1QK0A

Cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
b'TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk0A00
1HGWA 3VOIA 3VOGA 2BOEX 1OCJA 4I5UA 1UP2A 1QK0A 4B4HA 3VOFA 3VOJA 2BODX 4AX6A 4A05A 1OC5A 1CB2A 2BOFX 4I5RA 4AVNA 1UP0A 1HGYA 2BVWA 3ABXA 1OC6A 3A64A 4AVOA 1GZ1A 2BOGX 4AU0A 4B4FA 1UP3A 3VOHA 4AX7A 3RU8X 1OCBA 3A9BA 1UOZA 1DYSA 1QJWA 3RPTA 1TMLA 1BVWA 1OCNA 1QK2A 1OC7A
chains in the Genus database with same CATH superfamily
2CLLA 4ZFCA 5I3HA 3WEMA 5FOOA 2WHMA 4CEXC 3TZNA 3MKVA 2B31A 4FF5A 5HJLA 1VEMA 8XIAA 1EJ7L 1KRCC 1GJUA 5CZ0A 3RLHA 1CWYA 3VFCA 4XD6A 5F7UA 3WUGA 5BMWA 4XD3A 3SDOA 3EAUA 4B5TA 3URAA 1H7XA 3RX4A 4IHCA 1SFTA 4JQ2A 2OZ3A 2NWSA 2YCIX 1E6QM 1KCZA 5CPQA 1EA0A 1LRNA 1PDYA 3W02A 4JEQA 4D9PA 1T0OA 5EMUA 1KGXA 1OFEA 1VFOA 1IGSA 4HOZA 4O4VA 4AY7A 1S5VA 4WDXA 3SN0A 2QAFA 3I4EA 1UD2A 1CGVA 1I4NA 3OB8A 4N4PA 4QG8A 1V79A 1B9ZA 3JW7A 4MJ2A 1VFHA 3AYRA 1UWIA 4QE4A 3RG6A 4H9TA 3L4UA 2VJXA 1PZ0A 5CPTA 1E0WA 2Z1VA 4MIMA 2O92A 2ZRXA 2REQA 1OEPA 3A4XA 1V3JA 3GG7A 2F6UA 1M5WA 1NWSA 2ZXDA 1E1CB 4GQQA 5A8PA 1U5JA 1XLBA 1M03A 1JF5A 3U2EA 3QV7A 3VM7A 2Y61A 3NYDA 2FGLA 2WPGA 3NTYA 3LHYA 3WK2A 1VJSA 1JNEA 3ES7A 2Y2WA 3UGVA 3HOJA 1PKMA 4TX6A 2QV5A 3LPGA 3MMTA 3P6LA 2DZXA 4IWWA 6PTDA 4YNGA 4K38A 3BAWA 1U83A 3ARRA 4DZIA 3TYUA 4CNNA 1UKOA 2BOEX 4RDWA 1W2VA 1R2SA 2P10A 2FJUB 1LL4A 3FSTA 3TXZA 3UNTA 2FZBA 1ZP4A 1GK8A 2RGMA 1B3WA 2Y62A 3Q58A 3MKKA 3GLCA 3NFUA 1ADSA 3QZEA 1GOQA 1KRBC 2E28A 4PEKA 3PSVA 3UETA 3VC6A 3XISA 5IM51 2JE8A 1UZ4A 2PTZA 3GYEA 4HK7A 4WJ8A 4S3AA 1XL9A 1C90A 3ERPA 2NUWA 5LXXA 1OK4A 4PMOA 2QW5A 4FB7A 3TR9A 1JXJA 5FAGA 3NAVA 3QPYA 1E51A 3MSDA 1O66A 2W66A 4B5VA 3DFPA 2HBXA 3M0IA 4GRSA 1AW2A 3UY8A 2ZZ6A 2TYSA 1DJWA 1HKWA 3EZ4A 2ZA3A 4ZXOA 1GORA 4OUIA 5D9PA 3KFTA 5I3JA 4PMVA 1FWFC 4W7VA 1E1CA 1WX0A 3E38A 5AC8A 2YCLA 5BYWA 4KS0A 3AXKA 1DHKA 4YVVA 4O13A 4XX6A 1GZ1A 4GI4A 1EXBA 2Y0FA 3U2OA 1HVXA 3LLDA 1XGDA 2WV8A 2GDQA 1Q63A 1DJQA 4CD8A 1DQUA 1F74A 2PB1A 4HQVA 3ABZA 1C8XA 3WF4A 4NNBA 2QCNA 3W7PA 3LNMA 4OV4A 3NZGA 2XSAA 2X0HA 1AODA 3N3TA 2GUYA 2DSWA 4QJ5B 1E0UA 5KZEA 1OCNA 3UVIA 1Q6GA 1XDLA 3AIQA 1EHAA 2ZXBA 4B4HA 3W7DA 2J7CA 5ABFB 4LVFA 5FEZA 1J0JA 3GVGA 5F2LA 4BF7A 1OCQA 4B5WA 1E5JA 1YADA 3CZKA 3WBAA 3VZZA 1XH1A 1O5XA 1B5TA 4HHLA 3DECA 2QT3A 2GPTA 4A8RA 4JNYA 2QIIA 1XGEA 4F0SA 1BYAA 1UG6A 2HMCA 1IF2A 1EIBA 5D2TA 2XFYA 4XZ9A 2CLMA 1WNOA 3IV8A 4Q33A 2XH0A 2YKKA 5HWNA 3GE7A 3HU7A 4E3VA 4Q4KA 3ABRA 2ACUA 1PEZA 3W1NA 2ZBTA 3WMCA 3JR2A 1IZJA 1EC8A 4GIAA 4A21A 3WENA 4OOZA 1DORA 5EYWA 4GQRA 1P4CA 2QZRA 1KNWA 1JAEA 3AZSA 1J96A 2Z4GA 1QHPA 1RCQA 2F38A 2GUUA 3TXVA 3VIKA 3GG1A 3DFSA 1MEIA 3ZT6A 1DE6A 5JUVA 5TIMA 3EMZA 1XICA 3OQ8A 5IHRA 2D3NA 4KMQA 1TA3A 4J27A 3GQYA 1L2QA 3EKLA 4WZHA 5IXEA 3LCHA 3KX6A 3O63A 1C7TA 1OYCA 3TTQA 2YOCA 1G6CA 2ZUNA 1F6PA 1V02A 2AOSA 3H55A 5KTLA 3CUGA 1JULA 1RCOB 4GABA 3M0MA 3UWUA 2VGGA 4KWOA 2HZGA 1FDJA 1GVRA 2A5HA 4GJIA 3UXIA 4AD1A 3B0VC 4AC7C 1US3A 3P84A 4DUXA 1T8QA 1WAUA 2DSUA 2EF9A 1XC6A 3EOUA 3CUXA 2OEKA 3CMFA 3MYOA 1O5RA 4OE7A 3AS1A 3GDBA 4QJ4B 1EZWA 4XBKA 3EX3A 4Z42C 3T05A 5GJMA 4IT1A 3QMSA 3GXMA 2FZDA 1FCBA 9XIAA 4BZYA 1GYMA 1MRQA 2X0SA 3HJZA 4Y7EA 5ENLA 2RJGA 1KR0A 3VXGA 4AZHA 2FTYA 3G1SA 3LG3A 3BQ6A 2X1RA 2VEMA 2I5GA 3S1VA 3W7OA 8A3HA 4YYFA 1YNQA 1I8JA 4PCNA 2DV0A 1EB3A 3WY1A 3N34A 2YA0A 4NP7A 4AG0A 2BHZA 3VIMA 4JX4A 1R3WA 1XIHA 2I7GA 1C7SA 2PA6A 1MNSA 1SU5A 4F0RA 2WW5A 3AIVA 1G01A 4MY8A 1L6GA 3MUIA 2SFPA 4TMBA 4DJFD 1PVNA 3GDRA 2RGLA 5DT7A 3CHVA 4Q4RA 5T9BG 4IL2A 3SEPA 1TJ0A 4DQWA 1LWJA 4KW2A 3TR2A 1DL3A 1R47A 1OD8A 2WSYA 4H8VA 2QDEA 3II1A 4I9TA 1J12A 3HGRA 4UFLA 2V30A 1A53A 2RDWA 4FR6A 3BUVA 1M01A 5A6JA 1U30A 2YFNA 2WMGA 2E6DA 1I2NA 4UNIA 3H4GA 1LWIA 3CNYA 3O0FA 3LERA 4AAJA 3B8VA 3E0FA 3HV9A 4JTAA 4MKSA 4FK9A 2Y5JA 2X42A 2Y7FA 4GY7A 1H1YA 1V6VA 3TU9A 1JDCA 1M9HA 2IPFA 3RPMA 3NO3A 3W71A 1EJSC 2QCCA 3PNUA 1VH7A 3WL0A 5JQ9A 5H6HA 4WEVX 1OADA 4V27A 4UR7A 2V38A 4KRTA 4GVGA 3PPHA 4LCRA 2Z2AA 2WVSA 4AIBA 1FFRA 3AS0A 4XBJA 1CENA 3BAIA 3WX7A 4XAGA 3WH7A 1H4PA 2Z24A 2JQXA 3GY1A 1LUCA 1MDLA 4AY1A 3VOCA 3L12A 2BSLA 4OVXA 4D72A 2D1ZA 2H6RA 2BB0A 3ICJA 3IJ7A 4GIRA 4PCSA 1WZLA 3W37A 4AIUA 3S3GA 3UNDA 4IGSA 5C9ZA 3MUZ1 5I77A 4A29A 2E8ZA 1NFBA 1BSLA 4RCXA 1E56A 1WPCA 5DMNA 2V5LA 3S1UA 3KZPA 2XUCA 2O56A 4K68A 1H7RA 3LPFA 3M7SA 3WNKA 3PZOA 4MLRA 3VOFA 4BK9A 4OFCA 1V6UA 3FEMA 1TFVA 1MUMA 4DJDD 1ZLPA 4G1KA 3L65A 4S3FA 3EB3A 1MYRA 5HANA 2E0PA 4A8LA 2QQ6A 1N2VA 4A3HA 1H0IA 3I3EA 3PUEA 5ECUA 1N8FA 4LB3A 2DIEA 1KXQA 3UY7A 5BNKA 3EBVA 4AX6A 2PURA 2PDHA 4W8AA 1F6KA 2GGEA 2XDFA 4WGHA 1MQPA 3G1HA 3S47A 2V3GA 3BCJA 3WJSA 1QXLA 4M8UA 3E5PA 3A4AA 4L6DA 3EXTA 1PWMA 2J8TA 2YLAA 4Z2KA 3EOSA 4WJEA 3PZVA 3H7RA 1ME8A 2C3ZA 3KS6A 1ZY9A 4IG2B 5E93A 1W91A 5PTDA 2Y8VA 1TQXA 1VFLA 3L9CA 1FVPA 1K8ZA 4GI8A 4K7VA 4ZBCA 4WDTA 1IV8A 1F4AA 3KCOA 4ZCWA 3GDKA 1LTDA 4R85A 3DX5A 3TWAA 2QEZA 3HQNA 4CGTA 1FP8A 2XFFA 1PWLA 3FJ4A 4N2YA 2BZNA 1GTHA 1L6YA 1E1FA 3B3DA 4FNRA 1Y65A 1OHLA 5JVLA 3OQEA 3N2OA 2E9MA 1PCWA 3GU2A 3TEVA 3QRHA 1A0DA 4MAVA 2PF0A 2UBPC 3AWNA 1HJUA 3WBXA 5TAOA 2BASA 7ODCA 1QU4A 1MMFA 3DHFA 2CXEA 3LGGA 4JPGA 3GWQA 4J3WA 3SB0A 1Q6CA 5BXRA 5CZTA 3I6RA 1VRDA 4B9YA 4K6AA 1XS2A 4CNTA 5IHSA 2QMJA 1ELSA 2YDRA 5C5YA 4DLMA 1EWEA 5BOEA 3A5FA 4EPBC 3MSGA 3N2TA 3OA3A 4AMAA 4Z08A 2C71A 4BCEA 1XYCA 3F5KA 1UKPA 2Z1KA 5HAOA 1U5HA 2IKGA 2JALA 3O07A 2JK2A 3BAKA 4LT9A 1BTCA 1XIBA 1GOOA 2TMDA 2O9PA 3HGSA 4ZTXA 4UQ9A 1LOQA 1R9XA 3LLFA 3P7YA 3BGJA 5E1QA 3IGXA 3K1DA 1CXLA 4PBGA 1MFVA 3MWCA 1IE7C 3IAPA 2QJGA 1QMLA 4EXBA 2TSYA 3H4XA 4QLLA 1QOXA 3UPBA 2HK1A 1IZCA 4KEMA 2XVNA 4CCEA 1ZJAA 2YZ5A 2EBNA 4R7JA 3NVTA 1YIXA 1F9CA 3I3BA 1GOIA 4WCJA 3SUSA 4MZYA 1H0GA 3AHYA 5G4EA 3JVAA 3C8FA 2W67A 1WYIA 5IOBA 3SFWA 2AKMA 4LAOA 3H2EA 3K5XA 1TWWA 5JIPA 4XIAA 5BXPA 1X98A 1E6PA 4XB3A 1BLIA 4MWAD 1D3GA 4D2JA 1WXZA 2WCGA 5F4SA 2ISSA 3UD6A 4DJEC 1E4LA 1ZALA 1PE1A 3LM7A 3AHXA 3NM1A 1AVAA 1B3XA 3AOFA 4ONVA 4L4OA 1NQKA 4Q6JA 3WH6A 1KQZA 1R85A 4Q8WA 4EX4A 4ILSA 4DAFA 4F9JA 1OVDA 2CWXA 3PTQA 3CL8A 1GJWA 2QKFA 4AWSA 1VGAA 4LFYA 5JXQA 3MI6A 1Q6RA 1UWTA 4UTKA 3I3DA 1JYNA 5DCDA 2GJXA 3WDPP 2B81A 1KWKA 2IPGA 4D6JA 4GIEA 4Q4QA 4DUWA 1NFPA 2GYIA 4EWJA 3CS2A 3NSMA 2PC4A 1O1HA 5CZSA 3HPZA 3PFMA 3ZZ1A 4GK8A 5C9XA 3WF2A 2J7FA 1LLOA 3PJTA 1W5MA 2PGFA 4P7OA 1U1UA 4MB4A 1UWAA 4TQTA 2Z26A 1TREA 4FHAA 1THFD 3GR8A 3ZWSA 1VYRA 3PWAA 4ZB2A 1DIEA 3RJYA 2FH6A 2R9RA 2F2KA 5DELA 3VGBA 3P14A 4CN4A 3TV8A 3RR1A 1PAMA 3Q45A 2IQ0A 4HHMA 1FKXA 2WKJA 1V0NA 1WO2A 1JRBA 1J0YA 3MMDA 4CNSA 3NQBA 4O1CA 4HU0A 3T0CA 2JIWA 4IJCA 1ME9A 2VYOA 1EC9A 1XLJA 3EA2A 3IVUA 2PDBA 4ZE4A 4K8EA 5ABTA 3OJGA 5LYRA 4HOXA 3SADA 1D8CA 2WC3A 3U7VA 1LQAA 5FESA 2IPWA 1RY0A 2NV1A 3H54A 3S83A 1EC7A 2WM0A 4Z2JA 1YE4A 4LUSA 4FEZA 2HE5A 3UPWA 2ZRUA 4AZ6A 3A6OA 2WZIA 3MQTA 5LZLA 4YTQA 4CD7A 3SZ8A 4RK8A 3URBA 4ZZ9A 2ZXQA 2F7FA 4ZQRA 3JU2A 4PN2A 4C1KA 1HKKA 2YIHA 5FJJA 1OWQA 1SJDA 3P81A 8TIMA 2JKAA 3K8LA 4LBSA 4JTTA 5EB8A 1PX4A 5A6AA 1AK5A 3F5LA 1BVZA 4NX0A 5K9CA 4DELA 5LIYX 4XZWA 2QS8A 3KDNA 4MYAA 5MKGB 4QXIA 3CUZA 4JDYA 4RXGA 1CGYA 1V5XA 3EX1A 3V0TA 3BTNA 3BMWA 4M7SA 1P5BA 2VR5A 4KPLA 4Y9OA 3LQGA 4M19A 1MXGA 1TV3A 4DX3A 2YXXA 3KZSA 5F2IA 4ZGYA 1LBFA 4FNSA 2C15A 2CIPA 3AHVA 3TN3A 4NJHA 3UZWA 1VEPA 1FRBA 1KM1A 3BICA 1R30A 1OFRA 4HU8A 5D32A 1XM3A 2DQXA 1E4NA 4A2SA 2J6VA 3POCA 3KHDA 2VOTA 3UVAA 2CLOA 1XH0A 2HSAA 1OD0A 4PMZA 1C29A 1V7AA 1UZHA 4IX2A 1ZJHA 2WCAA 3G1XA 1A80A 1TV5A 2PPGA 4NHVA 2VVSA 4US6A 3GDTA 4TXEA 2ZIDA 7REQB 3E2VA 4YS1A 1QI5A 1L6SA 5LGXA 3L5MA 2FFIA 3T8LA 4CNOA 3QKZA 4UR9A 3AYTA 2Z28A 4L9XA 4UNLA 1E40A 2I56A 1CCWB 3CWNA 4JZ5A 4GFSA 3G77A 1KFWA 7TIMA 1K6WA 4ZENA 3VD7A 3BOFA 4AXKA 3VDHA 1JDAA 4XAFA 1TMQA 3M9YA 2E1DA 3TVAA 1I9CB 1ONRA 4QSFA 4F48A 3AZRA 3V16A 1AD1A 2C18A 3WLRA 1YEYA 2PWEA 1L8NA 4GBDA 4M24A 4JQ3A 5A5WA 2JBMA 1JCTA 2X8RA 3SY1A 1AZ1A 4MY1A 1UR1A 1XRFA 2E68A 3KRBA 3N11A 1F76A 1POKA 2A3EA 4QISA 4ZQPA 3W1AA 1MVYA 3BLDA 3W2JA 4TMCA 1NOUA 2QV4A 2DW6A 3U0HA 4IF2A 2GQAA 1R38A 4DF2A 1H50A 3GVVA 3B40A 4DBSA 5D9OA 4NF7A 3SY8A 2GK1B 4KCWA 4AHPA 4H6KA 4DWSB 3BW3A 1V0MA 1POJA 4P2VA 4CCCA 3LXCA 1H62A 1GT8A 1H09A 5C7HA 2FMNA 3CQHA 5T26A 3WUFA 4ERGA 1TJRA 3NM3A 1TJPA 2J47A 3OBAA 1EEXA 1QPNA 1ZZMA 3W6LA 1WDRA 4EAYA 4FXFA 1HJVA 3NPVA 3CPUA 2VCAA 3TX9A 3W82A 4LUTA 1RJRA 3EWCA 3WEZA 2VENA 4WIWA 1XLKA 3E6EA 4H2HA 3YPIA 5EMLA 1TPH1 1W3IA 1FWCC 1VCGA 2PUZA 4L80A 1SW7A 4LAZA 2FTPA 4BQ4A 1JPMA 1YE6A 5E6YA 3QF0A 3QZ6A 3ZFHA 1BYCA 2QGHA 1V8EA 2ZYFA 3W1XA 4JTGA 1FH9A 2FPYA 4UUIA 3H2MA 6XIMA 3GHUA 3VDCA 4HNNA 2XIOA 2CBJA 5D2WA 1IT7A 4FX7A 4CNUA 4KWWA 1ISXA 4H9YA 3E9AA 5K3VA 1DJXA 2ADAA 2Z27A 3VKBA 2DIKA 3MJYA 3TFXA 4LRTA 3AXHA 1M04A 3PBWA 5G2WA 4DBUA 4YTTA 2RDUA 1ENUA 3STEA 3WD2A 5TF0A 5G1MA 2VEIA 3N14A 3TJ4A 2CZDA 3PR2A 3FYPA 2EHHA 5IFPA 1UA3A 2ZUSA 1TX0A 4A8NA 2GK1A 3FA3A 2QR6A 5CG7A 5HUPA 2NW0A 2V2CA 4AYSA 1X7IA 4LQ1A 3K2GA 2CLKA 2VC5A 3BLOA 1FP9A 1XG4A 3DI0A 2HVNA 2E6AA 2XN1A 3TN5A 4M29A 4S3CA 1WQ5A 3LD5A 3B4UA 3C3NA 1V0LA 4D1IA 1GG1A 5HMDA 3TCSA 4D6FA 4A35A 1V3IA 5A2AA 1YRRA 3W81A 1W1TA 1Q6EA 4XSMA 2WNZA 5SWUA 6CGTA 4RKAA 1OQFA 2BHYA 3ITYA 3PZNA 3RO8A 4MAZA 1RUSA 3OVGA 3RGTA 4ZFMA 3UCDA 4M56A 4IQEA 1HXJA 5C9RA 4EIVA 3B9DA 3IK4A 3BVJA 3EMCA 5D2XA 3BJTA 1RZMA 1ICPA 4HA4A 2OKOA 1W37A 3I7RA 1BKSA 1QK2A 3CPGA 3R6IA 2OG9A 3KXQA 1QW7A 3CMJA 3W2NA 1VBRA 5T8GA 2C91A 2G3FA 2X16A 1FWNA 1F6YA 2PSNA 4TO8A 3SR7A 2P1FA 1OIMA 5DBTA 2DVXA 4L1XA 1E4MM 3TONA 2AQWA 2IQDA 1JGMA 3M6DA 3D5HA 2HTMA 3PF3A 4V28A 4BI6A 3B8WA 2AQVA 4B5NA 4R7WA 3EX4A 1VF8A 4G6CA 2PDXA 2VEKA 3GIPA 1E15A 1OT1A 4DO6A 3OVPA 2WQPA 5I2UA 1L6WA 1OGBA 5D03A 4NJJA 4GVHA 4PH6A 5LNWA 5AHFA 3KCJA 2ZE3A 2VNCA 2PDPA 4UFHA 3ZWTA 3TFCA 2BGNE 3MP4A 2PC8A 4S3BA 1PTAA 2WO5A 4W86A 4QG9A 2ISVA 2YL9A 1FOBA 3NQAA 2QCGA 3QLDA 2J13A 3MO4A 2I14A 4GO8A 1HIZA 2J27A 3GXPA 3NOYA 3POHA 1PIFA 4IFKA 2BXZA 1TZ7A 3E2RA 2GWGA 4JIPA 4BF5A 1FXPA 4O1AA 3WUBA 3USZA 4WOZA 2WLZA 1PL9A 4GHRA 4PODA 5DX7A 2PDGA 1J10A 4TOQA 1WDPA 4RZ5A 3W7QA 1I6NA 4H1ZA 1Z32X 1R3SA 2TAAA 2WC7A 3WELA 3ZIZA 1E6SM 3RAOA 3R0KA 4B91A 4O54A 1EJXC 4GMEA 4AX7A 5FJPA 1K6AA 2XGZA 3RFAA 2GVJA 3QFWA 3HFTA 5CXPA 1DP0A 1LYXA 5CPLA 1VLIA 4O57A 5EMYA 4X2RA 3LNPA 1BF6A 1SJCA 4TVCA 4FXSA 2JF7A 5CG0A 3K4DA 1DJZA 4UZSA 2V67A 1FWWA 1LQ0A 2AMGA 4LOCA 1E1EA 1W17A 1MUCA 4GA8A 3EKGA 3ZR6A 2YDQA 5A8NA 2DT0A 3B8UA 4PEEA 3BOXA 1KGUA 1BKHA 5DN1A 1WUFA 2DQWA 1ZSXA 3W2KA 1EP2A 4LALA 3ORWA 2FTWA 5C0QA 2QNEA 2VD8A 3AMKA 4JKKA 5HXMA 3HGOA 5HMSA 3GXIA 1E6ZA 1NDYA 3WH8A 3GBEA 4EXQA 2ATSA 3NQ6A 3W83A 2CHOA 4TU1A 3CV7A 4UQDA 5FJIA 5LGZA 1J9YA 4LWWA 7TAAA 2GUBA 1UROA 4AZBA 4ROPA 4I90A 3TJIA 1VP5A 1UH2A 2CXGA 2HPMA 3VGDA 1WB0A 2PAJA 4GZ7A 5H91A 1XKJA 3U3HA 1OSEA 2QAPA 1A5MC 2ZE0A 3HMJG 4QGCA 3C2FA 4X9SA 1LROA 4G7EA 1T99A 2ACRA 5HPCA 1A5BA 4DJFC 3FXYA 3IJ9A 1VRXA 1I2RA 1E73M 4FLSA 3M64A 3M0JA 3COTA 2VRQA 1WXYA 1H7WA 1KD0A 3B8SA 1Z42A 4W89A 3QC0A 3ZXWA 4GNVA 3LYEA 3QR3A 3AS3A 2RH9A 4Z17A 3IK2A 1O68A 3HG2A 2VDGA 4A6GA 1JYWA 1NY1A 4FOJA 1MUWA 3KP0A 3STCA 1F7BA 1FCVA 2JF6A 1VS1A 1JFHA 1GJPA 2FVMA 4JN8A 4IMDA 1KBJA 5D9NA 3WQ8A 1Q5MA 3BK0A 1R3QA 3C8NA 4TIMA 4B5XA 1T8XA 1CIUA 1FXQA 1GTEA 1M3UA 1UUMA 5D8ZA 4KFPA 3TSMA 1MSSA 4XIMA 1MXSA 2I5QA 3WFLA 1J0HA 1TPUA 1ZRQA 3QGAC 4IFRA 3IANA 1K9FA 3H7UA 3M1ZA 4BI7A 3ZLHA 1OX4A 1V51A 4KRUA 2UY5A 4O17A 3V0SA 5D04C 5C70A 3CZGA 3T0DA 4IISA 3TOYA 3DC8A 2XZ7A 4QS5A 1GVQA 3BLLA 4WXZA 1EO5A 2I57A 3W1PA 2AAAA 3C6CA 4FMVA 4Q6XA 3VKAA 1OCBA 3W1RA 3O16A 1J5SA 3H12A 1RBOB 4GC4A 3QV8A 1M65A 2X1IA 2WMFA 3UYIA 3STFA 3DFTA 3W07A 6REQB 4JHMA 3APTA 1U33A 3L5LA 1SM9A 3MI3A 3TAKA 2A6LA 4ZMGA 4DJDC 2V3DA 4NILA 3SGUA 2DEPA 3KVLA 2JGQA 3ZVIA 1E3ZA 2E8YA 4AC1X 3IUDA 3ECQA 1KFBA 2XFRA 1OIFA 2WSPA 4HNCA 5HNNA 3DN5A 3NVDA 1W3HA 4QAWA 4C6BA 5FEXA 3KUMA 4K3ZA 3RMJA 5J04A 2CNCA 1A0EA 4ZXLA 4WOQA 3VMPA 1DWAM 4DAIA 2WVVB 1FWHC 1A5KC 2PDKA 4A4AA 4NL1A 3XIMA 3ZVHB 4IIBA 4JN6A 1P43A 3GW3A 3HJEA 4S39A 1FWJC 3GW0A 2YR1A 2JGYA 1UOZA 3QPZA 3UJEA 4Z0SA 4IXXA 3I4KA 3AIBA 4XO6A 1XSKA 3BSGA 3QGVA 2PLCA 2VDIA 3QN3A 3MI2A 3A13A 2WZEA 3APGA 4I9MA 3TSDA 1QNQA 2RHGA 1GPFA 4MKVA 2VFFA 3SCQA 4H7CA 2FZ9A 2QCMA 5C54A 3KVMA 3BLPX 3D3FA 4PFMA 2FPTA 4QDMA 1S2AA 4K8GA 2R1KA 4GPNA 1NU5A 1BQCA 1N8IA 3UG4A 4YL2A 4A8IA 1J6PA 3MO7A 5HR6A 4CVWA 4GBUA 1HT6A 2E5CA 3OZOA 3K8MA 3BG5A 3ARTA 3GVRA 2Y7DA 1KBLA 1E43A 4QRNA 1TR9A 4UNKA 2WC4A 1Z89A 3CB8A 2WVTA 5M5DA 4AUBA 1MQQA 3LMZA 2F8QA 1DHPA 6REQA 3IIZA 4MG4A 3KW3A 3U48A 4PYSA 2ZTJA 3VIGA 1EUAA 4H04A 5BWAA 4PULA 3M41A 3HBLA 3PSWA 1Q45A 2WJEA 3G18A 3AMLA 1CGWA 1BWVA 5F4WA 3VDAA 1JPDX 5HK4A 1JCYA 1OBAA 2ZZ7A 1GEQA 4GCXA 4ZQMA 1X6NA 4WX2A 4LW7A 1VQTA 2CLEA 3NURA 4B3LA 2NV9A 3LV6A 1NDZA 5TD4A 2OWXA 4CNPA 1R46A 2WVVA 4URIA 3ZVHA 2VT0A 3VNIA 2Z2UA 4XAYA 5DRIA 1EBHA 2PP1A 2D3LA 1L2UA 2GJRA 1W1B1 2PGEA 4HYVA 4ZO7A 5HPOA 1J0ZA 4DM1A 4D6DA 1RBLA 4ATWA 2J75A 2INZA 4GKTA 1XBYA 2QUUA 2AL2B 4EP8C 2YDAA 1QI4A 4AHQA 3N15A 1AG1O 4IQLA 5CBBA 4AZCB 4LF1A 4Z2GA 3W26A 1W1VA 2BVWA 4NZ4A 3GKFA 2GOUA 3ZSTA 3QJAA 2UWFA 2OPJA 3T4CA 3VNZA 1W54A 2ZRYA 2A4AA 2E7FA 5HA7A 3CAQA 3M0YA 1QR7A 2HXTA 1VIZA 1QT1A 4Y8EA 4QM1A 3SCOA 1RR2A 5E6ZA 3QY6A 3L23A 1B57A 4O52A 5H8MA 3ARZA 3NZQA 4QNEA 3UR5A 3Q94A 5B7YA 4PMYA 3GNNA 4REQB 5BU9A 4MWAC 3NIYA 3DOPA 2GZXA 1M68A 3WQPA 2YA1A 3KOZA 4KKXA 5C71A 4PMUA 4J2MA 2E09A 2VMFA 4X61A 3S42A 4O19A 5ABHA 5A6LA 3UEQA 2VQTA 3QHOA 2DZWA 1KB3A 1V3HA 3HFYA 1JR1A 1XIDA 4YCOA 1HZYA 3DFOA 4ECLA 1RY8A 1KRMA 3MA8A 3OZYA 4JNZA 1TPB1 1G7UA 1JUBA 2GFTA 5HOSA 4EVZA 1YLVA 1WZAA 3M0ZA 2ACQA 2X05A 5DLCA 2A0NA 1I60A 1Y5VA 4J35A 4YVXA 2I17A 3KDOA 4R27A 1C93A 3N18A 4PE8A 5GPRA 3OG2A 3R2GA 3MYPA 3L7RA 4HNUA 1ESWA 2YL8A 2FDMA 3N4FA 4HB7A 3PN8A 2WWDA 4PBFA 5M1TA 1EJTC 1TPVA 4DVOA 5K4ZA 3MP5A 3VD5A 3I6TA 5CGQA 2EPHA 4AZCA 3GC2A 1UKTA 5A8OA 1MI3A 2D24A 2FFCA 2Q8LA 3GB6A 1SZEA 3UWYA 4XUYA 1MW3A 5E70A 3UQNA 1VCFA 1UR2A 2C0HA 3NXLA 2J77A 4BR1A 5HNRA 1VBJA 1AQ0A 3UWEA 3L4XA 3EWWA 2NVAA 2FHBA 4W4QA 1PZ1A 2CKRA 3VIIA 1PX8A 4XZHA 2POTA 3GIQA 2PLMA 5CC3A 4C6FA 1B30A 4REQA 3E0WA 2AL1A 4P8UA 1US2A 3EDDA 2P0OA 3CHEA 3KBVA 1TTIA 3QOKA 5G2HA 3B8IA 4LX4A 2YCJA 3T4WA 1F3WA 4B92A 3MHUA 3WQ4A 4IH3A 3S5ZA 4I9AA 3PTKA 1UUQA 4GYJA 1FWEC 3OBEA 1UZDA 2J7BA 2PDQA 3H24A 1JIBA 1GEHA 5BZAA 1UR9A 3VOHA 5KETA 4I7WA 3TQVA 1XKYA 2ZCGA 1FWBC 1P0DA 4AFYA 3PZGA 4JIIX 1OC7A 4Z1DA 5HATA 3AJ7A 3EWDA 4PL1A 4UTIA 2DW7A 3G1DA 3WQDA 3EGJA 3ITXA 5FF4A 4DHGA 2EQDA 1TWSA 2XPKA 5D37A 5EY5A 3GSMA 2EPMX 4BFAA 4HJWA 1BG9A 3PZUA 3IARA 4WY0F 4WRHA 2VUYA 3AJXA 3B9OA 1KQYA 5JU6A 3IUHA 3SCPA 5L9FA 3QGKC 1ODZA 3QMRA 2AGTA 4F8XA 4RDVA 4UQEA 2WNQA 1LBMA 4WJXA 1J2WA 4LRSA 5A6TC 3TIMA 3W1LA 1SMAA 4DPPA 4TR9A 3TC3A 1KFLA 1VPQA 3WUEA 1XDJA 4MFDA 1TWIA 2RUSA 3LPPA 3R89A 3B0PA 4HOWA 3W9ZA 5FACA 4HCHA 3WQ6A 3SBFA 4FP1A 2NX3A 3R5EA 2XHYA 3QQ0A 1ZTVA 4F66A 3G1VA 3CV6A 5G4WA 2H8XA 2EJAA 4WKAA 3UF9A 3WBWA 1OCJA 3M5ZA 3UT0A 3UCQA 4CQBA 2P8CA 4DBWA 4DXKA 2XIQA 4U5IA 3U57A 4D6GA 3QW3A 1QASA 5M03A 1TKKA 3SURA 3G6LA 4EK7A 5LIKX 3TAOA 1DPMA 5D9MA 3JUGA 1FKWA 1GG0A 2X2YA 3R43A 3M07A 2P3ZA 1JDEA 1UQYA 2P76A 3F4WA 3V4BA 2FQIA 4GYFA 3UA4A 4RDZA 2OODA 1ZBCA 3GTNA 1RXOB 2WANA 3FJNA 4RDYA 4ORIA 3O6DA 1YTKA 3BARA 4TX9A 1WKYA 3VIJA 4Q8PA 3LCFA 1MZHA 3ITLA 1FWGC 4OWGA 4N9EA 1SFJA 1TSIA 4JYFA 4MNJA 2J7DA 5CBJA 1ONXA 5A6BA 2BXVA 1G0CA 3OZPA 3TE9A 3W7EA 3G6MA 4DI9A 3UJRA 3NSNA 1TPDA 5EKYA 4WK9A 3N12A 1BQGA 1FHDA 2GSHA 4F9DA 6XIAA 1GOWA 4B2DA 4Q4PA 2PDJA 4EACA 4NG3A 1KM2A 3CAWA 1JCNA 3PZ9A 3UR2A 4DJEA 5GVJA 5CH9A 2O4QA 1WP6A 2PRHA 1UKQA 3THCA 1Z7AA 4Q22A 3GU9A 3ZM8A 2G3IA 1QO2A 3QZAA 1H61A 4PCTA 4EOUA 4J3VA 1QNVA 1BFNA 2QCEA 1KC7A 3W25A 5DANA 1E6RA 1W1IE 2C1HA 1UIPA 5D2YA 4RZBA 3MC5A 4N6EA 4C91A 3BE7A 1IEXA 5HINA 2XJ7A 4GFIA 3QYSA 3UJFA 1XUUA 5AOUA 4O53A 5HWMA 1K02A 2R1LA 4LV4A 3V0UA 3ARXA 5HWJA 2G4FA 3Q65A 1RCXB 3DENA 1EGZA 3QEZA 1XINA 1GOXA 1M6JA 1RP9A 3AIWA 2TODA 1DBTA 4XO7A 1NARA 2WJFA 2ABAA 3R94A 5MF5A 3AXMA 4H00A 3G0XA 1R3YA 4WVXA 3PUGA 3SQSA 1QO5A 3WJWA 3LZ5A 4C6DA 4H2CA 4POCA 2E9BA 1VPXA 4L9YA 2O55A 4WY0B 3M47A 3L4TA 3RMEA 3VK5A 2XVGA 1R7OA 5HQLA 1PBGA 2W0UA 3IVTA 3WLIA 3MV11 3C0LA 3MV01 1TX2A 2CZEA 2QUTA 2X1UA 4HSOA 3ITTA 2X41A 3SUVA 1HN1A 1XFCA 4XD5A 3HN3A 1SW3A 2C1IA 1PDZA 3MS8A 2QHAA 1YTDA 3CIWA 3OIXA 4N0RA 2ZX9A 3OLGA 1DJNA 4QX4A 2VURA 2DVUA 5E0FA 5E5CA 3V5FA 1J8VA 3GNPA 2D0GA 3LA4A 3WSUA 1D3HA 3T81A 3GG0A 3E5BA 2V5BA 4OECA 3PAOA 2O9OA 3DESA 1R3RA 3O9NA 1SZFA 4HT3A 3PULA 2XM1A 2C14A 4HU4A 1P7TA 1SYTA 3R58A 1M41A 1W3LA 4ZVJA 4P5UA 1RH9A 3SUTA 2QF7A 9CGTA 3FVMA 4JCMA 5DCEA 3MZNA 1XIFA 1KBIA 2CKSA 4JY8A 1TWZA 3N17A 1CECA 1OFDA 3FAWA 1XCWA 1P0NA 2WOQA 1IEVA 1XXXA 3F4VA 3L2IA 3IS4A 4B90A 2PWHA 2FVKA 1TE1A 2OZ0A 1G9HA 3CT7A 1OZMA 1S5MA 3BPWA 1R6WA 4ZOCA 1G5AA 3NQFA 4AF0A 1GQKA 4IGNA 1MRAA 4JIEA 4OZOA 3VABA 3T8QA 3N19B 5I78A 1RD6A 4XG1A 4EAMA 1KM0A 4ROQA 1I1XA 4DO4A 1FH8A 2GVYA 2Y5SA 3VGGA 4P8WA 2Y1HA 3ALFA 5XINA 5FJOA 3W1TA 2DPEA 1ALDA 1EDQA 3U9IA 2J62A 3NXFA 2ZZ5A 3G1YA 1DTNA 2F6KA 1BXBA 3EX2A 4WY0A 2ZX8A 3OLDA 3NEVA 3EKZA 3CUFA 3AUJA 3P5ZA 1J5TA 2BGQA 4ACZA 4IUOA 1JZ4A 1A49A 3CO8A 2HV5A 1HG3A 3KS5A 2NWRA 3NL3A 2V5DA 2V81A 3P67A 4IIFA 1TV4A 3TH6A 2E4TA 4PA8A 2FZNA 3UR8A 2R6OA 3HMCA 3WCZA 4PMXA 3BMVA 3GTHA 3N3MA 4MNMA 4NKCA 1EBGA 1H2JA 1XGZA 2H8ZA 1HL9A 3VILA 1OX5A 4R34A 3QV6A 4JTJA 3K46A 1UCWA 1ZBWA 2WXDM 1FX6A 1O7AA 5JBFA 1KO0A 3OLEA 1T41A 1YPFA 2UY4A 4M51A 2VZOA 3PANA 2X40A 4RR4A 4GUGA 3FHQA 4L5ZA 4ZQOA 3RXZA 4A3RA 1OX6A 5EFFA 1W9UA 1CGXA 3QW4B 5AHLA 4IP7A 4AD0A 3CIVA 2PGWA 3BOLA 2PD9A 4MSSA 4PB3A 3MT1A 4JL2A 1M53A 3QR0A 4FX6M 2WKLA 4F2TA 3ZR4A 2XGBA 1A3HA 1Q8AA 4K1WA 1YMYA 3RPDA 1XSJA 3EPMA 4HP5A 2W92A 2IXVA 4IMAA 3S9ZA 2V69A 3V36A 1KBKA 4X0VA 4TTGA 2G3NA 3DYOA 4C6OA 4MOZA 1PYMA 3NDOA 4TV5A 4GH1A 4C6MA 4W88A 3DCPA 4FOKA 2OSWA 3H8AA 3L2MA 1B31A 4NAFB 5BCAA 1J93A 3SRFA 4AHOA 4DBDA 1KCKA 1W3JA 1WDSA 5JH2A 1DJHA 3TJXA 2YXOA 3UP8A 4JL1A 2VVNA 3ELFA 2VCBA 3P82A 1D9EA 3DERA 1YTEA 3ATZA 3G8EA 3N13A 4HTBA 4GZIA 1XYLA 9XIMA 3O0KA 3VYLA 3MSRA 1W1YA 3AMGA 3AS2A 5AHMA 3CU2A 1E0VA 3GNDA 3FXGA 3ZYZA 1XLFA 4MB3A 3RU6A 1N55A 3MBFA 1JYXA 1ZBVA 2ZFAA 3VE9A 4UBPC 1YPIA 4FNUA 3ZOAA 2G50A 1KBBA 3KOFA 2VTFA 4RE4A 1E0XA 3ZT5A 3ABSA 4B9ZA 4Q8QA 4ICNA 4NIRA 3V18A 1Z8AA 3UYCA 2TPSA 3PZMA 4ZSUA 3CAKA 4IIGA 1QUMA 3GM8A 2W79A 1ICQA 4KT2A 3WMSA 1DYSA 2VI0A 2ZRWA 1BXNA 5I00A 1B9BA 4LB4A 2B7PA 3W70A 5AC5A 3I7SA 2ALDA 1ITXA 4WR3A 4PMNA 3MB9A 3FA5A 3LCXA 5AB3A 4R33A 4XWUA 4RUBA 5LXEA 1W3NA 2AQOA 4J7RA 1EOMA 5G1TA 3PBGA 4G8TA 2DZVA 2R82A 3LX9A 3W7NA 1LWHA 1GVEA 1WKEA 3BLIA 4IUGA 4MHBA 2VELA 1YNPA 1DE5A 4NAFA 1F2JA 1ZPTA 1E0TA 1O94A 2CEQA 2KX9A 1G4SA 1IWPA 4LYKA 1UBPC 2PLJA 4W7WA 1F05A 3VUSA 4NJIA 4C6JA 3LGEA 1A5SA 3IV3A 1HKIA 1SR0A 2EG8A 5H1WA 4AWTA 3VD3A 4FR1A 1JYVA 3QBUA 5F4XA 4F0HA 3F2BA 3Q67A 4PSRA 3W75A 4KIRA 2BXYA 1PTDA 3OP2A 2P8BA 4FSAA 4XZNX 3ZJ8A 4AWEA 3OZMA 3GAKA 2QCFA 2QYGA 2Z1SA 2BP1A 2A7NA 1TUFA 3AICA 3LUTA 4LVBA 3CLWA 2Z00A 4AIEA 2FHFA 3QV9A 3A22A 4Q7BA 1W2PA 4GOAA 2A3LA 3FHAA 2QULA 1LJYA 4HNLA 4Q4SA 5LIXX 2Q02A 1V4YA 4IIDA 4DBEA 4FI4A 3V7PA 5C6MA 4Y9NA 4GQBA 3QFEA 3RLUA 4V15A 2PRMA 4ZE5A 3MP3A 3MDWA 3CXOA 4ZTYA 1B1YA 3L4VA 3U8GA 3JRKA 4HA1A 3E3HA 2PCEA 2H9AB 4JTSA 1KFJA 5E09A 1WBHA 3P0WA 1BVNP 2IPJA 2VR4A 2PDWA 1UQZA 2PLKA 2BBFA 3N2MA 1Q65A 3HF3A 3BLFA 2GJLA 4W7UA 1DIDA 1SFLA 1H7NA 2ZUVA 2NXHA 7XIMA 3P93A 4HN4A 3VINA 4Q8MA 5A2BA 4HNTA 1CLXA 3OEXA 1L9WA 1TMHA 3K13A 1UKSA 5G2IA 4GQ0A 1HX0A 4Y9PA 1F8MA 2DT3A 3VNJA 1WCGA 1RK6A 2XISA 4GYPC 3OO2A 2Z29A 5B80A 1HTIA 3PWGA 2GGHA 4MLJA 3C2VA 2W61A 1CLVA 3M6YA 3AI0A 4HBKA 4AISA 4GXWA 4ADTA 1SO4A 2VRJA 2A7PA 4NZ5A 4OGZA 2WCSA 1BYBA 1DXEA 1S1RA 1DEDA 1DJYA 4WQ6A 2A3AA 4KQNA 4E4FA 4HMDA 1XI3A 5REQB 1FTXA 3TQKA 3A5VA 1CNVA 3C61A 4UR8A 4C90A 2GOKA 3PY2A 1VKFA 4UWMA 3H21A 4X2PA 2NVCA 1ZAJA 3PB2A 4ATLA 5KINA 1UIOA 5EPDA 3FCPA 2BLEA 4ZSTA 1WDWA 4DYJA 2QCDB 3FS2A 3D3AA 4O50A 2HK0A 3BW2A 2HQAA 1W9XA 4GXPA 3DKLA 2FH8A 3PBVA 2IUZA 4D71A 3DFNA 3GXNA 4RXFA 1TIMA 3VFLA 1TB3A 1YQ2A 3H2FA 2GGGA 2I9EA 5GNZA 3BAJA 4NU7A 5ECVA 2QUMA 3FEQA 1XLEA 3IGUA 4HNOA 3FJLA 3RLGA 4KESA 3WLMA 4C1LA 3N29A 2V68A 4IP5A 3WH5A 2J24A 3G3DA 2WPBA 1MXDA 3PUOA 4PR4A 1UWUA 1J2BA 1CX9A 3WQWA 1ZNNA 5AYXA 4L6HA 1OM0A 2E5BA 4JTUA 2RDTA 3UW6A 3TTOA 3O7UA 4XTDA 3AQUA 1TMLA 3CMGA 3S1XA 3WF1A 1XCXA 2WSRA 1UMYA 4HHPA 4DB7A 1XLHA 2WYSA 3IJ6A 3NUKA 3H6OA 1A5AA 3Q2DA 3DFYA 3FYYA 1KKOA 3N9SA 4AIOA 3G0SA 5LSMA 4DYKA 4Q4MA 4US5D 2H90A 3XINA 2AMXA 4LS2A 5TBOA 4F40A 2QUVA 4LNCA 4HPXA 5BXTA 1TV7A 2QPSA 3E0IA 2ZRZA 3UGRA 1X1NA 3UBPC 5REQA 1EEPA 3OHIA 3BAXA 4M1BA 4AH7A 3DZ1A 3BAYA 4KWVA 2F9RA 4ALDA 3STPA 1JAKA 3LLXA 3OPSA 4P8VA 1J4EA 1F3TA 4MJMA 2WMJA 1NJJA 3J7HA 1F3XA 5K2ZA 4MUZA 2HDJA 2CU0A 3CZLA 3W7CA 1JZ7A 2NT0A 3W87A 1AA1B 5XIAA 4H9XA 2J74A 4MZ1A 3LXAA 4WSKA 3FGCB 1KV8A 1XQLA 1W9DM 3ZO9A 1QW8A 4RV8A 2PS2A 4KEUA 2F84A 2NUXA 2OOGA 4GISA 1V3KA 1J79A 1EQCA 1XLDA 2W91A 4IPPA 2ZXAA 2ONEA 1SSGA 1K03A 4PSPA 1B0IA 2OB3A 1PUDA 2JFEX 4Q8OA 4AXNA 3ARQA 3G1RA 3V1PA 1TG7A 5C8BB 2CBVA 4U28A 2CFFA 3EB2A 4UZUA 2X09A 1BD0A 1CI1A 2BY2A 3SIMA 5DMLA 4DY1A 3HG4A 4O0QA 3LZ3A 2QJHA 2JIEA 2PFHA 1GQNA 4PMDA 4HYWA 5KMYA 2X1SA 1Z9AA 1PSCA 3VGHA 3GH4A 2ODOA 3DHDA 2D2HA 3W7IA 5I3FA 1K9DA 4RLIA 4MTVA 3WL1A 1E9YB 1VEOA 3WK3A 1JQVA 4MGGA 3W6YA 2PTXA 3I7QA 4C6EA 4F2UA 1B2YA 1GVYA 4PTNA 3WLPA 3L0GA 3LSBA 1TTPA 3QTGA 2ALRA 4QR6A 1DQXA 1K7FA 3WF3A 4OQVA 2GDVA 2VWSA 4GJ1A 3W0KA 2D0FA 5K9DA 1AQMA 3MHGA 1G4EA 3M4HA 4AVNA 2DSVA 1Q85A 3LHWA 4RL3A 3FSUA 1JZ8A 1JZ6A 3A3WA 1IT0A 1E9IA 3RX3A 4GY0A 3WNNA 1BGGA 5CBIA 4JTKA 1HP5A 2DZPA 5ABFA 4GCAA 4JDBA 1GZJA 4DJDA 4V1YA 1EGVA 4JTIA 1DIOA 1IWBA 4OTKA 5H8UA 3W72A 4DRSA 5F1VA 3MY9A 3H26A 1TJ1A 1J0IA 2VX6A 1RV8A 3PG9A 3EWBX 4HMCA 3VX0A 2HVMA 5HMFA 4UFIA 4O18A 4GLEA 4DPQA 1KXHA 3VNDA 3GNRA 4MNLA 4KH2A 5A8GA 2FJKA 1LDCA 4XZIA 4ZB0A 3CIXA 1UJQA 4NRSA 3WLKX 3H2OA 3WQOA 4UTWA 1RQHA 4MDPA 3VKDA 3NG3A 3AAMA 2PMQA 3K4AA 3USBA 3FA4A 2WZTA 3LHTA 3Q4DA 4PTXA 3LBMA 1PTGA 3E12A 4IIEA 1SJAA 3BSHA 1LLZA 1H7OA 2CLHA 2H3DA 3QLLA 4FNPA 5IRPA 6TIMA 5FF7A 1H60A 1UD8A 4Y8FA 4YJ5A 2ISFA 3G8RA 1R3TA 3VOJA 4N4QA 4A22A 2YW4A 3KRUA 4OOUA 2CC0A 2FB2A 1KM3A 4K2SA 4XUGA 3GHSA 4E8DA 1HO4A 2XVKA 1S38A 1UZ1A 4HZ7A 4MWAB 4U2ZA 7A3HA 4F0LA 1K7XA 4YYCA 1KFCA 3CAVA 1RK5A 3VC5A 2DH3A 2C79A 2VXNA 4GJJA 1O1ZA 2CCRA 4PMJA 1KW1A 1XYFA 3UFYA 3T78A 3VU2A 1P6BA 4P7LA 4N42A 1O60A 5IBXC 3V1HA 1PYFA 3BH4A 4ORMA 4FA3A 1JGIA 2XTKA 4GVFA 4M0XA 3WMLA 5C9UA 2NQHA 2QJNA 3IEBA 4AD3A 4ML4A 4E3TA 2INEA 3TTYA 3ATYA 2FLIA 4NSBA 1EUNA 4R9XA 3B03A 4IPNB 4S3JA 3CQJA 2OSYA 2DFAA 1QTWA 3BC9A 2QDGA 3VNKA 2J9XA 4M81A 2EO7A 3CQKA 5CQ1A 2OEMA 3TKFA 3BJSA 3PBYA 4D8ZA 1I0DA 1S2TA 3M16A 5CC5A 3EXRA 4P7NA 3AFBA 3NQVA 2ZUUA 2OGJA 3W27A 4R9OA 4H4IA 4EPKA 2J9ZA 1BRLB 5JMUA 1MW1A 1OGGA 1QHZA 3CQ0A 3IJDA 3TK7A 3S0CA 1UR4A 3CL7A 3EWYA 1Q6DA 4HYRA 3SGGA 2HJPA 4AVFA 4NJGA 4PCPA 4C5ZA 4EKJA 4QAIA 2RDXA 4YU1A 5FL1A 3KCLA 4HA0A 4IPLA 3NGFA 3RHGA 3PVFA 1PKLA 2MANA 1MO0A 2OLSA 1WAWA 1T40A 2GQ9A 3IRSA 2XFWA 3NZPA 3ZQ9A 4AY8A 3OIHA 3P80A 4MWAA 1EF3A 2VZTA 1UUOA 4MKNA 2C0AA 1HF6A 1U22A 1S2CA 3CC1A 4PTVA 4TTUA 3BJFA 3N1AA 4O1BA 4DZAA 3CEPA 2VFEA 3THQA 5CSYA 2YZRA 1OABA 4UTTA 5DY2A 1QI3A 5A1AA 3GVWA 3NQ8A 3QY8A 1MEWA 1QNPA 1VENA 4RV3A 2OCZA 3SJ3A 1B3YA 4NZ3A 2R1PA 2B7NA 3MUAA 3RCYA 3RX2A 4CU8A 3RK8A 3I68A 4GQGA 4QQUA 2Q09A 3RRAA 1TZ9A 4Z1BA 1VC4A 1MZRA 4HK5A 3UERA 3U5UA 1VHNA 5I02A 1NELA 3LY0A 1BRLA 1AZ2A 3A12A 2OYKA 1IXQA 1VAHA 2J88A 2B0MA 4ZO8A 3T40A 2O9TA 2KZHA 1U5VA 1EJUC 1M7PA 3W73A 2CLFA 3W6MA 4DF0A 4JX5A 3PZQA 1R2RA 2DSZA 3REQB 4C6PA 3KVJA 4WLCA 4KEZA 5H2ZA 2J79A 3M5YA 1KM6A 1ONEA 5GJPA 2YGYA 4J9JA 5DCBA 2C7FA 3H2CA 3E2SA 1EP1A 3D6NA 2OVLA 3LENA 4I3GA 2OMAA 4W93A 2IKJA 5A2CA 1FBAA 3FOKA 1B3ZA 4Q8UA 2OOFA 3CHFA 2PWGA 3SAZA 1IXNA 4HPGA 4IG2A 4X0NA 3H70A 4JIQA 1QI2A 4ICMA 3WQGA 5D4YA 3WD3A 4UTHA 1E9ZB 5I3KA 2HISA 1R8LA 1PS9A 3P60A 2OJPA 2XWEA 1W8SA 5DFAA 1I2PA 1ADOA 2NX1A 4FNQA 4O4WA 2RFGA 3VMNA 2R8WA 2A6NA 4EPDC 1BSIA 2Y8KA 3EOLA 3KLKA 1TCMA 4GZJA 2L5HA 3GBDA 1K4GA 1JCMP 1TZZA 2I1OA 3P61A 3CZJA 1JJKA 2P50A 1S2VA 4QSHA 4HIBA 2PI6A 5TNVA 2RJHA 3LHUA 1XV8A 2XN2A 2Y6ZA 4DNHA 3A9IA 3ID7A 4GYKA 2PBGA 3C2OA 1EOKA 3GTFA 4UXDA 5IDZA 3F4DA 4FO4A 4NVTA 1GYNA 1FA2A 1WOAA 4PZVA 3T7VA 3PZTA 5I3DA 3NQ7A 2E1WA 3RM8A 1CXEA 2A7RA 1MNZA 3FNDA 5KEZA 5B7ZA 2XIMA 1S1PA 3B4YA 3DYMA 3KL5A 1UC5A 1VFFA 2ZZ4A 5A8MA 3OODA 2D73A 5EMKA 1QPOA 4R88A 3HIJA 5CPMA 2Y89A 3SN4A 1RJPA 2PRLA 4F79A 2OGYA 4B4FA 4GH3A 4M1RA 3WLLA 1UWRA 1J6OA 1DVJA 1ZAIA 3W1QA 3TW6A 1N7KA 2FMOA 5AYBA 3UG3A 3WLNA 1GVOA 1KXTA 5FSDC 4JTRA 1XX1A 2VEFA 4J2PA 4UIOA 4IQJA 3KBJA 4Y9MA 2GJPA 4CU6A 2XZ9A 3ABQA 2HWGA 3GK0A 2PP3A 2XIJA 1UHVA 2CHRA 3RM4A 4Q32A 2VC9A 2QMKA 2PDCA 1MW0A 3O6AA 3EDFA 1CBGA 1X6LA 1WA3A 4IMCA 4JTLA 1AD4A 5HDRA 4H9VA 3N6QA 8RUCA 1NWTA 1FWRA 2NX9A 1TPWA 2QVHA 5CGTA 3N6JA 1EJWC 3WD0A 4YTRA 4PFHA 3NSXA 1XIJA 1AQFA 2Q3OA 3LCLA 3UG8A 1UC4A 1EH9A 3L4WA 3EWXA 3TN4A 1M1BA 3SSJA 1SO3A 3TWBA 1V77A 3WLHA 2VFGA 4YIWA 2OEJA 1PHQA 5JH1A 3FYOA 2B4GA 4L9ZA 5KZMA 3AIRA 4U31A 4G2DA 1QHOA 3THAA 2I16A 4QJ1A 1DV7A 1E6XM 3HPSA 3MVTA 1OC6A 3H53A 1HFBA 4R5EA 1IXPA 1YPXA 4UB9A 4MDOA 2YL6A 2VFIA 3CEUA 4XSLA 4Z1CA 2GVGA 3CZ8A 1H7PA 4Q3MA 4INFA 3B05A 1C92A 1ITQA 4LXFA 4F4RA 1I1WA 1RPKA 4N02A 4UOQA 3W53A 1CB7B 2WVUA 1W1PA 3ANYA 2OT0A 3NQEA 4L4LA 1PB0A 1W5PA 3IPWA 3INPA 1X97A 1KCLA 3M0LA 3CV1A 4KFOA 2PD5A 2C1GA 1WUEA 5AFDA 3W29A 4HZ6A 4XZMX 5BRBA 3FY1A 2ZUWA 5AYIA 1PKNA 3BV7A 3WNMA 4E2BA 2D0HA 4IM4A 5JBDA 5FA5A 5LNVA 1A5LC 1VBHA 2V8ZA 4GNJA 1QDSA 1Z69A 4NXKA 2VR2A 3U4AA 4M82A 2REQB 3W7RA 1CXIA 3MVIA 4S2CA 1PXGA 3FDKA 1Q6LA 3HPAA 1SPQA 4U10A 4EWND 3T6CA 3BANA 2DZAA 2AGKA 3OVRA 4YHEA 3PAJA 3N04A 1DXFA 3O1NA 4GC3A 1ZCOA 3GH5A 1NTHA 3LSCA 2J25A 2EKCA 1VFMA 3PZIA 5K9XA 4FOUA 4GUIA 3W01A 1U2YA 3V35A 1Z41A 1LL7A 3GXFA 3P62A 3CH0A 3VTRA 1P1XA 5A6MA 4E4PA 1O5QA 4K36A 2C13A 5D38A 4JICA 2VM8A 3DGRA 2YYTA 3VIHA 1JPKA 4UC5A 4HZMA 1ISZA 2D69A 1H5VA 3RN6A 2J6XA 1KV5A 5DBUA 1W32A 1MWOA 5J5RA 2PF8A 2VFDA 2ESCA 4Q8VA 1A4MA 3A24A 4AWUA 3BWWA 5MKGA 1UOKA 4NZ1A 3C2EA 5F2GA 1LL6A 4RE2A 3H4WA 1OY0A 4R7OA 3CV2A 3R0DA 1GHSA 1A3XA 2WZHA 5FIPA 2R91A 4JKMA 3EDEA 1X1ZA 2WZMA 1TTJA 3TZFA 3AZTA 4J40A 4DLFA 1ZP3A 4Y2WA 3K1GA 4GINA 3EXSA 1XLMA 2RAGA 2YW3A 3H22A 3ONCA 3OA5A 1BG4A 3K8KA 1ECEA 1LQ2A 3MKCA 5LA1A 2O9RA 2BMBA 7PTDA 1GVFA 1OFPA 4Q8TA 3W38A 1GYLA 4G56A 1UJPA 3S9IA 3SO7A 2ZX6A 4AZ7A 3LN3A 3M0VA 1GW1A 2OYLA 5FSEC 3D47A 2DDXA 1UASA 4BWLC 2YCLB 3NDYA 5A8QA 7REQA 3EMQA 4C6LA 2DZTA 4GX9A 2XIBA 4TUFA 3W2MA 3BZGA 4ATDA 4PUWA 2EXOA 1P48A 4L65A 5G1YA 2NQ9A 2EPKX 3BG3A 3W23A 5I79A 5FF0A 2PTDA 4ZOAA 3C3UA 1V08A 4J3UA 3P5YA 1R87A 2CESA 1PHWA 2EPLX 3AALA 1JL8A 2XH4A 3PB0A 1VYSX 4WSHA 4JTHA 3OHMB 3N4AA 2QJIA 1XRTA 2X2GA 3V75A 5D09A 4M5PA 4EXAA 1ODUA 3UZJA 1TVNA 3TDFA 3WQEA 1ADDA 4U2YA 1Q7MA 1P0BA 4X9YA 4AZ5A 5FD0A 4MFEA 4N7QA 3IIVA 4UMAA 3ARPA 1DOSA 3PJWA 1FWTA 4W9TA 4YN5A 4JX6A 2OWWA 2V3FA 4XAZA 3SGZA 5DF0A 2Y85A 4CKQA 1JF6A 1JI2A 4M80A 4UFMA 3UZXA 3KRZA 2W62A 3RR4A 3WDRA 5CCZA 2E67A 3QQ1A 2W3ZA 1K70A 1TELA 2ZUMA 3UESA 4BF9A 4DWSA 1UWSA 2YBTA 1WDQA 3LRKA 1SO6A 4MUPA 5HQMA 1ECQA 3KVKA 2OXNA 2FDSA 3HPXA 1RVGA 2HVOA 1HVQA 1AL7A 3G5EA 1X96A 2GSJA 1Q2RA 2WJDA 3OTRA 4S1FA 4K39A 4UTJA 2GLKA 1QW9A 1R86A 2PE4A 4CQAA 1AH3A 3DG3A 2AKZA 4PCFA 3IJLA 3GTIA 4ZOBA 2R1MA 4N6FA 3GR4A 1TA3B 1SMDA 3FW6A 4ZL1A 5BU6A 4CEUC 4H8UA 4XD4A 3S9YA 1SJBA 5AHEA 3S1GA 2EKGA 4H6RA 4IMEA 2V82A 5EBAA 2NSXA 3L66A 4JBRA 4NX5A 3M43A 1KRAC 1JNDA 3LCGA 2V0TA 1TUXA 3MCOA 3VNYA 2Y63A 1D7FA 3TSBA 3OOQA 3AHTA 1OGSA 1CXKA 4LUYA 4LJ3A 2Q8XA 4QEEA 4RE3A 3QPEA 1S5WA 1Q7ZA 3VO0A 1RPXA 4CVUA 3BXWA 1BWLA 4A3UA 4ASTA 4JEJA 2ZUTA 4PL2A 3R8HA 3GFZA 1XIGA 1KKRA 1FWAC 3WN6A 3VD4A 3PP7A 1T6MA 1QBBA 3W1MA 4GI9A 2BTMA 2J8FA 1EPVA 1X6UA 4UCGA 3VCRA 1ZCCA 1B4EA 2V3EA 1WE5A 2DZSA 1G4PA 5E9XA 3WYZA 1LRQA 1UH4A 4MB5A 2NZLA 1Q6FA 2ZQ0A 4DM2A 2NLYA 3WNOA 4X60A 1V6YA 1LM1A 5F1UA 2V2DA 2VC6A 4KWUA 3NQMA 1NF0A 3BZJA 3R8RA 1E55A 2OR2A 3CWHA 1R9YA 1LORA 3IJ8A 1VCVA 1OT2A 4C7FA 1B90A 3TMQA 3VAVA 3L4YA 2VWTA 1QWGA 4F0MA 3MMWA 4XV0A 1YW1A 1VPYA 2PDUA 3VNLA 4BKNA 1FWSA 3SI9A 3DHUA 4JTFA 3NEHA 4FIQA 5CC7A 4IJBA 1J11A 2PWDA 1TIWA 1XRVA 2VX4A 2HNEA 4F3HA 2OQHA 5I3GA 2TRSA 3UWWA 4H6QA 3UZZA 4MM1A 4QITA 1H1NA 4IP4A 3MSYA 1RHCA 4I5RA 2VEPA 2WB5A 1TYGA 2VZSA 4MWAE 4YXGA 1BTMA 3KLLA 4JQ1A 4E5TA 1AJ0A 4JR5A 5BXSA 5D8WA 1ITCA 2VD9A 3KL3A 1LUCB 1UR8A 1BVWA 3TA9A 3N6HA 1HGWA 4V33A 1HUVA 3GD6A 2OWCA 3A21A 3MBDA 1QPRA 3VX1A 3DI1A 1OK6A 4I5XA 1Y0EA 1UPPA 2BY3A 3C56A 3MZ2A 3WD1A 3PS7A 1J01A 2E3ZA 3P3BA 3NL2A 1X8FA 3EOOA 5HR7A 3MW7A 1XFBA 4JHZA 4LEFA 4WKHA 1UA7A 3LV5A 1HGYA 1NVMA 1AJ2A 2DP3A 3T1GA 3WDIA 1IQ8A 3KL0A 2QPXA 1EWDA 4LYQA 1M7JA 1A50A 1RALA 4TV6A 4JFWA 4IOTA 1OG0A 5CLTA 3G22A 1XLCA 4GYPA 5I3IA 2Z0IA 1RLDA 5H8PA 3A4WA 3NZRA 1H63A 4YLWA 9RUBA 3PUDA 1JD9A 2IMRA 4GNKB 3KBSA 2G97A 3VPLA 3WJYA 3V3WA 4WHBA 2G4JA 3HQ1A 4IMFA 3SJNA 4IPIA 1XUZA 3C0QA 4U3AA 5C2XA 2ZX7A 3BO9A 2PDFA 4CN6A 2DU2A 1NDWA 3PK7A 1E6NA 1YDYA 5HBFA 3R4IA 1CB2A 1HJXA 1VHCA 1XYMA 2VGFA 1VIWA 1AH4A 1NQ6A 1AMYA 1EL3A 3G2GA 4TVUA 1YDOA 1XSIA 3GNOA 5LA2A 4BHYA 3CUIA 2AAMA 4UOZA 2PGRA 2YBUA 1FWDC 4QFUA 5CSRA 1SZNA 3VOGA 4ERAA 2ZDSA 1DIKA 4YWIA 3UZ5A 1FWIC 4HZ8A 3IIOA 1PZ2A 1QVBA 3SFKA 2MUCA 3TJLA 1YDVA 3ABOA 2OO0A 3C86A 1JD7A 4HMEA 4O8AA 2C16A 1GQIA 3OGSA 3W7MA 1JPIA 4G9PA 1RVKA 3GS6A 3VUPA 3T2OA 5GNXA 2C6QA 2ACSA 2E6FA 3HG5A 3MANA 4NAEB 4M3PA 2V9DA 3WF0A 1S2UA 5C9WA 1GGOA 3W2LA 4KEVA 4I6KA 4LAUA 2J7GA 3CO4A 4KWSA 5AVNA 1E3XA 3W76A 3WO8A 4O1DA 2WHJA 3AMCA 3T09A 4H83A 5CZJA 3CJPA 2QPUA 1CEOA 4QQ3A 5GJNA 2DZBA 3IAQA 3FDGA 4CLMA 4JQAA 4OJYA 4F0KA 3PC0A 2D2GA 1WKFA 3VA8A 4Z2LA 2PDIA 1KLZA 1OF8A 5IFTA 2XN0A 1JEZA 1Q2SA 2CW6A 3M0KA 3GYCA 2DVTA 3KEHA 3ARYA 1W0MA 3T42A 1S3HA 1C9WA 2ZZ3A 4Q7IA 2Z7KA 1O6IA 4TX8A 5ABGA 4E6MA 2Z6IA 4J1OA 3N9RA 1SZGA 1W1A1 1XDMA 5LNRA 2R94A 5LNSA 4R3UA 3W84A 3WMBA 3F03K 4GACA 2LLEA 1BGAA 1ZU8A 1C8QA 3ARWA 1VFTA 4FLRA 1XLAA 4JFVA 4BJHA 1UB3A 2XIIA 4NUWA 3AU2A 3GAYA 3O8AA 2BGSA 4PUJA 1O5KA 3P8IA 3M5VA 1XRSA 3K4WA 1EO7A 3KTCA 1BXCA 1UR0A 1FUYA 1QOPA 1WDDA 4IGMA 3KOXA 3CTLA 4LS1A 3P2VA 5BRPA 2GGJA 1XPGA 3RU8X 3SRHA 4EF9A 1XYZA 2NQZA 1IR2A 2HEJA 2ISDA 2JEQA 4HTYA 4C6NA 5DO8A 4A3QA 1U1HA 3GFXA 3NZ1A 4JOMA 4YMZA 3L68A 1ISWA 3A47A 2WM1A 2WHKA 1JZ5A 4GKLA 3OGVA 1ISYA 2WSKA 2DUAA 3T08A 1R3VA 2B7QA 3DBPA 4UMBA 4H7VA 3TNOA 2J8GA 3CL6A 4PRTA 2OZ8A 1MEHA 1CXHA 3AHZA 4NAEA 1KFEA 4IGHA 1P6WA 3LCWA 2NV2A 4RZ6A 4Z0JA 4PC8A 5A94A 4JS3A 5J5DA 2BY1A 3MDUA 4LAKA 2X7WA 3O2LA 4FLQA 2FIQA 3PHAA 4GGBA 1WKDA 4Z1AA 1UP2A 1LG2A 3VMOA 3VKKA 3TUUA 5I07A 3EDJA 4UTLA 1QFEA 3GXDA 3URNA 2R1NA 3AXIA 2ANUA 4W5ZA 1FCQA 2WQDA 3NQCA 2DT2A 3SCNA 3MWAA 1PO9A 2FHCA 4HPNA 4LPCA 2GJXB 4L7ZA 2HS8A 3O6YX 3VCNA 2NXIA 3NNTA 2P3EA 2DJLA 1ZENA 4IICA 1ONWA 3R12A 4FS9A 4ADUA 3B04A 1V3LA 1B54A 4PUMA 1TTQA 1F8IA 3WK1A 3CTTA 3TCEA 1VFSA 2OFJA 4BI5A 3P74A 2G96A 1I2QA 1OC5A 5I7GA 5C7VA 3AIEA 4MPKA 3R0UA 4AYGA 4XZBA 3U6WA 2HE8A 2HS6A 3THUA 1XLGA 4DEFA 1PKYA 3PPCA 1RSCA 4DWDA 3E2QA 1UD4A 5AY7A 4CQDA 5FAJA 1K8YA 1IWAA 2OX1A 1EHNA 2WAGA 1BEUA 3CHCA 3VZYA 5LIUX 5D30A 3WQCA 4NI8A 2FZ8A 2Z7GA 4AB4A 2EPOA 2XINA 3ITVA 3VNMA 1JPHA 5BOFA 5BROA 1VB9A 5DXXA 4O1EA 4DIAA 4C7GA 1Z48A 4AD2A 1CPUA 3A4JA 5I09A 3E1F1 1BYDA 4Z2HA 3CGTA 4IZGA 4Y96A 3UXAA 3DUGA 4IL0A 3CM4A 2Y8UA 4LUSB 4IIHA 3LK6A 3DAQA 1XBVA 3T07A 2BG5A 1WZKA 4I8YA 3B0UX 2C19A 3NQGA 3EYPA 3L21A 3Q37A 4LNYA 1OB0A 4AD5A 3MCNA 1DTUA 1IR1A 4J4KA 4OV9A 3TLQA 4XK2A 1S5NA 3P0XA 3QTPA 4I7UA 2WKGA 3MCMA 4MMWA 1EA9C 1Q6OA 4UTFA 3B8TA 1NP2A 5FI8A 1FHUA 4B15A 4U4MA 4EE9A 5HNTA 4YTUA 3RYSA 3FIGA 1YX1A 4K37A 3GUGA 4GO9A 2W5FA 2OZTA 5IBXA 3S2MA 1XISA 3LCIA 1LOLA 3QY7A 1P1MA 5LNUA 3B9EA 3KBWA 3FKRA 1SGJA 4X22A 3U2CA 2OX4A 1NDVA 2OKTA 3GG8A 1GOKA 4AMCA 1KXVA 3H23A 4ACYA 2QJMA 3LEPA 3E02A 2ZVIA 1UYQA 1I2OA 2QCHA 1D2KA 3E49A 2AL2A 2W27A 1NOFA 4PMRA 5AZ0A 4DZHA 3SCSA 3SIZA 4CD5A 1IIHA 2X1TA 3EDKA 4PUUA 1P6CA 4C60A 5FJUA 3AISA 3SM0A 2Y70A 2VUNA 1E4IA 4UQCA 2YLLA 1S2WA 2YB4A 3LB0A 5FJTA 3FX4A 4N9DA 3GDMA 7ENLA 4GI6A 3BW4A 4NJKA 3AIUA 4J3SA 3G1FA 1UD3A 4RE0A 5C2GA 1NWRA 2NQLA 4PTMA 1GVIA 2JEPA 1G1YA 1E71M 2BOFX 4YVPA 4WDUA 2WMIB 3TROA 2OLHA 2Z1WA 1W9BM 3WDJA 2ASHA 3F2CA 2QLYA 3SUWA 3OU8A 1T96A 4QLKA 1NF7A 3QXBA 4XZLX 3UA3A 1YYAA 4NRRA 1EP3A 3DC0A 4D6HA 3QR1A 4EANA 1R0MA 3SY5A 3OBKA 3W85A 1AL8A 1BAGA 2RKXA 4LV9A 3KTXA 5RUBA 5DRCA 4D6CA 5D33A 1KLYA 3IIPA 3QKEA 2O7QA 1E72M 3VI2A 1P0KA 1KGWA 1F4HA 3RPTA 4H3DA 2FB3A 1EX5A 2IKIA 3URQA 4HGXA 3BL3A 5EL1A 2PWFA 1DJGA 4O0ZA 5C2CA 4HMNA 3IGHX 2VGBA 1C91A 1IGWA 4CD4A 4JN7A 4M6UA 1DWHM 3HURA 1XQKA 2POZA 4W5UA 4C7DA 3WNPA 4JNMA 4YPJA 1G69A 3S2LA 1GCYA 3AYVA 5M3WA 3EPOA 3ZS4A 1LRTA 1A47A 3T0AA 4GX8A 4KF1A 2ICSA 1W5NA 3VDBA 4UMCA 2FKPA 2V63A 1XHGA 4LUTB 5CSUA 1JDDA 4QTGA 3I65A 1W6TA 1CDGA 3PTDA 4HPHA 4S23A 4GZEA 2QDHA 4LCSA 1AJZA 3B8DA 4G5DA 4GWEA 4RNFA 1O12A 3BQ5A 1ISVA 2WHLA 2MNRA 3U2ZA 1DKWA 4HA3A 1GWJA 3MTWA 3S6TA 2WMIA 2D22A 2VGIA 3R10A 3ABXA 3E74A 1TPC1 5FEPA 2F2HA 1GUVA 4KBXA 4LS0A 2QXWA 4D1JA 1KTCA 3APYA 4FIRA 2HXUA 3ARUA 3NL6A 1IZKA 1FY6A 5CPOA 3LOTA 3TW7A 4L56A 3AXXA 4JYDA 2IQTA 4S3GA 1VBGA 3D46A 3VVGA 2E77A 1YXCA 4MB1A 1RQEA 3ANUA 5T9CE 3W7GA 3RNDA 5I5RA 1LT7A 5HUOA 3WQ5A 3L0NA 1M7OA 2CLPA 3GIYA 4H9UA 4GVIA 1A4LA 3KWXA 2XWDA 1TPEA 2O4MA 2ZRVA 2VQUA 1XYBA 3F1QA 4J3XA 1B4KA 4U33A 4NZCA 1DJIA 3GUWA 1XH2A 3RDKA 3WZ0E 4LF2A 3TC7A 1KFKA 3U5YA 4AEEA 1RP8A 1TV2A 4A3YA 4XTIA 3GO2A 1TJ2A 4UQAA 3FJ6A 1C8YA 4PMQA 4DXVA 3B0XA 4M6QA 1WOBA 2ZDRA 2PCQA 1SSDA 3V5CA 3S5OA 1OFQA 3MU7A 2D23A 1UR3M 1OYBA 4QS6A 3W00A 2VOMA 3CH9A 1CGUA 4E2OA 2Z1XA 4S38A 3PWIA 4FLOA 5GQBA 1TPFA 2VHLA 4BEQA 3O15A 4ADSA 4W84A 1UMLA 3GZAA 4MVAA 2DH2A 5EA9A 3DU0A 1CW2A 3S5YA 4GGHA 4QE1A 1V02E 2Z2BA 5AYZA 5AZ1A 2ISWA 2VEGA 3CB3A 2PDNA 1UPMB 5A6KA 3HM7A 2CYGA 4QLJA 2UY3A 2CPUA 4P7QA 4HN8A 2ZKMX 2PP0A 1RA5A 4RZ4A 4HCLA 3NGJA 4WXYA 4LGXA 4ZO6A 1J18A 1YDNA 2OQLA 2QVNA 3KP1A 4B16A 2FGBA 4GXMA 4QDWA 3R7MA 3TNBA 3SQLA 1HL2A 3VE7A 1IEIA 4UCFA 4LVDA 1V0KA 4QEHA 3S2NA 1Z3NA 4G7FA 2ZOXA 1Y5WA 2OYMA 4WGXA 4E4UA 1Z6KA 5CGMA 2Y7GA 3PG8A 3CUJA 1MW2A 4LYRA 3RM9A 3M5XA 1W1ZA 4ZO9A 1UD5A 3AO0A 1QPQA 2I5IA 3H2NA 5HULA 4N9CA 4O0KA 2CZFA 4DXXA 2CETA 4HKPA 3LI0A 4O12A 4IFKB 3RJXA 1KTNA 1QNSA 4UFJA 1B3VA 1NOWA 5A95A 2F6XA 3ITCA 3M0XA 1Q66A 1PV8A 2WBKA 4DN1A 1BPLB 1C3FA 1GKQA 2GWNA 2E40A 4NYUA 4K1GA 1V93A 1HJSA 3DG7A 3ZMRA 3G0UA 3ZJKA 2J9YA 3HB9A 3BDKA 3HPFA 4JFTA 3SRKA 4NQ1A 3TYAA 4O8RA 2A2IA 4GE8A 3TTEA 1T7LA 3WDHA 2V5JA 2QUNA 3I6EA 3BLEA 4LVGA 4I5UA 1JFXA 4MJ4A 1EXPA 5C55A 2V2HA 2YYUA 2XSBA 3H2AA 4JCLA 4WSJA 3MUCA 1LLWA 1NP0A 4G1NA 5E0KA 2YFOA 2Z25A 1KTBA 2BVYA 2P0IA 2YL5A 1FH7A 3CBWA 4XBSA 4YHGA 1IEQA 4J3ZA 3AU6A 3UWQA 2VO5A 2WWCA 3L4ZA 5F2MA 1ZHAA 1CGTA 1TRDA 3ME3A 1O95A 3MMUA 3WK0A 3DFQA 1UP3A 2IXUA 4O28A 1G4TA 4V1XA 4B3KA 3MUXA 4F2BA 2ATMA 1K8XA 5CKSA 3L0KA 5I03A 4OUEA 2PDLA 2YCKX 5L6UA 3OYZA 2BDQA 1G7VA 3TA6A 4CUCA 2HRWA 3KAOA 7CGTA 3GX9A 3RITA 4O16A 5DQPA 5LHEA 3FK4A 4PUKA 6TAAA 1AMKA 3DFHA 4AEOA 4U3CA 4OKDA 4H9MA 5EFDA 5BMXA 3HGJA 4DO7A 1EIXA 1IEWA 3O05A 4D6EA 4J5NA 1Q13A 1X7FA 4LC8A 2WK2A 3BV4A 3ZJ7A 1H51A 2G95A 3D0CA 3TLLA 4G7EB 3CK5A 4Q7NA 2PODA 3L67A 2DJXA 5EMJA 2OU4A 1VLWA 1K9EA 1DXIA 2CERA 2FZMA 4DWSD 3THDA 5AC6A 4ZEPA 1N82A 1XBZA 1RAKA 2VKZG 3WD4A 4L61A 3NO5A 1GW9A 3H7VA 1HW6A 1K9TA 1YXDA 4UFKA 5IDIA 2NLIA 1UH3A 1GKPA 2G5WA 4P61A 1XIMA 3LHVA 2O0TA 1EQPA 1VR6A 3S6DA 5ABEA 2YXGA 4UTMA 1GONA 3ENLA 2R14A 3KBNA 4W8BA 1A5CA 3N4EA 1AW5A 1Q7QA 1YXYA 1QOQA 1XP3A 3NDZA 4LCQA 4DYEA 3CHDA 5CPSA 2G8ZA 4OIFA 1PJ9A 2ZADA 2EG6A 4WKFA 3BCDA 4C6KA 2PDYA 2YBVA 2BFGA 4QIUA 5FF3A 2ZX5A 3ZR5A 1SO5A 1H1ZA 2QJJA 4FXRA 4BS0A 3LU2A 4AU0A 2A1YA 3DIPA 2XH2A 3VDGA 4H8NA 1TWDA 4HCDA 2DUXA 4LBRA 2GL5A 1EX1A 4JY9A 4JQ4A 3VM5A 5U7SA 1OX4B 2PWUA 1TCDA 5T91A 4LY4A 3S6OA 5DT5A 5I6SA 3A64A 4BWLA 3WLQA 5KSWA 3IIXA 3PM6A 2WNNA 1S3TC 3WLOA 4FF7A 3TP4A 2Y88A 1HP4A 1I45A 4BQ5A 1V7YA 4P7RA 4E2VA 1US0A 1XCFA 2VFHA 4IXHA 3RO6A 3BG9A 4JFSA 3P8JA 2F61A 4Y6GA 3C4UA 3E0VA 1JUEA 4N9BA 3GRIA 1LCOA 1RQBA 2XGIA 2Q8ZA 1G94A 2VZVA 3DDMA 4GD0A 3M7WA 4KFNA 2YX0A 3FV9A 1ZL1A 1NIUA 1MFUA 3VGFA 2BX7A 4YWSA 2HCVA 3EOEA 3PPFA 3B97A 3LTPA 5EU9A 2KAUC 3AC0A 3PFRA 3GH7A 1JRCA 2QF8A 3SQMA 1K3UA 2J7EA 1DQWA 3NPWA 4OBTA 4GG9A 1D7KA 1ML1A 5I23A 2GSEA 1V6TA 2I9UA 5DEZA 3QYQA 2Y5EA 3GC5A 4Z1YA 2VRKA 4Q8NA 1SVDA 4HSHA 4Z2IA 3BURA 2ZZ2A 4CCDA 3UCCA 1XLLA 1CYGA 1TO3A 1ZJBA 2VCCA 4KERA 3C0JA 2EEXA 3R13A 4CCZA 2OTDA 5CLWA 2J78A 1BHGA 1OYAA 4EF8A 5CJ5A 5D2VA 4MZ8A 3F4NA 1RJQA 2HNHA 2E5DA 2B7OA 3NOEA 4ES4A 3VD9A 1WV2A 4EPEC 3W3OA 8XIMA 4BA0A 3TQ0A 1B3OA 5FF2A 3CLMA 3S5SA 2VP8A 1EPXA 4KCUA 3IJQA 2J66A 3K30A 4RPPA 5CZKA 4XKMA 3HV8A 2FVLA 3RLVA 1OZQA 1KA9F 3F7JA 1W5OA 1REQB 3BGGA 3FN9A 3W22A 1WZMA 2E6YA 5D05A 2CBIA 3VZXA 4JTCA 4TVDA 1EDGA 3T0TA 2WMKA 4FNTA 4CQ8A 1H41A 5M17A 4PRRA 2BS9A 2YJQA 1VJIA 3ZT7A 4V2XA 2EPNA 4ZB5A 5EGRA 3GXTA 4US5A 1HO1A 1W3TA 3PJUA 2BV9A 1JZ2A 4RNIA 5DMYA 4C1NB 1GVSA 3MHFA 1VYPX 5D02A 4L1GA 5I24A 5BWFA 1LP6A 1XG3A 5AHNA 3SRDA 3QH2A 1EYWA 1IT8A 3EB4A 4UTWC 4XVEA 2BY0A 5AHIA 2YCEA 5G5IA 3N73A 3UU0A 2CBUA 1XWYA 4ML9A 4RW3A 3GC4A 5CAKA 5AECA 1QAPA 3PTMA 1Y7VA 4OHQA 2CWNA 3EPNA 3W88A 2J4GA 3M46A 4AZIA 4KGJA 1JXKA 1M7XA 2PEVA 4JFUA 1AW1A 1JDFA 4PB5A 3TYCA 1GHRA 1X38A 3RCMA 2X30A 2W9MA 1SUXA 3WLJA 2A79A 4WDWA 1H5YA 4IQDA 1CT5A 1LG1A 3N25A 4W8LA 3WFAA 1PX3A 4JIRA 4NNAA 4LANA 1C9DA 1HJWA 5LIWX 4NZFA 1REQA 5AN7A 4L1WA 3PPGA 3MPGA 2EAWA 2CZVA 2WMHA 3RILA 3U7BA 4CN1A 2DSKA 1VD6A 4GUFA 4S3DA 1AFSA 1T5AA 2R24A 3W24A 2YDSA 2DY3A 1E70M 1K8CA 2GVEA 5KZ6A 3VKCA 3C0SA 1LF1A 2ZC1A 4JD4A 3CPRA 3QQWA 4LSBA 1QCWA 1VZWA 1XYAA 4PUDA 3C52A 1FDZA 4AQLA 3KM8A 1QRQA 2PZ0A 3C2YA 3ALGA 2D20A 3ISIX 4K7YA 4E8CA 1HKVA 1J0KA 1OFBA 4LBUA 4W85A 3O06A 4IPJA 4MF4A 4PBEA 4C1NA 2X0YA 4RW5A 2H9AA 4A2RA 1H11A 1CLKA 2XM2A 5FCZA 3ITOA 2ZVRA 1CXFA 2OSXA 1LOSA 1TV8A 2CZ5A 5JIWA 4B5UA 4PUEA 4H41A 4RNHA 3HQOA 3LQLA 1HL8A 5CJMA 4QE5A 1QI0A 2QGYA 4QNWA 1Q6QA 2XVLA 3DXIA 4BQ3A 3NPUA 1YBQB 3G1AA 3EWUA 1V03A 3WNLA 4LUJA 1XIIA 5BRQA 3R79A 2FGZA 3S1WA 3WJZA 1GOMA 4RX0A 5CPNA 4I8DA 2JKEA 4GUHA 3CYJA 3R1ZA 1W9PA 3LTSA 3SCWA 3NQ2A 4XKYB 3OLIA 3IWPA 2Q71A 2A3BA 2OT1A 3KHJA 3LHZA 4WF7A 5GNYA 1UW9A 3M0HA 4DJFA 1QK0A 5EMMA 3AMDA 2BODX 3TMLA 3QSTA 4O15A 1GQJA 2QCDA 5AYYA 1SR9A 2Q3RA 4JYEA 4UTUA 2NSOA 2QCLA 4QBXA 3A9BA 4UTTC 4Q4OA 2P53A 3BMXA 1ZS2A 4DZ5A 4KGLA 3VOIA 3ZLGA 4ZODA 4OU1A 4LY8A 4GUJA 3FAXA 5LKYA 4JAWA 3TC6A 1K4HA 4OT7A 1SZRA 1U1JA 1QPKA 2X7VA 4Y9AA 3RUBL 4PTDA 3UR7A 2YSWA 3W2UA 2QIWA 4JTDA 4Y90A 6ALDA 4AD4A 1F61A 4D6IA 4QROA 5FEWA 2YA2A 1E9LA 1Q4WA 4W87A 3DHPA 1TQJA 3JZUA 4LVAA 2G3MA 4KCVA 4O10A 3KRSA 3M44A 4HD5A 3R11A 2CHNA 1D3CA 3BSMA 2CLIA 4HHHA 2G41A 3LM3A 2NQ5A 3GFYA 5AVHA 1ME7A 1W9VA 4QJ3B 2HPIA 4MADA 3UXLA 1R2TA 3WIJA 4JKLA 3ONBA 3L5AA 3SCTA 3W7HA 3EEZA 3EA3A 4C6CA 3SCVA 3I10A 4OBSA 1YBQA 3S2CA 1UD6A 1I0BA 3EEGA 4J28A 4PRWA 3GTXA 3B9NA 3S4TA 3IVSA 2XYLA 2NQJA 1BF2A 4L6OA 5LA0A 1IXOA 1ZUAX 1KM5A 4C6QA 4PTWA 4C6IA 3F5JA 3GR7A 4XKYA 4QCEA 2IKHA 2W63A 5AC7A 2J7HA 3AYSA 1JI1A 3UZYA 3W1UA 3WBYA 5LHFA 4LU0A 4GY1A 3IGSA 5TQLA 3BGAA 3T2QA 4ZQCA 3CQIA 3A23A 1ZJIA 2VDHA 1GQLA 2PDMA 1RA0A 3HZ3A 2OO6A 2WNWA 3T9PA 1IHIA 5U4NA 3QC3A 2XG9A 3PBMA 2XU2A 1F3EA 4FAMA 2WJZA 4JTEA 1A0CA 3KBMA 3LPOA 3FGCA 3UWZA 3LGDA 5DMMA 3U4FA 1QBAA 3WLTA 4BEUA 1NAL1 1X8CA 3MUY1 1PZ3A 1EDTA 4L4PA 1VFUA 2PU0A 3QHNA 3IJIA 4DNMA 2D2OA 3TYBA 2FYMA 1DWFM 2ZWZA 4M6VA 4H6EA 5HJYA 2EGZA 1L6FA 4LC6A 5E9AA 5J8LA 1IIGA 3CZEA 3DGBA 3UPMA 1YKWA 1VJZA 1PCKA 1W56A 4LUIA 2ZC8A 4A05A 3S8HA 1GNXA 2ZTKA 5HJXA 2P5NA 1XF0A 4XVDA 2PTYA 1F5ZA 4E0CA 1XPYA 3WKZA 3W28A 1L8PA 3TOPA 4O1FA 1OG6A 3DG6A 1W8GA 3S5NA 1TRIA 1GZGA 1R9ZA 3SECA 4JTQA 3ARVA 1XJBA 2IW0A 5AC4A 1KM4A 4JGDA 3ANVA 5CSSA 3RRXA 1IYXA 2VX5A 1H49A 2GQ3A 5E0CA 3F2DA 3TW9A 1TVLA 1AH0A 3LTYA 3NR0A 2GGIA 1DWGM 3NA8A 3NJ3A 1H3GA 1UP0A 3KTSA 3CT2A 4HK6A 4HU3A 2W4XA 3QOMA 1NH6A 1R5YA 2ZA1A 3HQPA 3S46A 3LI1A 4D8AA 4PGLA 3FLUA 3DH7A 4DO5A 1MDRA 4MJZA 3QSRA 1XBXA 3IRDA 1XR2A 1ICSA 4CQCA 2Z6JA </