4PN2A

Crystal structure of gh10 endo-b-1,4-xylanase (xynb) from xanthomonas axonopodis pv citri complexed with xylotriose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
305
structure length
305
Chain Sequence
AAPLAATASKFLGCAYGAQQAPGFAQYWNKLTPENGGKWGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQPEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQALGGNGDSGWEWVLQSFRLARRHFPHTKLMINDYSITSSAQATQKYLQIVRLLQRENLVDAIGVQEHAFETTPEVAVSVHRDNLDALAATGLPIYITEFDLDGPTDAQQLADYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEAAYLIRADGTERPALTWLRDYVAAHPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xylanase
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 123
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pn2A00
1V6UA 3ZJ8A 2A3HA 3UG3A 1WCGA 2YBTA 4PMRA 4X0VA 3U5UA 1ISYA 3RM4A 4UQBA 3A4AA 3CPUA 1GONA 4W5UA 5I2UA 1HIZA 3SCWA 1GCYA 1HP5A 1KGXA 3AMGA 2XVGA 4U33A 4J3TA 1C93A 2XGBA 4ACZB 2G41A 4MPKA 3A4XA 1BLIA 3M7SA 5ABFA 4PRWA 1ISXA 4HZ7A 4W86A 3WFLA 1DWFM 2G3MA 3MUZ1 1VENA 1Q6EA 4HTYA 2OWWA 2EPNA 2FHFA 3WDIA 2F8QA 3PBGA 1DWGM 4GZIA 1E0VA 3WDPP 3TONA 2JIWA 5A95A 3IJ9A 1E72M 3ZSSA 5CLWA 4U3CA 4V2XA 4AIEA 5A8NA 1XV8A 4R27A 1V3IA 1VBUA 1GOWA 4UFLA 3TOPA 1EOKA 2WMIA 2GJXB 1QOXA 1R8LA 4UR9A 1BG4A 1XD1A 4GXPA 2GJRA 1W2VA 3K46A 2DGAA 5A6MA 1C90A 2FH8A 2WVUA 2J7FA 5I79A 2VRJA 1C7SA 4JKMA 1K9EA 1OCQA 4XZWA 1VFUA 1LG1A 4N0RA 4HZ6A 3ARYA 5EFFA 2EPLX 3QOKA 4P7LA 1OINA 4TTUA 3DYOA 2F61A 3CBWA 1LWJA 4P7QA 3GXDA 3O2LA 1W2PA 2EBNA 1OGGA 3O9NA 1WAWA 1B0IA 5A2BA 1EO7A 2CHNA 4C7GA 1GOIA 3WUEA 4D6GA 4AIUA 1EOMA 3WH5A 2J7HA 3B8SA 3MS8A 3ARSA 2FGLA 2PWHA 1M01A 4U5IA 1UA3A 4CKQA 4CN1A 3UCQA 3WUBA 5JIWA 2Y24A 3ZT7A 1UR1A 3VIMA 4L4PA 4OOUA 4CVUA 3E1F1 1RH9A 2OYMA 2J7GA 1H11A 4LQ1A 4ZXOA 1FHDA 1JF5A 1XYZA 3NSMA 1V3KA 4DM1A 2J8GA 4EE9A 1H49A 3QR3A 4PN2A 4AW7A 1WDQA 3FAXA 2YIHA 1DWHM 1R7AA 5A94A 8CGTA 4CD5A 4H8HA 2DSKA 1Q4NX 5CPSA 3FHQA 1GW1A 1FH7A 1PZ2A 4Z2HA 3S2CA 2J75A 4QCFA 2WANA 1B3VA 1CECA 1HX0A 5D8WA 1V6VA 1CGUA 4MDPA 4QP0A 5A6KA 1W9PA 3POCA 4OBRA 3KL0A 5EBAA 2V3GA 1J0JA 4NSBA 3W53A 3VIOA 1CLVA 1B90A 3WNKA 1HXJA 3ZM8A 1QNPA 2XWEA 4KH2A 2HISA 5CPTA 2ZX6A 1C3FA 1G9HA 4M56A 3NUKA 3WD4A 3K4DA 1A47A 4X9YA 2BNJA 2WK2A 6TAAA 5I3DA 2W66A 1V02A 3ZMRA 1O7AA 1NP2A 1X1NA 2WYSA 1PZ3A 1W3LA 3VMOA 1BAGA 3TTOA 4KRTA 3CHCA 4WF7A 2BY2A 4BZYA 1VEPA 4W85A 5I23A 2YL5A 5KZ6A 3GZAA 1BPLB 3CUIA 1E56A 5C70A 4UFHA 1H0IA 1J01A 2E4TA 3VIJA 3J7HA 3OZOA 2ZUMA 3CMGA 3AIQA 2VZVA 1UR2A 2CHOA 3AS3A 4AD2A 3VGDA 3MUAA 1KBBA 3AQUA 2VX5A 5A6BA 5A6LA 4F9DA 2VZUA 3RIKA 1E43A 2PC8A 2BS9A 2W67A 2CYGA 2UY2A 1KXVA 3MSGA 1LF1A 2PB1A 3SCVA 2BVYA 1M03A 2E40A 3VNYA 4MJ4A 5JBDA 2E0PA 3BSGA 1QHPA 4DUXA 1MXGA 3BAJA 4U2ZA 5D8ZA 2RGLA 3VIIA 1B3WA 1ZBCA 5DMYA 5FIPA 4WK9A 3VGEA 4A3YA 2GUYA 3WENA 4HOWA 1TCMA 3F5JA 5JUVA 3ARVA 5D9MA 2VR5A 2A3BA 4WKAA 4CVWA 3CTTA 3WUGA 1MVYA 4YHEA 1E71M 2JIEA 3AIBA 4AIOA 2BVDA 1QBBA 3W24A 5A6SA 2OWCA 1UD6A 4AYSA 2DH3A 4ZE4A 5BWFA 3VDCA 1B1YA 2VQTA 5I77A 2VL4A 3ARXA 3VIPA 2JFEX 2QMJA 1E4MM 2WC4A 1I1XA 4LXFA 1DWIM 2ZX9A 4AD1A 2PWDA 1W3KA 1VRXA 3K8KA 4DWSD 4UQCA 1HNYA 1CXIA 1U33A 3QHOA 4CN6A 2PF0A 1PBGA 1WB0A 1P6WA 1UD2A 3W26A 4MB3A 1JDDA 4W8BA 3TTQA 3VDBA 2DT3A 3WY1A 1BVZA 4WJXA 1FP8A 2VVNA 5F7UA 2BHUA 2ZX5A 1I1WA 3AISA 3TTSA 5EB8A 2E9MA 1J0KA 2OYKA 1V3LA 2OSXA 6CGTA 1JFHA 2ZUSA 3AICA 4UQ9A 2WKLA 5BRPA 4AMCA 1JGIA 4GQRA 3SCRA 1HJVA 1E4IA 2VZSA 1ISVA 5IXEA 2DT2A 4GQQA 1W9DM 5TD4A 2ZX7A 1EH9A 3VOCA 1K9FA 3VX0A 1UR9A 1ZBWA 2AOSA 2VC9A 1NWTA 3ARZA 1MW0A 3BMWA 4R5EA 3UR8A 3OLGA 3WQWA 3SUWA 2WNWA 5I5RA 4X0NA 3IJ7A 4FLQA 4PEEA 3K8MA 1Y7VA 2X0HA 1HL8A 2GSJA 1GUVA 1NH6A 2W61A 4UZUA 1HVXA 4AD0A 4W8LA 4ATDA 2E8ZA 2WVVA 3F4VA 4CUCA 1UD5A 1JI1A 1BVNP 5GNYA 1W3JA 2J8FA 1C8YA 3UEQA 2DEPA 3WMSA 1MQPA 2J7BA 3NCOA 3CHDA 1UKPA 1JI2A 1JAEA 2NSXA 1IT0A 5GQBA 3PZVA 1CGXA 2FDMA 5A69A 3SCQA 1GOOA 2YDSA 1RP9A 4PMQA 5A3HA 1WDSA 1D3CA 1QHZA 2WMKA 2CKRA 3VGBA 5A6AA 5A8QA 2G3NA 3ZT6A 3VIFA 3HMCA 1CBGA 4H8VA 3SCUA 1CENA 3CUFA 2C0HA 2F2HA 1NM9A 2XFYA 1UZ4A 4HA1A 3ZT5A 2VZOA 1JYXA 3MUIA 2YL8A 3AXHA 2CITA 3VTRA 4J3XA 4PYSA 1E3ZA 1MFUA 1D7FA 1UQZA 5CG0A 4LYRA 1QNQA 2DSZA 1RPKA 4FK9A 2WMJA 3UESA 2D0GA 2WHMA 1E6XM 2V3FA 2Y5EA 4AEFA 5HPCA 2ESCA 1V3JA 3PZOA 1VFFA 1UD8A 1HKJA 1V3HA 2WB5A 3ZSTA 3NYDA 1HJWA 1HKIA 1JDAA 3VGHA 1XH2A 5C8BB 2ZUTA 3AHZA 4P7NA 7A3HA 3ZR6A 3ZR5A 1L8NA 2UY4A 4FLOA 3JUGA 1UR0A 5BXPA 1GVIA 2BV9A 2W5FA 4JFSA 4JFVA 1MXDA 4GKLA 1CNVA 3OA5A 5E6YA 1LL4A 1UR4A 3LMYA 1NWSA 1PAMA 1OIFA 2XM1A 4BCEA 1QI0A 2ZUWA 3PZIA 2CEQA 2CXGA 1V03A 1TG7A 4UCFA 1QW8A 2XYLA 1UD3A 5I24A 1E5JA 4JL1A 2XHYA 3CGTA 1V0NA 4W87A 4PCTA 2QPSA 3WD3A 3WBEA 4ZFMA 1JNEA 3IANA 1M53A 1UWRA 3NSXA 1HJUA 4QLLA 3I3DA 2GK1B 5BRQA 5ABGA 2X1IA 3LPGA 4P7RA 1BQCA 2QV4A 1GJWA 2XM2A 3THCA 4Z2KA 1G01A 4GO9A 1JZ4A 1JYVA 3NIYA 2VI0A 3DECA 4M29A 2E9LA 1QI3A 1D2KA 3N17A 2EO7A 1JF6A 3AMCA 3BMVA 4CD7A 5I0DA 2V3DA 3VO0A 1FA2A 3DYPA 2VJXA 4KMQA 1U2YA 4A3HA 3KZSA 5ABHA 2WAGA 4M80A 1ZBKA 2JEQA 3VD5A 2E9BA 1JYNA 4L4OA 2NW0A 1V0LA 1PX3A 2IXVA 1KXTA 1NOUA 3UR7A 5CXPA 1LQ0A 2OWXA 3VDAA 3OBAA 3WH9A 1UR8A 4GINA 4ML4A 5LA2A 4Q22A 3NDYA 3N15A 3AIRA 5M3WA 3KWXA 4CD6A 3WDQA 1E40A 4RE3A 1GOMA 1W1PA 1K9DA 4MB4A 2QLYA 2A3AA 1I75A 1AQHA 4P8XA 3CUGA 4PSPA 4H7VA 1VFMA 5CZKA 2VVSA 1C91A 2J7DA 3DHPA 2X05A 1TVPA 2XSBA 3ECQA 5A6BD 1V08A 3WH8A 3WNLA 3FNDA 3W38A 1BG9A 3WN6A 1E0WA 1GVYA 3PZTA 2YA0A 4PCSA 1DWAM 1GZJA 5A8PA 3APGA 2J47A 2GDUA 3WNPA 3VIHA 1X6LA 3B9EA 1E6PA 3VKKA 2VO5A 4J28A 3GBEA 4CU7A 4MJ2A 4P8WA 1HJXA 3CZJA 2YJQA 1VEOA 1OGSA 2WCAA 4TOQA 3VGGA 4W8AA 3OGVA 4H2CA 3ZIZA 4Z2LA 5A6JA 5FL1A 1PJ9A 3AZSA 3CUJA 1G0CA 3GH7A 4PTWA 3WDHA 4DUVA 1J0YA 1NP0A 4IISA 2VX4A 5ECUA 1US2A 8A3HA 1M7XA 3LPPA 4CCDA 4E8CA 1KBKA 2VZTA 1LJYA 1CXLA 3VD7A 3T2OA 1C8XA 1OT2A 3O6AA 2ZX8A 1ZS2A 1XH0A 1BHGA 4AZ6A 1E5NA 1QI4A 1CLXA 3CZ8A 1DWJM 4PMUA 5EFDA 2O9TA 3FY1A 3VX1A 4P8UA 3WL0A 2V5DA 4YHGA 1W9VA 2BY3A 1H41A 1XC6A 3T09A 4TVUA 3UETA 3L4WA 3PZ9A 1GNXA 1HF6A 2DSUA 2PBGA 1YQ2A 3VVGA 1UQYA 5IFPA 3SUVA 4UFKA 4QFUA 3WMCA 1H3GA 1E9LA 1JZ8A 3ARQA 4AD3A 2D22A 1KR0A 3PZUA 3VIKA 2EEXA 2DT1A 3F5KA 1DHKA 5IFTA 3FAWA 2JALA 1LL6A 4UFJA 2OLHA 1MW3A 3PTKA 4OBSA 4U2YA 3WEZA 1QI5A 1UG6A 2VR4A 2FGZA 3OG2A 3THDA 2DT0A 3LPFA 4ZXLA 5A2AA 1ITCA 2J25A 5AC5A 4PMDA 4LGXA 3W37A 1XD0A 1KB3A 1WO2A 3FN9A 1UA7A 3ARUA 4AZHA 1VF8A 1ZBVA 1HJSA 3BCDA 3EYPA 1ZL1A 4WKHA 3T2PA 3BAIA 2J7CA 3MSDA 3GXFA 1KWKA 4BS0A 4A4AA 3T2QA 5CSYA 1K6AA 1QNSA 1VBRA 2V3EA 1CXHA 4LYPA 4C7DA 1KWGA 3IK2A 3SCTA 1FFQA 1XSKA 2XWDA 2V5CA 3CZEA 2O92A 4GZEA 1Q6GA 2IXUA 4ACZA 3WNOA 3ZO9A 1KGWA 2YA1A 1W9XA 3VIGA 4IM4A 1VJSA 3HJEA 1BF2A 1J0IA 4AWEA 2XFFA 5I6SA 3WBAA 1UWUA 2WSKA 4ZE5A 4JFWA 1E6ZA 3SURA 1MWOA 3WEOA 4PUDA 3WH6A 1JAKA 2WHKA 3AZRA 4WKFA 4HPHA 3VUPA 3W25A 4MAVA 2CBVA 3M07A 5BROA 2VRQA 1K9TA 1V02E 3BC9A 2W62A 4NF7A 1US3A 3S6TA 4B3KA 2GJXA 4C7FA 4RE4A 1QNRA 4FF5A 3U7VA 1GHSA 5HPOA 5ABEA 3SEPA 2ZXDA 1AVAA 2WSPA 4D1JA 5D9PA 5M5DA 2WC7A 4B16A 5KEZA 3K4AA 4FLRA 2DSWA 1GQJA 4JCMA 1S46A 2ZICA 3GYCA 4IPLA 2G4FA 2DQXA 1R86A 5CGTA 1BYAA 1CGVA 1E4NA 1WNOA 1H2JA 2EJ1A 1FFRA 3L4TA 4MTVA 2WBKA 3AYSA 3NSNA 1LLOA 3ARPA 4CD8A 4U3AA 1R85A 2D1ZA 1UKTA 4GZJA 2CCRA 1OD8A 2D24A 4W89A 3N18A 1NWRA 1KGUA 2YOCA 3RM9A 2VX7A 4OOZA 4EANA 4Z2IA 3VINA 5M17A 2A3CA 4ATWA 1JDCA 3OLEA 3KL3A 3PHAA 1PEZA 2W91A 4TUFA 5E9AA 1EDQA 2MANA 3VD4A 1MW2A 1MYRA 3K1DA 3PTQA 1SFSA 3AZTA 4N42A 1XSJA 5HOSA 4IPNB 4DWSB 1KXQA 3CHFA 1CDGA 4ZEPA 3AJ7A 1J11A 3WIJA 2OYLA 1BFNA 4M1RA 3BH4A 2XIBA 5D9NA 5JBFA 4UFMA 5C71A 2PWGA 1B2YA 2QMKA 3VM5A 1FH8A 3EMZA 1R7OA 4TX6A 2VCBA 2WZHA 2X0YA 3SCPA 2A3EA 3MKKA 3RJXA 2EPKX 3BXWA 4GIAA 1WZAA 2G3IA 3L2LA 2XVPA 2DPEA 2BY1A 4J3SA 4CCCA 3AS0A 1FH9A 4AZBA 1JNDA 1JG9A 4NRSA 1IV8A 1UKQA 2CERA 4M24A 2QPUA 2J62A 1ODZA 1E55A 3WQ5A 3QHMA 3NJ3A 4CD4A 1EDGA 4MNMA 4PBGA 4DM2A 3RJYA 1PX8A 3SUUA 4Q7NA 3BGAA 2HVMA 2VCAA 1TVNA 2WZEA 1B31A 4M8UA 3BAYA 3CO4A 3N12A 1VJZA 1RP8A 3AMDA 4OIFA 5BYWA 2DH2A 1BSIA 3SIMA 4AY1A 1WZKA 4KRUA 1XSIA 5D4YA 4PMYA 2EQDA 4V28A 4AZIA 2WMGA 3AIWA 2C7FA 4H04A 2G8ZA 3SCNA 4DUWA 2BXZA 1EHAA 3FW6A 2BVTA 1LG2A 3I3EA 4E2OA 1H09A 2VX6A 2IUZA 1JD7A 4UFIA 4QLJA 3HN3A 1J9YA 1PPIA 4KWUA 3EDFA 4JCLA 3WQ6A 2C8NA 2DIJA 5E70A 1B3ZA 4UOQA 1V0KA 2CETA 4PTXA 1E70M 3BCFA 3MO4A 3WQ8A 1TE1A 2WVSA 2XSAA 3B9DA 4XB3A 3VPLA 3A6OA 1XHGA 4NI3A 4HOZA 1ECEA 4BA0A 3U57A 3N1AA 1B9ZA 5GPRA 2W4XA 4JHZA 1KQZA 3AHXA 3RCNA 3PTMA 1CXKA 2JE8A 3VNZA 1E1EA 1CTNA 2PBOA 2CNCA 4D6IA 4CCEA 4B3LA 2J74A 2WM0A 1HT6A 4EKJA 4DWSC 1QNOA 1L0PA 3W0KA 2WHLA 3PN8A 1Q6FA 1OSEA 2B31A 2DSVA 2XPKA 2WW5A 2VRKA 3TP4A 3G6MA 3QGVA 3WFZA 1EHNA 4OZOA 1BYCA 2E3ZA 2YL6A 4XX6A 3MU7A 3BLPX 4PMOA 3U5YA 2J77A 3W81A 5I78A 5LYRA 3DC0A 4W7VA 3W28A 1LL7A 1BGGA 2CPUA 3WF0A 3MMUA 1ZB5A 4B9ZA 3M6DA 4JFUA 3MV01 2YLAA 3RILA 4V27A 1E1FA 2ZIDA 3WL1A 1WZMA 1TFVA 2OSWA 4BQ5A 3TA9A 4D6EA 3T0DA 3KEHA 3SCOA 4F66A 1XRVA 2CBUA 2WLYA 3N9KA 3BAKA 3T0AA 1JZ3A 2DDXA 4W7UA 3MMDA 3N13A 3EDEA 1TUXA 1AQ0A 1J0ZA 4D71A 4AEEA 1WKYA 4GPNA 3F5LA 4UQAA 4LYQA 1QI2A 1ITXA 4Z2JA 1Z32X 4D6CA 2EPOA 3T08A 1JZ6A 2PI6A 3TTYA 4HMCA 3PZNA 1Q6CA 3CZLA 1OBAA 3AIEA 2J78A 3WKZA 4AZCB 1UKSA 5DT7A 2ZE0A 3AXXA 3L4YA 5AC4A 5IHRA 1XGZA 4XUYA 2VT0A 1JXJA 2Y4SA 3GH4A 3WF4A 1OT1A 3CZGA 3WF2A 1BGAA 1W91A 3EDDA 5HXMA 3BSHA 2XUCA 4U31A 2CKSA 1OD0A 2BHYA 3ZJ6A 1OWQA 2YLLA 5JBEA 1J10A 2VMFA 2VTFA 1ZU8A 1DTUA 2XTKA 3GDBA 3VGFA 5DO8A 2D20A 4PTVA 2JF6A 3ZOAA 2D0FA 3ALGA 2D3LA 4D6HA 2PWEA 4OJYA 1V6WA 4QDMA 1M04A 4XZBA 2Y2WA 1H5VA 4CU6A 2WHJA 5BCAA 1ESWA 1E6SM 4BQ3A 2G3JA 1PX4A 3DHUA 1W9UA 1UYQA 3AFBA 3IAQA 3AHTA 4IUGA 5HNNA 1ISZA 2XIIA 3EBVA 2TAAA 7TAAA 1VFOA 3VMPA 1JIBA 2YA2A 3OZPA 1QVBA 1XH1A 2QF8A 3RPMA 5CQ1A 3AS1A 3MMWA 3MV11 1UHVA 2WPGA 4MDOA 5GNZA 1E3XA 1JZ5A 4F79A 3EMQA 5FOOA 4W5ZA 3SUTA 2UWFA 1Q6DA 1GQIA 2QHAA 2W63A 3UG4A 3VDHA 4HPGA 1CGWA 1CEOA 3WD0A 3CIVA 1GQKA 1G5AA 2WC3A 5A1AA 1UWQA 3IJ8A 1WDRA 1KR1A 1XYFA 4KGLA 3GNRA 4J3WA 2ZXAA 4UOZA 3NDZA 4UTFA 1PIFA 5AYIA 5IHSA 1W9BM 5BXTA 3L4XA 4WIWA 4B9YA 4AXNA 5GNXA 4S3JA 2FHBA 5LA1A 2YDQA 1V6YA 4S3KA 4MNKA 4UNIA 4HOXA 3RMEA 1W1YA 3VU2A 1TR1A 4RL3A 2DIEA 3L4UA 2ZUVA 3WD2A 2ZUNA 5A2CA 3A3HA 4W7WA 3RO8A 3ARWA 1RD6A 4GI8A 3W6LA 1R87A 5FL0A 4PMNA 2GK1A 1JL8A 2CBJA 3ALFA 5HBFA 1X6NA 1GHRA 5E0FA 1JXKA 3UERA 3I3BA 2BY0A 5E09A 3AROA 2ZUUA 4J3UA 1EDTA 4AZ5A 3CUHA 4LX4A 2AMGA 1QHOA 2PWFA 1SMDA 3A47A 1E6RA 1EGZA 2GDVA 1OB0A 4W88A 1GOKA 1V0MA 4CGTA 1UH4A 2E8YA 2GJPA 2ZWZA 3L2MA 4JKKA 1UWSA 3GBDA 4E8DA 2Y8KA 1XCXA 1W3HA 1IZKA 2WWCA 1FP9A 1GQLA 3A4WA 3PZQA 2WXDM 2X09A 1GJUA 1E6QM 2UY5A 2J7EA 2O9PA 1CZ1A 1B3XA 4AZCA 3GH5A 3FHAA 4QLKA 3VD9A 1NWUA 1WZLA 4JKLA 5M03A 4QCEA 1G1YA 4J7RA 1F4HA 5BXRA 2WVVB 4OKDA 3WH7A 4UQEA 4JL2A 2O9OA 4PMXA 1EQCA 2ZXBA 5DT5A 4M81A 4GO8A 4F8XA 4ACYA 4W84A 1U30A 4RE2A 4JIEA 1QBAA 4D1IA 4TX8A 3PZGA 3IAPA 2X2YA 5LA0A 4NRRA 1W1TA 4MNLA 1GOQA 2ZXQA 5A8MA 4FMVA 3AHVA 2BXYA 1NQ6A 3SUSA 4ATLA 2VOTA 2NT1A 1SMAA 3W6MA 1GORA 2OSYA 3POHA 1EXPA 4MADA 4URIA 2BHZA 5E6ZA 3WUFA 3WQ4A 4AZ7A 2VURA 4EK7A 2FH6A 3CHEA 1PIGA 2Z1KA 2XVLA 4HP5A 5CGMA 3WNNA 4KGJA 1TZ7A 2RGMA 3AIVA 3AMLA 1E6NA 4ZENA 2VCCA 3WF3A 2ZWYA 1CGTA 1UUQA 1IZJA 1UWIA 3AMKA 5AYBA 1MQQA 4HA3A 3B9AA 3FXYA 3WD1A 1QW9A 3GTNA 1V6XA 2WVTA 4BF7A 2Y8VA 1C92A 1TMQA 2XG9A 1ISWA 4HMEA 1HP4A 4QAWA 4UQDA 2WWDA 3W27A 4JZ5A 4D72A 1BYDA 1KFWA 1O6IA 1E73M 4F9JA 5FD0A 4MAZA 3ARRA 2VQUA 1WP6A 4CN4A 3AS2A 2XJ7A 1ZJAA 3D5HA 1AMYA 1WE5A 4PTMA 6A3HA 3MANA 2VNCA 4TTGA 2WCGA 4TVDA 1CPUA 1CYGA 4D6FA 4WSJA 3G6LA 4Z2GA 1VB9A 5CLTA 1JFXA 4MB1A 4AISA 4PMVA 9CGTA 3CMJA 1MW1A 1MFVA 4J27A 4AZGA 2YBUA 4D6JA 1HVQA 3ZJKA 3EMCA 1TA3B 2AAAA 3CLWA 2X8RA 1UH3A 2WMHA 4J3VA 4XV0A 5AY7A 3DYMA 1DP0A 2GVYA 4PUEA 4UOJA 4NZCA 3N11A 4MB5A 1NARA 1UOKA 1W1VA 3VM7A 1UH2A 1BTCA 5HDRA 3KE0A 3BAXA 3AYRA 2WMFA 1E0XA 4M82A 4U5KA 3GXMA 1OIMA 1OM0A 2WCSA 3UG5A 3QOMA 1V3MA 2BFGA 4JFTA 1CXEA 2WKGA 2EXOA 4PSRA 3U7BA 1EO5A 4HZ8A 4E4PA 3WELA 1CWYA 3ZQ9A 3W82A 1FOBA 3WDJA 5CJ5A 4YPJA 5D9OA 1ZJBA 1AQMA 1HJQA 2CESA 4YN5A 3SCSA 4TVCA 2J79A 2XFRA 1JD9A 5ABFB 3QHNA 5CSUA 1OGBA 1JZ2A 1ODUA 4B15A 3WMBA 3OLDA 4CU8A 5FCZA 1C8QA 1NOFA 1HN1A 4P8VA 1KCLA 3RDKA 3WSUA 2UY3A 2D0HA 2O9RA 5FKYA 3KL5A 1HL9A 4AC1X 2XVNA 3ARTA 2CBIA 7CGTA 3MUY1 4H8UA 1H4PA 5DEZA 3N04A 4FLSA 3OGRA 5A8OA 2Z1SA 3EDKA 1SYTA 1UZ1A 1HKKA 1KXHA 1XCWA 2VUYA 2WMIB 1FHLA 4LPCA 4MNJA 3D3AA 3LPOA 4PMZA 4AD4A 4WLCA 1CIUA 4BQ2A 3AOFA 3OGSA 2D2OA 1MQRA 2CIPA 3II1A 4EAMA 5BXSA 3AHYA 4BQ4A 3EDJA 3GXIA 2D3NA 5EMYA 1JYWA 2W92A 3AXIA 4D6DA 1UWTA 5E0CA 4GI9A 3L4VA 1W32A 4P7OA 3HU7A 3GNOA 1H0GA 3BAWA 4GI6A 4WSKA 1A3HA 1CXFA 5CPQA 1EIBA 2YDRA 3WQVA 1WDPA 1DEDA 3OIHA 4HU8A 1J18A 1VAHA 2JF7A 3WNMA 1EA9C 3RM8A 2EPMX 2YKKA 2WZIA 1KCKA 1WPCA 3OB8A 1N82A 1E4LA 3WDRA 2WBGA 1BYBA 4Y7EA 5JIPA 2JEPA 4TXEA 1LWHA 1J12A 4UZSA 1J0HA 4DWSA 1GPFA 5DFAA 1B30A 4HA4A 1EQPA 3PZMA 4OUEA 1UKOA 4K68A 1F4AA 3ZJ7A 1CGYA 1YHTA 3M46A 3T0BA 3VILA 2XGIA 3AIUA 3W29A 3BLKA 2YL9A 3GM8A 1H1NA 3K8LA 3VMNA 1C7TA 2Q8XA 1JZ7A 5DF0A 3W4RA 1SR0A 1VIWA 4AD5A 4JHOA 3VD3A 4HMDA 1NOWA 1KQYA 3GNPA 2FHCA 2V38A 2D23A 3AI0A 2J4GA 1TA3A 2GFTA 1UD4A 4W93A 3L4ZA 3CZKA 1B3YA 3OLIA 4JAWA 1QPKA 3WF1A 4HU0A 1VEMA 2NT0A 5IDIA 2ZOXA 3CH9A 1HKMA 4H41A 1G94A 1E15A 2WLZA 2XVKA 3WEMA
chains in the Genus database with same CATH superfamily
4QDWA 2A3HA 3UG3A 2QCHA 4PMRA 4X0VA 3ITGA 3UWEA 4EWJA 3FOKA 4GYKA 2R1MA 2Y7DA 4ZCWA 2Z2BA 3CPUA 1GONA 2PDNA 3N2MA 2GUBA 1GCYA 1KGXA 2YCIX 4Q8MA 2XVGA 4WOQA 2RJHA 2XGBA 4ACZB 1PV8A 5AC7A 3W7RA 1BLIA 3M7SA 4R53A 4PRWA 4HZ7A 3F4CA 4HIBA 3ITTA 2OWWA 2EPNA 1UP2A 4LCRA 2AQOA 3F4NA 3QY6A 3MY9A 4PTNA 3ZLFA 3TONA 1I4NA 3MPGA 1XKYA 4RX0A 1O95A 3ZZ1A 3AXMA 5A8NA 3KCOA 1XV8A 4R27A 1V3IA 4HNCA 1JPHA 2H8ZA 4UFLA 4WHBA 3RX3A 3TOPA 2WMIA 3ZXWA 2ACUA 3DG7A 2OB3A 3QLLA 3UJEA 2NQHA 2DFAA 2DZSA 1OY0A 5D03A 4JTGA 4Y8EA 4H9XA 5A6MA 5DY3A 5I79A 3E96A 3SRHA 4XZWA 3LV5A 1VFUA 4MWAC 3AYTA 4N0RA 2BMBA 2PDYA 4YVPA 1UC5A 1ONXA 4JQ4A 2F61A 1LORA 5KZMA 1GG1A 3CQ0A 3AU6A 1TELA 3KHDA 2DIKA 5G1YA 1WAWA 2FVLA 3L67A 4C7GA 4AIUA 1SFLA 2IKGA 1HQTA 2I7GA 4N6EA 4ZTYA 2PWHA 5I3JA 4XZMX 5E1QA 1R5YA 3SADA 2WSRA 4AB4A 3MP4A 2O7QA 2Y24A 1RBAA 3TE9A 1RH9A 4NYUA 3O63A 1JF5A 3V0UA 4DM1A 2J8GA 4I7WA 3G2GA 3WK3A 2IPWA 2DSKA 2ASHA 2A5HA 5CPSA 3KX6A 5ABTA 4FA3A 1F76A 4NNAA 2WANA 4QCFA 1XDLA 1FWTA 2ICSA 1HX0A 3R1ZA 2QIWA 4RKAA 4QP0A 2YYTA 5IBXC 5EBAA 1IQ8A 4X60A 4IH3A 5FF0A 1B90A 1HXJA 2XWEA 3EEZA 4KH2A 3S8HA 3Q94A 2OU4A 3TR9A 3VNKA 3QLDA 2A3LA 3U8GA 2PU1A 4HHPA 2PDLA 3WBYA 3T81A 4O54A 4DJFA 6TAAA 3RXZA 1QPNA 3REQA 1TWIA 5TBOA 4GLEA 1NP2A 1LRQA 3VMOA 4E4FA 3UVAA 1JEZA 5D2TA 3CHCA 4AVNA 4DELA 1VEPA 2YL5A 5KZ6A 3GZAA 4QJ5B 3VKDA 2DUAA 4O8RA 1KCZA 4GVFA 4O1DA 4LSBA 3J7HA 3HPXA 3NEHA 4AD2A 1KBBA 3IJ6A 2Y5SA 3MKCA 2VX5A 5A6BA 1BKSA 2FB2A 1E43A 5C7HA 2UY2A 1OADA 4JQ2A 5DMNA 1JUBA 2E40A 1M03A 3IRSA 5JBDA 4KFOA 4C6FA 3KBSA 3LBCA 3QW3A 3BAJA 5BRBA 1AUSL 4J2PA 2LLEA 2DZUA 4HOWA 1TCMA 1TV3A 3QGAC 5D9MA 4MMWA 3S1WA 1XW8A 1V5XA 3BW2A 2FZ8A 4ZSTA 4CVWA 3KRBA 3SQSA 1MVYA 4QIUA 2EG6A 4D2JA 2JIEA 3PUGA 1S2WA 4WDUA 5F1VA 3W24A 2OWCA 4ES4A 2ZDSA 3HV9A 2BB0A 4LBRA 1M68A 3VDCA 5DRIA 1AJ0A 2GOUA 3PSVA 2VL4A 3ARXA 3NOYA 2WC4A 4PB5A 3HQPA 3PG8A 4AD1A 4DWSD 2F9RA 3K8KA 1CXIA 2Z6JA 3P82A 3QHOA 5GVJA 1LOQA 1RY0A 1UD2A 3IS4A 3C8FA 4MB3A 3AUJA 2FJUB 3VDBA 3WY1A 4WJXA 2VVNA 4JTSA 1F73A 1TV8A 3DN5A 3W1PA 3TTSA 2F6KA 4Q4SA 5EB8A 3R0UA 1T99A 1B9BA 2OSXA 4O15A 1KC7A 3K2GA 2WKLA 3ZLGA 1JGIA 2QF7A 3IEBA 2DT2A 5TD4A 2ZX7A 1EH9A 1K9FA 1TJ1A 1ZBWA 3CIWA 1WKFA 1NWTA 1S5VA 1VPYA 3BMWA 3TN4A 4Q8QA 3WG6A 2WNWA 1LYXA 1Y7VA 1HL8A 2QCDB 2CLMA 1GUVA 2W61A 4LY4A 2WNNA 3INPA 1TX2A 1SR9A 3IIOA 2WVVA 3TN5A 4CUCA 1BVNP 1OFRA 3LD5A 3RR1A 3NURA 3UEQA 4ZSUA 4B5SA 1MQPA 4D9PA 3CHDA 2L5HA 4RLIA 1JAEA 2NSXA 5A69A 4UCGA 1GOOA 4UMAA 1RP9A 1WDSA 1D3CA 3KOWA 3VGBA 5A6AA 2G3NA 3Q45A 1D3HA 3B0YA 4H6QA 1G7VA 3CJPA 4H8VA 3RRXA 4S3AA 2JBMA 4E4UA 4NI8A 4L80A 3RO6A 4R9XA 3MWCA 1NM9A 4K8EA 3BLDA 2YL8A 1XBVA 2CITA 3VTRA 2VELA 4J3XA 4PYSA 1BD0A 1MFUA 3ABZA 5CG0A 4I90A 3MI6A 3BK0A 3QTPA 4FXSA 2WHMA 5HPCA 4WOZA 2ESCA 3LDVA 3G22A 1VFFA 3VFCA 4NJGA 3W74A 3MP5A 2YZ5A 1JDAA 1XH2A 5C8BB 2ZUTA 3SW6A 2A7PA 3ZR5A 4BHYA 1L8NA 2UY4A 3JUGA 1UR0A 2CLFA 5CBBA 3W83A 3BO9A 1OYAA 1MXDA 4JTLA 5E6YA 4DF1A 1LL4A 3CAQA 1W1ZA 5I3IA 1PAMA 1OIFA 4QNWA 1QI0A 2A21A 3CWNA 3GFZA 2ZUWA 1XBYA 4HB7A 2XSXA 1OCBA 3V3WA 1TG7A 3BLFA 2Q02A 1QW8A 2XYLA 1E5JA 4HPNA 4A2RA 4FSAA 1I0BA 2QYGA 5FJRA 1JNEA 4TIMA 3IANA 3UJSA 1M53A 4WUIA 3I3DA 2VEFA 4IFKB 1ZGDA 3LPGA 4G8TA 4Y9OA 3T40A 3G1SA 2ZZ7A 1GJWA 2XM2A 3WQFA 1BEUA 3KBNA 3THCA 2D73A 1ONEA 4JY9A 1G01A 2C15A 5BOFA 2EO7A 2I5QA 2V3DA 1G4PA 4NYYA 4UTUA 5G2WA 3VC5A 1U2YA 3QW4B 3OHMB 5ABHA 3MZ2A 2X7VA 2XDFA 3BARA 3U0HA 3QQ0A 3DFSA 1F6YA 2NW0A 1PX3A 1A53A 1K8CA 2IPGA 3FJNA 3W1TA 4FEZA 2R8WA 1LQ0A 4H9UA 1UR8A 2PCEA 4HBKA 4ML4A 1XLEA 4DXXA 3N15A 3N29A 5M3WA 4KT2A 5U7SA 1GVRA 4O14A 5MKGB 1JCTA 1W5OA 4DAIA 2A3AA 3ZVHB 1FXQA 1VLWA 1TPWA 3CUGA 1UBSA 1TTJA 2VVSA 3CPGA 2X05A 1F3EA 1YPXA 2XSBA 3WH8A 3NPVA 3CYJA 3LCWA 3W38A 1GVYA 3PZTA 1DWAM 1GZJA 3BLIA 3K1GA 2QUUA 2PDUA 4ORIA 3UPMA 4UTWC 4KPLA 1H1YA 3NA8A 2BWGA 3B9EA 2VO5A 1UASA 5D33A 3GXTA 1M3UA 4CNUA 4P8WA 4X3ZA 2XN1A 4Z2LA 3CUJA 1G0CA 4PTWA 3LNMA 3R8GA 3USBA 4LBUA 4H83A 4UIOA 3E0IA 3NZQA 1CXLA 3VD7A 2PGEA 3T0TA 2YFNA 1ZS2A 1QI4A 4QR6A 4HYRA 3CZ8A 4ZQPA 4PMUA 2G95A 4GYPA 1QASA 1RJPA 1UWAA 3BE7A 2OO6A 3I10A 3FY1A 4JEQA 4DF2A 4P8UA 2V5DA 2XH0A 4MF4A 2Z4GA 1RVKA 4MUZA 3TUUA 1EC7A 3RNDA 1H41A 1XC6A 3TJIA 1MEHA 1HF6A 2PBGA 1AA1B 4JTAA 3WMCA 4C1NB 3PBYA 5ECVA 1JZ8A 4KFNA 1KKRA 2R82A 3PZUA 2EEXA 3PB2A 3HPFA 5IFTA 5AVNA 5HR6A 4UFJA 2OLHA 1HG3A 5DCDA 3PTKA 4G6CA 3P5YA 2P0OA 3GVGA 2VR4A 2QJNA 1AZ2A 2FGZA 2EPHA 3GY1A 3HJZA 3KW3A 3LPFA 4ZXLA 3VFLA 2FLIA 5LGZA 4ROPA 3W37A 1XD0A 3FN9A 2GJNA 1VF8A 1ZBVA 1HJSA 2J6VA 2ZA3A 3EYPA 1ZL1A 1KWKA 3HO8A 3PM6A 1QNSA 2V3EA 4LYPA 4IX0A 3TXVA 1S5MA 1XPYA 1K7XA 3S1GA 3OP2A 4GZEA 1Q6GA 3C6CA 4ACZA 3WNOA 4XTIA 1R6WA 2X30A 3UPBA 4E2DA 3S2LA 3HJEA 1BF2A 2Q71A 1FBAA 1JCXA 3WBAA 2WSKA 3S9ZA 3SURA 1B54A 1MWOA 5DLCA 1JPMA 3ABRA 4FP1A 3WH6A 4HSHA 3VUPA 1Q5MA 3W25A 4MAVA 1IGSA 3GTFA 3HGSA 1FHVA 2ABBA 1K9TA 1V02E 4HU4A 1R3YA 1Q6LA 4NF7A 4P2VA 1XC4A 3S6TA 1RK6A 4C7FA 4RE4A 1QNRA 4FF5A 3MUCA 1GHSA 3WYZA 2E6YA 3QPYA 3TLQA 3N9SA 3R0KA 4HPXA 3M44A 4QISA 1U1UA 5M5DA 3EB3A 4B16A 2UBPC 4FLRA 3H21A 2H9AB 1FCQA 3BUVA 3FV9A 3E38A 3I6RA 3GYCA 4TV6A 5M2FX 4O50A 1OC6A 1E4NA 1H2JA 2PC4A 4DHGA 1RAKA 4NASA 2BTMA 2WBKA 3ARPA 1ZP4A 1I2NA 4FI4A 1XIGA 2D1ZA 3PWGA 3VNMA 3UXLA 3ZYZA 3BL3A 3PPHA 5CPOA 3KXQA 1GVSA 3UXDA 3FYPA 1ZALA 4XAGA 4ATWA 2E7FA 4BKNA 1PEZA 3KVJA 4DO5A 3W2JA 2V81A 3CU2A 2QGYA 4JBRA 5D30A 4L1WA 1XRSA 4IWWA 1MYRA 3K1DA 3PTQA 1SFSA 2UZ9A 2HXTA 5JXQA 5EMJA 1DIEA 1XSJA 2YXOA 4GGBA 4QE1A 3ES8A 2CWXA 1KM3A 4DAFA 1OZMA 3TJ4A 4LFYA 2OYLA 3PB0A 5G1TA 2XIBA 2X7WA 5D9NA 3HV8A 5JBFA 5I3FA 3CWOX 1R7OA 3B8TA 2VCBA 3GNDA 4IFRA 2FYMA 1W1A1 4NG3A 3DCPA 3QH2A 1VFTA 2XVPA 2GVLA 2BY1A 4J3SA 1KLZA 5IOBA 1JNDA 4Y96A 3G0SA 3ITXA 1R9YA 1V8EA 3EX6A 4NRSA 1IV8A 4O53A 4OWGA 1ODZA 4BF9A 4J2MA 2V8ZA 1A5CA 5FF2A 3TX9A 1VCFA 1YEYA 1PX8A 1IIHA 1EYWA 1XGDA 2NZLA 1B31A 5C7VA 3Q67A 4B5WA 3ITYA 4F48A 5HQEA 8XIMA 2DQWA 1P0DA 5TAOA 4GIYA 4YTTA 4KCWA 2ABAA 5FEPA 2C18A 1JCNA 5HWMA 5D4YA 4PB4A 2OOFA 1Z8AA 2Y7FA 1YDYA 3GTXA 4V28A 4AZIA 4AWTA 4CEXC 2G8ZA 4DUWA 2BXZA 1IGWA 4S3GA 2QVHA 2BVTA 3I3EA 2IUZA 4OU1A 1T8XA 5DQPA 1PPIA 3BV7A 4IUOA 3EDFA 5AZ1A 4DLMA 4L6DA 1K7EA 3DENA 3KTXA 3LCLA 3M7WA 1B3ZA 4UOQA 3BSMA 1PHQA 2CETA 1E70M 1NDVA 4KIEA 3BCFA 2TSYA 4FALA 3PC0A 1EWEA 2XSAA 4XB3A 3O0FA 4NI3A 3W1NA 3APYA 3QC0A 2W4XA 1KQZA 3AHXA 4NUWA 3VNZA 1CTNA 2X1UA 2CNCA 4GRSA 4DYEA 2C0AA 3MYPA 2J74A 5I00A 5C0QA 2GQAA 2Q09A 3H26A 1HT6A 1X98A 3W0KA 4JYFA 2FZBA 2QCFA 3QGVA 3T9PA 3WFZA 1M5WA 1GVFA 3MU7A 1EBHA 2V63A 3LXBA 2FKPA 3MSRA 4V1YA 5HA7A 2J77A 3LUTA 1RZMA 3G0UA 1JCMP 3W28A 1LL7A 1O68A 2CPUA 4MYAA 2Y7GA 2A2IA 3M6DA 2RDTA 3N19B 2YLAA 3F7JA 1QXLA 3QQWA 1E1FA 2CLPA 3V5OA 2ISWA 4XKYB 3KEHA 1AH4A 2CBUA 3N9KA 3BAKA 4Q8TA 4F0LA 3MMDA 3EDEA 3W1UA 1AQ0A 1J0ZA 4D71A 3H22A 1WKYA 3QVQA 3F5LA 3UWZA 4LC8A 4LYQA 3QBUA 4LANA 1QI2A 2QCDA 3GG7A 1Z32X 3T08A 1MI3A 1XQKA 2PI6A 3RCYA 4Q33A 4S2CA 1IYXA 1XYLA 3AIEA 4MOZA 1CB2A 1UKSA 1ADOA 5T91A 5DT7A 3AXXA 3L4YA 1FDZA 1PIIA 1VLIA 1XGZA 2ODOA 2VGBA 1ITUA 4Q7BA 3MA8A 1OK4A 3FJ6A 3GH4A 3WF4A 1TWSA 4JTRA 1BGAA 2POZA 3EDDA 2XUCA 4U31A 3KTSA 3LM7A 1XP3A 5I3HA 4ZO9A 3KP0A 3LSBA 3ZJ6A 4UNLA 5JBEA 1MNSA 3LMZA 4AFYA 1DTUA 2XTKA 3LEPA 2WO5A 3DU0A 3VGFA 1Z44A 3ALGA 2D3LA 5KETA 5AN7A 1FRBA 4Q4PA 3UXKA 5BCAA 3H24A 2XH7A 2E67A 2NUXA 3GIPA 4AAJA 1XLJA 4F40A 1RVGA 4BQ3A 1PX4A 1A0EA 3DHUA 3AFBA 2C19A 2RUSA 4JNMA 1ISZA 2TAAA 4ZOBA 3OVPA 1F8IA 3UNTA 1KBIA 1XH1A 1ZAHA 3W88A 2ON3A 4QE4A 4LC6A 3MMWA 2Z1VA 4GFSA 3VE7A 1Q6DA 1GQIA 2QHAA 1DJGA 4HPGA 3WX7A 1CEOA 4YVXA 3UXIA 3CIVA 1IZCA 1GQKA 2DZTA 3TYZA 1XLMA 4RUBA 3NDZA 1NFPA 4HCHA 2W27A 4A29A 5BOEA 5IHSA 2ACRA 1U5VA 4GJJA 4R3UA 5DCBA 1XG3A 5C9RA 4O0ZA 1PB0A 5DCEA 3B03A 2J13A 3P14A 1BRLB 3IIZA 3N3MA 1NY1A 3VU2A 1GZGA 3CWHA 3MT1A 3OJGA 3L4UA 5A2CA 2Q3OA 4W7WA 3ARWA 3W6LA 1KV8A 5FL0A 4JY8A 1CB7B 1JL8A 1IEIA 2ZA2A 1W1B1 1IE7C 4O12A 1GHRA 1YTEA 1Q2RA 4MLJA 3M0YA 1Q7QA 4GXWA 4L9XA 2NQ9A 1EXBA 3CUHA 4XZNX 2AMGA 4KCTA 3LV6A 2PWFA 4XAYA 1SMDA 3A47A 3NQ2A 1EGZA 4GZ7A 5HULA 3ABQA 3DI1A 4B90A 3L2MA 3NPUA 1QPOA 3EZ4A 2ZZ2A 1XCXA 1YTDA 3RN6A 3HB9A 2BSLA 3L7RA 3PZQA 3GXNA 2X09A 3KRUA 3EA1A 4OUIA 2O9PA 2VWSA 3EA2A 4AZCA 1D8CA 3BANA 3QPZA 4XD3A 5LXXA 3R2GA 4IT1A 3N3TA 4JKLA 4QROA 4IX2A 2E68A 3WH7A 4JL2A 4L64A 2O9OA 1ICPA 4PMXA 3NO3A 1EQCA 3JR2A 3EOLA 4GO8A 4F8XA 5BU9A 4ACYA 3GZ3A 4W84A 3CUXA 4GCXA 4RE2A 1QK2A 1FY6A 3W01A 1OZQA 1A4LA 1W1TA 3SSZA 4YTSA 3QV8A 2ZXQA 2HE5A 4KEZA 4UTIA 4C6OA 7PTDA 1NQ6A 4H6EA 1DQWA 3SUSA 2VOTA 3VZZA 4ICCX 4UR7A 3M0ZA 2OSYA 3POHA 1G4SA 2HZGA 4C6LA 4XZ9A 2BHZA 3B9NA 1XISA 2VURA 1DJNA 5D32A 4EF8A 2VM8A 5HMSA 4WVXA 3W7MA 3UT0A 4GY7A 3BICA 4LU0A 2RGMA 3OBKA 3ABOA 3NVTA 4O28A 4PE8A 2IQTA 3IGXA 4I8DA 4K8GA 3MP3A 3DXIA 3PPGA 3S6DA 3B9AA 3FXYA 3QF0A 1MRAA 3CAVA 1ME9A 1C92A 2Z29A 3QR1A 1YW1A 1Q65A 2FVKA 1J2BA 1E1CB 1UZHA 4NNCA 4FNRA 4HK6A 4QAWA 4DB7A 1S2TA 5LIYX 4D72A 3T55A 2BXVA 1BYDA 1Y65A 1XIEA 1O6IA 4DJDA 2GOKA 3XIMA 5FD0A 4MAZA 5LIXX 1UC4A 3ARRA 3LHVA 3D46A 4WDXA 3SRKA 4HYWA 5I02A 1WE5A 4GE8A 6A3HA 1TQJA 1XRTA 1XDMA 4QSHA 1O5QA 4TVDA 1DXFA 4C1NA 4D6FA 1V79A 3CYVA 5I7GA 4IXHA 4Y8FA 1JGMA 4Z2GA 5AVHA 2Z6IA 4PMVA 1B57A 5A8GA 9CGTA 1VRDA 4GX8A 3QY8A 4D6JA 3S2JA 1DHPA 4RDYA 2ZKMX 1TA3B 2AAAA 1LUCB 4LCQA 2X8RA 4WEVX 4XTDA 4XV0A 1JCLA 3SO7A 2MNRA 2VXNA 2HVNA 3TN6A 1ADDA 1XUZA 3O1NA 4JIHA 1BTCA 4IIEA 1EGMA 3BAXA 4UMCA 3G1DA 3FYOA 4FPSA 5LGXA 1E0XA 2NV9A 1KM4A 4LV9A 5H8MA 3K4WA 3UG5A 3QOMA 1V3MA 4JFTA 1RHCA 5I06A 1RALA 2EXOA 4ERGA 4HZ8A 1CWYA 1FOBA 3T0CA 3TYUA 4AHPA 5D9OA 1AW5A 2XZ7A 3DI0A 3G8RA 3KOZA 4YN5A 3SCSA 3M43A 2NX1A 3EXTA 1XLAA 4B15A 3WMBA 4CU8A 2CC0A 1GKPA 1HN1A 3G1AA 4G7FA 2VDIA 5FKYA 1QPRA 3E2QA 1HL9A 2V5BA 2F6XA 4AC1X 3L9CA 2O4QA 3TJXA 3BPWA 3HGOA 1R0MA 1X1ZA 2XVNA 7CGTA 5D02A 5DEZA 2QDDA 3OGRA 3UZWA 3EDKA 1XCWA 4A6GA 4KEMA 3UR2A 1TRDA 2H9AA 3CV6A 4F0MA 1OVDA 1D9EA 3OVQA 1FWIC 2PTYA 3VKAA 4KEUA 4X61A 5LIWX 1CIUA 1I45A 1DL3A 4UMBA 1TRIA 3TK7A 4IJBA 3MBFA 4IG2B 2ZZ1A 4YNGA 1VHNA 1O5KA 2F2KA 2PRLA 3A5FA 4KKXA 5FEXA 5K2ZA 3HU7A 1H0GA 3QTGA 4MWAD 3GUGA 3TZFA 1GYMA 2OKOA 1UR3M 2YDRA 3GC2A 5HJXA 3WQVA 3OIHA 1OF8A 1VAHA 3RM8A 1DJQA 3GAYA 2GQ8A 4O57A 3PNUA 4DO4A 4O4WA 4JN6A 1VPQA 3OB8A 1N82A 1G67A 1E4LA 2VGFA 4PC8A 3M0LA 1BYBA 1LRNA 1NTHA 3KBJA 4D8ZA 4H1ZA 3MVIA 3GHRA 1LWHA 1IHIA 3IJIA 4WQ6A 1AD4A 1EX5A 3NQGA 4LT9A 3GM8A 4N02A 4A8RA 4AWUA 1VCVA 1MEWA 1QDSA 1JZ7A 1RLCL 1V7AA 4ZVJA 4HMDA 1BXNA 3E5PA 1I6NA 2QULA 4W93A 3OZYA 3CZKA 3OLIA 4K2SA 2PDWA 4JAWA 2PFHA 1VEMA 2NT0A 4U10A 3UCCA 1A3WA 4QSFA 1HKMA 1G94A 4B2DD 3NZGA 4Q4RA 1V6UA 1WCGA 2YBTA 4QX4A 5MF5A 2I16A 4UQBA 3A4AA 2DVXA 1SSGA 1HIZA 3H70A 1P7TA 3AMGA 4HSNA 1LWIA 5IRPA 4AY7A 1UIPA 5ABFA 3C8NA 3UNDA 2Z00A 2YCJA 3MUZ1 1VENA 3U2EA 4HTYA 4H9TA 2H90A 4ZZ9A 7TIMA 2WPBA 1H7NA 3WDIA 5D37A 2F8QA 1DWGM 1OHLA 1E0VA 4L6OA 3IJLA 4DBDA 3WDPP 1AZ1A 1HKWA 3IJ9A 4O52A 4V2XA 3H7UA 1VBUA 3TKFA 4HT3A 4UC5A 2XN2A 1QOXA 1BG4A 4GXPA 1FTXA 4F0RA 2DGAA 3NNTA 2HNHA 2WVUA 2J7FA 1YKWA 4C5ZA 1UP0A 3M6YA 5EA9A 1LG1A 3TJLA 1VYRA 4HZ6A 2J24A 3ARYA 3GHTA 3QOKA 3UU0A 2PGRA 1OINA 4GNJA 4TTUA 5CJNA 4HK7A 2J9ZA 2OEKA 4XD6A 1FVPA 4P7QA 1NAL1 3GXDA 1E9YB 4M0XA 2EBNA 1YBQB 1B0IA 1EO7A 2CHNA 4XBSA 3I65A 3WH5A 4WX2A 3T8QA 2QNEA 1XIFA 4HHLA 3HFTA 4KCVA 1M01A 4U5IA 5GJMA 3PWAA 1PZ1A 3R0DA 3C86A 3KM8A 3BZJA 4YTRA 1XLDA 5DY2A 1UR1A 4CVUA 2YPIA 5I3GA 1J8VA 2ACSA 2J7GA 3QV9A 2BOFX 2QQ6A 4GJ1A 4PL1A 4EE9A 3FLUA 4CQCA 4F2TA 1O4UA 4PN2A 3N4AA 3FAXA 2YIHA 1DWHM 3O6DA 4CD5A 2CLIA 4HNVA 1GW1A 1FH7A 1WKEA 1PZ2A 4EPBC 1KM2A 4U4MA 3BTNA 1B3VA 1CECA 3M0VA 4NJKA 5XIAA 1W9PA 1UUMA 4OBRA 4PFMA 1SW0A 1L6FA 5CKSA 4NSBA 1FWAC 3MCMA 5DBTA 3W53A 3N6JA 1CLVA 8XIAA 4IQJA 5G4WA 1T7LA 2HISA 3GR7A 4MY1A 3IJQA 2CLEA 3GIQA 4H6KA 3WCZA 4O13A 1I8JA 1A47A 1AQFA 2BNJA 3EX3A 3PULA 1KM5A 4PCPA 1OCNA 4M1BA 2AMXA 3AO0A 3PUDA 3ZMRA 4DJEA 4KIRA 3VA8A 2WYSA 3B0VC 1W3LA 3KTCA 3R79A 3TTOA 4KRTA 4DZIA 4BZYA 2PP3A 3CUIA 2HDJA 4UFHA 3N2BA 1J01A 2E4TA 3VIJA 3OZOA 1X96A 2ZUMA 3CMGA 2VZVA 1UR2A 1XYAA 1KRCC 3MUAA 3AQUA 4M7TA 1Z89A 3UXAA 4S3FA 3S5SA 1GVEA 3NQVA 3RIKA 2PC8A 2BS9A 1NFGA 1XI3A 1GG0A 2CWNA 3MSGA 4IQLA 3W75A 2XH4A 1NJJA 1IR2A 1KTCA 1P0EA 3LY0A 4KEVA 3V7PA 4DUXA 1H1ZA 4J9JA 4PULA 3NO1A 5DMYA 5FIPA 1M7OA 3M9YA 4A3YA 2GUYA 3WENA 4XWUA 1DE5A 5LIKX 3ARVA 1WXYA 4WKAA 5M1TA 3BG5A 3WUGA 4YHEA 4XBJA 2NSOA 1PHWA 1PO9A 3JRKA 1E71M 4AIOA 2NVCA 4F4RA 2H6RA 3R25A 3LI0A 5EY5A 4ZE4A 5BWFA 4HCDA 5CZSA 2GLKA 4A3QA 2VQTA 5I77A 2DZAA 5K9CA 3VIPA 2NQZA 2QMJA 3L0GA 3GC5A 4Z0JA 3ONBA 4AYGA 3G77A 2PWDA 1W3KA 3FA5A 4B4HA 4AVOA 1WB0A 1P6WA 2O0TA 1QR7A 2PDXA 4GC4A 4C6KA 4H00A 3TTQA 1PCWA 4K36A 2VFIA 1H62A 1BVZA 5F7UA 2DY3A 2ZX5A 2REQB 1S2UA 2ZUSA 1EJ7L 2FGBA 3AICA 3K13A 2OELA 5BRPA 3P93A 3HG4A 2B7NA 2ZA1A 3QRHA 3LHWA 1E4IA 2VZSA 4IF2A 4IPIA 4CQBA 3VOCA 3B3DA 1UR9A 2AOSA 4XO6A 1T40A 2VC9A 4JTDA 3ANVA 1MW0A 3EOEA 1QTWA 3PFMA 3UR8A 3WQPA 4FX6M 3OLGA 3SUWA 2GL5A 4MKNA 2P8BA 1UPMB 3DEQA 2GSJA 4TV5A 4RPPA 4AD0A 3VKCA 3MHFA 4ATDA 1T8QA 2E8ZA 1REQB 4ENLA 1OX4B 2VEIA 3IPWA 4S1FA 4XK2A 3FYYA 1UD5A 3S5OA 1C8YA 4K1WA 1VBGA 4ZL1A 2DEPA 3NCOA 1HL2A 1FWRA 1JI2A 3W72A 2RDWA 4DBWA 3RLGA 2OLAA 3QMSA 2INEA 2YDSA 1XLCA 4PMQA 2Q8LA 5A3HA 4Z17A 2HPMA 3C2FA 1QJWA 1CBGA 3SCUA 3CUFA 3LHYA 2C0HA 4ROQA 2XFYA 3UWVA 1JYXA 3CNYA 3AXHA 4N9EA 3VKJA 1IEQA 4A3UA 1E3ZA 3ORWA 4ZOEA 1D7FA 1THFD 1VQTA 1YXYA 1VFLA 4NY2A 2GWGA 2V3FA 4AEFA 1NDWA 2CHRA 2Z26A 1Q4WA 1PTGA 4AVFA 1V3HA 2QJHA 2WB5A 3QV7A 3NYDA 1HJWA 4P7NA 1E1CA 7A3HA 1SW3A 3OQEA 2FZDA 4FLOA 1UUOA 3C3NA 4IP4A 2BV9A 3UWQA 3H2OA 3IVSA 1CNVA 3OA5A 3STCA 1TQXA 3W7QA 3GTHA 2XM1A 3R10A 3HG3A 4JIIX 4DNMA 1TJ0A 2CXGA 1N55A 4UCFA 3VXGA 5K9XA 2J8TA 3KRSA 3BQ5A 3C5QA 3DDMA 4JL1A 2XHYA 1V0NA 4W87A 5JQ9A 1KRAC 1WDWA 4PCTA 1SQ7A 4XBKA 2QPSA 2JKPA 3WBEA 3I7SA 4RZBA 4MFEA 4LV4A 5BRQA 5ABGA 3V4BA 1MUWA 3QQ1A 3EWYA 3UW6A 4GYFA 2OQHA 4EXQA 3UD6A 3B8DA 2QV4A 5F2LA 3LLXA 4QEEA 1LUCA 2VI0A 3N17A 1W8GA 5CSSA 1JF6A 1TPEA 4RXFA 7REQA 4C65A 1DVJA 3ATZA 3D6NA 4Y9AA 1Z42A 3M47A 2VJXA 3IARA 3VI2A 1KM6A 4O10A 3TWAA 5REQB 3WJSA 4L4OA 3W84A 4TX9A 4QDPA 4YYCA 2C3ZA 1KXTA 4DJFD 1TWZA 1ME7A 1PKNA 5CXPA 3STFA 3WLQA 4J35A 2QS8A 1A4MA 3VDAA 5LA2A 2O4MA 1E0UA 4IMDA 3AIRA 1W37A 1E40A 4RE3A 1GOMA 1K9DA 4MB4A 4ZQRA 2DJXA 2QLYA 4P8XA 4ZGYA 1T96A 4PFHA 1ZY9A 1VFMA 3SQMA 1TVPA 5A6BD 3WNLA 2BP1A 3WN6A 4MZ1A 2YA0A 3BOFA 1GKQA 4DNHA 3LU2A 3LN3A 2J47A 2GDUA 3WNPA 1KRMA 4NL1A 1X6LA 3A21A 4IG2A 2YJQA 1OGSA 1CX9A 4E6MA 3ZIZA 1PYMA 2XGZA 4UTLA 3GG0A 1PJ9A 5AECA 3GH7A 3GHUA 4Y2WA 4UTTC 4IISA 3H4XA 2VX4A 4LBSA 1ZRQA 1US2A 4GVIA 1M7XA 3PVFA 3DHDA 2Q01A 1KBKA 1T6MA 4QITA 4LYKA 3CTLA 3W3OA 3WO8A 1SVDA 4RV3A 4DY1A 4PEKA 3RUBL 1QPQA 3WQOA 4GI4A 4MWAA 1FWNA 3B05A 3VUSA 2OX1A 3S2MA 3WQGA 4HVXA 3CQIA 3TQPA 4QTGA 3T09A 3M5ZA 3UETA 5HAOA 3L4WA 4EPKA 1GNXA 2DSUA 3PJWA 5IFPA 4M19A 4PGLA 2PDJA 4MUPA 1UMLA 3F2CA 4UFKA 2PGWA 2A4AA 4FXJA 4IHCA 3BGJA 5FSDC 3SGUA 3CXOA 3GG8A 3FAWA 2JALA 4GIEA 1YNPA 2PD9A 5MHBA 3TQ0A 4OBSA 1I2RA 1QI5A 3ID7A 4S3EA 4DUOA 4S39A 4DO6A 3OG2A 2DT0A 5JH2A 4KBXA 2V30A 5A2AA 3OG3A 1W56A 4PMDA 4UR8A 1FDJA 4IGMA 5FJUA 3ARUA 4AZHA 4K6AA 3BCDA 3BAIA 2J7CA 3E2RA 1K3UA 3T2QA 5CSYA 2F7FA 3UCDA 3LZ3A 3G24A 3NL2A 5IBXA 3HTWA 2O92A 4YWSA 1TVLA 4ZOCA 3GU2A 4DI8A 2GGHA 4AY8A 2X42A 4IM4A 3VNIA 3OA3A 4AWEA 4O1BA 1DIOA 1UWUA 4ZE5A 4JFWA 1E6ZA 1YXCA 3V0SA 5K9DA 3F4DA 3WEOA 4OHQA 4PUDA 1SO3A 1JAKA 2WHKA 3AZRA 2PEVA 2VP8A 3COTA 3JS3A 1P5BA 4EAYA 2E5DA 3GQYA 1YX1A 2QIIA 5BROA 1K6WA 3RX4A 4J4KA 4N7QA 2W62A 3CLMA 2VC5A 1SU5A 4HNNA 2CZEA 3UFYA 2PZ0A 2ZBTA 3U7VA 3W1MA 3P2VA 3SEPA 1XL9A 2HROA 1YDVA 5D9PA 2V67A 4Q8UA 5D04C 5KEZA 3M5VA 1I9CB 3PK7A 4JCMA 4XD4A 3UGVA 2ZICA 1L6SA 4IPLA 1RJQA 2RH9A 1OFQA 1FWEC 1MZHA 3UA4A 1ALDA 5CGTA 1BYAA 1WNOA 4LAMA 2EJ1A 3QFWA 1S3HA 4QJ4B 1M1BA 4O0KA 4MTVA 5HINA 3LCGA 3A12A 1LLOA 1VZWA 5A5WA 4CD8A 1IXOA 4U3AA 1XRFA 5BMWA 4US5A 4BEUA 1UKTA 2CCRA 1H7OA 1T5AA 4A3RA 4MKSA 4MYXA 3SY1A 3N18A 5FEZA 3MCOA 4US6A 3ISIX 3RM9A 4P61A 1PSCA 3R6IA 4JGDA 4YWIA 2ZDRA 2A3CA 2UV8G 1ZP3A 3OLEA 2DV0A 3EPNA 4LEQA 2W91A 1S2CA 5E9AA 3T6CA 2MANA 2QUTA 1MW2A 1J4EA 1IR1A 1AG1O 4N42A 4CNSA 1J2WA 3NZ1A 3HA1A 9XIAA 1KXQA 1CDGA 1J11A 1SPQA 5CZ0A 1XGEA 4UWMA 5RUBA 2I57A 3DERA 1DXIA 1TJ2A 2PWGA 2QMKA 1VJIA 3EMZA 4TX6A 2WZHA 2X0YA 3B06A 3SCPA 2A3EA 1TV2A 5CBIA 4DXVA 4LOCA 1RJRA 3HMJG 4M6PA 1GJPA 1FH9A 3PF3A 4AZBA 4CNTA 4JTKA 2P0IA 4K37A 2DUXA 2CERA 2QW5A 2QPUA 4YJ5A 3W73A 3JVAA 3DIPA 4IL0A 4ZQNA 4Q4KA 3NJ3A 4XZHA 4LVFA 1DQUA 4PBGA 1TX0A 4MZYA 5KITA 3B4UA 3RJYA 5T9CE 4DWDA 6REQB 3RYSA 2HVMA 4QGCA 1TVNA 1EB3A 2VOMA 3GU1A 4M8UA 2WZMA 3CO4A 2V6AA 4R9OA 3GFXA 4PUNA 2H3BA 1O1HA 3W7IA 5BYWA 5KSWA 1BSIA 4XKMA 4JQ3A 1BKHA 1WZKA 1XSIA 3MC5A 1WA3A 4BF5A 1NVMA 1ZZMA 4NNBA 2WMGA 3RGTA 2C7FA 3MDUA 3SCNA 3S6OA 3KBVA 1A49A 3MVTA 4C60A 1VKFA 4E2OA 4ILSA 3LK6A 2OXNA 1A5NC 1L2QA 4UFIA 1KNWA 4NIRA 1YPIA 4QLJA 3TYEA 3P5ZA 2A7RA 1V6TA 4JCLA 2W6RA 1J96A 5FJJA 2GDQA 3OTRA 1XYMA 5EYWA 5D2VA 2I56A 1BF6A 3M0IA 2WVSA 3A24A 2QVNA 3B9DA 1GTHA 3BW3A 1XHGA 3SN4A 1XJBA 4JTCA 3U57A 3N1AA 4DQWA 1SZFA 1B9ZA 2V69A 4J40A 4ZA0A 2JE8A 4FAMA 3GAKA 5C2XA 2PBOA 1W3IA 4CCEA 4B3LA 3AJXA 2ONEA 4ICMA 3N2TA 4NP7A 2PA6A 4DWSC 2WHLA 1Q6FA 5LHFA 2NQJA 1QO2A 2DSVA 4LUJA 5HK4A 1F61A 2VRKA 5H91A 3TP4A 3G6MA 3SECA 3TTEA 1IT7A 4ZB5A 1FWDC 2AL1A 3B40A 4JTIA 1OF6A 4L4MA 4PMOA 1Z69A 3U5YA 5I78A 3W81A 5LYRA 3DC0A 4W7VA 5J5RA 3FGCA 4XQ6A 3M0HA 4JFUA 2NLIA 4O18A 3AWOA 5HUPA 2ZIDA 3WL1A 1WZMA 1TFVA 4BQ5A 4D6EA 2O55A 1Q3NA 3EX4A 4F66A 3TAOA 1FKWA 1JZ3A 1AL7A 1KFEA 3E74A 4L5ZA 3F2BA 3LRKA 3NPXA 3G3MA 4GPNA 2FVMA 5LKYA 4GFIA 2FTPA 1I0DA 4UQAA 4J5NA 1MO0A 1ITXA 4JTHA 2Y6ZA 4ZFCA 2TMDA 5FAGA 3AALA 2ZE0A 3BCJA 3BDKA 5IHRA 4XUYA 4NAEB 2EGZA 2VT0A 4NT0A 1BTMA 3CZGA 4GMEA 2G96A 3BSHA 2BZNA 2EKCA 3C2EA 4A8IA 5C9ZA 1TV5A 4KRZA 5CAHA 4NKCA 1ZU8A 3DOPA 5DO8A 3Q4DA 1OFAA 2JF6A 4XVDA 2PDMA 4D6HA 1UJQA 2PWEA 2HMCA 1EJRC 3VC6A 3TFXA 1O5XA 3L66A 1ESWA 1E6SM 3FA4A 3LQLA 5CCZA 4KW2A 2V82A 2HWGA 2G3JA 4GVGA 1XXXA 3IAQA 1L2UA 3AHTA 1OFDA 2D2HA 5ENLA 3C2VA 1KBJA 1VFOA 3G1HA 1JIBA 4HNLA 1KA9F 1QVBA 2NQ5A 3RPMA 5CQ1A 3MV11 1UHVA 2WPGA 3S5ZA 1JZ5A 4LUTB 1RCOB 3C2RA 1TKKA 5F1UA 5FOOA 3EWZA 4W5ZA 4QG6A 1N8WA 1AD1A 1R3RA 3CAKA 1TB3A 5E0KA 1GT8A 2GGGA 1IWBA 4HNUA 2C1GA 1G5AA 4UTWA 5A1AA 3IJ8A 1XYFA 3FKRA 3GNRA 3CM4A 2ZXAA 1J6OA 5AYIA 3L4XA 3STGA 3I7RA 4S3JA 2FHBA 4MZ8A 1Z48A 1JCYA 3GR8A 2YDQA 1V6YA 2AL2B 2OEMA 3H54A 1VR6A 5HWJA 3S9YA 1W1YA 1TR1A 2DIEA 1TV4A 5B7YA 2ZUNA 4JHMA 4GUFA 4Q4MA 1R87A 1NDYA 4LAKA 3GO2A 2CBJA 4WDWA 1FWGC 1O5RA 5DBUA 1DIDA 2QCGA 4RE0A 1JXKA 3UERA 4FR6A 4A8LA 2V2CA 5E09A 1UJPA 3BVJA 3AROA 2ZUUA 4J3UA 1EDTA 4LX4A 1QHOA 4HPJA 2BBFA 1VFSA 4A35A 3OVRA 2PDBA 2YGYA 3BOLA 3V16A 3IK4A 1BXCA 1UOZA 1GOKA 2HK0A 2QXWA 3OIXA 3R12A 2GJPA 2ZWZA 6XIMA 3HGJA 1UWSA 5F2IA 4E8DA 4R33A 1US0A 3QYSA 5REQA 1W3HA 1OABA 1TO3A 1FP9A 3VCCA 2WXDM 2J7EA 3EWUA 1CZ1A 1B3XA 1M6JA 4PRTA 3H2AA 3FHAA 3R43A 4QLKA 1BXBA 1F6KA 4C6EA 1WZLA 4QJ1A 1X97A 1QWKA 4Y9PA 4J7RA 5BXRA 2B7QA 3GKAA 4L4LA 4UQEA 4IMFA 4O8AA 3SJNA 4NXSA 4FXFA 4IMCA 4K7VA 4MG4A 4LVAA 4JIEA 1AJZA 1QBAA 4TX8A 1JUKA 1KCXA 3PZGA 3SY8A 3IAPA 2X2YA 5LA0A 4NRRA 3IUHA 4L9ZA 2BG5A 4FMVA 2DZWA 4AHOA 4AC7C 3AHVA 1ELSA 3QR0A 4H7ZA 4ATLA 3DAQA 4AX6A 3M0JA 1YE4A 1TUFA 3V75A 3PJXA 4Z08A 4URIA 1EPXA 1AW2A 5E6ZA 3W7CA 5J5DA 4E2VA 2FH6A 3CHEA 1PIGA 3S2NA 1GQNA 3HIJA 3MHUA 5FF3A 1TZ7A 4B5VA 1MDRA 1E6NA 3AMLA 4IQEA 1RQBA 1VS1A 2ZWYA 2Y62A 4ECLA 3TIMA 3P60A 4QS6A 5G4HC 4LUSB 4Q8VA 1QW9A 1V6XA 5HNRA 1TTPA 2Y63A 4Y9NA 4PCNA 3DX5A 1VYSX 2PLJA 4E5TA 3V5CA 1PXGA 2QJGA 3TC3A 1XKJA 4XSMA 3WK1A 4JIQA 2QDHA 1Q66A 2ZCGA 4N9DA 1OQFA 3W70A 5CC7A 1CCWB 4F9JA 3PNZA 1HUVA 3LHZA 1H51A 1WP6A 3TDFA 3UZZA 4CN4A 5B80A 2XJ7A 1ZJAA 3HM7A 3B8UA 3D5HA 1A5SA 3F03K 2VNCA 1KKOA 3HQOA 3KUMA 1KFBA 1CYGA 3B04A 4WD0A 1S2VA 4U28A 1QW7A 1UBPC 2WQDA 4I5RA 3W7PA 3C2YA 4MB1A 4AISA 4JTTA 3WK2A 3TVAA 3NFUA 2G50A 3E0WA 3WLRA 1Q2SA 1MW1A 1JULA 1W8SA 4J27A 3QXBA 3ZJKA 1OYCA 3NQ8A 1P1MA 4IMGA 3R94A 4FNPA 4ML9A 3N34A 2WMHA 4J3VA 3NQCA 4FNUA 3DYMA 4GBDA 3ES7A 2A85A 3N11A 3N6QA 4W9TA 2Y88A 4MB5A 3VM7A 1UH2A 3GDRA 4QS5A 3AYRA 2WMFA 3KCLA 2D69A 3VAVA 3FVDA 1R2TA 3EB4A 3LM3A 4XVEA 4M82A 3LGDA 2WCSA 1OM0A 2WKGA 2WSQA 3EKGA 5HR7A 2PCQA 4R7JA 4E4PA 3ZQ9A 3W82A 3BZGA 1V7YA 4XAZA 2QUVA 4WJEA 5CJ5A 3TNBA 1ZJBA 5CZTA 2B81A 3Q2DA 2XFRA 1S38A 3CL6A 3PANA 3R13A 1OGBA 5CSUA 2OZ0A 2QKFA 5F4XA 2PODA 3APTA 1KCLA 4ZBCA 2D0HA 3PR2A 1J5TA 1RQHA 1G4EA 2PD5A 4GH1A 3ARTA 4H8UA 2X41A 1H4PA 3SIZA 4FLSA 3MW7A 2W3ZA 3IV8A 4AXKA 2QDGA 2WMIB 4LPCA 3LPOA 5FACA 3IGSA 6TIMA 4QRNA 3AOFA 1A0CA 2D2OA 3II1A 4EAMA 5BXSA 3AHYA 3QN3A 3EDJA 3KDOA 2GVGA 2BDQA 2BGQA 2OQYA 3LCIA 4D6DA 5E0CA 4GI9A 3L4VA 1W32A 4OTKA 3CPRA 2PMQA 4FNTA 1KFKA 3BAWA 4REQA 1F3TA 4WSKA 5CPQA 4JTQA 4JN8A 3WNMA 2JF7A 4FZIA 1EA9C 2EPMX 4O17A 2YKKA 2XINA 2P8CA 5CBJA 4B5TA 4MLRA 4IPPA 4LY8A 2PLCA 1XLKA 3S83A 2HS8A 2JEPA 3C0QA 3W1XA 3P0XA 1GPFA 1B30A 2RKXA 2C14A 4OUEA 1FXPA 2JGYA 2ALDA 4FX7A 2A79A 2DU2A 3QMTA 3AIUA 3W29A 3W22A 1H1NA 1QWGA 2ACQA 3CT2A 4NJIA 3H23A 5DF0A 1SR0A 3QKZA 3EAUA 4AD5A 2C13A 3QZ6A 1H50A 1R9ZA 2FHCA 4HN4A 2D23A 2HBXA 5H6HA 4C1KA 4EF9A 3TYAA 3W7DA 1B3YA 1QT1A 3A64A 1OG6A 4H9ZA 1SO5A 1QMLA 3WF1A 3RU8X 3OODA 3M0MA 4ICNA 4FNSA 2ZOXA 3BQ6A 4NAFA 3B0XA 3ITOA 1UZDA 4C6MA 2YZRA 3WEMA 2OODA 3U5UA 1ISYA 3VOFA 4OQVA 3UWYA 4EX4A 3W2LA 3RM4A 3JW7A 5AYXA 3TV8A 3AXKA 2GQ9A 1LBLA 3SCWA 3GLCA 5JMUA 3M16A 4U33A 4ZQOA 3REQB 3P81A 3IUDA 1PWMA 4Q8NA 4MPKA 3MMTA 2P3ZA 5LNUA 2ATMA 4GUGA 1ISXA 3WFLA 1DWFM 4E2BA 2Y7EA 1GZ1A 3FKKA 2FHFA 2QT3A 3PBGA 5IDZA 1V77A 1X8FA 3DFQA 4Q8PA 3A5VA 4OV9A 4HGXA 4GY1A 1E72M 3P6LA 2O7SA 3ZSSA 5CLWA 4YTUA 4DVOA 1GOWA 2F6UA 4I6KA 4PUKA 1TZ9A 3NXLA 4ERAA 4UR9A 2GJRA 1W2VA 4B5UA 2HV5A 1X39A 3G5EA 2AQVA 2YCKX 3GK0A 1Q7ZA 4CCZA 1WOAA 2FH8A 4M51A 2VRJA 1C7SA 2WJFA 1AFSA 2V68A 1K9EA 4F0KA 4RXGA 1R30A 1EA0A 2EPLX 4FOJA 3CB8A 2DZVA 2HPIA 2OO0A 4A2SA 3CBWA 4DJDD 1LWJA 4M3PA 3EWXA 3UR5A 3H2MA 2OT1A 3O2LA 2PDIA 1SO6A 1OGGA 5A2BA 2Y85A 4NXKA 3ATYA 5HNUA 4LJ3A 3OEXA 4D6GA 2DZPA 2J7HA 3UJ2A 3ARSA 2H8XA 4FB7A 4UTKA 2E5BA 1DJIA 3M64A 3LG3A 4RNHA 3W2UA 1E0TA 2ZYFA 4CKQA 1E9ZB 4CN1A 3WUBA 1RA5A 1U5HA 3IIXA 3W1RA 4BY3A 3VIMA 2W9MA 4L4PA 4ZXOA 3HFYA 1L8PA 1FHDA 1IXPA 1XYZA 3H4WA 1V3KA 3NSMA 4L6HA 4XD5A 2ZFAA 5HANA 1WDQA 1R7AA 8CGTA 1C8VA 4HU3A 1A5KC 3DZ1A 3FHQA 1EUAA 3S2CA 1S2AA 1A5AA 2J75A 3TZNA 5D8WA 4OE7A 1RBOB 4MDPA 4EVZA 3POCA 3KL0A 3V0TA 3WFAA 2V3GA 1J0JA 3DG6A 1HGYA 3WNKA 3ZM8A 2YSWA 1QNPA 2QCCA 5CPTA 4NAEA 5C9XA 4X63A 4BK9A 4M56A 1RQEA 1WYIA 3WD4A 1LOSA 1XICA 4FNQA 1FUYA 4X9YA 4NVTA 2OEJA 2WK2A 2OPJA 2YCEA 4KWOA 5I3DA 2W66A 3P62A 2FPYA 1V02A 4H9VA 3H2EA 3W7EA 1QU4A 1O7AA 1IWPA 3W1LA 3PSWA 1BAGA 1J5SA 2WKJA 4O4VA 1X1OA 2Z25A 3QYQA 5I23A 1BPLB 3UBPC 5G5IA 3USZA 1H0IA 3TSMA 1DOSA 1N8FA 4G2DA 3AIQA 3LBMA 1PKMA 3WJXA 1K03A 3GWQA 5FI8A 2QPXA 4OFCA 5A6LA 3DFYA 1HW6A 2CYGA 8TIMA 4LUTA 3SCVA 4LVGA 3IVUA 2BVYA 1U83A 1LROA 3VNYA 2RJGA 1MUCA 3P67A 4U2ZA 5D8ZA 3TFCA 3STEA 1B3WA 1ZBCA 3GG1A 2ZRUA 4UNKA 2VR5A 1SW7A 4R34A 3UWUA 4EOUA 4YYFA 1VBHA 1AODA 2A3BA 2QDEA 4RZ5A 3CTTA 4Y90A 1W31A 4BWLC 3LYEA 3W76A 2VENA 3W2NA 4OT7A 5TF0A 2BVDA 3T44A 3AWNA 1TWDA 1QBBA 2AL2A 1R3QA 1A80A 4IXXA 4AYSA 2DH3A 1TTQA 3MWAA 4JD4A 5C55A 1B1YA 3T1GA 4AF0B 1TREA 1I1XA 4XAPA 4LXFA 3ABXA 2NV1A 4NZFA 3CEUA 2ZX9A 4UQCA 3SDOA 3WJYA 4CN6A 2PF0A 2PWVA 5I07A 2WM1A 4GQGA 3W26A 4W8BA 1YPFA 3CH0A 2DT3A 1FP8A 1PE1A 4PZVA 5L6UA 1I1WA 2RDUA 2E9MA 3ABSA 1J0KA 1V3LA 2EJAA 1JFHA 1IT8A 5LNVA 4H8NA 4AMCA 4GQRA 3SCRA 1WDDA 4GQQA 3V1PA 1W9DM 3VX0A 4GKTA 3ARZA 5C2GA 4R5EA 3O0KA 3WQWA 4X0NA 4FLQA 1AMKA 2X0HA 3FEMA 4CNNA 4DN1A 3Q58A 1I2PA 4UZUA 1N7KA 4W8LA 2YXXA 3KRZA 3WJWA 3NM1A 3F4VA 1JI1A 5GNYA 2DVUA 1W3JA 2J8FA 2J7BA 3U48A 3GSMA 5LIUX 2QCLA 4DZAA 3R58A 4XO7A 4LF1A 3PZVA 4GOAA 3H55A 4I9AA 1R3WA 2PP0A 1Z41A 2WMKA 1ICSA 3ZT6A 3PBVA 3VIFA 1CENA 3V36A 1LLWA 1ICQA 4IQDA 4H6RA 4IIHA 5K7JA 2F2HA 1XIDA 1NF7A 3E3HA 4E3TA 3SI9A 2QCNA 3B0UX 3E12A 4QXIA 1XF0A 2Z1BA 5HQLA 1K4GA 4OECA 1TCDA 2VFHA 2VEKA 4LYRA 1QNQA 2D0GA 2HS6A 1E6XM 2Y5EA 4O1FA 1V3JA 4GA8A 1UD8A 3BJSA 3NQDA 3GU9A 2IQ0A 1EJSC 5AFDA 2PDHA 2FZ9A 1YTKA 3ZSTA 1EP3A 3VGHA 1G7UA 1M65A 1A3XA 1OYBA 1ZCOA 3DGBA 3U4FA 3LOTA 3P0WA 3KBWA 1N8IA 4RCXA 4JFVA 3MHGA 1UR4A 3LMYA 2R9RA 1SO4A 3BLOA 3WLIA 3CT7A 2NVAA 4E38A 3TXZA 2CEQA 1V03A 2EG8A 2QJIA 2VFGA 1BWKA 5FEWA 2G5WA 1UD3A 4HJWA 4HJFA 3CGTA 3VDGA 3W7LA 3WD3A 4IIFA 4ZFMA 1NDZA 1NELA 2GVEA 1VIZA 4IFOA 1UWRA 3NSXA 5BNKA 1XINA 1HJUA 4XIMA 3L5MA 2GK1B 1GKRA 4TU1A 1JQVA 3G1XA 2X1IA 3MUXA 4P7RA 4K1GA 1BQCA 3SFWA 4CQ9A 1EBGA 1DBTA 2R14A 4M29A 1R3VA 1D2KA 1FWWA 3WLNA 3AMCA 5I0DA 4KWWA 4XIAA 1W54A 4FOUA 3G3DA 5U4NA 2AQWA 2P76A 2XFWA 3W9ZA 3VOHA 4KMQA 4GXMA 3KZSA 1DPMA 1EEXA 2GZXA 1ZBKA 5FJPA 3MI3A 3VD5A 3W7GA 3ZVIA 2E9BA 4WXZA 3WMLA 3HBLA 2HEJA 3S47A 2IXVA 5CPMA 1SGJA 2J88A 3SRDA 1KW1A 4DJED 1S3TC 4I5UA 2OWXA 4HHMA 2WNZA 3TA6A 3OBAA 3LTSA 1XG4A 3BWWA 4CQAA 3WDQA 1N2VA 1W1PA 3W87A 4RNFA 2SFPA 3KS5A 3ERPA 1TIWA 3WLSA 2C71A 4H7VA 2Z1WA 5CZKA 5LXEA 2J7DA 3ENLA 3EX2A 3DHPA 5F4SA 2NXHA 3ECQA 1V08A 2PTXA 1A5BA 3URAA 4I9MA 3OVGA 1EGVA 1E0WA 4PCSA 3APGA 1I60A 2VHLA 4KETA 3VNJA 2PTWA 4J28A 3AAMA 4CU7A 4HSOA 3CZJA 1RCQA 2GUUA 1J6PA 3D0CA 3OYXA 3VGGA 4TOQA 3OGVA 2AKMA 4LB4A 3AZSA 1LLZA 1LTDA 3QPEA 1LOLA 2YFOA 1NP0A 2TRSA 3A13A 2WV8A 5ECUA 1B5TA 3MDWA 1RSCA 4A8NA 1CW2A 4E8CA 1LJYA 4FO4A 1X7FA 3N4FA 3O6AA 3QSRA 1EZWA 1TMLA 4AZ6A 1GW9A 5AHMA 1CLXA 3DC8A 3DHFA 4DZ5A 4GX9A 5EFDA 3L12A 1DJWA 5T9BG 1SJDA 2PZNA 1ONWA 4RJEA 3QJAA 3UY7A 3A9IA 2XIJA 3C0JA 4FS9A 3WL0A 3Q37A 2BY3A 4MIMA 4GCAA 3S42A 2XH2A 4PUMA 1K77A 1YQ2A 2QJMA 2E5CA 3VVGA 1A50A 1QCWA 1S1PA 4GNKB 4QFUA 4ERIA 4GC3A 4IFKA 3ARQA 4G7EB 4AD3A 2D22A 4N4PA 5K3VA 3VIKA 5LSMA 2CZ5A 1SFTA 1F7BA 3F5KA 3BJFA 1DHKA 1L6WA 1MW3A 4U2YA 3WEZA 4YIWA 1EL3A 3LBOA 1HFBA 2INZA 3BURA 4GK8A 1WO2A 3A3WA 4JN7A 3C0SA 1TPUA 1ZENA 2RFGA 3I6EA 4JR5A 5AC6A 4WKHA 3T2PA 3GUWA 3GXFA 1S1RA 4A4AA 2VDHA 1KWGA 1VBRA 1CXHA 3IK2A 3WLMA 1XSKA 3S1XA 2XWDA 3GW3A 2V5CA 3CZEA 3E5BA 1XYBA 2FZNA 1H5YA 2IXUA 2WJDA 1M41A 3ZO9A 1KGWA 3THQA 1H63A 4AIBA 3VIGA 3GNXA 2F38A 1VJSA 1Z7AA 2D2GA 3RCMA 1J0IA 3U6WA 3VOJA 2FQIA 3VNDA 3RMJA 3AU2A 4CEUC 3NGFA 2ZRZA 5MKGA 4JDBA 5LHEA 3ZVHA 2XISA 3LNPA 4WKFA 5AOUA 1R47A 2ZC8A 3STPA 5HJLA 1F9CA 2CBVA 3RF9A 3OOQA 4I7UA 2FPVA 1M7JA 2XU2A 3QC3A 1AL8A 3NQEA 4Q4OA 5HMEA 4X9SA 5E9XA 1Y5XA 1XWYA 3XISA 5HPOA 5ABEA 1AVAA 3DFHA 2GGEA 3K4AA 2DSWA 1GQJA 2G97A 4PRRA 2G4FA 2DQXA 2GJLA 1R86A 2YCLB 4C6QA 4L65A 3RAOA 1CGVA 4GUJA 1W3TA 3FSTA 1FFRA 4QG9A 3U9IA 3AYSA 2FDSA 4GD0A 2Z7KA 4RR4A 3G1VA 1JDFA 4GZJA 4C6JA 5C5YA 4W89A 1OJXA 1NWRA 1KGUA 3R8RA 1AK5A 4Q32A 2YOCA 1Q13A 3N14A 4JOMA 3TU9A 4OOZA 1O12A 3S0CA 4Z2IA 4N2YA 3VINA 4ASTA 4N9CA 1F2JA 4IZGA 4IGHA 1JR1A 1EDQA 1ML1A 2VDGA 3VD4A 3GDTA 3S4TA 4CLMA 3FCPA 3AZTA 3HGRA 4IPNB 4FOKA 4LTSA 4DWSB 1F3XA 3CHFA 5AYYA 5KZEA 4ZEPA 5KTLA 1FWFC 1BFNA 4M1RA 3WK0A 7XIMA 2E1DA 3BH4A 4PL2A 3BG9A 2OG9A 3N25A 2VGIA 5C71A 2Z2UA 1B2YA 3DH7A 3VM5A 5LNRA 1FH8A 3MSYA 1NF0A 1MUMA 3BXWA 3C3UA 4GIAA 3F2DA 1WZAA 2G3IA 3FJLA 3DBPA 1X7IA 4CCCA 3AS0A 3O07A 1FCBA 1EC9A 2HK1A 1UKQA 3T07A 2R1KA 2J62A 1SJBA 1J93A 4CD4A 1EDGA 1VD6A 1IXQA 1JRBA 2B0MA 1DTNA 3PWIA 2OFJA 3B4YA 1UCWA 3SUUA 4BI5A 4Q7NA 2E1WA 3CV2A 2WZEA 1S39A 1Q7MA 3W2MA 3N9RA 4AUBA 3AMDA 3CASA 2V5LA 1QRQA 2EHHA 2DH2A 1O94A 2RHGA 3GE7A 4WR3A 3SIMA 4KRUA 2R1LA 4NZ5A 1DORA 2EQDA 4L56A 9XIMA 3CV1A 1VPXA 3C56A 3AIWA 3E6EA 2QCEA 1KBLA 1EHAA