1QK0A

Cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
source organism Trichoderma reesei
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk0A00
1HGWA 3VOJA 3RPTA 1UOZA 1BVWA 3A64A 4AU0A 3RU8X 3VOIA 1QJWA 1HGYA 1QK0A 1UP3A 3VOHA 1DYSA 1UP0A 4B4HA 1OCNA 2BOFX 4A05A 4AX7A 1UP2A 2BOGX 4I5UA 1OC6A 2BODX 1OCBA 1GZ1A 4B4FA 4AX6A 4AVOA 4AVNA 1OC5A 1OCJA 3ABXA 2BVWA 3A9BA 1QK2A 3VOFA 4I5RA 1CB2A 1OC7A 2BOEX 1TMLA 3VOGA
chains in the Genus database with same CATH superfamily
2ZZ4A 4HIBA 4IL0A 1SMDA 3W7GA 4QDWA 1PL9A 1D7KA 3ZZ1A 1VFLA 4LVGA 3VDBA 3V0TA 2WC3A 5FL1A 2VRJA 2Y63A 3I3DA 1D9EA 1U33A 1XLLA 5CG0A 1G0CA 1GW9A 1WE5A 2ZUSA 1Z6KA 4U10A 4LAMA 3A64A 4IISA 1V5XA 3Q94A 2V68A 3CT7A 1GYLA 1IT8A 3SCOA 1KFWA 1JFXA 4FOUA 3GNDA 5JIPA 4LS1A 3W73A 4RE3A 4RXGA 3IIOA 1XIMA 3GG8A 4B5SA 2WV8A 4DI8A 5KETA 4Z1CA 4DXKA 2Y7DA 2YLLA 4MY9A 3CXOA 4HKPA 2Y4SA 5KZDA 3W7HA 4HA4A 3WNPA 1RP8A 3T2QA 3CAKA 2ZUMA 1KV5A 3FK4A 4R7OA 2X1UA 3PBWA 1E3ZA 3WKZA 2E40A 3NQ2A 1L6FA 3QTPA 2ZXDA 3W2NA 5D09A 2OYMA 3UXDA 3BLOA 4WK9A 1NWSA 4P2VA 1NFPA 5TNVA 3QHOA 1Z7AA 1DWAM 4HTYA 5EPDA 3TCEA 3B9DA 3G1VA 3QOMA 4ZOAA 4FF5A 3LNMA 3GBEA 3EOSA 3SUUA 1ZAJA 1DVJA 4FALA 2VWSA 1Q65A 3CBWA 2VZTA 2A79A 4HU0A 5D9PA 3SI9A 4QLKA 1XCWA 3CHCA 1HP4A 2WMKA 3FYOA 3QVQA 3W26A 5IDZA 5A6LA 5H1WA 2OKTA 3TN4A 2EF9A 4GQRA 4ZTYA 2V3EA 3R1ZA 1DJGA 2WCAA 1ADOA 4FR1A 4O57A 3VGFA 4O16A 2NUYA 1IYXA 4ECLA 3PR2A 2OZ3A 3OHMB 3V18A 3W87A 1KGUA 5D37A 1EZWA 4A3YA 3LQGA 2VZSA 4J28A 4MLJA 1OZMA 1H7RA 1EHNA 2PBGA 3R6IA 4UTTA 4NRRA 1GWJA 4D6JA 2C79A 1WKEA 1XRSA 1DJHA 3ZT5A 4LH8A 3LN3A 2DZXA 2IKGA 1A5NC 2FHFA 4AEEA 4B2DA 4A6GA 2GDUA 4ZQCA 1FWHC 4DN1A 3W07A 4V33A 1J11A 1GGOA 3R4IA 2XVKA 4BFAA 2FPTA 3BL3A 1YNYA 4PUEA 1FWEC 3W28A 5CLWA 4NXKA 4JY9A 4BY3A 3UY8A 2V9DA 1LBLA 4GNJA 4PRRA 1P0BA 1NAL1 4JTAA 1KW1A 1C92A 3LD5A 2G4FA 4PMVA 1PX8A 3A4XA 4GY7A 3TTYA 4GCAA 2CU0A 2GVEA 3I7RA 1Z3NA 1YX1A 3PTKA 1ZAHA 4Q3MA 1CBGA 2PWDA 3HTWA 5J8LA 1JZ7A 2PDYA 3C2RA 3UJ2A 3V36A 3PZMA 4JGDA 4A2SA 2ANUA 3IAPA 2Z1SA 2OEMA 4X2RA 3VGEA 1QPQA 3EX2A 1PIFA 4NSBA 5BROA 1DQUA 3ZR5A 4DHGA 4IICA 5HJXA 4GWEA 1Q13A 3CUHA 3M1ZA 4I3GA 3L23A 4BEUA 2H8XA 1V3MA 3MDUA 4L56A 2VEGA 3DOPA 2ZXAA 4M80A 1PO9A 4I9MA 3W7NA 3LGDA 1NQ6A 1FDZA 1WUEA 4CQAA 3OVRA 3C6CA 2OJPA 2OYLA 4DEFA 1IV8A 4I5RA 3IVUA 4GYPA 3WQWA 1OIFA 2WZHA 2E1WA 4QG9A 1PPIA 3U5YA 4JIIX 1N82A 4F4RA 4A2RA 3PBUA 1S5VA 4CNSA 1JYVA 3DC8A 3PTDA 4XG1A 4O8AA 4HJWA 5E6YA 1JZ2A 3SGGA 4NIRA 1X1ZA 4PFMA 3GXIA 5CSYA 4YN5A 1G69A 1HQTA 1W1ZA 3PZTA 2HBXA 3V75A 3RU6A 4QP0A 3GVQA 4FXFA 2XZ7A 4EXBA 2HEJA 3A6OA 1K8CA 2EPKX 1XG4A 5CJMA 2X7VA 3TEVA 3K13A 2CLIA 4FXRA 1KM0A 2PP0A 4Q4QA 4ZO6A 4XBJA 3ES7A 2YSWA 3EOLA 2HK0A 3QQWA 1YDYA 3KOZA 1JAKA 2ZC1A 2D20A 1CI1A 3S1XA 1T6MA 4XD5A 2PP3A 3GR4A 3I4EA 2PGWA 2CBJA 2R82A 1VAHA 5LXXA 5DT5A 4O8RA 4WDXA 4M82A 1OHLA 3IJLA 3ZQ9A 1TV3A 4BEQA 1TPFA 4HOZA 4V28A 4GH3A 4AWEA 4AZCB 3MV01 2WK2A 1BG4A 1GKPA 1E4IA 4L61A 1JAEA 4MZ8A 1QI0A 1B30A 4JTQA 3W00A 2QCHA 3F7JA 2Y5SA 3KX6A 2Y2WA 1Q2RA 3CHFA 1JIBA 3UWZA 1RXOB 2VWTA 3FJLA 3MUXA 1A53A 4NJKA 3P5ZA 3SADA 2VFHA 1V3KA 4PCNA 1DIEA 4JFSA 1OGSA 4DLFA 4FX6M 4J3ZA 3BWWA 1HJVA 3L0NA 4QG8A 1OX4B 2XN1A 1J2BA 2TPSA 5D8WA 3TFXA 1OADA 1TFVA 1BYBA 4I90A 3WUFA 3LCLA 3UQNA 2YJQA 1VPYA 3U2CA 4LSBA 4XZHA 3HQNA 3UWEA 5HAOA 1UD4A 3WELA 3HGJA 1VLWA 3W1PA 4QFUA 2A6LA 3M43A 1PB0A 2H6RA 1ZFJA 1D3GA 1XH1A 3TLQA 4KRUA 3UGVA 1XLBA 4M6UA 1WZLA 5D38A 3UPMA 3PPHA 4ZCWA 1I4NA 1BYAA 3G1XA 3H7UA 1MSSA 3O07A 3IIPA 1UD2A 1Z44A 4C90A 5HMDA 3UWQA 1MQPA 3R43A 5HATA 4FLOA 3IWPA 3RK8A 3VE9A 5K9DA 4Q8PA 4PA8A 1QTWA 2FFCA 1V3IA 5LA0A 1R2RA 1O5KA 1W17A 1B4EA 1OFQA 4HQVA 5LGXA 4C6NA 3IVTA 4JN8A 3UWYA 4MWAE 5IFTA 1GKQA 4Y96A 5C9WA 3AICA 4HMDA 2YA2A 3NO3A 4DLMA 4HP5A 3AYRA 1RLCL 4S39A 4P7QA 1MNZA 3BUVA 1I0DA 4KCUA 3NIYA 2C14A 4UMBA 1UMLA 3ARZA 5IOBA 4BI5A 1TZ7A 2WNZA 4GIRA 1FXQA 1G4TA 4Y9AA 4FNQA 3IARA 4H1ZA 3NQ6A 5JH1A 1DL3A 2NQZA 5FEXA 1XP3A 3U7BA 2ON3A 3QY6A 4HPGA 1BGAA 3G5EA 1KRBC 4C6OA 5C9ZA 1GVIA 2FIQA 1RA5A 2CFFA 5G4WA 2X0SA 2GYIA 3W1AA 3JZEA 3RMJA 4Q4PA 2ZRXA 3G0XA 2WJDA 3KBWA 1DP0A 4MIMA 4IQDA 3KP1A 1JNEA 3R89A 1VQTA 4GYPC 3PNZA 4CNPA 4D2JA 2W91A 5M5DA 1O7AA 2XPKA 2OWCA 4YU1A 3AISA 4PBGA 3T2PA 4YJ5A 5B80A 3GIYA 3ME3A 3HFTA 3O15A 5I23A 1OT1A 3U7VA 1YXCA 3ARPA 1ME8A 1X6LA 2BHYA 3OBEA 3AMKA 1PZ1A 2VFEA 4UZSA 2RJGA 5LIYX 2JALA 3UA3A 3P93A 1MQRA 3BLLA 2HPMA 2VEIA 5D03A 4DO6A 4YXGA 3UXIA 1NSJA 2XZ9A 1ZGDA 2PTYA 1C90A 1KXHA 4Y9MA 3OOQA 4DM2A 7REQB 4HGXA 1IZJA 4O0QA 4ZSTA 1S5TA 4DRSA 1XXXA 4WHBA 3NA8A 1TV8A 2UZ9A 3WNKA 2HK1A 4O12A 1JQXA 1XLGA 2Q8XA 4M7SA 4MJMA 4FNUA 5K3VA 4J9JA 4BQ2A 2E7FA 4MHBA 3KBJA 1XISA 3FXGA 2V3FA 3RCMA 4QISA 5IHSA 4ILSA 1SJCA 5AN7A 1O5QA 1PX4A 2ZE0A 3ONCA 3BLPX 1FDYA 3BMWA 3WN6A 1QR7A 1EP2A 4OZOA 2NUWA 3SO7A 1M04A 3PVFA 3QV6A 4QS6A 2NWSA 5IDIA 4GQGA 1OWQA 1Y8BA 5FF3A 1XDLA 2CPUA 4BF9A 1LORA 1B3YA 4RZ4A 4LYRA 1Q6EA 1WCGA 5HWMA 5EU9A 5HA7A 3W2KA 3DERA 2VX4A 3GIQA 3BSMA 1PKLA 2HVMA 3FX4A 1MEIA 1JPMA 3KL5A 2A3EA 3W7EA 3AAMA 2E6DA 2G4JA 2OZ8A 3W81A 1R85A 3ABRA 1XKYA 3DFNA 2FB2A 2W67A 4O11A 5T8GA 4PCFA 3RX2A 1W5QA 3KCJA 1W8SA 1DIKA 1OFEA 3SCRA 3O16A 2PWVA 3BAIA 4Z1AA 4DBUA 4KBXA 4GGBA 2XGZA 4GNKB 4WQ6A 3UG3A 2X1IA 3BJTA 3N3TA 4OUIA 4OUEA 3C2FA 4PTDA 3CB8A 4Z2IA 3G1FA 4JHZA 3Q37A 1EBGA 4C6MA 1F4AA 4AC7C 1R2TA 3J7HA 2JBMA 3LUTA 1B0IA 3W37A 1FWTA 4NI8A 3DFOA 3P81A 1GORA 4I8DA 1A0EA 2NQHA 1TX2A 1JCYA 1IT0A 4RZ6A 2UV8G 3N29A 1T41A 2C91A 4GUHA 3REQA 1RK5A 3NJ3A 2EBNA 3EOUA 3C56A 2XWEA 3UG4A 1TZZA 2NV9A 1QPKA 1D7FA 1J0HA 2AL2B 4PB4A 1ZJHA 4CNOA 3BOFA 4KCWA 3IRDA 3JRKA 1Z32X 1XLKA 2XSBA 2ZYFA 3FFSA 3MUZ1 4JX4A 4CN6A 2VC9A 4U28A 3MI3A 3RAOA 1BWLA 2VYOA 1VFOA 3W02A 2ZCGA 4WF7A 1V0NA 3H53A 4H2HA 3UZJA 3E9AA 1V02E 5I79A 1PBGA 5M17A 1O94A 3MCNA 3SRDA 4P8VA 3TQ0A 1UR1A 1MFVA 2Y24A 1W8GA 1XIJA 3WLKX 2P8CA 3H12A 2FQIA 2X2GA 2PB1A 3G8EA 1YRRA 3WF4A 3ARUA 1P6WA 2Y70A 4S3JA 4D6GA 1QJWA 1JPDX 4UTFA 4E5TA 3KLLA 3E96A 3SIZA 5HULA 4IFKA 1H7WA 4GXPA 2FZBA 2V5KA 4OE7A 4ADUA 1H61A 2WWCA 5K4ZA 2I16A 4B15A 3LPOA 3NDZA 1O4UA 2DH2A 3KBMA 1EGZA 1GTEA 1TG7A 1EJ7L 2YCKX 2NSOA 3CQIA 1J4EA 5F1UA 4DPQA 1R3YA 3PP7A 1W9PA 2Y85A 3ANUA 1QT1A 1XSJA 5DBUA 2OO6A 3NYDA 4DB7A 3TZFA 4WY0A 3PS7A 4MWAB 3BLFA 3HG2A 3UXAA 4PUDA 4EPBC 1A49A 1CEOA 1W9BM 1VHCA 1Z48A 4UOJA 2R6OA 4R33A 4UR9A 3AWOA 1V6WA 4IGSA 1BPLB 5A2AA 3G2GA 2GL5A 4DF0A 3T0CA 4JTEA 4CD7A 1B3VA 3AU6A 2FJUB 4IQLA 2RGLA 2BWGA 5GNXA 4UQCA 1YDNA 1FRBA 4DZ5A 2C15A 4Q4SA 4CVWA 1IEVA 1K70A 3QR3A 2WWDA 2D3NA 3S83A 1R3QA 3W4RA 3LM3A 1EJTC 4JEQA 3C52A 4WEVX 4MFEA 3MQTA 4CGTA 1DE5A 4FX8A 3RMEA 1QNOA 4FHAA 1TPWA 4GVHA 1KBIA 2QJHA 3HFYA 9XIAA 5LKYA 3VUSA 3DENA 4IMCA 4QJ3B 3LPGA 1UR0A 2DFAA 4LBRA 3MS8A 1TCMA 2ZX9A 2BXVA 4IT1A 3TXZA 4PRWA 5JBDA 3LQLA 4KWWA 1HKIA 3RYSA 1XGDA 4X2PA 4S3DA 1IXOA 3ZLGA 2PDXA 1ZPTA 1AQHA 3SEPA 5AECA 2ZZ1A 3ITXA 5AC6A 2NV2A 5DMMA 3QQ0A 4E2VA 4ADTA 9RUBA 5I24A 1KBKA 3NOEA 5D04C 4PMNA 2NVCA 5EBAA 1Q6LA 3NVDA 1C9DA 3N2OA 1R5YA 4Q22A 4AVOA 1J9YA 3WLNA 4J27A 1TJPA 2YCLB 4YTTA 3IACA 4XAPA 1SUXA 3CU2A 1X7IA 1QW7A 3DN5A 2JKEA 2ZUNA 2ZRVA 5M03A 2HJPA 3R10A 4LOCA 3H24A 1YADA 2J66A 1F6YA 2J13A 2PLKA 4O0KA 2QR6A 3IGUA 1B3XA 2YL9A 1JYXA 4BJHA 2V0TA 4R9XA 3STEA 4GD0A 3QV9A 4AWTA 3FOKA 1S5MA 3CJPA 3BOXA 1W1PA 4K8HA 3W7KA 2ZTJA 3B8SA 1RHCA 1WDRA 1PIGA 4MPKA 5I3KA 1XRFA 5TIMA 1Q6RA 1XS2A 4UFMA 3ALFA 3PG9A 3K4WA 2ZKMX 4UNLA 2DZVA 2QUUA 2WLZA 4HN8A 3SQLA 3VOIA 1A0DA 3CO4A 1Z69A 4WDWA 4ZGYA 3A5FA 4CD6A 3NQFA 3MO4A 4IJRA 1Q63A 1MW2A 1BF2A 3TQPA 1KM6A 4DBEA 1EUAA 4FEZA 4QEHA 3SN1A 1WB0A 3DFHA 2ZWYA 4CCEA 3TN6A 1ZBVA 3R8HA 4O50A 2PDUA 1W56A 1H50A 5HXMA 2GUBA 1UWUA 2X30A 1F74A 3WLPA 1XIIA 4LUSB 4NAEA 2QJIA 4H8UA 4HHPA 2XIIA 5G4HC 2FHCA 1WP6A 2WZTA 1JD9A 4IXXA 4J3TA 2CESA 1R87A 2H9AA 3FVMA 4KWOA 4W87A 2B0MA 4US5D 3RLHA 3LPPA 4FI4A 3WNOA 3ZM8A 2PE4A 3EXSA 3LRLA 2ESCA 2I9EA 3KHJA 4GQBA 4Q8QA 1QXLA 3GLCA 3WJSA 3JR2A 4FSAA 2ZDRA 1SW0A 3DG3A 5AOUA 4H9TA 4H83A 3E38A 2B7PA 1KTBA 1V7AA 3ZLFA 3NURA 1ISZA 6XIAA 5LYRA 1AQ0A 3SR7A 1UD5A 1S2TA 4JTSA 4PN2A 4KEUA 4OVXA 3PUDA 3ORWA 4QCFA 5HANA 3U2OA 2CLOA 4OFCA 2AAAA 4MYAA 3IK2A 1HKMA 1Y5WA 2TSYA 3GYEA 1PVNA 4KFOA 4MKNA 2Z2AA 4AZ6A 3N73A 4E3VA 1LLWA 3PM6A 3T81A 2EG7A 4L7ZA 2O55A 3O8AA 3RPDA 2BNJA 2A7PA 1UUOA 7TAAA 3GXDA 1U83A 4GINA 4EAYA 3FEQA 3A21A 2AMGA 5AC4A 2ZX5A 2QNEA 4Q8OA 4HHHA 1GPWA 1HP5A 4D71A 1Q8JA 1K1DA 3NQBA 1XSIA 3MP3A 4ZB5A 3CPUA 1G94A 3RILA 2AOSA 3GFZA 4RDYA 2PS2A 3FYPA 3N2CA 4NZFA 1LTDA 1E6SM 1UP0A 4R7WA 1UW9A 3CHVA 1YNQA 1UH2A 1CDGA 4F66A 1CGUA 1ICQA 3EDFA 3FNDA 3UETA 5D9OA 2V3GA 3OYXA 3VC5A 1LRQA 7ENLA 4ZFCA 3UYIA 4W8BA 3WF1A 4DY1A 1DJXA 3APGA 4QJ4B 1XH0A 3UVAA 2Z6IA 2XIJA 1W91A 3PTQA 4LYPA 3EGJA 1DJQA 3WH7A 1XUZA 2Z1KA 5U4NA 4A3QA 3B03A 1GUVA 4FP1A 2YX0A 3DHUA 4DUXA 3AMDA 2G3MA 2C3ZA 3A4WA 3GUGA 1C7TA 4QE4A 5IRPA 4RE4A 1P1MA 4UMAA 5FJJA 4Y2WA 2VJXA 3V1PA 3CMGA 3FGCA 1RP9A 4XB3A 2CLLA 3LMYA 1OB0A 2DEPA 2QDGA 3UZWA 1BVWA 2VXNA 3QXBA 1HGYA 2VQUA 3NPWA 3Q2DA 2J8GA 2OLSA 1KLZA 1VBGA 5HNRA 2KAUC 3INPA 2HV5A 3B4UA 4DNHA 3UR2A 2GQ9A 1EA9C 1H1NA 4XIAA 3AYVA 1OC7A 3TROA 3BPWA 3WK2A 3N6QA 4DO7A 1XUUA 1JCTA 2ZA3A 1CGXA 4U2ZA 8A3HA 4KMQA 3QW4B 3QW3A 1R6WA 1XLMA 2GSHA 4LQ1A 5CG7A 1R38A 1TTIA 2VVSA 2CZDA 2W63A 7XIMA 3TJXA 2GJXA 1LT7A 4HBKA 3D3FA 4LNCA 4B5XA 5IM51 3P62A 2HWGA 4JEJA 3AMCA 4QSFA 1CLKA 4GZJA 3SN0A 1F3TA 5DLCA 4E2DA 4ATDA 5LIUX 1H41A 4D1IA 3WK1A 3SCSA 2GGIA 3A22A 3H4GA 3S46A 1HFBA 3TA9A 1BWVA 1K02A 1HL8A 4QM1A 2ASHA 3RGTA 3SIMA 3C0SA 3LENA 1XSKA 1G6CA 1VFFA 2OFJA 2IMRA 1I6NA 1UJQA 4Z2KA 3H70A 2DT3A 4UBPC 1EQCA 2Y1HA 3PJUA 3HB9A 3BV7A 4GGHA 4KRZA 4S3BA 5C9XA 1NVMA 3E0FA 4AY7A 3UG8A 3FS2A 2PZNA 2V38A 5FEPA 1IQ8A 1A0CA 2V3DA 4HMCA 2FPYA 4Z42C 3SCTA 2YA1A 3KBNA 2YXXA 2INFA 1XV8A 1E9IA 2CWNA 4LY8A 2J9ZA 4L9YA 1E4LA 1SW3A 3LM7A 1Y5VA 5BOFA 3U2EA 3WNLA 4CD5A 2PDNA 3PANA 5K7JA 4DI9A 1UZDA 1J5TA 2OZ0A 4EK7A 3L68A 2DSUA 1DPMA 1ZNNA 5A2CA 1WPCA 4AB4A 4UTKA 4MUPA 3HGSA 4XVDA 4AD3A 1CENA 4TVDA 1OZQA 2D0FA 3KWXA 4RZBA 3EWWA 4NXSA 1VEOA 4L4LA 4YYCA 3M16A 2DJLA 2E6AA 2MANA 3GC5A 2QDDA 1VJZA 2J79A 1N8WA 2VDIA 3GDRA 1FHDA 5CPMA 4GG9A 4CCCA 3LHYA 4NZ5A 2BGQA 5FF7A 1I1XA 1LRNA 4NY2A 1PZ3A 3GU9A 4YTRA 3HBLA 2NQ5A 3U0HA 1ISWA 1JULA 2V2CA 2CWXA 1TUXA 6PTDA 4A8NA 4G7FA 4JY8A 4UFHA 1A47A 1B9BA 2Y88A 1WDSA 1JUEA 3A4AA 1LOSA 1RAKA 1SZNA 3GVVA 1FA2A 4AC1X 2RDUA 3QY8A 4NZJA 4W89A 1SMAA 2OSXA 1FWWA 2Y5JA 1RJPA 1QWGA 1XLCA 2C1IA 4LV9A 1UB3A 3L0GA 3WQGA 4C91A 4DJED 1WQ5A 3QFWA 3DECA 1S5WA 3W85A 4C6IA 2BASA 1KB3A 2OT0A 3ABXA 2W61A 4H19A 3M7WA 4HNTA 2G97A 2OQHA 4Z2LA 4PMQA 5HPCA 1TE6A 1IWPA 4ZXOA 1E9ZB 2WMHA 2AGKA 3EDEA 1SO6A 1TVPA 1G5AA 1UZ1A 4XO6A 4KFPA 5MF5A 2WMIA 1G01A 1AVAA 2NT1A 4J3XA 4B16A 4WR3A 4ZTXA 1SPQA 1I75A 3BICA 3DHPA 3O06A 4XVEA 3WG6A 2FZNA 1SVDA 4GI4A 4FPSA 2WC7A 1XJBA 4YL2A 1HO1A 1J96A 3KRBA 2EEXA 4MWAD 2R14A 5CJ5A 4KESA 4AY8A 4ICNA 1XYBA 2PURA 1W5MA 1NF0A 5LHEA 1W9VA 1FTXA 3TZNA 3F2BA 4UTHA 4RJEA 3B3DA 4MJ2A 4AQLA 4JHOA 1REQA 2Y0FA 3XINA 4DZIA 1W6TA 2FZ8A 2ZUWA 1PKYA 2BBFA 1R3WA 4K39A 2C1GA 2AKZA 3D5HA 3VCRA 2Y8KA 3NZGA 4OT7A 4YHGA 2D0HA 1J12A 3DU0A 1EO5A 3ZXWA 3M5ZA 3LHUA 3HOJA 5A8NA 1F73A 5HR7A 2CERA 3CUFA 1AZ2A 4DVOA 1FUYA 4NX5A 4ZENA 2FZDA 3STPA 5E70A 3LY0A 4XUYA 4X9YA 3OB8A 3S2CA 4UB9A 5D8ZA 5CAKA 1R8LA 5EB8A 2G3NA 4UTLA 3FJ6A 1PCWA 3CZ8A 5D05A 4AMCA 3V16A 1Q85A 3DG6A 1JG9A 3MHUA 1MRAA 1OSEA 2XYLA 1MW0A 3CIVA 4HYWA 2R91A 2J9XA 2A7NA 1KM1A 1L6GA 4A22A 1XLDA 1XX1A 3WDHA 1TSIA 3VOFA 1PEZA 3ZR4A 4C6PA 1ECQA 2EQDA 1P6CA 4W7WA 4QBXA 4H6QA 2J78A 4J2PA 2CHRA 4C6LA 3P14A 2PC8A 4JNYA 2VRQA 2YL5A 1H60A 2HXUA 4D8AA 5C2CA 3JZUA 1FQ0A 3P8IA 3MZ2A 2WNWA 3NO5A 4AU0A 3N13A 4U5KA 1DTUA 4HU3A 3LI0A 3M9YA 4KEZA 4S1FA 1KRMA 1X6UA 2PGRA 1RVKA 4FNPA 5C55A 5H8PA 4NHVA 2EPHA 2QVNA 4GA8A 1AJ2A 1O6IA 5J04A 3AHYA 4H7VA 3C2VA 4HT3A 5FJTA 3SFKA 1GQLA 3EBVA 4C6FA 4ZR8A 4F2TA 1T99A 3M07A 2IKHA 3HGRA 1OF8A 4I6VA 3TSMA 3FKKA 2ICSA 1AW5A 1L8PA 3ZS4A 5EA9A 1XINA 4N7QA 4EXQA 2NLYA 3M6YA 1AUSL 3SCQA 2WMFA 2X05A 5FD0A 2GUYA 4GI8A 3B0UX 1WDPA 1JUKA 1XD1A 3BLEA 3KRUA 3A5VA 4C1NA 1GCYA 1R86A 4JHMA 3REQB 4HMEA 5AYYA 4XZLX 2DZBA 1XLAA 3CLWA 3WNNA 4WKAA 1OC6A 1TQJA 3QYQA 4S38A 3S2NA 2Z24A 4D6IA 1GEQA 3VXGA 1Y0EA 3G3DA 4QLJA 3FSUA 1S3TC 3LG3A 3S5SA 3ZYZA 1ZUAX 1MW3A 2PDLA 4AZBA 1TMHA 5G2HA 4J40A 1E72M 4R27A 4PUWA 2KZHA 4JDYA 2YBTA 5HWNA 1OT2A 2PAJA 3LRMA 1IR2A 1AW2A 5LA1A 3GS6A 2EPNA 2HS8A 4ZB2A 4NI3A 4N6EA 4WCJA 1EHAA 2QS8A 1K9EA 1RBLA 2PGFA 5HQLA 3VK5A 3RF9A 3ECQA 5GJNA 1Q6CA 3G6MA 4R7JA 5AHEA 2DVTA 4RNJA 3T0AA 4OWGA 1NOWA 4LCQA 4AIUA 3MMDA 3EDKA 4FXSA 3SRKA 2SFPA 3BH4A 3PBGA 4IFKB 4FLRA 4B92A 3EX1A 1ITCA 2HTMA 5BWAA 2O4MA 3DFQA 1QPRA 1KR0A 2F6XA 3OP2A 1VRDA 1TTJA 4FZIA 2G95A 3L4VA 1UQYA 4UQDA 5EFDA 1IIGA 4M51A 4M6PA 3VZYA 3WSUA 3GWQA 2F61A 1UWRA 4UXDA 4O10A 3VMOA 2PU0A 2X2YA 4LB3A 3NZQA 4ZQNA 4NZ4A 3PBVA 2E6YA 2XUCA 1MQQA 2XIBA 5LNWA 4WY0B 4W86A 2J77A 1AZ1A 5FA5A 3WBYA 4R88A 4PMRA 3PZQA 1MYRA 5FAGA 2PTZA 3KBSA 5AHLA 3W7IA 3B0VC 2YB1A 3MZNA 2XFFA 1XIGA 1W3IA 4H9ZA 4HNLA 1KC7A 3RLGA 4P5UA 5I07A 1OK4A 3N34A 4W7VA 1DXEA 2I9UA 3G24A 1PYMA 2VENA 4OV4A 3BW3A 1BTCA 3U57A 4EOUA 1VIZA 4ML9A 4XZBA 3KS6A 1UWIA 1ZJBA 1QATA 3WJWA 3S5OA 1Q6FA 3AFBA 4DZAA 2JKPA 3FW6A 1WDWA 4Z0SA 1QVBA 3KVJA 3NPUA 2OT1A 3CH9A 4RKAA 3UF9A 2NSXA 1W9DM 5K9XA 3ZT7A 3WLQA 3IJ7A 4GBUA 4PBFA 3NO1A 4XAFA 1U5VA 3GR7A 3WEOA 5FCZA 3I6TA 3WLOA 1TE1A 3BO9A 3LTYA 3VKCA 3OZOA 1K4HA 2QKFA 2QPUA 3SFWA 4AEOA 4IPJA 3UG5A 3UXLA 3B9AA 1E0TA 2VP8A 4JL2A 3AIWA 2NT0A 1R3RA 3LBOA 3WBXA 2BMBA 1KD0A 4UFJA 4JTUA 1I9CB 4AD0A 4AD5A 3GH7A 4CNUA 4BF7A 1EB3A 2HPIA 3WBWA 3B9OA 3LPFA 3WJXA 4Q8NA 1KO0A 5CLTA 3PUOA 1NELA 2Q71A 2WNQA 2DUZA 1BLIA 3VKBA 4F0KA 3PSVA 3IJ6A 4P8XA 5AHMA 4ERAA 3AYSA 2EKGA 2NQJA 5IXEA 3GUWA 2TAAA 3UXKA 3WK0A 5I6SA 2QXWA 2CKSA 3TJLA 1ONEA 3PB2A 1JCJA 1OGBA 3O9NA 3TNBA 2E6FA 3UPBA 3MJYA 3NQCA 2VEKA 1RY0A 2ATMA 4D6HA 3SQMA 1VFHA 3H2EA 2WPBA 5D32A 3D6NA 1A5OC 1S2VA 3CUJA 2ISFA 3GK0A 1VFTA 5JBFA 1XHGA 5C5YA 3HGOA 3WQPA 3V3WA 2H8ZA 2NXIA 2VGFA 4ZQOA 1WXYA 4BWLC 1CB7B 3H6OA 3BMVA 3H2CA 4C5YA 2IPJA 4M8UA 3NCOA 3U8GA 3ZOAA 3T05A 3K8LA 2WMGA 5BWFA 2XN0A 3D0CA 4XAYA 4Y90A 4ENLA 3MSRA 4MVAA 2W92A 1FFRA 4XZIA 3URAA 4QX4A 4D8ZA 4DJDD 1X7FA 5ABFA 1QAPA 1KFLA 4GO9A 4WVXA 3GHRA 4NAEB 3G3MA 4DM1A 3F4WA 3AO0A 1K9TA 3LEPA 3FY1A 1J93A 4LXFA 4W93A 1FXPA 4DBWA 3C0JA 2CKRA 3QV7A 3SDOA 2WC4A 5CJNA 2ZX7A 4O1AA 2WM1A 4KH2A 5D9NA 3AJXA 3OODA 4DWDA 3QSRA 3T07A 3KHDA 3LZ3A 3PC0A 2OWXA 5I78A 4HMNA 1JDCA 4GX8A 1JYWA 1JVNA 1Q2SA 1W1IE 4FOKA 3ANVA 1JDEA 1E6QM 1WV2A 3NPVA 4DUOA 2D2OA 1JRCA 4Y9OA 2D0GA 5I3DA 3VI2A 3FXYA 1BF6A 2OX4A 1DV7A 2QV4A 3KE0A 1NTHA 1TPH1 2G50A 4MB4A 3QPYA 1NP0A 1LQ0A 1V7YA 4UOQA 1VFMA 3LCFA 1S1RA 2FVMA 3W84A 1ZZMA 4YTQA 4EPDC 4GH1A 2W3ZA 2Z0IA 1Q66A 2P0IA 1XBVA 4QDPA 3GTHA 1SM9A 4HJFA 4AZCA 1O5XA 3I7QA 1H1YA 1XYCA 4M3PA 3GX9A 4XIMA 3TYEA 4L5ZA 1D8WA 1MRQA 1K03A 2XM2A 3RPMA 4ALDA 1BG9A 3VABA 3ELFA 4HSNA 1F3WA 1CECA 4DPPA 4Q8MA 3AU2A 3L4YA 3URNA 3C3NA 2FMNA 1UPPA 4YYFA 1IXQA 4YTUA 1YIXA 4HHLA 4B5TA 4C6DA 1JDAA 4Y7EA 1GHSA 3CQHA 1E4NA 2JGYA 4XZWA 3W53A 2Y7EA 4US5A 3HV8A 2EJ1A 4PTNA 3VKDA 3EA2A 1NOUA 5CPLA 2EJAA 4XD4A 4YHEA 3N25A 1KM4A 1EIBA 2J75A 4OHQA 4RNIA 4MY8A 1G1YA 1GZGA 5CGMA 1E5JA 1DJWA 4D6CA 3C2OA 4RR4A 4UR8A 2OLAA 3PWAA 3MT1A 3A13A 4GYJA 3I65A 4EAMA 3A12A 2WSYA 3RITA 4HPXA 4H2CA 1LL4A 4JFVA 2QHAA 2ZRUA 1WOBA 2H3BA 4DBSA 1F8IA 3LLFA 1XYAA 3EWXA 2W5FA 3THQA 2VFDA 4IP4A 3V4BA 2YXGA 1G7UA 4RNHA 4ACYA 2NQ9A 1M01A 4A3HA 3SAZA 1IEQA 2AQWA 4JIRA 3B0XA 3POCA 4R34A 3IRSA 5A69A 3TSDA 5CZKA 2Q8ZA 3SCPA 3FGCB 3HZ3A 3WO8A 2VZOA 4PODA 3CV1A 3RPTA 2QW5A 4QJ1A 4MTVA 1SR0A 3EA1A 1YXDA 2E9BA 3WD0A 4LJ3A 5CZJA 4AFYA 2O7QA 4WY0F 3CV6A 3VM7A 1GG1A 2FZMA 1XDMA 4Z0JA 4QNEA 2J7DA 3DG7A 1VB9A 2DGAA 3PZUA 3R8GA 2JK2A 4UCGA 1LWHA 1XBYA 2J7GA 3IIXA 3LCXA 2GJXB 1JPKA 2J6XA 1V6XA 4RDZA 1FWJC 3S6DA 2AGTA 4EX4A 4LUTA 4AZ5A 4H9YA 1XCFA 4Z2HA 4FO4A 1BAGA 1YDOA 3BGAA 3RUBL 1VD6A 2G96A 2G0WA 1GVOA 3G6LA 2DZSA 3WQVA 1SFJA 3MI2A 3EB3A 2BVWA 2ISDA 1EJSC 3QGAC 3K8MA 2FGLA 1E51A 3PNUA 4NZ1A 2ZICA 1NDVA 3MBDA 5XINA 4O0ZA 1E71M 3H2FA 2E9LA 3OPSA 2BB0A 4L1XA 2QCCA 3VIFA 3CZEA 2XGIA 4K1WA 1XI3A 1Q7QA 3NDOA 3HJEA 2QVHA 2DUAA 3QEZA 2DZWA 5K2ZA 2ZADA 2VQTA 3WH6A 1WO2A 2VGIA 3VD7A 3L0KA 1P7TA 2G41A 4AD2A 3NQDA 3WQCA 3BCJA 2ZQ0A 4ZQMA 4HU8A 2PLMA 3TAOA 1O1ZA 1F6KA 3DI0A 1VHNA 1VCGA 1XG3A 3FA3A 1QK2A 1FKXA 2GK1A 1OD0A 2VZUA 4GUGA 4JICA 3WCZA 1AD4A 3TYDA 5C70A 3R13A 4AD1A 3ARVA 1ITUA 7ODCA 4JKKA 4P7RA 3H4WA 1VP5A 5AVNA 4CQ8A 1J0KA 3V5CA 1JGMA 3TQKA 1K8ZA 4JYEA 1QDSA 2XGBA 1GZJA 2B81A 2NX1A 1X98A 1J0JA 1EXPA 4MB5A 4G9PA 1JZ5A 1IZCA 3W7JA 3KOXA 4GCXA 1BEUA 3QMTA 3RDKA 2OQLA 1S2UA 4FIRA 4ICCX 2DV0A 3LMZA 3V35A 3EAUA 4B91A 1EJUC 4LAUA 4GOAA 4JCMA 4NL1A 4M5PA 5E5CA 3UERA 1TO3A 4F3HA 2WHKA 2QJMA 1VENA 2RUSA 2BV9A 3IGSA 1H7OA 2QIWA 1CNVA 4KPLA 1ELSA 4MPQA 4O53A 4RPQA 4I9AA 3OGRA 1OVDA 5CGTA 5J5RA 4M81A 4AUBA 4JQ3A 2DJXA 5D02A 1ODUA 1K6AA 5LNSA 1L9WA 4C6KA 4I7UA 2YB4A 1V6VA 1W2VA 3F03K 3C2YA 5C8BB 3L5MA 1SO3A 3CL8A 1TYGA 2IPWA 2AQOA 5BOOA 1XICA 4IGNA 4FXJA 4I6KA 3LBCA 5A6JA 3SSJA 3P61A 3B9NA 4O52A 1C8XA 3COTA 1ZQ5A 3W0KA 3U2ZA 2BTMA 1F6PA 5D2VA 1EDQA 4JNZA 3H2AA 3NXLA 4MFDA 3LSCA 3MVTA 1H63A 3OLEA 4PMZA 4BF5A 2YIHA 2HDJA 4HCDA 4QR6A 2WMIB 2BZNA 3BCFA 3E2SA 1GJWA 2Z29A 3HO8A 1BXBA 1E4MM 3UZXA 2J7EA 4NILA 2ABBA 3LGEA 2DIJA 1VPQA 3GC4A 4O17A 4R5EA 1M03A 1XLIA 3G0UA 3VGDA 3QHNA 1XR2A 4B90A 1B3OA 1TWDA 5AZ1A 3DI1A 1S38A 4O18A 1IEIA 4P7OA 4S2CA 3GDKA 3UW6A 1H7NA 2A6NA 3W23A 3S9YA 3LI1A 2JFEX 2WZIA 4CN1A 1NM9A 3LLDA 2GZXA 3FHQA 3ZVIA 3SCVA 3VCNA 1HJXA 1WZMA 1UA7A 4WGXA 1PWMA 2BHUA 1RBAA 2GDVA 4UQ9A 3APYA 1R7OA 1GW1A 3NGFA 1R46A 4TUFA 3CUGA 1GONA 1ZL1A 3WMLA 3QZAA 3RLVA 4J4KA 4DJEA 1H11A 4QQUA 4YWSA 3CQJA 3WIJA 1X1NA 2ZWZA 5KZMA 1ADSA 1YPFA 4IM4A 1W3JA 3RX4A 1Y7VA 3WDRA 3WMBA 1O12A 2Z2BA 2ZVRA 1GQNA 4LCRA 4KQNA 2HCVA 1LL7A 3AYTA 3VUPA 1H2JA 2WHJA 2HROA 5C6MA 2VT0A 1SFTA 3TLLA 4AYSA 1IR1A 4KGJA 4O54A 1XYMA 4JQAA 3TCSA 1GQJA 4NYYA 3KM8A 7A3HA 2GQAA 3N4AA 3MYPA 3GHTA 3MYOA 2E9MA 1XKJA 5CXPA 3N2XA 1KGXA 1Q3NA 1BGGA 1UZHA 4MWAA 5DCBA 1XPYA 2ZZ2A 2CIPA 1YE6A 1W0MA 1HVXA 1MDLA 3JW7A 5CPSA 1W2PA 3QTGA 2QPSA 2C6QA 3L66A 4IX2A 5IBXA 2GJPA 3SCWA 2JF6A 1H4PA 3OVPA 4ZBCA 2BY0A 4N2YA 4F9JA 1LQ2A 3K1DA 1A5UA 5H91A 1E40A 4KIEA 2PA6A 1X8CA 3WEMA 4KCVA 5HMSA 3NVTA 1D3CA 2VURA 3NM1A 1TIWA 6ALDA 3AS2A 3R94A 5BRPA 1UA3A 4LY4A 3KWSA 4RNFA 2XIQA 1J0IA 3RJYA 1F61A 1V6UA 3ENLA 3AIRA 2OR2A 3BJFA 3M6DA 2QZRA 1YPIA 1PV8A 2FVKA 2GVYA 1XFBA 1IGWA 4JR5A 2RHGA 3B8VA 2VL4A 3ITVA 3S6TA 4R9OA 3SY5A 3TAKA 1NJJA 1US3A 4AIBA 5ECVA 1QCWA 1FWFC 1WAUA 1QPOA 2RGMA 2HBVA 2JKAA 3QY7A 4O13A 1JD7A 4JBRA 2QPXA 4AHPA 2R1LA 3CLMA 5E09A 1BSLA 5DFAA 4D72A 3CUIA 2Z4GA 3QF0A 3AMLA 1X6NA 3W24A 2I56A 3TJIA 1I2NA 2NXGA 1W1YA 3F1QA 1Q45A 3QFEA 1EA0A 4B9ZA 4RXFA 1Q6OA 1ZJIA 5AYXA 2WYSA 1KXVA 1E0UA 2YCLA 5I09A 1O5RA 1E6RA 5KITA 1DKWA 1CXIA 2DIKA 3EWBX 4JTLA 1NY1A 2JF7A 1LM1A 3OA3A 4DNMA 5AYIA 1A3XA 4CQDA 4L4MA 3EDJA 4S3GA 4G8TA 3NEVA 3O6DA 3KLKA 3O6YX 4JTIA 1RJRA 3H55A 3W38A 4EF8A 4JIHA 3SM0A 1ISVA 3ZWTA 1CXEA 2Q01A 2UY5A 1KA9F 1UIOA 3CS2A 1NWTA 3STGA 3VD3A 3W01A 3HG3A 4HN4A 2X1RA 1QOQA 1LLOA 5FJUA 1EXBA 2I1OA 4R85A 4KEVA 5T9BG 5C7HA 1W3NA 3MP5A 2BY3A 1Q6QA 2HSAA 3QC3A 1QO5A 4OTKA 3ZO9A 3M0JA 5E9XA 1XIBA 1FX6A 3BSHA 3F4CA 3M4HA 3O63A 4NASA 1QHPA 4Z2GA 4FNRA 2YYUA 3HA1A 3GU2A 2OSYA 1UWTA 2EGZA 3JVAA 2D2GA 3WUBA 4DZHA 1KCXA 1MDRA 2CLHA 1G4SA 3P67A 2ZX8A 4TX8A 3V7PA 1RCOB 1BVZA 4LUSA 4MZ1A 2O4QA 5D2TA 3N15A 1FWSA 3MKKA 4DJEC 2BSLA 2WHMA 2BGSA 1FWGC 4H7CA 3SJ3A 3ABQA 4PC8A 4PSRA 2DT2A 3IV3A 3GNOA 1JYNA 3B97A 4W88A 2IQ0A 4IFOA 1HKJA 1B54A 2CBUA 3ABZA 4IG2B 1OD8A 4H9UA 4HA1A 3GU1A 3GQYA 1FFQA 3TYBA 3OIHA 4WJXA 3B8UA 3RO6A 3MUCA 3AUJA 3RJXA 4H8NA 3VVGA 4E8GA 2REQB 3L21A 8XIAA 4PYSA 1NFBA 2E5DA 2GWNA 3BSGA 4U31A 4TMBA 1QO2A 1J0YA 4FK9A 1ME9A 5HPOA 5BMWA 2XTKA 4K8EA 4PULA 2ISVA 3UCDA 4ES4A 3WQDA 3K1GA 3UZZA 5G1YA 3KP0A 1ONRA 3UZ5A 1XW8A 4UTUA 4MWAC 4BCEA 3KTCA 1V02A 3VIKA 4E38A 2GUUA 3TYCA 5F4SA 1S46A 4MMWA 5FJOA 5A6BD 3FN9A 3BJSA 1GT8A 3GXPA 4IQEA 4WSHA 3KOYA 3PZOA 5K4XA 3LTSA 1ZY9A 3DESA 4U4MA 4ZO8A 1UWSA 3OLDA 4FNTA 5E0KA 3TOPA 4Z2JA 2FZ9A 2OXNA 1KWKA 3Q58A 5ENLA 2F2HA 1PYFA 4BKNA 1NOFA 1J10A 4UFIA 3RR1A 3E5PA 4R3UA 1H7XA 4KWVA 4PH6A 2WCGA 2IPFA 3FAXA 3ERPA 1T8QA 3W74A 1LF1A 3LCIA 4L6DA 5FF2A 1EP3A 4WUIA 4DELA 3D47A 2BODX 3RCNA 4QROA 3SECA 1MEHA 3MKVA 4EF9A 3IK4A 3F4DA 4MDPA 4X3ZA 4OBRA 3LXCA 2OMAA 1XLFA 2EHHA 2PZ0A 3NZ1A 3ZJ7A 2Q3RA 4HZ8A 4E0CA 1MUMA 1XH2A 4JS3A 3IAQA 1GOKA 3CUZA 3BK0A 3N2BA 4PCTA 4UZUA 3WX7A 4W7UA 2X41A 2PGEA 3P0WA 3PPCA 3PPGA 4F79A 1GQIA 3RO8A 2YFOA 1V3LA 3CZLA 1GPFA 1NFGA 1GEHA 5AZ0A 4GI6A 4ZXLA 1NARA 3OG3A 1QNVA 2FFIA 3EMCA 3WJYA 2WB5A 2VO5A 5ABFB 5HQMA 4WD0A 1OIMA 2VCCA 2W27A 3ITGA 1W54A 3PZ9A 3UWVA 1RD6A 5BU6A 3LU2A 2BLEA 3VDGA 3W88A 4ZMGA 2ZBTA 3K8KA 4WKFA 1TVLA 3E2VA 1LG1A 2OWWA 5IFPA 2PEVA 1RJQA 1GVQA 2O7SA 4H8VA 2H90A 2B7NA 3Q65A 1JCMP 4J3SA 4B9YA 1CXHA 4FS9A 1ZTVA 4LGXA 1PXGA 2WAGA 3K30A 3NQMA 4ZEPA 1BQGA 1VS1A 4KWUA 1L2QA 4C60A 2ODOA 4ICMA 3VU2A 5EMYA 1BSIA 1NU5A 2BG5A 1CW2A 3WF0A 3S47A 2WNNA 4AZHA 5FF0A 1WDQA 1UQZA 2J24A 1LYXA 1BHGA 3QR1A 3GR8A 1BRLB 2YKKA 3EX4A 3URQA 4BK9A 4E8DA 4LWWA 3NQGA 1V0KA 4UR7A 5EMKA 3NUKA 3L7RA 3ARYA 2GOKA 2XH4A 3A3HA 4KWSA 4GVGA 1US0A 5C71A 5A8MA 2QT3A 4RDWA 1OQFA 3GDMA 4WXZA 3GG1A 5HBFA 4WJEA 2QCGA 4Z08A 4HSHA 1ZHAA 3DFYA 4DJDA 5CGQA 3HQPA 3W7CA 1JXKA 1YXYA 2XVNA 3AXMA 2D2HA 4LVFA 4TIMA 4HZ7A 1QW9A 5FJRA 3P8JA 1F76A 1CYGA 2PDFA 2ZTKA 4MKVA 4E6MA 5KINA 4NT0A 2QMJA 3V1HA 1J0ZA 2ACRA 3EWYA 5K9CA 2LLEA 1L2UA 1B5TA 3SBFA 1B3WA 4AYGA 1K7FA 3QBUA 4KW2A 3MUIA 1MFUA 4UTTC 1A4LA 2OODA 2QCDB 4LUIA 3PHAA 5A8PA 4D6DA 3UFYA 2VM8A 1UKQA 3T44A 5LZLA 2J6VA 4MKSA 4KCTA 1TB3A 2PDKA 1MXGA 3QV8A 3LLXA 1H62A 3VIGA 3K46A 3FV9A 2WPGA 2X0HA 5A3HA 1PJ9A 1XDJA 2P76A 5EBUA 5FKYA 3T0TA 3VIMA 5CZSA 2I5GA 4LU0A 5T91A 2X1TA 2Y7FA 3MUY1 3NZRA 1A50A 2CEQA 1EH9A 4WSKA 1MI3A 4IIBA 1R3TA 5B7ZA 4QITA 5CPTA 1TWSA 3S3GA 7PTDA 1VZWA 4H4IA 3AS3A 2FH8A 3ISIX 1GVRA 2JIEA 1XQKA 4GNVA 1KNWA 2PUZA 1VYSX 3WLSA 1A5LC 1J6OA 4M1BA 5BW6A 3S0CA 3P80A 3TTOA 4YCOA 5KMYA 4NUWA 4ERIA 1Q7MA 2INZA 2NVAA 1W1TA 4HD5A 3LNPA 5I5RA 3R8RA 1Q6GA 5JU6A 3M0MA 5FJIA 3ZJKA 3AIBA 5A1AA 1VLIA 4LUTB 4W9TA 4UQEA 7CGTA 3WNMA 3OZPA 5A95A 2J88A 4O28A 3SGZA 3W7DA 4HK5A 4H9XA 4Q32A 4YLWA 3M0ZA 1V6YA 1SFSA 3M47A 4HNNA 1S2AA 4J2MA 4M6VA 2X09A 4MZYA 3IJQA 3AXIA 1XCXA 3PUEA 1VPXA 4DO5A 4AVNA 1GOWA 4K7VA 4WLCA 2QLYA 4GI9A 4B5UA 3QLLA 1X38A 3WUEA 1FDJA 1CB2A 3ZSSA 3TWBA 1RSCA 3NR0A 1TWZA 4UIOA 3ANYA 4A8LA 1M3UA 5FIPA 3PWIA 4AH7A 4YNGA 5H8UA 4BQ4A 1UH4A 3UVIA 5DANA 1W3TA 4BI6A 1B3ZA 3OQEA 4MGGA 4N9EA 2W79A 3KOFA 3VAVA 1I45A 4HZMA 4F8XA 3W2JA 1GYMA 1P7TB 1QHZA 2VX7A 2ZA1A 1ONWA 3LBMA 5CC6A 3S6OA 4DWSB 1Y5XA 5F2MA 3SRHA 3VNIA 4C6EA 5H2ZA 4EIVA 3PZVA 2ZZ7A 3EMZA 4CEUC 3LCHA 1XL9A 2X8RA 4DIAA 2GK1B 3IJDA 4IMEA 3TOYA 1G7VA 4G1NA 1K4GA 3RM9A 3W1MA 2WJZA 4WKHA 5CPQA 4XQ6A 4QIUA 5D2XA 2CW6A 2VFFA 1M65A 2YZ5A 1PDZA 1WNOA 2CBIA 2HRWA 3RX3A 1CLVA 2DVUA 2E28A 2GOUA 4NZCA 3R11A 5BOEA 5A8QA 1B4KA 4ZO7A 4C7DA 1TQXA 4OBSA 3VKKA 5C54A 4ZQPA 3T78A 2PWEA 4NAFA 1FKWA 4CQBA 1ZP3A 3GNPA 4S3CA 4QE1A 3CC1A 4N02A 4GMEA 2Q8LA 3URBA 4IUOA 3WD4A 3BAKA 3OU8A 1KKOA 4MOZA 2P88A 3G1HA 4L4OA 5JQ9A 4CU6A 4J3WA 1YTDA 3MU7A 4CQ9A 2HVOA 5CPOA 2A21A 4P7NA 1IZKA 5DMYA 3N4EA 3ZJ6A 4LBUA 3ZR6A 4DJDC 1OFDA 3PK7A 6A3HA 4ZSUA 1WDDA 3TK7A 3W6YA 3DXIA 3W7QA 4JTJA 4GUFA 1CXLA 4JFTA 2VCBA 3QOKA 4L80A 4JTHA 1OCJA 1TX0A 1PHQA 2Y7GA 1TUFA 4BS0A 3LSBA 1CGYA 1M68A 2JEPA 3TNOA 1ZAIA 4GFSA 4LV4A 3UCCA 4NJGA 5D2YA 1Q4WA 2I14A 3DFTA 3EWCA 1M5WA 1IHIA 3THDA 5I3IA 3WD3A 5TAOA 4A05A 4MADA 4PMOA 4P8UA 5AVHA 3MSGA 2XJ7A 3RM4A 3KZSA 5C9RA 1SO4A 4ZQRA 3ARTA 1WOAA 2OVLA 1FWCC 3EMQA 4L6HA 3ITTA 3CHDA 2VNCA 1E9YB 2PPGA 3LXAA 2DW6A 3K5XA 2QUNA 3CPRA 2PDPA 4IMFA 4KKXA 2IS7A 3KW3A 2PRHA 3QC0A 2D69A 5GJMA 5E93A 2VMFA 2Y8UA 1FP8A 3VFLA 4PMXA 2BFGA 1UZ4A 4YVVA 1K7EA 3WQ6A 3OBAA 2A85A 1KBJA 4D1JA 2ZIDA 4JIQA 1X8FA 1Z8AA 2PCQA 3GSMA 3PJTA 3A47A 4EPEC 3UJSA 4K8GA 1EDTA 4OV9A 3M0XA 5E6ZA 4HK6A 4JKLA 3GW3A 5XIMA 3HIJA 1P6BA 1QK0A 2D23A 5FJPA 5E0CA 5AC7A 1BD0A 4AEFA 4Y8FA 1EYWA 2UY4A 2QCLA 2PWFA 2CHNA 1P1XA 5FL0A 2CNCA 1G4PA 5F1VA 5CSUA 4XAZA 3NZPA 2E3ZA 2E25A 5B7YA 1UKTA 3D46A 2PD9A 5DEZA 2X7WA 4NF7A 3SZ8A 3WQ8A 5HNNA 1UIPA 4A8RA 4OOZA 5U7SA 1NH6A 2Y5EA 2HVNA 1VKFA 3NQEA 5A8GA 3LB0A 1M53A 3T6CA 4C7GA 1KCKA 2ACQA 2VVNA 4TO8A 1YW1A 2ABAA 2BHZA 4PGLA 1RBOB 3CZGA 4NZ3A 2GLKA 1BFNA 4WJ8A 2YXOA 3BARA 2E09A 4XISA 1A5SA 4JIPA 3W75A 3RM8A 4CLMA 1ICPA 2P1FA 4J5NA 1QBBA 4FNSA 3VX1A 2DY3A 4Q7IA 1M7JA 4LNYA 4D9PA 1ZENA 4ORMA 3TP4A 5EGRA 4CEXC 1P0DA 1QBAA 4PFHA 1ZSXA 4GUJA 3FYYA 1W31A 4AHQA 4AW7A 4LALA 3LHWA 5E9AA 1J2WA 5CBJA 2VCAA 4LCSA 4AD4A 4ZODA 2RDXA 3BAYA 3S5ZA 1UKSA 4B3LA 1E0XA 2WMJA 4POCA 4IIFA 4J1OA 4JTGA 3F5KA 1QW8A 4Q4OA 3VGHA 4IHCA 3NEHA 2CBVA 2WBKA 3G1DA 2A3CA 2YBVA 4E3TA 4FB7A 4DXVA 3OTRA 4JNMA 4RPPA 3GE7A 4GC3A 2DSWA 1OFAA 1UD8A 3CGTA 3BZGA 1GK8A 3R58A 1JL8A 3GZAA 2C7FA 4P7LA 3G22A 3W71A 1SW7A 5CPNA 1CGTA 3SRFA 1J79A 2WJFA 1JQVA 1HGWA 3RHGA 1TVNA 1N8FA 4IP7A 4UOZA 1LUCA 3A3WA 3N6HA 1RVGA 5KZ6A 3LA4A 1LT8A 3ARWA 2B7QA 1QRQA 3THAA 2WSKA 1KFKA 4AY1A 5DXYA 2B7OA 3XISA 4NJJA 4HCLA 4Q6XA 1P43A 5I3HA 3JU2A 3W6MA 2CLFA 3GTIA 4KGLA 3N4FA 1W5NA 4XKYB 3GIPA 4JN7A 2FHBA 1XWYA 5CEWA 3V0SA 3E5BA 4I5XA 1E1FA 3CTTA 1XIHA 3L2MA 4KETA 3LS9A 3QR0A 4ZOBA 4F0SA 1M6JA 3VGGA 1E6NA 3FA5A 5AFDA 1NIUA 3IV8A 5HOSA 2MNRA 3FVDA 3LOTA 3MMTA 1VYRA 3QN3A 3VTRA 4GXMA 5T26A 3WMSA 4LC6A 1SYTA 2XWDA 1U2YA 1VBHA 5DO8A 1OFPA 5I2UA 4GXWA 4UUIA 2F6KA 3UZYA 3VDAA 3PPFA 4JTDA 1UYQA 4C6CA 2D3LA 4JAWA 3S5NA 2G37A 4O4WA 4E4UA 1HXJA 1LOQA 2BY1A 2VR4A 4K1GA 2BP1A 4GKTA 1NP2A 2EG6A 2GVGA 4A3RA 1UHVA 3U3HA 3HPAA 4H9VA 2PDHA 2GWGA 5EMUA 1RZMA 1M9HA 4XBSA 3FDGA 4XX6A 1RH9A 1Q6DA 4TQTA 2Z25A 2VEPA 3CAQA 2GVJA 3UT0A 4BA0A 3P74A 4M19A 4IH3A 2HNHA 3MWCA 1EL3A 1V0MA 2JIWA 4L9ZA 3MSYA 4RW3A 2GQ3A 4PL2A 4HTBA 1IF2A 3BG5A 3AJ7A 2WANA 2PMQA 4L64A 1VC4A 3ATZA 3UJFA 1W1A1 3ZMRA 3AMGA 3HURA 4IIHA 3KUMA 4XSMA 3IUIA 3IIZA 3T42A 2GGHA 3MUAA 3UNDA 3OIXA 1HIZA 4JTTA 4X22A 1JZ4A 2BXZA 4GZEA 6REQB 4C1LA 3LTPA 2OKOA 4JL1A 4XWUA 1IXNA 2DT1A 3EWUA 4RE0A 4Z1YA 5HMFA 4WOZA 1RQHA 2PSNA 3GYCA 3DDMA 5DBTA 1JI2A 2A3HA 1NF7A 4IPIA 1BXNA 4HA3A 2PU1A 1DWFM 3N12A 1VFUA 4WIWA 4C6QA 2B31A 3NSMA 3ABOA 3PFMA 1EJXC 1H7PA 1WKDA 4US6A 1H09A 2QJJA 3KVMA 4NU7A 1OC5A 3W1QA 4ERGA 4I9JA 3ZT6A 4KF1A 1UROA 2VELA 1O1HA 1R9ZA 1XD0A 1S2CA 2GJLA 2YCIX 1ISXA 5FI8A 2W0UA 4QDMA 3EKZA 2PRLA 3QH2A 4XZ9A 2Z27A 1L8NA 3WH5A 2Z7GA 5AKQA 4EACA 3W7LA 2ZA2A 1KWGA 4H7ZA 3UWUA 4AXNA 5AHNA 1SZFA 2VUYA 3L65A 8TIMA 3VZZA 3WL1A 2V2DA 3KBVA 3NL5A 4Y8EA 1THFD 2YZRA 4CCDA 4C7FA 1XGEA 2QF8A 3ZSTA 3WJZA 1EEXA 3QM3A 1E6PA 5I7GA 3P60A 1L6SA 1BYCA 5A5WA 4YMZA 1RPXA 4BQ5A 4DF2A 3T4WA 3TYAA 4M7TA 2VGBA 1UOZA 4ZOCA 2Z2UA 3ZIZA 3I6EA 1EO7A 1DWHM 2QCEA 2FPVA 8RUCA 4WRHA 4H8HA 5A2BA 1LLZA 5BRQA 3POHA 3WY1A 1TWWA 2YW4A 5A6BA 4HPNA 3UD6A 4DWSD 3MCMA 5A8OA 1W37A 4PRTA 3WUGA 3GVRA 5A94A 3BANA 2W9MA 3LXBA 3LV5A 5CBIA 3GB6A 3KDOA 5FSEC 4L9XA 3GXNA 4MAZA 1TPDA 4J35A 1JEZA 2Z7KA 1DXFA 5DMNA 4GLEA 4EWND 5BXRA 1RR2A 2A0NA 2YCEA 1AJZA 4Q4MA 4P61A 2YL6A 3BLDA 1C8YA 5LIXX 4DJFD 1FCBA 1NWUA 3ICJA 1UWAA 1SJDA 1KFBA 2D1ZA 3E3HA 1FCUA 1VGAA 3G1SA 4CD8A 4REQA 3PUGA 1E1CA 2CLKA 3GC2A 5BXSA 2VOTA 1HNYA 3MJMA 2X40A 1XF0A 3WK3A 1PAMA 2WVVA 1UC5A 3KRSA 5EMLA 2NZLA 3N04A 3OW1A 3S1WA 1PKNA 4OECA 2IUZA 2ZVIA 3G77A 2QGYA 1C29A 2ALRA 2B4GA 1PWLA 3CMFA 3AHVA 4L1GA 1YHTA 3O1NA 2WXDM 1XIFA 4NRSA 4L1WA 1GJUA 1IXPA 3M41A 1JF5A 3EA3A 1V0LA 5F4XA 4YVXA 2NV1A 3IVSA 5D2WA 2BOEX 3GFXA 3IIVA 5M3WA 2GJNA 1B9ZA 2R1PA 2WZEA 1AMYA 1MNSA 3WF3A 1EJRC 1EDGA 3CYVA 1Z42A 3M5YA 1RCXB 3M46A 3MW7A 3KL0A 4GIAA 4NNBA 1Q4NX 3UJRA 5LNVA 3CQKA 3L12A 3KOWA 3IANA 5DN1A 2HXTA 3N9RA 2DVXA 1H5YA 1GKRA 5REQA 5BXTA 3HPFA 3W2MA 1ZRQA 3H7VA 3R7MA 1EWDA 1OCBA 4O1DA 3KS5A 3CIWA 5HNTA 1F7BA 3GDTA 4NX0A 2CLEA 1PIIA 4QS5A 4I9TA 6TIMA 1NEYA 1OYAA 2W6RA 1W1B1 3CIXA 3VD9A 4ORIA 3PF3A 4B5NA 2IQTA 1SU5A 3CTLA 3R5EA 4HNVA 2F84A 1AMKA 2OGJA 2X1SA 2ZC8A 3RLUA 1QWKA 3F2CA 3M5VA 3I10A 1QASA 2WQPA 2QCMA 3YPIA 4GVFA 4TMCA 4DUVA 3NL2A 5DRCA 3MKCA 1EPVA 2C16A 3AXXA 1F4HA 3T1GA 3U48A 1Z89A 2IXUA 4H6EA 1OG0A 3BQ5A 2YBUA 3PAJA 3VNLA 5AYBA 4JXCA 3THCA 3R2GA 1AA1B 2CETA 1CGWA 3FA4A 3P2VA 3EOOA 4PUNA 4X0VA 3CHEA 1BKHA 4E4PA 4ZB0A 4KFNA 4QTGA 1KXTA 3TN5A 1XFCA 3VD5A 4IJCA 4JDBA 1B90A 5CCZA 4RV8A 1D2KA 3UCQA 1J18A 4UQBA 4OJYA 2P3EA 1F07A 2ZUTA 3TFCA 3T08A 1HG3A 3CV7A 3S5YA 2WSQA 5FEZA 2QYGA 3LX9A 3R79A 4D6EA 2PTDA 3VGBA 3GRIA 1UBSA 2PLCA 3BG3A 3WLIA 3WD1A 2W4XA 4QAIA 4JFWA 2WVSA 1A80A 1W9UA 1EEPA 4CU7A 4QLLA 4UC5A 4DXXA 3NQ7A 2PF0A 2WQDA 4M6QA 3WYZA 4AF0A 2ZZ5A 4IPNB 4UCFA 4JKMA 3Q4DA 1X96A 1UP3A 2NUXA 4TR9A 1UWQA 2Z1BA 2ZZ3A 4LT9A 5HK4A 3MC5A 3MV11 3WFLA 3CMJA 3P3BA 4JQ4A 1JCNA 4W8AA 4E2OA 1NDYA 1H3GA 2O9OA 1OCNA 4MNJA 3MMUA 4DYKA 4N0RA 5HJYA 2NX9A 3B4YA 1VEPA 3V5OA 1EYEA 4NNAA 1EZ2A 2PF8A 2VOMA 3W2LA 2ZE3A 5FESA 1A3WA 3WH9A 3TR9A 4N9BA 2OG9A 4K36A 4IPPA 5DMLA 3K2GA 1JI1A 3IPWA 5AC5A 3ONBA 1DJIA 5DY2A 4O4VA 3QMRA 2OO0A 4H01A 4ROQA 4N6FA 2WVUA 2V81A 3DBPA 1R2SA 4TX6A 3CZJA 2XFRA 1DIOA 4X0NA 1T8XA 1ZS2A 4PE8A 3CNYA 4GX9A 5ABEA 1RUSA 3HPZA 1HL2A 5FAJA 5G1TA 3RFAA 2VEMA 1QI4A 1VFSA 5XIAA 3UGRA 4NAFB 3B0PA 3VA8A 1IGSA 5M1TA 1L0PA 4Z1BA 3TTQA 2DZAA 2DUXA 3ID7A 4LRTA 4B3ZA 3W2UA 4JYDA 3IGXA 5C2GA 3IEBA 4S3EA 3A24A 3CZKA 3WF2A 4ATLA 3Q67A 4QCEA 4YVPA 1BWKA 2WSPA 1FY6A 1MXDA 4G6CA 3I6RA 3LCWA 3VM5A 3MA8A 1A5BA 5LNUA 3SURA 4XBKA 5CC5A 4IZGA 1EUNA 3ES8A 4DBDA 3O05A 2UBPC 1J8VA 3SCUA 1Q7ZA 1R30A 3NTYA 1DQWA 3U4AA 4FLSA 1XLHA 1UR8A 3QRHA 1AODA 1GYNA 4OKDA 3GKFA 3B8DA 3W9ZA 3T40A 4QRNA 2BY2A 3BC9A 2VEFA 1OYBA 1K6WA 4UMCA 1UR4A 4A4AA 3AIQA 2UWFA 4H6KA 1OG6A 1F5ZA 3HQOA 5IHRA 1I1WA 4HB7A 3RRAA 3T4CA 4DAFA 3SGUA 4JTFA 1HJQA 3BW4A 3H22A 6CGTA 2IKIA 4I7VA 4HYRA 4G56A 4V15A 2WHLA 2H3DA 4KRTA 4DAIA 1QHOA 3TKFA 4G7EB 4LUYA 3NM3A 1YPXA 2DSZA 4ROPA 3SB0A 3IJIA 2O56A 4GY1A 4AZGA 3EB2A 4GZIA 4B5WA 4O14A 1DYSA 3JS3A 2GGGA 2IXVA 1YNPA 4U33A 2CZFA 3ZVHA 2DU2A 3C61A 4LTSA 1DJNA 1G4EA 1I0BA 3CWNA 1EGVA 3VKJA 1UR3M 3SY8A 4XD6A 3LGGA 1ITQA 1DJZA 1YQ2A 3E6EA 5BXPA 4AHOA 3TA6A 3E0WA 5JXQA 5L9FA 1LP6A 3AIUA 3F2DA 1XGZA 1MUCA 1SSGA 1RQBA 2IPGA 4MJZA 4QNWA 3W1XA 1QU4A 2V2HA 5A6TC 4IOTA 1XRVA 1X1OA 3GDLA 3SUWA 3MVIA 4W5ZA 2FB3A 2WKLA 2A7RA 2XVGA 2J9YA 7TIMA 1PTGA 2RKXA 2YYTA 3VC6A 1JGIA 1KFCA 2PCEA 1RQEA 3DHDA 1U1HA 2VRKA 1V4YA 3Q45A 1X97A 1XIDA 5DCEA 6TAAA 4MY1A 1OFBA 3F5LA 4UFKA 4GJJA 1T7LA 3STCA 4Q4RA 4FAMA 2R1KA 1IWBA 3AZTA 3IGHX 1NQKA 1M7PA 1V77A 1KM2A 5JIWA 3C0LA 4ML4A 4PMDA 3K4AA 3C4UA 5EMJA 2QJNA 4PZVA 5LA2A 4WSJA 4ASTA 4PTXA 5HDRA 3F4VA 4QGCA 4LVDA 3S1UA 2OTDA 1E1EA 2ALDA 5A6SA 1SR9A 2FDSA 3L4TA 3MI6A 3O7UA 3EDDA 5JMUA 2OQYA 3AUOA 1H49A 5D33A 3OYZA 3BXWA 3DGRA 1JXJA 4K68A 3GVWA 1E73M 5CC7A 3O0KA 3CL6A 3DEQA 3AHZA 1E0WA 4WGHA 1VF8A 3N18A 2PDGA 3GH4A 1OY0A 4LPCA 4OOUA 1JZ3A 2CZ5A 4XZMX 2FGBA 2RFGA 8XIMA 2V69A 5C0QA 3HQ1A 1UKOA 2I7GA 2GPTA 1LL6A 4CU8A 4IG2A 3NL3A 1QI2A 1QMLA 1TA3A 3VO0A 3AIEA 5L6UA 4XTIA 4OU1A 3IS4A 2C13A 1V93A 2XN2A 3UY7A 2REQA 4O1EA 3GBDA 4UNIA 1UD3A 4MAVA 3WDJA 1KLYA 1JRBA 3IUDA 1ML1A 2YOCA 3U9IA 4PTVA 2E5CA 1C8QA 1W3HA 4LC8A 2NVDA 3TU9A 1F05A 2AMXA 2DORA 4W85A 3F4NA 3STFA 4RK8A 4YCPA 3O0FA 1VJIA 1OEPA 4ACZB 2V67A 4INFA 3QGKC 1EPXA 3GFYA 3UPWA 1LUCB 3CH0A 4Q4KA 4DYEA 3M44A 2Z00A 1TR1A 1AD1A 2I5IA 4ONVA 1OINA 4AAJA 4PMYA 1BYDA 1TREA 3WLHA 3L5AA 2JE8A 4S23A 1ESWA 1QNPA 3UU0A 1UH3A 1RPKA 4GE8A 2QEZA 1U1UA 1W3KA 2QDHA 3OBKA 1PZ0A 4B4HA 1SGJA 4RDVA 1UP2A 4HNUA 1BVNP 2VDHA 3NFUA 5ABTA 1XC6A 3EXTA 3G8RA 5LHFA 5JVLA 3CWOX 4X9SA 3SUVA 5BNKA 1XIEA 2A5HA 1IIHA 4ZVJA 1HVQA 1MMFA 3TONA 3RCYA 3DBNA 2YA0A 2QQ6A 2YL8A 3HG4A 1R9XA 4KERA 4FMVA 4AZ7A 2CC0A 4F48A 3H2NA 5LIWX 4WX2A 2BX7A 1KFEA 2XSAA 4MSSA 1FBAA 1XPGA 1CXFA 1KFJA 2P3ZA 4GISA 2XINA 2R1NA 1UUQA 2F7FA 3VMNA 3VIHA 1WKYA 2P10A 1V08A 5AB3A 2XIOA 3TN3A 1I2QA 3TUUA 1B31A 2Z6JA 1EOMA 3E12A 5CH9A 1SJBA 5GNZA 1HTIA 1EQPA 5J5DA 2FMOA 2C1HA 1F8MA 1FHLA 1TELA 5GNYA 9CGTA 4PUMA 2ACUA 2IW0A 1GVSA 3TYZA 3OLIA 1E56A 4QXIA 1ZB5A 3GY1A 1Z9AA 4WZHA 2PP1A 3VZXA 1KQZA 2GVLA 1CGVA 1XYZA 3SW6A 2X16A 4O15A 4LF2A 4L4PA 3HM7A 1DTNA 3B04A 4XUGA 4V1XA 5H6HA 1K9FA 1EP1A 4H41A 2UY2A 2QUVA 2GDQA 4O1CA 4GPNA 2O92A 4GACA 1P5BA 4H00A 5LIKX 2VD9A 3I68A 1DQXA 3ABSA 3L4WA 5AC8A 1KBLA 2Y61A 3ITCA 2EPOA 5D4YA 2YDSA 3W6LA 4LW7A 3ITYA 4B4FA 2YGYA 1TV2A 5GVJA 3MHGA 1SZEA 2L5HA 1WZAA 3I3BA 2OEJA 1KM5A 3O3RA 5CKSA 2XH0A 1BRLA 3GHSA 1J5SA 4F0LA 1L6YA 4IGHA 2WLYA 1EC9A 1MZHA 1GOXA 5CAHA 1UUMA 4WDTA 5BU9A 3AXKA 3VMPA 1CZ1A 2AQVA 3DZ1A 2DQWA 2X42A 1A4MA 4AISA 1A5AA 3FKRA 1E6ZA 3OG2A 1U22A 5HQEA 2QAPA 1MZRA 3LDVA 3UWWA 3UEQA 1GOMA 2ZUUA 3W86A 3CQ0A 2INEA 1V6TA 1ITXA 4AX7A 4GVIA 3CT2A 4NKCA 1HJWA 1W1VA 1EF2A 4JCLA 4FIQA 3H23A 3VKAA 2XSXA 4Z17A 3GG0A 3DIPA 1H0GA 3G18A 4NJHA 2QCDA 3KTXA 2DZTA 3ARXA 2G8ZA 3BCDA 1YE4A 3AOFA 1SZRA 2PTWA 4UQAA 4IMGA 1VCVA 1UR2A 4CD4A 4DQWA 1FHVA 1TR9A 2YCJA 3TYUA 3QMSA 1TJ2A 4TVCA 1BQCA 1OYCA 3W1TA 3NXFA 1OX5A 4XV0A 4E2BA 1DE6A 4Q7BA 5AHFA 4UTWA 3HJZA 3MDWA 5I3JA 4QQ3A 2J7HA 2QULA 4QAWA 4HSOA 3MP4A 4W84A 3B40A 4JTRA 2XVPA 1DIDA 2WM0A 2ZRWA 2C71A 3BGGA 3BW2A 3GAKA 4NJIA 3VNYA 2GQ8A 4BR1A 1PX3A 4KIRA 1S3HA 1CX9A 1I2RA 4G1KA 2BS9A 2PTXA 3PULA 4Q7NA 4IIDA 2XFWA 1QOPA 1P4CA 1PKMA 2HE5A 1GOOA 1AG1O 5FF4A 3AZSA 5E1QA 1M41A 2CHOA 2CXEA 3OZMA 4M1RA 3W7MA 4EPKA 4G5DA 3W1UA 1M1BA 2GFTA 4LBSA 4REQB 1E55A 1E1CB 1JZ6A 5HNUA 2C0HA 5F2LA 4GK8A 2WVVB 3EOEA 4LEQA 2E67A 3R25A 3UJEA 1N55A 3MMWA 3WLLA 2V5JA 4G2DA 3SJNA 4UWMA 3MB9A 1DHPA 4GUIA 1HN1A 3E2RA 2EPLX 3NGJA 4A35A 4QJ5B 2ZXQA 4AWUA 2PLJA 2ZOXA 3H21A 1VBRA 5EFFA 2VKZG 3A23A 3BQ6A 4K37A 2I17A 4L6OA 3TC7A 3IJ8A 3VDCA 3BE7A 2FH6A 4JFUA 1LWIA 1TRDA 4TVUA 5DT7A 2TMDA 5EKYA 1QOXA 2F9RA 2YDAA 3FLUA 3TTSA 3RG6A 3M64A 4B5VA 1SQ7A 3W3OA 4DWSA 3BLKA 3DFPA 2PDJA 3UBPC 5DY3A 4LS0A 1YTEA 3VIOA 1W5OA 1V03A 1ZP4A 3FJ4A 4X61A 5MKGA 1HO4A 3W7RA 1ALDA 2CCRA 3HPXA 5REQB 2CITA 1GOQA 3VOHA 1J6PA 5I3FA 5T9CE 5C2XA 2VZVA 1W3LA 3KCOA 5BMXA 2DQXA 4RV3A 1FWIC 2WKGA 2J8TA 3M0VA 2FKPA 1C91A 5F4WA 4DJFA 4GJIA 1RY8A 4C65A 5HMEA 4IX0A 3TX9A 3BVJA 3ITLA 1HKWA 3L4UA 3AXHA 4A3UA 4GY0A 3ZWSA 2XIMA 5TD4A 3USZA 4YPJA 2OB3A 1GVFA 1TV4A 3QYSA 4UTJA 4JX6A 3AWNA 3VYLA 4Q8UA 1ZCCA 2VD8A 2OYKA 3QLDA 1U5HA 3N17A 1TPUA 4KT2A 2F38A 4TU1A 3H4XA 3GXMA 4ZL1A 1R3SA 3LHZA 1RV8A 2GSJA 3N11A 3W1RA 5CZ0A 2J62A 3GM8A 4YS1A 3H8AA 3APTA 3NWRA 3EYPA 5ECUA 1IWAA 1JF6A 6XIMA 1EF3A 3UR8A 3G1YA 4O1FA 3TW9A 4J3UA 4L65A 5C7VA 3S9ZA 2WSRA 1F3XA 2UY3A 4XO7A 1WXJA 3G1AA 1DOSA 1HX0A 3TC3A 4IIGA 2KX9A 3SUTA 2QGHA 1G67A 4N4QA 2YPIA 5TQLA 1U1JA 2PDBA 4WDUA 4Y9NA 3TV8A 2BXYA 2XG9A 3TSBA 2J25A 2OOFA 1X39A 1E6XM 1V51A 2V5LA 4Y6GA 4MLRA 1WXZA 1EKOA 4PCSA 4RX0A 3E74A 2OELA 3W29A 4AF0B 2C8NA 1DJYA 3DH7A 3SUSA 4PEKA 3T0BA 3A3XA 1MW1A 2P53A 2GJRA 1FP9A 2PI6A 1KCLA 3MPGA 1F9CA 3WH8A 4LFYA 3WFAA 5G1MA 5KEZA 3P5YA 1UPMB 1RCQA 4AG0A 4UTWC 1AL7A 4IFRA 2YDRA 2Y6ZA 4IQJA 5HJLA 3EB4A 4RW5A 2HZGA 3P84A 3PAOA 4GYFA 4C1KA 2RDWA 4I5UA 4JIEA 3C5QA 4HU4A 3RRXA 3KEHA 1C3FA 2ISWA 2DH3A 4BHYA 4EVZA 6ENLA 1YDVA 1KM3A 1I8JA 1HF6A 3QQ1A 4BZYA 1TRIA 4NQ1A 1ME7A 4F2UA 1PZ2A 4HK7A 1KQYA 1P0KA 4HNCA 1KBBA 3IUHA 5FEWA 1CLXA 1G9HA 4Z1DA 4A8IA 2A4AA 2VX5A 3FHAA 3BLIA 4O1BA 3LK6A 3TR2A 5F7UA 4URIA 9XIMA 2BOFX 3WD2A 2A3BA 3PWGA 1HW6A 4FF7A 4CUCA 4XKMA 2ZX6A 2TODA 4XAGA 1UMYA 1H0IA 3SQSA 3FSTA 3T8QA 3HU7A 4LYQA 2XDFA 2O9RA 3OZYA 5BCAA 1NDWA 2J7BA 2QCNA 3N9SA 3L4XA 1E43A 4CNNA 5I0DA 1XRTA 3DC0A 2VR5A 3B8IA 4GRSA 1FCVA 3GTFA 4HZ6A 4PR4A 2A3LA 2DPEA 3DX5A 2O9PA 2ZRZA 1V3JA 3PZNA 4E4FA 4DO4A 2Q02A 1Q8AA 2FVLA 2PC4A 2J4GA 3KDNA 1FHUA 4N4PA 1OGGA 3SSZA 1A3HA 2FTWA 1DWJM 4GJ1A 2O9TA 3R12A 2QUTA 3PN8A 4DWSC 3GNNA 3W72A 2OX1A 2NQLA 2JQXA 4PTMA 4MDOA 2J7FA 2E5BA 4U3CA 1K8YA 2D22A 1K77A 1IE7C 4ADSA 1WA3A 3O6AA 1M7OA 2V5CA 2Z26A 2A3AA 4J3VA 3LRKA 1WX0A 4EKJA 3CK5A 4DJFC 3DKLA 2EKCA 3S4TA 4LRSA 3AROA 2GGJA 2EO7A 3PJWA 4U5IA 3S9IA 3W22A 2OLHA 1LQAA 5JH2A 3L2LA 3L2IA 4AX6A 4ZE4A 4PB5A 3KCLA 2Y8VA 3N9KA 1EC7A 3TC6A 1YBQA 1EJWC 4PTWA 3BAJA 3KRZA 2G3JA 2HQAA 2DIEA 3LYEA 2VGGA 3G0SA 1D8CA 1N7KA 3TXVA 3II1A 3OO2A 5I03A 3FIGA 5HUPA 3PG8A 5CSRA 3NYZA 2Z1WA 2J74A 1CWYA 1EJVC 4PMUA 1ENUA 3ZVHB 3EPNA 1E3XA 3ARRA 2XISA 1ODZA 3N2TA 5AHIA 4XTDA 1XYLA 1ZBKA 1JDFA 1S5NA 3WQOA 3NSNA 3WQFA 5JUVA 1JUBA 1OF6A 3HN3A 1UR9A 3M0LA 3VILA 1HUVA 3W7OA 4EWJA 1KRCC 1P0EA 4XKYA 3QGVA 1R9YA 1QNQA 3THUA 3E02A 4IIEA 3R0DA 3GNXA 4JTKA 2G5WA 2Y89A 3QHMA 3LHVA 2TYSA 3DYMA 4KEMA 1FWRA 3CASA 2R8WA 1XLJA 4HOWA 1KKRA 4JOMA 2WBGA 1W32A 4F40A 1HKKA 4HHMA 2HMCA 2P0OA 4XSLA 4AWSA 4HYVA 1JNDA 2QJGA 3NQVA 3RNDA 1RA0A 3T9PA 3EPMA 3HG5A 2PFHA 1AH4A 3GW0A 3NDYA 1XBZA 3MSDA 1T40A 4Q6JA 2V82A 3S2MA 4HVXA 4OIFA 1V3HA 4BWLA 1Z41A 3MTWA 1W5PA 2VHLA 3UNTA 3HMJG 1WUFA 1CTNA 3PZGA 3NG3A 3TMQA 4FX7A 1PE1A 2FDMA 5AY7A 2PDQA 3NSXA 4TTGA 4K7YA 4A21A 3NL6A 2J47A 4HCHA 4DF1A 1LJYA 2E0PA 4QEEA 1NDZA 3ZJ8A 5ABHA 5G4EA 3BGJA 2P5NA 2JEQA 2FGZA 3KTSA 4E8CA 1DWIM 4W4QA 3WLMA 2YLAA 3VNJA 1RD5A 1DXIA 1K8XA 1OFOA 1XQLA 3S1VA 3BG9A 4XD3A 4IF2A 4LB4A 1U30A 4HOXA 4LAOA 2PRMA 1TA3B 3GXTA 4FOJA 3QKZA 3RN6A 1WAWA 2F6UA 2R1MA 3T7VA 4CNTA 4IMDA 5FOOA 3EX6A 3U4FA 3VPLA 1XLEA 1XM3A 5F2GA 3GHUA 2ZRYA 3QZ6A 2PWGA 1L6WA 3DKJA 5EY5A 3WDPP 5JBEA 2NWRA 1A5KC 5HWJA 3JUGA 2W66A 1ZLPA 4TXEA 3P7YA 1O68A 4B2DD 1PSCA 1ZALA 3F5JA 3WLTA 5E0FA 4LX4A 1XBXA 3U5UA 5BRBA 3WBAA 6REQA 1R47A 2VFIA 4V1YA 1AH0A 1CXKA 2WVTA 3SN4A 1GTHA 1N8IA 3E49A 4QHRA 1M7XA 4TOQA 5IBXC 4N9DA 3L4ZA 1K9DA 3E0LA 1OX6A 1C8VA 1MXSA 1QI5A 3EZ4A 4R53A 4PL1A 4FA3A 1XYFA 3ZFHA 4ZO9A 3WLJA 2AKMA 1SJAA 1JPHA 3EXRA 4NP7A 1UCWA 1R7AA 5HR6A 4RE2A 3VE7A 3AIVA 3S8HA 3B06A 1BXCA 3S2JA 2E8YA 3VINA 5C9UA 2HNEA 2O0TA 2WKJA 3MHFA 2Y62A 3KXQA 1PCKA 4A29A 3OVGA 1TPEA 3PFRA 4IWWA 1DWGM 5HUOA 1I2PA 1B1YA 4D6FA 1GG0A 2QAFA 1UKPA 3AS1A 3LHTA 1C7SA 1VIWA 4KS0A 2EXOA 3HMCA 1IT7A 3IJ9A 2WJEA 1U5JA 3MO7A 2V8ZA 3PZIA 1POJA 1VYPX 3S1GA 2Z1XA 2HE8A 3CM4A 5G2WA 1R0MA 5TF0A 1B57A 3QPZA 1FWNA 4PB3A 4Q33A 1SSDA 3CL7A 3W82A 4IPLA 2VFGA 4GABA 3CAVA 1UASA 5EL1A 3AALA 2CZEA 4LS2A 4ZOEA 4AZIA 4EP8C 1CIUA 1VBJA 2G3FA 1JFHA 4MYXA 1WZKA 4WXYA 3L5LA 3EKLA 3W76A 3KVKA 3K4DA 1KR1A 1CT5A 3CAWA 2JGQA 1QNRA 3LERA 4DX3A 4P8WA 3USBA 1EIXA 4U3AA 1JCLA 2PDCA 3AI0A 1GJPA 3B05A 4LANA 1AJ0A 1YMYA 3VNKA 3W7PA 3CPGA 2C19A 1GOIA 2MUCA 3H26A 4AVFA 4F0MA 4HA0A 3FAWA 1JDDA 3BOLA 3N2MA 1H51A 2CZVA 2BGNE 1ADDA 2R94A 5SWUA 1VCFA 3VIIA 3UR5A 3CUXA 1JPIA 2Q3OA 4LVAA 4FR6A 5DF0A 2Q09A 5I00A 2C18A 4MB3A 3MY9A 1KRAC 3XIMA 1P0NA 4MUZA 5EMMA 1JR1A 1MO0A 2DZUA 3M7SA 4ZFMA 1VJSA 2A1YA 4UFLA 1JJKA 3CO8A 1UOKA 1JCXA 1O66A 4CKQA 3N3MA 1GHRA 3VNZA 2BVYA 1EOKA 3AS0A 3NQ8A 3VCCA 3OQ8A 3H2MA 3PB0A 1BKSA 4LUJA 2RH9A 2CLMA 1QI3A 3I4KA 3N14A 2VTFA 2OU4A 4CN4A 2FJKA 3OJGA 4CQCA 1OFRA 3OEXA 1UG6A 5GJPA 4RL3A 3W1NA 4GQQA 1HL9A 3U6WA 4Q8TA 1GQKA 1OJXA 1ZJAA 4GZ7A 2E4TA 1MUWA 4PUUA 4DYJA 1MEWA 1IEXA 4JYFA 2H9AB 2GGEA 4F2BA 1RLDA 2QIIA 3VIPA 2OGYA 4EXAA 3UA4A 4RLIA 2POTA 4YWIA 3RIKA 5H8MA 4H3DA 3QZEA 2WW5A 2QF7A 1YTKA 2DP3A 4NG3A 3CV2A 3PSWA 3WFZA 3WQEA 1AH3A 1LCOA 2I5QA 5DCDA 1LG2A 2OPJA 3OHIA 1PS9A 5CBBA 2BOGX 4JPGA 3MBFA 3C2EA 4FLQA 1UJPA 2TRSA 1J01A 3E0VA 1HZYA 3BTNA 3S2LA 1E70M 2WOQA 3I7SA 3B8WA 3M0YA 2IQDA 4DUWA 5FACA 5KTLA 3W1LA 1VR6A 2XVLA 3BAXA 3RXZA 1TPB1 3KVLA 2R9RA 1IEWA 4RZ5A 5CQ1A 1ONXA 3WQ5A 3B8TA 3V0UA 4Q8WA 1TZ9A 5A6MA 4K6AA 4V27A 5HINA 4K38A 4AXKA 4TV6A 1Y65A 3MCOA 1KGWA 4IGMA 5DRIA 5GPRA 1EBHA 1RALA 2YDQA 3TE9A 2W62A 1EFZA 4WOQA 3P0XA 2PWUA 4GC4A 1FCQA 3GAYA 1ZBCA 3OVQA 2DSKA 2V5BA 3PTMA 4EE9A 4N9CA 5I02A 5A6KA 1LBFA 2OSWA 2A2IA 1SFLA 5PTDA 2J27A 1OCQA 1I60A 1TV5A 2RAGA 1KTCA 4PCPA 5AYZA 2VR2A 5LXEA 3T2OA 5RUBA 2RJHA 1OABA 4MG4A 4M24A 5CC3A 4Y9PA 4K3ZA 4U2YA 3P6LA 2ONEA 2AL1A 5BYWA 1PUDA 1XC4A 3M0IA 1OX4A 3AZRA 3ITOA 1ZBWA 3FDKA 5CSSA 4LF1A 3MANA 3NAVA 2CYGA 4GBDA 2PDWA 4C5ZA 4UNKA 1KTNA 1EX1A 2PWHA 3I3EA 4AIOA 1VBUA 4GHRA 1C93A 4HPJA 3T8LA 3EEGA 4M56A 2Z1VA 4IMAA 3A4JA 1A5CA 3DGBA 3TQVA 4OGZA