1ZZMA

Crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
259
structure length
259
Chain Sequence
b'MICRFIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADEIAQALLNNTYTLFNVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative deoxyribonuclease yjjV
molecule tags Structural genomics, unknown function
source organism Escherichia coli
publication title Crystal structure of YJJV, TATD homolog from Escherichia coli K12, at 1.8 A resolution
rcsb
total genus 92
structure length 259
sequence length 259
ec nomenclature ec 3.1.21.-:
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1zzmA00
3IACA 4UBPC 3AU2A 2E1WA 1V4YA 1UBPC 4J2MA 3EGJA 2VR2A 4CNSA 1VFLA 2EG6A 4EPBC 2D2JA 5HMFA 4V1XA 4C6JA 3OVGA 4GC3A 4KERA 3KM8A 4F0SA 2OOFA 3MVIA 1P1MA 2FVMA 4LAOA 4KETA 1RAKA 1NDYA 1UMLA 3JZEA 3C86A 2AQVA 1HZYA 4GX8A 4GY7A 3GTHA 4L6DA 2R1NA 1BF6A 3TN6A 3OOQA 3URAA 4H9MA 3F2DA 3LU2A 4G7EA 1PSCA 2OGJA 3B0YA 3IV8A 4DI8A 2YZ5A 1W1IE 4G2DA 1QXLA 4IQJA 3QGKC 3GG7A 4DLFA 2FVKA 2WJDA 4P5UA 2FTWA 2GZXA 4IFOA 2UZ9A 1A5LC 3QY7A 3F4DA 2ICSA 4KEUA 1J79A 2Y1HA 4PCNA 4Z42C 1M65A 1R9ZA 4INFA 3E38A 4CEUC 4WGXA 4YIWA 3RN6A 3TN5A 4GYFA 1FWAC 4KQNA 3IRSA 4H9VA 3PNUA 1PTAA 4LFYA 4DNMA 4XD5A 3S2NA 1R9XA 3PANA 3ICJA 2O4QA 4QROA 4LCSA 3HM7A 1XGEA 2KAUC 4RDYA 3UF9A 4DZIA 2CZVA 4B90A 3RHGA 1IE7C 3UPMA 4E3TA 2VM8A 1O5RA 2EG8A 3CS2A 4F0RA 3A4JA 3IARA 2PLMA 3HTWA 3QY8A 4KEVA 1EJUC 1RJRA 1YNYA 1GKPA 5A6TC 4CNUA 4C6QA 3SFWA 2Z28A 4HK5A 2BGNE 2YB1A 3OQEA 4C6OA 3MDUA 3S2JA 4PE8A 1EZ2A 3A3WA 1UIPA 1V51A 3G77A 3URQA 1KRAC 5FSEC 3ITCA 2FFIA 4HA0A 3IPWA 2Z2BA 4IH3A 4KIRA 3LS9A 1S3TC 4LCRA 3ISIX 3CJPA 4ZSUA 4DZHA 2E25A 4EP8C 2IMRA 4QS5A 1O12A 4RDZA 4D8LA 3A3XA 2R1LA 4C60A 2WM1A 2A3LA 3T1GA 4RDVA 4XAZA 3NEHA 2VC5A 3GTFA 1NFGA 2QT3A 2Z27A 3TNBA 4F0LA 4BY3A 3B40A 4HK7A 3HPAA 3MKVA 1ADDA 1DPMA 4PCPA 2PAJA 4R88A 4AQLA 1YRRA 3PBMA 4LCQA 3QGAC 3T81A 2Q09A 2RAGA 3FDKA 1RJQA 3S4TA 3GIPA 3FEQA 2FTYA 4IGNA 4AC7C 1A4MA 4C6BA 2OB3A 1FWCC 2G3FA 2HQAA 1EJWC 2R1MA 4WHBA 3O0FA 2AQOA 3OU8A 4GZ7A 1EJSC 2Z4GA 4KEZA 2P53A 1NDZA 1ONWA 2OQLA 3AU6A 2Z25A 3UR2A 4C65A 4TQTA 3NURA 4XD4A 1A5MC 1P6BA 3ORWA 1KCXA 3UBPC 2Z26A 3DCPA 4GX9A 2OODA 4EPKA 2UBPC 4H9YA 3OJGA 4IG2A 3SO7A 4DIAA 1YIXA 2VUNA 2Z29A 2ZC1A 4C5YA 4WVXA 4CEXC 1V79A 1QW7A 1XRFA 4ERAA 3LSBA 5E5CA 2GSEA 1FWIC 3LY0A 3QY6A 3AUOA 3O7UA 3MJMA 5CH9A 1EYWA 4CQDA 4I6KA 3WYZA 3N2CA 4KESA 3MTWA 1POJA 3F2CA 1RK5A 4NG3A 1WXYA 3LNPA 3URNA 1WXZA 4RDWA 4PBFA 3E3HA 1XRTA 1FWHC 4LH8A 4HK6A 3URBA 5G4HC 1I0DA 5AKQA 1XWYA 3EWCA 4DO7A 2P50A 2HBXA 2Z24A 1E9YB 1KRMA 2VC7A 4NI8A 1RJPA 4ERGA 1FWDC 4CQBA 3E0LA 2BB0A 1NDWA 3NQBA 4XD3A 4V1YA 2ADAA 1ONXA 4QS6A 4C5ZA 4GY1A 4DI9A 4CQCA 2GOKA 4BKNA 3CAKA 1RA0A 3GIQA 1FWBC 4OFCA 3LGGA 1V7AA 3K5XA 3BE7A 1R9YA 3ID7A 3B0XA 3GTXA 1K1DA 2HBVA 3IGHX 4XD6A 4R7WA 5FSDC 3F2BA 2DVTA 3TN4A 2YXOA 1A5NC 1A5OC 1M7JA 4LEFA 3LA4A 1M68A 4XAFA 3K2GA 1NDVA 4CNTA 3UR5A 1K70A 4HJWA 1KRCC 2XIOA 4MUPA 3DUGA 3T8LA 4ZSTA 1A5KC 1J5SA 1PB0A 1PO9A 2HPMA 3S2MA 4H9UA 1JGMA 4ICMA 3F4CA 1FWFC 2W9MA 4GXWA 4H9ZA 5LXXA 4GOAA 1UIOA 4RZBA 2QPXA 4H9XA 4H01A 2Q01A 2PUZA 4C6NA 3DC8A 3LGDA 2F6KA 1V77A 1EJXC 4IFRA 1EJVC 4B91A 3GU9A 1ITUA 2Z00A 3K4WA 2QS8A 4GBDA 2YB4A 2ANUA 1E9ZB 3IJ6A 3D6NA 4B92A 2I9UA 3GRIA 1ITQA 4XAGA 4I6VA 4J5NA 1FWEC 3GTIA 2Z2AA 4C6CA 4G7EB 2PGFA 4EPEC 4M51A 3OODA 5HMEA 3MVTA 4L9XA 4BJHA 4C6LA 1RA5A 3MSRA 1EJRC 3PAOA 3R0DA 1YBQA 3GU1A 4C6IA 2D2GA 3E2VA 2DVXA 3FDGA 2HNHA 4PBEA 2O4MA 1K6WA 2GWNA 2WJFA 4EPDC 1RK6A 4XAYA 4IF2A 4LAKA 4ERIA 3S2LA 2R1KA 4LAMA 4H00A 3E0FA 1FKXA 3RYSA 1FKWA 1ZZMA 4RE0A 2EG7A 4GK8A 4DYKA 1A4LA 1YMYA 2QVNA 1P6CA 2GWGA 3MDWA 4C6KA 3TN3A 4LALA 4DLMA 1FWGC 4GY0A 4UB9A 3E74A 2AMXA 2D2HA 4KF1A 1POKA 3EWDA 4IG2B 1EF2A 1GKRA 3RCMA 1I0BA 4JOMA 1J6OA 3GU2A 3V7PA 2PGRA 1J6PA 2HPIA 4QRNA 4R85A 1FWJC 5HMDA 4C6DA 2WJEA 2VHLA 4C6MA 3MPGA 4LANA 1YBQB 4J35A 1KRBC 3LSCA 3GUWA 4H9TA 3WZ0E 2DVUA 2I5GA 4IFKA 4C6FA 2R1PA 3PNZA 4QTGA 1EJTC 4QSFA 4C6EA 4IGMA 1GKQA 3WMLA 4NP7A 4B3ZA 4C6PA 4IFKB 2Z7GA
chains in the Genus database with same CATH superfamily
3WELA 4CQ9A 3UFYA 1W3NA 2HXUA 3OZPA 4MUZA 5EFFA 3W83A 3PS7A 3M0IA 5HULA 2I17A 3DXIA 3INPA 1FRBA 1QK2A 3H7VA 2OXNA 3NQ7A 4GC3A 4WDUA 2BG5A 4GZIA 3MUY1 3N3TA 3CBWA 4B16A 1Y5WA 3LHUA 3BCJA 1TJPA 4TIMA 1VFHA 3FCPA 4WR3A 1BPLB 1PYFA 3TN6A 2OSWA 4U2ZA 1DJYA 3OG3A 1GYLA 2V68A 2F9RA 1XIJA 2CLOA 1H1ZA 1HJQA 4FNQA 4YU1A 2NVAA 1XH2A 4CQAA 4RJEA 2G3NA 3MQTA 1WUFA 2A7NA 2W67A 3ARQA 2VEIA 5FCZA 5KETA 1M65A 1UKPA 1OT1A 1TG7A 3LXBA 1GHRA 3CUGA 1O6IA 5DCEA 3T78A 1QPRA 4DN1A 2YBUA 4N6EA 2PC8A 3WQDA 5B7YA 3UT0A 2C13A 1OY0A 1W0MA 4GH1A 2DP3A 3O3RA 3GE7A 2WMFA 4LUYA 2V82A 1UBSA 2Z1SA 3RMJA 1M03A 2PLMA 1YNYA 1WNOA 4Q8NA 1YYAA 1VPXA 2Z28A 3SUTA 2QDGA 3N2BA 2PTZA 3URQA 1QCWA 5FSEC 4UQAA 2CBIA 4PODA 2PWHA 3QH2A 3I6EA 2G3MA 3LS9A 3L0KA 4XV0A 4Z2GA 3OB8A 2QR6A 2PODA 1UQYA 1F3EA 4Z08A 4BEQA 1XIHA 2Y62A 1TRIA 5TIMA 2BTMA 3H55A 3CUIA 3AIEA 3T0DA 2ZUWA 3NEHA 1V6VA 1NFGA 1TWDA 1DORA 4I7VA 3YPIA 4ICNA 4HNOA 1XLAA 1XPGA 3NQ2A 4GKLA 4M6QA 3TCEA 2R9RA 3VKDA 1F7BA 1NVMA 2YCEA 1KTNA 1T5AA 4PMDA 2EPLX 4AISA 4YWSA 4HNTA 3TXZA 3AWOA 3SGGA 1R86A 2DSUA 4LUSA 3WLPA 3RAOA 4P8WA 2VX7A 3SM0A 3TTQA 3KRSA 4QE5A 4F79A 2ZRZA 1G7UA 4H41A 1W1PA 2WB5A 3KE0A 5DQPA 3ORWA 1GVFA 2EAWA 4GQGA 4O1AA 2OODA 4PMOA 4IG2A 3DU0A 1S5NA 4DIAA 3EOUA 2ZC1A 3HFYA 2ZA3A 3WEMA 1B4EA 1V79A 1XRFA 4LX4A 1L6GA 1D3CA 4PEKA 3ITGA 3CQKA 1A5UA 3O8AA 4P7LA 3T0BA 3O7UA 2VELA 3MJMA 3EX3A 1FWWA 3LN3A 3ATYA 3AIVA 4N9BA 1POJA 2ZX6A 3NSXA 3FYYA 4RDWA 4B5NA 3U0HA 3E3HA 3N25A 1TV2A 3SQSA 4TOQA 3GIYA 4DJDC 2QCDB 1V5XA 3RXZA 1R6WA 2TPSA 2QMKA 4N2YA 2V2HA 2WXDM 1TIWA 3HQPA 2PC4A 1G5AA 4AXKA 1GT8A 4DUXA 4V1YA 1XP3A 1SJDA 5GJPA 3VIPA 3EOSA 2NUXA 4BKNA 3PBWA 1Q4WA 5MKGA 3K5XA 3THDA 3UG8A 3HPXA 3BE7A 3W6MA 3ID7A 5CGMA 1OCJA 1H7PA 3I3EA 1OC6A 1PV8A 4CN6A 4ECLA 1KM6A 3RITA 5FJJA 4KKXA 2G41A 2JQXA 3K2GA 4L4OA 1J2WA 2RDUA 4MUPA 2HE5A 1JJKA 4J2PA 2A2IA 3TC6A 3WDIA 2G4JA 3VE7A 2PWUA 4H9ZA 3VTRA 2GJPA 2ZZ3A 4NASA 2CLIA 1UR8A 3PPFA 1GUVA 5C2XA 4IFRA 4M80A 1B3VA 2B7OA 3KX6A 2BFGA 3PBUA 4N02A 2ANUA 4AHOA 3D6NA 2BBFA 3ALFA 2HVMA 3W25A 3VPLA 3AIUA 4J5NA 4GQBA 4YJ5A 4HN4A 3TR9A 2HE8A 4ENLA 3F4WA 1MYRA 2P8CA 2GJNA 5IDZA 2YDQA 4ADSA 1Z32X 3SW6A 4H83A 2NVCA 4W8LA 5FF0A 1UD5A 4L56A 1B57A 3TXVA 3PAOA 5EGRA 3BW2A 4JIQA 2DZAA 1H5YA 4LY8A 7REQB 5A6BA 3GWQA 2E67A 2DVXA 5HPCA 1HL2A 3KTXA 4PSRA 2VURA 3S0CA 1FKXA 3CLMA 1SSGA 3CTTA 4CD4A 2W0UA 1WX0A 5EBAA 5EMUA 1DE6A 3TW9A 4FO4A 2QVNA 3TMLA 3IS4A 3SBFA 2YLLA 1RCQA 3VFCA 4YL2A 5H8PA 4PL1A 1J5TA 2MUCA 1F76A 2ZKMX 2OX1A 5HQLA 2X7VA 3GU2A 1PTGA 4CKQA 1R3VA 1UD6A 1IZKA 2I16A 2PGRA 3SJNA 3MWAA 1FWJC 2ISDA 1QASA 4W7VA 1H41A 5ENLA 1R3WA 4TXEA 2WV8A 2NQZA 1S1RA 3WZ0E 4MWAC 5M1TA 2WKGA 3WQPA 3LGEA 4LBUA 3WF2A 4AEEA 3RILA 1A0DA 3H2FA 4JCMA 1UYQA 3AS3A 1H61A 3AWNA 3PM6A 5L6UA 2WWCA 2IPWA 2HSAA 4JKLA 4XKYA 4NHVA 4Y9OA 3SCRA 3IACA 2J7GA 1YLVA 1WE5A 1V4YA 5K9DA 3DHPA 3TYUA 5A6LA 3ZIZA 2NX1A 2XIMA 3H4WA 1E0UA 1XYBA 1XC4A 2FHBA 2HNEA 1B1YA 4IPNB 4KFOA 2VFEA 3SADA 3WFAA 1R3YA 1EX1A 2OZ8A 3AQUA 1JCNA 1C93A 2VNCA 1P1MA 3FKKA 2ZUSA 4QBXA 4Q4RA 2NLYA 2W6RA 5A94A 3EKGA 3MO4A 1KGWA 3ITLA 3SSZA 2PURA 3OHMB 5LIKX 4YTUA 2EPKX 1VBJA 1UP3A 3LCWA 3ONBA 3VNDA 3T07A 1BVWA 2PP1A 2VOTA 4U28A 4DBDA 4IQJA 1GVIA 2E1DA 4B5SA 2Y0FA 4RNFA 3SAZA 2BVTA 2XWDA 3RLVA 1XSJA 1J18A 3SUWA 3RN6A 3UWYA 3EMCA 4QJ1A 3PNUA 4IIFA 1XIFA 4DNMA 3OBAA 1Q6OA 2P5NA 4H6KA 4Q7BA 1UWSA 5CZ0A 4FB7A 2O4QA 5J04A 4S3DA 1IIGA 2AL2A 4RDYA 2O0TA 1BG4A 4RNJA 3UPMA 3KP0A 3KDOA 3FHAA 3AI0A 4I9AA 4F0RA 4UWMA 2ZX7A 4AY7A 5CZTA 2BGNE 1EZ2A 4XZNX 1KRAC 3CH9A 5A6AA 1VCGA 1CXFA 1OFEA 4JTQA 5DBTA 4GQ0A 4XZBA 3L4TA 3LBMA 4K68A 5K9CA 2QPUA 1DJHA 5REQA 3KVLA 3IV3A 3OA3A 4GO8A 2PDHA 3TJLA 4D8LA 1HKKA 4WK9A 4B2DA 3EDJA 3B0PA 5F1UA 5LXEA 2NVDA 3VOHA 3T1GA 3ITVA 4PMJA 1UMYA 1I1WA 2DJLA 3W7KA 5ECVA 2UY4A 4NJIA 4GRSA 2QT3A 3WLTA 3P14A 4ZXOA 3GNRA 1W91A 2Y2WA 3UR8A 3QGAC 3T81A 5EMMA 1N8IA 2DH2A 1RJQA 1XKJA 4FX6M 3RLUA 3O06A 4P61A 3CQ0A 1SJAA 4E38A 4J3XA 1HT6A 2XVKA 5LGZA 3CMJA 4W8BA 1KFCA 3DN5A 1UR1A 3N6QA 3TLLA 3NTYA 1AJ0A 3UJRA 1GQKA 3AIRA 3ZJKA 4TQTA 2A85A 4GHRA 4JFUA 3GHUA 2J7EA 3FJLA 5E0KA 2NWRA 1F74A 2DUXA 5I5RA 1PDZA 2OG9A 4Q8MA 5JH2A 1EBGA 1K03A 1QVBA 1AQ0A 5L9FA 4ERAA 1V0KA 4J7RA 4FR6A 3D46A 1FWIC 4ICCX 2C15A 5CPOA 2XGBA 1GORA 3N2CA 1VEMA 1ZHAA 4AZGA 4N42A 3WLMA 3C52A 3W1NA 1OBAA 1MI3A 3WD1A 3F2CA 1BXCA 2DEPA 5I79A 3NQVA 1E6QM 1LG1A 1PHWA 3KW3A 1C8YA 1HKVA 3WQ4A 1JPIA 1PDYA 3GR8A 4RW5A 3L68A 2HBXA 2ZUVA 1XBVA 5BXRA 3GVRA 1PCWA 4L5ZA 1JI1A 2ADAA 2X05A 4GY1A 1HGYA 4JAWA 2X30A 4AF0B 1OYBA 1LLZA 3V5CA 4XTDA 3VVGA 3QV7A 5I7GA 1US3A 2GYIA 3EBVA 4R7WA 4S3CA 1FXQA 3E12A 1PCKA 1VAHA 4H2HA 2INFA 5HWNA 2YCJA 1JG9A 2XM1A 2OYMA 1R85A 4HT3A 1PO9A 2DW6A 3UNDA 1EUNA 4LUTA 4M1BA 5MF5A 4HNVA 4GOAA 3NL6A 1UIOA 3KBJA 5GNYA 3CB3A 1V77A 4MAZA 1VCFA 3PUDA 5CGQA 3M47A 1W6TA 3HMJG 2OZ3A 3R0KA 3DYPA 4DWSC 3SY1A 1JCJA 3N18A 4LC6A 3H22A 1PE1A 4I8YA 4B92A 1WAWA 2WM0A 2H9AA 4OQVA 1VD6A 3TCSA 5CCZA 3NPVA 1QPQA 2P10A 1PUDA 3P3BA 5C9WA 1P4CA 4AYGA 3VCRA 4M51A 1D7FA 2Q3OA 4LTSA 4O57A 1Y5XA 1TPFA 4LV9A 3UR7A 1H51A 3XIMA 1EQCA 1ICQA 1C8XA 3PWIA 1NELA 1K6AA 2QJIA 1Q3NA 2YW4A 5EYWA 1CXIA 3SQLA 3WKZA 4CU6A 1G4TA 1V7YA 4M7SA 2EG7A 4O52A 4WD0A 1AW5A 1YMYA 2WHMA 3WLLA 4QLJA 2J6VA 5LZLA 3ZT7A 3W0KA 1ZJAA 5FL0A 2BHUA 2QUMA 1WKFA 1GG0A 3A4AA 3V36A 4BWLA 3ZR6A 3RU6A 1E0WA 2J75A 3ATZA 3MV11 4UR8A 4YTSA 3STGA 1E15A 1VFUA 2QCFA 2ZZ4A 4K37A 3QC0A 1JRBA 4C7DA 4PZVA 2B81A 2I5GA 4S3KA 4XK2A 2FHFA 4YVXA 2JK2A 5HR6A 5F2MA 2Y24A 3EWXA 1TR9A 3WUEA 3IJQA 1LQ2A 2Z7GA 3LG3A 1VFTA 3AHXA 2QAFA 1E72M 3CL7A 3KOZA 3TQVA 3QJAA 3H7UA 3WQFA 1UR4A 3LPGA 2R6OA 2REQA 4PMUA 3GUGA 4C6JA 1KQYA 5DANA 4JTSA 1C3FA 3AFBA 2XFRA 3DOPA 3LI0A 2E6DA 1K02A 5LNVA 8XIMA 1CGTA 1TV5A 2QJGA 1E56A 5AVNA 1ZB5A 3EA1A 4AZHA 1EGZA 4M6UA 2CERA 4IP4A 1T6MA 3U5UA 3M0HA 3T2QA 3DKJA 3B0UX 4QCEA 1U2YA 4OGZA 4AWSA 2A1YA 3QGKC 2FTPA 5KZDA 2FVKA 1C8QA 1GJUA 1OGSA 2D0FA 4ZQOA 2XTKA 4OUEA 3K8LA 1CW2A 4Z42C 2FMOA 1R9ZA 4INFA 1CIUA 4NRSA 4WGXA 4ZVJA 4JIEA 2D73A 1RY8A 4KQNA 4GVGA 4QITA 2PDKA 2WK2A 2AGKA 3E5BA 3LHTA 2PD5A 5BROA 1LQ0A 3DFQA 1Q63A 3UGVA 3ICJA 4K2SA 3W7GA 2C0AA 3W24A 5BNKA 2EKGA 1R0MA 4Y9NA 2DQWA 4B90A 3VD9A 3N19B 5C71A 1LL6A 4KCWA 2J25A 2VM8A 3TQ0A 3W1RA 4QJ5B 1W3LA 4UMCA 1LT7A 3CEUA 3UVIA 3MZNA 1I45A 1VCVA 2OQHA 1O4UA 4BR1A 3VDAA 2J8FA 3FAWA 1O7AA 4J40A 1JPMA 1SR9A 5E0FA 1OVDA 3CUZA 3CIWA 2YW3A 4BI7A 3FJNA 3QTPA 2J88A 3O6DA 4IQEA 1EB3A 2FMNA 4WX2A 2PDUA 1GPWA 3QZEA 4M7TA 4OBTA 1EPVA 6ALDA 2DU2A 3G18A 2CETA 3H2EA 4EX4A 2XZ7A 3UZXA 3UXIA 3EB4A 3CPRA 4QLLA 3ZS4A 1VIZA 2RKXA 1QW9A 1W1A1 1EA9C 4XAZA 1GQLA 4JTTA 2V8ZA 2PU0A 1GNXA 3M46A 4DX3A 3IUHA 5TNVA 1JZ7A 3SQMA 4O1BA 4UTMA 4HGXA 2VCBA 4DM2A 2OJPA 2VT0A 1UROA 1EDGA 1YNQA 2OKTA 4BQ3A 4AQLA 4O19A 1W1VA 3PBMA 2HCVA 3I6RA 2OQYA 3MJYA 1F3TA 4GVFA 3ABRA 3PFMA 5DO8A 1FH9A 4PSPA 2PDCA 3NO5A 4O8AA 6A3HA 1EO7A 4DJDA 1OCNA 3LTPA 4GISA 4LF1A 2ACRA 3G24A 3KXQA 2OQLA 3PZQA 5BRPA 1JFHA 4J3WA 2P76A 3VNKA 4X2PA 2A6NA 2Z26A 1S2TA 1A5CA 1WDPA 4UZSA 2G3IA 3M4HA 4OKDA 4RPPA 3VGGA 1XV8A 2QJJA 2XSBA 1QO5A 4XAPA 2V69A 3LSBA 2GSEA 1MZHA 1FDJA 2A3HA 3LY0A 2X7WA 1UZ4A 3SCNA 3A6OA 3WH6A 1OZQA 3LXCA 2PWFA 4NG3A 2ABAA 4MZ8A 4DXVA 5D2TA 1YDOA 4DWSD 4G8TA 4Q4PA 4ZOBA 3RR4A 2W62A 2BVDA 4CQBA 1XG3A 4JFVA 3AROA 4MMWA 1UOZA 5D38A 4N6FA 1JIBA 1N7KA 3FX4A 1VBUA 3G0UA 1XG4A 2A3BA 4XO6A 2EPHA 1EDQA 1SJCA 1K1DA 1OGGA 4E2OA 3JW7A 2X1RA 1M7XA 3TN4A 3CHFA 2TRSA 3BDKA 1FCVA 1J93A 1MZRA 1V6YA 2E0PA 4XAFA 1NDVA 7TAAA 4ML4A 3DGRA 2XVNA 5T91A 1KRCC 4QG6A 1YDYA 3IAPA 3VGFA 3LZ3A 3S1XA 2E68A 3W1TA 1XUUA 3V16A 2QPXA 4HCLA 2F6KA 4QE4A 4HSNA 4JTCA 4M56A 3AHTA 1ITCA 3VM7A 3VKCA 1HP5A 1FWSA 3PZTA 1BVNP 5HPOA 3QQ0A 1E6RA 3G2GA 1VP5A 3MMWA 4I6VA 3UD6A 1B0IA 1D3GA 5G4WA 2IKGA 2NUYA 3GTIA 2WW5A 4C6CA 2V38A 1DWAM 4MB3A 1YDVA 5D04C 3FGCB 1EX5A 4YHGA 5C2CA 3EKLA 2YFNA 3MT1A 3GU1A 3WDJA 4M5PA 3MHUA 3C2EA 3DEQA 3WX7A 2ZC8A 3MUZ1 2O4MA 2CESA 3VZXA 1VB9A 5IRPA 4S23A 2R1KA 1Q6RA 2J24A 4CCCA 1ZZMA 2WC7A 4LS2A 1M01A 3HZ3A 3APGA 3QQWA 2DDXA 3MHGA 2Y7GA 1POKA 5C55A 4OECA 3RNDA 1KKOA 1TPVA 4LEQA 5C5YA 2VRJA 1SQ7A 1JRCA 2XIIA 2WANA 2WJEA 3LENA 3BV7A 4YVVA 3P8IA 1J96A 4P8VA 4O53A 3STCA 1KRBC 2CFFA 4L1WA 4UFHA 1ZTVA 1E1CB 3ZJ8A 4IMCA 1OFDA 4LPCA 4AIUA 2QZRA 3BVJA 1EPXA 4J28A 4XX6A 5CSSA 5DT5A 3RJXA 4Y2WA 1VYSX 4G5DA 4NP7A 4Q8OA 4I90A 4Q4SA 2E4TA 1B90A 1VYRA 3VINA 1XPYA 2QJHA 3M0ZA 3BMXA 3EGJA 2PTXA 2EG6A 5EY5A 1E5NA 2REQB 4M3PA 4PGLA 3IWPA 1E0XA 1ZJBA 2BOGX 3LHZA 4GG9A 4ALDA 2Y4SA 3SR7A 1A3WA 1V08A 3V4BA 4FAMA 3G0XA 4R7JA 4AY1A 1JCYA 2Y63A 1WZKA 3SRHA 5LNRA 3JZEA 5LGXA 4XZHA 3OTRA 1JDDA 3BUVA 2IXUA 2PCEA 1OG6A 2XN0A 3B0YA 3EWZA 1RP9A 1X39A 1O5KA 3VX1A 3N9RA 1TUXA 1BTCA 2GZXA 2YDRA 1V3IA 1WXJA 4PTWA 1VYPX 1QATA 1CB2A 1E51A 1XX1A 3S1GA 3M43A 1TTPA 3BAIA 4UMBA 4DJFD 3USZA 4FK9A 3QEZA 1SZFA 1NQKA 1NWTA 1BF2A 1KB3A 4AZBA 1RZMA 4ZQMA 4FLOA 4HCHA 3HM7A 1HTIA 3NQ8A 2ALRA 3P82A 1OINA 1JNEA 1JZ3A 2AKZA 4B5UA 1G9HA 9RUBA 3AOFA 4GGHA 3W27A 1EJUC 2XJ7A 1OEPA 2VOMA 1OC7A 1PHQA 4FALA 4NY2A 1FDZA 4IXHA 2W92A 3GDKA 1KXHA 4EVZA 4X9SA 1TSIA 3IK2A 2FKPA 1HO1A 3PZIA 3RPTA 1DTNA 5FA5A 5A95A 5KSWA 5D32A 2VD9A 4LUSB 4QHRA 2BGQA 1KFKA 1NTHA 1WKEA 3T0CA 3WK0A 5C9UA 1OGBA 2PU1A 3BW4A 1MEHA 5LYRA 3GTFA 5HNTA 4WDWA 4PMVA 4H7ZA 1ADDA 2C0HA 2V3DA 4CD8A 2GQ3A 4YYFA 4TVCA 1ZJHA 2ATSA 2WLZA 3VIKA 1JULA 4ZO7A 4BWLC 2GVYA 3QXBA 1KD0A 1AD4A 1B3OA 1DYSA 2V5KA 3U4FA 3Q94A 3OVQA 2HQAA 2W79A 1DTUA 1KM3A 4U3AA 5G2IA 5HJYA 4Y9PA 2BP1A 5FACA 4P2VA 4E8DA 1Q65A 4J9JA 2NQJA 2PTWA 3VOJA 2IKIA 3VX0A 3NDZA 1O1ZA 3QTGA 2B31A 1F07A 1GWJA 2D22A 3UBPC 8XIAA 3UCQA 3UEQA 3T2PA 3OJGA 1E6PA 2EPNA 2NSOA 3PTDA 4CNOA 2JALA 3MO7A 4FSAA 4H8HA 1ALDA 2VRKA 4JQ3A 3QY6A 1DWJM 4Q7IA 1DJWA 4ATWA 4GVHA 4GYJA 1ECQA 2QNEA 1B3XA 4PL2A 4REQB 1FWRA 2PLKA 2GJRA 1R2RA 3FFSA 3TC3A 2DSKA 3ZLFA 5ABTA 2CC0A 4O28A 3KCJA 1I9CB 2ONEA 1BXNA 4ORMA 1HKMA 1IQ8A 4MSSA 3RCYA 2Y6ZA 3L12A 4O1FA 5A8QA 3LV6A 1UJPA 3GIQA 3GNPA 3UP8A 5DRCA 1DXFA 5I3JA 1VEOA 4MY1A 3L65A 1KGUA 1UUQA 4HMEA 4LNCA 4ES4A 4GI6A 1HO4A 3M44A 1AVAA 3NFUA 1XRSA 3S6OA 2V6AA 1H7OA 4CNTA 1TMLA 3QRHA 3QLDA 1X6LA 1PB0A 4UQEA 1CXHA 4MLRA 2F7FA 3UWWA 1WZAA 4IPLA 1O5XA 3OIXA 1OM0A 1EJXC 1KQZA 5U7SA 2F6XA 3HG5A 4MYXA 4K8HA 5KZ6A 1CENA 2GL5A 4DUOA 3P2VA 3LTYA 4XTIA 3LMZA 4EPEC 4XB3A 3GH4A 4CQ8A 3AUJA 2I7GA 5AYYA 1KKRA 4N0RA 4EAYA 4C6LA 1RA5A 4AVOA 4B4HA 3R4IA 2ZE0A 1JZ4A 1K6WA 4UTLA 4EPDC 3I68A 2H3DA 2H90A 3E0FA 1W2VA 1VFOA 3TE9A 4O15A 4Z2JA 4NYYA 1S5TA 2ZA2A 5K2ZA 5FEZA 4CCZA 1LRQA 4AZ6A 2NZLA 1WPCA 2GVGA 3LI1A 2Y7DA 1EF2A 3RCMA 1UP2A 3AAMA 3C8FA 5XIMA 3CUHA 1T41A 1W31A 4HMDA 1CGUA 5EMJA 4C6FA 3VGEA 4YTQA 3FAXA 4PUEA 3SCTA 2J4GA 3WMLA 2EJ1A 4LUIA 4U5KA 1SZRA 1UBPC 3VDCA 3EA3A 3MP3A 1A0EA 2DSZA 2HWGA 3MKKA 2RJHA 4QE1A 1Q7MA 1F3XA 1TWIA 3U2CA 2GDVA 4PCSA 2ZXBA 4GE8A 2FVMA 1VC4A 1PXGA 2XSAA 2PEVA 1BFNA 1MW0A 4AW7A 4IPPA 4GY7A 1TMQA 3U57A 3WF1A 2R1NA 2OVLA 2PSNA 3UY7A 4JGDA 3LU2A 4H9MA 1S39A 2TODA 2YA0A 2WQPA 3FJ6A 5CSYA 3GW0A 3W2NA 5A8PA 2DORA 1LP6A 3NZGA 1FBAA 3LV5A 3WFLA 2HVNA 4DLFA 1AW2A 5AYXA 1SVDA 3PB0A 3UYIA 3J7HA 1DOSA 4JTJA 3DFNA 2P3EA 4PCNA 2QXWA 2Z1XA 4L4PA 4YIWA 1N82A 1PBGA 1DVJA 1LUCB 4W87A 4AXNA 1XHGA 3BXWA 2CU0A 1I1XA 4XD5A 3S2NA 4CCDA 3QW3A 4NUWA 2VX5A 3VXGA 1GVRA 4QROA 3DHDA 4WKAA 3P62A 1EC7A 5D2VA 3LBOA 3NG3A 4R53A 4LB3A 1Q4NX 1PVNA 2CZ5A 4UFJA 3WCZA 2GGEA 4KEVA 1XF0A 2DV0A 5C2GA 1KBIA 2CLKA 1HKWA 1GKPA 1TMHA 4XKYB 1QWGA 3CNYA 3OQEA 3MDUA 3EXRA 2WC4A 1JEZA 3P84A 4BZYA 4AD1A 4MIMA 2BOFX 1GQJA 1ZLPA 3SRKA 1M9HA 5A6KA 4ZSUA 1HJSA 2XISA 1PEZA 4LJ3A 2FHCA 4LVBA 4GKTA 3NL3A 1Z41A 1XLHA 5EMYA 4F9DA 4YMZA 2ZUMA 3KBSA 2P3ZA 4QNWA 4ZQRA 4ZTXA 5BU9A 3W7RA 1HP4A 2Z27A 4F0LA 4MADA 1DJXA 3FEMA 2AGTA 3AC0A 1DPMA 1L6WA 4ZZ9A 1LLOA 4US5D 3AMGA 4GUIA 1N55A 4I5XA 3FVMA 4P7QA 4GGBA 3B9AA 1QRQA 3P7YA 1TQJA 1BSLA 3KWXA 2R1MA 1X8CA 7REQA 3MUIA 1EC9A 3ZO9A 4GVIA 4KEZA 4S3GA 2VWTA 3VE9A 5A8OA 3PZOA 4PB5A 2WAGA 3W85A 3GD6A 4UTWC 4JTUA 4Y6GA 3VGHA 3KVMA 3WJZA 4I7UA 2QKFA 5AHIA 3N1AA 5JBDA 2V5LA 2YZRA 2ISWA 1OYCA 2J7HA 2R82A 2VZOA 4MZYA 1MUMA 3RPMA 3ECQA 2JBMA 4FF5A 3BAYA 1YDNA 1GW9A 1WV2A 3ANVA 5M3WA 3GZ3A 2QUNA 5LKYA 4J1OA 1VF8A 4DUWA 2C91A 1H1NA 1D3HA 3N12A 5JU6A 5CPNA 3A13A 1I0DA 4HYVA 4B5TA 3BQ6A 3UCDA 1RJPA 1GVYA 5E6ZA 4NZFA 3M64A 3MSYA 2P88A 3ZSTA 3FK4A 1ISYA 3SCUA 2WBKA 7CGTA 1FWBC 4RL3A 3C0SA 4JIPA 4FS9A 4MNMA 3B8SA 3E49A 4UFKA 3ZMRA 3OYXA 4JTEA 1EUAA 2HBVA 3GVVA 3M41A 4Y9AA 2OWWA 4UTIA 3VOGA 3G8RA 1GJPA 3AHYA 3GC2A 2J6XA 1TJ2A 3GXTA 3HV8A 4IISA 3T6CA 5BZAA 4AU0A 3ZT6A 1TX2A 3AYVA 1XXXA 1W1ZA 1V02E 2W9MA 1CX9A 1I2OA 1W5NA 4J3TA 2DZTA 4WKHA 4O1EA 2TYSA 3M0JA 1JCLA 4Q22A 3A24A 3GH5A 5LSMA 2UY2A 3W6YA 1Q6QA 1K9DA 1GZJA 1ITQA 1DQXA 5CC3A 4FMVA 3C4UA 2NSXA 4E4FA 3KHJA 2D69A 4HD5A 2J7CA 1WKYA 3QKEA 4AD0A 5DRIA 3CT7A 2BVWA 3GNDA 1M41A 3NL2A 5FJTA 3O6AA 1GW1A 2QMJA 3MCMA 4WRHA 3W38A 1I8JA 4ZXLA 2VVNA 3BLEA 4MFEA 3S2LA 2DZWA 2GSHA 1AL7A 3LD5A 1V0MA 4GK8A 4WSHA 2IS7A 3DBNA 4AD3A 2BY0A 1BD0A 3RRAA 1RH9A 3WQ6A 4LVFA 1A53A 4KFPA 5FL1A 5D8ZA 1I0BA 2YL8A 4UMAA 2QUVA 2HJPA 1TA3A 4L9ZA 2PDPA 3VK5A 3RO8A 1X38A 2ACSA 2BY1A 4ZOEA 3ELFA 2VFDA 4X0NA 3GUWA 3M07A 3GX9A 3HJEA 4MF4A 2FVLA 4HTYA 1EJTC 4QSFA 2PDYA 3OZMA 2VEKA 4DJFA 3QOKA 4JKKA 3G8EA 4S3EA 2WMHA 3OIHA 1GVOA 3VIFA 4W85A 1EKOA 5CPLA 1QJWA 4BCEA 1K77A 2E1WA 1RQEA 3T0AA 2XWEA 2X42A 1TE6A 3BOXA 4EK7A 1CGWA 3UJ2A 1L2QA 5I3HA 4ZO8A 4A6GA 2QCEA 4O1DA 3DFPA 2EO7A 2WMKA 4RR4A 1GJWA 3VGBA 3VIOA 2B7QA 4FZIA 4LAOA 4KETA 2QVHA 4LVAA 3CQJA 1CXEA 2QV5A 1FP8A 2A7PA 1DJZA 2NUWA 3R12A 2O7QA 1TFVA 2IPJA 1H7WA 3DHFA 2RFGA 1IZCA 4XKMA 2VC9A 1EP1A 1EH9A 5JH1A 2ZQ0A 1E6NA 2G50A 2PWDA 3BARA 3FXGA 4HPHA 3U2EA 1UR9A 1AZ2A 1E71M 5AFDA 2J62A 5DLCA 3QY7A 4UTHA 1GVQA 2TMDA 5CXPA 5A8GA 6CGTA 3GVGA 1W8GA 1LOLA 4HNLA 3SB0A 4IWWA 4IIEA 3W23A 4LFYA 1W3IA 3TQKA 2ZVRA 1CLKA 3STPA 2PGWA 2YL9A 4MKVA 3WLSA 4WXYA 3F5LA 3KL3A 3NZ1A 3B4UA 3LYEA 3NDYA 3WO8A 3LB0A 4KWWA 1O5RA 4GCXA 2Q6ZA 4F2UA 2ZDRA 3EDFA 7XIMA 3LQLA 1A80A 4C6QA 4HK5A 3W1LA 3R13A 4PE8A 3CC1A 2CBVA 5TF0A 3VOCA 3ABZA 3OLEA 1B9ZA 1TWZA 3V35A 1MSSA 5GJNA 3P81A 1WKDA 3VNMA 5EMLA 3U7VA 2HK1A 1E1CA 3CJPA 3ISIX 1XW8A 2DZUA 3PBVA 2C1IA 3ARSA 1KGXA 4OVXA 1KFLA 5E70A 4JY9A 2WHJA 4REQA 3AYTA 2VCAA 4R7OA 4JDYA 4PUWA 3CK5A 1EP2A 4RDVA 2GFTA 4WGHA 3ME3A 1AMYA 4E6MA 5AOUA 2HMCA 3O0KA 4LV4A 5LIXX 2CLEA 3DKLA 2PS2A 5HK4A 4MNKA 3G1SA 1K3UA 3L4VA 3SGUA 2RAGA 3XISA 4GQQA 3RDKA 2JKPA 3TP4A 2E6AA 3OBEA 3FEQA 4UQDA 3W7EA 2AOSA 3N2TA 4PN2A 1ZP3A 3VNLA 4JTRA 1EJSC 1O95A 5HWJA 2XH7A 3B05A 4C65A 4FF7A 3V0TA 4FHAA 1TA3B 4MOZA 5A6BD 3VIMA 3SCSA 4C1KA 4H9YA 4LU0A 4S2BA 4ATLA 1R3TA 1TQXA 4C5YA 2AKMA 1Q8AA 2XH0A 1AFSA 4JDBA 1JD9A 3M5XA 1QNSA 2ZBTA 4TMCA 3TIMA 1TIMA 1K7XA 3BG5A 1NJJA 4I5UA 1ZS2A 3BLPX 5HOSA 5FF2A 1JZ6A 2D24A 3MCOA 3NZPA 5B80A 3WG6A 3PY2A 1EHNA 1UPMB 4HNNA 3W7QA 3BQ5A 4MPKA 1RVKA 2Q02A 3STEA 2NT1A 2C7FA 3LHYA 3TTSA 2JF6A 1CGXA 4K8EA 4DO7A 4D72A 3NGJA 1A49A 4NI8A 1X1ZA 2I14A 3TR2A 3NYZA 3AO0A 1GTEA 3NUKA 3NQBA 3BAKA 2INEA 1TCDA 1J10A 4Q7NA 1OK4A 5DCBA 3UJSA 1TKKA 3AYRA 2DSVA 3AZRA 1Y7VA 3HPFA 1Q6EA 3GTXA 4IGHA 2JIWA 4NZCA 1UZHA 3QMRA 2JIEA 2QPSA 2ZXDA 3QYQA 2ZUUA 3PUEA 1GPFA 3CIVA 3TA9A 3LPPA 1PKNA 1NSJA 1BG9A 5CBBA 4RZBA 2YCLB 2VEGA 3IJLA 3H2MA 1JXKA 4NXSA 5H8UA 3S5ZA 4MJ2A 3WBAA 3RPDA 1RR2A 2PWGA 3NZQA 3IIXA 3QPEA 1HVXA 1ME7A 3PFRA 3BGGA 3WL0A 3IUIA 4UTTA 2X1SA 3OGVA 2CBUA 1O68A 2B7PA 4X22A 3VMNA 3GG1A 1XBXA 3VC6A 3G1FA 4GI9A 3S42A 4PR4A 1VR6A 3OLIA 4KW2A 1EO5A 3CYVA 2WWDA 1JL8A 1EBHA 3A4WA 5H91A 5D9PA 3C2YA 4GYPA 2ZX5A 2FJUB 3CPUA 2A3AA 3RYSA 1YHTA 3R79A 1JDCA 2D1ZA 1A4LA 3T44A 2V5JA 3MDWA 3VOFA 3TA6A 1W5PA 1G94A 2VD8A 3OLGA 5BRBA 3UA3A 2EKCA 1I6NA 5FJOA 3BOFA 1XH0A 3Q65A 2GGGA 2G5WA 4S2CA 1P1XA 3C0LA 3V7PA 4Q8WA 2YOCA 1KV8A 3LCXA 3VA8A 4OOUA 3MPGA 2PD9A 5FAGA 4H04A 1FCUA 3R58A 4XVDA 4AZ5A 2ZRYA 4WJXA 1TV3A 1HW6A 1T99A 4QG9A 4NX5A 4CU7A 2ACQA 1R38A 1DKWA 2IXVA 2CHRA 4N9DA 3AU2A 4TUFA 3UWUA 4J2MA 2Y8UA 2VC6A 4EACA 4CNSA 1VFLA 4Q8TA 3WD3A 4Z2LA 4AIEA 4NRRA 3TK7A 3TW7A 3QPYA 2V63A 4K8GA 4RW3A 4AX6A 1K9TA 3PR2A 1E6SM 3W7IA 1SZGA 1RAKA 2GVEA 3WNMA 1E43A 2GQAA 4KBXA 1OFQA 2E40A 4GLEA 4K38A 1RALA 3U4AA 1HZYA 3FGCA 3HBLA 4QXIA 2YR1A 3H6OA 1CWYA 4P8UA 3T2OA 1B9BA 5KZMA 1IEVA 2J8TA 2GLKA 1EF3A 3WL1A 2PBGA 3W88A 2WJDA 3GQYA 2ZCGA 3W9ZA 2OGYA 4L6HA 2EXOA 1A5LC 3F4DA 3GO2A 1LG2A 3ZYZA 2UY3A 5J5DA 3DFYA 3QSRA 5DEZA 1LM1A 3PK7A 4A05A 3BG3A 1GOXA 2P8BA 3N2MA 5I24A 3PP7A 1LUCA 4H8VA 4DZIA 4A3QA 1ME9A 3RHGA 1IE7C 4CCEA 1A3HA 1U5JA 4OHQA 3ZLHA 2CHNA 4ML9A 4W4QA 1BYCA 3BJTA 1KWKA 2G96A 3TJIA 3E5PA 4FA3A 1KCZA 5LA1A 1V3LA 3A4JA 3WQGA 2E5CA 1BGGA 4A21A 2YA1A 1OD0A 1XLBA 4OZOA 1XLDA 1V51A 4FP1A 2EJAA 2C14A 1ONRA 3BW3A 5LIYX 5D2YA 3IPWA 5D30A 4GD0A 3Q4DA 3WQ5A 3TMQA 2WNNA 6ENLA 3CEPA 3WQWA 2C1GA 3A3XA 1EWEA 2VFIA 3I7RA 4G1KA 4JTFA 5IBXA 1XLJA 3FSTA 3H70A 4ZR8A 4I3GA 4MB5A 3C2OA 2PCQA 3STFA 2VC5A 1YEYA 1X8FA 1HL8A 4MZ1A 5AVHA 1Z7AA 5EMKA 1BYAA 3B40A 4LUTB 1JZ5A 2DT3A 4M0XA 4B5VA 3L2MA 3N04A 1RV8A 3K1GA 1O66A 4UNLA 4LCQA 3BZGA 3S4TA 1V8EA 1MUWA 3P93A 5E0CA 4LY4A 4PUUA 1IV8A 2VP8A 1FWCC 3NPUA 3QR1A 3DI0A 3E0WA 5K9XA 3VMPA 4LB4A 1EEPA 4QX4A 3ARPA 1EOKA 1YXDA 3GDMA 1A5MC 3TYZA 2GQ8A 4MNLA 3NIYA 3SO7A 5AHFA 3BSMA 2BY3A 2VUNA 4JX6A 1XLKA 4PB4A 1QW7A 4H1ZA 2H9AB 3SIZA 3ABSA 2GJXB 4IX0A 3W81A 3EWYA 3ZWTA 3QKZA 3W72A 1C9DA 3EB2A 1AQHA 1UA7A 2J7DA 3ITOA 2EPOA 1XKYA 1QU4A 3MTWA 1RK5A 3G1HA 3ZVHA 2X41A 3SJ3A 3HV9A 1LDCA 3URBA 5AKQA 4Z2KA 1E9YB 2HVOA 1LWJA 3NM3A 2X09A 1LT8A 3NGFA 1PJ9A 3LUTA 4DRSA 1BLIA 3BCDA 4IQDA 1GOMA 2IW0A 5FJRA 3FJ4A 3S6TA 1JXJA 2PWEA 4JTGA 5HMSA 4B5XA 3K30A 1LF1A 3Q45A 3IVSA 4HP5A 1S2AA 4PUKA 2DH3A 1KLZA 2PPGA 3CASA 4YCOA 3LA4A 5C9ZA 1XDJA 1IXPA 1Q45A 2OSYA 1Z48A 4M6PA 2HV5A 1ICPA 5D8WA 2GPTA 4UQCA 2PUZA 5J5RA 3R25A 2VO5A 1L2UA 1KM2A 1JVNA 1TR1A 2C19A 4AD5A 3BLKA 4IPJA 1GQIA 1FUYA 3E1F1 5F2GA 5GQBA 4PCTA 5HQEA 2CWNA 4QGCA 1PPIA 4WDTA 5LNWA 3SUVA 1AL8A 3E2SA 2DT2A 4DQWA 2Z2AA 3CMFA 5I77A 1UZ1A 1QI0A 3TWAA 2NXIA 3W1PA 3ZM8A 5CG7A 3QHMA 5G4EA 3BJSA 2ZDSA 1OX4B 1H63A 1HUVA 1AZ1A 2ZXAA 3LK6A 1K8ZA 1KM1A 3A9BA 1G4EA 1BWVA 3EEGA 3EXTA 1UASA 3T0TA 4NSBA 5E93A 1RK6A 3WD4A 2PRHA 1DQUA 1NAL1 1VHNA 1TPC1 4Z1AA 1W5MA 1HKIA 1ECEA 4LXFA 2WMIA 4ZB5A 1LBFA 3DAQA 1P48A 6PTDA 3ZLGA 4DLMA 1FWGC 2D2HA 1JD7A 3R43A 5CGTA 2OYKA 4QJ4B 3WEOA 3S3GA 3H24A 5HQMA 5A2AA 1J6OA 2WCAA 2QV4A 4V2XA 5CAHA 5BW6A 3CQHA 4BS0A 2VHLA 2JEPA 2BY2A 3QV6A 2ZADA 3AXXA 3VM5A 5REQB 4GINA 1P5BA 2OU4A 1TV8A 1IWAA 3COTA 1JFXA 1NP0A 4F2TA 3CWHA 4CLMA 4F66A 5EBUA 3QOMA 3W76A 1WQ5A 4IFKB 5KEZA 1J0ZA 3QQ1A 3A64A 3N11A 2VZTA 1JUEA 3DZ1A 1EYEA 1FFQA 2PDBA 2VJXA 3GNNA 4IJCA 1X98A 5GNXA 5FAJA 3KL5A 1XFCA 1XDMA 3GH7A 3OVGA 3QYSA 1YX1A 5CPSA 9XIMA 3KBWA 3K1DA 1H62A 3SFKA 1SO5A 3A3HA 2QDHA 4TV5A 1KA9F 1GQNA 5DELA 3GTHA 4BEUA 3AISA 3Q67A 2PGEA 3PG8A 1QI4A 4A3YA 3V5FA 3MY9A 2ODOA 3CV7A 3A22A 1BYBA 3CL8A 3AXMA 4KPLA 1E40A 3WSUA 4G2DA 2W91A 1J8VA 2Y7EA 3WLNA 3REQB 4JEJA 4AUBA 2QCNA 4PUDA 1U5VA 3GXDA 2DPEA 2UZ9A 1C91A 1VJZA 1ODUA 2NX3A 4KEUA 2YPIA 4GYFA 3ZZ1A 1IHIA 2LLEA 3KS6A 1UJQA 3MMDA 4H9VA 3AS2A 1C8VA 4TVDA 3KAOA 4HZ6A 2HS6A 3TFXA 3W86A 5MHBA 3ARUA 3PF3A 4NJKA 5HXMA 4H4IA 1KBBA 4B9ZA 1XQLA 4ACZA 4O0ZA 1XICA 1V3MA 2CHOA 2OO6A 5I3FA 2HTMA 4W5ZA 3NJ3A 3VKAA 2CYGA 3CYJA 5HWMA 3VC5A 3S5NA 1RJRA 4RZ6A 5BMWA 1E9IA 2CLHA 4GC4A 2WSYA 4AF0A 2E7FA 1WBJA 5CC7A 4DF1A 4AD4A 5C0QA 1LYXA 2VFHA 4GZEA 1HJXA 3TYDA 4Q4MA 3VUSA 3DERA 4B4FA 3CU2A 1T40A 3KP1A 5CC5A 2IMRA 2RDWA 5ABHA 4JKMA 3FN9A 2WVVB 2Z1WA 4LVDA 1X1OA 1M7PA 2Q8XA 3WLHA 1Z69A 4C1NB 1SFTA 1XFBA 4NJHA 1KW1A 4DM1A 3MI6A 4V28A 1I2PA 4DVOA 3HGRA 5D9NA 2OEKA 6XIMA 3F03K 4IQLA 1W9BM 3QZ6A 2YXXA 4ZE5A 1R7OA 4UTKA 3BO9A 5AC7A 2JE8A 1QOPA 3D5HA 1R3RA 3SIMA 4C6BA 4GNVA 4B3KA 4WHBA 2AQOA 3L2LA 3G6LA 2D3NA 4GZ7A 3WD2A 5I2UA 3G1AA 3WENA 2A6LA 4LYPA 3TROA 1AMKA 3UXDA 1GOIA 3MMTA 3QW4B 3MU7A 1YIXA 1TWWA 3M1ZA 3VGDA 3BL3A 1L8PA 4K7VA 4JN8A 1XGDA 4UZUA 1IT8A 2WO5A 3MP4A 1XSIA 4XSLA 5G2WA 1MXDA 2QCDA 4TVUA 5AB3A 3WJWA 1WZLA 3D3FA 4IM4A 1FY6A 4LBRA 1XYLA 3WH5A 1VLIA 5G1MA 3VYLA 4ZBCA 5IHSA 1N2VA 5EU9A 3LNPA 4PBFA 4IMEA 2VVSA 1JAKA 4AAJA 1MO0A 2FYMA 4G9PA 1AJZA 1J0IA 3CV6A 4DNHA 1U1JA 3I10A 3VILA 3FIGA 1KRMA 1NOUA 1J0HA 4HTBA 5I03A 1JPHA 2BB0A 1VBRA 1T8QA 3APTA 1MXSA 1E0VA 2PDIA 4POCA 1ONXA 4QS6A 4C5ZA 4JTAA 1VBGA 1SFSA 3IJ9A 3CAKA 1XH1A 3GHTA 2QJNA 3BURA 4ZE4A 4ZCWA 1PZ0A 2JGYA 1RPXA 2PRLA 1N8WA 3ABXA 2Z6JA 5AECA 2VXNA 1CZ1A 2XG9A 2POTA 4XVEA 2QJMA 3PWAA 2D2OA 2HZGA 3HQ1A 2W4XA 2YKKA 3TAKA 3WNKA 4NILA 4GJ1A 4PCFA 2V5BA 1QNRA 1YNPA 2WSPA 2IQDA 5CPTA 1QHOA 3TYCA 3UWZA 1NF7A 4FNTA 5BMXA 2GSJA 2I56A 1ZBCA 1TB3A 4M81A 5G5IA 4FXSA 1ITUA 3V5OA 2E8YA 3WNOA 3C2FA 5EFDA 1W1TA 4X2RA 3TWBA 4JBRA 1DP0A 3T40A 1DWFM 2NV9A 1LRTA 3QN3A 1NFPA 1T0OA 1S5MA 3T7VA 4NX0A 3KOWA 3UWQA 4NT0A 4BJHA 3WF4A 4RCXA 1YKWA 4HPXA 1U83A 3M6YA 1YBQA 2Z7KA 2VX6A 5EL1A 3L0NA 4C6IA 3E2VA 2GDQA 1UKTA 2WSRA 4TX6A 4QIUA 1S2WA 1FFRA 4KRUA 2WJFA 3GFZA 3VCCA 1R8LA 4YPJA 4QCFA 3WBXA 4HB7A 4WY0F 4B3LA 4Q8UA 3TN3A 3BPWA 4GCAA 1US2A 3FOKA 5AYZA 1GCYA 2ATMA 2J27A 3CL6A 3P5YA 1KLYA 4AEOA 3NEVA 4QEEA 4NJJA 1OF6A 4KCVA 1KXVA 2OOGA 4RV3A 5IDIA 5ABFB 4W89A 4Q8PA 4H8UA 1EGVA 1QK0A 3R8HA 4J35A 3HURA 3WLIA 1G0CA 2QQ6A 1B3YA 4MB1A 2O7SA 3IVUA 1RXOB 4LYQA 3RX4A 3WFZA 4KRZA 5IOBA 2BVYA 2X0HA 5FESA 1N8FA 3WQOA 1F4AA 1ISVA 3UGRA 4NNAA 3M0MA 3ABOA 3NQFA 1F8IA 1HJWA 3ARRA 1VQTA 4EPBC 1FDYA 4DYEA 2XSXA 4K6AA 3VIHA 3S1UA 4EXBA 5HMFA 4DEFA 5TQLA 1OT2A 2CLMA 2QUUA 3MUXA 1XLLA 1H7XA 3PPGA 3B8VA 5F4SA 4PTMA 1OB0A 2GUYA 2E28A 3V75A 4JIHA 3WBYA 2HRWA 3I3BA 2VZVA 5AHLA 1DWIM 4A3RA 3GHRA 3PB2A 3Q2DA 1YXYA 3FLUA 2EQDA 3KTCA 3TTOA 1I2NA 2UV8G 1KCLA 3TEVA 4W86A 4YLWA 4CU8A 5GPRA 1WBHA 1GOWA 1VJSA 1J11A 3E6EA 2OR2A 2I57A 3NO1A 4RV8A 2A3CA 4XZWA 1QNVA 4DO6A 1TRDA 3K46A 5LIWX 3E38A 1OQFA 2XZ9A 4GYKA 1ZBKA 1KV5A 1L9WA 5D4YA 3UU0A 1LWHA 3ZVIA 1H11A 4EE9A 1PTAA 1QNQA 3AJXA 4Q8QA 4K3ZA 3CO4A 1E4LA 3GSMA 2F8QA 1TV7A 4AD2A 3KZSA 4RKAA 1T8XA 3UYCA 3T8QA 2CZVA 1JAEA 4O10A 2WPBA 3WBWA 3MYOA 3QR0A 3VNYA 1UH2A 2Y5JA 3IARA 3QY8A 3NOEA 2NXGA 1AK5A 1PL9A 5AC8A 5A69A 5FF7A 1RLDA 1UOKA 3PZ9A 3M5VA 1FCQA 1JCXA 2YB1A 3UETA 2QHAA 4IOTA 1CTNA 5CBIA 1KCKA 1XSKA 2ZZ7A 3EWWA 3ITCA 1B54A 4XQ6A 5CJ5A 1CI1A 5T9BG 2WLYA 4IH3A 4KIRA 3SCWA 1UD4A 4M1RA 4ROPA 2X1TA 2X16A 5C8BB 3N73A 5FF3A 3BLFA 4D71A 2H3BA 1UD8A 4GXMA 4AHQA 2A3LA 4UTFA 1YE4A 3NNTA 4NU7A 4G56A 2AL2B 1KM5A 4JFSA 4BY3A 3BCFA 2OLAA 3TJ4A 1RD6A 3BLOA 3SEPA 4IMAA 3WLJA 1Q13A 4UNIA 1KFJA 1MVYA 4AB4A 2HEJA 4ZL1A 1LORA 1GYNA 4G7FA 2G3FA 1V0LA 3CTLA 5T9CE 2PRMA 1PTDA 3GNOA 1QPNA 1YTEA 5TD4A 1PKYA 4P8XA 2PDMA 3T9PA 3TH6A 1J01A 2E3ZA 4AC1X 2ABBA 1UWAA 1TPB1 3UR2A 4JY8A 2A7RA 3WK1A 1QUMA 4O8RA 3CZEA 4AHPA 2Z29A 1KO0A 2CCRA 4M6VA 1W5OA 1O60A 4F9JA 3DG3A 1G01A 1IF2A 1XI3A 3IIOA 3CZKA 1YTDA 4A22A 1UG6A 5CH9A 2QGHA 2EHHA 1XYCA 2WYSA 4L1XA 4GPNA 2X0SA 4QDPA 3Q37A 3VMOA 3SUSA 4LH8A 3WNLA 4HK6A 1JQVA 3SURA 3K8MA 2VR4A 5F2IA 2VC7A 1OIMA 4E8GA 3EAUA 1HIZA 4D6FA 1NWSA 1PZ3A 2DT1A 4GUFA 3BGJA 4GQRA 2FPYA 3UWVA 3OZYA 3UJEA 2V2DA 1E70M 4GH3A 2V81A 4HHPA 1NEYA 3PUOA 3GYCA 2YXOA 3RF9A 3HIJA 3E9AA 2NV2A 4JFTA 5DFAA 4AIBA 4QG8A 4H6QA 5BOFA 3AIWA 2VWSA 3P74A 4EOUA 1A5KC 2XHYA 2BNJA 4H9UA 4ICMA 1PAMA 1ADOA 4QEHA 4TTGA 2Q8LA 5AC5A 3D47A 4Y96A 1G69A 2YJQA 1E9ZB 2PTDA 4HVXA 4MM1A 3I7QA 1M04A 3EPNA 1KBJA 5CPQA 5DMYA 4L64A 4G1NA 1QAPA 2PGFA 3BAJA 3WMBA 1DE5A 7A3HA 3TSMA 1PZ1A 5A6SA 3I4KA 3POCA 4QR6A 3W74A 2XVLA 3AALA 1DXIA 4UR7A 2VGBA 3RU8X 1IYXA 4X3ZA 3R94A 3TTYA 3DYOA 3DESA 3DFTA 4TMBA 2J74A 3BG9A 4JN6A 2R24A 4DYKA 3N4AA 3SY5A 1UR2A 4MDPA 1AA1B 5A6MA 3SRFA 1UH4A 3OBKA 4LSBA 4HBKA 3PSWA 2PI6A 2CZFA 5CC6A 3EWDA 3GNXA 1QT1A 3IJIA 3IAQA 1AJ2A 2F61A 2HPIA 4R85A 4X61A 5HMDA 3WDHA 1RQHA 4R5EA 1TJRA 4ZO6A 5I02A 3ITTA 5JIPA 3CT2A 3G3MA 5CG0A 1C92A 2R1PA 1MW1A 4BK9A 4DUVA 5DMMA 5JMUA 3LRLA 1QNPA 3KWSA 1DJGA 1Z42A 3L23A 1XDLA 1UCWA 3NCOA 1A5BA 1U22A 1UA3A 1BKSA 4M8UA 4JTKA 4A8LA 2W3ZA 4AWTA 4U3CA 1TVLA 3FNDA 4O11A 3VD5A 1ZCOA 3CZJA 2J7BA 3WDQA 1WAUA 1QTWA 3CIXA 2ZX9A 3EPMA 2VQTA 4GJIA 2BMBA 3T05A 2G37A 4HPJA 3WH7A 3OLDA 5IBXC 1SM9A 4D6DA 4ZO9A 2ESCA 3MA8A 1CCWB 3O6CA 1D2KA 3MVIA 3CHDA 2H8XA 1EEXA 1Y65A 1DWHM 3MBDA 2WCSA 6TAAA 1X97A 2MANA 4GX8A 1O94A 1RCOB 3OOQA 1XIDA 2I1OA 5PTDA 2JGQA 2DJXA 1PSCA 3SDOA 3U2OA 1DIDA 2Z6IA 1I75A 1TELA 3ZWSA 2P0IA 4FX8A 3ITYA 4MGGA 1XYAA 4NJGA 1EIXA 4HN8A 1JI2A 1R2TA 3E02A 1QI2A 4PRWA 4D1JA 3HN3A 1X7FA 1FWAC 1TTQA 2BOEX 4HYRA 5CZSA 1JYXA 4P7NA 3FW6A 4YYCA 5ABGA 1H60A 3WBEA 4DBWA 3NDOA 4E3TA 4XBSA 1HNYA 3MP5A 3BJFA 4HMNA 1H2JA 1UWIA 1H4PA 2ZWZA 1UKQA 3JUGA 4YTTA 3ARXA 4ZMGA 1CDGA 4ZENA 4X9YA 3V0UA 4CN4A 3LCFA 5A6TC 4S3FA 1WO2A 3IUDA 3QMSA 1W3JA 3TLQA 4Q3MA 5HA7A 3S2JA 3TKFA 3FS2A 1G67A 5E6YA 1W54A 3O07A 1ISWA 3WJSA 2RDTA 4DZHA 2E25A 3GBDA 1W37A 1P0KA 1O12A 3LBCA 3W2MA 3SRDA 1JUKA 4C60A 3OA5A 3NAVA 4QSHA 5JQ9A 3WF0A 3M0KA 1E5JA 1GOOA 1LRNA 1EFZA 4D6HA 2XDFA 3TNBA 3AMKA 3ARTA 4DF2A 4DHGA 5BOOA 4GI8A 1DJIA 2PAJA 1D8WA 4IMDA 3R5EA 4W88A 3N6HA 3AJ7A 3DG6A 4ASTA 3L4XA 2E6FA 3NWRA 1F5ZA 2AMGA 5EKYA 2OWCA 2BLEA 3CH0A 3HJZA 4IL2A 4WIWA 1ZBWA 3L4WA 1QW8A 1VPYA 3JR2A 4M82A 3N3MA 4ROQA 1QWKA 1QHPA 5CQ1A 1GVEA 4A8NA 3W82A 3UQNA 1DEDA 1XLFA 1XQKA 3BTNA 2UBPC 4DWSB 1E4NA 1T7LA 3KRUA 1AG1O 5BYWA 2OTDA 3HB9A 1MRQA 3AUOA 4HIBA 5DXYA 5E9AA 3DC0A 1CBGA 1DJQA 1WXZA 4YNGA 4HA4A 4ZQNA 3U2ZA 1PIGA 5GVJA 3RX2A 1Q2RA 3QV9A 4EXQA 1ZL1A 2IKJA 3VIIA 2O9OA 3CGTA 2YIHA 2WMJA 4PMZA 1XCXA 4MB4A 4JQ4A 1U1HA 1OFOA 2L5HA 4DI9A 1EGMA 3N2XA 4U31A 3RUBL 4HZ7A 4Z1DA 3VD3A 2VEPA 3GDTA 1CB7B 3ES7A 1R9YA 3UZZA 1W1B1 4XD6A 2XVGA 4AX7A 2YL5A 4IJRA 1REQA 2GK1A 4Y7EA 1WDRA 2DT0A 1IXOA 1M7JA 4I7WA 1C90A 4XBKA 1IEXA 4CNNA 4DAFA 2E77A 4ZSTA 4ILSA 3AS0A 1KWGA 3B9OA 3L67A 3HGOA 4WY0B 1JGIA 4NNCA 4GXWA 5D03A 1JCTA 4AY8A 1JUBA 3B04A 4ZGYA 1WDWA 4LYKA 1UZDA 3THQA 3ZJ6A 3EOEA 3W7HA 2D0GA 1ZQ5A 4UTWA 4F4RA 1MRAA 2V3GA 4N7QA 2DZSA 7PTDA 5MKGB 3GZAA 4JNMA 3HOJA 4GUJA 4JX5A 2XN2A 4G7EB 4F2BA 4F0MA 4BQ5A 1J0YA 5FJIA 3LTSA 4DBEA 1J9YA 2V2CA 4PTXA 4U4MA 1KTBA 1IT7A 1HKJA 1R47A 3FDGA 4WQ6A 2V0TA 3SY8A 1CECA 4MJ4A 2A21A 4ERIA 4H6EA 2FZDA 2V5CA 4OUIA 3W1XA 2ZYFA 3G3DA 3E2RA 1TV4A 2XM2A 4PUMA 3B0VC 4NAFA 1F61A 4HOWA 2ZRUA 3UPBA 1W56A 3TAOA 2VEMA 2BXVA 4RXGA 4J3SA 4OJYA 1H0GA 4IG2B 1H50A 4KWVA 3TOPA 4MFDA 3PJTA 4GUGA 3IIZA 1VIWA 2GGHA 2FFCA 5TAOA 2ISVA 5IHRA 5C9RA 3N15A 1E6ZA 1MFVA 2W61A 1BXBA 4Q4QA 1JYWA 3IEBA 3KRBA 3B97A 2FDSA 4PTDA 4QTGA 4XIMA 1YPXA 3WLKX 4UFIA 4MWAE 4KWSA 2UWFA 4C6PA 2J9ZA 3II1A 2FH8A 3QZAA 1ISZA 4TO8A 1H3GA 2FB2A 3KOYA 4MJMA 1E0TA 4TX9A 4FX7A 4FXRA 2VR2A 3BLLA 2XFWA 1TX0A 1LROA 1L8NA 3B4YA 4E2BA 4UXDA 4V1XA 3U5YA 2MNRA 1BTMA 4RK8A 1LCOA 4WLCA 2OOFA 3HQNA 1E73M 4IIDA 3PSVA 4ZEPA 3CLWA 3HPSA 5HJLA 1NDYA 3MI3A 1WDDA 5FD0A 4L7ZA 4K1GA 5HNUA 4Q8VA 5FEXA 3JU2A 3N4FA 1UWTA 1XIGA 4JYDA 1BF6A 4KWOA 4JCLA 1TYGA 3PJXA 2OGJA 3DHUA 5LHEA 3M0YA 5DXXA 2XN1A 1CT5A 2JFEX 5D9MA 4DJFC 3MUAA 3EX6A 2OT0A 2WBGA 5BXPA 4S38A 2GVLA 5J8LA 2W27A 1J79A 2Y1HA 4DYJA 5HUOA 4C91A 1GG1A 4CEUC 3TN5A 1UC4A 1DQWA 2GQ9A 4H7CA 1EXBA 2CPUA 4EXAA 3UZWA 4I5RA 4G6CA 2RDXA 4X0VA 3M7SA 4PA8A 1QI3A 2FIQA 4UTJA 3IK4A 5M17A 1VRDA 1OYAA 4BI5A 5DMLA 8A3HA 3KHDA 2QLYA 2B4GA 3CAWA 2Z0IA 3L5AA 3SSJA 3UG4A 3G6MA 2BHZA 1S46A 1Z8AA 3AXIA 4UCGA 3IANA 3BLDA 3GXNA 3W2UA 3TONA 3KVKA 3KUMA 3MUCA 4O18A 4HMCA 1DIKA 1WOAA 2HXTA 2NLIA 3QHNA 1EDTA 3A5VA 2BS9A 2FFIA 4HA0A 4JPGA 1G4PA 2D0HA 1ZFJA 4JQ1A 4D6IA 2NX9A 4GBUA 1ZSXA 5DBUA 2ZUNA 4RDZA 1D7KA 1PS9A 3CHVA 3RMEA 1FQ0A 2P1FA 1YPFA 2ZE3A 1GOKA 1U1UA 4NZ3A 2JKEA 5G1YA 2DZVA 4YWIA 3K13A 1GHSA 5AHEA 3RFAA 4LVGA 3PJWA 1NQ6A 4ZOCA 5D02A 4PCPA 4R88A 4IT1A 1YRRA 1HFBA 4JD4A 4ADTA 1SMAA 4LYRA 2CLFA 2FTYA 5FIPA 3KEHA 2OLHA 5DY3A 2WZTA 3GKFA 4NZ5A 3GXPA 2OPJA 4RNHA 3N29A 1FHVA 4JZ5A 2F6UA 2Z4GA 3S5OA 5HUPA 1NDZA 4NAEB 2YBTA 1KTCA 2PP3A 2J79A 1LQAA 4XZLX 3B8TA 3O16A 4IZGA 2WMGA 3LHWA 1PWLA 2DSWA 3NQCA 3RGTA 2GOUA 3GXFA 3SCVA 3TU9A 5JBEA 2X8RA 2CW6A 1GZ1A 5JVLA 4GO9A 4CQDA 4HSOA 3NA8A 1H5VA 2PB1A 1BWKA 1SFLA 3GC4A 4O0KA 3PVFA 5CPMA 1ITXA 2HDJA 1QHZA 2FH6A 1XRTA 3TX9A 5AHMA 4OV9A 1XWYA 4A2RA 3HGSA 2O56A 4AWEA 3AS1A 4Y8EA 3A9IA 4PB3A 3TC7A 1EQPA 2F2KA 2PE4A 4ATDA 3S83A 1BKHA 4I9TA 6REQA 3IRDA 4DPPA 4E2VA 1I2QA 3N13A 4H6RA 6REQB 1YTKA 3JS3A 4GIEA 3C6CA 3W26A 3KBVA 5A2CA 4H2CA 3N34A 1ZUAX 1UKOA 3T4CA 1TCMA 8CGTA 1VBHA 3PZMA 2YSWA 1ZBVA 5RUBA 3CZGA 3T8LA 4WJEA 1XL9A 3PC0A 3ZT5A 4CD6A 4XIAA 5AY7A 2NV1A 3K4DA 4JS3A 4C6NA 3EX2A 1ONEA 4E4PA 5C7HA 4DBSA 5M2FX 3WJXA 1EJVC 1GVSA 4ORIA 2ASHA 3W29A 4GBDA 4NI3A 3I4EA 1P0BA 3PULA 2C8NA 4O14A 4UTTC 5I00A 1HN1A 3CXOA 4LRTA 4UC5A 2F84A 4JQAA 3GRIA 1LTDA 4BQ4A 2DY3A 2GGIA 1D9EA 4AVFA 4AVNA 4NZ4A 5SWUA 1C7SA 1JQXA 3MVTA 4YTRA 1VRXA 1Z3NA 2DZBA 4AFYA 5TBOA 4XISA 3WLOA 5DN1A 3AHZA 3H4XA 3R0DA 1SGJA 4I8DA 2R91A 3B8DA 3OEXA 3DECA 3UXLA 3KL0A 3GK0A 4DJDD 1XYFA 2GWNA 1CGYA 4XAYA 2Y5SA 5BWFA 3EX1A 1RD5A 4IICA 5F4XA 4RE0A 1NWRA 2WKJA 1KM0A 1S5VA 1F6PA 2G97A 3FHQA 3WNNA 1MEWA 1H7RA 3THAA 1PIFA 4K1WA 3RCNA 4O1CA 5BCAA 2PDFA 4QRNA 4A3HA 3GDBA 3K8KA 3SECA 4C6DA 3FSUA 3O63A 4NYUA 3DH7A 1RHCA 1OF8A 1OFBA 3KCLA 4HQVA 1W2PA 1CLVA 3HGJA 3EKZA 3LSCA 3Q58A 4IJBA 4HSHA 2GVJA 3IIPA 4Y8FA 1KC7A 3W1AA 4IGMA 1HVQA 1GKQA 1SYTA 3PZUA 2CLLA 5A5WA 1JZ8A 3M0LA 3GFYA 1QFEA 1CLXA 3WY1A 4B3ZA 4EWND 3WH9A 1KNWA 4S3AA 3F1QA 1RCXB 2V30A 1V3JA 1UD3A 3CAQA 3NYDA 4IL0A 1XLMA 1TPH1 4GIAA 5LA0A 3LRKA 4AZIA 1EL3A 3QHOA 7TIMA 2QIWA 3R8RA 3FV9A 3FA5A 3L4YA 3ZXWA 1FVPA 1TO3A 3LQGA 4HOZA 1IWPA 3S1VA 2ZVIA 2XGIA 1O5QA 3C5QA 3NL5A 5A8MA 4HU3A 1SFJA 3OW1A 2XIQA 3F2DA 2CZDA 5D2XA 1RVGA 3PTKA 1ZAHA 2D23A 1IZJA 1DHPA 1OABA 1AW1A 4CD7A 2PDQA 1C9WA 4P5UA 1OSEA 4FNSA 1MFUA 2PF8A 2ZUTA 1NWUA 2OZTA 2ZWYA 3BSHA 2QCGA 3ANYA 3EOOA 3LCHA 3KLLA 3ARWA 1FOBA 4RE2A 3VKJA 2Q71A 2J13A 1R9XA 2C1HA 1OWQA 4D8AA 1JF5A 1XGEA 2YDSA 4PMNA 4X63A 5E09A 2EG8A 1HQTA 3CS2A 4GZJA 1GYMA 3LXAA 3EZ4A 4R34A 3HTWA 4WDXA 4KS0A 1QR7A 4XSMA 1XBYA 5BOEA 4L1GA 2DW7A 3WUBA 4HA1A 3PAJA 4DB7A 3N9SA 3CV2A 1SSDA 4DY1A 2X2GA 4LCRA 2ZXQA 3W37A 1C29A 4P7OA 2EF9A 3NPXA 1KXTA 4B9YA 1QPKA 4HHMA 1J4EA 3VCNA 4EP8C 3FYPA 2R1LA 2FZBA 4EF9A 1P0DA 3HFTA 4FIQA 3W07A 3KOFA 3W1MA 3ABQA 5D09A 3RG6A 4BHYA 2OSXA 3IGXA 1KFBA 3GAKA 1ME8A 3UZYA 4RE3A 3NVDA 2C6QA 1V93A 3A47A 3GFXA 3PBGA 2HROA 3W1QA 1QI5A 3WMCA 3NQMA 1H49A 1F2JA 3VDBA 1ICSA 3GIPA 3V0SA 4H7VA 4AC7C 3VDHA 3H21A 2OB3A 2GK1B 4FNRA 4RLIA 3S1WA 1A0CA 3C2VA 3MANA 3AMCA 2ZZ1A 3AXKA 1X6UA 4JHZA 2R8WA 2P53A 2YLAA 1MW2A 5E1QA 3W70A 3WQEA 2G95A 2Z25A 3QR3A 5BXTA 4ZB0A 4RNIA 4NXKA 3ZSSA 4HZMA 5FKYA 2XPKA 3CZLA 4CEXC 2NQ9A 1EP3A 3GYEA 3T42A 4AZCB 2X40A 1E3ZA 1MQQA 1EYWA 2A79A 4I6KA 3WYZA 3OZOA 2R94A 3CUJA 1X6NA 3VDGA 4W93A 3N4EA 1J12A 4O4VA 2A3EA 1YQ2A 3LLXA 2Q3RA 3P0WA 3W7PA 4NZ1A 2EGZA 3XINA 3D3AA 1O1HA 4C1NA 1FHUA 4LWWA 2WVVA 3CV1A 2OX4A 3UJFA 4QNEA 3AMLA 3UA4A 1VGAA 1P0NA 3E96A 3LGGA 4IX2A 3EXSA 2QCCA 3B0XA 3MYPA 2XU2A 4N9CA 4RUBA 3NQDA 5M5DA 1EIBA 2BX7A 1S38A 1ZNNA 1Q6GA 4LEFA 1K8CA 1AUSL 2CITA 1K70A 4RZ5A 3DUGA 5I3GA 2OWXA 4GXPA 1K4HA 1V03A 1ZGDA 3BANA 3DC8A 3LGDA 3MB9A 3C0JA 2OLSA 4MLJA 4DXXA 1EJ7L 1Z9AA 7ODCA 1GEQA 5KZEA 2X1IA 2Z00A 4BFAA 1V3KA 4PMXA 2WZMA 3W2KA 1OK6A 2I9UA 4RE4A 3VUPA 4WSKA 5E9XA 3NQEA 1UUMA 2CBJA 1FWEC 1B5TA 1FTXA 3MI2A 1KBLA 3EEZA 3OODA 4LNYA 5HMEA 4QAIA 3G1YA 4HCDA 4MY9A 4OU1A 4NL1A 3WIJA 1TWSA 1CEOA 3UW6A 1HXJA 1JZ2A 3THUA 3RK8A 3DFSA 1VPQA 1TJ1A 4GYPC 1SUXA 3L21A 4LAKA 4C90A 1AD1A 4JL2A 2IQ0A 5HINA 4W84A 3EX4A 1K8YA 4R33A 3I7SA 1H1YA 3EMZA 4XUYA 4AZCA 4TV6A 3WDRA 1MXGA 4GUHA 2AMXA 3B3DA 2VQUA 1PIIA 2PA6A 3E2QA 4F8XA 4OT7A 1Q6FA 1MUCA 3KDNA 3NVTA 2Y8VA 3IGSA 3K4AA 3OQ8A 1GK8A 1YPIA 1V6XA 2QCHA 3W28A 3P0XA 1L6SA 1BHGA 4P7RA 2OEMA 2VENA 3GM8A 3IVTA 1UWUA 3HMCA 4LANA 1YBQB 1XBZA 4MNJA 3GXIA 1EHAA 2ZICA 5DX7A 1TVPA 5GJMA 3TJXA 2OEJA 1AH4A 1B3WA 5D9OA 3CQIA 3NXLA 3IIVA 1K7FA 2VFFA 5IXEA 1FA2A 1FCBA 5K7JA 2HISA 1QMLA 2W66A 3W02A 2CNCA 3VKKA 5KINA 4PFMA 2VGIA 2BODX 1XIMA 4UOQA 1W3TA 3WLQA 2WVTA 1BRLA 2D2JA 3BLIA 5KITA 4O13A 3ALGA 1WZMA 3V18A 3KM8A 1DBTA 3EPOA 8TIMA 4AZ7A 3MC5A 4NVTA 5BWAA 3RM9A 3C86A 4MY8A 3AIQA 5CLTA 1TJ0A 2WHLA 3O6YX 3PPHA 3URAA 3FKRA 3GR7A 3ZR4A 3FA3A 3F5JA 4ZA0A 4Z2IA 1FH8A 4S3JA 1B4KA 1WDSA 3AZSA 5I09A 4IIGA 3NR0A 3RO6A 1OX4A 1U30A 2YCIX 3F4VA 3UESA 2XFYA 4R9XA 2ZX8A 4PYSA 3UG5A 1QBBA 2FQIA 5B7ZA 1Y0EA 1OD8A 4GACA 4QM1A 2BSLA 1NOWA 1FWTA 1OFRA 4MKNA 1SO6A 4AYSA 2G3JA 5AYBA 3UXKA 3VABA 3UF9A 4IIBA 1XIBA 3MSGA 4MWAB 4L6OA 2VZUA 3G1XA 3VIJA 2PDLA 3S2CA 1R5YA 2KZHA 4CNUA 3SFWA 1EA0A 1LOSA 2WNQA 1V6WA 2NWSA 4C6OA 3OG2A 3U48A 3A3WA 1UIPA 4MHBA 3B9DA 4JNYA 1VH7A 1NY1A 2WSQA 4LF2A 1MQPA 5A6JA 5D33A 4E2DA 4PUJA 5F2LA 4JHMA 4QS5A 2ZRXA 3QV8A 2W63A 2Y89A 1JR1A 4WF7A 1F9CA 3W1UA 2VFGA 2VUYA 2RGLA 3W7OA 4PEEA 3TTEA 4UIOA 4HOXA 1SPQA 2C3ZA 3TNOA 1XJBA 4WOZA 3C2RA 3A23A 1FWNA 3P8JA 3S6DA 4E8CA 2WVSA 4PC8A 3R11A 1E6XM 1JPKA 4HK7A 1VS1A 3MKVA 1I2RA 1R30A 4D9PA 1OJXA 3FDKA 2PWVA 3VIGA 3W71A 3CM4A 3MZ2A 3W53A 1DXEA 4DZ5A 1OX5A 4Z0JA 4ZFMA 1A4MA 3BGAA 2ZRVA 4ZQPA 4O0QA 3WNPA 4CN1A 4KRTA 3FA4A 4UR9A 1VENA 1UUOA 1ONWA 6XIAA 5FEWA 1JF6A 3KRZA 3MSDA 3NSNA 1XS2A 3NURA 3IJ8A 1PKMA 3QBUA 1KCXA 4DWSA 3OP2A 4QDWA 2Z2UA 1RUSA 1W9UA 4FNUA 5IFTA 1PX3A 4WVXA 3B03A 1J2BA 2QF7A 2KX9A 1A3XA 3GDLA 2WNZA 3VZZA 5E5CA 2A4AA 2FDMA 3W7JA 1DL3A 1XLGA 1Q7QA 4OBSA 3WJYA 1ISXA 3TDFA 3IGUA 4Q6XA 2OMAA 5CLWA 2FZ9A 2VGGA 2WC3A 2C16A 2J9YA 2NQLA 5JIWA 3URNA 2GGJA 4GMEA 2E6YA 3TFCA 3GC5A 2UY5A 3NZRA 5AHNA 3EWCA 2P50A 4UQBA 4ERGA 3OHIA 2XH4A 1NDWA 4YVPA 4Q32A 1UP0A 3KLKA 4DF0A 3R10A 4HNCA 3C0QA 1RA0A 5FOOA 1BEUA 5A3HA 1V0NA 1V7AA 3NXFA 1YE6A 4JR5A 1M3UA 4HJFA 3N17A 3H2OA 3DI1A 9CGTA 3LERA 3TVAA 1A5NC 1IGWA 3HG4A 3P5ZA 1BQCA 1CPUA 5A2BA 2XIOA 3EB3A 2HPMA 2PDNA 4HHLA 3NSMA 2VDIA 5T26A 2WVUA 3DBPA 3QFEA 3G1VA 1JDEA 3OYZA 4ZQCA 3NOYA 1PWMA 1XYZA 2QS8A 4MJZA 1NFBA 1L0PA 3AZTA 2WZIA 1Z6KA 4MYAA 1AH0A 1LZOA 3TV8A 1TTIA 3WD0A 5CAKA 4JTDA 5CZKA 3N6JA 2E5BA 2QUTA 3MHFA 1WB0A 3TQPA 3LHVA 3BH4A 1J0JA 1P7TA 3C61A 2PF0A 5DMNA 1T96A 2FB3A 3L7RA 4A2SA 5I3DA 4K39A 2HNHA 4FOJA 2AAAA 3TYBA 1Z44A 1KBKA 3TZNA 1L6FA 1R3SA 4GI4A 4ZTYA 5HATA 5BU6A 4QLKA 1UR3M 3G22A 4L65A 3DYMA 1CXKA 2QCMA 1A47A 4CNPA 3GG0A 4C6KA 4LALA 3QGVA 3H2NA 3ITXA 3E74A 2QDDA 3F7JA 3PJUA 3L5LA 4AIOA 1RBOB 3HG2A 1GKRA 3C3NA 2CXGA 3LNMA 2E9BA 4M19A 6TIMA 1Q6LA 1DHKA 1GZGA 3EWBX 2WPGA 4H9TA 4US5A 1SR0A 3HPZA 4DAIA 2IPGA 4LQ1A 5G1TA 1IWBA 1TZZA 3PNZA 1CNVA 1S3HA 2XH2A 2ZTJA 2Y8KA 3UVAA 2XYLA 1DWGM 4JFWA 1W8SA 1ZAJA 2YYTA 3KTSA 3M16A 2DFAA 4L4MA 4Y90A 2OELA 3UXAA 4TTUA 3LMYA 4XZ9A 1Q6DA 2ISSA 1W9PA 1NF0A 2H6RA 3H2CA 2EBNA 3T4WA 2Y61A 3EA2A 1AQMA 4DWDA 3SCOA 1UD2A 4HU8A 1ML1A 3NQAA 3KCOA 3S5SA 4KERA 1Q5MA 2BXZA 2CLPA 4RPQA 3LX9A 4LS0A 1UB3A 4R9OA 4PTNA 4XZIA 4JIIX 3SZ8A 1KM4A 4WKFA 4EKJA 3PTMA 4K7YA 4OE7A 1ZAIA 4BF7A 5I0DA 3VZYA 5DY2A 1REQB 1NIUA 3RJYA 3AIBA 3L0GA 1XYMA 2HK0A 3DFOA 4D2JA 3GG7A 4A3UA 4IFOA 1IR2A 3WQ8A 1HX0A 4PMYA 4C7GA 2VZSA 4FLQA 3MCNA 1TZ9A 4YS1A 2E8ZA 4HNUA 1YXCA 1R2SA 3LCIA 4OWGA 2GJLA 3IRSA 4GNKB 1JCMP 3E0VA 3HQOA 3PANA 4Z17A 3H8AA 2FPTA 3H26A 4O54A 2DUZA 2PZ0A 5I3IA 1BYDA 2KAUC 4NIRA 4XBJA 3G5EA 3UWEA 3M9YA 5BXSA 5IM51 5CKSA 1W3HA 2NQ5A 4BF5A 4EAMA 3LM3A 3VU2A 1MDRA 2DGAA 3VKBA 3QSTA 1W3KA 3DFHA 4GABA 4GFSA 1DIEA 1VFSA 4DJEC 3NM1A 5EA9A 2XVPA 3V3WA 3L2IA 3WK2A 1E4MM 2WZEA 2FZMA 5HJXA 1XCFA 1E55A 1FP9A 3UZ5A 1Q7ZA 4N4QA 2Y7FA 1E3XA 2FZ8A 3H23A 2PFHA 3CUFA 4DO5A 4Q6JA 8RUCA 4KMQA 2YX0A 1EC8A 3VAVA 3LLFA 4CGTA 1XLEA 4FNPA 3TOYA 2YCKX 2QCLA 2NW0A 4S39A 3B9NA 2ZZ5A 1MQRA 4FPSA 3U8GA 4L4LA 3B9EA 3S9IA 3O05A 3B06A 1K4GA 4IGNA 2V3EA 1JDFA 3EDKA 2H8ZA 5K3VA 3N9KA 2QEZA 1TZ7A 5AZ1A 2PDWA 3CMGA 4NNBA 1Q66A 3W22A 4FXFA 1ENUA 1SW3A 3DGBA 4OV4A 3QLLA 2BXYA 5ECUA 4LW7A 2CKSA 5C9XA 3GS6A 2IUZA 4XD4A 2G4FA 4TR9A 3VD7A 2IKHA 1V3HA 2ZIDA 2YFOA 1EZWA 3T08A 3S9YA 1M53A 4FI4A 5DT7A 2OCZA 4XG1A 4S1FA 4C7FA 1E1EA 1R87A 4OOZA 2O9TA 1F6YA 2VMFA 3U7BA 2B0MA 4QQUA 4BA0A 1SW7A 1NH6A 4E5TA 2ISFA 3CUXA 3ARVA 4F48A 4H8NA 2F2HA 4Z2HA 1QOQA 3ARZA 1OFPA 2BWGA 3MKCA 1P7TB 2GUBA 4GWEA 2ZA1A 3U9IA 1PKLA 2WMIB 3NO3A 1TPWA 4HKPA 4A35A 4JQ2A 1VFMA 4J3VA 5KMYA 3BMWA 1IXNA 3L9CA 4ZB2A 4URIA 1K8XA 4YCPA 2ZFAA 1M7OA 1VHCA 2GOKA 4Q33A 1KFEA 4TX8A 4U10A 5D2WA 4JHOA 2J66A 4CVUA 3C8NA 3P60A 4PBGA 3IJDA 4ZODA 5C54A 5FSDC 5AN7A 2QIIA 4B2DD 4IP5A 4EANA 4QQ3A 1SZNA 3UR5A 1JPDX 1K9FA 3M0VA 4WY0A 1RP8A 4PMQA 1J5SA 1NOFA 4IMFA 3P80A 4N4PA 4PFHA 1XUZA 3AHVA 1LJYA 1TREA 2FZNA 4CUCA 2PDXA 1M5WA 2VI0A 5C7VA 3ONCA 3CWOX 4B91A 3GW3A 1WOBA 2V9DA 3BK0A 3K4WA 1F8MA 3GB6A 4PRRA 5H1WA 4OBRA 3QMTA 4AH7A 2VX4A 3IJ7A 5AC6A