3W1NA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-iodoorotate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-iodoorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1nA01
2GPTA 3TXVA 2DZVA 4LW7A 3PUDA 2Z0IA 4PODA 4FX6M 3LHTA 3BW4A 4IMCA 1OFEA 4MZ1A 3TROA 4IPIA 3AJXA 1VYSX 3NDOA 5I3IA 2YFOA 4IMFA 3FJ6A 3L67A 1JRBA 1TCDA 2ZZ5A 2DZXA 3CU2A 4JTKA 3DI1A 3T4CA 1PL9A 2WSRA 1F76A 1Q6OA 1F2JA 3UQNA 3P62A 1R47A 4JTTA 2NUWA 4FO4A 2CU0A 3SFKA 5CSRA 2QCHA 3HPXA 3LX9A 4UTIA 4DEFA 5LNUA 4AHOA 5BW6A 4FB7A 1SO3A 2VFEA 4DO5A 3RMJA 1GQNA 5AFDA 5AN7A 1FDJA 2A6LA 2QUUA 4R53A 1R30A 1TB3A 4AVFA 1NF7A 3BV4A 2CZFA 5KZDA 3SZ8A 3S5NA 2AAMA 4YMZA 3TAOA 2D73A 3T44A 3W07A 1YXCA 1ZJIA 3BG5A 1HFBA 1QPQA 4ALDA 3CIWA 1PHWA 3LBCA 3CWOX 3Q58A 4TO8A 3BARA 5DLCA 1XUZA 3CM4A 1ICQA 2X1SA 4OWGA 3PUOA 3LB0A 2BZNA 5LHFA 3ABSA 4ONVA 3UYCA 4D2JA 4AEOA 1SFJA 3QW3A 4UTKA 1DBTA 2YFNA 2FPTA 3CPRA 1L9WA 1MEHA 3W88A 3IGXA 1ZAJA 2BTMA 1DORA 3A5FA 2ZRZA 3A5VA 5T26A 2ZA2A 2PC4A 3JRKA 2TYSA 3S9YA 1HTIA 1K7EA 4O14A 4YLWA 3WJSA 3B0PA 3LCWA 2NX9A 2WNQA 5AHFA 3IIOA 3HMJG 4WQ6A 3TSMA 1RVGA 1TV8A 4UTUA 3QMSA 4WY0A 1LTDA 1XL9A 3NM1A 4UFIA 5DCEA 4HIBA 1W3TA 4U4MA 3WJZA 4ZQCA 5KZEA 3QMRA 3SJ3A 1W5NA 2QKFA 4ZVJA 3S5ZA 2J88A 3M1ZA 4HKPA 1W5QA 3DBPA 5DCDA 1LBFA 2AGKA 2FTPA 5CG7A 4BFAA 3G0SA 5DN1A 5AYYA 1FDYA 3N34A 3NVTA 4DF1A 1CX9A 4BK9A 1M6JA 3TSBA 1DV7A 3KFTA 2A2IA 4MZYA 3VFLA 4R33A 2ZRVA 4PA8A 3TA6A 4FX8A 3QQ0A 4N6FA 4NT0A 2YZRA 1TPFA 5LHEA 1MSSA 3W7PA 1W56A 1F6KA 5K4ZA 1KM5A 4M6QA 1ZY9A 3HF3A 3ZS4A 4NNBA 3W7DA 3OVRA 5FF7A 4I7VA 3F4WA 1OF8A 3ZWTA 1Z44A 4XQ6A 4XTDA 1DKWA 2B7OA 2YSWA 4Z0SA 4OE7A 3W1TA 2F84A 3PB0A 1U83A 1H63A 3W73A 1W8SA 2WJZA 3G1HA 1SW3A 1TRDA 3DAQA 4MY8A 1IXNA 5TQLA 4FIRA 2Q3OA 4IUOA 2XFWA 1K7FA 3RK8A 1X8FA 3BO9A 3VE7A 3EXSA 3CT7A 3PS7A 4O13A 1CI1A 4A21A 1UJPA 2QEZA 4HNUA 1MXSA 5KITA 3MMTA 1ICSA 4AHQA 4TR9A 1GYLA 2WV8A 2QCDA 4P2VA 2NZLA 3MO7A 4RCXA 1KFLA 3CQ0A 4CNOA 5HINA 3ATZA 4W9TA 4X3ZA 2BXVA 3RLVA 3NEVA 4TMCA 4XKYB 4AWTA 3HGSA 1R46A 3P82A 5EA9A 1DL3A 2ISWA 3UWQA 3W1PA 3UZ5A 3NQAA 3QM3A 4GUFA 3CIXA 4LY8A 3TXZA 4O53A 4Y9AA 2VFGA 1EP3A 3UWWA 3ABQA 1HG3A 2ABAA 5CGQA 4OHQA 1BTMA 3VCRA 4Q33A 3GB6A 3W75A 2TRSA 5HR7A 2CW6A 3P5ZA 5E0KA 3HIJA 4Y6GA 3UPBA 1D9EA 2EHHA 1IXPA 3LTSA 3NQ8A 2Y61A 3NQMA 2WNNA 2Z2UA 4GUHA 2WQPA 1XM3A 1G4EA 2C14A 3CTLA 4K36A 4P61A 2A1YA 1H1YA 2FPVA 3PAJA 1B3OA 1KTCA 4Z1CA 1HO1A 3TAKA 1TTQA 4K7VA 4UFJA 1DOSA 2NUYA 1I8JA 1S5TA 2C1HA 3M9YA 4KWVA 3C52A 1RQHA 2VFFA 3WJXA 2YGYA 5LGXA 4CNNA 3GKAA 3M43A 3U2OA 2RFGA 3TMQA 1LYXA 4ZL1A 5DCBA 4CNPA 2R8WA 1TIMA 3W6YA 3TUUA 4X9SA 3LHZA 2HS8A 3S1XA 4JTEA 1WOBA 3LHUA 3CLMA 3EX4A 3FFSA 3CEUA 3NQGA 3PBYA 3FIGA 2HTMA 3OG3A 2XN0A 2ZZ7A 2ATMA 5F4SA 3QPZA 3GVGA 4IMGA 3D0CA 4UNLA 4OU1A 3UNDA 3MW7A 2QAFA 3EWWA 5HUPA 3NQ2A 4WY0B 4YWIA 1P4CA 5AC6A 1VRDA 3O1NA 2H8XA 3W2MA 3LRLA 1OFRA 1H5YA 1GVQA 3I6RA 4O17A 1WQ5A 3SGUA 2V5LA 2A21A 1KM2A 1LRQA 4NJHA 1EB3A 4IMEA 2AQWA 5G1TA 1H61A 1XCFA 5K9DA 3GDRA 4ICNA 3VI2A 3E12A 1K8ZA 3M16A 5F2IA 3LLDA 3M5VA 3LCXA 4JYEA 2QJHA 3DFQA 3EX3A 2NX1A 3B8DA 3QSTA 3FOKA 3QC3A 1GG1A 1LLZA 4UR7A 3TCEA 1QFEA 3IIXA 1V5XA 5I3HA 3S5YA 1TPC1 2ZFAA 3IIZA 3PBWA 5DBUA 2NUXA 2VXNA 3C2FA 1I2PA 1QCWA 4UTHA 4UMAA 3N19B 5HMSA 2Y62A 4IMDA 3GNNA 5BMXA 1N7KA 3W22A 1PCWA 1FBAA 4NNAA 5EY5A 1TJPA 3H54A 1R2SA 2NXIA 1JCYA 4JX5A 1RZMA 4AWSA 4Z1AA 5K9XA 1ZALA 3DHFA 3Q37A 4AB4A 4RR4A 1LM1A 1NSJA 4JGDA 1XBZA 3G0UA 1JVNA 3NGJA 1KTBA 3PSVA 4ZQOA 4UTTA 4FNRA 4KKXA 2QDHA 1GVRA 3C6CA 4NZFA 3V75A 4DBDA 2PURA 3E49A 1OYAA 2GJLA 3E02A 1UB3A 1FDZA 1D3GA 1C8VA 4TX9A 5ABTA 8TIMA 2H3DA 5BOOA 2CLMA 3G1VA 1GYNA 4O1CA 4JYFA 3F4NA 1A5BA 1I2RA 1QPRA 3TW6A 3GDTA 3EKZA 5HUOA 2PRLA 1T99A 1G4PA 3NG3A 4JTIA 3Q94A 2FQIA 1DQXA 1IIGA 4O18A 1WX0A 2Q3RA 3HJZA 2ZTKA 1JCJA 4Q32A 1Q45A 5FEPA 2DU2A 1VLIA 1SSDA 3W7MA 1B9BA 2J9ZA 3UY8A 1SZNA 3BW2A 4MVAA 4O50A 3OEXA 1AW2A 3PG9A 3UXAA 3M5ZA 2QCMA 4AAJA 2VELA 1MEWA 4O1AA 1PCKA 1UASA 3EX6A 3TW7A 3M5XA 2HS6A 4M6VA 4RXFA 2P1FA 1G6CA 4PCFA 2C6QA 2O7QA 2Q8ZA 2R91A 3HG5A 3HQ1A 1SO5A 1N8FA 5LGZA 1TTIA 4QNEA 1JCNA 1VZWA 2KZHA 2A0NA 4UR8A 3NAVA 1OABA 2E5DA 5G4EA 3RFAA 4MIMA 1W5MA 3N9SA 1FWTA 5J5RA 2FPYA 1TJRA 3BK0A 3P7YA 5F2LA 4NXSA 4YCOA 3ZFHA 2J24A 1W37A 3KRSA 4Q4KA 5AOUA 3CWNA 4R7JA 5HJLA 4N9DA 1TRIA 2YX0A 1KV8A 4LVGA 3TFXA 1SZEA 2ZRYA 5FEZA 2WPBA 1G4TA 3LHYA 1VCFA 3C56A 1K8YA 1KM6A 3DGRA 3SR7A 1AMKA 1YTEA 2JKAA 1M7PA 2NXHA 3IV3A 4PH6A 4Z1BA 3WFAA 5AC8A 5BMWA 3GIYA 3GAYA 3OVPA 1F74A 2Y7GA 5D2XA 1HUVA 4R34A 3TFCA 3MYPA 2FJKA 4LV4A 1OFBA 2G96A 3DH7A 2WO5A 3O06A 4HHPA 4NX5A 4O1BA 5EL1A 1EA0A 1LDCA 2ATSA 1IXQA 3ELFA 1F73A 3ZWSA 3MHGA 4IJBA 5CSSA 3TK7A 1ME7A 1QMLA 3PF3A 3DU0A 3NQVA 1MEIA 2FFCA 2NX3A 3MUXA 3SY5A 4A2SA 3I7QA 5E1QA 3W2UA 1QPNA 5D33A 3G3DA 2CLEA 1H62A 1FXQA 4HPXA 3G22A 4UFKA 1NEYA 4A22A 5D38A 5G2HA 2IQTA 2CWNA 3EWUA 4UTMA 1KLZA 5DBTA 2QCFA 2DZUA 3NNTA 3LBMA 1I2QA 5LNWA 5D30A 2EF9A 3BVJA 1ML1A 1LOQA 1JUBA 2E5CA 5C2XA 4BI5A 1A5SA 5D2YA 4UTTC 1JUKA 4KFOA 3NQDA 1W1ZA 3M7WA 1E51A 3L5MA 1T96A 1JULA 2A7RA 3NL2A 5CKSA 1FWWA 4LU0A 1THFD 2NXGA 1TO3A 4N02A 2JK2A 4JX4A 3NZ1A 5EPDA 2Y7EA 4QM1A 3IVUA 5F4WA 2NV1A 3L68A 3G8EA 2Y89A 3I7SA 4QIUA 1FCVA 1TREA 2V30A 2X1RA 2VEPA 3FJLA 4RV8A 3F03K 5G2WA 3W7NA 3IVSA 4JYDA 4UC5A 4NVTA 5HQEA 5D09A 3W7RA 4M19A 3P81A 3G1FA 5G1YA 1H7RA 3TQVA 4BF9A 5GVJA 4L4MA 4MY9A 4EVZA 4N6EA 1P1XA 4UNKA 4FNUA 1AL7A 1IGSA 3W7CA 1F7BA 4KFNA 4LOCA 2YYUA 3STFA 3KVLA 2Y88A 2ABBA 2J9YA 4NJJA 1HL2A 1QPOA 4WD0A 4LC8A 3PC0A 3TJXA 3EKLA 2YPIA 3N2MA 4E0CA 2Y85A 3G24A 5FF0A 1FY6A 1ZCOA 4UTJA 4JICA 3L2IA 2CLIA 3ZR4A 4IWWA 1RQBA 1XDLA 5U7SA 4EIVA 4ZMGA 3G0XA 3R13A 3VE9A 1JRCA 1H7PA 1KM3A 1OK6A 2GVGA 4YXGA 3BLEA 5AB3A 1ME9A 1EPXA 2C16A 1TPWA 5EBUA 5KZMA 3PSWA 3NQ7A 1QOPA 4RX0A 3SGZA 3SW6A 3P74A 1MZHA 5LNVA 2VFIA 5KINA 3FLUA 4K6AA 4GNJA 3L9CA 2V82A 3KHJA 2QDGA 3C2RA 3G18A 3NXFA 1UBSA 2E09A 4HNVA 2RKXA 4HT3A 1GVOA 3EXRA 4IGHA 3LI1A 3UWYA 3UXDA 4E2BA 5L9FA 3HGOA 3OIXA 3C0JA 4O19A 2DZSA 2HMCA 4AWUA 4PC8A 2A7PA 3TC6A 4RXGA 3DI0A 3MP5A 4ZQRA 2CFFA 3KRZA 1LROA 2YXGA 3KXQA 2V2CA 2JBMA 4OV4A 4DBEA 4RZ5A 1TPVA 2QAPA 2B4GA 3G1DA 4MYXA 1KFCA 5F1VA 5BRBA 3L66A 3TE9A 3LXCA 1QR7A 3I68A 4NZJA 3W76A 4QSHA 3NPWA 3P8JA 1F5ZA 3NM3A 1R2RA 3QW4B 2ZZ3A 3DFTA 4HN4A 4L4LA 5F1UA 1N55A 3BGJA 1CW2A 1TTJA 3B04A 4LVFA 1AG1O 3EWYA 3M44A 2ISVA 4LVDA 4O10A 3LCGA 2XN2A 3LCHA 1Z42A 3B0VC 1YYAA 4IQLA 2Z1BA 1LBLA 4GJ1A 5I3GA 3THAA 4DPQA 4UTWC 4GUGA 3HB9A 3FKRA 1OX4A 1P5BA 2YDAA 1TPH1 5LZLA 1O5KA 1XXXA 1AL8A 5D03A 3I65A 4FNTA 3W23A 5FI8A 5EYWA 3W2JA 5HWNA 5C55A 3H53A 1WBHA 1VCGA 3R8RA 1OX6A 5AHMA 4LS0A 1BWKA 4ML9A 3EXTA 3PWAA 3SIZA 2CZDA 1OYCA 4M6PA 3W7QA 1VHNA 1SW7A 3UY7A 1EIXA 2E1DA 3UZJA 1L6WA 2GJNA 3PB2A 3B4UA 3DZ1A 1GEQA 2W0UA 5C5YA 1JCMP 3G1SA 4GFSA 3S1UA 3WK2A 1KFKA 2GVJA 5TBOA 5KSWA 2VEIA 2X2GA 3A21A 1TPDA 2ISSA 4O0KA 3TQ0A 3NPUA 1ZHAA 4ZZ9A 2JGYA 1P0KA 1PS9A 1G7UA 3W2NA 3G1YA 2ZRUA 4C1LA 4WXZA 2QJGA 3PM6A 3CB8A 4X2RA 7TIMA 5H2ZA 1VH7A 2ZRWA 3NZRA 1FCQA 3W1UA 4WUIA 2JKEA 1YADA 3LRKA 4NNCA 2VFHA 2WSYA 1OYBA 1M5WA 5SWUA 3VNDA 4RLIA 4MZ8A 2B7QA 3OHIA 3GNDA 3UPWA 4HNTA 3HO8A 5D02A 1GPWA 1KFEA 3O63A 1QWGA 3I7RA 1O4UA 3LM7A 3S1WA 2V2HA 1OFDA 4DO6A 2G5WA 2BX7A 3NO5A 4MKNA 4JN6A 1LRNA 4UFHA 4Y8FA 4IX0A 2ALDA 1LZOA 3LXAA 4ADUA 3HG4A 4JY8A 5G4WA 5F2GA 2V2DA 3DFSA 3RLUA 2EGZA 1GOXA 4O8RA 4ADSA 2QCEA 2I9EA 3FYOA 4DXVA 1X6UA 1A53A 1OFQA 4JS3A 3A24A 1HO4A 4GWEA 4JXCA 1YXYA 1I4NA 4O0ZA 4DO4A 3E0IA 3B06A 3C2EA 1OFOA 1OK4A 5CZSA 3BLIA 4UUIA 3L65A 3W72A 4WXYA 3L21A 2RDUA 2GUUA 5AYXA 4NQ1A 4B5NA 1A5CA 5HULA 3AO0A 3HPSA 4M5PA 4LS2A 1RV8A 2OJPA 3NQ6A 1XC4A 1YTKA 2ZA3A 2H8ZA 1L2UA 3T40A 1GVSA 2V0TA 1SSGA 2FIQA 1TQJA 3W1XA 3TH6A 4MJMA 1KFJA 4MLRA 1KM4A 4HSOA 5K2ZA 1ZAIA 1JUEA 1KM1A 3OA3A 3S1VA 1TTPA 2FB3A 1AK5A 2ZBTA 2C13A 3TDFA 1VGAA 4K37A 1Z41A 4RZ6A 1JQXA 3LGEA 4LNYA 3GAKA 2QJIA 2EPHA 3A9IA 1JCXA 3ATYA 4LC6A 3IIPA 3O6DA 5A5WA 4EF9A 2DJXA 2ZZ6A 4O57A 4JTFA 1RR2A 4I9AA 3ABOA 4Y90A 3WK0A 3QRHA 4FNSA 3L0NA 3IGSA 3TJLA 4ZQPA 3HPZA 3NYZA 4QAIA 5U4NA 3LI0A 2P0OA 3DKLA 3STCA 1O94A 1V7YA 5E93A 3EWBX 3U6WA 4IOTA 3L0GA 1LP6A 3WJWA 2RDTA 1A50A 3TU9A 3BPWA 1EP1A 5C54A 1JR1A 2QCDB 1EX5A 3P67A 4X22A 5CZ0A 1KV5A 5K4XA 1H7XA 1L6YA 2PRMA 4JY9A 1K3UA 4GUIA 3IGUA 3TSDA 1SW0A 1K8XA 1IXOA 5AHIA 4GXMA 3GXTA 3P5YA 4QISA 1VCVA 1LCOA 3GXNA 1I2NA 3NOEA 1YLVA 5G2IA 5D2TA 4GRSA 3USBA 4EOUA 2NV2A 1VYPX 4UXDA 1BWLA 3CHVA 4LT9A 1NAL1 1WXJA 1QO5A 3IEBA 4QJ1A 5DY3A 5LKYA 3N73A 5K7JA 1W54A 5DELA 4WY0F 4LTSA 1ZAHA 2R14A 1DJNA 1UCWA 2E5BA 3CEPA 3W87A 3GLCA 1EUAA 5CPOA 4LUJA 1DVJA 3MYOA 4FIQA 1SO4A 1SQ7A 5K9CA 2QR6A 4H3DA 1KW1A 3GYEA 3FA5A 1H50A 4DF0A 3KRUA 3NA8A 4A29A 1H1ZA 3QMTA 1MO0A 3V1PA 2YR1A 3M5YA 4LVAA 2Z6IA 4QITA 2ZCGA 2G97A 5CPMA 1TPUA 1TPEA 2TPSA 2E6FA 3PULA 3RNDA 3PBUA 1OJXA 3LDVA 4JTUA 1OFAA 4LV9A 4ORIA 4MUZA 5J5DA 3B03A 4N9EA 3PBVA 2ZQ0A 1RPXA 5D32A 3WK3A 1YDVA 4S2CA 3M47A 1QOQA 3DFOA 4S2BA 1EUNA 5HWJA 5I3FA 1WDWA 1JCLA 4E2DA 3EX2A 4G1KA 3GDKA 3HOJA 3G1XA 4JTJA 3NL6A 2RH9A 1NVMA 2E6YA 2DZPA 3R2GA 4OBTA 1ADOA 1Q3NA 3EWXA 2E77A 4O12A 3KX6A 3LLFA 1VPXA 1SU5A 3TV8A 3LCFA 2VOMA 1VJIA 3CC1A 3FYPA 1VYRA 3LXBA 3P84A 1VR6A 2Y7DA 4E38A 4NJKA 2TSYA 5FF2A 3W2LA 1IIHA 1G67A 4EF8A 3C8FA 2EKCA 3O07A 3M41A 2FLIA 3EEGA 1YXDA 3BGGA 1VQTA 5DXYA 5MHBA 1SZGA 3N2XA 1Q6RA 2H90A 4H4IA 1XI3A 1K02A 3QYQA 2VKZG 5D05A 1SFLA 2B7NA 5A8GA 1DQWA 2YW3A 2ZRXA 3LERA 3TC7A 4O4WA 2VEMA 3W74A 4FXSA 1KLYA 2QF7A 4Z0JA 2CLHA 4UTWA 1XKYA 1O5XA 3HG2A 3L0KA 4JEQA 1WA3A 1PE1A 2C0AA 1KBJA 2HSAA 4Y96A 3O6YX 3HGRA 4XKYA 4IXHA 5BNKA 1H7OA 3UWVA 1YPIA 4XZ9A 5K3VA 3UWZA 3QF0A 3IVTA 3C2VA 4RKAA 6TIMA 3NQFA 3JS3A 4JX6A 4Z08A 5F2MA 1TMHA 5AHNA 3S0CA 4O15A 3GK0A 4FNPA 1M7OA 4TMBA 3MI3A 2V9DA 4LWWA 3W7LA 4O4VA 1J4EA 1YTDA 4JTLA 1TYGA 1W3IA 3O15A 4FHAA 5LNSA 3B0UX 2ZDRA 4TIMA 4ZQNA 2A85A 3KOFA 3S42A 3ABRA 1OVDA 1Q6QA 4WOZA 2QCLA 4PL1A 1VC4A 2LLEA 2V5BA 4BR1A 3W70A 2Y7FA 4UFLA 1KM0A 1S5VA 1SUXA 3TMLA 4YCPA 1PV8A 5AHEA 2Q8LA 2H6RA 1GVFA 2C15A 2OMAA 3STGA 4I7UA 1H51A 1QDSA 3HG3A 1PVNA 3BG3A 3R89A 3MP3A 3UWUA 1ZENA 3IRDA 4J9JA 2PRHA 1TSIA 4MJZA 3G1AA 1B4KA 1SZFA 1LBMA 4QNWA 3VKJA 3P60A 3TR2A 1OFPA 3O8AA 1Q6LA 4N9CA 4XUGA 5D2VA 3C3NA 3U8GA 4RK8A 4NU7A 5IM51 3LRMA 5IBXA 1F6PA 4U28A 1WAUA 3PY2A 5D2WA 1UUMA 2J9XA 4K39A 5FF3A 4NUWA 1GWJA 3THQA 2X16A 4LRSA 5CPLA 4UFMA 3QZEA 4AF0A 3NR0A 3GKFA 5KMYA 1TV5A 1OHLA 5AC7A 1P0NA 5I3KA 1XDMA 3N9RA 2QCCA 4JDBA 4LVBA 3OVQA 2FB2A 3BLFA 1ICPA 2ZZ2A 2WOQA 4BI6A 4JD4A 2Z6JA 3LHVA 3W71A 4YL2A 2PE4A 1ZNNA 4AH7A 4WX2A 1Z48A 2V81A 3PR2A 3T78A 1PIIA 1B4EA 4HNNA 3MI2A 3DHDA 4DQWA 2ZZ1A 3O6CA 4UIOA 5EMUA 1GJPA 4UCGA 2NWSA 1OG0A 2QUVA 4O52A 4UTLA 2CLOA 2YYTA 4ORMA 3WK1A 3S5OA 1KBIA 3SI9A 2VFDA 1I2OA 1X1OA 2GQAA 2DZTA 3GR7A 4K8HA 3S6DA 1YDOA 1Y0EA 1G7VA 1TQXA 2OT0A 4DPPA 4CQ9A 4BWLA 4IPJA 1XFBA 5C6MA 1LLWA 4MLJA 4HPJA 2R94A 2VENA 1QAPA 2B7PA 3LV6A 5CZTA 3EX1A 3A23A 3NL5A 1ME8A 1WV2A 1W31A 5CZJA 4ADTA 1EWEA 2O7SA 3W7GA 4RJEA 1FCBA 2TMDA 2WNZA 2E68A 5G5IA 3W86A 2RHGA 1H7WA 1UUOA 4MFEA 3QJAA 2GOUA 1W5PA 1LOLA 2C3ZA 5FESA 3MI6A 2YW4A 4DF2A 3KVJA 3TX9A 1DHPA 3NQEA 1G69A 3NQCA 3M0ZA 3E96A 5FEWA 3NPVA 2Y6ZA 3W1NA 3QSRA 3C61A 1GT8A 3W7IA 1OX5A 3LCIA 3MBDA 1FX6A 6ALDA 2C19A 4KFPA 1LOSA 1J5TA 3W7JA 1KTNA 1ONRA 4OQVA 1K03A 1T0OA 3QFEA 3NPXA 4JIPA 3NL3A 2DZWA 4JTHA 1J2WA 2A7NA 1YDNA 4JTSA 3RF9A 5AYZA 2VC6A 4EWND 4OT7A 2QCGA 3E9AA 4KWWA 4XBSA 4CCDA 3W1AA 3W83A 2B0MA 2JKPA 2A5HA 1H60A 1A5AA 2QCNA 2E6DA 3BG9A 4FX7A 4MY1A 4I7WA 3GZ3A 3EB2A 4ZQMA 3OBKA 3L5AA 2YCEA 1B57A 2EAWA 1NFBA 3FEMA 1PHQA 4O1DA 3L5LA 2J27A 3F1QA 1C9DA 5HWMA 1C29A 3C4UA 1SR9A 4FF7A 1O60A 2A4AA 1LORA 4WZHA 2ZZ4A 4JNMA 4XWUA 3KVKA 5IBXC 4MOZA 1QNVA 4K8EA 3MJYA 3P61A 5D37A 4XTIA 2OCZA 3QPYA 2PCQA 3W85A 3O05A 3QH2A 1YPFA 4O28A 3MP4A 5D04C 4NX0A 4OV9A 2OZ0A 3HGJA 1WOAA 3W3OA 3DKJA 2VEKA 1XUUA 1IF2A 3DFNA 3O16A 2CZEA 4MFDA 4AF0B 2X30A 3A22A 4O54A 4CCEA 1BKSA 1VHCA 3N3MA 4M7TA 4IXXA 1O95A 2RDWA 1H7NA 3PUEA 1S5WA 4DELA 1RD5A 1ZFJA 2Y70A 2GQ8A 3ANYA 3PG8A 3FS2A 2C18A 1NF0A 3INPA 1ALDA 4HSNA 3LV5A 3P80A 2V8ZA 2J6XA 3G8RA 1FXPA 2FDSA 3S8HA 2DORA 1T8XA 3IIVA 3EWZA 4CCCA 2W6RA 3TQKA 1AW1A 3DFPA 1KA9F 3QQ1A 3STEA 3MHFA 5EKYA 3R5EA 4N2YA 5CPNA 3LHWA 4AHPA 4C1KA 1FCUA 1EWDA 2W79A 2CLFA 3KAOA 1GG0A 4GC4A 1S3HA 3JR2A 1U5JA 1RQEA 3RU6A 3TIMA 3BW3A 4N4PA 4XBKA 4S1FA 3LCLA 4BWLC 4LUIA 1WBJA 4LRTA 3W7OA 1EP2A 2GQ9A 4H6KA 5FEXA 4PEKA 4NJGA 3MHUA 4JDYA 4A3UA 3T55A 2I14A 4LS1A 2ZYFA 5LNRA 1FWSA 2ZTJA 3M6YA 1FWRA 1K7XA 1WYIA 3G3MA 4FEZA 4JIQA 3W7HA 2F7FA 4M7SA 3TNOA 3WJYA 1OX4B 1X7FA 4Z1DA 1VS1A 2CLLA 3W1LA 4QQ3A 5I3JA 4UMBA 5F4XA 1L6SA 3LOTA 4WJEA 1XBYA 3W1RA 1TPB1 2H3BA 3GX9A 3W7KA 2X1UA 3GDMA 2WSQA 4MYAA 4GUJA 4MPQA 1OF6A 1LRTA 4FNQA 2I1OA 2DP3A 3MBFA 3W9ZA 2QUTA 1TV7A 2NWRA 1W3NA 4NJIA 1JQVA 1KFBA 2A6NA 1JJKA 3R12A 4GE8A 4O11A 4PFMA 2XN1A 3TKFA 4GBUA 4WOQA 1FQ0A 4K7YA 4PL2A 5HNRA 4RZ4A 5DXXA 5FF4A 3W2KA 2UV8G 4JR5A 1I45A 1SO6A 2CZ5A 5L6UA 1EEPA 2DJLA 4BI7A 1G4SA 3MWAA 3W84A 4UMCA 5KTLA 1FWNA 3W1MA 2NLIA 2CLKA 3Q2DA 5TIMA 3SECA 4CQAA 1XBXA 1DJQA 3PVFA 1X1ZA 3T7VA 3P8IA 3GR8A 4OGZA 1XBVA 2BLEA 5H91A 2P10A 1F05A 3KVMA 5DY2A 1R2TA 4CLMA 4PTNA 4N4QA 3LTYA 3QEZA 1QO2A 5HR6A 1W5OA 3SSJA 3UD6A 3GDLA 1W0MA 3N14A 2X1TA 4TU1A 1VLWA 2BSLA 3GXPA 3W7EA 2ZA1A 5LSMA 4IX2A 4JTGA 2G95A 3LTPA 4NXKA 2GVLA 3HBLA 4AXKA 3B05A 4POCA 2E6AA 1AW5A 1D3HA 3YPIA 1FUYA 4A2RA 3C2OA 3DENA 1GTEA 1GTHA 4FXRA 2OT1A 1SPQA 3FKKA 4N9BA 2Y63A 1BEUA 4K38A 3H55A 4O16A 5AHLA 2BWGA 3K30A 2JGQA 2OX1A 4AMAA 3DXIA 4CQ8A 3W1QA 1GZGA 2WKJA
chains in the Genus database with same CATH superfamily
3PUDA 3RUBL 1LUCA 3RDKA 2C8NA 3WLHA 1OFEA 3TROA 2V3EA 4JBRA 3IS4A 3GFXA 2HQAA 1O66A 3SSZA 2TODA 2CBIA 3VGHA 1JRBA 2DZXA 3CU2A 3BAWA 4GQRA 1R0MA 4BEQA 3VMPA 5LA0A 1WAWA 3LPGA 3UQNA 5T9BG 1O1ZA 2G0WA 1R47A 1MZRA 4JTTA 2A3BA 1ZBCA 4GI9A 4QROA 2QCHA 2XVKA 3SCNA 3ONBA 5LNUA 5BW6A 5TNVA 3AYRA 3RMJA 1RPKA 2QUUA 2A6LA 3SUSA 1NF7A 4DJEA 4YMZA 2BDQA 4DUVA 2D73A 4B5TA 2V38A 3CTTA 1ZJIA 4PUDA 4HGXA 4ALDA 2WMFA 1PHWA 3IRSA 3UPMA 1MI3A 3CM4A 4C5ZA 2I5GA 4OWGA 4U31A 1PKLA 3ABSA 4ONVA 3T0CA 3WCZA 3H23A 4AEOA 3OA5A 4GKLA 3EMCA 5HAOA 4XO7A 1PWLA 2BVYA 1GPFA 4NRSA 3A5FA 3KZPA 2ZA2A 3JRKA 3S9YA 1HTIA 1HJVA 1XLDA 4KMQA 4Q8WA 2Y0FA 2PP3A 2NX9A 3WQPA 2DGAA 2VI0A 1B2YA 1FWGC 1DTNA 4WQ6A 4O1EA 3WNPA 3ZSSA 9RUBA 1QBAA 2V68A 5I3DA 2OX4A 4A8IA 5DCEA 4BQ2A 4H7VA 2DUXA 2PDJA 2PDKA 4M51A 3SJ3A 1PB0A 2QKFA 1B3WA 1R9ZA 1UA3A 2PF8A 1SMAA 3M1ZA 1XRTA 4G8TA 3N12A 2I7GA 2OO6A 5CG7A 5IFTA 3TZFA 3CUFA 3L4TA 4BFAA 5DN1A 1O68A 5AYYA 3NVTA 4LB4A 2PWUA 4BK9A 3DBNA 1GNXA 3II1A 3KFTA 4MZYA 2VCBA 2ZRVA 3TA6A 3PJTA 2G4JA 4N6FA 4L6DA 3GVQA 1W56A 1YDYA 1KWKA 3AZRA 4JOMA 3CLWA 5K4ZA 1TELA 1KM5A 2VC7A 2YIHA 3I6EA 4M6QA 4AC7C 2DIJA 3F4WA 3KWXA 1OF8A 2V69A 3ZWTA 1Z44A 3P6LA 3V1HA 4DLFA 2B7OA 2YSWA 4OE7A 3PB0A 1U83A 3GR4A 4C6PA 4F0MA 4QS5A 4UWMA 1FWEC 1W8SA 2WJZA 4JEJA 4B4HA 2E3ZA 3KDOA 1XH2A 1OADA 2VGGA 3CH9A 3GY1A 2GQ3A 4IUOA 1ZSXA 1JAEA 2A3EA 1K7FA 1JPDX 1HIZA 1X8FA 2VRKA 3BO9A 2NLYA 4O13A 4A21A 2OVLA 1UJPA 2QEZA 2V5CA 3GW3A 4J28A 4MWAD 4JFUA 2QCDA 3O2LA 5EB8A 4MF4A 1ELSA 3MO7A 5TF0A 5CSUA 1KFLA 3WFLA 4W9TA 2BXVA 3APTA 3T81A 3RLVA 3NEVA 2BASA 2R1PA 3JZEA 4TMCA 4AWTA 3HGSA 1JPMA 1DL3A 3UWQA 2CWXA 4GUFA 4LY8A 1NIUA 3SY8A 3TXZA 4Y9AA 3R79A 2OOFA 1EP3A 4WCJA 1RALA 3WQ5A 2ABAA 3ONCA 4OHQA 4E3TA 4HA0A 3GB6A 4GJIA 1G5AA 4Y6GA 1D9EA 3PFRA 2WCGA 2Y61A 3SRHA 4GUHA 5AZ1A 5HDRA 2WQPA 4AEFA 1UWQA 3ARSA 3EGJA 1MWOA 3URNA 3V3WA 1UQYA 2A1YA 4XD6A 2FPVA 3VOIA 4Z1CA 1HO1A 3TAKA 2Q71A 1DOSA 2DV0A 3GZAA 1I8JA 2WHLA 3R11A 1G1YA 1FH7A 1S39A 3LA4A 4MNMA 4XZWA 3WMCA 1CTNA 1NWTA 3ES7A 3GIPA 1Z89A 4NAFA 2WZIA 8CGTA 1EGVA 4F0SA 1TIMA 5A6LA 4DRSA 4X9SA 1EX1A 1WOBA 3FFSA 3CEUA 5F4SA 4H9XA 2D2OA 4IMGA 3D0CA 1UC4A 5AECA 3UNDA 3T0DA 2QAFA 3EWWA 3NQ2A 4WY0B 4DNHA 1P4CA 5AC6A 1OD8A 1OFRA 1H5YA 4ZEPA 2Y8KA 3I6RA 1WQ5A 4LXFA 3VKBA 3GBDA 2V5LA 2A21A 4C1NB 4Z2GA 1EB3A 4S3KA 4FK9A 4N7QA 3VI2A 2J7BA 3E12A 3LQGA 4AIEA 1M65A 3CO8A 3DFQA 3U7VA 3RJXA 1DXEA 3FN9A 3LSBA 4O1FA 2FHBA 4H04A 4J2MA 1E1EA 5I3HA 1J96A 1L6FA 2ZFAA 3PBWA 2WNWA 1QASA 5DBUA 3EMQA 1DWAM 1R3RA 4AXNA 1WKEA 4UTHA 4UMAA 1E4NA 1IR1A 5HMSA 2CKSA 2BV9A 2Y62A 5A6AA 3UJFA 3GNNA 4HYWA 1PCWA 1ONXA 1TX0A 1E5NA 3H54A 1UIOA 2NXIA 1IWBA 3PTQA 4GY0A 1DE5A 1WXZA 4J3SA 4OBSA 2EPOA 1OGSA 4C5YA 2XYLA 2Z00A 3CUXA 4KIRA 4RW5A 3PSVA 3RMEA 4UTTA 4FNRA 3LNMA 2QDHA 1ZRQA 2DW6A 3CHEA 3E0FA 4HJWA 4JFWA 3B8VA 2GJLA 1EHNA 4S38A 5FA5A 3EOUA 3AMLA 1EDGA 3UR5A 2P0IA 3SCQA 1FDZA 4AZCB 1H2JA 3AHTA 5BOOA 2RJGA 2ZUUA 5JH2A 1ZQ5A 3H2NA 4O1CA 3BSGA 2Y2WA 5HUOA 1JPKA 1A3XA 3Q94A 1DQXA 4P7OA 2QVNA 4I90A 2OLAA 2G41A 3GU2A 4Q32A 1Q65A 4PTDA 5FEPA 4QDPA 3RR4A 5A8NA 4GG9A 3UZZA 3UY8A 1SZNA 4O50A 3KOZA 1AW2A 3DG7A 3MTWA 3PG9A 3M5ZA 2QCMA 3UXAA 1HX0A 5LIWX 3ISIX 3KBVA 4AAJA 4XZMX 3EX6A 3HPFA 3M5XA 3FGCB 4AD5A 4QG6A 2Y8UA 4HMEA 1M53A 4YYFA 1KWGA 1F3TA 2OSYA 2XWEA 1CXKA 4DIAA 5IRPA 1XIFA 1W5MA 2QULA 2Z7GA 2FPYA 3QR0A 3T42A 1ZGDA 5FIPA 3ZFHA 2FGBA 3CZJA 3KRSA 3BAJA 2ZE3A 4R7JA 2WCAA 4AZ7A 3VC5A 3EPOA 2YX0A 3TFXA 1SZEA 4M6UA 2WPBA 1VCFA 3CXOA 5IXEA 3DGRA 2JKAA 3WBEA 1I75A 4PH6A 1XP3A 3CO4A 3WFAA 3BJSA 4ZOAA 2CPUA 3ZZ1A 4UOZA 1YBQA 2IQDA 3HURA 2X0HA 2CZVA 1DYSA 1D2KA 4MNJA 2FJKA 4LV4A 1R9YA 1J10A 3BH4A 4H9TA 3VOCA 3CZLA 3W82A 1F3WA 3DH7A 5EL1A 2CCRA 1E6QM 1EA0A 1LDCA 2VP8A 4JTAA 2E0PA 5ABGA 4LYKA 3ZSTA 1ZBKA 1J0KA 1MEIA 2FFCA 1VFSA 3SM0A 3SADA 5E1QA 4ZSTA 4D8AA 3W2UA 5D33A 1QJWA 3K13A 4R88A 3G3DA 4JQ2A 2CLEA 3CNYA 1Q5MA 4JKMA 3AJ7A 4UFKA 1OWQA 3BGAA 4W8AA 2AL2A 3UXLA 3T2OA 4ZE4A 4D1IA 4UTMA 2HBVA 2QIWA 5BZAA 1RD6A 3UF9A 5H8UA 3CV6A 3VZXA 4JNZA 1I2QA 2PA6A 5LNWA 4AIUA 3WY1A 1RJQA 4MWAC 1LOQA 3G5EA 3H4GA 1US2A 1XSJA 3KWSA 1Q63A 4BI5A 1A5SA 1JUKA 4KFOA 2DZAA 3QGVA 1I1XA 1E51A 5IOBA 3EOEA 4BQ5A 3NL2A 1TO3A 1BTCA 3WD3A 2H9AB 1Z7AA 3WNLA 4J2PA 4QXIA 5TAOA 5CSYA 3G8EA 1J11A 3H70A 1DQUA 4L4OA 1FCVA 1TREA 4FMVA 3FJLA 4V27A 1A5KC 5HMDA 2FZMA 4RV8A 3W7NA 3KUMA 4GACA 4JYDA 1V4YA 3G1FA 2HVNA 5GVJA 4MY9A 4C6EA 3H8AA 1P1XA 4GQBA 4B2DA 3W7CA 1F7BA 3PP7A 1UHVA 1I1WA 1VFMA 2QPUA 3PZOA 3LM3A 2ZUMA 3AIQA 2J47A 4NJJA 3BJFA 2D1ZA 4WD0A 4NHVA 1AJ2A 4LC8A 3EKLA 3N2MA 4E0CA 4UQEA 4UTJA 1R8LA 3L2IA 4Y2WA 3CQIA 1XDLA 5C70A 3F5JA 1XW8A 3RCNA 1ODUA 3R13A 3PJUA 1JRCA 1OK6A 4GINA 4YXGA 4Q4OA 4H9YA 1EPXA 1OB0A 2C16A 1T6MA 3PJWA 5KZMA 4LEQA 2Q02A 5XIAA 3SW6A 1MMFA 3T4WA 5REQA 4UTFA 3K2GA 4CU8A 3QV9A 5KINA 1GVEA 3VIKA 4GNJA 5J04A 3KEHA 4HOXA 3VKKA 3G18A 3NXFA 4PBGA 5XINA 1FH9A 1CECA 3EXRA 4IGHA 4GNVA 4IGSA 4DUOA 3OIXA 3UR2A 3C0JA 3QBUA 4O19A 3THUA 5A2CA 2HMCA 4TQTA 4RXGA 3SCSA 4ZQRA 5A95A 4QRNA 4G7FA 4RZ5A 3VDGA 3W29A 4MYXA 5EMJA 4IT1A 3M0HA 3B8WA 3LXCA 4Y9OA 1BRLB 4HPHA 3IJ6A 2PDBA 4WJ8A 1R2RA 1JZ5A 3CMFA 5F1UA 1CW2A 1TTJA 2GSEA 3M44A 4LVDA 1YPXA 4LH8A 4ICCX 3W6LA 3G77A 3L2LA 2Z1BA 4FR1A 4GJ1A 4UTWC 4QGCA 2YDAA 3UA4A 1XXXA 2ZOXA 5FJTA 5D03A 3I65A 4Q4SA 1VCGA 3R8RA 3VILA 3KRBA 1A5NC 3EXTA 3PWAA 3TLQA 1OYCA 1VHNA 5C9UA 1SW7A 5I06A 3UY7A 4QEHA 1EJVC 2REQA 1L6WA 2GJNA 3PB2A 1G9HA 1UROA 4GZJA 3RRAA 4NYUA 3WIJA 2VR4A 2GVJA 3HMCA 2EPKX 5KSWA 2FKPA 1TPDA 1C90A 1RY0A 1ZHAA 1P0KA 1PS9A 4XK2A 2ZRUA 4C1LA 2UBPC 3CMJA 4OUEA 3B9OA 3W1UA 4WUIA 1JF5A 1UKOA 4JCLA 3LRKA 4NNCA 3LYEA 1OYBA 3OHIA 3HO8A 1LWJA 4LAZA 4JFTA 5FJUA 4KCWA 3AUJA 1A5UA 3PUGA 2X40A 3AMDA 3MB9A 3WQOA 2OB3A 3AS2A 3G6MA 3NO5A 4MKNA 1XRFA 4JN6A 3VNMA 2ALDA 1OY0A 4UBPC 2HE8A 3LXAA 5G4WA 1TV2A 1KBBA 1G0CA 1GOXA 2POZA 2QCEA 1QW7A 1R9XA 4ATDA 4CKQA 4DXVA 2HE5A 1YXYA 2HK1A 3NDZA 4DO4A 3C2EA 1NOUA 2XSBA 1OFOA 1OBAA 1W8GA 3AHZA 1OIFA 4UUIA 3W72A 3L21A 3WLJA 3GQYA 5HA7A 2DSZA 2G50A 4AY7A 4J3UA 4H7ZA 3I10A 4DJDD 5HULA 1WKYA 2WYSA 4M5PA 2OJPA 1EYEA 1XC4A 2PAJA 1L2UA 2O55A 1BF6A 3C0SA 5LIXX 3UWEA 1UKQA 1J18A 1KFJA 4MLRA 1HJXA 1ZAIA 1JUEA 3S1VA 1TTPA 4CD6A 4GPNA 2YL5A 4CN6A 3ZJ7A 1XICA 4Q6XA 4TV6A 3M7SA 2QJIA 3WBXA 4B5XA 4LGXA 1C8QA 3B0XA 5A5WA 4EF9A 4O57A 1MUMA 1VEOA 4Y90A 3QRHA 1UR1A 1FWIC 3L0NA 2CBJA 4YTSA 1BG9A 4LYQA 5U4NA 4C6FA 2P0OA 3DKLA 1SFTA 2VGIA 4IOTA 4WSJA 1LP6A 3WJWA 1TX2A 2RDTA 3IJIA 3IK4A 3TU9A 5A6BD 5C54A 4S23A 5EMLA 3NOYA 4HTYA 1KV5A 4KEUA 1QPKA 3UEQA 2CBVA 4JY9A 1K3UA 3SQSA 3TSDA 3WDPP 3GXTA 4QISA 3QPEA 1CGYA 4Z2HA 1I2NA 1YLVA 1V02E 4C6JA 2J4GA 1VYPX 1F07A 4HYRA 2D23A 1QO5A 3RJYA 3KCOA 5BU9A 1XD0A 5K7JA 3DX5A 4LANA 4PUMA 3LPPA 4WY0F 1ZAHA 1UCWA 1ZPTA 3P3BA 1IHIA 2VC9A 3UR8A 1SJBA 1QK2A 1TVPA 2Y8VA 1W9UA 4DZHA 1EUAA 1DIDA 1XPYA 3STPA 3DN5A 1SQ7A 3AXIA 3OW1A 4H3DA 3WF2A 1KW1A 2VZOA 2GSHA 4DF0A 1H50A 3KRUA 4DWSA 1KCXA 1H1ZA 4JQAA 3VGBA 3GC4A 1PSCA 3K8LA 3U2ZA 1Q66A 1MNSA 1TPUA 5AYBA 1IQ8A 1CGXA 1IEWA 1RCQA 3LDVA 4C7DA 2NW0A 4CD5A 3EA1A 1VP5A 5J5DA 3GXDA 1V79A 3BANA 3DFOA 4S2BA 3LGDA 1WO2A 2VO5A 1WDWA 3EX2A 3GDKA 3HOJA 3UGVA 4RL3A 3U9IA 2RH9A 1J2BA 1NVMA 2DZPA 3R2GA 3GHTA 4PB4A 3PZVA 3TONA 1K70A 1VFOA 1VPXA 4GGHA 1VJIA 3CC1A 1VYRA 3LXBA 4E38A 2TSYA 3SDOA 5FF2A 3W2LA 2GVEA 3VIGA 4HYVA 1LG1A 2FLIA 5EMMA 2XFRA 1UPMB 3UJRA 2VDGA 5DXYA 4OZOA 2AKMA 2Z1KA 3N2XA 4RV3A 3L4UA 4KS0A 4H4IA 3QYQA 2DT1A 2VKZG 1PYMA 3RCMA 4GYPC 2XVNA 1MQRA 2VJXA 2ZRXA 3TC7A 4O4WA 3RG6A 1B54A 4B3ZA 4JAWA 1KLYA 1ZCCA 3EWCA 1ECQA 1TZ9A 4Z0JA 3K1DA 1GJWA 1XKYA 3QV7A 4ZGYA 3DHPA 1IEQA 1WA3A 3G1RA 3Q67A 3HGRA 3UWVA 4B3LA 3UWZA 1XIGA 3IVTA 3ZO9A 4CNUA 1UZHA 5I02A 4JX6A 1TMHA 1RBOB 2FZ8A 3CUJA 3W25A 1M7OA 2V9DA 2OSWA 4W7UA 3W7LA 3FCPA 5C2CA 4G1NA 1C3FA 1TYGA 1W3IA 1CNVA 4TIMA 3S42A 3ABRA 3MVTA 3QOKA 2GDUA 3GM8A 5IFPA 2UWFA 1H4PA 3HU7A 4XKMA 1VC4A 4BR1A 2Y7FA 2PDPA 5E0CA 1RP9A 3NVDA 5AHEA 2Q8LA 2WMGA 3SGGA 2XIJA 2C15A 3ZM8A 4QR6A 1M7XA 3RYSA 1QDSA 4DO7A 3R89A 4FPSA 1CZ1A 3XINA 3G1AA 4H6QA 3PTDA 2C0HA 3VKJA 3W26A 1DP0A 1Q6LA 4XUGA 3U8GA 1MW0A 5IM51 4GZIA 4X0NA 3E0LA 3KBSA 1EQCA 1R3VA 1WAUA 2VR5A 2GL5A 4AZHA 1HP5A 3VDCA 1CB2A 4HOZA 2D24A 3VYLA 3MSYA 1A0CA 4K39A 1DIOA 3CAWA 1GWJA 3THQA 4R27A 1DJZA 5DRIA 3GKFA 1S5NA 1OHLA 1P0NA 5I3KA 4C1NA 3NO3A 1K77A 2WZHA 4V1XA 1Q13A 2VCCA 3LEPA 1WZAA 2PZ0A 3VGDA 5PTDA 4YL2A 3W28A 3FNDA 1Z48A 2V81A 4DAFA 3B3DA 4K1GA 2G3JA 3TW9A 1CXIA 4GIEA 2WVVB 1UH2A 5DMMA 3I3BA 2NWSA 2WCSA 2WVUA 3EB3A 3QHOA 2YYTA 2HK0A 4DJDC 4H8NA 3S5OA 1KBIA 2VFDA 1I2OA 1X1OA 4ZB5A 3VGFA 3TYAA 4K8HA 3IUIA 1NP2A 4OECA 7ODCA 3WH9A 3BUVA 4CQ9A 1XFBA 1FVPA 1EXPA 2VENA 2VZUA 1QAPA 3HPAA 2F6UA 3UJ2A 2I17A 3CYVA 5CZTA 3AIUA 2QGYA 5CZJA 4ADTA 5HQLA 2O7SA 4D8LA 1VRXA 2E68A 1ITUA 2Y1HA 5KEZA 4CN4A 1PTGA 3WG6A 3DG6A 3EA2A 3MS8A 1UP3A 3D3AA 5FESA 4AZCA 1TJ1A 4V1YA 1G69A 3NQCA 3SUVA 4D71A 3E96A 4PB5A 3NPVA 2Y6ZA 5CPSA 3W1NA 4X60A 3QSRA 7A3HA 3C61A 3TNBA 3VABA 3E2SA 3LCIA 1WNOA 9XIMA 2ZUVA 3RX3A 1V77A 1QT1A 2A3CA 4C6KA 5HNNA 1K6AA 4OQVA 4Y9NA 2X7WA 3DIPA 3PANA 1TJ0A 1GOOA 1OM0A 1T7LA 2DZWA 3RLHA 4JTHA 1J2WA 3EOSA 1QI2A 4JTSA 3RF9A 4CU7A 4D6IA 3C0LA 1K6WA 1PX4A 3E9AA 3IGHX 3W83A 3NSNA 2OYLA 5JMUA 3EDKA 3OTRA 3GVVA 1KGWA 4I7WA 3R8HA 1BYCA 3OLEA 3GFYA 1KR1A 3LZ3A 1NFBA 3FEMA 4O1DA 2J27A 2W61A 4FF7A 4Z2KA 3OZYA 1J01A 2GJXB 4ZOCA 4XWUA 5IBXC 1QNVA 4K8EA 3MJYA 1XLJA 2PCQA 3ARQA 3W85A 1OC5A 4ZCWA 4AUBA 4O28A 3MP4A 1Q4WA 4LNCA 3HGJA 3W3OA 3DKJA 2F6KA 2BGSA 1XUUA 2CZEA 4KF1A 1ECEA 5HNUA 4AF0B 5E0FA 2WVTA 1UMLA 3OLGA 1P0DA 4M7TA 4R7WA 3EWDA 3PUEA 3WUBA 3CGTA 2GQ8A 3WBAA 3FS2A 3JZUA 2ACUA 4ATLA 1DJYA 4HSNA 1EC9A 5ABFA 1XG4A 1OD0A 2FDSA 2ONEA 1UG6A 3DDMA 5I24A 4JIHA 3IIVA 1NH6A 4EPBC 4LQ1A 1KA9F 2ICSA 3QQ1A 2ZC8A 4S3DA 4HSHA 2J62A 1AA1B 3LHWA 3U57A 2W79A 1GG0A 1DJWA 4PRRA 4DZIA 1S3HA 1GQKA 3TIMA 2W92A 3BW3A 1GCYA 3TTEA 1FHDA 1V6UA 4BWLC 4BQ3A 1JDFA 1Q6FA 4LRTA 1LWIA 4H6KA 4B5WA 4PEKA 1IT8A 4LS1A 2HPIA 1DJIA 4GVGA 2PTXA 3CYJA 3KOYA 3PWIA 2ZTJA 4DYEA 3M6YA 4K2SA 1NDWA 2F9RA 3TNOA 3WJYA 1OX4B 4PMVA 3D6NA 5AYIA 4Z1DA 1VS1A 3W1LA 1YQ2A 4QQ3A 3O7UA 4UMBA 3WD1A 4AX6A 3N4EA 3MDUA 5HXMA 3ARZA 1U5VA 3N6QA 4FNQA 4KRZA 3MBFA 1H11A 4C6DA 2QUTA 2NVCA 1NQKA 1W3NA 1M9HA 1K4HA 1P1MA 4HHHA 4GE8A 2XN1A 4L6OA 3SAZA 4PL2A 5HNRA 3W2KA 2WANA 4JR5A 1I45A 5L6UA 4CGTA 2DJLA 5ENLA 5BCAA 1RA0A 1G4SA 5KTLA 2NLIA 2QV5A 3PK7A 1WZMA 2D2HA 3EB4A 4M80A 5FAGA 5I7GA 2XHYA 4OGZA 4DX3A 2BLEA 2IPJA 5DY2A 4CLMA 4PTNA 2J7DA 3Q65A 3LTYA 2PGFA 3VKAA 5HR6A 3GDLA 2VHLA 3CPGA 3E38A 2BSLA 1E9YB 1V08A 3AYTA 3GTFA 5E5CA 3CB3A 5CQ1A 4LYRA 1IEXA 3ZVIA 3MUZ1 4FOUA 2G95A 3BAXA 3LTPA 4NXKA 3NURA 1DHKA 5CGMA 2Z7KA 3HBLA 3I3EA 4LUSA 3LY0A 2ZX7A 4AXKA 1EFZA 1D3HA 2A79A 1HVXA 2FDMA 1V3MA 3C2OA 4Q22A 3E5PA 2I9UA 4FXRA 5GNYA 4AEEA 1SPQA 1F9CA 4N9BA 3FKKA 4GIYA 3E2VA 2Y63A 4K38A 2VD8A 5AHLA 2IKIA 3TA9A 3SRFA 3BV7A 2JGQA 4QQUA 3DXIA 2FHFA 1BRLA 2WKJA 3AMCA 3WDRA 4IMCA 5AVNA 2EG7A 5ECUA 1VYSX 2JFEX 4G6CA 5I3IA 2GK1B 3A4XA 3T05A 1OSEA 2WSRA 1H1NA 3SCTA 4KGJA 4PMOA 1F76A 1F2JA 3ITLA 4PTWA 1EBGA 1GOMA 3WH7A 5CEWA 3CZ8A 4QHRA 2VURA 3H2CA 3PN8A 4H00A 1ZLPA 4S3CA 4DEFA 1DPMA 2J75A 4XD4A 1QUMA 4FB7A 1SO3A 2VFEA 4DO5A 3CZGA 5T91A 1GQNA 5AFDA 5AN7A 2JE8A 4R53A 4JL2A 1TB3A 4HB7A 3BV4A 2CZFA 2AAMA 4WRHA 3TAOA 1YXCA 1QPQA 3LBCA 4RPQA 4IFRA 1E5JA 3ARYA 1XUZA 2PMQA 5IHSA 2X1SA 4INFA 5BOFA 2OKTA 2BZNA 4GISA 4HU4A 1Z6KA 2QF8A 4P8XA 3IAQA 1F6YA 2CETA 3DERA 4J3TA 4CNSA 1RK6A 4A8NA 1K8CA 2QPXA 1CBGA 4WGXA 4L5ZA 1V6YA 4QDWA 3A3WA 4G7EA 3B0PA 3LCWA 1EDTA 3GXMA 3HMJG 4UTUA 3QMSA 4FAMA 4UNIA 2HCVA 4H7CA 4HIBA 1V0LA 4U4MA 4ZQCA 3C5QA 5C7HA 3F7JA 1W5NA 3BTNA 4L4PA 2IPGA 1LBFA 1TR9A 3FSTA 2ASHA 4W88A 2FTPA 2BBFA 3G0SA 1M6JA 1WE5A 4R33A 4FX8A 3QQ0A 1KRCC 2YZRA 1KXQA 5LHEA 4XBJA 4GHRA 3WLRA 3W7PA 4US5A 2AKZA 3P14A 1C91A 3HF3A 1W1A1 3W7DA 5FF7A 4I7VA 5DT7A 4MGGA 4XQ6A 4Z0SA 4B91A 4ZSUA 1PX3A 3W73A 2V3FA 4MY8A 1K1DA 5TQLA 2Q3OA 4W84A 4EP8C 5BOEA 3RK8A 3VE7A 4B4FA 3TTSA 3CT7A 3PS7A 1CI1A 3A4AA 2QHAA 3KLLA 1ICSA 4Q8UA 1GYLA 4TR9A 4B9ZA 3A3XA 4NYYA 1LUCB 3O9NA 2G4FA 9CGTA 3S47A 3ZMRA 2NZLA 2PPGA 4RCXA 1E4LA 3L7RA 1DWFM 1RLDA 3UR7A 2W27A 1UC5A 3W1PA 1W1TA 2WW5A 3MJMA 2W67A 4O53A 2VFGA 3CHFA 2GJPA 1QWKA 3PZUA 2TRSA 2CW6A 2WC4A 3P5ZA 4JPGA 2BODX 2GGEA 2ALRA 1IXPA 3LTSA 4F79A 3MT1A 4ZTYA 4K1WA 2Q01A 1XM3A 4AX7A 1G4EA 5C9XA 4DWDA 5I78A 5CBIA 1MUWA 3PAJA 1ZJHA 1PDZA 1H5VA 1TTQA 3E3HA 2NUYA 4EPEC 2INEA 1S5TA 2C1HA 1CXHA 3M9YA 4KWVA 4CN1A 1CT5A 4BA0A 5LGXA 2RFGA 1LYXA 2FJUB 1UYQA 1S2VA 2FH8A 2OSXA 2CXEA 3C8NA 5CPQA 3VXGA 2J8FA 3LHZA 2KAUC 4H9MA 2DQXA 4DYJA 3QY6A 3FIGA 3RO6A 2HTMA 3OG3A 2ATMA 2PP1A 4XAFA 1KNWA 4AD3A 2I16A 4UNLA 4OU1A 5XIMA 4QJ5B 4KCUA 1U22A 3UCQA 6PTDA 4YWIA 3K46A 3QLLA 3O1NA 3H4XA 3LRLA 1FWBC 3SGUA 1LRQA 4NZ3A 1PIGA 2AQWA 1X38A 3GDRA 4HCHA 1TIWA 2E25A 2OLHA 3W01A 2X8RA 3BQ6A 1W91A 4IQEA 3M5VA 4JYEA 3MUIA 4S3GA 1R7AA 3OBEA 5C71A 1NDYA 3B8DA 4Q8PA 4ENLA 2X05A 3T07A 3FOKA 4MADA 4UR7A 3TCEA 1GJUA 2PDNA 3VD5A 1V5XA 4UOQA 1PBGA 4GVHA 1LQ2A 1UH3A 3U5YA 3KBNA 3IIZA 2PI6A 5GQBA 2NUXA 3WH8A 3V35A 3BWWA 3C2FA 4L9YA 2V5JA 2WM1A 4WVXA 8RUCA 3N19B 5BMXA 3MMDA 5EY5A 3S6OA 1RXOB 1R2SA 3S3GA 5HATA 3VMOA 2XU2A 4B90A 3R0KA 4RE0A 3BLDA 2YBTA 4AWSA 3MZ2A 1PAMA 1O7AA 5ECVA 3DHFA 3M0VA 4MWAA 4AB4A 4I6VA 4RR4A 4JGDA 1EGZA 1XBZA 3NGJA 1EEXA 1VBGA 5DO8A 1GVRA 2PDFA 4DBDA 3S2CA 7CGTA 3E49A 1A5LC 1OYAA 4HTBA 3E02A 1OT1A 5T8GA 3N04A 1UB3A 3NIYA 2ZX6A 1V7AA 5ABTA 5BRQA 4W5ZA 1P0BA 3CUIA 2CLMA 3G1VA 4UOJA 2ISFA 4JIEA 1KBKA 1A5BA 1I2RA 2PBGA 3EKZA 2PRLA 1G4PA 2IPFA 5B80A 4PUKA 2JALA 2XM1A 2FQIA 1MFVA 1IIGA 1WX0A 2ISDA 3VNIA 1YEYA 2Q3RA 2ZVRA 5BXPA 4E4PA 3N1AA 4Q8TA 3GYCA 2DU2A 3NO1A 3HFTA 3CJPA 3WMLA 3W7MA 1WUEA 4L1WA 3HA1A 2VNCA 2WHMA 3R7MA 4AD1A 1IE7C 5EGRA 3QQWA 3AWOA 4O1AA 5FJPA 2HS6A 3URAA 3V16A 2AQVA 4PCFA 4EWJA 1J0ZA 1VFHA 1TTIA 2HNEA 4C65A 4QNEA 5JH1A 4S3JA 4NY2A 4UR8A 4MAZA 4XAZA 4Q7BA 4NAFB 4EKJA 1OABA 5G4EA 3CUZA 1PIFA 1FWTA 3AOFA 1JL8A 4YYCA 3MSDA 2FHCA 1BSIA 3LENA 1W9PA 4YCOA 3N3TA 1W37A 4Q4KA 3CQKA 4DBWA 2VGBA 4IZGA 4W5UA 3SQLA 3NEHA 1YTEA 3WLLA 2O9PA 3K8MA 4ZO7A 1MRQA 4Z1BA 3GD6A 3N29A 1E73M 1XYZA 2WJDA 3OVPA 3PFMA 2J7CA 2DW7A 1N82A 1X8CA 1VFFA 1HUVA 3TFCA 3MYPA 3RRXA 5HNTA 2QGHA 1K9DA 4HHPA 3AHXA 4NX5A 3KBWA 4KCTA 4BF5A 3ARTA 2QIIA 2ATSA 1HZYA 5E70A 3ZWSA 3MHGA 3AUOA 1H0GA 4IJBA 3LU2A 5CSSA 2QJNA 1ME7A 1TV3A 1MW2A 3MUXA 1N8IA 3SY5A 2CITA 5DFAA 3R10A 4OJYA 4ASTA 2ZVIA 1FXQA 4HPXA 1UKPA 1M1BA 3VM7A 2E67A 4A22A 5G2HA 3MCOA 1C9WA 3EWUA 1S2TA 5JUVA 2BS9A 3ITCA 4LB3A 4YPJA 2J13A 1J12A 4EAYA 3MO4A 3SJNA 3WF1A 2G37A 3NNTA 4IM4A 4A3QA 5D30A 2G3FA 1JUBA 2XH0A 3F2DA 1NTHA 5FJJA 2E5CA 1XLCA 2AQOA 2V63A 4HBKA 3ZXWA 4D72A 1XD1A 1ONWA 4HZ8A 3L5MA 4MPKA 3WLSA 1T96A 1JULA 4YIWA 1FWWA 1THFD 2XIQA 3N6JA 1YNPA 2HDJA 1ZZMA 4L80A 2NV1A 3CMGA 4GH3A 2Y89A 3I7SA 1JZ3A 4AFYA 2X1RA 1FKWA 4ZENA 2PBOA 9XIAA 3IVSA 4YVVA 4UC5A 4NVTA 2NV9A 5D09A 4JHZA 1U1JA 1CDGA 2A3HA 4Q4QA 2RUSA 2OKOA 2ABBA 3WLTA 1REQA 2J9YA 1ZBWA 3RILA 3WZ0E 2PWHA 4GMEA 1HL2A 1EJWC 5DMLA 3PC0A 2YPIA 2Y85A 1FY6A 3OYXA 4XAPA 3ZR4A 3OU8A 4NSBA 1BSLA 4WR3A 1HNYA 1U2YA 4EIVA 4ZMGA 4DI8A 5GJMA 1KM3A 4V28A 4CNTA 1VIZA 5A1AA 4JNYA 1GUVA 1ME9A 3VOJA 3GC2A 1TPWA 3PSWA 3NQ7A 1NOWA 1DXFA 4IL0A 5FJIA 3SGZA 3APGA 3ITVA 3P74A 2VYOA 1FWAC 4H8HA 1SYTA 4Q4PA 3TQPA 1AH4A 3KHJA 5EBAA 5H6HA 2D20A 1FH8A 1UBSA 2E09A 4JCMA 2RKXA 4GI6A 1GVOA 4Y9MA 3UXDA 2WWDA 4HMCA 5D8WA 1C8XA 2EPMX 2PP0A 3ALFA 2A7PA 3TC6A 3DI0A 2MUCA 2CFFA 1E9LA 3KXQA 2V2CA 3EYPA 1VIWA 3DEQA 5KZ6A 3TE9A 1QR7A 3F5KA 1YBQB 3I68A 4QSHA 1UKTA 2OO0A 3NM3A 2OZTA 3QW4B 3PZMA 3VD7A 4L4LA 1AG1O 2NVAA 3KBJA 1YYAA 2PDIA 1D7KA 2OPJA 1EO5A 3RGTA 2VX6A 3THAA 2R1MA 3UT0A 3HB9A 1OX4A 1TPH1 1W17A 5LZLA 3C3UA 1O5KA 3AZSA 3CL8A 1TUFA 1AL8A 4FNTA 3W23A 5HJYA 3RX4A 5B7ZA 3EOOA 2CHNA 1TG7A 1WBHA 1OX6A 5AHMA 3S5SA 1UBPC 4HA1A 3RO8A 1QATA 3UCDA 1G94A 2AL2B 1F3XA 4D6CA 4M6PA 4MAVA 1HF6A 3CPUA 4YHEA 2BY3A 2GGJA 2E40A 4NRRA 3M07A 2VR2A 3UZJA 3MCMA 4BF7A 3VIFA 2CXGA 4RNHA 1NQ6A 4GFSA 3WK2A 2BMBA 2YCIX 2ISSA 3TQ0A 5HANA 2JGYA 2HJPA 3ITXA 4WXZA 2WWCA 2C1IA 3CB8A 3PM6A 1FWDC 2WBKA 5CGTA 5I79A 2JKEA 1ZBVA 3AISA 5SWUA 4RLIA 3S9ZA 4YTTA 2B7QA 4HNOA 4ZR8A 1GK8A 5D02A 3FW6A 4YTRA 1Q4NX 3WMSA 2PTZA 3LM7A 1O12A 1W9BM 3AIWA 3V4BA 4ICMA 2W4XA 1LRNA 4IX0A 3EAUA 1OCQA 3GSMA 3RLUA 2EGZA 4ADSA 4Q7IA 2PWEA 1OIMA 2Z4GA 3QTGA 3VNZA 2DVTA 2WPGA 3HM7A 4GCXA 3A24A 1R86A 4M1RA 4PCSA 1AJZA 1MDRA 4D6JA 3E0IA 1OK4A 4AY1A 1GZ1A 3L65A 2HXUA 5BXSA 1BFNA 4QX4A 3M0KA 4NQ1A 1A5CA 4XD3A 2WAGA 4H9UA 1YTKA 2AMXA 4IIEA 4O8AA 3T40A 1GW9A 4Z2JA 1GVSA 3N13A 2HNHA 1B90A 2DH2A 1PDYA 2IKGA 4HK6A 1E0VA 3NCOA 2I5IA 3CBWA 3MANA 1YNQA 4PB3A 4GYPA 2WJFA 2YOCA 2DUZA 1KM4A 3F4DA 5REQB 4RDWA 4HSOA 2WK2A 2W62A 1XLHA 1KFWA 3BMWA 1UR3M 1VGAA 4RZ6A 1JXKA 3GAKA 2EPHA 3A9IA 4HZ6A 1JCXA 4OFCA 3D3FA 1EOMA 2PLKA 3IIPA 3O6DA 3PTMA 3QR3A 4L64A 4I9AA 3ABOA 5D4YA 3GS6A 3T2QA 5D8ZA 4JFSA 3NYZA 4QAIA 3SCWA 3EWBX 5E93A 5A69A 3U6WA 3AS1A 3UG5A 1A50A 4HA4A 1LLOA 4FLSA 3BICA 2BNJA 4PMYA 1JR1A 1EX5A 4X22A 2O4MA 4LYPA 3C0QA 4Q8MA 3KCJA 1XRVA 3SCVA 4GUIA 3IGUA 1K8XA 3S9IA 3P5YA 3GIQA 1VCVA 1XSKA 3B9NA 3GXNA 4XAGA 2ON3A 1SR0A 4U2YA 1GVYA 3USBA 2NV2A 1JZ4A 2D3LA 4MB4A 3CHVA 1AUSL 2PGRA 1WXJA 4QJ1A 6A3HA 2PDUA 5LKYA 1A0DA 4TXEA 2WHKA 5DELA 4LTSA 5T9CE 2PFHA 2E5BA 1F8IA 4A8RA 2REQB 1JGMA 1RA5A 4LUJA 3IK2A 4QCFA 4KWUA 1DVJA 3MYOA 1SO4A 2W91A 5K9CA 4Z42C 3FA5A 3NA8A 3QMTA 1DTUA 3V1PA 4U3AA 1P48A 4KWOA 3M5YA 4OIFA 5CBBA 1Y5WA 4DZ5A 1KQZA 1Q2RA 4QITA 2WM0A 2TPSA 2E6FA 3PULA 3RNDA 4G56A 4S39A 2INZA 4X61A 1XWYA 2P3EA 3PBUA 2CHOA 3PWGA 2YCLA 4FXJA 4BQ4A 5AZ0A 3OZPA 4N9EA 2ZQ0A 1NELA 3WK3A 4S2CA 1QOQA 1XYBA 4ZO8A 1EUNA 1JYWA 3REQA 2UY5A 4WF7A 4JTQA 3SN1A 1JCLA 1NJJA 1IEVA 2BG5A 2NT0A 1W1VA 2BOGX 4IPNB 1TWIA 2E6YA 3D5HA 5RUBA 1Q3NA 3EWXA 5I77A 2BVTA 4XUYA 5M1TA 5DRCA 3B9DA 1SU5A 3LCFA 3HJEA 2VOMA 2VVNA 1XDJA 3WL0A 4URIA 1G67A 1US3A 4DJDA 3IARA 4EF8A 1XGDA 2EKCA 3H7RA 3N15A 1V0KA 3WFZA 1YXDA 2EXOA 5MHBA 4P7RA 1Q6RA 1XI3A 1K02A 3AYSA 2CIPA 2YXXA 3TYEA 5D05A 1MW1A 1SFLA 3E1F1 1PZ3A 4CD8A 1BXBA 1DQWA 4E4FA 3ZJKA 3W74A 3GWQA 1D7FA 4MDOA 1E3XA 3NZGA 4GVIA 4HCDA 4FOJA 3HG2A 3L0KA 3LMYA 3KS6A 2HSAA 3H22A 3WQCA 2WMHA 1HKVA 4LUTA 3C2VA 1ZB5A 2IS7A 1K9EA 3NQFA 3KP1A 3LMZA 3JS3A 1KB3A 1B3ZA 1MNZA 3S0CA 1HKKA 4TMBA 2BVDA 4PULA 2XSXA 5A6BA 2BHYA 2OEKA 2PTDA 1P43A 3WKZA 1A4LA 1X96A 5KETA 1B30A 3CT2A 2ZICA 2IUZA 4LBRA 1P7TA 3KOFA 1OVDA 3MPGA 4ERGA 1GKPA 3UU0A 5HQMA 3TOYA 3SO7A 4WOZA 3J7HA 4DI9A 4G5DA 2LLEA 4MKVA 3UZYA 1H49A 3W70A 3OZMA 4IGNA 4UFLA 1HL9A 1SUXA 1PV8A 2GJRA 4IIBA 1RVKA 3UXKA 4C6IA 3UA3A 1X1NA 1GYMA 4MM1A 3MP3A 3BMVA 3KL5A 1E0WA 2RAGA 2PRHA 4MJZA 3TYCA 3K4WA 3TR2A 3DCPA 3KOXA 4H6EA 4N9CA 4B92A 3C3NA 4LAOA 4JTCA 1HJSA 3MDWA 4RK8A 2YL8A 4NU7A 2E7FA 5IBXA 1F6PA 3GBEA 3M46A 1JAKA 1KQYA 4H01A 3PY2A 2OTDA 2J9XA 5FF3A 4XSLA 4DWSB 5CJNA 2X16A 4LRSA 5CPLA 1Y7VA 5KMYA 1TV5A 3FA3A 3VKCA 5AC7A 4EXAA 3NFUA 2WOQA 2OEJA 3RITA 3TLLA 4BI6A 1UMYA 3W71A 2PE4A 1TR1A 1ZNNA 1S5MA 2YBVA 4AH7A 1PJ9A 4WX2A 1XYLA 3SCPA 3B4YA 5DEZA 4HPGA 4HNNA 3PHAA 3DHDA 3TYUA 1UZ1A 3BSHA 3O6CA 4KW2A 4IIHA 3WYZA 1GJPA 4IQDA 2ODOA 3E74A 4UCGA 2OFJA 4O52A 1D3CA 1UD2A 5EMYA 3WK1A 3EBVA 4I6KA 3F2CA 4HK5A 3BOFA 3LD5A 1ZTVA 1X97A 2GQAA 1JIBA 4PMRA 4QAWA 2DZTA 4NP7A 3S6DA 3CK5A 1BVNP 1Y0EA 3BQ5A 1G7VA 2PSNA 1TQXA 2V5KA 5CJ5A 4BWLA 1T8QA 3OGVA 4RE3A 3LV6A 5FD0A 3MSRA 3A23A 3NL5A 3N18A 1ME8A 1WV2A 1E72M 1W31A 3VD3A 1QI3A 5EFDA 4RJEA 2WNZA 2J74A 3W86A 4GY1A 5EU9A 3QJAA 5JBDA 1QK0A 2FZNA 1V93A 3NSMA 1GONA 4J40A 3FA4A 1QI4A 2PD5A 4TUFA 1GT8A 3HFYA 2Q6ZA 3MBDA 1FX6A 2G3NA 3DOPA 4AVNA 4KFPA 4GYJA 2PU0A 3W7JA 1W3JA 5CBJA 1T0OA 3CIVA 1IT7A 3UZXA 4LUYA 4W86A 2PGEA 4GQGA 4FF5A 3UESA 4OT7A 3V5FA 1EJSC 5CAHA 2A5HA 3ERPA 3ARPA 2E6DA 2Z29A 3BG9A 4FX7A 1WKDA 4ZQMA 2NQLA 3OBKA 5E9XA 4RDZA 2VRQA 2EAWA 1PHQA 4I5UA 4E2OA 3NTYA 3F1QA 3A13A 1C29A 3KZSA 1UJQA 3C4UA 3KE0A 1O60A 1LORA 4WZHA 2Z1VA 3UBPC 1M68A 1UOZA 1MQQA 1RLCL 4IFKA 3C2YA 1R3QA 3QH2A 3P0WA 4RPPA 5D04C 1EJTC 4Z2IA 2OYMA 1B3XA 1PO9A 3V0SA 1Y65A 3OBAA 2F38A 2WMKA 2MANA 3A22A 3QV8A 3B8SA 3R25A 4IXXA 5C0QA 3MKKA 3W00A 1YW1A 1RD5A 1XYMA 1X98A 1M03A 2FMOA 4QP0A 2Y70A 3ANYA 3UG4A 2C18A 1J8VA 1R6WA 3INPA 1ALDA 3CASA 2V8ZA 3G8RA 1EJXC 3RPDA 1R38A 1T8XA 3DFPA 4EAMA 4A3RA 1LT8A 1I6NA 3GG8A 2AOSA 3L4VA 2VRJA 3WDHA 1FCUA 1EWDA 1YRRA 4BS0A 4GC4A 2XGBA 3JR2A 4IMAA 4BJHA 4H8UA 1HVQA 2VX4A 3ZYZA 4TTGA 4LUIA 3MC5A 1WBJA 1M01A 2GQ9A 4QEEA 3F4VA 1GEHA 3OODA 4NJGA 4P8UA 5FL0A 3MHUA 1QW9A 2Z1WA 3N6HA 3ARUA 1GZJA 1FWSA 5BXTA 2XIBA 1KRMA 4LBSA 4B9YA 1JXJA 1WYIA 2GGHA 4NAEA 3CS2A 1X7FA 3B40A 4M81A 4ZXLA 5F4XA 1DJXA 4WJEA 1TPB1 2H3BA 2OQLA 3R1ZA 3GHUA 4OVXA 1HXJA 1OF6A 4Z1YA 1LRTA 3IV8A 2I1OA 3W9ZA 1IZJA 5J8LA 3WQGA 3FX4A 1V51A 2J25A 1BXNA 4NJIA 1JQVA 2A6NA 2DIKA 3R12A 4O11A 3TKFA 4WOQA 2GGGA 5FF4A 1A4MA 2CZ5A 1CXFA 1UD5A 3MWAA 3LPFA 2DQWA 1GOIA 3W1MA 1WDDA 3Q2DA 3CL6A 5H8MA 1XBXA 3GR8A 1HW6A 5H91A 2P10A 1F05A 3KVMA 2O92A 1Q85A 1E6ZA 3T0BA 1QO2A 4EE9A 3SSJA 2OWWA 3N14A 1VD6A 3DYOA 5G4HC 3OHMB 1AMYA 3SRDA 5JBEA 3TVAA 3GXPA 3L12A 1QHPA 5LSMA 3AMKA 1KCZA 3FY1A 1RJRA 4JTGA 3GUGA 2PCEA 3PBMA 3ARXA 3B05A 4PN2A 4YWSA 4POCA 4S3FA 3KCLA 4FR6A 6XIMA 1A5MC 2ZX9A 3DENA 1SVDA 4L6HA 1J93A 2OT1A 3RAOA 1EBHA 5A8PA 5EMKA 1O1HA 4LPCA 1MUCA 3NGFA 4PGLA 3WDQA 4O16A 1XX1A 3T9PA 2OU4A 4F4RA 3UVIA 4F2UA 4JZ5A 2YL9A 3TXVA 1FKXA 2Z0IA 3BW4A 1KCKA 1UR0A 3T6CA 4MZ1A 1S46A 4IPIA 3NDOA 2YFOA 5ABFB 3L67A 2ACRA 2VZVA 4JTKA 3DI1A 3SBFA 3T4CA 4GXPA 1PL9A 1M7JA 2PWVA 1JF6A 1UR9A 4WJXA 2GWNA 1GHRA 2CU0A 4GI4A 2QPSA 2WZMA 3GNXA 3HPXA 3LX9A 4UTIA 2GOKA 4IQJA 4AHOA 1WCGA 2WKGA 3R4IA 1QRQA 3GG0A 1FDJA 1KGUA 2RGMA 1HGYA 4NIRA 3SZ8A 3S5NA 2Z2BA 1BYBA 3W07A 1KC7A 1P6BA 3BG5A 1HFBA 4QS6A 1E15A 1DE6A 3VD9A 2QJMA 3CWOX 3Q58A 1UKSA 3UJEA 2QVHA 3VMNA 5DLCA 1ICQA 1F61A 2FMNA 3PUOA 3LB0A 3ARVA 5LHFA 3UYIA 5FSEC 4CD4A 3UYCA 3QKEA 3B9AA 3QW3A 2V5DA 4XZLX 2D0GA 2EO7A 2FPTA 5LYRA 3VD4A 1L9WA 3IGXA 3VIIA 2XTKA 1ZAJA 2BTMA 2ZRZA 3A5VA 5T26A 2PC4A 4F0HA 4ZE5A 2TYSA 4D6EA 2PDHA 4O14A 4YLWA 3WJSA 1BHGA 1W1B1 2WNQA 5AHFA 3IIOA 2P8CA 4L9XA 2YCKX 2V67A 1R87A 1LTDA 1XL9A 3L23A 2FZDA 4XG1A 5LIYX 1Q6EA 4F3HA 3WJZA 1DJGA 3QMRA 4AISA 3S5ZA 2J88A 2WSPA 3AYVA 3BZGA 2YLAA 4DUWA 2GLKA 1NWSA 5DCDA 4J3ZA 4IG2A 4Z2LA 4AZIA 1CGTA 2FTYA 4ZFMA 1FDYA 3N34A 2PDMA 3WL1A 3OGRA 3TSBA 1DV7A 3WNKA 2A2IA 4CVUA 3VFLA 1OZQA 4H83A 4NT0A 4RNJA 1TPFA 5C8BB 3Q45A 4GY7A 4F48A 4LUSB 4EANA 1ZY9A 3ZS4A 3OVRA 2QV4A 2DY3A 3EOLA 3U5UA 3W1TA 2F84A 3EDJA 2VZSA 1H63A 2YA1A 3G1HA 1SW3A 1TRDA 2J7FA 3WLKX 1IXNA 4FIRA 1OINA 4WDUA 2E8ZA 4R9OA 1WXYA 3KTXA 1XQKA 4GABA 4U2ZA 1VKFA 3AS3A 4HNUA 3AIRA 4JL1A 3MMTA 4AHQA 1XINA 2EJAA 3IJLA 1EZ2A 1K4GA 1UOKA 3ZJ8A 2E9MA 3CH0A 4LAKA 4LCRA 1JDEA 4CNOA 5HINA 4X3ZA 2EBNA 1QBBA 3N2CA 1QNPA 4XZHA 3POCA 3ME3A 2HEJA 2ISWA 5M17A 3GVRA 4PMZA 3UZ5A 2ZUTA 3IJ8A 4CQCA 3CIXA 4E3VA 4NILA 3VCNA 2NQJA 4AMCA 3ABQA 1HG3A 5CGQA 1LG2A 3V5OA 3DC0A 1BTMA 1XYAA 4ZO6A 3I6TA 3BOXA 3HIJA 3DUGA 3KW3A 1S1PA 1BPLB 1VJZA 1VBHA 2YA2A 2WNNA 4V15A 2V3DA 4PSPA 1FP9A 3I4EA 1W9XA 3GHRA 3FEQA 2C14A 2X42A 3FAXA 3CZEA 1HKWA 2YZ5A 5IDIA 3T1GA 1E6XM 1ISYA 4K7VA 7ENLA 3QY8A 3C52A 4W85A 1XLAA 1XIHA 3OO2A 4OTKA 3ABXA 1QHZA 2YGYA 1UD6A 3M43A 5F7UA 2YCJA 1JD9A 3W6MA 5ABHA 5DCBA 2X1IA 3AALA 3PNUA 3W6YA 1UD3A 1DWIM 1W2VA 2J66A 3M6DA 4JTEA 4TV5A 3ZVHA 3EX4A 2UY4A 3PBYA 2ZZ7A 2QLYA 1GOQA 4G7EB 3H12A 3QPZA 3GVGA 3DGBA 5DMYA 3MW7A 2PDLA 5HUPA 2H8XA 3W2MA 2PEVA 4A4AA 3SQMA 3RXZA 4O17A 1T41A 4I9TA 1BQGA 2C79A 4IMEA 1XS2A 3RHGA 5A94A 3CQJA 5K9DA 3BURA 3FDGA 4F2BA 2XWDA 4ICNA 4K68A 4GFIA 1VFUA 1K8ZA 3M16A 5F2IA 1BKHA 3CHDA 3N2OA 3TTOA 3LCXA 1Z3NA 1IEIA 3UJSA 2QJHA 4YNGA 3EX3A 1E71M 3WLQA 3QSTA 3QC3A 1GG1A 4R5EA 1QFEA 2DDXA 1LT7A 4RE2A 4P7NA 1D8CA 1VAHA 1JDCA 4W87A 3S5YA 3IJ9A 4MNKA 3AAMA 3RIKA 2DVUA 2XSAA 1I2PA 5G1MA 4E8CA 4IMDA 3B9EA 4L1GA 1V3LA 1N7KA 4HPNA 1GORA 7XIMA 1QHOA 3LNPA 2ACSA 3U3HA 4C6CA 4JX5A 3OIHA 4MTVA 1RZMA 4UQ9A 5K9XA 1ZALA 3Q37A 4RNIA 5I09A 4M1BA 3PZ9A 4ZQOA 4UQCA 1DXIA 4KKXA 3B8IA 4UCFA 2XFFA 2G8ZA 3KL3A 4ERIA 3QYSA 1XCWA 2A3AA 4LFYA 3TWBA 4TX9A 4UQAA 1AODA 3SB0A 3SUTA 1YHTA 3VOGA 4MB3A 1GYNA 1H41A 3TW6A 1V0NA 2CESA 3GDTA 1T99A 2ZADA 4HNLA 2ZUWA 2QDDA 1R3SA 3UGRA 4GYKA 3HJZA 2ZTKA 1JCJA 4B16A 1E56A 3M0IA 1VLIA 4JHOA 1B9BA 2J9ZA 3BDKA 4GNKB 1EC8A 3OEXA 4ZFCA 4JQ3A 2VELA 1MEWA 1XHGA 2R24A 3TW7A 2R6OA 1HKJA 1BGAA 1UP2A 1E0XA 1W2PA 4NZ4A 2R91A 1ZJBA 3VTRA 3VUPA 2KZHA 2A0NA 1A80A 4PR4A 1CPUA 3NAVA 3RFAA 3ZT6A 4MIMA 2XIMA 2F6XA 3U2CA 5I00A 5IHRA 1E9ZB 3TN3A 3P7YA 3BK0A 5F2LA 3TC3A 2P3ZA 1XH0A 4NXSA 1EDQA 4DJFD 2DT0A 4TVUA 4GXWA 3CWNA 3TTQA 4LSBA 4N9DA 4GIRA 3VC6A 1KV8A 2VCAA 1ODZA 3NWRA 4LVGA 2IXVA 4O0QA 2XG9A 2ZRYA 5FEZA 4ACZA 3T0AA 1G4TA 1T40A 3ITTA 4H9VA 1XV8A 3SR7A 1AMKA 1M7PA 2NXHA 3IV3A 4GX9A 3KOWA 2NT1A 1UR8A 3IAPA 5BMWA 1VJSA 4LBUA 3GAYA 3U4FA 3FV9A 4PTVA 1F74A 2Y7GA 2FVKA 2A3LA 3DECA 5D2XA 1PXGA 1V02A 1OFBA 3MQTA 3TJIA 2G96A 1S3TC 3O06A 1EQPA 4OOZA 2Q09A 4ZO9A 2OZ8A 1IXQA 1Z9AA 3ELFA 3QXBA 3TK7A 3ZOAA 3PNZA 1QMLA 3PF3A 3GG1A 2XVGA 2VX7A 4A2SA 3PPFA 3I7QA 4GO9A 3LLXA 4ZA0A 1H62A 3G22A 4PFHA 5D38A 4PMXA 1X7IA 5BROA 3N2TA 5CG0A 4AVOA 3VX1A 1KLZA 3WLNA 4M29A 5DBTA 1E0TA 2YJQA 3HQNA 2DZUA 3WQFA 3RR1A 2QYGA 2EF9A 2ESCA 5FJRA 3SUUA 5D2YA 3NUKA 3FJNA 3WUFA 1ITQA 1ZJAA 3NQDA 4MWAB 1W1ZA 4YS1A 4G9PA 1G01A 3TZNA 3KL0A 4PZVA 5CKSA 4QJ4B 4FALA 1TJ2A 1JEZA 3WMBA 1GW1A 4N02A 1LQAA 3NZ1A 4QM1A 3IVUA 3VKDA 3CUGA 5F4WA 1TWZA 4TX8A 3V36A 2EG8A 3MMWA 4QIUA 2QXWA 4YN5A 4E8GA 5HMEA 3G6LA 5HOSA 5A2BA 1ADSA 3PAOA 2PZNA 4H8VA 2VDIA 4EACA 1NWRA 2X0YA 3F03K 3T08A 4GKTA 4M19A 3TQVA 4BF9A 2UY2A 1ISXA 4QJ3B 4N6EA 4UNKA 2D3NA 1IGSA 2NQ5A 2G3IA 4KFNA 4LOCA 4HZMA 4C7GA 4AIOA 2Y88A 3VU2A 3N11A 3UXIA 4D6DA 1SJDA 4WDWA 2QW5A 4JICA 3GTIA 4H1ZA 1EF2A 4U10A 5U7SA 1XF0A 3G0XA 4JN8A 2NQ9A 3W24A 1FHUA 5HBFA 2GVGA 3BLEA 5AB3A 4DBUA 1UA7A 4PYSA 4QDMA 4D1JA 2PODA 5EBUA 1QOPA 4RX0A 4HZ7A 1WPCA 5LNVA 5AC5A 3DFYA 3FLUA 2XH4A 2BHUA 4NZ1A 3MV11 4NI8A 4HNVA 5FL1A 1EJUC 3BCDA 3LI1A 3UWYA 4E2BA 5L9FA 1BD0A 2J8TA 3EZ4A 3HGOA 1B0IA 1X6NA 4KBXA 3CHCA 3PPCA 4GO8A 3MP5A 3KTSA 3KRZA 1LROA 2YXGA 3A6OA 2O4QA 1TPVA 2QAPA 3G1DA 4KQNA 4BZYA 1KFCA 5F1VA 3L66A 4KEMA 2D69A 4NZJA 1XLIA 3NPWA 3P8JA 3VCCA 2HV5A 1FWJC 4MUPA 1TVNA 3E5BA 4HN4A 4XZBA 3ITYA 4L1XA 3BGJA 1A49A 2RDXA 1NY1A 2ISVA 4O10A 5HMFA 2X7VA 1ISWA 3B0VC 4IQLA 1BWVA 4M56A 1C93A 4KRUA 4GUGA 5FI8A 5CCZA 2PTWA 2Y4SA 4Q7NA 5EYWA 3WBYA 3WBWA 5HWNA 5C55A 2F61A 2O9TA 2PLJA 3PBGA 1E6NA 4L56A 4IPPA 4HQVA 4GC3A 3W7QA 2XH2A 2YL6A 3AXHA 1PTAA