1AQMA

Alpha-amylase from alteromonas haloplanctis complexed with tris
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
448
structure length
448
Chain Sequence
b'TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystal structures of the psychrophilic alpha-amylase from Alteromonas haloplanctis in its native form and complexed with an inhibitor.
pubmed rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 148
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1aqmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1aqmA01
1GVIA 4H2CA 3PZQA 1W3LA 1BGAA 1ODZA 4J3SA 4PYSA 4MNKA 5I6SA 1LG2A 3ZJ6A 3KZSA 5DF0A 3QOMA 4BQ3A 5C71A 1XD1A 2EPNA 1E56A 2WW5A 1DWJM 1E4LA 4H41A 2OWWA 3VD5A 2XSBA 5M03A 3FAXA 1KXVA 3UERA 1H0GA 5I23A 3LPOA 1KTBA 3WUFA 1AMYA 1KQZA 1MW0A 2HISA 3BAYA 3FAWA 1YHTA 4R27A 1MFVA 3J7HA 4NZCA 1A47A 2O9OA 2YFNA 2CETA 2YL5A 1O6IA 3S5ZA 1CXLA 1QPKA 1UWQA 4E8DA 2VX6A 3D50A 3HZ3A 3W53A 3MUY1 4JIEA 1EGZA 4M81A 3K8MA 3SUSA 4NX0A 1EHAA 2X2IA 2WPGA 2ZUUA 5FL1A 1F4AA 1GQJA 3VGBA 3NSXA 4ZXOA 1UD2A 4JCMA 1KBKA 2J74A 1YQ2A 4UFJA 4PBGA 5A2BA 4X0VA 2FHBA 2DEPA 4GI8A 1W1PA 2VZOA 4KMQA 1RP8A 5FL0A 1CGUA 1WZAA 4MB1A 1H11A 5BXPA 3WD2A 1SMDA 1ITCA 2CYGA 1HXKA 5A6KA 5E1QA 2W92A 1U30A 1SYTA 2XSAA 1FP8A 2OWCA 4UOZA 4AD4A 4HOZA 3LMYA 1ISWA 4CCCA 3WEZA 1D3CA 4W89A 1JDAA 1CLVA 4D6GA 2X05A 1XGZA 1FH9A 4OBRA 4M82A 3AQUA 3VD3A 3BVVA 3AIUA 1Q4NX 3BAIA 3DX1A 2X1IA 5FKYA 4DO5A 3WNOA 4MNLA 1E1EA 4W7UA 2ZOXA 5CZKA 3GH7A 1NWRA 4C7GA 2J7BA 4XZBA 3WNKA 2GDUA 1JXJA 1WO2A 2D3LA 1CBGA 5FCZA 1IZJA 4JFUA 1CENA 1EHNA 2UY3A 2WC3A 4PUEA 1QW9A 2GK1B 3WEMA 1XC6A 5ECUA 3A47A 4S3JA 1QI3A 3EJTA 3SCTA 3PZNA 4PEEA 4ATDA 2O9TA 4YN5A 1HJXA 4QDMA 3W37A 4FNRA 4HZ6A 2EPOA 1E72M 1WKYA 5AYIA 5JIPA 4FLQA 3BVWA 2CXGA 3CUFA 4X9YA 2WVVB 2GJXA 2D24A 3WUBA 2DSUA 2J79A 3W26A 5LA0A 1UKQA 1ZB5A 4AZ7A 2CCRA 2X0HA 3ZM8A 3IJ9A 4CU8A 1G0CA 8CGTA 3OLIA 1C8YA 1H1NA 1ISZA 1OM0A 4CD6A 2XFFA 3GXFA 4AZIA 2E3ZA 1BPLB 3F4VA 1H0IA 3CO4A 1OT1A 4NSBA 2RGMA 5CSYA 1W9PA 4HMCA 2AOSA 3WNNA 2J8GA 3NSMA 4D71A 5I2UA 1W9BM 3WQ6A 2WZHA 3BXWA 2YL6A 4IPNB 2WB5A 1V3MA 3BAKA 1JZ5A 3VD4A 1FH8A 4DUVA 5HBFA 3HG5A 1UG6A 3S5YA 3H53A 4OOZA 4J3TA 1JZ2A 1TUXA 1CECA 1PZ2A 5AC4A 3BLPX 1BG4A 4LQ1A 5D9NA 4EE9A 1DWIM 3N12A 3W28A 1NARA 3LRMA 1UHVA 5A95A 1GQKA 1BVZA 3AIRA 1R86A 1H2JA 4PMYA 2BY1A 4AWEA 3PTKA 4LX4A 1W2PA 3W0KA 3CHCA 1JI1A 3W29A 2YLLA 2QHAA 1H4PA 4D6HA 1V0NA 4YHGA 1MW1A 3BC9A 6A3HA 4PCSA 2JIWA 4WKFA 1GQLA 3WBEA 3UR8A 2DQXA 3LPPA 3NIYA 3W82A 4ACYA 1QW8A 2V3EA 3ZSSA 1TQVA 1XH0A 1G1YA 1KB3A 1TA3B 1EO7A 3PZVA 3CZSA 3D52A 3VGDA 2PWEA 5I78A 3MANA 2AAAA 1CEOA 2GJRA 1QHPA 2Y2WA 1J01A 3WQ5A 3UESA 1UR1A 3AHYA 2A3BA 1C90A 3BVXA 4W8LA 2ALWA 3AZSA 1KR0A 2NW0A 5A8PA 2F18A 2W63A 3CC1A 2YJQA 1CZ1A 3PBGA 1HVXA 4D1IA 4AYGA 4FNQA 1QBAA 4LYPA 4GQQA 3NSNA 3ZJ7A 1V3KA 1V08A 7A3HA 4NZJA 3B8SA 5GNZA 3CMGA 1VFMA 2EXOA 3WFLA 2EO7A 2J78A 4XZWA 3VM7A 2ZX9A 4JKLA 4IUGA 2VR5A 3N18A 4RL3A 5IFPA 1GJWA 1X1NA 2W5FA 1MQPA 4B15A 2ZIDA 3EBVA 3BVTA 4UOJA 2PWHA 4DO4A 1HJUA 3A4WA 5GNYA 3N1AA 4CN1A 3WDJA 4WJXA 3G6MA 4GKLA 3ZR5A 1D7FA 1M03A 2VCCA 1M01A 2DT3A 1HJSA 2XVKA 1LG1A 2XVGA 1V6UA 4HPGA 3WFZA 3JUGA 4Z2KA 1OSEA 3ZR6A 4K68A 4Z2IA 1GNXA 4URIA 2AMGA 4HTYA 5CGTA 4XUYA 1XCXA 1PEZA 1HKKA 3WY2A 2EPMX 4BQ4A 1XSJA 4L4OA 3DDGA 3MUZ1 5A2CA 3BMVA 1GPFA 3OLDA 2J7FA 4GZIA 3L4ZA 4J28A 2OYLA 3VIFA 2Y8VA 5CSUA 5C8BB 2D0FA 3WIJA 5DT7A 4BQ5A 3U57A 3AISA 3QGVA 3S2CA 3GNPA 3TA9A 4PTXA 3VDAA 2FHCA 2PWFA 4UNIA 3VUPA 1M04A 1I1XA 3B9DA 1RPKA 1DWFM 4JFVA 3CZJA 4IISA 3BUPA 5BWFA 4LYRA 3TTSA 1JZ6A 2D1ZA 3N17A 2J77A 5EB8A 3GBEA 1E5JA 2CHNA 2GK1A 1GOWA 2V5DA 3T0AA 1EOMA 4B16A 3MV11 4Q7NA 4ATWA 4CGTA 2WCAA 3AS0A 3THCA 3KEHA 2YKKA 3QOKA 2XTKA 4CCEA 2B31A 3IK2A 3LRKA 2GUYA 2DH2A 1RD6A 1J10A 2WANA 4P7OA 1ZBCA 1GOIA 3WQVA 2QPUA 5A6BA 3D4YA 3CUJA 2WVVA 3AHVA 1I1WA 4Z2JA 1E9LA 5E6YA 1WDQA 4PMOA 2ZUSA 2YOCA 1B9ZA 3MMDA 5BXTA 1LF1A 1H49A 1B3ZA 2PI6A 1C7TA 5EMYA 1E4NA 4P7RA 3WD4A 2YIHA 1C93A 4CD5A 1NQ6A 4D6JA 4QLKA 2VO5A 1R85A 1W9XA 1HKJA 5EFFA 2XIIA 1GOOA 5BRQA 1V0MA 2BFGA 4W8BA 3CHFA 1FOBA 3AXHA 3VDCA 3SCWA 1UWRA 3WDHA 1J9YA 1HN1A 1NP2A 3WH6A 1CGWA 4AC1X 4NXSA 5DO8A 1VJZA 5KZ6A 1R47A 2BHZA 5I24A 2D20A 1VEMA 4UR9A 1ZBWA 3WDRA 1SZNA 1H5VA 1OIMA 4DUXA 1HF6A 3AMCA 3AS2A 2BS9A 3CH9A 3WDQA 1CXKA 2WVUA 3DYPA 2E9MA 4S3KA 3BSGA 1R46A 1MW2A 2J62A 1NOWA 1TMQA 5IFTA 4OZOA 1UKTA 4H8HA 4WF7A 1T0OA 2ZICA 2ZWZA 3W6MA 1CGVA 1X6NA 2D0GA 1B1YA 1JDCA 1PX4A 2VZUA 1EDTA 4UFLA 4WIWA 1V02E 4M56A 1B31A 7CGTA 1C8XA 2E9LA 1UUQA 4UFKA 3SCQA 2YBTA 4FLOA 3D3AA 3ZMRA 4TVCA 3VIPA 3WH5A 4BQ2A 4HA4A 1TA3A 4HU0A 3SUWA 1BG9A 5JBDA 1BYCA 5FOOA 1NP0A 3PZOA 1UWUA 1WB0A 2BXYA 2BVTA 2Y8KA 1JIBA 4GQRA 9CGTA 4QLLA 5D8ZA 4CVUA 3QHMA 1CGTA 2CBJA 3GXIA 2F61A 2CBUA 4AD1A 4E2OA 1ECEA 5I79A 2WVTA 3D51A 2QMJA 1UZ1A 3AIWA 3PZUA 1H3GA 3W81A 3CPUA 4HOWA 4UQCA 3WBAA 1E6ZA 2PF0A 5DEZA 3CZGA 4XV0A 5JBFA 1HIZA 3PTMA 1V03A 2IUZA 1DTUA 5BRPA 5BROA 2X2HA 3IJ8A 2FH8A 3H54A 3OGRA 1TVPA 1NM9A 1ZBVA 3PHAA 3BGAA 4CN6A 1JDDA 2Q8XA 1AQHA 3AHTA 3VPLA 1QI4A 2WMFA 1FP9A 5EFDA 3U7VA 5HXMA 1H09A 1HJWA 3MSDA 4MDPA 1JI2A 2BHUA 1W9UA 2IXVA 4M24A 5HPCA 1CIUA 3ZT5A 4FLSA 3DDFA 4GI6A 1WZKA 3E1F1 3IGUA 1AQ0A 1KQYA 3RJYA 5A3HA 3MO4A 4TVDA 1KXQA 1UR0A 1ISXA 2VURA 4CU7A 1UD8A 3O9NA 3BMWA 1GCYA 1GW1A 4TTGA 1R33A 1CLXA 3AS1A 3BSHA 1PS3A 1EO5A 2F7OA 2WKGA 1QHOA 1UA3A 1G5AA 3POHA 1XSIA 4W87A 1C91A 5A94A 3AS3A 1WZMA 1V3LA 3ZT6A 2PBGA 3RO8A 2D2OA 4MDOA 4BF7A 1L8NA 4WSJA 4HA3A 1XV8A 3ZJKA 3PZMA 4PMXA 2WMHA 4Z2HA 2EEXA 4ZEPA 2ZX8A 2CEQA 3GZAA 1WPCA 3HU7A 5D9MA 2PC8A 4AMWA 3SCRA 1LL4A 1M53A 3AMKA 4W5UA 4ATLA 1Y7VA 2G41A 4F9DA 5I0DA 3IJ7A 3A3HA 3ARVA 3II1A 3WH9A 5M5DA 1UR2A 2DGAA 2IXUA 2X0YA 2WMKA 3KL3A 2BV9A 3WUEA 3LPGA 1CTNA 1PZ3A 1BYAA 2E8YA 2DH3A 1JZ8A 3GNRA 1Q6EA 3WH8A 1TQUA 3W6LA 1UASA 1JFHA 1Q6FA 3LRLA 2A3HA 2G3JA 3VINA 1OGGA 4J7RA 1C92A 2WHKA 3VGFA 4AEFA 2YA1A 3CHEA 4AD0A 1ITXA 2XFYA 1K9FA 2UY2A 1QWNA 4QCFA 3MU7A 3PZIA 1E40A 2WWDA 4RE3A 4Z2LA 2F7RA 1CXEA 2GJPA 1J11A 3GNOA 1JF6A 3A4AA 4DWSB 4CUCA 1UWSA 2YL9A 3OGVA 1QBBA 1L0PA 2J4GA 4AIEA 3I3BA 1QX1A 4JFTA 3F5LA 5E09A 1CDGA 2XUCA 1UZ4A 3TONA 1MVYA 4R5EA 3BVUA 5GPRA 4WLCA 1JFXA 3ARXA 2GVYA 2D22A 4UZSA 3K8KA 3EYPA 4TX8A 3WF3A 4CVWA 2J7DA 2J7EA 3OB8A 2VZTA 3SEPA 2ZXDA 4UQAA 5JUVA 2JE8A 4MB5A 5BCAA 3ARSA 7TAAA 1E6NA 2WMIA 3OZOA 1V0LA 1VFUA 1XSKA 2VQUA 4DO6A 4JHOA 3W38A 3WQ8A 4BCEA 2Z1SA 1J0ZA 5TD4A 5CJ5A 4HMDA 4A4AA 3VTRA 4AEEA 3NDZA 2JIEA 1MQQA 3BCFA 1DWHM 3WF4A 4W86A 4DM2A 1E73M 4PMDA 4AXNA 3ARYA 4DM1A 2ZXAA 1UQYA 4F79A 3BCDA 2F1BA 3MMUA 3POCA 5ABGA 4AIOA 1QOXA 4EANA 1DWGM 5LA2A 5D4YA 4LPCA 3N13A 4GZJA 4HOXA 3W4RA 1UD6A 2JEQA 2VZSA 3CZEA 4GO9A 2XM2A 1JZ4A 3EDFA 3AJ7A 4EAMA 4B9YA 2DSKA 3RIKA 3WY1A 4MB3A 1ESWA 4Q22A 1B30A 1B3VA 2ZX7A 5HDRA 4KH2A 4E8CA 1VBRA 4MTVA 2CBIA 4UTFA 2XGBA 3VOCA 1VEPA 2D3NA 3DHPA 5I5RA 1QVBA 1SFSA 1UKSA 4PUDA 5I3DA 2QV4A 5GQBA 3A5VA 3ZOAA 3WQWA 2D0HA 4FK9A 3RPMA 1E6SM 1UH3A 4H8VA 3GXPA 1TQWA 1B3WA 2G8ZA 3WKZA 4J3VA 3EJSA 2J7HA 4W7VA 3D5HA 4W5ZA 4D6FA 4IM4A 3TOPA 3VD9A 2ZXQA 1ISVA 4P7QA 4B3KA 3BAWA 3UG3A 5A6JA 2ESCA 1FA2A 1U2YA 4AY1A 3HN3A 3M6DA 1V0KA 4KWUA 1UYQA 4D1JA 4JCLA 1JYWA 2W62A 4J3UA 4GZEA 2WLYA 3WNMA 3VDBA 4J3WA 4TTUA 2DDXA 4CN4A 3KLLA 4HU8A 4PN2A 4ZE5A 2HVMA 5IDIA 1UA7A 2VJXA 2NT1A 2VI0A 3T08A 2XG9A 1E0XA 3VVGA 4UZUA 4GXPA 2QMKA 4BZYA 2VVSA 4RE2A 2IGTA 2X2YA 4WK9A 5IXEA 4PCTA 1UKPA 4UCFA 1US3A 2WBKA 3MS8A 1K9EA 1BLIA 1PJ9A 2VRQA 1WZLA 3RMEA 2WKLA 3NCOA 3CUIA 4P7LA 4D6IA 5FIPA 1UR4A 1XYZA 1XH2A 1E55A 3SIMA 2XWEA 4M1RA 1R34A 4HZ7A 3VD7A 1CXHA 2EACA 2NT0A 1VBUA 3L4XA 4AIUA 1XH1A 1E43A 4DWSA 4U33A 4DWSD 1WP6A 1JL8A 2UWFA 4KRUA 4XX6A 1RH9A 1W91A 1CNVA 2VT0A 2FDMA 2OSYA 4U5IA 1HKMA 3VM5A 4HP5A 1KR1A 2VOTA 5CPQA 1QI5A 2YA0A 1B0IA 3CIVA 4JFSA 4CD4A 3NUKA 2ZE0A 1QNPA 4MNMA 1NOFA 3HG3A 3A24A 1J0HA 1UOKA 3TTQA 4JL2A 1OGBA 5A6SA 4PMZA 4PSPA 1TFVA 2OLHA 2WSKA 2E40A 1B2YA 2DT1A 1HXJA 1W1TA 4Y7EA 4PTMA 3H55A 5CLTA 1EDGA 1SR0A 1B90A 4AISA 5A6BD 2ZX6A 3WY3A 4U31A 4L4PA 3FW6A 3RILA 1DEDA 1VEOA 5C70A 1HL9A 1Q6CA 3F5JA 1ZU8A 3SURA 2JEPA 3GBDA 1TQSA 4J3XA 1GOQA 4AW7A 3T2OA 5A69A 2C8NA 3AOFA 1BVNP 1EQPA 2X8RA 2WMJA 2DIJA 3VU2A 3AIQA 4YPJA 1MW3A 3TTOA 3TTYA 2CHOA 1IT0A 3BAXA 1J0IA 4TVUA 1PX8A 1V3IA 3VMOA 2CNCA 3VNZA 5FD0A 4P8UA 4P8VA 3SUVA 4U2ZA 1J12A 2ZX5A 3DX3A 3WD1A 3BLKA 3WDPP 3QHOA 4MJ4A 1NWSA 3VX0A 1UWIA 4MAZA 1HL8A 3BUIA 3EMCA 2Y4SA 1BYDA 3IAPA 4H7VA 4W88A 2VX4A 2GDVA 3LX9A 3LXCA 2E0PA 4FF5A 1IZKA 3VSVA 3ZSTA 3ALFA 4QFUA 1HWWA 1W1YA 2Z1KA 1B3XA 5CPTA 4TX6A 3ZJ8A 3M7SA 3VO0A 2CERA 3DYOA 5DT5A 2J7GA 1R8LA 5AC5A 3OLGA 1Q6DA 3WD3A 1E5NA 5DFAA 4HZ8A 3VSUA 1C8QA 1XCWA 1BFNA 2WLZA 3EJUA 3OZPA 2WC7A 1UWTA 2OW7A 4MJ2A 4PMNA 2UY5A 1ZL1A 5HOSA 2G3MA 3PZ9A 1JYXA 2YDRA 2XGIA 3DHUA 1UKOA 3AYRA 2WVSA 3WF1A 3LXBA 2E9BA 5ABFB 2YLAA 1V3HA 1JGIA 4V28A 3WUGA 4PMUA 6TAAA 1R7AA 1JG9A 1OB0A 2VL4A 3FHAA 3CV5A 2RGLA 3WELA 3I3EA 3NJ3A 2W67A 2PWDA 3A6OA 1WDSA 3LXAA 2GJXB 1BTCA 1EOKA 3GYCA 3ZO9A 3UEQA 3VILA 2OYKA 4HPHA 3T2QA 1NWUA 3ARQA 4ZXLA 4OBSA 2CIPA 2V3GA 2XFRA 1G94A 1XHGA 2JALA 5HPOA 1A3HA 2VZVA 1MYRA 3UR7A 1H41A 4GI9A 3N15A 1CXIA 3VGHA 1HTYA 4TOQA 3ZT7A 4D6EA 3K46A 3CLWA 2VX5A 4IPLA 1J18A 3ZQ9A 3AROA 1OD8A 3OG2A 3KE0A 4AZBA 2BVDA 3W24A 3KWXA 1ZJAA 4JZ5A 1OT2A 4FNTA 4M29A 1K6AA 3KL0A 1ZBKA 3CMJA 1V02A 1E70M 3KLKA 2FH6A 3QHNA 3CZKA 3GM8A 2DSVA 1TCMA 2J7CA 1VB9A 3AFBA 1HJVA 3VNYA 1D2KA 5A8MA 1O7DC 1DWAM 3VGGA 3SCVA 2J75A 1MWOA 1UD5A 3RJXA 1GQIA 3SUTA 3GXDA 1TE1A 1W3KA 1OBAA 2DT0A 2CITA 1LWJA 3AICA 3KL5A 4EK7A 4D6DA 2JFEX 4H04A 2WC4A 2XJ7A 4ZFMA 3WF0A 1R75A 2XVPA 1WAWA 4RE4A 2ZUMA 2DSZA 1OGSA 1RP9A 2YA2A 3ARTA 3VDHA 1CWYA 3EDJA 2ZUWA 3SCOA 1EA9C 2V38A 3BUBA 2V3DA 4OOUA 1GVYA 3AMDA 1KFWA 1QI0A 3AI0A 2XIBA 4QP0A 2FHFA 2XVNA 4MPKA 2CPUA 4M8UA 2ZWYA 2XYLA 2WZIA 1JD7A 2F7QA 3OGSA 1QNSA 3WF2A 5E0FA 3PZTA 3VIHA 3N11A 2BHYA 4FLRA 4GIAA 1V6WA 2VTFA 3VIMA 1JZ7A 2BY0A 3O2LA 3FN9A 1KGUA 4MAVA 4C7FA 3VIOA 5ABEA 5A2AA 2YFOA 3K4AA 3L4VA 4AZHA 3GXNA 4JKKA 3HG2A 5JBEA 1JXKA 2YL8A 2F8QA 1CYGA 4UFMA 4W7WA 4QLJA 2VQTA 3CHDA 4XB3A 1UR8A 1LWHA 2G3IA 4PSRA 5E9AA 1BQCA 3VIGA 4ML4A 2EPKX 2O92A 3K4DA 1GONA 4AZCB 3NDYA 2DT2A 3DECA 3DX4A 4C7DA 1VFOA 8A3HA 1QWUA 2A3CA 4UQ9A 2G4FA 4PMVA 4ACZB 3IANA 4UFIA 1OCQA 5EBAA 1E4IA 3GH4A 3WMBA 4PMQA 1E0VA 3OLEA 4GPNA 5LYRA 1DP0A 1MXDA 2NSXA 4CU6A 3RCNA 1ISYA 2OSWA 1ODUA 4WSKA 3OA5A 1ZS2A 1NH6A 3W25A 1HVQA 1GOMA 1BAGA 4KGJA 1NWTA 4PRWA 2GSJA 1US2A 1DHKA 1WDPA 3SUUA 4AD3A 3L2LA 3ECQA 3ARUA 4AMXA 4PTWA 4AZ5A 1EIBA 5ABHA 1UH4A 1JD9A 3L4YA 1LLOA 2CBVA 3PN8A 3B9EA 4GO8A 4UOQA 2UY4A 2E8ZA 3WENA 3PTQA 2XWDA 5CXPA 1W1VA 2VVNA 3FNDA 2DPEA 1GOKA 2WM0A 4P8XA 1QNQA 5ABFA 4P7NA 3RDKA 1C7SA 4OUEA 4KGLA 4AD5A 1LJYA 1KGWA 1ZJBA 3ARRA 4FNPA 4EKJA 2WZEA 3AXXA 3L4UA 4W93A 4FNSA 5A6MA 4FNUA 1C3FA 4MADA 2EJ1A 1GORA 4AMCA 1AVAA 5A8QA 1B3YA 3IAQA 4V2XA 1WCGA 1OINA 2BY3A 2MANA 1QHZA 2VCAA 2XHYA 1NOUA 2ZUTA 3BUDA 3AZTA 2CKRA 1BF2A 2W91A 4AD2A 4GINA 3EJRA 4J27A 4CD8A 3EMZA 4MB4A 3GH5A 1OWQA 1KXTA 3G6LA 1JAEA 1TZ7A 1V6XA 2WWCA 1QNRA 3DX2A 3FY1A 3T0BA 4U3CA 3QR3A 3U7BA 1GUVA 4DWSC 2VR4A 2QF8A 2WCGA 1GJUA 5LA1A 3A22A 4OKDA 3WY4A 3TP4A 4N0RA 3UG5A 4W84A 5A8NA 4UFHA 4BA0A 1HNYA 1WNOA 2Y5EA 1JZ3A 1E15A 4MNJA 3GXMA 2PBOA 3K1DA 5BXRA 3RM9A 3ALGA 1W9VA 2WSPA 2W66A 3MKKA 3VMNA 4U3AA 3WMCA 3SCPA 1JF5A 3AMLA 3TV8A 1TG7A 4U5KA 3MUIA 2G3NA 3OBAA 3DYMA 3L4TA 1HJQA 2BNJA 3AXIA 3SCNA 5BYWA 2WBGA 1P6WA 2C0HA 4H8UA 3T09A 3M46A 2WK2A 2D73A 1OIFA 1GHRA 1I75A 2JF6A 5E70A 1V3JA 2V5CA 4CCDA 2W61A 3AIBA 1VJSA 1AQMA 2X2JA 4NXKA 3A4XA 4OGZA 1F4HA 3U5YA 5M3WA 4LYQA 1CPUA 2BY2A 2WAGA 3EJPA 5IHRA 2W4XA 4B3LA 2VUYA 1WE5A 1E3XA 2EABA 3CZ8A 1FHLA 3WSUA 2OSXA 1G01A 3CZNA 1HX0A 3AHXA 2J47A 4QAWA 3DX0A 3HG4A 1Z32X 2TAAA 1JNDA 4ZENA 3WD0A 5D9OA 3FHQA 2XN0A 2CKSA 4PMRA 2OW6A 3CUHA 1EXPA 1WDRA 3DC0A 4AZ6A 1HP5A 2F1AA 5CPSA 1O7AA 4NRSA 1J0JA 3WMSA 1OD0A 3AHZA 3U5UA 5M17A 4YHEA 5HNNA 4AZCA 3VGEA 1IV8A 5AY7A 3NYDA 5DMYA 3VIKA 2F2HA 3K8LA 1FFQA 2XPKA 2F7PA 5D8WA 4ACZA 3BUQA 3AIEA 3WL1A 2QLYA 4NI3A 2WXDM 4D72A 2YDSA 3S6TA 4W8AA 4F9JA 3B9AA 4E4PA 3OIHA 1U33A 5GNXA 2VX7A 2BVYA 4OJYA 2D23A 2WMGA 1LQ0A 2VCBA 1FH7A 5A6LA 1PIFA 4OIFA 3SCSA 2EPLX 3WDIA 1VFFA 2CESA 2X09A 2VC9A 1CGXA 5CGMA 3D4ZA 3L2MA 1PBGA 1M7XA 2WHLA 3M07A 4F66A 3A23A 2YBUA 1JYNA 5JIWA 2XN1A 3EJQA 1VF8A 3I3DA 1XD0A 2VRKA 3AZRA 1CXFA 1J0YA 1W3JA 3ZIZA 3VX1A 3MMWA 2WCSA 4NRRA 1KCKA 2EBNA 1MXGA 4U2YA 3WEOA 3GDBA 2J8FA 4NZFA 5AYBA 4NF7A 3MUAA 1BYBA 4AYSA 1EDQA 1Q6GA 1E6QM 3RM4A 2A3EA 1FFRA 1SMAA 2PWGA 4DUWA 5A6AA 1MQRA 4ZE4A 2VNCA 1XRVA 4WKAA 5A1AA 4F8XA 3O6AA 3WNLA 3RM8A 1JNEA 1GZJA 4X0NA 5I77A 1BSIA 1J0KA 2EQDA 2XN2A 2DIEA 5E6ZA 1GHSA 1CGYA 3AYSA 1E4MM 4Z2GA 4JKMA 1TVNA 1K9DA 2FYVA 1R87A 1UR9A 1PPIA 1E6XM 2BXZA 2E4TA 1HKIA 1KBBA 1E71M 3SCUA 2JF7A 1LL7A 3F5KA 3EDEA 1K9TA 1QNOA 4B9ZA 1W32A 3VIJA 3EDKA 3GXTA 3APGA 4JL1A 2FGLA 2WHMA 1LL6A 4P8WA 2ZUNA 3CZLA 2FGZA 1TR1A 2DSWA 1R7OA 2O9RA 2WHJA 5IHSA 3UETA 2XM1A 3LPFA 4FMVA 4D6CA 1V6VA 1UD3A 4AZGA 1VIWA 3WH7A 3L4WA 4WKHA 1VRXA 1KTCA 4LGXA 3MSGA 4M80A 1JAKA 1UD4A 2A3AA 3T0DA 1V6YA 1W9DM 4CD7A 2O9PA 2WYSA 4JFWA 3CBWA 1UH2A 5F7UA 3CUGA 3N9KA 1JYVA 4N42A 3AMGA 2GFTA 2XVLA 2FE0A 2OWXA 4A3HA 3WQ4A 3BH4A 4HMEA 3WL0A 4KRTA 3VMPA 3T2PA 2WMIB 3GTNA 3VKKA 2J25A 1TQTA 1S46A 3VSTA 4JAWA 3EMQA 5CLWA 6CGTA 1W2VA 1PAMA 4BS0A 1KGXA 2V3FA 4UQBA 1VAHA 1PIGA 3ARPA 5CQ1A 3WN6A 1EQCA 4QCEA 1E6RA 4UQDA 3ARWA 2Y24A 1E0WA 5CG0A 3VIIA 1BGGA 5D9PA 3MI6A 1XYFA 3FXYA 4V27A 3MV01 5E0CA 4PTVA 2QPSA 4JHZA 1EH9A 1HT6A 2VMFA 1VENA 2C7FA 3THDA 1FHDA 2VRJA 3UG4A 2YDQA 3BAJA 1E1FA 1PX3A 4TXEA 3UCQA 2ZUVA 1KCLA 1N82A 3CTTA 1QI2A 2PB1A 1HP4A 1KWKA 3W27A 2ZXBA 3PZGA 3HMCA 4HA1A 1G9HA 4LXFA 1MFUA 1KWGA 5A8OA 5KEZA 2WNWA 1UQZA 2EADA 4TUFA 2OYMA 4W85A 3N04A 3A21A 3HJEA 1E6PA 3AIVA 4CKQA 1X6LA 3EDDA 3ARZA 4UQEA 1E3ZA 1W3HA 3WNPA 3CGTA 5BXSA 2EAEA 1BHGA 1KXHA 4A3YA 3BLBA
chains in the Genus database with same CATH superfamily
4LCIH 2BVOB 2XJLA 5I26A 4GS7C 4B2DA 3NURA 2F74B 2P9RA 5JXED 3VQ2C 4GAAA 4PJIA 1FDJA 3W7OA 5DK0A 4K3EL 4AV4A 3ZVHB 3CMFA 1T3FA 2AVFA 1J8HD 3UJFA 1R1CA 2BNQA 4B53A 1QPKA 4GA8A 4U6VL 3LNDA 4R2GD 2PUZA 4AIBA 3FQNB 2DW7A 4N02A 4XCFL 2ONEA 4AB4A 4BHYA 1RV8A 2VISA 5T3ZH 2R1NA 1YQ2A 2UVFA 4NZUH 4FQQB 3GG8A 4M7KH 2VZOA 3FQWB 5KSAA 4Y2DC 1RP8A 3VXOA 3NAVA 4LCWA 4GRLA 3NQDA 1WFIA 3IPFA 3VE0B 4DGWC 1I9EA 4L1BA 4PCFA 3UA3A 1JCMP 1HXKA 1N8ZA 3OU8A 2W92A 5E1QA 1U30A 4H25A 3IGAA 4KVCL 3LS9A 4AD4A 1Z3GH 2NOYA 1ZT4B 3WEZA 1CLVA 1ZCRA 4O58H 1WUFA 3DX1A 4ZO8A 1DVJA 5DXWA 4DO5A 2Q7AA 1ZHLB 4LAQH 1NWRA 4XAYA 3WNKA 3S0CA 4WKXA 1JXJA 2D3LA 5KYYA 4NP7A 2UY3A 3T3PE 2WQXA 5KW9L 1M5WA 4E5TA 3T5WA 4J1UA 3HE7D 4MQ7A 2CXGA 4JZJB 4H4NA 4Q74A 2WGNB 1KPRA 1ZB5A 1U91B 1SLWA 4F9LC 4QAMB 3TNMB 3M17A 3QXDB 3ANVA 1Q7QA 2X12A 1TPFA 2NVCA 2OK0H 4CD6A 5E6ID 1URIA 4NSBA 2GB2A 1AGBB 3CFTA 4BH8A 1DBJL 1HHJB 3ARGD 3FYIB 3CBJB 2YUWA 2D3JA 1E6OL 4XKYA 4E41E 4IPNB 1GYMA 3ZR4A 1BYNA 3TVMA 4I0PA 4J3TA 1TUXA 1CECA 1W3NA 1VHCA 2P8LA 1FLRL 1BQHA 1JGLH 4L64A 3W0KA 5B4MD 1IGJA 4DGYL 1CLOL 4F7TA 3GS6A 2BVWA 3R25A 1VZGA 4PCSA 5D2LB 1KLGA 2BDNH 1ZE3C 2G5RA 1HZYA 4ZXBC 3VG0L 4NIYE 4LPYA 5E56A 3TX9A 2ALWA 4YC2C 5E2UL 2F18A 3D0VB 4PI2A 5I1EL 2APXA 4LYPA 5EEVA 5LGJB 1KB9K 1SLUA 4X8XA 3KDMA 1G7JA 2W5FA 3ABQA 2HA1A 4H0LC 3A4WA 4ZX6A 4YU1A 1HJSA 2XVGA 3GX9A 3I6GA 3SY6A 1YBQB 5FXCH 2AMGA 2XXFA 2Y62A 2QIIA 5LHEA 5AW1B 2QDGA 1PEZA 5DI8B 1UPPA 5DVKA 3MTWA 3IGLA 1CWVA 2N0MA 2UUDH 5A2CA 2O4EA 1GPFA 1OFQA 2F54E 1S3RA 3Q6FA 3MLTB 5FGSA 3E9UA 1KIQA 4P2OD 5B22A 4X6DA 4DHLA 1VBJA 3IB4A 3BJTA 4MD0B 2VDHA 2P28B 4PULA 3S46A 2WUCL 5L4IA 1FIGL 2CHNA 2EYTA 32C2B 4L1SA 2GK1A 1KB5A 3VYOA 1KJVB 3THCA 2BNRA 1YPFA 3QDME 1T1WA 3GTVA 5E2TH 4FQCH 4Z2JA 5E6YA 4QGCA 1XDJA 5LXVA 3PFMA 3S9ZA 1FDLH 1VLWA 3DSNA 1C93A 1NQ6A 3GZPA 3A6BH 3G1SA 2X9WA 4OD3H 1N0XH 1EFZA 2ADIA 1IB5A 4X0KA 1SOQA 1FOBA 3GZQA 4QKTA 4KWSA 3DU0A 4Y4FC 3VFOB 3WUZA 2FQEA 1VEMA 1N12A 3PIQA 2BS9A 5J12B 4BRJA 2DV6A 1LXMA 3UX9B 5FJOA 3N6QA 3EZ8A 4JNYA 3E9AA 1FH2A 2Z35B 3MBEB 1PMYA 1QW7A 1EDTA 3K74B 4YLQT 5HYJD 1PZUB 3HMXL 4R84A 3FUJA 4HEMA 4FLOA 4MUPA 2PDHA 2NLJB 3X3FH 5E8DL 3OXSA 5LWYH 4G8FA 3B34A 1FUNA 2DLIA 1RZGA 1LEKA 4QLLA 2PTDA 1OYAA 1DUYA 5HMDA 1YTEA 5KVEL 2V5MA 4XV0A 1Q6OA 4NNCA 4Y1AD 3IVKB 1OANA 4CN6A 3OVQA 4ZQCA 4JPSA 2X44D 1ECZA 1E8ZA 2ZZ4A 2WMFA 5HXMA 1AIFA 3MSDA 3ALWA 3ZT5A 4B4FA 2A1YA 4RGOL 3ZL4H 4PY8J 3CT7A 2UZYA 2CUHA 1CBVL 2ZRYA 4NNBA 1OP3H 1BXCA 3ETBF 2J9ZA 4Y5YB 5FW8A 3L5WA 2ISDA 5EBMB 2RDTA 1YW1A 1MY7A 4DF0A 3S3GA 2W94A 4HIIA 1YECH 5ENLA 5C0CE 3E96A 1XV8A 4Z7WF 4Z7UE 4EIZC 2WMHA 5DJXA 3MPCA 5FM4A 4HLJA 3O0LA 2WV3A 1M53A 4LVOB 1GZ1A 2BMKA 3ARFC 4F9DA 5CGYD 4KKZA 4HCDA 3WUEA 3LPGA 1H50A 1LDPH 1ZA3A 3GNRA 3O9WA 4JTHA 2X2UA 5HHOE 2ZWSA 3MYJA 2ZAGA 2G5BB 1S2TA 1YUHB 3MFFA 2H9GA 5FGBC 1RULH 5AL8A 5CFHA 4GAJH 3TH6A 4IMEA 4M6PA 5DQJA 2HJPA 1N8FA 3EZ4A 4PTTB 4GMEA 1JWUA 5F2LA 4QXIA 4X99B 2M26A 2VLJE 5FYKU 5CEYA 3BWUF 1AR1D 4PJ9B 3A4AA 1PEWA 1TTAA 2R0KL 4N85A 4A37A 1W0VA 4LLUA 1FHVA 1NCUA 3NFPA 4KVPA 1EJFA 4KZ0A 3TCTA 5DHEA 5E4EB 5D55A 1PG7H 4OFCA 5GPRA 2R4SL 5CF3A 2NXHA 3OMNB 5IFHL 2PRHA 1RZ8B 4OLZL 4P23B 4MB5A 3ARSA 3JXAA 5T3ZD 2OZ4H 1ICTA 4PRNB 3OZOA 3CUPB 4GAYB 4DO6A 3BEWA 3IFNL 4LEBA 4JZNB 1XF4B 1E6JH 5CJ5A 2F7FA 4P06A 2IKGA 1GGIL 4O14A 3CCHB 4X7SL 3RBGA 4HS6B 4K5NA 4H5SB 5EU9A 3AGWA 2J2ZA 2EDYA 3P14A 1O1ZA 3KWWA 3MNWB 3VKDA 1XISA 1HILA 2NY0C 2D2HA 35C8H 1VFAA 4OKVB 4MZ8A 2E7LC 2WLIB 1A9VA 1AI1L 1UD6A 2JEQA 1ZWIB 4YHNB 5ERWB 5CPNA 1WXYA 1PL3A 3GSQA 3VFMB 4M4RB 5EGRA 2V9DA 2FTWA 4G6FD 1KELH 2NW2A 3TM6A 4G9FD 3QIBC 3MVSA 4MCNA 2AXFA 3LRSA 3P60A 1EEUA 3PPFA 3HE6D 3W7PA 3W2UA 4EVNA 1KB9J 4N24A 4J3VA 1IARB 4O0QA 2D4FA 1OAXH 3TOPA 4M5SA 4PJAA 3UG3A 4AY1A 4JEGB 4PR5A 4RZBA 4GY7A 3LQLA 2CDGA 2CRMA 2X4SB 5IVZA 4K8RC 1A6UH 5DHYA 2B7OA 5EULV 2OMWB 1GVQA 4G71B 2QZ5A 5EZOH 1AGFB 4FIRA 4PN2A 1U42A 1XWYA 1TUPA 4LVNB 3DIPA 1TJHL 1ADOA 3M0XA 1F1GA 4HUXA 2HJKA 2QEZA 3NIFF 1I7TB 2LLNA 5KBNC 3ITXA 4P7LA 3PB0A 5IMMA 1XH2A 1E55A 3F2LA 4AJWA 4W68A 1Z41A 4NAEB 1A5FL 2VKXA 4WKZA 1Q9OA 5F1NA 4QTIH 2WBXA 3ITYA 1B9KA 2FDMA 2QTEA 1MQKH 2VOTA 4R5TA 4L1XA 3MJ8B 1GY1A 2YMXL 1BFVH 3BZ4A 3HC4H 2CXEA 4PBDA 3PUUA 3E0VA 3MLYL 5F6HJ 4NJJA 3K80A 5F1IB 4XMZA 3FUIA 4J3OH 3DURA 4RFOL 1YEDB 1VESA 5IJBC 2P24B 3CDCA 1KCXA 3EO1B 1VCAA 3LNIA 4RFEA 4NI6A 3L3KA 4L4TD 3PPCA 2WXMA 1G69A 2Y22A 3ZK0A 1O66A 3CIAA 3W11D 2CJ3A 1JNJA 5IJVA 3KBJA 3VDGA 4I1NB 3VFTA 5LCVA 4L6OA 4YPJA 3E6FA 2WM1A 4JDYA 5AW4B 3DV4A 4Q4RA 1P2CA 4JDZB 4OAWB 4C4KO 3VFWB 2JKLA 5FM5M 2FUQA 4H7VA 3QJFA 2VX4A 1I3GL 4JY4A 4DQWA 2XXMB 3ZSTA 1H3TA 4O28A 3G7TA 4KTGA 5T9BG 4G5AA 3LGGA 1TV8A 4KQ4L 1KJ2H 1MJUH 3WD3A 4B96A 1ACCA 3BJSA 4KKBD 4ODWB 4KNSA 5FHAH 4FQXD 5DMKB 5HWJA 4XPTL 3VI4E 1Y1UA 5CBEB 2WVSA 4DZIA 3QI9C 1MRFL 4L1LA 7PCYA 3NIGB 2RGLA 1KF9B 2FX9H 3A6OA 1H15B 4JY8A 1SFHA 4Y9GA 1HINL 3ARQA 3V6FA 1EPXA 3P9MB 3UR7A 2B77A 1CXIA 1XUUA 4AX7A 3NA9H 4LSVL 2IPGA 3RU8L 2VX5A 2ZOOA 5F7DB 3RUGF 3FPYA 4DVRH 3CIWA 3VQMA 2ADYA 2EDEA 4L4MA 1HQ4A 4H26B 4PG9B 1ZVNA 3T3MF 1BEYL 1TE1A 1CFSA 1DHPA 3BJLA 4OFQA 4R8WL 4MHBA 2XVPA 4Z3EA 1M6UA 2Q0ZX 2J1WA 1XPGA 1M05B 4NN7B 4PLJC 4DCQA 4X6CE 4ZAKD 4UNVA 2ZWYA 3R06B 4BFIA 2YSSB 3QEGL 2ZG2A 1UA6H 4E42B 2EDNA 2BHYA 3FO9B 4A6YB 5DRWB 2AQQA 3DIFA 3BWWA 3IETB 3CQKA 4JKKA 5CJBA 3M0LA 1JZJA 2VQTA 4NKMA 2PGRA 1XBXA 1RLWA 4DN3L 3G5VA 4MLRA 2PE4A 2K45A 1HSBB 3GTTA 3W84A 2P88A 3ARDB 5KAQG 1BMWA 3WLWC 2EXSA 3W7MA 2DB8A 3HR6A 2YAMA 4PW4A 4JTDA 4HG4J 1P7KA 3LNGA 3BT2L 4XPBL 4UAHA 5E03A 1SEBB 1PYWA 4XVJH 5BOJA 4OGXL 4G7EA 3SD5A 5D7JD 1OZTG 3UTSD 4OLWL 4G6MH 2JCCA 4ZQRA 1K5NA 3LVEA 4ML9A 1F0LA 5AVYB 2HRPL 4GO8A 2UY4A 3QSRA 2QSCL 1CFTA 1GJPA 4P8XA 1WWWX 3NOIA 2F5AL 3OKDA 1R2SA 3ABSA 4TXVB 1H60A 1XIIA 1MCKA 4M7LH 2R94A 3B8TA 1XXFC 1LO0L 3APDA 4FR6A 4JRXD 2GSGB 2XHYA 5KN5B 3LKRA 5DY2A 4U6HB 2OEMA 3KMDA 4J27A 3PUEA 3R4IA 2GTWA 2OSLA 5FUOL 2F84A 3TBCA 1Q9LA 5BMWA 5CCKL 3EO9L 4QHMB 2WZPA 3MB9A 2MKLC 3A22A 3Q2DA 2GTZA 3AAZB 1HNYA 5DUPL 1JZ3A 5KVFL 1VCFA 3GLDA 1OF0A 3ALGA 1DFBL 2QS8A 4U3AA 1XYMA 3WSQL 1TG7A 3ASOB 1CDJA 3MLWL 4JY5H 3GUWA 1H1ZA 4ZW3A 2A6DA 3GSRA 1GEHA 1QLEH 1P7TB 2WWMD 2B4CL 2W0KA 5ACZA 4LGPB 4GSXA 2X2JA 2DQWA 1F4HA 3SCMD 4O54A 3EJPA 3TXAA 1ZT1A 4MZRA 3I9PA 4IRZA 5SWQA 3CZ8A 3C52A 4KTDL 4C60A 4ZENA 3EYVA 2XKNB 5G1TA 4O02B 3ZYJA 2ESVB 5L9FA 4LLQB 4OJAA 5BO1H 4EACA 2Y5TB 1ML0A 4QHNA 4YTTA 1MFBL 2XH0A 4HPJA 3NQBA 4WVXA 5AY7A 3VXRB 4P57A 3VIKA 5CZXC 3VI3B 4NIRA 2GJ6A 5D70L 4QXGL 4PD4K 2VCBA 4N6RB 1YTKA 3GKFA 1ZLEA 1CGXA 4L37A 3JV5A 2VLKE 3MV9E 2CHXA 1U93A 3EH1A 3RR4A 5TGBB 3MX0B 3EJQA 4XPFH 3AZRA 3PGCB 5GS0H 3JV6B 1RALA 4LARH 3UJJL 5DT1L 5EZIL 3S3BB 3B4YA 1Y5XA 2MOQA 1HQTA 5AYBA 1EDQA 4G3YH 2VC5A 3QYCA 3H3PL 3WMQA 3LKOA 2M8XA 1XRVA 1CICB 2EC9U 2ZXCA 3HB3B 3ITCA 2XKSA 4B5SA 1S9VA 1BSIA 4BKNA 1MCNA 2NX5D 4R3UA 4HNNA 3MRNB 4BK4A 1FRBA 4GP4B 1YCSA 2ZWLT 2Y63A 3KS0J 2OL3A 1FNEA 1E6XM 3SCUA 4Q2ZB 1KFBA 2YD2A 2CZFA 2XWBB 1RCOB 2WHMA 2Z6JA 4CSSA 1O9WA 3FB7A 4PRHD 1TR1A 4J3OD 3APCA 1DVZA 3N06B 4S3GA 2XM1A 4EUPB 3PWPB 2WQVA 3O15A 1JHTB 3CPRA 4DEPC 5J6HB 4ELKB 2CLHA 3Q3GB 1W9DM 1HCFX 2O9PA 3CBWA 1NPNA 3UU0A 1JYVA 4RBPK 4WUIA 4PV8B 1LNUB 3KX6A 4ES8A 1VCVA 1XLBA 1ADQH 1RLBA 2OI9C 1J5DA 4UV7L 4GG6E 3F64A 2PMZA 2AKMA 2HS6A 3KPMA 5D96B 4AEHL 2ILLA 4QQUA 4GLEA 3BQVA 5DRCA 2GHZA 3CNYA 1RZFH 3QULB 3PHOB 4V27A 2CLRB 1TTBA 3DH7A 1MHEA 2WJFA 3X1FA 5K5YA 3IJLA 4B97A 3W74A 4BY3A 4WCJA 3L8QA 2ATKA 3KS0H 2NDGA 1YZZA 2VKWA 1KTLB 2CLVA 3CTTA 3HMCA 4XAGA 4WJ8A 4YXLL 1GIGH 5H37A 4Z23A 3PABA 1IGYB 3MRHA 5LDUA 4UC5A 3I7SA 3PWVB 5MEPB 1FY6A 5H8MA 3M5VA 2R59A 3SQOH 5HHMD 3N40F 3CGTA 4PREA 2UWEF 2IBZX 5F70A 4XNQB 4JKWA 1O12A 1JGDB 2CU0A 1R5VA 3LZPA 4YAQA 1LOSA 4NO3B 3LM3A 2XSBA 1OAQH 3UWQA 4MSWA 5J9PA 5IBTL 3CXFA 1G9EA 5B7FA 1Z3RA 1KTBA 1S7UA 3O3UN 3NZ1A 4R27A 3PP3K 3SYPA 5EF2A 4UIMA 1ONXA 4HCRH 1T7ZA 3EWDA 4YS1A 4IW4C 4R33A 4KEMA 1IAIH 1E30A 3N2XA 2ZUUA 1P69B 2UXTA 4ELMB 1UD2A 5J1AB 4DVBB 3PWNA 4B5ZA 3FU3A 4BEQA 3URBA 4TQ8A 1T83C 4QOKB 1TZOA 3D0LA 3RG1C 3VFPB 4U3SB 4N1CA 2HDJA 2XZCH 1NIAA 2K70A 3V36A 3P4OA 2IH8A 3X2QB 3I50L 4QHLB 5F6IC 3X1NA 1RVFH 3BKJL 1EJTC 4KKXA 4QRUA 2DZUA 5FO8A 4GUFA 1GZPA 1WITA 3APMA 4G8GD 5FOJA 5LIUX 5T3XH 3CBKB 4HS3B 4JFUA 5F44A 4U6XA 1QW9A 5IB5A 4EUPG 2WZMA 1IM9B 2WNQA 2ZYIA 3H7RA 4EI5B 2EG8A 4YBLC 1VS1A 2KMWA 1TZGL 1GVFA 1A6WH 1GKEA 1RZIA 3BV7A 3QTPA 3ARFA 5A7EA 4Z1PA 4B60A 3VCCA 4L1HA 1NGQH 4FP8L 1YSOA 4GB9A 2QGYA 5FYLL 2PDFA 3OAYK 3CO4A 1OT1A 2P3ZA 2NPLX 1MRAA 5CM1A 5FGBA 3QIWD 3FOKA 1E7UA 1JN6B 1YPIA 3P5YA 3FBQA 2I1OA 1FVEA 2Q8ZA 1JZ2A 3GBLA 1DR9A 2ZXGA 3APFA 1KM3A 4G8EA 4BR1A 1SOXA 5I1JL 3SY8A 4WUUA 3X1EA 5I6OA 4MXQC 2XY2A 3W29A 4BFAA 2YPKA 2BSDA 3BC9A 3LS4L 3DHMA 2ISVA 1G6RA 4FZEL 5JXQA 3W82A 5DLCA 4HHHA 2W60B 3GU1A 3Q7JA 5CEZH 3WK0A 3HS9A 5C55A 3MANA 4R0LB 5D2WA 1X9LA 3IJYA 1PY9A 1OB1A 3A3XA 1CFMA 3OQ3B 4YBQD 5GNZA 1TPXC 2NSMA 5BOEA 4JICA 4JTAA 2P1YA 4YHOL 4JKLA 3CDZB 4K2SA 4IIFA 2J4WL 5IFPA 1EJ6A 5XIAA 3KW8A 4IFKB 3HKZA 1AH4A 3AUVA 1L7IL 3SE3C 2H1LM 5BQ7A 3WFZA 4S38A 3VA8A 2V30A 2E7LA 1CF8L 1GGBH 3QJVB 1AGDB 5FX3A 1KPVA 3OYZA 1Q0XL 5D2NA 4UMSA 1XIWC 2EPMX 3RHWF 1XSJA 2VH5L 4J28A 2KS0A 4HXBH 4ZSOB 3ZLQC 5DZVA 1V27A 4XNZC 3QIBA 4BFRA 2PAJA 4HNUA 1QFWL 1YXCA 3EJYC 3K71A 2BZDA 1OC6A 1UB5A 2F9RA 3WNIA 3C5SA 1ZS8B 4RUBA 1DQTA 4B16A 4Q7NA 2DUXA 4R88A 2DLFL 3PPGA 1NCAL 5DUBA 5A6BA 1MWAB 4XBKA 1QZNA 2VM8A 3O4LA 3MQIA 2AS5M 1XBDA 5IOBA 4RW5A 3R10A 2PC4A 2ZOKB 4ZX3A 1HKJA 4PFEA 5EFFA 2P5EE 3BOXA 5INCB 3SCWA 2H90A 1R5IB 1RHHA 1CGWA 3G6JA 4HQQH 2ITCA 2RQEA 3FQRB 5GS0D 1Y0EA 4XAKE 1ZLUK 1TMQA 2BVPB 4AQOA 3H24A 2ZWZA 2LLGA 1AH0A 4ZUUA 4F7CB 4M56A 1PAZA 1PKLA 1C8XA 1AS8A 1QFUL 5LBSH 1BXXA 1P6CA 4LVEA 1QRND 1N5YL 5I3GA 2FJFA 2BSRA 5FJUA 1FG2B 1NKOA 4WEMB 5JHDD 3IJEB 1OGPA 2HUEA 5FW7A 4N7QA 3D51A 5F3HA 4P8QA 5BRPA 2ZC8A 1KCRL 3VNDA 4RBPH 1JPEA 1IKFL 3PHAA 4AX3A 3DUSA 4X5LA 2J5LC 1FP9A 2DQDH 3FJ6A 2BHUA 4OUOA 4Q6XA 5FSDC 4GI6A 4Z77B 3MAWA 2CDEA 4DWDA 3B9NA 1KXQA 2VURA 1UD8A 4A21A 3PBVA 3TQKA 43CAA 2WKGA 5EA0L 3RNQA 5DD0H 1EBGA 4ZO7A 4GW4B 3FFCA 3LTVA 2AQRA 1POJA 2PBGA 3NDYE 4P4KB 3PZMA 1ELSA 3B7YA 5D7IF 4HWZB 1EFXA 4IL2A 2XV0A 5AYTA 3K6NA 1ZV2A 1AACA 3FCTB 1L3NA 1FKWA 4OUUA 3RDTD 2A6IB 4P2QA 3OL2A 5M95B 3C75A 1J9RA 4JO8A 2PD5A 3LB6C 1MZRA 4QTFA 2Z1PA 3CS2A 4UV4L 5EIIA 1NLDL 1CTNA 1PZ3A 3PWLB 4PJDA 3T7VA 2E5EA 3NIDE 4JM2B 3LI1A 4AC2A 3O06A 1QU4A 2NY7H 3IGXA 2PO6B 3CFQA 1T7VA 4B9CA 3KYMA 3VXNA 3VINA 2D03H 3FTVA 2FFIA 4NHCL 2JKXA 1H7PA 4GW5A 3PP3H 1WYIA 4RGNB 2Z1WA 4R83A 1E4XH 4MS8C 2WWDA 1EJOH 4Z2LA 2F7RA 1LE5A 1J11A 1K8CA 3L65A 5DXXA 5D93B 5BJTB 2F6UA 2VP8A 1FGNL 3AXLA 3AO0A 2FX8H 1XPYA 4HHMA 3IGFA 4EQ3A 3K2UH 4PS4H 4K36A 5EN3A 5KBMA 4Z3JA 1AMXA 4GYBA 4JS3A 2PDMA 3FQTA 3QIUD 3VTRA 4X5RA 3IRCA 4D0BB 3B3IB 2AANA 2XZZA 3N9GL 3WF4A 4BELD 1EC8A 2IH3A 5LG6A 3IVUA 5JIHA 2J71A 1OVDA 4PBWD 3OJ2C 1CGSL 4HOXA 1KNWA 3CZEA 2R1LA 2XM2A 2QDWA 1TJGL 5T3XD 3UTPD 2IF7A 3PWJB 1VZHA 1WBZA 3MC0A 2C3HA 3W75A 4PP2A 3LHVA 3DHPA 3QARA 3BAEH 2EP6A 2VQ1A 5HGDB 2ORBL 4X4YA 3G08A 1MCCA 1RXLA 2E7MA 3N44F 3LSCA 1VLIA 2RFXB 5HVWA 5JIQA 3SKJL 2HJFB 2AV7A 2NQDA 1FN4B 3OAYH 2BNUA 2QADC 3C0LA 2C9SA 1XO8A 4P7QA 1A4LA 2R56H 1T7XA 3UP8A 2VIRA 5I6XB 3LKSA 3OKOA 1O7VA 3H7LA 4J3WA 4UQ3A 1BIIB 1BGXH 2L0DA 4MGXA 4AX6A 4F0KA 4IRJC 3P0VH 4X83A 4JNXA 1NC2A 2DWEA 2IGTA 3HPSA 3LZ5A 1LORA 1BFOA 3UWZA 2QGEA 2FL5A 4K2UH 2DLEA 1MH5A 1K8IA 5GZND 5DVMA 1YN7A 1DV7A 5IHZA 1S5TA 4ORZC 3D30A 1K70A 1H62A 1IBZA 4IKJA 5C0FB 5CEZD 2ZADA 3FU7B 3GSOB 3I6SA 1FPTH 4AMKL 4AIUA 1E7VA 1EUAA 2KI6A 3GSNH 4RIRB 3MCG1 5C9KA 5EU6A 1DDHB 2AJUL 4CADB 5D1XA 3NVQA 3CV7A 4X80L 4UZGA 25C8H 1ZV5A 1M7PA 2ACSA 2OMZB 2FTYA 2XQBH 3MFGB 4EN2A 4FLHA 5FOBA 1DXEA 1OE3A 5DFTA 1HZHH 1MFAH 5ICUA 1I8KA 2VJ0A 3X3GL 4J1OA 5C0JA 2WZAA 3BG9A 3RILA 3KZPA 1UJPA 1Y6MR 3KCJA 1IF2A 5J1TC 1FKXA 3JTTA 1S5IH 4UI2A 3DX7A 1BXUA 3Q0HA 3TO2B 4NO0B 2FX7L 4PHXA 3IS4A 3KPTA 4RRPG 3VE7A 3FTXA 1O5XA 3BAXA 3ZWSA 1RH8A 5KZMA 2RR3A 1UZ6E 5ISZE 2H3NA 3D07A 1S4IA 2HQAA 3TNNA 2DKSA 3VSVA 5DD6A 4N0YH 1XGPA 3HHMA 1B3XA 1TXKA 3PBWA 1XR8B 3VXSA 1L9OA 1TV7A 1C8QA 2OW7A 1IBGL 4QUOA 2WZ0A 1SDDB 4W81A 4P2VA 3LZOA 3JYCA 4LC6A 2ANUA 4FP1A 2C9PA 2YEVB 1JG9A 2AEWA 4N9BA 3FS9A 1HXMB 5HGGS 3NJ3A 2IV9A 1EIXA 1RPXA 1U8CB 1ZLUH 1EOKA 1XGQB 1KM4A 2WNZA 3GHUA 1Z66A 1Q6LA 5IVOA 4IMLB 1YYAA 4M48H 3NCXA 2JKEA 1U8LB 3KXFA 5SWZE 1XYLA 1L6PA 4OZGE 1PKOA 1HDMB 4M9PA 4ADTA 4LDOB 5DR5H 3PRZA 3FO2A 1J18A 2ZJSH 1EAPB 2BVDA 1BLNB 5D71H 1EB3A 3P6LA 4HIQA 3LXUX 1E27A 5D7LB 4DAGH 4O2FA 4BH7B 1VB9A 3HF3A 3MYPA 2ZSVA 1A7OL 3SDDA 4OLXH 2J75A 3B8DA 4J39A 4UNLA 4OB5H 3GU2A 3GKWL 1ZTXL 1K8DA 5AKQA 1NVMA 3FV9A 1WAWA 1SBSL 5BRBA 4Y1TA 5L4JA 1EA9C 2VFFA 3KP0A 2D31B 3VOHA 5L8LB 1QI0A 3L5HA 5F7KC 4RMUA 3UAFA 4HFUH 3EF4A 2FFCA 2ZCGA 1H3UA 4ZG1A 1B54A 3N11A 1FORH 2F53E 4XHJC 4XH2A 4P2RE 3NQFA 2P45B 2GOKA 2XISA 5B1JC 2EXYD 1FNSH 2I07B 3GXNA 4DAIA 1FV1B 2A4EA 4B9PA 3DOPA 3SYQA 2AJSH 4A2HA 4MJID 3CHDA 1JTPA 4EF8A 3EPNA 4MNHA 1IGCH 3WLRA 5E9AA 4QYOA 4L4VA 5EMKA 1CD1B 2O30A 3MRGA 4UINH 2HXAA 1VRSA 4UM9D 5FEBA 3ZE2B 3D3VB 3W9ZA 4FC3E 2LU5A 5K9KA 2C3VB 4M5YL 4PMQA 4X9GA 4JPWH 3PULA 3OLEA 5GSRA 5DS8A 2DQFB 1TSRA 5EPDA 3NCBB 4G5ZH 4BFBD 1EERB 1A0CA 4NUQA 3UVAA 4JFPA 3IJHB 1HOCA 4CC1A 3O6KH 4NQEB 3L2LA 5L9DH 4OI7A 3W73A 1VA9A 4M5PA 4AZ5A 1CDBA 1SVDA 2OKTA 2L04A 1JD9A 1LLOA 5E08L 3B9EA 2X4TA 4JY6B 3SR7A 2HPIA 4LNYA 4FQ1H 3FUHA 1LJYA 3FGCB 3M86A 4OQTA 1SM3H 2Z00A 4RZ6A 3MBXH 5A8QA 1NY1A 1GRWA 2MANA 5DD3L 2DFAA 3CN0A 4S23A 4MB4A 3ISYA 3QQ9D 3GTFA 3X12B 2VD9A 3OXRB 4IBQA 2B7NA 4NS0A 4ZFOA 1T83A 3FY1A 4U3CA 4TSCL 1Y65A 4IJRA 4HDIA 4MXWH 3I65A 4WI0B 4N0RA 2FYMA 4KJPD 1TJMA 4LU5H 4U1NA 2GGIA 3F65A 4E0RA 3CXDL 3RM9A 3ZHLA 5AKTA 3EXRA 2JQMA 4OV6F 5TQ2H 3ZUNC 1I1FB 2ZKHL 1ZGLB 1WFUA 2C9RA 1E4JA 1Q9WB 3AXIA 4M6OL 5LBVA 3S1WA 2W9DL 3W88A 5ACLA 4WI6A 1SJEB 4JGMA 4A3UA 2KPNA 4Q6YA 1CX9A 1JFQL 4Z3FA 3IUHA 3AG3B 2HNEA 3KLSA 5EO9A 3ZKNC 4KOCA 2W4XA 1G4SA 3W7QA 4JDEB 1S78C 4Z7QE 3NPZB 4O8RA 3RHWK 4G70B 5I5IA 3C60C 4LL4A 2EYSA 2LVCA 1IXOA 2BWIA 5E2VL 1RUKL 3AU1B 5DQPA 4GHRA 1F9CA 1O7AA 2IPTL 5CPOA 5FF0A 4OGYL 4YDMA 3C2AL 2QGDA 3R94A 2XPKA 4ACZA 4HJEA 2E86A 5EIVA 2PW1A 2B0SH 5GGVY 3UO1H 5DURD 2AXJA 4F7PA 2XVBA 4K7FA 1SF5A 2D23A 1PCWA 1X5HA 4X5WB 1KZQA 4ZFZA 3VOIA 2CESA 5ID0B 3S6CA 5JQ9A 1KFAL 1LWRA 4LSQH 4UDUB 3QDJA 2VC6A 3GSWA 3SDAC 4KI5E 3EBIA 2IPWA 1XD0A 2VRKA 2B5IC 5AUMA 3LV6A 1RU9H 4L8DA 3ITTA 5KVEE 2EBNA 5ADOH 2C5DC 1AW1A 4I8YA 3TMLA 3U30B 2VDPB 1S9YA 2APWA 3S36X 2VM9A 2J88H 3M0HA 4G56A 1A4JA 3IXAB 4PJ8B 5HNTA 2XINA 1T8QA 4ORGA 3BDYH 2ZKMX 5A7BA 2OR9H 4TS6A 4N90D 3ZRSA 5I0YA 3MMEA 2IKIA 3BG5A 4XPAH 3O3DA 4A7TA 1ML1A 4F0MA 1K9TA 1S2AA 4QNPE 1WHOA 2HN7B 3C2FA 1XR9B 3RVXC 2FGLA 1C5DB 1UXWB 2FGZA 3UETA 4JFFD 4RDYA 4QRPE 5LHDA 2NXYD 4NQCB 2HFTA 3MSGA 3QDMD 3FA3A 2ZA1A 3HQPA 2EC8A 4I0KA 1AAJA 3N9KA 2XVLA 2OWXA 3MUCA 4HV8B 1DBKL 3R58A 5CWSA 3IEAA 1YADA 2R2HA 2G4GA 3U2OA 3QAZB 4N2DA 1U8KA 2Y7EA 4N8PA 3ES8A 3PBYA 2QQNL 3NABH 3JV4B 3FRPB 5DYOB 3TT1L 1T5WB 4UQBA 3ARPA 3P93A 1EQCA 3P77B 4QCEA 3TLRA 1NANH 3REQB 5CG0A 4CEXC 2GVGA 2OAAA 4N2AA 1DQWA 3BPCA 2PWUA 3CLFH 2CZVA 4KEUA 2BW5A 5T5FL 1NCDL 2YXWA 3ULUL 2H45A 1QFWM 2AJVH 3C08H 1KLUA 4GJIA 3DO7B 5KEZA 2WNWA 3CV6A 3U0WL 3FB5B 1I1AB 3E2HC 3N04A 1AO7A 5F96L 4LKCA 4LEXL 4RMWA 1W3HA 3JWOH 1IAKA 4JE4B 4MGGA 4IS6B 1U8MB 2VDRB 1W3LA 1U3HC 4H44C 3VRIA 3D85D 4KWWA 1QDSA 3CVDA 4GNVA 3P73A 1RZKH 3EX4A 3QBTB 1L7TH 5I23A 1P5UB 4HFWA 1AMYA 2NV1A 4Z5RB 3BAYA 1N0LA 1E9PB 1U8HA 3B56A 2YWYA 4HSCX 4ERSH 1E5ZA 3S5ZA 1FCQA 4PTDA 4TSBL 2MUCA 4E8DA 3UC0L 2VYOA 5IM7B 5K33A 5EBUA 4X5PA 2WPGA 5C0AB 2Z7KA 4ZBJA 2W9EL 5DRIA 4WSGA 2G0KA 1F97A 5C09B 4KEVA 1J9CT 4N0UA 1EDYA 4ODHH 1H11A 1YPZF 3O0RL 4N2NA 1B3OA 2VSMB 5DDHB 1EHXA 1A7PH 2F19L 1ZDQA 4WGVB 5TQ0H 4N5UA 5GXBB 3I6LD 1SYTA 2Y1VA 4IBYA 1BWVA 5B8CC 4ERAA 3T3PF 2GFBB 2XWJB 1DQKA 5CZKA 2NX9A 2O6PA 4XO9A 2IQ9L 4L3ED 4QTHB 4LEOB 1CT5A 2I9TB 2AL1A 2WO4A 4MRCA 5BS0A 4ODXA 5CJXC 4G6KL 1C08A 4MQSB 1OW0A 4UF7C 4LSSH 2W6RA 4OZIA 5DD1H 1U3ZA 2EPOA 2Y9RT 4HG4K 3BLDA 1KV3A 3ZE0B 5G4MA 3WAJA 1CG9B 2HPOA 3W1PA 1YJDH 3WO4C 3ZRCC 3M47A 3B2XA 1Y5WA 3SRDA 4WGKA 1VPYA 3AB0B 3B05A 1EDHA 3FRPG 2P8PA 1QYGL 5JPMB 2A0LD 2MEJB 3KRZA 3EA1A 4OGAC 3WQ6A 5ES4B 3GR8A 2IPFA 3X1GA 2CPCA 2EIEA 2VE6B 3S5YA 5A5WA 4IOIB 3FTYA 4FXLA 3DI1A 3MV8D 3DRQA 3RX7A 1NGWA 1VPXA 1DWIM 4DJFC 5I71C 6XIMA 2J1YA 1K4CB 5C0IB 3TA3D 4ZPTA 2Y07L 2FJSA 3L0GA 1M42A 1EEZB 2GQHA 3CHCA 1S8DA 2RB8A 4PLKC 1H4PA 3ESNA 2HWGA 5FI8A 1FNGA 4ZL1A 4NJGA 2HPMA 2CAKA 3W7RA 4UTAA 4M6VA 4Z7OF 4K9EC 3EYUL 2J8UF 3CFDB 3D25A 1EO7A 5AB1A 43C9A 1J01A 3UESA 2A3BA 5A8PA 1B4RA 3VH8A 4HEPG 4XBGA 3GC4A 3ZIMA 3WKQA 3EOBA 2J8TA 2XZAH 1FYTA 4TULH 5XINA 1MRCH 2ADAA 3WFLA 3IXTB 3KAOA 1IQWL 1AGEB 2BS71 4R4NC 1T21B 3BVTA 1XGUB 1JWSA 3T55A 2Z34A 5H1WA 3TURA 3FU9A 2CFFA 5GGSB 4U1LB 2FZ3A 4MYWB 4HTYA 5CGTA 4QJ1A 3WMLA 3B03A 1S3KH 1QBLH 3ATFA 3MRFA 4MA8H 4Y4KC 3AG2B 2P5WA 4MNQB 1KBGL 2XJKA 3QWQB 3LKQA 2OZ0A 3ZMNA 2EE6A 1EA0A 5EO1B 4UT9H 2GVJA 4KZEL 4PJBF 3S96A 3LCYA 1VGEL 1V7MH 1GOWA 1EOMA 4PRIE 1GS8A 5IQMA 1W31A 2GK2A 3RI5F 2DZWA 3GIVA 2YO3A 2GUYA 3GWQA 1RD6A 2ROYA 3W39B 4IIQC 4AJVA 1E9LA 1YDPB 4O9HH 4AZ8B 3SN4A 2N7AA 2Z91B 3TN0D 2DWDB 3GDCA 1R5YA 1TQCC 4I9TA 1LYQA 1W9XA 5IW6B 3IIXA 1QOKA 1EXUA 4GRMB 4L8BA 5ENWA 3WH6A 4OCSH 1FBIH 1MFCH 1HF6A 2QVHA 5FF4A 1T1ZB 4YSTA 2C34A 1R46A 1K4DB 4H8HA 3L1OL 4M7JL 5C8JA 5ALCH 2BMBA 4JFED 2KPWA 3OBKA 2E9LA 3B2VL 1JPKA 3G1XA 1DBAL 1FX6A 1S3HA 3KUMA 1TA3A 4KO5A 3W3BA 2A9BA 1NP0A 3FONB 2R23A 2H6RA 1TRDA 3PF3A 1PTZA 4BSWA 5ANME 5HMFA 2Q86A 1UP3A 1AHKA 2BLEA 1MNNA 3VFCA 1UZ1A 3CPUA 1SO6A 1H0DB 3MNVA 1BD2B 5DEZA 4F37F 3U4BH 5K9JL 4WHBA 3W0WB 1AMKA 1X7QA 4OLUH 2OLDA 3CDYA 4KROC 2FH8A 3C5ZA 3OGRA 1QAWA 2CWXA 5AZ0A 1AJ2A 1NGYB 1Z6JT 3WEAA 3FCSB 2DEWX 5D5MB 5K1NA 3C3UA 3CG8A 4XK2A 3FT2B 1A6ZA 1N10A 2V5YA 4A7VA 1MNZA 1E9OA 3STGA 5AZ1A 5REQA 4MAYD 2WBJD 1QPRA 4FJYA 1NA8A 1QHOA 3AALA 4YHML 1KIUB 1EF3A 4MF4A 3KLAB 3NJNA 5EO0A 2ICEB 2ZP0T 3D39D 3LB0A 4M7ZC 5FYJL 4PJEB 4ZEPA 3OR7A 4F2EA 4HIEB 3SYCA 2WZTA 4M02A 3Q94A 4MFDA 3IJ7A 1H6EA 4HKBB 1LP9A 1NEYA 5A6IA 4L0ZA 4M1BA 4RDQG 4O11A 1PHQA 3M0ZA 3ZGHA 2A3HA 4X7DC 3SPVB 3FA4A 3ESMA 1X9UA 4LRIA 2QCNA 1B6DA 4WNQB 2OXHA 3SY1A 1T96A 2VWEC 1IC5H 2QZRA 2DI8A 2FAUA 4AD0A 2PF6A 5KVFE 2R1XA 4JM4L 1MLBA 1N19A 4ZOBA 4R7NA 4LSPL 2ZYRA 4P46D 1UWSA 4P5KA 5F9OH 2J4GA 2LU3A 4LU0A 4NQUA 4P5MB 3PGFL 4B4HA 2Q8LA 3WLTA 3BVUA 3PB2A 4WLCA 4HZLA 1PZDA 3N0PB 4BSJA 4HLZH 1I60A 2OMXA 3K8KA 3S47A 2X38A 1JCYA 4GLRH 7TAAA 4FR1A 1RJZB 3W38A 4ODUB 1BXNA 3O05A 3QUXC 1J0ZA 2YXOA 2CKBB 4E2VA 4HPNA 3S48A 3BCFA 3OKNA 1EEPA 1MCRA 5DHDA 1XLEA 3S4SA 3NNTA 5D38A 2APTA 2HVOA 1AE6H 2VEPA 2BIPA 3S5OA 5LA2A 1XF2A 5DJYA 3VD0A 1TWIA 4GAGH 2QHRL 5B1JA 2RKXA 5FA3A 2PCFA 4CJ1A 4O18A 3AJ7A 3P2TA 1ES0A 5DFWH 4XGZA 4MZ3A 3BKCH 4CW1B 4A8LA 1A6TB 1INEH 2ZX7A 1KBLA 6PAZA 1PD0A 5AVNA 1LE9B 4Y2DA 1R6WA 5JW4R 1QVBA 2QV4A 4OVVA 3A5VA 3QC3A 1DJYA 3SDCC 5C0GB 5DJ0A 3L3JB 4GQ9H 4PJFE 1B3WA 5BVPL 2I5YH 4V1DA 3MHUA 4L65A 5EZJB 3LEVL 5TH2A 2QT6A 4HVXA 2PRLA 3VA6A 4NHVA 2X4RB 1SXAA 5FLUA 4E0CA 4PBVC 3MRJB 1U2YA 2Y06L 5ICZA 4E9TA 3KPLB 3PS6A 2UV3A 2G75B 2WLYA 4QMEA 4NQDE 5GRXG 4LMQE 1TTFA 5F72S 2XTJC 3QUMB 2YMOA 3M64A 3NOEA 3KM1A 3KVKA 3MA9L 3GD6A 2VGFA 3BRFA 2CGZA 3K30A 2FJGA 1N64H 4F9LA 1LO3L 2YAEA 4H9XA 4NBYB 2PR9A 5LNWA 3V6OE 2WSQA 1UR4A 2FB2A 1T6WA 5TF0A 4GW1B 2WCPA 3HZVA 1BF6A 3VD7A 3GUGA 5CD5C 3CN1A 2FDBP 1FWGC 4LEEA 3GDRA 1XLHA 3G1RA 3S37H 2NY1D 3RLSA 3UBPC 1W91A 1J1PH 4U1SB 1TX2A 3PXJA 1KMGA 2YA0A 3K7UA 1I8JA 3CN4A 1U2CA 5DWUH 3H9HA 3BPLB 4UT6H 5D1ZD 3GRWA 4IBVA 1CU4L 1Q1JL 2ZX6A 4QWWD 4ZXBA 4M5ZH 1VEOA 4ZTOH 2FZDA 4RAUA 5EWIL 4FXKC 1R3KA 5KJ4A 4IJTA 1IGFL 3HCVB 2IQAA 3RKDC 3GBDA 3UPWA 2EXWD 3IE4A 4GG9A 4RDWA 2ARJA 1G4PA 3P84A 2C8NA 4WGHA 4NKOB 5B21A 2RHGA 2HVJB 2NXZC 1IT0A 2VLKD 3VNZA 4P8VA 3MV9D 1OTSC 3C60A 4FYRA 5IP4A 1I0BA 1HL8A 4W88A 3QUZC 1XDLA 2YQ2A 1SUJA 3LX9A 1A5KC 3TC3A 4L6HA 5EBWA 2NY4B 2WP3O 4XBEL 3WBYA 1L8PA 3N9RA 2V69A 5J6GB 3VI4F 3OHXC 5JO5B 3MHZA 3BHBB 1R8LA 5E99H 3HJ0A 5I1GL 1JQXA 1FUYA 1U2HA 2QDDA 5JUEH 1ZVSA 3GZOA 2WLZA 4PUBH 2WD0A 4PMNA 4YPGA 2UY5A 4WO4C 1P5VA 2H32A 3VNLA 1TPB1 5INDB 4EIUA 1XDMA 5E4AA 4NZTL 3S9DB 2XFWA 2HFEB 2WZ5A 3TT3L 4FG2A 1LVEA 3IDYB 3GYCA 2ZG3A 3T6WA 4NRXB 5F89A 4R26L 2OBGA 3INOA 1PY4A 5E8OA 4LCRA 1MRDL 5AENA 4GRWE 3GY1A 5FM5O 4N8CH 1PU0A 4AZBA 1XGDA 5LQBH 4FNTA 3MRBB 1NDVA 2FCBA 4U6YA 2NUPA 1L0QA 2FECI 1NSNH 3GMOB 1OYBA 1DQDL 1YN6B 5DK3A 1EX5A 1SXSA 5T1KD 2B1AL 2NUTB 4WJG3 1R3JA 4F3FA 4Y4FA 2BIMA 2DIAA 3LN9A 1GQIA 3B9OA 2DT0A 1AFVL 3WQFA 3ZQWA 1JVKA 4X6CF 3DEQA 1CWYA 5F7EL 2ZUWA 1NAMH 1SF3A 4YQXL 4HWBH 2V3DA 2JF1A 5AD0B 3NEEA 2YAOA 1IKNC 4M7TA 1NGXB 4PRBB 1B4JH 5FYLE 3HRPA 2KKQA 1TYJA 4JN1H 1CR9H 1KGUA 4MAVA 3STLA 1T5XA 4YK4B 5I73B 3FIGA 3EOYG 4WY7H 5CCJA 1M7JA 3NGBB 1OV8A 3PSVA 1KLFA 2FSEA 1A8ZA 2YJLA 5DVLA 2R2CA 3TN3A 3GI9H 2JLPA 2EPKX 4R4FH 2R69H 1YEYA 4H9ZA 4S1QH 4WW1B 5GIRA 2LABA 3G5YB 5FO9A 1DP0A 1MXDA 5JU6A 3IDMB 4FCHA 4A2DA 1ISYA 4WSKA 3WQGA 1QO3A 5DK2A 3TBVB 5I02A 4RX4A 2HS8A 1SHMA 1U3HA 4BKLA 3EOOA 1XB3A 1EIBA 5D6CA 5A6TC 4K7YA 4NPYA 5C2GA 2J1ZA 1INQA 2X4OB 4H8QA 4M1GH 4MMYA 4AH2A 2WIIA 1AH1A 1ZJBA 4DXVA 3L7FB 1ZSDA 5DXYA 2AK4D 1RZ7L 5KANI 5AOKA 4H1LH 2YW4A 2IJ0C 5IV2B 3RB7A 4FADA 1D6EB 2ZUTA 5C54A 4D7PA 1UM5L 3BUDA 1QTPA 1P48A 1L9SA 4TUUA 4C47A 3V4VH 5MP6L 2QDVA 5DJAA 4M6NH 1LEIB 4ANXA 3LVTA 2XIJA 1QNRA 3DX2A 2R1KA 3ZZSA 4DWSC 1R3LB 3DI3B 1WNOA 2Y5EA 4XTRD 1CZ8L 4BJLA 2VXTL 2X87A 3QEQA 1E1CB 1NCWL 2EE2A 2VL5B 1CQYA 3OZ9H 4MYPA 5B8CA 4ORIA 3HEIB 1QKZH 1DKWA 1ZDSA 3MGTB 3T09A 4FQ2H 3PJTA 3HI5L 2ZCLL 4YDKL 4N8VA 2R4RL 2B14A 1V3JA 5KTEL 1TU2B 2A5UA 1GC1C 1P6AB 4HIHB 2DQ6A 2OJZH 4LLMB 1NAKL 3GO1L 1CPUA 2BY2A 4WTQA 2WAGA 3EFFB 2UZXB 3BWAB 3UTZA 5G4NA 3CZNA 3KPRD 2HRWA 2HXUA 1KBWA 3HBPA 3SE4C 3WD5L 1OP9A 5LXGH 5IMKA 4JIHA 2OT1A 5CZ0A 3DPBA 4FEZA 3QUYD 5DJ2A 1PQZB 1ETA1 4WHYG 3AIEA 3WL1A 3B9AA 4XWGL 2V9RA 1ROCA 4G42B 5HDQL 4A6YL 3CHPA 3RI5K 3BO8A 3WS3A 1OFOA 3JRKA 1LQAA 4PQXA 2BX5A 4AKPA 3LQZB 5JA8B 2IAND 1PZCA 2XN1A 4JG0L 5GGSY 2IAMC 2QJNA 3ATZA 3K1KC 1J0YA 1XUZA 4XP6H 4NGHH 1IM3A 2EDMA 3BGGA 3KYOB 3WEOA 2J9XA 2CBQA 3V95A 2PA6A 4QKXB 1D5MB 3KNBB 4MKNA 4AVIA 1IGTB 4W6YB 1JNEA 4LKXB 3PUDA 4DLMA 1AP2B 3ANUA 4NEHB 2GUOA 4XVUD 1ZMYA 4KDTC 2V0TA 3NAAH 3EYSL 5LAXA 2V68A 2P8MB 1AR2A 3IRSA 2OQLA 1PPIA 3MLUL 2E4TA 3TEWA 1HKIA 4LEQA 5AVRB 2CD0A 3UZVB 4LPVA 3V0IA 2DSWA 4ZX5A 3FCGA 1TO4A 1VIWA 3WH7A 3JTSA 3T0VA 2SODB 1OM3L 4HKZA 4MMXC 2XN9E 3TYZA 5F7UA 4GG6F 3CUGA 3SJVB 1A3ZA 4WZHA 3VXRE 4U6VH 3VI3E 3AACA 4BKTC 5SWSA 3WL0A 2ZCHH 5EU3B 4DP4X 2VC2B 1S46A 4XCFH 4KV5E 4F37K 4LLVA 2J6EA 3RJDA 2H2PC 1LDCA 5IQ9B 1FL5A 3TZVD 4NKDB 1DVXA 3UZWA 3MI6A 2Q8AH 1C12A 3CSGA 1QA9A 3J8F7 4ETQB 3US9A 4G8IA 2VLRA 3N0AA 2DI7A 2YKLL 3V5CA 4TKWA 1PX3A 1E1FA 4MX7A 1KWKA 2Y5SA 1S7WB 4HA1A 1PF3A 2ZRXA 3ZYOA 4PRPB 3C9NB 3WN5C 5EPMB 4D2NA 2QL1A 1O6VA 5I18L 3V35A 3D9AL 1JUBA 4R3SB 5JZ7C 4UQEA 4Y2WA 4U4IA 1B9BA 1PCSA 4XVEA 3RWIA 3O2VL 1G7PA 4EXPX 3TFKD 1P7BA 4A2LA 2OTDA 2X7LB 1NIBA 3ZJ6A 3KZSA 1OFPA 5DHVB 4NDMA 4XO8A 3SKOA 1E4LA 5M03A 4JX4A 3QIUC 1JZEA 4DP9X 4X7EC 3V5HA 4NUGL 4O02L 3II3A 2CMRH 1NBZB 4REQB 3PWPE 2EDTA 4UUJB 2ETWA 1UWQA 2NTFA 3OB0K 3K8MA 3E2QA 4IT1A 3QI9A 4L80A 3QP3A 5FL1A 1E6OH 5C07D 3NSXA 4RNRB 4JD4A 2J74A 1CS6A 4KK5C 4R90H 2X9XA 4PB9L 1IEBB 4LPWA 1WZAA 3C8NA 4RMSA 4EXKA 3F1QA 3WD2A 1QFPA 4A39A 3HTWA 1F1DA 4CILA 1MCSA 2QLVB 1CLOH 3PJNA 4K07A 5H2BA 3QJQB 2L4OA 2HMIC 4KKLC 3DFQA 1IGWA 3GR4A 3BVVA 1SW7A 5HHXL 3MCLL 1DXFA 4MNLA 1E1EA 3COOA 1TQBB 2AJZB 4GH1A 4JHWH 2F58H 2OELA 3HI1A 4CVZA 1INDL 2IW0A 1VSCA 5I1EH 4NBXB 4RA0C 1MSSA 1KC7A 2NCMA 2K0RA 4O1EA 1NCIA 4HZ6A 1KBJA 1IL1A 4Q58C 2GJXA 2ZA3A 2JK5A 5J06A 3VFVB 5TPWL 2DSUA 4HWNA 4UTBH 2J79A 4Z78A 4F8OA 2VMJA 4OHQA 1KFGA 5D7HA 2Y70A 2Q3OA 2WXRA 1W8GA 4JJHA 2AEOA 4PRAB 3NACL 2YPVA 2J8GA 4DTGL 3IDGA 2WWKO 2JJUA 1SJMA 3VG9B 4ELME 1OK4A 5D9NA 1G7IB 1I85C 4ZQPA 5LN4A 3FEQA 4MKMA 2WINA 2WUCH 5GGTA 1JI1A 4D6HA 4CC4C 5LIKX 4UQIM 1NBCA 4GBXD 1RJCA 1GQLA 3WBEA 4HK6A 3IUDA 1OWWA 4QJ4B 1Q7MA 5DUML 1ZKAA 1BQGA 2Y72A 3WQ5A 3D3FA 2YBRB 3AZSA 5EU4A 4PJ7A 1MJ8L 1XGYH 4OI8A 3L0NA 3QUXA 1M7DA 4K15A 4GUOA 4RDZA 4XZWA 1OSZB 1N7ML 3EYFA 2DEXX 3FJTA 2ZX9A 1XGTA 1MEXL 5T1MB 4PJCF 5GNYA 2VJ8A 4A8RA 3TS8A 2ZNWA 1FWAC 3ZR5A 3UY7A 1D7FA 1M03A 2BCMA 3GI8L 4CC0A 4HPGA 1S7XB 1AA1B 5LAPA 4LLYB 5K4XA 5F2MA 4GUPB 1S2WA 3KOXA 1RD5A 3EPMA 2HCVA 3ARBD 1TNMA 4CQCA 2Z8RA 5D1QC 3H6JA 1TMLA 4KJQD 3S2JA 4JFDE 2FSDA 1AL7A 1Q8JA 3PNUA 5E8DH 5DT7A 2PU0A 4YSUA 4KZCA 3DMMB 5I3FA 2I16A 4QNWA 3G5ZB 4X9IA 3SDCA 3VUPA 3R89A 2CR3A 1WCQA 5BWFA 4HCFA 1UWGL 4QRTA 4Z0BL 1T0MA 4ZYKB 1E5CA 3T0AA 2P7TA 4OF3A 2EDKA 5KVEH 1MCQA 5HPMA 3CUJA 2WVVA 2GSHA 1TJPA 3W5MA 4JFOB 3A3YB 2CDFA 4MWFB 3UTTA 4IKLA 4L8SC 3MUGB 4LFHD 3CFCL 5B39A 2PCPB 1JMZA 2IADA 1CBVH 1KV7A 1BWKA 5BRQA 1GOOA 3B2PA 1VYPX 3EHBD 2FQFA 1UWRA 1KJ3L 3TCSA 1T20B 4AC1X 1VJZA 4YXKL 1ZTXE 4C54A 1H5VA 1KJMA 4PYHA 2PKDA 4HU3A 3SQRA 2E56A 4JHUA 5JXEC 4WHCA 1FZKB 3QRFM 1KXVC 2E46A 2ICWJ 2X1XR 1V5XA 1OQFA 5GGQH 3IDNB 4IZGA 1UXSA 3G2GA 4DJDD 1HIML 4A55A 1GTHA 3JR2A 2YBTA 2ADGA 3D3AA 3MZTA 2JB6A 3QEHB 3HN8A 2V63A 3TLLA 1TPDA 4JREB 5BZDA 4R2GC 3BEVB 3PZOA 4KJYB 3VFRB 3O4OC 3TGXA 4IMKC 2X3AA 3R2GA 2Y0FA 5F88B 5EZLB 3CU2A 2WVTA 4UTMA 3JWNE 4F27A 3HFML 5LXXA 3IDJA 7PTDA 4UYQA 1I2PA 4FFZA 2I25N 4Q14A 4FXKA 2PLKA 2XXCB 3G5EA 1NM9A 5BRZB 4OD2A 1S3TC 5T5NG 3HC2A 3W7KA 2R0KH 4Z7NB 4ONGL 1ASOA 1AKJD 4PH8A 2A3TA 3HNVL 2R1YB 5JHMA 4PJXB 4M24A 4HC1L 5CN2A 3O2WL 1IE7C 4XP1H 3E1F1 2R4SH 2GUUA 2X6MA 4YCOA 2LR4A 5IFHH 1GW1A 4A7GF 4OLZH 3BZEA 5GGVL 2F7OA 1XL4A 4AXKA 4P5TD 4UILL 2HUHA 2R15A 3IFNH 3QWRA 3DX6B 1V3LA 3ZT6A 2QULA 2B9BA 2BRRL 3OHXA 4CQ8A 3R5EA 3HE7C 1T1XB 4I5BA 2YCLB 4GUQA 4YGVA 2CEQA 3HU7A 1Q4WA 1H3WM 3NIDF 1JTOA 3MOBL 1KN4L 3BVNB 2G41A 4F2UA 4UU9B 4C56B 2GC7C 3LH8A 3QPEA 4KNUA 1AI1H 5DVOA 5GJSH 1RFDH 5T1LB 2VDIA 3U36B 1II4E 3WKYA 3F7YB 5E6IC 1I0DA 2O61A 3BWUC 3V5DA 3ARGC 4FGMA 5I28A 4EDWL 1Q6FA 1Q94B 1NLBH 4GJTB 5KS9A 1FL3A 3O2DL 4HKXA 1C92A 4OFVA 4G2AA 4JPQA 2XFYA 4ZNEE 3MRPA 5B7EA 2AC0A 1QSEA 2ZVRA 3PZIA 5G55A 1ITUA 3MP3A 1AQDA 4M4PA 5B4MC 1I8LC 1JNLH 3DFOA 3LZQA 1BRLB 5D09A 3OMAB 1MWAL 2VDMH 1LL1A 1UZ4A 2F53D 4P2RD 4JPIA 5I8KH 5D7KE 4C65A 3OHMB 1GW0A 1UPMB 1NC4D 2E5DA 1SY6H 2O6CA 3MRRA 1HEJC 1HSAA 3WQ8A 3GK0A 2CIKA 3Q6GL 5JOFB 4M8QA 1VFBA 4FI7A 5I0WA 1XF5A 4GSDL 3WG7B 1MQQA 5CBJA 1T1YB 3R11A 4C83A 3WFAA 4DM1A 4KFPA 4TTDD 5ABGA 1B5TA 5L6YL 4K37A 1K77A 1DN2A 4XBPA 3PUCA 4HGXA