3W1NA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-iodoorotate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-iodoorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1nA01
2YFOA 3QMRA 4JIQA 2NWRA 3E96A 4GUGA 4LS2A 4UTTA 5AYYA 2AAMA 2V5BA 3C2OA 4QM1A 5A8GA 3G8EA 3NPVA 3K30A 3O8AA 4A3UA 4IMCA 5A5WA 3A21A 4NJKA 1BWKA 4XKYB 1XXXA 3L65A 4N6FA 3L21A 1HTIA 4MIMA 3NL5A 4H6KA 4PL2A 4IMFA 2QKFA 5LHFA 1TB3A 2Y7DA 1G7VA 3BG5A 3IIVA 3PBUA 4Y9AA 3QPZA 3W86A 1K3UA 1OFOA 4N2YA 3W7LA 3C2FA 3S1UA 1FDJA 3FKKA 1OX6A 1W3NA 1KFEA 4RV8A 1LDCA 3P84A 2NV1A 3NQVA 3T4CA 1OFQA 1XUZA 2DZVA 2BSLA 3GXPA 3TFXA 2E6YA 4DF2A 4ZQRA 4IPIA 2E5CA 3SW6A 2ZZ6A 4NJHA 1EEPA 1MSSA 2VENA 2ZRXA 5EL1A 4NT0A 1XM3A 4FXSA 2I9EA 2X16A 3NEVA 2ZZ5A 5HR7A 3WK2A 4Z1AA 3ZWSA 2WO5A 3BO9A 3PM6A 4M19A 4BI6A 4AF0B 4I7VA 1I4NA 1SW0A 3A22A 3D0CA 5D04C 3JR2A 5FF7A 1GVRA 5CKSA 2NV2A 1VCVA 3M5VA 3EXTA 3E02A 1MEWA 2C16A 3GXTA 3UXAA 2VXNA 3HO8A 3TAKA 2E5DA 2H3BA 3S6DA 3SZ8A 3W7IA 3GX9A 3L5AA 2ISWA 1TPFA 1YTKA 2EAWA 4MJMA 5U7SA 1KTBA 2A4AA 2B7PA 3KVKA 1H7OA 1RV8A 3I7RA 3FJLA 4GNJA 4KFPA 4YCOA 3GNNA 1C8VA 3W1XA 3MYOA 3W7CA 1X1OA 1Z41A 4GFSA 5FESA 3L0NA 5AYZA 4C1KA 4JYFA 6ALDA 3B0UX 1DL3A 1GVQA 3G1SA 3KRUA 1TTPA 2Q8LA 1TO3A 4IJBA 2JKPA 2YXGA 4CNPA 3C2EA 4DXVA 3WFAA 4DO5A 2YW4A 2LLEA 7TIMA 2NX1A 1L2UA 5FF0A 2ABAA 1KM2A 3LBCA 4O53A 4O1DA 1B4KA 3GAYA 2F7FA 1JCXA 4NX0A 4IX0A 3AO0A 1MEHA 3RMJA 3I6RA 1WX0A 2Y88A 2CZFA 3W2KA 3BLEA 2Z1BA 1OK6A 2GQAA 4RLIA 1NSJA 4GRSA 4UMAA 3QFEA 4CCEA 2A0NA 4POCA 3TUUA 3DFPA 3OG3A 1YDNA 1G7UA 4MFEA 3TXZA 2ISVA 2QDGA 3HBLA 3WJYA 2FPYA 3W6YA 4HSNA 1KFLA 5KSWA 3U6WA 1TTQA 5HUOA 1YPIA 1FY6A 4L4MA 2FTPA 3E0IA 1H60A 3G18A 1W31A 5DLCA 2VEMA 4AB4A 2P10A 2R14A 4MY8A 2Q3RA 2E1DA 1X7FA 3LV5A 5FEXA 2GOUA 4AHQA 4JYDA 5I3HA 2OMAA 2ZTKA 1H7NA 4XKYA 4O0KA 2YGYA 3SR7A 3BV4A 3STGA 1L9WA 3CLMA 1NVMA 3GXNA 3N14A 3SI9A 3USBA 4O16A 1LTDA 4O54A 2FFCA 1CX9A 2DJXA 1FDZA 1ICPA 5AYXA 3HG4A 2BX7A 4UIOA 5IBXA 3F4NA 3NZ1A 3S1WA 4RX0A 4OGZA 3LBMA 1VYRA 3MP4A 3Q94A 4GUJA 4K8HA 4MUZA 4OBTA 5LKYA 4UUIA 5BMWA 3P61A 3HB9A 3SFKA 4MLRA 4BWLA 4QITA 2JKAA 4NU7A 5HWNA 4Z1DA 3UWWA 2G97A 4EF9A 3PG8A 1K8YA 5CSRA 3C8FA 1TRIA 1LRNA 8TIMA 3W7HA 3G1DA 4AF0A 1JUEA 3HQ1A 3NM1A 1VYSX 3G1HA 3W7EA 5D38A 5HINA 1DJNA 2G5WA 3W70A 1VC4A 5D32A 5HWMA 3MO7A 4AVFA 3SGZA 4LRSA 3W1MA 4QJ1A 1VH7A 3HPZA 4RCXA 3G0UA 1KM4A 4OWGA 1KFKA 2QJGA 4ORMA 4J9JA 4KKXA 3W2LA 3N34A 3P62A 3PG9A 2Q8ZA 5EA9A 1LLWA 2PCQA 5DXXA 4UTKA 2B0MA 2J24A 1UUOA 2CLHA 1IXPA 2PURA 5C5YA 1OHLA 3WJXA 1XBVA 3LOTA 3RNDA 3DU0A 4E38A 4DPPA 3W83A 3G1XA 2CLMA 3I7SA 1TSIA 3VKJA 2HS6A 5CZSA 1W5PA 1A53A 5DBTA 5KTLA 1WDWA 1P0KA 1O94A 3MP3A 1CW2A 5D30A 4FNRA 1WOAA 3KRZA 1Z48A 1XBZA 4GUFA 2ZDRA 1KFBA 2CZ5A 3CIWA 3STCA 3TAOA 3G1YA 3PSVA 4N6EA 3PR2A 4S1FA 4O57A 2ZZ7A 5I3GA 5K9DA 1G4SA 4MJZA 3PB0A 2WOQA 3OHIA 1J5TA 2VFIA 4M6VA 4Q4KA 2VELA 2H6RA 1X6UA 2GJNA 4JX4A 3F1QA 1W0MA 3LTYA 1N55A 3QEZA 3HG3A 3WJZA 3IIPA 4XZ9A 2W0UA 1OFPA 3EX1A 4AAJA 2C1HA 1UJPA 2Y85A 1ADOA 3LXBA 4PODA 1ICSA 3QW4B 4N9CA 4CCDA 5E1QA 3L5LA 3CTLA 1R2TA 2DORA 1DQXA 4N9EA 2CFFA 4FNQA 3BPWA 4UTMA 2V2DA 3W72A 1YXCA 3W88A 4MFDA 2WJZA 2YYTA 3NM3A 2RHGA 3N9RA 3L67A 4AWSA 4BF9A 4RZ6A 3L5MA 1ONRA 3W76A 2JKEA 4NQ1A 5BRBA 2V2HA 3KFTA 4M7TA 4UFJA 3O6CA 3P60A 1WYIA 3OVPA 4QISA 4DQWA 2I14A 4K6AA 1TCDA 5LNVA 4XQ6A 2ZCGA 3B0PA 2YFNA 3M44A 4JTSA 1QR7A 1OVDA 3EKZA 3ZS4A 5EKYA 3UY7A 3STEA 3TW6A 3OBKA 2F84A 3G0SA 1W8SA 3G22A 3TDFA 4UR8A 4MY9A 3I68A 1Q45A 3O63A 3LXCA 3UPWA 1MEIA 3EEGA 3GR7A 2ALDA 2QDHA 3NAVA 2VKZG 1TTIA 4YCPA 1TPH1 1TQJA 5KZDA 3W85A 2RDWA 1AMKA 2QCHA 5AHLA 5LGZA 5D2TA 2X1RA 5AOUA 5I3KA 4CLMA 4IGHA 3GDKA 1XDLA 3HJZA 2IQTA 2CLKA 3TFCA 1Q6QA 4LUJA 2ZA3A 1YXDA 5C54A 4UTHA 4HNUA 1SFLA 5K2ZA 2RDTA 5G1YA 3GIYA 1M5WA 3G3DA 4UMBA 2CLLA 3G24A 4L4LA 2B4GA 3IGUA 2G95A 4DF0A 1RPXA 2VFDA 3V1PA 3BW4A 2CW6A 1FX6A 1GWJA 1F6KA 3EXRA 5LGXA 2FPTA 3QJAA 2GQ9A 4Y90A 1FXPA 3R5EA 5T26A 1XDMA 2FB3A 4ZL1A 3A5VA 4UFMA 4JTGA 2FJKA 3UZ5A 1R2RA 1VLIA 3DKLA 5CGQA 3L66A 3U8GA 1K02A 4EIVA 3NL6A 1EUNA 4LS0A 3VFLA 1VR6A 3CT7A 3EX2A 3WK3A 1KM0A 2FDSA 4MZ1A 1I2QA 4LRTA 2Z2UA 2YZRA 3S1VA 2NUWA 3OA3A 4IMGA 3NPWA 3O1NA 4JS3A 3TH6A 1DHPA 5F1VA 3CM4A 4AMAA 5F2MA 1SQ7A 3G3MA 2KZHA 2PRLA 3N9SA 4ZQNA 2DZTA 2B7QA 1BEUA 1KTNA 4LW7A 3MI6A 4LY8A 5AN7A 1QPQA 5CPLA 1PCKA 1KM5A 1Z42A 4QNEA 3CC1A 4ZQCA 2A5HA 1UCWA 2Y61A 4AH7A 4LNYA 1WOBA 4PH6A 1ZAIA 4KFNA 1SSDA 3LHZA 3DI1A 1VJIA 4N9BA 1AL7A 3H55A 3PY2A 2Y62A 4ZQMA 5EPDA 3G1FA 5KINA 1KM1A 1EP2A 2BLEA 4WXZA 4YLWA 1L6SA 1HO1A 1DVJA 5E0KA 4WUIA 3BGGA 4ZQOA 4ALDA 4EWND 1FCVA 2FPVA 3PWAA 3W23A 3MHFA 1PV8A 2HTMA 1KA9F 4MOZA 1Q6RA 2QAPA 3QF0A 4LVAA 3UWQA 5AC7A 3KX6A 5FF2A 1U83A 2Y7EA 4ML9A 3O07A 5F1UA 1KBIA 2CLFA 4ZVJA 4MLJA 5FEZA 5G4EA 5TBOA 5EMUA 3GKFA 3I65A 1S5TA 5HMSA 3LRLA 5G5IA 2Y6ZA 1VCFA 1SZFA 4JXCA 1TRDA 2E68A 3STFA 5CPNA 4HIBA 1P4CA 3LTPA 5F2IA 3WJWA 3LLDA 4LOCA 2WSYA 2ZA2A 1YTDA 4M5PA 2WSQA 3OVRA 1R2SA 3MHGA 4JTUA 1FWTA 5F2GA 1FWRA 3TQVA 4DO4A 1RQEA 3DKJA 1FCBA 3IVTA 3KAOA 5L9FA 4QAIA 3LHWA 5DCDA 1I2NA 3DAQA 4IWWA 3A5FA 3G8RA 2V30A 5LNUA 1RR2A 4Y8FA 2C6QA 1OFAA 5HUPA 5DY2A 1OFDA 4RKAA 1QO5A 5CZTA 2H8ZA 5K3VA 3NOEA 1KFJA 4UFLA 3PB2A 2A6NA 3LCWA 4E2BA 1H7XA 3DBPA 3KVJA 3LHTA 4UTWC 2C18A 4JICA 3VNDA 3L9CA 4K38A 5KITA 3TC7A 4HN4A 3QW3A 2ZRZA 2OX1A 3W7NA 1H51A 5C6MA 1VS1A 2YPIA 3TIMA 3EWYA 3LHVA 3NQ7A 4R7JA 3S0CA 1PVNA 3NQGA 3L0GA 4LC8A 4UC5A 1ME7A 1SU5A 2FLIA 3LRMA 4DO6A 4DBEA 1W3IA 5FEWA 3W7RA 2W79A 1G4TA 2BZNA 3WJSA 3NQAA 4LWWA 1B3OA 5CZJA 3T78A 4FEZA 3QQ0A 1LZOA 4ZQPA 4HNNA 3TXVA 1I2RA 1QO2A 3NQMA 1NF0A 4Z1CA 3DFSA 4K36A 3LGEA 3M9YA 2GVJA 1EA0A 3WK0A 1M6JA 2Y70A 3LLFA 4WQ6A 1UUMA 5G2HA 2C19A 3A9IA 1VRDA 5TIMA 1H61A 3O6YX 1LOSA 4JN6A 1OX4B 3PAJA 2FB2A 2ZRYA 5LNRA 3L0KA 2PC4A 4X22A 2GVGA 4FHAA 4IXXA 1NAL1 1B9BA 4TX9A 1BTMA 3R2GA 4PC8A 1DV7A 3IEBA 4M7SA 3DH7A 2ZZ1A 4X2RA 3KVLA 2V5LA 1KLZA 3EB2A 2A7RA 4UFIA 3QYQA 1DQWA 3GDMA 3PUOA 4PTNA 4CQ8A 5CG7A 3EX3A 3UXDA 1SFJA 4LVBA 2A7NA 1LRQA 3GLCA 5C2XA 4NJIA 4HNTA 4GUHA 1ALDA 2XN1A 4BR1A 1W5NA 4O11A 3NQ2A 3W7QA 1DBTA 3H53A 2J9ZA 2UV8G 4S2CA 4D2JA 5D37A 4AWTA 3B06A 5MHBA 3MP5A 4JTFA 1VYPX 3PBYA 1TJRA 3TROA 2NUXA 3LDVA 4HHPA 5FF3A 1XL9A 3PULA 2Z6IA 2RH9A 2DZPA 1JULA 3IGSA 5G2IA 3LB0A 1N8FA 1OYCA 1YLVA 2P0OA 2NX3A 2Z6JA 3ATZA 1QPNA 1TPC1 3CB8A 3RLUA 4NZJA 4R53A 3N2XA 5K4XA 4KWWA 4RR4A 2A2IA 4FNTA 3P8IA 4H3DA 4M6QA 3CEUA 5L6UA 1LRTA 1TREA 3PF3A 1GTEA 3NYZA 3O06A 3W7MA 1B4EA 2A85A 3NQCA 4NZFA 3E9AA 2OT1A 4WOQA 2C15A 5DXYA 3UWZA 4UTUA 1SW3A 1EPXA 3CQ0A 2ZZ4A 1I45A 3W07A 4RJEA 2VEKA 3C6CA 4ADUA 2QCDB 2ZBTA 2OT0A 2R94A 4Q32A 1K8ZA 2YCEA 2EPHA 4N9DA 3QPYA 5AB3A 3CWNA 3FYPA 4WX2A 3UPBA 4O13A 3GVGA 5LNSA 2HS8A 1DKWA 2XN2A 4Z0JA 1THFD 1L6YA 4WXYA 3C0JA 2NZLA 3O05A 4JTEA 2D73A 3MI2A 2FIQA 2TRSA 1WBHA 5AHMA 1SUXA 1F76A 3BG3A 5HWJA 3S42A 3KRSA 4U28A 4JDYA 4XWUA 4LVGA 4NXKA 5K9XA 1V7YA 1W37A 2V82A 3PC0A 1FCUA 1GOXA 3R12A 4JTLA 5AHFA 1EP3A 3KVMA 1W5QA 3HG2A 3ZFHA 3T44A 4FF7A 1KM3A 3LCHA 2BTMA 1F2JA 4K7YA 2DZWA 1SZNA 5D33A 1EWDA 5I3FA 3NO5A 4HNVA 1OF6A 1H7WA 4FIRA 3FIGA 4ADSA 1FQ0A 1BKSA 3TMLA 1Q6OA 4OU1A 1SO5A 3B4UA 1EB3A 1I2PA 1AW5A 2A1YA 4XTDA 3FA5A 2CLIA 4RXFA 1DORA 3U2OA 5F2LA 1SZEA 4GXMA 2C13A 3GAKA 3QC3A 4TO8A 1NF7A 1ICQA 1WXJA 1P0NA 3IRDA 4FX7A 5FI8A 4OHQA 2WNQA 1JQVA 4YL2A 1H62A 1W3TA 1SPQA 3O6DA 4MYAA 4WY0F 2QF7A 2H3DA 4OE7A 4UTTC 1GG1A 3W75A 1OX4A 3VI2A 4CNNA 1RQBA 4LS1A 4O1BA 2H8XA 2H90A 3FS2A 1ME9A 3FFSA 3LCXA 5G2WA 2GVLA 1LOQA 1GVFA 3M5ZA 3L68A 3RK8A 3HPXA 4BK9A 1SO6A 1HFBA 4JX6A 4ONVA 4RZ4A 3M1ZA 3EWZA 2ZRVA 4OV4A 1F6PA 3GKAA 4GC4A 2QCGA 5HQEA 3C52A 3NDOA 3T40A 2OCZA 3TQKA 5D02A 2XFWA 4RZ5A 3NR0A 3W2UA 4UTJA 5KZEA 3P81A 3LHYA 4GJ1A 5J5DA 2NWSA 3SIZA 1FDYA 3LCLA 3JS3A 4MZYA 1JCNA 4QQ3A 1KV5A 4KWVA 4EVZA 1JCMP 5D2VA 4AEOA 2QCEA 1G4EA 1GEQA 2R91A 3CIXA 1TMHA 1OYAA 2A21A 2E6FA 4IQLA 1ZJIA 4Y6GA 1HL2A 4Y96A 4RXGA 2QUVA 1PHQA 4GBUA 1PIIA 2J27A 4Z0SA 2CWNA 1GVOA 4FIQA 3ZWTA 3GK0A 1G6CA 3R13A 3TE9A 1XFBA 1XKYA 3M41A 2Y7FA 2O7SA 1UBSA 1X1ZA 1OFEA 5K9CA 3T7VA 2QCDA 1LYXA 1JRCA 3F03K 4FO4A 3NA8A 4ZZ9A 3FEMA 4XTIA 1YPFA 3LCFA 3OEXA 3QQ1A 2NUYA 3BK0A 1ZNNA 4IOTA 3DFQA 3UWVA 3CEPA 2C0AA 1A5CA 1C29A 4TU1A 4O4WA 1PS9A 3W84A 2VFHA 3V75A 1JR1A 4Z1BA 3NVTA 1YYAA 1OJXA 1VLWA 3LI1A 3MHUA 2V2CA 3TK7A 3PVFA 4MKNA 3P7YA 3SECA 1ZHAA 3S5YA 3BW2A 1E51A 3DI0A 2HSAA 4JY8A 2ZRUA 4ORIA 2V81A 2ZZ3A 5DCBA 3VCRA 3W1LA 2YR1A 3W1PA 1KM6A 5DCEA 5GVJA 1R30A 3CWOX 3DHDA 1R46A 2YYUA 4O8RA 3M16A 1JCLA 2GQ8A 3NPUA 2GJLA 1LBLA 4DF1A 5D2XA 4MVAA 3LCGA 3HPSA 4ADTA 3NQ6A 2Y7GA 4NNCA 4WOZA 1V5XA 1T96A 3MUXA 3FOKA 3TQ0A 4NNBA 3W7GA 1MZHA 3IIXA 5DY3A 3NL3A 3TV8A 2P1FA 4K7VA 1O5KA 1TYGA 2J6XA 3NQDA 5IM51 1Q3NA 1TPVA 3CHVA 1P1XA 2DZSA 1P5BA 1Q6LA 4N4PA 3MWAA 1JCJA 5CPOA 1LM1A 3W7DA 1A50A 4YMZA 3P82A 2X1SA 4XUGA 1S5VA 4DBDA 2QCCA 3P5ZA 3THQA 3W7JA 4G1KA 1HG3A 5BNKA 1RD5A 4GWEA 3MI3A 4CQAA 2BXVA 5BMXA 1EWEA 5AHIA 3ABQA 2VC6A 3M43A 5I3IA 5IBXC 1PCWA 4JTIA 3NG3A 1K8XA 3TKFA 1B57A 4C1LA 4A22A 1WV2A 2Z0IA 2TPSA 3W1UA 3NXFA 1H1YA 4BWLC 1MO0A 5EYWA 1OFBA 3E49A 3EXSA 5FEPA 3GZ3A 3W2JA 5H2ZA 1M7OA 3NGJA 4UMCA 1LOLA 3S5ZA 4A2SA 3RF9A 3KXQA 3TW7A 3IIOA 4K37A 2E6DA 3MYPA 3SGUA 1YTEA 3F4WA 1G69A 4Z08A 1A5AA 1UB3A 3QMTA 1F7BA 4DPQA 1RQHA 2ZZ2A 3N2MA 2X30A 5HJLA 4EF8A 3NL2A 3R8RA 1TPEA 3IGXA 5EBUA 1LCOA 3DHFA 1FWSA 3UD6A 1L6WA 1TPB1 4O1CA 5KZMA 2X1TA 4IMEA 2C3ZA 4O10A 2DU2A 4OT7A 4NJJA 4I7WA 2NXIA 4PL1A 2JK2A 1F74A 1SO4A 2XN0A 4UTLA 1W56A 1YADA 1IXOA 2X1UA 4LC6A 2ZQ0A 4HSOA 2PRHA 1LORA 1A5BA 3BGJA 1JJKA 3QZEA 3Q2DA 2V8ZA 1Y0EA 2J9YA 3EKLA 5DELA 3GR8A 3B0VC 4A21A 4UCGA 2A6LA 5E93A 1H7RA 3LM7A 2QUTA 2J9XA 3B05A 3S8HA 4M6PA 1KBJA 3NQEA 2A7PA 4N4QA 3UWYA 3EWWA 2NXHA 1IGSA 2VFFA 3M0ZA 1X8FA 3S5OA 1PHWA 5KMYA 4NUWA 1GTHA 2VFEA 4W9TA 4XBSA 2VFGA 3DXIA 3SSJA 1FWWA 3P80A 2ISSA 3W2MA 3LRKA 4O18A 2O7QA 3LXAA 3W9ZA 5G1TA 4LU0A 1TPWA 4IMDA 3C2VA 3A24A 2CZEA 4XBKA 5H91A 2QAFA 5D2WA 1AW2A 2GUUA 1EUAA 5EY5A 4JTHA 5K4ZA 2JGQA 3TA6A 2VOMA 3W3OA 1W1ZA 1VHCA 6TIMA 3B04A 3PSWA 3IVUA 4TMCA 2NXGA 4O14A 3TSMA 2E09A 3AJXA 3INPA 3B03A 1GZGA 1KLYA 5CPMA 2BWGA 4FB7A 4LTSA 4JY9A 1O95A 3MJYA 1YXYA 3P8JA 5DN1A 1LBFA 2JBMA 3WK1A 3OIXA 4NXSA 3HOJA 1SSGA 1IF2A 1KV8A 3BLFA 3DFNA 1JCYA 2QCMA 5BOOA 4I7UA 1K7FA 1M7PA 1WQ5A 2YX0A 4AXKA 5AFDA 1H5YA 5SWUA 2NX9A 4A29A 3HMJG 1H7PA 4O15A 3TJLA 2CU0A 1LP6A 3NNTA 1Z44A 4MYXA 4OQVA 4AWUA 4JX5A 1TPDA 1GYLA 1GQNA 3HGSA 3LX9A 3LTSA 3HF3A 3HGOA 1A5SA 4MZ8A 3DGRA 2DZXA 3QH2A 4WY0B 3ELFA 1EP1A 4GE8A 4FX8A 1UASA 1JRBA 5G4WA 2YW3A 3TJXA 1CI1A 1SO3A 1T8XA 1K03A 2DZUA 1TPUA 2ZA1A 3LHUA 1S5WA 4UFHA 2RDUA 1IXNA 5K7JA 4AHOA 4IPJA 2VEIA 5F4WA 3ANYA 3NQFA 2QCNA 1GT8A 3FYOA 4LUIA 5D09A 4CQ9A 4FX6M 1W5MA 2PRMA 3KOFA 4YXGA 1H50A 4H4IA 2EF9A 1G4PA 1YDVA 1I2OA 1KW1A 1NFBA 3HIJA 4ICNA 4AHPA 1QOQA 3GNDA 3O16A 4K8EA 3N19B 4QIUA 3PBWA 1WBJA 3THAA 3ABOA 3PUDA 5F4SA 3W7OA 1OG0A 1YDOA 2E6AA 4LT9A 2QR6A 4O50A 3W1TA 3VE9A 3M5XA 1VZWA 1O5XA 1K7EA 2AGKA 2J88A 1GPWA 5HULA 4FNPA 1AL8A 1JUKA 2YSWA 1FWNA 4BFAA 1BWLA 3BARA 4OV9A 2B7NA 1TQXA 1J4EA 1H1ZA 3TR2A 4PCFA 4R34A 1SW7A 4DEFA 4I9AA 1QCWA 2HMCA 3W22A 1QAPA 3N73A 1OF8A 3YPIA 4MPQA 4U4MA 1ML1A 3LI0A 4QNWA 4IUOA 3N3MA 3W1RA 2AQWA 4KFOA 3HG5A 1AK5A 4O12A 3IV3A 3SJ3A 4JTKA 3I7QA 3SY5A 2GPTA 3EX4A 3W1QA 1VHNA 4CCCA 4NVTA 3UYCA 5LSMA 4EOUA 3C2RA 5AHEA 4TIMA 1D3GA 4NX5A 1TTJA 4E0CA 2DP3A 3IVSA 3PBVA 1R47A 4FXRA 3NPXA 3P74A 3S1XA 3UY8A 5AC6A 1I8JA 3CPRA 1TV7A 1GYNA 2EHHA 4JNMA 3W1NA 2E77A 2CLOA 4IX2A 2VEPA 3LERA 2I1OA 4S2BA 1H63A 3CU2A 1VCGA 3UQNA 1W54A 3EWXA 3O15A 2WQPA 3GB6A 1QMLA 3TSBA 3UNDA 1HUVA 1OX5A 1D9EA 1JQXA 4UTWA 4WJEA 3W2NA 3UWUA 4LV4A 3LCIA 5LZLA 1GJPA 3L2IA 4CNOA 4WD0A 2OJPA 3MMTA 1LLZA 3S9YA 2ZTJA 1TIMA 4WZHA 4NNAA 4UNKA 1DJQA 4O19A 1WAUA 3TMQA 1FXQA 1RZMA 3RU6A 4P2VA 2QJHA 3R89A 2JGYA 1SR9A 4Q33A 3E12A 5D03A 3JRKA 1J2WA 1T0OA 3LV6A 4DELA 2C14A 4JDBA 4TR9A 3B8DA 1C9DA 3P67A 3W71A 1QOPA 3BG9A 1O4UA 4UR7A 1ZFJA 1LROA 2WNZA 2WSRA 5FF4A 3W7PA 4WY0A 1QNVA 1LBMA 5F4XA 3M6YA 4FNSA 5CZ0A 1EIXA 4GUIA 5LHEA 2ZFAA 4ZMGA 5CSSA 1ZAJA 2CZDA 3PUEA 4TMBA 1OK4A 3Q58A 2CLEA 2Y89A 1XBXA 3GDLA 1JVNA 3M7WA 1T99A 3C56A 4JTTA 3C3NA 1ME8A 1KTCA 1F73A 2QUUA 1GVSA 4LVFA 3M47A 4UXDA 3DFTA 5DBUA 4UNLA 3ATYA 1HO4A 3RFAA 4QSHA 2OZ0A 3W87A 3KHJA 5BW6A 4HPJA 1ZAHA 1O60A 4LVDA 3TU9A 3W7KA 4BI5A 3BLIA 2RFGA 1FCQA 1TV5A 3H54A 3HGRA 4IXHA 1XC4A 1QPOA 4NJGA 1OABA 3W1AA 3QSRA 2ATSA 3TCEA 4O1AA 3TNOA 3MBFA 5I3JA 1DOSA 3QRHA 1GG0A 4PA8A 3G0XA 3UZJA 1RVGA 2ZYFA 3QSTA 4RK8A 5HR6A 3BVJA 3C4UA 1F5ZA 3TSDA 3C61A 3QMSA 3IIZA 1JUBA 3GYEA 2EKCA 4YWIA 3NZRA 1QPRA 3FKRA 3QM3A 1ZENA 2DJLA 3A23A 4FNUA 2QEZA 4E2DA 5AC8A 2E5BA 5HNRA 4JEQA 3OVQA 4HT3A 1W5OA 2WKJA 1ZALA 2NLIA 1ZY9A 4X3ZA 3PS7A 1MXSA 1OYBA 3HGJA 4JD4A 5U4NA 4JTJA 4JR5A 3EX6A 1VQTA 1AG1O 1S3HA 1ZCOA 3DFOA 1XUUA 1OFRA 1VPXA 4K39A 3FJ6A 4O4VA 2FQIA 1F05A 1D3HA 2TMDA 2YDAA 3GDTA 4PEKA 2ABBA 3ZR4A 3EWUA 2QJIA 3P5YA 1QDSA 1U5JA 5AHNA 4O0ZA 1EX5A 4JIPA 1TJPA 2WNNA 4O52A 3TC6A 4UTIA 2WPBA 2X2GA 2EGZA 3RLVA 4O28A 3W73A 2ZRWA 4LV9A 5D2YA 1AW1A 2Y63A 4UFKA 5C55A 1VGAA 1PE1A 3MBDA 1IIHA 1QFEA 5J5RA 2R8WA 1XCFA 1IIGA 4X9SA 5LNWA 3G1VA 1K7XA 1KFCA 2QCLA 3M5YA 2V9DA 2ATMA 4JYEA 3FLUA 1IXQA 4HKPA 1N7KA 2W6RA 3DENA 1WA3A 3W74A 5D05A 1G67A 2B7OA 2Q3OA 5TQLA 2RKXA 5ABTA 4N02A 4A2RA 3ABSA 2QCFA 2PE4A 4P61A 3T55A 3TX9A 1QWGA 3S5NA 4BI7A 3ABRA 2WV8A 1PL9A 1TV8A 3EWBX 3MW7A 3DZ1A 2TSYA 1SZGA 1NEYA 1XI3A 3G1AA 2V0TA 3VE7A 1FUYA 1XBYA 2G96A 4O17A 4PFMA 4R33A 3GDRA 3BW3A 4HPXA 3NQ8A 1FBAA 4MY1A 2TYSA 4B5NA 4JGDA 3Q37A
chains in the Genus database with same CATH superfamily
2YFOA 3QMRA 5HDRA 4FLRA 3AIWA 2HE8A 3E96A 4GUGA 1MUCA 4P7NA 3DESA 1QNOA 3MQTA 4GYKA 1TFVA 4UNIA 5A8GA 1OINA 3G8EA 1JZ4A 4A3UA 2QJNA 1QBBA 4NJKA 3GH4A 4W85A 4N6FA 4MUPA 5AYBA 5DX7A 3ERPA 4H6KA 2PTZA 4R9OA 1MNZA 4GY0A 4D9PA 1EDTA 3BG5A 3IIVA 3PBUA 3E1F1 3C2FA 3M0XA 1H41A 3O7UA 1W3NA 1KFEA 3HFTA 4RV8A 2QIIA 3S6TA 3P84A 2VZSA 4PR4A 3UEQA 3CMFA 1XUZA 2Z1WA 4Q4PA 2DZVA 3H23A 1E40A 4ZQRA 4IPIA 2YBTA 4FXSA 4JQ3A 1S2UA 5HR7A 1ZZMA 3DBNA 4AIBA 2WM1A 2WJEA 5HK4A 1W6TA 4M19A 4AF0B 4I7VA 4X9YA 3A22A 4Y8EA 3H24A 5D04C 1S1PA 3WD3A 5I03A 4MADA 1BTCA 2V5JA 1X6LA 1VCVA 7REQA 1XX1A 1YDYA 3BQ6A 2PTYA 2E5DA 4AZGA 3W7IA 2H9AB 2XIMA 4UQEA 4IIEA 3CZKA 2YBVA 5A6JA 1YTKA 5U7SA 1KTBA 1KRAC 2A4AA 4GVFA 3WLMA 3ANVA 2O9RA 2OLAA 3I7RA 4GINA 3FSTA 4KFPA 4LAMA 8RUCA 5IFPA 1O68A 4LYQA 1GKQA 4OOZA 3DHPA 5C2CA 4ZE5A 3W7CA 1Z41A 4GFSA 4FSAA 4Q4SA 1EC7A 1JYXA 4C1KA 1QU4A 3G1SA 5FSDC 2GDUA 3BDKA 1OD0A 4J4KA 2Q8LA 4IJBA 2QS8A 4AYSA 4CNPA 3C2EA 3WFAA 2EO7A 4IFKB 4AW7A 2NX1A 1L2UA 4A3YA 2NQLA 4EK7A 3KOYA 4O53A 4RUBA 3EBVA 3WNKA 3GAYA 1Q5MA 2F7FA 1SR0A 1QT1A 3R94A 1AZ1A 4DN1A 4GH1A 2Y88A 3L7RA 2OO6A 2Z1BA 3AQUA 4KEVA 1Z7AA 4EAYA 4GRSA 3BWWA 1O1HA 2A0NA 3TUUA 2UY3A 3DFPA 2PLMA 3OG3A 4GZIA 4LCSA 3HBLA 3VD9A 3WJYA 3PFRA 2P53A 3WDIA 3KTSA 2PDBA 4PRTA 1KFLA 5LIWX 1S2CA 1YPIA 1UMYA 3G18A 1W31A 4MSSA 2VEMA 4CNUA 4PBGA 2P10A 2R14A 3M0HA 4GMEA 1ZPTA 2GGGA 4GI8A 2Z00A 3LV5A 2GOUA 4Q8WA 2CBIA 4JYDA 3UESA 2D22A 2UWFA 1CGXA 4XKYA 1E5JA 2IKJA 2YGYA 2HEJA 3GXNA 1V6VA 1FP9A 4LF1A 3SI9A 3CYVA 3JZUA 4PMVA 3FAWA 3KP1A 1LTDA 2FFCA 2E25A 3F4VA 3S1GA 4B3LA 3CJPA 3UG4A 5JBFA 4YYCA 4UIOA 3NZ1A 3NJ3A 6A3HA 2XWDA 3LBMA 1VYRA 1EXPA 4KIRA 4K8HA 3VZZA 5LKYA 5A94A 3H6OA 3P61A 3N25A 2R1LA 3KP0A 5HOSA 2IMRA 1E1CB 2OZ3A 4HQVA 3EDEA 3GO2A 4NU7A 5HWNA 2HV5A 4I9MA 1Y5VA 2VM8A 3KE0A 4RZBA 4YN5A 2BOEX 1JF6A 4YVXA 4ACZA 3DX5A 4AEFA 1TRIA 1LRNA 3BJFA 4IQEA 9XIAA 1JUEA 3HQ1A 3NM1A 5IRPA 3UJFA 3WZ0E 2DSWA 3G1HA 4F2UA 1S2WA 3MO7A 3FXYA 3W1MA 1BVWA 1GJUA 3G0UA 5DMLA 3FX4A 4OWGA 1PZ3A 4CN6A 4ORMA 1XFCA 4XAGA 2PWFA 4H9YA 5REQB 2B0MA 3VABA 1J12A 1WDQA 3RNDA 4XAFA 3TZNA 4A8NA 4DPPA 4DZIA 1RALA 3W83A 3G1XA 1V03A 3I7SA 4GI6A 1ZBWA 3VKJA 2HS6A 4C1NB 1REQB 3GTHA 1JNDA 5DBTA 1WDWA 1ODUA 3HQNA 1CW2A 3MP3A 5D30A 1BPLB 3DC0A 2XISA 1XBZA 2CZ5A 2ISFA 2G41A 3TAOA 3ARYA 1U30A 4HN8A 3FVMA 2QPSA 5I3GA 1E56A 1BYCA 3SM0A 2CPUA 3TYUA 1HKIA 4H2HA 2X7WA 5H6HA 2WCSA 2VX4A 4REQA 1KR0A 3BV7A 3OHIA 1E6NA 2VELA 2OZ8A 1UWRA 3A4AA 2EPMX 3AUJA 1PTAA 1ENUA 1N55A 1XRFA 3HG3A 1IZKA 3BICA 3BJTA 1KKOA 3UA3A 3WJZA 3EX1A 1OFPA 4AAJA 3M0LA 3LXBA 1QW9A 3SUUA 3OB8A 3QHMA 5E1QA 1OIMA 4J2MA 1YW1A 4N9EA 2CFFA 4FNQA 1EJRC 4KWOA 2ZX5A 1FWFC 3VNYA 4AWSA 5I2UA 4QGCA 4GJIA 2DGAA 4H8HA 4IG2A 4PUEA 2IQDA 2JKEA 4NQ1A 4J3SA 1TVLA 2ASHA 1OC7A 3N4FA 2WB5A 4YU1A 1GOIA 2YFNA 1XLDA 4UBPC 2XVLA 1JL8A 4HBKA 4W5ZA 3C2YA 3STEA 4GISA 4JCLA 4UZUA 1W8SA 3TDFA 4MY9A 4B5SA 4GC3A 3I68A 3AU6A 1CXKA 1DWAM 3O63A 1FH9A 2ALDA 2QDHA 1WUEA 3ANUA 1JD9A 3KBWA 3K8MA 1VBGA 1IT8A 3SN1A 4UR9A 2X2YA 3AYSA 2RDWA 1AMKA 5C71A 3IAPA 5AHLA 3BOFA 4L9XA 3ZJ7A 2DIEA 2XH4A 1XDLA 2AGTA 2ZX7A 4KGJA 2OPJA 4UTHA 4GNVA 4EWJA 4ZXOA 5G1YA 1M5WA 5C70A 3MA8A 4Z2KA 3PTKA 2B4GA 1XICA 1PUDA 1RPXA 2GJPA 3V1PA 1FHVA 2I5QA 5H8PA 3VKKA 1GWJA 2PLKA 5LGXA 4FF5A 2PBOA 5T26A 3ITOA 4ZL1A 4AY7A 2FJKA 1VLIA 1K02A 4EIVA 1V51A 1VR6A 3TOYA 4IIBA 2DW7A 1KM0A 3T0BA 2INZA 4E5TA 1EJVC 1Q66A 3S1VA 4IMGA 1UWQA 4GA8A 3VD7A 2DSVA 2R1PA 3FAXA 3CM4A 4Q4QA 1QOXA 3E0VA 3FA3A 1IR1A 2KZHA 4ZQNA 2DZTA 1KTNA 4LW7A 1J10A 1FWEC 5RUBA 5E09A 4CEUC 2W5FA 5XINA 2A5HA 1DWFM 5GNYA 1NJJA 4HA1A 2Y61A 1M7XA 3CHDA 1AJZA 4QP0A 5B7ZA 1ZAIA 3PHAA 3LHZA 3DI1A 3UR5A 3RU8X 1MUMA 2OOFA 5IXEA 4NAFB 4ZQMA 1W3JA 3TEVA 1KM1A 1E4IA 2BLEA 4IM4A 2P3EA 4QXIA 4DUVA 4OVXA 5IHSA 4AUBA 4PRRA 2YL6A 3BGGA 4ZQOA 4EWND 3MHFA 2FZBA 1PV8A 3PTMA 3TWAA 3C3UA 2QAPA 4QX4A 2VR2A 4KEMA 1OCJA 2Y7EA 4ML9A 3SB0A 5JMUA 5BYWA 2V5DA 1XRTA 1GK8A 3OBAA 4MLJA 3ZJ8A 4HK7A 3I65A 3W27A 4GZ7A 5FAGA 5G5IA 5CLWA 3EDJA 2Y6ZA 4F8XA 1VCFA 1SZFA 1V0MA 2XWEA 1TRDA 3SBFA 4EACA 4HIBA 1P4CA 3NDYA 5F2IA 3WJWA 1F3XA 1EQPA 2ZA2A 4LY4A 2WSQA 4GKLA 3CS2A 3VYLA 4L4OA 2DH2A 1FWRA 1A5LC 4DO4A 3DKJA 3WN6A 4ICCX 3OHMB 4YVVA 3I4KA 5EMKA 2ZUNA 1WE5A 3A5FA 2V30A 2VWSA 4CU6A 4Y8FA 5FD0A 2C6QA 5HUPA 5IFTA 2EBNA 1OFDA 1QO5A 3KCJA 5D4YA 2BMBA 5HA7A 3KVJA 1YNPA 1O66A 3VNDA 3L9CA 5CBJA 3QW3A 1X96A 1V0KA 3R0UA 4P7LA 1EGVA 3EWYA 3LHVA 4HB7A 3GHTA 3L0GA 1OM0A 2O0TA 4TTUA 3KS6A 4QCEA 1KBLA 1SU5A 2PCEA 4XIAA 1XD0A 5FEWA 3GXDA 3BLPX 2W79A 7XIMA 3QQWA 3DFHA 2BZNA 2OLSA 3NQAA 1CZ1A 4Q22A 3GDBA 3N2OA 4ZQPA 2QXWA 2QMKA 1U5HA 4UOQA 3NQMA 4HU4A 4H7ZA 1NF0A 1YQ2A 4Z1CA 3J7HA 3LGEA 3M9YA 1RA0A 1EA0A 4RNHA 3WK0A 1M6JA 4KQNA 2Y70A 3LLFA 4WQ6A 1UUMA 2VO5A 4R85A 1VRDA 1LOSA 4NASA 1H3GA 4JIIX 1OX4B 2D2GA 3L4UA 1QASA 2FB2A 2ZRYA 3L0KA 2GVGA 4IXXA 4Z2IA 1NAL1 3M6DA 4LB4A 2Z24A 3IEBA 1G0CA 3RN6A 1BD0A 2ZZ1A 5I06A 2VQTA 5E70A 3EB2A 1R87A 2EJAA 3GDMA 5DRCA 3PUOA 3B9DA 4PTNA 3SRKA 5CG7A 2EPLX 3GC4A 4HNTA 3AJ7A 3K1DA 4GUHA 3KWSA 1UKTA 3OU8A 1NDWA 3W7QA 1DBTA 3LY0A 3UG8A 3W01A 1V77A 1XF0A 5CPSA 1GOOA 1J0IA 1FHLA 4AWTA 5LYRA 3B06A 1X7IA 5MHBA 1VYPX 3R0KA 1R9ZA 4BQ3A 5FF3A 1AH0A 2DY3A 3LN3A 2P0OA 4E8CA 2YCLA 2PWHA 4OJYA 1HL8A 1US3A 1VFMA 1KCLA 1MZRA 1TPC1 4NZJA 3AS2A 5L6UA 1LRTA 3PF3A 4U5KA 1GTEA 3O06A 3W7MA 2A85A 3IAQA 2OKOA 4FXFA 4WOQA 3GYCA 1JPMA 1SW3A 1HJUA 3AMGA 4G56A 2BBFA 4P7RA 3CQ0A 4CUCA 4IJCA 1VBHA 3C6CA 2ZBTA 2R94A 2ZUMA 4TVDA 2YCEA 2XH7A 4W7WA 1SVDA 4N9DA 3VM7A 6TAAA 3QPYA 2PWGA 3CWNA 4QJ4B 4AIUA 3UPBA 1I9CB 3GVGA 4CU8A 3FGCB 1XRVA 4JTEA 5I0DA 1A0DA 3MI2A 3UU0A 2FIQA 5AHMA 3KRSA 3VIFA 3M64A 1GOXA 2WCGA 1EP3A 3BZJA 2QUNA 2VDHA 3AHXA 3LCHA 1R6WA 1WKEA 1SZNA 3S2JA 7CGTA 5D33A 2WHJA 2DSZA 1H7WA 4XD5A 3EEZA 3FIGA 2Z1KA 1K77A 2Q01A 3BSGA 3U57A 1AW5A 3ITLA 4XTDA 2OWCA 2CLIA 4F0KA 2DVUA 1DORA 1N82A 2CKRA 3QC3A 3IRDA 3H21A 1W3TA 1SPQA 1DXEA 2QF7A 4M29A 4UTTC 4PUJA 1RQBA 2QDEA 2R1KA 4LS1A 4DZ5A 1V93A 1ME9A 3FFSA 3LCXA 4MM1A 2GVLA 1F61A 3Q65A 2PUZA 5CC7A 3RK8A 3QY7A 1CCWB 4JX6A 1P6BA 4ONVA 3MO4A 4HP5A 4RE0A 4AZBA 1BXCA 1C93A 4UOZA 3AYRA 1M53A 1Z8AA 2B31A 3GKAA 3RO6A 3C52A 1Z3NA 3T40A 4H04A 1S2TA 2MANA 5CC5A 1Q7ZA 1S1RA 4LNCA 3CQJA 3U7BA 4IFOA 4B2DD 1U1HA 4GJ1A 3EWDA 1FDYA 2DVTA 3DOPA 1HX0A 4QQ3A 1W3KA 1KV5A 1TR9A 1RA5A 1JCMP 5D2VA 2QCEA 4H7VA 1GEQA 1UZDA 1ZJIA 2PDHA 3WMBA 2QUVA 3DYOA 8A3HA 4FOKA 4ZOAA 3CZGA 4FIQA 3ZWTA 2J7GA 4GVHA 1DYSA 2VZTA 2J74A 1XFBA 1H0IA 4MG4A 4L1XA 3PJWA 3T7VA 2V6AA 2QCDA 1QUMA 1NH6A 1LYXA 3UJRA 1XLBA 4GACA 4FO4A 3S46A 4XTIA 5JIPA 3BK0A 4PCPA 1ZNNA 4IOTA 3TC3A 4G9PA 1F6YA 3OQEA 1HKWA 1WXZA 4KCTA 4DYKA 4O4WA 1PS9A 1NU5A 1NDYA 3DHUA 1YYAA 1OJXA 3E5PA 3LI1A 4HYRA 3MHUA 1TVNA 2AKZA 3P7YA 1IGWA 1KGXA 1TZ9A 3SUWA 1DJIA 1CWYA 1V3MA 2ZZ3A 3VCRA 1TMLA 5HANA 3EA2A 3WQGA 3W1PA 1XIEA 3GTNA 3PN8A 3CWOX 3DHDA 2O9PA 4UQBA 2YYUA 4O8RA 3UJEA 1JCLA 1R86A 3NPUA 3SDOA 1A0CA 2GJLA 3MUZ1 1VFHA 4DF1A 4QRNA 1Q63A 3LCGA 3HPSA 4H7CA 2Y7GA 1XQKA 1V5XA 5CGMA 3CGTA 4L7ZA 3MUXA 4LEFA 4XVEA 2X09A 3FOKA 4ZBCA 3IIXA 3GSMA 3TV8A 1HZYA 2P1FA 2VCAA 2ZIDA 4A05A 1EO5A 2GJXB 4ZE4A 3ZXWA 3N13A 1H11A 5IM51 1E0XA 4WRHA 4DLFA 4GIYA 2BV9A 3CH0A 2DDXA 3MWAA 5HATA 1XIJA 5CPOA 1Q4NX 3UR7A 1LM1A 3VDGA 4YMZA 1ODZA 4PULA 4ZB0A 3EDDA 4DBDA 1ITUA 2QCCA 3P5ZA 4HJFA 4GXPA 2O9OA 3W7JA 4G1KA 4E6MA 1HG3A 3W4RA 1RD5A 4GWEA 1T5AA 4C90A 3UG5A 5AHIA 3WH9A 3ABQA 1GONA 2PDYA 4U3CA 4C1LA 2X0YA 2Z0IA 3NXFA 1J18A 3WUBA 2FVMA 4BWLC 5A2BA 3PZNA 3E49A 4A3HA 6REQA 3GZ3A 1M7OA 3VGGA 1YRRA 4CCZA 3IIOA 1TUXA 4K37A 4X2PA 1E6XM 4I8YA 3SGUA 1YTEA 2YXOA 4LBUA 4LX4A 1J01A 2XFRA 4XZIA 4A3RA 3QMTA 3D6NA 1RQHA 4MJ4A 4EF8A 1EDGA 2V3FA 3NL2A 3W00A 3WD1A 3UD6A 1TPB1 3EZ4A 4JKMA 1X97A 1FOBA 1DIDA 4O1CA 5M17A 3HZ3A 4J2PA 2HQAA 2C3ZA 3GVQA 4OT7A 4NJJA 3WMLA 2WMKA 3I10A 2JK2A 1EYEA 4UTLA 2QPUA 2QQ6A 3UZYA 1DJXA 3PNZA 2NV9A 1LORA 3QZEA 1PTDA 4H1ZA 2J9YA 4EP8C 1DWGM 3L4WA 1MDRA 2G50A 3VC6A 3A3WA 1XDJA 3LM7A 3B05A 1VBUA 3GBDA 3JW7A 3CTTA 3S8HA 4YTTA 4NZ1A 4DUOA 3UWYA 1PPIA 4NILA 3M0ZA 1PHWA 4W9TA 4XBSA 2ISSA 1UD2A 4O18A 2XSAA 2O7QA 4YJ5A 3TVAA 4D1IA 4V15A 4MF4A 1JF5A 1VFLA 4AIEA 3E38A 4IMDA 3C2VA 3EWCA 4XBKA 2QAFA 4CKQA 2IXUA 2ZOXA 4OBSA 2IPWA 3TTOA 4Q8MA 1HN1A 2J47A 1I0BA 2E3ZA 2VOMA 1W1ZA 1VHCA 1JPKA 2GVEA 3N9KA 3IVUA 4TMCA 3IK4A 3EDFA 1HT6A 1QHPA 4OBRA 1W9BM 2IKIA 2VDIA 1EGZA 2D69A 4FB7A 3W25A 2W4XA 3DUGA 4XO7A 4QHRA 4NXSA 3GU2A 2AL2A 1WP6A 1KV8A 2QCMA 3KLKA 3C0SA 1Q65A 4I7UA 1K7FA 1WQ5A 4D6IA 4KRZA 3GQYA 3AIQA 1B3XA 3FSUA 3N6QA 1VPQA 3HMJG 3UT0A 1E9LA 4LGXA 3UA4A 4GVGA 4BCEA 3AXHA 1GQNA 1PKMA 4JL2A 3BOLA 3HGOA 1A5SA 4MZ8A 3DGRA 1X39A 1UWAA 1IE7C 1D7FA 4MHBA 1JRBA 2F2KA 4F0RA 1CI1A 1GUVA 1TPUA 2INFA 3LHUA 4QG9A 3OLGA 2RDUA 2IKGA 2P0IA 4IL0A 3GH7A 3ANYA 1EXBA 2WMGA 2NSOA 1GT8A 5D09A 1P48A 1EBGA 5ABHA 1DJWA 4LSBA 1H50A 2XJ7A 3U4FA 1G4PA 1WDSA 1NFBA 1NQKA 1XYMA 4K8EA 3LK6A 4ROQA 1C8XA 3THAA 1YDOA 1IWBA 1O5XA 3L4VA 2J88A 5HULA 4FNPA 3MZ2A 1Q6DA 1PKYA 2V38A 4NSBA 2YSWA 4V1YA 3BMXA 1Q8AA 1XG3A 4PCFA 3V0TA 1SW7A 1I60A 1MQQA 1PX8A 1QAPA 1E4LA 3BSHA 3YPIA 4U4MA 2J7BA 3WMCA 3M0IA 1U33A 1SZRA 3QOMA 3EDKA 3T42A 2AQWA 1NDZA 1GNXA 1RBAA 4KFOA 2OEMA 4O12A 1MFUA 3SJ3A 3I7QA 3B0XA 3CUGA 4FOUA 3IJIA 5DEZA 3W1QA 2PU1A 1LG1A 3MY9A 4TIMA 4NX5A 1KXVA 1NY1A 4FXRA 4B9YA 1I8JA 3NGFA 3WLPA 1UZ1A 2D23A 3CO8A 1GYNA 3GNRA 4JNMA 2E77A 4TXEA 1H63A 2ZUSA 1VCGA 2CITA 4PCTA 1W54A 3EWXA 4HK6A 2WQPA 1MWOA 4IHCA 1OX5A 2V3EA 4Q7NA 2FH6A 2J66A 1UWSA 2A3HA 3W2NA 1OC5A 3F5JA 4PBFA 2VVSA 2BODX 3EPNA 5LZLA 1GJPA 4S3JA 3CZLA 2OJPA 5BU9A 4NNAA 1KCZA 4GCXA 3NEHA 4QDMA 3GTIA 1VFUA 1FXQA 1RZMA 3RU6A 2QJHA 4GJJA 3R89A 4B5TA 3HQPA 5E0FA 3K1GA 3FEQA 4ES4A 1TG7A 4LUTB 1QOPA 2FJUB 4H8UA 3MV01 3M6YA 2D20A 2NQJA 2DSKA 4FNSA 3KEHA 3A6OA 5LHEA 2ZFAA 1IEXA 5CSSA 4FS9A 5EGRA 5A6BD 2CLEA 3CUJA 1XBXA 2DVXA 3PZQA 1JVNA 3M7WA 3C56A 1M41A 1O5RA 1KTCA 2JE8A 1F73A 2QUUA 3DFTA 5DBUA 2YA0A 1AVAA 4QSHA 1FH8A 4GLEA 1E0UA 3TU9A 1EJSC 4BI5A 2RFGA 3GR4A 4O1EA 3H54A 4R5EA 2XIBA 3HGRA 1FKWA 3S5SA 1XC4A 5AYIA 1QPOA 4YTQA 3SUVA 3EMZA 2ATSA 3TCEA 1DOSA 4Q8NA 1XCXA 1K8CA 1GG0A 3BAKA 3G0XA 4RK8A 3DYPA 3R6IA 1LF1A 3BMWA 1JUBA 3GYEA 1XKJA 4YWIA 1QPRA 2D2HA 1ZENA 2DJLA 1R3VA 3GNOA 2QEZA 2QV5A 1OGGA 3OPSA 2ZICA 1E15A 1RH9A 3OVQA 1XYCA 3SRDA 3KHDA 3WLLA 4L80A 3PS7A 1MXSA 4JD4A 5U4NA 4H9MA 4MAVA 2BHZA 2Y0FA 2UY5A 3EX6A 4GH3A 3DFOA 1K9TA 2F6KA 4ZTYA 5IDIA 2TMDA 1D3HA 3ZR4A 3GDTA 4PTVA 3EWUA 1A3XA 2DT3A 7REQB 1QDSA 4WDXA 1UZ4A 3W6MA 3WLRA 3LD5A 1EX5A 3AHVA 3RR4A 3F2BA 9CGTA 3TC6A 2WPBA 1F4AA 2J6VA 5IOBA 4UFKA 1YE6A 4NG3A 3O0FA 3RLHA 1Y8BA 4QJ3B 3WLOA 1VGAA 1PE1A 2G8ZA 4W93A 2CLPA 1YBQA 1IIHA 1TWWA 1L2QA 1QFEA 1J93A 1XCFA 1UC4A 1JXJA 4X9SA 4ZO8A 5LNWA 3G1VA 1KFCA 2G3FA 5JBDA 2EPOA 4ZTXA 1KWKA 3TNBA 1V7AA 3FLUA 4WF7A 4HKPA 3DENA 4JIEA 1HJQA 4RW5A 4RW3A 4LYKA 5TQLA 2PDCA 2RKXA 4WEVX 1YNYA 5ABTA 5HBFA 4N02A 2XPKA 3G6LA 2PE4A 4WLCA 3TX9A 1FP8A 4HPNA 3S5NA 1WO2A 3GHUA 3IUHA 1XIBA 2BS9A 2XU2A 4Q4OA 3W24A 3NUKA 4KCUA 5FSEC 3EWBX 1QK2A 2TSYA 4H6RA 1W1PA 2A79A 3SCPA 2V0TA 1XBYA 2G96A 3GFZA 1OGSA 4HPXA 1TELA 3EOOA 1CGYA 1WDPA 2VEGA 3N29A 4S3EA 3VM5A 4B5NA 1ONWA 1CPUA 4RDVA 4JIQA 3CL8A 3VKAA 2WMIA 3UETA 5JU6A 4UTTA 3W37A 5DMNA 2OWXA 3C2OA 3KDOA 4L9ZA 2A3EA 3EPOA 3NPVA 3K30A 4IMCA 3BAJA 1M03A 3REQA 1ECEA 4XKYB 3L65A 4LB3A 4IT1A 3NL5A 1ZTVA 4IMFA 3A4JA 4A8LA 1G7VA 2NVAA 4B9ZA 4N2YA 3W7LA 3H2FA 4MNMA 3I6EA 3S1UA 1FDJA 3FKKA 1JIBA 3LGDA 4INFA 1HJVA 1E1EA 1XIIA 1Q6FA 1HKKA 2HE5A 4WJ8A 3AIBA 9RUBA 5ABFA 3LNPA 4DF2A 3SW6A 2E5CA 1A3HA 2ZZ6A 1AD4A 2ZRXA 2CETA 5EL1A 2BFGA 1RCXB 4HU3A 3NEVA 2ZZ5A 2WO5A 2OSXA 3SURA 2X0SA 1GOKA 4ACZB 4BI6A 4PUWA 1I4NA 3D0CA 4PSPA 1OC6A 5FAJA 3JR2A 5FF7A 4C6BA 3L23A 3M5VA 1J2BA 3E02A 1MEWA 1ZCCA 3CUHA 2BG5A 3R58A 4GPNA 4AZ7A 1O5QA 1J0JA 3CL6A 1VFSA 5AZ0A 2PTWA 1RV8A 2E1WA 3FJLA 2R1MA 3GNNA 3UVAA 3USZA 3TA9A 2XH2A 4JOMA 1VKFA 1FVPA 3N11A 3AUOA 3CPGA 1X1OA 2VYOA 2E28A 4DZHA 3VIPA 1PIGA 3AC0A 6ALDA 3B0UX 2XZ9A 1KBBA 1GVQA 1Q4WA 3R8HA 4KESA 1TUFA 1TWDA 4DJDC 2PSNA 5H8UA 2Z26A 5D9PA 4DXVA 4DO5A 7TIMA 1C9WA 3WDQA 3P3BA 3CLWA 3THCA 3ZYZA 1TX2A 3LBCA 1L6GA 2ANUA 4O1DA 1M7JA 3AO0A 1MEHA 4REQB 3RMJA 3I6RA 1TVPA 3W2KA 3BLEA 3R43A 1OK6A 1GQIA 1NSJA 3LU2A 3URQA 4CCEA 4AG0A 4U2YA 1QPKA 2YB1A 4MFEA 4GYJA 1CXLA 3W6YA 5ABGA 4H9TA 1TTQA 5HUOA 1HKJA 4Z2HA 4C6OA 4J40A 2FTPA 3E0IA 1H60A 3WNLA 4PMZA 3FY1A 1Z32X 1PJ9A 4GQGA 2XM1A 3BJSA 3VIKA 2E1DA 1XYAA 3A3HA 3ARSA 3CH9A 4IGSA 4AHQA 3MPGA 1LL7A 4IG2B 4F9DA 3VIGA 2ZTKA 3WD0A 3SCWA 4O0KA 1QI0A 4PMOA 5J8LA 3BV4A 2WVSA 3IGHX 1GCYA 3LPGA 1MXDA 3LUTA 3QY8A 5AYXA 3HG4A 1WKFA 3OODA 3SRHA 3Q94A 4A4AA 4GUJA 1BF6A 1Q6EA 4UUIA 5DT7A 3SFKA 5CZKA 2WBKA 4BWLA 3VUPA 2GGIA 1R3RA 5M2FX 1BRLA 1QVBA 4CVWA 3UWWA 4E2VA 4AFYA 1Z9AA 2G97A 3WL0A 1W9PA 3SCUA 1K8YA 3C8FA 4M6UA 8TIMA 3W7HA 3G1DA 2TODA 3UJSA 2BASA 3M0VA 1GVEA 1VYSX 4L61A 3W7EA 1GVYA 2CHRA 4FA3A 5C8BB 3W70A 1UP3A 1VC4A 3DECA 3I6TA 4AVFA 4QQUA 2PDWA 1GVIA 4TV5A 1XYFA 4QE4A 4RCXA 4ASTA 1PWMA 1CNVA 1KFKA 3WENA 5A8NA 1CGUA 1XYLA 3WMSA 3P62A 1U2YA 2Q8ZA 5EA9A 1LLWA 2PCQA 2J24A 3GD6A 1FWHC 1UUOA 2CLHA 4BS0A 1OHLA 4MB1A 3VNMA 5E9XA 2DSUA 1J6OA 3DU0A 1UKPA 4J3UA 1TSIA 3WKZA 3TTSA 5CZSA 4GI4A 1E3XA 2CIPA 1GOQA 2PDIA 3KRZA 4GUFA 4LBRA 4IQDA 2ZDRA 1ELSA 1TWZA 1J0KA 2WYSA 2CHOA 4N6EA 3PR2A 5I3DA 1E43A 1Z6KA 5CAKA 4MKVA 1DP0A 4JQ2A 2D3NA 2QNEA 3VD3A 4DZAA 2WOQA 2J13A 4PRWA 3RJXA 1X6UA 2GJNA 3OZPA 5E5CA 1LLOA 2WHMA 3ZO9A 1W0MA 3LTYA 1Y5XA 1F8IA 1A4MA 4XZ9A 1JGIA 2WJFA 2W0UA 1B3YA 1UJPA 1KXTA 2Y85A 5BZAA 4E8DA 1N8IA 4NKCA 3VOFA 3L5LA 4GCAA 1W9XA 3CTLA 2DORA 3SCOA 1TE6A 4UTMA 2ZE0A 2XSXA 4M24A 3W72A 1YXCA 3W88A 3NM3A 3L67A 4RZ6A 4UB9A 3L5MA 4C6JA 3W76A 2FMNA 1Q7QA 5BRBA 3KFTA 4UFJA 3FA4A 3O6CA 5I79A 3B8IA 1WYIA 3OVPA 3TZFA 2ZX6A 3TTEA 1NWTA 3TONA 3RM9A 2AMXA 5EMJA 5HJXA 2ZCGA 1Q8JA 3B0PA 3E0WA 3VINA 1IHIA 4JTSA 3UY7A 3OBKA 5AC4A 2F84A 3ZOAA 1MRAA 3G22A 4UR8A 4KIEA 1PZ2A 3LXCA 2EG7A 3EEGA 2E0PA 4KCVA 5BRPA 2VKZG 1TTIA 1TQJA 1E4MM 5AOUA 5I6SA 3ONCA 1BQCA 2CCRA 1R3TA 1KRCC 2CLKA 3SEPA 4LUJA 2ZA3A 1YXDA 3AU2A 1A5KC 1HKVA 1GOMA 4DX3A 4DWSC 1PDZA 3VNLA 3GIYA 3O6AA 4Q8UA 4UMBA 2CLLA 3MSYA 4H41A 1UP0A 4DUXA 3NO3A 3CMGA 5A6AA 1F6KA 4I6KA 3EXRA 2YIHA 4UWMA 3VD5A 1FXPA 4FI4A 4UTFA 3NURA 2FB3A 3QVQA 3A5VA 4UFMA 4YWSA 3UZ5A 1R2RA 3DKLA 3U8GA 2OSWA 4V2XA 3URNA 3BQ5A 1EUNA 2EG8A 3NL6A 4LS0A 4ZO9A 2FDSA 4MZ1A 3BLDA 1I2QA 4LRTA 1P0DA 2Z2UA 1EJ7L 4QSFA 1AJ2A 3OA3A 3VDAA 4R88A 3TH6A 2ONEA 2YA2A 3G3MA 3BUVA 3N9SA 3VKCA 5AN7A 4UQCA 1KO0A 4DB7A 5EFDA 3LENA 5CPLA 1KM5A 3CC1A 3MDUA 2I16A 4AH7A 4C6CA 1E6RA 1JZ6A 4KFNA 3CO4A 4QR6A 4N9BA 3H2AA 1WZKA 3PY2A 2GDQA 1BGGA 2OZTA 3G1FA 5KINA 4Z2GA 1EP2A 3LMYA 3Q67A 4WXZA 1HO1A 5E0KA 4AWEA 4WUIA 1UD4A 4U5IA 4ALDA 4NHVA 3QGKC 1FCVA 3PWAA 2Z1SA 3ZJ6A 3W23A 4XZNX 4L65A 1VBJA 2YCLB 3UZXA 1IT7A 2GSHA 3UWQA 5AC7A 1POKA 2CLFA 3DIPA 2ICSA 5G4EA 5TBOA 5HMSA 2W91A 3NZGA 5C7HA 4S38A 1JFXA 2YCKX 3QN3A 1ONXA 1EPVA 3STFA 2VQUA 3M0MA 4PBEA 4AX6A 3LTPA 3EB4A 5GJNA 4LOCA 2WSYA 3WO8A 2XUCA 1A3WA 4HOXA 1KNWA 3MHGA 4JTUA 1FWTA 3BOXA 2ZXBA 3AOFA 3LZ5A 4AD5A 1RQEA 3TOPA 1FCBA 3T1GA 2OKTA 1RJQA 2DFAA 5CZTA 3LCWA 3LZ3A 1JDDA 1C92A 3LHTA 1V3LA 4UTWC 1XLJA 3MMDA 1HP4A 5CJMA 1BVZA 5KITA 4HN4A 1K70A 3W7NA 5C6MA 3MSGA 4R7JA 4Q8VA 1PVNA 1P0BA 2J8GA 4D1JA 2FLIA 2PP3A 3CQIA 3WJSA 3U0HA 1X1NA 5HQMA 3PZMA 1LZOA 4I8DA 1EBHA 1UA3A 2DQWA 1YPXA 3TXVA 3QFWA 1F3TA 3UXIA 2GVJA 2DUZA 5G2HA 3PFMA 3A9IA 5TIMA 1H61A 3MUAA 3KS5A 2V3GA 3PAJA 5LNRA 2PC4A 4FHAA 4TX9A 4GIRA 1DV7A 3WNOA 3DH7A 4X2RA 4GY1A 3PWIA 3KVLA 3XINA 3QYQA 5TAOA 4AY8A 1TWSA 7ENLA 1K6AA 2R1NA 5HNUA 3RUBL 2A7NA 1LRQA 5C2XA 3FJNA 4BR1A 3EA1A 1W5NA 3EPMA 3TR9A 2UV8G 2QZRA 2VUNA 3RX4A 3WLHA 3PBYA 1TJRA 3GRIA 4HHPA 3NIYA 3EKGA 1JULA 3IGSA 1UQZA 6XIAA 3LB0A 1N8FA 2EPNA 2UY2A 4HMNA 1YLVA 3B8TA 4XAYA 4JTAA 4W8AA 3CB8A 3RLUA 4KWWA 4RR4A 3WSUA 1V02A 4N0RA 1MDLA 1WDRA 2P3ZA 4NZFA 1JZ2A 2OT1A 1BYDA 3KBVA 2C15A 4UTUA 1QHZA 2V68A 2Y2WA 1EPXA 2ZZ4A 1I45A 2J7FA 2ESCA 2Z28A 2VEKA 4ADUA 2QCDB 1XIDA 4Q32A 4FOJA 2PAJA 3PP7A 4CD8A 1YE4A 2D0GA 3R8GA 2VOTA 3B40A 1B0IA 1DWJM 3FYPA 4M56A 4WX2A 1ISYA 2XN2A 3TN6A 1L6YA 4WXYA 1M04A 4UQDA 2VL4A 3WQ4A 2TRSA 2RDXA 1WBHA 2VC7A 3S42A 5IDZA 1XV8A 2GJRA 3DN5A 2J7EA 2V82A 3HG2A 4AU0A 3KUMA 4MWAC 1Q2RA 4K7YA 4WSHA 5D9OA 2DZWA 4HZ6A 4OIFA 5I77A 3T0AA 1S3TC 3NO5A 3KBNA 4FIRA 3H7RA 1Q6OA 1GKPA 3WY1A 4CGTA 1IZJA 2ZXAA 4Q4MA 4DYJA 1S46A 3GU1A 5HNNA 4GXMA 4O8AA 4IQJA 3F7JA 2PDUA 1WXJA 1P0NA 2D0HA 4FX7A 2FYMA 4OHQA 2WNQA 4YL2A 2OYKA 5JQ9A 3UVIA 1CB2A 5A1AA 1GZJA 4WY0F 3UW6A 4KPLA 2I17A 1UD6A 2Q6ZA 4KS0A 3W75A 3M0JA 3VI2A 4U3AA 3GWQA 5G2WA 1KWGA 3F5KA 1E6PA 4A6GA 2YB4A 2WVUA 3WLIA 4OZOA 2OOGA 3VCCA 3AHZA 3M1ZA 3EWZA 2ZRVA 3VGBA 3QGAC 4GC4A 5FJIA 3V3WA 5AVHA 3SSZA 4FR6A 4HPHA 4QEEA 5D02A 1BVNP 1NFGA 1UUQA 1SGJA 1CTNA 4UTJA 3WFLA 2CYGA 6REQB 5J5DA 2WHKA 2BGNE 2NWSA 1JCNA 4DYEA 1TCMA 2VGFA 5KETA 4KWVA 1BQGA 4EVZA 1RJRA 3M0KA 3N4AA 3AYTA 4AEOA 1A47A 4DJDA 4IQLA 4Y6GA 1R0MA 4RNFA 1T41A 3ALFA 4GBUA 2VRKA 1PIIA 2CWNA 3HV8A 2GK1A 3ME3A 4ZOCA 3R13A 3TE9A 1XKYA 3GZAA 1OFEA 4AISA 3RLGA 1X38A 6CGTA 4XZWA 3F03K 3FEMA 1H09A 1H49A 5M3WA 2XGIA 2BP1A 2QGHA 2WSPA 3VNJA 3CEPA 1K4HA 1CLKA 1MFVA 1QI5A 3W84A 2VFHA 2Z7KA 2YOCA 4Z1BA 2WW5A 1GQKA 3TK7A 4RL3A 3ABZA 4MKNA 2DQXA 1TJ0A 1M1BA 4ECLA 2ZRUA 3LBOA 5DCBA 3W1LA 2WM0A 3UCQA 1KM6A 4X0VA 2ZVIA 5F7UA 5GVJA 1R46A 3M16A 4XX6A 1EOMA 4CNSA 1LBLA 3CHFA 3OTRA 3R10A 4LANA 2OODA 1DIOA 3L4ZA 5HNTA 1FHUA 1ZS2A 5H1WA 4C6IA 2E4TA 4HD5A 5DQPA 3SN4A 4Z17A 2BVDA 3OOQA 1MZHA 1UPMB 5HAOA 3LPOA 3GNXA 1WPCA 1ZU8A 1W9UA 3WLTA 1TPVA 5A6MA 1P1XA 1DQUA 2AKMA 2WMFA 1Q6LA 2QLYA 4HJWA 4YIWA 4RPPA 1GZ1A 1QNQA 3W7DA 1B3VA 5LA0A 5B80A 2HISA 4W7UA 3SQSA 4XUGA 3TN5A 5D8ZA 2AL2B 4PTMA 3C0QA 5BNKA 1N2VA 4CQAA 2BXVA 3P0WA 3T07A 2XM2A 2VC6A 5I3IA 2E9MA 5IBXC 2I9UA 1UR9A 1NWUA 1K8XA 1B57A 1UD5A 5T8GA 4NAEA 5EMYA 1H1YA 3PJXA 5I02A 5FEPA 3W2JA 1P1MA 4UMCA 1LOLA 4A2SA 4ZCWA 3KXQA 1F3WA 4GYPC 4IGMA 4IPPA 1MUWA 3MYPA 4PUKA 2W67A 1A4LA 3UCDA 4XK2A 1UKQA 1NP2A 1F7BA 3RPTA 2ZZ2A 2X30A 3UPMA 5T9BG 3IGXA 4ILSA 1LCOA 2DT1A 3HA1A 3Q4DA 3WDJA 4JKLA 3RIKA 2X1TA 5E0CA 3UXKA 4IMEA 2V67A 1PYFA 3CV6A 4I7WA 3H7UA 2NXIA 1YKWA 4PZVA 1F74A 1YADA 2OB3A 3OLEA 2V63A 1IXOA 1VRXA 3K5XA 2ZQ0A 4HSOA 1EJWC 2PRHA 1XW8A 4PCSA 1A5BA 2BGSA 3KRBA 2GYIA 3IS4A 3ITCA 3OYXA 3Q2DA 3S9IA 4NL1A 4EXAA 1G94A 2E8YA 5DELA 1MVYA 3GG0A 1UD3A 3GR8A 3B0VC 2A6LA 3MCNA 5E93A 3PJTA 2PA6A 1T40A 1FWGC 2FGLA 3KOWA 3LPFA 5BCAA 4KEUA 2YBUA 5A95A 1X8FA 2A3CA 4Y9OA 4NUWA 1QJWA 2VFEA 1PO9A 3CWHA 1W91A 2VFGA 3DXIA 3APGA 3SSJA 1FWWA 1ITQA 2INEA 3VGFA 1XIGA 3H4WA 4LJ3A 5G1TA 1KD0A 1TPWA 2WVTA 1CB7B 2D2JA 1P6CA 2RAGA 3ONBA 1KGUA 1EUAA 3LQGA 5C9XA 1UROA 1UR8A 2JGQA 5I09A 1EO7A 4P5UA 2NXGA 4JL1A 2YDSA 3INPA 1UG6A 2VHLA 4V27A 3S6OA 1LWJA 1YXYA 3KOXA 1J6PA 3BLKA 4C91A 1JDEA 5DN1A 3VCNA 4FMVA 4J5NA 3HOJA 4C7FA 3S4TA 4DUWA 1RUSA 1IF2A 4KERA 4AD2A 2XSBA 3DFNA 4DWSA 1CECA 3CUFA 1HVXA 2PGRA 5FJJA 1LL6A 4V1XA 1ZP4A 1H5YA 1ONEA 2YJQA 1H7PA 5MKGA 1EZWA 2GZXA 3VO0A 2J62A 3CZEA 4MYXA 4AWUA 2PDPA 4JX5A 1BHGA 3LX9A 4GQQA 2DZXA 3QH2A 3ELFA 4GE8A 1UASA 1GW9A 1UWIA 3TJXA 3H2CA 1SO3A 1K03A 3T8QA 2JIEA 3THUA 1CGWA 2BHUA 1V4YA 1S5WA 2GGHA 2I57A 1IXNA 5K7JA 4IPJA 3NQFA 1NFPA 2VX5A 4MPKA 3ARUA 4FX6M 4ZO6A 2ZC1A 4GKTA 4CD4A 4D6DA 1RLDA 1YDVA 3MVTA 2WK2A 3HIJA 2R9RA 1XH2A 3VXGA 3THDA 1V0NA 4C5ZA 4ACYA 3PBWA 1L8NA 3ABOA 1HP5A 2QR6A 3WBWA 4CNTA 5PTDA 4QLJA 3ECQA 1UIOA 1DEDA 5BXPA 1K7EA 2AGKA 4HNLA 3P2VA 1CXFA 3RG6A 1AL8A 3RCNA 2F8QA 4C6FA 1ISVA 4OV9A 4LBSA 2B7NA 2Z27A 1J4EA 1R3QA 1XLCA 2W27A 1QCWA 4LAKA 3W22A 5CGTA 5A6KA 2ODOA 2ZX8A 2Q8XA 4WKFA 2WZHA 2A3BA 3W1RA 3C86A 4KMQA 3ARXA 4F4RA 4YYFA 1D3CA 4JTKA 1ITXA 2JALA 2VCCA 4LCRA 1VFFA 1VHNA 1CYGA 3IWPA 1D3GA 1CXIA 3NPXA 4H6QA 5AC6A 3S1XA 3TYBA 1CT5A 3B8VA 3CPRA 3NSNA 3LG3A 2GSEA 2BY0A 3W1NA 1YBQB 2J8FA 3WH7A 5J04A 3ITTA 2VD9A 2CLOA 4IX2A 2VEPA 3LERA 1K1DA 2HROA 4FALA 2GFTA 3TSBA 4J3TA 1JD7A 5LIUX 4UTWA 4Q8TA 3URBA 1V6UA 4WJEA 3SY8A 3UWUA 4LV4A 3H70A 2QGYA 3LM3A 3QBUA 2ZTJA 4H19A 4JHZA 3TMQA 1R7OA 4C7GA 1EHNA 1CENA 4GO9A 3GFYA 2JGYA 1SR9A 3E12A 4AY1A 3K13A 3R11A 4E4UA 4S23A 3LV6A 4AVNA 4B5UA 1BYAA 4JDBA 4TR9A 3P67A 4X60A 4GGHA 2Y1HA 3BG9A 3UF9A 2C7FA 1IEVA 2XDFA 4D6CA 2NVCA 1XLAA 2HK1A 4CQDA 5FF4A 3W7PA 4J3VA 4WY0A 4DBSA 4DI9A 3KM8A 5HJYA 1VIZA 1L8PA 2PLJA 5CZ0A 3VA8A 4ATLA 3PUEA 2PDKA 4TMBA 5ECVA 3Q58A 4PGLA 3GVVA 2WMIB 1QBAA 2VCBA 3T0CA 3V36A 1ME8A 3TJ4A 1GVSA 4UXDA 3KBMA 3OGRA 3WUEA 5CC3A 2OZ0A 5BW6A 1MXGA 3ITXA 1O60A 3W7KA 3REQB 1JI1A 5FCZA 1TV5A 2ZXQA 3WQWA 4IXHA 4ENLA 4NJGA 3EAUA 1OABA 2VI0A 2Z29A 2ACRA 2PTDA 3QHNA 3QSRA 2D1ZA 4XD3A 4H00A 5I3JA 2VRJA 4S3DA 4AYGA 1OD8A 3E5BA 2PDNA 2PDXA 2NSXA 4C60A 3MUIA 3UZJA 1RVGA 3BVJA 3TSDA 1VP5A 3IIZA 5CH9A 4L6OA 1R9XA 2EKCA 3FYYA 5KZ6A 2VC9A 2ZWZA 2V5CA 4NZ5A 5ABFB 2FZ9A 4IICA 4HVXA 1ZGDA 3LQLA 5HNRA 3ZVHA 4JEQA 1XYZA 2WKJA 1ZALA 3AS1A 3QR0A 4JFTA 3IJ8A 2IPFA 3F5LA 4C6NA 3KLLA 1AG1O 5CXPA 1I1WA 1S3HA 3ARWA 4I9TA 5BOEA 1V0LA 4ATWA 1XUUA 1VPXA 3WQ6A 3FJ6A 4XVDA 1NARA 5TNVA 2WPGA 4J3ZA 4R9XA 3FDKA 3QV6A 4GZJA 2YDAA 3PZUA 2QJIA 4S3CA 5AHNA 3KTXA 2HCVA 3B0YA 3W73A 1XJBA 4LV9A 1BXNA 1J9YA 1D8CA 4Y9NA 8XIMA 1BGAA 2J77A 4GQRA 3T2OA 5AY7A 1EZ2A 5ECUA 2FHFA 1GQJA 1HW6A 1KB3A 3BCDA 2AAAA 1EJTC 4ZB5A 4E4FA 1IIGA 2VP8A 2ZUUA 4W86A 1OT1A 1CLVA 2V9DA 4D72A 1QNPA 2OO0A 1Y65A 4HA3A 1WKYA 3CIVA 3SAZA 1IXQA 3DCPA 1N7KA 2W6RA 3ARRA 2P76A 4EAMA 1XIHA 4MWAA 4TX8A 2B7OA 2QCFA 3T55A 3ITVA 3BH4A 3ABRA 2DT2A 2WV8A 1XLMA 3VMNA 4Z2LA 3E6EA 2CEQA 1SZGA 1NEYA 3G1AA 3VE7A 4B3ZA 4R33A 1DWIM 3BW3A 3U5YA 3VMOA 2P50A 3ZZ1A 1IT0A 2ZUWA 3Q37A 3ZT7A 2VR5A 3QV7A 2NWRA 3TYEA 5C7VA 4FK9A 4BHYA 5B7YA 4PMQA 2OWWA 1M9HA 3ITYA 3WEMA 4BA0A 2ACSA 4TX6A 3L21A 1HTIA 4MIMA 4PL2A 2OEJA 3K8KA 2QKFA 2Y7DA 3QKEA 1JG9A 3E0FA 4Y9AA 4AD4A 2J25A 3PZVA 4I6VA 3OLDA 1M3UA 3ZQ9A 2NV1A 1JPDX 4L64A 3FK4A 1EEPA 1BRLB 1E71M 3QLLA 4NT0A 4PUMA 2IS7A 2ZKMX 4US6A 2I9EA 2X16A 1K9DA 3WK2A 4Z1AA 5FA5A 2PZ0A 2DIKA 3N4EA 4DM2A 3UR8A 3BO9A 1Q6GA 3PM6A 4JNZA 1M68A 3HTWA 1PXGA 4WJXA 5CKSA 2L5HA 2NV2A 3MZNA 5BWAA 3TYAA 3EXTA 3GXTA 2C16A 2VXNA 2H3BA 3SZ8A 2NQ5A 3GX9A 5M03A 1TPFA 4QS5A 5GNZA 2EAWA 2IUZA 4MJMA 2B7PA 1X6NA 3KVKA 5AVNA 1AQHA 1C8VA 2Y8VA 1B31A 1RY8A 5HXMA 4H9VA 4HOWA 5AYZA 3SCSA 4JYFA 1DL3A 1XQLA 2GWNA 5LXXA 2X05A 3GM8A 1TO3A 4V33A 2JKPA 2YXGA 1VPYA 3SADA 2YW4A 1WDDA 2LLEA 3WQ5A 4GZEA 4HGXA 3S2CA 1KM2A 1B4KA 4LAUA 3AIEA 4NX0A 1JXKA 3L4XA 4RLIA 3ZR6A 3QFEA 2HXTA 4Q8QA 4H8NA 3AWNA 4POCA 1KRBC 1LUCA 4EANA 2EG6A 2E7FA 3TXZA 2REQA 2FPYA 4G7EA 4HSNA 5KSWA 3U6WA 1FY6A 5IHRA 4L4MA 1Y5WA 4AQLA 1E73M 1NQ6A 3N6JA 5DLCA 2D3LA 4P8WA 5HQLA 4AB4A 5A2AA 2Y24A 4MY8A 3GXFA 3TP4A 2Q3RA 3FVDA 1RBOB 3TYDA 1WKDA 5FEXA 1VFOA 1M65A 2WC3A 3GG7A 1XD1A 2NT1A 5BU6A 5I3HA 1J96A 1H7NA 3T2PA 1V3IA 4PTXA 3SR7A 2Z2BA 3CLMA 4K1WA 3N14A 2F2HA 4FPSA 2FMOA 4JTRA 3USBA 1WZMA 1FDZA 1ICPA 2PDGA 5IBXA 3F4NA 3S1WA 4JTQA 4OGZA 5DF0A 5FJTA 3MP4A 1XLLA 2JF7A 4MUZA 3EGJA 5BMWA 4MLRA 1ZSXA 3T4WA 4QITA 3T09A 1B54A 1XGDA 4CD5A 2MUCA 4GYPA 2O4MA 2YKKA 4A8IA 4HMCA 2V5KA 5CBIA 1SJAA 3C5QA 2ZXDA 3ID7A 4EPDC 1KQYA 3ORWA 5D32A 1MNSA 3EOEA 3VIMA 2OYLA 3I3EA 3CV7A 4LRSA 5BOFA 4DBUA 1VH7A 3HPZA 2GSJA 4G7FA 3VUSA 1Y7VA 2QJGA 2GL5A 4KKXA 4RE4A 1FFQA 4FXJA 5DXXA 4UTKA 1AH3A 2HXUA 4TVCA 2PURA 3LOTA 3VIOA 1ADDA 1US2A 2BDQA 1W5PA 4B91A 1A53A 3GW3A 1O94A 1FWJC 1WOAA 1Z48A 3MWCA 1KFBA 4Y9MA 4GI9A 3PSVA 2BOFX 2Z1XA 4S1FA 5DO8A 2WZEA 2WHLA 1QNSA 1XPGA 4MJZA 3PB0A 4DJFC 3CAKA 2VX6A 1J5TA 2VFIA 3IACA 2H6RA 2DW6A 4JX4A 3WYZA 2F61A 3GFXA 1DJYA 4CQBA 1JYWA 4W5UA 3QEZA 1WNOA 1PIFA 3GH5A 3IIPA 4PB4A 1ADOA 1MRQA 2YL5A 5M5DA 2YXXA 3IK2A 1R3SA 3WUGA 1HIZA 4JAWA 1US0A 1R2TA 1VBRA 3BPWA 4E4PA 3RYSA 1OADA 1EEXA 4MNKA 4PMXA 1P0EA 4BF9A 4H2CA 4R7OA 4F9JA 2QF8A 2OSYA 1AH4A 4M7TA 3KL5A 3P60A 2W61A 3WLQA 4US5A 3VILA 2GUBA 2I14A 4K6AA 1TCDA 5LNVA 3CNYA 4XQ6A 4LQ1A 3M44A 3WFZA 1BWVA 4Q8PA 1HNYA 3EKZA 1MMFA 3ZS4A 5EKYA 3D5HA 3G0SA 2ON3A 4G6CA 3UPWA 3GR7A 3R25A 2PWDA 2VGGA 3BL3A 4EE9A 4JTDA 4F2TA 1JZ7A 2P8BA 1LJYA 5KZDA 2QCHA 1BG9A 5LGZA 5D2TA 2X1RA 1QW8A 1OCBA 2VC5A 3BCJA 3WF4A 3VVGA 3U3HA 3TFCA 3VDCA 1Q6QA 4IMAA 4UOJA 3UGRA 5C54A 4HNUA 5K2ZA 1SFLA 1E1FA 7ODCA 1S2AA 3IUDA 2VURA 3G3DA 4C5YA 2JEQA 2YLAA 1P6WA 3G24A 4QEHA 4BY3A 2G95A 2QIWA 2CW6A 5CPTA 1FX6A 2Y5SA 3QJAA 2UY4A 2GQ9A 3AI0A 3FCPA 3R5EA 3GY1A 3PZ9A 3RITA 4JTGA 3GU9A 4ZGYA 3L66A 3K8LA 5E9AA 4RE2A 3VFLA 4F79A 4D6GA 3MT1A 3TYCA 3WK3A 3ZM8A 4XO6A 3T2QA 5CAHA 4M8UA 3M7SA 3T8LA 4GQBA 4MDOA 1OB0A 2NUWA 1SYTA 3KCOA 1QI4A 2HNEA 3CZ8A 3ABXA 1IQ8A 3WQCA 4K8GA 1SQ7A 3RO8A 1RHCA 2PRLA 4Q4RA 2B7QA 1WCGA 4LY8A 1NOUA 2YCIX 1FHDA 1KBKA 1FWIC 1PCKA 4ICMA 4QNEA 3WNPA 4U2ZA 1UCWA 4GYFA 2WCAA 4G8TA 3BURA 2W9MA 4Q7IA 1WOBA 4QE1A 2VRQA 4YNGA 1VJIA 3CV1A 1AL7A 3V0SA 5EPDA 3MMWA 1J0ZA 4YLWA 1DVJA 4AZIA 4JZ5A 2PF8A 3WF3A 1DWHM 1PZ1A 2FPVA 2GLKA 3RCMA 2HTMA 1KA9F 1PDYA 3ZT6A 4MOZA 3QF0A 3KX6A 3N1AA 2HRWA 5FF2A 3A9BA 1U83A 4RDZA 5F1UA 4ZVJA 1E9YB 2X7VA 5FEZA 3AYVA 1D8WA 3W29A 2JEPA 1RY0A 1S5TA 2J78A 3ZJKA 3E2VA 5XIAA 2DV0A 1RCOB 3RGTA 1S2VA 4KH2A 4Q6XA 4EPEC 1QW7A 4HA0A 1B90A 5CPNA 2C0HA 3LLDA 3O0KA 1YTDA 4M5PA 1I1XA 4AEEA 3OVRA 2Y8UA 3OZMA 6ENLA 3CAWA 3BAIA 4LXFA 5F2GA 4PTWA 4S39A 1QK0A 3WEZA 3TQVA 1XIMA 3VX1A 3KAOA 4QAIA 2UBPC 1I2NA 2FTYA 5C9WA 3G8RA 1E5NA 1VJZA 5AZ1A 5A8PA 1OFAA 4MNJA 5DY2A 3HU7A 2VEFA 4LEQA 2H8ZA 3ZLFA 5K3VA 3NOEA 3OGVA 1XGZA 3PB2A 2A6NA 3S83A 4D8LA 1H7XA 4E2BA 3DBPA 4L4PA 3B9OA 1PTGA 4W8BA 3VX0A 1TA3A 1JZ5A 2ZRZA 2OX1A 4EXBA 1VS1A 3F4CA 1AD1A 3NQ7A 3EOSA 3NQGA 4ZOBA 3LSCA 4LC8A 3LPPA 4UC5A 1IV8A 3LRMA 3VIIA 4DBEA 4LUSA 1HF6A 2EEXA 3W7RA 1WB0A 1G4TA 4LWWA 5CZJA 4B3KA 4ZXLA 3T78A 4FEZA 3QQ0A 2DT0A 1NIUA 1W3LA 3DFSA 3RPDA 1IR2A 2OXNA 4LAOA 5JIWA 1MW3A 3MCOA 1GOWA 1PEZA 4IJRA 2XYLA 4EXQA 4JN8A 3O6YX 1IEQA 3B9AA 4FLSA 4XZBA 4JN6A 4BZYA 2G37A 5FJPA 1ZBKA 1H4PA 1B9BA 3MDWA 3N12A 4PC8A 3OW1A 3W81A 1S38A 3KTCA 4PCNA 2V5LA 3H4GA 1XG4A 2DEPA 2NVDA 1DQWA 8CGTA 4CQ8A 3OG2A 3EX3A 3W26A 3UXDA 1SFJA 3GLCA 4NJIA 4IPLA 4O11A 3H53A 2J9ZA 3KL3A 2R6OA 2QVNA 4D2JA 5JH2A 5D37A 3AXKA 1UOKA 1JZ8A 3TROA 2ZUTA 3U5UA 3WDPP 1UOZA 1XL9A 1S5NA 2RH9A 2DZPA 1RBLA 5G2IA 3ES8A 4KRUA 5LA2A 1OYCA 2Z6JA 4I5UA 2PLCA 1QTWA 2ZUVA 3ATZA 9XIMA 4I9JA 1AFSA 1ISXA 3PANA 1XISA 4R53A 2FVLA 5K4XA 2WWDA 3RMEA 2FHBA 3P8IA 4H3DA 3I3BA 1E0VA 1EYWA 3B8UA 4XZLX 3NYZA 3NQCA 3E9AA 2GK1B 3UWZA 1ITCA 2XIQA 3W07A 4E8GA 4RJEA 4ZB2A 2J7HA 2EPHA 4FLOA 4S3GA 2JIWA 2IW0A 3NDZA 3WIJA 3OLIA 5LNSA 1DKWA 4CQCA 1UR3M 3GHRA 1THFD 3RX3A 4IFRA 1TJ2A 3C0JA 2NZLA 5I07A 2A3LA 2D73A 1F76A 3BG3A 5HWJA