3UU0A

Crystal structure of l-rhamnose isomerase from bacillus halodurans in complex with mn
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
414
structure length
401
Chain Sequence
KSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 142
structure length 401
sequence length 414
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uu0A00
3BZGA 8XIMA 1XIJA 1XLGA 2HK1A 5C9ZA 3FVMA 3XISA 2GUBA 1I6NA 3P14A 1XLFA 3TC3A 4E3VA 3CQJA 3QYSA 2XISA 4LNCA 3BDKA 3UXIA 4EAYA 2J6VA 1BXBA 1MNZA 4K3ZA 1XISA 4PGLA 4A8LA 4A8RA 4HNOA 2X7WA 2X7VA 3ITLA 4X60A 3U0HA 3KBWA 2GLKA 4XSMA 2NQHA 3DBNA 3KBVA 3NGFA 5H1WA 3KBSA 1S5MA 3QC0A 1CLKA 1DE6A 1YX1A 3P6LA 4HHMA 3UVAA 2QULA 5XIAA 1XLBA 2HK0A 1S5NA 5XINA 3L23A 4YTTA 1XIGA 1XLLA 1XYAA 2XIMA 4XKMA 1MUWA 1XLAA 4EACA 1XYBA 4Q7IA 1I60A 2G0WA 4YTQA 3CQIA 3VNMA 3VNIA 3ITXA 5EMMA 1XICA 3VNLA 4GJIA 4QE1A 3QZAA 3KBMA 3M0MA 3AALA 3C0SA 3KBNA 1XLKA 1XP3A 2Q02A 5B7YA 5B7ZA 5I7GA 2QUMA 3KBJA 4HGXA 3CWHA 4XIMA 3VNJA 9XIAA 1XINA 4GJJA 3ITVA 4QE4A 5H6HA 5J8LA 1XIMA 4HHLA 3ITYA 4XISA 1A0CA 1DIDA 4XIAA 1QTWA 4ZB2A 5XIMA 4XSLA 5AVHA 4KW2A 1OADA 8XIAA 3BWWA 1BXCA 2XINA 3IUIA 6XIAA 3VYLA 1XYLA 1XIHA 1XLIA 1XYCA 2G4JA 1A0EA 3AAMA 3KCLA 5EMLA 3U3HA 2QUNA 4QE5A 2ZDSA 3ITTA 3C0LA 1QUMA 4ZB0A 3IUHA 1XIBA 1DIEA 2I56A 4K1GA 4YTUA 3ITOA 3UA3A 5EMKA 2GYIA 4J4KA 1DXIA 3AYTA 1DE5A 4OVXA 4US6A 5TNVA 3XIMA 4DVOA 4X61A 3CNYA 3KTCA 1XLHA 2OU4A 4DUOA 3JU2A 3CQHA 2QW5A 1XIEA 5B80A 3OBEA 1GW9A 2NQ9A 3GNXA 3CQKA 1K77A 3UA4A 2GVEA 9XIMA 2HCVA 3M0HA 1A0DA 1XIDA 4QDPA 3BANA 5EMJA 4G56A 7XIMA 5AVNA 3LMZA 1XLCA 1QT1A 3M0XA 4A8NA 2NQJA 3TVAA 3N4AA 4PFHA 4QDWA 4X63A 1XLEA 1XLDA 4GLEA 4YTRA 5FA5A 3QXBA 4ZBCA 3C0QA 3M0YA 6XIMA 3DX5A 4A8IA 3AYVA 3M0VA 3XINA 4QEHA 1TZ9A 1XIIA 4ZB5A 1XYMA 3VNKA 3WQOA 1D8WA 2ZVRA 1XLMA 1XLJA 1O1HA 3UU0A 4YTSA 3IUDA 3BZJA 2I57A 1XIFA 3KCOA 4GQBA 4W4QA 3M0LA 3KCJA 4QEEA 3KWSA
chains in the Genus database with same CATH superfamily
2O9OA 3E0LA 4MNKA 2QDHA 2ZC8A 5T91A 4RJEA 3EWZA 3B4UA 4E0CA 5LIXX 2E6YA 3FNDA 2FZ8A 1FP8A 2WVVA 3GNOA 2CWXA 4F2BA 2FH6A 2VR4A 1BTMA 4MF4A 2G41A 4F0LA 4GJIA 1ZCCA 4GI9A 1MEWA 4N9CA 1RLDA 1HF6A 4XZHA 4A3RA 1FHVA 3W37A 1PJ9A 3IUIA 4AVFA 3SSZA 3A9BA 1Q6EA 1RJQA 3DI1A 2DT3A 1MFVA 3CPRA 1EOKA 3ABRA 3GR8A 1R87A 3IANA 2ABAA 4JIEA 2GYIA 5IBXA 1TVPA 1P7TB 1LG2A 3E5BA 2V3GA 4Z2GA 3VFCA 5TAOA 4FI4A 4RV8A 3VXGA 4H83A 1JF6A 3W24A 1KM5A 2AQWA 2WMGA 2SFPA 3GC4A 5CLWA 2ZTKA 1PZ3A 1UZHA 1VFMA 3CIVA 1BGAA 3RK8A 4OBSA 3BCDA 2F2KA 4O0ZA 3QY7A 4D8ZA 2NXIA 3UXAA 1LOQA 2O9TA 1FDYA 4DLFA 3JRKA 2YSWA 4GVGA 1CEOA 3WJWA 2BV9A 4GZJA 3L4WA 4JQAA 4PUDA 4H8NA 3IJLA 3LCXA 3N15A 2F9RA 2FJKA 3TC6A 3TTOA 3UG3A 8TIMA 4LAZA 1H3GA 3A5VA 4MWAD 5XINA 1ZLPA 4N42A 3TONA 4CD5A 5LZLA 3T1GA 1LRTA 1JUKA 3EX6A 2YZRA 4LYPA 3R11A 1NF7A 3AALA 1ZHAA 3KBNA 2BVYA 3NQVA 1EF3A 3PFRA 4TX9A 3WLSA 3M5VA 2INEA 2PLJA 4BA0A 1AJZA 2QCDB 4GH1A 3LHUA 3L4UA 3VDBA 3ITOA 4CNNA 2WO5A 4WSHA 5JMUA 3ALFA 3T4WA 4IHCA 3C2EA 1XD0A 1W3JA 3GQYA 5J5DA 3UPWA 3MCNA 4X0NA 1US0A 2ZUUA 4ICMA 1T8QA 4HIBA 4GFIA 5HNUA 1KCZA 3R1ZA 1PHWA 4DRSA 2PBGA 4D1JA 1EWDA 4XD3A 4DPQA 4XTDA 4XZNX 1N55A 4UWMA 5I07A 2RGLA 3CAWA 2E7FA 3LCWA 1I1WA 2OYKA 1GEQA 5A94A 5K3VA 3EEGA 3WD3A 1XLFA 2HBVA 1G5AA 2WVSA 4L5ZA 1PS9A 2AGTA 2JKEA 4K3ZA 5H8UA 3GC5A 5BXTA 4DBDA 3BLPX 3G24A 3DBNA 1M7OA 3W1UA 1MW1A 3LCLA 2VDIA 5LNWA 1SFTA 1EUNA 4HB7A 3CQIA 1RCQA 2V5CA 2FKPA 4HN4A 5HDRA 3NQBA 4KCTA 4R3UA 1JFXA 3SFWA 3BGAA 1BPLB 2R6OA 4BKNA 1EFZA 2VEPA 2INZA 3KCLA 3WL1A 1M03A 3BICA 5I2UA 1C91A 3ARSA 1SFJA 4D9PA 3UBPC 4GY0A 4NJHA 2OYMA 4UFHA 3VE9A 4X61A 2P8BA 4JBRA 2FTWA 3W7DA 2V0TA 2OWWA 2Y85A 2NVCA 5DT7A 4GY7A 2WNZA 3VNYA 3HU7A 3VE7A 3M6YA 2YCLA 2DT2A 4IIGA 1WDSA 4U31A 5DCDA 1UHVA 1GQJA 5CAKA 3GVRA 3AZRA 2Q09A 1MW2A 4Z2IA 4LCSA 3TNOA 1QI4A 3E5PA 1CXEA 1SFLA 3RCYA 1J0JA 4JTCA 3QYSA 1H4PA 3CTLA 1ZJAA 3IACA 1OGSA 3LSBA 1VJZA 1W1YA 2OZ0A 4C1NB 3WK3A 1TMLA 4JDYA 3L23A 4V1XA 3HA1A 2DVTA 1C7TA 1OK6A 2OGJA 3W71A 4MUPA 1XH1A 2GZXA 4KWOA 4DNHA 2WAGA 3TN4A 4GIEA 3ERPA 1M65A 3BUVA 1DJNA 4ZZ9A 4IXHA 2PDJA 3WDIA 2TPSA 2A3CA 1T99A 4H2HA 4WKFA 2VL4A 2WXDM 3WJYA 2ZVIA 5EBUA 3SGUA 4H6EA 4O14A 1TMQA 4TTUA 4ATLA 5CJMA 2F7FA 2BXYA 4UTTC 2EG7A 1MXDA 1VB9A 1UJPA 4MYXA 1PWMA 2ZE3A 1R3RA 3L4XA 4KGJA 3BG3A 2YCEA 2DSUA 1DHPA 4S3FA 3BPWA 1GK8A 4IXXA 5AHNA 3DFHA 2V9DA 2HWGA 4O1AA 3IVUA 3T4CA 4HNUA 2PDNA 1E4IA 3CL7A 2QS8A 2DDXA 1XFBA 1L0PA 2VOMA 1IT8A 2C18A 4YTSA 1JNDA 2Z26A 3LV6A 1KCLA 4I9MA 1KFKA 1YDNA 1XC4A 4N6FA 1TV2A 4HT3A 1SO5A 1TIMA 4PUKA 2X16A 3R58A 3P8JA 1F61A 1WXJA 4HU3A 3BCJA 3CEUA 2ISSA 4K8HA 3AHTA 1DE6A 1PZ0A 4FNQA 3VOCA 3YPIA 3URAA 5AYBA 2WNNA 1B3VA 1K8CA 4NSBA 4BWLC 1XCFA 2Y7GA 4IIHA 1R3VA 2YFNA 1XP3A 4JN7A 3WNPA 4TO8A 1FX6A 4PCFA 1ZENA 4XISA 4S1FA 2JIWA 4G7EA 4MVAA 4XIAA 3T0DA 3GS6A 4TIMA 5CBJA 2X8RA 4GNJA 4HNCA 2O4QA 4I6VA 3AUJA 3ENLA 3SGGA 3CZKA 4ERIA 3BVJA 3CB3A 5CXPA 5CC5A 4XZIA 4JFWA 2POTA 5TIMA 2Q3RA 1O5RA 2XFRA 4DUOA 1J9YA 3WFAA 3RU6A 5AB3A 4JTLA 2Q8ZA 2OKTA 1WE5A 3MUZ1 5AYXA 4XAGA 3TTQA 3OYXA 3DC0A 4KH2A 1K4HA 2G3IA 4H9TA 5T9CE 1OG0A 2O0TA 5HMDA 4EF8A 1WAUA 3CMJA 1A4LA 5A8PA 1SZGA 3BL3A 3N4FA 5T26A 5M5DA 3CPGA 1JULA 1WOBA 2BODX 4R53A 7ODCA 3UJFA 3WD0A 5HINA 2EJAA 4PE8A 3DESA 2GK1A 2JALA 2ZC1A 1NVMA 1TPVA 4CEXC 1SR0A 2GJXA 4XWUA 2V5DA 1O1ZA 4R9OA 4OQVA 3G1SA 4U5KA 1XH0A 4V27A 1OFQA 3N2BA 1O94A 5JH1A 2QCGA 4Z0SA 2Y4SA 4O1DA 2DGAA 2Q8XA 1F3TA 1ODZA 3IVSA 3TAKA 2Z2BA 1XICA 2XSXA 3AICA 3OVPA 2HE8A 2INFA 4DXVA 1LJYA 2Q02A 2NX9A 3AIWA 3DFYA 4LAMA 4N9EA 4J3TA 6XIAA 5I23A 2ZXDA 3WBXA 4FLOA 1WNOA 2WMJA 1GOXA 4MAVA 3AOFA 4PN2A 1W3KA 1Q63A 4HOWA 1R38A 4H8HA 1ME8A 3BLLA 4F2TA 4LY4A 2F6UA 1QXLA 1UD4A 5AN7A 2OMAA 1YPIA 1TZZA 3GNRA 2CBUA 3Q94A 3WQPA 4J3UA 3N29A 4IGMA 1Q8JA 1VBRA 4KRTA 3MVIA 3KM8A 3F2DA 1D2KA 4OIFA 1SQ7A 3QGKC 3U5UA 3R8HA 1O5XA 3W72A 3BQ5A 1TV5A 1YKWA 2FHCA 2A7PA 1OC7A 4NP7A 4DWDA 4BFAA 2ZZ7A 1RBAA 1TYGA 1JUBA 5LIYX 3MMWA 1JPMA 3VOHA 4JTKA 4U2YA 4BQ4A 4LNYA 4RDVA 2QJGA 2GGEA 4DF0A 4AY1A 4ZOCA 4V15A 1LUCA 1KFEA 1KGWA 3C0SA 3E0VA 4MNLA 3KBJA 3DYPA 1EP1A 3UWQA 2G96A 2FHFA 3ZM8A 2HS6A 3ARZA 3UR7A 3W3OA 3VC6A 4IFKA 4QQ3A 4Q4MA 5AHMA 5REQB 1XYLA 4BEQA 5BMXA 5AC4A 4KFPA 3G3MA 2QJIA 4XUGA 3UFYA 1G94A 4NYUA 4WUIA 3M0IA 3WJXA 3E49A 3FJNA 4B2DA 2UY3A 2W3ZA 4O4VA 1CB2A 1FHUA 5K9DA 3JS3A 1TO3A 1O7AA 4M29A 1K7XA 2XVLA 3QY8A 1FWCC 3CXOA 2OLHA 2VFDA 3LOTA 2ZRWA 2I9EA 4XZMX 3THCA 4CU7A 3BGJA 4RNIA 3KE0A 3B9NA 4UNLA 4JFTA 4QAIA 2NV9A 2VC6A 4O19A 4PSPA 2A1YA 1R46A 1XIIA 2QLYA 3EAUA 4ROQA 5F1VA 3EX1A 4QRNA 2QGYA 4E2BA 5AECA 2G3JA 4LBSA 5C9UA 4NZ1A 2W67A 4FX7A 3WLLA 2QMJA 5A8QA 1RZMA 1QHOA 3MMUA 4QLKA 4WDWA 1T8XA 4P7LA 3G1VA 3QC0A 4MB5A 5AC8A 1PBGA 4AG0A 3O63A 2WMKA 2O9RA 4M5PA 3OLDA 4OTKA 3W2LA 3CUZA 3OO2A 3B06A 3AS0A 2OR2A 3TSMA 2CZEA 2OODA 4EK7A 1RSCA 4ZODA 3D3FA 2WJFA 4GBUA 2G50A 4LF2A 1VP5A 2Z29A 4C5ZA 1C90A 2R1MA 3VKBA 3WFZA 1XSIA 4AF0A 1W3TA 3TR9A 2WM0A 3A9IA 1K70A 2IKIA 3F4NA 2GFTA 4PMNA 3UVIA 3CNYA 3KTCA 3TW7A 4FX8A 3UWYA 3MZ2A 1HGWA 3ARYA 3U5YA 1KCXA 2GUYA 3HQOA 3W1QA 3RLUA 3E38A 3D6NA 3O07A 3IWPA 2IS7A 3B9DA 4QGCA 5E9AA 3TA6A 2YBUA 3URNA 1OCQA 1S39A 3DU0A 2HQAA 2DUZA 2YLLA 3GG0A 3KVKA 2WOQA 1OQFA 1QVBA 2PDUA 3IIVA 3GRIA 4LEFA 3HG5A 3W28A 2A6LA 1EJ7L 3IIPA 4M6QA 3W6YA 2ZYFA 4LUJA 3CL8A 2YDQA 3N6HA 4B4HA 3QV9A 3F4CA 4C6FA 3O6YX 3UWVA 1TUFA 4FXRA 1NOFA 1SVDA 3GK0A 3W87A 3LDVA 3N11A 6REQB 1IWPA 2KX9A 3CLMA 3WF0A 3SB0A 1W1B1 1HO4A 4R7OA 5B7YA 1IZCA 2P3ZA 4GFSA 4WY0F 1S3TC 2B4GA 1PO9A 4V33A 2A21A 3AXHA 4LQ1A 3GDBA 2ASHA 4NX5A 2RJGA 2HRWA 4OECA 1RQBA 2BDQA 4LUTB 2GGHA 2EBNA 4K1GA 2DW7A 1J5TA 2O7SA 3IIZA 2IKJA 4K8GA 3GUWA 3UZZA 3TN5A 3NZ1A 1EO7A 3OG2A 4D6JA 3JVAA 5G1TA 4GUJA 4UQCA 2V8ZA 3VGHA 4DPPA 2ZFAA 4HK6A 3ARRA 4GVFA 1K9TA 4MJMA 4DJFD 3PZIA 3G6LA 1FWJC 1R2SA 4AISA 3WMLA 3EXRA 3P74A 2OOFA 1KBLA 4HK5A 1UZDA 4ADUA 3HMJG 1EA9C 4HPJA 1EP2A 1UKOA 3DKJA 1Y8BA 5JBEA 1KRMA 3T42A 1E4MM 1DL3A 2WMIB 3I68A 2J77A 4AEOA 4EOUA 4A05A 5C8BB 3OQEA 1XLAA 2PDLA 1C8YA 3UY8A 4NX0A 3STFA 2J78A 3PJWA 3AZTA 3N9RA 1IWAA 2REQB 1TJ0A 2ZXAA 3WFLA 1W32A 1W3LA 2VFFA 1QI3A 2BLEA 1AA1B 3FHAA 4MB3A 5AZ0A 1MVYA 7TIMA 1QAPA 2XIOA 3UQNA 4O53A 1Q2SA 1GVQA 1OBAA 3G2GA 2PZ0A 3U7VA 2C1HA 1M5WA 2E5CA 3SRKA 3WNNA 4NAEA 3WELA 3BSHA 3EWDA 3PPGA 1B57A 3U8GA 4WHBA 4Q4RA 4KWUA 1IR2A 3U6WA 1ME7A 3BH4A 1CGWA 5A5WA 5AKQA 1AUSL 4HSOA 5C0QA 1EQCA 2HV5A 2QDGA 4GABA 5IRPA 4AH7A 4PA8A 3S2CA 4JIRA 3WLRA 3CBWA 3S46A 3VIHA 2WHMA 2F84A 3VD9A 1ZTVA 1E1CB 4DI9A 4FNTA 2XIIA 3PWIA 4C7GA 5AYZA 4IIDA 5CJ5A 3SGZA 4XAPA 3F03K 5CG0A 3QRHA 5A6TC 3NGFA 3IVTA 3CAVA 5GJMA 4MWAC 1SR9A 1XYAA 3UZ5A 1QPOA 1OX4A 6CGTA 3GBDA 1VENA 1ITQA 1T40A 2QPSA 4I9TA 3W85A 3RITA 4LYKA 4AWUA 5I3KA 5D33A 3LRKA 1KKOA 3HURA 3WEOA 2E68A 2VT0A 4AY7A 4ASTA 1S5WA 3G77A 3PB0A 3VX1A 1PAMA 1DWGM 2AKMA 3PWGA 3LGEA 1XFCA 2BHZA 3W74A 3MPGA 3IGXA 1B5TA 2DZPA 2E6AA 4RPQA 3CHVA 1V3HA 2CZ5A 3SUVA 3QZ6A 4LGXA 2DT0A 4B91A 3LMZA 3QFEA 4RLIA 4JEJA 3CHDA 3TVAA 3U7BA 1N7KA 3ZZ1A 4IICA 4RNFA 1I2NA 3N73A 4IP5A 4JCMA 4YCPA 3W83A 1GJPA 2WKLA 4GG9A 3NQFA 3FJ4A 1MZHA 1PKNA 3H54A 3G1HA 3STGA 3RNDA 1AZ2A 2GSEA 1TJ2A 1ODUA 1VZWA 1EC8A 5FL1A 1JDEA 3W70A 4EPEC 2VDGA 4M6UA 3DC8A 1HVQA 4B90A 1XRTA 2AQVA 3KVMA 2G0WA 1JZ5A 6TAAA 3H21A 4AC7C 5EL1A 1PYFA 2F2HA 2NQZA 2RH9A 2Y8UA 1JCTA 4LYQA 1NP0A 1PL9A 3M6DA 2P53A 1UPPA 3CMFA 3JZEA 5AHLA 4BQ2A 5CC7A 1V02A 4DHGA 3TQVA 3CUXA 3BG9A 3UJ2A 3UT0A 3XIMA 2PWUA 3W7RA 3N2TA 1DOSA 4H01A 1XIEA 3LCFA 4AY8A 1T7LA 1QU4A 1YDYA 1P0KA 2C71A 4AIUA 5A6BD 3DAQA 3HG4A 4GOAA 1LLOA 1QT1A 3POHA 1KTBA 1QRQA 3RYSA 3R0UA 1FXQA 5BU9A 3ZR6A 1V7YA 3QN3A 1WXYA 3PPFA 3KTXA 1G4SA 1TZ9A 3URQA 1KA9F 1RHCA 2PDHA 3MWAA 1PSCA 2XFFA 2OXNA 1LBMA 1E6ZA 2ZUNA 5CCZA 1YNQA 3W88A 3P5YA 1TX2A 3E2RA 1JFHA 2PDXA 4Y7EA 4C6LA 4G5DA 4E2VA 3QW3A 3L4ZA 4L4MA 3CAQA 3P81A 4MHBA 1RQHA 3BV7A 4B5WA 3HBLA 1UWIA 3TLLA 1BGGA 2ZX9A 1CIUA 3LCHA 1U30A 2Y70A 3CAKA 3G0UA 1P43A 4IZGA 1I2QA 3WUFA 5CC6A 3TZNA 3WUBA 5ABFB 4Y8FA 1VYPX 1P7TA 2E28A 4W9TA 5F4SA 1R86A 5CH9A 3WJZA 4RCXA 3W22A 1W54A 4JIIX 4IIFA 3S2JA 1JPHA 1MQPA 1PDYA 2XIQA 4QJ3B 4YU1A 4UOQA 4O54A 1SJBA 3W07A 4RE2A 1KBBA 1JZ4A 1UG6A 3W00A 4UFKA 1ADDA 3H2CA 4N6EA 5G2WA 3NTYA 4A22A 4NT0A 3T2OA 4CKQA 3EWCA 1ZJHA 2OB3A 3DG7A 3UXKA 4PUEA 2G4FA 4PTDA 1QPQA 4O0KA 4PUJA 3LZ3A 4L9ZA 1M3UA 1PVNA 1BWKA 1XJBA 4OUEA 1N8IA 3I3DA 3KCJA 2WBKA 4UTJA 3UD6A 2ZOXA 3F2CA 3PHAA 3UY7A 2FH8A 2BGSA 5F4WA 3UXIA 4CCCA 1Q7QA 4H8VA 1BXBA 2EHHA 3P8IA 4HCDA 2WZEA 3VIIA 3R0DA 4IGSA 2QR6A 2OVLA 3WLKX 3V36A 4MGGA 3LPGA 1IT7A 1XIGA 2FGLA 4J3WA 2QCDA 3T8LA 1XDMA 3W6LA 1XPGA 2V5KA 2V30A 5HK4A 3NZGA 1XGDA 3R13A 2ODOA 4L4OA 3L4YA 2WCGA 2PMQA 3ZJ7A 1VCFA 1W3HA 1Q65A 4YCOA 1HTIA 5D37A 4M56A 1FCVA 4DI8A 4UQDA 1TELA 1L6SA 1TE6A 1JI1A 1IT0A 4JTJA 2ZRYA 3WMSA 1A3WA 3BSMA 4JNZA 1XKYA 3S42A 4GUIA 3MHFA 5SWUA 5A8MA 3RCNA 3OEXA 4LYRA 1V5XA 1YTEA 3H12A 2GVLA 3PZMA 3R4IA 3WQ8A 1QDSA 3MBDA 3KP1A 2C8NA 4S39A 2WSQA 1H2JA 3D46A 1GVRA 4V1YA 3NQAA 1GWJA 2POZA 4BY3A 3HV9A 3MI3A 3E3HA 1KV8A 1OM0A 3C52A 4NJJA 3BAJA 1BSLA 1TE1A 4KWWA 5HMFA 4ICNA 4PGLA 1E1FA 1DJQA 2DP3A 3KBWA 4UR8A 1F3EA 1AQMA 1KW1A 3IPWA 3P93A 5G4WA 3H7VA 2WWDA 2XIMA 4B92A 4HA1A 4Z2LA 4WZHA 5DRCA 2AMXA 2UWFA 1CGYA 3UXDA 1ELSA 1IWBA 4XG1A 3UWWA 4WOQA 3TJIA 4LS0A 3H26A 1KLYA 3KFTA 4Q32A 1F2JA 3N25A 5JVLA 3QHNA 1JRBA 4C6OA 4JHOA 2V67A 1Q85A 4LFYA 3U48A 1TZ7A 5HQEA 4KWSA 2PRMA 4FNPA 4WXZA 1MZRA 3TN6A 3W0KA 2OU4A 5BMWA 3ABXA 3GNXA 4PTWA 3S8HA 2YL5A 2EGZA 1JDDA 3HFYA 4LVAA 4JOMA 1PTDA 3TW9A 4JTGA 3B8SA 3C0QA 4F0MA 1ZAIA 4C1NA 1PIGA 1FWFC 5CZJA 3MS8A 1GVIA 3R8RA 3SCWA 4DYEA 2VD8A 4Z08A 5D9OA 1JZ2A 3GW3A 3ES7A 4AVNA 3I4KA 5CBIA 3WEMA 3QYQA 2EAWA 4HZMA 3GNPA 1ECEA 1XW8A 4H1ZA 4IMGA 3TMQA 4JTDA 3WQDA 1HL9A 3AJXA 1N8FA 5U4NA 4AWSA 4KGLA 3P0WA 5EYWA 2QF8A 2QNEA 1AH4A 3H2AA 4KFOA 4QSHA 1UH4A 3QBUA 1YTKA 4HGXA 1QI5A 1FWHC 1UQZA 3NPWA 1ME9A 3W02A 3MY9A 4AZCB 3VYLA 4FP1A 1UOKA 3KLLA 3SEPA 3ITTA 4DXKA 4I7WA 2VEFA 2VGFA 2J75A 2FGBA 5LA2A 2QF7A 4AYSA 1DIKA 3G1DA 3GTFA 1SZFA 2PFHA 1Q4NX 1VFSA 4EVZA 5EFDA 3W27A 5IDZA 4UFIA 1T6MA 1BG4A 4WDTA 3T0BA 3G5EA 2OSWA 4ERGA 1TPFA 5LA0A 4B15A 3GE7A 4HN8A 2ZX7A 1D3CA 3EOUA 4AX6A 1ZSXA 5DMNA 3TTEA 2J88A 3CV1A 1JXJA 4TMBA 2WANA 4A4AA 4IMDA 1UR9A 3UZYA 4M8UA 1E4NA 3U2EA 3AC0A 4QG9A 2YL6A 3P61A 4PSRA 1WA3A 4QG6A 4HP5A 4DF1A 1XDJA 4GQ0A 3M0ZA 4IP7A 3K1DA 2PDQA 5G2IA 4GGBA 1WAWA 3SCNA 3A6OA 2XDFA 4D8LA 2L5HA 3WF4A 3MP4A 4W84A 2OELA 2UY2A 4CNTA 1CXKA 5K7JA 3EXTA 5KSWA 3S6TA 2OTDA 5CPOA 3BOXA 2Z6IA 4URIA 4Z17A 3EKGA 3O0FA 3EPNA 4UCGA 3REQB 1XBXA 3FHQA 2GQ3A 3FCPA 1KR1A 1IEVA 1UD5A 1ZJIA 3LM3A 1GNXA 2XH7A 3VIKA 3R25A 4MB4A 3TUUA 4XD6A 5A2CA 5FJTA 4PEKA 4M7TA 2ZWYA 3WL0A 4M0XA 1UB3A 4Q22A 3A47A 4DJEA 4ZQCA 4OKDA 3RILA 1OYAA 3WDHA 3NXLA 1ISZA 2P3EA 3RPDA 3SFKA 5FSDC 3XINA 1BVWA 1V0LA 3AWNA 1QFEA 1DJZA 1K1DA 4EXQA 1CGXA 3VPLA 3F7JA 1KRCC 4P8WA 8XIMA 1KFLA 2QKFA 2Z27A 3IJDA 1O60A 4GJ1A 3UF9A 1G4PA 1G01A 2BY3A 1HQTA 3A21A 4A2SA 2YCJA 3VGGA 2C14A 4ENLA 1PX3A 4MPQA 2J25A 3LK6A 3PSWA 2QCCA 3EX4A 5EMMA 4BQ3A 2NVDA 2Y8KA 1LORA 4PUUA 1XYFA 5A6SA 1JZ7A 3WKZA 5BRQA 2YX0A 2VOTA 5D8WA 2HPIA 4H41A 2HBXA 4L61A 4KCUA 5FJJA 4Z0JA 4O8AA 2BZNA 4MJ4A 1E9ZB 4S3AA 3SCVA 2HDJA 2JF6A 3EBVA 1QO5A 4WX2A 1X1OA 3BCFA 4US5A 1W1ZA 3T81A 2PWFA 1U22A 3VIGA 4HTYA 1E6QM 1ZAHA 1MEIA 2DEPA 4XZBA 3RX3A 4CQBA 4UOJA 2IQ0A 1FFQA 4LT9A 5FF7A 1L8PA 4PMUA 4L65A 2OEMA 2W0UA 4RR4A 1J0YA 1YIXA 3WY1A 1BYCA 2VJXA 1K7EA 4DJFC 2PF0A 1GQKA 4TXEA 4W4QA 1US3A 3THDA 2OSYA 4NKCA 1Y65A 1S5VA 3NYZA 5HNNA 1V08A 1QK2A 3B8IA 5GPRA 3W23A 1ICQA 5BW6A 4LOCA 4BI6A 1HKWA 2CEQA 3S1VA 2XTKA 1VYRA 2PZNA 4KWVA 5CPTA 3S4TA 4GIYA 5AHEA 5AYYA 4L1WA 3L4VA 2WJDA 5REQA 3VI2A 1WO2A 5CZSA 3T7VA 3S5YA 4WSKA 1Y5VA 4AZHA 3EOLA 2VZUA 2PGEA 1ZNNA 1V02E 3GDRA 3UG8A 2XZ7A 1E56A 3KOFA 2AMGA 4HA4A 3WJSA 2OZ8A 1MWOA 3RMEA 4JGDA 2DZTA 2IKHA 3ABQA 3HTWA 3RAOA 1EXPA 3PANA 2QJMA 1S46A 3ZOAA 1UWTA 5H91A 5LIKX 3CT2A 1QHZA 4L6OA 8A3HA 3M4HA 3LBOA 3STCA 1W5OA 3TTYA 4RNHA 2WSYA 3CB8A 4I7UA 3UR5A 3PTDA 2YYTA 4DWSD 1TJRA 4GZ7A 4JTQA 3NQ7A 4UR9A 3DYMA 5FJOA 5FF0A 1X38A 5E6ZA 4LUYA 4CD8A 2D0HA 3QR0A 4DZHA 1RPKA 3GR4A 1NARA 3L2LA 3MP3A 3MUIA 1D8WA 4OOUA 1O4UA 4OV4A 4TVUA 3TXZA 1YHTA 3VDHA 1GONA 4MDPA 2YBVA 2GL5A 3GIYA 4JR5A 1JD7A 3TJXA 4C6MA 3WLTA 3CC1A 1DJGA 4JTFA 1RUSA 4I5RA 2Z2AA 4AQLA 2G3NA 2BVTA 3N04A 1ZBWA 3VINA 5HULA 4B5XA 3RUBL 3F1QA 2D2GA 3H22A 4PMVA 5IHRA 2DIEA 3MANA 4F9JA 4MZYA 1U2YA 4XTIA 1KM2A 5I77A 1TPC1 1W17A 4M3PA 3ZJ6A 3DEQA 5HWJA 4RPPA 3GSMA 2FQIA 4XIMA 3IRDA 3CL6A 2GQAA 1O6IA 3GAKA 4OHQA 3OHMB 4ZL1A 1XGZA 2XH0A 3T05A 4DBEA 4G1NA 3DFTA 3L0KA 4H6KA 1DHKA 3L65A 1ML1A 1F4HA 4XBSA 2WWCA 1CT5A 2XN0A 2Z7KA 3CO8A 4ZO8A 1GHSA 3G1RA 3SZ8A 2GDVA 3TX9A 2YCKX 1KFCA 1OSEA 3BLEA 3FYPA 1PWLA 2ZXBA 3DG3A 1W31A 3IJ7A 4LV9A 1AVAA 2YR1A 1S2TA 1UIPA 3URBA 4Q4PA 3R43A 1QMLA 3M43A 2V82A 1B31A 3CZGA 4H9MA 5C70A 1MNSA 6REQA 3ES8A 1W2VA 5EKYA 5G4HC 3QZEA 1VD6A 1LBLA 2X1UA 3CQJA 2W79A 3JZUA 4GXPA 4W8LA 2ZZ6A 3SURA 3IEBA 3DGRA 1LZOA 4BF7A 4LU0A 4JX6A 1K3UA 3B9EA 3S5OA 1BWVA 4TTGA 1SYTA 1WUEA 1ISYA 1DJYA 2PI6A 4HHPA 1E4LA 3KBMA 1NAL1 3RJYA 4FF7A 2FJUB 2VX6A 1ESWA 5MKGB 3STEA 1PKLA 4HHHA 1UD3A 2JGQA 3ZLGA 4AHQA 4JFUA 1P0BA 2QEZA 3U3HA 4RK8A 3F5KA 1UASA 4KIEA 1A5OC 2ZDSA 3U57A 1EGMA 3FYYA 1DIEA 3PZTA 4M24A 4JTUA 3SW6A 5BOEA 3AZSA 2P50A 4PRWA 2QCNA 1R30A 3ZSTA 3BMVA 2D20A 3OZPA 2ALRA 1QNPA 1VPYA 1RLCL 9XIMA 3I6EA 2E1WA 2VEKA 1QR7A 1ZP4A 3OVQA 1NSJA 1XLDA 4HU0A 1A5UA 2Y8VA 3R5EA 4BF5A 4NZFA 1EJVC 5G4EA 5I79A 1VPXA 2VCAA 2WMIA 1XLJA 4H9UA 3P84A 4FS9A 3HZ3A 1HN1A 2VX4A 3TDFA 3VA8A 2YXGA 3BLKA 2J66A 3LXBA 4UXDA 3EWYA 1S1RA 3RR1A 3L0NA 2REQA 3B0UX 4UBPC 1HJSA 1MNZA 2X2YA 3RJXA 4IMFA 2FVKA 4HNOA 2D24A 1J2BA 4U10A 4W5ZA 1JYXA 3M5XA 1KM4A 4P8UA 3RO6A 1VGAA 2XUCA 2PLKA 5H1WA 3WLNA 3UVAA 1Z6KA 5CPQA 2CLKA 3E2VA 3W26A 1TTPA 2XSBA 4GVIA 3OZMA 3E9AA 3QV7A 5F7UA 2QUMA 3EDDA 1EEPA 4H9XA 1QTWA 1VBHA 1ITCA 3S1GA 4IFKB 1CXFA 1FOBA 3G1AA 1N82A 1SGJA 4ZO9A 1UD8A 1V3IA 2BS9A 2PWHA 1FFRA 3BLDA 3HN3A 1OEPA 2OWXA 5C2GA 4N2YA 1W0MA 3DHFA 3IJ6A 1UOZA 3R8GA 1E1CA 4S2BA 2D1ZA 2ZWZA 3TXVA 1GKRA 3B0VC 3BV4A 1H0GA 4IX2A 1UWRA 4DB7A 2CLMA 1UC4A 1R7OA 1XL9A 2DQWA 5ABTA 5CAHA 2FMOA 1UR3M 3AU6A 3ZJ8A 1NH6A 3IUDA 3PP7A 4LEQA 1BFNA 1MYRA 4AZBA 3LERA 1PHQA 2CLPA 2GUBA 1EZWA 4LBRA 2R9RA 1TVLA 2DZUA 1Y5XA 1B4EA 1R6WA 3W7JA 3TYUA 4QS6A 2CITA 3DIPA 3SUSA 3H24A 4J40A 2D0FA 3VD3A 2ISWA 4FNUA 3MCOA 4GYPC 5I00A 4EACA 1OABA 2IPJA 2ZX8A 1S38A 4JY9A 2JGYA 3ZLHA 5JIWA 3GAYA 3V5FA 1V77A 1O95A 2I14A 1SO3A 3R0KA 3NIYA 3C2OA 3SQLA 1B0IA 1EYWA 2P8CA 4EAMA 4K36A 1V3LA 2W5FA 4UTTA 1F9CA 5FJRA 2C19A 1J11A 4GWEA 2A3LA 2JQXA 3EMCA 5TNVA 3F2BA 3NCOA 1MO0A 1GCYA 4FOUA 2CBJA 3ZVIA 1V6XA 2YB4A 4HSNA 4C5YA 3MBFA 4LH8A 4G7FA 1HT6A 3EDEA 3DBPA 2UBPC 3W84A 1EUAA 5IHSA 4H6RA 4A8IA 1IHIA 3GDLA 3S1UA 1E40A 1TQXA 1H63A 3ARUA 3CGTA 1UP2A 4RXFA 1KFBA 5DBTA 4GYKA 1UKPA 1ZQ5A 4LUIA 2E77A 3N2OA 2Y7DA 5C9ZA 2ZUSA 2DSKA 1PCWA 2BP1A 2V5BA 4JKLA 1ONXA 2O9PA 3HF3A 4EAYA 4BWLA 1QW8A 2X30A 5FSEC 3M7WA 2E67A 3V5OA 1P6BA 2BOFX 3NG3A 1S5NA 1ZALA 5A6LA 5E0CA 2BOEX 3GIPA 4Y9MA 1VRXA 2BVWA 3TN3A 2FB2A 4MY8A 1QNSA 3M0MA 3SRDA 3S6DA 2V2DA 2C1IA 1VFTA 2P88A 2I9UA 1W56A 2C0HA 3W7OA 3UEQA 4CEUC 3MYOA 2QVHA 1XIHA 2GGGA 1TREA 4Q4QA 3PTMA 4U3AA 2EKCA 2CYGA 1H61A 4I9JA 5I6SA 3ZXWA 3BURA 3SCRA 1SZNA 3QSRA 1KXTA 1CTNA 2EEXA 2NZLA 3SUWA 3RIKA 3NO3A 4XBJA 5D32A 4Y9AA 2CXEA 3FA4A 3AIRA 3W6MA 4O11A 1OFEA 2ZUMA 3MO7A 2DQXA 4D6CA 1R5YA 4ATWA 3NZQA 4QAWA 3APGA 3GG7A 2B0MA 3DKLA 1EWEA 1SUXA 3N2MA 3NVDA 3C6CA 2VUYA 1PIFA 1BYBA 1OINA 1GKPA 3EWXA 4IUOA 2WMHA 5ABFA 2DIJA 2GQ8A 3ISIX 1TB3A 2WZMA 4AEFA 1HW6A 3WD4A 5F4XA 3TQKA 2R94A 1ISWA 2PP3A 3C61A 2Z25A 1LQ2A 3ARWA 2KZHA 5D4YA 4Q8WA 4YVXA 3PZVA 1D8CA 3N9SA 4ZE5A 3M9YA 3UZJA 3QPYA 1U1HA 1KM0A 4OGZA 3EMQA 2D2HA 2Y5JA 1E3XA 3RGTA 3MUCA 4ZGYA 2VO5A 3C0LA 3VOJA 4R9XA 1QPNA 3KRSA 3F5JA 3T0CA 2OX4A 4M51A 2OT0A 3CUGA 3CQHA 2DY3A 1QI2A 4FF5A 3AS1A 4QP0A 3SY8A 1W5PA 3INPA 5JBDA 4CQ8A 4LC6A 3GZAA 4IGHA 3WQFA 3AS2A 3NQ8A 5FA5A 4MFEA 2BVDA 4ZR8A 4NZ3A 3WH8A 4QEHA 2NV2A 3GVGA 2AOSA 3H70A 1CXLA 4G9PA 1XLMA 3VKAA 3QQ0A 1U1UA 4LANA 5F2IA 3PB2A 2W92A 3PG9A 1F05A 3D47A 4NQ1A 1I75A 3UYCA 3I4EA 5D30A 1OYCA 5BXPA 3E02A 4ZTYA 4EKJA 1A47A 4I90A 2J24A 2BY1A 2J8GA 4JFVA 2RDUA 4ZQNA 4BI7A 3GVWA 4IQDA 1EJTC 3WH5A 4W93A 3C3NA 1OK4A 2P76A 3MC5A 1J01A 1UMYA 1UCWA 2I5IA 1EGZA 1BYAA 1OX4B 3VFLA 6PTDA 3RLGA 5C9XA 1ZAJA 2DPEA 1RJRA 1PX4A 3S83A 5D05A 2XU2A 3G1XA 1DWAM 8XIAA 4GGHA 5LSMA 4FMVA 2ACQA 4L4LA 3K4WA 3KL0A 1SPQA 5M17A 1ITUA 1U5VA 1F07A 1DIOA 3EDKA 3UPMA 3C2YA 1V8EA 2B7PA 4FXFA 3UA3A 1EOMA 4AW7A 3SECA 4L6HA 3BTNA 4YVVA 5B80A 3P3BA 1Q6OA 3W1PA 3MO4A 1IIHA 3QGAC 1DQWA 2ZDRA 3GH7A 4CGTA 3SI9A 4RDYA 3RRAA 2JKPA 2B31A 1BTCA 3C8FA 1GEHA 4HVXA 1TA3A 4E8CA 3AIEA 1OFDA 3HPZA 5LKYA 4PMQA 3SCTA 4JL2A 1BAGA 2BY0A 5C54A 2BHUA 3MI6A 3VIOA 1L8NA 2WV8A 1OF8A 4P7OA 3LENA 3NEVA 1RP8A 3G1YA 1I6NA 1Q13A 1Z3NA 4LUSB 4EX4A 3GVQA 4HQVA 2D22A 2PTZA 1BG9A 1W5NA 4YXGA 2VFIA 1F3XA 3PJUA 2WNQA 1YE4A 4P2VA 1EC9A 1BVZA 4IMCA 3TH6A 3UGRA 4DBSA 3VNLA 1IV8A 2Y61A 4GQQA 4XAYA 1MDLA 3B0PA 3QR3A 1CCWB 4K37A 3G18A 1S2UA 1XF0A 1DQXA 3ZT7A 4XSLA 2AQOA 4S3BA 2H3DA 1DXFA 2R8WA 3SBFA 1A0EA 2G4JA 3C5QA 2CNCA 1WDDA 2QDEA 4QE5A 1J18A 4JPGA 5I3IA 3QW4B 1O5KA 5KTLA 1NIUA 2PDGA 4TX8A 3VUPA 1M41A 4XAFA 1TWIA 2IKGA 4KESA 2NT0A 1X8FA 5IOBA 1XIDA 4Y8EA 4LF1A 2D2JA 1P0DA 4C91A 2ZQ0A 4AFYA 1UWQA 3FSTA 3O06A 4R7WA 1PYMA 4ZTXA 3GTXA 4KEMA 3NM3A 4RZ4A 3WMBA 3CQ0A 5K4XA 3UXLA 2VGGA 4TU1A 5IM51 1J2WA 4GMEA 4WJ8A 4GCAA 5DN1A 1BXNA 4C60A 4A35A 1S2WA 1Q6RA 4FZIA 5I3FA 1UW9A 1LROA 3LHVA 1S5MA 4NVTA 4AZCA 4HNTA 3VKKA 3KHJA 2ZXQA 3DUGA 3W7GA 1O68A 4U3CA 3KOXA 1LQ0A 5JU6A 4UB9A 1DPMA 1LM1A 3MZNA 2XWEA 4GACA 3E6EA 2EQDA 2WB5A 3L66A 4KW2A 5F1UA 1W9BM 4LCQA 3T44A 3GU1A 1AW2A 2Z1WA 4IIBA 2X0HA 2HROA 4ONVA 3PSVA 1UWUA 3WYZA 2E3ZA 4W85A 1FCBA 1RY0A 3HPAA 5DMLA 2P0OA 3BQ6A 3V4BA 2GVEA 1TVNA 2EG8A 4BI5A 3GLCA 5FOOA 2VCCA 4DWSC 1HJWA 1B3YA 1E6XM 2PURA 5FACA 1EX1A 3A24A 5MF5A 1NU5A 1PTAA 3CYJA 3B0XA 4F3HA 2FZDA 1Q4WA 4GPNA 4GVHA 3D5HA 3VDGA 2VC5A 4WR3A 1TJ1A 2V3EA 1OYBA 1B4KA 4LXFA 3VD7A 2QZRA 4HPXA 5CSUA 2XIBA 1Z89A 1WKFA 2OQLA 1XRSA 1CWYA 4LTSA 2EPHA 1OIMA 3ARVA 1VIWA 4PCPA 2ICSA 4G1KA 4X60A 4UFMA 3B97A 1G67A 1Y7VA 1GYMA 4CN6A 1JVNA 4Z2HA 4GQGA 3TKFA 3ITGA 1XBYA 3REQA 1J8VA 3FOKA 2ALDA 4B4FA 4JNYA 2X1SA 5DXXA 3TTSA 3SDOA 1GJUA 1A50A 3MI2A 4L1XA 3AS3A 3M47A 4JX4A 4WCJA 1XSJA 4PB5A 3ITYA 4UMBA 4CQDA 4NILA 3ID7A 5AY7A 3QLLA 2I1OA 3WNMA 5DMYA 2F6XA 1M7PA 5C7HA 4MTVA 4IL0A 3COTA 4EIVA 2HPMA 2NXHA 3N2XA 3MSRA 1UUOA 3M1ZA 3L7RA 2PE4A 4PCTA 4S3EA 1YYAA 3QF0A 5A2AA 4Z1BA 3GUGA 3VM7A 1RV8A 3RF9A 3C4UA 3P7YA 4A29A 1V0MA 4A8NA 1E71M 1EEXA 2QJJA 1EBHA 3MMTA 1EH9A 4ZBCA 4EPKA 2C13A 3DX5A 4MUZA 2VTFA 4S3CA 4D6HA 1PEZA 3MW7A 3BZJA 1EP3A 4B5SA 1H0IA 3ABZA 2VWSA 3U4AA 1RQEA 1AQHA 4MWAA 2CHNA 1VCVA 3RCMA 4QLLA 5BCAA 3RO8A 3GXMA 1J0ZA 1TIWA 1LLWA 4NF7A 5BRPA 3DGBA 3TJ4A 3VO0A 4XKMA 3TOPA 1W1IE 4LB4A 2DZBA 3BW4A 4ZFCA 1JCYA 1DWHM 2XGIA 5FD0A 4Q8UA 1XSKA 2DORA 3W1NA 3UP8A 3PNZA 4MY9A 4PCSA 2F61A 4J35A 1UP3A 2TYSA 4GIAA 2B7QA 2X1IA 2XIJA 4IFOA 4EWJA 2C79A 1K6WA 2WM1A 1T0OA 1KGXA 4XZ9A 3U2CA 5CGMA 2O92A 3TSDA 1AQFA 4OVXA 3A3WA 4XKYB 4GX8A 3O3RA 2I17A 3APYA 1UROA 3GHSA 3W7QA 4JIPA 4HNVA 2P0IA 3IIOA 2EKGA 2VZSA 5IDIA 2NQJA 2JK2A 2H8ZA 4QFUA 4MZ1A 1B2YA 1SSDA 4PMDA 3BLFA 5D2YA 1TJPA 1I2RA 4ORMA 1UA3A 4HD5A 1M1BA 2E9BA 3UU0A 4ZE4A 1YXCA 1M7JA 4DF2A 3THUA 4XVEA 2WQPA 1AZ1A 3NOYA 2A3AA 3C0JA 1Q66A 1QNOA 3GU9A 3GD6A 4JHMA 4CCZA 1ZB5A 4YS1A 4WOZA 1QASA 4A3QA 4EWND 2DFAA 2DZSA 1XWYA 3VNIA 3W1RA 3QZAA 3PFMA 4PZVA 1MMFA 3MKCA 5E9XA 2QPUA 3PUDA 5HMSA 3GFXA 1UUQA 3ZO9A 1OADA 1V93A 4MM1A 1GYLA 4JTSA 3W7IA 1ITXA 1GJWA 4IWWA 3NQ6A 3WLIA 2GSJA 2CESA 1LWJA 4NASA 5ECVA 3IUHA 4IQLA 3AYRA 4I3GA 4E2OA 4LV4A 4UCFA 1OY0A 5TBOA 2Z2UA 4JN6A 3THQA 1H1NA 1UA7A 3LLDA 5ABHA 3IGSA 2NQ9A 2A2IA 4D6GA 1E0VA 1POKA 4ACZB 2E8ZA 3PZOA 1H62A 1Z48A 3LI1A 3M0XA 1NFBA 3CM4A 5GQBA 2PC4A 4QLJA 2EPNA 2P1FA 2J7FA 4BZYA 1FWTA 4FIQA 2PRHA 1CDGA 5BRBA 1DV7A 3NNTA 4QDMA 1H7RA 4H7CA 5CBBA 3K8LA 3TZFA 3KS5A 2QPXA 4MLJA 3WK2A 1AL8A 4PTXA 4QJ4B 1WDRA 4NAFB 3HQ1A 2DZVA 5DFAA 1DJHA 3QH2A 2A79A 3RU8X 4PB3A 3KS6A 3EGJA 4IQEA 2ISDA 4DZ5A 3NR0A 4WDXA 1XC6A 2F8QA 2QCMA 2NX1A 2WSKA 2NXGA 1W37A 2QUTA 3KOZA 4MAZA 1YE6A 3M07A 1POJA 1OFOA 1YQ2A 1ZJBA 2FZ9A 2CZFA 3FGCB 2VUNA 3P80A 4C6JA 3TFXA 1KM6A 1UD6A 1XD1A 5JQ9A 1QWKA 2PODA 1JPKA 2ZZ4A 1KTCA 1ONEA 4CVUA 1OB0A 3S2LA 2DJLA 3QY6A 4ORIA 3FKKA 3T2QA 1WXZA 2XPKA 2VVSA 3L67A 3LQGA 1XDLA 2ON3A 3BLOA 2VX5A 1CXHA 1KCKA 4W8AA 1DWJM 3H2EA 1KBKA 3GVVA 2QCHA 3MYPA 2J27A 4FNRA 3H4XA 4R88A 3EOEA 3P60A 3LQLA 1EKOA 1UR8A 5EB8A 3LHZA 1V3MA 3WN6A 1QOXA 4UTKA 1E6PA 2YOCA 2PDWA 5LNUA 3VUSA 4ADSA 4EP8C 3KOWA 4XB3A 1GVOA 5DMMA 1GZJA 3KP0A 3HB9A 1IEWA 2GVGA 3QEZA 1JXKA 4NYYA 5EU9A 2E9MA 4AX7A 4LY8A 3V18A 5MKGA 4Q4KA 4IOTA 1ZBCA 1FWIC 2PDBA 1QWGA 5E0FA 4Y96A 3LSCA 4CNSA 5FF4A 3PZUA 3PC0A 1MUWA 1BF6A 4IG2A 2G95A 4C65A 1W3NA 4LC8A 3JW7A 5A8NA 2WJEA 1E0WA 2WMFA 2ZZ2A 3AHVA 1J0KA 1XINA 2O7QA 1UR2A 2RUSA 7TAAA 3E2QA 3AI0A 4OWGA 3LG3A 4X2PA 2ZRXA 5LNVA 3BW3A 4DJDD 3RPMA 3OTRA 4C6BA 3PZGA 4UTMA 3RX2A 4EXAA 3GNDA 1AH3A 2FFCA 5CQ1A 5CG7A 5C6MA 3BW2A 2QW5A 4IGNA 2GWGA 3FJ6A 3NPXA 3GTIA 4MADA 3KVLA 3TOYA 5FEXA 4DZAA 3NSXA 1EBGA 5RUBA 4S2CA 1CGTA 2OQHA 5LNSA 1XLEA 3DYOA 4JXCA 4B9YA 3N14A 2DSWA 3B03A 3DECA 1TSIA 3FXYA 1EHAA 1DKWA 2FZNA 2EPMX 2J8FA 2ZTJA 4LVDA 3K1GA 1F73A 3VOFA 3KWSA 3VMOA 2WHLA 4GH3A 1LOSA 3LCGA 4CLMA 4R7JA 4XUYA 1VS1A 3W53A 3WDPP 3AXKA 4H9VA 2PP1A 1KC7A 2AAAA 4L9XA 2KAUC 1GVFA 3DFSA 1RVGA 3LHTA 2E5BA 5KZ6A 3PBWA 4X3ZA 4IJCA 3LPFA 2RJHA 2P5NA 1S2CA 5C5YA 3HQPA 3ZMRA 9XIAA 2ZZ1A 3AHZA 4XK2A 1E0XA 3FDGA 3ARQA 3OIXA 3G6MA 2GWNA 2YFOA 5F2GA 2DZWA 1XIBA 3ANVA 4EANA 3UGVA 2CERA 2WC4A 1IGWA 3SN4A 2Z7GA 4H8UA 1KM3A 2CKRA 1IEQA 3O8AA 1UR0A 3UA4A 3WDRA 3CLWA 1JD9A 1GPFA 2QCEA 1V0KA 1F8IA 2WYSA 1QNRA 5ABGA 3SO7A 4NNAA 4GBDA 4HA3A 3VM5A 3G3DA 1EC7A 3R89A 4ADTA 3UETA 3C3UA 1PTGA 3IJ9A 4E4FA 2E4TA 3AU2A 3RPTA 3TSBA 2PCEA 4QM1A 5AOUA 2W9MA 1OCNA 3CHEA 3WCZA 1SMAA 4Z1CA 5M03A 2EO7A 1TV8A 2ISFA 2J9XA 1B3OA 2CIPA 1D3GA 3GFYA 3NUKA 2PDFA 1G0CA 3E2SA 3BAYA 2A5HA 5MHBA 1A4MA 2NX3A 1RH9A 2V81A 1PPIA 3N1AA 3V0SA 2QCLA 2HMCA 1K02A 1UJQA 2BSLA 1IYXA 2Y6ZA 4PC8A 5JIPA 4KCVA 1EIBA 4G6CA 2H6RA 2C7FA 1U1JA 1EJWC 3BJTA 2VURA 1L6GA 4JQ1A 5HA7A 3V16A 1P0NA 1IXOA 4BEUA 2PD9A 1H7PA 1TRDA 2O56A 3QOKA 1FY6A 1PE1A 3CPUA 5D2VA 2WSPA 1RA5A 4F48A 1EJXC 2E25A 2VEIA 3BMWA 2VHLA 3HGSA 3JR2A 4M1BA 2PEVA 2OLSA 1L2UA 3QTGA 2YDSA 4U4MA 3FIGA 1QO2A 5BYWA 1OGGA 5D38A 3A4WA 4IJRA 1R9ZA 1FHLA 1W3IA 3V35A 4GK8A 2C15A 5CKSA 3NURA 5G5IA 1Q6GA 3TYZA 3FAXA 1U33A 2VMFA 1E9IA 1QW9A 3MWCA 1KM1A 3P82A 1AMYA 4A3HA 5LXEA 1KO0A 3PS7A 2IPGA 3AJ7A 3FV9A 5EA9A 3WLJA 3L5LA 4Y90A 5DQPA 2I57A 1H11A 1TKKA 3FEQA 1H5VA 4FLSA 4E5TA 5M2FX 3MUAA 2PDIA 5A8GA 2FFIA 4LNCA 1E0TA 2E6DA 1B9ZA 1Y5WA 2HISA 5J04A 1VFHA 3QMTA 1C93A 1CX9A 1R9XA 4L80A 2BTMA 4Z2KA 3S9YA 4XBKA 5FAJA 3ATYA 4ZQOA 1REQA 1XYBA 4MNJA 3L12A 3AISA 3KLKA 2OT1A 3CH0A 4E2DA 4BS0A 5G2HA 1K4GA 2CHOA 3KRZA 1UR1A 5LHFA 1IGSA 4RXGA 3NQGA 2RHGA 2ZCGA 3O0KA 1Q8AA 4D6DA 5HJYA 2I16A 3B8DA 3GIQA 1UYQA 3ZLFA 4B5UA 1YADA 1BRLB 1IEXA 4RX0A 3VMNA 1RD5A 1KD0A 5H8PA 4NZJA 1O66A 3LXAA 1G7VA 3UPBA 1FH9A 1RA0A 1VHNA 2HXUA 4NJKA 5HATA 5AVNA 3AFBA 2HJPA 1QBAA 2W63A 2HVMA 3GXPA 4I8YA 4J3ZA 3KDOA 3PBYA 1KTNA 2BASA 4GIRA 3VU2A 3RMJA 5D09A 2YPIA 1WDPA 3UG5A 3EKZA 3TC3A 4WGHA 5DRIA 3MJYA 3TC7A 3ZJKA 1LRNA 3NQ2A 1WUFA 2NQLA 4JYFA 3UCQA 1SO6A 1D7FA 4A8RA 3ZT5A 2OSXA 4H9YA 4RW5A 4JEQA 1L2QA 1AJ2A 4HOXA 5FCZA 1ONWA 3D0CA 4AIOA 4HHMA 1SMDA 4LB3A 3WLMA 4AXNA 4HPNA 1ZBVA 1AG1O 5AHIA 5HPCA 1AW5A 4R5EA 3ABSA 4PBEA 3SN0A 3VGEA 1NEYA 1EB3A 2BHYA 5AVHA 4U2ZA 1BXCA 5H8MA 1Z32X 4LSBA 3FSUA 5U7SA 1FBAA 3THAA 4WKHA 3EPMA 3WF2A 4M82A 5I09A 1R3YA 3BSGA 2QUNA 1H50A 4W8BA 3AXMA 1CGVA 3EX2A 3VZZA 3S2NA 5I78A 2W91A 4O15A 3W7PA 5PTDA 1XLHA 4UMCA 3OQ8A 1JL8A 3IAPA 1OHLA 2X0SA 1H1ZA 2J4GA 4O17A 2FVLA 3GYCA 2IQDA 3ZIZA 4DJFA 1P0EA 5CSRA 2UY4A 1WP6A 4GXWA 5A3HA 4GLEA 5LHEA 3FXGA 1ZRQA 3MKVA 3UG4A 3OODA 4DZIA 2ZX6A 4ZSTA 3PULA 4HYWA 5KZDA 1PIIA 7ENLA 4PYSA 1D3HA 3HGOA 3IIXA 2VZTA 4GQBA 3C2FA 3IS4A 1JYVA 1EJSC 4LAUA 5TQLA 1JDCA 2Z1BA 2VQTA 2MANA 4JFSA 3E12A 5I24A 1E15A 4TQTA 3W2KA 3IAQA 3RXZA 4R27A 1X96A 2YGYA 3CUHA 1J12A 1R85A 1OC6A 4B9ZA 4PULA 1J0HA 2OGYA 2JF7A 4M19A 4QROA 1YNYA 3DFPA 3HPFA 1CXIA 5HAOA 1MRQA 3HJEA 3RLVA 1I0BA 2R1PA 3TROA 1IZKA 5B7ZA 4WXYA 3SCQA 4UZSA 4MZ8A 4MFDA 5CSYA 5J8LA 1LBFA 3VX0A 1A3XA 4UOZA 4GISA 1TX0A 3BAIA 3VZXA 2BNJA 3KVJA 1KBJA 4S3DA 1J79A 3V1HA 2PF8A 2IPWA 3PJXA 1KQYA 1E1EA 4WJXA 3GHRA 4ZOBA 5DXYA 2TODA 4GUGA 1KR0A 4US6A 2PP0A 4I7VA 5EY5A 1K7FA 2RGMA 2VFEA 3S5SA 3PVFA 2ZUVA 4FXSA 1SW0A 3GC2A 3GTHA 3LMYA 3G0XA 1XX1A 3M0HA 3NPVA 1FH7A 3B9AA 4LUSA 4PODA 1W2PA 3RRXA 1X1ZA 4K6AA 1HJXA 1ICPA 3VKCA 6XIMA 3W4RA 1GG1A 4DLMA 5FF3A 1RCOB 4C1KA 3W38A 4NG3A 2QCFA 1KRBC 1NTHA 1S2AA 3HOJA 1ECQA 4JIQA 3GH5A 5KEZA 3RHGA 3CT7A 1VAHA 1WX0A 5LIWX 5A95A 2GJRA 4LCRA 1I4NA 1BLIA 5F2MA 2A0NA 2ABBA 2C6QA 4X2RA 3IJQA 3VILA 3UERA 2EF9A 3LN3A 4AZIA 4RE3A 5A8OA 1XBVA 3L5AA 4O4WA 4N4QA 1XLBA 4ICCX 3V75A 1H49A 3VD4A 1TTJA 4JN8A 5I3GA 2YDAA 4KT2A 3VNMA 4YNGA 4P61A 3NDOA 2DW6A 3N17A 2Y62A 4ECLA 4A2RA 1FWWA 1MXSA 2XINA 2R91A 2F6KA 1EZ2A 1XLIA 4N4PA 1I2PA 2X2GA 5EMLA 4M80A 1J4EA 1LL4A 3W7HA 2WSRA 4D2JA 3LUTA 1FHDA 3GX9A 3LRMA 3B8VA 2WVUA 1EDQA 2YZ5A 4A21A 2W66A 1VFUA 1XXXA 3NWRA 5HOSA 3NL5A 3OVGA 4Q8VA 5E6YA 1SJCA 1WBJA 4FHAA 5CSSA 4C6PA 1K9DA 4ZOEA 3N3TA 3VGBA 1YXYA 3C8NA 1TR1A 3W29A 2E40A 2VM8A 1IQ8A 1FVPA 1VBGA 1A5CA 4FPSA 4NIRA 1F76A 4GX9A 4PRTA 1W1PA 4JQ3A 4GC4A 2VI0A 1LP6A 4H3DA 2NSOA 4AZGA 3KEHA 2YLAA 1TCMA 4A8LA 1Z9AA 3W2NA 1WDQA 2Z4GA 2CLOA 3U0HA 1TV7A 4NRRA 2X05A 3SAZA 3GKAA 1C92A 1OZQA 1NDYA 1EO5A 2WNWA 3ABOA 2VNCA 6ENLA 4WY0B 3NL6A 4GZIA 3Q4DA 2WPBA 7REQB 1LDCA 4D8AA 2UY5A 4KFNA 2BFGA 2AL2B 3NQMA 4PMJA 3WNKA 1B9BA 1E3ZA 4J2MA 2EPLX 2ZICA 3MSDA 2QJHA 5LYRA 3DERA 2ZX5A 1AQ0A 4HSHA 1EJRC 3FFSA 5A6BA 4GQRA 3OOQA 2QXWA 3W25A 1UUMA 1OT2A 1W8GA 4HK7A 3WQ4A 3NDZA 4BQ5A 1B54A 3MP5A 2WVTA 4NI3A 3SUUA 4CQAA 4P5UA 1R8LA 2J7DA 1S2VA 1FTXA 1JUEA 4H6QA 4AMAA 3LLFA 2BXVA 2WCSA 4FB7A 1H41A 5HANA 3LNMA 1NFGA 1MEHA 1HG3A 3VD5A 1UR4A 1UBPC 4YHGA 5JH2A 2DJXA 2R1KA 3ME3A 3WQWA 4YHEA 1XLGA 2JBMA 5EGRA 3APTA 1E9YB 2ESCA 3OYZA 3VKDA 2PWGA 3ZWSA 1XISA 5HPOA 4N02A 4GD0A 4JKKA 4ZXOA 3HGJA 3S9ZA 2NLYA 5H2ZA 1MQQA 3EWWA 1AJ0A 1SU5A 1JNEA 4RUBA 2R82A 3W7MA 2GGIA 3UR2A 2GDQA 1A53A 4DN1A 1T96A 5FJPA 1BEUA 3A5FA 3S2MA 1ADOA 2ACUA 4X0VA 1YRRA 4Q6XA 4QTGA 2DH2A 3UWEA 4WSJA 3WH6A 1PB0A 3OW1A 2CLLA 4YYFA 3NQCA 1W1A1 2G8ZA 4D71A 1VJIA 4JDBA 4JKMA 3VMPA 4XAZA 3T07A 1FP9A 5E70A 4K8EA 4ZB0A 2GQ9A 5BZAA 5JBFA 3BOFA 1M6JA 5EMKA 1DXIA 3GXTA 1E70M 3JU2A 3DHDA 4KRUA 1XCWA 4PBGA 1GPWA 1QHPA 2WZIA 3ATZA 3U2OA 3H7UA 4O57A 5I02A 4K68A 3WSUA 2FHBA 2OZ3A 4ZO6A 1JPDX 2LLEA 3OZOA 3EWBX 1TA3B 3BAWA 4UNKA 3FJLA 4Q33A 3OZYA 3T08A 4J1OA 1YW1A 2GJPA 3KZPA 3EOSA 5LGZA 3CU2A 4YVPA 3WO8A 3DFNA 2IXVA 2RKXA 2X42A 4JTRA 4AZ6A 3W1MA 2TRSA 1R9YA 1E6RA 1BF2A 3PZQA 3PTKA 4GYPA 1X8CA 3T0TA 1EXBA 4PMXA 2QVNA 4KEVA 3W86A 4Q8QA 3N4EA 1FWGC 1F6KA 4UR7A 3OLEA 1FWRA 1LOLA 1RY8A 3WLOA 1EJUC 1HJQA 1VYSX 5DT5A 1CB7B 4GA8A 3N6QA 3L4TA 5D9MA 5CZ0A 3HMCA 4M1RA 2NT1A 3S3GA 4XKYA 1MFUA 2RFGA 1JG9A 3ZQ9A 1WZLA 5I3HA 1FWBC 3CASA 4JS3A 2V63A 3U4FA 3PZNA 1F5ZA 4F0KA 2XVPA 1ZP3A 3LU2A 5D9PA 3B4YA 1U5JA 3NJ3A 3JUGA 3MTWA 7A3HA 5EMUA 4Q8TA 5A6JA 2OLAA 4DJDC 2Y88A 1QJWA 1NWUA 4UTWA 3TFCA 3LEPA 4ZSUA 3EPOA 4LX4A 3OIHA 2YBTA 4JQ4A 4QBXA 3BGGA 4K39A 2P10A 3PN8A 2BG5A 1RK5A 3PBGA 3LXCA 4HNLA 4E3TA 3EA1A 2WJZA 3WDJA 4OZOA 4P8VA 3PY2A 4X63A 1L6FA 4MKNA 4IT1A 3SIMA 4CN1A 3G0SA 5JXQA 4LVBA 4MOZA 3V3WA 1CECA 3MV01 4IMAA 4ATDA 3ICJA 3EDFA 5I5RA 3O05A 1EX5A 2VRQA 5HR7A 3OGSA 1ZCOA 2HK1A 1A5AA 3WUEA 3TR2A 4AIBA 2XISA 2MUCA 1W6TA 3AIUA 1DYSA 3B8WA 3FN9A 5IFPA 3QC3A 4ZEPA 1J6PA 2QAPA 3QVQA 3FK4A 1Q6FA 3QOMA 4S3KA 1X6UA 3B40A 2EPKX 4A6GA 1GQLA 1W9DM 1BQGA 3CUFA 1ZPTA 3GG8A 3ECQA 2PCQA 4NRSA 3MMDA 3S1XA 4BK9A 3OA3A 1XLKA 1YNPA 4S23A 6A3HA 3MHUA 3WIJA 1FWSA 2WHJA 4AHPA 5HUOA 1NJJA 1PDZA 4ACZA 1OFAA 4JQ2A 2J79A 2W6RA 2V5JA 2OEKA 1IXNA 4XD4A 1AK5A 3I3EA 3E74A 1Q45A 2Y7EA 3WNLA 5K9XA 3POCA 2E0PA 2J7EA 3BJSA 1LQAA 3LHWA 2OYLA 1A3HA 1BD0A 4IPPA 4RZ6A 1VH7A 3RLHA 1JF5A 1F8MA 1KBIA 2VVNA 1JIBA 4QDPA 4NAFA 3GW0A 3UJEA 4B2DD 1QNQA 4OFCA 4W7VA 2FVMA 5AC5A 4ML4A 4D1IA 1HO1A 1WKYA 3TU9A 4WKAA 1KNWA 3NL2A 3BG5A 3ZVHB 2E9LA 2CU0A 2V2HA 1GOOA 1CLVA 3BZGA 2OO6A 3USZA 1FDJA 4REQB 1E5NA 2GJLA 3FGCA 3QFWA 1DJWA 4QNEA 2PU1A 1SZEA 4DBWA 3CMGA 4I8DA 3M0KA 4KQNA 3UYIA 1I9CB 4FX6M 3ITLA 3MJMA 3CV7A 3LY0A 4FR1A 2D3LA 3PBMA 6TIMA 2F38A 4F66A 1EIXA 1UP0A 1VFFA 4NZ4A 3BLIA 5AHFA 4LWWA 3W1TA 5I7GA 4A3UA 3A12A 3WLHA 4Z1YA 4NJGA 1XS2A 3BAKA 3QPEA 4LS1A 3TA9A 4Z1DA 2A7RA 4PUWA 5HBFA 2C1GA 2HE5A 3PZ9A 3FVDA 2QAFA 4KS0A 4PR4A 4UQ9A 4WQ6A 3QTPA 5L6UA 2VQUA 4QCFA 2VGBA 3A23A 2WK2A 3UWZA 1OT1A 1TWWA 2PTDA 4GINA 2VFHA 2PU0A 2HTMA 3KAOA 4PBFA 2R24A 3N4AA 1V3JA 3VDAA 5I03A 4F4RA 2VYOA 1AFSA 2XFWA 5M1TA 2C3ZA 2PA6A 4FA3A 2H9AB 4NI8A 4ALDA 1DTUA 4MJZA 1OGBA 1VEPA 2ZRVA 4TUFA 4TVCA 4ZQMA 4UTLA 4D6EA 2QYGA 4JIHA 1F74A 2OFJA 5DO8A 4N0RA 2GPTA 4I5UA 2PAJA 4MWAB 2XGZA 5E5CA 4AU0A 2ZADA 3QKEA 3Q2DA 3VC5A 2J7BA 5A6KA 4N9BA 2OWCA 1HKVA 2QULA 1IEIA 4FK9A 3OGVA 3AIBA 4KIRA 1I60A 2DVUA 5A2BA 4HBKA 3MDWA 1V6TA 4IH3A 2VKZG 3NQEA 1YXDA 3ONCA 1I0DA 4DY1A 4GJJA 5LIUX 3SADA 3WNOA 5HWMA 5G1YA 4AIEA 4BR1A 4KKXA 2XJ7A 3W82A 3ZR5A 4Z2JA 4POCA 2YKKA 3AAMA 3NZRA 4JTIA 4O1BA 2CXGA 1R3QA 4PTVA 3PR2A 1Z44A 3EA2A 3LS9A 3H23A 1OD0A 3DN5A 2RDWA 4ZVJA 3WZ0E 3TYBA 1GW9A 4Q8NA 3R6IA 3B05A 4XO6A 3S6OA 1WQ5A 2Q6ZA 1D7KA 3VVGA 4GNKB 3F4VA 1SW3A 2B7NA 3O1NA 5HUPA 1AD4A 1RALA 1VRDA 2Q3OA 3W75A 2ZVRA 3H2NA 1RVKA 2DZXA 2PTYA 4KEZA 1V6WA 1YDOA 5E0KA 3BAXA 4RV3A 3NO1A 1M53A 4K38A 4LJ3A 1TWDA 2XH2A 1GOQA 2GLKA 4XSMA 1Z8AA 2NQHA 4GI8A 4GY1A 4GI4A 1JQVA 2HK0A 1C29A 3TMLA 1YBQB 2YA2A 3IGUA 3LA4A 2A3HA 2WKJA 4C1LA 3GXFA 2VX7A 1GHRA 3VIFA 5BU6A 2PD5A 1YPFA 1SO4A 3K46A 3WBWA 3FLUA 1XG3A 4JICA 5BXSA 2WPGA 4S3GA 4O28A 1EGVA 4FLRA 3NSNA 3FDKA 3MKKA 4YMZA 1MXGA 1WZMA 2ZZ5A 1V7AA 4KCWA 3NZPA 2ACRA 4CQ9A 3OJGA 3H8AA 1LWIA 4MLRA 1RR2A 3IRSA 2X0YA 3G1FA 3TYEA 5LGXA 3R12A 3EYPA 1MUCA 5IBXC 1G1YA 1JZ6A 1W8SA 4PEEA 4N7QA 2Z28A 1DBTA 4MMWA 2PWEA 4NUWA 5EFFA 4GHRA 4FNSA 4U33A 3OU8A 1XYMA 3HO8A 3WK0A 4DO6A 4ZOAA 3HG2A 5ENLA 4L7ZA 4HJFA 4TOQA 3A64A 4S3JA 4E3VA 3GKFA 3SQSA 3DZ1A 1TQJA 5CZTA 3AMLA 3WQCA 2ATSA 2V6AA 1XGEA 4PMOA 1JCXA 3H2FA 2YJQA 1KXHA 1GQNA 1Q2RA 5HQLA 2ATMA 4MB1A 3NL3A 4O1FA 4IPJA 2QUUA 3E0FA 4Y2WA 4Q7IA 2QGHA 1XUUA 4FOJA 3F5LA 5TF0A 4CD4A 3QMRA 1C9WA 1DXEA 1TPUA 4NJIA 1GYNA 1SJDA 3W7KA 1HP5A 1P48A 1MI3A 4O1CA 1E0UA 3M64A 3SM0A 5CGQA 5FJIA 3GDMA 4DO7A 1SZRA 2YXOA 4NNBA 1QPRA 4J4KA 4CU8A 4DWSA 3VCNA 3II1A 2CBIA 5HXMA 4G8TA 1ZFJA 4YYCA 1NDZA 1W91A 1LF1A 1A5KC 1LT8A 4LVFA 4WVXA 2DVXA 3QV6A 3Q67A 3IV3A 2RDXA 2A3BA 3WMCA 4EE9A 3LGGA 1XHGA 4ERAA 3MV11 4W89A 1QK0A 1J6OA 3VNDA 4QHRA 2YB1A 2CWNA 4UTUA 3KCOA 2I7GA 1WKDA 1MUMA 1Q6QA 3ZR4A 1HJUA 3FVMA 1H09A 3GM8A 3E96A 4E38A 1ZGDA 4AD4A 3GG1A 2WKGA 1KXQA 3KBSA 2YYUA 4BCEA 1PX8A 3WK1A 4MJ2A 1ZL1A 1UZ1A 3UW6A 1L9WA 4IG2B 1GZ1A 3ARXA 1P5BA 2VELA 2BGQA 1XH2A 1DJIA 3OLIA 1BRLA 1ZY9A 2Z1KA 5H6HA 2W61A 2PSNA 1H1YA 4OBTA 3KHDA 3N3MA 3OG3A 1Z69A 3H55A 3L2MA 3B0YA 2Y0FA 5C2XA 4GKTA 4IPIA 3W7NA 3CEPA 1C8XA 1ADSA 1V4YA 2I56A 4JY8A 3AROA 4Y9NA 2HSAA 3ZT6A 1G9HA 3EB3A 4ZQPA 3TNBA 3VIJA 5EBAA 4EF9A 2W62A 1BQCA 4W5UA 2GSHA 3CQKA 1GZGA 1QNVA 3VTRA 1VEOA 4QQUA 5EMJA 5A1AA 3UESA 2XH4A 3M46A 2FLIA 1P4CA 3AO0A 4XO7A 4YTRA 3NQDA 1X1NA 3Q65A 1YMYA 5DELA 5FEWA 4Y9PA 3VKJA 1XM3A 4HZ6A 1NF0A 1J93A 2NVAA 4F8XA 2ZA2A 4NZCA 5FKYA 3OP2A 3K30A 3A4XA 2VWTA 4UFLA 2X1TA 1KGUA 1E55A 4ACYA 4HZ7A 2EG6A 2X7WA 3QQ1A 4HJWA 4U5IA 5A6MA 1W9PA 3GNNA 2CZVA 1VC4A 4OUIA 1HL2A 3AMKA 4PUMA 1H7WA 3W01A 2CLIA 3J7HA 1BSIA 2D0GA 3TQPA 3MUXA 4YTQA 3K5XA 4JL1A 6ALDA 2Z0IA 3GHUA 1I1XA 1H5YA 3L21A 3T78A 4WGXA 4ZQRA 3WLPA 4O16A 4E6MA 2DZAA 3W9ZA 1HJVA 3V7PA 2YA0A 2NUYA 3PG8A 1N2VA 1IIGA 4OJYA 2V3FA 3OVRA 1GTEA 1MSSA 1KRAC 2FZMA 4DELA 8CGTA 3ORWA 2Y2WA 5DY2A 3P5ZA 4LRSA 4PL1A 3AYTA 3SCOA 4EXBA 1JCNA 1OX5A 4RZ5A 4NL1A 3R79A 3PPHA 4BJHA 3FX4A 3SUTA 1LT7A 3PWAA 1NQKA 1LYXA 4Z1AA 4R85A 5FJUA 1A5SA 4NNCA 1NM9A 5D2TA 5J5RA 3PNUA 1IF2A 1R2RA 3SCPA 4J5NA 5I3DA 2VXNA 3SJ3A 4M6PA 1RP9A 4YN5A 3RM8A 1FCUA 2V68A 4M81A 1NDWA 3WUGA 1V0NA 1A5NC 1JR1A 1E6SM 3DG6A 2V2CA 2QJNA 9CGTA 3IV8A 4DIAA 2PB1A 1WKEA 4DNMA 4RW3A 1VBUA 3C2RA 3LGDA 4C90A 1ISVA 2OKOA 1C8QA 1KWGA 4AD5A 4GI6A 1LL6A 3EMZA 3L68A 1UQYA 3NGJA 1Z7AA 2CFFA 3ZSSA 3ONBA 3A22A 4NXKA 3HJZA 5BWFA 4YPJA 3FEMA 4E4PA 5CPLA 1L6WA 3BO9A 4AD0A 1GOMA 1ISXA 2Q8LA 1FDZA 1DWIM 1HKMA 3DFOA 4HHLA 2ZE0A 4JX5A 4C6EA 1P1MA 2FPTA 3DH7A 1UKSA 1U83A 2J47A 3HQNA 4W87A 2VD9A 4FAMA 3QHMA 2A3EA 4JD4A 3VAVA 1CYGA 3EA3A 2CZDA 1YTDA 3KRBA 2XGBA 3VOIA 1OD8A 3LTYA 3PK7A 2PRLA 2DUXA 4W7WA 1V6YA 3CS2A 1TWSA 1KQZA 5CGTA 2IQTA 5LXXA 1FKXA 3A13A 2NSXA 4O12A 4D72A 3LPOA 3FYOA 2PTWA 2E8YA 4MKSA 2AAMA 1XG4A 4W7UA 1Q5MA 3S9IA 5AYIA 1AW1A 1XIJA 2A7NA 3MCMA 4FALA 2YA1A 2OEJA 3W7EA 1VR6A 1HKJA 3WQGA 1T5AA 2WHKA 1X7IA 3DFQA 3L9CA 3GFZA 3CV6A 2ZKMX 4C6DA 2AGKA 3HG3A 1IR1A 3FKRA 4HKPA 4YWSA 1EF2A 1GVSA 3OHIA 1REQB 1JZ8A 1BHGA 1XYZA 2J7CA 2B7OA 2YL8A 3BXWA 2O55A 3NA8A 4CQCA 3VNJA 1BYDA 4FR6A 4LAOA 4LPCA 3CH9A 2WW5A 5K4ZA 4UMAA 4WDUA 5DCBA 1FH8A 3OBAA 3N18A 2XVKA 1OWQA 1KB3A 2G3FA 3E0WA 1C9DA 5IXEA 4UTHA 1TUXA 2HCVA 2PGFA 2Z1SA 5FEZA 3T0AA 3WQ5A 4WD0A 2J13A 3WQVA 1JI2A 4CD7A 2ZUTA 1N8WA 3QXBA 2BBFA 3DHPA 2CHRA 4Q4OA 4M7SA 4IX0A 4LW7A 3TJLA 1IE7C 2PLMA 3H4WA 1W1TA 2CLEA 8RUCA 4GXMA 4WY0A 3T55A 2CC0A 3GHTA 5ABEA 1G7UA 4V28A 7REQA 2QHAA 3IJIA 2AL2A 4KETA 4UIOA 4ZMGA 1JPIA 2Y89A 1GGOA 1XLLA 4PTMA 4O18A 1XQKA 4KEUA 4L4PA 2H8XA 1OC5A 4B3ZA 3O6CA 2J9ZA 3A4AA 4QE1A 5FAGA 3GXNA 4HU4A 1ZU8A 4IFRA 4IMEA 3PUGA 4GO9A 2IMRA 1V3KA 3CWHA 2FTYA 4OV9A 2J8TA 5HWNA 1LL7A 2GGJA 3UR8A 3W7LA 2Z24A 3N12A 1DEDA 3QV8A 1E73M 2OJPA 5AC7A 3SIZA 2ZA3A 2PGWA 1KV5A 2ACSA 2TAAA 3EZ4A 1IXPA 1WB0A 4G2DA 3H2OA 1H60A 1XI3A 4MY1A 1M04A 3EWUA 3KW3A 4Y9OA 4BHYA 5A6AA 1W1VA 2FYMA 1F7BA 3QLDA 4J28A 5BOOA 2BX7A 3PAOA 3OGRA 2R1NA 3EX3A 3SN1A 3Q37A 2DUAA 4HTBA 3TCEA 1NP2A 1RPXA 3H2MA 1X39A 3VDCA 2ZA1A 2CKSA 4QCEA 4I6KA 1UC5A 1LLZA 3G8EA 3FY1A 4GC3A 1T41A 3SSJA 4R33A 2QV4A 1FXPA 3NEHA 3W2MA 5BROA 5ECUA 1HZYA 3VGFA 3KRUA 1C8VA 4DXXA 1KFWA 1OFRA 3NOEA 1JRCA 4OOZA 1QW7A 2Y5SA 1CI1A 2VC9A 3TYCA 2NUXA 3TQ0A 1NWRA 2ZRUA 1Q6DA 5KINA 1RBLA 3O7UA 3I65A 5C9RA 2GOUA 4KRZA 5KMYA 4QIUA 4GUFA 4WIWA 3TK7A 4AD2A 3VK5A 3LZ5A 1K8XA 1MDRA 3ITXA 3LB0A 2VCBA 3W1XA 5HQMA 5BOFA 1UD2A 3DHUA 1RK6A 2ZUWA 1G4TA 1G6CA 3KDNA 4H4IA 1U5HA 3LTPA 2H3BA 2WVVB 4C7FA 5DEZA 5AZ1A 2YXXA 3MSYA 2HS8A 3SY5A 2E1DA 1X6NA 4MG4A 1QUMA 3U2ZA 2IUZA 5F2LA 3HPXA 3W76A 3MHGA 4IL2A 4GO8A 4DQWA 3DOPA 1P1XA 3TYDA 1SW7A 1UWAA 2JEQA 2Z1VA 2HNHA 3GWQA 4AUBA 1VFLA 2ZBTA 1R0MA 2PS2A 3UNDA 1PZ2A 1W9UA 4IP4A 1VKFA 3K13A 3GB6A 4DO5A 2E6FA 4MSSA 4GZEA 3MVTA 1JJKA 3ARTA 3USBA 3H6OA 4KMQA 1Q3NA 5FIPA 4DX3A 3MT1A 3A4JA 1DJXA 4DJED 1YDVA 4QG8A 4JHZA 2GJNA 2QMKA 3CUIA 2GVYA 3FS2A 3WF3A 2PGRA 1VIZA 3GU2A 3FAWA 4ML9A 3XISA 1TPEA 3GXIA 1JGMA 4AD1A 4GCXA 2HVNA 3O15A 3V1PA 4TVDA 2DU2A 1WYIA 5M3WA 2XFYA 1G69A 5T9BG 2JEPA 4DO4A 1VCGA 5HR6A 4F2UA 3DDMA 3CWOX 4YTTA 2JE8A 4CNOA 4Z42C 2HVOA 3WBEA 1F4AA 1WOAA 1UKTA 4GKLA 4MYAA 3T09A 5L9FA 3L5MA 5K9CA 4AHOA 4OBRA 2OO0A 3ANUA 1TPWA 1UIOA 1JZ3A 4MDOA 2WC3A 5CLTA 3R94A 3RM4A 4XZLX 2VEGA 3UJRA 4EPBC 5C2CA 4JCLA 3LNPA 3VNZA 1E9LA 2OZTA 2PUZA 3WQEA 4K2SA 1MRAA 5EMYA 1W9VA 4UC5A 5DCEA 3IK4A 4B5TA 4US5D 5HJXA 5C71A 3RX4A 3ITCA 3S47A 3H4GA 3CYVA 4ZXLA 1W9XA 5C9WA 3HV8A 1JAEA 5GNZA 3AUOA 3KTSA 2JIEA 3IK2A 3WQOA 3H7RA 1E51A 4P8XA 1OF6A 4LRTA 1XCXA 3LTSA 4CUCA 1ONRA 3N2CA 2G97A 4LAKA 1OZMA 2YIHA 5CJNA 3EOOA 4PL2A 4HNNA 1H7OA 4OU1A 3WBAA 4NXSA 3UZXA 4ILSA 3VIMA 4JYEA 1QI0A 2UZ9A 4O10A 1J5SA 3WF1A 2W4XA 4AWEA 2B81A 2A4AA 4JYDA 4RL3A 1ZS2A 1C3FA 1GUVA 4AC1X 4B5VA 4ZO7A 2ADAA 1F3WA 3B8TA 4UZUA 1UZ4A 2O4MA 1DIDA 3QSTA 3I3BA 3IGHX 3SQMA 5HJLA 2PDPA 3AMGA 4FO4A 2WQDA 3I7SA 4DAIA 1M01A 3SJNA 4CCDA 2DIKA 3MUY1 1GG0A 4PMZA 4GE8A 1M68A 4DM1A 1A5BA 3M0JA 1CNVA 1EPXA 3ZVHA 1R47A 4MNMA 4R34A 4REQA 1K9EA 4DUXA 1QBBA 3EB2A 3GZ3A 5D2XA 2FPVA 4XVDA 2VENA 2PLCA 1JDFA 1OIFA 3M0VA 2NUWA 3NAVA 2IPFA 4UNIA 3GY1A 1VEMA 5D2WA 4D6FA 2UV8G 1CW2A 4RE4A 4V2XA 3MQTA 3FA3A 1LCOA 5D04C 2PC8A 3OLGA 4Q7NA 3QKZA 2TMDA 2YCLB 3I6RA 3WENA 3WX7A 4HMCA 2CPUA 3O6AA 4CNUA 1DVJA 1YPXA 4JZ5A 1VFOA 3KBVA 1AD1A 4C7DA 1DTNA 4UQBA 4AAJA 1AMKA 1XUZA 2H90A 3T8QA 4XQ6A 4EPDC 3QPZA 4MKVA 4JTTA 4CN4A 2PDCA 1B3XA 4C6NA 2RDTA 1UBSA 5DBUA 3W2JA 4DEFA 1K6AA 4NY2A 3S5NA 4ZB2A 3BWWA 3W1LA 3UZWA 3EKLA 5CZKA 1TV4A 4AVOA 2VFGA 4NHVA 1O12A 3BARA 2QV5A 2ZRZA 1V51A 1W5MA 1JYNA 3G22A 4HOZA 4Q7BA 3STPA 4BF9A 2H9AA 1DE5A 4DVOA 7PTDA 3A3XA 4CCEA 2JFEX 3GXDA 3TP4A 1SM9A 3WDQA 2CLHA 3CK5A 1V6UA 5E93A 5K2ZA 2DV0A 4YJ5A 2NWSA 4QX4A 5KITA 1AH0A 1H51A 1ALDA 1KXVA 1UKQA 1F6YA 1A80A 1NY1A 2HEJA 3WEZA 2VC7A 3R7MA 2FMNA 4E8DA 1PUDA 3OB8A 2OCZA 1EPVA 9RUBA 1E43A 2EPOA 1GOIA 1NDVA 3CWNA 1JGIA 3CZLA 5KZMA 4H2CA 3T40A 4RZBA 4I5XA 4Y6GA 4TMCA 5FI8A 1IZJA 3TIMA 1FRBA 3QMSA 4Q8OA 1HVXA 1XPYA 5C55A 3PM6A 4AD3A 3CZ8A 5GNXA 3NYDA 4K1WA 4HYRA 3N13A 4RKAA 1V6VA 3DENA 1I2OA 2XHYA 3P2VA 2GDUA 1RJPA 2FDSA 2D69A 1B1YA 4Q8PA 1EDGA 4L56A 3R2GA 2D23A 3OPSA 4GRSA 1GKQA 2Y1HA 1EDTA 1L6YA 3P0XA 1XIMA 4HA0A 3E1F1 2C16A 4UTIA 4GYFA 5CC3A 3BJFA 1FWEC 3SY1A 1XV8A 4AZ5A 1XYCA 2GUUA 4PUNA 1TCDA 3O16A 1K03A 2MNRA 1THFD 4IQJA 3NXFA 1V79A 4JNMA 2PTXA 1ICSA 3M7SA 4PMYA 1K8YA 3T9PA 3GO2A 2XVNA 4FSAA 3SR7A 1HX0A 1XKJA 4JTHA 4HMEA 4G7EB 1SFSA 4J9JA 2RAGA 4W86A 2NLIA 4L9YA 3GR7A 4NZ5A 1OCJA 4PFHA 1XR2A 2DH3A 1TTQA 4DYJA 4UQAA 1TPDA 3AYSA 4O1EA 4L6DA 2PWVA 2XSAA 5HNTA 3EXSA 3ZWTA 3WQ6A 4UQEA 1NELA 2D2OA 2FB3A 4KPLA 1EYEA 1P6CA 1YBQA 4H00A 4F79A 1Z42A 3P14A 3CZJA 1HFBA 4TR9A 2VZOA 2D73A 3LCIA 3GBEA 1PKYA 4H19A 4RDWA 3TLQA 4O52A 4RNJA 3AXXA 2WZTA 3RR4A 1DORA 4DAFA 2E09A 1B30A 5E1QA 3KX6A 1P6WA 4FOKA 5FL0A 1PZ1A 2GK1B 1JEZA 3QJAA 1NWTA 4YWIA 2GJXB 3E0IA 4QE4A 4YIWA 1KWKA 1A0CA 3MDUA 2TSYA 4WJEA 4XV0A 4H7VA 2OPJA 3MA8A 1NOWA 4IPLA 1B90A 1PXGA 1W5QA 4LUTA 4S38A 5HNRA 5BNKA 2J7GA