1AQMA

Alpha-amylase from alteromonas haloplanctis complexed with tris
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
publication title Crystal structures of the psychrophilic alpha-amylase from Alteromonas haloplanctis in its native form and complexed with an inhibitor.
pubmed rcsb
source organism Pseudoalteromonas haloplanktis
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1aqmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1aqmA01
1LLOA 3VNZA 2VCCA 1J0IA 4P8VA 3VDCA 5JBDA 3DX0A 4JCMA 3VDHA 4HOWA 4JCLA 2VI0A 1EOMA 3BMWA 2V38A 1CGTA 1LG1A 4D6HA 1UWIA 3AHXA 1GW1A 4TX6A 2X2JA 2VX7A 2ZOXA 1SFSA 3CO4A 2V3EA 1V02A 4LPCA 1E4NA 1CDGA 3AS1A 1W1TA 1V02E 1CNVA 4AIUA 3AICA 4J7RA 1V6XA 3UR8A 3VIFA 2WMIB 3BVWA 4N0RA 4JHOA 4V27A 1BYAA 4HZ8A 3BLBA 1EO7A 4NZFA 2E8ZA 2FHFA 3LRMA 4LGXA 1NOUA 4LYRA 3W53A 5FCZA 1MW1A 5EMYA 3HG5A 4HMDA 3RJYA 2ZX5A 4CCEA 5BXRA 1CXKA 1KCLA 4W5ZA 3VUPA 4P7QA 4WSKA 1FH7A 3ZJ6A 1H11A 3QHOA 1R34A 5A6LA 2F8QA 2VUYA 4MB5A 2XSAA 3TOPA 2VNCA 4F9JA 3L4WA 4CGTA 3WBEA 3BUIA 3OLIA 4JKMA 3GDBA 1ODUA 4D6DA 3WEOA 3ZO9A 4Y7EA 3SCQA 1NWSA 2WXDM 1UQYA 1W9DM 1XC6A 1U30A 4S3KA 3WD2A 4CN4A 2CBIA 5CSUA 3ZJ7A 1DWGM 2WCAA 3KLKA 1ITXA 5A6KA 2WSPA 3DC0A 3CBWA 1U2YA 5E6YA 4FK9A 4ACZA 4N42A 4DUXA 4Z2JA 2XIBA 1B9ZA 2WPGA 4U33A 1CLVA 3ZR5A 1QW9A 3WUFA 1ZBWA 3AS3A 1U33A 3W28A 3WH7A 3B9EA 2WKLA 4A4AA 1BQCA 4R27A 3OIHA 4X0VA 4W88A 2F7PA 4PMXA 2YA1A 2GK1A 2ZX8A 3CHEA 3PZGA 2QHAA 4AD3A 3WDJA 2WSKA 2VTFA 2EJ1A 1XYFA 1JAKA 1E70M 3VMOA 4MDPA 1V0LA 2CIPA 1JG9A 1C90A 1ISZA 4NXKA 2ZUNA 1M03A 4HA1A 3NDZA 4J3SA 3WD3A 1KTBA 1PIFA 2EXOA 3GH5A 3HU7A 2D73A 2WC4A 3THCA 1VEOA 3WUGA 1J18A 3MMDA 4XZWA 1EH9A 3LPGA 2WVVA 3BMVA 3AIRA 1CXLA 2WAGA 5CPTA 1EIBA 2ESCA 2WB5A 3MANA 5EBAA 3EMCA 5EFDA 2F61A 4AYGA 3ARXA 1PX3A 3KEHA 3DDFA 1JNEA 1E72M 4PMZA 4AZ5A 2JE8A 3WL0A 3W0KA 1PZ3A 4WK9A 2XHYA 2TAAA 2VZUA 4RL3A 3S5ZA 3AHVA 3SUTA 4EANA 3IAPA 3WH6A 1CGVA 4D6GA 1JDAA 4CU6A 1HVXA 4AZ7A 1UD6A 3L4TA 4P7RA 4AXNA 1XD1A 3T0DA 1MQRA 3WNOA 2GFTA 4CD4A 3W4RA 4FNRA 1TA3B 4LXFA 2XGIA 2V5CA 3II1A 5LA1A 1BYCA 3FXYA 3RIKA 2AAAA 1UD8A 3OA5A 4GZJA 1BYBA 1B30A 1QWUA 1KXTA 4UFIA 4DUWA 5I77A 3WQWA 4CKQA 4DWSD 3MUY1 1CXEA 1QOXA 3NSXA 1PS3A 4E2OA 4J3VA 4ZE5A 3HJEA 4KMQA 4AMWA 2ZXQA 2DH3A 3GBEA 3L4VA 1HNYA 2GVYA 2J47A 2X8RA 1UR2A 5KZ6A 1W3LA 1XCXA 3CV5A 1JIBA 2CETA 3SUWA 4Z2GA 2J8GA 2ZXDA 4BF7A 3SCPA 2ZUMA 4MAVA 4B3KA 2GDUA 2J75A 2PWDA 4UOQA 3ZSSA 2J77A 2J7CA 1HJSA 2PF0A 3M46A 4ZFMA 2BVDA 3VSVA 1S46A 4PN2A 1PPIA 3M7SA 1V6YA 5A6SA 2WMHA 3ARVA 5D9NA 3SCNA 1J9YA 1W9UA 1M01A 1P6WA 4UTFA 2BNJA 2IGTA 2GUYA 4H7VA 1UR8A 4AW7A 4ZEPA 4PCTA 4HU0A 3GXIA 1CENA 4HZ6A 1ZJBA 1KWKA 2UY3A 3NSMA 2ZWZA 1JFXA 1TR1A 5D9PA 2EO7A 1QWNA 4PYSA 2VRKA 1UKSA 3RCNA 4UFMA 1PEZA 4C7FA 1OD8A 4A3HA 3DX1A 1C3FA 4PTMA 1XH1A 1D7FA 1V3JA 3PTKA 1R8LA 4MJ4A 3TTOA 5DO8A 3DX4A 4J3UA 3AMGA 2O9TA 4HTYA 1K9TA 3ZSTA 1HKIA 1D3CA 5FKYA 1QX1A 3T2QA 2UY5A 4OGZA 3WNPA 3OZOA 2CBUA 5IXEA 3EJUA 3L4YA 1BGAA 3VPLA 1HJVA 3HZ3A 1EO5A 5D9OA 3WEZA 1TQWA 7A3HA 2ALWA 2CEQA 4FLSA 3MS8A 3ARWA 1H0IA 4R5EA 1J11A 1E0WA 1HN1A 1RPKA 1WDQA 3KWXA 4ML4A 5BCAA 1J0KA 4TVUA 4BZYA 5A6AA 3FAXA 1QW8A 4D6FA 3WELA 5C8BB 3WF3A 1TVPA 4D72A 2DT2A 3AMDA 4D71A 4UFKA 2E8YA 4KRTA 1ZBKA 1E0XA 4TVDA 4WJXA 1WAWA 4PBGA 3WF2A 2XVGA 1ESWA 2DSVA 3AMCA 4PTXA 3VGFA 4FF5A 5IFPA 1Y7VA 3L4UA 2X0HA 4IPNB 2G3MA 1UD3A 2YL5A 1V03A 3RDKA 1PX4A 2WVSA 2XN0A 1D2KA 2GJRA 3BUDA 3UG5A 2VR5A 3WFZA 3VM5A 3VGGA 3CH9A 3TTQA 4ACZB 5GNXA 3T08A 2DT3A 5BXTA 4BA0A 2PWHA 3W25A 3A47A 5DT5A 1KXVA 2XG9A 1FHLA 3WF4A 3VKKA 1WP6A 2CBJA 2OSWA 3MUZ1 4OBRA 3BGAA 2GK1B 2WANA 3AIEA 2YLAA 3NYDA 1UWUA 1VB9A 2W63A 4GINA 2OYLA 2WHKA 3U5YA 2JIWA 2G41A 1DHKA 3DDGA 3CUIA 5E70A 2D1ZA 5CGTA 3AYSA 3L2MA 5GNYA 1Q6CA 1TCMA 2CYGA 1UA7A 5BRQA 3AZRA 2CPUA 5IDIA 4TXEA 3GYCA 2XPKA 3UESA 3LPOA 3TTSA 1FH8A 4CN1A 1E6NA 3ZT5A 4AD0A 2WVVB 4GPNA 1US2A 3WNNA 4HU8A 4KH2A 2GDVA 4L4PA 2YOCA 1QHZA 1PJ9A 1JZ8A 4W7UA 1C93A 3MSGA 3WH5A 1C8YA 5D8WA 4P8UA 2EQDA 3T0BA 3HMCA 3BLPX 1VFOA 1Q6DA 1QI4A 1WDPA 4DO5A 1ZBVA 1B31A 4DWSA 1VFUA 5KEZA 1EXPA 3BAWA 1W9PA 1JI2A 1K9DA 2F7QA 4DO6A 1G0CA 3CMGA 1QI0A 5I6SA 4GI9A 3K4AA 3VSTA 1LF1A 2XUCA 1JL8A 2J79A 1ZB5A 5A8NA 5HPOA 1KB3A 4MB3A 4P8XA 3WY2A 2W61A 1K6AA 4D1JA 2WMFA 1B3ZA 1H3GA 4X0NA 2O92A 4TVCA 1UD5A 1X6LA 2F1BA 1Q6GA 1LL6A 3RM4A 5JIWA 1GONA 4WKAA 2XVKA 3A24A 2W4XA 1KCKA 5CG0A 1H1NA 2VRJA 1W9BM 1E0VA 3M6DA 4MB1A 4AZHA 3RM8A 1E6SM 4Q7NA 3D50A 1YHTA 4RE3A 4LQ1A 1ITCA 4YPJA 5A3HA 3WF0A 1ODZA 3MI6A 4WKFA 4DM1A 3B9AA 3RM9A 5C70A 1JDCA 3S6TA 4E4PA 3QR3A 1G9HA 2VMFA 2YKKA 2OYKA 3WDIA 3VINA 3OB8A 2RGLA 2XVLA 3OZPA 4CVUA 1X6NA 2B31A 2BS9A 1NOWA 2HISA 2ZUWA 2J4GA 4HZ7A 1A47A 4GIAA 4AD1A 3D4YA 3WDRA 3CIVA 3AMLA 3AXXA 1VJSA 3GXMA 2EACA 4LYQA 1CECA 3KL3A 2BHZA 1XH2A 4KGJA 3G6MA 3O9NA 2NT0A 2F1AA 4PMUA 4HMCA 4Q22A 3F5KA 2EAEA 1AQMA 3WKZA 2WHLA 3D5HA 3AMKA 3NCOA 5A2CA 1QBAA 3MV01 2PWGA 1WDSA 4ZXOA 1HF6A 1DWJM 5ABGA 3SCTA 5HOSA 1V6VA 1OGBA 4AD2A 1C7SA 1C8XA 1XSJA 3EBVA 2D20A 1JZ5A 2WW5A 3F5JA 1KR1A 5E1QA 3AZSA 5A94A 2X0YA 3WD0A 4PTVA 2BY1A 3A6OA 2Q8XA 4UFHA 1ZS2A 2EADA 5CLTA 3N17A 5HNNA 4H41A 4W85A 2D22A 3QHMA 2OW7A 1UG6A 4WLCA 4MADA 1JYVA 2YL9A 1SR0A 3VU2A 3WNKA 3BLKA 5A8MA 1V3MA 3K4DA 1UD4A 3BSGA 1OD0A 2DIEA 4PEEA 3RO8A 3ARTA 1TG7A 2WCSA 1OSEA 4F66A 1OIMA 3U7BA 3KLLA 3FHAA 1HVQA 1RP8A 1I1WA 4M56A 1E55A 1GQLA 2XFFA 4U3CA 3WDHA 3QGVA 2CKRA 2A3BA 3RILA 3W27A 1EDTA 1W3HA 5CPSA 1ZJAA 1V3IA 3POCA 4UNIA 1MVYA 3TONA 1UQZA 4PTWA 2OWCA 1F4AA 3ARQA 3N15A 5E0FA 3ZOAA 3NJ3A 2D0HA 2WZHA 1PBGA 1CGYA 4ZE4A 3WDQA 2W66A 1JGIA 3EDDA 5HDRA 3OLEA 3J7HA 2PB1A 1HJQA 1B3XA 4TOQA 5ABFA 3WEMA 5TD4A 4W7WA 3AS2A 1UA3A 3S5YA 4B16A 1DWAM 1MW2A 3EDEA 2A3EA 1CZ1A 2DT1A 4HMEA 3NUKA 3SCUA 5DMYA 1XD0A 1SYTA 3DECA 2A3AA 4WKHA 8CGTA 4OJYA 1CWYA 2JEPA 4PMRA 4B3LA 3SEPA 5C71A 2FE0A 4U5KA 2ZWYA 3B9DA 3POHA 3ZIZA 3CZGA 4UZSA 1GJWA 2E9MA 5A2AA 3PZOA 3T0AA 2YL8A 1E71M 1LG2A 2VVNA 1MW3A 3ZJ8A 1JI1A 3WQ6A 3FY1A 1DP0A 3APGA 4W84A 3GBDA 1NQ6A 2WMGA 4HOXA 1OCQA 5HBFA 4M1RA 1WO2A 3WMBA 4PSRA 3VSUA 5FOOA 1W9XA 1DWIM 1VEPA 2E0PA 4U2YA 4FNTA 2XGBA 3NSNA 2ZUUA 1LQ0A 2BFGA 1GHSA 1O7AA 1E73M 3CZNA 1OIFA 1W1PA 5BWFA 2QF8A 4JIEA 1TVNA 1QVBA 4KWUA 1HIZA 5I78A 4DWSB 5I3DA 1B3YA 3ZT7A 1CTNA 1HKMA 1VBUA 5LA0A 2DSUA 3N13A 1BFNA 4AYSA 3EJQA 5BXPA 4OOUA 2FDMA 2ZX9A 3TV8A 2J78A 4W86A 3VIGA 3WD4A 2YL6A 3UEQA 2FYVA 2Z1SA 2WWCA 3AIUA 3VIKA 2DH2A 2Y8VA 2WHJA 2YFOA 3WN6A 2XN2A 2DPEA 3KE0A 4GQQA 2DSZA 3AS0A 1K9FA 4UCFA 1QNRA 1NWRA 5ABEA 3U7VA 3S2CA 1SZNA 4HPGA 2NW0A 3D51A 1CYGA 3TP4A 4C7GA 2ZXBA 3QHNA 4WIWA 1HX0A 4JFSA 3ZQ9A 4FMVA 1MFVA 1J0ZA 2GJXA 4BQ3A 4PCSA 1TQSA 4FLQA 3CUGA 2EBNA 1B2YA 3MU7A 5A95A 5E9AA 4FNQA 1IT0A 1UUQA 2UWFA 4CU8A 6A3HA 1V0MA 4J3TA 4OKDA 2C0HA 2J7HA 3VD3A 4S3JA 1E4MM 5LA2A 2CHNA 3K8KA 3MO4A 1HJXA 4F9DA 2PWEA 1VFFA 3JUGA 1ZL1A 2XN1A 2VT0A 4Z2LA 1V0NA 1W2VA 1MYRA 4NI3A 3KZSA 1FA2A 4UQ9A 2VC9A 1E5JA 4XUYA 2YFNA 3UERA 1E15A 1H41A 1BAGA 1WNOA 5LYRA 3WH9A 1FHDA 2C7FA 4AD5A 3OGSA 2V3GA 1C8QA 4AISA 1OT2A 2J7FA 4M8UA 2FHCA 2ZICA 3AHYA 4KRUA 2Y4SA 3CPUA 3U57A 1BG9A 3AJ7A 1TFVA 1JXJA 4TUFA 1FFRA 1UHVA 1QHOA 4PMVA 1RP9A 3LRKA 1V0KA 3AIVA 2CITA 3W6LA 1LJYA 3WQ8A 2VVSA 3BAXA 2F7OA 4ZXLA 4FNUA 1WCGA 4HA3A 3VGHA 5A2BA 4JKKA 2OSXA 1EDQA 5JUVA 2WBGA 1R47A 1TQTA 2V3FA 1GNXA 1I75A 5ECUA 1VIWA 3RMEA 1NWUA 1W3JA 2JALA 1UWRA 3VD5A 1YQ2A 2VX5A 1JAEA 2V5DA 3D3AA 1HJUA 1UH2A 4PSPA 4ATLA 3N1AA 4EKJA 2OW6A 4D6JA 4AIEA 1QNOA 2DEPA 4AZ6A 1VJZA 1EGZA 3VO0A 5D8ZA 3GH7A 1HJWA 1WPCA 2QPUA 1WDRA 4BS0A 5AC5A 2FH8A 1KGXA 4M24A 1HWWA 3ARSA 4JFUA 2OLHA 5AYBA 3CZKA 1ISVA 2VZSA 5DEZA 3MKKA 3ALFA 1CXHA 1GUVA 3AHZA 2WK2A 3SURA 5I0DA 1AQ0A 1ISYA 1E6QM 3N12A 1JZ2A 2D0FA 3KL5A 3AQUA 1CGXA 4UFJA 3PZTA 3A4WA 3ARYA 4JKLA 3CLWA 2OYMA 1JZ3A 1TE1A 3ECQA 2XVNA 4M82A 2PBGA 5FD0A 4XB3A 5CPQA 5HXMA 5ABFB 2FHBA 3VIJA 3UCQA 3THDA 3A3HA 3SCWA 1AVAA 2DSWA 4EK7A 5FL0A 4W87A 4JZ5A 4EE9A 4W89A 3W81A 3LX9A 2W67A 4MTVA 1JF6A 1BPLB 2WVTA 3WY4A 1FOBA 3E1F1 1SMDA 1PZ2A 1JZ6A 2QMKA 3ALGA 4PMNA 3TTYA 2EPOA 1OT1A 1OB0A 9CGTA 3EYPA 5CSYA 4ACYA 3IK2A 1GOIA 4U3AA 1NP0A 1EA9C 4H04A 3OLDA 3AI0A 3VIOA 2BHUA 1KFWA 3AIQA 3L4XA 3UETA 4QAWA 4NX0A 2PC8A 4FLOA 5IHRA 1VAHA 1XGZA 2J7BA 1J0YA 3VD7A 3VGDA 2W91A 1CGUA 1G1YA 2XWDA 2VOTA 3CMJA 3ARZA 1E40A 3I3BA 4M81A 2XFYA 3T2PA 2D3NA 3EDJA 1MW0A 3W37A 1PAMA 1DEDA 3WNMA 8A3HA 3D52A 2FGZA 3LXBA 3CHDA 4QP0A 2CNCA 2QLYA 1GQIA 3AIBA 4LX4A 4UOJA 3W82A 1N82A 4CU7A 2OWXA 1GOWA 3EDFA 2EPMX 4L4OA 3CZSA 1XV8A 2E4TA 2F7RA 3GXNA 1J12A 4QFUA 2CESA 5CZKA 2WNWA 3B8SA 2ZXAA 1ECEA 4WSJA 5D9MA 1UWSA 3QOMA 1V6WA 1HT6A 4HA4A 3TA9A 3OGRA 1KTCA 1XRVA 4AZIA 3DX2A 1B3VA 1C7TA 3UG4A 3FW6A 3N11A 2E9LA 3OBAA 1GOMA 1H2JA 1FFQA 3ARUA 4MNMA 3BVVA 2ZE0A 3K46A 4TTGA 4H2CA 4JL1A 1KGUA 3AZTA 3MMUA 2J7DA 2XVPA 5GPRA 1UR9A 3BH4A 3BVXA 5CGMA 2VX4A 1WE5A 3FHQA 3A23A 1B1YA 2ZUVA 1J10A 3PZUA 2EABA 5M03A 1MQPA 4AMXA 4DWSC 2VZTA 1QI3A 3CTTA 5JBFA 1LWHA 1E56A 1R33A 1W3KA 2X09A 1R75A 1JFHA 4PUDA 6TAAA 3BCFA 3ZJKA 1XCWA 1E1FA 1CIUA 1HL9A 2BY2A 4ATWA 1AQHA 4AZBA 1RH9A 2FGLA 4A3YA 1J0HA 1UKPA 3CGTA 1UYQA 2Y5EA 3WL1A 1EDGA 3BVTA 5BRPA 1UH3A 1ZBCA 4M29A 1H0GA 2A3HA 5M5DA 1QI2A 2EPNA 4QLJA 3L4ZA 2ZUSA 4UQEA 5A6JA 4Z2HA 3K1DA 2XYLA 1FH9A 3MSDA 4JFVA 4MNKA 4F79A 1KGWA 5FIPA 2DIJA 4CD7A 4URIA 3PTQA 1OINA 3F4VA 2VR4A 1CBGA 4GZEA 3LXCA 2BV9A 3A21A 2NT1A 1BG4A 3VGBA 2YJQA 4BQ4A 3BAKA 1DWFM 4HP5A 2VCAA 1VFMA 5A8QA 2Y2WA 3IANA 1KQYA 1BVNP 3IAQA 3IJ9A 1UKQA 2X2HA 4RE2A 2PWFA 3PZNA 2J62A 1WZLA 1CEOA 4NXSA 2YDRA 1I1XA 4BCEA 4D6EA 3DHPA 3WD1A 1QI5A 4OUEA 1LWJA 3N9KA 2ZUTA 3VTRA 3GXFA 2AOSA 2UY4A 3EMZA 5E0CA 2J7GA 3UG3A 3GZAA 3VGEA 2W5FA 4J28A 3CUFA 1W32A 3CHCA 5GQBA 2WMJA 4P8WA 3WY1A 1E6PA 1HKKA 2DGAA 3MV11 3GH4A 2RGMA 3F5LA 3G6LA 2XTKA 2DT0A 2BVTA 4XV0A 4JL2A 3DYOA 1ISWA 5CJ5A 1OM0A 5E6ZA 4AD4A 5DF0A 2F18A 3CHFA 2VZVA 3NIYA 3ARPA 2XSBA 1XSIA 1E3ZA 1XH0A 2FH6A 4W7VA 2VJXA 2WBKA 2XIIA 2J7EA 3T2OA 2BXYA 1GOOA 3PZVA 1M04A 1HP4A 4CD6A 4ATDA 4D6CA 1WB0A 4LYPA 1QHPA 4MJ2A 4IISA 3W29A 1GQJA 1UZ1A 3ZT6A 1UASA 4CD8A 7CGTA 1H4PA 1UH4A 3PZIA 2DDXA 3H55A 2O9RA 4AEEA 1CPUA 5BROA 1GQKA 4P7NA 2BY3A 3SUSA 1IZJA 2VQUA 1W91A 1E4IA 3VIPA 2O9PA 1MXGA 3I3EA 4U31A 4FLRA 1EHAA 1WZKA 1FP8A 4NRRA 1US3A 3KL0A 4Z2IA 1FP9A 3WF1A 5AY7A 2XFRA 1Q6EA 1JD9A 5AC4A 2Z1KA 3WENA 5I79A 4GI8A 3T09A 4P7LA 1QNSA 2UY2A 3AOFA 1HP5A 4WF7A 4IPLA 3HG4A 1V3KA 2WVUA 4V28A 1V3LA 1PIGA 4GO9A 1XSKA 1UWTA 2AMGA 2D23A 5I2UA 1EHNA 3PN8A 3PZQA 2EEXA 3BAIA 3AIWA 1B0IA 1R7OA 1VENA 1CLXA 4YHGA 2X2IA 3SIMA 1NOFA 3BUBA 2WC3A 2WLZA 1G94A 1GOKA 4JHZA 4J3WA 4MNJA 3WIJA 2JF7A 2G3NA 1IZKA 5BYWA 1NARA 2VQTA 3A22A 4AMCA 5A6BD 4MNLA 3PBGA 3GM8A 4E8DA 5JIPA 1M7XA 1UOKA 3IJ7A 2QPSA 1TZ7A 1V3HA 3AISA 5A69A 1BTCA 5I23A 5JBEA 4PUEA 3FNDA 4U2ZA 4CVWA 1F4HA 1C91A 2D0GA 1LL4A 2WC7A 1E6RA 3SCSA 1MQQA 1KQZA 4GXPA 3W26A 1B90A 4JFTA 1ISXA 1BYDA 2CHOA 3LRLA 3BC9A 1O7DC 2WWDA 1BGGA 4H8VA 4JAWA 2JIEA 3DYPA 3LPFA 1LL7A 1E9LA 7TAAA 1BHGA 3ZM8A 2JFEX 5CQ1A 3N18A 1EQCA 4B9ZA 1G01A 3VX1A 4B9YA 2QMJA 5M17A 2WCGA 1VBRA 1UKTA 3A4XA 1M53A 3ZR6A 3FN9A 1OWQA 4QCEA 2WLYA 3CZ8A 1CXIA 3H54A 4MPKA 2OWWA 2WYSA 3MUAA 1V6UA 1UZ4A 3VNYA 5CLWA 5A8PA 4KGLA 2J25A 3WMCA 3IJ8A 4NRSA 4AZCA 3VMNA 3OLGA 1KBKA 2E9BA 1QNPA 5F7UA 2VRQA 1W2PA 1UR1A 1OGGA 4XZBA 3PZMA 3GXTA 1K9EA 4DUVA 4HPHA 3WQVA 3GTNA 1H5VA 3BUPA 4HOZA 4X9YA 2IXVA 3PHAA 3AFBA 3DYMA 1GOQA 3VX0A 1GHRA 3FAWA 2XM2A 3OGVA 1H49A 3I3DA 3SCVA 4H8UA 1VEMA 1CGWA 1HXJA 5FL1A 2VURA 3MMWA 3HN3A 2W92A 2X1IA 3WH8A 1JZ4A 3BVUA 1E1EA 1TUXA 2J8FA 2D24A 4PMOA 3K8MA 4TX8A 1G5AA 3HG2A 2JF6A 3GNRA 2OSYA 1E5NA 2W62A 1V08A 3BSHA 5IFTA 3AHTA 4J27A 3LXAA 3A4AA 1TQVA 1R7AA 1OGSA 2WM0A 3SUVA 4QDMA 1BLIA 3W38A 1R85A 2A3CA 1NH6A 3W24A 4CD5A 2D3LA 2PI6A 4UQDA 1EQPA 3DHUA 1VRXA 2WKGA 4MAZA 3BAJA 1B3WA 4NF7A 4OBSA 1DTUA 3RPMA 2IXUA 1C92A 4YN5A 4NSBA 2WMIA 1O6IA 2VZOA 3SUUA 2GJPA 1J0JA 5A6MA 3BCDA 3EJPA 2F2HA 4UFLA 1XYZA 2WMKA 3WFLA 1JZ7A 3VD4A 2J74A 3VM7A 1UR0A 1L8NA 3ARRA 2HVMA 1KXQA 1WZAA 2WZIA 4OZOA 3EJSA 2YBUA 4UOZA 2QV4A 2YDSA 4U5IA 3QOKA 3AROA 2G3JA 5DFAA 5E09A 5GNZA 1UKOA 4NZJA 4W8BA 4XX6A 3UR7A 4ZENA 4OIFA 2G3IA 5M3WA 4EAMA 4PRWA 4W8AA 4UZUA 3OG2A 2XM1A 2EPLX 1CXFA 1KXHA 3VVGA 2PBOA 5EB8A 1QNQA 4CUCA 1BF2A 1E43A 3LMYA 2E40A 2YIHA 1GORA 4UR9A 3ZMRA 2WHMA 3O2LA 3WBAA 2CBVA 4TTUA 3WQ4A 4D6IA 1W9VA 3A5VA 4E8CA 4W5UA 1EOKA 1XHGA 1GPFA 1HKJA 6CGTA 4AWEA 2O9OA 2DQXA 4UQBA 4UQAA 2BXZA 3K8LA 4P7OA 5AYIA 1JYWA 4FNPA 2YDQA 3N04A 2WZEA 1E6XM 2CERA 5CXPA 1MXDA 3CC1A 5A1AA 4AEFA 2BVYA 1GZJA 3SCOA 4GZIA 3WNLA 3VIHA 2IUZA 3U5UA 2ZX7A 1UWQA 1X1NA 2E3ZA 4M80A 1JD7A 1IV8A 3GXDA 1DWHM 1KR0A 4AIOA 4OOZA 2YA2A 5ABHA 1HTYA 3WUEA 1UD2A 5A6BA 3AYRA 4CN6A 4DO4A 3VD9A 1W1VA 2CCRA 3L2LA 4B15A 1MFUA 1ZU8A 5A8OA 1E3XA 1HL8A 3EDKA 4IUGA 1J01A 3WSUA 1GJUA 1GVIA 2V3DA 4GO8A 1KWGA 1JYXA 3HG3A 3BXWA 1TQUA 1HXKA 1AMYA 3CUHA 2VX6A 4CCDA 3MUIA 2Y8KA 2DSKA 2YLLA 3CZJA 5I24A 1MWOA 3EJTA 1VF8A 1T0OA 3EMQA 5EFFA 3VOCA 4QCFA 4JFWA 1Q6FA 4AY1A 4PMQA 3M07A 1W1YA 3WUBA 2XJ7A 3DX3A 1A3HA 5HPCA 5IHSA 4QLKA 3D4ZA 1E4LA 1NM9A 3CZEA 1BSIA 4BQ5A 4J3XA 1TA3A 3NDYA 4FNSA 2VO5A 2X05A 4H8HA 1PX8A 4F8XA 4C7DA 4CCCA 4D1IA 2GSJA 3BUQA 2CXGA 1KBBA 2CKSA 1R46A 4GKLA 1WZMA 1SMAA 2NSXA 5D4YA 2MANA 3GNPA 5BXSA 3VDBA 2G4FA 1GVYA 2JEQA 1R87A 3WDPP 2ZIDA 3AXHA 3BAYA 2VL4A 4IM4A 2X2YA 1NP2A 2BHYA 5DT7A 2C8NA 4QLLA 4RE4A 4DM2A 3LPPA 4GI6A 1JDDA 1NWTA 1JF5A 5I5RA 3GXPA 2EPKX 4GQRA 2D2OA 2G8ZA 1JYNA 4W93A 1JXKA 4MDOA 2VCBA 4K68A 1TMQA 3RJXA 4W8LA 3O6AA 3PZ9A 4AZCB 3SCRA 1QPKA 1Z32X 1E6ZA 4AC1X 1QBBA 1R86A 1BVZA 3CUJA 2GJXB 2YA0A 2BY0A 1UR4A 3VILA 3H53A 1RD6A 4Z2KA 3VDAA 3WQ5A 3EJRA 3W6MA 1L0PA 4V2XA 2XWEA 1GCYA 3WMSA 4PMDA 4UQCA 1JNDA 1H09A 4PMYA 2ZX6A 3GNOA 3WY3A 3IGUA 3CZLA 4NZCA 3PTMA 4BQ2A 3VIIA 3VIMA 4AZGA 3VMPA 2YBTA 4MB4A 2Y24A 1WKYA 4YHEA 1Q4NX 3AXIA 1OBAA
chains in the Genus database with same CATH superfamily
5KJ4A 5BUGA 4KV5F 2WV3A 5J9PA 3HG1E 5CSZA 4QJ1A 4PRTA 4J4KA 5I76A 1T21B 4S3EA 2BCKA 2O7QA 3CAKA 3EOTH 1MFAL 2BNQE 4O14A 4P23C 3NQGA 1QAPA 4G1KA 2NLJB 4JDEA 2YOAA 4ACPA 4O5LL 1JN6A 3NJVA 1W1TA 1XKJA 1I3RA 1OZQA 1CU4L 2UXFA 4LU5H 1KCUH 3BVWA 1R6WA 4GRMA 4KV5E 4HK0B 2XX1A 1AHMA 1WZ1L 1JZDC 2IKIA 5FCZA 5C08A 5KG9B 1EWHA 1YNLH 2INFA 3OHXC 3BFOA 4X61A 2B1OA 2CKNA 4WSKA 3KM8A 1IEIA 1FO0L 1ME9A 5AW9B 1MCSA 1UQYA 4HV8B 1NELA 2JQAA 1DWGM 4B2DD 4IRSB 3VDGA 4EAYA 3H85A 1RA0A 4DUXA 1B9ZA 1GTNA 3VXGA 2BW4A 5ELIA 3WGUB 2VLKA 5CC7A 2R1KA 2C16A 4MNGE 2XTJD 1TIMA 1EP3A 4QKTA 1D5MA 2EJ1A 3HA0A 3BJTA 5CFHA 3TEYA 2C7UA 3KD4A 1AG1O 3EPNA 1XF0A 1FCGA 2P0IA 1D3HA 3BANA 3S1XA 3LNPA 1OFAA 4FAMA 4YU1A 1KIRB 3TBYA 4UTAH 4CQ9A 4X7TA 4R33A 5ITBH 2X5PA 1IAMA 4GIRA 1YN7B 4EDXA 1PX3A 5C0AB 3H7VA 5BZWA 5ETUB 4DEFA 4C58B 4Z1DA 1PZ3A 3MLYL 2GBAA 5LGHL 4HGXA 2TSBA 4PRNA 4D6GA 3ZKNC 3APFA 1XLAA 4N2AA 4GKNB 4MMZB 3KPMA 4FFWD 4GP4B 4LXFA 4OF0A 5EH1A 5CEZH 1M1BA 4DWSD 3GJFA 1PS3A 2K7QA 4FQHA 3QI9C 4EZMA 3QZ6A 2F6KA 5I19L 3HJEA 4KMQA 1WK0A 5E08H 1LEGB 1TVHA 3NGJA 3D07A 1QXLA 2VDMB 3E3QC 3P30H 5IY5B 4KJPC 4TTDC 1KV8A 3LTVA 3RPIA 2J77A 1MCOH 3W88A 4X7DC 3M7SA 1IM3D 1PKYA 2WMHA 4QRQB 3KVMA 2JJTA 4UTFA 3VFMB 1L3NA 4PJBA 3QDJE 3I6GB 3REWA 5XINA 2BVPB 5C7XL 3L12A 4E6MA 4HG4J 3SQBB 2FD6L 4Q6KA 2EEAA 2VRKA 3KG5A 4AEHL 4ML9A 3ARBD 2A7RA 4RQQA 1PEZA 1OD8A 3EXLA 2CQVA 1PLGH 3GQFA 2OMBA 4JQIL 5E4EB 2Z6JA 5AOZA 5I00A 4RIRA 5DMLA 3EYSL 1D3CA 2L7QA 1AQFA 4WW1B 1BCIA 4K7PL 35C8L 4OGZA 1NCIA 1JGLL 4ZMNA 3TZVA 1HJVA 2J3SA 4JZOB 4ZRGA 4OCXL 3ME0A 5FEPA 1U58B 4HTBA 5JIDA 1WDQA 3PQYA 4ML4A 5BCAA 4BZYA 5F7BA 1OYAA 5H6HA 2NRDA 4CRPA 5DQ9B 1RZMA 3BESR 1J8HD 3ZLQC 3WF2A 1OB1A 4YCOA 5A43C 1RHCA 3GNNA 4G6ML 1MDAA 3T04D 3M9YA 4WHCA 3TQVA 2WLHA 4JQIA 4ACZB 3TO2A 3V52H 4M9PA 4KJQD 1FHLA 1Q9KA 5IB2B 4YSDA 1EYEA 1TRIA 4ZFOA 1RERA 2WM1A 3VI4E 2X6VA 1CR9H 1ZHLB 3V0JA 2YC1A 4XB7A 3U9WA 1A4JA 1TMLA 3W1PA 2PDNA 1YN6A 4GPNA 5E2VL 5HDBE 4H1LG 5D30A 2CLVB 1FWEC 3QI9B 1KBGL 1C93A 5C86A 5I6LA 3D9AL 3V6ZB 2EQDA 3HMCA 1U4FA 4E9VA 1VFUA 4YR6A 1JBJA 2EPHA 2HVKB 4DO6A 1AXIB 4Z1PA 5I6SA 1FHVA 3N9GL 5LIWX 1NIEA 3ZYZA 1CC3A 2YGYA 4D1JA 4MJZA 4NQEE 3ZHNA 5ISZA 3O3EB 1E0VA 4XMPH 3PK7A 4AZHA 1XVSA 4OKVA 2X87A 4RE3A 1PXGA 3E74A 3UWEA 1TCRB 3CFQA 4HG4K 1SEBB 3WDIA 4QTHA 1XXDC 1SSDA 1M5WA 4ZYKA 4HX1A 5IKCA 1A47A 1SXSA 3L81A 3AMLA 5LN8A 3CIAA 2DQGH 4G80B 1N55A 3BEVA 5CO1A 1AGCB 3FXIC 2WHLA 4N0FB 3MV01 5IJKC 2YCLB 2DI7A 3DBXA 5AHNA 4FQQB 1Q1JH 1OE2A 1MY5A 4HNCA 3J07A 3DV4A 4JTQA 1EEUA 4AM0A 2C26A 4X5LA 4IFOA 2ROYA 4ZXBC 2H3DA 4LAZA 3VU2A 5JLZB 3UD6A 5FFOA 2JKNA 3GHPA 3RITA 5D1QD 4LIQH 3K5SA 2AV1A 4Z3HA 4PJ9C 4CNUA 4M56A 1V7NH 2VAAB 3VYNA 4PJFB 1U9KA 1IAKB 4Y2DA 3GDCA 4Q8NA 4BDVA 3SYOA 5CPSA 3HURA 4XRCB 1FE8H 2WWMC 1HCZA 4EWJA 1T0NB 4LCYB 1CFSB 3WLHA 4PR4A 3D0VA 5TD4A 2XOTA 1B4LA 3UWWA 1QLFB 3R4DA 5H37A 1ULVA 4ZX6A 3TEVA 1KCSL 2XG4A 1C12A 4I48A 4M7LT 3MOQA 2CAKA 2VEGA 3GI8H 5TE4H 1J1OL 3SQOH 4LLQB 1PZ5B 1ZHNB 2JCCE 3EPMA 1EFQA 3FOMB 4UTTA 4ZUWA 1Q5MA 2AXFA 4PJCF 4MBRA 4KI1A 3W1ZA 3EH2A 3K6OA 1U3HD 1AXTL 3SI9A 3A4FA 5LNEA 4LEEA 4OZIA 3UTSA 3QO1A 1F6AB 1TTFA 3H1ZA 4PJ8A 5EUKB 3LAFA 4FCAA 2C13A 2BDQA 1S39A 3VXSD 4MKTA 4PUWA 1GJPA 1PL9A 4EI6B 1ETB1 3NQBA 4PL2A 2FEEI 1MHCB 4B4HA 3GC5A 3TC7A 4TKWA 5JHLL 3EAKA 2YL6A 1S3RA 3IIXA 3QZPA 2WWCA 5B1BB 4UTIA 5HJDA 1OSZA 5IFAH 1FVCB 3JSSA 3KH3A 1NWRA 3HMWL 4PG9A 4HPGA 3R79A 4BWTA 3DFSA 3FDKA 5ECVA 3KR3H 3TAOA 3KYMA 3H2PA 3Q1SH 4MIMA 1F3DJ 4CU8A 3IDJB 3W7EA 2Q7AA 5I5IA 1VFFA 4ZXBB 1YQVL 4ZBJA 4YSUA 3G5ZA 3EJZD 4UQ9A 3SJVD 4FQCH 1YY9D 3SB3A 4PJ9B 1R3SA 5CHNA 4MZ1A 3KPRB 2QJHA 2C7FA 3WL9A 2PU0A 4BFEA 3TJ4A 3FUKA 2Y4SA 5B1AB 4X6DF 4FZ8L 5BMWA 3U0PA 4RGNC 1FWHC 5B3SB 5CP3A 2JJTC 2ZA3A 1WCGA 1XG4A 1NLDL 3WKYA 1GNXA 3MBXH 3DX7B 4S1FA 2JALA 3S36H 4HEPA 5D4HA 1MRQA 5DCDA 5DDHB 4K7PY 3S46A 1A6AA 4XBEL 3MV8D 5DC2A 1KGXA 3TWCH 3IGSA 2PP1A 2V9QA 4X98A 4LLUA 3UFYA 3PULA 4MWAC 1INEL 3PL6A 4Q0XH 5LIYX 4M3JA 4A8LA 3S9YA 5JW3L 3F4DA 4S3GA 4KKNA 1N0LB 2IPTL 3LRSA 3TZVC 5CPQA 4QXGL 5DXYA 3S35H 1CLYH 4EE9A 3P4NA 3PV6B 2WQAA 4W89A 1MVFA 3GSUA 3OBEA 5IB1A 4E3VA 2YBGA 4D2JA 3MZTA 4N2MA 1JDEA 1KGIA 3JTSB 1RBLA 1MDLA 5T1LB 4IU3A 3VXPB 3EYPA 5BJTA 3CSPA 5FB8B 4WKZB 4QO1A 5KMYA 4I90A 4JTEA 3OGCB 4XN5A 5K1JA 3C2OA 5F96L 4A37A 4X7TB 4FFYA 2YMXH 2W91A 2OLSA 4OGQC 1IT7A 4ONOA 2WQUA 5ESVA 2RFGA 3KZ8A 4ZCWA 1U8MB 2KERA 4L3CB 1H7WA 3L48A 1GQIA 3W0WE 4HCRL 3S8GB 4PW3A 4A6YL 4ZQMA 1RZFH 4ODWA 1XV8A 1I2PA 2CK0H 3MRPA 3ATEA 4WCYH 1ECEA 1TYEB 4MJ5A 1GW6A 1GGIH 1C7TA 2G5BB 4ZPTB 3UG4A 2H9GA 3X3GL 1AJ7H 3GW0A 5DJ8B 3VKCA 3QA3A 4M7LL 3IXTB 3MNMA 3EFOA 3FMGH 3ISIX 4IX0A 1G43A 3BH4A 3GRWA 4B0MB 1GVRA 1J10A 3PZUA 1HQ4A 4F37F 1WDWA 3T8XA 5B3NA 1QMUA 4Q33A 4OLZH 2SEBA 3VYLA 2DV6A 4ECNA 1KEMH 5DMJB 4RGNB 4IBYA 1BOYA 5EEWA 2YCEA 4NJ9L 1LROA 4M29A 3LS4L 4H1LH 4I9AA 2X4UA 4M1BA 3OKMA 3EX3A 1CDYA 1NMBL 4PY7A 4I4WB 2ENYA 3GLAA 4LT9A 4R2GD 5EFIA 2DJLA 1MI5D 1H7OA 4DJED 2MH4A 3DDMA 3Q94A 5CILH 3WK3A 1KQYA 3EO9L 4BCEA 2UXTA 4WGXA 4MWAB 2OJPA 5CGYD 1LWJA 4JO3H 3N9KA 2EH7H 2P1YA 3AWOA 4UTMA 4ZFQA 3EMZA 2W5FA 3H42H 5I1JL 3QO0B 3KBFA 1W32A 4KWSA 3UT0A 1AR2A 2IIJA 1HOCA 3WI9A 2WMJA 4DBWA 1HKKA 1R3RA 1NJ9B 5DX7A 4ZZKA 2RGMA 3N2MA 4MJJA 2RH9A 2FH6A 3HNSL 4I3RL 2WBKA 4MDRA 1SY6A 3T2OA 3LSOA 4LNRB 1OB1B 4QMEA 4UBPC 4ATDA 4D6CA 4UQIM 3QLDA 2QHRH 2QPFA 3LOWA 4QSFA 1UFGA 4OLYL 3C2AL 1PYMA 3QY6A 5C55A 5D03A 1VP5A 3TA4D 1IGFL 4RSYA 4G9FA 4LOFA 3QVAA 3NZ1A 1JK8A 3I50H 1FP9A 1XPYA 3TN0A 5CPMA 4Z2IA 4ERSL 1CT5A 2PDQA 4FAAB 1ZA3B 4CLMA 1W6LA 3EH4B 2PFHA 4V28A 3WLQA 4FLHA 2VDIA 4DRSA 2R0WH 6PCYA 1BFVL 1EHNA 1F6YA 5D70H 3ZYJA 3AIWA 1CN4A 1NIDA 2WLZA 2DORA 5JXQA 3DPBB 3A22A 3NACH 4GJJA 3W1XA 5A6BD 4IRJD 1XGYL 1X7FA 2AJ3B 4N2OA 3CFBB 4IJCA 2VWSA 1ONEA 2NY0C 1IGYB 2WC7A 3TFKD 2WYZA 4GAJL 5LNVA 3DOIA 3W26A 4G7YH 4PRHA 3ZL1A 1BBDL 5KUMA 4KUCD 5C0FB 5F7EH 2VXVH 3JZUA 3O2DA 4QXIA 1P0EA 5C0BB 1EX0A 2DQJL 1J5OL 1MQKL 2X7LA 4BEQA 4NUWA 2QGEA 4XTRD 4GRLB 3A4XA 2O56A 4PJ8C 3LBCA 4PUKA 3H56A 3NSFA 5T8IA 2XG5B 3CX5J 3VMNA 5ABAA 3UPRA 2VN7A 3PZMA 3LKSA 3R1ZA 3EFDH 2GC7C 4ENZA 3FRPB 3RKPA 3EOYG 3QDGE 5EBWB 2NZ1A 4N8UA 4QRPE 4KK8C 3IYLW 3HN3A 1NKOA 3WJSA 1YC7A 5KVDE 2E5EA 5GS0H 4Z7WB 5J1AA 4KEMA 5BW6A 2QUMA 1I7UB 5DFVD 3HRZA 3K13A 2UY7A 4GFXA 4OD2A 5KS9A 3I68A 1FCUA 2H7WA 3TPUA 5CCKL 3VXMD 1UR3M 1C5BL 1K2DA 4UQDA 1EQPA 4YE4H 3GLZA 1F3DH 2Q3OA 1B3WA 4N02A 3KBVA 5HHMD 4Z1AA 2FO8A 1WAAA 4DHLA 3LERA 4PBFA 3PWAA 1XYZA 1DN0A 2Q7YB 5AWNL 3VXTA 3LZFL 1KFEA 3KS5A 4OHQA 5FGBA 2AV1B 3B2VH 3QQ9D 4NZJA 1Z48A 4LCRA 4F0HA 3RR1A 4NC0B 1PG7W 4EJ1C 1KRCC 4RUBA 3FUJA 2PDBA 1CXFA 3CG8A 2YAMA 3O3DB 4WY0A 4JPVH 5A3IC 1QNQA 2E4FA 1ML1A 3GAKA 3LMYA 4O2EA 2YD0A 3Q43A 3SDCD 4JN2A 3QPEA 3O06A 2X4PB 3GUWA 3ITVA 1DQLL 1XHGA 4M4RB 3VVWA 4NZ4A 3IU3B 5CEYB 3PWPB 5JPNA 3MQIA 2HBVA 2OVLA 5C0JB 3TU6A 4L9XA 1VGKB 2IANB 2NY0B 3ENLA 5G5DB 3HVDA 1X1NA 3C09B 4B53A 5L88L 1Q9WB 3PL6C 3MPCA 1HTYA 4AQLA 3E8VA 1UZ6E 1N6QH 1ZU8A 3P9LB 4P2VA 1WLHA 2VWEE 2EIZB 4RESB 4JO8A 2OX1A 4OZIB 5EC1A 1A6VH 3RIAK 4O50A 3U6RB 3QO1B 5CGBA 2ADJB 5HGGS 2KQNA 4PJHE 3JR2A 1LEIA 3VOCA 4C6EA 3EWBX 1JUBA 4ELME 3EOBA 4PFMA 3A5FA 1PFOA 4QR7A 1YE6A 5TPWL 1TV2A 2CMRL 1JPGB 4G3YH 3WFCL 4KIRA 4AF0B 2VEFA 2ZIDA 3BAYA 1PV8A 3BEWB 1W5OA 4X63A 3MV9A 1O9ZA 1F6KA 3IKCB 3W7QA 5ID0A 4G7VL 1LK3H 4HJWA 4PG9B 1V77A 5I3IA 1D6EB 2AXHA 4XP1L 5HHQB 4X2PA 5DLML 1R3VA 2ZUQC 1F07A 3CUJA 3L7EA 3RLGA 3LIZH 1WGVA 1GCYA 5AL8A 4XHJD 1H09A 4PMYA 4F8OA 3DA0A 3IGUA 4MYPA 3S5LG 1F3WA 1F61A 1TQXA 2YBTA 1L6ZA 4AC7C 4YHEA 3LEVL 5DSCA 3AXIA 2CZNA 5CZVH 1AFSA 1T96A 2R69A 4DVBA 4YGVB 3VNZA 5T33L 5AEAA 2V69A 5B3JF 2DM4A 1RL1A 1A4KB 3M0JA 2ZRUA 1UWIA 3LHPL 4RA0C 4EUPG 3A3YB 4KDVA 4IGNA 1XT5A 4AIUA 4QXTB 4KRPD 3HE7A 3WYZA 3GKZA 3M17A 4GW4B 1BYAA 2PPAA 3QFJB 3SE4C 3E0LA 2FWOB 2FHFA 5B3JE 2Y6SD 3DVNB 3KLQA 5G4HC 3LMJH 4P7QA 3TJXA 3ZJ6A 4C56D 3SQSA 1M2VA 1O7VA 2CLRB 1A6AB 1L6WA 4PGCB 4RZBA 3MMEA 2HWZL 3KHJA 1RVFL 4JDZA 4HKZA 2F53B 1ODUA 4AYBA 3ZO9A 4Y7EA 3N42B 2DYPA 1PZDA 4X4YB 4CN4A 3MHGA 3GO1L 4AQEB 1XGDA 4UT7H 4QT5B 3RJOA 3H0TB 2C4FU 5J6HA 1S2CA 1AH4A 5H4YA 3VOHA 5MEQB 2F7PA 3VZXA 4YHYB 5LNRA 4L61A 4MNQA 3ES7A 4GE8A 1WD9A 4RW3A 4FF7A 1A9VA 4ZODA 1ISZA 5A7BA 3U7WH 3IMTA 5CBEA 3HU7A 2HJFB 3ZDZB 2AEWA 4NAQA 4TNWK 3HAEG 5CPTA 1BFOB 2AXGA 2ED9A 4JPWL 3FIGA 3O9WD 3TO4D 3H21A 1TPXC 3N34A 2GJZB 4WI2A 5FYKE 3MLSH 4BM7A 3GHSA 1PKLA 3S6OA 3LRGA 4C83A 3TBWA 4MJMA 4TSCH 4LCUB 4ZDHA 2ZUQB 3BT2H 5C9WA 4JJHA 3VQ2C 1RUPL 2GFTA 3VFVB 2V5CA 2WQRA 1TNNA 3KWVA 1B30A 1BD2D 5HNTA 4M48H 2X6UA 1YYCA 1IGCH 4JS3A 5AAMA 4MSWA 1ROCA 1ZV5A 1EGVA 4DTGL 3L4VA 2G9KA 1JRCA 3OPZH 3E0WA 2X8RA 5E00B 1X1OA 1GZGA 4U3XA 4MAVA 1ZEAH 3BFQG 3CFKA 1W8EA 1S7UB 2Y89A 1E4KA 4C57C 3FHEA 1P5VB 2D7QA 3KBPA 3IJSA 3G6JB 2Y25A 4GW1B 1M01A 1AHWA 2GUYA 5L2JA 4ZEPA 3QJTB 5IHZA 4RAVB 4YLWA 3OR6A 1EHLH 2DZPA 5IV2B 4NPYA 3DO7B 2UY3A 3HHSA 4YE0A 4GYFA 4LV4A 4NO0B 4JTFA 3FQYA 2VLJB 1BYPA 4YX2L 4TUKH 4MJ4A 2G2PA 3MXVH 5E6UB 1JCLA 2IAAC 5AW7B 4F7TA 4JMNA 3R7MA 5KYUB 1QX1A 4QI3A 3T2QA 3HRZC 2QGYA 1SFTA 1ZJHA 3WFEH 2DV0A 2Q8ZA 1IEWA 1TQWA 4MJIA 4LPWA 4JFEE 1VDGA 1DIDA 3BGFC 4P48A 2OR9L 1YTDA 4LCSA 3N9SA 1Q0EA 5F1KC 3RY6C 1S7VB 4Z7AA 4CGUB 4YSQA 1ESWA 3BWAB 2GI7A 4LRTA 2X7WA 3FJNA 3N2OA 3L4UA 5LG1A 3Q2VA 4PJEE 4XPHH 1NDWA 3RDKA 3M0IA 1AOHA 1SN5A 1VFBA 3M1BA 1MJ8H 4A55A 2FLIA 1U8HA 4DBDA 5EMJA 4WHYH 2R82A 3H7RA 4WDIB 5TTRA 3WF4A 3VAVA 3S8FB 1K4DB 1UWUA 4GSRA 2AP2A 1A3ZA 3QNFA 1R5IB 2QQLH 1K8IA 2JIWA 3BARA 2HX8A 3QORC 1AW1A 1WFUA 3C6CA 1UA7A 1FUYA 3U1SL 4FX6M 2CPUA 4PREB 1ESOA 3T2NH 5I17B 4TM9A 1HHGA 2XWBB 1YPZA 3SN1A 1UWGL 4UT9H 4KH2A 2NW2A 2WB7A 3EWWA 4BKTC 4HW6A 3WH5A 3WIIL 7REQA 5C6MA 2HT4C 5MEND 5DHDA 4OLXL 4V1DA 1HCYA 4QRUA 3WS6C 4DKEL 2C3VA 3HZVA 3ZE2B 4RX4D 3C2VA 1OADA 3KNBA 5IFJB 1JI2A 3BP6B 3HS0A 4Z8FH 3P5ZA 2BCMA 2F8IA 1NAML 2X1SA 1ZAJA 5HPOA 1KXTB 5EEXA 4PC8A 3Q9PA 1IBDA 1HZYA 2C4XA 5E1IA 4TVCA 1UD5A 1CD1B 3IFLH 2QKIC 4FC3E 1RLCL 3JWOC 2GSHA 1FDJA 2ON3A 5G1TA 5JPMA 3JWNC 3ALXA 5A3HA 4AYID 4Z7QF 3CWHA 3B9AA 5K9JH 3RM9A 4OFYD 3QR3A 4YEEA 2YKKA 3CM4A 2PO6A 3ESMA 5TK4A 4N0CC 4LCIL 1SFLA 4KKAC 4P8QA 5E03A 4ZMTA 2YUVA 2R27A 3CUPA 1FVDB 3HBGA 3BH9A 4XVOA 4YNGA 3L1OL 1FPTL 4N5UA 1CECA 3GGWB 2NT0A 1F76A 3P9WB 4R4ND 1YNTF 1NAMA 2XXMB 4K3EH 1WDSA 4LC8A 3BGFB 5FO9A 1C8XA 5IVNA 2EDMA 3WD0A 4P5KA 3B3IA 1F42A 1Z89A 4NLAA 1IKOP 3M7WA 1FWDC 4PJDB 3WJYA 4RA3A 4OJDH 1TJRA 4HNUA 2PURA 5HMDA 4PMFA 2CG9X 4P9HH 1RP8A 1LQBC 3GSOB 1YEDA 2A3BA 4ZQTA 2NNAB 1ZGLA 4YVVA 3POCA 4B5SA 2CDFB 3H9SB 1U5HA 3NJ3A 4JTCA 2ZSVB 5JVLA 5F9WC 3QORB 2J1WA 1NC2A 3I9AA 2BVWA 2QGBA 2OP4H 3RGVC 3AABA 3FTSA 1B3XA 3PFUA 3WEMA 3R8QA 1OC6A 3IDXH 4YJ5A 5H94B 1I6NA 3VW3H 3AUOA 3EDEA 4Z7VF 3DOPA 4L3EA 5SWSB 4U5KA 3LKOB 1WQVT 3BJLA 2J2ZA 1YBQB 5EZLB 4YVPA 4WW2B 2FB4H 4HKBB 2J1ZA 5E1AA 2VXUH 3ZJ8A 1OOWA 1ACXA 4Z7VE 3UFIA 4I18C 2LR4A 1IQWL 1NQ6A 4X5XA 4HOXA 1CURA 4HPYL 1MUJA 3GC2A 4NO5B 2QAPA 1HEJC 4HSNA 2QZQA 2QKIB 4LUTB 3GHEH 2CDGB 2KLRA 4X7CC 4KKLC 3B8TA 4HF5L 3WQEA 4JIEA 1TVNA 4IIZA 1B9BA 2LV4A 5IJBC 4OOUA 3QCVL 3NTCH 5ANME 4XN1A 2ICWA 1QO3A 2PTDA 3UEQA 4WOQA 4ZW8A 3VIKA 2DH2A 3B9KD 3IJDA 5IJVA 1ZSHA 3WN6A 3P67A 1A1OA 2GC4C 4XOCA 4ZX4A 1XHHA 4XT1C 2XZ9A 4RKAA 1URLA 4JBSA 1Z5LB 2HNHA 2P5WB 4PJAE 4JIIX 5F21B 2XZCL 3II3A 5EBLB 4LO9A 1HX0A 4JFSA 3U4BL 2F8XC 1S2AA 5J8LA 3MU7A 2W38A 3D3VB 4YHNA 4JE0A 4XMZA 4UDTA 3MDUA 2Z2UA 3SHSA 4BJHA 2VT0A 5AAMC 5JORA 1MYRA 5DA0B 1FA2A 3MC0A 4CDGC 1F56A 4Z5RB 2X2GA 3VYOA 3O63A 3APYA 3PJXA 2E7MA 2V3GA 1Q6QA 4CNIA 1YJDC 4WUUA 3T0EE 1CBVH 3CHXA 3S2JA 3LN4A 1HH9B 3I7QA 1MRFH 4K8GA 1SVBA 5HMSA 5F8RC 2GTWA 5EG6C 1PKQA 4BFJA 4R7WA 4N9GB 5F9WB 3OKYA 4TV5A 3RGVB 3TS8A 1RPUA 1TTBA 1YQ2A 5TJWK 4OFQA 3K4WA 4EKJA 2UZ9A 2ZRYA 4AWTA 2IXQA 1XGPA 4LSUH 1EGZA 2OMVB 4KO7A 4OCWH 4LAKA 3UGXA 1W5QA 1FL5A 3P74A 4HKZB 1A5FL 1BVWA 4JX5A 5ICZB 3ETBF 4JFUA 2VZSA 3EJJX 4WO0A 5AZUA 3DTXA 1RFDH 3OC5A 5I2IA 1V7MH 2DL2A 3HW7A 2W6RA 4ORMA 4G8FA 2UXGA 1S3KH 2X0SA 3GLCA 2JKWA 3FQXB 2OYMA 4Q8QA 2XVNA 3MLXL 3NIFE 4I18B 1FCCA 4JZ5A 3N5AA 3W81A 4DF2A 3FFCA 3MGOA 5IBUG 1UWAA 5GSVB 1R24B 2WVTA 1FOBA 4AHPA 1QQDA 4F9PC 5E6IC 1TQJA 3QIWA 4L0YA 5ICXB 1XDMA 2XRAL 1LDSA 3C75A 3JT0A 3RWFB 1FBAA 2PYFA 1KB5A 1SEQH 5CBEB 1UOWA 2VDPL 5D6DC 4DN3H 2BHUA 1KFWA 2PC8A 3GMLB 3MU3A 4QRSB 2VMCA 3D1MC 5EU6D 3ZDYB 2G30A 3MKCA 3LHAA 3DOSB 1Y18A 1DEDA 2LFEA 1TXKA 1ED3B 4EP8C 5KANI 5F70A 4Y2LA 4R0LA 2HLFC 1GOWA 2EPMX 2GWGA 1K7EA 1TF4A 2DDQH 1E5ZA 2Z7YA 4WSJA 1HT6A 4HA4A 1MCQA 2OELA 3PY9A 1BZDA 2J88H 4PS8A 2I5YH 3RTQD 1TEFA 1R30A 4MNMA 4XCYA 3MJ9L 1J96A 2ZE0A 5I02A 3MLZH 1QTPA 2EKSB 4QQUA 3TR9A 1AW2A 2NY1D 3UAJC 1U3ZA 4XVTL 4KXZH 4RR4A 4P59H 3FX4A 3KXFB 4P2OD 4WWKC 5ADOH 3CTTA 1DXEA 4HMNA 1A25A 1F3XA 3CFKB 4MAUL 2NYKA 4ZAKC 1Q8AA 1JJUA 6TAAA 3GHBH 1MAKA 1OCOB 1XCWA 3W01A 5L2KA 1SO5A 1ZT1A 4ATWA 1AQHA 1RH9A 1XIWA 5CCHE 1EDGA 1M42A 3GTFA 3FB5B 3QNYB 4JLRB 3KDMA 4CADB 2K70A 3QHTC 5C3IA 2HXUA 4JFVA 3MCMA 3MV7B 1SRDA 3HHSB 4G7FA 4LYKA 3TF4A 3P5YA 2ZVIA 4KU1A 5IW6A 3FS9A 2WWNA 2QFRA 1A7QL 3UPMA 4R7NB 5BQDA 1EA0A 4RFOH 2FLRT 4WQOA 4BZ2H 3SKJL 3R13A 3V4UL 1FAKT 2KZWA 2BJMH 3RX7A 3CNKA 1Z2KA 2ZUTA 1EYWA 2YQGA 2V9DA 3ULVL 5C0NC 4NZRL 2HAZA 2OJZL 1OF2A 1QR4A 3IT8D 1MIMH 1WKDA 2CR3A 3G6DH 1FG2A 4U1KA 2IOOA 3IPFA 4KK6D 3RGHA 4JL2A 1J8SA 4RFEB 1E4XH 2FJGB 5DF0A 4KROC 4DF9A 3F1QA 5E6IB 1OZMA 1H8NA 4URTB 4KO5A 5EU3A 5GGRB 1HP4A 1TKWA 4QITA 4K37A 4AMKL 3S5OA 2ZCKH 4AY8A 5EC2B 3AQZA 3TVMD 5EZJB 5FCSH 4XP6L 5IHUH 1QU4A 4P49A 1CPUA 1GQKA 5HHXL 5SWZE 1K4HA 1U8HB 5DS1A 2CHXA 1OAJA 1WZKA 3DHJA 3QQ0A 4C47A 4N0UB 1X39A 1JD9A 1X5IA 1ZXKA 2W60A 2DQDL 4MDJB 4O2FA 2BP0A 2BRQA 2F19L 4MZ8A 3CDCA 4R96B 2AEPH 1F90L 2NUPB 1SUJA 1AKPA 3O3RA 1FO0A 1WT5A 6REQB 3B2PA 2RJHA 5HYJB 1ZXQA 3C8DA 4YHKL 4LRIA 4G7RB 1YY8A 2PKDA 3TVAA 4U05A 1A66A 4LAOA 3SQRA 5A69A 5EIIB 2GGIA 4O8AA 4EF8A 1DJNA 3GUFA 2HKFL 2A4EA 3KEDA 1GG0A 2R24A 4ORGA 4PRDB 1GRWA 1S2WA 3EW3B 1J93A 4BINA 4WWKB 3HV8A 5AAPA 1DVQA 4X5WA 5HUPA 3CN0A 3ZE1B 2GBTA 3HZVB 4N8VA 4BSWB 3RZCD 4ZAKB 4PYHA 5IUSA 1MPAL 1EQCA 1JMXA 3GBNL 5JQ6H 2OSLB 3M7FB 5INDB 2PXYC 2X3CA 1M53A 3VCLA 4WGKA 5FC9A 5D09A 1EBGA 5CD3B 4LSRL 2QKFA 4GAGL 2F5BH 4NRSA 3LHTA 4Z1BA 3QXUA 2X3BA 1EPXA 4APQD 2IXVA 2PRHA 4WJ5B 4DJFA 3TYGH 2PS2A 2XLLA 4P23B 1VEMA 3ECVA 1M7IA 4XBPA 3W75A 4MQ7B 4RWYL 1S9VA 2Z35B 1A7NH 5FF6A 1NLBL 3RU8H 3K8MA 4JJ5B 1G5AA 4HHAA 1X7QA 5BV7L 2H0FA 3GNRA 12E8L 5HPMA 2NX5E 3WLWD 4Y4HA 3CUXA 3ZHDA 5HATA 5T3ZD 3M1OA 4HKXA 1D7BA 2J6WA 5HHPA 4ALDA 2CIIA 1RZ8B 5TQ0H 2HUEA 5ALBL 3NNTA 3OHXB 2Y6ZA 3W24A 5FO9B 4HWBH 3L5MA 4G5ZL 3MLWL 5IBLC 1XISA 4KROB 4S3AA 3N40P 1GMEA 1IB5A 3QPYA 5DQDH 2H0EA 2RDTA 1K4CA 2E7LA 3WFLA 4DSYA 3C8KB 4OZOA 4RGOL 4MXQD 4OTXL 2GUUA 4J8QA 1XFBA 1YDYA 1UKOA 5AFAA 4OIFA 3B7SA 3FT1A 4B7LA 3H8NA 1IC5H 3GSQA 4ZW6A 3GUGA 4X0KA 4YHIA 4IL0A 1GC1C 1SU5A 1NC2B 1XLJA 3PS7A 2X70A 7ENLA 2R2HA 3B9VA 1KTJA 4L8BB 4U3HA 4PRIA 3KPOA 1HI6B 4LKCA 4LESA 1M7DB 1R3IH 3V0GA 3STGA 1IAOA 4Z0BL 3D25A 3MUXA 3QXTA 3E0GA 4V33A 1JVOA 1OAZL 5C07E 4QHKI 4BFBD 3G1RA 5DD0L 4JRYE 2BVOA 4XE5B 2H9AA 2QDGA 4E41E 3N40F 3FONA 1J05A 3RWCB 1FWGC 5BS0D 4NOBA 2EE0A 3WLBA 3UDWA 3O07A 4X3ZA 1Z3GH 3C5ZA 3PNWA 1CI1A 1MJUL 1QFWI 5JOFB 4X9FA 1JQXA 3BURA 5KJRL 2QQ6A 2PXYB 3U0TB 4M0XA 3QULA 3M1ZA 1HQRA 1PDYA 3C6SB 4DBSA 4H0HB 5C0CA 3EXJA 1BOGA 3NEEA 3HNVL 1MCRA 3EMQA 3NQ7A 4KITB 3M07A 2P8MB 3CC5B 3DX3A 3H70A 3KVKA 4UMCA 3PWNA 5I8KH 2Y07L 5FFGA 1EJTC 4NJAL 4I6KA 5K59F 1I3GL 2G50A 3TJEL 1N6VA 4Y16C 4QHLA 1GVYA 1QO3B 4DT2A 2JEQA 1CJYA 1DBTA 2HVJA 1NWTA 3EGJA 3QDME 5J4MA 4R0LC 4Z95L 3FT4B 4XVSH 5JW4M 3MC5A 4FOKA 3JZYA 1UBSA 2ZT9C 1BVZA 5FOBA 2YD2A 2J6VA 2V33A 1I85C 3UTQA 4RCAA 2PPGA 3QG7H 5AHFA 3LS9A 1HOEA 5SWQA 2R4SH 1I31A 3F83A 4H9ZA 2AQTA 4HH8A 3C08H 1U92B 1XW8A 2WJ7A 5D7JA 2VDLB 1PHQA 5I16A 1LG1A 4WUUB 1M3JA 4DXVA 3CO4A 3BVNB 3OGOE 1T5XA 3VH8B 1ILSA 3QFDA 3UJEA 1XS2A 1OK0A 1R1CA 5FAJA 3VTAA 1XIWC 4J7RA 1BZEA 2QTEA 2GTWB 1FL6B 2BS71 3JUZA 3UR8A 3REVB 1YDOA 3PDGA 4FFZH 3LRMA 2V6AA 1OAUL 4XNYH 4ZNEA 2YN5A 1E5YA 3HG5A 4LVGA 4L4VE 3ZLHA 2EDRA 3BPNC 1DJGA 2X1TA 4L1WA 4N0YL 3LHWA 1BQKA 3WLMA 4WJ8A 3WEOA 3WO8A 1TWZA 1RV6X 4HCGA 3PP4L 2XIJA 1W9DM 4GFIA 3WD2A 1CDJA 4UTCA 1NAL1 5CSUA 4ZT1A 3OX8A 2WCAA 2BK8A 2FTWA 4N42A 4N6FA 3UYOD 2PGEA 3H22A 3I4KA 1TU2A 1JZEA 4OZFB 1ZBWA 1G9ML 4Q7IA 3OIHA 4M1DH 1A50A 1DQKA 3HBLA 5I18L 1F18A 4P5UA 3IRCA 1T7LA 3TJHC 3ZXAC 1XC4A 2PYFB 1F11A 5KVDH 4HA1A 4TPRH 3MJ8A 3WD3A 1MZYA 4H40A 3QSRA 2NR6D 4A21A 4Y16B 2O93L 2I9TA 2WBJD 1P6BA 5KBNC 3D08A 2GVEA 1KLUB 5LBSL 3QCTH 3MWCA 2UWEB 1SF3A 4KZDL 2UY6B 1A6TA 5C09E 4U1HA 2NWRA 5CC6A 3AHVA 2Q3RA 2PTVA 3FUNA 4D9LL 4PJCE 5BRZA 1T7WA 4YMZA 3WNOA 4FNRA 5DTFB 5JQHC 3A67L 4UFIA 3GVQA 1Q4WA 1CFVH 3FQNB 3K0WA 3MROB 2J9XA 3GSVB 4J3VA 4PLKC 1AL8A 3V3WA 3RX5A 5JW4R 1QRNB 3TCLA 1S7XB 4GRWF 1E2ZA 4BE6A 2ZXDA 3SCPA 2ZKYA 4M6UA 3F7PC 2DRUA 2ZPKH 4ZTYA 3ABOA 1TJIH 2WXLA 2AK1L 4P5MB 4N6EA 2EE9A 4EIGB 3WLIA 1P6WA 2R29H 1N64H 1A3LH 4OF7A 3T6VA 1IKNA 5J9PB 5CSZB 4XWOD 5I76B 5JH1A 5AVXB 3ORJA 4IGSA 2BCKB 1J2BA 4IPIA 4FXFA 3KYNA 5JHLA 4NUPA 3D3FA 4JDEB 2IV9A 1DJWA 2IFGA 1JN6B 1TTRA 3UTTA 3DKHA 2ZC8A 4H88L 1I3RB 2O9TA 3VC6A 4HTYA 3EBGA 4GRMB 5FKYA 3XINA 3S3SA 2Y3NA 2O5XL 3N0PB 3L4YA 1J5HA 4LHUD 1AI1H 3WEZA 1AFVH 4RV8A 1WWAX 5C08B 4R5EA 4LCWD 4OIAA 2CNZA 4X6DE 4UILH 1B0RA 1QW8A 2NDGA 1RZGA 4D72A 5EU3B 2E8YA 1E0XA 1TKWB 1UA6L 4IBQA 2E7LC 3URNA 5IFPA 1Y7VA 2Z31A 1NOAA 4ZSTA 3CDFA 1R0AH 2CALA 2VR5A 4G6CA 2VXSL 4H1ZA 3IWUA 3SE3A 4MX7A 3B0UX 2VLKB 2CLHA 1WP6A 4IYKA 2CBJA 2X3AA 3RVWC 4RGMC 5EF1A 4O2FB 1D5MB 2PTYA 1TPFA 3CHQA 2C7UB 3NR0A 4ZSOA 2G41A 1S3HA 4X99A 5CGTA 1RUAL 3PP7A 2PDXA 3TBYB 4ZFFA 1FH8A 3TX4A 1G7UA 3ZKQD 1B6DA 3GD1C 2G60H 3IS4A 2YOCA 4ZFGH 4ORGB 4EDXB 3LQAH 4P8UA 5BZWB 1VCVA 3N3TA 7TIMA 5K7JA 4X5WB 3Q45A 4NCDA 4N8VB 4PRNB 2FNBA 2AGKA 2QLVB 3KPMB 1TOXA 3TPKA 1NUFA 3US9A 1NINA 4MXVF 4JFPA 5FSEC 1OHLA 3OMIB 4X0NA 1TV5A 3GJFB 4FQHB 4TV6A 3BDXA 5IREA 1TVHB 3BGJA 4Q4RA 1BZOA 1HL5A 3T4WA 3S6TA 1MVUA 3RPIB 4MXVE 3VINA 4ZMXA 2PTTA 3CVHH 4HCRA 2DWYA 5ESAA 4A6YA 3W7DA 2ZUWA 4DZBA 2XQBL 5GJMA 3U7YH 1I8UA 1KLGA 3WTWA 4HUXA 1G7JA 5E9NA 4PJBB 3CQJA 1GZHA 4OV4A 3REWB 2CIIB 2OMUA 2AQ2A 1GSMA 2PTXA 3GINA 4XO7A 1MFEH 4PB9L 4ZXOA 4YZFF 3BPCA 4JM2F 5HYFA 1PWMA 3MFGB 1C1EL 4L65A 5F3FA 3PUUA 4RQQB 4TVPL 3RVUD 4FXTA 2Q8XA 4RIRB 3DUSA 5EF3A 2EXWD 2Z0IA 3RCYA 5FYKH 3WNKA 2Y7OA 5IMMA 3WU1A 4A2FA 4YMPA 2EIKB 4K1WA 2CD0A 5HVGB 3TZVB 4B9IA 4BGLA 1I1WA 3ME0B 3F7QA 2I7SA 4XZNX 4Y4FA 3KM2A 3BQVA 2D3VA 3STLA 3PQYB 1XBYA 2HDJA 4RGMB 4RDYA 2YEVB 1MVYA 3P2VA 4YHIB 2ISDA 2ARJQ 1F4AA 2PPFA 1KBPA 3ARQA 2D0HA 3X14A 2X70B 4PBDA 5HDRA 4M51A 4ZOBA 2A9NL 4I8DA 1P4IL 4B16A 1B0GA 3ULSA 1U95A 3LEXA 1M6OA 3TO2B 3PS6A 2LT9A 1CZ1A 5KVEE 4PJIA 4NBYB 3UP6A 3URQA 3U46A 2A3AA 1CWYA 3EUDA 5J7CC 4JVWA 1E6JL 1Q9KB 4Y2DC 3NK3A 4UZSA 1T6VN 3AU0A 1CB7B 3PZOA 1SOKA 3P3YA 3BP7A 4N1EA 3FSZA 3SGEI 4ZFOB 2HS8A 5EORL 3ITCA 3B37A 3A6CL 1SZGA 2YC1B 3APGA 1PU0A 1A4JB 5C0CB 1YN6B 4FNTA 3J8F7 2Y7GA 1CG9A 3ANVA 4L5FL 1HYRC 3N43F 2FEDC 1DR9A 4XN2A 4FQ1H 3VI3A 4DKFL 4H6QA 1N8FA 3PWNB 2CLZA 4UTTC 3BW3A 4YR6B 4HPNA 4H4NA 1NFDF 2QPDB 2FDSA 3CVIL 2Y7MA 3VFNA 3TV8A 3FT3A 3Q6FA 1E5UI 5FV1L 2O6EA 4F7CA 2QEZA 4J3OD 1A3RH 5I3KA 2V2CA 3AIUA 5ILTH 1OK6A 5JO5A 3OTTA 4Z7OF 2XQYG 3D51A 5GZND 5ISZB 1A14H 1RIVH 4Y5XA 2CA4A 1MFVA 4OKVB 2WTRA 1IAIM 1UUQA 1ECZA 3U9PH 1V5XA 3OYZA 4QTHB 4S3JA 4AVKA 3MO4A 4ZYKB 3KRBA 2OPCA 1JOIA 4HX1B 1ZSDA 4K5NA 5IKCB 4Z2LA 3ZFHA 2X28A 4XAWL 3U8GA 4DIAA 4QYAA 1H8LA 2VC9A 1V8HA 3IGFA 4GP5B 1FHDA 5CP7A 3BEVB 3OJDA 4N2DA 3W84A 2FHCA 2Q3XA 3ZUCA 2FT8A 1WHOA 3FH8A 4G2DA 4UTHA 3DBXB 2W0PA 2H1LM 2O26U 3R7QA 3SQMA 1DVJA 4QS5A 1Z69A 1A6UH 3GLDA 3DV4B 4A29A 4AM0B 4F91B 1KCVH 1L9TA 4QE4A 1SVZA 4YBHA 4FSAA 1KCXA 1L6FA 3TN6A 2XC8A 3D39A 4NILA 1VJZA 3GR8A 4X9BA 4K94L 4ZMWA 5AC5A 2ZFAA 4Y2DB 3CZKA 4BDVB 2AANA 2APVA 4KERA 1NCCH 1JRHI 3UIYA 5IBTH 4OJFL 1AQ0A 3USZA 5KVGL 3A4WA 4D8OA 4UV7H 2C9AA 2PBGA 3D0VB 4P4KA 3C9NA 4HGMA 1XYCA 4XNUH 4MQSB 3SB0A 4QM1A 4JFDE 3C60D 3BG3A 3SGDI 4MUPA 4HFUH 1KCRL 1X9UA 3OP2A 2XG4B 1NDYA 1R2SA 1C12B 4I48B 1Z44A 3LCHA 3ALGA 4JICA 5I6NA 4F40A 4GKZA 4ZUWB 3AI0A 2AXFB 4QRRE 4RMUA 5BUAA 4AQZA 1DVYA 5KSAA 3WJJA 3R5EA 1XGZA 3L45A 5KSVA 2XBZA 1E40A 3MODL 3H2WA 1XCTA 2YWZA 1BEYL 3O6KH 2V8LA 3UTSB 3TU9A 1MCKA 4RDQF 1J1XL 4UOJA 4PJ8B 1IIIA 4QGYA 5E8OA 2DZWA 4RZKA 2Z4QA 2QQKH 4O9HH 2A85A 1UWSA 1E67A 1AD4A 4NP7A 3CX5K 3FW6A 3N11A 3LZRA 1YO4A 5HYSA 3NO3A 3ARDD 1D6VL 3DCPA 4M5PA 1JHTA 1V6TA 1OSZB 3CPRA 4MYXA 3OAYK 4OZGA 3CVCA 1EVUA 1ORSA 4BY3A 1Q6RA 3NESA 1QSFE 4Q3MA 3N3EA 1EEZA 2EC9T 2IV8A 3R0KA 2D31A 4NQDE 1ICQA 1UTDA 4JGJA 3KYMB 1FZKA 1UYWL 3GWQA 2VM4A 1Y5VA 1UKPA 3FO0L 3BO9A 2E68A 2X88A 2O5YH 3LNGA 1S9YA 3UPBA 1SPDA 1F8MA 2QQNL 3TESA 1FH9A 4FEMA 5FJPA 1GYMA 1F86A 1KGWA 3G5ZB 2AK4A 4R7VA 1WA1X 1OINA 4NZ3A 5CHNB 4PH6A 1DQUA 2Q6WA 3GZKA 1PY9A 3BAKA 2ZOTA 3WL9B 1T03L 1CI5A 1OALA 3V7MA 2NLIA 1Y07A 2CO6A 1CEOA 4NB7A 3UTTB 1CCZA 5I6KA 2YQBA 4Z9KB 4W9ZA 3U0PB 4FZIA 1D2PA 3MHUA 2VO8A 1QHQA 1DE4A 1R9XA 3GZAA 3H9YA 3VGEA 4ZX5A 1LO2H 2H3KA 3QKZA 1VADA 3T3PB 4PHXA 2P10A 1OVZA 2ROXA 5CBBA 4H26A 2DT0A 1SDDA 3THUA 1KTNA 3LJ3A 5E2UH 4XV0A 2ZF8A 5PTDA 2ADAA 4HNVA 4AD4A 1T4KA 4KI5D 4WK0B 5I15H 2VJXA 2ZDSA 5CSGA 4NQCA 1VLIA 5MI0C 4CD6A 4X98B 4LLUB 4S1RH 3ZO0A 1E5AA 3EX4A 3TJLA 3PL6B 7CGTA 4RMSA 1X4XA 1WFIA 2OO0A 1O5RA 4HLZG 2VGFA 2PRMA 2BY3A 3DG6A 3LRSB 1ADOA 2LLGA 3QH2A 4H9MA 1A9BA 4U31A 5LG6A 4LLMA 4Y4FC 3P4NB 4XE0A 2BZNA 3DEQA 1CLOH 3GSUB 3RLUA 3UJSA 1Q6EA 3L5XH 3GB7A 5IB1B 2MPAL 3MCG1 4JY6A 4U7MA 1AGBA 3DWTA 5I09A 1UBPC 2ATPA 2DI8A 1OOAA 4UWMA 1D3GA 4GO9A 2V5TA 4HS8L 4LGSB 4Z78A 5TIMA 4IU3B 1BZ8A 3NIDB 4BUQA 5BJTB 4QO1B 2Y6TE 3ZVIA 1YTEA 2FX7L 3KOXA 4Z42C 4S3FA 3UZJA 3MXWH 2BDNH 3U30C 2Y7QA 1HINL 3WYRA 5ESVB 1LO0H 3C61A 1L9WA 4QD2E 1Q2RA 2NY7L 3TN0C 1QNVA 4NM4L 2R1LA 4E2DA 4ODWB 3HFFA 5KZMA 5C0AD 2YARA 1EHXA 1IGSA 3MRPB 4H8VA 1EZVY 4BZ1L 2AHIA 2NNCA 1ADSA 4MJ5B 4S3CA 1BWKA 1G9NL 4ZQCA 4M8VA 2H9GB 4YHMH 2WLKA 1DQMH 1HIMH 3QA3B 5JOEA 5GGTL 3EFOB 3GT6A 5D7IA 1MJ7H 1BAFH 3AWEA 3FU9A 4DF1A 1HQ4B 1H49A 1DQVA 3SCVA 1ZRQA 4HT3A 3CV6A 3T8XB 4JPGA 4L29A 2XGZA 5FL1A 2GBVA 3WQCA 4HJ0D 3NZQA 3QC0A 2SEBB 2UZXA 4J2MA 3JUYA 3H24A 5EMKA 4EZJA 1A0QL 1UJQA 4PCPA 3APTA 4DZBB 1OQFA 2RACA 1JZIA 1KLGB 4H6EA 4BZ1A 1IBGH 3WTYA 4HHHA 3OR7A 4EF9A 1H5YA 2X4UB 3P9MA 3OKMB 3QDHA 1NTDA 1HTIA 4PY7B 1OGSA 4LY4A 2V0TA 1TVBA 2PI6A 5EFIB 4HZMA 5F2LA 3S98A 5D05A 2JB6A 2QVMA 2PF8A 2WQPA 5DJCA 2AQSA 3LKPA 5MI0B 3U6XA 3OAYH 1IZCA 1A6WL 3MKGA 1QOPA 1EO8H 1L8NA 3OVGA 5E0KA 3WLKX 4MQTB 1Z6JT 2QV4A 4O4YH 2BOFX 2YKLH 5I3HA 2WWKT 3MSYA 1HOCB 1KDJA 3ROLA 1X7SA 1O60A 4GSDH 2VUNA 5JR1H 1KXHA 3VVGA 3S0PA 4CUCA 3TH2T 1GORA 4DW2H 1OABA 3LSOB 4LP5A 4LSTH 4JRLA 2KL6A 3HMXH 2Z3FA 3G22A 3RURA 4BUGA 5FGBC 3TM6A 1Q2SA 3N85L 3V36A 4G9FB 4PJIB 3U30B 4EI0A 1MXDA 3WJMA 3LENA 1JK8B 1TPXB 3TN0B 3UYIA 2HMCA 3BIBX 3NURA 4IXXA 1SBSL 1CE1L 3AGVA 4M80A 3FT0A 3SPJA 4OAWA 4DO4A 4XNAA 2DPKA 5AHMA 4BK9A 2CA3A 2QULA 4MYWB 1RCYA 1RJLA 3TW7A 4P4KC 3WSUA 4IBLT 3TV3H 3M0VA 3IIOA 1VQTA 2R2BA 5JPNC 1SQ7A 3CUHA 5CZSA 2C71A 1WEJH 2Y8KA 4ALAL 2PCPA 3M0XA 3TL5A 4KUZH 2H0PA 3OV6A 5M95B 4PRHB 3QI9D 4PCYA 2X0UA 1IXQA 1CE6A 5KSAC 1GVSA 3QHZH 2HZGA 4CCCA 2HT2C 2R8SL 2IMNA 3ULUF 4AG4H 3FT3B 1OM9A 2R7EA 1WXYA 1KENL 4KJPD 2YXFA 3VXQA 1QR1A 2X7LB 4IDJH 4UIKH 3MOBH 4JHBA 1GS8A 3U2JA 4LCVA 3PZ9A 2AC0A 1HC1A 4LEOA 3UPRB 1J86A 3LKSB 5I6MA 1RUML 1YMME 3ULUE 1G67A 3NL6A 4PRPA 4JTLA 2ZBTA 3WQ5A 2XWEA 3D8MA 4UQCA 2BGNE 1W6WA 2CJUH 4HWNA 4O00A 3TKFA 2PODA 3VMPA 2FWUA 5IT2L 1ZV9A 5J1AB 3IUIA 3B83A 1J0IA 3AJXA 3DMMA 3HRZB 1OAYL 4A67A 3IDYC 2UY7B 4PLOB 4QNWA 5CP7B 4OD2B 5KS9B 4WO4D 3TPUB 4DFHA 4Z7QE 1GW1A 1VKXA 2HB0A 2ZOXA 1T2QL 2C1IA 3LH2H 1K2DB 2GJJA 4P2RA 1TO4A 2E3VA 3GFZA 3SFWA 4UV4H 1DN0B 5DJZA 2XZQH 2FTYA 2IW0A 3GO2A 3VXTB 5A6LA 3RGTA 4LU5L 3TOPA 2PE4A 5I6OA 1MCNA 4D7PA 1MEWA 4WY0B 3SCQA 2WO5A 4NIKB 1U8OA 1UACH 4O2EB 1QSEE 3HE7C 1YNLL 2RB8A 4JN2B 5GRUH 8XIAA 3V8CA 3RK8A 1PCXA 1YCSA 1U2YA 4Z2JA 4D0DA 2FGWH 3SE6A 3VB8A 2OL3H 4BF5A 5E94A 5JPNB 5CCZA 4Q9QH 2QVTA 3IF1A 4KHTL 1XGRA 3T6CA 4AD3A 2BW5A 1Y8BA 1GEQA 4EUPH 1XB8A 1XR8A 1DDHA 1F8IA 5DJAA 1C90A 3KWSA 1CYXA 4GI4A 4NXKA 1CQKA 2ABBA 5KSAB 1EV2E 3HA1A 1KBWA 3LPGA 1UXSA 4AHQA 2WAGA 1EIBA 5E2TH 4PAZA 5EC1B 2FBOJ 5DRNA 4NJKA 1MFMA 5HI4D 1LEIB 1T1YA 3BZGA 2R91A 1OGAA 3GHTA 4UTAL 4QOKE 2Z4QB 1FYTA 3EOBB 5ITBL 5HYIA 3ARFA 3L4TA 4QXVA 5K9KA 5CG7A 1UD8A 4DLMA 4CKQA 1PCWA 3EB4A 4HKJA 1KB9J 2OODA 2HN7A 2K9FB 3HHMA 3MV9B 2JK2A 5ID0B 3QDAA 3CBKB 1HJBC 2GZXA 4PLNC 1EEZB 2ZUMA 4C6MA 5CEZL 3HUJA 4GACA 3VFOA 4KEZA 3L7EB 5IB5A 4XR8C 5E08L 5GRVK 2AQOA 1YECH 3MRGA 3P30L 3HAEH 1XX9C 1OF6A 2OCCB 5DSCB 4YHZL 4HU0A 4WGWB 1LO5A 2AK4B 4F3HA 1NWOA 4GS7C 4DVBB 1MCOL 2QT6A 4JDYA 3FO1A 4A2HA 3W11C 2NZLA 4FYTA 4AITA 3DHDA 3H3KA 1TWIA 3F05A 3DZ1A 2B4CH 1E4KC 1FWXA 1TG8A 3HE7B 1DE4B 2NZIA 3M17B 4AUJA 1AHWC 5EA0H 1IAIH 4DBEA 1FYHB 2PDWA 2XKUA 1WFOA 5D9OA 3U2OA 1PLGL 3VGAC 3TCSA 4ODTH 5HI5C 1DCEA 2XA8H 1M2VB 2A1WL 3PAVA 5FYLD 5B80A 3MMEB 4S3DA 4JDZB 5I26A 3AMDA 4UFKA 4PBGA 2D2JA 2DYPB 1TFPA 2VM9A 4PCKA 2WVSA 2XN0A 2GJRA 1SR9A 4GT7A 4LNCA 2DT3A 3FXGA 5J6HB 5G2IA 1GKQA 5IUCA 4CNSA 5DT5A 1L7TH 3D6GA 2JQXA 3WLJA 4JY6B 2YLAA 1QTYT 4MNQB 2C9UA 1M4KA 4Z78B 3PANA 3V52L 1J79A 5KZCB 3AYSA 4F24A 3H2NA 2UX6A 3AZRA 4JCWA 3BP5A 5T1LD 3GD6A 3PJTA 2XPKA 1NGWA 2P5EA 5IQ9A 2V5RA 5A6IA 4HU8A 1B5TA 2AXGB 1QHZA 1ASPA 3KOYA 3C2FA 3WHXA 4LC6A 2NSOA 1CR9L 1FGNH 3DETD 1KB9K 2GGHA 3QQ1A 2WXOA 4C83B 3TBWB 1W3IA 4YVUA 3FU8A 4ZDHB 2ZKHH 4XD6A 2W9DH 5ECGA 4F33A 4ERAA 4U1JA 5D7LA 3BLIA 1BA9A 1KB3A 3WY2A 2W61A 5AYQA 2NY6D 2R0LH 1AC0A 1XINA 3NG5A 2F1BA 3E38A 3WIAA 3KLAA 3RLVA 4MKMA 4MSWB 2B7OA 2W79A 2AV7A 2IAMA 1H1NA 1MIEL 1DPMA 3D50A 4HC1H 1ITCA 2N4IA 3WF0A 3VFSA 3JWDL 2VMFA 4GOSA 2B4GA 3G3MA 3HS0C 5DZ9A 4L23A 3UH8A 4ADSA 4EBQH 3IJSB 2QNEA 4K8EA 4TNGA 3P0WA 2HISA 3E9UA 1RZKH 4IS6A 3TNOA 4XMPL 4KIEA 4DJDA 2P24A 4NRZA 1AHWB 4HPJA 3KL3A 5L2JB 4HWEH 2ZCHH 4PI2A 3EHBC 4RGND 4H8WH 1IFRA 1EEPA 5IHZB 1MHEA 2Z28A 2F1AA 2VW7A 2OPJA 5LKNA 3F5KA 3OR6B 4NPYB 1P2CA 5T1JA 4R3SA 3K80A 3W9ZA 4XGZA 1TPB1 2AABL 5JPMC 1J9CT 3MJ9A 2N7SA 4XPGH 4N3UA 4MZIA 2DQGL 2PO6C 2P1FA 1XUZA 4F7TB 1SR0A 1U8PA 5A8MA 3CH0A 2A99A 4PEEA 1Q1JL 3H9ZA 1FVEA 1K8XA 3O45A 1FNGA 4MJIB 3QY7A 3STZA 2I69A 4ETQA 1MFBH 4HYVA 1EVTC 4UWQB 2DKUA 2YCJA 1GGOA 4I9MA 4F37K 4AT6A 2MOGA 2Y2TA 1N70A 4LIQL 5ID1A 4WFGE 1PBGA 2BVUA 4ELKA 2XZ7A 3RAOA 1TWSA 2F5AH 2MOQA 1K02A 1VFBB 4ZGYA 3M1BB 2FX8H 1MW2A 3QJVB 2APWA 3GMQA 1E9ZB 2FQEA 2D2GA 4DZ8A 2FZDA 1TNMA 2F9RA