1ZZMA

Crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
MICRFIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADEIAQALLNNTYTLFNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative deoxyribonuclease yjjV
publication title Crystal structure of YJJV, TATD homolog from Escherichia coli K12, at 1.8 A resolution
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 92
structure length 259
sequence length 259
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1zzmA00
2OOFA 2EG7A 3GG7A 2HBXA 4CQDA 4IG2A 4QS6A 3FDKA 1EJTC 1KRMA 2O4MA 1GKRA 3GRIA 4KEVA 3SFWA 4C6DA 1A4MA 1XWYA 2GSEA 4GYFA 4QROA 4H9TA 2OGJA 2VUNA 3QGKC 3V7PA 1KRCC 2P53A 3URAA 1FWHC 4C6NA 1R9ZA 3ID7A 5LXXA 3FEQA 3F2BA 3MDWA 2Q09A 3HPAA 4LCQA 3MSRA 4KEUA 4XAYA 3OJGA 4XAFA 5FSDC 1FKWA 1RA0A 1A5LC 3K4WA 4Z42C 4RDWA 1EJRC 1QXLA 4I6KA 2GZXA 1NFGA 3GU9A 4PCNA 1FWCC 4H9ZA 1J6PA 4AQLA 5AKQA 2DVTA 2WJDA 3G77A 4KIRA 4KETA 1NDYA 3LY0A 1A4LA 4GZ7A 1EZ2A 2GWGA 4KEZA 3PANA 2FTWA 3AU2A 2Y1HA 2Z4GA 5E5CA 4DLMA 1XRTA 4P5UA 3MDUA 3LGGA 2Z00A 4ERAA 3B0XA 2Z7GA 3IJ6A 4C6FA 4ICMA 2OODA 4C6MA 3E38A 3UPMA 3K2GA 4CNTA 3O0FA 1E9YB 4G7EA 3MPGA 5HMFA 2VR2A 3UR5A 2QPXA 4PBEA 2OQLA 1EJXC 2R1LA 3BE7A 4D8LA 2QVNA 4AC7C 1FWAC 3URBA 3D6NA 4F0LA 1QW7A 2PLMA 3WZ0E 2E1WA 1V4YA 4QS5A 3E2VA 3OQEA 4WVXA 3E74A 4DZIA 3O7UA 3QY6A 3T1GA 2D2HA 3IRSA 3ORWA 4QSFA 2Z29A 4WGXA 4C6PA 4C6IA 3IARA 2ANUA 4IG2B 3LA4A 1RJRA 1EJVC 1ITUA 5G4HC 2Z26A 3T8LA 3TN6A 3CAKA 4CQCA 2HNHA 2O4QA 1YMYA 2HPIA 4CNUA 2EG6A 1YIXA 2OB3A 3GU2A 4LAMA 4R85A 4ERIA 2EG8A 1YBQA 2YZ5A 3PNZA 3GIPA 4C6EA 1HZYA 4V1XA 4HK7A 1K6WA 1NDVA 4HA0A 1UIOA 4KESA 4C5YA 4YIWA 4GK8A 4DZHA 2VC7A 2R1PA 1A5MC 1XRFA 4GBDA 2PGFA 4ZSTA 4C5ZA 2XIOA 1FWGC 1WXZA 1UMLA 1RA5A 4IFRA 3GUWA 1XGEA 3A3XA 3AU6A 2I9UA 1I0BA 1RAKA 1YNYA 4UB9A 4G2DA 3ICJA 4L9XA 1P6BA 2AQVA 2YB4A 3GU1A 1RJPA 1I0DA 4E3TA 3WMLA 3IGHX 3PBMA 4GC3A 3IV8A 3UF9A 5HMEA 3MKVA 4LCRA 4H9UA 2FVKA 3K5XA 4EPEC 4EPKA 4KF1A 4EPDC 1FWJC 2AMXA 1EJWC 1K1DA 4DO7A 2WJFA 1J5SA 4LH8A 4KERA 3RN6A 2FVMA 3E3HA 3TN5A 1VFLA 3HM7A 1KCXA 1P1MA 1E9ZB 2AQOA 4BJHA 4G7EB 4M51A 4GOAA 3CJPA 3OVGA 4F0SA 4DNMA 1EF2A 4B91A 1EYWA 4J35A 4B90A 4XAGA 4KQNA 4RZBA 1R9YA 1A5OC 4CNSA 4F0RA 4WHBA 4R88A 3LS9A 4L6DA 4LAOA 1ZZMA 3GIQA 4PCPA 3SO7A 1WXYA 1FWFC 2W9MA 3QGAC 1W1IE 1M65A 1POJA 1PB0A 3HTWA 4EP8C 1ADDA 3MJMA 3NQBA 2BB0A 2YXOA 3F2DA 3AUOA 2P50A 4LALA 3S2JA 1GKQA 2HQAA 3EWCA 2IMRA 4CEXC 4V1YA 1V7AA 2RAGA 4JOMA 4XD4A 3IPWA 4H9XA 3KM8A 4XAZA 4GY1A 4IF2A 2Z2BA 1J6OA 5HMDA 4C6LA 4BKNA 3DUGA 3QY7A 4C6KA 2GOKA 3CS2A 3GTHA 2Z27A 1GKPA 3F4DA 1ONXA 4BY3A 1ONWA 2QS8A 4R7WA 3TN3A 4LCSA 3S2MA 4NG3A 4GY0A 2WJEA 3GTIA 3LSBA 1DPMA 4TQTA 1RK5A 1KRBC 3S4TA 4CQBA 2KAUC 2UBPC 4H9VA 4NP7A 3NEHA 1KRAC 4J2MA 2VC5A 4NI8A 4C6CA 5FSEC 4GXWA 3RCMA 4H00A 1RK6A 3EWDA 3TN4A 4XD3A 1O12A 3LNPA 4MUPA 3PNUA 1A5NC 2BGNE 1IE7C 4C6OA 2VM8A 4HK6A 4IFKA 4LFYA 2E25A 2PAJA 4HJWA 1P6CA 4C6JA 4QTGA 3OU8A 3R0DA 3N2CA 4RDVA 4LANA 3IACA 2ADAA 2ICSA 2HBVA 2YB1A 1M7JA 1EJUC 3ISIX 2VHLA 3LSCA 4IGMA 2Z25A 1NDZA 2QT3A 4PE8A 4RDYA 3MTWA 2F6KA 4OFCA 5A6TC 3PAOA 2HPMA 2UZ9A 4I6VA 3E0LA 4B3ZA 4IH3A 2I5GA 3E0FA 1S3TC 3F4CA 4IQJA 3F2CA 4PBFA 2PGRA 3DCPA 3URQA 4GY7A 4B92A 4RDZA 4EPBC 4DIAA 2GWNA 3S2NA 4DI9A 4LEFA 3GTFA 2Z24A 4IFOA 2FTYA 1J79A 4J5NA 2D2JA 3B0YA 3GTXA 1JGMA 4C60A 1FKXA 1FWEC 4H9MA 5CH9A 2WM1A 4GX9A 1FWIC 4QRNA 1V51A 1ITQA 1FWDC 4H01A 3MVIA 3MVTA 2FFIA 1M68A 3WYZA 2R1NA 1POKA 3A4JA 1PSCA 4UBPC 3UBPC 3UR2A 4DYKA 1UBPC 2DVUA 4ZSUA 2R1MA 3JZEA 1FWBC 3FDGA 1A5KC 3A3WA 2A3LA 3LU2A 2D2GA 3ITCA 4INFA 1NDWA 1PTAA 3OOQA 4LAKA 3TNBA 3S2LA 4CEUC 1YBQB 2G3FA 2Z28A 4ERGA 2DVXA 4C65A 3LGDA 4C6QA 2CZVA 3DC8A 4HK5A 3NURA 1BF6A 3B40A 4H9YA 2PUZA 3OODA 1YRRA 4DI8A 1RJQA 1PO9A 4RE0A 1V79A 1EJSC 4GX8A 1O5RA 4IFKB 3URNA 3T81A 4DLFA 2Z2AA 4XD6A 3C86A 4C6BA 4IGNA 1K70A 2R1KA 2Q01A 1UIPA 1R9XA 3RHGA 3QY8A 3RYSA 2ZC1A 3EGJA 4XD5A 1V77A
chains in the Genus database with same CATH superfamily
3AQUA 1B57A 2Q02A 2ABBA 2VGBA 3WLPA 3O05A 1KRMA 3W4RA 1GKRA 3NEVA 3KVJA 5KZ6A 3VNIA 3IS4A 2NLIA 3DYMA 2O55A 4Z08A 1AD4A 1H63A 1BF2A 2JIEA 2INEA 3VNYA 1E6XM 3DYOA 1S2WA 3P8JA 4LCQA 4XAYA 5FACA 4JQAA 2OLSA 2PLJA 4N0RA 3BO9A 5DY3A 4PCNA 3EEGA 3WH5A 5C9XA 3TSDA 2RDXA 1GOKA 3IANA 2PB1A 5D37A 3UW6A 1XUUA 2CBVA 3TYZA 1WAUA 3K30A 3W29A 1XFBA 2XGIA 1PTGA 5GVJA 2NQLA 3C4UA 3WD2A 1F7BA 4LWWA 1F6YA 4MNJA 2VFGA 4DRSA 2DIEA 1XIIA 1LRNA 3LGGA 2JGYA 3WBWA 3PP7A 4UTKA 1EWDA 2W4XA 4C6FA 1LZOA 2OODA 4C6MA 1TR1A 4ACZA 3TR9A 1EL3A 1VJZA 1SZEA 4BQ5A 5F4WA 4WZHA 3DECA 1TPWA 5A8PA 3KP0A 2VZSA 5EBUA 4E4UA 1K8YA 4ES4A 4P7LA 3UJFA 2YL5A 4GABA 3IIOA 3L5LA 2X09A 4O10A 4WVXA 2G97A 3GVVA 3T1GA 3T8QA 5JH2A 3C2VA 3NFUA 3PUEA 3SUWA 4WGXA 2QPSA 2ANUA 1JD7A 2DIJA 1CGTA 3QW4B 1A0DA 3FN9A 4V33A 2UY3A 3E12A 1SSDA 2XFFA 2OELA 4B5UA 1GW1A 2OKOA 4FNPA 3WQWA 1ME7A 4W5UA 2OCZA 2PDFA 2XU2A 3S6OA 1H1ZA 3N29A 3UD6A 3PJWA 3LQGA 4X9YA 1AMYA 3VKAA 4B5NA 2AAAA 4PMXA 3ATYA 1KM5A 1EYEA 1R3YA 2Y85A 4N9CA 4JIRA 5AZ0A 1RAKA 1W1PA 5DBUA 1JPHA 2QZRA 3UPWA 3GU1A 4K38A 1UCWA 3HG4A 5T9CE 3UF9A 3GHSA 2ISVA 1O5QA 2IQ0A 4LCRA 5DRCA 3APTA 4GFIA 3PG9A 3F5KA 4LOCA 4NXKA 4L5ZA 3TMLA 4EWND 4BQ3A 1EJWC 4DO7A 3F1QA 1NU5A 4F9DA 5HWMA 8CGTA 4HPHA 1XDJA 1LRQA 2VCAA 1QNQA 1XSJA 4AU0A 1OFEA 2GQ3A 3KBSA 4XAGA 1CIUA 3Q4DA 4LUSA 1G94A 3UVIA 2CLHA 3VOIA 4UQ9A 2H9AA 1R9YA 2GFTA 2CLPA 4CNSA 2ATMA 2V3EA 3HMJG 2V2DA 1F8IA 1LT8A 3GIQA 4JFUA 1W1IE 1WUFA 3BVJA 4JIQA 3KEHA 3OLDA 8A3HA 3T42A 2W27A 1JYVA 4E2DA 4LC8A 4L4OA 2OZ0A 3RFAA 2WC3A 1VBUA 4TVUA 4Z1YA 3CAVA 4H83A 1BSIA 2IPWA 3MHGA 5BWFA 2VVSA 4DPQA 4UTHA 5IOBA 1XKYA 2DT0A 1OX4A 2CKSA 4DEFA 3RDKA 4GY0A 3ZJ6A 3MBDA 1ZTVA 1PX8A 1AVAA 3S4TA 3RIKA 5U4NA 1C92A 4J2MA 2VC5A 4NI8A 3NPXA 4NX0A 3QRHA 2EPMX 1L6FA 2C71A 4XD3A 2VZOA 3W84A 4GG9A 4LX4A 4ZEPA 3AXMA 1I2QA 5H6HA 2VM8A 3T4WA 1XICA 1P4CA 4Q22A 4MNLA 2XSAA 3UJRA 3TLLA 2RH9A 3H55A 2E0PA 5A6BA 2DDXA 3R0DA 3AYRA 4IZGA 3APYA 4LANA 2VDIA 4X0NA 2VELA 3REQB 3CL7A 4XVEA 2F6KA 2ZX5A 5ABHA 3S9ZA 1XHGA 4PRTA 4UMCA 1RXOB 1HJXA 3F2CA 1YKWA 5A94A 2QIWA 1SFTA 5FJIA 3W3OA 1ADSA 1TQJA 4A35A 4ATWA 2GGJA 4YL2A 4J3VA 4Y9OA 4IPLA 4PUKA 5IXEA 4DWSB 4LYQA 1R46A 4NASA 2R14A 4WD0A 3VKDA 2YXGA 3B8DA 3CTLA 3T6CA 1XYMA 3WQCA 4HBKA 5IM51 2PODA 3IRDA 4OOUA 1NQKA 3H53A 5BZAA 4H01A 3MI6A 1PSCA 4UBPC 1TX2A 2QMKA 3GY1A 1B3YA 2OJPA 3K8MA 3G1DA 1FWWA 3FDGA 4AHPA 3BSHA 2TYSA 3NSNA 1RLCL 3C6CA 2ZXQA 4GH3A 4Q8QA 2A3HA 1F6PA 1GHSA 4C65A 2QJMA 2ZRZA 3WJYA 1AFSA 1BWLA 3NURA 3U4FA 4IL2A 4LXFA 4NRRA 1QI4A 2VNCA 1L9WA 5F7UA 3H23A 3TWBA 2JKEA 4XZWA 3W85A 4ZB2A 4Q4PA 1Z6KA 2BVYA 3PULA 1KXTA 1GQIA 3P5ZA 4QAWA 1GORA 1GUVA 3B8VA 1KBLA 3GDLA 1QI2A 3AMCA 2FGBA 3I6RA 2EPHA 3GXFA 3AHTA 4F8XA 3WUFA 3SAZA 2X1RA 1OC6A 4HSOA 3RPMA 2ZWYA 4F2TA 1FWHC 2C8NA 3C2YA 1PIIA 3P7YA 3K1DA 2GYIA 2QUUA 5A8QA 5A6SA 3B8WA 2VC9A 3K4WA 1TPH1 1JNDA 1FWCC 4O50A 1S2AA 1BD0A 3G77A 3CV7A 4Q7NA 5G4WA 3ZMRA 1VPYA 3DGRA 1TMQA 3DKJA 1SR9A 1RQEA 5CEWA 4WX2A 1EDGA 1PE1A 4GVIA 3UXDA 1QNSA 2BGSA 2PDJA 1IV8A 3ZR6A 2I17A 3P62A 4OUEA 1XIHA 5DMLA 4GUFA 1MDLA 2WZTA 5CLTA 5D4YA 1W54A 1UH3A 3CPRA 3R1ZA 1M7OA 4UZSA 1GCYA 3SGZA 3AFBA 5CLWA 4PFHA 2ZFAA 1MSSA 4D8LA 1KCZA 3FOKA 2WCSA 1H50A 2NWSA 1UH4A 5H8MA 1QFEA 5CCZA 5CJMA 3MWCA 4D6HA 2ABAA 2WVSA 1P5BA 3V5OA 3TEVA 3GE7A 3ARXA 3T2PA 2WVVA 2WKJA 1S38A 4C6PA 4HIBA 3B0PA 4CN4A 3Q94A 2P3ZA 3SW6A 1ITUA 3ITGA 2B7QA 2O4QA 3T44A 1U33A 3SI9A 3G2GA 2MNRA 2QUVA 2WNZA 3W2NA 3FVMA 3R5EA 3FX4A 1KXQA 3WBXA 1R3RA 1XQKA 3WQ4A 3WQVA 4Y8FA 3KTSA 4XSMA 5G4EA 3LD5A 1CB7B 3QLDA 3SQLA 4IQDA 2XM1A 5AYZA 4PB4A 3FV9A 3HQPA 4ATDA 4DO4A 1UC5A 1CXLA 1Q6QA 5FESA 2C7FA 4WJ8A 4K1WA 3LLXA 2J8GA 2G4FA 3MO4A 2FH8A 3CO8A 3LPGA 1BQCA 5CPLA 2VEMA 3TE9A 1W8GA 2HXTA 1SZRA 4U28A 3WK0A 5CC7A 3ANYA 2UY4A 3WH7A 4O0QA 4DXXA 1XIDA 4FK9A 1OFOA 2VGFA 1HP5A 4AZIA 4ACZB 3OVPA 3ALFA 4GLEA 4HPNA 1F6KA 2ZVRA 1QBAA 4AW7A 2ZA2A 1FDYA 2J8TA 3ZLFA 4XBSA 1A5OC 3WELA 3CEPA 4CCEA 3LENA 3VGGA 4YWSA 3W88A 2W9MA 3MKKA 3GXMA 4NNCA 2DSVA 4ZB5A 4AZCA 2E1DA 3HTWA 1W1VA 2V2CA 2CITA 4LALA 1QO5A 4BI7A 3HPSA 4RNIA 4AWSA 3W1UA 2FQIA 2P76A 4GY1A 2VQTA 1ZJHA 3VVGA 3UZXA 4AFYA 3QY7A 4C6KA 3FYPA 1RSCA 3GTHA 5A6JA 1IGSA 3GR7A 3SB0A 4Z1CA 4QG6A 4WKAA 1PYFA 2VGIA 3E9AA 1ZPTA 4YYCA 4U31A 2ZA3A 5FOOA 1OFAA 3LSBA 4PBGA 3V5CA 4UTFA 5M3WA 3STPA 2XVGA 4GXWA 3RCMA 1E0TA 3NOEA 4YTTA 4WGHA 1MRAA 3CYJA 1VS1A 4E38A 5CGMA 2GJPA 3TOPA 4CQ8A 3BSMA 1B4EA 3GB6A 2Y89A 1BPLB 1IEIA 2G0WA 4JNZA 1FQ0A 1L6WA 4R5EA 1LG2A 7XIMA 1TR9A 1OT1A 3KE0A 4NAEA 1Z3NA 4ONVA 1G67A 3M1ZA 1BXNA 4I6VA 4AXNA 2P5NA 2Y5EA 1EX1A 1VEMA 5C70A 3NZ1A 2J7HA 5EMKA 3FJ4A 1QI5A 2FGLA 3HA1A 4GGBA 1J79A 2CLEA 2D2JA 1RHCA 2C0AA 3UPBA 2X05A 4AIUA 5D33A 1VCFA 1XLDA 1FDJA 2YDRA 4JTFA 1SM9A 3VABA 2FGZA 4OQVA 3GR8A 4DPPA 4BF9A 5A6BD 3GLCA 4ICNA 1K9TA 4HHMA 5ABFB 1S3HA 3C0QA 1E5NA 1QATA 2NZLA 4LVAA 2ZYFA 4E2OA 1O7AA 2V3FA 2VEFA 3VOCA 1OX4B 1XLEA 3WFZA 2QIIA 4INFA 4XIAA 2QCHA 2JF7A 5LA2A 3K46A 4D8AA 2C1GA 2V68A 1CB2A 4L9YA 2QCDA 3CZLA 1TWSA 2HTMA 1GJUA 4YLWA 2CYGA 2AL1A 1BF6A 3CT7A 5EYWA 1FP9A 4H9YA 1V6TA 4CKQA 1YRRA 3S83A 4O12A 5LIXX 1VRDA 4A8LA 1VLWA 3GFYA 3PZVA 4Y8EA 2YFNA 3WQGA 3WL1A 2WOQA 2Z2AA 5EB8A 5JBEA 1IF2A 1XFCA 1MW3A 2GLKA 4FF7A 1OGBA 3AXHA 3ZWSA 3PZIA 4JN6A 3QR1A 3U9IA 1UR0A 4D1IA 3H2EA 1UJQA 3VKCA 4M7SA 1BYAA 1QHZA 3UJEA 2QVHA 2QMJA 3VNJA 2OX1A 3BPWA 1P0EA 5CSYA 3W22A 2P53A 3BAWA 2YCIX 1S2VA 4WUIA 2I16A 1WUEA 2A21A 2UWFA 3ITVA 3OJGA 3SBFA 3AALA 2A1YA 4Z42C 3R8HA 1QXLA 1S1RA 1HFBA 3B9NA 4E0CA 1E56A 1P0KA 1OFRA 2PDLA 3BICA 2C79A 4GZ7A 1GZGA 4KEZA 2PP1A 2OLAA 3BARA 4H7CA 4NNAA 4XVDA 4IGSA 1AW2A 4AHOA 3VGDA 3P8IA 3QPYA 5E5CA 1UASA 4AZ6A 1TUXA 3VC5A 1CYGA 3NZGA 3V0UA 2ZRXA 2Z7GA 1VHNA 3W7RA 2V2HA 1JZ8A 3WD4A 1JULA 3JS3A 3WF4A 1JCJA 3LCGA 2G3NA 1E9YB 1LJYA 4RXFA 1VEPA 5DXYA 3WH8A 3OG3A 4NHVA 2WCGA 3NXLA 3OIXA 1TPVA 1QW9A 1X1NA 4DBWA 2NQ5A 5DN1A 2YBVA 1XM3A 3LCHA 3XIMA 2ZZ3A 1BLIA 3L67A 1XDMA 2DUZA 3IRSA 3LBOA 3W86A 1G1YA 2VDHA 2YIHA 1KM3A 2VOMA 3ZYZA 3WDHA 3NZQA 1LROA 4QQUA 5K9XA 3V1HA 1ZJAA 5XIAA 3LA4A 1NIUA 1SO4A 5EMJA 5G4HC 4L4PA 3GWQA 3CAKA 2PWDA 1DJHA 1P7TA 2EG6A 1C7TA 2WKLA 4P7NA 1REQB 2GJLA 4ERIA 3DI0A 1N7KA 2EXOA 1H0GA 3M0LA 1QHOA 1ZHAA 2FB2A 1ZNNA 1NARA 3E96A 3E0WA 3KVMA 4GJIA 3QC3A 2DUXA 2PDBA 1M04A 1LG1A 3FYOA 5D30A 4CD7A 5HJYA 2Y0FA 3SECA 4PTVA 4AVFA 2VKZG 1NWSA 4B3KA 3EWBX 4S3FA 5E0FA 3HN3A 4B4HA 1FWJC 4F0MA 3K4DA 4LF1A 2WJFA 1IQ8A 5E1QA 4ZZ9A 5F2LA 3UNDA 3MUAA 2G41A 5BOOA 1RPXA 4IPJA 3KDNA 2OQHA 3V4BA 4LF2A 1WP6A 3WD1A 3VMNA 3V75A 5I77A 2EBNA 3UJSA 2YL9A 3KAOA 1UWTA 4IIBA 4N7QA 3UP8A 2ZBTA 1GTHA 4YCOA 1HIZA 1H7PA 2JGQA 5D8WA 5BCAA 1ZZMA 2I1OA 3WL0A 4PMUA 1VYRA 3ZQ9A 4JTUA 3M5VA 2R6OA 4RNJA 2WVVB 5E9AA 3XINA 2VCBA 1HKIA 1DQUA 4MY9A 4CEXC 3EMZA 2BP1A 2PEVA 2YL6A 2ALRA 3KL5A 3TJIA 1UR2A 3RGTA 1W1B1 1G7VA 2Z27A 5IBXA 1JZ5A 3AIQA 2ZUMA 1R6WA 2BHUA 4FXFA 2D1ZA 4G1NA 1Z7AA 2E67A 3TTOA 3WNPA 1EDQA 4CQBA 2YX0A 1Q6DA 3L4ZA 2J8FA 4DN1A 1OD8A 4DJEA 1KRAC 1YDOA 4Y7EA 3EDFA 1Q7ZA 1RK6A 1R8LA 3BQ6A 3NQ8A 2YZRA 2J78A 4U5IA 4YCPA 4GVGA 3T78A 2XSXA 2FZDA 4IFKA 1OGSA 3W7DA 4HJWA 1EGZA 3AZSA 4QTGA 1HXJA 1J18A 1IIHA 1WOAA 2V0TA 4DNHA 1YEYA 3BG9A 3B9DA 5HR7A 1BRLA 3HURA 2C16A 4RDYA 1LRTA 2C6QA 3FFSA 3GDTA 2ZZ2A 1W9DM 3H4GA 2TMDA 3W72A 1FHLA 2I9EA 1G6CA 1ZAIA 2PI6A 4WQ6A 5HQEA 5DMMA 3THUA 2A3AA 4P8VA 3O8AA 1OX6A 1JUKA 3WX7A 3G5EA 2Z6JA 1LM1A 3W1LA 4DI9A 2INZA 2OLHA 4GYKA 3B0YA 3QHMA 4AZCB 1DWAM 2FHCA 1FWEC 3GDRA 2WM1A 4FNUA 3MW7A 2ZIDA 4G6CA 1OFBA 3NTYA 1WCGA 3W81A 4YNGA 3ZJ8A 3KLKA 3EPOA 3O1NA 3FIGA 3LRKA 3WQ8A 5T8GA 3L4WA 4FIRA 4YVPA 2QV4A 3VK5A 4BEUA 2XYLA 4XSLA 3CC1A 2E9BA 5LZLA 3ITCA 2PDKA 3SRFA 3WUEA 3EDEA 3G3DA 4IIGA 4UQCA 3H12A 4AEEA 3BG3A 2E8ZA 2CBUA 3LGDA 3PK7A 4HK5A 3M6YA 1EUNA 4NRSA 2DZVA 4W84A 1N55A 3VIMA 1KW1A 1J0HA 2E68A 3ZM8A 1U30A 3SUVA 2VZVA 2E9MA 3FHQA 2W62A 4IGNA 1EPXA 3LCLA 3QYSA 1UIPA 5FJTA 1VFFA 4ECLA 1TELA 4GD0A 4XZLX 4NAEB 2HBXA 5BNKA 1HGYA 1W32A 1YQ2A 3SFWA 3GRIA 1JEZA 5LNRA 4TX9A 3PBWA 4GYFA 2XDFA 4JQ2A 1DYSA 2AKZA 3PFRA 1TQXA 4NILA 3D46A 2J74A 5ENLA 1UZ1A 2YCJA 3L21A 1YPFA 3MDWA 2BFGA 3MSRA 5I3JA 2CHOA 2FHBA 3GBEA 3PBVA 1DP0A 2CC0A 3W7PA 3RF9A 3GVGA 1H5YA 3QHOA 1M1BA 1DJZA 4RDWA 3I68A 2CLIA 2BWGA 3DFPA 4GKTA 3PTKA 3LMZA 3JRKA 3P84A 3F4WA 2VJXA 1AODA 2CNCA 1HL9A 3IAPA 4B16A 4OTKA 4R3UA 4H6KA 1BWKA 2YBUA 4AD5A 1PTDA 3KOWA 4DLMA 5B80A 4P5UA 2WC4A 4DBUA 3KHDA 4NI3A 2V9DA 2QCDB 3E38A 1JRCA 3DIPA 2Y7GA 4AX6A 5GQBA 3HIJA 2Y8VA 4ZOCA 4X60A 4K2SA 4PZVA 4JTRA 3GG1A 4IMFA 1FH9A 4M6UA 4L65A 3TQ0A 1UMYA 1X7FA 2XFWA 2V67A 3OQEA 3F03K 2F8QA 4D9PA 1JRBA 1QWKA 4QQ3A 4O1AA 3BLEA 3IARA 1R3TA 4XKYA 3GHRA 1QJWA 4XV0A 5L9FA 3W7HA 4BWLA 5D8ZA 4M29A 2Z26A 3S2CA 2C13A 1DORA 2Y88A 4CNUA 3VCCA 3WLTA 4HMCA 3WDRA 4O14A 4HHHA 1KFEA 1Q45A 1KD0A 5G1MA 5GNYA 4KWUA 4HA0A 3ONBA 3N12A 4C7DA 3LTPA 1GPFA 3TR2A 2YBTA 1FBAA 5ABEA 1P1XA 1TV2A 1JCXA 1I2RA 1EC9A 3F4NA 1UMLA 4UTJA 2YCEA 4IFRA 1CGXA 3ITOA 2O7SA 1K03A 3A3XA 2HDJA 3CMFA 1CBGA 3NQ6A 4F0KA 1ZBKA 2PRHA 3ICJA 1V3HA 4NL1A 2WAGA 4QE4A 1I0DA 1UKQA 4N02A 4F66A 4WY0B 1ENUA 1ECEA 2CKRA 3M43A 1TIMA 1VFOA 5H8UA 1JCTA 2DIKA 4EPKA 5C9WA 4UTTA 1N8WA 2V5LA 3U2ZA 4OV9A 3BK0A 4FOUA 4MB1A 3WH9A 3A21A 3P82A 4YXGA 4GUHA 3USBA 4MKNA 4M51A 4XZIA 3IIZA 3H2FA 2YKKA 3SCWA 1ONRA 4HU0A 4J35A 3BW2A 5FJPA 2CLOA 1I75A 4IISA 4Q3MA 4WY0F 1AW5A 3AIWA 1UP3A 1LOLA 3IUHA 1FWFC 1PDZA 3R0KA 2FIQA 5AOUA 2R94A 2YXOA 4RPPA 1BTMA 4O0ZA 4FALA 1JZ6A 1YNPA 3KM8A 4NAFB 3PUOA 2KZHA 1NSJA 4IF2A 1XLMA 2ZE3A 1J6OA 1W3HA 2WC7A 1E43A 1SR0A 1ICQA 2G95A 2XVLA 2IKIA 1G0CA 1ONWA 1TA3B 2O7QA 2QS8A 4XBKA 3OA3A 1A5CA 2ZRYA 2VEPA 4ZL1A 3OBKA 3KBJA 4NG3A 1ISZA 3AJ7A 1IEWA 4AZHA 3W71A 3EX1A 5J5DA 2KAUC 4WKHA 3MHUA 3PZNA 1W9VA 1Q6LA 2XH0A 3LXAA 3N19B 3EWDA 4XTIA 4OUIA 2VWTA 2F38A 2NV9A 4PCTA 4C6OA 4E8GA 2BZNA 2FMOA 3N2XA 3FLUA 2DV0A 1JYNA 1TV4A 1UD6A 1UP2A 4BF7A 4A22A 3RPTA 1F8MA 2ADAA 1P6WA 2PD5A 1Y8BA 2PTWA 3BH4A 4HNTA 2BOEX 1CLKA 2Z25A 1CPUA 4AB4A 1KKRA 1O5KA 4S3EA 4FNSA 2OYKA 3TYCA 2JQXA 1B5TA 3SR7A 2F84A 4PBFA 4DUVA 2ZDSA 4JFTA 3OZPA 2G3JA 1JDDA 1EDTA 2G3IA 3SQSA 4N9EA 3W75A 2E7FA 1W17A 4CNNA 4Q4KA 2ZDRA 2FTYA 4PUWA 4M6PA 1J12A 3KBMA 1V03A 1PKYA 1UR3M 3WFLA 2W92A 1W0MA 4ALDA 4DJFA 4H9MA 5FD0A 4GX9A 3A6OA 2WO5A 3PJTA 2X7WA 2V3DA 3DGBA 1D2KA 3M64A 1X39A 1OABA 1M68A 2OVLA 4MMWA 3W37A 3DC0A 3QSTA 4FLSA 1V3LA 2R1MA 3BG5A 5FJOA 3VDGA 3SRHA 1SO5A 2D2GA 2PZNA 1IXPA 4LSBA 4E2VA 3B4YA 4Z0SA 4C7GA 1ESWA 1JCYA 2G37A 2OX4A 4NNBA 5JMUA 5DY2A 1LL7A 1J5TA 3GNNA 1PKMA 2Z1VA 4HYWA 3B40A 1AD1A 3B03A 4JGDA 1NP0A 4IFKB 1KC7A 3ZFHA 3WQ5A 1IEQA 4EAYA 2RGMA 1XIMA 1E0WA 3OGVA 3PWIA 3WSUA 2VOTA 1NY1A 5EY5A 5DMNA 3EWWA 5GJPA 3QY8A 1I45A 3L0GA 4LQ1A 1ZFJA 4M5PA 1BRLB 3FDKA 5FA5A 1CNVA 2QCFA 3AXKA 3QBUA 4PUJA 3W0KA 4ICCX 2D3LA 4F9JA 3VZXA 2BDQA 2NSOA 5MKGA 5C9UA 3LX9A 4M6VA 1GQKA 2DZAA 2GQ8A 3ARRA 4M1RA 3M07A 2E4TA 1J9YA 3HPAA 2DSZA 3N04A 3NOYA 4US5D 2A2IA 5C7VA 3RU6A 4MUZA 4N9DA 5LA1A 3B05A 1V3MA 3W7EA 5DCBA 4LS2A 4NZFA 4DUWA 2IXVA 2OT1A 4OIFA 2WMKA 3LY0A 1A4LA 3JZUA 1V3JA 3WLSA 5U7SA 3PUGA 2D24A 1FX6A 5AC6A 3I7QA 1QVBA 2C0HA 1VBJA 4TTGA 5CGQA 2J7EA 2CESA 3GC4A 1XLJA 4Q33A 4JKMA 1OC5A 2PMQA 1RPKA 3H54A 4RE4A 1EJ7L 4E4FA 2XIJA 1ZCCA 1TTIA 1R5YA 3IVUA 3TC7A 3EKGA 3WEMA 3GZ3A 3C5QA 4FLRA 2QJGA 2FPYA 3RRXA 3ITTA 2VR2A 1V6XA 4WF7A 2XISA 1HP4A 5BXRA 2NV1A 4F0LA 3VX1A 4NZ4A 1C8YA 3IJQA 2E1WA 3E74A 3BGJA 4BR1A 1M53A 3VIJA 1U5HA 3UA4A 4P8UA 2G96A 1VBGA 1F3EA 2DT1A 4XO7A 2X8RA 2J62A 1KFKA 3QW3A 4AIOA 1GEQA 3BAIA 1XCWA 2DT3A 5HNTA 2Y5JA 1IIGA 2F2KA 2BX7A 1JG9A 4O1DA 3T0BA 4U5KA 2QJIA 3LI0A 4FMVA 1OG6A 1C8XA 3OYZA 1QPOA 4AXKA 4QG9A 2V5JA 4QJ5B 2BY1A 2E8YA 3PJUA 4US6A 1D9EA 2W61A 4O54A 5M5DA 5BRQA 4IIDA 3L4XA 3N6HA 3Q58A 2FVKA 2J47A 4HZ6A 3VGBA 1MFUA 8RUCA 1C7SA 1E4IA 1LCOA 2WLZA 2D0HA 2GQ9A 3GYEA 4XTDA 3BDKA 1NWRA 3LM3A 1S5NA 1TREA 2X0SA 1I6NA 1C9DA 3E3HA 2BS9A 1VFLA 3PR2A 1AH0A 5A6KA 2NVAA 3WDIA 3MUZ1 7TAAA 4E3VA 4K1GA 1TJ2A 3QZAA 1MDRA 1HW6A 4UNKA 5J04A 2OO0A 4A3YA 4KQNA 4EF8A 3HB9A 1QCWA 2HS6A 1EQPA 3IVTA 4UXDA 5BRBA 3W7JA 2X7VA 4WHBA 3OZYA 4DAIA 2X16A 3EXSA 2PDUA 2WZHA 1H1YA 1QPRA 3N25A 4Y90A 3FY1A 2C91A 2ATSA 3WD3A 3W1PA 3W2UA 3O6CA 2J77A 2FZBA 4JTEA 3EWCA 1I8JA 4N2YA 1OBAA 4XD4A 4ZXOA 4PFMA 3T2OA 3F5JA 1DIOA 3H2NA 3R10A 3G1AA 3ZSTA 4UR8A 2V6AA 4S3BA 2CWXA 3F4DA 3T4CA 3BLPX 5D9OA 3QR0A 3TTEA 1XYZA 4R7WA 3FW6A 2FVLA 3GTIA 4R9XA 5EBAA 3NEHA 4EF9A 4H2HA 1KFWA 4H04A 1IR2A 1RBLA 3IGSA 3QOMA 4EXBA 2W91A 1R2RA 4P7OA 2DORA 3I4KA 4HK6A 2E28A 5F4SA 2HRWA 2ZICA 3GC2A 1HJQA 1E0XA 5TF0A 2HVMA 2NQJA 2VTFA 4BZYA 1WX0A 1IT8A 1WNOA 4E5TA 2OPJA 4QE5A 4ZCWA 1M7JA 1EJUC 2VHLA 1GOXA 1GVEA 4HPXA 3QMRA 5LSMA 4RUBA 4QX4A 4BQ2A 3AXIA 3WF3A 1E1CA 1F9CA 4GWEA 3GZAA 1H51A 3URQA 3MMWA 4DHGA 2GSHA 3SIZA 1US3A 1KBBA 3E1F1 3AS1A 2XZ9A 3S5ZA 3W02A 3ES8A 3HPZA 2ZZ1A 1B3WA 4I9MA 4JY8A 4C60A 3TSMA 1FHUA 2XH4A 5ABGA 5AC4A 5CH9A 4P7QA 4FS9A 5LA0A 3TOYA 3GNOA 3TH6A 3MVIA 1NOFA 2BNJA 3M6DA 2POZA 3O6DA 4UOJA 4ASTA 1H60A 1E71M 4L6OA 2WMFA 3UXLA 4Z1AA 4PMZA 2PDWA 1XYAA 4NYYA 4WSJA 3WN6A 4W93A 4FB7A 2E5CA 3TYUA 1EGMA 1W1YA 2BXYA 4S2BA 4XZHA 3CO4A 4A8IA 1TMLA 2A6NA 1WDWA 4UQDA 5HOSA 2PTXA 1MXDA 4C7FA 4C6QA 2QJHA 4MTVA 1UC4A 1EO5A 3IJDA 2XM2A 3UQNA 3BGGA 3TTYA 4QXIA 1QOXA 4XD6A 4X0VA 2R1KA 1B3VA 4AUBA 4Q4MA 3M0HA 1XW8A 4Q8NA 1HG3A 5JQ9A 1TPFA 2QGYA 4OE7A 3W28A 4KEVA 1NFBA 3S9YA 4HNLA 3FKKA 3KTXA 4JTKA 1QNRA 4G5DA 4O18A 3CZ8A 5GNZA 1OVDA 2ZADA 3ID7A 4TUFA 3NL2A 4N4PA 4KCUA 4QBXA 1T5AA 4DF0A 1MQRA 4W86A 5DBTA 3BGAA 1K02A 1MW0A 4I6KA 3A24A 4ZBCA 5A8GA 4QG8A 1J6PA 3CUGA 4JTLA 3L66A 3NR0A 4HOWA 1NDYA 4I9TA 5CJ5A 2PCQA 3HU7A 4MJZA 3RCYA 3W25A 5EGRA 3RO6A 5C71A 3CUXA 3S8HA 2QW5A 1G4TA 4PTWA 1DJNA 4K8HA 2WQDA 1V02E 3MDUA 1P0NA 2AMGA 4W85A 3TNOA 1DE5A 4AF0B 5CAHA 1WO2A 1JAEA 1XYLA 4UTMA 1QHPA 3NSXA 2WWCA 1UKOA 1SQ7A 3UWWA 3O0FA 2DPEA 3U2OA 4Z0JA 1C90A 4M82A 4XZ9A 3OW1A 4EXAA 2RDWA 4DO6A 5CZ0A 3FA3A 4H6EA 4HCHA 5TIMA 2FJUB 1JDCA 3RM9A 1EO7A 4IQLA 3NO1A 3W1QA 2QV5A 2Z29A 1ZJBA 4WOQA 4HU8A 1VCVA 1MXSA 1Z32X 4TIMA 3UNTA 3DAQA 4FA3A 3PC0A 4HA4A 4HNUA 3QFEA 4LAMA 4NUWA 1ISVA 2QNEA 5J8LA 1BWVA 5M03A 2ZUWA 4GYPC 2IKJA 2QQ6A 2WHMA 4PSPA 1Y7VA 1NDVA 4PTNA 4YIWA 1BG4A 4DZHA 1W3JA 1SFSA 4K6AA 2Y7EA 2X30A 5E0CA 3AAMA 4N4QA 2FHFA 4B3LA 5JXQA 2O9PA 3PZTA 4JFVA 2OWWA 4FLQA 4V27A 3VIIA 1T96A 3DH7A 3AIVA 4Q8VA 2NUWA 1HUVA 3KVKA 4MZYA 1ZUAX 1UD3A 3WKZA 1R0MA 2DGAA 3S0CA 1GVFA 3C2FA 3O0KA 4ZVJA 1L8NA 3R25A 4MKSA 1UKPA 4Q4QA 2E6FA 3N4EA 3GG8A 2FVMA 3LMYA 3ARVA 3EOUA 3UEQA 3VIFA 3R0UA 3VAVA 1CXIA 1DE6A 1LLOA 3QZ6A 4QIUA 3TYDA 5CBJA 3HGOA 5KZDA 4B90A 3GVQA 3AZTA 2H3BA 2QPUA 1NP2A 3DN5A 4O28A 1QI3A 1E3ZA 1VJIA 4D72A 1VIWA 4IMCA 4PCPA 5PTDA 1XC6A 4OBSA 3ARZA 1KTCA 2Q6ZA 4FO4A 2GK1B 7REQA 1PCKA 4N6FA 2CLKA 2CLMA 2JIWA 4S1FA 1BEUA 2R8WA 5G2IA 1LTDA 4MWAC 3IPWA 4JIHA 6PTDA 1WZKA 3MP4A 4HN8A 4FOJA 4XQ6A 5FJUA 3S6DA 3BLFA 2VR5A 4HD5A 1N82A 4CCZA 1YXYA 1NF7A 4WSHA 4NKCA 1UWUA 1L6SA 1KLZA 1Z41A 3JUGA 3RMJA 5CPNA 3N11A 1KQYA 2RJHA 4S3GA 3SQMA 1W56A 5CBIA 2OT0A 1AA1B 1XLLA 2A7RA 2OWCA 1A0EA 1JXKA 4B5SA 4H3DA 3GHUA 3S1GA 3ABRA 4V2XA 4CCDA 2WB5A 3ITXA 4PTDA 1RP9A 2AKMA 3CM4A 1S2TA 4GQGA 1V0KA 1EIBA 1J0IA 4LAZA 3KCOA 1TMHA 4HTYA 2OTDA 4OV4A 1JZ2A 4PEEA 3RX4A 3WH6A 3F5LA 3WIJA 2HV5A 4CVWA 1U1JA 1A53A 2Y4SA 1BTCA 1KFCA 3U2CA 2VVNA 3DENA 2HPMA 4JL1A 3IJ7A 5JIPA 3E0LA 3ME3A 3NA8A 3EX2A 1O1ZA 4FNTA 2ZRVA 4IMEA 1DTUA 3ZR4A 1Q6FA 1ZP3A 3IAQA 1DXFA 5AYIA 2Y70A 4LNYA 4IFOA 2D0GA 1A3WA 1FKXA 3SSJA 3CIWA 3BTNA 4XKMA 3UWVA 2QJNA 3M16A 4U2YA 1SUXA 1HJSA 1ZAJA 4FF5A 4JBRA 3CPUA 2CEQA 4NJJA 1VCGA 1XH1A 3W26A 3L4YA 4H1ZA 4O53A 5FF0A 2BSLA 3R2GA 2A3LA 3AI0A 4HP5A 3TC3A 1Z89A 3DBPA 1LOQA 4TOQA 1UA7A 4MG4A 4HA3A 5EU9A 4DWDA 2ALDA 2QLYA 3W6MA 5BMWA 4NZ5A 1IEXA 4AWTA 4H8VA 1YXDA 3DX5A 2IUZA 4O52A 1GZJA 1Y0EA 1EJSC 1WXJA 4GX8A 2PTYA 3ZR5A 3A5VA 4PEKA 1AJZA 5I06A 4UTWC 2FKPA 4FSAA 5DXXA 2VFHA 5AHMA 2XTKA 1IGWA 3M5ZA 3OVQA 4Q4RA 5JUVA 4BA0A 2ONEA 2QEZA 1SZGA 4QROA 2GSEA 3EB2A 1DJYA 3COTA 2PF8A 4ZMGA 4EAMA 4DBEA 1E1CB 3WMSA 1OF8A 2WW5A 1QT1A 4CQAA 1A5UA 3WBAA 1A80A 1TRIA 2Q09A 1JF6A 1UZDA 1W5OA 3MCOA 1WKEA 1A5LC 5AN7A 3OLGA 5M2FX 1X8FA 2Q71A 4H9ZA 1W8SA 1S5VA 2WZEA 4CN1A 2YDAA 1K9DA 1K8ZA 4MNKA 1XIJA 3ZIZA 5CC3A 3CPGA 4H19A 3AU2A 1S5MA 3AOFA 3REQA 1W9BM 1EH9A 1GYMA 1YTKA 1X98A 4UQBA 2BG5A 3IJ6A 4A3HA 1L2UA 3NZRA 4NQ1A 2DY3A 3PBYA 3BJFA 4Y96A 3NL5A 3BOLA 5I7GA 4GI4A 3NGFA 4KH2A 5E6ZA 4G1KA 3TLQA 5I23A 1OJXA 2DSKA 3VGHA 1QPNA 2OXNA 2QVNA 3QXBA 3URBA 1B4KA 1QW7A 2E09A 5LHEA 3QV8A 1UUQA 4QSFA 3TXZA 2QUTA 4RX0A 1B54A 4B2DD 3EDDA 4Y2WA 3T05A 3GNXA 3M0ZA 4IIHA 4Y9MA 2HMCA 2ZUNA 4QGCA 2AGKA 1TE1A 1ZENA 4EVZA 2D3NA 1VJSA 2C19A 1PEZA 5D2WA 5CC5A 5EKYA 2FMNA 2WHKA 3GIPA 4YYFA 1JCLA 3B9EA 2VX7A 1JYXA 3VPLA 5J5RA 3R8RA 1XGEA 2BHYA 5LNUA 3O07A 3UXAA 3CHEA 1CGVA 2PDXA 1PKLA 3HJZA 4LY4A 2W67A 1AW1A 3AO0A 3DFNA 1NF0A 1SMDA 2G4JA 7ODCA 2XN0A 3UR8A 3LQLA 4IMAA 1IWPA 4GC3A 1BKSA 4MWAD 5D05A 3P67A 5G1YA 3W1TA 2FPTA 1UWAA 1QNPA 4AZ7A 1UJPA 2HK1A 3BL3A 3E02A 5LNVA 2X1IA 1F3TA 4AY7A 2QUMA 1F74A 3WJSA 3UJ2A 3OHIA 1T99A 3L0KA 3LGEA 3PAJA 2IKGA 4JNMA 3VKKA 4RE2A 3CASA 4Q6XA 3SJNA 1JDAA 1RALA 3R6IA 4QM1A 2G5WA 1AQ0A 3ANUA 3SIMA 2GJXB 2Y5SA 1A47A 3LZ5A 4W7VA 4QISA 3AIRA 4DQWA 3TW9A 1POJA 3E2SA 1Y65A 5B7YA 1RQBA 1H09A 2BY3A 3TAKA 1CLXA 1GKQA 3VC6A 2ZTJA 3ZWTA 2CU0A 4V1YA 1PAMA 4RXGA 5BMXA 3I7RA 1MEIA 3CV6A 1RVGA 2BV9A 4BKNA 1JUEA 1JPIA 3HGJA 4AX7A 3CS2A 3BMVA 3M7WA 1VD6A 3WNNA 3MCNA 3FNDA 5GNXA 3VIOA 2C18A 1AL8A 1J0ZA 2ZX6A 3V3WA 3A4XA 4GMEA 1JAKA 1V3IA 4ML4A 3SUUA 1W31A 4RKAA 5HMSA 3C2OA 2A7PA 4HMDA 5CAKA 3TV8A 4O8AA 4DJDC 5FSEC 4QJ1A 1E6QM 3RLVA 4S3KA 3IIVA 1ME9A 2QAFA 1QU4A 3OVRA 1KTBA 2I5IA 5G5IA 3LNPA 4GQRA 4AZGA 5K3VA 2P0OA 4ZO9A 1HTIA 4L6HA 4J3UA 2I57A 4LUTB 3B0UX 2IQDA 2X42A 4Y9NA 3L2LA 2GVJA 4Q8UA 1E4MM 4FEZA 2V63A 4IGMA 2QT3A 4PE8A 1KM1A 4MJ2A 1DHKA 3OIHA 4J3ZA 4MYAA 1JQXA 5H91A 1OZMA 1MO0A 2RHGA 3D0CA 4GNVA 2B4GA 4GCXA 3ECQA 2ZUSA 3G0UA 4A21A 1EEPA 3S42A 1ME8A 1TWZA 3MO7A 1MRQA 1SSGA 2B7OA 1K8CA 3G1HA 2DP3A 1DIKA 3GTXA 3UY8A 4GH1A 2VUYA 2X2GA 2NSXA 2VX6A 7REQB 2PPGA 2V30A 1F4HA 5EA9A 1A5SA 1KA9F 5FI8A 3UA3A 4O0KA 3A12A 3L2MA 5KZMA 4F40A 3WYZA 3IEBA 4MZ8A 4DXVA 4KCTA 1YTEA 3HBLA 4DB7A 3BLDA 1HF6A 1VP5A 3WUBA 2QKFA 1SFJA 1T6MA 3TQKA 3JZEA 3ZSSA 2XZ7A 3EKLA 4LPCA 1FFQA 5I78A 2PWUA 5REQB 4G9PA 1V6WA 4LAKA 4WDWA 1ISWA 3S2LA 5HANA 4LTSA 4WDUA 1E5JA 3DESA 4EANA 1G7UA 2VFFA 3VNKA 3CUFA 3T0AA 1WPCA 3CWNA 5D9NA 3EX3A 5FAJA 4QITA 3O63A 3R12A 1SVDA 3SRKA 5AYYA 1E4LA 1XV8A 3LZ3A 3G24A 1UQZA 3AZRA 4AD2A 4DM1A 2ESCA 3DEQA 2DZBA 1BGAA 3DERA 2YXXA 1MEWA 2FZ9A 4CU8A 2CHNA 3ZZ1A 3CHCA 4HZMA 4CCCA 4QHRA 4RZ4A 1EB3A 3PB2A 1QTWA 4YPJA 1XIEA 2HZGA 3WNKA 3HG5A 1J96A 1Q4NX 2FYMA 1YPXA 5D9MA 5LXXA 3WLKX 1PUDA 1TYGA 1Z9AA 3RLHA 3B4UA 1TCDA 4UUIA 5LHFA 5KITA 4GQBA 3GD6A 3W27A 3W9ZA 2XVKA 3S5OA 1CGYA 3ARPA 5AKQA 3QTPA 4OECA 4EWJA 1FWRA 4MNMA 1Y5VA 1MVYA 3VTRA 1EXPA 4FR6A 5AHLA 2EEXA 3GK0A 3GAYA 1XRTA 5E6YA 3L4UA 5CG0A 3N3MA 4UFJA 1K9FA 4LBRA 3E6EA 1CENA 1UH2A 3QMSA 3B8UA 2TODA 4PMOA 1XD0A 1Q7MA 4CNTA 3QEZA 3DG7A 4PBEA 1FCVA 3NQGA 4QNEA 1EOKA 1S5TA 2QCMA 4KFPA 4GINA 5CSSA 4FAMA 3S1VA 3MWAA 4UNLA 2ZRWA 4IM4A 5HNRA 5A6AA 1YYAA 4JTJA 3ORWA 3EZ4A 4ZXLA 2FJKA 1CCWB 2J66A 5D2YA 1GJPA 3H26A 2XIIA 5ABFA 3T7VA 1ZP4A 4YWIA 1HKMA 3MS8A 1KWGA 1E1FA 4QJ3B 2XFRA 4MDPA 4NZJA 4ACYA 2PWGA 3S1UA 4HNNA 5D09A 2HNEA 5DF0A 3D3AA 3O15A 1O1HA 5XINA 3GAKA 1PZ1A 5CXPA 3B3DA 1EA9C 4W89A 1TJ0A 2E6YA 2HCVA 3VD7A 1OFQA 4PMYA 3SEPA 2R1PA 4GBDA 4ZO7A 4C5ZA 1FWGC 1RA5A 4UZUA 3IJ9A 1MUWA 1I0BA 2E5BA 3G22A 1EFZA 4G2DA 1RBAA 4QEHA 1QO2A 4H2CA 4UR7A 1PPIA 1OK6A 7TIMA 1FFRA 1DQXA 1QAPA 4C1NA 1JJKA 1XISA 5DFAA 5I09A 3QN3A 4KKXA 5E70A 1V3KA 1LQ0A 4HNCA 2Z1WA 4PSRA 3QV9A 3ARYA 1ICPA 2OYLA 2I5QA 1FY6A 4H4IA 1OY0A 4GFSA 1EP2A 3LLFA 4GOAA 3O9NA 2RJGA 4RLIA 1GOWA 4DJDD 1Q8JA 2WM0A 2GJRA 3P60A 1KFJA 4CD5A 3V0TA 3TW7A 4DO5A 5D2TA 5C9RA 1GOQA 3BAKA 4XISA 3NPUA 3FJNA 5B7ZA 1PHQA 3P14A 3MJMA 1Q13A 3F2DA 4J40A 3TYEA 1WBHA 1GQNA 4JFSA 1V02A 3W7MA 1CTNA 3A23A 3WLQA 2V5DA 3E0IA 1F3WA 5C0QA 4KRUA 3H2OA 1TVNA 4F2UA 4JTCA 2AGTA 4JEQA 3EDKA 1OC7A 4OOZA 1SZNA 1DPMA 4WK9A 3O06A 2GOUA 3R43A 1H11A 4UC5A 3GW0A 2QCNA 4BI5A 1PS9A 4KBXA 2JEQA 4B5XA 4FPSA 3ABOA 4YU1A 1HVXA 1LBMA 3OP2A 4KRTA 5E0KA 1D7FA 1UZHA 4LW7A 4ZQRA 2EKCA 4XUYA 4KFNA 4W9TA 1REQA 3KS6A 4QCFA 3W7CA 4O4VA 1HVQA 2FZMA 3MTWA 3WLJA 3KTCA 4LNCA 2PGRA 2OSYA 4J3SA 3BJSA 1H61A 1VFUA 1DWHM 1TZ9A 4D6IA 3RO8A 1ELSA 1HO1A 2V38A 2GWNA 3S2NA 4LBUA 4LS0A 2O56A 1CZ1A 1J2WA 5I0DA 5D04C 2A0NA 4RE3A 2A85A 3TCEA 5FF4A 3HJEA 4HZ7A 1H4PA 1FWDC 1XBYA 1Q66A 4P8XA 3CZEA 5MF5A 3PM6A 4H41A 3A4JA 1J11A 3EOLA 4UQEA 2V5CA 2WZMA 1WKFA 1DJXA 3A13A 4TV6A 2GPTA 3LU2A 5DCEA 2CPUA 3CHDA 1PTAA 3EOEA 1X97A 4DUXA 4MY8A 5ABTA 4ERGA 3EOSA 3QPZA 4WR3A 2R24A 1TX0A 4MPKA 3GH4A 4N6EA 1ZBWA 3CB8A 5F4XA 2EKGA 5AYBA 3M46A 2WSQA 2PDQA 4ADSA 4RE0A 1XKJA 3N17A 1P43A 1JGIA 1I9CB 1KV8A 1W1A1 1TV5A 2CFFA 4D6DA 4PB3A 3BZGA 1G5AA 2Q01A 5I24A 1A5BA 3LPFA 4BS0A 4ZQCA 4MSSA 3QLLA 3CBWA 2IKHA 2YDSA 2ZC1A 4JCLA 1TPUA 1VAHA 2J13A 4I8YA 3ELFA 3HGSA 3CUIA 5I2UA 4C6DA 3DG3A 1JFXA 3POCA 4W8BA 5K9DA 3NQAA 3UZWA 3ZT5A 3IJ8A 1E70M 3A47A 4HHPA 1UD8A 4S39A 3AJXA 1KBJA 3W74A 4FHAA 3F2BA 5HQLA 1DXEA 2YDQA 4X9SA 2WNQA 5FSDC 4HSNA 3UCQA 2VQUA 3N18A 2Q8LA 1PZ2A 2X0HA 5M1TA 1CI1A 3IIXA 4HA1A 3GSMA 3S1XA 2HXUA 4P7RA 1QRQA 5HXMA 2YL8A 4I7UA 3MP5A 5DRIA 3GKFA 3VM5A 3CIXA 3W87A 4GJJA 1U1UA 1ZL1A 1V0NA 3CEUA 1GK8A 1XRSA 1XLGA 5GJNA 2OMAA 3UYIA 2JKAA 4GYJA 3N13A 4QDPA 4ERAA 3B0XA 4GO8A 3ZT6A 3BOFA 5F2IA 2D73A 3UG4A 1Q6GA 1FCQA 4OBRA 1PDYA 4LV9A 3TK7A 3VE7A 2QUNA 3MPGA 4AMCA 2R1LA 3BE7A 1B3XA 3DDMA 4KEMA 3ZLGA 3WMCA 4DF2A 3NYZA 4QLJA 3CWOX 4FI4A 3CH9A 4X2PA 1ZJIA 3ENLA 2J75A 1XINA 4N42A 4U4MA 2H8XA 4ILSA 2WV8A 3ZLHA 2ZRUA 3H6OA 3NAVA 4K8EA 1W2VA 1W91A 4D6CA 1LLZA 3LLDA 5DMYA 3UR7A 2GL5A 1W5NA 2FH6A 3W1RA 2ODOA 2BVTA 3NO5A 3HFYA 3H70A 4D6EA 3KOYA 1L0PA 1KKOA 4C6EA 4HK7A 4O1CA 4O4WA 4GISA 3LXBA 2ZXBA 2CXEA 1I1XA 2VC7A 3DOPA 1D7KA 3AS3A 5CGTA 1AZ2A 1D8WA 4CLMA 2QCCA 2WLYA 4IUOA 4O11A 2I9UA 1OYAA 1R7OA 1TPB1 4DBSA 2AQVA 3WQFA 1FHVA 4B9ZA 3IV8A 1KQZA 4NJIA 1T41A 3PZUA 4JFWA 2VENA 1TIWA 3W7NA 3EB4A 3LTSA 3MT1A 2OEKA 1R3QA 1KXHA 5DQPA 3LK6A 1UG6A 1GJWA 4QDMA 1H1NA 4I7WA 3KRSA 1US0A 1XIFA 2FLIA 3EMCA 3UWQA 3PY2A 4QEEA 4F0SA 4B91A 3SCTA 3NM1A 4JHZA 1TWWA 3GH7A 2PLKA 1HT6A 4MAZA 3HFTA 3TDFA 2Z0IA 1KM4A 4R88A 8XIAA 3SO7A 1MW2A 4Q8MA 3T0TA 1FUYA 4DVOA 4Z2LA 3NCOA 8TIMA 3DFQA 1H5VA 3VOGA 2P50A 4JDBA 4BHYA 1P0DA 1VPQA 3N15A 2PWVA 2QDEA 3E2RA 3IIPA 2VZUA 3NDZA 2VXNA 3L12A 1UB3A 1JZ4A 3ANVA 4YN5A 3SCOA 4EACA 4F79A 4GIEA 3DUGA 3TWAA 5D02A 1MYRA 1PKNA 3AIBA 1KGWA 3B8TA 3VDBA 1GKPA 2V5KA 1M7XA 4WKFA 4RW5A 1QOQA 1QMLA 3W7LA 2VP8A 4NU7A 2BOFX 1UBSA 4Q7IA 5FF3A 4EOUA 4NP7A 1THFD 5HJXA 3MSDA 4FP1A 2V3GA 4F0HA 5KZEA 4H00A 3GNDA 4HB7A 3SJ3A 1H62A 3VI2A 3WF2A 1Q2SA 6REQA 5FEWA 3TN4A 1TV7A 2WKGA 4R53A 3HF3A 3VE9A 3W7QA 4C1NB 2I56A 2E25A 1BGGA 1TTQA 4CN6A 3MI2A 1XLAA 3UXIA 3CMJA 4XG1A 3OLEA 2W5FA 3IACA 1DVJA 3KX6A 3SCNA 4K36A 1PIFA 3BZJA 3KWXA 2CBIA 3CNYA 1NDZA 4GCAA 1SJBA 2GVGA 1N8IA 2WCAA 3MSGA 1Q3NA 4ORIA 5ECUA 3TA9A 1E15A 1YDYA 4YJ5A 5C2GA 5KETA 4IH3A 5EFDA 3TJXA 1GTEA 3T09A 3BJTA 4RDZA 2FDSA 1VIZA 4IPPA 3EYPA 3GTFA 3NVDA 1DWJM 4GIRA 3NM3A 3XISA 3UT0A 3II1A 4PTXA 4AIBA 2DZSA 4GVHA 4WY0A 5AC7A 4RPQA 4HYVA 1QBBA 2YYUA 1MEHA 4MY1A 2W3ZA 1SW7A 3A9BA 8XIMA 5C8BB 3K13A 1IXOA 3KZPA 1CT5A 1B9BA 2OYMA 1E3XA 1DWFM 3MVTA 2R1NA 5HK4A 1SGJA 1IXQA 4GZEA 3AYVA 3E5BA 3Q65A 2P0IA 3OYXA 3MQTA 5CZTA 1GVIA 3GYCA 2J24A 4PMDA 1A5KC 4ZR8A 3ZJ7A 4O1FA 1HKWA 1NDWA 1R3WA 3BCDA 4NXSA 4HNOA 1DEDA 4N9BA 2L5HA 4POCA 4S3DA 4IJBA 3VA8A 2Z28A 2CZVA 2IQTA 1B3OA 4OBTA 2WMJA 3DXIA 1AZ1A 1K3UA 1AJ2A 4B5VA 4TV5A 1JI2A 2TRSA 3EPNA 4GPNA 5BU9A 3NXFA 4Z1DA 4NAFA 4PULA 2C15A 3PZ9A 1OIFA 1VBRA 5HBFA 1XLHA 3C2EA 1Q6EA 1ZY9A 3QOKA 1M5WA 3TX9A 3W7OA 3L2IA 1A4MA 1TA3A 1WYIA 3AIUA 2ACRA 3M0XA 2ZC8A 1E0VA 3WUGA 3JU2A 4IIFA 3N2TA 1YHTA 4QSHA 1K6AA 1MNSA 4HJFA 3DG6A 2XWDA 4MVAA 4FOKA 4NSBA 4JY9A 4AWUA 1NEYA 2PDPA 4I5XA 4GBUA 4JAWA 4MZ1A 3FA5A 2WJDA 3S46A 2GSJA 5JU6A 1EZ2A 4GXPA 3MZNA 2VRKA 1RUSA 3FJ6A 3VILA 4AVOA 1TZ7A 1UD5A 1XLFA 3TKFA 4C1KA 4WEVX 2SFPA 4DWSC 2Z4GA 3DFTA 2Y61A 5AVNA 1JCMP 2X1UA 3STCA 2DZUA 3EDJA 4DZ5A 3OLIA 3WQEA 3FYYA 1W1TA 4LVDA 1PWMA 3K2GA 1DKWA 2YGYA 2X0YA 4H7VA 3C8FA 2ACUA 3U48A 2XH2A 1EJXC 5AVHA 2QDGA 2PLMA 2ZTKA 4MLJA 1BYCA 3SCPA 2Q8XA 2OU4A 4HMEA 2VFIA 3QY6A 2XIQA 3BAXA 3GXPA 3S5SA 3UZZA 2OZ3A 3OEXA 4MFDA 3OBEA 4HQVA 2DFAA 5BRPA 4LEQA 2EPNA 3BAJA 2WPGA 4JTQA 2A5HA 1O94A 2Q8ZA 1MQPA 3GQYA 2NXGA 1PBGA 1YIXA 1M01A 4Z1BA 1EOMA 2EG8A 2J7DA 2XINA 4Q6JA 3G6MA 3PNZA 4HNVA 3IK2A 1TB3A 1I1WA 2A3EA 5CG7A 1MMFA 4JTDA 3GUGA 5IDIA 4ZE5A 1IZKA 3CIVA 1EP1A 3CZJA 1WXZA 2QCEA 1M3UA 1H7NA 4PGLA 4IP4A 1XIBA 1IT0A 4GUJA 1O4UA 4UTLA 1HL2A 1HJUA 1A0CA 3FAXA 3WEZA 1R2SA 1OFPA 3IGXA 1UOKA 5CBBA 3LPOA 1E72M 2PRLA 3KUMA 1K1DA 1WDRA 3HQNA 3TA6A 1AQFA 3N9SA 1UR9A 3EXRA 2ZUTA 1TE6A 3HM7A 1E55A 3WLRA 3S3GA 1ZB5A 4KW2A 1TPDA 2ON3A 4DNMA 5JBDA 4QDWA 3N14A 1WB0A 2ZVIA 3VD4A 1A3XA 3KOXA 3WQOA 3SURA 3N34A 2Y8UA 4GNJA 3QF0A 4GE8A 5I07A 1OFDA 4L6DA 4DX3A 1BKHA 1RV8A 2PC8A 4JTAA 3TW6A 2YLLA 3NL6A 3D3FA 4MWAE 4HVXA 2DQWA 3TC6A 4FX6M 3RU8X 1AQMA 5BWAA 2HVNA 4IICA 4I5RA 2Y24A 3PUDA 4AY8A 5AHEA 4DYEA 5LIKX 3W7GA 4CUCA 5RUBA 4P8WA 1UWIA 4NZ3A 1RZMA 3GC5A 4TX8A 4JYEA 1LUCB 4US5A 3SGUA 1GW9A 1BVWA 3V35A 1XIGA 2ACQA 1DJQA 2PP3A 3NQ2A 3O2LA 1QPQA 2WJEA 4YTQA 1IXNA 3GXNA 4TQTA 2RFGA 2PE4A 4H9VA 5L6UA 1LBFA 1W1ZA 2VRJA 3UZJA 4BF5A 2GJNA 1UUOA 5HWNA 4XWUA 5I00A 4GGHA 1CDGA 3LHYA 1HJVA 2W79A 1UKTA 2POTA 3UY7A 3W7IA 1TVPA 4HHLA 2D22A 3EBVA 3KDOA 1Q85A 3CU2A 2HS8A 1NJJA 1YLVA 2DH3A 1K4HA 4XB3A 3CLWA 3VOFA 3DU0A 3EMQA 4AH7A 5K9CA 1X6LA 3UG3A 1JD9A 3RG6A 4PUUA 1ECQA 3W2JA 5TQLA 2J6VA 3DHFA 4JIEA 1AL7A 4L1WA 4AD1A 2DZPA 4W5ZA 1W3IA 3H2MA 3PAOA 3LBMA 4GIAA 5DANA 1CEOA 1BHGA 3DHUA 5F2MA 1TZZA 4XBJA 4U2ZA 2JK2A 2W63A 1PZ3A 4DIAA 1Q65A 2Z24A 3U7VA 1R38A 4TX6A 4A05A 4JIPA 1OEPA 4H7ZA 2MUCA 2W66A 4JS3A 3M0IA 5K4ZA 3BCFA 1KCLA 1MUMA 1X6UA 2WK2A 2HEJA 2VURA 1ZBVA 2J7GA 4X22A 2V5BA 1LP6A 4Z2KA 5H2ZA 4ZENA 3A3WA 3WNOA 3QV6A 4HSHA 1JVNA 1XBVA 1E51A 4DBDA 2P1FA 3T40A 1YBQB 3VIPA 2Y62A 4Q7BA 2VO5A 2F9RA 6REQB 1SJCA 2AOSA 3OODA 4DI8A 5T9BG 1QNVA 3STFA 1NOWA 4UNIA 3VCRA 3LTYA 4RNFA 3MMTA 2YCLA 1KFLA 1GNXA 1YX1A 2BVWA 2VZTA 5KTLA 3V0SA 1S46A 4ZOEA 4C6BA 4PRWA 3IV3A 1UZ4A 1OG0A 4DWSD 3LHVA 1LDCA 1V77A 2IPGA 4CNPA 2EG7A 3GG7A 3OZMA 3STEA 3TCSA 5FAGA 2BASA 1OCNA 1ZGDA 1EBHA 1ZCOA 2XVPA 4DAFA 3HPXA 4IPIA 3NQCA 4IGHA 4MB3A 5HR6A 1HX0A 2YR1A 2PBGA 3OGRA 4ENLA 1IEVA 3M0VA 1XP3A 3DBNA 5I79A 3QV7A 4JNYA 5C6MA 3Q37A 1RCXB 1R2TA 1LBLA 1NFGA 3G1YA 3STGA 4ROPA 1KWKA 3LUTA 4NX5A 3PVFA 2WBGA 3M0KA 1NTHA 2WSKA 2O92A 2GWGA 4OGZA 3CAQA 3NGJA 4BCEA 2OZ8A 2Y1HA 4L56A 4O16A 4HPJA 2QDDA 3FEMA 2Z7KA 2X41A 2YA2A 4K8GA 4L64A 1KBKA 2Z00A 2VL4A 3QMTA 3L9CA 3ATZA 3HPFA 5IRPA 4GJ1A 1GGOA 1MXGA 1B31A 2JFEX 3BQ5A 3L7RA 4JXCA 4NIRA 1DIEA 4PRRA 3ZVHA 5C5YA 3CWHA 3AUJA 1IZJA 3AMGA 2H3DA 1G4PA 1WZMA 3VINA 3EA2A 4XZNX 1KM2A 4DYJA 3NWRA 2Z1BA 2A7NA 3LBCA 3ITYA 1OYCA 4E8CA 3H2AA 4A2RA 4OVXA 3HG2A 3UWEA 1EHAA 5HJLA 1QWGA 1QW8A 4HMNA 2D23A 3SCVA 3Q2DA 3KRUA 3THCA 3THDA 3UWYA 5EMMA 1GOMA 5G1TA 4H8UA 3GU2A 1VFTA 3FS2A 4H8NA 4LC6A 1GG0A 4AG0A 1XLKA 1B90A 1KCKA 1Z44A 1BYBA 2J9ZA 2CZFA 1UWSA 1VKFA 3T2QA 1K6WA 3NQEA 1CXHA 4KWVA 1XRFA 4AHQA 4O8RA 1RLDA 2XIOA 4O17A 4M80A 1V0LA 3K8LA 3IK4A 2GUBA 4Z2HA 2BXVA 5IHRA 2EPOA 3ARUA 1S1PA 1X6NA 3GG0A 1QI0A 4X3ZA 2PDNA 4ADTA 1YE4A 1XCXA 4YTUA 2BY0A 1EBGA 3C3NA 2GUUA 3NYDA 4H9UA 1B9ZA 3K5XA 3ABSA 3SUTA 3NIYA 4E4PA 5H8PA 4WDTA 1H3GA 4LH8A 1J5SA 2WWDA 3C56A 1IWBA 4AMAA 2PCEA 3IUIA 3PBUA 1F05A 2Y63A 1HKVA 1U83A 2FZNA 3A4AA 3ZVIA 3TYBA 1FWSA 4ADUA 4F4RA 5I3KA 3AMKA 3VKBA 4LB3A 1V08A 1VGAA 1PV8A 2VYOA 1NH6A 4KCVA 5TAOA 1MZRA 3ABQA 1JR1A 3CYVA 4W7WA 3VMOA 3BANA 1US2A 4LAOA 1EP3A 3FSTA 1WXYA 5GJMA 6ALDA 4LAUA 3TSBA 2BMBA 2BHZA 2IXUA 2BB0A 4Z2JA 3TQVA 1TVLA 3HQ1A 2HQAA 2B7PA 2CWNA 3NVTA 1B2YA 3TFXA 2TPSA 2Z2BA 3KW3A 1SJDA 1D3GA 4L7ZA 3LHZA 3AYSA 2GOKA 4AF0A 2DZXA 3R8GA 1UUMA 1GQJA 2QCGA 2Y8KA 3EB3A 3CB3A 2NX1A 3PHAA 3KL0A 3VIGA 1MW1A 2WPBA 3AXXA 3EEZA 1WDQA 5EMUA 3BLOA 1OX5A 2X1TA 1QPKA 2F2HA 4A3UA 4LUIA 3B0VC 4EXQA 2GDVA 1EIXA 4MUPA 1KXVA 1W37A 2PU0A 2H90A 3V16A 2CHRA 3VNDA 3N1AA 5FEZA 4P2VA 1XBXA 1ZALA 3M0YA 1R85A 3PFMA 4MJ4A 4OT7A 4AC1X 3BOXA 1Z48A 3E5PA 3UZ5A 4JQ1A 3PBGA 3LXCA 1UD2A 2XVNA 3LSCA 1OGGA 4ZQMA 2EF9A 2XJ7A 3UWZA 2D69A 2OFJA 2W6RA 1YXCA 3CQ0A 3LCFA 3M0JA 4QLKA 2WMHA 3THQA 4ATLA 1KR0A 2PDYA 2FB3A 2PBOA 3BC9A 3FAWA 3MKCA 3NSMA 1LQ2A 3BLKA 5E09A 1SJAA 1JGMA 4F3HA 3C2RA 5F1VA 2WHJA 1DXIA 2FZ8A 3SFKA 2A3CA 1DQWA 3L5AA 5BYWA 3PTDA 1K77A 1V51A 3N73A 1C3FA 3G8EA 3GIYA 3LI1A 3N4AA 1CXFA 3UBPC 4DYKA 4LGXA 3W38A 4MGGA 4S3JA 3R89A 2CLFA 5JVLA 2WANA 1EZWA 3CUZA 1DV7A 1M41A 1FA2A 1V6YA 1XBZA 3RCNA 2YPIA 5LNSA 1DJGA 1SMAA 2O9RA 1GVYA 3AHVA 3W7KA 3RNDA 3P2VA 3WNLA 4AY1A 4CEUC 3IWPA 1UHVA 3C0SA 2DVXA 2OG9A 1KM0A 3MCMA 3AICA 1T8QA 3DC8A 4AYSA 3BXWA 1OZQA 7CGTA 2YFOA 4D2JA 2GK1A 2INFA 2BODX 4XAPA 3BSGA 1B0IA 3RR1A 3UCCA 1E6NA 1HQTA 3RHGA 5I03A 3V1PA 3VDAA 4K7YA 3UG5A 2G3MA 1FCBA 4CQDA 2QF7A 4IG2A 1EJTC 5LYRA 1PX4A 2ZZ7A 4JTTA 5HDRA 2PDCA 3PWAA 2BOGX 2E9LA 5DT7A 5CPTA 5C55A 3R4IA 2GQAA 2YYTA 1PHWA 2J25A 5A5WA 4EK7A 3URAA 3SCQA 3DZ1A 1AG1O 2E6DA 3VOHA 3LYEA 4KEUA 4UCGA 3W73A 2XG9A 3N2MA 3G18A 3BCJA 2VFDA 2OO6A 4LUSB 3W24A 2J4GA 3UERA 1IZCA 2H9AB 3TROA 1UROA 2DVTA 3MUXA 5HULA 3FKRA 2P3EA 3LM7A 1XH0A 1FWNA 3P80A 3LNMA 2WHLA 3HMCA 1HL8A 3KZSA 2JEPA 2FTWA 4NZ1A 3E2QA 1XDLA 3WFAA 2PDMA 5A8NA 1AH4A 2EQDA 3CZKA 3R94A 3P0WA 3CZGA 5AY7A 1FRBA 1U22A 3GR4A 3PS7A 1SW0A 4Y9PA 3RRAA 5FL0A 1JPDX 1VC4A 3NQMA 3SSZA 6TAAA 3P0XA 5KSWA 2PRMA 1J2BA 3QSRA 1W9PA 4YTRA 2A3BA 4G7EA 4J3TA 1TG7A 2PWFA 5D9PA 2ISFA 4NY2A 3KL3A 4AAJA 4AC7C 3RITA 1UR4A 3NQDA 1UOZA 2WMIA 2YCLB 3AWOA 2RDUA 3WZ0E 2PS2A 2ZOXA 4S3AA 1I60A 3VFLA 4LJ3A 1XI3A 3LERA 3WK3A 4UFLA 1BSLA 3WLNA 3ZT7A 3RJXA 1HO4A 3E0VA 1E6PA 4W88A 1W5PA 1GEHA 3ERPA 3TN6A 4CQCA 4D6JA 1YMYA 4O13A 4HZ8A 3SCSA 5HA7A 2YZ5A 2X2YA 3DHPA 3O3RA 1NM9A 4F2BA 3OZOA 4Y6GA 1H49A 3EWXA 4MADA 3SGGA 2HJPA 2WSYA 1GVRA 3M5XA 3BLIA 1RVKA 2DJXA 1GYLA 3H21A 3QQ0A 1RJPA 3I3DA 2OEJA 3A3HA 1GZ1A 2EPLX 3UU0A 4WLCA 4JEJA 2WQPA 4KWOA 5DEZA 3DKLA 4KF1A 3MUCA 2YCKX 3MV01 1GWJA 3MU7A 1Q63A 1O66A 3RN6A 3RJYA 2JBMA 3TN5A 3S6TA 3MBFA 1P1MA 1Q7QA 4PB5A 1MWOA 3AYTA 3B04A 3MUY1 3KCLA 3ZVHB 2ZKMX 1XC4A 1LQAA 2CERA 4O1BA 3RILA 3S47A 2REQA 1H2JA 3QTGA 4MF4A 3O16A 3W53A 4LU0A 5LNWA 1EWEA 4KRZA 1F73A 1ODZA 3H8AA 2GGEA 1PJ9A 2NX3A 1TTPA 3ZO9A 1ML1A 1E1EA 4JD4A 3TJ4A 1RR2A 1AMKA 1T7LA 1ADOA 4TMCA 3B97A 1S39A 3N3TA 2WXDM 4JCMA 2WVUA 2RAGA 4J1OA 3K1GA 3SZ8A 5JH1A 2QXWA 2VT0A 4PUNA 5AHFA 1V8EA 1RY0A 3LCXA 1QNOA 3M5YA 3VUPA 2PF0A 4D1JA 2QYGA 1E0UA 1ONXA 2GVLA 3VOJA 5AZ1A 3Q67A 3OQ8A 4O19A 1VLIA 2E77A 4OZOA 4MM1A 2NT1A 5CPOA 4IUGA 5T91A 1N2VA 3KHJA 2VEIA 4JPGA 4HGXA 1P48A 4HOXA 3GFZA 4DF1A 4AZ5A 3WG6A 4KS0A 3THAA 3BMWA 4DUOA 1TTJA 5FJJA 4M24A 3FK4A 5A2AA 4MIMA 2Z6IA 2BLEA 3PTMA 1E73M 2GVEA 2CXGA 2NLYA 3OU8A 4GYPA 4X63A 4KIEA 4GRSA 1OK4A 2IPJA 3U5UA 1RY8A 3GNPA 4W7UA 2NQ9A 2UZ9A 2ZQ0A 3KXQA 1U2YA 2I5GA 4JL2A 4IQJA 3CLMA 1XLBA 1W6TA 1ZRQA 1RCQA 2O9TA 1X7IA 2PGEA 3AROA 3VFCA 1XQLA 3W01A 3PWGA 2PSNA 1E9IA 3EWYA 4J5NA 4I3GA 1E9LA 5XIMA 4B2DA 3M41A 3QQWA 3BURA 4PH6A 1IHIA 1UQYA 5C2CA 1ITQA 2OEMA 4CU6A 3I6TA 4HU3A 1D8CA 3AHYA 2GUYA 3WO8A 2AL2A 2WYSA 4I90A 5CZJA 1FXQA 1UD4A 4PMVA 2NT0A 5BOEA 3S1WA 2FDMA 2DUAA 2D0FA 4UOZA 3W2LA 4B5WA 3QPEA 1TWDA 2ISWA 1OWQA 3ABXA 3LCIA 3AC0A 5EMLA 3OOQA 3W82A 2TSYA 3LG3A 2EGZA 4R7OA 2JALA 1OYBA 5D38A 4ZTYA 3NPVA 3UETA 2GJXA 2WMGA 4J7RA 4HT3A 5I3DA 5HWJA 3DFOA 2JKPA 4GO9A 2P88A 3WJWA 1LWHA 2PUZA 3VMPA 3U0HA 1VYSX 4MWAA 4G8TA 1JNEA 4ZOBA 4CVUA 2OQYA 1UWRA 3SY8A 4DZAA 1GVSA 3FJLA 3AMLA 4MB4A 1J8VA 5FEPA 1Z8AA 2Y7DA 2CIPA 5D2XA 2OOFA 3UG8A 2IS7A 3LRMA 3V18A 1M9HA 5KINA 3I3BA 1G4SA 4PR4A 2ASHA 4GI9A 3WJXA 4MLRA 1R9ZA 1DWIM 1JZ3A 2OSWA 5BXPA 1YW1A 3G1SA 4G7FA 3M4HA 3W00A 2D20A 1XGDA 5MHBA 3H7RA 3W1MA 1RA0A 2VMFA 3B9OA 3VKJA 5FEXA 1U5VA 2H8ZA 1PCWA 3GU9A 1ZSXA 2GGGA 4CD6A 2PTDA 1GHRA 4LUTA 3GTNA 4IL0A 3I6EA 3CQJA 1YTDA 3HO8A 4DXKA 3PANA 1UPMB 1UYQA 3VCNA 3VM7A 5BXSA 4HCDA 3KBWA 4JX4A 5AB3A 5HINA 1U1HA 3SY5A 1J0JA 2YOCA 4ORMA 1DWGM 1JFHA 1FXPA 1JPKA 2ZZ4A 4A3RA 4L9ZA 3DYPA 2DU2A 4Z2GA 4FNRA 2EJAA 4GUIA 3UPMA 1OINA 3W76A 2NV2A 4KGJA 4PUDA 5HMFA 1G9HA 4CD8A 1OCBA 3G1XA 3AHZA 2OQLA 1G69A 2J6XA 2XIBA 5IBXC 2V82A 2OR2A 1H41A 2CW6A 4J2PA 4S38A 3FSUA 4UQAA 2D2HA 4DJEC 1WAWA 4HYRA 3NPWA 2HWGA 1PZ0A 2VEKA 4LS1A 3CGTA 3KCJA 4IG2B 3WLLA 5CC6A 1WKYA 4LY8A 3I7SA 2J27A 3RAOA 4DELA 5CPSA 4M56A 5A95A 2HPIA 5REQA 4HOZA 4A6GA 4IMDA 3ZXWA 3D5HA 3VD3A 1OCQA 1VEOA 1K9EA 3H22A 1HZYA 4YHEA 4D6FA 4C5YA 5C9ZA 4IQEA 5K7JA 1ALDA 1UWQA 4A8NA 4XUGA 1ZS2A 3CAWA 3P81A 4GQQA 3OO2A 1OCJA 1C8QA 1ZLPA 3BAYA 4WSKA 4UTWA 1A5AA 2RUSA 1I4NA 3BV7A 4FXRA 2ZX8A 3QYQA 3GDKA 3L23A 4UB9A 3GXTA 3PF3A 2UV8G 1M7PA 1D3CA 3DFHA 5EPDA 1ISXA 3HZ3A 3PBMA 2PU1A 5CSUA 1KFBA 1KNWA 3KLLA 3WLMA 4LYRA 4MKVA 1SW3A 1HKKA 4EPDC 1F4AA 1O5XA 1JIBA 1MFVA 4U10A 3TZFA 4OJYA 4IMGA 1CXKA 1H0IA 4E2BA 3WBYA 4AEOA 2XGBA 3GBDA 4BJHA 4G7EB 1HGWA 4ZA0A 5CPMA 4U3CA 3CJPA 3CTTA 3ZOAA 1EF2A 3NQ7A 1IR1A 1V0MA 4GHRA 3OB8A 3R58A 3CV1A 3NDOA 4IXXA 3BV4A 5AHIA 4Q8PA 1B3ZA 1GVOA 2WMIB 3CL6A 4RZBA 3M0MA 1WOBA 4F0RA 3EOOA 2HROA 1TJPA 3O6AA 4EKJA 3QGAC 3FCPA 1Q4WA 3RLGA 4O1EA 4BFAA 5CQ1A 4A4AA 1CW2A 2I7GA 3OBAA 5HPCA 3S2JA 5D03A 1TPEA 4H6RA 4XAZA 4UIOA 3SCUA 1PXGA 4B5TA 3BWWA 3VIKA 3NQFA 2X1SA 1DIDA 2HK0A 4TTUA 1C29A 2QR6A 4JQ4A 4O57A 4M1BA 3TN3A 3TXVA 1JDFA 4LCSA 6ENLA 3S5YA 4NYUA 6CGTA 2E40A 2B31A 3G6LA 3LEPA 2PFHA 3GNRA 3QVQA 1RK5A 3RPDA 3VD9A 1O60A 3UGRA 4C6CA 3RMEA 3CMGA 2DZWA 2F6UA 1LORA 2Z1SA 3E49A 1XYBA 3HV9A 3VX0A 1OHLA 4UMAA 1M03A 3MMUA 1EXBA 4A2SA 4LFYA 2DT2A 3MZ2A 2DZTA 2PAJA 1JQVA 1XUZA 1XR2A 1YDVA 4UR9A 3EA3A 1T0OA 5CZSA 1TJRA 3QJAA 3N2CA 2Z1XA 2X40A 4FXSA 5AECA 4ZO6A 4D8ZA 2YB1A 1J4EA 2XN1A 4EE9A 3L4VA 3MC5A 4JYFA 3GHTA 1TWIA 5LKYA 4LVBA 1V93A 4Q8OA 3E0FA 3HV8A 4D71A 1O68A 2REQB 3DCPA 3FA4A 4XZBA 3W6YA 1W9UA 1Z69A 2YW4A 1K4GA 3ZJKA 1HKJA 1CWYA 1YDNA 3L0NA 3T0DA 1VFHA 3W1XA 4PCFA 3KRBA 4TR9A 1FWIC 3Q45A 4MYXA 1QUMA 5IDZA 1ZU8A 2G8ZA 1C8VA 1Q6OA 3WDQA 1EA0A 1EF3A 1FH8A 1BAGA 4ZE4A 1ZQ5A 2GGHA 4PA8A 2Z1KA 2CCRA 2A6LA 4HCLA 1RD5A 1TO3A 2VI0A 5HNUA 1P7TB 4BWLC 3TNBA 3N9RA 2Y6ZA 3W6LA 2FFCA 4RJEA 1WZAA 1BXCA 2FTPA 4CU7A 4R33A 3LHTA 4HKPA 4D6GA 3EX4A 4RK8A 4QLLA 2YW3A 3WDJA 2PWHA 1V79A 1KO0A 1T8XA 7A3HA 4TO8A 3SDOA 1PYMA 1JUBA 1LLWA 1K70A 1WQ5A 1NAL1 2C3ZA 4XO6A 4KT2A 4JR5A 7ENLA 5TD4A 3VNMA 4QCEA 2IPFA 3PPHA 1EGVA 1O6IA 3C8NA 3WK2A 1KGUA 4UFIA 2O4MA 6XIMA 4XX6A 3N4FA 1OF6A 4H9TA 3EAUA 4I7VA 4O15A 1FOBA 1U5JA 3QGKC 1JPMA 4DJDA 5A3HA 3OPSA 1KRCC 4UTTC 3DI1A 2WNWA 2GVYA 4Q8WA 2NUYA 3FEQA 4BEQA 2VEGA 1PWLA 1TFVA 3ITLA 3NDYA 1HJWA 1GG1A 1T40A 4RR4A 4QJ4B 3PPCA 1D3HA 1PVNA 1SFLA 4XZMX 1J0YA 4DJED 7PTDA 1Y5WA 4E6MA 4WCJA 4R34A 1XX1A 2NXHA 1GVQA 3MHFA 2AL2B 3SRDA 3PN8A 3FGCA 3N2BA 1W5QA 1AH3A 5FJRA 1PIGA 3WCZA 1ZBCA 3VIHA 3ONCA 2V8ZA 4IX2A 1ITCA 1NELA 4UFHA 3RLUA 2HISA 3INPA 3W2KA 3QC0A 3UGVA 3WF0A 1BQGA 1WV2A 4JN8A 1VYPX 1GPWA 2ISDA 3M7SA 3R11A 4OKDA 2XPKA 3CK5A 1XH2A 2PD9A 3UR5A 2J88A 2QPXA 5DELA 3U3HA 1Z42A 4GC4A 1VHCA 1FWAC 2HSAA 3D6NA 4MWAB 1QDSA 3CQHA 5SWUA 1FWTA 2PC4A 2ZA1A 2PZ0A 3O7UA 1WDSA 3MY9A 4K68A 5M17A 5I3HA 4YVVA 3G1RA 4JKKA 3T08A 1H7RA 4TMBA 2NVCA 1R86A 5I3GA 1DJWA 4PUMA 5CSRA 3N9KA 1EJVC 2EJ1A 3NG3A 3OTRA 3PJXA 3SADA 4IJRA 2HNHA 1WE5A 1KM6A 2OB3A 4GIYA 1EQCA 3K8KA 1JL8A 2QAPA 3QKEA 5A69A 1UIOA 2YA1A 2VC6A 4GK8A 1WDPA 5KMYA 3HOJA 4GKLA 1JCNA 4Q8TA 1BFNA 3SN4A 3ES7A 2PGFA 4ZSTA 3LDVA 6A3HA 3G0XA 3TYAA 3GUWA 2NW0A 5K4XA 1G4EA 1OSEA 4X61A 3AU6A 4NJGA 1KV5A 1JF5A 1BYDA 4JYDA 1AUSL 4E3TA 3WMLA 1EEXA 5HMEA 1OIMA 3LPPA 2E6AA 4DJFC 1XPGA 1F5ZA 1QR7A 3NUKA 2E3ZA 2QJJA 4QNWA 3A5FA 2AMXA 3A64A 4AVNA 1XLCA 2Q3RA 3CQKA 4KERA 4ZO8A 2XIMA 1RD6A 3UFYA 5IFPA 2ZZ6A 2CETA 1DTNA 4M19A 3G0SA 3OGSA 3WK1A 4NVTA 5FF7A 3GVRA 4YVXA 3SUSA 1EX5A 1KR1A 4H6QA 5FIPA 1GT8A 3WY1A 3BW3A 2EPKX 3GKAA 5DCDA 4HTBA 1KB3A 3B8SA 2R91A 3ARSA 1ADDA 2XUCA 3NQBA 1VR6A 1A50A 2WZIA 2IMRA 5I02A 3U6WA 3ARWA 3IVSA 4KMQA 1RBOB 1KGXA 1Q5MA 3MUIA 3PZMA 5D32A 2XWEA 4X2RA 4ZQPA 3CT2A 2J7CA 1LL4A 4BY3A 4P61A 1N8FA 5FCZA 1H7WA 1J10A 3G1FA 4WIWA 1W9XA 3RK8A 4RV3A 4A8RA 3CXOA 1SZFA 3PB0A 3OA5A 1BG9A 3G1VA 2UBPC 4BI6A 1GYNA 3QFWA 3FXYA 5FF2A 1OT2A 4IXHA 1GQLA 3GVWA 4U3AA