3CUJA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylopentaose.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords Exo-beta-1,4-glucanase
total genus 131
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cujA00
1QHPA 1J0KA 3SCPA 1FOBA 3ECQA 2VCCA 2W4XA 3WNKA 1WKYA 3OGVA 4CD6A 3NUKA 4NSBA 1H5VA 2C8NA 3A3HA 1E4MM 1H11A 1A47A 3F4VA 1VENA 3MMUA 1VF8A 5BYWA 1V0LA 3CHEA 4AZ7A 1QOXA 4JHOA 1E70M 1CIUA 1RPKA 3WQVA 2WZHA 5E09A 4JFUA 3CZ8A 1K9FA 3VNYA 4P8WA 4LYQA 1H4PA 4AZ6A 3SURA 2ZUVA 2EPNA 2WBKA 1C8XA 3AHYA 4CN6A 3NIYA 2PWEA 5D9PA 1B3YA 3A4WA 4PBGA 3WIJA 4B3KA 4FLSA 1J0YA 1CGUA 3DC0A 1HJQA 3VIJA 4MNLA 1TVPA 1JD9A 1KR0A 3F5LA 2FGZA 4WJXA 1VB9A 3WD4A 3ZT5A 1GQKA 4KRTA 1UHVA 2VI0A 3CHCA 4V27A 1DWHM 1LQ0A 2PF0A 4P7QA 4PRWA 1E6QM 5JBDA 4JKKA 3RJYA 1PZ3A 4MDOA 4DM1A 1VEMA 3AZRA 4PEEA 3RIKA 3WMSA 1C7SA 4JZ5A 3VVGA 1YQ2A 2XVPA 1M04A 2OSXA 3IANA 4AEEA 4D6CA 3BSHA 1ITXA 3CZEA 4AIOA 1QNRA 4W84A 1V3HA 3L4ZA 3CBWA 4BQ2A 3MMDA 3KL5A 1P6WA 2XVNA 3MV11 1UUQA 4ZE5A 3S2CA 4IPNB 1MXGA 1WDSA 4C7DA 3WUFA 3EMZA 1W1PA 1K6AA 1V02A 1ZU8A 3MKKA 4PTWA 4TVDA 2WLYA 1UZ1A 4RE2A 1ISVA 2WCSA 2YDRA 4FF5A 4D6GA 5BXTA 3OBAA 3PZIA 1HJWA 1NWSA 1GUVA 4J7RA 4GKLA 3N15A 2YBUA 3POCA 1F4HA 4U3AA 5JBFA 1C91A 3U5UA 3N13A 3BC9A 4M82A 3TOPA 1OB0A 2WHLA 1EO7A 1NWRA 1E6SM 2ZUTA 4Z2JA 2G4FA 1VFUA 2VZOA 2TAAA 2ZXQA 4UQDA 2ZUWA 2OSWA 1G9HA 2VR4A 1R7AA 5CQ1A 4BQ4A 2XVKA 3DHPA 3BMWA 4XV0A 3WF1A 2W62A 2W5FA 4CU7A 3UR7A 2DPEA 2J7BA 4UFHA 4WK9A 3MUY1 2XGBA 2VRJA 3BAJA 2VOTA 1TCMA 2HVMA 3N17A 1GHSA 3VGDA 1UWRA 3DYOA 3KE0A 1R7OA 4PMOA 4UFLA 3WMBA 1E6RA 1BVNP 1E6PA 1JYWA 3M7SA 1UD6A 6A3HA 2IUZA 4JIEA 2EBNA 3MSDA 2WMKA 3T09A 1EQPA 5AC5A 4CD8A 3AQUA 4JAWA 3GXDA 2XFYA 1OBAA 2A3CA 5HOSA 2G41A 4BA0A 2DSZA 4XZBA 1HKJA 1I75A 3ARPA 2O9PA 3WDQA 3BMVA 3T0BA 3TTOA 2GDVA 1HP5A 5D8ZA 4J3SA 1XYFA 1QPKA 2X05A 1V03A 4QCEA 3ZJKA 1TMQA 1N82A 1E9LA 1FHDA 2VTFA 5D4YA 3GDBA 3UG5A 1WB0A 3PZUA 4UFMA 3K1DA 3GNOA 4AD4A 1UKOA 1B2YA 2YA1A 5FCZA 4C7FA 4M29A 2VJXA 2J7EA 4LYRA 1IZJA 1D2KA 4L4OA 1V0MA 4H8VA 4FLRA 3VGEA 3AYSA 4TX6A 4HU8A 4BS0A 4U2ZA 1B3VA 4AIUA 1XRVA 1CNVA 4UOJA 1VJSA 1J9YA 1RP8A 1UH4A 3M46A 1IV8A 3AS3A 4P8XA 4OBSA 2QF8A 2FHFA 1KBKA 2VZVA 2W61A 1TE1A 3BAIA 4P8UA 3ZOAA 4V28A 2JFEX 1XV8A 3AIRA 4UCFA 5EFFA 4ATLA 1XCWA 1W1TA 4B9ZA 1Q6GA 2VVSA 3WUBA 4J3WA 4GINA 1J0ZA 2DSWA 1UR0A 2XIBA 4GPNA 3VD4A 2DIJA 2IXUA 2EJ1A 3VGBA 3BLPX 1AQHA 3GXFA 3WNPA 1E56A 3N12A 3WEOA 4EAMA 1ESWA 4AMCA 2QMKA 2J47A 2XFFA 1JAKA 3SCNA 1UWSA 4D6DA 4J3UA 1V3KA 1UD3A 3NSMA 4U5KA 5I24A 5GPRA 3BXWA 5ABFA 1HVQA 1FH9A 2OWWA 5E6YA 4D6HA 2JALA 5HXMA 4M24A 1PJ9A 1GPFA 4YN5A 3ZQ9A 1C90A 4AZHA 3SCSA 1JZ2A 1WDRA 1NWTA 5AYBA 4BCEA 1BPLB 2BY0A 2D0GA 3LPPA 1G5AA 2ZX6A 4DUXA 4J3VA 1HJXA 2BXYA 4PTVA 3OLIA 2V3GA 1KBBA 1D7FA 4PCTA 5CG0A 3VIHA 1CXLA 5JIPA 1FH7A 4HA3A 2X09A 1BFNA 4S3JA 1GJWA 1QNOA 1CTNA 1VBRA 2D24A 4GO9A 2J7CA 1K9TA 1H0GA 8CGTA 4PMDA 4HZ7A 4F9DA 1SMAA 3BAYA 1KR1A 4GO8A 2VZUA 3WQ5A 3T08A 2ZUSA 4YHEA 3DECA 1QNSA 4P8VA 4WSKA 3CZGA 3AIEA 2WSPA 4CCCA 4AZ5A 1L8NA 2J8FA 2XWDA 2WANA 1J18A 3PHAA 2XM2A 4XX6A 3W81A 4ATWA 1NWUA 1OGGA 4W89A 5LA2A 3J7HA 4IUGA 2WMIB 2VX7A 2CEQA 2GJXA 5I5RA 5A6MA 1HF6A 3ZT7A 3AZTA 3SUWA 7TAAA 4WLCA 2EO7A 1H49A 1UKTA 3WH6A 3G6MA 1W91A 1CDGA 4HMCA 4GI9A 1GNXA 1MW2A 2VZSA 3GH4A 1BVZA 3SCVA 3SCQA 1IT0A 4ZENA 4TTGA 1X6LA 2WAGA 4D1IA 3U7BA 3PZMA 1W9PA 1F4AA 1R8LA 5ABGA 3OZPA 4TOQA 3ZJ7A 5FKYA 2PWHA 2VCAA 2V3DA 1FP9A 3BAXA 4AD3A 2ESCA 1YHTA 4HPGA 4E8CA 2BS9A 1DHKA 3WY1A 2VL4A 3AROA 1EH9A 3WEZA 1JD7A 3T0AA 1IZKA 3VILA 1J10A 1EHNA 4OKDA 5EBAA 1GORA 3VGFA 2OWCA 3CMGA 1OWQA 5GQBA 1GJUA 3ZM8A 2X1IA 3PZNA 1V0NA 4GZIA 2FDMA 1OSEA 4GI8A 3NYDA 1ZBWA 2ZWYA 3RDKA 1PX3A 4J28A 1QI0A 3EDDA 3ARRA 1DWFM 4X9YA 1HL9A 1WAWA 5E9AA 4KH2A 2WC3A 4ZEPA 2UY3A 2VRQA 3PTQA 4R5EA 2IXVA 3PZOA 1V6VA 1XC6A 4ML4A 2XWEA 3THDA 3THCA 5CJ5A 2X8RA 2ZUNA 1CXEA 4AZCB 1B3ZA 5AY7A 4PMUA 2GK1B 2PWDA 3L4WA 4KWUA 1WZKA 2RGLA 4QDMA 3SUUA 4Z2KA 2WKLA 3PZ9A 4D71A 3N04A 4UR9A 2WPGA 3QHMA 4W85A 1H41A 1W9XA 3WN6A 4H2CA 4UOQA 2G3MA 1NQ6A 3ARQA 1CXIA 3W4RA 3VX1A 3WENA 4MB4A 1M03A 1B3XA 5M5DA 3FXYA 3O6AA 4ZXLA 1ZBCA 4ACYA 1CZ1A 1Q6EA 2ZWZA 1UD4A 2JF6A 4P7RA 1KCKA 2XPKA 2ZE0A 3FW6A 1JZ5A 2Z1SA 4UFJA 3WNLA 4OUEA 4D6JA 4UQ9A 4UQCA 1UKPA 1XD0A 5CPTA 4PMYA 1DWAM 3AIQA 4DWSA 5AC4A 3E1F1 4XZWA 1E1EA 1DWIM 1XHGA 2MANA 4UOZA 4A3YA 2XUCA 1G1YA 2NSXA 3AMGA 1QHOA 2XYLA 1JDAA 3AMCA 3L4YA 1GOWA 2O92A 2WMJA 1HKKA 3SCOA 3ARYA 2WNWA 4HP5A 4QAWA 1D3CA 2DGAA 2DH3A 1CPUA 3UESA 1UKSA 1JZ8A 1RP9A 2YIHA 2VMFA 3VGGA 2B31A 3DYPA 3AYRA 1VEPA 2XVLA 1E5NA 1WZLA 2W91A 3OLGA 1JAEA 3PZTA 4D6IA 2VX5A 2CBVA 2A3EA 1DTUA 3IAQA 2J75A 1J12A 4AZBA 1LL7A 1BSIA 1CGWA 3I3BA 1ZL1A 4UQEA 4PMXA 3AZSA 2JIEA 5A8OA 3A4AA 1ODZA 3WH9A 4BQ5A 3MV01 4M8UA 2BVYA 2YLAA 4PUEA 3EMQA 4E8DA 4CUCA 1ISXA 4JKLA 4OBRA 4EKJA 3B9EA 1VFMA 1UD5A 4P7LA 5DMYA 2VUYA 2PC8A 4IPLA 2BVTA 1H0IA 2X2YA 2V5CA 2F61A 3N9KA 5A8MA 2D20A 3M07A 4WKAA 2WZEA 2D3LA 1KGWA 1B90A 3WQ8A 1BG9A 1UKQA 2WC4A 1DEDA 2O9RA 2WMHA 1PEZA 2D23A 1U2YA 3AXIA 2DT3A 3CMJA 3PTMA 1VEOA 1NM9A 3AJ7A 2E4TA 1NOWA 4HMEA 4J3TA 2A3AA 3KL3A 2FGLA 1XCXA 2NT0A 4LGXA 2E8YA 2W92A 5CXPA 4U31A 1E4NA 1E0VA 1U30A 1O6IA 3VIFA 2CETA 5DEZA 2DT1A 1W2PA 5IDIA 1CBGA 4AWEA 3A4XA 4XUYA 2OYKA 1DWGM 1HT6A 2E40A 2WVVA 3CUHA 3ZT6A 2ZXAA 4CN4A 4MB3A 1QBBA 3NCOA 3CO4A 4LX4A 5KZ6A 3KL0A 3RCNA 2E8ZA 1E4LA 3WL0A 3ZR6A 3MSGA 4CKQA 2QLYA 3VMOA 3ZO9A 2XJ7A 3BSGA 1PAMA 1JFHA 3VUPA 1VIWA 1WDPA 4AEFA 1RD6A 3RPMA 1JI1A 3QR3A 2CBUA 1CXHA 3IJ8A 3UCQA 3WD3A 4AD5A 4W8AA 3WF4A 5LA0A 3PZGA 1KWKA 1QVBA 1UOKA 3ARTA 5A6LA 1PIGA 2V5DA 4MADA 1Q4NX 1GW1A 2WVTA 4KMQA 3WUGA 3MUZ1 1SYTA 2EXOA 3AMKA 4EE9A 2VRKA 4ACZB 4EANA 3W38A 1SMDA 4FMVA 1B9ZA 2QHAA 3W53A 3VKKA 1SFSA 4RL3A 1WO2A 1GVYA 1UQYA 1CGYA 3EDFA 5D9MA 3VOCA 5HPOA 3K4AA 1C8YA 5A69A 2JIWA 5A95A 2XSAA 1B31A 4CVWA 5HBFA 4PSRA 1FFRA 1LL4A 4RE3A 3WD2A 1C7TA 1MW1A 2JF7A 1KXHA 1Y7VA 1AQ0A 5CSUA 3WDIA 4PMNA 3CGTA 5HNNA 4B9YA 2BV9A 2J7GA 4JL1A 1E6XM 4U3CA 2NT1A 1W3JA 1E73M 1SR0A 3WL1A 3CUFA 4UFKA 5A2AA 3IK2A 5JBEA 3TTQA 1V08A 3WNMA 1BQCA 5AYIA 1US2A 4W88A 1BHGA 5A6BD 3L4UA 4WF7A 4M1RA 2XM1A 3N11A 4JFVA 2D1ZA 3VU2A 3F5JA 3RM8A 1J01A 5BXSA 2GJPA 5ABEA 2WW5A 4IISA 5M3WA 1HXJA 2XG9A 3OIHA 3GNRA 3QGVA 3WH8A 1QI2A 1S46A 3VDAA 2CHNA 4W7VA 2D2OA 2CIPA 3GXIA 4DM2A 1G0CA 3OB8A 3WQ6A 5CGMA 2PWFA 1M7XA 1EDGA 2Y2WA 2WCGA 3W25A 4UQBA 2CBIA 1WDQA 3TP4A 3WBAA 5C70A 1H09A 1HNYA 3HN3A 1EDTA 5BCAA 3NJ3A 4HOXA 2V3EA 1JZ6A 1AQMA 3MMWA 1JYXA 1M53A 3BGAA 1NP0A 2UY2A 4JCLA 4UQAA 2D0FA 2E0PA 1UZ4A 3WBEA 2G3IA 5LYRA 3AIVA 1ODUA 1JDDA 4DWSD 3ZJ8A 2YL8A 1G94A 1A3HA 3RM4A 5A3HA 1V3MA 2ZUMA 4HA1A 3HJEA 3WFLA 3VD5A 1WZAA 2XVGA 3U57A 1JZ4A 3AIUA 2AMGA 5A6SA 2W67A 3N18A 5FOOA 3BCFA 3D5HA 1XH0A 3KEHA 5I79A 4JFSA 3ARVA 1JF6A 2J7DA 2YLLA 4WSJA 3FNDA 5E6ZA 1BAGA 3GBDA 2Y4SA 1XH2A 2QMJA 4X0VA 4ACZA 4D1JA 1BYDA 4QFUA 2BY3A 3LPGA 1EGZA 2ZX9A 3PZVA 3AHVA 3MUIA 1H3GA 1PBGA 3ALGA 2BVDA 3OLDA 2BHUA 1UG6A 2D3NA 2BXZA 3CZJA 3ALFA 2DSUA 1W3LA 2PBOA 1BTCA 3CPUA 4LXFA 3WNOA 1BGGA 4TVUA 3GBEA 3WF2A 1LWJA 5I3DA 2WZIA 5CZKA 2YA2A 2VNCA 5E0FA 5I78A 3O2LA 4Q22A 3GYCA 4H7VA 3B8SA 1MQPA 1R86A 1LG2A 1OD0A 2YBTA 1O7AA 2ZOXA 3WDJA 4F8XA 3AOFA 4HTYA 4W87A 1JL8A 3RM9A 2ZXBA 1E5JA 3WDRA 4UTFA 5HPCA 2J8GA 1XYZA 1E4IA 1UA3A 2Y24A 1C8QA 1WZMA 2ZXDA 3L2MA 2EPLX 4B16A 5D9OA 1W3KA 1ZBVA 3VGHA 3VIIA 4KGJA 1OM0A 1H2JA 3ARXA 3BAWA 4UZSA 4ZE4A 5FL1A 1W9UA 2J4GA 2PWGA 5A1AA 1KGUA 2E9LA 4PYSA 3ZJ6A 3FAWA 1W9VA 2V38A 4AZCA 5FD0A 3AS0A 4L4PA 2X0YA 3CH9A 1BYAA 4CVUA 3GM8A 4OJYA 4AZGA 3VIMA 2YKKA 2DH2A 1E3XA 3I3EA 4KGLA 1L0PA 1JNDA 4K68A 2A3HA 1Q6FA 4BQ3A 2G8ZA 3A47A 4PMZA 3HU7A 1CGVA 1CXKA 4A4AA 5A6JA 4RE4A 2WBGA 1EOKA 2OLHA 1Z32X 1MQQA 4MAZA 1W32A 4JFWA 4B15A 3WD0A 4NRSA 2CPUA 3T2PA 4CU8A 2O9TA 3T2OA 2F8QA 1E6ZA 3IJ7A 1XSJA 1TUXA 2WMFA 2VO5A 1XH1A 1JNEA 2WHJA 5BWFA 4TVCA 2D0HA 2RGMA 1QW8A 4UZUA 1NOUA 4DUVA 8A3HA 4MB1A 2YA0A 3UG4A 3WUEA 3TONA 5JUVA 3ZSSA 1V3LA 4S3KA 4C7GA 2DSKA 2CCRA 1JXJA 4AIEA 4Z2LA 1LWHA 2F2HA 2VQUA 3K8KA 2WK2A 2BHYA 5EMYA 3CTTA 3I3DA 1OGSA 2CXGA 1E43A 1UA7A 4AISA 2WCAA 4HOWA 2YOCA 1HKIA 3AIBA 1OCQA 1UWQA 4D6FA 3WH7A 4MJ4A 1JGIA 4MNKA 4HMDA 1UH2A 4PMRA 1Q6CA 1MFUA 1FHLA 1XGZA 2QPSA 1JYVA 4NRRA 1NP2A 2GDUA 3WMCA 4W5ZA 3VD3A 4DUWA 4JL2A 3LPFA 4EK7A 3AXHA 1VAHA 3K8MA 4CD5A 4OZOA 5DT5A 2WHKA 3W82A 3CLWA 9CGTA 3W0KA 4JHZA 2CYGA 1WCGA 3FN9A 1UR9A 4U2YA 3JUGA 3U7VA 2ZUUA 4LPCA 1PX4A 1TZ7A 2DT2A 4U33A 3G6LA 4H8UA 1KQYA 5IHSA 1CEOA 1BLIA 3GNPA 1HX0A 3SUSA 2AOSA 1BYBA 3RJXA 1NARA 2WWDA 2J25A 4DWSC 1V3IA 3U5YA 3VD9A 4Z2HA 3W37A 4TTUA 1UWUA 1E0XA 4AW7A 4AZIA 1GQLA 1JFXA 1MQRA 4Q7NA 3WH5A 1V6XA 5CLTA 3SIMA 1B1YA 4JCMA 4ZFMA 3MS8A 1BYCA 1NH6A 1ZB5A 1RH9A 3L4VA 2YL5A 3NSNA 6CGTA 1HP4A 3APGA 2OYMA 1LG1A 1V6WA 4GI6A 1UH3A 4NI3A 2C7FA 4GIAA 1TA3A 4QLJA 1OGBA 1UR2A 2VX6A 4HU0A 4F79A 3MO4A 3VIGA 2CBJA 2PI6A 4ATDA 2VC9A 2ZICA 3SCTA 1AMYA 4CGTA 3GH5A 2DSVA 2XHYA 4M80A 2QV4A 2WC7A 4CCDA 4GXPA 1LL6A 1J0JA 1EO5A 5I23A 4NF7A 1GQJA 5EFDA 5GNYA 3WD1A 4HOZA 3VD7A 2FHCA 1GVIA 2CERA 3WF0A 2DT0A 3AI0A 3VDHA 1CLVA 2JE8A 3SCRA 1V02E 2BY1A 2FH8A 2WVUA 1MXDA 3VX0A 3S6TA 5A8PA 2GVYA 2GK1A 3EBVA 4KRUA 4H41A 5ECUA 3FHAA 2OYLA 2PBGA 3OGRA 2C0HA 3ZSTA 1EHAA 1CECA 2VZTA 2X0HA 1UD2A 3W6MA 4N42A 3SUTA 5D8WA 2CKRA 1U33A 1X6NA 3NDZA 1HKMA 4N0RA 2DQXA 1PZ2A 2WYSA 2YJQA 4BF7A 2CNCA 3SEPA 2DDXA 5E0CA 3OGSA 1W1VA 1HIZA 2AAAA 3L2LA 1HJSA 1V0KA 1JDCA 3AFBA 4DWSB 3EDJA 4BZYA 3UERA 3PTKA 3F5KA 1LJYA 3RILA 3GXMA 1UR1A 1GOKA 3VDBA 4GQQA 3MUAA 1K9EA 4PSPA 3NDYA 1GCYA 2WLZA 5ABFB 1KGXA 2WXDM 1C3FA 1GOMA 2BFGA 2ZX8A 2XTKA 4B3LA 1JZ7A 2CHOA 1Q6DA 1ECEA 1UQZA 1J0HA 2V3FA 4WIWA 3M6DA 1QNPA 2YL6A 2NW0A 1J0IA 1QNQA 1MYRA 3WQ4A 3AHXA 1W9BM 4PCSA 4MAVA 4GQRA 1ISYA 2J74A 3QHNA 2EPMX 1R85A 1EDQA 1GOOA 2WMGA 2FH6A 1EIBA 4FLOA 1DWJM 3EDKA 3AXXA 3B9AA 5FIPA 4H8HA 5E70A 1JG9A 3OLEA 5M17A 1HVXA 4LYPA 3AMDA 4GZJA 1VRXA 4Z2IA 2WVSA 1LLOA 3T0DA 5BRQA 1E40A 1I1WA 3MU7A 1LF1A 1TR1A 4J3XA 5BRPA 2WWCA 1MWOA 3HMCA 3IJ9A 1ITCA 3L4TA 4MPKA 1C92A 2XIIA 4AXNA 4CN1A 3UG3A 5A2CA 3WQWA 5HDRA 1HJVA 5A6KA 6TAAA 1ZBKA 3DYMA 3SCWA 3WKZA 2QPUA 2E9BA 1WP6A 5GNZA 2G3NA 1PX8A 1CLXA 3EYPA 1GONA 1US3A 5C71A 1EXPA 3AS1A 1E1FA 1I1XA 3PN8A 2EPOA 3A6OA 1EQCA 3ARZA 2OSYA 2VVNA 4W7UA 1E72M 2JEPA 3OA5A 4XB3A 2XFRA 4OOZA 3VM5A 5I2UA 2VQTA 3W24A 5C8BB 1M01A 3AHZA 1CYGA 2G3JA 2WKGA 4HZ8A 1TVNA 3DHUA 1OINA 5KEZA 3W29A 4AD1A 3FY1A 3GH7A 4ZXOA 1X1NA 4HPHA 1MW0A 2Q8XA 1EA9C 3TTSA 5A6BA 5A8NA 4AD0A 3ZR5A 4URIA 3WNNA 2JEQA 5GNXA 5BROA 1XSIA 4W8BA 2GSJA 4JKMA 4UFIA 1ZS2A 3AISA 1QW9A 1QHZA 4WKHA 2WVVB 5I0DA 1QI4A 3CZKA 3ARWA 2A3BA 5IXEA 3SUVA 3CIVA 3IAPA 3K4DA 1KXQA 1B0IA 3AMLA 3KWXA 3N1AA 2O9OA 2CESA 2E9MA 3K8LA 5ABHA 3GZAA 3FAXA 1GHRA 1VFFA 4PTXA 1CXFA 1E0WA 1W2VA 1W3HA 1G01A 2GJRA 2WSKA 5TD4A 1GOIA 7A3HA 4TX8A 4X0NA 1B3WA 1UR4A 3VO0A 3CHDA 4FK9A 1JYNA 4TUFA 1AVAA 1MVYA 4CU6A 1B30A 1OD8A 2Y8KA 1FH8A 5D9NA 5CLWA 1OIFA 4AYSA 1ISWA 5DT7A 3VMPA 3WELA 4W86A 5IFPA 1OT2A 1JIBA 2J7HA 1JI2A 1W9DM 3BLKA 1FP8A 3VIKA 1EOMA 5FL0A 2EQDA 1QI5A 2EEXA 4AD2A 4P7NA 1VFOA 4E4PA 2OWXA 2WMIA 1KXVA 4F66A 1TFVA 3LMYA 3O9NA 4QCFA 3NSXA 5I77A 5BXRA 4W93A 4MTVA 3GTNA 1WE5A 5A8QA 5CPSA 2UY4A 1UYQA 1UWTA 4MNMA 4JFTA 4OOUA 3BH4A 4FLQA 3WDHA 3VTRA 4P7OA 4IM4A 1GOQA 3D3AA 4QLLA 3PBGA 1OIMA 3TTYA 1QI3A 2CITA 3AICA 1MW3A 4GZEA 3VNZA 2UWFA 4HA4A 5DF0A 4J27A 5A94A 5A6AA 3ZMRA 4WKFA 4M81A 1CWYA 1QBAA 3UETA 2WB5A 4R27A 2UY5A 3WF3A 4AY1A 4A3HA 1JXKA 1OT1A 5JIWA 2XGIA 2VR5A 3RMEA 1FA2A 3VIOA 3B9DA 3UEQA 4E2OA 4TXEA 1E15A 5DFAA 4MDPA 4CCEA 4UNIA 4MNJA 5CSYA 3ARUA 3CUGA 5A2BA 2PB1A 3VINA 3AS2A 3AHTA 3KZSA 1PIFA 2Z1KA 2E3ZA 1XSKA 4Y7EA 2CKSA 1VJZA 2ZX7A 5EB8A 3VIPA 3WFZA 4YPJA 1HN1A 3PZQA 1CGTA 2BY2A 1W1YA 2ZIDA 3ZIZA 4QLKA 1KXTA 3FHQA 2WM0A 5I6SA 1TA3B 4Z2GA 5LA1A 3QOMA 4U5IA 2XSBA 2FHBA 4W8LA 3VPLA 3RO8A 4CD7A 1KWGA 5DO8A 7CGTA 1E6NA 1PPIA 4M56A 3TA9A 1UWIA 1E3ZA 2BHZA 2Y8VA 1C93A 1GQIA 3W27A 4PN2A 4CD4A 2D22A 1HL8A 1BG4A 4PUDA 1V3JA 3QHOA 4NZCA 3BCDA 2GFTA 2J77A 3T2QA 2W66A 3CUJA 3LPOA 1JF5A 5CGTA 1ZJBA 2VT0A 2YDQA 3W6LA 3WEMA 1K9DA 4PMVA 4PTMA 2W63A 1V6UA 3L4XA 2J62A 4YHGA 1KB3A 3VM7A 2ZX5A 3II1A 4F9JA 2Y5EA 2J7FA 4D6EA 3W26A 1E71M 1DP0A 2WHMA 3CHFA 3CZLA 1BGAA 4W7WA 3AIWA 1VBUA 1UR8A 2DEPA 5IHRA 4PMQA 4H04A 3K46A 2J78A 4D72A 3W28A 1TG7A 3EDEA 5M03A 1KFWA 3POHA 2J79A 4MB5A 3VDCA 1GZJA 3BAKA 5BXPA 3MANA 1HJUA 3ARSA 4MJ2A 2GJXB 1MFVA 2YDSA 2EPKX 1WPCA 4AC1X 4QP0A 3UR8A 1ZJAA 4V2XA 2VURA 3OG2A 2VX4A 2BNJA 2YL9A 1R87A 1FFQA 4HZ6A 3WDPP 1KCLA 1NOFA 2GUYA 3SCUA 1CENA 2HISA 3OZOA 1J11A 1BF2A 3QOKA 3VMNA 1JZ3A 1XD1A 1UD8A 2DIEA 3WSUA 1H1NA 5F7UA 5CPQA 1ISZA 4W5UA 3CUIA 3EMCA 1V6YA 1CGXA 2VCBA 1WNOA 1KQZA 4LQ1A 1E55A 4OIFA 5IFTA
chains in the Genus database with same CATH superfamily
2VGBA 1Z7AA 5REQA 3ECQA 3S5YA 5MHBA 1RSCA 2W4XA 3QXBA 1MO0A 2GJNA 2ACRA 3PC0A 3LLDA 2YCEA 2GVJA 3M0IA 1H5VA 2IMRA 3QZAA 2ZADA 3P74A 1A47A 4QBXA 5CPNA 1VENA 2I5QA 3NEVA 4QQUA 1QPOA 5LGZA 3P60A 1VF8A 3QGKC 5BYWA 4M6PA 4HHLA 4NX5A 1KLZA 1L6WA 2WZHA 4ERGA 1FCUA 2PDGA 4JFUA 3CZ8A 1K9FA 4ZL1A 4P8WA 1H4PA 3SURA 2WBKA 5AZ1A 3NIYA 2PWEA 3M5XA 2Q3OA 3A4WA 4PBGA 3WIJA 4B3KA 1CGUA 2MNRA 2DZSA 4MNLA 1KR0A 3F5LA 4IMAA 3WLQA 1VB9A 3M64A 4Q8VA 3HTWA 4Q8UA 1LRQA 2CLIA 3WMLA 4V27A 1FQ0A 3R10A 2HV5A 4EIVA 4B2DA 1EKOA 4DF0A 1R9YA 4LOCA 3NPUA 4DM1A 4S3CA 4O19A 3PJUA 5KETA 3RIKA 1I0DA 4ZQRA 2DW6A 1NAL1 3SR7A 3RFAA 3W88A 2B7PA 3TTEA 4B5SA 2OSXA 3GWQA 3IANA 2HNHA 2KAUC 3FV9A 1XLJA 3TW9A 1XWYA 4RZ4A 3BVJA 2EGZA 1ADDA 1V3HA 4BQ2A 5DCEA 1J2WA 4LS0A 5IBXC 4ZE5A 3W00A 5B7YA 1MXGA 2FTYA 2Y7FA 4PUMA 1UIOA 2A7NA 4MUPA 3EMZA 1W1PA 1NQKA 2Z24A 2BASA 1UZHA 3RCMA 3NA8A 3GXTA 4Q6JA 4KF1A 4X3ZA 4ORIA 1FY6A 1A3WA 2JGYA 4GKLA 1RY0A 3KXQA 3NXLA 4H9XA 4U3AA 4JDYA 2XH0A 1C91A 1OYAA 3PBWA 3U5UA 1OB0A 2WHLA 1Y8BA 3LB0A 5KZDA 2ZUTA 3GVRA 3YPIA 1JPDX 2PODA 4V1XA 3UXIA 2TAAA 2ZXQA 3KOWA 3I4KA 2DZVA 2ZUWA 4D9PA 1JRCA 1R7AA 3ZZ1A 1TJ1A 3AUJA 1RCOB 4BQ4A 2XVKA 4H9VA 1DVJA 3W1LA 5DCBA 4GYPA 1OZMA 3UR7A 5E9XA 3NPWA 2FB2A 5H8UA 4PFHA 3NZRA 1X1ZA 3WJXA 3A5FA 3C61A 5EA9A 3BAJA 1TCMA 4QROA 2HVMA 3N17A 3VGDA 3DYOA 3MDUA 4PMOA 4UFLA 4MY9A 1KFCA 1NY1A 2EBNA 3MSDA 2WMKA 3LCIA 1Q5MA 2F9RA 1WDWA 4PEKA 5C9WA 3E02A 3LXAA 1V77A 3CU2A 3K30A 2G41A 1PV8A 4BA0A 4GC3A 3T07A 3DESA 1PDZA 3CMFA 4XZBA 1I75A 4DO7A 3MZNA 3UWEA 1Q2RA 3BMVA 3T0BA 2GDVA 4DZ5A 1XYFA 3IV3A 3W1NA 3ZJKA 4N4QA 1SO4A 4WZHA 5D4YA 3GDBA 4M6UA 5BNKA 4DYEA 1KNWA 4DUOA 5G1YA 3GNOA 1GK8A 2RAGA 4LAZA 4B5XA 2YA1A 1H7XA 4LU0A 4C7FA 1D2KA 1LUCA 4Z0SA 1AL7A 2VC7A 4FLRA 3GVQA 3STEA 4BS0A 4GIRA 3UWQA 3RN6A 2VEFA 4AIUA 1XRVA 3VA8A 1GGOA 3APTA 1RP8A 1US0A 3O0FA 3V1PA 3M46A 1IV8A 3AS3A 3MY9A 4P8XA 5JVLA 3BAIA 4P8UA 4L6OA 4L5ZA 4I5RA 4IL0A 3AIRA 1Q85A 3WK3A 2PLKA 1Q6GA 1JQVA 1RALA 3QTPA 3WUBA 4GINA 2J27A 1J0ZA 4UCGA 2PE4A 3LCHA 2XIBA 3WCZA 4L9XA 2DIJA 1EP3A 3ABZA 3BLPX 2RDUA 4GQGA 3WEOA 2IPWA 3OZYA 1XFBA 2V63A 3L9CA 4AMCA 4BI5A 2QT3A 4NQ1A 4F40A 2OEJA 3FOKA 4O10A 3ANVA 2PU1A 4DJDA 4J3UA 4S1FA 1UD3A 5AKQA 5I24A 5F2IA 7REQA 1KM3A 3M0VA 5XINA 4GVIA 5HXMA 1IEWA 1RHCA 2JKPA 4XZLX 3ZQ9A 1WDRA 1K8XA 4EF8A 3U3HA 4XKMA 4FAMA 4ADSA 1TPVA 1SW7A 3LGGA 2IPGA 3G77A 5K9CA 2GYIA 3P3BA 1KBBA 1VHNA 4XD4A 3UZYA 3UNDA 1U5JA 4S2CA 1R2RA 3EB3A 1GJWA 4PULA 3DH7A 1M7OA 3W84A 2PP0A 2PDNA 4GWEA 4MOZA 1K9TA 1H0GA 2I5GA 1JPHA 2PUZA 4O16A 1VFSA 3MA8A 1SMAA 4L61A 3BAYA 3LG3A 4GO8A 5I3KA 1O5RA 4XD3A 1QNSA 4O0ZA 2GSHA 2F7FA 5FJUA 4E0CA 4C91A 4AZ5A 3TJIA 3HJZA 4ZBCA 1DV7A 4HD5A 3W7GA 3J7HA 4IUGA 4O8AA 3PB2A 3O6YX 1T40A 3NL5A 2CEQA 1KRCC 5AFDA 3ATYA 1HF6A 1F9CA 4JQ1A 3AZTA 7TAAA 3TV8A 4WLCA 1H49A 1UKTA 1W91A 3RPTA 4GI9A 3EOUA 3W75A 1Q7ZA 3K13A 5ABTA 5K3VA 4ZENA 4RZBA 4M7SA 3V5CA 1TWDA 1EGMA 3HIJA 4WY0A 4D1IA 3U7BA 3G1AA 3C0LA 3PZMA 1W9PA 2VFIA 3PFMA 4PE8A 2B7OA 2VCAA 1T99A 3URAA 3GS6A 4XZ9A 1SO3A 4IHCA 4LEFA 5BOFA 1VJIA 4B91A 2BS9A 1DHKA 2VL4A 1F7BA 3AROA 3NL6A 1JD7A 1SPQA 4HNCA 3T0AA 3VILA 3ZFHA 3A5VA 4OKDA 3QQ0A 2R1LA 4TU1A 1N8FA 3C0SA 2AGTA 4A8LA 1L6SA 2X1IA 2Y6ZA 4R9XA 3SADA 2Z26A 4Q3MA 1AH0A 3ZWSA 3DUGA 2PFHA 2GQ9A 1QI0A 1HL2A 3NQDA 1EP1A 1DJQA 1HL9A 2HMCA 4C1KA 3TSMA 4ZEPA 1SFLA 3IJDA 2D69A 4IQDA 1V6VA 1TWIA 5LNUA 4ML4A 2XWEA 4Q8NA 3GVWA 3THDA 4KKXA 5I3JA 3QPYA 2X8RA 3UPWA 1AW5A 1DQXA 3IV8A 3N3TA 3P5YA 4QDMA 4Z2KA 3PZ9A 1LBMA 1PL9A 4GCXA 1XIJA 3QHMA 3NQ7A 1H41A 1IXPA 1W9XA 2PCQA 3WN6A 3EAUA 3KHJA 4UOQA 3CL6A 2V67A 4B4FA 2G3MA 1D3HA 3W1XA 4GH1A 4MB4A 1M03A 3ABSA 3O6AA 1I6NA 3TE9A 1TV4A 2JF6A 3IGXA 2PLJA 4INFA 2E6AA 2JQXA 2G5WA 4UFJA 3CQKA 1HGWA 4D6JA 4E2VA 4TO8A 1XD0A 1A5MC 1TPUA 5AC4A 3WBXA 3TLQA 1DWIM 3BW4A 1XHGA 4UOZA 3RLUA 1XISA 1YADA 1I0BA 2CLMA 1MEHA 3AMCA 2J6VA 2WMJA 1ZJHA 4S3AA 2HWGA 3U2OA 4O11A 2WNWA 4HP5A 2NQ5A 2PAJA 2DH3A 3THAA 1CPUA 5CZTA 3UESA 2NVDA 4PA8A 3R79A 4AYGA 1RP9A 3SSJA 4LF1A 2YIHA 3W70A 4Z42C 3L23A 2B31A 1DJIA 1IXOA 2P0OA 4HMNA 1D9EA 2J88A 3OLGA 3SM0A 1JAEA 1FWEC 4FXFA 5T8GA 2A3EA 2O0TA 1J12A 4L4LA 1BSIA 4PMXA 3DFTA 1IEXA 3HV8A 3ZYZA 5CC3A 1AJ2A 2FMNA 4DIAA 1MUMA 4E8DA 1YE4A 3ZVHA 4OBRA 3U2EA 1H7OA 5DMYA 2VUYA 3H7UA 3NQ6A 4H01A 1RJRA 3CO8A 5FACA 2ZKMX 5H6HA 1WKFA 1DJWA 5A8MA 2F61A 4GBDA 1XDJA 2FZDA 4ROPA 4RXFA 2WZEA 2PGRA 4FZIA 4H9UA 3WQ8A 1QFEA 3H7VA 2WC4A 1DEDA 1F3WA 5CSSA 4Y9MA 1PEZA 1YEYA 1SM9A 1VEOA 3W2UA 1IWAA 4HT3A 1ZTVA 3M0HA 4IICA 4LBRA 3DC8A 1NM9A 5I00A 4HMEA 1NEYA 2A3AA 3KL3A 3GU9A 1QCWA 2X16A 4S3DA 4U31A 1JUEA 1XCFA 1O6IA 1W2PA 1Z89A 2PSNA 4LAMA 5IDIA 2INZA 2CLLA 3NOYA 3FA4A 1OFDA 1XBZA 1UBSA 3A4XA 2OYKA 3MW7A 2E40A 3SO7A 1U5VA 2ZXAA 3IUDA 3ZXWA 3HGSA 5L9FA 3CO4A 2XDFA 1PO9A 4Q4RA 1OYCA 1WDDA 3KL0A 3TU9A 3LQLA 4HYRA 4DI8A 4L64A 1UUOA 1SJAA 2HJPA 3BLOA 4DBUA 4YWIA 3REQB 3DFPA 5SWUA 3VMOA 3BSGA 4C1NB 2EF9A 3A3WA 4ZB2A 4N9DA 1L6GA 3MP3A 4MY1A 3GC5A 2CBUA 3V5OA 4GCAA 3IJ8A 3UCQA 3WD3A 3E2QA 1ZUAX 4C65A 1PHQA 3W6YA 5JQ9A 2O7SA 3Q45A 1UPPA 3BJSA 3CB8A 3URBA 1GW1A 4IXXA 4KMQA 1FXQA 3RMJA 3B9OA 3W38A 3BOLA 4FMVA 1KRBC 2QHAA 3W53A 3KCOA 2VEIA 2DZXA 3VOJA 3LSCA 6TIMA 2OO0A 2HEJA 3W2LA 1X7IA 4DY1A 3VOFA 1B31A 5HBFA 4PSRA 4S38A 2JF7A 4GUHA 2QCMA 2RDXA 4WR3A 2HE5A 4PMNA 5HNNA 1W5PA 2BV9A 4ROQA 3UCDA 4PL1A 3MYPA 4U3CA 4JIIX 1REQB 3KLLA 3M7WA 5A2AA 3RLVA 2FVMA 2HPIA 1BQCA 2R9RA 4W88A 4A8IA 3S5ZA 1EC8A 3M1ZA 1O5XA 3N11A 3F5JA 3G0UA 5DY3A 1I45A 4HN8A 2BOFX 5M3WA 1Y5WA 1ZCOA 1QI2A 1S46A 3VDAA 3E0FA 1F3EA 1JRBA 3BW2A 1ZFJA 3B8WA 2ZZ2A 1Y5VA 2PDIA 1EL3A 1M7XA 2WCGA 1QW7A 3PBYA 2YSWA 2HBVA 3WBAA 3W23A 1EDTA 1T8XA 3NJ3A 2V3EA 1AQMA 3LUTA 1UUMA 4IIHA 2E6FA 3BGAA 1NP0A 4HB7A 1TMLA 3WBEA 2G3IA 2QCGA 1ODUA 2HROA 3FA5A 5I09A 2PMQA 4UIOA 3ZJ8A 2YL8A 1EJSC 1PKNA 4F0KA 4US6A 3PB0A 4QTGA 4K1GA 2ZUMA 4HK5A 2RDTA 5C54A 2XVGA 3LBMA 3TXZA 2VHLA 1MRQA 1JZ4A 3QKZA 2Z00A 4XSLA 2ZRWA 2FPTA 2ZZ1A 2DQWA 8TIMA 2R6OA 1JPKA 1K7XA 2YLLA 1XJBA 5E6ZA 3DFHA 1EWDA 5AYZA 1XH2A 4Y96A 2QMJA 4HBKA 4X0VA 3HBLA 3W7CA 2EJAA 1BYDA 4QFUA 1TV8A 2WSYA 5C5YA 1EGZA 2ZX9A 1KFKA 3MUIA 1PBGA 3ABXA 5J5DA 3OLDA 4AHPA 2D3NA 4FNUA 2OKOA 2BXZA 3UNTA 3CIXA 4M19A 4GYJA 1W3LA 5CPLA 1BTCA 4GVHA 1BGGA 4TVUA 1KTBA 1RBOB 3GBEA 1XICA 3U4FA 3RLGA 2YA2A 5E0FA 4GD0A 4Q22A 1M1BA 3B8SA 3OODA 4A35A 1OD0A 2YBTA 1O7AA 2ZOXA 3WDJA 4MKVA 4G1KA 4ZODA 4JOMA 4K7YA 3O16A 3TDFA 3LS9A 4JTUA 4GVGA 1WUEA 3WDRA 2J8GA 1E4IA 4L80A 1NDYA 3L2MA 4FSAA 1VYRA 4LALA 3T55A 4B16A 4D8AA 4O18A 4ZO6A 1ZBVA 3VGHA 3VIIA 4OQVA 4KGJA 1OM0A 3ARXA 3FX4A 2NLIA 4G56A 3FAWA 3B0UX 3DU0A 4AZCA 2AL2B 5FD0A 2E5BA 3AS0A 2P88A 4JTGA 5C9XA 3HPXA 3ITXA 3D3FA 4NX0A 3VIMA 2QS8A 3PBUA 1OYBA 1EJVC 3I3EA 1RQHA 3DCPA 3MWCA 2G8ZA 4F4RA 2QUTA 3UZ5A 1CXKA 5A6JA 7REQB 4RE4A 1YMYA 1YDOA 2FVKA 4E4FA 3L0NA 1W32A 2Q01A 3WD0A 2GZXA 3H2CA 1HO1A 1E6ZA 4LUJA 1YTDA 2Q09A 3INPA 2VO5A 3WJWA 4B92A 2A2IA 4IMDA 5BWAA 1IR1A 4O28A 2OKTA 2P50A 4Y9AA 4PUNA 3RX4A 1EEPA 3KM8A 3EA3A 3CQHA 1NOUA 1GKQA 4LBUA 3U2ZA 2YA0A 2R24A 4JEJA 4WHBA 3WUEA 2IQ0A 3NQFA 3T9PA 3DFYA 2ABAA 4N9EA 1WOAA 3TYZA 3SY5A 4L9ZA 4AIEA 4Z2LA 3HGJA 3ELFA 2BXVA 1JJKA 1TV2A 3Q2DA 1ZALA 2VQUA 3K8KA 1B9BA 2BHYA 7PTDA 2FJKA 3QVQA 1V51A 2FZBA 1OGSA 1Q6RA 1PVNA 3IIPA 2XH4A 1A80A 1LT8A 1FWIC 2YOCA 2X41A 3GDMA 1OCQA 2ATSA 1UWQA 3LA4A 4RR4A 3WH7A 1FRBA 4XZHA 3USZA 4MNKA 2PDBA 3GW0A 4UTWA 1Q6CA 1MFUA 4PMRA 3R6IA 4NRRA 4BEUA 4YYFA 2Z1VA 1Q7QA 1AODA 3GU2A 4KCUA 2WHKA 9CGTA 2OT1A 4ZQMA 3FN9A 1UR9A 4NXKA 4U2YA 3JUGA 3N6QA 3U7VA 3P0WA 2DT2A 2FKPA 3GVGA 3F2DA 3SGZA 4ZO8A 5TQLA 1K70A 4UXDA 4L1WA 4MGGA 4GMEA 2J25A 4DWSC 1IT7A 1FWJC 4WJ8A 4TTUA 1UWUA 1OC6A 1GQLA 1QT1A 2AKZA 3NQ2A 5C9ZA 3WH5A 4PC8A 2XN1A 4FX6M 1LLWA 2W6RA 4BR1A 5FSEC 4EPDC 4F0RA 4O1FA 3TQKA 2GVEA 3GC4A 3FGCA 3L4VA 3WK0A 3I6TA 4XQ6A 2YL5A 2OYMA 1LG1A 4GNVA 4NI3A 5A8GA 2C7FA 4Z1AA 3NM3A 2C16A 3ZVIA 2CBJA 4KEZA 1KBIA 3H8AA 2DSVA 3VFLA 5JH2A 2WC7A 3TN3A 5PTDA 4CCDA 1LL6A 1IXNA 3NG3A 3NQEA 5CPMA 4AMAA 4HOZA 2E09A 2CZFA 1VYSX 2FHCA 1GVIA 4IUOA 3LZ5A 3PUOA 4QG6A 3MBFA 3SCRA 1V02E 2BY1A 1MXDA 3AXKA 3AWOA 2QAFA 4L4MA 4NVTA 1YXDA 3GFXA 1GG0A 2C1HA 5G2HA 2GK1A 1X98A 1S2WA 3SBFA 2VD9A 5ECUA 4L7ZA 2HZGA 3IACA 1CB2A 1EHAA 3FIGA 3C52A 4G2DA 2OGJA 2X0HA 3WJZA 4UTHA 3PAOA 4N42A 1GTEA 2XIOA 3SUTA 5HQEA 2QDHA 4LUIA 2CKRA 1POJA 3NDZA 5AC6A 3OW1A 3AC0A 3LRKA 2WYSA 3EPMA 4QE1A 3BQ6A 4NAEA 3H2EA 4ENLA 5E0CA 3OGSA 1R3TA 1XIFA 4XD6A 1Z44A 3NZPA 3L2LA 3H12A 1HJSA 3ORWA 3MJMA 1AFSA 5FSDC 3PTKA 3RILA 3GXMA 4GRSA 3VDBA 1RK5A 1F8MA 2QCNA 2GVLA 1K9EA 3FGCB 3T8LA 3CT2A 1KGXA 2WXDM 3H22A 2Y5SA 4NP7A 3NQCA 1WKDA 1XLIA 1ONRA 3VI2A 4CQBA 1ECEA 3APYA 3UXKA 1BF6A 1QNPA 2YL6A 2WQDA 1QNQA 5I07A 3PTDA 4F0LA 3AHXA 4NI8A 3F4DA 3HMJG 4M1BA 1EF3A 1OFEA 3W1UA 4IGHA 1EDQA 2WMGA 3UWVA 4Y6GA 3M0MA 1O68A 1K3UA 3QQWA 3EDKA 4HGXA 4H8HA 5M17A 2YZ5A 1HVXA 5HQLA 3L5AA 4IMEA 4MFEA 2WVSA 3T0DA 5C55A 3TLLA 1TR1A 4J3XA 2WWCA 1P0NA 3CNYA 3L4TA 3ANYA 4A2SA 1S5TA 3NQGA 4CN1A 2I7GA 2OLSA 2QQ6A 3LERA 4E4UA 3WQWA 1U83A 3JW7A 1PTGA 3KBJA 3PPCA 1XLGA 1XYLA 6TAAA 3DYMA 4I7WA 2QPUA 2E9BA 1XBXA 1CLXA 1GONA 2CZVA 3IGSA 4D8LA 3UJ2A 4O52A 3EKGA 5HK4A 1ADSA 3ARZA 3H24A 3DFNA 2HS8A 5I03A 3HM7A 5HANA 3OA5A 2VXNA 3P82A 1DXEA 1QOPA 3FYPA 2I5IA 4YTUA 3VM5A 4LUSB 4JX5A 1SO6A 3V75A 1CYGA 1R38A 4HQVA 1TVNA 3DHUA 1FXPA 4PUUA 1WX0A 3FY1A 3GH7A 3GVVA 1X1NA 4FNRA 5EMKA 4HPHA 2Q8XA 3IIZA 2G4JA 4AD0A 2WZTA 1RVKA 3WNNA 4FIRA 5GNXA 1XSIA 3SN4A 4UFIA 2PDXA 2NX1A 4H00A 3MJYA 2A3BA 5IXEA 3K2GA 1JEZA 3IAPA 2NQLA 1ZCCA 1Q8AA 2FFCA 1XR2A 2CESA 3UP8A 2FQIA 3GZAA 1UMYA 5EY5A 3UJFA 4XUGA 5M2FX 4S3EA 1LOLA 3G2GA 1GT8A 2BLEA 2ASHA 4LNYA 1XLFA 2WSKA 4TX8A 1SFTA 1RLDA 1B3WA 2PLMA 4C6EA 1PWMA 2FMOA 3CHDA 3EX3A 4KESA 5LKYA 2A21A 3AU2A 1FH8A 4DO4A 5CLWA 1H7RA 3W1AA 4LY4A 4W86A 3W2JA 1OT2A 1JIBA 1PYMA 1FP8A 2ZC1A 1SW3A 4DX3A 1EOMA 3C56A 4KW2A 2EQDA 3VE9A 3O15A 1VFOA 4NZ4A 4E4PA 3TNOA 4QSFA 4NT0A 3LSBA 4WVXA 2A1YA 1KTCA 1RAKA 5I77A 3H23A 1Y5XA 3E5PA 4YCOA 1UYQA 1UWTA 3QZ6A 3PP7A 2ALDA 1P1XA 4OBTA 4H6RA 4N4PA 3D3AA 4WY0B 1QI3A 3AICA 2IKJA 3BARA 3K5XA 4LAUA 2UWFA 3VZYA 3N2CA 4J27A 3C2EA 4JTHA 2QVHA 5DXYA 1VCGA 1D8WA 4G5DA 4HNTA 3SRFA 1JXKA 2PS2A 5JIWA 2XGIA 2PGWA 2VR5A 3RMEA 1FA2A 2OXNA 3VIOA 3B9DA 2QXWA 4TXEA 5G1MA 1KD0A 4DPQA 4L1GA 4MKNA 1VC4A 4MDPA 4CCEA 2IW0A 4MNJA 2YFOA 5CSYA 2PWVA 3ARUA 3CUGA 3NAVA 4Q4SA 3WLJA 5A2BA 2PB1A 4MJMA 4JQ2A 2ZA1A 3VINA 5AVNA 1PIFA 2Z1KA 1XSKA 1VJZA 2ZX7A 3VIPA 3G3MA 4AQLA 1BD0A 2YBVA 3W83A 2BY2A 3ZIZA 3FHQA 1FDZA 4U5IA 4DJDC 1SJDA 3RO8A 1X97A 1GTHA 3LEPA 1E6NA 4K6AA 1VRDA 4Y9NA 2Y8VA 5D32A 1SO5A 4KIRA 4GJ1A 3UXLA 1Z6KA 2D22A 4TQTA 2PCEA 4HPXA 1Y65A 1LQAA 1J79A 3BCDA 4JS3A 4C6JA 2J77A 3CUJA 5G4HC 4DPPA 3IUIA 2C13A 2E5DA 3H4GA 1ZJBA 2YDQA 4JYEA 1XG3A 1G4PA 1L6YA 3NZGA 4ZSTA 1KB3A 3A12A 4F9JA 2OMAA 5DMLA 3UPMA 3TKFA 4LUTA 3HFTA 4GI4A 1JGMA 2C14A 2E25A 4ZOCA 4W7WA 2H6RA 1XLAA 1UR8A 3UQNA 4KS0A 1XC4A 1MMFA 3E9AA 3K46A 5TNVA 2J78A 4MZYA 4ML9A 3BLIA 4D72A 3W28A 1KC7A 1TG7A 4HTBA 5M03A 3UY8A 4Y8EA 1GZJA 4ZSUA 4Q8OA 1S39A 4MJ2A 5IRPA 2YDSA 1J6OA 3N29A 4M7TA 1OFQA 4V2XA 4GX8A 4NUWA 1FFQA 4QEEA 4DN1A 3WDPP 1MNSA 2CU0A 2GUYA 1JCJA 2BDQA 5IOBA 1LDCA 2DIEA 2AGKA 1H1NA 4JNYA 5F7UA 2BZNA 2KZHA 4XZIA 3EMCA 1JCMP 3BURA 4DNMA 3QPEA 2DY3A 1QHPA 4HN4A 1FOBA 3W87A 2YX0A 3TFXA 3WNKA 1W6TA 4AVOA 4HZMA 1TREA 4X22A 4GFIA 1DJXA 2OG9A 3OGVA 4CD6A 4NSBA 3WLRA 5LXEA 1E4MM 2VELA 2SFPA 1FWBC 1CIUA 4ZQOA 2PDYA 2ZZ3A 3PNUA 1HQTA 4QS5A 5FJIA 1J93A 4AZ6A 3BLFA 2ZUVA 5D03A 3AHYA 4CN6A 1BKHA 5D9PA 4R53A 3DC0A 1HJQA 3WLKX 3I68A 3WD4A 1F8IA 5I3FA 3C4UA 1GQKA 2VI0A 3R25A 1FTXA 3PFRA 4LRTA 3MCOA 5JBDA 4JKKA 1KM0A 3VKBA 4JHMA 2TMDA 1X39A 1C7SA 5JXQA 4JZ5A 2XVPA 1PZ0A 2P5NA 1W17A 4O13A 4ADUA 1J4EA 4EVZA 3UCCA 3BSHA 1ITXA 3CZEA 3M5YA 4BI6A 3E3HA 5BOOA 4AIOA 1W31A 3CBWA 3MMDA 3KL5A 1XPYA 3EWDA 3STFA 3DXIA 4J4KA 4C7DA 1BWKA 1E1CA 1XL9A 3VNMA 1V02A 4IP4A 1OVDA 5HMFA 2YDRA 4FF5A 2ZRVA 4LV9A 1SGJA 4D6GA 3OBAA 1W5MA 3SECA 1FWSA 5CBIA 2G3FA 4O54A 3POCA 4Q4PA 4G7EB 5JBFA 2YXGA 5CAKA 1FWNA 3N13A 2E28A 1HO4A 3S5NA 4LANA 1NWRA 4HKPA 2X1TA 1L2QA 3MHGA 3OVGA 2VZOA 5AHMA 2X30A 3UR2A 2VR4A 2XFWA 2FPVA 3DHPA 3O63A 1E51A 3BMWA 3L67A 1DIDA 4XV0A 2OGYA 2W62A 4CU7A 3LHTA 4S3BA 2J7BA 4UFHA 1LOQA 4UUIA 3SJNA 3LD5A 3RNDA 3MUY1 1EZWA 2VRJA 2VOTA 1G4EA 2YFNA 1ZNNA 1GHSA 3G0XA 1R7OA 3PVFA 3S3GA 4GY7A 1E6RA 3K4WA 3M7SA 6A3HA 3T09A 3P61A 2QR6A 4CD8A 3GXDA 4EPKA 1ELSA 3RX3A 3PG9A 5AN7A 2GWGA 2A3CA 1VIZA 1O94A 5LIKX 4O1EA 4XISA 1HKJA 3WDQA 4O14A 1EJRC 3N4AA 1QPKA 3E96A 1Z3NA 1V03A 1P0EA 1E9LA 1CCWB 5D2VA 1FHDA 3FJNA 5D2YA 3H4WA 5HMSA 3UA4A 3I7RA 3PZUA 1ZENA 2OQYA 3K1DA 4UFMA 1B2YA 4HPJA 5FCZA 2VJXA 2J7EA 3E74A 3EEZA 1IZJA 1QMLA 3E0LA 4LRSA 4RV3A 3GQYA 3H70A 1V0MA 4H8VA 3K1GA 1R5YA 4TX6A 1PYFA 1G7UA 4U2ZA 2HXTA 3M5VA 3N2OA 2EG7A 3BZGA 1H61A 1K7FA 2OO6A 1XLKA 3T4WA 3FXGA 3OVPA 4OBSA 2QF8A 4NJIA 5D05A 2VM8A 2VZVA 2W61A 1TE1A 3ZOAA 4V28A 3VCCA 3NL2A 3DI0A 4GYKA 3LCGA 4GH3A 3PAJA 4V1YA 4IX2A 4AF0A 3VGBA 1ZJIA 4KERA 3GXFA 3WNPA 3N12A 4GISA 1ESWA 4Q4MA 4UBPC 4FX8A 2QMKA 2J47A 3C2YA 4OTKA 1JAKA 3SCNA 1UWSA 1V3KA 4U5KA 2Y88A 1MDRA 3BXWA 5GPRA 2Q8ZA 1NSJA 4D6HA 1FWRA 1F07A 4M24A 1GPFA 4O17A 3SJ3A 3TN6A 3W7JA 4GIYA 3WLMA 2ZZ6A 3SCSA 5HMEA 1TQXA 4IWWA 1BPLB 2D0GA 1G5AA 1W3IA 1QPQA 3T81A 3P0XA 2X7WA 4YS1A 3V18A 2NUWA 2QIIA 4PTVA 1T96A 2V3GA 3OLIA 1H1YA 1UPMB 1IEQA 3QRHA 1PWLA 3LI0A 1CB7B 4S3JA 4IQJA 1QNOA 2NQZA 2QCFA 2EAWA 3TCEA 4B5WA 1F05A 2D24A 4GO9A 5TBOA 4BF9A 1I8JA 1R3RA 1QPNA 4HZ7A 4F9DA 5T9BG 1J96A 1FKWA 4R33A 4A29A 3E0WA 4F2UA 4B2DD 1H50A 2DORA 3T08A 1TR9A 3V0SA 2ZUSA 4F2BA 4YHEA 3MQTA 4WSKA 3CZGA 1Q7MA 4Z1BA 1LUCB 1XKJA 2WSPA 5LIWX 3KOFA 1L8NA 4HNVA 2XWDA 4OGZA 4C6PA 3RU8X 3TAKA 3PHAA 2XIQA 3B40A 1NWUA 1MEIA 4IQEA 5AZ0A 3JVAA 1BWVA 3PY2A 4DLFA 5LA2A 2OZ0A 3EX6A 2OQLA 3TEVA 1GVFA 2VX7A 3MSRA 3ZT7A 3RGTA 2ZTKA 1EJWC 3THUA 2X1UA 1XINA 1SQ7A 3WH6A 3G6MA 1B5TA 1CDGA 1XQLA 1TZ9A 4HMCA 1AUSL 2VZSA 1BVZA 4Q8MA 4LV4A 3HFYA 4H9MA 2WAGA 3VE7A 3S42A 1F4AA 4TOQA 5FKYA 3L7RA 4NY2A 5D04C 3W02A 2ESCA 4HPGA 1OZQA 3T0TA 4IIFA 4CLMA 4Q7IA 3GR7A 3BJFA 3WY1A 1BKSA 1EH9A 1TKKA 3B4YA 4JNMA 4A8NA 1J10A 1NFBA 5EBAA 1GORA 1OY0A 3FEMA 1JPMA 2OWCA 4UMCA 1UJPA 1OWQA 5GQBA 3PZNA 4J2MA 2J66A 3MMTA 4FNPA 1YXCA 3GR4A 1QWGA 3RDKA 1PX3A 3S2MA 4NU7A 3ARRA 1LT7A 2PF8A 1LZOA 1IWBA 5E9AA 4KH2A 3W7KA 4R5EA 2Z27A 2ZFAA 3VK5A 3N6HA 1XPGA 4HNOA 3C2OA 1B3ZA 1PCWA 3FLUA 2RGLA 1HTIA 3TH6A 3RITA 1F3XA 4D71A 4UR9A 3SQSA 1SUXA 3RHGA 2YW4A 4HSNA 3FA3A 3ARQA 5M5DA 2QAPA 4ZXLA 5AHEA 3OBKA 4ACYA 3TIMA 2B0MA 4RXGA 3QSRA 2XPKA 1G69A 3FW6A 1TPC1 4I9AA 2NQ9A 2Z1SA 3HQNA 4N9BA 1P6CA 1PSCA 4OUEA 3SW6A 2ZRXA 4FHAA 3TX9A 3AIQA 4DWSA 4XZWA 1IYXA 3HZ3A 3NO3A 2FDSA 3RCYA 2RUSA 1VQTA 2Z4GA 3FCPA 3KVJA 2NSXA 3MO7A 3REQA 1TV5A 2O92A 1WXZA 4I6VA 1M68A 3SCOA 2RDWA 1D3CA 2PTYA 3LCWA 1UKSA 3NOEA 1LBLA 3BMXA 1R0MA 3VGGA 4DBSA 1NIUA 3STGA 2W91A 3F2BA 7ENLA 3U6WA 1DTUA 3IAQA 3W7NA 4DZIA 2R1PA 1F6YA 3RR4A 1H1ZA 1CGWA 1VFHA 4DJED 3CASA 3LXBA 3VZZA 4BQ5A 2NX3A 3MV01 1WQ5A 4NG3A 1YPIA 5HATA 3UW6A 1VBHA 3UZJA 4CUCA 4EXAA 4B3ZA 4KCTA 2V2CA 4EKJA 3N9RA 3W2KA 1MZRA 3W2NA 4QJ3B 2HVOA 5I3HA 2XIJA 4GACA 2X2YA 2V5CA 2V30A 4LFYA 4JX6A 2ZDSA 3NEHA 4WCJA 1UKQA 4GUIA 2QJHA 4C6FA 2D23A 3AXIA 2DT3A 3TQ0A 3XIMA 4IX0A 1CLKA 4NZJA 3QQ1A 1NOWA 4J3TA 5FF4A 1S3TC 2CLOA 1DOSA 1XCXA 3EX2A 4KFOA 3T44A 2NT0A 4NYUA 2E8YA 2A79A 1HKVA 2H90A 5DMMA 4NJJA 3R4IA 3W72A 2DT1A 4C60A 4B5NA 3G18A 2QEZA 3LI1A 1KBJA 4XUYA 1DWGM 1ENUA 2WVVA 1QUMA 1TIMA 4CN4A 3WLLA 1UR3M 5CAHA 4NJHA 2A5HA 3CV2A 5AHLA 3LQGA 2Z29A 4TMCA 1E4LA 3HURA 3WL0A 3ZR6A 2V69A 2PGEA 3P80A 4R7OA 3L5MA 3G1FA 4CKQA 2XJ7A 3U2CA 1PAMA 1JFHA 3UY7A 4MZ1A 2WO5A 1RD6A 4LWWA 1JI1A 4PBFA 1ONEA 4XO6A 5LA0A 2YB1A 3EWUA 1QVBA 5KITA 3ARTA 5A6LA 3PNZA 2A3LA 2V5DA 1Q4NX 3WUGA 5AHNA 1SYTA 2EXOA 4IQLA 2VRKA 5FI8A 3MP5A 1GPWA 1IE7C 1ONXA 1N2VA 2RH9A 3SRHA 1E9IA 3QEZA 1SFSA 3TW6A 4CEUC 3K4AA 1RV8A 3GTXA 2GOKA 3B0VC 3SQMA 1VKFA 2QDEA 1KXHA 3VOIA 4HNUA 2ZZ4A 1OK6A 1HG3A 4JL1A 1E6XM 1W3JA 1SR0A 3N73A 2DW7A 2ZVRA 3IK2A 4GQBA 5JBEA 4ZQCA 3WNMA 4LCRA 3R5EA 5GJPA 3W73A 2TSYA 2XIMA 1XI3A 4JFVA 1RJQA 3A24A 5BXSA 3QY6A 2WW5A 4IISA 3MUXA 3GNRA 2CHNA 4WJEA 2AMXA 4W7VA 3QW4B 2D2OA 1O1HA 4DM2A 2IKGA 1FKXA 3WQ6A 1EDGA 3MHUA 4OVXA 4XWUA 2Y2WA 5LXXA 4J1OA 1WDQA 5C70A 4I6KA 1Y0EA 1I2QA 3HN3A 4IFKA 3GDLA 5BCAA 4HOXA 2PRHA 1JZ6A 3P93A 3UZWA 4FNTA 4O50A 2AKMA 3R7MA 4JCLA 2UY2A 4JYDA 3QMRA 3NQMA 1LBFA 1DORA 5HMDA 3W7IA 1JDDA 4CQ9A 4V15A 1YRRA 1S1PA 3BWWA 4X2RA 2EHHA 4GY1A 4YTRA 1P7TB 4FR1A 1V3MA 2G95A 3V0UA 3CT7A 1P48A 3DGRA 3P7YA 5M1TA 4C5ZA 1EUAA 5C9UA 1MDLA 1RBLA 1XH0A 1QO5A 1FWGC 4JFSA 1PKLA 3LMZA 3PM6A 4FOKA 3EOOA 4XTDA 2O4QA 1BAGA 2XZ7A 3EXSA 4BI7A 2F6KA 5AYYA 4D1JA 1PXGA 2H8XA 1S5MA 4JIHA 1H3GA 1A5NC 2TPSA 2BVDA 4HPNA 1TX2A 4E6MA 2BHUA 3M44A 3WQFA 3NTYA 3CZJA 1FDJA 3O8AA 2F6XA 2DJLA 1MUCA 5DANA 3OQ8A 1S5NA 2OLAA 2Y7GA 3CPUA 3XISA 3M0KA 2DZTA 1YPXA 1LWJA 4R3UA 3F4NA 2VNCA 3O2LA 1ICQA 1R86A 3IRSA 4AFYA 4HCLA 4GK8A 3KHDA 3B0PA 3E2SA 3C3UA 1H63A 4NZ1A 3KLKA 1UA3A 1T5AA 1C8QA 2EPLX 4CQ8A 5D9OA 5F2LA 4JQ4A 1XLBA 4AC7C 1H2JA 5FL1A 5BMXA 2J4GA 3F1QA 2E9LA 3QTGA 3ZJ6A 2DP3A 4IPPA 3E38A 3NXFA 3UPBA 2X0YA 1ITQA 1BYAA 1O66A 4H4IA 4CVUA 5FAJA 1YTKA 3M0JA 4R7WA 5CBJA 4IIDA 5HULA 3TYCA 4GGBA 2GGIA 4IP7A 3A64A 1L0PA 1JNDA 3G0SA 4K68A 2A3HA 1K77A 4BQ3A 5KSWA 3HU7A 1QU4A 2QCHA 3DBNA 1RA0A 1X7FA 2Y62A 3G22A 1MQQA 2H3BA 4B15A 1UP2A 3JZUA 2POTA 4NRSA 1UC5A 2O9TA 2TRSA 4GKTA 3COTA 1XSJA 1TUXA 2WMFA 2ACUA 6ENLA 1TJ0A 1LP6A 4XZMX 1TWSA 3M5ZA 5BWFA 4FB7A 4DBWA 2G37A 4LW7A 4ZOEA 4LVGA 3BDKA 4MB1A 5E1QA 1JCYA 3SY1A 3W9ZA 1TTPA 5G5IA 1OX5A 1ZP3A 3GE7A 3BV4A 1JXJA 4MWAA 1DKWA 3KRUA 5D09A 1TRIA 4NNBA 3H6OA 3OIXA 3CTTA 4US5D 4ZFCA 2E7FA 2WCAA 4I8DA 2YCIX 1HKIA 3CB3A 3FSUA 1A5AA 1JGIA 2V2DA 3VNLA 2Q6ZA 1P7TA 4QX4A 1FWDC 4WDUA 3WK1A 1VPQA 2EG8A 2DV0A 1NP2A 2GDUA 3WMCA 4ZQNA 4DUWA 2INEA 4EK7A 3EXTA 4NASA 3K8MA 3ITOA 3NURA 4OZOA 4A3QA 4MG4A 3W82A 2IPFA 2R94A 3GKAA 3MBDA 2QULA 4LPCA 1B54A 4E2DA 5HNTA 1TZ7A 5TIMA 2QV5A 5EKYA 1KQYA 2P8BA 3GNPA 4Q33A 3SUSA 4NL1A 1BYBA 3RRAA 3LOTA 3RJXA 1F6KA 3VD9A 4Z2HA 1JFXA 3SSZA 1XIMA 2TYSA 4KWWA 3A22A 1B1YA 3UWWA 1FHVA 3HF3A 4ZFMA 3MS8A 3NM1A 4LVAA 1BYCA 3S8HA 1ZB5A 2B7NA 2FZ9A 1E1CB 3LU2A 4Q4QA 6CGTA 1UH3A 3F4CA 1B3OA 4GVFA 1R46A 2Z6JA 3QKEA 2R8WA 1TA3A 2AQVA 1OGBA 4HJFA 4QJ1A 2B4GA 2FZNA 2PI6A 4ATDA 2VC9A 3C0JA 3VFCA 4TR9A 4CGTA 5H1WA 1OJXA 1EPXA 4GXPA 1J0JA 5I23A 3RR1A 1G6CA 1KM2A 3AI0A 3VDHA 4JQ3A 3WFAA 2DFAA 5FAGA 1EC9A 3S4TA 3KCJA 1F61A 3VUSA 5J8LA 5FJOA 4H41A 4DJEA 4PRRA 2C6QA 1KKRA 3QMTA 4C6KA 4EOUA 5K2ZA 3HOJA 1NF7A 1KLYA 1CECA 2VZTA 1YBQB 4HSOA 4E5TA 3JRKA 5D8WA 3TMQA 1G67A 1IXQA 1HKMA 2I1OA 4PTNA 3SEPA 2OPJA 3UYIA 2DDXA 3DX5A 1HIZA 3MKVA 4IPJA 2BP1A 4ICMA 1V0KA 3MPGA 1JDCA 2P53A 3MHFA 4DWSB 2A6NA 3KS5A 1LRTA 1UR1A 4Q8PA 2MUCA 2KX9A 3QLLA 4HCDA 4NZFA 4GQQA 3CH0A 1S2TA 3KTXA 4GC4A 1W54A 4PSPA 3NDYA 3D47A 2WLZA 1C3FA 1AQFA 3TUUA 3GFYA 3R0DA 4FF7A 4PUWA 4HK7A 1JZ7A 4UTJA 1PKMA 3GY1A 1Q6DA 4AX6A 1EP2A 1TPH1 4RDZA 4PTDA 3OYZA 1JQXA 3GHTA 3M6DA 4XZNX 3DN5A 1P1MA 3D0CA 5EU9A 2HPMA 4QDWA 2NQHA 2PDHA 2HDJA 4XIAA 4GQRA 5G2IA 3QHNA 3HV9A 5K4XA 1W1A1 4K38A 1R85A 1GOOA 2BTMA 4X63A 1DJNA 1O5QA 1DWJM 3GB6A 3IGHX 1QR7A 3AXXA 5DX7A 5FIPA 1N7KA 2OX4A 1JG9A 3OLEA 4C6MA 4LYPA 4MLJA 4AHOA 1P4CA 5E0KA 1VRXA 4POCA 4FX7A 4D2JA 2P3EA 1E40A 4ES4A 3FYOA 1OX6A 1WYIA 3M0XA 3HPFA 3IJ9A 4MPKA 1C92A 5KINA 4REQB 4AU0A 3WQDA 9RUBA 1R6WA 4DJFD 5F2GA 1SJCA 2V9DA 1F74A 1NF0A 3H4XA 3SCWA 3W86A 3WKZA 5GNZA 2G3NA 3EYPA 2WKJA 1EXPA 1E1FA 3KRZA 3PN8A 2EPOA 2VVNA 2DVXA 2HCVA 2JEPA 3B8VA 2XFRA 1VFTA 4JYFA 3W24A 4MPQA 5I3GA 2WKGA 4HZ8A 2RJGA 1OINA 3W29A 4ZXOA 3GSMA 5RUBA 3DHFA 1EA9C 3TTSA 5A8NA 1XDLA 4DJEC 2IQDA 3ES8A 2JEQA 4JTJA 5BROA 2HVNA 4JKMA 1AL8A 4NAEB 4Z0JA 1OADA 2D2HA 1QW9A 3SN0A 3CZKA 4MKSA 4OV4A 3ARWA 1A0DA 3S6OA 3SUVA 5HUOA 2AQOA 3DBPA 1NTHA 3CUXA 5KZMA 3AMLA 3KWXA 3W1MA 3ZWTA 1GHRA 1VFFA 2RKXA 1A5UA 1TRDA 2C15A 4RNJA 3G8EA 3O05A 1E0WA 1W2VA 3TWAA 2E6DA 3VDGA 4ERIA 1GOIA 7A3HA 4X0NA 4R34A 1UR4A 4IPIA 4FK9A 1AVAA 1MVYA 4F48A 2YCJA 1B30A 1OD8A 4P5UA 5D9NA 3F2CA 3W7PA 4AYSA 3LHYA 1TJ2A 1QK0A 1Q2SA 1JCXA 4XO7A 3TN4A 1JI2A 3IPWA 3VIKA 3LCXA 3HPAA 1EIXA 3QV8A 3ZLFA 1QI5A 1ZZMA 3R8RA 4ZGYA 4EWND 4P7NA 4MZ8A 2WSRA 2V82A 1KXVA 4FOUA 4O57A 3MT1A 2ZCGA 5CC6A 4GX9A 1YPFA 1UP3A 2WOQA 4W93A 2C1IA 3QC3A 3GTNA 9XIAA 2UY4A 3RPDA 1PZ1A 5T9CE 1C29A 1QAPA 1FX6A 3PPGA 3H2OA 2RFGA 4QNWA 3WDHA 2WM1A 3VTRA 3ITVA 4IM4A 1W8GA 4GUGA 3GZ3A 2YXOA 4LS2A 1MW3A 4GZEA 1OK4A 3USBA 5DF0A 3GX9A 5A94A 4DYJA 4WRHA 3ZMRA 4N2YA 4PODA 2WB5A 2UY5A 4LUSA 4A3HA 1OT1A 1M7JA 1NFGA 1VBJA 2BODX 1TWZA 3N34A 4O0QA 3UEQA 1ZAHA 4E2OA 8XIMA 1KO0A 2W0UA 1S5VA 3GNXA 3SZ8A 1I60A 3LGDA 3WG6A 3BV7A 1KFBA 3AHTA 3KZSA 3CL7A 4Y7EA 3LHWA 4GQ0A 1RQBA 1TIWA 4YPJA 1BWLA 2REQB 3UT0A 1IQ8A 3GDRA 4Y9OA 3EWBX 2WM0A 2Y70A 1BTMA 3JS3A 4Z2GA 3G1HA 4JN8A 5LA1A 3QOMA 1BXNA 1LM1A 2I9EA 2FHBA 1LQ2A 5GJNA 5A6TC 1F73A 4CD7A 3I4EA 5DO8A 7CGTA 1PPIA 3ATZA 4Y9PA 1C93A 1GQIA 4FO4A 4CD4A 3DKLA 5GJMA 4Q8WA 4M5PA 1AH3A 3GXNA 4NZCA 3VXGA 1AJ0A 2GFTA 2ANUA 3C6CA 4B90A 3VC6A 5AVHA 4UTTA 3LPOA 1JF5A 4RJEA 5CGTA 4ORMA 5DMNA 4M6VA 3WEMA 1K9DA 4PMVA 4UTIA 3P8IA 3LLXA 1QXLA 3CK5A 3L4XA 4ZR8A 3QZEA 4PUJA 3VM7A 1XFCA 2Y5EA 5BZAA 2J7FA 3VNDA 4DBEA 2NXIA 7ODCA 1JULA 2L5HA 3CAKA 1A5CA 1E71M 1TPEA 2WHMA 2YCLB 3CZLA 1BGAA 1TMHA 1VBUA 3VKDA 4JIPA 4H04A 2OU4A 4HK6A 1KA9F 2J79A 5BMWA 5MF5A 3KAOA 3GFZA 2H8ZA 3DHDA 1MNZA 3Q67A 4MYXA 4W9TA 1P0DA 1GZGA 2VUNA 3MCMA 3QY8A 3LV6A 4QM1A 4S2BA 2BNJA 2G96A 1XLLA 3TJ4A 2YL9A 3GD6A 3CQ0A 5FJJA 2ICSA 3PANA 4O1CA 1RCQA 3SCUA 2PRLA 3OZOA 1A5BA 1BF2A 3QOKA 3VMNA 1JZ3A 3MI6A 1TJPA 5CPQA 3V3WA 4C1LA 1ISZA 4W5UA 3CUIA 2BVWA 1CGXA 1AJZA 3HG5A 1LWIA 1KQZA 4FS9A 3TR9A 3TJXA 5IFTA 4ICCX 2GGEA 4MY8A 3Q94A 5CJNA 2CWXA 4N6FA 1AK5A 3I7QA 2VCCA 3TAOA 3BE7A 3NVTA 3HO8A 1M65A 5C0QA 1AW1A 1T41A 4PB3A 3NUKA 3A3HA 4BWLA 1H11A 3F4VA 1A50A 3PG8A 3CHEA 4AZ7A 1QOXA 4B4HA 1E70M 2IPJA 4Y8FA 1XUZA 5E09A 2WNQA 4I5UA 2R1NA 2ZQ0A 1XM3A 2E77A 1TWWA 1DJYA 2DUXA 1C8XA 2PDWA 2BGNE 2FB3A 1DTNA 1TV7A 1B3YA 2HQAA 2INFA 5I3IA 3OA3A 4HVXA 3DDMA 4FLSA 3GNNA 1TVPA 1JD9A 1VCFA 2FGZA 4WJXA 1DJHA 3H54A 4DI9A 1REQA 1XXXA 1UHVA 2OODA 4ZTYA 3ONBA 1LQ0A 4PRWA 2HRWA 3LCFA 1KM4A 1PZ3A 4Z1CA 1OF6A 1VEMA 1ME7A 2CWNA 4HSHA 3VVGA 2E6YA 1YQ2A 1KFEA 4MF4A 4N9CA 4D6CA 3U9IA 3L4ZA 3UYCA 3W01A 2XVNA 3MV11 3IUHA 3S2CA 4DO5A 1ML1A 3KOXA 2ZYFA 1ZU8A 4US5A 3MKKA 6REQB 3DIPA 2WLYA 1UZ1A 4RE2A 1ISVA 1QPRA 4CNSA 3PZIA 4L65A 3HQ1A 4GA8A 4J7RA 3N15A 2YBUA 3A21A 4AWSA 4CEXC 4C90A 4A6GA 4FNSA 4C6DA 1BRLB 4UMAA 4PRTA 3WLTA 1F4HA 1U1UA 3QN3A 4M82A 3TOPA 1SU5A 1SZGA 1EYEA 2GQ3A 3M47A 3E0IA 3WJYA 1VFUA 2RHGA 1V93A 5BU9A 3W1PA 2OSWA 1Z41A 1JCTA 2I56A 5CQ1A 2VP8A 2NWSA 3VNJA 4ZQPA 5LGXA 2PWUA 4EPEC 2HK1A 3L12A 1A5KC 2DPEA 2FJUB 3R12A 3LTYA 2O55A 1SFJA 5CKSA 4WGHA 2OTDA 2XGBA 3LNMA 3LENA 3UJRA 2BX7A 2P3ZA 1AZ1A 1DIKA 5CGQA 1UWRA 3OTRA 3W1QA 4PL2A 2E68A 1ZRQA 1ZQ5A 1UD6A 2IUZA 4JIEA 5BW6A 1EF2A 2E5CA 2XFYA 2QJJA 2QJIA 1EEXA 5HOSA 3GTIA 4WXZA 3S9ZA 3UU0A 3ARPA 1VHCA 2O9PA 3M16A 3RLHA 2PDKA 3TTOA 4G7FA 1HP5A 2GUUA 5D8ZA 2ISFA 1TTIA 1G7VA 2X05A 1TMQA 4QG9A 4L56A 2VTFA 1FCBA 4IFRA 4X61A 1YIXA 4KIEA 4UTLA 3HGOA 1A4LA 3P5ZA 1WB0A 3JR2A 1BRLA 3TYEA 4AD4A 3OOQA 3QY7A 4M29A 3G1YA 5HINA 4LYRA 4L4OA 3TROA 3W1TA 3CWNA 1NDWA 3VGEA 5I06A 1HZYA 3QH2A 4HU8A 4EAYA 1B3VA 3CWHA 3BLEA 3IK4A 4XAZA 3N4EA 2Z2BA 1PTAA 1QATA 1UH4A 3L66A 3N19B 1KFJA 3A9IA 3PR2A 4S3GA 2JFEX 1XV8A 4ATLA 4H9TA 1XCWA 4B9ZA 5HUPA 4YL2A 4KEMA 3LHVA 4RK8A 4J3WA 4KEVA 5IBXA 3MP4A 4G9PA 4LYKA 2DSWA 4GPNA 3GIQA 2EJ1A 1LRNA 4YJ5A 1AQHA 1OG6A 3G1XA 3U0HA 4KT2A 3PS7A 2C71A 2XFFA 2DVTA 3URQA 1RY8A 4UR8A 1MI3A 3GHRA 3NSMA 3O06A 1FH9A 2OWWA 5E6YA 3B05A 3SGUA 3MTWA 1PJ9A 2BMBA 1RD5A 3W76A 1C90A 4AZHA 5AYBA 3S9YA 2V5JA 1J6PA 4JTLA 3T40A 2XN0A 4WUIA 3TVAA 3NPVA 4DUXA 3GC2A 2XSXA 4J3VA 1HJXA 2BXYA 3MVIA 1D7FA 2W27A 3KFTA 3VIHA 5XIAA 1BFNA 1DPMA 3WBWA 2E1WA 2V0TA 3UWZA 4IJBA 1WA3A 3WJSA 2A6LA 3AYTA 1CTNA 4RZ6A 3UXDA 3UGVA 4XSMA 2A4AA 3VYLA 3LRMA 3S1GA 2WNNA 3VOHA 3R89A 2XU2A 1VLWA 2V8ZA 2VZUA 3MVTA 1QTWA 3KWSA 3DG7A 3EZ4A 3KRSA 1W37A 2NZLA 2NXGA 4P8VA 5D33A 5GVJA 3V35A 1VYPX 2V68A 3AIEA 2OFJA 4CCCA 3FVMA 4ATWA 1SZFA 1OGGA 4W89A 1Q66A 5T26A 2OB3A 4DYKA 4BFAA 1RVGA 3L2IA 5TAOA 2WMIB 3BCJA 3EGJA 2ATMA 4UTUA 4BK9A 3ME3A 5A6MA 4WDWA 4ZOBA 4MWAB 3SUWA 5LIUX 2EO7A 3W7LA 4RDYA 2IQTA 1GNXA 1MW2A 3GH4A 2WQPA 5FJRA 3SCQA 3TQPA 4U4MA 3EWCA 1X6LA 2X40A 3RYSA 1R8LA 3ZJ7A 4C6IA 5BRBA 2PWHA 2PTDA 4OFCA 3BAXA 4AD3A 1YHTA 3B3DA 4XVDA 3KDOA 3FJLA 2PDCA 1LLZA 4E8CA 3IVSA 4JY9A 1ZSXA 1A5OC 3NL3A 1EHNA 5CC5A 3VZXA 5LHFA 3GAKA 1OG0A 2CLKA 2GDQA 1GJUA 3ZM8A 1LTDA 3LNPA 1OSEA 4C6LA 1KM6A 1KKOA 3NYDA 1ZBWA 1V6TA 4K8HA 4NYYA 2ZWYA 4J28A 1PKYA 1PTDA 1K6WA 4FP1A 2WC3A 2WSQA 1MEWA 2VRQA 1L8PA 2IXVA 3PZOA 1XC6A 3O7UA 4HYWA 3THCA 3WLIA 5CJ5A 1MRAA 5HWMA 3NPXA 3A4JA 3PSWA 5F1UA 3GG1A 4UNLA 5AY7A 2GK1B 2PWDA 4C1NA 3N04A 3G1SA 3UZXA 4W85A 4H2CA 1R2SA 3S0CA 4O53A 1O12A 3GTHA 1CXIA 3W4RA 3VX1A 3WENA 3M0ZA 2BOEX 1ZBCA 1CZ1A 2ZWZA 4X9SA 4DF1A 4K37A 1UD4A 4NIRA 3UBPC 2Y1HA 3UZZA 3BG3A 1ITUA 1K8ZA 3SGGA 3UWUA 1JZ5A 2YPIA 3WNLA 1DJGA 4OWGA 4UQ9A 1ZHAA 3LHZA 1UKPA 4UQCA 4PMYA 4G6CA 2ZZ7A 4YYCA 1E1EA 4LF2A 3CXOA 4DXVA 5K9XA 1G1YA 1VFLA 3AJXA 2XYLA 3DFQA 3L4YA 4M6QA 2NV9A 4DJDD 1UWAA 5FJTA 2ALRA 4QAWA 2DGAA 3N2MA 4PCFA 5EMLA 1OCJA 3R13A 2GVGA 2FFIA 4WDTA 4AG0A 4RNHA 3AYRA 2XVLA 1UBPC 3WBYA 4PGLA 4XAPA 4D6IA 2J6XA 2Z6IA 3QFEA 1XYAA 4AZBA 3DG6A 1X8FA 3GHUA 3MDWA 5F2MA 3AZSA 2JIEA 5A8OA 4A05A 3E5BA 3WH9A 1W1IE 1VBGA 3EWZA 1W3NA 4M8UA 4MIMA 1H7WA 4CNPA 3BICA 1YNQA 4RPQA 2YLAA 1RQEA 3EMQA 1YKWA 4H6KA 1ISXA 4FEZA 1C9DA 5B80A 1UD5A 5C2CA 3WQOA 2PC8A 4IPLA 5EMUA 2BVTA 2BB0A 3I65A 3LZ3A 3N9KA 2D20A 3M07A 4WKAA 3B04A 1C8VA 2D3LA 1B90A 3GUGA 2O9RA 2WMHA 5F4SA 4GG9A 1U2YA 2HK0A 3PTMA 3CMJA 4YWSA 3SQLA 3CAQA 5MKGB 2BGSA 2J9YA 2Z7KA 4UTKA 2NXHA 3AJ7A 2FGLA 1XIBA 3EB2A 3PBMA 1SR9A 1E0VA 1U30A 2Y61A 3B4UA 1XGDA 4C6QA 2CETA 5DEZA 1CBGA 4AWEA 2GLKA 3KTCA 3G24A 4F0MA 3WO8A 1IT8A 4JXCA 4CNUA 5F4WA 3GG8A 3NYZA 4O0KA 3CUHA 3ZT6A 1BQGA 4MB3A 3GUWA 4QRNA 4JTKA 4LX4A 4Z17A 2Y63A 5KZ6A 2A85A 4IGNA 4KBXA 2PA6A 1NU5A 3MSGA 1GWJA 3ZO9A 1TPFA 5CH9A 3I10A 3VUPA 1VIWA 3CV7A 1RXOB 3C2VA 3CC1A 1J5SA 2CFFA 1CXHA 3RG6A 4AD5A 3TZFA 2ONEA 1K4GA 3WF4A 3PZGA 2R1MA 3T42A 1VD6A 1Z48A 2CLFA 3QYQA 4MADA 1Z8AA 2WVTA 4PCPA 3AMKA 4GZ7A 4GFSA 1OCBA 2V6AA 5DBUA 4ACZB 1G4TA 5JMUA 4MLRA 3GO2A 5FEWA 4PBEA 4RL3A 1WO2A 3E2VA 2CZEA 1GVYA 3EDFA 4DZHA 2XH7A 3VOCA 3GRIA 3MI2A 5HPOA 5AC8A 1AA1B 4JQAA 2YR1A 5A95A 3TC7A 5LIYX 4D8ZA 1LL4A 1C7TA 1MW1A 1AQ0A 1UROA 5D38A 2BG5A 3WDIA 4ZO7A 4UC5A 4Z1YA 2J7GA 3F7JA 2NT1A 1E73M 3C8NA 3CUFA 3WL1A 3VCRA 3FDGA 3TTQA 1I9CB 1YDYA 2ZZ5A 3EWXA 5AYIA 1BHGA 3U4AA 3GR8A 5A6BD 3L4UA 4M1RA 1EZ2A 2XM1A 3KS6A 4LSBA 4LBSA 3VU2A 4ZOAA 1RJPA 3W1RA 4ZZ9A 3RM8A 3VAVA 2GJPA 1AW2A 1HXJA 4N6EA 2PP1A 4XBKA 3OIHA 3WH8A 4BKNA 4JICA 3Q37A 3TFCA 5J5RA 2CIPA 3GXIA 3D6NA 4AH7A 1VCVA 1FWHC 3W25A 2PDFA 2CBIA 4A2RA 1H09A 2JKAA 1OFOA 3ZS4A 2DZBA 1V8EA 1JYXA 4OV9A 3ID7A 4QITA 4UQAA 2D0FA 1K8YA 3P81A 4IG2A 2PD9A 3AIVA 3ITTA 4DWSD 1IGSA 3CAWA 3U8GA 1TO3A 1OFBA 2O56A 1G94A 3ERPA 1GKPA 3E0VA 3T1GA 1UCWA 1A3HA 3RM4A 5KMYA 3B06A 5CEWA 4MWAE 3VD5A 1WZAA 5HAOA 3U57A 4L6DA 5HJXA 4AB4A 1KM5A 2AMGA 5A6SA 1V79A 2W67A 3N18A 3BCFA 3D5HA 3KEHA 1AD4A 5I79A 3KBNA 3ARVA 4GHRA 1JF6A 3BGGA 2ACSA 2YXXA 2WJEA 4KFNA