2QV4A

Human pancreatic alpha-amylase complexed with nitrite and acarbose
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 171
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qv4A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qv4A01
1QWUA 1HN1A 5HBFA 1VB9A 1C7SA 1WO2A 2CHNA 1L8NA 3N18A 3WIJA 3O6AA 1UD3A 2YL8A 1LJYA 1UZ4A 1GQIA 5CLTA 3RMEA 3TTSA 2EQDA 3L4XA 2PI6A 1WCGA 4HPGA 3FHAA 4Z2IA 5C8BB 2BVDA 2CEQA 3IK2A 4MNLA 2ZUWA 4M80A 1HTYA 1EHAA 3OZPA 4TX8A 6TAAA 4KRTA 2VZTA 4QDMA 2YOCA 4W93A 3SUUA 1V6YA 3VSUA 1E72M 3ZJ6A 4X9YA 2WVVB 3DDFA 1W9DM 4EKJA 4MDOA 1MFVA 1E70M 2ZX8A 4DO5A 4HZ6A 1E1EA 3ARUA 2XVKA 4F9DA 1UWSA 4UFJA 2WVSA 1UD5A 4UQ9A 4BF7A 4Z2LA 5IFPA 3SURA 3N9KA 1J11A 2VI0A 1EGZA 3W37A 4MTVA 2XYLA 3WDIA 4GKLA 3VGDA 2BHZA 1UD2A 4F9JA 3I3DA 2QF8A 1HJWA 1W1VA 5A2CA 2J4GA 1Y7VA 3U7BA 1GJUA 3ARTA 2PF0A 4MB3A 3WQ8A 2WB5A 3CGTA 1QI3A 3WF4A 1FP8A 1QHOA 1HJXA 3SCQA 1VENA 1B3VA 1E4NA 2J25A 3A23A 3SUVA 5CPTA 3WQ5A 3EYPA 3KLLA 1GUVA 6CGTA 1SR0A 3DX4A 1LG2A 2V3FA 4UCFA 2ZIDA 1HVQA 1WB0A 2XM1A 2ZUTA 3N12A 1CXEA 1KWKA 5I78A 2FDMA 3K1DA 4AZ5A 4HZ7A 4TTUA 1PX4A 1BLIA 3AFBA 5CG0A 3PZ9A 2WZIA 3WNNA 4FNPA 5BXSA 2WNWA 3EJQA 3L4UA 3BUDA 1QW9A 1K9DA 2OSWA 2E0PA 2W92A 1CIUA 1OCQA 2OWCA 1H2JA 5FL1A 4DM1A 4AXNA 1E6RA 4QLKA 2IXUA 4Q7NA 1K6AA 2UY2A 1E55A 1GCYA 3WF0A 1TA3B 1R85A 1JAEA 3DX2A 4QFUA 2X1IA 2BNJA 4U5KA 1NWTA 2NT0A 3WBEA 2VNCA 3W4RA 1TVPA 1ZU8A 5LYRA 2D73A 3H54A 3BCFA 1ZBKA 2E9MA 4D6GA 2XWDA 3FN9A 1MVYA 4PTXA 3SCOA 4H2CA 3RDKA 4JAWA 3WUGA 5LA1A 3DHPA 3TA9A 1W9UA 4AD2A 1JFHA 1V02A 1EO5A 4ATWA 4AZ6A 3MMWA 1CTNA 1PEZA 1CGYA 1UA7A 1FP9A 4YHGA 1E0WA 1JZ8A 1CXLA 4MB1A 1NOWA 4PYSA 1KGWA 2XGBA 5E0CA 1BF2A 3FY1A 4MNKA 3TTYA 5BROA 2CESA 3MMUA 3VDBA 3A21A 5JBEA 3AHZA 4AWEA 3PN8A 3PTMA 2W61A 3NSNA 1MW3A 2VUYA 4H41A 1EXPA 2F7PA 2RGMA 1BVNP 1UR9A 2OWXA 2VX4A 3CHCA 4B15A 1SMAA 1UG6A 1HX0A 4GZJA 4NZJA 2VJXA 3B9EA 1UWTA 5JBDA 2BFGA 5I23A 1NOUA 4PMYA 1PIFA 1OT1A 1H4PA 1TCMA 2X0YA 3GXDA 1FH8A 3DDGA 1GZJA 3ARPA 3SCNA 1OBAA 5C71A 3WENA 3EMZA 2YFNA 1VEOA 4NXSA 2D2OA 4GXPA 1TMQA 3IANA 1UD6A 1XCWA 1EHNA 2CBVA 4CGTA 2EPLX 2W5FA 3HZ3A 2J75A 3D3AA 1QNOA 2PWHA 1W9PA 3L4ZA 4W8AA 1UQYA 3AZRA 2YL6A 3ZM8A 4BQ5A 1VBUA 3BAWA 4DM2A 4PMNA 4FLQA 3A6OA 4EK7A 3VIPA 3T2QA 3AXHA 1E15A 1C8YA 1BQCA 1J0ZA 3CZJA 3WY2A 2CBJA 1E1FA 2WHLA 4XV0A 1HP4A 3W29A 3KEHA 3W6LA 2ZE0A 3K8MA 3PZIA 2PWGA 3GXPA 1K9EA 5LA0A 3BAYA 2O9OA 3DYPA 3VM7A 3VX0A 1E3ZA 4WIWA 1GQJA 3CZSA 2J7HA 2WHKA 2D0FA 1IZKA 3ARQA 2WXDM 5GNYA 5I77A 3PTQA 4TOQA 2GVYA 3GXTA 3D51A 3MUY1 4H8VA 3WSUA 4AD0A 3BGAA 3NCOA 4J27A 1NQ6A 4RE2A 2GJRA 3HJEA 1DWHM 4JL1A 3II1A 3PZQA 4EAMA 2J74A 3NSXA 4HMCA 2O92A 1R7AA 4L4PA 1FFRA 1E71M 4UQBA 1GJWA 2FHBA 3AHYA 4ACZA 1BPLB 1E0VA 2CIPA 1QNSA 3VM5A 4CU8A 4QAWA 4E8CA 1WAWA 1NOFA 4M1RA 4MAVA 2XJ7A 1J10A 1VBRA 4M82A 1HJQA 1SYTA 4DWSD 4AIOA 1JZ7A 2VR5A 4CKQA 1BSIA 1CXIA 4GQQA 3W82A 2BY3A 2A3HA 1G94A 2HVMA 3MI6A 1E56A 1UR2A 3DX3A 1HL8A 1R75A 3AMLA 3A4WA 3WEOA 1FHDA 4QCFA 3VVGA 3N17A 2WMKA 2WHJA 4MPKA 1B3XA 2V3GA 3OA5A 1JDAA 3BC9A 1CXHA 1U30A 1R33A 2YL5A 3MUZ1 4D6HA 4W5UA 1UKTA 2J7CA 3B9AA 4OUEA 4ATDA 3VGFA 4PMZA 3CUIA 4TXEA 1CGVA 3D5HA 1EQCA 2ZUUA 2CKSA 3NYDA 4AZGA 3CTTA 3CUHA 2EPMX 1E6ZA 3WQWA 4WSKA 1B2YA 1ISWA 4CD4A 4KWUA 1Q6DA 2WLYA 2Y5EA 1H3GA 1JZ2A 3ZSTA 1M53A 4JKMA 1KWGA 3OG2A 1IT0A 1TQSA 3VDCA 3PZMA 2FYVA 2W66A 3GBEA 4J3WA 4XZWA 2BV9A 3OIHA 3LRLA 3AICA 5DO8A 4EE9A 3ZR5A 3BSHA 5I24A 5A8OA 3IAQA 2F18A 4MNJA 4TVUA 3WQVA 1VJZA 4GI6A 2CCRA 3VO0A 5CJ5A 3WFLA 1QI2A 4UQAA 3BAIA 4AD4A 4KH2A 1EOKA 1W9VA 3AYRA 2YIHA 3AIRA 3QOKA 1BFNA 1NP2A 1UWUA 2QLYA 2DT0A 4LYQA 4AZ7A 4PTVA 3VIIA 3IJ8A 2FE0A 3WMSA 3AIWA 3MO4A 4TUFA 2IXVA 3CZKA 1HKMA 3F5KA 3EDDA 3ZT7A 2BXYA 1V3JA 2Z1SA 3PZNA 2E3ZA 1KQYA 1WDSA 4JHZA 3ZOAA 3T0BA 3MKKA 1DP0A 3SUTA 2XIBA 1O7AA 1R87A 3AS0A 1KXQA 3WMCA 2WYSA 1E6QM 1J0IA 5FOOA 1EDGA 1LLOA 2W4XA 1R34A 4UR9A 4EANA 1ZJAA 1W2PA 1E9LA 1XCXA 3DHUA 5ECUA 2W67A 1CBGA 3CUJA 2QV4A 1GOIA 3L2MA 1R7OA 1WKYA 1B3YA 1X1NA 3QR3A 3UG5A 2Y8VA 1FOBA 3S6TA 1GOWA 1GVIA 2X05A 2BXZA 3AIEA 3KZSA 4NRRA 1UHVA 5IDIA 1VEPA 1KR1A 1EH9A 4AD5A 3PHAA 2ZX5A 3ZQ9A 1XD1A 3VD4A 1HP5A 4JFTA 1JFXA 2JF7A 1ISXA 2DIEA 3AIQA 5CLWA 1CWYA 1TUXA 3L4TA 1WZAA 2CBIA 1DWFM 1R46A 3RM8A 2EABA 4HA4A 2VR4A 3VGGA 2WZHA 3BCDA 4UFMA 3HG4A 2UY5A 2WC7A 1E6NA 1W32A 2G3IA 2XG9A 1PIGA 1B30A 2WMIA 1CGWA 1UZ1A 5CPQA 1A47A 1V02E 2DT3A 2EPNA 3T0AA 3D52A 2NT1A 4WKAA 2V5DA 3L2LA 1O6IA 1US3A 1JL8A 4DO6A 4PN2A 5A6BA 4FNTA 3ZSSA 4DO4A 4BQ3A 3WEZA 3ARYA 2FHFA 3WDJA 2ZWYA 1C8XA 2ZXQA 1F4HA 5BXRA 1B3ZA 3KL5A 5HDRA 4MNMA 5CGMA 1ISZA 4PMVA 1J0JA 3VD9A 1NWUA 1WDPA 3MUIA 7CGTA 1MXGA 1ZS2A 3U57A 1GQLA 1JNEA 1QNPA 3T2OA 2WK2A 3SCVA 1BTCA 2GJXB 1T0OA 2X09A 3GNPA 4CD6A 4F8XA 2D0GA 3DYOA 3VIOA 2F1BA 2YDSA 4WK9A 1W3JA 1V6VA 2C0HA 3PTKA 4HTYA 4L4OA 4PUEA 1XYZA 4W89A 3UESA 3HU7A 3AIBA 3ZJKA 1OGSA 2D22A 2J7GA 3POHA 5E6YA 2GUYA 4AZBA 1UH3A 2Y4SA 1GORA 1HKIA 3MS8A 2OW6A 1VAHA 1GNXA 1VF8A 2VURA 1WDQA 1X6LA 2ZUMA 1U2YA 1CDGA 1C91A 4GI8A 1QHPA 4E8DA 3BAXA 3VPLA 5CSYA 1Q4NX 3WD1A 2GDUA 4CVWA 1ZBWA 3GXMA 1L0PA 4U2YA 3K46A 4CCDA 3AISA 3WF3A 2J79A 3QHNA 1GONA 3O2LA 3BMWA 3TTOA 4DUVA 3PZOA 5E09A 3A4AA 3AS1A 4BS0A 2XSBA 2Y24A 1V3MA 2W63A 3WNOA 4W85A 1JZ6A 5CPSA 3SCRA 1C92A 2YL9A 3LPFA 4AIUA 2WLZA 3KLKA 2VT0A 5FKYA 3WNMA 4QP0A 4W7VA 4OBSA 1XHGA 1BHGA 5A6JA 4AMXA 2A3EA 3AYSA 1D3CA 3ARWA 4PMRA 4OGZA 4AZCB 3GXFA 2J78A 4MB5A 3FNDA 3VNYA 1WZKA 4DWSB 1XRVA 4TVCA 1XH2A 6A3HA 1ITXA 1KGUA 3VUPA 3LPOA 2XUCA 1HJVA 4UFLA 3FAWA 3BH4A 3AOFA 3BSGA 1E5JA 2YDRA 3LXCA 7A3HA 4J28A 3POCA 5BRPA 2ZXBA 2F7RA 2E40A 1B0IA 2EPKX 3ALGA 4WJXA 2VZUA 3N13A 3PBGA 2J47A 4M29A 2EAEA 5CSUA 4HPHA 1I1WA 1OSEA 4BCEA 5I5RA 5KEZA 3EBVA 1W2VA 5CZKA 2VX7A 2F61A 1A3HA 2XN1A 3WBAA 2YFOA 3CO4A 3VKKA 4DWSC 8A3HA 1TQTA 4PEEA 4JFWA 1V6UA 1B1YA 3B8SA 5TD4A 1OM0A 1J18A 3NDZA 2EADA 1J12A 4CN4A 2A3CA 1BGAA 3CUFA 1UYQA 1BGGA 5E70A 2X0HA 1XH1A 3RM9A 2WVVA 4A4AA 1GOMA 5A8PA 2D3LA 4M81A 1JYVA 4U31A 5A1AA 3GXNA 5IHSA 1UOKA 5E1QA 4U33A 3OLDA 5JIPA 2VL4A 1GQKA 3ZMRA 3ARXA 2WAGA 2G41A 1O7DC 2J8GA 5A95A 5ABGA 1V0KA 1DWJM 2VX6A 1V08A 3N11A 4Z2GA 3PZUA 4WKFA 4E4PA 1OINA 4P8VA 1KXVA 3CZ8A 3HN3A 1W3LA 4LYRA 3T2PA 5BWFA 3L4VA 1PS3A 4PMXA 4P8WA 5EB8A 3QGVA 3K4AA 3G6LA 4W88A 2PWFA 4HP5A 3PZVA 2OSYA 3WUBA 4CVUA 4KRUA 1MQRA 3QHOA 3UR7A 1HJSA 3QHMA 3BXWA 2DDXA 4U3CA 4LGXA 3K4DA 1H0IA 1PAMA 1HKJA 3AXIA 3VILA 3IJ7A 5A6AA 3GTNA 5DF0A 1K9TA 1JXKA 5E0FA 2WMFA 3AXXA 2PBGA 2XN2A 4F66A 5I6SA 1EA9C 1MXDA 2YA1A 1E6XM 3WY1A 1V03A 3TV8A 3S2CA 4LX4A 2OLHA 5A69A 4GINA 3RJXA 2WSKA 3EDEA 3AMDA 3CZEA 2DEPA 1RPKA 1YQ2A 4LQ1A 2CBUA 3EMCA 3KWXA 2XVGA 3ZT5A 4KGJA 3GH7A 1C3FA 1NWRA 4WLCA 2OW7A 1LL7A 4FLSA 1K9FA 2EBNA 5IFTA 1IZJA 2VC9A 3GDBA 3VD5A 3KE0A 1KXTA 1W9BM 3B9DA 1TA3A 1GOQA 4HU8A 3W38A 1W3HA 2C7FA 4HOZA 5EBAA 4Y7EA 1CLXA 2QMJA 1JYXA 3CHEA 3UG4A 3WY4A 4NX0A 4FF5A 2GDVA 3G6MA 4QCEA 1I75A 1MW2A 3HMCA 1ISVA 4PTWA 1AQ0A 2X2YA 3LXBA 2EEXA 4NXKA 4M24A 1TFVA 1MWOA 4TVDA 1TG7A 2BHYA 4D6IA 2BS9A 1C8QA 1UKQA 4Q22A 1HL9A 4FNRA 1G01A 4N0RA 2VRQA 2YBTA 2VCCA 3ARZA 3L4YA 2B31A 2GK1B 4CN6A 1W1PA 2DH3A 4JZ5A 1UH2A 3OLEA 4W7UA 1FA2A 5ABFB 1JDDA 3U5UA 1V6WA 2XVLA 1JD7A 4P7RA 3T09A 2NW0A 1OIMA 4FNUA 4CCEA 4OOZA 4H8UA 5EMYA 3UG3A 4CD7A 3SIMA 1VFOA 2YDQA 2JEPA 4HU0A 2ZUSA 1HF6A 1GHRA 3BUIA 1DWGM 5BXPA 2E8YA 3T0DA 2VZOA 2FGZA 1UUQA 1DEDA 3KL0A 1JNDA 2VZVA 1EQPA 4AZIA 3UETA 1IV8A 1JYNA 1UKPA 1HVXA 3AI0A 1J0YA 2F1AA 2O9PA 4DUXA 1LL4A 3OB8A 3AIVA 4PSRA 1XV8A 7TAAA 3SEPA 4K68A 2XHYA 3VD7A 4HA3A 4PCTA 4JIEA 2PB1A 3ARSA 4UZSA 4CU7A 5IHRA 2OYKA 3HG5A 4MB4A 2UY3A 1VFUA 1UKSA 2VRJA 5M5DA 4R5EA 4JCLA 3CLWA 1ESWA 4D1JA 4J3XA 1WNOA 5FCZA 4ATLA 1DHKA 1VFMA 4GO8A 1QX1A 2Y8KA 1J01A 3O9NA 4D72A 4J3TA 3WDQA 4PSPA 2ZX7A 4GO9A 2PWDA 2F7QA 1BG4A 2VZSA 1D7FA 4FLRA 2E4TA 2IGTA 4J7RA 3WNKA 3S5YA 3SCUA 1CECA 4BQ4A 4JCMA 2J7EA 3CZGA 3VU2A 4CU6A 4WF7A 1HKKA 1WP6A 1XH0A 4B9YA 2V38A 3AQUA 3MUAA 2BHUA 3CPUA 1EDTA 1H11A 1R86A 2WPGA 3WMBA 1JDCA 1PX8A 3W27A 3K8LA 2EJ1A 1EOMA 2YA2A 3ZJ7A 3W81A 4OZOA 4Z2JA 1E73M 3AS3A 2D23A 1ODUA 4MJ4A 3IJ9A 4W84A 2XGIA 3BUQA 3CIVA 2X8RA 2WCSA 2WC3A 2W91A 5BCAA 4DUWA 4A3HA 1ITCA 3EDFA 1D2KA 5F7UA 2FH6A 4NZCA 4FK9A 3W0KA 3CBWA 2VRKA 2VX5A 3UERA 1KBKA 4AY1A 4URIA 1E4IA 4PUDA 4F79A 2C8NA 1R47A 1US2A 1G5AA 3GNOA 1H49A 1JZ3A 3LPPA 4CUCA 4HOWA 3HG2A 1OIFA 4AIEA 2WMHA 5AY7A 1OD0A 3ZIZA 3RILA 2V3DA 1V0NA 4PRWA 5BRQA 3AHVA 1GOOA 2ESCA 3BVVA 1MYRA 3S5ZA 1CENA 5DT7A 1E4MM 1KFWA 5A6SA 3VGBA 1EDQA 4GPNA 2QPUA 1M04A 3NSMA 1KQZA 3GYCA 3THDA 2ZXDA 1B9ZA 5I2UA 4KMQA 1UH4A 4FMVA 1AQHA 3W6MA 1JGIA 4PMDA 1QI4A 3BUBA 1QI0A 5FIPA 4RE4A 1HIZA 1WDRA 3FW6A 4OKDA 4FLOA 2ZX6A 3W25A 4YPJA 3WDRA 1JIBA 1GHSA 4J3VA 2OWWA 1CZ1A 2CNCA 2DSKA 3VSVA 1MQQA 1HJUA 1BVZA 1Z32X 3EJRA 1VIWA 1N82A 2XFRA 3AMGA 1QNQA 1G1YA 1KTCA 5A2BA 1B3WA 2XPKA 4GZIA 1JF5A 4B3KA 1SZNA 1G0CA 5GNZA 2CYGA 2F8QA 1MFUA 3HG3A 1G9HA 1PZ2A 2YLAA 1LWJA 2XWEA 3U5YA 3DECA 4BZYA 3GM8A 1JYWA 3CZNA 3CHFA 2WVUA 3CHDA 3VIFA 4ZXOA 3WUEA 3WQ6A 1W1TA 3CH9A 1GW1A 2F7OA 2Y2WA 2A3BA 3WD3A 2QPSA 2VQUA 3AROA 1RH9A 4YN5A 3VINA 3WEMA 1PJ9A 5HNNA 2V3EA 4PMQA 2D0HA 1SFSA 1W1YA 5D9NA 2E9BA 1XD0A 4D6FA 2G4FA 2WMJA 1BG9A 1H1NA 1X6NA 2G3NA 5D8ZA 2VVSA 4LYPA 1HT6A 2V5CA 1DWIM 1WZLA 1WE5A 4JFSA 4ZXLA 4RE3A 2DSZA 1V3LA 1DTUA 3RPMA 4HOXA 5A3HA 3WH5A 1FH7A 1H5VA 3WELA 4ZE4A 1C90A 3CZLA 5DFAA 4JHOA 2WW5A 4N42A 4UOJA 1XYFA 4QLLA 3W53A 3AMKA 5D9OA 2WBKA 4OIFA 1LQ0A 1VRXA 3ZR6A 1KCKA 1UR4A 1YHTA 3VIJA 1NARA 4OJYA 1OWQA 5JIWA 1UA3A 3GH4A 3WDPP 4KGLA 2F2HA 3OGVA 2AOSA 1E4LA 5A6BD 4JL2A 1VFFA 4TTGA 3JUGA 3L4WA 1R8LA 2DIJA 2AMGA 4AD3A 3UCQA 1CPUA 1BAGA 1UWRA 3J7HA 4U2ZA 1UASA 1VEMA 1UD4A 3D4ZA 1TQWA 3VSTA 1OGBA 1AQMA 3SCPA 2WKLA 1E40A 3BUPA 4UQCA 3VX1A 4ML4A 2EXOA 4H7VA 4P7QA 3RJYA 1ODZA 2D1ZA 3VTRA 4UQDA 3WH9A 4CD8A 3FHQA 1E43A 2AAAA 3WL1A 1E0XA 5KZ6A 4TX6A 1UD8A 5A8MA 3M7SA 4U5IA 3WQ4A 1GOKA 3SCTA 4H8HA 2HISA 3CMGA 1KBBA 5AYIA 4X0VA 2GJXA 3BAKA 5A94A 2ZXAA 4M56A 4C7GA 3ZJ8A 3LMYA 1QBBA 3SUWA 1C93A 1KTBA 1Q6EA 1Q6GA 1FH9A 2WKGA 5HPOA 9CGTA 5CGTA 1E5NA 5D9PA 3AHXA 3AMCA 1UR8A 3UEQA 2XN0A 1XC6A 4JFVA 5A6LA 1LF1A 3AJ7A 4AZHA 3IGUA 3BVXA 4D6EA 1PZ3A 2XFYA 3A47A 4MDPA 4UNIA 4PMOA 2D24A 3GZAA 2YKKA 2DT2A 3AIUA 5M03A 4XX6A 1CEOA 2X2HA 2XM2A 3FXYA 4AD1A 4YHEA 1OGGA 2WBGA 4R27A 2JALA 3N15A 1FHLA 3VOCA 1CXKA 4IPLA 1QOXA 4Z2HA 2WWDA 4P8UA 2VCAA 3BLPX 4NI3A 2WHMA 1HXKA 1CLVA 4MAZA 1ECEA 2ZWZA 4V28A 2J7DA 4AISA 4UTFA 4MJ2A 4ZFMA 3ALFA 4ACZB 3VIKA 2G8ZA 4MADA 2J7FA 5JUVA 3A3HA 3BVTA 3CUGA 3EJSA 1QBAA 1U33A 1ZBCA 3NUKA 2PC8A 1M01A 2CXGA 2DH2A 2OYLA 4GQRA 2VCBA 4P7NA 3W24A 4NZFA 1JZ5A 5M3WA 3RCNA 3PZTA 5C70A 3WH7A 3EDKA 1UR0A 2PWEA 3BVUA 5A6MA 2VVNA 2JFEX 1CGXA 3I3BA 4AZCA 1JAKA 2FGLA 2WZEA 4LXFA 2WVTA 3A24A 4DWSA 3LRKA 5HOSA 5IXEA 3BAJA 3WH6A 5HPCA 2VTFA 4B3LA 3GNRA 2XFFA 2BY0A 3DX0A 3VMNA 3SCWA 1CXFA 3LX9A 4AMCA 5A8QA 1QWNA 2JIEA 1MQPA 2DSVA 2J8FA 2DSUA 1SMDA 2BVTA 2G3MA 1JD9A 2O9RA 1LL6A 2IUZA 2G3JA 3CV5A 1CNVA 1BYAA 3GH5A 2ZX9A 3EJPA 4B16A 3OLGA 4PMUA 1XGZA 2DT1A 1GVYA 3K8KA 3F5JA 1QHZA 2YA0A 3WF1A 3H55A 2JIWA 3GBDA 3TP4A 1FFQA 3A5VA 1AVAA 4LPCA 4WKHA 5HXMA 5E6ZA 5FL0A 3WDHA 1MW0A 1V0LA 3NIYA 4J3UA 5FD0A 4OOUA 2WCGA 3ZT6A 5I79A 4P7OA 4PBGA 3CMJA 4HMDA 1NP0A 3U7VA 2DGAA 4BA0A 3APGA 4QLJA 4IM4A 2CERA 4ZENA 1NH6A 4FNQA 1RP9A 2NSXA 5ABHA 1EIBA 4IPNB 2YBUA 4X0NA 1ZB5A 3MSDA 2CETA 3OGSA 1UWIA 1W9XA 1MW1A 3MU7A 3LRMA 1I1XA 4D1IA 3MSGA 3VIMA 3VIGA 1H09A 3WD0A 5I0DA 4UZUA 2TAAA 1J0HA 3CC1A 4CN1A 3LXAA 1JF6A 5CQ1A 2J77A 2D3NA 1RD6A 1ZL1A 3BLBA 5D9MA 2CITA 4IUGA 3MV01 5AC4A 3T08A 2FH8A 3RM4A 5BYWA 1QI5A 4JKKA 5AC5A 3D4YA 1LWHA 1KR0A 3WY3A 3E1F1 4XZBA 1E6PA 3VIHA 2ALWA 4UOZA 3WN6A 4UFKA 3OZOA 4U3AA 5A8NA 4JFUA 1F4AA 3A22A 1V3HA 1PX3A 3WNLA 1JI2A 4CD5A 1TE1A 1NWSA 1TQVA 2XVPA 5D4YA 3OLIA 2UY4A 2BY1A 1LG1A 4HZ8A 2O9TA 4JKLA 3PZGA 2XIIA 3DC0A 1ZBVA 3NDYA 1J0KA 4PTMA 3AZTA 5GQBA 4P7LA 1GPFA 1QVBA 4HA1A 5DMYA 4CCCA 3WD4A 4AEEA 2GJPA 4AMWA 4ZEPA 3D50A 2WM0A 1CGTA 3TOPA 2X2JA 3FAXA 4M8UA 2UWFA 2VO5A 3I3EA 1DWAM 3F4VA 5AYBA 4A3YA 5A6KA 3EMQA 3N04A 3SCSA 2WMGA 4D6DA 3AS2A 4W8BA 3DX1A 5DEZA 1V6XA 2ZICA 1V0MA 3NJ3A 1H41A 3WH8A 4P8XA 2JEQA 2ZOXA 3VDAA 1QNRA 2WSPA 3IAPA 2QHAA 4C7DA 3OGRA 4IISA 2E8ZA 3ZO9A 4AYSA 4NF7A 1W91A 2J7BA 1OB0A 2DPEA 1P6WA 2WMIB 1E3XA 5EFDA 3QOMA 3SUSA 3TONA 1V3KA 4GIAA 3BMVA 2W62A 4D6JA 3EJTA 4W8LA 4V2XA 2RGLA 1OD8A 2CKRA 5I3DA 3RIKA 3VDHA 2XSAA 2Z1KA 3MMDA 4W87A 4H04A 2A3AA 5LA2A 2FHCA 4NSBA 4ZE5A 1PPIA 1JG9A 2GK1A 1XSKA 3F5LA 3KL3A 2GFTA 3ARVA 2WCAA 1M03A 1NM9A 3DYMA 1KGXA 3W28A 4V27A 5ABFA 2EO7A 5CXPA 2JE8A 3EDJA 5BXTA 4UFHA 1W3KA 1B31A 1TVNA 3AZSA 3WKZA 3ARRA 4S3KA 1BYBA 4B9ZA 1E6SM 2OYMA 2X2IA 1M7XA 5A2AA 2XVNA 3VMOA 8CGTA 3M6DA 4E2OA 4D6CA 5D8WA 1Q6CA 3A4XA 3MV11 4W86A 1PBGA 2EPOA 2DQXA 5EFFA 1JZ4A 2WANA 1S46A 4AYGA 4AW7A 2WC4A 3M07A 4PCSA 5GPRA 2BVYA 2JF6A 3VNZA 1QPKA 1Q6FA 3WUFA 4C7FA 2BY2A 4GZEA 1BYDA 2XTKA 2J62A 4GI9A 3BLKA 2GSJA 1KB3A 2ZUVA 1HXJA 2VMFA 3WF2A 1RP8A 3BVWA 4FNSA 3TTQA 4D71A 3WFZA 5E9AA 3H53A 2OSXA 1UR1A 2Q8XA 3VD3A 1C7TA 1BYCA 1TZ7A 1HWWA 3LPGA 3GXIA 1TR1A 3WD2A 4OBRA 1UQZA 2DSWA 1UWQA 4WSJA 3VGEA 5DT5A 3W26A 5ABEA 3EJUA 3UR8A 5GNXA 5M17A 1ISYA 3MANA 2YJQA 3M46A 3WL0A 1JI1A 2CHOA 4RL3A 4BQ2A 2WWCA 4J3SA 1ZJBA 3WNPA 1TQUA 1JXJA 2VQTA 4AC1X 1HNYA 3VMPA 1UKOA 3THCA 2QMKA 1VJSA 2PBOA 4UFIA 4AEFA 1CGUA 4XB3A 1KXHA 1OT2A 2CPUA 4Z2KA 3RO8A 1QW8A 5JBFA 1KCLA 4ACYA 1H0GA 4UOQA 1WPCA 4W5ZA 1V3IA 2YLLA 1CYGA 1B90A 1AMYA 4HMEA 2MANA 1WZMA 1EO7A 2E9LA 4XUYA 2D20A 2EACA 3VGHA 3AHTA 3ECQA 3N1AA 4S3JA 4UQEA 2ZUNA 2VOTA 1XSIA 1XSJA 3OBAA 4W7WA 1J9YA 4NRSA
chains in the Genus database with same CATH superfamily
3PLYA 1BZ9A 3TFXA 3KYOB 4YZFE 1A7QH 2OT0A 3ULUL 4U1JA 1LMIA 4KZEH 1ZV2A 3PV6B 4M19A 3NEOA 1X3DA 4OH2A 4XWUA 4QKXB 2YAEA 1A4BA 5INCB 3MV7A 2YD6A 4WI3A 1U58B 3NA8A 2HKAA 1J11A 4OLXL 3CC5B 4YBLB 4YIQA 2VXQL 1UD2A 3H3KA 3DX5A 4IRZL 1R3KA 3ASWA 2Y8UA 4P3CL 1XB3A 1F86A 3WF4A 1HE7A 5D93B 2CRYA 2J9XA 3I75B 3R1GL 2H3XC 4PJ5D 2A6JB 2DN7A 2OMWA 5H8UA 1H3VA 3QULB 3HZYB 1SVZA 5MHSE 2YUZA 4YBLC 3WIIL 3MLSH 2ZUTA 4MMXB 4BZ1A 3HMWL 4DEPC 3O0RH 1X7SA 4IX2A 1ASPA 1G9NC 1K9DA 5IT2L 1FGNL 4XMUA 4JN8A 1MHCA 4M62L 4YL9A 4PBWD 3TT1L 1I85C 3X1BA 1SHMA 1CFTA 4QRNA 1PD0A 2N1KA 1DJXA 3BSZH 1KB5L 3CDFA 4MMXC 4REQA 5B8CB 2W0KA 2JCCE 3FQNB 5BPPA 5DRNA 1YMMA 3BCFA 1ZBKA 4ESKA 4D6GA 3O3DA 1SW3A 4MMZA 5DRIA 3PUCA 4HK6A 4XNBA 4CNPA 4HKJB 1FCGA 1W9UA 3EA2A 4C54A 5CO1A 1F05A 4WI8A 2ZUQB 3V35A 5B8CC 4Y2DA 2X4SB 4FFZL 4IMEA 3QJQB 3NSNA 1OP3K 4N0UA 3TYEA 1TZGL 3CHCA 1ANUA 4NZJA 1NFDF 5I23A 3A3XA 1PIFA 1TPB1 5D7SL 3O07A 4ODVL 4W4NA 1VEOA 5DHVH 1UD6A 5M95B 3LYRA 3I7SA 3VG0L 5FCSH 3NPUA 2ZUQC 5HGAA 1OG0A 1YEEH 4GBUA 4X6DB 4IG2B 1VBUA 4DM2A 2X89A 4FLQA 1I2NA 1SYVA 3VCLA 3STBA 2UXGA 1FCBA 3L3DB 4G9FB 4Z7UF 1MREL 3KEHA 3H1ZA 5L7XH 2ACSA 3G1VA 5CZXC 3UU0A 4S10A 3FRPB 4B2DD 3FUFA 3ITGA 4JHUA 4Y2OB 1BOGA 5HI5C 3ZKNC 3SBRA 2I17A 4UNUA 4I90A 4ZPVB 4E42A 1JCJA 1Z42A 2ATKA 2Z1PA 2O0TA 4YCOA 4DI8A 1QHQA 3WFDH 5HHOB 1JS4A 1LO3L 4E8CA 3K2MC 3D69A 5INDB 1GC1C 4XXDB 1KFCA 1NC4B 1WZ1H 4WQ6A 1TSIA 2R1WB 4F4RA 3MRDA 1MFDH 5KSAA 4ZQTA 1HZLA 5A2LH 1AY1H 1SRDA 1S7UA 1FIGL 3S1XA 1VGEH 3MUZ1 4QQ3A 1GZPB 2F9RA 3V0GA 1M9HA 5C9JB 5I8OH 5D5MB 4I5RA 4ZFOA 2HUHA 3W01A 1XGQA 2ZUUA 2L7JA 2OX5A 3D3VA 3CTTA 1E6ZA 5AG9A 3WQWA 1FLRL 4OCNC 1Q6DA 1ND0A 3K6SB 1R5VA 3IFOB 1QFEA 4A2MA 1V05A 3FQ4A 5AOIA 3MA7B 3OIHA 1VFAB 4ZSUA 4DZ8A 3GVGA 3GLZA 4JTSA 4JN2B 4HWBH 3VO0A 1QI2A 1OFRA 1KCWA 2AK4A 4PUKA 4HN8A 3FK4A 2J44A 2EDBA 4R84A 4U6VL 4JM4L 2CC0A 4WI5A 3Q44A 5IEKB 4G80B 4OZIB 1AH1A 1N70A 3WLHA 5L2KA 3V55A 3PZNA 3IRPX 4PLJC 3SGJA 1O7AA 2VHLA 5FOOA 1MSSA 3TEUA 3E12A 4KIEA 5FYJE 3DHUA 1XIWC 4DP2X 2W67A 3K72B 2E7CA 2Z2UA 4GS7C 1H3XA 3F5WB 3UJTH 3QCTH 4AH2B 5D6DA 1F76A 3K2GA 1AG6A 2D2JA 4PB4A 3ZDYB 1R2RA 2H0EA 4FZEH 3T65B 1SJEB 3T42A 1FL6B 2YMXL 4S3FA 1P7KA 4QD2E 3QT2A 1RIHH 2MTAA 3GHEL 1MQKH 3ITTA 1CYWA 2JI3A 5FO8B 1S1RA 3FSVA 4GYPA 5SWQB 3W1XA 5EO0A 4LT7A 1OALA 4KFNA 1PIGA 2WMIA 4Y7OC 2AL1A 3QUHA 2EPNA 5I2IA 3H9HB 4G70B 4XPTH 3PGDA 3WDJA 1M3JA 3BN9C 2R0LH 4J3OG 4YHYB 1CCZA 2BP3A 4N0UE 4LBUA 3DJTA 3JR2A 2X4NA 4N2DA 2XU2A 2AJXL 2FT7A 1AKJA 2FD6L 4GNKB 4CAGA 3K3QA 3SQBA 3VIOA 1NGPH 2R69A 1W15A 2YDSA 2LAGB 1TO3A 1OC7A 4W89A 2Y7QA 4YHYC 1W1B1 3EYUH 3POHA 2GQ9A 3WFEH 3M8OH 5JDJA 1UH3A 3NIFF 1M7IA 1UM6H 3V16A 4GCXA 3F4NA 3IFLL 4MA1B 4IBZA 4QWWD 3M17A 4FG2A 3H4HA 4ZUSB 3QI9C 1ZBWA 5HGHA 3CJPA 4AM0A 4EXPX 5G2NA 4IJTA 5IVXA 1ZPLA 4R4BA 4BFIB 4DX3A 1VACB 1I8LC 4UQ3B 1ZTMA 2R29A 3SO7A 2YPLB 3J2PA 3P61A 9XIAA 4MA1C 5A6JA 4H5SB 5CZVL 5LIYX 3P40A 1J8VA 3MBWB 2RAGA 4IWWA 5FWRA 1ZGLA 1A7BA 3Q9QA 3VABA 1E50A 2OP4H 4DIAA 3BZ5A 3UTZB 1F7BA 3X14B 4QHKJ 4WZHA 4Z76B 4JJ5A 4LO9A 3NCBB 1ZLEA 3ZDXB 1XXDC 1NDMB 2D9CA 3QXDB 1KT2B 2TRYA 4HOMA 5AEAA 4GNVA 3VKKA 4A3RA 3QCVH 2OCCB 4NI8A 1B1YA 5BWAA 2AKMA 4MD0A 4MZ1A 1OEPA 1J12A 4PG2C 3IGKA 2A3CA 1EZ2A 4H01A 4K36A 1AIZA 4L7ZA 5C0GB 2DQCH 4HHHA 3D3VE 1DSFH 4G7SB 3RGBA 4QNEA 5JIPA 1GQKA 3FFDA 4HJIA 3CDCA 4G71B 4JFQB 3TH3T 4IIDA 1YJDH 1MCDA 4UZGA 1EEXA 4EBQL 3RTLA 3T2PA 5FO9A 5T5NG 1OGTB 5JW5A 4KWVA 4HP5A 1CL7L 1KEGL 4CVUA 1KFLA 1Q0XH 3WKMH 2YQBA 2FAUA 3BGMB 4BI7A 1QNZH 3TJHC 3D39A 4HEPG 5BQDA 3B8IA 4POCA 3E6HB 3B0UX 3NFPB 1IEVA 3C5ZC 4RR4A 5CP3A 1BZ7B 5L2KE 4R34A 2YD3A 2JCCB 5I30L 1Q8JA 1FWSA 1NGWA 2B08A 1EIXA 4R5XA 2V9TA 1LL7A 2VXUL 1G7LB 4F7PA 5B38A 5IFTA 1U8OB 4XN2A 1KXTA 4QHKI 4Z78A 1ZLVK 5CCGE 4HOZA 3BZEA 3IDMA 1CLXA 4N2LA 5IMOB 2ZNXA 2WLHA 3NH7L 3B9KA 3LXBA 4BR1A 1HINH 4WI0A 1JQXA 3DFHA 1C8QA 3LK6A 2JKTM 1G01A 1XEUA 3EWWA 4UYQA 3U7YH 3CFDA 3BPCB 4MFDA 4WHCA 2W0UA 2XVLA 4P7RA 1A0CA 5KBLA 3MKCA 3TPUB 3FCBA 4J35A 1K8DA 5EZJB 2YEZA 4CCEA 1QFOA 1V7ML 2JQZA 1XIFA 3WNIA 1UG9A 2VZVA 4QTHB 4PPTA 4L8BA 5DZOA 4UIMB 1XF5A 3R4RA 3G1FA 4LOUD 4GJJA 2HZHA 2NY5L 3OKMB 3SE9L 3AIVA 2NXYB 2ZOLA 4PSRA 4WEMB 3H21A 5GRXG 3QF0A 4PAZA 3FA4A 3ARSA 3V9EA 4OLYL 1VFUA 5CS7A 4ZUWB 4H8WL 2PTUA 3NFUA 3NM1A 2XU9A 4R2GB 2NNCA 4UI2A 4GAJH 5BZZA 2NXYC 2AL2B 3BE1H 1MDAA 1XSOA 3CQJA 1MCPH 4JCMA 4ZQMA 3EBGA 3MZTA 5F7NC 5GGRA 4KDTA 1WP6A 4B9YA 4NNPL 4MBOA 2WPGA 2QAFA 1PX8A 4R2GC 2YA2A 3EX2A 4OZOA 3CHVA 1RY8A 1TYRA 3CFBA 1BZ9B 3UXFA 3KW3A 3V7MA 4POUB 4JTJA 1GG0A 3WV0A 4N9CA 4U1JB 2VUNA 4O11A 1KJ2H 3E2SA 1R47A 4DAGL 1K2DA 2HSIA 4RZCA 4C57C 4X7CC 1X5GA 3MV7B 1OF6A 4WJ8A 1TJPA 4E2BA 3GFYA 1MYRA 1T7XA 4BH8A 2V7NA 2EIDA 4G8EA 1EDQA 5F2GA 3THDA 4KMQA 4JZJA 3W6MA 3UP1A 1DANU 4F48A 3T44A 1CTOA 2QCFA 1QI0A 5DCDA 4YIQB 3IMTA 1R3KB 4Z7IA 2R27A 1HILA 3AB0B 1M3IA 5AVHA 3RL2A 4CC1A 1C9SA 2XFRA 2ATMA 1FORH 3P81A 2A4CA 4DZIA 2OMWB 4PJIF 3O8XD 2F8QA 3X3GL 5IKCA 4LGRB 1FZKA 5DO2C 2P0IA 4US6A 3O2WH 1DN0A 3AB0C 4RFOH 2ATPA 5FSDC 4UV7H 2PPFA 1MHCB 2F5BL 5IP4A 4HCGA 3D39E 4WFFE 2J1ZA 4DPRA 5I15L 1RZIA 1RZKH 1SLVA 4O02A 5CPOA 4AVFA 3APDA 2N3JA 3ZE0E 4REQB 3MLYL 4X61A 5DRNB 1YMMB 2XVBA 3O3DB 1PYMA 1MFCL 3IPBA 4ODHH 3WELA 4MMZB 1PJWA 3O3RA 5JHAA 2GJJA 4KHXL 2OZ0A 3GO1H 1PO9A 3GG1A 3E3QE 4OLVH 4IJCA 3SE8L 2PLTA 3M6YA 1AP2A 2XICA 1KV7A 3F2BA 4Y2DB 3KAOA 1JVOA 4MMZC 3BLFA 1R3RA 4N0UB 3WJXA 1OGBA 5DC4B 1AQMA 2WKLA 3F04A 5FCUL 3VX1A 1AR1B 2E4FA 2MUCA 5LVEA 4DJFA 5IESH 4DGYH 4XTIA 5HVWA 1IBZA 3B8TA 4Y9BA 5HGAB 4Y2DC 5A8MA 1PZ0A 1YC7A 5DD6A 4WUIA 2WO4A 3QZWA 1SYVB 3VCLB 4MCMA 5SWZD 3BXNA 3LMYA 2CWNA 1AR1C 3QR1A 1XZ0A 3HE6A 9CGTA 2VDOB 1VCAA 3AJ7A 4IGSA 4UNIA 4URTB 2QW5A 1HW6A 3WE6A 2ZKYA 3ET9F 1BOGB 1PMYA 4WSGA 4M6ML 1OGGA 2VDNB 3VXRA 2ZVRA 4NG3A 3BLPX 4E42B 3CU7A 3QCUH 2ATKB 1RBOB 5EPMA 1U83A 3VIKA 3ATFA 1F90L 1DQLH 3D69B 2PC8A 4P7NA 4O16A 1EC9A 3M1ZA 2H3DA 4PJHF 4FQCL 3S36X 3MRDB 4KFZC 5KSAB 3I3BA 3RDTD 1B3OA 4ZX3A 3N4AA 2GDQA 2FGWL 4Y19D 4OIAA 1S7UB 4PTUA 5AC8A 3IVKA 2V5YA 4KBXA 1EX5A 1SXZA 3WLBA 1SMDA 1YNQA 4ZFOB 3WUZA 4IRSA 5JHBA 1XGQB 5DN1A 2OX5B 2WNKA 3D3VB 4HJJH 4ELMF 5KSAC 5HULA 5J6HA 1OVZA 5J5RA 3H56A 1ZSXA 2EDMA 4BD4A 3UBXG 3ABSA 4ZS7H 3F5JA 2YA0A 1ND0B 4XO7A 4ICMA 1R5VB 2D2HA 2DVXA 3CD4A 4EXBA 1XLDA 1XDJA 3V5DA 4M3JA 4UINL 4BF5A 4DZ8B 1EJWC 4YFEA 5IW6A 4AX3A 1UENA 3NYKA 5DA4A 2AK4B 4Y8AA 1JPDX 4Z3GA 3SFKA 5D9MA 4ABQA 4HWEH 3T08A 2HK0A 4ADGA 4P5MA 2WUCH 1OCRB 1FH5L 2QDEA 1MOEA 6REQA 4RDBA 2QFPA 4L1XA 1Z5YD 5L2KB 4GG9A 5C09A 1JK9A 5JQ6H 5AZEH 5IHHA 4WWOA 1WUEA 4O4VA 4WX2A 1KC7A 4NUWA 4PRID 4PTMA 3ITCA 3UTPE 3TR2A 2O1AA 2I7GA 4DN3H 5FEBA 1HEJC 1BYPA 1GPFA 1QVBA 5DWPA 4EXAA 3FOLB 1MEXL 5M7QA 4MDJA 4ZDHA 3TWBA 4LP8A 2E7BA 4XNXL 4TF4A 1B3IA 4K3EH 1TV8A 2WQSA 4KJPC 2NQJA 3SGJC 1P7KB 2F53D 1LP6A 1WIOA 3HLAA 4I7ZC 8FABA 4G7RB 1HKLH 2G60H 5EO0B 2QHAA 5D6DC 1MRCH 1ZT1A 2DDQH 1DBAH 2VKWA 2WMIB 5A7EA 5EFDA 3GDTA 5F7HA 4C59B 1IGIL 5I2IB 1OD8A 3PGDB 1ZHKA 2FHCA 4W9KC 4ZE5A 3OC8A 5D8JL 5IOPA 4GYPC 5CXPA 5G4WA 3BK0A 1X7TA 3G1XA 1TVNA 1FXQA 4WY0F 2A38A 2X4NB 2X2IA 4XOAA 2XSKA 1H51A 5HYIA 1AKJB 2A2IA 3HGJA 1F74A 3OAYH 1O1ZA 2CZDA 4KTDH 5AW8B 4A2SA 1BMGA 1SW7A 3MLUH 3SQBB 3M1CA 1S46A 2Y7QB 1YO4A 3NGFA 4Z5RA 1QK2A 4P8QA 2XTKA 1KB3A 3GLEA 2IWFA 1M7IB 2IGFH 1S9KC 2WBJA 4BHUI 3LRGA 4FQIH 4Z17A 4YR6A 3KFTA 3M17B 2XZZA 1NMBH 2FB4H 1RZ7L 5JLZA 4MGXA 5HGHB 3K5SA 4KK9C 2R9HC 3EJUA 4AM0B 3KGRA 1GAFL 2Z6IA 3RN6A 3S8WA 1EVTC 3SOBL 2A6KA 5IVXB 5DANA 1ZJBA 4AM0Q 2J6EA 4R4BB 3THCA 4NNXB 3LKRA 1WPCA 3PCYA 2XI9A 1WZMA 2RDWA 5I1HL 4XHQA 2Z25A 5CU5A 3F7PC 4BFRA 1ZGLB 1XSJA 4RAVA 2Z2AA 3Q67A 1DE4A 1J1OH 3WIJA 4IM8A 4JJ5B 3BTNA 2XCMC 1PEWA 1LJYA 3VE9A 3P4OA 4Q97A 1NOAA 3L54A 2CEQA 1UXWA 1R5WA 4QTIH 2EVGA 6TAAA 4MD0B 3LN9A 3SUUA 5EUOF 1G84A 3QJSB 1E5YA 4E6MA 35C8L 3O0KA 2B7OA 5GRUH 3ARUA 1TLMA 3FFDB 2WVSA 4X8GA 3FFCA 4BF7A 4Z7WF 3LZRA 1MWAL 2Z34A 4WWKD 3DARA 4MTVA 1F00I 5AB3A 3T0EA 1UGKA 5FO9B 5JW5B 3WJWA 1EHLH 3DURA 4C55A 5E99L 4IKJA 2WB5A 1VC4A 5J6GA 3NTYA 4UXDA 3P02A 4OKVA 3GIZL 3MPCA 4PULA 3KLLA 4JY8A 1DE6A 1SR0A 3D39B 4ZW3A 2YGQA 2A99A 4XC1L 5HJ3A 4PI0A 4MLJA 3QS2A 5JQ9A 2G4GA 2NY1B 5JHLL 1RK0A 2FVMA 1UXLA 1NGWB 5C09E 4Z3HA 3FRPG 3LM7A 4GUIA 3HMJG 1TJ0A 4F7PB 4PJ7F 5B38B 4RA3A 1KXTB 3MUGA 5EZIH 2B59A 4Z78B 1TPXB 3BZEB 3IDMB 4E2VA 1HSAA 1ZU8A 3GO2A 4QM1A 1UWAA 3D7PA 2NY1C 4UV4H 1MY5A 3OGCA 3RQ3A 4JAWA 4BFFA 1X9LA 4XBPA 5LBGA 2AGKA 1MFEL 4R9OA 4ENED 4WI0B 1V02A 3IRZA 4U7KA 3MMWA 1FDLL 4YJZL 1CXLA 3ZE2F 2X0SA 3U30B 1TPXC 3E3QC 1D5IL 4N6QA 1MRQA 5BROA 2CESA 4U4IA 4ZK8A 1BVNT 3FQTA 4UTLA 3CFDB 4K94L 4ZW8A 2F7PA 3D5OF 4JY5L 4RSYA 3B9KC 3P4MA 1T41A 1K8DB 2YEZB 4G8GD 1NPUA 4MKSA 3EFDL 3WMLA 2D2OA 4IIHA 1NZRA 1SDDA 3V4BA 3U30C 2CBVA 4JJOA 1DBTA 4L8BB 3BMXA 4IICA 3L4ZA 3AZRA 1XF5B 5CGYD 3BPNB 2YL6A 5IQLA 4XAGA 3BAWA 2P3ZA 3KW7A 3FN0H 4Q4OA 2ZOLB 4W9EC 4DP8X 5DHEA 3LS4L 2DUAA 1A6VH 1Q7MA 4G8TA 1RUMH 4UNTA 5LNWA 1K9EA 3DYPA 3WIFA 4PLKC 5I77A 3BPNC 5GGVY 2GVYA 1T4KA 3CEUA 3TBWA 4KKPA 4G42A 3P11H 2XH0A 2VR2A 5DK2A 3FA3A 3U2ZA 4JIPA 4UQBA 5EV7A 5H1WA 3HBLA 2VDKH 3ROLA 4P46A 4ZS6C 5GGRB 2JIXD 4HUMB 3EW3B 4JE0A 4N0CD 3W7JA 1WJ3A 3UL4A 1U8LA 3CFBB 5GS2H 3MI6A 1UR2A 3DX3A 1HL8A 1PCSA 4H6KA 3ARDA 4EJ1C 2Q8AL 3QQ9D 4Q6YA 5F0JB 1E7UA 2IOOA 4KDTC 1K2DB 4RZCB 4PLNC 1TPDA 4NNAA 4DGVH 4ICCX 1PG7L 4OUEA 5KANI 3IGLA 2CK2A 4TXEA 2W79A 3T6XA 1EQCA 5E5MA 3ZZQA 2ED7A 2NUYA 4PRDA 3SPIA 3QDMD 4BH8B 4HC1H 2V7NB 4G8EB 4APQD 2BJML 5IMMA 1A3XA 1F6YA 4PVLA 1CFNA 4JZJB 1M53A 3ZRCC 2J8HA 1S9VA 3PZMA 2HXTA 4XZWA 2XZCH 3ZX1A 4YEFA 4JFFE 2EVIA 4WI4A 2WXLA 1HILB 1ECQA 5I1JH 1IC4H 3RL2B 5M94B 3FFCE 1GH7A 5JXED 3QOKA 4LQFL 4JZJC 1T99A 3JZEA 5IKCB 3I85A 1FZKB 4YXHL 2WWNA 1JTPA 1DN0B 3KX6A 3FKKA 1IEAA 2PYED 2ATPB 5H8DA 3PHQA 4R8WL 2V67A 2IKGA 1SBBA 2VAAA 4LEXL 5DZJA 4JD4A 4QR6A 2I85A 3O6KL 1RZIB 1WAAF 4O02B 1YPXA 3MX0A 2DYPB 3STZA 2YPVL 2QNEA 5B7ZA 1G69A 3ABOA 1A3RH 3LZFL 3MOAH 1WKYA 1Q9OA 1TKWA 2Y8VA 3FTGA 5K69A 3KZSA 5IDIA 1Z0NA 3ABKB 1LDSA 3VFMA 4S2CA 4FIQA 1CBJA 3MJ9A 2PPGA 5AFDA 1XLJA 4JFTA 4F15C 4EDWH 2WQVA 3A3WA 1R46A 2B20A 1AP2B 3RWJA 1OCWH 3QJVB 2NUPA 3EOBA 5BOEA 1CVRA 3NFSH 5CBAA 1V02E 2RACA 5FJUA 2G0KA 4OLZH 3R43A 2B1AH 2FHFA 4CMHC 2PDQA 4KY2A 4NQQA 1TZ9A 3QPKA 4X0KA 3EJZD 4KRMB 4WEUD 4P9HL 4I8DA 3P0YL 1G4SA 1XIWA 5MP6H 6PAZA 5AVRB 5DD6B 3GSNH 1Q2RA 4LOVA 1PLGH 3QZWB 4HW6A 2H26A 5FGCE 3BXNB 4YHML 4LUJA 1L9MA 4S3CA 2IQDA 1XZ0B 5TE6L 1NIDA 3HE6B 5I1LA 2QGEA 3FT1A 4WK9A 4PP1D 4DJFC 3IIXA 1NFGA 4MKVA 4PUBL 4N3TA 3WE6B 3II3A 4XVTH 4LFHG 2F7FA 1A3WA 2F5AH 3VXRB 1U2YA 5EIQA 3U9PH 2CW6A 3HE6C 3I2CH 4CVWA 3RR1A 2E1DA 1IEXA 5EPMB 4A38A 2AQWA 4DP4X 2BVOA 2W63A 4IBWA 3VC6A 2HFTA 5E4AA 4Z3IA 2Y61A 2A3EA 1D3CA 3E8VA 2XC8A 3H7UA 2BSTA 1WZKA 3ATDA 1D5XA 5DA0B 4TNVF 3T8VA 1ZALA 4PTUB 3AXLA 3ZZLA 3IVKB 2WO2B 3NQEA 3VRLE 5AZ0A 3QAQA 3L68A 4IBLT 2KHAA 4WJXA 3WLBB 1CBVL 4IRSB 3MVIA 1G67A 5J6HB 3DXAA 2P4AB 3VFSA 2YXWA 3LJ3A 2APFA 2YFOA 3HPAA 3TEXA 2EADA 4AQ8A 3WIHH 2NY6B 4HV8A 4X6DE 3VFOA 1XH1A 2OMXA 4M81A 4FULA 3V5DB 4U31A 4IRSC 2YMOA 1FHNA 5B1CA 3W1LA 1VPOL 5IW6B 2G41A 3F64A 1PUDA 3MJYA 3GEFA 4X6EB 1MLCA 1A8ZA 4WW2F 1HYSC 1UWEL 4PMXA 2NY6C 5FLVA 5EB8A 2PWFA 4P5MB 2PRMA 1YPZA 2WKJA 6REQB 2CZ5A 3QW3A 3LOWA 4WY7L 2Y7NA 2Q0ZX 3O9WC 3CQKA 3QVAA 4U1SA 5C09B 1CICD 1JK9B 4TLTA 2WOYA 3OQRA 4OFCA 5EORH 2C1GA 4XD3A 1KCVL 2UX6A 3G3LA 3TSMA 1IFHH 2V5SA 2MPAL 3OG6B 4QITA 3ZT5A 4MDJB 2I1OA 1S3RA 4ZDHB 3COTA 4EIVA 3VFGH 1EHXA 3AWFA 3TSDA 1I1CA 1MKFA 2ZZUT 3LZ5A 2VGGA 7PAZA 2FX8H 4K8EA 1JYXA 2FEDD 4N2FA 4FF5A 3HLAB 8FABB 3G6MA 4BZ2L 5D5ME 4JGJA 1IEQA 3BQVA 3F6IA 4JFDA 4KHTH 5CZJA 3PFQA 3OVQA 4AL8C 2BHYA 2CKBH 1ZHKB 2K70A 1UCWA 3N44B 2YK1L 2QQQA 1R9YA 3OLEA 3RAOA 3DJRA 5IOPB 2P5WA 3C5ZA 4JR5A 2MCPH 2YW3A 5GISL 4N2BA 3QC0A 1A4CA 2C3WA 1I45A 3T0DA 2Y2YA 3PNZA 4DT2A 3L95A 1N8IA 1BRLA 1UW9A 5KW9L 1WX0A 1UKPA 3O3AA 1HVXA 3T6CA 1FWGC 1T1YA 4Z5RB 4PJXF 3REVA 4JZOA 4Q7BA 4GC4A 1GS7A 2WBJB 2PB1A 4BINA 4YR6B 2WXFA 4KEVA 1KBIA 2DQ6A 4JCLA 1KPRA 3CLWA 1ESWA 5JLZB 4OR1A 5EBWA 3K6NA 1NVMA 2VSDA 3VI3A 1AS8A 2FT8A 2A6KB 4J3TA 4F37F 3ZDYE 3W7QA 3UZWA 3RJDA 3M5VA 2WBJC 3FSOA 1A5CA 3LIUA 3PDOA 3S5YA 3RYMA 4QJ3B 5I1DA 1BD0A 3LKRB 1W1A1 1O0VA 1U3HA 1XO8A 1TQJA 4UM9A 5FDYA 3LHWA 3D6GA 4RAVB 4H0HB 2PP1A 5ADOL 1DE4B 2EG8A 1RPXA 4YHPA 2ADAA 5SWSA 2L5HA 2X3CA 3AU0A 2LLNA 1UOZA 2YD2A 5DLCA 1KGCD 1TTRA 5I8CA 3P4OB 5E5LA 4WO4D 3SDDD 3CBWA 4IFOA 3K91A 1UXWB 2CUIA 1R5WB 4DY1A 3HRZA 3R06A 1X1OA 1JZ3A 1EMTH 4AIEA 5DUJA 5AY7A 2IFFL 5CEZE 3NJGA 4YMPA 5BRQA 1GOOA 1HO1A 1PKMA 1BW8A 2VLJD 1JCVA 3KOZA 2PN5A 4GPNA 3USZA 2DEXX 4E36A 3FFCB 3NWRA 1C5BH 3TMLA 3T0EB 2O4MA 2XHNA 1SFJA 3DURB 2WZTA 1I4NA 4ZZKA 2DW5A 3GBNH 4HUXA 5J6GB 2XPKA 2VC6A 4J5NA 4OKVB 4MXQC 4UIKL 3MZNA 3ZQXA 3T0EC 4WU7A 1X8CA 4UR7A 2YLAA 5HJ3B 4WI2A 3LHTA 1YPZE 3CHFA 4P04A 3WXWL 3BW4A 1RAMA 4N26A 3DVIA 1EFXA 1RK0B 4G7VH 4QRPA 1EPVA 1TJGL 5F1IA 2YPLE 3AROA 3SDAA 4ZPTA 2A83A 1F6LL 3A4DA 1NGQH 4NZ1A 1XLAA 4LT9A 3NXLA 3MUGB 2HVNA 4YHKH 1H1NA 2B59B 1WZLA 1VD6A 3D6NA 1HSAB 3NSYA 2I5YL 3JQOB 3OGCB 4HH8A 4I9JA 5FECA 4WGXA 3ZDXE 4XBPB 4RXGA 4PFHA 4MRBA 5EF1A 3B6SA 4NQTA 4A2LA 1VRXA 5E03A 2VXTL 1MRFH 3H2PA 1I8JA 3GH4A 1MCJA 3RWGB 4QHNA 4WEEA 4XZNX 3ECVA 3GWJA 2A9BA 5A6BD 3U0WH 3L2IA 4DEPB 2F54A 3FQTB 3FU9A 4JEGB 4U2ZA 1UASA 4PJCA 3BOXA 3P4MB 5FX3A 1DQIA 1SU5A 2Y7SA 3T4YA 4LUIA 4JGUA 3RJYA 2R56H 4PJFF 5FGCB 3NZQA 3WH9A 3ULVL 4CD8A 1SDDB 4GP4B 1YY8A 5IROA 2P5WE 4DB7A 3WZ0E 1GW9A 3UZJA 3MBXH 5JMUA 1FGVH 3HBQA 3LLXA 5KVDH 1NF0A 2GJXA 5K9QI 2CIIA 1RZFH 1YRRA 1EEZA 1FCVA 3QEHA 3FDKA 3HFYA 2WUBL 3A47A 5EPDA 4AF0A 5AVSB 3WIFB 5D6CA 3HJ0A 4GVHA 4XCFL 5AYYA 4RMTA 1LZOA 3NA9H 1T4KB 2CBQA 4HHPA 1NKRA 3TBWB 5AOZA 4PGJA 4G42B 1TMLA 2FX9L 3CX5J 3FB8A 4KFOA 1KYAA 1VSCA 4XWGL 3SO3B 4R6UA 3GD1C 5DK2B 1MEIA 3E0GA 1JNJA 4V28A 3OC5A 3LGGA 4YXLL 3QYMA 5I8EA 3ROLB 2G8ZA 3OAUL 4P46B 1F13A 1KTLA 3OD3A 4NHCL 3VI3E 2ENSA 3H24A 2UUDH 4C5ZA 5CC6A 4INFA 1U8LB 1GTHA 3SO3C 1W8SA 2EXYC 1W0MA 3N19B 4JG1H 3MBED 3ARDB 3FH7A 1PSKL 2X10A 5CKAA 2XFFA 3RDJA 4P46C 1ITUA 3KPSD 4AMCA 2DMHA 2WQDA 1QWNA 1E1CA 1MQPA 3WU1A 4FHAA 2NQCA 3AXKA 1MG3C 1BYAA 5E5MB 4HS8H 4X5PA 4PRDB 1RA0A 3NIGE 1H3TA 3S1UA 5IMMB 3O4LA 3ARDC 1CFNB 3BEVA 4PV8A 4Q3MA 4M7TA 4PRHA 1NGXA 2XN9D 1S9VB 1V0LA 3EA3A 5FD0A 1T2XA 1UXMA 4QLJA 2LLEA 1Y6KR 1CD8A 1ONEA 3PGCA 5FF0A 5I19L 4LARH 3RU8H 3RA7L 1W9XA 5LIKX 3QE5A 4D1IA 2DM3A 1XF2A 5F7LB 1BMWA 3P3YA 4LPWA 4G5ZH 5F2FA 4L5FL 3D4YA 3WLLA 4H8PA 3RAJH 4P2RD 3C08H 1IEAB 2VMDA 4PFMA 2WGXA 3PHQB 3WS3A 4KV5F 2VAAB 1INQA 1P5VA 1NWSA 1BSLA 3B5HA 3TCTA 4Q4SA 4HZ8A 3NABL 3MX0B 1E9PA 3BESR 2E9JA 3STZB 2JB5L 5GGQH 3WUWA 4QYOA 1U22A 3TNOA 1TKWB 3CVDA 1SGKA 4QRPE 1V8HA 4I1NB 3FTGB 4PWEA 3DI3B 5F1UA 5D2LF 3NN8A 4N8UA 3VFMB 3D50A 4AFYA 2WM0A 4LVEA 2DLFL 4M8UA 5G1MA 5LGZA 3N04A 3P7YA 4Q89A 3SCSA 2X1TA 3SW6A 4PD4J 1V6XA 4DJDA 2QADD 1UXSA 3OPZH 3RWJB 4XCYA 1QNRA 5BU6A 2QSCH 2NUPB 3EOBB 3B04A 1U1HA 3QARA 3MV7E 2UY7A 4IOIA 1NSNL 3SQMA 1AZ1A 4OZHA 5CBAB 1UIOA 3DSFH 2EKSA 3MMDA 4NUMA 2O7SA 2JGQA 3MNDA 1DJHA 4X0KB 3DGBA 3H9ZA 3QORD 1XIWB 1EGJA 2ZP9A 4GS7B 4PJCE 3LHVA 3H7VA 4ECLA 2QULA 4TUJA 5HDBF 3TIDA 3F7VA 1OK0A 4D6CA 2H26B 5J0BA 3V4UH 2A7PA 2CZEA 5I1LB 3AUOA 3SBFA 2VEFA 2QQKL 4JO5A 1JRHH 1OTSD 2I60H 5KOMC 3SGDH 4N4YB 1DOSA 3FCTA 3PJLA 3VOHA 1P9MC 4XZ9A 5FESA 1TR1A 2DSWA 3K2IA 2OSLA 4GRSA 2CHOA 1YMME 4KRPD 3JTBA 2BVOB 4AEHH 4LVAA 3WNPA 1TQUA 4MAUH 4P59L 5JIQA 4NZUH 3EWCA 4B60A 1ZJIA 4ABVA 3FKRA 4UT6H 4XRCA 3OAZK 4OT1H 4UOQA 4K23H 2YLLA 4G6MH 2C79A 2BSTB 4FN0A 3KVMA 3LY0A 1D5XB 4XUYA 3N1AA 4UQEA 3S3GA 3OKLA 3AXLB 3EX4A 4FHJA 1SXNA 1YDOA 2O30A 1E9QA 3MOQA 5FYJL 1QG3A 3DC8A 1IMHC 3RWIA 2BRRL 5BXFA 3RMEA 1P6CA 3L4XA 1WCGA 3PL6D 2DQJL 1T89A 3DXAB 2X87A 3VFSB 1H63A 1O95A 2QQ6A 3IK2A 1LQBC 3QI9B 1EHAA 3OZPA 3C5JA 4TX8A 4QX4A 4KRTA 2PGEA 2H6UA 5FF2A 5FJJA 2XKSA 3NG5A 4HV8B 3VFOB 1JZIA 4Q56A 2CO3A 2OMXB 5BOFA 1EEQA 3QQDA 1X7QA 1W6TA 3I9IA 5CINH 4IRJC 4CSPA 3MKVA 2BC4A 3W00A 4XTRD 4PRHE 1MLCB 3CQFA 2XYLA 1KOAA 4LEFA 4IS6A 3RXZA 5DWUH 2QF8A 4AQ8C 5A2CA 4J2XA 1UT9A 3PFUA 3IK4A 2VLKA 2QCMA 2I25N 1YPZB 1KLFA 5LQBL 3TEVA 4RZ6A 1ZMYA 3SUVA 2I5QA 5CPTA 3ABLB 3NESA 5DD0H 2EDHA 3JT2A 1AHMA 3FU7A 4N5EC 4U1SB 5CM1A 1CFVL 2XA3A 2Y6ZA 2V3FA 1PCXA 3NMEA 5FW7A 4XPAH 3TYGL 4QE4A 1NDTA 1KWKA 2Z8RA 3K1DA 3FJLA 4CW1A 1E4WH 4LL9A 3AFBA 3ARFA 3DCPA 5PAZA 1OX4A 3QEUA 3D0CA 3KMDA 1WFTA 4HBKA 4KETA 2YLHA 5AW9B 5HMFA 2FBJL 4BK8A 3S35L 3FA5A 3W6YA 4QFUA 5CJNA 1P4LA 1NWTA 4Y6GA 4N25A 4P2OC 2E9MA 5CBIA 3MTRA 3HS8A 3P8JA 3UXIA 4JFDB 4ZMGA 3DJ9A 1IM3D 4JDEA 3IS4A 1EO5A 3O6FA 1ZLUH 1TX2A 4DN4L 1JWSA 1Z9SA 2AGTA 2BIHA 4MB1A 4M6QA 1O68A 1MJUH 4PYSA 4EI5C 2PR9A 2OR9H 1RUQL 1K7EA 3W7CA 2FO8A 1JRHI 4D9LH 4RISH 4WI6A 3SGDI 2P5WB 1UR9A 3TKFA 3C5ZB 4OZHE 2VX4A 2NZ9C 3LZPA 1HX0A 5DFTA 1R0AL 3OJDA 2X7WA 2NX3A 2IDFA 4J6RL 1NA8A 1SXCA 2AK4E 1Z9LA 3DFNA 1AH0A 3L95B 1BRLB 3UX9B 1B4LA 1ACXA 1EZUA 2CO2A 3O3AB 3B34A 4HQQL 3VVWA 43C9A 5AENA 1OAUL 4PY7A 3REVB 4JZOB 1J0ZA 1A6AA 2CNYA 4WENB 1BFTA 2X88A 4XV0A 3VZZA 1GY2A 5IBXA 4IMLA 3SECA 1C1EL 2J7HA 3QWQB 3FSTA 5FM5O 2P88A 5GNYA 5EBWB 2AABL 3NVQA 2YCLA 5IQMA 3VI3B 2JKIS 4FQLH 5LN4A 3MSYA 4OZFG 4I48A 1I9RH 2XBDA 2XIMA 3AWNA 4EAMA 3PDOB 5I1DB 2QTEA 3BG3A 2G97A 3U2EA 1HIMH 4JFYA 1BPLB 1MY7A 1ACYH 1U3HB 3GVWA 2AGJL 4UM9B 1WAWA 3O63A 3JW7A 1VHPA 4PMFA 4AIOA 1P69B 5A2KH 2WJFA 4YHPB 5ILTL 5SWSB 1RQHA 3SCMC 5JXAH 5I8CB 1QSVA 3QEQA 3NIGB 4XNQA 3DBPA 1EB3A 3W88A 5H6HA 3HNSL 3VFLA 1U3HC 4GRWF 3HRZB 3R06B 3B9AA 3JS3A 1ZHAA 2AQ2A 4NZRH 3D5HA 3MXVL 5E6SB 2GJ6D 2O6EA 1IJ9A 3HM7A 1BXXA 3OWRA 4ES4A 3OTRA 1AOHA 2DJLA 2Y7GA 2WLJA 4JN6A 1TMCB 1DFXA 5JMOC 1JZ2A 2D4DA 1HHHA 4L0ZA 1MJJA 4FI4A 2Y5SA 3E5BA 1O60A 2ITEA 5GGRY 5H8MA 3HRZC 1A5NC 5GGSB 4AU0A 3SRFA 1WFIA 5TIMA 4PA8A 2PXYA 2ZCHL 1A25A 1K4DA 4GI6A 4HUXB 1RUAH 4S23A 1EOKA 1E9OB 3AYRA 3AU1A 1AXIB 3L3OA 4LYQA 4WU7B 4HIIA 4ZD3H 2F58H 3KOFA 3AIWA 2VLKE 2IXVA 5IVXE 1F0LA 3ZHKA 3UT0A 5I0XA 2Z1SA 5E2VH 1EFXB 4QRPB 1M7JA 1JHKH 2FIQA 5F1IB 5DJ8A 2R0WL 3SDAB 4ZPTB 3WMCA 2A83B 3LQAL 1EF3A 5T3XL 5DUPH 3N3EA 5GGTH 5T8GA 3N2XA 3AZUA 3I9GH 2AEPH 3M7WA 3QR3A 2RJHA 1GTEA 1P4BH 1UYWL 5C3IA 3NACL 4WDIA 3VGAB 1NGZA 5FECB 5C9WA 4EVZA 3R4DA 3UABA 5I0YA 2QBWA 1RR2A 3SDAC 1XD1A 3VD4A 3B6SB 3WBWA 1FV1A 4WUUA 1GKQA 4J4PD 3CFCH 3VXUD 1DWFM 2DZXA 4QHNB 2CQVA 4YSDA 3BCDA 1KTKE 3N14A 5ID1A 2V4LA 2F54B 3DUGA 1RA5A 3VGAC 1I9CB 5T8IA 2DT3A 4PJCB 4DK5A 3T0AA 1RK7A 3GIVA 1O6IA 2I26N 1OFEA 4XP5H 4NT6A 1F4HA 3T6ZA 4MNMA 1YY8B 2VXVL 2R0ZH 4QGCA 2AV7A 1Q72L 3AWEA 7CGTA 3VCNA 3T8LA 1TJHH 5GS0L 2WK2A 1MHPL 3UJSA 2OJPA 2OQLA 5AVWB 5HPMA 5CCKH 2GJXB 3ZU8A 5LGJA 2CIIB 4PJGF 3QDGA 2F08A 4NKCA 4GHRA 2NX5A 1EEZB 2VLMD 4Q6IA 1KYOJ 3QEHB 1W3JA 2H4EA 2QZ5A 4P48A 1CFTB 4DNLA 5D7LD 5IROC 3IYLW 2R82A 2BSDA 4AF0B 5D6CB 1U9KA 3MJ7A 3ML8A 2OMVA 4WDTA 1KM0A 1TT6A 2WQUA 2GQHA 2YQ2A 2Y69B 2J12B 3FB8B 3I02A 1FTXA 4L5ZA 3CQ0A 1LNUA 5KVEH 2Z29A 1EFQA 5GS1C 1EYWA 3BW2A 5K5YA 5IJDC 3O2LA 4DUVA 1CE6A 5I8EB 2DWTA 2FVKA 3KWTA 4LCUA 1MCEA 1RLDA 2CHWA 2BGNE 1TO5A 4AIUA 2WLZA 5DELA 3HR5A 2I24N 1RIVH 3C8KA 2LT9A 2DORA 1TNMA 1XRVA 2GZXA 1KGUA 3ABZA 4O4YH 2FJKA 4RW3A 5L8JB 1Z41A 4FOJA 4WU5A 5E4IA 4QJ1A 2EPKX 3HNTH 1E1CB 2LFGA 4FG6C 2J47A 4X7EC 1OSEA 3CLFL 5JZ7C 5IBTH 3QEQE 3M41A 1SOSA 2NQHA 3CO4A 3L2NA 3O4LB 4PWKA 4JFWA 1W54A 3BEVB 3GPEA 3LS5H 4PV8B 5TD4A 1G7VA 4PRHB 1E0UA 1NGXB 3RIAK 4QGYA 4X7SH 2KPNA 3UZXA 3PGCB 2O5XL 4ONGH 3H12A 3GLDA 3ZMRA 5DJCA 2EVHA 2AK1H 5B1JA 1FAIL 1XF2B 4WKFA 4EOUA 3LNHA 1D7BA 4U1GC 2GGGA 1VCFA 2JVUA 2V8LA 1AGDA 3PZVA 2AQPA 4GFSA 1BD2D 3UR7A 3E2QA 3V4VL 3QH3A 4CC4A 3Q6GH 2BDNL 3C52A 4OY9A 3WS3B 5J8OA 1INQB 1P5VB 2BW4A 3PP7A 2XN2A 5I6SA 1EA9C 1A80A 5EU6D 1E9PB 4TS6A 1YEJH 4UC5A 5FR3A 3WUWB 4NL1A 4QYOB 3URNA 3B05A 2DZUA 4EIZC 1U8IA 6FABL 2H45A 5HDQH 3F6LA 4D7PA 3O0FA 3OW1A 2EBNA 4M7JH 3DTUB 1KY7A 4BRVA 1EJ8A 1AODA 3R2GA 1QO5A 2EDEA 3GB7A 5IF0A 5EBAA 4Y7EA 1AE6H 1UXSB 3UG4A 3IVUA 3UYRL 4XCYB 1TXKA 4QRRA 2A6DA 2HCVA 2UY7B 5KVFH 3KS0H 4IOIB 4K73A 1WDWA 2YAHA 3HA0A 4EACA 4OZHB 3M5YA 2VN6A 3SGGA 4AEIL 2Y0SA 4GKNA 4JIHA 4FEIA 5MENA 2EKSB 2XRAL 3O9WA 5GJTL 1X6UA 2PRLA 2HZGA 3GI9H 2VQ4A 1OZMA 1ZENA 4AV5A 4DJDC 3CH1A 2VEGA 1XJBA 4ZTEA 2X4OA 2ZXWB 2HMID 5LXGH 4F7CA 1TV7A 1OIMA 1IGFL 4FNUA 4TUJB 2KDGA 4CD7A 3TIDB 3F7VB 1XR2A 1N7MH 3RBSA 2Z93A 2FGZA 2A0LD 4KKQA 3MLZL 2CKNA 1G6RL 2E7LC 3U2CA 1DJWA 2YYTA 2F1AA 1IXQA 1SBSL 4LAUA 3TBVA 3C6CA 5D1ZI 1FDJA 3FCTB 3VD7A 2J21A 3LN5A 1YCSA 3QDGE 4CBPA 4EN2A 5AB2A 3D85A 3LBOA 3EOOA 4I0PD 5A7BA 5HYFA 4MB4A 4DCQA 5DTFA 2HLAA 3SHSA 1L9PA 1JPKA 2OSLB 1VFMA 3W3OA 5F9DC 3NQAA 3O9NA 2WB1A 1Y0EA 1HQ4A 3YPIA 2ZX7A 1N64L 3QQ4A 5ENWA 5I6XB 4RX0A 2ED9A 2VIRA 3W87A 3TX4A 4XMKL 4XRCB 3CVIL 3SDCD 2C9AA 1DO5A 3BQ6A 1DFBH 2FB3A 3GR8A 3VFNA 2H2PC 3T05A 5IR1A 3KS0J 4ZUUA 4NN6B 4G6AD 3TR9A 3OKLB 3AS3A 2NNRA 3RWCA 1TV4A 1E9QB 3MRIA 2JQMA 5I6XC 3RWIB 4MXWL 5BXFB 2ZZ6A 4FK9A 2VRKA 3SB3A 1EBHA 2DQMA 3PAZA 4FFWC 4NUQA 1US2A 4NN6C 3APYA 1E90A 3C5JB 3R6IA 3UNDA 5DMGC 5AWNH 3OMIB 1NSJA 2VFHA 4YDJA 1VKXA 1R17A 3NCJL 5DT7A 4Y9GA 3BD4A 3ABQA 2AJUL 3QQDB 3B8UA 1X7QB 4GBXA 1TETL 1KQZA 1T89C 4ZB0A 5F8RC 4IS6B 4X8CA 3TCLA 2Z8WC 2Q86A 1MQQA 4KRZA 2VLKB 1SJBA 5C6MA 1F8TH 3RGVD 3FUNA 1KLFB 3VXRE 1N82A 3QQXA 3DHDA 4QNPE 4X5XA 2KYIA 3WHE0 3FU7B 3FXGA 5LB1A 1X4ZA 4RWHA 1RLCL 2WLIA 1IQWH 4JR9L 2XQBL 4YLWA 4CW1B 4JS7A 3H9SD 1F18A 1YEWA 4HF5H 4G5AA 5GRYA 3ARFB 3NCFB 3P0VL 3W1UA 1OX4B 1ME7A 3QEUB 4BBWA 2KDYA 4HWZA 2ZJSH 4P5SA 4TUOA 5AC6A 2VJ8A 1P4LB 2IKHA 4RGOH 2PDLA 1UC5A 4RVBA 3ARFC 3VCRA 3WYRA 3AFLA 5H37H 4AITA 3RMJA 4JDEB 1XYFA 4ZMPA 4MXVF 3DNKA 3O6FB 3S8FB 5D30A 1OAYL 4OIFA 4L8CA 1KCKA 1JWSB 1Z9SB 3X3FH 1JK8A 1MF2H 4KUCD 2F2HA 1IAIL 1GYNA 1HE8A 3EWXA 4GUGA 4XNUH 5FFGA 4AD3A 4JTGA 3RG6A 3D4ZA 4Q8UA 3W1PA 3N4FA 2B16A 3OJDB 3WLTA 3O6FC 2DTMH 3NNTA 3TU9A 1KFEA 4MFHA 5D7KD 4Y1SA 4GNJA 4KOCA 1NDYA 3ZKXB 2HX8A 1XGRA 1TVLA 4U5IA 4Q0XH 3PR2A 3QZ6A 5CCZA 2C9QA 3RPTA 1DXIA 43C9B 4U6XA 4ZR8A 1HZYA 4PY7B 5DURD 1XPGA 3QDJD 5F0LB 1O75A 2ZXAA 4M56A 1A6AB 3PPFA 4NOBA 4IOFC 1XYMA 3SYOA 2AQTA 4P5UA 3AMCA 3GHSA 3RPIA 5KYXA 3LB0A 3ZKXC 4IMLB 2P3EA 4CNIA 1IGJA 4LZKA 3ZTJH 3FXYA 3LHYA 2CIKA 5G1YA 1JOIA 2YCLB 4J23A 2ZA3A 1XLMA 4P5TD 4OIIL 4YEEA 4R27A 4I48B 4ZX6A 4QXWA 1Q6LA 3B9KB 1J86A 5B7YA 1ECEA 2H6PA 4IYKA 1D9EA 5EB9A 2DAVA 3C4UA 2OTDA 3L1OH 4TSCL 4FNLL 5IBXC 4JFYB 3N41F 5JUVA 2GSIA 2LFEA 1RJYA 2FQGA 3JV0A 2XTJD 1NFAA 4Z7AA 2ASHA 3N1QC 2UXVA 3W1MA 2K4WA 2WINA 2J1KA 3HPFA 1OP9A 4PMJA 4Y8FA 4QXUL 5M3WA 3MKGA 5EA0L 3PZTA 3ULUD 1UFUA 4HGMA 1EAPA 3USBA 2DJUA 5IXEA 4GRMA 1UP0A 2Z00A 4B3LA 1YLBB 3QEQB 4XNQB 2J88L 1FRGH 2P49B 1ZK5A 4S3GA 1F02I 4FABL 4DVRH 3U7WH 1UWYA 5EH1A 3EYQD 2K6YA 2LHAA 5ANMA 1YEKH 3OLGA 1XGZA 4JRYD 1OFPA 5HANA 1HHHB 1MJJB 1NBYA 1MW0A 1MCOH 3QG7L 2JMRA 1OFQA 4PBGA 2A1YA 3HI5H 3QNYA 2NY0B 4NFCA 3QUYD 3TOYA 4EXKA 1JMZA 2PXYB 1NH6A 4NUJA 3QBTB 4YSPA 1K4DB 1EJVC 2CLFA 5C7XH 4LAJH 1IBGL 4FEMA 2XDFA 4S1RH 3Q94A 5BNKA 1FO0A 4IMAA 1JHLL 3AU1B 3L3OB 3WFCL 2CITA 3W23A 3CV7A 1UA6H 4HIIB 4JPWH 3N43B 2NY0C 3ZE1E 1BQKA 4M6OH 2PXYC 1GGTA 4IQJA 2VABA 2ZPKH 1KCUL 2FLMA 1JUKA 2V9RA 1XWYA 5JOEA 3V6OA 1BQLH 5DJ8B 4JAMA 5CAHA 6ENLA 4I9AA 3L3OC 1J0KA 2YAPA 1OM3L 2XFWA 5CU9A 4LAQL 5GQBA 3BUYA 5F4SA 2CA4A 2E6QA 1XCFA 5TQ0L 4X9HA 1QD0A 3LHPL 4WDIB 1NGZB 4XMPL 4NRYA 4XVUD 1SJHA 1T66C 3C60A 4IGHA 5DCCA 1FV1B 5HWJA 4PRBA 4WUUB 1LHZA 2OZ4L 2V9QA 3V6ZA 1G7JA 4KXAA 4JFED 4IDJH 3GS4A 4S0HA 1VBJA 3BURA 2E8ZA 5ID1B 3JWDL 3L9EA 3PWLA 1HFUA 3DETD 1AJ7H 4LCCA 3GIVB 3CDYA 5EC2A 2ZZ7A 4MJHA 2Z1KA 5TQ2L 4NT6B 2F19L 4U3XA 1HUVA 3B2MA 3UPCA 3T0EE 4MG4A 2QUMA 2JE8A 1GYCA 4KRLB 2AV7B 4FQXC 1E6SM 2XWRA 4MKNA 1ETA1 3DO3A 3VMOA 8CGTA 2IOMA 5HPMB 5DEFA 2JJTA 5LGJB 3QDGB 2QT3A 2NX5B 4DESA 4Q6IB 3T4CA 4XVDA 4M93C 4F15B 5DD5L 4YU1A 1BFVL 1DJIA 3DFTA 2GSJA 1JNLL 3MJ7B 2VMFA 2Q3ZA 3NGBC 2OMVB 3TTQA 2ALAA 3PHOA 3I02B 5L4FA 3VRIA 1I4FA 3NGJA 1LNUB 1CLCA 4Q6IC 1UQZA 5CJOH 1SOQA 4JHAH 1M1SA 5C9XA 4CMHB 3B3IA 3UR8A 1CE6B 1JI1A 4L1DA 1OD7A 1EUAA 2WWCA 3DXIA 1EP1A 3S8HA 4AYFA 2KT6A 2N59A 4LCUB 3UZYA 1AH4A 3SDXF 4AEFA 5FYKE 3HR5B 4EPEC 3UTTA 5HTSA 3C8KB 1L6SA 4FOKA 1AMYA 1CG9A 1I8MA 3UVIA 2V17L 4KDWA 3S3CB 3S6DA 2DQTL 4WU5B 5G4NA 4NRSA 4ICXA 1YHPA 2P10A 2DM7A 2DQHH 4NZTH 2YL8A 2VW6A 1FC2D 3OJVC 1QXLA 1HHJA 1XIBA 1P9MA 1ADQA 4HJ1A 3T3MF 1YPIA 4QS5A 2GJZA 4L4LA 5LAPA 4OCYH 3OYXA 2P52A 4G1EA 5BO0D 5K59E 4M7SA 3LERA 4L8DA 2ZOTA 1G0XA 1MI5A 3AG1B 1E70M 4DO5A 4W9DC 2ATSA 3UJJH 2GEEA 4UFJA 1FRBA 5F6HJ 5DJCB 2ADFH 4EN3A 4HAFA 2O4QA 4OECA 4F0HA 1EGZA 3N9RA 2FGBA 2YOAA 3LB6D 2JKJA 2DLHA 1AGDB 4EZKA 2YD1A 3C6SA 3F85A 5BW6A 3QH3B 1F97A 2NY7H 4FXTA 4HSNA 3A23A 5B1JC 4NJHA 2E6PA 1G9NL 4UCFA 2Z31A 5IM51 2P0OA 3FUDA 5LBSA 2P44B 4AZ5A 3B5GA 2AJSL 2HRPH 1JMXA 3WNNA 4N8VA 4P4KA 5KUKA 3FFSA 4CC4C 3G6JA 1U8IB 2W92A 1OCQA 1U2HA 3DUHA 1TJ1A 2IXUA 1DVTA 1YNLH 4PJ8D 1E55A 3AUVA 4C58B 4IRJA 5FAJA 2BP8A 3MLWL 3GB7B 4MNGA 5IF0B 5JH1A 3U8GA 1TVPA 2D73A 3ZVHA 5F7EH 4PUMA 1KEMH 5B4MD 2RUSA 4QRRB 3C0LA 2GIMA 2A6DB 3PVFA 1BKSA 3TA9A 5B1KA 3TQVA 5LCVH 3FONA 3BWSA 4GKNB 5MENB 4B5VA 3ZY7A 2W60A 3O9WB 4OM1H 2VMCA 2G5BA 4XBJA 1T03H 3CH1B 1B6DA 2WZPA 1A0DA 3PTMA 4NJJA 2F6UA 1DL7H 5GRVK 2FPYA 2X4OB 4ICNA 5D96B 4RRPM 4F7CB 1H3PH 5GGVL 1LILA 3FUMA 5HA7A 4NXSA 2AQSA 3WLJA 1TMQA 2Z93B 1XCWA 3G6DH 1J1XH 5JW3L 5D1XA 4N9EA 1H6EA 5IGXL 3W0WA 4RNHA 4P3WA 4P2OA 2DFAA 2EDOA 3TBVB 5D96C 1ICQA 2VDMB 2LU4A 4YUEH 3RVXC 3VKJA 3CZJA 3ATAA 3HURA 3D85B 3U2JA 4AIXA 3SPHA 1LO2L 4IJRA 3VM7A 3VX0A 4YTQA 1YQVL 4DCQB 4AHPA 5DTFB 5CHNA 3KBMA 2HLAB 1EXBA 4EI5A 1KA9F 4I7UA 3C8DA 4LEQA 4L1TA 4F7EA 2VDLH 3OF6A 1A49A 2NV1A 1HQ4B 4CQ8A 1E9ZB 4FXFA 1XG4A 3KCJA 3FDWA 3QQ4B 4FYTA 1ZT1B 2AJYL 1PKQA 5ENWB 1GC1L 3II1A 2VIRB 3DOSA 1QSFD 1P5UA 1PU0A 1ADSA 5MI0B 4G3YL 1FWHC 2FHBA 3HB3B 4YHIA 4F2TA 2CHDA 4KS0A 3VFNB 4CU8A 5IR1B 4ZUUB 1XGUA 5CSZA 1ZT4A 3BSZA 3JUZA 1V10A 3OZ9L 1QACA 4TYUA 1V55B 1TVHA 3RWCB 1PCWA 1BSIA 1CXIA 4HUKB 3MRIB 4RZKA 5JOPE 1L6YA 5DVOA 5DMKA 3UTTE 1PKNA 5MI0C 4RESB 6XIAA 3HB3C 3DTDA 3S2LA 2FPVA 2YUWA 4RPQA 2FSEA 3B9VA 4ZMVA 1N12A 4D6HA 3MYPA 4QHLA 5C92A 5KJRL 2VJ0A 5FUZL 1VBGA 4YDJB 4YDIH 1VKXB 3BQUD 2O93L 4BFGA 3IWUA 4LYKA 4YOKA 2EPMX 3ZDZF 5AB1A 4ZTOH 4GBXB 4GABA 4DF0A 1HFBA 4MHHI 2GIYA 5E9DA 2XG4A 5K9JL 3RWDA 3CT2A 4OJFH 5HYQA 4FXGA 2PTXA 1R24A 1SO3A 3TCLB 4KNSA 4ES9A 4Y1AD 2Q86B 3LCIA 3ZE1B 1NUNB 3QRGL 1VJZA 2SFPA 4L37A 3VQ1C 1AZCA 1KIPA 4X5XB 4GBXC 3V52H 3SCMA 2ZE3A 2YIHA 3NTCH 5IVZA 3AALA 3EADA 5KAQF 4Q8WA 5FHAH 2EDWA 4NJGA 3VIIA 2WLIB 4EX4A 4JO1L 2DV0A 1HKMA 3WO4B 3EDDA 4ANKA 4NGHL 3G9VA 4C6KA 3ECBA 5AQ0A 4HPYL 4NQXA 3MKKA 3C0JA 2DMKA