2QV4A

Human pancreatic alpha-amylase complexed with nitrite and acarbose
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 171
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qv4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qv4A01
4JL1A 1C92A 3WFZA 1BG4A 4PBGA 2XM2A 1Y7VA 3AHYA 1WDQA 4GQQA 2W67A 3GYCA 1ZJBA 3HG3A 4NF7A 2EXOA 3BH4A 1LWJA 1WP6A 1JDAA 2XG9A 1X1NA 1J0ZA 4W5UA 3THCA 2AMGA 5M03A 2J7FA 3AROA 4CU8A 5A2CA 2V3DA 2XGBA 1DWJM 3DDFA 4M29A 4PTWA 3QHOA 4JHZA 1XYZA 3AIBA 3FXYA 1BYBA 3QR3A 1UD4A 1HVXA 2Y4SA 1UH2A 1WO2A 3NUKA 3DX3A 2W4XA 2DDXA 2JIEA 1W9XA 4IM4A 3IJ8A 1UH4A 1ZL1A 2J8GA 4QCFA 1E55A 4FLOA 2XJ7A 5BXTA 3MKKA 3D4ZA 4AEEA 4A3HA 3W29A 4AIUA 3L4UA 2WZEA 2XN0A 1TA3A 3K8KA 2W91A 3GNRA 3WF3A 5A3HA 3WDQA 1EOKA 2ZXQA 1VBUA 3WBEA 3S6TA 2FHCA 2XSBA 4W88A 2XWDA 3AMCA 2BFGA 4W8LA 4J3SA 1HKJA 4NXSA 3WF1A 4HMEA 2E0PA 1LJYA 1PS3A 5AYIA 2DT2A 4ZXOA 1PPIA 1K9TA 4JL2A 3MMUA 3EYPA 2ZWZA 4R27A 3WMBA 2GK1A 4PMXA 4WK9A 1Q6GA 1WZAA 1HT6A 4NZJA 3W6MA 2GFTA 5I5RA 4HOZA 4NSBA 3WDPP 1W1PA 3WDIA 3W38A 2GJXA 4N0RA 4Z2GA 5JBDA 2W66A 1IZJA 4D6IA 3VGHA 2Y2WA 4D6FA 3VU2A 3NSMA 4W7WA 2CESA 1EDTA 1GOKA 1B3WA 1PX4A 1R47A 1BVNP 1RH9A 3UCQA 2ZX8A 4CD4A 4JCLA 2YOCA 2VR5A 3ARYA 3EMZA 2ZXAA 1PBGA 4QCEA 4KRTA 4J28A 2YA1A 1JDDA 4UFIA 5A69A 3VDAA 1V3LA 3K1DA 3OLIA 3ARQA 1CXHA 1HXKA 2YL8A 2Z1KA 4WKFA 4ZE5A 2HISA 4NZCA 4TVDA 3BXWA 3AS0A 4C7DA 4WSJA 4J7RA 2VX6A 2WLYA 4BA0A 2XWEA 1V6UA 1V0LA 1NQ6A 3RMEA 1HIZA 4LX4A 2YDQA 3TA9A 5KEZA 1HL9A 1S46A 1E1FA 2VX5A 1VFFA 3W82A 1R34A 4M81A 4UQ9A 2YL5A 1Z32X 4MADA 5CQ1A 3EJPA 3AIQA 3WFLA 4M8UA 3A24A 1ECEA 3UR7A 4DM2A 1UR2A 3BAJA 1ISVA 4QDMA 1U30A 1E5NA 3W27A 1JZ8A 3SCOA 2ZOXA 1U2YA 3WKZA 4CU7A 4Z2JA 4DUVA 1JIBA 3L2LA 2BV9A 4H7VA 4MTVA 4LPCA 4HU0A 1OB0A 1UWQA 2YLLA 4A3YA 3SCNA 3TV8A 3HG4A 5HPOA 1TG7A 2EPOA 4AWEA 5A6KA 1CGTA 1KXHA 3WQ8A 2J62A 1K9DA 1QNPA 4OZOA 4AMWA 2DIJA 1E0WA 1WDPA 4Z2IA 2ZX6A 1EOMA 1QX1A 4D1JA 2DT3A 1C8QA 3WEMA 3MV01 4BCEA 2J7HA 3WQ6A 1GQKA 1EHNA 3WQ5A 2VOTA 4TUFA 3VGBA 1E73M 3GBDA 3CUHA 4FNQA 3MO4A 2XVGA 1VBRA 3ZJKA 3AIRA 1BPLB 3K8LA 1U33A 3L4TA 4JFSA 4E8DA 3HMCA 2BVDA 1LQ0A 4LYQA 1UR9A 4JFUA 4OJYA 4DWSD 2OW6A 4KGLA 1HXJA 1JAEA 3WDRA 3ZQ9A 5CJ5A 1LWHA 2IXUA 1V6YA 3KWXA 2OYLA 1GVYA 3DYOA 2X8RA 2WVSA 2ZXBA 2F7RA 2X09A 2D24A 3AZTA 1TQSA 1EIBA 3FNDA 4MNMA 1CLXA 2UY2A 4AMCA 3GXTA 3DECA 3AISA 3PZGA 3WY1A 4HMDA 1CLVA 1KTBA 5CG0A 3WQWA 1BSIA 3MU7A 3AHTA 1QHZA 4U2ZA 5DO8A 5CZKA 3T0DA 3LMYA 1PX3A 2JEQA 3VGFA 2G8ZA 1GQJA 3ARZA 3CHDA 5D9OA 1UKOA 4Z2HA 2CKSA 1GOQA 1T0OA 4AIEA 1W1VA 3GXPA 2ZXDA 3HG2A 3BUPA 4XZBA 3WENA 4AD0A 3IK2A 1HL8A 4HA4A 4ZE4A 2XYLA 3CBWA 1PJ9A 1UQYA 1UWSA 2Y5EA 3MUIA 1ISWA 3FAXA 1DTUA 1IV8A 3VSTA 3CZNA 1WCGA 2E8ZA 4DUXA 3IAPA 4UZUA 4CUCA 2AAAA 1QI2A 1UKQA 5EMYA 1W3LA 1WKYA 1BVZA 3CV5A 4PMNA 1TVPA 4AZHA 1JD9A 4PMOA 5DT7A 4RE3A 4EE9A 4AZCB 3PHAA 1US3A 4PSPA 3VNYA 3CHFA 2VQUA 3FN9A 2XVLA 2VURA 5A94A 1W32A 1UR0A 1UWTA 1E72M 3SUUA 1B3VA 2IGTA 3WD0A 4W85A 4AD4A 5BXRA 2WMGA 4D6GA 1AQMA 3MV11 1FH8A 1C90A 4URIA 1NOUA 4AZIA 4HTYA 4PTXA 2QLYA 2ZUTA 5I78A 3CHEA 3BUQA 3IJ7A 3TTOA 1JZ4A 4JFVA 4HMCA 3VMPA 4UQCA 2WXDM 4FNUA 2PBOA 1XYFA 2DSUA 4GPNA 2BHZA 1CIUA 5ABFB 1B1YA 3CPUA 3F5JA 3QOKA 3GXDA 1VFMA 3ARVA 4Z2KA 2ZUMA 1JXJA 2JF6A 3UERA 3ZT5A 3CMJA 4MDOA 1Q6DA 2CBVA 3CO4A 2E9LA 2J7CA 1E0VA 2CCRA 3VNZA 1JXKA 3SCWA 3ARRA 1V6WA 3EDKA 2UY4A 1HTYA 2FGZA 1JD7A 1H41A 1UG6A 4HU8A 4K68A 2JF7A 4B3LA 1E4NA 4DWSC 4A4AA 2D0HA 5C70A 3WDJA 2W62A 4MAZA 4AEFA 2VC9A 1ISZA 4GZEA 2BY1A 6CGTA 4GKLA 2WHLA 2X1IA 3CZKA 3VMNA 1KQZA 2VCAA 4LYPA 1GOOA 3GZAA 3B9AA 2BY2A 1O7DC 1KCLA 4LYRA 4GI8A 3DC0A 2IXVA 4D1IA 4GO8A 3GXFA 3BSGA 3RILA 4PUDA 3SEPA 1MW2A 1PIFA 1QI0A 4MNKA 3MSDA 1JL8A 2X2YA 3S2CA 3W37A 5IFPA 3SUVA 2CITA 3OLGA 4HPHA 4HZ6A 3U7BA 1MXGA 4F79A 5I3DA 2XIBA 3NDZA 3WNMA 2C0HA 2ZUVA 3WUFA 5LA0A 3MUZ1 3D52A 3W53A 3WL0A 5AYBA 3WNOA 3FHAA 3OLEA 2GSJA 9CGTA 2WHKA 3NSNA 4CVWA 1QPKA 5CSUA 3ARSA 3KL5A 5D8ZA 1OBAA 1H11A 1LL6A 5C71A 1SFSA 1J10A 4J3XA 1HF6A 1VJZA 3PZIA 1Q4NX 2VX7A 3EJTA 4UFLA 2F18A 5GPRA 2WC7A 1E3XA 1QNSA 1H1NA 1V3JA 1R87A 1WPCA 1MFVA 1QNQA 1VENA 1SMAA 1UASA 5EFDA 5E6YA 1FH7A 3EDJA 2WB5A 4D6CA 5GNXA 4AD2A 2ZUUA 2WVVA 1W2VA 3SCTA 4CD5A 3A23A 1NWTA 1JZ2A 3W24A 2DEPA 1D2KA 3EDDA 4UOQA 1CGWA 1JF5A 4J27A 1GHSA 1W3JA 1TFVA 2V5CA 2CERA 3FHQA 3H54A 3N1AA 1QOXA 4UFJA 2G3NA 4P8UA 1OT2A 1IZKA 4U31A 2XFFA 4D72A 4AYGA 4PRWA 6TAAA 4MAVA 3F5LA 4N42A 2EJ1A 3DYPA 2FGLA 1TR1A 4ZXLA 2WVTA 4IPLA 3G6MA 4X0VA 1DWAM 3WH9A 2ZX7A 1VEMA 1KB3A 1H0IA 2YIHA 3A4XA 4PMRA 4PEEA 4PMUA 1CGVA 2JEPA 4FNRA 4CGTA 2AOSA 3M07A 2YBUA 1CZ1A 1HP5A 4NRSA 1V3MA 3N04A 3U57A 1C7SA 2BY3A 1OGSA 5A6AA 4GI9A 2BHYA 3WH8A 2VR4A 4M80A 2A3AA 2J77A 5D8WA 3BLKA 1KFWA 4FMVA 3LRLA 2JE8A 3SCVA 3WL1A 1VIWA 1UQZA 4AW7A 1EDGA 3WBAA 2VRJA 4NRRA 1EDQA 1E40A 2Y24A 1TVNA 1IT0A 2J7EA 1H2JA 1W9UA 3OZOA 1V03A 3ZR6A 2WMFA 1B3YA 4NI3A 3T09A 4B16A 5GNZA 4MB5A 4TX6A 1TQUA 2WMIA 4CCDA 5M5DA 2V3FA 4DO5A 2W5FA 3WNLA 5CPTA 3A4WA 8A3HA 3PZTA 2EPMX 2CYGA 1NP0A 1MW3A 5JBFA 3D51A 1XH1A 2J75A 4MNLA 1J9YA 3SCRA 3EMQA 4PMYA 4TTUA 3A4AA 2ZIDA 4UOJA 4C7FA 3N9KA 3B8SA 2G41A 3SUTA 3LRMA 3CUGA 1WE5A 3HU7A 2DSKA 3GH4A 3AXHA 4PMZA 2YL6A 2ALWA 1NWSA 1Q6FA 4EANA 4J3VA 1M04A 1VB9A 3ZR5A 4MDPA 2QPUA 2VMFA 1UD6A 1YQ2A 2XIIA 1J0JA 2XPKA 4ATWA 1ITXA 3AXXA 1KGXA 4CD7A 2YJQA 5CSYA 5JUVA 3B9DA 8CGTA 3NJ3A 2YL9A 1W91A 1LL7A 5GNYA 3TTQA 1B30A 3BLBA 2VQTA 3CZGA 3VPLA 1UKTA 3DHPA 3DYMA 1KGUA 2WCGA 4AYSA 1VFUA 3WEOA 4KH2A 4CKQA 4HP5A 1ISYA 2OSYA 1HJUA 3LRKA 1JYWA 4QAWA 1TQTA 3II1A 4D6EA 3WELA 2XVPA 4U3CA 3BVUA 3AI0A 4B9YA 3VOCA 1CYGA 3GXMA 3VILA 4AZGA 5JIPA 2OW7A 5DT5A 2XVNA 4X0NA 2ZUNA 1JZ5A 1GVIA 2QF8A 4AC1X 2EO7A 2WC3A 4MPKA 5DMYA 4S3KA 5IFTA 1QWUA 1E70M 4FK9A 4GZIA 4W89A 3U7VA 3POCA 1I75A 2BNJA 3BAYA 1M7XA 2FH6A 1HVQA 2EQDA 3T08A 2PF0A 1TE1A 5FL1A 4H8HA 1TQWA 3TOPA 3VUPA 5I2UA 2V38A 2WLZA 4BQ5A 2O9RA 3K4AA 1N82A 3NCOA 5HOSA 4P7QA 2J7BA 1AMYA 1DWGM 1NH6A 5FCZA 3CUFA 3CUJA 3L4WA 1CPUA 1PZ2A 3SURA 1GNXA 1GJWA 1OGBA 4BQ4A 5BXPA 1O6IA 5A6BD 3WD4A 1MXDA 7A3HA 2EPLX 1XSKA 4KWUA 3O6AA 4LQ1A 2RGLA 1JF6A 3BUDA 2PWHA 3IGUA 1TA3B 1UKSA 2NW0A 3BGAA 3WH5A 1HN1A 3THDA 4PMVA 3VIJA 4P7LA 3L4XA 3VIMA 3AZSA 3UEQA 4U3AA 2OWXA 2PC8A 5HDRA 4AZ7A 2VZSA 2UY5A 2PWFA 4M56A 3A21A 5E09A 3WQ4A 4PYSA 1B31A 7CGTA 1JYVA 2ZUSA 2UY3A 4UTFA 3VIPA 2WWCA 3WY4A 3L4ZA 3BCDA 2XFYA 3PZNA 2HVMA 2E9MA 2CHNA 4ZFMA 3WNPA 1XV8A 3W0KA 2FH8A 1RP9A 3MI6A 2PWDA 1E4IA 4ACYA 5E9AA 4WIWA 3WD2A 4R5EA 3BC9A 2QHAA 3O2LA 2GJXB 4CD6A 3SUWA 3WUBA 1OIMA 3VIIA 1FA2A 4FLRA 1J18A 2CHOA 4ATLA 3JUGA 3F5KA 3HN3A 3VDHA 3MANA 3WN6A 1CGUA 7TAAA 1BGGA 3VIFA 4DO4A 1MYRA 4JCMA 3N11A 3BAIA 3SIMA 1V02A 4DM1A 1C3FA 1ZBVA 3BVXA 5BCAA 1CXIA 2WM0A 2ZWYA 3EJUA 3DX4A 3A6OA 1I1XA 1OWQA 3CMGA 4RE2A 1OM0A 4HOXA 2X05A 3POHA 3UG5A 1EQCA 5E0FA 1NARA 3RDKA 5C8BB 1RP8A 4ACZA 3AIEA 4BQ2A 2ZX9A 5LA1A 2CBJA 4H04A 3RM9A 3WF2A 1VEOA 2DSVA 4PTMA 1UYQA 3LPOA 1KXQA 1EHAA 1UKPA 3WNNA 1DEDA 4Q7NA 3U5YA 2ESCA 1X6LA 1CGYA 2E9BA 1ZJAA 1EQPA 5E70A 2D0FA 2D73A 1TUXA 2MANA 1QBAA 5M17A 4KMQA 3CZJA 3TTSA 4UQBA 1UHVA 5CPSA 3IANA 2C7FA 1CBGA 2PWGA 4UNIA 1UWIA 3RIKA 2V3GA 1XC6A 2YBTA 5A8MA 1KWGA 4RE4A 1BTCA 2VUYA 4UOZA 3ZJ6A 3VM5A 1HKKA 1JNDA 3CIVA 1P6WA 3D3AA 3CZLA 1GONA 3RJYA 5A8OA 3VINA 4CD8A 5BROA 5D9NA 2CBUA 3U5UA 1OIFA 3T0AA 4JKKA 3D4YA 1JZ3A 3VM7A 1J12A 5ABEA 1HWWA 3ZIZA 2YDSA 1UD3A 4PMDA 4TTGA 4HOWA 4H2CA 2EABA 1V0MA 1HJVA 5DFAA 3KLKA 4UQAA 4HA3A 1BHGA 3H55A 1BLIA 3PTKA 3MMDA 1W3KA 1LL4A 1CXFA 5IHSA 2XN2A 1A47A 1NWUA 2J8FA 3LXAA 3OB8A 1OT1A 4W93A 3I3DA 2WK2A 2WZIA 4V27A 1G9HA 2O9TA 3SCSA 1TZ7A 1WZLA 3GNOA 4KRUA 2XFRA 3CHCA 5CGMA 3AHZA 1O7AA 3PN8A 1B90A 3PBGA 4W87A 1R7OA 3AHXA 1ZBKA 3QOMA 1ZBCA 4F9DA 1QW9A 1EO7A 3LPGA 2FHBA 3CUIA 3MUAA 3RO8A 2E8YA 5CPQA 1B0IA 3VVGA 1DWHM 2YFNA 1UA7A 2YLAA 4F66A 3PZQA 1B3XA 2F7PA 3OG2A 2YA0A 3WQVA 1KBKA 2XM1A 1SMDA 3VD5A 4WLCA 3CZEA 2DH3A 5ECUA 1W9DM 3PTMA 3M46A 5A8NA 3NYDA 2J74A 3N15A 1XH2A 1GW1A 2BS9A 1BAGA 3FY1A 4B9ZA 4PCSA 5E1QA 3RPMA 2YKKA 1C91A 4IUGA 3KLLA 4DWSA 1W1TA 3BAWA 3TTYA 1HNYA 3DDGA 1KTCA 3MUY1 4CN4A 3GXNA 3WD3A 4JIEA 1CENA 3WF0A 5ABHA 1ESWA 3OBAA 3L4YA 2WZHA 3W28A 3GBEA 1E6XM 1V3HA 2Q8XA 1E6NA 3CH9A 3N13A 3EDEA 2Y8KA 3MS8A 1UD8A 4BZYA 2X0YA 3OGRA 4P8VA 2OYMA 1XCXA 2G4FA 2A3CA 3RCNA 2WANA 4J3UA 2WBGA 3GTNA 3B9EA 3WD1A 2VT0A 5F7UA 2CKRA 1R46A 1MQRA 1FH9A 2E3ZA 2GJRA 3WDHA 2WKLA 2F8QA 3KEHA 3GM8A 2DQXA 1G94A 2DPEA 4AZ6A 5BRPA 3WH6A 1K9EA 3VDCA 3AFBA 1CTNA 1JFXA 3RM8A 1E9LA 5EFFA 3ECQA 5M3WA 3AJ7A 2B31A 3AYRA 3PZUA 2YA2A 1BFNA 2JALA 2WMHA 1JDCA 3TP4A 1V0NA 4FLQA 5A2AA 4OBRA 5LYRA 4P8XA 4YN5A 5A6SA 3QHNA 3ZJ8A 1JGIA 3FAWA 4U5IA 1R33A 2J7DA 3VX1A 2VVSA 2D3LA 2VZUA 2X2HA 3ALGA 4W8AA 4L4PA 5AC4A 5IDIA 2WBKA 2FDMA 2J78A 2NSXA 3AXIA 5I77A 4W86A 1PAMA 3KZSA 2CIPA 1QHOA 3AIVA 3TONA 4B15A 1GZJA 4NX0A 5I6SA 3H53A 2EBNA 2QMKA 1JYNA 2J4GA 2YDRA 2DH2A 3ZSTA 2GJPA 2CNCA 3AQUA 1HKMA 3S5YA 4ZEPA 4W5ZA 4MB4A 4QP0A 4AXNA 2EACA 1H09A 1NP2A 3IAQA 4AZ5A 2CEQA 1DWFM 4GO9A 5GQBA 3GDBA 1OD8A 3EJRA 3L4VA 4OOZA 1LF1A 2VRKA 3F4VA 1KXVA 1TCMA 2DIEA 4AMXA 2GDUA 2Z1SA 2PB1A 3VMOA 1V02E 2WVVB 1HKIA 2BHUA 6A3HA 2W63A 2GUYA 4BS0A 1OGGA 3AYSA 1KXTA 3E1F1 2A3EA 1CXEA 1WNOA 3ZO9A 5FL0A 1UA3A 3CTTA 4GINA 3OLDA 4ZENA 2O92A 4XZWA 3ZJ7A 1E56A 4U33A 1VEPA 2J25A 4OBSA 1WZMA 4UZSA 4P7RA 1UUQA 5FOOA 3OA5A 2WHMA 4HPGA 4AY1A 4JFWA 3W6LA 1C7TA 4AD1A 3UR8A 2O9PA 4W84A 1CXKA 3ZT7A 1OCQA 2G3MA 1SR0A 4JKLA 2PWEA 2VI0A 2D22A 1BG9A 2WMKA 1XRVA 3WSUA 1UD2A 1KQYA 1MFUA 3BVWA 1J0YA 1V6VA 5HPCA 4TVUA 1G0CA 4ML4A 1QNRA 2G3JA 2WPGA 4X9YA 3A47A 1TQVA 1K9FA 1D3CA 3HG5A 2VO5A 3UG3A 3BLPX 1J01A 1K6AA 1PIGA 4FNTA 2OLHA 2ZICA 4XX6A 5BYWA 2V3EA 2XVKA 2WCSA 2BXYA 4B3KA 3ZMRA 4F8XA 3BVTA 3VIHA 3A3HA 4OGZA 3ZSSA 1R85A 4H8VA 4QLLA 2XHYA 4FLSA 3APGA 5I0DA 2WMIB 1M01A 2CBIA 4KGJA 4P8WA 3AIUA 5AC5A 1WDRA 1CDGA 3QHMA 3VO0A 1E6RA 1FHLA 1NWRA 1E3ZA 4NXKA 4IPNB 1E71M 3VTRA 3WIJA 3UESA 4CN6A 2F1BA 1W9BM 5EBAA 1VAHA 3WY3A 4HA1A 1BQCA 1QI4A 3AMLA 1BGAA 4M24A 5CGTA 3VGGA 3SCUA 2YFOA 2UWFA 4DUWA 1CEOA 2QV4A 1W9PA 1ZU8A 3VSVA 3VGEA 3AMGA 4GXPA 3CZSA 5I24A 3CZ8A 3EMCA 3I3BA 5CLTA 1GORA 1J0KA 1AVAA 1KCKA 3MMWA 4M82A 1E43A 4QFUA 3VIOA 4UCFA 2W92A 2ZUWA 1JAKA 4V28A 1QWNA 4AIOA 1R75A 2VNCA 2WHJA 2WMJA 4H41A 4D6HA 1EH9A 3KL0A 5CXPA 3N18A 2NT1A 1UOKA 3VIGA 4CN1A 4J3TA 3W25A 5BRQA 1UR1A 2F61A 5A8QA 2DSZA 1F4AA 1V3IA 5EB8A 1JG9A 5A6JA 1QW8A 4PUEA 2DSWA 3OZPA 2OWCA 1KBBA 3WEZA 1V3KA 3WY2A 4JFTA 1HJSA 2D1ZA 3NSXA 4MB3A 1UR8A 3RM4A 1ZB5A 1R7AA 1W9VA 3AOFA 1GQLA 2X2JA 3N17A 1OD0A 1E4LA 4DO6A 1L8NA 2CETA 3EJQA 4EK7A 3UETA 1I1WA 2EPNA 2VRQA 3GH5A 5E0CA 4F9JA 2IUZA 1DHKA 4UFHA 2GK1B 1XH0A 1GOWA 2A3HA 4L4OA 3WH7A 3ARPA 1HP4A 2TAAA 2ZE0A 1KGWA 3ARXA 2OYKA 2D3NA 1GQIA 2VZOA 4AISA 1H5VA 4U2YA 1B3ZA 1V6XA 5AY7A 1OINA 5JBEA 4GIAA 1YHTA 3LPFA 4TVCA 1GOMA 3VGDA 3PZ9A 3AMDA 1OSEA 3PZMA 4P7NA 4XUYA 3AICA 3BMWA 3GNPA 3K46A 1X6NA 4TXEA 4EAMA 1FHDA 2WKGA 1ODZA 2X2IA 1TMQA 1W2PA 2F2HA 1NOWA 3OGSA 3VD7A 1VF8A 1LLOA 4D6JA 3ARUA 3WUGA 2C8NA 3A5VA 4Q22A 5A2BA 4HZ7A 4J3WA 5D9PA 3T0BA 1GHRA 1US2A 1EGZA 4E4PA 2WW5A 3ZT6A 3BAXA 3VSUA 3M7SA 5ABGA 5IHRA 4AD3A 4YHEA 1GCYA 4XB3A 3AS2A 5KZ6A 2ZX5A 4AZCA 1M03A 3G6LA 5A95A 3BAKA 1UD5A 5JIWA 1GUVA 1QI5A 4JKMA 2OSXA 1DWIM 3SUSA 3HJEA 1MQPA 1Q6EA 4CVUA 3I3EA 2FHFA 5CLWA 1UWRA 1HJXA 4FNSA 1LG1A 3T2QA 1G01A 4E2OA 2BVTA 4IISA 2DT1A 3DX0A 4FF5A 1H0GA 1GPFA 2OWWA 5ABFA 3CGTA 4CCCA 4AD5A 4ATDA 1H3GA 1E6SM 1GOIA 1WAWA 2J47A 4PTVA 3ARWA 1G1YA 2D0GA 2WCAA 3WNKA 4WJXA 2CPUA 5BWFA 4MJ2A 3SCPA 1C8XA 5A6BA 3UG4A 1UH3A 1HJWA 4EKJA 1G5AA 1R8LA 1XD1A 3LXCA 4RL3A 2RGMA 3GXIA 4PSRA 3ZM8A 4D71A 1UZ1A 3WMCA 1VJSA 2NT0A 4OOUA 1XGZA 2QMJA 2VJXA 2G3IA 2EEXA 2OSWA 3CC1A 1AQ0A 1CNVA 4LGXA 4AZBA 4V2XA 3J7HA 4WKAA 4ACZB 2CXGA 5D9MA 3BMVA 2VCCA 3DX2A 4PMQA 2O9OA 5HBFA 2E40A 1RD6A 4D6DA 1E6ZA 4TOQA 2WAGA 2VX4A 1GJUA 3AMKA 4WSKA 2D2OA 1PX8A 1J11A 1V08A 1WZKA 3VKKA 3SCQA 1E6PA 1C8YA 2FYVA 1XSIA 1QNOA 3M6DA 4YPJA 2F7QA 5TD4A 3WMSA 1XSJA 2XUCA 5I23A 1JYXA 3KL3A 1VRXA 3ARTA 4TX8A 4GI6A 1ISXA 4PCTA 1VFOA 3FW6A 4WKHA 3WF4A 1FFRA 3LX9A 1JZ6A 1UZ4A 1UR4A 1B2YA 1JFHA 1HX0A 4JAWA 1M53A 3MSGA 1H4PA 3W81A 1BYAA 3PZOA 1E5JA 1AQHA 1BF2A 1J0IA 1NOFA 1XHGA 4E8CA 2PI6A 1WDSA 2BVYA 4UQEA 1NM9A 4CU6A 2VL4A 4W8BA 3KE0A 1MW1A 1CXLA 4UFKA 1SYTA 4U5KA 1RPKA 1QVBA 3GH7A 1JI2A 1D7FA 1CECA 2WYSA 2D23A 2A3BA 3N12A 5A6MA 3VX0A 1A3HA 5D4YA 2FE0A 4GQRA 1B9ZA 4XV0A 2DGAA 2EPKX 3AS3A 1FP9A 1L0PA 1FP8A 4FNPA 4QLJA 5DEZA 3EBVA 3WUEA 1C93A 2J7GA 3PTQA 3NDYA 2VCBA 3BCFA 1KR1A 4CCEA 4PN2A 3VIKA 1J0HA 1Q6CA 4M1RA 2V5DA 4OUEA 1W1YA 2W61A 1CGXA 3AS1A 4HZ8A 4UFMA 1XCWA 3K4DA 2VVNA 1KR0A 3VD3A 4W7VA 4Y7EA 2WSPA 3QGVA 3NIYA 1ODUA 4BQ3A 2QPSA 1UWUA 4W7UA 3ZOAA 2WVUA 4Z2LA 2D20A 2X0HA 2XSAA 2WC4A 3DX1A 1FOBA 1ITCA 5A8PA 5E6ZA 4MB1A 3W4RA 3A22A 4JHOA 2Y8VA 1MVYA 1WB0A 2EAEA 4UQDA 1E0XA 5A6LA 2J79A 2BY0A 2EADA 2BXZA 3BSHA 2JFEX 1V0KA 2WWDA 2F1AA 4JZ5A 1F4HA 3EJSA 1JZ7A 4DWSB 3K8MA 5DF0A 3AHVA 2WSKA 1CWYA 5HNNA 1EA9C 1E1EA 1QHPA 1ZBWA 5FD0A 1PZ3A 1FFQA 3S5ZA 1E4MM 3L2MA 4C7GA 4YHGA 3VDBA 1ZS2A 1HJQA 3T2PA 2F7OA 4WF7A 3OGVA 1EO5A 1EXPA 1QBBA 5FIPA 5IXEA 2WNWA 2GVYA 3LXBA 1DP0A 4OIFA 3BVVA 3EDFA 3VD9A 3W26A 4NZFA 1XD0A 4MNJA 4OKDA 3BUIA 3D50A 2XN1A 1W3HA 3IJ9A 4P7OA 3ALFA 4QLKA 3VD4A 3RJXA 5HXMA 1KWKA 2XTKA 3PZVA 1BYCA 2VZVA 3D5HA 1MQQA 5LA2A 1PEZA 1BYDA 5BXSA 1MW0A 4H8UA 3BUBA 5A1AA 4BF7A 1QI3A 1R86A 3AIWA 4S3JA 5FKYA 2VZTA 3CLWA 3DHUA 1JNEA 1LG2A 1SZNA 3O9NA 1H49A 3AZRA 4LXFA 3OIHA 1MWOA 2XGIA 2E4TA 4GZJA 1E15A 2DT0A 2PBGA 2JIWA 2VTFA 3T2OA 4MJ4A 3HZ3A 1E6QM 5I79A 3LPPA 2GDVA 4UR9A 1JI1A
chains in the Genus database with same CATH superfamily
3B9KA 1D8WA 4DZIA 2KI6A 4HVBA 4QQUA 4PJFE 1N8FA 3B0PA 4WJ5A 2W67A 4G6MH 3O2DH 3VA8A 3B83A 2B16A 2EXOA 3H7BB 1WP6A 2QW5A 5EZIL 1NOLA 3CFJB 5M03A 2AZAA 4ONVA 2QPEB 3TYGH 3AROA 2CIIB 2V3DA 4LW7A 5CKGA 2VQ4A 1LTXA 4AG4H 1ZLPA 3G1FA 4OLYH 1UUOA 5J9PA 4B9KC 4LCUA 2ED7A 2G9HB 2Q7AA 2QQLL 5CCKL 3KS0J 3L4UA 3G6AA 4G9FE 1VBUA 4F2FA 3CWGA 1ZVHA 1AJ7L 4NBXB 3RNKB 5HAOA 4MMZA 5BNKA 3WQDA 4S23A 3ZJAA 3UJFA 3F2CA 3EO0A 4WK9A 1HT6A 4H44C 1AUSL 2QCDB 5M2FX 3FJLA 2VE6A 1RUKH 1IXQA 1ADWA 1RZ8B 1OSZA 4D6FA 2VDOB 5IMKB 4HUWB 2NY6D 5EZOH 3CQJA 1TTGA 5CZJA 1BQLL 4XBPB 2OX1A 2QTEA 4Y1AE 4ZQRA 4J28A 4WI8A 3QPQC 4G7YH 3UBXG 4Y16C 5CZVL 1HXKA 1TT6A 3UNDA 4TQPA 3EOYG 3SDAB 5F1OB 1LQ2A 5PTDA 4XKYB 4E9SA 3ZKQD 1I7ZA 1V0LA 3CAVA 4HKBB 5IRPA 4LSTL 4Q2ZA 3LEPA 1R34A 1HH9B 2O6CA 4KK8D 5HNUA 1F4YH 4AYDC 4LLQB 1JMZA 5B1KA 4C6IA 3NA9L 3D12B 3O8XA 1UIOA 4UI2A 3TE9A 1WIPA 3T40A 3UCDA 2GSEA 1ME7A 5HPOA 3GMMB 4LKXA 3KCPB 5DZAA 2WTPA 4JJ5B 3W2UA 4AMWA 3L81A 3V6FA 3C87A 2OPJA 1XLJA 3QNYA 4WY7L 4AFYA 3MV01 4YHKL 3WQ6A 1CD8A 5DRZB 5I75B 2VOTA 1G67A 4GS7B 1RZQA 1T80A 1LOLA 2VN3A 2AZUA 4BKTC 1WFTA 3L4TA 1NSNL 3AU0A 2FTPA 2IGLA 4OQ1A 3QS2A 3BPLB 5J5RA 1DJHA 4JPWL 1SHWA 3Q0HA 4DWSD 4N26A 4Y9GA 4JQXA 5D1ZD 2NX5E 2C4XA 1T1XA 2DYSB 4MNMA 2VXUH 3VOGA 5D72L 1Y5VA 1KTBA 1TITA 1YEKH 3OZ9H 3MU7A 3CNKA 4JG5A 2E6PA 4IRSC 3D18B 3P67A 2BVEA 2CKSA 4CMMA 3SY0A 2FX8H 2O5YH 5CHNA 3HJZA 3WK1A 4FR6A 2Y5EA 2YN3A 5EF0A 2C1OA 1R9FA 3MRRA 2CDGA 4C47A 3U7YL 4PTUA 3PHAA 1D3HA 4FKKA 4X83A 1JF1A 1YEJL 3RTQB 3IDNB 1QU4A 4F8PA 3VMPA 4OGXL 2DAVA 4JNYA 1NAKL 4ZUWA 3BL3A 4K23L 3EF4A 3QFJA 3NZQA 2WZ0A 5E9DA 4UTHA 1XDLA 4Q9QL 4ZX4A 1JXJA 3ZDXB 3L3GA 4KKPA 3CX5K 2NWSA 3FCSA 2XHNA 5ANHA 1PD1A 3EXLA 1NLDL 2FGZA 3VI4A 1JD7A 4AWSA 3JWNE 2A2QT 4LLDA 5GS2H 1E4NA 2VFIA 2BB0A 4G6FB 4EOWH 4N0YH 4O10A 4NKIL 3UC0H 5I6XB 1BVLA 3QXTA 1A7RH 4S3DA 3OSKA 5FAJA 2BY2A 3DJTA 4NNXA 4Z7WB 1EMTL 3MHFA 1A6WH 3ZDZF 5IGXL 4YNYB 5CAYB 4PB0L 4PUDA 3ITXA 1BV8A 4NNYB 4LJ3A 3H3BC 4LLYA 3OLGA 1P0BA 1JHKL 1ECYA 3WNMA 4PS3A 3D85D 2R69L 5IB2A 4PUMA 2PSNA 4XR8C 1T22A 1OBAA 4JICA 1UB6A 1U3JA 4GBXD 4HPNA 5HJ3B 3HUJB 4OF6A 4NG3A 4PEKA 4Z7UE 1VENA 3OF6D 4MD5A 1K7XA 3S4SG 4O0QA 5L8KB 1LO5A 1XQLA 2PO6D 3CJJA 3FJ6A 1FJ1B 3VFLA 4ODVL 2ON3A 3BZEB 2DKSA 3IMTA 1KV3A 4PBDA 1AANA 1KCWA 1S9XA 3QDJA 1NWTA 3KVLA 4ZSOA 3FZUC 4F7TB 5BZDB 3JV4A 2H1XA 3VWKB 4F7MA 3AU2A 1ZENA 3EG9B 4N2OA 4YIQA 1A64A 3CXFA 2VN4A 2W60B 5D1QB 3OQ8A 4QHPA 2Q3OA 2A9DA 4Z7NB 4PMRA 1UPMB 2GBUA 4A7GA 4NUQA 1S1RA 3O2DL 3DJRA 5IR1A 3W71A 1N64L 5C0BB 3SOBL 5DMGC 1K8DB 3O6ML 2A6DB 1YEYA 2GVGA 2D3VA 5SX4I 1OPGL 3LRLA 4MM1A 5EUOA 4L3FA 5GISL 2VIRA 2X6MA 1P5VA 5MEPB 5LBSA 3I50L 3UYIA 4LAOA 1T3FB 3ZE2F 1DXEA 3MYJA 1J8HE 2CM6A 5FOBB 4MB5A 2QDGA 2ETWA 3IMRA 3G8EA 3QFWA 2ZYHA 1S3RA 3LAFA 3TJEL 4YYCA 1MFDL 1XB6A 3PGCA 4XWUA 3MI3A 3NZPA 1CDUA 1PY9A 2ZRUA 4ODSL 4R3UA 3K6OA 1VP5A 3HMXA 3EB4A 2HN7B 4H7ZA 3U8GA 3DTDA 1JNHA 1JCVA 2XPKA 1D6VL 3W7NA 1YXYA 1KIRA 3PNZA 4TUUA 5FM8A 5JZ7C 1F58H 1E2WA 3V75A 2ZRVA 2FJHB 4QTIH 4JXCA 2GCYB 2WQRA 3QR0A 2E9JA 4K5MA 1OAJA 1SDAB 4KKAD 4U6XA 5E1AB 4DNHA 1G7IA 3RUGF 12E8L 2OMYB 4AZGA 4ZXBD 3T6ZA 4W6WB 4NQEA 1J8KA 3W73A 4U10A 5J12B 3ARDB 2QLVB 2EO7A 4AGMA 3BLIA 5AC8A 3HPJB 4O4YH 4B27A 1RZKL 1LO4H 2IC2A 2A6JA 4AGPA 3NCOA 5HJYA 1IGJA 4JHAH 4XHQA 5JUEH 1DZ0A 4YXLH 4RDZA 5EC1A 1ZA6B 4RV8A 5GRJH 1XISA 3DK0A 3E6FA 2VDNB 4TNEA 2PXYB 3RPKA 1BDYA 1OTUD 4FA8A 4J2MA 1RCQA 3ZE1F 4U3AA 1JP5A 1AY1L 2GTZA 3HE6C 3WQ4A 4U1SA 1FVCA 1UA6L 4TM9A 1PF3A 1D7CA 3FUIA 3P0VL 5D6DC 2CHNA 2B0SL 4HQQL 2YRLA 3FKUS 1XF4B 3NJMA 2QHAA 3FQXA 2OMTA 3VFPA 4GAGH 4H9TA 2IFFL 1BGGA 1CGUA 3XISA 2HUHA 5DANA 4JCMA 3NQ8A 3IFNL 3VG9C 3Q13A 1SY6A 4D9LH 2KS0A 1YEWA 2HKFL 3JTSB 2FBOJ 3WV0A 4C6FA 4WD0A 2HT3D 3MBXH 2CLRA 5G4MA 5LA1A 3W2JA 1WX0A 2E1DA 4LCYA 4M7JL 4NZUL 3U36B 2EUZA 1EHAA 4GACA 4JFED 3OV6A 3LN9A 4JB9L 2C1HA 4PGCB 6FABH 5IT2H 1CGYA 3I7SA 3CAFA 1THAA 2QCGA 2ZWNA 1UHVA 1HH6A 1R6VA 4L8DA 2E3VA 3E8UH 3RVWD 4KNUA 2XWTA 4ZMTA 3TW6A 3RURA 1Q7QA 3BN9C 5EORH 2UXTA 2K4WA 2H1PL 3UZJA 4R4NC 1ZGDA 1HG3A 1KB5L 4DPCX 2B77A 3OXSA 2QDDA 2LT9A 3H2WA 3ZIZA 4HOWA 2RBLA 1Q0XH 1MZZA 3N3MA 3HA1A 4UQAA 4X6CF 1BLIA 2HMID 3PGFL 3DROB 1CXFA 2GG1A 2OMVA 3R25A 4PA8A 4P5RA 4WI2A 4YO0A 1ZCCA 3ARFD 3MNDA 1ZFJA 3QPXH 1AK5A 1OAKH 4RIRA 4FQ2H 3AHZA 3QXVA 5DELA 4ZYKB 5IB4B 1ZBCA 4MLJA 1J9QA 4XMUA 2CZDA 4Y89A 3MUAA 3ZBMA 1KGJA 4NQQA 3SBWA 4LSQL 5E8EA 3LNEA 3UTZB 1FZOA 1AXSB 3ISIX 1KYUA 1UWEH 2ACSA 5F4SA 1WV7T 2F7PA 1ND0A 1JPST 1BF8A 3UBPC 1KBKA 3S2MA 1U6AL 2F54A 2DQJH 3JTTA 4E5XB 2XCMC 1EHLH 4ZMLA 1R3TA 1IKFH 1KIQA 3E0WA 4AK1A 3TTYA 3ZZQA 1A4AA 1IX2A 4WDUA 4WEVX 3L4YA 2KAUC 1OFDA 4N0UA 1T99A 4HW6A 3LNDA 4F9LA 4J4PC 1YADA 2X0YA 4Q33A 3B9KD 4J3UA 2VT0A 1INEL 3QDGB 1AI1H 2WUBL 3GMQB 3R7RA 3OHXC 5IQ7L 4WEBH 1WFIA 3RQ3A 3QG6A 2KZWA 4JQIH 1M7DB 3HGRA 3SIZA 3GD6A 2X89A 5E93A 5BUGA 2HVJA 3AFBA 2HTKC 3VOIA 2DZUA 3URNA 5EEZA 1D9EA 2OPCA 1PSKH 3TP4A 3OVPA 1X7TA 4LVHC 2V5BA 1CLYH 4N3UA 1IAIL 1V5JA 2DTML 2X2HA 2NYZA 1IGWA 1QSFE 3FRPB 4AM0B 5EBWA 2QVKA 4YSUA 4B15A 1OWWA 4HD5A 3FLUA 1DQJB 4QP0A 4AXNA 3VFWB 1WT5A 2VR3A 1EQWA 5CC7A 3IT8D 2DLFL 2WBJD 4PB9L 5I73B 4ZFOL 4JQVC 3WXWH 5FL0A 3PSWA 1CDJA 1JGLL 3HC3H 3T6WA 3B9NA 4OF8A 3D33A 4KKBC 1TO3A 4BYHA 4GGBA 2UZYB 4UZSA 4OQVA 3M0KA 4J3OH 1C7TA 1DVFA 4ISVB 3UU0A 3VWJB 5KAQG 1BGXH 4AF0B 1BG9A 4LLVA 1MFMA 3L21A 3FU8A 3SJNA 4A8IA 3RX2A 4JO8A 1R3RA 1EBHA 3O8XD 2LGNA 2WPGA 3QEGL 5IMOA 2G2NA 3E02A 4Q9BA 4PJ5D 5TGBB 5F88A 5CN3A 3ZTJG 3FTXA 2ZOUA 5BYWA 3ZMRA 4O17A 2Z1BA 35C8L 3DO7A 3A3HA 3EW3B 1MZHA 1C8VA 2XHYA 5I0DA 4KGJA 1WIOA 2JCWA 1HEHC 5FYLE 1C08B 4KQNA 3MSPA 3VTRA 3OZLA 5JNYA 5T1JA 1CD9B 4B95C 4C4UA 1KRMA 3ABRA 2ROXA 4M93C 4REQA 3H9ZA 4PR4A 1RJYA 4M6OL 1LOQA 2QCLA 1MIEH 4MZIA 4DO7A 1E43A 3VA6A 4GAGL 3NN8B 1M6OA 1E9YB 2PRHA 2OZ4A 4GY7A 4MRBA 1S2CA 5KSAC 3KL0A 3S3BB 2AJVH 1MCOH 1K70A 4DGVL 4BKSC 4JY9A 4Z6AT 3R7QA 2XZQL 2IXQB 1TLKA 3G5YB 1W9VA 1VLIA 3T42A 3L16A 3VQLA 3W00A 4P2QA 3TFKD 4HHAA 4MAYA 4YLCA 5FEWA 1BJ1H 2A3HA 2CMRL 3ARPA 2GITB 4F7EB 1CB7B 1HP4A 2DL2A 4H13C 1NWOA 1ZT4B 1KGWA 5AZEL 4KY2A 2RQEA 5IV2A 4M6PA 4LRSA 4BRVA 3QFJD 4HK7A 1W0MA 3IRCA 5E9DD 5T1DH 1VS1A 3RHWF 1PJWA 5I30H 3CV6A 2F2HA 3REQB 4NHCL 1OP3K 1U8CB 2AEQL 2AANA 1AD4A 2VABB 2VXVH 4AD3A 5FK9B 3EGDA 3UPRB 3QLLA 5A3ID 4KRPC 2VDRL 1N6VA 4XAFA 1K6QL 2B15A 3HJEA 2BLEA 3UR5A 1BPVA 3I84A 3CB8A 1G01A 4IISA 1H0GA 5IHUH 1T4KB 4NJIA 3F4NA 5ID1B 1NGPL 3FK3A 3QVAA 3ELAT 2X0WA 3IKKA 4AENA 4MJJA 5GS3A 3TBWA 2WQXA 2PP0A 4QE4A 3GTIA 4FQIH 3EHBC 3ZL1A 4LCWD 3EGSB 3E2HC 3BD4A 3KHOA 4X4XA 3DG7A 5DWUL 1B4JL 4QM1A 5E5LA 4PRDB 1ZJHA 2X4QA 5C0IB 4YDKL 4KRZA 2VCCA 2YR1A 3QDJD 2FRGP 5D4QA 3KPRE 4LVNB 2VX4A 2HLFC 3TEXA 2QKIC 1WBXB 4LKCB 3QF0A 1XSJA 2Q86B 4NCC1 4Z23A 5IHLB 1JGUH 1VFOA 3L3KA 1I3UA 1JPTL 3IDJA 2OKMA 2QVFB 4ANKA 4DF9A 25C8L 2Y72A 2HWZH 5HVGB 4UNVA 4DERA 4FP1A 2B2XL 2VL4A 1GAFL 2O5XH 5LIXX 5TDOA 3WLLA 3GR4A 1R3SA 2VLLA 3HLAA 4IYKA 3UZWA 3OSVA 4LFYA 2QUUA 3HQPA 1ZSXA 2DMHA 4JIQA 4PY8I 2VDQL 1LP9A 4LSRL 2J8HA 1A0CA 5E1HB 2AQ2A 2BVPB 1DBMH 5F2MA 2E6YA 3SJVB 4GYKA 3M7OA 3D25B 3PWLA 5E6ZA 1RFDL 2E7MA 3A22A 3QXDB 3P9WB 4WGHA 2DMKA 2BCKB 1QBLH 4XBJA 5A6LA 2E7HA 3FF7A 3G0UA 3A4EA 2WWDA 3RHWK 1XW8A 3H2CA 1P1VA 2CK0H 3A6BL 5KJRH 3WCZA 1XPGA 1K03A 4LEOB 4Q6IA 4DI8A 1K4DB 4YHGA 3OJGA 3CO8A 1G9NH 3RG6A 3ZKMD 5BOJA 1L4IA 4FQXA 3RRQA 3NSFA 2GLKA 3G1AA 5FIPA 4NQED 1DVQA 2AKRA 4KO6A 3SDCB 5CJOL 4Y9FA 3TXAA 4O52A 4D8AA 1XD0A 4IDJH 3D50A 3MN8A 4L3EA 3AT9A 4LOEA 5F0LB 1PZSA 5DEFA 1MHHA 2A6LA 2CRZA 3OKKB 2YLKA 1A14L 2G2RA 1MW0A 3L0KA 5CGQA 3GSUB 4KKLC 2CO4A 3BZFA 3EBIA 3AIWA 4JY5L 4BSWB 4XPAL 2EXSA 5TE6H 3DOSA 3WLOA 1MWOA 4A2LA 4N3TA 4MOZA 4XISA 5LGHH 4KI5D 5IQ9B 1E15A 2OMAA 3SKNA 1O68A 3AWOA 1KJ2L 1VKFA 5EBMB 4F3FA 2IANE 1NICA 3QI9C 3VXRE 3VD2A 4IXHA 2P48B 4PS4L 4GQQA 5J13C 3W1AA 5LKYA 1E5AA 1NIFA 1U8QA 1JDAA 1RCOB 1Z66A 1AGBB 4E2DA 1UMLA 3V4PA 1MIEL 5DFVD 3CN4A 2XZ7A 5HJLA 2V5LA 4MA8H 1PKOA 2DDXA 5I76A 1ZL1A 2KPNA 5F6IB 4X4ME 1L9SA 3GNML 3RZCB 4I3RH 3DSFH 4KNQA 4FFWC 2BNUA 3C5JA 3E6HA 4W4NA 1BQRA 4PU2A 5ISZE 1JGEB 4C6QA 2VHLA 3O05A 4Y7MA 1MEXH 4HAFA 5C0CE 4XCCH 4PTTB 4A35A 2B08A 3IEBA 4P23B 2NX1A 4NXSA 4PJGB 1FCQA 3B8WA 4ZXOA 4AHQA 2BP8A 1OO2A 4R27A 4OLEA 3F5WA 1PLCA 1RMFL 2J56A 1H15A 4GJ1A 2GGHA 1LEGA 1QMLA 3VGHA 4X6DF 3ABZA 5B21A 1NPNA 1WFJA 4PLJD 2VR5A 1T1WA 2I7SA 1IGYB 1ZT7A 3BW2A 4KRTA 3BH9A 2VO8A 4I7WA 1V3LA 1X97A 2Z1KA 4L1LA 4ZE5A 5CBAB 2HISA 3GMRA 3ILQC 1NDGA 2YAOA 5A16A 5DU7A 3RMEA 4UQ2B 4LX4A 2YDQA 2YSTA 3FVMA 1HKFA 3WKML 2GABA 5IF0B 2WY3B 2EDDA 3HAEA 4XD4A 3DVGA 2C3VB 1K3ZA 1TCRB 2Y89A 1TJIH 3DVIA 4G7EA 1XGRB 1IXNA 1U93B 4CNTA 2A0LD 1YTKA 4ODWB 1Z9LA 1YN7A 4A3YA 1BFVL 5A2LH 3V35A 5C9WA 4Z2IA 4Q6KA 1QX1A 2Z92B 4FQIL 3SN0A 2DT3A 4IP7A 5DQJB 4IBYA 1M1XA 1URLA 1TYRA 1TPFA 2QAPA 2P46B 2YPVA 5I0XA 2F54D 4MPQA 1VPOL 3HNVL 2XVGA 1VBRA 1TVHB 5B39G 4H4NA 1E9OA 4JFSA 4E8DA 4QJ4B 4OJYA 1NCWL 5CJ5A 2C13A 1HDMB 1GGYA 3T1GA 3FCGA 4NNBA 3KWXA 2OYLA 5B39A 4YHMH 4QRAA 4P2RA 3NCYS 1CLXA 5AG8A 2Y5TB 3G6JA 2JK2A 2J7LA 2W0FB 3LMYA 2JEQA 3EPNA 5J8OA 3BCJA 2BSTB 3ARGB 3UWYA 1YMHA 1WDAA 3HRPA 4GO6B 1LO2L 3ZKNC 1R30A 1HYSD 3U82B 3UWVA 1DTUA 5KTEH 3VSTA 4JHWH 2X89D 3IAPA 4ZTYA 3A5FA 2X6BA 4MNGE 3X3FH 4Z7VA 4I0KA 3WEXB 3V0EA 4XPBH 3PXHA 3X11A 1UR0A 1LQSR 5DHVB 4N0FB 4PY8J 4URIA 1CL7H 5GS0L 1R6WA 5HDQL 2B5IB 3TOYA 2VC7A 4NJGA 3UT0A 3GXDA 4FMKA 5CPOA 3FO0H 3P62A 3CWHA 2A1WL 3CNYA 3EDKA 3B3IB 2GIMA 5EL1A 3OOQA 4XD6A 1US0A 4AEFA 2FPVA 5GZNC 1KFCA 6CGTA 2V67A 4LB4A 5EBGA 3CZKA 1EPVA 3NPVA 4LF3B 4X6BA 5C0DB 5C0NC 5DD0L 1GIGL 3SZ8A 1GG0A 1EZSA 2B3IA 2JKNA 1NFKA 3S36X 3SGEH 5HNTA 4ZTEA 4WEMB 4X5XB 5I8EB 2W81C 3HC0B 3TGXA 2CDEA 2VXSH 4OIIL 2PP1A 4RGMB 4I2XB 5JH1A 1S7XA 4NAEA 4A68A 1Q4NX 3L6FA 1ZHLA 4IXXA 4CADA 1AHWC 5EFDA 1BA9A 4ZFCA 4GKZA 3ZVHA 2NDGA 5IJVA 2V5MA 1TZIB 5E4AA 5K9CA 4GSDH 1BREA 3O15A 4CNNA 3EDDA 1CGWA 2F9RA 4XN4A 1T7LA 1QOXA 2R1WA 1PKNA 4AW4A 1V27A 3T4YB 1MFEL 2F8OA 2DP3A 1CLCA 1R3IL 2ADYA 4HC1H 3IACA 3H9SE 4XH2B 5D04C 4AQOA 1VEMA 3DBXA 1L0XA 1YYLL 3RE0A 3CLFL 4B7IA 1EDHA 4CGTA 4G43B 3KPMA 4ZK8A 5BO1H 4OCYL 1YEDB 2E6FA 5BPPA 1ETA1 5C0QA 1FDYA 3QCUL 5CD5C 2VR4A 1HHKB 3HRZA 5DQ9B 4FMVA 5DFWH 5FYKU 4O00A 2Q3XA 4AW7A 4NQVB 4UTTA 3W39A 2FTAA 4M1CC 1EDQA 3CVBA 2C9PA 3NCXA 4Q14A 4GG6A 1FWAC 4I3RL 4OZFB 4DNLA 3LZ3A 3PV6B 4PMEA 1MEXL 4OLUH 5CPTA 3HPLB 3BSMA 3KXFA 3FSTA 3B37A 2LTQB 3C60C 4XMWA 4P2QD 4WHTB 5SWSB 4L9LA 1F97A 3SUTA 4PWGA 4JN2B 2REQB 4PJ6A 2YSSA 3GBNL 3RRAA 4KEVA 5F2LA 4JE0A 5LVEA 4G8AC 4NY2A 3AXXA 5L4IA 2QXWA 2BMKA 2IWKA 4UQ3B 3HGSA 1GGUA 2JI3A 4BKLA 1NEZB 1KFJA 3T8QA 2OSYA 3ECUA 2H26A 4B9PA 4D6EA 2NLJA 3VFUA 1I9CB 4KEUA 5E51A 1CB2A 1T66C 3GLEA 3FN0H 2WQDA 4UDUB 3TVMA 5IFTA 1T5XB 3ITOA 3V0DA 4FK9A 2BS71 3POCA 3ROLA 4LHUG 1TO4A 2GFBA 1YLVA 3B2XA 5EZIH 2BOEX 4UTCA 3O16A 3I2CL 4LHUA 5IOPB 1R3QA 3O0LA 3VGAC 3N1FC 1FWCC 4KX9A 1VADB 4C6DA 5C08E 5GRUL 3IGUA 5CCKH 3ZS4A 5FJPA 1UKSA 3N40F 1XP3A 3KTCA 3SRDA 4P7LA 2G5BA 3QORB 2X4PA 4WJEA 5EZLB 1AJ7H 2R1YB 2INFA 4F2EA 3TEYA 1LRTA 2OZNA 2D7TL 3VXNA 1FRGL 4R7LA 1OL0A 4LY4A 4FXKA 1JPDX 4J12A 3MRPB 1XV8A 4YGAB 4ZPTA 4G8TA 3BC9A 3O2LA 3GK8L 4ATLA 4PC8A 5I0YA 1E90A 2RAGA 1GS7A 5DZNA 3HBGA 3GMNA 1BQLH 1U1UA 4C56E 4AH2A 5CZVH 2MH4A 1ZBVA 3VNIA 4AY7A 3SO7A 4GG8B 3CMGA 1N5AA 3MC5A 3EIFA 4H04A 1U3ZA 4PTMA 2J27A 5FUCC 3G08A 4S3CA 3O3BA 4LSTH 1JRHI 1ZJAA 1TPEA 1F07A 3TA3C 4J4KA 1Z5YD 1KFKA 1L6SA 3H42L 3GPSA 3BARA 4IEFA 3RZWA 4AH7A 3DJZA 3NA9H 2B4CL 3UO8B 4XIAA 1P6WA 3DURA 5B8CA 1HU8A 1Z42A 4CD8A 4JRLA 2FEEI 3G9AB 4A7VA 1XLLA 2RR3A 3BGJA 3CZFB 4WY7H 4BQBA 4K71C 4X7EC 5AAPA 2IFGA 1MH5B 4YPGA 3DFQA 1XLAA 4HUXA 1NU5A 2E75C 5IROC 3S35X 4M00A 5KS9F 1LMIA 4GXFA 2QADC 1NSNH 1WCBB 2NY4D 3R11A 1N8OE 2XACC 5LN8A 4JPWH 1ADQA 2XWJA 3CMFA 4HIIA 1VYPX 4IP4A 2B1HH 2NSQA 5G4OA 5D72H 3UMTA 4MZ8A 4XBSA 5MEOB 4KITB 3IGLA 1JERA 3IAGC 5KSBE 2YR3A 3BZJA 4YSRA 5C09B 4ZSTA 5AOZA 1Q0EA 2W38A 1LLZA 3W7LA 4L3ED 4BH8A 2YA0A 4G9DB 4KO9A 4AX6A 2E5EA 4PJEF 5CP3A 1TMLA 2CUAA 4PCSA 4H0IA 3DVNA 3U7YH 2Q8LA 4WVXA 1IWPA 4P46B 3WAKA 4LZKA 1NFGA 3E3QE 4WW2C 1WBZB 5HDOA 1RK0A 1BXCA 1X5FA 4FTVD 4HC1L 1IL1B 1XIIA 1YEJH 4P5TB 4G8GE 4OI7A 3EDEA 2B7NA 5DGRA 1UD8A 4OGXH 1A3RL 2CR0A 5CJQL 1NAKH 4CKVX 3NPZB 4K23H 4LO9A 3TCLB 3MRMA 1MQRA 5CC5A 4HALA 1UXWB 4Q9QH 3WJJC 1N18A 3VJ6A 5JO5B 1KYAA 5H37G 3GM8A 1NLDH 1DYZA 4YS4A 3UAAA 1WA3A 2EUVA 4QAIA 4NKIH 5DN1A 4MA3A 4N5UA 5B1JC 1G9NC 5LJYH 3PP7A 4DWDA 5I16A 2TODA 5EO0A 4JPQA 3ZFHA 2F6UA 1EMTH 2EH8L 4HSOA 1XC4A 5IGXH 4PB0H 3VX1A 3H9HB 1XLDA 4NHUA 5AW2B 1JHKH 5HDBB 4R97B 1K85A 2P5EE 2R69H 3AIVA 4PRRA 2WV3A 1AIFA 4XBGB 2OX4A 1S7WB 4GLRI 5F7AA 4B5SA 3PPCA 4EN3A 3ATEA 2OV0A 3R0UA 3QDMA 2CQVA 5GQBA 4O51B 3GDBA 1C5CL 2GDUA 2WV8A 4ODVH 1EJOL 3ZW3A 1QG3A 3AYSA 2ZP0T 2XIQA 2P43B 2RD0A 3F7PC 5SWZA 3ZO9A 2YPLE 1W3NA 3FFCB 3EYVB 1NZRA 3NCJL 2JF1A 3VKDA 2ZQ0A 1CXKA 2Q3ZA 4FXJA 2J13A 1G6RA 2Y7GA 2PWEA 3UZZA 3OB0H 2D22A 1C29A 4ML9A 3QIWD 3QLDA 1NCTA 2B7DT 2ZC1A 2Y7NA 1N64H 3SOBH 2C9XA 3O6MH 3MNWA 3Q2WA 4YHNA 4HHLA 1ZWIA 4U1NB 2CSPA 2FWUA 2DLGA 1OPGH 1KENH 2VCOA 1K6AA 4H25A 5GISH 1DBBL 4HISA 3WLRA 3BVTA 3I50H 3QARA 4MJZA 3MLWL 4HIBA 4DIXA 4DVBA 3ECWA 3MV8B 3MRQB 1G0YR 1WDRA 3S1XA 1E3ZA 3GXUB 4J1OA 4BHYA 3AQDA 3FT9A 2EE3A 2XKNB 2GQ9A 3B2UC 3ETSA 3TJEH 1MFDH 3NOIA 4BFIA 4WFEE 2ZZ3A 2YFOA 1W9PA 2R2HB 2ZF9A 4UTBL 3CC5B 4Z0BH 4X9FA 3I3BA 1VZHA 4ODSH 3PWVA 4PL1A 3U2JA 5L8JB 3GSNB 4XSLA 1S7QB 4HNNA 4P2RD 3QY8A 3TYEA 1RLCL 3H23A 1D6VH 4PJBF 3ES7A 4PJXB 2BWIA 4OZHB 2A5UA 4RE0A 5EU3B 3T3MB 1UOKA 5EOQL 2EEFA 1Z5LA 3VIGA 1IVLA 3WHE0 4NQUA 1A1MB 1FYHB 3QW3A 3EZ4A 5DBUA 3TZVA 5EB8A 1K4GA 4AGOA 4NUMA 2ATAA 1ZHBA 12E8H 1DEEA 3DRTA 2ZSVB 3MUJA 1E4LA 3UBXA 4I0PD 4FQHB 3GH5A 2PUZA 4UFHA 4ZMWA 1KNWA 1R9YA 2H6PA 4MHBA 1N7KA 4MGXA 1AQDA 1RZKH 2B3RA 5AY7A 3L3OA 1XLGA 3CLEL 1R3KA 5BW7C 3ZHKA 3H56A 1H0DA 4OJAA 4ZMOA 1EAJA 4OFPA 2IDQA 4GE8A 4C6KA 3V6OA 4Z1PA 1KEML 1ZAGA 3QIBB 3X14B 4YDJA 3KBPA 1OZMA 3T4CA 4YSCA 1AY1H 3D0CA 1EFZA 4O13A 4CVUA 1T7VA 2YGYA 1UA6H 4P2AA 2DT1A 5AB2A 2FVLA 2OR9L 3P0VH 3MJ7B 2B0SH 5DXYA 4HQQH 4AD5A 3AGVA 5DR5L 2B1HL 1W72B 5E00A 4OQTA 2J47A 2WCAA 4WJXA 5BWFA 1XAKA 1CGSL 1MG2C 1WH0A 2IFFH 5DD3L 3UG4A 4ELMA 3GDMA 5GJSL 3L5LA 1CQYA 1PQZB 3WMCA 2VJXA 3IFNH 4F5CA 4NSKB 2E09A 3LTVA 2J4WL 2HKFH 3DGBA 4WDWA 5D32A 1W1ZA 2DUAA 3J7HA 2Z2AA 2AP2A 2Z35B 4M7JH 3RK8A 2ANUA 4FA7B 4NZUH 5K9XA 1AFSA 2E40A 3WIFB 2FIRT 3WJMB 4DN1A 4JB9H 1XL4A 1BECA 2ODOA 3PK7A 3SGDH 3FCTB 5KOMC 2XWXA 4LUTA 1KO0A 2HVNA 4YL9A 5TH2B 4OGQC 4N9GB 3G3MA 3ITCA 3KHJA 5E6UB 2PDLA 4NHVA 4IMAA 3GB6A 2CGRL 1M53A 3D39E 5IY5B 3MUHL 2H1PH 3V4VL 5DVNA 1KB5H 1BD2A 5IMMA 5M7QA 1QCWA 2ESVE 4CU6A 2ZADA 1VACB 5IEKA 4PP1C 4CNOA 1ACXA 3S9IA 3W0WA 3LI1A 3RVUD 3ES6B 3HURA 4PGZA 1OFRA 5DZOA 3B2VL 3PGFH 4XP1L 2M2DA 3BT0A 4QEHA 3AS3A 3EX3A 3GMOB 1JZFA 4IBTA 2K0RA 3LCGA 3KXFD 1Q38A 1XL6A 2H0JA 2ZF8A 2P7TB 2I17A 1GPWA 2WSPA 1FC1A 2BERA 4R9OA 3SPJA 4LSQH 3AWGA 4BQ3A 1RXOB 3FH7A 1C12A 3L08A 1QXLA 1ODAA 1E4JA 4Z2LA 2QJIA 1XF5B 2YX0A 4P06A 2Z1WA 1A5OC 4M4RA 4WUUE 1U6AH 3BQUA 2J79A 1VPYA 4XC1L 3GVVA 4YNGA 1W54A 3LZLA 3K30A 4PBFA 1JZ7A 4YIWA 4M3JA 4FG6D 4NJJA 1FNEA 2KLTA 2X88A 2XRAL 4J8RA 2A9NL 3S4SA 4YLWA 1HJQA 1TPWA 1A6AB 5HYSB 4QRSA 3SQBA 2LLGA 3LS9A 4HXAL 5J57B 2NY2D 1SZFA 3Q5YA 1DUYA 1AMXA 3OKMB 1INEH 2OBGA 1U8PB 2WUBH 3RJXA 5IQ7H 4U1IA 3O2VL 3GZKA 4GBDA 2DIAA 4HHPA 4OZ4A 4H8UA 3CQIA 3WLTA 3USZA 4LTSA 4XAKE 1KENL 2QPDB 3WJLC 1U41A 4NZTL 1YYML 4KKQA 4LHUD 3SECA 3V5HA 2N4IA 3CLWA 3WXVL 1B54A 4O28A 2NXGA 4DKAA 1H8NA 5TF0A 4JFQB 4GZJA 3KNBB 3RX4A 1WS7A 3T2OA 2DI8A 2PR4L 2ADJB 3APTA 1IAIH 1DCEA 4X9HA 3REWA 3NIGB 4GUFA 2DTMH 5DVOA 3U9IA 2UWEA 4XN8A 1QW7A 5D4IA 2Q1EA 2JXMB 4ENEC 4AK2A 4JFYB 4UF7C 4Z0BL 5DHEA 1X1NA 4FQLH 3PNUA 2I60L 3VACA 1DWJM 1IFHL 5HHNA 2H8ZA 1QZ1A 4NFCA 3O3AA 3HB3C 1D5BB 4FLOA 4O2CA 4HJSA 3V9CA 5XIAA 4KFNA 3CFNA 2DLFH 4PB9H 2WZEA 1XYMA 3WBEA 4AL8L 4W88A 1RKRA 4OD2B 4CSZA 1JGLH 3MV7A 2G5UA 3L3JA 5CLXA 4E41A 1G7HB 2BOGX 1EDYA 1LJYA 3W70A 5B22A 3MMUA 4XD5A 3WMBA 1VR6A 4AIBA 5I5RA 3RFZC 1QPRA 5EYWA 1WYIA 3SSJA 4ZO9A 4IBSA 4G59C 1HHIB 3FBQA 2YOCA 3QEGH 4LVBA 5J7CC 1NCAL 1CG9B 4TUJB 2YA1A 2KERA 3C8KA 4I48A 3L9CA 1PW3A 3VDAA 4S0SD 3SKMB 1PFOA 3MCLL 4Y9BA 4HWBL 2RH0A 1E2VA 2NY5C 4FXSA 2XWZA 4E9TA 4AQ1A 8FABA 35C8H 4J7RA 3TZNA 4PJ8A 4CMHB 4HU4A 4Y2OA 2DJXA 2YN5A 1A7QL 4KXDA 4UQ9A 3CQPA 4A37A 3R89A 1RK1A 1ETZB 2XIDA 5I26A 1U42A 3FDWA 4PJCE 3WFLA 5ABDE 5HHOA 1UYWL 3NDYE 2O72A 5C07E 5J11C 4N2KA 2ZOXA 2FYMA 4M6OH 2BV9A 3WL9A 4HU0A 2XSKA 5I1AA 2VLRA 1PVHA 2XKUA 1A2YB 4AWEA 1OF0A 1NF7A 5HJGA 5JVLA 3OTRA 3BN3B 3FSOA 3QEQB 3I75A 4IX0A 1U83A 4A8LA 1SFLA 3VXPA 4ICWA 3GEWB 3NCYP 4PJ9D 3QYCA 4DGVH 1POJA 2B7QA 3VGBA 2KL6A 4E38A 4AC7C 5FYLL 1T41A 1SDDA 2HK0A 2XZQH 4FX8A 3K8LA 4LC8A 3Q44A 3RLGA 3EJJX 5LDUA 2PABA 2HE8A 1A21A 1XBDA 3P84A 3BD5A 1GVEA 3AU6A 2CMRH 1JOIA 2ISFA 4W9EC 5E5MB 4XAYA 1PB0A 2YHGA 5EFIA 5AZEH 3WQWA 3WIHA 5DO8A 3SIKA 1QEXA 3BZDA 4AIEA 1COBA 2ZXDA 2BFVL 3FUMA 4NHCH 3IBEA 1L3WA 4POYA 4KX7A 1WCGA 2AEQH 4M6ML 1WKYA 2Z6JA 3CV5A 1QD0A 1US3A 1VFTA 2DPKA 2NV1A 1OCJA 2VDRH 3EAKA 1K6QH 2NXYC 3TNMB 5BNXD 2HE5A 3CHEA 2ITDB 5EWIL 1XYFA 4GPNA 2BHZA 2WMPB 3AO0A 1OADA 1B1YA 1LDPL 1NGPH 3BUYA 1QATA 2G37A 2Q7NA 2HV5A 1FAIL 5FJTA 5E56A 3VNZA 4GAYB 3D48R 4LCCB 2J6XA 4IIQC 4DXVA 3WDJA 4M7TA 1LWRA 3CFQA 3QV6A 1KRCC 4ELKB 3HE7C 5DWUH 4LNRA 4DZAA 4HJGB 1A9BA 1B4JH 1GOOA 2K6WA 3RL1B 2FLRT 1KLZA 1TV7A 1I1AA 4YDKH 4O2EA 3L1EA 1SN0A 2IXVA 5AOIA 2WNGA 5SWZD 2AABL 4DJEC 1UWXK 2EDXA 3T8XB 4IGNA 1NAMB 2HG5A 3MGTB 4ZD3L 4R2GC 4LS2A 4DETA 3VE9A 4RDQF 3RY6C 1T6VN 1JPKA 3PNRB 2R1LA 3ZDZB 1VJZA 1JPTH 2PYFA 4TULL 1AKJA 2WXKA 1IGTB 1U2HA 25C8H 1P1MA 1GW0A 4LLUA 2EO1A 4OVUA 3MLRL 4X8JB 5GS1A 4U1HB 2B2XH 5AG9A 1BVWA 3VDGA 1GAFH 1JVOA 1K4CA 3IMBA 3W24A 3RWGA 3FO2B 3HZKB 3OKYA 3DX6A 4P8UA 4BFNA 5G2NA 1N55A 4UM9B 2FEDD 4ZTOL 2OEKA 4NENA 4BCXA 2C15A 2PP3A 2PYEA 1O4UA 1JUFB 3DYPA 3DGDA 1GY2A 5IVXA 5GJMA 3FUKA 2X6CA 3LM3A 1CGVA 1DANT 3GU1A 1CZ1A 2VDQH 2KLRA 4LSRH 2LU7A 5IJKC 1QA9A 3KAOA 4FQLL 3LQMA 4XWOC 3EZ8A 1F5ZA 5C9JB 2FBJL 2WWKO 1E30A 3WL1A 2PDXA 1ICTA 4AT6A 4C65A 3WBAA 2NUXA 1RFDH 1T21A 4O58L 3IARA 1TVNA 1M71B 3CX2A 3T09A 1BEXA 4B16A 2HFEB 1DQKA 3A6BH 3TZVD 3BDBA 5HDWA 4BUGA 2P0IA 3LVEA 4HJEA 5F9WC 2YAFA 4N8VG 5IEHA 2TSAA 4ZW8A 4X2PA 2KYIA 4YHPA 3EMQA 6ALDA 5EZJA 1NIBA 3S1VA 5CJOH 3ZE2B 3S1WA 3OQRA 4N8VA 3HU7A 2H9GB 4AQEB 3VK5A 3D0VA 4ONFL 1VB9A 2WNKA 3ABGA 1YQ2A 3MKCA 3GFXA 2V2XB 1VLWA 2H0EA 2W59A 1A14H 5CO1A 3B9DA 1W91A 3TJLA 4FKEA 4U6HB 5K4ZA 4JY5H 3EKGA 4XPAH 1MJ7L 2DW5A 3GC4A 5I3IA 4M5TA 3KWWA 1CYGA 3VILA 4QLRA 3DETC 1KJ2H 1FORL 3L0NA 3SADA 3F05A 2XIOA 4JAMB 5FA3A 2QPXA 4W89A 4PS4H 1AGEB 4AJVA 1OK4A 4EF9A 3MLPA 4AU0A 5AW0B 5FL1A 1IEQA 2NTSP 3RUGB 3PXJA 4HAGA 3CSYB 3L4WA 1IKNC 3MWCA 1S2UA 4TTDC 1GNXA 4GW1B 3U2EA 3ZTCC 3CIWA 4PRHA 4JFHD 2X7WA 3GNMH 4IZGA 2ED9A 1O0VA 4JFEE 4X6FA 3DEQA 5H94A 2PC8A 5HDRA 3O6LL 3AT0A 3JUZA 4HZLA 1WOBA 3SBQA 3L4ZA 3FQWA 1OW0A 3PZNA 5E9NA 3G18A 3W7GA 2FH8A 1PKLA 1RMFH 3MI6A 4JEQA 3GZOA 5EOTB 4WIWA 3DXIA 2GJXB 1OIMA 3ZE1B 2ZYSA 1AQ8A 1EUUA 5CD3A 5K1JA 5TDNA 1FVEA 5CJXC 3RR4A 3HV8A 3TJ4A 5DC0A 1RV6X 4U1LB 4XBMA 9RUBA 1E9QA 2OMZA 4YSEA 4TSCL 1BZEA 5BCAA 4G1MA 4R7DB 1X9UA 1NARA 4Y5YC 1P1ZA 2ZX9A 1BD2D 3O3EA 3LZQA 1H7PA 3QRHA 5FEBA 1FI8C 1N6QL 3E5PA 5JOFB 2QHLA 4U1GB 3WKMH 1AQFA 1N26A 3W0WD 2NQZA 1TUXA 5M17A 4MYPA 1QUMA 3I6LE 4HWUA 1UWIA 5H6HA 5D2NC 2Q02A 2CO6B 4E5XG 1KZQA 2R23B 4HUNB 1ZVYA 1BFVH 2FZDA 2GC7C 1H7RA 1QDSA 3O6FB 3IJHB 5E6IC 3RCYA 2YXWA 4E6MA 4KROB 4AQ8C 4ZMQA 2XTJB 3TO4C 1UMYA 4IGHA 4HSAC 5DD6B 4NYYA 1I2RA 4H20L 4TF4A 3PREA 5I03A 3BQUD 3RWFA 1W15A 5ABZA 5KZCB 1VPOH 3HNVH 3APFA 5CIPH 1JQVA 1AAJA 3C2FA 4JLRB 5CEYA 3QY6A 3C5ZB 1KPVA 5DO2D 4P4RA 1FSKC 1NCWH 3PSVA 5GGTA 3I3DA 4BI5A 3IFPA 4ETYA 4KESA 5DURD 4F7CA 2XFRA 4HPOL 3N2OA 1IQDB 2DZAA 1FNGB 4RWHA 3H7RA 4UBDD 3PL6A 5IM51 1DE5A 4X6CB 2QVIA 1PKQB 4KTYA 4OJCA 3NZRA 1UA7A 2FMNA 3FKKA 2V17L 4EPSA 3U6RB 3FDGA 3V7AG 2YOAA 3NPWA 3NIFF 1P0DA 1LO2H 2DEWX 3T0EC 1EAPA 1X5IA 3L9BA 3TEZA 2B7OA 1W9DM 3NQEA 2NWRA 4YL4A 4G6CA 4JDTL 3IJQA 3FN3A 2OTWB 2WZAA 3MV9A 3QMTA 4CN4A 2EKSB 4ICMA 4PREA 4OKVB 4LP5A 4Y9MA 1Z6KA 2FWLB 4NYUA 5GS0H 5HDQH 1A50A 1CVRA 3ARBA 4UTIA 4OGYL 3UTSA 4GRMA 1JWUB 2A1WH 1MRFL 3HG0A 4XN7A 5KANI 1O6SB 3MBEC 5JORA 3QH2A 5BRZB 5ESVA 1K9EA 3FRUA 2DIBA 1FX6A 4TYUA 3B6SB 3G04B 5F3HA 2B31A 1DBKL 3FU9A 5C7HA 4Y1TA 2IO5A 5AD0A 2RAMA 1GRWA 3WFEL 1DYSA 4JBSA 5DD0H 1GIGH 1H8OA 3GUFA 5F7EL 5JW4N 3RJQB 4U5IA 4IQEA 3WMQA 3W7RA 4TQEL 1X4YA 3L3IB 5I2IB 1P2CB 3ZTDC 2ZC8A 4E41D 4OIIH 4WJG3 5DMKB 2J43A 3TONA 1OZQA 2JJSC 4QSFA 1HAUA 1AYRA 4L4TB 5EU5B 3IWPA 3S5YA 5I1LB 2VLKE 3M45A 4D0CB 4WU7A 3L1GA 4NO0B 2ENJA 5T3XE 4HFWA 4PB3A 4MTMA 2YYTA 3CFKB 3WLKX 2DIEA 5FDWB 4L4VA 4PH8A 1D5IL 2E1WA 2CO7B 4WKZA 4ZUTB 1CZ8L 1TPXB 4KXZH 3KLDA 4XNZB 1MAML 1MFEH 5KYWA 4PJ8D 4E42A 3NABL 2HXAA 1R3IH 2OQJB 1KELL 4K8RD 4HS6A 1ONEA 2VDPL 4HH9B 1SO5A 4RZKA 1G1KA 1YYLH 2IPGA 3CLFH 4XVJL 4EVZA 4DF1A 5D1XC 3TN5A 4OCYH 2PW2A 2WSRA 4QRPA 2OCCB 1WAAA 1QNRA 4X7CC 5C0RL 1BVKB 3LTSA 3GDLA 1W0VB 3QCUH 4ICNA 3W84A 2A77L 2QKSA 1SYSA 4IQHA 4MJ6A 4X5RA 1OY3B 1XIGA 4HETA 1XIDA 3UPAA 2ZOKA 4NKQB 4NP9A 3V7PA 4QXVA 1IZCA 3VIHA 2V5RA 1R85A 3AU1B 3AFLA 3VUAA 3DMMC 1V7NL 2NNCA 4TR9A 1F6AA 4HCGA 5CGTA 4H40A 5IW6A 3ASOB 2A74B 4M02A 4NQXB 3QPKA 2IH1A 3ABLB 4M82A 2NY0B 3GBNH 2VH5L 5FV2A 1G7PA 4NRXA 1AODA 3ZYOA 5F97E 5GGSB 3FOKA 4H6KA 1KBLA 1XICA 1P7QA 4KZCA 2BNQA 1V3IA 3LBMA 2EXWD 3DPBB 4O53A 4C6OA 3WY2A 2IOMA 4HDIB 3PDOB 3DGCR 2HJPA 3QJVB 3NIDE 2EPNA 3AREC 2V5YA 2DN7A 1XH0A 3EFFA 1WKDA 1VGEL 4IGBA 4ZBCA 4NO2A 4HCFA 5I06A 4YXKL 2BCMA 4KK6D 1FWTA 2D3NA 1SXZA 4GUOA 1HI6A 4W4QA 3MBWB 4D0DA 3AMDA 3AY4A 2HZGA 4WSGA 5IBUG 4LCWE 1IBBA 3I2CH 3NSCA 3RVTC 1SOXA 4WI0A 4RXGA 1YLBB 4G42A 5A2BA 3W22A 5I6MA 4YXHL 5GRUH 5E6SB 2VDMB 1RVGA 4XB3A 5A95A 5FKAA 2X4RB 5JIWA 5C0AB 1VFHA 2NW2B 1YDPA 3N44F 3RWDA 2DQWA 2HLAA 1I1AD 2D7TH 1FRGH 5JW5B 1RY7B 1X5YA 2TRYA 1UWRA 3W3OA 1PYFA 2W07A 1OP4A 4FF5A 3MRCB 3NZHL 3LNGA 1RUML 1WUNT 4BE6A 3IN2A 3A0OA 4X6EB 3ARWA 3FH5A 3WNKA 2CPUA 3GK8H 3UBGA 4N2BA 1OP5H 3V95A 1C8XA 1B9KA 3CCHA 1HILA 1S8DB 1GGTA 2YB4A 4OZIF 2PDIA 2NR6A 2ZAHA 3SSGA 1BXAA 4S2CA 1XGZA 4RFNB 2ZCHL 3RDTC 1AKJD 1I0BA 5FM5M 4KWSA 3WO4B 5IZ7A 3KRZA 4HEME 5CJNA 2CKBL 4WKAA 3MR9A 5DS2A 3O2WL 3KDMA 1BZ9A 1NLBL 3AB0C 1O66A 3WQPA 2YS4A 3JZUA 1JHTB 5DRXB 1E6PA 3H42H 2PYED 3EYFB 3H4GA 2ZUXA 5TD4A 3WMSA 1BQHB 3RLSA 4TU1A 4BJLA 1VRXA 2B4CH 4EZKA 2BODX 1T2JA 2R29A 1PTDA 3MSGA 4EXPX 3UTQA 1E5JA 2UV3A 2FYYA 4NI8A 2QFPA 3QQ4B 3P9LB 1X7FA 5GGRA 2FB3A 2NZ1A 5E8NB 3QA3B 2ZSWA 3PWUA 3ML8A 4C55A 3GMPB 3F2LA 4QRQA 3LCXA 2UY7B 1GR7A 3QT2A 1Q8MA 1L0PA 4O8AA 4BKNA 3K2MC 1SR9A 4U4BA 4AG0A 5E2JA 2ZQKA 1XCWA 5DUPL 3BANA 2XH2A 1LLAA 1DVFD 3MRIA 5T5NG 3CQFA 1PZAA 3C09C 2FLMA 4L1BA 4PRIB 4W9ZA 1I1FA 3QC5X 4L9DA 4G7SB 1BRLB 1QLRA 2EAEA 3R58A 4K3GA 1DIKA 1NM4A 5CGYD 3RWIB 1BJ1J 7REQB 1XM3A 4Y0GA 5CKSA 3RL2A 5DHDA 4L1GA 4IIBA 4F27A 4YTRA 4Y4FC 5ENWB 2XQ0A 5PAZA 1EO5A 3D08A 4QRRE 4IX2A 3PF2A 4GSXA 2P8PB 2OSLB 3KYMB 5CAHA 1A3RH 1AJ2A 5CJQH 2IADB 4XPFH 2ZNXA 5F1UA 4Y5VA 2HTLD 1BBJB 5FGRA 5TNVA 5D7JC 1AO7A 1Z8AA 1WDWA 2QCCA 4K36A 1SW0A 4I9XA 3VSQA 1F3JA 1OGAB 1F2QA 4CNIA 4GFSA 5B38B 5F9JA 5F7NC 2WXMA 5FCUL 3U4BL 2VZTA 2E27L 1GOHA 4PRHD 2R1NA 1BZ8A 3OIHA 4KEZA 1NDZA 4GB9A 3P0GB 4ZVJA 3DGGB 5D2XA 4WWOA 3GIQA 1O5DT 2X44D 4J3OC 4BWUA 2EH8H 3LPPA 5F3BA 1U8NA 2I32A 1C92A 3NCWA 1U8LA 3O4LB 3AZUA 5DI8B 4NPYA 1KLYA 3GTXA 4MAYD 2A7NA 2I69A 3AYVA 4B3EA 1U92B 2QR6A 3JWNH 2J7FA 4Z42C 2XGBA 2Q71A 5HI4D 3BZGA 1C5CH 3IJ8A 3IJYB 4KC3B 3ZN6A 5BXTA 2D31A 4DAIA 1ROWA 3FQRA 5I6LA 1EJOH 2YWZA 3UJJL 2NXZD 4YVPA 5JXEC 1OE1A 2AL2B 3ZGIA 2R9HC 1OVZA 4F7PA 2NW3A 5KYUA 1YMMA 2B8OT 4Z0XA 5KBPA 3NCJH 2WSDA 3CDZB 4NZJA 4MIMA 2GFTA 4OFIA 1SZRA 1E4WL 5G4HC 5DJZB 1BWVA 1RIVL 4MDJA 3CH8A 3WDPP 5ENLA 4Z2GA 3VQMA 2OG9A 1FL3B 1EBPA 2N59A 1R47A 4ZSUA 2CLVA 5INCB 3MO1B 1V51A 3QUML 1FIEA 3SBFA 4LEBA 1X1ZA 5CP7A 1CXHA 2V9TA 1ZRQA 3QSTA 1DBBH 1MREL 5KG9A 4DBDA 3MLWH 3I9PA 4GKSA 4X6DB 2QL1A 4IMKC 1I8MA 5GXBB 1W8NA 2OXGA 3M1BA 4QY8B 4MQ7B 3WN5C 2YW4A 4IMGA 5EH1A 3NAVA 3BP6B 4X99A 3UR7A 3SYQA 1JTTA 4UTBH 1H6FA 1ISVA 4QDMA 3G2GA 3WKZA 4JM2C 2DQTL 4HX1B 1L9RA 3ZE0E 1S5MA 3SCNA 3NDZE 5B7ZA 1SQ7A 1G7QB 1YY9D 2J62A 3PL6D 1KM1A 1O5XA 3HHRB 4R0LC 2DW7A 2OT1A 3CMOL 5EOQH 2BNRA 1F74A 4WY0F 3LS5L 2UXVA 1EAOA 1Q9KA 3U1QA 4Y16B 5IJBC 4WNQA 3ECVA 3IIZA 2PMZA 2ATSA 3NOEA 4X9BA 1GYLA 3BE7A 5D7IF 4O14A 4P0DA 3V0FA 1DSFL 3P2BA 2W9MA 2VL5B 3TEUA 4H0HB 2IDUA 4CCZA 4RBPH 4A6YL 4LESA 1UR3M 5AVNA 3DECA 1K77A 4ZODA 5E0KA 2RJHA 3OZMA 5E8PA 3EFOB 3CLEH 3T0DA 2OAAA 2HFFB 1XEDA 3CHDA 5LAXB 5HYIA 3RKDC 4A7UA 3GXPA 3UTSD 3BUPA 3WENA 2XXFA 2Q6WA 5TFSL 4X9GA 4A3UA 1A4LA 5BO0D 5HGGS 2YC1A 4UZUA 5KSUB 2A6IA 3TBVB 1QAWA 1UKQA 5EMYA 5AVQB 1Z9AA 1KEMH 4OZIB 3QJFB 4MMXC 2Z31A 3FN9A 2YZ1A 3WD0A 4EDWL 2TSBA 1C90A 2J8UE 2OMNA 5HUPA 3RWCA 5G2HA 2PBOA 2ZZ1A 5C7ZA 1BIIA 5F9AC 2OR9H 2Y36L 4ILDA 1FZKA 5DR5H 1EFXB 4FQXD 4HCHA 3ZIMA 5BS0A 1CGSH 5DD3H 3UX9B 1U8KA 4DP5X 3SCWA 2VWSA 4D3CL 5GJSH 4Z18A 2GSHA 4IRSB 2VQ1A 5ITFB 3UXKA 4EI5C 4J8QA 3S37L 3EBAA 2P5WB 5DQDL 2J4WH 1GW9A 1CO1A 4KDVA 4WV1C 1MNSA 1HZYA 2Y2TA 2FJKA 5A8GA 5TQ2H 1YJDL 3LTYA 4L4VD 3L4CA 3FA5A 1G4TA 1L3NA 2BP5M 3EUUA 4XP9L 4O16A 3U9UA 3R18A 1LRNA 1VZIA 3U7BA 2OTUA 3LERA 3R8GA 1OEZW 2RHEA 1D9KC 4CVWA 2YAPA 2TRHA 1HQ4B 4IU2A 3EYQC 2AEIT 2DLEA 1CICC 4J3XA 2KKQA 4XPFL 3BFWA 1UM4L 4IF2A 2CGRH 3LKSA 1WXJA 3P73A 5DUBA 3ZMEA 3SSZA 3M4HA 3V4VH 3HR5A 4YVNA 2PDJA 2A3TA 4Z5RA 3QQXA 4HNVA 2ZUQC 3GUGA 3S7GA 3P14A 1GHSA 5ICZA 5H37A 2Z6FA 1OT2A 1LEKB 1MWAL 3KPNB 3NCCB 2R2BB 3B2VH 1H5BC 1Z7JA 4XP1H 2DZXA 4YFEA 2E9WA 1IO4C 4R96A 3LCWA 1MVFA 3ULVE 3HG1E 1WHOA 2P88A 4ILSA 4IG2A 4QMEA 3KPPB 4OGAD 4K1GA 2X2UA 3N04A 1CI3M 4MWAE 3W7MA 4GI9A 2BHYA 1MI5B 1S5HB 2JKPA 3HEIB 3URBA 2Q20A 4OV6F 4YJ5A 2H32H 4ZR8A 4ZQKA 1WC7A 2WSYA 5D5ME 5L6YL 4KVNL 4JNZA 4N4QA 4XC1H 5HHMB 4K38A 3OAYK 3OKNA 2WMFA 3HNSL 1UZ6F 4D9QE 3SDXA 5GNZA 1P7QD 1VBHA 1X4XA 2BNQD 4K7FA 4JIPA 5DK2B 4DO5A 4YBQC 2YXOA 2XRAH 1YAIA 4O50A 2A9NH 1S7SA 3QUGA 1B3JA 4N20A 3RGHA 2ZIDA 1SQMA 3UR2A 4C7FA 1RBOB 1MDLA 4HXAH 3R13A 3JTBA 4IGBD 2NMSA 3B9OA 5K33A 3GH4A 5FYKD 2B59A 4EANA 2D2GA 3ZR5A 5KUMA 2Y6SD 2EXYD 3O2VH 2W0UA 5JUVA 3TT3L 3V36A 4NZTH 3IRSA 1YYMH 4AYSA 2FCBA 3Q05A 3NFNB 3GDKA 3WXVH 1ZIBA 3P8IA 1UB5B 2V8LA 1AJZA 3JV0A 1KLFB 2F7FA 3DH7A 1QFEA 2V2HA 4PRPA 3R1ZA 3DKLA 4W9LC 2PR4H 1SFHA 2BSRB 3NL2A 4KH9A 2OXHA 3GKWL 1VH7A 2NVAA 5EMMA 4K5LA 2PF0A 3LV3A 5EA9A 3TOPA 5I2UA 3T1WA 1ONQB 1TJHL 4LLMB