4PN2A

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylotriose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
305
structure length
305
Chain Sequence
AAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 123
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pn2A00
1XC6A 1UUQA 2ZX9A 5IXEA 3AMCA 1HN1A 2QMKA 3BCDA 1GW1A 2YBUA 2WBGA 2BFGA 2EJ1A 1KGWA 4CCEA 3CZLA 4QDMA 3CZEA 2JIEA 2D3NA 1JZ6A 2QLYA 2NW0A 1VBUA 1XGZA 1B1YA 2A3BA 4QP0A 2CYGA 2WSPA 1FFRA 2OSXA 3VGHA 3SUTA 4RE2A 2AAAA 3IJ7A 4JL1A 1H41A 1UH2A 1CGWA 1B3VA 2XFFA 3CZKA 2D22A 1E3ZA 1TVNA 5JIPA 5FOOA 2WYSA 3W81A 2VRQA 3AIVA 4JFWA 1Z32X 2WKLA 3CPUA 1CXFA 4OUEA 4NF7A 3O9NA 1HVQA 1JYWA 5A6KA 2J7CA 2ZICA 2BY3A 4GI9A 2OLHA 3VGBA 1PIGA 5AYBA 1E1FA 3L2MA 3VMNA 5DMYA 2E0PA 2E8YA 1J0JA 2OWXA 2YDSA 2CBVA 4B15A 1W32A 2WC4A 2X0YA 9CGTA 2J62A 3SCRA 1QI5A 3GTNA 3BH4A 1HKIA 4PMDA 3PBGA 1B9ZA 2VRJA 2Y24A 3VMPA 1B2YA 1D3CA 4EANA 1DWFM 1ISZA 1Q6FA 1G5AA 1JFXA 7A3HA 3WF4A 4M8UA 1GOKA 4XZWA 2WZIA 4PBGA 4J7RA 4CKQA 3CO4A 3ZQ9A 4TX8A 4W7UA 3I3DA 3ARZA 1BYBA 4A3HA 4D6CA 3WD4A 1PX8A 4W8BA 2JFEX 1TFVA 5A8PA 2ZUNA 2J7HA 1GZJA 2W63A 4LQ1A 3D5HA 5IHRA 1V0KA 5EB8A 4GQQA 5FIPA 5HOSA 3TONA 3N12A 2WMIA 1CECA 1H1NA 3FY1A 2VMFA 5KEZA 3AJ7A 2FGLA 3WD1A 3M6DA 3OGVA 3TTOA 1H4PA 2WZEA 2VC9A 4MB3A 4NI3A 1UHVA 3VIJA 1R7AA 3W4RA 5A1AA 1H49A 1GQJA 3CHDA 3FNDA 1JAKA 1I75A 3TOPA 1W3KA 5M3WA 2DSKA 1JFHA 1TCMA 4LYPA 1V0NA 3BLPX 3AS2A 5I78A 5CLTA 4ZE5A 1V3JA 1UR0A 3POCA 3VD3A 5EMYA 1YQ2A 5CQ1A 5D9NA 3UERA 1MW2A 1K9FA 3GNPA 2CHNA 2A3HA 4MAZA 1VB9A 2YJQA 4V2XA 1QNQA 3OLIA 4M24A 3AMKA 2ZUWA 3BMWA 3GXDA 4ACZB 4HA4A 3T0DA 3VIKA 4PUEA 1HP4A 3EMQA 1EHNA 1NP0A 3VGFA 2D1ZA 2J4GA 4QCFA 4GI8A 2CCRA 1W1VA 4TVDA 1XSIA 3ZMRA 3RDKA 1JZ3A 4MJ2A 1CXKA 5M5DA 2DIJA 2OSWA 2VTFA 1OBAA 3DYOA 3WNNA 4CGTA 2YL9A 1WKYA 1UD8A 1JDCA 2ZUSA 3K8KA 4U2ZA 3WY1A 1J0KA 1JI1A 1N82A 4GZJA 4NSBA 1CYGA 4BQ5A 1TVPA 1FH7A 1A47A 2EEXA 4KGJA 5E6ZA 4AEFA 2YA0A 3BGAA 5CPQA 3ALFA 2WANA 3SCWA 3SUWA 1E4NA 1WB0A 1CXEA 1EO5A 4MNJA 5A3HA 1PIFA 2DQXA 1GPFA 4HU8A 1NOWA 1BG9A 1CWYA 1X1NA 5C8BB 2ZWZA 2GJRA 3WMCA 4J3VA 1UD2A 3T2OA 2CIPA 2CITA 1MWOA 3CH9A 2YL8A 1P6WA 2D0GA 2YKKA 3ZOAA 1TA3B 4MPKA 1KBBA 4D6HA 3PZIA 2E40A 3WF1A 2WBKA 1ESWA 3THDA 4JHOA 1GCYA 2XFYA 2ZX5A 3AZTA 3MSGA 2Q8XA 1KBKA 1Q4NX 4MNLA 1UA7A 2XGBA 1IZJA 3SIMA 2UWFA 2WVTA 2GSJA 2XWEA 2HVMA 4WKFA 3WNPA 4P8VA 1RPKA 4M81A 4BZYA 5I6SA 3AXXA 3T2PA 1ODZA 5BWFA 1JZ2A 1ZBCA 5A8QA 1CLVA 2V5CA 3RPMA 3GNRA 4M56A 2RGLA 2EPNA 1W9UA 4WF7A 3APGA 3I3BA 3WQ5A 4XUYA 2J7FA 4HMEA 3SEPA 3EDJA 1JDAA 2WLYA 2J79A 4S3JA 1BHGA 1QHZA 1GVYA 2DGAA 4JIEA 1JYNA 2ZWYA 1GQKA 2JF7A 4QLLA 4V27A 4NZCA 3VIHA 1H0GA 1LJYA 5M03A 2YL5A 4HMDA 2VR5A 2ZXAA 3AISA 2D2OA 4MDPA 1LL4A 1CPUA 3RM8A 1MQQA 2O9OA 4FLQA 1MVYA 4UFMA 3BAXA 1OT2A 3AS1A 4U3CA 4UQDA 1XRVA 4PMXA 3WEZA 5ECUA 4W86A 2BXZA 3AHZA 1QI2A 1BQCA 3IJ8A 1Q6GA 4J3WA 4YHEA 1XCXA 3T08A 5CPTA 1W9XA 4UCFA 1UKQA 3MUZ1 3VGDA 2ZUUA 4ML4A 3WDQA 4KGLA 4FK9A 1J0HA 5BXPA 1CGUA 1QW8A 2GJXB 4HU0A 5GQBA 4UZUA 3PZ9A 2VX7A 2PC8A 1J0YA 2WMKA 2VX5A 1H0IA 1ZB5A 3CHCA 3WQ6A 1W3HA 3PZVA 2NSXA 1JAEA 4XZBA 4W8AA 2PWEA 2WHLA 4UFLA 4H2CA 1B0IA 4P7NA 3VKKA 3WNKA 1RD6A 3RJXA 2JALA 1W1PA 4UOQA 4YPJA 1O6IA 2NT0A 1E4MM 2XSBA 5BXSA 3EDDA 3WL0A 3LPOA 4D6FA 5HNNA 4QFUA 1WZMA 4C7GA 1UKTA 1VRXA 4Y7EA 3MUAA 1OCQA 1J0ZA 2WHMA 3F4VA 3SCNA 3WQVA 1ECEA 3RIKA 3N17A 1VEMA 4U3AA 3PZUA 1ZJAA 3K8MA 4UQCA 1EQCA 1PAMA 1VAHA 4ATLA 1BAGA 3D3AA 4D1IA 4DM2A 4Z2HA 4TUFA 3W25A 3SCSA 5GNYA 5JBDA 2WZHA 2YOCA 4WKHA 1VBRA 3AHYA 1UD4A 1BGAA 1KGUA 2FHFA 1J0IA 4D6EA 3DECA 4CD4A 1KB3A 2E4TA 4HTYA 3ZT7A 4PMNA 1UH3A 2XVPA 3CUGA 2XUCA 4KMQA 4QLJA 1CXHA 1OD0A 2O9RA 3K8LA 3SUVA 1M53A 3VM7A 1HVXA 1OB0A 3GZAA 3MKKA 2VRKA 3RM4A 4V28A 1QHPA 5ABEA 3L4UA 3N1AA 4GO9A 1SMDA 1C90A 1W9BM 4UFKA 3UEQA 1ZS2A 2BY1A 4OIFA 3A4AA 5HBFA 3FW6A 2WMHA 1R85A 2A3EA 4PTXA 4F66A 3PZMA 2CHOA 3OA5A 2WMFA 4P8XA 4TOQA 4M29A 1DEDA 1QHOA 3VX0A 5C71A 3UCQA 1WO2A 1UD5A 1NH6A 4ACYA 5A6SA 1ISXA 1HP5A 1X6NA 2YL6A 1PPIA 4QLKA 4BCEA 1JYVA 5CSUA 1UD3A 1GOMA 3SCTA 1JXJA 3WMBA 4CD5A 2HISA 2X1IA 1JIBA 2V3EA 3BLKA 3NIYA 3WH9A 2FHBA 2ZUVA 5JUVA 1VJZA 4AYSA 3WFLA 1KQYA 2PI6A 3AIWA 4FLRA 2IXVA 3EDEA 4LPCA 4GIAA 2VZTA 1XD0A 3CUHA 1HJWA 1AQMA 3NDZA 2J25A 1L8NA 4PSPA 1V6XA 3VDHA 3WH8A 2VUYA 2Y5EA 1AMYA 2WM0A 3WMSA 1GJUA 5FD0A 2BY0A 2DDXA 1UA3A 1ISWA 1OGSA 3FN9A 5AYIA 4AXNA 4N42A 2BS9A 4WJXA 1TR1A 2XIIA 5HPOA 2NT1A 3VIPA 1E55A 4AD0A 5BROA 4HA3A 1NM9A 3ARWA 3AMGA 1UWIA 3G6MA 2VVSA 3F5JA 4D6IA 2X0HA 4HZ7A 2WW5A 3WUFA 1UR4A 3RCNA 1CENA 2D0HA 2YLLA 2XM1A 1KXVA 1VJSA 3CZJA 3HN3A 1SR0A 3BCFA 2G4FA 2X2YA 4JCLA 3EDKA 4W93A 2WVVB 4D1JA 3IANA 4U33A 4HPHA 1C91A 2EO7A 1HNYA 1HX0A 4AD5A 4JFTA 5A94A 3NYDA 3VIGA 3MUIA 3KZSA 1UD6A 5D8WA 1DP0A 3POHA 3S2CA 4ATDA 3WDHA 2EPMX 5IFPA 1V3HA 4L4PA 5D9MA 3WDPP 3WD2A 3W29A 4PMOA 4JZ5A 2GDUA 4HZ6A 1YHTA 5ABGA 1UR1A 4OBRA 3VIMA 1E3XA 1UWQA 3EMZA 5D4YA 4BQ3A 1UQYA 3VD7A 5BXRA 3W27A 1AVAA 2XWDA 2DT1A 3NDYA 1DWIM 1UH4A 1V0MA 2Y8KA 5ABHA 3LPFA 3AHXA 4UFJA 1MFVA 2GK1A 3RO8A 1NP2A 1QBBA 4HOZA 3VD5A 2GFTA 3QHMA 2VL4A 1CNVA 4E8DA 4DUWA 1MXDA 3GH4A 3VIOA 4UOZA 5A8NA 3M46A 5A6BA 3ARQA 1ISYA 1WZKA 2J77A 4MB4A 3U5YA 5E9AA 3VDAA 3W38A 1GQIA 3AYSA 2UY3A 3TTQA 1NOFA 2QPSA 4AZ5A 5C70A 3N9KA 1MQRA 3ARSA 1BG4A 3AOFA 2C8NA 3O6AA 1QW9A 4DWSA 1NARA 2UY4A 7CGTA 4B3KA 4LX4A 4P8UA 3U57A 2VT0A 2J8GA 3W26A 1Q6CA 3TTYA 2CBJA 3SCQA 4DWSC 2V5DA 1ODUA 1ZL1A 5AC5A 3SURA 2GVYA 1E4LA 1QNOA 3WUEA 4NRRA 4P7RA 1WDRA 1SMAA 2JE8A 4AZHA 4WKAA 4CUCA 4M1RA 2WSKA 1JXKA 5BCAA 2WWCA 1E6ZA 1V02A 1IZKA 1JZ8A 3U5UA 5FL1A 4GO8A 1E5NA 5GNXA 3KWXA 3GM8A 1H09A 1XYZA 4JHZA 1V6YA 1OD8A 3MV11 4HZ8A 3CHEA 2G3NA 3UR8A 2W67A 4MB1A 1F4HA 1QI3A 1R7OA 4ZENA 3AMDA 4IPLA 4HA1A 1XH2A 4AZBA 1E15A 2G41A 3B9DA 4FLOA 1KXTA 1HJVA 2XHYA 2ZUTA 1E0XA 1GHSA 2XIBA 2O9PA 1UYQA 4JFSA 1K9TA 1KFWA 4AD1A 6CGTA 2Z1SA 1G94A 3SCUA 2YLAA 4PSRA 1QBAA 3SCPA 5I2UA 1VFFA 4CU6A 4D6JA 1LQ0A 4TXEA 1WZAA 3A3HA 1C7TA 1G0CA 2WMGA 1OIFA 1J18A 4YN5A 3BXWA 2ZX7A 1B3WA 2DPEA 4W88A 3HJEA 1B3XA 2Z1KA 3CTTA 5HXMA 4ZEPA 4Q7NA 1B30A 3L4ZA 1W2PA 1CGYA 2GUYA 4BS0A 3PZTA 4M82A 4PMRA 4BF7A 2BVYA 4TVCA 3WNMA 5CSYA 4WLCA 4P7OA 4AZ6A 1ZBKA 4B3LA 2A3AA 4IM4A 4TVUA 1HKMA 1UKPA 1G9HA 1EOKA 1W2VA 1KWGA 2EPOA 2CPUA 4CCDA 4J3XA 4MDOA 5IDIA 4KRUA 1OIMA 3FXYA 1OWQA 3GYCA 2QHAA 3UR7A 1UR9A 1J12A 2DSWA 4XB3A 4UQEA 5A2AA 5A95A 1XSJA 5FL0A 4BQ4A 5DO8A 4DUXA 1U2YA 4AWEA 1L0PA 2V38A 1I1XA 3GBDA 3VO0A 3W6MA 3AFBA 3EDFA 3W82A 1DWJM 1FHDA 3WNLA 1HKKA 3QOKA 5CZKA 3OZOA 1QNRA 2X09A 4Z2GA 1CXIA 5BXTA 2FGZA 4H7VA 3GBEA 3VIIA 4FF5A 1M7XA 1EXPA 3TTSA 3VTRA 3BAWA 2VZVA 2IXUA 5D9OA 3IJ9A 1M01A 2EPLX 3THCA 1KR1A 2XVGA 1ZBVA 1DWGM 1V6UA 3BSGA 4J27A 4AD2A 5HPCA 5A6MA 1E40A 2WMJA 3T0BA 1B3YA 3I3EA 1UG6A 4W85A 1BYAA 2J78A 3NSXA 5I79A 1PZ2A 5DT5A 1KXQA 5EBAA 2XYLA 1PZ3A 4ZE4A 4AZIA 1J01A 2YIHA 3VGGA 4XX6A 1PJ9A 2GJPA 4ZXLA 3VOCA 4JKKA 3W24A 5D9PA 3WELA 4ACZA 2BNJA 5KZ6A 3ZJ7A 1KWKA 2D23A 2X8RA 3UESA 2QPUA 4LXFA 4PMYA 1E71M 1LL6A 2XJ7A 5I23A 1JL8A 1Q6DA 4GXPA 8CGTA 3QOMA 1XH1A 5FCZA 2CETA 1CGTA 2XVNA 1LG1A 4W84A 3DHUA 3RILA 5A2CA 4H8UA 4C7FA 1PX4A 4TTUA 3OZPA 2E9BA 1MW0A 1EQPA 2F61A 4URIA 5EFFA 4RE3A 2VCBA 2OYMA 3AXIA 3ARRA 2DIEA 3M7SA 1I1WA 1KCLA 4Z2IA 1E6QM 2QMJA 3NUKA 3VILA 2BHZA 3CZ8A 1LG2A 4OOUA 2CBUA 1AQHA 4JL2A 1ZBWA 1FOBA 2VX4A 4QAWA 4H04A 4UOJA 3OB8A 2O9TA 3OG2A 1HJSA 3F5KA 3CHFA 1PBGA 1W9DM 2UY2A 1U33A 1E6NA 2B31A 1JGIA 1Y7VA 1C93A 3FAWA 2PWFA 3ECQA 1JZ7A 5LA0A 2WVSA 2WHJA 3WKZA 3NSNA 3S6TA 1MW1A 2YBTA 2WHKA 2QV4A 3VD9A 2ZXBA 4CD7A 1FHLA 2PWDA 1GUVA 2W4XA 2BXYA 3PZQA 3AXHA 2X05A 1QPKA 3IAQA 4E2OA 3WQ4A 4MAVA 1LF1A 2XVLA 1J11A 4A4AA 1F4AA 1TG7A 3MMUA 3II1A 1CEOA 4U2YA 4GKLA 4EKJA 2RGMA 3AMLA 3WBAA 3ARYA 1RP9A 3K4DA 3JUGA 1R87A 2C7FA 4ZFMA 3WF2A 1BSIA 2WCAA 1WE5A 3ALGA 4W5ZA 1PEZA 1JG9A 4MJ4A 4RE4A 2VR4A 4CN1A 1GOIA 1RH9A 4WSJA 2V3FA 3NSMA 1JD9A 2W62A 1VENA 3AIBA 2E3ZA 4W89A 4F79A 1JF5A 4OBSA 3WDIA 1E4IA 4CN6A 1CTNA 1DWAM 2XGIA 2GK1B 1V0LA 3AIEA 1WAWA 4UNIA 3VUPA 3VDBA 1C7SA 3K1DA 1V02E 4PCSA 1BYDA 4PTMA 1FP9A 4D6GA 3RMEA 1OGGA 2ZXQA 4MADA 4AEEA 3HU7A 1HKJA 4OOZA 1KCKA 3N11A 2XM2A 1JDDA 1CZ1A 1HJQA 1W1YA 5I77A 5CGTA 4A3YA 5I0DA 1M03A 3B9AA 1S46A 1LWJA 3AICA 3VU2A 2XG9A 2BHYA 1WNOA 2XTKA 3MV01 1EA9C 1EGZA 3ZSTA 2WMIB 4J3SA 3ZJ8A 3WQ8A 1BFNA 4WSKA 4Z2LA 1EDTA 3VNZA 4CD8A 3T2QA 5LYRA 5CGMA 3OGRA 3WL1A 4AIOA 5JBFA 2Y4SA 1OINA 4PTVA 1E6RA 5A6LA 2CEQA 5LA1A 3AIRA 7TAAA 1ITXA 1E6XM 1UWRA 1BVZA 4H41A 2EQDA 3EBVA 2ZIDA 3M07A 2D24A 1VIWA 3DYMA 3PZGA 3J7HA 3BC9A 2WKGA 1BLIA 2WCGA 4JCMA 3WIJA 2E9MA 2XFRA 1SFSA 2WWDA 2WNWA 4EK7A 2TAAA 4WIWA 3VPLA 1B31A 5FKYA 5JBEA 1BYCA 1CXLA 3A4XA 2XPKA 3MS8A 3NJ3A 3GNOA 3B8SA 3IAPA 3WD3A 2D0FA 1FA2A 3AHVA 4AISA 2JF6A 4OKDA 4P7QA 1MYRA 1G01A 3ARVA 4UFIA 4AZCA 3BMVA 3FHQA 3DYPA 4K68A 1QI4A 4OZOA 4X0NA 2CBIA 2VZOA 1WDQA 5BYWA 1V3LA 2BVTA 1XH0A 1C3FA 1HL9A 1UWUA 2DSZA 3GXMA 3OLGA 3OLEA 5BRPA 3W53A 4CVUA 1GNXA 4UFHA 1UQZA 2VVNA 1RP8A 4L4OA 1KGXA 3GH5A 2G3JA 4J3UA 2DT2A 2DT0A 2O92A 4AW7A 3EMCA 3ZT6A 5AC4A 2J8FA 1DWHM 3AS0A 4AIEA 3HMCA 1FH9A 3AQUA 4HPGA 4U31A 1NWTA 4GQRA 3VVGA 4JFUA 4JKLA 2J7EA 3L4XA 3UETA 2ZXDA 3WENA 4CU8A 3QHOA 1JZ4A 1GONA 1KR0A 1ISVA 3AZSA 4BQ2A 2FDMA 1US2A 5A6AA 2G8ZA 2PB1A 3ARPA 5ABFA 3KL3A 1UOKA 2PF0A 1H11A 4N0RA 1ITCA 3FHAA 2W66A 1NWSA 2WB5A 3AROA 3CUIA 1CDGA 1XSKA 2C0HA 3NCOA 3K46A 2CNCA 3KL0A 1MXGA 2WC7A 1FH8A 4UR9A 3ZM8A 1HXJA 5IFTA 3WH6A 4UQBA 4GZIA 4F9DA 3GXFA 1HIZA 2BV9A 2J7DA 1E0VA 1K9EA 3W6LA 4AIUA 1GOWA 3PZOA 1BGGA 3N15A 4Z2KA 1JYXA 2OSYA 5E0FA 3A6OA 1GORA 1LWHA 2E9LA 2VQTA 5CXPA 2PBGA 2OYLA 1E56A 3VDCA 4JKMA 2YA2A 4J28A 3WFZA 1QNSA 1UWSA 4MNMA 1CLXA 2VI0A 3UG3A 1WPCA 1M04A 3MSDA 1JD7A 2PBOA 1TZ7A 4JAWA 2OWWA 2FH8A 3WDJA 1XCWA 4LYRA 1EO7A 2FHCA 2DSUA 8A3HA 2ZOXA 3GXIA 4B9YA 4W87A 2WC3A 1ZU8A 1H2JA 3PN8A 1BPLB 2AMGA 1EH9A 2W91A 4AC1X 1SYTA 2FH6A 3KE0A 2CKSA 1WDPA 4MNKA 1EOMA 1K9DA 1V3KA 3PHAA 5A2BA 5TD4A 3LMYA 3WF0A 4X9YA 1LL7A 2WVVA 3O2LA 2W5FA 3DHPA 3PTQA 2J74A 1H3GA 4DUVA 2VURA 5GNZA 4BA0A 3L4TA 4PTWA 4E8CA 2BHUA 5CPSA 4S3KA 2ZX6A 1JF6A 2DH2A 3ARUA 1DTUA 1WDSA 3BAKA 5M17A 3AIQA 4GZEA 1W91A 1QI0A 2E8ZA 3OIHA 2WCSA 2JEQA 2OYKA 1QOXA 3F5LA 3AI0A 6A3HA 2VJXA 1E1EA 3CMJA 5E6YA 4W5UA 1VFOA 3SCVA 6TAAA 2MANA 1J10A 5GPRA 5BRQA 1TUXA 1TMQA 1E72M 4U5KA 3AIUA 4PRWA 3MU7A 2ZX8A 3PTKA 4IUGA 4R27A 3L2LA 1E0WA 2VNCA 4WK9A 1FFQA 3KL5A 4MTVA 4NRSA 3A47A 1K6AA 5DEZA 4AZGA 1E70M 1JNDA 2EBNA 3PTMA 3AZRA 1V08A 3W37A 1MFUA 4C7DA 3WUBA 2JIWA 3TP4A 4PYSA 4F8XA 1C92A 3WNOA 3U7VA 2F8QA 3WH5A 3WF3A 2D20A 1E6SM 1FP8A 3MMWA 5I5RA 4KH2A 3SUSA 3AS3A 3KEHA 1G1YA 2VO5A 2XVKA 3OGSA 1D7FA 1WCGA 3MMDA 1HT6A 4AD3A 4X0VA 2ZUMA 3ZO9A 5LA2A 2W61A 1C8QA 2VX6A 1JZ5A 4PN2A 2A3CA 2EXOA 5A8OA 1EHAA 4PMQA 5A69A 2WLZA 2WAGA 2BVDA 3MUY1 4Q22A 3ZJKA 4IPNB 1OGBA 1UR2A 4MB5A 3ZR6A 1NWUA 2ESCA 3QGVA 1UWTA 2QF8A 4ZXOA 4GPNA 1R86A 3TA9A 3VIFA 2W92A 3T09A 1B3ZA 1V3IA 3N04A 4RL3A 3CUFA 3GH7A 4W7VA 1GJWA 4B16A 3WD0A 2CESA 2CERA 4GINA 1WP6A 4KWUA 4UZSA 5A6JA 4PMVA 3U7BA 3N18A 3PZNA 4J3TA 3IK2A 4F9JA 1V6VA 2VQUA 5CJ5A 2G3MA 3DC0A 3L4WA 4M80A 4PUDA 4R5EA 4CU7A 1OSEA 1BF2A 3EYPA 1MW3A 3MO4A 1XV8A 2EPKX 1GHRA 1GOOA 3BAJA 3CBWA 4AMCA 1HJUA 1UZ1A 4U5IA 5E0CA 1GOQA 1VF8A 2Y2WA 3WDRA 3WEOA 4E4PA 2WPGA 4UQ9A 1GVIA 1E9LA 3WSUA 4EAMA 5IHSA 1C8YA 3RM9A 1VEOA 3FAXA 2DH3A 2VZSA 1W3LA 3ARXA 2VZUA 3WQWA 1NWRA 3VMOA 3MANA 3SUUA 2VCCA 2J75A 1HJXA 3B9EA 3LPPA 2YA1A 4LGXA 2PWGA 4YHGA 4UTFA 5F7UA 1C8XA 1UR8A 4P7LA 1UKSA 5I24A 3ZSSA 1ZJBA 3VX1A 3LPGA 3WEMA 3ZIZA 2G3IA 3A4WA 3CIVA 3G6LA 4PEEA 1H5VA 2GDVA 1Q6EA 4GI6A 1HF6A 4DM1A 4B9ZA 3CZGA 3VGEA 3QHNA 1TA3A 3UG5A 5E09A 1U30A 4FLSA 4IISA 2F2HA 3AHTA 3UG4A 1O7AA 1R8LA 1CIUA 1KXHA 2WK2A 5EFDA 5AY7A 2VOTA 4H8HA 1UZ4A 2DEPA 2J7BA 4P8WA 4QCEA 2V3GA 2OWCA 1X6LA 1CBGA 2CXGA 1XYFA 2J7GA 2DSVA 4FMVA 4CVWA 3VM5A 1V3MA 2D3LA 4HOXA 2CKRA 4OJYA 3WH7A 3W0KA 1JI2A 3VINA 1XD1A 3CLWA 4AZCB 4AD4A 3L4VA 3OBAA 3BSHA 4Z2JA 1V03A 2AOSA 2UY5A 1UKOA 3CUJA 3K4AA 3WN6A 5I3DA 4KRTA 2YDQA 2YDRA 5A8MA 1E6PA 3E1F1 1W9PA 5DT7A 3RJYA 5CG0A 3W28A 4H8VA 2XSAA 1QNPA 1US3A 1OM0A 2PWHA 5DF0A 1KQZA 4XV0A 3VD4A 1E43A 1EDQA 5E70A 4CD6A 1W3JA 1LLOA 4UQAA 1VFMA 3WUGA 3ARTA 4AZ7A 1CGXA 3BAYA 4CCCA 1HL8A 3OLDA 3T0AA 4PMZA 3QR3A 2WXDM 1NQ6A 1VFUA 3GDBA 4LYQA 3SCOA 5ABFB 1EIBA 1VEPA 1B90A 1WZLA 3WBEA 3ZT5A 1GQLA 5A6BD 4AY1A 4EE9A 4HOWA 2Y8VA 4JFVA 3CGTA 2GJXA 1AQ0A 1D2KA 1BVNP 1XHGA 3L4YA 1IT0A 4TTGA 4W8LA 1TE1A 2J47A 3ZR5A 4CN4A 1PX3A 4DWSB 1IV8A 2WVUA 1W9VA 3CMGA 4D6DA 4DWSD 4D71A 2IUZA 5JIWA 3BAIA 2VCAA 1E5JA 1W1TA 2V3DA 1J9YA 1EDGA 3AYRA 4HMCA 4TX6A 4ATWA 5CLWA 3N13A 2JEPA 5HDRA 1QVBA 1OT1A 3ZJ6A 4HP5A 4PCTA 1JNEA 1V6WA 1BTCA 4PMUA 1NOUA 2BY2A 4D72A 3VNYA 5D8ZA 1DHKA 2DT3A 1E73M 2ZE0A 1A3HA 1MQPA 1CGVA 4W7WA 5DFAA
chains in the Genus database with same CATH superfamily
2NX3A 2ZX9A 1G69A 1GW1A 1MNSA 2AMXA 4CCEA 3BJTA 4H6KA 4QDMA 4TV6A 2D3NA 2QAFA 1VBUA 2ZRVA 3G0SA 3W70A 2FZBA 2A3BA 4QP0A 2CYGA 2WSPA 2OSXA 1G4PA 1KA9F 1MZRA 3VGHA 3SUTA 3DBNA 4JD4A 3C86A 4RE2A 2AAAA 1O66A 4LVFA 1LM1A 1UH2A 1HQTA 3VNIA 4HNVA 4HK7A 3G1XA 4AWTA 1TVNA 3W22A 3LRKA 2B7QA 4MJMA 4Q3MA 3VFCA 4Q8TA 3AIVA 5F4XA 1CXFA 3GG7A 4OUEA 3BQ6A 4LVAA 1N8WA 4NAFA 2YFNA 3GG0A 3OVRA 3ITVA 3I68A 3ATYA 3LI1A 2E6DA 2FMOA 3V16A 2V5BA 1W54A 2G50A 2QDGA 3SCRA 3BH4A 4PMDA 1ZZMA 2Y24A 4B5XA 3W1PA 1D3CA 3T4WA 1DWFM 2JGYA 3DAQA 3AU6A 1UOZA 4M8UA 4MGGA 1IEQA 5CJMA 4DVOA 3GUWA 3FDGA 4XO7A 1JR1A 1F2JA 1SJAA 3ABSA 4KT2A 2IQDA 4W7UA 1G4EA 3ARZA 1XL9A 4A3HA 1JRBA 4ONVA 2ZUNA 4AVFA 1MRAA 3D5HA 3DHDA 4GQQA 3PP7A 3QMRA 1A5SA 3LZ5A 2X16A 1DJZA 3KVKA 2FGLA 1XIDA 1AH3A 3GO2A 3PF3A 1SGJA 2WZEA 1UHVA 1EZ2A 1H49A 2JGQA 5A1AA 4PUKA 4U4MA 1FKXA 3EA1A 3FIGA 2O55A 3MP5A 4A8IA 3T40A 1UPMB 1UR0A 3CIXA 1SM9A 3POCA 3R4IA 3VD3A 4EPEC 2EPHA 5EMYA 5CQ1A 1DIOA 2QPXA 3UERA 3CS2A 1LCOA 4LVGA 4S3DA 2PURA 3QPEA 1PWMA 1ZJIA 1S39A 4NG3A 2XZ7A 4QJ3B 4F0LA 2Y7GA 3EMQA 4ZZ9A 1IT8A 1F8IA 3UPWA 3CU2A 2D1ZA 4PUWA 4AWUA 1TJPA 1E1CB 4YYFA 1W1VA 4XZIA 4CEUC 3RDKA 4G56A 1JZ3A 4MJ2A 4NYYA 2ZYFA 3SGUA 1XDJA 3O06A 4J4KA 4IT1A 3JS3A 2QCDA 4CGTA 1IT7A 5C9WA 1ADDA 5K4ZA 2YL9A 3BURA 3Q45A 2ZUSA 1MDRA 3K8KA 4FNSA 4DJEA 1TPVA 4A29A 3LCGA 2GLKA 4FNQA 2GGIA 2GZXA 3OHIA 2CFFA 4JTIA 1W5PA 5F2GA 1XDMA 2YXXA 1FWBC 1VYRA 3L12A 4IQDA 1I2NA 1GPFA 1KFLA 1NOWA 4IG2A 3ZLFA 3WMCA 1UD2A 3T07A 1MWOA 1NY1A 3BLLA 2YKKA 3F1QA 1X7IA 2NVAA 3GVVA 1DJGA 1J4EA 5DELA 2E40A 4YNGA 3THDA 2NVDA 1QPOA 3GVGA 3CXOA 4LC6A 1A5LC 4MWAC 5HJLA 2NWRA 1W3IA 2VHLA 3SY5A 4WKFA 4B4FA 3FA3A 3UWWA 1VHNA 2Y5JA 1CLVA 2V5CA 1DE5A 1W3TA 3GNRA 4M56A 4H9XA 3M5XA 3W74A 1W9UA 4J3ZA 1XYAA 1ZCOA 2YYTA 4CQDA 4RW3A 2J79A 1SFTA 3IUDA 3S9ZA 4KIRA 1BHGA 2PGRA 4ZOBA 1JYNA 1PKMA 1WA3A 2ZWYA 5TIMA 5XIAA 2JF7A 3HZ3A 4C6FA 3GDLA 4NZCA 1KTCA 3UWVA 1OYAA 5TNVA 5M03A 3FA5A 1F3WA 1XYMA 2D2OA 2TRSA 1EJSC 4BEUA 1MQQA 3PUEA 3LHYA 5REQB 2J6VA 1OT2A 2DFAA 4Z0JA 3SSZA 4PMXA 5J5DA 4BF9A 3AHZA 3URQA 2BOEX 4J3WA 3GHUA 3LX9A 4KGLA 4FK9A 1RCXB 1XLEA 3C2YA 1EF3A 1Q7ZA 4E5TA 4HU0A 3PZ9A 4HHHA 2VX7A 1J0YA 1R30A 2WMKA 1H0IA 3ZVIA 1KBLA 4I6VA 5MF5A 4W8AA 2PWEA 3EAUA 2QIIA 3WBXA 3VKKA 1AL7A 2OEMA 4DLMA 4Q8MA 3RJXA 2JALA 4YPJA 5AHMA 4A3QA 3LOTA 4H9TA 1B5TA 1E4MM 3EDDA 4DZHA 4GH1A 2SFPA 1UKTA 4ADUA 2CW6A 4F0SA 3HG3A 2Q09A 3H24A 1XFBA 3QBUA 3T44A 1WUEA 4IQLA 2DW6A 5MHBA 4KCWA 2DZWA 2YZRA 3N17A 4ERAA 2B0MA 4UQCA 3CQJA 4LANA 1ENUA 1WUFA 1VFHA 4YCPA 5C7HA 4HK6A 3XISA 3W25A 5GNYA 5JBDA 1XPGA 2YOCA 4WKHA 1VBRA 3U0HA 3AHYA 1UD4A 3UPBA 4JNYA 4GJ1A 3NWRA 3VKCA 3VXGA 3VOFA 1B57A 4C1NB 4ZFCA 4QLJA 4MOZA 1TRIA 1CXHA 4ZO7A 3SGZA 4JX5A 1OD0A 4PODA 1ONRA 4Z0SA 1M53A 3VM7A 2PGWA 2VRKA 3T8LA 2HPMA 3M6YA 3IRDA 1ZCCA 3F7JA 2QULA 3IJ6A 5ABEA 3VOIA 1YADA 2OGJA 4RW5A 1W9BM 3UEQA 4E2VA 4HZMA 4N4PA 5HBFA 5AZ0A 3RGTA 3KBMA 5D2TA 2A3EA 1VP5A 4JIHA 4TOQA 4M29A 1ELSA 3OODA 4XBSA 4LS0A 5C71A 4L4MA 5TF0A 4IFOA 1UD5A 4ACYA 2E68A 3MMTA 3C5QA 1Q63A 2YL6A 1GK8A 1JYVA 5I3IA 4RZ5A 4GVIA 5GJMA 1ZP4A 3BW3A 2V3EA 4PH6A 4FOUA 2Y1HA 2ZUVA 5JUVA 2J66A 1AW2A 2IXVA 9XIMA 3IJLA 3GAKA 2A0NA 4L9ZA 4HN4A 5EMUA 3CUHA 3HJZA 4GC3A 1XLFA 1L8NA 1OFRA 3WH8A 2Y7DA 3TQVA 1AMYA 3WMSA 1GJUA 5FD0A 3MI6A 1I45A 1OGSA 1JCNA 5CAKA 3FN9A 4AXNA 4N42A 1P0NA 3QYQA 1DIDA 3DENA 4DF2A 1W56A 5JVLA 4ZOAA 3CB8A 1UWIA 3G6MA 2VVSA 3LG3A 3F5JA 2HS8A 2Z29A 3P5ZA 3LNMA 4LYKA 4Q8VA 3TQ0A 3Q67A 2YLLA 4UC5A 2XM1A 1R3QA 5J5RA 2V67A 2A79A 1VJSA 5K4XA 3BCFA 4YL2A 3I7QA 2BX7A 5KITA 3T7VA 3LXCA 3H6OA 3VIGA 3MUIA 3E74A 4LS1A 2R1NA 1DP0A 4IFRA 3NPUA 4N2YA 3PWAA 5IFPA 4JTRA 3UJSA 3W29A 3B8VA 4JZ5A 5T8GA 4GFIA 1XYCA 2Q6ZA 1KKOA 2FVKA 2KX9A 1J5SA 4O12A 3VIMA 1E3XA 1UWQA 4V1XA 3M41A 5I02A 2RKXA 5D4YA 5I3FA 3EPMA 1UQYA 5BXRA 1AVAA 3KTCA 1TX2A 4QM1A 3KRBA 4I5UA 3G2GA 4RNHA 3ORWA 3AHXA 3GTIA 2UZ9A 3QSTA 1TWWA 1MFVA 3LY0A 4WCJA 2XINA 3S5SA 5HQLA 3OTRA 3VZYA 4MZYA 1R47A 1H50A 2VL4A 4E8DA 3GH4A 4RNFA 3VIOA 1MUCA 1OK4A 3THQA 4O0QA 1HFBA 3VDAA 3W38A 1GQIA 3TTQA 3FJNA 4IFKA 1PSCA 4ICCX 3MBDA 2C8NA 1QW9A 2PMQA 4DWSA 2Z26A 4YIWA 3RCYA 3AAMA 4NT0A 1XC4A 1VFLA 4XAPA 1MXSA 2ZA2A 4O54A 1ZL1A 4HMNA 4OVXA 3I6RA 2Y88A 3UR2A 3P8IA 4INFA 1SMAA 2HVOA 4E3TA 4AZHA 4WKAA 3E0LA 4CUCA 1OC6A 4HPNA 1AODA 5KETA 5HMEA 2YZ5A 1E6ZA 3NQMA 3NPWA 4IXHA 3FK4A 1JZ8A 5HMSA 1XKYA 1XP3A 3H12A 8XIMA 3DGRA 2ZADA 1XYZA 2DIKA 1V6YA 3MV11 2I5GA 3W2KA 2PAJA 1D3HA 1R9XA 3W7QA 5JH1A 1R7OA 4AX6A 3AMDA 4WVXA 5G1MA 4JTJA 1OC5A 1E0XA 2Z28A 1K9TA 2CHRA 1RR2A 3F2CA 4LB4A 2ABBA 2Z1SA 3OQ8A 1FWAC 5I2UA 3YPIA 2OLSA 2VEIA 1B4KA 4D6JA 2NWSA 4IMDA 4GYPC 3KFTA 2BGSA 2VYOA 1LROA 2WMGA 4YN5A 3BXWA 1QO2A 3CUZA 4HQVA 2Z1KA 4A8LA 4B5NA 3L4ZA 2EHHA 1EC9A 4HPJA 3E0VA 3UBPC 1PCKA 1RHCA 3N9SA 2OGYA 3BLOA 4WLCA 4UIOA 2PDGA 3FSUA 3G1VA 2A3AA 1AK5A 3LQGA 1Z3NA 3EPOA 3T0CA 4MYXA 1KWGA 3GXNA 1R2SA 4GQGA 1TQJA 2EPOA 2HEJA 4UTWC 4G8TA 5C5YA 3NQ2A 1P0EA 1OWQA 1SJCA 3GYCA 2D2JA 3TYDA 3MJMA 2HROA 1Q45A 4HCDA 4R85A 3SRDA 4KESA 2VGGA 4DUXA 3SJ3A 5F2LA 1G4TA 1XCFA 1L0PA 4IQEA 3GBDA 3VO0A 2RUSA 3M5ZA 5DLCA 4CCZA 1IXNA 2FGBA 3TLLA 5LXEA 3P7YA 2X09A 4Z2GA 1TWIA 3EEGA 4MSSA 2KAUC 3A13A 2EPLX 4LFYA 3THCA 3OZYA 2XVGA 2CZVA 2ISVA 1DWGM 3RLVA 3W00A 3G77A 4AD2A 1E40A 3W7KA 1IR1A 1Q7QA 5HK4A 1BYAA 2ZA1A 2PDFA 3W1NA 2YR1A 3N34A 4HYRA 2PF8A 5EBAA 4FPSA 2XYLA 5DCDA 1TR9A 4JQAA 1J01A 2YIHA 3B0UX 2R14A 4ZXLA 3MVTA 4XG1A 4AG0A 4ACZA 2ZRXA 1X1ZA 1YX1A 3ZJ7A 1XUUA 1QATA 4QRNA 2X8RA 4LVBA 3UESA 3VKDA 4Q8PA 3LHVA 4PMYA 3TQPA 1SO4A 1E71M 2VC5A 1QPNA 4GBDA 5HAOA 1Q6DA 8CGTA 4S3FA 3WQOA 1A5OC 1YTEA 5DRIA 4W84A 3DHUA 3M4HA 1F61A 3IWPA 1HG3A 4H8UA 4Y2WA 3ZWTA 1PX4A 3HFTA 3REQB 3OZPA 2Y62A 2F61A 3H70A 4H1ZA 2ZRUA 3DG6A 4PTDA 2OYMA 3PTDA 3C2EA 1T8XA 4H8NA 3ARRA 1S1RA 2DIEA 1NDVA 6TIMA 3GZ3A 1E6QM 4NIRA 4YVXA 2I9UA 4JTTA 2O0TA 3DZ1A 4AQLA 5FJPA 2BHZA 3GFZA 3CZ8A 1GKRA 2OO6A 3EWUA 2VX4A 4AYGA 2PZNA 3EKZA 3OG2A 1HJSA 4LV4A 4K36A 2Z25A 4MY9A 1E6NA 3KOYA 2V5KA 2B31A 3O63A 2OFJA 4FOJA 1JZ7A 3URAA 2PLCA 3KBJA 2PDYA 2WHJA 4R9XA 1MW1A 2WHKA 3HBLA 3VD9A 2ZXBA 3LV6A 2R1PA 3LV5A 3NQGA 4K8HA 2VP8A 4O50A 3V5OA 5AVHA 2E09A 4DI8A 1J11A 3G3MA 4OGZA 1W0MA 1PXGA 1CEOA 5CZ0A 4C6DA 4EKJA 3QW3A 3BQ5A 2RGMA 3WBAA 4ERGA 2AKMA 1O60A 3DUGA 3PPGA 1R87A 4ZFMA 3NQVA 3WF2A 1IYXA 1FX6A 1BSIA 1GYMA 5FA5A 5LIYX 4L1XA 3ALGA 1TPFA 1GT8A 3BWWA 4W5ZA 5AVNA 4TO8A 3PG8A 3KWSA 1ME7A 5LZLA 2OEJA 1GKPA 4RE4A 4DZAA 1UIPA 4HYWA 3H2NA 1JD9A 4FXSA 1VENA 3L21A 5AHEA 2E3ZA 4W89A 1ZY9A 4OBSA 4NZ3A 3AWNA 2OOFA 5LNVA 3DI0A 3H21A 2RDXA 3WLPA 3F2BA 1DWAM 1UB3A 2X30A 3NZRA 4TQTA 2B4GA 4RNIA 1L2UA 4JEQA 1FP9A 4LWWA 1OGGA 2ZXQA 1Y5WA 4AEEA 3IUIA 4K39A 2XDFA 1HKJA 1KCKA 3EWCA 1ZGDA 2Y7FA 3EEZA 2E6AA 4QJ5B 5FI8A 5I09A 4A3YA 4LUIA 1LWJA 5FJUA 3C61A 3U6WA 2XG9A 1WNOA 4Y8FA 1YDNA 1O1ZA 3ZSTA 4V15A 3NZ1A 3ZR4A 2NQJA 3R94A 2H90A 2ZBTA 3OGRA 4LAUA 3WL1A 3ITOA 1BF6A 1OINA 4E4FA 3OBKA 5A6LA 1ITXA 1E6XM 1ZHAA 1IIGA 2EQDA 2P53A 1JUEA 3EBVA 2D24A 1VIWA 2ACSA 3GU9A 2WKGA 4NAEB 3GC4A 1TV2A 4EXBA 2E9MA 1SFSA 3S4TA 1KO0A 5FKYA 1R0MA 2QEZA 2VFEA 3E3HA 3ANVA 4E3VA 2V8ZA 1MEHA 3WD3A 3W83A 4AISA 1M7JA 4XAGA 2HQAA 4P7QA 3D0CA 5HULA 1MYRA 1ITQA 4Y96A 3RLHA 3HV9A 4KQNA 1H51A 4L9XA 1FXPA 1V3LA 3LA4A 2FQIA 3GG8A 1C3FA 4H6EA 3OLGA 4DJED 3W53A 1A4MA 4Q32A 3W3OA 4NASA 1KGXA 2BASA 3GH5A 3L5AA 2DT2A 4QDPA 1SUXA 4IGMA 2O92A 1JCYA 4AW7A 4ZL1A 3H22A 3RN6A 3C0JA 1FH9A 1QASA 3AQUA 4HBKA 4HPGA 4U31A 3WJYA 4O1CA 1DVJA 3JU2A 1EJRC 4JFUA 5K9CA 1S2UA 3UETA 2ZXDA 3UT0A 4LEFA 1ZQ5A 4CU8A 4HTBA 4PUNA 1GONA 2FDMA 5C55A 3ARPA 4LH8A 3A64A 3MKVA 1UOKA 1H11A 5FF0A 4MWAB 4JTGA 3FHAA 1H1ZA 1XBZA 3ME3A 4D2JA 3CWOX 4IJBA 2AKZA 1FWWA 3VAVA 3BL3A 3T9PA 2NSOA 1MXGA 4O8RA 3RX2A 1Q6RA 4UQBA 3NQBA 3UY8A 2QW5A 2ZVIA 2GVLA 1K9EA 4LAKA 3W6LA 4AIUA 1GOWA 1JUBA 4ZQCA 4IF2A 5ABTA 4ZB2A 2ATSA 4POCA 4HIBA 3WBWA 1JYXA 5E0FA 1YPXA 4DAFA 4PULA 3ONBA 1QNVA 4NQ1A 1E56A 3FEMA 3F4NA 3WG6A 3RR4A 3WO8A 3VC6A 1Z44A 3UG3A 4NNCA 1WPCA 1A5KC 6REQA 3MSDA 2FH8A 4M0XA 3DHFA 3WDJA 4GX8A 4YLWA 5BMWA 4LYRA 4WGHA 2NVCA 2FHCA 1S5WA 1FY6A 4WD0A 2OPJA 2P88A 1Y5XA 2OG9A 3UJEA 3MZNA 3H4XA 1BPLB 1EJWC 3DN5A 1ONXA 1SYTA 1TZZA 2FH6A 2Q3OA 5TD4A 5KMYA 4FEZA 1LL7A 1LRQA 4HA0A 3O2LA 3W72A 1FHUA 2PDBA 1QO5A 4NNAA 1H62A 4PTWA 4E8CA 2BHUA 3FCPA 1LZOA 3QM3A 4S3KA 3EX6A 3TZNA 1OZMA 4I9TA 5M17A 5AYXA 4GZEA 2PRLA 1W91A 1QI0A 3V5CA 2WCSA 2JEQA 2OYKA 4RJEA 1XX1A 3AI0A 3CMJA 1S2TA 6TAAA 2G4JA 1VD6A 1TMQA 3E2VA 1E72M 3D3FA 3W6YA 4R27A 2ZX8A 4GG9A 1POJA 2ZZ2A 1R3WA 5AHLA 4NRSA 1XIBA 4UTWA 4A22A 5DEZA 4QAIA 3HPZA 5LIKX 3TC6A 3AZRA 1V08A 3W37A 1R46A 4F8XA 3WNOA 2VC7A 1FWRA 3WF3A 3MI3A 3BG5A 3OHMB 5I5RA 3OPSA 4GXWA 3LHTA 3OGSA 1YDOA 4A35A 4K1WA 4IGHA 3BV4A 4AD3A 4QJ4B 3OVGA 3W7LA 2OEKA 3TKFA 1SJDA 1JPIA 4M19A 2A3CA 2W79A 3NGFA 2NX1A 2GQ9A 3ENLA 5CC3A 4REQA 5A69A 1TTPA 4UTTA 4TX9A 3MUY1 1SO6A 4Q22A 4IPNB 4MB5A 3CAQA 2HXUA 1NWUA 4BEQA 1YTKA 3Q37A 1R86A 3B04A 5FAGA 3PBYA 3VIFA 3HB9A 2W92A 2ACUA 3PJTA 1WV2A 2IPGA 4YTTA 4ROQA 4RL3A 3CUFA 4WY0A 1GJWA 1OFQA 4B16A 2PTXA 2QF7A 4UB9A 3STGA 3INPA 3U7BA 1JGMA 5TQLA 3QV6A 1V6VA 4PR4A 1GVFA 4DYJA 3T8QA 2FFIA 2YCEA 3BV7A 4Z08A 5L9FA 4CU7A 1NIUA 1KRAC 1KNWA 1OSEA 4MZ8A 3SQSA 4OFCA 1J79A 1GHRA 3BAJA 3CBWA 1UZ1A 3TYEA 2PDUA 1XG3A 3EOUA 5E0CA 3WDRA 4E4PA 1IEIA 4EAMA 3RM9A 3B8IA 3GQYA 2DH3A 2VZSA 3RMJA 3ARXA 3LXAA 2NX9A 4LEQA 4JDBA 3R13A 2ZRWA 4WOZA 2ZE3A 3LPPA 4O1AA 4LGXA 1TSIA 5F7UA 4LCRA 4LBSA 3GE7A 2PWVA 3MWCA 4GVGA 3IVSA 1J2WA 4I5XA 3M0ZA 3V75A 5E09A 3NO3A 1U30A 1UMYA 3E2SA 1YBQA 5EFDA 5AY7A 2VOTA 4H8HA 2DEPA 4O28A 1PZ1A 2AQOA 4QCEA 2E25A 2V3GA 1GZGA 3EX1A 2ISWA 5CEWA 2J7GA 4LJ3A 3THAA 2CKRA 3R8GA 1ALDA 3KLKA 1XLGA 3VCCA 3WQPA 1E9YB 3VINA 1XBYA 1RJRA 1O5KA 3M9YA 4LU0A 3TW7A 4OECA 3P3BA 3KOXA 5I00A 4KWSA 3WN6A 3VYLA 2A2IA 1JDFA 4J35A 1OFDA 4ZODA 3E1F1 3S8HA 1AUSL 5CG0A 1XBVA 1O68A 4GOAA 2PWHA 3MVIA 3GTFA 5DF0A 4XV0A 4OBTA 1EBGA 2HNHA 5DRCA 1LLOA 3EWBX 5IM51 3VKJA 3UG8A 4DBEA 4UNKA 3OLDA 3MJYA 3IIXA 2WXDM 3FS2A 1EGMA 1EIBA 4AXKA 1B90A 3ZT5A 3H8AA 4EE9A 4JFVA 1D2KA 1DV7A 3ABXA 3NM1A 3L4YA 1EXBA 3RCMA 2AL2A 4FB7A 2GPTA 3EX4A 1VGAA 4D6DA 4BWLA 1DJYA 4DWSD 4UTKA 4PZVA 1E5JA 5CLWA 4A21A 4KEUA 4PCPA 2PPGA 5HDRA 4C6IA 3H26A 3R2GA 2VXNA 3HA1A 1V6WA 4PMUA 3EOSA 2NQ5A 2BY2A 4GQ0A 5D32A 1F74A 3LS9A 1DHKA 1OQFA 2DT3A 3GSMA 4H9UA 2R24A 3VABA 1EEPA 4GZ7A 1XC6A 2QNEA 2YCLA 1F7BA 1EP2A 3H2AA 3R7MA 4K38A 1QAPA 4L6DA 4RDYA 3IVTA 1KGWA 3IEBA 3QR0A 3UY7A 4B90A 2QLYA 3ERPA 1B1YA 3T6CA 3A9BA 1WKFA 4GK8A 1QXLA 1R3VA 5E1QA 1KBIA 4PB3A 3RR1A 4C6MA 1AH4A 3O7UA 4ORIA 2XFFA 1BWLA 1KM0A 2D22A 4ZB5A 4DRSA 3W81A 1P7TA 1I6NA 2VWSA 3CQIA 2VRQA 1KM2A 3KBNA 2WKLA 3IIPA 1RLDA 4NF7A 3LHUA 3O9NA 4LOCA 3DEQA 2ZICA 3UFYA 4JY8A 2CWXA 1SW7A 3QYSA 3B3DA 1PIGA 2C3ZA 1E1FA 3L2MA 2E8YA 2OWXA 3ITGA 4B15A 2I5IA 3U2CA 2X0YA 1F76A 1FBAA 3MA8A 1EX1A 1QCWA 3P62A 5HWNA 9CGTA 2J62A 1QI5A 1JRCA 4IPPA 3RRXA 5JXQA 3LHWA 1B9ZA 5CGQA 1VPXA 2CXEA 4LUTA 1B2YA 4A3UA 1XPYA 2RDUA 2PA6A 2CWNA 4LV9A 4KFPA 1I0DA 4F2UA 4NKCA 1JFXA 4IGSA 2BGQA 1VPQA 1T7LA 4XZWA 4G6CA 3SO7A 4DJDC 1W1A1 2WZIA 1PCWA 4PBGA 4J7RA 1KTBA 3CO4A 1AJ0A 1CT5A 3ZQ9A 4JIRA 1BYBA 3IS4A 3WD4A 2XGZA 4LQ1A 4N9EA 2XIQA 3RF9A 5HOSA 3TONA 3H4GA 3FY1A 4GUHA 5KEZA 3AJ7A 3EGJA 3WD1A 3M6DA 1CB7B 1TWZA 1YE4A 2VC9A 4NI3A 1N2VA 3CHDA 1JAKA 1I75A 3R0DA 1IHIA 4ZBCA 1ZPTA 3WLOA 1V0NA 5EMJA 4FX6M 3EB3A 5DY3A 1BSLA 3S2MA 3BLPX 4GUIA 1FCBA 1Q13A 3LLFA 3IIVA 2H8ZA 2WQDA 3GNPA 1VB9A 1M65A 3AMKA 1PO9A 2H3BA 3T0DA 3VIKA 4PUEA 1WBHA 2V63A 4H6QA 5F2MA 4EF9A 1EYWA 2PWUA 2J4GA 2OKOA 3ZMRA 1CXKA 2R6OA 3KAOA 2OSWA 1VFSA 3MY9A 1JVNA 1P6CA 4G7FA 1XLMA 4S3GA 2XIOA 3DFPA 3W7MA 2WZTA 4US5A 4IPJA 4UTJA 1JI1A 5CC6A 2ADAA 1TVPA 3DH7A 4KGJA 2YA0A 1FWFC 2LLEA 5DANA 3I6TA 1V7AA 4LAZA 1E4NA 3S83A 4V1YA 1CXEA 4DBSA 3A23A 1PIFA 5A3HA 2NV1A 2PCQA 3UGVA 4HU8A 5C8BB 3UYIA 2ZWZA 4J3VA 3I10A 2EF9A 5L6UA 1VBGA 3G8RA 1RY8A 2YDAA 2HVNA 2YL8A 7TIMA 3TUUA 2HK0A 4D6HA 1YXCA 3WF1A 1YBQB 2WBKA 5H8UA 4BI6A 4DY1A 1GCYA 2GSEA 3GHSA 2ZX5A 1OFEA 2JKPA 1H61A 4HCLA 1VQTA 3GK0A 3PULA 1KBKA 4MNLA 2XGBA 1IZJA 2ZFAA 2UWFA 2GSJA 3WLIA 1VRDA 3IGHX 2IPFA 4P8VA 4ZMGA 3G1DA 1ODZA 5BWFA 5A8QA 4FIRA 3RPMA 2ON3A 3SDOA 3CL7A 3APGA 3I3BA 4XUYA 3EDJA 2WLYA 1SO3A 3N4AA 4DJFA 1UW9A 4JIEA 1CW2A 1PE1A 3EWDA 1H0GA 1FDZA 3TTEA 1LJYA 2J27A 1XS2A 2ZXAA 1TTIA 1FWHC 3N3TA 1CPUA 3RM8A 3ANUA 4IOTA 4JN7A 1YKWA 4M6UA 4UFMA 3BAXA 1IXPA 2NZLA 4HKPA 4U3CA 3SIZA 4UQDA 5A5WA 3GVWA 3VNLA 5ECUA 2ZZ5A 4W86A 1P0KA 2BXZA 4LSBA 1NDYA 2DP3A 1UC4A 3IJ8A 1Q6GA 4HNUA 5CKSA 2BP1A 2FJKA 1W9XA 1UKQA 4IL0A 2ZUUA 3WDQA 2VGFA 1FCUA 4Q4MA 5BXPA 1QW8A 1L6FA 4CQ8A 2AL2B 5GQBA 2A4AA 3P74A 1A5BA 2VX5A 1LUCB 1F5ZA 1VBJA 1ZB5A 1RD5A 3WQFA 5FSDC 2PDJA 3WQ6A 1QU4A 4IMEA 3TXVA 2PGEA 1F6PA 4EF8A 1T99A 3DBPA 3PZVA 2YSWA 4GYKA 2NSXA 1OFAA 1AJZA 2QT3A 1HKWA 4H2CA 3DKJA 2RFGA 5EMKA 5DXXA 2V81A 1UASA 3LPOA 4GY0A 5HNNA 4D6FA 2X2GA 4C7GA 3PM6A 3H2FA 1ADOA 4JPGA 1Q6LA 1XRTA 3MUAA 1OCQA 2XISA 3KBWA 3WQVA 1UIOA 3RIKA 1TJ0A 5HR7A 1VEMA 1L2QA 1XI3A 1S1PA 4U3AA 3W88A 6XIAA 2XSXA 4ATLA 4BR1A 3THUA 2PDHA 4Z2HA 4TUFA 3N2MA 3GC5A 1L6YA 5G2IA 2WZHA 3KDOA 3BDKA 1BGAA 1KGUA 5D2WA 3EWWA 3KBSA 5RUBA 1J0IA 4E2DA 2UBPC 3KRSA 4C90A 4HTYA 1UH3A 1P7TB 2Z7KA 3CUGA 3E0IA 1HVXA 2GGEA 3PNZA 2YFOA 3V36A 3JVAA 3B05A 1ZS2A 2BY1A 5HUPA 3R8HA 1C29A 2YXGA 1R85A 4GISA 4F66A 2CHOA 3TFCA 5IBXA 4J9JA 3W73A 2BG5A 2XN2A 1K8XA 1NH6A 1PPIA 3QV8A 3GD6A 2Q02A 1JXJA 3S3GA 3R1ZA 3O6DA 4RDZA 1HUVA 3BLKA 1DJNA 3IJIA 4AYSA 4JY9A 3BOFA 3EB4A 1EKOA 4GIAA 4WXZA 2PE4A 1R3TA 2IKJA 1HJWA 5GVJA 1AQMA 3W84A 3NDZA 4I90A 2J25A 1FVPA 3ABOA 3W7JA 1V6XA 4DQWA 2E77A 4E4UA 3N3MA 4GBUA 1UA3A 2X1RA 3F4CA 5AYIA 2BS9A 1TR1A 2XIIA 1W6TA 1OJXA 4AD0A 1S5MA 5BROA 3LENA 2AL1A 3TDFA 4ZCWA 1A5CA 5AFDA 3DESA 3HG2A 1QT1A 4D6IA 1H7OA 8XIAA 3H55A 2ZZ6A 2WW5A 1UR4A 4I7VA 1R3YA 1W1ZA 1GQNA 1T40A 3W7OA 2YX0A 2QJNA 3VFLA 5HJYA 3T42A 5LHEA 5GJNA 2I1OA 1SR0A 1DJHA 4DO4A 2G4FA 4LUJA 4JCLA 3R10A 1XIMA 4W93A 2WVVB 2J88A 4IQJA 3IANA 4U33A 2EO7A 1HNYA 3V1HA 2DVXA 5A94A 4JFTA 1GVOA 5F4SA 4XIAA 1EWEA 3S2CA 3TQKA 1UC5A 3DGBA 5D9MA 2DZUA 3WDPP 1KCZA 3PANA 1BWKA 4ZGYA 4HZ6A 2ICSA 4MPQA 1YHTA 3OP2A 2OR2A 2Z4GA 4EXAA 4F2TA 1ZAIA 1UR1A 5F1UA 3FGCB 1VIZA 1ZAHA 1DQUA 2GUBA 1C9WA 1JUKA 3NURA 3OU8A 1C8VA 3SQMA 1V5XA 4CQBA 2VEMA 5ABHA 2DZXA 2QCLA 1YDYA 4UFJA 1IR2A 1VS1A 3ANYA 3OW1A 3QRHA 3C56A 2FJUB 4O11A 4O8AA 2GFTA 3QHMA 3O6YX 4C65A 3BZGA 1CNVA 1S2WA 1K4HA 1MXDA 4JR5A 1M9HA 2X1SA 3M46A 3ARQA 3CB3A 1WZKA 3U4AA 4QSFA 5E9AA 1NF0A 3AYSA 1LQAA 1NOFA 2DV0A 3E96A 4KEVA 1YEYA 2FB3A 1NARA 1TTQA 2UY4A 4B3KA 4UCGA 2VOMA 4P8UA 3U57A 3W26A 2CBJA 3SCQA 5AC5A 3ITCA 4LF2A 1E4LA 1XFCA 4M6VA 4FIQA 5CZTA 1GKQA 2JE8A 4R7OA 4UR7A 3VNMA 4G5DA 4FO4A 1JXKA 5BCAA 2WWCA 1EZWA 4JTAA 4WDUA 2CLKA 4BHYA 3LMZA 4IJCA 3AUOA 4GO8A 3TYCA 5LKYA 5LNWA 2QDEA 3DFQA 1K7FA 9XIAA 1TPH1 1H09A 4JHZA 1OD8A 3CHVA 2A1YA 4HZ8A 1EFZA 2CZFA 2W67A 5HANA 2PDQA 3TX9A 2CLLA 1EF2A 4DBUA 4Z1YA 3KXQA 2QUNA 1E51A 2G41A 1XRSA 3B9DA 4QNEA 4FLOA 1KXTA 1GHSA 7ODCA 1UP0A 4ZA0A 3V7PA 1KFWA 6CGTA 3KRZA 1A5MC 3GDTA 2B7OA 4A2SA 3ZS4A 4JXCA 4C5ZA 4CU6A 2HBXA 3PBVA 3L5MA 3A3HA 3MHGA 1G0CA 4X2RA 3IIZA 2DQWA 4W88A 4C6LA 3S46A 1S2VA 1B3XA 2AGKA 4Q7NA 1B30A 1NFGA 2V82A 1CGYA 4BS0A 4PMRA 2BVYA 3TIMA 5CSYA 1IGWA 1OVDA 5BU6A 4IH3A 4IM4A 3RRAA 3DKLA 3UJRA 3W1QA 3S1WA 4I9JA 3C0SA 5IDZA 3TSDA 1QTWA 5HNUA 2CPUA 3NYZA 1KCXA 2A5HA 2HPIA 3EXTA 4KRUA 3GXPA 4MFEA 1O5RA 3CTLA 3VKAA 1IEXA 4XB3A 4UQEA 3HMJG 2WKJA 5FL0A 2VR2A 3EKLA 3G22A 5CPOA 5H91A 2HTMA 4CNUA 3GYEA 4N4QA 1U2YA 4AWEA 3KLLA 2JBMA 2V38A 5C0QA 1K77A 1FHDA 2TMDA 5FEPA 3OZOA 1QNRA 3W02A 2X41A 3P0WA 3UPMA 5BXTA 6PTDA 3ITLA 4MM1A 4H7VA 3VIIA 4FF5A 1G4SA 1M7XA 4MJZA 3TTSA 3FKRA 1R5YA 1ITUA 4WJ8A 1XYBA 3CV7A 1KR1A 5DXYA 2VEKA 3QLLA 4J27A 5XINA 5HPCA 1SFJA 1B3YA 5KZEA 4RX0A 1LBLA 3NSXA 4BY3A 1PZ2A 5DT5A 1NF7A 1KXQA 4XK2A 2AAMA 3ITXA 3L0NA 4JEJA 4AZIA 2UV8G 4QE1A 2O7QA 4Y8EA 3VGGA 3QLDA 4JKKA 4QJ1A 1IEVA 1DE6A 3LM7A 1UUMA 2QPUA 4WSHA 3MUXA 4RXGA 3SM0A 2WSYA 2QJMA 4PFMA 3KTSA 1JL8A 2PDNA 1E1CA 5CSSA 4LAOA 1FUYA 4QS5A 1NJJA 1A80A 1CGTA 2CETA 2XVNA 3DU0A 4LS2A 4TTUA 2X1TA 3UYCA 2E9BA 5CCZA 4QR6A 3UF9A 5EFFA 1YRRA 3SRKA 3TJLA 5G4WA 3VCRA 2Z2AA 1KCLA 4Z2IA 4AHQA 2QXWA 2ACQA 2HMCA 2CZEA 2C14A 1VLIA 1LG2A 1AQHA 1TMHA 1ZBWA 1XW8A 3ZZ1A 2BXVA 4H04A 3OB8A 3DC8A 4UOJA 3SW6A 1XXXA 3HG5A 1BXCA 4NJGA 4DYEA 1MMFA 1NDWA 3TVAA 2A7NA 1SW3A 1JGIA 1W1IE 1C93A 4HB7A 3ECQA 1YTDA 3S6TA 3NZGA 5FJTA 3S1UA 3UWUA 3TAKA 5EGRA 2EJAA 2W4XA 2GYIA 1QPKA 4E2OA 3G1YA 3WQ4A 6ENLA 4MAVA 1LF1A 3TW6A 1HKVA 4L6OA 4A4AA 4RDWA 3N4EA 5I06A 1MSSA 4EWJA 3MMUA 3II1A 4KCVA 1H1YA 4R3UA 3ITTA 3M5VA 3FLUA 3JUGA 4GIRA 4CQ9A 2C7FA 1TV3A 2WCAA 2F6KA 3HPFA 1PEZA 3NDOA 4NNBA 1UWAA 2NLIA 4MJ4A 3KS6A 2EKGA 2JQXA 2PZ0A 3N6JA 4CN1A 1XIFA 2PUZA 3NSMA 1VFTA 5REQA 2MNRA 4IXXA 4CN6A 1OEPA 5LGZA 1GWJA 1Z9AA 4RR4A 3JZUA 4QG9A 1V0LA 2PDLA 4UNIA 3GAYA 5DMMA 4WDWA 4GVFA 1C7SA 1V02E 4AU0A 2C16A 1BYDA 1KC7A 1Z42A 3O0FA 3N11A 3DG3A 3QVQA 5CGTA 2R8WA 3TROA 4HNTA 5LGXA 3VU2A 2XTKA 1EGZA 3KRUA 2WMIB 3ZJ8A 1BFNA 4WSKA 1XRFA 4CD8A 4IIEA 3T2QA 1JJKA 3M0LA 4QXIA 1E6RA 2WNQA 4O52A 2ALRA 2VM8A 4RZ4A 4NHVA 1UWRA 3LN3A 1AJ2A 3VE9A 5H6HA 1ECQA 3HGSA 3DYMA 2Y70A 3J7HA 3BC9A 3GW3A 1BLIA 3G8EA 4TMCA 3UVAA 2QIWA 3WIJA 1WDDA 2XFRA 1ZTVA 4KETA 2TAAA 3T05A 1B31A 3VA8A 3A3XA 1S5NA 1BYCA 3A4XA 4C6BA 2XPKA 3MS8A 3NJ3A 3GNOA 1Q8JA 2VWTA 3B8SA 2PDCA 4LY4A 3G18A 1FA2A 3AHVA 2JF6A 4L61A 4OKDA 3FEQA 1GVEA 5D38A 3BMVA 3FHQA 3DYPA 1TJ1A 1PTDA 3QTPA 4AMAA 4X0NA 2CBIA 1FCVA 2BVTA 2ZZ1A 4GQBA 5BWAA 1TO3A 4NXKA 3U2EA 3OLEA 4US5D 4KEMA 5J8LA 1GNXA 1YYAA 4UFHA 3WYZA 1UQZA 4C1NA 1RP8A 2E5BA 4F0KA 3QPYA 2PC4A 3U2ZA 4J3UA 2DT0A 4XKMA 3EMCA 5AC4A 1D3GA 1PTGA 1DWHM 3DFHA 1YLVA 4AIEA 4QGCA 3SY8A 1W1B1 4K1GA 4LAMA 2X7VA 1VCFA 3OEXA 2FTWA 4UNLA 1ZAJA 4S3AA 3QHOA 4HU4A 4Z1DA 1F73A 3DX5A 5D2VA 1KR0A 1ISVA 2P8BA 5A6AA 5G2HA 4ML9A 1RUSA 2V5JA 4LCSA 5ABFA 1TMLA 1V6TA 4HK5A 4DO6A 1S5VA 5CAHA 1TELA 3AROA 3CUIA 1CDGA 3LI0A 4IGNA 1XSKA 2C0HA 3QR1A 3NCOA 3K46A 1K8CA 2GVGA 2CLEA 4UR9A 3ZM8A 3LB0A 1GW9A 3IACA 4GZIA 4O4WA 4F9DA 2BV9A 1P1XA 2RHGA 2FZDA 3F4WA 3O16A 1FDYA 4L80A 2WOQA 4R34A 2OO0A 4R9OA 1GORA 1E9ZB 1OX5A 5HATA 2PBGA 2OYLA 3M44A 4J28A 3RO6A 4CLMA 3MZ2A 1QNSA 4MNMA 1CLXA 4DJFD 5ECVA 1XDLA 2GQAA 4PBFA 4JIIX 1XISA 4JTKA 2C19A 1MO0A 3CV6A 4B9YA 4ES4A 4GE8A 4IX0A 1EH9A 1MZHA 1Q65A 2Z1WA 2CKSA 3VZZA 5FAJA 1EOMA 1JCXA 1V3KA 3PHAA 4YVVA 5LIXX 3LMYA 4EIVA 2J74A 2FPYA 1H7XA 1A3WA 4HNCA 2ZX6A 1JF6A 1DTUA 5JH2A 3EXRA 1WDSA 1TX0A 2OVLA 1UZHA 3AIQA 1LLZA 3C2OA 3H53A 1POKA 3F5LA 2ISFA 4H00A 6A3HA 3KOFA 5E6YA 4W5UA 4FP1A 5EKYA 3UJ2A 5FACA 5GPRA 1TUXA 2ALDA 3AIUA 3DFTA 1G6CA 3P8JA 1E0WA 2VNCA 3P60A 4WK9A 1OFOA 4U28A 7XIMA 4I8DA 2OZ3A 3KOZA 2NUYA 3PTMA 4LRSA 3V35A 4AB4A 5D04C 1VLWA 2JIWA 3SJNA 3M0YA 3TP4A 1EEXA 3U7VA 4KS0A 3CYJA 1NAL1 5HINA 5JU6A 3AS3A 4UR8A 2XVKA 4DNMA 1D7FA 1BXBA 2ZUMA 1EPXA 1T8QA 3OZMA 1C8QA 1TZ9A 4EWND 2VX6A 2G95A 4KEZA 1A0DA 1W5NA 2ODOA 1EHAA 4PMQA 4A8RA 2WLZA 2NXIA 2WAGA 1ZP3A 1UR2A 3SFWA 3E5BA 1UWTA 4UMBA 4ZXOA 2YBVA 4IP5A 4IMGA 3WJXA 3PUGA 1ADSA 2QKFA 1B3ZA 3N04A 4AEOA 3GH7A 3HGJA 4E2BA 1DORA 2PDKA 4UZSA 4PMVA 5LXXA 3G0UA 1NQKA 2VQUA 5CJ5A 2G3MA 3DC0A 3BG9A 3L4WA 4M80A 4CNSA 1N55A 1QUMA 1TREA 1BF2A 3V18A 4GUFA 1JCMP 1H7RA 1LT7A 1Q3NA 1MW3A 1XV8A 2EPKX 1GOOA 4O0KA 4LTSA 1KW1A 3S1XA 1HO4A 1XQLA 7REQB 3G1FA 2WPGA 1YE6A 4KFOA 4NP7A 3W2MA 1GVIA 1PVNA 2WM1A 4K2SA 3WSUA 3WK1A 1TPEA 2XH7A 3FAXA 3GFYA 3E5PA 3QZAA 1W3LA 2VZUA 1NWRA 1O5QA 3MANA 5F2IA 1F8MA 1XGDA 2YA1A 1L6WA 3N73A 4YHGA 2PTYA 4UTFA 1VCVA 3S5OA 4BF5A 3CL6A 4GH3A 4P7LA 1UKSA 5I24A 2NQLA 3GR4A 2WJEA 5LIUX 4O16A 4GLEA 5FJJA 2GDVA 1Q6EA 4MMWA 1RXOB 3CZGA 3VGEA 3TYZA 1TA3A 5EA9A 3R0UA 4FLSA 3AHTA 1O7AA 1AFSA 1IIHA 2WK2A 3STPA 3BE7A 1OG6A 3SECA 1QR7A 3MBFA 3LCLA 3EPNA 1U22A 4GX9A 4AIBA 1H7WA 2DSVA 4FMVA 3VM5A 1V3MA 2Z7GA 3E38A 3N2XA 3TYBA 5BU9A 3NA8A 2EAWA 4GCAA 1CI1A 4N6FA 1QW7A 1TYGA 3NQDA 4Z2JA 1V03A 4MFDA 1XWYA 2VFHA 1FDJA 2UY5A 4L64A 4O1EA 3AXKA 4N02A 1TPWA 2G0WA 2YDRA 3G1SA 2YCKX 4XBJA 5DT7A 1US3A 1XICA 2ISDA 4KCUA 1KQZA 8RUCA 4MZ1A 1F6KA 1E43A 2YW3A 4Q7IA 3CL8A 5E70A 5AC6A 5EL1A 2V6AA 2ZVRA 2C18A 4YXGA 3ARTA 3BW2A 1SFLA 1HL8A 4HN8A 1I9CB 3LDVA 3T0AA 4PMZA 3C6CA 3CO8A 1VFUA 3SCOA 5ABFB 1VEPA 5XIMA 3LTSA 4H6RA 4NZ5A 1IZCA 3CGTA 2GJXA 1AQ0A 1BVNP 4QDWA 1J96A 3CUXA 1TE1A 2J47A 4CN4A 1PX3A 3REQA 3EB2A 4EACA 2IKIA 2CLMA 3AO0A 4D71A 2IUZA 3HG4A 4NY2A 1J9YA 4TX6A 3N25A 3TMLA 4HSHA 3N13A 3LGDA 4NYUA 4JTLA 5DCBA 2QCEA 2NXGA 4ORMA 5CBBA 2R1KA 4D72A 1DXIA 3VNYA 1OCBA 4QEHA 4IMAA 2HWGA 1M1BA 1CGVA 5DFAA 1UUQA 5H2ZA 1QWGA 5IXEA 3QZEA 2DUAA 2QMKA 2WBGA 5D09A 3CZLA 3PR2A 4K3ZA 2JIEA 1JZ6A 2NW0A 1J2BA 2RJGA 5B7YA 1W8SA 3JRKA 4C6PA 1BRLB 4O18A 3W7PA 3PFMA 1W3NA 3IJ7A 2INFA 2POTA 3DOPA 4Y90A 2V68A 1CGWA 3SN0A 1B3VA 1BKHA 2C13A 1V93A 1E3ZA 3NG3A 4K8EA 3KTXA 2QUUA 5JIPA 4AF0A 2WYSA 4H7ZA 4A2RA 4IIDA 2ZTKA 5CC5A 4Q8OA 4JFWA 1WXYA 4MWAE 3T55A 3EWZA 4RUBA 2XZ9A 2VD8A 1JYWA 3KVJA 3BICA 2J7CA 3A5VA 2OZ0A 2ISSA 2BY3A 4PUJA 1SZRA 2EG8A 3G3DA 2Y85A 3VGBA 5AYBA 3U8GA 1G7VA 2E0PA 4LY8A 5DMYA 1DJXA 3P6LA 1I2QA 2C15A 3I4EA 2WC4A 2P50A 3M64A 2Z1BA 4LW7A 4S39A 3RITA 3EWXA 3M0JA 4S3EA 2VRJA 3GTHA 3VMPA 4DXXA 2JKEA 3PWGA 3CT7A 3LTYA 3NL6A 3P81A 1Q6FA 4Q4KA 1G5AA 2TPSA 3RNDA 4KBXA 2XH2A 4O1DA 3U3HA 3B8WA 4CKQA 3HGOA 3BG3A 3L2IA 2PTZA 4TX8A 1TPB1 1OX4B 3I3DA 3S42A 2E1WA 1PX8A 1UJPA 1FKWA 1RCOB 3H4WA 5FF4A 3UXKA 3GLCA 5EB8A 2OQLA 3W23A 3N12A 4GY7A 1CECA 1H1NA 2GOUA 5M2FX 5CG7A 3C8NA 3TR9A 1KKRA 4Q8WA 3LD5A 3OGVA 3TTOA 1H4PA 3MYOA 4MB3A 3L23A 2GJNA 1PHQA 2OB3A 3STEA 2DSKA 4LYPA 4IIHA 4LB3A 3NQCA 1DQXA 3AS2A 4ZE5A 1YXYA 4S3BA 1DPMA 4NAEA 3SGGA 3LERA 4IP4A 4JNZA 5D9NA 2XFWA 2QV5A 1SZNA 1A0CA 4F40A 2A3HA 2FZNA 3IGXA 4DELA 1C9DA 4M24A 5G1YA 2ZUWA 3BOXA 3BMWA 1Q2RA 1I2OA 1NSJA 3VGFA 3P93A 5T9BG 4GI8A 2CCRA 4XTIA 1Z7AA 1XSIA 5M5DA 2VFDA 2PD9A 5CPMA 3TN6A 2FTPA 1WKYA 4LVDA 3VI2A 4U2ZA 4QG6A 3WY1A 1XLKA 1PKYA 4GZJA 4AUBA 3L9CA 4NSBA 5KZDA 1TVLA 1CYGA 5G4HC 4BQ5A 1FH7A 1US0A 1A47A 1RQBA 2EEXA 4UUIA 4DJEC 5E6ZA 3LEPA 3MSYA 5CPQA 1SPQA 3ALFA 2HCVA 2R1LA 4DZIA 3ZXWA 4K6AA 3SY1A 3P80A 1PKNA 4QNWA 3L66A 2DQXA 1BG9A 1X1NA 3TV8A 1QOQA 1QPQA 2E7FA 2GJRA 4UTUA 1WDWA 3T2OA 2Q3RA 5M1TA 4XD5A 4C6QA 2CIPA 5K3VA 4B5VA 4UTHA 1P6WA 4JQ2A 4DF1A 2V2DA 3KHDA 1TA3B 4MPKA 1KBBA 2ZCGA 4OV9A 3M5YA 4LUSB 4MWAA 1ESWA 4NXSA 3IV3A 3AZTA 4M7SA 3TU9A 3MSGA 1VZWA 2Q8XA 1KM3A 1X98A 1Q4NX 1UA7A 5SWUA 4LF1A 3BLDA 4KERA 2I14A 6ALDA 1RA0A 5FF7A 2WVTA 2XWEA 4MHBA 1Y0EA 3WNPA 4BZYA 5I6SA 5EMMA 3T2PA 1V7YA 1JZ2A 1ZBCA 3U4FA 3GFXA 4L9YA 4FA3A 4QX4A 2RGLA 3SI9A 3WJWA 3IK4A 4C60A 2OMAA 4H4IA 4EPDC 3WQ5A 3RLGA 2J7FA 3LBMA 3NXFA 4GY1A 4HMEA 3SEPA 2O4QA 3NL2A 5C7VA 2PS2A 3SBFA 1OK6A 4I9MA 1WOBA 4HHLA 1JCJA 3QSRA 4H9VA 3UCCA 4Q4OA 4RV3A 2OZ8A 1GQKA 5EBUA 4NUWA 4V27A 2GOKA 2IW0A 1Y65A 3HF3A 3AISA 3FSTA 2Z1XA 3PJUA 1M6JA 5D30A 4MDPA 1OG0A 1YNQA 4GNVA 1TV8A 2O9OA 1MVYA 1X1OA 3LQLA 5BRBA 2WNNA 3PB2A 1XRVA 3QMTA 2ABAA 3BANA 3WEZA 1L9WA 3HQPA 3HPSA 4TV5A 5AZ1A 4GNKB 1BQCA 3SN1A 1EIXA 4YHEA 1XCXA 1CX9A 3CT2A 3T08A 1N8IA 4C6NA 2DY3A 4H3DA 2GJXB 3GNNA 1L8PA 3TOYA 4UZUA 1Q8AA 1JQVA 2PC8A 3WCZA 3GIYA 2PLMA 5CPNA 4JTCA 3QKZA 4FZIA 1W3HA 3PFRA 5I7GA 2Y63A 2WHLA 1B0IA 4P7NA 1F6YA 3LM3A 1QOPA 2P8CA 1RD6A 4KKXA 2OELA 1ICQA 3KZPA 1TB3A 1D7KA 1FWTA 4YTRA 3NO5A 3TE9A 4QFUA 4PC8A 2INEA 1VRXA 3SSJA 2PRHA 3HIJA 2DW7A 4Y6GA 1K6WA 1TKKA 1TWSA 2WHMA 3SCNA 2FFCA 1VYSX 1ECEA 4GYFA 1ZJAA 3K8MA 1EPVA 5D03A 3ZYZA 1VAHA 2OQYA 1BAGA 3D3AA 3S0CA 4DM2A 3FVMA 4YU1A 1K8ZA 5KSWA 2PDXA 2PP3A 4PCNA 3H7UA 3BK0A 4ADTA 2FHFA 2FVMA 3DG7A 4AF0B 3ZVHB 1KRMA 4PMNA 2XVPA 4B2DA 2XUCA 3BTNA 4KMQA 3W7CA 4ZO6A 2O9RA 3K8LA 5FF2A 1OB0A 3GZAA 1GEHA 1M7PA 2QQ6A 3MKKA 3RM4A 4O1BA 1QHPA 3MCMA 3L4UA 4GO9A 1SMDA 3GDKA 2ZTJA 1C90A 3NOEA 4XIMA 4UFKA 2QUTA 4KWVA 3FW6A 3OJGA 4KW2A 2WMHA 3F4DA 4PTXA 4DNHA 3PZMA 3OA5A 3TC7A 2YCJA 4X9SA 5FF3A 3VNKA 3AYVA 1DEDA 1QHOA 4FOKA 4G7EB 4JQ4A 2FDSA 4GC4A 3FKKA 4HYVA 3UR5A 1WO2A 3FVDA 1DL3A 1GVRA 5A6SA 3GVQA 1HP5A 4D8LA 2KZHA 2Y7EA 3K2GA 4QLKA 3M0XA 1I60A 5CSUA 1UD3A 1GOMA 3WMBA 4ZQRA 4CD5A 2HISA 4B91A 5LNSA 2X1IA 1JIBA 3NIYA 3WH9A 1YNPA 1DBTA 1NTHA 4GYJA 5T91A 5E5CA 2PI6A 3NAVA 3PSWA 3WLLA 4DPPA 2VZTA 5ENLA 3TEVA 4PRTA 2GQ3A 5BNKA 4IPIA 5HUOA 2ZC8A 3USBA 5E9XA 1VHCA 4PSPA 3GW0A 1P43A 1TV4A 3F03K 3VDHA 3M0HA 2VUYA 3OIXA 2WM0A 1U5JA 4DF0A 1ISWA 3L7RA 1DJIA 5HPOA 2NT1A 1E55A 1F05A 3QY8A 4HA3A 4LRTA 1NM9A 3ARWA 4HGXA 4XD3A 3AMGA 4XZ9A 1SSDA 2GQ8A 4KIEA 4WRHA 1A5UA 1KM1A 4EP8C 2QCNA 3WUFA 1RSCA 2NUXA 3LRMA 3R43A 4RZ6A 2D69A 3PBUA 1WXZA 2V2HA 3W86A 2NQ9A 1EUAA 1EA0A 3HN3A 4GWEA 4C1LA 3EWYA 3TAOA 4O1FA 3EDKA 1RVKA 3WLMA 5IRPA 1HX0A 4QISA 1OF8A 3NYDA 4C91A 5G1TA 1UD6A 4O13A 4XZLX 3POHA 4ATDA 4XZHA 3LNPA 4L4PA 3ISIX 4O15A 4OUIA 2GDUA 1VJIA 1FWIC 3GKFA 4HU3A 4Y9OA 1EJTC 1TV7A 4GUJA 3CJPA 4J2MA 4HD5A 1SZEA 1ICPA 3H23A 4BQ3A 2HV5A 3VD7A 4TU1A 1VKFA 2NLYA 2ZQ0A 4JX4A 1IXQA 3OVPA 3W27A 4NL1A 2DT1A 3PUDA 1TQXA 1DWIM 3NM3A 1X8CA 2Y8KA 1UCWA 3LPFA 1A5NC 2A7RA 3CYVA 1OCNA 3EA3A 1OX6A 1NP2A 2GVJA 1QBBA 3HV8A 1M5WA 1EB3A 4DUWA 4UOZA 3NPXA 4ECLA 5A8NA 5A6BA 2J77A 3MB9A 4FS9A 3FV9A 4GJIA 2UY3A 5C70A 3N9KA 2QS8A 1F3XA 1BG4A 2C71A 3CAKA 1W5OA 3TSBA 2E28A 3GIPA 3BUVA 4J40A 4RCXA 3KBVA 2Y89A 4LX4A 2CLPA 3DFSA 2VT0A 3RPTA 4S2BA 3FA4A 2V5DA 1P4CA 4DBWA 4DWSC 4D8AA 1HGYA 2GVYA 4UTIA 2EG6A 1QNOA 3O1NA 1JPMA 3WUEA 1LOLA 4P7RA 1RAKA 4M1RA 2WSKA 5I07A 3L68A 1THFD 3KVMA 1RBLA 3AC0A 1EC8A 1IZKA 5FL1A 2IKGA 4OT7A 3GM8A 1OABA 1H7PA 3TMQA 3P84A 3N19B 3NL5A 3G0XA 2H9AB 4MF4A 3CHEA 1J8VA 2G3NA 3B9OA 3UR8A 4MB1A 4ZENA 3DFNA 2A21A 1Z48A 2F84A 2VEFA 4AZBA 1AH0A 1XF0A 4LCQA 3W75A 3GRIA 3QY6A 2BOGX 3BCJA 3IVUA 1QWKA 4O4VA 2XHYA 2XIBA 3UVIA 4AD1A 3BLFA 3N4FA 3C0QA 3C2VA 3R11A 4GYPA 1AD4A 1G94A 3SCUA 2YLAA 4PSRA 3D47A 3UXAA 5C6MA 1QBAA 1FWGC 1VFFA 1LQ0A 4TXEA 3I7RA 9RUBA 5U4NA 1WZAA 5HA7A 1XKJA 4R88A 4ICNA 1RY0A 1J18A 1M3UA 2DPEA 2J8TA 4MKNA 1GVQA 3CTTA 4IWWA 5HXMA 4ZEPA 5HR6A 2EKCA 2R9RA 3N2OA 4OTKA 3PZTA 2VGIA 4M82A 4PL1A 3FX4A 2GDQA 5CBIA 4L6HA 3T4CA 1ZBKA 4TVUA 4B92A 4Z1AA 1WOAA 4Q7BA 4XQ6A 3QPZA 1KLYA 1UROA 4MDOA 3ID7A 4FF7A 1OIMA 3FXYA 4C6KA 2PRMA 2QHAA 2VDIA 3RK8A 3UR7A 1XSJA 3V3WA 3PB0A 5DO8A 4C6JA 3PBMA 1I1XA 3W6MA 3W82A 1UBPC 1P6BA 2OT1A 4GI4A 3WNLA 3WZ0E 3QOKA 3QMSA 1LT8A 2Z2UA 1CXIA 3IV8A 4N9BA 2ZZ4A 5CBJA 1REQB 4Q8NA 3GBEA 1EXPA 3LGEA 3BAWA 3L67A 2QUMA 4R33A 1S3HA 3W1UA 1M01A 3NOYA 4NX5A 4S23A 1V6UA 3LUTA 2DZTA 1Q4WA 2FPTA 2JK2A 2WMJA 3I3EA 1GPWA 1QK0A 3QZ6A 3T0BA 1GTEA 2QR6A 3WLTA 2J78A 1XLJA 3M0VA 3NR0A 5DX7A 1PZ3A 4ZE4A 1IWPA 2DZVA 3QXBA 2E5CA 4XX6A 1PJ9A 3UNDA 3VOCA 5D9PA 3T1GA 3WELA 2BNJA 3N9RA 5KZ6A 3PC0A 2D23A 1YNYA 4M6QA 1LL6A 3C8FA 1PDZA 4I7WA 1SVDA 2HXTA 5I23A 4PEKA 4FNPA 3VOGA 2R94A 4CNOA 3QOMA 1RK5A 4K37A 4XAYA 5DBUA 1LG1A 5A2CA 4IMFA 3H54A 5AECA 2DUZA 3CWHA 3M43A 4C7FA 3QQWA 1YDVA 3UZ5A 3ZWSA 4AFYA 4RE3A 2VCBA 3H2OA 3AXIA 2DZPA 3FFSA 2WV8A 3M7SA 1BWVA 1ICSA 3CQKA 3EKGA 4B5WA 2V69A 3P5YA 3VILA 3ICJA 1E0TA 4HJFA 4MLJA 3OOQA 4YTQA 4QAWA 3GNXA 2O9TA 3LTPA 5B7ZA 3K1GA 2JKAA 3CHFA 1W9DM 1X38A 2UY2A 3KVLA 3FJ6A 1PS9A 3IIOA 4MVAA 3KX6A 2ZZ3A 3ABZA 4UBPC 3FAWA 3UZYA 3WKZA 3W7GA 1YPFA 2YBTA 2QV4A 4ILSA 4DHGA 4CD7A 3JW7A 4O53A 8TIMA 5AN7A 2J9ZA 3RU6A 1UBSA 1KRCC 4YWIA 2BDQA 4ZOEA 3IAQA 2HBVA 3A4JA 2GGGA 3MCNA 4DXVA 1F4AA 1TG7A 2OX4A 4IICA 4U2YA 5I3HA 1R38A 1LDCA 3EOOA 3AMLA 1KFCA 3ARYA 3K4DA 3SB0A 4NAFB 2Y6ZA 3SN4A 3R5EA 1KFEA