3CUJA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylopentaose.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 131
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cujA00
2BY3A 1E71M 3K8KA 4PMXA 3CIVA 3E1F1 4AWEA 3WQ4A 2GJPA 1UR4A 3L4UA 3L2LA 1GOOA 3WD4A 4AD5A 2WMIA 2WXDM 5D9MA 3ZT7A 1ISYA 1KXHA 2VTFA 1G0CA 3EDJA 4MB3A 2BNJA 3NSXA 5CGTA 3BH4A 3WF2A 2BFGA 2J7FA 3F5LA 1BG9A 3SUTA 1GOIA 3NDZA 1FH8A 1JZ3A 4PYSA 2D22A 4M56A 4WIWA 1BLIA 1QNRA 1M03A 3WH7A 1WZMA 3VGDA 4UQBA 4OOZA 4HA3A 4B9YA 2JFEX 1W1YA 4BS0A 3AS0A 4HOWA 3T09A 3BMVA 3K8LA 1O6IA 1MWOA 3GZAA 1WZKA 2VRQA 1F4AA 2OSXA 4AYSA 3HJEA 1HJUA 3A4XA 5CSYA 5HNNA 2B31A 4UR9A 4RE4A 3CUIA 1VB9A 2VX4A 2GJXB 3O6AA 1HKMA 3CH9A 1ZBCA 1J0YA 5D4YA 1HP4A 2V5DA 3BXWA 4N42A 3SCOA 4AC1X 2W4XA 4P8WA 2EO7A 4PN2A 3GXDA 3ARQA 4DWSC 5IFPA 1WO2A 5CPTA 2G3NA 4ATLA 1CGXA 1QNSA 1RPKA 4X0VA 5IDIA 3VVGA 1JZ6A 1OIFA 2DSUA 3PBGA 2GVYA 4D6DA 4CD7A 4EE9A 2DH2A 4AIOA 2GSJA 3G6MA 3W4RA 2X0HA 4JL2A 2AMGA 2OLHA 2QPUA 4PMRA 2Y4SA 4UZSA 4D71A 2J25A 2XJ7A 1PIFA 2XWDA 3UEQA 3WUFA 2YA2A 5FCZA 1TUXA 3VGHA 2VURA 3RCNA 3LPOA 4CD6A 2V5CA 2ZXDA 2D1ZA 3WFLA 1NWTA 1BVZA 3VIOA 1W3JA 2ZUVA 5CJ5A 2UWFA 1KXQA 1BG4A 5BXPA 4KRTA 3ZR6A 3T0DA 4UQ9A 1HIZA 5ABEA 1C7SA 1WDSA 1CEOA 1CXIA 2FH8A 4WK9A 3ZIZA 1GOWA 3ZO9A 4BA0A 3FXYA 1E6XM 1S46A 4HP5A 1GHSA 1H3GA 2FGZA 1UQYA 1W3LA 1Y7VA 1W1VA 1HF6A 4U3AA 1WDRA 3LPGA 2ZUMA 1C92A 2A3BA 2JALA 5JBEA 3AYSA 1V3LA 4Q7NA 2X1IA 4PTXA 3VIPA 3BCFA 3FAXA 4HMDA 3S6TA 4UQCA 2XM1A 4A4AA 1BAGA 4U3CA 5E09A 1VFFA 4BF7A 1E3XA 1UH2A 2WC4A 2UY3A 3VUPA 1LWHA 1WNOA 2E4TA 3CZEA 1SR0A 5FL1A 2WHKA 4W5ZA 2CBUA 2JIEA 3CBWA 2VR5A 4AMCA 3U57A 3VMOA 2X8RA 2Y8VA 1JYNA 1Q6EA 1NOFA 3VD7A 3A6OA 5EB8A 2EBNA 1JG9A 1K9TA 3VPLA 4LYPA 1BQCA 3PZOA 2CIPA 2PWDA 2D2OA 2DGAA 3WFZA 3AHYA 5FIPA 1UD6A 4R27A 2BY1A 3PZNA 3EBVA 3WH9A 1XH2A 2G3IA 1XV8A 5A2AA 1MXGA 2CXGA 2WVVB 5A69A 3AS1A 3GYCA 2WM0A 1CLXA 4CCDA 2EPMX 4JFWA 2WWDA 5GPRA 2WZHA 1TA3B 1XSKA 5CPSA 1TZ7A 5DFAA 4FLRA 4W89A 3A4WA 1HJXA 5I2UA 3PZQA 2VCBA 1E4NA 3PZMA 2J7HA 1TVNA 3AHXA 1E6QM 2C0HA 3ZJ7A 3EDEA 1EDQA 1N82A 4NRSA 3VGFA 3DHUA 3VGBA 4J3XA 4ZXOA 4ACZA 4JAWA 1DHKA 2J78A 1CXEA 3BGAA 3WL0A 3SCPA 3I3EA 1KXVA 3AHVA 1C91A 1FOBA 1UD4A 3SCVA 4QDMA 2BHZA 1WPCA 3GXIA 5DF0A 1E72M 1AQ0A 3B9DA 4NZCA 2WBGA 3ZJ8A 3ALFA 5DO8A 1KGUA 4HZ7A 4JZ5A 1V6WA 4B9ZA 1UWUA 3M6DA 2BVTA 2CERA 1VEMA 4GI9A 1QI0A 2YL9A 4JFSA 4LQ1A 5KEZA 2CHOA 1V6YA 3VO0A 3N12A 4Q22A 4J3TA 2CBIA 4AZ7A 3T08A 4UOZA 2BY0A 2FHFA 3KE0A 4JFVA 1HJQA 1PZ3A 3BSHA 3SCTA 4D6HA 3AMDA 4UFKA 4ZE4A 5E70A 4AZCA 2VQUA 5GNXA 1HKKA 2WWCA 1QNPA 3K8MA 3W53A 2J74A 4QLKA 3THCA 1UOKA 3WDPP 5ABHA 1KWKA 4AZGA 1LQ0A 1GCYA 1GVYA 1UR1A 3GNRA 1H49A 1VFUA 4E2OA 4LYQA 4AIUA 1HNYA 3AIQA 3OLIA 2CBVA 4BQ5A 5A6KA 2D23A 3ARVA 3MMWA 4GZIA 2EEXA 2XVLA 3WDJA 1QI3A 1ITCA 4WSKA 3K4AA 2ZUTA 3THDA 5I3DA 1EO7A 2JIWA 4JFUA 1MW2A 2XPKA 4NRRA 2J7GA 4OBSA 3KEHA 1JDCA 4KH2A 1JNEA 3U7BA 4MNMA 3ARXA 4U33A 4JL1A 3VIKA 2GJRA 4W5UA 1B1YA 2WW5A 4B16A 4PUEA 2WB5A 1GUVA 1OSEA 2QHAA 3I3BA 3NJ3A 1CXLA 4MB4A 2DT1A 1VBUA 4J3VA 2YJQA 4P8UA 4CN4A 1B3XA 1V0LA 4DWSB 1UWQA 2DIEA 5I5RA 5I24A 1CDGA 4PMVA 3VGGA 4YN5A 1E6RA 4GZJA 2WMIB 3RMEA 4CUCA 3SEPA 3UR8A 4OKDA 4WSJA 1C3FA 3W38A 1H4PA 5HXMA 4CU8A 3A47A 1ECEA 1R7AA 2D0FA 2EJ1A 2FHBA 1DP0A 2MANA 3AHTA 3WNPA 4IPLA 2XVPA 2WBKA 1QW9A 1ZL1A 1J0IA 2ZUSA 4V28A 1C90A 2DSKA 2VT0A 1CGUA 1MQPA 4P7RA 5A8OA 1UKOA 4PSRA 3SCNA 1FH9A 1JF6A 5M3WA 3NDYA 1XHGA 1W3KA 2A3EA 2J7EA 2XM2A 2YA1A 2WZEA 1JI1A 2C8NA 3ARWA 3PTMA 5FOOA 2XSAA 3NYDA 3FHQA 5BCAA 3F5KA 3TP4A 3FNDA 1KCKA 1LF1A 5HPCA 2WPGA 5GNZA 2J8GA 5LYRA 3CUHA 2QLYA 4MNLA 1O7AA 3VIFA 1QW8A 1XD0A 3W26A 5GQBA 3IAPA 4AZIA 1FHLA 4GI8A 2J7DA 3ZT5A 2Y2WA 3WMBA 1J0KA 1E43A 2VUYA 4LPCA 1UKSA 3BMWA 3RIKA 4AD0A 2DIJA 1XSIA 3LPPA 4AY1A 1GQIA 2IXUA 2VVNA 3DECA 3MMUA 4ZEPA 3L4XA 4U2YA 2BVDA 2XGBA 4J3WA 1X6LA 4F9DA 1H0GA 3BAJA 4AD2A 4WJXA 1JDAA 4LYRA 5BXRA 1XD1A 4QP0A 3SCQA 5IXEA 4W87A 1B3VA 1G94A 2CKSA 5D8ZA 1XYZA 1E70M 2A3HA 4CN6A 1KR0A 2YDQA 2F2HA 1GZJA 3SUUA 1CTNA 3EMQA 1UZ1A 3PZGA 5A95A 3RM8A 3BAXA 3AIWA 7A3HA 4FLOA 4V27A 4JHZA 3KL5A 5A8NA 1W9UA 3DYOA 1H1NA 2X09A 1MQQA 3UERA 4ATDA 5E6ZA 1R7OA 4C7GA 1VAHA 3VD9A 3CZ8A 5FKYA 3IJ8A 4HPGA 3OA5A 4C7DA 2V3FA 2ZUNA 1NP2A 1ZBKA 4DM2A 4PMNA 3AIBA 2D24A 1J01A 3T0AA 4A3HA 3WIJA 1C7TA 2XFRA 4LXFA 3DHPA 1XC6A 3QOKA 3TTYA 4F66A 1Q6DA 3M46A 3LMYA 2XUCA 4PBGA 3MV01 3UG4A 4L4PA 1W32A 5ABGA 1H5VA 2VZOA 2OWXA 1KB3A 5A6JA 4AZBA 3SUWA 1WZLA 5C8BB 1BPLB 4OOUA 3WQ5A 1QI2A 3CGTA 1MVYA 4J27A 3MMDA 4C7FA 1XCWA 3QGVA 1V03A 4PCTA 4A3YA 4CVWA 1L0PA 4J3SA 4CD4A 4Z2HA 2F8QA 4QLLA 5DT5A 1QVBA 1G01A 3NIYA 1E1EA 4V2XA 3L4ZA 4UZUA 4CD8A 4MB1A 4AZHA 1US2A 4FLQA 3CLWA 4ZFMA 3ZSSA 1NP0A 2XSBA 4TOQA 6CGTA 4MAVA 1X6NA 3IJ9A 3KL3A 3N15A 4ZENA 1M04A 1JYVA 2WMKA 2J62A 4JKMA 3ZT6A 2G8ZA 1H0IA 2GK1B 1DEDA 4H04A 1CGWA 3QR3A 1EDTA 1DTUA 5AY7A 2A3CA 4AIEA 3W6LA 1BFNA 1JZ5A 1HN1A 1EHNA 1WP6A 1EOKA 1HVXA 3CTTA 5I79A 6TAAA 2D3NA 3OGVA 4TTUA 4WKHA 5I0DA 1W9VA 2CESA 3WF1A 4JCLA 3F5JA 3SCSA 3N9KA 2WKLA 3B8SA 1JD7A 3AXIA 1UKPA 1H09A 4AEFA 3MS8A 4ACZB 1VIWA 1UZ4A 1UKQA 1K9FA 4OZOA 2IXVA 1B30A 5HBFA 2ZX6A 4X9YA 4AW7A 2J79A 4MB5A 2GFTA 4W85A 3VNZA 1HXJA 4YHEA 2WVUA 1ZJBA 3WUGA 3WF3A 1KQYA 5A3HA 3N1AA 5JBFA 3O2LA 1TE1A 4BQ3A 2ZWYA 3QHNA 4URIA 3WL1A 1NWRA 3K1DA 3F4VA 1BVNP 4LGXA 5A6LA 1J10A 2FH6A 1PEZA 3CUFA 2Z1SA 3VMNA 2WSKA 5EMYA 3VINA 3OZPA 3SCWA 3AXXA 3U7VA 1NOWA 1LG1A 1PAMA 1K9EA 1B3YA 3QHOA 4B3LA 1IZKA 2XTKA 3AHZA 4LX4A 2YKKA 5E6YA 1GQLA 1Q6FA 3BLKA 1TCMA 1C8YA 2WCAA 4HOXA 4CU6A 4JFTA 1BYBA 5CXPA 3UETA 4AZCB 3AZTA 3D5HA 2WZIA 5M5DA 1XGZA 8A3HA 3MSGA 3AIUA 1JIBA 3VIIA 4PEEA 2XGIA 4M8UA 4GO9A 2NT0A 1AQHA 2VMFA 5EFDA 4OUEA 5BRPA 4B3KA 3T2QA 1J0JA 1I1WA 2CHNA 2PBGA 4CVUA 1MYRA 1V6XA 3SUSA 1BGGA 3OLEA 1J11A 3OLGA 3MUIA 2PWFA 4QCEA 1V0KA 3VD3A 2J75A 2FDMA 3WQVA 1HT6A 1VJZA 3WMCA 2YDRA 1R8LA 2YIHA 2D0HA 3W28A 1QPKA 2X0YA 3AMLA 3WD1A 3W37A 1JXKA 3BAYA 1FFRA 1VJSA 3MANA 4GQQA 2WMJA 3AIVA 2ZIDA 1H2JA 2ZXAA 3PZ9A 4AZ6A 4Z2JA 4CD5A 1J12A 3FY1A 2GK1A 3N17A 1JYXA 1UWSA 2YBUA 3OLDA 5ECUA 3WNOA 2WHMA 3SURA 2VZSA 2WVSA 3MUY1 1GONA 4UNIA 1QOXA 3VD4A 3D3AA 3WNKA 3GM8A 1BYCA 1G9HA 4DUVA 4UTFA 5I23A 3KZSA 3UESA 3WUBA 4W88A 2GUYA 1F4HA 3FAWA 4UQAA 2PWHA 4UFJA 4DUXA 2NW0A 2PI6A 4IPNB 1UUQA 4KGJA 3HN3A 3IAQA 9CGTA 3L2MA 2EXOA 3QHMA 5BYWA 1W3HA 2DSZA 3BLPX 4AD3A 1W1TA 1ISVA 2JF7A 1EIBA 2PF0A 5IHRA 1OD8A 1GQJA 1GHRA 2TAAA 3GBDA 2ZX9A 1V6UA 2YLAA 3CUGA 1V3IA 1BTCA 1B3ZA 3ARTA 2ZX8A 3WF4A 2ZOXA 2DQXA 3OGRA 2OSWA 2NSXA 2VRKA 1RH9A 1P6WA 3SCRA 2WSPA 1EHAA 5AC5A 2ZE0A 1JZ7A 4YPJA 3AISA 3ARSA 1ZBWA 3POHA 2VNCA 4OBRA 1E0VA 4OIFA 1CIUA 4UFHA 5I77A 1IT0A 1TG7A 3VIJA 5A6MA 5ABFA 3IANA 5BROA 3WH6A 5BWFA 1QHZA 1NARA 1CXHA 4S3JA 1CGTA 5CLWA 2V3EA 4CN1A 3CUJA 1C8XA 1QI5A 5C70A 1C93A 3MUAA 1KQZA 2JEPA 2VOTA 1UWRA 2W62A 4F9JA 1LL6A 3VKKA 3N13A 1GW1A 1OGGA 5HPOA 2W66A 2W67A 2QMKA 1US3A 2HISA 2ZXQA 1EA9C 5CGMA 1E6PA 1WZAA 2AOSA 2WVTA 2XHYA 1E6ZA 1VEOA 3MV11 1XRVA 2E40A 4D72A 1UQZA 1VFOA 3PZVA 1EO5A 1UKTA 4EAMA 1OINA 2DT2A 3MU7A 1UH3A 3WQWA 5BXSA 2FHCA 2VX7A 5AC4A 1DWHM 2V3GA 2WNWA 1VRXA 5A8MA 4GXPA 2DT3A 3WDRA 1KWGA 3RM9A 1QBAA 3NUKA 5JIPA 5I78A 1M01A 3G6LA 2V38A 2DT0A 1V3JA 2E9LA 4U2ZA 1XYFA 3W6MA 2RGMA 3FHAA 1AMYA 1TFVA 1ZJAA 1JNDA 3CZJA 4D6IA 1RD6A 1OT2A 5GNYA 3U5UA 5C71A 4W86A 4HA1A 3AJ7A 3I3DA 3VM5A 3OBAA 3EMCA 4XV0A 3NSMA 4B15A 4Z2IA 1UYQA 1J0HA 1NOUA 7TAAA 1KFWA 3PN8A 2CPUA 4MAZA 3DYMA 4UFMA 3HU7A 5IFTA 1MFVA 1ZS2A 1OM0A 5EFFA 3TTQA 5CPQA 2EQDA 1B9ZA 4W8AA 1PIGA 3CHDA 2PWEA 4H8HA 2YBTA 1L8NA 3TTOA 3SCUA 1D2KA 1M53A 3RJXA 4E8CA 3BSGA 2RGLA 3CHEA 1I1XA 3CZGA 4NI3A 3NCOA 2VX5A 3GDBA 1HJSA 3A3HA 4HA4A 4E8DA 4IISA 1VEPA 5M03A 3CMJA 1CBGA 1G5AA 4MTVA 5FD0A 1JFXA 1MQRA 1GJUA 3M7SA 4P8XA 1FP9A 3KL0A 2WAGA 3OIHA 1E6NA 5A6BD 4PTMA 1Q4NX 2OWCA 1E4LA 2J77A 1OBAA 5AYIA 5A6SA 3T2PA 1SMDA 4MNJA 1E0XA 4DWSD 2OYKA 1PX8A 4NSBA 4W84A 3W25A 2X05A 2WLYA 3BAIA 2W63A 1E1FA 1KCLA 1KBKA 2D0GA 3WNLA 3DC0A 4S3KA 2Z1KA 1VFMA 2BHUA 2O9OA 3EDKA 4M29A 3WQ6A 3WY1A 2CBJA 1FFQA 1GQKA 2WANA 1QHPA 2YL5A 2FGLA 4N0RA 4HTYA 2XFFA 2D3LA 3B9AA 4MJ2A 1SFSA 1W9XA 1UD5A 4F8XA 1CGVA 2YDSA 2BXYA 4P7QA 3WBAA 4U31A 4HMEA 3ZJ6A 2VC9A 4MADA 5CLTA 1YHTA 2XG9A 3PTKA 4HU0A 1HVQA 2G3MA 3PZUA 3GH4A 4UQDA 1CNVA 4M80A 4M81A 3L4YA 1Q6GA 4BCEA 5D9NA 4M82A 4TXEA 1JAKA 3OB8A 3GH5A 2CCRA 4MNKA 3WF0A 2G4FA 2OSYA 4QLJA 2XIBA 3GXFA 3W82A 4ZXLA 4H7VA 3VILA 5F7UA 4W7VA 1WDPA 3AFBA 1LWJA 1CZ1A 4W93A 4WLCA 1NWSA 1SYTA 2QMJA 2ZX7A 4TUFA 5A8PA 1H41A 3MO4A 3TOPA 1BGAA 1HKIA 4PUDA 1HKJA 2VX6A 2XIIA 1UR0A 2XVKA 2E9BA 5AYBA 1VBRA 4CU7A 3QOMA 1CXFA 2J4GA 3GXMA 4D1IA 1V02A 2A3AA 2E3ZA 4EANA 1I75A 4RE3A 4M24A 3LPFA 2YLLA 2W91A 4EKJA 5TD4A 1NWUA 1AVAA 3EMZA 1ISZA 4D6FA 2EPOA 4UFIA 1U30A 4PMDA 5IHSA 4FF5A 3BAKA 2VQTA 3J7HA 5CZKA 5HDRA 3OG2A 1VENA 2XVNA 3K4DA 3IJ7A 4H8VA 3WD2A 4HU8A 4Y7EA 5KZ6A 2W5FA 3VIHA 1IZJA 3VD5A 4H2CA 1R86A 3IK2A 2VCAA 1Q6CA 2XVGA 1BHGA 1MFUA 2WLZA 3FN9A 2CNCA 4FK9A 4JHOA 3NSNA 5A2BA 4D6JA 1DWFM 2YL6A 2VRJA 4PMZA 4P8VA 5BXTA 1WCGA 1OD0A 1KBBA 1NQ6A 1R85A 2W61A 4HZ6A 1HX0A 1BYAA 1D3CA 1V3HA 2DDXA 2BY2A 3L4TA 4HZ8A 3PTQA 4JKLA 3WN6A 1QI4A 3PZIA 1E6SM 3UR7A 2IUZA 4PCSA 2EPNA 3A4AA 3N04A 2ZXBA 4RE2A 3ARRA 3U5YA 4GZEA 4J7RA 1GOKA 3MSDA 2BS9A 3CZLA 2CETA 2HVMA 4D6CA 1XCXA 4EK7A 1UR8A 2WCGA 4TTGA 4WF7A 1GOMA 1E9LA 1DWIM 3S2CA 3APGA 1MW0A 1PX4A 1E73M 3WEMA 1V3MA 2OYLA 1EDGA 1GNXA 3RM4A 3GNPA 3WDHA 1HL9A 4AXNA 1XH0A 2ZWZA 1QHOA 4CCEA 4D6EA 3TA9A 1DWGM 1GOQA 3AYRA 3DYPA 1E0WA 1JI2A 1UA3A 2DPEA 3BC9A 4WKFA 1W9PA 1V02E 1MXDA 2BHYA 3AOFA 3SIMA 3WNMA 4H41A 1E3ZA 2O9TA 3B9EA 4AD1A 3W81A 4E4PA 3ZR5A 2JE8A 3W27A 2DH3A 3UG3A 3GH7A 1SMAA 3POCA 3VDHA 3VDAA 5A1AA 2ZUWA 2VJXA 7CGTA 5ABFB 3EDDA 3ARZA 1JZ2A 1GVIA 4IUGA 1JYWA 3MUZ1 4X0NA 1HP5A 4D6GA 1UD8A 3AI0A 5E0CA 4WKAA 1ODZA 4ZE5A 5CSUA 1GORA 4AZ5A 3II1A 3K46A 4AD4A 1OCQA 3VX0A 1BSIA 1J18A 1EQCA 4RL3A 1RP8A 1UR9A 3AZSA 3PZTA 4JCMA 3UCQA 4U5KA 3EDFA 4TVUA 1AQMA 1V6VA 2BXZA 1KR1A 1FA2A 3WKZA 5M17A 2QF8A 1CYGA 3OGSA 3T0BA 1PJ9A 1OB0A 1ODUA 3O9NA 3VOCA 3ZMRA 2AAAA 2WMGA 3RILA 4CCCA 1OGBA 1UD3A 4MDPA 2J7BA 1WE5A 3CZKA 2GJXA 1PZ2A 3VMPA 1PPIA 1HL8A 1EXPA 3BCDA 2CITA 1KGWA 2BVYA 1M7XA 3VNYA 3WH5A 1LLOA 4XB3A 4Z2GA 2VZTA 2QPSA 3AROA 1W91A 3GTNA 2J7CA 3WBEA 5A6AA 3VIMA 1B2YA 1E40A 5CQ1A 4KMQA 1B31A 1WKYA 2W92A 2BV9A 3AMCA 4NF7A 3VX1A 2Q8XA 4OJYA 1ITXA 4P7OA 1J9YA 2WMHA 3T2OA 2UY5A 3CO4A 2YA0A 5CG0A 1HJWA 2WHJA 1TMQA 1E5NA 3ZQ9A 3ZM8A 1BYDA 4PMQA 4Z2KA 4TX8A 1EGZA 1UG6A 1E56A 1PX3A 3ALGA 4J3UA 3W0KA 3SUVA 4BQ2A 4HPHA 4PTVA 1ISXA 2O92A 3WELA 5JUVA 1JXJA 1B0IA 2O9PA 1JF5A 3W24A 1UWTA 2PWGA 1D7FA 2JEQA 1RP9A 2WCSA 2G3JA 5I6SA 2JF6A 3WMSA 3CPUA 4BZYA 1PBGA 3AICA 1QNQA 1JDDA 1KGXA 2YOCA 3ECQA 4YHGA 5DEZA 1MW1A 1WB0A 3WEOA 2Y8KA 2ZX5A 1LL7A 2CYGA 1UA7A 3HMCA 4QAWA 4DUWA 3GBEA 1MW3A 4M1RA 1JAEA 1OGSA 4HOZA 3VIGA 1G1YA 4FLSA 3RDKA 1VF8A 3WSUA 1GJWA 1GPFA 2OWWA 3RJYA 2PC8A 2ZUUA 5D9PA 1JFHA 3WD3A 4QCFA 3OZOA 2F61A 2ZICA 1JD9A 4UCFA 5LA0A 4P7NA 1C8QA 4AISA 4D1JA 3RO8A 1BF2A 1W1PA 1UWIA 5E9AA 4U5IA 3CMGA 4PRWA 5D8WA 1EH9A 2CKRA 4UOJA 4PMOA 3VGEA 4GIAA 2WC7A 3TTSA 3RPMA 1YQ2A 3WUEA 4CGTA 1CLVA 2VI0A 2NT1A 2E0PA 3MKKA 5E0FA 1UD2A 3EYPA 5DMYA 1NM9A 1CXKA 5LA2A 4JIEA 4Z2LA 2XFYA 2VL4A 3ARYA 1EQPA 5DT7A 2VVSA 1CPUA 1UR2A 4DM1A 1CWYA 2XYLA 3WDIA 2WVVA 1TVPA 2VO5A 1V3KA 4MDOA 5LA1A 2PBOA 1JL8A 4UOQA 2DEPA 1CGYA 1K6AA 5HOSA 1TA3A 1ZB5A 4CKQA 2VZVA 1LG2A 1CECA 5A8QA 4KRUA 4IM4A 1TR1A 2WKGA 4TVDA 3PHAA 2D20A 2Y5EA 4JKKA 3WEZA 2VR4A 2WC3A 1X1NA 1HJVA 4UFLA 4ACYA 5JIWA 3AZRA 4GI6A 5FL0A 3FW6A 6A3HA 3ARPA 4XX6A 4L4OA 1E5JA 1JZ8A 1E55A 2GDUA 3GNOA 3WD0A 4P7LA 3KWXA 5BRQA 2GDVA 5A94A 3TONA 3L4WA 3AS3A 4W7WA 3AMKA 3ZOAA 1OT1A 1EOMA 3N18A 2CEQA 3W29A 2E8YA 2QV4A 4K68A 2YL8A 4AEEA 1R87A 1J0ZA 3ARUA 3VTRA 1ESWA 2X2YA 4PMYA 1W2VA 2UY4A 8CGTA 1LL4A 1U33A 2WMFA 3AIRA 3WH8A 4TX6A 4KGLA 4GKLA 3AXHA 4F79A 1E4IA 3VM7A 1QNOA 4BQ4A 1XSJA 5JBDA 2WHLA 4GPNA 4PTWA 1CENA 1KXTA 3WNNA 4GO8A 4XUYA 3VDBA 3AIEA 1Z32X 1FH7A 1UH4A 2C7FA 2J8FA 1V0NA 4FMVA 3ZSTA 4GQRA 1H11A 5D9OA 2VCCA 2UY2A 3VDCA 2WYSA 1NH6A 2G41A 4PMUA 1JGIA 1FHDA 1OWQA 3AMGA 1V0MA 1U2YA 2OYMA 1UHVA 1K9DA 5EBAA 1A47A 2DSWA 4R5EA 3N11A 3UG5A 4MJ4A 2O9RA 1DWAM 4HMCA 1B90A 4J28A 5A2CA 4GINA 1B3WA 4UQEA 4PSPA 3WDQA 3JUGA 3VU2A 3BAWA 3ZJKA 1IV8A 4H8UA 3AQUA 3CHCA 4ATWA 1QBBA 2E9MA 4XZWA 1DWJM 1V08A 1FP8A 4QFUA 4KWUA 1JZ4A 2VZUA 3AS2A 4XZBA 1WDQA 2EPLX 1OIMA 1E4MM 4MPKA 2DSVA 2V3DA 1W9BM 3L4VA 1ZBVA 4TVCA 1A3HA 2E8ZA 1W9DM 2Y24A 4W7UA 3WQ8A 4W8LA 1E15A 3CHFA 2EPKX 4ML4A 2ESCA 3WENA 2J47A 1W2PA 2WK2A 3M07A 5A6BA 1WAWA 1LJYA 1ISWA 4W8BA 2PB1A 1XH1A 1ZU8A 4DWSA 2XWEA
chains in the Genus database with same CATH superfamily
2ZZ1A 1EJ7L 1L8PA 3GXTA 3E1F1 3GD6A 1J8VA 1LRNA 1UR4A 1XLIA 4I3GA 3GG0A 3UXAA 3CV2A 1UBPC 5FAJA 2BNJA 2BFGA 2J7FA 3NDZA 3WYZA 3EB2A 3HFTA 4M56A 4R7OA 3DN5A 1QNRA 2DZVA 3WJSA 1M03A 4QISA 1TWZA 1U5HA 3P93A 3LMZA 4NL1A 4ZQCA 2X2GA 1XDLA 1P4CA 2VENA 4N6EA 4HA3A 1AODA 4NJJA 3A22A 2KZHA 2E5BA 2JFEX 4F0HA 2CZFA 4B90A 1MWOA 3GZAA 4IPIA 1F4AA 2IKIA 1HJUA 4E4FA 5HNNA 3IRDA 2B31A 3CUIA 2VX4A 3VKJA 3RYSA 1R2RA 3IACA 2GGHA 4KKXA 1HKMA 1KFBA 3CH9A 2Z6JA 1FCQA 1FDJA 3CO8A 3T4WA 2FTWA 3WCZA 4IJBA 1HP4A 4OWGA 4XD6A 3BXWA 2BASA 3NVDA 3OOQA 4IX2A 4B3ZA 3SCOA 4AC1X 4C6KA 4IIFA 2PZ0A 4H9MA 1QPNA 2EO7A 4PN2A 3UWVA 4XKYB 3ARQA 2PGRA 2P8BA 2G97A 5FA5A 5C2GA 3NPVA 4DWSC 5IFPA 1AK5A 3BL3A 1EC7A 1QNSA 3EX2A 5IDIA 1JZ6A 4ZMGA 1E9ZB 2GVYA 2L5HA 4C60A 3FVDA 3W4RA 3R10A 2OLHA 4PMRA 2OQHA 4D71A 3PPHA 3R8GA 2XJ7A 4ONVA 5HJXA 3CV1A 1ONRA 3UEQA 5FCZA 3NQ7A 2YW4A 3F7JA 2OT1A 1ZCCA 4HTBA 4R9XA 1G67A 4AWTA 4PFHA 3CPGA 1BVZA 2ZUVA 3NO3A 1UC5A 5MF5A 3FKRA 3T0DA 4KCUA 1LM1A 4HA0A 2DVXA 2OX4A 2FH8A 3F4CA 4BA0A 1E6XM 1F3XA 3UWZA 1GHSA 4S2BA 2FGZA 1W3LA 1LYXA 2A3BA 2JALA 2ZZ7A 1QCWA 1RCOB 2X1IA 3NQFA 1P0NA 4AVOA 3WLRA 4MYAA 1IR2A 4WJEA 4B5XA 3OG3A 4DBEA 4DZAA 4U3CA 4S3CA 4G7FA 4US6A 1VFFA 2W79A 1GOXA 3NR0A 2E4TA 1UB3A 3NL5A 3TX9A 3MHFA 5CPOA 2H9AB 2JIEA 3CBWA 2RDUA 3U57A 2X8RA 5EB8A 4LYPA 2CIPA 3BLLA 3BSMA 2DGAA 1Q66A 3RUBL 1UD6A 4R27A 1XG4A 2P1FA 3CUZA 3WH9A 1IGSA 1XH2A 2X30A 1EX1A 3DERA 3N25A 3GW3A 3UJFA 3IGHX 1P0EA 3BV4A 2WZHA 2V6AA 4A6GA 5JH1A 1TZ7A 5FACA 1X38A 5EBUA 2GQ8A 3PZQA 3ITLA 1E4NA 3RGTA 3MC5A 3PZMA 3TYZA 3G5EA 3EWCA 2HCVA 2W9MA 1DHKA 3BGAA 1KXVA 4EF8A 2BHZA 1SPQA 1ML1A 2GVEA 1IEVA 3B9DA 3GHSA 3SRDA 4DXKA 2X1RA 3KBMA 5DO8A 3DEQA 1HGWA 4GVFA 4DZ5A 2CERA 1VEMA 3G0XA 3A4JA 2YL9A 1XIFA 4UTUA 4HCHA 1XLLA 4JFSA 2CHOA 1V6YA 3VO0A 3TROA 2BGQA 4Q22A 2WNNA 4J3TA 1VYRA 2SFPA 2QUUA 4NZFA 4UOZA 2BY0A 3KE0A 1HJQA 3GAYA 3Q45A 3RAOA 4NYUA 1TPEA 4J2PA 3AXMA 3S3GA 2O4MA 3RN6A 3K8MA 3HQOA 2J74A 4FXSA 4QLKA 1KWKA 4UTWA 4H19A 3S1VA 5C9ZA 3UZXA 3H8AA 1H49A 4AIUA 1HNYA 4Y6GA 1P1XA 4BQ5A 3ARVA 4GZIA 3DFTA 2XVLA 1KM2A 3WDJA 1KFKA 1QI3A 3ABQA 4K1WA 3K4AA 2ZUTA 1PTAA 3KM8A 5G5IA 4POCA 2F6KA 2WQPA 4NRRA 2GYIA 2J7GA 4AUBA 2CZEA 5H6HA 4ENLA 1J2BA 3FGCB 3IRSA 3R11A 4W5UA 2WW5A 3LCGA 4UTJA 3FV9A 3G1XA 4G7EA 4P2VA 2OKOA 3I3BA 1HQTA 4ERGA 2PRLA 1CXLA 5LXXA 4P8UA 3PUEA 1F6KA 2Z24A 1B4EA 4NP7A 2PF8A 2DIEA 2Z1BA 3PPGA 5I5RA 3C2EA 4PMVA 3WG6A 2VWTA 1FHVA 3OQ8A 3WK0A 1M1BA 3WK3A 3TR9A 2C1HA 3PJUA 3SEPA 3BMXA 3M0YA 4L1GA 1H4PA 4UTWC 2VDHA 2QIWA 3RCMA 3TQ0A 4NZ1A 3WLTA 3A24A 5D05A 3TYCA 2PWVA 1MRQA 7REQA 4NASA 3CB3A 1ECEA 2FHBA 2HXTA 1QW9A 5D33A 1OG0A 1M5WA 4TU1A 3UWEA 3R12A 1J0IA 3IIZA 2DSKA 1UMYA 3TSBA 1P0BA 3LCFA 4IP7A 2CLLA 2G0WA 2P3ZA 2Z2BA 4PSRA 3NOEA 4Q8QA 2FMOA 2G50A 1XHGA 2ZADA 2XM2A 2WZEA 1GGOA 2ALDA 5J8LA 3ARWA 3B8IA 3PTMA 4EXQA 1OFDA 1EWEA 4HU4A 1MXSA 1QO5A 3KCLA 5BCAA 3NYDA 1OFPA 3R0UA 3FNDA 3V5CA 4QE4A 3L7RA 2J8GA 1W1ZA 5LYRA 3CUHA 2QLYA 4MNLA 4AZIA 4KWSA 3TXVA 3GR7A 3ZT5A 2V2HA 3WMBA 4LPCA 1E43A 1YTEA 3QY6A 3BMWA 1R3RA 2DIJA 4GA8A 2IKJA 1XSIA 4AY1A 3GVVA 1GQIA 2VVNA 1A5LC 5LGXA 4ZEPA 3L4XA 5D03A 3HJZA 4AD2A 1IEXA 4LFYA 3IV8A 2CKSA 1IXPA 4C6FA 1A49A 1EJSC 1KR0A 2F2HA 1ZZMA 5KZDA 1PDZA 1CTNA 3QYSA 3PFMA 1AH3A 1UZ1A 5A95A 1X39A 1NY1A 1LOSA 3KBSA 4ZQPA 3AIWA 1ZUAX 2YCIX 4Q4OA 3IJIA 3DYOA 1MQQA 4ATDA 1K8ZA 4H3DA 4X2PA 3DCPA 5FKYA 5DY2A 5G4WA 1FWAC 4HPGA 4B2DA 3I4EA 1GPWA 3GZ3A 1S5VA 3H70A 1KTCA 3ZVHA 4LUSA 3DAQA 1OCBA 1C7TA 3O0FA 4S2CA 3TTYA 4GNKB 7ODCA 1Q6DA 2QAFA 3MV01 4Q7IA 4RPQA 4QG6A 1K70A 1O1HA 2OWXA 3T9PA 5A6JA 1XCFA 4AZBA 3SUWA 4B5VA 2ACRA 1PDYA 3CGTA 2NWSA 2POTA 1FHUA 2OJPA 4J27A 3EX4A 1V03A 2P76A 4CVWA 1L0PA 1VIZA 4CD4A 4Z2HA 4JBRA 1P0KA 1QVBA 4CQ9A 2P0OA 4UR7A 2BG5A 1AL7A 4V2XA 3GUGA 3H2MA 2GQ9A 3LQGA 2O4QA 3VOJA 4N02A 1EC8A 2JK2A 3SB0A 3MP3A 4LALA 4LUTA 3STCA 1M04A 1AG1O 4L56A 1H0IA 5AYXA 1DEDA 3QR3A 2A3CA 4JQAA 4QIUA 3IGUA 4ZOEA 5LNSA 1JZ5A 3GNXA 3JU2A 3NGFA 3D46A 1EHNA 4S38A 3HBLA 1HVXA 5H8MA 4TQTA 3F5JA 2WKLA 1F61A 5J5DA 5D2VA 3LRLA 1UKPA 2F7FA 1UKQA 3T81A 1XWYA 4LUJA 1A0DA 4FNTA 4LC6A 4C6NA 4GY0A 1YBQA 4QBXA 4MB5A 2GFTA 3CWOX 3D0CA 4ML9A 4W85A 1HXJA 2GWGA 3WF3A 5A3HA 1TJRA 3O2LA 2ZWYA 4LS0A 1Y5XA 4URIA 3WL1A 2NV2A 1NWRA 3UBPC 1BVNP 4A8IA 3ZYZA 4EPEC 2Z1SA 4BI5A 4IXHA 3VMNA 3M0LA 2FKPA 2QCDA 5EMMA 3LCXA 3QKEA 3U7VA 1X96A 1K9EA 2F2KA 2XTKA 3DGBA 3GHUA 4LX4A 1Q6FA 3TA6A 4O52A 4EPBC 3T8LA 3EB3A 3CHVA 1OC7A 3UETA 3BG5A 3EWUA 1Q6LA 4CNUA 1MDRA 4CQ8A 1XGZA 1UUOA 5I09A 8A3HA 4N4QA 3LCHA 4A8NA 2C3ZA 4LU0A 1GTEA 4HK6A 2NT0A 2NXHA 2NV1A 4OUEA 3T4CA 1KBLA 3BW2A 4IQJA 4B3KA 5I3KA 2YXOA 1J0JA 1I1WA 3VE7A 4CVUA 1MYRA 4PUWA 4EPKA 4QCEA 1PTDA 2TODA 2XZ9A 2YDRA 2YIHA 2D0HA 1QPKA 3GR4A 2X0YA 3P80A 3DXIA 2PDHA 4I7VA 1JXKA 3BAYA 3TC3A 6TIMA 1VJSA 2WMJA 1CX9A 3HGOA 3W1QA 3AIVA 1H2JA 3MBDA 4QR6A 2V9DA 3OW1A 1E9YB 1J12A 3FY1A 2GK1A 3N17A 2YBUA 4TV6A 3OLDA 1JCTA 3NFUA 3Q65A 2WHMA 3SURA 2VZSA 2WM1A 3LDVA 1RJPA 3T44A 1Y65A 2IQTA 4TX9A 5CH9A 3VD4A 1IF2A 3D3AA 2GVGA 3GM8A 1YDYA 3R58A 1MZRA 3P8IA 3UESA 3WUBA 5DCEA 4UQAA 5REQA 4UFJA 4M19A 3T8QA 4O17A 3PWIA 2A0NA 2E1WA 4KGJA 1YXDA 1FBAA 3HN3A 4JTIA 1KBJA 3FX4A 4IPPA 5BYWA 3P2VA 4JGDA 3M0JA 2QYGA 2VM8A 2FPYA 3N14A 1ISVA 3UR2A 4QX4A 1KKOA 1XLKA 4YL2A 4JQ2A 1I2NA 3C2VA 2PTZA 1GHRA 2YBVA 1RK5A 1XQKA 2YLAA 3NNTA 1BTCA 1KO0A 1VD6A 2R1PA 3QH2A 3EZ4A 4X61A 3VC5A 3ARTA 1EP3A 2ZX8A 4D2JA 4A22A 5D2XA 2DQXA 4GE8A 2IQ0A 5FF4A 3PUDA 4NXKA 3TSMA 2WJEA 1AL8A 4HNVA 5LHFA 3TU9A 1TE6A 4WQ6A 4OBRA 3FA4A 1S1PA 3DKLA 4WJ8A 1RA5A 3NM1A 4LS2A 1B5TA 5A6MA 5ABFA 4LY4A 3UY8A 1T7LA 1QHZA 1CXHA 3LSBA 2OEJA 1MRAA 3RLHA 4JPGA 2BP1A 2E6YA 2V3EA 1C8XA 1JRBA 4CLMA 4X3ZA 3UXDA 1KQZA 1UWRA 3HG3A 2DQWA 3VKKA 3M0ZA 1OGGA 2R1LA 2QMKA 6REQB 1FCUA 1NDZA 1WZAA 2WVTA 5GJNA 1E6ZA 2Y88A 1VEOA 1XRVA 2E40A 3S5NA 4F0RA 3PZVA 1UKTA 1OINA 4J35A 3MU7A 4LUIA 2I9UA 2NX3A 4D9PA 2FHCA 4ICNA 2WSQA 3NVTA 3FSTA 1DWHM 4IUOA 4GXPA 4ZQRA 2PP3A 1Z44A 4DJDD 3NUKA 3DHDA 5I78A 3I7QA 1M01A 4H6QA 3TAKA 2E9LA 3C56A 1OF8A 1AMYA 3UPWA 5DMLA 2ON3A 1ZJAA 2EG6A 3W7OA 5FJOA 1JNDA 4D6IA 5CPLA 3U5UA 2Y70A 1OG6A 4HA1A 2GWNA 3VM5A 1DQXA 3N29A 5KITA 1UYQA 5M1TA 3PN8A 3H23A 4MAZA 4UFMA 1W17A 5HANA 5IFTA 1OM0A 3WBXA 3UZZA 1HKVA 2NXGA 2CLEA 4Y2WA 2ANUA 1HFBA 4G5DA 2PDIA 3CHDA 3DX5A 2YZ5A 1PZ1A 3PBMA 4IFOA 4WEVX 1H61A 4J1OA 3NZPA 4GKTA 3SAZA 2AL1A 1OYBA 1J93A 1E1CB 5D04C 5CEWA 1J5SA 3CZGA 3TTEA 4FX7A 3GDBA 2QUTA 4E8DA 4IISA 5M03A 3VXGA 3CMJA 4GYPA 1ZJIA 2Y0FA 4RK8A 4DELA 2HTMA 4Q8OA 3UCDA 4P8XA 2WAGA 3SN1A 1E6NA 5K9XA 4IIBA 1Q4NX 1E4LA 2J77A 2J66A 3IWPA 1SMDA 4MNJA 3PPFA 3QV8A 2DUAA 1S39A 1W5PA 4JDBA 1PX8A 4NSBA 3KRBA 3AAMA 3W25A 5D32A 2YSWA 4KFNA 2XIQA 2PCQA 3BAIA 1E1FA 1KCLA 3ITOA 2Z1KA 1VFMA 1WAUA 3LCIA 4MOZA 3WY1A 1ADSA 1W5OA 4NG3A 1QRQA 2D3LA 4OFCA 1QO2A 1YNPA 2E67A 4MJ2A 1W9XA 4HQVA 2J9ZA 2YDSA 3OZYA 4P7QA 2FJKA 1Z7AA 3WBAA 1S5NA 3ES8A 3JZUA 3ZJ6A 3N19B 4I5XA 1OY0A 1R3VA 1CNVA 3OO2A 4M80A 2QULA 1PIIA 3EEZA 1Q6GA 3S8HA 1JULA 1ALDA 5D9NA 5DX7A 1XUZA 4WSHA 3NZRA 3TEVA 3GIYA 4TXEA 4FNUA 4HVXA 2CCRA 3WF0A 2OSYA 1MUCA 3GXFA 3VILA 2ZCGA 2DZUA 3AFBA 3E3HA 5B80A 1LWJA 2NSOA 3PNUA 4W93A 3KVMA 2QMJA 4DBSA 1IXQA 2YCLA 2ZX7A 5A8PA 4UNLA 1H41A 3OYXA 3TOPA 3MWCA 4QS6A 1HKIA 2Y7GA 1GKPA 2RDWA 3A9BA 1UR0A 1IEIA 4NY2A 4LVGA 3ZLFA 3QOMA 1CXFA 3LOTA 2J4GA 4JTRA 3ZLHA 4DO5A 3QW3A 3LS9A 2A3AA 3TFXA 4L61A 4RE3A 3R25A 1PE1A 2W91A 1X97A 1AVAA 3GRIA 1VYPX 2PP0A 3GFZA 2YCKX 2YYUA 2GQAA 3GHRA 5HUPA 3VDGA 4UFIA 4DZIA 5IHSA 4PMDA 5DBUA 1C8VA 3TQPA 3BAKA 4G1NA 4ICMA 4TIMA 4HHHA 4B5SA 4A3RA 1H5YA 3IVTA 1L6YA 2C1IA 2Z27A 4CNTA 4HU8A 3N2BA 3GDTA 1DV7A 4US5D 2PAJA 4Y7EA 4FP1A 4LY8A 4GBDA 3TN5A 2Z25A 1WXZA 1IZJA 2W0UA 5I06A 4FOKA 2F6XA 3M5VA 4QJ1A 1MFUA 1QPQA 2WQDA 1AW1A 3NSNA 5A2BA 1W54A 4D6JA 2GGIA 2YL6A 4QNWA 4M6UA 1K02A 1FX6A 5F1VA 1AZ1A 2ZDSA 1TZ9A 1EKOA 2DDXA 3NL6A 2D2GA 4GNVA 5C2CA 2BY2A 5AZ1A 4L9ZA 4JKLA 3TN3A 4WCJA 3KHJA 4DF2A 3I7SA 4IX0A 3CK5A 1A50A 4IPJA 2IUZA 4PCSA 3A4AA 1QT1A 1LT8A 3I7RA 4JXCA 2FFIA 2DJXA 1TV7A 1F3EA 1GOKA 3DU0A 3MSDA 4WDXA 1WOBA 1XCXA 1UR8A 3S9YA 4UMAA 4TTGA 1XYLA 1GOMA 3GC4A 1E73M 3H54A 2INZA 3VE9A 3CT2A 2OYLA 3RM4A 3TR2A 1FWGC 1HL9A 4AXNA 3T1GA 2ZWZA 4ZB5A 4JNYA 2QQ6A 1DWGM 2XH4A 1TWDA 3WJXA 2OKTA 3ME3A 1DQUA 4O10A 2BHYA 2PE4A 4DEFA 1G69A 4ZO8A 3W81A 1UCWA 4AF0A 5I3GA 2JE8A 3W27A 3UG3A 3GH7A 1SMAA 3VDHA 5C6MA 1EXBA 1JCLA 5CSRA 1TRIA 1W8GA 1MSSA 3WLPA 1HP5A 3P7YA 1UD8A 1ZCOA 3AI0A 4DF0A 1VLIA 3QR1A 4WY0B 3CPRA 3MMTA 4AX6A 2P5NA 4ZQMA 3B04A 3II1A 1US0A 1XLFA 3LSCA 2C1GA 4LW7A 4FA3A 1IGWA 4QE1A 2WJZA 1GKQA 4JTJA 3FEQA 4PODA 4NZJA 1DXFA 1EUNA 5DCDA 4UMBA 3ZLGA 3DOPA 4AIBA 3E6EA 4C1NA 3C2RA 2RJHA 2DZWA 4AU0A 1XM3A 5E0KA 4DJEA 2OGYA 4RZ6A 1OGBA 1UD3A 2ZTJA 3I10A 4MDPA 1WE5A 5EGRA 4ZVJA 1YPXA 3RLVA 2GJXA 4FALA 4HNUA 5CPMA 3UP8A 5CZJA 3VNYA 3WH5A 1LLOA 1PS9A 4ZOCA 4PFMA 3URNA 5FEPA 1EEXA 4Q6JA 3VNMA 3RLGA 3P74A 2J7CA 3VNJA 4DHGA 4RZ4A 1J4EA 5I00A 1XJBA 4KMQA 3HM7A 3PBUA 1B31A 4D8ZA 4PCPA 4NF7A 4OJYA 3PM6A 3G1VA 3VI2A 1ITXA 1XIMA 4REQA 4P7OA 1J9YA 2Y6ZA 1IEQA 1ICQA 2BOFX 2X1TA 2DP3A 4HB7A 3IJLA 2OB3A 2QCFA 4BY3A 3MBFA 1I2QA 1UG6A 1JCJA 4BQ2A 1J6PA 2HQAA 2O7QA 3PB2A 4PTVA 2O0TA 4GD0A 3W2KA 3WELA 4MG4A 3U2OA 2PLKA 3G1FA 2JEQA 1RP9A 4MZ8A 3BLDA 2G3JA 2JF6A 3WMSA 4HNNA 3NA8A 3TJIA 3AICA 4A8LA 3CEPA 4YHGA 1MW1A 1WB0A 3WEOA 5IBXC 4HCLA 3FDKA 1H7NA 4DUWA 4X60A 4DJEC 3WK2A 2FIQA 3LGGA 2PS2A 2E5CA 3VIGA 2A85A 3CQKA 4R85A 3RDKA 8XIAA 1VF8A 3W2MA 3WSUA 1D3GA 1FWCC 1G4SA 3RX2A 4DLFA 3HV8A 4DX3A 4X2RA 3HOJA 1JD9A 1XYCA 2REQB 3M5ZA 4I6KA 3VK5A 3AO0A 2CFFA 3NQ6A 3RO8A 3QY8A 4Z1BA 3CMGA 3W75A 1KM3A 5C55A 5D09A 5LIXX 4O57A 4JICA 4IIEA 2XH0A 3E2VA 2B0MA 3QZEA 3IIVA 3WUEA 4GXMA 1XISA 3G24A 1TPH1 2Z29A 3EYPA 3M0MA 1CXKA 2NV9A 4JIEA 3OJGA 4Q8WA 3NXFA 4P5UA 1JQXA 3QMSA 1EQPA 1EIXA 3KRUA 3L0KA 2Z0IA 3TCSA 2WVVA 3A13A 2PBOA 1JL8A 2F84A 1CGYA 1K6AA 2PU1A 4QM1A 1ZB5A 2VZVA 5A8QA 1CECA 2WKGA 3HA1A 2VR4A 5HNRA 4GI6A 2GOKA 1EBHA 5AHEA 4I5RA 3FW6A 4IG2B 4DI8A 3R4IA 3VAVA 4XX6A 4L4OA 1E5JA 3XISA 4AC7C 3EAUA 1E55A 1JPHA 3GNOA 3WD0A 1HTIA 2PDUA 4P7LA 3KWXA 5BRQA 5A94A 3TONA 4RNFA 1NDWA 1IT8A 4E2BA 2CEQA 3W29A 4AQLA 2QV4A 3EX1A 3V1HA 2DVUA 4AEEA 3BVJA 7XIMA 3GS6A 1PVNA 3VTRA 1ZPTA 2BTMA 2QCNA 3KBJA 1NFPA 2PCEA 4XAGA 1SZFA 4HYWA 3RXZA 4KGLA 3C2FA 3AXHA 3MW7A 4ES4A 1O60A 1XSJA 2WHLA 4PTWA 1UC4A 4JQ3A 1A53A 5C9UA 4B92A 2ISWA 3AIEA 2VGIA 1Z32X 3M0IA 1G6CA 2C7FA 1V0NA 1LUCB 1IIHA 1F8MA 3MP4A 1K7FA 2VCCA 3VDCA 3DESA 1FHDA 3AMGA 3FYPA 4XTIA 2OYMA 3VYLA 4Z1DA 3M0HA 1K9DA 3BQ5A 4JYFA 5HR6A 3M47A 5FJTA 4J28A 4HN4A 1OFAA 4DO6A 3B0UX 3L12A 4UQEA 1RUSA 3QC0A 4UXDA 3AQUA 3CHCA 2BXVA 1QBBA 2E9MA 2QGYA 2Y7DA 3PAJA 4RNIA 5H2ZA 3O6DA 4KWUA 2NQZA 2VZUA 1WDQA 2EPLX 1X6UA 2DSVA 3TWAA 1ZBVA 3LRMA 3W23A 2E7FA 4UTHA 1XDJA 4GABA 3HPSA 1W9DM 2LLEA 3ANYA 1HO1A 4LCQA 3WLLA 3QF0A 1TX2A 5K7JA 1GW9A 1LRQA 1WAWA 3Q94A 4KFPA 1U22A 1XRTA 2PRHA 2XH7A 3HPZA 1T99A 2Q8ZA 3W7NA 3NEVA 2TRSA 3CIVA 4NAFB 3WQ4A 1R46A 3L2LA 1GOOA 4AD5A 2WMIA 5D9MA 1L6GA 1KXHA 3UT0A 1G0CA 3EDJA 3NSXA 5CGTA 2WJDA 1RBAA 3C3NA 3SN4A 1L2UA 1PKNA 2B7NA 3E2QA 2WPBA 1FH8A 4MWAB 1BXNA 1JZ3A 5TF0A 5HATA 2D22A 4B5WA 3ZS4A 4WIWA 2Z2AA 5HMEA 1Q6QA 4KCTA 1U5JA 3D6NA 2ZTKA 1ZALA 4IOTA 3UD6A 3B06A 1TV8A 4IMCA 3MI3A 4BS0A 3AS0A 4PR4A 3T78A 1O6IA 2F9RA 1ME8A 4IMEA 2Q8LA 1WZKA 2VRQA 4AYSA 1Z6KA 4K37A 3HJEA 1SM9A 4IMFA 4UR9A 4RE4A 1VB9A 1QPOA 2VEMA 1P5BA 5BOEA 1OVDA 4JIQA 2OEMA 5HWMA 1DIKA 1L2QA 4O50A 1J0YA 5D4YA 3QSTA 4MF4A 3D47A 4LVDA 1QUMA 4N42A 3E74A 4P8WA 5EMKA 4O11A 1UBSA 2QJGA 3RCYA 3GXDA 3IEBA 2P10A 4MUZA 4Z1YA 2HBVA 1XKJA 2Y63A 4X22A 3M43A 3SZ8A 3C0QA 2DSUA 3IJDA 3PBGA 4XD4A 4D6DA 3S5ZA 1HUVA 2X0HA 4JL2A 4Q8VA 1FWWA 3EOSA 5FF3A 2J25A 4Y90A 3W1LA 3KWSA 1P6BA 2YA2A 3VGHA 1I0DA 1B9BA 5AC8A 1TELA 2V5CA 4XUGA 1P7TB 1KXQA 1ZNNA 1OQFA 2QZRA 2Z1VA 2FQIA 1HIZA 4WUIA 4MM1A 1I8JA 2Y89A 1GOWA 3ZO9A 6PTDA 3FXYA 3ONCA 1S46A 5CBJA 1XYBA 4DF1A 1H3GA 1Y7VA 1W1VA 4U3AA 3LPGA 3EWWA 1C92A 3ID7A 4PB5A 1V3LA 3W74A 5KZEA 4PTXA 4JIRA 4FO4A 2QCMA 4AB4A 3LB0A 3TZNA 2JKEA 4NYYA 2TPSA 4A4AA 1BAGA 4Q6XA 4BF7A 1UH2A 4H1ZA 2UY3A 4CNNA 3F4NA 3QLLA 3BLOA 1WNOA 3BE7A 1SR0A 5FL1A 7TIMA 4W5ZA 1GVFA 4KPLA 2R82A 3M6YA 4GK8A 3H2FA 2ZQ0A 4K2SA 1EJTC 2A6NA 1JYNA 4RZ5A 3VD7A 4YNGA 1JG9A 3RR1A 2P0IA 2QJMA 2D2OA 3GG1A 3WFZA 1S5MA 1OFBA 3AHYA 3JRKA 3SBFA 4J3ZA 4RUBA 3LBCA 3PZNA 3EBVA 4L64A 1DL3A 3KCJA 3FOKA 1PYFA 2GVJA 3B8UA 3GYCA 2VDGA 1KM5A 2YYTA 4CCDA 1W0MA 4JFWA 5GPRA 2BLEA 2X0SA 5CZTA 1LCOA 2NQ9A 1TA3B 1XSKA 5DFAA 3A4WA 3NQMA 3R13A 2NQ5A 1Q45A 4HHPA 2J7HA 4ROPA 1E6QM 3ZJ7A 3JZEA 3G0SA 1EDQA 4NRSA 4B5UA 4OHQA 4IHCA 3VGBA 5AC6A 4ZXOA 4R33A 2J78A 4FPSA 4GYJA 3INPA 2G3FA 3AHVA 3I6TA 3OTRA 4JTUA 1C91A 1FOBA 1UD4A 1Q63A 1OCNA 3SCVA 1PV8A 4H6KA 1F3WA 4QDMA 1WPCA 5DF0A 1PKLA 1Z48A 1E72M 3FLUA 3ZJ8A 3UR5A 2ABBA 3U2CA 3W7QA 2IKHA 1MEHA 1FWEC 1I2RA 1UWUA 2BVTA 5F4SA 4IJRA 3OIXA 1UP3A 5BWAA 1QI0A 1G7VA 1BVWA 1M41A 3N4FA 2GUBA 1AJ2A 4LQ1A 1FCBA 4B5TA 4UTKA 3N12A 2BMBA 2GGGA 1JDEA 2WOQA 1JDFA 4KFOA 3TDFA 5EMJA 1SW7A 4HD5A 3THUA 3SCTA 4IQEA 4UFKA 2NLYA 4AZCA 3L21A 3LCLA 1HKKA 5D37A 4YVPA 1VBJA 1UOKA 3W1RA 2YB4A 2C16A 1LQ0A 1GCYA 1GVYA 3DC8A 3M0VA 3GNRA 4Y9PA 1DYSA 3CWHA 1KRAC 3WZ0E 4FZIA 3VOIA 4C6PA 5C9XA 4ZOBA 2CBVA 4HPNA 2V30A 5A6KA 2UV8G 5U7SA 2H9AA 3KLLA 4LH8A 3R2GA 4B4HA 1JVNA 3E38A 2BGSA 3THDA 5I3DA 3OVRA 1OEPA 3K2GA 3CQJA 1L9WA 2JIWA 3PG8A 3OA3A 3O6YX 2DZAA 4G8TA 3PJTA 4OBSA 4IIGA 3U7BA 4DN1A 3WJWA 3R89A 1XF0A 5E5CA 3VC6A 2HNEA 3CQIA 2ZA1A 2RDTA 4QDPA 1GUVA 2QHAA 4LVBA 1H1YA 2PC4A 4MB4A 2DT1A 1VBUA 2YXXA 4OV9A 3V0TA 3TW6A 2BX7A 4DWSB 3UWYA 2YX0A 4ZL1A 1CDGA 3LK6A 4AMAA 4LVFA 1E6RA 4GZJA 3FYYA 4RDVA 4H2HA 4DXXA 1B54A 1YDOA 3UR8A 3SIZA 2FPVA 4OKDA 5J5RA 1C3FA 5HXMA 2KX9A 2CHRA 1XGEA 2E25A 1K7XA 1WV2A 4HIBA 1R7AA 2D0FA 3WNPA 4JR5A 3BLEA 1TTQA 1ZL1A 4YWIA 4IIHA 1VHNA 4C5YA 2C71A 2PPGA 1V7AA 2ZUSA 4V28A 1XYAA 1MQPA 1XG3A 4FIQA 3SCNA 3GHTA 2Z1WA 4MKSA 3NDYA 1TPUA 4PB3A 3SY8A 2A3EA 2YA1A 4RZBA 1PKYA 1JI1A 3B8WA 3W3OA 1O12A 5FOOA 1DOSA 2VC7A 3F5KA 3TP4A 1P1MA 3BG3A 4RX0A 5HPCA 2WPGA 3E12A 5GNZA 4C5ZA 3LTPA 4BEQA 2G4JA 1XS2A 1O7AA 3VIFA 3L5MA 2PDCA 1XD0A 3W26A 3FIGA 1FHLA 1S1RA 2Y2WA 1SW0A 1A5AA 4GOAA 4ZSUA 3C2OA 1VBHA 2Q6ZA 1UKSA 5KTLA 5EYWA 1ICPA 3LPPA 3BJSA 2IXUA 2TMDA 3DECA 3AWNA 4U2YA 2VD9A 2E5DA 5AKQA 2GQ3A 3L23A 1CCWB 1H0GA 2HEJA 2VFHA 4QP0A 3SCQA 5IXEA 5LSMA 3LHZA 1G94A 4JIHA 5F2MA 2ZA3A 3HTWA 1E70M 3G1SA 2DJLA 2NUXA 1QWGA 1OFRA 5LGZA 4IICA 3EMQA 1BRLA 4O13A 1FWSA 4H83A 4LEQA 1QWKA 4V27A 3KL5A 5A8NA 3UVAA 4PUNA 1H1NA 2X09A 3UERA 1TPC1 1GVEA 1ZENA 3CZ8A 3LXBA 4DJFD 4LAMA 3IJ8A 4UTTA 2V3FA 2PLJA 4DM2A 1ZRQA 3AIBA 3M7WA 4Z42C 4A3HA 3B03A 4LXFA 3DHPA 1XC6A 3QOKA 5AB3A 5LIUX 4CCZA 4AY7A 2QIIA 2YZRA 4NJKA 4R7WA 1R0MA 1XRSA 1WZLA 3BUVA 4YVXA 3MDUA 2JBMA 1KA9F 1X7FA 1MVYA 4ERIA 4YCPA 3MMDA 4C7FA 1POKA 2E28A 3IVSA 1F74A 1ADOA 1VFSA 1G01A 1E1EA 1F07A 1TWWA 2V2DA 3L4ZA 3G8RA 3WMLA 2OXNA 4UZUA 1S3HA 4GJIA 3N3TA 4MLRA 4CD8A 4MB1A 1J2WA 5DMMA 2CZDA 1JUKA 1US2A 2I7GA 3VFLA 3QV9A 4MYXA 1SZEA 2XSBA 2J9XA 6CGTA 4MAVA 1X6NA 3KS6A 3IJ9A 3N15A 4ZENA 1QJWA 2JKAA 1LZOA 2J62A 4JKMA 4F3HA 2G8ZA 5LKYA 3TLLA 5BOFA 1LORA 3CAKA 4H04A 1CGWA 4Z08A 1RV8A 3EA1A 1Q7QA 5AY7A 4PUUA 5EPDA 4EAYA 3W6LA 1BFNA 3ABZA 2PWUA 2ZVRA 3A5VA 5CPNA 3G1DA 2YDAA 4JNZA 3HQNA 3CTTA 4UTTC 4B5NA 1AMKA 1W9VA 2WV8A 4YMZA 5CJMA 3SCSA 3B8SA 2G96A 4C6JA 3AXIA 1EEPA 1H09A 3H24A 3U9IA 4F4RA 1EJVC 4WGHA 4X9YA 4AW7A 4YHEA 2QAPA 1MDLA 1R2TA 5LNRA 4G9PA 3TYBA 2PURA 1TV3A 5CSSA 4QSHA 5DY3A 4BQ3A 3CQHA 3DG3A 3QHNA 3B4UA 1J10A 1VC4A 3TYDA 3CUFA 5CG7A 3P5ZA 4OGZA 3W2NA 1WA3A 4KEVA 1EZWA 1PAMA 4ZSTA 5AHLA 4B3LA 3DUGA 4XIMA 1JQVA 2ZE3A 3LBMA 5DBTA 4KRZA 3SQLA 1U1UA 3GG8A 4JFTA 5BU6A 3VNDA 3IJQA 1A0CA 5LXEA 3QMTA 4GFIA 4HCDA 4L6DA 2V8ZA 3LG3A 3W7KA 3DBPA 4MLJA 1JIBA 3VIIA 2I14A 4M8UA 1A4MA 1SZRA 1AQHA 2VMFA 2Z4GA 4M6VA 1NQKA 1LQAA 3T2QA 5T91A 3UNTA 2CHNA 2HNHA 4HKPA 3SUSA 1J11A 3TQVA 4F0MA 3MCOA 2PDPA 3CUXA 3BOXA 3DFPA 4IZGA 2QDHA 1VJZA 3W28A 3BK0A 4NAEA 5AZ0A 4AEOA 3GVRA 4G1KA 3F2CA 1NSJA 4Q33A 1W3NA 2ZXAA 1TO3A 1H51A 3EX6A 1A5UA 3MUY1 3EXTA 5LIWX 3WNKA 4PL1A 3IJ6A 3G2GA 2FZ8A 4DUVA 2G5WA 4UTFA 3B0XA 3RRXA 1PTGA 3FAWA 4XSLA 2ISSA 1RVGA 3CWNA 1GVRA 1LOLA 2NW0A 4DUXA 2PI6A 1TB3A 4IPNB 1UUQA 2VOMA 9CGTA 2VEIA 2EXOA 3QHMA 1XC4A 4ORMA 2DSZA 2OLSA 2ATSA 3BLPX 1W1TA 2JF7A 3OU8A 4F0LA 2VGGA 4O18A 2ZFAA 2UBPC 3E0IA 7REQB 1RA0A 2PF0A 3CEUA 4XAPA 2A79A 1GQJA 4GJ1A 1W31A 3GDMA 3CUGA 4MWAC 1V3IA 4UTMA 2I57A 1B3ZA 4PUKA 3N6HA 2ZOXA 2OSWA 2HV5A 1P6WA 5IRPA 5FJIA 4I5UA 2ZE0A 3M1ZA 3AISA 3O63A 3K13A 1JCNA 5AHIA 4GVHA 1E0VA 4UFHA 4OQVA 5I77A 2GSEA 1KBIA 4CNSA 3VIJA 5G4EA 4H01A 3IANA 3BURA 4S3JA 2VYOA 1CGTA 1IZCA 4LJ3A 5DMNA 3LHWA 3CUJA 3W7DA 2VC6A 2ZRYA 3G8EA 3ICJA 5C70A 3MUAA 2OQYA 4IGMA 3IK4A 1GW1A 1EPVA 2W67A 4OTKA 1EA9C 2WZMA 1E6PA 3ZXWA 1YMYA 2OODA 4WOQA 1I6NA 4D72A 1VFOA 4PL2A 4EAMA 3VOHA 4IP4A 1M68A 2CLHA 1G7UA 1M7OA 4YU1A 5BXSA 3JW7A 4O4WA 3E0LA 3EA3A 1W5NA 2A6LA 5AC4A 2PDBA 4WHBA 1T41A 2V3GA 4HK5A 4I8DA 3GVWA 4LBUA 2DT3A 3M4HA 3WDRA 1KWGA 3KVLA 1SSGA 5CC5A 3BLFA 3E96A 5HK4A 2V38A 2DT0A 1V3JA 3CLMA 3NEHA 4ALDA 3FHAA 1TFVA 1H7XA 1SU5A 3OHIA 4O4VA 3CZJA 5C9RA 4O15A 1OT2A 5C71A 3ZVHB 4LUSB 3AJ7A 3DG7A 3OBAA 3EMCA 4JYDA 1P48A 1J0HA 3R1ZA 1KFWA 2CPUA 3GNNA 3O15A 4WXYA 3PSVA 2R1MA 1ZS2A 3B40A 5ABTA 3GDKA 1TMHA 1VGAA 4H9ZA 1F6YA 1XL9A 3WBYA 2CU0A 1B9ZA 4W8AA 4S23A 1FDYA 3R0DA 3TTOA 3B0VC 3T7VA 3BGGA 1F5ZA 1M53A 1O94A 3RJXA 1MI3A 1FWHC 2RGLA 4FNRA 4CEXC 1I1XA 3U8GA 1B3OA 5LNVA 3NCOA 3F1QA 4Q4RA 1KM6A 3WQGA 4HA4A 1QR7A 4GH3A 1VEPA 2Y8UA 1A5BA 4K38A 4XZNX 5EKYA 4G2DA 1JFXA 3LD5A 3NQAA 4C6DA 1S3TC 1MQRA 3MY9A 6ENLA 4H8NA 3KL0A 4LUTB 5E93A 3GB6A 5A6BD 4N6FA 3Q2DA 2OWCA 3TOYA 1DIOA 2PDNA 5AYIA 2VFDA 1RY8A 1V77A 3W1TA 2ACQA 1KD0A 3W9ZA 4I8YA 5FSDC 4E38A 4ZTXA 1NFBA 1MZHA 1XI3A 4K3ZA 4GACA 3GAKA 2D0GA 3WNLA 2I9EA 1EF2A 4RJEA 2BHUA 5HMSA 1MO0A 3GW0A 2OO0A 1GQKA 3H4WA 4QITA 2YL5A 4N0RA 4HTYA 2XFFA 3B9AA 3BG9A 4HU3A 2I5IA 1SFSA 1UD5A 2QCHA 3W07A 1CGVA 2BXYA 2GLKA 3XINA 1JGMA 1W37A 4U31A 4MADA 3W22A 4HBKA 1HVQA 2G3MA 5BZAA 2VEFA 2RJGA 4FNSA 4GQBA 4WZHA 3TMQA 4UIOA 1J79A 1RXOB 3KUMA 1H7RA 1CT5A 1VCVA 4M6PA 2QCDB 4R34A 4LYKA 3KP1A 3SQMA 2XIBA 3GYEA 3UU0A 1S38A 5F7UA 1RQBA 3RMJA 2WZTA 4KEZA 1SZNA 3S2JA 4LAUA 4GUJA 4INFA 4GQGA 4BHYA 1BGAA 2DZTA 4GIEA 1LT7A 2E9BA 1OABA 1VBRA 2C15A 4GH1A 4M5PA 3GXMA 3FXGA 1V02A 2J9YA 3LPFA 1XP3A 2XDFA 3MDWA 5TD4A 4QSFA 3GVGA 2I17A 3S6DA 5I3FA 1TV2A 5CZSA 5I3JA 3ONBA 1GWJA 7ENLA 4FF5A 4FXRA 4Y9OA 4L9YA 4LB3A 1KM0A 1VENA 3AC0A 3K4DA 1U83A 3IJ7A 4S39A 4LF2A 3TYAA 1LROA 4ERAA 3LTSA 2E68A 3PY2A 2PGFA 1W1IE 2W6RA 1H1ZA 4MZYA 4S3DA 4OBTA 2OEKA 3SR7A 1R86A 3UWWA 4WX2A 4LNYA 3AJXA 3CIXA 4KETA 2DZXA 3FN9A 2CNCA 1M9HA 4FK9A 4HMNA 1SZGA 1XLCA 5T9BG 1DWFM 4PA8A 3CB8A 4L65A 5CBBA 4L9XA 3WLJA 4HZ6A 4UCGA 4Z17A 2PDGA 3L4TA 4HZ8A 5REQB 1BWVA 3E2RA 2Q09A 1EJRC 4YS1A 2NUYA 3PBWA 1EJXC 1UIOA 3O07A 4WY0F 2C18A 3N04A 4GZEA 3S47A 4R9OA 1UROA 2J13A 2V5KA 2GUUA 4U10A 4H9UA 1L6WA 1XLJA 2WCGA 4WF7A 4DYKA 4FNPA 2VC5A 2XN1A 1RLCL 3STPA 3UW6A 3APGA 2QDEA 5DRIA 1GNXA 3GNPA 3RU8X 3FSUA 5RUBA 1QHOA 1ZSXA 1I2PA 3DYPA 6ALDA 1FWFC 3N2XA 2HS8A 2DPEA 4JX6A 3BC9A 1GVSA 1MXDA 2OQLA 2ZRVA 4F48A 4H41A 1E3ZA 2O9TA 2J6VA 4AD1A 3F4DA 1I60A 2DH3A 1X7IA 3POCA 4HHLA 3G0UA 1ENUA 2VJXA 2VKZG 2OELA 7CGTA 5ABFB 5CKSA 3QV6A 4IUGA 4D6GA 1R3TA 3QTPA 1J5TA 3I65A 2XGZA 1GORA 2CLOA 1PL9A 3U4AA 4XZMX 1N8IA 4FEZA 3VX0A 2PDXA 1K8XA 4KESA 3AU2A 1O5KA 2E77A 5XIAA 3H22A 1EQCA 3MCMA 3QJAA 3QV7A 1UR9A 1VFHA 3MWAA 3TNOA 5MKGB 4LEFA 3PZTA 1DJYA 2C6QA 4L5ZA 1YNYA 5TQLA 1UPPA 4O0ZA 3RK8A 3EDFA 3KTCA 4I9TA 1V6VA 2Y1HA 1KR1A 4DY1A 1CYGA 1OB0A 1ODUA 2HMCA 3VOCA 1EGVA 3RILA 2DZPA 2J7BA 5SWUA 1Z41A 4EF9A 2QDDA 4U28A 4GMEA 5AN7A 1EXPA 4RW3A 1ZHAA 2QEZA 3G18A 1KGWA 1M7XA 2FDSA 4XB3A 3RPDA 1S2AA 1SJBA 1PHWA 2VZTA 2RUSA 4O1FA 2BOGX 2F6UA 3AROA 2GVLA 4H9XA 2XFWA 4NX0A 3HQ1A 3WBEA 2Z26A 1TMLA 4XO7A 4BJHA 1O95A 4Z1AA 3LTYA 2Q8XA 1DJQA 3NQ2A 4UMCA 2WMHA 1NELA 1YYAA 2VFFA 1VQTA 2WHJA 1E5NA 3ZQ9A 3ZM8A 1BYDA 1Q6OA 1DJGA 4HSOA 1F3TA 3N9SA 3TVAA 4K1GA 1ISXA 3M16A 3UJRA 1OK4A 1JXJA 3VCCA 1B0IA 1JF5A 1WXJA 3WQDA 3QRHA 1DE5A 4YWSA 2HDJA 3S5YA 1KM1A 2WCSA 5I6SA 4J5NA 1JDDA 1V4YA 2YOCA 3V0UA 3ECQA 5DEZA 2B81A 1ONXA 2Y8KA 2OGJA 3CJPA 2CYGA 3HMCA 4QAWA 2GDQA 5DRCA 1R2SA 1XBYA 1G1YA 3TW9A 4MWAE 1HL2A 1A80A 4FLSA 4TMCA 2DY3A 1PB0A 2E1DA 2ZC1A 3RJYA 4O54A 5D9PA 4HYVA 3WD3A 2QV5A 9XIAA 4HNLA 2X42A 4DPQA 1C8QA 2DVTA 4D1JA 2DORA 3NPUA 2WKJA 4L6OA 1EP2A 4K8HA 4KCVA 1T40A 2V5BA 4AX7A 3C61A 2PDYA 4X63A 4GIAA 5EMUA 4L6HA 3VKDA 1D8CA 2VI0A 5ECVA 3MKKA 5E0FA 3TXZA 5LA2A 3PFRA 1V93A 2XFYA 2V5JA 3H2AA 5HWNA 2Q02A 2VVSA 1CPUA 1UR2A 5JQ9A 4DM1A 3IGXA 3L0NA 3SGUA 2V68A 3WDIA 3TW7A 4MDOA 1DJNA 5LA1A 3P5YA 4UOQA 2DEPA 3PWGA 5G1MA 1MEIA 3N6QA 2YCLB 4LT9A 2HXUA 1TR1A 5I3IA 3BLIA 4TVDA 2VFIA 3DBNA 3MUXA 5JIWA 2Y85A 5FL0A 3ARPA 4IMGA 3DFSA 4DPPA 3ANVA 8RUCA 2CLFA 2GDVA 1V7YA 5HQEA 4RNHA 4DVOA 3AS3A 3T0CA 2O55A 2FMNA 2YR1A 2ZZ3A 4ADTA 4K68A 2OMAA 5FF0A 3WQCA 2GZXA 4Q8TA 1R87A 5CCZA 1J0ZA 4Q4KA 3L65A 4PBEA 4Q4QA 5DLCA 1ESWA 4BI6A 1WX0A 4PMYA 2MNRA 1BQGA 3HQPA 4FOUA 3RRAA 3AIRA 4DJDA 5A5WA 3S5OA 1WYIA 2VEKA 4F79A 1E4IA 3P82A 3GXPA 3VM7A 3PS7A 4Y8EA 3KDOA 4GPNA 4HSNA 6XIAA 1MNZA 4GVIA 3PG9A 5D30A 5CBIA 3QC3A 3ZSTA 4GQRA 1H11A 3HPXA 1Q7MA 2WYSA 4PMUA 2REQA 3N34A 5FI8A 3W84A 2Z6IA 2DSWA 1FWRA 1JUBA 4MJ4A 2O9RA 1DWAM 1Q13A 3DI0A 4KWWA 4LV9A 1OFQA 5CZ0A 1Z9AA 2FGBA 1WDDA 3VU2A 1XRFA 1IV8A 4ATWA 3GKFA 4GI4A 1DWJM 1V08A 2CLPA 4NU7A 1TX0A 4LCSA 3C5QA 3A9IA 1UWAA 1OIMA 3PTDA 2OZ8A 2ZKMX 4MPKA 1W9BM 4NT0A 4Q8NA 4ZFCA 4RCXA 5D2WA 1P6CA 1R5YA 5KINA 4R3UA 1UR3M 3UVIA 2Y24A 3UPBA 4W8LA 1CLKA 1PWMA 3G3MA 3W70A 1XFCA 3WENA 5G1YA 2J47A 2ISDA 1ISWA 5G2WA 1H62A 1TYGA 4FR6A 3TQKA 2PB1A 2V69A 2IQDA 1QFEA 3B8VA 4AF0B 2BY3A 2CWXA 1E71M 1OC5A 3K8KA 1XINA 4IG2A 3H2OA 2GJPA 2HE8A 1KNWA 3TN4A 2WXDM 3UZJA 1JRCA 3ZT7A 1ISYA 1MNSA 2WSYA 2XIJA 4MB3A 4L1XA 5HJLA 1IYXA 3WF2A 3KVJA 4JTDA 4GUHA 4PYSA 4ZQNA 1I9CB 3BO9A 3LQLA 3VA8A 1I4NA 1TPVA 1PUDA 2B7OA 3WH7A 1WKEA 1OF6A 1XIHA 4JN6A 5I03A 2HZGA 1OJXA 4JTHA 4HN8A 4Q8PA 1W1YA 4C1NB 3T09A 3BMVA 2RDXA 3TKFA 2FB3A 2OSXA 1U1JA 3UGVA 4M1BA 2ZA2A 3A4XA 2PDMA 5CSYA 5FJUA 3B8TA 3CYVA 3GUWA 3LBOA 4NQ1A 5H8UA 2VEGA 3GR8A 2GJXB 4E2VA 1ZBCA 4GX8A 4LC8A 1SO5A 3S4TA 4WXZA 2DUXA 1P43A 3UWQA 3UCCA 2W4XA 2OLAA 1D3HA 4WDWA 4IIDA 5CPTA 2G3NA 3CC1A 4ATLA 4PZVA 1RPKA 4NJHA 4X0VA 3VVGA 1EBGA 4REQB 4ZO6A 3WQFA 3WJZA 1DJZA 2DH2A 4F2UA 2ONEA 3G6MA 4UZSA 3JS3A 3V75A 3COTA 3WUFA 3PANA 2VURA 3KS5A 4MGGA 3LPOA 4AFYA 2ZXDA 2D1ZA 3C52A 1RK6A 1W3JA 4ZBCA 1ZY9A 3PC0A 5CJ5A 2UWFA 5BU9A 5BXPA 4KRTA 4KF1A 2EGZA 4UQ9A 4US5A 3PF3A 4CQCA 5LHEA 5ABEA 3B0YA 5FF2A 4WK9A 1TTIA 3W72A 5AECA 2PEVA 3ZIZA 2VGBA 7PTDA 2Z1XA 3RFAA 4Q7NA 4F40A 3GDRA 4KQNA 3BCFA 4I7WA 4N9EA 3FAXA 2C13A 2XM1A 4UQCA 1YW1A 2TSYA 5E09A 4AHQA 4DBUA 2HK1A 1E3XA 2UZ9A 4CNPA 2V81A 3CZEA 3QMRA 2CBUA 2JQXA 3T42A 4A2RA 2VR5A 2Z7KA 8XIMA 2OOFA 2A21A 4LRSA 1Q6EA 3NOYA 3P8JA 1BQCA 1QW7A 1H7OA 1REQB 2X41A 2BY1A 1NDVA 4QQUA 3UFYA 1SFLA 1XUUA 2G3IA 3VABA 1XV8A 1DPMA 1SUXA 5TBOA 1MXGA 2CXGA 2WVVB 4K6AA 5M2FX 1XQLA 2WM0A 4XZ9A 4DIAA 2IPWA 5AC7A 3V5FA 2PDKA 5CPSA 4AVFA 1KTNA 4IFRA 3B4YA 1KW1A 1OHLA 1HJXA 5I2UA 4Y96A 4QG8A 3THQA 1PCWA 3H21A 1TVNA 2C0HA 4LANA 3EDEA 1T8XA 4XVDA 4L4LA 1N82A 3VGFA 3DHUA 4IWWA 4J3XA 1OYAA 4ACZA 4JAWA 1CXEA 3WL0A 3IS4A 3SCPA 3I3EA 3G1AA 4H9TA 5CAHA 1OFOA 2ICSA 1EJWC 1R9YA 2NWRA 3URBA 4RXFA 4GNJA 3MP5A 2YCJA 3GFXA 1TV5A 4L80A 4LNCA 2Y7EA 4DBDA 4NZCA 4UWMA 2WBGA 2C79A 1KGUA 4JZ5A 1V6WA 3M6DA 3EOEA 4GI9A 1X98A 5HAOA 2Q3OA 2X40A 2FTPA 4LBRA 4AZ7A 3QSRA 1XIBA 3CTLA 3T08A 1XW8A 2NQLA 1AZ2A 2VFGA 3WFAA 2FHFA 4JFVA 1PZ3A 3VZZA 3CL7A 3BSHA 1I0BA 2QT3A 4AH7A 3NPWA 4D6HA 4DNHA 5EMLA 1QU4A 5GNXA 4C1LA 2WWCA 1QNPA 1SSDA 2GJLA 2IPFA 3W53A 5ABHA 1QK0A 4AZGA 2O7SA 4E6MA 1WBHA 1VFUA 4LF1A 4LYQA 5A8GA 1YPIA 2EEXA 3LENA 1ITCA 1LDCA 4WSKA 3QFEA 2ACSA 1TTPA 2AGKA 4JFUA 4H9VA 4NZ3A 2IPJA 1ZTVA 2EHHA 1P0DA 3LLDA 3NTYA 5ENLA 3ARXA 4U33A 4JL1A 4NXSA 2GJRA 1UJPA 4B16A 4RW5A 1UIPA 5MHBA 5TIMA 3NJ3A 3CXOA 3N2MA 1FRBA 1BF6A 1K8YA 1B3XA 1V0LA 4GC4A 5FJPA 4ZTYA 5I7GA 2H3BA 1EF3A 3CS2A 3V35A 3MKVA 2ZVIA 5C7VA 2VR2A 4PUMA 3VGGA 4YIWA 3LX9A 5F4XA 2WMIB 3M5XA 4XZIA 4CUCA 1OX4A 3ITCA 3LUTA 2D2HA 3W38A 3E02A 3FKKA 1VPQA 3BDKA 3SGGA 1RY0A 1J6OA 3A47A 3W7GA 5G1TA 1CW2A 3C8NA 4QROA 5AYZA 3AHTA 4IPLA 1K8CA 4IGNA 5HNTA 2WBKA 3EA2A 4EXAA 4NKCA 3C86A 4N7QA 1Z42A 2VT0A 1CGUA 1A5CA 1R3QA 3PPCA 1NDYA 3PVFA 2QXWA 4DYEA 4Q4MA 4GBUA 3WLSA 4WDTA 4C90A 4GIRA 3MJYA 2C8NA 3W7PA 3LA4A 2XSAA 1GTHA 3KXQA 4LS1A 4C65A 4O1BA 3TV8A 5B7YA 5HNUA 3FJ4A 1QW8A 2AAMA 5GQBA 3IAPA 1DQWA 3FFSA 4GI8A 2J7DA 5IDZA 3W1MA 1YXYA 2VUYA 5EU9A 4IQLA 1Y8BA 3RIKA 4AD0A 2B4GA 2Y5SA 1QOQA 1TQJA 5BMWA 3APTA 3URQA 4GGBA 3ABOA 2BVDA 4EP8C 2XGBA 3ITTA 1DJIA 1X6LA 2PZNA 4F9DA 3BAJA 5BXRA 1JDAA 1XD1A 4LSBA 4W87A 3V4BA 3QYQA 1XYZA 3E2SA 1XLEA 2TYSA 2A3HA 4CN6A 1S2WA 2YDQA 3SUUA 4O0QA 4UBPC 4S1FA 1VKFA 3KW3A 4WD0A 5E1QA 1SO4A 7A3HA 4M0XA 4JHZA 1E0UA 2J8TA 1W9UA 1FXPA 3HPFA 1R6WA 2ZRWA 5E6ZA 1AFSA 3QBUA 1A5KC 1VAHA 3VD9A 3ABSA 3W7EA 4C7DA 1JCMP 1JJKA 3MB9A 1ZBKA 3VUSA 3NQDA 4QNEA 3P61A 4IT1A 3HG2A 4GYPC 2D24A 3HPAA 1J01A 4M6QA 3T0AA 3O16A 2XFRA 4DLMA 3M46A 3LMYA 3TJLA 3TSDA 1FWJC 4PBGA 4S3BA 1QASA 3WLQA 4MKNA 3UG4A 1L6FA 4L4PA 1W32A 4A2SA 1H5VA 2VZOA 2R91A 1RAKA 1KB3A 3A5FA 2O56A 5C8BB 2FZBA 4GYFA 2A7NA 3SRHA 5D2YA 4C91A 2NUWA 3QGVA 5XINA 4A3YA 2F8QA 4Y8FA 5DT5A 1KFCA 1VPXA 3MUCA 3NIYA 3VOGA 1C9DA 1B57A 2PD5A 2OT0A 1PXGA 3CLWA 4ZFMA 1R30A 3W1AA 3ZSSA 3SADA 4RLIA 5T8GA 4UC5A 4GUFA 3OVQA 2RFGA 3KL3A 3WQPA 1JYVA 3KTXA 2WMKA 4HPJA 3ZT6A 3H12A 1EDTA 1DTUA 3E5BA 4O16A 1IEWA 2BODX 3NZGA 2BBFA 1RCQA 3ENLA 3H55A 4LRTA 1HN1A 4ICCX 1PZ0A 3H4XA 3EXSA 3EOOA 4N9BA 1UUMA 6TAAA 2B7QA 2D3NA 3OGVA 4FF7A 3U2ZA 2I16A 2PLCA 1JD7A 1DVJA 4MWAD 4RNJA 1UZ4A 4OZOA 2IXVA 1B30A 2ZX6A 4O1CA 2BVWA 1TJ0A 3VNZA 4DRSA 1ZJBA 3WUGA 1B4KA 1FKXA 3W7MA 1KQYA 1D8WA 1TE1A 4LAOA 4RDWA 3G77A 5A6LA 1PEZA 2WSKA 5EMYA 1WXYA 3VINA 3OZPA 3SCWA 3AXXA 1NOWA 1B3YA 4XSMA 1KLYA 1IZKA 4DO4A 5K9DA 3AHZA 2QGHA 5E6YA 1HG3A 3BLKA 3RPTA 4JTEA 1YADA 1C8YA 2OPJA 1TPDA 4CU6A 1HGYA 5H1WA 1W8SA 1BYBA 1F7BA 5CXPA 4AZCB 3AZTA 4HK7A 2WZIA 5M5DA 4RDZA 1Q7ZA 4PEEA 5GVJA 5DANA 4L7ZA 1XBXA 1M7JA 4TO8A 1LBLA 4HYRA 4A35A 1ZGDA 5BRPA 3MQTA 5F2LA 3NWRA 2PBGA 2ZRXA 1SJDA 1EP1A 1V6XA 1TWIA 4H7ZA 3MUIA 4MY8A 3TH6A 2PWFA 3OP2A 3DKJA 4O1EA 1V0KA 4ILSA 3WQVA 1R8LA 1AD1A 2ACUA 2QPXA 4Z0JA 3AMLA 2D2JA 1Q3NA 3SFWA 1AW2A 1UMLA 1FFRA 3PZ9A 2XH2A 4Z2JA 4FXFA 4GX9A 1XPYA 4QRNA 1GYNA 1R47A 4S3FA 4W4QA 5ECUA 1OFEA 4Q8MA 3PJWA 4MJZA 2WVSA 3QPYA 1GONA 4UNIA 1QOXA 3CAWA 3REQA 1OYCA 1GKRA 3N73A 1G9HA 1BSLA 1R3SA 5AVHA 5I23A 2A2IA 4W88A 2GUYA 9XIMA 4HHMA 3EPOA 2PWHA 2ZYFA 3EX3A 3VNLA 1K03A 1Y5VA 5K9CA 3A64A 2V2CA 1A3WA 1K4GA 3EWZA 1W56A 2V0TA 2PP1A 4N9CA 3Q4DA 5U4NA 4AD3A 3PNZA 4F0SA 4O14A 4JX5A 1EIBA 2EG7A 5C5YA 1QATA 4D8LA 3U2EA 4KWVA 4O8RA 5IHRA 2OO6A 4GQ0A 2ZX9A 3L68A 1OCJA 4X9SA 4I7UA 3WF4A 2W3ZA 1YIXA 3NQCA 3OGRA 2NSXA 3AUJA 2VRKA 3KX6A 3SCRA 3HIJA 2WSPA 1EHAA 3L5AA 5AC5A 2AMXA 3OVGA 4YPJA 1PCKA 3ARSA 1ZBWA 2VNCA 3QPZA 2ZZ4A 3SY1A 2ATMA 3DH7A 4BWLA 1CIUA 3VZYA 1BWLA 1SO6A 1TG7A 1QDSA 1BWKA 1VS1A 5CLWA 4GHRA 3NXLA 1O1ZA 3LEPA 1X1ZA 1C93A 2JEPA 5A6TC 1VCGA 2W62A 3S0CA 4F9JA 4ZQOA 3N13A 5H8PA 4R88A 3MTWA 5HPOA 2W66A 3S46A 3W1XA 4BK9A 2JGQA 3GX9A 2ZXQA 4AY8A 2AOSA 2XHYA