1ZZMA

Crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
MICRFIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADEIAQALLNNTYTLFNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YJJV, TATD homolog from Escherichia coli K12, at 1.8 A resolution
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords putative deoxyribonuclease yjjV
total genus 92
structure length 259
sequence length 259
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1zzmA00
1RA5A 2KAUC 2E1WA 4ICMA 1VFLA 2G3FA 3GIPA 3B0YA 4TQTA 4ERAA 4V1XA 1GKRA 4PE8A 1V79A 3T8LA 4WGXA 2WJDA 4LCRA 4C65A 3IGHX 4KEUA 1XWYA 1FWFC 4C6FA 2D2HA 4UBPC 4H9ZA 1WXYA 1RK5A 3GTIA 4G2DA 4DI9A 1WXZA 1FWCC 1XGEA 4L9XA 4C6LA 4GY7A 4QS6A 4LALA 1W1IE 3LNPA 1BF6A 4QRNA 3PANA 4KEVA 4CQCA 2YB4A 4B3ZA 3URQA 4HK5A 2ZC1A 3MKVA 1NDZA 1FWAC 5A6TC 3S4TA 3SFWA 3TNBA 4RZBA 2VHLA 2Z00A 3PBMA 4R7WA 2HNHA 2GWNA 2DVUA 4DZIA 4IF2A 3O7UA 4C5ZA 4OFCA 3DCPA 3TN6A 2O4QA 3WMLA 4H9TA 4C6QA 2YZ5A 1PO9A 3V7PA 3WYZA 3OOQA 4P5UA 1K70A 3MDWA 4KQNA 3GU9A 2PAJA 2GZXA 3CAKA 4GX8A 3LU2A 3LSBA 1J6OA 2D2GA 4C60A 1RAKA 2FVMA 3PAOA 2Q01A 4WVXA 2VM8A 4XAFA 4XAZA 1POKA 4B91A 2FFIA 3MDUA 3IPWA 3PNUA 2VC5A 3SO7A 4ERIA 3FEQA 4GZ7A 2I9UA 2OQLA 4H9MA 2GOKA 4BJHA 2OODA 4C5YA 4IQJA 4KESA 2R1NA 3K5XA 1XRTA 2Q09A 2ADAA 2AQOA 3PNZA 4IFOA 2HPIA 3S2LA 1DPMA 3QY8A 1K1DA 1RJPA 4H01A 2EG6A 1EJVC 1POJA 3OVGA 1FWDC 1RJQA 4H9YA 3IJ6A 4GK8A 4IFKA 4ERGA 4IH3A 3K4WA 2OOFA 2R1KA 3QGAC 4IFRA 2DVXA 3A4JA 1V7AA 1A5NC 3IV8A 4GX9A 4PCNA 3IRSA 1IE7C 3E3HA 2D2JA 4M51A 3URAA 4WHBA 3LGDA 4KETA 2Z4GA 5LXXA 1UBPC 1ONXA 1PTAA 3R0DA 4LANA 2QT3A 4F0RA 4DZHA 4NG3A 4QSFA 3QY7A 3E2VA 3ICJA 2Z24A 2FTYA 4DYKA 4H00A 5FSEC 3LS9A 3E38A 4C6CA 4XAGA 1KRBC 3RCMA 2R1PA 4HA0A 2EG8A 3LY0A 3UR5A 2Y1HA 4I6VA 2E25A 2Z2BA 3AUOA 4B92A 4RDWA 3UPMA 4KF1A 4GOAA 1EJXC 4LH8A 4XD6A 4AQLA 2VR2A 2WJEA 1ZZMA 4CNUA 1I0BA 4RDYA 4DNMA 2O4MA 3OQEA 3UF9A 4KIRA 3MTWA 1GKPA 2FTWA 2GWGA 1YIXA 4IFKB 4H9VA 1J6PA 3NQBA 1J79A 4EPBC 4MUPA 3F2DA 1R9XA 2DVTA 4DLMA 4ZSTA 1M7JA 4GXWA 3ID7A 5FSDC 1P6BA 3QY6A 2PUZA 2HQAA 2Z29A 5CH9A 4YIWA 3TN5A 4QS5A 1KRCC 2VUNA 3OJGA 4XD4A 3MSRA 4CNTA 1A5MC 1KRMA 3B0XA 1EJWC 3QGKC 2Z28A 1UIOA 3ORWA 2PGRA 1O5RA 1A4MA 3K2GA 1FWEC 4C6MA 3S2MA 4GY0A 4IG2B 2RAGA 3T81A 1M68A 1NDYA 3BE7A 1QXLA 1I0DA 1YBQB 4G7EA 4B90A 1YNYA 4R85A 2WJFA 1R9YA 4UB9A 3TN4A 3LGGA 3FDKA 3NURA 3MVIA 1HZYA 3OODA 3UBPC 4DLFA 1EF2A 2VC7A 4CEUC 4GBDA 3CJPA 3GRIA 4HK6A 4GC3A 1KCXA 2YXOA 5AKQA 4J2MA 1ITQA 1FWBC 3GUWA 4XD3A 2UZ9A 1A5OC 1XRFA 2XIOA 4H9UA 1E9ZB 4PBEA 3NEHA 1EJRC 1YRRA 4C6EA 4H9XA 4GYFA 4Z42C 2W9MA 1ADDA 2QS8A 3S2JA 4LCSA 4KERA 4G7EB 2GSEA 1V4YA 3A3WA 1M65A 2Z2AA 4DI8A 3URBA 4E3TA 3UR2A 1UIPA 3MVTA 4QTGA 4CNSA 3C86A 2PLMA 4JOMA 4DIAA 3WZ0E 4LFYA 1FKXA 4F0LA 2R1MA 3IARA 3GU1A 3E0LA 4RDZA 1FWJC 1PB0A 4KEZA 2Z26A 1J5SA 1K6WA 4DO7A 2QVNA 1V51A 3GU2A 2WM1A 4EPDC 4LAOA 4EPEC 2HBXA 4C6BA 4XAYA 3URNA 1NDWA 2P50A 1EJUC 1FWIC 3EWDA 3G77A 1EZ2A 2BB0A 3A3XA 4RDVA 4V1YA 2HBVA 2ANUA 1A5LC 1EYWA 2IMRA 1A5KC 1RJRA 4I6KA 1P6CA 3B40A 1V77A 4J35A 4LEFA 3GTFA 5HMFA 1ONWA 2AMXA 4CEXC 2CZVA 4NI8A 3AU6A 2AQVA 3ITCA 2OB3A 4LCQA 4CQDA 1O12A 4F0SA 1RA0A 1S3TC 4BY3A 3F4CA 1JGMA 3GTXA 5HMEA 1YMYA 4QROA 2OGJA 3S2NA 3RYSA 4NP7A 3HTWA 4R88A 1RK6A 4C6PA 3CS2A 2Z27A 2Z7GA 3RHGA 3EWCA 2FVKA 4C6KA 3MPGA 2F6KA 3F4DA 2Z25A 4C6DA 4LAKA 2BGNE 1FWGC 3O0FA 1GKQA 5G4HC 1ITUA 1YBQA 4INFA 1PSCA 4AC7C 4RE0A 3F2CA 3N2CA 3GG7A 3JZEA 1EJSC 2YB1A 3FDGA 3OU8A 1A4LA 2EG7A 4LAMA 4L6DA 4HK7A 3D6NA 4PCPA 4ZSUA 1FWHC 2P53A 3RN6A 3KM8A 2ICSA 3TN3A 4C6OA 3LSCA 4EP8C 4J5NA 4C6IA 3LA4A 1NFGA 1NDVA 1R9ZA 1P1MA 4IGNA 4CQBA 1QW7A 3E0FA 2I5GA 3AU2A 2QPXA 3E74A 4BKNA 2A3LA 5E5CA 5HMDA 1EJTC 3GTHA 3ISIX 4C6NA 3HM7A 4GY1A 3F2BA 3DC8A 3DUGA 4HJWA 4C6JA 3HPAA 2HPMA 4IG2A 3IACA 1UMLA 2R1LA 4XD5A 1FKWA 4IGMA 4EPKA 3T1GA 2PGFA 2UBPC 4PBFA 3EGJA 1KRAC 3GIQA 4D8LA 3MJMA 1E9YB
chains in the Genus database with same CATH superfamily
2BS9A 2FHFA 1MI3A 4PUEA 2W3ZA 4NJJA 5EA9A 1OX6A 3U7VA 1EEXA 3A6OA 1E1CA 4PZVA 3S83A 2GUUA 2IPJA 1E0XA 3W7MA 1LWJA 3QHNA 4G2DA 4L9XA 3LTSA 6XIMA 3L0KA 4LYPA 3URQA 2GUBA 2WKLA 3DENA 4ZOEA 4LT9A 4TXEA 1TVNA 1TIWA 2DVUA 3FJNA 3GDTA 4OFCA 3VGGA 3ZVHB 1UWUA 3ALGA 4W9TA 3D3AA 3IK2A 1OGGA 3FKRA 1RBAA 1TVPA 4FLSA 1JCYA 2GK1A 5EU9A 3GAYA 1VENA 3L66A 1EYEA 3WYZA 1X6NA 1JPIA 3QYSA 4JNZA 4LVGA 4C60A 3UU0A 1XLGA 4YJ5A 2VM8A 2AKMA 5TF0A 7ODCA 3I68A 2VUYA 2PDPA 5MKGA 4LS2A 3PNUA 4DJFC 4R3UA 1KTCA 2CZ5A 2D73A 4UOJA 1KC7A 4IGSA 3I4EA 4Z2HA 5CSRA 3GNXA 1QDSA 4W87A 1ZY9A 2ASHA 2ZZ6A 1NOUA 3GG1A 3V5CA 4FNSA 1J4EA 3OG2A 1OX4A 2VZSA 9XIMA 3GH5A 4XK2A 1NWSA 1QASA 3E0VA 2WWDA 3JR2A 4GK8A 5DY3A 3UWWA 3E5PA 3UY7A 3PVFA 3ANVA 3CV6A 1UCWA 1ZGDA 4OWGA 1DWHM 5D38A 3P8JA 1WDSA 1N2VA 3E3HA 3PTKA 2D2JA 2PTDA 4HYWA 4R53A 1PE1A 4PUJA 2QCHA 2VCAA 3L4WA 2DEPA 5IBXC 4A05A 4H2CA 3DG3A 2REQB 2ZDSA 3ANYA 3PPGA 3E2VA 4H00A 3KXQA 1ECQA 3RU6A 1SFSA 3M47A 3QF0A 1EC8A 5DLCA 3IUIA 3H2MA 2E25A 4TX8A 3HPFA 5CPOA 1XCFA 2WPGA 5D9NA 4NX0A 1CEOA 1ZBWA 2PDIA 2PA6A 1XKYA 3RRAA 1WV2A 1GKPA 3P61A 4BCEA 2DQXA 2XDFA 4AZ6A 4AD4A 1SO5A 3CNYA 4LU0A 3UQNA 3UGRA 3IIOA 5L6UA 2I5QA 1OC6A 4XUGA 5K7JA 3DHUA 2AAAA 3INPA 2Y2WA 5I06A 3FN9A 2C71A 3LCFA 4UFLA 4LUTA 3M0HA 4R7OA 1A5MC 2G5WA 3G1RA 1D2KA 1ZRQA 5EL1A 2Z28A 3TVAA 2J6XA 1V6VA 4GGHA 3GNOA 4HNOA 5E1QA 3GDBA 1AUSL 1U2YA 3R79A 2PLKA 1FP8A 2GGJA 4Q33A 1UUOA 3DHFA 1ZP3A 4JFVA 5LNUA 3TQKA 1VJZA 4FSAA 1U83A 1CLKA 1WNOA 3SFKA 1DIKA 1MXGA 1GZJA 2ZTKA 3BURA 1XRFA 1J12A 4JTRA 1PYMA 4W8BA 1ZJIA 1Q7MA 4MJZA 1LZOA 1MMFA 4DO5A 1XH0A 1AJ2A 4JQ1A 4UR9A 1VP5A 2ISFA 4PB4A 4S3GA 1FP9A 3VNMA 1UIPA 3V18A 1VBJA 4PULA 2G3IA 3W1LA 2DP3A 4QLKA 1YPFA 2ZA1A 1X7IA 3G1YA 2NWSA 4AVFA 2O9RA 1N7KA 1AA1B 2ZXBA 3AYVA 3CLWA 3F4WA 1TIMA 4HKPA 1FDZA 1ZALA 1H3GA 3K1GA 3AOFA 4F3HA 3P81A 2WM1A 5EMJA 1GHSA 2CZEA 2DT3A 3AHTA 1VFOA 3QEZA 4JTLA 3CPRA 3STCA 3S5NA 1GYNA 2QIIA 4F40A 3WNOA 3GH4A 3W37A 3UWQA 1TJPA 2FB2A 2YLAA 2XFFA 1BSLA 3B40A 4JR5A 2C1GA 3L5MA 3LZ5A 4LEFA 4Y9AA 7CGTA 4HNCA 3VFCA 4WSKA 1W9VA 4WGHA 1MXDA 1V6WA 2AQVA 4CU8A 2PDMA 3C0SA 5AECA 2J7FA 3VM7A 3VXGA 1ZCOA 1Q45A 1QNVA 3HG2A 3KLLA 2Z27A 2Z7GA 3GHSA 5C2XA 2G95A 4PFMA 5CZJA 2ZADA 4AHOA 3IVUA 4UTHA 2Y5EA 3SCPA 2J7EA 3C2RA 3NDZA 3HG4A 4LAMA 1N55A 1DHKA 1HF6A 4PCPA 2ACQA 1GPWA 3LI1A 1TMLA 1IR1A 4PTDA 1NFGA 1NDVA 1NOWA 2ABBA 2IXVA 3VDAA 1QW7A 3VAVA 4GQBA 3PF3A 4Q4MA 1BXCA 2A3LA 4O50A 5E5CA 4IZGA 1TE6A 1AW1A 5F2IA 1IWBA 5AZ1A 1E43A 2DW6A 1MEHA 1TPVA 3AAMA 4QDMA 3NVDA 4DJEC 2L5HA 4AZ5A 4AD1A 1HT6A 2UBPC 3B8WA 1CNVA 2GQ3A 4S1FA 2QJHA 1E9YB 2BFGA 3IWPA 5CZ0A 4MIMA 2KAUC 3FJLA 4PSRA 2DSWA 3BV4A 1TZ7A 4WIWA 4WGXA 1KW1A 3KVKA 4H7ZA 4RPPA 2W27A 4J9JA 1J9YA 1RK5A 3SCUA 2A3BA 1WDQA 4IJRA 1YDNA 3WD2A 3CMFA 1TO3A 4I9AA 4YVVA 4AWSA 2DZSA 2ZC1A 4ZL1A 1GGOA 3E1F1 5J8LA 1FWAC 4KMQA 3VGBA 1R5YA 5BXTA 3TNOA 1XD1A 2V3DA 3PFMA 1HJQA 1E6SM 3J7HA 3UCQA 3N9KA 3TCSA 4X0NA 4U33A 2AGTA 2E68A 1TYGA 1S46A 3ARPA 3A21A 1DXEA 4GYKA 1Q6GA 2OX4A 3TZNA 3PG9A 3CAKA 3LU2A 4YHGA 3B4UA 1TTIA 4YVXA 5LGXA 2PZ0A 3C5QA 4KWUA 1VFMA 2ZZ7A 4AIEA 3O6AA 4C1NA 4L56A 3NZPA 1K9DA 4JIQA 3BAIA 5A8GA 1Q6CA 3QPYA 4UC5A 5FAJA 3DX5A 3M41A 4IP4A 1VYPX 4HOZA 3ES7A 4ZXLA 1TRIA 3B4YA 1RPKA 3N34A 3MBFA 1E56A 4DJDD 3K5XA 2C16A 2FDSA 3SEPA 3DFSA 1DPMA 2MANA 1HN1A 2W6RA 3VIKA 4H01A 1DWAM 3IIPA 2R82A 4IIGA 8RUCA 5REQA 3BK0A 4PEKA 3W84A 4ACYA 1G94A 4IFRA 3GK0A 4PBGA 3OZOA 1EO7A 4PTWA 4LY4A 3G0SA 2VCCA 2YYTA 2GQ8A 1OC5A 1PTGA 3L7RA 2E40A 1PPIA 2EPNA 4LXFA 1CB7B 3AXMA 4PL2A 3LHZA 1BAGA 2VQTA 3GIYA 4IIDA 5FSEC 1WKEA 2OLHA 2CXEA 4JX5A 1B57A 4Q8VA 4B92A 5BROA 1UZHA 2WHKA 1M53A 4FIRA 4IWWA 2GQ9A 4LVBA 2VZTA 3EBVA 4CNUA 4DNMA 1HNYA 4YWSA 3BL3A 4KIRA 2CC0A 2VRQA 3KVLA 4GHRA 3RIKA 1J6PA 1J79A 5G1MA 3NDOA 4MWAE 2O9OA 3L65A 5I6SA 2VGIA 2PLJA 1M7JA 2CERA 3MMTA 4GXWA 5FSDC 1JYVA 2BOGX 5T91A 3TSDA 1OZQA 2WLZA 1B2YA 3H53A 5K3VA 4PA8A 2P8CA 1RP9A 2V68A 3AO0A 5M03A 3CV7A 3L4YA 3JS3A 1LUCB 4C6MA 1YTEA 3N2BA 4DNHA 4QM1A 3LBOA 4W7UA 3T0CA 5HNRA 3T09A 1FCBA 4PRWA 3N13A 1JYWA 2TODA 1FUYA 1PCKA 3H4WA 1L6WA 1GVIA 2VX5A 3QV9A 4GUFA 3LMZA 4F66A 1HGWA 4UFHA 3VOIA 4KGJA 4JEJA 3DYOA 1WZMA 5BU6A 3G1HA 3R8HA 4JTUA 2CW6A 4HK6A 3S9YA 3NCOA 4HMDA 5GJNA 1AFSA 1FCQA 2A7RA 4XD3A 2E1DA 2V63A 4YVPA 3B8VA 1BTMA 2YCJA 2QAPA 1KFKA 3GDKA 4KWWA 4C7DA 5EGRA 1O1HA 4MY8A 1GTEA 4DUOA 1UUQA 3CXOA 1R30A 1WB0A 2PBOA 3CK5A 1JQXA 2VEFA 1H7RA 3GDLA 4DIAA 4YHEA 4TO8A 1NQ6A 3WEMA 4TTUA 4Y90A 3G3MA 4ROPA 4RNJA 1KTNA 5C54A 4KEZA 1S5MA 1NM9A 1J5SA 1EGMA 2WZIA 3SRDA 3GU2A 4EPDC 1E4MM 5DT5A 4LAOA 4JTKA 1BPLB 2XZ9A 4BA0A 5F2GA 3IGUA 2O7SA 1EFZA 5JVLA 4G1NA 3ARTA 3G77A 3WQFA 2PTWA 5T26A 1BSIA 2QHAA 4WY0A 4KS0A 2ZZ3A 4FEZA 4HN8A 3K46A 1ZENA 3T9PA 3E2RA 1KXHA 1QCWA 4FXRA 1TZZA 2XFWA 5J5RA 3CWNA 4NYUA 3KAOA 3AHVA 3U6WA 1W1PA 1DIDA 4Q8MA 5F4XA 5HNNA 1WZLA 3VGHA 3SCWA 4O0ZA 2Z2UA 1XI3A 3THDA 1NTHA 3VDGA 2ZYFA 3W7CA 3DI0A 4QG6A 2CITA 1NAL1 3L21A 3TZFA 4NRRA 3BLOA 4WSHA 2NXIA 3VD5A 4XTIA 2Z25A 3LPFA 1Z89A 3GLCA 1S5WA 1ITUA 2BTMA 1F61A 1Q8JA 3W28A 2XH2A 3DHPA 4N7QA 1W32A 3STEA 3UXIA 3M5ZA 1W54A 2EJAA 1OT1A 1VJSA 4ZBCA 1S2TA 3D6NA 4ZSUA 2WBKA 3RO6A 4C91A 2WMIB 1V0KA 4N6EA 4N2YA 1KWKA 1U33A 3MYOA 1O1ZA 3DIPA 3THQA 1M04A 3NWRA 4ENLA 3FJ6A 3R10A 4EX4A 3APGA 3ISIX 4H6EA 1BKHA 2AOSA 3SUTA 4I8YA 4RXFA 3RR4A 3T2PA 4PUNA 1BKSA 4EPKA 3M07A 3E5BA 1OIMA 1XYLA 2RH9A 4UQBA 1AL7A 1DJWA 1V6XA 4GACA 2WNZA 4RE2A 3UWUA 1RCXB 2CESA 1GKRA 2J7CA 2PWDA 2WC7A 4GO8A 3ZJKA 3QM3A 1SW0A 4DI9A 3A5VA 2ZTJA 3LTYA 2WNQA 2Y62A 1UKSA 1FH7A 3ZT7A 4FB7A 4DYJA 2VX6A 5DN1A 3U2EA 3VNIA 4NUWA 4CQCA 4B3ZA 4AY7A 1JEZA 5T9CE 3ARUA 3RG6A 3AIVA 1E51A 1R3RA 3MKVA 3ENLA 2TSYA 3RLUA 3WNLA 3PTQA 2E6AA 4XQ6A 2EEXA 3G2GA 2WM0A 1KFLA 4X9YA 3R94A 4ZGYA 4S3JA 2QKFA 1CGWA 5GVJA 4FX7A 4YYCA 1BF2A 1XSJA 2V3GA 3NG3A 3AIBA 2D0GA 3VA8A 5BWAA 1M6JA 2DGAA 3TSBA 2C14A 1Y5VA 4IM4A 1I9CB 4M1RA 3OEXA 3OO2A 3W26A 2BHZA 3EXRA 1CGUA 1EC7A 1CXKA 2D0FA 1ELSA 3SN1A 3N25A 3SSZA 3SO7A 2I5IA 2OQLA 5EYWA 2WZTA 4ATLA 1G6CA 1JUEA 4JS3A 4REQB 4G56A 1UP3A 1KGXA 1A47A 3CWOX 4IFOA 2HPIA 2FIQA 1QJWA 1VQTA 1K1DA 5TD4A 3OVGA 2G97A 3W71A 2WPBA 3UNDA 1XPGA 1W56A 1BYDA 4A3RA 1A5UA 1XG4A 4XSMA 9XIAA 2BHYA 1R46A 5AHEA 1ZPTA 3W7OA 1Z41A 1D3HA 1JDEA 1NJJA 1J01A 4JTGA 4K2SA 3H55A 2I57A 1DTNA 4PODA 3BAKA 1UR1A 3IJIA 3U9IA 1XFBA 3DECA 3L12A 2TYSA 1W2PA 1QPNA 3IEBA 5FKYA 1F05A 4AIUA 2PFHA 3VVGA 3GSMA 8TIMA 4CU7A 3W2LA 1MYRA 1DV7A 3AUOA 5A95A 2XH0A 4YYFA 2GDQA 1RP8A 4RR4A 4S2CA 3WLLA 2DFAA 5FA5A 4R34A 1O6IA 2Y8KA 4R27A 5AZ0A 5AC5A 3WK3A 3QVQA 3PJUA 3AIWA 3KCOA 4MUPA 4DLMA 3NXLA 4NRSA 1TCMA 2V67A 4M0XA 4HSHA 2HQAA 4NY2A 2PDNA 5CSUA 4O53A 1UH2A 3LCXA 1JXKA 3WBEA 3QBUA 3QV8A 1KRMA 4JTSA 3KP0A 3B8TA 2HMCA 2GFTA 1NP2A 2FDMA 5I24A 1ZBKA 3ZJ7A 3MC5A 1C29A 2AAMA 1V02A 4I7UA 3EYPA 4W93A 1ZJBA 1US0A 4MPQA 2VZOA 5A8OA 1JAKA 4UTKA 5I5RA 4O19A 1XG3A 4WDUA 1B9BA 2A85A 2WW5A 3KRBA 5ABFA 3CYVA 4LYKA 1G4TA 1B31A 3B04A 3HV9A 1LT7A 4K37A 2NW0A 4LY8A 1BQGA 1P7TA 3NEVA 2ZE3A 4XO6A 1XQLA 2H6RA 1Z42A 3S2JA 4AF0A 4S3AA 1Q7ZA 5LNRA 2ZQ0A 3CUGA 4W7WA 3M5YA 3RCYA 2P10A 3UA3A 3SGGA 4CNSA 2E5CA 3EOEA 2BXVA 2NT1A 1TMHA 2FYMA 3OPSA 3W1PA 3LCGA 2CNCA 3E0IA 1X98A 2J7GA 2PURA 2QVHA 3QSRA 4E6MA 3ITGA 3CTLA 1GOWA 3SJNA 4U3CA 3FAWA 1CZ1A 2WHLA 3W81A 2D22A 1FWIC 3AIRA 4WJXA 3A3XA 2CBUA 1YEYA 1ZP4A 5KINA 1E6QM 3EOOA 3B8DA 1IWAA 3JUGA 4FLQA 3DEQA 4YTTA 1FFQA 2GGIA 3CAQA 4JFSA 1SMAA 2FZBA 1NF7A 1ODZA 3FYYA 2DUZA 4NI8A 3VINA 5I77A 4CQDA 2E6YA 3BOLA 3GW0A 4L7ZA 4Q8NA 3BAJA 4JIRA 2J66A 3WSUA 1D7FA 3GDMA 3UZYA 5CC5A 1XIFA 4ACZB 2FVKA 1Q6OA 5M1TA 4RV8A 2Q3RA 4G5DA 5AC7A 4LAKA 3K4AA 3M0XA 4LOCA 4GVFA 4DX3A 4K38A 1QPRA 1YHTA 3WQEA 1QNPA 3QLLA 4BZYA 2CKSA 4L6DA 4E2BA 5DANA 4U2ZA 1EQPA 5I07A 2BY1A 3C2EA 3SY8A 1XLBA 2V5KA 1C8QA 1T41A 3RX4A 5FF0A 1ZB5A 1R3TA 4GZJA 4IIFA 4IQEA 4J3WA 2WCGA 2PDJA 5HUPA 2H9AA 4GD0A 2BGSA 4IMEA 1K02A 2HPMA 3ARSA 2J75A 5FI8A 3VX0A 4HHPA 4Z1BA 4IIHA 4IGHA 1OCQA 4PBFA 3W1RA 1E73M 3BDKA 1C8XA 3CH0A 4MFEA 2PZNA 1UWIA 4LUSB 1M01A 2PRHA 5CCZA 4C65A 4DBEA 4KEUA 4XIMA 1B3ZA 1XIHA 3RX3A 4Q4KA 3N12A 3FVMA 1F5ZA 4H4IA 2HSAA 1F73A 3W3OA 2INFA 1J5TA 2WBGA 3VI2A 5C2GA 5I3JA 1KKOA 5A6TC 5EPDA 1UC4A 5HPCA 2WVTA 1A3HA 4O15A 3S5YA 1E55A 3TAOA 4XO7A 3I6TA 3PZOA 4C5ZA 1K9FA 4AEEA 3FAXA 3DKLA 3I3EA 5C2CA 4X63A 3FXYA 3CT7A 2Q8ZA 1HKWA 5GNXA 1EXPA 1MSSA 2FVMA 4WVXA 4AD0A 2G50A 4HPJA 2WSYA 5F2MA 1VEMA 4NVTA 3BSMA 1C7SA 1GT8A 1HKJA 3T44A 3F5KA 3DN5A 3PHAA 1KCZA 1DJYA 3EEGA 4MJ4A 4QG9A 5CZSA 4C5YA 3LM3A 2HE5A 4HHLA 4GCAA 1DKWA 4O18A 1AH0A 3SURA 4BI6A 4AEFA 2E28A 2VFHA 1EJ7L 4IH3A 1TV7A 1PKNA 3WFLA 2R1KA 1IV8A 4CQ8A 3WY1A 5B7YA 1CI1A 3FXGA 4B4FA 2BODX 3IV8A 1G01A 3EKLA 2PF8A 2Q6ZA 4AH7A 1OABA 2F84A 3SUUA 4WK9A 4LANA 4HGXA 3C0QA 1LBMA 3IIVA 2X05A 2XSXA 3CC1A 4OV4A 1VFUA 1LORA 3S6DA 3NDYA 3AS3A 4AXNA 3QR1A 3LS9A 1JCTA 1KFEA 3W6LA 4ZCWA 1OD0A 3LY0A 4NAEA 4HCLA 4Z1CA 3CUJA 5DBUA 4KF1A 1AJ0A 2YW4A 1JJKA 3BLDA 4G6CA 3A4WA 3WLTA 2WZHA 1BRLB 2PGWA 3B05A 4KWVA 1K4HA 1XLMA 3NVTA 3M46A 3TLQA 4IL2A 4UXDA 5H2ZA 3HB9A 2J9XA 1K77A 1SFTA 4EPBC 5BRQA 5CBBA 4N02A 2XVNA 4Z2GA 4Y9NA 4M6UA 4L4LA 3FLUA 2ISDA 1XIEA 3HGSA 2XWEA 4QS5A 1IQ8A 4V2XA 4BI5A 5A6SA 2QPSA 1G0CA 2PDLA 3TXZA 3G5EA 4US5A 2ZUVA 1OT2A 1QXLA 2EKCA 4O1DA 3CH9A 5IM51 2ZUWA 4UNLA 3NUKA 1XQKA 2VDHA 3MSYA 1XGZA 4UB9A 4FNTA 1XDMA 3VO0A 3MVIA 2NX1A 1I6NA 1LBFA 1GVSA 1HJXA 2E8ZA 1NFPA 1GORA 3B8IA 1KBLA 4HBKA 4J27A 1W1TA 3LENA 2NT0A 3CIWA 3VX1A 3F4VA 5LNSA 2FH6A 5I23A 3FA5A 2C7FA 3LRKA 4JTQA 2OJPA 2ZRXA 3CHVA 2WVUA 4MYAA 3TA6A 1M65A 3VCRA 4S3CA 1OFQA 4HNLA 2QJJA 4AISA 1ZHAA 2ZX9A 1VFHA 2ZVIA 2PLMA 4JOMA 1U5JA 3BH4A 1JR1A 3QKEA 3EOUA 4QAWA 3VIOA 1UPPA 1MRAA 3U57A 4UFIA 2I17A 4JX6A 1ITXA 2Z26A 1QWKA 4HSOA 4DO7A 3FYPA 3HV8A 1QHPA 1BYCA 4KIEA 1GOMA 3UWYA 1Z48A 4DN1A 5C5YA 1F4HA 3TJXA 1KGWA 3EWDA 1PHWA 2FJUB 4P7OA 4WJ8A 3EKGA 2HBVA 1G9HA 1PWMA 5I2UA 4P61A 1SZGA 4Z08A 3TWAA 4QISA 4LW7A 1TV3A 3UR7A 4WDWA 4QITA 4TMCA 1BXNA 3WNPA 3PFRA 2BSLA 4J7RA 1V3MA 2OT0A 3CQ0A 5FESA 4LCQA 2B7QA 3WMCA 2ZRWA 2NV1A 1T8QA 4BY3A 5AHFA 2HCVA 4CN4A 1GQLA 4DEFA 3PJTA 3SW6A 3C3NA 2ZIDA 3UYCA 1L8PA 3U5YA 3UJEA 3RXZA 2J47A 3O15A 2QCDB 3RRXA 2QMJA 4J3VA 4RZ6A 3LCLA 4MLRA 3L0NA 4LVDA 4PMRA 4QXIA 1JF5A 3BC9A 5DT7A 1FY6A 4UQEA 1QVBA 2ZX7A 3FYOA 4LC8A 1GYMA 2CETA 2F38A 1F6KA 2AL2A 4MYXA 3W85A 1W8SA 4LJ3A 3A5FA 3GKFA 4O16A 3E0FA 2RDXA 4D8AA 3CPUA 4XIAA 3E74A 1ISZA 3S1WA 3GTHA 4QQ3A 2VJXA 2IQTA 3MUIA 4I5UA 2RJHA 3IACA 4LNCA 4JX4A 4X22A 4HZ7A 3WUGA 1PYFA 2V30A 5LIKX 1E40A 3M64A 5BRBA 3FJ4A 2E5DA 1VRXA 4JZ5A 3CUIA 1OFDA 3KX6A 2HROA 4GVHA 4U2YA 5HINA 1RA5A 1UJQA 4Q32A 1NELA 1T7LA 3VCNA 2XIIA 5CSSA 2WHJA 4PFHA 4JIEA 1XWYA 3QN3A 3KOYA 3L0GA 1PIIA 4H9ZA 1MUWA 1DE5A 1V7YA 1WXZA 1UKTA 4I9TA 4RPQA 3SBFA 4IUOA 3GW3A 3AXHA 4H8VA 3AYSA 3LQLA 3R12A 4Z17A 2OCZA 3MY9A 3RLGA 5SWUA 3EDDA 1S39A 1XBVA 1SJDA 5D9MA 2VHLA 2Z00A 3T78A 3WK2A 4DZIA 1EHAA 4GVIA 1EP3A 1A5AA 2IKHA 1XICA 3W87A 2EPMX 1GZ1A 4J3UA 1UKOA 1QOQA 2DU2A 3OOQA 4YU1A 3SADA 3KOZA 2Z1VA 3QQ0A 3POHA 1A5BA 1QI4A 5E9AA 1TTPA 3SI9A 2OQYA 1Y65A 1I2OA 2PU0A 1QU4A 3GC5A 1HJWA 1BYBA 1ECEA 5HOSA 1XS2A 4ZO7A 2NX9A 4TX9A 2FLIA 3KLKA 3VDBA 2GOKA 4QGCA 1FOBA 4J28A 1QI5A 3LN3A 2LLEA 1GJPA 1P6WA 3KL0A 3APYA 2IXUA 1EL3A 1E15A 3QGVA 4O1AA 4FA3A 1PZ2A 4CCEA 4NKCA 2HWGA 1E0UA 5DBTA 3IRSA 1FXPA 1VCFA 3CQKA 3UJRA 4FF5A 4KETA 2WXDM 5LXXA 2JEQA 1IZKA 1D3CA 2GL5A 1OJXA 3O1NA 3ONBA 3SN4A 3WK1A 3LERA 1R3YA 3REQA 4GUJA 3LMYA 1XRSA 1MW1A 1HGYA 2FVLA 5CJMA 3WLQA 2BG5A 3PM6A 1DQXA 4HHMA 4C6CA 1MQPA 1BXBA 4JQ3A 3MQTA 4XZWA 3FCPA 4H83A 1XBYA 2ZVRA 4ADSA 1JPHA 3VDHA 2QEZA 2OFJA 4FNPA 2RGLA 3IJDA 4RE3A 4ADTA 1AD1A 4I7VA 3SCQA 3VZZA 1Q6RA 1RV8A 3STFA 3F2DA 3BICA 2ZZ2A 4E4UA 2WJZA 3S6OA 2PUZA 1YDYA 3S3GA 1LOLA 1RHCA 4QNWA 1ONRA 3BCDA 2IPWA 4LF2A 1KTBA 3VC5A 1UOZA 2PDHA 2C15A 2FGBA 2NSXA 2Y8UA 2IUZA 3GVWA 5CPTA 4XKYB 3MUAA 4IG2B 4M6PA 3TYDA 4AHQA 2FMNA 2PD5A 3IGXA 3QPZA 2QZRA 2REQA 4RL3A 4ZQRA 4I90A 1FTXA 1EKOA 2VOTA 2CIPA 3ZWTA 1HZYA 1OGSA 4X9SA 5BZAA 4EIVA 2WKGA 3CASA 4DJED 4CEUC 4GBDA 2G0WA 3QR3A 1G4EA 1HFBA 1XYMA 2VDIA 1KCXA 3W1TA 2A1YA 2MNRA 1A5SA 5FJUA 4H9UA 1QO2A 2HS8A 4C6EA 3QW4B 1ADDA 3NPXA 3EMZA 3O2LA 4HMNA 2P8BA 1XIDA 3UZJA 3B8UA 3CIVA 3EA1A 1LRNA 3QC0A 4GJIA 2C0AA 3CZEA 2OEKA 2CPUA 3UFYA 2FB3A 4QCEA 1DQWA 3RO8A 1LL6A 3IIXA 1KLYA 5EMYA 3MP5A 1K7FA 3MUY1 3O07A 4WY0F 5CSYA 3DFHA 1TUXA 5PTDA 1I4NA 5G1YA 5A2CA 1C8YA 2QW5A 2ZOXA 4MPKA 2D2OA 4HHHA 3BQ5A 1LROA 2DV0A 3OVRA 1QOPA 2WCSA 3UR8A 3QYQA 4LQ1A 3PZUA 3U7BA 4HIBA 2FTPA 3PZGA 1DBTA 3LZ3A 2QCMA 2AMXA 3O63A 4ML4A 4WX2A 3WH7A 4M82A 3U4AA 3DOPA 1ZNNA 3W86A 1NWRA 4F0SA 2J62A 3I4KA 4WDTA 1J0ZA 3V4BA 4GNKB 3W6YA 5CZTA 1S5VA 5FACA 3VE7A 1KXQA 3GX9A 3W2UA 1GWJA 3CQHA 4O13A 2V3FA 3FY1A 3R8RA 1UHVA 4C6PA 3CS2A 4K39A 5I03A 1ICQA 3T0AA 4C6KA 2F6KA 4FF7A 4L65A 1SZNA 3GKAA 4JL2A 4MNJA 1DL3A 3OVQA 4FZIA 3WLOA 4PMZA 5CGQA 3BZJA 1A0CA 2ZDRA 1HJSA 3AJXA 3PULA 1W9XA 2QDHA 3MU7A 4HU0A 2XVPA 4NQ1A 4DBUA 3GVQA 3AU2A 3CQIA 3N29A 4Y9MA 1EJTC 2CHRA 1DJZA 5BWFA 5TBOA 3GNNA 2OZ0A 2GUYA 4EOUA 1V3HA 5BCAA 2WLYA 3DYMA 3E6EA 1FKWA 3T1GA 1FXQA 4LBUA 1EHNA 5DRCA 1XPYA 3BAYA 3O6YX 3R6IA 5I09A 1ONEA 4ORMA 3WD4A 2OSWA 1OGBA 4D6FA 4B5SA 4UR8A 4ICMA 2G3FA 3TTOA 1R2RA 1V79A 4CD5A 2WJDA 4LCRA 1GW1A 2Z1XA 4E2VA 1GW9A 5EFFA 5AC4A 3CO4A 4TVCA 1R2TA 3RM4A 2JKPA 3MZNA 3U3HA 1TPFA 1EPXA 1JFHA 1OFPA 4GY7A 5C9XA 2Z7KA 3MP4A 1U1JA 4RCXA 4FP1A 1IEVA 1V3JA 4LVFA 3CV2A 4QRNA 1LQ2A 3N14A 4UTLA 4X2PA 4ZEPA 3LEPA 1PWLA 1B54A 2XWDA 2HNHA 1U30A 2YXGA 3WFZA 1OINA 4EVZA 4IF2A 2F7FA 4GKTA 4Q7NA 4AB4A 3WQ4A 1S2UA 3A24A 3UXDA 1K70A 3MDWA 3IIZA 1BLIA 1A3WA 3DKJA 5JBDA 1UZ1A 4S38A 4A8LA 2OELA 3TTSA 3OTRA 2Q01A 3KZSA 2FPVA 5DEZA 2GLKA 2H90A 1VR6A 3BSGA 1VBHA 4UR7A 4XBJA 3UWZA 2I9UA 3DU0A 3GHRA 1B1YA 5H91A 3H2AA 4Y2WA 1BWVA 4O1CA 4PB3A 2NVAA 4KESA 2R1NA 5IBXA 2JE8A 4P7QA 3UPWA 4LBSA 2A5HA 1W3KA 3CL8A 2ZUMA 1JRBA 2QGYA 3K4WA 3UXAA 2OOFA 3ZXWA 3QGAC 4D6DA 2ABAA 3A4JA 4AC1X 3UVAA 4K68A 4GX9A 4HZ8A 3VABA 3RF9A 1IE7C 2OYMA 1XC4A 2OO6A 3B0UX 3UNTA 3EWUA 4LUIA 5DFAA 1MDRA 4D8ZA 3LXCA 1EB3A 1IT8A 2OWWA 1FWSA 1CWYA 3DFYA 4IUGA 4UTTA 4C90A 3ICJA 4DYKA 3CZ8A 1Q13A 3QZEA 5D9PA 1KA9F 2ISWA 2Y1HA 5KETA 1ZAIA 1I2RA 2NUYA 1DOSA 2BGQA 4AD5A 3MI6A 3CWHA 4GFSA 4O1EA 5D33A 1FH8A 3PK7A 2JGYA 4IFKB 4GQRA 4URIA 3GBEA 5IHRA 4NZ5A 3VKCA 3T2OA 3U2OA 1X6LA 4QCFA 1J2BA 2DVTA 3TMQA 2PTXA 1UWRA 1W91A 3NGJA 1EWEA 4LUYA 3I7QA 1A0DA 4W5UA 3M5VA 3AXXA 3AMDA 4HZMA 3B9AA 5EY5A 1UD4A 1E6RA 3JRKA 3W70A 1MNSA 2RDWA 4CGTA 1O5QA 4ZO9A 5ABHA 3CZJA 3QGKC 5HQMA 1O5RA 1Z3NA 3GUGA 3TQ0A 4D6GA 1W5NA 3G8RA 3NQEA 1GNXA 3OB8A 1CT5A 1T8XA 2ZRVA 2C3ZA 2CYGA 4L4OA 3T7VA 1B90A 3FOKA 1TQJA 2GVLA 1S38A 2PDQA 2VENA 1AL8A 1VLIA 3OBEA 1H7PA 3TW7A 3BVJA 4I9JA 3FIGA 1AQHA 3TDFA 4OJYA 4W8AA 1UASA 4GYFA 2AL2B 4J1OA 2ZRYA 1MVYA 3NQMA 1MUCA 2V82A 3R1ZA 4D6JA 2VRJA 4RKAA 2XHYA 3TONA 2NUWA 3DDMA 5D37A 5EKYA 3C86A 3QV6A 3GB6A 1FQ0A 3U2ZA 1R87A 4LFYA 3SM0A 3G1AA 2Z1BA 2W5FA 5AC8A 3OHMB 2P5NA 2HS6A 2XU2A 4ILSA 1UP0A 3NYDA 4ZTYA 3HG5A 4IX2A 1KBBA 4JTIA 3WLKX 4PUUA 3RM9A 3URNA 4HSNA 3LPOA 2D3LA 3ZR4A 3UCCA 3HQNA 1W1B1 3LPPA 2CLLA 1CCWB 2X8RA 1M1BA 2IS7A 4WOZA 3CO8A 3N73A 4EF9A 1CGYA 1WA3A 3BGAA 3MS8A 4WSJA 2D24A 3Q65A 1A5KC 2V2DA 3TCEA 2BVTA 5F1UA 3OLGA 1V77A 4DBSA 1FHDA 2RKXA 1DIOA 1THFD 2NLYA 4AY8A 1K9TA 1JG9A 2E67A 2CBJA 4DZ5A 2OVLA 4A3UA 4NZFA 2DUXA 1GCYA 3EWYA 5A1AA 3AZSA 4XVDA 1UD3A 2Y85A 2Y61A 1U22A 1UQZA 3C2YA 3K1DA 1S1RA 1PZ1A 4JNMA 3TSMA 1PUDA 1RALA 2BXZA 2GGHA 1XYCA 2J25A 1F3EA 2DIJA 1VIWA 5CBJA 3PWAA 4UTJA 1C9DA 3VUPA 4GQGA 1MWOA 1K03A 4IGNA 3SCOA 2RFGA 3WNMA 2I5GA 1X39A 4LUJA 1K8ZA 1JZ3A 3H70A 4ML9A 4XZNX 1CYGA 4IPPA 1LUCA 1FWTA 1Z6KA 5B80A 2DJXA 4D6EA 4XBKA 5M5DA 1ZL1A 4WCJA 2VEGA 4FLRA 3UZXA 1W5OA 5A6AA 4JTEA 3AQUA 3E0WA 2CBIA 5FJRA 1REQA 4MVAA 4XV0A 2R6OA 4D2JA 2QNEA 5A6BA 3WJXA 1SJBA 3W7JA 2O92A 4MZ1A 1LL4A 3WDPP 5BYWA 2ZX8A 5LHEA 4LRSA 2OTDA 1VYSX 3QTGA 1E6NA 3NQCA 4NU7A 4D9PA 3USZA 3W1UA 4JDBA 3GVRA 1SZRA 2DH2A 6PTDA 3SECA 1TTQA 3GAKA 3S4TA 4R7WA 2VMFA 3ZJ6A 3OQ8A 4F8XA 3GFZA 5GQBA 1BGAA 2VRKA 2HJPA 1TRDA 2EO7A 3BJFA 2PU1A 4C6QA 3QH2A 1GOQA 2PCEA 4NNCA 3OZYA 1WAWA 3OLDA 4QX4A 5AYYA 1JDDA 2PWEA 1JZ4A 1J6OA 1NY1A 1HJUA 1JD9A 4O54A 3I3DA 1FWRA 4XAFA 1SO4A 1KM4A 4DXKA 2PI6A 5C71A 3WLHA 3WBYA 3R7MA 3VPLA 2GYIA 4JQ4A 3EDEA 3QC3A 2E8YA 1BHGA 3N4FA 2XN2A 2Y4SA 4IQJA 1KM3A 3EZ4A 3A64A 2DW7A 1XKJA 1I8JA 3UXKA 5XIAA 4P7NA 2HVNA 2GVEA 3QY8A 2V5CA 2HV5A 3QLDA 1OFEA 1XF0A 4IFKA 4JFTA 2YLLA 2OPJA 2BX7A 1B3WA 3W00A 1LYXA 2DSZA 3WJZA 4MAZA 1F7BA 5K4ZA 3WLJA 2B31A 3K8LA 1PDZA 5D30A 2V0TA 4H1ZA 3URAA 4GI9A 3V36A 4HQVA 5EMUA 2DZWA 4UTWC 3BOXA 1VBGA 2W63A 5D8WA 1MW0A 1UH4A 5AYXA 1ZBCA 2VTFA 1I75A 4KFNA 3OYXA 4GZEA 4DQWA 4K7YA 2JIWA 1V3KA 1FBAA 1RQBA 3APTA 3Q67A 4FOUA 1AQMA 2V9DA 1KBJA 1LOQA 5AHNA 3HPSA 2WVVB 2VR2A 1EOMA 3VKDA 4C1KA 1TPB1 3BLIA 2XVLA 2NLIA 4IJBA 3T8QA 2XM2A 2O4MA 1TA3A 3D0CA 2W62A 2DIKA 3NQGA 4Y8FA 3PSWA 4O4WA 2EF9A 5DRIA 1YIXA 3H7RA 3U48A 1E6XM 1UW9A 1M03A 3SJ3A 1H49A 1WDPA 3MANA 4A35A 5J5DA 2WNNA 5AVHA 4LS0A 1RPXA 5C9UA 4PMNA 2PS2A 1XSIA 1OSEA 3NIYA 4O11A 1OFAA 3BLFA 1VEPA 1EJWC 4ADUA 2RGMA 4GE8A 5LGZA 1OYAA 5I3HA 5A94A 5D2YA 2CFFA 1CXLA 3PJXA 3GH7A 4H2HA 1PDYA 1WAUA 5H8MA 2WJFA 3MB9A 4CQ9A 1VKFA 3LGGA 1FA2A 3SQMA 3VIPA 3LNMA 5DMMA 5CPQA 3K4DA 4DELA 4DLFA 1MFVA 5FEZA 4MFDA 1P4CA 3CJPA 3PBVA 1LDCA 4HU4A 3ELFA 3B9EA 3HJEA 3ZSTA 1W9UA 1RCOB 2ZXDA 1VHCA 3R8GA 3V5FA 1A5OC 3KVJA 4TV6A 3UWVA 1TA3B 1M9HA 2P0OA 1W17A 2EPKX 1EXBA 1W5PA 3EX1A 3GNPA 3VTRA 1TWWA 2QQ6A 3N3TA 3O3RA 2Z2AA 1EC9A 3COTA 4E8CA 3MHGA 3TOYA 4HB7A 4GYPA 4NZ3A 2X2GA 1EDQA 4PC8A 4MHBA 3KWXA 4PCFA 3HIJA 1XM3A 3GXNA 1E5NA 1W1ZA 1L2QA 3EA2A 4B5UA 1FKXA 3VOHA 2R1MA 3OZPA 5IFTA 4UQCA 1ZJAA 1U1UA 5FJOA 2UY5A 3SGUA 4AZCB 5IXEA 4WD0A 1OF6A 2XGBA 4B16A 2QV4A 2BB0A 1WKFA 1I1XA 2ANUA 3AIUA 4NHVA 4DO4A 4GH1A 5E6ZA 3V1PA 1G69A 3KOXA 4ATWA 3GTFA 2VX4A 3MA8A 4AW7A 5E93A 4HA1A 4HPGA 2QIWA 3CQJA 4S23A 3R89A 4GQQA 2HZGA 5BXRA 4JQ2A 3PBGA 4RXGA 2OKTA 3AZTA 2C1HA 4P7LA 2PODA 1BWKA 2WSQA 3ZS4A 4JCMA 1VPXA 3ZLFA 2IW0A 1E5JA 2HRWA 4IHCA 3EEZA 2AKZA 3EWCA 4GIEA 1A5CA 2QGHA 1M7OA 4PMYA 3S6TA 1TREA 1F6PA 1FWGC 4NSBA 4F4RA 3UCDA 4F0KA 4KRZA 7A3HA 5DXYA 4RE0A 3O9NA 3PPHA 2B7NA 4XSLA 1JCJA 1EGVA 4CNPA 1SPQA 4W7VA 3VD4A 4IOTA 4GVGA 2XGIA 2UY2A 4LGXA 4UMBA 4EP8C 3MW7A 3KTCA 1YTDA 1NIUA 4UNKA 1UD6A 2W0UA 1TG7A 4BKNA 2ZFAA 2EAWA 3ATYA 3EOLA 1W3IA 3WQ8A 4C6NA 1EPVA 3E2SA 1LT8A 3W1AA 4IPLA 1JFXA 5REQB 4GNVA 3TYAA 4KFPA 3II1A 4DRSA 1YLVA 1K3UA 3NOEA 3LCHA 1HP5A 4GCXA 4R9OA 3CUZA 3RDKA 3S8HA 1OCBA 2Q8LA 1VFLA 3HGJA 4RZ4A 4TQTA 4ERAA 1OB0A 3OBAA 6TAAA 1A50A 1EX1A 1RVGA 4Z2IA 4UNIA 2VWTA 1WCGA 2GVGA 2D2HA 3B06A 1KD0A 4KEMA 1HL8A 1WXYA 6TIMA 1SU5A 2YKKA 1TVLA 2R91A 1VB9A 4QS6A 3WDRA 4EF8A 2YSWA 2W92A 4KCWA 4PB5A 4W84A 2YXXA 1IZCA 1IYXA 1UH3A 1O5KA 3VIHA 3I3BA 4KPLA 3LXBA 3OA3A 2W66A 3EDFA 2ZKMX 2WKJA 2I9EA 2O4QA 3RNDA 1R2SA 2YL5A 3I7RA 2VEPA 1XISA 1KM1A 3CPGA 2BY0A 3WNKA 4PTVA 3K13A 3O6CA 3PAOA 3MCOA 4L64A 1C90A 6A3HA 4ZOBA 4CUCA 2B7OA 2CLEA 4K36A 3ATZA 5ABFB 3W07A 1V3IA 3FK4A 4F0MA 5ECUA 1RSCA 3ONCA 3TQVA 5CG0A 2X1UA 2HISA 3KS6A 1I45A 4N9BA 3N3MA 4ASTA 3TIMA 2RDTA 4E8DA 1TWZA 3M0ZA 4MZ8A 3FX4A 3TEVA 3AS1A 3UERA 1GJWA 3UG4A 3WF1A 2QCLA 1TJ2A 1R3VA 3H22A 5JQ9A 1RCQA 1Q6DA 2EHHA 2F2KA 4JFUA 1V7AA 2WO5A 3REQB 1GEQA 3KBMA 5EBUA 3WJWA 5CC3A 4Q4OA 3P5YA 1UBPC 2ZWZA 1PTAA 3LRLA 1KQZA 2IKJA 1WE5A 4NJHA 3E02A 5KZ6A 1R7AA 3KCJA 2XM1A 2WMJA 2NQ9A 4MWAA 3CHCA 4ZOCA 4DY1A 4FOKA 1L2UA 4XAGA 1KRBC 3WL1A 3LLFA 5FF7A 4J3TA 4QBXA 4IMAA 3UJ2A 3UPMA 2IQDA 3HFYA 1WUFA 1ZZMA 4AX7A 3LV5A 2CLPA 2Y24A 3TFCA 1P0KA 3N9RA 3BMWA 1VS1A 3EWXA 4XZMX 1UG6A 3VGDA 4KCUA 2QUVA 4E38A 3TC3A 5C55A 2Y7DA 4QJ1A 1AH4A 1OCJA 1RY0A 4GJJA 4Q4SA 1X6UA 3CL7A 2HXTA 3KHDA 2DZUA 4LNYA 4ZQPA 3NQ7A 1CPUA 3IJQA 3HOJA 3S2MA 1YXCA 5DO8A 4PTNA 4FALA 4HPNA 2ZUUA 1Q4NX 1DJGA 1VH7A 2ZRZA 1H63A 2OSXA 4XZIA 4ZTXA 4V28A 4O0KA 3W74A 1UWSA 1EEPA 1J0IA 1S2VA 2WHMA 1QI3A 1UD8A 4R7JA 4B2DD 3C8NA 2OGYA 1H7XA 5CPLA 1RZMA 3W01A 3M0VA 4YMZA 1XHGA 4HTYA 1GOKA 1XLAA 2ZC8A 5AKQA 1N8WA 2PDWA 1ITQA 3BW4A 2DH3A 1JGIA 2OG9A 3W53A 2E77A 5BNKA 3EWBX 1LTDA 4BF7A 4LC6A 3NEHA 2VC9A 2DORA 5FL0A 3SCSA 4J3XA 3H21A 1SM9A 4MB4A 2ALDA 2XPKA 4HOXA 3WK0A 5RUBA 2RJGA 4L4MA 2PTYA 3F5LA 2NXHA 1HG3A 2IPGA 1DJQA 1W6TA 1W31A 1GQIA 3DERA 2PB1A 3WZ0E 3Q58A 4V15A 3NQFA 4HNVA 4OU1A 5EMLA 3TYUA 3D5HA 2QCEA 1EF3A 1ODUA 4CNOA 3ZLHA 1O7AA 1XINA 2WQPA 5KSWA 4WJEA 3KP1A 4B3KA 1K7XA 2UY4A 3CIXA 4TX6A 5HBFA 1KM5A 3DFQA 5DXXA 1NP0A 3EX6A 1VZWA 1E6PA 2FPYA 3MP3A 3WEOA 2GJXB 3OYZA 1S2AA 1K8CA 1NU5A 4DPQA 1GOIA 1HVQA 4ZVJA 4CEXC 3BPWA 3F4NA 4TU1A 2ATSA 2FPTA 3FW6A 1SQ7A 5XIMA 3F4CA 3NO1A 1YMYA 4TV5A 4GPNA 1BG9A 1SR9A 3S2NA 1O66A 4MSSA 2GVJA 3HG3A 3HTWA 1MNZA 4AWUA 2OLSA 4AU0A 3TKFA 5M17A 4Z2LA 1RR2A 4S2BA 2J77A 2QCNA 2Q3OA 2KX9A 3T0DA 4IISA 2BY3A 2WCAA 4M24A 3CBWA 2XISA 4ZODA 1EJSC 1O5XA 3GO2A 3NSXA 3FDGA 2AMGA 4UOQA 3AZRA 1GEHA 3DAQA 2XVGA 3ECQA 2P53A 4GUGA 2ZXQA 3N2XA 2E0PA 2ZUSA 4FX6M 7TIMA 1V08A 3OLIA 1GOOA 4P8WA 2EQDA 3CTTA 3GXMA 2QPXA 6ENLA 5F2LA 2ZZ5A 3C8FA 3P0WA 2XGZA 2PDBA 3HF3A 3HM7A 3XINA 3HFTA 2D69A 1OFRA 4UTTC 3W7QA 4M29A 3CHEA 5E09A 4YTRA 2YX0A 3IK4A 3KBSA 3MV01 4L1XA 1OHLA 5FCZA 5LZLA 4QP0A 2C6QA 1K8XA 3LI0A 2QUNA 4AWEA 1S2WA 2RUSA 4O8RA 3A22A 1ZJHA 4JKKA 1JI2A 2A3CA 1XYZA 4E3VA 1XIMA 8A3HA 4HZ6A 4I5RA 4MJ2A 3UY8A 4PUKA 4RLIA 3ZT5A 1KCLA 4F2TA 1OM0A 1PKLA 2YL8A 3CEUA 3QOMA 3UD6A 1Z9AA 1W0MA 5C8BB 5T9BG 3P93A 1PTDA 3IJ7A 5MKGB 4F9JA 1Z8AA 1MRQA 2Z1KA 2ESCA 1R47A 4TIMA 1XLLA 3M0MA 3A47A 3TH6A 4GZIA 1UR3M 1DJIA 3PBWA 2UY3A 4DWSA 4FNUA 1PIGA 3LSBA 3MKCA 1X7FA 1SGJA 2NV2A 4JTDA 3PPFA 1POKA 1PEZA 4Q6JA 1ZTVA 3V16A 3TYBA 4M81A 4GZ7A 4ZMGA 3HPXA 4D71A 5I3FA 2Q09A 5AYIA 2EG6A 1EJVC 1JZ7A 1JYNA 2A21A 4O0QA 1VFFA 3T40A 1RJQA 4UFMA 4ZO6A 2XH7A 1EBGA 3E49A 4Q8OA 4FXJA 4DF0A 1TPDA 1J96A 5A8PA 3OBKA 4FPSA 2A7NA 1PX4A 3P74A 2R94A 4DB7A 1H7OA 1QPKA 2QT3A 1AG1O 3LHYA 4JTJA 4DZHA 4UMCA 2HEJA 4EXBA 3QY7A 1J0JA 2YCLA 4O57A 3MUCA 4Z1DA 4PRTA 3V0UA 4DJEA 2YCIX 3DGBA 3L4ZA 1Z69A 4JHMA 4NJIA 1ISWA 1I2PA 4GOAA 1Q2RA 2PDKA 2YDQA 3H2FA 3D3FA 1I0BA 5B7ZA 2PDXA 2VXNA 5FAGA 5BXPA 1KBIA 3OQEA 3VZYA 2NXGA 3PP7A 2QDGA 3V5OA 2Z1SA 2JF7A 5HR6A 1KXVA 2P76A 3KUMA 4WLCA 4WXYA 3WG6A 3NM3A 3QPEA 4IIEA 4ZQCA 4M1BA 2Y5SA 1P6BA 2VZUA 3QY6A 3R13A 3KE0A 5GJMA 5C70A 3NL6A 3CZGA 3IUHA 1G7UA 5TNVA 5CGMA 2VUNA 3OJGA 3W82A 3IRDA 1JAEA 2VDGA 2PE4A 3P2VA 3ORWA 5T8GA 1UKPA 2INEA 4W5ZA 3A12A 1DEDA 5JH1A 2QR6A 4GUIA 3W25A 5AOUA 2YDAA 5A8MA 8XIAA 3WF4A 2WK2A 4ZR8A 1AMYA 3ITTA 1PJ9A 3GR8A 1YNPA 4BF9A 4MKNA 4JPGA 1CDGA 2VC7A 2VO5A 1SMDA 3JW7A 3HJZA 4YTSA 1XLCA 2YXOA 5M3WA 3WBXA 3HQPA 4BWLA 3EA3A 4O8AA 4PBEA 4XKYA 4NILA 3ZR6A 1LQ0A 2W9MA 1XFCA 2ACSA 1A3XA 2D23A 4YWIA 4TOQA 3NM1A 2Y89A 2YFOA 3NTYA 1V4YA 1JZ2A 4LX4A 2NQJA 1OF8A 3UESA 3LM7A 3H4XA 4G1KA 3V75A 3UZWA 1HP4A 4QTGA 3T55A 2G3JA 4DWDA 2ZX6A 4HMEA 4F0LA 4NAFA 3EB3A 2VL4A 4RDZA 4OBSA 4BK9A 1PB0A 3WQ6A 2P3EA 3S1UA 1I2QA 3ITVA 3VD3A 2HBXA 1NVMA 2E6FA 1DXIA 1XCXA 2VGBA 1PL9A 1MW2A 1OY0A 1CECA 4RJEA 3U5UA 1JUBA 2ZBTA 3A13A 4M6QA 1WZAA 4KRTA 2QF7A 1UR9A 2OLAA 3TTQA 2ODOA 1RJRA 4D6IA 1MXSA 2X09A 5I3GA 1P6CA 4GXPA 4DUXA 4DAIA 2PPGA 1ZUAX 4LB3A 1H5YA 2WANA 3GHUA 5FL1A 4MB1A 4L5ZA 2ZUTA 1O12A 2G96A 4HNTA 1XUZA 1UC5A 4I8DA 4ZB0A 4DJFA 1V0NA 3VNJA 4OV9A 1ME7A 4X61A 5DMNA 4O10A 2BWGA 3KW3A 3UG8A 1O94A 1GK8A 4N4QA 4AC7C 3W6MA 4JYEA 4TVUA 3TV8A 4GO9A 2EG7A 4M8UA 3LCWA 2V2HA 1SJCA 3AROA 3WQ5A 4AY1A 5E0KA 3C61A 1LCOA 1H4PA 3P84A 1GJUA 1R9ZA 1P1MA 2FQIA 4GINA 4CD6A 2VC6A 4K3ZA 5IDZA 4BHYA 3D47A 1RVKA 1WKDA 4JKLA 4GY1A 1VPYA 3DC8A 2X1TA 4RNIA 6REQA 3EXSA 3HPAA 3BZGA 3KOWA 1O4UA 3EWZA 4ZFCA 5A5WA 4JN8A 4WDXA 3LCIA 3L67A 3BV7A 1BTCA 2VGGA 1ENUA 4AF0B 5A6LA 4ZB5A 4HU3A 2RHGA 4TR9A 3W7HA 3G1XA 4V1XA 1FWFC 3TAKA 4MWAB 1KV5A 1XLDA 4GC4A 4GI4A 4OUEA 1M41A 3GTNA 1FWCC 5DCEA 5K4XA 5HJXA 5ABEA 1W1IE 1K6AA 3S1GA 1KM6A 4IXHA 3BUVA 4M3PA 2VELA 5LIYX 3WD1A 1AMKA 1PX8A 2QPUA 4ZE5A 3SFWA 1YTKA 1PXGA 3G1FA 2Y88A 3MCMA 2QJMA 2GWNA 1TELA 2VEMA 1FHLA 1IZJA 4FLOA 3V7PA 4MKSA 3VKAA 1UZDA 2OO0A 4EXQA 4P5UA 3FHAA 1QNQA 1RAKA 1SZEA 3GZ3A 1HO4A 1LLZA 5F4SA 4ZE4A 3KBJA 2V8ZA 1L6SA 1I60A 1PBGA 2FFIA 4L4PA 3MDUA 3R0KA 1TQXA 4KFOA 2QCCA 4M56A 2EXOA 2R24A 1AQ0A 4WKFA 4ERIA 4JCLA 1K7EA 3ABZA 1XXXA 5FEWA 3LBMA 1RXOB 3W7NA 5LA1A 3SCNA 3BAWA 7TAAA 3LHTA 1MZHA 1GOXA 2H8ZA 3VD9A 2ADAA 3E12A 3PNZA 5HK4A 2ONEA 3RK8A 5HR7A 4GYPC 3MI3A 3LHWA 4WKAA 3BMXA 4Z1AA 4HCHA 1V6UA 3N4EA 2DVXA 1EP2A 3A4XA 1A5NC 3B9DA 1EIXA 4Z2JA 5CPMA 3FS2A 2BNJA 4NZCA 3TJLA 3HO8A 4Z1YA 1KV8A 2F61A 3YPIA 2J27A 3SCRA 2INZA 4NG3A 3MMUA 4DM2A 4QE5A 3ZYZA 2FTYA 5BMWA 3MCNA 2TPSA 6REQB 1MZRA 3MWAA 4IICA 2ZUNA 1LP6A 2GGGA 4C7GA 1EJXC 5I79A 4XD6A 3G18A 3TX9A 3MV11 5HATA 1AODA 1DJHA 2J8GA 3P8IA 3LPGA 3I65A 3N19B 4LYQA 3PR2A 5FD0A 1R6WA 2FTWA 2J88A 3QQ1A 1W1A1 4OKDA 4PEEA 2J13A 3B03A 3TMLA 1DWJM 3FA3A 2VFDA 1UPMB 2WOQA 2Z29A 3H7VA 1NWUA 3UT0A 1X96A 4US6A 4XD4A 3H6OA 1V3LA 4LVAA 1VBRA 3TOPA 1UIOA 5DY2A 4XVEA 2GPTA 1VGAA 3BMVA 3RPMA 4DYEA 2J9ZA 3T81A 3BE7A 2WNWA 3BLEA 3FHQA 1K9EA 1RLDA 3BW2A 4GBUA 5HQEA 1US2A 1SZFA 3OODA 3N2TA 1RUSA 3THUA 4RV3A 1FDYA 3M0JA 3VU2A 4FO4A 3G1SA 1HXJA 2FZ8A 2E3ZA 4K7VA 5GNZA 3GM8A 1L6FA 3IJ9A 1E3XA 4J2MA 3WJSA 2YFNA 3TC7A 4ZO8A 2YBUA 2YR1A 4HD5A 4J3ZA 1B4KA 1Q4WA 4JNYA 2AL1A 1UP2A 1ISVA 4LAUA 1WX0A 1QHOA 7PTDA 1G4SA 2BHUA 1XJBA 4I9MA 1GVRA 1QI0A 3UXLA 2X7WA 3UP8A 1KWGA 1W37A 4BQ2A 3DYPA 1Q3NA 1ZSXA 5JBEA 1S2CA 4DM1A 5DMLA 3OIHA 5HXMA 4JAWA 4WF7A 3PB0A 2PWVA 1B30A 1C8VA 5HWNA 1QPQA 2FZ9A 4YCPA 5IOBA 3EDJA 3I6EA 3MO4A 3P0XA 3UJSA 4LV4A 4E4PA 4I6KA 2F6XA 3L4TA 2E09A 3GYEA 4F0HA 1K8YA 3ITLA 4UFJA 3H2OA 4KW2A 4AAJA 4HA4A 3NL2A 4Y9OA 1WBHA 4DBDA 4OQVA 4N6FA 3H8AA 1TJRA 5K9DA 3AU6A 1OBAA 4YPJA 1SSGA 1PVNA 4FR6A 4OT7A 4LS1A 5A8NA 4P8VA 2VEIA 4QROA 5KTLA 3PJWA 1BWLA 4NX5A 2CLOA 2J74A 2PWFA 1RLCL 1YNQA 3QMTA 4GI8A 4B5TA 1ZBVA 2V3EA 4GIYA 2XIJA 3EDKA 4UQAA 3WQGA 3T07A 1CENA 1L8NA 3ZO9A 1GKQA 1FX6A 4J40A 1YBQA 4Z0SA 5DELA 3IVTA 4MWAD 1QR7A 2Y7FA 3ZFHA 4M19A 3W88A 2CLHA 2HTMA 3W7EA 4IMGA 1ITCA 1VD6A 4UZUA 2ZZ1A 4XB3A 4A2RA 3L5AA 3PC0A 4JKMA 3AWNA 1WQ5A 3ES8A 4ZXOA 2FHCA 4W4QA 4CVUA 4IT1A 1NFBA 7ENLA 1GUVA 3C52A 1KCKA 2PCQA 1Q6EA 4QIUA 3UWEA 2PC8A 5AC6A 3N11A 3F2BA 2J7DA 1M5WA 1JCXA 1XLHA 5FF4A 1DJXA 3WLSA 3WQVA 1FDJA 3NL3A 2QMKA 4OOZA 2ACUA 2V5LA 1BEUA 4NL1A 4QQUA 2PGFA 4AG0A 3EGJA 3GIQA 1OK6A 2O9TA 1KFCA 1CLXA 5J04A 2PWGA 2ZX5A 4GA8A 4YCOA 2BXYA 1YW1A 4DF1A 5E0FA 1C93A 1E70M 3WNNA 4JN7A 5H8UA 2VR4A 2PTZA 4CCZA 1JNEA 5BU9A 4JTAA 1CTNA 3U2CA 5HANA 2FHBA 4LUSA 2CCRA 3LNPA 2A4AA 1UB3A 4E0CA 2P3ZA 1C92A 4PMJA 4KWSA 1UWAA 5IRPA 3QR0A 4H7VA 1E0WA 1QOXA 3T08A 1TE1A 3AFBA 3S5SA 1B3XA 1XD0A 2QYGA 1D9EA 3ARYA 1GQKA 2TRSA 1M7XA 3ITOA 4E8GA 1UKQA 3S1XA 1F6YA 5DX7A 3KL3A 2X0YA 1TWDA 1TV4A 5BW6A 1PO9A 2DJLA 1MDLA 3O16A 1XLJA 2WYSA 1UD2A 5BMXA 4OBTA 5CPSA 2GZXA 5CC7A 3UPBA 4U3AA 4OUIA 3AJ7A 8XIMA 1W9PA 5JIWA 4WY0B 1MQRA 4MDPA 1E1EA 3BOFA 4PYSA 5AHMA 1GQJA 1XX1A 1W3LA 2FFCA 3GNDA 3CUFA 4IL0A 3L23A 3N9SA 1TX0A 4I7WA 4PTXA 1XW8A 3TK7A 1REQB 3RLVA 1GTHA 1SO6A 3WELA 4EAYA 3C0LA 4YN5A 1W3HA 4P8XA 1DVJA 5G4WA 4Y96A 2DPEA 1POJA 1KO0A 2H8XA 4Q4PA 3VNZA 2FZNA 1KKRA 4MY1A 3IJ6A 2QJGA 3V0SA 1RH9A 2WV8A 5G5IA 1QMLA 3S5OA 3DC0A 5CG7A 1YE6A 2YW3A 4IMFA 3KRZA 5LSMA 1QRQA 5E0CA 3V35A 2CLIA 3ZVHA 4E2DA 4C1NB 5HULA 2CZFA 1QUMA 1EUNA 1YDOA 1EDTA 4NXSA 3GXTA 2EG8A 4QR6A 2JKAA 3MWCA 4RNHA 2OOGA 1LQAA 4RDWA 1E9IA 1LG1A 4XAPA 4AQLA 2GJLA 3TR2A 2Y8VA 5AYZA 3BCJA 4ACZA 2CHOA 3LTPA 3UF9A 2YZRA 1HKKA 1OD8A 4BQ4A 3OVPA 3DFTA 3HZ3A 4YNGA 5ECVA 4H9VA 4AHPA 2I14A 4BI7A 2JQXA 5KZEA 1R9XA 3HQOA 4ZQNA 4ZSTA 3VNLA 3FSTA 1FFRA 1W9DM 1Z7AA 2X1SA 3NPUA 1XYBA 2VD8A 1JCMP 4DWSD 2VQUA 1W1VA 3C56A 5C6MA 1HKIA 3W1NA 1KRCC 2VKZG 1OG0A 4R9XA 1LOSA 5EMKA 2CLKA 5F1VA 3N2MA 4OHQA 4K6AA 5CEWA 3WUEA 4OGZA 3QTPA 1P7TB 3H7UA 3F7JA 3M16A 2IPFA 4K1GA 3CB8A 1JVNA 1V6TA 4M7TA 3PS7A 2JEPA 1VC4A 1FWNA 3KTXA 3DZ1A 1NH6A 4N0RA 4B5NA 1LLOA 1R9YA 2H3BA 4MGGA 4L61A 2W61A 5I3DA 5C9ZA 4A3HA 2CHNA 3QMSA 3UBPC 4K8EA 1E72M 1E0VA 3BO9A 4DUVA 1S3HA 3UYIA 3RMJA 3M44A 4GUHA 4E4FA 3WH9A 8CGTA 3DFPA 3IJLA 2UZ9A 1BQCA 7XIMA 3M1ZA 2OX1A 3ARXA 1J93A 3BGGA 4Z42C 4GXMA 1HJVA 1TUFA 4LF1A 5K9XA 4HPHA 2WZMA 2JKEA 3PN8A 2VI0A 6CGTA 3P62A 4CCDA 4G7FA 2OEMA 3H2CA 1OVDA 3VCCA 5A3HA 1YE4A 2WWCA 4JICA 1BVZA 4HJFA 5JXQA 4AFYA 2G41A 3EOSA 3AMLA 3UJFA 1FVPA 1FWJC 2HNEA 3BARA 3SIZA 4OBRA 4LEQA 3QSTA 2DQWA 1YPXA 1P0DA 1IR2A 1R85A 2ZRUA 2NVCA 3LHVA 3O6DA 4RDVA 4UIOA 2G4FA 3LD5A 3M0LA 1RQHA 4C1LA 3XIMA 1TMQA 3S2CA 2BASA 3C2FA 5CGTA 9RUBA 5D05A 4A2SA 1CGXA 4JEQA 3KWSA 3WLPA 1DYSA 2QXWA 1TR1A 3LG3A 2G3MA 4PMQA 1OYCA 3EPMA 3VGFA 4CLMA 1K4GA 5JIPA 3C6CA 3DI1A 2PWUA 5CAHA 4FNRA 5HWMA 4P2VA 4NP7A 1ZU8A 4N9CA 2SFPA 1QK2A 1V02E 1LM1A 1V0MA 4JD4A 2Q71A 2ZCGA 1PSCA 2A79A 2JF6A 2GSHA 3UVIA 1W3TA 4GI6A 2YB1A 1BVWA 4GH3A 3RLHA 2FZMA 2XN0A 1KFJA 2C91A 2V69A 4AZCA 1Q85A 1MEIA 3KM8A 3PZVA 1W5MA 3RJXA 1X38A 1B4EA 2E9LA 3W2NA 2D3NA 5HMDA 1S5NA 3VUSA 4K8GA 4A8NA 3AUJA 4HJWA 5CPNA 1CB2A 4HT3A 1Q5MA 1QBBA 1Q8AA 2QUTA 2R1LA 5LXEA 4IGMA 2PD9A 4GRSA 1B0IA 5LHFA 1BGGA 1KRAC 1BG4A 2PDYA 5D2TA 3WQPA 1PX3A 3IANA 1F3WA 3MJMA 4MY9A 1MUMA 4OECA 1EA0A 2XVKA 1OQFA 4AD2A 2ON3A 4A8IA 2VP8A 1YYAA 1WDRA 3GWQA 3UA4A 3FSUA 3GTIA 1Q7QA 4JIIX 3KVMA 5D09A 3NAVA 3VM5A 4XZBA 1FCVA 3L68A 4PR4A 2C13A 5HA7A 2J7HA 1IT0A 3AS0A 4AZGA 3NQDA 1EUAA 3THAA 4ECLA 1EA9C 1P1XA 5AHLA 2C79A 3TYZA 3SCTA 3WDHA 2YA2A 3N4AA 4W86A 4H7CA 1JYXA 3MKKA 3DCPA 5FF2A 1V0LA 3WMLA 4LSBA 3WD0A 5CLWA 1M7PA 3T6CA 2DY3A 4XTDA 5A6JA 2YDSA 3CMGA 5FJPA 2PAJA 1CIUA 1JDAA 5C0QA 2Q02A 1WOAA 1ICPA 3CM4A 1Z44A 1RD6A 2HDJA 1IEIA 3VKJA 4EKJA 3N18A 1PZ3A 5LIWX 3I6RA 4XAZA 1JQVA 1U5VA 4QDPA 3BANA 1JXJA 4B91A 3WQCA 5DMYA 3ARWA 1TV5A 4HN4A 2OR2A 3IPWA 3A4AA 5A6BD 1VFTA 5JBFA 4XZ9A 4YTUA 4PGLA 2X42A 3MHFA 5LYRA 5DF0A 4JXCA 3GBDA 4QJ3B 1P5BA 1R86A 4B9YA 2A6LA 4V27A 4H19A 1RJPA 4O28A 1TFVA 3STPA 3BLPX 4ZZ9A 1IXPA 2A3AA 1TPH1 1W3JA 4HP5A 1HKVA 2IKIA 4IQDA 3L9CA 4PCNA 4QSHA 4OTKA 3LGDA 5E9XA 3A9IA 2O56A 4D6HA 4A29A 4TMBA 1CW2A 1XLEA 3R0DA 4FNQA 2WMGA 3B3DA 2PDGA 4QSFA 3K8MA 1DP0A 1YXYA 1CXEA 3Q45A 4UMAA 1XGDA 3S42A 3LLXA 1NF0A 4U31A 3G1DA 2DZTA 3ZQ9A 4H6QA 3W75A 3ITYA 3QOKA 2FGLA 1AZ2A 2FJKA 2BOEX 5CZKA 1DXFA 3NPWA 3NO5A 3W73A 3P7YA 5AVNA 4O4VA 4GKLA 4PUWA 3G8EA 2Y70A 4MNKA 1CLVA 1QK0A 3NQBA 3PZTA 3PB2A 4KRUA 3OG3A 3AXKA 3O06A 3WCZA 3WUFA 3WUBA 2EPOA 2VR5A 1QFEA 1I2NA 1EOKA 2PGEA 3OIXA 1KM0A 1JCLA 4F2UA 3MYPA 4D6CA 2GVYA 3NOYA 5I00A 1Y0EA 3NQ6A 3V0TA 2JFEX 4DXXA 1H60A 3RPDA 3TROA 2X0SA 3MSRA 4U10A 3V3WA 3AHXA 4EANA 3NL5A 1FWEC 4UZSA 2YJQA 4K1WA 3ABOA 1RQEA 3CL6A 1GPFA 1M68A 3BG9A 2WB5A 2Q8XA 4F79A 4J4KA 1SVDA 1YNYA 4RW5A 1H11A 4XKMA 2TMDA 3M6YA 3HMCA 3WEZA 3CB3A 3GE7A 4HMCA 1TPWA 1CGTA 2X7VA 3NURA 4S3FA 2X40A 3SY5A 3SGZA 1EF2A 3POCA 1UQYA 1H50A 3B9OA 5K2ZA 4GC3A 2Y6ZA 1A49A 3ABRA 3WQWA 1E1CB 3W2JA 1FWBC 1QO5A 3BG5A 2VFGA 3SUWA 3WLIA 1Y5XA 4B15A 1E9ZB 1UMYA 3AIQA 3GG0A 3HGRA 4AXKA 1HKMA 4MAVA 4Q8WA 2QS8A 4HYRA 1H7NA 3ZLGA 3A3WA 2YBTA 3W9ZA 1L6YA 1SR0A 3PUGA 4DI8A 4E3TA 4Q8PA 3CGTA 4ORIA 4JBRA 2F8QA 3AYRA 4CNNA 3FV9A 7REQB 4MLJA 4UUIA 3E0LA 1IEQA 1JPKA 1R3SA 4FI4A 2WMHA 2GK1B 1LWHA 3BLLA 2V2CA 4TVDA 2HVMA 1OEPA 4XAYA 3QJAA 4MKVA 4DAFA 4PMOA 1DWGM 1YQ2A 2HE8A 5HUOA 3RILA 1A5LC 4QDWA 1EYWA 5CJNA 3W7GA 3L4XA 4LTSA 4ALDA 1H09A 4J35A 4HCDA 4IPIA 1GG0A 2R8WA 4EWND 4AIBA 2JGQA 4XZLX 3DESA 4C7FA 2DT2A 1FHVA 3M7SA 2CZVA 1B3YA 4G9PA 5FOOA 1GVQA 3WLNA 1RA0A 4CD4A 3PWIA 4F9DA 1UWTA 2FKPA 2NVDA 2QCGA 2W67A 4LUTB 5BRPA 3TTEA 4POCA 2I56A 3AHYA 3KZPA 3NJ3A 1VCGA 4GNJA 2GJRA 1PAMA 5MHBA 3F4DA 3EB2A 1R3WA 2OMAA 4ZA0A 3M0IA 2QUUA 3AALA 3VOCA 3PZQA 1IXQA 3F2CA 3N2CA 2OU4A 1A4LA 3VMOA 4BQ5A 1ISYA 3FFSA 1FWHC 1QTWA 3TN3A 2H3DA 4C6OA 4JDYA 3LSCA 1EBHA 4XZHA 4AZ7A 4H6RA 3P3BA 4J5NA 4C6IA 5IFPA 2NQZA 2WVVA 4L1WA 3RX2A 3W27A 4ZB2A 3RUBL 2Y5JA 4JFWA 3DUGA 3L2LA 3O05A 5H1WA 1W3NA 3OZMA 1T5AA 1JD7A 2QCFA 2OZ8A 3T4WA 3WO8A 1V8EA 4QEEA 3TYEA 4GFIA 4D8LA 3TA9A 4X60A 1OADA 3PZ9A 1TSIA 1XL9A 4LBRA 3GIPA 3PY2A 2D1ZA 3AHZA 1AQFA 3UG3A 2VEKA 1H62A 3IGHX 5D4YA 3ARQA 4JTCA 2QDEA 2P88A 1P0EA 5M2FX 4LYRA 3VNKA 1KBKA 1Y7VA 1GVOA 1KQYA 3PUDA 2CZDA 3PANA 1DJNA 1EGZA 1ME9A 3KTSA 4O12A 3G6LA 4XX6A 4UOZA 3TNBA 5HWJA 5IHSA 4NT0A 4YLWA 1D7KA 3WFAA 3TFXA 2BP1A 3VKBA 1G67A 4FXSA 1Q6LA 4N4PA 3WDQA 3CU2A 3LB0A 2BLEA 3T42A 2VOMA 5A8QA 3WKZA 4KH2A 3TLLA 4LWWA 2I16A 1LJYA 5JU6A 3JZUA 3HBLA 4JTTA 4F2BA 2ZICA 4KWOA 1RBOB 3LHUA 4AZBA 2PRMA 4IMCA 5D2WA 1E9LA 4HNUA 3ZR5A 1NQKA 1G7VA 3GFXA 3PG8A 3VK5A 4H9MA 5XINA 2OODA 1KLZA 2XIMA 2P1FA 2AQOA 3MT1A 3OGRA 1FWDC 3AMCA 3UW6A 3QZ6A 1TCDA 3BAXA 4QNEA 1UR8A 1QWGA 2WC3A 3PZMA 2EJ1A 1TWSA 1XUUA 3N04A 5LA2A 2OWXA 2ZA2A 4DJDC 2G3NA 4WHBA 3TW9A 2Z4GA 1Y5WA 2WMIA 4M80A 3N17A 3SY1A 1A53A 3WMSA 3F1QA 1E0TA 2QAFA 4H41A 3CV1A 1NOFA 4JYFA 3R4IA 2Y0FA 4GABA 5C7VA 1NEYA 3GG8A 2Z24A 1U5HA 1S5TA 4Z2KA 3RFAA 2O0TA 4S3KA 5G2HA 1IHIA 4O1BA 3GQYA 2ZA3A 3UR5A 3W83A 4I6VA 1AK5A 2Z2BA 3ERPA 3KRUA 5MF5A 4LH8A 2G4JA 2OYLA 2WJEA 1M3UA 2PDFA 3MTWA 1D8CA 3UGVA 5D2VA 4H8NA 2XYLA 4CQAA 3W7PA 2VX7A 2BV9A 1YPIA 2XH4A 3HN3A 1FHUA 1ML1A 1QNOA 1KM2A 2DZPA 3QKZA 3ARRA 3ID7A 4NZJA 3KCLA 1PHQA 1F3XA 3W7KA 4GYJA 3SR7A 3PPCA 3WQDA 2PWHA 2HK1A 2OWCA 4ICCX 1AD4A 1V03A 1PV8A 1GVFA 1UBSA 3B0XA 3BGJA 1XDLA 4K8HA 3C4UA 3LK6A 3ZOAA 1XP3A 3R0UA 3WF0A 3AC0A 4GY0A 4QJ4B 1I0DA 4CVWA 3LBCA 2WMKA 4QE4A 1W8GA 1B5TA 3S47A 5HNUA 5L9FA 4QJ5B 4E5TA 3EWWA 2IKGA 1LF1A 3I10A 4FAMA 2DIEA 3GXPA 3ZIZA 2IQ0A 4XUYA 4GMEA 1UR2A 1TJ0A 3TTYA 4HVXA 1OIFA 4WKHA 3W1MA 3MMDA 3WH5A 4W89A 3SN0A 1X1ZA 3PBYA 3LDVA 4KERA 5A69A 1WKYA 1HX0A 1J18A 3QFWA 3URBA 3W29A 5CC6A 3GR7A 3AICA 3AISA 4U5IA 4IPNB 2VYOA 4MG4A 4MTVA 1B3VA 3CUHA 5HQLA 3TWBA 2QVNA 2B4GA 3W7LA 2GGEA 4IX0A 2B0MA 1XCWA 3PTDA 1IEXA 1PIFA 4NYYA 4EPEC 1TV8A 4MOZA 4C6BA 1NDWA 4PMVA 4PMXA 1NSJA 1YKWA 2P0IA 4GLEA 1Q63A 3WDJA 3NGFA 5IDIA 4EXAA 3SQLA 4WOQA 4JIHA 5I02A 4FS9A 2F9RA 4DHGA 2PLCA 3VNDA 4RE4A 3DHDA 4MZYA 4UTMA 5U4NA 5LIUX 4AD3A 2YCKX 3SRHA 2Z0IA 2QF8A 1AH3A 3GXDA 4JY9A 5E70A 3KL5A 3W7RA 1ZAHA 1S3TC 4ICNA 1SO3A 4O52A 5HMEA 4S3BA 1AJZA 4JHOA 1Q6FA 3T0TA 1CXIA 1DHPA 3P60A 3S46A 1KXTA 1EWDA 2WSKA 3BCFA 1KR0A 3WMBA 2C8NA 3MPGA 3TJ4A 4A3QA 1IF2A 3CEPA 5G4HC 3VNYA 4H6KA 3PZIA 3H2NA 4X0VA 3R5EA 2J9YA 5A6MA 4WZHA 4D1JA 2F2HA 4WXZA 4D1IA 3FVDA 2VWSA 2WQDA 4PL1A 4DUWA 3O8AA 5F7UA 1IIHA 3AMGA 3T2QA 1OYBA 4Q4QA 2ZXAA 3WX7A 4PUDA 2V6AA 3IGSA 2V5JA 3S9IA 5E6YA 5D32A 2PP0A 3U4FA 2GQAA 3FGCA 2PBGA 4PMUA 4C6JA 4Q3MA 4IG2A 1B9ZA 3CZKA 2OZ3A 2YL6A 5HDRA 1A0EA 4P7RA 4GGBA 2OYKA 1OFOA 3EMCA 5HJYA 3KBWA 1UR4A 3DGRA 4UTUA 3U8GA 4ATDA 5CJ5A 3GHTA 1E1FA 4HNNA 3KEHA 2E1WA 1HUVA 3DG6A 4GQ0A 1IGSA 3B0YA 5EFDA 1O60A 4PE8A 3T05A 1SW3A 4C6FA 1FCUA 3W24A 1SUXA 1HTIA 1XGEA 4C6LA 4LALA 2FH8A 4DBWA 2JBMA 2CWNA 2X30A 5D02A 2XG9A 4FOJA 4LAZA 2Z6JA 1BF6A 2POTA 3R11A 3MZ2A 4CD8A 4DWSC 3F03K 4XWUA 2CXGA 3Q2DA 4DVOA 4AX6A 1T96A 4AYGA 3GDRA 3QW3A 3VYLA 5G2IA 3GVVA 1IIGA 1J0YA 4WQ6A 3TN6A 3HQ1A 4H9TA 5EBAA 2PMQA 2YZ5A 4BQ3A 1W9BM 5LA0A 3WL0A 1J0KA 5D03A 4TUFA 2NSOA 5FF3A 3GU9A 2PP3A 2GDUA 5KZMA 4KT2A 3HA1A 5AY7A 5LNWA 3IS4A 3GS6A 3CAWA 3VIGA 1VIZA 3VE9A 4FXFA 3TJIA 5DCBA 3H24A 3UG5A 5I78A 4S39A 1TV2A 4KKXA 1H2JA 1F07A 1UWQA 4DO6A 3KS5A 1UYQA 1JPMA 4RUBA 4NASA 3VKKA 4BJHA 2E9MA 3NO3A 6XIAA 1UA3A 1GVYA 1SJAA 3W22A 1QT1A 3H2EA 4QE1A 4CU6A 1QW8A 4B3LA 3W1QA 2Z1WA 3RMEA 3TP4A 1OX5A 1PZ0A 5CLTA 2WSRA 1P0NA 2C0HA 2HK0A 3ARVA 1JIBA 4NIRA 1XIJA 1XC6A 3WN6A 4NAFB 5DQPA 1WPCA 2YL9A 3N6HA 1LWIA 1CGVA 3W72A 4B5XA 4QAIA 4A4AA 3IJ8A 3M0KA 1UUMA 3C2VA 1H1NA 1LG2A 1IEWA 4ZENA 3MUZ1 3M4HA 2YIHA 5JMUA 4AZHA 3IVSA 1QNRA 1DE6A 4JTHA 1F76A 1GVEA 4HTBA 2OEJA 1XSKA 2J24A 1XR2A 4DXVA 1NARA 1JUKA 1KR1A 1UD5A 5GJPA 2QJIA 3IAPA 4RDYA 1R7OA 4QG8A 3VDCA 3SZ8A 3PUEA 3LUTA 3L4VA 4YTQA 2WC4A 2YOCA 5BOOA 2GWGA 2XJ7A 2DSVA 2V81A 1VHNA 2WAGA 4XG1A 1I1WA 3DG7A 1D3GA 3MUXA 1OWQA 1N8IA 9CGTA 3GXIA 1OG6A 3RR1A 4HOWA 2VCBA 2XSAA 2OQHA 5CH9A 1OK4A 2YDRA 4QFUA 2W79A 1CXHA 4L9ZA 3VGEA 1Y8BA 4NNAA 3NFUA 3QFEA 3NZGA 4U28A 2DSKA 4MADA 4CKQA 1A4MA 4NI3A 4N9DA 5I3IA 4I3GA 2EPLX 4CN1A 4PN2A 3HU7A 5DCDA 2POZA 4B90A 4R85A 1G5AA 3ZM8A 3FDKA 2Y63A 5KZDA 2GJXA 4IXXA 2PEVA 2Z6IA 1V6YA 3W23A 1XLFA 1TR9A 2PRLA 4NAEB 5ENLA 1VFSA 2XINA 5C9RA 4BFAA 2BVWA 3DXIA 3L5LA 1IGWA 3WF2A 2XIOA 4P8UA 4Q8QA 3WF3A 3SDOA 3W1XA 5TAOA 4H9XA 3VIFA 4DZAA 4PUMA 1IXOA 1ALDA 4G7EB 2GSEA 3HURA 3OHIA 4Y6GA 3R2GA 5HJLA 4X2RA 5H6HA 1JDFA 1QNSA 1P48A 4BWLC 2NQ5A 1AW5A 1JPDX 1D8WA 4A6GA 3SSJA 1