3W1NA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-iodoorotate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-iodoorotate
rcsb
source organism Trypanosoma cruzi
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1nA01
4WY0F 4EIVA 2A2IA 1C29A 4O16A 5BMXA 4JS3A 3N9SA 4JTFA 3NA8A 2WSRA 4N9CA 2C3ZA 1W3TA 4LRSA 1EA0A 5LSMA 3VE7A 3BGGA 5D2VA 3G0UA 3GLCA 4FXSA 1RR2A 4Q4KA 4Y90A 2OCZA 3MI2A 3A24A 4HN4A 3C8FA 1DJQA 1R2TA 4IMEA 3C4UA 2X1TA 5ABTA 1LORA 4W9TA 3CHVA 3Q2DA 4JYFA 4JYEA 8TIMA 3STFA 3P5ZA 3TIMA 3G8EA 1LTDA 4CQ8A 2EPHA 3NL6A 2B4GA 4ZQRA 4UNLA 1VYPX 3A21A 3CPRA 3HIJA 4ADUA 1UJPA 2B7OA 1P5BA 4LC6A 2GQAA 5BRBA 2V5BA 4XTIA 2H8XA 3IGXA 3G0XA 2X2GA 3EEGA 4O11A 4K38A 3QPZA 4PTNA 1O94A 4UTWA 4K8EA 3L5AA 5DXXA 3A5FA 5FEWA 5AN7A 3S1WA 1JCNA 4LVAA 5KZDA 3W7QA 4NX0A 1VHCA 1CX9A 1YTDA 3UXAA 4CCCA 5AC7A 1WDWA 3PBUA 3F4WA 1VYRA 4ZQOA 3HGOA 2VC6A 3W70A 1S5VA 4U4MA 4UTHA 3BLEA 2Y85A 4JICA 1PCKA 1GWJA 4FXRA 4FX7A 3NM1A 3NQGA 4PL2A 3SZ8A 1E51A 2FJKA 3MHFA 3TUUA 4TR9A 3NQ6A 3P61A 3QMRA 2HSAA 3T7VA 4DF1A 3SGZA 1LM1A 1YYAA 1TMHA 5E0KA 3M1ZA 5D30A 1TRDA 2X1UA 1I2RA 4JDBA 3GAYA 5AHNA 1DJNA 5EBUA 1AW1A 2QCNA 2E5DA 5C5YA 3G3MA 1UBSA 3O6YX 1B4KA 1JRBA 2QCHA 3NQVA 2NLIA 3PBVA 3B0PA 5E1QA 1QCWA 3C56A 1JUBA 1SUXA 6TIMA 3W87A 4UMAA 3WJSA 3LXCA 2CZFA 4HNNA 4DF2A 1JUKA 1ZY9A 4UFLA 4BFAA 3W85A 4GUJA 4AF0A 1XXXA 2TSYA 1CW2A 3P62A 1D3GA 1W3IA 4NX5A 3TK7A 4MLJA 3W1XA 1H63A 1J2WA 4N9DA 1WA3A 4GBUA 1OVDA 4DO4A 4QISA 2E6AA 3RF9A 1GT8A 3NQAA 3PR2A 1PCWA 2Y70A 5D05A 4FNRA 4XTDA 5EY5A 3GR8A 2QR6A 4UR7A 2A7PA 4ICNA 1SZNA 3IVSA 4O52A 5AC8A 2XN0A 3F03K 1XI3A 2A6NA 2QCCA 3FKKA 3L66A 1WV2A 2ABBA 5G1TA 2FB3A 3PVFA 5CZSA 4UTTA 5TBOA 2I1OA 4PL1A 2WNQA 2J9ZA 3OVRA 4JTTA 1BWLA 4AEOA 1ICPA 1L6YA 5CPNA 1P0NA 2Y62A 3DENA 4OBTA 3GB6A 3QQ0A 4XUGA 2JKPA 3UD6A 2H8ZA 3EWYA 3A22A 1SO3A 3RK8A 4O53A 2RKXA 4YXGA 3NNTA 3T4CA 1VS1A 2E5BA 1GJPA 1XKYA 1MZHA 3DFNA 4O8RA 3ATZA 1I4NA 1KM3A 5EKYA 1WBJA 3W7HA 4NU7A 4LVDA 4Y96A 1UUOA 3OVQA 3LI0A 5HUPA 1XL9A 4LT9A 1ONRA 2V2HA 2W6RA 3N34A 2BTMA 3W23A 1VR6A 4ALDA 3BLFA 3DXIA 2PCQA 3T55A 4N02A 1N55A 2Y7DA 2PURA 1TPUA 3W7GA 3FA5A 4O1BA 3GYEA 3USBA 3DI1A 1PV8A 1VHNA 3S1UA 3EXSA 1AW2A 1X7FA 4I9AA 2Z0IA 1QWGA 2QCDB 3KHJA 3EWXA 2BXVA 4JIQA 4NJKA 1FWSA 1OHLA 3W1TA 3W6YA 2VFIA 3W83A 1JCLA 3LCFA 4JTKA 4QAIA 3EX4A 4JTIA 1VPXA 2ZFAA 3W1RA 4MJMA 3HG5A 2B7NA 1F76A 4Z0SA 3C52A 4MKNA 4G1KA 3HGRA 2C1HA 1VYSX 1XUUA 4ORIA 4JTGA 4O18A 5I3KA 3ABRA 5F2IA 5HINA 2F7FA 1FDJA 2DZXA 1Q6QA 3PUDA 4FNQA 3G22A 2NV1A 1KBJA 3LRLA 2DZSA 5I3HA 5BNKA 3LERA 1SR9A 4YL2A 2NZLA 3LTPA 5DCEA 3TW6A 3R12A 1OYCA 4E38A 3B4UA 5AHMA 1TYGA 4NXSA 1O5KA 1QPRA 3JS3A 3GKFA 4JN6A 4Y9AA 3S5YA 1RZMA 2ZZ7A 2CLKA 4JTJA 5K4ZA 3FIGA 3P81A 4GUGA 4PC8A 5D02A 3NEVA 4M19A 3W7OA 4MZYA 3W86A 4B5NA 3HPXA 5CGQA 1H7PA 4ZQNA 4OQVA 2QUUA 3K30A 5U7SA 3TQVA 3NGJA 4EOUA 3W7PA 3BG3A 4RXFA 4XBSA 3TSDA 1KM0A 3SJ3A 4GUHA 2Y61A 1KFLA 1ZALA 1A5SA 4TMCA 3LCGA 3L0NA 2WO5A 2A0NA 2G97A 1W37A 2DP3A 1SW0A 5CZJA 1TREA 3A5VA 2PE4A 2JGYA 3UZJA 3O06A 4IWWA 1YTEA 3NL3A 3MMTA 4UMCA 2ZRVA 2DZPA 3TV8A 2R14A 1XDLA 3WFAA 3LLDA 4DF0A 4PFMA 4OU1A 2AAMA 2NX1A 1XBYA 3CEPA 3UPBA 5IM51 2GJLA 2V8ZA 3ELFA 3LXBA 1XDMA 4UIOA 4AMAA 4WXYA 3TA6A 4FB7A 1ME9A 3O16A 4IQLA 4N6EA 4OHQA 5FF2A 3QF0A 1QPNA 1TV8A 3TW7A 4UUIA 3L9CA 4RKAA 1L6WA 4JTLA 1TTPA 4UFIA 1WOAA 3GIYA 1HO4A 1EX5A 3O63A 1DQXA 1A5BA 2P1FA 2TPSA 3MI6A 1Z44A 3RU6A 3OBKA 2QUVA 3ZR4A 1IXPA 3P5YA 4DBEA 1X1OA 4QJ1A 5FEXA 3GZ3A 4PCFA 5DY3A 4O15A 1OK4A 3IGUA 3L0KA 2ISWA 3CIXA 3EX3A 2CZEA 1JULA 4J9JA 3UWWA 5HNRA 2VFGA 1YXDA 4UTJA 1TJPA 1R2SA 2ZZ6A 2JBMA 1O5XA 3W2UA 1HUVA 4OWGA 5FI8A 4UFHA 2ZQ0A 2ZTKA 3RLVA 2HS6A 3W1LA 3ZS4A 5DELA 3RFAA 3U6WA 1JCYA 3BO9A 3W2JA 4IX0A 5KZMA 3FS2A 3C2FA 2QCDA 4NNAA 3QSRA 3DHFA 1S5WA 4UTWC 5HR6A 1JUEA 4BI7A 2FTPA 2NV2A 3W7KA 2GUUA 3BV4A 5LNSA 1FWNA 1W5NA 3ABQA 3FLUA 3KVMA 2V2CA 1SSDA 2Y6ZA 3L67A 4CQAA 3V75A 5C6MA 1LYXA 2J24A 4PEKA 5T26A 4AF0B 1N7KA 1F6PA 4X22A 3TAOA 5EA9A 5TIMA 5DCDA 3NL5A 1P0KA 5GVJA 1OF6A 1JCJA 4HHPA 4PH6A 1DL3A 1RQEA 2HTMA 1LDCA 2IQTA 3JR2A 4K36A 5DXYA 3P74A 3EWWA 5L9FA 4CNPA 1N8FA 3N2XA 3KVLA 3LHVA 4E2BA 1IXQA 3G8RA 2CLFA 4KFNA 4TU1A 5EYWA 2YSWA 2GVJA 4DO6A 1H7OA 3G1DA 1KM4A 2E6FA 1QPQA 4AHPA 5I3IA 3HBLA 4FF7A 3MBFA 1LROA 4R33A 1EP1A 1VZWA 4N9EA 1GTEA 1XBVA 1AG1O 1C9DA 1UB3A 2RHGA 3NPUA 4UFMA 3U2OA 1EP3A 1QNVA 5D37A 3GAKA 2G95A 2CFFA 3BK0A 1LCOA 3WJWA 1ZFJA 4AWSA 3QMSA 5KTLA 4LY8A 3TJXA 4LC8A 1SSGA 3L21A 3BPWA 1OFQA 3LRMA 3UYCA 2QCFA 3FYPA 4LUJA 1QO5A 1Q6LA 2Y89A 1ZENA 1FUYA 5HR7A 1OX4A 4RCXA 5HWJA 5K4XA 4YWIA 1G4PA 4AWUA 2XN2A 5DBUA 3W1MA 2CZ5A 3UWQA 5AHLA 5LGZA 4UTTC 4HSNA 3TCEA 4PA8A 3LV5A 3A9IA 1RQHA 3S0CA 3W72A 2EAWA 4WQ6A 2FFCA 3NO5A 3PUOA 3G3DA 3IIXA 1PHQA 1WX0A 3ZFHA 4WZHA 3NQ7A 3QFEA 1LRNA 4QM1A 2DJLA 1VLWA 4RJEA 1H50A 3QJAA 5I3JA 2BSLA 1FCVA 2B7PA 3OEXA 3THQA 5LNUA 1KA9F 4DQWA 2C19A 2R8WA 1KFEA 1DVJA 4L4MA 2A7NA 4LS2A 5LNRA 3AO0A 4MVAA 3S5OA 3ZWTA 4WOQA 3W71A 1FCUA 3W1AA 4OV4A 5F2MA 1ZAJA 4Y6GA 1B57A 4CCEA 5I3GA 3PG9A 2R94A 5D2WA 4O54A 3IIZA 2GVLA 3PC0A 4LW7A 4A21A 5IBXC 4RZ6A 3P82A 2V81A 1LRQA 4HSOA 5CPLA 5F2GA 1PL9A 5CKSA 1GTHA 1C8VA 3WJYA 4MOZA 3TFXA 1BTMA 1NF0A 2FDSA 5EMUA 1SZEA 4C1LA 4HPJA 2ZRWA 3BARA 1HFBA 1JJKA 5LNVA 4GRSA 1BWKA 2YYTA 1LRTA 5EL1A 5C2XA 2CLHA 2VFHA 2J27A 2V30A 3M16A 4NUWA 3DKLA 2VEKA 3CT7A 3C61A 4O1CA 2NX9A 3WK3A 1L6SA 2QDGA 4P2VA 3B0UX 4NJIA 1HTIA 1SFLA 2ZA2A 3ABOA 3HB9A 3TXVA 3VE9A 1T8XA 4ZQCA 1KM1A 3W2NA 4CLMA 1QFEA 2C15A 2VKZG 3QW3A 4KWWA 3M5YA 3NDOA 1Z42A 3D0CA 3S42A 3LI1A 2ZYFA 2W79A 1W5OA 1A5CA 2YFNA 1NSJA 3LV6A 4Z1BA 1M5WA 3W7NA 1KBIA 2J6XA 4IPIA 1FXPA 4M6QA 1HO1A 3W7JA 1ME8A 1TQXA 1FCBA 3SR7A 4H3DA 1BKSA 5AYZA 3NPXA 3LCHA 4OV9A 3I68A 1S5TA 4HIBA 2VEPA 4U28A 3NPWA 2TRSA 4NJJA 1SO6A 4JD4A 1TIMA 3GDRA 4CNNA 3RMJA 1A50A 3L0GA 3O6CA 4JR5A 3HG4A 4UTIA 1V7YA 2FIQA 3NVTA 2A85A 1DQWA 1UUMA 3TU9A 3ZWSA 1EPXA 1FQ0A 1H51A 1GPWA 3LGEA 3UPWA 1W31A 3T44A 1IF2A 1W54A 5D04C 2Q8LA 4AB4A 1KFBA 4MFEA 1TPVA 4UTMA 3LBCA 1ZAIA 1SU5A 4GNJA 1OX6A 3UY7A 2ALDA 1AW5A 1VGAA 3TC6A 3C3NA 1MXSA 3U8GA 1G7VA 1K8YA 3DFTA 2RDUA 1FWTA 3W2KA 3EB2A 3AJXA 3IVTA 5G2HA 3UWYA 2BZNA 2WOQA 2ZTJA 1EUNA 1H7NA 1SQ7A 3STGA 1SZFA 1DV7A 3QEZA 1EIXA 5AHEA 5CPOA 3YPIA 4MYXA 1TPC1 2EHHA 2C14A 2DZUA 2FPVA 1KTCA 1I8JA 2NWSA 2QAFA 3I7QA 1TTJA 2PC4A 4AHOA 1Z48A 1H60A 3OIXA 2J88A 4YLWA 1B4EA 5HJLA 4ORMA 1SPQA 5D09A 4KFOA 3KX6A 3A23A 7TIMA 3NQ8A 1Q6RA 2E1DA 3E96A 4ZVJA 5L6UA 2FPTA 2NXIA 1O60A 5KINA 4K7YA 3CWNA 1GEQA 1DORA 3PSVA 1Q45A 2QAPA 4MY9A 1K8ZA 4MZ8A 1TPDA 2QEZA 2GQ8A 3CQ0A 4JTHA 1Q3NA 5F1UA 2Y7EA 2YW4A 2ISVA 4HNUA 3W2LA 4FO4A 4Z1AA 1JQVA 3RLUA 4A22A 1SW7A 3QC3A 3L2IA 4KWVA 3S1VA 4FNTA 3NL2A 4HNVA 1OF8A 1GVSA 1TCDA 4EWND 3NQCA 4Z1DA 2OMAA 2Y63A 3HMJG 1TTQA 4IGHA 4M5PA 3TNOA 4S2BA 3DI0A 3UXDA 1YDVA 3EWZA 5FF0A 2WV8A 2ZRUA 2QCEA 3FJ6A 1B3OA 1YLVA 4O1DA 1HG3A 3GDLA 2TMDA 5CZ0A 2E5CA 4MY1A 1R46A 3NAVA 4JEQA 4MFDA 2CLEA 5D33A 4JX6A 4D2JA 1F73A 1OX5A 2VENA 1VJIA 1VH7A 4O28A 4S2CA 2J9XA 4K6AA 4BI5A 1OFBA 3S5NA 3W74A 3W7IA 3L5MA 4KKXA 4R53A 3HGSA 4YCOA 1IXOA 4A2RA 2YX0A 3NG3A 4JY8A 2QUTA 4N2YA 3W07A 1MSSA 4RZ4A 2WJZA 5FEZA 3QYQA 2W0UA 4NXKA 3SIZA 5SWUA 2QDHA 3STCA 1G4TA 4LVBA 1TTIA 2XFWA 1QO2A 5F4XA 3R5EA 3LCLA 3WK1A 4DXVA 3W1QA 1H1ZA 1F7BA 3G18A 1W5MA 1AMKA 1I45A 1OX4B 4M7TA 2A5HA 1ZNNA 2EF9A 5G2WA 2GQ9A 3LHYA 2CLOA 3FYOA 3O15A 1NFBA 4DPPA 3QRHA 3KOFA 4JNMA 5AC6A 1LLZA 3GK0A 5J5DA 2NXHA 4MLRA 1WXJA 2CWNA 3N73A 1TSIA 1ZJIA 4QNEA 1F6KA 1AK5A 4LWWA 3OHIA 4BWLA 5K9CA 1ICQA 4LVGA 4NQ1A 3HQ1A 2E77A 1K02A 1XCFA 2V0TA 3S1XA 2E6DA 4TIMA 4A3UA 2NUYA 4E0CA 4BK9A 4XKYA 2TYSA 3VI2A 3T40A 1AL8A 3H55A 1UCWA 2ZZ4A 3MHUA 2WPBA 3SY5A 4R7JA 3NXFA 1BEUA 1KTNA 4TX9A 4O17A 1FBAA 2G96A 3JRKA 3TDFA 3GNDA 2R91A 3PWAA 1TV7A 4UCGA 2CW6A 5KITA 1I2OA 1I2PA 3B04A 3INPA 1G6CA 3W7LA 1G7UA 1OG0A 1RQBA 4AHQA 3TROA 3TJLA 1UASA 3VCRA 2ABAA 3O8AA 1T0OA 3DHDA 1DHPA 1TPEA 2H3BA 4FIRA 5A8GA 3W9ZA 4NT0A 4OT7A 1NEYA 3QH2A 3EX1A 1G69A 5LHEA 1DBTA 4NNBA 3E49A 4O12A 5F2LA 3P7YA 4TMBA 2FQIA 3C2OA 2NWRA 4DEFA 1KV8A 4WY0A 1JQXA 3BW4A 2ZRYA 5FEPA 1K7EA 4LNYA 3PB2A 5LZLA 3UNDA 1P4CA 1AL7A 5D03A 4LV9A 3TMLA 4HNTA 3M7WA 1W8SA 2OX1A 3GDKA 2V82A 2ZRXA 3KVKA 2ZZ1A 2C0AA 3PY2A 2O7SA 1P1XA 2VEIA 1KFJA 1OFRA 3LXAA 4N4QA 5D2XA 5DN1A 4FIQA 3MI3A 3C0JA 1LP6A 4UFJA 3NPVA 3WJXA 4CQ9A 2C18A 1OFPA 3NQ2A 4JDYA 2P10A 4N9BA 3E02A 3OG3A 5G4EA 4K7VA 2VOMA 1W5PA 2H90A 3MP5A 1RPXA 4LU0A 2UV8G 5BOOA 5CG7A 3DAQA 3LRKA 2WSYA 4N6FA 3PG8A 3IV3A 3MW7A 3P67A 3LM7A 3OA3A 2ATMA 3TAKA 3QQ1A 3C6CA 5AYXA 4DBDA 3F1QA 4KFPA 4WJEA 3SSJA 4RX0A 3W2MA 3QSTA 2NUWA 4O1AA 1U5JA 3KVJA 4IUOA 4ADTA 2PRHA 1ICSA 1FWWA 4ZL1A 3BG5A 3CC1A 3NQFA 5AFDA 1FCQA 2O7QA 1JCMP 2E68A 2EKCA 2C13A 1FX6A 4FX8A 4JGDA 1T96A 4I7WA 1TV5A 2QKFA 4O0ZA 3R13A 4R34A 4IMFA 1R47A 3PM6A 4UR8A 3BG9A 3B06A 2I9EA 3BVJA 1JRCA 2ZBTA 3NQEA 5DCBA 4S1FA 1TJRA 2OT1A 1WAUA 5G5IA 5LHFA 3GXPA 4K8HA 2ZA3A 4HPXA 3RNDA 1KLYA 3M47A 3S6DA 5K7JA 4LUIA 3MHGA 4OE7A 1M6JA 1F74A 4ONVA 3UZ5A 4DO5A 1GVQA 1K8XA 5A5WA 1KLZA 2BX7A 4MIMA 5AOUA 3R8RA 1EEPA 2B7QA 4JX4A 2WQPA 4WUIA 1VC4A 2X1RA 1H7WA 4HKPA 3DH7A 1LBFA 3M9YA 5K9XA 1TO3A 1KM6A 4XZ9A 3N14A 3LDVA 4X9SA 5TQLA 3CEUA 3QMTA 3HF3A 5G2IA 2YYUA 3HGJA 1D3HA 1K7FA 3TXZA 2C6QA 3FFSA 1QOQA 2AGKA 1QAPA 3C2EA 3EKZA 2WKJA 2EGZA 2Z1BA 3TH6A 4JTSA 4QQ3A 2ZZ5A 5AYYA 4AH7A 1QDSA 3UWVA 4OGZA 3MYPA 4O10A 3UQNA 3LHZA 4IX2A 1XC4A 3DBPA 1WYIA 4MZ1A 2DU2A 4M6PA 4PODA 4NJHA 3P8JA 1X1ZA 4FNUA 4MUZA 2H6RA 1PIIA 5EPDA 1V5XA 1TPH1 2Z6JA 2NUXA 1TPB1 3LHTA 3CLMA 4Q33A 2GOUA 2VFEA 2FPYA 2KZHA 2QCMA 1YADA 5AHFA 1ADOA 1H1YA 5K3VA 1H5YA 3F4NA 1KFCA 5CPMA 1WBHA 4LV4A 3BLIA 2Y7GA 1QOPA 4WXZA 3KRZA 3W75A 3PAJA 4LS1A 3C2RA 1YXCA 1OJXA 2ZCGA 3W1PA 4ML9A 1W5QA 3WJZA 4O50A 3PSWA 3LB0A 1DKWA 2ZDRA 3PUEA 3KRUA 1ML1A 4UXDA 3MP3A 1X8FA 4O4VA 1XFBA 3G1FA 3HPSA 2VXNA 3W7CA 1G4EA 4TO8A 5CZTA 3TMQA 5HMSA 5BMWA 2P0OA 1D9EA 4M6VA 3G1YA 4H4IA 3M0ZA 4QNWA 1IIHA 4GUIA 4RV8A 1PHWA 3M5VA 1RD5A 3M44A 4QITA 2JKAA 5MHBA 2RDTA 3G1AA 1QMLA 3O07A 1ZCOA 3G1VA 4ZZ9A 1TRIA 4ZQMA 1ALDA 3LOTA 3M43A 2OJPA 2DORA 1A53A 3EXRA 3SGUA 3L5LA 3M5XA 4MY8A 1F2JA 2PRLA 1NAL1 4POCA 3I7RA 3KFTA 2DJXA 1T99A 1VCFA 1KTBA 4ZMGA 3IGSA 4Z0JA 3HPZA 5D2TA 1ZHAA 2FLIA 3DZ1A 3LTSA 3VFLA 3L68A 3CWOX 3W76A 4Z1CA 3I65A 1GYNA 3DKJA 3CB8A 3GDMA 1OFDA 4XKYB 3MBDA 4I7UA 1MO0A 1XBXA 5G1YA 4X3ZA 3SFKA 1ME7A 2JK2A 2BWGA 1G4SA 2X1SA 2YCEA 1KV5A 3NZ1A 5I3FA 1TB3A 3TQKA 3S8HA 4L4LA 4P61A 3Q58A 5FF4A 3TE9A 1OFEA 4JTEA 4AVFA 4JTUA 2QJGA 3H54A 3IIVA 3B8DA 5CSSA 1SZGA 5K2ZA 1OK6A 4ZQPA 1GG1A 3DFPA 4DELA 3Q94A 5H91A 2BLEA 3O05A 2PRMA 3MO7A 1H7XA 1YXYA 3N2MA 3TR2A 3EWUA 3KXQA 2ZZ3A 3LX9A 3FEMA 3GVGA 3CTLA 4IXXA 5LNWA 4NVTA 2YPIA 2RH9A 3THAA 1YDNA 3IIOA 3LBMA 2HS8A 4EVZA 2A1YA 4XWUA 4BWLC 1HL2A 2GVGA 4MYAA 5F4SA 4LVFA 4WY0B 3PS7A 5U4NA 5HWNA 1O95A 5IBXA 3GDTA 3TC7A 1SW3A 3HO8A 3NQMA 1VLIA 3MJYA 3R2GA 4AWTA 1H61A 2A4AA 3EWBX 2YGYA 3QM3A 2CLLA 1LOSA 2GJNA 4GFSA 1EWDA 2Z2UA 3TQ0A 4EF9A 3E9AA 3M5ZA 4X2RA 3FKRA 1K03A 5CSRA 3I6RA 2X30A 3LHUA 3GNNA 3GXNA 3IVUA 3NR0A 1WQ5A 3R89A 1I2QA 4FNSA 2LLEA 4IMDA 4GWEA 3CIWA 1W56A 1Y0EA 4E2DA 3CU2A 1GVRA 2JGQA 5H2ZA 3P8IA 3G0SA 3KRSA 1FY6A 3SW6A 2VFFA 3PF3A 5BW6A 5E93A 1H7RA 4RXGA 4LTSA 4NZFA 3NZRA 3PULA 3TKFA 1GOXA 1JR1A 1WOBA 2DZVA 1LLWA 2HMCA 3W1UA 3W73A 2OZ0A 1F05A 3P80A 5F1VA 4K37A 2Y7FA 1XUZA 3EX6A 1SO5A 1KW1A 3M41A 1K7XA 4GUFA 4BF9A 1TPFA 3S9YA 3E0IA 2Q3OA 4K39A 3B05A 1KM2A 4UTKA 5FF3A 4GC4A 4IPJA 4AAJA 3VNDA 4JYDA 2V2DA 5C54A 3EKLA 1K3UA 5FF7A 1XM3A 3GXTA 2NX3A 3FOKA 2E6YA 4RR4A 1VQTA 2FB2A 3DU0A 4UFKA 4RLIA 3P84A 5LGXA 1B9BA 2A7RA 3LCIA 4QIUA 4RK8A 3SI9A 3LCWA 4JX5A 1TQJA 1GG0A 1TPWA 3LLFA 3O6DA 4LRTA 3DFOA 1EP2A 3G1HA 3N19B 3NM3A 5FESA 4Z08A 3MWAA 4NJGA 1NF7A 1GQNA 3ATYA 2WNNA 1KM5A 5D38A 3NOEA 1S3HA 2QCGA 3N3MA 1Q6OA 4UMBA 1THFD 2QJIA 3L65A 4JIPA 3CM4A 1IXNA 3Q37A 5DY2A 1YDOA 4CCDA 1GVFA 3IRDA 4FX6M 3HOJA 4H6KA 1G67A 4A2SA 4WOZA 1FDYA 4O57A 5DLCA 1F5ZA 1QR7A 2ZRZA 1SFJA 1SO4A 4LS0A 1OYAA 3N9RA 4XQ6A 2X16A 2D73A 5LKYA 1FWRA 3KAOA 1LOLA 3FJLA 4BI6A 5KMYA 1MEHA 5D2YA 3W1NA 6ALDA 2DZTA 1PVNA 1LOQA 2NXGA 2VFDA 3LTYA 3B0VC 2CZDA 3W7EA 1LBLA 1H62A 4BR1A 1OABA 3E12A 5HULA 1JVNA 1M7PA 3MYOA 1GZGA 3B03A 1U83A 3O1NA 1CI1A 3BW2A 4IMCA 2WNZA 4FNPA 3BGJA 1EWEA 3DFSA 4GXMA 4O0KA 5HQEA 1R30A 3PBWA 5AB3A 4WD0A 1X6UA 5C55A 3BW3A 2OT0A 1LBMA 4EF8A 5F4WA 1FXQA 1IGSA 3PB0A 2B0MA 4QSHA 3WK0A 3OVPA 3W7MA 1W0MA 3DFQA 4JXCA 2V9DA 3G24A 4NNCA 2V5LA 3HG3A 1LZOA 5KSWA 2Q3RA 1YTKA 1W1ZA 3TX9A 4IMGA 3W7RA 2ATSA 1PS9A 2C16A 2I14A 1Z41A 2E09A 2YZRA 2RFGA 5D32A 3EX2A 4O14A 1GYLA 4UTUA 4WX2A 3W7DA 2ZA1A 4C1KA 4M7SA 3W22A 2CU0A 3MP4A 4O4WA 2F84A 3UWZA 2Q8ZA 1MEIA 1KFKA 3LCXA 2A21A 1J4EA 3UY8A 2Y88A 3EXTA 3TFCA 1OYBA 3IIPA 3STEA 3WK2A 3H53A 4JY9A 1L2UA 1EB3A 3SECA 1PE1A 4Y8FA 1QPOA 3HJZA 2CLIA 3T78A 1DOSA 1NVMA 4ADSA 1L9WA 1O4UA 1VRDA 4UC5A 2GPTA 3HG2A 4Q32A 2QJHA 4XBKA 5G4WA 4HT3A 1GVOA 3DGRA 5K9DA 2XN1A 1M7OA 4MPQA 2H3DA 5J5RA 3V1PA 1JCXA 3PBYA 3I7SA 1VCGA 4O13A 4GJ1A 1YPFA 3W88A 2WSQA 2YDAA 3M6YA 1YPIA 3G1SA 1I2NA 4YCPA 3G1XA 3W84A 3P60A 1IIGA 3TSBA 4IJBA 1EUAA 5KZEA 4O19A 2ISSA 5HWMA 1VCVA 4UNKA 1J5TA 4GE8A 4I7VA 2J9YA 1RVGA 3S5ZA 2VELA 4A29A 1FDZA 4UTLA 3UWUA 2VEMA 4RZ5A 2YW3A 3W3OA 2QF7A 3GX9A 1A5AA 2Z6IA 3LHWA 5AHIA 1ZAHA 2YR1A 4LOCA 4FHAA 3QW4B 3GKAA 4N4PA 2CLMA 2YFOA 3C2VA 4FEZA 1RV8A 3NYZA 4MJZA 3TSMA 3QZEA 2QCLA 2DZWA 3ABSA 4YMZA 2AQWA 4NZJA 1MEWA 3ANYA 1OFAA 3NQDA 4AXKA 3MUXA 4DPQA 1R2RA 2A6LA 5HUOA 1W3NA 2JKEA 3VKJA 2G5WA 3GR7A 3IEBA 2ZZ2A 2YXGA 5DBTA 1XBZA 3QPYA 4IOTA 4CNOA 1OFOA 2RDWA 4IXHA
chains in the Genus database with same CATH superfamily
4JS3A 2VUNA 4N9CA 1W3TA 4GIRA 5LSMA 3BGGA 3Q67A 1SR0A 1UP3A 3PZVA 3SN4A 1RR2A 4Q4KA 4P8UA 3VDGA 3MI2A 2DSZA 3C8FA 3JZEA 1W1B1 3C4UA 2GGEA 2AL1A 2D2OA 3CHVA 3VPLA 2HBXA 4JYEA 1KGWA 3W27A 2VX6A 2GGHA 1TCMA 3UFYA 1ITCA 2RJGA 4P7LA 4FALA 4CQ8A 2WC3A 4ZQRA 3ITOA 2DPEA 3CPRA 4ADUA 1P5BA 1HKWA 1UPMB 2G41A 3ITXA 4IIFA 4XTIA 3EPNA 1Q6EA 4GPNA 3E2SA 2X2GA 3B40A 3QPZA 4UTWA 4K8EA 3L5AA 5AN7A 3TONA 3A9BA 5A6SA 4U5IA 4LVAA 5KZDA 1OB0A 5ABFB 1MW2A 4NX0A 1CX9A 4BEUA 5AC7A 3SCOA 1VYRA 4ZQOA 2XYLA 2VC6A 3BLEA 4L6OA 3F5KA 5G4HC 3RUBL 2WZTA 3NQGA 1R7AA 2OPJA 1DPMA 4TR9A 1Z32X 3N2CA 4FXFA 1LM1A 1TE1A 1CLKA 2BGNE 5D30A 5I0DA 1AVAA 1DWAM 4H9XA 1B3WA 1EH9A 1VJSA 9XIMA 1DJIA 1AW1A 2QCNA 3MSGA 1KCXA 4B5VA 1T7LA 2VT0A 1E1EA 2ZUTA 4KWUA 1SUXA 3TWAA 3POHA 4UMAA 4B90A 1JUKA 3KE0A 1F6YA 4BFAA 4IT1A 3O0FA 4AF0A 5J04A 3MKCA 3M0MA 4A35A 2GSJA 4R88A 3P62A 4NX5A 4A4AA 1KWGA 2GJXA 4MLJA 3OPSA 1A5KC 4GBUA 1V93A 3M64A 4DY1A 3VC5A 1NIUA 3TYDA 2E6AA 3NQAA 1E15A 3MO4A 1V6VA 4FNRA 4ACYA 1G1YA 3GTIA 4OBSA 4UR7A 5A2AA 5AYBA 1SZNA 3IVSA 2D2JA 4HHMA 1J18A 1XI3A 3PFRA 3GM8A 4M24A 1WV2A 1R7OA 5EGRA 3PVFA 4U33A 4UTTA 2A3BA 3SCRA 2FVKA 5TBOA 1EZWA 2J9ZA 3OVRA 4A8IA 4XB3A 3MZNA 4QJ5B 3EDKA 4CD7A 4NIRA 4QJ4B 5CPNA 2BY3A 4NRSA 2H9AB 4C6NA 1TMQA 3EWYA 3V5CA 4GBDA 1DQUA 4JNYA 1DXFA 1GW9A 5CH9A 1D8WA 2E5BA 2PP3A 2VR5A 3AI0A 2QGHA 3ATZA 3HMCA 4J2MA 1KM3A 3N1AA 5EKYA 1WBJA 3BZJA 2PBOA 4H19A 3W7HA 4NU7A 4DB7A 3BAWA 3LI0A 5HUPA 2XSXA 1ONRA 3N34A 5T9CE 2O55A 2PU1A 1H0GA 2WM0A 1TELA 2QVHA 3T55A 4N02A 2Y7DA 2PURA 3W7GA 3ABZA 5DANA 3VZXA 3RAOA 6REQB 3USBA 3DI1A 3DHUA 3ZQ9A 2DT0A 1IZJA 1QWGA 1YW1A 1IR1A 4NAFA 1VFMA 4IF2A 1FWSA 3EMQA 3W6YA 3W83A 4ZR8A 1KCZA 3LCFA 4Q8TA 3EX4A 1VPXA 2J7BA 5FJOA 3W1RA 1BWVA 4MJMA 4GABA 3VMOA 2YDSA 4Z0SA 3C52A 3AAMA 3HGRA 2C1HA 4D6IA 1E6QM 2QQ6A 2NVCA 1W1VA 5F2IA 5HINA 4AFYA 1L8PA 4FNQA 3VOGA 3G22A 2NV1A 1E6XM 6CGTA 1SR9A 2E3ZA 4YL2A 4EPEC 5DCEA 4URIA 3TC3A 4C6EA 4E38A 1RVKA 3B4UA 4NXSA 3S2LA 4L9YA 3MDUA 4Y9AA 1RZMA 1S5MA 3FIGA 3P81A 1Z9AA 5D02A 3NEVA 1SGJA 2X7WA 1MUCA 5JIPA 5CGQA 4GZIA 1HVQA 1PTAA 3NTYA 2ZWYA 3MUAA 4OQVA 3O9NA 2QUUA 1XFCA 3F2CA 3NGJA 4GYKA 1HZYA 1W1IE 3U2EA 2J7GA 4XBSA 3DGBA 4Y9MA 3SJ3A 5E09A 1W9VA 1VENA 4GYPA 1RBLA 3DESA 1W37A 1SW0A 3LZ3A 2JE8A 4HD5A 1P0BA 1YKWA 1XISA 1ISXA 2ZRVA 2V68A 3BLPX 1SJCA 2DZPA 1XYCA 3TV8A 2R14A 3KUMA 5H1WA 4D6EA 4P7NA 2GZXA 4PFMA 2EQDA 4R5EA 3S2CA 2NX1A 3CEPA 2V8ZA 2YXOA 4WXYA 1JZ7A 4GY1A 1BSLA 2FHCA 4Z2GA 1TMLA 3ITTA 2ZC1A 4OOUA 1L6WA 3GH7A 1OQFA 4UFIA 2G0WA 5DMMA 1WOAA 5KETA 3CH9A 3N11A 3U0HA 1Z44A 3OBKA 4XZBA 2P53A 3RMEA 3PN8A 4DBEA 2ZDSA 4S3KA 4QJ1A 1B90A 2PDWA 2D20A 3TTEA 4PCFA 1Q13A 3PJXA 4O15A 3IGUA 1EJSC 3L0KA 2ISWA 4MDPA 1I1WA 2OWXA 2CZEA 1IHIA 2XSAA 4AZCB 1TJPA 3DFHA 1R2SA 5EMLA 2QZRA 5A6LA 1UZ4A 1XC6A 2GDQA 4L4OA 3RLVA 2HS6A 3TTSA 5DELA 3QZ6A 3FSTA 3W2JA 1FWEC 5H6HA 2GGJA 3LMYA 8XIAA 2XU2A 4IX0A 3WF4A 3C2FA 3BJFA 4GH3A 2OSXA 3DHFA 4UTWC 2OG9A 5HR6A 3CPUA 4E6MA 3WMLA 1XSKA 1BRLA 3BV4A 2V3FA 2XH2A 3OLIA 1FWNA 5CEWA 3BCJA 3DC8A 3OZPA 4CQAA 1VFLA 3CBWA 1N2VA 2J24A 3V0SA 5T26A 1KXTA 3EOOA 3TAOA 4PUDA 4CEXC 3VDBA 3KW3A 2J78A 2TODA 3V4BA 1XSJA 1OF6A 1JCJA 2P5NA 1KKRA 1J96A 1RQEA 3GWQA 1LDCA 2IQTA 1BSIA 3CB3A 4QRNA 3IARA 4CNPA 3A4JA 4L9XA 3GXMA 2ZADA 3WUFA 1DJYA 3KVLA 4WDUA 3VCCA 1TZ9A 1NELA 4KS0A 3PZOA 1ZP4A 2VDGA 5EYWA 5HNNA 1HJVA 4DO6A 4Q8PA 1KM4A 1QBAA 3RO8A 4XK2A 1TV4A 3HBLA 3WLIA 4J5NA 2BHUA 4A8RA 1UB3A 3VVGA 5FSDC 3U2OA 3M0XA 2BGQA 5D37A 3GAKA 3WJWA 1SSGA 3QV6A 4FLOA 3TOPA 3UYCA 4LUJA 1QASA 1UJQA 1ZENA 1FUYA 1A80A 2O4QA 4RCXA 4N0RA 2XN2A 5JMUA 1HNYA 5DBUA 1K4GA 4CD6A 2IPFA 2WZMA 4UTTC 4HSNA 4LAZA 1RQHA 4R9XA 4JQ4A 3G3DA 4PCPA 4AISA 4KQNA 5AVNA 3ZFHA 3QFEA 3NQ7A 5IDIA 1UWSA 4QM1A 2AL2A 3FNDA 4RJEA 4YVVA 1FCVA 3DYMA 1KA9F 4JIEA 2C19A 1GZ1A 3W6LA 3EPMA 3KBSA 2A7NA 4LS2A 5LNRA 4MVAA 1K9DA 3OODA 3ZWTA 1FCUA 5F2MA 3FV9A 3GNOA 2OYKA 2Q8XA 4RDWA 5D2WA 3VOFA 3IIZA 2GVLA 3MMDA 3WF0A 3P82A 2JFEX 5CKSA 4PFHA 4AY7A 4DJEC 3WJYA 3RU8X 4MOZA 4QXIA 5EMUA 5FKYA 4F2UA 4HPJA 4LYKA 3BAJA 3FVDA 3QR3A 2PGRA 5IFPA 2J27A 1S2CA 4DJFC 2PSNA 4HOZA 2YL6A 1ZLPA 3FGCA 4D8ZA 5CGTA 2NX9A 4P2VA 3B0UX 4NJIA 5FOOA 2D24A 2PODA 2PD9A 2ZA2A 3F4VA 4PN2A 2WVSA 2ZUWA 3HB9A 3TXVA 1VEOA 1T8XA 1KM1A 3WD1A 3N29A 1QFEA 3OLGA 2F2HA 3QW3A 4LNCA 3GU1A 1RH9A 1ZJAA 3BUVA 3B8UA 2NQZA 1W5OA 2YA1A 3LLXA 1A5CA 2YFNA 3RIKA 4Z1BA 2DSUA 1M5WA 4IH3A 4DWDA 3MU7A 3V3WA 2VQTA 2FZMA 4IPIA 4DLFA 1FXPA 4XSLA 1QI3A 2F38A 1AQ0A 5H8UA 2W91A 4OOZA 1ME8A 4J7RA 1FCBA 3ITYA 4H3DA 1SMDA 4MKVA 1S5TA 3S6TA 3BMVA 4CNNA 5C9UA 5IFTA 4Q8MA 4LYPA 1M1BA 4UTIA 3EEZA 3ES7A 1DQWA 1W6TA 3RHGA 3WX7A 3C0QA 1GPWA 2BDQA 2VZOA 1W31A 4BQ3A 2EG6A 4R27A 3CL6A 5C70A 1Y65A 1D7FA 3ARUA 1KNWA 3WLLA 2XGIA 3UY7A 2VM8A 1VGAA 3W24A 3CH0A 3QLLA 3EB3A 3DFTA 4NYUA 3EB2A 4KGJA 5G2HA 1E9ZB 3ZOAA 2BZNA 2ZTJA 3ZZ1A 4LGXA 1EIXA 5AHEA 1NOWA 1W1PA 2C14A 4HVXA 3U3HA 1I8JA 1EO7A 1M01A 1TTJA 1L0PA 4AHOA 1Z48A 4V1XA 3PZTA 3SCPA 3KOXA 2VRJA 3A23A 2QULA 3NQ8A 1HXJA 3HPFA 4MWAA 2ODOA 2FPTA 2NXIA 1O60A 3NQBA 4FI4A 2DQXA 3CWNA 2GWGA 2DDXA 2QAPA 2V63A 4MY9A 2NQ9A 4F66A 2TAAA 1JIBA 1Q3NA 1X39A 4HNUA 4F2BA 2Y5EA 3RLUA 4A22A 1A5LC 2PTYA 1REQB 3EPOA 1BPLB 4HNVA 2PF8A 3NQCA 4GFIA 3UZXA 4HTYA 3F2DA 3DI0A 5FF0A 2WV8A 3APGA 2QCEA 3FJ6A 1B3OA 2W67A 3Q45A 3T9PA 4ZODA 4O1DA 2TMDA 5CZ0A 2HK0A 2GSHA 3WQ8A 1XLJA 3WLJA 4G56A 1RK5A 3NAVA 4L1GA 2BOGX 3JUGA 1WB0A 2WMKA 1OX5A 3TZFA 3SQSA 3FXGA 4O28A 4BI5A 1OFBA 3LPFA 3L5MA 1CGWA 1Y5XA 3FJ4A 1JNEA 3SCUA 3HGSA 5JXQA 1V3IA 1MQQA 3C3UA 1FHUA 3QYQA 3WDJA 4F2TA 1HJWA 1ONEA 2I9UA 2XFWA 4KIRA 2V3GA 2WJFA 3G18A 2YCLB 3ID7A 1I45A 4M7TA 4UBPC 3UW6A 1OBAA 3LHYA 2J7CA 1XDJA 4S3CA 3O15A 1NFBA 4CD5A 2BHZA 3KOFA 4GIAA 3T0TA 3GH5A 1SYTA 1WXJA 2CWNA 5GPRA 3A3XA 1ZJIA 3CIVA 1F6KA 1Z8AA 2WMIB 5K9CA 1ICQA 2UY4A 3S1XA 3UZZA 2E6DA 4GGBA 4FA3A 3WLSA 2NUYA 4E0CA 1IT0A 1YMYA 1AL8A 1Z6KA 3MUCA 3KCOA 3VGFA 3CMGA 4KEVA 3TYAA 4R7JA 1BEUA 3AIQA 2CPUA 2WWCA 3FAWA 4ZOCA 4KBXA 3GNDA 4S3DA 1US3A 1Q8AA 4I6VA 4XD6A 2CW6A 2PC8A 4O8AA 2XH4A 4F0MA 1W2PA 1I2PA 1G7UA 3EDDA 1OG0A 2MUCA 4MB3A 4AHQA 3VXGA 4MWAE 4RL3A 3VCRA 2Z1XA 5LIKX 1DYSA 1TPEA 3SAZA 4FIRA 5A8GA 1OC6A 4D6DA 2P76A 5ABHA 1G69A 4O12A 4WGHA 7XIMA 5FD0A 3AUJA 5CAKA 1KV8A 3SCQA 1JQXA 1FWCC 5FEPA 1K7EA 3PB2A 2PTXA 5LZLA 4JTRA 1DIEA 5D03A 3TMLA 4HNTA 1PIFA 4E3VA 1K4HA 3BURA 3M7WA 3WD2A 1UWRA 2V82A 3FHQA 3PY2A 1P1XA 3M4HA 1OFRA 2B81A 4GA8A 4FIQA 4BQ5A 1M65A 1E5NA 3W28A 1XR2A 1CNVA 2G3MA 4CQ9A 2CHOA 5C9XA 4ZSUA 5G4EA 4YNGA 2XSBA 4DLMA 2VOMA 1W5PA 3RGTA 4F0KA 3WLKX 1JYVA 5CG7A 4BA0A 1E6NA 3LRKA 4N6FA 3PG8A 2DIKA 4DUOA 3OA3A 3TAKA 2WVVA 3C6CA 5AYXA 3T4WA 3SSJA 4WJEA 4JFVA 2WMJA 2QPSA 3WY1A 5FJJA 1U5JA 4ADTA 2PRHA 1ICSA 1FWWA 4XZMX 3V36A 1KXHA 2O7QA 2E68A 4DX3A 2EKCA 1TWWA 4AD1A 5CGMA 1TV5A 2J74A 1UZDA 1NFGA 1EJWC 3HM7A 2PS2A 2ZBTA 1JRCA 4LBSA 2IKIA 3G6LA 5BXPA 3GXPA 2ZA3A 3KP1A 1KLYA 1BXNA 3M47A 3S6DA 1VFTA 1EPVA 5GNZA 4DI8A 3MHGA 3LBOA 1UZHA 1C9WA 3S2NA 3CV6A 3ANUA 4H8UA 5BOEA 2QLYA 5AOUA 1EEPA 3GYCA 1XLCA 2PWDA 4WUIA 2WBKA 1E1FA 3EDEA 3URBA 3M9YA 3RN6A 1LJYA 1EGZA 3U4AA 3I3DA 2EPMX 4Q8UA 1D3HA 3FFSA 4MAZA 4MSSA 2GYIA 4JTSA 2OEMA 3NZQA 1LG1A 5AYYA 1Q85A 4A6GA 1E3XA 3UWVA 4OGZA 1VRXA 1V3HA 3UQNA 1XC4A 3DBPA 1WYIA 2P8BA 1V3LA 1UKPA 5XINA 3K5XA 1X1ZA 2OQHA 4FNUA 1C7SA 1M7XA 3NXLA 3EB4A 4OZOA 2EJAA 5EMJA 1OD8A 1PIIA 1V5XA 3WNPA 4CQDA 2Z6JA 2NUXA 4XAGA 3BMXA 2GOUA 4QE1A 4MNJA 3B8TA 4LANA 1M53A 4PUKA 3CO8A 2IPGA 1ADOA 4U10A 1TWDA 3F4NA 3VKDA 2PP0A 3CGTA 1CB7B 4UQCA 2AQVA 3CZGA 1F8MA 4LV4A 5EU9A 3BLIA 4F3HA 2PDUA 4JN8A 5I23A 5CLTA 4H9MA 1OJXA 3BTNA 1W5QA 4IUGA 4GK8A 4L7ZA 3T2QA 3PSWA 1ISWA 3ZIZA 3LB0A 1DKWA 2ZDRA 4C65A 2BMBA 1X8FA 2D2GA 3SRHA 1JZ2A 1B9ZA 5AZ0A 5DFAA 3UG8A 5BWAA 1KD0A 5BMWA 1O6IA 4QE4A 3ONCA 1MI3A 4GUIA 3SGGA 1S46A 2DUZA 2XVPA 3V5FA 4QITA 2JKAA 4R85A 1YNQA 1XH0A 1QTWA 5D8WA 2VZSA 3LOTA 4DWSB 2REQB 2DORA 4MJ2A 2YL9A 3SGUA 3L5LA 3M5XA 4HYWA 1FP9A 3ISIX 1UD2A 3WFZA 1MNZA 4GY7A 5CJ5A 1VCFA 4Z0JA 2DY3A 3HPZA 1E43A 4EK7A 5D2TA 5CC7A 1UIPA 2FLIA 4GVFA 3LTSA 4J3XA 1GOQA 3AHXA 4QLLA 2SFPA 4IG2A 4Z1CA 4CNTA 1IV8A 4XKYB 3KBVA 2CBUA 2HEJA 5LA2A 2JK2A 1G4SA 2XZ7A 1FH7A 1TB3A 4IJRA 3TQKA 5BRPA 5I06A 5FF4A 1EJTC 1V8EA 5FCZA 3R94A 2Z4GA 4JTEA 1KR1A 4JTUA 2FYMA 2QIIA 3H54A 1SZGA 2D0HA 3NDZA 1GG1A 2VRQA 2ON3A 5D8ZA 1OWQA 2FH8A 2DZAA 3KLLA 2WZHA 1TV3A 1DIOA 4YVPA 2J7FA 1HJSA 3CTLA 2YPIA 1A5NC 1IZCA 2W3ZA 1PKLA 2GK1B 4CVWA 1R6WA 4U3AA 3EMCA 1HL2A 2GVGA 2Y5SA 5HNUA 2I5QA 1Y5VA 4PB3A 2CXEA 1QHZA 3APTA 2YCKX 1O5QA 3W37A 3TC7A 3PNZA 1N82A 4DJED 4FOUA 1IZKA 5DF0A 1GCYA 2A4AA 2PDIA 3KBNA 3TYZA 4GFSA 3TQ0A 1TZ7A 4EF9A 3UJEA 3M5ZA 4MGGA 3FKRA 1K03A 3KLKA 4F0SA 1W1A1 4DJFD 3UT0A 3GXNA 1NWTA 1RP9A 1JDAA 1WQ5A 1I2QA 3HZ3A 4FNSA 4IMDA 3B9OA 3WQGA 1Y0EA 4E2DA 4DN1A 2HVMA 2W62A 3KRSA 3MVIA 4LTSA 4NZFA 3E0LA 4QLKA 1PDZA 2WZEA 1JR1A 1W1TA 1LLWA 2VMFA 3PPHA 1ONWA 3W1UA 3W73A 4JZ5A 1RSCA 1UD5A 1R3WA 1F05A 3P80A 3S47A 5A2CA 1TJ1A 4CUCA 4DZIA 4K37A 4C6KA 3GBEA 1SO5A 3TTYA 1KO0A 5HATA 2PDGA 2V5DA 3U4FA 1ZPTA 4BF9A 1X6NA 1VEMA 3PUGA 4UTKA 3UR5A 3WQDA 4AAJA 4JYDA 2V2DA 3EKLA 1HJXA 1K3UA 1C8XA 3I6EA 2E6YA 3JU2A 3WQVA 3DN5A 4RNJA 5KZ6A 3H4WA 2FB2A 3OB8A 2GGIA 3UCQA 4FR1A 4CN1A 3ZLFA 2GFTA 5DQPA 3N19B 3NM3A 3TYBA 4NJGA 3POCA 1KRBC 1IEVA 4KRUA 3NOEA 3N3MA 1T6MA 1THFD 4UMBA 3TN5A 1BFNA 2OZ8A 1KQYA 4J3UA 4JIPA 4HMCA 1IXNA 3UG3A 4K8GA 4FX6M 3QGVA 3WH8A 2X41A 4LALA 4ROPA 1VP5A 2HZGA 2PGFA 2VZVA 4GYFA 3KWXA 2ZRZA 3TQPA 2DEPA 4XQ6A 5LKYA 3OGRA 1FWRA 3W38A 1LOLA 3FJLA 4JCLA 5HMFA 4GI6A 5KMYA 1B0IA 1MEHA 3UEQA 3ZJKA 5M5DA 4KGLA 3W1NA 6ALDA 2E8YA 2EPNA 2DZTA 1PVNA 2CZDA 1U33A 4M82A 4W7UA 4AD2A 3SQMA 4LPCA 3O3RA 1XX1A 2YOCA 4LYQA 1JVNA 3KZPA 1M7PA 1W3JA 1GZGA 2IXUA 1U83A 3O1NA 3BW2A 3BSHA 4IMCA 3S9IA 2WNZA 3BSGA 2P50A 3BGJA 2C1GA 1UOKA 4WR3A 3PK7A 4YTSA 2VCAA 2CYGA 1X6UA 4WD0A 5C55A 2EJ1A 3BW3A 2XIIA 4EF8A 5F4WA 3DDMA 3F2BA 4QSHA 4KCVA 3N04A 3QR0A 3CHFA 3KL0A 5C9RA 3HG3A 3LSBA 5I03A 3WF3A 2ZWZA 4IMGA 5D9MA 1C90A 4IGSA 4IGMA 3ZJ6A 4J3TA 3CAKA 3PJWA 2YZRA 3AIEA 2RFGA 1OGBA 4G7FA 1A0CA 4U2ZA 3EX2A 1LL6A 4CEUC 4H8HA 4UTUA 2ZA1A 3ENLA 3VM5A 1E0UA 3AU2A 3W22A 2CU0A 4O4WA 1MEIA 4RNHA 1RXOB 2WJEA 4RV3A 5E0FA 3STEA 4JY9A 1L2UA 4IP5A 3LSCA 3SECA 2ZE3A 1QPOA 4QE5A 1PZ3A 4ZE4A 3MV01 4Q32A 3WDIA 3OGSA 1GVOA 2ZIDA 1EXPA 4MPQA 1ZTVA 2H3DA 1OC5A 5A8QA 3PBYA 3GC2A 5I00A 1TFVA 3AXKA 3W88A 1H1NA 1W1YA 3N6QA 3M6YA 1B54A 3G1XA 4IJBA 1US0A 5CLWA 1UMLA 3FW6A 1J5TA 3V0TA 1WP6A 2VELA 3SY8A 1LLOA 3A64A 5I24A 2VVNA 3GX9A 4C60A 3WD4A 1T5AA 1AD4A 2QUNA 4V27A 3CQIA 3QW4B 4UNIA 4FEZA 4IIHA 4QS6A 1RV8A 4HZ6A 2AQWA 4BCEA 5IDZA 4W4QA 5HUOA 4FMVA 3H2FA 3GR7A 3PZNA 5DBTA 2OGYA 1XBZA 1FWAC 4ICCX 3OZYA 3S9ZA 3VGEA 1OFOA 4ZSTA 1P7TB 1OZMA 2A2IA 1S2WA 5BMXA 4JTFA 3NA8A 2WSRA 2PDNA 3UPMA 3UJ2A 4XVDA 2IKJA 4Y90A 2OCZA 3VNYA 1R2TA 4IMEA 2X1TA 1FWFC 4KCUA 3OLEA 5I78A 4JYFA 4S3AA 2OLAA 1I75A 2QW5A 4E5TA 3STFA 3G8EA 1LTDA 4AXNA 2VX4A 2B4GA 4GLEA 4A3HA 4UNLA 1VYPX 3A21A 4DNHA 2B7OA 3LPOA 3AXHA 5BRBA 2V5BA 1BXBA 3BL3A 4K38A 4PTNA 1OCQA 1O94A 5DXXA 1E9LA 3QV9A 3CHEA 4P7OA 3GW0A 2PDMA 3M0YA 1JCNA 3IGHX 4QBXA 2GL5A 4ZOEA 3W7QA 1UHVA 4ZENA 4CCCA 3MZ2A 1V3MA 3HGOA 2XJ7A 2FTWA 3IK4A 1IT7A 1B3YA 2OSWA 4ZCWA 3EDJA 1GWJA 1FP8A 4PL2A 3SZ8A 1SFSA 3NQ6A 2HSAA 3T7VA 3IANA 3V1HA 3WDRA 1YYAA 5HQMA 3M1ZA 2YZ5A 4CQBA 1TRDA 3LYEA 3R8HA 3OTRA 1AQFA 4PTMA 1WNOA 2QCHA 5E1QA 5LIXX 3REQA 3TJ4A 3WJSA 3VMPA 3WMSA 4UFLA 4X0VA 1HKKA 4EX4A 5T8GA 4EKJA 4KEMA 1D3GA 1H3GA 2E7FA 1H63A 1WKEA 3GZAA 1J2WA 4YIWA 1OVDA 4GXWA 1MFUA 4QISA 3RF9A 3UWEA 5LA1A 4XTDA 3HURA 2RUSA 3GR8A 2A7PA 4MTVA 1RJQA 4CD8A 2A6NA 2QCCA 1NOUA 3FKKA 2ABBA 4D8AA 5A2BA 2OKTA 5BU9A 2R82A 2PWEA 1HGYA 7A3HA 2NT0A 2WNQA 4MAVA 2PB1A 3GHSA 3NO3A 4AEOA 2Y5JA 1P0DA 1XS2A 5HDRA 4A3YA 4OBTA 2VJXA 1FWDC 3QQ0A 5CSYA 3UD6A 4U3CA 4XKMA 2WCGA 3NNTA 3T4CA 1VS1A 1GJPA 3CAWA 4Y8EA 1W3LA 3PWIA 1XKYA 5I6SA 2WW5A 3E2RA 4O8RA 4Q7NA 4W8LA 1I4NA 1UH4A 4KWSA 4WKAA 3MSDA 1J12A 1B3VA 2BTMA 4XAFA 3W23A 4AUBA 2EPOA 3BLFA 2PCQA 2XVLA 3UXLA 1WXYA 4V15A 1MRQA 3S6OA 5ABGA 4GX9A 2HPMA 2OQLA 2D2HA 1SZRA 4ZA0A 1PV8A 3GG8A 3S1UA 2C79A 3LZ5A 3A4AA 4J4KA 2RDXA 1X7FA 3K46A 4I9AA 2QCDB 4JHZA 3EWXA 2BXVA 2OZTA 4B3LA 4I5UA 1DJWA 4V2XA 1GVYA 1OHLA 3W1TA 1E6ZA 5A94A 3W4RA 4BF7A 4QAIA 2VD9A 3HG5A 2B7NA 2FMNA 1L8NA 3GRIA 2ALRA 3QY6A 1VYSX 4QG8A 1XUUA 4EXAA 4JTGA 3P2VA 1UC5A 1FDJA 1Q6QA 3CPGA 1EC9A 2PWUA 3QTPA 1KBJA 2DZSA 4LB4A 3LERA 3TOYA 3LTPA 2PDHA 3TW6A 2OSYA 1O5KA 1AJZA 4X9YA 1QPRA 4H9YA 1A4LA 3GKFA 1IE7C 1WCGA 4JTJA 1N8WA 1H2JA 2AGTA 1L6GA 2QV5A 4QSFA 4M19A 2WM1A 4C1NB 4B4HA 4JTCA 3AHVA 1VD6A 4M1RA 4XG1A 1EDQA 2BS9A 4AX7A 3TQVA 3P3BA 4EOUA 1QJWA 3R11A 3VDCA 3W7PA 4RXFA 1Z3NA 4JL2A 1A5UA 1CIUA 4NSBA 2OU4A 4GUHA 1KFLA 2R24A 4IFKA 4NILA 3TA9A 4TMCA 3EA1A 1M41A 1Q65A 1ITUA 3L0NA 2G97A 3WL1A 5CZJA 1TREA 2PE4A 2JGYA 3WMCA 4IWWA 3IACA 4GH1A 4Z2KA 1JXJA 2OWCA 3LLDA 4DF0A 1UKQA 2AAMA 4LUYA 3B8VA 4TVCA 5IM51 4EAYA 2GJLA 1XDMA 4AMAA 4MB4A 4M3PA 3O16A 3QY7A 3QF0A 1TV8A 3B9DA 3AQUA 3KCJA 2DT2A 3L9CA 1D8CA 1TA3A 1J0IA 4DJDC 4NG3A 1DQXA 2H9AA 4NRRA 4XAPA 1XLEA 3ZR4A 3AS0A 2XGZA 3P5YA 1WUFA 1X1OA 3AZSA 2CZVA 1RPKA 1OCNA 2QNEA 2BBFA 3OQEA 3CIXA 1JULA 4J9JA 5HNRA 3FVMA 2VFGA 2G3JA 4W7WA 4M1BA 4RE0A 5CZKA 3RCMA 2JEQA 1O5XA 3GUGA 1HUVA 2WAGA 4E2VA 3W1LA 1OZQA 2V38A 3H6OA 5BROA 3RFAA 3U6WA 1JCYA 3BAIA 1VJZA 4JNZA 2F2KA 4BQ4A 2ZKMX 5KZMA 3GNXA 4AW7A 2PP1A 1D3CA 1VB9A 4NNAA 3SSZA 2IQ0A 1NFPA 1P1MA 2FTPA 3ARXA 2NV2A 1XYLA 2QPUA 3OLDA 2VGIA 3S46A 2GUUA 4LCRA 4TV6A 2J8FA 3TN4A 1MMFA 3ABQA 2E25A 3VIGA 3KVMA 3MCMA 2V2CA 1SSDA 3AHYA 3L67A 4PRTA 3H26A 2CERA 1UWAA 4Q6XA 3V75A 4AZ7A 4HK7A 1V02A 3GVWA 4AF0B 1N7KA 3PBMA 4X22A 1P0KA 4L56A 2GJXB 3PAOA 2ZXBA 1RLCL 4HHPA 3UR8A 1CXIA 1ENUA 4PH6A 1KGXA 1DL3A 3UERA 1HN1A 2HTMA 3PPGA 3RCNA 4JQAA 1MW1A 4M51A 3CZLA 4JHOA 3P74A 1LF1A 4L1WA 1MUWA 3EWWA 5L9FA 3N2XA 5JH2A 4E2BA 1IXQA 3G8RA 2VTFA 4KFNA 4J27A 2GVJA 1RA0A 1QPQA 4FF7A 4J35A 3NEHA 4LBUA 2R1LA 4N9EA 2VD8A 1GTEA 1AG1O 1C9DA 3TJIA 1JZ6A 3VGBA 3BCDA 4WKHA 4HMDA 3BK0A 4DXKA 1LCOA 2G8ZA 2DT3A 4HSHA 4AEFA 4LC8A 5EFDA 1PJ9A 2QCFA 1QO5A 2Y89A 1C7TA 3LM3A 4QDPA 3SURA 3FA3A 4RE2A 5HWJA 5K4XA 4AWUA 4E8GA 3WH7A 4HYRA 2CZ5A 3UWQA 3WO8A 4LX4A 2VWTA 5AKQA 2F6UA 3TCEA 1POKA 4R7OA 4TVUA 3S0CA 1UKSA 4AD0A 2FFCA 3PUOA 3GUWA 4ECLA 4PMXA 4WZHA 4WCJA 1LRNA 3PTKA 1KC7A 3QJAA 2ZUVA 5I3JA 2BSLA 3THQA 1V6XA 4DQWA 3RITA 1HP4A 4HU3A 3U7BA 3GFXA 1DVJA 1XD1A 2I5IA 3S5OA 2CESA 4PB5A 3W71A 1B2YA 3W1AA 5JUVA 4MB5A 1W32A 5A6JA 3QOKA 4Y6GA 5I3GA 4YU1A 2R94A 5CJMA 4O54A 4UQAA 3PC0A 4A21A 1OSEA 2V81A 2A3AA 5FJTA 5F2GA 3K8LA 4CNSA 1C8VA 4LBRA 2J62A 1QOXA 4US6A 1HFBA 1V02E 4TQTA 4PBEA 3T05A 1BWKA 3PPCA 1WKFA 1I0DA 4Q4OA 1VBJA 4OTKA 4GINA 3SM0A 1MFVA 2PDLA 2VFHA 4DAFA 2FHBA 1DWGM 1AZ1A 4L61A 2WSKA 2VOTA 2OFJA 3LN3A 4NUWA 2WHMA 3CT7A 3BH4A 3FY1A 2J79A 1E56A 2QDGA 3GO2A 5HNTA 2CKSA 1XIFA 2UY5A 3GHRA 1X1NA 4ZQCA 1BF6A 3W2NA 1XJBA 3UGRA 2Y1HA 2C15A 1TZZA 1PDYA 5HK4A 3M0HA 1TR9A 1Z42A 1BG4A 1XIDA 4V1YA 3ME3A 2ZYFA 4NP7A 4AG0A 4EWJA 1NSJA 4GQ0A 3PFMA 3RDKA 1NTHA 3DERA 1BHGA 4EPDC 1KBIA 4PTXA 1SVDA 3KWSA 3C8NA 4M6QA 1FWJC 1HO1A 3W7JA 1UD8A 2DVTA 3SR7A 1E73M 5AYZA 3CASA 3NPXA 3LCHA 3PTDA 4DIAA 3I68A 3NUKA 3R7MA 5E6YA 4HIBA 1TIMA 2E9LA 1A50A 3HG4A 1A5MC 2BVWA 1KXQA 2BNJA 3PZGA 3UZWA 3NVTA 3L2LA 3UG4A 3WG6A 4E4FA 4P8VA 1FQ0A 1BYDA 2R6OA 2X0SA 4HNCA 4AB4A 4GO9A 1SMAA 3HA1A 3VU2A 1ZAIA 1SU5A 4GNJA 2ALDA 1UR3M 1MXSA 1G7VA 4Y7EA 3U2CA 1K8YA 2RDUA 3W2KA 3AJXA 2Q6ZA 4GACA 2WOQA 3TYEA 1H7NA 4DNMA 1Y7VA 1SQ7A 3STGA 3WLPA 2VR2A 2BASA 1EDGA 5CPOA 3YPIA 1X96A 4Q7BA 1O12A 5HBFA 2PCEA 1JZ5A 2FPVA 1NH6A 1NDVA 1NP2A 1I6NA 2PC4A 1J0JA 2J88A 4YLWA 4KH2A 5E6ZA 4ERGA 5D09A 1BRLB 4KFOA 3KX6A 1SJAA 5A6AA 1Q6RA 2E1DA 3E96A 3T07A 2OTDA 3A4WA 5KINA 4K7YA 3GIPA 1GEQA 2EPKX 3O7UA 2BP1A 2G50A 3R10A 2G3FA 2QEZA 4JTHA 5M1TA 1AQHA 3VIPA 2Y7EA 4NI8A 4MF4A 1XIEA 1JQVA 1CEOA 3EGJA 4HN8A 4UQ9A 3A3HA 4WLCA 5JIWA 2Y8VA 4B9YA 3QBUA 2OMAA 1TTQA 1OD0A 1FH8A 4S2BA 4ASTA 2XIMA 1E5JA 1HG3A 3AMKA 2OEJA 2CNCA 1S5NA 1R46A 3F4CA 4MFDA 1RCXB 1LQ2A 3VNZA 3IUHA 4JX6A 4HYVA 1BQGA 1EYEA 4K6AA 3UJSA 2CBJA 4R53A 4Q22A 2MANA 4GY0A 2YX0A 4UWMA 4N2YA 1L2QA 3W07A 2PLMA 4RZ4A 3KTSA 7ODCA 5FEZA 1V6WA 2W0UA 5BXRA 3AXXA 4YVXA 1H5VA 1G4TA 2YBTA 2QDEA 5F4XA 1MWOA 4ZXOA 1H1ZA 1PKNA 1W5MA 4NYYA 2IPWA 1AMKA 1UR0A 1ZNNA 5G2WA 2GQ9A 1UYQA 2CLOA 4AIEA 1CBGA 4NI3A 4JNMA 4PZVA 5AC6A 5J5DA 4AC7C 4QNEA 1AK5A 2AKZA 4LWWA 4BWLA 4HU0A 4I8YA 2A3CA 2E77A 1K02A 4WDWA 2AL2B 1UIOA 5CPTA 3GVVA 4TIMA 4A3UA 4BK9A 2TYSA 3VI2A 3T40A 2Q02A 3VOIA 2ZZ4A 4HB7A 4I5RA 1PX4A 3SY5A 1XG3A 3AWOA 4TX9A 2WC4A 1DTUA 4JEJA 2AQOA 3F7JA 3PWAA 4UCGA 4DZ5A 3DHPA 5BYWA 3W7LA 4NZCA 1RQBA 1E9YB 1W3KA 1LT7A 3TROA 1HL8A 2PI6A 1DHPA 2BY1A 3MMUA 4HBKA 1ITQA 4OT7A 3N15A 1NEYA 1DBTA 3MKVA 4H9TA 3P7YA 2KX9A 5FAJA 2NWRA 4DEFA 2DVXA 4DO7A 4WY0A 1RLDA 5DRIA 1P43A 1WZKA 3EYPA 1AL7A 5T91A 2W4XA 3FGCB 1EA9C 1BVNP 4DM2A 2ZRXA 2ZZ1A 2C0AA 2O7SA 4B5SA 4N4QA 2J66A 3IAPA 1N8IA 1EBGA 1NM9A 4GZJA 3D46A 3MUIA 4UFJA 4WJ8A 2C18A 1OFPA 3NQ2A 5ENLA 1UBPC 4K1GA 3OP2A 4K7VA 2H90A 5DX7A 3MP5A 4LU0A 1Q7MA 3DECA 1K9FA 4JAWA 3UXIA 3H2MA 3EOSA 1UP0A 3F1QA 2C71A 3GTNA 4RX0A 4V33A 3W2MA 2NUWA 3WYZA 2XIOA 4Q4RA 4O1AA 9XIAA 3RO6A 2BXYA 1Q8JA 5AFDA 4QS5A 3E5PA 2C13A 4FX8A 4L9ZA 2P3EA 2IQDA 4O0ZA 1F3WA 1POJA 1A47A 2PUZA 3I4KA 4R34A 1R47A 2RJHA 3BJTA 3PM6A 3BG9A 3ARZA 1DJHA 4PYSA 5DCBA 3NQEA 2Q09A 3SCVA 1JGMA 1VFHA 2CKRA 1TJRA 2OT1A 1WAUA 2XG9A 5LHFA 3R0KA 4HPXA 3RNDA 3CQKA 5K7JA 3URAA 1XRVA 4OE7A 4ONVA 4DJDD 3UZ5A 2J7DA 3AMDA 2GJRA 1KLZA 2BX7A 4AIOA 3CT2A 2OX4A 3AS1A 3AYSA 1NDZA 2B7QA 2BHYA 2VGBA 2WQPA 1VC4A 2FZ8A 2X1RA 2X05A 1H7WA 3FAXA 4HKPA 3WH5A 1ISVA 3G77A 5A8PA 1KM6A 3N14A 3M0IA 1R9YA 4I9MA 5AECA 5G2IA 3GBDA 3TXZA 2AGKA 3FHAA 3R8GA 3NO1A 4MWAB 3NOYA 2WKJA 2HRWA 3TH6A 3GG7A 4QQ3A 3GC5A 2QHAA 1RCOB 5BZAA 4JQ2A 4O10A 3BDKA 3LHZA 4BHYA 2J7EA 4MMWA 1KQZA 4MZ1A 2DU2A 4M6PA 3P8JA 3BOLA 5M2FX 5ECUA 2NQLA 3HFTA 5EPDA 1PTGA 3SCTA 3UG5A 1JGIA 1R3VA 3LHTA 4E4PA 1DIDA 1FHDA 2FJUB 3T09A 3GXIA 4QX4A 2FPYA 2KZHA 2QCMA 1KFCA 3M0KA 5CPMA 2Z2AA 4IFOA 1QK0A 1RHCA 1GORA 4G9PA 3LENA 5A95A 2UZ9A 2VZUA 5FJUA 3VX0A 3WEMA 1OIFA 4O50A 3N3TA 1F4HA 2FHFA 3KRUA 1JDEA 3MP3A 2GDVA 3G1FA 1DWFM 4MPKA 3PP7A 2ICSA 1D9EA 1K8CA 5E5CA 1IIHA 2AMGA 4N7QA 1HT6A 3QV7A 1RD5A 1WPCA 1QRQA 3VDAA 3G1VA 4ZZ9A 6XIAA 4ZQMA 2BOEX 1YNYA 5D9PA 1EKOA 4KF1A 5TAOA 2WKGA 1W2VA 3WKZA 1FOBA 1NAL1 2P0IA 1U5VA 4POCA 5FJIA 4D6HA 1UW9A 1QXLA 3UGVA 3E3HA 3QV8A 4H7VA 3F4DA 3IGSA 4JFWA 2D3LA 1OT1A 1C8YA 1QW8A 4LY4A 3W29A 1DWJM 3VFLA 4PGLA 3SDOA 4XBJA 3MPGA 1QBBA 3CWOX 4B3ZA 4MNKA 3RXZA 3NIYA 1XPGA 1JD9A 3CB8A 4DZAA 3GDMA 1OFDA 4QG6A 4I7UA 3EKGA 3B9EA 1R86A 1UPPA 2OXNA 1KV5A 5I3FA 2CEQA 5ECVA 3VNKA 4L4LA 3Q58A 3TE9A 2E9BA 3N6JA 4PSRA 2ZUMA 2DUXA 1O1ZA 4PMUA 5AY7A 3AZTA 1EL3A 1XGDA 2W61A 1KRCC 3KXQA 2ZZ3A 3ERPA 3FEMA 1U5HA 4KPLA 4F0RA 2D0GA 4GKLA 4NVTA 4MJ4A 3THAA 1YDNA 3UVAA 4EVZA 2NV9A 4WSKA 4XZWA 3HFYA 4LAKA 4BWLC 4ATDA 3G1RA 3KDNA 1F4AA 3AC0A 4AZIA 3UR2A 3HO8A 3ZJ8A 3NQMA 3CO4A 1JF6A 1J0KA 4DJEA 1H61A 3QM3A 2YGYA 4Z2HA 3S5SA 2GJNA 4PTWA 3PZIA 3VMNA 3MB9A 2XH0A 5C7HA 4HMNA 5CSRA 4UZUA 1EXBA 1EJ7L 4DJFA 3IVUA 3DUGA 4GWEA 3BLLA 1W56A 3K1GA 3L12A 1FY6A 1ISZA 3KBWA 3GR4A 3NZRA 1GOXA 3K4WA 1WOBA 3VOJA 3WMBA 3V16A 1R3SA 1YHTA 3WUBA 1UD3A 3UCCA 3GFZA 1O66A 2O9TA 4CQCA 2WVVB 5C71A 3TTQA 1TX2A 1CGYA 2MNRA 2FVLA 4X2PA 2XZ9A 1KW1A 3M41A 3S9YA 1CTNA 1CT5A 2Q3OA 1EC8A 1E0TA 1KM2A 1IEXA 5HMEA 4FAMA 3GE7A 3PANA 1JZ8A 1V6UA 3GXTA 2RGLA 2WSPA 4G5DA 2ACRA 5C7VA 2QGYA 3DU0A 2QJJA 3ICJA 2VZTA 3P84A 2A7RA 3LCIA 4RK8A 3SI9A 3APYA 3ZT5A 4E3TA 2PDQA 4JX5A 4M8UA 1AJ0A 3USZA 3E0FA 3NURA 3O6DA 3G1HA 3MWAA 3RX3A 2ZXQA 4JKLA 4XV0A 5D38A 3KTCA 2A79A 1TJ0A 4WSJA 1S3HA 3EWDA 5FACA 4ZTYA 3WNMA 5HXMA 1Q6OA 2QJIA 3L65A 3CHCA 3CM4A 3AROA 1EJXC 3BCFA 5DY2A 4CCDA 1GVFA 1OGSA 4JTAA 1BVZA 4FR6A 1Z7AA 3HOJA 1CLXA 1V08A 4L64A 4A2SA 1Q6CA 1FDYA 4D6GA 4HZ7A 4O57A 1PAMA 4LS0A 7REQA 2X16A 1AFSA 3WZ0E 4LXFA 5HAOA 3WH6A 3S83A 1T8QA 2WHJA 4JIHA 1TUFA 2I57A 5D2YA 4H01A 1LOQA 1ZS2A 2VFDA 3LTYA 3MKKA 2E67A 1H62A 2GJPA 1VFUA 4JHMA 3B03A 3M46A 2Y8UA 1WE5A 3GHTA 3DFSA 3ZSTA 4GXMA 4LUSA 4W8BA 2OR2A 4KT2A 4J3WA 4US5D 2ZXAA 1BXCA 4TTGA 1QPKA 1WAWA 3PB0A 2B0MA 3HTWA 4WHBA 4AC1X 3KDOA 3W7MA 1W0MA 3DFQA 2GVEA 4FPSA 4NNCA 1OEPA 1W1ZA 1VBHA 3U57A 3W7RA 1E0WA 1XRSA 3GG0A 1E4MM 2HV5A 1CXLA 3H7VA 2E09A 2QIWA 3RM8A 4WX2A 2PDCA 4C1KA 4NAEA 4FLQA 4G8TA 3UY8A 3EXTA 1A3HA 2HXUA 4WF7A 4PMOA 1EB3A 4IL0A 3SRKA 2CLIA 3T78A 3D3FA 5BXTA 1OM0A 4UC5A 2GPTA 3ZT6A 1PX3A 3G5EA 1R87A 1RBOB 3PNUA 3RRAA 1TIWA 2VYOA 3T2PA 3DC0A 1FWHC 3V1PA 1PWLA 1X6LA 4O13A 3RCYA 2WSQA 1YPIA 1R5YA 3R6IA 4OECA 3W84A 3MCOA 3P60A 1EUAA 4H8NA 4O19A 7PTDA 1GVIA 4PCSA 4UNKA 2IPJA 4IIBA 3OA5A 1U30A 4JN7A 4GZ7A 3AIUA 4IG2B 4A29A 3TP4A 3SADA 2VEMA 2XISA 4LSBA 4FP1A 1XLIA 2Z6IA 4ZBCA 3UXKA 4MB1A 1EO5A 3BMWA 4UQBA 3O0KA 3GKAA 4EANA 4JQ1A 3QPEA 3OZMA 1E1CA 1HKVA 4MJZA 2XIQA 3PZUA 3ABSA 4YMZA 3E38A 4NZJA 1MEWA 5KEZA 1OFAA 3MUXA 2PLKA 2EPLX 4C6MA 1H11A 3SN0A 2YXGA 4IOTA 2RAGA 4CNOA 5ABEA 4GCXA 2CETA 2P8CA 4LAUA 3MT1A 3N9SA 3CWHA 3VE7A 2E8ZA 2WMGA 4XSMA 4FLRA 3BAKA 1PWMA 2PD5A 2OOFA 2W9MA 2ZX9A 4HN4A 3CMFA 5ABTA 4G7EA 3OW1A 4W9TA 3Q2DA 1DP0A 4KETA 4P7RA 3H7RA 3T0DA 8TIMA 4IM4A 3P5ZA 3TIMA 4NY2A 1ZBKA 1J11A 2WVUA 2EPHA 1G01A 3LNPA 2GQAA 3QHOA 4LC6A 3WDPP 2QYGA 4O11A 4FF5A 1KFWA 2P88A 3A5FA 5FEWA 3IJ6A 4AIUA 1W9BM 2Z29A 5BU6A 1XPYA 3CAVA 4XISA 2XIJA 5LXEA 3UXAA 2ACUA 4RW5A 4ML4A 1ADSA 3MQTA 3W70A 4U4MA 4UTHA 2Y85A 3DBNA 1PCKA 3WF2A 4FXRA 4FX7A 1GYMA 3CZJA 4IZGA 2ZC8A 2NSOA 4J1OA 1E51A 1XIMA 3TUUA 3OU8A 4MM1A 4DF1A 3SGZA 3TLQA 2PWFA 3BJSA 4ZTXA 1CCWB 1TMHA 5E0KA 4M29A 2X1UA 1I2RA 4JDBA 3GAYA 5AHNA 1KXVA 3GY1A 3VNJA 2E5DA 5C5YA 1XSIA 4KEZA 2RGMA 1J9YA 1UBSA 1WDSA 4IIDA 1UH3A 4HGXA 3NQVA 1HJQA 2NLIA 3PBVA 3B0PA 2PBGA 1QCWA 1YE6A 2D3NA 5DMLA 3W87A 4HNNA 2CZFA 5FL1A 4J3SA 4GUJA 1XXXA 2X0HA 4DUVA 1HVXA 3TK7A 3ZVHA 2R9RA 2X2YA 1WA3A 2XWEA 4DRSA 3MWCA 3G6MA 4J3ZA 1GUVA 1MW3A 3BAYA 1GNXA 2ZX5A 3RJXA 3MV11 2IKHA 3WNOA 1JFHA 1KBKA 2CXGA 2XM2A 4ICNA 5AC8A 2ZICA 3F03K 2Z2BA 4Z2JA 3TTOA 4X60A 3L66A 3QHNA 5G1TA 2FB3A 3LS9A 2I1OA 4PL1A 5EB8A 2VO5A 4BS0A 3MSYA 4WK9A 4DWSC 2Y62A 2OQYA 3DENA 4D1JA 1V6TA 1CZ1A 2JKPA 4NHVA 1BYCA 2H8ZA 3A22A 2OO6A 4O53A 2RKXA 4YXGA 4B3KA 3SN1A 1XYZA 1P7TA 4HA1A 3DFNA 1E6RA 4LEQA 2NVDA 2G37A 4DVOA 1C8QA 4Y96A 1J6PA 3DX5A 5DO8A 4LT9A 2V2HA 1VR6A 4ALDA 3VD7A 4IQDA 4E2OA 2XFYA 3V7PA 2BG5A 3VIJA 1N55A 1VFSA 3R0UA 3XISA 3FA5A 3PZ9A 1EQPA 4GO8A 3K8KA 1EC7A 3NCOA 4LH8A 4A8LA 4H83A 1AW2A 2Z0IA 1MQPA 4Y9OA 1JDCA 4XZNX 4TX8A 4RE4A 4GVIA 3WQ4A 2WCSA 4JIQA 2VFIA 2FGZA 4JTIA 4GI4A 1J0ZA 2ZFAA 3CUXA 2VGGA 3DIPA 4MKNA 4G1KA 2IS7A 3ZVIA 1TV2A 5I3KA 4CKQA 6XIMA 4ZB0A 2B31A 2F7FA 3PZQA 1FA2A 3PUDA 4YTRA 1RALA 1Q6GA 3D47A 4B16A 3LRLA 2YB4A 5I3HA 5BNKA 1UC4A 1TYGA 3JS3A 3GG1A 1JPMA 2Q71A 5EMKA 2ZZ7A 4PC8A 1W9DM 1MXGA 3IJ9A 4Q3MA 3W86A 1IQ8A 1ZBWA 4B5NA 3HPXA 3VNIA 5CPQA 1H7PA 2BGSA 3R0DA 4E8DA 2DUAA 4C5ZA 2ZX7A 3K30A 4IQEA 3FYYA 4XO7A 1CGXA 1F07A 1XICA 4I6KA 2Y61A 2X40A 4QDWA 4RDYA 1KWKA 2WO5A 3SCWA 2A0NA 1XCXA 3KBMA 2X42A 2DP3A 3A5VA 1QU4A 3UZJA 4ZO9A 3MSRA 3O06A 3H21A 1YTEA 4ZO6A 4UMCA 4D6JA 1JDFA 1V79A 1XDLA 1EJUC 3L4VA 4S38A 4PUEA 1HKIA 2HNHA 2EXOA 3K1DA 4HPGA 2JIWA 4GQQA 4PULA 3E6EA 3KOYA 1JYWA 2VURA 3ELFA 4FB7A 1UWTA 2JIEA 3TA6A 1ME9A 4IQLA 3O6AA 3VIKA 4OHQA 1YBQB 1QPNA 4UUIA 2FDMA 1G5AA 4OVXA 4JTLA 4I5XA 1H49A 4FSAA 3GIYA 1EX5A 3O63A 4G6CA 4DBUA 5MKGB 1ZJBA 1A5BA 2P1FA 2TPSA 3MI6A 3QFWA 4AZBA 3KZSA 2QUVA 4OBRA 3NZGA 4S39A 1NQ6A 1PTDA 5FEXA 3OOQA 5A6BD 3PTQA 5DY3A 1OK4A 1HJUA 5I09A 3UWWA 5B7ZA 1YXDA 2PTZA 3BOXA 4UTJA 2NQ5A 2ZZ6A 3OYZA 4NZ5A 3W2UA 2CITA 2NQJA 3WQOA 1J01A 4C6FA 4V28A 5CBBA 1CXHA 1JYNA 1KRAC 3H2OA 3T08A 3RX2A 4IQJA 1BGGA 2QCDA 4KCWA 4C7DA 3QSRA 1S5WA 3WEZA 3Q4DA 3N13A 1JUEA 2OB3A 3B0XA 4BI7A 1QHOA 1S2UA 3W7KA 2O92A 5LNSA 1DHKA 2VUYA 1W5NA 3OQ8A 3K13A 3FLUA 3IJLA 1K70A 3REQB 1F3XA 2ZVRA 2ZX6A 2VX7A 5C6MA 4KWOA 3VIIA 1VFOA 4H6QA 5GNXA 2G3IA 2INZA 3SBFA 4AMCA 1UMYA 1MNSA 1XLBA 1YX1A 2X09A 3UF9A 3D6NA 3B9NA 5IHRA 4D9PA 4HZMA 1E72M 2E28A 3RX4A 4K36A 3VUSA 2UBPC 1N8FA 1YEYA 1XD0A 1K1DA 2CLFA 5CSUA 3VDHA 4TU1A 2YSWA 2VRKA 5GJPA 3VABA 3G1DA 4AHPA 1R9XA 3MBFA 4B91A 1XBVA 2RHGA 2V67A 3NPUA 3IUIA 4AD3A 2OGJA 1EP3A 1QNVA 2YXXA 1LWJA 1GQIA 2I17A 3VNLA 1HL9A 5CJNA 2PLCA 4AWSA 3QMSA 5KTLA 3EWCA 3FA4A 1JCTA 3TJXA 4Z1YA 3ARSA 3BPWA 1OFQA 3AXIA 3BLOA 3FYPA 1WKYA 2WLZA 5HR7A 1UR8A 1OX4A 3UP8A 4IIGA 4Q4PA 1G4PA 1UR1A 2HJPA 4DI9A 1EIBA 3GHUA 3NWRA 5AHLA 5BOFA 4PA8A 3LV5A 3AIWA 3A9IA 3TEVA 4F0LA 4ZFCA 4H6EA 1C91A 4WQ6A 3BWWA 1PHQA 1Q4WA 3GU2A 1WX0A 4IPPA 3W53A 2YA2A 4JKKA 3NVDA 1X97A 2EEXA 1VLWA 4YTTA 3O2LA 2B7PA 3OEXA 5LNUA 3P6LA 1PSCA 1KFEA 1LWIA 4L4MA 3BGAA 3EOUA 4WOQA 4OV4A 1QWKA 2O4MA 4F48A 3CV1A 5IBXC 4LW7A 1WDPA 8A3HA 4HSOA 1AJ2A 1A0EA 4NF7A 1GTHA 2P3ZA 1NF0A 1KCLA 1SZEA 3T2OA 4C1LA 2ZRWA 3BARA 4GOAA 2ZUNA 3PZMA 3RYSA 1JJKA 5LNVA 4X61A 4KRTA 3ARVA 3WSUA 2J8TA 4F4RA 3SRDA 4L80A 4WKFA 2CLHA 4PSPA 3NJ3A 3I6TA 2F6XA 3WLTA 5EMYA 1R8LA 3TVAA 2CBVA 3WK3A 3ABOA 3OZOA 3VE9A 4I90A 4CLMA 4HQVA 3ZYZA 1ZB5A 9RUBA 5HOSA 1E40A 7CGTA 4IFKB 4A3QA 4DBWA 1RBAA 4KWWA 4RNFA 3NDOA 4HK5A 1HW6A 4TV5A 1BYAA 4BKNA 3LV6A 2VEGA 5HPOA 2J6XA 2OYMA 2L5HA 3R43A 3RPMA 4AEEA 5CQ1A 3C0LA 3NGFA 1BKSA 4KESA 4FOJA 4OV9A 4U28A 2VEPA 1TJ2A 3H2EA 3WLOA 1JAEA 2TRSA 2YCJA 3GDRA 2GLKA 3RMJA 2HCVA 4IJCA 3GVRA 3L0GA 5CC3A 4DYKA 2FIQA 1TA3B 2A85A 3WNKA 1W9XA 1D7KA 1W91A 2XFFA 1UUMA 4REQA 2ISFA 3T0CA 3ZWSA 3TU9A 2GQ3A 2F6KA 3CUJA 3ECQA 4YWSA 3BOFA 1V0LA 4PR4A 1DXIA 3AIRA 3T44A 3AXMA 4JIIX 1W54A 5TF0A 3M7SA 5D04C 2Q8LA 1B3ZA 4S3BA 3AISA 1TPVA 4Z2IA 1OX6A 4P7QA 3WQ6A 4LEFA 2NW0A 3UWYA 1QK2A 2PDKA 1R3TA 1EUNA 4BEQA 5CBJA 3QEZA 1TWSA 4MYXA 1TPC1 3ZR5A 2DZUA 1QVBA 2QXWA 2BFGA 1H60A 3OIXA 1ZL1A 1B4EA 4W88A 3WQFA 3LQGA 4ORMA 4ZE5A 1CLVA 5C9ZA 2O0TA 1WO2A 7TIMA 4WVXA 4S3JA 1EF3A 4ZVJA 4DYJA 1DORA 1MYRA 3SO7A 1K8ZA 1XHGA 3RM9A 3WIJA 2QJMA 3HV9A 2HK1A 5JBDA 2GQ8A 3CQ0A 4YHGA 3UNTA 2YBUA 4S3FA 2YW4A 3N2BA 2EG7A 5EMMA 2ISVA 2FH6A 4PEEA 1RK6A 1AH4A 1KRMA 1SW7A 1UA7A 2ZX8A 4KWVA 3S1VA 2XIBA 1GVSA 4P5UA 4EWND 4WRHA 3MA8A 2YLLA 4A3RA 4M5PA 3QZAA 3UXDA 1V0NA 1YDVA 3VX1A 1GJUA 1CB2A 1YLVA 3C86A 4XAZA 2R1KA 1NU5A 2E5CA 2YCIX 1R3RA 2D69A 4MY1A 4HU4A 4CU8A 4JEQA 3JZUA 2PTDA 5CG0A 2CLEA 5D33A 5REQA 2Z1KA 1PIGA 4D2JA 1AD1A 1F73A 2VENA 1VJIA 1UKOA 2VDIA 3S5NA 3W7IA 4KKXA 4TVDA 2YL8A 2QT3A 5A1AA 4YCOA 1IXOA 4JY8A 2QUTA 1MRAA 1MSSA 2WJZA 1ZRQA 4NXKA 3SIZA 3VIOA 3UZYA 4LVBA