1QK0A

Cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk0A00
3ABXA 4AX7A 3VOJA 4A05A 3A9BA 1OCJA 2BOEX 1UOZA 1HGYA 4I5RA 3RPTA 4AVNA 1UP0A 1QK0A 1CB2A 4B4FA 4B4HA 1UP2A 4AU0A 2BOFX 1OCBA 1GZ1A 2BVWA 3VOIA 3VOFA 1OC6A 1UP3A 4AX6A 3VOGA 1OC7A 1QK2A 1TMLA 3VOHA 1DYSA 2BOGX 1BVWA 4AVOA 1OC5A 4I5UA 1HGWA 1OCNA 3RU8X 1QJWA 3A64A 2BODX
chains in the Genus database with same CATH superfamily
3UZXA 2RH9A 2YKKA 1BQCA 4XWUA 4FB7A 3M0KA 1QHPA 3AIBA 3HQPA 4GX8A 1TJPA 2W63A 4BEUA 4FF7A 1GUVA 2G3JA 4NYUA 3SRDA 3V0SA 4R53A 4TTGA 1OCJA 1QOXA 4PTDA 3KFTA 1FWWA 3M07A 3HPSA 3VD4A 1OABA 1EC9A 1U22A 4Z2GA 2DPEA 4FLQA 1JD7A 3DN5A 1A49A 3W23A 1QHOA 3PZUA 8TIMA 4LBUA 1IWBA 4MDOA 3G22A 3CT7A 2GOKA 3TN6A 4UTIA 1AH0A 3MO4A 3M6YA 2V38A 1GQLA 1KQZA 1XYZA 3R0DA 3P84A 3RLVA 3HG4A 3F1QA 3WLKX 4ZL1A 4BS0A 3IJ7A 1ZBCA 3GNDA 1XBZA 4XV0A 4YTSA 4KH2A 4PUJA 2VRQA 4Q7IA 1SM9A 1QAPA 3LBCA 1UZ4A 1UH3A 3AZSA 2JKAA 2VFHA 4LS0A 3M0VA 1OX4A 4JIQA 1YXYA 3QLLA 5M17A 3N25A 4HZMA 5F1VA 1XKJA 3BSHA 3RLHA 3W2KA 3GK0A 3N9KA 3GXNA 3VKCA 1W8GA 4WKAA 3LHWA 5AC6A 2WVTA 1VENA 1EIXA 3DX5A 3NSMA 3NEHA 3U9IA 3GUWA 2J27A 2HE5A 4N6FA 2VQTA 4HSNA 3CHDA 4MJZA 3VIHA 4AXKA 4PUNA 4JY8A 1WXJA 1E6SM 3NQAA 4QX4A 5CJNA 4V33A 5FEPA 3N6JA 3QV9A 3UG8A 3VC6A 2HE8A 4Z1YA 3P3BA 4HNOA 5HJXA 1LM1A 4HK6A 1FWJC 3S2LA 4XISA 4BHYA 4PA8A 3OHMB 3D6NA 1VRXA 4EE9A 5IFTA 1V3MA 3MUXA 4L64A 3S46A 4C6DA 1OFQA 1ONRA 2G41A 1TPVA 2QW5A 5M2FX 3VOFA 1TIWA 3KS6A 1PB0A 2DZWA 5H8UA 4DO7A 2WZHA 4DNHA 4FZIA 5XIAA 4C1KA 1TV7A 1WKEA 1TPFA 2B81A 2JQXA 3MP4A 3HTWA 4NJIA 2TODA 3G24A 4QROA 2PF8A 2WWDA 4M24A 2QCCA 2XINA 1TE1A 3S2CA 1HVXA 4U4MA 3MWAA 3TSDA 4Q32A 3CMJA 5BMXA 1UOKA 3R5EA 4ATLA 1MUWA 1SW0A 4A8NA 1NP0A 4HYRA 5HMFA 1OFOA 1Q6LA 1DQUA 3JR2A 4EXQA 1ZAIA 2CBJA 1BPLB 1V0LA 2X41A 1FWTA 4P8UA 1R3SA 4K37A 5C9ZA 2BVDA 2VELA 2IPFA 2GJXB 2NQ9A 4DF0A 3SEPA 5AC7A 2ZUWA 4JGDA 1JZ5A 3R12A 3M0JA 3H22A 3KXQA 3WNPA 1NAL1 1YIXA 3A4WA 4HA0A 4ILSA 2UV8G 1S5MA 5TAOA 1FDYA 4DAIA 4O1BA 5AB3A 2IPWA 2WCGA 1OYCA 3VMOA 1XW8A 3W1XA 4NSBA 1JUBA 3KM8A 3CV1A 3LMZA 3HMJG 3IVSA 3PZOA 3BW4A 3UBPC 1LL4A 2XFWA 1LZOA 2EPOA 4Q33A 3E0IA 1GZGA 4TVDA 3N6QA 1X1ZA 3MS8A 2XDFA 2Y8KA 4AZCB 5HWNA 1NOWA 3HBLA 4E3VA 4AIUA 5HWJA 4LT9A 1Q2RA 3URAA 3FGCA 2YYTA 4M7SA 1OG6A 4NIRA 5LA1A 3TYBA 4AG0A 1JNDA 3STPA 3U5YA 4AAJA 2C6QA 3DUGA 1WDSA 3TTQA 5ABHA 3LRMA 5K3VA 1H7XA 2OKTA 1KV8A 3CHFA 5LNRA 3M6DA 4QG9A 2Y61A 4IGHA 3WLIA 3SN1A 3K46A 4A05A 5F2LA 1HVQA 1H7NA 2I5GA 3N1AA 4B4FA 4R7JA 1R87A 4DXVA 2Y5SA 3W6YA 1PTDA 3UZZA 1CXLA 1GGOA 2FZNA 1V5XA 3I6RA 3KL5A 4WF7A 4Z0SA 4UCGA 3TLQA 2XG9A 2Z2BA 2WSRA 5CCZA 1KM1A 1V7AA 3JZEA 3UGRA 2ZZ1A 3M5VA 1EP2A 4F40A 4KGJA 4JBRA 2WZEA 1TR9A 4E5TA 1S2UA 1NSJA 3WLOA 4NXKA 2PGWA 2FTYA 2V30A 4WY0B 3DKJA 5BWFA 1VPYA 3BMVA 4GQQA 5GJPA 3F5KA 4W93A 2CZEA 2OMAA 2FDMA 2RDXA 3V7PA 3N18A 1OT2A 3TQVA 5IFPA 4Q4PA 2J8GA 3WEMA 2FPTA 3GRIA 3T05A 2BY2A 5XIMA 3MUIA 6ENLA 1GQNA 3N12A 2OLHA 1CNVA 3KDNA 1DBTA 4M56A 4AF0B 1TG7A 3K1DA 3VCRA 4O4VA 2GVGA 5D04C 4HPJA 1VCFA 3BZJA 5BOFA 1AQFA 2VR2A 4LAZA 4JCMA 1M01A 1FWEC 5FIPA 2QULA 4YTUA 1IT8A 3MPGA 3DG7A 3R89A 4L4MA 3WBEA 3SECA 5FJRA 2PRHA 4G7EA 2I9EA 4OBTA 3AS2A 1PZ3A 2L5HA 5FF4A 3FW6A 3S1VA 4RZBA 1W6TA 2XIBA 4DQWA 1KXQA 3GB6A 2AL2A 2E67A 3MV11 3AIVA 3DDMA 1HQTA 1GZJA 4F66A 1GVYA 3HFYA 4UTWA 4RXFA 4HNVA 4K1WA 4PZVA 3HQ1A 1NWRA 1KKOA 1UZ1A 3EXRA 5JIWA 3ZLHA 1PV8A 4FP1A 4UMAA 4BEQA 4UZSA 3O6CA 4JQ4A 1WA3A 1YQ2A 1AQHA 1DQWA 2Y1HA 3TXZA 3A3WA 3O2LA 1FHVA 1XIMA 2D0FA 1XSKA 4B5NA 1Z7AA 2EO7A 2G3NA 4UZUA 5F2GA 2BVYA 2FKPA 5DCDA 2G95A 1EIBA 4IQEA 1SVDA 5JBDA 5G2IA 3AMLA 4YN5A 5AYBA 2GLKA 3PZVA 3T0AA 2P88A 1VLWA 3SDOA 4OWGA 1QBBA 4M8UA 1V77A 1JDDA 1J5SA 3GXDA 3BURA 5FI8A 1VRDA 2J74A 3RIKA 4PMOA 1KM3A 5AHLA 4ICCX 3L0NA 3OYXA 5CZSA 4DZ5A 1ZQ5A 1OZQA 1BYBA 1SMAA 3G1AA 2ZTJA 3S47A 3MQTA 3W22A 4PGLA 4CNOA 1YMYA 3WK1A 4DBDA 1FCVA 1BVNP 1CDGA 4P7NA 3B8VA 1GW1A 1KFJA 3QV7A 1Q6DA 1JI2A 1PZ2A 1RP8A 1XLAA 3TK7A 4FR1A 3D5HA 1R6WA 2DZVA 1AA1B 3M0XA 4HGXA 1ADSA 3GW0A 3KTCA 3LCWA 4GUJA 4KETA 3FEQA 4AY1A 1HL2A 5E93A 3DKLA 4PBFA 4YHGA 3BSGA 3LN3A 2H8ZA 4JL1A 4FOJA 4TV6A 1QPOA 4V1YA 3QW3A 2W27A 3GVRA 1IT7A 3O1NA 3VVGA 1LLOA 3W1MA 3C3UA 5DXXA 4DIAA 5XINA 3F4DA 4WGXA 3NZQA 5DBUA 4WSKA 4IT1A 3W7EA 2HBXA 3TE9A 7ENLA 1XI3A 2XM1A 3BC9A 3FJLA 1SJBA 1C9DA 4PUKA 3B0VC 3FX4A 4DNMA 4KFOA 3BH4A 3N4AA 1EO7A 3LPFA 3P0XA 4DHGA 1O5RA 1PBGA 4DPQA 5FL1A 3PTQA 1AJ2A 5HAOA 1ZJBA 4HNUA 1T41A 3NQ8A 4MKNA 2DZUA 3AO0A 4FI4A 4Q4SA 3RO6A 4ZZ9A 3IAQA 3SQMA 2DW6A 3BICA 1DWGM 3AZRA 3GC4A 1D7KA 2HV5A 3ES8A 2OELA 1VGAA 5E5CA 4OU1A 4IUGA 4ORIA 2Z27A 2HPIA 5E09A 5JBEA 4GINA 4HOWA 1AD1A 2EPMX 3TYUA 1P48A 2HQAA 3ERPA 3SCOA 3AAMA 2JE8A 4XZIA 5BRPA 3FJ4A 3UG3A 2R1PA 1EGVA 1XSJA 4EIVA 2I7GA 3TNBA 1SZNA 3WYZA 1GPWA 1DJYA 2VDGA 3CZKA 3KP0A 2ZVRA 1QXLA 2J9YA 2WW5A 3WLPA 4WOQA 3D0CA 3BGJA 3AMKA 3GNNA 1A3XA 3EKGA 1OX4B 4Q8MA 1A5BA 3W2JA 3OZMA 3HPFA 4YCPA 2PTYA 4L1GA 4E0CA 3G3DA 3E0FA 4CEXC 4UOZA 4WKFA 4JFVA 1XC6A 1VR6A 1IZKA 2VZUA 3TN4A 4DELA 1D8WA 1SR0A 3LA4A 7TIMA 3A24A 4K36A 1FP9A 3GFXA 3I6TA 2BSLA 5T9BG 5DMYA 4C6LA 1BQGA 1SUXA 3DYPA 4MMWA 5U7SA 3Q2DA 4W85A 3E2RA 1XGEA 3BAKA 2ZRXA 1UUQA 4MB3A 2WNQA 3TROA 3KBMA 4MG4A 3WNLA 2VEKA 4V2XA 3B4YA 3I65A 3DESA 4BQ5A 1RQHA 2PPGA 2Z29A 3EX3A 4A8LA 4H2CA 3S9IA 3QHNA 4JTIA 4B3KA 2NT0A 4H9YA 4UNLA 4C6QA 3HB9A 5FJOA 3ALFA 1V03A 1FFQA 3GKFA 1R85A 1E1CB 2NUXA 5C9RA 1PEZA 2KZHA 2QCHA 2QZRA 4U2ZA 5IDZA 3VCCA 4DF2A 2CEQA 2YCKX 5H91A 4HKPA 1DHPA 4FR6A 3ME3A 1KLYA 2GQAA 2GK1B 2NX3A 2WQDA 3S5ZA 3BCDA 2PLKA 3GNOA 3QY6A 3ABZA 1I1XA 2HTMA 1OJXA 2HPMA 4GCXA 2FVKA 3H2EA 2OT0A 1VF8A 5GNZA 1TV3A 5HJLA 1A5UA 2C1HA 5FESA 3RX2A 1BYDA 1F4HA 2CBUA 4GQRA 1W9UA 2HBVA 4QQ3A 4PYSA 4PMDA 4O1CA 2YFOA 3LCHA 1E4MM 4WJ8A 1NF0A 4AX6A 1VIWA 4AZHA 3CS2A 3P80A 3ITGA 1RD5A 3VI2A 4EACA 1QO2A 3JU2A 1LT7A 4WEVX 1W3NA 1ZU8A 4AX7A 1V3IA 1VHNA 3CYVA 2MANA 3VOIA 1V3KA 1UPMB 1ICPA 1J0JA 3PUEA 1CW2A 4NZ3A 4ZO9A 4GXMA 1JFXA 1XHGA 3B9NA 3CQHA 5C7HA 4ADTA 2PDUA 1JQVA 2HK1A 2VZOA 2RGMA 3CO4A 3SY8A 3WBWA 2OEJA 1D7FA 2C1GA 2P3ZA 3HPAA 5A6TC 1DPMA 1Y0EA 1XG4A 4IICA 1QMLA 1MNZA 1E15A 1KCLA 1YHTA 1WZLA 4TVUA 5GPRA 4PTNA 5CBJA 1QI5A 3S1WA 4QCFA 4GVHA 3C0JA 3DI0A 1MYRA 2YCEA 2QQ6A 1UIPA 3KWSA 2E3ZA 1P5BA 3QQ0A 4X0NA 1TJ0A 2VEGA 1JCTA 4AYGA 1HFBA 2NSOA 4ATWA 3O3RA 4CN4A 3SRKA 3UEQA 4O0QA 2GPTA 1AH3A 2CXGA 5D9NA 1EEPA 5AZ0A 3T78A 1OCNA 4UTWC 2PDWA 3FIGA 5DEZA 1P0NA 3THUA 2CXEA 1M03A 3G8EA 1E6RA 3SCVA 3T2PA 3WLHA 2VUYA 3Q67A 3EB2A 1I4NA 2B7QA 1JRCA 1VFLA 4X3ZA 2PBOA 4MPKA 3CK5A 3VNKA 3TC7A 2PDQA 1RD6A 3TXVA 1UG6A 1TRIA 4EPBC 3MHGA 3WD3A 4AUBA 1GOOA 4M6UA 2EG7A 4FIRA 3VA8A 2CERA 2AL1A 4PMJA 4C6OA 3TAKA 1WDQA 4B5WA 2DUZA 3Q58A 3H4XA 1E43A 1TZ9A 2V6AA 3PHAA 2GSHA 1IV8A 1K1DA 2AOSA 5FJTA 2QCDA 1CGWA 2WMIA 3CUFA 4X0VA 1PKNA 1PUDA 5ABFA 3DHFA 1FCQA 4HN4A 4S3GA 2V2DA 3NSXA 4LCSA 3R1ZA 1GNXA 1HO1A 3AZTA 2VGFA 3GLCA 1FWRA 3B0XA 5A8GA 2CKRA 1XYCA 5F1UA 3FXYA 4N9CA 5DO8A 3OGRA 1EP3A 2ZYFA 1N8WA 3IK2A 3NAVA 3DGBA 4GRSA 1QW9A 3I3EA 1XG3A 3RU6A 3SM0A 3N2XA 4Y8EA 4JTAA 4OJYA 3SGUA 1EBHA 4GX9A 3NXFA 2IUZA 2ZVIA 4PODA 4AZGA 2QV4A 4JQ3A 1GT8A 1RA0A 3V4BA 4LVBA 3SGGA 3CHCA 9RUBA 3AI0A 4E2DA 5GJMA 1H5YA 3ITOA 1ZNNA 3N34A 3CNYA 4K2SA 1QHZA 2ZCGA 4XZLX 3E1F1 4C91A 4LVFA 4GO8A 1OYBA 2A7NA 3B8DA 3PP7A 1AK5A 2CZDA 5KINA 3GYEA 1JXKA 4D6FA 3U4AA 3THCA 2VX7A 3G6MA 3E49A 2OU4A 2Z24A 3BW2A 1FBAA 2GJLA 3FY1A 2FTPA 3IGXA 3EWCA 4CD5A 4LAUA 4GQBA 3WQ6A 1GKRA 2VP8A 3T2QA 2QJMA 4K68A 2CWNA 4IWWA 3G5EA 1A5SA 4QE4A 3BCJA 4QLJA 3WJSA 4KIRA 1O6IA 2WM0A 3L4XA 4J4KA 4HT3A 2ZX9A 3W71A 3L0KA 2XIQA 2WHKA 3T0BA 5CPLA 1LBMA 3K4WA 3FOKA 4L9YA 2ZQ0A 3SCTA 2MUCA 1RLDA 2J66A 4R5EA 5K7JA 3N17A 1OB0A 3IJDA 1UMLA 5BU9A 2HEJA 1Q6FA 5AC4A 1C92A 4XO6A 3PK7A 2DEPA 2X1TA 5CEWA 3THDA 3I68A 3UR8A 1C3FA 5I3DA 3BAYA 5EPDA 3EWYA 4PCFA 2C7FA 1B4KA 2HK0A 3G1SA 2OEMA 3CAVA 5I02A 3WFZA 4Q7NA 4LC8A 4MSSA 1CXHA 3VD5A 3FEMA 4DZAA 2XH7A 1E6QM 3V0TA 4N7QA 4GYPA 5I3KA 2WHJA 3RG6A 3PZNA 1GYLA 3H6OA 3TYEA 4G1KA 4KWOA 4N9BA 2MNRA 5HNNA 1M5WA 4D6HA 3W81A 4DJEA 1PO9A 1WKYA 5C70A 1FWBC 1TWDA 1S2AA 3OOQA 3CZGA 1SU5A 5M1TA 5I06A 3GXIA 2J79A 1J10A 3DEQA 3P93A 4KWVA 4ORMA 3RMEA 3EOUA 3GXTA 1R0MA 2E8YA 1NDZA 2IQDA 3O6YX 1HIZA 3QOMA 4A35A 2ACUA 5AHFA 2A4AA 3JRKA 3LPGA 2E1WA 1PSCA 3LB0A 3UXDA 2BXZA 5BZAA 1W3IA 5ABTA 2FZDA 2DJXA 1LUCA 4QTGA 1VQTA 2HVOA 1ESWA 2BY1A 4LYKA 3N15A 3AROA 1LBFA 1UOZA 1FKWA 1UR1A 3OBEA 3NQ6A 4GH1A 2ZC1A 3FA5A 2ZUTA 2B4GA 4IPLA 1MDLA 2C14A 3LHUA 4Z2LA 2BGQA 1RVGA 1MMFA 2QJHA 1CLXA 1R38A 2F38A 4PSPA 2C0HA 2X16A 3EXSA 4LU0A 3LXCA 2G8ZA 3U0HA 2WNWA 3BE7A 3B0PA 1AL8A 2R82A 1E0WA 4MM1A 1J2BA 2R91A 3WSUA 2CETA 3CHVA 4GY1A 2FFCA 4ZQCA 3OGSA 1QI4A 2XFFA 2R6OA 1MEWA 3KZSA 1EZ2A 3POCA 1JZ4A 4DJFA 2ZA1A 4MAZA 2PTDA 2Z7KA 3EPNA 5FAGA 3GX9A 2IXUA 1YDYA 1DJXA 3CB8A 2JEPA 1UBSA 3AXIA 3S1XA 1S3TC 4LUTA 4QS6A 3OBKA 1JAKA 1XIIA 3BK0A 4PE8A 1DIEA 4IG2B 4ZODA 4NI8A 2BOGX 1VFMA 3IGSA 1HT6A 1XDJA 2O0TA 4K7YA 2G3FA 2ZRVA 3RM8A 3AFBA 1HN1A 5A8PA 1E72M 1GKQA 4XKMA 3DG3A 3UVAA 3R58A 3N29A 3NR0A 1FXQA 5B7ZA 1BTMA 2WZTA 3EDKA 4N02A 3NA8A 5FAJA 4GK8A 3EEZA 1F76A 1JZ7A 4H41A 3WN6A 1P0KA 4PL1A 1TWSA 3GS6A 2GVYA 4GIYA 4KWUA 2X8RA 1V51A 3CO8A 2QUMA 3PR2A 3H24A 4QG8A 5CAKA 4UR9A 1W2VA 2O7SA 2A6LA 4WZHA 3MBFA 5EL1A 1HJXA 1FWHC 4P8VA 5BXSA 2YGYA 4HNTA 4EPKA 5A8OA 5JQ9A 2E5BA 1PVNA 1I60A 1OADA 4EKJA 4XG1A 3LV6A 1KXTA 1CEOA 1FWAC 3VOGA 2W66A 3CBWA 4OFCA 2W3ZA 4XTDA 2QEZA 4RJEA 3TR9A 4E2VA 3UJEA 3AHTA 3O06A 4XAYA 1V3JA 3B8IA 3B0YA 4NZ4A 1UQYA 2ZX7A 2PWVA 5A8MA 3BJSA 3G1RA 2VCBA 1JPHA 3F03K 4AFYA 5KMYA 3HMCA 1O5XA 2QS8A 1ITUA 5PTDA 5D8ZA 1KTNA 2NQZA 1NARA 1R3QA 1W3LA 3E2VA 1POJA 2EJ1A 4ZTXA 3CQKA 2VM8A 1W9XA 1W1TA 1A3HA 1C8YA 4S2BA 5SWUA 1D3HA 4CVUA 1T6MA 3R11A 2YW3A 4RV8A 1XC4A 4IP4A 3I4EA 4F8XA 2RJHA 3PUDA 3LHZA 2PLMA 4NZFA 3WF4A 3GQYA 3NIYA 5EMKA 3L5AA 1AZ2A 4AHQA 3MSDA 5CAHA 3QBUA 3UR2A 4FS9A 5H1WA 1VJSA 3S0CA 2WZMA 3TZNA 5I00A 3DU0A 1NTHA 1E5JA 3CZJA 1MQRA 1QNPA 3MU7A 2E9MA 2OT1A 1LF1A 4J5NA 3WMLA 5FL0A 1B3OA 1Q3NA 3M7WA 1PIGA 1KCKA 2QF7A 3GNRA 4D72A 3ABXA 3EWZA 2D24A 3BVJA 1AG1O 1F7BA 3ZT7A 2A3HA 1S2CA 3VMPA 2VR5A 1GK8A 3ZXWA 4IQLA 4FHAA 4JIEA 1OWQA 1TA3A 4CGTA 3HG2A 3MUZ1 5ABEA 4CQCA 1EX1A 3PAJA 4QIUA 4QQUA 2PCQA 5C9UA 1GVFA 4ZBCA 3GFYA 4PMUA 2NV1A 4Q8TA 2QJNA 2IS7A 3GG8A 4L4LA 1WDPA 2A5HA 1XSIA 1R3YA 1ZP4A 2IQ0A 4AIBA 3T4WA 3EXTA 4LS1A 4KMQA 1QNQA 4XSLA 1DWHM 4QDMA 3RLGA 4XUYA 3AYSA 3L9CA 4NT0A 2E9LA 2NQ5A 3SB0A 3KLLA 4HSOA 1HJQA 2X0YA 1UA7A 2JIWA 2VOMA 3E2SA 1DE6A 5FEXA 4UB9A 4IJBA 2YBUA 4CU7A 1IGWA 5HNTA 2FPYA 5D37A 1MNSA 2O9TA 2QCMA 2RAGA 3AJXA 3MY9A 4N4QA 5I0DA 3R13A 3BSMA 3LCIA 3PSWA 4S3AA 2EG8A 1KM4A 1RH9A 3HG3A 3KL0A 2G3IA 4XVEA 4DBSA 1FXPA 3IANA 2WB5A 4JFSA 3AIEA 3UJSA 4YPJA 5I3FA 1W37A 5K9XA 4H04A 1OX6A 3TJXA 1YKWA 1MWOA 4JFTA 1GVIA 1PHQA 3P7YA 2D69A 1VYPX 4C6BA 2VFEA 4YCOA 3RR4A 3W1NA 1C8VA 1P4CA 4JYDA 3TOYA 2GUUA 2V2CA 4LFYA 4E38A 2V9DA 2YLLA 4JTKA 5D2TA 4ZQNA 6REQA 1AVAA 4HIBA 3B8SA 4US6A 3KBNA 1L9WA 5C2GA 3TIMA 5FKYA 5D2VA 5L9FA 2FZ8A 5J04A 4U5KA 4AHOA 5IOBA 3SSZA 1AL7A 3P67A 1DJZA 3TW9A 1UJQA 2XIIA 4WR3A 4L6HA 5CBIA 1VFHA 4CCDA 3B8UA 3R8GA 2VX4A 2XZ7A 1HP4A 1TCDA 4LNYA 4DJDA 3GR7A 3STCA 4DJEC 3L4WA 3PZGA 2X1RA 1B31A 3W1RA 4IGNA 4ZXOA 4G56A 3LHVA 1B57A 3LPOA 3ZM8A 2VVSA 3RPDA 1DIDA 4QE5A 2YPIA 3GXPA 3VKJA 1KBIA 4JTEA 3IS4A 4RKAA 4HNCA 2ZTKA 4FMVA 1RK5A 3RR1A 4GNVA 2IPGA 1G4TA 3UYIA 3LLXA 1B9ZA 1OC6A 2Q8ZA 3A23A 4AWTA 3LSCA 1W9VA 1MW1A 3SRFA 4P2VA 3T0DA 2XVNA 1N8FA 3VIIA 3UWQA 2C71A 1MEIA 3S5NA 4GZEA 3U6WA 4L4OA 1E6XM 1ISWA 2YXXA 1A50A 1TV4A 5IM51 1TJ2A 3NQGA 2V5CA 7REQA 3WQFA 1C7TA 2BV9A 4UTUA 3G77A 1UD4A 4L6DA 3CIWA 3B40A 3AXHA 3POHA 1S38A 4NG3A 3GM8A 4DJFC 2PDHA 4I8DA 3RYSA 4BKNA 5C71A 2Q6ZA 1KFKA 4ZO7A 1KFCA 1LT8A 3B05A 3VGBA 4GWEA 3VOJA 1E3XA 3TN5A 4H6QA 1VBGA 1ZBKA 4H8NA 2CLHA 2PWHA 2P53A 4NAFA 4XBKA 1KQYA 2XISA 4F2BA 4D6JA 4RE2A 3YPIA 1H60A 3T81A 4O1FA 4IQJA 5EA9A 3A64A 5FSDC 2FDSA 1CGYA 3PJWA 1HGYA 2AKZA 4K8HA 4DJED 4F0KA 5ABGA 3KWXA 4OGZA 3WH9A 4HHPA 1P7TB 4E2OA 4GMEA 3H21A 5AHNA 4XAGA 1T96A 3PWGA 2X30A 4E4FA 2PWGA 3G1DA 1KFLA 3UPBA 4TVCA 3NQCA 3ZO9A 1R2SA 1WXYA 3L23A 4BI7A 3ZIZA 3A12A 3BJFA 4GJIA 1V93A 3VUSA 3TW6A 4D6EA 3E0VA 2Y8UA 1JCMP 1U5VA 1HL9A 3GHSA 4LX4A 5DLCA 1MVYA 2Y70A 4J3XA 1B9BA 1FHDA 1ITXA 3BGGA 5I2UA 3T8QA 4PCNA 3VAVA 3A5FA 3W53A 1Q8JA 3DFTA 3EB4A 1MW0A 4V27A 1UWAA 4GC4A 4QSFA 1TTQA 2BP1A 3VIFA 2CU0A 3OZOA 2Q3OA 2WWCA 3KEHA 4Z1AA 1N55A 4EVZA 2GGJA 4PB4A 4C6JA 3WNOA 3CUZA 3UG5A 4LF1A 5FEZA 2VC9A 3A21A 1Y7VA 2QCNA 4PRRA 1K6AA 2VHLA 4JQ1A 2PE4A 4R7OA 3NDYA 3K8MA 1YDVA 1EYEA 4DJFD 4Z0JA 3NQVA 5DANA 3GU2A 1TIMA 3PNUA 3MKKA 1A4LA 1UR0A 5FJUA 1VPQA 4C90A 1X6UA 4EWJA 3MCMA 2ZA2A 2QNEA 3B06A 4BZYA 4R85A 3L4UA 1OIMA 2D0GA 1KO0A 2C91A 4HHMA 4UWMA 3VCNA 3CT2A 4O0KA 3UETA 1TPB1 1GEHA 3LGGA 3CLMA 1MRAA 1U30A 5U4NA 4PMZA 2XN2A 1Z44A 1LOSA 2PP3A 3LCFA 5EFFA 2OEKA 1HJWA 2A2IA 4KW2A 3E6EA 3OLEA 3N2OA 1TMHA 3BMWA 2P0IA 1TWIA 3S2NA 5C5YA 3V16A 5E9XA 2PA6A 3VFCA 3WUFA 3QKZA 4NNAA 2ZZ3A 4IFKA 2P10A 1HKMA 1UD8A 1L0PA 2Y5JA 4S3FA 1CCWB 5A6JA 4CU6A 4JX4A 2VX5A 1Q6GA 4GNKB 1IGSA 2VC6A 3MA8A 3GG7A 2HS6A 3L2IA 2UBPC 3INPA 3OO2A 3CZEA 2J7EA 5FJPA 3VDBA 2REQB 3TA9A 4DBUA 3WFLA 2CLLA 4HOZA 4GFSA 3W07A 1RR2A 5CGQA 4GUGA 4MWAA 3BO9A 3BMXA 4AZBA 4MNMA 2RGLA 4UTTA 1GHSA 3A6OA 3HM7A 1YDOA 3ANVA 4QLLA 3LLFA 2XH2A 5CC7A 1WZAA 2GVLA 1RAKA 2BY0A 4GUHA 4NF7A 3WH8A 3U3HA 2ODOA 1TPDA 4F9DA 5LXXA 3CZLA 3LZ3A 3VKDA 2R1KA 4FF5A 5CPNA 3MYOA 5J5DA 2XSBA 2BHUA 4CQAA 4CNUA 3T08A 3PG8A 3GNXA 4RE3A 3QC0A 3STGA 4IMEA 3QPZA 5REQB 3IVTA 5KITA 2NLYA 3NOYA 2HCVA 9XIAA 2PGFA 2YL8A 3CL8A 3CXOA 1GPFA 3V5CA 5DBTA 3PUOA 1X6NA 3UP8A 1XISA 4LB4A 2OZ8A 2VFDA 3F2BA 1HZYA 1K9DA 3KBSA 5LIUX 1HW6A 1KD0A 3RK8A 4YMZA 4B91A 1XYMA 1XQKA 3MZNA 2YX0A 1OFDA 1FH9A 4A3YA 4ERIA 1EWDA 4CQDA 4RK8A 1JYXA 4RDYA 2XTKA 1DL3A 5K2ZA 4HPXA 1F5ZA 4C1LA 4AZ5A 4NJGA 3RHGA 4DUXA 2CYGA 3B8WA 1SMDA 1JF6A 1ZZMA 5A95A 5AYZA 1R9XA 3BV4A 1XD1A 3PBGA 3F5JA 4GACA 4LUYA 1HP5A 1UCWA 2GFTA 3NZ1A 5BOEA 4TUFA 2DT3A 2EPNA 2H8XA 2BXYA 3NFUA 1TCMA 4Q8PA 1S46A 3UJ2A 3TQKA 3G6LA 3DFQA 1VBUA 3K30A 3CUGA 2QR6A 3SUWA 5D2YA 3RCNA 3EKLA 1MFVA 3OODA 1TPH1 5D38A 3B04A 4H8UA 2J7FA 1E9LA 2A7RA 3VZZA 1MI3A 3AU2A 1ZSXA 1K8YA 2R1LA 3COTA 4D71A 1ENUA 2ACRA 1UA3A 4XTIA 4ASTA 4MF4A 4O52A 2YL9A 2X42A 5LIWX 2OSXA 1BGAA 4PUMA 3LNPA 4G9PA 3ONBA 4LALA 4WKHA 1EDGA 1DXEA 4ZENA 4PMQA 4F9JA 3GTHA 1A0DA 1KWKA 2DZBA 1JD9A 4AVOA 3MC5A 4RV3A 1AODA 1SO3A 2FTWA 3VPLA 3W1LA 3DCPA 2FZ9A 4AW7A 4A3RA 2PURA 1JCYA 4REQB 4UFJA 1EDQA 3OIXA 3ZOAA 3B9OA 4RDWA 2CC0A 1YNPA 4X61A 3SQSA 4P7RA 3GE7A 3AIQA 4W8BA 1V8EA 3PAOA 3NCOA 5BXPA 3U7BA 4TXEA 3ARPA 4IPNB 3TWAA 1MDRA 4C6PA 1GOKA 3BQ6A 4XBSA 3GU9A 3Q94A 1BLIA 1GQJA 3Q37A 4RNJA 2ZWYA 7TAAA 3AMGA 2Z0IA 2QDHA 3MT1A 4H6EA 3FAWA 2CITA 5GQBA 5HATA 4MZYA 5AC8A 3KE0A 4GZJA 5IHRA 1FWDC 1U1HA 3NYDA 4US5A 1HF6A 2ISSA 3SY1A 4CD4A 1V6YA 3RFAA 3PZ9A 1PWLA 2O9OA 4WK9A 4H9MA 4FNPA 3GFZA 1XLDA 3CJPA 4DJDD 2E25A 2VWTA 5HUOA 3W7HA 5K9CA 1Y5WA 2FGZA 4PTVA 3TW7A 3LD5A 1L6GA 1PX8A 3TVAA 1PKMA 3WQDA 4U33A 3BAXA 4JTUA 4AEFA 1VBJA 3WDPP 3CAQA 3AYRA 1BRLA 4PL2A 3W28A 3IUIA 4ZR8A 4M1BA 3RGTA 4UQ9A 3V3WA 1OFPA 4Y6GA 3W87A 3PBYA 4OECA 2NUYA 2VD9A 1XUUA 4OKDA 4YTRA 1LWHA 1WV2A 1JI1A 1UW9A 3WLMA 1KXVA 2Z2UA 1OFEA 3H8AA 3S5SA 1QK0A 1JDEA 4NHVA 2Z26A 2GZXA 3RF9A 4DLFA 2VEIA 3BGAA 1JCJA 3ARRA 3MSGA 4BJHA 4UNKA 2I56A 2NX1A 5DELA 2PLJA 4LYPA 1A0EA 5IXEA 1U5HA 3HPZA 3I7QA 2ZRUA 3TTYA 1EWEA 3L68A 2WANA 4ICMA 1MZRA 4FXFA 4BQ3A 3HGOA 1KM5A 1PAMA 3NGFA 1K3UA 3IGHX 2OWCA 2XWEA 5FCZA 4UC5A 4FAMA 3OLDA 2CWXA 2ZXBA 2C19A 1XLEA 3UXAA 3EB3A 5BU6A 5C7VA 1V02E 4P5UA 4UCFA 3EWUA 5TD4A 1E4LA 4BWLC 1TV2A 4H6KA 5LIKX 2P0OA 2PDMA 3NTYA 1QPQA 1I9CB 1QVBA 1N8IA 3CEPA 1EJUC 4DO4A 1KBLA 4YIWA 2BGSA 3AXKA 3BAJA 4BI5A 4NJJA 3WQ4A 6XIAA 2FIQA 1ZCCA 5FACA 1M41A 4CD6A 4S3JA 2C13A 2HSAA 4ZQPA 1HTIA 1Z9AA 1M68A 4YVPA 5LHEA 4A8RA 3GO2A 2FHBA 1GOMA 3D3AA 1V79A 1J18A 2C18A 2ZA3A 1R3VA 1TZ7A 4WXZA 2WM1A 5HJYA 4M3PA 3V18A 1H7OA 2OXNA 2F84A 4S39A 4QP0A 4KRUA 4IMCA 3NXLA 3IIVA 3NNTA 2DSZA 4JHOA 2XVLA 4JZ5A 4UQCA 4IP5A 2INEA 4AWEA 1AQ0A 3NVDA 3TNOA 1J6PA 4H8VA 1IXOA 1R47A 1ISYA 3EKZA 2AGTA 4UFMA 3W2UA 1HKWA 3IV8A 2ZE0A 4ACZA 6PTDA 1S1RA 3EA3A 1TREA 2X0SA 3F7JA 5AHMA 1UH4A 3SIMA 2VTFA 2CPUA 3W2MA 4YXGA 3URNA 1H7PA 1UJPA 4CNNA 2O7QA 3H7UA 4GC3A 4UIOA 2OJPA 2B0MA 4UFLA 3VE7A 4DAFA 4M6VA 3A22A 3RO8A 4DI8A 3AU6A 2NQHA 4H9UA 1HKJA 3SW6A 3N2CA 3WMCA 3RJXA 5E70A 1QPNA 1OF8A 1GKPA 3G1VA 3WH5A 2EBNA 4UNIA 3CH0A 3NZPA 3PANA 1E6PA 1IWAA 4B15A 2OR2A 1KR0A 2IPJA 1LRNA 2A79A 4B9ZA 2Y89A 4NASA 1BKSA 1BWLA 1IXQA 4RNIA 4LY4A 3ZVHB 3QGVA 5BNKA 3LZ5A 3CH9A 1QNSA 2WPGA 1DWFM 1F8MA 2RDTA 4JFUA 5GNXA 2OSYA 2J4GA 1W3JA 1E0XA 4AISA 1I75A 1OHLA 4K39A 2FVLA 4EANA 1B3YA 1JQXA 1IQ8A 3W26A 2Q02A 3WELA 1R46A 4B5SA 1DEDA 4E4PA 4P8XA 1TR1A 4D1JA 1TE6A 3GC5A 3TCEA 3JS3A 5A5WA 2YL6A 1J0YA 3CHEA 2WSPA 1E5NA 3FYYA 4JQ2A 3S9ZA 4DY1A 3W27A 3NSNA 1FKXA 3M41A 1J0ZA 1RPKA 3R43A 4XKYA 1C90A 4J9JA 1TB3A 3PZQA 3BV7A 3SCPA 1P6BA 3T4CA 2YR1A 5A6BA 3C86A 4YTTA 4KCUA 2E5CA 3MTWA 4ZOBA 4ZEPA 3N13A 3QLDA 4CN1A 4ADUA 1Q2SA 1S5WA 1SW7A 3UWZA 3DXIA 3S42A 3CL6A 4C1NA 4NILA 1P0DA 2J13A 5I79A 3NQ2A 1CGTA 4PUEA 1EOKA 3RUBL 4PC8A 1H61A 2QF8A 1Q4NX 4Q4QA 1XUZA 1FA2A 2VR4A 2GQ8A 2R14A 4UTHA 4UXDA 1P43A 1SPQA 3IRDA 1QR7A 1QFEA 1YXCA 5C54A 2VENA 4HNNA 2CKSA 4X63A 4UFIA 4DBEA 2E9BA 4JY9A 2WOQA 1ISZA 2GYIA 1OVDA 5A2BA 4LB3A 1GWJA 8A3HA 2HVNA 4EAYA 2FH6A 5A6AA 4PSRA 3M46A 2WVVB 1KR1A 3WEZA 1P0BA 1GVEA 4L1WA 3GR8A 1MO0A 3BAWA 3ZR4A 3CTTA 1RXOB 1W1IE 3QEZA 3T0CA 1WAUA 2A85A 2Z4GA 3H4WA 2FMNA 1SFJA 4YLWA 2Z1KA 2ZRZA 3VTRA 3CTLA 4UBPC 3EAUA 1THFD 3SCNA 2ZX5A 5AZ1A 1S5TA 4FNTA 5CPQA 2D73A 4ATDA 4GKLA 2WBKA 3EDFA 1PTGA 1BKHA 2W5FA 1FH8A 1PDZA 1OC5A 3HZ3A 4C6KA 4AZIA 2DZTA 4L4PA 5E0KA 1E0TA 1B90A 2E6FA 1G69A 2ALDA 1DJHA 2ZDSA 3UF9A 1GVOA 5MHBA 4NZCA 3UW6A 4J2PA 4R9XA 1MUMA 5HWMA 3GBDA 4O1DA 2RHGA 1ECQA 4PUUA 1JZ3A 4HCDA 1EO5A 2FGLA 2OQLA 2ACQA 5CG0A 4HU4A 1UWTA 3CWHA 3NO1A 1ZTVA 2QPXA 4JAWA 2V5BA 3KOWA 3T07A 3DYMA 3MI6A 3T40A 3F5LA 4M51A 1E9IA 3PBWA 1BXNA 3W73A 3DERA 4M6PA 4W7VA 3LCXA 2WKGA 2FHFA 3BLLA 3VIKA 3GG1A 2ZZ7A 1KM6A 1NEYA 1UKQA 1LG2A 4ACYA 1LOQA 1WOAA 1LRTA 3F2CA 4NNCA 4P7QA 2FFIA 3CLWA 3FDKA 3REQB 3FJ6A 3QMRA 4V1XA 2PU1A 3G8RA 3GH5A 3NQDA 1XCWA 4E8DA 2DVXA 2AGKA 1EQPA 3AHXA 4QNEA 2YCLB 3VGHA 2QUVA 3D47A 2BGNE 1EPXA 4YU1A 2DVTA 3WMSA 4JX5A 4QLKA 4CN6A 1MXDA 4W84A 2Z1VA 2GWGA 1JYVA 2YLAA 1A5OC 4YWIA 2IMRA 1PWMA 2XN0A 1T8XA 4OT7A 3CB3A 1EHNA 2WVUA 4GJ1A 4IFOA 2D3LA 4QJ4B 4MUZA 1S39A 4O1AA 8XIAA 2J7BA 3RM9A 3GIYA 2VEMA 3R6IA 5JVLA 3KHJA 1YPIA 4H2HA 4Q8WA 1GOWA 5C0QA 2QIWA 4RZ5A 2PZNA 2ZXAA 3QMSA 1KFEA 3N2MA 1B2YA 4QR6A 3SR7A 3ECQA 4B5XA 1XLLA 3IIZA 1SO5A 4WOZA 1IEQA 2PDCA 3HPXA 3OZPA 4JN6A 4C5YA 4Z17A 5MKGA 3E02A 4TX6A 3WD1A 2Y7DA 4MY1A 5CC6A 2NVCA 1VCVA 2YSWA 4LGXA 4O54A 1PKLA 1GHRA 1WBHA 4W8AA 1UPPA 1SO4A 2GGIA 2ZWZA 1LL7A 4IJRA 4JIRA 3L2MA 3RNDA 1PJ9A 4TX9A 1BAGA 2FPVA 1FVPA 4D1IA 3PBVA 1DHKA 4EX4A 4MB1A 1QDSA 3A9BA 3FYPA 3PPFA 1O95A 4GD0A 4US5D 1W9BM 1ZLPA 4NAEA 5T8GA 3UY7A 5HNRA 2VFGA 3G1XA 3BZGA 1OK6A 1OT1A 1BRLB 4Q8QA 3TMQA 2TRSA 2CLMA 3EMZA 1QUMA 4C6MA 4ZOEA 3DBPA 1Q45A 2ZRWA 2DFAA 2VVNA 1PIIA 2RUSA 3IIXA 3GR4A 1TUFA 4MB5A 1OK4A 1XGZA 1NM9A 3U8GA 5AYIA 1BSLA 4OV9A 4UTJA 1JDCA 2XZ9A 5G1TA 1NWTA 1PCKA 2W4XA 1ZS2A 1KGWA 2EEXA 4HA4A 1CXFA 4L5ZA 1R3WA 4GFIA 3M4HA 3UGVA 4UTMA 4AD4A 2V3EA 2FGBA 3VD3A 3L4ZA 2PODA 4IP7A 3KUMA 2ZZ5A 2EPKX 1XXXA 3C56A 1R3RA 2ZE3A 3VFLA 3QQ1A 2CHOA 3BPWA 1W0MA 3VZYA 1NY1A 1M7JA 2ZX6A 1LLZA 4HA1A 1ZJHA 3L12A 1RY0A 1W3TA 3PVFA 4POCA 1W3KA 1I8JA 1F6KA 1ME7A 2CLPA 2D1ZA 4PFMA 4PH6A 1A5KC 3M0LA 3CIXA 1F3WA 4ZMGA 5D2XA 4RUBA 2C79A 4NJKA 1ZPTA 4WDXA 2WJDA 5CZJA 1KBJA 4MAVA 1TPEA 2OGYA 5IBXA 4RDZA 3EDJA 3ZLFA 3ANYA 2G50A 4DM2A 5CH9A 4LYQA 1HJVA 5G4HC 4PBEA 1O1ZA 2W67A 1EXBA 4KCVA 3WD4A 2ZDRA 5BRQA 4QCEA 4NL1A 3JUGA 1ICQA 1RY8A 2PMQA 4FALA 1FUYA 2I1OA 3FLUA 2VCAA 2PUZA 2A3LA 1XIBA 4MPQA 1A3WA 2NV9A 1NELA 4B5VA 4PUWA 3NG3A 3IUHA 1DTUA 1QOPA 1W17A 3LDVA 1Q4WA 2E5DA 4C7GA 3M47A 4XK2A 2P8CA 2JGQA 1AMKA 3U48A 3E9AA 1RSCA 2Q3RA 2OVLA 4Q4RA 2JBMA 1BSIA 3M5YA 1DJQA 1GONA 3BLKA 2YBVA 4WGHA 1OYAA 4Y9MA 3MMWA 4ZOAA 2Y8VA 4HVXA 3T8LA 3OB8A 5IHSA 5LA0A 4GVGA 3VUPA 2BMBA 2NVAA 4FXRA 1US3A 5K4XA 1UR9A 1FDZA 1M3UA 3H70A 2GL5A 4BR1A 5HQMA 1J4EA 2OCZA 5DMNA 5AKQA 4KIEA 3C2VA 4J3UA 1JJKA 4XZHA 1I0BA 1Q6RA 1XRTA 5FOOA 3MKVA 1QPRA 4KRZA 2Q01A 4LUSA 2XU2A 1VFOA 4AMAA 1MQPA 1R2TA 4AH7A 2WXDM 3KHDA 4BF9A 1S5VA 1WPCA 3CYJA 3MMDA 3PZTA 4GBUA 4GI8A 3WLJA 4UQEA 4WSJA 4Z2KA 4A29A 3SADA 5CPMA 3EA2A 3KTSA 4HCLA 1J9YA 1UYQA 4IMAA 1NOUA 1Q6CA 2BS9A 2O9PA 3MSRA 2G37A 4GYKA 5CGMA 2Q8XA 3TYDA 3R2GA 1C9WA 1JPKA 4GG9A 1DWJM 4FX7A 1S1PA 5A6MA 2J8TA 3K5XA 3TN3A 3TSMA 3HFTA 1CIUA 4JICA 4EPDC 4I9AA 4KS0A 4J7RA 5DMMA 2D22A 2DZXA 3W7CA 1VIZA 1HXJA 3ZJ7A 2GDUA 4NUWA 2YDSA 3I10A 5C6MA 3ZFHA 2A3AA 4LOCA 2PC8A 3B9DA 1A80A 8RUCA 2UY5A 2DQWA 3TONA 1C29A 2DP3A 2ACSA 4D8AA 1EYWA 1HJSA 3LNMA 4DWSC 1OCQA 5A6BD 3UWWA 3MZ2A 5CBBA 1YADA 4PB3A 1IWPA 1DTNA 1G94A 1XH0A 2RDWA 4IFRA 1QK2A 4Z1CA 3VNZA 4TMBA 3TCSA 2PDNA 3W38A 1GJWA 3NWRA 3M0YA 3LERA 1FCUA 1OQFA 4O1EA 2D2JA 4F0SA 3K13A 5I78A 3NDZA 3CV2A 2WCSA 1LQ2A 3LXAA 1XLKA 3LI0A 1L8NA 3HQNA 1IEXA 4ZB2A 2WKLA 1G7VA 1LYXA 3FNDA 3IJQA 3QKEA 4W7WA 2PDLA 3NO5A 3WQCA 4C6NA 1J96A 5ECUA 4MNJA 1I1WA 4GBDA 4U3CA 5CC3A 3W76A 2FLIA 3U5UA 3OG2A 4O16A 2GQ9A 4GY0A 3EWWA 4AXNA 3NL2A 4JDYA 3P2VA 1HGWA 1J0KA 4OIFA 1CZ1A 5L6UA 2OO6A 3QXBA 3OLIA 5CZ0A 3W1QA 4KEVA 3MV01 3S83A 5G2HA 1EJRC 3UPWA 3UR5A 3VIJA 2W91A 1R7AA 1FWIC 3USBA 5CJMA 1R8LA 2ZOXA 4QRNA 3RPMA 1K9TA 1V4YA 1TSIA 3TLLA 3RRAA 5D30A 4FIQA 3HQOA 3I3BA 1O66A 1R7OA 1XH1A 3NZGA 1ISXA 3HURA 3IJLA 3QR0A 1MZHA 4X9SA 3TFXA 1EJXC 3VDGA 3P5YA 1M9HA 4LNCA 1BEUA 4DWSB 1XPYA 1GJUA 4M80A 3ITCA 3AOFA 3KCOA 4I8YA 4TOQA 3QHMA 4A8IA 4F0RA 3UQNA 1AUSL 4HU8A 4U5IA 1LWIA 2YXOA 2XVPA 2ZXQA 3M7SA 4DWSD 1IE7C 1CB7B 1VLIA 1B3WA 3PBUA 3WL0A 1H1ZA 2DZSA 2Z28A 4UTLA 5T9CE 2E68A 3LEPA 3NPVA 3QM3A 4CU8A 5HK4A 5HMEA 4MY8A 1AFSA 4G5DA 2FZMA 2CFFA 2XM2A 2Y5EA 2Z1SA 1KLZA 3URBA 4BF7A 1UWSA 4QEEA 4O50A 1SQ7A 2ZKMX 2VC7A 2EKGA 4RE0A 2NZLA 4QSHA 1G0CA 2EJAA 3SO7A 1NH6A 3TUUA 1TZZA 2JIEA 2ZXDA 4LEQA 5JXQA 3MUCA 1R9ZA 4AD2A 1VP5A 2QHAA 1XPGA 5DXYA 2DGAA 3MP5A 2X2GA 2QCFA 3NQEA 3EYPA 3W7LA 3JZUA 3S6DA 1GVSA 1X39A 1B0IA 3QQWA 2VFFA 1CWYA 4CD7A 1E4NA 4OOZA 3K4DA 4PTMA 7ODCA 4FNRA 1LQAA 3WH6A 3OBAA 1QNOA 3H2MA 2AMXA 1GG0A 3W72A 2FZBA 1XRFA 2OG9A 4GUFA 3E0LA 5CQ1A 4JIIX 4I6KA 4HA3A 2NSXA 4MNKA 3IJ9A 4FO4A 4ZGYA 2WBGA 4W89A 4A4AA 1TQXA 3WNMA 1OX5A 1O7AA 4J40A 5BMWA 4ERGA 4XZWA 1RCXB 3E96A 4RCXA 5KSWA 4OTKA 3K8KA 1YRRA 5MKGB 3MUAA 5JIPA 2V5KA 5FF2A 4GVFA 3ABSA 3B97A 3SCSA 5HNUA 2Y7FA 5BXRA 3IRSA 1TPWA 1BTCA 2IKGA 1WKFA 3EDDA 4X22A 4DYEA 3GTFA 3PWIA 3OLGA 3AWOA 4DF1A 3PNZA 3GAKA 3BLPX 4GIEA 2GJXA 4KQNA 1W54A 1DXFA 4DXKA 3ZSSA 3RN6A 4Q4OA 3CV6A 1IZJA 3GDRA 3SBFA 2BOEX 1I2RA 1WZKA 4OZOA 3SFWA 1JCXA 1TX0A 3UVIA 4O12A 4ZO6A 4JTJA 3VILA 3PTMA 8XIMA 5AN7A 4YS1A 2AMGA 1VYSX 4NZ1A 3JW7A 3P74A 1RJQA 2BFGA 3SIZA 3W3OA 4KPLA 2Y63A 1ZL1A 1WZMA 3O0FA 4ZQOA 1R5YA 1H41A 1UP3A 2I17A 4NQ1A 5DF0A 1XIDA 2YB4A 1QBAA 1CBGA 4HJFA 4I6VA 3AIWA 1I45A 2OSWA 2DU2A 1XIGA 1GVQA 1MFUA 1RA5A 5EU9A 4PMNA 5HINA 3EPMA 4HYWA 1K9EA 3OQ8A 1FDJA 3KRUA 4EXBA 3OHIA 3WENA 4JCLA 5CZTA 1JEZA 1Z8AA 5E0CA 1E9ZB 3VE9A 5TNVA 5D02A 3ITLA 5E6YA 4MFDA 3SUSA 4PUDA 3VNJA 4X9YA 2DH2A 2QLYA 4GI4A 1UKSA 2ISVA 1LL6A 4PN2A 1D3CA 2B31A 1Q66A 3ABOA 3RRXA 4QE1A 1UKTA 1J8VA 3AYVA 2BVWA 3R8HA 3GUGA 3PPHA 2DUXA 3MO7A 3K8LA 3KP1A 3VYLA 3THQA 4H7CA 1K4GA 4UOJA 3VK5A 4Y9PA 3BCFA 3O15A 1XRSA 1Z41A 5HA7A 2UY2A 3OVGA 1RPXA 3AUOA 4HQVA 2E7FA 1NP2A 2QDGA 1UD2A 2VFIA 2OGJA 4X2RA 4WY0A 2GSEA 5EY5A 3VX1A 1W5PA 5IRPA 1G6CA 4KEZA 3B0UX 4KEMA 2P5NA 3ARVA 1RBOB 2RJGA 1UMYA 1QI0A 4B2DA 1FWSA 1NWSA 1UR8A 1WX0A 2V5DA 3U57A 3TC3A 4M5PA 3QMTA 2YCJA 1IT0A 3IVUA 1PX3A 1IR2A 3KX6A 4PCPA 3PJUA 1CPUA 2IQTA 1FTXA 3T42A 4AF0A 4A2RA 2ALRA 3FGCB 1IIHA 3VINA 1VYRA 3A5VA 2E0PA 1VC4A 4HPNA 2BNJA 2DORA 2E09A 3W7QA 1QCWA 1V3HA 3GC2A 1P0EA 3GVWA 4MKVA 3NQBA 3TR2A 1ISVA 4PMVA 3KW3A 2Y85A 4GIRA 2NXIA 1UASA 3KCJA 4E8GA 1DYSA 1MRQA 2F9RA 1ITCA 5FD0A 3PULA 5HR7A 3A47A 2UY3A 5MF5A 2X1SA 4IQDA 1Z42A 3AMCA 2JF6A 3VGFA 4WIWA 3AS1A 5AFDA 4NP7A 2PTZA 5TIMA 1S5NA 4D6CA 4BA0A 2QMKA 3MKCA 3WL1A 4F0LA 4EWND 2HS8A 4LTSA 1P6CA 1JNEA 1REQA 2XGZA 1UUMA 1L2UA 2QVNA 2ICSA 2G4FA 5AC5A 3ZYZA 2PCEA 1JZ6A 1EBGA 3WZ0E 2YA2A 1XYFA 5A8QA 2VL4A 4KT2A 5LYRA 3MCOA 3WJZA 1TTPA 3GW3A 4Q7BA 4Y9OA 2QJGA 2C8NA 2OQHA 1IEIA 1TMQA 1C8XA 3MSYA 1VCGA 2G4JA 2W79A 1H62A 5EMMA 2JGYA 4Q6XA 3UWUA 1Q13A 1ZALA 3QW4B 3OEXA 1E56A 3WBAA 2KAUC 4S3EA 3E5PA 5G4WA 1YTKA 3T1GA 4FOKA 5F4WA 1X7IA 3UYCA 1C93A 1MEHA 4BQ4A 4U2YA 1MQQA 3GSMA 1EJSC 2WC4A 3IIPA 2I5QA 4G7EB 4O13A 5ENLA 1KW1A 5D2WA 3VO0A 2YW4A 1VAHA 1RZMA 2FJKA 4UR7A 2P50A 1VFTA 2AL2B 4LCQA 3VDAA 3II1A 4OVXA 4H9TA 1Z6KA 1ZP3A 3HV8A 1IXNA 1YX1A 1LLWA 2OLSA 4WDTA 1T7LA 4D6DA 1KRMA 1ME9A 3GTNA 1NDVA 4ZA0A 5EYWA 1H49A 2ZRYA 2QT3A 3IJIA 1XLBA 2XSAA 4IZGA 4RDVA 3NURA 4FOUA 2ZIDA 3B03A 2PB1A 4JN8A 3ZS4A 4ML9A 4U28A 1UWRA 4QJ3B 2A3BA 3C2RA 5I24A 3EWXA 4H8HA 1H2JA 1CLVA 4W5UA 4IIEA 5D03A 3VGEA 2FH8A 2WC7A 4I9TA 2VD8A 3N2TA 2PS2A 2PRMA 3LV5A 2J75A 1WB0A 3CC1A 1DJGA 4WD0A 1DXIA 3W84A 2NWRA 3M16A 3T9PA 4DZIA 1F61A 3IAPA 4JKKA 2HVMA 4ADSA 1AMYA 4QEHA 3WK2A 4P7LA 2V5JA 2G5WA 2PDPA 3KZPA 1RBLA 1G9HA 3NM1A 3ZWSA 4EPEC 1I2NA 4FNSA 1VB9A 3OA5A 5I23A 3CQ0A 2P8BA 3EX4A 3WQWA 2OOGA 2PGRA 2UZ9A 3PZMA 1BYAA 3QN3A 3GBEA 4F3HA 3DYOA 1V0KA 1QNVA 2DIKA 2OX1A 2F8QA 5M03A 3K2GA 2YA0A 2Y24A 3J7HA 1IR1A 3STEA 1W56A 3UNTA 1ADOA 3FDGA 3IUDA 4FEZA 1HKVA 5G1YA 1SSDA 4ZXLA 3W88A 4PTXA 2EQDA 1CTNA 3OP2A 2OPJA 3KDOA 3S1GA 4Z2IA 3NJ3A 1NDYA 3HOJA 2WMHA 1TX2A 1VS1A 2CLKA 5LIYX 5TF0A 2HXTA 2QJJA 1H50A 1EJ7L 5CGTA 4M82A 4GI6A 3BDKA 3ONCA 1K02A 1YYAA 1G7UA 3WF2A 2I14A 2YCIX 4WJEA 2FHCA 3FHAA 5TQLA 1BVWA 1JUKA 2XVKA 4IXXA 5A8NA 2TPSA 3GDTA 4ZE4A 2WSKA 2WCAA 1NFBA 4LWWA 3T7VA 5HPOA 1X8FA 3H53A 3L5LA 3RILA 1DVJA 5LGZA 1O1HA 3M43A 3BLOA 4JTCA 4DYJA 4H00A 2OX4A 4XAPA 1R86A 3EA1A 1B3XA 2J9ZA 1A5MC 2Y62A 3FS2A 5FA5A 5KTLA 4GA8A 1M7XA 5GVJA 4IL2A 1EPVA 2KX9A 4JTGA 3VM5A 2PTWA 2D23A 2CCRA 4B3LA 3AC0A 1BFNA 1W32A 2X1IA 3FCPA 4RL3A 2O55A 1ZRQA 1TTIA 1E1CA 3QZAA 4W5ZA 1KB3A 3IACA 2JKEA 2IKJA 2X2YA 2C3ZA 1POKA 1TWWA 3BW3A 4YNGA 1QOQA 2YYUA 3BOLA 3ITVA 1S3HA 1OSEA 2GK1A 2WHMA 1XX1A 1J12A 1L2QA 4ERAA 3E12A 2VT0A 1P1MA 3F4CA 2QCGA 3KBVA 3CQIA 1I2QA 3UG4A 2QDDA 3BG9A 3KBJA 3LMYA 2EXOA 1CB2A 4IL0A 3WQPA 1E73M 2V82A 4ICNA 3MWCA 1WYIA 2QJIA 2E40A 2DT2A 3R10A 2Q09A 4I3GA 3EX6A 4H1ZA 2BTMA 3NEVA 1XDLA 3K1GA 3SN4A 5A6KA 1UC4A 2WNNA 1OM0A 1RHCA 2POTA 3OA3A 4KKXA 4IIHA 4H4IA 3W7GA 3N19B 3P82A 3LX9A 1ZAJA 4AMCA 1K6WA 3QY8A 4ZFMA 5EMUA 3XISA 3S2JA 3A9IA 1KC7A 4BK9A 3EZ4A 1VPXA 1PTAA 4AVNA 4MB4A 4P61A 3DECA 2VRJA 4YJ5A 3W1TA 4PTWA 1CGXA 4LY8A 4L80A 3TQ0A 1A4MA 3EX2A 2QPUA 1Q6OA 3S9YA 3U2EA 4DUOA 3LM3A 2FJUB 3W7KA 4R7WA 1B30A 1E3ZA 2YXGA 2PDYA 2ZC8A 4L9ZA 1JGMA 3CZ8A 3I7SA 1VKFA 3RJYA 3OPSA 2E1DA 1G4SA 3WF0A 1OZMA 4H9XA 3QTGA 3CMFA 3MMTA 4F0MA 3M0IA 1F07A 3LTSA 1BF6A 4FLOA 1HJUA 2AAAA 2WV8A 3LM7A 7PTDA 1NFGA 4YYFA 2J7CA 3N4EA 4GYJA 4G2DA 1CI1A 5D9MA 4JYFA 3W7OA 4IMDA 4NJHA 4OUIA 1NVMA 4A2SA 1T99A 1K8XA 4UQAA 4ENLA 3NVTA 3OTRA 4GH3A 1JZ8A 4HU0A 5CSSA 2PAJA 4B5UA 3O05A 1LP6A 1B54A 2A3EA 1PXGA 3EPOA 1OF6A 3N4FA 3KVMA 3DHDA 1FHUA 1M1BA 1FQ0A 1FWCC 5E9AA 3EOSA 3AS0A 3TTEA 4C6EA 3DC0A 2I16A 1OFRA 2Z1WA 4K38A 4J3ZA 4KBXA 1IZCA 1K03A 5FJIA 1WUFA 4DI9A 3MANA 5C9XA 3F4VA 5BYWA 3ARWA 1QTWA 1Z89A 4UQDA 4O18A 2H3DA 2PEVA 1TFVA 4B2DD 3MYPA 3F4NA 1D3GA 5CC5A 4V28A 1YTDA 1XINA 1EHAA 1UD5A 4JFWA 1PCWA 3H2AA 5HXMA 3AICA 2QPSA 1WXZA 1V3LA 3G1HA 4QG6A 1LQ0A 1GCYA 4WJXA 4HTBA 2J25A 2VEFA 3DOPA 1BYCA 2J24A 2OO0A 2XJ7A 3VXGA 5K4ZA 3LK6A 2DT1A 3WIJA 3I3DA 1M6JA 1XR2A 3ARYA 5HBFA 1L6WA 4KCWA 3P61A 4MYAA 1VZWA 2XFYA 1BG4A 4AY8A 2WLYA 4F4RA 3GXFA 1PZ0A 1OCBA 1XLHA 5CLWA 3DFHA 3FN9A 5M5DA 2G0WA 3IEBA 4HSHA 4LBRA 1BGGA 2W62A 3VIOA 2JEQA 4GPNA 5DT7A 1SZRA 1H63A 4U10A 3K4AA 4XAZA 4NXSA 3DIPA 1JPDX 3W7DA 1E71M 2ZUSA 1EA0A 1REQB 3M1ZA 1DKWA 1X96A 2QCDB 1YNQA 4HB7A 2NWSA 4IPJA 3VNYA 4FK9A 1SZGA 2WMIB 2CHNA 1US2A 2Z2AA 1EC8A 3HN3A 2PWEA 5ABFB 3PF3A 2QAFA 4GCAA 4TV5A 3VZXA 2XVGA 3IWPA 4IXHA 4ZQRA 2G97A 3CM4A 3WF1A 4INFA 3MBDA 1XQLA 3XINA 1FP8A 1H0IA 3WBXA 1F4AA 4IIBA 1SYTA 3NQ7A 2VZVA 3AXXA 5RUBA 3TH6A 3VIGA 3HF3A 4C6CA 5JMUA 1MXGA 1M65A 3MMUA 4E2BA 1FFRA 2DSWA 2DSVA 2W0UA 2ZUNA 1FH7A 1FOBA 4NY2A 2F2HA 4H9VA 3UD6A 2J7DA 1OD8A 1RV8A 3N3TA 3QFWA 4TX8A 1JF5A 4OV4A 3AISA 3KOZA 3OVPA 3WK0A 2GDQA 3MVIA 3QYQA 1OIFA 1N82A 4GYPC 4I90A 3IV3A 3V75A 5AHIA 2JALA 3VD7A 3MJYA 1CXEA 1GVRA 5D05A 4J27A 1JRBA 4MJ2A 2IKHA 1XDMA 1GOIA 4O0ZA 2TMDA 2XH0A 3NO3A 4JPGA 1DQXA 3CUHA 3C52A 4WY0F 1UKOA 3H7RA 2GGHA 4O17A 4O11A 3FKRA 3UY8A 3L66A 4P8WA 5EB8A 5F7UA 1TKKA 3GVGA 1L6YA 1H7WA 2Y6ZA 4IX0A 4Y8FA 3W82A 3V5FA 3EGJA 4IJCA 3DAQA 3BLFA 3O63A 3WD0A 3E3HA 3VDHA 3TOPA 2J62A 4FSAA 4HOXA 3R25A 5T91A 4PRWA 1D9EA 2CZFA 1SO6A 3LUTA 1F3TA 3F4WA 1PPIA 1RLCL 3W37A 3ITXA 3P14A 3ARSA 3HGRA 2WQPA 2EPLX 3APTA 4HMNA 4HZ7A 2WMGA 3ZT5A 3C5QA 4CUCA 1XFCA 5EKYA 4B90A 1NJJA 4MOZA 3WQEA 4ECLA 3H55A 2JF7A 2NX9A 1LWJA 4AHPA 5JH2A 1R9YA 3MDUA 4MWAE 2XFRA 1S2WA 1CXIA 2DSKA 4H9ZA 3L4VA 3ZR6A 3AALA 4MUPA 1M7PA 4TMCA 3KRZA 2D2HA 3B9AA 4JHZA 3RX3A 4RR4A 1DIOA 3CV7A 4IG2A 3ORWA 3ANUA 2H9AA 3MP3A 2GJPA 3S2MA 1BXCA 2WNZA 3L7RA 1WKDA 4J3WA 4S2CA 2R1NA 2VUNA 2TYSA 2OYKA 2BG5A 3CWOX 3MUY1 3P62A 5HUPA 1T5AA 4C7FA 3TWBA 1C91A 1FRBA 4EP8C 2ISDA 4JTDA 4Q8VA 2VNCA 1WUEA 1IXPA 1TPUA 5AOUA 2R94A 4LCRA 4OQVA 2VXNA 1LORA 1H0GA 2Y88A 1LUCB 1DP0A 4OHQA 2XGBA 3SJ3A 4NVTA 3ARXA 1WP6A 1G5AA 3URQA 3R94A 3VABA 2W6RA 4AD0A 4KGLA 3V36A 4M6QA 1LOLA 5CG7A 2INZA 3QPEA 3MI3A 3WG6A 1YLVA 4HMCA 4W4QA 2YB1A 3L5MA 2D3NA 4MGGA 3G3MA 4KF1A 2WLZA 2PBGA 3VC5A 1XYBA 2F6KA 1EUAA 2DDXA 1JULA 4MHBA 3W86A 5ECVA 2VGIA 1L6SA 2V81A 3GTXA 3LGEA 4WCJA 3WDHA 4RPPA 1UR2A 3M0HA 3GH7A 3SRHA 2QKFA 4LUTB 1IIGA 1G4EA 4AC1X 1J79A 4G1NA 4XZNX 4YVVA 4DUWA 1ZJAA 4GABA 5AHEA 2Y7EA 2DW7A 4GY7A 3PB2A 1BWKA 5GJNA 3BLEA 1ITQA 3Q4DA 3SURA 1B3ZA 2BLEA 3GTIA 3QF0A 4YVXA 3W85A 1ODUA 3WBYA 3HJEA 3C8NA 3QGAC 3FVMA 2AKMA 2V0TA 1UBPC 4ROPA 4JS3A 4XX6A 2EGZA 3UCDA 4HHHA 3IPWA 1HKIA 3SQLA 1UP0A 5BRBA 3NM3A 4L7ZA 1AZ1A 4PCTA 3ICJA 2V8ZA 3HGSA 1XLFA 1RVKA 4W7UA 1JYNA 1V08A 3AHVA 2WSQA 3LOTA 1QW7A 1U33A 4S3DA 4GQGA 3H12A 5DRCA 2F2KA 5HDRA 1PZ1A 3L65A 1Y65A 3GWQA 3O8AA 2D2OA 5A6SA 5J5RA 2GVJA 2E4TA 3AWNA 5DFAA 1UB3A 2NUWA 3L4TA 1EOMA 1YEYA 2YIHA 3SCQA 3VOHA 1TO3A 4K1GA 2QIIA 4V15A 1EXPA 3N9SA 3S1UA 1CGUA 3QZEA 2C0AA 2PGEA 1GYNA 4DLMA 4QS5A 5LNWA 4MNLA 4W87A 5KETA 3L67A 3W29A 4PMXA 1KGXA 3ARZA 2XSXA 1NDWA 1DIKA 5IDIA 1KM0A 4I5RA 3TV8A 1TWZA 3KBWA 5D33A 2XIOA 4AD1A 1MUCA 2V69A 3BOFA 3TJ4A 3QGKC 2AAMA 2TSYA 3HV9A 1AJZA 2CHRA 4CNTA 2H90A 1MSSA 4MKSA 1RK6A 3ARTA 4S3CA 1XIJA 1XIFA 4WX2A 2D20A 2BASA 4QBXA 4IMGA 4A3QA 3VNDA 3P0WA 1A5AA 1U5JA 1RALA 2YOCA 3G0XA 1OBAA 2PDFA 4KERA 2WMKA 3GHTA 1ONEA 2ABAA 4M81A 1GTHA 3RAOA 3TAOA 1BHGA 1OGSA 1UWQA 4LAOA 1P6WA 2DIJA 2BY3A 3AUJA 4G7FA 3SCUA 3BQ5A 4GISA 4CCCA 3FXGA 4XIAA 1TV8A 3PFRA 3GDKA 1LCOA 3PFMA 3QH2A 4XO7A 3V35A 1TQJA 4GKTA 4DZHA 2ZUMA 3FAXA 3WDRA 4EK7A 1RP9A 1UC5A 4GIAA 2CZ5A 1NQ6A 5DMLA 2NLIA 1H1YA 1M7OA 3QY7A 4WXYA 3H2NA 3U4FA 3QTPA 4E4UA 1JGIA 4F0HA 4LPCA 4MJMA 3PPCA 4ZFCA 3FA3A 5BW6A 3IGUA 4HHLA 2ISFA 1TA3B 1OEPA 3OIHA 3DENA 1J93A 1CENA 4F2TA 3A4XA 1IEWA 4LRSA 1V6TA 3KRBA 1F05A 3BANA 1K77A 5F2IA 1EFZA 4WVXA 1K8CA 3WMBA 5A69A 1E0VA 3GIQA 3LQGA 3TEVA 3ZJ8A 2YL5A 1RCQA 1QATA 2IXVA 3FKKA 3OW1A 2OWXA 3PJXA 2V2HA 1VHCA 4ZCWA 3G1YA 1F9CA 4UTKA 5KZMA 1GG1A 5CPSA 1JAEA 1X7FA 5I07A 5EMYA 3CAKA 4DJDC 2CW6A 3THAA 4QAWA 2VZTA 3TDFA 3O6DA 5AVNA 3U7VA 5LIXX 4KFNA 5FF0A 3CUXA 1JPIA 1W31A 1JR1A 3LI1A 1A5CA 2X05A 2FVMA 1T8QA 5DRIA 2ZICA 3TU9A 1N2VA 4YWSA 4A21A 1XFBA 2EKCA 1U2YA 4IHCA 5DT5A 5LNSA 3GAYA 1KWGA 2RDUA 5D8WA 4N2YA 2GOUA 3P6LA 4DO5A 1G4PA 3T6CA 4IIGA 4HMDA 1KRCC 1SW3A 4QISA 1V0MA 4QHRA 3CPGA 1J2WA 5E0FA 1X97A 4Y2WA 4AU0A 1LDCA 1W5MA 3GD6A 2GSJA 4HMEA 4MVAA 3SCWA 3WDQA 3ITYA 1V7YA 4I5XA 2ZADA 4TIMA 3G18A 3H2FA 1GJPA 2Y0FA 4I9JA 4OUEA 2VGBA 4LBSA 4AEOA 4HBKA 4JTTA 1F8IA 4IPIA 2F61A 4MDPA 1XBVA 3Q45A 2GGGA 4JEQA 5J8LA 3USZA 3AXMA 3VOCA 2QYGA 1QU4A 4AEEA 1H4PA 1IEVA 3WLRA 1Q7MA 2ATMA 2AQVA 2FB2A 3B8TA 3N9RA 1EC7A 6REQB 2YDQA 4FXJA 3M44A 3OJGA 1WO2A 3KRSA 1KCXA 3I6EA 2Z6JA 3CQJA 5D9OA 3WLTA 3GVVA 1X38A 5DCBA 1PKYA 1TVLA 4Z2JA 4UUIA 2ZUVA 1OG0A 2WMFA 4S1FA 2PTXA 1Y5VA 5K9DA 1XV8A 1EUNA 4DO6A 3G0UA 1JIBA 1KBKA 5DY3A 3LGDA 3CL7A 4HK5A 4LV4A 4PCSA 3AIUA 4HP5A 1YW1A 2B7OA 4YL2A 5I6SA 2QVHA 3W4RA 1RJRA 3P8JA 1O12A 2PZ0A 3CAWA 1XH2A 2ZZ2A 3WLQA 5C8BB 3SUTA 3UNDA 1F3EA 1J0IA 4NX0A 1EJWC 4WSHA 1B1YA 1DWAM 3EBVA 2QXWA 3ZMRA 3LCGA 4MZ8A 3EEGA 4GVIA 3RXZA 1P7TA 1HNYA 3WDIA 2A3CA 3GYCA 4TO8A 3STFA 2GQ3A 4Q8OA 3PS7A 4D9PA 4AC7C 2YJQA 1ZENA 3KAOA 2VI0A 3GNPA 4PB5A 4ROQA 3C2OA 3O16A 3QRHA 4HYVA 4Q22A 5AYXA 4M1RA 2I9UA 3AHYA 2RKXA 4PR4A 2VOTA 1ZGDA 3WJXA 1EP1A 2TAAA 5JU6A 1EL3A 4UMCA 2DSUA 1U83A 1X1OA 1QT1A 4TTUA 1YBQA 2VCCA 4XVDA 4DEFA 4B3ZA 3UJFA 3WCZA 2PWDA 7REQB 4A3UA 4R9OA 3WNKA 3N3MA 4N42A 4EXAA 4JNZA 1K8ZA 3O7UA 4QDWA 4DBWA 2NW0A 1EJTC 2OYLA 4KCTA 5B7YA 1I0DA 2OZTA 3C0QA 3LPPA 1QI3A 3GZAA 4LUIA 3PBMA 2WKJA 1XJBA 1E4IA 1XLMA 4OE7A 4IH3A 4LJ3A 3VIPA 3DFNA 4BI6A 5C55A 3AS3A 2WSYA 1XLIA 3GU1A 3IJ6A 5HR6A 5LZLA 4TQTA 1CGVA 1ME8A 3VD9A 3H4GA 4NAFB 4O28A 2H9AB 3WQOA 1F73A 4FXSA 4C65A 5G5IA 5DN1A 2EPHA 3GHRA 5EBUA 4IIDA 4H7VA 1C7SA 3A13A 3M9YA 4JDBA 4EF9A 1J11A 5CJ5A 1I2PA 4C6FA 3VNLA 1YDNA 1NOFA 1CXKA 3AIRA 3WUGA 2FYMA 3FVDA 1WDRA 1XICA 1OFBA 3RDKA 1BF2A 3RCMA 2PDXA 3PN8A 5I5RA 4ONVA 3PTDA 3V5OA 4AD3A 2P3EA 1A5NC 1H3GA 3KL3A 2XH4A 2CESA 2ZZ6A 5I3HA 2DJLA 1FWFC 4R3UA 2LLEA 3N14A 4K6AA 4HU3A 1Q6EA 2HJPA 4FNUA 1DORA 3IK4A 3VMNA 4CLMA 2OZ0A 4AWUA 3SCRA 1V0NA 2J9XA 4JNMA 4HN8A 1Q7QA 1YE4A 3A4AA 2GJNA 4CD8A 3N11A 3PWAA 4NZ5A 3UA4A 1FWNA 3H23A 1V6UA 3OG3A 4Q8UA 5A2AA 4O8AA 3UERA 1ZCOA 2INFA 3VM7A 1FY6A 2REQA 3HGJA 4W9TA 1LRQA 3VDCA 2NQJA 2PC4A 2Z1XA 5CKSA 4MWAC 3CWNA 4UTTC 1JL8A 3WH7A 3DFPA 4D6GA 4ES4A 1KKRA 1H51A 5A2CA 1T0OA 3M5ZA 3WFAA 2WVSA 1TTJA 1PHWA 1L6FA 4KFPA 1WCGA 4EAMA 4QJ5B 3TJLA 3LRKA 4O57A 1WBJA 1ZJIA 1UHVA 3LBOA 4LVAA 2VC5A 2O9RA 3PY2A 3R0UA 3GH4A 2DH3A 1ONWA 3VKAA 2O4MA 2IW0A 1XCXA 2WJZA 1BXBA 2Z7GA 2B7PA 3DI1A 3OQEA 3WDJA 5BWAA 2E6AA 1F3XA 3UCCA 1A53A 1VH7A 4G8TA 1Z32X 2QAPA 5REQA 3CPRA 4DPPA 2W61A 2WHLA 3QYSA 4O4WA 1FWGC 3P5ZA 3BAIA 2ZX8A 4DX3A 1ELSA 3BLDA 4IFKB 3W7IA 4R34A 3N04A 5A1AA 1QJWA 3W2LA 1CT5A 4AIOA 2VDHA 2OZ3A 3ZWTA 1XP3A 5D4YA 2ESCA 4LEFA 4QNWA 2YFNA 3BWWA 3QPYA 2D2GA 2J78A 5FSEC 4BF5A 4FA3A 2ASHA 1ALDA 4JTFA 2Z6IA 3ATZA 3UXIA 4MWAB 3U2OA 2G3MA 3FYOA 1F6YA 3T0TA 3EWDA 4WUIA 4UTFA 6TIMA 1AD4A 4RW5A 2WAGA 1QO5A 3QJAA 4UOQA 2ISWA 3OU8A 2WJEA 4MWAD 3ARUA 2BHYA 2J7HA 4GNJA 3C61A 3LS9A 4RZ4A 4MYXA 3WLSA 4PEEA 3ZR5A 2CLEA 5I3JA 2QV5A 3W7PA 1VFFA 3LHYA 3I7RA 5AYYA 1UZHA 3HU7A 4XD5A 1M53A 2OTDA 4K3ZA 4B9YA 4U3AA 2BWGA 1G67A 1O5KA 1ZAHA 4PMRA 4Q3MA 5DCEA 2PWFA 1B5TA 4YTQA 6ALDA 3WD2A 2V5LA 4Z08A 2BVTA 1RBAA 1Q85A 4NKCA 2HRWA 3Q65A 1KNWA 2Y2WA 2F7FA 3DFOA 1EB3A 4N0RA 4GGHA 2B7NA 4W88A 5EGRA 4MY9A 5M3WA 1IF2A 1K7XA 1VJZA 1Y8BA 3ID7A 1HO4A 5LNUA 4WQ6A 2VEPA 1ECEA 2ABBA 3T09A 4REQA 3EOOA 4R88A 1M04A 3BARA 1WAWA 2HNHA 1W8SA 1H11A 4S38A 3BXWA 4MZ1A 4OBSA 5EMLA 1PE1A 2ONEA 5HMDA 4PFHA 5JH1A 4RE4A 1FHLA 3ZJ6A 3U2CA 1KXHA 1TELA 2J77A 4IX2A 4QGCA 2VURA 1V6WA 1XLGA 3UU0A 3FSUA 3GG0A 4QM1A 1VEPA 2VX6A 3M0ZA 1TV5A 4XB3A 2XGIA 4CNPA 3QFEA 4I7UA 1UQZA 4PMYA 3L4YA 2ZBTA 4JXCA 5LSMA 5E6ZA 1EF2A 2OYMA 4GGBA 1Q63A 1RUSA 4JTRA 3BJTA 2PDKA 3ZT6A 3WQ5A 3DC8A 3NL3A 3HIJA 4CKQA 2R24A 1NWUA 3NL5A 3PM6A 1KTBA 2GDVA 4ZTYA 7CGTA 3RMJA 3AYTA 4DRSA 4H83A 2F6UA 2DIEA 4U31A 1US0A 4XZMX 1WDDA 3AJ7A 1JZ2A 1KFBA 1XM3A 2OWWA 4DYKA 4E6MA 4AZ6A 1Z3NA 3W6MA 3ISIX 5E1QA 1SFSA 1UUOA 3OYZA 4N9EA 2Z1BA 3TSBA 1K4HA 1UH2A 1G01A 1Q7ZA 3BL3A 4ZE5A 2X7WA 3DBNA 4JOMA 2PFHA 5EFDA 4Z42C 5HULA 4GXPA 3TFCA 3LY0A 2DY3A 1AH4A 2QMJA 2QUNA 4DN1A 4S3KA 4CCEA 2WO5A 1O4UA 2XHYA 4DM1A 3W2NA 3TZFA 3ES7A 3RITA 3HA1A 4QXIA 1HX0A 4HCHA 2HDJA 1EJVC 3C0LA 4GJJA 5JBFA 4NU7A 4FLSA 4HTYA 1XL9A 4AB4A 4PBGA 2UY4A 4FX6M 3W83A 4CQ9A 5GNYA 4Y7EA 2WYSA 4Z1BA 2W9MA 3KLKA 3DG6A 4D8LA 3QOKA 4I7VA 4AWSA 4NRRA 4RW3A 4IF2A 3KS5A 1OFAA 1Q65A 1NQKA 1XIEA 4J28A 5A6LA 6TAAA 3TJIA 5I3GA 2WMJA 4JN7A 4PULA 3H2OA 1ZHAA 2OKOA 2O4QA 1W5NA 4LF2A 4MIMA 3C3NA 3FHQA 2NXHA 4LXFA 2JK2A 2BOFX 4GHRA 4Y9NA 2FQIA 2OOFA 4OOUA 2DUAA 2J6XA 3NUKA 2H3BA 5TBOA 4JR5A 1L8PA 5BCAA 4QITA 2X1UA 3BOXA 4Y90A 5HANA 2A0NA 5EMJA 1K7FA 4HPGA 4J3VA 3T55A 4C7DA 2R9RA 4J35A 3RLUA 5C2XA 5AECA 2UWFA 3WLLA 3UESA 4Z2HA 1FCBA 3OGVA 4EOUA 3UWVA 4HK7A 1JG9A 2QGYA 2I57A 1GEQA 1MW2A 3NDOA 2OQYA 2ZFAA 1BG9A 1O5QA 5CSRA 2ANUA 1UKPA 2YA1A 3SJNA 3W7MA 5I77A 5H8PA 4F79A 3SGZA 3HJZA 4KESA 3WQGA 1LTDA 3N2BA 3W0KA 3ITTA 4CCZA 1YBQB 4XD4A 4ZQMA 1TJ1A 4JIPA 4JYEA 5KZ6A 4WDWA 4JX6A 1E70M 3WKZA 4NRSA 4MTVA 4Y9AA 1UD6A 1CYGA 3S4TA 2C15A 2Z25A 4GE8A 1H1NA 2BODX 3L2LA 4RNHA 4LVGA 4Q6JA 1EX5A 3KVJA 3LYEA 1UP2A 2ON3A 3C4UA 4Z1DA 2IKIA 1S2VA 2R8WA 2SFPA 4BWLA 1U1UA 4L9XA 3WUBA 3N6HA 1E51A 1AJ0A 5I7GA 4RNFA 2X40A 2VGGA 3QR1A 2HISA 1KV5A 4JIHA 3MVTA 4W86A 5AY7A 1C8QA 3BG3A 3R0KA 1CLKA 1TVNA 3FK4A 3PSVA 4LAKA 4LAMA 3KVKA 3P81A 1KRAC 2C16A 1I6NA 4XD3A 1MW3A 1WE5A 1GW9A 3ZVHA 1NF7A 4TU1A 4K8EA 1UIOA 3BG5A 3S8HA 3TP4A 3WF3A 1HL8A 3T44A 4RX0A 2VYOA 3MI2A 3NYZA 4ALDA 5G4EA 5HOSA 3LTYA 2DVUA 3O0KA 3MHUA 1FX6A 1O94A 1RCOB 2BHZA 3NZRA 4LSBA 3OVQA 3WJWA 3BLIA 3XIMA 2V3GA 3R79A 1KRBC 5H8MA 2E77A 4L56A 1X98A 4A3HA 3DHUA 4OBRA 4S3BA 1GOXA 3FSTA 4UQBA 1LROA 2PDBA 3PPGA 5CXPA 2PRLA 3RU8X 1K7EA 5DY2A 4ACZB 1HKKA 2PLCA 4JQAA 1QWKA 1W91A 3QR3A 4WRHA 3GIPA 4NX5A 4JTHA 1TUXA 1CX9A 1WOBA 2V68A 6A3HA 1ODZA 1KBBA 3LSBA 5EBAA 4UFHA 1DWIM 5T26A 3W1PA 1Q6QA 1PYMA 3M5XA 1N7KA 3NQMA 4M19A 2WPBA 3CASA 2POZA 3ELFA 5HQLA 3WLNA 4RXGA 2X0HA 4XSMA 3G1FA 3B4UA 3LQLA 4FPSA 1UROA 4Q4MA 6XIMA 2EF9A 3S3GA 3MB9A 3OZYA 1S2TA 3LHTA 4N4PA 3I4KA 1B3VA 2BX7A 4FNQA 1E1FA 4EF8A 3IARA 3GVQA 1AW1A 3VKBA 4B92A 3T2OA 1ZFJA 3E74A 5LKYA 1W1VA 4YYCA 4JD4A 1YPXA 2A7PA 4KEUA 3G2GA 5B80A 4LW7A 4Y96A 4BFAA 4WDUA 3W01A 1E0UA 4WLCA 4IISA 2VKZG 1HG3A 3TYZA 3PJTA 2WVVA 4CQBA 1V6XA 2HNEA 4H7ZA 3TYCA 4X2PA 1J0HA 1WNOA 4I9MA 3TTOA 4MLRA 3E38A 4K8GA 2Q71A 2EG6A 2PD5A 3GXMA 3OVRA 1E55A 3GZ3A 2WC3A 1JCNA 4N9DA 3FV9A 3ABRA 3IJ8A 2J47A 4XKYB 1F2JA 5DQPA 2QUUA 1E9YB 3TQPA 1SZEA 1R2RA 4UMBA 4JTSA 2EHHA 4FX8A 4CEUC 5C2CA 2Y4SA 4P7OA 1J6OA 1GQKA 1KM2A 1UR3M 4J1OA 1OGBA 1XF0A 4Q4KA 3ENLA 1VD6A 4O53A 5JUVA 1NIUA 1XKYA 1JXJA 4C1NB 4NYYA 3EDEA 5C9WA 1JPMA 2A1YA 2CLOA 3VGGA 3O6AA 4AQLA 1W2PA 3KOFA 4JTQA 1XYLA 4S23A 2E6DA 4J3SA 3PG9A 2J8FA 3W6LA 4GI9A 2CLFA 4LUJA 4JKLA 9XIMA 3EOEA 3SUVA 3GDLA 5D09A 5F2MA 1X8CA 3NL6A 3O9NA 2E8ZA 1XD0A 2HROA 2AQWA 3UZJA 1SJAA 1BD0A 1K9FA 1Z48A 4GO9A 1A47A 4IIFA 3EX1A 2CZVA 2CNCA 3AHZA 1JFHA 4AIEA 3W70A 3SI9A 4XD6A 2NXGA 1H5VA 3CUJA 3VGDA 1EZWA 1D8CA 4D2JA 2O56A 1EGZA 3PZIA 4CQ8A 1TJRA 5CZKA 5HPCA 3REQA 4ZVJA 4JNYA 4O19A 4XBJA 1OC7A 1OY0A 3MHFA 3RCYA 4PEKA 3N73A 3R8RA 4H01A 3QC3A 2RFGA 4NI3A 3W24A 1QI2A 4RPQA 2YCLA 2NT1A 1Q8AA 4PRTA 1EDTA 5LA2A 3TYAA 1H7RA 5FEWA 3PB0A 4A6GA 1P1XA 2XIMA 3DGRA 3D46A 2ATSA 6CGTA 4KWSA 3LCLA 1XRVA 1PS9A 1QW8A 1OINA 3AMDA 1QPKA 2BBFA 3UXLA 2R1MA 3W00A 4BCEA 2QCLA 1SZFA 4G6CA 1I2OA 2CBIA 3QSTA 4H19A 3FA4A 2PDGA 5LNVA 4LQ1A 3UCQA 1W5OA 1E6ZA 2AQOA 1G1YA 4GXWA 4QAIA 3VKKA 3W1UA 3R7MA 3WUEA 5A94A 2OFJA 2XWDA 3LLDA 1J5TA 2WJFA 3W9ZA 5FF3A 3DFSA 3E0WA 1A0CA 2FMOA 5CSYA 2PSNA 3DH7A 3B3DA 3W25A 1GTEA 3MJMA 3AQUA 5HQEA 2WK2A 4K7VA 3APYA 1EH9A 3M64A 3NPWA 1ICSA 4URIA 1DJWA 3UWYA 1VEOA 3NOEA 3CIVA 1ZBWA 4IMFA 3CPUA 4LS2A 5CPTA 4IOTA 3W02A 4H6RA 1XCFA 4GOAA 2NVDA 3F2DA 3TC6A 4DB7A 3GHUA 3HG5A 4F2UA 3IIOA 1W1ZA 3LU2A 4W8LA 1Z69A 1TRDA 4JL2A 1ZY9A 2J6VA 3S5Y