2QV4A

Human pancreatic alpha-amylase complexed with nitrite and acarbose
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 171
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qv4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qv4A01
4UFMA 3MI6A 1JNEA 2WHMA 1GJUA 3OA5A 1VF8A 1MQPA 4PEEA 4B3LA 4P7RA 1B90A 1X6NA 1R46A 3NDZA 3OLIA 5A6JA 3MKKA 4GO8A 5CGMA 1J9YA 4WLCA 1JAEA 3N18A 4ATWA 1QOXA 5A2BA 2FGZA 1XGZA 3N12A 2EQDA 1G0CA 1ISVA 1PZ2A 3OLDA 1HN1A 4Z2HA 3TTYA 1V08A 4CU7A 4ZFMA 3U5UA 3RJYA 1CXKA 1E4MM 3VIJA 3WY2A 3KL0A 1HX0A 2JF6A 3ZJ8A 4F8XA 4AISA 2WCSA 2VCBA 1GPFA 3ARYA 1B3YA 5DT5A 1JFXA 2ZXQA 1MXDA 1FHDA 4KH2A 3AROA 1KR0A 4DWSC 1DHKA 4AYSA 2G41A 1OM0A 1XH2A 3PZ9A 3ARTA 3ARSA 4D72A 4J3UA 3AS1A 5IFTA 2XTKA 2G3MA 1BLIA 3F4VA 1XYFA 5I0DA 2NW0A 2OWXA 4CVUA 3QGVA 4PMNA 1B0IA 4PN2A 3WF3A 1RP8A 4AEFA 2WMIB 1GOIA 3D50A 1E6NA 3BAYA 3RO8A 4W5ZA 3VIKA 4CVWA 2V3FA 3NJ3A 2WZHA 4W84A 1WZKA 1H41A 3BVXA 4FNUA 5I23A 1V6YA 3CV5A 1DWGM 2YL8A 4Z2LA 1JG9A 3MUIA 4GZJA 4JIEA 1XHGA 4WKHA 3VSVA 3GH7A 5CJ5A 4AZ5A 1GQIA 5CQ1A 1PS3A 1JGIA 2D0FA 2QHAA 3AYRA 3AIEA 3W81A 5I79A 2QPUA 1LWHA 4R5EA 4PMXA 4L4PA 3OZPA 1KCKA 4TX6A 4ACZA 5F7UA 1UHVA 4PMRA 2WC3A 5BROA 3UR8A 1UWUA 3CMJA 2NT1A 1CXFA 3U7VA 1UD8A 2FHBA 4CN6A 1C93A 1JXJA 1HJVA 2W61A 3BAKA 3PZIA 3EJPA 3VDCA 2WM0A 5JIWA 2XYLA 3CHFA 3PZOA 4JKKA 1OIFA 1V3KA 1L8NA 3KZSA 4RE3A 2PWEA 2J7GA 4V2XA 4TTUA 3W29A 3AIQA 4M82A 3VGBA 5CPSA 2WBKA 2ZXBA 2A3EA 4F9JA 5I5RA 2DSVA 1D7FA 3VDHA 1J0IA 1E6ZA 4UZUA 3VIMA 2EACA 2XVGA 3SUVA 1ZB5A 1CGYA 1OGSA 3BMWA 4URIA 1QPKA 5M17A 3T2QA 1TQWA 4LYPA 1I75A 4ML4A 2NT0A 3VIIA 1U2YA 5ABEA 1OSEA 5ABFA 2EADA 4HOZA 3CBWA 3CUFA 4WSJA 1NWUA 2GJXB 4AZCA 3A24A 1JFHA 1HXKA 3N13A 2FH8A 4UR9A 3CZ8A 3GM8A 4WK9A 6CGTA 1E0VA 1BYDA 1GQLA 3WNOA 4JL2A 2XHYA 3U7BA 2W62A 2WANA 4KWUA 1ECEA 3T0AA 4CKQA 3VIPA 1ZU8A 2WKGA 1RD6A 1GQKA 2ZX9A 3BCDA 3W53A 2J8FA 3ZO9A 4JKLA 3QHOA 3KEHA 4ZEPA 4NZJA 1JIBA 4TUFA 2YFOA 1MW2A 1NP2A 2NSXA 3DC0A 2PBOA 1WB0A 1LG2A 3W26A 4U31A 1W91A 3BGAA 2DT1A 3BH4A 2CEQA 2GDVA 2D1ZA 2WZEA 3VINA 1VBRA 3RM8A 3WNPA 4HMCA 1HP4A 5FCZA 2EBNA 1FFRA 2WSKA 5HXMA 5D8WA 2E40A 2W91A 4AMCA 2XPKA 4CD6A 1CXEA 2FHFA 5E1QA 3LPOA 2BXYA 3MMDA 1HVQA 4PCTA 1Q6FA 4P7QA 5D9OA 3TONA 4DUWA 4D6GA 5I24A 3A21A 2EPOA 4ZXOA 2D3LA 3MMUA 5EFFA 3GH5A 3BSHA 3CPUA 2EEXA 2PI6A 3ARRA 5GNZA 5IHSA 1PPIA 2WW5A 3SUWA 3SCWA 1JD7A 1XD1A 4U5KA 3BUIA 1FHLA 4UOZA 2ZUMA 4W85A 3MANA 2PF0A 4P7LA 1UWIA 3OIHA 1BVNP 2DGAA 3ZOAA 1NP0A 2VQUA 4OZOA 4BA0A 3DX1A 3AOFA 3WF0A 3HG4A 1V0NA 1V02E 1OWQA 3W6MA 3VMNA 1W2VA 5IDIA 2YA2A 1QNQA 3KLKA 1E0XA 3DYOA 2XUCA 5E0CA 2CKSA 3A6OA 1JDAA 1H5VA 3WFLA 2OYMA 1DWIM 4TX8A 1E4LA 4AD0A 3CHEA 2QF8A 4IM4A 8A3HA 4X0VA 2IXVA 2D20A 1C8XA 4DUVA 1N82A 3W27A 1TE1A 1VBUA 3B9DA 4MB1A 4W86A 3BLKA 3ARPA 1R75A 1KB3A 2E0PA 2D0GA 2VCAA 4AD3A 1R34A 1M04A 1OBAA 1QI0A 1NARA 4FNRA 1O7AA 4P7NA 1OGGA 2XM2A 5A6SA 5E6YA 1OD8A 1EOMA 4QLLA 4D1IA 2YJQA 3VGFA 5I3DA 4AMXA 3SCVA 1BVZA 1JZ5A 3EBVA 1HXJA 4P8XA 1R8LA 3I3EA 4ZE4A 1AQHA 3FN9A 3PTKA 4D6EA 4MNJA 4HZ7A 3FAXA 4C7DA 5A6BA 3CZSA 4PSRA 1RH9A 1DEDA 4A4AA 3ZMRA 2ZWYA 3SEPA 1H49A 2VTFA 5HNNA 3SCTA 2XGIA 1UKQA 3SCPA 2D23A 2EJ1A 3UETA 2ESCA 1EQCA 3AHYA 1IZJA 4UFKA 3SCOA 1Y7VA 3CGTA 4H7VA 4H04A 5CZKA 2XJ7A 3NYDA 4WIWA 1OCQA 4PMZA 4JFSA 1C90A 1E5NA 2C7FA 2F2HA 2WBGA 4IPNB 1SYTA 2D2OA 3UEQA 1NQ6A 3DHUA 3WN6A 1C92A 4LGXA 4AIUA 1CENA 2J75A 1J0JA 1UH2A 1MQQA 1HL9A 1CXLA 2UY5A 1UD4A 4OBRA 1NWSA 2PWHA 4HP5A 3PZVA 4FLSA 1W1PA 4CD7A 1XRVA 2VVNA 1UA7A 3AXXA 2F7PA 1DWFM 1I1WA 1UR9A 3FY1A 1WO2A 4MB5A 3EDEA 2WXDM 5M03A 2YLAA 3DX0A 1LWJA 4OGZA 3FHAA 3WQ4A 2WZIA 4LXFA 1VAHA 3AS2A 4J3SA 3NUKA 3QHMA 2CKRA 2ZUWA 3CIVA 5C71A 1R7AA 1F4HA 2XWEA 1BFNA 3AQUA 4PCSA 4CGTA 3AJ7A 4FNTA 1PX3A 2FDMA 1G9HA 3IGUA 1WDPA 1E40A 2WCGA 2VR5A 2G3NA 3VUPA 4DWSD 2Y8KA 4E8DA 3LMYA 3VM7A 4AD5A 2J77A 3RCNA 4QCFA 3IAQA 4UOQA 3WEMA 2VZUA 1MYRA 2XFFA 2GFTA 2BFGA 4FF5A 4AZGA 4UFLA 1V6UA 2PB1A 1TA3B 4UZSA 4TXEA 1JF5A 4FNPA 4CD4A 2WAGA 1JYXA 1I1XA 4DWSA 3GXIA 4PTWA 1HKMA 1HP5A 3VSTA 1VENA 3VPLA 3CZGA 2YA1A 1XSKA 5JBFA 3WQ8A 4H41A 3LRLA 3CZKA 2F7OA 1C8QA 1V0LA 2CNCA 4P8UA 3T2PA 3DX4A 2OYKA 4CN4A 3A4XA 4MB3A 4CD8A 2PWGA 1QW9A 1UWSA 4WKFA 3ZM8A 2DT3A 1VFFA 5A3HA 3CZNA 2VVSA 2A3AA 2XG9A 2CYGA 3WUBA 3WMBA 4HA3A 3CHCA 7CGTA 5DMYA 4W8BA 2XN2A 2YA0A 1W9VA 1JI2A 4Q22A 3T08A 4BQ4A 3WQ5A 1G01A 1E0WA 2EO7A 2BV9A 3WEOA 1J0ZA 2HVMA 1KGXA 2O92A 2DEPA 1QHOA 5DT7A 3WMSA 1HJXA 1ZL1A 2G4FA 2WKLA 4JHOA 1CLVA 5M3WA 3T2OA 2ZIDA 1E56A 2WVVB 3KLLA 3K1DA 2VMFA 1JZ6A 2X0HA 1OB0A 3AHXA 4PBGA 3AS0A 2VC9A 2BHUA 2E9BA 1UR0A 1MXGA 4W5UA 1WDQA 1Q6DA 4ATLA 4AD4A 2XVPA 3QHNA 1CXIA 3AMGA 1KXVA 1O6IA 4HTYA 5AC4A 2F18A 1LL4A 4H8VA 3LX9A 1BHGA 2GK1B 1DWJM 4V27A 2ZUTA 4A3HA 1TUXA 5E70A 4AIEA 4U3AA 4OIFA 2EAEA 1E73M 1U30A 1JI1A 2VZVA 3L4XA 1G94A 5FKYA 4M81A 4EANA 1QI5A 1SFSA 3UESA 4E4PA 3OLEA 1UQZA 5E0FA 4UFHA 4MTVA 2XFRA 1B3ZA 3BLBA 4S3JA 1EO5A 1HL8A 4N42A 3K8KA 2QMKA 3OLGA 1ZJBA 4MADA 3WENA 3BAIA 1GOWA 3M07A 1CGXA 1WZAA 3VX0A 9CGTA 3VDBA 4NSBA 5GNXA 1EA9C 3HG2A 2BVTA 3QR3A 1HTYA 3WH7A 1GUVA 1ZBWA 1J0YA 1GOMA 3PN8A 1G1YA 2F7QA 3WL1A 2GJPA 2WMFA 1M53A 3SCSA 2ZX6A 3WKZA 2WMKA 3UG5A 2ZX7A 3PBGA 2GDUA 3SCNA 5HOSA 3O2LA 1HF6A 1PAMA 4PSPA 2XSBA 2DH3A 3CHDA 3CO4A 1PEZA 1XD0A 4HU0A 2VCCA 5JBDA 3VM5A 1QNSA 4PMUA 4J3WA 1V3JA 5DF0A 4GINA 2OWWA 4HMEA 3W38A 1GW1A 1TQVA 2CCRA 3UCQA 2J8GA 2W92A 3HU7A 1J0HA 1CXHA 3IAPA 3VTRA 3LXBA 1OGBA 4S3KA 2X2JA 1D2KA 2XSAA 2ZUSA 3WUFA 1AQ0A 3L4YA 1CGUA 1XYZA 5E9AA 1UASA 1IZKA 3SUSA 3AI0A 1A47A 4JAWA 2VRKA 1EXPA 4OKDA 4QP0A 4MNMA 3GNOA 3PZTA 1QNRA 1PX4A 1UG6A 3WDHA 4W7UA 4PUDA 3VD4A 3APGA 3WQWA 4AW7A 4KRUA 1CGVA 1BF2A 4MPKA 1BSIA 1E72M 1W9BM 2YBTA 5AC5A 1WZLA 1EGZA 2DIJA 4ZXLA 1H11A 5E6ZA 4PMDA 4DUXA 4AYGA 7TAAA 3U5YA 4NRRA 3VU2A 1ISYA 1CWYA 1HJUA 3OGSA 1ITXA 1PJ9A 1J12A 2GSJA 4UNIA 1QI4A 2DQXA 1HT6A 1SR0A 4FMVA 4P8WA 4AZ6A 3TOPA 2ZXAA 1FFQA 3N9KA 3BXWA 2CBUA 3AHTA 1DP0A 4EKJA 5JUVA 3AZSA 3SURA 1MQRA 3CUJA 3AMKA 3MUZ1 4BF7A 3VGDA 4W89A 2OW7A 1B2YA 3WIJA 3AMDA 1XCXA 4PYSA 3ZR5A 3RM9A 1C7TA 3WNKA 5IXEA 3CUIA 2WYSA 2MANA 5GQBA 3HG5A 3NIYA 4CCEA 4GZIA 1G5AA 1UR4A 5ABGA 3L2LA 4DM2A 3FXYA 3THDA 1CGTA 2F7RA 1OD0A 4LX4A 3D4YA 1KGWA 1V3LA 3NCOA 5A8NA 3ARUA 1GNXA 1BYAA 3IK2A 4J3XA 4J27A 4C7GA 1FP9A 2VOTA 1US2A 1MW3A 1UZ4A 4R27A 1R87A 3TP4A 1KQYA 5IHRA 4D6DA 1JL8A 3VD7A 2ZOXA 3K4AA 1BGAA 4CCDA 1CNVA 3VIFA 2VRJA 4ACZB 1R7OA 2RGMA 2WMHA 1XH1A 3LRKA 2O9RA 2XFYA 4B15A 3CC1A 3VD9A 2QV4A 1KR1A 4JCLA 4HA1A 1H0IA 5A1AA 3ZSTA 3GXMA 2YLLA 2D3NA 1UKPA 1E5JA 4BQ3A 1NWRA 4BS0A 2V38A 1ZS2A 3BMVA 5CGTA 1ESWA 4LYRA 4D6HA 3GZAA 3PZMA 1Q6EA 1JYNA 1H0GA 4UFJA 2XM1A 3J7HA 5CLWA 1JF6A 1JYVA 3WH9A 1YQ2A 1Q6GA 4GKLA 1K9TA 2DPEA 2E9MA 1KTBA 3GDBA 4DM1A 1JXKA 3DECA 5LYRA 3PZGA 4AWEA 5EFDA 4KRTA 3CZEA 1DTUA 3VIGA 4TOQA 4NZFA 2D73A 1D3CA 2DH2A 5ABFB 2IGTA 1E6SM 4AZCB 2F1BA 1MW1A 1TG7A 4HZ6A 4M1RA 5D9PA 4D6FA 4X9YA 4PTVA 2GVYA 4FNQA 2J7BA 4YHGA 5DO8A 3L4WA 1WKYA 5A69A 4JFWA 3WDRA 3U57A 3VO0A 1QW8A 3BUBA 1ZBKA 3K46A 3VNZA 3W4RA 1GORA 1NOFA 3RDKA 1ZJAA 3WH5A 3ZIZA 1XSIA 4XUYA 1LL6A 2OSWA 2OYLA 3CZJA 4BQ2A 4EK7A 1BPLB 1KBBA 2J7EA 1BG4A 1GOQA 1PX8A 3AIUA 1LL7A 2OLHA 3T09A 3ARQA 1NOUA 3OB8A 4HPHA 1WCGA 3RILA 1YHTA 1R33A 3SCQA 1BYCA 3KL3A 3OZOA 5A6BD 4MB4A 4KGLA 2VI0A 4CU6A 1B9ZA 1FA2A 1HKIA 3LXAA 1CIUA 1ZBVA 3CTTA 4LPCA 1VJSA 2FGLA 3EDKA 3SUTA 4HMDA 4IUGA 3UERA 1UD6A 2F1AA 1HJSA 1QVBA 2BS9A 2X8RA 4W8AA 4RL3A 3WF2A 2YOCA 1CYGA 3AMLA 2ALWA 3ZSSA 1KXQA 5HPCA 2DT0A 1W1VA 3WNNA 3WNLA 2F8QA 1BGGA 3VSUA 1GHSA 2J7DA 1WPCA 4H8UA 4AIOA 4QCEA 4GI6A 1W1TA 3CLWA 3DHPA 2BY2A 1W9XA 2X2HA 5A94A 3AXIA 1E3ZA 4GIAA 4KMQA 5I77A 3WNMA 1H3GA 1GVIA 2J25A 4UQ9A 4HZ8A 3WDQA 4Z2GA 1X6LA 1JD9A 2YFNA 4EAMA 2WLYA 4UQAA 3BVUA 1E6PA 4WF7A 2DSUA 5A8PA 1KFWA 1ISWA 2AOSA 4N0RA 1JZ4A 2EPKX 5D8ZA 3AS3A 4P8VA 1V3MA 3N1AA 1CECA 1V3HA 4GQRA 3FHQA 3VGGA 2Q8XA 3W37A 3AIWA 2BY1A 3S5ZA 3AIBA 3G6MA 3A23A 1CEOA 3T0BA 4OBSA 2UWFA 3WUEA 3OGVA 1HVXA 3IJ7A 4GI8A 3W25A 4W87A 3AFBA 2AAAA 3EJRA 3D3AA 1QNPA 3EMCA 4M8UA 4ZENA 4UTFA 1EOKA 5LA2A 2X0YA 1K9EA 2YDSA 3MU7A 2X09A 1CLXA 2HISA 1K9FA 1KWGA 3ZR6A 1E6QM 1WAWA 3K4DA 1KGUA 2C8NA 4B16A 1BAGA 2J4GA 2VZTA 4H8HA 3VKKA 1GZJA 1GHRA 1E3XA 2CERA 1TVNA 2IUZA 1V0MA 4NZCA 4X0NA 3E1F1 4MDPA 3ZJKA 4CUCA 1NOWA 4GXPA 2ZUNA 3HMCA 1W3HA 3MMWA 3WH8A 3TTSA 4NXKA 4PMYA 1OT1A 3L2MA 3PTQA 1HJQA 4AC1X 2Y24A 7A3HA 2VRQA 1U33A 1GQJA 4UOJA 4BZYA 4J28A 1H09A 3D52A 1UH3A 1JZ7A 2CESA 3I3BA 2W4XA 5HBFA 5KEZA 4Q7NA 1VB9A 4IPLA 3BAWA 4TVCA 4W7VA 3GH4A 1CGWA 1W32A 1LLOA 4XV0A 4TTGA 1BG9A 1KXTA 4W8LA 1WZMA 2BNJA 4F79A 5BXPA 2CXGA 3LPGA 2OSYA 4UQBA 4PRWA 4DO6A 4TVUA 3A4WA 3BUDA 3M6DA 2BVDA 4MJ2A 3GBDA 2VO5A 3NDYA 5A2AA 3WBEA 3VIHA 5CXPA 2JIWA 3WDPP 3VNYA 3KWXA 4NI3A 3H55A 2WC4A 1KTCA 2Y4SA 3AICA 5A8MA 4AY1A 4HU8A 5A6AA 2JEQA 4GQQA 3DX2A 3DYMA 1ZBCA 1JZ8A 5EMYA 3BAXA 2X2YA 3FNDA 3THCA 1LJYA 3I3DA 2J62A 3D4ZA 3F5KA 5FL0A 1GOOA 4GO9A 3PHAA 3K8MA 5DFAA 1SZNA 2V5CA 2WMIA 5GPRA 1UOKA 2BHYA 3EJSA 2CBVA 5BXSA 4J7RA 4U3CA 2WNWA 2XN1A 5GNYA 2G8ZA 1UR8A 4B3KA 4Z2JA 1V6WA 1W9UA 1VIWA 4FNSA 3GYCA 3WUGA 2UY4A 1HWWA 3UR7A 1ISZA 3WD0A 2JALA 4AZIA 3ZJ6A 2B31A 4BQ5A 2VZOA 4U2YA 3BVVA 3WDIA 4DWSB 3CUGA 3WD4A 4JKMA 2UY3A 3KL5A 1VRXA 1VJZA 5HDRA 3AYSA 4W7WA 1XCWA 4HA4A 4MNKA 3GTNA 3F5JA 4YHEA 1AVAA 4AMWA 2V5DA 3CH9A 4GPNA 3HG3A 4V28A 3AIVA 4NX0A 2PWFA 3VILA 2BY3A 3VOCA 3VDAA 1JYWA 4HPGA 2VNCA 1LG1A 4HOXA 5JIPA 1EHAA 2VX6A 1J0KA 1UD5A 1W1YA 1M01A 1PZ3A 2QLYA 3HZ3A 4U5IA 1VFUA 3ZT6A 3B9AA 2Z1SA 4U33A 5CG0A 2ZUVA 1UZ1A 1R47A 2E4TA 2GUYA 2W63A 2WMGA 1TR1A 1BQCA 3RPMA 1CBGA 3WY4A 2G3IA 2D24A 1W9PA 2WLZA 2WK2A 3T0DA 4PMQA 4JHZA 1W3JA 3WEZA 1TCMA 1MVYA 1TQTA 3BUQA 5C70A 4KGJA 3TTOA 1E71M 3WD1A 3NSNA 1GCYA 1SMDA 2GJXA 2Y5EA 3AHZA 5AY7A 5A8QA 1B3XA 4AZ7A 4CD5A 3ZQ9A 2AMGA 1C3FA 1R86A 2A3HA 4B9YA 3GXNA 1K9DA 2XN0A 3OGRA 1JZ2A 5FOOA 2YL5A 1UUQA 2A3BA 5CLTA 2YDRA 4J3TA 4UQCA 4PTXA 1RPKA 1UKOA 4NRSA 3FW6A 4P7OA 2W66A 5ABHA 3OBAA 2XGBA 4JFUA 3M7SA 2ZE0A 1EH9A 3BLPX 4JFTA 1J10A 3WFZA 1P6WA 1QBBA 3NSMA 3ARXA 3L4UA 3A3HA 1LQ0A 1E55A 4AXNA 2V3GA 3WDJA 3BVTA 1UQYA 3BUPA 3JUGA 2WSPA 4WKAA 1E9LA 2XIBA 2QPSA 4JCMA 4IISA 3H53A 1FP8A 4B9ZA 3WQVA 1EHNA 1PBGA 1B3VA 1EDGA 4RE4A 1M03A 1EO7A 1UR1A 3WBAA 3WF4A 3EJUA 2VUYA 3IANA 5FD0A 1UWQA 5I78A 2ZXDA 4A3YA 2CBIA 4YPJA 1MWOA 5A6LA 1K6AA 5LA0A 1QWUA 3WSUA 5AYBA 1UWTA 2VQTA 5D9NA 3TA9A 3VMPA 2JIEA 2VJXA 2OW6A 3HN3A 3CMGA 4Z2KA 1QNOA 2DSZA 4FK9A 4XZBA 4C7FA 1MFUA 1W9DM 5M5DA 1LF1A 3AZTA 2BHZA 2VX7A 2VT0A 2VR4A 1KXHA 4JZ5A 3VMOA 1C7SA 2WCAA 3WY3A 1HNYA 5I2UA 2JEPA 3BCFA 2EPNA 1E6RA 3D51A 3PZQA 2A3CA 3KE0A 2WVSA 2F61A 2VL4A 2XVNA 4NXSA 5CSYA 3RIKA 4D6CA 4D1JA 2O9OA 4XB3A 4HOWA 1V6XA 4AEEA 1C8YA 1J18A 1UD3A 3BC9A 2O9TA 1TFVA 5DEZA 1OIMA 1XC6A 3MO4A 3MSDA 3DYPA 2J79A 1TQSA 3ARZA 1CZ1A 1TVPA 3SCUA 1E6XM 1QX1A 2EXOA 3PZNA 3A4AA 1VEOA 3W0KA 1ODUA 3EJTA 4D6IA 2FHCA 2YBUA 1Q4NX 4NF7A 1DWAM 3WMCA 3B8SA 1F4AA 1US3A 3N17A 1UKTA 1MFVA 1DWHM 2WHKA 3GXPA 2V3EA 4D71A 1B31A 1B1YA 4MAVA 5CPQA 2CITA 2O9PA 1B30A 5A6KA 3L4TA 1PIFA 3W6LA 5KZ6A 3ALGA 1UH4A 2W67A 4M80A 1CDGA 1S46A 2WHJA 1JDDA 1QI3A 1XH0A 3S5YA 3IJ8A 2WWDA 2JF7A 3N11A 4W93A 5BRPA 2J47A 4EE9A 2DDXA 3MSGA 1W3KA 2PWDA 3BVWA 3O6AA 3OG2A 6TAAA 3O9NA 2XIIA 3VGHA 2CHNA 4WJXA 3GNRA 3IJ9A 5BXTA 2EABA 4D6JA 1IT0A 1R85A 2CHOA 4QDMA 1KWKA 2WVTA 3ARVA 3WY1A 2YKKA 2DIEA 1A3HA 5BCAA 5LA1A 2Y8VA 4BCEA 1OT2A 1KCLA 1TZ7A 3VD5A 2PBGA 1ODZA 5FL1A 5C8BB 4AZBA 4FLRA 2WB5A 3AMCA 2EPMX 3FAWA 4AZHA 5A6MA 2Z1KA 4PTMA 3N15A 2BVYA 3GNPA 4TVDA 4Z2IA 5BXRA 3EDDA 3EYPA 2GJRA 5A95A 5D9MA 3L4VA 3DX3A 4AD2A 1AQMA 1QBAA 1V0KA 1GOKA 4K68A 2DSWA 2BXZA 2G3JA 3MUY1 2WHLA 3WF1A 2BY0A 4OOZA 3AIRA 4PMVA 2EPLX 1B3WA 1V02A 1X1NA 2QMJA 4RE2A 1HIZA 4Y7EA 2IXUA 5IFPA 2ZICA 1EIBA 3ARWA 3QOKA 4GZEA 4OJYA 2VZSA 1JAKA 4QLJA 3G6LA 4H2CA 1OINA 3EJQA 1E1FA 3AHVA 2UY2A 2YDQA 1ITCA 5BRQA 3NSXA 4XZWA 1VFMA 3W82A 1H4PA 5AYIA 1IV8A 3LXCA 3LPPA 1AMYA 5HPOA 1V03A 5D4YA 1QHPA 4UCFA 1C91A 3N04A 4F66A 2X05A 1E70M 3WELA 4YN5A 4DO5A 2YL6A 4UQEA 3AISA 3RJXA 1TA3A 1JDCA 2YL9A 5JBEA 1GONA 1MW0A 3W28A 3CUHA 3TTQA 2J74A 1M7XA 3BAJA 1E4NA 3SCRA 4ZE5A 2J78A 1BYBA 4JL1A 4FLOA 2JE8A 4XX6A 2ZUUA 2DT2A 2CBJA 5BYWA 4PUEA 1JNDA 1E1EA 1WNOA 3RM4A 3CZLA 4CN1A 3K8LA 2FH6A 3AZRA 1HKKA 2D22A 1Q6CA 3SUUA 3M46A 3VX1A 1E15A 1FH8A 1FH7A 1UKSA 1JZ3A 3VD3A 1EDTA 2J7FA 1E43A 3A47A 3WL0A 3BSGA 3LRMA 1NWTA 3WH6A 3POHA 1NM9A 1VEPA 2DSKA 1VFOA 2WWCA 4GI9A 3HJEA 1ISXA 2RGLA 2VX4A 1CTNA 2E9LA 5A2CA 2CIPA 1NH6A 2J7CA 3RMEA 4JFVA 1EDQA 1V3IA 4E2OA 4PMOA 2WVVA 1H2JA 1W3LA 2Y2WA 3UG3A 1HJWA 1WE5A 4ATDA 2YIHA 1SMAA 5EB8A 4E8CA 3II1A 3GBEA 3D5HA 3VIOA 1TMQA 2WPGA 1UWRA 4MJ4A 1UR2A 2ZX8A 2GK1A 4J3VA 4LQ1A 1TQUA 4MAZA 3EMZA 4ACYA 2J7HA 8CGTA 1E4IA 4L4OA 4MDOA 3B9EA 1KQZA 5ECUA 1GVYA 1FOBA 5I6SA 1KBKA 4M29A 3QOMA 4U2ZA 2CPUA 3W24A 2OSXA 2D0HA 2WVUA 3L4ZA 3VGEA 2ZWZA 3POCA 5A8OA 1J11A 2ZX5A 2C0HA 3SIMA 6A3HA 3AXHA 1PIGA 2XVKA 3EMQA 4FLQA 2W5FA 1L0PA 3MV11 2WC7A 3DDGA 4DO4A 1Z32X 3TV8A 5E09A 3MS8A 3S6TA 4MNLA 3A22A 3MV01 3WD2A 4QFUA 4OUEA 1QHZA 4M24A 3UG4A 1WP6A 1FH9A 5FIPA 2TAAA 2E3ZA 5BWFA 5EBAA 5CSUA 3EDJA 2PC8A 4AD1A 2XVLA 3ECQA 1UYQA 3GXDA 1J01A 1CPUA 3VVGA 1T0OA 1RP9A 1XSJA 2X2IA 1WDRA 4LYQA 4W88A 1GJWA 3ZT5A 1QI2A 4QLKA 2E8ZA 3GXFA 3S2CA 2VX5A 2CETA 2V3DA 1QWNA 2E8YA 3PZUA 4CCCA 2X1IA 3ZJ7A 5TD4A 5CPTA 2WMJA 3DDFA 2FE0A 3GXTA 3H54A 2XWDA 4WSKA 1XV8A 2JFEX 4QAWA 4F9DA 1HKJA 2VURA 3ZT7A 4OOUA 3LPFA 2FYVA 4UFIA 3PTMA 3WD3A 1BTCA 1UA3A 2OWCA 3A5VA 3EDFA 1EQPA 1V6VA 1H1NA 4M56A 3F5LA 1VEMA 3WQ6A 1O7DC 1W2PA 3ALFA 1UD2A 4CU8A 1WDSA 3MUAA 4UQDA
chains in the Genus database with same CATH superfamily
4E0RB 5KN5A 2V9UA 3MOBL 1LILA 1I60A 5HYQB 2W9LA 1XGZA 4Q3MA 5D1XE 1YUKB 2VC2B 3WLOA 3P5ZA 4J3OC 1GG1A 4KIRA 3CSGA 4WWID 5I1EL 3RX4A 3U0WL 1HXMA 5HGBA 1GZHA 2ZRYA 1N5YH 3BW9B 3HE7D 1DHKA 3PPFA 1XFPA 3ZDXB 2B8OT 4LDLB 2IJ0C 4QHLA 4HPJA 1WTGT 2BFVL 1GKOA 3RG1C 4EDWL 5XIMA 2EHHA 2K7QA 2V3FA 4LK4A 1T7LA 4ZAKB 3Q44A 5HVWA 1KFJA 1IAMA 2J5LC 1VBJA 1MVUA 4GSDL 3ARDC 3UFIA 1JPGB 5H35A 3OZKA 3OIXA 1A5LC 1X4ZA 1GOGA 4HC1L 3IS4A 3TC9A 3E7JA 3DSNB 2YGQA 5EEYA 2SODB 5CAKA 3KZSA 4Z7QE 2OKOA 4IK6A 1DLHA 3VGBA 2BNRA 1KEML 4GFSA 4RFOL 2HPTA 2PYFB 3H7UA 4FQ2L 1NTDA 1ZB5A 3T0TA 1L2UA 1JDEA 1TQWA 4ML4A 5TE4L 5CMAB 5I2IB 2D31A 1JV2A 5CCKL 3UJSA 4CC0A 2KH2B 3GUTB 2PF6A 4YH6A 4E41D 3VCLB 1QSZA 3VIPA 3NJIA 4A2EA 3GIVB 4E41E 3LDBC 3L5LA 3JXAA 3W53A 2DQUL 4PJIF 1HHGA 3OMAB 2XICA 5FYLD 5JNYB 4DGWC 5HYIA 2H26B 1NP2A 3F12B 3KW3A 5FYLE 4KK9D 4KV5F 2PBOA 2RGSA 3W26A 4PGBA 1BX2A 1LQBC 4CNIB 2YMTA 1X9UA 3QUXD 3ES8A 3C8NA 3UJTL 4IRSA 3G08B 4C60A 1CLOL 4AMCA 9XIAA 1UACL 2HRPH 3N85L 1UOWA 2C16A 4PCTA 2APFA 1GGOA 1MRAA 3OVUB 3MLPA 1MQKH 5IMKA 3TAOA 3UTSB 3M5YA 4ZYKB 2GJ6D 1PPIA 1OAYH 1FV1A 3UZZA 4R7JA 2MHAA 1GZ1A 4MS8D 3BN9D 4DFHA 1K4CB 1JR1A 3WNIA 1DBJH 1I0BA 4UUIA 5F6HI 5J6SA 3KLKA 1RUPH 2DAVA 1DQXA 1DJYA 3WFLA 4H44C 1DWIM 3ASOB 3ARBB 2IXVA 3LD8B 3B9DA 1QSFA 3BLKA 1TZHA 1R75A 1KB3A 5FAGA 4LEBA 4L1BA 1OTUD 2EDKA 1A6WH 3QY8A 1RUAL 2O26U 2FX7H 4NFDA 4P7NA 1KV3A 5KINA 5FF7A 4L4TD 3IS0X 1OFQA 3EFDL 2BP1A 4ZD3H 1T40A 5HHVH 2P45B 4L4TE 5FYJU 4LCWD 2A6LA 2LVCA 4GG9A 4F2BA 1K8ZA 2FATH 5AVUB 3FAXA 2RDTA 4JQXA 2WNXA 3B2VH 1OF0A 2Q0ZX 1LLZA 4NM8L 1IZJA 3IYLW 2EXYD 3K5SA 2XJ7A 3NYDA 2OZ4A 2FBJL 2ZA1A 5D2LB 3CFJA 5CPOA 2C7FA 5DK2A 2D2OA 3C2FA 3TQPA 3DHUA 5F7KC 2FBRA 4ERSH 2UWEA 1UD4A 3P61A 1UPPA 2CZFA 4NN5B 2J4WH 4ONHA 3QXDA 5G4MA 2OZ4H 4UTUA 2BERA 3JTSB 1P0NA 3AS2A 4GXMA 2OKTA 2ZUWA 3MLSL 3OAWA 3U1SL 2K8QA 1X8CA 1FZJB 5DQ9A 2AJUH 1YYMH 2G3NA 1T99A 2Z00A 1O5PA 3FQYA 3E6EA 4M7LH 3IVKA 3GLAA 3LLXA 2A9ML 1IXNA 3I7QA 1JCYA 2GSGA 3FBKA 1E0OB 4A1RA 5C8JB 1S5HB 3T3PE 3ARGB 4BKSC 1XB6A 2RFGA 4Z1PA 1W8SA 4XNDA 4K5MA 4FQCL 1G7UA 5K69A 3GR7A 2VAAB 4PCFA 1BP3B 5DA0B 4Q14A 2MCG1 3MLWL 2PDJA 2CJUH 2QQNL 4YHKH 3QCUL 7CGTA 1I31A 2Q09A 2H8ZA 3I7RA 2R4SL 4KDTA 3WEOA 3QVQA 2NXHA 1AXIB 3T8LA 3ZWSA 1C5BL 1ZJIA 1ZL1A 3T40A 1J88A 4MNHA 4HUXA 5BOFA 2JKWA 1O7SA 2XNAB 5EU6A 5C7ZA 4FIQA 5I1IL 4YK4B 3AHXA 4PBGA 3TWAA 4M19A 3D69B 2E9BA 1A7QH 4ATLA 2XVPA 4QRTB 3QF0A 3QIBC 5FO9B 2LU3A 4ABVA 4E42B 2KERA 4X6FB 3BAEL 4NASA 4WO4C 1FFPA 3OW1A 2EAEA 1FYTA 4QRQB 4UBPC 2AAVA 2OSLA 4NKIL 4W9IC 1DSFH 4EWND 1SRDA 1RMFL 2ADJA 3VDGA 3ZK0A 3BLBA 5DURD 5IREA 1DQQA 5EO1A 4RH4A 1E1CA 1SNRA 3X1BA 3B05A 3ELAT 1CLKA 3B9KA 5H1WA 3Q2LA 2DIAA 1DANU 1GUVA 2FQDA 5F6IB 5KVGH 3L54A 2WMFA 5IM51 5HVGB 4YE4L 3DBNA 1A0QL 4ZQCA 3F7VB 1AJ0A 2VAJA 4O2EA 3FH8A 3CO4A 3MBED 2FEEL 1ZHLB 5JA9A 3VRJA 5B3SB 1FHVA 5HJXA 5C0DB 3NM3A 1J0HA 3VTRA 3CSYA 4FQ1L 3KOYA 3CT2A 1UIOA 4JFFB 1A4BA 4A7VA 4FFTA 2OO0A 1NFDA 2YSTA 4JG1L 3I75B 4XN4A 1FH5L 4P23C 4EAEA 4BWUA 3CCHB 2CRYA 1JPMA 4NVTA 5EF1A 3B2DC 1UOZA 2WWKO 1PHWA 1W9BM 1I9EA 5T1KD 1CLZH 2NY3B 4RDWA 2EKGA 1PDYA 2CLZB 2P24B 1PNDA 2CA4A 3C8KB 4F7PA 1TJ1A 1YPZF 4LF1A 3KYMA 2H41A 2J12B 3JRKA 3EUDA 5I0VA 1IGMH 2P88A 3P8JA 3BOLA 4O57A 3NEVA 3AHTA 4YPGB 1MPAL 4TTDC 4H19A 2EJAA 3VG9B 4HK5A 4A7TA 4WI0A 4W89A 3BJFA 5EOQL 4OGAD 2GG1A 4M5YH 4X9SA 3L2LA 1PSCA 2J8UB 4NP9A 4PRIE 3P8IA 2PP3A 5DS8A 1R87A 4NDMB 2MCPH 2QGYA 4KJPD 5IGXH 4LU5L 3P14A 4ODXB 3K4AA 4KRNA 4Q6IB 4NAFB 5FDYA 1P4BL 5ESQB 2GUBA 3QHFH 1XO8A 1T03L 1G7QB 4EXKA 5IBUB 5IMMA 4HKXB 3PF3A 1RK1A 1XZ0A 3SY1A 4FQLH 5BZAA 1WHPA 3SQMA 4R0LB 3I7SA 4A2GA 5JZ7C 2C9XA 5K3VA 4YXHH 4ZZFA 2V9DA 1OL0A 1JYVA 1K9TA 4O1EA 4UM9A 4HJ0D 2D9QB 3LHAA 4DRSA 3PZGA 3VKJA 1H7XA 1IX2A 1D3CA 5I1KL 5BOOA 1E6SM 3BDKA 3KUMA 4IDLA 2C3XA 2Z29A 2OA9A 3RJOA 3TURA 4YHGA 5HD8C 4A35A 2IWKA 4AW4A 3NCJH 4JJ5A 1G4MA 5CEZE 1GORA 3HHRB 1NOFA 3STPA 1UXWB 3CZJA 3KR3L 3W7HA 2Z25A 5GGVL 4OCRH 4OUUA 3CLEL 3Q9QA 2XGZA 4HCLA 4LO9A 1C29A 4FA3A 4RSYA 2HP4A 4K3GA 1V05A 2NY6D 1XLKA 1EEYB 2K7PA 4ZSOB 8XIMA 1NGXB 2VP8A 4LPVA 1DE5A 1MFNA 3HC2A 3MNDA 4P5SA 3KZPA 3UERA 5C0BB 3ES6B 3G2GA 4FQJH 4NNXA 1F4YH 4JZJB 3WF2A 2ALWA 5LGJB 3IM1A 1BQSA 2A6IA 3PB0A 4CVZA 1Q72H 1CW2A 1P0BA 4E2VA 2VXUL 5HHXH 4X9BA 2YAEA 2OLDA 5KYXA 4IDJH 1KEGL 3ID7A 1INQA 4ENLA 4HZ8A 1O1ZA 1KJ2A 5IJVA 1UQSA 3ALPA 2CWNA 2AK1H 4P8VA 4R7XA 2XH0A 2PE4A 2ZP8A 2WKOF 4YQXH 4LCSA 1TSRA 5HTSA 2I9UA 2XWBA 3S5ZA 2O93L 1NTHA 2CA3A 1HQ4A 1LOQA 1KGCD 5M2FX 1T0PB 3FU5A 1KJ2H 1KGCE 1NZRA 3T0EA 2MNRA 2D2GA 2AP2A 2Z65C 3UTTB 1PSKH 4R97C 1K9FA 4N2AA 1C8VA 5TQ2H 4IMKA 4BWLA 4IIQA 3O3BB 3PGFH 3V7PA 2J3SA 4JPQA 4L4VD 1QA9A 4A05A 3QY6A 1L0XA 1ADWA 3WLBA 3V9EA 4JN2A 2ZUNA 4L4VE 5K59E 4QNPF 3RF9A 2R8SL 1V7ML 4PMYA 3FA3A 1ZJHA 2VRQA 4F9PA 3B06A 2EKSB 3CK0L 2E7LC 3RPIA 3I3BA 3O3UN 2YBRA 3VXME 3GH4A 3Q2NA 4MXWH 3OU8A 3TW6A 2YCJA 3SY8A 3LKSA 3QJFA 6FABL 1SSGA 1HXYA 4QM1A 1XGRA 3VIHA 2O5ZL 3CIWA 3H55A 2QBWA 3KCPB 1ZK5A 2H90A 3NSFA 5FW6A 4ONOA 4M5SA 4HU8A 2VE6B 3L9YA 3DYMA 2JEQA 2BINA 1XICA 4D0DA 3CL7A 1ZRUA 5TFSH 5FYKL 4J7RA 4PJHA 2ZD0A 2Q8BL 4PB0H 1JPFA 3BQUD 1SVZA 3TNNB 1H5YA 3HIZA 4CILA 1RCQA 4LDEB 3NRFA 4DWSB 1QKZH 1LO4H 5IG7A 1VFAB 1MAJA 2ODHA 3MJMA 1U21A 4U6XA 3V16A 3VWJD 4LSSH 5D4HA 1AVAA 3QI9D 4TSCL 1J9RA 2A0LC 1D6VL 3CEUA 4I9AA 2XWJA 1EFXD 1S2AA 2MMXA 1RIVH 5HHNB 3VOCA 3CC5B 3HZYB 4M03A 4BCXA 1W1YA 1EJXC 2QLYA 4X8JA 1TPXB 1VFUA 5CJMA 3ZYOA 2BOGX 3W1LA 4NQDE 2XG5A 3VC5A 4XX1E 4A22A 1T22A 4DQAA 1T5XA 2Y23A 4YSPA 1W9PA 2WLZA 4NQUA 2WK2A 1GMIA 3NSNA 5A8QA 2HVJA 4Z7WF 2AMGA 5EG6C 2Y5TB 4QBXA 4PB3A 5I03A 2AERT 3MRLA 4ZGYA 4PV8A 1UC5A 4NRSA 4TV6A 3TO4A 3WAKA 2K3TA 3HS9A 3EZ4A 1J10A 3QN3A 2A4ZA 3GGWA 2ZZUT 4X7SH 3JUGA 1AH1A 3S5LB 4RVBA 3FCUB 3EF7A 1N0LA 3MCOA 5HGDB 2PWVA 2ZADA 1EHNA 2YZ5A 2J66A 5KYUB 2WNKA 3F2LA 4I8DA 2DLGA 5KSAB 3TESA 3IDJB 3B34A 4YPJA 3VCRA 2H2PD 4ACTA 3VTAA 4JO3L 2WLLB 2NXYD 2VDLB 2GFBA 5L88H 3RVVD 1LF1A 2E25A 3OGOE 3IT8D 4MVBC 1Z9NA 3PWPE 1HOCB 4MMZC 3IPFA 3FQXA 4G6JH 2NV1A 1E6RA 4I6VA 1LOSA 5G2NA 4D1JA 3ANVA 2GHZA 1X44A 3W6YA 4JEJA 4N5ED 3PBWA 1QVOA 4JFPB 3FJNA 4B5VA 4XXWC 3HA0A 3WFDH 1OLLA 2B39A 3A4AA 3US0A 4JDBA 4HJGA 3G18A 3HRZC 4KK6D 3OPUA 4HHMA 4MHHG 1QAPA 2G2RB 1SXBA 5IVXA 3GXPA 3QE5A 4D71A 5DUJA 4Y90A 3ECBA 2NY2B 2EAWA 5DEFA 3OKDA 5BUAA 2IH3B 3W6LA 1XPYA 3TZVC 1QEWA 4UTIA 4FULA 4JY5H 2ZCLH 2VLRE 3QISA 2HZHA 1Q0XL 1CDGA 4JHWH 2GQHA 4I88A 3B0UX 2D4FA 4TUKH 3VXUB 5SV4A 4NAEB 4UV4L 2QFPA 4PJFE 1CD9B 4MJ6B 1UJ3A 1AR1D 1ES0A 6TAAA 5K39A 1CDIA 1H9VA 3SQSA 1S3KH 3LIZL 5MHSD 3W57A 3ARVA 2DIEA 3CMOL 1TTRA 4XCCH 2Y8VA 1LDPL 1ODZA 1EZUA 3ZVVA 4JTDA 1E2WA 2JFCA 1FWTA 1W56A 4XP4L 3WLWD 1V0KA 2VGBA 3O0LA 2PMQA 3B4NA 2Z91B 4F20A 4X6CB 3TT1L 1E9OA 3CFIC 3ZHNA 2DZVA 4OB5L 1HIZA 3HQ1A 1AKPA 1JAKA 2HSIA 4YVVA 3AHVA 4HT1H 4FX7A 2DWDA 1DN0A 2Y7OA 4ANUA 2V5TA 4JREC 2ASHA 1M9SA 3HOGA 4XVSH 2EXTA 3LXCA 3LPPA 4HAKA 1I8MA 1V03A 4PVLA 3BGFB 2WQPA 4F66A 1N3NA 5CGYC 3TXVA 2V0AA 1TA3A 3BWAA 3ANUA 4MJ5B 2H1PH 2AGKA 4HFWB 3L3OC 2V81A 4PWGA 4LWWA 1IAOB 3HNSL 1X5HA 3APCA 2C15A 2FH6A 4OU1A 1XKYA 2D22A 3VX1A 5JPNB 1QFWM 3BSGA 3UDWC 1IC7H 5FACA 4F58L 3P9MA 1QW7A 3GDKA 4JR5A 4O11A 3IWPA 1WKEA 2B2XH 3CN0A 1JUEA 4IMFA 3ZUCA 3N2TA 5A2CA 4MA1B 1S7SB 4WJKB 2D7QA 2ZJSH 2Y7SA 4QLRA 5JPMC 3TBTA 1EWDA 1H3VA 1SM3L 2F8OA 1VIZA 4JRXB 2FJHA 4X4YB 2DQFB 2FVLA 4K8EA 5EYWA 2CBMA 4AQ1C 4LQ1A 3LEYH 5ECUA 2XIJA 2I25N 1W3TA 3MUJA 1ME8A 1I1RA 3NK3A 5F1NA 2VDNH 4K73A 1HKWA 1PD6A 3L0KA 3WFEL 4GW1A 1IKFL 1IC5L 1DFBL 2P8LA 2W5FA 1W3NA 3SB0A 4LRNH 4HFUH 4ODHH 5CD3A 5I18H 3VE0A 3FOKA 4X60A 3WJMA 2PC8A 2BSSB 4K3HA 4PZVA 4ONFH 5C09A 5HJLA 4XNQB 2HFTA 4L80A 5AD0B 1U8JB 1XGTA 1MCWM 1IR1A 1A22B 5E9DB 3SO3C 4MMWA 5DSCB 1HKJA 5HGAA 5MEPA 3LPFA 1Z2KA 2VDMB 3DERA 4J1UA 1NEUA 1EJSC 2FPVA 3A5VA 1MIMH 3KPNB 3STLB 5D2WA 2YO3A 2GBUA 5DUBA 2IG2L 1KY7A 3TU9A 1O7DC 1OB1A 3C87A 5D2NC 1UD2A 4Q4PA 1WDSA 1Q8JA 3G5ZA 1HIMH 3O9WB 5A6JA 4FMFA 3W00A 4ATWA 1A7NH 2EYSA 3VXOB 1TTJA 4XOEA 5EY5A 1S78D 3HN8A 3L3KA 5CO1A 4LB3A 3SOBH 3OHXC 4ZFMA 3U5UA 3COTA 2JF6A 3SPCA 5D4IA 4AHOA 4WY0A 2P53A 4PJCB 4JHVA 1KR0A 2CWRA 3EFFB 4PGEB 3DRQA 1BMGA 1XH2A 5IFTA 1BLIA 1XF4B 4KNUA 4P5MB 3QUZA 3RI5F 4CVUA 3EO0B 5D5ME 1UP3A 2WMIB 1FH2A 3NQCA 1H7PA 3KLAB 4LLDB 5DHXB 4JFDA 1NIBA 2YARA 3HKFA 4WKZB 1DWGM 1YEGL 3MLXH 3KPLB 4L9LB 2G9KA 2BP8B 3VSVA 3RL1A 4FFZL 1XF2B 1XGDA 4R9OA 2YPLA 3LB6C 1U22A 1X9QA 1K3ZA 3IJ6A 3GI9H 3UR8A 5HHQB 1CXFA 1TV7A 4WJ5B 1X5FA 5EO9B 1J87A 2AEPH 4O54A 1XIWA 1KGYE 1T66C 2E76C 1EAOA 2VQ1A 4JKKA 5KBKA 3KPOA 5KBPA 4Z7NE 2Y06H 3MHFA 5CPSA 1U3HC 4QXWA 2AGTA 4GABA 3VFCA 1Z6JT 1PCXA 1JPSH 3BMWA 5KG9A 1IGSA 4GP5B 3D30A 3PWNA 3MOAH 1I75A 3KTCA 3THMH 4LAOA 3UXDA 1UVQB 3ZKXB 4CMMA 4WSJA 2FH8A 1B4LA 3UAEA 3AT0A 2R1NA 1BIHA 4GMEA 3N2JA 3T0AA 3ARFD 4MFHA 1GHFH 4EVNA 3BCDA 3UWWA 3VNDA 2WQWA 4QRUB 3QHOA 1TEFA 1OFPA 4H1ZA 3PJSA 4IH3A 3UXLA 2HFFA 4KHXL 3M88A 2X4TB 3DC0A 3VE9A 1LG2A 5DHEA 2Z26A 3BISA 5FWRA 3ZJAA 3O63A 4MZRA 4ROPA 2CBTA 3GB6A 1S38A 4GYFA 3RWFA 2BXYA 3MCLL 4YMZA 5AKTA 3K2IA 4P7QA 2FX9L 3T78A 4APXA 4EOUA 1OAQL 3D08A 5E5MB 3UJFA 2OMXB 3S8HA 2R82A 3SUWA 3JV6B 4PJ8B 3L3DA 4ZMPA 2BCKB 1JNNH 3QJXA 3P4MB 2YXMA 3WJYA 4ODTH 3GRWL 3HG4A 3SECA 5LBSL 3W6MA 3NPUA 4W9HC 1A6AA 3OJGA 1M7UA 5E03A 1XR8A 3DX5A 3EWBX 4UTAL 4Z7UB 1JNLL 1W0VA 4AD0A 3C5ZB 5INCA 4QXTB 2GAZB 5B38B 4AD3A 3QPQC 3E6FA 1IM9B 4BGLA 4QLLA 4D1IA 5DFVD 2O4EA 3W7LA 1TJPA 1E0UA 1HXJA 3CN1A 1R8LA 4NO3A 3B8DA 4Q8VA 4ZE4A 4X8XA 2I57A 3UBGA 3WLIA 4FN0A 2BC4B 5B1JA 5J06A 4AEHH 4GAJL 1EO8H 5DDHA 3L5JA 3RWDA 4NYLA 1XISA 5JOFB 4OZHE 4I7VA 4M6NL 5ANMB 4UFKA 4PRHB 4LTSA 1KCRH 4Y7MA 3RRAA 1K72A 3OZYA 3ABKB 1JK8A 1EAQA 3N4EA 4M7JL 4LUTB 4LF3A 1YDPB 1C92A 4LGXA 3HI1A 2J75A 2UY5A 3BPOC 3NQ6A 3TUUA 2BP0B 1ZE3H 4OBRA 1NWSA 3MA8A 3BOVA 3QUKA 2OMUA 1DWFM 2WKJA 3M17B 3HUJB 1SYSA 3WMLA 4BFIB 1OO2A 2B59B 2A6JB 3ZRSA 4JIHA 4MDIB 3SGJA 4CBPA 2CFFA 2CLOA 5L0QC 3AJ7A 5E56A 3VNJA 1TZ9A 5DC0A 3DFNA 4I48B 3NL5A 3FH7A 3PUDA 2J77A 4E9WA 1EXGA 4JFEE 4BFAA 4I77L 1H9DA 5E6RB 1YNLH 2XFFA 1WA2X 2WBXA 1NMBL 2CLRB 3BW2A 1OE3A 2VN5A 4HNVA 3WUWB 2O61B 4PTWA 1HKMA 3DFSA 2ZE3A 1VZGA 3CZGA 2C1GA 3GTIA 3EGDB 4P2QA 2H6OA 1D8CA 1CFTB 3GIQA 1F3RB 3TC6A 4JVPA 4LCUA 3IJSA 3RR4A 3LK6A 1QRNA 5JXAH 3N42B 1FCUA 3G1SA 2RA1A 2DUAA 1VCBC 2G5BB 2PTWA 1VJIA 1P1VA 2HCVA 3HI6H 3ZHKA 5D93C 2EO7A 5ILTH 1W31A 4N8VA 1P7KB 3GMPB 5I8KH 4MWAB 1K3IA 3VRLE 3TT3L 3EKZA 3QWRA 4JTHA 4QRBA 2X9YA 4HEME 3M8OL 3UCDA 1EP2A 4O50A 5JUEH 3R8GA 3QQ4A 2B5IC 4MDJA 2R0KL 5DMKB 3GNMH 4BH7B 2FNWA 1Q6DA 4WHDA 4FXGB 4HYTB 1CXIA 3CM4A 3KRUA 3TFCA 4RDBA 4DTGH 1U2HA 4NGHL 5E08L 1LL4A 1PLGH 4PV9A 3VFSA 1TPVA 5EH1A 2Z2AA 1G94A 2PCPA 3SN4A 3QPXL 5E99H 4E4PA 4WW2F 3MWAA 2H3NA 4DK5A 4UFHA 3LKQB 5ADPH 2EUXA 3RVXD 1HL8A 4N42A 3W0WE 4BQ9A 5F3BB 4RAUB 4WWKC 5FGCE 3BAIA 3OGCB 4Y9GA 2VEMA 3QAZC 3RX2A 2RIKA 3VDBA 2BVTA 4WRLA 3N50A 3KDPB 2WO2B 2VEPA 4M4PA 3CU1A 3PHQA 4XGZA 4CMHC 5E5CA 4GIPD 3WKZA 3BZEA 2PF8A 4AVOA 1FCQA 1YZZA 1CFMA 3TE9A 4GYPC 4PMUA 4IU3A 1V3JA 5D2VA 5DJ8B 4PLJD 2OWWA 3W38A 4H2AA 3QY7A 3LXBA 2OK0H 4LT7A 5C2XA 1AQ0A 3MACL 5A7EA 1D6EB 3V75A 4I2XE 3HPLA 4OCSL 3F7YB 1P84K 3FB8A 1SSDA 4GA8A 1B9KA 5GJSL 5SWQB 3I02A 3WFCL 1E72M 2DIJA 4IW4C 1QR1A 3MLYL 2CKBA 4PJEB 1CWYA 1R9FA 1YVLA 3MLVL 4ISVB 3D6NA 5KVDL 3AU1A 4LHUG 4XVUD 1WBXA 4BSWB 3LM7A 3U9PH 1ZSDA 3BPLB 2EXSA 1F5WA 4BDVA 1M57B 2Y62A 5DD6B 1QCWA 3C6EA 2AQTA 4JDZB 2HTKC 1ZWIA 3GB7B 1QLFA 4JUSA 1XF0A 3THDA 1IEAB 4RCXA 4U7MA 3P7YA 3D4YA 2UZYA 1I9RL 1YJDC 3KG5A 3NA4A 4KITB 5C9JB 1J8SA 5TGBB 4I5BB 4IPPA 3LQAC 1SZGA 1OPOA 1H5BA 2ADAA 1RULH 1FFNB 1ZHAA 1YJDL 3L3GA 4HS6A 3BH8B 3KBJA 1H0IA 1NKGA 4RESB 3LQAL 5D33A 3G6JE 4Y4HA 1TTFA 1NWRA 3QIUD 3FQTB 1G7VA 4FA8A 3P73A 4MLRA 3PZMA 1KB5L 1ZTXL 3EYOA 1YN6A 1DVJA 1HILA 3U79A 4KY1H 1WYJA 2EC9T 1W1A1 1PNCA 2PYEA 2YCIX 5IHUH 3ULVE 4Y5YB 4LBSA 2VRAA 4J3OF 5IZ7A 4WHYG 2Q3AA 3U7WL 2R4RL 1TQCB 1WH0A 2B1AH 4PTVA 2ERJC 3SSZA 5HJGA 3A67L 3EH1A 5DVOA 3ANYA 3VNZA 1Q65A 3QZNA 3KPRA 3U36A 1HGYA 5I5JA 1AZUA 4XPHH 4AL8C 1UMYA 1KBBA 4Q9QH 3SN1A 1PZUB 1BG4A 3K0WA 3RLUA 4YDKH 1GOQA 3NG5A 4LNRA 2JLPA 4JZNA 1BQLL 2PLJA 1PGRB 2BB0A 1DCLA 1SVDA 4AL8L 3EOTL 1NCBL 4ANXA 1FA2A 3O0RH 1LEGB 2EEBA 2JSFA 4LLYA 2GQ3A 3WCYA 4WJEA 3PL6B 4G82A 1GQNA 2WP3T 1LEKB 1L3NA 5E23A 1AXTL 3MX0B 3DJ9A 1QATA 4DJFD 1P0SE 4MJMA 3QNZB 5GS2H 2P48B 1J05B 1NF0A 1D9KB 4QJ4B 2YXOA 1NWOA 2NNCA 4U0RC 4N3TA 5I66A 4K37A 5CEYA 3KNBB 1JPIA 4YWIA 3TNMB 2YFNA 2PSNA 3ROOA 2LU4A 2PDWA 3GMOB 3RFZC 1MFCL 1JZ4A 5F2MA 1NC4B 3W7OA 2HAZA 3PF2A 1L9NA 2ED8A 3N1AA 4QX4A 1L7IH 1XAKA 2WUCH 1MF2H 1CECA 3LGDA 4GQRA 3QUMA 1NIDA 4NN6B 1TPC1 4FALA 1U8OB 1YXDA 4X2PA 4KWWA 3BP4A 2ZVIA 2NLYA 1AD4A 3U0TB 1FNEA 4O52A 4W87A 3QHTC 1VRDA 4JFXB 4PVBA 4X6DB 1BFVL 4APQC 4HX1A 1DL7H 1M7IB 3OKOA 2BOLA 2HPMA 3HM7A 4RZBA 4N2BA 3U4EA 5EMMA 3QUMH 1XJBA 2C8NA 4CSPA 3VKKA 1AJ7L 2IPTH 3MU3A 4MXVE 1TVNA 4MAYD 4R5TA 2JJVA 1IC0A 3RMJA 4QUOA 4NUQA 1J5OH 3K6DA 4B53A 1A6ZA 1QYGH 2OVLA 4MCZB 2JI3A 4CADB 2CESA 5HQLA 4EUPG 1CGSH 4GWEA 1GGYA 5TIMA 4KRMB 1JJUA 1U8MB 3EPNA 5DK3A 2EH7H 4M7KH 4DO6A 2CLIA 3GBDA 1N5AA 3EX6A 3TBWA 5MP6H 1KTCA 1MOEA 4M0XA 2RR3A 1IE7C 4DJDA 2MRYA 4G7EB 3O41B 3V4PB 4GQQA 1JRHH 3IFLH 1HUVA 1GW6A 4M6UA 2QDDA 2FKPA 3GSQB 2QQ6A 3B2PA 4F33A 5GPRA 1SXZA 4Y1SA 1TJIL 3GSXB 1VIWA 3GYCA 4XZ9A 2ZOLA 5F1OB 3D85B 4RKAA 4K3ZA 3L5WA 1MCKA 3SIKA 4NZ1A 2YN5A 3MDUA 1CLYH 4IMCA 3KXQA 3SRFA 4IRZL 4IGBB 2CRMA 3AZUA 3SE8L 4YHPB 2HH0H 4DLMA 4BY3A 4MNKA 2KBGA 1S2UA 3VGAC 1PBYA 5D1XD 1HH9A 4L65A 2JTDA 5IBTL 3SCMA 2HUEA 1JYWA 1F4XH 3ZFHA 2VXTH 4XTDA 1JXFA 3ZLHA 2DRUA 3UPAA 3DGGB 1CFVH 3ZIMA 3SKMA 1L6SA 1CX9A 2V9RA 1SYVA 1QSED 5CG0A 2E4TA 3ZHLA 2WMGA 4HJFA 1HK6A 1QSEE 4LRTA 3JWOC 3WD1A 1SMDA 4GG6E 1JOIA 1XMEB 1S7RA 3EF4A 4Y4FA 2R1WA 3ISRA 2A3BA 3N0AA 2XBZA 3OYZA 3RBSA 2BSRB 1MRDL 3JWOL 1I85A 4MG4A 4OUOA 3DMMC 3LRSA 4FXKB 3AW5A 2J5WA 1QBBA 3R7RA 3DNKA 4K9JA 3RFRA 3L4UA 3DFHA 4LIQH 4JB9L 1TXKA 1TYGA 4DEPC 3WQVA 2APSA 1S5VA 1XF3A 4OF0A 1HSAA 1EO7A 1UR1A 1N6VA 3VNLA 3U4BL 1DQUA 2BCMA 3PG9A 1UWTA 2ZCHL 1AACA 1F45A 2KLTA 3GVRA 1YYLH 1XLLA 2EDLA 2FWOA 1TQJA 3LLDA 3HGSA 3NZ8B 2WVSA 3GF8A 4W9JC 4P9MH 3FYYA 5CWSB 1SOKA 3DU0A 3GR8A 3QQ9C 3RIKA 5DHVH 3U6XA 3T8XB 4XB3A 3WLQA 1WEJL 2EIBA 1W16A 1FKXA 1TQSA 1E6XM 3X1NA 5BMXA 4YNYB 1QNIA 3O6FC 3FB6A 4ZK8A 4IFRA 4XR8C 5A5WA 2CCLA 4DZHA 4XCYA 3E12A 3S96B 1MFVA 4A2FA 1THFD 5AZEL 1UM6L 4NNYB 3F4DA 2TRSA 1IIIA 2QL1A 5KZ6A 1D7CA 3ALGA 2O7QA 2D2HA 4M7LT 3TYGL 3KS0J 1JDDA 1XWVA 4ELDA 2WWDA 1QSVA 1EBAA 1H1YA 2I5IA 2J47A 4EE9A 1JSYA 1IKOP 4ROQA 5D7EA 3GPEA 3QFJA 2HT3D 3IFPB 3PWLB 4ADTA 3WY1A 1ETB1 2W95A 2EIDA 3ML9A 4G59C 5ADOH 4U1KA 5A16A 2WB5A 3RLVA 5DJAB 4FFVD 4BR1A 2VSKB 1AIFB 4WI6A 4FQHA 3N15A 4Z2IA 1BRLB 4S1RH 1UP0A 3ITGA 3IK4A 1Q94B 4V15A 1LBMA 5GSVB 3M7WA 4WV1B 3AIRA 4JHMA 2BJML 3VU1A 2FZBA 1N19A 4Q9RH 2YC1A 2H3XC 3QZWA 4GQZA 4YX2L 3PPSA 1L9MA 3EJQA 2F15A 2WIIA 1G67A 3DENA 4MPQA 4XVTL 3NSXA 4XZWA 4N0UE 4YTQA 4UMSA 2DEYX 1ND0A 1SEQL 5E5UB 4CW1B 3NCWA 2WWMD 4Z0BH 4AOFA 4Q2ZA 3LD8C 4UNVA 4UINH 4L6HA 4TNEA 4IMLB 2XI9A 4PY8I 4UQEA 4KVCL 1VLIA 4LEEA 4K5LA 4FG6D 3KVJA 3RX3A 4R4BA 2J74A 1GVSA 2DMGA 4J5VA 4ESKA 1QBLH 5JQ6L 5C0FB 4YYFA 1KNOA 3KXFB 1KN4H 4XZUB 3M46A 1EEQA 3TN4A 3D3VB 4B3ZA 3W7RA 4XB7A 4OCMC 4O2FB 2Y7GA 4OTXH 3TCTA 4KZDL 2Q2EB 1VGKB 4WQ6A 5KS9A 1MLBB 3BEVA 3O11B 2E3VA 2X88A 4JFVA 3KOFA 1X4XA 4LVEA 4JHAH 3K5RA 5ELIA 4IFOA 3MCG1 4E8CA 4HG4K 5KW9H 4B5ZA 1E5UI 1MI5B 5H8DA 2JCCF 3EMZA 1QPQA 1E4IA 3JT0A 3WYRA 4DELA 1QWGA 1KBKA 3QOMA 4Y2DD 2DBLH 3KOXA 4AQ8A 1DEEB 2ZX5A 4HF5H 1P48A 2XVKA 2X44D 4YR6A 3BT0A 4Y9FA 4TQEL 2DFAA 4ADUA 3O6MH 4QTHB 3TIEA 5CCJA 3MRNB 2E3ZA 1UZHA 1U58A 3F58L 5BWFA 2J55A 5CSUA 2AJZB 5C9ZA 2Y63A 3ARGC 3MXVH 3REQA 2VOMA 2BZ7A 1E6JH 4NNPL 1S9KC 2Y5QA 2DIKA 5AOZA 2Z35A 5E2JA 1Z7JA 3H54A 3HAEB 4N3UA 2RQ8A 4ELMB 2JFEX 1DVSA 4MYPA 4AZ8A 2ORBL 4LC6A 3C60A 1KDJA 4N2EA 4OJFL 3PTMA 3IXTB 3NTYA 1UA3A 4TL4A 3ZX1A 4DZ5A 3S1XA 3MLTA 3WO4B 1F74A 2WM1A 1AZ2A 2OJEB 5CJXA 4ANKA 4G9PA 4JRYA 2WHMA 1FWGC 1B90A 1Y18B 4YK4C 2JKRM 3NDZA 3NEXA 4E9TA 4WTQA 2FGZA 4K8RH 1S5WA 4MWFB 3GO2A 4XBKA 5HMFA 3O6DA 5CLZA 3W1TA 5I8EB 1TJHH 3EGSA 3B3IB 1DJIA 3VA8A 4JRWA 1DVTA 1R3RA 1U95A 4QXUL 4G1EB 2Z1VA 5HHPB 8FABA 1XLHA 2PO6D 1U8NB 5KSBA 3GBML 4HXAH 1OF2B 3IS1X 1E4WL 3CXOA 1BEXA 1Z9AA 2N3JA 1GOIA 3R43A 4A7GA 4GUHA 4L29B 2A3TA 4UU9A 3NJ3A 1P7QA 2IDSA 3EB3A 4DPCX 3RLSA 5F6IC 3OKKB 4XCEA 2EVHA 5DHYA 1OSPH 1QUPA 5AW9B 3M1BB 1UC4A 2VMCA 2DZPA 1F8MA 2DQIH 4NJAL 4UANA 5HI3C 2YBVA 4F5CE 3CMJA 3EPOA 3ZKNC 5EEUA 2W61A 5T3ZD 4PFEA 1BZEA 5T3ZE 2J24A 1NFPA 3K6OA 1T89A 3FYOA 3TBCA 3QO0A 4XBEL 2JXMB 3QFDB 2P5WA 4OZ4B 4S3DA 4FKHA 2A3EA 2XX0A 3MRKB 4XMVA 2Q7YA 4O4YH 1MFMA 1OGSA 1MMFA 4DLFA 4ZW8A 3JWDH 5KSUB 2NY3C 2OMVA 3DVNA 4PI0A 1TJ2A 5ABFA 5F0PB 5KETA 4YU1A 1R5IB 5D7IA 4PRID 1BYDA 1NCAH 4JTGA 1MNZA 1TVLA 1F1GA 2DQHH 1ODAA 2Q20A 2ZX9A 1RBOB 1CCZA 2GBVA 4A8LA 4OIBA 1T6BX 2ICEC 3RGVB 1AO7B 4NI6A 4X5XB 4PREB 4F80A 2YEZA 2DJLA 3FDWA 3IAGC 3H3PH 3U9UB 1TUPA 4HB7A 3O3AA 2LFGA 2QHRL 2Y1YA 5I6NA 3GG7A 4JFZH 3F6LA 4U7SA 1YMMA 3B1TA 5D8WA 2E40A 1LO0L 3MUGA 1FIEA 1DQIA 2RFXB 5DI8A 4WI8A 2R9RA 5D9OA 1DHPA 4X7CC 5I24A 2EPOA 3RU6A 4KHTH 3IBEA 5HMDA 3G5WA 1FSKB 1JPDX 2DPKA 1QFHA 2NXGA 3NAAH 4XZIA 3FO9A 1WX0A 2AGJH 5FCUL 4P04A 3ZOAA 1AY1H 5IKCB 1EQWA 5D05A 3H8NA 5CG7A 5CEZD 1FE8L 3E3QC 4WVRA 4L8CB 2QUUA 2CGZA 2PCYA 1FZOA 4AIZA 3O6LL 2MOQA 3FT0A 2PXYD 4C55A 1E0XA 3CVBA 5SWSB 1SJXA 4B5TA 2BVPA 1E4LA 2VDRB 4NBYB 2IPGA 3LENA 5ESAB 1A1NB 4NRYB 3QPYA 5IHWA 4S2SB 5I1CH 2WUBL 3PY9A 3HS0B 3P0GB 1CYXA 3SPHA 1OGGA 2IMRA 1IM3D 4C6BA 4G5DA 3TC3A 4NQVA 1UOLA 4DZ8B 3QUYB 4KRZA 4AE1A 1AD9B 5E00B 4H1LB 1HEJC 2XN9E 3E6HB 3UWZA 4Z7OF 4YAQB 3EXTA 1QXLA 2VSDA 1TQBB 2DQEL 3DN5A 4O2CA 2E5DA 4FKKA 4DCQA 1OHLA 4RRPA 5GRYA 3OR7B 1EQCA 4OR1A 5T1DL 1VERA 3L67A 1OSZB 2BS71 1U8QB 1J5SA 3QWOA 2BIMA 5GS3A 1OG0A 4YLQT 5JDSA 4JZJC 3FV9A 2VKWA 2ZP9A 4QAIA 5GZOD 1XL6A 5AKQA 5D7LB 3HG1A 5F9JA 1I1WA 3H9SE 3QARA 1QOQA 4EN3D 1SJDA 1P4CA 4LXFA 2BSCA 1MCRA 5C71A 5HJ3A 3MV7E 4W9TA 2OODA 4PLNC 5L2KD 2X6MA 4DB7A 5IFJB 1SOXA 5CSZB 4HS8L 5L2KE 1T1XB 3GS0A 2GABA 3QIWD 4GUPA 1YECH 3NCEB 3WEMA 2VZUA 1ROWA 4YJZL 4N6RB 4TXEA 3DDMA 4B5NA 3FJ6A 2PTVA 1KM1A 5JBFA 1I3GL 4H41A 1G6RH 5F71A 1NGQH 3VXMD 4UQ2B 2V7HB 2WJFA 1VFFA 1W54A 3QZOA 1NSNL 3QXWA 1JCVA 1P4IL 3GQYA 2YA0A 3SE9L 1E0WA 3I6KB 3H4WA 3HE6A 4GGBA 1KGXA 8PAZA 1F6FB 5AZ1A 3U6WA 1IMHC 2NY1D 2ARWA 4FR6A 3UJ2A 1CCWB 4S3FA 2FSEB 4MA3B 1GS7A 4K7YA 3HMXH 1KY6A 2LABA 4AF0A 3S1WA 2F1EA 3T4YA 4XNXL 5G55A 4ORIA 1V93A 5AVTB 1NWPA 1BQKA 2NW2B 4AM0A 1AGDB 1WDQA 4JQ3A 1YEIH 2BGQA 3FJTA 2F18A 4MA7H 2ZPKH 3VI3E 2ZFAA 1CD8A 1F86A 4U3AA 4JPIA 4OQ1A 3OJDA 4LVDA 2IDUA 1UG9A 1C5DB 4KVNL 3IETB 3VI4A 5BRZB 3QQ3A 4KPHL 3SO5A 4P2AA 1PW3A 3AGVA 4OI9A 1WJ3A 5LXXA 3ZE2F 4BZ2H 1E27B 3C2YA 3I65A 4U3HA 3GPSA 1FO0H 3FTWA 3MRGA 1OGAA 4PB5A 5CIPA 1Q0YH 1UB3A 1ZBWA 1TFHA 1MHHA 3NTCH 1FNSL 4NQDD 2WWNA 2RJMA 2AQVA 4N0YH 2Z6JA 5GRZA 4U1GC 1RVFH 5GGUB 2CE6A 3JWNG 3F2DA 3GU1A 4G6FD 3C52A 2J8GA 4UC5A 4FQXA 5AG8A 5CR1A 3S5OA 5CIPH 5D7JB 1D5XA 3TQ0A 3T77A 1A47A 5CCZA 2BMKA 3B9VA 4QP0A 1PX4A 5F9OL 5HANA 1OTSD 3DHJA 4TLTA 2A99A 3SFWA 3SQOH 2D03H 2RH9A 4E4FA 1MDLA 4UNIA 3PFUA 1W80A 4QRSA 4P8WA 3KP0A 4H9UA 3EYSH 4CC4A 1JWSA 4FIRA 5EMUA 4H9MA 4Q74A 3OO2A 4HIXL 4FQQA 1HI6B 4X6BB 3BHBA 1CU4L 4Y88A 5AVVB 1IAII 2VDQH 3PWPD 3BXNA 2MANA 3NIYA 5LIYX 2IADB 2X4PA 4DVRH 3GDMA 1TJGH 1D5ZA 4FF9A 5KSAC 1BVLA 1BYAA 3BP7A 5FV2A 3IJQA 3BG5A 3W1XA 3TP4A 1JMXA 3FUFA 4LAQH 5LJYH 3N5AA 1IBBA 1HFUA 3LN3A 4MA8L 2OQJA 5GISL 4GIRA 5EDSA 3UMTA 3GSNB 3ZMNA 1Q45A 2ZTJA 1TETH 2QV4A 2W0KA 2ZF8A 3UO8B 1IUZA 2VDLL 1HL5A 4FOKA 1TPWA 4BS0A 1ZS2A 1KBWA 5AW2B 4D6HA 3VWKD 4MFEA 2VLRD 3GW0A 4GKLA 4DKFH 3GY1A 4H83A 3OQEA 4KZEH 1MJ8H 2XFXA 3HB3C 2R56H 4NQQA 1GPOH 4XIMA 3KYOA 4EX4A 3D1MC 4XRCB 4FXSA 2HT4D 3JW7A 3SZ6A 2XQYK 4A04A 1A5BA 1OPGL 5CPNA 3TZNA 2XBTA 5H2BA 5AQ0A 3NQ7A 3EH2A 1BWWA 2V5KA 1J1PL 3P3BA 1WBJA 2GVLA 1PZ5B 3QULB 3TU6A 4C6NA 4KXAA 5FF6A 1T83C 4KO6A 3ESUF 3L7EA 1FGNH 3FVDA 1GS6X 1CC3A 4KJQC 5E94A 1JUBA 4MXQD 4DNLA 1OF6A 4KERA 2LW3A 1LK2B 4PBEA 3EX1A 3QC6X 4DETA 1EZLA 4HJJL 1WAEA 5A6BD 1OC7A 5EU5A 4QRRA 4MF4A 4ZBJA 4AVIA 1DLFH 3DX9A 2EVJA 3VZZA 2VN6A 3RGHA 3NGFA 3S9IA 1VJSA 4CL7A 4F48A 1C9DA 1VYPX 3SKNA 3MNWB 5M94B 4M6OH 1QVBA 2B1HH 3QUXB 3BLIA 2BLFA 2EG6A 4V1DA 1G7HB 3CAVA 4I87A 3VSUA 4B9KC 1A0DA 1OANA 4AEIH 5ABDE 1COBA 3I6RA 5EA0L 2GJ6B 3ERXA 1JD9A 2VDIA 5E2UL 1W15A 5ITBL 3WIFB 2FX8L 1VKXB 4XB8A 3GJFK 3PFQA 1OAXH 4PJ9A 1KM5A 5MKGA 1RLWA 2W60B 2ADIB 4ZSUA 3LS5H 5HYJE 3HLAA 1RAKA 3EJRA 2Q6ZA 3NJHA 3VD2A 3CAKA 2GY5A 4I5UA 2HISA 1G0YR 3ZR6A 2VABB 1RZKC 4LKCA 5JPNC 1KGUA 2ISWA 5CJQL 3KCOA 4XO7A 3HG0A 3UMNA 3NZHH 5AYZA 3AWFA 4AYFA 2KYIA 3FUMA 4LCWB 4LESA 4YGVB 1RZKL 2PABA 3WEBA 3FZUD 3V0TA 4BZYA 3IMWA 4QG6A 1DVFC 4LH8A 2QPDB 4R8WH 1YEJL 4TVCA 2BFVH 1RY0A 1CGWA 1RZ8A 4PG2A 1Q7QA 1XT5A 3UYPB 4UTJA 4M02A 3A4WA 2NYZA 1JPST 4PJGB 2G50A 4JYEA 4NT6A 5C55A 4F9LA 1BFOA 4IP5A 5A6AA 3MRRA 5GRUH 4OZGF 3RNQA 4F2MA 5ACLA 3U7AA 2HBVA 3TF4A 3WIHL 2VN4A 1RVGA 2IH1A 5DFAA 5INDA 3QPZA 1BZ7B 3OQ8A 1DQMH 2G8ZA 2KZHA 2H1XA 4ZQPA 5DCEA 3WJSA 4IBUA 4MKMA 3KBSA 4K23H 3UBXI 4ZFQA 4XWOD 4AC4A 3APTA 2Y36H 3WHXB 3ZRCC 5C07A 3FFCB 3TVMD 5B8CA 5IFAH 4OM1L 5HDLA 1I2NA 4NX0A 2HVKB 1J86A 2PWFA 3RKPA 1DJQA 1XLCA 3O2WL 1UWGL 1LG1A 4IBLT 4L5FE 1L9WA 4DKTA 2Y07L 4EACA 4RMRA 3F04A 1JEZA 3HZ3A 4C57C 5FHBH 4WI5A 4NSKA 4DAGL 3WKML 1FZMB 4QS5A 5GJMA 2Z1SA 2YHGA 3T3MF 3C5QA 3O9WC 2X70B 4IX2A 2Y5JA 3WE1A 1C1EL 3WEZA 5C6PB 3TTOA 1E71M 2NR6A 2C1PB 1FG2B 3IU3B 3FCTA 4ML9A 4F7CA 1E5ZA 2FB2A 1MJUL 2NY0D 3OGRA 1C12A 3ARED 1QDSA 5C7HA 4ZFZB 4FXJA 4WU5A 1SLVA 1NLDH 5ITFA 1IC4L 2NW3B 3PP3K 3QEGH 3BLPX 3ITTA 1R6WA 2YPVA 5JW4M 4QXGL 2XZ9A 3U2JA 1UQYA 1EC7A 4WDUA 5C0CD 2QPSA 4RE4A 5CPMA 4L0PB 4L4MA 3WBAA 4ZL1A 5C0CE 4K0OA 4L9LC 2VUYA 3DX6B 4Q4IA 5LA0A 3GS6A 3DTXA 3N6YA 5IROD 1AJ2A 2YPVH 3NP3A 4LAJH 2BOFX 3BH9B 3PBVA 4U1LB 2D4DA 4XZBA 1MFUA 4G9FA 3AZTA 1HKLH 1A02N 3T6QC 1C7SA 5C08A 3BCFA 4PBFA 2EPNA 6PCYA 1O7VA 3FGCB 1AGBA 2VL4A 4C6IA 3SY5A 4GKZA 3RAJL 4HOWA 2CAKA 1HYSC 1N4XL 3MBEB 3MSDA 4ZTPH 2ADFH 4EI5D 1W2KT 3PZNA 4PA8A 1XIDA 5DMGD 3ZKXC 4OH2A 1NQBA 5A3ID 2X1UA 3DETD 1US3A 4AYBA 3MREB 1YW1A 1RZFL 1RY7B 5CPQA 4C83A 1B30A 3JQOB 2VZ1A 4L3CB 4OF8A 3R13A 3OPZH 1CICC 1EF2A 1TTIA 4C6DA 3GMLA 5T1KB 2EIEA 2JF7A 2VM3A 1HSBB 4Z95H 3SDAA 5DQDL 1O12A 4R7OA 2XIIA 3TBSB 4LANA 3LV3B 1XL9A 2PUQT 4KEMA 5JW4N 1KWKA 4U6YA 3LNMA 2XZ7A 3R1GL 4LL9A 3CG8A 4OZIE 1P7TA 5DO2C 5BVPH 5C2BL 2GUOA 3OAZH 3P11L 1MEIA 5LLIC 1X7SA 2V17L 3Q4DA 3ECUA 4JTKA 2VDOH 4M1CD 1CVSC 2BXZA 1BWKA 5H91A 2WHLA 4JZOB 1NC2A 4LKXB 5TQ0L 2HRHA 4H01A 4PJ8C 1KC5H 1BZ8A 3PPCA 4OIIH 4P46C 1KPRB 1E5YA 5C0GA 1RA5A 2VZ3A 1EIBA 2XSXA 1VADA 5LNSA 4WD0A 1NAMH 2OELA 3FU6A 2IPKB 4ORGB 2F6KA 4Q4MA 4QOKB 2E56A 1VFMA 3I6LE 32C2B 5I8CA 3RR1A 2SEBA 4E68A 1EFZA 5HPOA 3CXFA 2EEFA 1LZOA 1QHPA 3NZPA 4A37A 1JCMP 2CCVA 3WN5B 4P2OA 3LCXA 4FOJA 4PRDB 4REQA 3W28A 5MEQA 4M7SA 1E4NA 4ZFOA 4X98B 3ZKMD 4YHYC 4JEGB 4XX6A 4DGYL 2DVUA 5E6IA 3BYYA 2CJTA 1K8DB 4PJIA 3T4AB 1OX5A 4DXKA 4GXWA 2I9LA 3BJ91 1JZ3A 2IMMA 3WL0A 2L7QA 5ALBH 3RL2B 3BUVA 3POHA 4MJIB 1P6FA 4KXZI 4DVBB 4R2GC 3LKOA 1F6LL 4N8VG 3TW7A 4ZOAA 5C9UA 1MCBA 1V3IA 3PHOA 1LRNA 1AFVH 3JVAA 5KVMC 3EXSA 1UM4L 4A7QA 2P76A 2DMHA 3W85A 2Y22A 3OPSA 1HJWA 2NY6B 2UZXA 3N25A 4ZMLA 1RA0A 3B6SB 5EB8A 4JFED 2R7EB 4X8GA 4N9OB 4N0FA 3HVNA 4L4OA 5K33A 4JGDA 4BBWA 5FOBB 1ONRA 1MO0A 5IB3A 4PJDF 4N8UA 1RUKH 1K4HA 6A3HA 4FLQA 3R18A 1NMAH 3QRGL 3FRPB 1M9HA 2VISB 2ZONA 4RIRB 3CWGA 1OAKL 1TYRA 2YB1A 3SFKA 1ELSA 1ZHKB 3FOLA 4ZR8A 1J01A 4IXXA 4JX6A 1KOAA 1D5IL 5E6UB 3GXFA 4M9PA 3KPSB 5AW1B 3NP4A 1U8LB 3GXTA 5TE6L 5IMLB 4ETQB 1NEPA 3EYQD 3OAUL 4CRPA 3RI5K 4JPVL 3WD3A 5I1GH 3CQ0A 3EAUA 4I7WA 3I6GA 1ZQ5A 3B9NA 1VC4A 2PUZA 3NVQA 1J9CT 5IB1B 3W0WD 3UGRA 3MKKA 2WJ5A 4WLCA 1CN4A 2LLGA 4J1OA 1OKEA 1A1OA 1REIA 4Z2HA 1Q38A 1R9YA 4B5UA 2YXGA 1P4LB 3QEUA 4HBCH 4K94H 1TPDA 4GG8A 1E9ZB 2HUHA 4ENZA 4KUZL 1ZGDA 2Y2YA 1OM0A 4XZMX 1QLEH 4O51A 3WTTA 4Q8BA 2ZQ0A 1MUMA 2XTKA 3CFCL 4U1IA 3NRPA 3EGXB 5HDBE 4OJEH 1NCJA 1DJWA 3QXAB 4G5AA 4YYCA 1M2VB 1WK0A 1F4WL 3BVNA 1CT5A 3VIKA 3MR9B 4O4WA 5BZXA 3INPA 1Y8BA 4MNQD 2X16A 4EXAA 1WZKA 2R1YA 1IEXA 4Z2LA 3VYOA 4MNQE 4JIEA 1FXQA 1XHGA 4WKHA 5D6CA 1TWSA 3U3HA 4W4OA 2K6WA 1UXSB 1ZP4A 1KCKA 4KQ3H 2BIPA 3CLFL 5FEWA 5BROA 1E7UA 4NENB 4YGAB 3EWYA 3SPVB 1QZ1A 1I4NA 1Z9MA 1JXJA 1NFIA 3WL9A 3QQNA 5GVJA 1HHJB 2R39A 3QM3A 4PJ5E 1F6AB 4C56D 3NMEA 3SIZA 5JIDA 3HJ0A 1VCFA 4C56E 1GYAA 1EFXB 3KR3H 5CD5D 2P8CA 5IY5B 3AWOA 4Z7VF 2GJXB 2X2UA 4NKMA 4IMEA 5DJ6B 1E9QB 3RZCA 5EUOA 1HC1A 4Y16D 3B2UC 1XRFA 4US6A 3IJDA 1RD6A 4WNJA 3SJVA 3BPLC 1A4AA 4OLVH 3QDGD 3QEQE 4Q89A 4ZEPA 2WZTA 1R0AL 3ZDZF 1MUJB 3QDGE 4YWGL 1Q8MA 5DJZA 5AB9A 5FEZA 1R3LA 4L1DA 2DT1A 4LALA 3QP3A 4PGDB 1RLDA 4G1MB 3WNPA 2P1YA 4L3ED 4HMCA 4WEBH 5HXMA 1HTIA 4L3EE 3P77A 3TN3A 4GAGL 2FHFA 2EIMB 4LVHC 3MMDA 4HZLA 2J6EL 1B2WH 4DUWA 2R1LA 2DY2A 3ULVD 4OV5A 2F54A 2JB6B 1XYMA 1BEUA 3NZRA 4XCNA 2X1SA 1X7QA 3TA3D 2AXJA 2WZAA 5DANA 3G5VA 4ZMXA 1PCWA 3FN0L 3KWWB 3WKYA 3W1ZA 3LCFA 1U4FA 3NJJA 5I3HA 3RPBA 4KOCA 1NGZA 1M7DB 5T33H 4OLWH 5E0CA 1YDNA 2E6PA 2OYMA 2QF8A 1BQHA 1TQCC 3IFNH 3C8HA 1TE1A 3DUHA 1QLRB 3W27A 1YMHA 3QNXB 4IOIB 2E0PA 2D0GA 2VB5A 2Z1PA 3MNVB 1FAIL 3RX5A 1GVRA 1OD8A 4JICA 2YJQA 3IIVA 1RQBA 4JTEA 2ZCKL 1JZ5A 4I90A 2HKHH 4EPKA 3JZEA 1ACCA 4DKEL 2AJVL 3V52H 5LIXX 1EMTH 4PJAF 3CYJA 3MLZH 1VBHA 2ZCGA 4F93B 2GGGA 4KWVA 1JUKA 2AKRB 1M42A 2XGIA 3NFUA 2XXFA 3MP5A 1KFBA 1F18A 4M3HA 1RZPA 3PL6C 4M3JA 3VJ6A 3QZEA 1AR1B 2EKCA 2CHWA 3HI5H 2EDOA 4AT6B 4HUMB 3GLEA 1J0JA 1CXLA 1FVPA 2A7BA 4PJXE 2NYYC 2LQRA 3LB0A 2ZZ1A 1U3YA 3QORC 2EE9A 4LGRB 1DQWA 5M03A 4MCYA 5GZND 3C9NA 2F58L 3S3SA 3DO3A 3KJ4C 4OCLC 3OF6D 4UM8A 3FTUA 3P9LA 1ETJA 4GYKA 4D2NA 3CHQA 4H5SB 4AVKA 1UZ8B 2FDSA 3DSFL 4R83A 3BOFA 5IOPB 1Z9PA 5D4JA 2YOAA 5F4WA 2V8ZA 5E5LA 3SQBA 3LN5B 1MYRA 4LBEA 4AEOA 3QG6A 5AAPA 4FNPA 1LO3L 1EAPA 4QE1A 3H7RA 5DZAA 1SFJA 4IPIA 5M95B 5FHAL 5DXXA 2YA1A 2O5XL 5I71B 2F7OA 3FJLA 3CVHA 1LE9A 1EYWA 3NQFA 2PWGA 2H7WA 3U6XS 2A85A 2N1TE 4XBMA 1MCLA 4U1NA 2CYGA 1SUJA 1J96A 5E2TL 1A7RL 2A4AA 2VD8A 4MX7A 3CVHH 5B7MA 1FRBA 4G6KH 1SN5A 4H9VA 3DHDA 1BBJA 4AM0Q 2QR0B 3DV4B 1OB0A 4R9XA 3R89A 4UMAA 2XQYA 3PV6A 5FYJD 3ATDA 2X6AA 5DRWA 4AUYA 4HTYA 4KROD 3NZSA 5FYJE 3HBGA 3NL3A 4A3HA 1TUXA 5E70A 4AIEA 1DIDA 1CTOA 3K81A 1FWAC 1GPWA 1NIAA 1ADQL 5B3JE 2DVXA 1W72L 3SSJA 2QKFA 3CIQA 2DBJA 4NU7A 1DUZB 3OLEA 3LHPL 5E0FA 3QJQB 4IRJD 1DDHB 2VQ4A 1LTXA 3EYFB 5J1AA 1EEXA 4NQCB