3CUJA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylopentaose.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords Exo-beta-1,4-glucanase
total genus 131
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cujA00
1W9BM 1WZKA 3SUVA 2BFGA 2CHNA 1AQMA 3WKZA 1WDRA 5A8QA 4ATWA 1UD6A 5IDIA 3WUEA 2WC3A 5I78A 2ZUWA 4X9YA 1P6WA 4PRWA 1JDCA 3PZIA 1M01A 4GXPA 4M56A 3CHCA 2A3EA 5BRPA 5CSYA 2VVNA 2XGBA 1UKTA 1V3HA 4AZCA 3WD0A 1QW9A 4JHZA 1ITXA 2JE8A 2YJQA 4TVCA 2UY3A 4BQ4A 3VIHA 3VIOA 5CPQA 1M7XA 1ISYA 2VRKA 1E40A 2J47A 4CD7A 1KGWA 3MUY1 2E8YA 4Z2GA 3OGSA 2ZUSA 2WSPA 2PWGA 2EPMX 1QBAA 4B3KA 2VMFA 2PF0A 3UG3A 4HZ8A 3T2QA 3RJYA 2CBJA 3WQVA 2DH2A 2FHBA 4W93A 4L4OA 3W81A 3CH9A 4D71A 1HKJA 3N12A 1OIFA 2V5CA 1BLIA 1EQPA 2D24A 1LL7A 1NWTA 2JALA 2QPSA 4NRSA 1V6WA 1MQQA 3WENA 5E9AA 3AS3A 3QOMA 1UD4A 2DIJA 2ZXAA 3VMNA 1BG9A 1W9XA 4CD4A 1O6IA 1JAKA 4WSJA 3O9NA 4AZIA 1AMYA 2VI0A 3VPLA 2DT2A 3N18A 1E73M 1GW1A 2J7EA 2BV9A 5ABHA 1G9HA 3VD4A 1KB3A 2X09A 1HJXA 1QNSA 3SCOA 4M80A 3II1A 3WUFA 1F4HA 1WKYA 1IZJA 2IXVA 1J0YA 3VMOA 3OGVA 4P8VA 5IHRA 1D2KA 1HJUA 4DWSB 1BYBA 2QLYA 2WM0A 3DYPA 2CCRA 4AZHA 4GIAA 5I2UA 2O9RA 2HVMA 4HZ6A 2BXYA 1H5VA 2G3NA 5D9PA 3AJ7A 1MVYA 2CITA 2XHYA 3BH4A 5LA1A 1KBKA 4UZSA 5F7UA 1MW0A 3N1AA 4Q7NA 2WVVB 5HDRA 1CWYA 1J01A 1ZJAA 2O9TA 2PWEA 5FL1A 3DYOA 5CSUA 5A69A 6TAAA 2A3BA 2WAGA 1BVZA 3VVGA 2DEPA 3RDKA 1HKIA 4BQ5A 3AHTA 4GO9A 1KR1A 1HL9A 5E6YA 1W9VA 4GZJA 4QCEA 1J12A 3VDBA 1FHLA 1K9TA 4J3SA 4J3VA 1DP0A 1UWUA 3CZLA 1L8NA 2OSXA 3AIVA 2EPOA 4JCMA 5A6BD 4QAWA 3WBAA 1GOMA 1J0HA 3KE0A 5E0CA 3FAXA 1K9FA 1UKSA 1XCWA 1C8YA 1JF6A 1QI4A 3CUFA 1ITCA 1JYVA 3VMPA 4LPCA 5I6SA 3ZSSA 3GNPA 1XC6A 4MNJA 1EIBA 3TP4A 2XGIA 1OB0A 1FP8A 2UY4A 2W5FA 3K1DA 3TTSA 2XFRA 2WZEA 1QHOA 3BC9A 1H49A 1TR1A 5EBAA 5CLWA 1OGBA 4FF5A 3ZT7A 3HN3A 1U33A 3EDJA 3AROA 3UEQA 2J7GA 3RILA 4D6DA 3WBEA 2D1ZA 5C8BB 5FCZA 1BPLB 1LL4A 4ACZA 3SUTA 4FLOA 2A3AA 1H2JA 4QCFA 4YPJA 2D0HA 2FGLA 1UHVA 4W5ZA 1LG2A 1U30A 5EMYA 3BAKA 4X0NA 3RM9A 1UQZA 5ECUA 3EYPA 1G01A 1W2PA 1V02E 4UFHA 3F5JA 3PHAA 4WJXA 1JDAA 1J18A 1JL8A 3SURA 2VZOA 2C8NA 4HPHA 3DHPA 3A4XA 1EH9A 4W8AA 4MPKA 1E72M 3VM7A 5A8PA 1V0NA 1VFOA 1WB0A 4H8HA 2VO5A 1ZJBA 5LA2A 1ZS2A 4R27A 1B3XA 1MW2A 1E4NA 4UFLA 3VD7A 5I3DA 2BY1A 4F79A 5A8NA 1JD7A 3VGEA 3ARUA 1PZ2A 1GHSA 2EXOA 4PMDA 4B9YA 5M03A 3UG5A 2MANA 3QGVA 1CECA 1UH3A 1JYWA 1KXQA 2J7CA 1VB9A 1V0MA 4R5EA 1DWJM 1FFQA 1J0IA 2CEQA 2GFTA 5A6JA 4BS0A 1HNYA 4D1JA 1LJYA 2J74A 4P8UA 4GINA 3T08A 4MDOA 4MAZA 1DTUA 2FHFA 5DMYA 3KL0A 2JF7A 2E4TA 2JEPA 4FLRA 1E6PA 5A2BA 1H3GA 2NW0A 1W91A 3WH8A 2WWCA 3BAIA 3L4VA 1UKQA 1OD8A 3WELA 1QW8A 1VFFA 3W0KA 3PTMA 1H11A 3GXDA 3MU7A 3PZVA 5FD0A 2GJRA 5E70A 1JZ2A 1LWJA 3WL0A 4HPGA 3HU7A 3K8LA 1LF1A 2D20A 1HKKA 1TA3B 1JXJA 3MS8A 1VBUA 2E9BA 3MV11 3PZTA 2Z1SA 5EFDA 2G41A 4H8VA 2B31A 1BG4A 1DEDA 3AXXA 1B2YA 1JZ5A 3W28A 1W1YA 1LWHA 3K8MA 1MFUA 3W25A 3WQWA 1TVPA 2XTKA 1UYQA 1QHZA 2ZWYA 1ESWA 4PMOA 3BCDA 1YQ2A 1JZ3A 3NUKA 2J8GA 3W4RA 4CD8A 2WSKA 3AIRA 2XM1A 2J7BA 3W24A 4JZ5A 3CO4A 4UQDA 1FHDA 4UOZA 1BF2A 1DWGM 2XVPA 4LXFA 4UFMA 5CXPA 1B3VA 1MWOA 1NOUA 5CGTA 2YL8A 3WD4A 5A6SA 4U2YA 3WFLA 4Z2KA 4UQBA 3AFBA 3TONA 4UFJA 1RPKA 2VX5A 3FN9A 1PX8A 3WH7A 1W3JA 4JFWA 4ZFMA 4UQEA 3ARVA 3VDAA 4H8UA 8CGTA 1SFSA 1KXHA 1PJ9A 2YDQA 3VNYA 4C7GA 4BQ3A 4B9ZA 3NDZA 5ABEA 4Y7EA 3BAWA 3BCFA 2CBVA 3OGRA 2AOSA 3WY1A 1E5JA 4MNLA 1GVIA 4OBSA 5IXEA 1B90A 1DWHM 2WVTA 1X1NA 4UQAA 4D72A 2PBOA 3AISA 1E0VA 3UG4A 1UWTA 3WUGA 5BXTA 1PIGA 1TMQA 4CN4A 4IISA 1CNVA 2X05A 1WAWA 3CGTA 4KWUA 1CIUA 1JGIA 1Q6GA 1PZ3A 2ZXQA 4WKHA 3ZT6A 1E1FA 1GZJA 1PX3A 3AXIA 4MTVA 1UOKA 3L2LA 1X6NA 4BQ2A 2BHZA 3UESA 3FNDA 2Y4SA 2HISA 3J7HA 3PBGA 4P8XA 7A3HA 4ML4A 3UETA 2FH6A 3JUGA 2WKLA 4ACYA 1EHAA 5FL0A 1JNDA 2J78A 3AS2A 1CTNA 4Z2IA 5I77A 2YL5A 2YBUA 1V3KA 4FK9A 3VIJA 3OZPA 4JFTA 1H4PA 2J4GA 1BGAA 3PZQA 4MNMA 1W9PA 3EDKA 3VO0A 1UKPA 1VFUA 3U5UA 1J10A 4EAMA 2G8ZA 4CVWA 1W32A 3M7SA 3KZSA 4GI6A 1JFXA 3AIQA 1BGGA 2VTFA 2EPLX 1E15A 1UD2A 4PTVA 1UD3A 3AIWA 4PMUA 3VIPA 2VZSA 4XUYA 3PZMA 4UFKA 2OWCA 4MB1A 1E6RA 4AD0A 1V6VA 2ZX9A 4HOWA 1ODUA 4PUDA 4DM1A 2DQXA 2RGLA 1EDGA 3MV01 5E0FA 4UQCA 4M82A 2OWXA 3DECA 1VJZA 3BLPX 3AIEA 4AD3A 1JZ6A 5BWFA 3CPUA 3UR7A 1DWFM 3G6MA 1MXDA 4PCTA 1R85A 4AZBA 4W85A 1OSEA 5JUVA 2AAAA 3AMDA 2VUYA 1OT1A 3VGHA 1Q4NX 3W29A 4AMCA 5A6MA 3W37A 3L2MA 3MMWA 4Z2LA 1QNRA 2OSWA 1C8XA 1BQCA 1CDGA 1H1NA 2W92A 1H09A 5ABFB 3RPMA 1JNEA 1ZBVA 1V6XA 3WNOA 2E40A 3WUBA 2Y2WA 1CXEA 4P7QA 1HP5A 4LYRA 3WEOA 1XSJA 2O92A 1C91A 3GZAA 2G3IA 1CENA 4AC1X 1AVAA 1J0ZA 2IXUA 2GK1B 4OOZA 2VQTA 4F66A 4A3HA 1NH6A 4CKQA 4PMNA 5A2CA 1Y7VA 5JBEA 3W26A 1MW1A 1NOFA 4JL2A 3BAXA 4LGXA 1EHNA 3AS0A 4JKLA 3WF3A 1UZ4A 3OB8A 4OUEA 1XRVA 1UD8A 2OYKA 1W9UA 2ZXDA 3RIKA 3SCWA 2BVTA 2VOTA 3VDHA 4PSPA 2A3CA 2YLAA 3WNPA 1MQPA 3VKKA 1JI1A 1Z32X 1E4LA 1O7AA 1CLVA 1VAHA 3VOCA 2CYGA 3APGA 4PEEA 4IPNB 4DUVA 2VURA 3N9KA 1L0PA 3AIUA 1B1YA 3SCQA 1OGGA 1JZ8A 3CHEA 1I1WA 1V3MA 3L4UA 1PEZA 2FHCA 3ZMRA 3WDQA 3T2OA 2YKKA 4MB4A 4AYSA 1HJWA 2CBIA 4LQ1A 4WLCA 3KL5A 1SR0A 1FH9A 5CG0A 5BRQA 1UWQA 4WK9A 1PPIA 1E6ZA 3KEHA 1HVXA 3WF1A 4OKDA 2PC8A 4GKLA 4P8WA 1BTCA 2Z1KA 2WVVA 2J62A 1E6QM 1ZBCA 1E71M 1KBBA 2VT0A 3U7BA 3AXHA 3KL3A 3GTNA 3DC0A 4QLLA 4E8CA 1UKOA 1XH2A 3UR8A 3VGGA 1VF8A 5D4YA 3AQUA 3ZJ8A 1TZ7A 3PZ9A 3A4WA 1R86A 1ISWA 2ZUUA 3WMBA 4AIEA 5D9OA 1KXVA 2EPNA 3AICA 4HTYA 4CCEA 1CLXA 2WW5A 3GNOA 2EPKX 1C7SA 3IJ7A 3BAJA 2WYSA 4NZCA 2V3DA 4PUEA 2E9MA 1GPFA 3ARWA 2VC9A 2J79A 3VINA 4AY1A 3PZOA 4HU8A 2GJPA 4JKKA 1FA2A 2QV4A 4HMCA 4HOXA 4P7RA 1GOKA 1OT2A 2YL9A 4W89A 1WCGA 2G3JA 2JF6A 5I5RA 1ISVA 2BY0A 3AZSA 4YN5A 2XVGA 2Y5EA 1HKMA 1EQCA 2G3MA 1JFHA 3A6OA 5HPOA 3TTYA 3S6TA 5HPCA 1JF5A 1B3YA 2DGAA 4W87A 1CGXA 3CUIA 1QVBA 1HF6A 1VJSA 4DWSD 2BHYA 3SUWA 1JAEA 3CZGA 3WD1A 3SCRA 1QI0A 3AMCA 1C3FA 2VX6A 4GQQA 4AISA 3OLGA 2PWFA 3B8SA 3I3BA 1W1VA 3GBEA 3ARQA 4AD4A 5E6ZA 5A3HA 2WZHA 1Q6CA 3GM8A 1CGWA 3WQ4A 4CCDA 3VDCA 2CESA 2VVSA 2OYLA 3BMWA 2UY5A 4RE3A 7CGTA 1A47A 4QFUA 4DM2A 4LX4A 2VZUA 2WXDM 1DWAM 3AHXA 4HP5A 4GQRA 3W53A 1D7FA 1UH4A 2D22A 3RO8A 6CGTA 4WKAA 2CXGA 1J9YA 4TVUA 1HJSA 5AC5A 1OIMA 5A2AA 3NJ3A 3GXIA 3LPOA 5A95A 4WSKA 1EDTA 4TX8A 2A3HA 1E43A 1NOWA 1V08A 2EO7A 3IK2A 4JKMA 1GQIA 2ZUMA 2WBGA 2UWFA 5CLTA 3OA5A 1G1YA 3WDHA 3I3DA 4H04A 1Q6FA 4JFSA 2D0FA 2JFEX 1ECEA 3VGDA 3TOPA 3MMDA 1CXIA 3NCOA 4CU7A 4D1IA 1BYAA 4KRTA 4HOZA 4WKFA 2J25A 3A47A 3ZR5A 1E70M 4MB3A 3WDJA 5DFAA 3IJ8A 1AQ0A 4M8UA 2XFFA 4BZYA 3CHFA 3L4TA 2W62A 1KXTA 3D3AA 3QHMA 4CN6A 3WIJA 4GO8A 5E09A 3BGAA 3VILA 1FP9A 1TVNA 2WHLA 3WD2A 2J8FA 1CXFA 4XZBA 4DUXA 5AYBA 2W63A 1ISZA 4CGTA 1CEOA 3MSDA 3SUSA 2ZX7A 1HVQA 1E56A 3NYDA 2OWWA 4ATDA 4D6IA 3QHOA 1I1XA 3TTOA 8A3HA 4WF7A 3PZGA 3RM8A 3F5LA 2E0PA 3OZOA 5I23A 2VR4A 2UY2A 2BXZA 1F4AA 5A6BA 4TX6A 4U31A 1MFVA 5BROA 1QBBA 2QMKA 2Q8XA 2PWHA 3ZR6A 1JG9A 5GNYA 1WZMA 1FOBA 3CBWA 4AD2A 4FLSA 2O9PA 4CN1A 4N42A 2XPKA 4X0VA 3VGFA 3POHA 3B9AA 3BXWA 1G5AA 3WDRA 4PMXA 3W27A 1PIFA 4ATLA 1GJUA 2DT3A 1CXHA 1IZKA 2X1IA 3WNNA 4F9JA 1LL6A 2VQUA 3T0BA 3NSXA 4C7FA 3SCPA 4RE4A 2CKRA 4UZUA 4J3WA 4UOJA 1GORA 1NP0A 1JD9A 3W38A 1C92A 4IPLA 1UUQA 4DUWA 4PMYA 5HBFA 1B30A 4MADA 3AYSA 2V3FA 1EGZA 3GXFA 2ZICA 1UR9A 3ARTA 4KH2A 5BXRA 4GPNA 1JI2A 1QPKA 1NWUA 2WNWA 5D8WA 1DWIM 4PSRA 2FH8A 1TCMA 3ZOAA 1KR0A 3EMCA 1LLOA 4TUFA 5KEZA 2CERA 3N15A 3MSGA 1QI3A 3SCUA 3T0AA 3AMLA 3BMVA 1ZBKA 5FIPA 2GSJA 2VX4A 4AZ5A 1B3WA 4JL1A 2VJXA 2EQDA 3GXMA 1K6AA 1KCKA 2WMIA 3N11A 2WB5A 3VIGA 1HXJA 2F2HA 2YLLA 1UR0A 3GH7A 3UCQA 3W82A 3VX1A 3OLDA 2FGZA 5DO8A 3O2LA 3AMKA 3AI0A 1BHGA 5AY7A 3WQ8A 4P7LA 3WF4A 4GI9A 2DSZA 1UWIA 3LPPA 3AMGA 2TAAA 2WCSA 3VNZA 3NSMA 3WF2A 3EDDA 3BAYA 1JYNA 1AQHA 3N13A 2J77A 3CUHA 1MW3A 3T2PA 5HXMA 2XUCA 4CUCA 1EO7A 2C7FA 3AZTA 3T0DA 1M04A 1V3LA 1UH2A 3POCA 3VD5A 2G4FA 1E4IA 4CVUA 3B9DA 1LQ0A 3CUJA 2VRQA 1CGUA 4W8LA 5A8MA 5AYIA 1GQLA 2XSBA 2DT0A 4EKJA 1NWSA 3CMJA 4ZE4A 2WZIA 4BF7A 2DSUA 2WVUA 1KGUA 2GJXB 1XYZA 1OWQA 4AZCB 1WZLA 3O6AA 3MUZ1 2WVSA 1W1PA 4U5IA 1G0CA 1GOQA 4YHGA 2GDVA 2WANA 3WN6A 2O9OA 1ZB5A 3KWXA 1WDPA 3WQ5A 5DT5A 4UR9A 3OBAA 2F8QA 2BY3A 2XG9A 3MKKA 5CPTA 1EA9C 4AZGA 1R8LA 1E3ZA 4HMDA 4U3CA 4EE9A 4MAVA 2GDUA 2JIWA 1N82A 3BLKA 3FHAA 3SCSA 3ECQA 3CZ8A 4D6JA 5IFTA 3CLWA 1WZAA 1XGZA 1C90A 1HL8A 3THDA 1W2VA 5CQ1A 4OBRA 4UCFA 1BYCA 1U2YA 3F5KA 5A8OA 4HU0A 1UR2A 2DT1A 5DEZA 2W66A 3E1F1 2ZX5A 2WCGA 1XD0A 3GH4A 1X6LA 4CD6A 4ZEPA 5A94A 3EDEA 4KGJA 4PMRA 2D0GA 3VM5A 4J27A 3QHNA 1BYDA 3I3EA 3PN8A 3EDFA 2WMGA 1B0IA 4AXNA 3GNRA 3CZEA 5A6AA 4E4PA 3ALFA 4FLQA 4KMQA 1W3LA 5A6KA 3WEZA 3MANA 5JBDA 2AMGA 3AYRA 3DHUA 2OYMA 1C8QA 3HMCA 3U7VA 4CU6A 1B9ZA 1WDSA 1KWKA 2WMIB 3CTTA 2VRJA 1IV8A 4H7VA 4KGLA 1QNQA 3M6DA 2WHKA 1E1EA 2BNJA 1XHGA 1PAMA 3VUPA 5C70A 4W7WA 4XX6A 1UQYA 5D8ZA 4JCLA 3AZRA 4PCSA 1XSKA 3AHVA 1R7AA 4AD1A 3L4YA 4M24A 1M53A 4PN2A 2GVYA 4KRUA 2FDMA 3FAWA 4NSBA 1SYTA 1UR8A 2CKSA 3MO4A 4AZ7A 3DYMA 3ZSTA 3SCNA 2Y24A 1K9EA 5I79A 2WCAA 3ZJ7A 3SIMA 4AWEA 1TUXA 4PTXA 1UA7A 5GQBA 4AD5A 1QNOA 2D23A 4NF7A 1S46A 3HJEA 3ZIZA 3A3HA 4PYSA 3WH5A 1I75A 2ESCA 1CXLA 1V0KA 1E3XA 4MJ4A 1UR1A 2NSXA 3K8KA 4URIA 4CD5A 4N0RA 2YA0A 2J7HA 4CU8A 1HJQA 3WFZA 1B3ZA 4M1RA 1QNPA 5JBFA 1RP9A 1EXPA 1R87A 5CPSA 1EOKA 5EFFA 5GNXA 1PBGA 5JIPA 4W7VA 1GVYA 1XYFA 3T09A 3RMEA 2CNCA 4GZIA 3AOFA 1KCLA 1M03A 4MDPA 4D6CA 1GJWA 4OZOA 5D9NA 1JYXA 4W88A 3OLIA 1WP6A 5BXPA 3ARSA 2XM2A 2DIEA 1TA3A 1VENA 3AHYA 4FMVA 2VNCA 4JHOA 1RH9A 3PZUA 3K4DA 5GNZA 1WDQA 2CPUA 4HZ7A 4AEEA 4U33A 1FFRA 1NARA 3FHQA 2ZWZA 4RL3A 1B31A 4BCEA 3VD9A 4JIEA 3WQ6A 3M46A 2VZTA 5LYRA 5CJ5A 2WC4A 4V28A 1OD0A 4Z2JA 2RGMA 1OM0A 3ARYA 4B3LA 1US3A 1ZBWA 4L4PA 4GZEA 2EJ1A 2XVKA 3WSUA 5KZ6A 1V3JA 3CUGA 4UTFA 3SCTA 3QR3A 2VX7A 1PX4A 3RM4A 3N17A 1EDQA 2IUZA 3WDPP 1WE5A 1QI5A 3NSNA 5D9MA 3A4AA 3OLEA 2ZX8A 3VIIA 4M29A 3SUUA 3WL1A 3CIVA 5EB8A 1GHRA 3AHZA 1BAGA 2YDSA 2ZUNA 2WMKA 1CBGA 2QMJA 4H41A 4BA0A 4DWSA 2GJXA 4H2CA 4UNIA 3VGBA 2WMHA 1UG6A 5ABFA 5BYWA 1CZ1A 1XSIA 4A4AA 1K9DA 3CZKA 1TE1A 3W6MA 2XFYA 2BS9A 2V38A 1W9DM 4JFVA 1GUVA 1VFMA 3PTQA 4CCCA 4GI8A 2Y8KA 2WLYA 3ZQ9A 4MB5A 5M3WA 2V5DA 2GUYA 1BSIA 1E0WA 3VIKA 4ACZB 1VBRA 2QF8A 9CGTA 2YIHA 4AIOA 1HP4A 4HA3A 5I24A 3K46A 2XVLA 1GOWA 4PMZA 2OLHA 5GPRA 2Y8VA 3SCVA 1KGXA 1R7OA 3FW6A 3BSHA 2BHUA 2VCBA 4ZXOA 1IT0A 5M17A 2BVDA 1YHTA 4PMQA 4EK7A 5CGMA 2NT0A 5DF0A 2VCAA 4ZXLA 5BXSA 3WH9A 4B15A 3ARPA 5JIWA 4QP0A 3WF0A 2XIBA 1C93A 1QOXA 1CPUA 4PBGA 1V6UA 1XV8A 2V3GA 4P7OA 1UD5A 3IJ9A 5FKYA 1GOIA 1XCXA 1JZ4A 4QLKA 3IAPA 3VX0A 1GNXA 1NQ6A 2VR5A 1FH7A 2DH3A 3L4WA 4W86A 4F8XA 3ZO9A 3L4XA 4U5KA 3BSGA 4D6GA 3LMYA 1WPCA 2CHOA 1W1TA 1XH1A 2WWDA 2YA2A 1UWRA 4J7RA 2BY2A 1RP8A 2ZOXA 2QHAA 4B16A 2D3LA 2OSYA 2VL4A 5AC4A 5M5DA 4EANA 2J7FA 1WO2A 1HJVA 1CGYA 3U5YA 1EOMA 4MNKA 3MUIA 3PTKA 4D6FA 2DDXA 4J3XA 4D6HA 1E4MM 1W3HA 4MJ2A 2W91A 2WHJA 1ISXA 5DT7A 5C71A 1HX0A 2D3NA 1ZU8A 4TXEA 2X2YA 5TD4A 3QOKA 5A6LA 4LYQA 3GBDA 2ZIDA 3EBVA 3OIHA 4TVDA 2X0YA 1VIWA 4E2OA 1UZ1A 4OJYA 2V3EA 3EMQA 1TG7A 3WMCA 3GDBA 1OGSA 4V27A 3RJXA 2ZUTA 5CZKA 4AIUA 3VTRA 1CYGA 3IANA 1HT6A 2WLZA 4UFIA 1WNOA 1HN1A 2X0HA 5IFPA 1XD1A 4WIWA 1GCYA 4DWSC 1H41A 4XV0A 1V02A 4W8BA 1E6NA 1SMAA 4XB3A 1CXKA 1LG1A 1JDDA 4LYPA 4Z2HA 3N04A 4JAWA 1GOOA 1HIZA 1J0KA 2ZXBA 4E8DA 3W6LA 2WKGA 3ARRA 2YA1A 1W3KA 3VD3A 3F4VA 5ABGA 2J75A 1JIBA 4RE2A 4NRRA 2PBGA 2GK1A 4C7DA 2E8ZA 3K4AA 4ZE5A 1G94A 4TTUA 5HOSA 2YL6A 2WMJA 3FXYA 4UQ9A 1UWSA 1OCQA 1FH8A 2WBKA 1BVNP 3TTQA 4QDMA 3PZNA 2XIIA 4HA4A 2J7DA 1Q6EA 4XZWA 2XWEA 3ZJ6A 3WH6A 4TOQA 1XH0A 4U3AA 3MMUA 3S2CA 5I0DA 3D5HA 1UR4A 2XVNA 3CMGA 3VIFA 6A3HA 1DHKA 1H0IA 3ARXA 4HA1A 3AIBA 2WPGA 3RCNA 1ODZA 2E3ZA 4QLJA 1E6XM 1MQRA 1OINA 2CETA 3ARZA 3ALGA 1UA3A 2E9LA 3WMSA 2ZE0A 2DSKA 3U57A 1E6SM 1GONA 2PB1A 2PI6A 1Q6DA 3NIYA 1US2A 4IUGA 4OIFA 1SMDA 5HNNA 2VCCA 3OG2A 3WD3A 2WC7A 1KQYA 3VU2A 3FY1A 2YDRA 3GH5A 3B9EA 4AEFA 2DSVA 4YHEA 1J11A 4U2ZA 2C0HA 2YBTA 4Q22A 5A1AA 5LA0A 2EEXA 2JEQA 2WHMA 2XYLA 1ZL1A 2WK2A 3SEPA 5BCAA 2DPEA 1NWRA 2WMFA 1A3HA 1VRXA 4P7NA 1JZ7A 1NP2A 2QPUA 3MUAA 1C7TA 2CIPA 1VEPA 3CHDA 2PWDA 3L4ZA 3EMZA 4M81A 1QHPA 4K68A 1KFWA 4PTWA 1GQKA 1BFNA 1MYRA 3CZJA 4J3UA 1EO5A 4S3JA 1TFVA 3G6LA 4J28A 3IAQA 2W67A 4D6EA 1H0GA 5IHSA 7TAAA 1V6YA 2JIEA 1E5NA 5FOOA 3LPGA 4A3YA 3ZM8A 1OBAA 1J0JA 4S3KA 3ZJKA 2DSWA 2XWDA 4W84A 4PMVA 2YOCA 1JXKA 2BVYA 4IM4A 2X8RA 3WEMA 1GQJA 1E9LA 3WDIA 3WNLA 4JFUA 3M07A 1CGVA 1NM9A 2ZUVA 4J3TA 1V0LA 2XJ7A 1V03A 3WNMA 2ZX6A 1KWGA 1VEOA 4OOUA 1E55A 1E0XA 4NI3A 4PTMA 4ZENA 4UOQA 1D3CA 4AZ6A 3UERA 4W5UA 4AW7A 2EBNA 4F9DA 2XSAA 3GYCA 2F61A 3THCA 1CGTA 1KQZA 3WNKA 1V3IA 3NDYA 1MXGA 4TTGA 2W61A 2D2OA 3ZT5A 2CBUA 3VIMA 1QI2A 4W7UA 3TA9A 1VEMA 2VZVA 2NT1A 4HMEA 4V2XA 2W4XA 1RD6A 3LPFA 3AS1A
chains in the Genus database with same CATH superfamily
3S2MA 1WZKA 3SUVA 2ZDRA 4NJGA 3WKZA 3O63A 4O13A 4Y6GA 1Z41A 2DZAA 5HA7A 3QY8A 1ZENA 3EWUA 2OFJA 3UXIA 4OECA 1SM9A 5I07A 1TWSA 4IXXA 4NXKA 2YJQA 4OVXA 3VIHA 3OTRA 3VIOA 4RZ5A 3VKDA 1E40A 1SVDA 3P67A 2E8YA 4C6KA 2WV8A 4LVFA 3HQ1A 5ABTA 4B3KA 3WQGA 4D8ZA 2PF0A 2P76A 4DO5A 3RJYA 1I0DA 4RCXA 4W93A 3R1ZA 1PV8A 1UMLA 3CH9A 4D71A 1HKJA 1S1PA 1EQPA 1LL7A 2JALA 2QPSA 4LW7A 3FVMA 2Y5SA 5E9AA 1MUCA 5BU9A 3QOMA 1DJWA 4UTTC 2DIJA 4LAZA 4UR8A 3IJDA 1HKWA 1WAUA 3P80A 4NP7A 3N4EA 4AYGA 4CD4A 3U3HA 1S2WA 1ADDA 1VPQA 4DF0A 3RU6A 4NAEA 3DUGA 3R8HA 4GBDA 4MLRA 3BW2A 3ITLA 3N18A 1E73M 4YTQA 3GVWA 3N6HA 1G9HA 2O56A 3VD4A 1KB3A 1QNSA 3HPAA 4GX9A 3W71A 3IJIA 4DHGA 2PRLA 3S5OA 4E8GA 2IXVA 1J0YA 5CBJA 3PNUA 3OGVA 4P8VA 1D2KA 3RU8X 4V15A 1HJUA 3OQ8A 3UY7A 1VJIA 2YW3A 3DYPA 5DBTA 4AZHA 2PTWA 5I2UA 1YKWA 2BXYA 3AJ7A 1AZ1A 3BJTA 2CITA 2PLMA 3BH4A 4UZSA 3IVUA 2YCKX 3MI3A 4GX8A 1MW0A 1DORA 2ANUA 1KO0A 1NY1A 1J2BA 3TXZA 3DYOA 1G6CA 5CSUA 3PWIA 2A3BA 1KM5A 2G97A 4ZL1A 3DFYA 4Q8NA 3B06A 3HGRA 2QYGA 4GO9A 1M68A 1KR1A 1HL9A 5E6YA 2OKTA 3GG1A 4QCEA 3VE7A 3MC5A 1J12A 2DP3A 3RLUA 3OVPA 1Q8AA 3V5FA 1DKWA 1L8NA 3U6WA 4PTDA 4JCMA 4KCUA 4LANA 3WBAA 3O6YX 1JF6A 3N29A 3GU1A 3LRKA 1ITCA 3SM0A 3NQ2A 1N55A 3TN6A 5I6SA 4MNJA 1EIBA 4QJ3B 5C2XA 2W5FA 3TTSA 4FNTA 3L12A 1A5SA 3BC9A 5EBAA 3IEBA 1JCXA 2Z4GA 1HL2A 1F3TA 3ZT7A 4XSLA 3V5CA 2L5HA 3GR8A 3KLLA 2ZZ2A 1LT7A 3WBEA 5H8UA 4PA8A 5C8BB 3SY1A 1G69A 1LL4A 3A64A 3S4TA 5FF7A 4ACZA 3NOYA 3QLLA 2IKJA 4LS2A 4FLOA 2A3AA 1I45A 2FGLA 5EMYA 2QUNA 4Z42C 5ECUA 2VFHA 3EYPA 1OCJA 4XAYA 5CAKA 1HQTA 3SURA 2VZOA 4HPHA 5GJPA 4E3TA 2GSEA 4XBJA 3OVGA 1LUCB 1V0NA 3NEVA 4R27A 3UJ2A 4JX5A 1MW2A 4DYJA 3VD7A 3JZEA 2PWVA 2ABAA 1AK5A 1PZ2A 4HB7A 1R3RA 3E74A 2F38A 5M03A 3R25A 2HZGA 1JCMP 3FV9A 1B5TA 5EPDA 3SRHA 2E67A 5XIMA 3URBA 4AUBA 1KXQA 2TSYA 5I7GA 4R5EA 1FFQA 5CC7A 1J0IA 2GFTA 2P8CA 4FOUA 3NPUA 3U8GA 4D1JA 3VOHA 4QDWA 4MAZA 2XH7A 2E4TA 2CFFA 4Q4RA 3O15A 1A5KC 3S42A 3L4VA 2FMOA 1H11A 3BOFA 4NAFA 4IP7A 1XIMA 1YW1A 4GNVA 2QCEA 1VFHA 3HU7A 2D20A 3UWWA 1HKKA 2NQ5A 4TQTA 3MV11 1MI3A 2Z1SA 2B31A 2PDNA 3AXXA 2X2GA 4ILSA 3P0XA 2ZBTA 1MFUA 4NAFB 1Q5MA 1R3VA 1TVPA 1QHZA 2AMXA 3O3RA 2KZHA 3MI2A 2Z2AA 2Z2BA 2XM1A 4JIIX 1XX1A 4L1WA 3FA4A 1FHDA 1OG6A 4DRSA 1DWGM 5CXPA 4KFPA 1MWOA 5DMNA 3WQCA 1O5RA 3TU9A 2OEKA 3NL5A 3GDKA 2YL8A 1EJUC 4Z2KA 4UQBA 3TONA 4IMCA 2PRHA 2KX9A 1TIWA 1POJA 3SR7A 4GC3A 5AHLA 1I4NA 2BGNE 2OOFA 4JFWA 4UQEA 3U9IA 6TIMA 1H60A 3R4IA 1SFSA 2YDQA 3NZRA 4O10A 4B9ZA 3ZLHA 3PK7A 4AB4A 2C16A 1F3EA 1XUUA 3KBVA 2BXVA 3PTDA 3PUGA 3KDNA 3OGRA 4Q32A 2AOSA 3QN3A 3SFKA 1ONWA 4OBSA 4OGZA 4S3DA 5LNSA 4UQAA 2J24A 5HINA 1E0VA 3DDMA 3WUGA 5BXTA 5LHEA 4MGGA 4CN4A 1CNVA 4LVDA 2X05A 1WAWA 2PDGA 3BPWA 3A13A 1PZ3A 2QCDA 4MTVA 3AXIA 3IRDA 4KESA 2A5HA 2HISA 3W1NA 2QGHA 4AEOA 1R9ZA 2FH6A 4YYFA 4N2YA 3Q4DA 5HNTA 1GPWA 1FDZA 4IFKB 4B5NA 2PPGA 2J78A 4YWSA 3AS2A 5I77A 1OZMA 2YL5A 1TV3A 3W7EA 2Y7GA 2GQ3A 3VIJA 2NZLA 2FPVA 4JFTA 1H4PA 1P7TA 5FF4A 1RR2A 3C6CA 1BGAA 3PZQA 1W9PA 1VFUA 3QVQA 1DXIA 4LB3A 5DXYA 1H5YA 2XFWA 3GX9A 4XZIA 1UW9A 2QCHA 1BGGA 1J79A 4Z1YA 1XFBA 3W23A 4MM1A 1S5TA 4PE8A 1QW7A 3TCEA 5C2GA 3NQ7A 1X7IA 4D8AA 1TV4A 1XG4A 3C2RA 3P8IA 3W1QA 2OWCA 4MB1A 1E6RA 3SY5A 4AD0A 2ZX9A 3I65A 1ODUA 4DM1A 2DQXA 2RGLA 3GG0A 4M5PA 4UQCA 2ZYFA 3N3MA 3AC0A 2Y85A 4E0CA 1VJZA 3QSTA 3AIEA 4DLMA 4K1WA 3WJXA 2PGFA 1JZ6A 1MEIA 2FVMA 4FEZA 1DWFM 4LAUA 1L9WA 1MXDA 4W85A 5T26A 1A5MC 1KKOA 1OSEA 1V51A 3QFWA 3JRKA 4BF5A 1Q4NX 2PUZA 3W37A 3MMWA 1FWNA 1QNRA 1H1NA 1XYAA 4AVNA 4IF2A 3WNOA 2E40A 5CC6A 4XZMX 4P7QA 3RMJA 3GFZA 3HJZA 3G1YA 3RR1A 2RJGA 1HP5A 5I3JA 3EA1A 2O92A 1C91A 3BG3A 4JN8A 1J0ZA 3NQEA 3WLKX 4A3HA 1SO3A 1JCTA 3GLCA 3DZ1A 2Z7KA 1Y7VA 5JBEA 3W26A 4JL2A 3THUA 3EB4A 1T99A 2W3ZA 4MY1A 1UZ4A 1EC9A 4WGHA 3SCWA 2VEMA 4X63A 4UNLA 1IEIA 3VKKA 2DFAA 1Z32X 2A2IA 3A23A 3PWGA 5BMWA 1JDEA 3EWDA 3CV2A 1VAHA 1MEWA 3VOCA 2CYGA 4PEEA 1X39A 4DUVA 3NM3A 3BOLA 3FEQA 1L0PA 1EX1A 2OZ8A 4CNUA 3SCQA 3WYZA 1OGGA 2V8ZA 4DBEA 1I1WA 1XLFA 3L4UA 2YFNA 1KM2A 2Z6IA 3T2OA 1AG1O 4ERGA 4AYSA 2PU0A 1XINA 3UP8A 1RV8A 3PNZA 3OP2A 4G5DA 3W00A 3GXTA 3ANYA 3G0UA 3W7IA 1PZ0A 4WK9A 1AH4A 2AL2A 3LUTA 1EJ7L 3WF1A 4OKDA 4MF4A 2PC8A 2Z25A 4P8WA 1OC6A 3QFEA 4F0RA 2J62A 1Y5WA 1ZBCA 1E71M 2VOMA 1XYLA 3R94A 3U7BA 4AWSA 2Z2UA 3GTNA 1DIOA 2HE5A 1XH2A 1VF8A 3OHIA 3B8VA 1A80A 2ZUUA 2DZSA 2ZRXA 1AD4A 2BX7A 3K1GA 1KFKA 1CLXA 2WW5A 3F4DA 3GNOA 1C7SA 4FXSA 3LA4A 4PUEA 4WSHA 5JH1A 2J79A 3VINA 3VYLA 4YL2A 2GJPA 2QV4A 2EJAA 2NV2A 1WXYA 1GOKA 1OT2A 4GY7A 3R6IA 2YL9A 3GG7A 1WCGA 3L9CA 3BSMA 4BFAA 1UIOA 4CNNA 5HPOA 4H9XA 5L9FA 3S6TA 3CQHA 1FHUA 2F7FA 1YE4A 4R9XA 4HJFA 1QVBA 2UZ9A 2C3ZA 1VJSA 2PU1A 1TPVA 4LY4A 3PC0A 4DWSD 1V7YA 3BL3A 4M7TA 4OE7A 2YFOA 4HTBA 1ELSA 3H7VA 5F4WA 5HMEA 1WX0A 1PTAA 1GTHA 2VX6A 5G2HA 4NX5A 2V63A 3OLGA 4POCA 3FDGA 2PWFA 2JGYA 3B8SA 3P84A 1KLYA 1S5VA 2ZVRA 3IJ6A 1IYXA 1QOQA 3V18A 3W07A 3TW7A 4RE3A 2DVUA 1P0KA 1A47A 1TR9A 4DM2A 4H7ZA 1Q7QA 4HNOA 4R85A 1AA1B 3AHXA 4GUHA 3W1UA 4FXJA 1UH4A 4FNRA 2D22A 2FB2A 3RO8A 2CXGA 3ICJA 1J9YA 4MZYA 4JNMA 3UWVA 3LPOA 2YZ5A 1ICPA 1Q65A 5DCEA 4LAKA 3VZXA 4TX8A 3W02A 1ZSXA 2IKGA 4A6GA 1GQIA 4XAGA 4GE8A 4N9CA 1XL9A 3KW3A 8RUCA 2QAFA 3ZLGA 1EPXA 2QXWA 3RF9A 5CLTA 1KM6A 4WQ6A 3SFWA 4GGBA 3MHFA 3OA5A 1G1YA 3WDHA 4DNHA 3I3DA 4H04A 3S5SA 3CWHA 2JFEX 1ECEA 3RAOA 1PWLA 3OYZA 3REQA 3TOPA 3MMDA 1KBLA 3NTYA 2WSYA 3K5XA 2VDIA 3HQPA 4KRTA 3IIOA 2TYSA 1X1OA 2HQAA 3TEVA 1OC7A 1QO5A 1EXBA 4BZYA 4B4FA 2W62A 3L0GA 3QHMA 3R10A 4N6FA 4XD6A 4UTHA 4JYEA 3WJSA 1TVNA 2WHLA 3STCA 4XZBA 4DUXA 1ISZA 4PCFA 3ZFHA 3CK5A 4US5A 2OX1A 3SUSA 5AC8A 2QZRA 3NYDA 2OWWA 5A6TC 3PZGA 2E0PA 2E5DA 5I23A 1AUSL 2EGZA 2BXZA 1F4AA 5G2IA 1XLAA 4U31A 5TNVA 3DKLA 1MFVA 3P81A 4KEZA 3IPWA 4O18A 1LM1A 3W84A 1OQFA 1DIDA 1EX5A 2PWHA 4JQ2A 1J93A 5AKQA 3MCOA 2CLIA 4O15A 5H2ZA 3OBEA 4AH7A 1Y8BA 4H00A 3UJEA 4OTKA 4L9ZA 4AD2A 4HJWA 4CN1A 2PDFA 3HMJG 3BXWA 1T5AA 4H7CA 3ES7A 5AECA 3XIMA 4IXHA 4IICA 2VQUA 3MBDA 3NFUA 5FEZA 2CKRA 4UZUA 2XH2A 1NP0A 3ANUA 2Z1BA 5HBFA 4BY3A 1S5WA 3AYSA 1WUEA 2FMNA 3IS4A 2VGFA 5T9BG 3G1RA 3GXFA 2ZA3A 1N2VA 2TPSA 3ARTA 5FACA 4KH2A 1Z44A 4GPNA 4Q6JA 1XICA 1QPKA 1UPPA 4MKVA 3CQIA 3R8RA 4G7EA 1B4EA 1KR0A 4DJFC 1LLOA 3G2GA 3MSGA 4NJJA 1QI3A 4QJ5B 3REQB 3SCUA 4K37A 1TIMA 1ZBKA 2DUXA 4G6CA 4XKMA 1SO6A 2EQDA 3GXMA 1O60A 3HA1A 2AQVA 3GH7A 1YE6A 3W85A 3TKFA 1FXQA 1LOQA 3AI0A 1RLCL 3TMLA 3LCGA 3IJQA 3WF4A 4AMAA 4GJ1A 2IKHA 4NHVA 3WJWA 2TAAA 3UVIA 5FSDC 4Z17A 4AFYA 3EDDA 2POTA 2DZVA 2AGTA 1GT8A 1EF3A 3I7SA 3ITVA 2YYTA 4RXGA 3W7QA 3T2PA 1KRMA 2HPIA 1JUEA 2C7FA 1SW7A 3AZTA 3T0DA 2R1KA 5AFDA 2AL1A 4CVUA 1LQ0A 3BOXA 1M5WA 1MNSA 2XU2A 2XSBA 2O0TA 1FWHC 4XZHA 2Y7DA 7PTDA 4IUOA 4ZE4A 3FCPA 1QATA 4BF7A 1EZWA 4PUKA 3WJZA 1Q2RA 3L5LA 2GJXB 3FGCA 3O6AA 3MUZ1 1W1PA 2CLOA 1GOQA 4A21A 1XIDA 2WANA 1ZB5A 3WQ5A 5DT5A 4UR9A 1KFEA 3P14A 2PDBA 2P3ZA 1EA9C 2DV0A 4AZGA 3B04A 2GDUA 4QROA 3SSZA 4IL2A 3SCSA 3ECQA 1O1ZA 3CZ8A 1KM1A 2OPJA 2D69A 4Q6XA 2X7VA 1WZAA 4ZO7A 2MNRA 1QWGA 3THDA 3QXBA 4TMBA 4EAYA 4OBRA 4YTUA 4K8EA 1BYCA 4FXFA 1U2YA 2VFDA 5K9DA 5A8OA 1K77A 4CQDA 2Q71A 2W66A 3E1F1 3LNPA 1W3NA 2WCGA 4O1CA 2JKAA 3BZGA 3GH4A 1X6LA 2DVTA 1TJRA 4GH1A 5A94A 4DJDD 1GG1A 3CHVA 2NVDA 2OEMA 4J27A 4M6QA 1EGVA 4JIQA 3I3EA 3EDFA 1EJVC 4F0LA 4AXNA 4E4PA 1GZ1A 1EC7A 1W3LA 3R5EA 3WEZA 2AMGA 3MPGA 2OZTA 1C8QA 3HMCA 4I5RA 3U7VA 1WKFA 5J8LA 1VZWA 1KWKA 2WMIB 1NF0A 4AWUA 1RALA 2NVAA 1QNQA 4M6UA 4PH6A 1E1EA 2BNJA 1KFCA 2PTZA 2TODA 1F05A 4W7WA 5D2XA 4NZ4A 1YNQA 1UQYA 1LWIA 4XIAA 2VUNA 3UF9A 4LUIA 3GUWA 3TE9A 3DFPA 5J04A 1XSKA 3NPVA 5D09A 4TV5A 5EBUA 4CCZA 1M53A 4PN2A 2GJLA 3TMQA 2FDMA 4NSBA 3CQJA 3UZXA 4EF8A 4I6KA 2HMCA 2QCLA 2Y24A 2GUBA 3W2NA 4RXFA 5DY2A 3TLLA 1OF8A 4JTCA 1UA7A 4AQLA 2OODA 4NF7A 1W8GA 3HPZA 3A3HA 3KXQA 3OPSA 3PBMA 3ATYA 4ZQMA 1EBHA 1I75A 4ZQPA 1HJQA 3M0YA 3WFZA 3A24A 1QNPA 5JBFA 1RP9A 1EXPA 1R3TA 4KEUA 1VYSX 2IW0A 2FQIA 5JIPA 3FK4A 3SZ8A 4C6LA 1GVYA 1XYFA 4GZIA 2V81A 4Q8PA 4WR3A 2YYUA 3STFA 4IMDA 3NWRA 2DZXA 3QPZA 2V2HA 1OZQA 4S3EA 1TA3A 3T05A 2NV9A 3C52A 4QSHA 2OEJA 1ADOA 5T91A 4QJ1A 1EKOA 2A7NA 1RH9A 2GPTA 2OGYA 4HIBA 4BI5A 3FJ4A 2X16A 1WDQA 4G2DA 5FSEC 3W74A 4V1YA 4AEEA 1NARA 3FHQA 4RL3A 1AL7A 4BCEA 3TV8A 2XDFA 3G0SA 5CJ5A 1OD0A 3C0SA 3ARYA 3M0MA 4WY0A 4ERIA 5AC6A 2A7RA 3WLTA 2D2GA 1ZBWA 1UP0A 4L4PA 4GZEA 3W73A 4TO8A 4ZQOA 2E09A 2INEA 3WSUA 3EX1A 1XBYA 1OFEA 4MYXA 4NZJA 3QR3A 1Z8AA 1MDLA 1EDQA 2C15A 1FY6A 3QR1A 3TIMA 3UZZA 3VIIA 3SUUA 4NJIA 1LYXA 1UP2A 4WDTA 1JPKA 3WL1A 1Q7ZA 1BAGA 1EJSC 2ZUNA 4PC8A 4BKNA 2X1SA 4DWSA 3M41A 4C60A 2PP1A 1HTIA 4OHQA 3VGBA 2JKEA 4C5ZA 1UG6A 4WX2A 2PTXA 3TLQA 4IMGA 3F2CA 3UQNA 1XSIA 4PUMA 5LNVA 1TE1A 2BS9A 4KCVA 1K8CA 4EVZA 3ZQ9A 2Y8KA 5M3WA 3TR2A 1BSIA 4O14A 2QF8A 3EWZA 1LCOA 1VD6A 4YCOA 2V5BA 3K46A 3NQDA 3NNTA 3VC5A 4PMZA 2OLHA 5GPRA 2J6XA 1L2UA 5CGQA 5KINA 2YCLA 5IBXC 1I60A 4PL2A 3TDFA 1RK6A 3ZZ1A 2BVDA 1YHTA 1QFEA 4HYWA 4UC5A 4ENLA 5DF0A 3R58A 5JIWA 3HURA 2Y89A 2XIBA 1T41A 3KHDA 3M44A 2GDQA 1V6UA 1XV8A 1RZMA 2V3GA 4HHMA 2YR1A 4P7OA 4QQ3A 4B92A 3LU2A 4WY0F 3GFYA 2FZBA 3I68A 2C0AA 2PDYA 1Q6OA 3JZUA 1K3UA 4W86A 3V0TA 3UJSA 3ZO9A 3L4XA 3SQMA 4U5KA 1PKNA 4ICNA 3LLDA 3P93A 2CHOA 4GUIA 3GSMA 3IARA 3S5NA 3WBXA 1IT8A 2BY2A 3CASA 3W7RA 2NQHA 2QHAA 4B16A 5AC4A 4EANA 1XI3A 2J7FA 1FXPA 3QYSA 4MWAE 2XGZA 1KV8A 3TCSA 5BNKA 1WDDA 1EOMA 2Z1XA 3MUIA 3PTKA 5B7YA 4DAFA 3PAJA 1PSCA 4M0XA 4D6HA 1W3HA 1IIHA 2CC0A 2OXNA 2W91A 2WHJA 5DX7A 5FAGA 2D3NA 1ZU8A 3FVDA 1Q7MA 3BE7A 3QOKA 3M0JA 4LYQA 1KRCC 5EMUA 3GBDA 3EBVA 1B9BA 2X0YA 4UTWA 3UFYA 2PWUA 4OJYA 3N2BA 1UR3M 3GB6A 5HQLA 3EMQA 3WMCA 3GDBA 3RJXA 3EOLA 2F6UA 1A5CA 3LTSA 2VD8A 5CZKA 5CSRA 2GVGA 3GNXA 1KD0A 2WLZA 3O7UA 1Z3NA 1WNOA 1YEYA 3MP3A 1XD1A 3LN3A 4K1GA 1GCYA 2PCQA 4C91A 1EC8A 1V02A 3BG9A 1E6NA 3QZEA 4LUSB 4LYPA 1OYBA 1R6WA 1KTNA 2Y70A 3N04A 4EXAA 1HIZA 3LHVA 3JR2A 5HJXA 1BRLA 3ARRA 3WBWA 3E0FA 3F4VA 3CYJA 3Q94A 2E5BA 5FJRA 4NRRA 3L23A 2E8ZA 1ECQA 4TTUA 3I7RA 4QAIA 4HSHA 5HK4A 1OCQA 4DLFA 1FH8A 3CL8A 3B4YA 3TQKA 2WBKA 2A6NA 4J40A 1Q6EA 2QULA 3ZJ6A 3W22A 4CLMA 3OO2A 3MMUA 1UUOA 3O6CA 1H50A 4O1DA 3GRIA 1M41A 2R1NA 1V77A 4HA1A 1F61A 2YSWA 2WPGA 2VEFA 1UJPA 1GWJA 6XIMA 3LMZA 1A53A 3WMSA 3A12A 1E6SM 2PB1A 4J1OA 4OIFA 3WZ0E 1DTNA 2WC7A 4OWGA 1Q6LA 3LY0A 5C9WA 4F4RA 3LS9A 1LLZA 3PULA 2PE4A 2YDRA 4FNUA 3GIPA 2DSVA 3UPWA 3MSYA 3WQFA 4NZFA 4U2ZA 5K9CA 2C0HA 5EL1A 5LA0A 4Q4QA 4LNYA 5FEWA 4GNKB 3VNLA 4XK2A 2V5KA 2DPEA 2OQYA 1QRQA 2UBPC 4EXQA 1AJ2A 4RLIA 3AXMA 3OZMA 3STEA 4NVTA 1NP2A 4HU4A 2QPUA 1XLDA 3TYEA 4H8NA 3M4HA 2CIPA 1CI1A 2NX3A 1QHPA 4K68A 3UYIA 1KFWA 3DFNA 5HR7A 2YXXA 2WSRA 2JIEA 4JS3A 1E5NA 1F8MA 4A29A 5FOOA 4A3YA 1WA3A 3ABQA 1J0JA 4S3KA 4JYFA 4ONVA 2C71A 1JXKA 4GYFA 1VLWA 2BVYA 1FUYA 2WNZA 3DI0A 3WEMA 1WXJA 4UMBA 1NFPA 1V0LA 3WNMA 1M7OA 2ZX6A 2RJHA 2ZA1A 4F2UA 1E0XA 4GHRA 3UZWA 4AZ6A 3UERA 3TNBA 1DQWA 1KQZA 3WNKA 1V3IA 2D2OA 1V93A 3TA9A 2VZVA 2NT1A 3W1AA 2W4XA 4JTSA 4C6DA 1RQBA 3LPFA 3AS1A 1W9BM 1T40A 4RDWA 5H6HA 4JEJA 1R3SA 1WDRA 1WKDA 4JQ3A 2A1YA 5IDIA 2WC3A 3KBWA 4K8GA 1P6WA 4PRWA 1A0EA 3G3MA 4KQNA 1XC4A 4B4HA 2VVNA 2XGBA 1V3HA 4FNSA 1ITXA 2Z29A 4TVCA 4DF2A 4LBUA 4K3ZA 1AZ2A 2P0OA 1ISYA 1FDJA 2J47A 4H6KA 4NX0A 1F9CA 4CD7A 4A8IA 5E93A 1K8XA 2Z0IA 4XZ9A 4S3BA 1XYCA 4HT3A 2QGYA 5C9XA 2XIMA 1QBAA 4LVBA 1V6TA 2VMFA 1O66A 3SGUA 1MUMA 2DH2A 2FHBA 4JY8A 4L65A 4NYUA 5BOOA 2V5CA 1BLIA 2D24A 1NWTA 4WCJA 4GZ7A 3LQGA 3CTLA 1TO3A 4ASTA 4JTHA 4J9JA 1XPYA 2HEJA 3SN0A 3B0VC 1UWAA 4D9PA 1JAKA 3CAQA 5D2VA 5C2CA 4RKAA 1TV2A 4BK9A 1TPEA 1IE7C 4JD4A 4MJZA 2VFEA 2O55A 1P6CA 2CW6A 4H9YA 2R82A 1GVRA 1F4HA 1WKYA 3RITA 3VMOA 3SSJA 5IHRA 2BOGX 4IIBA 4HSOA 2QLYA 2WM0A 3PB2A 3USBA 3UW6A 4GIAA 3TN3A 4Q4OA 4HZ6A 1H5VA 1T8XA 4F0MA 2QUMA 1MVYA 3MW7A 3LZ5A 3BGJA 1EFZA 1KBKA 4ZGYA 3N1AA 3VI2A 4Q7NA 1L6WA 2DJLA 2WVVB 2CLPA 1CWYA 1HW6A 3PBWA 3MJMA 3G1DA 1J01A 1ZJAA 1P48A 4YWIA 5FL1A 1SR9A 3G1HA 5CC3A 2HCVA 2WAGA 4D2JA 1WBJA 3VVGA 2Y61A 4J4KA 1ZZMA 2RDXA 4BQ5A 3L5MA 2V2CA 3MVIA 4ZQRA 1DJQA 2E6YA 1W9VA 3VDBA 2CZEA 1AW5A 3C2VA 3T9PA 3BGGA 1IGWA 3P8JA 1DP0A 3RHGA 3CZLA 2OSXA 2X0SA 5A6BD 2Y8UA 1J0HA 3KE0A 3S2LA 1UKSA 3P3BA 1C8YA 1EP2A 3CUFA 4R7WA 1K7EA 1JYVA 3EOEA 2E1DA 4LPCA 4QEHA 4XZNX 4O8RA 4S1FA 4MFEA 3TP4A 4LJ3A 2FTWA 2XFRA 2I5GA 3LSCA 1PO9A 1H49A 3EWBX 2I1OA 1LBLA 4FF5A 2ISDA 3G8RA 1U33A 2PSNA 1X98A 3CMFA 4LBRA 1VPXA 2WJDA 3TWBA 2J7GA 3L21A 2P53A 3QMSA 1FWIC 3RILA 2D1ZA 3EA2A 1F07A 1SW0A 3EPOA 1UHVA 1Q13A 4X0NA 3RM9A 3AYVA 1P0EA 3A9BA 1V02E 3PHAA 1RCOB 1UASA 2C8NA 3TX9A 1TYGA 3A4XA 3TAKA 1EH9A 5KZMA 3VM7A 2DZUA 1WB0A 1ZJBA 3IIZA 4E3VA 5I3DA 4F79A 5A8NA 3E6EA 2H90A 3VGEA 1R5YA 1KFBA 1CB7B 1L8PA 2VD9A 4B91A 4PL1A 3CC1A 5D05A 2QF7A 4JDYA 4O52A 3UG5A 3QZAA 1JYWA 1CECA 1R0MA 4JX6A 4AHOA 2HS8A 4WDXA 4C6IA 3KP0A 1DWJM 4WXYA 1S3TC 5A6JA 4BS0A 2J74A 2GWNA 9XIMA 2Z26A 3EOOA 1EYEA 1YPIA 1R38A 1O12A 2FHFA 5DMYA 3KL0A 2ADAA 4UWMA 1YBQA 2NW0A 4IIGA 4ZSTA 3BAIA 1VC4A 1OD8A 4ZTYA 1QW8A 3PZVA 2GJRA 1DJGA 5EMLA 4FIQA 2VEPA 3SJ3A 3B8IA 1JZ2A 3M5XA 4JTGA 3WL0A 4HPGA 2VDHA 4Z0JA 1JCLA 2G41A 2R6OA 1BG4A 1E9YB 1ZHAA 3VCNA 4BF9A 1W1YA 3MMTA 3K8MA 2XIQA 2HNHA 4M7SA 2PDQA 2Y63A 3EX2A 5CZ0A 2WJFA 1FWCC 1JZ3A 3W4RA 3B97A 4US6A 3V4BA 1TPH1 4O1EA 4XQ6A 4UFMA 2VEGA 5IDZA 2C14A 5DCDA 2HWGA 1EWEA 3LEPA 3WD4A 4A22A 3ME3A 3W86A 2OLSA 5F2GA 2OO6A 4PUJA 3UNTA 4QXIA 4GGHA 4WVXA 2VX5A 3FN9A 3UWEA 1PX8A 3WH7A 4K6AA 4A3UA 3W6YA 1W3JA 2QNEA 3C2YA 4ZFMA 4RPPA 3VDAA 3LX9A 2V0TA 1Z7AA 4LVAA 3VNYA 3FFSA 4JGDA 4C7GA 1YDYA 3CT7A 4BQ3A 3W2UA 3M64A 3C0QA 3UCCA 4YTRA 3NDZA 3INPA 2V5JA 1KV5A 3BAWA 4W4QA 3OZYA 2B7NA 1RY8A 1E5JA 3G1VA 1GVIA 2OELA 5FI8A 4QR6A 1AJZA 1B90A 5ECVA 1X1NA 1LOSA 4LCRA 4D72A 3N73A 1EUAA 2P8BA 4U4MA 2BWGA 1QTWA 4CNSA 3W7CA 1F6YA 2Z28A 4IISA 1RXOB 1AQFA 1V79A 3CGTA 4CNPA 1PIIA 3ZT6A 1A0DA 3L2LA 1X6NA 3MQTA 4LS0A 4OU1A 3UESA 3MSRA 2Y4SA 3J7HA 2W9MA 3FYOA 2XZ7A 3W88A 2DW7A 4Q4MA 3PJUA 1OFDA 4NZ5A 4Y9OA 4IMEA 4EOUA 3UA3A 1PS9A 3QC3A 1V3KA 4DZIA 4Z0SA 5MHBA 3ZVHA 4B2DD 3EDKA 3IJLA 3NA8A 3VO0A 1UKPA 3U5UA 3PBYA 4S23A 2CU0A 1ICSA 4CVWA 2RDTA 3KZSA 1QPNA 3V1HA 3AIQA 1TKKA 1SQ7A 2E77A 4MUPA 1E15A 4PTVA 1VYPX 1JULA 2FKPA 1FWGC 3FLUA 1P1MA 5CZSA 2VZSA 4XUYA 5G1MA 3RLGA 3B9OA 1A3XA 3PZMA 4UFKA 5F1UA 2XINA 3KTSA 1K02A 4KETA 3EXSA 1SZNA 1A5LC 4Q8WA 4DNMA 1BRLB 4A2SA 2OWXA 3DECA 4DELA 2PDXA 4AD3A 1FCQA 1DXEA 1XJBA 3DC8A 4XBKA 4Q7BA 4RUBA 4WZHA 3H54A 4US5D 3G6MA 1RD5A 1E0UA 1R85A 2B81A 3CYVA 3FKRA 3CQ0A 1RA5A 5C9ZA 3GVVA 3VGHA 4RK8A 1Q66A 3W29A 1OC5A 4AMCA 5A6MA 3L2MA 4Z2LA 2C13A 2PZNA 2OSWA 1H09A 1IGSA 3VUSA 1NDVA 4NIRA 3RPMA 3PANA 3TUUA 1OYAA 3F4NA 3WUBA 1M65A 1YXDA 3T4WA 1TZZA 1HG3A 4FXRA 4ML9A 3HFYA 4GOAA 4ZQNA 4R3UA 4AY8A 2INFA 4C1LA 3HGSA 9XIAA 2VQTA 1NH6A 4KFOA 4AX7A 3UWQA 4GISA 4YYCA 1MW1A 3BAXA 2HNEA 2VKZG 1EHNA 3AS0A 3LGGA 3OB8A 1W9UA 2ZXDA 3R79A 2BVTA 2VOTA 5G1YA 1MQPA 2PGRA 4R88A 3GZ3A 5I3IA 1VIZA 2QDHA 3M5VA 2E6DA 3N2OA 4KERA 1EB3A 4XKYB 3WO8A 3GU9A 3STPA 1JZ8A 3CHEA 2VELA 3H12A 1UCWA 4GLEA 1SJBA 4J35A 1WBHA 3ZVHB 4K7VA 5KMYA 2PS2A 2FHCA 2YKKA 4K39A 2CBIA 1M1BA 4LQ1A 1P0NA 3A21A 1UWQA 3VNJA 2OMAA 4YLWA 3CPGA 3W70A 1PDZA 4GFSA 1BTCA 3ONCA 2H3BA 3MCNA 5RUBA 5HAOA 1E6QM 1CCWB 3GVGA 2DUAA 3AXHA 1TRDA 4AF0A 1X6UA 3SBFA 2YCLB 3N2CA 1TX0A 4R34A 3ZJ8A 1TZ7A 3JVAA 3A4WA 1BWLA 1R86A 3QF0A 4FNQA 1P7TB 4WHBA 4AIEA 4IGMA 2PZ0A 5K2ZA 1RJPA 1YTDA 3TW6A 4GK8A 1O95A 1XDLA 3F4WA 4LU0A 1Z69A 4AY1A 3GQYA 4JKKA 4HOXA 1RBOB 4P7RA 3B05A 1Q85A 1H62A 4K36A 3V3WA 2G3JA 5CPNA 1ISVA 4YN5A 3AUJA 4EWND 1HKMA 2Y5EA 1E9ZB 2G3MA 3NQ6A 5HMDA 3NL6A 3MA8A 3O1NA 1O4UA 4ECLA 1A0CA 1VBHA 1FRBA 3PF3A 3CL7A 3TJLA 3U48A 3WLJA 3DH7A 1MZRA 1D9EA 4HBKA 2FJUB 5DELA 2E6AA 1CGXA 3OA3A 3I4KA 3LK6A 3MVTA 4S39A 3TJ4A 3F7JA 3M5ZA 4LVGA 5D30A 3W7MA 4FOKA 2MUCA 3WD1A 3SCRA 1QI0A 1XIHA 4EPEC 2PDHA 3W75A 4GIYA 5FJUA 1VFSA 1K4HA 4DBSA 3ENLA 1W1VA 2IKIA 4LCSA 3KUMA 1AMKA 2Q3RA 5LIWX 4C65A 3QTPA 2UY5A 2V9DA 7CGTA 1IXNA 4TIMA 3CLMA 2WXDM 1V8EA 1YMYA 3DHDA 4GQRA 4LSBA 3NPWA 3CL6A 7ENLA 1KM4A 2WKJA 6CGTA 4WKAA 1N8FA 3VCCA 4TVUA 3FEMA 5A2AA 2V6AA 5A95A 4WSKA 1G4TA 2A3HA 1E43A 2EO7A 3ITGA 4O57A 1H1YA 4RDYA 2ZUMA 1DHPA 3GYEA 1EL3A 3DBPA 4REQA 2INZA 3W76A 1BEUA 2D0FA 2CLFA 3RCYA 5EMKA 4LUJA 2H9AA 1CXIA 5C5YA 3NCOA 4HOZA 3WLRA 3ZR5A 4I9MA 3APTA 3I7QA 4F48A 4IQEA 4M8UA 4LH8A 5CZJA 5KZDA 2BASA 3CHFA 2FFCA 4CN6A 3E0WA 4DEFA 1OCBA 3VILA 2XN0A 2R1MA 1IHIA 1W31A 3WD2A 2J8FA 4CGTA 1CEOA 4C6OA 3MSDA 1E56A 4I8YA 3P0WA 3QHOA 1I1XA 1AODA 3QLDA 8A3HA 4WF7A 3RM8A 3F5LA 4A05A 4B3ZA 4JTIA 3EEGA 2VR4A 2UY2A 3QPYA 4Q4KA 3TYBA 3C3NA 2R91A 3CU2A 1QBBA 5JU6A 1OK4A 2QMKA 2PP0A 4GYJA 1JG9A 5GNYA 1TE6A 1WZMA 5G5IA 3CBWA 2ISSA 3LM7A 4AY7A 2PLKA 3TROA 3VGFA 1SZRA 3VOGA 2E25A 3KRUA 3EWYA 2X1IA 4F9JA 3T0BA 4C7FA 4ZMGA 4RE4A 1ME7A 5LNWA 4JTTA 1H63A 3EX6A 3MWCA 1JD9A 4IPLA 2QIIA 3OYXA 1B30A 3TSDA 1ZP3A 4O1AA 1XFCA 3DAQA 2ZICA 5FJTA 1UR9A 3OU8A 2OB3A 1BTMA 4GYPA 5D8WA 3FJNA 2FH8A 4R7OA 3ERPA 3EMCA 4TUFA 3GHTA 4PB3A 3N15A 3BMVA 5H8MA 5FIPA 3C2FA 4H4IA 3SGGA 2GSJA 4AZ5A 1JPMA 2VJXA 3N11A 4CQAA 3P74A 3E2SA 4JY9A 2F2HA 3W7KA 3G18A 2A21A 3DX5A 1UR0A 1KRAC 3U2CA 4WJ8A 3GW0A 3OLDA 2PC4A 3O2LA 4ORIA 5LZLA 1BHGA 5AY7A 1ZNNA 4QBXA 4P7LA 3S1WA 2XN2A 4J2PA 1Q6RA 3W72A 4GI9A 4FA3A 3KP1A 1UWIA 1AJ0A 3N2TA 3NSMA 4Y90A 3GIQA 4YVXA 3UG8A 3KS6A 4NJHA 1QO2A 3BAYA 1AQHA 3NQMA 1KLZA 1OFQA 3N13A 4M3PA 3CUHA 3LERA 5DLCA 5CPMA 4LV9A 4CUCA 1EYWA 2FZMA 2F84A 1M04A 1V3LA 1UH2A 4OT7A 2UV8G 5I3KA 1E4IA 4ORMA 4Y96A 3B9DA 4X9SA 4W8LA 1XLJA 1GQLA 3AJXA 2DT0A 1B4KA 3R2GA 3RR4A 4EKJA 1NWSA 3OIXA 3CMJA 2DSUA 2WVUA 4ZA0A 1RSCA 5JMUA 1KGUA 3EWWA 3PSVA 3L66A 5K7JA 2WVSA 5EMJA 4YHGA 1FVPA 3WN6A 3KWXA 3KX6A 1WDPA 2AAMA 3OBAA 2DY3A 3HPFA 5CPTA 3T7VA 1E3ZA 4HMDA 4L64A 4HU3A 4MAVA 5HR6A 5CJNA 2W27A 2KAUC 2EG8A 1UROA 2PDCA 3SW6A 3BLKA 2BB0A 1OFOA 3D0CA 3LZ3A 1EIXA 4D6JA 4GJJA 4C1KA 3G77A 5K9XA 4NY2A 2NX9A 3MTWA 4HYVA 1K03A 3V0UA 4E4FA 3PPFA 1TV8A 4ZTXA 2BOEX 3THAA 1GKQA 4BR1A 4A8NA 1US0A 1XD0A 4MUZA 1G4EA 3QMTA 4PMRA 1SFJA 4CQBA 1O5XA 4DF1A 4XAFA 4DO6A 3G24A 3U2ZA 3GNRA 3ALFA 2I17A 4ADTA 1RBLA 4L6OA 3AYRA 3DHUA 5JVLA 1PYFA 3C2EA 3HG5A 3GHUA 3LI0A 1WDSA 1DE5A 3E0IA 3CTTA 3S9IA 4QG6A 4KGLA 2WHKA 1XHGA 4B5SA 3NL3A 4BHYA 1PAMA 3N4FA 5C70A 4XX6A 1FX6A 3M0IA 1H7XA 1I0BA 4JCLA 1C29A 1JR1A 4PCSA 2D2HA 4Q8MA 3UVAA 5AOUA 4MFDA 5D03A 4QE1A 3FAWA 3NDOA 3RO6A 4AZ7A 3E12A 2GGGA 4JTLA 1K9EA 3DOPA 4WRHA 1K1DA 2I7GA 3DFHA 4AWEA 4LRSA 3BJSA 4AIBA 1GVQA 1F5ZA 1L6FA 5IBXA 2D23A 4GXMA 2RDUA 3H4GA 1SJAA 3HJEA 1ZY9A 5D04C 3FSUA 3V36A 2P1FA 1ADSA 1UR1A 3K8KA 3DFTA 4IIEA 4CD5A 2YA0A 4CU8A 5D2YA 5DANA 2GVJA 3URAA 3BK0A 1ZCCA 5CPSA 3HG3A 3LV5A 4I9AA 1VBJA 5EFFA 2V2DA 4IL0A 3S1UA 4O53A 4GIEA 4W7VA 3GKAA 3AOFA 5TF0A 3LGDA 1AD1A 1KCLA 1BWVA 1M03A 2QKFA 4MDPA 1B54A 4D6CA 1GJWA 1JYXA 5D9NA 4W88A 4I7UA 5BXPA 3ARSA 5HQMA 2DIEA 1VENA 1ZRQA 2QAPA 3U2EA 3PZUA 4IMFA 2V30A 4XVEA 2CPUA 3MDWA 4U33A 1FFRA 1FWRA 2OQLA 5J5RA 3PAOA 5FF0A 4M6VA 3WLNA 2VZTA 2FJKA 4V28A 1IXQA 4LRTA 1K8YA 3SN1A 1J96A 4IHCA 4Z1DA 3TQPA 2XVKA 1L6GA 4H9VA 1V3JA 3N14A 4UTFA 3E96A 1WYIA 3HGJA 3RRXA 4J5NA 1PX4A 1JRCA 1LRTA 3N17A 1J6OA 1WE5A 3RGTA 3E2QA 5D9MA 4HN8A 2CXEA 4M29A 2I56A 3AYTA 3CIVA 2ZRVA 1GHRA 3AHZA 2YDSA 2VM8A 1CBGA 1ZLPA 4H41A 4BA0A 1TREA 2DORA 3UA4A 3C0JA 2XN1A 4UNIA 3UYCA 1PB0A 2DZBA 3WLLA 5HMFA 5BYWA 4XIMA 3A4JA 3NQVA 4I7VA 3DENA 1S2UA 2ASHA 4C6NA 3W6MA 1PYMA 4BJHA 1TWIA 1XCFA 1W9DM 2R1PA 1GUVA 2A85A 3MJYA 4JFVA 4NASA 3BLDA 3NXLA 4LY8A 1F76A 4HK6A 2GUYA 6REQB 1E0WA 5A5WA 3VIKA 2CZ5A 1VBRA 1S1RA 3W7GA 9CGTA 1TTQA 4Q8OA 2YIHA 4YMZA 1HP4A 3S1GA 4PBEA 5D02A 5JXQA 3SCVA 1R7OA 1ONRA 3FW6A 3BSHA 5LIUX 3W87A 4ZXOA 3HBLA 3WBYA 5M17A 4UTTA 3E49A 5LXEA 1IEVA 1J4EA 4EK7A 3BWWA 2NT0A 4ES4A 5HWNA 2VCAA 4MOZA 5BXSA 1W6TA 3WF0A 1QOXA 3GTHA 1CPUA 3RX2A 2YCEA 3IJ9A 5FKYA 2Y88A 1XCXA 1JZ4A 1XKYA 3VX0A 4ZBCA 1NQ6A 1Q6QA 1U1JA 2DH3A 5HQEA 3ITCA 3L4WA 4RE0A 2PGEA 3UJFA 2PRMA 3FX4A 3SO7A 3BSGA 1RJQA 4D6GA 3LMYA 3M0LA 3O8AA 4ZOBA 1FWBC 1XH1A 2WWDA 2YA2A 4A8LA 4IG2A 5SWUA 1T6MA 2IPGA 3YPIA 4I5XA 2F2KA 5M5DA 2VL4A 2OSYA 3N9SA 4E2BA 4HNLA 1CGYA 3HZ3A 3WLQA 2TRSA 3BTNA 1E4MM 3GDLA 3CIWA 2C79A 1HX0A 1DIKA 1GYLA 3E38A 4TXEA 3ZXWA 1P0DA 2ZIDA 1QK0A 3LBCA 2XISA 4F2TA 1VIWA 5I3GA 4MWAA 2JKPA 2V3EA 1YDNA 2R9RA 1TG7A 3DKJA 4V27A 3BW3A 5I3HA 4AIUA 4H6RA 4LWWA 1DJXA 3MWAA 4G8TA 4LTSA 1HN1A 5IFPA 1JUKA 4WIWA 2AL2B 5AZ1A 4W8BA 3E2RA 1SMAA 3GR7A 3EB3A 4I5UA 3LHTA 3LXCA 4JAWA 3V35A 4IP4A 4CQ8A 1E1CB 2ZXBA 4JEQA 1DYSA 4JXCA 1GG0A 2J75A 3L5AA 4HHHA 1H51A 4MPQA 2YCIX 3L68A 1TWDA 4C7DA 3K4AA 4IPPA 4ZE5A 1G94A 2YL6A 4S2BA 4J3ZA 4UQ9A 1UWSA 4FI4A 3H2NA 5J5DA 3PZNA 2XIIA 4HA4A 2J7DA 4RDVA 2ISWA 3WQPA 1F3XA 3P62A 3TQVA 3SQSA 5H1WA 2XVNA 2A79A 3VIFA 1MNZA 3ARXA 1N8IA 3AIBA 3LLFA 3RCNA 2C1HA 2E3ZA 3JS3A 1VLIA 3HIJA 1UA3A 3U57A 2PI6A 1Q6DA 4ROPA 3EPNA 1OG0A 3QQ0A 5HNNA 3OG2A 3WQEA 3P61A 1OX6A 4G7FA 2GQAA 4AEFA 1WQ5A 2YBTA 4Q22A 5A1AA 3KLKA 1I2RA 2P50A 4GUJA 1JCJA 1KFLA 1P4CA 3O06A 4DAIA 3NVTA 1PKLA 2HVOA 2XYLA 2WK2A 3SEPA 4LAOA 1H7RA 1TV5A 2WMFA 4KWVA 4LFYA 1VRXA 2OZ0A 5F2IA 2Y6ZA 4PFHA 3GR4A 2SFPA 1QPRA 2X1RA 3CHDA 1VH7A 3L4ZA 5I06A 4CEXC 4M81A 3PFMA 3T8LA 4HNVA 2YXGA 1BFNA 2HS6A 3EZ4A 3UJRA 1MYRA 4J3UA 3CZJA 1EO5A 1G7UA 1N8WA 2OTDA 1TFVA 4N9EA 3BANA 3BV4A 2W67A 3M9YA 4D6EA 3E3HA 1R2SA 3ABRA 3ONBA 4GNJA 3ZM8A 3NAVA 1OBAA 4ICCX 2REQB 3MBFA 4IWWA 3GK0A 3D47A 1B3OA 4IM4A 1IWBA 3RK8A 1XYBA 3N4AA 1E9LA 2I5IA 3WNLA 4JFUA 3TNOA 1CGVA 2ZUVA 1XQKA 2XJ7A 5AVNA 5M2FX 1KWGA 1DE6A 1UC4A 1V4YA 2QJNA 4YJ5A 4NI3A 4UOQA 1D3CA 1Z48A 1X8FA 4W5UA 4AW7A 2EBNA 3GYCA 5KSWA 1ZGDA 1MXGA 4TTGA 2VC7A 2W61A 3WLOA 3ZT5A 3EWXA 2Y62A 1QI2A 3W7HA 2GGIA 1RD6A 1BXNA 4O0KA 1JEZA 2BFGA 2CHNA 4O16A 1AQMA 2GOKA 1KCZA 1JCNA 3LCHA 1UD6A 4ATWA 3WUEA 5I78A 2ZUWA 4JICA 2BP1A 1M01A 1IEXA 4GXPA 1XIBA 1X38A 1YTKA 4KWOA 4M56A 2A3EA 1TPUA 2P0IA 5CSYA 3QMRA 3TSBA 1UKTA 3WD0A 3H7UA 1QW9A 3ITTA 2D2JA 2JE8A 3GNNA 4BQ4A 3W7OA 3UGRA 5CPQA 2XH4A 5H91A 3W2KA 2R8WA 1W54A 3GDTA 2DZWA 3RRAA 3OQEA 4C6QA 4Z2GA 3OGSA 3N34A 2ZUSA 2WSPA 2PWGA 4REQB 3V16A 4FOJA 4L4LA 3AAMA 4DBWA 4OUIA 4BEQA 3WQDA 4HZ8A 1DXFA 1Q2SA 1GK8A 1SJDA 1BXBA 1XRTA 1OCNA 3G3DA 2PTDA 4L4OA 4JTDA 4GA8A 3ZR4A 1OIFA 3RFAA 1UIPA 3UU0A 1EBGA 4FR6A 2ZXAA 1OABA 3VMNA 2C1IA 3G1FA 1BG9A 1W9XA 1ZAIA 1A4MA 4IIHA 3O05A 3T07A 3EB2A 1O6IA 1MO0A 3NO1A 4H6EA 5DQPA 3SB0A 1JPDX 3CV6A 2VI0A 3TN4A 3EAUA 3NO5A 4L4MA 5FAJA 1GW1A 2J7EA 3GKFA 2ZTKA 3VOJA 3KAOA 2C18A 3UPBA 3ZS4A 2IQTA 4GABA 3SCOA 3W1PA 3II1A 3WUFA 1IZJA 4NU7A 3UGVA 3H22A 4X60A 4DWSB 1BYBA 1JQVA 2YB1A 2CCRA 2GLKA 3IGSA 3W1TA 2YXOA 5LIKX 2O9RA 5D9PA 1UMYA 3E0VA 4HNCA 1KBIA 5F7UA 3L7RA 3M7WA 5HDRA 4W9TA 1EEXA 2OGJA 4IT1A 2ZZ7A 2O9TA 4GBUA 2NQJA 3DFSA 5A69A 3B8UA 3JW7A 6TAAA 4HK5A 2XZ9A 4PUWA 3MDUA 2DEPA 3RDKA 4Q8UA 4CQ9A 4EPDC 3AHTA 1LZOA 4JTUA 1GVOA 2IPJA 3LDVA 1AW2A 4GZJA 1FHLA 1K9TA 4PR4A 4J3SA 3SIZA 4J3VA 1UWUA 2GJNA 2HRWA 3IIXA 3AIVA 3HQOA 3NZ1A 4G7EB 2EPOA 1HGYA 5AZ0A 1K6WA 3IV3A 4L61A 5E0CA 4K8HA 4NNAA 4IH3A 1K9FA 1XCWA 2WOQA 2IQ0A 5IRPA 3LXBA 1TJ2A 3S6OA 2ZZ4A 3AWOA 1SSGA 4YXGA 3PG9A 3KS5A 3OVRA 2UY4A 4JNZA 2OR2A 4B5XA 5CH9A 2WZEA 5CG7A 1QHOA 1TR1A 5LNRA 4KRZA 3B8WA 1QT1A 1OGBA 3EDJA 3UEQA 4D6DA 4GVGA 1GKRA 2HV5A 1XGEA 4KS0A 5FCZA 3NG3A 2O4QA 4YTTA 2DVXA 3T1GA 9RUBA 1RA0A 4GG9A 4YPJA 3UWYA 3AUOA 4GD0A 1LG2A 2ZZ6A 3MKCA 3BAKA 3T55A 1W2PA 1JDAA 1R3YA 1EGMA 4N9DA 3OBKA 5EKYA 3BJFA 3DHPA 5GVJA 3T44A 4W8AA 4ERAA 3UWZA 5K3VA 1GQNA 2VO5A 2PDMA 3H7RA 1E4NA 1PE1A 4UFLA 3STGA 4M1BA 1JD7A 3QW4B 2EXOA 2OQHA 2J9ZA 3P60A 4PMDA 4IIDA 1ZUAX 4Y8EA 2MANA 2QDEA 3QGVA 2QJMA 1FTXA 1VB9A 1V0MA 2ATMA 3NEHA 2CEQA 4A3RA 4P2VA 1HNYA 1IWPA 1LJYA 2VR2A 2NQLA 4FIRA 1W37A 2CLEA 1KCXA 4WY0B 2JEPA 1SO4A 5A2BA 1H3GA 3WH8A 3C2OA 1UKQA 3WELA 3BLEA 1VFFA 3W0KA 3PTMA 2PDWA 1QPOA 3MU7A 3TJXA 3DHFA 1EJRC 3GC4A 1D7KA 3S83A 1XUZA 3W3OA 4HCHA 1LWJA 5BOEA 3JU2A 1TA3B 3GDMA 1VBUA 3PZTA 4H8VA 1DEDA 2YX0A 1B2YA 1JZ5A 1TTJA 1JVNA 3W28A 1FWTA 4GYPC 1LWHA 2OVLA 2YW4A 4HQVA 3W25A 2HVNA 3WQWA 2G5WA 2ZWYA 5FF3A 1ESWA 5K4ZA 1NIUA 1IZCA 3NUKA 4CD8A 3W24A 5REQA 5DMMA 4NL1A 4JZ5A 3CO4A 2QJGA 2ZZ3A 4UOZA 1IF2A 3HPXA 1BF2A 4Y9PA 3QBUA 3FOKA 2ZC1A 1B3VA 1V5XA 1PVNA 1M7JA 4RNIA 1LT8A 4P5UA 2NQ9A 4DO7A 4B5VA 2WSQA 3CM4A 3F1QA 3AFBA 2NXHA 5I09A 1RAKA 3C3UA 2P88A 4C6BA 4DYEA 1KXHA 1FWEC 1W56A 1X1ZA 3GS6A 4K2SA 2NUXA 2HK0A 5D2WA 3H2OA 3VNKA 2A0NA 7TIMA 1JPIA 4ZOCA 3BCFA 3WY1A 3WK1A 3Q58A 1GYNA 2QJIA 5IXEA 3ANVA 1EWDA 1DWHM 4L6HA 3S2NA 2GWGA 2G96A 1UWTA 4XO7A 3H70A 1PIGA 2QW5A 2Z7GA 4MY9A 4JTFA 1TSIA 4O4WA 3MB9A 4N4QA 4LF2A 1XLLA 1CIUA 3ZVIA 1Q6GA 1E1FA 3QV9A 3I4EA 1UOKA 4QISA 4BQ2A 3S8HA 2BHZA 3FNDA 4FZIA 3QM3A 3PBGA 4JTKA 1VHNA 7A3HA 3JUGA 1IXOA 1ML1A 4ACYA 1WDWA 1EHAA 4GKTA 3IK4A 4KIEA 1LDCA 1XLGA 3LTYA 1B57A 4KF1A 2OG9A 1TTPA 4Z2IA 1FCBA 3E02A 3USZA 5HNRA 1TMHA 1R9YA 4FNPA 4FS9A 4FK9A 1AH3A 3OZPA 4A3QA 1PXGA 5HANA 4R33A 1TX2A 2RUSA 5TBOA 3B9NA 1W32A 3W2MA 4DZHA 4NZ1A 3T0CA 4JYDA 2NUWA 4GI6A 4LOCA 1JFXA 3TYUA 1ME9A 2EPLX 4YVPA 2G0WA 1UD3A 1A3WA 4RZBA 4NT0A 1Y5VA 3BICA 3I6EA 3HV9A 2CLKA 4IPJA 3Q37A 2YDAA 1V6VA 3R43A 4IJRA 4N02A 4HA0A 5U7SA 3PG8A 4PUDA 5E1QA 5FF2A 1EDGA 3MV01 1JCYA 3P7YA 3SY8A 2BDQA 4M82A 4XD3A 5HNUA 1XLBA 3MT1A 1FQ0A 3WG6A 3R0DA 3CPUA 2FVLA 3UR7A 4H19A 4YU1A 2BBFA 5AHEA 3LV6A 4AZBA 4XISA 2QIWA 5JUVA 3CUZA 3IUIA 4H6QA 2VUYA 1H7PA 1ZCOA 4IOTA 4PB5A 4AC7C 2W92A 5ABFB 5AHMA 4R7JA 1ZBVA 1XIIA 1IT7A 1K8ZA 2Y2WA 1CXEA 4RDZA 3VAVA 4FSAA 1RVGA 5HUOA 3GZAA 2G3IA 1CENA 1YDVA 2GOUA 1VPYA 5XINA 1AVAA 4GMEA 2IXUA 4OOZA 4F66A 3DERA 4PMNA 5A2CA 3ABZA 1NOFA 4ZO6A 1HUVA 4LGXA 4JKLA 3WF3A 4OUEA 2IQDA 1QMLA 3AU2A 7REQB 4L56A 3VDHA 3WNPA 3P5ZA 3GVRA 3UBPC 4LEQA 3TSMA 1E4LA 4O0QA 1O7AA 1CLVA 1TELA 4Q8QA 2F6KA 1C8VA 3BCJA 5D33A 3APGA 4E38A 4IPNB 2VURA 3O0KA 3N9KA 3AIUA 2BSLA 3UWUA 3OEXA 2PDLA 4DB7A 3V75A 1V3MA 4A35A 1PEZA 3LCFA 2YGYA 4MB4A 3FYYA 1HJWA 3KL5A 3N9RA 5IM51 3Q45A 1J5TA 1U5JA 4GCAA 2G3FA 4IFKA 4UTMA 5HUPA 1E6ZA 3KEHA 2GVEA 1S39A 4GKLA 4OQVA 3TYZA 4MSSA 3UR2A 1KTBA 2Z1KA 4QG8A 1PHWA 1KBBA 2VT0A 3KL3A 4O11A 1YPXA 3DC0A 1GJPA 1GEQA 3UR8A 1R3QA 1XYMA 3AQUA 5FJPA 4P61A 3GD6A 1ONEA 4O0ZA 1UUMA 3GG8A 2CLMA 3G8EA 1A5AA 4XVDA 5D9OA 1KXVA 1RBAA 2EPNA 2EG6A 4HTYA 4CCEA 3CJPA 3D46A 3IJ7A 2WYSA 4NZCA 2W6RA 2E9MA 1GPFA 3ARWA 2VC9A 3CAKA 3BARA 2B7QA 4HU8A 1FA2A 2GGHA 2WJEA 4W89A 3DBNA 3AZSA 2C19A 5EA9A 1EQCA 1JFHA 3A6OA 2HXTA 3BDKA 1N7KA 1MMFA 5HPCA 5LGXA 1JF5A 3GC5A 1ITUA 4RNFA 2HTMA 2RHGA 2DGAA 3CUIA 1HF6A 5U4NA 3LNMA 1TB3A 3BVJA 4HYRA 2BHYA 3SUWA 3RPTA 2QUUA 1OK6A 4N6EA 4N7QA 3CZGA 4MWAD 1IWAA 3EA3A 3AMCA 4GQQA 3I3BA 4XKYA 3ARQA 4TV6A 1Q6CA 3KFTA 5AYYA 4L9YA 2NLIA 4CCDA 3VKBA 2CESA 2VVSA 3TOYA 1NFGA 2WZMA 3C0LA 4QFUA 1KTCA 5PTDA 1ZAJA 4LX4A 5DN1A 1F6PA 2PD9A 2VZUA 3FDKA 2LLEA 1DWAM 5AYXA 4HP5A 3W53A 1D7FA 3V1PA 4NG3A 1HJSA 1OIMA 1W1B1 4RZ4A 2XIJA 1EDTA 1NOWA 1V08A 3IK2A 4UTKA 2BMBA 4GCXA 5I00A 3TXVA 3THQA 1YLVA 5GJMA 3TN5A 1QUMA 2NQZA 1PHQA 1DBTA 4QS6A 1UBPC 3VGDA 1Z42A 2J6VA 4LC8A 5CPOA 3T42A 1ZJIA 1J2WA 1BD0A 1BYAA 4TR9A 4WKFA 2J25A 3A47A 4MB3A 4N9BA 3WLSA 3OHMB 5CAHA 5DFAA 1TTIA 2XFFA 4K38A 4UUIA 1QOPA 3L4TA 1KXTA 3D3AA 4MWAC 3WIJA 4H9MA 5E09A 4Q7IA 3R11A 4GRSA 4DI9A 3PFRA 3RPDA 1CXFA 2W63A 2EPHA 3KHJA 1VQTA 1HVQA 1VFTA 4ATDA 1P0BA 2QCCA 3TTOA 4GACA 2NWSA 4DJEA 5A6BA 4TX6A 3LRMA 5BROA 4O1FA 1DIEA 4PEKA 1A5NC 3ABOA 1XLIA 5CEWA 1W1ZA 4S2CA 3ZWTA 3KRSA 4Q33A 1W5QA 1AL8A 3LXAA 5BU6A 3KWSA 1LTDA 4LS1A 3XISA 3B9AA 4NI8A 3WDRA 3QEZA 4PMXA 3MO7A 3W27A 2WJZA 1JRBA 2QJHA 4Y8FA 4YCPA 1GJUA