3CUJA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylopentaose.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
314
structure length
314
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 131
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cujA00
2DGAA 3ZJ7A 1H0IA 2XWEA 2F8QA 4ATLA 2WC4A 3OZOA 4CD7A 2D23A 3IK2A 3W28A 1JI2A 2RGMA 2VJXA 3WDRA 3UESA 3VDCA 1J0YA 2VVNA 3ZMRA 4AZIA 4D1JA 1NWTA 2WK2A 2PBOA 3B9AA 1JYVA 1UH2A 4S3KA 1EDQA 1CXLA 2WMIB 3QGVA 2VTFA 3WFZA 3WUFA 3RPMA 3N17A 2G3JA 2BHYA 4NRSA 4UFJA 4EANA 1XCWA 1EIBA 2D0HA 2YA2A 5M17A 4D6HA 4TX6A 4FLOA 5DMYA 3LPPA 3SCVA 1MQPA 2QV4A 4W89A 1XHGA 5ABFB 1GQLA 4AXNA 1QHZA 1UWRA 1V3IA 1W2VA 1MW1A 3MUAA 4QLKA 3MV01 4AZBA 3WFLA 1U2YA 2A3AA 2PF0A 3PBGA 3A4AA 3POHA 3OLGA 3AHZA 3KZSA 1JDCA 2J7GA 2ZX7A 3SUWA 3L4TA 4WIWA 3VOCA 5DO8A 1CNVA 5IXEA 4ZE5A 3UG3A 1QNQA 4UOZA 1CXIA 1CGYA 2BXZA 3AS2A 1UH4A 1V08A 2J25A 3M6DA 3WN6A 1JZ2A 1V02A 4PTXA 1GOQA 4AW7A 2PWGA 4B9ZA 3AQUA 1FFRA 3VM7A 4RE3A 4Z2HA 1KCKA 4M80A 1C92A 2WVSA 4UFLA 2YIHA 4BQ5A 1WZLA 4IUGA 4OBSA 4CD8A 1US3A 4X0NA 3OLEA 1ISZA 3WNLA 4CGTA 4PMNA 1BVZA 5F7UA 3AHYA 2D22A 1XYFA 1V03A 4J27A 4MNJA 4FLRA 1K9TA 5FIPA 1TVNA 3OGSA 2HISA 4AZCA 3AHXA 2DQXA 4HZ6A 3W26A 1WZAA 1V0MA 2UY2A 4P8VA 1S46A 1CTNA 4CKQA 1RH9A 3D5HA 1OWQA 1V0LA 1QI2A 4PEEA 3TTOA 1Q6FA 3N18A 5BXTA 4GO8A 3OGRA 2E8YA 4HPHA 2QPSA 3MS8A 2PWEA 3VIOA 5EFFA 2Z1SA 1I1WA 4LYQA 3BMWA 5IFTA 1E6QM 3KWXA 1KR0A 1OINA 2WHLA 3THCA 1OM0A 1W32A 2BNJA 4HU8A 1UKTA 3W53A 2WVVB 3WL1A 2VX4A 3VO0A 2OSWA 1K9EA 3VD5A 2QLYA 3IJ7A 3KEHA 3WENA 3WNPA 4JZ5A 4A3YA 4WKAA 4MNMA 4UQCA 1V6YA 4XUYA 3WH5A 1BPLB 3WNMA 1UWTA 2BFGA 2ZWZA 2Y8KA 4EAMA 3AIQA 1DEDA 1UD2A 2E40A 1DP0A 4H8VA 3BSGA 4OOUA 1V0NA 1D2KA 1JZ6A 3ARZA 1H2JA 1UKPA 4TVUA 4D6FA 2J8FA 4W88A 4ZE4A 5E70A 5E0CA 2VT0A 4UQBA 1HT6A 2QPUA 1WZKA 3PZTA 1QHOA 1UKQA 4D6EA 5HXMA 3RJXA 2ZOXA 3GNRA 2WZHA 3ZJKA 3PTQA 5A6SA 2BS9A 3QR3A 3KL0A 3F4VA 1SMAA 5A2CA 1BHGA 1EQCA 4U5IA 3ZT6A 4WJXA 2WMIA 1J18A 2YA1A 2NW0A 4GZEA 1FHLA 2ESCA 4URIA 1O6IA 3WEOA 5D8WA 2WHMA 1V3JA 4TUFA 3OG2A 2VZVA 4ZXOA 2CPUA 5ABHA 1M04A 1BYBA 2BY0A 3FHAA 4F8XA 1OD8A 3PZGA 3NUKA 1E72M 4N0RA 1C8QA 1BGAA 3AS3A 1HKIA 3GDBA 3A6OA 1UWUA 3VIHA 5EBAA 3N11A 3UETA 3WMSA 4B3KA 3GBDA 4GI8A 2YBTA 1H49A 1WDPA 4BA0A 1KBKA 3DECA 4HMDA 5I24A 4HZ7A 1AQHA 4AZ7A 2CKRA 2D0FA 2CEQA 1V6XA 1GORA 1R85A 4W7VA 3VPLA 4MB1A 4DUXA 4P7LA 3ZM8A 1GQJA 2DT0A 3PZOA 2Y4SA 3MUIA 1E43A 2G41A 4FLQA 1EDTA 5D8ZA 1LG1A 1XD0A 2CHOA 2EEXA 4U3CA 1E0WA 1PIFA 5HDRA 2VR4A 1EO5A 2OWWA 5AC5A 2WZEA 3NYDA 1GONA 1GOIA 1YQ2A 5D4YA 4UTFA 2JALA 4KH2A 3BC9A 2EXOA 1QW8A 1LL7A 3RM4A 3CUJA 1UR4A 3BAXA 1UG6A 5HNNA 1UD5A 4U2ZA 1VAHA 5IFPA 1JI1A 2VC9A 2J8GA 5GNYA 4W8BA 4EKJA 2W92A 1QI3A 1E9LA 3MSGA 4W93A 4WK9A 1C7SA 1ISYA 4P7RA 4CN1A 2OSYA 2UWFA 1GQKA 5FCZA 5AY7A 4JFTA 3WQ5A 3CTTA 2J7DA 3EDEA 3RO8A 4BCEA 2YDRA 4UNIA 3WQ8A 1E6ZA 2OYKA 5DEZA 2XFYA 2WLZA 3GXIA 4B16A 2XIBA 2AMGA 5TD4A 3ARYA 3MUZ1 3O2LA 2A3CA 2DSWA 2UY5A 4A3HA 2XUCA 1ZBVA 2X8RA 1J0HA 3FNDA 2WVVA 1GJWA 4D1IA 4D6GA 1PPIA 4HP5A 4W8AA 1B3VA 1B3WA 3O6AA 3WELA 3HU7A 2ZX9A 4LXFA 2ZUVA 4F9JA 4CU7A 1HXJA 2J75A 4GPNA 3KE0A 2GK1B 1RP9A 4JFWA 3SUTA 1Q6CA 1N82A 3AICA 3WD2A 3DYMA 2XVNA 1I75A 2VX7A 1DHKA 4MJ4A 1XV8A 2VCBA 4LQ1A 1PAMA 3W25A 2PI6A 2VZOA 2FHFA 2AAAA 4PMVA 1QBBA 1U30A 5E6ZA 2WSPA 4PUDA 1NQ6A 2CBUA 1V6UA 1W9UA 2EQDA 3AIBA 3EDDA 2CETA 3DHPA 1V3KA 4OZOA 4CD6A 1UR1A 2DIJA 1C93A 3WDJA 2WCAA 2WYSA 3PZVA 4JKLA 4TOQA 1E4IA 1OT1A 3EBVA 1JDDA 1QNSA 5IDIA 1UQYA 3AXHA 4UOJA 3NIYA 3ARUA 1VBRA 4CUCA 4HMCA 2V3GA 1EOMA 4HA3A 1RD6A 2BV9A 1UR2A 3AHTA 3PZUA 3F5LA 3QHOA 4GZJA 4J3VA 1KQYA 1WZMA 3CIVA 1E3ZA 3JUGA 2J7BA 4U3AA 3IJ9A 3CMJA 2GJPA 1JYXA 1GZJA 2J7FA 1QNPA 1NOFA 1CZ1A 3PZIA 4HOXA 1PX4A 3WF3A 1H0GA 1V3LA 2PB1A 3L4VA 1E55A 3M7SA 1KXHA 3VNYA 2X09A 4PRWA 5A2AA 4CD5A 1B90A 1G01A 3T2PA 5E0FA 4ML4A 1NH6A 2YDQA 4PTWA 1PEZA 3AS0A 1MFVA 5CPTA 2VOTA 1LLOA 1HVXA 3NJ3A 5ECUA 4MAVA 1VRXA 4PMXA 1HVQA 1SFSA 2VI0A 3BAKA 1JZ3A 4NZCA 1E73M 1FHDA 1WO2A 1UYQA 2WHJA 1E6SM 4H2CA 4DWSB 2RGLA 1HJXA 5HOSA 3VMNA 3OGVA 1TA3B 1XGZA 2XPKA 4ZFMA 1QOXA 3SCSA 1EA9C 2J4GA 1NP0A 3CPUA 2ZUUA 2DT3A 5HBFA 2FHCA 3S6TA 3N13A 3VIPA 4R5EA 2YLAA 3WDPP 2WMHA 1BGGA 2O9TA 1UZ1A 3ZJ8A 1D7FA 1UKOA 5KZ6A 2FH8A 5CSUA 5I77A 1HKJA 3AS1A 2WMJA 4PMZA 1CPUA 3GH4A 4UOQA 1WDQA 3VTRA 2E9MA 3VDHA 4Y7EA 1BVNP 1M03A 2BXYA 2XVLA 4JFUA 5C71A 1VEPA 1B31A 3RDKA 3T0BA 3WH7A 4Z2JA 3W38A 5D9PA 1UH3A 2Y8VA 2C7FA 5A8NA 1ZB5A 2J77A 4PMOA 1Q6EA 3CHFA 1MQRA 2EO7A 1W9PA 1UA3A 4AD0A 1KCLA 4Z2KA 5CLWA 1FH7A 2GDVA 3CHCA 2BY1A 4P7OA 1MYRA 2W5FA 4NSBA 1EXPA 1CECA 4L4OA 2DSVA 4D6DA 4W85A 1CYGA 3L4XA 2BHUA 1UWSA 2WSKA 5A69A 3BLKA 1OB0A 1EQPA 1UA7A 3CLWA 1XSKA 2BY2A 2J7HA 1E6NA 3SCQA 4TTUA 1QI0A 4BF7A 3OLIA 1XC6A 4ATWA 1LJYA 1HJSA 4E8CA 3HJEA 3WD3A 1E5JA 2G3MA 2ZX8A 1AMYA 1CXFA 4OJYA 3VUPA 3W82A 2ZUWA 3MU7A 7A3HA 2GK1A 2CIPA 2DSKA 1VFMA 2Y5EA 5A3HA 1TUXA 3F5KA 2X0YA 1KQZA 2G3NA 1PZ2A 1HN1A 3FXYA 3QOKA 4BQ4A 1V02E 1XSIA 4JCMA 2D2OA 4N42A 3ALGA 1BSIA 1NM9A 2VRJA 4YPJA 4DM1A 1E0XA 4KMQA 2WC7A 4W5UA 4R27A 4BS0A 4UFKA 4P7NA 4PMUA 3VGBA 1JFXA 4TVCA 2VQTA 3MKKA 5JBFA 4GIAA 2JF6A 5BXRA 5JUVA 2DH3A 3AMDA 3B9EA 2XFRA 3CZ8A 3K4DA 4Z2LA 1KBBA 1KWKA 1PJ9A 1W91A 3T08A 1EHNA 1OBAA 2HVMA 3FAXA 1W9DM 4ATDA 5I0DA 4E2OA 1E6RA 3CUHA 1B30A 2YL6A 4BZYA 1W3KA 5GNXA 4RL3A 1GOKA 1CGWA 1X1NA 3W27A 4DWSD 1FP8A 3W81A 2ZXDA 2W61A 4TVDA 3VINA 1JZ8A 4CCDA 1I1XA 1Q6GA 2W66A 2WMGA 5JBDA 2O9OA 2WB5A 2WHKA 1QHPA 1W1VA 3WKZA 1PX8A 4W87A 1WNOA 4UFHA 4MB3A 3CUGA 4AIOA 1IZJA 2VCCA 3ARSA 3OBAA 5I79A 2GJRA 2XSAA 3TONA 2W4XA 2Z1KA 1Z32X 4JCLA 3AIWA 5M03A 4NRRA 1FFQA 2ZXQA 2V5CA 5C8BB 9CGTA 1G0CA 1W1YA 5CG0A 1XYZA 4W5ZA 4DWSA 2YOCA 2ZX6A 4JIEA 3GBEA 1TA3A 5I5RA 1TR1A 3AJ7A 4KGLA 3WMCA 1WAWA 1ISVA 2A3BA 1AQ0A 1JIBA 1QNRA 2WCGA 6A3HA 3L4YA 1E6XM 4PMYA 1J0KA 2FGZA 5A6LA 1K9FA 1O7AA 4RE2A 1JNEA 4WKFA 2NT1A 2UY3A 2YL9A 1EDGA 4JFSA 1QBAA 2WVUA 4CD4A 1B0IA 4MJ2A 4JL1A 4PSPA 2VRQA 4BQ2A 2Y2WA 4AC1X 1HL9A 3EDJA 5JIWA 3WQVA 3K8LA 1E70M 1R86A 2BVTA 2DDXA 3VDBA 1UD3A 2XJ7A 2O9RA 4UR9A 3AXIA 4HMEA 4MPKA 2CYGA 2YL8A 4NF7A 2PC8A 1P6WA 1R87A 3VGFA 2JIEA 1RP8A 4CVUA 4JL2A 1W3JA 4YHEA 5CQ1A 4HTYA 1JGIA 3PTKA 3WUEA 3MMWA 4OOZA 1JNDA 4IPLA 4AZ6A 1K6AA 1WKYA 2IXUA 1BYAA 4UZUA 2QMKA 1E15A 1JZ5A 2DT2A 1JF5A 3T09A 1HX0A 2CBIA 4GINA 1GOWA 2VZUA 1YHTA 2VZSA 3WBEA 4E4PA 1E0VA 2FDMA 5A8MA 5FOOA 1GHSA 3AI0A 3TA9A 1PIGA 2E9LA 4W84A 4AYSA 1G1YA 4F79A 1DWJM 2EPNA 3AYRA 5D9NA 3RM9A 1HJVA 4GI6A 3TOPA 4M1RA 1H11A 1VFOA 2ZWYA 4LYRA 1GVYA 4P8UA 2W63A 3DHUA 1GUVA 3VGGA 2JF7A 2IXVA 4S3JA 1MW0A 1JZ7A 3UR7A 3W29A 3MO4A 1XSJA 3WH9A 5GPRA 3AMGA 2E9BA 4GZIA 3SURA 4Z2GA 1JYNA 1DWAM 4QAWA 5LYRA 1EHAA 1H41A 4XV0A 1TVPA 1ZJAA 4D71A 2W67A 3ZT5A 2PWDA 1TZ7A 1CGUA 1R7AA 2WANA 3GNOA 3ZOAA 1B3ZA 3WEMA 1H09A 1MW2A 1LG2A 3ALFA 3N9KA 2JFEX 3L2MA 4AZHA 2XVKA 1UOKA 2XSBA 4M82A 3G6MA 1NWSA 1TFVA 3QHMA 1MXDA 2WWCA 2WLYA 4CVWA 3VIGA 1VEOA 2GUYA 2PWHA 3ARXA 4AEFA 4KRUA 2XM2A 4FF5A 3W24A 4H8HA 3MSDA 5A6KA 1BTCA 4GQQA 2XVGA 1KGXA 2FH6A 3GXFA 3K1DA 2WAGA 1NWUA 2J7EA 4QLJA 3L4ZA 1LL6A 4UQDA 5A6JA 3WSUA 2XTKA 3BLPX 3AMCA 4M81A 1QW9A 2O92A 3N04A 3CUIA 3AISA 5M3WA 2YDSA 2YJQA 1IT0A 1JL8A 8A3HA 1XCXA 5C70A 1SMDA 3VD4A 2OYMA 2ZICA 4M8UA 3AHVA 3CHDA 2CESA 3SCNA 3VD3A 4W8LA 4J3WA 3DYOA 2VMFA 3F5JA 1QNOA 4MDOA 4PCTA 4EK7A 1C3FA 1CGTA 3LPOA 1EGZA 4HA4A 3WQWA 1IV8A 3ARVA 1UHVA 3RJYA 4U31A 1KGUA 3AZSA 4PSRA 1HIZA 3T0AA 1ODZA 1BG9A 3WH8A 1R8LA 3MUY1 4OIFA 7TAAA 1W9XA 2DSZA 3S2CA 3WQ4A 4UFMA 1JG9A 1X6LA 4PUEA 3SCOA 1ITCA 2GFTA 4MB4A 2IUZA 4ACYA 3SCUA 3WEZA 3SCPA 2XFFA 3CO4A 2Q8XA 2VURA 2VQUA 4D6IA 2OLHA 5EB8A 3BAJA 4PTMA 1BG4A 3WDIA 4GXPA 1PX3A 1JYWA 3VIFA 3PZQA 4D6JA 1DWGM 3FHQA 3SUSA 1VIWA 8CGTA 2CKSA 2ZIDA 1HL8A 3THDA 4J7RA 4ACZB 1IZKA 3AIRA 1E1FA 2JEQA 3U7VA 4W7UA 1ODUA 2DSUA 4CCCA 3PN8A 4HA1A 7CGTA 3RIKA 4HPGA 1WDSA 2XM1A 5BXSA 4OKDA 3IAPA 1BYCA 1CGVA 1UR8A 2WM0A 3J7HA 1HF6A 1K9DA 3ARWA 4JAWA 4H7VA 1B1YA 5LA1A 2O9PA 1XRVA 3U7BA 4LX4A 1W9VA 3RILA 5I78A 4QDMA 5CXPA 3N12A 2GDUA 3VGHA 1FH9A 1RPKA 1OGSA 2FGLA 4CN6A 1J0JA 3HN3A 5A8PA 4P8XA 2GJXB 1HP5A 2WXDM 3CZKA 5LA0A 4HOWA 4UCFA 3E1F1 1E4NA 3T2QA 1HJQA 4KRTA 2JIWA 5HPOA 1JFHA 3AMLA 1F4AA 3CBWA 1VF8A 1CLVA 4U33A 1C7TA 1A3HA 2D0GA 2G3IA 3K46A 1LWHA 3UG4A 2YBUA 1LQ0A 1CBGA 4MB5A 2X0HA 3VIKA 5CLTA 3WF0A 1WE5A 4HOZA 3T0DA 5CZKA 1ECEA 5A6AA 3VD9A 3W6LA 1MVYA 4YHGA 4DWSC 3AMKA 2V3DA 5BWFA 1ZBCA 1QVBA 1SYTA 1VB9A 2DT1A 2CITA 2G4FA 5CSYA 1J0IA 4MTVA 3LMYA 3U5UA 3EDKA 2G8ZA 1E5NA 3PZ9A 3GZAA 3CZLA 3POCA 2OYLA 1UWQA 1C91A 1TG7A 2ZE0A 2A3EA 3FY1A 3NDZA 2WKLA 3QHNA 4ZXLA 2ZUSA 4AISA 5I23A 3A4WA 2DIEA 2B31A 1JDAA 2D3NA 1VFFA 3BAWA 3ZIZA 4PCSA 1ZBKA 5I3DA 3ECQA 1UQZA 5JIPA 4C7DA 3SUVA 3AYSA 4BQ3A 2W91A 5BRQA 1J9YA 2XGBA 2X1IA 5FKYA 3OA5A 3PZMA 5CJ5A 3DC0A 2CBJA 5DT7A 3W0KA 1LF1A 1VBUA 3VIMA 1PBGA 3TTSA 2C8NA 1KXQA 3VX0A 3M46A 2NSXA 1QI5A 4UQEA 1C8XA 3LPFA 2WKGA 5DF0A 1GNXA 2ZUTA 1OGBA 1NWRA 4IISA 3FAWA 4AD2A 5IHRA 4PN2A 4EE9A 1E3XA 1E1EA 4U5KA 5CGMA 3BSHA 3WUGA 3L4UA 4XX6A 1GQIA 1J10A 4CU6A 3A3HA 1GJUA 3WMBA 1TMQA 3ARQA 2E4TA 3WBAA 3VGEA 2VR5A 3VVGA 2VUYA 1QPKA 1M01A 3T2OA 1DWHM 4M29A 1GOOA 1CIUA 5A94A 1JD7A 3EDFA 5BRPA 3KL3A 4QLLA 2WNWA 1A47A 1XH1A 5KEZA 5BCAA 2WPGA 5A95A 1H1NA 1US2A 2VCAA 4AEEA 1JF6A 3GH7A 1V3MA 3ZSSA 1WB0A 1E6PA 4GO9A 2VVSA 1V3HA 3W4RA 1VFUA 2EJ1A 4CU8A 3NSNA 2WMKA 4ACZA 3KL5A 1W9BM 5FL0A 4AIEA 1VEMA 4H41A 2C0HA 1UWIA 4L4PA 3ZR6A 1W2PA 3G6LA 3WDHA 3PHAA 2W62A 5HPCA 5E9AA 2ZXAA 2D24A 1UR9A 1BQCA 3WY1A 1B3YA 3CHEA 5E6YA 1BFNA 4ZEPA 3CZEA 1JAEA 4YN5A 3IJ8A 5CGTA 1ZJBA 2NT0A 1DWIM 2YL5A 1GCYA 2XYLA 3MV11 1V0KA 1HKMA 2DEPA 2CBVA 3B9DA 2WBGA 1CLXA 3WIJA 2GJXA 4AD5A 4B3LA 4Z2IA 1ITXA 3ARRA 1H5VA 3NSMA 5CPQA 1PZ3A 2UY4A 1OIFA 2X2YA 5A6MA 4PMRA 2VX6A 1E40A 4WF7A 1H4PA 2XWDA 1ISXA 5JBEA 2WC3A 2EPKX 4MNLA 3SIMA 4AD1A 4TX8A 4J3SA 4PTVA 2BVYA 4LGXA 3CZGA 3CMGA 3CH9A 6CGTA 4XZWA 5BROA 4PMDA 3IANA 4J3XA 1TE1A 3DYPA 1J12A 4AZGA 4F66A 1E56A 4V2XA 3I3DA 4CN4A 1XH2A 3APGA 2OWXA 4WLCA 2D20A 2YLLA 5BYWA 1U33A 1MXGA 1TCMA 3O9NA 3VX1A 3D3AA 4QCFA 1HJUA 3MMUA 1MQQA 3MANA 2PWFA 3TTQA 3IAQA 4W7WA 4W86A 5CPSA 3RM8A 4LPCA 2A3HA 4GKLA 4J3UA 5A2BA 1Y7VA 3WD4A 3TP4A 5E09A 2EBNA 3ZQ9A 1FP9A 4J3TA 1UD8A 1XD1A 2BHZA 1EH9A 1OIMA 3VIIA 2CERA 1F4HA 3L4WA 1CXKA 3ARTA 5GQBA 1WDRA 5EMYA 1E4MM 3EMQA 4F9DA 2BY3A 3L2LA 4GQRA 3QOMA 1CWYA 1M53A 3UCQA 3AXXA 1V6VA 4IM4A 3FN9A 4WSKA 3ARPA 4IPNB 1AQMA 4TTGA 3LPGA 2GSJA 5D9MA 4Q7NA 2QF8A 3AIVA 1B3XA 4M24A 5A8OA 4AY1A 1W1TA 4AD3A 1E4LA 1GHRA 3AZTA 3EMZA 5ABEA 3M07A 3W6MA 2OWCA 1L8NA 3UERA 3AIUA 4H04A 2VX5A 4DUWA 2J7CA 3WD0A 1HNYA 4MDPA 1G94A 3AZRA 1G9HA 4DM2A 5BXPA 3A47A 4H8UA 4UQAA 4JFVA 1OD0A 3BMVA 1JD9A 2CXGA 4OBRA 5ABFA 1R7OA 3BAYA 1MFUA 1B2YA 1UUQA 3GXMA 4FLSA 4UQ9A 6TAAA 4B15A 4QP0A 2GVYA 2XIIA 4C7FA 2XVPA 2TAAA 4UZSA 3K8KA 3I3BA 5DFAA 1CXHA 3NSXA 1BF2A 2CHNA 4PYSA 2DH2A 4LYPA 1BYDA 1CGXA 1CDGA 4AMCA 3WF2A 3OIHA 3WL0A 4XB3A 2CCRA 3ZR5A 5AYIA 1GW1A 4KGJA 3SCWA 3PTMA 4UFIA 3WDQA 5A8QA 1V6WA 3NCOA 1WPCA 1WCGA 2E0PA 2J62A 1BAGA 1ISWA 1KGWA 4DUVA 5AC4A 3UEQA 1FH8A 2XG9A 4X9YA 2V38A 1D3CA 2V3EA 2WWDA 4B9YA 1HJWA 2J47A 1EOKA 1UKSA 2BVDA 1NARA 3WF4A 5I2UA 3OB8A 5DT5A 4XZBA 2ZUNA 3VD7A 1W3HA 5A1AA 4HZ8A 3EMCA 4RE4A 3WUBA 3SCRA 3WH6A 2J79A 1UD4A 3WNOA 4V27A 1KWGA 4D72A 5IHSA 2ZX5A 1GVIA 1ESWA 2V5DA 3WF1A 2D3LA 2F2HA 4JHOA 1MW3A 1OCQA 2EPLX 2YKKA 3UR8A 2VZTA 5M5DA 4K68A 4JKMA 5ABGA 2F61A 2XHYA 1CXEA 1MWOA 1OSEA 3W37A 3CZJA 4E8DA 3A4XA 3TTYA 1L0PA 1JXKA 1J0ZA 1XH0A 3U5YA 2ZUMA 1LL4A 2VNCA 3VDAA 4JHZA 2OSXA 1WP6A 3RCNA 1GOMA 1ZS2A 4AWEA 3ZJ6A 1J01A 1KFWA 2J78A 1OT2A 3VNZA 4M56A 3BH4A 1Q4NX 3ZT7A 3K8MA 1W3LA 1JXJA 1FA2A 1SR0A 3BGAA 2X05A 3I3EA 4ZENA 1KB3A 3RMEA 3B8SA 3II1A 1C8YA 2WBKA 3SEPA 3VM5A 3OZPA 1VENA 3CGTA 1CEOA 3WD1A 1HKKA 1H3GA 1QI4A 4X0VA 2VO5A 2VL4A 1KXTA 3VU2A 1M7XA 3VKKA 2D1ZA 3VILA 2QMJA 2WW5A 3ZO9A 2AOSA 3ZSTA 3VIJA 1FOBA 1DWFM 4MADA 4P7QA 2DPEA 3BCFA 3SCTA 3VGDA 2MANA 3GTNA 2JEPA 2EPOA 2VRKA 3GYCA 1DTUA 2WVTA 4NI3A 1W1PA 2XGIA 4OUEA 3GM8A 5LA2A 3U57A 5I6SA 1X6NA 3FW6A 3CUFA 3VMPA 4CCEA 3GXDA 5D9OA 4C7GA 2PBGA 1E71M 4AZCB 4V28A 2V3FA 3PZNA 1KXVA 5FL1A 1CENA 3WNNA 1EO7A 1LWJA 1UZ4A 2JE8A 3EYPA 4PMQA 1NOUA 1J11A 1KR1A 2QHAA 3AOFA 4MNKA 1NOWA 4QFUA 3VMOA 5A6BD 4MAZA 4AZ5A 5FD0A 1C90A 1GPFA 1AVAA 1Q6DA 4KWUA 4PBGA 5EFDA 2CNCA 2Y24A 4FK9A 2ZXBA 2FHBA 2WMFA 5AYBA 3N15A 1VJSA 2EPMX 2E8ZA 1BLIA 3BXWA 4AD4A 4TXEA 4WKHA 1UD6A 3MMDA 3UG5A 4GI9A 3BAIA 2WZIA 3GNPA 4J28A 5GNZA 1JAKA 3WNKA 1VJZA 4U2YA 3AROA 4FMVA 4JKKA 1OGGA 5A6BA 3OLDA 4Q22A 3BCDA 2E3ZA 1G5AA 1ZBWA 1B9ZA 1HP4A 3HMCA 1ZL1A 2J74A 1UR0A 3WQ6A 3NDYA 4HU0A 1JZ4A 4AIUA 1NP2A 2YA0A 4WSJA 3N1AA 3GH5A 3AFBA 3AIEA 4QCEA 4P8WA 3SUUA 4A4AA 2WCSA 4D6CA 3K4AA 1ZU8A
chains in the Genus database with same CATH superfamily
3W7NA 2Y7GA 2PP0A 3IK2A 3W28A 3KBNA 5L6UA 3BICA 2OLSA 2G96A 1J0YA 3ZMRA 4DJED 4AZIA 3H2NA 1IXNA 3MY9A 5A6TC 3B9AA 2ATMA 4GK8A 1JYVA 1UH2A 3W2MA 1EDQA 3M0HA 1FCUA 4RUBA 3KCJA 3WFZA 1XBVA 4H9YA 1X8FA 4EANA 3UXKA 1EIBA 3V16A 1JUKA 3SIZA 5M17A 2PGWA 2VC5A 3W7QA 2CLKA 4FLOA 5DMYA 4GYFA 4IT1A 3VCNA 4O54A 4AXNA 4JTSA 1QRQA 1KM6A 3N19B 4QLKA 3PBGA 1YNYA 1N55A 4XVDA 1JDCA 2J7GA 1PDYA 2HTMA 4GX9A 4IXHA 3VOCA 2HBVA 5IXEA 4ZE5A 4LW7A 3B0YA 4Y9PA 1WXJA 4MJMA 4CCZA 3UGVA 1UH4A 1V08A 1ENUA 3LM7A 3M6DA 1YPIA 1YYAA 3PBMA 4L1WA 3SY8A 1HUVA 1GOQA 3LD5A 4KIEA 5LIWX 2J9ZA 2V30A 3GFZA 4RE3A 2HV5A 3SN1A 1RA5A 1TRDA 4M80A 1C92A 2WVSA 3TMQA 4BQ5A 4IUGA 3ANVA 3H2AA 2B7PA 3WNLA 5D33A 4JYEA 1V03A 3GXTA 4JTTA 1NFGA 4E2DA 4HT3A 1ONRA 1TVNA 1THFD 1O68A 4QS5A 4HN8A 2DQXA 4HZ6A 3W26A 1WZAA 5C54A 4ILSA 5LXXA 3TN3A 4PUUA 4OGZA 1CTNA 4CKQA 1RCXB 3D5HA 5DBTA 1V0LA 5D2VA 3KLLA 4N9BA 1NSJA 1Q6FA 1ICPA 2QZRA 3PWGA 5K4XA 3OGRA 5FF4A 3LN3A 4EPKA 4C6FA 1DHPA 3KOZA 1JPIA 4QE4A 3AXMA 2X42A 4J9JA 2PWEA 4ZCWA 4UTUA 2Z1SA 3QKEA 1IWAA 1KTNA 1E6QM 2F7FA 1KR0A 5FF2A 4HHHA 1TPWA 1W32A 4XKYB 3P5YA 3W53A 3GW0A 1MEIA 2AQVA 3WL1A 2VX4A 2ZZ7A 4PUKA 3VO0A 3GDRA 2OSWA 4NNCA 3IEBA 2DORA 3KBJA 3VD5A 2A2IA 3KEHA 2BGSA 1LDCA 2OU4A 4PUMA 4WKAA 1WUFA 4H83A 4I9AA 4UQCA 1POKA 4YXGA 3WH5A 1BPLB 1UWTA 2Y8KA 3MCNA 3AIQA 2WSRA 1U5HA 2RFGA 3OW1A 2VWTA 4H8VA 3BSGA 4OOUA 4XO6A 4TVUA 5LNWA 4W88A 2OODA 4ZE4A 5CBJA 5E70A 1Q6OA 1AH3A 3VUSA 3EEZA 3CNYA 1DL3A 2E6AA 3BSMA 1HT6A 4LYKA 1WZKA 1XPGA 3PZTA 2E1WA 1RBAA 1TMLA 4ICNA 3L0KA 4QDPA 4WDWA 1KRMA 2WZHA 3PTQA 4PC8A 4Q8VA 4JQ2A 2H8XA 1KFJA 4LUIA 3DHFA 1K4HA 1R3YA 3ZT6A 5D04C 1RK5A 4WJXA 1J18A 2AL2A 4GZEA 1QTWA 1O6IA 3WEOA 5D8WA 1O4UA 2BXVA 4TUFA 3SN0A 1FHVA 5T9BG 3EAUA 3U4FA 3DAQA 1E72M 2X40A 1C8QA 3S1GA 3MYPA 3B0XA 4H9XA 4B3KA 3W00A 4GI8A 1WDPA 1KBKA 1F74A 1ITQA 4HZ7A 4AZ7A 2D0FA 3W7GA 2CEQA 1V6XA 4XBJA 1V8EA 2ANUA 2QUUA 4W7VA 4J2PA 4DBWA 4FOUA 2G41A 1LG1A 3UJFA 1VHCA 1ZENA 1YE4A 3MC5A 2ISSA 3R8RA 1TSIA 1PIFA 1EO5A 3NZPA 5CZJA 4WVXA 4Q4MA 4RDZA 4LANA 3AU6A 2JALA 3TJIA 3WFAA 2OGYA 4AEOA 1UR4A 1BF6A 2OKTA 3SY1A 1JI1A 2VP8A 4F0SA 5GNYA 1EPVA 1FXQA 1E9LA 1KBJA 3H55A 4WK9A 4QXIA 3DI0A 4CN1A 3VXGA 1GQKA 2X41A 1K03A 2QQ6A 3CTTA 1Z6KA 3IVTA 3E0VA 3ORWA 3WQGA 1IGWA 2YDRA 4UNIA 4QAIA 2AQWA 2P10A 1E6ZA 4C60A 5DEZA 2Y62A 4KFOA 4I3GA 2WLZA 1ZP3A 2XIBA 3QYQA 1LBLA 2Y7FA 1EXBA 3ARYA 2IQ0A 3NR0A 1HTIA 5I00A 4O16A 1ZBVA 2CLEA 3N4FA 3RHGA 3W83A 4D1IA 3DI1A 1FWGC 4D6GA 5CSRA 4W8AA 2I9UA 3A64A 3FYOA 3HU7A 2J66A 3M41A 4AC7C 1TPEA 1PV8A 2J75A 1TMHA 4YYFA 4EP8C 3PG8A 2GK1B 1RP9A 2EPHA 3SUTA 1Q6CA 3G0SA 1TWZA 1HL2A 2XVNA 1H7PA 1TR9A 2VX7A 3TOYA 1DHKA 4MJ4A 1XV8A 1GG1A 4DO6A 1A5NC 1JRCA 1MRQA 1QBBA 2C15A 2DQWA 4PUDA 1FQ0A 2O4QA 3KBVA 3MP5A 4FA3A 3EWBX 1M3UA 3WLJA 2VFIA 3QLLA 1V3KA 1RR2A 1C93A 2R91A 2WCAA 3IJ6A 3GIQA 2Q8ZA 2AGTA 3P82A 4TOQA 3EBVA 1JDDA 3CAKA 5IDIA 1LTDA 1UQYA 4Q8PA 3LSBA 2XN1A 1QPOA 4O0KA 1LYXA 4CUCA 2FYMA 1XGDA 1ME8A 3O07A 4DJEC 2VYOA 1RD6A 3C6CA 4FNRA 3RPDA 3S47A 3FKKA 3KX6A 5BNKA 4G7FA 3H8AA 1TX2A 4MKNA 1GTEA 4W4QA 2GJPA 4CQ8A 4S3CA 2R24A 2VEIA 3WF3A 1V3LA 3ZLFA 3L4VA 4QQUA 2X09A 3QM3A 3IUHA 1KFLA 4O50A 2O7QA 3HM7A 4PTWA 5AKQA 3AS0A 3PPGA 1MFVA 4Z0SA 1HVXA 1VRXA 1SFSA 4FPSA 3BAKA 1S1PA 1ZTVA 3GUGA 1FHDA 1BXBA 4DWSB 3CQKA 3VMNA 1XGZA 2XPKA 1A5UA 1FWIC 1IIGA 1QOXA 4ZQMA 5AC8A 4IPIA 5HBFA 3PWIA 4R5EA 2YLAA 4HKPA 2WMHA 1BGGA 3ZJ8A 3AUOA 2FH8A 4PA8A 3AS1A 4PMZA 4AF0A 3RNDA 1CPUA 3IJQA 5I77A 2POZA 3BUVA 2DVTA 3GH4A 3UFYA 2P8BA 1WDQA 3VTRA 1M03A 3W7MA 1ZALA 4QITA 1HZYA 1KM4A 1VEPA 3RDKA 3T0BA 2CLMA 4QSHA 3GR8A 6ENLA 1AJ2A 3UU0A 1FUYA 3HMJG 2YXXA 4DYKA 1AJ0A 2ZRVA 4HSNA 3KTSA 1T8QA 4S3EA 2F6KA 1OVDA 4AD0A 1EKOA 1PB0A 2YR1A 2R1MA 4N9CA 5CG7A 2GDVA 1T40A 4YVVA 2NQJA 1MZRA 1R9XA 2RKXA 1NQKA 1C8VA 3CEPA 4W85A 3S5ZA 4D6DA 3HB9A 3L4XA 5A69A 4NI8A 2J7HA 1E6NA 4ZMGA 2XN2A 1QI0A 1IHIA 2FPYA 5C5YA 3STCA 4ZOEA 1TJPA 5DQPA 5U4NA 5BOEA 1E5JA 4IIFA 5XIAA 1HG3A 3GDMA 4OJYA 5IBXA 3MU7A 2GK1A 1TV3A 3F5KA 2X0YA 3KWSA 1HN1A 3GNNA 2ZRXA 4KRZA 4AHOA 4PCPA 4O11A 1V02E 1XSIA 3CAVA 4QSFA 4Q7BA 3ALGA 4LVAA 1EJSC 1L9WA 5G1TA 2VRJA 1FBAA 4I6KA 2QCEA 3FIGA 3FJLA 2WC7A 4W5UA 1T96A 3APTA 5BU9A 1ZHAA 1O66A 3FXGA 1JFXA 3NAVA 4TVCA 4JX4A 3MKKA 5JBFA 2JF6A 1AK5A 2QCMA 4IPJA 3CLMA 5G4HC 4K8GA 1W91A 1T7LA 3EWYA 2NX9A 3T08A 1XG3A 4ATDA 1E6RA 1XIEA 3CUHA 8RUCA 3V0TA 3LNPA 4LY8A 4FOKA 1OYCA 1SJCA 1GOKA 3W27A 1FP8A 3W81A 4EAYA 5AZ1A 1JZ8A 3S42A 2A7NA 1Q6GA 2W66A 3VNMA 5JBDA 1QHPA 3WKZA 2RJHA 2Z25A 4LF2A 3BZGA 4UFHA 3M0YA 4C6NA 2DZXA 3CUGA 4AIOA 3ARSA 2ZA1A 3USZA 1I2PA 2Z1KA 1KKRA 3HPSA 4GVIA 5M03A 1OFEA 1FFQA 3W84A 2QDGA 1XYZA 4DWSA 5AB3A 2MUCA 2YOCA 4JTIA 3W7IA 3GBEA 2VC7A 2OZTA 5I5RA 2QIIA 5AHLA 3VKAA 4LBRA 2HWGA 3O16A 4KGLA 3W87A 3WMCA 2GVGA 4XZIA 2Y6ZA 4ZO6A 1PUDA 3GDKA 4GYPA 3L4YA 1ECQA 3GC4A 3H6OA 2RDUA 2A3LA 1JNEA 3KTCA 1YXYA 3DFHA 4UWMA 4DF1A 4JFSA 4UCGA 4ZO8A 4RNIA 1PKNA 3NNTA 4DZIA 4JN8A 4BQ2A 3C0LA 2ZCGA 1IIHA 4MYXA 3GIYA 3UZ5A 4A8RA 3K8LA 4KETA 3F1QA 2ISVA 1E70M 2I1OA 4MZ1A 4TMBA 5EKYA 3QFEA 3M5XA 4KKXA 3HGRA 4HMEA 3PF3A 2YL8A 4NF7A 3KTXA 4IP7A 3UWWA 1V4YA 3TROA 2YFNA 4NX0A 3VI2A 1PVNA 1W3JA 3P0WA 2HQAA 1DXIA 2OG9A 3WUEA 4OOZA 1JNDA 4AZ6A 1K6AA 2BSLA 2IXUA 1BYAA 2Z1XA 5C9UA 3PBYA 3CB8A 2DT2A 3ONBA 3DFYA 3T09A 3QMTA 1XBXA 3A9IA 4GC3A 2QJGA 2VZSA 3PUOA 1PWMA 3UYCA 3T9PA 4WY0B 3KCOA 1RUSA 5FOOA 1GHSA 1PIGA 3ZR4A 4AYSA 4F79A 4ORMA 3RM9A 2PDXA 3C2EA 4LYRA 2I5IA 1GUVA 3AJXA 2AAMA 3PNUA 3CV6A 3CU2A 4S3JA 1JZ7A 3UR7A 1BKSA 1H51A 5HUOA 4PCFA 3C2YA 1XSJA 3WH9A 5GPRA 3K13A 2E9BA 4RPQA 4BEQA 2Z00A 3VZXA 1VR6A 1TZ7A 4JGDA 2WANA 4UMBA 3DFSA 3TYBA 3WEMA 3NVDA 3KZPA 3HPAA 5DCBA 2XGZA 1LG2A 1VBHA 3VOFA 1DORA 2JFEX 3L2MA 2V81A 3G1YA 3KBMA 1TQXA 1TFVA 5E1QA 1MXDA 2WWCA 4CVWA 2BGQA 4AHPA 1FCQA 2PWHA 4KRUA 3W24A 4H8HA 1C29A 3ITOA 2D73A 2WAGA 1NWUA 3PVFA 1MDRA 3H4GA 4QLJA 1UUOA 3SGGA 2QCHA 3L4ZA 4BI7A 3QMSA 3M6YA 1QW9A 2O92A 3W85A 2RUSA 3N04A 3CUIA 2DVXA 2B7NA 2FVMA 2YDSA 1X96A 3WBXA 1IZCA 3CL6A 8A3HA 3EOEA 4M8UA 4KFPA 9XIMA 5CPOA 3VD3A 4G7EB 4J3WA 1JPDX 4Z1CA 3QV9A 3F5JA 1HGYA 1FWAC 4A6GA 1AD4A 3ITTA 4PCTA 4EK7A 3HBLA 3GWQA 2G95A 3HO8A 3WQWA 3OOQA 2ZDRA 3PJUA 1KGUA 4PSRA 1SO5A 3ITGA 2FMOA 5CC7A 1ODZA 3WH8A 1R8LA 1ICSA 7TAAA 2R6OA 2DSZA 3WQ4A 4K1WA 4PUEA 3TK7A 3SCOA 2GFTA 4IF2A 2IUZA 3R1ZA 3WEZA 2VQUA 2P5NA 3LI0A 3A22A 4B5TA 1BG4A 3W73A 3JU2A 4GXPA 3UYIA 4GI4A 5FESA 1NU5A 3PR2A 2CKSA 3OQ8A 4US6A 3W7CA 4R53A 1IZKA 4W7UA 1LOSA 2IPWA 1MO0A 3EKGA 4HA1A 5G2HA 4Z1DA 4YJ5A 2CXEA 2WM1A 1RQEA 1SW0A 1WDSA 1XC4A 4CNUA 2XM1A 3WQCA 3EWXA 4CEUC 1VIZA 1IE7C 3CWOX 2CU0A 4LJ3A 1GJPA 3D47A 3O3RA 1U1UA 4HTBA 1B1YA 3GTFA 1XRVA 1DJWA 1W9VA 4WY0A 4JY9A 1P0EA 4QDMA 4JIIX 5CXPA 4ENLA 4JTRA 1KLYA 1H1YA 3KOFA 1MUMA 2BVWA 2FGLA 4IQDA 1M6JA 3GSMA 3FEQA 5A8PA 2GJXB 4JTAA 3LY0A 3CZKA 4HOWA 4L56A 3TCEA 3VKJA 1FY6A 1HJQA 2DFAA 3B03A 1JFHA 1F4AA 4MF4A 3CBWA 1VF8A 2TSYA 2RH9A 2F6XA 3H4WA 1XJBA 2EG7A 1LQ0A 2B4GA 3L2IA 1WE5A 4HOZA 2A7PA 4WOQA 1ECEA 1TPDA 3UJEA 4O8AA 2V3DA 2NWSA 5DX7A 1FWDC 4OBTA 4XZMX 1H7WA 3B8IA 4TQTA 5CSYA 1PXGA 2FTYA 1KD0A 3EDKA 5C2XA 3TW9A 3U4AA 3FY1A 2DZWA 3E2QA 1XIDA 4IL0A 2JGYA 2H90A 4YMZA 3ATYA 3VNKA 1IXQA 4Q4PA 3LCIA 1FKWA 2DIEA 3W74A 1IEXA 2XH2A 1EJUC 2BB0A 4X61A 5JIPA 1RZMA 1F7BA 3AYSA 4GGHA 4BI5A 5BRQA 3TFCA 1J9YA 3CS2A 5CJ5A 3B9OA 4PRRA 2R94A 1LF1A 1VBUA 3GX9A 3VIMA 3O05A 1PBGA 2Z2UA 4LTSA 3TTSA 3VX0A 1MNSA 3M46A 4DAIA 4UQEA 3LPFA 1H7OA 1GNXA 4G7EA 2Y61A 1SO4A 3NL5A 1JQXA 1EJ7L 4AD2A 1E0TA 5AHEA 3U2EA 2Y7EA 1F3EA 4U5KA 2CZ5A 3WUGA 4OWGA 3C2FA 2I7GA 3A3WA 2KZHA 4RR4A 1J10A 1QOPA 1GJUA 3WMBA 1XM3A 1D7KA 2VUYA 4HQVA 4JBRA 4ECLA 1LUCB 1M01A 2HCVA 5A94A 1JD7A 5HMFA 1ZUAX 5BRPA 3KL3A 4I8DA 1RCOB 4QLLA 2P88A 1S2TA 2NUWA 3UJRA 4AEEA 4Z42C 2Z6IA 3BLOA 3HQPA 1VFUA 2PDYA 3SAZA 4NYUA 5FL0A 1VEMA 4DNMA 1UASA 4H41A 2BGNE 1UWIA 5HK4A 2TODA 4R33A 3WDHA 4LWWA 4V15A 1ZAJA 5CBBA 5HPCA 5E9AA 2D24A 1UR9A 2PLKA 4DJDA 3E12A 1B3YA 2IQTA 1UZHA 3CHEA 5E6YA 1BFNA 2GZXA 3WLHA 2ZYFA 3VZZA 1F8IA 2OO0A 1HQTA 1UBSA 5LHEA 1GCYA 4H9ZA 4BR1A 2IS7A 1HKMA 4Y96A 1VHNA 1AZ1A 2WBGA 3WK3A 5I3IA 2GJXA 4B3LA 3TN5A 1ITXA 3B8VA 4R85A 4IMGA 4GNKB 4PMRA 1E40A 1H4PA 1KNWA 2XWDA 5JBEA 3FSTA 4JTHA 5A8GA 4UTHA 3PG9A 1KO0A 4QNEA 3T05A 4TX8A 1DJHA 2BVYA 3TYDA 4TIMA 2A1YA 4M1BA 4YCPA 2XH7A 2OT0A 3JZUA 1LT8A 1ZAIA 2FZ9A 1Q13A 5F4SA 4AZGA 4V2XA 1XIMA 4B92A 4ML9A 2YXGA 4S3AA 3TSBA 3INPA 3FX4A 3BANA 2E25A 1MXGA 1TCMA 5E9XA 1YTKA 3FA4A 2JKPA 4LF1A 1B4EA 3SGZA 4Z1AA 2BASA 2PWFA 5KSWA 1RBLA 4W86A 4W7WA 1DJNA 3MB9A 1Q65A 4J3UA 1GVQA 4M5PA 2X30A 2XIJA 5E09A 5RUBA 4UTKA 2EHHA 3CYVA 1UD8A 2DUXA 1XD1A 3CWHA 4KEUA 3LRKA 1NTHA 2CERA 4GACA 1SM9A 3SECA 1DIEA 3GB6A 5GQBA 4IX0A 4F2TA 4KFNA 2F2KA 1HW6A 3CAWA 3S2MA 2OEMA 3CUZA 3L2LA 4LB4A 2QT3A 4B2DA 1CWYA 3UCQA 4E38A 3AXXA 1UCWA 1XDLA 1H1ZA 4GGBA 3ARPA 4IPNB 3LPGA 3N4AA 4A3UA 5XINA 1GWJA 5D9MA 4Q7NA 1PTAA 3NPVA 4M24A 1OF8A 4HU3A 1LUCA 3USBA 4XAFA 3M07A 3W6MA 3H7VA 2J7CA 3UXLA 1LWIA 4WY0F 3STPA 4MDPA 1X97A 1ITUA 3QV7A 3AZRA 3A47A 3MI3A 3PJTA 3RLGA 5LKYA 3BMVA 3G1AA 2PDFA 4OBRA 5C9WA 2CFFA 4R9OA 1ZSXA 4ZVJA 5ABFA 2BZNA 3BAYA 2GJNA 5AECA 1B2YA 1UUQA 3OHMB 3EB3A 3W72A 4F0RA 2GVYA 2R14A 1R46A 1L6WA 5CAKA 1BF2A 1OG0A 1PE1A 1OFBA 4PYSA 3WO8A 2QJMA 4F0LA 1HO1A 5DANA 3OIHA 4RZ6A 3EX1A 4XQ6A 5F2IA 3DC8A 1GW1A 4KT2A 5HWNA 3KS6A 1N2VA 3BW3A 3NQAA 3WDQA 4KCTA 3GRIA 1KGWA 3SFKA 3GDTA 1TQJA 1FH8A 4L9ZA 4X2PA 3R7MA 2WWDA 1EA0A 2ZZ6A 4NJIA 4QEHA 3WF4A 2FPTA 3OVQA 1DIOA 4QGCA 4IUOA 3OYZA 1GVSA 3MZNA 4JIQA 1JCXA 2Q01A 3WUBA 4GCAA 4KERA 2FQIA 1GEQA 1UD4A 2VGBA 3WJZA 1WX0A 4NY2A 3WBYA 1ESWA 3PB2A 8TIMA 3WF1A 2D3LA 2F2HA 2XN0A 1MW3A 3EGJA 1OCQA 2VGIA 1JULA 1KBLA 2G5WA 1OZMA 3MVIA 2QGYA 4RPPA 1KFEA 2VZTA 5M5DA 4K68A 4JKMA 2QAFA 2V2DA 5ABGA 2XHYA 1MWOA 2ONEA 3CZJA 4HB7A 4AYGA 3TAOA 2L5HA 4GVGA 1Q63A 3P74A 4NVTA 3XINA 4AY8A 1P6CA 3A4XA 1L0PA 1A4MA 1J0ZA 5HR7A 1NDYA 3IGHX 3VDAA 4JHZA 2NVAA 3R11A 1WP6A 3VFLA 2NXHA 1OT2A 4JEQA 2FFIA 4IH3A 4E6MA 4M56A 5TQLA 4K1GA 1F05A 2V69A 2FTWA 1Y5WA 4X22A 1JXJA 2QUTA 1TPC1 1JDEA 1FWHC 1YNPA 3II1A 1VBGA 1VENA 3CGTA 1RVGA 4UTTC 4JYDA 1TTIA 2TPSA 2YDAA 3MKVA 4EX4A 1QI4A 4ERGA 3P3BA 5CBIA 1M7XA 3VKKA 1AA1B 4E0CA 3RF9A 4ES4A 4ZODA 4GKTA 1OYBA 4JR5A 4S2BA 1FOBA 3TDFA 1I45A 3TMLA 4L7ZA 3QPEA 2MANA 1XLIA 3A21A 5DY2A 1H7RA 2OO6A 1TV5A 2CLLA 5I3KA 3MP4A 5BU6A 1DPMA 5G4EA 4F0KA 4GBDA 3GM8A 3LI1A 1FWEC 5I6SA 1X6NA 3FW6A 4CCEA 3GXDA 2PBGA 5FACA 4DF0A 4ROQA 4AZCB 3DXIA 1F6PA 3Q94A 4DO5A 3GR7A 3VKDA 2JKAA 1EO7A 1LWJA 2JE8A 3IV8A 4M6UA 1YBQB 1DOSA 2PLJA 3EA2A 3M5YA 1RJRA 4IMDA 4WGHA 1J11A 2QHAA 1WV2A 2QR6A 3L0GA 5A6BD 3UWYA 4IIDA 2XIQA 2B81A 1VCGA 4NZ5A 1AVAA 3C3NA 5BW6A 3S5OA 1B54A 4H6EA 3QW4B 3S1VA 2BLEA 5HAOA 2Z7KA 4Y6GA 2ZXBA 1XFCA 1P0DA 2EPMX 2VR2A 1BLIA 4XTIA 1UD6A 3UG5A 3QR0A 1JAKA 4LS1A 1VJZA 4U2YA 3AROA 4JKKA 4IMFA 3OLDA 3SSZA 3BCDA 4QDWA 5FEZA 4R88A 1QPNA 3KP0A 1IGSA 2PDGA 2YA0A 4WSJA 2NX3A 4NUWA 1LROA 3AIEA 5C9ZA 2NQLA 4QCEA 4DLFA 4P8WA 5TIMA 4HHPA 3H26A 1W6TA 2V9DA 3M0LA 4F0MA 2XWEA 2F8QA 2WC4A 3EEGA 4CD7A 4DY1A 1UWAA 3WDRA 5FEPA 3UESA 1EP3A 3MMTA 4S3FA 5T26A 3M47A 5C9RA 5FJOA 5HR6A 3B0VC 3FOKA 4HSOA 4Z0JA 4HA0A 4JTLA 5CEWA 1CXLA 3QGVA 2VTFA 4JDYA 4DELA 3QJAA 3WUFA 3M5ZA 3PBVA 1UPMB 2ISWA 3KBWA 3UWEA 2GL5A 2BHYA 1PHQA 3H70A 3KS5A 1E0UA 1YLVA 4TX6A 2E5BA 1DJZA 1R47A 4GLEA 2F6UA 5EMJA 1XHGA 1GQLA 3W7OA 4ZB5A 3UWVA 1XXXA 4R34A 2A3AA 4KWWA 3POHA 3A4AA 1M9HA 3AHZA 3KZSA 3WJYA 4NJKA 4LVFA 3BPWA 1QNQA 4DXXA 2PDLA 3W1PA 4PTXA 1FFRA 3VM7A 5BOOA 1KCKA 3C86A 2XDFA 1AW2A 5D02A 4CD8A 4F40A 1DE5A 4CNPA 1ISZA 4CGTA 1BVZA 5F7UA 3AHYA 2J27A 4YL2A 3CPGA 4J27A 5H1WA 4Y9OA 4GFSA 1GW9A 1AJZA 2DJXA 1LM1A 3OGSA 4AZCA 1GVEA 4Q33A 1U5JA 5HUPA 2OX1A 3IS4A 3B4UA 5B7YA 1YBQA 3WG6A 1QI2A 3TTOA 1DTNA 3MW7A 2Z2BA 4GO8A 3QZEA 3D3FA 3SADA 3MQTA 1KCXA 1XICA 2E8YA 4HPHA 2FVLA 3QRHA 3PP7A 4FHAA 2J88A 3SSJA 1J4EA 1P7TB 3KWXA 2DVUA 2WHLA 4XWUA 1YX1A 2BNJA 4AUBA 4IJRA 3IVUA 1REQB 5EU9A 4A8IA 1PKMA 2E6DA 3IGUA 3RRXA 3MCOA 3R58A 3WNPA 2XU2A 4A3YA 1GEHA 4PULA 4NNAA 3WNMA 2BFGA 3P6LA 4EAMA 1I2RA 4PB4A 1DEDA 5DMMA 3H22A 3M4HA 1DP0A 3RX4A 4DJFC 4L9YA 1ELSA 1V0NA 1OX4B 3GVGA 3ARZA 1FTXA 1P43A 2MNRA 1S3TC 2VGGA 3VKBA 4UQBA 5AHNA 2A21A 2PC4A 2QPUA 1J5SA 1ME9A 3CH0A 5F4XA 2V8ZA 4BHYA 4D6EA 4J1OA 3RJXA 3CQHA 2PRHA 2ZOXA 3GNRA 2WO5A 2CZDA 1NAL1 2BS9A 3QR3A 1RLDA 3JZEA 3KL0A 4R9XA 1SMAA 1EQCA 3R0UA 5JQ9A 4U5IA 3WZ0E 1FHLA 1X7IA 4URIA 4RDYA 1R2SA 1V3JA 3E02A 1A5BA 1JEZA 3RX2A 1BYBA 2BY0A 1OD8A 3PZGA 3FCPA 3RU8X 3NUKA 4N0RA 2OPJA 1TJ1A 3AS3A 4XISA 1XBZA 3A6OA 3NL6A 4LSBA 3W2JA 3FJ4A 2XIMA 3VIHA 1R9ZA 1VYRA 3N11A 1ZJIA 1CT5A 2YBTA 2EG6A 1CB7B 3CMFA 4C6KA 1F3TA 5I24A 3W86A 1AQHA 4Z1BA 2CKRA 1GORA 1VH7A 2XZ7A 3T44A 3BLIA 4XZNX 1XI3A 1KKOA 4FLQA 4XAPA 3OZYA 3LS9A 1XD0A 1HGWA 2WJEA 2EEXA 4U3CA 7REQB 1E0WA 5HDRA 3E0LA 2RJGA 2WZEA 3GVWA 3RR4A 3OG3A 1YQ2A 5D4YA 3WX7A 2XISA 3TU9A 4KH2A 4Q8WA 2PDBA 4GG9A 3BC9A 1LL7A 3BCJA 3CUJA 3NQ8A 2ASHA 3EOUA 2J8GA 4W8BA 2E68A 2FTPA 3SRHA 2QDEA 1Z48A 3I6TA 4M6PA 2UWFA 3ANYA 4JFTA 3H2MA 3GU9A 4QTGA 4UUIA 2ALRA 5DELA 2Y63A 2VDHA 3L0NA 5HULA 1Z8AA 4AAJA 2BMBA 1C9WA 1Z42A 1P7TA 4HYRA 3MUZ1 3BO9A 2UY5A 3H2FA 4Q32A 2X8RA 2CHRA 4M7TA 3LRMA 1J0HA 4JTEA 5LZLA 1REQA 3NQEA 1UIPA 5D2YA 1PPIA 4HP5A 1ZFJA 1AFSA 5DXYA 2PGFA 2ZX9A 4LXFA 2V68A 2ZUVA 4CU7A 1HXJA 2XINA 4IMEA 4FX7A 3W1LA 2ADAA 4FX6M 1IT7A 4IGNA 3AICA 3WYZA 1M7PA 3WD2A 4QIUA 1EJWC 2PTDA 1F3XA 3NPXA 2O4MA 2FGBA 5LXEA 3DZ1A 4I7VA 3UXDA 3ONCA 1OX4A 3ZVHB 1I2OA 4FALA 1GKQA 4N7QA 1EJXC 1QATA 5C6MA 1EWEA 2WSPA 5HWMA 3ITXA 2CBUA 3FKRA 3IGXA 3P67A 3AIBA 4JTFA 1XGEA 2CETA 2PTYA 3DHPA 1CW2A 4CD6A 1UR1A 1YADA 2WYSA 3V7PA 2A0NA 2X7VA 2Y0FA 1RCQA 2DZUA 1Q7ZA 3UZXA 5CC6A 4NXKA 1QNSA 1V7AA 4NZ1A 4HK7A 3O6CA 3NIYA 3C61A 4ASTA 1VBRA 2V3GA 1EOMA 4GFIA 2BV9A 4C6EA 1W8SA 4S1FA 4LALA 5CCZA 2FDSA 3NO5A 4UC5A 4J3VA 3CIVA 1NOFA 1CZ1A 4HOXA 2VKZG 1Z89A 4JTJA 3E74A 1DE6A 4LRTA 4B4FA 2PB1A 3W7EA 1KXHA 2OCZA 4CD5A 3ZVIA 1G01A 3VYLA 4ZFCA 2P0IA 5ECUA 3QZAA 4G56A 2HXUA 5KZMA 2P0OA 1HVQA 1BSLA 2GLKA 4NZCA 1E73M 1A80A 1WO2A 1UYQA 4H2HA 2BDQA 4AMAA 5K2ZA 1HJXA 3W1TA 1S5WA 5D37A 3GNDA 3NZGA 4JQ4A 1MEHA 1TTQA 1NP0A 3CPUA 4JOMA 1Z9AA 2FVKA 4LV9A 4LEFA 2FHCA 2WSYA 3TNOA 3KCLA 7REQA 4WGXA 4GXMA 5I7GA 4BFAA 3WDPP 3M0MA 2PDUA 2R1NA 3PPHA 1D7FA 2Z26A 3U2OA 1A5AA 3G1RA 5CSUA 1UIOA 3MJMA 4RCXA 4UOQA 4Z17A 1BRLB 1TO3A 2E9MA 4NJGA 3VDHA 1BVNP 1I2QA 1AH0A 1JPMA 1B31A 4OT7A 4Z2JA 3W38A 5D9PA 3SRKA 2EF9A 2Y8VA 2VDIA 3T0CA 4DI8A 2J77A 4AIBA 1Q6EA 3CHFA 4MWAD 2OKOA 1UA3A 2QUMA 4FZIA 4Z2KA 2PRMA 1FH7A 4FXRA 3MVTA 4DN1A 2BY1A 1XRTA 4M0XA 4P7OA 4NSBA 4L4OA 2V63A 2PDKA 2O55A 4GQBA 1XCFA 3BLKA 3CLWA 1EQPA 1Q6LA 3QPYA 2BY2A 4ADSA 4CQ9A 1A5SA 4UNLA 3OLIA 4A21A 1FXPA 4GY1A 3WQPA 1OEPA 1XRSA 3G2GA 2G3MA 2ZX8A 2HVOA 2OB3A 2ZRWA 2X0SA 3TLQA 3QGKC 4GVFA 3D46A 2Y5EA 5A3HA 1KQZA 1Y65A 3MWAA 3F4CA 3LXAA 2ZE3A 3FXYA 2PGEA 4JEJA 3R25A 4KWSA 1I60A 2EAWA 2HS8A 1OYAA 4C6OA 1E0XA 4KCWA 1NF7A 1LOQA 4R27A 1A49A 2Z1WA 1TUFA 3R79A 4PMUA 4UBPC 2ABBA 4A22A 3B06A 2VQTA 4BWLC 1EFZA 4LH8A 3B9EA 4DAFA 3K4DA 4RW3A 1KWKA 3W1XA 1DV7A 1W9DM 5I0DA 4E2OA 1YMYA 2YCLB 3NEHA 1W3KA 4BZYA 3UZZA 4RL3A 1CGWA 4H8NA 1MI3A 2ZXDA 2W61A 2ZBTA 3L9CA 1QW7A 1OK4A 4V33A 1I1XA 2V5JA 1FWSA 1Z44A 1K7EA 1W1VA 4W87A 4LC6A 4MB3A 4GUJA 3HPXA 1XDMA 3OBAA 1M68A 5I79A 3MHFA 3VFCA 3VOHA 4G6CA 4A35A 3FJNA 1XLGA 4PL1A 1Z32X 4JCLA 4NAFB 5J04A 3GC2A 4NRRA 1NY1A 4PL2A 1MSSA 4RW5A 1G0CA 1FDYA 1W1YA 5CG0A 4W5ZA 4YWSA 1W5MA 4JIEA 3GVVA 5FEXA 1TWIA 3W7RA 4K3ZA 2PRLA 5IM51 1WAWA 4DYJA 4B3ZA 1SJDA 1AQ0A 1FDJA 1RSCA 3IVSA 1X39A 4RNHA 4LAMA 1DQUA 1E6XM 1J0KA 3V5CA 3B8WA 1O7AA 1BRLA 4RE2A 4DBDA 2HROA 2KAUC 2YL9A 1R3SA 2E77A 2Y70A 3B97A 3L12A 3QSTA 4O18A 5D03A 1R2TA 3W23A 1KRAC 2W6RA 4F3HA 4PSPA 3PUEA 1SUXA 3CV2A 3TZNA 4DPQA 1KFBA 3O0KA 3BK0A 4DB7A 3R10A 3NO1A 3WQEA 3UPBA 4Q8MA 3WLSA 5F2LA 2DDXA 3VDBA 1UD3A 2XJ7A 4UR9A 5I03A 3ISIX 3OPSA 3VKCA 3VNDA 2RDTA 4I9TA 2GVEA 2CYGA 4H9UA 3W01A 3LCGA 3W75A 1JUEA 3Q58A 2JIEA 3TQKA 5FJIA 2INEA 4DLMA 4IQLA 4L6DA 2TMDA 4JS3A 1BD0A 4REQA 3W1AA 1HX0A 4LNCA 1GOWA 1XLCA 3WBEA 3W1RA 4NYYA 4IFKB 3QY6A 3TA9A 2PD5A 1VZWA 4W84A 1G1YA 1Q2RA 5DCDA 1HJVA 4OU1A 3TOPA 4M1RA 1H11A 1VFOA 4HNTA 2C3ZA 3G0XA 1GVYA 2YGYA 5IOBA 3GXPA 1NDVA 1U22A 1XYLA 1J6OA 3VGGA 5IDZA 1PSCA 2ON3A 3LGDA 3W9ZA 4B91A 1B9BA 3W29A 2Z29A 3URQA 1RHCA 2E6FA 1O60A 2YCLA 1RJPA 3AMGA 3SURA 3KHJA 1RXOB 1XLLA 5LYRA 3E2VA 4XV0A 2YSWA 4I90A 2W67A 3ZT5A 2PWDA 4DNHA 1N7KA 1R7AA 2HK0A 3V18A 1SO3A 1H09A 5G1YA 4E3VA 3ALFA 1AL8A 1NFPA 1W8GA 3UBPC 1G4SA 1OK6A 1A4LA 4O0ZA 4NAFA 4I7WA 3TYCA 5HINA 1OC5A 3F7JA 3N2CA 3VIGA 1VEOA 3LLDA 4Q7IA 2XM2A 2Y7DA 3MSDA 4GQQA 1DJQA 5B7ZA 3GG0A 5A6JA 3BLPX 3ZFHA 1D8CA 1G69A 1JPKA 3V36A 4PE8A 1EJTC 4RDWA 1Q66A 3GO2A 5C70A 1SMDA 2R9RA 2VOMA 2VD8A 1PWLA 4Z1YA 1ZNNA 2OELA 5SWUA 2CESA 5AZ0A 1CB2A 2OX4A 5A5WA 1F8MA 2VMFA 5DMNA 4B5VA 1VKFA 4NZ3A 4X2RA 3SJNA 1C3FA 4C65A 4HA4A 3ARVA 3QY7A 3RX3A 2AGKA 3AZSA 1SSGA 4TU1A 3MUY1 1EF3A 3ABZA 4JX6A 4MWAC 1AW5A 1KV5A 1M7JA 4ZOAA 3TEVA 1ITCA 2AQOA 4GJIA 3G1FA 4ACYA 5EYWA 4PFHA 3CUXA 5I3JA 3CO4A 2VURA 4D6IA 4QEEA 2OLHA 4ICMA 3BAJA 2C79A 2NVDA 1R2RA 1GZGA 3TH6A 1JYWA 1OC6A 1SFLA 3BV4A 3QQWA 3PZQA 3JS3A 4I7UA 3FHQA 1VIWA 3SW6A 3E38A 2BOGX 1VFSA 4C6IA 2X1UA 3THDA 4XSLA 3AIRA 4Q8UA 1E1FA 4C6MA 1KTBA 3U7VA 2DSUA 3PN8A 4ERAA 7CGTA 4HPGA 4QQ3A 3W88A 1VQTA 4ZSTA 4AX7A 4O57A 1UR8A 4IIGA 2YB4A 4WRHA 3L68A 5LA1A 2O9PA 3U7BA 4LX4A 3RILA 2FFCA 1GGOA 3C2OA 2GDUA 4IFKA 5HQEA 3EA3A 1FH9A 3UR5A 2HRWA 1EP2A 3W1QA 1HP5A 5LA0A 4JQ1A 1E4NA 2ZZ1A 3T2QA 3GE7A 4BJHA 3W07A 1EYWA 3KHDA 5HPOA 1ZAHA 4BKNA 1AW1A 1CLVA 3IIZA 3S2NA 2D0GA 3VA8A 3UG4A 3F2BA 1YDVA 4XIAA 4MB5A 5CZKA 4YHGA 3AMKA 1MRAA 4UTWA 1G67A 4GVHA 5K7JA 1DYSA 2DT1A 1TCDA 3N34A 2CITA 3BJFA 4GD0A 3GW3A 3NL2A 1PZ1A 4H3DA 4TX9A 4MGGA 1ZZMA 3CZLA 3ZYZA 3B05A 2PE4A 1TG7A 2ZE0A 2ODOA 3B9NA 3CYJA 3MZ2A 4QE1A 1M1BA 4MWAE 2ZUSA 2B31A 1JDAA 3ZS4A 2D3NA 3BAWA 4HJFA 4PCSA 1ZBKA 3ECQA 5HATA 3AC0A 5U7SA 4QROA 1XYBA 2C19A 2W91A 4GUFA 2YFOA 3DU0A 2PMQA 1KCZA 2XGBA 1QO2A 1EYEA 1EC8A 3OA5A 3FVMA 2CBJA 1ZJHA 2PUZA 5DT7A 1F5ZA 2I5QA 2C8NA 2YZ5A 1FWRA 1QI5A 4PBFA 1XYAA 5DF0A 3B0PA 3VK5A 4IPPA 3NZRA 1N8IA 4IISA 1TV2A 5G1MA 2GQ8A 3FAWA 4GOAA 4LAKA 4UNKA 3F2DA 3L4UA 4O12A 4J5NA 4MSSA 3A3HA 3ARQA 1K77A 4KWOA 3R0KA 4QRNA 3VVGA 2PS2A 5K3VA 4BF5A 1LRTA 1QPKA 1OFDA 4M29A 1CIUA 1P6BA 3GTXA 5JU6A 5FJTA 3DIPA 1YDOA 5D2XA 5BCAA 3ITCA 3LRLA 2VCAA 3GH7A 3GUWA 1V3MA 2YB1A 4LVGA 2VVSA 3NSNA 4H4IA 2NV9A 4FF7A 4C1LA 3TAKA 2PU0A 3LQGA 1YPFA 3TWBA 4I5XA 3SZ8A 3ZR6A 2OZ8A 3QZ6A 4H7CA 3I7SA 2X1RA 5B80A 3T78A 4QX4A 5CPMA 3WY1A 2BP1A 4O28A 1ZGDA 2GUBA 4FNQA 4YN5A 3LU2A 2NT0A 4NASA 2IKHA 2XYLA 4HCLA 4MM1A 1TIWA 3MV11 3M0JA 1GYNA 4RZ4A 3B9DA 4GIEA 4J40A 3N6HA 3NM3A 1S2UA 4AD5A 1K02A 3RR1A 4S3BA 2V5KA 1OIFA 2D2GA 2X2YA 5A6MA 2VX6A 4MY1A 3ELFA 3L66A 2CZEA 2EPKX 3SIMA 4ALDA 4H01A 2V2CA 4AD1A 1GTHA 3LSCA 2X2GA 3KBSA 3FVDA 1YW1A 5H91A 1KC7A 4JNZA 4E3TA 3N2XA 3CZGA 5HJYA 3V5FA 1XLDA 3NXFA 2BODX 3M7WA 5MF5A 3IANA 4FNUA 4J3XA 3BQ6A 1FWJC 3DYPA 5D30A 1J12A 5I3FA 2QV5A 3I3DA 1XH2A 2OWXA 4NJHA 4WLCA 2D20A 3S1UA 1LRQA 3EPOA 5BYWA 1SZEA 3O9NA 3D3AA 1QASA 4QCFA 4NAEB 5D32A 5EGRA 3NOEA 1HJUA 4MLJA 1PDZA 3W7KA 3HIJA 2D69A 4JTUA 3RM8A 3CAQA 4I5RA 2HE5A 4IFRA 3S5SA 1Y7VA 3TP4A 3R8GA 2EBNA 3ZQ9A 1GOXA 4GUIA 3QLDA 4PODA 1XUUA 4JD4A 1ML1A 2YX0A 2A5HA 4ZTYA 1F4HA 1WKFA 3DEQA 3G3MA 1CXKA 3ARTA 4XK2A 2W3ZA 5EMYA 3T4CA 4DYEA 3EMQA 5I3GA 4F9DA 3M0IA 1M53A 2QUVA 3NQDA 3IGSA 4IM4A 3GY1A 3FN9A 1U1JA 5KINA 4WSKA 4TTGA 2G97A 1B3XA 4HCHA 2EG8A 4AY1A 1UC5A 1W1TA 2C1HA 4AD3A 4KESA 2Y1HA 5ABEA 2OWCA 4H6QA 4EXBA 4M3PA 4DUWA 4ZR8A 3WD0A 1R5YA 1LQ2A 1HNYA 1S2VA 1XIFA 2V5BA 5HQLA 4H8UA 4MFEA 3NQ7A 1JD9A 2G50A 2YPIA 1ALDA 2GWGA 1R7OA 1MFUA 1F6KA 2I17A 4GMEA 4Y8EA 2XIIA 4C7FA 4UZSA 3TFXA 4G9PA 3I3BA 3N25A 5DFAA 3NSXA 4WCJA 3V1HA 2Z2AA 3F03K 2QJJA 3P0XA 2ACSA 3NGFA 4N4PA 1VFHA 1BYDA 1JCMP 1H5YA 1RLCL 4DQWA 1NEYA 2I14A 4B5NA 4LB3A 1QT1A 4AMCA 3WF2A 4H9MA 3E3HA 1I0DA 3N6QA 3RK8A 2HS6A 3HQNA 4HNNA 4CQDA 2NV2A 3EA1A 3W6YA 3WLIA 5AYIA 5AHMA 5ENLA 3R13A 2QW5A 4KGJA 1ICQA 2PDQA 3PTMA 5T9CE 4Q4SA 3E49A 1VYSX 2E0PA 2J62A 1BAGA 4DZ5A 3UEQA 4A2RA 3EB2A 3NQ2A 4X9YA 2V38A 2V3EA 5C55A 4ZQCA 4LAUA 1MUWA 5I2UA 4L64A 1XLMA 3FYPA 4MZ8A 2ZUNA 3VD7A 1L6YA 3WQFA 3EMCA 4OE7A 4PGLA 3ZLHA 3EXTA 4POCA 4AB4A 1GQNA 1QK2A 4YTUA 1S3HA 1KWGA 5IHSA 3S83A 2ZX5A 2V5DA 1Y5VA 3CEUA 2Z7GA 1S1RA 4EPDC 4Z08A 1X7FA 3ABQA 3VNJA 3TXVA 4NAEA 4XKYA 3T7VA 3W1NA 3MSRA 1OSEA 1QJWA 3ICJA 5EMUA 3NQMA 5ABTA 2QKFA 3TTYA 5JH2A 3L5MA 5DY3A 1MEWA 3U5YA 2AMXA 2ZUMA 1BXCA 1LL4A 4ZGYA 5I3HA 3MSYA 1YDNA 4IG2B 1LQAA 2H3BA 3H24A 1VCVA 4H6KA 4MMWA 1HKWA 1H50A 3N6JA 2PCEA 4XG1A 3SB0A 4YTRA 2HE8A 3ZT7A 3K8MA 4IGMA 1SR0A 4MOZA 1W1IE 3IUIA 2C16A 2WBKA 1BVWA 2Z4GA 3SEPA 3QBUA 4JPGA 1CEOA 3WD1A 5FI8A 4LFYA 4J3ZA 5AYXA 1H3GA 4LUSB 4X0VA 3FDGA 5MKGB 2VL4A 1QPRA 2WV8A 2WW5A 4S3GA 2AKZA 3QC0A 3ZO9A 3ZSTA 2Q8LA 3VIJA 1DWFM 1EGVA 2Q02A 3BCFA 4JDBA 3T4WA 4UIOA 4FAMA 2JEPA 4NT0A 2EPOA 4AWSA 5K9CA 2NZLA 3HGJA 1DJIA 6TIMA 4N2YA 4NI3A 4MY9A 3KRSA 4OUEA 2FKPA 1PKYA 4OV9A 1A5OC 2GGHA 4LUTB 1S2CA 3TC3A 4GHRA 2HBXA 2ALDA 3WNNA 4H6RA 3QV6A 1KR1A 4MNKA 4GZ7A 3O6DA 1F76A 4QFUA 2UZ9A 2OJPA 4MAZA 2VFGA 3T1GA 1YKWA 1C90A 1GPFA 2GSHA 2E09A 6ALDA 4DXKA 4HNUA 4PBGA 1SZFA 3BURA 2CNCA 2Y24A 2FHBA 2CWXA 2E8ZA 4M6QA 3MMDA 4B90A 4KW2A 1J5TA 4GI9A 2EKCA 2WZIA 4J28A 3UD6A 3OVPA 4FMVA 1OGGA 3TE9A 2IPFA 5F1UA 1ZBWA 4ZA0A 4QJ4B 3HMCA 3LCLA 3BL3A 1MNZA 2OOGA 3EX4A 4AIUA 3IACA 3NQGA 4B5WA 1UC4A 1TV7A 3ITYA 1FWNA 2ACUA 4LVDA 3F4NA 4O4VA 3CWNA 3T07A 1QWKA 4CNNA 1MDLA 2VRKA 3K4AA 4C5ZA 5H2ZA 3EPNA 3DENA 1WOAA 2D23A 1JI2A 2RGMA 3NEVA 1GT8A 1SZGA 4Q8OA 3VDCA 1XLKA 2VVNA 3IIVA 3ME3A 1NWTA 2WK2A 1US0A 4PCNA 3IWPA 4C5YA 4GY7A 3V1PA 3HV8A 2WMIB 1WYIA 4IG2A 1G7UA 3RPMA 3KVKA 3N17A 3APYA 5F2MA 4NRSA 3SDOA 1XCWA 2D0HA 1M65A 2YA2A 1NF0A 3S0CA 1MQPA 3BGGA 3STFA 4DJEA 2BOFX 4LEQA 3MUAA 1TWDA 2NLIA 2PF0A 4KS0A 3LHVA 2ZX7A 3DG3A 3SUWA 2FZBA 1XISA 5DO8A 1CNVA 2P1FA 4LUSA 7TIMA 5MKGA 3I10A 2OQLA 3PSWA 4UOZA 2BXZA 2QIWA 3AS2A 3HGSA 3P8IA 3WN6A 1IQ8A 3MYOA 2V82A 1V02A 1TZZA 2OT1A 2PWGA 3IV3A 3I65A 3QF0A 5KITA 3KRZA 3HPFA 2YIHA 4JIPA 1W3TA 1WZLA 5AHIA 1FHUA 1US3A 3OLEA 1F6YA 3UG8A 4PMNA 2D22A 1XYFA 2PURA 4FLRA 1K9TA 3LUTA 5FIPA 3VOJA 1RVKA 2HISA 4E2VA 5HMDA 4RLIA 5EMMA 4LUTA 3H54A 2Z28A 3P60A 4IP5A 4AHQA 1S46A 4J2MA 2PSNA 1GKRA 5LHFA 2Y5SA 4PEEA 5FA5A 5BXTA 5G2IA 5CJMA 2QPSA 3MS8A 5AYZA 3VIOA 5EFFA 3MUXA 1I1WA 3BMWA 5IFTA 5ECVA 4FNTA 3THCA 4NKCA 1UKTA 3KLKA 2OR2A 2WVVB 2FZMA 3LBOA 4RKAA 1K9EA 4YWIA 1J2WA 1TVLA 2QLYA 2QJHA 3IJ7A 2W27A 3LLXA 4ZQNA 4B4HA 1NIUA 5HJLA 4MNMA 1V6YA 4XUYA 8XIAA 1OCNA 4DBSA 3N73A 2FB3A 5HQMA 5REQB 1Q6QA 2E40A 5D38A 3TR2A 3BLLA 1JZ6A 1H2JA 4MZYA 4HK6A 1T99A 1RPXA 4NNBA 2F38A 3RPTA 5EMLA 5E0CA 4O1BA 5I07A 2VT0A 3GIPA 3BE7A 2GDQA 3VC5A 1UP0A 2V2HA 1XLBA 4LOCA 1QHOA 3LDVA 5HXMA 3SO7A 3F4WA 3ZJKA 1I4NA 3A23A 3G22A 2ZZ4A 3KRBA 5CPNA 1L6FA 4AXKA 3F4VA 3SQSA 1PKLA 2QCLA 3TW6A 3BGJA 2NW0A 2WMIA 3KDNA 2ESCA 3FDKA 4OHQA 3OG2A 2VZVA 4ZXOA 5ABHA 4QG8A 1M04A 1XDJA 3R2GA 2YW3A 3AWNA 3VAVA 4PB5A 1HKIA 3GDBA 1IT8A 1UWUA 3PPCA 1I2NA 4Y90A 5EBAA 3UETA 3M43A 4HIBA 3CT7A 4FO4A 4NQ1A 2VFDA 4C1NB 4BA0A 1TPB1 1ZQ5A 4PR4A 3KRUA 2Y8UA 3V35A 3PB0A 3DECA 4WD0A 2WSQA 3VPLA 4P7LA 2DT0A 4IGSA 3PZOA 3MUIA 4HNOA 1EDTA 1EUNA 2CHOA 3LMZA 3W71A 2CLHA 1T8XA 5G5IA 3PBUA 3DFOA 1GOIA 2VEFA 4U28A 4UTFA 4YU1A 3RM4A 4YTQA 3BAXA 1UG6A 4U2ZA 1JRBA 1VAHA 2Q3OA 2WQPA 1UZDA 2VC9A 3U2CA 3HQ1A 1QI3A 1PTGA 4HPNA 1C7SA 1ISYA 4L6OA 2YXOA 4EVZA 4DX3A 1SZNA 5FCZA 5BOFA 5AY7A 1EIXA 3WQ5A 3S1XA 3TQVA 1VBJA 4BCEA 2V67A 2DJLA 3N4EA 2I56A 1DXEA 3NO3A 2OYKA 5LIXX 2XFYA 4IIEA 4B16A 1Z41A 4FXFA 5TD4A 4CQCA 3R89A 3QQ0A 3H2CA 4PEKA 1Q8JA 3BW4A 4A3HA 4LC8A 3S1WA 2FLIA 2XUCA 1B5TA 2WVVA 5FSEC 1GJWA 2QCCA 1XKJA 1FCVA 1B3VA 3U9IA 1H63A 1K8ZA 3UXAA 1P48A 2QCGA 4LS0A 4DWDA 2PLMA 4F9JA 2OXNA 3KE0A 5BZAA 1N82A 1VS1A 1I75A 5D2TA 2VCBA 2PWUA 1PAMA 3CJPA 2PFHA 3W25A 1D3GA 2PI6A 3QR1A 2FHFA 2AAAA 1GYMA 3G18A 3GZ3A 1U30A 5E6ZA 1R3TA 2QNEA 3ABXA 1V6UA 2JGQA 2GJLA 1W9UA 4ZQPA 2EQDA 3EDDA 3WLLA 4OZOA 5KZDA 4JKLA 4GQGA 4ZBCA 3AXHA 4UOJA 4DEFA 4HMCA 4BF9A 4HNCA 4R3UA 1VP5A 4V1XA 1UR2A 3WLQA 3AHTA 1IYXA 3PZUA 3QHOA 2POTA 3JUGA 3G3DA 3NM1A 4U3AA 3IJ9A 3CMJA 1JYXA 2J7FA 1EX1A 1QFEA 1OZQA 1PX4A 2ISFA 1H0GA 2ZVIA 3W2LA 1E55A 3E0IA 3M7SA 3VNYA 4PRWA 5A2AA 1PYFA 1B90A 3T2PA 2VFHA 4NG3A 4PUJA 3KOWA 4CNSA 4LUJA 1NH6A 1W5OA 1IEWA 2VOTA 1LLOA 3NJ3A 3PULA 4PMXA 3WCZA 4C1NA 1IWBA 3CQJA 2VI0A 1WOBA 2E6YA 1JZ3A 1V51A 5IRPA 3LNMA 2WHJA 2CLFA 1E6SM 1QXLA 3CXOA 3E5BA 3NOYA 1TA3B 4ZFMA 3SCSA 4MG4A 1E9ZB 1EA9C 4C6QA 3B4YA 2DT3A 1Q7QA 4L80A 3KVJA 2BWGA 5CGQA 1UKOA 4XTDA 5KZ6A 4CNTA 3EOSA 1HKJA 1S38A 2WMJA 1XX1A 3N3MA 4L4MA 1K3UA 3T8LA 1R6WA 2BXYA 2XVLA 3NZQA 3HPZA 5C71A 2Y89A 4Q8TA 3QFWA 1X1ZA 1V7YA 4QM1A 3GHSA 3MBFA 3DESA 2X1SA 4EWJA 2C7FA 1JCNA 1AD1A 5FAGA 3GHUA 3NQBA 2HPIA 1UMLA 2XIOA 5E5CA 1W9PA 4NILA 1KCLA 3WLPA 1X38A 4LT9A 1U83A 4MVAA 3TUUA 1EXPA 1CYGA 4XVEA 2BHUA 4PUWA 1UWSA 2WSKA 2AKMA 5CZ0A 1CI1A 4TTUA 3S2JA 2NVCA 1XC6A 3UA3A 1LJYA 3NG3A 4E8CA 3HJEA 3WD3A 1K70A 1AMYA 1CXFA 3W82A 1DJXA 2ZUWA 4UXDA 7A3HA 4C6PA 4Y2WA 2CIPA 2AL2B 5CH9A 5TF0A 2G3NA 3WJWA 4EXAA 3A5FA 3QW3A 3KOYA 1KA9F 4ADTA 4GH1A 2X16A 2LLEA 2D2OA 4UMCA 4O4WA 1ONWA 3FK4A 4CQAA 1H62A 3TN4A 4OV4A 1IF2A 3PC0A 4FIQA 4BS0A 2ZTJA 1XQLA 4UFKA 4P7NA 2QCNA 3C56A 4JTCA 1FWWA 5MHBA 1UPPA 5JUVA 1VCFA 2XFRA 5HMEA 3CZ8A 4Z2LA 3KVLA 1PJ9A 2UBPC 3OJGA 1EHNA 3FAXA 4K7YA 4QR6A 3WK2A 2PU1A 3URBA 1EZ2A 5GNXA 1IEQA 1X1NA 4DWSD 4TVDA 3P80A 3TJLA 4CEXC 5I09A 2WMGA 1I8JA 4BI6A 1JPHA 2VHLA 2C71A 2WB5A 3GDLA 1LBFA 1RAKA 4OECA 4YVPA 1IZJA 2PDHA 4MUZA 3S2LA 2GJRA 4RXGA 2W4XA 2VFEA 3AIWA 1R3RA 2ZXQA 5H8UA 2V5CA 3MTWA 5C8BB 1VFTA 4Y8FA 4UB9A 5LGZA 1TA3A 3K1GA 1TR1A 3BARA 4XAGA 2NX1A 3CL7A 4EIVA 1RK6A 4HN4A 4Q3MA 2A3BA 3MWCA 4MIMA 4MFDA 1JIBA 1AODA 1QNRA 1TZ9A 3UVAA 1B3OA 1BWLA 4EOUA 4QG9A 4HNLA 3GG1A 3FSUA 3UVIA 5A6LA 1K9FA 3OEXA 2PPGA 3C8NA 2UY3A 2ZFAA 2PWVA 1A0DA 3RUBL 4TV5A 4U4MA 4MJ2A 4NX5A 4JL1A 2A6LA 2VRQA 1OFQA 5FJJA 4WDXA 3K30A 1LCOA 4G1NA 3WQVA 1R86A 4PFMA 1VYPX 2HMCA 4S2CA 4LAOA 3OVRA 3GHTA 3A13A 3DOPA 1Q2SA 1SJAA 1D3HA 2PC8A 2NQHA 1R87A 3VGFA 3W2UA 4YS1A 1TPFA 1RP8A 1Q85A 3VE9A 2VC6A 4CVUA 4JL2A 4YHEA 5HNTA 5CQ1A 2CLPA 4IIBA 2DZTA 5FF7A 1OFPA 1RJQA 1JGIA 5EBUA 4IPLA 2PLCA 4F0HA 5AN7A 4KQNA 3TCSA 1WKYA 3GYEA 3GG7A 1E15A 1JZ5A 1JF5A 2CBIA 4WX2A 5K9XA 2VZUA 1PL9A 3S9IA 4ZOBA 1YHTA 5CAHA 4E4PA 1F73A 2FDMA 3FA3A 5CJNA 3AI0A 4NZ4A 5I06A 2C14A 3N2MA 5HWJA 3TTEA 2EPNA 2TYSA 2F9RA 4GI6A 1FWFC 2ZWYA 2WNZA 5FF0A 3MJYA 3DHUA 3O15A 3W2NA 1K7FA 4QJ3B 4HD5A 1WA3A 3T0TA 2JF7A 3BTNA 3HFYA 3PTDA 4UTJA 3MO4A 2PZ0A 3I4EA 2RHGA 3H12A 4GZIA 1XKYA 2J24A 4Z2GA 1JUBA 1JYNA 4QAWA 1EHAA 3KXQA 3OODA 1H41A 4DZHA 1K1DA 1ZJAA 3IIPA 4AF0B 3GTHA 1XLEA 1W54A 2DZPA 1A3WA 2NUYA 3CB3A 5KTLA 2WPBA 1MUCA 1IR1A 1MW2A 1FKXA 1PTDA 5AC6A 3N9KA 3T81A 1O5RA 4JY8A 4AZHA 2XVKA 1UOKA 2XSBA 3WK0A 3ZWTA 4M82A 3G6MA 3QHMA 4FSAA 2WLYA 4ZOCA 5LIKX 3BOLA 4ZQRA 1AZ2A 2QXWA 2BX7A 3TYAA 3ARXA 3UPWA 2ZRYA 2XVGA 3K1DA 1KGXA 3LHTA 2J7EA 3G1VA 3STGA 4UQDA 4JQ3A 5EMKA 4GBUA 3E2SA 3RLHA 2D2JA 3AISA 2CWNA 2YJQA 1IT0A 1JL8A 1NELA 1XCXA 3VD4A 4H9VA 2PDNA 3JVAA 4PMJA 2ZICA 3AHVA 4XO7A 3SCNA 4B5SA 3LERA 1XR2A 3ZWSA 3F4DA 4PTNA 3L65A 3MO7A 2YW4A 1QNOA 3LPOA 1CGTA 3BLDA 4S3DA 1OX5A 1IV8A 3RJYA 4U31A 1HIZA 1S2WA 4XD5A 3C0JA 3N2BA 4OIFA