 4OJYA 2QVHA 3M6YA 4H3DA 2GK1B 4REQA 3E2QA 4JTTA 4GY0A 2J8GA 4J3ZA 4R34A 2BGSA 2QR6A 5CJNA 1OY0A 3GC4A 2Y89A 3CO8A 1YTKA 3HFYA 3UD6A 3VKJA 1H7RA 1E43A 2IKJA 5EU9A 3CWOX 2XPKA 2PRHA 4OVXA 5BCAA 3FK4A 1UUQA 4KEZA 5CZ0A 2B7OA 4FS9A 3ITOA 4Z2LA 1P0EA 2E3ZA 1QI5A 4UTWA 2FPYA 3SN4A 4CKQA 4AG0A 3UEQA 1DHKA 3W2MA 4B5VA 4LCSA 4TV5A 2CZFA 4C6KA 3DFSA 4PBEA 4F48A 1TMLA 1GYMA 3BSGA 2ZXBA 5A6LA 5DX7A 3UPBA 2EO7A 3POCA 1VEOA 5HQEA 1JGIA 3I7RA 1QI0A 4BQ2A 1LORA 2C8NA 1EDQA 5I23A 3GTFA 3WQGA 1R8LA 4D72A 1ZJAA 2VX5A 1EHAA 1GW1A 3MWCA 1SZNA 1CGTA 4QTGA 3RX2A 2X0HA 3W24A 2XFFA 4K36A 5IDZA 5DBUA 4O4VA 3UGVA 4DF1A 3R2GA 3W1QA 5E93A 2ZZ6A 2DT2A 3N12A 4AH7A 4YTUA 3C61A 4B5SA 2V63A 3A5VA 2QGHA 2OOGA 5CZJA 2OB3A 4K68A 4C1NA 3G3DA 1WO2A 4IMGA 4GI9A 4O18A 5A6JA 3XINA 5HNRA 4WDXA 3CPGA 1RBLA 4TVUA 2I9EA 2O4MA 4JPGA 3EA1A 4ZVJA 3LNMA 3VCCA 3EA3A 1QI3A 3K46A 2YB4A 4NRRA 9RUBA 1B3OA 1A47A 1R6WA 3S1XA 3V35A 1JPHA 3DI0A 4V1YA 1K03A 3UJFA 1C3FA 3KLLA 1VC4A 1EGVA 4AMCA 1C8QA 4S2BA 4TMBA 4H9TA 1ZJIA 5CKSA 6PTDA 3GDLA 4AXNA 1U1JA 3BTNA 3KVMA 5I00A 1LWIA 5A8GA 5LNWA 5D9OA 2JF6A 3VNJA 4XUGA 4YCOA 2WSRA 1R9ZA 1W56A 4MWAE 4A3YA 1TPVA 4HPNA 1E3ZA 1U5VA 2PMQA 4AIBA 4P7NA 1KR0A 3WD1A 1KCZA 1TJ0A 1S39A 3VGGA 2Z1VA 3SIMA 3EA2A 1DIDA 2ZA2A 1VFSA 4PEKA 5REQA 4E8DA 3WKZA 2ISWA 2WNNA 3DECA 1PKMA 5G1YA 3VD9A 4US5D 1XC6A 1SU5A 4S3JA 3EX6A 4AIUA 1ONWA 5I3KA 2PC4A 3RO8A 3SCWA 3TCEA 4DY1A 1DQXA 2JEPA 2GVGA 2A4AA 1O66A 4ZA0A 1DL3A 3WN6A 3DEQA 2JKPA 4UTJA 6CGTA 5LSMA 3FAWA 1WDRA 3GO2A 1LDCA 4A8LA 4HNUA 1H7XA 4BHYA 1W5NA 2CIPA 1PDZA 4D6GA 1FBAA 2QJNA 2WJDA 5LZLA 2BVTA 3AS0A 1O68A 2ZXAA 3OZOA 1S3TC 3GKFA 3C0SA 4TR9A 2XIIA 4IUGA 5E6YA 3N4EA 1EL3A 3CZ8A 1K70A 3CL7A 1A5CA 3UW6A 2ZTKA 4YYCA 3R79A 5I3FA 4DJFA 4GLEA 1X98A 3WX7A 4J3WA 1UWIA 3G22A 3OBKA 3SECA 3LLFA 1J2BA 1KGUA 2VXNA 4B92A 3KCOA 3N4FA 3S4TA 4X2PA 3SBFA 1J11A 3CNYA 1R7AA 3SSJA 1MZRA 5D37A 8RUCA 3FXGA 2FHBA 3E74A 2ACRA 1GVOA 4UFLA 3O6YX 3NXFA 1IEVA 2V5BA 1MZHA 1B0IA 4TTUA 3PZGA 2A3HA 2NQLA 4RZ5A 3M9YA 2OKTA 3JZUA 3RO6A 3CV2A 3K8LA 3R58A 5ABEA 4C6MA 3S2CA 4FALA 1OCJA 1MUMA 4I9MA 3WUFA 4OHQA 4B2DA 2F84A 3RRXA 2FJKA 2C91A 5LIXX 4RPQA 4B3ZA 3I3BA 3RCMA 3VIKA 2FGZA 1LF1A 1EC7A 4GZEA 3KRSA 3ARZA 2BBFA 3B8VA 2EPNA 1TVNA 3FGCB 1TV5A 2I5QA 4DUOA 3MCNA 4ERAA 4M6QA 1VLWA 1E1CA 4LCQA 3ZXWA 3BQ5A 3K2GA 1VFHA 3GLCA 4S3EA 3MMDA 1L2UA 3UETA 5EMLA 1HFBA 3K30A 1FWGC 5ECUA 1MSSA 2GDQA 4UR8A 3BLIA 2W62A 3QXBA 1TIWA 4AZ7A 3QPYA 3SCTA 3EPMA 3QR1A 2ZRYA 3BW3A 2CZDA 4LXFA 1PYFA 2RAGA 3SUTA 1HGYA 3CU2A 3DYPA 3VE9A 3HGRA 4YJ5A 3W7QA 4IZGA 4H7ZA 3E0FA 3NXLA 5BRBA 1OYBA 4C5YA 3MMTA 3LPPA 4TOQA 4JX6A 4DELA 4AUBA 4DXVA 4X3ZA 1QNQA 4K37A 2D69A 3EX2A 2NQHA 4DF2A 3N9SA 4EWJA 4FOKA 2X2YA 1F4AA 4WEVX 4WHBA 4F2TA 2DDXA 2CU0A 4NP7A 3W07A 1C9WA 1E73M 3HO8A 2POZA 1X1OA 2Y7DA 2O56A 3W1TA 7TAAA 3S6TA 6REQA 2YDSA 4DYJA 1PTGA 3VOCA 4O1AA 3R1ZA 5GNYA 3RHGA 1W1ZA 4LNYA 2Y8VA 4CQAA 1HL2A 1MUCA 3FEMA 3A13A 1VFLA 5AYIA 1S5VA 2W91A 4N42A 3SUVA 5AYBA 1Q7ZA 3TYAA 2NUXA 3PZ9A 1PAMA 1JYWA 2LLEA 4AD5A 3NQMA 1UOKA 4MZ1A 1JYXA 5ABHA 3TW6A 1Z44A 1J5SA 3DYOA 2XU2A 4OT7A 3QOMA 5A6SA 2VURA 1KFWA 3GIPA 4C5ZA 3AQUA 3L4ZA 4QRNA 2D20A 5CPSA 3AHZA 3SRHA 2EPMX 5C0QA 3WNOA 4DEFA 5I5RA 1XIMA 2QUUA 4M29A 1UUMA 4HZ7A 2F38A 5LA2A 1OD8A 2WSKA 5AC8A 4PUMA 3GG7A 4ORMA 4V2XA 1HVQA 3V18A 2ACSA 1K9DA 4MKVA 1OC7A 1RALA 3QZ6A 3QH2A 4X0VA 3MI6A 3T55A 3VIPA 4PB4A 4A2SA 4IMAA 2INFA 3CASA 4KCTA 5C55A 2ZRWA 3EWDA 3K4WA 3BSMA 5JH1A 1CYGA 3NZQA 1M1BA 1XG4A 4CNNA 1UIPA 4K6AA 2V68A 4JYEA 1GOMA 4UFHA 3HM7A 4MWAD 4EXAA 1P0NA 2W27A 1XPGA 4DNHA 1VP5A 2VTFA 1BAGA 4HU3A 1TJPA 1VYPX 3LHYA 1NP0A 3WD3A 3GC5A 3I6EA 3L68A 4XD3A 4GIRA 1FWJC 3P7YA 2RHGA 3TWAA 3N9KA 1IZKA 3OLGA 4XAGA 1UC5A 5A5WA 3NEVA 1QHZA 2D73A 3ABRA 5HATA 1I1XA 2VFEA 2JE8A 5HNNA 2V67A 4R85A 1JYNA 1MEWA 2OSWA 3GFZA 1VEMA 1CB7B 2XWDA 4PE8A 3THDA 3TXZA 4UC5A 2G3FA 1SQ7A 3KCLA 3DHPA 5CCZA 2WQDA 1LM1A 3L4YA 5T91A 3GNXA 4DJDD 4YXGA 4EP8C 4PTWA 4PBGA 3GTXA 1OC6A 5FJPA 3ARTA 3M5VA 3FLUA 4IIBA 4LT9A 3DN5A 3MUXA 1HKJA 3TAOA 3AC0A 2FPTA 1AG1O 5L6UA 4OWGA 2B31A 5C9WA 5CC3A 3HIJA 4LALA 3G6MA 4PSRA 9XIMA 6TIMA 4XIAA 3GHRA 2IS7A 3DYMA 4YN5A 3PTDA 3JRKA 3VA8A 1DIOA 3FN9A 4LY8A 4GI6A 1U1HA 3W7OA 4ICNA 3ARWA 3P8JA 2YB1A 1XGEA 4PTNA 4FAMA 1SZFA 4US5A 3W37A 4ADTA 4M5PA 1JCLA 2FVLA 3LBMA 4CQ8A 4O19A 3SCNA 1EJSC 4L4MA 3KRBA 3CIVA 3REQA 1UD3A 1CXHA 1B30A 2J8FA 2ZFAA 1UR9A 4KEUA 5DLCA 3N2BA 4ML9A 4FOJA 3NNTA 1XIBA 2WCSA 2BVWA 3UY8A 1KV8A 3BICA 3VILA 3KUMA 1RA0A 2UY2A 2BS9A 2QT3A 2G50A 3THAA 3VD4A 1U33A 2H3BA 2QDGA 1DV7A 2EKGA 4NSBA 3DBPA 4MY1A 3LRMA 1EJTC 5T26A 1F2JA 1XFCA 2PRLA 2YL6A 3ABQA 4OZOA 5J04A 3U5YA 1JNEA 4QS5A 4M82A 1UR4A 1ENUA 3U9IA 4GIAA 1DJYA 1F3EA 1O1ZA 1WDSA 3W1UA 2AKMA 3GXNA 2TRSA 4RDYA 4UUIA 3VGDA 3F4WA 3C2YA 2Y24A 4N6EA 5BU9A 1LQAA 3WF3A 4LU0A 1W1TA 5AYYA 2BTMA 3L5AA 3UYIA 5CPOA 3IJDA 3L0KA 1FRBA 4LV4A 2A85A 3DCPA 1DIKA 1QPKA 5LA0A 2GJLA 1CXKA 2PS2A 2YZRA 4L6HA 5FD0A 4P5UA 3P2VA 1XSJA 5H1WA 1XKJA 3WEZA 2PA6A 4FO4A 3B06A 1KFBA 3W9ZA 1ZQ5A 1DP0A 1DBTA 4YVPA 2PWDA 2R24A 3N2XA 1PZ3A 1PUDA 2DIJA 1RLDA 5E09A 5FSDC 2DZWA 2AKZA 2NXIA 3O1NA 3QW3A 2DH3A 5FF4A 4IWWA 4Q33A 4HN8A 2EJ1A 1BPLB 3CXOA 1KFJA 2KX9A 5T9CE 3BE7A 4DJED 1M04A 2V8ZA 4CNPA 1XLJA 2WM1A 5DY2A 5EPDA 3NG3A 2XH0A 3W1LA 5ENLA 2CEQA 4K1WA 2QV5A 4Q7BA 2BSLA 1IIHA 2WO5A 3HV9A 4QLLA 3MSDA 3C0JA 1WXZA 3BH4A 4QE5A 2X1RA 2OPJA 1EJWC 4QE1A 2ZWZA 4DBUA 3G0UA 5CAHA 2YXXA 2Y88A 2ATSA 3D3AA 1BG9A 1J10A 3NPWA 3VKBA 1EBHA 3NQ6A 3JS3A 2FZBA 3V16A 3GXFA 1FH7A 1U1UA 3HN3A 3SURA 1FHLA 3UXKA 1UUOA 3OODA 4P8XA 2POTA 2FZNA 4I8DA 4KS0A 4PA8A 5FSEC 2G0WA 3AXMA 3QMSA 1B1YA 5D09A 1JQXA 3DHFA 1TJRA 3CHCA 4L6DA 5IFPA 4H6EA 2HVNA 2Z26A 3WBAA 4PMQA 3T9PA 1X96A 4O4WA 1X6NA 2GJXB 2GDUA 3HQOA 1V3HA 3P84A 4DYKA 1UCWA 3CUIA 1UQYA 2J7EA 5HPOA 2QCCA 2R8WA 1QNSA 2X30A 3ZOAA 3FX4A 1DIEA 3U57A 4A8RA 4XZNX 1TTIA 2J7GA 2Z2UA 4XKMA 2OCZA 3A23A 4PMYA 3U4AA 2FH8A 1EWDA 3EEZA 4GVHA 1Y5VA 4YCPA 4HU8A 3AZRA 7REQB 1ZRQA 1K1DA 4WVXA 2J24A 4LRSA 1UBPC 3P67A 1P48A 4RV8A 3K4AA 4IICA 3C56A 2PDWA 1QW7A 2BHYA 4XVDA 3EOSA 2VD9A 3LK6A 3OGSA 3PF3A 2OWWA 4DZHA 3E2VA 2MANA 4J27A 3TWBA 3AS1A 3WQ4A 1JCXA 4XZLX 4Y9PA 1S5WA 2YL9A 1NWSA 3WFLA 4QEHA 2VENA 1UPPA 5FF3A 5G2IA 4DO7A 1H3GA 1LBMA 3LHTA 1LRQA 2VEPA 1F6PA 3C2VA 3GBEA 3G0SA 4MJ2A 3FY1A 1R3SA 2BGQA 2QCNA 1V6UA 3CEUA 3KBMA 3RLUA 1BD0A 5GJMA 4IJBA 1K8YA 1Q2SA 3UCCA 1LJYA 1WOAA 3WDPP 2D2OA 3TLQA 1F61A 4CU8A 2WQPA 1O12A 4B90A 3Q37A 1KW1A 4MWAA 3RU8X 3IRDA 4JFTA 1FCUA 4DWSB 3MYOA 3TNOA 3GHSA 4NZ3A 2R6OA 1A5NC 2Y7FA 4X22A 4F2BA 3H70A 4AWUA 1PKYA 3UBPC 1PZ0A 4D6EA 3WMBA 3BZJA 3TR9A 4H7VA 1Q6QA 3B8TA 5KETA 4UMBA 4YS1A 3IAQA 3PZOA 3V1PA 1KR1A 2V2HA 2DEPA 3WD2A 1ITUA 3JZEA 4M6UA 1AFSA 2OELA 4J3VA 3Q45A 2XN2A 1M5WA 5AVNA 1S2TA 4DUXA 3N2OA 2FZDA 4KERA 4WDTA 1KKOA 2I1OA 1YADA 3CZJA 3MHGA 2X2GA 2CLKA 4KF1A 2GWGA 3HPSA 2E6FA 4A21A 4DJDA 3NEHA 3C52A 3W2JA 4YTRA 1V6XA 4IQDA 1KLZA 2C1HA 4RPPA 1EUNA 4X63A 3LB0A 2Y1HA 4XX6A 1S46A 5KITA 2DZPA 4FZIA 1JXKA 5BWFA 5CH9A 2WZEA 3ANVA 5LHFA 4C6EA 2H6RA 4TX8A 2I7GA 1R87A 4HSOA 4G6CA 1OX4A 3DESA 1G4TA 3G24A 3EAUA 3E5PA 4Z08A 1PHQA 3N04A 2X1SA 1IQ8A 1NF0A 1SO3A 3FJ4A 1XHGA 3M0KA 2E68A 1EP2A 1F05A 2DVTA 1T8XA 1SSDA 2OWCA 3TYDA 3RX4A 1NAL1 4GINA 3AUOA 1FVPA 4RW3A 2PRMA 3S5YA 4CUCA 3A4WA 3P3BA 4Q7IA 1MWOA 4KETA 3ITYA 5AHIA 3VE7A 3P62A 4S3FA 5J8LA 3OYXA 3TV8A 4MKNA 2TODA 2DT1A 3CEPA 4HT3A 3CQHA 4AEEA 2F6UA 1RJPA 3NGJA 1NWRA 1J0ZA 1GPWA 2DU2A 3A5FA 2OGYA 2PU1A 2Z1WA 1PIGA 2YCLA 1HN1A 3W2NA 1A50A 4G9PA 1AW2A 4U5IA 4XIMA 2V5KA 2DGAA 4B15A 1TV3A 3GAYA 3T44A 3C0QA 3HGJA 5IRPA 1BKHA 1S3HA 4XBKA 4X9YA 3W70A 3WDQA 2V3FA 5K3VA 3DDMA 1IT0A 3IV3A 3E0LA 4K7VA 5JIWA 4HK6A 3WF1A 4C6DA 1HIZA 3TOYA 5GNXA 4MPKA 1W9PA 4Q8UA 2XFYA 1IWAA 1JZ5A 3PC0A 4CEUC 4J3UA 5HPCA 4PUEA 5AHEA 4JDYA 2YA0A 1GONA 3EKZA 3DH7A 3RITA 1JXJA 1VFUA 2ZRUA 3NSMA 4C6IA 3I4KA 4NAEA 4QNEA 1QXLA 3NR0A 5AOUA 5IM51 3DFOA 2DSWA 3CB3A 1HP4A 2NQ9A 1I2RA 1CZ1A 3U2OA 3S8HA 1V3LA 2J6XA 5FJRA 4JN7A 2NQZA 4URIA 1AW1A 3B8WA 3S6DA 1SZRA 4H7CA 3BLPX 5PTDA 3AU2A 3U0HA 5ABFB 4JTDA 1HL8A 4HMEA 4L1GA 2WMGA 1HG3A 2Z1SA 2C71A 2EF9A 1K4HA 4YTQA 2I5GA 3NJ3A 1KXTA 1V0MA 3IWPA 4NU7A 2C18A 3E9AA 4CQBA 1G6CA 1E40A 3UZZA 4O57A 4A3QA 2EGZA 1NOFA 2PU0A 3BC9A 4MY9A 3M1ZA 1WPCA 5TF0A 2P0IA 5EYWA 1ODZA 2F9RA 2FB3A 2YPIA 3KCJA 4WKAA 3N2CA 2HQAA 1J4EA 2CNCA 4AF0B 1J0YA 1JR1A 3NQEA 5U7SA 5M5DA 1S38A 1HZYA 3GTHA 2NQJA 3GU2A 4QFUA 1FFQA 1ML1A 3E0IA 3T4WA 4GYFA 3IIOA 1F6KA 1E4MM 1EZWA 3HG4A 4JTUA 2ZCGA 3KZSA 5A2BA 1UKSA 2JALA 1TV7A 3UJSA 4KPLA 5KINA 2PWEA 4PFHA 3KLKA 3WNNA 3TJXA 4Q8NA 3BG5A 3AIUA 4L65A 4O12A 5F1VA 1HTIA 4FXJA 4IMFA 3B0UX 2A0NA 3KVJA 3S5ZA 3VOJA 1RD6A 3AIEA 3CTTA 2EQDA 1OYAA 4QDMA 1Q85A 3FOKA 1XSKA 4I3GA 3IJ8A 4HNLA 2IUZA 3M0XA 4PUNA 1KXQA 1XRFA 2WV8A 3LHZA 2G3NA 4HU4A 2YKKA 3GTIA 3L2LA 3PHAA 4IIDA 2XIJA 2PLJA 2NV2A 3N1AA 1BWKA 1SM9A 2O7SA 4LYPA 4ZCWA 1W9UA 2V5DA 3UJ2A 2ZICA 3A4XA 1BVZA 1XQKA 4NKCA 3OB8A 4PFMA 4PRRA 5E70A 4NZJA 4QNWA 1O60A 1T41A 1G67A 4NZFA 3TQKA 1D3HA 2V69A 4AHOA 2VYOA 4A29A 4FK9A 4ILSA 2XJ7A 1PKNA 2VC5A 3IANA 2YX0A 2UBPC 3A3HA 4PMNA 1F9CA 4GHRA 2DP3A 2G37A 2RJHA 1W3LA 1YYAA 4L9XA 1PWMA 2PDPA 1E6SM 1E70M 4M51A 4V28A 3WFAA 3TYEA 3C0LA 3NQ8A 1V03A 1KD0A 4J3TA 3L9CA 1QOQA 4U4MA 1EIXA 3EXTA 4C6BA 4H01A 1GCYA 5HUPA 3R6IA 4LQ1A 1CGUA 1KLYA 3DGBA 1RPXA 1HUVA 1UZHA 4HPGA 1J93A 3S47A 4AD0A 1HJSA 2NV1A 5K9XA 4F8XA 4ROPA 5A8QA 1R2TA 4CU7A 4HCDA 3ZR5A 1RY8A 1UA3A 3B04A 1OD0A 5J5DA 2EPKX 5DCBA 4FR1A 3LQGA 1M68A 5H6HA 4AZ6A 1KTCA 4MKSA 3HPXA 1JUBA 2E9MA 2YBVA 3TTSA 3KXQA 1VB9A 1QVBA 1B3VA 3Q94A 5DO8A 1LOSA 3B0YA 3TVAA 4F66A 1YMYA 3DX5A 3UU0A 4G1KA 2VR5A 3AXHA 3PBGA 1QO5A 5JBDA 1HW6A 1BSLA 2DIEA 2C1IA 1H0IA 1GWJA 5I77A 4F0HA 1EPVA 4Q4RA 7ENLA 3WLJA 3CIWA 2WM0A 2XIQA 5B7ZA 2X09A 5AHNA 4MZ8A 1OJXA 4FI4A 3M16A 3WLMA 4ZTYA 4FNTA 1JCTA 3S9YA 2ISVA 2IQTA 2IPFA 1PB0A 5TNVA 2DUXA 1NFBA 3L4VA 4R53A 1V02E 4NY2A 2VGBA 1NDWA 4IG2A 3NO5A 5IBXC 4ADUA 1RBAA 4S39A 1QOXA 1DTUA 2J4GA 4LVFA 1J8VA 2R94A 5E9AA 1Q2RA 3TYCA 3I10A 3PG9A 3PWGA 2PP0A 4GO9A 4TXEA 3TQ0A 3WO8A 2HJPA 4S3GA 3UQNA 4ML4A 2PGFA 5A95A 1TV4A 3HOJA 3LCHA 1JD7A 4BFAA 3U7VA 3VIHA 1XSIA 5I09A 3UWYA 3OOQA 3TYUA 1FWEC 2FKPA 1XIHA 1FWDC 3PG8A 5E9XA 3HQ1A 4Z42C 3D47A 1GOOA 3WUEA 4NXKA 2A1YA 8TIMA 3O0FA 2G5WA 1EEXA 5CGQA 3R10A 3WQ6A 4OQVA 3MQTA 4JTJA 4EE9A 2JIEA 4GUIA 4LEFA 3DENA 4C6FA 5AHMA 2RJGA 3CM4A 2CBJA 1HP5A 2HTMA 3VNLA 3I65A 1FWAC 2Q09A 3GVQA 5DRCA 4FHAA 3TN6A 3AALA 5H8PA 1CX9A 4WX2A 3WUBA 3EWCA 1PEZA 3SRKA 1ITQA 2NXHA 2VMFA 1CXEA 1CXIA 1QTWA 2HXTA 3KE0A 3M6DA 5I02A 2UY5A 4Z1YA 1OWQA 5AN7A 3VIFA 5G2WA 3HMJG 2OGJA 5AECA 2ZZ7A 2YDQA 3HMCA 3M0YA 3UT0A 4RZBA 2GGJA 2ASHA 4F0RA 1FWTA 3WEMA 1TYGA 1RVKA 3GWQA 3W1XA 2B0MA 2FIQA 4JTEA 3W7CA 1ZAHA 4A8IA 4MZYA 1KCXA 1YBQB 2WJEA 4GKLA 2BP1A 1W37A 1NQ6A 1MRAA 2KAUC 2OQYA 3LM3A 3ES8A 1XGZA 1XLAA 4H9XA 1FKXA 1KM4A 2EJAA 2H9AA 1B3ZA 3ECQA 3FYYA 5A6TC 4V15A 3UXLA 1PDYA 2YCLB 4E2VA 1GTEA 1W1A1 2GLKA 2PZ0A 4QXIA 1MYRA 4N9BA 5CAKA 3KWXA 1AW5A 3EDFA 1OADA 3S5NA 1C8XA 1NFPA 4QG6A 2WSPA 3MW7A 2PDUA 2D1ZA 3DI1A 1W3TA 2QJJA 4HYRA 1TG7A 2O9RA 4W85A 1AMYA 3RGTA 1CB2A 3D5HA 2WMJA 1GEQA 4XD6A 1BRLA 4IPIA 3CQJA 2DY3A 2EG7A 1PCKA 4XKYA 5F7UA 5AYXA 4K3ZA 3VNYA 5I3JA 4CQ9A 4V1XA 4ZQOA 3NFUA 4LSBA 5EMMA 4UTMA 4YVVA 2PI6A 3KTCA 4QROA 1SW7A 4DBDA 4HTBA 1XFBA 1O5RA 3WD4A 3CC1A 1FHDA 3O2LA 1DWHM 1PZ2A 5HR6A 4QG9A 2XVLA 1E0UA 1FA2A 1EKOA 4H6KA 1GW9A 3NQBA 2ZUMA 3NZRA 1THFD 3H23A 1Q6CA 1A53A 1B57A 2VFHA 5K4XA 1IEQA 4UQBA 4IMDA 3WK1A 4GXWA 3P74A 4KKXA 4GBUA 4GBDA 2VX6A 3B3DA 3FA3A 1G69A 2C3ZA 2ZZ3A 4K2SA 3V0TA 4RNIA 1J0KA 2WZTA 4Z1AA 2VRJA 3DBNA 2PDFA 2X8RA 3BQ6A 1M7PA 4Y6GA 4KRUA 4BQ4A 2J79A 4QISA 2GOUA 3RPMA 1NH6A 1W5MA 1VPXA 4UQ9A 5HQMA 2WVSA 4O1DA 1WXJA 1FXPA 4DX3A 2X1TA 4YMZA 1KGXA 3OIXA 3KDNA 3SCPA 3MZ2A 1QBBA 1V77A 1IIGA 3INPA 2J77A 1TRDA 4A8NA 2ZX6A 3SCSA 3QJAA 4B9YA 4OUIA 3PZNA 3P14A 3TC7A 3BMVA 4U10A 5EA9A 3IIPA 4MJ4A 2DSVA 5LGXA 3VU2A 1KM1A 5C9XA 5DANA 3PZUA 3QSRA 5DXYA 4FXSA 3L2MA 5CXPA 1JDDA 4C6JA 1F6YA 2J7HA 2P50A 2BZNA 2WNQA 1W31A 4UTFA 5LXXA 5A6AA 3CQ0A 3BOFA 1GORA 3B40A 3U48A 2D22A 2ZRVA 5MKGB 4D8AA 4Y9AA 3VOFA 1MFVA 1W1B1 3VCNA 3OLIA 2HSAA 4PL2A 1VD6A 3PNUA 2BX7A 4GUHA 3NUKA 2DUAA 3KS6A 3LV6A 2QJIA 1JFXA 1EJVC 1YDNA 3WCZA 3S42A 4B3KA 4IGSA 1EF2A 4NNCA 3WQVA 3U8GA 2Z00A 2J88A 3TH6A 3LTYA 1GZGA 3AUJA 3GW0A 3WH6A 1MNSA 4LY4A 1XYAA 2CKSA 1QAPA 2QUNA 1VHCA 1OK6A 2VEFA 1A3WA 2PDXA 3ARUA 3C5QA 1Z7AA 4INFA 1DVJA 1FOBA 3TYBA 1A0EA 3SGZA 1CT5A 3H4GA 1E6ZA 1FCBA 2GQAA 1OFBA 3NA8A 1J18A 3N18A 1MXSA 4DO6A 4EPBC 3L5MA 4JL2A 1EJXC 2BY3A 4ROQA 3VUSA 3BLLA 1EGMA 4JCMA 1AQMA 4LWWA 4H1ZA 5CEWA 4N02A 1H60A 3QY7A 1JCJA 3OJGA 1NWUA 4U5KA 1X7FA 4YWIA 4IJCA 4ZXOA 2PTZA 3IUHA 4MDPA 4EVZA 4DYEA 3MDUA 1XIIA 2SFPA 3KP0A 1TSIA 1FP9A 4MNMA 1Q8AA 5D8WA 3TTQA 2P10A 2BHZA 3GXTA 3MKVA 3LNPA 2RDTA 3RUBL 1W1YA 1JG9A 3UVIA 1W8SA 2OQHA 4NZ5A 4UOQA 3R4IA 4AMAA 3AFBA 1T7LA 2R14A 4KMQA 2C14A 1QU4A 3LZ5A 4I7WA 3VM5A 2W6RA 3P8IA 3M0JA 4AQLA 7CGTA 3SCOA 1FFRA 1KFLA 2XDFA 2X1UA 3LZ3A 3II1A 3BSHA 3QFWA 2DZSA 2W0UA 5M03A 5BW6A 3W76A 1OC5A 1JDFA 4LRTA 1WP6A 3FVMA 3FNDA 2E28A 1GQJA 3V36A 3NL5A 3B4YA 4HA3A 1RV8A 4UZUA 3H53A 3A47A 3QPZA 1K8XA 1KTBA 2QCDB 1S2VA 2EPLX 4EXBA 2BV9A 4D8LA 5HMSA 3W1RA 5HJXA 1ITCA 4UWMA 1X1NA 1FXQA 1TA3B 1EOMA 4JFSA 2VOMA 1XIGA 1QNVA 1WZAA 4IP7A 2J8TA 4BS0A 3TKFA 1D3CA 3VYLA 1KM2A 4IIGA 1Q45A 1XLDA 3CBWA 4LH8A 3OVRA 3UWEA 3LYEA 3UVAA 4AX7A 3DKJA 5BNKA 5JIPA 2GVYA 2B4GA 3O05A 4TQTA 4M7SA 3UYCA 3T1GA 3WK0A 3WLOA 4OIFA 2Y8KA 4E4FA 1XC4A 3SCVA 4UNKA 3QR0A 4M6VA 2PGRA 1EXBA 3G8RA 2E5CA 1RHCA 4NAFA 3RK8A 4BF9A 3I3EA 3QV6A 1K9TA 5G4WA 4WSKA 2XG9A 4GY7A 1HF6A 1EO5A 2CLPA 1TUXA 2F61A 1VF8A 3LXBA 1K8CA 2VT0A 2H90A 3CV6A 5FAGA 4JN8A 3U3HA 3CQKA 4ZEPA 1JULA 4L9ZA 2Y85A 3QSTA 4EX4A 2NT1A 3KRUA 1XGDA 1VENA 1JYVA 1NU5A 4A4AA 1BGAA 5A3HA 3BK0A 4GUJA 4M19A 3F5KA 4I7UA 3P5ZA 1Y5WA 1KCKA 4WR3A 1TPB1 2ZVIA 4D6HA 1GJWA 3VD5A 1MQRA 1A4MA 1V3IA 2J7BA 3M7SA 4ASTA 4CCZA 4D2JA 5IDIA 3AIVA 3ONCA 5HA7A 1FCQA 4OU1A 4ZE4A 4AWTA 3EOLA 3UXAA 4DUVA 3W01A 3KBNA 1P0KA 4Z0SA 4C7GA 1W9DM 2YYUA 2TPSA 1DJIA 3B9EA 4WDWA 3ELFA 1J0JA 3IRSA 5HNTA 4MYAA 4MADA 2ZA3A 1T96A 3RJXA 3TTYA 2J66A 5CZSA 3W87A 3F4DA 1WKYA 1WBJA 3MCMA 3S2LA 2I5IA 1OF6A 5A6BD 3G1DA 4WXYA 1ADDA 1W1VA 4I5RA 4N9CA 4QIUA 4Q4OA 4X60A 4Y9NA 3AXXA 4LYQA 3IK2A 3WNKA 5D9MA 1UR8A 3LY0A 4AY7A 2J6VA 1R3RA 3WQEA 3VX0A 2YGYA 2WVVA 3VZZA 1L6WA 3SY1A 3QN3A 3W86A 1IT7A 1LWHA 1OHLA 4WY0A 4WZHA 2E67A 3GH7A 3MCOA 4CNSA 1XIEA 1DJZA 4CN4A 3TSMA 3WQWA 2ALDA 2GUYA 1RK5A 2G4JA 1L6GA 3E5BA 2IW0A 1AJZA 1EX1A 3VAVA 4I6VA 3MSGA 4XKYB 4RW5A 4GRSA 1BKSA 1E72M 1G7VA 3VUPA 2PTDA 1XDLA 3EOOA 4FLRA 3MI3A 4GXMA 2PPGA 3AIBA 1TTJA 5DCEA 2NZLA 1VAHA 2ZQ0A 1R3QA 4PMRA 1WCGA 1JF5A 1VBRA 1BGGA 3T08A 4GYPC 3NWRA 1NY1A 4AVNA 3NQ7A 5EFDA 1R2SA 3QVQA 3G1RA 4JNMA 1B31A 2IXVA 4C6QA 2CHRA 4IX2A 2RKXA 2E25A 2Q02A 1F5ZA 1I2PA 1SPQA 1KXVA 3A9IA 1SW3A 3DC8A 3EXRA 1ADOA 1O5QA 1R5YA 4DHGA 4RCXA 3IGXA 3C3NA 3G8EA 3EDJA 1G0CA 2OJPA 3N11A 4MNLA 1AD1A 4WKHA 3VFLA 2ZA1A 5C2CA 4FP1A 2ZX7A 3WF0A 1FH8A 3LHUA 2YOCA 5DCDA 3TOPA 1E0VA 4O52A 4XZ9A 1QWGA 3HV8A 3IV8A 1B3YA 2QVNA 2ACUA 3ITTA 3SIZA 2CLMA 1JRCA 1RD5A 4FNQA 4OE7A 1V02A 2NW0A 4IL2A 1LUCB 1VIZA 3DZ1A 3WF4A 2W9MA 3CH0A 3G0XA 3GVVA 1OFEA 1GEHA 2XGBA 3BW2A 2E09A 1H63A 4K8EA 1X1ZA 3LRLA 4E8GA 1QR7A 3FDGA 3CTLA 4IL0A 3H2MA 4AZGA 2EG6A 2YDRA 3TZNA 2VKZG 3UZWA 1EC8A 3L7RA 1B90A 1GK8A 1R85A 4G7EB 3CWHA 2QIIA 3G1FA 4ZENA 1P1XA 2Q8ZA 2V0TA 4KFPA 3EB4A 2VZOA 2YW3A 5KZDA 3DU0A 3F7JA 3L66A 1XRSA 2HDJA 4O13A 4DJFC 3NTYA 3Q58A 3QKEA 2WVUA 4TUFA 2Y8UA 4LB3A 3SDOA 2WWDA 2FLIA 1XYCA 2GVJA 4GI4A 3WLTA 1X39A 2DZUA 2ZE3A 4O14A 3MMWA 2PGEA 4E2OA 3G6LA 3AYTA 3IPWA 1SFSA 4QGCA 1YE6A 4IIHA 3QGVA 4XISA 3IAPA 4LB4A 1XBXA 4QP0A 4JTRA 3OTRA 2HVMA 4DBEA 3CZLA 1UA7A 1TREA 2E5DA 4LJ3A 4HA1A 3W82A 1S5MA 2E8ZA 4KRTA 5D02A 4Q8OA 3IVTA 2YFOA 4QR6A 3QYSA 2QCGA 1WDPA 4QQ3A 5D05A 4NT0A 5DRIA 3GG8A 1MUWA 4ECLA 2J25A 5CBBA 1OX6A 3N2MA 1XKYA 2WPBA 2O7QA 3MJMA 1GZ1A 1K8ZA 3WLKX 1XRTA 3W53A 1KA9F 3CLWA 4YTSA 3MKKA 1FX6A 1D3GA 3CUGA 3OU8A 2XHYA 1S1PA 5A1AA 8XIMA 5BYWA 2BODX 3BCDA 1LOLA 1YNPA 3ZVHA 1NELA 3EDDA 1H09A 4RXFA 1OGBA 2CLIA 4LX4A 3VFCA 2ACQA 4KWWA 4JL1A 2MNRA 2FH6A 3LDVA 3PVFA 3BLKA 1NOUA 3GSMA 3PK7A 4AXKA 5LGZA 1GVFA 3CZKA 2G4FA 3KZPA 3OZPA 2NVDA 4LTSA 3A3WA 4KEVA 4WUIA 5KZEA 3BLOA 4DPPA 4JTLA 1HJQA 3ZT6A 1G4PA 2XFRA 5CC5A 3N15A 3AXKA 1J0HA 2FB2A 2OFJA 1EYWA 1TZ7A 3BXWA 2WOQA 2JBMA 3SRFA 1M41A 1Q6OA 5K7JA 3TYZA 2E8YA 4Q8QA 4F9JA 4XBSA 1W17A 3GHTA 4O0QA 4O8AA 5BOFA 3BAKA 1RCOB 2J9ZA 4DF0A 1LG1A 4GNJA 3AHYA 5HANA 3WDRA 1NF7A 3MUIA 5TD4A 1D2KA 3PJUA 2Z7KA 3PUDA 1H7WA 2WMIA 4UB9A 1IV8A 1KB3A 1GJUA 3MUZ1 1AJ0A 4G8TA 5HK4A 4G1NA 1JI1A 3SQMA 1R2RA 4UIOA 2NWSA 1BVWA 1WKDA 4WY0F 3QTPA 4CQCA 3BGAA 1NM9A 4UCFA 4FIQA 4RZ4A 4JN6A 4JBRA 3F5LA 1WZLA 3A4JA 3GU9A 3WBXA 3DHUA 3PZIA 4X0NA