2HDJA

Crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with nadp(h)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
322
structure length
322
Chain Sequence
b'DSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mouse 17alpha-Hydroxysteroid Dehydrogenase (Apoenzyme and Enzyme-NADP(H) Binary Complex): Identification of Molecular Determinants Responsible for the Unique 17alpha-reductive Activity of this Enzyme.
pubmed doi rcsb
molecule keywords Aldo-keto reductase family 1 member C2
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 113
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2hdjA00
3O0KA 3LEPA 4GA8A 4YVXA 2I17A 2INZA 2WZMA 3V36A 1AH4A 3UZYA 1Q13A 1ZQ5A 2PDNA 3O3RA 4F40A 4GIEA 4XZIA 2R24A 1X98A 2PDGA 3UZXA 3EB3A 1RALA 1YNPA 1ADSA 3VXGA 2PFHA 4EXBA 3R43A 3LQLA 1S2AA 4QBXA 4JTQA 2HDJA 3RX4A 2VDGA 3KRBA 3CASA 2FZBA 3LUTA 2P5NA 2IKJA 3UZZA 2FVLA 4GQGA 2IKGA 1IHIA 5HNTA 1AH3A 4XVEA 1EL3A 1ZSXA 1PWMA 3F7JA 4ASTA 5DANA 2ACQA 4WDWA 3DOPA 3BCJA 2F38A 4Q3MA 4JTDA 4PRRA 4XAPA 4JQAA 4H7CA 2R9RA 4JIRA 3UFYA 4QR6A 3UWEA 2PDIA 1MZRA 3CAVA 2IPJA 4PRTA 5LIUX 1GVEA 2PDFA 3V0SA 4HMNA 3EAUA 4LB3A 3LQGA 5HNUA 3LN3A 4JQ1A 2PDLA 4NKCA 1YE4A 4XK2A 4GQ0A 2F2KA 4YVPA 1MI3A 3GHUA 2HEJA 4L1XA 2ISFA 4ICCX 2IKIA 1R38A 1JEZA 2IQDA 4XVDA 2NVCA 1VBJA 1M9HA 3M0IA 3P2VA 4WDUA 3CMFA 2PDWA 2PDCA 4LB4A 1Z89A 2PDYA 3EB4A 2PDHA 4DBUA 1AFSA 3LZ3A 2IQ0A 4GCAA 3GHSA 3G1RA 2PEVA 3M64A 3GHTA 3WCZA 3RX2A 1T41A 4XZMX 2PDBA 5LIKX 4RPQA 3ERPA 4FAMA 2IPGA 1YNQA 2QXWA 1Z3NA 4YU1A 3CV7A 1EF3A 3FX4A 3GHRA 1J96A 3BUVA 2PD5A 4JQ4A 1SM9A 4LBRA 2DV0A 2PDJA 5LIYX 2FGBA 4JQ3A 4FALA 4DZ5A 1S2CA 1Q5MA 1VP5A 1XJBA 2AGTA 3Q65A 4R9OA 5M2FX 2PD9A 1FRBA 2IPFA 3R8GA 2DUZA 4YVVA 3MB9A 2ACRA 3R94A 1OG6A 2IPWA 2A79A 4XO6A 1US0A 2PDKA 3COTA 3S3GA 2PDXA 3R6IA 1PZ0A 4Q7BA 3U2CA 1QWKA 4GABA 2PDMA 5KETA 2IS7A 1XGDA 4IJRA 3CV6A 1XF0A 1PZ1A 4PMJA 3WBXA 1X96A 2ALRA 3LZ5A 3C3UA 4FA3A 4IJCA 4WDTA 2BP1A 2BGSA 1X97A 5LIWX 4WRHA 2BGQA 4IGSA 1RY0A 4AUBA 3LBOA 4FZIA 4DBSA 4WGHA 2PF8A 3V35A 5AZ1A 3H7RA 4HBKA 3LD5A 4PR4A 1LWIA 3RX3A 2PDPA 2NVDA 5HA7A 2HV5A 3CAQA 4H8NA 4WDXA 3G5EA 4LAZA 3H4GA 4ZFCA 5AZ0A 1Z9AA 1C9WA 3R8HA 2J8TA 4JIHA 3UP8A 4QXIA 4MHBA 1AZ2A 3T42A 3N2TA 5C7HA 1EKOA 1Z8AA 1MRQA 3WBYA 4LAUA 2IKHA 3B3DA 1YE6A 5LIXX 3LENA 4OTKA 3QKZA 1IEIA 2ACUA 3BV7A 4JQ2A 1K8CA 1PYFA 1QRQA 3V0UA 1ZUAX 1S1RA 5JH1A 3Q67A 3V0TA 3UYIA 1AH0A 3ONCA 1EXBA 4PUUA 3R58A 1UR3M 3R7MA 4G5DA 2HE8A 4GACA 1HW6A 3BURA 2FZDA 4YS1A 3LNMA 2CLPA 4PUWA 2INEA 4QX4A 3ONBA 4JTAA 4XO7A 1S1PA 1T40A 3GUGA 4JIIX 3WBWA 3M4HA 4I5XA 1LQAA 3FJNA 1ZGDA 3WG6A 4XZLX 4XZHA 4EXAA 2ACSA 3H7UA 1A80A 1AZ1A 3UG8A 2HVOA 3UZWA 4XZNX 3DN5A 3MC5A 4DBWA 1RY8A 2PDUA 4JTCA 1HQTA 4L1WA 1PWLA 5JH2A 4JTRA 3D3FA 2FZ8A 2PZNA 2HVNA 3NTYA 2FZ9A 2WZTA 2C91A 4LBSA 3UGRA 2DUXA 4WEVX 2I16A 2PDQA 2HE5A 3N6QA
chains in the Genus database with same CATH superfamily
4BF9A 2XIBA 1NH6A 1AH4A 3MT1A 4GO8A 4ROPA 4TMBA 1A4LA 1Q13A 5AYBA 3TYCA 3MMTA 3DXIA 3KRSA 1X98A 4C5ZA 3PY2A 5A94A 4R85A 4J3SA 1Q6FA 3I4EA 3VXGA 4IX0A 1ODZA 1V7AA 2PFHA 1XLJA 2VOMA 4PEEA 1ECEA 1CGVA 3P8IA 2QUUA 1YDYA 1SFLA 2OCZA 3MZ2A 1B9ZA 3QQWA 3P84A 4K1GA 2JIWA 1JDFA 4J27A 3WDJA 1W1A1 4FIRA 1E6PA 3QC0A 3MA8A 1JRBA 2VCCA 3MHFA 3VI2A 2G50A 2VFDA 2PMQA 3WLPA 1KV8A 2O56A 1EJXC 2WMIA 4OU1A 4H6EA 1XRFA 3UJSA 2PC4A 1TWIA 1ECQA 1X7FA 4A6GA 2ISSA 3V18A 2OLSA 5BWFA 5I3JA 3GG0A 1JCXA 2PUZA 4QLKA 1NOUA 3O6CA 1KXQA 5A8QA 4QEHA 3PJTA 5F1UA 3DBNA 4DWSA 3M0HA 1AA1B 1BVZA 3PZGA 4CD8A 2HS8A 1ZP3A 1OT2A 2PDLA 3IJQA 4GFIA 1EJRC 3AICA 5CSSA 3W23A 2R6OA 1Q2SA 3CYVA 2DH3A 1HUVA 3GO2A 1JYWA 3AYRA 3NDOA 1B3YA 3GG1A 3WMBA 1WO2A 2V67A 4K37A 5LXXA 3LSBA 4OOZA 1KTCA 2VEKA 3A4JA 3EB4A 8RUCA 4DBUA 1AFSA 2CLKA 3U2ZA 3NGFA 1ZJBA 3IVUA 1B3ZA 4ZQNA 1XD1A 2WC3A 1H11A 5HATA 3QHOA 1LRQA 4MWAA 4XZMX 4QCEA 2VFFA 5KSWA 1W9VA 2PLJA 2FGLA 1YNQA 4V28A 3M5XA 4O1FA 1EHAA 4YU1A 1MUCA 3K8LA 3CBWA 4JX6A 1EF3A 4XBKA 1SFTA 5LNUA 3THQA 2I7GA 1TPWA 2QCNA 3ZLHA 3LTPA 1BD0A 1ZALA 3W7GA 4MB5A 3EBVA 3S4TA 2Z1SA 4H6QA 3HJZA 1MUMA 4CU8A 1EF2A 4FIQA 3GKAA 3IRSA 1S2CA 5E9XA 3S1XA 3PFMA 3EX2A 5D2WA 3R8GA 5CPTA 3TVAA 1REQB 3THDA 4CCEA 4NZFA 1CNVA 4Q4SA 2VQTA 3W7CA 3B9EA 1B90A 3KBSA 4AZHA 1GJWA 3TR9A 3NQ6A 4GGHA 3U2CA 3B8DA 1M1BA 1ITUA 3TTQA 4TU1A 4FK9A 3EKGA 3M41A 1JVNA 3A4WA 3W7KA 3IIXA 4KRUA 4TX6A 2ZWZA 3OG3A 3VMPA 3A5FA 1RJQA 3P62A 3F5KA 1CT5A 1DYSA 3MI6A 3SY8A 4BWLC 2MNRA 5C6MA 3B06A 1UPPA 5A95A 2Z1WA 4ADUA 1J0IA 2I5IA 2Y5SA 1P1XA 4NAFB 1YMYA 4R7WA 3ZT7A 3NM1A 3WQCA 5L9FA 4M6QA 4ZGYA 3HF3A 1AQHA 2Y24A 2WJDA 3L5AA 3DU0A 2Y8VA 2ZX9A 4AY8A 1M53A 2DZTA 2Y6ZA 1VRXA 5FAJA 1J01A 4PULA 3PS7A 3V1PA 2BHUA 4I3GA 4B4HA 4CNTA 3WNNA 2J8TA 4E2DA 1L6SA 3KWSA 2ISDA 1WE5A 3SCQA 3NYDA 4AZCB 4JYFA 2E09A 3VDGA 1T8QA 4QLLA 4ZENA 4QAWA 1BQGA 3NQ2A 3B9DA 3U5UA 4GH1A 2XUCA 4OTKA 2OB3A 1I1WA 3UNDA 3WK0A 1UASA 1KBIA 3WDRA 3LPGA 2QCGA 3T78A 1TVLA 3B97A 3D0CA 1EXBA 4BEQA 2PE4A 5BNKA 1VLIA 3UJRA 1PB0A 3W00A 3PBGA 2ZE3A 1GOXA 1VEPA 5A5WA 3STPA 3T2OA 2VJXA 3NAVA 4IXXA 3MY9A 4NASA 4ACZB 1WKEA 4M51A 5L6UA 1XBXA 3WBWA 3VO0A 2PTZA 3M4HA 1XLGA 1RVKA 2CZFA 4IMFA 1LOSA 4GBUA 5J8LA 1WV2A 1J79A 3FHQA 3S47A 1PX8A 5EYWA 1YBQA 4Y8FA 3ARXA 4AIOA 5HWNA 4C6DA 4UXDA 4C7FA 3F4WA 4K8GA 4MFEA 5F4SA 4QEEA 2NQ5A 2ZBTA 2ON3A 3UG8A 3AALA 2E9BA 4P2VA 2C7FA 2CLIA 2E8ZA 2BVTA 1MXDA 4XD3A 2CZDA 1Q2RA 3LXBA 5JH2A 1UB3A 4C6NA 5FEWA 4H9YA 2ZUSA 1EDQA 3TC6A 3WQ8A 2YCIX 3GTIA 1ZB5A 2VT0A 2C91A 4O0QA 3VTRA 4F8XA 3IRDA 5E09A 3W0KA 1OIFA 5E6YA 3H6OA 4ROQA 1Q6QA 2G41A 1XLDA 3GNOA 4W89A 3NQGA 5CSRA 4J3ZA 4PA8A 1M3UA 4IP4A 2ZA1A 4P8WA 2J9XA 3B03A 3WQGA 3WN6A 3W7OA 1JZ4A 8CGTA 4PMRA 2ADAA 1CB7B 2EJ1A 1ZU8A 3MI2A 4DEFA 3OZMA 4PTDA 5M1TA 3BPWA 4W8LA 3PUOA 2QPSA 3W75A 1GVQA 1UKTA 5H8MA 3S6TA 3SJNA 1T5AA 1QNRA 4WKFA 5D2XA 1R46A 1H1ZA 5HNTA 2D0GA 3G24A 3HJEA 2ZIDA 4MNKA 4AD5A 3P74A 4CU7A 3S2NA 3RNDA 3ABRA 5G5IA 3F2CA 1UYQA 4Q8PA 2Z7KA 3DYMA 3QY8A 1V6WA 2PTYA 1B9BA 4IPJA 1LCOA 2POTA 5EBAA 3BAIA 1E9LA 4B5NA 4I7WA 4K1WA 2P8BA 1IT8A 4KETA 3K8MA 3C6CA 4PBGA 2PGFA 3BOLA 2IPJA 3TW7A 2X09A 2X0SA 3VGHA 3VMNA 2XFWA 4XISA 3CZGA 3HU7A 3H2CA 4GNKB 2H6RA 1UKQA 3MMDA 3TH6A 1NWUA 4LB3A 3MQTA 3WUEA 2YIHA 4JIEA 4JFTA 4XIMA 1C8XA 1Q7QA 3IAPA 1V6TA 5EPDA 5HMFA 2OQHA 5A2CA 4LEFA 4XX6A 1NOFA 2CWNA 3LCHA 3RIKA 3QMRA 1V4YA 3U48A 3EA2A 4HJWA 2ZXBA 3W7MA 4H9ZA 1OBAA 2WC4A 2DZAA 1Z89A 1WYIA 2YXOA 1ZHAA 1M04A 4M6PA 5TBOA 2OZ3A 2DEPA 4FI4A 2F84A 3IUHA 1IR1A 2OT1A 1EPXA 4HD5A 1OVDA 3BTNA 5GNYA 3USZA 3W29A 2A2IA 4H83A 4UR8A 4C6LA 4FB7A 1TPEA 4N9DA 4JTSA 3AJ7A 3UVIA 2FIQA 4CUCA 2B0MA 4B5SA 4JY9A 4DNMA 4GXWA 1UA7A 4YLWA 5AFDA 5KZDA 2E6DA 4JN7A 4QS6A 3W6YA 1J93A 2NZLA 2QAPA 1DV7A 2QVNA 3GC4A 4IICA 2F7FA 4G8TA 1KM6A 5C5YA 1PAMA 2BXVA 4DJDA 3H2EA 3VKJA 5CBJA 1GOQA 4S39A 4ZOCA 1G7UA 5CXPA 4IIEA 2ACRA 4TV6A 4YTSA 3TNBA 1CXEA 4LT9A 1UOZA 1I6NA 3S8HA 3TQ0A 4L64A 4I90A 2ZZ7A 4GABA 2F6XA 2GJNA 3HM7A 4U33A 5KETA 4QIUA 2GJPA 4P7QA 3RR1A 1PZ2A 2NT0A 1FP9A 4ENLA 1W9XA 4OQVA 4XB3A 2R1KA 5GNZA 1TE6A 4Q4MA 3LS9A 4LAKA 1RY0A 2VFIA 3W87A 2E6YA 1FXQA 3FV9A 3NM3A 3S1VA 4N42A 2Z4GA 4NSBA 4BEUA 3AIBA 2RDXA 5AZ1A 1M03A 3SIZA 4XAZA 1TO3A 4N0RA 4WSKA 4M19A 5FJOA 1XPYA 4IIFA 4DXKA 3G5EA 3SZ8A 1P6BA 2V2DA 4XZWA 1DE6A 1E6ZA 3NR0A 1SYTA 3MW7A 1GPWA 1K9EA 4QXIA 4WF7A 3PFRA 3TU9A 4CVUA 3BH4A 2DY3A 1C7SA 4QNWA 1VYSX 4O1EA 5DLCA 4Y6GA 4AC7C 5EMUA 2C0AA 1SPQA 3CWOX 1WAWA 5CG7A 1KKRA 4AXNA 3EX4A 2CLLA 3ZIZA 5BROA 4ORMA 4ZR8A 3VILA 1QRQA 2E0PA 2RDUA 4YTQA 1I2OA 1VFTA 1VC4A 3CPUA 1LJYA 3R79A 1JUBA 1NFBA 3U7BA 4CGTA 4IIHA 4ZB0A 5JIWA 4DJFD 4QG6A 1J0JA 3C2RA 1KR0A 3CL6A 1FXPA 3FS2A 5SWUA 7TAAA 3HA1A 3LNMA 1XIIA 3SECA 4XTDA 3HFYA 4HP5A 1KFWA 1VH7A 1AD1A 4JNZA 2DU2A 4C1KA 1NVMA 4JIIX 2QGYA 1O95A 4S2CA 4UC5A 3FJ6A 1JNEA 1FDZA 3SBFA 1SO6A 2CU0A 4OZOA 1PHQA 4XWUA 3Q94A 3IUDA 1XBYA 4B5TA 1TV2A 2Y4SA 4GJJA 1JUKA 3R0UA 5K2ZA 3CIVA 2B31A 2PP1A 4Q22A 5CEWA 1JYNA 1GW1A 3EOLA 3S5ZA 4D8ZA 3DZ1A 3LOTA 3GH4A 2CKSA 1JI1A 1LQ0A 1R2SA 3APYA 2WM1A 4CLMA 2YCEA 3FEQA 4R7OA 3SAZA 1P7TA 1YW1A 1DQUA 2J7GA 2YPIA 1PEZA 1M7PA 2Z1VA 3WMSA 4J3UA 2PZNA 3W1TA 4O1DA 3G77A 3FA4A 4MJZA 2OMAA 3BMWA 1E73M 1HKWA 4D2JA 4PMVA 4EX4A 4YHEA 4JTKA 4GISA 1XSJA 1OX4A 4TX9A 3ZR4A 5D03A 1UC5A 3LI0A 4LVDA 2EG7A 1R5YA 2YBVA 1UR4A 2YA2A 1J5SA 2GWNA 2PDNA 1LROA 2PWUA 4LUJA 3GM8A 4Q8NA 3ARPA 2AAMA 2JIEA 5FD0A 4NIRA 1NOWA 3WD3A 3AIVA 5A8OA 5J5RA 2Y1HA 3ARUA 4NZJA 1CGYA 1JAEA 4PEKA 3OIHA 1SFJA 3CB8A 5B7ZA 4KESA 1BWLA 2I9EA 1DHPA 1IZKA 2XISA 1H49A 3JU2A 3PSVA 1EGMA 4LVBA 4UTLA 1XYFA 5CSUA 5I3GA 3S6DA 3SUWA 1LBMA 5CC3A 4QNEA 1OINA 1EUAA 1JG9A 3I7QA 4UIOA 5CGTA 2X41A 4PL1A 3TQVA 1O68A 5DXXA 3KDOA 1KKOA 1XYMA 4OOUA 1LL7A 4DF0A 1CZ1A 2D2OA 2ZCGA 1X38A 2ZX8A 3OZYA 1NQKA 3TFXA 4CQBA 3QGAC 4MZYA 1B3XA 2XIQA 2FVKA 2ZRXA 4F9JA 2DSWA 4KRTA 2WVVA 4KIRA 3SCVA 3BG5A 1GQKA 2ZC1A 1CGXA 2WAGA 3U7VA 3V0SA 1GNXA 3W1AA 2OGJA 4DQWA 4OV9A 4DI8A 1QW9A 1SO3A 4A3QA 2FVMA 4UOZA 2HEJA 3MSDA 4GE8A 3SO7A 3OOQA 1F8MA 3VM7A 4LV9A 3BW2A 4ATLA 3QPZA 1XIDA 2QKFA 4JS3A 1JCTA 3VE9A 1FH7A 4K68A 5CGQA 1DBTA 4P8VA 4DXVA 4RR4A 4HJFA 3TTOA 2Z2UA 2QJNA 3SCRA 6CGTA 1FCVA 3IGHX 5HUPA 3TFCA 2ZZ4A 3O0FA 1OABA 4I9JA 2SFPA 3ZYZA 3SCSA 3EWBX 4I7UA 2EXOA 2QDDA 4F48A 3NWRA 4IQJA 3L4TA 4KW2A 3M0YA 1RBOB 2J7BA 4Z0JA 1GVFA 2BS9A 3RUBL 4DWSB 1DEDA 3W2JA 5FEXA 4DJED 3ITOA 1SM9A 4IFRA 2DSKA 3DIPA 1NEYA 4UQDA 1W5MA 3CPRA 4HNTA 4PMQA 3HGSA 5GVJA 1XJBA 5MHBA 4RNIA 1T99A 4GYJA 3WLTA 1V5XA 2GFTA 3MDUA 3QQ0A 1ICPA 1VD6A 1Q6GA 4PH6A 4WVXA 4XO6A 3W7RA 1P1MA 5CZTA 4W93A 1YDOA 3DHDA 3IJ9A 2XN1A 3ZS4A 3GU1A 3VIKA 2W62A 1X1OA 2G5WA 3VIHA 3QOMA 2WNZA 3ZT6A 4EAMA 4KGLA 1TIMA 2HMCA 2FMOA 1EDTA 4MWAB 1EO5A 4I5UA 4KMQA 3DGBA 2WANA 2QCHA 3KRUA 1ZFJA 3M43A 2G4JA 3N73A 2OJPA 3KVLA 2OLAA 2XINA 3RCNA 3KHJA 1J0KA 2ZKMX 2YFOA 1EJWC 5ENLA 5LHEA 3WSUA 3CIXA 3JS3A 1LM1A 1L8PA 4IPIA 1W3JA 2QEZA 3LCIA 4MB3A 1Q6OA 2C1GA 3EXRA 4AYSA 1JPDX 3VABA 3UWWA 1OB0A 4PMUA 3VKCA 1V6YA 2YDSA 2CW6A 5AC6A 3WELA 1UIOA 4AX6A 3H4GA 3HQPA 4YMZA 3N6HA 2BHZA 1UROA 4LY8A 1DXIA 3F03K 2E5CA 4IL2A 4JKKA 1SW0A 1XLHA 4TUFA 4IUOA 5CPMA 3N2TA 1QPRA 3VDHA 3T07A 1FWHC 3ABZA 2PWGA 4Q6XA 1ZRQA 4G9PA 2C1IA 2XIIA 3PWIA 1WUEA 4AD1A 4NAEA 1E1EA 3HGRA 1FWSA 4JEQA 3HG3A 3UYIA 2P1FA 4U5KA 4PCNA 4KGJA 4JOMA 3RO8A 5A2BA 1TV3A 4G5DA 4AU0A 3EZ4A 3KLKA 1I2RA 1C7TA 1V3LA 2VP8A 1Q4WA 2CLPA 3EYPA 3EDFA 1Y7VA 2PU1A 1LP6A 1UR0A 3HBLA 1QI4A 5AYYA 3R5EA 2A0NA 2TODA 4HCHA 1A47A 4LYKA 4DZHA 4R9XA 2A3AA 3M6YA 4L9YA 3S83A 3FK4A 5LNWA 4NILA 4F0SA 3IIOA 5JBDA 1E0TA 2YOCA 3DFOA 3LA4A 4JYDA 1V3HA 3ANVA 3H7UA 1KM3A 4HNOA 2ZWYA 1J4EA 4I6KA 1V6UA 4XV0A 1Y0EA 1WQ5A 2X1RA 4UR9A 3H26A 5AB3A 1JXKA 1MYRA 4HMDA 4FP1A 3BQ5A 1O5QA 2OZTA 1N8WA 3C2VA 1LF1A 3PWAA 4FOUA 1K4GA 3LHWA 3PBWA 3T81A 4UTIA 5EMYA 1W9DM 1C8YA 3GWQA 3KBJA 3P82A 4IPLA 5H8PA 1ZPTA 5G1YA 4PFHA 1FWBC 3VAVA 5C2GA 5F2MA 4PTVA 2XGIA 3SRHA 1ME8A 4IQEA 1FUYA 4TQTA 3TJLA 4KQNA 1XKJA 3BG9A 2X1UA 5FJTA 3RCYA 3WJSA 3N1AA 1YBQB 1DPMA 2BV9A 4NZ1A 3NUKA 4IMAA 2XSXA 3MPGA 2BSLA 4HN8A 3B9AA 1TFVA 1E9IA 5HBFA 2P5NA 2IKJA 3MJYA 3PC0A 3LU2A 5LKYA 1JZ6A 1C93A 5HQMA 2CXEA 2XFYA 1XLIA 3GXTA 1DWIM 4J28A 3A9BA 3WQVA 1JF6A 1QVBA 3GW0A 3G6MA 4URIA 3E0VA 1AH3A 1ZSXA 5H6HA 3C3NA 3DCPA 1X1NA 4ASTA 5DANA 3WKZA 3TWBA 2ACQA 1DWJM 5DT5A 3BCJA 1JULA 1G67A 4FNRA 1WXJA 3O15A 1R2RA 1BAGA 3DKJA 4PTMA 5FCZA 3T0DA 3C0LA 1SR0A 2QCLA 4EPDC 4BZYA 3N9SA 1FWDC 2E7FA 2OQLA 2NXIA 5KITA 4EXQA 3SCTA 2CC0A 2PBGA 1OT1A 3TK7A 4W7VA 1AJZA 4C6QA 2OOGA 3L0GA 4PMXA 4KEVA 5AN7A 1OCJA 2GVJA 1YNYA 5I2UA 4JQ1A 2QQ6A 1TPB1 1M5WA 3CHCA 4HIBA 3UD6A 1WDQA 3WNOA 1OIMA 4A22A 1K7EA 3M44A 1TPDA 2AL2A 4CD6A 3PHAA 3L0KA 1JEZA 4GVFA 2C15A 3APTA 3N34A 4NNBA 4QDPA 4GOAA 3CMFA 3VZXA 4XBJA 3AIWA 3EPNA 3G3DA 3NL6A 1GZ1A 1DJXA 3W6MA 4PMNA 1LUCA 5AYXA 3QMSA 5IDZA 3OVGA 5TIMA 1YTKA 3NIYA 4B92A 4HT3A 3RG6A 3CHFA 4WQ6A 1TB3A 1A0CA 3WDPP 2REQA 3GHTA 1SGJA 3CLMA 3K1DA 2PDBA 3CZ8A 4F0LA 5E9AA 5JVLA 4BHYA 4BQ4A 1FA2A 4PODA 3AWOA 3GC2A 1RXOB 4UFLA 4K7YA 2OG9A 4AIUA 1OJXA 3SRFA 4RE4A 1TWZA 1FKWA 4L4PA 4U3CA 2ZICA 1HN1A 3MJMA 2IXVA 1UC4A 2IPFA 3S5SA 1JZ5A 1XXXA 4PMZA 3RDKA 1FHVA 1JGIA 2E25A 4O0ZA 3CAWA 3PBUA 3EEGA 1MDLA 3WNLA 1RV8A 4AX7A 3QY6A 3QPYA 1U1HA 3ZMRA 2BY0A 3CGTA 3TIMA 4D6HA 4IQLA 4O1AA 3W22A 1RH9A 2FGZA 4UQEA 3PZNA 1NY1A 3GDRA 2Y8KA 1NARA 3MVIA 2W66A 5U4NA 3ZM8A 3NQCA 4CQAA 4Q33A 1FHLA 1R7OA 3KLLA 3VNYA 4I9TA 3TYDA 2WPBA 1JPIA 2BGQA 3IUIA 3VDCA 2FFCA 3P80A 1ZBWA 5JXQA 5FAGA 3IJDA 4GZEA 4UNLA 1NM9A 2Y85A 4XAFA 1GYMA 3HPXA 1OFRA 3M0MA 1FH9A 1R9YA 1RA5A 4D6JA 3LCWA 5E0FA 1ME9A 3UR5A 4WR3A 1FY6A 1RQEA 1ZCOA 4HHLA 4AF0A 5JQ9A 3B8TA 3GNXA 2ZVRA 1S2UA 2WMFA 1IF2A 4IZGA 4Z2GA 1G9HA 4UTJA 2R1PA 3NJ3A 3H8AA 2VWTA 2Y7EA 2A6NA 1L6FA 3UPWA 1JF5A 3CT2A 1R9XA 5IHRA 1C90A 3B3DA 3P8JA 4V1YA 2XTKA 2ATSA 2DZBA 3UXDA 1YE6A 5LIXX 2A21A 2V3EA 3KZSA 1XWYA 1TZZA 5CAHA 4QE4A 4EANA 5C70A 5KINA 1VBGA 1QPNA 3LYEA 5JH1A 3GDLA 3Q67A 2RKXA 1OK4A 4WKAA 4JTHA 1E43A 5BMWA 1VENA 4E6MA 1TTJA 2UZ9A 1HJXA 4MUPA 4W87A 2PWVA 2PCEA 2HK0A 4HOZA 5K9XA 1XINA 2X1IA 4RUBA 1KM5A 5HK4A 3L4XA 1H1NA 4J35A 2NWRA 5FACA 4LALA 1CENA 3DYOA 1UH4A 3UWUA 3GUGA 4Z1AA 3BWWA 1W2PA 1U30A 4KT2A 2XVGA 1K3UA 2TMDA 6ENLA 1JNDA 3P0XA 3M5ZA 4FX7A 3W83A 2Q3RA 1BXNA 3KCJA 3T4WA 4U5IA 4GUHA 3BAJA 3LRMA 2VI0A 4J3TA 2QPUA 3RYSA 4M0XA 3DHPA 3UQNA 3KTCA 4ZQRA 2BVWA 1XRVA 4ZOEA 3NQ8A 4JNMA 2KAUC 4FLSA 3GR4A 2X40A 1UPMB 1MO0A 3DG7A 2CLMA 3BANA 3EWWA 4WK9A 1E6XM 3VOJA 1YHTA 2CBJA 3ENLA 4QLJA 4UCFA 2PDQA 4N7QA 1KFEA 3GTXA 1QMLA 2INZA 2VZSA 3PJXA 2Z1XA 3VCCA 3MSGA 5EMMA 1UR2A 3BSMA 4AEEA 3W4RA 3GKFA 3VU2A 2E6AA 5HR6A 2DT2A 4GJ1A 4AFYA 4G6CA 2OT0A 4B3KA 4JNYA 3UF9A 1SFSA 2P53A 3UBPC 1PL9A 4XZBA 3DFPA 1KWKA 2G3JA 1EJ7L 3GTNA 1MRAA 1QBBA 2WNWA 2EPMX 4LAOA 3RPDA 3B9OA 3K5XA 4H04A 3I68A 2NV9A 2FVLA 4JIPA 2X05A 2EPHA 1LLZA 1P7TB 4HA1A 4JCLA 1BXCA 1JDEA 3LCFA 3UERA 3K4AA 2E9MA 2H8XA 1EL3A 2QMKA 2I14A 2AGKA 4MIMA 2DZPA 3AFBA 3TN4A 3GUWA 2VVNA 4RX0A 5AHEA 3ECQA 4B16A 2FPVA 5T8GA 3TTYA 1OX4B 3LPPA 1H1YA 3KRZA 4BA0A 3RHGA 3G1AA 3P5YA 3NQFA 3PAOA 4XG1A 3T0TA 2ODOA 2YL5A 4ERIA 3CWNA 1MXSA 3PUEA 1XLLA 3TSDA 1Q65A 3MWCA 1GTHA 1JCJA 1W32A 3EAUA 4Y96A 4C6KA 2G3IA 1GKPA 4GVGA 2V82A 4O4WA 4YVPA 1MI3A 3GHUA 4N4PA 3NL5A 3PANA 4ERAA 3S1WA 2QLYA 3BSGA 1H0GA 3STFA 2ZX5A 2RUSA 2OWXA 2C18A 3VIFA 1CBGA 1E4NA 1WZMA 5D2YA 3N18A 1EA9C 1RCOB 4AVFA 2PDYA 4GLEA 1LT8A 2W61A 4J7RA 2OSXA 1FWEC 5HQLA 1OGGA 1LQ2A 3HO8A 4DI9A 3MUXA 1DJNA 3I65A 5H1WA 4Q8VA 5HINA 4RPQA 1SMAA 1D7FA 5GJNA 4EE9A 3BXWA 2WVVB 3T44A 1VQTA 4QJ1A 2CBIA 3UPBA 3QW3A 5DCEA 1VYPX 3QV6A 4NYUA 4B5VA 1Z69A 4LC6A 1KXTA 1VPQA 4C6BA 5CH9A 3AMKA 4X61A 2VMFA 4WIWA 4R27A 5DMMA 2WYSA 4DRSA 4ZQPA 4RJEA 1UWTA 1UR9A 1VF8A 4NUWA 4EWJA 4GRSA 5E6ZA 3GDKA 2AGTA 4C6PA 4PC8A 1SZGA 2Z24A 3T0CA 3VZZA 3PZVA 5C2CA 4BKNA 3NL2A 1LWJA 1V0KA 3TE9A 3W2LA 3L68A 3OVPA 4LRSA 4RZ6A 4UFIA 4BR1A 4RNJA 4M8UA 4ML4A 4EPEC 3GXNA 2CLHA 1A53A 5I0DA 4H9TA 2V5JA 3OPSA 3W1MA 4RE2A 4YPJA 4LU0A 2OXNA 3M0LA 1XP3A 3WQ5A 6TIMA 2Y62A 3QN3A 3QPEA 2GGJA 2VQUA 4KCTA 2CETA 3GYEA 1UKPA 4W88A 3VIMA 2ZRUA 4A2RA 4GO9A 3IEBA 4C6JA 3ABQA 1PS9A 3E2SA 2OYKA 4XTIA 1Q6RA 2IQTA 1WBJA 2WW5A 1UP0A 3QVQA 1BWVA 1W5NA 3VC6A 2OX1A 3V35A 4ZE4A 1VZWA 1KFKA 2YGYA 3KDNA 3S2LA 4CCCA 4NHVA 2PGEA 4DAFA 3LHTA 3GSMA 3WNPA 2IUZA 1RLDA 1Q63A 1DQWA 1PIGA 4GQBA 3W7JA 2FJUB 4WDXA 5HDRA 1IIGA 4QP0A 2QCCA 3VFCA 2QR6A 3GNRA 3AXIA 1EYWA 4MKNA 1VYRA 3RK8A 3W7PA 1JRCA 1YRRA 3NQMA 5JMUA 2Z6IA 1MNZA 3S9YA 3WK1A 4UB9A 3GS6A 1ADOA 2I5GA 5CBBA 3P7YA 2B7QA 2CNCA 3LI1A 4ZSTA 1O6IA 3PBYA 4Y7EA 1G4SA 2QDGA 2Z6JA 3EXSA 5A6MA 4DNHA 3OJGA 3LENA 1KM4A 2VC7A 3RJYA 3LHVA 3ZR5A 5LA0A 3S1GA 3DDMA 3WYZA 1DWAM 4CU6A 4Z1BA 3IJIA 3UWZA 4JCMA 2WHJA 1KQZA 3EWUA 3PNUA 3QYQA 4NZ4A 4UQBA 4E3VA 5I3FA 2WVSA 4OFCA 1M7JA 2C1HA 3MSRA 1E15A 2XVLA 3C0JA 3N2OA 4B5UA 3NPVA 3UG4A 2XWDA 3TEVA 2Z28A 3O16A 3RN6A 4CVWA 5D04C 1H7OA 4PCFA 5DF0A 3EMCA 2INEA 2RDTA 1GVSA 1A50A 1UUQA 3MVTA 1XLBA 3UJFA 1LQAA 1XHGA 3GNDA 3TOPA 1A5UA 3O05A 1HVQA 1Q8AA 2FDSA 4RNHA 1EXPA 1POJA 1SW3A 3OIXA 3WG6A 2J7CA 4DPQA 4R33A 3ARTA 2J4GA 2PURA 4AQLA 3WK3A 3L65A 4E5TA 3C2EA 4WHBA 5A6SA 4MLRA 1JDCA 5E93A 3HURA 2BB0A 4NAEB 2A7PA 3B40A 3WF2A 1N2VA 4PBFA 4O50A 1BEUA 3I4KA 1P6CA 1JDDA 1ZJHA 4K8HA 4IGNA 1PYMA 1OADA 1TQXA 2A3EA 4ZODA 3O0KA 1IE7C 4CQCA 4LH8A 1XLCA 3SUVA 4KH2A 1KFCA 1ZQ5A 5C0QA 1FDJA 4NY2A 1W0MA 1E3ZA 1HGWA 1R3WA 3EOSA 4H00A 4HSOA 1UIPA 4Z42C 2WCAA 1W1TA 4CNUA 3L4YA 4JAWA 1VPXA 5XIMA 2VD9A 3R43A 2BNJA 1XISA 4Y2WA 3T55A 1CLKA 3KRBA 1OGSA 4PSPA 1XBZA 2KX9A 3PZOA 4PB3A 3LV5A 4KPLA 1K9FA 1Z48A 1AJ2A 3A5VA 4LJ3A 4M1BA 1GOWA 2YL8A 2EQDA 2J9YA 4GQGA 1TRDA 4KFNA 3MCMA 3SRDA 3BL3A 2ZADA 4Z2JA 2NLIA 3HPZA 3ARZA 2YKKA 3NZ1A 4GUJA 1ONRA 4S1FA 1F3WA 1JPKA 1VFLA 4J3VA 4PB4A 3KOFA 3FFSA 3PTQA 1FP8A 2F61A 2CHNA 2PU0A 4TX8A 2DSVA 3JZUA 4B2DA 3LTSA 1EIXA 3C2FA 3E1F1 3KVMA 2JF7A 1YTDA 4EF9A 5PTDA 3ARQA 4S3DA 1ODUA 1Q7MA 1O60A 3T8QA 3VOIA 4H2CA 3UWEA 5CPNA 4DPPA 1XICA 4U10A 3VNKA 1ISXA 3VOGA 3CM4A 3OODA 4QJ5B 3S5YA 1J9YA 1HO4A 1KFJA 3TZNA 1RBAA 1JZ8A 4HB7A 3V5FA 5IM51 1C29A 4HNCA 3AJXA 1R85A 1R9ZA 4EAYA 3GX9A 1DVJA 2XFFA 2ZXDA 1TVPA 5E1QA 3AISA 4O57A 3RLUA 1VBJA 3M0IA 7ODCA 1YXYA 4H7ZA 2PDCA 2D2HA 3MCNA 1WZKA 4HVXA 1U83A 3G1VA 2WSKA 3GVVA 4P7NA 1ML1A 2WQDA 4EVZA 1DHKA 5LA1A 1F2JA 2TRSA 1Q3NA 1TX0A 2WMHA 1K02A 3GVQA 1R3YA 1WKYA 1ONXA 4Q4QA 3GTFA 2HNEA 3QFEA 2ZRVA 4JR5A 1QT1A 3KS6A 4J2MA 2VENA 3C5QA 2BGNE 4H8HA 4HNUA 4LCSA 2NVAA 3CUZA 4QITA 2V3GA 1Q5MA 5A6BA 4S2BA 3THUA 2WQPA 1YTEA 1D8WA 4LYRA 1HJWA 4GXMA 3R94A 2YCJA 2OYMA 3E2QA 3WENA 3T4CA 3RPTA 1XCWA 4DB7A 3E0IA 2PDKA 2NSXA 2V3DA 1LUCB 3E9AA 1GQLA 4JHMA 1QWKA 5DMLA 1YQ2A 4LVAA 4FXJA 1BLIA 3AZTA 1NDYA 4AHOA 1WAUA 3CJPA 5DXYA 2REQB 2GDUA 2J62A 3OVRA 2A3CA 4XSLA 4DUOA 1KCXA 4UZUA 1K1DA 3ABOA 3L5MA 4NZ3A 3E3HA 4LS0A 3FA5A 7TIMA 3GBEA 4AMCA 4WDTA 1IEQA 3OGVA 4E0CA 3MANA 1X97A 2W9MA 3RAOA 4WRHA 5LNSA 1TMQA 3QLLA 1A5BA 2HVMA 3IV8A 4FZIA 1W3LA 4MAZA 2VCAA 3TROA 2DW6A 1C9DA 3ZSSA 2FB3A 1DKWA 1O7AA 4GXPA 3MMWA 2D20A 5F2IA 4JBRA 4NP7A 3V75A 2BY2A 2DZXA 1SJBA 1XDLA 3ITYA 1E0UA 3PJUA 4ZB2A 4DBEA 1I2PA 2CHRA 4LXFA 1AQMA 4D9PA 3KTSA 2WPGA 2DDXA 2QT3A 3AYTA 5HJYA 4WY0A 2BODX 4JICA 2CZ5A 3CIWA 1DOSA 4ZVJA 4D6DA 1QI5A 2Y7FA 5A8GA 1Z8AA 2VX7A 3B8VA 4RXGA 1WNOA 2DZWA 4C6IA 1E0XA 1F6YA 3E02A 4LNCA 2OLHA 2CHOA 4U31A 3ABSA 4XQ6A 1IEIA 4WGXA 4JKLA 1VJIA 2WSQA 3KZPA 1ELSA 4FR1A 1ZUAX 2EG8A 3I6TA 1W17A 3CZJA 4MJ2A 3C8NA 1CYGA 3VNIA 1U1UA 1ICQA 1H5YA 1U5VA 1J2BA 5T9BG 2YL6A 4MDPA 3EWZA 1S46A 4ZB5A 4UOJA 1FWGC 3L21A 1BSIA 4O17A 2WMJA 3C52A 1K03A 3N15A 5I6SA 1JL8A 3TJ4A 1QO2A 4ZXOA 4C1LA 3PK7A 1XR2A 5JUVA 4AF0B 1QU4A 4MG4A 1EIBA 3ITTA 4HYVA 4S3FA 4MKVA 3I3EA 2MANA 4I6VA 5BU6A 2W27A 3CUIA 4E4PA 4EXAA 3GFZA 3WO8A 1OCQA 1XBVA 1QNSA 3S5OA 4C91A 3FJLA 4Q8MA 4FNSA 3NA8A 2J66A 1S2WA 2QUVA 3B4UA 1B57A 3IJ7A 4IQDA 4QSFA 3IIZA 4FPSA 4PUKA 2XVKA 3LGDA 5B7YA 1MSSA 1SJDA 2O4QA 4YIWA 4UTMA 3AMGA 4Q8WA 1MW0A 4DO4A 3TTEA 5K7JA 1ZAIA 1EWEA 2Y5JA 2I17A 2NW0A 1W31A 4XAGA 4HU0A 1GQIA 1TPVA 2BY1A 3HG5A 2Q3OA 2YXXA 1I9CB 4GWEA 3O3RA 4P5UA 2VGFA 3BG3A 2PDGA 1RALA 3QBUA 3LLFA 1UD5A 1VBHA 3ES8A 4JZ5A 5D32A 3KM8A 1QW7A 4IX2A 1S2AA 4RNFA 4AD2A 1P0EA 4UR7A 4MZ1A 3O6DA 5EA9A 1XX1A 4WOZA 3LDVA 3WD2A 4JTFA 2ASHA 3F5LA 2WVUA 2J47A 3W7EA 2WZIA 3W7HA 3POCA 1EDGA 1NP0A 4DX3A 2XM2A 3W2UA 3L2LA 1QK2A 3LBCA 3CC1A 3UG3A 2JE8A 1I75A 1Q6LA 2WVTA 4DHGA 1THFD 4WDWA 1QWGA 1HP5A 4Q3MA 1XD0A 2YZRA 3IIVA 3NEVA 1TV7A 4KBXA 1GQNA 1DJYA 1EOKA 5FL0A 3S9IA 4D6GA 4DBDA 4QHRA 1MZRA 2ZRZA 2BZNA 1YXCA 5BOEA 3AYVA 5AC8A 3SY5A 1DIEA 3VCNA 3VZYA 4E8DA 3APGA 1RP8A 2WSRA 2I57A 3SUUA 3AS0A 3ITCA 1TCDA 4B9YA 1WUFA 3GY1A 2QJGA 3HPFA 3ATZA 5ABEA 5BXSA 2Z2AA 4S3BA 3UJEA 1T0OA 1V7YA 4GPNA 1OM0A 4XVDA 1LBFA 3W2MA 2POZA 1FWIC 1TMLA 1JGMA 2DQWA 2HXUA 4UBPC 1POKA 3V16A 2W3ZA 1GJUA 2VTFA 1S38A 4AAJA 2ZZ2A 3VYLA 3W7LA 3CYJA 4S38A 2V30A 2CLEA 4V15A 1ZBCA 1O12A 1EH9A 3MV11 4AMAA 5K9CA 4OV4A 4E2BA 2ZTKA 4CN1A 1EGVA 1PCWA 4I5RA 2EEXA 1QTWA 2YX0A 3QZAA 4MNMA 1X8CA 2AQOA 1XYAA 5J04A 3SI9A 1CLVA 3CV7A 5A6TC 3VC5A 2ESCA 1TMHA 5CKSA 1GOOA 4L4OA 4Y9PA 1YPXA 3BUVA 4TVDA 1XIMA 3HQ1A 4CNOA 2PDJA 4QS5A 4FLRA 4ECLA 1HJVA 4MWAC 1TZ9A 1RBLA 3JW7A 4US5D 3OG2A 2FB2A 1CXKA 2OZ8A 4UTWA 2ZX6A 1E4LA 4IFKA 1G01A 1FOBA 1AW2A 4J2PA 5G4EA 3L9CA 4K3ZA 3E96A 5C9UA 1ICSA 1X6NA 4OKDA 1A3XA 2QDHA 3XIMA 5BZAA 5I07A 3FKKA 4MAVA 3COTA 4XKYA 1WX0A 2VUNA 3DENA 4AW7A 1AW1A 1GUVA 1BRLA 1E6NA 3GZAA 4FNPA 2ABAA 6REQA 2HQAA 5F4XA 2VVSA 2CWXA 2D73A 1EYEA 3BLDA 3R0KA 4C1NA 1XPGA 5HUOA 1OZQA 3Q58A 2WJZA 3W37A 1X96A 2R14A 2BP1A 1L2QA 5AC7A 1M41A 1V3JA 3FAWA 1AD4A 4WSJA 3A21A 3UCDA 4H41A 3KOZA 1WKDA 3KEHA 3QHNA 1XL9A 2WKJA 1IZCA 3BK0A 3H7RA 1RAKA 4TO8A 2VZTA 2Q8XA 3CV2A 3JZEA 5FF2A 1LWIA 1LDCA 1MQQA 3F2BA 2ALDA 5I23A 2Y7GA 2OFJA 3CAQA 3H2OA 5FSDC 2QDEA 4E3TA 2AKZA 1Y5XA 4NJJA 3U6WA 3OU8A 2PP0A 3BLPX 1F6PA 4QISA 4FX8A 3STGA 3BJTA 3CS2A 4JTEA 4EACA 5A6LA 3T0AA 1OYBA 5DQPA 2F9RA 2ISWA 5G2HA 4PB5A 1JQVA 2XIMA 2QS8A 3NDZA 2DIJA 3M07A 3B0UX 1AODA 1G7VA 4LUIA 4W8BA 3WBYA 1DIKA 1I4NA 4ATWA 2J75A 3W25A 3OBEA 2OGYA 3ELFA 3BV7A 4IISA 4ML9A 4N02A 1M68A 2A5HA 1GVYA 4ZBCA 2DSZA 2DH2A 3BDKA 4IHCA 4DN1A 3CK5A 2QVHA 3LK6A 1WKFA 5G1MA 3ANUA 4QDMA 3PB0A 3VX0A 1SZFA 3N4FA 3AO0A 3NPUA 3CT7A 3AXXA 3MMUA 1JZ3A 1H7NA 3TQPA 4BI7A 4KWVA 2XGBA 2R94A 4IM4A 1PTGA 1LT7A 1XC6A 4E2VA 1O66A 1WOBA 4YWIA 5BMXA 5KZEA 9CGTA 4L7ZA 4BJHA 1HP4A 3ZJ7A 4HGXA 2Q6ZA 3EPOA 1CXHA 1OG0A 4F2TA 4I8DA 3PZTA 3UZ5A 1UJQA 4LUYA 3VKAA 5IDIA 3H21A 3TAOA 1FWWA 4IJBA 2YCLA 3CU2A 5CGMA 3AYSA 3A12A 3L4UA 4IUGA 1CIUA 2P50A 3K8KA 5TF0A 3BOXA 1CLXA 4E8CA 1UW9A 3AIRA 2QUNA 1W37A 4O16A 2PS2A 5D4YA 4CN6A 1LG1A 4PCSA 2C71A 4X22A 1MMFA 3BV4A 1Z6KA 2VDIA 5D37A 3VMOA 4L9XA 2XSBA 3V5OA 4GQRA 4H9VA 5A3HA 5FL1A 1EX5A 3S2CA 3NTYA 2VC5A 3FDKA 2X16A 3R10A 4NJHA 4QJ3B 1VIWA 3AZRA 2QCMA 2XGZA 4R5EA 4RDYA 3TYBA 4S3CA 3E74A 3WH6A 1TR9A 4AHPA 3GXFA 4TV5A 3L66A 5BXPA 4O18A 3EDKA 3I3BA 4TTUA 4W9TA 3T9PA 1WZLA 1IXOA 4M5PA 1OCNA 4L65A 3AHTA 4FX6M 3W7NA 2Y61A 3EOEA 5T9CE 1GVIA 3GXIA 2PCQA 2VDGA 3CZLA 1C3FA 3ZVHA 5EB8A 2VM8A 4RKAA 5GPRA 3SGUA 4K7VA 1DJWA 3UZZA 3VCRA 1H7RA 1W3IA 3QR0A 3VGGA 1JDAA 3IGUA 3UETA 3FJ4A 3EDEA 3DAQA 3CMGA 2IKGA 3MO4A 4DF2A 4DUWA 5EFDA 2WBGA 1J8VA 1ZP4A 4IIDA 3BAYA 4C7GA 1KGWA 1J2WA 2ZUWA 5AC5A 1F3TA 2OKOA 5BOOA 1DJZA 3TJIA 3BAKA 3QRHA 2Z1KA 4JTDA 4L9ZA 3TC3A 4W7UA 1VB9A 4KEMA 1CECA 2J7DA 4K36A 2EPNA 4JIRA 2VEIA 4AVOA 2AQWA 3EKZA 2INFA 4ERGA 2PDIA 1CWYA 2V38A 2DT1A 4AIBA 4NXKA 3AXKA 4QROA 2R82A 2JGYA 4CNSA 3FAXA 2J7EA 3BAWA 1KC7A 4UNKA 3VX1A 3LN3A 3WJZA 1YE4A 5HNRA 4GQ0A 2W63A 4D1JA 4L1XA 5F4WA 3WQEA 2DZSA 3VUSA 1UJPA 1QW8A 3N6JA 1W1PA 3J7HA 4WDUA 3REQA 1FCBA 3N4AA 2VGGA 2JF6A 3DC0A 3ISIX 3WLNA 1TWWA 4ZO8A 4O14A 3G1RA 2UY3A 3BLEA 3M64A 3UJ2A 2J13A 3QFWA 4J5NA 4EOUA 4AYGA 1CGUA 2VZVA 4RPPA 1M7OA 1A4MA 3NNTA 4A35A 4AEFA 1CGWA 1TTPA 5IXEA 1NDVA 4F2BA 1OYCA 3PBMA 1VIZA 2WLYA 1Z3NA 2A3BA 3KWXA 5FJUA 3WQDA 5BYWA 1E56A 2YW4A 4US6A 4QGCA 2GZXA 1PTAA 1UD2A 3OVQA 4BS0A 1EZWA 1XH0A 1OGBA 3IANA 2G37A 3N19B 3T2QA 4EWND 4DZ5A 3WLOA 1A5KC 3V5CA 4CEUC 5M2FX 2XN0A 1K6AA 3K46A 1W56A 7PTDA 1W2VA 2FPYA 3IK4A 1RQBA 1US0A 1VCGA 1AL7A 3G1FA 2XDFA 1K8XA 2PDXA 3MSYA 1V02E 2FZNA 3TN3A 4XIAA 4IP7A 3BVJA 4FXSA 4FNTA 1GVOA 4DJDC 1TWDA 3A4XA 2VR5A 3TNOA 4GUGA 3AMCA 4NYYA 4Q32A 2ALRA 3IIPA 3ITLA 3U5YA 4IJCA 5FIPA 3NYZA 4NL1A 4J1OA 2B7OA 5DX7A 3TW6A 3T1GA 3GE7A 2TPSA 2VWSA 2E9LA 1HKKA 1EEPA 3P61A 3OZPA 5C8BB 3AMDA 2A7NA 2GUYA 2Z27A 5HA7A 1H51A 2XN2A 4I7VA 4YTRA 4ZFCA 2EJAA 1IEWA 1DE5A 1C9WA 4KFPA 3GD6A 3EWCA 2GOUA 1BYAA 3FSUA 3KTXA 4MHBA 2JQXA 3RM4A 2BOEX 3W1XA 3W3OA 5GJPA 2E4TA 3GH7A 3W27A 4JTGA 1BYBA 1QI0A 1UUMA 4J4KA 4FNUA 1LORA 5TAOA 4K39A 1BXBA 2NWSA 1V03A 1IR2A 3F4CA 2C14A 3UR2A 1ZCCA 2RGMA 1A5MC 3ORWA 4AD3A 4NAFA 4TXEA 1KXVA 2ACUA 5REQA 4F9DA 3OQ8A 3VNLA 3GDBA 3UCQA 2PAJA 2V3FA 2VX6A 1S1RA 1TV5A 5D02A 2Y5EA 4F4RA 4EPBC 2GVEA 3NQDA 2DW7A 3ONCA 3TWAA 2FKPA 1QOPA 3PUDA 2AAAA 3HZ3A 1PKNA 3H4WA 2WSYA 3Q2DA 2MUCA 9XIAA 4YS1A 1KLZA 2BVDA 3GDMA 4OIFA 4S3JA 4UFJA 2VX4A 4MM1A 1GPFA 5ABFA 4G7EA 1GHSA 1BVNP 2PLMA 3WLQA 1TJRA 5EY5A 4F0KA 3W1UA 1EJTC 4XO7A 2B7PA 3SURA 2OKTA 4YYFA 3W7IA 4NI8A 4K38A 1VJSA 4Q4OA 3EPMA 1E6RA 3A6OA 1L6GA 4JDBA 4MY8A 1G4TA 3FJNA 4HTYA 4RV3A 1E1CA 4EPKA 1Y8BA 3STCA 2J9ZA 2WWDA 4K6AA 4GGBA 4HK6A 1IGWA 3CXOA 4DLMA 2GDVA 4HHPA 3M0JA 1XH1A 2VUYA 1RP9A 4Y9AA 4DBWA 4ATDA 1LOLA 4JTCA 1HQTA 1K77A 4UZSA 2GGHA 3QV9A 5LNRA 3HQOA 4MB4A 2ZFAA 2PB1A 3TQKA 4GVHA 2YBUA 3WBEA 3B04A 2VFEA 3WLLA 2DIKA 2DVTA 4HU4A 4IIGA 1DXFA 2YA1A 3FW6A 2Z0IA 2FDMA 2UY2A 4AG0A 3NZPA 2DZVA 1PTDA 4YVXA 1NDZA 4X3ZA 3LGGA 1BQCA 1IV8A 3S42A 2E3ZA 4JHOA 1MWOA 3UZYA 4PSRA 2DT0A 3E12A 3UXLA 1OX5A 3T05A 4TR9A 2OR2A 1RK6A 4JL1A 1YPFA 3MKKA 1QNOA 3SQSA 5DRIA 1NELA 4MNJA 1BVWA 4JEJA 1M01A 2IW0A 4B9ZA 3P60A 4QBXA 3M0XA 5DEZA 3W84A 1R6WA 1KCLA 3WK2A 1R86A 1DXEA 4H6KA 3QW4B 1XSKA 2FJKA 2UV8G 3G1HA 1SO4A 5CPOA 1QPQA 1XGZA 4O4VA 3LERA 3VOFA 4L6DA 2X2GA 1X6LA 4HYWA 2P3ZA 4NRRA 1CCWB 5FEPA 2ZTJA 3CH9A 1FTXA 1KGXA 3G18A 4DY1A 1O5KA 4Q7NA 3P93A 1OEPA 2TSYA 3HN3A 3UFYA 1Z32X 5K4XA 4RZ5A 3VIGA 4KEUA 3ID7A 2V5CA 3C56A 1KM1A 4HYRA 5HWJA 3HV9A 4Z2KA 2GJXA 3RO6A 3W9ZA 2NQ9A 2E6FA 2VRJA 3LQGA 5ABHA 4O8AA 2W5FA 4UTTA 3ME3A 5LGZA 2VZUA 5DY2A 1UG6A 3NQEA 3TAKA 4ICCX 2IKIA 5CJNA 1R2TA 4GMEA 2IQDA 3RILA 1ZS2A 4ZTYA 4NQ1A 3UEQA 1KW1A 2AKMA 2Z2BA 3QZ6A 1W5OA 4OE7A 1C91A 2PDHA 1XYZA 3LZ3A 3N12A 3AS1A 4IT1A 4ZMGA 3K4WA 1CI1A 1EFZA 1OZMA 3NPWA 2FTYA 5BCAA 5LIKX 2E8YA 2JFEX 3W7DA 2EPKX 2CZVA 4TIMA 2P3EA 3CH0A 3I3DA 2TYSA 1RQHA 3TYUA 2QJHA 3THCA 3HMJG 3GQYA 4ACYA 2VR4A 1ITQA 2E68A 3ZO9A 1OC7A 1XLEA 1P43A 4FALA 5CLWA 3NQ7A 1HJUA 2BOGX 5EL1A 2NUWA 1HVXA 2NXGA 3L2MA 4R9OA 2PD9A 1A5CA 1ZENA 1DL3A 4AWSA 1WZAA 3R1ZA 1W5PA 4OBSA 1E0WA 1VCFA 2CZEA 3VKBA 1UZ1A 1EOMA 5HJLA 1EHNA 1VPYA 3TCEA 3U0HA 1TUXA 2J8GA 4PUMA 5AHIA 1U5HA 4A3RA 1P6WA 1XF0A 3GYCA 1SSDA 4H9UA 3VIOA 3WBXA 1VFUA 3DFQA 3C3UA 4FA3A 4FLQA 2Z29A 1IQ8A 1TJ0A 3LV6A 5HQEA 3TX9A 3PM6A 4H3DA 3PUGA 1H4PA 1V0NA 2G96A 2ZE0A 3SDOA 1KXHA 3M7WA 1E5NA 4PZVA 1Q6CA 1S39A 2J74A 1KO0A 3L4VA 1OC6A 4QRNA 5BOFA 4Q4PA 4O0KA 3O8AA 4GFSA 2WJEA 4IFKB 3S9ZA 1U5JA 1XFBA 1Z9AA 3NXLA 3FVMA 5CPLA 4FOKA 1IWBA 2G95A 2V2CA 4XKYB 5LXEA 4QTGA 3CHEA 4AZBA 4UQCA 4H8VA 3NO5A 2QPXA 3ZFHA 1OFQA 4JGDA 1BRLB 1ME7A 6REQB 4W86A 2W6RA 4LBUA 3OA5A 4C1NB 3CHVA 1J11A 1EJSC 2XZ7A 3GU9A 4DM1A 3QC3A 3UXKA 4N6EA 3MBDA 3RRXA 2NV1A 3I10A 3JR2A 3G6LA 1C92A 4R7JA 3GTHA 3V0UA 1EQPA 3SN4A 3NOYA 4GUIA 2Y8UA 4QG8A 2BASA 2JKPA 1RD5A 3R58A 3R7MA 4BQ3A 2WC7A 4YYCA 1H7PA 3IVTA 3UY7A 2VOTA 4TTGA 4PTWA 1Q4NX 4GK8A 2PA6A 1XLAA 4GI8A 4UWMA 3IAQA 1D8CA 1M65A 3W1NA 1S1PA 3DUGA 1ISWA 2CFFA 3OA3A 4DJFA 3WDIA 4QQUA 4CEXC 4KWOA 3UWYA 1F8IA 3O2LA 4BI6A 1ZJAA 3ICJA 5BU9A 3C61A 2ACSA 4GY1A 4DJEC 3PPFA 1HKMA 3LCGA 1G4PA 3NSNA 3CO8A 4B4FA 1G5AA 1RHCA 1ALDA 4JN8A 1UD6A 1E40A 4LGXA 1KBKA 5AHFA 2ZXAA 8A3HA 3WLSA 4HCLA 1I0BA 4L1WA 3UWQA 4HPJA 4LTSA 3H2NA 3O06A 3AIEA 2IXUA 3O63A 3M0ZA 1E0VA 2QCFA 2FZ9A 1DORA 1V3IA 4WEVX 1DIDA 2PZ0A 3N2MA 3WEMA 1B1YA 1V77A 3GXPA 4CNNA 2B4GA 4HZ7A 1PUDA 3JRKA 4FLOA 3B4YA 3TW9A 1ZBVA 3YPIA 2AMXA 2WMIB 2RAGA 4LOCA 5DRCA 2HS6A 4DYKA 3GIQA 3BOFA 4N9BA 5BWAA 5A8NA 2XH0A 2XHYA 2PTXA 4EXBA 2OVLA 3ALFA 3VFLA 2YCLB 4C7DA 4NJIA 2DZUA 3HIJA 4MFDA 4R3UA 2D0FA 1QATA 3SRKA 1UHVA 4DZAA 4RXFA 3W82A 3RMJA 4NVTA 3LNPA 1UQYA 1QOQA 3HB9A 2EKCA 3W26A 3LCLA 5CZ0A 4RE3A 4GKLA 1D3HA 1FWTA 4LWWA 3M0KA 4C5YA 3CQIA 3W53A 1VR6A 1EB3A 1BG9A 1AUSL 3KBMA 1MEIA 3FKRA 2DVXA 3TUUA 1V51A 3A64A 3CQ0A 3USBA 4JTUA 4PUNA 4DWSD 1W54A 2G3NA 1UZDA 3TV8A 5H91A 1UBSA 2WBKA 2H8ZA 5FKYA 4QR6A 2ZXQA 3HMCA 3CAVA 1RJRA 1F73A 2XIOA 2JEQA 2PDFA 2JKAA 2WM0A 2GVYA 2X1SA 3KS5A 4IMDA 5FJJA 3WF1A 1F74A 1PKLA 3L0NA 4A21A 4ES4A 1XDJA 3LHYA 5JBEA 4WD0A 1JUEA 3ZVHB 4XK2A 3SY1A 3E0LA 3CTLA 1NDWA 2X7WA 1QHOA 1G6CA 2I1OA 1J10A 1K8ZA 3DFHA 5D09A 1HIZA 1PDYA 3R13A 1R38A 3CL8A 1XLKA 3S6OA 1WP6A 4MWAD 3N9KA 3F4DA 4IWWA 4IG2A 2OYLA 3VA8A 5IBXC 3QR1A 3WL1A 3ITVA 4IP5A 4ZZ9A 4ZOAA 2VC9A 1TV4A 1JQXA 4W5UA 1D2KA 5T26A 2YBTA 3S5NA 2GWGA 4GCXA 4W4QA 3F5JA 4HA0A 2VFHA 3PP7A 4A8LA 5CC7A 3B0PA 1JFXA 2RDWA 4AWEA 1OK6A 2GVGA 5EGRA 5G4WA 7REQA 5CPSA 3PPCA 1B3VA 3DESA 4W85A 3E0FA 1RA0A 4JQ4A 5I79A 2CESA 1QOXA 4ZO6A 1O1HA 4MLJA 6A3HA 5LIYX 3B8SA 4Z1CA 4LYQA 1EZ2A 1O5RA 1E1FA 1WPCA 4B90A 2WCGA 1O5XA 2JGQA 3DKLA 3MUZ1 3MB9A 3G1DA 3REQB 2GQ3A 1F05A 2GGIA 3NZRA 1KCKA 3KCOA 4OWGA 4PGLA 1JPHA 1YDVA 4DJEA 4IOTA 2Y70A 3DX5A 1PZ0A 1W3KA 2C3ZA 4U4MA 3L7RA 2QV4A 3WJWA 3M47A 3MTWA 6PTDA 1H09A 1MUWA 1AMKA 3MWAA 2VO5A 2VGIA 2YW3A 5LNVA 1R0MA 3BCFA 5DN1A 1QPOA 3G1YA 5LGXA 2JKEA 3U2EA 3FHAA 2ZDRA 1DWHM 3GK0A 1PV8A 2QIWA 4AEOA 3W02A 4NI3A 3LLDA 5E0KA 3T40A 2YL9A 3WF3A 3VOHA 5C9WA 3PJWA 4W7WA 1F6KA 4ZE5A 5M03A 2NUXA 4Q6JA 1J18A 5D38A 2WHMA 4LV4A 3FOKA 4ZQCA 4MY9A 4DF1A 3AU6A 1VEOA 3N29A 1KFLA 3MUIA 2OWWA 3R8HA 1PCKA 1MQPA 4JPGA 3QF0A 4GINA 3PZ9A 1Q66A 1QI2A 4HU8A 3RR4A 2ZRWA 1I8JA 1JI2A 4NG3A 5LSMA 1TKKA 1A5NC 3BICA 5I24A 5DBTA 2OEKA 1EGZA 4GQQA 1JR1A 3KXQA 4WJ8A 2VZOA 4U2YA 3QM3A 4CKQA 3K2GA 2D24A 2YJQA 5D9MA 4H4IA 1US2A 2PWFA 3KFTA 2OQYA 1S5NA 4GNVA 1F9CA 2CIPA 4GACA 3IJLA 4ZL1A 1YYAA 3Q45A 4LAMA 1BHGA 5KEZA 5DBUA 1NTHA 2GDQA 4AXKA 4MNLA 2BX7A 1JD7A 4QFUA 2NQZA 5G2WA 2ZA2A 4HHHA 4I5XA 3TYEA 3OQEA 4CD5A 4AB4A 4GIRA 3UCCA 3BLKA 3WJXA 3FLUA 2L5HA 3RMEA 4D6EA 1A5LC 4PUEA 4GYKA 1MDRA 1VHCA 2NX1A 5G4HC 4A05A 3GH5A 4AIEA 1EP2A 3KBWA 4HPXA 2RGLA 2HVOA 1GT8A 3AHVA 3CB3A 4J9JA 3CQJA 2VGBA 2BLEA 3W28A 1UWSA 5REQB 3N25A 9RUBA 3NPXA 2PDUA 5IBXA 5FI8A 1YEYA 3UU0A 4RLIA 2QJJA 4MJMA 3MP4A 4FOJA 5CQ1A 1XQLA 2YCKX 8XIAA 2UBPC 3CL7A 3HOJA 1TTIA 4RW3A 1UP2A 2I16A 2JEPA 3I7RA 2GQ9A 1VRDA 5FA5A 4L5ZA 1MW1A 5ABFB 3ITGA 4G7EB 2X0HA 1ISVA 2C79A 3PN8A 1RPKA 2AQVA 4DO5A 3EA1A 3GVGA 3SCOA 4I9MA 3WF4A 3LMZA 2R24A 3DG6A 5CZJA 4MUZA 1F3XA 4MB1A 1EBGA 2BXYA 1K7FA 3MUY1 1E1CB 1IT7A 4F3HA 1Q8JA 3UXIA 3TMLA 3ZXWA 3TN5A 4LVGA 4AWTA 5CC5A 3SFWA 4GI6A 2JK2A 3V7PA 3MKVA 1OC5A 4O8RA 3QV7A 3TN6A 3QGVA 1XH2A 2W92A 4O53A 3SEPA 1JJKA 1TRIA 1TUFA 2XH4A 3ZQ9A 1RZMA 2CYGA 3QKEA 4LYPA 3EX6A 1TELA 3VE7A 4XVEA 4PN2A 3WLRA 4U3AA 2DSUA 3WD1A 2HROA 3GC5A 1Z41A 1IYXA 1OSEA 5DELA 3KHDA 1S5WA 4DZIA 2DT3A 1CTNA 2R9RA 3WLHA 5AHNA 3SFKA 2VELA 2XWEA 3S0CA 1V6XA 1FWCC 3DG3A 3VDBA 2XFRA 3VGBA 3SN1A 1MFUA 4XD5A 3RPMA 2Q09A 4C6CA 3WMLA 3KAOA 1WA3A 1NQ6A 3WY1A 4AD0A 4P7RA 2Z26A 5D05A 1GWJA 4GZIA 1E71M 3O9NA 3G1XA 3EKLA 4S3AA 1UKOA 1GOIA 5HXMA 2NVCA 3HPAA 2QJIA 4MPQA 2J79A 2BG5A 1UWAA 1FQ0A 1EA0A 3PULA 1N8IA 4HQVA 2KZHA 5LA2A 3BJFA 3W1QA 3P5ZA 3BCDA 2NUYA 4GY7A 4GCAA 4HA4A 1R3VA 1XKYA 2TAAA 2OTDA 4HOXA 3M16A 3IACA 3VNDA 3M46A 3NXFA 3PTDA 1SUXA 3AROA 3H55A 5HNNA 4O28A 3AIUA 1QNQA 3AAMA 4H9MA 4DJDD 4GZJA 4A8IA 2PLKA 2A1YA 3AHXA 4V33A 1SQ7A 2ZC8A 2GJXB 1FKXA 1DWGM 5FSEC 2AOSA 3STEA 4X60A 2DFAA 2Z1BA 3QEZA 3SGZA 3VGFA 2F2HA 1XI3A 1PO9A 5K9DA 1HG3A 3F4VA 5MKGA 5M17A 3OB8A 1TYGA 1SZNA 1DTUA 3BMVA 2OEMA 2FTPA 3BSHA 3MHUA 1KLYA 5JBFA 4GH3A 3SIMA 4IFOA 4BWLA 2FLIA 3LRKA 1UA3A 4DELA 4PL2A 3AC0A 3SR7A 4H19A 1ZL1A 3NGJA 1UR8A 5C9RA 1U33A 3DH7A 1A5OC 2PDMA 3H23A 1L9WA 1OD0A 4PMJA 4KF1A 4B5XA 1PXGA 4UTUA 4G7FA 4IGHA 3URAA 3N2CA 4S3KA 5CBIA 4M7SA 4LW7A 1JPMA 2ATMA 3UR7A 2B81A 2OSYA 5I06A 2BGSA 1XCXA 3PZIA 4BQ2A 3WLKX 3R2GA 4FR6A 4NJKA 1MEHA 3BE7A 2NT1A 1H62A 3WH9A 3VNJA 3EB2A 4ZTXA 1JCLA 1OFDA 2VNCA 1F61A 3VD5A 1OFEA 4KCVA 1ZBKA 1ZZMA 1JXJA 4LF2A 3NSXA 1GONA 2ABBA 1FHUA 5AVNA 2HBXA 2PDPA 5HWMA 3U4FA 5IOBA 3KOWA 4GJIA 3OEXA 4INFA 4LAZA 2OODA 1LOQA 2YDRA 1DJIA 4I9AA 3K1GA 4IMCA 4RDWA 5LHFA 3G0SA 5AZ0A 1BF6A 3TLQA 3HQNA 3OTRA 3PVFA 4KWSA 1X7IA 3FYOA 2G4FA 5XIAA 2WZEA 3S2JA 1N8FA 1EKOA 1MZHA 2DORA 3W88A 3DHUA 2ICSA 2VRKA 1IXQA 1K7XA 4NXSA 4LAUA 2FH6A 4OUEA 3FCPA 4ILSA 4AZ6A 4U2ZA 4E4UA 4DUXA 3QKZA 1BYDA 4C60A 4GIAA 4O19A 3UW6A 3W74A 1K8CA 3ITXA 4RK8A 3TA9A 2H9AA 1AH0A 1CPUA 5A1AA 4A8NA 5D9OA 3TZFA 1TJ1A 3PB2A 1I2QA 4M1RA 4YJ5A 4E8GA 1XUZA 3QH2A 3BURA 3EWDA 3W1LA 1QDSA 4M7TA 4LFYA 2CLFA 4PUWA 5GQBA 3SQLA 3WD0A 1PVNA 5RUBA 1N55A 4H6RA 4JXCA 4DYJA 1RVGA 3FSTA 1OHLA 3RRAA 2EF9A 2XH7A 4JHZA 1XGEA 3D5HA 1FHDA 4RV8A 1ZGDA 4Q8TA 1UR1A 4Z2IA 1E4MM 3ZSTA 2GGEA 1NU5A 2HPIA 1AZ1A 4H9XA 4U28A 4AH7A 3NG3A 3WEOA 3SCNA 3DN5A 3NCOA 2FYMA 3VPLA 3UT0A 5I78A 1HKVA 5DCDA 1IT0A 1KR1A 3G0UA 1V02A 2PF0A 3HV8A 4M56A 1GOKA 3TKFA 3AU2A 1R7AA 3NFUA 4Y90A 4ZQMA 2E28A 2HVNA 1HNYA 2Y0FA 3ZT5A 4KS0A 1R3QA 1YX1A 2BFGA 3N6QA 2WOQA 3H70A 1RR2A 3ANYA 3M9YA 3CUXA 3AUOA 4GX8A 2J7FA 3D6NA 1XIBA 5FOOA 4PUDA 3OHMB 5C2XA 2PRHA 5FJIA 3ES7A 4HZMA 2WXDM 4LF1A 1JIBA 1ENUA 5IFPA 3AZSA 5G1TA 4MYAA 3BMXA 1KCZA 4DWDA 3P3BA 2PRLA 4WX2A 3CASA 4R53A 2FZBA 2WB5A 4C65A 3FXYA 1LZOA 2A85A 1BTCA 4FSAA 1B30A 2EKGA 2C8NA 5HMSA 1OFPA 5D9NA 3T2PA 3PR2A 1TTQA 1IHIA 1I60A 4HHMA 4XUYA 3EWYA 1EPVA 5GNXA 4HPGA 2VCBA 4N9CA 5A69A 5A6KA 4LY4A 4LPCA 3S2MA 3F7JA 2Z00A 5DCBA 1VGAA 4O12A 3WLIA 3K13A 3VUPA 2F38A 1SJCA 4L4LA 4HU3A 2VX5A 3IJ8A 1FBAA 1CXLA 1WBHA 2DJXA 4B3ZA 2WMKA 4V1XA 1GVEA 1MW2A 1U1JA 3VM5A 1BGGA 4B91A 3RU8X 2W0UA 3BGJA 5HNUA 3UVAA 1T7LA 2XYLA 4KEZA 1B4KA 4OBRA 2B7NA 2PSNA 4HZ8A 5CAKA 1VFMA 3W72A 2ANUA 1EX1A 2YSWA 1PBGA 4HOWA 2HJPA 2OEJA 3P2VA 3BLLA 2PDWA 3CMJA 3UNTA 1VHNA 3IV3A 3OYXA 4LB4A 3KP0A 1TWSA 3AXMA 4JY8A 3KUMA 1F7BA 3KP1A 4J40A 1UMLA 1OX6A 1I1XA 3W38A 1TPFA 5C55A 1OCBA 4A3HA 1E4IA 2PEVA 1HX0A 1CXIA 1KRAC 1UH2A 1XG3A 4X2PA 2WSPA 2Y88A 1SVDA 4NT0A 3Q37A 3RJXA 1KBJA 3RLGA 2DJLA 3I7SA 4S3EA 1KQYA 3M0VA 3N13A 1DIOA 3K4DA 1US3A 5DT7A 3RM8A 1AJ0A 1XIJA 2E1DA 3KX6A 2G3FA 2WWCA 4ADSA 1MNSA 1EJVC 4FHAA 1OFBA 4OT7A 3E0WA 1GGOA 1VBRA 3N14A 5ABGA 1YIXA 2Z25A 4LBRA 3UZJA 1G1YA 1LG2A 1W6TA 4J3XA 5DMNA 3IGXA 4AZIA 1VP5A 4EP8C 4M3PA 3WNKA 4L80A 4HZ6A 3GIPA 3PPGA 2DUZA 1O1ZA 4IG2B 1OG6A 1A49A 2Y7DA 3CUGA 1MXGA 3Q4DA 3VDAA 1ZAJA 1LRNA 2ZRYA 3B0XA 3M7SA 3D46A 1XFCA 3LXCA 3SSZA 4Q8UA 2XVNA 1E9ZB 3N11A 2I56A 4XSMA 1E5JA 3WQ6A 3U8GA 4B3LA 3RITA 3W1PA 1BKHA 1PZ1A 1R30A 2ZUNA 3B0VC 4RZ4A 1B2YA 2QUMA 5AYZA 3DFSA 4POCA 4D6CA 2VC6A 4C6OA 2CEQA 4QQ3A 7REQB 3QTGA 3U57A 2ZZ3A 3NDYA 1Y5WA 3GR8A 4ZQOA 4V27A 5FF0A 3TSMA 1E55A 5TQLA 1V6VA 1HF6A 1KTBA 3GG8A 3VKDA 3DFTA 3MI3A 5K4ZA 3EGJA 1XRTA 4PMOA 3TLLA 3FA3A 1F5ZA 3H54A 3LPOA 1LBLA 1C8VA 1TCMA 2R1NA 2GQAA 5CC6A 1FWFC 1ISZA 5BXRA 2ZDSA 5C54A 1HKIA 4NZ5A 4KIEA 3T42A 4G56A 3PZMA 1XRSA 2ZOXA 4ADTA 1XV8A 3RF9A 5EFFA 3T8LA 4QG9A 2VRQA 3H4XA 2NSOA 5C9ZA 3MO7A 1KGUA 3BJSA 1CDGA 1AVAA 2V5DA 4AY1A 1H7WA 1OQFA 2FMNA 3LY0A 2CCRA 2RJGA 1KRBC 1G69A 5D9PA 1HT6A 3V0TA 3PG9A 4GHRA 3E5BA 2O9RA 3AMLA 4UQAA 3GBDA 1TJ2A 1W3TA 1BTMA 5TD4A 2GQ8A 1YPIA 1SZRA 2O9OA 3L12A 4X0VA 2VYOA 2RHGA 2W91A 2BDQA 1W1ZA 1DTNA 2BY3A 1HTIA 3D47A 3L5LA 2YYUA 3TXVA 2VEPA 3WZ0E 2FFIA 1H5VA 1DWFM 4YN5A 1E70M 1KM0A 2BBFA 2XIJA 4B15A 1BPLB 4IMGA 1LLWA 4MYXA 1OWQA 1FFRA 1H7XA 3V1HA 3E6EA 4O1CA 5EKYA 3XISA 2D23A 2E67A 2VD8A 3OYZA 1PWLA 3KBNA 1F4AA 4OHQA 2V63A 2XG9A 1UWIA 3D3FA 1KA9F 3GIYA 5B80A 4UFHA 2G0WA 1QK0A 3U4AA 1EEXA 1V3KA 3UYCA 2WZTA 3UGRA 2OZ0A 3GDTA 4FS9A 4ZO9A 3GRIA 3CAKA 2CLOA 3RM9A 3LEPA 3NO3A 4HSHA 4IPNB 3ZZ1A 3AUJA 4L6OA 4Z08A 2ZZ6A 3V36A 1ISYA 3EMZA 5CJ5A 3FYYA 3BZGA 2O9PA 3AHYA 1VS1A 1H0IA 1V3MA 2V81A 2A6LA 1GCYA 3EB3A 2WKLA 5C7VA 3R0DA 1YNPA 1ADSA 2E5DA 1GEHA 3FGCA 3PF3A 2FQIA 1B5TA 1NWTA 3LQLA 3AWNA 4A3UA 4H8UA 1D3GA 4PFMA 3VD4A 1E51A 2HTMA 1RLCL 4Z1DA 2PLCA 2VKZG 3KOYA 1SJAA 1BWKA 2A7RA 4KFOA 4YCPA 4GI9A 3C2YA 1GEQA 4NZCA 2EHHA 3AIQA 4S23A 2AL2B 3C86A 6TAAA 2DQXA 1IGSA 4PCTA 1J6PA 4L4MA 4DO7A 2FH8A 4YWSA 1E6SM 4NU7A 3N2BA 3DOPA 4PBEA 4Q7IA 1KB3A 6ALDA 1WDSA 2ZUVA 1WDDA 1W8GA 1WB0A 1S3HA 3MBFA 4F2UA 1H63A 1HL9A 3GR7A 3UG5A 1L6WA 4CD7A 3G1SA 2WJFA 2R1LA 2D3LA 1HGYA 3UGVA 5DFAA 1H41A 1FVPA 5LIUX 2E1WA 3SSJA 5CG0A 2Q02A 3DFYA 5HMEA 4FEZA 4YNGA 4O52A 4LUTA 1RCXB 1XIFA 1NSJA 3SUSA 3EOOA 4CNPA 2HPMA 1TZ7A 4KWWA 3LSCA 2EPOA 3H53A 4CQ9A 3WBAA 4D6IA 3DERA 5EBUA 3A22A 1LTDA 1PIFA 2E77A 4FXRA 1KRMA 2UWFA 1J0HA 1FX6A 1SSGA 3QZEA 3PAJA 4XUGA 4WUIA 4HNLA 1TX2A 1TA3A 3K30A 4H7VA 3WH7A 5I5RA 4ZO7A 4K2SA 3TOYA 1S2VA 1TPH1 3RX2A 3W24A 3QLDA 2GUUA 3P6LA 1WXZA 3NL3A 1PKMA 2GL5A 5FJRA 3QSTA 4EK7A 1QCWA 2BXZA 1XIGA 2A3HA 3FX4A 3GHRA 1XS2A 2VL4A 3SCPA 2OX4A 1JCYA 5I03A 5LYRA 3OBAA 4GD0A 1AW5A 2PPGA 3DI0A 1L6YA 1GHRA 1DJQA 4XD4A 1XIEA 2CKRA 4UMAA 1WDRA 3W01A 3LM3A 2PWDA 2O7SA 3M5VA 1XYLA 1MVYA 3VK5A 4ICNA 4L1GA 4YVVA 2IPWA 2DP3A 2WCSA 3WUFA 1K4HA 2NX9A 4J3WA 1RUSA 1GOMA 3BZJA 2QIIA 1IIHA 4Q7BA 3WD4A 3QV8A 3NQBA 5C71A 2IS7A 3VOCA 4IJRA 3MS8A 1TR1A 3LGEA 4UTWC 2Z7GA 1XDMA 2GLKA 4D72A 2PWHA 3LX9A 3W2NA 2X0YA 4IGSA 3O6YX 1R8LA 2EAWA 4P7LA 2C16A 3A3HA 3PTKA 1X1ZA 4WGHA 2PF8A 4W5ZA 3PPHA 5FF4A 5JU6A 4BCEA 3MHGA 4AC1X 1IXPA 1ZNNA 3EWXA 4HTBA 1VEMA 2D0HA 4ZOBA 3RX3A 5MKGB 1VJZA 4PCPA 4H8NA 5KMYA 2O55A 3TC7A 3PBVA 2FHCA 3L4WA 2NLYA 5I02A 4QJ4B 4C6EA 2CERA 2GVLA 4H2HA 2V5BA 5I3IA 4GVIA 3FEMA 3CPGA 4ALDA 3A4AA 1JZ2A 4AZGA 3UY8A 1PPIA 4WLCA 1PX4A 1CXFA 4FMVA 3VKKA 5A8PA 4UNIA 1GKQA 1KM2A 3JVAA 5E5CA 1TV8A 3OLEA 3WJYA 1JYXA 3T09A 3MYPA 4M82A 3KL0A 4FF7A 4LQ1A 5J5DA 4JN6A 1SZEA 1Z44A 2GK1A 1QXLA 4WJEA 1HJQA 4KWUA 3GXMA 3R89A 1F4HA 2HE8A 1KV5A 4IIBA 4ZCWA 2FZDA 1CW2A 2DVUA 2UY5A 4X63A 5FF3A 2O0TA 3DGRA 5I00A 2J8FA 3OP2A 3ZOAA 3W6LA 2R1MA 3MZNA 3D3AA 4RCXA 2GSHA 1U22A 4JX4A 3HGOA 3SM0A 4IGMA 3GVRA 4MMWA 4DLFA 4KCUA 3FIGA 1CGTA 3KVKA 1ZY9A 1RK5A 1MW3A 3AOFA 4WCJA 4XZLX 1EO7A 3RLHA 1A80A 2BMBA 2WLZA 2WMGA 3UZWA 4Z2HA 4HN4A 3W1RA 2YXGA 4C90A 1IZJA 3GAYA 2O4MA 3MV01 5E0CA 3CUFA 2DPEA 4WXZA 3IARA 3VD9A 4MWAE 2NV2A 2ISVA 4HK5A 2H9AB 4CQ8A 2HBVA 3ZLFA 1EP3A 1GG0A 1GZGA 2CBVA 4K8EA 4LRTA 4GUFA 5JIPA 4F0HA 2G8ZA 2J6VA 3UXAA 3H2FA 1MQRA 4TOQA 3MDWA 3SADA 4BF5A 2WZMA 4P8UA 1OFOA 1GYNA 3NOEA 5HULA 1NF7A 3WMCA 3KOXA 3KE0A 2GJLA 4CCDA 2GSEA 3BLOA 4X0NA 3ZJKA 4JTIA 3QR3A 3R4IA 3E5PA 2X7VA 3MYOA 3R25A 3UZXA 2V6AA 5EMJA 2Q8ZA 2QHAA 2YLAA 1SO5A 2YYTA 2NX3A 3CEPA 1PX3A 2ZZ1A 8XIMA 2Q71A 2CITA 4GYFA 3L2IA 5CCZA 1SW7A 4UFMA 3HFTA 1Q6EA 4DO6A 2A3LA 1W9PA 3AS3A 5IRPA 3TXZA 1V08A 2BWGA 1J12A 2PP3A 3O7UA 5IFTA 1R87A 1H3GA 4GIYA 4A4AA 4JTLA 4XD6A 4R34A 3ZVIA 1HJSA 2AMGA 2OSWA 4ZEPA 3OHIA 1FH8A 1S5MA 2WZHA 5XINA 1S2TA 4PMYA 4H7CA 4GC4A 4TVCA 5FJPA 1BG4A 1Q85A 4JD4A 4PTXA 5DO8A 1QJWA 4BQ5A 2GPTA 3PG8A 2XU2A 4YHGA 3GNPA 4O10A 4LUSA 2DGAA 3WFLA 4F79A 1E6QM 3LB0A 4HMNA 3N9RA 4PTNA 3G0XA 3P67A 4WKHA 4HPHA 2YFNA 1HKJA 4G1NA 1XW8A 5A6AA 1GW9A 4HCDA 4ZA0A 1IXNA 1PJ9A 1W9BM 1AQFA 4MY1A 4Q8QA 2O9TA 4CD4A 5I77A 4NNAA 4AISA 2QCDA 4HNVA 5BRQA 3WH8A 5HOSA 3N17A 3A3XA 3TMQA 3GHSA 2O7QA 1XCFA 3NEHA 3KBVA 2E5BA 2ZQ0A 1UQZA 2BTMA 2HXTA 2D1ZA 2NXHA 3WLMA 3ERPA 2XM1A 1D9EA 5D8WA 1UWQA 4LS1A 3MU7A 2W67A 3H2AA 5F1VA 2G3MA 2YZ5A 4MOZA 3W73A 3ZJ6A 1P4CA 3CTTA 4NF7A 5AHMA 2P0IA 7XIMA 3INPA 4MJ4A 4P61A 1J96A 2C0HA 1ADDA 2PD5A 1O94A 3SCWA 2OO0A 3NVTA 1WDPA 3VIIA 2DV0A 4KKXA 3QQ1A 5D33A 5I7GA 1GQJA 2WNQA 2FGBA 1QAPA 4G2DA 3ARYA 4Z1YA 1I0DA 4RE0A 1UZHA 4GZ7A 4D71A 3LXAA 3Q65A 4D6FA 4UFKA 3AHZA 3XINA 3THAA 3QMTA 3IS4A 5A8MA 3E49A 5HAOA 2XPKA 3F1QA 1KBLA 3S46A 2QJMA 1XUUA 4Z2LA 4FO4A 3NZGA 3NZQA 1R3TA 2YB4A 2P76A 1ONWA 4EIVA 6XIAA 3VNZA 4GNJA 4US5A 1XGDA 2C19A 3A9IA 1RJPA 1AK5A 1F76A 3IGSA 4LSBA 1LLOA 1RD6A 1UCWA 4NJGA 5AY7A 2PC8A 3CQKA 1P0BA 5LIWX 1V0LA 2A4AA 2J25A 2WKGA 1G4EA 4DBSA 4WY0F 1JFHA 3RCMA 2GSJA 4E38A 3FDGA 4FNQA 3BW4A 4HBKA 3RLVA 4PR4A 1HL8A 1UBPC 4Y9NA 1R47A 4RL3A 3UESA 3H12A 1XYBA 1GZJA 2HV5A 1YADA 1A3HA 1X6UA 2V68A 2BOFX 2ZUTA 5LZLA 1UMYA 4JFWA 3GAKA 1B31A 4X2RA 3EMQA 3VGEA 4HMCA 1TJPA 1K9DA 3ARVA 2V8ZA 3TA6A 1S5TA 3O07A 4UUIA 4L56A 3TDFA 4KCWA 4Z0SA 2ZZ5A 2D2GA 2RFGA 2HSAA 4MF4A 3O6AA 1R3RA 4EF8A 4QE5A 4IMEA 4MADA 2W79A 3DFNA 5DY3A 4AHQA 1TPUA 1GG1A 2GUBA 3GU2A 3E2VA 2Q01A 2PRMA 3TYZA 1BSLA 2HZGA 1XIHA 4JIQA 1VKFA 3GFYA 2OELA 5G2IA 4A3YA 1XYCA 2HWGA 3QY7A 4DAIA 4NNCA 4M81A 3ALGA 4WOQA 3GW3A 1GKRA 4CCZA 1UZ4A 4YXGA 4E4FA 7ENLA 3WFZA 4REQA 4KRZA 2HNHA 4G1KA 1NIUA 4D1IA 2X8RA 3W7QA 4UMCA 3TP4A 1H50A 3KW3A 4JTAA 1AQ0A 4H01A 1KTNA 2RH9A 5ECVA 1NAL1 2EPLX 4UMBA 2DIEA 4HNNA 4MVAA 5CZKA 3URNA 2O92A 3BQ6A 4AVNA 1VCVA 2XZ9A 3SCUA 3QTPA 3IK2A 3AQUA 4XZHA 1A0DA 2WHLA 5C9XA 1S3TC 2CXGA 3IJ6A 4YCOA 4F0RA 3TSBA 3MC5A 4RW5A 2QULA 3OLIA 2W4XA 2X42A 4OUIA 2XH2A 3LRLA 4LNYA 2NQHA 3PNZA 3HG2A 3B8WA 1OFAA 4DM2A 1V0MA 3F4NA 5TNVA 1GJPA 4A8RA 3F2DA 3A13A 1VFOA 4B5WA 3M1ZA 3B8IA 1IWPA 1W1YA 3T08A 3W2KA 1A5SA 3VIPA 2HE5A 4DXXA 5I3HA 3WNMA 4O11A 3O1NA 4OJYA 3LTYA 2DUAA 1W9UA 1TE1A 3A3WA 1SMDA 1Q7ZA 3JUGA 1EQCA 1HO1A 4YTTA 1WOAA 4F40A 2Y89A 4XZIA 3WQWA 1FCQA 2QW5A 4MKSA 4QSHA 3ATYA 2VXNA 3SJ3A 1JAKA 5I3DA 1B0IA 5CJMA 4GI4A 4ZXLA 5AHLA 5F7UA 3ZJ8A 3NO1A 2QF8A 3RX4A 1GORA 4IL0A 3EEZA 3SGGA 1T6MA 3LUTA 4GYPC 4LVFA 3BGGA