1QK0A

Cel6a with a non-hydrolysable cellotetraose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
363
structure length
363
Chain Sequence
b'TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE CEL6A (FORMERLY CALLED CBH II)
molecule tags Hydrolase
source organism Trichoderma reesei
publication title Crystallographic Evidence for Substrate Ring Distortion and Protein Conformational Changes During Catalysis in Cellobiohydrolase Cel6A from Trichoderma Reesei
pubmed doi rcsb
total genus 137
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1qk0A00
1OC7A 4AVNA 1UP3A 2BOEX 2BOGX 1DYSA 3A9BA 3ABXA 3VOIA 3RU8X 4B4FA 1UOZA 2BOFX 1QK2A 1OCJA 2BODX 1GZ1A 4AX7A 1QK0A 1UP0A 1QJWA 1UP2A 3RPTA 1TMLA 3VOJA 3A64A 3VOGA 4I5UA 3VOFA 1OC5A 1OCNA 4AVOA 4A05A 3VOHA 1BVWA 4B4HA 4AU0A 1OCBA 1OC6A 2BVWA 4AX6A 1CB2A 4I5RA 1HGYA 1HGWA
chains in the Genus database with same CATH superfamily
2XIBA 1OK4A 3EXSA 3PPFA 3UZJA 1M1BA 3MYOA 1KRAC 3GUWA 1CB7B 4LB3A 1W5NA 1FWEC 3SN1A 3TW7A 3W07A 1M53A 2ZKMX 2WNZA 2YDAA 1UHVA 3UJFA 2CERA 2VD8A 5LNUA 2EG6A 3GDLA 4H2HA 1J2BA 2JQXA 3GDMA 4HZ6A 1TWSA 3WUBA 5LIXX 5E09A 1UBPC 3HV8A 1EYEA 1JDDA 4W89A 3ZLFA 2V38A 4AVOA 1BGAA 2VC6A 2F61A 2DUZA 3SGZA 2GJLA 2AMXA 2YLAA 2A7RA 1D2KA 4D6GA 1QW9A 1ISVA 1G7VA 2I1OA 5CZTA 3H53A 3H2CA 2X05A 3WLLA 4GO9A 1JDFA 3LI1A 5A8MA 2DY3A 5E6YA 1I8JA 4X0VA 3IUHA 2FPYA 1FX6A 5CBJA 1FRBA 1DXIA 2WZMA 2V5CA 1VFOA 2H8ZA 3IJ6A 4GQBA 3VYLA 3CH0A 1PIIA 4R9XA 4B2DA 3TV8A 2GPTA 5KITA 2PDKA 2PTZA 1H7NA 5DMMA 4GJ1A 1W5MA 3SCOA 4UXDA 1OX4B 4OHQA 1VR6A 4NY2A 3WL0A 1YHTA 3WQEA 3QGKC 1IZJA 3CNYA 1QPRA 4WRHA 1SZRA 4W5ZA 4LU0A 4OTKA 4NZFA 3N25A 1VRXA 1EP1A 3SSZA 1F9CA 1T8QA 1SZFA 1HKIA 2E6DA 3LTSA 3WDRA 4MLRA 4Q8NA 3P67A 4PTDA 3TTQA 3IJDA 4OGZA 3A9IA 3NL2A 5I3IA 2VT0A 4XAZA 5HOSA 5FI8A 3VNZA 1CB2A 3S83A 4ICNA 1KO0A 3AHTA 2J24A 1M7XA 1PKLA 4Q4MA 2FVMA 1GQIA 3DG3A 1WKDA 3HJEA 3MSYA 2Z6IA 5AYIA 3VGEA 1YTEA 1VYSX 2CXEA 2DQXA 5I3JA 2AAAA 1KQZA 1DJQA 3VVGA 3CMJA 4OFCA 1S2AA 3VO0A 4YYCA 2XVNA 4EPDC 4PMDA 5DMLA 4KF1A 4DUVA 2V3FA 4LCQA 3EWZA 3TLLA 2DW7A 4PN2A 5G2HA 1HT6A 3L2LA 3HMCA 2XFWA 3W74A 2CHNA 5D2XA 1JCJA 1WDRA 3PWGA 1SJBA 2NSXA 3FAXA 4ACZB 1RCOB 1W1A1 4S3AA 1QCWA 1TZZA 4EXQA 5CJNA 4IG2B 5EBAA 4D8AA 3QQWA 2J74A 3WF3A 3UCCA 3UCDA 4NI3A 1UWAA 1GVQA 1TR9A 4UFHA 2Z27A 4XUYA 2NUWA 3VOGA 3BAKA 1OCNA 2OO0A 4GRSA 3VM7A 4ALDA 3Q45A 1RXOB 3VE7A 5HJYA 1X39A 1H0IA 1QWKA 4DN1A 1A49A 3USBA 2GYIA 4NYYA 4PTWA 3QSTA 1D8WA 1S46A 3T0DA 1DHKA 1XHGA 3B04A 3G6LA 3T4CA 3WQGA 3B0YA 5PTDA 4PH6A 2EO7A 3G1FA 3MKVA 1M68A 2Y5SA 4M24A 4JFUA 1EPVA 5HQMA 4WR3A 1DWAM 4TV6A 1TELA 1JNEA 1B3YA 3QPYA 3IGXA 1OFBA 4UUIA 4B5UA 4BS0A 3WLRA 1R7AA 1W31A 3CO8A 3PAOA 1B90A 1Z8AA 3M9YA 5BWFA 1PDZA 3IAPA 2VC9A 4AD2A 1P5BA 3O07A 4FALA 3MSRA 1C8QA 2XISA 4OOUA 4B4FA 1U1UA 1BQCA 3M6DA 2HTMA 4YMZA 5T9CE 4Y6GA 3WLTA 3CT2A 3M5VA 4YU1A 2H3BA 4JIHA 1MO0A 1UWQA 2HVMA 3VC6A 1GOXA 1P6CA 5LHFA 1TJ1A 4QDPA 4JN7A 1J10A 3MY9A 5TBOA 4ASTA 1OIFA 2PDFA 1O5KA 5F2MA 4ZOEA 2E28A 2Y7DA 3BOFA 3N9RA 2D20A 4L80A 3WJZA 2VDIA 2EPLX 4PMZA 2GVGA 3FXGA 4O1CA 2WPBA 3APGA 4LOCA 4R88A 4MWAD 4GH3A 1Q6GA 4U31A 4E3VA 3EA3A 3PB2A 4DO4A 3W27A 1QI4A 1P7TA 3GWQA 2DT3A 5G5IA 3ZSTA 5DRIA 1GGOA 5L6UA 3E1F1 4J4KA 2PWFA 3UPMA 1TJ2A 2J27A 1XCFA 3NCOA 2DSZA 1LQAA 2FVLA 1DTNA 4CUCA 3SCWA 1TPUA 2GOKA 3MV11 3B8VA 1O94A 3GDRA 2E67A 3CEPA 4XO6A 4EE9A 1D3CA 4TIMA 1WCGA 4LCSA 2IW0A 3PZ9A 1QFEA 2V2HA 4DY1A 3TXZA 3LG3A 3QV8A 1KRMA 1J8VA 4R9OA 2O55A 3IJ7A 1V6WA 4REQA 1KA9F 4JCMA 4BKNA 1IEVA 1XINA 1CYGA 4GWEA 4KESA 1YXYA 1REQA 1GVOA 1VBRA 3M0IA 1QPOA 3M1ZA 1ICSA 4KRZA 1B1YA 3B4UA 5B7ZA 3UQNA 2CBJA 2PLMA 1YPFA 4MTVA 2YX0A 5LNVA 4DO6A 3A4XA 1F05A 1JUBA 2FB3A 4Q8OA 1A5KC 1PKNA 3N34A 1GWJA 2P0OA 3W83A 3TC6A 1EDQA 1V6VA 4ZBCA 1FWDC 5KZEA 3ARVA 2ZE3A 4OE7A 1W5OA 1ZP4A 3GXMA 3OZPA 3NG3A 4IMGA 5D02A 3GSMA 3WLNA 4AF0B 1V93A 2SFPA 5E9AA 3MP3A 1PE1A 3WD0A 3PAJA 2JIWA 2PAJA 3ARPA 3U8GA 4A3QA 2G3FA 3A9BA 3STFA 4JICA 4C6JA 3EEGA 3BCDA 2FVKA 4QLKA 2OO6A 4JKMA 3DFOA 4RZ4A 2D73A 3FJNA 2C71A 4QHRA 1W56A 3KZSA 3MW7A 2VGIA 3CB3A 2AQOA 1XG3A 3NDYA 2BB0A 3W7RA 3K46A 4L7ZA 1D7KA 3GU9A 1T8XA 4YVVA 1DWGM 1WV2A 1VIZA 1OD0A 2Q3RA 4WY0F 1FH8A 2WHMA 2ZZ1A 1TMQA 5AC5A 4PBFA 4PFMA 2IQDA 4GZEA 4HYWA 2HXTA 2DVUA 4LYKA 4EKJA 2V5BA 4BI7A 1V3KA 2QMJA 2NQ9A 4K7YA 3ARTA 1GOIA 1ODZA 3P0WA 4CD8A 4AZ6A 1K8XA 1NVMA 3NXFA 1VP5A 3U48A 3IIPA 3SQMA 2WYSA 1EIXA 4TUFA 3NL6A 1F4AA 4D2JA 3L4XA 2OTDA 4MNLA 3MA8A 1G4TA 2WLYA 3OHIA 3E49A 1NJJA 4PL1A 1XSJA 3GDBA 1H7OA 1WXZA 4NZJA 4ZXOA 1Y8BA 3AHZA 4QE4A 4M82A 1UH4A 4M6VA 5ABHA 2OZ3A 1A50A 2DT2A 5FJTA 5M03A 2AMGA 2PTWA 1SW0A 4YVPA 3S42A 1DJHA 4AIUA 2O9RA 2V6AA 3P0XA 3RF9A 3CUHA 2F2HA 1XIBA 1MW2A 1IT8A 4GC3A 1X1OA 4P7OA 3K30A 3O2LA 2QUNA 5H6HA 3BTNA 3VIGA 3AU6A 2G41A 4FF5A 3HV9A 2PWUA 3W6YA 1ML1A 5KETA 3W7QA 1VFLA 2O9OA 4RXGA 3M0XA 4EPBC 2FZDA 3S2NA 1A3XA 3K1DA 2A3AA 5D2TA 3S2CA 3R11A 2NX9A 2DSKA 4HIBA 1BRLA 2Y62A 3TSBA 5AB3A 2OEKA 4JTJA 2GGGA 3UZWA 3WFAA 1LL7A 2QDEA 3LY0A 1KGWA 1TWIA 2VZVA 3L9CA 3I4KA 4C1NB 3GNRA 1MQQA 3Q67A 3P8JA 3NJ3A 1K7XA 3R4IA 3AS1A 4ZO8A 3DYPA 2RUSA 5CH9A 2Z00A 2FZ8A 1G01A 3OZMA 5HMEA 5F2GA 4TR9A 1CXFA 4BEUA 3LHUA 3TE9A 4IP4A 1FXPA 4XIAA 4Q4KA 4ADSA 1PTDA 3VIJA 2C0AA 3L4YA 3LPOA 2NV2A 1F5ZA 3AIRA 1SMAA 3KDOA 2VOMA 3OZOA 1G7UA 3W1NA 1OGSA 3CYJA 4DVOA 1OFDA 3VFCA 3UNDA 2BHZA 2FZ9A 1JAKA 1I0DA 2DW6A 4XVEA 3S5YA 3NVDA 2Y5JA 3VNJA 2CWNA 4D1IA 2V5DA 3TP4A 5BW6A 3L7RA 2DT0A 5AECA 1SR0A 4D6HA 3KDNA 1IEQA 1ISWA 1R2TA 3LEPA 3PN8A 1XC4A 1GCYA 1Z42A 3G1XA 3KLLA 1ISZA 3GQYA 3V36A 4ZOAA 3PZIA 1UQZA 4DJDC 3P6LA 3ZXWA 1R46A 2D0FA 3H26A 5H8UA 1V5XA 2R1NA 3A4AA 3UT0A 4US6A 1XP3A 1VENA 1JYVA 4KIEA 2RKXA 5LIYX 4NNBA 4ECLA 4PODA 4J3VA 3QMRA 3R8HA 1V03A 2PS2A 4FO4A 1RJPA 2PDGA 3OPSA 4RDVA 1XICA 4DO7A 2Y7FA 2EAWA 3QH2A 5FJRA 4R33A 1XBYA 2JEQA 1ZCCA 2PDYA 1EQPA 2VO5A 1XW8A 2VHLA 1H62A 3BG9A 3L66A 4BZYA 4AZIA 2J8TA 2CC0A 4O15A 1EGZA 1O95A 1XYLA 1ME9A 4UTWC 5CSYA 3UXIA 2XN2A 3LGGA 3WK3A 5MF5A 1R9ZA 4DYEA 3DFYA 2W5FA 2Z4GA 2PRLA 1L6GA 3VNLA 1Q2RA 1QNRA 3HPAA 4FR1A 1TV8A 2VGGA 2Y2WA 1HKMA 1E0TA 3CGTA 4IQEA 3HGRA 3HOJA 4D6DA 1JYWA 2XZ7A 1UD5A 4PBEA 2HS6A 3MTWA 4HNCA 3T1GA 1UJQA 1V6TA 2E4TA 3LRKA 3MUAA 4CVUA 4Q4OA 4UMAA 2PP1A 3R8GA 3GB6A 1RK5A 1Q6FA 4ZR8A 2FZNA 4ZTYA 1HXJA 2Y0FA 3L4ZA 4AEFA 1ISYA 1RA0A 5G2IA 3BLOA 3UPWA 3NQDA 4J1OA 4Z42C 2ASHA 1QO5A 2ONEA 1VKFA 3JU2A 4ICCX 3IUIA 4I6KA 3M47A 3WK0A 1T96A 1IR2A 1S2CA 2QJGA 3WZ0E 1TMLA 3FGCB 3KWXA 1Q65A 1IZCA 3N6JA 3LQGA 1R86A 1BWLA 2PTYA 1EDGA 1K8CA 3EPNA 3GXDA 5EMJA 3N29A 1Z9AA 3VMOA 1E0VA 3BAJA 2WANA 4CU7A 1QRQA 1LQ0A 1J18A 2R94A 1W8GA 3KWSA 4ZCWA 2V81A 4O10A 1OC6A 2OVLA 2RH9A 4IXXA 4POCA 5C9ZA 3B3DA 3EDJA 4RE2A 1MRQA 1N2VA 2B7NA 1JYNA 3KRSA 3PK7A 2PDQA 3AZTA 1PZ0A 1QNVA 3T55A 2B7PA 1J5SA 4Z0JA 1G4SA 1JZ4A 4LUSB 4A8NA 4UTTA 5C8BB 1TV5A 3FFSA 3NQAA 1VH7A 3UWWA 4IWWA 2V69A 4O1FA 3THUA 2YDSA 3RX3A 1VEPA 3L12A 4GG9A 4ZZ9A 3S2MA 1C8XA 1L9WA 2GVEA 3AIWA 1PKYA 3AYTA 4OOZA 2QS8A 2OU4A 4QLJA 1KR1A 2BY3A 2R91A 2VRJA 3DHFA 3VILA 4FS9A 3AUJA 3CWNA 4C7DA 4AZGA 4IPIA 1KKRA 3MYPA 2INFA 3BG3A 1ZJBA 1ZB5A 4JTRA 4FXSA 3PG9A 1Z41A 2R8WA 3WFZA 1QDSA 4CCEA 4XZNX 4JHMA 4DXKA 5M3WA 1YLVA 2D1ZA 5M1TA 5J04A 2O0TA 2ZRVA 3M46A 4FX6M 4HU8A 4GBDA 2ZC1A 3PTQA 2C19A 3F2DA 3GW3A 4GXWA 3ZFHA 2TSYA 5AHMA 3CUJA 3SQSA 2YA0A 3PTDA 4EF8A 3NPWA 1QXLA 2YR1A 2ODOA 3ZWTA 1E4NA 3QV7A 3WG6A 1GQJA 3T44A 1SW3A 2TAAA 3BGJA 2CBUA 3T0TA 1QVBA 3TSDA 2Z6JA 7REQA 1XUUA 1S2TA 1DJNA 1VRDA 3SY1A 4HMDA 3R58A 3P8IA 3T2OA 3QBUA 1REQB 3V5CA 3BARA 3TEVA 4M1RA 4AG0A 1S5TA 3N1AA 2X2YA 4J3WA 4E5TA 3TWAA 4HYVA 1ZQ5A 4Z2KA 1Z6KA 2ZCGA 3HQ1A 4H4IA 3W7LA 3OODA 1HGWA 5I79A 1RQHA 4JIQA 2G4JA 3KBWA 5DRCA 2YKKA 1CWYA 1VJZA 3MS8A 4TU1A 1Q8AA 2PGFA 3WQ4A 1OQFA 3HPSA 2ADAA 3QC0A 1OX6A 2YCLA 2YXXA 3TQVA 2J78A 4IT1A 4QG9A 4S23A 5JVLA 4D6IA 3C5QA 3N4EA 3AQUA 4IP5A 5K3VA 1L6WA 4RLIA 1L6SA 3DECA 2FKPA 5LNRA 2GVYA 2Z0IA 5E0FA 1A0EA 1Q45A 5AYXA 1YNPA 1W5QA 2Z1BA 3VOHA 3W2KA 2VEFA 3AMKA 4JN8A 3GBDA 5JIWA 5JXQA 4WSJA 2FPVA 1X8FA 4AH7A 2PODA 5I3DA 1Q4NX 2ZA2A 3L68A 2P76A 4JTSA 3SCVA 2QF7A 1KTNA 3IV3A 1OSEA 1LOQA 4NHVA 4AVNA 1PDYA 1XLMA 1M7OA 2XDFA 3EYPA 2A6LA 2X1UA 2FB2A 3CBWA 2QV4A 1UWTA 4JTDA 2GQ8A 2BASA 5A94A 5JH1A 1WOBA 2R14A 4ORMA 3EWWA 1V4YA 3AO0A 4NZ1A 3RGTA 3O16A 4GYKA 5AC7A 3URNA 1QT1A 1H1YA 2I56A 2FHCA 1CGXA 6REQA 2GJRA 3N2TA 2CZEA 1MVYA 4N6EA 2ZUVA 5LNWA 3DFQA 4GACA 2HV5A 3GFYA 2DZUA 1WDPA 2PC8A 1XH2A 3UG5A 3IACA 3PULA 3UESA 2E09A 1W9PA 4Q7IA 3ARRA 3ZR6A 3LV6A 3TYUA 3MWAA 3UVIA 4LUSA 3URBA 1IQ8A 2D23A 1E6RA 1NP2A 3OBEA 2FPTA 4IIEA 1H7PA 3YPIA 5TAOA 4AWEA 3ABRA 5FKYA 4JS3A 4GCXA 4DXXA 1DL3A 3G22A 4WEVX 4WDXA 1SJDA 4EAMA 4B92A 1H1NA 1P7TB 2EKCA 4BQ5A 4MOZA 4G2DA 2E5CA 3NDOA 4FP1A 1X7FA 4WIWA 4ONVA 1QU4A 2VMFA 3MMUA 1FDYA 4O0ZA 3SAZA 5FSEC 3AIEA 1M5WA 1P0NA 4GISA 3MCOA 3B8WA 5C5YA 1H2JA 3UG4A 2Y5EA 2CLKA 1WDSA 4LGXA 2H8XA 3BK0A 2IKIA 4KGLA 4IIHA 3KBNA 2Z1SA 1E3ZA 4CNPA 2YPIA 4LS2A 3UWYA 1BFNA 4HSOA 1H61A 4P7QA 2D2OA 3VNYA 1GVEA 2RJGA 5DT7A 3HGJA 1Q63A 4MGGA 4E4PA 1H63A 1TWZA 2HE8A 1EPXA 2Y70A 1EC7A 3C4UA 4V27A 3THAA 1TPEA 2OYLA 4W8AA 1UJPA 1UPMB 2W3ZA 4P2VA 3R5EA 3EWBX 4OJYA 1QI2A 3HU7A 1DTUA 2B31A 4FNTA 3C6CA 2YB4A 3CPUA 1HL2A 1WO2A 3CZKA 3ARXA 2FZMA 1R3VA 2R6OA 3TVAA 4ZL1A 3FVMA 4GUJA 3CQHA 2NV9A 4PSPA 3GXTA 3W84A 4D71A 3UR7A 3I3BA 1WDQA 3WF2A 1A5SA 4MIMA 3CJPA 1EGVA 1FDZA 5HDRA 2QJNA 4XWUA 2V82A 1AQ0A 2XIMA 2UY3A 4W7WA 1XSIA 3HTWA 5E0CA 3EA1A 1YPIA 2I5IA 1P0EA 2BGNE 4TMCA 1UBSA 5I24A 1W0MA 2ZA3A 3BXWA 3EOOA 2IKJA 4BF9A 4JIIX 2Y88A 2ZZ3A 2ZBTA 2WAGA 5EFDA 3RPDA 3UGRA 8CGTA 3A22A 2E5BA 2BXZA 3VI2A 3VD7A 4JDBA 2PU1A 4HA1A 3M16A 4ACZA 5CC7A 2WSRA 3SRDA 2HRWA 4N4PA 1H41A 3M64A 2UY4A 3OHMB 4ERAA 2QGHA 3GXNA 3W81A 1K03A 4W86A 5EA9A 4MYXA 3WLQA 3UWZA 3IIZA 1XXXA 3GNNA 3PWIA 4XD6A 3AS2A 3URQA 1XDJA 1A5OC 3QSRA 4LH8A 4L1GA 2F8QA 4XSLA 2VURA 2IPWA 2TPSA 4H1ZA 1JD9A 5CPTA 4CQ8A 1AJZA 4MLJA 1OM0A 1TPDA 3O0FA 1EHAA 1I2QA 2VEIA 3N2MA 1LROA 3WBWA 2VUNA 2FQIA 1GW9A 4FSAA 3RAOA 1G0CA 3QHMA 3RPTA 2CBIA 1XC6A 4HOXA 3KRZA 3LENA 4DELA 4H8VA 3SY8A 2D22A 4KEMA 4O8AA 3LRMA 4RUBA 1FH7A 1ZHAA 3PR2A 3WQCA 2CCRA 2J4GA 1OJXA 4LFYA 1XIFA 4R7JA 4TMBA 5IFTA 2J7DA 3KCOA 3W53A 2Z25A 1W1PA 3BGGA 3BQ6A 2XVGA 4HNNA 5I07A 2VC7A 3M7SA 3SGGA 5C9RA 1ONXA 2BTMA 3LTYA 4K1WA 5DMNA 1UYQA 3THDA 3SADA 3U7BA 1WBJA 4I9TA 2BLEA 3AXKA 4WKHA 1QTWA 3WBXA 4WXZA 4WDWA 2AGKA 1VJIA 2G97A 2V5KA 3SCRA 1R3TA 4G56A 4BQ4A 1ME8A 2NLIA 3BQ5A 4HB7A 5D4YA 1LP6A 5H91A 4HK6A 1HJVA 1E9IA 1XKYA 3S1XA 3SW6A 4C6MA 3NQ8A 5C55A 2YOCA 4JYFA 4PCSA 5IHSA 3N4AA 2WNNA 3W7DA 3NSNA 3PY2A 3SR7A 4C91A 1J01A 3D5HA 1F76A 2J8FA 1XGEA 2QPSA 4F79A 3VOJA 3LBMA 3LZ3A 3ZT5A 4N6FA 4GINA 4PYSA 1Q6LA 4YTSA 3TA9A 1MDRA 2G50A 3M5XA 3BJTA 3W1PA 1U22A 4AY7A 3NZGA 5XINA 2ZYFA 1KCXA 1GEQA 5A6SA 1UG6A 1OT1A 1S1PA 1YE4A 5GJMA 1BGGA 4XIMA 1HJSA 3MB9A 1EL3A 1DJGA 2DQWA 2QGYA 3B0XA 1GEHA 1P0DA 1FKWA 3UY8A 1B9BA 4Y9PA 2ZRUA 1RUSA 3O3RA 3CIXA 3VGGA 1OX5A 3RIKA 4LF2A 2BVWA 2D2HA 3ATZA 4IUOA 1F3TA 1N55A 1VFTA 1RVGA 3GYEA 4H9TA 1BVZA 1XIHA 5T26A 4MVAA 4E2BA 1E6NA 1TTQA 2NWRA 1IIHA 1UD6A 2FYMA 1J6OA 3OTRA 1VD6A 4FB7A 3NEHA 1AL7A 4UNLA 5A6BD 1F3XA 4A6GA 4OV4A 1DIDA 4QEHA 5BXSA 2DZXA 2QDGA 4MZ8A 3UJRA 4EACA 5CXPA 4LAMA 3M44A 1B4KA 4NILA 1W9UA 4HU0A 5AHNA 1QI0A 1R9XA 3VD3A 2G3IA 3P7YA 3LLDA 3AZRA 1W1B1 2AKZA 2OG9A 2YCLB 3WBYA 3Q58A 3N15A 4QSFA 2WZIA 4UMBA 3T42A 1XBXA 4QE1A 4AX6A 4HJFA 4UTHA 3R0KA 3QXBA 2CBVA 1W8SA 2NXHA 4UZSA 2E8YA 4DZIA 3EAUA 4U2ZA 5CGMA 1GKQA 1TMHA 5BRQA 1YX1A 4PTXA 3OEXA 2XFFA 4DI8A 1VAHA 2W4XA 3CUIA 2YBUA 1ELSA 1EWEA 3UYCA 2YL5A 1H50A 2BS9A 4LEQA 2J13A 2NVCA 4B9ZA 4ZXLA 1C91A 5DBTA 4TOQA 1MW1A 2VEMA 3KOWA 1SGJA 1WX0A 3VDCA 1RD5A 3UZXA 2V0TA 3PC0A 4AZCB 3ARZA 4AC1X 2A21A 4DJDA 1C8VA 5G2WA 1VFFA 4N9DA 3IVUA 1TUXA 5AYBA 3W2JA 4B5SA 1AZ2A 2GQ9A 4F0RA 2E77A 3DEQA 1VFSA 4I3GA 2OODA 1BG4A 4C6PA 4YL2A 1TO3A 2XWEA 5FEPA 5LA0A 1LG1A 1UWUA 2ZOXA 1EXBA 1ITCA 1I9CB 4GC4A 4IM4A 4MJ2A 2PWDA 2X1RA 4Q4PA 4M80A 1V6UA 4HTYA 4HU4A 1HP4A 2GUYA 6REQB 3TH6A 3VIIA 4U3AA 3R79A 2HROA 1FWHC 1DYSA 1UR9A 2ZZ5A 3I7QA 3MJMA 3VA8A 1W5PA 3LCIA 5HMSA 2P8BA 1TTPA 3S6TA 1ZU8A 2C1HA 4G7FA 3URAA 4DXVA 2QVHA 2PF0A 4JQ1A 2ZRXA 3A3XA 4QCEA 2DP3A 4N02A 3TJ4A 5DN1A 3SZ8A 2OZTA 1RJQA 1ADOA 3FYOA 3AMDA 3FYYA 5G1MA 3T7VA 3IIVA 3H54A 1HL9A 2F9RA 4RDWA 3EWXA 2QCLA 4H7ZA 2WSPA 3M0LA 1TG7A 2VX7A 3WQFA 3PZQA 2DVTA 3MSGA 1JI2A 4X2RA 3C3UA 3W1LA 5I09A 2NLYA 4GY7A 3BZJA 3S1GA 3IGHX 1ZBWA 3SM0A 4YTUA 2ANUA 3MI2A 4Q8TA 4ROQA 2H9AB 2A5HA 4YHGA 1QNPA 1ICQA 3I6TA 4AEEA 3SRHA 3G2GA 5H8PA 1JF5A 2WV8A 2VELA 2WVSA 3DKJA 3T2PA 3ME3A 2HK0A 3LUTA 3FK4A 4C6NA 1CLXA 3BAYA 5FOOA 4XTDA 3EOUA 2A7PA 2BG5A 3TCEA 1W3KA 3EKGA 1ZJIA 3V16A 1XDLA 3T08A 3ISIX 3U57A 2XN0A 2DZAA 4HMNA 4DWSD 4YHEA 3C0JA 3BOXA 4AMCA 1Q4WA 1I6NA 1HKKA 1SW7A 3MZ2A 4F2TA 2QJMA 1CXLA 2AQWA 2W79A 3JZUA 4HSNA 1H7WA 4TX9A 1JQXA 4L5ZA 1OINA 1AJ0A 2A3CA 3LD5A 1BRLB 4B16A 4X0NA 3I68A 2GOUA 2AL1A 2YDQA 3LX9A 1CTNA 3OQ8A 3EPMA 1TTJA 2FJKA 3W7MA 4X9YA 3W76A 1Y7VA 1Q6CA 2NQHA 3TYBA 3O8AA 1W1VA 1ZALA 4AXNA 5CSSA 3AHXA 3EKLA 1VS1A 1O66A 3KVMA 1PB0A 4XK2A 1E1CA 1OX4A 1YIXA 2AAMA 5ABGA 2YCIX 3MUZ1 3IV8A 4TVDA 2J7EA 1H51A 3CZLA 1PV8A 2C13A 3WH8A 4TXEA 3C0QA 3B8SA 1OFQA 3T05A 4JHOA 1V7AA 1QUMA 1J4EA 2X09A 3SUSA 2YL9A 3NQBA 4NNAA 4XAFA 4GE8A 1KM0A 3CK5A 4I8DA 1V0NA 4WSHA 2PDIA 4V15A 4GFIA 5DLCA 3GH7A 4WY0B 3LCWA 1K9FA 4ACYA 1TV3A 3PUDA 1XD1A 5ABFA 1FWWA 1AMKA 3RUBL 1K6WA 1LOSA 3QJAA 2ZX6A 2QJJA 3F4VA 4Q8UA 1J96A 1M7PA 2NVDA 3FVDA 1IF2A 4I9AA 2RAGA 2Y24A 3IGUA 3WNOA 3OYZA 5HBFA 3BJSA 2CLHA 2XHYA 3MZNA 3TNBA 4C6EA 5CSUA 4US5D 4X3ZA 2Z1VA 4C1LA 1YNQA 3M0HA 3CUXA 3S6DA 5HNTA 3FA5A 2QCFA 3AOFA 2XIIA 3PZGA 3O7UA 1F6PA 2VRKA 4CCCA 4Y96A 1HUVA 3KL0A 4US5A 4CN1A 3PBMA 4FA3A 2VCBA 1OCJA 1V77A 2PD5A 1UASA 5A2BA 3RJYA 2MUCA 4N9BA 2Z1KA 4PUUA 1IT7A 1ZSXA 2EJ1A 1E4IA 2ZUSA 1C7SA 1R6WA 4F3HA 3E0LA 5HR7A 2WVUA 4GIAA 5A1AA 1CGWA 1A5BA 4C6KA 4O0KA 2YL6A 1CXKA 1TA3A 4GQQA 5F4WA 1VC4A 1X38A 3P74A 4BHYA 4LEFA 2Z2BA 1ZZMA 3PVFA 1L6YA 2D3LA 1Q6OA 5HANA 3U4AA 3AJXA 5FD0A 1UOKA 1M41A 1TV2A 1MFVA 3UWUA 4Q6JA 2Z2AA 3DN5A 1GJPA 3GZ3A 3CXOA 1ZJHA 1UZ4A 1UWIA 2BX7A 3TONA 4GI4A 1QBAA 3I3EA 2VEPA 1KBKA 3W0KA 4N9CA 1R87A 3KZPA 3VZZA 3VNDA 1CGTA 5FEZA 4H9YA 3TAKA 2HEJA 3ABSA 3HZ3A 4O11A 3V0SA 7TIMA 3TC3A 1IYXA 3GO2A 3KP1A 2VFGA 5REQB 4E2VA 2CZFA 3UXAA 3W72A 3RO6A 4C1KA 4I5RA 4DUWA 3SCSA 5D30A 5HNRA 1X96A 3KHDA 4JIPA 4EXBA 1QHPA 1U5HA 4UQBA 2O4MA 2C3ZA 2DVXA 4I9JA 3MJYA 3EOSA 1MEIA 3O63A 3UCQA 4WDUA 1US0A 3LCHA 4JTCA 4QGCA 2OSXA 2GWNA 3BW2A 3HQOA 3QOMA 3SUVA 1MEWA 3KTSA 2W0UA 3HIJA 2AGTA 4MWAE 3V1PA 4C6DA 3NURA 1XLIA 2PWVA 1U5VA 2DSWA 3G1VA 3O0KA 1A4MA 1ONRA 5AYZA 1XDMA 4EOUA 2OELA 1JXJA 1E0UA 3PJXA 1J0JA 1FOBA 1VQTA 1EFZA 1F6YA 2WKJA 3WH7A 1JZ5A 2C1IA 1IEWA 1X1ZA 2VR2A 5D04C 3TLQA 2D2JA 5FF7A 2O4QA 5C71A 2XIOA 3SBFA 4EK7A 4PUNA 2ZRWA 4RZ6A 1CGUA 3MANA 4P8XA 2EEXA 4Z08A 1QASA 4F4RA 2V63A 3VGDA 2Y4SA 4QNEA 1K70A 5GJNA 4IHCA 3HG3A 3L21A 2VR4A 1OYBA 5BRBA 3FAWA 3AYRA 3WENA 3OJGA 2CNCA 2DUAA 4ZQMA 2O56A 3OIHA 4FPSA 4AB4A 1G69A 2ZXDA 4S3FA 3G1SA 3VINA 1PHWA 4KEZA 3QV6A 2PDJA 3H2NA 3EMQA 1XCWA 1X6NA 2VDGA 2VNCA 2Z1XA 4LPCA 4CLMA 1W9XA 1W3LA 3UJSA 4D9PA 1XYCA 3AMLA 3QMTA 4NQ1A 3N9KA 3L5AA 3GRIA 2V2CA 1GZGA 4JQ4A 3SCPA 2Z2UA 3WLSA 2OFJA 3FKRA 4U3CA 2PURA 1LBLA 4AYGA 4MY1A 2DZBA 1A0CA 4ZOCA 1W2VA 3VD4A 5U4NA 3DKLA 1BXNA 3WNMA 4I7WA 1HO1A 4C5YA 2FH6A 8A3HA 3EA2A 4S39A 5D05A 1TPH1 4Y8FA 2OQYA 4GZ7A 4B91A 4DRSA 2FHBA 2PTDA 4J3XA 3P3BA 4YYFA 3F5KA 3ALFA 6A3HA 3O06A 4ZB5A 2HK1A 3IJ8A 1R85A 2YA1A 1XQKA 3W29A 3AALA 4W8LA 3CV7A 4L4MA 2PBGA 4WX2A 3DESA 2WO5A 3FLUA 3W2NA 1ZP3A 2I5GA 4BQ2A 4NJIA 2GJPA 1JGMA 5TNVA 3GUGA 3TFCA 1FBAA 2Y1HA 1PCWA 4KCVA 1XBVA 3B06A 3BCFA 3W7PA 5BXPA 4J28A 4FXRA 1GHSA 4GGHA 3S46A 4E8CA 4YCOA 1ALDA 2VXNA 3PSVA 1OIMA 5AZ1A 1FWBC 1GJWA 2BY0A 3JVAA 1AH0A 3VCRA 1AW5A 2YL8A 3CV1A 1TZ9A 1EF2A 2X0YA 1WQ5A 1PCKA 3RO8A 5A2CA 1YMYA 4P8WA 4Z1CA 2ZXQA 3N2CA 4AZCA 1E9YB 1F3WA 1S2WA 3TYZA 3VU2A 2DPEA 3LHTA 1UR0A 4HNLA 3GE7A 4LC8A 1XV8A 1LRNA 3Q94A 2R1LA 4BEQA 3AS0A 4H6RA 2WCGA 1FCBA 3LXCA 1R7OA 1LRQA 3TQKA 4LUJA 4PMRA 3AYVA 1EJWC 2ICSA 2WMJA 1KWKA 4IPLA 3BCJA 1DXFA 3E6EA 4MAVA 1IEIA 4FOUA 3MU7A 2XVKA 2P5NA 1E6ZA 3XIMA 1HGYA 3FEQA 3ECQA 1CIUA 3OYXA 4C90A 4M3PA 2ABAA 4JYDA 1DPMA 4KRTA 4NJJA 3O6AA 4WKAA 2JKAA 3ARSA 4U4MA 3TROA 4J27A 1BSLA 3AHYA 3H4XA 1G94A 4IFKA 2F7FA 2E9LA 5H2ZA 3F2CA 3BLIA 3H2OA 1OG6A 3UNTA 2IMRA 2OX1A 5AZ0A 1GOMA 1I2PA 1IGWA 5B7YA 2XH0A 2DFAA 4R7WA 2D0HA 3GXFA 3UBPC 1VYRA 1LL6A 1R9YA 3S9ZA 2QMKA 2IQ0A 1KXVA 4YTTA 3EX3A 1G5AA 3WNLA 2DIKA 2FHFA 1SSGA 4C7GA 1EBHA 2PE4A 1KQYA 1UP0A 1MXDA 4WLCA 1XIDA 1AQFA 1CGYA 3SY5A 1RALA 4IGMA 4AQLA 4IFOA 5BMXA 3VX1A 4D6JA 3BPWA 1ZNNA 1AD1A 4K8GA 3ABZA 3DDMA 5CCZA 3OIXA 4IPNB 4FNQA 2J66A 5HR6A 1UH3A 1O7AA 2PUZA 3PG8A 4UTKA 3DZ1A 1NOWA 3UZ5A 3W71A 3N73A 3E9AA 3PM6A 1KCLA 4B90A 5DEZA 4UNIA 1UZDA 1IGSA 1PSCA 1VCVA 4B3ZA 2JALA 1ENUA 2ACRA 3H7VA 4EIVA 3IANA 3DU0A 4Q8QA 2BOFX 4L6HA 3C2FA 1THFD 2FGLA 3L0KA 4MHBA 3STPA 4LVBA 4YTRA 4O57A 3NM3A 5CPQA 2WMIB 4WSKA 4XAPA 5DY3A 3LHVA 1CCWB 5F1VA 2NW0A 3S5SA 4XVDA 2GVLA 3S4TA 2WQPA 3V7PA 2HJPA 3N18A 3TJIA 1NF7A 1OADA 3L4TA 3PBGA 5C0QA 3BMVA 1OGBA 3GTNA 1O60A 1B3VA 2HSAA 3WF1A 4XZBA 4JXCA 4GPNA 4KWSA 2Z7GA 5CLTA 1XLBA 3G8EA 4Q22A 1EDTA 1UKTA 1R3WA 5BZAA 2QW5A 2UZ9A 3ZYZA 3L5LA 4P8VA 5DMYA 2FZBA 4M0XA 3R2GA 1FHVA 2DH2A 1F8MA 4Y2WA 1FQ0A 2ISVA 4J3TA 3ITLA 3B0PA 2PU0A 3LGDA 1VBJA 1JZ2A 4PCPA 2G95A 3RLVA 2G0WA 3ITXA 3QPEA 3MMDA 1P1XA 4NAEB 3NO1A 3LPGA 2YGYA 3BL3A 2FFCA 3N3MA 4IX0A 5XIMA 4WXYA 4WJ8A 5HWNA 1GKPA 4BWLA 2GVJA 3ZIZA 1VCGA 5FESA 1BD0A 1BF2A 2VFEA 4DIAA 4Q7BA 3D3FA 1VPYA 1S5MA 3DC8A 5DT5A 1Q7QA 2OSWA 4QFUA 2O9TA 3ES7A 1EUAA 1W9DM 4UOZA 2PF8A 5HNNA 2XFRA 3CT7A 4V33A 1F4HA 4H19A 1SJAA 1HX0A 4UB9A 1N8WA 1OFEA 1DP0A 4QG6A 4GYJA 1TVLA 2OGYA 2C16A 1ITQA 3N6HA 5FL0A 1KFBA 2NQ5A 1TA3B 3H2MA 5EY5A 4ZO9A 1ME7A 1PHQA 3NPUA 5SWUA 5FAJA 3BLKA 1W32A 3KL3A 3DYMA 1H09A 2HZGA 4PEKA 1XLCA 4C5ZA 5HUPA 3AU2A 3FSTA 3KBSA 2BMBA 1LOLA 4QE5A 5CLWA 4WKFA 4ZB2A 1VFHA 1JYXA 2X2GA 2OT1A 1P4CA 4V2XA 1I0BA 1QWGA 1Z69A 1LRTA 2QJHA 1ZY9A 1RK6A 3WNNA 5A3HA 1WYIA 3LSCA 1S39A 3FJLA 5AVNA 4H2CA 1LORA 1TE1A 3TC7A 3H6OA 2HBXA 3WJYA 4HKPA 1S2VA 4LRTA 3H70A 5EGRA 1E5JA 1F07A 4QJ1A 1AODA 2WHKA 3S2JA 2IXUA 1FHDA 2DSUA 1WDWA 2GDUA 1JEZA 5CC6A 3VD9A 5EMYA 3REQB 5KZMA 4DI9A 1XFBA 7PTDA 5AFDA 1Q85A 4M8UA 4FIRA 3QQ0A 4NVTA 1JRBA 1QW8A 2WJFA 3GIYA 3I65A 3RN6A 2TYSA 2Y8UA 1E3XA 1W54A 3QZEA 2E1DA 4HHPA 3V5OA 4NJKA 1BQGA 3C61A 4H7VA 4UWMA 3U2ZA 4JKLA 1K9TA 3WBAA 4E0CA 3GS6A 4O0QA 1I4NA 4R27A 3FNDA 1TX0A 2WSQA 4NJGA 3KBVA 3W24A 4AX7A 3T78A 5FCZA 1WZAA 1PO9A 2BDQA 2QVNA 3AIBA 1LQ2A 4RDZA 2PI6A 3OGRA 5KMYA 5ECVA 3UXDA 3WF4A 4X61A 2CLIA 4E2OA 4A2SA 1CECA 3UVAA 4RK8A 1XR2A 5A2AA 4NXSA 4HNOA 1H11A 3IIXA 7REQB 1V8EA 2HVNA 4WK9A 3BV7A 3LI0A 5KTLA 4Z2LA 3G6MA 4HMEA 4QG8A 2OWXA 4MZ1A 4PUMA 4A8IA 4KS0A 3BJFA 1TIWA 4Y9OA 1PX8A 2EG7A 4N4QA 4GVIA 4QCFA 1F61A 4I7UA 2BODX 4HN8A 1GZ1A 2OQLA 3UFYA 3GAKA 1V3HA 4M6PA 3PZNA 2RDXA 3R10A 5CC3A 3UR8A 3QY6A 2A3LA 4W5UA 5A8PA 1WUEA 1HIZA 1NDYA 3COTA 4GX9A 2V68A 1EOMA 4OV9A 4UQEA 1M04A 4GUGA 2QEZA 3W88A 4S3KA 1AL8A 4PUJA 5I23A 4BCEA 4XZHA 3GHUA 2REQB 2ATSA 1I1WA 3T6CA 4IF2A 4UNKA 1FHLA 2GUBA 2VC5A 3ZZ1A 4DBDA 3ZQ9A 1TPFA 1K4GA 3CL8A 3II1A 4PMXA 3P5YA 4RNJA 3BICA 3UWEA 2PDMA 3IWPA 1IXOA 1AUSL 3FY1A 1KXHA 4GMEA 3KUMA 1EC9A 8TIMA 2J6VA 4FLOA 4H3DA 1EA9C 1KKOA 4HCLA 3MDWA 4HA3A 1LWIA 4N0RA 3ABQA 5A8OA 1XRVA 5BCAA 4NIRA 1Z7AA 4QITA 1LWHA 1FWAC 1GT8A 1ZENA 4BI6A 5HPOA 3WMLA 3F5JA 1MW3A 3OVRA 3AS3A 2E25A 3BV4A 2WXDM 5LYRA 1BKSA 3MDUA 1I2RA 1SM9A 1TB3A 2VGBA 2X42A 4O14A 1FXQA 5HMDA 4ZE4A 7ODCA 2VP8A 4QEEA 1F6KA 3GX9A 4P61A 3QLLA 2BOEX 4UIOA 4B5VA 3GR8A 2CHRA 1A5NC 1R3YA 5DXYA 1JUKA 4B5NA 1JZ7A 4XO7A 3SQLA 3VIHA 3PZUA 3RLHA 5EFFA 3CMFA 3LSBA 3V5FA 2VCCA 2XM1A 1K77A 1IWPA 4BR1A 3ONCA 3TOYA 5CPMA 7CGTA 2E68A 1W3JA 3E0VA 5IRPA 4F2UA 4D72A 3WX7A 3OG3A 5HINA 4GLEA 4JEJA 3CHCA 5K4XA 1R47A 2PZNA 3NA8A 5M2FX 3MCNA 3E5BA 1XYMA 1GTHA 3THCA 1J2WA 4G5DA 4DF2A 3GHRA 1FWRA 3QQ1A 4DUOA 2BSLA 3NSXA 3L4UA 4MWAB 5E0KA 1FWCC 1XG4A 1WKYA 2QIIA 2VZTA 3C0SA 2KZHA 4YIWA 4XZWA 4PMVA 3W3OA 2E8ZA 3APYA 3R94A 3WY1A 1JXKA 4IICA 4A3HA 4JQ2A 3VIFA 4EWJA 4L6DA 3VKAA 1D7FA 3BW4A 3W01A 1SFSA 1ZLPA 3E2SA 3ARWA 2QT3A 3R7MA 4C60A 1JZ6A 2BHUA 3NWRA 4KMQA 3DYOA 3GVWA 2OX4A 3LMYA 1PX4A 4IIGA 4K8HA 4PTNA 2JEPA 3F4WA 1BWKA 1RY0A 2WM1A 3K13A 1K02A 3OLEA 4U2YA 1QW7A 5I3KA 3AROA 4UC5A 3GH5A 1ONWA 3TQPA 4Z2GA 2ZIDA 2FTPA 4MB4A 3WDJA 1RR2A 1IR1A 4GUIA 3QY7A 1CBGA 3Q37A 2X41A 4GI9A 4HZMA 2YJQA 3EB3A 1Z3NA 1B30A 4UTFA 3ES8A 5GVJA 2Q8LA 2QDDA 2DH3A 4JFTA 4G8TA 2J75A 3FGCA 4PL2A 4O54A 2DUXA 4K38A 2BXYA 2AL2A 9XIMA 3GBEA 2Q8ZA 3CIWA 1A0DA 4LXFA 1X97A 5HPCA 1AQHA 3RCMA 5I77A 2V3GA 1W9VA 4HPXA 1MQPA 5EMMA 3N12A 4A05A 1RD6A 2YXOA 1AW2A 4ERIA 1VYPX 3HGOA 3NGFA 4AMAA 2CEQA 3WLKX 4HP5A 1Q13A 1XL9A 2JE8A 4IGNA 5A6KA 4M81A 3HQPA 1KGUA 3VDBA 5DO8A 2WBKA 4JL1A 4MAZA 2ZDRA 2OLHA 2JGQA 1RH9A 1WKEA 4BQ3A 1TPB1 2ZRZA 1XIIA 1IXPA 3CWOX 3K4WA 4XG1A 4C65A 4MFDA 4DBSA 1XD0A 2PDCA 4CGTA 3L2MA 4L9ZA 2F2KA 4AF0A 2PFHA 4LVAA 1JPKA 3QC3A 4ZODA 3W86A 1EUNA 1LL4A 2LLEA 1JL8A 4HYRA 4LB4A 4JNZA 3S9IA 3ARYA 6PTDA 4Q8PA 1K6AA 3PFMA 1YDOA 2HWGA 5ABFB 4QDWA 2GSHA 1TRDA 1SO3A 4WUIA 4XZ9A 3OA5A 5AC6A 1E15A 4XD5A 4GKTA 2A85A 5FA5A 4OKDA 1SUXA 1MW0A 1WUFA 3GC5A 3HQNA 3D46A 1CXIA 1JPMA 4S3EA 1QHZA 1HVQA 3MP4A 4OZOA 4UOQA 3I3DA 1NAL1 1RP9A 4FXJA 4R7OA 1VEOA 3NAVA 5I3GA 2VWSA 1PTGA 1DQUA 4GO8A 1EF3A 2GGJA 3M5YA 3VKCA 1E1EA 3BMWA 3WMSA 4PMQA 3VNIA 2FJUB 3GNOA 5HATA 2EPHA 4Q32A 3N2XA 4AEOA 2V67A 1PZ1A 3L65A 3TUUA 1LT8A 3A5FA 1BLIA 3T2QA 1A53A 1OG0A 3UA4A 4A3RA 3WQVA 4DHGA 5MKGB 4Z2JA 1DEDA 4P7LA 6XIMA 1WB0A 2CZVA 4QS5A 1SMDA 3KAOA 1QNQA 1K3UA 5U7SA 1KM6A 2ZUWA 4M7TA 1KCKA 4QX4A 2FDSA 4YNGA 3WLOA 2EF9A 3GKAA 1RBOB 2HNEA 3EWUA 4N7QA 4PSRA 3EDEA 4MNKA 2QF8A 5JIPA 1K7FA 4B4HA 2ZTJA 3SFKA 3WLHA 3TR2A 4AWSA 5D09A 1TX2A 3TTSA 3LHYA 2W67A 1R3SA 2Z29A 4JX6A 4A35A 2PEVA 2WJEA 1SYTA 2OYMA 3IUDA 1GVYA 3NL3A 4ZENA 4JTKA 1E1FA 4JEQA 5ECUA 1NWSA 3M0ZA 3QR3A 2XGIA 3WN6A 3W38A 4URIA 2PRHA 2UV8G 4F9DA 5K9CA 5I2UA 1BKHA 4HHHA 1LUCB 1ITUA 3B8DA 1TPVA 2CZDA 4IX2A 4M56A 3S1VA 3WJSA 3OOQA 3R0DA 3RJXA 1US2A 2B81A 3VMPA 4UTLA 4AD5A 4I5XA 1R30A 5DF0A 2O7QA 4RL3A 1VLWA 3LCFA 3UETA 3CPGA 3V3WA 3V1HA 1TVPA 4IIFA 3RX2A 4CQ9A 4MFEA 2ISWA 2Q6ZA 4JCLA 2JIEA 4ATWA 1MXGA 2A2IA 1BVNP 3VIKA 1HG3A 3TNOA 2DORA 3CV6A 4FLQA 4V28A 1J0HA 4F0KA 3DFNA 4S3BA 1BYAA 1F3EA 4H04A 4LANA 5F7UA 1N7KA 2RDUA 1NIUA 1FP9A 3P14A 3H2AA 3MHFA 4LF1A 2ZUNA 2Q09A 4S3DA 1YKWA 2B7QA 4RZ5A 2GLKA 4YVXA 3WKZA 2WHJA 2EQDA 4Q4SA 5AN7A 4RNFA 3VXGA 3EEZA 5JMUA 5I00A 1BEUA 5K2ZA 1DJZA 3DG6A 3BSHA 1POJA 3TN6A 3AUOA 1GQKA 4H00A 3ICJA 1S1RA 5F1UA 1ECEA 2VENA 1KB3A 3A3WA 2QHAA 2NWSA 5FEXA 5ABTA 2O9PA 3C2VA 1XKJA 1UQYA 3T09A 4K68A 3WELA 3TJLA 1B3XA 2OKTA 3ZT6A 2IS7A 1KD0A 1YTDA 3VCNA 1LM1A 3WUGA 1GPFA 3VD5A 1CT5A 1JQVA 1XUZA 4X9SA 5IBXA 2VQUA 1AQMA 1HJQA 3B9EA 3GVQA 4DJFA 1TJ0A 5TIMA 4HVXA 2IXVA 4RJEA 1XPYA 3W1TA 1YBQA 2D0GA 2QDHA 2W66A 3C8NA 1LYXA 3TIMA 2ZC8A 1OGGA 2WMHA 3U2OA 4KGJA 5A6MA 5I5RA 1UKPA 2EHHA 2DSVA 3NEVA 3O9NA 3R6IA 4B3KA 1WXYA 1NFPA 4MKSA 4LAKA 2DZWA 1X6UA 3TU9A 1EB3A 1HKJA 4CQDA 4GYFA 3EWDA 5RUBA 5A6BA 5I3FA 3S9YA 2CYGA 2FFIA 4MY9A 4CN4A 3HM7A 3P93A 1MSSA 4Q7NA 3JS3A 2I9UA 1FCVA 3FKKA 5A5WA 4KFPA 5MKGA 4YS1A 3AXIA 5E93A 4QP0A 4IGSA 2DJLA 4AD0A 1AH4A 1PL9A 3QZAA 1BXCA 3MI6A 2WCAA 2OWCA 3CAVA 5IDZA 4H8HA 2VM8A 1DVJA 3AZSA 4G6CA 3MCMA 2I14A 2PWGA 2QCDA 3F4CA 3FV9A 4JTIA 5AHFA 2VZOA 1GG1A 1XJBA 3EX6A 3SURA 1OVDA 3M0VA 1ONEA 4NAFB 4GIEA 4D8ZA 3BLDA 4I90A 3K8LA 1D3HA 5BOFA 3NQEA 1P48A 2J25A 4AHPA 5CG0A 1PXGA 4OECA 2BFGA 3GG1A 1VIWA 3GYCA 4MJMA 1PYFA 3EXTA 5EKYA 1F8IA 3K4DA 2XVPA 2VWTA 4Z1BA 1GNXA 4MF4A 3PJWA 3M0JA 3MUCA 5M5DA 1DOSA 5G4WA 1E0XA 2OJPA 4D8LA 2FMNA 4LUYA 1YQ2A 5FF3A 1JPIA 3M43A 4HPNA 4L6OA 1LUCA 5E5CA 1GYMA 1UPPA 1WDDA 4ENLA 1WPCA 3MKCA 4ZE5A 2INZA 4L61A 4DO5A 1RCXB 1EJRC 3MUIA 1MWOA 3N13A 4ZQOA 1J9YA 1XIEA 3P84A 3RITA 4L64A 4AW7A 3NFUA 3F03K 3OLIA 4DPPA 3E96A 3JZEA 2V3DA 2C15A 1MI3A 4CNOA 2ZE0A 2F38A 1JFHA 1G9HA 1MNZA 4QS6A 4O53A 4UFJA 2OGJA 1XSKA 4M7SA 1TSIA 1RBLA 2CHOA 5FJPA 3CPRA 1G1YA 1EEPA 3SCTA 2EGZA 2WC3A 3PUGA 3DI1A 3NDZA 3P82A 2DIEA 3UPBA 1EWDA 1PZ2A 2D3NA 2XGBA 4NZ4A 1V08A 1PWMA 2OZ0A 1H0GA 3CEUA 2CW6A 2RHGA 2VR5A 5REQA 2UBPC 4IMDA 2PDBA 1CGVA 2QPUA 3CTTA 4LYRA 1CXEA 1V6YA 3UWQA 2GK1B 3EWCA 1YE6A 4UTIA 2VFIA 4W88A 4MDPA 3GM8A 3CZGA 3OBAA 3L2IA 1LBMA 2D2GA 3W1RA 5BU9A 3H24A 1C7TA 3PB0A 3WEZA 3VABA 3CUFA 3OZYA 1QNOA 1TR1A 4W8BA 4DAIA 3EB4A 1T41A 4U5KA 5A8NA 1XCXA 3N4FA 3O1NA 2PCEA 1PZ3A 4FZIA 4J40A 1EZWA 4JHZA 2PDWA 5KSWA 4Q4RA 1T7LA 1CLVA 3S3GA 2WZTA 1I45A 2J88A 3BAXA 2W63A 1XQLA 3RHGA 1UCWA 3EOLA 1QHOA 3BVJA 1XF0A 1K9DA 3RR1A 4XQ6A 4UCGA 1TVNA 3R13A 4E8DA 1VGAA 2EBNA 3AWOA 4PB4A 5CPNA 3QYSA 1POKA 1PX3A 1PTAA 3S0CA 3UXKA 2J7FA 1DE6A 3NQ7A 4L4PA 1E70M 3UY7A 4LUTB 2OZ8A 3KE0A 2NVAA 2HS8A 2YYUA 4TVCA 1RY8A 4LAOA 2FH8A 2GJNA 4HZ7A 2HDJA 1E73M 3O6DA 2FTYA 2ZADA 1AFSA 1Y5WA 2G8ZA 2QQ6A 2I7GA 1FP8A 2GDVA 3MKKA 4UR7A 4WF7A 1F74A 1YXDA 5I6SA 4TX8A 1OBAA 5T8GA 3UJ2A 3O6YX 2XG9A 1PUDA 3RNDA 5DFAA 1UZ1A 3R89A 4NI8A 3SECA 4EANA 4S2CA 2C1GA 3N9SA 4GQRA 1Q8JA 3ZVHB 2VI0A 3DHPA 2C0HA 4AHQA 2HNHA 4JN6A 5AOUA 1KRBC 3P80A 4DJED 4GUHA 3NYZA 3AWNA 1GOWA 4O17A 4MMWA 1DWIM 1AH3A 5IFPA 1Q7MA 4IQLA 4S3JA 2CLOA 4K3ZA 1NU5A 5LA2A 3GHTA 5A69A 2CESA 4UQAA 1WNOA 1PBGA 4ZFMA 4JZ5A 3ZR4A 1OFPA 4F2BA 3P2VA 3TYCA 1YDVA 1Y0EA 3RMJA 2A6NA 3VOFA 2WQDA 3LPFA 2CKSA 2DEPA 2QKFA 4HA0A 5EMUA 3C0LA 4N42A 2I5QA 1RBAA 5AHEA 5K7JA 1OYAA 4IP7A 2GGHA 3E0WA 1A5AA 4AXKA 2QLYA 3FDGA 3K4AA 1EJUC 4KWVA 1OK6A 3W7HA 1Z48A 2QCNA 3KVJA 1EXPA 3WNKA 5DCEA 2CIPA 1BYCA 2WMKA 4IJCA 5EB8A 4H01A 5AKQA 1UKOA 4R3UA 3W1AA 2VTFA 3GKFA 3C2RA 4A22A 2J7CA 1S2UA 3WK1A 1B57A 6ENLA 2HE5A 1YDNA 1UA7A 4FAMA 1V0LA 4JIEA 3WNPA 3W2UA 1O6IA 5LXEA 1FWSA 1T40A 3PUOA 1O4UA 4JYEA 2IPFA 2OSYA 1JVNA 3ERPA 1V51A 4OIFA 1JCXA 1DXEA 4X22A 5D9OA 5HQEA 1QI3A 1L8PA 3Q4DA 1AZ1A 3SN0A 4WGHA 3WLJA 1GVIA 5D2WA 3OVPA 4MSSA 4X60A 4GGBA 1PPIA 3GD6A 2QNEA 1E0WA 3FSUA 2PDNA 4XV0A 4PUKA 3VMNA 5E6ZA 3QW3A 2RJHA 3C8FA 1XLFA 1SR9A 1XIGA 2F84A 1XFCA 4DJEA 5CGQA 4NXKA 2X16A 3RRXA 3CIVA 3HPXA 3DIPA 2YCEA 3SIMA 2YCJA 4OT7A 3WQOA 3RFAA 1TPWA 1HP5A 2X0HA 3ZVIA 4BK9A 4CNNA 5E70A 3EWYA 3F1QA 1TCDA 3PANA 3SI9A 3RX4A 3H23A 1TV7A 3EMZA 2BBFA 3MT1A 1SO4A 1PKMA 4CU6A 3ORWA 3UJEA 1V79A 2RGMA 3VC5A 4HU3A 1MNSA 4J3UA 3IIOA 2ZVRA 3G1AA 1GZJA 2XSBA 3UG3A 4O16A 5BWAA 4YJ5A 2V5JA 1ISXA 3CHFA 3FJ4A 4GNVA 1TUFA 4LYPA 4MG4A 2OLAA 3G3DA 4MJZA 1XWYA 3CHEA 1WAWA 3EX2A 2W61A 3WLMA 3S1UA 1HQTA 2WJZA 3ANUA 5DELA 3H7UA 1Z44A 3SO7A 1W1ZA 1KFKA 1JG9A 2WK2A 3V35A 4AZ5A 8XIAA 4HPHA 1FWJC 3QVQA 4LBSA 1RJRA 3F7JA 4XD3A 2GGIA 1SSDA 5AC8A 3BDKA 3KCLA 3ZO9A 2G96A 3POHA 3BUVA 1YBQB 3LPPA 4NASA 9CGTA 2BV9A 2Q01A 4ZQNA 4PMYA 3EX1A 1ESWA 3MMWA 1ODUA 3LB0A 2MANA 1LBFA 1MRAA 5XIAA 1SZGA 2DV0A 5AYYA 3HPZA 3USZA 3FHQA 2WMIA 4HNUA 3TFXA 2VL4A 1EX5A 3BC9A 3SJNA 1ZGDA 3HN3A 1KR0A 3CLMA 1QJWA 1W3IA 4MB1A 5GNXA 2E5DA 3A64A 1TRIA 4D6FA 4ZVJA 1FDJA 1F73A 2ISSA 4O13A 4MWAC 2NT1A 3W00A 1RHCA 4S1FA 4JGDA 3ZLGA 4C6LA 3MMTA 1UZHA 3G8RA 4JTAA 3B9AA 3VUPA 4WJEA 2GSEA 3AFBA 3K1GA 2X30A 1RPXA 2WVTA 3JW7A 3E38A 3B9NA 4EF9A 2R1MA 4LAUA 3SUWA 5JQ9A 5D32A 2GJXA 1IXNA 5D2VA 1Q6DA 3M07A 2NSOA 2ZZ6A 3PUEA 1N8IA 1RLDA 3LMZA 1EP2A 2PLKA 2Y61A 4PRTA 1XLLA 2PGWA 1GORA 1E40A 2OB3A 1QK2A 3A4WA 1NOFA 3QGAC 5CG7A 4H41A 1OFRA 2E7FA 4DAFA 3AI0A 3W1UA 1FCQA 5HUOA 1E56A 2J7GA 3W37A 4ERGA 2W91A 2Q02A 1KGXA 3IK2A 1K7EA 4LWWA 3O15A 4C6IA 4H9MA 3GW0A 1QR7A 4FX7A 3TAOA 4NYUA 4FNUA 3VDAA 3DFSA 4GOAA 1GOOA 2NV1A 3BAIA 1C9DA 4NNCA 5CPSA 3ZSSA 1V02E 1CENA 5CZKA 3WQDA 1C9WA 3WH5A 1CPUA 1RPKA 2PCQA 1MEHA 3OO2A 2PDPA 3ITVA 5CZJA 2VX6A 3LBCA 5LSMA 1AMYA 4FF7A 3KBMA 4IMAA 1EH9A 4I7VA 5HULA 4CCZA 5D9MA 5A8QA 3ZOAA 2Y63A 4J3ZA 5KEZA 4PCNA 2OOFA 3L0GA 2E6FA 4LALA 4IJRA 4D6EA 4XKYB 3ID7A 4AIEA 3H22A 1FWNA 3OB8A 4JNYA 4P8UA 3W1MA 2WKGA 2VCAA 1QPQA 1PYMA 1FFRA 4LAZA 3VFLA 1C29A 5F2LA 4Z17A 1VZWA 3R1ZA 2XFYA 3RM4A 3ZJ6A 4UMCA 1GHRA 2ZZ2A 4MNJA 3R0UA 1OEPA 4D6CA 2PDXA 4FXFA 2VZSA 4RE0A 4ZTXA 1KWGA 4M6UA 2PA6A 1JNDA 2W27A 2P3EA 3PS7A 3IVSA 3BLPX 4DZHA 4XBJA 3AXMA 4RPQA 1RAKA 2GDQA 4A8LA 1ZL1A 1E6SM 1TZ7A 2ZX9A 2XH7A 2ZUMA 5C54A 5BNKA 1GYLA 3TOPA 5JBDA 4B5XA 3M7WA 3HG2A 4J35A 3LHWA 3TCSA 4Z0SA 2GQAA 2GGEA 1CXHA 4JFSA 5HAOA 1KLZA 2BY1A 1FTXA 1KXTA 1PS9A 1JD7A 1NWUA 1ADSA 3DUGA 3RR4A 1V0KA 4ZO7A 4KW2A 1BSIA 4C1NA 2DU2A 3OP2A 3UYIA 1SPQA 5D2YA 4J7RA 4MUZA 5HMFA 5BXRA 3RMEA 2P0IA 3WH6A 3TMLA 4NSBA 2VFFA 4G7EA 3FXYA 2E9MA 4PMOA 2H90A 4I5UA 4GZIA 2J7BA 3BANA 4GXPA 3SDOA 4L9YA 3FA3A 1A5CA 1KBLA 3HF3A 5BOOA 2J77A 5I03A 3LLFA 1TE6A 1NDWA 3PPHA 4Y90A 4EXAA 1A5MC 4LSBA 2IUZA 5LZLA 3KP0A 1EO7A 3NGJA 1IV8A 2FMOA 3CZJA 5D8ZA 3GR4A 5A6AA 5HWJA 1YXCA 3LDVA 4O1EA 2PP0A 4GABA 5FEWA 1P1MA 3G0UA 3QMSA 4JOMA 3LBOA 3QY8A 3EDDA 4IMEA 4L9XA 4DBEA 4IL2A 2EPKX 4GYPC 3KW3A 1T6MA 1JIBA 4E4FA 1X8CA 1ZJAA 5A95A 2WJDA 1JUEA 1KXQA 4LT9A 2Y7GA 4AZBA 5BROA 1JCNA 1U5JA 1LCOA 3ZS4A 3L5MA 1SVDA 2J47A 3NQ2A 1DJIA 3WYZA 4CQCA 2PC4A 4XAYA 5IBXC 3HBLA 3K2GA 2XVLA 2ZICA 3B0UX 2REQA 2Z7KA 3CQ0A 3I10A 1IXQA 1KNWA 3PHAA 1ZCOA 3BLLA 2PGEA 3NTYA 2XN1A 2XM2A 4DM1A 1KCZA 2INEA 1O5XA 1ZTVA 2EXOA 5LKYA 4O28A 1CI1A 2VZUA 4DZAA 3QTGA 4DBWA 1EYWA 3KOXA 4R53A 3FS2A 4C6FA 1FA2A 1IWAA 5IOBA 4Q4QA 3VDGA 4I6VA 1OB0A 1QO2A 3V75A 1XYAA 4ZQPA 1J11A 3GIPA 5CBBA 7TAAA 2CKRA 5FF4A 3QR0A 4WOQA 3PTKA 2DZSA 3CZEA 3H55A 2QCMA 3M41A 4PRWA 4J2MA 3NUKA 4L56A 3CASA 1NARA 1UR3M 2AQVA 5FF2A 3BLEA 5I02A 4XD4A 3TJXA 2BY2A 4GK8A 4H6EA 3AXHA 3GZAA 3MO7A 4KT2A 4EPKA 5G1YA 1W1YA 3SRFA 4S3CA 3CAKA 4QRNA 5EL1A 2PDHA 1Y5VA 2DZPA 4DZ5A 1SO5A 2XPKA 3B8UA 4HBKA 4F40A 3AIVA 3GHSA 2XU2A 5DCDA 1HN1A 3MO4A 1XLEA 3WDPP 3BZGA 1EJVC 3D6NA 1TFVA 4Z2HA 2BWGA 4MJ4A 4M19A 4MY8A 4KQNA 2CLFA 2YIHA 4E2DA 1FWFC 1WZLA 1N8FA 3AYSA 1D3GA 5DANA 1WOAA 5IHRA 3BW3A 5CEWA 1LLOA 1XIJA 4W93A 1AD4A 2OEJA 3F5LA 4H8NA 4KKXA 4MNMA 1LLZA 3S5OA 5LXXA 3BSMA 4FK9A 4LYQA 4MPQA 3GTFA 4QIUA 3TYAA 1Q6QA 1Y5XA 4GI8A 3NYDA 4P7RA 1KLYA 3DERA 4M51A 3ZLHA 1ZUAX 1JAEA 4DYKA 4TV5A 2H9AA 3EDFA 1HJUA 3A24A 3NR0A 3CHDA 2KX9A 1R0MA 4ROPA 3KBJA 4NL1A 2ZUTA 4HA4A 1J0KA 4F0LA 3ITCA 1BXBA 4CEXC 2Y8KA 4CQAA 3M0KA 4H6QA 4WCJA 1X1NA 1KM1A 2PWHA 1X6LA 3N19B 2YLLA 3GU2A 3PBYA 1Z32X 4UFLA 1BVWA 3W1QA 1E9ZB 1XLJA 1SQ7A 4B5WA 1R2RA 4HD5A 4F0SA 1EA0A 1NDZA 2ALDA 3W6LA 4ML4A 5M17A 3VZXA 3N04A 4JY8A 1NWRA 3W87A 3GTXA 3UWVA 2J9XA 1JI1A 3A21A 2XH2A 4UTUA 3QW4B 4W87A 4JY9A 2HXUA 1OZQA 2O7SA 1XRSA 3ABXA 1FKXA 1KFCA 1E43A 1U1JA 2ISDA 4L4LA 3QRHA 4OUIA 4WDTA 1E1CB 1VFMA 1EOKA 3VPLA 1I75A 3A13A 4LX4A 2VVSA 3NNTA 1XRFA 3ZMRA 1O5RA 2VEKA 3TK7A 4HK5A 3KOFA 3PSWA 3UP8A 2X1IA 4GJIA 3M0YA 2B0MA 3LXAA 5TQLA 3SUTA 1H3GA 1UA3A 3P81A 4CN6A 3V0TA 4Y7EA 3IGSA 3AAMA 4FHAA 4JBRA 5AC4A 3B97A 4UCFA 2IKGA 1EJSC 2XWDA 4RW5A 3WD2A 5BU6A 3CQJA 3EXRA 3P61A 2G5WA 2Y89A 5I0DA 1BWVA 4Q6XA 5C7HA 2CLMA 4OQVA 1ICPA 3VGHA 3WLIA 3DC0A 1FWGC 2YW3A 1VJSA 5H1WA 3ZM8A 4WQ6A 4J3SA 5G1TA 2IPJA 4O4VA 1LT7A 2A7NA 3GTHA 3PWAA 1B3ZA 3DGRA 3MQTA 3OVGA 1ZFJA 4GZJA 2RGLA 4LVGA 3GAYA 3CQIA 4IMFA 4JX5A 3BAWA 3VTRA 4A2RA 5ABEA 2BZNA 1K4HA 1IEXA 3R43A 4XKMA 3CO4A 3BO9A 5HJLA 2G3JA 1NF0A 4IMCA 2P8CA 3VIOA 3QEZA 1G4EA 4K39A 1UMYA 4JTFA 4DB7A 4FNSA 4PBGA 3KTXA 1UR1A 3EMCA 1UC4A 1DJXA 1N82A 3OQEA 1UMLA 2CFFA 1E6PA 4JNMA 4NRRA 3W70A 3NQ6A 1JULA 2GJXB 2VVNA 4GQGA 4JPGA 3NZPA 2E3ZA 2J9ZA 4H9XA 3WK2A 3GR7A 4LNYA 2VEGA 2YBVA 4OUEA 4KERA 3QPZA 5K4ZA 1C92A 1A5UA 3T8QA 2GL5A 2VQTA 1D8CA 4FI4A 2QUTA 2X8RA 4FLRA 1XS2A 3UXLA 1JFXA 4YWIA 3A23A 4PCTA 2ESCA 2BHYA 5HXMA 3E5PA 9RUBA 4GVFA 3RK8A 1L8NA 2A4AA 1HFBA 5JU6A 3LTPA 1XYZA 1IWBA 4IXHA 1DE5A 4LS0A 1KFJA 1KM5A 4W85A 1M01A 4IJBA 3WFLA 2OT0A 2ZWYA 3N3TA 4Q8MA 2NX3A 3FW6A 3KS6A 4DJFC 3HFYA 5A6JA 4HHLA 1UD2A 5C9WA 1OCBA 3STGA 3XISA 3E0IA 3E12A 3KTCA 4GKLA 2A3EA 4KRUA 1QAPA 1VBUA 4QM1A 2E0PA 1LZOA 3HG5A 4QBXA 3PPGA 1E4MM 1ZAIA 3FCPA 4HMCA 4BA0A 2VRQA 4PUEA 4N9EA 1W9BM 4QAIA 1PIFA 4WOZA 5T91A 3DBNA 4HSHA 3ATYA 8XIMA 1Z89A 4CU8A 4JFVA 2GSJA 4W7VA 4FOJA 5JUVA 1EJXC 3W7JA 3TR9A 1O68A 2CZ5A 3RG6A 1XI3A 5GNZA 3W25A 1IHIA 3NZRA 1W17A 3CU2A 2MNRA 3TN4A 3T0CA 3QF0A 5C9UA 3N6QA 1P6BA 5D9PA 3K8KA 4AZHA 3E02A 4LY4A 4W7UA 3LCLA 1QNSA 2HVOA 3MWCA 1OF6A 1BHGA 3B0VC 2XGZA 4KCUA 4UTTC 4C6CA 3V18A 2PMQA 3G1HA 1MZHA 3U5UA 4HN4A 5BOEA 7A3HA 2WBGA 1UOZA 1WZMA 2FGZA 1GYNA 1PWLA 1LLWA 2R24A 5HQLA 2YZRA 4XAGA 3OU8A 4S38A 4KWOA 1FCUA 1DBTA 1H49A 4B2DD 2Q3OA 3C56A 2PPGA 3OG2A 2WVVB 4OWGA 4XUGA 4W9TA 4LQ1A 5D38A 8RUCA 1KM4A 2OEMA 4Z1YA 4K6AA 3GLCA 3I7SA 4HNTA 3IRDA 1EZ2A 4DF1A 3T8LA 4REQB 1PJ9A 1XX1A 2VJXA 3T9PA 2WPGA 4LVFA 3RLGA 1DIEA 2R1KA 4IPPA 3K8MA 5D9NA 5C9XA 4DJDD 2ZX5A 2XH4A 3LM7A 1L6FA 3NPVA 4KH2A 4DWSC 1GOKA 4CVWA 3GXPA 3RYSA 1UROA 2BNJA 4WVXA 2XSAA 3VAVA 4A21A 4HOWA 1NH6A 4L4OA 3S6OA 2H6RA 2PP3A 1K8YA 1OY0A 1OYCA 4AU0A 3B40A 4QJ5B 1G67A 3M5ZA 4JTEA 1JCTA 3W4RA 4IQDA 3GG8A 1B31A 2G3MA 2QCGA 9XIAA 1GW1A 3RLUA 3I7RA 2CLLA 3F2BA 3OA3A 3OW1A 3QTPA 4PZVA 1GUVA 4W4QA 2RDWA 3JR2A 3IJLA 3TX9A 5J5RA 5FL1A 2CITA 5GJPA 1TPC1 4DLMA 4FX8A 3NIYA 1F2JA 3MVIA 3LZ5A 2WWCA 2ZX7A 4EVZA 3PZTA 3LV5A 3MV01 1IT0A 1F7BA 3PP7A 1OZMA 2WKLA 3CAQA 2VYOA 3WQ8A 3W1XA 2WM0A 3TN5A 1GVSA 3NSMA 4JR5A 4LY8A 2TRSA 1TKKA 2P53A 5FSDC 4NAFA 4KIRA 5E1QA 4A8RA 3S5NA 2YFNA 3VX0A 3JUGA 3U3HA 2HPIA 3M0MA 1T5AA 2P88A 3EB2A 4FIQA 4K8EA 1B2YA 3VGFA 3IAQA 1S5NA 3PZVA 4AVFA 2I17A 3RM9A 4PMJA 4TX6A 2V2DA 3VNMA 4ZEPA 2QZRA 3GFZA 3W7OA 3FDKA 4ZSUA 4HOZA 4E3TA 1HJWA 2ZTKA 5K9XA 3BMXA 2JF6A 1CLKA 3O6CA 4UFIA 2C91A 4QDMA 3I6EA 2Z24A 4JAWA 1QMLA 3AICA 2PRMA 3DENA 2TMDA 2ZZ4A 1GK8A 2E1WA 2WZHA 3H4WA 7XIMA 3ITGA 3IARA 1QI5A 1VBHA 3NQGA 1C90A 5AHIA 1I60A 1WKFA 1CW2A 3FX4A 1XIMA 4AY1A 1A3HA 4O4WA 1XISA 5CKSA 3OLDA 1H60A 1E4LA 1WA3A 4KETA 1LG2A 5BMWA 2F6KA 3ANVA 2L5HA 1FUYA 3W7EA 1VPQA 3WIJA 2CLPA 4CNUA 2BGQA 3NOEA 3MUXA 3GNXA 1TV4A 4TTGA 4S3GA 4MB3A 3HG4A 4OU1A 3QKEA 1UIOA 1AK5A 4IFRA 1EX1A 1P0BA 3STEA 3GY1A 1OC7A 3IEBA 5CBIA 2Q8XA 4LBRA 4AIBA 4HT3A 1WAUA 4NAEA 4GQ0A 2DIJA 3FA4A 4H6KA 3C3NA 1SU5A 2OPJA 6XIAA 1QBBA 2QAPA 3SIZA 1H7RA 4I9MA 3TZFA 3DHUA 2P50A 3PBWA 4UTWA 1SFLA 3NQVA 3PZMA 3WD1A 3MBDA 3WUEA 3VOIA 5CJMA 1U2YA 2A0NA 4RCXA 2WNWA 4BFAA 4RE4A 2NX1A 4MKVA 3WDQA 4UTMA 3GVGA 1L2UA 1AA1B 3LCXA 1LDCA 4U5IA 1ZS2A 4NZ3A 3B8TA 4F66A 4NZ5A 2I16A 3D47A 1P0KA 3FOKA 4QISA 6TAAA 2XUCA 2AL2B 4Y9AA 2HMCA 3CS2A 4ZOBA 1NWTA 3SUUA 3GFXA 3W85A 5GPRA 2WW5A 3CH9A 1MDLA 1UR2A 5T9BG 2C8NA 3G1YA 1NEYA 3A4JA 1JDAA 3PNUA 5J5DA 3KCJA 2PTXA 1LWJA 3U9IA 4LS1A 3WQWA 2P1FA 2EPOA 2V8ZA 3VIMA 1G4PA 5D33A 1HW6A 3SGUA 1ITXA 1TJRA 4HNVA 4FEZA 4PMUA 1JDEA 3IPWA 3C2OA 3CM4A 1NQKA 1PIGA 4A3YA 3GG7A 3NVTA 4P5UA 1GONA 4LC6A 1OFOA 1QOQA 4ICMA 5EYWA 3M4HA 1Q6EA 1P6WA 5LHEA 3R8RA 3K5XA 1HKVA 7ENLA 1RP8A 3LHZA 4C6BA 3LCGA 3RXZA 1PEZA 5G4HC 3MUY1 1DIOA 4H83A 1OABA 1R38A 4DLFA 1GPWA 4DPQA 2BVYA 2YA2A 5F2IA 1GKRA 3TTYA 4UR8A 4OBTA 1BF6A 4BJHA 5HK4A 2Y6ZA 2QIWA 2UWFA 3XINA 5J8LA 4XB3A 3CZ8A 1PVNA 3BGAA 4M6QA 2WB5A 3KHJA 5EMKA 4HCHA 1V7YA 3AC0A 3UZYA 5MHBA 3VK5A 1UUMA 1O12A 3QN3A 1UH2A 3HPFA 3PFRA 3G1RA 4TTUA 4RDYA 4Y9MA 1EIBA 4H8UA 1NM9A 2A79A 3S2LA 2ALRA 4ATDA 3VUSA 1NTHA 2C7FA 3F4NA 4ZB0A 3GDTA 3TTOA 4OVXA 2YZ5A 4PB5A 3PPCA 5IDIA 3N17A 1R5YA 2IKHA 1E5NA 1V02A 1Q2SA 2ZUUA 4O1DA 3QHOA 3H2EA 2HCVA 1OHLA 1IE7C 1EC8A 4IL0A 5AY7A 3W7IA 2W92A 1YRRA 1CEOA 3QYQA 3REQA 4G7EB 6CGTA 4PRRA 3ITTA 4XZMX 4O12A 5FJJA 1RSCA 3G5EA 4HCDA 4JDYA 4UQ9A 3BE7A 2POZA 5G4EA 4ORIA 3THQA 1KFEA 3VGBA 1AJ2A 4AIOA 2CLEA 2YDRA 3W7CA 1FWIC 3SFWA 3VOCA 4IISA 4NKCA 3G0XA 3S5ZA 1NP0A 2DT1A 2EJAA 2I9EA 3DHDA 2DDXA 3DH7A 4R85A 3B9OA 3BWWA 1TYGA 1EBGA 1KV8A 4V1XA 2VOTA 1OT2A 4MWAA 3ARQA 5F4SA 3LNMA 4E8GA 5CC5A 4RR4A 3I4EA 4NT0A 1V0MA 2X40A 5LGZA 5JBFA 3WSUA 6TIMA 1VHCA 2B4GA 1I1XA 3IVTA 4L65A 5D03A 2KAUC 4LBUA 4JTLA 2R82A 4GIYA 3N2OA 3UW6A 1T0OA 1S38A 3I6RA 2WMFA 2WSYA 3LM3A 3T0AA 1CNVA 3W2MA 2PLJA 4GYPA 1S5VA 5DCBA 4Q8WA 3HJZA 3UZZA 3QLDA 4K1GA 1A3WA 5HJXA 4H9UA 3DG7A 3WMCA 2YBTA 5I78A 1RA5A 2P3ZA 1OD8A 3P5ZA 2QUVA 3T81A 1BYDA 4Y9NA 3ZJKA 4IIBA 3HURA 4IQJA 6ALDA 1BPLB 4RZBA 3RILA 3GDKA 1V3IA 4O50A 4GBUA 1DIKA 4PTVA 4C6OA 2QCCA 2Z26A 3W7GA 1UUQA 2C18A 1W1IE 4I8YA 5CZ0A 1DORA 3W23A 3ARUA 2G37A 1TQXA 5CQ1A 4K7VA 2WVVA 3FN9A 4XBKA 4F0HA 2QPXA 2ZXBA 3EDKA 4U28A 4PUDA 3NQMA 5DBUA 5BYWA 2XTKA 4IIDA 4C7FA 3POCA 3DI0A 4KFNA 5GNYA 2DGAA 4DM2A 4R5EA 4XZIA 3R12A 4YN5A 3DX5A 2BVDA 1JCMP 3BSGA 4GVGA 2VX4A 4G9PA 4GNKB 1MXSA 2GQ3A 3IRSA 1GQLA 2CU0A 4WJXA 2XIQA 4QTGA 2PLCA 1NSJA 3AIUA 3INPA 3MHGA 4OBSA 3SCNA 5B80A 2F6UA 4M29A 5A8GA 5BXTA 3L67A 3ZJ7A 3BLFA 3VKKA 3DBPA 4DX3A 1V6XA 3WEOA 3SCUA 5LGXA 3TQ0A 3KL5A 2HBVA 4UR9A 2C79A 2OLSA 3SEPA 3WQ5A 3SSJA 1JZ8A 1KTCA 2A3BA 1HO4A 1RV8A 1FWTA 3MSDA 1NFGA 3BH4A 3IK4A 1K1DA 1VEMA 3NQFA 1AW1A 2XJ7A 3IJ9A 2EPMX 4CD6A 4CNSA 4W84A 5JH2A 1QOXA 2QCEA 5L9FA 3U0HA 4IH3A 4PA8A 3DXIA 3ITOA 1IZKA 4AYSA 5FACA 2X0SA 2F6XA 2FIQA 2NQJA 4XX6A 1Y65A 3ZJ8A 4RW3A 3TSMA 1UIPA 2UY2A 4ML9A 2JF7A 3WL1A 4FNRA 1J6PA 3MP5A 2ZQ0A 1VF8A 1LTDA 3C2EA 5A6TC 4FLSA 3CUGA 3TXVA 3B9DA 4INFA 2J9YA 1UUOA 1XGZA 4PE8A 1O5QA 3C52A 1A47A 4JFWA 4WD0A 4AD4A 4J2PA 5CJ5A 4JQ3A 4NX5A 3B03A 4PC8A 3FIGA 3O05A 4CKQA 5LIUX 3KX6A 1R2SA 1H5YA 2IQTA 3PJTA 1EO5A 4KEVA 1W6TA 2OOGA 3ALGA 5CGTA 3GH4A 4YWSA 4AZ7A 1J0IA 4EPEC 3E2RA 1VHNA 3HA1A 4PMNA 1S3HA 1ZAJA 4FMVA 4C6QA 4LV4A 1BTMA 2OCZA 1DWFM 4F8XA 1E51A 3KS5A 3SCQA 2QR6A 3VDHA 1UKSA 1M03A 4D1JA 1C93A 5KZDA 5I7GA 1ZBKA 4LUIA 5HWMA 3SRKA 1FHUA 4DQWA 3B8IA 4L1XA 1GG0A 1YNYA 4BI5A 3DCPA 1W91A 1UD4A 4GHRA 3AXXA 3H7RA 3CQKA 4A29A 1EKOA 4ZGYA 2J8GA 3VCCA 5AVHA 3WCZA 2RFGA 3WD3A 3LU2A 2NQLA 4J9JA 3E0FA 2W62A 3G1DA 4YLWA 5LA1A 5C2XA 1EQCA 4KFOA 3PF3A 2AKMA 3GNDA 3CL6A 3HO8A 2ZRYA 5GQBA 3KRUA 3L4VA 1JCYA 1RCQA 1WXJA 2PWEA 4UFMA 3H4GA 3UF9A 2X7VA 4HGXA 1MYRA 3CB8A 1UC5A 3CWHA 3TW6A 3U6WA 2WLZA 4KPLA 1DQWA 4GCAA 1OFAA 4J5NA 4MM1A 1ECQA 3NL5A 4NF7A 3H8AA 3BG5A 1DQXA 4JTTA 2E6AA 4O19A 1J0YA 1H4PA 2NUYA 1TIMA 1RZMA 4Z2IA 3LLXA 1MUCA 1SZEA 1WP6A 4PFHA 2R9RA 3WQPA 4H7CA 3D0CA 2BOGX 4FR6A 1XPGA 1US3A 4BF7A 3ABOA 3GIQA 3MVTA 3B05A 4GH1A 4H9ZA 4QJ4B 3GU1A 3UA3A 3FYPA 2GK1A 2OR2A 3L23A 4F0MA 1TJPA 1YPXA 3KM8A 4WHBA 2JFEX 1B4EA 3PTMA 3TTEA 4UFKA 1D9EA 1J93A 4JTHA 3G18A 2J62A 3W9ZA 1U30A 1XBZA 4AWUA 5KINA 4NU7A 1WE5A 4QQ3A 1J0ZA 4RXFA 1RVKA 1CZ1A 3QGVA 2ZVIA 4O1AA 4IPJA 5H8MA 1UB3A 4DJEC 3NPXA 3TMQA 1JJKA 4A4AA 4DWSA 4CCDA 2WHLA 3DFPA 3QFWA 4ZFCA 1XGDA 2JKPA 2V5LA 1NOUA 2ABBA 4CEUC 3HB9A 2ZA1A 1HJXA 1OWQA 4ADUA 4YTQA 4DBUA 3G3MA 4PR4A 5FJUA 3MPGA 4DF0A 1M6JA 3N11A 3PBVA 2P10A 3W7NA 4JQAA 3W82A 4PTMA 3ANYA 1NFBA 2R1PA 3N14A 3AMCA 2ACSA 3AIQA 1VPXA 2C6QA 5C7VA 2X7WA 3W26A 3W22A 2G4FA 3FHAA 1UKQA 4UBPC 1H1ZA 1TCMA 4G1NA 1NY1A 2GFTA 3FEMA 4LV9A 1VB9A 2GWGA 2QCDB 2WCSA 3TDFA 5FAGA 5DXXA 3W6MA 4B9YA 5AHLA 1DJWA 3V0UA 4RNIA 2JBMA 1KM3A 1AVAA 1FVPA 4QJ3B 1L0PA 3H12A 3A12A 2Y85A 5K9DA 1NQ6A 3EOEA 1E6QM 3IS4A 3UU0A 2FLIA 2JK2A 2VKZG 2QUUA 3HMJG 1E9LA 2PSNA 1K8ZA 4Y8EA 4DJFD 3TN3A 2E9BA 4IFKB 4AWTA 1KBJA 1UWRA 4AHOA 1W1TA 5IM51 4RNHA 3U5YA 2YXGA 3OLGA 3NZ1A 5BRPA 2QV5A 4KWWA 2QYGA 5CAKA 2XYLA 1B54A 1E72M 4OBRA 4GD0A 4LVDA 1SO6A 3ZT7A 4GI6A 1XLGA 4MUPA 2YW4A 3ITYA 1O1HA 2FTWA 3KFTA 4LCRA 3UR2A 4HTBA 4EAYA 1YDYA 4M1BA 4NX0A 3AJ7A 2QAFA 5EPDA 1W37A 1W2PA 1CX9A 1KM2A 2JKEA 3VZYA 3QZ6A 3GNPA 3TYEA 3TW9A 1J79A 3RU8X 4Q3MA 2ACUA 3LRLA 3MHUA 4QAWA 4YCPA 3RDKA 1KW1A 1JF6A 1ZPTA 4IUGA 4E38A 4QROA 3Q65A 3NZQA 2D24A 2PD9A 1LF1A 4F48A 1DWHM 3EPOA 2HPMA 3DFHA 3E2QA 3F4DA 4K37A 4PB3A 1TTIA 4ZQCA 5C2GA 2FGBA 4ZMGA 3ZWSA 4O1BA 1ZBCA 3KLKA 4LW7A 3LNPA 4G1KA 5FJOA 2C14A 3LOTA 2UY5A 1KFLA 2WMGA 1UD8A 1KTBA 3TYDA 5D37A 3LYEA 1J5TA 2NQZA 3TWBA 1EHNA 4RE3A 1HF6A 3FJ6A 3GC2A 4L1WA 2VDHA 4TVUA 2HISA 1MQRA 3A3HA 4AFYA 1SFTA 2BP1A 2YSWA 3IJIA 1PAMA 3OVQA 1MMFA 3P60A 5LNSA 3E3HA 4H9VA 5KZ6A 3CYVA 1TQJA 4IOTA 1BG9A 2WSKA 5IXEA 1GJUA 5LIWX 5D8WA 3LK6A 3DOPA 2ATMA 4DYJA 1B3WA 3RU6A 4AUBA 3UERA 3U7VA 3QV9A 3GVRA 3SN4A 3C2YA 4GX8A 1QPKA 4ES4A 1W3HA 3AISA 3SB0A 3SJ3A 3BOLA 4EX4A 4O18A 4RKAA 4P7NA 3CHVA 4HJWA 1JPDX 3B4YA 1E71M 3QKZA 3R25A 1XH0A 3G24A 1MZRA 2CPUA 1Q6RA 3ELFA 5FF0A 3EX4A 1EJTC 2JGYA 4FOKA 4ILSA 4R34A 2XIJA 4DEFA 1BTCA 4UOJA 1B0IA 3RCYA 3T0BA 2BXVA 4HK7A 4TO8A 4CQBA 1WBHA 5DQPA 2YCKX 2VFHA 3NXLA 1JRCA 2D69A 1JR1A 2IPGA 1G6CA 1DV7A 3EZ4A 3S1WA 4X63A 3KRBA 4ZA0A 1SJCA 3LQLA 1YEYA 3HGSA 1GTEA 3BURA </