1AQMA

Alpha-amylase from alteromonas haloplanctis complexed with tris
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the psychrophilic alpha-amylase from Alteromonas haloplanctis in its native form and complexed with an inhibitor.
pubmed rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1aqmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1aqmA01
3RO8A 7CGTA 4AZCB 4XB3A 1E6ZA 1E4IA 4ZXOA 5IHSA 1WZMA 1KB3A 1JDDA 1J11A 1CGTA 2OLHA 4U31A 2XVNA 2WMHA 3WF4A 1WDRA 1HIZA 1GPFA 3WQVA 2D3LA 3EMQA 1UH2A 1CGYA 5E1QA 3BXWA 4PTWA 3W27A 3BLKA 4HTYA 3DECA 2O9TA 4TXEA 1CXHA 1AQHA 3PZIA 5JIPA 4BQ4A 1XCWA 1OSEA 2D0GA 1NP0A 2DSZA 3DDFA 2XUCA 3N04A 4CN1A 3S5YA 2Y8VA 2WVUA 2AOSA 2J74A 2VZOA 2VZSA 3N12A 4W89A 2XHYA 2BVDA 2WSKA 1H3GA 4UQEA 2Q8XA 3MUY1 1QHOA 1LQ0A 3SCWA 1JD9A 4CU6A 3JUGA 5AC4A 3UERA 2D22A 3WNKA 3VSUA 4OJYA 3PHAA 4M24A 2YIHA 2WC3A 3EDKA 2X2YA 4JHOA 5AY7A 3AI0A 3WY4A 1C8XA 1HKIA 3PZ9A 3SUWA 1MQQA 1QHPA 4W93A 4CN4A 3SCUA 2QPUA 4WF7A 1PX3A 3AYSA 3CUFA 1V0MA 1UYQA 4CUCA 1UA3A 2IXUA 4PMRA 1ISVA 4W87A 1VAHA 3GTNA 4U5IA 2DSKA 4QDMA 4J3TA 2W4XA 1V6YA 4PCSA 3WSUA 1JZ5A 1CDGA 1IV8A 3AHXA 3NSXA 3QHOA 4U5KA 1OT2A 1OWQA 1L8NA 1TUXA 4MB1A 3VDBA 5CPQA 3WD4A 3BH4A 5KEZA 3ARSA 1EO5A 1NARA 1NM9A 1QI3A 4WKHA 4YHEA 4PN2A 4NXSA 3AHVA 4PMZA 4U3CA 1GQLA 4D6EA 1UKQA 3N15A 3VIFA 2XTKA 2CEQA 4UZSA 4OGZA 1GHSA 1BYCA 3SEPA 4AEEA 5FIPA 3WF2A 1E6PA 5BYWA 2ZXQA 4H8VA 3GNPA 3ALGA 4BZYA 1LWHA 3MI6A 3ARYA 2ESCA 2WM0A 1QI0A 3ZR6A 4DWSD 3SIMA 4QLJA 1BYAA 2ZICA 5C70A 3W37A 3DX4A 2JEQA 4XZWA 5ECUA 3PZGA 3AIQA 1Q6EA 3CBWA 4M56A 3VIPA 4MB4A 3GXFA 5I79A 2XFRA 4MAVA 3L4WA 1CEOA 2WWDA 3OA5A 3NDYA 3WF3A 4F8XA 1GZJA 4J3UA 1H4PA 1WCGA 3CZ8A 4UFLA 5DEZA 4BF7A 2VZTA 4TVUA 5LYRA 2G3JA 1W3LA 3BUDA 4MAZA 3CIVA 5CGTA 2ZX6A 4Z2IA 1V3IA 1VRXA 4EK7A 2EO7A 2X09A 1PX8A 5E9AA 2YL9A 1EHAA 2Y24A 2ZX7A 1NOUA 2WBGA 3OIHA 3SCVA 2Y8KA 4D1JA 3A3HA 1W1VA 3VVGA 1OD0A 1GORA 4LPCA 4LYRA 2BHZA 3WEZA 1GQKA 2OWWA 1G94A 5A6KA 1O6IA 5FCZA 3F5LA 3ARUA 1GONA 2EPKX 4Z2KA 3K8KA 3WQWA 3EJTA 2WMGA 3VIHA 2VX4A 4ACYA 5JUVA 1H0GA 4W8BA 2CITA 1JAEA 5A6BD 3BUQA 2DSUA 4P8VA 4ACZA 3DX1A 3O9NA 5FOOA 1BGAA 2XWDA 5M17A 1Q6DA 2A3EA 4M82A 5A8OA 1JI1A 2EJ1A 2AMGA 2WANA 1E4NA 3WL1A 5ABEA 4B16A 1H2JA 3RDKA 1O7DC 5I77A 1B9ZA 3L4TA 2X1IA 3RIKA 4AEFA 3CHCA 1CGWA 3GXTA 4ATWA 3DHPA 1R8LA 3AISA 4CKQA 4GQQA 1H11A 1OGGA 1UQZA 3FXYA 2JIEA 1W2VA 3MMWA 3SUSA 3WMCA 1IZKA 1HJSA 5ABFA 1C90A 3DYMA 3HU7A 1IZJA 1SZNA 3ECQA 1TVPA 2WCSA 5A6MA 2CPUA 2W91A 3T2QA 1DEDA 3T2PA 1KXHA 4CVWA 4JFWA 2CKSA 4UFJA 1AVAA 1GQIA 2Z1SA 3A4WA 4RE3A 5ABHA 1E5NA 1ODZA 4TX6A 3ZJ8A 4JL2A 1SMDA 1NQ6A 3UG5A 2VMFA 1E73M 2BNJA 3WQ6A 3A6OA 1QNOA 5IXEA 1SFSA 4IM4A 4RE2A 2VURA 2E9BA 3GM8A 4B9YA 2QHAA 3AZTA 3DDGA 2E8YA 1TCMA 4JIEA 2FHBA 2YFNA 1HP5A 1D2KA 1JGIA 1E1EA 3ARPA 3AYRA 4P8WA 1UG6A 1KTBA 2QMJA 1B30A 3ZT5A 3EJPA 4PUEA 3EJUA 4BA0A 2DSWA 5JBFA 2EABA 4J7RA 2WVVB 4AYGA 1ZL1A 2NW0A 2UWFA 4YPJA 3SUVA 4QCFA 4MADA 4PCTA 3VGHA 1TA3A 3BVUA 1Q6FA 4M81A 1PZ3A 4AIOA 3AS1A 3IJ9A 1UWRA 3WD1A 2W62A 5I3DA 5GNYA 1HN1A 4HMCA 5HXMA 1B31A 3NUKA 4Q22A 1GOWA 3SCTA 3LPOA 3W24A 2C8NA 3RM9A 4ATLA 4PMOA 5A3HA 1JZ3A 1J01A 4PBGA 3RJYA 4Z2GA 4UFIA 5BWFA 2IUZA 3BC9A 1CECA 2JFEX 4X9YA 4FLRA 1WDPA 3WBEA 3POHA 6CGTA 1NOWA 3DC0A 3VMOA 3UETA 4NI3A 1QI2A 1VIWA 1V08A 3IK2A 2V5DA 3BVXA 2WMJA 2V3EA 2G8ZA 2FH8A 4UZUA 1BF2A 3GH4A 2PB1A 1R46A 4OUEA 3KEHA 2ZX9A 1UA7A 1OIFA 2AAAA 1KTCA 2WVSA 3L2LA 4PMQA 2WC4A 3WH7A 3K1DA 3OLGA 1UR4A 1J9YA 3GXNA 1V02A 1CXFA 1QPKA 2BY0A 3HJEA 4TTUA 3ZMRA 2B31A 1BAGA 3VX1A 4LYQA 3APGA 4PEEA 3IAPA 1UR1A 2VNCA 2XVLA 3PTKA 1JDAA 3HN3A 2VVSA 4NZCA 1HKKA 1US2A 2WCAA 1B3WA 4C7DA 3D4YA 1D7FA 4BS0A 1W9XA 1U30A 1PBGA 5EB8A 1HF6A 2BHYA 4LX4A 2XSBA 1HKMA 1W9UA 2WBKA 1JXJA 2IGTA 1KWKA 4AWEA 3MV11 4TUFA 3WDIA 3OLEA 1E5JA 4AZ7A 5GPRA 3SUTA 1MFUA 2BY2A 3TTOA 4CD6A 3NSNA 1JIBA 3KL5A 3ZR5A 2ZX5A 2YDRA 2J77A 1E9LA 3VMPA 4XV0A 5JBEA 2J7DA 1U33A 3LPGA 3CZJA 4DUVA 3BLPX 2O92A 2BVYA 1GUVA 1Q6GA 2EXOA 2J62A 3AFBA 3VGGA 4JCMA 4U2YA 1VEPA 4OBRA 2XWEA 2EBNA 2ZWZA 3VILA 5DT5A 4DWSB 3NJ3A 1V6WA 3THCA 1KGUA 2DT3A 4KGJA 2GVYA 1UD8A 5A2AA 1HWWA 3UR7A 3GNOA 4MDOA 3K46A 2WHKA 1R75A 4FNTA 2DT2A 3W28A 4FNSA 4B9ZA 4GIAA 1KBBA 4FLQA 4D72A 2EADA 4C7GA 3WFZA 4AXNA 4W5UA 2GDUA 5DT7A 2XFFA 2PWGA 1MW2A 1VFUA 1EGZA 4DWSC 3MANA 2XN0A 3D5HA 4CD8A 3CZNA 2WXDM 3VMNA 1HVXA 6A3HA 1WE5A 1T0OA 1LJYA 4D6IA 2X0YA 1UD4A 3DX3A 2OWXA 1K9FA 4JFUA 3TV8A 3N9KA 3GBDA 3GNRA 5IHRA 4AZBA 4D6FA 1V6UA 4JZ5A 1AQ0A 2EAEA 2D23A 1UWTA 3DHUA 1J0ZA 3D51A 1JG9A 3T2OA 2YBTA 3AIWA 1VFOA 2FE0A 1KWGA 1RD6A 1UWSA 4PMUA 3WNMA 1PEZA 1ZBWA 4NF7A 2DDXA 4L4PA 3BVTA 2VZVA 5JBDA 3GBEA 1BHGA 4MNMA 1OCQA 4AZGA 1HT6A 1HTYA 4AD2A 3IAQA 5A8QA 4H04A 4E8DA 3CZEA 1CLXA 1RPKA 2J25A 1XRVA 3A47A 3CHFA 5E6ZA 3UG3A 4JKMA 4GKLA 4J3WA 1ISZA 3I3EA 2VRKA 4PMNA 3VGFA 5D9OA 1B3XA 3EDFA 1EXPA 7TAAA 3MUZ1 1UQYA 3WL0A 5C8BB 5EMYA 4CCCA 2EPOA 1R33A 3LX9A 3BMVA 1QI5A 2CETA 5CJ5A 3ZJ7A 4HOXA 1OBAA 4ZENA 1L0PA 1VFMA 2O9PA 3GXPA 3ARXA 1EIBA 1G5AA 4D6CA 3BUPA 3ARQA 4DM1A 3RM4A 3W53A 2CBVA 4FNQA 4M80A 1E55A 1W9VA 2DT1A 1XSJA 5LA2A 2XIBA 2VR4A 3WFLA 3CHDA 1I1WA 2FDMA 1CLVA 2CIPA 4V2XA 4H7VA 3ARTA 3WQ5A 1QX1A 4GXPA 5HBFA 4IISA 1EDGA 1B1YA 1LG2A 1CZ1A 4DUWA 2PF0A 4OOUA 2GJXB 3WMSA 1CYGA 1OGBA 3K4DA 3AOFA 1K9EA 1XC6A 1E15A 4N0RA 3HG3A 5GNZA 4ML4A 3VD7A 3DYOA 3UEQA 3PZUA 1ECEA 5A2BA 1UD3A 1UWUA 2A3CA 2WKGA 3SCNA 1V3HA 1A47A 1TG7A 3CH9A 2VZUA 1KCKA 1JXKA 2DPEA 4UQDA 3WUFA 3GYCA 4DO6A 2J47A 4W88A 3MUAA 3VU2A 1XYFA 4PRWA 4ZEPA 1E3XA 1S46A 3W0KA 3WNLA 4AD3A 5A95A 2YL8A 1EH9A 5A2CA 1V3KA 2WVVA 4U2ZA 1B3ZA 1UZ1A 1QVBA 1CXIA 3QHMA 1NOFA 2G3NA 4AZHA 5LA1A 3VIIA 3AHYA 2G3MA 1JZ6A 1ISXA 2WLZA 4TX8A 3AMGA 4FLSA 3N18A 4HZ7A 2OYMA 4JL1A 3W4RA 4V27A 1KCLA 5HDRA 3WF0A 3U5YA 1CWYA 5A69A 1TQUA 1QBAA 3WNPA 5I23A 3ZT6A 4RL3A 2D1ZA 2V5CA 1V6VA 2XN1A 1TVNA 4GZEA 2VUYA 3WKZA 1MW1A 1V0LA 1KQZA 4ZFMA 2YL5A 3A23A 2V38A 3CLWA 2A3AA 1B3VA 2GK1B 2WC7A 5M5DA 5A8PA 5ABFB 3A4XA 2VO5A 4M1RA 2W67A 2F1AA 3OGRA 3MKKA 4UQ9A 8A3HA 1PX4A 3VIOA 1C8YA 1CPUA 1WO2A 5A6SA 3PZVA 2ZUUA 1ZU8A 4GINA 3OLIA 4UOZA 3KLKA 3EMCA 4R5EA 5FL1A 5A6BA 2YL6A 1XCXA 3ARWA 2ZE0A 3UCQA 4BQ3A 3AZSA 2A3HA 1TQVA 3AS3A 1HXKA 1NWRA 1TQSA 3AXHA 3CZLA 3AIUA 5A6JA 3LPFA 2ZUNA 1ODUA 1FHLA 1UWQA 1XH2A 3VX0A 4NZJA 3F5KA 4PMYA 1GQJA 4LGXA 3WQ8A 3GXDA 2FYVA 3OLDA 4J3SA 3PZOA 2YKKA 4HOZA 4HA3A 5CPSA 1E43A 2WSPA 3WBAA 3L4XA 1K9TA 4H41A 1GJUA 4J27A 3W26A 1MYRA 2XGBA 1CIUA 3BAIA 1E6XM 1VFFA 4ZXLA 1UD5A 4AD0A 2J7EA 2VR5A 2HVMA 3A22A 3IJ8A 4NXKA 4WLCA 4H8HA 3HMCA 2VCBA 2X2JA 1X1NA 1UR2A 3WH9A 1D3CA 2PWHA 1ITXA 4DWSA 2XGIA 3CMJA 4F9JA 4UR9A 3IANA 1XSIA 3WEMA 3VINA 9CGTA 3CO4A 4DM2A 1B2YA 1E0XA 1W1PA 2WHJA 1QNQA 4GO9A 1H1NA 2ZUMA 3ZT7A 5LA0A 1MQRA 2HISA 4EANA 4EAMA 4PTMA 2CNCA 5FL0A 1XH0A 1HL9A 3PTMA 2G3IA 1J0KA 2VX5A 5EFDA 2XM2A 3SCPA 4HP5A 1G0CA 4AISA 4D71A 2RGMA 4JCLA 3VIGA 2NSXA 1V3LA 1G01A 1R7AA 1UKOA 3ZSTA 3WUGA 5CLTA 1DTUA 1DHKA 3WNOA 2WMIB 1UOKA 2OYLA 3ZO9A 1MWOA 3W6LA 4D6JA 1LG1A 1CENA 3VTRA 2GJXA 1ZBCA 4IPNB 4GO8A 3BAYA 1US3A 4D6HA 2D3NA 1OT1A 1KGWA 4X0NA 2DQXA 3TA9A 4TVCA 3WDQA 3VOCA 1GOIA 4AIEA 1ESWA 4AD1A 3HG5A 2PC8A 3K8MA 3D50A 3AMDA 1GJWA 1HJXA 4PYSA 1BFNA 1Q6CA 4AW7A 2CCRA 2QLYA 4FMVA 3CUJA 3H55A 3II1A 1FA2A 2FGLA 1E6QM 3TP4A 3B9DA 3MU7A 2GSJA 2XN2A 4P8XA 5A6LA 3K4AA 2YBUA 5IFTA 1C8QA 3HG2A 1JNEA 2UY2A 5D8ZA 2ZXAA 2YOCA 3GXIA 1GOQA 2DT0A 3AQUA 3ARRA 1ISWA 2JEPA 4A3HA 1PPIA 4JFSA 2CBIA 4F66A 4UOJA 1R86A 1Z32X 1E71M 1JYXA 3EBVA 3UESA 3PZMA 3ZQ9A 3WY1A 3CUHA 5DF0A 1W3HA 1PIGA 4N42A 1DP0A 1ZBKA 3MV01 2YFOA 1R87A 1RP9A 1XGZA 3FHQA 2F8QA 4CD4A 4KMQA 5D9NA 2F61A 1J10A 1BVNP 4WKFA 2F7RA 4E4PA 1KBKA 1LL6A 3D3AA 2FHFA 3VDCA 1VBRA 1UKPA 3EDDA 3LXBA 2J7BA 4LXFA 3N13A 3TONA 2X2IA 3M07A 4B3KA 2DGAA 2CKRA 3THDA 3A5VA 2WAGA 5FKYA 1RP8A 2YA1A 2EPLX 2ZUTA 4MB5A 3NYDA 3O6AA 4JKKA 1GOMA 5CGMA 4CD7A 4V28A 3EMZA 1HJUA 1V3JA 1JD7A 3CUGA 2D20A 5D9PA 2MANA 3L4VA 1BVZA 3AS2A 1UH3A 5HPOA 4AMCA 1QW8A 1QNRA 3MO4A 5M03A 1KXTA 2OYKA 2ZOXA 1CXEA 2A3BA 3LXCA 1WB0A 4HPHA 2ZXBA 2VRQA 2DIJA 4AZIA 1XYZA 3GDBA 3VGBA 1V6XA 4NSBA 4QLLA 1M03A 5CZKA 3OBAA 3BUIA 1SYTA 3KWXA 4W7UA 4D6DA 1JAKA 1WZKA 4W7WA 4HMEA 1OINA 1MW3A 4F79A 3WD0A 3BVWA 4MNLA 1M7XA 2CESA 1SMAA 3WNNA 4W84A 2XYLA 3ZOAA 3GH7A 4LQ1A 3ZIZA 3WENA 1E4MM 2J8FA 2WHLA 2D2OA 3J7HA 3VIKA 1QW9A 2D0FA 3SUUA 4S3KA 4HA4A 5F7UA 1FH8A 2WVTA 2W92A 1GVIA 5GQBA 1UD6A 2QPSA 4GI8A 3U7BA 1J18A 1JI2A 3TTYA 4Q7NA 3KLLA 4PTXA 4AC1X 1EOMA 3QOMA 4IUGA 3WDPP 1UR0A 5IFPA 1W1TA 1OIMA 3NSMA 3KL0A 1JYVA 1JF6A 2EPMX 3MMDA 2DH3A 1V03A 3UR8A 1TQWA 2F1BA 3U5UA 5DFAA 5IDIA 4HU8A 3GH5A 2XJ7A 1LF1A 1ZB5A 2J7FA 2C0HA 1LLOA 5D4YA 4KH2A 4TOQA 3I3BA 1QWUA 3CHEA 1ZBVA 2CYGA 3RM8A 3DX2A 1LL7A 4W85A 2F18A 3BAWA 2VJXA 3BUBA 1KR0A 2J7GA 2WZHA 4MDPA 4WJXA 3S2CA 2J79A 5DMYA 4U3AA 1QWNA 2ZWYA 5GNXA 1GOOA 8CGTA 3W25A 1E72M 2E40A 2NT1A 4AMXA 1UZ4A 2YLLA 4E8CA 3T0DA 4M8UA 3T0AA 4HA1A 2OSWA 1H0IA 2YLAA 2XIIA 1MQPA 1DWIM 4GPNA 1UR9A 4HZ6A 1XV8A 3T09A 4UQBA 1C7TA 1PAMA 3RPMA 3SCSA 5CG0A 1KGXA 3QHNA 1UASA 4W5ZA 3LRMA 2JE8A 2WHMA 2VQTA 2EACA 1GW1A 3F5JA 3D4ZA 2YDQA 2V3GA 3B9AA 3AZRA 1EDQA 3ZJ6A 4KRUA 2J7CA 1CXLA 3LRLA 1BTCA 1H5VA 4W8AA 2WWCA 2X0HA 1HJQA 2Y2WA 1W91A 1XSKA 1JZ2A 2PWEA 3BAXA 5C71A 3DYPA 1QOXA 1WNOA 1FOBA 2E9MA 3AJ7A 1QI4A 3NIYA 1AQMA 3W81A 5E6YA 3G6MA 7A3HA 3F4VA 1EQPA 4CU8A 5BRPA 2VQUA 5ABGA 4AZ5A 3VSVA 2OW6A 1F4AA 3U7VA 1M04A 5I78A 3VKKA 3VSTA 4QLKA 1OGSA 2ALWA 1OB0A 5BRQA 3OG2A 4NZFA 3O2LA 3KE0A 5DO8A 3AMKA 3TOPA 1E0WA 2BV9A 4J3VA 5CXPA 1V3MA 3EDJA 2QV4A 3L2MA 4OZOA 3WMBA 3EDEA 1TA3B 4X0VA 4MPKA 3BLBA 3WUEA 1J12A 2WLYA 1CTNA 3ZSSA 1AMYA 3TTSA 3IJ7A 1A3HA 1M53A 2PBGA 2XVPA 4CU7A 1LWJA 3LPPA 2UY3A 1W3JA 2CBJA 1VEOA 1VF8A 3EYPA 1R47A 3SCOA 1DWGM 2GFTA 2WW5A 3FAXA 5EFFA 1K9DA 3W82A 4MJ2A 1MFVA 3FAWA 4IPLA 1HXJA 4UQCA 1FFRA 2W61A 3WUBA 1FP9A 4JFVA 3AHZA 4K68A 2BY3A 3AICA 1JZ7A 4OIFA 2E9LA 3FY1A 1UKSA 4XZBA 4R27A 1G9HA 1ZJBA 1DWJM 5M3WA 1WZLA 3H53A 2J8GA 3MUIA 1KFWA 2EQDA 3CPUA 1DWHM 4L4OA 4GZIA 4OKDA 1VJZA 3SCQA 1KQYA 2WZIA 2VX6A 3FW6A 1CGUA 1GOKA 4DO4A 1HJWA 3D52A 3CC1A 1UWIA 2V3DA 3M6DA 4PSPA 5HOSA 4XX6A 2VX7A 1R85A 2J78A 1EDTA 3BSHA 3W29A 1ZJAA 2ZIDA 3CZSA 5AC5A 1CGVA 2D73A 1E3ZA 1V02E 1XD0A 4CD5A 2O9OA 2E0PA 2WMIA 5I2UA 1QBBA 3AHTA 2OWCA 4RE4A 1KXVA 4S3JA 3AMCA 3SCRA 2BS9A 3PN8A 4AD5A 3A4AA 1HNYA 3BSGA 1BSIA 1NH6A 2DEPA 4JHZA 4CCDA 3A21A 1FFQA 3BMWA 5BCAA 3BCDA 1PJ9A 2GUYA 4Z2JA 1C91A 2DSVA 4PUDA 4AYSA 2JIWA 3KL3A 4MJ4A 1MW0A 2DIEA 2X2HA 2FH6A 3VIJA 1EOKA 3VM5A 3POCA 3AIBA 1J0HA 4YN5A 3WY2A 1BQCA 3NCOA 3WEOA 3GXMA 5BXPA 4MNKA 1I1XA 3VUPA 3VNYA 2FGZA 1TZ7A 2VL4A 5E09A 2XVGA 4FLOA 3AXXA 5CQ1A 3EJRA 1CXKA 4BCEA 3N1AA 2ZXDA 2QF8A 1QNPA 3BAKA 3EJQA 5CSYA 2IXVA 1F4HA 5AYIA 1GNXA 3OGVA 2XM1A 3S5ZA 2F2HA 2OSYA 3T08A 1MXDA 1M01A 3A24A 2OW7A 1EHNA 1GVYA 1E4LA 1HVQA 4WSKA 2ZUWA 4D1IA 3QOKA 1H09A 4PMDA 2J7HA 3W38A 3VGEA 1JDCA 2WKLA 4M29A 5AYBA 1R7OA 2YJQA 2BY1A 3VD5A 4FNPA 4NRRA 4MTVA 1G1YA 4FF5A 2OSXA 5I6SA 4XUYA 2W66A 1I75A 2YA0A 3DX0A 2WK2A 1FP8A 4MNJA 4UTFA 3BAJA 1N82A 3OGSA 3L4YA 1J0IA 2JF6A 4F9DA 4TTGA 4Z2HA 1DWFM 1RH9A 5E0FA 1WP6A 1WDSA 3L4ZA 4U33A 3N11A 5HPCA 1V0KA 4UQAA 3WDHA 4BQ2A 3VM7A 2QMKA 3WD3A 2G4FA 1HX0A 4HOWA 1BPLB 3M46A 2NT0A 3AROA 2FHCA 4JFTA 1HJVA 1HKJA 2BVTA 4A4AA 3OZPA 4UOQA 2VOTA 1TFVA 2JALA 4GZJA 2W5FA 1NWTA 5FD0A 2F7QA 5A6AA 4CVUA 1UUQA 3QR3A 1PZ2A 2GJRA 5D9MA 3H54A 3WY3A 1ISYA 1E1FA 2JF7A 3TTQA 3ALFA 5TD4A 4J28A 4DO5A 1B90A 3EJSA 1WKYA 1E40A 4PSRA 3MSGA 4DUXA 1VEMA 3K8LA 5A8MA 1C3FA 1PIFA 2GK1A 1B0IA 4FNRA 2XPKA 3UG4A 1UKTA 4P7QA 1VB9A 5A1AA 2CBUA 2CHNA 1WAWA 3CTTA 3CGTA 2J75A 4JKLA 3BGAA 4PMXA 1Y7VA 3M7SA 3MMUA 3WDRA 2ZUSA 4H8UA 4UNIA 3ARVA 4P8UA 5A8NA 1CGXA 1JYWA 3BVVA 2UY4A 1XH1A 1JFHA 2O9RA 1JL8A 2TAAA 2F7PA 5CPTA 6TAAA 3S6TA 1JFXA 2VRJA 4QAWA 3WH5A 2W63A 2BFGA 1UD2A 1DWAM 4UFKA 1OD8A 3WIJA 1HP4A 3CZGA 1X6NA 3I3DA 4CN6A 3B9EA 3LXAA 5JIWA 1HL8A 1FHDA 1B3YA 1E56A 2PI6A 2XVKA 3KZSA 2Z1KA 2VTFA 2E8ZA 1J0YA 2D24A 4CGTA 1TE1A 3L4UA 4P7NA 1R34A 2YDSA 1VJSA 1OM0A 3VGDA 3VPLA 5E0CA 2VVNA 4FNUA 3LRKA 1BYDA 1C93A 1W9PA 2WMKA 4YHGA 1WZAA 2GJPA 1UH4A 2D0HA 5BROA 4AD4A 4AZCA 4PTVA 4AMWA 1W32A 2F7OA 5HNNA 5CSUA 1GCYA 2DH2A 1E6SM 3W6MA 2BXZA 3CZKA 4HZ8A 2V3FA 3G6LA 4GI9A 3VD3A 4OOZA 1V0NA 1JNDA 2PBOA 2YA2A 2CXGA 2WYSA 1JF5A 3B8SA 1ITCA 1BG9A 1IT0A 3WELA 1QNSA 2XG9A 1E6RA 1TR1A 1QHZA 3VNZA 1XD1A 3RJXA 4EKJA 4W86A 1NWSA 4KWUA 2ZX8A 1O7AA 5EBAA 4D6GA 1Q4NX 2BHUA 3OZOA 4LYPA 4Y7EA 1WDQA 4KRTA 1UHVA 3RILA 4NRSA 4FK9A 2UY5A 4ZE4A 5CLWA 2VT0A 1FH9A 4WIWA 2EEXA 3ARZA 3PZNA 2CERA 3T0BA 3HZ3A 3WN6A 3PBGA 3GZAA 1YQ2A 4WSJA 1X6LA 2E4TA 3WQ4A 4B15A 1GHRA 3FHAA 2WCGA 2J4GA 3AIVA 2GDVA 1SR0A 1U2YA 3VDHA 1BGGA 4GI6A 1VENA 4QCEA 3AXIA 3PZTA 1EO7A 4A3YA 4WKAA 5E70A 3IGUA 3MS8A 1W2PA 2VCAA 4ZE5A 2Y5EA 1KXQA 5BXRA 1EA9C 2ZUVA 2EPNA 1LL4A 1UR8A 4KGLA 4HU0A 3ZM8A 1JYNA 1MXGA 3MSDA 4AIUA 3SURA 2BXYA 3AIRA 4URIA 2WNWA 1CBGA 2E3ZA 3AMLA 2WPGA 3QGVA 1W3KA 4BQ5A 1E0VA 3FNDA 4J3XA 1YHTA 3LMYA 4E2OA 3VIMA 4B3LA 1EQCA 3PZQA 2X05A 3CMGA 1W9BM 1W9DM 4PMVA 3VO0A 2G41A 4UFMA 1H41A 1XHGA 3RCNA 4ACZB 4EE9A 3U57A 1JZ4A 3N17A 4ATDA 5D8WA 4TVDA 1TMQA 4UCFA 3AIEA 1VBUA 3OB8A 1J0JA 4AY1A 1JZ8A 3BCFA 3WDJA 5KZ6A 1CNVA 5I5RA 5I0DA 1NP2A 4P7OA 4JAWA 3VD4A 2WMFA 1PS3A 3CV5A 4W7VA 4H2CA 4OBSA 2Y4SA 1MVYA 1E70M 2VI0A 4C7FA 3AS0A 1NWUA 1TQTA 3CUIA 2XSAA 1BG4A 3ZJKA 4NX0A 2VC9A 3WF1A 2VCCA 2PWFA 1W1YA 4Z2LA 2C7FA 4WK9A 4QFUA 2WZEA 3FN9A 1KR1A 2X8RA 1H49A 4MB3A 4HPGA 5BXSA 5I24A 1E6NA 3WH8A 2RGLA 3NDZA 3VD9A 3RMEA 1WPCA 3HG4A 4P7LA 1BLIA 1C92A 4AZ6A 1FH7A 3VDAA 4UFHA 1ZS2A 5A94A 1BYBA 2PWDA 3E1F1 4W8LA 2XFYA 2CHOA 4HMDA 4QP0A 4GQRA 1K6AA 5BXTA 2WB5A 3WH6A 1C7SA 3PTQA 3WD2A 4CCEA 4P7RA 1P6WA
chains in the Genus database with same CATH superfamily
1Q0XL 1U91A 3NFPA 3S1WA 2A0LD 1T1ZB 4GT7A 4ZQOA 1AZ1A 2R14A 2DWXA 7CGTA 4AZCB 2BS8A 3S0CA 1NWPA 5GRUL 4YDVB 2FYMA 3KYMB 3UX9B 4ZB0A 3GFZA 2L8AA 1JDDA 1UYQA 2Y61A 2CZDA 4EXQA 2NQLA 4Y5VA 3P4MB 2CK0L 2J1WA 4R7WA 4QTIL 5FO8A 2DIAA 3WIFB 1H61A 3MSYA 2BNQA 2KC0A 4G8IA 4GP4B 5KSBF 1NGPL 1C9DA 1WDRA 4NDMA 1ZHBB 2OX5B 4PB0H 5DZVA 4V1XA 1IM9D 4IEFA 4OUOA 3S3JA 3T3ME 2N1TE 3WQVA 1L7IL 2D3LA 2VL5B 1UH2A 4Q6IB 1CGYA 5CEXA 3UPRB 3BXWA 4PTWA 3KLSA 3W27A 1MFEH 3BLKA 1K4GA 1AL7A 3PDGA 5C3TA 4DGVH 2WSRA 4LCIL 5EF0A 4GYKA 2DS4A 2YGQA 3OZ9H 4ODVH 2O9TA 3HVNA 4E0CA 4Z23A 3LQAH 1MNZA 5K9DA 2IPFA 3HPLB 3NGFA 3PZIA 1WSST 2YKLL 2J55A 3L7EB 1KCRH 1RJRA 5JIPA 1CFVL 1MRCL 4AL8C 4BQ4A 2BASA 1OSEA 1AO7E 2D0GA 3NYZA 3RZCB 4M61A 3S35H 2PDJA 2B15A 4Q32A 3EADA 3N04A 1OGAE 2FX9L 4DBDA 3LNDA 1RBLA 1TSRA 4L6OA 4OB5L 3NWRA 4TO8A 3RNQA 1GPWA 5KN5A 2R9RA 1NEPA 4X6DA 5KSUA 4IIFA 2AMXA 1J1XH 1IGYB 4FXKB 4W89A 2BVDA 3TEVA 1QR1A 3WLQA 3W2UA 5H6HA 2HRWA 4Y4FC 3DNKA 3K2UL 4EPDC 1DVSA 4UQEA 4IGSA 5J57B 32C2B 1I53A 2E59A 1JTTA 4XNXH 4JGNA 2F2KA 4FZ8H 1TKKA 3WBWA 2P5EA 3ABZA 3VI3E 4JIIX 4C6DA 4XO6A 2A77H 2YXFA 1JD9A 4CU6A 1YAIA 3ZHNA 5IKCB 2VFIA 4HZMA 2ZQKA 2NZ9D 1LLAA 1IKFL 2AL2B 3HG1B 2ADGA 2FUQA 5D93C 2P5EB 1A6AA 1OARH 3GRWL 1ADOA 1ZAIA 2H90A 4M24A 5AY7A 2W0FA 3WY4A 4HNVA 5LBVA 2BSED 1C8XA 3GNDA 3F2LA 5IRPA 2AQNA 4KVPA 4QNPE 1YCSA 4PIBA 2F53B 2ZXGA 4CN4A 5IJVA 2R2EA 3I2CL 4GUPA 1T6BX 4LZKA 3SDDD 3UAEA 4C56A 4WF7A 2GWGA 4FZ8L 3BQ6A 4KCUA 2NY1C 3A4EA 4K9EH 2XACC 3HMWH 2X4PA 1GIGL 4KAQH 4R96B 4U7SA 5D7LA 5AYQA 5CCHE 1UT2A 3HAEB 2XN9D 3P84A 2NY7L 5HDQH 3BW2A 2HT4D 1J1XL 2GGGA 4KITB 3WXWH 2QJNA 5E7FA 3RY6A 3PP3H 3WLBA 1QSZA 1WUNT 1JK9B 4WZ9A 4LCWE 4F57H 3R0MA 1KTNA 4W87A 4JO4L 3DMMC 2WZMA 5HP5A 1KYUA 1EGJA 3DUUB 1NFBA 4I0PB 4L7ZA 2ZP9A 4WWPA 5D1ZI 2DQFB 2A9MH 4U1LA 4U5IA 5CGBA 2CMRH 3W56A 1QFOA 2YBGA 4UT9A 3W7RA 4J3TA 2W4XA 2WLLA 4GJJA 4WEEA 3G0XA 4G8EA 4LMQE 2AJ3B 3ZJAA 1IEIA 2GUBA 1FO0L 2QJMA 1KPUA 2Z31A 4UBDC 3E96A 4U5KA 5AALA 4NQSB 3GMOB 3X13A 3ULVL 4ICMA 5U7SA 1UMLA 1TJ0A 4WGWB 1IL1B 5AVTB 3C6CA 3WD4A 4L1TA 1CI1A 2G30A 4KRPB 2CJTA 4KKQA 1PZ5B 3E3QC 4TNWK 1FHVA 3B5TA 3Q8FA 1OFEA 1B2WL 1QI3A 3ZL4H 2E7LA 4WI4A 3IDXH 1D9KD 2AXJA 2E7MA 3DX9B 3CQ0A 5DURD 3S9IA 4PN2A 3L5XL 3AHVA 4PMZA 1A1OB 1JRHL 3TLLA 2ARJQ 4NUQA 1ORQA 3EZ8A 4QKTA 4D6EA 1NOAA 3IU4L 4OCWH 4A66A 3C8NA 5LAXB 3M86A 4JRYD 1GHSA 2AGJH 1BYCA 3P30H 4AV0A 4AEEA 5TDOB 2I24N 2CCVA 5C7XL 1EZWA 4NHCL 1E6PA 4V1DD 3BKYH 2ZXQA 4H8VA 3H56A 1CC3A 1USQA 2BLFA 4L8SA 4XBGA 3TBVA 3ZE0B 3ULSB 1S1RA 2DRUA 1U83A 4XUGA 1SBSL 4I6VA 1ZVNA 3B0PA 3BPNC 2HN7B 3R1ZA 2X6BA 3MO1B 4I89A 1E6OH 1IXNA 4PVLA 4AC7C 3V9EA 1FG2B 1IFRA 3V3WA 4H0LC 1JF1B 2NX5E 5IFAH 2I60H 3T55A 1CB4A 3BZFA 1RZFH 1N5YL 3XISA 3C4UA 4LRSA 3IFPA 4TLSA 4WNJA 5C70A 1VZIA 4PJFE 4YDMA 1Y0EA 2FNBA 2JEQA 1U93B 2B5IB 4IGMA 1IC1A 4O1BA 3AIQA 3ECUA 1UWYA 5GRVK 3SYOA 3CBWA 1QSEA 1S5HB 2E9JA 4MB4A 4A2FA 2XFRA 4MJMA 1BXXA 4YDJA 3N6HA 4LMQI 3WF3A 4HEMA 3RPTA 1SFLA 2NQHA 2DUZA 3QC6X 5AC6A 5D2NE 1E28A 3UH8A 5DEZA 4G5ZH 3LNHA 4BF7A 2DIBA 4PJ9A 3V10A 4PY8I 4PMJA 1MCDA 2DJ4A 4U1SA 2QDVA 1HYSC 2FJGB 5EOCJ 3SPCA 1TQXA 1XIFA 2G3JA 4NM4L 4IMLA 4GAGL 3JWOL 5M95B 2B39A 4E5XG 4GP8B 1WA2X 3GB7B 2ZX6A 2W9DL 5FM8A 1V3IA 5B1KA 9PCYA 1MWAL 5D7KD 1VRXA 2V17H 3MV7A 1UUNA 3V0FA 1MFCH 2B0SL 2ZUQB 1RULL 1Q1PA 1YMHA 3GMLB 4QKXB 43C9B 3T8VA 3X1BA 2YL9A 3SCVA 3IJYB 3VXQB 5DANA 2C9AA 2WIMA 2OZTA 5MKGB 3MUAA 3IRPX 3OKEB 3ZKMD 5KZCD 1POJA 1WXYA 4HV8B 1I7ZB 3LVEA 4K94H 2GGIA 3W7QA 1FE8L 1CIDA 5HMSA 2XKNB 3QJQB 1D5BA 2IF7A 2H0EA 2ZOWA 3HAEH 3O4LB 3AWGA 3OJDA 4BK5A 1I3GL 4EZLA 1ACXA 2FZ3B 2W5PA 3MRGA 4U1NA 4UDUA 3U36B 5FECA 3V4VB 4AIBA 3V8OA 2GJJA 2IWKA 4TSCH 3NCFB 1WBYB 4Z2KA 1M9SA 1TLMA 3SDYH 3M0IA 2GQ8A 3P93A 2ZA1A 1SZGA 4JX4A 2VX4A 4ACYA 3FO0H 3DURA 1C08A 1CYXA 1NKOA 3P3SA 4B50A 1X98A 2R1KA 5K1NA 4Y9MA 5AYTA 5HGAB 2EILB 5FCSH 1FHGA 1L6XA 2JBMA 4TIMA 1KBLA 1NMCC 2JF1A 4LARL 2DSUA 2OZ0A 5AYXA 2NQDA 4N9OB 2Q6WB 2FWSA 4GUIA 1ZV9A 2WLKA 1TVBA 4GJTB 3RWFB 5LQBL 3ARBC 1YEDB 2ZSVA 3DGGA 4O9HL 3VFTB 4QG9A 4UTBL 1JQVA 4GNJA 4RX0A 1Q6DA 5IVZA 5B39B 1DBTA 3WL1A 2AMGA 5CSZB 1CLZL 1G7UA 1RULH 5ABEA 5F1IA 5HHPB 3MV7E 3L9CA 2ISVA 1YEKL 3GC4A 4M0XA 4ZBJA 3UWVA 1OG0A 2ZAGA 5D6DC 1O7DC 2G2RB 1D5IL 3PY9A 4LLDB 3G1VA 4F1SA 3HM7A 5I77A 2WP3T 1MUJB 1WAPA 3HURA 5C8JB 2X1IA 1G1OA 4HZAA 3APFA 1DJIA 3LHAA 5H2BA 3UJ2A 1X5AA 4GYFA 3QVQA 2ZCGA 4K5PA 2X4OB 4RE0A 2JCCF 1AQDA 4PRHA 3RLVA 3RRXA 2DQJH 4P4KB 3MUIA 3NN8B 2RDTA 4CKQA 2FEJA 4GQQA 1C9SA 4WEBH 2DW6A 3WMCA 2YEVB 3O2VH 2B1HL 1C90A 3DYMA 3HU7A 5ABFA 2HWZH 3V6OC 5MI0C 1DQWA 4XKMA 5E2WL 1ZSXA 3ZYZA 2O6FA 1IZJA 2OOGA 3MGTB 4NQ1A 3ECQA 1TVPA 2ILLA 1YEKH 3CMOH 3IYLW 3UTZB 2BFVL 3GJEA 3GQYA 3HPXA 3T2PA 2W07A 3IMVA 3MLYL 4HJSA 1KIUB 4JFWA 3SYCA 4CVWA 3U0TB 3WTTA 4ONFH 1AVAA 1JTPA 4ZSOA 3VXTB 2QEZA 3H12A 5GGQL 2HVOA 3DXAA 1RIHH 5B1AB 1FDYA 1KFCA 1UR3M 4J5VA 2Z1SA 3AGVA 3K4WA 4MTMA 1NAMH 1KB9J 2FL5B 3O3EB 3H7BB 4DK5A 1R3YA 4RE3A 3ZRCC 1NFIA 5EU6B 4TX6A 3COOA 2IFGA 3GPSA 4RGOH 4PLNC 3T8MA 4BFOA 2FO1A 1R2RA 3E9AA 5ITBH 3S3PA 1WYJA 3EOBA 4ZDHB 1NQ6A 3GBLA 1MNUH 3L3OA 4PS3A 1XR8A 3S37L 3T81A 1A7NL 1SFSA 3BFQG 4J2PA 4RE2A 2E9BA 3NEXA 3STCA 5IXEA 1EWHA 1P7QA 3BN9D 4QO1B 1T2QH 4H5SB 4F8NA 5EEWA 4X8GA 1TENA 2QAFA 4XB8A 1F05A 5CZTA 5CAKA 2EVFA 3RTLA 2PNDA 2OSLA 1CDYA 4JZOA 1T03H 1D2KA 5JHDB 4HH9A 2CDGB 3SKJL 2JK2A 3WAJA 2V2TB 4P8WA 1SDDB 3RR4A 1X9UA 5BW7A 2EE9A 1UG6A 3BGGA 1KTBA 1BXNA 1IMHC 5MEPB 3WHE0 4L0YA 1B30A 2FQDA 4KKAC 4AWJC 2VFHA 3M5ZA 1U8JB 4K55A 1DVFC 3ULUL 4JFEA 4P57A 4JFHD 1C8VA 1BWWA 2D2GA 4TKWA 3MB9A 4XKYA 4FZIA 3EJUA 3JWDL 5TGBA 1PS9A 2UX6A 4E2BA 5BV7B 4ENED 3BPNB 1QABA 5BO1L 4BA0A 2FMNA 4HKXA 5FF4A 5LXGL 3B06A 5TJWK 3F01A 3IV8A 1X5GA 4ODWA 2NW0A 2WGNB 2AQSA 1QG3A 4MXVF 1YHPA 4YPJA 1OOWA 4QCFA 1ZUAX 3BP7A 1VKFA 5I1LB 2J73A 4V11A 2UZYA 5CPNA 3CFJB 3O9WA 3UGRA 4P46B 3TKFA 3NRPA 4W4OA 3S4SB 4OM1H 3DBSA 1I9CB 2YAHA 4QTFA 3GIPA 5I3DA 5GNYA 2WNKA 1HN1A 4XXDB 5CMAA 5B7FA 1SHWA 2BOCB 2KPNA 2WXKA 2ZP0T 5IBUB 4BINA 5HXMA 1B31A 4N5UA 3V5HA 2GDQA 3PDOA 5LBSH 3I7SA 3LHWA 1NQBA 4MYPA 2HX8A 2HLAB 4NRYA 1VIZA 2ZTKA 3UC0H 2J8TA 2FATH 4W9TA 4OF7A 1T2XA 1OOAA 1LO2L 5EOCL 5ICZB 1C5CH 4FERA 5AAWC 1B6UA 2F6UA 1DO5A 4X80H 1IGIH 3TSMA 4UFIA 1T5WB 4GRWH 2G4GA 3BC9A 4X6FA 1A5AA 4X9YA 2AV7A 4TLTA 2P52A 2JQAA 3WBEA 3ZWTA 2WZPA 2H6UA 3HJ0A 3L1OH 1VH7A 3DC0A 4EIZC 3VMOA 1G7VA 2YPVH 3BIAX 2B7DT 3HS0A 1QRNE 3PAVA 4K8RH 4LLWA 1SVDA 4OV4A 1V08A 2YZ1A 4O19A 3T0TA 2VMJA 3MV9E 4L48A 3BJSA 3NJKA 4NPYB 2JV6A 2JKTM 1PCWA 2M2DA 4UZUA 1KYDA 2QUVA 2B3IA 4UQ2A 3GH4A 1YC7A 1N70A 4YDIH 2PB1A 4GQ9L 1R46A 3UBGA 2WN3A 3KEHA 4WTZG 1X7IA 3EWZA 3D08A 5KS9E 1AO7D 2IAMC 1JVKA 4OKVA 2MHAA 4Y4FA 3M4HA 1NEZA 2AAAA 4LLVB 3YPIA 3QZPA 3HFMH 3GY1A 2DYPB 4X9SA 4G80B 3SO7A 4E41B 2WC4A 3QT2A 2BOLA 4N2FA 5D93B 3ULVE 3OB0H 1HL4A 3GZPA 1J9YA 2VWEE 3CHQA 5EU6A 3Q4DA 1ZT7B 3TPUA 2PW2A 2XXFA 5ACZA 4ERAA 4X6BB 1XLLA 5DQJA 3AREA 4PGEA 4X6EB 5J1TC 1FO0A 3IIXA 4U6YB 2C1OA 1W31A 2YXOA 4UBPC 1QLEH 1V8HA 2EC9T 2B31A 2YZRA 3DERA 3ZTEA 3GIYA 3VX1A 5GJSH 5I3KA 2WQ8A 1CS6A 1MI5A 4IMAA 5KYUA 2VKWA 4NNXB 5E4IA 2CU9A 4NT6A 3RPIB 4YSEA 1ITQA 3GK0A 4JY5H 3PHOA 3C2AH 3L7EA 5C07D 4WU5B 2VVSA 2YOAA 3TW9A 3BLOA 1H15B 1VYPX 3QORB 1JPFB 4BFIA 3C3NA 3UFYA 3VG0H 1HKKA 3RZCC 5FKAA 3E80A 5GGRY 3FO0L 5T3ZD 4CQ9A 2RMNA 1RERA 3W9EB 3F64A 2FEEI 5IEKB 1B3WA 4KZEH 1I6NA 1OARL 3CL6A 2X10A 4KFZC 2G2RA 3D4YA 1X9LA 3KPSE 3BKJL 2AK4D 1CG9B 4Q0XH 3P3YA 3L3HA 3K5SA 1AFSA 5DY2A 2R39A 1WFMA 1UWFA 1W9XA 3CN1A 1FPTL 3GC3A 3OR7A 1HF6A 1UCWA 3TEZA 3VCRA 4HNUA 1PDKA 2GK0B 1P5BA 3I85A 4RSVA 3SZKC 4FG6C 5GJTH 3SECA 1JCNA 4C6MA 1S78C 4OFYD 3VWKA 1L6WA 3EFFB 2UXVA 3PJSA 4GKNB 3PY2A 4GY0A 4YBLB 1KWKA 3P81A 4MY9A 3T8QA 1KIPB 5EEVA 1MSSA 4WI0B 1KEMH 1XCTA 4CNPA 4NJ9L 3CPRA 2NUPA 3OLEA 5E23A 1P0DA 3BIBX 3HQPA 4QDWA 3P61A 4PJAB 5GPRA 4MD4B 1JWUB 3QZ6A 1ADDA 1EYEA 4CD6A 1JIBA 1L6ZA 4FABL 3BW9B 3KL5A 5I1EH 1XGDA 2VZ1A 1NINA 2ZX5A 3QJHA 4ZOEA 4J35A 1Z3GH 3MU3A 1FVDA 2JB5L 2WXIA 1TQJA 5EOQH 3VMPA 3UXIA 3QV7A 2DAVA 2BSRA 3WJMA 1U33A 2FIKB 4DUVA 2UZIH 2MPAL 3KHJA 1UCBH 2BVYA 3FJ6A 1XYAA 1Q6GA 8FABB 2AQWA 3OP2A 1UURA 1I1YA 4LSTH 1A6ZB 1I3RA 2IFFH 1GSMA 3JTSB 2X41A 2V5SA 4JPKH 4L8SC 2BW4A 5E6IA 5FWQA 5TDNB 3VGGA 5JMOC 3GC2A 3HS8A 4U2YA 1NSJA 3ARGD 3UYRL 5SWSA 3AQYA 2EG7A 2Z7GA 4HNTA 2XWEA 3LKPA 3RWEB 3QEQA 3TN3A 5DT5A 3RDTB 4KKZA 5J13C 3CNYA 1LL1A 1VR6A 1ZWIB 2K7PA 4GABA 1S7XA 1QFEA 2WQAA 3ABGA 4JFFD 4M1CC 3THCA 4OLUH 2DT3A 2DLFL 2YR3A 3PGFH 5EN3A 4Y9PA 3HMXL 3S48A 4AX3A 3BUVA 4PVNA 2AGJL 4X50A 5AOLA 4OCRL 5T5NG 4TULL 5JHDA 4LHJB 3GNOA 4D8AA 4PULA 4EOUA 5ISZA 1BTMA 1XBVA 3RWHB 2NV2A 4FNTA 2OSLB 1PZSA 1SNRA 4HSCX 4GIAA 3ZO0A 5MEND 1IQWL 1HAWA 3WK1A 4XPTH 1KBBA 2QULA 3KRZA 4NFCA 4R7DA 5C09E 4D72A 5E9DB 3WFZA 4FGMA 4PY8J 2OMVB 5DMIH 5EOQL 5CHNB 3G8RA 3OAUH 4U0RB 2CJUL 4ZQRA 1ZS8B 3P74A 4KEVA 5KSAD 4KXBA 3TNOA 2PUZA 4YZFE 4OQTH 4R4FL 1RUSA 2IVFC 3B40A 2QPDB 1JCTA 2HLEB 3D2TA 3KOZA 2Z93B 4MX7B 5FI8A 1AQFA 1L9TA 3KEDA 1CR9L 3U4BL 4YHLH 2A4CA 4H88H 1MLCA 5CWSB 5AG9A 2Z6IA 3MANA 2CIKB 4BZ1L 4CD8A 4K9EC 1FCBA 3LLXA 3E49A 1R3SA 4G3YH 1PKQB 1UJ3C 5AW0B 1TFHA 3GJEB 1WE5A 1T0OA 1SW3A 3DBPA 4IMGA 1AXTL 5C2XA 4C57C 3UPWA 2X0YA 3V2AR 1UD4A 5LQBH 3AAZA 1GJIA 2F53E 3HS9A 5JO5A 3RU8H 1GTFA 2OWXA 4XISA 1BMZA 3OAUL 4JFPA 1A5SA 4ZW6A 1QLRB 1RZKH 3HRZC 4ISVA 4JFUA 3W70A 2PETA 4FQ2H 1TTUA 3N9KA 3GBDA 4BK5C 4Z1YA 3W0WA 4AUUA 1KBGH 5JBFA 2R29H 1JNLH 1FZMB 4FDWA 3WKYA 1IGJA 3WJMB 2CU0A 3T2NL 2MNWA 3WI9A 1JZGA 3IV3A 3SY0B 2ABAA 1ZXQA 4WTWA 2I5GA 4PCPA 3QUML 3W88A 1UWTA 3HMWL 5AL0A 3DHUA 3D7PA 3D51A 4KBPA 4Z7WB 3E2VA 3N42B 3UT0A 1RJYB 1JG9A 1JS4A 3GSOB 3E3HA 4S3FA 2QCDA 3BJ91 5LXVA 5M1TA 4XCCH 1VFOA 1T20B 2FE0A 3ARBA 3O45B 1RD6A 5AZEH 5IB5B 4ABUA 4KWVA 4G8EB 4NYYA 1P9MC 3CSBA 4OCLC 3WNMA 4FQLL 3MLYH 4NIKB 4AYFB 5J6SA 2DDXA 2J9XA 1RK0A 3MBDA 4G1KA 3O6YX 5IB2A 3INUH 1P5UC 2XTJD 1KYAA 2FBJL 1HT6A 1IBGH 1HTYA 5JIDA 4YTQA 4L3EE 4PRIB 5I8OL 1A6WL 1JK8B 3IAQA 3H26A 2J1ZA 1G7PB 4KK8C 3CZEA 4E8DA 3U2JA 1RPKA 3TFBA 3MZ2A 4AQEA 5D33A 1QD0A 5B3NA 3LOTA 2XKNA 3HGRA 2Z1PA 1OK0A 1AQ8A 1A7OH 4XCYA 4OV5A 1UZ8A 3V6OA 3OKEA 5L6YH 4GKLA 4IU2A 3CHSA 3PXJA 4L8DA 5C09B 4FP1A 3RY5A 1ISZA 2HRHA 1NC4D 3I3EA 1ADSA 4C60A 3NCJL 2I07B 2QV2A 3RNKA 2QUTA 2SODB 2ADGB 1FKWA 1NIUA 1YTEA 4Y8AA 2NY2B 3EO0A 2HS6A 2CALA 5C0JA 4MYXA 1B3XA 3CFBB 3UVIA 5LGJB 3REQB 3ESNA 1FG9C 5EORH 2IKGA 4RZBA 5KINA 2H41A 4DAGH 1UQYA 4YEEA 2OAAA 3S5LA 1XX9C 4ETQB 3G04A 1NPUA 4L2YA 3F1QA 2XIQA 1WZ1H 5DD3H 5DLLA 5C3IA 1QI5A 1U2HA 4O8RA 3LNIA 4WW1B 2CETA 1UM5H 4QQ3A 4UCGA 2QR0B 4RGND 2FUTA 4HOXA 3LHUA 4J3OH 4WY0A 4MMXB 4EF8A 8XIAA 1UCBL 3TVMD 1ZVYA 1AO7A 2CLVB 3C5SB 2O9PA 4FIRA 3OPZL 4FFYH 2A73A 5BUAA 4MLIA 1L2UA 2PTVA 2DQCL 1XUUA 3V7MA 3L3JB 3DVIA 5F71A 4C59B 3WD5L 2XPZA 3SRFA 1Z5YD 4MA7H 2QQKH 1XR9A 4LSSH 2QVFB 3I2CH 5BW7C 1YQVL 2EDOA 2W81C 4FNQA 1BGXH 4XWUA 3MSPA 3EXRA 1AL8A 3AVEA 3SJVA 1THCA 3PHSA 4NZTL 3LKOA 3ZMEA 4X3ZA 1R9ZA 5F1UA 1I1WA 5CC6A 1KLFB 1DVFA 1WZ1L 3E2HB 2V5TA 1FG2A 4HS8L 4MQSB 2XVBA 1TO4A 4DKEL 4I5BB 4UUJB 3IRSA 1IEBB 4H7VA 2G5BB 5DEJA 3ARTA 4FOUA 3WQ5A 1QX1A 2YYUA 4AX7A 1J8SA 3CFQA 1F3JA 4PGBB 2OPCA 2WLIB 1KCSL 3BWAA 4HSQA 4XGZB 5KSVB 1LG2A 2XRAH 4I5XA 3I9AA 3WIIL 1ZLDA 2KUTA 1CZ1A 5DRIA 1QRNB 2OTUA 3T04D 3L3IB 1FO0H 5ILTH 1R3VA 3CEUA 4OOUA 3OX8B 3WMSA 4HJTA 1B0WA 4IEFB 5B22A 1R38A 3K4DA 1U5VA 3FO1A 3EB3A 4IHBA 1OHQA 1BVKA 4ODBD 3CIXA 3HG3A 3WSQL 4XN4A 1XW8A 3QFEA 4A29A 3O9WC 2WSYA 4HGWA 1P7KB 4W4OC 4XMKH 3RCMA 4DEWA 1YDPB 1ICQA 5AC4A 2PDGA 3UEQA 3PZUA 3IXAB 1MCPH 4O54A 4AEHL 2XXGA 4AYDC 3VFLA 2W9EL 3K7UA 3WUWB 1NMAH 2HLAA 4NRYB 3CVIL 3SCNA 4G6KL 2SEBA 3SDCB 3U0PB 1V3HA 4YXLH 2QQKL 4XZHA 4HGWB 4YNGA 1D9KB 2W59A 4NUJA 4FEMA 2YMXH 1ZENA 1YXYA 2V5KA 1IBGL 4LUTA 3L5JA 1FJ1B 3L1EA 2VDNH 5BJTA 3GRWH 1ZTMA 5I8EA 5AAWA 1J4EA 1PZ0A 3MKCA 4M5TA 3L5AA 3UP8A 5AB1A 4DKDC 3GYCA 2J47A 3GVVA 2YARA 2GG1A 3GSNA 2CLFA 4ZEPA 2P28B 5E94B 3LA4A 2V7HB 1QO3A 4IPJA 2NRDA 2J66A 1SO6A 1RHHA 2HXAA 5LBGA 1OGPA 4BDVA 1R2TA 3OVGA 4OIIH 1N8FA 2H9GB 1V5JA 3ZW3A 4AWSA 3HS0C 3KR3L 1CXIA 1JNHB 2BNRA 2CLZA 3WFEH 1P0BA 3QHMA 4C6JA 1QACA 1A53A 3BH8B 1LRTA 1DVFD 4EUPH 4YQXL 1NCGA 2EUWA 3DI2B 3MCLH 5I03A 4Q6JA 4W9DC 3TXAA 5BRZD 4NKDA 5IVXB 1JZ6A 2CWXA 4TX8A 1QFWM 1FYTA 5DZOA 5T33H 5GGSA 1UC4A 2VYRE 5BOOA 1TELA 4BE6A 3PAOA 3PRZA 2VDQB 3ROOB 4Q3MA 2E75C 3LRHA 3EG9B 3LV6A 5DRZB 5F9JA 2IAMA 1Q0XH 2XOTA 3N2TA 4JIPA 4O0KA 5C6PB 4OFKA 3EZJB 2P4AB 1YEFH 2APWA 3GRGA 3JV6B 1UBSA 1W0WB 3L65A 1ADQH 2DLHA 2Y3NA 3MBXH 1MQ8A 4JZOB 1QBAA 3CBJB 3APYA 2MEJB 3PBVA 3PB0A 5K9QI 2RJGA 1ZALA 2O6CA 3HG1A 3TCLB 2J72A 4E9VA 1IGFL 1K1DA 2D1ZA 3NQEA 4RL3A 2BIQA 3MLWL 1AQKL 3NFSH 5IM7A 3KXFA 3A5FA 4KO6A 2BJML 4HCRA 5JQ6H 1OAYL 2X40A 2YUXA 5EU3B 5KMYA 2WW8A 5D32A 1ZHNA 1X5LA 4JX6A 5LHFA 4P07A 1TVNA 3AREC 2AABL 1HKVA 3W7NA 4A7UA 3WLNA 2IPUK 3F12A 1E30A 2VUYA 2OZ4A 4CNIA 2DU2A 3WKZA 4E5TA 1MW1A 1DQJA 3IWUA 4UU9B 4YR6B 4UOW1 1XWVA 2OJEA 1A4JB 4UMBA 5DD6B 2P7TB 3HZKB 1LO0L 2XQYK 2YSSA 3Q0HA 1IQ8A 4MZYA 4JM2B 4JN7A 2VLKA 3TSDA 2YL5A 3A23A 4EAYA 1NBVL 2WXLA 4Y7MA 4XNBA 3VFMA 1FWEC 3H9HA 3NJFA 3K5RA 1YN6A 5JPMB 3MNWB 3OA3A 2X6UA 5KZCB 1OB1B 2A3AA 2Z26A 2X87A 5JHDE 4TQPA 1YECL 4MMYB 1DIEA 5GRVL 1KBVA 3G6JB 2WSQA 3SIKA 2WUCH 3RZCA 1TU2B 1KJ2H 3CDGA 5A8PA 4JLRB 4N0CC 5KUKA 2ODIA 4K15A 5K9JH 3G5EA 4RBPH 2W67A 1GKRA 2B08A 1KIQA 4KTDH 3BICA 4CNOA 3IPWA 8RUCA 1S5VA 3QYNA 5K9QG 1M9WA 4AYFA 4JIHA 3NIGF 3MYJA 4TV3A 2AQ2A 3G1YA 4BI5A 4WFFD 1GJPA 4S1QL 2DF3A 4PS4H 1E8ZA 1KCVL 3X3GH 1GTNA 2GYSA 3OHXA 3DO7B 4Q6YA 3VWKC 2QCDB 4O12A 5A6SA 3NJJA 3E0WA 3NQCA 3QLLA 4HYVA 3OJVC 4K3GA 5F96L 1CLOH 1NMCB 4N3TA 5F6HJ 3PTDA 1LOSA 3FU5A 1DO6A 3KLKA 4N24A 4OLXL 3EMCA 4O1EA 4H7CA 3NK3A 1HILA 1TDQA 4XCEB 2C4XA 5AOJA 1O6SA 4LSPH 2DORA 2H3BA 3ARWA 3U4BH 2QQQA 2FZMA 4KV5F 1IC0A 3BYYA 2YPKB 4P4KD 5HBBA 1HUVA 2OR9H 2RCSH 1ID2A 2CO7A 3IKKA 2FEDC 1F90H 3GHEL 2H0PA 4CADB 3WLTA 1TQVA 1B9BA 5CSGA 2DQJL 4PJBF 4CC4C 4P5TC 4PJGB 2FPVA 5F2FA 4WEUD 1C08B 1N0XH 3QUYD 2OCZA 3GUWA 1GOGA 3O2VL 3TN0D 5FW7A 3B6SA 4EBQH 2VXSH 1TQSA 4FXJA 5FJIA 3AXHA 5ETUA 3UF9A 5J6HA 1M1XB 1MAKA 1DE6A 2O4MA 3AIUA 4LTSA 3PL6C 5AB0A 3ALXA 2WYTA 5IV2B 5KYWA 4ZMYA 1MRQA 2ZUNA 3VD2A 2F5BL 5E6IC 1WICA 5T33L 3V0JA 1FHLA 3GS4A 1XBYA 4MAYC 1TCDA 1YXDA 3FQUB 4R2GB 3G1SA 2OI9C 2UY6A 4LPXA 5BZWA 2LLGA 3MRIA 3RAJL 2V2XB 3WTSA 1PG7X 3L9RB 3NMEA 1CCZA 4PS4L 2ZSWA 4ZUUA 1DBKL 3EH4B 1WC7B 4KI5F 4ZZFA 1Q6LA 4J3SA 2AEIT 2P7TA 3AGWA 2ZZ2A 2C26A 4WO4D 3G6DH 3GLAA 3PUCA 4WWKA 2DTML 1DQJB 1EHLL 3O0LA 4PJIA 5IG7A 2H2SD 4BGLA 1PF3A 4LRNH 1G6RL 1X5JA 3HNSH 1PB0A 4GW4A 1PFOA 2GJ6B 4GQ0A 5HK4A 3MBWA 1BIIB 2FIQA 2RFGA 4IXXA 4IOTA 4DHGA 1NDYA 2B1OA 4IMLB 4J27A 4D8OA 2LTQB 2R1YB 3ML9A 3W26A 3S1VA 5D7JB 4O02A 4F37K 3DFTA 1U8HA 3IFOB 4HLZH 2MQCA 2Q2EB 4Q9CA 3WQPA 1UD5A 4P9HH 3M5YA 3LTYA 2XFGB 4TVPL 1MSPA 1Q1JL 4DXKA 3A22A 4WLCA 4UTAH 4DTGL 5DD5H 2VCBA 4AX6A 1IGMH 3F7QA 1A4KA 4RMQA 4ANUA 2PP1A 1FUNA 4F3FA 5JHDD 2IJ0C 1KG0A 1UVQB 3S47A 1D3CA 2PWHA 2Y5TB 3Q8AA 2VIRA 4F8OA 4MUZA 2A6DB 4ACPA 4YDKL 1S2VA 1XSIA 4X4YB 2ALAA 4AZ8B 4EIVA 1FA4A 1HXYB 1YUHB 1UJ3A 3BZDA 3C09B 3HHSB 4G6AD 4W68A 4W9FC 5F7FA 5TDNA 3CO4A 4DM2A 5HNTA 1NEUA 4OZGA 5E5RB 3RDTC 1I9RH 5HATA 5SWSD 4WU7B 4PMFA 3NG5A 1T5XB 2X38A 1IO4C 1OG6A 3NDZE 3GTFA 1VD6A 4GSXA 1ZHLA 4TVPH 1QNQA 4A6YB 4GS7B 2DI8A 4MHHI 4ZA0A 3SQRA 3HRZA 2X4SA 5T3ZE 4XBGB 2Y23A 5HDOA 2E1WA 5GJMA 3J2PA 4CVXA 1HG3A 1TV5A 5L7XH 3HI1B 1XCQB 3UZZA 4UDTB 4NYLA 1SUXA 4LNVA 5HHQA 2CNCA 5FL0A 2AGTA 5BMWA 3D5OF 1HL9A 5I17B 3PTMA 4O10A 1H5BB 3FNKA 1AJ7L 3LHPH 1D9KA 4NUJB 4JM4L 4IMDA 1J0KA 4ZTEA 2VX5A 5A6IA 4NNCA 4MAYD 4DP7X 5G1YA 4D71A 6REQB 4XX1E 2RGMA 4L64A 3SADA 1XQLA 1XRFA 4FFYL 3VIGA 2MQGA 2NSXA 3SGEH 4XIAA 2YQBA 1G01A 1UKOA 1DHKA 4R3SA 3IVTA 1PDKB 1T2QL 2GK0A 1P9MA 2WMIB 3NIFF 1HHKB 4WDUA 3L4CA 4YHKH 3EYFA 1N12A 1CENA 4P5TD 3ZMNA 2O93L 3ENLA 4LCUB 1AIFA 1CJYA 1UEYA 5E6SB 5IMLA 1IEHA 2GJXA 1A0EA 2PMQA 4ES4A 4IPNB 1QRNA 1UXSA 4LVNB 4F7EA 3LTPA 1FWNA 2KYIA 1NC2D 1P5UA 5EFIB 5C0AA 4G8FA 2Z00A 4PGBA 3PAZA 1X3DA 2L0DA 2GCYB 4F0SA 3WTXA 1HJBC 3CVHH 4QS6A 3TA9A 4FIQA 1NJ9B 4IRSC 3U2EA 4YSSA 4AD1A 3NZSA 3HG5A 1A3RH 3BG5A 2GTWA 2NY1B 4NT6B 3RPIA 2PC8A 1OTUD 4QRFA 3NA8A 1HJXA 5E2WH 1T04B 4DZBA 1UWGH 4YVNA 5EO1B 4AW7A 4C56D 3T78A 1AE6H 1MCEA 4S11A 1A9BB 1SHSA 2BP0B 1ZAJA 4YS1A 1YN6B 5EU7E 5TTRA 4AEHH 4H9UA 2R2BA 4DWHA 2P8MA 1NGQL 4U6YA 2OMYA 3TP4A 1SXCA 4AC4A 4GUOA 1H1ZA 3PJWA 4F40A 3GDCA 5KSWA 1AG6A 5DK0B 4LC6A 1XKYA 3ZE0E 5DD6A 4AT6A 2BVOB 1B4EA 35C8L 5JYLA 1EUTA 4AMKH 1XF2A 2HVBA 4A6YL 2P3ZA 4LVDA 3SFKA 4PRPB 3GXIA 4NAEA 1GOQA 2VGIA 1P5VA 2DT0A 3TROA 1RU9L 3LRGA 3IBEA 3QFDA 2QQLL 5ADOL 5DSCB 3E02A 2O7QA 5CGQA 2JEPA 1KCSH 1PPIA 2G2NA 3OG6B 2HT3C 3WE1A 4KEZA 3QQXA 4QJ4B 2GT9A 2VXVL 4M6ML 1KY7A 3BRDA 3KXQA 1RUQH 1R86A 2V5JA 5AZ1A 3CUPA 5EIIG 5EOCH 1NGPH 5JZ7C 3QHFL 1FF5A 3E0VA 4S2BA 3VQ1C 5AECA 1T03L 1MY5A 3FONB 3PZMA 4HS3B 2IAMB 1KB5A 3WY1A 4NQEE 4M93C 4POZC 4DAFA 1OXYA 3SPJA 4HHMA 4FF9A 2F08A 4JG0L 1TIMA 4JX5A 4L5FH 4F2TA 1DP0A 2XV3A 5SWZB 4ADTA 1Q9KB 2CO6B 2JTDA 1KJMB 2UWEF 3C2AL 3CHXA 5HDLA 4BIKA 3PAJA 2PCXA 1RU9H 4NQCD 1HFUA 2EIBA 4BSJA 3CV1A 3OPSA 5G2HA 3B0VC 2WBJD 2AMUA 2YCEA 1ILSA 1OP3K 3QPYA 2DDQH 4KMQA 4IJ3B 5D9NA 3U7AA 3FTXA 3QQWA 4PBWD 4DEPC 1UZHA 2F61A 2JJUA 5D1QC 2EEBA 2F7RA 4XC3H 4EWJA 4Q6IC 1L3WA 5SX4H 2P42B 2X7WA 1A4CA 2EDLA 1VBRA 4O13A 3TV3H 4HHAA 4O2FA 4OUUA 2YCLB 3LXBA 1OF6A 2V5MA 3EWXA 4NRXA 4ADUA 4B3KA 3U9IA 1IEQA 5B3JF 2DGAA 5JQ6L 1E1CA 2UUDH 1UUOA 1UXSB 4F7EB 4D0BA 4DP2X 3UWYA 4KKLD 4N9GA 1KW1A 1PXGA 3ZYIA 5FSDC 1RHFA 4MCZB 4ZFGL 5HR7A 3QJFB 1FJ1A 2GEEA 1DUZB 4TPRL 3F7VA 2EE3A 5TE7L 5FKYA 1SF5A 2LFEA 1ES0A 4NO2B 3RFAA 3BT2H 5F7DA 4MB5A 4JKKA 2J71A 2OMUA 3CVBA 2ZUTA 2OT1A 2FD6H 5L9DH 3NYDA 4YQXH 2ON3A 3GG0A 4V28A 3GMQB 3C2FA 5GS0D 1ITUA 1HJUA 1V3JA 5T1KB 1ECQA 4NILA 2QADD 2QAPA 3B03A 3MKVA 3FTZA 4I7UA 3FOKA 1H8SA 1KTLB 2J5LB 4GSRA 3DX6A 4HMNA 3NTCL 3AS2A 5DURB 1HGWA 5IFJB 1QW8A 4ANWA 1XLGA 3HOJA 2XTJE 2Z64C 2NX9A 5CFHA 3MO4A 2JK5A 2OYKA 5M03A 1NIBA 5JO5B 2XH7A 3EX3A 3LXCA 3LZ5A 3BUYA 4I13B 5ESVA 4P57B 4HPHA 2OTUB 2ZXBA 4WUIA 5F6HI 2VRQA 1WS7A 3R10A 3DUSA 1XYZA 4PV9A 1F3JB 4XGZA 1M03A 2GSIB 3RVVC 4GLEA 3DETD 3OBAA 1FLRH 3BUIA 1NJJA 1LP9E 2FT6A 2HWZL 3EGXB 4X0KA 1ZTVA 2AQOA 3TBYA 3P60A 2R9HD 1KTKE 2NQ9A 2VDNL 1XYBA 1LEGA 3B5HA 1Q8AA 3KDNA 3F3HA 5CKSA 3W2NA 5CJOH 4KXAA 1WZKA 12E8L 5LBSA 1MPAH 3I84A 4IYKA 2FVKA 1F4XL 2OGJA 2FD6L 3QV6A 3LQZA 4F79A 3MNVB 2OZ4H 5H91A 4IIBA 4MNLA 3W9DB 1EZVX 1T1WB 1SMAA 2HKHH 1FYHB 3LNEA 1J5OL 4GLRI 1QCWA 4F48A 4F1ZA 3L45A 3UZQA 1VPYA 1BOYA 1NFIB 4J3BA 4WW1A 5CGYC 4G42A 4H3DA 1LOLA 3UR2A 3MOBH 1YAZA 3AT8A 3LD8C 4KXCA 3REWA 1YN7B 2XU2A 3B9KD 3N4AA 4YDKH 3QQ1A 5D96B 3DWTA 2J8FA 3G3MA 1C5DB 2IKHA 4Q9RH 4AUBA 1VGKA 3NH7H 4TSAH 4Y8DC 5F7AA 5I6MA 4LQFH 3VIKA 5TE6H 4DYJA 5IHUH 4KKBC 1K7FA 2Z2BA 3N06B 1RV6X 4S3KA 2NXHA 43CAA 2ZCZA 1FH8A 1IEAB 3QDHA 4JN1L 2W92A 3O8XB 1KCVH 3KPOA 5CJXC 3V6ZB 2PDXA 1T83C 3H23A 5C0CD 3TWCL 3OMAB 4IRZH 4M6NH 4W4QA 4KHXH 2Y7LA 2ZUYA 1W72H 4MAYB 5GQBA 3CLMA 4RVBA 1NCHA 3NZ1A 4R85A 3SPIA 4TV5A 4U1KA 3NN8A 5HI4C 4ZZKA 1BIHA 1GH7A 1Z2KA 1XL4A 5IY5B 1FXPA 4WDTA 2G4EA 3CLFL 3D85A 3EJYC 4JHAH 1S39A 3EZ4A 4R90H 3LM3A 1E65A 4XAKD 1TPFA 1F6LL 4NHUB 4JHWL 1TREA 3TNMA 3SRHA 3KLLA 2M83A 3ZX1A 4PJDF 2OZ4L 1EC7A 3QOMA 1NBZB 1QEWB 2APSA 5J1AB 5HPMB 3GUFA 1OIMA 1UP2A 2EO1A 3A67H 4PJIF 1JCXA 1Z9SA 4B5TA 3NQAA 5EB9A 5EU5A 2GYIA 4HKJA 1JF6A 2G3XA 3TAKA 1V03A 4H0HB 1TQWA 1N5YH 5CIPH 4DYEA 3EOTL 4FMFA 4GFXA 4MD4A 3RWCA 5JW3H 5EEYA 4BQCA 3MJYA 4BH7A 4HU8A 4UTTA 1FH5H 2XJ7A 3PGDA 5DRXA 1GGOA 3DRQA 3OHXC 1TV2A 1BJ1H 3S9YA 2HT2D 2IKIA 4TOQA 1AXSB 1QWUA 1KIPA 2Q76A 2CO7B 3DVFA 3C0JA 3SIZA 3V1PA 1AY1L 3VDGA 5TE6L 1X5HA 3WS3A 1V4YA 3QNYB 2VEFA 4O2CA 3T3MB 1CT8A 5IW6A 4C6KA 3V9FA 3H8AA 2ZKHH 1T20A 3O45A 1MEXL 5IB5A 2WBJA 1BXAA 4XAYA 3LKRB 1HNFA 2FR4B 4FXLA 2YPLE 1YRRA 5AZ2L 2BGNE 2DJLA 2F18A 3O0RH 5CO1A 5I6KA 4PJHE 3BUBA 4CC4A 4H1LB 4P5TA 3PP4H 1KR0A 1MAML 2F58H 1UUMA 3K4ZA 4PFEA 4RLDA 2WZHA 2NPLX 6XIMA 4MFHA 4OLEA 1HZYA 2FBJH 3HC0B 2X3AA 4U3AA 5FKAB 1NC4B 4PWJA 2FX8L 3TF4A 1XS2A 2ZWYA 3FO2A 3PL6A 3BPOB 1ERNA 4F8TA 2INEA 1KJ2A 3W0WB 3WKPA 4OTKA 4DN1A 4RGMC 1LDCA 4WOQA 4XC1L 2HQAA 3VH8B 4MAYA 1FWSA 3W25A 1LDSA 1OQXA 1RUMH 4JLRA 2AJUH 1WWBX 4Y19D 1E72M 1U22A 2E40A 2NT1A 2OEKA 5CC7A 4BELD 4DQOL 2YSWA 3UACA 3T0DA 1PVHA 3G6JA 1PZ1A 1WAAF 1E4WH 2E5EA 3GB7A 3LYEA 3OBEA 3W1NA 1WKDA 4D9RD 4ZO9A 4MJIA 3RB7A 3QCUH 4ELMA 4WWKC 3UZWA 1VA9A 2CE6A 2Y6SD 1DWIM 4FLHA 2VC2B 3GI9L 4NO0D 1F3RB 2Q9OA 1XC4A 1ZJHA 3C60D 3UJJH 5EMJA 3T4AC 3M43A 5AOZA 4IU3A 3T09A 1U36A 1I2QA 3W5NA 4CEXC 1AGDB 3FRPB 3SCSA 1LYXA 1M56B 1MJ8L 3ES6B 1F3DH 3FU9A 4PI2A 1ONWA 2BVPA 3LSOB 1KCWA 2F7FA 4GUGA 1RMFL 4W5ZA 4H44C 3TOYA 2Y7QB 2JE8A 2A85A 3LKNA 3E5PA 3ATAA 4FNLL 1Z5HA 2OMWA 5CN2A 3TIEB 5C0EA 1N6QL 1HGYA 1SFTA 2YDQA 1OTSD 3UYPB 3BZFB 4WY0B 3ARFD 4ONVA 1OZQA 5F4SA 1T8QA 3OR6B 5IUSA 3WZ0E 1N3NB 4DGUA 3VGAB 4BZ1H 3ZJ6A 1MWAH 3EGXA 1QRND 4YHLL 3DGBA 4QPEA 3VI3A 3RUBL 1TX2A 2ZCHL 5GZNA 2X0HA 1HJQA 3H22A 3D2UB 4MZ3A 2W9LA 3RDTA 4FP8H 5DD0L 3I6SA 1TRIA 4XXWA 4L65A 2C9SA 3R89A 2HMCA 4O1FA 4HFWA 4JY6B 2YR1A 1JZ2A 1XLKA 5E00A 5DEGB 4HF5L 1QWGA 3BAXA 3DYPA 5I15H 4U6TA 3B2XA 4O53A 1WNOA 1O6TA 4PJ5B 2Z0UA 3O8XD 3QWQB 4L56A 3Q01A 3FSOA 2PYEE 3OYXA 1KTLA 2AANA 3RRAA 2D2HA 3ZZ1A 1WFJA 2YQ2A 3D3VE 7A3HA 1KT2B 1ND0B 3I75A 3BLFA 5I3IA 4DPBX 4CU8A 4P9HC 4KK6D 3S2MA 3UBFA 3OD3A 2BX5A 4S1DC 4YSDA 5D1XD 1UP0A 2A6IB 1D9KC 4FX5A 3U7VA 3CQIA 3DFPA 5I78A 1K77A 2FO4A 2DBJA 4N8VB 5H37H 1ZV2A 1OGSA 2ALWA 1OB0A 5C0DA 5SWZE 4ESKA 3OG2A 3WLOA 3HAEG 4KHTH 4FTVA 3VFRB 5LJYH 1D8WA 3TOPA 1B4JH 1S3KH 1E0WA 2D8KA 2P80D 2BRRL 5DGRA 4DBEA 1J1OH 3G3LA 3SDXF 3WV0A 2BMKA 4WXZA 1LUCB 2YN5A 3L2MA 4JDEB 5KYYA 3WMBA 1E2VA 3EDEA 1TA3B 2ED9A 4PJCF 4S1DD 5HI5C 3T3MF 4A7GA 4HHAB 4O2FB 3NBNA 3ME0B 1INEH 1W6TA 4MPKA 3WUEA 3QWOA 4TVPE 3OU8A 3QUKB 4L1GA 2OXGB 1QFUL 3N42F 3ZSSA 4HUVB 1OE1A 2WQPA 3AT9A 5BVPL 3CX5J 5HNUA 3DMMD 4OCWL 3FCTA 1KJVB 2CHWA 4JFDE 3EKZA 1Q9WB 1XPYA 7XIMA 1TTJA 1FNFA 3QG6A 4G1EA 1A3HA 2E7BA 1GOHA 4IRSA 1A3QA 2XVPA 3A0OA 4R96A 5CD5C 5IEKA 2AQPA 2E47A 1X44A 1LWJA 2ZJSL 3WLWD 1W3JA 3IU4H 5G4OA 4CDGC 2D2JA 1HAUA 4RETB 4JO8A 3B9KB 1J5IA 1YVLA 4CL7A 2H3XC 2G3FA 1DWGM 4AVKA 4I2XA 1ZKAA 1UWXK 1CE1H 2V37A 1SFJA 2W0PA 3IVUA 3O2WL 4PJEF 4HLEA 2VAJA 2NMSA 1T0MA 2XWXA 4NWTH 5LUMA 4IPLA 3S35L 3CHPA 1K8DA 1SJCA 2W61A 1MRAA 4NQUA 3V4PH 5INCB 2BY3A 3F58L 3CCHA 3LZPA 4P3WA 2LLEA 3K0YA 4PUWA 3VI3F 4UTBA 3AY4A 2E9LA 4XZBA 3ZDWA 4N28A 5EUKA 4E9QA 4EXAA 2HWGA 4PVMA 5F3HA 5DQJB 1G9HA 4QIUA 1DZBA 3K2MC 4P59L 1WZLA 4GVHA 1DBMH 3QDAA 1WISA 5B1BB 2FFIA 5HGDA 1CL7I 1T7VA 3RP1A 1EBGA 3BH9B 4B7LA 4GQBA 1Y1DA 4K5MA 2VHLA 5C6TH 2P8PA 4A55A 4HWBA 1VJZA 4LJ3A 3AWNA 3BEWA 1CFTA 3SCQA 3TJIA 4HBQA 2EH7H 2WZ6A 1KQYA 3RVTC 2WZIA 4IBYA 4AYBA 2VX6A 3MZGB 3C8FA 1GOKA 4GHRA 3VOJA 5T3XL 4L9XA 4Q8QA 3REVB 1ZPUA 1QBMH 3ORJA 4MASA 2H6RA 2Y7GA 4M5PA 3U30C 2VYOA 2ZWNA 2FO8A 3U6XS 3BQUD 5DUML 2TPSA 1N7MH 1XDTT 2FTAA 2ZTBA 4HJ0C 4D9PA 2X30A 3FYEB 3CC1A 1LXMA 4B96A 4K94C 3ZKXB 2BP1A 2Y89A 5ABZA 4PSPA 1YRKA 3BEVB 3BZ5A 2IDFA 5HOSA 4H8WH 2NSMA 5D1XE 5FYJU 4QT5A 4OV5B 1M3UA 4HK5A 1E4KC 2J78A 5K9KB 3L0GA 3KVKA 5D1QA 1G4EA 1XCFA 1ZJAA 4Q6IA 5CEXB 3UPRA 1RZ8B 4LS2A 3IETA 5ERWA 5INDB 2O26U 1A5KC 4LKCA 1RVKA 1VCFA 4XD3A 3FCTB 2FNWA 3D2UD 4TMBA 4CD5A 1ITBB 2WMIA 4OGYH 5G2WA 2VN3A 1OZMA 3ZS4A 2FLMA 5I2UA 2DYRB 1XEUA 1LE5A 3SGDH 3AHTA 3DOSA 3MA7B 4RE4A 4D8ZA 1CT8B 3OVUB 4OM0H 5T91A 3DFQA 4BFKA 3H6OA 2ADJB 3GSVB 3U82B 5L2KE 5KVGE 1CFSB 1KM6A 1MAMH 2F58L 3QHZH 2QKIB 1TETL 2XU9A 4AM0Q 5JIQA 3TESA 3A4AA 4Y1TA 3CC5A 1U91B 3NFPB 4JVUA 4TLKA 4UT6L 2YZ5A 3M0KA 2Q7NA 2C1PB 3A21A 2ZRXA 1HW6A 3H7VA 4DFHA 1G1KA 5C0DB 1C8PA 2QELA 1SN2A 1P6FA 5EF2A 2LAAA 1YPZB 2CIIA 3UXKA 3O2DL 4PJEA 4KFPA 5J12C 5AVNA 4MJHA 2V82A 2UZYB 3VFWB 4IGHA 4NZ4A 2NZLA 4NO0B 4UB0L 1DBAL 1U8PB 4AQ1A 4P2AA 4CVZA 1FRGL 3QQ3A 4R83A 3POCA 3QZLA 3AIBA 3BLEA 4F5CE 3SCUA 4N6EA 3GKFA 4G11A 2F6XA 3NCOA 4OZGB 3QQDA 3VXQA 4HCLA 4R7NB 4OLZL 3UC2A 3T0VA 5KBNC 2A2QT 3MV7B 2J12B 2FGZA 1SYSA 4PRAA 3VNYA 2GGHA 3N9RA 3FUEA 4LF2A 3ZKSD 1TZAA 5DMGD 5DQ9A 3VFGL 4OCXH 3UY7A 4AJ0A 4XXCC 3HZVA 4BA8A 1AW2A 1QVOB 3W39B 3P0GB 4BCEA 1F18A 1FFOB 2BFVH 3N2BA 5CBEA 1D3GA 3KYNB 1EVUA 1CD0A 1MJ8H 3EYQD 5T1LA 1DVZA 4WO0A 2VDOL 3NZHH 3MLSL 4BHUA 1G69A 1G4PA 3L2NA 2PKDA 1ZAHA 3BAKA 1BEUA 2QF8A 4G1NA 3DJRA 3STGA 3WLPA 5AYIA 1W72L 3VRJA 1GNXA 2OO6A 4J8RB 1MCPL 4DLFA 3TIEA 4PGCA 1I1FB 3FUJA 1I1AB 2OSYA 4G56A 1MXDA 3CDYA 4KKAD 2F6KA 1EHNA 1KO0A 1HVQA 3FA5A 3PUGA 1U8KA 1AS8A 1X5FA 2OR8A 4XOAA 5T1MB 2FTPA 2N7BA 4R7DB 1BD0A 1LQAA 3QYMA 3B8UA 2CO1A 1TNMA 3RGVD 4Q8BA 3OC8A 2AABH 3QUZC 1YNKL 1I1FA 4PMDA 1VFBB 4ZX4A 5I26A 3W38A 4DN3L 3B04A 2WKLA 2Y2TA 3TE9A 3ULVH 1EJOH 2CLRB 2Z4GA 4Q4RA 1LO5A 4XC1H 4WCYH 1V51A 3MJ9L 3TBYB 2XTSA 4FNPA 4R97B 4XMUA 4NRRA 5CJXA 1CYWA 4OTXH 2CKBB 5G4HC 2DOCA 1G1YA 1T83A 1S4IA 2QJDA 4KT2A 4XUYA 1Y1UA 2GJ6E 4TNFA 1FP8A 2I5IA 2W07B 4K36A 4OECA 2C3HA 4NM4H 2ZA3A 4XVEA 4PUMA 1SZEA 2O5YL 2X6AA 4K7FB 3QEQB 2DJMA 4HG4K 3BAJA 4APQD 4PA8A 1FDLL 2HSAA 4C1KA 3V4LA 2JF6A 2FAUA 4F9DA 1WEJH 3D30A 1X8FA 4H8NA 3P2VA 3KP0A 3W57A 3MUJA 4JR9L 2XZ7A 3U6XA 5J04A 5E0FA 3NEVA 1AD9A 3B8VA 1OX4B 2AXHA 2EDFA 1OGTB 5HPCA 4U6XA 3OKNA 5E9DE 1QTPA 4A2LA 2PCQA 3DHJA 3KJ4B 3QXVA 3FT3B 4RK8A 4WFHD 3Q9PA 2OMAA 4L9YA 4PJEB 4K7VA 1PZCA 1GKEA 4QRUA 3JS3A 1K3UA 2FHCA 4UTTC 2VDMH 3GRBA 2XI9A 1B0RA 4P5TB 4Q4SA 3ESPA 1HKJA 1OHZA 3BURA 3RA7H 3HQNA 1C16A 4JQ1A 3U3HA 4HJGA 4UOQA 3N0AA 4BZ2A 1RZFL 2G9HA 2V2WB 1Q7QA 2JALA 3QXBA 1QFPA 3DPDA 3ATYA 1IWBA 5B1CA 4GZJA 5FD0A 1IIKA 3HF3A 1NFDA 1MIMH 2VH5H 1LD9B 2BODX 4LBRA 4QI3A 1CDHA 3ZDZE 3NVQA 2WBJC 2IQAA 2ADJA 1P2CB 4DB7A 2FATL 4ZGYA 3WY3A 1N26A 2HMIC 3PWNB 5IOKA 4WOZA 1KKOA 1B4TA 1NC2B 2YD3A 4QJ3B 2GBAA 3B3BA 1XH3A 3G1DA 4WSGA 1NDZA 4OE7A 5DXYA 5FO9A 2A5HA 3K8LA 4I18B 4RV3A 5IUCA 3FN0H 2TSYA 4H1ZA 1TU2A 4ZFGH 4NZ3A 3WQGA 2DPKA 5FA3B 4B0MM 2QGYA 5DUBA 1YUKB 1E4HA 1V5XA 1UENA 2P46B 4FNRA 1BREA 4P2QE 4ROQA 1WTGT 4L4TD 3LN4B 4K3JH 3UG4A 1C9WA 4MFEA 3WK0A 4KY1L 5HYSA 3TNMB 1VB9A 2I25N 1I4FA 2WIIB 3APMA 1IC4L 2R2EB 4C56B 4ZYKA 2XDFA 4TR9A 5G4WA 3QF0A 1LQSR 4MVBD 5BZXA 3CGTA 4CRPA 3LIZL 4DQAA 1S2AA 3BQUC 3MNZA 3M7SA 1P4BL 3MMUA 5FESA 2ZUSA 4UNIA 1WAAA 4BWWA 4FQXC 3JXAA 5D09A 4NKIL 5EBGA 3GGWA 1R0AH 3NABH 2ZE3A 2F74A 2ITEA 2X1XR 3PV6B 2PWVA 4OT7A 1RJCA 1XH1A 4AG4L 2BBFA 3T4WA 3WQFA 3WLRA 1FGVL 2A1WH 2Y85A 1UOWA 2F7PA 4KROC 3ZY7A 5CPTA 3T4AA 4Y96A 2ZOLA 3TYAA 3FT2B 4ML9A 1E90A 1TIUA 4X6EA 4J8QA 3U2CA 1XF5A 2X42A