1AQMA

Alpha-amylase from alteromonas haloplanctis complexed with tris
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystal structures of the psychrophilic alpha-amylase from Alteromonas haloplanctis in its native form and complexed with an inhibitor.
pubmed rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1aqmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1aqmA01
2DH2A 1JF5A 1GUVA 4W88A 1JAKA 3W25A 3TTSA 4V27A 2FGLA 3A3HA 2OLHA 1GOKA 2OWXA 1RH9A 3NSMA 3ZT5A 3WD2A 2Y24A 3TONA 1B9ZA 2EPNA 2J25A 4UZSA 1VBUA 4CD7A 2XGBA 1LJYA 2YL9A 1H41A 3EJUA 1ITCA 3B9EA 9CGTA 2J7CA 1J01A 1W3LA 1MXGA 1OB0A 4YPJA 5A1AA 2IXVA 1UQZA 4EAMA 5BXTA 5IXEA 4J3SA 3FHAA 1EO7A 3CO4A 4XV0A 1ZBWA 4TX6A 1CXLA 1XSJA 4FLSA 3DDFA 1CNVA 4D6GA 4GQRA 5E9AA 3B9AA 4HZ6A 3QHOA 1B3ZA 4FLOA 2B31A 3POHA 4PUDA 4U3AA 2F8QA 2EXOA 4F9DA 1W9VA 1MQRA 3CUFA 1E1FA 4W8BA 2F2HA 3NUKA 5HNNA 3GH7A 1HKKA 1E3ZA 1BG4A 1E6XM 2OWWA 1NWTA 1X6NA 2YA2A 2CERA 4NRRA 1QPKA 1X6LA 1V3JA 1MQQA 3BUPA 1B3WA 2XM1A 2PWDA 1SMDA 2VT0A 2D22A 1E4NA 2ZUUA 7CGTA 3AHZA 5BXSA 3WF3A 4BCEA 1FP9A 1UA7A 1CDGA 2WWCA 1NQ6A 3S5ZA 1WZLA 5CPSA 1VJSA 3UETA 1BYAA 2WNWA 1EOMA 4PRWA 1QX1A 2ZUTA 3WMSA 1MQPA 2CKSA 2X05A 3VGEA 1W9PA 5A2BA 2XPKA 4P8XA 2BVDA 3WFLA 2BHZA 4V28A 3CZKA 4U5KA 3VINA 3WQ4A 3RJXA 3VDBA 1UH2A 1I1WA 1R8LA 3BUIA 3ZOAA 1HKIA 3KL3A 1W9XA 1ITXA 3AOFA 5I77A 4D6HA 2PF0A 3A6OA 1QNPA 3U57A 3WH9A 1VF8A 3DX0A 3MV01 4AZBA 4NX0A 2HISA 1CGYA 5LA2A 4Z2LA 4Z2IA 2EABA 1F4AA 1GVIA 2G3MA 2CIPA 3WY3A 2J7GA 1UR2A 4KGLA 3ARZA 1VFUA 3RCNA 2FH6A 4D6DA 3WUGA 2PWFA 1E1EA 1WKYA 2A3EA 3LPPA 4PMZA 2WVUA 5I79A 4B3KA 3VSVA 1QNOA 2DT0A 3OZPA 4B9YA 3CZ8A 1FP8A 3BUQA 3WH8A 1BPLB 1XD0A 1QHZA 2OSWA 1PJ9A 2D23A 1V3KA 4CD4A 4D1IA 1RP9A 2ZIDA 1FA2A 3WUEA 2WHMA 2CBIA 4P7NA 2XUCA 3BAXA 3KLKA 1CTNA 1V0KA 3SURA 3UR7A 4QCEA 1MWOA 1BAGA 1KB3A 3QHMA 2ZX6A 4PN2A 3A47A 3WL1A 3AZTA 3AIRA 4PMOA 1VBRA 5BXPA 5I2UA 1PX4A 1BHGA 4UQ9A 5AC5A 1R7AA 1TVNA 1E6NA 1UKOA 4JFSA 1UWSA 5A6LA 4XUYA 1TVPA 5BYWA 1HL8A 3LMYA 5A3HA 2GJPA 1DWGM 3IAPA 2ZWYA 3WDJA 5A95A 4MDPA 1BFNA 2EO7A 1HJQA 2C0HA 1GHSA 2VRKA 4MB1A 3WEMA 2BNJA 1OSEA 3AS3A 2JIWA 2G8ZA 4AD0A 1MFVA 3VDAA 4WKHA 1GOIA 3CLWA 3CZLA 1NOWA 3AXIA 3WNOA 1JYWA 5IFTA 2GVYA 3OLDA 4M1RA 2ZXAA 1XRVA 1SR0A 2J79A 4URIA 3WQVA 2ZE0A 1E0WA 5CPQA 1QI2A 1VFOA 1UD4A 2DH3A 3EJSA 1W9DM 2ESCA 2BS9A 4AY1A 1PBGA 3WDQA 3AMCA 4C7FA 3GBEA 1JAEA 2J62A 2EPMX 2X8RA 3VMNA 4QCFA 3ARQA 5A8QA 3W24A 4UOZA 4P8VA 2VUYA 3WD3A 3NDZA 4M8UA 3GXMA 3DHUA 2VVSA 3CH9A 1G94A 2BY2A 4AIEA 4DO6A 3UG3A 4ZE5A 1DWFM 2VI0A 3S2CA 1QI5A 1L8NA 2CETA 3BAWA 3LXCA 2V3EA 3KZSA 4H8VA 4OIFA 1KGUA 4M82A 3HZ3A 1UKQA 3GH5A 3WBEA 3ARXA 1M53A 1E6ZA 1E72M 1CBGA 4CD6A 2ZUMA 4AZ6A 3EJQA 5I78A 1LLOA 3ZSSA 1KR1A 3CZJA 3MUAA 3LXBA 3HG4A 1O7DC 2WHJA 3N1AA 2EACA 5CJ5A 1KCLA 3N15A 1E73M 2FYVA 2DSKA 1C92A 1C8QA 3GDBA 4AZGA 1E55A 1UH3A 1OBAA 4J3UA 1UR8A 3HG3A 1JD7A 3I3EA 2WVSA 4PSRA 1E4LA 4UQBA 2D20A 3WDRA 5DEZA 3CZGA 4DUWA 2Y5EA 2V3GA 2VQUA 4M81A 2YLLA 2BVTA 2TAAA 1NM9A 2ZX7A 4JL1A 3FXYA 4IM4A 5CQ1A 2YLAA 1J0JA 1GQKA 2QF8A 1WNOA 3L4VA 1JDCA 4MB5A 4KRTA 3WNMA 4QLKA 2WVTA 3BCFA 3LRLA 3T2QA 1W3KA 1DWAM 5M3WA 1OGBA 2DQXA 5JIPA 1G01A 1RPKA 5JIWA 3M6DA 4HZ8A 1R87A 1EDQA 3BVXA 4CKQA 2W5FA 3F5KA 1RP8A 4HMDA 1QW9A 4GO9A 1QNQA 4LYPA 4NI3A 4DWSD 1BGAA 3VGBA 4W84A 4D72A 3WH5A 3DX3A 1H2JA 5M03A 2WBKA 3VD9A 4JKKA 4HA1A 1KGWA 4AD2A 3ARUA 1WDPA 1KTCA 4OOZA 3BLPX 4BQ3A 2CHNA 3AIEA 3HG2A 2FHBA 2VZVA 2E9BA 3WDHA 2BY3A 2WMIB 1XC6A 2WVVA 1TQTA 3NSXA 3A21A 4PCTA 4W86A 4JL2A 3OZOA 1Q6EA 3H53A 1KXTA 2DT1A 3PZIA 3KL0A 2V3DA 1MFUA 2XG9A 2CNCA 3OLGA 3MI6A 2WYSA 3UG4A 1CGWA 2WWDA 4Z2JA 3CV5A 1QI3A 2J7FA 4L4OA 2ZX5A 2WC3A 3ARVA 1Q4NX 1HJSA 2QMJA 2ZWZA 2E0PA 1SFSA 3K1DA 1RD6A 2BV9A 5EMYA 3AHVA 4FNTA 2J47A 3F5JA 3U7VA 3BLBA 4AIOA 2X1IA 2VRQA 1W1VA 1LL7A 1EXPA 4AIUA 3OLEA 3VGFA 4ZEPA 1TA3B 3BLKA 3QOMA 2WZHA 2XIIA 1XYFA 2ZXDA 2GDUA 2C8NA 4BQ5A 2OW7A 2WK2A 3D5HA 4LXFA 1NP0A 2XWEA 1B30A 4UTFA 3GXDA 1FOBA 1IZKA 1W3HA 1GOMA 3CUJA 3WKZA 3BVTA 4U2YA 4UQDA 4P7QA 2VCBA 4U31A 2E3ZA 2XIBA 2IGTA 1NH6A 3DDGA 1CXEA 4MJ2A 1UD6A 3L4ZA 3TP4A 1PEZA 1NWSA 4PUEA 3FY1A 1JNDA 5D9NA 3CMJA 3RDKA 3WBAA 3EJRA 5GNZA 2NT0A 4GZIA 2VNCA 3J7HA 1XD1A 3DX1A 1C8YA 1E6QM 1WDQA 4OZOA 3EDFA 1OM0A 4E2OA 3MMWA 1W91A 3DX4A 3TOPA 2YA0A 3AS2A 3T0BA 2XGIA 2WSPA 1CENA 2WLYA 3B9DA 3N17A 1KXQA 3BAKA 2AOSA 3VIPA 2WMFA 2G41A 4D6IA 1IT0A 1T0OA 4AWEA 2A3BA 2PWEA 1U30A 5E09A 4MADA 1W1TA 1G1YA 1V08A 2EPOA 2XSBA 4ZE4A 3OGRA 3BVWA 2FHFA 4JKMA 2A3AA 4PYSA 1UA3A 2Y8KA 3E1F1 4H8UA 1IZJA 5FIPA 3H54A 2J7EA 3AHYA 4A3YA 4AMWA 5GNYA 6CGTA 3VO0A 1LF1A 1QBBA 4P8UA 4PBGA 4MB3A 1DWJM 3VSTA 4PMDA 4HOXA 3SCWA 5IDIA 3CHDA 2WCSA 3L4YA 4GI8A 4OBRA 1UWRA 1JYVA 1JYXA 3SCVA 3T0DA 1AQHA 3WD4A 3VIOA 3ARYA 4TTGA 1BG9A 1ODZA 2DSWA 1HF6A 1UR4A 1KFWA 5IFPA 3AMLA 4B16A 3NYDA 5I0DA 3FHQA 1BQCA 2NW0A 3VIFA 3VGHA 3WF1A 3UEQA 1WPCA 2PBOA 2VO5A 1GOOA 5BROA 4HA4A 1LL6A 2D3NA 1WE5A 1H0GA 4J3TA 1C90A 2YIHA 1H49A 1CGXA 1W2PA 1VFMA 4NXSA 1J12A 1OIFA 1V03A 1AMYA 2UY3A 3BMWA 3TTOA 4ZFMA 4V2XA 1M7XA 1Q6DA 3CZSA 5D4YA 4BA0A 2ZXBA 4H2CA 2WHKA 2XFFA 1KTBA 4LGXA 5GPRA 4JIEA 2G3NA 1E6SM 2QMKA 4KGJA 1CZ1A 3EDKA 2VR4A 1TQWA 1OWQA 2WKGA 1K9FA 2VCAA 4PMXA 1KQYA 1MW3A 4JAWA 4OOUA 4XZWA 5BRPA 1J0HA 1HX0A 1HWWA 3WH7A 5LA0A 3GBDA 2VZTA 4U33A 5A6AA 4K68A 3AI0A 4HMEA 4W85A 2CYGA 3ARWA 1J0IA 1D7FA 3WNLA 3APGA 4FNRA 3OG2A 1P6WA 3M7SA 2F7OA 2XVNA 3W29A 3RM4A 1JZ7A 3LRKA 3WQ8A 1E15A 2OYKA 1C91A 1ZL1A 4TX8A 3WSUA 1W9BM 1WAWA 1HVXA 2XVLA 1V6UA 7TAAA 3AIUA 3ZIZA 1EA9C 3VDHA 2XN1A 1TUXA 3AMDA 3VGDA 3O2LA 5EB8A 3WF2A 2OYMA 1JZ2A 4FMVA 3VNZA 4WKAA 4ZXLA 4FK9A 4ATDA 3EJTA 1US2A 3AHTA 4GINA 3CUIA 2JFEX 4JFVA 4AMCA 2ZUNA 3MANA 3D4YA 2GDVA 2V3FA 4GKLA 3AMGA 3D51A 6A3HA 5HDRA 3PZMA 3WY4A 1E5JA 4NZFA 1TR1A 4Z2HA 1W1YA 3GNRA 3WNNA 3VKKA 3ECQA 5A2AA 2BFGA 5I5RA 2JF6A 2J8FA 3WD1A 4CVWA 1C3FA 1J9YA 4TVCA 1R75A 1GORA 3ZT6A 1CGVA 3PTKA 4F9JA 4AMXA 4B3LA 2GSJA 5CZKA 1VEPA 3SCRA 3GTNA 3WNKA 3WDPP 5CLWA 1H11A 1V3LA 1NWRA 3CIVA 4UOJA 4DM2A 3U7BA 3AMKA 4LYQA 1DWHM 5DT5A 1QWNA 1FHLA 1EH9A 4UFMA 1CPUA 4U5IA 4E8DA 1NOFA 1EOKA 3ARRA 1WO2A 3II1A 1G0CA 3A24A 1TFVA 1PIGA 2DSVA 5A6JA 2FH8A 3IJ7A 4YHEA 4A3HA 1HP5A 1V0NA 4BQ2A 2W67A 3CHCA 4OGZA 3VILA 2VMFA 2VJXA 3ALGA 1GONA 1EQCA 3AHXA 1V3IA 2HVMA 1UUQA 3BGAA 3W4RA 3RM9A 4X0NA 2ZX8A 3PTMA 1CIUA 1BYCA 1W3JA 2O9RA 2FE0A 5E1QA 5A6MA 3N12A 2W92A 4J28A 3WEOA 2WSKA 3VIGA 2QLYA 3OGSA 5AY7A 4IPLA 1E70M 3IANA 2Z1KA 1BTCA 1UASA 3SUSA 4W93A 4FNUA 5E70A 2XVPA 3VIIA 1CECA 1C7SA 3RPMA 3EDEA 2BXYA 2JF7A 3VIMA 1JZ3A 5D9OA 4W87A 4AEFA 3TTYA 1VAHA 3AYRA 2PC8A 2E8YA 3MO4A 2C7FA 3GNOA 4AC1X 1XHGA 2DIEA 3ZR5A 1QHOA 3D52A 5HXMA 1HJWA 1JNEA 1K9TA 4W7WA 5F7UA 4D6FA 1OT2A 3AS0A 4CGTA 4PMRA 1JYNA 3B8SA 3ZT7A 1E40A 3A4AA 1KGXA 4J3VA 2ZOXA 2WAGA 4DUXA 1ZBKA 2ZUVA 1JFHA 2XJ7A 3HU7A 5CSUA 2W66A 5BWFA 4EK7A 2GJRA 3PZNA 2UY4A 4F66A 3QGVA 4XB3A 1VEMA 2DEPA 5FL1A 2EAEA 4OKDA 1J18A 3VIJA 3ZJ6A 5IHSA 2WMIA 3BSGA 1O6IA 3OIHA 2XN2A 1VEOA 3AXHA 1UWUA 4X0VA 2VOTA 1EHAA 2QPSA 4KH2A 4F8XA 3AIQA 3M07A 4LQ1A 1EDTA 2EPKX 1XCWA 2YOCA 1PAMA 1UH4A 2RGMA 1TQSA 2ZUWA 1B3VA 3T08A 2O9PA 1UWQA 1E56A 3IK2A 4MNMA 4PMYA 3RILA 1XV8A 4DUVA 1CWYA 3BXWA 1OT1A 2G3JA 1OCQA 1B3XA 2WMJA 2CBUA 2VX5A 3UR8A 5A8MA 4PTXA 1K9EA 2O92A 3ZM8A 2FDMA 3UCQA 1OIMA 3LX9A 5I23A 4D6JA 3MUIA 1TMQA 3MU7A 3NDYA 2XM2A 1TA3A 3THDA 2WC4A 3ARSA 3TV8A 3SCNA 1Q6GA 4MNJA 3ARTA 3AIBA 1I75A 1A47A 4N42A 2D3LA 1IV8A 4LPCA 1EGZA 2J8GA 4IISA 3SUTA 1DP0A 3WMCA 1TG7A 1UKPA 1QW8A 4EANA 5D9PA 4D71A 1FFQA 4WF7A 2F7RA 1U33A 4TVUA 1V0LA 2GK1B 2CXGA 4CD5A 2CEQA 2AMGA 1S46A 2YDRA 1KQZA 1BF2A 4GPNA 3CPUA 2YJQA 4DO5A 1J11A 3DYMA 1AQMA 5FKYA 3W28A 1LG1A 4PTVA 2XVGA 3CHEA 4HU0A 2WC7A 1UD5A 3KWXA 3N9KA 1WDRA 1QNRA 3TTQA 2EPLX 1VJZA 1JF6A 1X1NA 2VZUA 1HT6A 2WLZA 1J0KA 3QHNA 1LQ0A 3K4DA 5CPTA 4MDOA 3WEZA 5I24A 3VPLA 3DC0A 2WANA 3NIYA 4W7VA 1UWIA 4PMNA 3L4UA 1WB0A 4AZCB 3SUUA 1UD8A 4WJXA 1V6XA 5CLTA 4ML4A 3LPOA 2QHAA 1XH1A 3GXTA 2JEQA 1V3MA 1C93A 2BHYA 4ATWA 2X0HA 1QOXA 1V6WA 5GQBA 3MMDA 3EDJA 5ABEA 2E4TA 1O7AA 2CCRA 1MXDA 1EDGA 2WM0A 5CG0A 1B3YA 2UY2A 1JG9A 1R47A 1SMAA 3VU2A 2GFTA 4PMQA 1V6VA 1SZNA 2YFNA 4PTMA 3VX1A 1KXVA 3VTRA 3IJ9A 1PZ3A 2DIJA 1AVAA 3EJPA 4GZEA 1GJUA 1HNYA 2OW6A 4YN5A 2F7PA 1E4IA 2W91A 3AYSA 1GZJA 2V5CA 1XCXA 3WQ5A 5A8NA 3VDCA 3SCQA 2DPEA 1H0IA 2QV4A 4AYGA 4R5EA 2YDQA 1EHNA 2D1ZA 4UZUA 4CN1A 5FOOA 2JALA 4AW7A 2ZXQA 4UCFA 4NSBA 3LPGA 3O9NA 4W5ZA 3WF4A 1GPFA 3CUGA 3QR3A 4GIAA 3SCOA 4DM1A 3L4WA 4JZ5A 3D50A 2YKKA 1B90A 2YBTA 1CYGA 1ZBVA 4AZ5A 4B9ZA 2BXZA 4HPGA 3HJEA 5A6BA 4Q22A 2CPUA 3D4ZA 2O9OA 2NSXA 2W4XA 5BCAA 1KCKA 3NSNA 3WIJA 1CEOA 1GW1A 4P7RA 3GNPA 2VR5A 2F61A 1C7TA 4HTYA 1HTYA 3A4XA 2D0GA 4AYSA 2WXDM 2OSXA 4N0RA 4QLLA 4AZHA 1BVZA 1C8XA 1BYBA 1BSIA 5A6SA 3A22A 1DEDA 3W81A 1E6PA 3ZR6A 1KBKA 2DSZA 4HOZA 1ZU8A 3ZJ8A 4AD3A 1JZ6A 4J7RA 4ZENA 4U2ZA 2VURA 2J78A 1BVNP 4QAWA 1HJVA 1ISVA 2PWHA 2WZEA 3W82A 4CCEA 4C7DA 2DT2A 3SCSA 1VFFA 3VMPA 4HPHA 3MKKA 3VNYA 1GQJA 3WY2A 2A3HA 3OBAA 5HBFA 5KZ6A 4AD5A 8CGTA 2X2YA 3N04A 1H5VA 4PMVA 3W53A 2FGZA 4KWUA 1OD0A 4HOWA 2AAAA 4ACZB 3T0AA 1UKTA 2VX4A 5ABFB 4Q7NA 4AD4A 3GXPA 4PMUA 5AYBA 4WSKA 2JEPA 3MS8A 4TOQA 1UD3A 1F4HA 1XH0A 3VD4A 1V3HA 4E8CA 4TUFA 2OWCA 2J4GA 3O6AA 1KXHA 1A3HA 3DX2A 2CBJA 3WQWA 3SCUA 1HVQA 4D6CA 5HPOA 5LA1A 4GI9A 1JI2A 1DWIM 1FH7A 4M80A 1M01A 2X09A 1JZ4A 4TVDA 4M29A 2OSYA 4FLRA 3DECA 4GO8A 4UOQA 2XFRA 7A3HA 4B15A 1HXKA 4GQQA 1W9UA 4P7OA 3PHAA 2PI6A 4W7UA 5GNXA 1CXKA 4MPKA 1JFXA 1UQYA 3CMGA 2XYLA 5KEZA 5M5DA 3GH4A 4EKJA 4C7GA 5E0FA 3GYCA 3VD3A 4W8LA 3RIKA 4UFHA 4CUCA 4UNIA 2WMKA 1ZJBA 4DWSB 5E6YA 2V5DA 1ODUA 4JHZA 4HZ7A 3IAQA 1QWUA 1HJXA 4F79A 4W5UA 4CVUA 4S3KA 4A4AA 1ZB5A 5C71A 4WLCA 1UOKA 2F18A 3NCOA 4WIWA 2GJXB 1UYQA 1JI1A 2MANA 2X2IA 3RM8A 1PS3A 3T09A 1TCMA 1Y7VA 3W6LA 2CESA 2VVNA 1XSKA 1R86A 4EE9A 2VC9A 1CGUA 3MSDA 3WMBA 3W6MA 1VRXA 2Q8XA 4GZJA 1HKJA 4Z2GA 3WD0A 3F4VA 1J0YA 5M17A 1B1YA 1R7OA 3BVVA 1PPIA 1ZJAA 1FFRA 3VM5A 4HP5A 5FCZA 1MW1A 2XN0A 8A3HA 1E5NA 4HMCA 2BVYA 3K46A 4UFLA 3WUBA 3LRMA 1PZ2A 1EQPA 5C8BB 4H04A 1D3CA 4CU8A 3T2OA 4UQEA 4CD8A 3FW6A 1H3GA 1QHPA 2D2OA 1CLXA 3CGTA 2X2JA 4ZXOA 1M04A 1ISYA 1WCGA 4OUEA 1J0ZA 3GZAA 3H55A 3VX0A 1Q6FA 2Y8VA 4X9YA 4QDMA 4FNQA 3W0KA 3BUDA 4NXKA 2VX7A 1BGGA 1HL9A 3BUBA 1WZKA 2ZUSA 4NF7A 2YL6A 4XZBA 4JFUA 3K8LA 1GVYA 1MVYA 3FAWA 1QBAA 1YQ2A 4JCLA 2E8ZA 3CBWA 3BMVA 1QI4A 3W26A 5D9MA 1PX3A 1E3XA 5CXPA 2VZSA 3OLIA 3VUPA 2G3IA 2VL4A 4UR9A 3VOCA 4PEEA 2XTKA 2WB5A 4P8WA 4RL3A 5LYRA 3EDDA 3PBGA 1R46A 1LWJA 1CXHA 1V6YA 5C70A 3AZRA 3N11A 2X0YA 2EQDA 2Y2WA 1NOUA 4L4PA 3AICA 1ISXA 4KMQA 1V02A 2BY0A 2GK1A 2UWFA 1H4PA 1UD2A 2VCCA 1JGIA 3VVGA 2G4FA 2F7QA 1E4MM 3SUWA 3L2MA 4MJ4A 4NRSA 3ZJ7A 4E4PA 4M24A 4U3CA 1E43A 2D0HA 3BC9A 3AS1A 1KR0A 4Z2KA 1ESWA 2CITA 3PZUA 3LPFA 4CCCA 3WENA 3OA5A 5FL0A 4IUGA 1GOWA 5E0CA 3UESA 4JFTA 2DSUA 2DGAA 1QVBA 5IHRA 1UKSA 4XX6A 3A5VA 1ZS2A 4S3JA 3AJ7A 4KRUA 2ZX9A 3HN3A 3POCA 1OGSA 4FF5A 2NT1A 4ACYA 1E0XA 4AZCA 1E0VA 6TAAA 1WZAA 3RMEA 3K8MA 2YL8A 3EYPA 1NP2A 2YBUA 1G9HA 1G5AA 2DDXA 2XWDA 2WCAA 4UFIA 2VQTA 3WF0A 4YHGA 4LX4A 1CXIA 1GHRA 3WFZA 1UHVA 3L2LA 1Q6CA 1KWGA 2WCGA 3WY1A 2W61A 1OGGA 1SYTA 1FH9A 4RE4A 2IUZA 3AISA 3FAXA 4GI6A 5DT7A 1HKMA 5A6KA 1QI0A 5D8ZA 1L0PA 1JDDA 5BXRA 3OB8A 3D3AA 1V02E 3BVUA 3K4AA 1WDSA 2ALWA 5AYIA 3TA9A 4H8HA 4R27A 1XYZA 1VENA 3WN6A 3WNPA 3ZMRA 3BH4A 1GQIA 1ZBCA 3IJ8A 3RO8A 3BAJA 4RE3A 4P7LA 1B2YA 4FLQA 3THCA 1GJWA 3ALFA 3NJ3A 3BCDA 1JD9A 3AROA 3ZJKA 3WELA 2YDSA 5EFDA 2FHCA 4J27A 1MW0A 3L4TA 4OJYA 3PZVA 4M56A 4CU7A 2PB1A 3S6TA 1BLIA 3SIMA 5HPCA 3GM8A 1JZ8A 1UWTA 3L4XA 3KLLA 3WQ6A 1JXJA 3UERA 1GOQA 1TE1A 5DFAA 2WMGA 1QNSA 3RJYA 3FNDA 3AIWA 1GCYA 4AD1A 3MUY1 1KWKA 4UFJA 2EADA 1E6RA 1JL8A 3UG5A 4PTWA 1EO5A 1ISWA 3HMCA 2WKLA 1M03A 1FHDA 1E71M 5JBFA 1UG6A 4NZCA 2WPGA 5DO8A 3G6LA 2UY5A 1FH8A 4H41A 4BZYA 5AC4A 4BS0A 4MNKA 3VM7A 1JIBA 3QOKA 1TZ7A 5FD0A 3MV11 1OD8A 1BYDA 3PN8A 3T2PA 5E6ZA 2D73A 3DYOA 2J7DA 5DF0A 2E9MA 2J7HA 1LWHA 2CBVA 1R33A 3KL5A 3M46A 5A8OA 3ZO9A 3PZ9A 1B31A 4MB4A 5ECUA 5CGMA 3PZQA 2WMHA 3PZOA 3SCTA 2E40A 2V38A 3AXXA 3PZGA 4OBSA 1AQ0A 3N13A 4AISA 1N82A 2XFYA 3BAIA 3BAYA 4MAZA 3JUGA 3U5UA 5ABHA 1CGTA 1HJUA 4Y7EA 3GXIA 4JHOA 2YA1A 4D1JA 4QLJA 2J77A 3AFBA 1JZ5A 3S5YA 3EMZA 3LXAA 4JKLA 4NZJA 4ACZA 1XGZA 2PBGA 2CHOA 3PZTA 1DTUA 4AXNA 5ABFA 2D24A 4LYRA 2GUYA 5A8PA 4DWSC 3KE0A 3EBVA 3SUVA 2CKRA 1VB9A 3VMOA 4W89A 2X2HA 1HIZA 4TTUA 3GXNA 4UQCA 2J74A 1PIFA 4QFUA 5A6BD 1TQVA 2JE8A 2F1AA 1XSIA 3CTTA 2F1BA 1HXJA 4BQ4A 5A94A 3KEHA 4FNSA 3OGVA 1R85A 1UR9A 1VIWA 3WDIA 2XHYA 3A4WA 4CU6A 2BHUA 4HA3A 5EBAA 5DMYA 1UR0A 1W1PA 2BY1A 3HG5A 1LL4A 4UQAA 3AZSA 1LG2A 5I6SA 5A69A 2D0FA 2VTFA 4JCMA 5CGTA 3I3DA 4J3XA 4AZIA 3SEPA 3DHPA 2RGLA 3A23A 4DWSA 4PSPA 3U5YA 2YFOA 3K8KA 4W8AA 1NARA 1I1XA 3MUZ1 2Y4SA 4QP0A 1Z32X 3VGGA 1UZ4A 1W2VA 1E9LA 2WHLA 4D6EA 4WKFA 1OINA 1PX8A 1W32A 5TD4A 3AQUA 3BSHA 1KBBA 1K6AA 3EMQA 5I3DA 5D8WA 5HOSA 4HU8A 4MNLA 2EEXA 3W37A 3CUHA 4FNPA 3SCPA 4BF7A 4CN4A 3F5LA 2GJXA 2DT3A 3DYPA 1ECEA 3ARPA 3MSGA 4PCSA 3VIHA 2VX6A 2A3CA 1J10A 2VRJA 1CLVA 3PTQA 5JBDA 5JUVA 5JBEA 1UR1A 1V0MA 1JXKA 1TQUA 3ZSTA 1UZ1A 2JIEA 2WW5A 2YL5A 1WZMA 4GXPA 2O9TA 1H1NA 4J3WA 1MW2A 4UFKA 3VD5A 3ZQ9A 2EJ1A 2J7BA 3VSUA 2E9LA 1B0IA 1NWUA 2WBGA 4MAVA 3I3BA 3IGUA 1DHKA 4WK9A 1US3A 4RE2A 3EMCA 3CC1A 3WL0A 4TXEA 5EFFA 4IPNB 1H09A 2VZOA 1HN1A 3VIKA 2OYLA 1R34A 1GQLA 1YHTA 3AIVA 3CZEA 4ATLA 1U2YA 1ISZA 4DO4A 2IXUA 3WH6A 1D2KA 1CXFA 1XH2A 2QPUA 1EIBA 5BRQA 4MTVA 5CSYA 2XSAA 2Z1SA 3W38A 3W27A 1GNXA 2EBNA 5A2CA 3MMUA 4AZ7A 3GXFA 2WZIA 1JDAA 4AEEA 2W63A 3CHFA 1K9DA 2WVVB 4JFWA 3FN9A 2J75A 3CZNA 2PWGA 1HP4A 5ABGA 4CCDA 3G6MA 3N18A 2XVKA 2ZICA 1MYRA 3VD7A 4CN6A 1WP6A 4WSJA 2W62A 4H7VA 3WUFA
chains in the Genus database with same CATH superfamily
3MWAA 2HX9A 1N7MH 3K6SA 1WFNA 2NQCA 4CD7A 2UXFA 2QUMA 2WBXA 1J01A 3LZFH 3F85A 2EDHA 3SQMA 4YFDB 4RGMC 1IT7A 3DDFA 4X9BA 3B9AA 4HZ6A 1E9PB 1W72L 1PVHA 4PFMA 4JQAA 1LO4L 1W9VA 5JW3L 4DQOH 1MCIA 4O02L 3KOWA 1GRWA 1NWTA 1X6NA 1TV5A 1CLOH 4IJ3B 3S35L 5CJQH 3W00A 1P4BL 3LD5A 4TX9A 2R2EA 1A0CA 5RUBA 2V4LA 1WZLA 3ROLB 2WNWA 4CSPA 4K2UL 5JLZA 3VGEA 2DW6A 5A2BA 1SVZA 5DMGC 4KI5D 3GSVB 5E6SB 1SYSB 1UA6H 1ITQA 3JVFC 3VDBA 2EDOA 2OJZL 2XX1A 1U8IB 4YHZH 1HZYA 5I77A 2C19A 2F58L 1I31A 4WGHA 1VF8A 1DCLA 1E5UI 2Z64C 3TW6A 2MNJB 1PHWA 2CGRH 4JDVA 2A74A 4I7WA 4Q58C 1T1WA 1MCHA 4KK6C 4NQSB 3C9NA 3LKRA 3RJDA 3LY0A 3TJLA 3WUEA 2IWGA 3M43A 5K1JA 5TK2A 2Z3FA 2F6AA 4D0CA 2HE5A 1V0KA 2P5WE 4G8EA 4QCEA 3HOGA 4L1SA 2PR4H 3WU1A 4OSUH 2C4XA 1OX5A 5F9OL 4C6JA 1EEYB 5AC5A 5H8UA 1N6QL 4NUQA 3SCMA 1NFPA 1DWGM 5F9WC 3IUHA 4YYCA 3TBVA 6ENLA 3QR0A 4JREC 3GHRA 4HK0B 4YUEL 2RAMA 2XTJB 1OSEA 5F1NA 4G43B 4GW4B 3PPFA 1A4KB 5CG7A 3V5HB 3WIHA 3V8OA 2KX9A 1M6OB 4YIWA 4K73A 3N6QA 2BC4B 4MASA 2JCWA 4LGSB 3EGSA 3KAOA 4HEPA 2J79A 3NPXA 3WQVA 3S37H 3GMQB 1E0WA 5CPQA 2B59B 5SWZB 1R0AH 3KPRE 4ODXB 1N2RB 3ULVH 4V1XA 2QGHA 4TVPD 3CHVA 4XKYB 3TA3A 1ICSA 2F15A 4MJIE 3N9RA 3S47A 1HZLA 4Z6AT 4DP2X 4TNVF 2DZWA 3K6FA 3GBNH 1UB6B 1QSFD 3NRQA 3UBFA 4PRHB 1PG7X 5DR5L 4OGAD 3QJUB 3OB0K 1QR1A 3VXSD 3IXAB 1I1AB 4H2HA 4G6MH 4JM2D 2PAJA 3Q37A 3TVMC 2RR3A 4ZAKD 3OKDB 4LB3A 4Z7UF 5FYLL 3MUCA 4DUWA 3FC8A 5TAOA 2UZYA 4JN7A 3QRGH 3HE6B 4NNAA 3JRKA 4R7DB 1F8TH 3L4VA 5AW2B 4OF8A 3DGCR 1J9CT 1DLHB 1NPNA 4JRFA 5FKAB 4NKOA 2ZPKH 2BOGX 1DWAM 2PN5A 2F5AL 4OT7A 1MAML 5HVWA 4PTDA 3ARDA 1DJSA 2EVGA 2HN7B 4GO9A 2BXVA 3DLQR 3P3TA 2IQDA 5M03A 3P77A 3OJGA 4I0PD 4I48B 4UWMA 3PJNA 4R8WL 1KFEA 1AH1A 3OKLB 1U3YA 2XRAH 2HFEB 4PCTA 1KV3A 1Q6EA 2DT1A 1UM4L 2HRPH 4ZSOA 4ZTEA 1IGTB 2ED9A 2CNCA 3M88A 2IS7A 2WC3A 1P1ZB 4YL4A 4HUMB 1Z9SB 5E8OB 3F5JA 5EL1A 3VGFA 3U30C 2HT3C 5DEGA 3UR5A 3S2JA 3KDNA 2E7BA 3HMXH 3H2EA 5ABAA 4Z5RB 1GGCH 3PWNA 4W9EC 2AEOA 1LO5B 3IXTA 3GC5A 5C1MB 3NO1A 4MJ2A 3DDGA 4AGNA 3WFBL 2AZUA 2NT0A 2DYPB 2HG5B 4I2XE 4WUUD 1F5ZA 3TBWA 1ENUA 1NAL1 3K91A 4KQ3H 1UADC 1UYWL 4Z7QE 2QUVA 2YA0A 3S3SA 5T1DL 3QV9A 3AVEA 4TMBA 1W8NA 3STPA 1CK0H 1QFUH 3JWOL 2PTZA 1S7XA 4AWEA 1DYSA 2X7WA 3M8OH 5E09A 3L81A 4CMHC 2G9HA 5D70H 3M1ZA 3ORWA 1AIFB 3WS6C 3E1F1 4H8UA 3I4KA 4K3JL 1DANT 1T5XA 3N6YA 1N2VA 3VO0A 4P48A 1JFQL 2HLEB 4PJ5D 3L3OC 1DWJM 4PMDA 3SCWA 3CHDA 1BD2D 1PE1A 3U9IA 3FSWA 5F9DC 2W80C 5TDOA 4GQPH 3M47A 1EWEA 4FXLA 1JYXA 3T8XA 3U0WH 3N42B 1FZKB 2ZOOA 1MH5A 4JY6A 1DKWA 4MZ2A 2QHLA 4DZ8B 1T5AA 2I5IA 3WF1A 1FCCA 3AABA 3ILPA 1DVZA 2WB7A 2Q7AA 1TJGL 5E2TL 4XVTH 1OFRA 1VFMA 1EJFA 3HB9A 1AL7A 1DN0A 3SO7A 1SJHB 1M7XA 3P4NB 1MLCB 3PWGA 4JIEA 1E6SM 1INDL 2QMKA 3M0VA 1JNLH 3WGUB 1VACA 1K85A 2DLHA 2X4TB 4WU7B 1LE9B 1TQWA 5CP3A 1ZXQA 5HY9A 3TWYA 1J8HE 3WH7A 3MLUH 3QHTC 2BIPA 1EYWA 3AYVA 5A6AA 2I7GA 5TF1L 4GUIA 4LQFL 5GRYA 3TWCH 2F7OA 1VPQA 1A4JB 3WQ8A 4F9LA 4P0DA 5EC1B 2VXNA 3D48R 3AIUA 4JAMA 3RU6A 1TSIA 3WF2A 5J4MA 1XQLA 1JZ2A 1G6RH 5C0RL 2ALDA 3MO1A 5E9NA 3TN0B 3Q67A 3MANA 3MV9D 1ZGLM 6A3HA 2VDMB 3IIZA 1C12B 1E5JA 3R8HA 3QJAA 1UQSA 4PB9H 1B2WL 2X1PA 3VXOA 2I56A 4HNNA 2LLNA 4BEQA 3V0WL 4JR9H 1H11A 4F7PA 5E9DE 3CIVA 3GZ3A 1P5VB 5DT5A 1UWYA 3ZLFA 1G9NL 1CD9B 3WAJA 5B3SB 5LNDA 4AYFB 4MXVE 2FH8A 2GB2A 3SGEH 1Y18B 4UUIA 4JMNA 2HVMA 3A4FA 1UUQA 2X6AA 5FEXA 5AZ2L 3BO9A 3RM9A 2OR9L 3UWUA 3SY6A 2J8UE 1JHKL 2AL2B 3CM4A 4AJVA 3T7VA 2Z31C 4YHKH 5AY7A 2GBUA 3U9PH 1DQXA 3LQAH 4L3FA 3DJRA 4EPDC 5JO5A 5CPOA 4XPAH 2XY2A 3QKEA 2VITA 5E5MA 3GNOA 3IDIA 4HUUB 2HNEA 1Q90A 1CG9A 2Z8SA 4EI5B 2NDFA 3V2AR 3EGJA 3CXFA 1ZVSA 2OGJA 2WAGA 3TM6A 4DESA 5AFDA 1EAPB 3L8QA 4P61A 1IAKB 1CQKA 1R3SA 1SQMA 2UY4A 1L5GB 3ONBA 3FN3A 3F8UB 1KEGH 1A3WA 5A5WA 5I1IL 3HFTA 3QZWA 3RLVA 1EDTA 4UTCA 3GTHA 2CIKB 4IP7A 5D1XC 4I9WD 4PCPA 4PW9A 3O6FD 4DQWA 1F90H 4WI8A 2WINB 3L5AA 3TH6A 2EYSB 3G5XB 4LEQA 4XKMA 2Y3NA 4FXKC 3THDA 5CJOL 3D6GA 4A39A 5D32A 4YSQA 3Q6FB 4M03A 4BWWA 3R06B 1BKSA 2J43A 1G4SA 4JM2C 3OMAB 1S7RA 4RAVB 1X1OA 4NHVA 3NSFA 3PUGA 9PCYA 3OJDB 3NQMA 2LHAA 4UMAA 2P80D 4D9LL 1JF6A 1X1NA 2FLIA 4PJCB 1K03A 3ANUA 2OZTA 2A9AA 3QHZL 3L6FA 2JNZA 3S1XA 4JDEB 4WJXA 1QEXA 3BE1L 2GQAA 4ML4A 3DRTA 3VI4F 3GXTA 3SPHA 3ZDYB 3EDJA 4Q7IA 1M9WA 1F86A 2WM0A 4GBXD 2CKNA 4F80A 1V6VA 1TO3A 3MGOB 1KXVA 1ZLEA 1PG7W 1JRHH 3APTA 3MVSA 5ISZD 5IOPB 2I14A 3DX7B 2WTRA 4ZI8A 3FUHA 2Y6SD 4NAFB 1MY7A 2H3KA 2XN9A 4PI2A 2MJWA 3CN0A 5BMFL 3NIDB 4GG8A 4HYWA 5EU9A 1WTLA 3UO8B 2CO7B 1UJQA 4E5XB 4ZCWA 3VFOA 4F0RA 3FRPA 4M7ZB 4G56A 3FUEA 3D4ZA 5KTLA 1GW1A 1IYXA 3DI0A 2F61A 2MNUA 3LYEA 4B60A 2ARJQ 4NP4H 1SSGA 5GSVA 1BVZA 1CE6A 2VFGA 1BSIA 2VLRB 3N5AA 4ADUA 4P46D 1N7ML 1R5VB 1E5YA 1UEMA 4EOWH 3SI9A 4AY8A 5D96C 3U9UA 1AGBA 3SKOB 1NCCL 4ZFOB 3LZFL 1U42A 4N8CH 2VWEE 2A3HA 1MG3C 4APQD 4LFHD 4AKOA 3HS8A 4GLRI 3RIFK 3FNKA 4A7SA 4PGEB 3KRZA 3NPVA 4WSKA 4R96A 4DQOL 3MC0A 4BH8A 3V0SA 4XN4A 1SVBA 3N6JA 2JGQA 2CIIB 3BHBB 3PGFH 1CLOL 2FAUA 4LEFA 4I3SL 3DRQB 1PLCA 2WLIA 2GJLA 4P3DA 4D2NA 4K3ZA 3H4GA 2OSYA 4LALA 5C0BB 4PL1A 5F3FA 1OX4A 3KG5A 3NFNB 1W72B 1JFXA 4HV8A 3B2VH 1AS6A 2AJYH 2VM9A 4ODTH 4O02B 1UA6L 2N01B 1A8JH 3UADA 4HBCL 4KIRA 3HRZA 4YHZL 1HJXA 4P2RB 2QUUA 3LNIA 1HSAA 1KIQA 4MNGB 2AERT 1VFAA 4WLCA 5K7JA 1VBGA 5EBLB 3MLTA 1QFHA 1MWAA 5DUJA 3L9EA 3OHXB 4DJFD 2RJMA 3O3UN 4P4KC 3WGVB 3F7YB 2YBVA 2DKSA 4EVZA 1R86A 2EE3A 2NY0D 1NCDH 5AWNL 2DQWA 1OW0A 5AYYA 3HPLB 1DSWA 2VUOA 2PF6A 2KBGA 1B1YA 4HJIA 1ZJAA 2YD6A 3NRPA 2XN0A 1P48A 4GYKA 2PLTA 2MOQA 4UFLA 1UC5A 4LHUD 4HQQH 2VEIA 2DM3A 1NGWA 4OSUL 3PAYA 1GR7A 1AP2B 4JFDB 4X0KB 4ECNA 4MQXC 1G7MA 4G80B 2VGBA 3C08L 5H8PA 3GZAA 4G8GE 1UIPA 2XICA 4GW1B 3SDDB 4AU0A 4L1TA 2P26A 2NYYD 4O0ZA 3LH2L 4JTCA 3QC0A 4B4HA 4Z76B 3HFFA 4GSUA 4MD4B 3FAWA 3W22A 3AT0A 3QUXC 5EU6D 1S6NA 4QHKI 1M71A 4LBAA 3MNZB 1Y8BA 2G3IA 2ADFH 1R0AL 2VL4A 3ULVL 3CJJA 1OLZA 2D7OA 1R46A 4PV1C 4YSAA 1B0RB 3N11A 4N0UE 5JNYB 1LCOA 3ATEA 5I19H 2E28A 2I60H 3GBNL 1I85A 1S9YA 5MI0B 3WHE0 1WUEA 2NX5E 1DYZA 4NY2A 2WMPA 4OT1L 1IUZA 4MMZB 1Y07A 3STEA 3M41A 3V95A 2IOIA 4G6ML 4FHJA 3W9EB 3ROOA 1TMCB 5AFAA 2NT1A 4ACYA 4EF3A 1E0XA 3TN5A 6TAAA 1WICA 4NQVB 2YBUA 2AQ2A 2C1GA 1DBAH 1G5AA 1HWGB 1ZSDB 1ZPUA 2E75C 3HAEG 5I76A 2WCAA 4ALAH 1OAUH 3LAFA 4ZYKB 5DRCA 3QRGL 3H21A 2OZ4A 4IGMA 2VDMH 5D8ZA 3WLHA 3ZFHA 2NZ1A 5I1DB 4XODA 2WQRA 3BKYH 3BAJA 3UJIH 3URQA 1RR2A 4U6VH 4HCGA 3H2AA 2QULA 2YDSA 4IQJA 3ABXA 1K4DB 2Y06H 4CQ9A 1MVFA 5HPCA 5BNKA 3MOBH 3FJTA 3S2LA 2O7SA 4X5WB 1JZHA 3N9GH 2BSSB 2EADA 3BPCB 5DLMH 1ISWA 3V4UL 3KBSA 2EUXA 5HPMB 2Z35A 4ZTOL 2XPGA 1IB5A 1KRCC 4JPWL 3BGGA 1Y1DA 1AKJB 5HJXA 2X7VA 3BLEA 5HTSA 3OP2A 3ZKNC 4E42A 3QOKA 2AW2A 3M1BA 3E7JA 4C57C 2E7LA 5D4QA 5DRWB 1F3TA 1K6WA 1QSFA 4U4IA 3PZ9A 4K7PY 1TPVA 1EHLH 1GTNA 1OK4A 3VXSA 4YE0A 3S88H 3HMXL 3S34L 3V4VA 3CIXA 4KO9A 4GD0A 4D1JA 1A9BB 1NBYA 4DEPC 3PUCA 4JX6A 4GABA 3FKKA 2PYFB 3N42F 4DX3A 1IAMA 4ZAKA 4OUIA 1U4EA 1U1JA 1R17A 3QMRA 1U1UA 1TX0A 2BVPA 4A6GA 4H26A 1QSEE 1EXHA 4XZ9A 1UCTA 1TQVA 4KQ3L 1SZRA 3EZ4A 3APNA 1M2VA 3TJ4A 3F04A 2MCAA 5C9JB 3W1NA 2ZP9A 1XGTB 2QYGA 1QFUL 1COBA 2DLIA 5DMYA 1Q0XH 4POZD 4N2HA 4L1LA 4N2IA 4HZMA 4Q8BA 5IK3A 1R6WA 5JMRA 5D70L 3I9PA 5A69A 5FK9A 3LQZA 4JYFA 2ERJC 2IWFA 3AG3B 1W17A 1QPPA 5IJCC 3LDVA 4I0PA 5C97A 3EMQA 3V4BA 4HU8A 3GMLA 1IGJA 4AKQA 1O66A 5C6MA 2JJTC 1UTDA 3VXTA 1R5WB 5CD5C 3SCPA 1IRAY 2WHVA 2PPGA 1QUNA 3UBXI 5JH2A 1FJ1A 1I82A 4XVUC 1IWPA 2CRYA 3TFKC 4P2OB 4UTTA 2RQ8A 5IVXF 1DJXA 4OCRH 1MJ7H 3NM3A 3S1GA 1EJUC 1I7UA 4UFKA 1GKQA 5C55A 2GDQA 3S83A 2BMKA 1XIJA 3EGXA 5JPNA 2OI9C 4WK9A 5DD3H 3VCNA 2QLVB 5DJDA 3B7RL 5F97E 3WG7B 1JNLL 1E0TA 1FWSA 1WKEA 4XNZB 4JPKH 1VA9A 3NQAA 5IEKB 4JHMA 3OQRA 4GK8A 4XC1L 1RK6A 4EF9A 3WH6A 3MLUL 2ITDB 4I1RA 1LGVA 3FCBA 4OV9A 1XINA 2WO4A 1BZ7A 4BZ2H 2FIKA 3EXJA 3KVJA 1UXWB 3L5JA 4WUUA 2PKDA 3FN9A 5IQLA 4MTMA 3UGEA 2ZUQB 4KO6A 2EP6A 2ZICA 4IGBC 2XKNA 3CVHA 2A9DA 3KLHD 1FGNH 4Q3MA 5XIAA 3SN0A 4XP6L 1DTNA 2XG5A 2OWXA 4FQXB 1G6RL 3Q2VA 3UZQA 2Y24A 4OUUA 2Z4GA 3MRFA 5FUCE 2CNZA 3WTVA 4RNRA 5HNUA 4ZX5A 1YNKH 4JS3A 4PCNA 3NQEA 3L48A 2UWEA 4OU3A 4PJ5A 2FPTA 2QFPA 2CBTA 3CO4A 1BD2A 2QHRH 4AV0A 3GY1A 1Z9NA 4LCYA 4JR9L 4EPSA 2B31A 3KBWA 3EBAA 3BVNA 6FABH 1QATA 4CBZA 2QL1A 1YY9D 1ETA1 1XGUB 2IWEA 5T5FA 1EJXC 1TZOA 3WOVA 3W7EA 1N4XH 4OLZH 1IKNC 2B3RA 4R90H 2OV0A 1FZJA 5DFVC 5D2LE 1GGIH 2KZ1B 4ZS7H 2XV3A 4UTWA 3C87A 3GLEA 3JYBA 3T65B 3U9PL 1U6AL 4ODVH 4IHCA 3SDAB 3P11H 1HKIA 1ZAHA 4P5TD 3UBXG 1R3HA 1GZHC 4WV1B 3GSRB 3DETD 3BWAB 1RUPH 4IHBA 4RDQG 1MZRA 4Z2IA 1JF1B 4FTDA 4XP5L 4KC3B 2DMHA 4GIEA 3CUPA 4WJ5B 3UF9A 3BUYB 3I6SA 2QJDA 1TJMA 3MZTA 5DEFA 1A3ZA 3BUQA 5JW3H 4MWAD 1PHQA 2OSWA 3ES8A 4N9EA 4CD4A 5DEJA 4KKPA 3C8NA 3HAEB 3WMLA 4IS6B 3MV9A 3MKGA 1OFEA 1HAUA 1KEGL 1DJZA 3OQEA 1P4BH 1CTNA 4PJCF 5HI3D 3WLWC 5D2NA 3KOZA 3QQDB 3WL1A 3AZTA 5HVHB 2R2CA 4UAHA 2H3NB 5CKSA 1R7AA 2VLJD 4KETA 3GDKA 2TMDA 3ZDYF 3GSXB 5ICYB 1A4AA 4BHUA 2YW3A 5CBBA 3L7RA 4MDPA 3KRBA 4Y4KD 2BM3A 2FBRA 4Q8NA 3IVUA 3RGVC 2UV3A 4R9HA 3FV9A 4IIDA 5FFOA 4Q89A 3OMNB 4QEHA 1YECL 3OXSA 5GZNA 3C2OA 1K7XA 2OGYA 1AMKA 3GLDA 3WNOA 1KGCE 1V55B 3CXHK 3Q0HA 1T0PB 3INPA 3WDQA 1T7VA 4JY8A 4C7FA 1XIHA 1S2WA 3RTQD 3FO1B 1G1KA 4P8VA 5FM4A 3KJ6L 4H0HB 5HHNB 2HJKA 4LVGA 1IC5L 1TFHA 5EPMB 1KZYA 3ELQA 3S2CA 4Y5YB 5MKGB 2A6DB 5B1AB 3WBEA 3ARXA 4TLUA 3AB0C 2H5UA 4UB9A 4Z1BA 3VNKA 1M6JA 1IEHA 1KR1A 2XZZA 3MUUA 3LXBA 3HG4A 3BW3A 3HPJB 4K7FA 3KCWA 4P23B 5HSFA 3INUH 3GDBA 4YUEH 1ILUA 1U21A 4PJIB 2O93L 1MHHA 4K7VA 3FTGA 1WFUA 5EEWA 3IPWA 2DOCA 2OEKA 4EKXA 3TJIA 4HS3B 5C0EB 3E6HA 1J0JA 2ADIA 4LMQE 2YPKA 3O6FA 3G04A 2PO6B 4FLHA 1OAZL 4PRBB 5KYYB 3UA4A 3BANA 3IJHB 3NPUA 2DQXA 4HULB 1RVFL 5D02A 4KEUA 4GY4A 3V6OA 1W3TA 1QTSA 4LP4A 1U95A 1S5MA 4WDIA 4NP4L 1G7LA 4TLKA 1BGAA 3HMJG 1E9ZB 5DR5H 5DRZB 2GJZB 3UTQA 4QJ5B 4AYID 4Y2DC 4LP8A 2CHNA 3P1VA 3ULSB 4EOWL 1BVNT 5CIPA 2E09A 2P80A 4ZO9A 4B95C 5F70A 1KXTA 2XV6B 2WWDA 1JPEA 4BWUA 2PZNA 2J7FA 2NY5C 3U6WA 4LRNL 5FYLH 2BO0A 1NUNB 2VEKA 4Z95H 3DSNB 1OCWH 3CH1A 3K71B 4UDUB 1QFOA 4O4VA 1PZBA 4BQ6A 4NIKB 3BG3A 3SDOA 3PGFL 3FQTA 3HIJA 5LXXA 1RZKC 3C86A 1JR1A 3BVTA 5XIMA 4U31A 2F5AH 1F3JB 1SLVA 3DO7B 3D1MC 3CK0L 1RLCL 3TP4A 5ISZA 3WBAA 2DEYX 3VE0A 3B2VL 3P7YA 1P7TA 3KBPA 1TELA 4ZSOE 2HUEA 3E0FA 3CU2A 4Z23A 3WQGA 2AKRB 3PPEA 4R8WH 3DFNA 3N17A 2FIQA 4I3RL 2FR4A 3LMZA 2NY2C 2GG1A 3GMPA 1UWXK 3OGRA 3IN2A 4Z17A 4ENLA 1UA3A 5AW3B 5K59F 3BO8B 1ZHKB 3T0TA 4RV8A 3H54A 3TO2B 1T5WB 3FCTB 1JCKA 4P46A 4PJ7B 2IALB 3L4YA 1C29A 1AOZA 1U93A 4MKMA 2I26N 3APFA 1AQHA 1PZAA 4HZ1A 2DYSB 4TTGA 4KEVA 3TN3A 1FHGA 5J11C 5BRBA 4X9GA 3P5YA 4MD0A 1VLWA 4APQA 4KERA 1FCUA 4AWUA 5D6DC 3KLHC 3H7VA 1AH3A 1U8CA 2OB3A 1LL6A 2Y7OA 3TTOA 3TEWA 1Q9KA 1ZANH 3NEOA 5B7YA 5ICZA 3JWOH 1NICA 4PE8A 3ARFC 3UBXB 3HC2A 4XSMA 2MTPA 4FF9A 4FXGB 1TV7A 3BRFA 3ZHLA 5JW4M 2JK2A 3GZQA 3AI0A 2X2UA 5FF7A 4O00A 1N12A 1VADA 1PNCA 1W9BM 1AH4A 5A3IC 5TQ2H 3E5BA 5DMGD 3NN8A 5E9XA 3EJTA 1KNOA 3OKNB 1YZZA 4DJFA 2VMDA 3F6IA 4J8QA 1E67A 4GKLA 3DO4A 1TJGH 5E2TH 5AAPA 4NZFA 5DANA 4CA4A 5C08D 2PCEA 4LNCA 4R0LC 4UV4H 1KACB 1XF3A 4GUJA 1SM3L 5IMKB 3P30H 1DZ0A 3WDPP 4J39A 3JTTB 4PG2A 5HJ3A 3VH8A 1DBAL 4KK6D 4E8DA 5C0GA 4DKAA 4LHUA 4FADA 1KRBC 3A24A 3CYVA 5A6JA 3IJ7A 1QRQA 1VD6A 4ILSA 1WSST 2RALA 4G7QB 4NPYB 5CWSA 3IJSB 2IH8A 1M57B 4O1BA 1HH9A 2A9BA 3WFEL 1W37A 4FKEA 3JT2A 3W7LA 4TQEH 1CFNA 1ES0B 3F4DA 3RPKA 3BH8A 4LCSA 3UZWA 2Q0ZX 3L23A 3UJIL 5F7FA 3I6TA 5KSAC 3RNKB 4Z3EA 3QI9B 1LEGA 3QJZA 4FKKA 5JHAA 1MCFA 4JANB 3NA8A 2XVPA 4FPSA 2A5HA 3QGKC 3BZDA 3MMEB 1A5AA 2FMNA 3MOBL 2X4PB 4JFFB 5D9OA 1ZJHA 5F0PB 4V33A 5DMLA 5EU6A 4M8RA 4Z08A 3TZVB 1B2WH 3LS9A 4M4PA 3P2TA 1P0NA 4PJEB 4DKTA 4U1MB 2P28B 4GLRH 4I89A 2J8UB 3K4WA 3GXUB 3CQQA 4PWKA 1FQ0A 1T21B 4CSSA 1G9NH 4EIBA 4ABVA 3H2NA 2CJUL 4MDRA 5TTRA 2J73A 1ZVNA 4C47A 4IF2A 5FL1A 3F1QA 3BSGA 4KRPC 2FNBA 3PP7A 1EHLL 3H4HA 4TNEA 1NFDB 3S88L 3VRIB 4LRTA 3CDGB 4QGYA 3HNSH 2OR9H 5FFLA 3BOVA 3VB8A 1NGYA 3RHGA 1OCJA 2X4UB 1IAOA 3WFCL 5GSRB 4B92A 3KXFD 3U4BH 2AK1H 4HYTB 3DO3A 3TYAA 1V7AA 4L5FE 5J13B 5I23A 3OJVC 1UOZA 4J3ZA 1RXLA 1OZTG 1YBQA 3ARTA 4XMUA 3TVMD 1NFAA 3HAEH 3L3DA 4DVBB 1EGZA 3NJIA 2XBZA 5FYKE 4WJEA 3SBRA 1AL8A 3D08A 1XICA 4H1LA 1W1A1 3BT0A 2VMCA 1TTPA 4PJGB 1RY7B 1Q0XL 4TQTA 4G5ZH 2WNZA 4C6NA 1PKMA 5D7LD 2QKIC 2ENPA 1NIFA 1MIMH 3W7IA 1HT6A 4R4BB 1LMKA 3GS0A 2CXKA 5ENWA 1F76A 5I1IH 4W7VA 2VSKB 1LVEA 1NEZG 2JI1A 4HLZG 4F5CA 1V6XA 3LBCA 1EBPA 3LPOA 2ZWLT 3TNMB 3ZHFA 3RWFB 4S3EA 1EC9A 1QOXA 4OCRL 4OCMC 4PMQA 5CJOH 1E90A 3UAFA 3GZPA 3S4SA 5KANI 4UQ2B 5DD3L 4H8NA 1AGFB 3QDAA 1XCXA 3LN5A 2IG2L 4MZ8A 4WW2F 3FSVA 2HT3D 3HS0C 4FXRA 5D7IF 1M7IB 3SW6A 2WKJA 2R1PA 1KM1A 1K5WA 2Y7DA 1AHWA 3C5XA 2F53D 3IPBA 3NJMA 4AVIA 1WYJA 4HHWA 3B04A 4QHMA 3KHOA 1CFSB 3C3UA 4AYSA 2OSXA 3O7UA 4XGZB 2AV7A 4HOZA 1EEXA 3DGRA 3B2UC 3Q05A 4NO0B 2J78A 1WWWX 4P05A 4CCEA 4US5D 3L1OH 4QJ1A 3NJHA 3VNYA 1GQJA 1KZQA 2XN9E 4AD5A 2J6EL 1VIZA 3IUDA 4QT5B 1J05B 3DAQA 2MH4A 4ACZB 2FRGP 1AZNA 1G6RB 2GI7A 5DY2A 4R7LA 6FABL 1MRAA 2HVKB 3FFDA 3N2TA 4XWGH 3S8WA 5BMFH 1USQA 1MHEA 4JRWA 4EQ2A 3BSMA 3HFMH 3VXQB 3PU7A 2CZEA 3O6AA 1XXXA 2CBJA 1K2DB 3WE6A 4OLZL 5E1IA 5DXWA 1D5ZA 3BOXA 1JI2A 1S7UA 2NXZC 4ZFOL 4N9BA 4R90L 3KH3A 1D2PA 1NWOA 2JKRM 3ZL4H 1F1GA 4D8PA 3QIWB 1FXQA 1RAKA 1SJCA 4D2JA 3P3BA 1GGIL 4ZS7L 3FLUA 4POUB 1BBJA 4GUQA 5C9RA 3PHAA 1CXKA 1OHQA 3W6YA 5JOPE 2ACRA 3UYPA 2CWXA 4C7GA 1EF3A 4ZOBA 2WJDA 1SZEA 4ODVL 3V0AC 5ICXB 4R97C 3P11L 2DDQL 1NCCH 2A6JB 3FA5A 1ZD6A 4ETQB 1RUPL 3MUJA 3D5OF 2B3IA 2F18A 4I7ZC 3E8UH 4XN1A 4PJ8B 1UYQA 4MA7L 5KANG 3MZ2A 4F8TA 2HJLA 2G2NA 3SDCB 4YC2C 2UZXA 3UZXA 2PW1B 4K71C 3IGAB 1OB1B 4FTVD 3ZBMA 4C6MA 2NUPB 3T1FA 3QO0A 1F11B 4PJAB 1FWEC 4I3SH 4IT1A 5CAYB 3KEDA 8A3HA 5E6RB 5FYKU 4UDTB 2N0MA 3ZYIA 2Q6WB 2BOBA 4RLDA 3DI3B 4M93C 3KPOB 1U8KA 2EHHA 2D7TH 3FW6A 1Z42A 2PR9A 3BP5A 2XJLA 4ELKA 1ZJIA 2Y36H 2GJNA 3HZKB 4HBCH 4QDMA 3W0KA 1BXCA 2FLMA 3OR7A 4NF7A 1MRQA 1E9IA 1NCAL 2G5UA 4PJIF 4A1RA 3LD8B 1QI4A 4YSDA 3V6ZA 3MJ9H 1G7IB 4XN9A 1N70A 5BOJA 2FO8A 5KBMA 2RDWA 3OLIA 4A35A 1EGJA 4PV8B 5AWNH 1PMYA 4C56B 4G9PA 1KT2B 5KZMA 5CJBA 4P5TA 3WQPA 2R1MA 1SJVA 1XF0A 2X0YA 2Z31D 4IJBA 3WUZA 3LN4A 1CLCA 4L4PA 3QYNA 4KMQA 2XKSA 1BPVA 4QIRA 2ODIA 2F7QA 3SUWA 3RY6C 4A2HA 3FK4A 3HPSA 3BC9A 1LQAA 3LZRA 2ZWSA 4HDIB 1ZRUA 1T22A 4MWAA 5C3LD 3C08H 4CVXA 3ZLQC 4ZMXA 3INUL 1QWKA 4YCPA 1GXEA 1HSBA 1TXKA 3AXMA 1U58B 3GJEA 4KI5E 3LH2H 2D3JA 1UWAA 3QKZA 3ME0A 1TJRA 1N0LB 2JJSA 3DSFL 3CAKA 1MAKA 2IUZA 4GI6A 2WXPA 2NX5B 5HINA 2VLJA 1DXFA 1H61A 3OB8A 3APDA 4DEWA 3GDCA 5D1XD 4TUOA 4UM9D 3ZMRA 2OMNA 3M7FB 1GQIA 4Y4KA 4MHBA 2NPLX 5TQ0L 3KS5A 3SO5A 5DK2A 4QRUB 1FVCB 2C9VA 1ZT1B 4X2PA 2L7JA 4PBWD 1BLIA 3SKNB 5C9UA 2O0TA 1AD4A 3VOIA 4OT1H 3FNDA 1NEZB 4YPGA 3L3GA 1TJHH 5JBFA 3RTQA 5BWAA 4H41A 5AC4A 5LAXA 4M9PA 2ZC1A 2DZUA 3C61A 1T83C 1LQBC 4L9LA 3IJYB 4MYPA 5HYSA 3E2HC 2C5DC 5FLUA 5HDOA 4Z95L 1ZY9A 3KL5A 3MV7B 1OCWL 4AV4A 1N82A 2XFYA 3BAEH 4G2AA 3QAZB 3ABQA 2ROYA 3FBKA 5HQEA 2MCG1 4X7CC 4JG0L 4JKLA 1J88A 5HP5A 1PY4A 4PJHB 4JG5A 3UTSD 3QZ6A 2J1WA 3SYQA 3TXZA 4TVPE 4G7YL 4QFUA 1IF2A 1Z69A 4KX8A 3WQDA 1A0EA 3DXAD 3AQXA 4M6QA 3V4UH 3OGVA 1KA9F 1VIWA 3KM1A 4ZTOH 4JPWH 5HMEA 4UUJB 2CH8A 5LKNA 5G5IA 3F6LA 3WJMB 3T0WA 3JWNE 2VE6A 2YGOA 3VXSE 4XP4H 3CBRA 3PHSA 4J3XA 4RDQF 4HEPG 3AG2B 4PUWA 2NYKA 5T5NG 1D5IH 1OINA 3S34H 3RWEA 2YD7A 4X7SH 2EEXA 4PJXA 4Z7WB 4FP1A 1C5DB 1Z9LA 1DSYA 2RGSA 3QWNA 5FSEC 2XPZA 4OLXL 1PEWA 1LK2A 2VDKL 2Y25A 2BMBA 4QGCA 5GS2H 3VD5A 4LCUA 2EJ1A 3E3QC 2I25N 1B57A 4Q4RA 4QRPD 3L95A 1DHKA 3MPCA 1US3A 3ULVF 1AQKH 4OIIH 1ZANL 4NN5B 4X5LA 5AVYB 4HB7A 1YADA 4C6PA 3QUZA 1Q72L 5FPIA 4S10A 4EVNB 4RXGA 4REQA 5DVPA 4I9XA 1D7BA 3EFDL 3R13A 3BMXA 3HBLA 4JE0A 1GPOL 3EYOB 4LSQH 5HGGS 2QEZA 1Z1WA 4TV3A 4XXCA 4D8LA 3Q01A 1KM0A 1Q9WB 1BCIA 1H9VA 5ABGA 1MYRA 1WA1X 3W85A 1GMIA 3PWPE 4EQ3A 2YPLE 5TQ2L 4EE2A 4V27A 3NGBC 3BWUF 3W0WD 2QF7A 3NSMA 3WD2A 4U6HB 2FB3A 2XGBA 1XZ0A 2WP3O 3VXUB 4O1CA 1R6VA 4J3SA 4UV4L 3ZXAC 5F93C 4O58H 4FLSA 4P4KD 4X6FA 1ASPA 3P30L 4GQRA 1TITA 2YYTA 4PJEF 4A21A 4U1LB 1DQJA 4X5XA 4WUUE 2XIMA 5FO8B 1ZHNA 1JPFB 4XC1H 4YTTA 4WSGA 1CICC 3B7TA 5KVGE 1RJZB 1JPMA 1MQQA 2X12A 2W94A 4Q2ZA 5ACLA 1P4CA 2H1LM 1TZ8A 1NVMA 4TQEL 1YPFA 3GT6A 1I7RA 5K39B 3FK3A 1KB5A 3FGCA 4XP6H 5DCDA 4HNLA 4MQXD 4KJWC 2HCZX 3RJXA 4PJ5E 1I1WA 4M7SA 3DPBA 1SJAA 1BD2E 1VCFA 1W9XA 3C8HA 1QNPA 3GM0A 4NX0A 3DFTA 5IEHA 5LA2A 2K0RA 1UBPC 4P3CH 3QUXD 3WUGA 2BWDA 1U8MB 5D2LB 2WVUA 4B3KA 2BGQA 4PJGF 4I1NB 1MRCL 2X3AA 5F2MA 3T6CA 1NIDA 1SJBA 3S3JA 4ACTA 2CBIA 1SXBA 2VLKD 4HH8A 3QPYA 1UT2A 1SDAB 1BA9A 3HNSL 4KK5C 5HHOD 4GO6B 2HTLC 5ID0B 3NXFA 4P9MH 3AIRA 3CQIA 1HH6A 1U3ZA 3X17A 2EDQA 4UQ9A 3D4GA 3U4BL 2AK1L 1SDYA 1U6AH 1KG0A 1NUGA 3FTZA 3QRBA 4ZJ9A 3WDJA 2Y0FA 3W7RA 1NBZA 3BSZL 4KTDL 5A43C 1P84J 1E5BA 7XIMA 2R27A 3AS3A 4WTZA 5H91A 3WTXA 2Y2YA 4QXGH 2HA1A 4XTRC 1PLGL 4ZFCA 1EJ6A 4XP5H 4ZOAA 3VFSA 1F6YA 4ZB2A 3TK7A 2TRYA 2X88A 5AVVB 3Q8AA 3MRIA 4XBKA 1JWUB 4I6VA 4PGZA 3TIDB 5FA4A 2BP8B 4G5ZL 4Q6IC 2ZE0A 3U0TB 4F15B 1UD4A 1XBRA 3IYLW 4Y6GA 5LCVH 2J62A 4OH2A 1MIML 4XMWA 2ACUA 5EMLA 3NDZA 1WCBB 2XX0A 4YIQA 5DHDA 3MLYH 1OQFA 5LXVA 3GIZL 3F58H 3H4XA 3HBPA 1XF5B 4W9GC 1YUHB 3GH5A 3QFJB 3QUMA 5IW1B 4IM8A 2CZDA 1RMFH 1KIRA 4AQEA 3K6NA 4KMTH 2H4EA 5I5IA 4WI2A 1M05B 1IM9A 3N25A 4LBSA 1JV2A 3HG3A 2Z1BA 2WVSA 3ZRCC 1YECH 3ZKND 1O5QA 5DEZA 2Y5EA 4C58B 5EB9A 3QG6B 4PQXA 2P43B 1BFOA 5HYQA 2RFXA 3GPSA 3SCMB 3GMNB 2O6CA 2CGZA 3ES7A 3T4WA 1TNNA 1J5DA 1XJBA 3KXFA 5J7CC 1REQB 3RIFF 2WVTA 1T2XA 3T2QA 1GJIA 3AWFA 4JPVH 3KJ6H 3WK3A 3S3PA 1IC5H 3TVMA 4K8RL 2A9MH 1T3FB 1ORSA 5MEOA 3BVXA 3W2MA 3KBEA 2VQ4A 2YS4A 1DEEB 2YARA 1SFLA 2VXUH 1R3LB 3DX3A 4LKXB 4TF4A 4NAEB 4G1MB 4DZIA 2K9FB 4GP5B 4NZTH 5D7LA 1Y5XA 3L1OL 2PPDA 4PL2A 1SXCA 2GI0A 5EUKB 3FKUS 2HK0A 5HYIA 4K07A 2XG9A 3YPIA 3TNNA 4I9WE 4PV9A 5JIQA 4YLBA 2MOGA 2GQ8A 5DQ9A 3EB3A 3BKCH 2ZX5A 1DVQA 1Q1JH 4XN8A 4H6QA 5BUPA 2LAGB 2BSRB 1GL4B 4Y1TA 1AG0A 4AIUA 4XWGL 5DRXA 1HKLL 4IJTA 5LG1A 3R4RA 3B2PA 1OAZH 4HLZH 3HFML 1JQVA 5T1KA 3SN4A 3V6OE 4I9JA 4P57B 5CD5D 4YDMA 4PJAF 3E6FB 4P4RA 4I7VA 5BU6A 2X89D 1ET7A 2E3ZA 1RVFH 4XVUD 1W8GA 3ZL4L 3TFKD 3L4ZA 5E03A 3GUTB 4AY7A 2NVAA 2NNCA 3QMTA 1NMCB 1N8OE 5DFWH 1FUYA 3Q5OA 3UOAB 5FGRA 4OZOA 1M5WA 4R5VA 1QNIA 3SY0A 4RDZA 4KEMA 3W2UA 4U1SB 2Q8ZA 3IFPA 4NHUB 4NZUH 4MADA 1RUSA 2XV2A 1TFPA 2F53A 3E8UL 3THQA 1SN0A 4LRNH 1FBAA 4R4FL 2Y8KA 4MVBC 3QDMB 3CNKA 5CSZA 4G7VL 4A6YA 4A3YA 1XTLA 4YLCA 5D8JH 1WBYA 1SYVA 1WFMA 1YDPB 3U6RA 4IGBD 4Y9BA 5DMJB 1EHKB 5ISZE 1LOSA 4O2FA 4URKA 4QRQA 2AQQA 4US5A 1WX0A 4YDNA 2V68A 1ODZA 3LSBA 4P3WA 1BXUA 2DZTA 4Z3GA 1FP5A 2XLLA 3CK0H 3RRXA 1EGMA 1JCXA 4H9VA 2EGZA 3WS6A 3TBTB 2D7TL 4HVXA 2QUTA 1W2PA 3DUSA 2HRHA 3G0UA 3L3OA 2Y36L 4K38A 4I3RH 4B3EA 1W0WA 2G5BB 1CZ1A 4I90A 1PY0A 4FQHB 1MW3A 4DVRH 4JAWA 4OOUA 4XZWA 3GVRA 5B7EA 3FQUA 4GMEA 2X0VA 3L66A 3MJ9L 2BIHA 4LYKA 3OG2A 3RM4A 3MA9H 3LRKA 5DFVD 3P67A 1J7VR 1BIHA 3KPLB 5AVQB 1RALA 4WW1B 5DXXA 1KLYA 1XSOA 2OYMA 4UMSA 4FK9A 4A7TA 3QXWA 1NM4A 5E2VH 3H7UA 3AMGA 1WQ5A 1A1MA 2VWSA 1FWRA 3S1VA 2W0FA 1RCYA 1UJ3A 3UPAA 4FTVA 4KKAC 3KTXA 4B9JA 3H4FA 5KMYA 5IR1B 2VC6A 2A77H 4ZT1A 1H0DB 3GTNA 1K5NA 2BB0A 2OQYA 2A7PA 1CPUA 2ZXCA 3Q1EA 3DVFA 3ECBA 1V6TA 4AV5A 2EDMA 4O16A 4F3HA 4RVBA 1HP5A 1SQ2N 4UOW0 4H83A 3EWZA 3F7QA 4NCC2 2L7UA 2BCKB 1I3GL 1MCCA 3WLWD 2PDCA 3N40F 1BYCA 1AIZA 1PU0A 2A85A 1EERB 2UXTA 3EX4A 4QG6A 3V5DA 4MKSA 4PJHF 2VISA 4FNUA 1KTLA 5I6LA 4GWEA 2GTWB 3WS3A 4R26H 1TETL 3RX3A 3RMJA 1JVLA 3TTYA 3RGVD 3CYJA 3BLIA 3IJEA 3CB3A 3GMMB 2QAPA 3UAEA 2QCNA 4LBRA 1QLEL 1TJHL 1XMEB 2I85A 1SM3H 5FCSH 1JYNA 1K7EA 1AD0A 4TSCH 3B8SA 1EJSC 2Z31A 3AGWA 4RW3A 3ZU8A 2ZA2A 2W66A 4G6FB 3PZNA 3DTXA 3ZJ6A 4DB7A 3Q2LA 5EU7C 3MRLA 3TPUB 1GG0A 3AXHA 3T6XA 3IDJA 3WFEH 5H94B 4O11A 4F7PB 1XCWA 2VLLA 3BAEL 1P0EA 3FRUB 4C6EA 4MNMA 4Z7WF 1RJYA 5EU6E 4KMLB 2FO4B 1B3XA 3TYCA 1AS8A 2CBUA 1K9EA 1RAMA 4AENB 4LF3B 3QO1A 1F56A 2Z92A 2WC4A 5I1EH 2D3LA 1Z6KA 4AG4L 1JGVL 4JGDA 1UWEH 1WA0X 4NDMB 1FHVA 1GTEA 2PU0A 2AGTA 3GFZA 5D1XA 4CD5A 1JHTA 4F40A 1QTWA 1S46A 5B1JC 2YGQA 1J11A 4NO5A 1KIUB 4YE4H 4XP4L 2CJUH 3KBMA 2WNGA 1NPUA 4Z0XB 1ZGLA 2VDLH 2FEEI 1J0KA 3CWNA 1KTNA 1F2JA 3HR5A 4FXKA 1LQ0A 3ZWTA 4BFRA 1D5IL 4IK6A 1VFBB 2X1TA 2HX7A 1VH7A 4X7SL 4S1FA 3I6EA 3EFOA 4Y8DC 3WFCH 4JM2A 4ZMAT 4NGHL 2I16A 4Y2DD 2X7LA 3EH4B 5EIIA 5ABEA 4X2RA 4Y9MA 3NZQA 4E36A 4JKWA 3WLSA 2HTKC 2WLMA 4O2CB 1SZGA 2QVNA 4BFBD 1Z44A 3BZFA 1AANA 4GZEA 5JMUA 1AQKL 4OIIL 4XAPA 2L04A 4Q8VA 4DPQA 3N34A 4BCXA 1ZA3B 2J56A 2PDYA 5H2BA 1IMHC 2QV4A 4DP7X 1DL3A 2Y89A 1TEGA 4QDGA 1DV7A 4K7PX 3S35X 2VDKB 4ZMQA 1S5HA 3UTSA 3SCOA 4AITA 1B4KA 1CDHA 4ONHB 4YHIA 4LSQL 4A2RA 3V9CA 4F5CE 1IIIA 1KYFA 2ED6A 5ACMA 2FX8H 4NN6C 4Q22A 1CCWB 3H9HA 3K6OA 4DYEA 3HLKA 3AUOA 3DXAA 2ICWI 1MDTA 4Q6KA 3RX2A 4LBEB 5I6XB 1XDJA 5K9QG 3AADB 1UUNA 3X3GH 3AZUA 3MRJB 2WXKA 1XLKA 3QZLA 4ANUA 1AH0A 5D7JB 4MG4A 2CFFA 5BVJA 3SRHA 1A49A 1ISVA 4TPRH 2NY2D 4LUSA 2PW2B 1G9MC 4I4WB 2HPTA 1Q6RA 1A5LC 4H9UA 2HLAB 1OD0A 4B97A 2CLHA 5FW6A 4O58L 2A7RA 1NKOA 2IG2H 3PXJA 5I30L 4Q4OA 3HO8A 1OT4A 1JRBA 5I8CB 3I02A 1UP2A 1L9NA 4L64A 2DLFL 1DDHB 1ITBB 1FH7A 3JWNG 3DH7A 4XBPA 2OQJB 4QRPA 2CK2A 3ABGA 3LQGA 4KJYB 3KYMA 5ANHA 4Y9CA 3T4YB 4F7MA 3SE3C 4WTXA 3ZHNA 3B97A 4XWOC 1W54A 3N29A 4DBSA 4GIYA 3SQRA 2QIWA 2WAQA 3BN3B 3ARFD 3OJMB 4K3HA 1KO0A 3NTYA 3FB8B 2J6EH 3RCYA 4RFNB 4JS7A 3S98A 4ODUB 3PBVA 4A7UA 5MENB 4P3CL 1QZ1A 4NRYA 1Z5YD 4ODWB 1TTUA 1GW9A 3QXAA 2K9UA 4JUSA 2Q86B 3BGFB 1FCVA 2CO4A 1JPGA 3W0WA 3OA3A 5A3ID 3VVVA 2YD3A 2NR6C 4UU9B 4CAGA 4YNYB 4Q56A 1RBAA 4Z3TA 1N9PA 1FFRA 2OXHA 1MW1A 3ZGIA 1N0XH 3WUBA 4UIKL 2ED8A 1G7PB 4P9ML 4IBZA 1TWDA 4NJIA 3W2JA 4H44C 4P4KA 1AC6A 4CMMB 4GJJA 1UWXH 3VXRD 4NS0A 2K7QA 4Q74A 3SJVD 2DDQH 2K3HA 4ABUA 4AJWA 3L3JA 3RFRA 4NUJA 3KDMA 1VCVA 4A7VA 4QXGL 4I5UA 4MQ7A 3FB5B 1KFLA 4JDYA 4MA7H 4BKTC 4XIMA 5KYXA 1OC5A 3BCJA 1LDSA 3RI5K 1X8CA 1OY3B 1DJQA 4K39A 1ORQA 5LCVL 3MLTB 2W0UA 1I8KA 1RZFL 1KC7A 5CC7A 1H50A 3MLYL 2W8CA 5KSAD 3F58L 2GK1A 4N68A 1O7VA 4ACPA 3CCHA 3NESA 3TW7A 4RGOL 2J21A 3L2MA 4MJ4A 3EYVB 1LK3H 2XU2A 1BVLB 1RLDA 4BHUI 1ESWA 3QUXA 1E5ZA 2LOEA 3LV5A 3OA5A 4IUGA 1RMFL 4RCAA 1QAPA 1D9KC 4KMTL 1F2QA 4MGGA 4FF5A 4ZQPA 3SPVA 3VXNA 4F7CB 4QGTA 1CC3A 2VLKA 4A2SA 2X70A 3B06A 4HHPA 4KRZA 1NCAH 3QJFA 4AMKH 1JDEA 5JPMC 4JTIA 2YSTA 2P5WB 5HHOA 3VFVA 2ICEB 4KRPD 1PY9A 1H19A 3AISA 1IE7C 1Z5LA 5IF0A 3VTTA 3UP8A 1L0PA 1SBSH 2H2SC 3J8F7 3NIDF 2V2XB 2GJJA 1VENA 4JPVL 3KGRA 4P7LA 3KPSD 3ET9F 2A9ML 4Y90A 3FSZA 4MWAE 2PB1A 3S6TA 1CFTB 1CD1A 3ZXWA 2VXUL 1JZ8A 3M5XA 5F6HJ 2FBJH 3WFAA 4C5ZA 2WMGA 4AD1A 4MMXC 1M2OA 5FCUL 1BQSA 3U48A 4N8VG 5BZXA 3M17A 5DJ0B 1EO5A 2X6MA 4XX5A 4NZTL 5E4AA 1XFBA 2WKLA 2QT6A 3KPRB 5CP3H 4NOBA 5FEBA 1UFGA 5T8GA 4A2MA 4HPJA 4MJIB 1R9ZA 3F7LA 1PUDA 2CRIA 3BKCL 2AQVA 2VLJE 4HW6A 3Q44A 3T81A 4YTRA 5FD0A 1ZAJA 1Q1JL 1FUNA 1SOSA 2G97A 2D73A 4JR5A 1AG6A 3HBGA 3DSFH 4QXVA 2VW7A 1D7CA 5ECUA 4DP1X 2QQLL 4M7TA 3OVUB 1ZP4A 3N13A 1TOXA 4HKZB 4N6RA 3IETA 3O6YX 3BAYA 3U5UA 5FEPA 4IUOA 4JTKA 3VAVA 4QLJA 1JZ5A 2DQFA 1OGAD 1EDYA 5TQ0H 1FZOB 1FLRH 1X4YA 2PEVA 5H6HA 1DE5A 5MHSD 4W89A 4C1NA 4UQCA 1POKA 2GGHA 2VM8A 3EHBB 2ZKYA 1BM7A 2JLPA 1ACXA 2VN5A 4D0BA 4F2EA 1I9IL 2YZ1A 2MFNA 5DA0B 2WSDA 3MNWA 4CU6A 1VJIA 4WXYA 4NZUL 2H6RA 1PLAA 5GS0C 4CW1B 5EOCJ 1GJPA 3IJLA 5LDSA 3US0A 3HGSA 3Q4DA 4JCMA 4QHPA 4TIMA 4AUYA 1BMGA 5D8JL 1WQVT 5DD0H 2JIXB 4IDJL 2RMNA 4HU4A 2ATSA 4GBXA 4Q9BA 4MLSA 4MNLA 1FWGC 2QAFA 2GWGA 5IMLA 5GRVK 1SFJA 2AEPL 3ELFA 4JG0H 4Z3JA 3B2UD 4BFKA 1YNPA 3V0VB 2M8XA 1BGXL 5DJAA 1V0MA 2Y1AA 2Q3XA 5CC6A 3WJLC 4G7YH 1PWMA 3HQ1A 3F2DA 1VFHA 4BFAA 1S7VA 2DQHL 1X6UA 2W65A 3D33A 4AEIH 1MUJB 1I7ZB 4LUTA 3DFHA 3RL2A 2JJTA 1GQLA 3AIVA 1BJ1J 4DVRL 2X89A 3CIWA 4OF0A 4G71B 2H2PC 4GX9A 4FFWC 1EL3A 5BRQA 5EU3B 5E8PA 3BUVA 5HK4A 3HE7B 3NCYP 4K3EL 4AZ7A 2C91A 4AEEA 4PJXE 2WN3A 4IIZA 2XTSA 8FABB 3MA9L 2XPYA 1FE8L 4LV4A 4I2XB 5FW8A 2NXZD 3LDBC 4BEIA 5CEXA 3VD7A 3IFOA 4Z7QB 3BDXA 3C5SB 4KESA 5FC9A 3W25A 4NAQA 4XIAA 4MNHB 1MI5D 3CFNA 3DFOA 2OMXA 4UTBA 5E2VL 3PREA 1GY1A 4N0CC 4WQOA 3KPNA 1VBUA 4OLXH 2VDKH 4UF7C 1AGCA 3EJUA 3LQLA 1L6YA 1W3LA 5JIIA 2B8OT 2ITFA 1JPSL 3MRMB 5LGZA 2ICWB 1NDMB 1TQBB 2A77L 1ZBWA 2V7NA 5E9AA 1B3ZA 1UM5H 3PWPB 2YPLB 4A55A 1Q72H 1JK9A 3GFUA 2BOLA 4FFZA 5SWQA 1EZVY 3EFDH 1HKKA 4HSQA 3TCSA 1GPOH 3VYOA 1X6LA 3RKDC 3F5WB 2JQZA 1JVOA 1MN4A 1CDGA 1YIXA 1LZOA 2ITCB 2FSEA 5DJZA 4N2GA 4Q0XH 1U91A 3UXDA 5IQNA 2DMKA 1J8HB 4R26L 4J3BA 5H37A 5TGBB 3VFGH 4ABQA 4ZA0A 3H1ZA 2EIBA 2IADA 1KJMB 2FD6H 3WHXB 1IKNA 4LESA 2NZLA 3MYJB 5BZAA 1URLA 4KF1A 4N28A 4D6DA 3P0YL 4TSCL 1E1EA 3NSDA 5L2KD 2VAAA 3VSVA 2JI2A 1C9WA 3EKGA 4DP5X 2ADJA 1XDLA 2G75B 1P6AB 4NKIL 2P3YA 1GZHA 4HYVA 1F3DH 1QLEB 2C18A 4WI7A 2JVUA 4QUOA 3VZXA 2W9DH 1MWOA 2R39A 1BAGA 5IB5A 3QHMA 4PN2A 4NQ1A 3C4UA 3P4OA 4BKLB 1FVDA 1BHGA 5E1AB 1RERA 3O8AA 5E9DB 1CX9A 4N2KA 3QUKA 2R9RA 1Q6OA 3UIYA 1HOCA 4LFHG 1G0DA 5IJVB 12E8L 2XDFA 1I8LC 1BWLA 2D7QA 4OY9A 5I1EL 2C0HA 5T3XE 2VRKA 3WEMA 4XOCA 5KVMC 1EXUA 1PCWA 1QR4A 5F8RC 1UWEL 5E4OA 3UZJA 4N8VB 1XRVA 3C6EA 3EYUH 1O9ZA 4X9SA 1BLNA 4ADJA 1X5FA 3TJPA 4YE4L 5EBUA 4LZKA 5J6GB 4L1GA 1MRCH 3IS0X 3UZYA 3VMNA 3ARQA 2VDLL 4QCIA 2B81A 4ZFFB 5DC2A 3VKDA 3RGVA 4XG1A 1Q7ZA 4MD5B 4E2VA 5HANA 5DMIL 4CQAA 2V3EA 2X4SA 1M53A 3G1VA 2ZUMA 1GZPA 3ZSSA 3GC2A 3E3HA 4PBXA 2WHJA 3NGFA 2PPFA 3OL2A 3V5KB 3BSZH 4FEIA 3VC6A 4P5MB 1MWAH 4KTDH 2NDGA 2GITB 4PVMA 2X40A 5EMJA 1KCWA 1PLGH 4NAJA 1SM9A 3L5WB 3U2CA 2DPKA 2HWZL 3D85B 1PLBA 4N5UA 3VH8G 4U6YB 4TQIA 3QFDB 4LHUG 4YSUA 2ISSA 4S3FA 2OYPA 3NNTA 2FX8L 3T9PA 5JIWA 1HW6A 1KM5A 1BYNA 3CDZB 3GIZH 3EO1A 4ZUWB 5I28A 5DSCB 2QGDA 4W4NA 1QW9A 4HUWA 5E08L 4BHYA 2GSIA 3VGBA 1A50A 3UTPD 4XZNX 3X3GL 4HA0A 3VI2A 5AB3A 3W83A 4NZ1A 4UT6H 4KKBC 3UTTD 5DQDL 3WDHA 5HHPA 2YGPA 4TNGA 3UP6A 1WUZA 4PZVA 3CQHA 3A21A 4TPRL 3VA8A 5FKPB 2WV8A 3KL0A 2DBLL 4HJJL 2WYSA 4WI5A 3L3HA 3WFHB 4L4OA 3ARVA 3KXFE 2I9LA 3PM6A 2ZWZA 5CEZD 4DELA 4OV4A 2J47A 5AVWB 2LV4A 3D69A 2FX7L 1QFPA 4N2NA 4Y2DA 5KN5B 1Q8JA 1MHCB 1H8NA 4NENA 4XH2A 4Z0BH 2JXMA 1B30A 3GXDA 3Q94A 1GOMA 3FULA 5DJYB 3LXUX 4K8RH 5I17A 1F3XA 1CXEA 5DWUH 4A7GF 1PEZA 3U0HA 4HMNA 4YLWA 2NW3B 3UWVA 5D7LE 3C6LC 3LKNA 2PP1A 1C1EH 3QNYB 2GABA 4OLEA 4NQXA 5D4JA 2ENYA 4ZO7A 3BRGC 1EJTC 2OTDA 4JX5A 4UV7H 2EDJA 2CLLA 2XGIA 3DFQA 1IR1A 1X8FA 4XNQB 2PWEA 2ZP8A 2A2IA 4ZB5A 2XSBA 4ZE4A 4LLUA 3TIEB 1U83A 1EVTC 2IAND 1I0DA 1YEDB 5HGHA 1HEJC 1T0MB 3GS6A 3PANA 3S37X 5TE6L 4D7PA 3DBPA 4H1LG 4YK4C 3VRLE 2YQBA 3LVTA 1OANA 5CIPB 5GRVL 4ROPA 3QR2A 1C08B 7PCYA 5IHZA 1HKLH 4FZEL 5ECVA 5JQIB 5GJTL 2WBJB 3UAAA 3C5JB 2ZE3A 1N0XL 3KWUA 4MIMA 1HK6A 4M3PA 4LVHC