2QV4A

Human pancreatic alpha-amylase complexed with nitrite and acarbose
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 171
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qv4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qv4A01
3WDHA 3WUFA 2B31A 4J3SA 1WZLA 1W91A 3K8MA 2BXYA 4EE9A 4B16A 2ALWA 3WBAA 1FFRA 3CZGA 3MI6A 1QBAA 2YA1A 3WNKA 5I78A 2VZUA 3WY4A 1UKPA 2BHUA 1UR0A 1XYZA 5A94A 4J27A 1GVIA 3EJUA 1BPLB 2CETA 4H41A 2WM0A 1MQPA 3LRMA 1CXEA 7CGTA 1HKKA 1HF6A 4K68A 4CD7A 4NXKA 2JIWA 4P7QA 2QF8A 2VQTA 4FLQA 2CBIA 2VVNA 2W92A 4AZBA 2Z1KA 2AOSA 1GOWA 3MMWA 3AS1A 4A3HA 1BSIA 1QNPA 3I3EA 1E73M 1V6WA 1CPUA 2FDMA 2J74A 1MWOA 3VPLA 1RP8A 3SCQA 2XWEA 4W88A 4OJYA 3EJQA 2C0HA 2W5FA 3GNPA 3MV01 2ZUTA 4AD1A 1KWGA 1L8NA 4NX0A 3I3DA 1WDQA 1CDGA 1UKQA 4PMNA 3KEHA 1BHGA 2VX5A 1TFVA 1ESWA 4ACZB 1UR1A 3G6LA 4GXPA 1ZBKA 4U2ZA 3EMQA 3D4YA 1GQKA 5A6BA 2F18A 3L2LA 3K8KA 3A6OA 3BLKA 2XM1A 5A6AA 3BVXA 4AZCB 1NWSA 1HJQA 4GI6A 1FP9A 4HOXA 2GK1A 1ITCA 4LGXA 1HVQA 3WQ5A 4AMXA 4W89A 2O9PA 4JAWA 5EBAA 1R7OA 2YIHA 1EOMA 5A6JA 2X8RA 1G9HA 1P6WA 1MQRA 1WCGA 2OSWA 3PN8A 3QHMA 3VIJA 3DHPA 1KTCA 1IT0A 4PCSA 1E6NA 1PAMA 4URIA 1I75A 5CXPA 4FLOA 1Q6FA 5E6ZA 3LMYA 4GI8A 1YQ2A 1CBGA 1UWQA 1OT1A 3OLGA 3AYRA 8A3HA 3AIBA 3K4DA 5CJ5A 1EQCA 1KR1A 2DGAA 2X2YA 1V6UA 1B0IA 3I3BA 4XZBA 3AIEA 3AZTA 1EHAA 4B3LA 1SR0A 4P8XA 2BV9A 4E4PA 1QWNA 4M56A 3W25A 1NQ6A 1LL4A 3OGSA 1C3FA 2G3NA 1W2VA 4JZ5A 1E6SM 4W93A 6CGTA 2CXGA 2NSXA 3EBVA 3IAPA 2WCAA 4CU6A 1J0YA 2VZSA 1JL8A 2VZVA 1BGAA 1OSEA 2G4FA 1V3HA 4HU8A 1CGWA 1E4MM 5D4YA 3ZO9A 2VX7A 1I1WA 4U33A 1J9YA 4DO4A 3VDCA 4CCDA 1BYCA 3RM4A 2ZUMA 2IGTA 2ZWZA 2RGLA 2VC9A 3CMJA 1QNRA 4M82A 3VDBA 3OZOA 1RD6A 3N1AA 3TTQA 1MXGA 2VOTA 5BRQA 1EA9C 3DX2A 1PX3A 3ZMRA 2WPGA 4ATDA 3TA9A 2BHZA 4FMVA 2XFYA 3VUPA 3MMUA 4HPGA 2OWWA 4AC1X 5EFDA 4D6EA 4TOQA 4LYQA 4UOQA 1Q6DA 2UY5A 2PWDA 3BLBA 5I77A 3MUIA 1LG1A 3OIHA 3DC0A 2GJRA 1TQUA 2DSUA 5CPSA 2EPMX 3CZNA 3AZSA 5I3DA 3AHZA 2G3JA 3KLLA 3HU7A 3CUGA 2GJXB 4W7WA 3NIYA 1GW1A 4PMOA 1LJYA 2VUYA 1KXTA 1E6ZA 3FHQA 3SUWA 2QPSA 1AQMA 5IHSA 3T2OA 2ZUWA 3RM8A 1V0LA 2UWFA 3VVGA 3WH9A 3VGHA 4W87A 5D9MA 4BQ3A 3AIWA 1DWIM 3OGVA 2VCCA 3KWXA 1KB3A 3DHUA 3N12A 3ARZA 1OGSA 1UKOA 2WHLA 1JZ8A 2YL9A 2CCRA 1TR1A 3LPFA 4PMXA 2YA2A 4HA1A 2WVUA 2Y24A 2XFFA 5ABEA 4BF7A 4DO5A 3H54A 1OCQA 5M17A 1JD9A 3K46A 1ISZA 1J11A 3AMKA 2JF7A 2PBGA 2D73A 1XHGA 1PPIA 4ML4A 1WNOA 3CGTA 2GUYA 3ZJ6A 2CKRA 3NCOA 3VINA 4U31A 1GJUA 2EPKX 4V27A 5CPQA 2E8YA 2A3CA 5A1AA 1K9TA 2UY2A 5FIPA 1VEPA 1JXJA 3SCWA 1UR2A 1D2KA 4B9ZA 3SUSA 1GNXA 5FCZA 1ISXA 1ZU8A 3BAKA 4CN4A 1NH6A 4W5ZA 1HP5A 2JF6A 3JUGA 1NARA 3E1F1 1UWSA 1OD0A 2CITA 4DWSA 2DQXA 4CD8A 1E6QM 3CZJA 2DH3A 5EMYA 3VMOA 3L4UA 2YFNA 4ZFMA 4JFUA 4AZIA 4FNRA 1CGVA 4CVWA 4AZ7A 3ARYA 5GNYA 3AXHA 1NP2A 1HX0A 2D20A 1CNVA 2BVYA 1A3HA 2XM2A 3W82A 1E5NA 4GPNA 3MSGA 1UKTA 1BAGA 3FY1A 1H49A 3EMCA 2E40A 3HMCA 5A6BD 4TX8A 3EJRA 4GZEA 4P7LA 3ALFA 3BMWA 3WH5A 4MNMA 3PTMA 4CD4A 1VF8A 4H8UA 2YDSA 3PZOA 1AVAA 1OM0A 4JL2A 1R87A 1GZJA 3GXMA 3SEPA 5F7UA 3A3HA 3T0DA 4D1JA 3OZPA 3WMBA 3KL0A 1UQYA 1JDDA 1BYDA 5A69A 1HL9A 3VOCA 1BG9A 3ZT7A 3EJTA 4KRUA 5CSUA 4GQRA 1V3IA 2XIIA 2VR4A 1DHKA 4AZ5A 5I6SA 4C7DA 2UY3A 4MDOA 2WVTA 3GXTA 2XG9A 3W53A 4D6HA 3GXNA 9CGTA 1V0MA 1EHNA 5BCAA 2J79A 1H3GA 4HPHA 3RO8A 1J18A 4J3UA 5ABGA 5A8NA 1JZ3A 1H5VA 3SCUA 2VRQA 4ZENA 4D6FA 5JBEA 3D5HA 2ZX7A 4WF7A 2WMGA 2X09A 4BQ4A 3PZTA 1WDPA 4ACZA 1C8XA 1UD6A 3J7HA 3N18A 1U2YA 4UFMA 3BVWA 2OW6A 3MO4A 2JEPA 3WF1A 4W84A 3AIUA 2Y8KA 3MANA 3CZEA 1BYBA 4QCEA 3W27A 4UFLA 3VIHA 4AZCA 4MNJA 4LPCA 4AZGA 7A3HA 3ZQ9A 3WEOA 3VTRA 1JD7A 5M3WA 1GQIA 1WAWA 2WB5A 4AEFA 3QHNA 1BGGA 4BCEA 4RL3A 3CZSA 2PWFA 3PBGA 3EYPA 3VO0A 1JF5A 4B9YA 4NF7A 4WSKA 1E55A 3VDHA 3ZJ8A 4TVUA 4MNLA 2EEXA 2D2OA 1BVZA 5E6YA 1D7FA 4HZ7A 3GNRA 1PJ9A 3SCOA 5LA0A 5CG0A 3AHYA 1V03A 4CD6A 5KZ6A 1W9DM 1JFHA 1UWTA 2F7PA 1XD0A 5LA2A 1R47A 1UWRA 2OYLA 4XV0A 4CCEA 1V02E 3QGVA 5HBFA 4AYSA 2WMKA 4OIFA 1B3YA 4W7VA 1HT6A 3GXIA 2ZE0A 3WD3A 2VZOA 2WWCA 1E71M 1W9XA 4UQBA 3HG2A 2Q8XA 2ZXBA 2G8ZA 1FP8A 3A5VA 2XSBA 3SIMA 4HU0A 1CYGA 2X0HA 1AMYA 1JYNA 1J12A 3BUDA 4UQAA 2OWCA 2XTKA 2XSAA 1W3JA 3D51A 1E4IA 3BAWA 2EPNA 1FH7A 4E2OA 3WNOA 2FHCA 3WFLA 4PEEA 3VIOA 3CH9A 4GINA 2OYKA 5AC4A 4N0RA 1SZNA 3WNPA 4UCFA 4AWEA 4HTYA 1E15A 1QPKA 5ABFB 4C7GA 1CLVA 1UD8A 3NSXA 4JL1A 4TTGA 3IJ7A 4BQ5A 3KL5A 1UH4A 2O9OA 3ARVA 2FHFA 1ZBVA 4FNPA 3WQ6A 3GXDA 1W2PA 1C90A 4AIUA 2ZUNA 1MW1A 1UH3A 3ALGA 5I0DA 1W1VA 2X2IA 5AY7A 4AMWA 1I1XA 3SCNA 5A6SA 4UQDA 3LPGA 4QLLA 1B2YA 2CBUA 4AEEA 2VQUA 1KGXA 1TE1A 4AD4A 1ZBWA 2CBJA 3AROA 4PMYA 1J0IA 2GSJA 2J7HA 4JFSA 1DWJM 3W6LA 1VFOA 5ECUA 1QWUA 1HXJA 5BWFA 3HG4A 3PZNA 4UFIA 4A4AA 3DDGA 3WD1A 4AIOA 4M80A 4KRTA 4UNIA 1K9EA 2GJXA 5GQBA 1K9FA 1J0HA 1HJVA 2YDRA 4WK9A 3TP4A 1E4NA 1ECEA 4DWSD 3ARQA 3BXWA 1QX1A 4WKFA 3WMCA 1JZ4A 5GNXA 4R27A 3WEZA 5I5RA 3OLEA 2CKSA 2D23A 2IXVA 2MANA 1W1YA 4L4OA 2BVTA 3MSDA 1US2A 1FHDA 5A6KA 4AW7A 2YL5A 2VT0A 3CUFA 1ISWA 3ARXA 1E6PA 4NXSA 3DECA 4ZE4A 3D52A 4Z2IA 1W1PA 1OBAA 3LXBA 3B9DA 1C92A 5E09A 5BROA 5EFFA 4KWUA 2DIJA 2ZUUA 5A2AA 4NZJA 4FNQA 1B90A 4HOWA 4P7OA 1TQTA 3EDKA 5E70A 3AMGA 1ZB5A 3PTQA 4PYSA 4U5KA 2ZUVA 1XV8A 3AQUA 1C7TA 1PBGA 1WZKA 1HP4A 2GDUA 2XN2A 3GH7A 5A95A 2XYLA 1G01A 3N17A 4PTXA 1TQWA 2ZUSA 1M04A 5EB8A 1WKYA 1V6VA 1VBUA 1D3CA 2V3EA 4YPJA 1BG4A 5A6MA 3BUQA 3BVVA 3ZIZA 1JXKA 1GUVA 2YL8A 3LPPA 3EDJA 3W26A 1EDTA 4OOZA 3DDFA 1GVYA 2E9MA 4HOZA 1W3HA 2ZX6A 2WSPA 1DTUA 1JNDA 2W4XA 1UHVA 2WK2A 2WBGA 2J75A 2EO7A 2ZXQA 2VI0A 5TD4A 2Y8VA 4OZOA 1BQCA 4W7UA 3W37A 4W86A 6A3HA 3AXXA 4NRSA 3VD7A 3T2PA 2C8NA 4LYRA 5ABHA 2J78A 1B30A 3VSVA 1BLIA 4WIWA 5KEZA 4EANA 5A8OA 3PZVA 5A3HA 2CPUA 3A4XA 3VMPA 4UFKA 1UA7A 2BY3A 4Z2LA 3W4RA 3EJSA 3MV11 4PTVA 1E6RA 5BXPA 1US3A 1UQZA 4MAVA 1JI2A 3K8LA 4HP5A 4NSBA 2QPUA 1XH0A 4RE2A 1XH1A 2WZHA 3L4VA 5A2BA 1ISVA 1UUQA 2CERA 3TTSA 1QNSA 1NOUA 3RJXA 3VMNA 1OGGA 1VIWA 4L4PA 4D6CA 1YHTA 3CZLA 4PMVA 3VX0A 4PMRA 4TUFA 3ZM8A 3BCDA 1SYTA 2BFGA 2D3NA 1CENA 4GIAA 1W9VA 2WVSA 4JFTA 1JZ7A 5GPRA 1JAEA 4CVUA 3PZGA 3AICA 4D6IA 3NDZA 4ACYA 1JYVA 3WD2A 5GNZA 4PSRA 3VM7A 2WMJA 3IJ9A 1GQJA 2HVMA 4MNKA 3VGEA 4UOJA 1XSKA 2XN1A 2YFOA 4U2YA 1CGYA 2XVPA 2BHYA 2G3MA 2VCAA 1GORA 4HZ6A 4J3TA 3UR7A 2BXZA 4QCFA 5CLWA 1R7AA 1HKMA 4GQQA 1H0GA 4PMDA 5IFTA 2D0FA 2J7EA 2WMFA 2WLYA 1OT2A 5I2UA 3VDAA 2XIBA 3CPUA 4IPNB 1HVXA 3A4AA 5DT5A 5E0FA 1E1EA 2JEQA 1E9LA 4GO9A 1MXDA 1DWAM 2JALA 1E0VA 1ODZA 3BH4A 3ECQA 4YN5A 4JHZA 5I23A 2UY4A 1U33A 1ZBCA 3L4WA 2JE8A 4FLSA 2PWGA 4FNSA 1HJXA 3WD0A 5JUVA 2IXUA 3S5YA 3MUZ1 1CXKA 1EOKA 4MJ2A 1EGZA 1B3ZA 1V6XA 3WMSA 1JI1A 3APGA 3RDKA 1XSJA 3GH5A 1CGUA 3FAWA 3B9AA 1GHRA 3VIKA 3IK2A 3MMDA 4H8VA 2ZX8A 3BUPA 2CYGA 1CXIA 3QOKA 4D6DA 1QI3A 3UETA 1PS3A 1KGWA 1TZ7A 2J7DA 1M53A 1DEDA 2DH2A 1B1YA 3CHEA 1K6AA 5C8BB 2CBVA 2D24A 3A47A 1JDAA 1T0OA 3WUGA 2XVKA 1OD8A 4EAMA 2J7FA 2WMIB 4AZ6A 5DEZA 3AMCA 1GQLA 1CZ1A 3BCFA 3F5LA 3GZAA 4HA4A 3IGUA 2GJPA 4IPLA 1QI2A 4DUWA 1JGIA 3LX9A 2W62A 2NT0A 2D0HA 3O2LA 4AZHA 3AZRA 3NUKA 3DX1A 2XVLA 1DWGM 4A3YA 1GCYA 1UYQA 7TAAA 1GONA 4FK9A 2WBKA 3SCPA 4CUCA 4U3CA 2YOCA 1LF1A 4LQ1A 1UR9A 3IANA 3WDPP 5ABFA 3SCVA 1Q6CA 1UR4A 4YHGA 3BVUA 2DEPA 1WZAA 4GO8A 4PCTA 1J0ZA 4IISA 5JBFA 5D9PA 4AISA 1LWJA 4P7RA 3CLWA 2G3IA 2JFEX 3B8SA 2XWDA 2ZXDA 1WB0A 2ZOXA 1UOKA 5D9OA 1OIMA 5AYIA 4CN1A 2V3DA 4AMCA 1EXPA 3T08A 3PZQA 1HTYA 2E9BA 5FL1A 1WDSA 2WVVB 2VRJA 1C91A 1E43A 1X6LA 1G5AA 4LYPA 1JF6A 1CECA 4BA0A 4B15A 5DF0A 1XD1A 1ODUA 2J4GA 3VNYA 3SCTA 1TCMA 2VL4A 2WC7A 2D22A 5HXMA 2WXDM 3F4VA 1RPKA 2V5DA 4F8XA 1R75A 1HJUA 4UQCA 3M7SA 2JIEA 1H11A 5CLTA 1O7AA 1UA3A 2XJ7A 3WEMA 1GOMA 5HOSA 3BGAA 1E6XM 4UOZA 3ZOAA 1MQQA 4GI9A 3DYPA 1HWWA 1E3ZA 3BSGA 1ZL1A 3AHVA 1BVNP 1JZ6A 4WSJA 1QNOA 4X9YA 4JHOA 1W3KA 4J3VA 1KFWA 4TX6A 1WE5A 4J3XA 2O9RA 1V0NA 4GZJA 4IM4A 3AMDA 2PC8A 3VGDA 3BAIA 2FGLA 1HJSA 4NI3A 2W63A 4EKJA 3WF4A 3T09A 1G1YA 4D1IA 3AHTA 3FHAA 5E0CA 3WDRA 1W3LA 2WHMA 3U5UA 4WJXA 2O9TA 2WZEA 2CEQA 3UR8A 2ZIDA 4QP0A 1CGXA 4UZSA 3VD9A 2WYSA 1EQPA 2F2HA 2PWEA 4P8VA 1KGUA 4IUGA 4JIEA 1JNEA 3VIMA 2WKGA 4JFWA 2WW5A 2NW0A 2OSXA 1NOWA 1EH9A 6TAAA 1KCKA 2G41A 3PZMA 1W9UA 2ZWYA 5A2CA 3VGGA 1CIUA 3AMLA 1JDCA 1TA3B 3N15A 4AD5A 1XRVA 4P8WA 2J7CA 2J47A 2VZTA 3WD4A 4RE3A 5E9AA 1E70M 1TMQA 4ATWA 4M8UA 2WANA 2WC4A 2E4TA 2QHAA 3HN3A 5DMYA 3H53A 2YJQA 3WQWA 3GXFA 1MFUA 1MW0A 3B9EA 2ZX9A 3MUY1 1M01A 5HPCA 4UQEA 3RJYA 3VIFA 2X1IA 4CU8A 1E5JA 1KBKA 4Z2KA 3VX1A 4PUDA 5A8QA 1BYAA 4UFHA 1J0JA 3UERA 4C7FA 1NWRA 1L0PA 4H04A 3A22A 5DFAA 4HMCA 4PTWA 1H1NA 1DWHM 1E0WA 3CC1A 1Q6EA 4Z2GA 2AAAA 3ARUA 2NT1A 4GKLA 2PB1A 2FGZA 1VJSA 4YHEA 3KZSA 3CZ8A 3OLIA 1QHOA 1M03A 3WF2A 1JZ5A 1QNQA 3WN6A 2GFTA 1E40A 4B3KA 4JKMA 4QLJA 3CBWA 4H2CA 5FKYA 2EABA 3WIJA 4J3WA 3U7BA 2BVDA 3ZT5A 2X2JA 1CTNA 3A4WA 1W32A 4KMQA 2J62A 5IXEA 3DX4A 1SMDA 2XGBA 1JFXA 1QBBA 1TQVA 4FLRA 1PZ2A 1HXKA 5CZKA 2EJ1A 3BC9A 1PEZA 2W61A 2WMHA 4ZE5A 3LRKA 1G94A 1KBBA 3WL1A 1EO5A 1V3JA 2Y2WA 1E1FA 1VFMA 5JBDA 3ZSSA 1QHPA 4J28A 3II1A 4D6GA 3AIVA 4U5IA 1VRXA 1E4LA 3IAQA 1PX4A 4JFVA 4PTMA 4JCMA 3VGBA 3VD3A 4DUVA 1LWHA 1PZ3A 4PN2A 3AFBA 4AIEA 2WCSA 3PHAA 3AXIA 1XC6A 2EQDA 2OSYA 3SUVA 1TVNA 1CXFA 2J77A 1GJWA 3ZT6A 2VURA 1B3XA 2QMJA 3VGFA 3QOMA 3KLKA 2WNWA 3OBAA 3T2QA 4DWSC 2VRKA 3AS0A 3WKZA 2WAGA 1UD4A 2CNCA 4HMDA 3WH6A 3TTOA 4NRRA 2YL6A 5C70A 1HJWA 1LLOA 3AOFA 3WUBA 3VSTA 5CGMA 5BXTA 1X1NA 3M46A 5BYWA 3G6MA 4ZXLA 1XCWA 1UASA 1HKJA 4FNTA 3WUEA 1LL7A 1LQ0A 3WF3A 2FH6A 1UWUA 3FXYA 1Y7VA 1OINA 2PF0A 2W67A 4QDMA 3POCA 5FL0A 3DX3A 1UH2A 1UZ1A 4DUXA 3W24A 1KXQA 3DX0A 3EDDA 1VB9A 1WDRA 2A3AA 3L2MA 4AD2A 3VIPA 4D6JA 3UESA 3ARSA 3AI0A 1SFSA 3BAXA 3U5YA 1WO2A 3D4ZA 2WMIA 1E0XA 2D0GA 3M07A 3WENA 3OA5A 4OBRA 2F61A 3W38A 1UD3A 3UG5A 3ZR6A 2BNJA 2WC3A 3T0BA 3O6AA 3LRLA 4V2XA 1CXLA 5AC5A 3THDA 3U57A 1MYRA 3MU7A 1KCLA 2DPEA 2Z1SA 2BY0A 1FH9A 3WNLA 2OYMA 2QMKA 2XUCA 2F1AA 1HIZA 4M81A 1CXHA 1B31A 4W8AA 1W1TA 5AYBA 3WDJA 3BUIA 3ZR5A 1GOOA 4JKLA 1EIBA 1UWIA 1XCXA 3D3AA 4XUYA 1F4HA 5CSYA 3CUJA 3DYOA 4UFJA 4HZ8A 1B3VA 4UR9A 3LXAA 2V3GA 2YA0A 2OLHA 2YKKA 3HG3A 1NOFA 4NZFA 2WCGA 1J10A 3N13A 4AYGA 1GHSA 4LX4A 2F7RA 4D72A 1WP6A 2Y5EA 4UQ9A 1QVBA 1R8LA 4WKAA 2EADA 3GH4A 3WQVA 1JYWA 2VTFA 3BUBA 2WZIA 2DSVA 5M5DA 1NP0A 2WHKA 1XGZA 2WVVA 4LXFA 2V3FA 5LA1A 1O6IA 4CKQA 3HJEA 3IJ8A 4KH2A 2D3LA 3AS2A 3VILA 3MKKA 2J25A 2XGIA 1E56A 1PIFA 1R34A 1XH2A 3WH7A 5HDRA 1B9ZA 2E0PA 3BSHA 2CHNA 1VJZA 1UD5A 2A3EA 1GPFA 3W28A 1E3XA 1ITXA 1UKSA 3OLDA 5DO8A 4BQ2A 4HMEA 1MVYA 2DT1A 1FH8A 1IV8A 4MB4A 3AHXA 4Y7EA 3BMVA 2DIEA 3EDFA 3WFZA 3PZUA 3GXPA 2EBNA 4W8LA 4HA3A 4BS0A 2J8FA 1UZ4A 2VJXA 1OGBA 3VIIA 3BLPX 4JCLA 4S3KA 4AY1A 3CV5A 1CGTA 1Q4NX 4XZWA 4PSPA 1UG6A 2EPOA 2XHYA 1KQZA 2WHJA 2XN0A 2VMFA 1ZJBA 1QOXA 3L4TA 3L4YA 3FAXA 3L4ZA 1QI5A 4W5UA 1TG7A 3WNMA 4F79A 4TXEA 3ZJ7A 1TQSA 1Z32X 3U7VA 3WSUA 2FYVA 2DT3A 3OGRA 3WL0A 1BFNA 1HKIA 4DM1A 3A23A 3WDIA 3GNOA 1KXHA 5IFPA 3NDYA 1LG2A 5HNNA 2VNCA 4MAZA 1FFQA 3CUIA 3F5KA 1DP0A 5BRPA 2DT0A 3TTYA 3GBDA 4CU7A 1FA2A 3CHFA 3GTNA 3CTTA 3KE0A 2EPLX 4CCCA 3TONA 2VR5A 2J7BA 2PWHA 1AQHA 3F5JA 3UCQA 3CUHA 4W8BA 3N11A 4PUEA 3EDEA 1TA3A 1RP9A 1OB0A 2FE0A 5BXRA 2VVSA 2GDVA 3ARWA 4PMQA 4QLKA 1LL6A 4NZCA 3VSUA 3CHDA 5A8MA 2E9LA 1JIBA 5I79A 3SURA 4X0NA 3AISA 4M24A 8CGTA 1KQYA 1VENA 1NM9A 3SCSA 3LPOA 4S3JA 1OWQA 3S2CA 3WY1A 3RILA 3WY2A 4KGJA 3RIKA 2CESA 1CEOA 4CGTA 1R86A 2DT2A 5E1QA 1V3MA 1XYFA 1AQ0A 4XX6A 2W91A 1BTCA 3AJ7A 4RE4A 3GDBA 3RCNA 3D50A 4PMZA 4OOUA 1JYXA 3AYSA 2F7OA 1NWTA 3AS3A 3EMZA 4F9JA 2QLYA 4J7RA 5LYRA 1CWYA 3N04A 1QI4A 3KL3A 3HZ3A 4M1RA 5FD0A 2BS9A 3POHA 3VNZA 4XB3A 5HPOA 4QFUA 2GK1B 5A6LA 1GOQA 2A3BA 1DWFM 1F4AA 3W6MA 2PI6A 2FH8A 1R46A 1Q6GA 3CO4A 2VX6A 3BVTA 3PTKA 3PZIA 1MW3A 1PIGA 1EO7A 1N82A 1SMAA 2XPKA 3VU2A 1IZJA 4AXNA 1KXVA 1C7SA 3WELA 1KWKA 3RPMA 3VKKA 2DSZA 4AD3A 2F7QA 3TV8A 3FW6A 1H41A 3ZJKA 2XVNA 3WF0A 1HL8A 1FOBA 2J8GA 2OWXA 2V38A 4H8HA 5CPTA 1H09A 4MADA 1CLXA 1E72M 1ZJAA 4MJ4A 3BAJA 4UTFA 4Z2HA 3CMGA 2ZX5A 1XSIA 4U3AA 5IDIA 4EK7A 3WQ8A 4E8CA 1VEMA 3HG5A 5BXSA 2PBOA 2YBTA 4Q7NA 4OGZA 2QV4A 1S46A 3FN9A 3ARPA 1TUXA 1X6NA 4ATLA 2VCBA 2GVYA 3AIQA 3W29A 3QR3A 1QI0A 3GYCA 3M6DA 2AMGA 3MS8A 1J01A 4X0VA 3DYMA 1RH9A 3K4AA 4PMUA 3NYDA 4E8DA 3WQ4A 3GBEA 2YLAA 1HNYA 1V02A 4MB3A 2CHOA 2O92A 3VD5A 2J7GA 3W0KA 3TOPA 1QW8A 4TVDA 1ISYA 2HISA 4CD5A 4Q22A 1VEOA 2VO5A 4R5EA 1FHLA 1U30A 3NSMA 1R85A 5I24A 3CIVA 3VM5A 4OUEA 1V08A 5D8WA 4FNUA 4JKKA 1MFVA 3L4XA 2WSKA 4Z2JA 1WZMA 3EJPA 3WBEA 4OBSA 4OKDA 3LXCA 1M7XA 3BAYA 2BY1A 1K9DA 1H4PA 1V0KA 3THCA 5JIWA 2X0YA 3A24A 1A47A 3SUTA 1EDGA 1EDQA 3S6TA 2E8ZA 3UEQA 3RM9A 1J0KA 2Y4SA 4N42A 5IHRA 4P8UA 4GZIA 1KTBA 4BZYA 1W9BM 4H7VA 4V28A 5D8ZA 2YBUA 1C8QA 5JIPA 2IUZA 4F66A 3WH8A 1PX8A 2EXOA 4FF5A 5M03A 2ZICA 3PZ9A 2V5CA 2WWDA 2ESCA 3CHCA 4MB1A 3OG2A 2C7FA 3A21A 1VFUA 3H55A 4KGLA 2DSWA 3CZKA 5FOOA 2WLZA 2XVGA 2E3ZA 1MW2A 3FNDA 4D71A 4ZXOA 3S5ZA 1H0IA 1UR8A 3VIGA 1WPCA 2EACA 2FHBA 5DT7A 3WY3A 2TAAA 1B3WA 2VX4A 2YLLA 4MPKA 1JAKA 1IZKA 4TVCA 2BY2A 4MTVA 4M29A 4TTUA 2A3HA 4W85A 1QW9A 4MDPA 1ZS2A 3WDQA 3VD4A 5C71A 1JZ2A 3UG4A 4DM2A 1GOIA 3MUAA 4P7NA 4ZEPA 3AIRA 3T0AA 1QHZA 5CGTA 1VBRA 3RMEA 1W9PA 5A8PA 3SCRA 2DDXA 3SUUA 1V3KA 1V6YA 3W81A 4QAWA 1O7DC 2WKLA 2XFRA 3ARRA 4F9DA 3NJ3A 2YDQA 1TVPA 2RGMA 3OB8A 5D9NA 3QHOA 1OIFA 3NSNA 3ZSTA 2F8QA 3O9NA 4MB5A 1VAHA 4DWSB 3GM8A 2CIPA 5CQ1A 3N9KA 3K1DA 1KR0A 2ZXAA 1JG9A 2EAEA 2DSKA 2X2HA 4UZUA 4DO6A 1C93A 1HN1A 1V3LA 4WLCA 1H2JA 4CN6A 1UD2A 1GOKA 3ARTA 3UG3A 1R33A 1BF2A 2OW7A 2W66A 1NWUA 4AD0A 1G0CA 4PRWA 2D1ZA 4WKHA 2X05A 4PBGA 3WNNA 1C8YA 1VFFA 2F1BA
chains in the Genus database with same CATH superfamily
1UW9A 3WDHA 2KZ1B 4KTDL 4B16A 4BH8B 4I7VA 5EB9A 3CL8A 1PCWA 1DQMH 5I78A 4UDUB 3VI3B 1M7JA 4DWHA 3MCKA 3EJUA 1X5GA 3BOXA 1YNPA 3F7KA 1TEGA 1CWVA 2DZAA 4CD7A 2FPTA 4OF7A 4HG4K 1OCNA 3A4JA 3A6BL 1AFVH 3QHFH 2VC7A 1N0LA 1N3NA 3SKJL 4Z18A 4N1EA 2IFFL 3FBKA 4PJDF 3P3SA 3WXWH 3UAJA 4IIFA 2FPYA 2OL3H 3WLHA 3LKSA 1KWGA 1L8NA 1JPHA 4YE0A 1PHQA 2A6IA 4QDGA 4AVHA 5DJ0A 1A3LL 1IGJA 4UV7H 5A6BA 4YDJB 3S5SA 1Q63A 3BVXA 3FTZA 3ZKMC 3QMSA 4FFWC 3M45A 2X1QA 2Q3AA 3F58L 5LHDA 5IWLA 1INDL 2X8RA 4NQCE 2CIKB 3PN8A 3N85H 3DHPA 3DIDA 1V10A 2Z6JA 1FDJA 4JS3A 5HJBA 3BESR 1CBGA 5DA4A 4KPHH 3OLGA 5IKCB 3S8HA 1V6UA 3MBXL 1AJ7H 3L1OH 1IL1A 1Z69A 4L48A 4YYFA 1G9NL 4PG9A 1LRTA 4FFZL 2DQ6A 1UB5A 1IEQA 1RMFH 1WFOA 1C3FA 3BJFA 3MROB 2ZC8A 4FOJA 4E8GA 2O5ZL 4B27A 4HD5A 1GGOA 2W5PA 1JL8A 4JQIA 1EJVC 2J4WL 3LQLA 4YGAB 4ICMA 2A2IA 4YHIA 4ENED 2W3ZA 1O75A 2DW7A 2K9UA 1DE6A 3VRIB 3TN0B 1E51A 2J8UE 1KULA 3MRFB 4UTAL 1BFOA 2W6RA 4NGHH 3BKCL 3V9FA 4ATDA 4FMVA 5FYJU 3UTOA 3EYQD 1ZSDB 1FNHA 3L45A 3W70A 5I77A 1J93A 5CU5A 2L5HA 5CZVH 3EOBA 4DF0A 3M0MA 4PRRA 2IQAA 3EOYG 1G7PA 2RHEA 5G1TA 1E2VA 3H0TB 3HE6C 4PMOA 5ENWB 4OKVB 2WBJC 5KG9A 3RM8A 2UWFA 3GJFB 4DP0X 2DW5A 4MNHA 3U2IA 4PJIF 5CZJA 4MCNA 3OAYK 1NCDH 3VXMA 3KWXA 4WI5A 2NR6D 1RHHB 3OJDB 4UB9A 3DHUA 4LAOA 1JZ8A 2VABA 2QCCA 3B3BA 1A0QH 1JP5A 4BF7A 4DO5A 1F8MA 3KPPA 5HJYA 3Q45A 1BVLA 1WNOA 1OO2A 2IV9A 3MLVH 4R3UA 3MCOA 2F19H 2A3CA 4F7KA 5DUJA 3KOFA 2BZ7A 4OU1A 3VFTB 1Q72L 1ISXA 3BAKA 4XBGB 2YYUA 2JWYA 2DTMH 4YBLB 3V4LA 3UJTL 1SO3A 2DQXA 3EOSA 3Q8FA 4MY8A 3BW2A 3IWPA 3Q1SH 5C0IA 3P2DA 1PNDA 1DJSA 1M7IA 1SR9A 3EO9L 5ILTH 4DQOH 5JHMA 1BAGA 3FY1A 2CXKA 4JFZL 3NEXA 4JN2B 4K1GA 2DM7A 4ZQTA 1G6RB 1YDNA 1PY0A 4UMBA 2GAZA 3RY4A 3LH9A 3U0TA 4JFPB 5F88A 2JB5H 4DHLA 4AEIH 3SQRA 4ZFFB 4DJED 2A1WL 3GXMA 4I1PA 1FCQA 4D8PA 4B5SA 1JDDA 2V81A 3KBPA 3HPLA 1I1AD 2P24B 3JRKA 1QO2A 1DXEA 2VR4A 4R5TA 1XGTA 4KUZH 2VLMD 3GXTA 2C9AA 2J79A 4DKTA 2F84A 1M7DB 4JKPL 1JJUA 4GRLA 2NX5A 2HWZH 4CQDA 2H2PC 1DVXA 1K70A 1L9TA 1GPOH 1JGEA 1JCJA 3QIBB 4XC1H 5AAMA 7A3HA 5DD0L 3B56A 1E7VA 3JXAA 1P7TB 4S1DD 4K94L 3G5XB 3U2CA 1GGTA 4TNVK 4H2AA 3M0ZA 3FQ4A 3BDYL 3OAUH 1C08A 5IBLD 3CQPA 3NAAH 2VQ4A 4G8GE 3IU3B 4QRFA 1NUDA 1H6EA 3QGVA 1YNLH 1B3YA 5HGHB 4YFLF 1HT6A 5I15L 4IRJA 3GXIA 2JCCB 1P6AB 5TBOA 2CKBL 3LZ3A 1R3SA 1A7RH 4HU0A 1J12A 2OWCA 3SOBL 1H3WM 2DMGA 4NNXB 3CH9A 4IGNA 1AW2A 1SZNA 4JLRB 1TVLA 4PJFA 1IJNA 2H32B 3ELFA 3NSXA 4WU7B 4JL1A 1IKOP 3IKCA 1HEHC 3CV2A 2OJEA 4HUUA 3HQ1A 4J3ZA 4YLQT 5FO9A 3AALA 4Y2DB 3ALGA 1U3JA 4IGBC 5I0DA 5JPNA 4AMWA 5AHMA 3VFSB 3UXIA 1QCWA 3N2XA 3IE4A 4CADA 4UV4H 3E38A 1PSKL 3L95B 4MCMA 1DWJM 2VELA 2NLJB 4PB4A 4X6DA 1GK8A 1YDPB 4EZMA 5DR5H 5C08D 3VA2C 3PP4L 1CG9B 4DWSD 5LXVA 3BXWA 4EDWH 3OSKA 1D5MB 1KM3A 2H32H 4X9IA 3IIZA 4G3YL 3ABMB 5JIQA 1WRFA 5DD5H 5HA7A 1XIEA 4QKXB 5IB2A 3W9ZA 3N43B 4PRPD 1E4KC 2O7QA 1WTLA 2RH9A 3N6HA 3A4EA 3SDXE 5KN5A 3REWB 5KBDA 1IXQA 2BZDA 1OQFA 3IGKA 2B4GA 1O5QA 3HEIB 3KP0A 3DI0A 5KSWA 2NY5C 4IOFD 2VEKA 1V6VA 1LBMA 4Y88A 3BVVA 5DUMH 1EAQA 3G08B 1B4RA 4LF3B 1AYRA 3HR6A 1OPGL 1SRDA 4NNAA 3KCPA 3O81A 3DX9A 3CQQA 3T42A 1T89C 5L4FA 1LLZA 2P28B 1GKQA 1XLBA 1V6TA 4RGNE 4S3DA 2WJ7A 2WXHA 4L4VB 4W86A 3VD7A 5I16A 2C8NA 1BX2A 4F33B 1LWRA 4KEVA 1AW5A 5KEZA 3PZVA 2BOBA 1N8OE 1HE7A 5LNDA 3RPBA 1R5VA 5IF0B 3W4RA 2P47B 1E6RA 1K8YA 3KCJA 4GFSA 4XNAA 4HP5A 5C3TA 5KZMA 1TT6A 1MXSA 4XZNX 3RRAA 1NIDA 1NOUA 3LNHA 2DIBA 3VWJD 3PJSA 2DWDA 4KKBC 3ZM8A 4LBRA 4EO5A 2BFGA 4IIQB 1W9VA 3FOKA 4MRCA 5HHOA 1PZ5A 3NDZA 2EYSB 3DUUB 4PP1D 3WD2A 3BWSA 4PSRA 2DZUA 2WQWA 5HYSB 2WMJA 3TYDA 5FXCH 2CDFA 4G9FA 5IEKB 4J3TA 5C07E 3S37L 3TH4T 4Z1BA 2VWEC 4JYEA 1SSGA 3SGGA 2V7HA 3G1VA 1X5ZA 2CU0A 5D1XB 2JALA 2BOLA 2VQ1B 2V2TB 4H8WC 1SFTA 5AYUL 1U33A 3NZSA 4GKNA 3ARGC 5HHVH 5IT2L 3MUZ1 1NC4A 4M6QA 3FTXA 1R3JA 1D5RA 1J1XL 2WB1A 2IAMD 3BH9B 4QRNA 4V2CB 3BUPA 3QH2A 4QTHB 2R69L 1M53A 4X3ZA 4LRNH 1TJGL 2FO4A 3W07A 3ZWSA 4ZG1A 2O6FA 4ACPA 1MHPL 3T8VA 5DEZA 4F2TA 5C0JB 4O1BA 3N3TA 1CZ1A 3BCFA 3UPMA 4MA8L 4Y4KB 4H2HA 1FTXA 4WFGE 3I02A 3OKOA 3HBPA 1RZJH 1DDTA 3W7EA 5I1CH 1GCYA 1UYQA 3PAUA 4FK9A 5FDWB 4UZGA 4N0UA 4U1LA 3GBMH 3HC0B 3JW7A 3W7QA 4KY2A 3U2ZA 1ZSXA 3KR3H 2IPKA 4F15B 4JTHA 4YJZL 3NJMA 1UZ8A 5CD3B 1T1WB 5C6PB 2ZXDA 2WY3B 5HGDA 5I1EL 2F6AA 3EO1A 3WEXA 3V5FA 4HWNA 2FIKB 5FL1A 2BC4A 5IG7A 4XHJC 4OV6F 3F3HA 3L3JA 4ZODA 5TDOA 4B92A 4FQ2H 5D7EA 3K2KA 3WKQA 1HHHB 2ICEC 3T1FA 1KBJA 4V33A 4N85A 3RLUA 1NIUA 1LLAA 3FQNB 4PN6A 4NQED 5J89A 5HGBB 4M1GH 1AXTL 3HNTL 3IUDA 1SBBA 3WIIH 1AKJD 2Z7WA 1GVRA 5DC0A 3W7LA 3EHBC 1MQQA 5E2JA 3DYPA 4K2SA 1UJTA 3LZPA 2DQHL 1B0WA 4X9YA 3WFHA 1IIHA 3HE7C 3HN8A 4R3SA 4J3XA 3AMDA 3CDYA 1W3LA 3BYYA 4NKOB 4G6FB 4QP0A 3KDMA 2C3HA 4XNBA 1GGIH 2BS8A 2PPCA 2PZ0A 2F2HA 4DGYL 1NDZA 3IRPX 2NW0A 4CNIA 1KCKA 2G41A 5IUCA 2XETA 4NT0A 3SDCB 4AD5A 3FN0H 1EUNA 1W8NA 3WD4A 4U28A 4EACA 3FFCE 1HQ4B 4BK8A 2WANA 5JHDE 1XFCA 4I90A 4ZFZB 1JCNA 1LO5B 5J06A 3FQRB 4I85A 3FRUA 4FHBD 3QAZB 5EIVA 1FG2A 3I75B 4PUDA 3E2SA 3QIUC 2PO6B 4JHBA 1D9KB 2KH2B 5B3JF 3SY8A 1OGAB 3DHDA 3M5YA 2BPBA 1YEDA 4S1FA 1F1DA 1XSOA 3GXUB 3NPSC 3SBQA 3O4LB 2J6WA 4G11A 5AYQA 5IXEA 1VRDA 4IPIA 5C0BE 1PZ2A 2FJGA 1S2EA 3BC9A 1I9EA 3GT6A 1OZTG 4Z3EA 1DBBL 1CGSH 4AY8A 4JBRA 4J28A 4UAOC 3ARDD 3CFUA 2Z7GA 1Y1DA 1YYMH 1FE8H 4JCMA 4O4YL 1AHWB 1MLBB 3CE1A 5T3XH 1KENL 3KJ6H 4HTBA 3IVSA 4Y4HA 3AXIA 1E4XH 2XTLA 5BS0B 3QFJD 1GJWA 4CMHC 4XB8A 2Z29A 2YBRB 4GB9A 4BK5A 3KLKA 3KPMB 2CNCA 3OVGA 4K3HA 4QRAA 4HMDA 4QXTB 2D03H 1JQVA 1WV2A 4ADIA 3TBTB 2OMTB 4HUVB 2E75C 3G6MA 4Z7UE 1UOVA 4NYYA 3HUJB 2XTJB 3BEWB 4F7PB 2PDCA 5DRNB 1QRKA 3PR2A 4E5XA 1DQDH 4LIQE 3AI0A 4DHGA 1HO1A 4JDZA 2VN3A 4ADTA 5D1ZD 3X12A 4DCQA 5HMFA 4M7SA 3PWUB 3MU7A 4YHZH 3R0NA 4LVOC 1B31A 1ILSA 3HKFA 3D3AA 3K6SA 4MYAA 1XEDA 3CQ0A 4BH7B 5IM7A 1PTAA 2V6AA 1MHCA 4OGAD 4JFDB 3SZ6A 3TXVA 2VR6A 4G70B 4IP5A 2ANUA 3KM1A 5EO9A 4AX3A 4ZFOA 3QYCA 2XIOA 2RHGA 3DZ1A 2H26A 5C2XA 3SPHA 3IJ8A 4F8OA 1UT2A 2XQ0A 3IJEA 5DFWH 3BJSA 2HT2D 3RHWK 2XPYA 1H5BB 3II2A 4LDEB 4JQ2A 4NPKA 4GG6B 5HYJE 3PL6A 1T80A 5C0GB 5E2UL 3WFZA 2PXYB 1B4EA 5EBWB 4A67A 4URKA 1AD1A 4I0CC 2A0LC 1AY1H 1TTAA 4Z7VB 1S78C 4ZXBD 3VD2A 2V4LA 2YPLB 1ZJBA 1IZCA 4Z7QE 1QHQA 4W5UA 2XWTA 4TXEA 4QRUB 1MG2C 3OVRA 5GVJA 1ZT7B 3VXRA 3RNDA 1T1YA 3L0GA 3DPDA 2X9YA 2QQKH 3NDYA 3HFMH 4HD9A 4XPFL 2E7LA 2ODOA 4QDWA 3GHEL 1BQUA 2Q6ZA 3MCKB 4J5NA 2J7BA 2FB2A 3TYUA 5M7QA 1TA3A 2QAFA 1WGVA 2I7OA 1JHLH 4D0DA 3SM0A 1N0LB 2J21A 3QUXA 3RVUD 4XMLH 5DZLA 1UXWA 3BZ5A 4LY4A 5JUEL 1GZ1A 4JX5A 5K9QG 3LKSB 2ED6A 2A6IB 3D09A 5DJ0B 3LXUX 1IGJB 2GITA 5E8OB 3T8MA 4FAAB 4TLKA 3L12A 1W5NA 2IKHA 3DJTA 3EOTL 2J5LC 1BWKA 3EBIA 1LK3H 2A3BA 2WJDA 7REQA 3EFOA 1ZT1A 2PPAA 3LZFH 2VX6A 1I4FA 2FR4B 4YBQD 5J12B 1NAKL 1OB1A 3VKKA 2H1XA 1O1HA 3N2BA 3SYAA 1ZGLM 2JJTC 4FXGA 5BVPL 1BSLA 1XSIA 3GKWH 1IL1B 1ORQA 1SJDA 5AFAA 4HSNA 4NQDA 4IL0A 3FQUA 4PG9B 1UB5B 1X1ZA 1NGWA 4XN1A 4C6MA 1B5TA 2JELH 4KAQL 4LIQL 4FQPA 3S3JA 4JM0A 2WZ0A 4G7VL 5TAOA 5CD5C 1RIHL 4JHWL 1FV1A 4A2EA 1FZKA 3NIGB 4HAKA 3W0KA 3LKPA 4M3HA 1YJDL 3NSMA 4JIRA 4N2LA 3VM5A 3DXIA 5FEPA 3H2QA 1X5JA 4YHIB 3S9IA 5EF3A 2WOQA 3UC0L 2QELA 4DPAX 2ZXWB 1JZGA 2V2WA 3K2UL 1BFOB 3LXCA 4K3JL 1M7XA 1YY9C 3FO2A 4WKZA 3P73B 1ZS8A 3WFCL 3A24A 2REQA 3WTXA 2OODA 3WX7A 3AB0C 3RM9A 1FUNA 1UXLA 4B9IA 1IGIL 3EOBB 1G5GA 3OG6B 3NZUA 4JVUA 2IQAB 3JV6A 3PZ9A 1G7PB 1RZMA 1VPOH 2GG1A 5DQJA 1F97A 3RURA 2H6RA 4JQIH 5D1QC 5KG9B 2HT3C 3BGFB 4JQ1A 2QYGA 3SPVA 3JWOL 4GG6F 4MNHB 3F12A 3WFDH 3VXMB 1OAKL 3R6IA 5DUPH 5B22A 1L6GA 2VABB 4P4KC 4Z7VF 3F8UB 5C71A 3KPPB 5BJTA 2IH1A 3LS5L 4FJZA 1C5BH 2YDAA 1BVLB 3P0GB 4L4JA 5IOPA 4MAUH 2FRGP 3S0PA 2WO3B 2Y6SD 5LB1A 2V0AA 4QAWA 4PYHA 4DF9A 3PXLA 1CZ8H 3LG3A 5GRUL 4NX5A 3O1NA 3V0AC 3MAWA 2Q2LA 3H4FA 1JVKA 1I85A 4JDEB 1O9WA 4APQC 5I17A 4UZUA 4FFVC 5C0IB 4D9LH 4R0LA 5KITA 2JF1A 4WLCA 1A66A 5HNTA 3V7MA 2XJLA 1X5AA 5MEQA 1M7IB 4GY7A 3AUWB 4QHNA 4UWQB 3K6FA 1Q0XH 1ZLUH 1OCZB 2AQWA 3OTRA 5DBUA 1J9RA 5CKAA 4AV0A 5H94A 1WJ3A 2GAZB 4H5SA 3U0TB 1CVSC 5F88B 1UKPA 2NVCA 1LO4L 3G8EA 2YAFA 3ECWA 3UVAA 4D8PB 4P7QA 3AWNA 2N7BA 3NXLA 4UQIM 1WDAA 3HPLB 1QP1A 4AZBA 1GOWA 5LN4A 4C6OA 4I8YA 5BRBA 1ONRA 3FULA 3AC0A 1XGTB 2CQVA 4QRRA 1UWYA 4PYGA 4HZMA 4KKRA 4OJYA 5EZPA 4QRBA 2C0HA 4GRLB 2NX5B 3KEHA 4X8JA 1RY0A 1MZHA 4OT1H 5KYYA 1JGEB 1OFDA 3WK1A 2DF3A 1WYIA 4J35A 2DJLA 4LPWA 2BP5M 3M0JA 3C2VA 2D2CC 1MJUH 2GK1A 2W79A 1KLUA 4OW6A 4IICA 1HXYA 4LARL 3G5EA 1WCGA 2OSWA 2MQ3A 3NIGF 2X0WA 1NCIA 4ANXA 2OKMA 1C08B 2J3SA 2H1PL 2Q10A 2VFIA 3QORA 2OMVA 2BZNA 2C9SA 3HS8A 3VWKC 1H7WA 3N25A 2Z92A 3AZTA 4IRJB 1FGVL 3RDTD 4BKLA 2YZ5A 5ECVA 1DBKL 2NW2A 4AU0A 2IF7A 1ZLWK 2QFRA 1FLRL 5C3IA 1C8VA 3TO4A 5D72H 4G6MH 3B8WA 4MA3A 4PCNA 1U8LA 4PJFB 4KXZI 2ZWKA 3ZZ1A 3IKCB 3CV6A 3B8UA 3W01A 3RM4A 4FX6M 2OJEB 4HUUB 3V6OE 1A02N 3GIPA 2ZWLT 2F38A 4N2HA 1QNRA 2Y8UA 4M82A 5JXAH 5FO9B 4E3VA 1CU4L 4GW1A 2FZDA 4Q4OA 5AHEA 3LBMA 2WNZA 2JI2A 4XBMA 2DYRB 1MCIA 3V4VH 1S2AA 4CADB 3MLPA 4AC7C 1VA9A 3UYRH 4A38A 1Q6DA 4JFFA 5I30H 1LG1A 3OIHA 3ML8A 4TMPA 3BSZL 5B4MC 5I1GH 2G3JA 4X6DB 4EI6A 2ZRWA 3SGKC 3FQXB 3WLLA 5K1NA 3TW9A 1RK0A 5D9MA 3U6XS 3P0VH 3QWOA 3C60D 3GIQA 1RK5A 4PS4H 2EDHA 4AIXA 3D8MA 3N12A 5EEZA 2WXJA 3NJJA 4X80H 5F6HJ 5IB2B 1MI3A 4DQAA 2EDXA 3P0YL 5KN5B 3D07A 3K46A 3OIXA 2ZQKA 2D73A 1TCRB 3V4PL 2EKCA 1A1MA 4Z3GA 3QDJD 1P1VA 4IBQA 3KG5A 2UY2A 3HI5H 3D4CA 1EYEA 1GNXA 1FL6A 4A05A 3RUGE 1H3PL 3DXAE 1XT5A 3SY1A 1E6QM 3KCPB 3DX9B 4UTTA 1N8ZA 1EP2A 4PJHE 1YE6A 2O4EA 3FCBA 1Z2KA 5HD8C 3QFDA 4KVCH 1EIXA 2IQ9H 2Y3AA 1BX2B 4AKQA 2P5NA 1RXOB 4FABL 2P3EA 5HWNA 2BOBB 4TX8A 3MLYL 1S5WA 1R5VB 5XINA 4LNVA 3N42F 4N2IA 5LNUA 2W9EH 2C9XA 1XICA 3OKNA 1LOLA 3ZK0A 3PJSB 3PNUA 2DWDB 2AJYL 5HHOB 1LO3H 1PZ5B 2R7EA 4ZMAT 5KZEA 4JX0A 3IDUA 2OTWA 1JGUH 1ID2A 3F4NA 3ELQA 2CDFB 2ZONA 1T4KA 1JZ3A 4G9FB 4U1GC 4ACZA 4QRPD 1GZGA 3BJLA 2FB4H 2NY0D 4HALA 3AIUA 2Y8KA 4Y7OC 2UWEA 2V7HB 4OQVA 3KLQA 3RJDA 4PRIA 4C6FA 1FCBA 1ZRUA 3S9DB 2QFPA 2J1WA 3ATFA 3MNMA 1KV7A 4H20L 4ZK8A 3QHNA 1G0YR 4QD2E 1ZY9A 3RAOA 4ZSOE 4WSKA 1E55A 4RDVA 1A5FH 1NC4B 4PJEE 5FCSH 1R3JB 2GGGA 5CG0A 3IRSA 2X12A 4LVDA 4PJFF 4ZMVA 4CCEA 1SLWA 3N0PB 1IC4L 2FO4B 4QYOA 3CAVA 1MRFH 2ZE0A 4KDTA 3I50H 1K2DB 3RKDD 4H1LG 1MCRA 4DGVL 4P05A 3I02B 4RFEB 3OKOB 5SWUA 5FESA 3Q01A 1UURA 1P0BA 2ED8A 4N0RA 4N0UB 1RZKH 3ZKND 4GD0A 4HCFA 4X6DF 4BQ5A 4XBJA 1ZFJA 4DKEH 2IPKB 4JNXA 4OCYL 4JD4A 2G4JA 5FEZA 1UZ8B 3DBXA 5LG6A 1SSDA 5HGDB 2HE5A 3VRJA 3P9MA 2K70A 3WEXB 5DD1L 3VNDA 3QULA 3LPGA 5FUOL 2BC4B 5IG7B 1MCOH 4GIOA 5TDOB 3G3MA 1ICSA 1KACB 3T1FB 1LO2L 4POZC 1ASQA 2PCEA 1ZGLA 5DANA 4PCFA 1IIGA 3K2GA 3S6CA 3ARQA 5REQB 1ZLVH 2B0MA 4GUGA 3M0YA 1KXVC 2ZYHA 1OFQA 1HZHH 3GLCA 4L4OA 3MBEC 2XG4A 1NPUA 3HPZA 2PLKA 1E28B 3QDHA 4R3SB 4RJEA 1XGEA 1GYVA 3HC4H 4FQLH 3LTVA 5I1HL 5LIYX 2BVOB 4KWUA 4Q6JA 4FE9A 5CZTA 1ZJIA 2ID5A 2NCMA 3CNKA 2FTPA 1WFTA 1TQTA 3PTQA 4PYSA 4U5KA 3KDMB 2ZF9A 2ZUVA 3D39D 1HESA 2Z1PA 3GRGA 3GIZL 5I0ZA 2BB0A 1GGCL 4CNIB 2XG5A 3QV9A 3W23A 1UM4L 3ZIZA 3CVCA 5DZOA 4LCIH 3WHE0 5AHLA 2GC4C 1MH5A 3N9GH 1XTMA 3QC3A 3WFAA 5LIKX 4G1MA 1BQCA 3FRUB 4JB9H 2B5IC 1FG2B 1RD5A 3D18A 3T2PA 1PTZA 3G24A 4U10A 4G6JH 1KV5A 1X5YA 4P49A 3UYOD 3K8LA 2GSMB 1YEDB 5D7SL 3W75A 2PCPB 2V33A 5EZLA 3L4VA 4FD0A 4YHOH 5GGRA 4QPEA 4JZNA 5JOFA 1JZ7A 3GLDA 5MP6L 1TKWA 2FJGB 3R13A 2ZZ6A 3EXTA 4UOW1 3VM7A 4K3GA 3KHQA 1A80A 1E8YA 1OABA 4RRPG 2UV8G 1I2PA 3MZ2A 4LBUA 1JNNH 1X5LA 2VXTL 3FO0H 1HKMA 4Q4PA 5IFTA 5E24E 5DD3L 4F8TA 3NCCB 3A3YB 2EH7H 4WI0A 3OKLA 4Y4HB 3U4KA 1PNCA 2A3LA 2OR7A 3C75A 3UZZA 4K9EL 4UIKH 1XLKA 4KEUA 1CURA 3W7MA 3S5YA 4NO0D 4AK1A 3OR7A 4MQXC 1WT5A 5GS0C 2J24A 1A14H 1FYTE 1FCGA 3QEUB 2X9ZA 3QTGA 2QDVA 5F6IB 2QW5A 4D6DA 2JKRM 4K7PH 3UETA 5DUBA 3U4BH 3LCHA 1A4MA 1RV6X 1N6VA 4FYQA 4ZI8A 5T3ZE 4IRZL 1FWTA 1H50A 4E5XB 2K1MA 3V9CA 2GOUA 3E3HA 4JDZB 3T9WA 4IPLA 4YXHL 3X12B 4DCQB 1FH5H 2EEBA 2EVJA 2UV3A 3KRBA 5A2KH 1GONA 5AL8A 3PWPA 4IK7A 2IQDA 1P4UA 3K6SB 1W17A 2DEPA 1A53A 5IM7B 3LBOA 1J0ZA 1MHCB 3BLIA 4QJ4B 1FFOA 5EO9B 4EIGB 4ZFOB 4X98A 2H26B 1E43A 4FERA 4BA0A 4C6QA 3IACA 1MDTA 2Z2BA 3IJEB 1FFTB 2RMNA 2VR9A 4Z0BL 4L1TA 4NWUL 5AW4B 5HXMA 2QVTA 3SJNA 3PL6B 3STFA 1SUHA 5G1MA 3AHVA 3CL6A 4Z7NE 3DHFA 5E5MA 1W6WA 3O8AA 2CJUH 4KRPB 3CQIA 3KFTA 2OKOA 1CE6A 1P9MC 2XWTB 4Y8AA 4WUUA 3H24A 2CLRA 2UZIH 5CJXC 2ZUQB 3VXRB 3DTDA 3MV7E 1T1YB 4LHJB 2PWEA 4B9JA 2YYTA 3LDBC 3BKMH 4M7KH 1SQ2N 4JTFA 3C61A 1V55B 1MFBH 1SHSA 1KNOA 3IUIA 4UNKA 3GRWL 5B1CA 4NP4L 3AMLA 3WKYA 1EGMA 1TA3B 5TDNA 1DL7H 4D0DB 3GMOA 4TULL 4YXGA 3B4NA 2P8MA 5BNXD 3QUXB 1MEIA 1UXWB 5ETUB 1BLNA 5EV7A 4HHMA 3RJYA 1SY6H 4IDLA 2NXZB 3BPCA 1FBIL 5A8QA 5JPMB 1L0PA 4H04A 3TQKA 1WBHA 1WUZA 2FT8A 4UANA 2BHFA 1PKQA 1WA1X 2GITB 4YNGA 4YHEA 2EIDA 4TM9A 3JS3A 1OAUL 4NCDA 2BIOA 7REQB 3U8GA 3BGMA 4QLWA 3GO1H 1I4FB 1ETJA 3LMJH 4MY9A 3APFA 1OB1B 2WMHA 3LLFA 2YPVA 1SFJA 1XDLA 1V3JA 3OPZH 1JWUA 1JZHA 3QW4B 1L9RA 5GZND 4PJ5D 5LCVH 4FXGB 1FO0A 1ORQB 2QSVA 4NQDB 3K0YA 3FQUB 4QTGA 4KI5E 5D2XA 1NGWB 1KJVA 5CFAA 3NGFA 4C5YA 4X4MA 5ESAA 5T3ZL 2EQDA 4O2FA 1TVNA 4OAWA 2VMDA 1M2VA 5D09A 4ABQA 4K3DH 2AQ3A 2X41A 1POJA 1FHVA 1FZKB 4M7ZC 5C0FA 3LKPB 2A5HA 3PF2A 2ITDB 1QMUA 2FBJL 4U1SA 4Z7WF 1TJ2A 5IHLB 1AE6H 1M7UA 4R7OA 3VGAB 3TLQA 1Y7VA 4KKPA 1KCSL 2V2WB 2Y3NA 2QT6A 1Q66A 3EDDA 3FO2B 4WKZB 4DNMA 4N87A 1ZS8B 2REQB 4H6QA 4E5XG 1A5MC 5IJDC 2QUVA 2HS6A 1OW0C 3AT9A 4MAYA 3WMQA 4M3KB 1IT9L 4KTEH 2CO6A 4J12A 3JV6B 3O6FD 1Q1JH 5DQJB 1T6VN 2YD9A 3BUIA 5GGQH 3EZ4A 3SPVB 2VDPB 3B03A 1TPVA 3F12B 3F5WA 1NOFA 4AYEC 4BWWA 3NA9L 2VO8A 4PMEA 4JY5L 3CSFA 4N2MA 5C09E 5BJTB 2IH1B 3IK4A 1SEBA 1T04A 3GHSA 3GR7A 3E8UH 1AQ8A 4YHLL 3W28A 4A8IA 3ITTA 3W74A 3MLXL 2NY3B 4K23H 3S35H 4KC3B 4D8AA 5DXWA 2Z7KA 4DJFD 4ZA0A 3NIDF 3O6LL 4PLNC 5LUMA 4M3PA 4OCXL 3ULUH 2VDPH 4XXCC 3MZNA 4PEKA 5I17B 2R29H 3P2VA 2C9RA 4R0LB 4LVEA 3L4YA 3S35X 2QT3A 1PO9A 5MEQB 4WHBA 2EO9A 3PGDA 4DERA 3D3VA 4P5TD 4QHNB 3W3OA 2C3XA 1HKIA 3R0DA 5I8EA 3A23A 5EOCJ 3OX8A 3A9IA 1Q6LA 2P50A 1BWWA 1KIRB 4MXQC 3MI2A 5INCA 3TTYA 5H94B 3GBDA 1BZ7A 4H5SB 1RULH 2EPLX 1N2RA 2E77A 5GS3A 3TONA 4HQQL 5I1KL 5KVFH 1OCJA 4AYBA 3CUHA 1M5WA 4DEFA 5IVXA 3W2UA 1CFBA 3LIZA 4NZCA 4UU9A 1JCMP 4LHUA 2CLEA 1JFQH 1Q8JA 4N22A 4JMNA 4QRRB 4Z7OF 1IC5H 2AGJL 4PVMA 1UWEL 5EEWA 3H7RA 2WSQA 4M7LT 4X8JB 4AVOA 2F5BL 3MLZL 2D2GA 3KWUA 3T04D 3HZ3A 5CEZH 3GVQA 2GK1B 1K72A 5EU7E 4NSKA 1HZLA 4HHPA 4JN7A 4KI1A 4YZFE 3P02A 3QIWA 1LVEA 2OTPA 3GKZA 1HXYB 1RUAH 3QC6X 4WX2A 1P0DA 2XPKA 3NOIA 3GJFH 4V2BA 8TIMA 3VI3F 1H3XA 3QZBA 3TV8A 1N59A 2WBXA 5DMGC 5CPTA 3FU8A 4JHAH 3L0NA 1KLGB 2I16A 4XKYA 4MADA 1CLXA 3QORB 2OMVB 4UB0H 3ERXA 2ZX5A 2QVMA 3WQ8A 2Z92B 4F1ZA 4BKLB 2NQJA 3SDDD 3WMPA 2NW2B 4BQBA 4C57C 2ENPA 1CF1A 1BVNT 1KDIA 2PC4A 2Z31A 3TO4B 4XP9H 3N2CA 3UGXA 4MA3B 2Q3RA 4ZQKA 1U8LB 2OMZA 1F6FB 5BZAA 3IXTA 1DJQA 3AU2A 1HUVA 2FTWA 4Z2JA 2DB8A 3EJPA 3L3IA 2I57A 2DL2A 1IEWA 3BV4A 3ULUF 3HFFA 4Y8EA 4GW1B 3O16A 1EJRC 3CCHA 4PUUA 3ARED 4XP5H 3WLTA 4HETA 2HLAA 1EDGA 4JFFB 3T4AA 4P8UA 1TFPA 1VC4A 1ICPA 1VS1A 5E00A 1G6RH 4EI6B 3PSVA 3UBXA 5AG8A 4KRMB 1JPEA 1O5KA 4EDXA 2INZA 1DSYA 4LEQA 4X5RA 5AZ1A 3IDIA 4ZXOA 3QWOB 3HCVA 4F0LA 4QXIA 3WY3A 2E7MA 1TNMA 1YAZA 4RW5A 4H26A 3APCA 5LZLA 2OU4A 1WLHA 4GVHA 3BFOA 1MDRA 3ZBMA 1WXZA 4MJID 4DM2A 2IPGA 3OVPA 4YTQA 3LUTA 3L2NA 1GOIA 2IWEA 1A1MB 3QJVB 4B5VA 2DDXA 3SUUA 1V3KA 1EGVA 1FL6B 1TVPA 3GKAA 1HFUA 1NCBH 4AQEA 1VAHA 3Q2WA 5CQ1A 4UXDA 5J1AA 1N8ZB 1URIA 3GUGA 3TIEA 3IETA 5HJGA 3UJFA 3AWFA 2AI0H 2FECI 4XNDA 3QFDB 1UM6H 1YNKL 1R33A 2W66A 1S3KL 5D70L 2NNFA 5ADPL 2FJKA 4O02L 4JAWA 2B31A 4DPBX 1HO4A 1GIGH 4G6KH 4ZD3H 1EEQA 2OGJA 1MPAL 4ATTA 1X7QB 2YA1A 4J27A 5C0EA 3OKNB 2YWZA 1NWOA 1HKKA 3VVVA 1EWDA 1AH0A 1FDYA 2YAOA 3JWNC 4FXKA 2R91A 4HWZA 1I3UA 4OE7A 4HSHA 2R7EB 4X9SA 3FH5A 4I6KA 2OTWB 1NUNB 5DC2A 1TMLA 2D3JA 3I7RA 1T4KB 1ZENA 4LUYA 3L3GA 4WI9A 1T99A 4MSWA 5HNUA 5DO2D 4ACZB 2PGEA 3HZVA 4U2ZA 2EGZA 4IBTA 2UWEB 5L7XH 3A6OA 4KT2A 1KF9B 4PRIB 5LGJA 2HUHA 4JREB 3MHGA 5FPIA 3Q9PA 4P2RE 4A2LA 1TQBB 1CBVH 4OLUH 5HHMB 1EPVA 5K9JL 4XCFH 4ADSA 3VQMA 1DCLA 3FB7A 5AB2A 4PJXA 2D2JA 3RCYA 4U6VH 4PI0A 3H2FA 4JO1H 4D3CL 4KS0A 3OXRA 1CE1L 4LEXL 2H9AA 4FCHA 1OT1A 1YW1A 5KTEL 5TE7L 4XMKL 1OWRM 2AGTA 4IZGA 3ILQC 3ZTCC 2DMHA 4QYOB 4WCYL 5C0AD 3NP4A 3N40F 4EVZA 3OGSA 1E6JL 3BARA 4M48L 4GRMA 5EOTA 1P53A 2WCAA 4PW9A 2XV6B 2X87A 4N9CA 3NK3A 4XC3H 3S3PA 2NDGA 4A39A 4X7FC 5B1BB 3MKCA 2PFHA 4XGZA 2B4CH 3O8XB 3OZ9H 3DBXB 3PAYA 3VRJB 3P9MB 3QULB 2JB6A 2O1AA 3MMUA 4YTSA 4XNUL 2OYPA 1IEHA 1ZGLB 4HWBL 3W7HA 2E9WA 3LNDA 1GOHA 1Q65A 3AJXA 4M5TA 3BV7A 3GO2A 2JCCF 3ZTEA 3SUWA 4G7SB 3OA3A 2X7LB 4H6RA 1RA0A 3JTSA 3LCIA 2XG4B 4JRXA 4HK5A 1A8JH 2VDRB 1EC7A 2BSRA 3KHDA 4AE0A 4C6BA 2K6WA 4WEBL 2O6CA 5C7XH 4WCJA 5ABEA 4IT1A 4W4OC 1RXLA 4CNUA 1J11A 3RNKA 3R1GL 1QFEA 3U46A 1LLWA 4I3SL 2EPKX 3UPRA 5M95B 1RAMA 3EWDA 1E4HA 2XG5B 2DDQH 4ODSH 4X2PA 1TYRA 3AYTA 5EIIA 3N2MA 5H8MA 1AJ0A 4Y19A 1H6UA 1IBHA 3CZJA 5AW8B 1MH5B 2YFNA 4K94C 2VDRH 2XDFA 1YLBB 2EVFA 2WZAA 3FQTA 4G1MB 4XTDA 2DKSA 3KDPB 3RGVA 3D18B 4X7SH 3KH3A 4B53A 2E40A 5EU6E 4GZEA 1QMLA 4HF5H 1Q4WA 1DQUA 3LEVH 4MNMA 2VYRE 3N43F 1XYCA 1A49A 3NPUA 5EZLB 1FNAA 5B39A 3OMAB 3AITA 4HK3N 5GGRB 4OQTL 4B4HA 5FGSA 4NHCL 1IBBA 3GSVA 4JZNB 5JOFB 1G9MH 1XR9A 1TKWB 2PR4L 3U82B 1WZ1L 1FJ1B 4LCVA 1G4TA 1II4E 4KY1L 3WE6A 5FHAL 4NM8H 4I0PA 3C8HA 1DVUA 4BY3A 4D6HA 1H3GA 3D85D 5PTDA 4WJ8A 3SCUA 4I1NB 4M9OA 1OALA 2DQIH 1OAJA 5CINH 3BN9C 3LN9A 5FV2A 4WI0B 3OKLB 3N34A 1F1GA 2P46B 1F6AA 2XBZA 5DGQA 1HCFX 2K4AA 3VFGH 3VIHA 4HUNB 2DQJL 4LPCA 4PBFA 3MV8E 2G37A 3WEOA 2H3NA 2V8MA 5JXEC 2EAWA 4RX4D 1OQXA 4B9YA 4YDLB 4F9LC 3USZA 2JKWA 3OR7B 1W72A 2D7OA 2NX1A 3H4XA 1JFHA 3H26A 2PDYA 4MQSB 2X4OA 5DUBB 4WEEA 5G4WA 2WWCA 1W9XA 1AAJA 4TX9A 4RUBA 1RBAA 4LOUD 3TVMA 2ZXGA 2IDUA 1AMYA 3FQWA 3GB6A 5FLVA 2OCJA 1W3JA 3MRGA 4JR9H 4NJHA 1TV2A 1QLFA 4K7FA 1YYAA 4HTYA 1LWIA 2EE2A 4J9JA 4TTGA 3VAEA 5TNVA 1U8OA 5KWYC 2RCSH 1ONWA 1CDJA 2FSEB 3GXDA 4XPBL 3NR0A 2HT4C 5D7JB 3NZPA 4WFEE 2JKPA 1A3ZA 4U7KA 4CSPA 4JTKA 1FFOB 5HYSG 3QQ9D 5T3XD 4P9ML 4AEEA 1ADQA 1NCOA 2HFGH 2PDMA 4PJCA 1Z44A 2Z8SA 1U3HA 5ECUA 5CBJA 1HXJA 2EECA 3Q7JA 2QPFA 4ALAL 1HJVA 3FH7A 1KLZA 2RDTA 3P9WB 3VZZA 1KIQA 1CW2A 1OP3H 3H9HA 3MNDA 2D23A 3QZPA 3RX5A 5H8DA 1KC5H 4HJ0C 5E5MB 3CVIL 2CIIA 2W65A 5KUKA 4XNYH 5JW3L 3IFLL 1CFMA 4C47A 1T40A 2ZVRA 2GQ3A 4NXSA 2QIWA 2QGYA 1CE6B 3H1ZA 1C92A 4BHUA 5IUSA 2YD3A 4WUUB 1KV8A 3MFFB 3NG3A 3AMGA 2J6EH 3AUOA 4G6AC 3VYNA 3AQUA 4MBRA 2XN2A 2WN3A 1TTBA 1OFAA 1S5HA 3M8OL 4FOMA 3MODH 3P9LA 3S3GA 1KNOB 1FDZA 4IU2A 5DDHA 1GUVA 3O7UA 4GMTH 5TDNB 2E9MA 3GMOB 2ZX6A 3WD5L 1J05A 3SKNB 4OFYA 2I60L 3HRPA 1BLNB 7ENLA 3FUDA 3BPCB 4KROD 2YQBA 2VDHA 1LGVA 3U7YH 2D7MA 4PWGA 1B30A 5HVHC 5DEGA 4WIWA 3O11A 2NSMA 3VTAA 3EJSA 4CSTA 3V2AR 4W9IC 1MZYA 2X10A 2QPUA 1VESA 4NLAA 1XUUA 4KERA 5LG1A 4YE4H 3VW3H 1OGGA 2J1ZA 2XXGA 3BGMB 4A6YL 1JPFA 2COQA 4N4QA 4IEFA 4FLHA 2B15A 2G5BA 3IJ9A 1JWUB 3INPA 1WOAA 3SSZA 3ITLA 2BXZA 1FO0B 5LO7A 1ZV2A 3DO7A 1DIDA 3V8OA 3N9SA 3VDAA 3CPUA 5ESAB 2CWNA 3QQ0A 4O2FB 1E6OL 2FLBT 4OAWB 5F7AA 4XVSL 2K78A 4AXKA 2EEDA 4JHUA 5JQHC 4PBEA 3W1MA 5C0FB 2AAMA 3MX0A 3WG7B 1CXKA 1EGZA 4U1SB 5BRZE 1N3NB 2AQTA 2ZX8A 4NAMA 3MB9A 3W7NA 1FO0H 5FGCE 2FGWL 5L6YH 4A29A 4MAYB 1B3IA 1GQLA 3GZAA 1OOWA 4RGNC 2EUVA 1VFSA 4WWKA 2IWFA 2BINA 3IBEA 3NGBC 2CO6B 2UX7A 5AAWA 4Y16C 1DYSA 2VLRD 4GAGL 3MT1A 1L9NA 4FG2A 4V1XA 3UOAB 5F1VA 1QSED 3F5WB 4AISA 3B8SA 3BHBA 5JQ9A 2B1HL 3B9OA 3MJ9L 3MPGA 2VB5A 4LW7A 1SEBB 5AYZA 2VSCA 3KXFA 5DF0A 4C56D 1YDYA 1T04B 5BU9A 2ERJB 2OQJA 1JZIA 3V0DA 3HUJF 3MDJA 3F4VA 4Z76A 1R3HA 4UQCA 1FRGL 5CLTA 1WAEA 4M1BA 3N3EA 4JX6A 1WIUA 1NEPA 4QNPF 4FS9A 5IR1A 5ICZA 4IM4A 3BAIA 5LXGH 1SEQH 2R4RH 4BKNA 3PPFA 3PGDB 3D3VB 1PKNA 3CV1A 5F72S 3L5AA 2FNBA 5I8EB 4AWSA 3OX8B 2A83A 4Y0GA 4P8VA 5AVZB 5INCB 1BZ7B 1NOWA 1N2RB 5FUCC 5DMLA 2BGSA 2HP4A 3FTUA 1S9VA 5G2IA 2CZFA 2CLOA 2FYYA 3UU0A 3T65A 3DJSA 4E9YA 4P8WA 4LGPB 5IVXB 2DQFA 4UU9B 4LHUB 1BMZA 3T0WA 2HKFH 3MUY1 4GCXA 1HH9A 5I6KA 2WLMA 1N7ML 3MGOA 4P2AA 2ZTKA 4UBDD 3CPLA 5DMIL 2VEGA 3UXAA 2P45B 3EG9A 3C8NA 4HV8A 4GKLA 2I24N 4P0DA 2JH2A 4QLJA 3I9GH 3MOAL 4WOZA 2ZOTA 4YVXA 3MA7A 3ZLGA 4NSKB 2X2JA 2ZT9C 3P30H 3QIWB 3GSQA 3BW9A 2ZD0A 5DEJA 2DWEA 3LIZH 1FNEA 4LU0A 4YSDA 3QPKA 1J8HD 1Q7MA 3B05A 1N59B 4FX8A 2XZQL 3ZSSA 4XKYB 3GQFA 4EF3A 1E4LA 3IAQA 1PX4A 5EU5A 2HTMA 3P11L 1TZAA 4CQCA 3ZRCC 4NRZA 4FQIL 3EXRA 3TU9A 2PGFA 2WCSA 4J1UA 2VMEA 5BW6A 3SUVA 5GRVL 2Z31B 5KSAD 3DK2A 2WAGA 5GGSY 4AQZA 5IQ7L 4ZQKB 2OMZB 3IXTB 2Y7EA 5BUAA 2B7PA 4H44C 3IEAA 4NUGL 3VSTA 5ABTA 1UASA 4QOKE 3DBNA 3L3IB 2E1DA 1MNZA 3BAEL 4CC1A 2XXFA 4Z1YA 4Z78A 2PTXA 3KP1A 3CCHB 4YQXH 1TPDA 1S6NA 5D2LA 2HLAB 3NK4A 3T4AB 3AM8A 5JOPD 1T1XA 3ENEA 3RVTC 3PPHA 3T0BA 4YXKL 3TFKD 1MZZA 2MRYA 5E00B 2DZSA 3O3RA 3UBXB 3MHFA 4IQLA 2F1AA 5DFTA 2OPJA 4C4UA 3O6CA 3ZR5A 4JQXC 4DP8X 1NLDH 1XCXA 3IDIB 1PE1A 5E8NA 4UFJA 2WZPA 5CC7A 5L2KD 3HBGA 1AC6A 2V3GA 3N6JA 3T0ED 3EFDL 1IR1A 1H5YA 4H26B 2AEIT 5C2GA 3UPCA 1JYWA 3H21A 2VTFA 1GGBL 2WHKA 1MRQA 1WAAA 3TEUA 1O6IA 1EEPA 1TV4A 4WNSA 4LUJA 1M6JA 2Z0UA 3TYGL 1VYSX 1HHJA 5T1KD 1E3XA 3HV8A 2QSTA 3OLDA 2CK2A 4FL4C 5K3VA 1BG1A 5HQLA 5HJDA 5FB8A 3BI9X 3BG9A 1GVEA 3QC5X 5J1AB 2QULA 1UG6A 2WWOA 4PG2C 1KQZA 3TIEB 3IETB 1RJPA 5B3SB 4R7XA 3SCMC 5HMSA 2PU0A 3L81A 1TG7A 2R1WA 5JPNB 1QU4A 4CGUB 2WXIA 2B2XH 3Q8BA 3C09B 2OEJA 4XB7A 4E6MA 3V5HA 4F5CE 4K7PY 1L7TH 2BX7A 3UT0A 2ZE3A 4S39A 3CXHK 5HDBE 4CCCA 1JCVA 5MENA 5C0EB 3Q2DA 1S8DA 2DM2A 3HMWL 4YVPA 3MXVH 5DWPA 5F1NA 1B6UA 4FXKB 4HWZB 1LZOA 4N5ED 2E9LA 4MWAE 1KFCA 5FX3A 3D7PA 3GUFA 1TJPA 4RXFA 1DLFH 4NZRH 5HAOA 1CDIA 2HVBA 3VI4E 2DZVA 1J79A 2W94A 1YEFH 3ZL2A 3L3DA 4MSWB 4EOWH 1GTFA 3D08A 3HJ0A 4CGTA 3TAKA 3OJMB 3HZVB 5LWYL 2HTKD 2VLJD 3Q1EA 5ISZA 2YGOA 3EMZA 5LYRA 5LGJB 2MKLC 4KZDH 3L9YA 4TSAH 4PU2A 2R0ZL 4XB3A 5CGBA 2QJMA 1I9RL 5A6LA 4I2XA 2NY1C 3CFKA 1Q6GA 1XS2A 4DWDA 4KKAD 4DP1X 5CAHA 2ZA3A 3HOGA 1JHTA 1R3VA 4LLVA 4AZ8A 3IIVA 3PJNA 4M51A 4OCSH 1KWKA 3FB7B 4AQOA 3JWOC 4XVTL 4P23D 1HL8A 3QUZA 3VKDA 3WYRA 3OXRB 4IRSC 2H9AB 5EOQL 1ZJAA 4UTFA 2A74A 4ZBJA 3C6LD 1DVQA 1NDMA 3DESA 3AWGA 3UZJA 5I16B 4OZHE 2WIIA 3LBCA 5SWSA 1XDMA 1YMMA 4GRMB 2AMGA 1IWBA 4ZQPA 3IJQA 3EH5B 3TZVA 5EOTB 3WO4B 1KJ3H 4H88L 4FULA 3C5ZD 3DOPA 2P88A 2CHOA 1EF2A 3OQRA 7ODCA 3IS0X 1JVLA 3QDGA 4OUEA 2D31A 4XGZB 3ARFC 3HHRB 3TQVA 3N5AA 2GUOA 1SF5A 2EH8H 4HC1L 4LSPL 2JB6B 2A6DA 3SUTA 4DI8A 3VCCA 2UZPA 4EIUA 5C0RH 3AACA 3BE1H 1LDCA 1ESOA 3FK3A 4N8UA 3TX9A 3TA3C 3NQ7A 4F66A 2PDGA 1IGSA 4D9RE 5L0QC 4CRPA 3UBXG 3CHCA 1AO7A 2ZOKA 4MNQD 5CSGA 3JTSB 3E0VA 4GKNB 2P42B 2H0PA 3VYLA 1FWDC 3W9DA 2HRPL 2BNQA 4JN8A 4MCYA 3PBWA 3MLUL 3OV6A 2F54A 2FDBP 3LZQA 3RNKB 2X1XR 1O9ZA 12E8L 4N0YH 3U46B 3KLDA 4ZPTA 1KJ2L 1Z3GH 3O2WL 3UPRB 4EXAA 2ZZ4A 1K6WA 2NQHA 5I71B 1Z42A 5EIIB 2ACSA 4Y19B 1ME7A 4U1LB 4UYQA 3TO2A 5F4XA 1JG9A 3UADA 3B37A 3UYCA 3GI8L 4LL9A 4GP4B 5K1JA 3FQTB 5G5IA 1UTDA 4JPWL 3RGVB 3EO1B 1N70A 5C3LD 3L3JB 3W3BA 2IG2L 3ATZA 3VXUE 1G7LA 2XZCH 1JK9A 2QR0A 2XZ7A 3F2BA 4X6EA 4F2UA 1QBAA 1OP5H 5A94A 3O2VH 1BPLB 2BIQA 2WM0A 3GSVB 3WBWA 3O0RL 1MCSA 1OAXH 4Y5VC 1XR9B 2FSDA 3HN5A 3QEQD 1I2NA 2PDLA 1XLEA 2J74A 3WFHB 2HLFC 2O5XH 3NL5A 4HHAA 4NRYA 3B1UA 1BQHA 1I2RA 2EVHA 4I0PB 3ULVE 2FO8A 2KPWA 3W5NA 2C19A 2OP4H 2GJZA 5U7SA 3QKEA 3IDGA 1AXIB 1I9JL 3BJTA 3ABLB 3G6LA 1ALDA 2R51A 2FECL 3K8KA 1GJPA 1OCBA 3R0MA 1F6AB 1MAJA 5F2MA 2H3NB 1FCVA 4NYUA 3O9WA 4AMXA 5EBAA 3QK0A 2X6CA 2WYIA 5IMKA 3RK8A 1DUZA 2UXGA 1CVRA 1W72B 4ZW3A 3JZEA 3B7RL 5IJCC 3X3GH 3O3EA 4K7VA 1BXAA 2X4OB 5HBBA 1CD0A 2PTVA 1L9SA 5FLUA 2WUCH 1O7SA 4R2GD 3DGCR 1QK0A 3TVMB 1QAWA 4L8BA 2AXJA 2PUZA 3FQWB 4LU5L 1YTEA 3WIHA 3T0TA 3THML 3RWHA 2XWBA 3MRGB 1KXQE 2G4FA 2DLFH 1QLFB 2J72A 4K7FB 2PYED 1Z9PA 4YK4B 4XNXL 1FXPA 3KW3A 1OF6A 1JUEA 3R10A 1U8OB 3PNRB 2CUMA 4HS8L 2ZSWA 4KCUA 3X17A 5CKGA 1CICA 5CPMA 2Y25A 5I1IL 1ZPTA 4UQ3A 1PX3A 3B5TA 3L21A 3TA9A 1BF5A 2H1LM 2PDJA 4ZS6D 4D6EA 3GHRA 1XF2A 2B3RA 1U3HB 2EZ0C 1Z41A 4ADJA 3OQ8A 5GGTA 3MACL 5I2IA 4PRHD 2QNEA 1X7SA 3IDXL 5K9DA 2UX6A 3HGJA 1KIQB 4OTXL 3H9HB 1V7AA 3FTWA 3KS0H 2DP3A 1NCCL 3FTGA 2CIIB 1LP9E 2I9LA 5CMAA 2W65B 2WHLA 3U4FA 2FKPA 1TF4A 1JV5A 5E94A 5M17A 4UT9A 1R2RA 1RU9H 1PPIA 3B2UC 3BQVA 2CKRA 3PPCA 4R90L 2N3JA 2NYYC 3TC3A 1OL0A 1K9TA 1XYMA 1S5HB 3BT2L 1F42A 3P9LB 4IU2B 5DDHB 3KM8A 3U2JA 1UWSA 4UTJA 1YY8A 3MV9D 5EIIG 2N59A 1RUQH 5J4MA 1JCKA 2HG0A 4Q9QH 5AVHA 5DJZA 1J05B 1A3XA 3ZL4H 4FNRA 1CGVA 3PSWA 4QTFA 3F04A 3SE4A 4O16A 1GY1A 3AXHA 1F4WL 3UXKA 1TTPA 4LLMA 1TV8A 1AR1C 3PCYA 1TB3A 2HKHL 5DEGB 4P3DA 4HU3A 3N73A 2NX9A 3ULVL 3WSQH 3O11B 2M8XA 1QJWA 4HNLA 5HI3C 5E4AA 4IUOA 7PTDA 3P3YA 1XBDA 4PH8A 3SPJA 5I6XC 3KTCA 3I9IA 1TOXA 4AJWA 1XKJA 3VOCA 1JPFB 4KQ4H 5KBMA 4IEFB 3FVDA 3EJTA 2P48B 2CHDA 3UP6A 3H3PH 3MREA 2G5BB 3LVEA 4LH8A 1DQXA 3A6CH 1J18A 4NN6C 2D7TL 3KLHD 3W2MA 1T5XA 4LVNC 4NZUH 1WDPA 3NCYP 3DO7B 4UFMA 5I3GA 4P46A 1AP2A 5LHFA 1FP5A 1MFAH 3TBSA 2QLVB 4AUYA 4JFHD 4PWIA 3NXFA 4MNJA 3BW4A 5E8EA 2DZTA 3MX0B 5EMMA 1WBZA 2CBOA 1GYCA 1QTWA 4MKSA 2A9MH 5DK2A 1PLCA 4M02A 4B9CA 4PD4J 3CUPA 3DSNA 4OF8A 3DEQA 4ACTA 5AVTB 2NXGA 2G4EA 3QS2A 1CI1A 3RI5F 3GI9H 1WX0A 1LO0H 1E71M 5G5DA 3I6GA 4G5ZL 4WDUA 3SIMA 1A6WL 5A16A 2NNRA 4WWKB 2DUAA 3BAWA 4W6XB 5I06A 1FH7A 5DA0B 1MCJA 3BEVA 5FKPA 3ME0A 3EFOB 1CLVA 1ZT1B 3W7GA 2CU9A 1RBLA 2ZAIA 3K4WA 2EDRA 5DT1L 1TWZA 4ISVA 1JPKA 5KYWA 3S5OA 3BHBB 3NACH 3BKYL 2X2IA 4ZMWA 3NSYA 1PWLA 4Y1AE 2Y6ZA 2F53E 2BNRE 1ZBWA 1GZHC 4A68A 3WS6C 2XH4A 2OQJB 1NIEA 1J48A 4C1LA 3OPSA 4Y1TA 1BECA 4Z76B 1R3HB 2OZ4L 3ABZA 3EGJA 1E4NA 4GACA 3O0FA 1FL3A 3FHEA 3SBFA 2YUXA 1FV1B 3WEZA 2AV7A 1NCJA 3S88L 3D46A 4LASH 4LE8A 3R18A 5DHMC 5IR1B 4NC1E 1E6PA 3N0AA 2W0FA 3D52A 4Z2IA 3LXBA 1XH3A 1KO0A 5FF0A 4PJ8A 1PCKA 1P0EA 2LR4A 2WXQA 4Z3FA 1EDYA 1R9YA 5KOMC 1NPNA 1HP4A 3P54A 1RJYA 5BWAA 3FSWA 4PLJC 3IJIA 2E46A 3UBFA 5HHXL 1GVSA 1KN4H 1BVWA 1PL3A 1RJCA 2IMMA 3BYTA 1NBYA 3CLEH 4DZIA 3SO3C 1S9VB 3FH8A 1Q1PA 1WS7A 3T65B 4BFBD 1HCZA 3T2LA 4K9EC 3HTWA 1RZPA 5AOKA 5IB3A 2DQFB 1JNDA 3HE7A 1GYLA 3I6KA 2UBPC 1TWDA 1HH9B 5AWNL 3MGOB 4MVBD 2FJHA 3AXXA 4NRSA 3CPLB 2J78A 3GC2A 1TZZA 1VBJA 2HS8A 2FK9A 3EG9B 3BD4A 5E7BA 4UFKA 3NYZA 4HV8B 1D2PA 3TWAA 4FG0A 5K7JA 3E6HA 1BQLL 4X6BA 2LLEA 1LM1A 5IOPB 4J23A 2P3ZA 4DP6X 1XH1A 5D7LA 4XI5C 5JIDA 1TSHA 1XF4A 4S11A 3MA7B 3ULUD 4HHHA 1VIWA 2K45A 1K4DA 3GSQB 1VCVA 3BW9B 2F5AH 2Z28A 1W3NA 3N91A 2F58H 4LSUH 3AICA 2DWEB 1FNEB 2X40A 1FZOA 3FJ6A 4XK2A 2VEFA 4IX0A 5BOFA 5EBGA 1F8IA 3AADB 3STCA 3E49A 1KRMA 3TQPA 1BAFL 5EU5B 2FZ9A 3UR7A 4RK8A 1OTTD 3MNWA 1J87A 2F2KA 4L56A 2RDXA 5IROA 3OD3A 4GC3A 3DJRA 3BP7A 4NRZB 4J1UB 5E0FA 1KG0A 1E9LA 5E9DA 4RDWA