3MO7A

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 2'-fluoro-6-iodo-ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Novel interactions of fluorinated nucleotide derivatives targeting orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 98
structure length 258
sequence length 258
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mo7A00
3I65A 4GE8A 3LV5A 3O6DA 4PCFA 3PULA 1XFBA 2EPHA 1OX4B 3OVPA 4JTKA 1O60A 1YYAA 1L6YA 4LV4A 4UFHA 1CI1A 2YXGA 1RVGA 3Q58A 1FXPA 1MO0A 2DJLA 4L4LA 1TQXA 3LRKA 3NQDA 2OT0A 3HJZA 3TV8A 1EX5A 4O1DA 4UTLA 4DPQA 4Z1BA 2XN1A 3C52A 4AXKA 2V2DA 3W70A 4JEQA 3STEA 1UUOA 4UNLA 2YR1A 3B06A 3GKFA 3VKJA 3LX9A 4JNMA 3C56A 1O5KA 1FX6A 3LCIA 3S42A 2AGKA 5D05A 3QC3A 1VCVA 1YTDA 5F2LA 1B4KA 1A50A 1LM1A 1H61A 4QIUA 2R14A 1H7OA 2BX7A 4RV8A 4UFMA 3TX9A 3LGEA 3MHGA 1LBLA 2KZHA 4MIMA 1O4UA 1OF6A 1UUMA 3EX4A 2WKJA 1W3TA 1TTPA 1GTEA 3THAA 3W9ZA 4QNWA 1SZNA 2WSRA 4RXGA 2VOMA 5AB3A 1RQEA 2HS6A 3W88A 1DV7A 3PS7A 5C55A 3S8HA 3UD6A 3W3OA 4AHQA 4UIOA 1TPDA 4A3UA 3STCA 4MY8A 1FUYA 5H2ZA 3GDMA 4GXMA 4AMAA 4CQ9A 2H3BA 3W7LA 4D2JA 4W9TA 2Y85A 4WOQA 4ADTA 4TU1A 2QJIA 5HWMA 1HO1A 3W1RA 3MI2A 2A6LA 3SIZA 5AYXA 3W7QA 3W1NA 3W1TA 5EL1A 5K9XA 3W83A 3PM6A 1N7KA 3O07A 1JQXA 4Y6GA 5CG7A 1LBFA 2LLEA 1KFEA 5DBTA 1F76A 2P10A 4GUHA 5CPNA 1XDMA 3LCLA 4ZQMA 3Q94A 1ICSA 1XBZA 3LHZA 3NNTA 3PR2A 3UXAA 4RLIA 2E6YA 3RMJA 4K8EA 2BXVA 2ZFAA 1GVFA 3BARA 3SW6A 4BI7A 4JTFA 1IGSA 1OVDA 3KVMA 4DO4A 2W0UA 5EKYA 1LLWA 4NZFA 2RDUA 3NQMA 1TPB1 4ZQPA 3W1PA 2Q8ZA 3DHDA 1QPQA 1K03A 5KZDA 2C15A 5EPDA 3N9SA 4O57A 1ME8A 3NG3A 3R2GA 2QCEA 5TQLA 3UPWA 4FX6M 4WQ6A 1DJQA 3T44A 3QW4B 3GIYA 1BKSA 2CLEA 4AHPA 3M5XA 4OQVA 1EIXA 3MI6A 4YLWA 4YL2A 7TIMA 1XCFA 1GJPA 3ABOA 2NXGA 2QEZA 3I7SA 4LTSA 1WX0A 3EXTA 4GNJA 2YW3A 4P61A 1B9BA 1H7XA 1LRTA 3IGXA 3LTYA 1VQTA 3GXNA 4UTIA 2O7QA 3L21A 3L67A 3MO7A 4UFKA 2E6AA 2WV8A 3K30A 5EBUA 1XI3A 3GK0A 1LOQA 2G95A 3BW4A 3TJXA 5FESA 2RKXA 2NLIA 3LOTA 4IX2A 4YCPA 4PC8A 2O7SA 2RHGA 2WJZA 4HHPA 4IMFA 4KFPA 3MBFA 3NQVA 2X1SA 1WOAA 3ABRA 3TC6A 2E5BA 4AH7A 3GDKA 3DFOA 1VCGA 3UWVA 1DKWA 1UB3A 3P74A 5DXXA 1LORA 2VEIA 2GVGA 1PS9A 5AHIA 2I9EA 2D73A 2QCCA 4CQAA 4N2YA 3TR2A 1D3HA 1VGAA 4M7TA 1TYGA 1EEPA 4IMEA 3GDRA 3W2UA 2IQTA 3PB2A 4UTKA 2V81A 4Z1DA 4BFAA 3DFNA 3OVRA 3HG2A 2Y88A 1W56A 4O14A 1PCKA 2ZZ5A 1YDOA 4FX8A 4R53A 4BR1A 3BW2A 3O6YX 4RZ4A 3WK2A 2Y63A 3IGSA 5LHFA 3LV6A 3VI2A 4M6VA 2ZYFA 2GOUA 1K02A 5G2WA 5D04C 3NAVA 1T96A 3W2LA 3EWBX 3BLIA 2OJPA 2CLOA 2CLKA 4LS1A 3S5ZA 2F84A 2HS8A 2J24A 2V5BA 1GT8A 2DZXA 3NDOA 3B0VC 1A5AA 3LCGA 2NXIA 3L0NA 3DH7A 3C2FA 1YPIA 1I2OA 4RJEA 5DBUA 2VFFA 5I3KA 5G4WA 4YCOA 3MMTA 4ZQCA 1LOSA 2OZ0A 4MLJA 1L9WA 5FEPA 3S6DA 4ADSA 4RCXA 1BWLA 1F6PA 2C14A 1KTNA 2QDHA 4RR4A 4A2SA 1K7EA 1KFJA 3M1ZA 1LOLA 3DGRA 3LCWA 2I1OA 4Q33A 3NPUA 4KWVA 2CZEA 3C2RA 2H90A 1RQHA 1JULA 3S1WA 5D38A 1W8SA 3C4UA 5AFDA 2B7QA 4GUIA 4LVFA 3CIXA 4K8HA 3OEXA 2B0MA 1SPQA 1NFBA 4UCGA 2ISWA 2J9YA 3IGUA 3IVTA 3NM3A 2QCLA 3EB2A 3QH2A 2VXNA 4N6EA 5BMXA 5HQEA 2P1FA 3EXSA 4K7YA 2NWRA 1Q6RA 4O4VA 4QM1A 3FYOA 3GZ3A 1JCXA 1ME9A 1X8FA 5I3HA 2C18A 3S9YA 1PL9A 3QZEA 2JKAA 1O95A 3SSJA 3N14A 5ABTA 3Q2DA 3H54A 1JCLA 3TFCA 1GEQA 4TX9A 4NJJA 4ORMA 1QR7A 4M19A 3CU2A 5F2IA 3G0SA 1KA9F 1NF0A 4N4QA 1H60A 2V8ZA 3KRSA 3N34A 1XUUA 2C3ZA 3FLUA 4O18A 4JYEA 4FEZA 3MHFA 1IXPA 4O52A 1FDZA 2CZ5A 1KFLA 2ISVA 2CLMA 4WX2A 5LNUA 2NZLA 4LS0A 1TJRA 1ICPA 4KFNA 3CEPA 1NEYA 5LHEA 1W3NA 3O63A 3E12A 3N3MA 5A5WA 3VFLA 4JN6A 4LRSA 2A7NA 1TPEA 4IMCA 4HNNA 2A0NA 4BF9A 4POCA 1DORA 1OK6A 3M9YA 2Z1BA 1FWTA 5HWNA 2FJKA 3PG9A 4N9EA 2X30A 5FF4A 1FY6A 1OYCA 5SWUA 3M47A 5C6MA 3W1XA 4HSOA 5IBXA 2HMCA 1TCDA 2GQ8A 4IUOA 5DCDA 4H3DA 1OF8A 3W7HA 3TIMA 3L2IA 3QM3A 3NPXA 1FXQA 3USBA 4UMAA 3LERA 3M7WA 2PRLA 2VFIA 3KVKA 4Y8FA 3W2JA 4WUIA 1H1ZA 2B7NA 1LBMA 3W1LA 2JGYA 1FWNA 4O53A 4N4PA 3QMRA 3CEUA 5TIMA 2YZRA 3BG5A 4FIRA 3FYPA 3L5MA 2GVLA 3HGSA 4JTIA 2ZBTA 4MJZA 4DPPA 1VLIA 4OT7A 4CNNA 3TCEA 2PRHA 1O5XA 3PUOA 4GWEA 3RK8A 5KZEA 4LVDA 4GRSA 1WV2A 2NWSA 3BO9A 1F6KA 1RD5A 3S5YA 4CQ8A 4AWTA 1A5CA 4NZJA 4YXGA 4JR5A 5DXYA 1YXDA 3L68A 4FNRA 6ALDA 2AAMA 5FI8A 1B4EA 3QFEA 3QQ1A 2G5WA 1ZJIA 2Y61A 4IXHA 5F4SA 1T8XA 4Z0SA 1CX9A 2E68A 2A1YA 3IVSA 3IIZA 3W7CA 2E09A 1QPNA 1OFPA 1GYNA 5EMUA 2WQPA 3EX1A 4IX0A 3O05A 4ML9A 3W6YA 3NL2A 2QJHA 2J9XA 4DF1A 3QF0A 5D2VA 3CM4A 4Z0JA 1VLWA 3W1UA 3LB0A 1Z48A 3G18A 4M6PA 1W5OA 3A5FA 2C6QA 2JGQA 4ICNA 1V7YA 3QQ0A 4HNUA 1D9EA 3PAJA 3RLVA 1KM1A 2X16A 1WXJA 4XBSA 3TKFA 4PL1A 3ABQA 1J2WA 3M44A 3KOFA 3L65A 4BI5A 4O1CA 2QCDB 4JD4A 3PG8A 4NJIA 5HJLA 3NQFA 4K39A 1KM6A 1SW3A 2XN0A 4FF7A 3HPXA 3UWWA 2A6NA 2FDSA 1XC4A 1XXXA 3O6CA 3E02A 1YXYA 2A85A 1YTEA 3MBDA 1U5JA 3V75A 4OU1A 3ATYA 3P5YA 3EX2A 3M5VA 1OFRA 5HR6A 3CWNA 5F2MA 2QCFA 1JR1A 3SJ3A 4FNSA 1PCWA 4QITA 1WAUA 1GWJA 2TMDA 4FNTA 1TPC1 3G3MA 3GAKA 1RQBA 1P5BA 1TIMA 3NQ2A 1U83A 2E5CA 3I68A 3GR8A 1SW7A 2GPTA 3IVUA 3W7KA 4CCDA 1YADA 1UJPA 1QMLA 1TREA 1OG0A 2A4AA 2I14A 2RFGA 1I8JA 4EF8A 2GVJA 1TSIA 1T0OA 3P8IA 1J4EA 2Y89A 2TPSA 5KTLA 4WXZA 3LTSA 3NQ8A 1WBJA 1A5SA 3NPWA 4XTDA 5DLCA 4FX7A 5AHFA 3C2VA 5IM51 1F74A 3JS3A 4OV4A 3LXBA 1B57A 2QAPA 3GNNA 3INPA 2C0AA 3GX9A 1NF7A 3UXDA 3F03K 3O15A 2YW4A 1Z44A 1DOSA 1L6SA 3TH6A 3TAOA 2V5LA 4O0KA 4E2BA 3SI9A 3PWAA 3RLUA 4NXSA 2YFOA 1NSJA 5HUOA 4K7VA 2ZRVA 3UYCA 1BTMA 1SSGA 2PCQA 1IXQA 4JX4A 1PVNA 1N55A 3EKLA 2GQAA 3TW6A 5HNRA 3W7IA 4U4MA 2FB2A 3LM7A 3WK1A 1SR9A 2E77A 1YDVA 4UTWC 1TPWA 4WZHA 4N9BA 1SZEA 1OFDA 4XUGA 1M7OA 3YPIA 2EHHA 3PBUA 3EWYA 3P84A 4EF9A 4FIQA 5BOOA 3THQA 1JUEA 1WOBA 1ME7A 1BWKA 5AHMA 1KLZA 3IV3A 1C8VA 1J5TA 3TROA 5BRBA 1IXNA 3C2EA 5IBXC 3PB0A 4IMDA 3KFTA 1FDYA 4XKYA 3BLEA 1JVNA 2R8WA 3QPYA 1EP3A 1VPXA 4PL2A 1KV5A 3PF3A 4O1AA 3I6RA 4R7JA 3TDFA 2H3DA 4QQ3A 4JYFA 3LHUA 5G1YA 3W7GA 1I2NA 4UR7A 1OX5A 2TYSA 4EVZA 3W23A 3SGUA 2WSQA 3STGA 3DXIA 3EX6A 3A22A 3ZS4A 4NUWA 4AAJA 1GVQA 4CNPA 1ONRA 1KW1A 2ZRXA 3M16A 5GVJA 4UFIA 3R12A 4IPJA 3TQ0A 3E9AA 2Y7DA 4O15A 3M5YA 4DQWA 1H7WA 4K36A 3C61A 1QO2A 4ZQRA 2VFEA 3EEGA 3STFA 3L9CA 1AL8A 2EGZA 3MI3A 3QPZA 4JDYA 3HIJA 3TSBA 3MWAA 3CT7A 3GAYA 3O16A 3P80A 1P4CA 1VJIA 2DZSA 4O11A 2NUYA 1KM0A 3VNDA 5K4ZA 2QUVA 1TTQA 4NVTA 1Z41A 1ZHAA 3G1FA 4RK8A 5J5DA 1W5QA 1R2TA 1AK5A 4RX0A 4UMBA 5AC7A 1SO5A 5HINA 2A2IA 3I7QA 4NJHA 1JQVA 3NR0A 3ANYA 4JTGA 2TRSA 1VR6A 1PHQA 4X22A 1W37A 1TV5A 5LZLA 3QW3A 2ZDRA 3IRDA 2ZRZA 3BK0A 5E93A 1LRQA 3LTPA 4JIQA 3C8FA 4IQLA 5EY5A 3H55A 5CPLA 3GB6A 3OA3A 1SQ7A 2QCNA 2OT1A 3I7RA 1W54A 1H63A 4N6FA 4LUJA 2B7OA 3E0IA 5C2XA 1QFEA 3CIWA 3BLFA 2WSYA 2XN2A 3LHTA 3MW7A 2YX0A 5K3VA 5LNSA 1JUBA 1Z42A 3NZ1A 1WA3A 3UWQA 1PE1A 3W75A 2FQIA 4TMBA 3LCXA 1QCWA 1KV8A 5L6UA 1ZCOA 3L5AA 2V30A 3KHJA 3W22A 3WK0A 1M5WA 3S1UA 3RU6A 5HR7A 2DZPA 1DJNA 3W2NA 1KFKA 1ML1A 2VC6A 1G7VA 1G7UA 3HBLA 3UWUA 3W7DA 4HSNA 3KX6A 2QKFA 1QPOA 3S5NA 3TNOA 2H6RA 3KAOA 1YPFA 1OFAA 3NO5A 3U8GA 4LWWA 2CLIA 1UCWA 4WY0F 2W79A 2FIQA 3NPVA 2PE4A 5G4EA 1DBTA 2DZUA 2QUTA 1W5MA 3W2MA 1TB3A 3GNDA 2AQWA 3TUUA 4AVFA 3B4UA 4TIMA 3UQNA 2GUUA 3W7NA 1PV8A 1R46A 1AW5A 4IOTA 5CZTA 2BSLA 4XKYB 3RF9A 3NQCA 1AW1A 2RDWA 4FXRA 5H91A 3TC7A 3UZ5A 1NAL1 2JBMA 3RFAA 4K37A 1TRIA 3QSRA 4HT3A 1LLZA 4PA8A 3B8DA 2YYUA 1VH7A 1LROA 4RXFA 5F1UA 2ISSA 3MP3A 1WQ5A 5MHBA 3OIXA 4JTHA 1G67A 3O06A 3P67A 3T7VA 4NXKA 1GG0A 1I2QA 4LRTA 4QSHA 3V1PA 5K7JA 2PRMA 3B0PA 2PC4A 3L0GA 4GUGA 5CSRA 4ADUA 3IIXA 3R8RA 1WDWA 2CLHA 2DP3A 2ZZ6A 1DHPA 2DU2A 3S0CA 1KFBA 1F2JA 4NNAA 2PURA 4E38A 4UTJA 4J9JA 1XBXA 1CW2A 1GQNA 1G4TA 1EP2A 2FLIA 3G1XA 2ATSA 1R30A 3ZWSA 3OVQA 2F7FA 2R94A 2NUWA 4AWUA 4IGHA 5BW6A 2V0TA 1ZFJA 2G96A 1XBYA 1T99A 3P7YA 1TV7A 2ABBA 4O50A 1FCVA 1JCMP 3GXPA 1EUNA 2JK2A 2P0OA 4G1KA 4IXXA 4ONVA 3UWYA 1Y0EA 4MPQA 4MY9A 3WJSA 1SO3A 3FS2A 4JIPA 5D30A 5HULA 3PBVA 2XFWA 1AL7A 4HNVA 1I2RA 2ZTJA 2ZQ0A 3ZR4A 5BNKA 5CKSA 2UV8G 4GFSA 4CCCA 4HIBA 5D03A 4OHQA 4K38A 1ADOA 3DFTA 4NNBA 3CQ0A 3OG3A 1S5VA 4Y90A 4JXCA 3QSTA 2QR6A 1G4EA 4UTWA 1C29A 3P81A 2GJNA 1HTIA 2ALDA 2YCEA 3EWWA 1S3HA 3TA6A 4Q32A 4A22A 2VELA 1Q6QA 5F4WA 1MEWA 4AWSA 2HTMA 1TPVA 1QDSA 2ZZ2A 3NM1A 4O4WA 1I2PA 3QMTA 4Q4KA 3L66A 1SO6A 4LC6A 2ZZ3A 5KINA 1S5TA 4WY0A 4CNOA 4NT0A 2V2CA 4FNUA 1OFOA 5CGQA 5F4XA 2Y7GA 1LYXA 4UTMA 1ALDA 3LCFA 1JCYA 5DCBA 4PTNA 1NVMA 4IWWA 1OFBA 2ATMA 4JS3A 4B5NA 4MFEA 5G2IA 1SO4A 4DO6A 3B0UX 1GZGA 5DY3A 4MYAA 4R33A 4Y9AA 3W86A 3HQ1A 3NVTA 5G2HA 1M6JA 2DZVA 2R91A 1KBJA 2H8XA 1MXSA 2J27A 1W0MA 3LLDA 3TE9A 3O1NA 3M43A 3GDLA 5AC8A 4O1BA 1KFCA 4UTTC 2RH9A 2A7PA 4MYXA 3W2KA 1QNVA 3MUXA 3TAKA 1LTDA 2YGYA 3HGJA 2X1UA 4MLRA 5LNRA 3S1XA 2FPVA 4JX5A 4UC5A 5DELA 3L0KA 3GYEA 1R2RA 3WJZA 4R34A 4YMZA 1YLVA 3W07A 2Y70A 2VKZG 1P0NA 2ZZ4A 4E2DA 1JRBA 4DO5A 3LXAA 3TQVA 1KM4A 4S2CA 3FOKA 4C1LA 2EAWA 1LCOA 4ZMGA 6TIMA 1FDJA 5KZMA 3TU9A 3DI1A 5T26A 1OYAA 3BGJA 3S5OA 1MEHA 3ZWTA 1GVOA 3BVJA 5AYZA 1THFD 2BTMA 4GBUA 4BI6A 3NEVA 2ZA1A 2NX1A 4WD0A 1P0KA 5FF7A 1L6WA 3FJ6A 3HPSA 4UNKA 5CZ0A 3NQGA 3QRHA 3BV4A 5K2ZA 1DVJA 3IIVA 2V2HA 4PODA 3N73A 3ZFHA 1ZENA 3LDVA 1VYPX 2FPYA 3G1AA 1OHLA 4LU0A 5FEXA 1A5BA 1MZHA 2BWGA 3LI0A 2RDTA 5G5IA 1ZALA 2DZWA 4JY8A 3UY7A 4QNEA 3SY5A 2Y7FA 5L9FA 4LVAA 3HPZA 3QYQA 1XDLA 1QWGA 2EF9A 4JX6A 2ZZ1A 3HMJG 5AOUA 1VRDA 3UY8A 4WXYA 2Q3OA 3C0JA 3EKZA 1F7BA 2QCHA 1IIHA 1X1ZA 5D2YA 1ZNNA 2CW6A 3MP4A 1YDNA 4DBDA 2VEKA 3W1QA 2VFGA 5K9DA 1DL3A 3TJLA 3WJXA 3NXFA 3DKLA 5A8GA 2V9DA 1K3UA 1VYRA 2VENA 1UASA 3MP5A 3MJYA 4BWLC 4UUIA 4GC4A 4WY0B 2C19A 3BGGA 2ZRWA 3EX3A 5DCEA 2BLEA 4UFJA 2FB3A 2J6XA 1JRCA 1WBHA 1R47A 3NL3A 3P60A 4JTUA 2Z6JA 3BG9A 3TMLA 1WYIA 5HWJA 2Y62A 1H7RA 5I3FA 1ZY9A 3T55A 5DY2A 2NV1A 1OABA 3P5ZA 4O28A 2CU0A 3G3DA 1G4PA 3UNDA 3DZ1A 4ALDA 1EB3A 1K8YA 4I7VA 5AYYA 1HL2A 3QJAA 5F2GA 1LZOA 4MOZA 1XM3A 2NXHA 4LOCA 2ZA3A 5D2TA 3W76A 1ZAIA 2G97A 3ATZA 3R89A 3TMQA 1YTKA 4LW7A 2JKEA 4PEKA 1SU5A 3FIGA 2WO5A 2V82A 4O0ZA 1VYSX 4NJGA 4MJMA 3G0UA 2NV2A 3L5LA 5C5YA 3DFSA 4KWWA 5TBOA 4A21A 1RV8A 3CPRA 3HOJA 3SR7A 3DI0A 3W72A 3W87A 3CTLA 5KSWA 5KMYA 4JTTA 4NU7A 3U6WA 2Z2UA 3HGOA 5AHEA 1QOPA 5BMWA 3NYZA 4O10A 4YWIA 1K8XA 4M6QA 2B7PA 3AO0A 3WJWA 5I3IA 5DN1A 1G6CA 4DEFA 2A7RA 3PY2A 2E6FA 4UTHA 3G8RA 2C1HA 1GOXA 5C54A 3FFSA 3EWZA 1DQXA 2A21A 3DHFA 3PSVA 4LUIA 4IJBA 4AHOA 5I3JA 2QCMA 2QDGA 5D02A 3JRKA 1TJPA 4O54A 1GYLA 5FF0A 1GVRA 1TV8A 2CLLA 3M0ZA 2W6RA 3W71A 4O8RA 2YPIA 3W7MA 1GVSA 3H53A 1JCNA 4DBEA 4LY8A 4IPIA 1VS1A 2JKPA 3MHUA 1RZMA 1F73A 3PBYA 4DF0A 3HG5A 1XBVA 3TW7A 1VZWA 1H5YA 3E96A 4MFDA 1I4NA 4QAIA 4FHAA 2DORA 1LDCA 1HO4A 1W1ZA 4LVBA 1FCBA 2EKCA 1FCUA 3ELFA 3G22A 2J9ZA 1P1XA 1GG1A 3BG3A 5LGZA 4QJ1A 2B4GA 1H7PA 3IEBA 3ABSA 1XKYA 3KRZA 5AN7A 1SW0A 3FJLA 2ZTKA 4UTUA 2QCGA 3EXRA 5I3GA 1TPUA 4RKAA 1F5ZA 4NQ1A 4ORIA 1SFLA 1SZFA 5D33A 3KRUA 2GJLA 3GDTA 4MY1A 3R5EA 3LCHA 3G1YA 1GTHA 2QAFA 1G4SA 3JR2A 4EIVA 1RPXA 3IIOA 3UZJA 4ZVJA 2A5HA 1IIGA 4K6AA 3DU0A 2OMAA 4UTTA 3W1MA 1QOQA 3P8JA 1KLYA 3W7JA 3M41A 1FWWA 4LNYA 2Z6IA 3IIPA 3RNDA 3WK3A 4GUFA 2OCZA 4HKPA 3QEZA 4H4IA 4HN4A 5AC6A 1TPH1 4I9AA 4NX5A 1KM5A 1F05A 4EOUA 5K4XA 3W7RA 3VE9A 5CSSA 3W74A 4ZZ9A 3W85A 3W1AA 1TMHA 4MZ1A 4XWUA 1OFQA 1VHNA 4I7WA 4M7SA 1FWRA 1KTBA 1EPXA 2E5DA 2J88A 4OWGA 3P61A 4MKNA 2FFCA 3NA8A 3GXTA 4UMCA 3A21A 3A5VA 1A53A 3HO8A 3LBCA 3S1VA 3T78A 1TQJA 3PUDA 2ZZ7A 4C1KA 5K9CA 3LXCA 3NOEA 4XQ6A 3NQ6A 3NQ7A 1AMKA 1OYBA 4UXDA 1C9DA 2X2GA 1AG1O 2E6DA 1X7FA 1BEUA 3G1HA 3FA5A 3GKAA 4MUZA 1L2UA 3CLMA 1LP6A 4UFLA 1OK4A 4O17A 4AF0A 5D2WA 3TQKA 3TFXA 4FB7A 4N9DA 4CLMA 1N8FA 4XTIA 4L4MA 3N9RA 3DKJA 2CZDA 5LNWA 3B04A 5U7SA 1HG3A 2BZNA 3Q37A 1H50A 2NX9A 1EWDA 1KM3A 3LHWA 1H51A 1DQWA 1W31A 3NQAA 3A24A 4Z1AA 5D09A 3FKKA 3F4NA 2YFNA 3M6YA 3R13A 2Y7EA 3MYOA 4LS2A 4TMCA 1HUVA 3B03A 1AW2A 5FF2A 3SGZA 3UWZA 3SZ8A 1SFJA 3TK7A 3C6CA 2ZRUA 5G1TA 4JTEA 2YYTA 3W73A 3W7EA 1VCFA 4LVGA 1RR2A 4BK9A 3G1SA 4BWLA 3SECA 3G0XA 2Y6ZA 5F1VA 1QO5A 3TXVA 1FQ0A 4WJEA 3LI1A 4M5PA 1KBIA 4JICA 1TTJA 4PFMA 5U4NA 4E0CA 4FNPA 4O16A 4X2RA 4FXSA 3VE7A 3DAQA 4GUJA 3NZRA 1JUKA 1IF2A 2VEMA 4AB4A 2QJGA 2TSYA 4JYDA 2HSAA 1M7PA 3PC0A 3NQEA 1GPWA 1K7XA 5EA9A 1K8ZA 4S2BA 4GJ1A 4RZ5A 3W7OA 4CCEA 4OBTA 2DZTA 2Q8LA 4LV9A 2C13A 3PSWA 1JCJA 2Q3RA 3LHYA 2QF7A 1S5WA 1UBSA 3B05A 5D32A 4O19A 3PVFA 3GR7A 4N02A 1ZAHA 5CPMA 4NX0A 2QCDA 4HNTA 2Z0IA 4WOZA 4NJKA 4OGZA 5KITA 1QAPA 1SUXA 3HG4A 2OX1A 5CZSA 5AHLA 4JGDA 3MYPA 3P82A 4S1FA 5J5RA 1B3OA 1SSDA 3OHIA 1K7FA 2FPTA 3D0CA 4IMGA 4DELA 1W3IA 1HFBA 2YDAA 1SZGA 4LT9A 1OX4A 2FTPA 3NGJA 5CPOA 4Z08A 4HPJA 3P62A 1ICQA 5EYWA 3KVLA 1W5NA 4AEOA 4OV9A 5FF3A 3F4WA 3G1VA 5FEZA 1Q45A 2YSWA 1EUAA 2VFDA 3LLFA 3F1QA 3N2XA 1FWSA 1IXOA 1ZAJA 4N9CA 4O12A 2E1DA 1YXCA 4KFOA 1EWEA 3HGRA 3CC1A 4NNCA 4OE7A 3E49A 2WNNA 4ZL1A 1Q6LA 1Q3NA 1H62A 3W7PA 1VHCA 3G1DA 1V5XA 3G24A 1MEIA 2WPBA 2X1TA 4AF0B 4P2VA 4XZ9A 1O94A 1EA0A 3DENA 1X6UA 4FNQA 4JTLA 3A23A 5E1QA 3LRMA 2ZCGA 3LBMA 4PH6A 2CLFA 3KVJA 4FO4A 2CWNA 2VFHA 4JDBA 4XBKA 3HF3A 3AJXA 3DFQA 1OX6A 1JJKA 1EP1A 1Q6OA 5E0KA 4RZ6A 5CZJA 3FEMA 3NL5A 1PIIA 4JTSA 3PBWA 4Z1CA 3U2OA 3LHVA 1TTIA 4JY9A 3UPBA 3TXZA 5LGXA 5LSMA 2WOQA 3HB9A 3HG3A 2CZFA 1TO3A 3SFKA 4X9SA 4KKXA 4TR9A 5D37A 4ZQNA 3QMSA 1X1OA 4I7UA 2NUXA 4DF2A 5FEWA 4H6KA 2ABAA 1FBAA 3BW3A 3EWXA 3N19B 4Y96A 1FCQA 5HUPA 3M5ZA 3G8EA 4A2RA 3N2MA 5LKYA 3LRLA 2NX3A 3CB8A 2WNZA 3VCRA 3WJYA 1KTCA 4UR8A 3O8AA 3C3NA 1LRNA 3EWUA 1E51A 3TSDA 4X3ZA 3OBKA 3DFPA 2ZRYA 3A9IA 4JTJA 1G69A 1R2SA 1TRDA 3KXQA 1VC4A 3TSMA 5HMSA 3CHVA 5LNVA 2DJXA 1TPFA 4U28A 5AHNA 3T4CA 4DXVA 1MSSA 4QISA 4TO8A 3NL6A 3FKRA 2CFFA 3PUEA 1OFEA 1OJXA 4LC8A 1H7NA 3BPWA 4A29A 4MZYA 2WNQA 3W84A 8TIMA 1QPRA 3CWOX 4O13A 2QUUA 4MVAA 3WFAA 1I45A 1D3GA 1H1YA 1KM2A 3GVGA 4HPXA 2GQ9A 2C16A 3C2OA 1XUZA 1PHWA 3DBPA 3T40A 4ZQOA 2H8ZA 2X1RA 4MZ8A 2VEPA 4EWND 1XL9A 5D2XA 1W5PA 3GLCA 2ZA2A
chains in the Genus database with same CATH superfamily
4KPLA 2PGEA 4GE8A 3RM9A 3CV2A 1A5NC 3PWIA 1XFBA 3N1AA 1Y5XA 2VRKA 3AYTA 5DX7A 2QYGA 3OJGA 3GXIA 1L6YA 2X40A 5HAOA 1MW1A 1CI1A 4XX6A 3Q58A 4JTCA 1HXJA 1TQXA 2OT0A 3MCMA 4O1DA 1R6WA 2QQ6A 4R9OA 1WXYA 1BG9A 3STEA 4AXNA 4CEUC 4JNMA 1TR1A 4HA4A 2AGKA 3QV8A 1DIEA 1T8QA 4ZR8A 1A50A 1LM1A 4QIUA 5HQMA 4GYPC 4QG9A 2EPKX 1RJPA 1LBLA 1IYXA 1OF6A 1UUMA 3EX4A 1D3CA 2WKJA 1GTEA 1TIWA 4RW3A 4RXGA 1RCQA 3APTA 2VOMA 1DV7A 4AZCA 1P6BA 2UY5A 3S8HA 1AODA 1DTNA 3DIPA 1TPDA 3PJXA 1Q6FA 4TX8A 3POHA 4NZ3A 3ARZA 4JCMA 1QVBA 1OBAA 3SURA 4AMAA 1DTUA 4CQ9A 2NVAA 4QCEA 4D2JA 1NH6A 4F48A 4ADTA 4TU1A 2QJIA 3HTWA 2OKTA 3A4JA 5HWMA 3GE7A 3W1RA 3BE7A 3W25A 2A6LA 3EZ4A 4Q7IA 3UESA 3WDQA 3GH5A 4C6PA 4O1EA 1LBFA 5CG7A 1KFEA 1IWBA 1F76A 4GUHA 1XIBA 3ZLHA 4D6GA 4GI9A 2RDXA 3LCLA 1J9YA 1XBZA 5M3WA 4L7ZA 1MXGA 3RMJA 3KP0A 3LUTA 3WLJA 4JTFA 1OVDA 3TEVA 1UUQA 5T91A 4NZFA 5TAOA 2RDUA 5FJTA 1BTCA 1TPB1 1CXKA 4UOJA 3W6LA 4Y9NA 3PJUA 4Q4PA 5KZDA 3WLTA 4E2VA 5EPDA 3N9SA 5A3HA 3UPWA 4FX6M 1S2TA 3GYCA 4OQVA 1EIXA 3TONA 4ATDA 3W27A 3H2FA 2VYOA 4YLWA 3O7UA 7TIMA 3MS8A 1GJPA 4QLKA 1GEHA 1PDYA 1EJUC 3I7SA 4UR9A 2YW3A 3W0KA 2PI6A 3AXHA 2HXTA 4KMQA 4QX4A 5I2UA 4XKMA 5EBUA 3W6MA 5AZ1A 3GD6A 4FLOA 3TJXA 1M7XA 3WX7A 4H8UA 2RKXA 3AICA 4DUVA 3GNRA 3KZSA 2RHGA 2WJZA 4IMFA 1JPIA 3TC6A 2DT1A 4FALA 1UB3A 4FOUA 4YN5A 4Q6JA 3VD7A 4DWSC 1KXQA 1PTAA 1PS9A 2GVGA 3I3EA 4JZ5A 5AHIA 3GDBA 2I9EA 4CQAA 2GJPA 4N2YA 4AZCB 1US3A 4M7TA 1TYGA 1EEPA 3L4YA 4Q8NA 3W2UA 2IMRA 1YW1A 3ITOA 1F3TA 2V81A 3UNTA 4P7NA 3OVRA 2BFGA 5E9AA 3DYMA 3FXYA 1OZQA 1W56A 3A6OA 1TA3A 2E8ZA 3BW2A 3O6YX 2VGBA 3IGSA 2NVDA 3ITVA 2UY2A 2Y0FA 3GWQA 1FP9A 2CLOA 3S5ZA 3MDWA 1GT8A 1BXNA 4OZOA 4JTAA 3U9IA 3C2FA 1O5RA 1I2OA 4C6CA 1F3EA 1WAWA 5DBUA 3KCOA 5EMYA 2QDEA 1KWKA 4YCOA 3MMTA 3ZM8A 1CGXA 3E2QA 4ZQCA 4DUOA 1LOSA 2OZ0A 2FGLA 5CAHA 1L9WA 4GPNA 4ADSA 2FZDA 2C14A 4DNHA 2ZXAA 1WNOA 1KTNA 2QDHA 4C6LA 5XINA 4OOUA 3NPUA 3GG8A 3C2RA 2G8ZA 4AX7A 1W8SA 5H6HA 4AZBA 3BCDA 5AFDA 1V6XA 4LVFA 4K8HA 4IFKB 3OEXA 5LIXX 4HJFA 4QGCA 3IGUA 3LZ3A 1H5VA 1EL3A 1CLVA 3K1DA 3QH2A 4GVFA 5AYBA 2P1FA 3GU9A 2NWRA 2POZA 1Q6RA 1EJ7L 3FN9A 1ZBVA 1X8FA 3KTCA 2VCBA 4IF2A 4XG1A 3N14A 4BZYA 3BAYA 1JCLA 4GCXA 3TFCA 1KR1A 4TX9A 3VKAA 1QR7A 4PMZA 2Z1SA 5FACA 4M19A 4LAMA 3G0SA 2PP3A 3AHXA 2ANUA 1E9ZB 2BNJA 4QDMA 3UXKA 4AG0A 1QI2A 1RUSA 4OBSA 2DSVA 3AC0A 4R7OA 1NARA 1XG3A 3FLUA 3R25A 3UZWA 4OUIA 2O4QA 2CLMA 3NO3A 4WX2A 5LNUA 4LS0A 4KFNA 3CEPA 1Y5VA 5LHEA 1TZ7A 1W3NA 3E12A 3N3MA 2XVKA 4M29A 4LRSA 1E6ZA 4IMCA 3CZLA 4HNNA 2W91A 4L6DA 1DORA 1VJZA 3M9YA 3VM7A 4D8LA 1VF8A 4C6OA 3PN8A 4WJXA 2FJKA 3ANUA 4NAFA 1CIUA 1NP0A 1VKFA 1J10A 2X30A 3KOWA 4HSOA 4YJ5A 5IBXA 4I5XA 2GQ8A 1GVYA 2PDCA 4GC3A 4I5RA 2IPGA 4MMWA 1PTGA 1UKSA 2VR4A 3TIMA 2CERA 4YTTA 4YTSA 2DVUA 2GGIA 4D8ZA 3USBA 3LERA 1YMYA 3PHAA 4DVOA 1G01A 1MW2A 4B5VA 1FWNA 2PDJA 2XISA 5AYIA 4I8YA 1WPCA 3PTDA 3T4WA 2DW6A 2E4TA 2HZGA 4FIRA 3FYPA 4DPPA 3PFMA 5BXSA 2XSXA 1VLIA 4OT7A 3WLPA 1ZSXA 4CNNA 3TCEA 4LYKA 1O5XA 1W1B1 3QR3A 3UG4A 5KZEA 4KCUA 3BO9A 4IFRA 4WVXA 4NZJA 3H70A 3ALFA 4FNRA 2VGGA 4GQGA 2VC9A 4ZB2A 3WH8A 3NWRA 4LSBA 1UROA 4H9UA 4GABA 2Y61A 4IXHA 4Z0SA 2A1YA 4XBJA 4GYJA 3EDFA 3W7CA 5JUVA 4IL2A 2YA0A 3MUIA 1PBGA 3G2GA 4AYGA 2XIMA 4ML9A 4QLJA 3MUAA 3W6YA 2QJHA 2J9XA 2O56A 1Z48A 3AZRA 3LBOA 3CUXA 1W5OA 2XIOA 1RPKA 2OVLA 3WQCA 3CPGA 3FV9A 4QRNA 1S39A 3UZXA 3LQLA 4GGBA 3VDHA 1KM1A 4XBSA 3TKFA 3ABQA 1E0VA 7PTDA 2XHYA 3M44A 3KOFA 3VTRA 1RH9A 2WVUA 2VR2A 3PG8A 1FP8A 1MNZA 1O7AA 2OOGA 4K39A 1KM6A 1OY0A 3ARPA 1AMYA 1U1HA 3TYAA 2DGAA 4FMVA 4ATWA 1JDFA 3E02A 2A85A 4WSKA 4PRWA 3MBDA 1U5JA 3T42A 4OU1A 3C8NA 1Q6DA 1L8NA 3P5YA 5HR6A 3CH0A 3CWNA 3H2NA 1J6OA 2QCFA 1JR1A 4MPKA 3SJ3A 3EPOA 1GWJA 1AUSL 3B97A 4B92A 4JIRA 1P5BA 2YA2A 5A8PA 3GR8A 3SUVA 2ZC1A 1E0UA 3REQB 3HMCA 1TREA 2I14A 1I8JA 1TUFA 1T0OA 3GHSA 1HJWA 2XTKA 1B3VA 2FZNA 2OX4A 3AZTA 1NU5A 2QT3A 2JIEA 1S2WA 3LTSA 4Y9OA 1G5AA 4XTDA 3JS3A 4OV4A 1B57A 3GNNA 1B3YA 4TUFA 3GX9A 1NF7A 3UXDA 1MQQA 1Z44A 1DOSA 1L6SA 3POCA 4R3UA 4IIDA 2VX7A 4H6EA 4NXSA 2DT3A 1SSGA 3PJWA 2AL1A 2CBUA 1IXQA 1DIOA 1CXEA 1E6RA 1MXDA 3GW3A 1JGIA 1OFDA 2J79A 2QJJA 3P84A 1SYTA 4EF9A 5BOOA 3QBUA 1JZ7A 1KLZA 4DYEA 2I57A 2R1KA 3C2EA 4D1IA 1JYVA 3SCUA 1FDYA 2WC3A 3QTPA 2PDFA 1ZBWA 1ECEA 4WK9A 1C8XA 1NTHA 5LXXA 3I6RA 5HATA 1OZMA 1QHOA 5G1YA 3M0JA 3N25A 3TTSA 1FTXA 3GH4A 4TVCA 3ZS4A 4CNPA 2ZRXA 1IT7A 2HK0A 3R12A 1V3IA 2VRJA 1X6NA 3WUGA 2FHBA 4A8LA 4W5ZA 4BF7A 4DQWA 2Q02A 4K36A 4Q4SA 3FVMA 4PMJA 3VDBA 3L4UA 5FSEC 3MWAA 1US2A 3BMVA 2DZSA 4O11A 1RP9A 3CL7A 1KM0A 1JFHA 4HJWA 2WXDM 2QUVA 1TTQA 1Z41A 2ESCA 3M0MA 1W5QA 4HMNA 4PYSA 4L6HA 1V02E 5CPSA 1Q5MA 3NFUA 5XIAA 1VR6A 1W37A 3QW3A 2IPWA 2ZRZA 5E93A 1BF6A 1QHZA 1R38A 4IQLA 5DO8A 4HK5A 4ROPA 3I7RA 2QCNA 1ZS2A 1GKPA 2OT1A 1W54A 3ANVA 3CAWA 2QPXA 4QG8A 1KB3A 4LUJA 1W9BM 1QFEA 3CIWA 3BLFA 4P7LA 3MW7A 2YX0A 3UWQA 1PE1A 3HV8A 4ERAA 1GQLA 3KM8A 1GK8A 1KR0A 3URNA 5L6UA 4HB7A 5BRPA 4JQAA 3TLQA 2DSUA 3RGTA 9XIMA 3W2NA 3HPFA 2BG5A 3S2NA 2YCIX 1G7UA 3ZR6A 3VDAA 1QPOA 5G1MA 4Z2GA 2REQA 1YPFA 3NO5A 4GVGA 1RBLA 2PS2A 2FIQA 2PE4A 5G4EA 4WKHA 2DZUA 3VOJA 1Q4NX 3GNDA 2AQWA 3VZYA 3WLOA 2GUUA 3LPPA 1D7FA 2YDQA 1KKOA 1TE1A 1IEVA 1F07A 1WDPA 2RDWA 4PTXA 4NL1A 1A0CA 3RFAA 4ACZA 1TRIA 1OD8A 4DN1A 2PD5A 4HT3A 2DQXA 1PTDA 1TV2A 4G7FA 3WNNA 4AWEA 3EKGA 2ISSA 1WQ5A 3SRFA 3OIXA 4JTHA 3PZQA 3O06A 1OGBA 3P67A 4YPJA 1GG0A 4E6MA 1FWBC 2PDPA 2PRMA 2PTWA 2FVLA 2PC4A 3L0GA 4DAFA 2WMGA 1WDWA 2ZZ6A 2WZHA 2DU2A 3S0CA 1ZP4A 1BSLA 1KFBA 3LU2A 1HX0A 4DJFD 2INZA 3EDKA 2CHRA 2RGLA 4G1NA 3ZSTA 4WDTA 3G1XA 3SJNA 3OVQA 3OG2A 2R94A 2FDMA 1T99A 3G5EA 1TV7A 4O50A 5M2FX 2JK2A 3NDYA 1EBGA 3QLDA 3VD4A 1Z6KA 3WH5A 2DFAA 5D30A 1TVLA 1XLLA 4IQEA 2XFWA 1RCXB 3WLQA 4IICA 3KTSA 2ZQ0A 2HXUA 1UP2A 5CKSA 2UV8G 1RJRA 1UR0A 4HIBA 3RR4A 1NWTA 1FWEC 2OYLA 3ITLA 3O0FA 3DFTA 3CQ0A 3FJ4A 3RAOA 4KRUA 1HL8A 4ACYA 4DBSA 3BCFA 3LYEA 4MDPA 3QSTA 3N4AA 5ABGA 3GC4A 5JH1A 1C29A 4J3SA 4JCLA 4TVDA 2O55A 4Q32A 4A22A 2X0YA 1UH2A 1Q6QA 1XF0A 3A4XA 5F4WA 3LY0A 1RSCA 2ZZ2A 4O4WA 2BHYA 2YLLA 3QMTA 4Q4KA 3WQVA 4LC6A 4WSJA 5KINA 2WW5A 1HKWA 4AD0A 4CNOA 2X09A 6ENLA 5CC6A 1FFRA 2WJFA 4DBWA 2CXGA 1AQMA 4FNUA 2A79A 4Q7NA 1UD4A 1LYXA 3AXKA 2FTWA 4UQAA 1IHIA 4QROA 4BY3A 4JS3A 4M82A 6CGTA 2HE5A 4ACZB 4B5NA 3V0SA 2ZWYA 2G50A 3VK5A 4J4KA 1A3XA 3RLHA 1M6JA 2DZVA 1KBJA 1W2PA 2V3GA 3TN5A 5CSYA 5AC8A 2IKGA 2AMGA 1KFCA 2NT0A 2A7PA 3B8TA 3W2KA 1QNVA 1KRAC 3UVAA 1M9HA 3EOSA 1AJ2A 2DVTA 2WMJA 3HGJA 4MLRA 1WDSA 3BLLA 3OGVA 5DELA 3PZMA 3VCNA 1BPLB 4V15A 3L0KA 1UP3A 4YMZA 4PCNA 4GFIA 1PKNA 3RHGA 2V3DA 4GNKB 2ZZ4A 2WCSA 1JRBA 4DO5A 3BGAA 3WF2A 3LXAA 1VFHA 4S2CA 1UWTA 2EAWA 2ZE0A 2D69A 1FDJA 5A2CA 1HKJA 4F8XA 3DI1A 5T26A 1OYAA 3BGJA 3S5OA 1LJYA 1WZKA 1GVOA 3BVJA 4CQBA 1ADSA 3NEHA 2PBOA 4L4PA 5FF7A 1ITQA 3FJ6A 4A35A 1GW9A 5CZ0A 3NQGA 2BOGX 3QRHA 3EMQA 3VNZA 3IJIA 4HCHA 1DVJA 2DUAA 4IGSA 2BVWA 1PKMA 3LDVA 1VYPX 1JF5A 1OHLA 2J66A 1A5BA 4C6JA 1MZHA 3EDJA 3LI0A 1FHUA 3EOEA 4QE4A 5G5IA 1R7OA 4AD1A 5L9FA 1A5UA 4GIAA 4RDZA 2OU4A 2ZZ1A 3H23A 3HMJG 5AOUA 2V6AA 3L4TA 1XLJA 4JIEA 3BOFA 4MHBA 1LUCA 2Q3OA 3C0JA 3EKZA 3OLDA 1X1ZA 3T05A 4Z2IA 4MAZA 3IS4A 3MP4A 2GOKA 4DBDA 2VEKA 3NYDA 1SZRA 4K8GA 2VQUA 3WJXA 3TJLA 3DKLA 2D2HA 3SQSA 1VYRA 1DEDA 4UUIA 4CQDA 2AAAA 2C19A 1JDAA 2ZRWA 3SIMA 4YVPA 2XGIA 4LNCA 1EJXC 1X39A 2YXOA 1FH7A 3L4VA 1R47A 4JTUA 5A6SA 3RPTA 1W9DM 3TMLA 1P43A 1VBUA 4GQ0A 5HWJA 3TC3A 3QHNA 2PGRA 5EFDA 2NV1A 4O28A 3RUBL 2XIBA 4DJDD 2P3ZA 1ZL1A 1G4PA 3GRIA 5CJNA 3KZPA 3DDMA 1J0KA 3EMCA 4LBSA 1EB3A 4FAMA 2ICSA 2Y1HA 2Q8XA 4A3HA 1XW8A 4QTGA 4GI4A 4DY1A 3FDGA 3WQDA 4E4PA 1R3SA 5LIKX 1RBOB 3WL1A 1EC7A 3ECQA 4LEFA 3PK7A 3TMQA 1YTKA 2O9OA 4KWOA 3FIGA 2I7GA 1K1DA 2V82A 3SO7A 1DWJM 2FHFA 2PDQA 3SN4A 1TVNA 5TBOA 3TP4A 4RNFA 2QUNA 1RV8A 2UZ9A 3CPRA 4E4FA 3WY1A 2OELA 4YS1A 3U6WA 2WHJA 2Z2UA 3W37A 4EXQA 5BMWA 4O8AA 3SCPA 3WJWA 1G6CA 4DEFA 3Q65A 4GI8A 3EWZA 4QE5A 1CB2A 1UMYA 4AHOA 5I3JA 4PUEA 3T07A 2VZSA 1JI2A 3IARA 3M0ZA 2IPJA 4O8RA 2JE8A 3K13A 3UR5A 3VGEA 4HK7A 4DBEA 3BTNA 6XIAA 3MHUA 1RZMA 4I9JA 4WJ8A 1J0JA 2Y8KA 1UD3A 1V08A 5I6SA 2RUSA 1GUVA 2OPJA 2Z4GA 2BXYA 3MY9A 3IWPA 1H5YA 1XSJA 4QAIA 2VZUA 5BU6A 1LDCA 4LVBA 1DE5A 1QU4A 3WLRA 1FCBA 1LUCB 1P1XA 2PC8A 3WDPP 5C2CA 3BZGA 1SM9A 1FVPA 4I6KA 1XKYA 2YL6A 3M0VA 1H49A 1F5ZA 4AZHA 4ORIA 1UWQA 3I10A 3HZ3A 1FRBA 3TTYA 3UR7A 1XICA 3WZ0E 4MY1A 1BVNP 2QAFA 1ECQA 5KETA 4EIVA 4J2MA 1F61A 4D6DA 5DRCA 3IIOA 1QATA 4UQCA 1IIGA 3W53A 2OMAA 1QOQA 3W7JA 4HPGA 1FWWA 4LNYA 1EYEA 3IIPA 4GUFA 1HKVA 2OCZA 1N8WA 2XFYA 3GU1A 3F5LA 4HN4A 5BWAA 3B9AA 1KM5A 3LD5A 4M56A 5CSSA 3W74A 3BJFA 3AMGA 3SN0A 4MZ1A 1MQPA 4MWAB 1EDTA 2Z2BA 1VHNA 4M7SA 2YJQA 5JBDA 1FWRA 4L9YA 2J88A 2E5DA 4H7VA 3ID7A 4UMCA 3A21A 3A5VA 3UGVA 1TQJA 4XQ6A 4TX6A 2X2GA 4C5YA 1EEXA 1X7FA 5HDRA 2PZ0A 1BEUA 1HJSA 3G1HA 1G94A 1A49A 3FA5A 4F0MA 1LP6A 4O17A 1Y5WA 3ARTA 4J3VA 4XVDA 3TQKA 1EQCA 1EKOA 4FB7A 2F38A 2CEQA 2WWDA 3VOGA 2QF8A 3VNIA 4GJJA 3N9RA 3DKJA 3B04A 4GGHA 5U7SA 2GJXA 1HG3A 1UWIA 1J0YA 1H50A 2W61A 2ZC8A 4KF1A 1DQWA 1W31A 2VWTA 3NQAA 4HYRA 3WQ4A 1QNQA 1XIDA 3FKKA 3F4NA 3TWBA 4IM4A 1K4HA 4IJRA 4CU8A 1HUVA 1AH4A 1AW2A 1A0EA 1V3KA 3SGZA 4V1YA 3SZ8A 1EGVA 4XZLX 2QMJA 3VDGA 3TK7A 3CUFA 4ZFMA 3PFRA 4P8VA 1XRFA 1XRSA 4BWLA 4OKDA 3SECA 3N6HA 3HQNA 3QVQA 1YX1A 1TELA 2BGNE 1BYCA 2VVNA 1TVPA 3LI1A 1AH0A 4M5PA 1SMAA 1W8GA 4NKCA 3VE7A 4AIOA 4GUJA 1E3XA 1IF2A 5I7GA 2VEMA 4JYDA 2HSAA 4UWMA 3PC0A 4JQ4A 2FJUB 1R86A 1K7XA 2IXUA 2Q71A 4WF7A 3QY8A 4FR6A 4U31A 2DZTA 2Q8LA 1UPPA 1UWRA 2YCLA 5FJJA 3VCCA 2QF7A 1W9PA 1S5WA 1UBSA 1W3JA 3L12A 3OLGA 2O4MA 4V27A 3GR7A 1PX3A 2Z0IA 3LN3A 4OGZA 3M7SA 2OX1A 3FSTA 3PZIA 1UP0A 1YNYA 1E6QM 2PU1A 2PTXA 4IMGA 1HFBA 2OWWA 4LT9A 2YDRA 4CN1A 3MTWA 3NGJA 1ICQA 1EJTC 2HE8A 3N4FA 4AEOA 4OV9A 5FF3A 3EGJA 2VFDA 4ENLA 3N2XA 3ARYA 3CUIA 1ZAJA 4N9CA 4O12A 2QV4A 3CMFA 5FAGA 3CC1A 2WNNA 1CEOA 5C9RA 2XZ9A 1MI3A 3WF1A 1V5XA 1V03A 1T6MA 3THUA 2QJNA 3RJYA 3DENA 3A23A 4A3YA 4WGHA 1RALA 2OWCA 1CGUA 4FO4A 4JDBA 3CL6A 1FWAC 1K9EA 2HWGA 1EP1A 5E0KA 4L9XA 3TYCA 5CZJA 3PBWA 2Z1WA 3U2OA 3RYSA 3LHVA 1TTIA 3VIJA 5LGXA 2NQLA 4IGNA 1TO3A 3DX5A 3SUUA 4S23A 3CXOA 3SFKA 4X9SA 2OEJA 4ZQNA 4DF2A 5FEWA 2ABAA 2WMHA 4ATLA 4H9MA 3WG6A 3VMNA 3EWXA 1K70A 2DUZA 4PFHA 3M5ZA 3G8EA 4A2RA 5LKYA 1ISXA 4QSFA 1CNVA 4CD6A 2INFA 3AYSA 1KTCA 1IQ8A 1NFPA 4W8AA 1EHAA 2ZX8A 1XLAA 1EJRC 3TSDA 3F5KA 3T9PA 2ZRYA 4X0VA 2PDLA 1VC4A 2DJXA 4HTBA 4A8IA 5AHNA 2OZTA 3T4CA 3CO8A 1MSSA 3NOYA 3FKRA 3WENA 3PUEA 3NCOA 3CQJA 4JKMA 1P0DA 3RLGA 2YCLB 3WLHA 2WNQA 4HP5A 3U5YA 4MADA 4US5D 4EWJA 3C2OA 2PD9A 1PHWA 4ZQOA 3AISA 4MZ8A 4KQNA 1XL9A 3N2CA 4W8BA 4EK7A 3N04A 3O6DA 3S47A 4NZ1A 4PCFA 3PULA 2VO5A 2EPHA 4FA3A 3OVPA 3VPLA 3TTEA 2YXGA 1RVGA 1FXPA 1MO0A 6TAAA 5DQPA 1GGOA 4Z1BA 2XN1A 3ITCA 4JEQA 3LS9A 5FA5A 1UUOA 4UNLA 3VNKA 3SCOA 4F4RA 1BQCA 1V93A 2PDHA 4HZ7A 3WF4A 3D47A 1V3HA 9RUBA 4PTVA 3QC3A 4JIHA 3LMZA 4UFMA 1ESWA 3LGEA 3MHGA 3KBSA 2KZHA 4MIMA 1O4UA 1GJWA 1E4IA 3DFYA 1TTPA 3DN5A 2WSRA 3VXGA 3W4RA 1R3TA 2XYLA 2HS6A 3W88A 1X7IA 3UD6A 3W3OA 4AHQA 5I78A 4HMDA 4A3UA 1PB0A 5H2ZA 3UA4A 4GXMA 3VFCA 3W7LA 2C91A 1EHNA 2BVYA 1F9CA 1SVDA 1DWAM 3PNUA 5CJMA 3OP2A 4MB5A 4Q8TA 4IIHA 3SIZA 4Q4OA 1XFCA 3W7QA 1NDWA 2ZX9A 3GQYA 5K9XA 3W83A 2DT2A 3E1F1 1V4YA 2TAAA 4FOKA 1S38A 1OCNA 2J62A 1JQXA 4KT2A 1N82A 2P10A 4EPDC 1U1UA 2G3JA 1CLKA 1XDMA 3LHZA 3PR2A 3UXAA 2E6YA 4K8EA 3QGKC 4L1XA 4M80A 1VPYA 4H04A 4DO4A 1AFSA 1AQFA 3AIEA 3ZOAA 1QNOA 3NQMA 2PMQA 3H2CA 3W1PA 1V79A 4OECA 4LFYA 1O68A 1VPQA 4KEUA 2C15A 4WQ6A 3F7JA 1DJQA 5BZAA 3RCNA 1UKPA 2GWNA 4PMRA 1M03A 1BRLA 1ONWA 9CGTA 3XINA 1K9DA 3DGBA 3W28A 5IFPA 2HK1A 2NXGA 4XZWA 5KEZA 1S1RA 4LTSA 3EXTA 4GNJA 1VRXA 3BLDA 4PE8A 1H7XA 2PWEA 1VQTA 1H4PA 3CHDA 3S46A 3L67A 3FGCA 3BOXA 2E6AA 1Z9AA 3AWOA 1XCXA 2AOSA 2F9RA 2IKIA 3BW4A 4YTQA 3LOTA 1D8CA 1DJXA 4YCPA 5D8ZA 4PC8A 4HHPA 1NOFA 4O0QA 4D6EA 1NQ6A 1WOAA 2ACQA 1ITUA 3K2GA 4CNSA 1TV3A 4AW7A 2X7VA 3GBEA 1UZHA 4LQ1A 3LMYA 1R0MA 1R8LA 4IP5A 3WDJA 1VGAA 2CCRA 1R3YA 3ERPA 4IMEA 1KFWA 4QJ5B 1EH9A 1XLIA 2D20A 1RK6A 3ZR5A 1BLIA 4MGGA 3HG2A 3H2OA 1EDGA 2ZZ5A 1EIBA 5T9BG 1YDOA 4FX8A 1V6TA 4GX9A 4BR1A 3WK2A 3LV6A 3VI2A 4Y8EA 2GOUA 5G2WA 5D04C 1W3LA 1R9YA 3W2LA 3S1GA 1XISA 2OJPA 4JKLA 4ML4A 1IEWA 2DUXA 2HS8A 5CLTA 3L0NA 3ZMRA 2ZICA 1Y8BA 4AD5A 2ODOA 4RJEA 1SMDA 1RCOB 3PWGA 1OWQA 3V4BA 2PWGA 4AYSA 4RCXA 5BXRA 1WXZA 4UNIA 4A2SA 1IEXA 1UA7A 3ZSSA 3U48A 1Q2SA 1LOLA 1XLGA 3LCWA 4MM1A 2E25A 1NJJA 3T6CA 2H90A 2GL5A 5D38A 4UOQA 1U30A 4HN8A 2FH6A 1E0XA 2B7QA 3CV7A 2A3EA 3CIXA 4BQ5A 4PTMA 2B0MA 4EACA 1NFBA 2W63A 4UCGA 2ISWA 1BRLB 6XIMA 2YBVA 3NO1A 2BVTA 2VXNA 4N6EA 5HQEA 3EXSA 1JFXA 4H6QA 1GOIA 3KLLA 3SCTA 2GUYA 3BICA 4QM1A 3FYOA 1ME9A 5I3HA 5BOEA 2JKAA 1O95A 3R1ZA 1HW6A 4L1WA 3Q2DA 1P7TB 1GEQA 1Q6GA 1KCKA 4L80A 1KA9F 2VJXA 1MDRA 1AA1B 3MA8A 3F4CA 1H60A 2V8ZA 4EKJA 3OQ8A 2C3ZA 1JYNA 3UXIA 3LEPA 1REQA 2J7DA 4O18A 1S2UA 3HURA 4JYEA 1C93A 1EGMA 2OXNA 3MHFA 3PTKA 4O52A 1KFLA 1QT1A 2ISVA 1TG7A 2NZLA 4DHGA 3QLLA 4PUKA 3TW9A 3LZ5A 4K1GA 3WQ8A 3RX4A 3O63A 4WDXA 1TPEA 2A0NA 1XYMA 3A4WA 4POCA 1U5VA 2DZBA 4W7WA 2GSEA 2Z1BA 2NQ5A 3ISIX 1QW7A 4GZJA 5FF4A 2OO6A 5SWUA 3M47A 5C6MA 1TCDA 2ZVIA 3K5XA 2R9RA 4IUOA 2JEQA 3QKEA 4H3DA 3EOUA 5TNVA 2MANA 3E2SA 1BVWA 3L2IA 1FXQA 2WHKA 3UZZA 5DANA 3M7WA 2ZIDA 4WUIA 3IJQA 1LBMA 3W1LA 2JGYA 3PZVA 3PTMA 1KQYA 3CMJA 4O53A 4N4PA 4D8AA 2ISFA 5HQLA 4HK6A 5TIMA 4DI9A 1OB0A 2YZ5A 1VFLA 2YZRA 3N13A 1WUFA 3A4AA 2ZBTA 7TAAA 5A8NA 8CGTA 1EF3A 1NWRA 3M07A 2R1LA 3GG7A 4GWEA 3UG5A 1E6PA 4LVDA 4F9DA 5I02A 3GTNA 1XINA 2NWSA 3IK4A 4J1OA 4GQBA 1F6KA 4CQ8A 1A5CA 3C0QA 4LBUA 4W7UA 4YXGA 4JR5A 5DXYA 1YXDA 3L68A 3H12A 2AGTA 1YNPA 1B4EA 2ONEA 4ZO8A 1GVEA 1PXGA 3RIKA 4IIEA 1UD8A 2G5WA 1ZJIA 5F4SA 1T8XA 4AC7C 3TYUA 4D6FA 5I06A 4NAEB 3IVSA 1IGWA 2VURA 2E09A 1OFPA 3STPA 1GYNA 5CG0A 4HD5A 2O92A 5EMUA 1ZCCA 2WQPA 4IX0A 5REQA 3QOMA 3NL2A 2Q01A 4DF1A 4EE9A 1VLWA 3OQEA 1HGWA 4ICNA 1Q13A 5CC3A 1ZJBA 1XYAA 2ON3A 4HNUA 1U22A 3PAJA 1JCTA 3RLVA 3BSMA 3WDRA 1CCWB 2OR2A 3FXGA 5HK4A 3IJLA 1REQB 1J2WA 3E5PA 3AJ7A 3L65A 4BI5A 3P0WA 1K4GA 4O1CA 3HQOA 2QCDB 2E8YA 3HPAA 3TYDA 4NJIA 1FWFC 2CITA 2ZUMA 4H8VA 4M6UA 2P8CA 3MKCA 4NSBA 5I07A 4A6GA 3I3BA 3R0UA 1QHPA 1YE6A 1M1BA 1XC4A 2WHMA 3KBVA 3L23A 3VD5A 1CZ1A 2C8NA 4KWUA 2EPLX 4EPEC 3U4AA 2ZUTA 3V5FA 5F2MA 3KRBA 2X41A 4L5ZA 1PCWA 3LNMA 2W67A 2TMDA 3VC5A 4OUEA 3G3MA 3WDIA 3GAKA 4PMXA 1A3HA 2A4AA 3WBXA 1UC4A 1E4LA 1TSIA 3WQ6A 1H11A 3P8IA 4GACA 3IAPA 2BP1A 3KUMA 5KTLA 4FLQA 2WSPA 5DLCA 4Q7BA 1VEOA 4DJFA 3LXBA 2QAPA 3P6LA 1DYSA 1VBRA 5CPTA 4E2BA 1LQ0A 3EBVA 4AISA 4HYWA 2YFOA 2OGJA 4J2PA 1VEMA 3SCVA 3T1GA 1SJDA 4K7VA 3VZXA 2ZRVA 2V5KA 2J8TA 4GXPA 4ZOBA 1PZ2A 2GQAA 4TTUA 3TW6A 2IKHA 3W7IA 3ARQA 1SR9A 2E77A 3UT0A 2WCGA 4UTWC 1TPWA 4GO9A 4WZHA 1SZEA 2WVVA 4XUGA 4HYVA 3EWYA 1BWKA 4S38A 3AOFA 5AC4A 1J5TA 4IUGA 3TROA 5BRBA 1L6GA 5IBXC 2IXVA 2MUCA 4K2SA 1JVNA 4AVOA 3QPYA 5A6TC 3OLIA 1KV5A 3PF3A 4O1AA 1Y7VA 5REQB 5DMYA 2H3DA 4KCVA 3AHVA 4QQ3A 4NHVA 4JYFA 2J78A 2UY4A 3EA2A 2P50A 1HVQA 1OX5A 2TYSA 3VGGA 4EVZA 3W23A 3DXIA 5ECUA 3CTTA 3BSHA 4B4FA 2D22A 2R1NA 4PN2A 3R0KA 1XKJA 3JZEA 4DWSB 5D9NA 1SJAA 3PPGA 4IPJA 1UHVA 2Y7DA 4QDPA 1I6NA 2RJGA 4J27A 4DZAA 3C61A 1QO2A 1NDZA 4ZQRA 4MJ4A 1R3RA 3CWHA 3FCPA 3L9CA 5AY7A 3QPZA 4JDYA 5D9PA 3TSBA 1E9YB 3GAYA 1XH0A 4W89A 2I5IA 4ZCWA 4NG3A 4X2PA 5BU9A 4NVTA 3BAXA 3G1FA 1ZHAA 4U10A 1R2TA 5EMKA 3I4KA 1ZRQA 4UMBA 1Q8JA 3VKBA 1EZWA 4NJHA 1QTWA 2VDGA 3F2DA 5HNNA 3ES8A 2TRSA 2PODA 1PHQA 3BK0A 4XAYA 3KS5A 4RE4A 4D6IA 4BQ2A 2W9MA 5CPLA 3OA3A 4HBKA 3E0IA 5C2XA 4GNVA 4U5IA 3E38A 2CC0A 2VX4A 4HHMA 3AU6A 1M7JA 3NZ1A 1WA3A 1E1CA 3MUCA 4TMBA 3LCXA 3QY6A 1QCWA 5HJXA 3MO4A 4Q8MA 1KV8A 6REQA 4H9ZA 1TUXA 5BCAA 3R10A 2PFHA 3UXLA 3VAVA 3TOYA 2PA6A 1MRQA 1KFKA 2VEFA 5CSUA 3ZT5A 4R5EA 3S5SA 2XVGA 3R0DA 3VX1A 5I77A 3TNOA 1QW8A 5HJYA 3VNMA 2XZ7A 2WVVB 3KAOA 1UCWA 5ABHA 4LUYA 4ZSUA 2CWXA 3W2MA 3TUUA 4YYCA 4AVFA 4TIMA 4MKSA 1PV8A 1XH1A 4QJ3B 4KCWA 5EFFA 3TC7A 1MRAA 2JBMA 1V3MA 3RR1A 1KD0A 3QSRA 5CZKA 2XFFA 2NLYA 1ZLPA 4ZEPA 4C90A 1WKYA 1LROA 3U5UA 4B3ZA 4PB5A 3MP3A 5MHBA 4DZ5A 2PF8A 1G67A 3T7VA 4LRTA 4D6JA 1FFQA 1KNWA 4GUGA 3RRXA 5CSRA 5FJOA 4LGXA 3R8RA 1XH2A 2F61A 4H7CA 2DSKA 3CMGA 4LXFA 4EXBA 1PZ3A 5H8PA 1GQNA 4PRTA 4LANA 2BODX 1EP2A 5AZ0A 2ATSA 2ZX7A 3ZWSA 1E1FA 4PB4A 4EP8C 4GI6A 3JW7A 5BW6A 5DF0A 2V0TA 2G96A 1Z69A 2ABBA 4DJDA 3VD3A 4J3WA 4B2DD 4MWAD 3GXPA 2P0OA 2EG6A 4ONVA 5RUBA 2VGFA 5HULA 2G4JA 3GTXA 4GZEA 4HU0A 3UW6A 3LM3A 3AYRA 2YL8A 4DX3A 1WKDA 4HTYA 5LA0A 1FHDA 4GFSA 3R94A 4OHQA 4ZSTA 4K38A 1V6WA 2R1MA 4JN8A 4NNBA 1S5VA 1XYBA 4C1NB 4B3KA 2QR6A 3MQTA 2FFIA 3ARXA 4XVEA 4FZIA 1JNEA 3ZT7A 4WIWA 4RNJA 4LCRA 2ALDA 2YCEA 3EWWA 1FWDC 2CYGA 3TVAA 3B9EA 2WMFA 2PU0A 1NDVA 3NM1A 4KW2A 4JQ2A 1I2PA 1TWDA 2ZZ3A 3GHUA 2Y8VA 1E40A 4NT0A 4CQCA 3AS2A 1VFOA 1OFOA 5H8MA 1CENA 3TOPA 2Y7GA 4XSMA 3LCFA 1JCYA 3KOZA 1C91A 3RITA 1C8QA 2A3HA 2ATMA 1QI4A 1FWCC 1E4MM 1KRCC 4DO6A 3VIHA 3W86A 4Y9AA 3OTRA 2XGZA 4XZIA 5G2HA 5M03A 3AXXA 3SCWA 2POTA 1MXSA 5LXEA 3TE9A 3O1NA 3M43A 4F66A 1W3HA 4H01A 5TF0A 3BQ5A 4MNLA 3GDLA 3V1HA 3AS1A 3D5HA 4ZXLA 1TZZA 3WD2A 5F7UA 1OC5A 3TAKA 1KCXA 3NSXA 2OG9A 4GKTA 2YGYA 4I3GA 3W26A 3S1XA 4E2OA 4V2XA 2P5NA 1A3WA 1LG2A 1JD7A 3GYEA 1R2RA 3WJZA 4R34A 1JAEA 1ENUA 3W07A 4CUCA 3UWEA 2Y70A 3RO6A 3BAWA 4C1LA 1EBHA 3WQ5A 1LCOA 4KS0A 5KZMA 3CZGA 4FLRA 3BOLA 3U0HA 1JAKA 4ZENA 2HV5A 3GVVA 4GBUA 4BI6A 3NEVA 1JZ4A 1WB0A 4LEQA 4JN7A 5CJ5A 3DYPA 3HPSA 4UQDA 1DQUA 3CYVA 5E5CA 2YL5A 1E43A 3CLWA 4R85A 1L6FA 2J25A 2V2HA 4PODA 2X05A 2AKMA 3N73A 3ZFHA 3R8GA 2FPYA 3G1AA 2OQLA 4LU0A 5FEXA 4EPKA 3R11A 2RDTA 2DZWA 1W1TA 5A1AA 1XDLA 3KWXA 3MU7A 2PWHA 3OGSA 5IRPA 1S3TC 3QV7A 4HHLA 1EDQA 1ONEA 4S3CA 4X9YA 3PPFA 3CH9A 4AIEA 3PZOA 1V7AA 1F7BA 3ZVHA 3SM0A 3THCA 5D2YA 1Z89A 2EG8A 2W62A 2Z00A 3LGDA 5HMFA 3PJTA 2PDXA 2ZVRA 5ENLA 1TJ0A 1DL3A 3H2MA 2JALA 5A8GA 5GJPA 3B8UA 1E0WA 4JPGA 3NURA 2VENA 3B40A 3TLLA 4GC4A 5I03A 2FMOA 4DUWA 5FJUA 5DCEA 2BLEA 2EJAA 1UD5A 3BWWA 4NYUA 4P5UA 1DWFM 3NL3A 3OPSA 3BG9A 3RILA 3WD1A 1ZBKA 3CZKA 2YA1A 2Y62A 1ZY9A 1JYWA 2X42A 2ZUNA 1JDDA 2WHLA 3G3DA 3VGDA 3QR0A 4MKVA 2W27A 3UNDA 4ALDA 2J7CA 2ZUVA 1K8YA 1XQLA 4I7VA 2PP1A 3H22A 1HL2A 3QJAA 4MB3A 5AYYA 1LZOA 5F2GA 2AL2B 4MOZA 4H8NA 2NXHA 2I9UA 3T2QA 2ZA3A 4GY0A 2PAJA 4PTWA 1ZAIA 1DJZA 3QN3A 1W2VA 4HZ6A 4IPNB 2GFTA 5C7HA 1WE5A 2ZX6A 5LIYX 2BGSA 2VWSA 4IMAA 4O0ZA 1VYSX 4NJGA 4RPPA 1UH3A 1FH8A 3DFSA 1E70M 3CAVA 4KWWA 4NYYA 1ZBCA 3F5JA 3GVWA 2YB4A 3WKZA 2INEA 4W7VA 4R88A 4NU7A 3QPEA 3NYZA 4YWIA 2B7PA 3AO0A 4A8RA 3ONBA 3BC9A 4PSRA 4B5UA 1F4AA 1WDDA 2V68A 4GO8A 1VBHA 3OHMB 4LB4A 5EB8A 2E6FA 3M0HA 3VIKA 4JAWA 2C1HA 4IP7A 5C54A 2WM1A 2A21A 3PSVA 4IJBA 2QCMA 2DH3A 1WCGA 1OT2A 5D02A 1KGUA 3JRKA 1TJPA 3CHFA 1GZ1A 4KERA 2W6RA 4L9ZA 1HJXA 3AUJA 1GVSA 3H53A 1JCNA 4IPIA 2JKPA 4M1RA 2DQWA 1XYFA 2WQDA 4W85A 5B7YA 4HHHA 3HG5A 1XBVA 4ZOAA 4IFKA 3OZYA 5MF5A 1XS2A 1W1ZA 5HPOA 3AROA 3ZVHB 5JH2A 4OIFA 4X61A 3BSGA 3S4TA 4TV6A 4WGXA 5IHRA 1H7PA 3FK4A 3IEBA 3KRZA 3EWCA 2ZTKA 4UTUA 5I3GA 2VCAA 1TPUA 1GNXA 4NQ1A 4M1BA 4RPQA 4HCDA 1XIHA 1XLBA 4E3VA 3R5EA 1QNRA 2CXEA 2NQZA 3GY1A 1UIPA 3JR2A 3B3DA 1AZ2A 1RPXA 1GYMA 3UZJA 4PGLA 2A5HA 3T2OA 2CHNA 4YTRA 3W1MA 3P8JA 1KLYA 4GK8A 3M41A 3XIMA 1VIZA 2Z6IA 3WK3A 1ONXA 3EWDA 4B4HA 1BSIA 3HV9A 3BUVA 3B8WA 3TYEA 2D0FA 3QEZA 3WNOA 3T81A 5BYWA 3S2CA 2E67A 3WYZA 4X60A 4I9AA 4NX5A 3ABZA 1QI0A 4LYPA 4FPSA 3M0XA 3NSMA 1HQTA 2V69A 3GFZA 3KLKA 2PDYA 3W1AA 1TMHA 4UQEA 3ZO9A 4I7WA 1PX4A 3FVDA 3FA3A 3P61A 1V3LA 4MKNA 3NA8A 3VILA 3CV6A 4LBRA 1A53A 3KTXA 1ZB5A 3S1VA 3KBWA 2FZMA 2ZZ7A 3OU8A 5K9CA 3LXCA 3NOEA 3OW1A 1AMKA 3RMEA 1OYBA 1ZPTA 4U2YA 4KEVA 4Z1YA 8A3HA 1E15A 3IUDA 3GKAA 4GYFA 3CLMA 2YIHA 4I6VA 4UFLA 1ZUAX 2OYMA 4IH3A 2Q6ZA 3QC0A 4N9DA 3BLPX 5A8QA 1N8FA 4XAGA 1V6VA 2VRQA 4DJEC 4L4MA 4US5A 1C7TA 4IL0A 3TA9A 2CZDA 1HN1A 3KDOA 1FA2A 3VOFA 3Q37A 4G5DA 4DYJA 1TE6A 3LHWA 3LSCA 1XD1A 4MB1A 4I8DA 3A24A 2C1IA 3APYA 3A9BA 2YFNA 3M6YA 2WJEA 3EOOA 5IXEA 4BQ3A 3MYOA 4LS2A 2VZTA 1GOMA 1JXJA 2X0HA 4R27A 4GVHA 3H7RA 1E6SM 1XG4A 5T9CE 4GY7A 1Q8AA 4JTEA 2YYTA 4A8NA 3SCSA 1VCFA 4LVGA 2D1ZA 3G1SA 2JEPA 2DPEA 1BQGA 3ITGA 4MSSA 1XR2A 3AMKA 3K46A 3G0XA 5C0QA 4QFUA 4F0RA 1VFTA 4XAPA 2GDUA 1KBIA 4E0CA 1JF6A 1TWWA 4X2RA 4XAFA 2ZUSA 3DC0A 3H24A 3IAQA 5MKGA 2WSKA 2QJGA 2OGYA 1JZ5A 3NQEA 2VL4A 4QJ4B 1CYGA 2PTZA 4S2BA 4GJ1A 3AMCA 3W7OA 3M0IA 2ZDSA 3M4HA 3DESA 4YVVA 4OBTA 1OM0A 1O1ZA 4LV9A 1P0EA 4NIRA 5FJIA 3UYIA 2Q3RA 4C7DA 3LHYA 1M53A 1J12A 1EFZA 4N02A 1ZAHA 4NX0A 4HNTA 5A8MA 4WOZA 1JDCA 2I16A 3G6MA 5KITA 3SN1A 1SUXA 3NZQA 3MYPA 3OHIA 1B2YA 2FPTA 3D0CA 1LWJA 3H26A 1KXHA 5E09A 3UCDA 5IDIA 6A3HA 4U33A 4U3CA 1S46A 4AFYA 3TNBA 4B90A 2OWXA 4EX4A 5C7VA 3F4WA 2XIQA 1B1YA 3GNOA 1FWSA 1C90A 1IXOA 3CHCA 1UMLA 4GVIA 2J7GA 1YXCA 1EWEA 3HGRA 3REQA 4TVUA 4ZL1A 1X38A 1VHCA 3G1DA 4BQ4A 3G24A 4KBXA 2X1TA 4P2VA 1B3XA 3WLIA 2NVCA 3EDEA 3SBFA 2DH2A 5E1QA 4M3PA 2ZCGA 1XD0A 1RLCL 2CLFA 1KKRA 2VFHA 4F2UA 3KS6A 1Q7MA 3GS6A 4RZ6A 1PJ9A 4Z1CA 4JTSA 1UKTA 1XLCA 4REQA 4HSHA 5A95A 5C9XA 1PYFA 3UPBA 3TXZA 5LSMA 4G9PA 1JYXA 3HG3A 1E72M 4DUXA 3UU0A 1MW0A 5D37A 3QMSA 4FP1A 2NUXA 1W1VA 3BW3A 3N19B 3N4EA 4Q4QA 3N2MA 2EXOA 3LRLA 4XO6A 1W9XA 3P2VA 2WNZA 3K8KA 1UBPC 4P8WA 4IJCA 3K1GA 1OG6A 3FYYA 2EG7A 3C3NA 1LRNA 4LCQA 2J7BA 3GNPA 4X3ZA 5MKGB 5CC5A 1XLDA 2BVDA 4JTJA 3HM7A 1G69A 5LNVA 3VVGA 1PKYA 4GZIA 3B9DA 1M04A 5D9MA 4JFUA 3AIVA 1OJXA 3MMWA 1I0DA 3DCPA 1W91A 3BPWA 1BVZA 4MZYA 3W84A 3C0SA 4DB7A 4O13A 2CPUA 4E3TA 1H1YA 4LX4A 1O6IA 1KM2A 4F0SA 3GVGA 3IJ6A 1FWJC 1TX2A 4XD3A 4HPXA 3P3BA 3OZPA 4U5KA 3W01A 3T40A 2PDMA 3UJEA 2H8ZA 2X1RA 1AQHA 2VEPA 3FAXA 5D2XA 1PYMA 4GKLA 1S2VA 3CQIA 2FVKA 3UFYA 1O60A 1OIFA 4AD4A 4LV4A 2E1WA 5DMMA 1NY1A 4J40A 3MUZ1 2ZXQA 1OCJA 2VC7A 3SFWA 3NQDA 3RU8X 3HJZA 3TV8A 1EX5A 4UTLA 4DPQA 1DHKA 2V2DA 3W70A 3ARVA 3URAA 3VZZA 1C3FA 5GNYA 3B06A 3GFYA 3VKJA 3LX9A 1O5KA 2PDGA 2VEGA 3TN6A 3LCIA 4JHZA 4HU3A 3WD4A 5I3DA 2R14A 2BX7A 4RV8A 1PO9A 3GIQA 1VFUA 1BYBA 3OZOA 4QCFA 2PLJA 4NY2A 4W87A 1E71M 1XGEA 1JIBA 4HA0A 2WZEA 4QHRA 3SRDA 1V6UA 1W3TA 2HROA 4QNWA 4Z42C 4MG4A 3V36A 2G3FA 5AB3A 1RQEA 1J18A 1WZAA 5C55A 1ISYA 4WHBA 4C6IA 1AVAA 4HU4A 4REQB 4MY8A 1FUYA 3IANA 3GDMA 2E40A 2PEVA 3GIPA 3VA8A 2H3BA 4W9TA 4B15A 1UW9A 3UG8A 3SCRA 2ZADA 1VFSA 1WDQA 3W1TA 3PM6A 1N7KA 3VOIA 3O07A 1HNYA 2HBXA 2LLEA 5CPNA 2ALRA 1MFVA 3DG6A 4ZQMA 1ICSA 4GQRA 3NNTA 1QNSA 2Z29A 4RLIA 3U7BA 5DFAA 2ZFAA 1GVFA 3BARA 1DXIA 3SW6A 4ASTA 4BI7A 1IGSA 2F6UA 2W0UA 2X0SA 1QI5A 2EQDA 2UY3A 3FDKA 4ZQPA 1Z3NA 5E6YA 3EOLA 3USZA 3DHDA 1QPQA 1K03A 2D0GA 2OQYA 4O57A 1ME8A 3NG3A 3R2GA 1E5NA 2VNCA 4AHPA 4S3AA 1BG4A 5FSDC 2EPNA 3MKVA 3AZSA 3I4EA 3C5QA 3UJRA 1YHTA 4FXJA 1UZ4A 4P61A 1B9BA 1LRTA 3IGXA 1LT7A 3OOQA 4QS5A 2O7QA 4L61A 1Q4WA 2A3LA 1UD2A 4H19A 5HOSA 3NDZA 2WV8A 1X96A 4G8TA 1H0IA 4FI4A 5CC7A 1XI3A 1LOQA 2G95A 3W00A 3ARSA 1EXPA 2ACUA 4GA8A 2OO0A 3PTQA 4B5WA 4CNUA 1HVXA 1K6AA 4IX2A 3ZZ1A 1Q66A 2O7SA 1ZJAA 4KFPA 3MBFA 8XIMA 3NQVA 2CIPA 2X1SA 2PGFA 1HIZA 3GDKA 3DFOA 2BOFX 1VCGA 1LORA 1BFNA 2VEIA 2WC4A 4ZODA 5CXPA 4UOZA 1T40A 1RHCA 4X63A 2WM0A 2QCCA 3TR2A 3CGTA 1D3HA 4ZBCA 3FW6A 4QR6A 3GDRA 2X1IA 5HNUA 4LAKA 3SGGA 4DWSD 2IQTA 1CGWA 3SCQA 3PB2A 1XHGA 4AIUA 1UJQA 4BFAA 1A4MA 3DFNA 2Y88A 3A64A 3HU7A 3UZYA 5IFTA 3PPHA 4O14A 1PCKA 1ITXA 3VGFA 9XIAA 4HOXA 5JBFA 2P8BA 4R53A 4RZ4A 3WL0A 5LHFA 5JVLA 4M6VA 1LG1A 4HNLA 2KX9A 3NAVA 1T96A 1VFFA 3BLIA 4ES4A 4LS1A 1V0LA 2DZXA 1EJVC 1A5AA 3UETA 2NXIA 3KOYA 3OA5A 4US6A 2WZIA 5I3KA 5G4WA 2ZXDA 4IIBA 5FEPA 2YXXA 4AZ7A 4AZIA 1F6PA 2DY3A 4DJED 3RCMA 3CNYA 3QGAC 2J13A 4DAIA 1K7EA 1KFJA 3DGRA 3DOPA 4JHMA 1KCZA 3ES7A 3C3UA 3W38A 4IT1A 1QPKA 4JTQA 1U33A 5AVNA 4AQLA 3C4UA 4GUIA 3QV6A 4V33A 3CHEA 1SPQA 2J9YA 2HEJA 3EB2A 1QRQA 3VKDA 3H2AA 3WQEA 3OB8A 2EEXA 5BMXA 4K7YA 3E2VA 4WLCA 4O4VA 2W3ZA 1ZJHA 4NI8A 1JCXA 3S9YA 3MCNA 4QQUA 3QZEA 1F3XA 1OGSA 4JL2A 5I79A 4DBUA 5ABTA 3H54A 1IT8A 2QPSA 3CU2A 2VX6A 4CNTA 5I09A 5LYRA 4N4QA 4CN4A 2VHLA 3N34A 1XUUA 4ZGYA 4UTFA 2WYSA 3O6AA 1UR8A 1J79A 4FEZA 2PDWA 1IXPA 2P76A 2CZ5A 3C86A 1XV8A 3PZTA 3IPWA 4UBPC 1RJQA 1NEYA 3F2CA 1BF2A 3EPNA 3VGBA 4JTDA 4MDOA 2BY3A 4B9ZA 4JN6A 4ZO7A 4BF9A 1X97A 1OK6A 3VABA 3SY8A 1HKMA 3DEQA 3PG9A 1FY6A 1P6WA 1DIDA 4DWDA 2HMCA 3T08A 4HZ8A 4D72A 3FHQA 1P6CA 3B0XA 1OF8A 4RNHA 4G2DA 3QM3A 3NPXA 1GZJA 4UMAA 1XLHA 2NT1A 2QVNA 2VFIA 1QWKA 3KVKA 3W2JA 1HKIA 1AZ1A 1Q85A 2J47A 3CEUA 1PEZA 4LCSA 1A4LA 3VMOA 4Q8OA 4C6KA 1ZTVA 3WH9A 3BG5A 3T0DA 3VM5A 1W9UA 4I5UA 2GVLA 3PZ9A 3HGSA 3SDOA 3BAKA 5A6JA 3TZNA 1H1NA 4AD2A 1GONA 1J11A 3ME3A 4AEEA 4PBFA 5CBJA 5C9WA 1Q7QA 3WQFA 3RK8A 4WEVX 1WV2A 2FMNA 1RD5A 3S5YA 2DDXA 3JZUA 3LNPA 6ALDA 3BAIA 4ZOEA 5JBEA 2ACSA 2Y2WA 2DIEA 3L4ZA 3QFEA 2D2GA 1B3ZA 2OEMA 1V8EA 3F4DA 1E4NA 1GVIA 3GTFA 1WUEA 1CX9A 2E68A 1UD6A 1NWUA 5XIMA 3EX1A 2BV9A 1OT1A 1KRBC 3O2LA 4H9XA 4F0HA 4URIA 3AYVA 1JPDX 1UPMB 4Z0JA 3LB0A 3G18A 2JIWA 4M6PA 1P1MA 5LA2A 1EGZA 3A5FA 2JFEX 4JTRA 2V3FA 1UWSA 1ZQ5A 1WXJA 4PL1A 1W1IE 3GTHA 4FOJA 2FYMA 5HJLA 3MCOA 1QNPA 2OLSA 2XN0A 1PZ0A 4FF7A 2A6NA 5BXTA 2FDSA 4M24A 3I6TA 1YXYA 1YTEA 3VGHA 3V75A 2V5JA 3T2PA 2OFJA 1UOKA 3ATYA 3M5VA 4P7OA 1EX1A 3HA1A 2HRWA 4QITA 1Q63A 1WAUA 1CXIA 1J0ZA 3E0FA 1TPC1 5H8UA 1RQBA 1TIMA 1WDRA 3NQ2A 4G56A 1U83A 2E5CA 3I68A 1YBQA 3GM8A 1SW7A 2GPTA 3W7KA 4CCDA 1E6XM 1UJPA 2DT0A 1QMLA 5D8WA 1OG0A 4HOZA 3R58A 1R3WA 4N7QA 1DWIM 4ZO9A 4UZSA 2Y89A 3NZPA 2GK1A 2E9LA 3NQ8A 1WBJA 1IR2A 1A5SA 1HT6A 5AHFA 3C2VA 2NV9A 1F74A 1VIWA 1XRVA 3INPA 5DT7A 3MV11 3W24A 3O15A 2YW4A 1A47A 3PWAA 3RLUA 2J4GA 3GG0A 1M3UA 1NSJA 1QK0A 4GIYA 3UYCA 1BTMA 2V38A 4RE3A 2PCQA 4AD3A 3AWNA 3N18A 4GIRA 3T8LA 1N55A 1EJWC 3EKLA 5HNRA 4TQTA 3GU2A 4B2DA 2FB2A 3IUIA 4MWAA 4H00A 4IQJA 3KP1A 3LM7A 3WK1A 2D2JA 5HNTA 5I00A 4C91A 2I5GA 4H9VA 4N9BA 3PPCA 3YPIA 3L2LA 4ZB5A 1O5QA 3MZNA 4FIQA 4KIEA 1JUEA 1ME7A 3ZYZA 2ADAA 3IV3A 5IHSA 3VNLA 3WIJA 4IMDA 3KFTA 1H3GA 2HJPA 4XKYA 2HPIA 4H2CA 3WMLA 1EP3A 1E3ZA 3C2YA 4QLLA 4Z2LA 1GOKA 3TDFA 3T0TA 2QV5A 3W7GA 4P8XA 4IZGA 3UVIA 3STGA 1IEIA 1Q6EA 3EX6A 3A22A 4FS9A 4NUWA 4AAJA 4AC1X 1CLXA 1KW1A 3M16A 5GVJA 1GQJA 4UFIA 4B5SA 4FR1A 1JPMA 3TQ0A 5EMJA 3WEZA 3E9AA 2WLZA 1H2JA 3M5YA 1XCWA 4JFTA 1QOXA 1H7WA 3RO8A 4RUBA 3CQHA 1H41A 3RM8A 2PSNA 3M46A 3STFA 3V3WA 1NP2A 3MI3A 3AALA 3HIJA 3P80A 3N3TA 1EOMA 1PZ1A 2NUYA 2Y5SA 3IGHX 3T0AA 4RK8A 4HMCA 5A2AA 1NQKA 5J5DA 1AK5A 4RX0A 8RUCA 3R6IA 1SO5A 5HINA 4PMYA 2A2IA 3ANYA 1YBQB 3ZLGA 3BAJA 3VIPA 1TV5A 1LWHA 3MB9A 4HNOA 2WLYA 5GQBA 3LTPA 3O9NA 5ABEA 5EY5A 3ARWA 1SQ7A 4H9TA 3AXIA 1XSKA 2GK1B 1EA9C 1E1EA 4GLEA 2QS8A 2XN2A 4FSAA 5LNSA 3T09A 1Z42A 3GZAA