3MO7A

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 2'-fluoro-6-iodo-ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Novel interactions of fluorinated nucleotide derivatives targeting orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 258
sequence length 258
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mo7A00
2BX7A 1TRDA 3VFLA 3EX4A 1K02A 1O5XA 2RDWA 5AYYA 1AL8A 4BFAA 3G22A 1EEPA 3FJ6A 1LZOA 1I2NA 5CZ0A 2Y70A 3O8AA 5AHEA 2DZPA 3K30A 4XBSA 5C55A 1WQ5A 3STEA 1XFBA 1JQXA 3W7QA 3BLEA 1EIXA 3HBLA 4IMGA 2ZDRA 1SW3A 3ATZA 1VJIA 3W76A 3DAQA 4K6AA 3BK0A 2Y61A 2ZA2A 5D2WA 2H8ZA 1WV2A 3GX9A 1W56A 4QNEA 1W5PA 2Y62A 1OX5A 3ABRA 1LBMA 3PVFA 3HJZA 3SECA 3IVUA 5E1QA 2CW6A 3GKFA 5KZDA 2GPTA 2NV1A 3CU2A 4UMBA 2ISSA 2J27A 3M44A 1PVNA 3P8JA 3UPWA 1DHPA 3NQVA 4NNBA 2WSYA 5KSWA 3G8RA 1XBXA 1K7FA 3LBCA 1O94A 2BZNA 4O19A 1OABA 3E12A 1Q6LA 1QCWA 2GQ9A 2YZRA 1ML1A 2Z6IA 5AC7A 3NPUA 2BLEA 3USBA 4PODA 5EL1A 3TSMA 3P5ZA 4FXRA 1GZGA 3IV3A 3IRDA 1VCFA 3BW2A 1TPWA 2DZWA 4IXHA 5FEZA 1SQ7A 2OCZA 3STGA 1ME7A 3W7EA 4WY0A 3TK7A 2QR6A 4K7YA 3B4UA 5CZSA 3S0CA 3RK8A 1EUNA 4LS1A 3BGJA 1LRNA 3QQ0A 3DFOA 1W1ZA 3NQ8A 3O6DA 4FNPA 1OHLA 1DQXA 4JNMA 1GQNA 5D30A 2DORA 5I3JA 3LX9A 1D9EA 1ADOA 4YMZA 3T55A 1NEYA 3NNTA 4LVDA 3PG9A 3UNDA 3FKRA 5FF3A 2E6DA 3TJXA 2QCLA 3W88A 2BSLA 2GOUA 1VQTA 3STFA 5I3FA 1EP1A 3G1DA 3I7QA 1L2UA 3G18A 3RNDA 2CZDA 1TCDA 1R2TA 4FNQA 2R14A 2E6AA 4O16A 4ZVJA 4O10A 3G1FA 3M16A 4Z08A 1RPXA 3CC1A 3M43A 2NX3A 3SSJA 5AC6A 1KTBA 4O12A 1OFAA 1GPWA 3UY8A 5BW6A 2C14A 2HSAA 2VFDA 2F7FA 3W71A 1GG1A 1YXCA 3GNDA 2B0MA 4ICNA 1XXXA 4UTTC 4UTTA 2V9DA 2D73A 3HPSA 2I14A 2WSRA 1M5WA 4AWTA 2PRMA 1IXPA 1J4EA 3ZWSA 2QCEA 1KTNA 1ZALA 3PC0A 3DI0A 4XKYB 2HS8A 2E1DA 5E93A 2QEZA 3W7NA 5CPOA 4CQAA 1YXYA 3CLMA 3KRZA 1BWKA 3C56A 1W31A 5AHMA 3A22A 2DZUA 3I6RA 1TJRA 5AOUA 3TH6A 3SY5A 2A6LA 1LP6A 3L5LA 2QAFA 3N2MA 4IUOA 3N3MA 3L65A 4IMEA 3A5VA 2JGQA 2YW4A 5CSSA 1SZEA 1QPNA 2G5WA 4Y9AA 1MZHA 2ZZ6A 3GXNA 3KHJA 4M19A 1KFEA 1W37A 1SR9A 2ZRVA 2JK2A 2ATMA 3I7SA 1SUXA 3M5VA 1K3UA 4UR8A 3QMRA 1WYIA 1YXDA 1TTPA 3RU6A 1W54A 4JN6A 3GZ3A 1F6KA 3C52A 4TU1A 5D2VA 1TPH1 2ABBA 4R7JA 1SW0A 3MP3A 3L0NA 3G1VA 4JTGA 1N8FA 3PUEA 2J9XA 3MHUA 3LHZA 4XUGA 2CZEA 5GVJA 1F2JA 5LNWA 5EBUA 4MFEA 4BK9A 3O6YX 3PUOA 4QIUA 2Y88A 4N2YA 2O7QA 2EGZA 1QWGA 2O7SA 3F1QA 5AYXA 4LS0A 1FXQA 3S1UA 1ZAIA 1VYPX 3BARA 1JQVA 3THAA 3L21A 1S3HA 1OFRA 1FDZA 3L66A 4YWIA 1TPFA 3JRKA 1THFD 4XQ6A 5HMSA 4O15A 4U4MA 2FPTA 5HWJA 3H55A 3IGUA 3O16A 3P5YA 4I9AA 5DBUA 1QOPA 4Y96A 1YDVA 5BMXA 1X1OA 4PH6A 3DZ1A 1D3GA 4LRSA 3LCXA 2Y7FA 4O1CA 3QYQA 5BRBA 2C3ZA 3FEMA 3HF3A 1L6SA 3KOFA 3TROA 3LV6A 3CTLA 3MHFA 2WJZA 2DZXA 3W1NA 1R47A 1RQHA 2NLIA 3BW3A 1W0MA 3OVQA 5CSRA 1ICPA 4NZFA 3SR7A 1CX9A 1GYLA 2QCMA 5E0KA 3PS7A 3W1PA 1Q3NA 4UXDA 5D2TA 3TU9A 4OGZA 6ALDA 4UFMA 3W2MA 2V2DA 4LVAA 3TAKA 3PB0A 3QF0A 1W5OA 4DBEA 2YXGA 5K4XA 4RZ6A 4QSHA 5TIMA 2JKPA 2X1TA 2TPSA 4CCDA 4AHOA 3NPXA 3G1YA 3KAOA 4QAIA 2CZFA 3P84A 2YYUA 4NJGA 3W7IA 3UZJA 5F2MA 3DFTA 1MEIA 2GVJA 5KTLA 5LNSA 4UIOA 4Y8FA 2QCDB 1VRDA 3LCHA 3UWQA 5D05A 3R5EA 1A5CA 2OJPA 3UWWA 1W5MA 3FYPA 5HWNA 1I45A 1Y0EA 5AYZA 3W3OA 3G1XA 1OF8A 4N9CA 1TQJA 3HPZA 4RLIA 1Q6QA 4CNPA 3D0CA 2RFGA 1T96A 3GDMA 1H62A 3T7VA 1TV5A 3KRSA 1ZCOA 3OHIA 5DCDA 4UCGA 5L6UA 1LRQA 4JTTA 3LCGA 1JCJA 1TB3A 4ZQOA 1FDJA 2PRHA 3NL5A 5G2WA 3W7LA 2W79A 4K37A 3C2OA 4DF0A 2B7NA 2P10A 4IJBA 3KFTA 1LOSA 3DHDA 3GYEA 3EWBX 5K7JA 1LDCA 1KFLA 4DXVA 2QJIA 4FX8A 3IIXA 4HT3A 1G4PA 4ADSA 3LRMA 2H90A 2QCHA 4JX4A 3N14A 2CWNA 4S2CA 3HQ1A 2Z2UA 4NX0A 2C19A 3ABSA 3IIVA 3GDRA 4JD4A 3O07A 4O54A 1X8FA 5D33A 3OVPA 4BR1A 1VZWA 5G2IA 1VYSX 1WX0A 2QJHA 4O52A 1RD5A 5CZJA 3A21A 4ZMGA 4NZJA 1H60A 3L9CA 4X3ZA 4Y90A 3LCIA 1AW5A 3UPBA 1JRBA 3SGUA 3IGXA 3B8DA 1JJKA 4CLMA 3YPIA 4A22A 3W1XA 3P82A 4ML9A 4LVFA 4QISA 4GUHA 3LTPA 3O1NA 1H61A 3PAJA 5C2XA 1PHQA 1X1ZA 1PCWA 3C3NA 1DV7A 5HWMA 3W2NA 4N9BA 4J9JA 3S5YA 2ZTKA 3W7HA 3T40A 3CWNA 4HPJA 1K8XA 5AHFA 4A3UA 5DELA 3N9RA 2A0NA 4FB7A 3MWAA 1ICSA 3VNDA 3LHUA 5CPNA 2DZTA 4MJZA 1WOAA 4LUJA 3KXQA 5G1YA 1LBFA 3W70A 4NJKA 1H7OA 4LRTA 1KLZA 5F1VA 5C5YA 1KM5A 1H1YA 1QFEA 1I2RA 5G4EA 1HG3A 1G7UA 3MYPA 2Y63A 4UR7A 2QDHA 2I1OA 3W7JA 1KFBA 4MZ1A 2XFWA 1O60A 1IGSA 2A7NA 3IIZA 3NDOA 3S6DA 4ZQRA 4DELA 1G67A 1GVFA 1SZNA 5A5WA 1SO6A 4L4LA 3TSDA 1VPXA 3QRHA 3TW7A 2V5LA 2OT1A 1L9WA 1KTCA 3VI2A 3L0GA 2C16A 1T8XA 3QZEA 3R12A 2E5CA 6TIMA 4EF9A 4O0ZA 2ZZ3A 3SW6A 2YFOA 3EX6A 4GUGA 1Q6RA 2ZFAA 3MBFA 4NU7A 1QDSA 3HGRA 4IOTA 2V2HA 1FDYA 3AJXA 3HGJA 1NAL1 2EAWA 3GNNA 3C0JA 4E2DA 1ZAHA 1HFBA 2NXHA 2V5BA 2Z1BA 4UTMA 1EX5A 1TTIA 1XKYA 1N55A 4UTIA 1U5JA 1AW1A 5DN1A 2DU2A 1WBHA 2Q3RA 3F4NA 2GQAA 4K39A 3PR2A 5KINA 4PL1A 3B0UX 2ZTJA 2KZHA 1GTHA 4JXCA 2ZRXA 3G24A 3NQEA 1P0NA 4QITA 2FB3A 1SSDA 4QNWA 3W2JA 4KFNA 5D32A 3C6CA 3B03A 1RQEA 3W83A 3V75A 3V1PA 5AFDA 3TDFA 2WNZA 4P61A 4WXZA 1LCOA 4A21A 2CZ5A 3QPYA 4JIPA 3TKFA 1TPC1 4JY8A 1JCMP 3HG3A 4ADTA 3F4WA 3MYOA 5AC8A 4N9DA 3QJAA 4G1KA 1UJPA 1I2OA 1I8JA 2E77A 2Z6JA 3P67A 3R89A 1AK5A 1L6YA 1R2RA 1V7YA 3IEBA 3LXCA 4IQLA 3QQ1A 1ALDA 1VYRA 3W86A 5KZEA 1P5BA 1KBJA 3EEGA 3M7WA 1ZNNA 4NNCA 3TIMA 4X2RA 1O95A 1X6UA 4O1AA 3NVTA 3TQVA 1V5XA 3F03K 5I3HA 1OK6A 4OU1A 5FF4A 3W7GA 3QW4B 3PG8A 2WO5A 4AXKA 3TJLA 5LGXA 4RKAA 3TMLA 2HTMA 5AN7A 1YTDA 2G95A 5K9CA 4IMCA 3PB2A 1FCQA 1VR6A 3MI2A 5BMWA 3BG5A 2ZZ1A 2NX1A 4LY8A 2CU0A 1SPQA 5D38A 1IIGA 3C2VA 3LHYA 3S5OA 1QOQA 5FF2A 1ZAJA 5EY5A 1KM4A 1QR7A 4JTLA 3M41A 5K2ZA 4Z1DA 2VEIA 1N7KA 3DGRA 4MUZA 1R2SA 1FQ0A 3TUUA 4TIMA 3GIYA 3MO7A 5DY3A 4DEFA 4M6PA 3W7DA 4DO5A 1QNVA 3WJYA 1JULA 4O11A 2QCGA 3W1TA 2HMCA 3NM3A 3KVLA 5CPMA 3L68A 4XKYA 3NO5A 2AAMA 3NL6A 2Y7EA 2YX0A 3KVJA 5D37A 4MFDA 2HS6A 1HO4A 1FWTA 1B9BA 3E96A 5LNUA 1KM3A 3IVSA 3TXVA 1YPIA 2GJNA 1TSIA 3MI6A 1EWEA 2RHGA 1EWDA 3LTYA 4LV9A 3W22A 5KITA 4LVGA 1RQBA 4CQ8A 1JUBA 1Z42A 5U4NA 4GUFA 3M5YA 1G69A 1CW2A 5LKYA 4Z1AA 1BTMA 4C1KA 5HQEA 1LRTA 3O06A 1VLWA 3GAYA 3P7YA 1FCBA 2FDSA 3N34A 3LV5A 1A5SA 2C0AA 2E6FA 4OQVA 5F2LA 2VFHA 1D3HA 3G0XA 4XTDA 3LERA 2A85A 1EA0A 4U28A 5I3GA 3S1XA 3NQAA 5HR6A 1ZY9A 1O5KA 2BXVA 2JBMA 1TQXA 2ZRYA 4YCPA 4FHAA 3DENA 3ABQA 3O15A 3W7CA 3TA6A 4O14A 5IM51 5HUPA 3TXZA 5LHFA 3PSVA 4FO4A 4JDYA 4IX2A 4S1FA 1XCFA 3SJ3A 1OYBA 1UB3A 5DCEA 3QC3A 5G4WA 4UTWC 1MEWA 5EA9A 3NA8A 4UTWA 4ZQCA 4MY9A 1JCYA 3TCEA 3QH2A 1Q45A 1XI3A 4A2SA 4DPPA 4UTHA 2C6QA 3M0ZA 4LV4A 3KRUA 5HINA 2A2IA 1H7RA 1KFJA 4EF8A 1KFCA 3TNOA 2CLOA 2QAPA 1FUYA 1WDWA 4JY9A 5FF0A 3MUXA 3A9IA 3GLCA 4NX5A 5C6MA 5HJLA 3O63A 4LTSA 2RDUA 4EOUA 3CEPA 2Q3OA 4N02A 3B0PA 3G0UA 3LBMA 2YGYA 3LLDA 2QCDA 4R53A 3TC6A 2GUUA 3W84A 1JR1A 4DO6A 4Z1CA 1C29A 5K3VA 3LHWA 3CQ0A 4TO8A 4WY0B 3DKLA 4Z1BA 1AG1O 3W2LA 4PCFA 3FIGA 1KM2A 3ANYA 4K7VA 2AQWA 1YTKA 1B57A 2FQIA 3FJLA 1TJPA 1VCGA 3WK3A 2R91A 2ZCGA 3DKJA 4Q32A 1K7EA 4K36A 2PURA 3NL2A 1PHWA 1J2WA 4E38A 2CLHA 4MY8A 1GOXA 1W3TA 4H6KA 2CLIA 3E9AA 3DI1A 1OJXA 2PE4A 2YSWA 4L4MA 4LVBA 3M5XA 1C8VA 3UXDA 2TSYA 4MYXA 3CWOX 3EWYA 3TW6A 4YLWA 2EHHA 3P61A 4AWSA 2YPIA 1SO3A 3DFNA 4GUJA 4N6FA 4MYAA 4XZ9A 1TO3A 5LGZA 4GFSA 4N6EA 4M5PA 4FNSA 4PC8A 2PRLA 3EXRA 1GG0A 3INPA 5DXXA 1GJPA 1PV8A 3EX2A 3EWZA 5D2XA 3R8RA 3MHGA 1W5NA 1KBIA 4HN4A 3GXTA 4WX2A 2GVGA 3QMTA 3EWUA 2H3BA 4JTFA 1G4TA 5LZLA 1VH7A 3NYZA 3W6YA 3GR7A 1OX4A 3GK0A 3CB8A 1NFBA 2A6NA 3W07A 1TRIA 1DORA 3RF9A 1H63A 3E49A 1T0OA 3SFKA 4JTIA 3WFAA 5FESA 1JCNA 1DBTA 4GXMA 5KMYA 3I68A 3ZR4A 3A5FA 1DL3A 4UTJA 3Q2DA 3FS2A 2WPBA 5K9DA 1A50A 4O28A 4BWLC 4I7VA 4HNTA 4BWLA 2C18A 4IX0A 3WJSA 2J24A 1PE1A 2G96A 4JGDA 3SZ8A 1I2QA 4DPQA 5H2ZA 2QCCA 2WSQA 2VEMA 5LNRA 3L5MA 5DCBA 1UUMA 1NVMA 3LCLA 5K9XA 3G1AA 5F4WA 3NEVA 2A4AA 2G97A 2NXGA 3BLFA 3OG3A 4O1DA 4OV4A 5BOOA 3S1VA 5DLCA 3W7OA 3JS3A 5EYWA 3EKLA 3P74A 2Y85A 4O4WA 1LTDA 2E09A 4CCEA 1S5VA 1B3OA 3M47A 3QFEA 1T99A 5AHIA 2QUTA 3CHVA 5F2IA 3FA5A 3W75A 1FBAA 3QPZA 2OMAA 5F1UA 1BWLA 4QQ3A 1QPRA 4FIQA 1OFPA 3L0KA 3T4CA 2WNQA 4GBUA 4JYDA 2W0UA 3LRKA 1X7FA 4I7UA 4KFOA 4A2RA 4UFKA 4RK8A 4IMDA 5ABTA 2QKFA 5SWUA 4MLRA 2H6RA 2ZA3A 1Z41A 3G1HA 1OX6A 1K8ZA 3W74A 3EX1A 3BVJA 1OFDA 1IXNA 1XUUA 4GJ1A 3MW7A 1YDNA 4R33A 2X16A 2X30A 4IWWA 4WXYA 1LLWA 1GEQA 4EIVA 2XN0A 1UUOA 1NF7A 1TIMA 5CZTA 3NXFA 3TAOA 3OEXA 3IGSA 3UWUA 1ZENA 4AF0B 3L5AA 2FJKA 1HUVA 1SZFA 2CLLA 4MVAA 4EVZA 2TYSA 5AHNA 2QF7A 4EWND 1P0KA 4MZ8A 3U6WA 3HGSA 2ZYFA 1DOSA 3WK0A 1KW1A 1TPDA 2YCEA 2EKCA 4NXKA 4AWUA 4N4QA 3VE7A 1B4EA 3VCRA 4O8RA 3RMJA 3PUDA 3SGZA 4KWWA 3QEZA 4RJEA 3KVKA 3TC7A 1C9DA 3THQA 4FNRA 4XTIA 1MSSA 3S5ZA 3G3DA 2FLIA 3W1QA 1TMHA 3IVTA 4RZ5A 1LORA 3LHVA 1EB3A 4TR9A 3S5NA 3PM6A 1DQWA 2BWGA 4UTUA 1F6PA 2NX9A 3EWWA 1XDLA 5F4SA 1WOBA 2E5DA 4HNUA 4LC6A 1XM3A 1KA9F 2B7OA 2J9ZA 4AVFA 1JCLA 3GDLA 3MP4A 4AAJA 3EX3A 3LI0A 2GJLA 5MHBA 3TSBA 4M7SA 4O17A 1VHCA 4BI7A 4JTSA 1FWWA 3R13A 1VCVA 1PCKA 4RZ4A 3UD6A 2A5HA 3SI9A 4UNKA 4UFIA 4XBKA 5D03A 4YL2A 4M6QA 2TRSA 3P60A 3ABOA 3PBUA 3WK1A 4DO4A 1TV8A 4LU0A 3NZ1A 2WV8A 3DU0A 3LXAA 5F2GA 3TE9A 4IPJA 4UTKA 3HO8A 1QAPA 4HNVA 2GQ8A 2Y6ZA 3DFQA 3S1WA 2CLFA 2Q8ZA 4UNLA 1BEUA 3H53A 3DFSA 3B05A 3NAVA 1TV7A 3C2EA 3HG4A 1AL7A 3N2XA 1A53A 2ZBTA 5KZMA 5T26A 3WJXA 1U83A 3UYCA 1SSGA 4WUIA 3TFCA 5IBXC 4N9EA 1KFKA 4OV9A 3TFXA 3CEUA 5IBXA 3W72A 5G2HA 3I7RA 1FCUA 1WA3A 1B4KA 3E0IA 1R46A 1DJQA 2ZZ7A 1OYAA 2J6XA 2LLEA 4MIMA 1F5ZA 4DBDA 1H7XA 2EPHA 1UASA 4RXGA 3NQFA 4LS2A 4YCOA 3TMQA 5D09A 1JCXA 4BI5A 2VEKA 2WNNA 3PBVA 2Y7DA 4CNNA 1TTJA 3W7PA 1YLVA 3PBWA 3FOKA 2ZRZA 3RFAA 4BF9A 1NF0A 5HNRA 1EPXA 1MEHA 5D04C 1HTIA 3LDVA 1WBJA 3HPXA 2XN2A 1LYXA 1SZGA 1H7WA 2DZSA 2IQTA 2QUUA 1KM0A 2V82A 3PBYA 4O13A 4K8HA 3A24A 5EMUA 4JTKA 5HR7A 1KM1A 4AHPA 3MJYA 4PFMA 1LOLA 4BI6A 3LOTA 1OFBA 4CCCA 1WXJA 1LBLA 2C1HA 3HGOA 1LROA 3NM1A 5HULA 4KKXA 3TQ0A 1R30A 4ZQPA 3GB6A 2B4GA 2PC4A 4ZQNA 1OK4A 3PSWA 4NJIA 2QDGA 3CM4A 2TMDA 5AB3A 3WJZA 1PIIA 3G0SA 5L9FA 4HIBA 2NWRA 3QSTA 1GYNA 4NNAA 5D02A 4P2VA 4ALDA 3GVGA 4HPXA 3DXIA 4UMCA 2E6YA 4PA8A 2VFIA 4ORMA 5I3KA 3W87A 3BG3A 2B7QA 2WKJA 4JICA 3S8HA 1KM6A 3QW3A 5FEXA 1ICQA 5G1TA 1AMKA 1Q6OA 2ZZ5A 3UWYA 5J5DA 4OBTA 4UFLA 2H8XA 3WK2A 3I65A 4OWGA 4MPQA 2UV8G 2F84A 2X1SA 1EUAA 2NWSA 3AO0A 3CT7A 4UC5A 2JGYA 1YADA 4LOCA 3CIWA 4RV8A 4WJEA 5K4ZA 3LGEA 3EXTA 2VKZG 2WQPA 5J5RA 1ZJIA 2X1RA 3ATYA 1SO5A 3HG2A 3PWAA 3Q94A 4LT9A 2Y89A 2V0TA 3L67A 3MBDA 2WOQA 4X9SA 1ONRA 3C8FA 5DY2A 2VOMA 4GWEA 4ONVA 2ZZ2A 2Y7GA 1IXQA 3M9YA 3T78A 4AB4A 2YFNA 2ZRUA 3OIXA 4C1LA 2XN1A 1W3IA 1TYGA 5FF7A 3W2KA 2J9YA 3GR8A 3UWVA 2X1UA 4JEQA 3EKZA 2EF9A 1OYCA 4JS3A 1SFJA 4JYEA 3BG9A 3PY2A 5D2YA 2FPVA 3NQ7A 1W3NA 3ELFA 1Z44A 3BPWA 4Z0SA 1UCWA 1TTQA 1G7VA 3O6CA 2ZZ4A 4TX9A 3FFSA 1W8SA 5TBOA 1SW7A 2CLKA 2JKEA 3BGGA 3HG5A 3W85A 5LSMA 3B06A 3A23A 4ZQMA 1LLZA 5FEPA 3W9ZA 3W73A 1FCVA 1FXPA 1LM1A 1TPEA 1TREA 1H5YA 4IMFA 4W9TA 3LI1A 5EKYA 2VEPA 4JR5A 3VE9A 2P1FA 4UFJA 3C61A 4ORIA 3W7MA 1LOQA 1YYAA 3OA3A 4O18A 4ZZ9A 4Q33A 3TX9A 8TIMA 4KWVA 1M7PA 3NGJA 4O0KA 2A21A 1YTEA 3NOEA 4RCXA 4O4VA 1GVOA 1OF6A 1L6WA 3OBKA 2FTPA 5F4XA 3P8IA 4KFPA 3EB2A 1QO5A 3QMSA 4RR4A 2YDAA 1Z48A 4LNYA 2E68A 4FX6M 2ZQ0A 4H4IA 1F05A 1G4EA 2NUXA 4S2BA 4A29A 3IIOA 4DF1A 2ALDA 1KV8A 4FNTA 2V2CA 3C2FA 1QPQA 2I9EA 3GAKA 2RDTA 3HOJA 4XWUA 1G4SA 4WZHA 4PEKA 1ZHAA 4UMAA 5AHLA 3EXSA 2VXNA 2Z0IA 1BKSA 2V30A 3HB9A 4TMCA 2DJLA 3U2OA 1E51A 4HKPA 3PF3A 1PL9A 3FKKA 3RLVA 1QPOA 1K8YA 3NQGA 1VS1A 3LLFA 4MZYA 5HUOA 4M6VA 4X22A 1UBSA 4O50A 2FIQA 2V81A 1F73A 2CLEA 1TPVA 2NXIA 3E02A 1OFOA 2H3DA 5H91A 3W1MA 4R34A 4Y6GA 1GTEA 3B04A 1GVSA 4WOZA 5LNVA 2FPYA 3ZS4A 4ZL1A 4PL2A 3R2GA 1GT8A 3IIPA 3N73A 1EP3A 4GNJA 3UQNA 5U7SA 1XC4A 4N4PA 1EP2A 4TMBA 1FX6A 1RVGA 1OG0A 3HMJG 2JKAA 4OHQA 2Q8LA 2YW3A 3C4UA 4LW7A 1DKWA 1DVJA 3NQCA 4MY1A 3GKAA 4NQ1A 1XBVA 1ZFJA 1H7NA 4AF0A 1HL2A 5CPLA 3NR0A 3G8EA 1YPFA 4ADUA 1H50A 1ME8A 3W2UA 2C13A 3CPRA 1KLYA 3OVRA 3NQ6A 2ATSA 4IXXA 2VFFA 1ME9A 1YDOA 4WY0F 2RKXA 1QMLA 3S42A 4I7WA 3NQDA 3W1RA 2FFCA 4UFHA 3NPVA 4JTUA 1SU5A 3P81A 1PS9A 4O53A 3GDTA 3U8GA 4JTHA 4GUIA 1F74A 4HSNA 4LWWA 4LUIA 2NUYA 1J5TA 2YR1A 4WD0A 5DXYA 2GVLA 1AW2A 1SFLA 2ZRWA 4UTLA 1JUKA 3BLIA 5CGQA 1RR2A 2B7PA 4Z0JA 3LM7A 1F7BA 3MMTA 5G5IA 3DH7A 4AMAA 1P4CA 3W23A 1S5WA 2VFEA 1H7PA 4FX7A 1HO1A 3LHTA 3NL3A 4NJHA 5FEWA 1FWNA 2QUVA 3TR2A 3O05A 2DP3A 4QM1A 4YXGA 1O4UA 3DBPA 3DFPA 2VENA 1M6JA 4HSOA 3UZ5A 3ZWTA 2PCQA 2QCNA 1M7OA 5CG7A 4DQWA 4RX0A 2CFFA 3JR2A 3C2RA 5LHEA 3RLUA 1OX4B 4CNOA 1OFEA 2NV2A 4HHPA 3T44A 4Q4KA 2A7PA 4K38A 3LTSA 4WOQA 2QJGA 2CLMA 2FB2A 2R94A 3EWXA 1XBZA 4JX5A 1OFQA 2YYTA 4NT0A 3Q58A 3LXBA 4RXFA 2QCFA 5A8GA 2NZLA 1GWJA 2ZA1A 1W5QA 1I4NA 3W1LA 3TQKA 3M6YA 5DBTA 4MKNA 3B0VC 2ABAA 2ISWA 4PTNA 4FEZA 3G3MA 2DZVA 1G6CA 3SIZA 5I3IA 1OVDA 4JTJA 3MP5A 4GRSA 1A5BA 3STCA 3BV4A 2BTMA 3UXAA 1JVNA 1I2PA 3W1UA 5C54A 2E5BA 5TQLA 3NZRA 3BO9A 4FF7A 2X2GA 4H3DA 4E2BA 3HIJA 3P80A 3Q37A 4CQ9A 2P0OA 3QM3A 3LCWA 4HNNA 4NVTA 3ZFHA 1VC4A 1P1XA 3KVMA 4LC8A 2VFGA 4K8EA 4M7TA 3TV8A 2A7RA 3CIXA 4E0CA 3M1ZA 4OT7A 2RH9A 1S5TA 3FLUA 1MO0A 1XUZA 4UUIA 1MXSA 3W7KA 3W1AA 1K03A 5CKSA 3LCFA 4D2JA 4AH7A 4NXSA 4POCA 1JUEA 1DJNA 3H54A 1H1ZA 4AHQA 3N19B 1TPUA 2C15A 3NQMA 2OT0A 4O57A 1H51A 3LRLA 3DHFA 5BNKA 4QJ1A 4MJMA 3NPWA 4B5NA 2J88A 1KV5A 3LB0A 2ISVA 4FXSA 4OE7A 2VC6A 3MI3A 1K7XA 3G1SA 4JIQA 1SO4A 3NQ2A 3BW4A 3GXPA 3L2IA 2A1YA 3WJWA 4FIRA 1NSJA 1VGAA 1F76A 4NUWA 4GC4A 4MLJA 2NUWA 2R8WA 3PULA 1XL9A 1JRCA 2OX1A 4MOZA 7TIMA 1XBYA 2V8ZA 2OZ0A 1CI1A 4O1BA 2VELA 4JTEA 1IIHA 4JYFA 4IGHA 1GVQA 1IXOA 1VLIA 1A5AA 3UY7A 3KX6A 1IF2A 5EPDA 4JDBA 4GE8A 1FY6A 1RV8A 4NJJA 3N9SA 4JX6A 2DJXA 5FI8A 4WQ6A 3GDKA 4IPIA 4DF2A 2AGKA 3UWZA 1FWSA 2W6RA 1XDMA 3P62A 3W7RA 3M5ZA 1TPB1 3VKJA 1GVRA 1VHNA 3QSRA 1RZMA 4AEOA 3S9YA 1QO2A 3NG3A 1FWRA 4FNUA 1WAUA 3FYOA
chains in the Genus database with same CATH superfamily
4QLKA 4KS0A 4UCFA 4AX7A 2RDWA 3VNIA 4BFAA 1K4HA 1W1B1 3UR5A 4G8TA 5AYIA 3PPHA 3AICA 1LZOA 3O8AA 2P8CA 3K30A 4I9JA 3DHUA 3HPAA 3HBLA 3EB4A 1VJIA 4TOQA 4PUUA 4K6AA 5GNXA 1UZDA 2ZA2A 5D2WA 2PDIA 1W56A 4XZHA 4ZR8A 3ABRA 4Q4OA 1LBMA 1L8NA 1PBGA 3SECA 4JKMA 5E1QA 3GKFA 4FZIA 3MCOA 4UMBA 2WC3A 2J27A 3M44A 3GFZA 1Q6DA 1PVNA 2RGLA 3P8JA 5DRCA 3ARSA 3TQPA 1KR1A 3AIVA 2XJ7A 1XLEA 1K7FA 2CHRA 3S3GA 1F4HA 1OABA 2G3FA 5CJMA 3IJQA 2GQ9A 2J7BA 2YZRA 4EPEC 5IFPA 2Z6IA 2BLEA 3PP7A 3UXKA 3P5ZA 2QJNA 1AA1B 3IRDA 1MUMA 4DWSB 1VCFA 1OQFA 3WIJA 5EMYA 4RDVA 1TPWA 2DZWA 4IXHA 5BWAA 1UPMB 3S0CA 3T8QA 1EUNA 1ELSA 3BGJA 1SMAA 2DPEA 4JIEA 5I3DA 3NQ8A 3AC0A 4FNPA 1OHLA 1DQXA 3GVVA 2PWHA 3VDAA 2O55A 4HOWA 4AIUA 1D9EA 1ZP3A 4YMZA 3NNTA 3WLRA 3UNDA 2XIJA 4GI4A 5JVLA 1PZ3A 2OLSA 2PDYA 3BSHA 3STFA 5TF0A 2NVAA 5I3FA 3G1DA 4J3ZA 1L2UA 2PDPA 1C91A 3G18A 2BOFX 4RW3A 3DC8A 1R2TA 2R14A 1BVZA 1HGWA 4ZVJA 1F3WA 2TODA 3M16A 4Z08A 1RPXA 4I8YA 2NX3A 5AC6A 3C3UA 1NFPA 3FA4A 3UY8A 2HSAA 3PWGA 4ATLA 3GNDA 1A3HA 1PUDA 3V5OA 4QCFA 2D73A 3HPSA 1UZHA 3MUCA 3GC2A 4NP7A 3FK4A 1KTNA 1OG6A 2PWGA 3PC0A 4O1FA 2GJXB 3CUJA 5E93A 2BY2A 3W7NA 4AFYA 3RIKA 1EZ2A 4S3GA 3XIMA 2DZUA 1TWWA 4PCPA 5AOUA 3SY5A 6REQA 2W3ZA 4H9ZA 3LS9A 9XIAA 1GOWA 3P93A 2FYMA 5LIYX 4QG6A 4GCAA 3MUAA 1SZEA 1MZHA 3GXNA 2Z1XA 1KFEA 3I7SA 3N04A 2DVUA 1RLDA 3BQ5A 4W7VA 4BQ4A 1WYIA 1YXDA 1W54A 1NARA 1ZBCA 4R7JA 5D9NA 1RCOB 2PDCA 3DX5A 1N8FA 3R58A 1UD5A 1VFSA 1EHAA 4QQUA 1NY1A 1POJA 1AQ0A 4AC7C 2OU4A 3GSMA 3RMEA 3UVIA 2Y88A 3QLDA 4N2YA 2O7QA 2O7SA 3F1QA 4LS0A 3S1UA 3BARA 1JNEA 2OX4A 1A4MA 1S3HA 5IHSA 1XIEA 1THFD 4XQ6A 4UOZA 4AZCB 1YNQA 4ZB2A 5HWJA 3O16A 4I9AA 5DBUA 1QOPA 2GGIA 4GI8A 4C91A 4RL3A 2PS2A 1CB7B 3RPMA 1YEYA 3QYQA 3UW6A 4GMEA 3TROA 3W1NA 2NLIA 3BW3A 3PAOA 3U5UA 4NZFA 2QCMA 3PS7A 1Q3NA 3G2GA 3PB0A 3QF0A 5GJPA 2YXGA 1EPVA 3CAVA 3NPXA 1AH3A 3KAOA 4QAIA 4D6GA 3SN4A 2QUMA 3A3WA 1ITQA 5F2MA 1L6GA 3KHDA 1MEIA 5KTLA 1KRBC 4GXPA 1VRDA 4DX3A 3R5EA 1OWQA 1NDYA 4W87A 3SUTA 3W3OA 3G1XA 4RLIA 1Q6QA 3H2FA 3EDDA 2A79A 3ES7A 4CNPA 3D0CA 4N42A 2OYLA 1H62A 1OCNA 4HMCA 4Q8WA 2P53A 3OHIA 1BAGA 5DCDA 3IWPA 1UP0A 5L6UA 3OGRA 5LA0A 5AZ1A 4DYJA 4ZQOA 1R86A 4K37A 3C2OA 4Q22A 3I3DA 4DF0A 2B7NA 4IJBA 3SSZA 5ABHA 1LOSA 2NT1A 4HVXA 1E9ZB 1KXTA 3CTTA 3GUWA 2PTWA 3DHDA 3EZ4A 3GTIA 1J0YA 1LDCA 1K9DA 4GYPA 1W32A 3H8AA 1W91A 2INZA 3GXFA 3NGFA 4FX8A 3IIXA 4PBFA 5H8UA 2ZWZA 3SUVA 3VIIA 2I5QA 4ADSA 3LRMA 2H90A 1GCYA 2QCHA 2CWNA 4DI8A 4NX0A 5D8WA 4IFOA 5A69A 3BLOA 3TYAA 4OOUA 3O07A 1X8FA 1BWVA 4BR1A 1VZWA 1V3IA 1WX0A 3T0CA 1SJAA 4O52A 5CZJA 1QJWA 2QV4A 1QUMA 4X3ZA 4U31A 4W85A 3AS2A 3TN5A 1AW5A 3SGUA 3IGXA 3PFRA 3A3HA 4A22A 2WZTA 1FWGC 4XV0A 4QISA 2O9PA 4U3CA 2HNEA 3WMBA 1X1ZA 3WFLA 5HWMA 5XIMA 3R25A 3AALA 3BAWA 1HT6A 3BTNA 4P7OA 4RE2A 3VNYA 2YIHA 3APTA 3GZAA 3IJIA 1Q8JA 3ARTA 3N9RA 3PZVA 4QLJA 5I6SA 5HA7A 3GG8A 3QZ6A 3SO7A 4AYGA 3ZR6A 3MUY1 3BMWA 2EPMX 5CPNA 2W67A 4XAZA 4GQGA 1IEVA 1KGUA 1LBFA 5FCZA 5F1VA 1V0NA 3VCCA 5C5YA 1UR0A 3MANA 1QFEA 5G4EA 4GO8A 3MYPA 3MT1A 1KFBA 4MZ1A 1O60A 1PIGA 1W9PA 1GVFA 1SZNA 1CXLA 1VPXA 4NKCA 3WH6A 3M0KA 2DSKA 3DYPA 2OT1A 5CLTA 2QYGA 3QZEA 3R12A 6TIMA 2VVSA 2VDHA 4D6JA 2OSYA 2ZZ3A 3EX6A 1Q6RA 1J5SA 3VCNA 4IOTA 2EAWA 4KWUA 3C0JA 3POHA 1FWAC 1ZAHA 2J75A 3WNKA 3H7UA 4TX6A 1UHVA 4WJXA 1EX5A 1N55A 4UTIA 4EACA 2I5GA 2BOGX 3WMSA 2PDLA 5H6HA 3PPFA 4FF5A 3NXLA 3F4NA 5KINA 4K39A 4DB7A 3CZEA 1E4MM 2ZTJA 2KZHA 3M64A 2E40A 2ZRXA 3G24A 3NQEA 3UERA 2WHLA 1SSDA 3CWHA 4QNWA 3A4WA 5D32A 2FGBA 3B03A 3TDFA 2WNZA 4P61A 4ECLA 3A4XA 3A3XA 3ABZA 3TKFA 2I5IA 3WNLA 3ALGA 3FXYA 1JCMP 3HG3A 4ADTA 2PEVA 2R1LA 3KEHA 4G1KA 1I8JA 2Z6JA 4Z2LA 3LXCA 1U33A 4IQLA 3QQ1A 2PI6A 3S2LA 1ALDA 3QV9A 2PP3A 1KBJA 1Q63A 4CD4A 2DVTA 4NNCA 1V6VA 1FP9A 4OVXA 1E4IA 3BOFA 1TE6A 5M03A 4NASA 3DFYA 1X6UA 2VUYA 1Z32X 3NIYA 3TQVA 2ZICA 1V5XA 1OK6A 3TZNA 4D6DA 4OU1A 1WB0A 5FF4A 1T5AA 1CGTA 4CNSA 3GW3A 4XZMX 5LGXA 2XU2A 1LG1A 1FCQA 1VR6A 1W3JA 1TJ2A 1V6UA 4DJFD 2DY3A 2XM2A 1IIGA 3S5SA 1VFOA 1KM4A 1X96A 2GUBA 4MPKA 1E6PA 2QF8A 4MUZA 1FQ0A 3TUUA 1L0PA 4W84A 5DY3A 1YBQB 2WWCA 4L6OA 2KAUC 1T6MA 3AROA 2Y5JA 3UEQA 4O11A 3AUOA 2IPWA 3NM3A 4GH3A 3L68A 2GJXA 4O1EA 2YX0A 1NM9A 1HO4A 1KM3A 1YHTA 3IVSA 1XIFA 8XIMA 1YPIA 4XAFA 1TSIA 4UQCA 2DT0A 4WR3A 3MI6A 1SJDA 3LTYA 2OWCA 4F9JA 1GQLA 4LVGA 1RQBA 1P0EA 3TN6A 4CQ8A 4IPNB 2NW0A 1Z42A 5U4NA 1JDCA 1T7LA 1QW8A 3M5YA 4AD1A 2GQ3A 3ANUA 1E1CA 4XUYA 4C1KA 3N29A 2HEJA 3N12A 5HJYA 3CHEA 1E1EA 1UKOA 4MMWA 3CO4A 1TWSA 1VLWA 1E72M 3P7YA 1JDDA 1Z3NA 4BF7A 1FCBA 2MUCA 1KD0A 3K46A 4OQVA 5JBFA 5F2LA 2VFHA 1BXNA 3RRAA 1GQIA 4U28A 3UP8A 3S1XA 2VWSA 1YKWA 3U4AA 2BXVA 1O5KA 2O4MA 1Z69A 1TQXA 3DENA 3ABQA 3TA6A 3M7SA 3GNOA 3VIFA 3QHNA 5LHFA 1YDYA 5HOSA 2ZXAA 4AZCA 3OTRA 3DG6A 3H26A 3SRHA 2GYIA 4KH2A 2VD8A 1UB3A 5G4WA 3LPGA 3NA8A 4UTWA 5TNVA 1RP8A 3K8KA 4QR6A 1XQLA 2C6QA 2X0SA 5BU6A 1KFJA 5J8LA 3IK4A 3VXGA 1YNYA 4ERIA 5FF0A 1BXBA 4BZYA 4H2HA 3GLCA 2V3FA 5ECUA 4F0SA 3KP0A 4LTSA 2JE8A 3CEPA 1DTUA 3IJDA 4N02A 2QVNA 4R53A 3W84A 4EX4A 4S23A 2V5JA 1A3WA 3CQ0A 3DKLA 2OEKA 2GJPA 3FIGA 3ANYA 5F7UA 3FAXA 1DJHA 1YTKA 3PZ9A 1HN1A 3L4VA 1E71M 1TJPA 2UBPC 2WMGA 4ZO7A 3WK3A 2R91A 5D9MA 3DKJA 3GTHA 1OC7A 4K36A 1CIUA 2ZXQA 2W63A 2CLHA 4ERGA 4LANA 1Y8BA 3E9AA 1U2YA 4L4MA 4U33A 3QY7A 3GTFA 2EXOA 1CDGA 3CWOX 2BXZA 3S46A 4YLWA 1AZ1A 1PXGA 3KTSA 2IUZA 1SO3A 2WMJA 5HNTA 5LGZA 4GFSA 3TWAA 1B2YA 1I60A 2AOSA 3P3BA 3VDCA 2ASHA 2AQOA 4PMXA 4M5PA 3B9OA 2ZDSA 5HMDA 4CKQA 2R9RA 1PV8A 4GCXA 1V3LA 3VD3A 2WWDA 1EZWA 1VPYA 4NYUA 4H8HA 3WF3A 3QMTA 1BD0A 2H3BA 1LT8A 1AFSA 1OX4A 2PTZA 3RN6A 3GK0A 3CB8A 1NFBA 2A6NA 3KWXA 2O9OA 3RF9A 3USZA 1LG2A 1BYCA 4QDPA 3DHPA 5KMYA 3WX7A 3I68A 3A5FA 1DL3A 3HFTA 1UWUA 4BWLC 3H2EA 1HNYA 3FY1A 1VENA 3B3DA 1PE1A 4GK8A 1I2QA 5H2ZA 4HU8A 2VEMA 5LNRA 3N11A 3LGGA 1GW1A 3EOEA 2WNWA 1UUMA 3F4CA 5K9XA 4NZ5A 3UCDA 5HDRA 5DLCA 1E6NA 3MUZ1 3PJWA 3P74A 4W89A 2Y85A 3QGVA 2WMKA 3VOJA 3PZTA 4W7UA 1UKQA 1B3XA 2O4QA 3FA5A 3W75A 1FBAA 3QPZA 1ZBWA 1OB0A 4QQ3A 1IT0A 2RJGA 3L0KA 4GBUA 4MM1A 1XLKA 3DIPA 1VJZA 1C8QA 4R85A 4KFOA 4A2RA 4HJFA 4IMDA 1KO0A 4DJDA 3S9IA 3G1HA 3BURA 3L2LA 1ITCA 3BVJA 3ONCA 1OFDA 3GHTA 4I8DA 4RNIA 4IFKB 4GJ1A 1D2KA 3WBYA 3VYLA 3LZ3A 1KWKA 4WXYA 1LLWA 4L80A 1GEQA 2WJFA 5FAJA 2X40A 1TVPA 3R79A 3TAOA 1Z8AA 4E8DA 3VGBA 4K8GA 3UWUA 1R3TA 3PN8A 1ZENA 4B15A 1EIBA 5I06A 5IFTA 2FJKA 2DFAA 4EVZA 1F4AA 2QULA 4D1JA 3G1RA 1VEMA 1DOSA 1TPDA 3VE7A 3VCRA 4Z17A 4O8RA 3PUDA 5I07A 2NV9A 4KWWA 1JAEA 3QEZA 3KVKA 3U7VA 3THQA 1SFTA 1CXEA 4FNRA 4XTIA 1RY8A 1TMHA 5I02A 1LORA 4PCSA 4GABA 2KX9A 2ZWYA 4TR9A 2GWNA 3PM6A 2BWGA 1JZ2A 3M0XA 3WD4A 4AD4A 2PWEA 2E5DA 4HNUA 4MTVA 4LC6A 1DXFA 4AVFA 1XIDA 1JCLA 4N7QA 3RM4A 3MP4A 1EGZA 1ONWA 2R6OA 3EX3A 1DIOA 1V3MA 1JYVA 4M7SA 4ICMA 3LNPA 4MNLA 4PMDA 4UNIA 4BA0A 2A5HA 2G8ZA 3SI9A 1J9YA 2A3HA 3IJ7A 4XBKA 2WCSA 3S83A 3WK1A 4LAKA 2JIEA 1TV8A 3GNXA 3R0KA 3LXAA 1E70M 4IHCA 2DSVA 1HKKA 4F0RA 2YCJA 1XSIA 1PSCA 1NOWA 4BHYA 3S1WA 2Q8ZA 3DFSA 2XISA 3WLPA 4ZOAA 3WNNA 4YYFA 5A6TC 1YBQA 3HG4A 3R1ZA 2E28A 4HCLA 4K1WA 2XGIA 1U83A 4Q7NA 3EKGA 4OJYA 4WUIA 4N9EA 2DW6A 4OV9A 5IBXA 5G2HA 1GOKA 1IYXA 1FWIC 1Y5WA 2F2KA 2F2HA 1DJQA 2NQJA 1JZ5A 3GD6A 4R88A 4M1BA 4YTUA 2WANA 2DSWA 4DBDA 4ZOBA 3V36A 2X09A 2Q09A 3NEHA 2HJPA 1UR4A 1OT1A 2VEKA 1TTJA 2POTA 1UA7A 3CIVA 3FOKA 2ZRZA 3CQHA 3RFAA 1NF0A 4JTRA 2PLJA 4IIDA 3LDVA 1WBJA 1X6LA 2XN2A 4B5XA 4PTDA 1K77A 1CLKA 1H7WA 1R3SA 2IQTA 2QUUA 4AD2A 1JZ4A 4K8HA 4KMQA 2DIKA 4OTKA 4JTKA 5HR7A 3AJ7A 1UYQA 2ACUA 1IWPA 4HA3A 3RPTA 2PP1A 3S2MA 4R7WA 3HGOA 3UG5A 1MDLA 3ALFA 3R4IA 1BHGA 5HJXA 3FA3A 1BPLB 2PC4A 4ZQNA 3GIPA 4YIWA 5I24A 5TAOA 1ISVA 1GYMA 3K5XA 2PF0A 4YNGA 3VILA 3QSTA 1C8XA 5D02A 2DZBA 4F2UA 2E6YA 4PA8A 1S5NA 3BG3A 1MW0A 4OUEA 1FFQA 4MWAC 1M01A 4JICA 4AZBA 4IFRA 2D1ZA 3L7RA 3ARRA 3BV7A 4PMJA 2G3NA 3BJTA 1KKOA 4LEFA 2WJEA 3WBEA 2J7EA 3CT7A 4UC5A 2JGYA 3WLLA 1F07A 2WBKA 4P8XA 3CIWA 3LQLA 4YTTA 2Z00A 3UCCA 2FZ9A 1MQPA 1UJQA 3DBNA 4EKJA 1SO5A 4F8XA 3AIWA 2Z24A 4S3CA 2YKKA 3VKAA 4S3FA 3N4AA 2PGRA 4HZ7A 4PUNA 4I6KA 3L67A 2OGYA 1WDRA 4RNJA 1W1VA 2OODA 4GWEA 2ZZ2A 1OINA 4W8BA 2ZRUA 3ENLA 4NL1A 1W3IA 3E0VA 1T8QA 3WLTA 2EF9A 1OYCA 1SFJA 4EPBC 2VC5A 5IRPA 4G56A 1FVPA 4V15A 5G1MA 4HPNA 4OFCA 4DBSA 5AECA 3O7UA 1G7VA 7ENLA 3LM3A 2PD9A 4PULA 1XYAA 2XH7A 3WLMA 3WO8A 1E15A 1ZGDA 2CLKA 4ZB5A 4B2DD 1OY0A 4ZQMA 3ARUA 3GNPA 1FCVA 3N4EA 2W61A 4E2VA 1TPEA 4IMFA 4W9TA 4LAOA 1R5YA 2DGAA 1S2TA 2FVKA 3T1GA 4MB1A 2P1FA 1V0MA 4D6CA 3W7MA 1LOQA 3OA3A 4O18A 3CUGA 8TIMA 4O0KA 4X61A 1YTEA 3MJMA 4RCXA 2CHOA 3EA3A 3AHVA 3GYCA 1L6WA 1XLAA 4XZLX 2PTXA 2XYLA 2FTPA 3SCSA 3P8IA 4HZMA 4XIMA 4KFPA 1QO5A 1A3XA 2HBXA 1J0JA 3R43A 2E68A 1ZUAX 4H4IA 2VX4A 1G4EA 1H2JA 3EPOA 4K2SA 4GD0A 1KV8A 3VINA 3GH5A 4M80A 2DH2A 2GOKA 2CNCA 4Y9NA 3TTYA 4DO7A 3HOJA 2Y1HA 4PEKA 1ZHAA 4DYEA 4UMAA 3URNA 1Q7ZA 3WY1A 2VXNA 1BKSA 2V30A 4JIHA 4J28A 4TMCA 4J27A 4R27A 1E51A 1PL9A 3TJIA 1QPOA 3NQGA 4LCSA 5HUOA 1D8WA 4X22A 3TYBA 3QKZA 4D8AA 2VWTA 3WQ4A 1Y5VA 2PLMA 1RSCA 1KR0A 4NZCA 1NWUA 3ZLFA 2JALA 3UZYA 2FPYA 1MFVA 3NZQA 4IFKA 3N73A 1QI2A 3GC5A 3KE0A 1UWIA 1XWYA 1EP2A 2DEPA 5ENLA 3HMJG 2JKAA 2OLAA 2YW3A 2BG5A 3C4UA 1B90A 1OGBA 3H70A 3GC4A 3FN9A 1ZFJA 1H7NA 1PX4A 3MMWA 1YPFA 4ADUA 1ME8A 1UUQA 1ZU8A 2E1WA 4KW2A 3FVDA 1Q65A 1Y65A 2PDGA 1S5MA 1SU5A 1UWTA 4KCUA 4GUIA 4LWWA 2DW7A 2YR1A 4WD0A 2GVLA 2CERA 3BLLA 1VPQA 1DJGA 2ZRWA 3HV9A 3WENA 2BOEX 3VUPA 1ZRQA 4W88A 2VGBA 4P5UA 3DYOA 4PCTA 2B7PA 2OKOA 1UD3A 4AMAA 2VFEA 1J0KA 2XFYA 3OGSA 3NL3A 3MQTA 3GFXA 1EBGA 2QDEA 4QM1A 1OCJA 3L12A 2CBIA 3DFPA 3W53A 1XYMA 5CG7A 1UG6A 1US3A 1ODZA 3F5LA 3C2RA 2QDDA 2A3EA 3STPA 2QJGA 2R94A 3SUUA 1OFQA 1PDZA 3LXBA 1EL3A 4M3PA 2NZLA 1D7FA 1GWJA 2ZA1A 3AMCA 4XKMA 4DAIA 3KRBA 1EHNA 4QJ5B 4N0RA 5DBTA 4MKNA 1TZ9A 2ISWA 2B81A 4G6CA 3VKDA 4DJED 3D46A 3W82A 4MDOA 1C9WA 1OVDA 4JTJA 3UXAA 1JVNA 1CBGA 2YJQA 2E5BA 1H09A 5TQLA 3NZRA 2WQDA 1WPCA 3P80A 3Q37A 4EE9A 1EXPA 1UD8A 3EB3A 1DJZA 1VC4A 3A9BA 4P7LA 4RNHA 2F6KA 3CB3A 5CZKA 1BF2A 2AQVA 2VFGA 4F0KA 3TV8A 3O0FA 4URIA 4Y2WA 1M68A 1HKWA 3ZZ1A 4TVDA 5CPTA 4HYWA 2WLYA 1MO0A 2HVOA 2X0YA 2IS7A 1Q6CA 2ZXDA 3W7KA 3C8NA 4G1NA 1K03A 4NXSA 1DJNA 4GNVA 3N19B 2BFGA 3M46A 1JXJA 2OT0A 2X1IA 4AX6A 1H51A 3NSXA 3DHFA 4NHVA 4QJ1A 4B5NA 3K8MA 1Q66A 3UZZA 4QP0A 3LB0A 2JEPA 3H7VA 3VDBA 2GFTA 1R0MA 5I7GA 3MI3A 3ZIZA 4U3AA 1SO4A 3KL5A 9RUBA 3NQ2A 2A1YA 1NSJA 1W3LA 4LXFA 3ZJ7A 4MLJA 1KBKA 2NUWA 2R8WA 1OC6A 3APYA 4HJWA 2VT0A 1XBYA 1HKIA 2PC8A 1CI1A 2NQZA 3ZT5A 4IGHA 1VLIA 4Q6JA 1JPIA 2BHUA 4M0XA 3MVTA 3AYVA 4LUTA 4JX6A 1VP5A 3GDKA 5LXEA 4DF2A 3N6JA 1QI3A 3AHTA 2GK1B 2YL5A 3VZZA 1AJ0A 3W7RA 3VKJA 1GZJA 5I2UA 4C60A 4WJ8A 1RZMA 1BQGA 2CPUA 2E3ZA 3NO1A 1FWRA 3CZ8A 3Q45A 4EP8C 1TJ1A 1O5XA 3MC5A 2WZHA 1GQJA 1UW9A 3GTNA 2Y70A 1J01A 2DZPA 1DHKA 3R0DA 4XBSA 5C55A 1W8GA 3STEA 1QW7A 1SW3A 4B5VA 3W76A 3VTRA 5HANA 1CYGA 1EC7A 2H8ZA 1ECEA 1WV2A 3H2CA 4QNEA 1W5PA 3B8UA 4YHEA 3QBUA 1A80A 3PVFA 1QNSA 2Z28A 2GZXA 3HJZA 4RDYA 5CBBA 3GNRA 3UPMA 5KZDA 2GPTA 3CU2A 3NZGA 1JZ3A 3LN3A 5KZ6A 3CPUA 3AI0A 1DHPA 4KGJA 1LQ0A 1Q6GA 1S2WA 3NQVA 4NNBA 3VIKA 1P6WA 3V0TA 3VM5A 3LBCA 2BZNA 1Q6LA 1QCWA 4D8ZA 1K6AA 3TSMA 4FXRA 1V3KA 4M24A 4R9OA 4RW5A 3KBWA 5FEZA 3IRSA 1SQ7A 2OCZA 2PSNA 7XIMA 3W7EA 4WY0A 3TK7A 5CZSA 4LS1A 2D24A 1ZPTA 4IIBA 3DFOA 3RPDA 4NRRA 3T09A 2SFPA 2PLKA 3BL3A 4PBGA 1GQNA 1Y7VA 5D30A 3D3FA 5I3JA 2BY0A 4LVDA 1UOKA 5FF3A 3P14A 3UFYA 2BSLA 4TQTA 2NQLA 1VQTA 3EOUA 2HZGA 1EP1A 2WM0A 2J7HA 2Y8UA 4DUVA 3LK6A 3RNDA 2CZDA 1ADSA 3ZXWA 2E6AA 4HA0A 4O16A 3JUGA 3G1FA 1MZRA 4G2DA 4V1YA 3RX4A 4GACA 2C14A 3W71A 4KGLA 4AZ6A 3CZGA 4ICNA 4P8UA 1P0BA 2GGGA 4AUBA 1AH4A 2ZKMX 3MB9A 4FOKA 4UTTA 2PWDA 1E3XA 4LBUA 1HF6A 3TTEA 3CO8A 3TVAA 1NWRA 4GX9A 3N17A 2VTFA 2BNJA 2E67A 2FHBA 1ZALA 3DI0A 4IUGA 2HS8A 3T42A 1W3HA 4CQAA 1YXYA 2W27A 3C56A 3A22A 3I6RA 1TJRA 3MDUA 3TH6A 2J8TA 4PUMA 1LLOA 1LP6A 5BROA 2QAFA 1K9EA 4IUOA 3N3MA 3VIGA 3L65A 4IMEA 2PP0A 1R3YA 4CD5A 2JGQA 5CSSA 2G5WA 1JF5A 1QPNA 4M19A 2ZZ6A 5CH9A 4MWAB 4HU0A 2ZRVA 2JK2A 2ATMA 3DC0A 2ACRA 3ID7A 3RU6A 3C52A 4RE3A 4Z2KA 4PEEA 2VL4A 1C92A 1SW0A 4OBRA 3MP3A 3L0NA 1XD0A 5JH2A 2ON3A 3PUEA 4D72A 3MHUA 4KRZA 4NYYA 5GVJA 1F2JA 5LNWA 2GVYA 3NCOA 1TKKA 2OQLA 1QWGA 1J93A 3JW7A 1EA9C 4J3UA 5AYXA 4W7WA 4X0VA 1VYPX 1JQVA 2PWFA 1OFRA 3PTDA 3WD2A 1WAWA 2ALRA 4YWIA 4DY1A 1E6SM 1OIFA 1TPFA 2WHKA 5EU9A 3A13A 2XVLA 4WKHA 4DI9A 4QDMA 2J25A 3VGFA 1X1OA 4PH6A 4O1CA 2YBTA 4RE4A 4JTDA 5DFAA 1F9CA 4AEFA 3HF3A 1L6SA 3LV6A 3CTLA 3MHFA 1R47A 1RQHA 3OVQA 4CVUA 5CSRA 3SUWA 3LMYA 3KBMA 3SR7A 1CX9A 2AKZA 1UIOA 5D2TA 4UXDA 3G77A 3CHFA 2VZOA 2PBGA 2V2DA 1YPXA 5K4XA 1KC7A 2XGBA 3A64A 1XLHA 4QSHA 4CCDA 4JTCA 4DZIA 4K68A 5I77A 3P84A 1XLJA 4NJGA 3UZJA 1S46A 5LNSA 2ISFA 4Y8FA 3LCHA 4J2MA 4HYRA 1XRSA 3AIBA 1E0TA 2OJPA 4DM2A 1W5MA 2CXEA 3FYPA 5HWNA 2PDUA 1Y0EA 3WL0A 4DZ5A 1OF8A 1TQJA 3HPZA 5B7ZA 4XK2A 3L4XA 2RFGA 1TV5A 2Y24A 3A4JA 4JHZA 3V35A 1XD1A 4JTTA 2XVGA 2RAGA 5FJJA 1RXOB 1UOZA 3UXIA 3NL5A 4ZB0A 5CPQA 3C5QA 2BVWA 4K3ZA 1S39A 1UA3A 3XINA 4L64A 3ARPA 4GYPC 3GYEA 1KFLA 3TOYA 1B3VA 1PKLA 1C8YA 1PEZA 2GWGA 1A5MC 1IHIA 4S39A 4YN5A 4E6MA 4JX4A 3N14A 5IHRA 5A2BA 3LPPA 4DAFA 2C19A 1AQFA 4O54A 4M8UA 1Z6KA 3CV6A 5I79A 5G2IA 1VYSX 4Q4SA 4E8GA 1V6WA 4GVIA 1H60A 4NRSA 1JRBA 1JJKA 4QROA 2QJMA 4F2BA 3YPIA 1ZS2A 3W1XA 2VZVA 4A8LA 3CAKA 3CH0A 2G0WA 4LVFA 4NSBA 3QY6A 5C9ZA 1H61A 4CNUA 2VR2A 1IR1A 3THDA 2IKJA 1PCWA 5GJMA 4E4PA 5ABEA 2ZTKA 3GBEA 3ORWA 2UY5A 4WCJA 3F7JA 3T40A 3WBXA 1K8XA 1N8IA 2G37A 1OZQA 5DELA 5H8PA 4FR6A 1ITUA 4QXIA 2REQB 1WOAA 2V3EA 4LUJA 3W70A 1O5RA 1R87A 1EH9A 1KM5A 1H1YA 2OTDA 5DO8A 1I2RA 1UP2A 4UR7A 2PDXA 3S2NA 2CCRA 2GK1A 3EOSA 2XFWA 7ODCA 3IIZA 1TR1A 2F6XA 4NAEB 1G67A 3A6OA 1SO6A 4L4LA 3QRHA 2OZ3A 3TW7A 2V5LA 3AUJA 3GH7A 1L9WA 3L0GA 1ISWA 4RV3A 1T8XA 4B92A 1VBGA 2V67A 3SW6A 1LWHA 5JU6A 4GUGA 3MBFA 1QDSA 1R3WA 1OT2A 2V2HA 3HGJA 3GNNA 1N2VA 4H41A 2QIIA 4UTFA 1DTNA 5A6BD 1XKYA 1J96A 1U5JA 2INEA 4Q4QA 2EG7A 4GZIA 1XKJA 4A3RA 2OWWA 4LAUA 2O9RA 1WBHA 2H9AB 2Q3RA 3N3TA 4JXCA 1P0NA 4QITA 2PZNA 4KFNA 4L61A 2AMGA 3V1PA 4A21A 2OEJA 4KQNA 3QR3A 4JY8A 1RHCA 2R24A 4A8IA 4MNKA 4B2DA 3UBPC 5DT7A 1UJPA 2E77A 3IAPA 1R2RA 1V7YA 4NI3A 2IPFA 4G9PA 2QGHA 4FSAA 1IV8A 1EO7A 1VYRA 3R11A 2D20A 1V6XA 6CGTA 3EEGA 3M7WA 1ZNNA 4H1ZA 1DJWA 2ZX9A 5B80A 3VNMA 4A8RA 4X2RA 1X97A 3K2GA 2E9MA 2XWEA 4D6HA 3HV8A 3NVTA 4F2TA 5MKGB 3CV1A 4QG9A 3RCYA 3QW4B 2CZVA 3PG8A 4AZHA 3VGGA 3MZ2A 2GVEA 5FJRA 4GBDA 2ZC8A 5AN7A 1YTDA 2ZUMA 4HN8A 3MI2A 2WVTA 5BMWA 2ZZ1A 1GEHA 4A8NA 1E1FA 1DXEA 2CU0A 4ZTXA 3S6TA 1JPKA 1SPQA 2EQDA 1XSJA 2WZMA 1M65A 3C2VA 3LHYA 3MDWA 3S5OA 1QOQA 1ZAJA 1UC5A 4ML4A 3M41A 1TZZA 4FLSA 4Z1DA 3WF0A 2ZX8A 3DGRA 1XF0A 5C70A 3S9ZA 4CQDA 2ZUNA 1A5UA 2ICSA 9CGTA 1BYBA 1WDPA 3QHOA 3W1TA 5CPMA 2QPSA 4B3KA 1ZSXA 2AAMA 1CLVA 1PJ9A 2GDUA 5HNNA 3ZJ6A 4Q6XA 3KOWA 1FWTA 1B9BA 2GSHA 2W4XA 3E96A 4GGHA 1V93A 4LQ1A 4IIEA 1EWDA 4KCWA 4C5ZA 2DT2A 1EOMA 3SQLA 1ZL1A 3PPGA 1J6OA 4MWAA 4IL2A 3SCRA 3PPCA 3URBA 4IQDA 4AC1X 1BTMA 4M29A 4C7FA 1LRTA 4CU8A 1NU5A 2E6FA 2V3DA 3LERA 1VB9A 2A85A 1EA0A 5FL1A 5HR6A 1I1WA 1ZY9A 1TZ7A 1Q6FA 1I0DA 1QXLA 2ZRYA 2JFEX 4FHAA 3GUGA 1ISZA 2PDMA 2X0HA 5IM51 3TA9A 5HUPA 1JYWA 4PB4A 3VDHA 1K9TA 3C0LA 3VGEA 3PZUA 1OM0A 5D4YA 3AISA 2QQ6A 5DCEA 3QC3A 4UTWC 5FACA 2DUAA 4ZQCA 1JCYA 3F2DA 3M0JA 4PB5A 4UTHA 1NQKA 2RJHA 3TLLA 4LV4A 1JZ8A 2A2IA 3VK5A 1H7RA 1RJRA 3TNOA 2CLOA 4J5NA 1FUYA 5FD0A 3VABA 5I03A 2Q71A 1US0A 1XGDA 3EA1A 3FX4A 3A9IA 2OXNA 2W5FA 4NX5A 4FA3A 2AL1A 3EBVA 5HJLA 5JMUA 1G5AA 4CD8A 3A4AA 3NDZA 3O63A 3VX0A 3H4WA 3GW0A 3HA1A 3WQPA 4EOUA 1R6WA 3RR1A 1MNSA 3ZYZA 1O7AA 2YGYA 3LLDA 1MRAA 4C6NA 2GLKA 1JR1A 1XDJA 2EPLX 1DWFM 4G5DA 4Z1YA 5K3VA 3LHWA 2WC7A 4LYPA 5FIPA 1HGYA 4GINA 4IISA 4EAMA 1AG1O 4PCFA 1XLIA 3HQPA 1KM2A 1SGJA 4A35A 5C9UA 1HP5A 2VZUA 2FQIA 3FJLA 4DZAA 4DJEA 4S3EA 2ZCGA 5T9BG 6XIMA 1K7EA 4C6CA 3NL2A 3UYIA 1J2WA 4E38A 4ZOEA 1JAKA 3GIQA 1I6NA 1S2VA 3SGGA 5LIKX 1H1NA 3ZT7A 4LVBA 3M5XA 1C8VA 1QU4A 2XVKA 1O6IA 1LF1A 1KBLA 3EWYA 3WEOA 4Q8TA 3HQNA 3DFNA 1IT8A 4MYAA 1TO3A 2D3LA 4EWJA 4PC8A 3INPA 4A05A 5DXXA 2NT0A 3R8RA 3MHGA 3RU8X 1KBIA 3AXIA 4HN4A 1M04A 1WXZA 4UQEA 4WX2A 2GVGA 3VM7A 1QWKA 1R38A 3GR7A 1T41A 3CGTA 3GY1A 2D0GA 3QV7A 3BAXA 4BEQA 2YA1A 5BOFA 4A3YA 3E49A 1C7SA 6REQB 3B9DA 2PDBA 3WQEA 3SFKA 4JTIA 4GXMA 1HQTA 3U5YA 4M81A 3Q2DA 2WPBA 4NF7A 5M17A 1HJWA 2OGJA 1PX3A 2HISA 4CN1A 4NIRA 3TTSA 1IEXA 1WUFA 4S38A 2G96A 2Z1SA 1CTNA 3M0HA 5HXMA 4HA4A 3W29A 3LCLA 1HX0A 5F4WA 1VF8A 2A4AA 3WUBA 4HOXA 2G97A 1EQPA 3BLFA 3H2OA 3OG3A 1E9YB 2X7WA 3JS3A 3UCQA 4ZGYA 5EYWA 3WH9A 2WHJA 4KETA 3LZ5A 3VOCA 2EPKX 3CJPA 4O4WA 1KNWA 1LTDA 1CXFA 1S5VA 3QFEA 5AHIA 1OGGA 5F1UA 3WH7A 1QPRA 1DWIM 3W02A 4FIQA 2ONEA 2WNQA 4R7OA 3N2OA 2W0UA 3WQOA 3AIRA 2CHNA 1D8CA 4RK8A 4JQ2A 4AD0A 3CYJA 2VCCA 3ARWA 1OX6A 2BVYA 3EX1A 5E09A 2G50A 1UMYA 1XUUA 2ODOA 2BP1A 1UZ1A 2X16A 2X30A 1EJXC 3VGDA 2H9AA 1Q8AA 2L5HA 4EIVA 1J11A 4JFSA 3NURA 1GHSA 3BQ6A 2XWDA 3CHCA 1R85A 5CZTA 3NXFA 4L65A 5AY7A 1MI3A 4AF0B 3L5AA 2IXUA 2CLLA 2R1KA 4B5SA 3TTOA 2QF7A 1P0KA 4HP5A 5CGMA 3HGSA 2ZYFA 4AY1A 1EBHA 1H41A 4AWUA 4AWEA 2X7VA 1B4EA 2BVDA 1E56A 2XH2A 3RGTA 3RMJA 3O3RA 3SGZA 1ZBKA 2V38A 2WVVB 1UKSA 3W1QA 5CGTA 3G3DA 1E0XA 3IVTA 4IM4A 1PAMA 4LUSB 3S5NA 2ZVIA 3E5BA 3GG1A 3NOYA 1XDLA 5F4SA 3CUZA 5M3WA 5MKGA 3GDLA 1XH1A 4JTSA 1VCVA 1PCKA 3CAQA 1UR9A 1AH0A 4M51A 1XLGA 1R9ZA 2NLYA 3HZ3A 5D03A 4FLQA 2TRSA 3ABOA 1VFTA 1IT7A 2YA0A 1G0CA 3PBUA 2XIQA 1FWEC 4DO4A 4QCEA 3PZOA 4GIYA 5IDIA 4X60A 3WD0A 4LU0A 1U5VA 5IXEA 5F2GA 3TE9A 4UTKA 3ZSTA 3HO8A 3K4AA 2Y6ZA 1ONXA 4JNZA 1RBLA 1LL4A 1TG7A 1KXHA 2WMHA 4LPCA 1IWAA 4F9DA 3TLQA 3B05A 1TV7A 3EA2A 5FJOA 4DNMA 2VDGA 3QGAC 3HTWA 5KZMA 4KEMA 4GYJA 1W9XA 2GGEA 1NDVA 4UB9A 5IBXC 1KFKA 1OEPA 3B4YA 1WZLA 1PWLA 3W72A 1QNOA 3I7RA 1FCUA 4Y7EA 3E0IA 1R46A 2CYGA 4F0HA 1LUCA 3MCNA 1F5ZA 3I6EA 1H7XA 2EPHA 5A8NA 1HW6A 3ZJKA 3SIMA 2F38A 4I5UA 1DWHM 1JCXA 1KCZA 4BI5A 4PR4A 3WELA 4CNNA 3W7PA 1EDGA 1UBPC 2UZ9A 4L4OA 3H23A 3ONBA 5HNRA 1Z7AA 1MEHA 5D04C 5E6ZA 1KB3A 4JCLA 2QUNA 3AYTA 4Z2IA 3R7MA 2IKIA 1SZGA 1KM0A 1X7IA 4O13A 3A24A 1E40A 5EMUA 1KM1A 1J0IA 1HL8A 1NOFA 3UESA 3ECQA 2RGMA 2VRKA 1OFBA 3NM1A 4KKXA 5FA5A 3TQ0A 3P0XA 3TP4A 1ODUA 3GB6A 2B4GA 2Z27A 1OK4A 3PSWA 4NJIA 4GI9A 3I4KA 1JZ6A 5AKQA 2TMDA 4XZIA 3WJZA 4PRWA 1A0EA 2GDVA 2OEMA 2W91A 3WZ0E 1EF2A 2NWRA 3AIQA 1NOUA 4OZOA 4NNAA 3DEQA 2VC7A 3WDPP 2EEXA 4ALDA 3GVGA 3K8LA 3WSUA 4HPXA 3DXIA 4H9YA 1IEQA 3U7BA 4KT2A 4ORMA 3HU7A 4UQ9A 2CIPA 3B8TA 2B7QA 4WRHA 2WKJA 2BDQA 1K4GA 1RJPA 1KM6A 3QW3A 5FEXA 1ICQA 1AMKA 1Q6OA 3UWYA 7CGTA 5J5DA 4OBTA 3ITYA 1YIXA 1EF3A 3QHMA 4OWGA 1RP9A 3IAQA 1DWAM 1UH2A 2F84A 3AMDA 1XICA 4YYCA 1M1BA 2OFJA 2FMOA 4QEEA 1YADA 2YCLB 4JBRA 1VFUA 2PDNA 4Q7IA 3LGEA 3U2CA 2VKZG 4C6IA 2E8YA 3HG2A 4FALA 2OR2A 5HATA 2IKHA 3PZIA 2AAAA 2PUZA 3U2EA 2X05A 3V7PA 1WE5A 3MBDA 2WOQA 3QYSA 3DYMA 4X9SA 1ONRA 4Z2JA 1K8CA 2E25A 3RCNA 1Q7MA 3RXZA 2YFNA 1SYTA 3FCPA 5CC6A 5C9XA 1TWDA 3W2KA 2J9YA 3UWVA 4JS3A 3T0DA 1H4PA 3PY2A 3TOPA 1NH6A 3SN1A 2VGFA 3ELFA 2ACQA 3BJSA 1DIEA 4NZ1A 3O6CA 2ZZ4A 3CMGA 1MW3A 4TX9A 4AZGA 2GGHA 1W8SA 5TBOA 1HKJA 1SW7A 1ZB5A 4IIFA 1C93A 3A23A 1LLZA 1V77A 1GHRA 2FZNA 1FXPA 2HWGA 2DUZA 2P5NA 5EMLA 1QHPA 1P6CA 4KCTA 4L6DA 1B9ZA 4HU4A 3VE9A 4UFJA 3C61A 3F2BA 2EJAA 4GJJA 1YYAA 1DXIA 3WH8A 4Q33A 3TX9A 4H7ZA 4YVVA 3NOEA 3AIEA 4L6HA 4IJRA 3N25A 4X0NA 1GVOA 1E1CB 1OF6A 1XW8A 3LMZA 4XZNX 1EYEA 1YW1A 3QMSA 1WZAA 3CXOA 3MKKA 3V4BA 2YDAA 3F5JA 1BF6A 4LNYA 3A47A 1F05A 1RY0A 4S2BA 5JUVA 3IIOA 4DF1A 3B9NA 1BGGA 4B91A 4FNTA 3VU2A 3TR9A 3ARYA 1RA5A 3GAKA 1XP3A 1KGWA 4H9XA 4GNKB 1S2CA 3S2JA 2ESCA 4QLLA 3EXSA 2BBFA 2Z0IA 4JCMA 2NSOA 4B5TA 4BQ2A 3WLQA 3PF3A 4IF2A 3RLVA 3TYUA 4ICCX 1B54A 4WKFA 1TX2A 4O50A 4RNFA 2FIQA 1F73A 2CLEA 1TPVA 2QNEA 4C6PA 4IP4A 1W1A1 4GVGA 4PYSA 2W92A 1XFCA 1GTEA 1GVSA 5LNVA 2VVNA 2WSKA 3B8WA 3ZS4A 2YBUA 3KLKA 2GJRA 4PL2A 3MU7A 2Z7GA 1GT8A 2Y8VA 4AIBA 2HVNA 1IZJA 1BKHA 2Z2AA 3GXMA 5U7SA 3H21A 4TMBA 1GKRA 4CVWA 2P3ZA 3NYDA 4OHQA 1NQ6A 1DKWA 3NQCA 4MY1A 1XBVA 4AF0A 1HL2A 3OW1A 5CPLA 3PZMA 3G8EA 3DFHA 3CNYA 3W2UA 2C13A 3CPRA 2ATSA 2VFFA 4AW7A 4WY0F 1ZCCA 2Z4GA 2FFCA 4JTUA 3U3HA 2JIWA 1PS9A 3CS2A 5C2CA 4HK5A 2WVVA 4JTHA 4AYSA 2GSEA 2Q6ZA 4D6FA 2NUYA 3BOXA 2BMBA 3QXBA 3PFMA 1XGEA 4LUSA 1TIWA 1QI0A 1YNPA 1RR2A 4Z0JA 3LM7A 4H9TA 3RDKA 3W6LA 4CD7A 3W23A 4LCRA 1H7PA 1B31A 5FEWA 4H9VA 1XLDA 3VKCA 5A6MA 3O05A 3DBPA 1KCLA 4G7FA 1M6JA 3DCPA 2HXUA 2R1PA 2QT3A 2C7FA 2PCQA 3ICJA 3MKCA 2QCNA 3T05A 2ADAA 4DQWA 4Z2HA 3MUIA 3HURA 2CFFA 2XH4A 1UQZA 1OX4B 1VFLA 4HHPA 3T44A 4Q4KA 3EMQA 3LTSA 3UVAA 2CLMA 4IGSA 3BCDA 3RJXA 1XBZA 2EG8A 1J0HA 4JX5A 4RXFA 2J7FA 5A8GA 2D2OA 4PUWA 4HNCA 1KQZA 2YBVA 3NSNA 4ASTA 3L2MA 2ABAA 4PTNA 3G3MA 3C86A 1G6CA 4GRSA 3STCA 3NJ3A 1SR0A 1I2PA 3T0TA 2DT3A 3BO9A 4FF7A 4WDUA 4E2BA 4LH8A 2W66A 4DWDA 3QLLA 3QM3A 4NVTA 4GZ7A 4J3SA 1P1XA 1JL8A 3KVMA 1QI5A 4LC8A 1XC6A 4M7TA 4XSMA 3F4DA 3BSGA 1S5TA 4A3HA 4PUKA 3HN3A 1CXKA 2WVSA 1HVQA 3ABXA 5CKSA 2WAGA 2J77A 4D2JA 4AH7A 5A1AA 2E9BA 4POCA 5JXQA 5FSEC 1TPUA 2C15A 2QV5A 9XIMA 1DIKA 4O57A 3LRLA 3AZRA 4GGBA 1TR9A 5DMNA 3LENA 2WCAA 5CJ5A 3NPWA 3MTWA 1F6YA 1B5TA 2WXDM 2QPUA 2YDQA 4HQVA 4ZO6A 3N4FA 1G1YA 4JIQA 3GXPA 2DIEA 4P7QA 2DSZA 3CL6A 1BG9A 1TJ0A 1WKFA 2XDFA 4GKLA 4MOZA 7TIMA 2V8ZA 4F4RA 4JTEA 3RJYA 1GVQA 1IXOA 1P7TB 4E5TA 3SRFA 2NVDA 5EPDA 1IGWA 1FY6A 3R94A 1RV8A 4NJJA 3WEZA 1BLIA 1FRBA 3UWZA 1Q2RA 1FWSA 2W6RA 1PZ1A 1R3QA 3EEZA 3GDBA 3B40A 1GVRA 3QSRA 4IIHA 1QO2A 3MSYA 1WAUA 3FYOA 1E43A 1V02A 1VFMA 5T91A 2BX7A 1XQKA 3EX4A 2YCLA 5I00A 5A95A 3VMNA 3UNTA 1GK8A 1XLBA 3UJEA 2YCIX 2OQYA 1I2NA 5CZ0A 1RAKA 5AHEA 4LX4A 3VFCA 1XFBA 2FVLA 1JQXA 1XS2A 3W7QA 1EIXA 5DMLA 4LYRA 1UP3A 5M5DA 3SRDA 3BK0A 2Y61A 4IIGA 1EDQA 5D8ZA 1FKWA 3GX9A 3M0IA 2Y62A 4FR1A 1DWJM 1XINA 2E8ZA 1K9FA 4HNOA 3QTPA 1XYZA 3M4HA 3CUHA 3IVUA 1PPIA 2FDMA 1FH7A 1UWSA 3UJSA 1EX1A 2YB4A 2IQDA 2ISSA 3QN3A 4US6A 2VHLA 3BAIA 3IK2A 4GZJA 2UY4A 3UPWA 2QGYA 2VM8A 4RPPA 2WSYA 3WNMA 5KSWA 1RBOB 4LB3A 2I9UA 3U4FA 2VJXA 5CPSA 2XTKA 1FWBC 2X2YA 3CYVA 1ML1A 1PX8A 4MJ2A 5AC7A 3NPUA 3USBA 1GZGA 4EXAA 2F6UA 1IZCA 1TMQA 4BKNA 3STGA 1QRQA 3FSUA 1O5QA 2QR6A 4FXFA 5FOOA 3RK8A 5E6YA 4F3HA 1W1ZA 4C1NA 3ITLA 1S2UA 2VI0A 3T81A 1J79A 2DORA 3LX9A 5EMMA 1UH3A 1ADOA 3T55A 1NEYA 3PG9A 4FXJA 3FKRA 2QCLA 3GVQA 2PLCA 1W1PA 1EDTA 4HK7A 5BRQA 1ZTVA 3K4DA 4FNQA 5FJIA 2OSWA 2ZC1A 4H83A 4GYKA 4C6EA 3IS4A 1C90A 1LL6A 3CC1A 3M43A 4AG0A 1GQKA 3MVIA 1GPWA 3EMCA 2VFDA 2Z26A 2F7FA 3CLWA 1YXCA 3T9PA 5C9WA 1JXKA 2B0MA 1XXXA 4UTTC 3ARQA 1V6TA 1VIWA 3W27A 4QE4A 2V68A 3NQBA 1FA2A 1IXPA 4HHLA 3EOLA 2NSXA 3WF1A 2W62A 5CPOA 4QS6A 3CLMA 1BWKA 4DWSD 4DLMA 2A6LA 3L5LA 1JI2A 4I90A 4R9XA 3WQ6A 3A5VA 2Y5SA 1CGWA 2XH0A 2YW4A 3GS6A 5G4HC 3AU6A 4XISA 1GZ1A 1SR9A 4PBEA 2C8NA 1SUXA 3M5VA 3IV8A 4KESA 3PBMA 1V02E 3QY8A 4GXWA 3VMPA 4JN6A 3GZ3A 3VD7A 3OQ8A 5D2VA 2XM1A 2ABBA 1EYWA 4PMYA 5E0CA 1HJUA 3L4YA 3G1VA 2RUSA 4JTGA 2FMNA 1JFXA 2R1NA 4XUGA 2MNRA 4F79A 3BWWA 5EBUA 1MUCA 3WKZA 4MFEA 3O6YX 1M03A 3PUOA 4QIUA 2EGZA 3OIHA 1FXQA 1ZAIA 2XIIA 4RDZA 3L21A 1FDZA 3L66A 1JPHA 5DT5A 5AYBA 3UA3A 5HMSA 3V5FA 4O15A 4U4MA 1M41A 3VIOA 1XIGA 2FPTA 2XIBA 3P5YA 1WNOA 1J0ZA 1XV8A 4LBSA 4YU1A 3K1DA 1YDVA 3RO6A 3T8LA 3UR2A 5BMXA 4IL0A 1D3GA 4LRSA 3LCXA 2Y7FA 3B9AA 3VVGA 3SQMA 5BRBA 2C3ZA 2FGLA 1E0VA 3KOZA 5AZ0A 4K1GA 3AU2A 3KOFA 3EOOA 4IQJA 2WJZA 1I0BA 1W0MA 1ICPA 2HRWA 1GYLA 2HK0A 6ALDA 3W2MA 4LVAA 1W5OA 3OBAA 4RZ6A 5TIMA 4L1XA 5BU9A 2X1TA 2TPSA 2D2GA 4AHOA 5CBIA 3G1YA 4IH3A 1JEZA 5HMFA 3BSMA 3JZUA 2CZFA 4I9MA 4QS5A 7A3HA 1A5KC 4IGMA 3CHDA 3ZQ9A 1R3VA 2F8QA 3UWQA 5D05A 3UWWA 4ZCWA 1Q7QA 4YVXA 1HJXA 1I45A 5AYZA 1RLCL 2GDQA 4AZ5A 4IPPA 2CEQA 2PA6A 4GIRA 1CECA 4UCGA 2OQHA 2Y5EA 1VJSA 1A5OC 4HOZA 2WZIA 1GUVA 3WUGA 1TB3A 4C6QA 4TTUA 1PTAA 3BZGA 3WQ8A 5CQ1A 5G2WA 4JHMA 3VIPA 2W79A 3W7LA 2D0FA 1PKYA 3KFTA 4DN1A 2J78A 4GJIA 2BS9A 3B9EA 3EWBX 4DZHA 5A8OA 1RVKA 4DXVA 3WUFA 4PTWA 4HT3A 1G4PA 1XRVA 5DX7A 2NQ9A 2C91A 3DG3A 1K1DA 3QR1A 3AOFA 3GDRA 4JD4A 3OVPA 3RLHA 2QJHA 3GBDA 1RD5A 1OD8A 2F61A 2PGEA 4ZMGA 4NZJA 1VEPA 2HBVA 5FL0A 5EGRA 4Y90A 4QE1A 1EJSC 3UPBA 3E0FA 3B8DA 3ERPA 2PFHA 4ACZB 1FWDC 1ZJAA 3J7HA 4GISA 1XYCA 4GUHA 3O1NA 3KCJA 4V1XA 4PN2A 3PAJA 5C2XA 1PHQA 4C6KA 5LA2A 3KZSA 1DYSA 4BQ5A 4ZFCA 2HQAA 1W2PA 3W2NA 4N9BA 2V3GA 4HMNA 3W7HA 1UMLA 1HJQA 4A3UA 4GQBA 1G9HA 3MWAA 3VNDA 3VO0A 4Q4RA 3H4GA 3LHUA 3AHXA 3KS5A 2BASA 1P7TA 4WEVX 5G1YA 2FVMA 4LRTA 3JVAA 3E6EA 1UIPA 4FS9A 3SY1A 1G7UA 2Y63A 3EDKA 4FPSA 3W7JA 2A7NA 3S6DA 1US2A 1GGOA 1NP0A 3BAYA 4Q8VA 5A5WA 4XAPA 1AJZA 4EPDC 3TSDA 4ZOCA 1HJSA 3NTYA 2E5CA 4EF9A 4RDWA 4Q3MA 1F8IA 2YFOA 5BRPA 3LA4A 2Y4SA 2ZFAA 5MF5A 2UY3A 1UROA 4NU7A 4Q4PA 3HGRA 4PUEA 3U0HA 1FDYA 1NAL1 4WSHA 1XJBA 3RX2A 4E2DA 4MGGA 1FHLA 4LF1A 2NXHA 1L6FA 4UWMA 4UTMA 1TTIA 3AMGA 3VD9A 4F66A 1M53A 3T2QA 4C6DA 5I78A 1GJUA 3V0UA 2J79A 2VQUA 2A3AA 3PR2A 4PL1A 3B0UX 1J18A 3VIMA 2HROA 2R82A 3RO8A 2OPJA 2FB3A 3OG2A 3T07A 3GG0A 3C6CA 4A4AA 4KRUA 3W83A 5AFDA 3SADA 3I3BA 3WQCA 3HPFA 4ATWA 4Y8EA 3QPYA 4JIPA 3BE7A 1W1IE 4ZA0A 3WDHA 3O0KA 2VX6A 3DECA 1O66A 4A3QA 1XYLA 4J2PA 3F4WA 3PNZA 2CBVA 2CKSA 4PSPA 3QJAA 5H1WA 1XCWA 6XIAA 3P67A 3R89A 5KETA 1MRQA 2ZXBA 3CUXA 2QZRA 5KZEA 1P5BA 2EPOA 4JZ5A 3EAUA 4JFTA 1O95A 1K6WA 3OZOA 1KCKA 2XHYA 1EGMA 3OLIA 2XZ7A 3W7GA 1JD9A 1P1MA 2OELA 2WO5A 4AXKA 1E0UA 3LEPA 3TJLA 4RKAA 1S38A 1CPUA 4DJDD 2BVTA 3TMLA 1UPPA 4DXXA 2HTMA 1ISYA 2G95A 5GJNA 3PB2A 2EBNA 2YXOA 4H9UA 1KRMA 3UJRA 5CC5A 4EPKA 4E3TA 4PRTA 1XIIA 1VKFA 8RUCA 3B8VA 1GJWA 2OOGA 3KM8A 4XBJA 5LA1A 4CD6A 1N7KA 2D2HA 4J3XA 3EPMA 3GIYA 3OB8A 4TIMA 1GOMA 2WMFA 3ITOA 4M6PA 4DO5A 5LIUX 3WJYA 1M7JA 2QCGA 1MQRA 1JGMA 1GONA 2HMCA 2PDKA 4Q8UA 3CMFA 1TWIA 3NL6A 2Y7EA 1H49A 4MFDA 1WKEA 2HS6A 1E6ZA 4B9ZA 5CEWA 2GJNA 2DIJA 4IGNA 4UOJA 3WLJA 4LUTB 1XG3A 1DEDA 1E6QM 2ZE3A 2XPKA 4WHBA 1AVAA 3DUGA 2XSBA 4PMUA 3FDGA 3OBEA 3EMZA 2O0TA 4Z1AA 3F5KA 1P6BA 2WPGA 4W5UA 3QR0A 5T8GA 1MXGA 5HQEA 3KP1A 3UETA 3GAYA 1BYAA 2FDSA 4W8LA 1A5SA 2C0AA 1DIDA 5GPRA 1D3HA 1M9HA 1S1PA 1H3GA 4YS1A 3QZAA 1PZ2A 3NQAA 1C7TA 2HDJA 2JBMA 4L9YA 1CXIA 4O0QA 3O15A 1TMLA 4XVEA 3UJFA 4O14A 3AXHA 4Z42C 5D9PA 3BMXA 2QHAA 4IX2A 4S1FA 4F0MA 1U1UA 1XCFA 2Y2WA 4HU3A 4U5IA 1PWMA 3AYRA 3SJ3A 1OYBA 1YX1A 4KPLA 1OCBA 1JGIA 3MV01 4MY9A 3TCEA 3UGRA 1Q45A 2V5DA 4A2SA 3M0ZA 1MYRA 3KRUA 5HINA 1KFCA 5CLWA 1WDWA 4JY9A 4QG8A 3TCSA 3MUXA 4MUPA 3BUVA 2G3MA 1L8PA 5AVHA 1MUWA 4P7NA 4OOZA 1NWSA 3B0PA 4DBUA 3FEQA 3G0UA 3IARA 3SCVA 3TC6A 2GUUA 1GOQA 2QMJA 1RA0A 2VCBA 3BZJA 4DO6A 4TO8A 3E0WA 2C0HA 4WGHA 4WY0B 3R10A 5FAGA 1XHGA 3RAOA 4ZENA 4DJEC 3K1GA 4ZO8A 3SURA 1VCGA