3UU0A

Crystal structure of l-rhamnose isomerase from bacillus halodurans in complex with mn
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
414
structure length
401
Chain Sequence
b'KSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
total genus 142
structure length 401
sequence length 414
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uu0A00
3KTCA 4A8NA 3N4AA 1XLIA 3XIMA 3VNKA 4XKMA 4GQBA 1S5NA 3KBJA 3XINA 2XIMA 4QEHA 5EMJA 3NGFA 2G4JA 4QEEA 5B7YA 3CNYA 1XLJA 1A0EA 3VYLA 3CQHA 5B7ZA 3M0HA 4YTRA 3BZJA 3AAMA 3WQOA 4XISA 2I57A 2QUMA 3KBWA 1QUMA 1XYCA 3AYVA 4QE5A 3ITVA 3ITOA 4QDWA 2X7WA 3U3HA 9XIMA 2GUBA 4W4QA 3JU2A 4YTUA 3KBMA 5H6HA 5J8LA 1XLAA 3XISA 3UVAA 1XYLA 2GYIA 3C0SA 4US6A 1QTWA 4Q7IA 1I6NA 5I7GA 1XLKA 1MUWA 1XIGA 4A8IA 3IUHA 4X60A 4PGLA 1S5MA 3DX5A 1MNZA 4YTQA 1TZ9A 3AYTA 4GJIA 4ZB5A 3P6LA 3M0XA 3UU0A 3ITLA 3CQJA 2GLKA 5XINA 3DBNA 3KWSA 5C9ZA 5XIMA 2GVEA 4YTSA 4HHLA 1GW9A 1XLDA 3VNLA 3BDKA 3KCOA 4X63A 2HK0A 3IUIA 1XLBA 2QULA 4EAYA 1XLFA 3M0LA 4HHMA 3M0YA 4XIAA 1BXBA 1DIEA 1XIHA 1XIIA 1DXIA 2G0WA 2J6VA 1CLKA 4GLEA 3CWHA 3VNIA 4KW2A 2XINA 3BANA 3GNXA 4G56A 2HCVA 3VNMA 3QC0A 3OBEA 4XIMA 2NQJA 3ITYA 1OADA 4A8RA 2HK1A 1XLEA 5EMMA 2QW5A 5EMKA 3UA4A 8XIMA 4XSMA 7XIMA 9XIAA 1DIDA 3TC3A 4GJJA 3C0LA 1QT1A 1XYBA 4J4KA 4ZBCA 4DVOA 4K3ZA 1XLHA 6XIMA 3VNJA 4QDPA 3TVAA 2QUNA 5H1WA 1O1HA 1BXCA 1XIBA 1XLMA 2NQHA 3ITXA 2I56A 1XYMA 5AVHA 3FVMA 4DUOA 1XYAA 3KBSA 3KCLA 4E3VA 4HNOA 3C0QA 1A0DA 4QE1A 5AVNA 1DE6A 3U0HA 1XP3A 1DE5A 3IUDA 1XICA 4A8LA 4OVXA 1K77A 2NQ9A 4X61A 3AALA 1XIMA 3BZGA 3KCJA 3KBVA 4YTTA 4QE4A 3ITTA 2X7VA 3P14A 1D8WA 1XIFA 3QXBA 2Q02A 1XIDA 4XSLA 3UXIA 2OU4A 4EACA 5B80A 1XLGA 1XINA 3CQIA 3M0MA 4ZB2A 5FA5A 2ZDSA 3QYSA 5TNVA 1XIEA 2ZVRA 3M0VA 5XIAA 8XIAA 3CQKA 3LMZA 4ZB0A 4LNCA 1I60A 1A0CA 4PFHA 1XIJA 1XLCA 4HGXA 1YX1A 2XISA 3BWWA 6XIAA 3UA3A 5EMLA 3L23A 3QZAA 3KBNA 1XISA 4K1GA 1XLLA
chains in the Genus database with same CATH superfamily
5AHMA 5E9XA 1WCGA 1KKRA 1SW3A 3DFTA 4JIPA 3IWPA 5JIWA 4UFJA 4MNKA 3TCEA 5AHIA 4QNEA 3UNTA 4CCDA 4CQBA 1R9ZA 2WBGA 5K4ZA 2QGHA 4HZ6A 2WZHA 3M0KA 1XLAA 5BU9A 2E6FA 2WNQA 3IIZA 4CQDA 2PA6A 4O15A 4ZA0A 1KBIA 1QDSA 3N6QA 4QFUA 2OZTA 2P3ZA 4HNLA 4KEZA 4WGHA 3EX6A 1OGGA 4D6EA 1LBMA 1RCOB 3DG7A 1WB0A 3W1RA 5BRPA 1LOLA 1EF2A 1QNPA 4J27A 3UESA 7REQA 4NRRA 1FFQA 4P8VA 2B7QA 4G2DA 2WCGA 3TONA 3TVAA 4NAFB 4NNBA 4FLQA 3LMYA 4PTMA 2I56A 4E5TA 1EXPA 3CPRA 2HV5A 4MWAC 4ATWA 1F8IA 2V5KA 1PYFA 1RK6A 3RGTA 3MHUA 2G95A 5L6UA 3O1NA 2OOFA 1DOSA 1UH2A 3E0FA 1HJWA 4AIOA 1LORA 4AIEA 3QYSA 4MMWA 2YCLA 4JHZA 3DERA 2ZVRA 4QSFA 5K4XA 4KFNA 4L61A 1R7AA 1PPIA 1PIGA 2UY3A 3KVMA 2GK1B 4BQ3A 4RR4A 4PTVA 2Z2BA 2PWVA 2EF9A 1XPYA 2PDUA 5LGXA 3G3DA 2ZRYA 2ZUSA 2PRMA 1MXGA 2VI0A 3GHRA 4JCLA 2FPTA 3XISA 2GZXA 2ZKMX 2DZBA 2DFAA 1A3WA 2O9OA 3QW4B 3L4UA 2ALDA 4XG1A 4WHBA 1CLXA 1EEPA 3F5KA 4GUFA 3ARTA 4ZSTA 3GWQA 1WP6A 3GZ3A 3NZQA 3NQVA 4HOXA 3HO8A 4HQVA 4TU1A 2P3EA 4DBWA 1KLYA 4JL1A 4CEXC 2CHOA 2PI6A 3M0LA 1EZWA 4HCHA 4XIAA 3TN4A 5G2IA 4H9XA 4K8EA 1L6GA 4GACA 1DXIA 3H55A 3VNMA 3ZVIA 3HPAA 3E2SA 3SSJA 3OO2A 3V7PA 4OQVA 2VM8A 3R8RA 3EWBX 3MT1A 4GZEA 3S1GA 6XIMA 2R82A 5CPSA 2NQHA 4UTIA 3Q58A 4XD5A 3HBLA 3B06A 2DH3A 5H8PA 4MDOA 3D6NA 3AICA 3BW2A 4EF9A 1BTCA 5DT7A 3N13A 2GGIA 1XBZA 2R94A 1VAHA 4FO4A 4EACA 3TXZA 4CQAA 3S5YA 4XAPA 2P0OA 1A0CA 2P88A 3WJYA 2BXYA 2HBXA 6XIAA 3NQDA 3VOHA 1HP5A 5DO8A 3ZWSA 3VDAA 3TDFA 4DYEA 3H7UA 4D72A 3M7SA 2RUSA 2Y85A 1KCLA 2W6RA 3N29A 2J8FA 2J66A 1ECQA 4NQ1A 1O5RA 2WV8A 1G6CA 1WDRA 7REQB 3A22A 1XYLA 1WXYA 3RU6A 3O16A 3OTRA 3EB4A 4LC8A 5M1TA 3R0KA 4ZOAA 4ACZA 5A6TC 3M07A 2E8ZA 2V30A 1MMFA 2NQLA 1P4CA 2V67A 1I45A 3TE9A 2PLKA 1MDLA 2F61A 3DFYA 3N04A 2Y62A 1RBOB 1MQRA 5AZ0A 3RX3A 5JMUA 1AH3A 2E3ZA 4GE8A 3B9OA 1CI1A 3SJ3A 2UY4A 3LA4A 4R33A 1E56A 1EWDA 2X42A 4PUNA 4E3VA 2QCFA 4Q8VA 4POCA 4R9XA 1WE5A 4DJFD 1DE5A 2OEJA 2J8TA 2PDFA 4RL3A 2GOUA 3ZMRA 4QCFA 1EXBA 4GY1A 1X7IA 2GSEA 1J2BA 3LPFA 1FXPA 2BVDA 5BROA 1BVNP 1EH9A 1J9YA 1NEYA 5IM51 1ZL1A 4LVAA 1TMQA 4RK8A 1F05A 3N4AA 1E3ZA 4XKMA 1LLOA 3H4GA 1BGGA 4GVFA 3SJNA 4EXQA 2VD8A 2AQWA 3A3XA 1WZLA 2DPEA 4H83A 3SUTA 1Z8AA 3ITVA 5A3HA 2D2GA 2EPHA 2HNHA 3R11A 4Q7IA 3PZ9A 2NT0A 1UWUA 3ZS4A 2VENA 4U31A 5FF3A 1LQ0A 4V1XA 1TPC1 3VUPA 4Q4QA 1GJPA 3VO0A 3EEGA 5C9XA 1CX9A 5CC7A 1JIBA 5TAOA 5HINA 4ROPA 4WSKA 3LTSA 4UMCA 3PWAA 1KBBA 2BHYA 1FKXA 1CXFA 4IUOA 4A22A 1RAKA 2Y89A 1HJSA 4RE3A 1JG9A 2JF6A 2W63A 2H3DA 3UCDA 4QLJA 1V4YA 4UR9A 4IXHA 1V7YA 4IL2A 4IIBA 2W5FA 3U8GA 2D3NA 3N4FA 1KFJA 5H8UA 3CZKA 2A4AA 1AL7A 1DP0A 3A4WA 2YCKX 2ICSA 2RDWA 1EDQA 3S46A 1H51A 5GJMA 3UJSA 1ZS2A 4WCJA 3S2CA 2QQ6A 3FAWA 1LBFA 3VDCA 2Q02A 1C9WA 3SFWA 1JCMP 4ZB2A 4NYUA 4OKDA 3GB6A 3AU2A 1LQ2A 3IJIA 4DELA 3O6CA 3BWWA 3B97A 3WEOA 4LGXA 2G37A 3CJPA 3CUZA 2WSRA 5AN7A 3VM7A 3WO8A 1M7XA 2X41A 1DV7A 5JXQA 3PNZA 4U5IA 1QI4A 2CZDA 3SRDA 1J5TA 4PMRA 3B0YA 3PZOA 5J8LA 3KLKA 1H7RA 1UB3A 1ZY9A 3HG3A 1G5AA 3TYBA 3LHYA 5AC5A 1UKSA 3P60A 4M81A 2Z1KA 1T41A 1AQ0A 4K38A 1WBJA 3EEZA 2DVXA 4WJ8A 3UWVA 1S46A 2PMQA 3TN5A 1M1BA 4H6RA 3W29A 1E0VA 4R7OA 3CAWA 1HKKA 3H7RA 1BSIA 1QO5A 3CLWA 2D24A 2HCVA 9RUBA 2ABBA 2EBNA 2BY0A 2V81A 1EX1A 2OLHA 2QJGA 1M5WA 2DT0A 3SURA 4DYJA 3R12A 1SPQA 3W76A 4KT2A 1W5NA 2NV1A 3IGSA 4X9YA 1RJQA 1LZOA 1LCOA 3OHMB 4FXRA 2VCAA 2REQB 4MZ1A 2PAJA 3VGHA 2RKXA 2HS6A 1NSJA 2ZDSA 3MWAA 3CT2A 2Y5SA 1TTIA 3OVGA 4OUEA 2XYLA 3HZ3A 5DXXA 3NQCA 5HNUA 3LQLA 4LUSA 1X39A 1ZHAA 4DNHA 3JZEA 4DI8A 3NL2A 5IBXA 4FSAA 2G3FA 3AXHA 5F1UA 5FACA 3W26A 3IJ7A 2OTDA 4M7SA 2OVLA 3IRSA 3VIMA 1C29A 5DXYA 5KZMA 2GFTA 1Q63A 3KS5A 1LTDA 3BLLA 1UR0A 4US6A 2QR6A 4NZ5A 4LF1A 4HHHA 3QR3A 2EO7A 1Q6DA 2LLEA 3LTYA 5HDRA 4DN1A 1MFUA 2NQZA 1NF7A 2NXGA 3P7YA 3QZEA 5DCEA 4DF1A 4Z2HA 4HKPA 3QF0A 4Q4OA 3T55A 4C6NA 1XBYA 2HBVA 1V02E 1U5HA 4F0MA 3CZLA 2J7HA 1SZRA 2WMFA 4ZQPA 4D6HA 3WEZA 1JNDA 2PD9A 1MQQA 3VD3A 4FOKA 1OYCA 3O3RA 2JEPA 1TV4A 4GYPC 3HG5A 1C8VA 3H2FA 3B0UX 4HMDA 5K9CA 1TWWA 1NU5A 2HXUA 5K3VA 2VRJA 2HXTA 4UQAA 3UR5A 4O14A 1Y5WA 4FP1A 4FOUA 3QV9A 4IQLA 2Q3OA 1GOMA 4AH7A 1LBLA 4HSNA 4X2RA 3GX9A 2CFFA 1Q7ZA 4NASA 1OZMA 4GPNA 2FTYA 3M0ZA 4BF7A 2AGKA 1XISA 2GVLA 1LM1A 4B9YA 1GJWA 2CW6A 3NGFA 1E73M 2FH6A 3ZIZA 3W7IA 3G1VA 4A05A 4PSPA 3SGGA 2Y7DA 2GUYA 3WLOA 4C6BA 3K2GA 3O7UA 1BWKA 4W4QA 2KX9A 1J01A 4BK9A 4JQ4A 1GW1A 3E0LA 4HNCA 2VDIA 4CD7A 4US5D 3FVDA 3KRSA 3OA3A 4I8DA 5GNZA 1S38A 3C2YA 3RM4A 2I1OA 3V3WA 3ZR5A 1RVGA 3N9KA 3NO1A 3TR2A 3W2UA 4IP4A 4YWSA 3WH5A 5LYRA 2VC9A 3URBA 3D47A 3WK0A 1MEHA 4KRZA 3G1HA 1XFBA 3IV8A 3WJSA 4IHCA 2FMNA 4M29A 3FDGA 3VKKA 1TR9A 3IV3A 4LUSB 5IXEA 2YX0A 1K3UA 1L6WA 1A0DA 1VEOA 1TVLA 2PDQA 3N17A 5REQB 1K1DA 2QJJA 3GDMA 3JR2A 3TYCA 3CZEA 1A47A 3SR7A 4DWSC 4BQ2A 2Y4SA 4JIHA 3VE7A 3OU8A 2Z25A 5C2CA 1F3EA 3T05A 3SCSA 5CPOA 2GQAA 3T4CA 4MKNA 2XIBA 3NQMA 4MB3A 3OPSA 3WQDA 3VAVA 2BOEX 1JNEA 3CTLA 4LBUA 4AVFA 3P5YA 1TV3A 3KTSA 3VYLA 1AQMA 1OY0A 4UTTC 4MAVA 3V1HA 1W9VA 1VFFA 1G4PA 4I6VA 1DWGM 3UYCA 3S1WA 4JKMA 4PMDA 1F3WA 3QGVA 1P6CA 1EOMA 2R9RA 2EG6A 4GI4A 1GNXA 3PUEA 1KRBC 1H1ZA 1W9UA 4INFA 2IKGA 3FJ6A 2XVKA 1TV8A 4KEVA 5ENLA 3NVTA 3WF2A 4ECLA 2WJFA 1A5NC 3TC7A 4HNTA 4NX5A 3A9BA 3BSHA 2ON3A 3TYAA 3SRFA 1WX0A 3UG8A 2VEPA 3FW6A 3WBWA 1X98A 3QMSA 1EA0A 3LENA 1CENA 3TA9A 3ONCA 3LXCA 3CHCA 4ZO6A 2WW5A 3H2NA 1GG0A 2CLOA 1B90A 3ABZA 3NQBA 3T7VA 5CH9A 3GHTA 3NL5A 4MPKA 4RV3A 2QPUA 2Z27A 3A4XA 3NQ8A 1B4KA 3W0KA 4ZQNA 3AIEA 1E72M 2NV2A 4KERA 5ABGA 1XLIA 2C0AA 1GTHA 2QJHA 5BZAA 4GIAA 3BV7A 4OT7A 4AEFA 4UXDA 1QUMA 1V6YA 4LANA 2YPIA 4PC8A 2ONEA 2EKCA 3N73A 1I6NA 1U5VA 3IPWA 1PCWA 1QATA 4UMBA 2J25A 2CZ5A 3LGGA 3V5OA 3AIBA 5HQMA 3W6YA 5E9AA 2QS8A 4GFSA 4JEQA 3L21A 4Z2KA 5KMYA 5AHEA 2QCHA 3KRUA 4MY1A 1XLFA 3HG2A 4Y9PA 2C3ZA 1G4SA 1WOAA 4ERIA 1PX4A 2VC5A 4DJDA 1FHVA 3NAVA 4KCWA 4PZVA 1NTHA 1RA5A 3PPGA 5C7HA 4WD0A 1PBGA 3R13A 4FK9A 3PJWA 1J0IA 1J93A 3BV4A 1U1HA 2Y7GA 1CW2A 4O19A 2OYLA 3HPXA 1WXJA 3WF4A 5A2CA 4AZCA 4UWMA 2WSPA 4GJ1A 3CS2A 1XICA 2GDQA 2GDVA 3AS3A 3H70A 1FWTA 3I6EA 3AXIA 4MLJA 1ZTVA 1WUFA 1WKYA 1QJWA 1UROA 2HDJA 1VRDA 1F2JA 4LBRA 3BL3A 3LDVA 1J18A 3LD5A 1NFBA 2VFHA 1OB0A 1TV5A 3P67A 5E0FA 4JX4A 1Q6CA 3MUIA 2YXGA 3W1MA 3OW1A 1OD0A 2D2HA 4S3BA 3AAMA 3OJGA 3L4YA 4QDWA 1K9FA 3W7LA 5CBIA 2OT0A 5FJOA 3H23A 3KOZA 4WGXA 1F8MA 3FJNA 1XCFA 4RV8A 4L4LA 3ALGA 2NSXA 4I8YA 1BVWA 2VX7A 1BG4A 1WDQA 2PRLA 1ICPA 1M03A 3CIXA 1XD1A 2BP1A 2PCQA 3ZJ7A 5BU6A 5E5CA 2JIWA 1ADSA 2HK1A 3VI2A 4E4UA 5I2UA 1VENA 5CCZA 3WQ6A 1EQCA 2V5LA 1OIMA 1AW2A 4J3SA 1IT0A 4RXFA 1R38A 4GZJA 1B3WA 4AY8A 2FDSA 4D6IA 1H11A 4F4RA 1VFLA 1FCVA 2C91A 1ZQ5A 2QCNA 1A5AA 3AYSA 3WQ5A 1QPQA 2V8ZA 2WHKA 4CEUC 1H7WA 3QKZA 1FP9A 3QTPA 3NZPA 1MZHA 5FJIA 2CPUA 2YA0A 1UKTA 2PC8A 4IPNB 2FFCA 3H2AA 3NDZA 4PMXA 3DHPA 1PWLA 2FJKA 3ABQA 1XW8A 3QFEA 3P0WA 1GOXA 1DWFM 3DUGA 4PMZA 4D6JA 3W1AA 4AZ6A 3L4XA 3R94A 1C7TA 3QRHA 2G41A 5ABTA 1QXLA 4CNNA 3EOUA 1ZP4A 1PTGA 2X2GA 3AROA 4CNSA 2ZRWA 4MUZA 1H0GA 3E74A 1NAL1 3A4AA 1C9DA 3FCPA 3N1AA 2FKPA 4TV5A 4AD3A 5CGQA 5I03A 1XV8A 3S4TA 1U22A 2EQDA 1K8CA 1OSEA 3GSMA 3FXYA 1IEVA 2OZ8A 2WHMA 1O12A 4TX9A 5HJYA 5M3WA 3PFMA 1E1CA 5CG0A 4H4IA 1FDZA 1SO3A 3C2OA 4A6GA 1WA3A 3SBFA 4GQGA 4JTFA 3HPFA 1HQTA 4W86A 1ISVA 3WQVA 3CZGA 3MKCA 2D22A 5D8WA 4Z2IA 3MMWA 1RPXA 4FPSA 4E2VA 3UY8A 1SM9A 4LFYA 2HJPA 1JQXA 4GGHA 1E4IA 2YDQA 3W85A 3RXZA 4Q8PA 1UWAA 4RZ5A 4JTQA 1JI2A 3L2IA 4HU4A 1DORA 3ORWA 3UFYA 4PUUA 4M80A 4NY2A 5G2WA 1Q3NA 4HJFA 5F2MA 4K7YA 1E5JA 2XIOA 2ZX9A 4KFOA 1WDSA 1NWTA 2Z7KA 3GK0A 2OR2A 3TN6A 2I57A 2RJHA 3ARRA 1ENUA 3SY5A 3N34A 2C8NA 4HYWA 3DN5A 2CHNA 4MYXA 4B92A 3GIYA 3D3AA 2JF7A 3BCDA 4HIBA 1FHLA 3VGBA 4AD1A 2YL8A 4QAIA 2DP3A 2ZDRA 4JIRA 5EB8A 2ZA1A 4R88A 2TAAA 3RM8A 4RPPA 1H1YA 1UOKA 4RUBA 3VTRA 2PODA 2QCEA 3UGRA 2WCAA 2I17A 4PTNA 1NDYA 3DFQA 4UQDA 2E6AA 3ZLGA 5DY3A 3GU9A 3H26A 3TFXA 3BCFA 3BE7A 3HA1A 1UH3A 4W8BA 2UV8G 3TTQA 3BSMA 1HO4A 1ZLPA 4LRTA 4E8GA 3VE9A 2AL1A 2GUUA 4IH3A 2A3CA 3CQKA 1J6OA 1DQXA 5A95A 3VIPA 3HTWA 2JKAA 4U4MA 4FF5A 3VDGA 4NAEB 4O54A 4UTHA 3WJXA 3NYZA 2BHUA 3WFAA 3OYXA 4A4AA 1P0EA 3T0TA 3STCA 1SO5A 3VNDA 2J78A 4HPJA 1JAEA 3EAUA 4I9TA 4C6PA 4IJCA 4HOWA 1DQUA 4YVPA 4WJEA 1TVNA 4DUWA 2W0UA 1P5BA 3ZT6A 1LG2A 2POZA 2V5JA 4AFYA 2G3JA 3PZMA 2OSXA 2Z1BA 3V0SA 3ARWA 4NZ3A 3LBOA 1UR4A 1BKSA 2HZGA 3S1UA 3DXIA 4EK7A 3VDBA 3V36A 3IJLA 4NRSA 1IT7A 3VOCA 4O1DA 2NW0A 4CCZA 4AWTA 1QW8A 3KE0A 3PJTA 4RPQA 3T81A 4C5YA 1TWDA 2DJXA 5JH1A 5F2LA 3NUKA 1NJJA 2Q6ZA 4DUXA 3R25A 3WNKA 3OVQA 3VX1A 1GQIA 4GYFA 4GC3A 4ZE5A 1UKPA 1OK6A 1KXQA 3LHWA 1RK5A 1R47A 5FL1A 1UP2A 3FJLA 2V2HA 3PAOA 2NQ9A 3W27A 2P8BA 3QEZA 3OGSA 5K9XA 4BEUA 4Z2JA 2GL5A 5LSMA 2X30A 3BO9A 2CEQA 4D6FA 4FOJA 3DI0A 1DJWA 3UP8A 1TIMA 5XIAA 4UTMA 1XR2A 5D8ZA 3EXSA 1RY0A 1LDCA 3QJAA 4QISA 1SR9A 2C71A 3LCFA 2C1HA 3UNDA 3D0CA 1I1WA 3R89A 3T0AA 3VNZA 2CZFA 2E6YA 3UERA 2PS2A 1Z42A 1AG1O 4PRRA 5B7YA 3HJZA 3GR7A 5LA1A 2W67A 3WF0A 1KTBA 4AW7A 5FEWA 1J12A 3QC3A 4P7QA 4C7FA 3WQ8A 4N9EA 3VZYA 2YJQA 3ARZA 3VFLA 5C5YA 3WLIA 3S3GA 4EKJA 1S5MA 3URQA 4ZB5A 3P6LA 5A94A 2HE8A 3HB9A 3H4WA 2WWDA 7ENLA 3K1DA 4JY9A 3GQYA 3BW4A 1T40A 3R7MA 3NEHA 2XGIA 4IPPA 3HQ1A 3ES8A 3RG6A 3SCQA 1OFQA 4J1OA 1UBSA 3ANVA 3Q37A 4LYKA 3W3OA 3KRZA 3EOEA 1S3HA 4V15A 3UZXA 2NQJA 1JVNA 5JUVA 4B91A 1QWKA 2OGYA 2PLCA 5F2GA 2E4TA 1MWOA 3T8QA 1A5OC 3LSCA 4GRSA 4F8XA 3IS4A 4JFWA 1Z41A 4XKYA 3AIWA 3WDJA 3LY0A 2PWHA 4KCUA 1N8FA 3WBAA 3WD4A 4DQWA 4H19A 1KGUA 1MEWA 3KRBA 5HWMA 3OP2A 2NUXA 5TQLA 4L9XA 2PGWA 1EUNA 3VOIA 2OU4A 2XHYA 3QLLA 4M1BA 4RDYA 1H60A 3WDRA 1XIEA 1FBAA 1WKDA 1SSGA 4XZNX 1GYMA 5LIKX 4WOQA 4NNCA 2ZA3A 2F84A 1EHAA 4NP7A 3DG6A 1PE1A 1W54A 3WEMA 3H21A 3KDOA 4BR1A 3XINA 4IOTA 4KWSA 3TNOA 5CGMA 1Q2RA 3PZNA 3FSTA 1JF5A 3BICA 3L2LA 5KETA 2PGRA 3T0DA 5FCZA 2A6NA 3RCMA 4ZO7A 3MSRA 3K8MA 4DJFA 4KGJA 4PTXA 4G7EB 4IG2A 2ZXAA 2FB3A 2SFPA 3LM7A 1P0DA 4D71A 1YDNA 1DWIM 3OBKA 3RYSA 2V38A 4PCTA 2Y8KA 4EAYA 4HHMA 2AMGA 3EWZA 3MP4A 3S5ZA 2OXNA 2PF0A 3FYOA 5DRCA 3SIZA 1KBLA 3LI1A 3AO0A 9XIAA 1OGBA 3TC6A 1LRTA 4AYSA 3OB8A 2CWXA 5FSEC 1V93A 1G01A 3UXKA 3KBSA 5IBXC 3QQ1A 3C0QA 3DDMA 4E38A 2YBUA 2OEMA 4KIEA 1N8WA 4PULA 4K6AA 2QCMA 4JTRA 4XSLA 2Z1SA 3TP4A 2BMBA 4WUIA 1Q5MA 2AOSA 1LUCB 2DQWA 3NZRA 1ML1A 4C6IA 1EC7A 4NJJA 3L12A 2PD5A 4HCLA 5CC5A 1E6PA 4V2XA 4K7VA 1EP3A 2X1RA 3MANA 2G4JA 3IJQA 3COTA 4TX8A 1HKWA 1Q13A 3W83A 1EO5A 3JS3A 1AZ2A 3WLRA 3F2CA 3IIOA 3ABRA 3RAOA 5TF0A 1YTKA 2OMAA 3W7NA 3S6DA 1JRBA 4I5UA 1XHGA 4X60A 1NELA 3RMJA 2HEJA 1D9EA 2QJIA 2VUNA 4AHQA 5MKGB 2GQ9A 2QULA 4L7ZA 3M0YA 4IWWA 1AVAA 4RDZA 2J24A 1EUAA 1WZMA 2QDEA 2W61A 3SO7A 1DXFA 4UTLA 3ZJ6A 3MY9A 1DIDA 3PPFA 3ECQA 3UR7A 4J3VA 1Q8JA 3A23A 3GNDA 3EWYA 1QI3A 2QUNA 4CCEA 4ZXLA 1XYAA 1B57A 3U4FA 2V63A 3LV6A 4J40A 1M9HA 2BOFX 4D8ZA 1XG4A 3LG3A 2OG9A 3S9IA 1V3HA 3GXFA 4ZGYA 2YW4A 1H63A 2WKGA 3BG9A 4FX6M 5TBOA 4XB3A 2IXVA 1OCQA 2H90A 4OECA 4NI3A 1UOZA 2WMKA 4GD0A 1TUFA 4DJED 6REQA 4HGXA 2GOKA 4IG2B 5CC6A 3UETA 1EZ2A 3FOKA 1PSCA 5ABEA 1W32A 1HUVA 4A2RA 4QRNA 4RZ6A 3QMTA 2EAWA 3HGOA 1U83A 3N14A 3UD6A 3TFCA 4RE4A 1K03A 4F3HA 2INFA 3N9SA 1TPDA 3TTOA 4DAIA 3RO8A 4X22A 4ORIA 3SCNA 3W1NA 1NFPA 1XIGA 1RUSA 3S2MA 1CWYA 2WO5A 3W2KA 4P8UA 4FZIA 4EWJA 3OZYA 3OLIA 4QHRA 4CNUA 4CKQA 1GW9A 1XL9A 1P0BA 1I2OA 1QCWA 4Q8WA 1DIEA 1V6TA 1K4GA 2XIIA 4DZHA 4GIEA 5EFFA 3EX3A 3LOTA 3MMUA 3CB8A 3SN1A 2G50A 1TV7A 2BHZA 1BQGA 2A6LA 4QR6A 3UY7A 3UXLA 3MZNA 3A3HA 4QSHA 1YBQA 2AL2B 4AVNA 3WD2A 1AA1B 2L5HA 3CXOA 3B40A 3EWDA 1W1ZA 2VX4A 1EQPA 2PDJA 1K77A 5HMEA 5ECUA 2J9ZA 1BRLB 2QZRA 3O63A 5T9BG 3W7HA 4AUBA 3ABOA 1A53A 5FIPA 1E51A 2ZQ0A 5I23A 1PEZA 2PDLA 2WSYA 2IKIA 1G7VA 5K7JA 3PZUA 4CN4A 2H8ZA 2VT0A 3W28A 4AVOA 1KW1A 1NFGA 2OKOA 3ID7A 1JJKA 4MG4A 4KESA 3U3HA 3PUDA 4BEQA 4H9ZA 4RDVA 3PTQA 1XSKA 1IQ8A 2GPTA 4IJRA 2WLYA 4AX6A 5I09A 3W81A 4ZQCA 3BQ5A 2QJMA 4WY0B 2YCJA 4PUJA 3BVJA 3O6YX 3W2MA 1J11A 2VVSA 3P8IA 1RV8A 4N9DA 1EYWA 3LXAA 3UXDA 3ARUA 4YCOA 1E71M 1SJCA 4UFIA 1HIZA 6REQB 3RCNA 3WN6A 1ZSXA 1W8GA 5C2GA 2E1WA 2FVKA 2PWDA 4Q6XA 1GVFA 4US5A 5I3FA 3GVWA 2XN1A 3STGA 3G3MA 4LNYA 4NU7A 3WLPA 1E40A 3VGDA 3P8JA 2W27A 3EOLA 4UNKA 2FZNA 3USBA 1ZGDA 1QAPA 3BLOA 4E2DA 2V9DA 2WC4A 3APYA 3VIIA 2X1SA 5BXSA 1PZ0A 3TQPA 5EMLA 4BKNA 3SADA 3WLHA 2D1ZA 2WSQA 2ISSA 5HBFA 3AJXA 5AHNA 3CMJA 2DSUA 4WDXA 3GVVA 1Q4WA 4M8UA 4UBPC 3RRAA 2VR4A 2FVLA 3SW6A 1FWCC 3B05A 4DJDC 4P2VA 2Y70A 4Q22A 1OF6A 2HWGA 4CD4A 2WM1A 1UR8A 2WQPA 1DIKA 1XWYA 3ABXA 4H8NA 1YBQB 2CXEA 3MI2A 4NHVA 5AYZA 3G0UA 1R3RA 3VKAA 3SN0A 2XWDA 1TYGA 2G4FA 3D5HA 3VFCA 3V5FA 5BWAA 3OBAA 4MJMA 1S2AA 3PB0A 3MVTA 1BXBA 3DFPA 5JVLA 3FHAA 1KBKA 1J8VA 2CERA 3F1QA 4ZO9A 3GNXA 4DUVA 3F7JA 1XGDA 3I7QA 1XQLA 5KZEA 4EIVA 1VFHA 3WL1A 4LEFA 4YVXA 3WL0A 1W1A1 4WF7A 4XD6A 3UJFA 1H61A 3EDKA 4KWUA 3M7WA 3Q4DA 4ZTYA 4BZYA 3B9NA 5D9MA 1GVEA 3AHZA 1HL9A 2Z1XA 3NL6A 3TJLA 1CZ1A 2QUUA 4S38A 3L7RA 2YDSA 3N25A 3P14A 2BS9A 4H8UA 3AS0A 4HTYA 2MANA 2YL6A 3AMCA 2ABAA 2V3DA 3E38A 3WNOA 2R8WA 3S8HA 5A8MA 1GYNA 3IVUA 2DUAA 1XLLA 1BYAA 1O5XA 4G5DA 3M0JA 5AYYA 4C6MA 3TTEA 4UOJA 4LS0A 4YTRA 3TROA 4JD4A 2BXVA 1W1TA 3DI1A 3SIMA 7ODCA 2J88A 3OZMA 5E09A 4V27A 4C1KA 1M6JA 1EGMA 2UY5A 1F74A 3PC0A 4GO8A 3GTNA 3LHUA 1SO4A 3LU2A 2BNJA 5EPDA 4YU1A 4IPJA 2WZEA 4HU0A 3S6OA 1H5YA 4O28A 1ECEA 3BJFA 2E09A 5DF0A 3BDKA 1GVIA 4MKVA 3N2OA 2Y24A 5HUOA 4CNTA 4TMBA 3BUVA 2D3LA 3CL8A 3UZWA 4L1GA 1KLZA 4Z1DA 1KFBA 1UBPC 2FFIA 1ISWA 3KHDA 1XDLA 5CZJA 2F7FA 5BXTA 1GOQA 4MZ8A 1P0NA 1O1HA 3QSTA 3R79A 3E0IA 3AMGA 4GH3A 1ME8A 4GXWA 3NOEA 4H04A 3EX2A 4Q4SA 3MW7A 3MCOA 3RPTA 2I14A 1HG3A 1QPOA 4WKAA 3UXIA 4CD8A 4UTJA 3R0DA 1V03A 1R3VA 3JRKA 2JE8A 4S3EA 5FF0A 1F9CA 1EJTC 4DBDA 4HPXA 2ATSA 2XZ9A 3LCIA 2A5HA 1H7XA 2WZTA 3MYOA 3DZ1A 4N9BA 1YDVA 4BI7A 1QI0A 3IJ9A 4UQEA 2GJLA 1YW1A 2NXIA 1RQHA 1I2QA 3W82A 3ITCA 4GXPA 4H6QA 2WNWA 1XH2A 2BVTA 3TKFA 3SRHA 1T99A 2VWSA 5CJMA 5AYIA 3KP0A 7CGTA 3B8IA 1J6PA 4JHMA 2CC0A 3K4DA 3GNRA 2FQIA 2OO0A 3L9CA 3T40A 4TR9A 1FH9A 4MTVA 1QI2A 5BRQA 2QW5A 4GY0A 4JTTA 4NJGA 3TC3A 3WH6A 4IICA 1V6VA 1GG1A 1LLWA 4B5NA 3DC0A 1QW7A 1R7OA 4AEEA 3ALFA 3EDFA 4B5XA 1EJRC 3CL7A 3CZJA 1HKJA 1K9DA 5KSWA 4FLRA 1JDDA 3HGRA 3TYEA 5HNTA 1EC8A 1YPFA 3VIGA 2ZUWA 4LEQA 4TVUA 4DO7A 3GFXA 4J2PA 2FJUB 3WY1A 2PFHA 1QK2A 5I6SA 3V4BA 3S5OA 3WQ4A 2EG8A 3QHOA 2WVSA 5H2ZA 4FXJA 1UC5A 1QPKA 1RY8A 4HZMA 4B15A 4CU8A 3RLUA 1X8CA 1B0IA 3KAOA 3PAJA 2VDGA 1H09A 1LOQA 4DNMA 2OEKA 2EPLX 3ONBA 3ITOA 3LCXA 4EPDC 1MYRA 1KCKA 2Y8UA 2OWCA 4CVWA 4JHOA 3SZ8A 4O18A 2QCDB 3QZ6A 4LV4A 4WIWA 3CL6A 3POCA 2C6QA 3ARQA 5EBUA 3ZLFA 3RR4A 3SQSA 4D6CA 5LIXX 2F6KA 4Z0SA 2VX6A 4JTSA 5FAGA 5E0CA 5DCBA 1OINA 2XGBA 2F38A 2V3EA 1XLEA 1EPXA 1BG9A 1KR1A 4EWND 1XC4A 3GC4A 4YNGA 3WH9A 2QAPA 3AMKA 5HMSA 2DVTA 2VEGA 1QMLA 1E6QM 4BS0A 4OVXA 3O6AA 2ZICA 5EMYA 3UEQA 4AAJA 1ZU8A 4HZ8A 3GH7A 3WF1A 1UUOA 2ISWA 4GINA 2FGLA 4QG8A 2IQ0A 1TB3A 3GXIA 1C90A 3VM5A 3G1FA 1MRQA 1ZCOA 3VIKA 5G1MA 4FR1A 3SQLA 3FHQA 1WBHA 2VFIA 2QUTA 1TV2A 5HMFA 2VQUA 5DN1A 4A3QA 3PB2A 2VWTA 1FUYA 1ICSA 5DCDA 1PB0A 3PSVA 4AHOA 1V0MA 5I7GA 3EYPA 3LI0A 1H1NA 1N82A 2VGFA 3GNNA 4L1XA 3ZJKA 1Y7VA 2VURA 3K4WA 4W87A 2Y88A 4D6DA 3NIYA 2X05A 4FLSA 1IEWA 2FPYA 4L64A 4IPLA 2XIJA 3WH8A 4BF5A 1V6XA 2CIPA 2JEQA 4KGLA 3W7CA 1FWSA 4KKXA 4DZAA 1L6YA 5AZ1A 3DECA 3BOFA 1XF0A 1AD1A 3GNPA 4HOZA 2YZ5A 3WLTA 1HFBA 1X7FA 2PWUA 3VOJA 4DUOA 4H8VA 3WFZA 2J7GA 3AWNA 3VMOA 4LWWA 1W8SA 4JKLA 1LRNA 1KXHA 3R1ZA 1MFVA 4YTTA 1CXEA 3FSUA 1SGJA 2I16A 4A29A 1PAMA 4ZB0A 2BLEA 1RQBA 1JXKA 4MWAE 2XISA 1A4LA 5BOEA 1FWHC 5M17A 1FCBA 1J0ZA 2CLIA 3AXKA 3AHXA 3PBGA 4IZGA 4JNMA 1R3WA 3TH6A 4JTGA 1ITQA 3FNDA 2J7EA 4F9DA 3ZT5A 1MEIA 1E55A 5I77A 3P62A 4UOQA 3NDYA 2PC4A 1Q4NX 5GJNA 4MFEA 4AD5A 1TWZA 1D3GA 2ZZ1A 1XLKA 1R2RA 1MQPA 3B0VC 1GHRA 3NEVA 1SMDA 2D0FA 4UQBA 3W71A 3EWXA 4G6CA 3GXPA 1FP8A 3I68A 1HKMA 1TWIA 4X63A 3M47A 3SCRA 3FIGA 4O12A 1OFBA 1QPRA 3FA3A 1VRXA 4N6EA 3W72A 2C16A 1FOBA 3AOFA 3B0XA 3N2XA 2PU0A 3DH7A 2VZTA 3S2NA 3C0JA 1UIOA 1SMAA 4O0ZA 3ZOAA 3GFYA 1IHIA 4UB9A 4HNVA 5DELA 5E6YA 1IXNA 4DJFC 3LHTA 4BA0A 4M6UA 5ABFA 3Q2DA 3WCZA 1JZ5A 3UF9A 1TTQA 1MSSA 4EAMA 5CAHA 4NZJA 1P1MA 4J3UA 3FKKA 2VFGA 4HPGA 2XIMA 4JDBA 3ICJA 4YXGA 5CBJA 5D32A 4FF7A 1NY1A 3WSUA 4TTUA 4OTKA 1TZZA 5CJNA 4Q8QA 3U2EA 4YTUA 1WQ5A 1I2RA 5FJUA 3RHGA 1K4HA 1PKMA 4B5SA 1EDTA 4XUYA 4UR7A 1TMHA 4F2TA 1KFCA 4WDTA 8TIMA 3N2MA 2PB1A 3BAWA 1UJPA 5HJLA 5AC4A 3THUA 5HUPA 3BLPX 5D30A 2G0WA 4WKFA 3C61A 5I3DA 5DX7A 3GBDA 2FHBA 4HMNA 1AD4A 4XUGA 1ZCCA 5HMDA 2H9AA 4UOZA 3KLLA 3MKVA 3DESA 2EJAA 1PDYA 1GQKA 1OT2A 4WKHA 1V3LA 1IGSA 4R3UA 3POHA 5AVHA 1UC4A 2Z1VA 4C6LA 1W3HA 3C6CA 1LWIA 4NKCA 2OKTA 3B03A 1KXTA 5I07A 4WVXA 4MJZA 1THFD 2QUVA 2VOTA 1W0MA 3B9DA 2IS7A 3MUZ1 3QOMA 2PLJA 3W07A 1UIPA 4AD0A 3B9AA 5FA5A 1ADDA 4UIOA 2ALRA 4JZ5A 1KM4A 3STFA 1MW0A 3PNUA 4IMGA 4F0HA 1JXJA 1Q6LA 4JFSA 5GPRA 3LHVA 3NQAA 4Z1BA 4QS6A 2FMOA 3NO3A 4IIEA 4ZL1A 4JS3A 5M5DA 2YB1A 1EHNA 1EJXC 4ZQRA 2PU1A 1L6SA 3APTA 3LCWA 1RALA 1M65A 4F0SA 2ZUNA 5CPTA 3HURA 2NVDA 2O4MA 3TWAA 3MCMA 1QTWA 3TCSA 4J3WA 3C4UA 3TEVA 3L2MA 5GNXA 1YADA 1XGEA 1ONWA 3CT7A 1RZMA 1ESWA 4W8AA 1W3JA 2YZRA 3U9IA 3AHTA 3TTSA 3EXRA 4AD2A 4AX7A 2VCBA 4PCFA 2GJPA 3U5UA 2A21A 1U2YA 1I8JA 3VGGA 1RQEA 5AFDA 3LZ5A 3GO2A 2PRHA 1PYMA 1R3YA 4PEKA 2CXGA 3KCLA 4NAFA 2FGZA 2NV9A 3GY1A 2X0HA 3CMGA 2INZA 3LPOA 2J9XA 1MW3A 4HA3A 1EBHA 3FK4A 1W5QA 1Y8BA 2VYOA 2PDIA 1ZJHA 2E7FA 5E1QA 1XLGA 3S5NA 1YPXA 3P82A 3NXFA 4F2UA 1XYFA 3PZQA 1XM3A 4HPHA 3FKRA 1X96A 1WZAA 2P50A 3N2CA 3A64A 4FEZA 1GUVA 4O8RA 2GK1A 3W02A 3CASA 1KM2A 3RR1A 4BFAA 2DH2A 1RD5A 1A0EA 1ISYA 4PMQA 2JKPA 3AC0A 4IUGA 3IANA 4GA8A 3NGJA 1US0A 2PDKA 1VFUA 3DGBA 4LY4A 3NNTA 4H2CA 1UZHA 5CZ0A 2ACRA 3CUGA 4WRHA 3DX5A 5CJ5A 1NVMA 1IWPA 2PWEA 1AW1A 4J35A 1HJUA 4QM1A 3CK5A 2ZXDA 1NOWA 3RFAA 1GKPA 4DHGA 3F4VA 2AAAA 2A3EA 1E9ZB 3QPZA 3GG7A 2NWRA 3CWHA 3BLDA 4ZE4A 3Q94A 3VPLA 2GSHA 4ZEPA 4Q8UA 5D38A 3NG3A 1BYBA 1LYXA 4MLRA 5FEXA 4IMDA 4BI5A 5H1WA 4MB5A 4UCFA 1GVYA 1RP9A 5HATA 2W4XA 3S0CA 3H2OA 4CQ8A 2EJ1A 3H2MA 2PTWA 3EPNA 1UQYA 1VYSX 4LYQA 1E70M 1RH9A 3HOJA 4S3KA 4QE4A 3AYRA 2BB0A 3IJ6A 3TV8A 3QXBA 1R30A 5FEPA 2JK2A 5MHBA 3O6DA 3LMZA 1E0WA 4MHBA 2FYMA 1FWFC 1H50A 1YTDA 1N8IA 2Q8ZA 2TSYA 3GZAA 3C8FA 2VOMA 1YQ2A 4PL1A 3LPPA 2YXXA 1K7EA 4LVFA 1XRVA 4RCXA 3C3UA 5BWFA 3CWOX 4UNLA 2ZX7A 1RBAA 5IFTA 3I4KA 2WWCA 4JTAA 4JTDA 1KGWA 1TCMA 3AWOA 2A85A 2ZC1A 4KBXA 2PUZA 4AF0B 4N0RA 3QPYA 4AEOA 1QBBA 3DCPA 3NTYA 1RR2A 3PBWA 2GJNA 4GI9A 4DJEA 5GNYA 3K5XA 3FXGA 4E8DA 3VOFA 1H41A 1UD5A 2Y6ZA 4HK6A 3Q67A 4EX4A 4IP7A 1HP4A 3SN4A 3QTGA 3DGRA 3KZPA 3ITYA 2PTYA 2ZE3A 4D2JA 3IGUA 5FKYA 5C71A 5FESA 3CLMA 2YCIX 2WSKA 5AOUA 2O9TA 1HVQA 4Y8EA 3WKZA 4WDUA 5BMXA 5BRBA 1IEXA 5FD0A 3H2EA 4DF0A 3NQ6A 1Z48A 1DJHA 3I4EA 3W7RA 1TPWA 4QX4A 3R8HA 2OJPA 1SZGA 1VLWA 1SUXA 2J62A 2UWFA 1EO7A 5AC6A 2DIKA 1FHUA 3S1XA 3MS8A 1D8CA 3VNKA 1JDEA 3MP3A 1C8YA 2PDMA 3CUJA 5BMWA 4JCMA 1W5MA 3A12A 5AB3A 3T9PA 1AJ2A 3BXWA 3MPGA 1JDFA 3G0XA 3KHJA 2PDCA 2D23A 3CQ0A 2ADAA 3CPUA 1YPIA 3DHFA 2ZTJA 2E9MA 3SFKA 2FB2A 4LB3A 1W91A 3LPGA 4TV6A 2VEIA 4IFRA 1V08A 4GKTA 3CV2A 2HPIA 3G1RA 4KWWA 3W7MA 4JIQA 2CYGA 1DTNA 3SEPA 3BCJA 1B9ZA 4LCRA 1F61A 3WNMA 1TG7A 2TMDA 4G8TA 4DAFA 4LTSA 4MFDA 1J0HA 4XZWA 1W9PA 4N9CA 3R4IA 2CBIA 3NQEA 1DPMA 4O57A 2YFNA 4YPJA 4GUIA 1FWDC 5FJPA 1LT8A 2NX9A 4Q3MA 5CEWA 1EP2A 1I4NA 4UNIA 4PMVA 3WLLA 3W53A 3S1VA 3TAKA 2NSOA 3AXMA 1W37A 3Q45A 4YL2A 4V1YA 4B9ZA 1A50A 1IIGA 4HMEA 4N02A 1ITUA 3R8GA 3ARPA 2CZVA 5A8PA 1XS2A 5DY2A 3VIOA 5AC8A 2MUCA 4R85A 3TTYA 3CTTA 1JZ8A 1VFOA 4J28A 1FTXA 4UMAA 1PHWA 4ERAA 3I7RA 4CN6A 3W25A 1MNZA 4H7CA 1EPVA 3W1XA 2DSVA 3B8SA 4GFIA 4V33A 1F5ZA 2QMKA 1HO1A 3GYCA 4NJHA 4ZQMA 2JIEA 2W92A 3MUXA 5HNRA 4XZIA 3V16A 1JCNA 3ZWTA 2ZUMA 1M3UA 3AISA 4K2SA 2ZOXA 1XCXA 3OGVA 2A3AA 2XPKA 1CYGA 4HU8A 3WMBA 3G22A 4IL0A 3NVDA 4AIBA 2Z6JA 5LXEA 4QDPA 4GCXA 4FB7A 1YRRA 2V2CA 3B8DA 1QHZA 2GJXB 3FN9A 1OFRA 3SSZA 3TYZA 2XZ7A 2HQAA 1T8QA 1UA3A 1W56A 4IJBA 2G3MA 2GVYA 1A80A 4HYRA 1VPQA 1XIDA 3KVLA 4Q4RA 1B3OA 4GI8A 1JCXA 2REQA 4QQUA 5CLWA 4JDYA 3G6MA 4JTJA 4WXYA 1YNYA 1REQB 3AFBA 5GQBA 4U5KA 3QZAA 2WMIA 5C2XA 1HL2A 2AKZA 1MXDA 3ZJ8A 3PM6A 2CBVA 1HJVA 4R34A 1LG1A 2KAUC 5T9CE 3FLUA 4RLIA 3CIWA 4ZOEA 3TOYA 2CLKA 5JH2A 3NPWA 4F0LA 4EVZA 2C18A 1XYCA 3AZSA 3GDBA 4YYFA 4NZ1A 1RJPA 4FXFA 3TJ4A 1TA3A 4PN2A 4RXGA 3ZFHA 3N18A 4AWSA 3DG3A 4WR3A 1UWQA 3THCA 3MJYA 4TUFA 2VGBA 4R7WA 1KM0A 1Q6FA 1JYXA 3KDNA 3O05A 5A2BA 4JN8A 5DMNA 2XH4A 1MI3A 3C86A 4M6QA 5JBDA 3PBUA 4JIIX 3BURA 1XH0A 1UZDA 3R6IA 4ERGA 1GQNA 2ZX6A 8XIMA 3BGAA 1FWNA 2OSYA 4QCEA 4DVOA 4Z2GA 2X40A 2BY3A 5L9FA 5LGZA 1SZEA 4GVGA 3VINA 5CKSA 3B8VA 4HZ7A 4E2OA 5A6SA 4A8LA 3QMRA 3S5SA 4NZ4A 4TQTA 3IIXA 4REQB 3CU2A 1F6PA 3E6EA 3QH2A 3CHDA 1V5XA 4AQLA 1UUMA 4TXEA 2JGQA 1LOSA 3FS2A 3N6JA 4Y9NA 4YLWA 2WAGA 1XLCA 1WKEA 1T0OA 3WMSA 1YNQA 4AG0A 2BY2A 2V5CA 4ICNA 3WYZA 3QGKC 1UA7A 2DZAA 2VGIA 2WKJA 1K70A 2WC3A 4F0KA 1JD9A 4QE5A 2ISFA 3NSXA 3RJXA 1JQVA 4AZHA 3OODA 3R0UA 4DX3A 4URIA 3IVSA 4S23A 5A69A 1K8XA 4JXCA 3KOYA 3ZVHB 3PK7A 2TPSA 4WY0F 4NJIA 4LSBA 5CG7A 5C9ZA 4DZ5A 3P81A 5CSRA 4S3AA 2ZRUA 3TJIA 5FJRA 1Q6OA 5A2AA 3VD9A 1A5UA 1E9LA 4OOUA 3H22A 1WDPA 3LN3A 3IJDA 3LS9A 2VFFA 5EBAA 2PF8A 2VR2A 5D2XA 5CSYA 2CNCA 3OLDA 2Z7GA 2WMIB 1J5SA 1EGVA 4FS9A 3L0GA 3FV9A 2KZHA 1UZ4A 2CU0A 4X61A 2P0IA 1ZRQA 2RDXA 5REQA 1FVPA 3ES7A 4MOZA 3ZO9A 3F5LA 1D8WA 1GONA 1L8NA 1IZJA 3LHZA 2XVGA 3LTPA 3KL3A 1TA3B 3MV11 4LNCA 5D4YA 1AMKA 4HD5A 2MNRA 2DQXA 4ZFMA 1UHVA 1UKOA 3UPBA 1AK5A 3EOOA 2QF7A 4XTDA 1NP0A 1GZ1A 4W84A 1VYRA 3BW3A 2O4QA 1J4EA 3EPMA 5MF5A 4GI6A 1DJZA 1AMYA 5LIWX 1P1XA 3N11A 1NOFA 4C7GA 3LYEA 3V35A 3W2JA 2IPFA 2B7OA 2XH2A 4H00A 3WK3A 1H2JA 1W3LA 4LAOA 3FGCB 4PB4A 1YEYA 3GH5A 5LHEA 4F79A 4MAZA 3W1LA 2FPVA 3LERA 3M43A 1RLCL 5AECA 1JF6A 2AKMA 3IAPA 2YLLA 4GHRA 4XQ6A 4I7WA 2B0MA 2DZUA 5DANA 1PIFA 2DY3A 1OK4A 3L0KA 5I02A 1XX1A 1EWEA 3USZA 3ABSA 4FNTA 3S2JA 1RP8A 1AJZA 2WMHA 3EB3A 4N2YA 4ADUA 1DL3A 1RCQA 3VX0A 1Z9AA 2I5QA 1A5BA 3SY1A 1LL6A 1K02A 3BG3A 1DJYA 1A5SA 1KC7A 2VTFA 3PUOA 3DENA 1TX0A 2R24A 3SUVA 4LX4A 4W89A 3DKLA 4NZCA 2EGZA 1YXCA 1R2TA 2CLFA 4Y2WA 7A3HA 1SQ7A 1HXJA 1TSIA 3O0KA 2H3BA 3GUWA 4H9UA 1GGOA 3VK5A 2F2HA 1OIFA 2V2DA 1IXQA 5BNKA 1KRAC 4LPCA 5JBFA 4KMQA 3DHDA 1Q85A 1VHNA 2PDPA 3B4UA 1JYWA 1XLJA 2WQDA 3WX7A 1S2WA 3HV9A 1MW2A 1W31A 1EX5A 1FQ0A 3M6YA 3VKJA 4B2DA 1NP2A 4S2CA 5A1AA 5I3IA 1R6WA 4MNJA 4AC7C 4GYPA 2VXNA 5EY5A 3WDHA 3KEHA 1OX6A 1WOBA 2ZUVA 1KV8A 1EB3A 4UQCA 2GWGA 4M1RA 3A5FA 4GK8A 3CAKA 4M5PA 1DWHM 2ZZ5A 4KEMA 2YFOA 3MU7A 2ZIDA 3K8LA 2XINA 4W93A 1W1B1 3ATZA 4DBUA 3WLQA 1KRMA 1UP0A 4XSMA 4Q6JA 3BLKA 1BVZA 1ZUAX 3K4AA 4BY3A 1VZWA 3QM3A 1LWJA 2J7CA 2OQLA 4XD3A 2IW0A 2TYSA 3GG1A 2AAMA 1KQYA 2D20A 4LUTA 3AUOA 1T6MA 4Z1AA 1I75A 3PP7A 5LA2A 1IR2A 3MDUA 1Z3NA 4L4MA 2PGEA 4M82A 4EPEC 2J7DA 1KM3A 1ITCA 2VEMA 1BPLB 3VD5A 3LQGA 4A8NA 4LF2A 2YGYA 3QY6A 5D2WA 4J3TA 4MB1A 3GG8A 5FEZA 1GPWA 3LEPA 4OV9A 4B4FA 4X9SA 1MDRA 1E6XM 1KR0A 4B5WA 1CGUA 1F73A 1C91A 2XSBA 2UZ9A 3VGFA 4I9JA 4KRTA 3ZR4A 4BCEA 1EJSC 3GNOA 2DZPA 4C65A 3U4AA 1VHCA 2EPMX 4LAZA 3NQ7A 1QBAA 3UGVA 4ONVA 3KW3A 1E9YB 1R87A 1EIXA 3A6OA 2AQVA 3T78A 3W23A 2CLHA 1SFSA 2VJXA 1P7TB 4P61A 1OM0A 1AQFA 4FX7A 2PTZA 1CGXA 4HCDA 1XIHA 4JYDA 1AL8A 4Z1CA 1W5PA 3B8TA 2YYUA 3F4CA 2O9RA 3QW3A 4H1ZA 1DEDA 1XYBA 4GG9A 5G4EA 3EKGA 1UR9A 3CM4A 4FALA 3L4VA 3RM9A 5HWJA 3WZ0E 3QSRA 4DF2A 1LLZA 1Z44A 3C2FA 4C6QA 2JKEA 1FDYA 1O95A 4D8LA 3EPOA 3T2QA 1UD3A 3P0XA 4W9TA 4LB4A 5E93A 1C93A 3TK7A 1YTEA 3CQIA 3UJ2A 4HU3A 2EHHA 3CMFA 4KQNA 4B3KA 3IEBA 2P1FA 4I5RA 3K13A 5A6JA 2E1DA 3RRXA 4GUGA 3HQNA 4ZMGA 2X0SA 3KBJA 1W1YA 4DLFA 4QG6A 1SYTA 3MUY1 3AHVA 2XFFA 5LNRA 3KUMA 3BMXA 2G8ZA 3VDHA 3CUFA 4DY1A 3II1A 4ATDA 1CGTA 4R7JA 5HANA 3QPEA 5A6KA 5HQLA 1TFVA 2A7PA 4LUYA 1G67A 1B5TA 3B8WA 3E5BA 2R1KA 1XQKA 1JYVA 1R9XA 4LUTB 3LCLA 3QHNA 1OFOA 1DJXA 3L65A 3AS1A 3UCCA 1PTAA 2E5BA 1KQZA 4RE2A 1CLKA 1QNQA 3T0CA 1MUCA 3NYDA 3BOXA 4JFUA 1YDYA 2FVMA 3RMEA 2OELA 1QT1A 1UWSA 2PP1A 1CT5A 1GOWA 5TIMA 3QVQA 1H0IA 4QJ5B 3UCQA 3AI0A 1PO9A 4CQ9A 4P5UA 2XGZA 2QEZA 1AW5A 3S47A 2ZZ4A 4K37A 1WAUA 2NVCA 3GAYA 4FNRA 4GZ7A 1VGAA 1XUUA 3AQUA 1ELSA 3PTKA 1S39A 2X1UA 4GWEA 4K8HA 1L0PA 4CD5A 3F4NA 3G1AA 3EB2A 4XWUA 2IXUA 4PUWA 2NX1A 3TUUA 4E4PA 4O0KA 1Z69A 1A5LC 4AD4A 4LCQA 1PDZA 3PG9A 4PSRA 5HPCA 2VKZG 4R5EA 4QDMA 4C6KA 1B54A 3OVRA 3F03K 1JZ4A 1VCGA 3PANA 4LQ1A 4IMEA 4FIQA 3DYOA 2Q09A 4EXBA 3P74A 2Z26A 1UR1A 4L5ZA 1IXOA 4GIRA 1XBXA 1E6ZA 3U5YA 3ITGA 2GLKA 3OZOA 4YS1A 4J9JA 3TYDA 1SFTA 4Z1YA 4QJ3B 4YMZA 2HK0A 1Y65A 2F6XA 2YIHA 4CU7A 4J3ZA 5BXPA 3M44A 4XIMA 4O0QA 4FIRA 3E1F1 4AU0A 1ZP3A 4RNIA 3WLSA 1NWRA 1O7AA 4PMNA 2INEA 1Q7MA 3DHUA 5G4HC 3NOYA 2PPGA 3EMZA 3CYVA 1B30A 1O6IA 5I79A 4XVDA 1GJUA 4GO9A 3IVTA 2HVOA 4P7NA 5B80A 3K30A 1SFJA 3BK0A 3F4WA 4W88A 2R1MA 3GG0A 1TJ1A 1HN1A 4TTGA 2XM2A 4GABA 3L5MA 4LU0A 4LVGA 3FDKA 1K9TA 4GZIA 4Y9OA 4DJEC 3LBMA 3W9ZA 4NAEA 3MKKA 2Z2UA 1H7OA 3CWNA 3F5JA 3VXGA 1VCVA 1U33A 2E8YA 2XU2A 3PBVA 2HSAA 4G7FA 1ZZMA 4XD4A 3BOLA 1QNVA 1OFAA 2E77A 1QR7A 3R10A 2OFJA 3DYPA 5D2TA 2J8GA 2Y2WA 4D6GA 4LT9A 4LV9A 3M64A 4IGMA 3CHFA 3W7QA 1K6AA 4BJHA 3QV8A 4JNYA 3W1UA 1EIBA 4HA1A 3BC9A 2QDDA 2WYSA 4GQQA 3G8RA 1TCDA 1VLIA 4NUWA 3ZYZA 4XZHA 4HK5A 1TX2A 4P8XA 1V02A 3HIJA 2YCEA 4PUKA 3GAKA 1I9CB 1C3FA 3CPGA 1UG6A 4JICA 3AZTA 3O0FA 4GYKA 1TIWA 2B81A 2WOQA 3GHUA 1KXVA 1EJWC 1LRQA 2W62A 4NIRA 1TE6A 1QWGA 1S2UA 1TKKA 3RF9A 3TU9A 1JUEA 2ZBTA 3ITTA 3W86A 3WF3A 2C19A 3TLLA 2A1YA 3SAZA 1ONEA 4M7TA 1W3KA 3FYYA 3N4EA 1FHDA 3TQ0A 1A4MA 5K2ZA 1GEQA 1PZ1A 4UCGA 2YBTA 4RNHA 1H7NA 4QEHA 2TRSA 1GZGA 1V8EA 4IIDA 4PCSA 1W1VA 3GTHA 1R3QA 1Q6QA 4AB4A 4MKSA 3VIJA 1A5MC 3AYVA 4GIYA 3TNBA 4GNKB 3KBMA 3G6LA 3WBXA 1M7OA 3SUSA 3LCGA 4GISA 4S1FA 2XSAA 4D8AA 4ZQOA 2TODA 5XINA 3G24A 2QYGA 1PVNA 3VNLA 2C14A 1ICQA 1CEOA 1JUBA 3G1YA 1R8LA 2C13A 2FHFA 3VNIA 1H7PA 1UKQA 1PWMA 1RA0A 1VH7A 1V3IA 1HKVA 2A3BA 2OZ0A 3VD7A 4FX8A 4DPQA 2CBJA 3E96A 1GOIA 1TQXA 2Z4GA 5F4XA 2DJLA 1LROA 2OT1A 5A6MA 4R53A 5FAJA 1VBUA 3SY8A 2HNEA 3UPMA 3T4WA 1R9YA 3I7SA 2E9BA 2BBFA 1E5NA 4GVIA 1QHPA 1SFLA 4MSSA 3MSYA 4JYFA 1TZ7A 3EMCA 5AY7A 4B3LA 3W7JA 3M5XA 1JZ2A 3NQGA 1E43A 4PFMA 4JFTA 4U2YA 1XC6A 2WJEA 3APGA 5B7ZA 3BZJA 2DIEA 1CIUA 3KBWA 3MDWA 3DYMA 2I9UA 1VF8A 2YSWA 4I9MA 3UVAA 4QLKA 2QIIA 3RNDA 3TMQA 3FY1A 4ML9A 1T7LA 4IM4A 3ZR6A 2CITA 3GDLA 4JTIA 4G7EA 4IGNA 3OEXA 4MPQA 1TVPA 4IFOA 4C90A 5C7VA 1SJDA 1XCWA 4XX6A 1PTDA 1E4NA 4XZ9A 3WDQA 1TO3A 3D46A 2OQHA 1B2YA 2QHAA 3C52A 4A2SA 3PHAA 3QV6A 4QROA 3BANA 3TQVA 2BY1A 4E2BA 4YCPA 5FF7A 5C54A 2PLMA 1TJ0A 4L6OA 5J5RA 4DBSA 4GQRA 5F4WA 5AC7A 1AH4A 4HN4A 3W87A 1GEHA 4WOZA 3LBCA 5K9DA 2YCLB 3GVQA 2OGJA 2XWEA 6ALDA 3M0MA 3V0TA 3OQEA 1G69A 2HRWA 2WCSA 3NCOA 3TXVA 3N3MA 1GOOA 3P2VA 1LUCA 3EKZA 5G1TA 3ZZ1A 2OB3A 3UWWA 3INPA 1OABA 1ALDA 3HPSA 2V69A 3SCPA 1CNVA 1FY6A 2VD9A 1ZAHA 4IX2A 1UWRA 4O17A 3A47A 3WQFA 1OG6A 3JU2A 4Z08A 3FYPA 3RLVA 4ZVJA 3GIPA 4EE9A 1HF6A 1EC9A 6A3HA 4WDWA 3IGHX 2YA1A 5C70A 1TUXA 3RLGA 5G5IA 3C56A 1AQHA 3LCHA 5HWNA 5U7SA 1O1ZA 1CGVA 1R5YA 4X3ZA 4AZBA 3ZSSA 1L6FA 4ADTA 2PP0A 3SM0A 3EA2A 2OX4A 4QJ4B 5MKGA 2HE5A 3HU7A 6ENLA 2FLIA 1L9WA 4MNLA 4G56A 3SCTA 2BASA 1I0DA 1JULA 1RHCA 2DU2A 4M51A 2OSWA 5PTDA 1M41A 3KP1A 2NX3A 1IIHA 1S1PA 1F3XA 1VPYA 3ITXA 4MY9A 4U10A 1YHTA 3TLQA 4EXAA 1JFXA 4YHGA 1AH0A 5H91A 1QPNA 3LB0A 4RW3A 4KH2A 4XBJA 2G3NA 2J75A 1W9BM 5G4WA 4AWEA 3CH9A 1ZPTA 2BXZA 3ZLHA 2FZBA 2VR5A 3VD4A 4UFLA 2EKGA 3TW9A 3OIHA 2CLPA 1DJQA 4XZLX 2YB4A 2HS8A 3UPWA 2WNNA 1F4HA 5CXPA 2RFGA 1F7BA 1LP6A 3LLXA 4AZGA 3ARVA 2Y5JA 4C60A 3MCNA 1LQAA 1JFHA 1JPMA 3OIXA 3GBEA 4GQ0A 1PZ2A 3W70A 3H8AA 1VR6A 4IF2A 4JNZA 4O53A 1OFEA 1MUWA 4ACZB 4Y9AA 2CKRA 2AQOA 4TVDA 1Z6KA 4Y8FA 1OG0A 7TIMA 3WQPA 4OGZA 4KFPA 4S3FA 2E0PA 3I3BA 4WEVX 4ADSA 3GW0A 3EZ4A 4ORMA 4ZOBA 5IRPA 2OO6A 3F4DA 2BVWA 4U33A 1EKOA 1C8QA 4ML4A 2ZVIA 3A5VA 3I6TA 1W3NA 2PDWA 3GXNA 3UWEA 1NDVA 3KX6A 2EPKX 2VZSA 1XD0A 1BXCA 3P5ZA 1VKFA 2POTA 4JGDA 4UTKA 1DIOA 1A3HA 1R0MA 3O2LA 2AL2A 1W5OA 3IIVA 1H3GA 3UW6A 3CV1A 4XV0A 3MO7A 4UC5A 1PX3A 3LK6A 5D02A 3IJ8A 1GQJA 3MSGA 1JCYA 1X6LA 1QK0A 1Q6GA 3PF3A 1BRLA 3FEMA 1JZ3A 4L80A 2BTMA 1ZFJA 3GXMA 3T2OA 2DSZA 1KRCC 3SGUA 4O16A 1IEIA 5HPOA 4Q8MA 2G3IA 6TAAA 3L4TA 2ZWZA 1VBHA 4OFCA 2OCZA 2BWGA 4PBEA 1B31A 2PDGA 1E6RA 4OE7A 2VC6A 7TAAA 4C6DA 3OYZA 3U2CA 2F6UA 1Y0EA 4O4WA 1XJBA 3AIUA 4ENLA 3O15A 3IACA 1AFSA 1W6TA 1FWRA 1L8PA 3T09A 1GCYA 1RLDA 2XM1A 2ZA2A 2A7NA 3L4WA 3WIJA 4S2BA 3RPMA 1EBGA 3GDKA 4FR6A 5CQ1A 4WY0A 4M56A 1SVDA 1KA9F 5GVJA 2UY2A 4C1NA 2W66A 1V79A 1ZJIA 4LUJA 2OOGA 4WSJA 5AHLA 4LBSA 2PP3A 2HROA 4PRWA 5D9NA 2I5IA 1G4TA 4HSOA 2ZX8A 1E1EA 1KCZA 1JPIA 1CGYA 3ZXWA 4FAMA 5A8NA 4MIMA 3WD1A 4LUIA 5I3KA 2OODA 2Z24A 2X7VA 1TWSA 4DB7A 1QNSA 4RDWA 3M5VA 3ERPA 3U57A 4Y9MA 1DXEA 1KBJA 3QN3A 5EL1A 2J47A 3I6RA 1BD0A 3V1PA 1F6KA 5FOOA 2O92A 2WVUA 4I3GA 3UWQA 3N2TA 2YDRA 1NF0A 2CZEA 5EMJA 4KPLA 3CNYA 1KFWA 1I2PA 2E25A 2ZRVA 3SUWA 1P48A 3WBYA 3VMNA 3NSNA 1JPKA 4HP5A 2YW3A 4TIMA 4NYYA 1X97A 4O4VA 1PXGA 1SJBA 4MVAA 1QASA 3C2RA 4DIAA 1KCXA 5IOBA 1TZ9A 1FCUA 4L4PA 4PUMA 2CWNA 4IIHA 4HHPA 2A3LA 3UXAA 3CUXA 4PB5A 4C7DA 5ECVA 3BJTA 2ACSA 6CGTA 1FA2A 4YWIA 1K7XA 4A3RA 2Y7FA 1A49A 4Q7BA 2QVHA 4W7WA 1JAKA 3UG4A 1JZ6A 1W9DM 1W2VA 3VILA 4FMVA 2UBPC 2DZWA 2YA2A 2PBGA 1R2SA 4U3AA 4MWAD 4S3GA 3BAIA 1OX5A 2BVYA 4K1WA 4HNOA 1CXKA 3VCCA 1EJ7L 1HX0A 5HR7A 3MI3A 3U0HA 4UTWA 5HNNA 4IX0A 3GIQA 4X0NA 1B3ZA 3WLJA 3GYEA 3OG2A 1G0CA 1DJGA 1GORA 5IDIA 1ZJBA 4BWLA 1VJZA 1R3SA 1OF8A 3LUTA 4I9AA 2HVNA 3MB9A 2FZ9A 3B9EA 1BLIA 4JY8A 4IISA 4XK2A 3TJXA 2QCCA 1MUMA 3WUGA 3KTCA 2DIJA 4L56A 3GE7A 1VCFA 1MZRA 4A21A 3H54A 2ZZ6A 4HT3A 4P8WA 1XRFA 1WAWA 4B16A 1E15A 2PWGA 3NZGA 5I0DA 2QDHA 4C1NB 1EOKA 3M46A 3UWUA 4A3HA 1F07A 3KXQA 3VMPA 3MSDA 4O11A 3AHYA 2VP8A 2OWXA 3CAQA 3LLDA 4QQ3A 3GC2A 1HNYA 4ILSA 3PTMA 3PR2A 3ARSA 2WLZA 2VRQA 3F2DA 2DZTA 4D1JA 5A5WA 1HJQA 3KCOA 1KV5A 3IUIA 4PL2A 1PKLA 2VEFA 2VZVA 1WDDA 5A8QA 4U2ZA 2W3ZA 4H3DA 4OBRA 4G1KA 2Z28A 1NOUA 5I3HA 1U30A 2D69A 3J7HA 1FDJA 4I7VA 2R91A 4TMCA 4J5NA 5DLCA 2IUZA 5A8GA 7PTDA 4O13A 1S3TC 3GH4A 1ADOA 4PR4A 3W84A 3RX4A 1J79A 4DZIA 1DHKA 4X2PA 1XG3A 3KCJA 1SZFA 3CGTA 3PZVA 2JGYA 2QV5A 4E0CA 3RK8A 2J27A 3MVIA 1QW9A 1NQKA 2OWWA 1GKQA 4LYPA 4CD6A 1IXPA 2VVNA 3M9YA 1UZ1A 2Y5EA 3PZGA 2OZ3A 3BARA 4PMOA 3O06A 4EOUA 1E0XA 4Q4PA 3YPIA 4DBEA 2PGFA 1CPUA 5AKQA 3ME3A 4K39A 3AUJA 4HYVA 2ISDA 4R27A 4FNQA 3BLFA 3U2OA 2ZRZA 2NLIA 1OT1A 2BZNA 4HPNA 2GYIA 1ZBVA 1XH1A 2YLAA 4LCSA 1E4LA 1XUZA 4QP0A 4IFKA 4CNOA 1YLVA 3M0XA 5A6LA 4XBSA 1OWQA 3DU0A 4LJ3A 2WHJA 3DC8A 4ES4A 1FX6A 4EPBC 2VC7A 1V51A 2EPNA 2OQYA 1BKHA 2DUZA 5CLTA 3W6LA 1JPDX 4IMFA 1EP1A 4KEUA 1OADA 3TIMA 1Q6EA 2JBMA 4XO6A 4CNPA 2P76A 3BMVA 4Q8TA 2BG5A 3V75A 1JCJA 5EKYA 5IHRA 2BV9A 2Z2AA 3IUDA 2CLEA 3CC1A 3G5EA 3OG3A 1DBTA 3DIPA 3NDOA 1YIXA 4ZSUA 3P84A 1WNOA 3K8KA 4R9OA 1H49A 3OOQA 4RW5A 3CAVA 2PDYA 1UR3M 3VKBA 4NZFA 4IXXA 4Y7EA 4N42A 3KVJA 3OHIA 3H24A 3OVPA 4BF9A 1EL3A 1GOKA 4WSHA 2XN0A 2ATMA 3CHVA 2V3GA 3LRLA 1V6WA 1R85A 3B3DA 3HMCA 4W7VA 1V0NA 1HGWA 3E2VA 4MF4A 2ZRXA 4L6DA 2ZFAA 3GDTA 1XDMA 3C8NA 3LXBA 1TPB1 2Q01A 1TJPA 3PFRA 1DKWA 3HQOA 4HSHA 1I0BA 2QCDA 4HHLA 4PMJA 1J0YA 1ONRA 3SDOA 4EANA 2GDUA 3NM3A 4K36A 4HVXA 1NARA 3RITA 3UQNA 3QC0A 5EMMA 3PY2A 3KOXA 2XSXA 4P7RA 1M53A 4J4KA 4GNVA 4IGHA 3MTWA 1XIBA 3M1ZA 1GVRA 3S6TA 2QT3A 4JTHA 3BZGA 4CGTA 2FTPA 1BWLA 4Z17A 3GU2A 3ANYA 3NWRA 3NL3A 2BDQA 2IQDA 4DEFA 3W22A 1I1XA 1GTEA 1US2A 4IFKB 2WXDM 2VHLA 5DMMA 2O7QA 4N7QA 4AXKA 3XIMA 1Y5XA 2WZMA 2YDAA 3BTNA 5D9PA 1SW7A 2C1IA 2QPXA 4DYKA 2NVAA 4Y6GA 4LH8A 3W7PA 1G94A 4EP8C 1V6UA 4RNJA 3C5QA 2ZX5A 1TRDA 4JKKA 4W8LA 1CBGA 2F2KA 4Q32A 3W7GA 3TWBA 5D9OA 2WKLA 3RILA 5H8MA 3G0SA 2V5BA 2QVNA 1ZB5A 1ZBCA 4DO5A 2EXOA 1FH8A 5BYWA 2V0TA 3ANUA 2OX1A 1UW9A 5D03A 3BAYA 3WQEA 1XSJA 5DEZA 2FHCA 2ESCA 3W2NA 1A5CA 4GX8A 4AY7A 1OCNA 4B5TA 4U28A 2J9YA 3SCUA 3VABA 2RDTA 2WHLA 5DMLA 2DT1A 2V6AA 1EGZA 3VNJA 1E3XA 3WBEA 3SRKA 2GGEA 3AJ7A 3LGEA 3VVGA 3ZT7A 4AZCB 4LAMA 4F2BA 5AVNA 4NT0A 4OU1A 4NG3A 3HJEA 2WPBA 5LKYA 3K46A 4KCTA 4XAFA 3T1GA 1UQZA 3U6WA 1IWBA 3HGSA 4O1CA 3MMDA 1HGYA 1VFTA 1HTIA 5KZDA 3BAKA 3AMDA 4NJKA 4JQ3A 3QOKA 1X38A 4Q4KA 4I90A 3CHEA 1US3A 3EKLA 3FJ4A 2ZADA 3NXLA 1ZBWA 4ICCX 1R3TA 2E67A 4J3XA 3KL5A 1VEMA 4W5UA 3S83A 4JX6A 3L66A 5H6HA 3MHGA 1JZ7A 3QFWA 3C0SA 2J7FA 4AIUA 1O5QA 1JGMA 2IKJA 4C6FA 3W88A 2C7FA 4U3CA 1BYCA 1J0JA 2G96A 4GH1A 3UT0A 4PYSA 3TW6A 1ZALA 1P43A 1VP5A 1PHQA 4H41A 1R46A 1PL9A 3W00A 5EFDA 3KL0A 4JQ1A 3SCVA 1OCJA 2JALA 2XVPA 3IRDA 5C9UA 4IGSA 3N3TA 3WK1A 5LZLA 1XLHA 1ODZA 2GVGA 2HVMA 4H9YA 3VNYA 1FWIC 3HG4A 1WDWA 3VC5A 2A3HA 4Z0JA 1UJQA 4G1NA 2YBVA 1WUEA 4UUIA 4ATLA 1NWUA 1OCBA 4WXZA 3T6CA 3B8UA 3JVAA 3S9ZA 4CN1A 1K8ZA 5LNSA 2E5CA 5A6BD 4DPPA 2WNZA 4OIFA 2OLSA 1B3YA 4PB3A 2VZUA 4AC1X 2QLYA 1EJVC 4KWOA 4LRSA 3GW3A 5D33A 3OZPA 4L9ZA 2QNEA 3LRKA 4AZ7A 4FXSA 1LL4A 1VQTA 1DQWA 3EWUA 4M6PA 1R86A 3H2CA 5LNWA 4XAGA 3CEUA 1SW0A 2FIQA 3TYUA 1VBRA 2NLYA 1E1FA 1F76A 5FSDC 2QJNA 4JX5A 4Q7NA 2GGJA 3QY7A 5E6ZA 4GMEA 3CB3A 3QR1A 1E6NA 1K6WA 5I5RA 5JBEA 5DT5A 3QY8A 4PRTA 3P61A 2J7BA 1E1CB 3KVKA 4JTCA 4ZENA 3HPZA 3EX1A 2GWNA 4C6OA 1YYAA 5FF4A 1PZ3A 1UYQA 1C8XA 1HZYA 1VC4A 2Y7EA 2Y1HA 4JYEA 1IE7C 4J2MA 2NWSA 3UJRA 4OUIA 1VIWA 3GHSA 1DWAM 4TOQA 1SR0A 5F1VA 3I65A 4UQ9A 3I10A 1QOPA 4DI9A 4AWUA 4HTBA 1UASA 1Q45A 4ZFCA 4PMYA 1JR1A 4DWSD 2Y63A 2ISVA 4DO4A 1K9EA 1QVBA 3BMWA 1W1IE 2IPJA 1WKFA 3UJEA 2QCLA 4S3JA 2OLAA 3UWYA 5DQPA 3F2BA 1M68A 1PKYA 4DM1A 3WUEA 2Y8VA 4PFHA 5CAKA 3UG3A 4YJ5A 3TX9A 1XPGA 3E2RA 3G77A 5D37A 3M0IA 1GK8A 5LA0A 2B31A 3AU6A 3IGXA 2PSNA 4OWGA 4WK9A 4AHPA 1AODA 3MJMA 4ZCWA 1OEPA 1B4EA 4MNMA 4GBUA 1E9IA 4EF8A 5DMYA 5I3GA 1PJ9A 3T44A 3P80A 5T8GA 4Y90A 4DRSA 1EJUC 3VOGA 1FXQA 5G1YA 3U2ZA 2R14A 1JUKA 2R1PA 2DDXA 2VFEA 1RVKA 3GFZA 3I3EA 1JD7A 1RJRA 3LX9A 4O1BA 4DM2A 1YE4A 5BOOA 4O1AA 3THAA 4Q8NA 1VBGA 3N12A 5G2HA 2FH8A 2X16A 4KW2A 1W3IA 4O1FA 1AUSL 1OYAA 4OHQA 1QI5A 4DXXA 3GS6A 3R5EA 4NXKA 1D7KA 1BQCA 3UA4A 4K8GA 2F9RA 4H6KA 1HVXA 3PUGA 2ACQA 4TO8A 1XYMA 2WJZA 3FVMA 3MUAA 1JI1A 2C79A 3DFHA 1XGZA 2BGQA 4AMCA 1DE6A 5EGRA 2BGNE 3A13A 3W74A 2IQTA 3NR0A 4QAWA 3WFLA 3PWIA 4X0VA 3R58A 3LM3A 1UD4A 5TNVA 1FWWA 1BTMA 2PDBA 3MUCA 2FTWA 3C2EA 3V5CA 1XRTA 3E3HA 3DFSA 5FI8A 1E0UA 4IQJA 4Z42C 3WELA 3QQ0A 3WLNA 1QOXA 3PPHA 3TQKA 1D3CA 3LZ3A 4GC4A 2ZXQA 3QV7A 1N55A 1TQJA 4JIEA 2WBKA 5C55A 2ZZ3A 3W7EA 3A24A 5FF2A 1UPMB 3N2BA 1EDGA 5CC3A 5I78A 3UU0A 1KB3A 1BGAA 5DFAA 3N6HA 3VA8A 3AMLA 3CUIA 2ZE0A 1SO6A 4PBGA 1IT8A 3HMJG 3W6MA 1MXSA 2D2JA 3W7DA 1OC5A 4FNPA 1JDCA 2EG7A 1CCWB 1KWKA 4AZ5A 5C9WA 3VKCA 1DWJM 3KZSA 1FWGC 4JTUA 4FLOA 2CLLA 2ZWYA 3HGJA 4BQ5A 2VGGA 1TR1A 4PA8A 1GPFA 1V7AA 1AJ0A 1KTNA 1PV8A 5D2VA 1KM6A 1T8XA 1WYIA 4M19A 4TVCA 1TPEA 1ISZA 5AYBA 3W7OA 3W1PA 2ODOA 3E49A 3OGRA 8XIAA 1H4PA 4QG9A 3W1QA 3URNA 3ARXA 3E02A 2PTXA 1KTCA 3RIKA 2ZYFA 1UPPA 5CGTA 3AXXA 4GNJA 4LVDA 1OJXA 2B7PA 3ZM8A 1UWIA 1WPCA 5CSUA 1ZENA 4GKLA 3JW7A 3MZ2A 2CHRA 5T26A 1JPHA 1OC7A 3T08A 4GBDA 3WLMA 3P93A 4H9TA 1YMYA 2PZ0A 1J2WA 5LNUA 3MYPA 2VELA 4G9PA 4GJIA 4MB4A 3BLEA 4NILA 4AF0A 5J5DA 2V3FA 3BAJA 3EBVA 1SJAA 3G1DA 3EXTA 1U1UA 3GVRA 3M41A 3UWZA 1S5WA 4Z2LA 2PURA 3GDRA 2DZSA 2DEPA 1DTUA 4RJEA 2XIQA 1ITXA 3KOWA 1CLVA 4A8RA 3FEQA 5EMKA 1VEPA 1A3XA 5F4SA 4CU6A 4M0XA 4XKYB 1U1JA 3L0NA 3LSBA 2YXOA 1NDZA 3SCOA 3CEPA 4FNUA 1Q8AA 3QYQA 1XP3A 1T5AA 3H4XA 3CV6A 2WK2A 4UZSA 2Y61A 1OFPA 3C2VA 1F3TA 1VPXA 1TELA 3T42A 4I6KA 1XBVA 1KM5A 4NSBA 2FZDA 2H6RA 2VNCA 1XXXA 2P8CA 3GXDA 3T8LA 3PZTA 1BHGA 1S5NA 3GRIA 3NQ2A 2DV0A 2WVVA 4KETA 4AXNA 1Q2SA 1ZAIA 3PJXA 4MADA 3IK2A 4IIFA 3WQCA 1QHOA 8CGTA 3MP5A 4NXSA 2OPJA 2YL9A 4JPGA 3W38A 4PCPA 4OZOA 2QGYA 3CZ8A 1KKOA 4GOAA 3DBNA 3TMLA 4PEEA 4UTWC 1GHSA 2VCCA 2X0YA 4Q4MA 1DVJA 4FHAA 4H8HA 3WDIA 4CVUA 1EFZA 4BWLC 5BOFA 2ZC8A 1XIIA 2D2OA 1GQLA 5ABHA 4WJXA 3HF3A 5D09A 4F9JA 2HISA 1WV2A 4JFVA 3D3FA 1UUQA 1XI3A 2X2YA 3C0LA 1D3HA 3M6DA 1PX8A 3OLGA 1XLMA 3PTDA 4NVTA 5JIPA 2I7GA 4NF7A 4LAKA 2CETA 1K7FA 4EPKA 1UMYA 4HNUA 2DSKA 4PODA 4W5ZA 1KFEA 1JCLA 3QBUA 3DBPA 1POKA 1S2VA 3GUGA 4F48A 4YN5A 3BLIA 5E70A 4N4PA 4OOZA 2RJGA 2CCRA 2XUCA 4YYCA 5I00A 2E6DA 5AHFA 4JR5A 8A3HA 3N9RA 3M5ZA 2PZNA 4Q33A 2W9MA 4C1LA 4ZZ9A 4PUDA 1UH4A 4HA4A 4GCAA 4L4OA 1Q6RA 2IPWA 1S5VA 2A2IA 1TPUA 3IK4A 1VYPX 4PBFA 1QOQA 3W1TA 1BEUA 1PKNA 2P53A 1GVOA 4PMUA 3H7VA 2QAFA 1D2KA 2Y0FA 3IAQA 5CPMA 2O56A 3CQJA 1LF1A 2VQTA 1O60A 5GJPA 2B4GA 3GKAA 1XLDA 3SQMA 3WUBA 2PDHA 2Q8LA 5HK4A 2DVUA 4JOMA 4PUEA 4GLEA 3L67A 5D05A 2BOGX 2JQXA 3FAXA 2ZUTA 3DOPA 3E12A 3G2GA 4GUJA 2ZUUA 3L4ZA 3WMLA 2IMRA 3U48A 3CIVA 2NXHA 4GJJA 1JL8A 4H9VA 4MJ2A 4IMAA 4OBTA 2ZZ7A 4JTKA 2ACUA 3NPXA 3QHMA 1JEZA 1NDWA 2GJXA 3MA8A 2WVVB 1XYZA 5T91A 1XFCA 3VCRA 3B4YA 3HN3A 4KS0A 3CYJA 4H01A 2ZXBA 5C9RA 1VFMA 1CXHA 1TTPA 4QIUA 4XZBA 3G18A 1I60A 2VO5A 3PZIA 1J0KA 1FRBA 3TN3A 3ENLA 3UYIA 4RNFA 4F0RA 1YE6A 1REQA 4JN6A 4LW7A 4IMCA 1JYNA 1W3TA 3MQTA 2CBUA 2WJDA 4MWAA 5LXXA 4PTWA 3GD6A 5KZ6A 4BQ4A 1FH7A 1PS9A 3WD3A 1BYDA 1X6UA 3TSMA 3RJYA 1NQ6A 1NIUA 3EOSA 3IIPA 5A6AA 3EWCA 3ISIX 2B7NA 2QDGA 4MYAA 4NX0A 1SSDA 4GXMA 1UP3A 4Y96A 4YTSA 5KINA 1M01A 1J10A 2PWFA 2DT2A 3AIRA 5IHSA 3W01A 1D7FA 4JN7A 1MNSA 1Q7QA 3R43A 2Q71A 3PULA 2J13A 4RX0A 1MVYA 3HQPA 3UZ5A 3VIHA 3W24A 5EYWA 3W37A 4XVEA 2I5GA 1YDOA 4O8AA 4LAUA 4HA0A 4JAWA 3BPWA 5AYXA 1CXLA 3BGGA 1HT6A 2Z6IA 3GTFA 2DGAA 3NQFA 4P7LA 4V28A 2NUYA 4REQA 3BG5A 4UTUA 4GVHA 3WQGA 1P0KA 2H8XA 2DSWA 4KWVA 4KRUA 3PPCA 2X09A 3MMTA 2EEXA 4OV4A 4A35A 3UA3A 4DO6A 1LL7A 3PBMA 1IR1A 1EF3A 3UZYA 3TSBA 3VKDA 1JCTA 3CBWA 1S5TA 3S9YA 2D73A 4P7OA 4XISA 2QUMA 3WH7A 1YXYA 4PCNA 3PVFA 4DXKA 2YOCA 4NI8A 1CGWA 3KTXA 3O8AA 2HMCA 4L6HA 3ZVHA 2V82A 2DW6A 3CO4A 4IQEA 3SECA 3W7KA 4YVVA 4QGCA 4M24A 1POJA 5JU6A 1TJRA 2J6VA 2WC7A 1HL8A 3EA1A 3KM8A 2IKHA 4AZIA 2YR1A 2PE4A 1BAGA 1RSCA 2VFDA 1ISXA 2RDUA 1TPVA 2GQ3A 1ME7A 3NURA 2WMGA 5EA9A 2C0HA 2XVNA 4ICMA 4LS1A 5LIYX 1A5KC 4H6EA 3W2LA 4MWAB 2J74A 1S2CA 4XZMX 4MDPA 1GYLA 3CH0A 2C15A 1V0KA 5D2YA 3WDPP 3W4RA 1TMLA 4ZO8A 5KEZA 4LY8A 1M7JA 1X6NA 3EMQA 1S2TA 1TTJA 4HJWA 3TSDA 2CLMA 3VZZA 3SB0A 3KBNA 4MM1A 2PBOA 3M4HA 4GYJA 4E3TA 4OJYA 1E4MM 2D0HA 4LALA 3Q65A 3R2GA 2DT3A 1XDJA 3C3NA 5FJTA 3WQOA 3QQWA 3T2PA 3FA4A 3VU2A 2ZZ2A 1K8YA 3ATYA 3GR4A 2RHGA 3MBFA 3UR2A 4C6JA 1PUDA 5HOSA 1L2QA 3EWWA 1PCKA 4C6CA 5F2IA 3FGCA 4CQCA 5DBTA 2GVEA 3S42A 1FCQA 1JGIA 1S1RA 4ACYA 1TE1A 2O7SA 5RUBA 3WJZA 1MW1A 3OLEA