3CUJA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylopentaose.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
314
structure length
314
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 131
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cujA00
2C0HA 1XD0A 1UUQA 1V3JA 1W2PA 3T0AA 1VBRA 1KFWA 2ZUVA 1JI2A 4AEEA 1QI4A 1JXJA 1V6UA 1E70M 2G3MA 2VUYA 2C7FA 1DWIM 1HKMA 1GJWA 1CXKA 1MQQA 4UQDA 5CLTA 2QPUA 2ZE0A 1V3HA 4MB4A 1HIZA 2GK1A 1HVQA 1GVYA 3AMCA 2VX5A 1V6VA 1XCWA 2YDQA 4AD1A 5FL0A 1EH9A 3VPLA 3WH5A 4Q7NA 2VVNA 2WMFA 3GH4A 4H8UA 4MNJA 1WDRA 3VILA 1CGVA 1MVYA 3AYRA 1OD0A 2YDRA 3ECQA 3NDYA 1CIUA 1NWUA 2QV4A 1UQZA 4D1IA 3W29A 5GPRA 1XC6A 1PIGA 3FXYA 4D71A 1AQMA 5A6SA 3WNPA 4FF5A 3W4RA 2WCAA 1OCQA 3FHAA 4PTWA 4HZ8A 4S3JA 5D9NA 4PTVA 2O92A 1KGXA 5HDRA 3FN9A 4W7UA 1V0LA 5JBFA 1V3MA 1J0ZA 1C7TA 3AIQA 1UWUA 3OGSA 2D20A 4BQ4A 3WNLA 4PEEA 3VDCA 4AZ7A 1UWSA 1JZ3A 4H8VA 3LMYA 3SUSA 1IZKA 3CTTA 4RE4A 3VMPA 1BYCA 1MW0A 3MANA 2XVNA 5BRQA 1GOQA 2VMFA 4F9JA 3UERA 2YJQA 3AIWA 3A47A 1EGZA 3SCQA 3L4YA 1C92A 2NT0A 4P8VA 5ABFB 4KWUA 3M07A 1LL4A 1SR0A 2D22A 3WQ5A 4PUDA 4W89A 1VEOA 2IXVA 3D3AA 4AZ5A 4U33A 1GQJA 2UY5A 3AS2A 3AXHA 4JHOA 3L4ZA 2J7EA 2XM2A 1WZKA 1H5VA 3BAIA 3OGVA 1NWSA 1B3XA 4GZJA 2EQDA 1XH2A 3ZJ7A 1XHGA 5C70A 1KCKA 1MQPA 4Z2KA 1KB3A 2UY3A 1HNYA 5AYBA 1FP8A 1UA3A 2Z1SA 2VZOA 2GK1B 2PWFA 2WMGA 2XWDA 5BROA 3W25A 4K68A 5BXSA 4CGTA 3NSNA 3RIKA 3KEHA 3CZKA 1NP0A 1GOOA 4YHGA 2WWCA 5FKYA 3VOCA 4XZWA 1VENA 5BCAA 2JE8A 2ZUNA 2XJ7A 3EDDA 3FAXA 2J7BA 1GOKA 1C8QA 1UD2A 5HNNA 1XSKA 2A3EA 3FAWA 5CQ1A 2RGLA 5E0FA 5TD4A 4GQRA 2WKGA 3M7SA 3K46A 4Q22A 3WQ4A 4PSPA 3VD7A 4NRRA 4MJ2A 2PWEA 1UWIA 5D9OA 2OWCA 4AZ6A 3WNNA 1JD9A 2IUZA 4W86A 3N12A 1JZ4A 1V02A 1SFSA 3K4AA 1FP9A 2DIEA 3S6TA 5A8NA 3CHEA 3OLEA 3QGVA 3WELA 3U7BA 1CGYA 1UWQA 3WMCA 5D4YA 1OT2A 1U30A 4TOQA 1S46A 2O9RA 5CLWA 1F4HA 1PPIA 2WC7A 3DYOA 4CN4A 2D0HA 4U2YA 5M03A 3VDAA 4JAWA 4GXPA 3U5YA 1XV8A 4D6JA 1BFNA 5JIPA 2G3NA 4GO9A 3W24A 1GHSA 2J79A 5CG0A 1DWJM 4DWSA 1E0XA 2FH8A 5DT5A 1C8XA 4OIFA 5A2BA 1WDPA 1W2VA 2MANA 2A3AA 3ARRA 2VZUA 1UKTA 1W3LA 1O6IA 1VEPA 2WANA 2QHAA 3WDRA 1K9TA 2WC4A 5FOOA 4HMDA 3AIBA 5D8WA 4JFVA 2E8ZA 2EEXA 2X05A 2J8GA 2DT0A 2EJ1A 3BH4A 3WQVA 3RM9A 2Q8XA 5A8QA 1J12A 2CITA 3TA9A 4Z2LA 3IJ9A 1ZBVA 4H2CA 4N0RA 2J62A 4YN5A 2A3BA 4FK9A 4GKLA 3K1DA 4FLSA 3DHPA 3VD4A 3EMCA 4YPJA 1JL8A 1UG6A 1QI3A 4W93A 1KXQA 1E3ZA 3VNZA 1GONA 3PTMA 1XGZA 2BHYA 2D24A 3AHVA 1VJZA 4AW7A 3AHXA 1BVZA 2GJXB 1HJVA 3RM4A 2PC8A 4HMCA 1BYBA 1US2A 3I3BA 3CMJA 2GDVA 1JDAA 3FY1A 1J11A 4D72A 4P7OA 1Q6EA 3NSMA 4MB3A 2DSKA 3L2MA 3AHTA 2WNWA 4AIUA 1VBUA 1A47A 1FHDA 1LQ0A 5C71A 5FD0A 2VZTA 2QF8A 4D6DA 3SUVA 1E4NA 1E72M 1UWRA 4MDPA 5ABGA 4ATLA 4JKMA 3AQUA 3NCOA 5A6BA 5CGTA 3SCOA 1NP2A 2ZUMA 2J7GA 2Y2WA 3PN8A 5BWFA 3VVGA 4MNKA 4QLLA 3ARTA 4Z2HA 1AQ0A 1BVNP 4JCMA 1US3A 1NARA 1KCLA 5CGMA 1OSEA 4DUWA 2QMKA 1MXGA 5A8MA 2XM1A 3O9NA 3NJ3A 1W9UA 1QNPA 3OG2A 1QNSA 1CYGA 3MMUA 3WQ6A 2BVTA 3AHYA 3AIUA 3VINA 1QNQA 1FH7A 3DYMA 3MS8A 3N13A 5I79A 3MKKA 3KWXA 3VTRA 2V3GA 4V28A 4UZUA 5E9AA 3ZSTA 4HMEA 5BRPA 1W1VA 2VTFA 3GH5A 1CECA 3GNPA 7A3HA 2BY2A 2WHJA 1IV8A 2W91A 3LPPA 4LYPA 2W61A 3AI0A 3FHQA 4JKLA 1C90A 4P8WA 1B3YA 1JYNA 5DMYA 3B8SA 1J18A 4CU6A 4U3CA 1TVNA 3WDJA 3CUIA 5A3HA 1Y7VA 3IJ8A 2WMIA 4WJXA 3WSUA 2WHLA 2J78A 2XUCA 4ZFMA 1UH3A 4MNLA 1VFFA 3BAWA 1E6RA 2BVDA 3UETA 2VT0A 1UR1A 1Q6GA 2F2HA 1H09A 5A6MA 2YBUA 1NOUA 4X9YA 1E9LA 1BQCA 1H2JA 2E9LA 3TONA 4CD8A 3BAJA 2OWWA 1Q6DA 1ZBKA 4NI3A 3SUTA 2BV9A 2YL8A 3GYCA 4TTUA 3SUUA 1A3HA 4LGXA 4CU7A 2D0GA 1W9DM 1CGTA 1FH9A 3T2OA 4HA3A 5HBFA 5M3WA 1GQIA 1NQ6A 5I77A 4LQ1A 3W81A 4TVCA 3LPGA 1E0WA 3AICA 2CHOA 4HTYA 1E40A 4KRUA 3A3HA 5CJ5A 3WUFA 3J7HA 1HL9A 1NM9A 1X1NA 1LLOA 1E4IA 2J8FA 2EXOA 4C7FA 3HJEA 2ZXQA 3M46A 5C8BB 5HPCA 1KXVA 2Y8VA 2WKLA 2PBOA 3O6AA 3VMOA 4J3UA 1IZJA 4UFLA 2UY4A 1NWTA 1G1YA 2FGZA 1DWHM 3RCNA 1BG4A 2EPOA 1CXEA 1J10A 2VRKA 2WW5A 1C93A 1KGWA 1QHPA 3NYDA 3B9AA 5BXRA 2WC3A 4AZHA 4D6IA 9CGTA 5LA1A 1VIWA 2G41A 1NH6A 2DH2A 3B9DA 4HOWA 5JIWA 3AXXA 3PZOA 4AIEA 1WDQA 2OSXA 4UCFA 4D6EA 4JFTA 5I78A 1E6ZA 4J28A 1JNDA 1V0KA 3GXFA 4UFKA 2WHKA 4DUVA 2VX4A 3EDEA 4M8UA 1ISVA 4PTXA 4AZCA 4AWEA 5IDIA 1CGXA 1XCXA 4IUGA 4U31A 1H0IA 1XYZA 5E0CA 2XVPA 3SCPA 3WFLA 1R87A 4AIOA 2DT3A 4AXNA 1C91A 2X0HA 5A1AA 1Z32X 4PMXA 3AMKA 2VCBA 4AD5A 2TAAA 3G6MA 2XG9A 2X8RA 2XFRA 4HU8A 3VDHA 1JZ8A 4OOZA 1R8LA 4IPNB 1H3GA 4TTGA 1B3WA 5JBEA 1RPKA 1JNEA 3BAYA 4UOQA 4IPLA 1QNOA 3ZIZA 1CBGA 3W28A 1OIFA 3SCSA 3U57A 3AROA 3THDA 1JAKA 5A6KA 4MTVA 1DWFM 2V38A 1EOKA 3AIRA 3WMSA 1RP8A 1TCMA 3GBDA 4ZE4A 4HOXA 1GHRA 1JZ5A 3WDQA 3F5KA 3AS0A 4AYSA 3WUGA 3OLIA 2DGAA 4PMRA 5I24A 4TXEA 1W1TA 1QW9A 2WM0A 3VNYA 1I1WA 1TZ7A 3N11A 1JFHA 1UH4A 2GJRA 4PMVA 3ZT5A 3TOPA 4W85A 4WF7A 1EQPA 1E1FA 3PZUA 4UNIA 2QMJA 3PHAA 2CEQA 4KGLA 2XHYA 3CO4A 2DT2A 2JF7A 4DUXA 2CBJA 1R7OA 2G3IA 4D6HA 1H1NA 4S3KA 4LPCA 2W92A 5A94A 1KR1A 5IHRA 2EPNA 3CZEA 1WCGA 3WDIA 1ITCA 2BY3A 3GXMA 2JALA 2WHMA 2JEPA 3U7VA 3WDPP 2WSKA 1V08A 3DYPA 1UQYA 2OWXA 3ZJKA 1YHTA 1KXHA 1QI0A 1V02E 1QBAA 4J27A 4U3AA 3CZ8A 4OZOA 4W87A 4P8UA 1UR8A 3VGBA 4ML4A 2W63A 3CPUA 5IFPA 1W9VA 4DWSD 1ISZA 3CBWA 1JGIA 2J7FA 1U33A 5A6JA 4U5KA 2VQUA 3DC0A 4KRTA 1QW8A 1V03A 3ZM8A 1H4PA 3ZR6A 2PI6A 4P7NA 2VX7A 4UOJA 4JZ5A 3THCA 1UZ4A 4AY1A 2VZSA 1BLIA 4HA4A 2WBKA 4WKFA 2AMGA 1KBBA 4PBGA 2CBUA 1JYWA 1KXTA 2ZX9A 5M5DA 2E9MA 4LYRA 1SMDA 1LF1A 3UCQA 4PUEA 1MW1A 5I3DA 1DTUA 1LL7A 4XX6A 3MSDA 1QI5A 1AVAA 4E8DA 1EDGA 1CXHA 1W9BM 3OZOA 4HZ7A 3L2LA 3QHNA 4MB1A 4QCEA 4WKHA 4HOZA 3BLPX 2OSYA 3VIHA 2WCGA 2AAAA 4CVWA 3QOKA 4W8BA 4NSBA 4D6GA 5CSUA 2WLYA 3IANA 3L4WA 4UFJA 1LG2A 1E4LA 2ZIDA 5CPTA 4P7RA 1OT1A 3VX1A 2WVUA 3MUY1 1KQZA 1UKQA 1TA3A 1CXIA 2PWHA 1V3LA 5E6YA 1E43A 3WD3A 4D6FA 4M80A 2XFYA 3K8MA 5DEZA 3MO4A 3OGRA 4W8LA 3MMDA 2WVVA 2BY1A 4AD3A 3N9KA 4PMQA 2ZX6A 5EB8A 1J0IA 3QHMA 2QLYA 3AXIA 1QPKA 2D3LA 2WCSA 1B1YA 2FGLA 2XIBA 3F4VA 3W26A 3OBAA 4EANA 1JFXA 5A6BD 3WEMA 2IXUA 4JKKA 4EAMA 4GI9A 4OJYA 3WQWA 2CBIA 2E8YA 4CD7A 5D9MA 3L4TA 1HJSA 4FLRA 5FIPA 1UKOA 1JF6A 3FW6A 1XRVA 2JIWA 3WL1A 4JFUA 3GXIA 4WLCA 3RM8A 1HP5A 1VJSA 4DWSC 3W6LA 3MU7A 5ABEA 2ZXDA 1WO2A 2WXDM 1LG1A 1OGBA 4PMUA 3ZOAA 2OLHA 4FLQA 4WSKA 4CUCA 1ITXA 4WKAA 4AEFA 1UKPA 5DT7A 1ECEA 1GPFA 3MSGA 4JFSA 1V6YA 2CIPA 2F61A 4BQ2A 4W8AA 5A6AA 5IXEA 1ZU8A 4HZ6A 3EDJA 1QOXA 4H8HA 4OBRA 2WMHA 4E4PA 2XGIA 1EQCA 1QBBA 4MNMA 4M1RA 1NWRA 1E1EA 1CNVA 1W1PA 4QDMA 5I2UA 4CCEA 2CHNA 1TUXA 4UFHA 1XH0A 1IT0A 1MW2A 4GINA 4WSJA 1J0YA 5EMYA 1CDGA 4CVUA 2ZUTA 3AIEA 5DFAA 1XSIA 2X2YA 2J77A 2D23A 3ALGA 4MAVA 3AZRA 4PCSA 4PSRA 3A4AA 3AYSA 4V2XA 3N17A 1MXDA 1PJ9A 1R85A 4IM4A 2XPKA 3VD5A 3BSHA 1E71M 3N1AA 1UD8A 2GFTA 3ARPA 2EBNA 3ZT6A 3BMVA 3AMGA 4OUEA 2OSWA 5F7UA 4CU8A 3MUAA 3W38A 3TTYA 1EIBA 2CKSA 4AMCA 1JI1A 3TTOA 3VM7A 4NRSA 1EDTA 4M24A 4CD6A 4ACZA 2VCCA 5A2CA 1KQYA 2GVYA 4U2ZA 3UG3A 3KZSA 4PMDA 1B3ZA 3NDZA 1MFUA 3CZLA 4UOZA 2PBGA 2WVTA 4HU0A 5AY7A 5EFFA 2YDSA 4MADA 3ALFA 4PYSA 3RDKA 2BXZA 1W9PA 2CXGA 4UQ9A 1HKJA 4AD4A 4UR9A 2WZIA 1V0MA 3CH9A 4D6CA 1L8NA 4DWSB 5A69A 2DSVA 3OB8A 2BNJA 2WMKA 3AISA 4F66A 4JIEA 2GJPA 1G94A 4BA0A 1NOFA 4HPHA 5CPQA 4E2OA 6TAAA 3PBGA 1RH9A 2D1ZA 4B16A 1CZ1A 4HPGA 1E55A 3KE0A 3K4DA 4GZEA 4CCDA 3DHUA 1UWTA 4QLKA 1XH1A 3VIJA 4B9YA 4CN1A 5HXMA 3F5LA 1R86A 1WB0A 1HJQA 5I6SA 4BF7A 1WDSA 1JYXA 1ZL1A 3OA5A 4W84A 4GZIA 4CD4A 3PTKA 5DO8A 4A4AA 3GXDA 1ZB5A 3CMGA 4AZGA 1FH8A 3SCUA 1CWYA 3UESA 1N82A 5E6ZA 1VAHA 1GZJA 4QCFA 2YA2A 1Q6CA 2WB5A 4W7WA 2ZWZA 3BSGA 3I3EA 2G3JA 2J7HA 3BMWA 1DWGM 4B15A 4HA1A 3TP4A 2VC9A 1X6NA 4B9ZA 3T09A 2VI0A 1GJUA 2RGMA 1BAGA 1JXKA 1GOIA 1PBGA 1M04A 2J25A 3NSXA 1PX3A 2D0FA 3WEZA 4J3XA 1FFRA 3W53A 3EBVA 4ATWA 1GVIA 3WH7A 3ZJ8A 2J47A 4ZEPA 1HJWA 2O9PA 1B3VA 1EOMA 2YLAA 3WD0A 4MJ4A 3AZSA 4UQEA 3GDBA 1GW1A 4J3VA 3SEPA 4ZXOA 3PZ9A 4MAZA 2JF6A 2DSWA 1D2KA 4UZSA 1JIBA 4WIWA 3W6MA 3AS1A 1V3IA 1BGGA 3VO0A 2WWDA 3RILA 2DIJA 4TVUA 3WNOA 4H7VA 1LWHA 1UKSA 1K9DA 4C7DA 2Z1KA 1HL8A 4RE3A 4FLOA 3ARYA 1QHOA 4PMYA 1HKIA 2YLLA 1CTNA 4QAWA 3ZJ6A 1PX4A 1GUVA 5E09A 3MMWA 1E4MM 2NW0A 1BTCA 5KEZA 1JZ2A 3HMCA 2DH3A 3GTNA 3AMDA 1LL6A 3ARQA 3U5UA 1J0JA 5ABHA 2EPMX 3K8LA 3JUGA 1JYVA 5JBDA 4V27A 4D1JA 3VM5A 1I1XA 3AS3A 4QLJA 3WF1A 1HF6A 1W3KA 4AZIA 4IISA 3RMEA 3GM8A 1DEDA 4P7QA 2X09A 4B3LA 1B30A 1E0VA 2G4FA 3VGFA 3OLDA 1HT6A 2CERA 2BFGA 4OOUA 4UFMA 2DSUA 1CGUA 3HU7A 4W5ZA 4N42A 5D8ZA 1E3XA 4J7RA 4MDOA 1JDDA 5LA2A 2VRQA 1CENA 5EFDA 3BCFA 3AZTA 5BXTA 1YQ2A 2EO7A 2WMIB 4DM1A 1G0CA 2ZUUA 3A4XA 4NF7A 3WIJA 1JD7A 1CEOA 3CUFA 3CUJA 4AZBA 5ABFA 2WVSA 1HJXA 1HKKA 2W5FA 2CPUA 3OIHA 1UR4A 2XSBA 4RL3A 5FCZA 3W82A 1BHGA 3KL0A 3SCRA 3ZMRA 4R5EA 1HX0A 2FDMA 1ISYA 1HVXA 1OBAA 2PWGA 5E70A 4GO8A 5A8PA 1M53A 3UG4A 1KR0A 3SUWA 2BVYA 4OBSA 1OM0A 3GH7A 1HP4A 1MWOA 2Y5EA 1HJUA 4ZENA 1OB0A 4A3YA 1BSIA 1GORA 1H49A 2GUYA 2WYSA 2XFFA 5ECUA 4URIA 2J4GA 2GDUA 4M81A 4J3SA 4AD0A 1WAWA 3VD3A 2ZXBA 3NUKA 5JUVA 1KWKA 1MFVA 3AFBA 2AOSA 3CLWA 5AYIA 1FHLA 4FMVA 2VR5A 5IHSA 3APGA 4GI8A 1CXLA 3S2CA 3SCWA 1VFUA 1EO7A 3T2PA 2JEQA 4F8XA 2FHCA 4A3HA 1EDQA 2XIIA 2Y4SA 3W0KA 2G8ZA 2BY0A 1WE5A 4M29A 2J7CA 3WKZA 1WNOA 2DQXA 1XD1A 4MB5A 3WF2A 2FHFA 1CXFA 1EHAA 3T08A 4H04A 4W88A 3WNKA 5AC4A 2Y24A 3VIGA 1SYTA 1VF8A 1D3CA 1PX8A 2V5CA 4UTFA 1PAMA 1B9ZA 1E6NA 1DWAM 1E5JA 3BGAA 3QOMA 4XV0A 1UD6A 1R7AA 1VFMA 3OZPA 4BCEA 4BQ5A 4X0NA 3IAPA 2E3ZA 3VIFA 4AZCB 3VIOA 2DT1A 1C7SA 1E56A 1FA2A 1EXPA 2NSXA 2V3EA 1W91A 1I75A 1DHKA 2VX6A 2OYLA 1AQHA 2W66A 1W3HA 3WL0A 3WF3A 1JDCA 3PZMA 3WN6A 1KBKA 3WH6A 4CCCA 3DECA 5GNZA 3BAKA 4F9DA 1ODUA 1ZBCA 2J7DA 3ARSA 3VX0A 5I0DA 2EPLX 2W62A 3M6DA 4CN6A 3EDFA 4GIAA 4QP0A 4JHZA 2VURA 2ZOXA 3IK2A 3CUGA 1FOBA 4ZE5A 4UQAA 1UD5A 3VD9A 1WZAA 2YBTA 2VL4A 1QHZA 2Y8KA 1KWGA 3BXWA 1GQLA 3WD4A 3L4UA 1GCYA 3WF0A 2YOCA 1JZ7A 3A6OA 1GOWA 1M03A 4DM2A 3VIIA 1VFOA 1DP0A 5IFTA 4BQ3A 2YL9A 1Q6FA 5AC5A 1G9HA 3KL3A 2YL5A 3VU2A 2E40A 3IAQA 2WK2A 4BS0A 3UG5A 4P8XA 3VUPA 4AD2A 2E0PA 3WENA 3PZQA 8A3HA 2OYKA 2VZVA 1OGGA 1J9YA 3G6LA 1UH2A 3WDHA 5KZ6A 1B31A 3ZT7A 3ARWA 4KMQA 3UEQA 5DF0A 2GJXA 1H0GA 2VQTA 5CPSA 4CKQA 2YIHA 2HVMA 3MUIA 3N18A 4EKJA 1ESWA 1J0KA 3PZVA 2A3HA 1BGAA 4UQCA 1E6QM 3BAXA 3QR3A 3ZQ9A 2VOTA 1B0IA 3PZGA 2WAGA 3L4XA 3CUHA 2UWFA 3T0DA 2DSZA 2VVSA 3RJXA 4M56A 5GNXA 1WZMA 1GQKA 2CESA 3POCA 3SCTA 4X0VA 1VB9A 3WMBA 3NIYA 1O7AA 4J3WA 3ZSSA 2J74A 4J3TA 4XB3A 1K9EA 1WP6A 2NT1A 3UR8A 3W37A 1W3JA 3HN3A 3T0BA 1OIMA 3VIPA 1HXJA 1V0NA 1JF5A 4PCTA 3VIKA 3MV01 3UR7A 2W67A 1CGWA 2YA0A 1Q4NX 1UR9A 3E1F1 2WBGA 2XVKA 4LYQA 2ZX5A 3KL5A 1BYAA 1WKYA 2ESCA 1C8YA 2B31A 3WH8A 7CGTA 4JFWA 4Y7EA 2ZWYA 4PN2A 4W7VA 3VDBA 2E4TA 2XGBA 2CYGA 5GQBA 4F79A 2FH6A 3CHCA 3VGDA 1EO5A 1WZLA 3SCNA 2O9OA 1E73M 3D5HA 2CNCA 2PWDA 2CETA 3AIVA 2JFEX 1OINA 1TMQA 2VJXA 3GZAA 2ZICA 2EPKX 5HPOA 2FHBA 4W5UA 2XVLA 2BXYA 3N04A 5LYRA 3VIMA 3WNMA 2XWEA 1OWQA 1ISXA 2WZEA 2O9TA 2E9BA 4ACYA 5CZKA 1TA3B 5A6LA 3BC9A 3CZJA 1JZ6A 3T2QA 4P7LA 1UHVA 8CGTA 3VGHA 1QNRA 3CIVA 2WVVB 4GI6A 1XYFA 2VCAA 4Z2GA 1ISWA 5BYWA 2V5DA 3AMLA 5CXPA 1CPUA 1JG9A 1M01A 1HN1A 4L4OA 2ZX7A 1UOKA 2DDXA 1TFVA 3ARVA 3ARZA 2GSJA 2UY2A 4TVDA 2BS9A 1E6XM 6A3HA 6CGTA 1PZ3A 2CCRA 4EE9A 2V3FA 4ATDA 3POHA 3II1A 4R27A 2XVGA 4PMNA 3RJYA 3I3DA 3PZIA 4AC1X 1RD6A 3FNDA 4MPKA 4CD5A 3ARUA 4WK9A 1CLVA 3LPOA 2WZHA 3WY1A 1QI2A 4AISA 1W1YA 4ZXLA 3MUZ1 2A3CA 2D2OA 4NZCA 4BZYA 2PB1A 1E5NA 4GQQA 2ZUWA 1XSJA 5FL1A 1WPCA 4U5IA 2W4XA 2CKRA 3TTSA 1UYQA 4Z2IA 5A8OA 3SCVA 3WEOA 3AOFA 2F8QA 3CHDA 3PZNA 1MYRA 3WBAA 1ODZA 1GNXA 1ZJAA 3WFZA 1TVPA 2WLZA 4LXFA 4C7GA 2BHZA 1G01A 3CGTA 1BG9A 1BYDA 5A95A 2X0YA 4YHEA 3WUEA 4PTMA 4KGJA 1V3KA 3N15A 1X6LA 4PRWA 3W27A 1EA9C 3L4VA 2D3NA 3ARXA 3VMNA 4H41A 2QPSA 5M17A 1PZ2A 3PZTA 3O2LA 3ZO9A 1LJYA 3LPFA 1K6AA 3SIMA 4L4PA 1E15A 1E6PA 3MV11 3AHZA 1UA7A 1TE1A 1VRXA 1BPLB 1G5AA 5EBAA 3AJ7A 3B9EA 3WQ8A 1F4AA 1V6XA 2XTKA 4HP5A 3WD1A 3CHFA 2OYMA 1EHNA 4TUFA 5HOSA 3EMQA 2J75A 3RO8A 2BHUA 1TR1A 2XYLA 4PMOA 1SMAA 2WMJA 1H11A 4ACZB 1M7XA 4XZBA 3EDKA 4TX6A 3OLGA 1E6SM 1L0PA 2X1IA 3F5JA 5A2AA 1W9XA 4RE2A 1UZ1A 2VR4A 1VEMA 4QFUA 2WSPA 4E8CA 4GPNA 1W32A 1MQRA 2YA1A 1MW3A 1B2YA 1B90A 5LA0A 1KGUA 3VKKA 5I23A 2ZXAA 1H41A 3WH9A 1TG7A 2DEPA 4UFIA 1FFQA 1LWJA 4JCLA 3WF4A 3EYPA 1K9FA 4UQBA 4PMZA 3ZR5A 1UD4A 3IJ7A 1D7FA 2V3DA 4EK7A 3VGGA 2YL6A 3GNRA 3TTQA 1GOMA 3GNOA 1OD8A 2PF0A 3CZGA 2CBVA 1UR0A 4TX8A 3WUBA 3VGEA 3WBEA 2ZUSA 3SURA 2C8NA 5GNYA 1J01A 2JIEA 2DPEA 1PIFA 3WD2A 1C3FA 4Z2JA 1UD3A 4KH2A 3EMZA 5I5RA 1CLXA 1BF2A 1UR2A 1AMYA 1OGSA 4XUYA 2HISA 5D9PA 1RP9A 1NOWA 2VO5A 1PEZA 3K8KA 4JL1A 3PTQA 2YKKA 4B3KA 4JL2A 3BCDA 3A4WA 3QHOA 2VNCA 7TAAA 1QVBA 1JAEA 1ZBWA 5CSYA 2XSAA 2ZX8A 2VRJA 1U2YA 5BXPA 1P6WA 1V6WA 1ZJBA 2WPGA 4LX4A 4OKDA 3GBEA 4M82A 1J0HA 3BLKA 3RPMA 1ZS2A
chains in the Genus database with same CATH superfamily
1XD0A 1W2PA 2OKOA 4XIMA 1VBRA 3C2OA 3WLHA 1JI2A 1MNSA 3U2EA 1TPUA 4FHAA 1E70M 1MQQA 4H19A 2QPUA 1XUUA 1V3HA 1SZRA 2GK1A 1XIFA 3BOLA 3LGGA 1HVQA 1RPXA 2E6DA 1XCWA 4AD1A 5CC3A 5FL0A 4LW7A 3PF3A 1FWSA 2OQYA 3MTWA 3SW6A 2PDIA 3PPFA 2V8ZA 1UOZA 3GH4A 1ZP4A 3UWVA 3TW6A 3R0KA 1YXYA 4F0LA 2YDRA 3ECQA 3NDYA 1IEXA 4LB3A 3KHJA 1NWUA 2QV4A 5AFDA 1X1ZA 4G5DA 1EXBA 4Q8NA 1MEWA 4H9TA 4L1XA 4XG1A 4C5ZA 3FDGA 4C1LA 3FHAA 5T26A 4HZ8A 5D9NA 4QEEA 3OO2A 3M0XA 3ABXA 1KGXA 2CW6A 5HJYA 2RDXA 1V0LA 4LBRA 1KFLA 4KWSA 3AXKA 3GDKA 2EG6A 4UTWA 3WNLA 4K37A 4AZ7A 1XLKA 4JTEA 4MHBA 4LANA 1TELA 3QXBA 4GRSA 4DLMA 2GQAA 3IIOA 5GJNA 3GW0A 1H5YA 3C8FA 3UW6A 3UERA 3AIWA 2E77A 1IGWA 2JQXA 1N55A 2CLMA 5ABFB 2NT0A 4KWUA 2D22A 2G97A 3GDLA 4YWIA 4XAZA 3DCPA 1EGMA 3CAKA 1P0DA 5C54A 4QG8A 1GQJA 4OU1A 3WLRA 4MZ1A 4HJFA 2DIKA 4LC8A 4GUFA 2J7EA 2Z25A 3OGVA 4GZJA 3EX3A 4WXZA 2EQDA 3C4UA 3DEQA 2ISWA 3RO6A 1WQ5A 1KB3A 4PRRA 5AYBA 4E2VA 1FP8A 3UQNA 2Z1SA 1XDMA 2PWFA 2RHGA 1L9WA 4CGTA 3NSNA 3BURA 3CZKA 3UJRA 5KETA 1Q2SA 5D05A 4LRSA 1A5BA 1K77A 1K8CA 4DI9A 1BD0A 9XIMA 3L66A 2FZBA 2YCLA 3FAXA 6ENLA 2C19A 4GI4A 5HNNA 1XSKA 2PLJA 5H8MA 5DBUA 3T07A 4IIDA 1XGEA 4F2BA 4TMCA 1JR1A 3P6LA 3W1RA 3N34A 5AHIA 5FEXA 4NRRA 2PWEA 1UWIA 2OWCA 1JD9A 4W86A 4WY0A 1V02A 4C6CA 1PDYA 4W9TA 3PUDA 4AXKA 3QGVA 4BY3A 2W9MA 3WMCA 3KBMA 4RZ6A 3LSCA 1GVEA 2CZVA 4TOQA 5CLWA 4FSAA 3DYOA 4CN4A 2D0HA 3U9IA 1XFCA 4JAWA 4GXPA 1UUMA 4QNEA 3U5YA 5JIPA 2G3NA 1JVNA 4QX4A 4ICCX 5F1UA 1GHSA 2F84A 1DWJM 1IXPA 2FH8A 3EWXA 2BBFA 5DT5A 3MHUA 4XAPA 3LRKA 5A2BA 1W2VA 2X30A 3LHVA 6XIMA 1TV5A 2ATSA 2QHAA 4G6CA 2OXNA 3T8LA 3LGEA 5FOOA 4GJIA 4B5NA 1X8FA 4X3ZA 2EF9A 2V67A 3M43A 1JEZA 3WQVA 3VKDA 3RM9A 2Q8XA 4N6FA 2CITA 4Z2LA 3EPMA 4K6AA 2J62A 4OHQA 3B0VC 2ZZ4A 3GFXA 4JIRA 3UPBA 3VD4A 4RV3A 4ZBCA 1OC7A 4D9PA 3G1RA 3W7MA 4QNWA 4XAFA 3QY8A 2XZ9A 2QT3A 2WZTA 3MWAA 2BHYA 4YJ5A 2PS2A 2D24A 1EJTC 1VJZA 4HPXA 1HJVA 3RM4A 2PC8A 3ITXA 4R3UA 3CMJA 5LNUA 4HNTA 3M0JA 4P7OA 1Q6EA 4M5PA 2I9UA 2NXIA 1VBUA 3SI9A 4ZQCA 1LQ0A 2DZBA 3GNDA 5FD0A 1UP3A 1JQXA 3NQ7A 1R46A 1E4NA 1E72M 5C0QA 2OZ0A 3TLLA 4ATLA 3AQUA 4NJJA 1S2WA 2YR1A 2J7GA 2Y2WA 3T42A 4MNKA 3PY2A 3VOJA 4EXQA 1XBZA 3EWYA 3TZNA 1NARA 2D2GA 2QMKA 1MXGA 1YLVA 2DORA 4GZ7A 2XM1A 3NJ3A 4JTHA 4O4WA 2ZA2A 4Q8WA 3SN1A 3CM4A 4PUMA 3B06A 4NU7A 3KWXA 3WJXA 1Y8BA 5HWJA 4V28A 4UZUA 4GBUA 5IBXA 5BRPA 2NXGA 5IM51 4RZ5A 1AW2A 3CLMA 1EC8A 2BY2A 1IV8A 2W91A 3LPPA 4XD5A 4CCZA 4HNVA 1C90A 3G1AA 1JQVA 2YZ5A 1TVNA 4HU3A 5A3HA 1CB2A 3IJ8A 3SN4A 2J78A 3E2SA 3ZR4A 3G2GA 4DBEA 3G1HA 1UH3A 3GAYA 3KHDA 2BVDA 1UR1A 4KWVA 5KZEA 3TFCA 4HK5A 2F2HA 1H50A 2F2KA 5D30A 2YBUA 1XQLA 2BMBA 3C6CA 3ZLFA 1Y5XA 4CD8A 4LUYA 5FJJA 2X1TA 3HQPA 4ALDA 1DQXA 4NI3A 2BV9A 2YL8A 1NFPA 5LNRA 1NDWA 4OT7A 1EA0A 3BJTA 4IP4A 3LBMA 2WNZA 3JZEA 1AD4A 4C1NA 1E0WA 1OYCA 3LHYA 4JEQA 2R6OA 3C2VA 3WUFA 1VR6A 2HVNA 1LLOA 2EJAA 3HJEA 2ZXQA 4XVDA 4Q8QA 5HPCA 4QDPA 1OFQA 4J3UA 1IQ8A 1VD6A 3VNIA 2FFIA 3RCNA 2X1UA 1J10A 4UC5A 3O16A 3B03A 4I3GA 2G0WA 4PUKA 7ODCA 2PD9A 5LA1A 3MCOA 1VIWA 3M5VA 1FWFC 5TIMA 3PZOA 4H6QA 4WGXA 3GWQA 1P4CA 1SSGA 4KFPA 3P5ZA 4D6EA 3PBUA 1V0KA 1FWAC 4UFKA 4HNUA 1TWWA 4AWEA 5LGXA 3BDKA 3M6YA 3QFEA 4U31A 2P8CA 3S2LA 2ISDA 5D02A 3INPA 3KOXA 1KRCC 3GHRA 4LU0A 5A1AA 3LCIA 4WSHA 2ZA3A 2VCBA 1VIZA 4AD5A 3G6MA 3VZXA 3QZEA 1JZ8A 4GXMA 3VDHA 1W1ZA 4DNHA 1B3WA 3W88A 1RPKA 2F7FA 1EYEA 3LZ3A 1YDOA 4IPLA 2OVLA 1A0EA 4Q32A 2FTYA 4XZLX 4C6BA 2J9YA 1RBLA 3I6EA 3KDOA 1H7NA 1AW5A 4NNBA 1K7EA 3BLDA 4BI5A 4UMCA 1QPNA 5A6KA 3OVRA 4LFYA 3TYUA 5HMSA 2V38A 2PDCA 1BTMA 3GBDA 2BODX 4HOXA 5GJMA 5LNSA 3F5KA 3AS0A 3BUVA 4FXSA 4AYSA 4Y9MA 3SZ8A 3TSMA 3O15A 4IH3A 2DGAA 4PMRA 4YU1A 3EXTA 1OK4A 5I06A 3VNYA 2EPHA 1FVPA 1TZ7A 3AYTA 3WLMA 3E38A 3ZT5A 1OFEA 4E3TA 4WF7A 4GBDA 1EQPA 3W1LA 2ABAA 1I2QA 2W79A 4KGLA 3SADA 2CBJA 1R0MA 4D6HA 4XIAA 3PNZA 1WAUA 4IMCA 3U3HA 2W92A 1SZFA 1BSLA 1VFSA 3DFTA 4FNQA 4MVAA 3QY7A 4OUIA 1PHWA 2WHMA 3WDPP 3NQAA 1DE5A 4L6DA 1PO9A 3DYPA 3SSJA 4D8AA 1KXHA 2NQJA 3EA1A 4O17A 4YIWA 4NZ4A 2ZQ0A 4MOZA 1UZHA 3GHUA 3OYXA 1M7PA 4ML4A 5CCZA 4LJ3A 4DWSD 1GKPA 4ZSUA 1HZYA 4HN8A 3MHGA 4XTDA 4U5KA 1IT7A 3V16A 1V03A 1WV2A 3ZM8A 3ZR6A 3QN3A 4PEKA 3I7RA 3SQMA 4AY1A 4GGBA 2FDSA 1HKVA 4QR6A 2PZ0A 4V33A 2WBKA 1GG0A 3G1XA 4YTRA 4IT1A 4B4FA 1KXTA 2C1GA 3GKAA 3UNDA 1W5PA 2C79A 3KBJA 1LF1A 3KUMA 4BWLA 1MW1A 1LL7A 3MSDA 1M6JA 1QI5A 4BI6A 1AVAA 4E8DA 4GNKB 3LB0A 4EPEC 1EP2A 4LBUA 3GD6A 4QCEA 3EA2A 2P0IA 2UV8G 4CVWA 1HG3A 4NSBA 4D6GA 5AZ0A 3L4WA 4UFJA 2ZIDA 2CHRA 2HVOA 1OT1A 2VP8A 3VX1A 2RDUA 2TRSA 1HO4A 1L6GA 1AUSL 3LCLA 1KO0A 3FYOA 3MO4A 4W8LA 4QQ3A 4EP8C 4J2PA 2BY1A 3E0WA 4AWUA 1M1BA 3DI0A 4AD3A 4Q4OA 4PMQA 3H4GA 3AXIA 2C16A 1QPKA 5DBTA 2XIBA 3W26A 1HL2A 1ZJIA 4EANA 3CWOX 5A6BD 4K7VA 3SQLA 1GEHA 1OFAA 2Y0FA 3FFSA 4GI9A 2E8YA 1UKOA 4FS9A 1A5NC 3VKCA 1R30A 3FW6A 1K02A 4JFUA 3GXIA 1VJSA 4B5VA 2FPTA 3VA8A 3CMFA 5ABEA 4WJ8A 3C2EA 1OGBA 3G3DA 4PMUA 3N4AA 3TAKA 1I6NA 3UZXA 5DT7A 1EUAA 4O4VA 3ZVHA 2PTYA 4BQ2A 1XKJA 1XI3A 4JTLA 5A6AA 3NQEA 3N14A 1XLCA 4UTUA 3C3NA 4DO7A 4L6OA 3PNUA 1QK2A 4E4PA 2YYUA 5CZTA 1QBBA 3W86A 4UTIA 1CNVA 3DUGA 4QDMA 1WA3A 2ZZ1A 3KP1A 4Q8TA 2AQVA 3QH2A 3TSBA 4YCPA 1TUXA 6ALDA 1BRLB 1TPFA 5EMYA 3FJ4A 1P7TA 4HA0A 3PUEA 2HWGA 1XSIA 2J77A 3UZJA 2OB3A 4UTTC 1KBJA 4PSRA 3Q2DA 1R85A 4Z0JA 3EKLA 4FNSA 4CNOA 3TAOA 3BSHA 3RR4A 1EJ7L 1UD8A 3LHTA 3ZT6A 5DCEA 4S38A 2QKFA 4OUEA 4X60A 2YB1A 2DW6A 3ZYZA 4AMCA 3G5EA 1PL9A 2ZDSA 3PJWA 3ITOA 1PCWA 2XH2A 3VM7A 3WQCA 4LYKA 1XIGA 1EDTA 4AY7A 1RR2A 4BK9A 4ACZA 3SRDA 2C1HA 2Q6ZA 4U2ZA 5BU9A 2GGJA 4UOZA 2QJJA 4MADA 2BXZA 1PKMA 4AD4A 3W87A 4GIRA 3AWNA 3UT0A 4E0CA 1LT7A 3CT7A 3PBGA 3MT1A 1RH9A 1O5RA 2D1ZA 1YKWA 3KE0A 4EACA 1D8WA 2X42A 5MF5A 3L0KA 4CCDA 3DHUA 4QLKA 1XH1A 3VIJA 4GC4A 4F3HA 2GQ9A 4IIFA 5HXMA 4DPQA 5D2VA 1O60A 7XIMA 1U1UA 1JYXA 4O16A 1ZL1A 3OA5A 4CD4A 1RALA 5EYWA 3GXDA 3GXTA 4XTIA 4N2YA 1SPQA 3TWBA 1Q6CA 3MA8A 2ZWZA 1LUCB 1TJ1A 2NUYA 3JS3A 3S5SA 2GGGA 3BMWA 4B15A 3JU2A 4JQ1A 4UTJA 4QG9A 2X41A 4B9ZA 2AKMA 5CZ0A 2PLKA 1GJUA 2RGMA 1BAGA 3V4BA 3NSXA 1TKKA 2PDUA 1PX3A 3TLQA 2KZHA 4A2RA 1FFRA 2TODA 4DF1A 4ATWA 1F8IA 1QOPA 1ZRQA 2J47A 1ZY9A 4EIVA 2Y63A 1ZP3A 3WLLA 1B3VA 1EOMA 2B4GA 2PDJA 4MF4A 3ABOA 3G1VA 2B7NA 1GW1A 4J3VA 4ZXOA 2QEZA 3CS2A 4K8EA 3W1MA 2QVHA 4G2DA 8XIMA 4DJDA 3W6MA 2HTMA 1SQ7A 3VO0A 1SJCA 3RILA 2DIJA 4PL1A 4H00A 2FVMA 3DBNA 1M68A 4RE3A 4FLOA 3OJGA 3NWRA 4GH3A 3DKLA 4HYWA 1ME7A 3TX9A 4V1YA 1PDZA 4IUOA 3ZLHA 1UPPA 3O7UA 5AC7A 3AMDA 2EPMX 3K8LA 1U1JA 1JYVA 3VM5A 3LDVA 1E0TA 4QLJA 1HKWA 1SSDA 3GU9A 5AKQA 2DZWA 5C55A 3GFZA 3COTA 4Y8EA 1DEDA 2QAPA 3KCOA 1B30A 3A24A 1I4NA 2G4FA 4CLMA 3VGFA 1V79A 2CERA 2A5HA 1RJQA 4LAOA 3UBPC 2WPBA 5D8ZA 3OVPA 5LA2A 1JDDA 1R6WA 3RMJA 3BCFA 4GUIA 1X7FA 3NZRA 1YQ2A 5CBJA 2VFDA 3D0CA 2BOGX 2ZUUA 3ICJA 3WQFA 4JN7A 5DMMA 4PC8A 3CUJA 5ABFA 3SGGA 3UZWA 1V5XA 2Z2AA 3MZ2A 2WVSA 4H7CA 2CLEA 3TMQA 4L1WA 4G1KA 1BHGA 1XG4A 2PTZA 3ZMRA 4H6RA 3WBYA 1OG6A 2PWGA 5E70A 5FI8A 2YFOA 4JTCA 3UWWA 4F2TA 3IVTA 4OBSA 1JPDX 2OCZA 1MWOA 3MVTA 4MUPA 1OB0A 1BSIA 4WDXA 1YE4A 5I09A 1HFBA 2NQLA 4LUSB 4JTKA 1TPVA 2GDUA 3O3RA 1GTHA 2JKAA 4J3SA 4M81A 1WAWA 4IF2A 3CWNA 4REQB 2AOSA 3CLWA 1V77A 4CEUC 4B92A 1ONWA 4FIQA 3S2CA 3SCWA 4ORIA 1EO7A 3RLHA 4F8XA 4A3HA 1LROA 1C9WA 1EDQA 3BV7A 4C6NA 1J4EA 3S5NA 2BY0A 4FX8A 2CLIA 3N2MA 3APYA 1H1YA 2ZZ2A 4H04A 1QCWA 2NQZA 3WNKA 4GUHA 2Y24A 3VIGA 1VF8A 3MJMA 2Y88A 2D69A 3MUCA 1F6PA 1E6NA 1E5JA 1EEXA 1R7AA 2WJFA 3SN0A 1Q6RA 4IQEA 2IPGA 4M0XA 3BQ5A 4DUOA 4GIEA 1P0NA 4GQ0A 3TN6A 1C7SA 3B40A 1E56A 4XSLA 2PU0A 3VABA 3FKRA 1I75A 2OEKA 1DHKA 4JNMA 1KM0A 2OZ3A 3KLLA 2V81A 4FX7A 4I7VA 1GVQA 3WF3A 3PZMA 1KBKA 2VWTA 4RZ4A 3S9ZA 3U2OA 3DECA 3W83A 4F9DA 4QG6A 4G8TA 4EAYA 2VEIA 5I0DA 2EPLX 3UJFA 3B8DA 3A3WA 3V1HA 4O0ZA 2ZOXA 4ZE5A 4C6EA 3L0GA 4JY8A 5J8LA 2I5QA 4GCXA 1QHZA 2WZMA 2A6NA 4AY8A 3H4WA 1POJA 1OF6A 4H9YA 4ZA0A 1DQWA 5BNKA 3A6OA 1FQ0A 1SM9A 8RUCA 1W1A1 5IFTA 3BL3A 2CWXA 2ZRZA 3LRLA 2YL5A 4O1DA 1CB7B 5C2XA 3F2CA 3VU2A 4R7OA 4BS0A 3QEZA 3T44A 1BEUA 4AD2A 1KTCA 3PZQA 8A3HA 2VZVA 3G6LA 4B91A 1B3OA 4KMQA 5EMJA 4KWWA 2PGFA 3N18A 1D8CA 3OW1A 2NVDA 2H8ZA 1SW3A 4YS1A 3QR3A 2AL1A 3ZQ9A 1E9ZB 3QLLA 1S2CA 1LRNA 5FAGA 4PB4A 3UZ5A 3RJXA 2WQDA 3LEPA 3WQPA 2CESA 4WHBA 5HJXA 1VB9A 4JYEA 3RUBL 1MZHA 2BOFX 2QV5A 1VLWA 2Z1WA 2FVKA 3HTWA 1P48A 2PAJA 3TSDA 1W3JA 4ZO9A 4M6PA 4O1CA 1EJRC 4FALA 3B0UX 2B7PA 3VIKA 2E6YA 2I1OA 3E6EA 2Y7FA 2W67A 3GW3A 2GQ8A 2V69A 1Q4NX 4WDTA 3E1F1 3WLNA 2XVKA 2HK1A 4MY1A 3FS2A 4EF8A 3QY6A 2QVNA 3W1NA 2B31A 7CGTA 3F4NA 3H2EA 4JFWA 3GG8A 4N7QA 1XYAA 4FOJA 4W7VA 3B9OA 5GQBA 2ISVA 3R0DA 1F7BA 5AYZA 1P1XA 5FA5A 3AIVA 2QJGA 2JFEX 5F2MA 1ZFJA 3FDKA 1OINA 3GZAA 2ZICA 5HPOA 4DX3A 3B4YA 4W5UA 2WO5A 4B5SA 1J93A 3TQKA 1JPHA 4R9OA 1WXYA 1OWQA 1ISXA 4H83A 3W2NA 3CQIA 1I0BA 3TZFA 1S5VA 5A6LA 2Z24A 5H6HA 4F0HA 2H8XA 4H9ZA 2ZKMX 1ZAJA 2NQHA 3C61A 4JBRA 3NM1A 3CIVA 2QDEA 3NXLA 3N19B 5BYWA 2QGYA 1VFLA 2NZLA 1JDEA 1JG9A 4US5A 1XLEA 1VP5A 2GSJA 4TVDA 1TJ0A 4IGSA 2Z27A 1T7LA 1PZ3A 1A5CA 2RUSA 4MY8A 1XLDA 2QIWA 4FNRA 1UCWA 1A5SA 4ZMGA 4AHQA 4PMNA 1GYNA 3M4HA 1KBIA 3CQ0A 6PTDA 3LUTA 4DBUA 1KFKA 1YW1A 1W1YA 1DJZA 3ANUA 1ICPA 1TV7A 1PSCA 4PCFA 1QATA 3DN5A 4J1OA 4R33A 3QV6A 1J79A 4GQQA 1TWSA 1PVNA 3GDTA 4K3ZA 3UJSA 1WPCA 4U5IA 2W4XA 4KFOA 3Q58A 4JNYA 3REQB 3RLGA 1V8EA 3WEOA 4GYPC 1QDSA 3WFZA 1TWDA 1F07A 3GG7A 2BHZA 3I6TA 1BYDA 5A95A 5FF2A 3HGSA 4PTMA 1WBHA 1V3KA 3W01A 4XVEA 4A8LA 4UNLA 3O07A 3KBWA 1P0EA 3ARXA 1NDZA 3G0XA 5M17A 2HBVA 1WKEA 3PZTA 3O2LA 2ICSA 3SIMA 1US0A 3EOEA 4HIBA 2P8BA 3NQDA 1G5AA 5EBAA 2BOEX 3AYVA 3WQ8A 4TUFA 5AN7A 2I14A 4GC3A 2J8TA 2Z6JA 3PM6A 4V15A 2XYLA 3A12A 1MMFA 4NZFA 2WMJA 1W3TA 1M7XA 4XZBA 4QJ4B 3EDKA 3SIZA 3ONCA 1WX0A 1E6SM 2BGSA 3MKCA 2P10A 5FESA 3N2BA 5I3HA 1L0PA 2VR4A 1XUZA 1VEMA 3HPXA 2WSPA 3NQ8A 3VXGA 1H7WA 3BGJA 1FWJC 5LZLA 1B2YA 1PTAA 4GE8A 4F4RA 3YPIA 1VPXA 3G1DA 3QQ0A 2PD5A 3WH9A 2QNEA 2DEPA 4GFSA 3OP2A 4ZB5A 2FFCA 4MPQA 3IGXA 3BZJA 5KITA 4PGLA 3NVTA 3W84A 3SRHA 4PMZA 3HBLA 3ZR5A 1UD4A 3IJ7A 3BSMA 4WZHA 3VGGA 1GOMA 2CBVA 2QJMA 5C6MA 2ZUSA 3HGJA 5GNYA 1J01A 3WLOA 1VCFA 1UC4A 1C3FA 4Z2JA 4AF0B 3FSUA 4PZVA 3HO8A 3TYAA 1WKFA 1CLXA 1UR2A 1AMYA 4AC7C 1OGSA 2VO5A 3P8JA 4NJHA 4E5TA 3UGVA 4IL0A 3A4WA 1QVBA 2VRJA 3FA3A 2PP3A 5BXPA 3CAWA 1P6WA 1V6WA 5DX7A 3FX4A 3Q94A 4Y96A 4LAMA 4LX4A 4OKDA 3GBEA 4DXVA 3HA1A 5HULA 2G4JA 4PUNA 2C0HA 2DZSA 1V3JA 4OGZA 1RXOB 2Y7EA 2I16A 2ZUVA 1HO1A 4A3RA 2DFAA 1ELSA 1IT8A 4JTTA 5JQ9A 2VUYA 2C7FA 4XBJA 1DWIM 1GJWA 2TYSA 2ZRVA 4I7WA 1GVYA 1NSJA 2NUWA 1MUCA 1OFPA 4ORMA 3G1YA 3WH5A 5J5DA 2VVNA 2ZDRA 3Q45A 1TZ9A 4ZQMA 4RE0A 1WDRA 3MSRA 1Z89A 3VILA 1CGVA 2GGIA 1TWIA 1NQKA 2Q09A 2R24A 1I2NA 3MYOA 1CIUA 4HJWA 4XKMA 3OYZA 3W29A 5GPRA 3FXYA 2QJIA 1EWDA 2Y5JA 2WCAA 4FF5A 5AZ1A 3WNPA 3FYYA 4J5NA 1PYMA 5K9DA 2O92A 3OPSA 5HDRA 3TQPA 5FSDC 4KEVA 1V3MA 3AIQA 4YWSA 3OGSA 2D20A 3QM3A 2R8WA 5EMKA 3T81A 3DGBA 5FF0A 3LV5A 4IZGA 5FJIA 3LMYA 3SUSA 3S2NA 2KAUC 3GK0A 1IWAA 1REQB 3CV6A 1QK0A 3GIPA 1GOQA 3EOUA 5LNVA 3PPGA 4WQ6A 4JTJA 5HINA 3NQMA 2VGGA 3SCQA 3VNDA 1JUKA 4ZCWA 4N02A 3VKAA 1PTGA 3M07A 9XIAA 1LL4A 3KOFA 3AUJA 5CBIA 4PUDA 3W02A 2WNQA 1X97A 2OX4A 2C18A 2UY5A 3AS2A 2QCMA 1FHVA 2D73A 4FIRA 4JHOA 5F2GA 3SY1A 1WZKA 5EGRA 3BAIA 4HNNA 1TV3A 2GUUA 2HZGA 3T0TA 5C70A 5D04C 4Z2KA 1XBYA 3DENA 1NDYA 1UA3A 3M64A 3SJ3A 2GK1B 1O5KA 1BRLA 2WMGA 3KVLA 1PKLA 2YXXA 1GOOA 5H8UA 2E28A 3VOCA 1S3HA 3EWBX 2JE8A 2ZUNA 2NX9A 3EDDA 5ENLA 3VOGA 3VCRA 3L2IA 2J7BA 4AEOA 4G7EA 1UD2A 1UW9A 2PMQA 2RGLA 3FSTA 3WQOA 5HR6A 5E0FA 5TD4A 1FWTA 1R3TA 2IQTA 3I7SA 1FKWA 2Y7DA 3VD7A 1K8YA 4MJ2A 4FXJA 5D9OA 1LQAA 1KV5A 1SFSA 4HQVA 2DJXA 1FP9A 4L4LA 3S6TA 3UVAA 5A8NA 2CLFA 2PRMA 1DIKA 4S3DA 1F4HA 1PPIA 5M03A 3SRFA 3M41A 3VDAA 5LIXX 3NEHA 4GISA 3ES7A 3P0XA 4IFKB 2AGKA 1ZGDA 4AIBA 1F9CA 4LAKA 2OLSA 1XLIA 4MUZA 2HPMA 1C8XA 3RLUA 2QDGA 4DBDA 3MJYA 3EWUA 2FZDA 2MANA 5BRBA 1J6OA 1W3LA 1K1DA 1MXSA 2R94A 3VE9A 3WDRA 1Y5VA 1K9TA 2WC4A 4KPLA 3VE7A 3TCSA 2X05A 4IIBA 2J8GA 2DT0A 3BH4A 4C6IA 3IWPA 3TA9A 3LD5A 1ZBVA 3M1ZA 4H2CA 2ADAA 3NQVA 4V1XA 2A3BA 5IOBA 3K1DA 3ZWTA 1A0CA 4IMGA 2NV1A 5HAOA 1QI3A 5EPDA 3VNZA 1LUCA 3ANVA 1M9HA 2EKCA 3I65A 3W72A 5DANA 5AHEA 4AW7A 1UBSA 3MY9A 2QR6A 4HNCA 2YCLB 4HPNA 1YNQA 4O1AA 3W71A 3I3BA 5CZSA 2GDVA 2EG8A 4UCGA 4D72A 3EWCA 3UZYA 4EVZA 3HMJG 2X7VA 3L2MA 3WJZA 3C2YA 4O18A 1C8VA 3RPTA 3TU9A 4IMDA 4B5WA 3GQYA 2JKEA 2VZTA 2YX0A 3G1SA 3GY1A 4HMNA 2QF8A 3DESA 4WY0B 5ABGA 3TVAA 3KAOA 3STPA 1FUYA 4NNCA 1Q7MA 2HXTA 1F5ZA 2VUNA 5CGTA 3SCOA 3PN8A 5BWFA 3V0UA 2NQ5A 3MI3A 4Z2HA 1AQ0A 4JCMA 3O63A 1US3A 4E2BA 1KCLA 1OSEA 3G1FA 1KM6A 3EOSA 1CYGA 4JEJA 3B0XA 3VINA 4IIHA 3DYMA 3VC6A 1LWIA 4EX4A 3DFQA 2FLIA 1FCQA 4PB3A 4DXXA 5IBXC 4U4MA 2NXHA 3R8RA 1SW0A 4B90A 4HMEA 4XO6A 3LCGA 1CECA 3UXKA 2Q8LA 3HQOA 4BHYA 2WHJA 1QO5A 5FACA 4LYPA 3MVIA 2DZVA 4IMEA 4JKLA 2EG7A 4ZQOA 5DMYA 1J18A 3P7YA 3W2KA 3GNNA 3WDJA 3RU6A 3H2MA 4YTSA 1KCXA 4OQVA 4RCXA 2G96A 4HTBA 2WHLA 5AVHA 3TJLA 2RDTA 4MNLA 3B8TA 1SZEA 1Z48A 3BAWA 3UETA 2VT0A 5D37A 3I7QA 5HR7A 5F4WA 3UNTA 3DG6A 4NAEA 2AQOA 4Y8FA 1NOUA 4O10A 1GT8A 3WX7A 4X9YA 1BQCA 1F6KA 3TONA 3DFOA 3WLJA 4W4QA 2PDXA 5FF3A 2FVLA 2A7NA 4JIQA 6REQB 1ZBKA 3SUTA 1DL3A 3T8QA 3TQ0A 2ZZ6A 4AU0A 1NDVA 4TTUA 4IL2A 3SUUA 2IPJA 4CU7A 1W9DM 4XWUA 1CGTA 3NQGA 5E9XA 5HBFA 2VM8A 5M3WA 3GIYA 1EIXA 1NQ6A 3R2GA 4GUGA 5I77A 2NSOA 3C8NA 3W81A 2R14A 1Y65A 3LPGA 3GG0A 4HTYA 4LCRA 1TREA 3R89A 1DQUA 4JR5A 4QQUA 3SECA 1X1NA 1RCQA 4C7FA 3T4WA 1A5MC 4GX9A 2RFGA 3RF9A 1V6TA 3ZVIA 5C9WA 2Z26A 1EP1A 3LBOA 4Z17A 3P5YA 1IZJA 1QFEA 3LLFA 2FGZA 1DWHM 1BG4A 1EC7A 2EGZA 5M1TA 1CXEA 3DHDA 4F40A 5F4SA 3DG7A 3NYDA 5G4HC 4D6IA 4GKTA 2G41A 2PDYA 2DH2A 5JIWA 1RJPA 1WDQA 3B9NA 1QOQA 3LXCA 3LG3A 4LY4A 2OSXA 3G0SA 1IZCA 1MRAA 1PV8A 5I78A 4NYUA 3BGGA 5IDIA 2FZMA 1CGXA 2I5GA 5K3VA 3W7KA 3PBWA 3UG8A 3D3FA 3AMKA 4PB5A 3K1GA 4JTFA 3UJ2A 1FWHC 2J9ZA 2X8RA 1EJWC 4G7FA 1TIMA 1B4EA 4ES4A 3I10A 1YPIA 5EA9A 5JBEA 4Q4SA 1GJPA 3FEMA 3W22A 1JNEA 3BAYA 2J6XA 5JMUA 1YADA 3S2MA 4GQGA 3ZIZA 4M3PA 3SCSA 1H1ZA 2AKZA 1NFBA 3UXLA 1HQTA 1JAKA 1GGOA 4MTVA 1WOBA 3EA3A 3ENLA 5ABTA 2HV5A 4LV4A 3CXOA 4UXDA 3TYZA 4TQTA 1H60A 4XZHA 5I24A 4C1NB 1FCUA 1Q5MA 2E1DA 1QW9A 3N11A 1UH4A 1I8JA 3DERA 1E1FA 3PZUA 4UNIA 2QMJA 4G56A 3U48A 3PHAA 4R88A 2CZFA 2CEQA 4DWDA 2XHYA 2ZC1A 2BZNA 3GAKA 2DT2A 1R7OA 4LVAA 1H1NA 5L9FA 1KR1A 5IHRA 3KVMA 1W56A 3CZEA 1MEHA 1TV4A 1T0OA 2A2IA 1UZDA 3L65A 3MB9A 2WSKA 1V08A 1UQYA 3ZJKA 3VI2A 1RK6A 1WDWA 3HG2A 4XZIA 4J27A 3CZ8A 1L2UA 2BB0A 1M7OA 4W87A 4P8UA 4XO7A 2W63A 5DXYA 2RKXA 2QJNA 1ISZA 4UTMA 4J4KA 3O8AA 1QW8A 3ITVA 1G69A 5KMYA 3A9BA 1H4PA 2PI6A 2NLYA 4P7NA 5DRCA 2VX7A 2J88A 1UZ4A 1TCDA 2VZSA 3R43A 4AWTA 3HJZA 1R2RA 1BLIA 4PBGA 4JX6A 4CQDA 2CBUA 1L6FA 4H3DA 2E9MA 4PBEA 4BWLC 3LHZA 3PVFA 3UCQA 1ZUAX 3QGKC 2ZRUA 4MWAC 3O05A 4EPKA 3PPHA 1LBLA 5ECVA 1EUNA 1ENUA 3OZOA 5BOOA 3L2LA 2PA6A 1HGYA 1ZALA 1X6UA 4HOZA 4CNNA 1XIJA 4AUBA 1XIDA 4FEZA 3THAA 4QBXA 4W8BA 3HV8A 3UPMA 5CBBA 4ZL1A 1XC4A 4HYRA 1OHLA 1EC9A 3LV6A 2CWNA 4KF1A 1UKQA 3W6YA 1V3LA 1E43A 1RY0A 2CZEA 3FA4A 3K8MA 5DEZA 5I02A 4Q4PA 3OGRA 1AH4A 1IE7C 2GJNA 5B7ZA 3K30A 3EOLA 3HQ1A 1CX9A 2I9EA 3IRDA 3HM7A 1K8XA 3H2OA 4LS0A 3T78A 3QHMA 2QLYA 3MBDA 4CNPA 1AZ2A 4AQLA 3C2FA 1B1YA 3W7DA 3F4VA 3GTIA 3STCA 3WEMA 1AZ1A 4EAMA 3W00A 2CBIA 4GHRA 4CD7A 1R2TA 3L4TA 1HJSA 5LGZA 4GK8A 1JF6A 1Q63A 3DDMA 1XRVA 1QO2A 1YXDA 4WLCA 4Z1YA 3RM8A 1HP5A 1KM2A 1WO2A 4WRHA 3U2CA 2OLHA 4WSKA 1ITXA 4WKAA 1XX1A 4AEFA 1UKPA 1ECEA 1LTDA 3MSGA 2FKPA 4JFSA 4DQWA 4W8AA 5DXXA 2AQWA 4WD0A 3E12A 4LCSA 4LUIA 3EDJA 4L65A 1VBJA 4FOUA 3SGUA 1QOXA 4IQLA 5H8PA 3BJSA 4A05A 2XGIA 3IV3A 1G4PA 1XGDA 2IMRA 1EQCA 1NWRA 1TB3A 4WOZA 3REQA 4XK2A 4HK6A 2VGIA 1SZNA 1S38A 2CHNA 1RZMA 1IT0A 3T55A 4WSJA 4E2DA 5LHFA 2Z2BA 1CDGA 4CVUA 4MWAB 1W54A 2P50A 2UZ9A 2PPGA 2D23A 4S3BA 3NL2A 2GLKA 4WEVX 3C0SA 3AZRA 2YFNA 4RNHA 4Y9OA 4MFEA 3MSYA 1TPWA 3MP3A 2PGWA 4X9SA 4BF5A 3DX5A 4JTIA 4LTSA 4B2DA 1S5WA 5F7UA 3TTYA 1VS1A 2CKSA 4RPQA 1JI1A 1LRQA 3NPXA 3R79A 4M24A 3B97A 5A2CA 1OF8A 2P1FA 5REQA 2Z29A 1XM3A 3NDZA 4O50A 1B57A 3NQFA 2PBGA 2PDWA 5EFFA 1DJHA 4PYSA 3RDKA 3UXAA 2CXGA 1XDLA 3PSVA 3NA8A 1V0MA 5U7SA 4O8AA 1ECQA 5G2HA 1UP0A 3UWUA 5A69A 4XD3A 4FXFA 2DSVA 2BNJA 5HQLA 4JIEA 4BA0A 1NOFA 5BOFA 4XBKA 1EB3A 4R34A 4B16A 2HE8A 1CZ1A 3LNMA 4HPGA 3TTEA 1E55A 4C90A 4JN6A 1T41A 2BWGA 3M5XA 2WV8A 3F5LA 3P60A 5IRPA 4IMFA 4BF7A 4WOQA 2QXWA 4LS1A 4W84A 1S1RA 4S3AA 4AF0A 3PTKA 4A4AA 4ICMA 1EJSC 2ZZ7A 3QBUA 4GYPA 2ODOA 3UESA 1N82A 1P7TB 5E6ZA 1GZJA 4QCFA 3N2CA 2YA2A 3EGJA 5I3KA 3V5FA 4OECA 1KLYA 3UR2A 1MNZA 4WR3A 1X6NA 1PBGA 4KKXA 2D0FA 1WUEA 3EBVA 1PXGA 3WH7A 1HJWA 3WMLA 1S2AA 1E9IA 1XINA 5CEWA 2YSWA 3M0HA 2YB4A 3SEPA 3STEA 3TYBA 1AK5A 4MAZA 2JF6A 4DJDC 3VKJA 4UZSA 5JH2A 4NILA 4JQAA 1V3IA 1SJAA 3ABSA 2NVCA 2WWDA 1XBXA 2DJLA 1TTIA 4TVUA 3WNOA 1LWHA 3BANA 4C7DA 1K9DA 3LNPA 1HL8A 4PMYA 1HKIA 3DBPA 3IEBA 4C1KA 3ZJ6A 4R7JA 1PX4A 1O5XA 5E09A 1DJIA 1UMYA 2NW0A 3DKJA 5U4NA 3E9AA 1P1MA 4M19A 3CTLA 2ATMA 4I9JA 1FX6A 3RLVA 4HYVA 1J0JA 5ABHA 3EOOA 4GA8A 3AAMA 3ITTA 5JBDA 1SFLA 1I1XA 1PWLA 5G4WA 3E96A 1GG1A 4AZIA 4FF7A 3GM8A 1UROA 1S2UA 4J40A 4KRZA 1HT6A 2C0AA 4UFMA 1CGUA 4QTGA 2X1RA 3WCZA 4N42A 1E3XA 4MDOA 5EFDA 2NX3A 4KERA 4HHLA 2GPTA 1EBGA 1U1HA 4N6EA 5F2LA 5SWUA 4MFDA 1REQA 2HXUA 2WMIB 4DM1A 1G0CA 4C60A 3V1PA 3A4XA 4MYAA 3RGTA 1JD7A 1Q8JA 3QZAA 3OEXA 3CUFA 1Q6QA 4C91A 3WK1A 1UR4A 3W7QA 3UY8A 4OE7A 3WLKX 3SCRA 3KRBA 1HUVA 1BQGA 1UPMB 1HVXA 1Y5WA 3DGRA 1B5TA 4GO8A 1KR0A 5FEWA 2QGHA 4MWAD 2IPFA 1CW2A 1DJQA 1HJUA 4ZENA 3E5BA 4A3YA 3N9SA 1GORA 3PAJA 1XLMA 2GUYA 5ECUA 1JCTA 2XIOA 3QR0A 3KP0A 4FNTA 5M2FX 3VD3A 4IIEA 5HATA 2DZAA 1MFVA 2A0NA 4RDZA 1SVDA 4ECLA 4FMVA 1KD0A 3P8IA 2G37A 1CXLA 3T2PA 3VZYA 2JEQA 3QYQA 4DB7A 2Y4SA 4M29A 1F2JA 4S3EA 2DQXA 4OV4A 4I5XA 2GWNA 4MB5A 3O6CA 1LOQA 1R3RA 3B4UA 2VXNA 1P6BA 2XINA 3GZ3A 1ME8A 2VD8A 4W88A 2HSAA 1FWEC 3AU2A 4NZ5A 2GOUA 1AH3A 1EKOA 3HB9A 1FXPA 3KTXA 3HF3A 4UTFA 1PAMA 1UD6A 1VFMA 5BMWA 4QGCA 4IGHA 4BQ5A 4X0NA 1ZNNA 1R3WA 2E3ZA 3IJIA 3VIFA 1QPQA 3T7VA 4AZCB 3EX1A 4M7SA 2DT1A 5D2TA 4QHRA 1EXPA 2NSXA 2OMAA 1RCXB 4GY1A 4IFKA 4KEMA 2IQ0A 4PMJA 2VX6A 1TX2A 4DZAA 1W3HA 2Z4GA 3G77A 4M1BA 3WH6A 4DJFC 1KFCA 1Q45A 4LC6A 4EXBA 3BAKA 1O95A 2Y7GA 2QW5A 2W62A 4MZ8A 3EDFA 2NV2A 4UMAA 5I00A 1FOBA 1UJPA 3GDRA 1LLWA 4UQAA 1TR9A 2YBTA 3DC8A 3PPCA 1YX1A 1Q65A 3S9YA 2Y8KA 1QJWA 1GOXA 4FA3A 1O12A 1QUMA 2WNNA 4WUIA 1EBHA 3W07A 4GUJA 1KKRA 4Z1BA 1GOWA 1M03A 4DM2A 4CEXC 4JTQA 3QMTA 4XZ9A 1DPMA 1XS2A 1G9HA 3EX6A 4XD6A 2X2GA 1RHCA 4CQ8A 3UG5A 2E0PA 2V2DA 3W73A 5CSRA 3S47A 3HFYA 3CQHA 1UH2A 3WDHA 5KZ6A 3F4CA 3QV9A 2VQTA 3MUIA 3OZMA 1VGAA 2Z2UA 1J0KA 4QJ5B 3NPUA 3BAXA 5LXEA 2VOTA 1B0IA 1S2TA 2A79A 2WAGA 1XR2A 4O15A 2QUUA 1G7UA 2VVSA 3MUXA 4DYJA 2VOMA 4M56A 4JDYA 3TC3A 1XICA 2MUCA 3SCTA 3H2AA 1RLDA 5DLCA 3WJYA 2QCGA 3CV7A 3EKGA 3WMBA 1XLGA 1O7AA 4J3WA 1AL8A 2J74A 4IGNA 3M0ZA 2OGYA 4XB3A 2XISA 1R2SA 1K9EA 3UVIA 2NT1A 4DIAA 4UNKA 1PWMA 1EPVA 1SR9A 3A21A 1HXJA 4LV9A 1GVOA 4ICNA 1QPOA 3LQGA 3MV01 2POZA 1FKXA 3ITLA 5DMLA 2VC5A 5AYYA 3U0HA 4H9UA 1A49A 4KFNA 3KL5A 2ESCA 1C8YA 1I45A 2FB3A 5LIYX 1D3HA 5AHFA 2ZWYA 3LS9A 3VDBA 2E4TA 2E6AA 3GNXA 2PWUA 2GVLA 1E73M 3MP4A 4LB4A 2PWDA 2CETA 3U4AA 4O54A 4DO5A 3O0FA 5K9XA 3IVUA 1IIGA 1FRBA 4S3GA 3P3BA 5LYRA 3TKFA 2VEFA 3NZ1A 4JHMA 4GH1A 1LLZA 1TA3B 2YDAA 3EKZA 3CZJA 3T2QA 3XISA 1OYAA 4PTDA 3KX6A 1L2QA 3PJXA 2HDJA 4AH7A 2Z00A 3L21A 2XH7A 1XYFA 1ISWA 4Q4MA 5CKSA 5CXPA 4DJDD 2B7OA 3BG5A 3KS6A 2ZX7A 6REQA 3ARZA 1SO5A 1H7XA 4IICA 4MIMA 6CGTA 1QMLA 2OT0A 3VUSA 1R9YA 1KM5A 2CCRA 4H2HA 3T6CA 3LXBA 2CXEA 3M0MA 4R27A 2D2HA 2VDIA 3I3DA 4AC1X 1RD6A 1RY8A 4MPKA 4M7TA 4CD5A 3AU6A 3B04A 5BMXA 3ARUA 1CLVA 4IP7A 2JGYA 3NGFA 3B0YA 1VQTA 3MUZ1 2A3CA 1TQJA 3A13A 4BZYA 1E5NA 4MJMA 1BWLA 3LHWA 3OTRA 4K36A 5HUPA 2CKRA 4LCQA 3P14A 4DYKA 4DRSA 1UYQA 4IQDA 2QPXA 1M41A 3AOFA 2F8QA 4US6A 3CHDA 3PZNA 3R94A 1ZTVA 4KS0A 3NOYA 3WBAA 1ODZA 2HS8A 2ZVRA 3MI6A 3GHSA 1IWPA 1ZJAA 1FWWA 1TVPA 2J13A 2WLZA 1EJXC 2Q02A 4D8LA 1M7JA 3L12A 3JZUA 4YHEA 3F4WA 1BKSA 1DOSA 4KGJA 3N15A 1RAKA 2PODA 3W27A 3MDUA 3VMNA 2ZCGA 1XIEA 3KOYA 4IP5A 3LPFA 1E15A 2FPVA 3QMSA 1TE1A 4QISA 4IWWA 5DN1A 3B8IA 3B9EA 1F4AA 1X1OA 2XTKA 3KTCA 1V7YA 3R13A 4F48A 5HOSA 2ZRWA 2J75A 4GVHA 3W74A 1QT1A 1TTJA 4D8ZA 1TR1A 1SMAA 2QJHA 4TX6A 1ZSXA 4GY7A 4Q8VA 4LSBA 2Y5SA 3F5JA 2X1IA 4RE2A 4ZR8A 4QFUA 1W5MA 1OADA 4GPNA 3H2FA 5HANA 9RUBA 4IMAA 3EWZA 3ZZ1A 1MW3A 2BGQA 3UA4A 2GWGA 5LA0A 1KGUA 3EXSA 4ZB2A 3UXIA 2ZXAA 3BICA 4UFIA 2G3FA 1R3QA 5MKGB 1FFQA 3WF4A 1K9FA 4QE1A 2PGEA 4AVNA 2V3DA 4H1ZA 2OPJA 2YL6A 4FI4A 2R1LA 1T8QA 3GNOA 1EPXA 3EX2A 2H3BA 4L9ZA 3SURA 2E1WA 2F6KA 3BO9A 3GVVA 4RW3A 3DAQA 1UD3A 4HNLA 2VDHA 3EMZA 3WLPA 2VFHA 3AUOA 5I5RA 2ISFA 1BF2A 1P6CA 2A7RA 1RP9A 1FWRA 1XLAA 1JPMA 3A22A 3K8KA 3H6OA 2YKKA 3PTQA 3QHOA 3IVSA 7TAAA 4G1NA 1IXNA 3L68A 3P74A 4ZOAA 2NQ9A 3WQDA 3U6WA 4NG3A 2R9RA 4EWND 3OG3A 4M82A 2V0TA 3BLKA 3N4EA 1W1IE 1Q6LA 4UB9A 1F73A 4DLFA 3T0AA 4MM1A 1KFWA 1FWDC 5B7YA 1NAL1 2G3MA 1GK8A 1HKMA 4Y2WA 1CXKA 2ZRYA 4KCUA 3DFSA 4UQDA 5CLTA 3K5XA 2ZE0A 4MB4A 4LY8A 4UIOA 3W7OA 3A5VA 2VX5A 1V6VA 2YDQA 3LY0A 1EH9A 3KOZA 3VPLA 3F03K 4Q7NA 2WMFA 1PB0A 3W23A 4MNJA 3W1UA 1MVYA 1GVRA 2A1YA 2HJPA 3UWEA 3AYRA 3H2NA 3D46A 1YNPA 3F1QA 4U10A 4D1IA 3PFRA 3V0TA 1XC6A 1PIGA 3QSTA 4P2VA 4D71A 5A6SA 3DOPA 3W4RA 3NPWA 5CAKA 4RDWA 3QV7A 1EFZA 4YTTA 4KT2A 4PTVA 5CC5A 2OELA 2YXOA 4B4HA 2A3LA 2YW4A 3RHGA 1FDZA 3V3WA 3FN9A 4KWOA 1K4HA 5JVLA 2DVTA 3GC4A 4KEUA 1OCBA 1J0ZA 5JBFA 1C7TA 5E93A 3MBFA 1UWUA 1N7KA 5LNWA 4PEEA 2F6UA 3LHUA 4K7YA 4RE4A 3VMPA 1BYCA 1OC5A 1MW0A 5AHNA 3STFA 3WJSA 3MANA 4E3VA 5BRQA 5KZMA 2VMFA 4F9JA 1G67A 3M0IA 1C92A 4ENLA 2PDHA 1MDLA 3WQ5A 3ZWSA 1GKQA 2ZE3A 2TPSA 4LAZA 4XZMX 1LORA 4W89A 4YYCA 5I03A 2QCNA 3D3AA 4U33A 1XG3A 2ISSA 3M9YA 6XIAA 4E8GA 2X40A 2PRLA 3AXHA 4FR6A 1SU5A 2OR2A 1XRTA 3L4ZA 2XM2A 4F0SA 3IK4A 2E5CA 1H5VA 1BWVA 5LKYA 1XH2A 3ZJ7A 1QU4A 4POCA 4ZVJA 1XHGA 1DHPA 2Q3OA 1VPQA 1EGVA 1KCKA 1KRMA 3B8UA 1V51A 5HUOA 4A8RA 3VOHA 1HNYA 4I5RA 1XIMA 2ALDA 4ZFCA 2FIQA 3NQCA 3M0YA 4K68A 2AL2A 2PTWA 3RIKA 4MWAA 1J8VA 2KX9A 5RUBA 2NV9A 3A9IA 1VH7A 4HSNA 3MHFA 2PTDA 4LVBA 4NAFB 3FXGA 2FGBA 5BCAA 2Z28A 1GW9A 2XJ7A 1BXCA 2R82A 1JCLA 3GU1A 3VNLA 5I3GA 2J6VA 5EKYA 2AGTA 1UIPA 2A3EA 5CQ1A 2RDWA 3WLSA 4Q7IA 2QZRA 2YCEA 1A5KC 2WKGA 4US5D 2XN1A 3M7SA 5T8GA 3PUOA 4QE4A 4Q22A 2D2JA 2BP1A 1LRTA 2V5KA 3LI0A 3BTNA 1NF0A 4AZ6A 1OEPA 2IUZA 3N12A 3CB8A 3K4AA 3N6QA 5PTDA 4GIYA 3ITCA 2DIEA 2FZ9A 3CHEA 1OK6A 3OLEA 3S1VA 3WELA 1CGYA 1OT2A 2OEMA 1U30A 1S46A 2O9RA 2WC7A 4U2YA 5J04A 2HNHA 2V68A 1XLBA 3TN3A 1BFNA 1I0DA 3B3DA 1YXCA 1BXBA 2J79A 4WXYA 1Q3NA 3EB3A 2PDMA 2QUTA 1WDPA 3ARRA 2VZUA 1UKTA 1F61A 1H7OA 1O6IA 2Q8ZA 4OVXA 5FEZA 2WANA 4OV9A 3CJPA 1KRAC 4HMDA 2FQIA 3AIBA 4TIMA 5D8WA 2QCDB 3GTFA 2EEXA 4TV6A 4YTUA 3TXVA 4K8GA 3WO8A 4WJEA 5A8QA 1J12A 3DFHA 4E38A 2IKJA 3TJXA 1KFBA 4QXIA 3IJ9A 4N0RA 2ZADA 3V0SA 1IGSA 5LSMA 4FK9A 4ZOCA 2C15A 4GKLA 1OX5A 4FLSA 4YPJA 1AG1O 1JL8A 3C56A 3MP5A 1UG6A 1IR1A 3H22A 1Q13A 4KCWA 3Q4DA 1KXQA 1E3ZA 3PTMA 3PB2A 4E4UA 1XGZA 1PS9A 3GDMA 2BGNE 1BVZA 2RJGA 4QSHA 2TMDA 4F0KA 4MMWA 3IARA 3TMLA 4G7EB 1US2A 1GEQA 2BASA 4Q4KA 2EHHA 3FY1A 4ZOBA 3NSMA 2LLEA 2DSKA 3WZ0E 1PKYA 2XSXA 4DAFA 2WNWA 4PTNA 4AIUA 4DXKA 2FZNA 1FHDA 5C71A 2GSHA 4LRTA 2HQAA 5HNRA 1ZENA 1UWRA 4DZIA 4MDPA 2HPIA 3BW2A 4RXFA 4JKMA 4DO4A 3IJQA 1NP2A 3VVGA 2BLEA 5XIAA 2X16A 1XIIA 2VYOA 1NF7A 1BVNP 3IACA 4LS2A 3QC3A 1VRDA 2V82A 5C9RA 5A8MA 4H9VA 1DJNA 3ONBA 1XFBA 1W9UA 5DQPA 1QNSA 3OG2A 3MMUA 3AC0A 3UWYA 3WQ6A 2BVTA 4GQBA 3AHYA 4JPGA 2VR2A 1RA0A 3N13A 1A0DA 1FH7A 3MS8A 5I79A 1WXZA 1ZJHA 4Z1CA 1UBPC 1MO0A 2YPIA 3MKKA 3MCMA 2ZVIA 2GVGA 3VTRA 1WYIA 4KESA 1W1VA 2VTFA 3GH5A 2NWSA 4GVFA 2CLPA 4A3UA 1VKFA 3URBA 3AI0A 3FHQA 4P8WA 3RG6A 1JYNA 3C3UA 3SO7A 4C6PA 3CUIA 2FYMA 4C5YA 4Z08A 3UZZA 2WMIA 4WJXA 5GVJA 4S2CA 1OZQA 2DV0A 2XUCA 5HNTA 2VFEA 4O1BA 1UASA 1U5JA 1E1CB 4LH8A 1VFFA 3L0NA 3RX4A 1Q6GA 4JY9A 1H09A 5A6MA 5HQMA 2E9LA 5HMDA 3G22A 2PDFA 3BAJA 2OWWA 3PBMA 4MSSA 4GNJA 1YE6A 3GG1A 2GVJA 4QEHA 7ENLA 1V93A 3N6JA 1A3HA 1JULA 2D0GA 3TNBA 4NKCA 4HA3A 3LM7A 1GQIA 5HNUA 1JCNA 5A6TC 3APTA 1F6YA 4LQ1A 3GVWA 2CC0A 4C6QA 3AICA 3A5FA 1E40A 3BZGA 4RNJA 5CJ5A 3BLLA 3J7HA 4UWMA 1HL9A 4KCVA 5I3FA 3WBWA 1NM9A 3UD6A 1E4IA 2EXOA 1F3WA 3M46A 1A4LA 3R11A 5C8BB 5D38A 1KXVA 2Y8VA 2G5WA 3BW3A 3Q67A 3O6AA 3TJIA 4ADUA 4UFLA 2P0OA 3SY8A 1NWTA 1G1YA 5HA7A 3L67A 4N4PA 2W6RA 2WW5A 1C93A 4XAGA 3GTHA 3FJNA 1QHPA 3B9AA 1Z8AA 4Z0SA 4AZHA 9CGTA 1QWKA 3A4JA 4HOWA 3TC6A 4AIEA 3EWWA 1DXFA 1H7RA 4UCFA 3HOJA 2GVEA 4JFTA 1E6ZA 1X38A 1JNDA 4J28A 4DNMA 3GXFA 4DUVA 2WHKA 3EDEA 1ISVA 4PTXA 3LTSA 4AZCA 3CL6A 1SGJA 5J5RA 1XCXA 4L9XA 1IR2A 3H21A 1XYZA 3T0CA 2ANUA 3IJ6A 1R87A 4UBPC 3I4EA 1EZWA 1TWZA 3GTXA 3W2JA 3RCYA 1C91A 4O28A 5DCDA 1KFJA 1KLZA 2XG9A 5C9UA 2XFRA 4J9JA 4HCDA 4JIIX 1O5QA 3E0VA 4IPNB 2ZTKA 3ERPA 4NAEB 2R1NA 3IGSA 4JX5A 2HE5A 2F6XA 3H55A 2PCQA 1XLLA 3QPYA 3MWCA 4JIHA 1RV8A 2QCFA 3ZXWA 4BR1A 4A22A 1OABA 3NQ6A 1E9YB 1UR3M 1EOKA 3W7RA 3WMSA 3F2BA 3R12A 1TCMA 1GHRA 3N29A 3ES8A 3WDQA 4LALA 3WUGA 3OLIA 1NJJA 2EAWA 4TXEA 1I1WA 5CJMA 3VK5A 4QAIA 1I9CB 2GJRA 3HPFA 5K2ZA 3RN6A 4W85A 3OVGA 2BDQA 3DFPA 5CJNA 1T8XA 3LN3A 2JF7A 4DUXA 1XLJA 4Q7BA 3QKEA 2XH0A 1XL9A 2G3IA 3SRKA 5CPNA 1EJVC 4NX0A 3O06A 4S3KA 1SJBA 4LPCA 3T05A 5EBUA 5A94A 3PFMA 2I56A 4Y9PA 1JUBA 1WCGA 1LCOA 3URNA 3GXMA 2JALA 3KRSA 2ZZ5A 2ZZ3A 2OWXA 2PRHA 4R53A 1YHTA 4TV5A 3UGRA 1QI0A 3BLOA 1QBAA 4TO8A 4WVXA 4U3AA 4OZOA 1VJIA 2WSYA 1F3TA 3VGBA 3CPUA 5IFPA 3E3HA 1L6WA 1A53A 2VQUA 4HVXA 3DC0A 4A8IA 3HFTA 4JZ5A 3H12A 2XDFA 3CPGA 3QFWA 4EPBC 3QW4B 4ZB0A 2QS8A 1GYMA 4WKFA 5A5WA 3BOFA 3NR0A 4DJFA 1JYWA 3RR1A 3SSZA 1GZGA 1XKYA 4LYRA 1X96A 1SMDA 4PR4A 3H54A 1DTUA 3EX4A 4XX6A 2O7SA 3D47A 1VCVA 1FHUA 1YBQB 3BG9A 1CXHA 1RQHA 1W9BM 3CIXA 2OLAA 1VYRA 1S3TC 3VCNA 3KS5A 4H9XA 4GGHA 2OSYA 1DXEA 2WCGA 2AAAA 2NWRA 4RLIA 4QE5A 2WLYA 3IANA 3P84A 2ONEA 1LG2A 2A6LA 1E4LA 1W1B1 5CPTA 4JTAA 4P7RA 4J2MA 4LWWA 3CB3A 3UF9A 5G2WA 1KQZA 2BX7A 5G5IA 1TA3A 1CXIA 3KBNA 3WD3A 1U5HA 4LAUA 4M80A 2XFYA 4H01A 2ASHA 3PAOA 1A5UA 2BG5A 3F7JA 3IS4A 5I3IA 4ZGYA 1LOSA 1OJXA 3EB4A 3HPSA 3MMDA 3WLQA 2HNEA 4ADTA 3N9KA 1EF2A 3S0CA 1I2RA 5EB8A 1J0IA 1OFDA 2V5BA 1T6MA 4NX5A 3NZPA 1JFXA 2P53A 3U2ZA 2IXUA 4JKKA 2O0TA 2GGHA 3M44A 4OJYA 2OZ8A 3WQWA 3UYCA 1P43A 3OQEA 1W5QA 4M6QA 4FLRA 3W7PA 4NY2A 5FIPA 3LSBA 5A8GA 1KFEA 3LYEA 2JIWA 2YXGA 5CPOA 5EMUA 4DWSC 3MU7A 2ZXDA 1PYFA 2DUAA 5AC6A 1YTDA 2DUXA 3NL6A 4FLQA 2QIIA 3UYIA 4S3CA 5HMEA 1V6YA 5IXEA 1ZU8A 1XYCA 4Q33A 4KCTA 1LZOA 4OBRA 1GKRA 4MNMA 4M1RA 1E1EA 3RPDA 1PHQA 2GQ3A 3M16A 2Z1VA 4P61A 2XZ7A 4CCEA 2INEA 1XH0A 4GINA 3V5OA 2H3DA 3AIEA 3BW4A 4MG4A 5CG7A 2X2YA 1QTWA 1GPWA 3ALGA 3LRMA 4F0MA 2Y61A 4AX6A 3HPZA 4J35A 4V2XA 3N17A 1PJ9A 5AB3A 3R10A 4IM4A 3NYZA 2XPKA 1FWCC 1E71M 1SJDA 2GFTA 3ARPA 2EBNA 3BMVA 2OSWA 1IYXA 4IX0A 2WJEA 3MUAA 4CU8A 4GX8A 2QCLA 3NPVA 4MLJA 1EEPA 1O4UA 4DY1A 3OVQA 4NRSA 4PBFA 4CD6A 1G7VA 2WQPA 3TK7A 4DVOA 1KQYA 1SO4A 2GVYA 3KZSA 3QC0A 3EEZA 1GYLA 2ZBTA 1J2WA 5AY7A 5D2YA 2YDSA 3ALFA 4PFHA 1W9PA 2VHLA 4UR9A 3CH9A 3PWGA 3LCFA 1L8NA 2Z1XA 4DWSB 1K7FA 5FF4A 4AVOA 2DP3A 2XN2A 5MKGA 6TAAA 3U8GA 3W7NA 3R6IA 3G0UA 3K4DA 4X63A 3PSWA 1TTQA 3E74A 3I6RA 4E4FA 4B9YA 5DELA 1UP2A 1WXJA 1Q4WA 3GRIA 1R86A 2E5DA 3BMXA 5I6SA 4HSOA 4NHVA 4HHHA 1Z44A 4O1FA 5I07A 1W8GA 4GZIA 3BWWA 5DO8A 1IXQA 1IEQA 1ZB5A 1ADDA 5H91A 4AZGA 1FH8A 2G95A 4IFRA