1ZZMA

Crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
MICRFIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADEIAQALLNNTYTLFNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative deoxyribonuclease yjjV
publication title Crystal structure of YJJV, TATD homolog from Escherichia coli K12, at 1.8 A resolution
rcsb
source organism Escherichia coli
total genus 92
structure length 259
sequence length 259
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1zzmA00
4CQDA 3B40A 4WHBA 3MPGA 3T81A 4KETA 4C6QA 3F4DA 1I0DA 4UBPC 2F6KA 4C5YA 3E38A 2GOKA 1UBPC 4NI8A 5HMDA 1FWCC 1QXLA 1EJSC 4B90A 3O0FA 2PUZA 2WJDA 4DZIA 4GXWA 3MDUA 2UBPC 3MDWA 4IGNA 4IFOA 4IFKB 4QSFA 3GUWA 3AU6A 1JGMA 4INFA 3ISIX 3V7PA 4PCPA 1KRAC 4AQLA 1XWYA 3CJPA 3GIQA 4DNMA 4IH3A 1GKPA 3OOQA 4GX9A 3URAA 4C60A 2OODA 3UBPC 2FVKA 4RDWA 4LAKA 3E2VA 2RAGA 3EWCA 1NDWA 3OVGA 4C6KA 4OFCA 2A3LA 2VC5A 4I6KA 4C65A 3RN6A 2FVMA 1WXYA 4BJHA 1R9ZA 5LXXA 4ZSTA 3E0LA 3LSCA 4H9VA 1FWIC 3EWDA 3LGGA 3AUOA 1VFLA 3A3WA 4EPBC 4IF2A 4GC3A 4C6PA 4XD5A 2W9MA 4P5UA 1V77A 4GYFA 2Z7GA 4G7EB 5HMFA 1POJA 4CQCA 2ICSA 1R9YA 2D2JA 2R1KA 3GTHA 3MJMA 2WJFA 4LEFA 5FSDC 1E9YB 4QRNA 4B92A 2OOFA 3GU2A 1V7AA 3GTXA 2I9UA 5G4HC 4GOAA 1KRMA 4ERAA 3GIPA 3E74A 1PTAA 4H9YA 1KRBC 2EG8A 1K70A 3OJGA 4H9XA 4C6OA 4F0LA 4PBEA 3UR2A 2DVTA 1EJWC 3E0FA 2D2HA 2R1NA 1KCXA 4RDVA 3CAKA 1S3TC 1UIPA 4UB9A 3ITCA 2WJEA 4J2MA 1FKWA 2HBXA 4C6JA 4CQBA 3DUGA 4GK8A 4ICMA 3K2GA 3LNPA 3AU2A 4HK6A 4DO7A 4YIWA 2VR2A 4DYKA 5E5CA 1A5LC 1YBQA 4H9TA 2FTYA 4HJWA 4GBDA 3QGKC 3PANA 3GU1A 4HK7A 2DVXA 3LU2A 1A5KC 3FDKA 3CS2A 4IG2A 4LFYA 4B3ZA 1FWFC 2XIOA 3WZ0E 3GRIA 3HTWA 3NEHA 1O5RA 4C6IA 4DZHA 4CNUA 4XAGA 4CNTA 2HPIA 4I6VA 3HM7A 3T1GA 2AQOA 3PBMA 4BY3A 4QROA 3QGAC 4C6FA 3S4TA 3ORWA 3FDGA 2Z24A 2P50A 3LS9A 3S2MA 2VHLA 4LCQA 2DVUA 4C6EA 4PCNA 2AMXA 2GSEA 1J6OA 2R1MA 2I5GA 4DI9A 2VM8A 4CEXC 4H9MA 2YZ5A 2Z26A 4QTGA 1J5SA 5FSEC 1KRCC 4DIAA 3MKVA 1M7JA 3JZEA 4KEVA 4JOMA 1XRTA 3GU9A 4RZBA 3RHGA 3TN6A 3E3HA 3F2CA 4XAZA 4H00A 4KESA 3QY7A 1P6CA 4DLFA 2D2GA 4R85A 4C6BA 2HNHA 2Z00A 4Z42C 4C6NA 4H01A 2HQAA 4V1XA 4KIRA 3QY8A 1NDYA 1V79A 1RK6A 3TN5A 4EPEC 4LCSA 4KERA 2O4MA 4LH8A 4LAMA 1EJTC 4KEZA 4KQNA 3N2CA 4TQTA 3WMLA 1M68A 1GKRA 1FWEC 3C86A 1UMLA 1A5MC 3LGDA 4D8LA 4EPKA 1FWHC 3MSRA 1YNYA 4HK5A 2Z2BA 4C6MA 2E25A 1RA5A 1K1DA 2ADAA 2GWGA 4C6CA 4XD3A 1FWGC 4IFKA 4V1YA 4GY7A 1EJRC 4H9UA 4XAYA 2BB0A 2OB3A 4ERIA 3HPAA 3G77A 1PSCA 3LY0A 2FTWA 5AKQA 2E1WA 1V51A 4R7WA 1M65A 3NQBA 3WYZA 1V4YA 2ZC1A 4J5NA 1NDZA 3S2NA 2Z4GA 3MVIA 4RDYA 4GY0A 2R1PA 2QS8A 3URBA 1A4LA 2GWNA 4WGXA 4RDZA 3GG7A 3UR5A 3URQA 3ID7A 1P6BA 5HMEA 3UPMA 4RE0A 2O4QA 4LANA 3F4CA 2PAJA 1J79A 1FWDC 2EG6A 4G7EA 3UF9A 3R0DA 3SFWA 4EP8C 3RCMA 1E9ZB 4HA0A 1RJPA 4MUPA 3LSBA 2Y1HA 4KF1A 3A3XA 4XD4A 4E3TA 1ITQA 1XGEA 2QPXA 2CZVA 1PB0A 3A4JA 4PE8A 4NG3A 1HZYA 1FKXA 3GTIA 4QS6A 4F0RA 1R9XA 3F2BA 1I0BA 4G2DA 4KEUA 2PLMA 1J6PA 3D6NA 3ICJA 4XD6A 1ZZMA 5A6TC 3PAOA 1ONWA 3TN3A 4IQJA 3FEQA 4ZSUA 1YMYA 2Q01A 3S2JA 3S2LA 1POKA 1A5OC 1RAKA 3IGHX 3K4WA 2Z25A 1P1MA 4H9ZA 4F0SA 3IARA 1NFGA 4AC7C 1GKQA 1A4MA 2QVNA 3B0XA 2P53A 4XAFA 4J35A 1BF6A 3MVTA 4DI8A 1PO9A 3OU8A 3SO7A 2HBVA 2IMRA 3OODA 3IJ6A 4NP7A 4IGMA 1YRRA 3TN4A 1O12A 4PBFA 3PNZA 2UZ9A 1FWBC 1YBQB 2EG7A 4R88A 4C5ZA 2OGJA 1EJVC 2HPMA 1RA0A 2Z28A 1NDVA 3IRSA 2Z2AA 1YIXA 3BE7A 1XRFA 1EF2A 2G3FA 4IG2B 4CNSA 1EYWA 3OQEA 1RJRA 3RYSA 1A5NC 2AQVA 3F2DA 1W1IE 2R1LA 2KAUC 1FWJC 2WM1A 3MTWA 2YB1A 1UIOA 4WVXA 2YB4A 3O7UA 4BKNA 2YXOA 3IPWA 2VUNA 3URNA 3LA4A 4B91A 3TNBA 4L6DA 1IE7C 3NURA 2VC7A 1RJQA 4C6DA 1EJXC 3DC8A 3K5XA 5CH9A 2FFIA 3T8LA 3GTFA 1ADDA 1EJUC 1ONXA 4IFRA 4QS5A 2PGFA 3EGJA 3KM8A 4GZ7A 2OQLA 3PNUA 4LCRA 1QW7A 2Z27A 3DCPA 1FWAC 4ERGA 2ANUA 2Q09A 2GZXA 2PGRA 4GY1A 3IV8A 4LAOA 4DLMA 1K6WA 1EZ2A 4M51A 3B0YA 1RK5A 2Z29A 4L9XA 1DPMA 4C6LA 2QT3A 1ITUA 4CEUC 4GX8A 4EPDC 4LALA 3QY6A 3IACA 1WXZA 2BGNE
chains in the Genus database with same CATH superfamily
2PDKA 1QU4A 3H2AA 4DUVA 4PSRA 1DJQA 1AD1A 4JPGA 3ALFA 3GHUA 4DJED 3WMBA 2CKRA 4UBPC 1XL9A 2PC8A 2WZIA 1B30A 3CAVA 3WN6A 3L68A 3PPFA 2QQ6A 3GX9A 3HG5A 1C91A 1WV2A 1HGYA 4PSPA 3WG6A 5IHRA 2NUXA 2WV8A 4Q4KA 1JGMA 4O19A 3KZPA 1JULA 1PL9A 4GYPC 4HNLA 2FTPA 3ZWTA 3F4NA 1QNVA 4ALDA 1VQTA 1R5YA 3SQLA 4NZCA 2JQXA 1JAEA 5FEXA 5CJNA 2FQIA 3ABZA 2GVGA 4ZO7A 2FVMA 3L4TA 3B03A 1LRTA 1XPGA 4ZSTA 3SN0A 4GG9A 5BXPA 3AUOA 2V2CA 2VDHA 4ONVA 2ZUUA 4UFHA 1P0NA 2PCEA 3MHUA 4PMQA 3MKCA 2ICSA 4WJXA 2TYSA 1GOWA 5LNRA 4OT7A 3WK0A 1ZSXA 4H8VA 1EC7A 3VE9A 5BOEA 3CZ8A 2FGZA 1KFJA 2WXDM 1P0KA 4ZTXA 1EDGA 3WQOA 3M0XA 3IEBA 5IDZA 3N13A 1C90A 3WD2A 2HNEA 2VI0A 5BRQA 3ITCA 3KOYA 4BI6A 1UYQA 1OC7A 3EB4A 4CCZA 4Q4MA 3T0AA 3EOSA 2HXUA 3B8DA 1DWIM 4NNCA 4GBDA 1XH1A 5XIMA 4AZ6A 2WBKA 3VMPA 4JIHA 3WQ5A 4JD4A 4QJ1A 3S42A 7REQB 2EJ1A 2YCKX 2OYKA 4M6PA 1GQJA 2PWHA 2ISFA 5DXYA 5DT7A 3BQ6A 3FSTA 3EWYA 3G1HA 3T55A 4XTIA 2AOSA 1GGOA 1S39A 4DNHA 3WD4A 2FLIA 1E0WA 4TX9A 3M47A 1UP2A 2XUCA 4NF7A 4C6FA 2DQXA 3A3HA 2Q8XA 3N2MA 4GZEA 3E0IA 1DJNA 3TTSA 3VNKA 2PU1A 1E4NA 4K8HA 4CD7A 3BLLA 1IZJA 4IMGA 1FRBA 2A21A 4M56A 4R9OA 3HGRA 5E09A 1OFRA 2QCFA 3N9RA 1EX1A 1Q8AA 2XVPA 5E93A 6REQB 3AIWA 3JU2A 4OJYA 3EOUA 3G3DA 3IANA 3QY7A 1XXXA 1MEHA 4M7TA 3PG9A 4UTMA 2PLCA 1UWTA 1T8XA 2ZXDA 4JS3A 2X8RA 3UZWA 4UTJA 2EQDA 5REQA 3PPHA 5D05A 3AYRA 4YNGA 3HQPA 3H24A 3QY8A 3QC3A 4HT3A 1MUWA 1QNPA 3FV9A 3WMSA 1Y65A 3LHWA 4TQTA 3FFSA 4HA4A 1X6LA 1YADA 1RLDA 2XVGA 1KFLA 1Q7MA 1BLIA 1HXJA 5A8OA 3VIPA 4ASTA 1IEQA 1QTWA 2QCLA 4I8DA 5CPNA 2NSOA 3CAWA 4N9EA 2X7WA 3ARTA 2H8ZA 3M0ZA 1CWYA 4AD2A 3INPA 3PZNA 5AECA 4KFPA 4JTUA 1NEYA 3ZFHA 1WDDA 3H7VA 1V3KA 3FAXA 3W1NA 4G1KA 2XWDA 3ERPA 3NQBA 2HTMA 1GVYA 1UZ1A 3BLDA 1LQ0A 3N4EA 1EDTA 3E2SA 3EDDA 3Q67A 4R53A 1KBBA 4JFWA 2NQ9A 1K9TA 4W89A 3N04A 2EKGA 2RDWA 4KW2A 4FIQA 3VOJA 1EUAA 3GHRA 1RCXB 1R7OA 3S1VA 3T8QA 2ODOA 4CLMA 4O1CA 4YYFA 4XZMX 4XZNX 3R13A 3SRKA 5D2VA 1CXEA 1KM5A 3VD9A 1Q8JA 2DFAA 4PE8A 1YDNA 4GYPA 3B8TA 3SUSA 3T05A 1F8MA 4MMWA 1A3WA 2CLOA 1NTHA 4DJEA 5HQEA 3PAOA 4X0NA 3TN3A 1YMYA 3W7RA 3S2LA 2P8BA 1RZMA 3RJYA 6XIAA 3O6AA 1EFZA 2E40A 4IP4A 4N9CA 2QVNA 4NZFA 1XP3A 2QCMA 1E6ZA 1U5VA 2D0GA 1E3XA 4MVAA 1HJVA 2ESCA 1KV8A 1KBIA 1WA3A 2XIIA 4JCMA 3EDFA 4MJMA 1ZAIA 5XIAA 2E8ZA 1FWBC 2HPMA 2Z28A 4WY0F 1W1PA 4R9XA 2J7BA 3D46A 2CERA 1C29A 2Y62A 5K3VA 3GAKA 3LDVA 4YVPA 1KC7A 4J7RA 4XO7A 4LTSA 3CTTA 2V38A 1GOQA 4CKQA 2ISWA 2NX9A 3GDKA 3UXKA 2ZUMA 3DN5A 3GXIA 4DB7A 2R24A 3IWPA 3BL3A 1TQJA 1PTGA 3GM8A 1AL7A 5I3KA 1DJHA 2PEVA 2PWUA 2OQLA 3BCDA 1V7YA 2PBOA 3ZR5A 4OBRA 1OWQA 4F2UA 1IWAA 1E6RA 4O18A 3OLDA 3AO0A 2X1IA 1ML1A 3BVJA 2GGJA 1UCWA 5E70A 1F07A 1R47A 4C6LA 1HJSA 2QT3A 4PA8A 5FJPA 2FJKA 3WJYA 1WXZA 4WHBA 4UWMA 1DIKA 4UFJA 1ZENA 3T6CA 1FFQA 3BOXA 2TPSA 2QMJA 1B4KA 3FX4A 3NSXA 5FJTA 2PD5A 1JZ4A 3KHDA 2XH2A 3WFLA 5D04C 1UKPA 4X63A 5CPSA 2VGIA 3OEXA 1GQLA 2X0HA 5LGXA 1ZP4A 4QGCA 3PR2A 3ENLA 3G3MA 1QI5A 1KXHA 1XYFA 4OFCA 3CT7A 4BA0A 3DFPA 1H41A 1TJ2A 3M0LA 2YLAA 1MMFA 1YDVA 4XG1A 3E0LA 2NVAA 1OX4B 1ZBVA 1YE6A 1O1HA 5FD0A 4XD5A 1BAGA 2V3GA 3KBSA 1RBAA 1QWKA 2PDYA 3WJZA 4Z1YA 1R9YA 4J3ZA 4WSJA 3GTHA 2WJFA 1HKJA 1TX0A 3CTLA 1FCBA 1NWTA 4S3GA 4GOAA 3TAOA 4LUTB 3SRFA 3PZUA 2EG8A 3CMJA 3T4CA 5AZ1A 3RK8A 2FPTA 3LG3A 3DKLA 3RRAA 2WPGA 2RDUA 4RW3A 3F5KA 4UR9A 1Q7ZA 3W3OA 3W7QA 5HNRA 4X22A 1NP2A 3NPUA 4Q7NA 4RR4A 5G2IA 1QMLA 1KCLA 2ZA1A 1H1ZA 2D0HA 4IX2A 1RQBA 1A3XA 1HF6A 4DYJA 3L2IA 5LIKX 4KEMA 7CGTA 4H9TA 3M9YA 3QH2A 4Q8UA 5CSUA 1TR1A 3VIFA 3QZAA 2NQLA 1K9EA 3FJ4A 5H6HA 5JXQA 2BDQA 2DVXA 1W37A 1IEVA 2QLYA 4DF2A 1OVDA 3GRIA 3TSBA 3NEHA 1PEZA 3TFCA 2V5CA 4C6IA 3R0UA 2HS6A 2QDEA 1A53A 4QISA 3T1GA 4JDBA 2G95A 1YTEA 1UD5A 3VKCA 1J0HA 3QGAC 4I3GA 3WNKA 3TJXA 1J10A 4E2VA 1REQB 1RXOB 4EWND 1HNYA 3CHEA 1PVNA 4EKJA 1C7TA 1LWIA 1J9YA 2VZUA 2VCAA 3EXSA 3SFKA 3TR2A 2OGYA 3OZPA 3LXAA 3KS6A 4DN1A 3BMVA 2E7FA 1LQ2A 3WJSA 3THAA 5C2CA 5IFTA 1UQZA 4TU1A 3R8GA 3PFMA 3W7DA 3O07A 2V3FA 4S3KA 2Z00A 1JXKA 4L6HA 3WBYA 4FA3A 1WZLA 1XV8A 1J0ZA 1I2QA 1V3LA 1IXOA 4NSBA 1RD6A 4K68A 4HU0A 1UMLA 4KFNA 2BTMA 3PBYA 1A5MC 1L6GA 3R89A 4UTWC 2CCRA 1FWHC 1TE6A 2P5NA 3W2MA 3UCDA 2QDHA 3VIGA 4JFUA 4R7JA 3CL7A 4AD4A 1F8IA 3ABRA 2XPKA 3OG3A 4IXHA 4GY7A 1RQEA 4C1NB 4D1JA 2CZDA 3DHPA 2ZZ4A 4AEEA 2WMIB 3BTNA 1TWIA 5I3JA 4J5NA 1VRXA 3TLQA 1W5NA 4KGLA 4LU0A 3C2EA 3T0BA 4DBSA 4WKAA 2DZTA 3QPYA 3O05A 1A0EA 4WGXA 2GWNA 1PIFA 2YL9A 3RPDA 5CSYA 2LLEA 2A1YA 2GDVA 1W31A 3FXGA 4J9JA 2PAJA 3KL0A 1DBTA 4LBUA 3P60A 2WPBA 2VGBA 2ZUWA 3ZT6A 1UOZA 1V0MA 4HYVA 4JIPA 3RCMA 1ME8A 5CCZA 3GR8A 4S3JA 1RJPA 1F6KA 3OPSA 3WLRA 1E1FA 1H5VA 2P3EA 4DO4A 1AZ1A 1GZGA 3MBDA 2W0UA 2BY3A 3HG3A 5HJLA 2QV5A 5BCAA 4W7VA 4ZOEA 1V6TA 3BICA 3PZ9A 3R12A 3RG6A 2GQ8A 3CZEA 2PWFA 5FCZA 2EKCA 4IXXA 2YIHA 3N2TA 4XISA 1SPQA 4POCA 4YJ5A 3UYIA 1PCWA 1Z8AA 3S5OA 3GXFA 1RP9A 5FJRA 4DYEA 5AC6A 3R79A 3KWSA 1J96A 3UY7A 6PTDA 2AKMA 3VOCA 4O1DA 3QW4B 1Q66A 1PTDA 1WKFA 1XD1A 4MM1A 3PPGA 2X0YA 2XZ7A 1BG9A 4IUGA 1BGAA 1CX9A 4Z1BA 4EXAA 3VNLA 3TUUA 1VBJA 4B4HA 3FJ6A 1JGIA 3VD3A 2Z2AA 4I5UA 1TPH1 1XIFA 3QOKA 1MVYA 1QOPA 4CCDA 5HNUA 5H8MA 4PTWA 3IJ7A 2NQZA 4W8AA 4PCFA 4UQEA 1VBUA 4AWUA 1YNQA 5DFAA 2ZZ7A 2DZWA 4H7VA 3O7UA 1UR8A 3TKFA 1IXPA 3P8IA 1Q6GA 4V33A 4JKLA 2IPFA 4Y9OA 5LZLA 4PCTA 3AQUA 2E5BA 3QFEA 5A6AA 2YA0A 4JFSA 5CH9A 2O9OA 3KX6A 2Z0IA 1G9HA 4UFLA 3RX3A 4FALA 3S1GA 4BQ3A 1PJ9A 2VEGA 1UWIA 1EJUC 1TFVA 1R85A 2PGFA 3CPRA 4UCFA 5BMWA 3ARWA 2DZAA 4GACA 1M3UA 3TW6A 2DEPA 4HNVA 1VIWA 2ACRA 1GVSA 1N8WA 3GAYA 1XLEA 3VFCA 4L9XA 3H54A 1N8IA 3SR7A 3CUZA 2X2YA 2Y5SA 1UC5A 3M16A 8A3HA 4RNJA 1Q6RA 1H50A 3WENA 3N3MA 2OSYA 1E40A 3AC0A 3QVQA 2WNZA 1L8PA 1XLKA 4AUBA 1TWSA 2YDAA 4IQLA 1MDRA 2Q8ZA 3E12A 4Y9AA 3MQTA 2DZSA 2WK2A 5CPQA 4UR7A 4LF2A 5CBBA 2ZOXA 3U7BA 2O0TA 4G9PA 1W1TA 2NZLA 1JI2A 2O9PA 2FVKA 3IIOA 1D2KA 4LV9A 5CG7A 4M5PA 1AUSL 5KEZA 1XIBA 4IMDA 2XIQA 1OCNA 3CUHA 3LSCA 1XI3A 2BS9A 3W74A 1XS2A 4GZIA 1JI1A 1QCWA 3WD1A 5A6BD 3L4UA 3LPFA 3DFHA 3KE0A 4GQGA 1POJA 1XIMA 3MO4A 4Q8QA 4UOZA 2GYIA 1GCYA 4AY8A 1JF6A 2JGYA 3GBEA 4J27A 4LEQA 2VDIA 2ZX6A 1T99A 3NGFA 3M5VA 1K7XA 3C8NA 3ITOA 3LM3A 1WDPA 2BV9A 4W86A 4DY1A 4H9XA 1P6WA 1QNOA 4Q8VA 3C2OA 2FZ8A 3L4WA 3WQCA 3DEQA 1VYPX 2FB2A 4E8GA 3I6EA 1FVPA 4E6MA 1B9ZA 1Q7QA 3LTSA 4YWIA 2J25A 4H6KA 1GUVA 1W5PA 4FXRA 1F5ZA 3ZWSA 1N55A 3WQDA 2PP0A 3GKFA 4QAIA 3GVGA 3RCYA 4JDYA 4TTUA 2YDRA 4LAUA 3MP4A 2XIOA 2GDQA 3QOMA 4FNSA 4Q8WA 3NZRA 4CNUA 4XAGA 3DYPA 5CBIA 1YTKA 4IL0A 4GXMA 1B9BA 2WKGA 1X98A 3M4HA 3N12A 3QLLA 3TEVA 4IMAA 4FR1A 3U6WA 2AMXA 4JICA 4BWLC 2R1MA 1XIDA 3BPWA 2UWFA 1TPDA 2VM8A 3BMXA 4W7UA 4H9MA 3AMKA 1W9BM 2CHNA 3N3TA 5K4ZA 4OGZA 1B90A 1GVFA 3GK0A 4MKSA 2VCBA 4Q4PA 3O0KA 1R0MA 4F48A 5AFDA 2NT0A 3N9KA 4GZJA 3MSGA 3R7MA 1TJPA 4QFUA 2Y2WA 4B5UA 4LC8A 1EGVA 1BYAA 3VIOA 1VHNA 3NNTA 3KP0A 2G50A 1S5WA 1MW0A 1EJTC 5DMNA 1WUEA 2PWGA 2VMFA 1WB0A 3I7QA 3WQFA 3P80A 1GVRA 3U57A 2IKHA 1ADSA 3VMNA 2E25A 4Z1DA 1EXPA 2GWGA 4GIRA 1EOMA 4IFKA 4E4FA 3MI6A 2WOQA 5C54A 3A4XA 1DJXA 3I6RA 2NUWA 1V3JA 3GQYA 4H1ZA 4YHEA 4R7WA 4N2YA 1K02A 4ZEPA 2QUUA 1AQ0A 3HA1A 2G4JA 5HWJA 2VFGA 3P84A 3KTXA 2JBMA 4GY0A 5HPOA 5I02A 4MY1A 5ABGA 1CGYA 3UR5A 3P0WA 1LT8A 5HMEA 1TWDA 5JBEA 1J79A 3KBWA 3NGJA 5FJJA 4X9SA 4P61A 4DZ5A 3T0DA 4CCEA 3TTYA 1K8CA 1NQKA 1JRBA 4P7QA 2CXEA 4E3TA 4ZGYA 1AMYA 2CXGA 1AODA 5DMLA 3KDNA 1EO7A 4NX5A 4DXKA 4KEUA 4OIFA 1SSDA 1ZQ5A 1XKJA 3B4UA 4IQJA 4O57A 3QKZA 1F6YA 1U30A 4EIVA 3UXAA 2BGSA 3R6IA 1E4LA 3C0JA 3ZMRA 6TIMA 3VIIA 2XDFA 1ME9A 1GKQA 1LYXA 4FS9A 3V5FA 3KOXA 3CQHA 4UMBA 2V5LA 2V2HA 3SAZA 4HZMA 1GZ1A 2OCZA 2X1RA 3RR4A 3RGTA 3B8UA 2ZUVA 2R82A 5U4NA 4ZB2A 2J13A 2RHGA 1PHWA 5C7HA 4QIUA 3DC0A 5CJMA 4ZR8A 3PUGA 5A6KA 3W81A 4O0ZA 3M0YA 1FWTA 5A6BA 3LRMA 5CZKA 4NXSA 4JHMA 3AHVA 3MUIA 3VC5A 4DEFA 1SZFA 1Z48A 2V30A 3WNNA 1I1WA 3MUAA 4C6DA 2NT1A 3KOWA 1WKDA 3WF0A 1KTBA 1G69A 3T8LA 1ADDA 1OK4A 4U3AA 1CXIA 4OVXA 4JCLA 4UUIA 1AH0A 2PGWA 4ERGA 4Y9MA 4GKLA 3W53A 3KRBA 1HL2A 2J88A 3UWQA 4XBSA 2NV9A 3EDEA 5LNSA 2QJJA 4LAOA 3OVQA 4C7DA 1BSIA 3WDQA 2YLLA 3ONCA 1DXFA 1BYCA 4UTTC 5REQB 4CEUC 2OWCA 1GOOA 1KLZA 1F9CA 4U5KA 2OX1A 5FF7A 4JHZA 2F8QA 5AHFA 1ECEA 2GOKA 2NX1A 2YBUA 3SCRA 4B90A 3UZYA 3WLTA 4O1EA 5K4XA 3EX3A 1KQZA 5D4YA 3NA8A 3RLGA 3HJEA 4Y9PA 3GVQA 1W1B1 4ZE5A 2EPHA 4KWSA 4DNMA 4IH3A 3RIKA 4GD0A 3WNOA 3VU2A 2XN2A 4NZ1A 3BGJA 1GVQA 1C93A 4AMCA 4DXVA 3BG3A 1EHAA 3SIMA 1I1XA 4LYQA 5AYYA 4DHGA 2E6FA 1FWIC 4NAFA 2Z7GA 1NFBA 3AZTA 3IUDA 2D2JA 4ZB5A 3BLOA 1HKMA 1M03A 3LHZA 1SZRA 3U4AA 4YTUA 2P76A 3E74A 3NQAA 3IGSA 2OELA 1KRBC 1O66A 3QC0A 3TXZA 5A8GA 1QBAA 3Q65A 4PMYA 1CT5A 3UR2A 3HJZA 1O7AA 1AA1B 1WDSA 1TREA 3M7SA 2O7QA 1FKWA 3GXNA 4WQ6A 3ARRA 4ML9A 1HJXA 4UIOA 3K2GA 3LNPA 1TPUA 2CLHA 1GJUA 1K9FA 3POHA 3ZSSA 2HWGA 1TV7A 4Y8EA 3XIMA 1WE5A 2OO6A 3DGRA 4JTDA 4JTJA 2B31A 3UP8A 3GSMA 3GU1A 1EPVA 1OFPA 3GYCA 3LU2A 3O1NA 2CLKA 4LFYA 1O1ZA 1XIGA 4Z2IA 1RR2A 5G1YA 3M5ZA 4O11A 2CESA 2HPIA 5E0FA 3N6QA 4GUIA 1R3TA 2YCJA 4I7VA 4PH6A 2Y5EA 3ZLFA 2DQWA 4AHQA 4DM2A 1R7AA 4QROA 5LHEA 2JKEA 3FW6A 2ZXBA 2XSAA 2JALA 3LQLA 2TMDA 2VHLA 1UR0A 3FNDA 5BRBA 4TUFA 3GW0A 4HYWA 4CNNA 4NAEA 1TPB1 4JL2A 4N4QA 3DECA 1CZ1A 3CQIA 1XRTA 3T7VA 3TN6A 1V3MA 4FK9A 3WF1A 1O95A 2Q3RA 5DBUA 3IIZA 4LT9A 4WY0A 1UPPA 3TFXA 4R85A 3EXTA 2OT0A 3ARPA 4LC6A 4B5SA 1BYDA 3R4IA 2A3CA 5XINA 3EKLA 1P7TA 2DT0A 1NAL1 1XM3A 3DZ1A 2HQAA 1XHGA 2ALDA 5D9NA 5BOOA 4LS0A 4LH8A 3AXMA 2ISSA 3B04A 3KXQA 1C8QA 1M68A 1GKRA 1MNSA 2CHOA 4MWAD 5D2TA 3Q94A 3K4AA 3KOZA 4R7OA 5BXRA 3G1AA 2Z2BA 5HNNA 3O2LA 2PE4A 1KGXA 3H2OA 3PUDA 3GZ3A 3AWOA 1ZTVA 3AIUA 4KMQA 5G1TA 1KKOA 4ROPA 5AY7A 1A5SA 4AD1A 1XYMA 5AYIA 4L1XA 3G77A 3AXIA 3LY0A 4IZGA 3PBGA 4O0QA 2OYLA 3SQSA 1VLWA 4S3FA 2WMJA 2Z1BA 1KBLA 1T6MA 2DZUA 2C0AA 3AYVA 4GYKA 2VZOA 1LT7A 4GFSA 2NVCA 3GG7A 1Q6QA 1P6BA 2XSBA 4LANA 4PUKA 1Z32X 5DRCA 2XG9A 5A6SA 3N6JA 2RGMA 4MUPA 4RJEA 2J9XA 3CB8A 4GUJA 3KVKA 4KF1A 3HN3A 3JUGA 4JX6A 3WBEA 2CZVA 5AHIA 5GJPA 1JL8A 3A4JA 2PDBA 1B3YA 2FGBA 3GTIA 1CCWB 5AHLA 1R2SA 3THQA 2XFRA 5CGTA 3ALGA 4QSHA 1KWKA 2IXUA 5H8PA 3CUXA 4RNIA 1E6SM 4HNCA 4OBSA 1Z6KA 1Y5VA 1GOKA 1H0IA 3LRKA 4S3CA 2PDJA 2DH2A 4GH3A 4DI8A 3OU8A 2HVMA 4HMCA 4CQ9A 2ZA3A 1OF6A 3U4FA 1VJSA 4LF1A 3WELA 4IT1A 5IXEA 1SFLA 4NJIA 4Z2LA 2A85A 4HU3A 1BPLB 2VZVA 1GPFA 4MG4A 1XUUA 4O1AA 3G22A 2PDLA 4NJKA 4N6EA 4MKNA 2G3MA 3BAKA 3WD0A 2QF8A 1LCOA 4CNSA 5MKGA 2WZMA 4FOUA 1ZFJA 5AB3A 3N15A 2ZIDA 1FHVA 4Z0SA 3GBDA 1JZ5A 2IPGA 2ZUTA 5IRPA 1Q4WA 4HPNA 1TJ0A 3K5XA 1OX5A 3T42A 1Y5WA 4LYPA 3T40A 2FFIA 1X7FA 1CPUA 3U2CA 3U7VA 1OFQA 3PZGA 1K7FA 3LGEA 5AHMA 4WX2A 1UHVA 3VUSA 3R11A 3TCEA 4Q8NA 4D6IA 5C9UA 1VGAA 3GVVA 3WQ6A 3AMLA 1J5TA 3T09A 5D8WA 2MANA 4WD0A 1WZKA 4IJCA 4G56A 4XKMA 4HHLA 1MQPA 1ZJIA 3DESA 3WDJA 4JFTA 4LJ3A 4O0KA 4EPDC 3R5EA 2H9AA 2QVHA 5SWUA 4AHOA 1YPIA 4J3SA 3UZZA 3MMTA 3CPUA 4KRTA 1FX6A 2IUZA 4RL3A 5BWFA 5D02A 1UR9A 3AALA 4EACA 4N7QA 1W6TA 3CIXA 2OT1A 1XGDA 2ATSA 8TIMA 4ZTYA 3LCGA 4H3DA 3MW7A 1YHTA 3N2XA 4X61A 1K8YA 4IPPA 3JVAA 4D6EA 2VOMA 4KCVA 3BANA 2Y8VA 3LCXA 3TQPA 4C6PA 2XU2A 3DI0A 2E09A 1X39A 1MQRA 4H8UA 1V5XA 9XIMA 3ABXA 5HWNA 3A12A 3GC2A 3MBFA 1JPIA 1GOMA 1J0KA 1OM0A 2OOFA 3KW3A 3TTEA 4MWAA 1KTCA 5GQBA 3I3EA 4RZ4A 1C7SA 1ZAHA 1PTAA 5A5WA 4GA8A 2YFNA 3GDRA 3VKDA 5I78A 5EMUA 1W3HA 1OC5A 3TYZA 1W3NA 3ZIZA 1EJ7L 1PUDA 3TC3A 2ZX8A 4F8XA 3MHGA 1ADOA 5C0QA 4WIWA 4GI6A 4J3XA 4GK8A 3W1MA 1F74A 1C3FA 3KHJA 5GNZA 5TQLA 5LKYA 4DYKA 2YDQA 3VDGA 1K9DA 3ZT5A 1A5LC 1YBQA 2Y5JA 4UNIA 2DZBA 1E4IA 4LSBA 1CNVA 3W6YA 3S83A 1O4UA 3K8KA 4Q4QA 5JIPA 1TV4A 4XB3A 3STGA 4V2XA 2C15A 4GXPA 3HMCA 5CC5A 1OC6A 1K7EA 3A5FA 3VNMA 2BXYA 3KL5A 2B7OA 4YTQA 3MMUA 2BODX 7ODCA 4JL1A 1IZKA 1DQUA 1L6SA 3FDGA 1X97A 1XC4A 4KBXA 2HJPA 4I9MA 4JYFA 4C6EA 1GEQA 4MDOA 3K8MA 3HBLA 3D0CA 2OEKA 3V36A 4AD5A 3M0MA 1N2VA 3CWOX 4XAZA 3B0VC 2OKOA 4YLWA 1WZMA 2Y61A 3MS8A 2OJPA 3RITA 4UQ9A 1BEUA 1VENA 3E9AA 1B0IA 4P8WA 3L0KA 3H55A 4TX8A 2DUXA 2H8XA 5CZJA 1NDYA 1GVEA 3MP3A 2Y88A 3UWYA 3UCQA 4Q8OA 4KGJA 1LWHA 3V1PA 4AWEA 4EVZA 2Z1WA 1WAWA 3QN3A 5M5DA 4PMVA 1YNYA 1JCMP 1F3WA 4ML4A 4ORMA 3G1SA 1EJRC 1SSGA 1DORA 3QHMA 2DH3A 5KITA 1NARA 2YA2A 2FTWA 3IJDA 3CQ0A 1KV5A 3WLPA 2Z1KA 3WBAA 4PEEA 3H4GA 4U2YA 4ZOBA 4E4UA 2VD8A 4H6RA 4K2SA 2R1PA 3GTNA 5FEZA 4PULA 3ARSA 3TDFA 3UR8A 4TVDA 3F5LA 2V3DA 3W82A 2GJXA 4BS0A 4QG6A 3HURA 1BTCA 1VFTA 1LTDA 3LD5A 1RCQA 4UTKA 3NXFA 4U4MA 1X7IA 4EP8C 2Y4SA 2O55A 4HPJA 1E9ZB 2J62A 4WDTA 3OBKA 2AKZA 3R10A 2GVYA 4WXYA 2Y1HA 3LUTA 1H0GA 1CXKA 3GKAA 1VPYA 3M0HA 1LZOA 2PZNA 3OGVA 1MNZA 1J18A 5GNYA 3FVDA 4L9ZA 1FWRA 1GVOA 7TAAA 4XD6A 3PPCA 4HBKA 4ZSUA 3R94A 3IGHX 3K4WA 1LRQA 4TV5A 5H2ZA 4F0SA 3OZOA 3OG2A 1T40A 3MA8A 1U22A 2IKGA 1DWJM 2W6RA 2YL8A 5JBDA 3DKJA 3EB2A 3GG0A 2XGZA 4WJEA 4DBDA 4CU6A 3PNZA 4UMAA 1TUXA 2QCGA 2P3ZA 2ZX7A 4GNVA 5CJ5A 4S3DA 3EYPA 2IPWA 2ACSA 2WSKA 3VE7A 4R5EA 3LCWA 3WF3A 4K8EA 3NUKA 3ARXA 3HO8A 5GNXA 1FWJC 2XGIA 2YB1A 1UIOA 5FL1A 4N02A 2FZMA 1FUYA 1CGVA 4AF0A 4L64A 1O6IA 2GGHA 4D8AA 3QMSA 3A6OA 3V75A 1H5YA 5CBJA 3GO2A 3DCPA 3EOOA 3OHIA 4E2DA 2J7HA 4W8BA 4QG9A 2QJMA 4OBTA 5I24A 2YBVA 2VR5A 2JEPA 1TV2A 5D03A 3P6LA 1XIJA 1F4AA 1EC8A 3S8HA 2FJUB 1VEOA 1JCYA 3UG3A 5CG0A 1ITUA 3BCJA 4HSHA 4D9PA 5HPCA 4LALA 3VM5A 3CHCA 4NJHA 3WNLA 1BFNA 4JBRA 3BV7A 1JQXA 4KETA 1UJPA 3SQMA 4NI8A 1N7KA 1PCKA 1F3TA 1TTPA 5E6ZA 1IF2A 1DQXA 5A6MA 1G94A 8CGTA 3LCLA 3ME3A 4IFOA 4IFKB 3N18A 3VO0A 4MJ2A 1BQCA 1WYIA 5AYXA 1XLBA 4LAZA 1EDQA 1GKPA 1MWOA 3VINA 3URAA 2KZHA 2D22A 2OZ0A 2ZYFA 3OVGA 4ES4A 4OUIA 2EPKX 2VDGA 4RNFA 2OVLA 1XH2A 3RN6A 3W83A 3SSZA 2F2HA 1SU5A 3GW3A 1EC9A 1XLHA 4WOZA 5D9OA 4ZB0A 5BU9A 1OT1A 3O6CA 3B9OA 3WL1A 4JTRA 5KZEA 1V77A 4GBUA 2J77A 4WDUA 4QM1A 1PZ2A 2W62A 5LA0A 5CKSA 1BRLA 3NL2A 4NASA 4DO5A 5HQMA 2V0TA 4NU7A 2Z1VA 4CN4A 1WAUA 1NJJA 1IXQA 3VIHA 1UBSA 2I7GA 3TOPA 2I9UA 1BTMA 2GJPA 5DN1A 2PP3A 5CSRA 1CW2A 3CYVA 3SUUA 4P8VA 3SUWA 1FH9A 1A5UA 4MHBA 1VBGA 4J3TA 4QLLA 1L9WA 3V16A 1TB3A 3EDJA 2HBXA 1BXNA 4C6JA 4XAPA 4IGHA 1US0A 2YCIX 4HK6A 3NPXA 2VKZG 2WCAA 1DIOA 1VB9A 4GIYA 1A5AA 2VD9A 4MLJA 2DPEA 3BAWA 3S5SA 3BW3A 1EKOA 1W17A 1W9VA 4BZYA 1ZY9A 4PTXA 1MFUA 1SO6A 1XIHA 4AIOA 1UD4A 3LPPA 4PN2A 3QF0A 5EMKA 4DZHA 5BW6A 2XIBA 3EKGA 3MB9A 1KM1A 4HNNA 3P67A 5JMUA 3IAQA 3RPMA 5DMMA 4MPKA 2P50A 3DHUA 4AZIA 4BF5A 1OZMA 4Q6XA 1HT6A 3STCA 3W7PA 2J7EA 2X40A 4QTGA 2UY4A 2WCGA 1KRCC 2A7NA 1VH7A 2XVKA 3H2CA 4QQUA 2CBVA 2J6VA 1VPXA 1UWUA 2EHHA 4GWEA 3OZMA 4HZ6A 3PY2A 3BXWA 1IV8A 3VPLA 4LGXA 1R3RA 3P8JA 3B0UX 3I4EA 2V6AA 4PR4A 4TR9A 3PZMA 1VRDA 4Q4SA 1EGZA 4JQ4A 5I00A 4PL2A 3GIYA 4PFMA 3A21A 1UA7A 4KQNA 3G24A 4GJ1A 1EL3A 3RPTA 4HGXA 2WNWA 3A5VA 3ITXA 3S2CA 4YYCA 3T4WA 4ZQPA 2IKJA 3CL6A 4WGHA 4C6CA 1ZNNA 1TCMA 4GABA 5DY2A 4V1YA 3VOIA 1QJWA 1BVZA 1GONA 4QEEA 1XDLA 3M44A 1DIEA 3QJAA 4DWDA 1XINA 5PTDA 4W85A 1V4YA 4L56A 5GJNA 1I6NA 4F0HA 4ZFCA 3MVIA 3EKZA 4RDYA 3FCPA 2A4AA 3N6HA 4E2OA 3W6MA 1HQTA 3AWNA 2Q3OA 1AVAA 3WL0A 5A3HA 2A3BA 2EG6A 3GH4A 4KH2A 5A2BA 4NNAA 4NAFB 5EBUA 3PP7A 2DSZA 2P88A 1AW1A 5IDIA 1UKSA 4JKKA 1IQ8A 3WNMA 1XSKA 4PMJA 4BQ5A 1JCTA 4FNRA 4MKVA 1PB0A 3LERA 2FGLA 4ATWA 2YZRA 2PSNA 4E2BA 3WEZA 1I0BA 1ZU8A 2J6XA 2WVVA 3I10A 3ICJA 1ISVA 2FFCA 4FXFA 1MYRA 1OT2A 1ZJAA 2HXTA 3Q58A 1LOSA 3PWAA 3R0KA 4A2SA 1YXYA 3T44A 4JYEA 1GQKA 5FJUA 5D8ZA 4XZBA 3HPSA 3GC5A 2VEKA 3RX2A 3QMRA 3I7RA 3I65A 6XIMA 4QR6A 3SO7A 5AN7A 3OODA 4W93A 3BAJA 3LV6A 3WQWA 3TN4A 3T07A 1OY0A 2YL5A 3W75A 4ACZA 1TPC1 4GUFA 1EIBA 3VGDA 3P81A 1ZBKA 3GR4A 1K3UA 5CAHA 2YA1A 3FYPA 2YYUA 1MZHA 4XQ6A 4QP0A 4IWWA 4I7WA 3SN1A 4C91A 1W1IE 2C19A 6CGTA 3OZYA 4HNUA 2YB4A 3OLGA 3UJRA 2CIPA 4L6DA 2R9RA 1XQLA 1RJQA 3WDRA 4GO8A 1R6WA 1W3LA 4ZL1A 4GPNA 1OFAA 4M80A 3C61A 2XN0A 3RILA 4ICCX 3SCTA 4DJFD 1OG0A 1E56A 3RU8X 1KBKA 4GZ7A 4B3KA 8RUCA 1QHOA 4DZAA 2YX0A 3AHZA 4NAEB 1ONRA 4ICNA 1JPMA 1YXCA 1L6WA 4PMRA 5FF0A 2ANUA 4GY1A 4OZOA 4NY2A 5ABHA 4WY0B 4GQQA 2BASA 3VKBA 4FX6M 1P7TB 3NIYA 3FN9A 3BAXA 3L2LA 1WPCA 4AB4A 1D7KA 4GQBA 2XM1A 1B57A 3KCJA 2BGNE 4AZ7A 2WSRA 1H7WA 4ZQOA 3O9NA 2XM2A 3PS7A 2R91A 4GNJA 1J4EA 4LYKA 3MSDA 3CNYA 2I14A 4EX4A 3CQKA 3M6DA 1EWEA 1IEXA 3MUCA 3VVGA 5CSSA 4HOWA 2V2DA 3OBEA 2UY5A 3O6YX 5TD4A 4E5TA 3BWWA 4X2PA 2OODA 4FLSA 3OTRA 1TPWA 3VZZA 4H2CA 1E3ZA 4HA3A 1XYBA 3KAOA 5EMJA 2RJHA 3WCZA 5M1TA 3B4YA 4ZODA 1DTUA 3KCLA 2VZTA 4Q4OA 2G41A 1GW9A 3KTSA 1DXIA 5C9RA 5FL0A 3OVRA 3RO8A 2OMAA 3U9IA 3KVLA 3TA9A 1XC6A 3EWUA 4K3ZA 1YYAA 3S1XA 4Q6JA 5IFPA 3OJGA 1U1UA 3ITGA 2Z1XA 2WWCA 2ZBTA 1EJWC 4RX0A 4A8LA 2CZEA 1UD3A 3VIMA 2POZA 3WLHA 2QIWA 3CH0A 2FZBA 4DO6A 3LHYA 4JTIA 2PB1A 1JPDX 2HV5A 3UWWA 3AU2A 3TQKA 3TMLA 3GG1A 4FLQA 3SJ3A 3TJLA 3IVSA 1PZ3A 2C13A 4HJWA 3V4BA 1N82A 4JIIX 4LUIA 5BZAA 3SCSA 3TJIA 4FZIA 2QGHA 3PZVA 4O16A 2W27A 4MNJA 1O5RA 2BY2A 2GJRA 3QHOA 2P0OA 5EMMA 3WLLA 3ZSTA 5MKGB 4DUOA 4M81A 1P0DA 4X60A 1JYNA 3VNJA 4GLEA 4QEHA 1Y8BA 2GSEA 4AZHA 4A29A 2CHRA 1W3KA 2PI6A 3UG8A 2Z26A 5FSEC 3VD4A 3DFNA 3T9PA 1KFWA 1VFUA 4DF0A 4E0CA 1SFTA 1KLYA 4DWSD 2OU4A 4P2VA 1M01A 1CGWA 4QAWA 4H41A 3A22A 4H04A 3W02A 4LS1A 2ZRZA 4YVXA 4MAZA 4C6NA 3THUA 1TVLA 1SR0A 5DEZA 1S2WA 3MC5A 2J66A 3N73A 2J47A 2PWEA 3FEMA 3HQ1A 1F6PA 4MYAA 4KEZA 2BNJA 4GO9A 3EAUA 2HE5A 2YFOA 4N6FA 2H9AB 1IEIA 1GWJA 3MSRA 2ZXQA 5EBAA 1BWKA 4KT2A 3WUBA 1B2YA 3EMQA 4IMCA 1O5QA 4HPGA 1D7FA 1Q6LA 2RUSA 4YHGA 2ZDSA 3LCIA 4FLOA 1DE6A 3M0IA 1XSJA 2YDSA 5KZMA 1RUSA 1XCFA 3RNDA 4GVFA 1DKWA 1W1VA 4JZ5A 1NDZA 1HG3A 3TONA 3OA5A 1QATA 4P8UA 3WNPA 3TNOA 4DJFA 4QNEA 3CWNA 3QV8A 1PXGA 4AISA 1XJBA 3H26A 2O92A 3WQEA 4C7FA 1G7VA 5T9BG 3SCPA 4XZIA 1FH7A 3R0DA 3NSNA 4FAMA 5JH1A 1XBVA 3KUMA 3PUEA 4CVUA 3MO7A 3KBNA 3M7WA 2W61A 3UW6A 2HCVA 2B7NA 1X96A 2F2KA 3TTQA 3W7KA 1RCOB 1ZBWA 3P61A 4MY8A 3W1PA 3H2FA 4F0RA 2ZZ6A 4JTKA 4MWAB 1JR1A 1OADA 2C1HA 3WEMA 1PDZA 1RPXA 3UGRA 4ENLA 1PBGA 1CB2A 2V82A 4JN8A 1U5HA 3LCFA 2ZTKA 2ONEA 2P1FA 2YL6A 3VNDA 1KFCA 3GNDA 1PO9A 3PTQA 3STFA 4DJEC 5AC7A 1C92A 1I2RA 4XKYA 4UFKA 1W9DM 2RH9A 1QI0A 3ANUA 3UJ2A 1EWDA 1Q63A 1YBQB 2EG7A 3QZEA 4EF9A 1Z9AA 1HO4A 5E9AA 3LPOA 1CLVA 4LBRA 5HUOA 5I3GA 1VC4A 2PMQA 4YTRA 4TVCA 3BW2A 1KWGA 4PFHA 5AC5A 2V68A 3GR7A 4WDWA 3CHDA 2BFGA 4MNKA 4MZ1A 2WM1A 1S1RA 4S2CA 1BWLA 4UOJA 4HMEA 4O4WA 3IPWA 3SY5A 3URNA 4HIBA 2QUMA 1J93A 3EEGA 3H2NA 2UV8G 4IJRA 1RSCA 2VCCA 1YDOA 3CK5A 1YTDA 2XVNA 3W07A 1TMHA 4C1KA 2PWVA 2FDSA 4R33A 1ISZA 1HUVA 3V0SA 4G8TA 5HMSA 3TXVA 4Z17A 1XLGA 2PF0A 1Z7AA 2GJNA 3SDOA 1GQIA 1DHPA 4ZZ9A 4YPJA 3B0YA 1TKKA 4JFVA 1EB3A 1ZGDA 4HTYA 3IAPA 3C2RA 3QY6A 3DENA 5E0KA 3N4FA 5LIYX 1IWPA 3GHTA 4BFAA 2PU0A 4EOUA 2F6KA 3TV8A 6ALDA 1UBPC 1UG6A 3ZM8A 5L9FA 2GJLA 3FHQA 4V27A 1W5OA 2RDXA 1CECA 1H7XA 1GORA 3GHSA 2UBPC 3U5UA 4A3RA 3ZLHA 3GUWA 3H4XA 4F9JA 4NILA 3L4YA 2DSWA 3CJPA 4IMFA 5E6YA 1P4CA 2POTA 3H4WA 3ZVHA 4IHCA 2OXNA 3WK3A 3VZYA 2RAGA 4AXKA 5GPRA 2DJLA 1SO4A 4C6KA 4HCDA 4C65A 1EA0A 1NM9A 5F2GA 4DWSA 3LGGA 4O1FA 3SCQA 3ZYZA 3N1AA 4GC3A 4H6EA 2GJXB 1QBBA 1GTHA 2C7FA 2DUZA 1TA3A 1RBOB 1SW3A 1KO0A 4JTSA 5HMFA 3TWBA 4CQCA 2VXNA 3GNNA 5EGRA 4RV8A 3WQ8A 5BNKA 2VRKA 3E5BA 4KCWA 1E9YB 2FDMA 2VWTA 3M0JA 1JDAA 3U8GA 3KBMA 4G7FA 4KRUA 1OCJA 1E4MM 1U1HA 4W88A 3GNOA 1LQAA 4FPSA 4MF4A 4B5NA 1XQKA 3XISA 2GFTA 1AQMA 4UTIA 2DUAA 3OHMB 3TYBA 6REQA 2NX3A 4UB9A 3DGBA 4IIBA 1DQWA 1A49A 1Z44A 3C3NA 2XYLA 1GZJA 4CQBA 2H3BA 3W70A 3W2NA 4M6VA 3CZGA 3FK4A 1TJ1A 5JQ9A 2PDNA 2RFGA 5E5CA 4XX6A 5I2UA 1NVMA 4IMEA 1JCLA 4HMDA 4OQVA 4ADTA 4HK7A 1W1YA 3CS2A 4PRRA 3GG8A 1QO5A 1WO2A 1GT8A 3BV4A 1GYMA 2PF8A 3NQVA 1W9PA 1ALDA 4U28A 4M24A 2X41A 2CZ5A 4XVDA 3PBMA 1QK2A 2BGQA 4B2DD 3S4TA 3CO4A 3JS3A 1OCQA 1FXQA 3G1FA 3QR1A 1J0JA 2E67A 1QWGA 5DF0A 4ECLA 3A9BA 4IQEA 5CC3A 9CGTA 3CLWA 4CEXC 3PSVA 3CGTA 3USZA 4AZCA 3NZQA 4U31A 3EX4A 4AF0B 1IEWA 1EA9C 3VFLA 2FVLA 3MKVA 1W91A 3ECQA 4V15A 4RZBA 5D37A 2OPJA 3E3HA 1IT7A 4FIRA 4DLFA 6A3HA 1AL8A 1SW7A 1QPRA 3WH7A 5I6SA 1BG4A 3GE7A 3TQ0A 1H7OA 3NDYA 1G67A 3OYXA 2YBTA 3VDCA 3R8HA 2DP3A 1RPKA 4KKXA 3SZ8A 4PUUA 4ZQMA 1FDJA 2ZZ2A 1EYEA 3PBUA 4A3YA 4M0XA 4EAMA 1XFBA 4IP7A 3SRHA 2YCLA 1E5NA 2ZXAA 2ADAA 4MAVA 1X8CA 4H9UA 1XFCA 4ERIA 4PL1A 1M41A 1IT0A 1L2UA 5G2HA 3E5PA 3AUJA 1V6WA 1H7PA 5D09A 1AH3A 3HIJA 5T8GA 4P7OA 2E1WA 4IPIA 3V5CA 5F2IA 3UR7A 4KPLA 2PZ0A 4HU8A 2GUUA 1IIHA 3VA8A 3FY1A 2WHLA 1AK5A 1Z3NA 3VABA 3F4WA 1LL6A 1U2YA 1TUFA 4IIGA 3BDKA 3G0SA 1X1NA 3F4CA 4ATDA 1G7UA 4X0VA 3S5YA 2PTDA 1TVNA 4JXCA 3F5JA 5FF3A 4QCFA 1H60A 2VRJA 1PX3A 1BD0A 3NJ3A 4NVTA 3R58A 3G2GA 5H8UA 4GKTA 4N42A 3NQGA 1BRLB 1H7RA 5D30A 4A8IA 2ZZ1A 3DG3A 3N34A 3F2BA 4B5XA 3IIVA 1EXBA 4WSKA 2Q6ZA 2QUNA 5G4WA 4K39A 1HP4A 1EEPA 2R8WA 2V9DA 4QJ3B 1YPFA 2W79A 3FEQA 3BSHA 1VP5A 2Q01A 2Y0FA 4XZHA 3UPBA 3WUFA 1TIMA 1ITCA 3K13A 4XUGA 3W84A 2BY0A 4AC7C 3C2VA 2HDJA 1A80A 3DFOA 1ZJBA 2NXHA 3B0XA 2GUYA 1WZAA 1FCQA 1SQ7A 3L66A 4TOQA 4JGDA 3B9AA 2DZPA 2OOGA 3Q4DA 4EANA 2ZDRA 1UKOA 2UZ9A 1FY6A 4BEUA 2CFFA 5HANA 1TYGA 2PDPA 1TWZA 3WJXA 4GQRA 1B5TA 1VCVA 2QNEA 3BE7A 5A2CA 1QOXA 4UC5A 2P8CA 3GB6A 4FNTA 3GVRA 1HVXA 1IT8A 3OQEA 3ANVA 3UESA 1A5NC 4CU8A 2R1LA 1TZ9A 2NV2A 2WC3A 3E2QA 2KAUC 3MTWA 2WMFA 3V3WA 2A5HA 4UZSA 5I03A 5D38A 4AZBA 5CAKA 1AQHA 1HX0A 1EJXC 3NQDA 2QCDA 1BXBA 1AD4A 4MIMA 3S47A 3HZ3A 4IFRA 3W7MA 2W63A 1HL9A 3WF2A 2NQJA 1OK6A 3LNMA 4GUGA 4KCUA 4MJZA 4Q8MA 1OX4A 5J5RA 2XH0A 4XBKA 3W71A 3FAWA 3SJNA 4UTUA 1Q85A 2Z29A 1PHQA 4KCTA 3UNDA 3IACA 4MPQA 1XD0A 4LNYA 4BQ4A 1X8FA 3W7GA 4CQDA 3V18A 2PDIA 3B40A 4LUTA 3VIKA 3T81A 3JZUA 1NWUA 3QEZA 3F4DA 1J2BA 2DSKA 3BLPX 3LB0A 1JFHA 2VX4A 4OUEA 1E1CA 2WJDA 4IGNA 4B2DA 4JTLA 2BWGA 3C2FA 5HAOA 4HSNA 3ISIX 2DZXA 1S2UA 1KRAC 1VJZA 1L6YA 4HHPA 3W26A 3H2MA 2REQA 4NI3A 5I3FA 3DI1A 3GFYA 4GX9A 4YTSA 4RDWA 1E15A 5IM51 3P62A 1GG1A 3UWEA 1XLAA 3DIPA 3MWCA 4H9VA 1JD9A 1B4EA 3GNPA 1EO5A 3VGHA 1EPXA 3CZLA 4KWUA 1R38A 3THDA 3EOLA 2Y6ZA 3C0LA 5T9CE 4ADSA 3P7YA 5CPOA 1V0NA 3AXXA 4AZ5A 3RM9A 4E3VA 2F38A 2MNRA 4NUWA 3CHVA 2ALRA 3G0UA 1Q45A 3W23A 1MRQA 4O17A 1LUCA 2WVVB 1HJWA 5CZSA 4QBXA 2DVTA 1UR1A 2O9RA 5J5DA 3E0FA 3IJIA 3EDKA 4NJGA 3BOFA 3QBUA 1S3TC 1R87A 2W66A 3UT0A 1OYAA 5G4EA 1UA3A 4W7WA 1VYSX 2BXVA 2YOCA 1JRCA 4CQ8A 4D6FA 3I3DA 3L12A 3UCCA 1DEDA 5FKYA 3GH5A 3WBXA 4DJDD 2G3JA 3FIGA 1E51A 4JTGA 3Q37A 4REQA 1B3WA 4ACZB 2ABBA 3MJYA 2Y7GA 1Q2RA 3LXBA 5CZTA 4ZCWA 1SM9A 2WQPA 2WVTA 1V0KA 4C1NA 1M04A 4PMUA 4XWUA 3II1A 4O53A 4RV3A 4UNKA 4O8RA 4DJDC 1JZ3A 1H62A 4WZHA 3WLKX 1UWSA 3ITYA 3LZ3A 1JXJA 4AIUA 3D47A 1W3IA 4GGBA 4F3HA 3N14A 4QXIA 5JUVA 3PUOA 3DFQA 4JY8A 2XH7A 1J5SA 4UTHA 3W7HA 4A05A 3KEHA 1YPXA 3M46A 1QW8A 3LYEA 2NLYA 1ZP3A 3QHNA 2D2GA 2EPMX 1RP8A 3N2OA 4LS2A 1ZRQA 3QQ0A 2J27A 2I9EA 2UY2A 4ZVJA 1OZQA 3VKJA 1GJWA 3KFTA 3MCNA 2EO7A 1XR2A 3NO3A 4J3WA 3W7CA 2PPGA 5FEPA 1AH4A 4QCEA 3OIHA 4PTDA 2FH6A 3K30A 2D3LA 1X6UA 1JEZA 4I5RA 1NWRA 1Q6DA 3HQOA 4NX0A 5I77A 3RLVA 2D2OA 4UQCA 4DBEA 4MWAE 1XF0A 3NFUA 4PMXA 2GQAA 4YTTA 3AZSA 4FI4A 2E3ZA 4XZLX 1QPNA 2BB0A 2CLPA 2VEIA 2OB3A 3VK5A 4DXXA 1Q13A 1JIBA 4L65A 4FNQA 2GK1A 2HSAA 1UJQA 1M65A 3AISA 5F4SA 3WYZA 1V8EA 3DU0A 4GYJA 3EWWA 5C2GA 2EXOA 1A4LA 1ZCCA 5HBFA 1D3CA 1E43A 1KBJA 3NEVA 4Q8TA 2O4QA 4KWWA 3ABSA 1WBJA 1UH3A 3W1XA 3SFWA 3H12A 4AG0A 1Y7VA 5BXSA 3C5QA 1SJDA 2PS2A 5F1UA 1VCFA 2TODA 3KVMA 1DWHM 1VZWA 3BH4A 4ZO8A 4XD4A 4ZE4A 3RLUA 3ZR4A 4JQ2A 1JZ7A 1ESWA 2HMCA 2ZZ3A 5KZ6A 1FHDA 4JTQA 4QS6A 2I5IA 3LBCA 1VIZA 2IPJA 1JQVA 2CYGA 4MGGA 5DCBA 3CU2A 1HN1A 4H9ZA 3IIXA 3IARA 1U33A 3QGVA 4BCEA 1MZRA 2E5CA 4AAJA 3LHTA 4D2JA 1LDCA 9XIAA 3TYUA 1TX2A 3PG8A 1P1XA 1Y5XA 3HFYA 4Z0JA 4QE4A 1V6VA 3ZO9A 2JKPA 2HE8A 3GDBA 1UP0A 4QDPA 4FNUA 1KA9F 1SYTA 4AVOA 4B5WA 1GOXA 2YYTA 3AFBA 4Y7EA 4DPPA 3GWQA 3YPIA 5C9WA 1J0IA 4AEOA 1EF2A 2G3FA 3W25A 4J3UA 4RUBA 1E70M 2VYOA 3VZXA 3F2DA 1L0PA 3G1VA 1WOAA 3W2UA 3KRSA 3LA4A 4LQ1A 2C18A 1WDWA 5MHBA 3L21A 3RLHA 3ONBA 4X3ZA 2BX7A 4HN4A 1S2AA 3SCWA 3QQWA 1E0TA 3N17A 4LCRA 1KFEA 3MSYA 1B31A 2VEFA 1YE4A 4O1BA 4LOCA 3WFZA 2EEXA 2Z6IA 2E4TA 2QJHA 1K8XA 1NOFA 4DJDA 3SURA 3GY1A 1OG6A 3PWGA 5F7UA 3OP2A 2CWNA 3C0QA 2ABAA 4PGLA 1CXHA 2J8TA 5HDRA 3L0GA 4GJJA 5HR7A 5D2XA 4C5YA 1B1YA 2QUTA 5KINA 3LLDA 1EJSC 3KS5A 3EA2A 3QTGA 4EK7A 2BOEX 2HISA 2NWRA 3SCNA 1OF8A 1WDQA 3NOYA 3MDWA 1J8VA 2DIKA 1BHGA 3AU6A 2V63A 5I07A 4XO6A 2QPSA 3T2QA 5ABFB 1B3VA 1TPVA 1E0VA 1MEWA 1TWWA 3W76A 4G1NA 3FJLA 3CHFA 3L4VA 2VC5A 3NR0A 2CWXA 3LXCA 1LP6A 1ZS2A 1WXYA 4BJHA 3S1UA 2QPUA 1UZDA 4JQ1A 3VD5A 4H8HA 4XSMA 4CNPA 3P82A 3UQNA 5EB8A 4EF8A 4GYFA 4AIBA 3W37A 3WLSA 5T91A 4IOTA 1G6CA 1CGXA 4ZMGA 2ZVIA 2X1SA 1S5MA 3V0TA 4J4KA 4W9TA 1A50A 2YSWA 1AJZA 3I7SA 3PJUA 5DELA 4M3PA 3GU2A 1V7AA 3AYTA 3U0HA 4HHMA 1DJIA 2E6DA 4F0LA 1XDJA 3B9EA 2WKLA 1MUMA 2D2HA 2FIQA 2FZNA 4UXDA 4IIFA 1JPKA 5E9XA 2PDCA 4TVUA 2CETA 2E6AA 2EPOA 3DUGA 3SGUA 3T0TA 3M5YA 1OD8A 4F0MA 2QULA 5I06A 3TJ4A 2GPTA 2QR6A 2Y24A 3DDMA 3GFXA 5LNWA 4XKYB 1DL3A 1OEPA 2EAWA 1JCJA 3D5HA 4WR3A 4B3ZA 3ZJ6A 3W2LA 3WZ0E 3PTKA 3TVAA 3DFTA 3RMEA 3VYLA 1LL7A 4I6VA 3BZGA 3C56A 2ZE0A 4H19A 3DH7A 1LORA 3H21A 1TRDA 1J2WA 4DBWA 5TAOA 2Z24A 3LS9A 3VOHA 3SBFA 3GXDA 5H1WA 3MU7A 2G8ZA 5DO8A 1VFOA 3CZKA 2IKIA 2WZTA 4RLIA 3ZQ9A 5I23A 2VURA 1PWLA 3IIPA 3S6OA 3EPOA 2EJAA 3IGXA 4IIDA 1L6FA 1VS1A 4H00A 5B7YA 3VKAA 5GJMA 4S39A 2HNHA 3A4WA 3C2YA 5FI8A 4G5DA 4JTFA 4PUJA 3HU7A 1XBZA 4H01A 4V1XA 3MV01 3TN5A 4LAMA 3GNXA 4FOJA 1HKIA 4H7CA 2OEMA 1XUZA 5C7VA 2WAGA 4AZGA 3LGDA 2WYSA 4EPKA 2ZC8A 4URIA 4A2RA 4ORIA 2G97A 2BZNA 1PV8A 3FKKA 3UD6A 3OA3A 4O50A 3PTDA 3E0VA 4KWOA 3UETA 3LBOA 4XAYA 1CENA 4A3UA 3NVTA 3RJXA 2IQTA 2J8FA 4LVAA 4A8NA 2XIJA 1KKRA 2WVUA 2NQ5A 4D6HA 5I79A 4IP5A 3UVIA 2BOGX 2Q02A 4FNPA 3ZVHB 1MXSA 3EEZA 1QDSA 2QS8A 1OIFA 3A13A 3WH6A 3TYDA 4NRRA 4EXQA 2QYGA 1NWSA 3L5LA 1G4TA 1SO3A 4TV6A 1VFFA 4AIEA 4DWSB 1VF8A 2E68A 2PRHA 1OSEA 2PWDA 4RKAA 2WSPA 1QI2A 3WX7A 1TA3B 1XYCA 1CYGA 4HZ7A 3U2OA 4F9DA 1W32A 1ITQA 1XGEA 4ZBCA 5DT5A 4P7NA 4NG3A 3WSUA 1JNEA 1YEYA 1BKHA 2WSQA 4LUSA 1XLFA 3CUGA 3O16A 5BRPA 4QX4A 3H2EA 1E1EA 4BK9A 5HULA 1W5QA 2YPIA 2Z25A 1AW2A 4HN8A 1SZEA 3BGGA 2PDWA 3TSMA 4S1FA 2QJIA 3MKKA 2GVJA 4W84A 3ZLGA 2BBFA 1BF6A 4QDMA 2Y70A 4LYRA 2J4GA 3W00A 4ZXLA 1I45A 3MUXA 2XFFA 4JAWA 1YX1A 4PBFA 2JKAA 4PC8A 3BSGA 1R3YA 2A3AA 4ACYA 4DX3A 2QCEA 1YIXA 3NQCA 4HPXA 5D9PA 1IHIA 2XJ7A 1JDCA 1LWJA 2OLAA 1Q6EA 2XFWA 2NWSA 2YGYA 3K46A 4HU4A 3A47A 4KRZA 1RLCL 2YXOA 2NV1A 4AD0A 4AW7A 1YKWA 4OKDA 5DY3A 4QE5A 2VC7A 3ABOA 1IIGA 1WBHA 3FA5A 2VOTA 4ZQRA 2CU0A 2AAAA 4HSOA 2DY3A 3UNTA 3RRXA 3GTFA 1ONXA 2D24A 3OIXA 1M7OA 4AZCB 1C8VA 3VDHA 3DYOA 3QSTA 4WRHA 4H83A 1DP0A 2Q09A 1KFKA 3IGUA 4M1RA 4JX4A 1ODUA 1E0XA 4L4MA 4M51A 1KM3A 4JKMA 3UFYA 3OGRA 1IR2A 4GE8A 2V5KA 1TV8A 3AIQA 2J9ZA 4D6DA 5HXMA 2DW7A 5D32A 4ATLA 3W7JA 3MYOA 1H61A 1FHUA 5A94A 1YXDA 1TV5A 3FA4A 4AX7A 4AVNA 2OWWA 3O0FA 2CW6A 3GYEA 3E1F1 3PZOA 2RKXA 1P0EA 2YCLB 1KGUA 1GHRA 3N4AA 4GIAA 1S2VA 2OX4A 3CYJA 4K1WA 3W1LA 4HCLA 4H7ZA 4PCPA 4R34A 2BMBA 3HPZA 2OFJA 1TRIA 1J12A 1DWGM 2C0HA 3L9CA 5B7ZA 4K37A 2IQ0A 5K2ZA 5BROA 1KR1A 1IYXA 4MZYA 1JG9A 4HOXA 3HV8A 3I6TA 4CD4A 4QJ5B 3PF3A 1J0YA 1SFSA 2F61A 1VFLA 2CEQA 2Z7KA 3EX2A 2W9MA 2VGGA 4UTFA 2PBGA 4YCPA 4NRSA 3CV2A 1KCZA 4RW5A 2I17A 4P8XA 2FMNA 2PTYA 1JNDA 1R86A 3CUFA 1R30A 4Y2WA 1HKVA 3TE9A 3WLQA 4B92A 1CGTA 1UZ4A 1Z42A 3H7UA 3S6DA 5DBTA 1L2QA 2EF9A 4JTAA 1K70A 2AQWA 4PBEA 2D3NA 5LXEA 2CLIA 2W91A 3CUIA 2QCHA 4D1IA 1Z89A 3VCRA 3LENA 2XN1A 1UIPA 1JYXA 4LY4A 2GSHA 2O7SA 4O4VA 4MWAC 5LIXX 1R8LA 1UP3A 4IJBA 4DRSA 1VCGA 4OWGA 3E2RA 4A22A 4JTHA 1PWMA 1UR2A 4NZJA 1QUMA 3P14A 2G96A 4XIAA 4HMNA 4NQ1A 3RFAA 3LK6A 4M19A 4MFEA 1LROA 3QGKC 3FA3A 1QPQA 1MDLA 2OQYA 3TK7A 4CD5A 3FDKA 3DG7A 1BF2A 3A24A 2OZ8A 2AGKA 6ENLA 5HJXA 1LF1A 2BXZA 4CN6A 2QDDA 3FJNA 1JYWA 3AIVA 1BYBA 2WVSA 2CZFA 4MB5A 2RGLA 3W9ZA 4QDWA 3AHYA 4Y6GA 2ZUNA 3ORWA 3ZOAA 1UB3A 5ENLA 4IM4A 3IJQA 1FA2A 1LBMA 5L6UA 3JR2A 2WB5A 3BG9A 3M6YA 4RPPA 3DX5A 2C14A 2PODA 3QTPA 4ZOAA 3VGBA 2Z6JA 1A0CA 2WZHA 2QCDB 3O15A 1M7JA 3JZEA 3WH9A 3GU9A 4GI9A 2DGAA 3NL5A 1H51A 2XGBA 3G5EA 3VAVA 1UUQA 1LJYA 3E02A 1OYBA 3NZGA 3QV7A 3N11A 4MLRA 4PODA 4OTKA 3KTCA 1MXGA 3UYCA 4U10A 1V79A 1KW1A 4KERA 3KVJA 3SCUA 2D73A 2I16A 2I57A 2JF6A 3WMLA 3W1TA 2JFEX 3ZS4A 3UJSA 3NYDA 3W1AA 3QPZA 2EGZA 1QR7A 2G0WA 4N4PA 2CBUA 3BURA 3PJWA 4MJ4A 3NO5A 3SY8A 3HFTA 2XZ9A 1YLVA 5EMYA 2XH4A 4BHYA 1MUCA 3ARZA 1E1CB 3HOJA 5D2WA 3HPAA 2J7FA 5EU9A 2ACQA 3PVFA 4D6GA 5AKQA 4GCXA 3W73A 4FOKA 3TA6A 2REQB 2Z4GA 3CB3A 1SMDA 1Q5MA 1TIWA 4S2BA 4OV4A 1NU5A 3DXIA 5J04A 4HB7A 3OQ8A 1RBLA 3G1RA 4PYSA 1XKYA 4RE0A 1U83A 3AMDA 4I90A 3S6TA 2X16A 1BWVA 2OYMA 3WQGA 3UGVA 2OQHA 1JJKA 4RXFA 1BVWA 4RZ5A 4L9YA 1GVIA 2HROA 5I3HA 4PTMA 3W6LA 1HZYA 1XPYA 2WKJA 3EOEA 3NDOA 1QASA 1CB7B 5A6TC 3BC9A 3VNYA 1O5XA 2XHYA 3RF9A 2BHUA 1XCXA 4AC1X 3STPA 3MUZ1 1WUFA 5AVNA 1LUCB 3CH9A 5LYRA 2VENA 1J11A 3UEQA 4FMVA 2TAAA 4KWVA 4NYUA 4DUWA 2ZX5A 4PB3A 4RZ6A 1WXJA 4LRTA 1ICQA 3WLOA 3H8AA 3LRLA 4OHQA 4O13A 2HBVA 3DYMA 2YKKA 4IPJA 3GD6A 4XIMA 2OGJA 5CPLA 4C5ZA 3ARQA 2KX9A 3BUVA 2GGIA 1LG1A 3PBVA 4RE2A 4QLKA 3WF4A 4REQB 4O54A 4EWJA 3BZJA 4S38A 4QG8A 3NPVA 1SGJA 1V03A 4B5VA 4NXKA 2O9TA 3QYSA 3VXGA 3VI2A 3PBWA 2VWSA 3ITVA 2R94A 4RPQA 4U5IA 4E38A 4TO8A 4DELA 4YS1A 1CLXA 3UJEA 3SSJA 1ZB5A 5C5YA 2C6QA 2Y7DA 2B0MA 4U2ZA 1EZWA 3TROA 1TPEA 3W2KA 4MY9A 2AGTA 1BGGA 2B7QA 3KM8A 1QNSA 4PTNA 3AIBA 3ABQA 4D72A 1M5WA 2Z27A 1LM1A 4PMNA 3CT2A 4AFYA 1UR3M 3TW9A 3EWZA 1V08A 3W7OA 3WUEA 4O28A 1ISYA 1X6NA 1R46A 3TP4A 2PDGA 3UG5A 3UY8A 3SEPA 1E9LA 3C4UA 3UXIA 3MP5A 2C79A 3WLJA 4GX8A 2CNCA 3BSMA 1UH4A 3MPGA 3I4KA 3TZNA 3EWXA 3QV9A 1WDRA 1TTQA 4NYYA 4Q7IA 3QM3A 5FJOA 4ZOCA 3EA3A 5FAJA 1OABA 4G6CA 1OCBA 1US2A 3MANA 3EB3A 4PBGA 1XWYA 4Q3MA 4O14A 3GIQA 3WBWA 1GJPA 1FTXA 1HVQA 4ZQNA 5C71A 2GK1B 2X30A 4AY1A 1RQHA 2IQDA 2J7CA 4QNWA 1W8SA 2J78A 3VX0A 3UBPC 3FS2A 4ZA0A 4GUHA 4GVHA 2QZRA 2ZCGA 3CWHA 4ZENA 3OLEA 3CMGA 3BJSA 3EZ4A 5CGQA 1DYSA 2HK0A 1V02A 2WNNA 3EWDA 4K38A 1LLOA 3E49A 3R43A 5JH2A 2FZ9A 2BY1A 1V93A 4P5UA 3VNZA 2GSJA 3CQJA 4C7GA 1UQYA 1HTIA 2GUBA 1OHLA 3AS2A 1H1YA 3KRUA 4FSAA 1Q6CA 2R1KA 1B3XA 1XYLA 3MJMA 3G1XA 4O8AA 2HVNA 3GTXA 4FXJA 3VKKA 4YWSA 4TXEA 3GIPA 4PUMA 1UD6A 3OBAA 4H9YA 4AVFA 2PTZA 4RE4A 1RY0A 1P48A 4JHOA 4NZ3A 4ZQCA 4LUYA 3QYQA 1QK0A 2C1IA 1XYZA 3CV1A 3FSUA 2R1NA 3P93A 4F79A 3FHAA 5BYWA 4JQAA 2QIIA 3CEUA 5D9MA 1DXEA 3EMZA 3OB8A 2ACUA 2WANA 1G01A 4FLRA 1QOQA 4US5D 4DBUA 4PRWA 5C55A 1OFBA 2FTYA 3NTYA 3H6OA 4DAIA 2VX6A 2V3EA 3PK7A 5LA2A 1KD0A 1PIGA 3UZJA 2NQHA 4MUZA 3HTWA 1N8FA 4CNTA 4UMCA 4JNYA 3HM7A 2VP8A 4AXNA 1ENUA 3LPGA 1XG3A 2JIWA 3B8WA 1TVPA 2ZUSA 4NNBA 2GGGA 5J8LA 4AMAA 1SUXA 2A3HA 4PCSA 4JIEA 4LCQA 3T78A 2DVUA 5HR6A 2YXXA 3AZRA 2QAPA 4PCNA 2DW6A 2TSYA 4X9YA 5ECUA 4WUIA 1I75A 2C1GA 3L4XA 2X05A 4GVIA 2YZ5A 2WMKA 4M7SA 4JN6A 2QW5A 3JW7A 4WDXA 3F2CA 4HVXA 3DBNA 3DAQA 4UTWA 3ARYA 1G0CA 1DWFM 1CDGA 4C6BA 3PWIA 1XLDA 3GXPA 1GK8A 3DBPA 2E6YA 1DOSA 2CLFA 4QLJA 2XIMA 3WEOA 5FEWA 1JZ8A 2A6NA 4HOZA 3T0CA 4LCSA 5DCEA 5CC7A 4I9TA 2E9MA 3WQVA 4AWSA 1XRVA 1MQQA 2ZICA 4HK5A 7TIMA 4C1LA 1T7LA 1H3GA 3SGZA 5KMYA 1IXNA 4B5TA 3ITLA 3CBWA 2I1OA 2HK1A 1LL4A 1SJAA 1FQ0A 1D3HA 3KBVA 4KIEA 4Q8PA 3AS0A 3C3UA 3LLFA 1EP2A 3GUGA 1V51A 4GC4A 4WKFA 3CL8A 2QEZA 1H11A 2ZC1A 3B8IA 5BWAA 3IK2A 3FXYA 1I2NA 3DERA 3GXMA 2WM0A 5DQPA 2HEJA 4WKHA 3ZJKA 4G7EA 2BOFX 5KTLA 4UR8A 3P0XA 1I9CB 1Q2SA 1DJWA 5FF2A 2E28A 1XYAA 1JPHA 1EP1A 3QFWA 4K7YA 2ISVA 5KSWA 1D8CA 2DDXA 3NQFA 1TZ7A 2WBGA 3NL6A 1FP9A 1EOKA 4M82A 3HPXA 3WH5A 2ZX9A 5GVJA 1POKA 4UCGA 3KCOA 3APTA 3BCFA 2J8GA 1ONEA 5AYZA 2C8NA 2CLMA 3R2GA 3TZFA 4U3CA 2INFA 3MUY1 2P53A 2PRMA 4B3LA 1VKFA 3MVTA 2DIJA 2ZRYA 2FHCA 4XBJA 4A21A 5A8PA 1H4PA 1VPQA 1YRRA 1KXTA 2DT1A 3R1ZA 4B16A 1G5AA 3N19B 2WHJA 1DVJA 3APYA 1CXFA 2Y8KA 4R3UA 1F3EA 1LG2A 3VOFA 2XISA 3A23A 1KTNA 1UW9A 5FF4A 1S5NA 6TAAA 5LNUA 1EYWA 2BG5A 2AQVA 4JEJA 4I5XA 2JE8A 3F03K 2D0FA 3O06A 4LB3A 2PRLA 4WVXA 1Q65A 5C9XA 4M6UA 3BMWA 1AG1O 2VELA 3U2EA 4JIQA 2DT2A 3VDBA 1RD5A 3DFSA 3M5XA 5A95A 1JDFA 5IHSA 4YMZA 3AS3A 5C9ZA 1RVGA 2GVLA 4RXGA 1EBHA 1EX5A 1ZALA 3L0NA 1P0BA 3TX9A 2PA6A 1YDYA 4GINA 4F0KA 1W0MA 3WDIA 1V6UA 2C3ZA 3REQA 1UKQA 5U7SA 4US5A 1K6WA 1EZ2A 4AEFA 1ODZA 3OYZA 4LBSA 4FR6A 1TV3A 3M0VA 3NPWA 1E9IA 3F4VA 1K8ZA 4OOUA 5M17A 1A5CA 4LB4A 3W1UA 3NDZA 1QT1A 2F6XA 2GOUA 3LI1A 1CXLA 3N29A 3VGGA 3VGFA 1PKYA 4MB4A 4NIRA 2PUZA 4DZIA 4GXWA 1EQCA 1OINA 1TE1A 4QSFA 3SI9A 4PUWA 1R3VA 2PCQA 1SZGA 3NL3A 4AQLA 3OOQA 5AC8A 3C0SA 4RNHA 3WK2A 1PPIA 1I2PA 1RALA 2QV4A 5EFDA 3CMFA 2A3LA 2VL4A 2V67A 4I6KA 1W54A 1HIZA 3E0WA 2E9LA 4HPHA 4QE1A 3T2PA 1FOBA 1SFJA 2VTFA 3K8LA 2WLZA 1XDMA 3RX4A 1RH9A 1HJUA 1EEXA 3PHAA 3W7LA 3COTA 4TMBA 3JRKA 3FOKA 1FWWA 2CLEA 5ABEA 4MSSA 3C6CA 1D3GA 3NZ1A 5CXPA 4YU1A 2BVWA 3PTMA 1CLKA 4LVDA 2E9BA 2IW0A 1KNWA 2V8ZA 3TC7A 1KRMA 2OKTA 2PFHA 1EGMA 1MSSA 1HFBA 4LUSB 2FMOA 3NOEA 1JDDA 1FBAA 8XIMA 3P3BA 3N9SA 4Y90A 1SMAA 4MDPA 2WJEA 1ZBCA 3NVDA 5I3IA 3ARVA 3CXOA 4CQAA 5A8MA 4N9BA 2F84A 1T41A 3I68A 1JZ2A 3UJFA 1XIIA 4DO7A 1EF3A 3A9IA 2B4GA 2VR2A 1FXPA 4R27A 2C71A 3M07A 3RMJA 1NF0A 4DUXA 4MB1A 2VR4A 5M2FX 3W7IA 1ZPTA 1VLIA 3M43A 4IG2A 5TIMA 4BWLA 1FWSA 4Z1AA 3LHUA 1EBGA 2Y89A 2HZGA 1UZHA 4F66A 4U33A 5EYWA 1C9DA 1B54A 4PRTA 4J40A 3C8FA 4LX4A 4FF5A 1K6AA 2QCNA 4NZ4A 1UPMB 5AC4A 3HG2A 1YQ2A 4HD5A 4MNMA 3MT1A 4JNMA 1WQ5A 2I5GA 5MF5A 4PB4A 3QMTA 1MXDA 2H6RA 3NWRA 1S2TA 1S38A 3TYEA 4FEZA 4JOMA 1A5BA 3NQ7A 5EKYA 4K36A 1B3OA 4Y8FA 4B15A 1G4PA 3UU0A 4Z42C 1OX6A 2VGFA 2ZTJA 2VVSA 1NFPA 1QRQA 2I5QA 4CD8A 2OR2A 3BLEA 4EPEC 2AL2A 5JIWA 4W4QA 4F2BA 2YJQA 3LLXA 3MMDA 4BQ2A 1VFHA 3IRDA 3QR3A 4GI8A 3QPEA 3HV9A 3AS1A 3PB0A 4XSLA 1UASA 3VC6A 2H3DA 1HJQA 1OGSA 4YCOA 1RY8A 3KBJA 1A3HA 3B0PA 3QR0A 4H4IA 3L67A 1XIEA 5LSMA 3H7RA 4PUDA 4ROQA 2J24A 1US3A 5FAGA 4QJ4B 3KP1A 4J3VA 3S5ZA 3ID7A 5CC6A 3UPMA 5CLTA 1OB0A 1E6PA 3WLIA 1JUEA 1LLWA 3W28A 1JVNA 3S3GA 4HA0A 5B80A 4WOQA 3VILA 2OSXA 4ZFMA 4DJFC 2QPXA 5M03A 4GCAA 2PDHA 5EA9A 4A35A 2DU2A 2YCEA 1VR6A 3H70A 2PD9A 2DJXA 3KLLA 2WZEA 3CC1A 2VFDA 2VFEA 3S2JA 4KFOA 5BMXA 3WLMA 2VJXA 5H91A 4O12A 4CNOA 5DRIA 1A0DA 1PZ0A 4K1GA 2FH8A 4L4PA 3SN4A 1V3IA 4D6CA 2XTKA 4J1OA 2FHBA 3ARUA 3TTOA 1EQPA 4WLCA 1XBYA 2E5DA 3BJTA 3SGGA 2AMGA 1W5MA 1JD7A 3IJ6A 4ADUA 4K8GA 3BG5A 1Z41A 1QAPA 1HKKA 2C91A 1NDVA 1PYFA 5C8BB 4S23A 2Y63A 2X09A 3EA1A 4UFIA 1E5JA 2DIEA 1RJRA 4HJFA 1THFD 3CPGA 3WMCA 1LOQA 4UTLA 2OZTA 1E73M 3L7RA 3UXLA 1KCKA 1F73A 4BKNA 1CTNA 1TJRA 3K1GA 4Y96A 2NSXA 4JNZA 5CQ1A 1CIUA 4A4AA 3TAKA 2XINA 1SVDA 1MW2A 2DT3A 1JCNA 5CLWA 4UTTA 4QS5A 3CAQA 1XLCA 4H6QA 5DMYA 3PNUA 5F4XA 1IWBA 4Z1CA 4WF7A 2QF7A 4M8UA 1ZAJA 1UKTA 2PGRA 5AOUA 2INEA 1ZCOA 3IV8A 3F1QA 1M53A 2W5FA 2MUCA 1TCDA 2AL1A 1RHCA 1MI3A 1H2JA 3QLDA 1NF7A 3VM7A 1Q4NX 4TTGA 2VZSA 4DQWA 4KS0A 4TMCA 1GNXA 1RV8A 2HS8A 3WDPP 1R3WA 2XFYA 2QJNA 1S1PA 5RUBA 3LX9A 1W2VA 3E38A 5I5RA 2NXIA 1DJGA 5HQLA 2WWDA 1W1A1 3AXKA 2JGQA 4I9AA 4XV0A 3IV3A 3MYPA 3N25A 3RDKA 3W87A 3KOFA 3PN8A 1FCUA 1X1OA 2F9RA 2V81A 1DJZA 3CO8A 3LMYA 3MV11 1D9EA 1DE5A 3STEA 3CUJA 2EPLX 1KXQA 1XCWA 2D20A 3EWCA 1XGZA 3UA4A 2VFIA 2OG9A 1QPKA 2FB3A 2E8YA 3HB9A 1R9ZA 2BLEA 5FACA 2OZ3A 3EWBX 3AMGA 2X1UA 1F7BA 4HZ8A 5C2XA 2DZVA 1XLLA 3WY1A 2Y8UA 1KB3A 1PZ1A 4MZ8A 3P5ZA 5LIWX 3W85A 4B4FA 1V6XA 1OBAA 1CBGA 2C16A 4LEFA 1UD8A 5FSDC 3CM4A 4QRNA 3GXTA 4DWSC 2JF7A 5G4HC 5K9CA 1KM0A 3RUBL 4ERAA 8XIAA 3LMZA 1ECQA 1I60A 4AYSA 5IBXC 4DVOA 3SCVA 3FGCA 1OGBA 3SCOA 2CPUA 5D33A 1SO5A 4Q4RA 3WH8A 3CAKA 3CIVA 1W8GA 1F05A 5HINA 3SECA 3IVTA 3B8SA 3GZAA 1Q6OA 1H09A 4XTDA 3TW7A 1S46A 1K4GA 1PX8A 3SW6A 3BLFA 2FHFA 3WIJA 4S3EA 4TIMA 4WEVX 3W38A 3S9ZA 1W3JA 1NOWA 1IGWA 3V5OA 3PANA 3UG4A 2VNCA 1S5VA 5K9DA 4IISA 1PKMA 4BR1A 3HGSA 4L7ZA 5BU6A 1KGWA 5EL1A 1LOLA 1DIDA 4IQDA 4Q22A 1P5BA 2VEPA 3VCNA 3LTPA 2GQ9A 1C8XA 1KM4A 1NELA 3VNIA 3ATZA 2X42A 3GDLA 1Z69A 1WP6A 2IS7A 1YNPA 2YW4A 3S2MA 4LVFA 1IGSA 3VIJA 4DI9A 2D1ZA 1G4SA 3IJLA 1OQFA 3W4RA 4OOZA 5C70A 1PDYA 4DIAA 4KEVA 5E1QA 1JF5A 3SUVA 1KR0A 4L4LA 4YXGA 5BXTA 2E0PA 1ELSA 4X2RA 1H7NA 1F3XA 1I2OA 3IUHA 5IOBA 4NKCA 4O10A 3PZTA 1M7XA 4LPCA 4GIEA 3N2CA 1FWEC 4LNCA 3EBVA 2HVOA 3IJ8A 1WOBA 2ZQ0A 1X38A 2OTDA 4Z2HA 1RA5A 2D69A 3B06A 1UOKA 4O15A 4MYXA 5BOFA 3CIWA 2WCSA 4AY7A 3KZSA 4L4OA 3W0KA 1EP3A 1ISXA 2W3ZA 1GHSA 3UVAA 3TCSA 2A7PA 1HP5A 5TF0A 4XVEA 2QKFA 1FP8A 1E0UA 4GI4A 2Y85A 1WKEA 5AVHA 3V35A 1MFVA 3URBA 3W88A 4UQDA 3PZIA 4JTCA 4A3HA 3URQA 3QZ6A 2J7GA 4DF1A 2INZA 1FWDC 3UF9A 2YR1A 2PDQA 3V0UA 1XH0A 2Q71A 1FDZA 3FKRA 2XWEA 2UY3A 1ISWA 3B3DA 4HYRA 4L1GA 1GYLA 2PLKA 3AJXA 1R3QA 1M6JA 1PKNA 3HF3A 4CVWA 3ELFA 3TC6A 3MI2A 3O6DA 1UH2A 3A64A 1JFXA 3U48A 4B9ZA 1R9XA 4CU7A 4LVBA 3V1HA 2PLMA 4H8NA 3TQVA 3RM4A 3KLKA 1MEIA 3MZ2A 4UZUA 1RAKA 3ZJ8A 2OEJA 2V5BA 3VCCA 3AIRA 4L6OA 2J79A 4PUNA