3UU0A

Crystal structure of l-rhamnose isomerase from bacillus halodurans in complex with mn
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
414
structure length
401
Chain Sequence
KSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-rhamnose isomerase
publication title Structure-based studies on the metal binding of two-metal-dependent sugar isomerases.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Isomerase
total genus 142
structure length 401
sequence length 414
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 2011-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3uu0A00
1TZ9A 2J6VA 1S5NA 2GUBA 3BZGA 3CNYA 3KBSA 5EMKA 4QDPA 1XYMA 2I56A 4G56A 4YTSA 5B7YA 3VNKA 5EMMA 1XIDA 4GJJA 2HK0A 2ZDSA 4A8IA 4EAYA 4A8RA 1QUMA 3WQOA 3KBVA 2GLKA 3ITXA 1YX1A 1MNZA 4YTTA 5XINA 6XIAA 3M0XA 4QE1A 4XSLA 5H6HA 3P14A 1DE6A 1S5MA 4Q7IA 3C0LA 3M0YA 4E3VA 5TNVA 2QUNA 1XIEA 1XICA 4PGLA 3DX5A 4OVXA 5AVNA 1DIEA 4ZB5A 3ITTA 3TVAA 4EACA 4PFHA 5H1WA 3U0HA 3ITVA 3BANA 1CLKA 3FVMA 1XLBA 2XINA 1D8WA 3AAMA 3OBEA 4GJIA 4HHLA 3UA4A 2QW5A 1XLDA 3VYLA 1QTWA 1XLHA 5I7GA 3XINA 1I6NA 1XLLA 3KTCA 3AALA 3N4AA 2NQHA 5FA5A 2QULA 3CWHA 3KCOA 2GYIA 1XYCA 2I57A 2X7VA 4XIMA 4YTUA 2NQJA 1A0EA 1XLMA 3AYVA 3ITYA 3LMZA 5EMJA 4ZB0A 3NGFA 3IUDA 4KW2A 4ZBCA 4XISA 6XIMA 4K3ZA 4X60A 1DIDA 4QE5A 4HNOA 2NQ9A 3TC3A 2XIMA 2QUMA 3DBNA 3VNMA 4DUOA 3QC0A 4X63A 4LNCA 4QEHA 3VNJA 1XIMA 3UA3A 1QT1A 3CQIA 3CQHA 9XIAA 4US6A 3CQKA 5EMLA 4K1GA 3KBMA 1XIGA 5AVHA 1XP3A 3C0QA 1XIFA 1XIBA 3M0VA 4QEEA 3UXIA 1DXIA 4QE4A 1XYLA 1XLGA 3CQJA 3XISA 4DVOA 9XIMA 1XLKA 1XLAA 3GNXA 3KWSA 4XSMA 3VNLA 2G0WA 1A0DA 4X61A 1OADA 1XLJA 3ITLA 3IUIA 1XIIA 3UU0A 3XIMA 5J8LA 1BXCA 3KBNA 1I60A 3KCJA 3U3HA 1K77A 3M0LA 3QYSA 3IUHA 3QZAA 2G4JA 4A8LA 8XIMA 5C9ZA 1XLCA 8XIAA 1A0CA 3KCLA 3BZJA 2Q02A 3M0HA 1XLEA 5XIAA 4YTQA 2XISA 2GVEA 1GW9A 3AYTA 4J4KA 4ZB2A 1O1HA 1DE5A 3QXBA 2HCVA 1XIHA 3VNIA 5XIMA 1XYBA 3BDKA 3KBJA 5B80A 3ITOA 2ZVRA 3C0SA 1XINA 1XYAA 4HHMA 4HGXA 1XLFA 7XIMA 3UVAA 1XLIA 3JU2A 4YTRA 4XIAA 4QDWA 4GQBA 3KBWA 4GLEA 2OU4A 1MUWA 4W4QA 3BWWA 4A8NA 1BXBA 1XISA 2X7WA 3L23A 1XIJA 3M0MA 3P6LA 2HK1A 5B7ZA 4XKMA
chains in the Genus database with same CATH superfamily
3T2OA 1R2SA 1U5JA 3RLHA 2G97A 1SO5A 1XQLA 4AF0A 4L6HA 3PUOA 4JTSA 1E4IA 4ZA0A 4OU1A 3R10A 4YMZA 4O54A 1P43A 3H21A 1MRAA 2XZ7A 1A4MA 2Q8XA 3KTCA 3RF9A 3B8IA 4F0HA 3EMZA 1P0BA 3G8RA 3VIGA 2YW3A 3KVJA 5BU9A 4FB7A 1J8VA 2OLHA 2A3HA 2PDPA 3LX9A 4QJ1A 3BW4A 1J0JA 3VZYA 1E0XA 1HP4A 3MBDA 2PDQA 4RKAA 1QI3A 1TMHA 3VD7A 5ABFB 5GVJA 4CQAA 3M6YA 4NNCA 1V3LA 3SIZA 2QVNA 5CPTA 3MY9A 3H2OA 4O52A 3E6EA 2AMXA 5A8PA 1HJQA 5KINA 4PODA 3R8HA 3QH2A 4WDTA 2VFEA 3BOLA 2AQWA 2Z1WA 3JZEA 3R4IA 3MMUA 3W6LA 3WLQA 5AYZA 3VKKA 3MO4A 3WQCA 1OYBA 4PSPA 1H1NA 3BXWA 2DZTA 1E4LA 1OFPA 3N18A 2ISDA 2IW0A 1Q6LA 1KCKA 1E56A 3DYPA 4B5UA 3CNYA 4KIEA 1LJYA 1RH9A 2PC8A 4K8EA 4ZQCA 4ZEPA 1XFBA 4H9UA 1AJ2A 1BVWA 3IPWA 3CZJA 3NO1A 1NVMA 2WHMA 1B4EA 5CKSA 1RALA 3GVQA 3AHXA 1XUUA 3RO6A 3LENA 1DORA 4L4OA 4GUHA 1C3FA 6ALDA 4XWUA 4GRSA 4O8RA 3BANA 1J12A 3VNYA 1NDYA 3R12A 1HL9A 1WPCA 2Y70A 1EWDA 4V15A 1XLMA 1TMQA 4U31A 4K3ZA 5DBUA 3QC0A 3UY7A 1C29A 2E67A 4Q8QA 1ZCCA 4GINA 2ZRUA 3VOFA 4AYSA 4TVCA 4GH1A 4MJZA 1WOBA 1RLCL 3CV7A 2CESA 3HA1A 1XIGA 3W25A 4FALA 1ADSA 5TAOA 2PWEA 1L6YA 2WK2A 4ZENA 3V1PA 4I7VA 1GEHA 1NEYA 3G1XA 4FNUA 4JIHA 1MUMA 2Q09A 4J3WA 1ZY9A 3B40A 2Y24A 4BQ3A 5RUBA 4A8LA 4OE7A 2XVGA 5F2MA 3AHVA 2VOMA 1VFLA 3UWVA 2Z6JA 4XD4A 4IG2A 4XD6A 2YL8A 4WZHA 3AS0A 3FX4A 3OLIA 1RBLA 4YTRA 1PIGA 3P2VA 4GJ1A 2OU4A 2C3ZA 3NQ6A 4F9JA 2ATSA 2BGNE 1NWTA 2ESCA 2D22A 3UT0A 4LVDA 3I7QA 2WNZA 4DZIA 1US3A 4MY8A 3S9YA 4DO7A 2NV1A 5C9UA 1KM1A 4WKHA 3MSRA 3NQEA 4V33A 5AVNA 1A80A 1CLKA 1VBGA 1TUFA 4JQAA 3GZ3A 1XLHA 2YFNA 3SQLA 2YDQA 4TVDA 3H55A 3VCRA 4Q8OA 1QHOA 4EPKA 3WLTA 5AY7A 3R0KA 3PF3A 1JZ3A 3R5EA 1OYCA 1VCGA 4V2XA 1QW7A 4CCDA 1R9ZA 2JFEX 1D3CA 2BHZA 5EGRA 1WZMA 3AQUA 3CPRA 1UWTA 4ZQNA 2C8NA 2D2HA 4JFVA 2WVSA 4IPIA 2X1SA 4RZBA 3W2KA 4RE3A 2PTYA 3PBGA 5AOUA 1TTJA 4KEZA 3EWZA 1T5AA 3SCOA 1A5BA 1TJ0A 2LLEA 4FLQA 4NZFA 5FD0A 4OT7A 2BY2A 3A6OA 3BLOA 4EX4A 4LBUA 2PGEA 3GX9A 1XISA 4MUZA 2V3FA 3FKKA 5LIYX 2GDUA 3SCPA 4UNIA 5H8PA 4H8NA 3N2BA 1BWKA 4HPNA 1Q7QA 3UR7A 2IQDA 1BVNP 1ZFJA 1YRRA 2D73A 4L56A 3GTFA 4MB5A 3NXFA 2Y62A 1VFTA 4LRTA 1J2BA 3PY2A 3BCFA 2PAJA 2ZIDA 1Y8BA 3ARQA 3NQBA 2OXNA 4M6VA 1ME9A 2WZEA 1T99A 2BOFX 3KCOA 3ATYA 3GAKA 1FWEC 2FTWA 4P7LA 3WDJA 3V0SA 3M44A 3UR5A 2GQ8A 4LAZA 3ARTA 2CLEA 4KWSA 2A0NA 5DRCA 2EHHA 1BFNA 3NXLA 2VDHA 4K1GA 4C1LA 2VQTA 4MB4A 1A3WA 3MT1A 1MEWA 1B4KA 2PP3A 2HV5A 4MKNA 1X97A 4F0LA 3W7GA 3R6IA 3GNPA 2XH7A 1R38A 2RHGA 1KM2A 1DVJA 1IEXA 2OX1A 2QNEA 2PE4A 3STPA 3PBVA 4YIWA 1WAUA 3KS5A 3RM8A 3DHFA 4ERAA 1ICSA 3W1UA 4UR9A 5CEWA 2ZA1A 1XDLA 4P61A 1FFRA 4YVPA 1IZCA 2FIQA 2Y89A 3NZ1A 4UTTC 3LG3A 1HF6A 1ODUA 1U1HA 3IRSA 3VMNA 1DJGA 2YB1A 1RA0A 2XZ9A 2RJGA 4EKJA 4AVNA 3FCPA 3K1DA 3IS4A 5D09A 2C71A 1UBSA 3AXHA 3UWEA 5I6SA 2QJHA 1XIEA 4MVAA 7ENLA 2ZRVA 5BXSA 1DIEA 4ZZ9A 1Q7MA 4ERGA 4J3XA 1DXFA 3QYQA 3DXIA 1UOKA 3H70A 3FHAA 3NAVA 1EC8A 2F6KA 3ZLHA 5KMYA 4B2DA 2FPTA 4XD3A 4IWWA 1KXVA 2GUUA 2RDTA 2J7FA 4D6GA 2XPKA 2W63A 3LI1A 3KXQA 4W86A 2VR4A 9XIAA 4L61A 1O66A 4MTVA 5JH1A 2PS2A 2Z00A 2J62A 3DFTA 4PMNA 3SSZA 3TAOA 4ML9A 4C6LA 1F05A 3B8WA 2CITA 1I8JA 4JTEA 3XIMA 2WLYA 1BAGA 1JEZA 4I9JA 3VD5A 3SAZA 4JHOA 4AY8A 4S3KA 1U1JA 2CEQA 1JPMA 2DUXA 3MDUA 1ALDA 4YL2A 3H54A 4UFMA 4DZHA 2QCNA 4HHMA 1TJ1A 3I3BA 3LQGA 1XBYA 3O63A 4MPKA 3M0MA 3G77A 4JDYA 2B7NA 2H90A 4KCVA 3A4XA 4M0XA 4YJ5A 3ZVHA 3SUSA 1GVIA 3M43A 3ANUA 4L9XA 2D2JA 2ZRXA 3DKJA 3GVWA 4Q4PA 4UOZA 4AF0B 3LA4A 4MZ8A 1RJQA 3TR9A 3RMJA 1PSCA 4O19A 3R43A 1VZWA 1GWJA 3VOJA 1M03A 2P0OA 4CNPA 1Q45A 1KGUA 1VS1A 3UPBA 3GG1A 2BFGA 3WD2A 3H7UA 4AZBA 3CMGA 3HURA 2PD5A 1LP6A 2C18A 3WF4A 1PEZA 3VKDA 5AZ1A 2UY5A 4LVFA 4O0QA 4IPLA 1FCVA 1Q6CA 4JTRA 3EAUA 3VC5A 1MQQA 1Q63A 3SJ3A 4EANA 2J24A 4UXDA 1HFBA 4OQVA 3RYSA 3B9DA 5K3VA 2TSYA 4IICA 1KC7A 2ZADA 4KQNA 3CPGA 4FX6M 1Q6GA 1SZRA 5DQPA 5C9ZA 5AYBA 1NWRA 2ACRA 4M8UA 3PBWA 3TE9A 4LUIA 1TVNA 2AKZA 5GNYA 4GGBA 3BOFA 3S1WA 1CZ1A 2V68A 1J5TA 5D03A 1YYAA 4FXRA 2E68A 5EFFA 1W1PA 1UA3A 1OGGA 3E38A 1B30A 1FKXA 2Z0IA 4HU3A 1POKA 4N42A 1FHVA 1KBJA 1W1YA 1Q8AA 2NWRA 4HK7A 3GO2A 2PSNA 3RRXA 3I3DA 2OODA 2O56A 2WANA 1U5VA 4IZGA 3L2LA 3E5BA 3VGBA 2ZTKA 3RUBL 3U2CA 4OVXA 4XBJA 3GDRA 1NJJA 1UR3M 2IUZA 2WVVA 2CLPA 3WQ6A 2NLIA 4DBUA 1UBPC 4ATWA 4RE2A 4HZMA 3RDKA 5BW6A 1TZZA 1G69A 2OEJA 1ZB5A 2XIIA 5EMJA 4MPQA 4QE5A 3OLGA 1UPPA 4A35A 1HJWA 1VD6A 1P0NA 4IH3A 3FNDA 1W1VA 2JKAA 3CQKA 3OVQA 1JUBA 4NSBA 2YA2A 1DXIA 1LM1A 2VRKA 1V6UA 4Z2GA 1YXCA 1R46A 3P81A 3HFTA 4AD0A 3EX3A 5D33A 4QLJA 4AG0A 1QI2A 3E02A 2CBVA 4D6CA 1FWAC 3WMCA 3N2XA 4AISA 1JPHA 2HSAA 1GKQA 1XH0A 1ZSXA 3GTIA 5CPNA 5EB8A 4D6DA 3GTXA 4U5IA 2Y85A 1ZP4A 3IIVA 3EYPA 1HL8A 1ZBCA 5KZDA 3UEQA 4HN4A 3GB6A 3BVJA 3POHA 3VMOA 2RUSA 1XIDA 2AL2A 1VR6A 3ITXA 3WQ8A 1SZGA 3MVTA 3QQWA 3VIOA 4TX6A 2NX3A 3VVGA 4B5VA 4E3VA 3SCQA 3WQVA 3RJYA 2J88A 2Z7KA 3IV8A 1KFLA 4Y8FA 4NYYA 3MWAA 1CGTA 3BW3A 3F4CA 1UKSA 3GD6A 3OHMB 3ITYA 4HK6A 1VHCA 2BV9A 1MQRA 1DWJM 4A05A 1NF7A 5JXQA 1R3RA 5A94A 1S2VA 1K9TA 2Y5EA 1EEXA 4LWWA 3UY8A 5D38A 3P8IA 1XGZA 2ZUWA 3GVVA 1KFJA 1WAWA 2VWSA 2RGMA 4NI8A 3BAIA 4X3ZA 3STCA 1Q6QA 5DANA 1JCJA 3CTTA 3ITCA 3VNDA 4DF2A 4GFIA 1OYAA 3DBPA 4IIGA 4XZIA 3L5LA 5C54A 4WLCA 3L4ZA 5AHMA 4KEUA 3MJMA 1TPEA 3GR8A 2WPGA 3E2SA 2WYSA 4XZMX 4JY9A 3EX4A 3KHJA 4NNAA 4H3DA 3BDKA 3FGCA 3ZIZA 4H6EA 3QQ1A 4URIA 1GEQA 2QV4A 4IX2A 5F4XA 3OEXA 1T8QA 3L23A 4PN2A 3GY1A 1VBJA 3TUUA 1KRBC 3EOLA 3V75A 3LDVA 2PBOA 3TTOA 3MI6A 1B3YA 4S38A 1DOSA 3S46A 3T8LA 3WF3A 2UZ9A 2QDGA 1YDVA 2GLKA 4YTTA 3N73A 3SRKA 3TSMA 1WDQA 1DHKA 3NEHA 4LALA 5I0DA 3KWXA 1K7FA 4CVWA 1XGDA 2NVDA 1QO5A 5I7GA 2DVUA 1UWIA 1NQ6A 3WF0A 1UR1A 3AYVA 3B0PA 2WMJA 3II1A 2F8QA 4J9JA 4X22A 3IJDA 3LHUA 1QOPA 1YE4A 3LGDA 3LXBA 3BLEA 3ME3A 4AD3A 3O0FA 4XD5A 3L4UA 4EAMA 1M7OA 1A5UA 3FAXA 4DQWA 3EPOA 1MI3A 3HG5A 1VJIA 2GWGA 3S5YA 3N14A 3IJ6A 2QUVA 1SU5A 3M16A 3U3HA 1DJHA 4EF9A 3M47A 1PTDA 4CD5A 2QMKA 1UD5A 3RILA 4AC1X 2OQLA 3WQPA 1S2UA 3OW1A 1DHPA 4GY0A 5I2UA 1JZ5A 1ZBWA 2D3NA 4A2RA 4FNQA 4RK8A 2HVMA 5HR6A 5G4HC 3SUWA 3WEZA 1LUCB 1SJCA 3AI0A 3RXZA 3WLHA 3QOKA 4NAEA 3WN6A 5HANA 1Z9AA 2PB1A 5AYIA 2BTMA 4UFJA 2ACSA 2YLLA 3JR2A 1S5MA 2G3JA 4N4PA 1JZ4A 4IPNB 1TJPA 5HUOA 4UTWC 1UHVA 4RLIA 1BSIA 4DJED 2V3GA 4PCPA 1WO2A 2FHFA 2XVLA 4PUEA 4CNNA 1TWSA 1KQYA 1I2OA 1XCXA 1E0WA 4R9OA 2GJLA 3KE0A 4JTLA 4Y90A 4F48A 3HQOA 2WQPA 1TIWA 2VR5A 4GXMA 4IPJA 3NURA 1KTBA 4CNSA 3VNZA 1U5HA 2FZDA 1NFGA 1RP8A 1Q6FA 4O0ZA 1V5XA 4ILSA 3AHTA 4DWSC 3HU7A 3P0XA 2AL1A 3BW2A 2NT1A 2OKTA 5C2CA 1TWDA 1K70A 1BRLA 2WWDA 4IP7A 1UD8A 2XFYA 1XF0A 3UG3A 2PURA 1EGMA 4XZHA 1D9EA 3W1TA 1FWTA 1S3TC 3KBJA 2J7EA 4XG1A 5LYRA 4D1IA 4EOUA 4P8WA 5A6BD 4XIAA 4GYJA 3GNDA 1TYGA 2FYMA 4H01A 1GT8A 4G1NA 3KL0A 5B7ZA 1HKMA 2GUBA 2FVMA 2JEQA 1JZ7A 2W62A 1FDYA 2QV5A 4FMVA 3AOFA 2XG9A 3VIPA 4IIFA 3T0TA 4X0NA 3E5PA 1ZUAX 3KRBA 2QMJA 1JQXA 5IFPA 3QKZA 2AMGA 3RPMA 1KM4A 1V02E 2WMFA 1NDVA 1V3MA 4X60A 3HMCA 4GI6A 4O4VA 4QG8A 3F7JA 4AZ5A 2QHAA 1GZ1A 1FFQA 3W7IA 4WUIA 4KF1A 4H4IA 1CXEA 5DN1A 3LHWA 4EXAA 2VZUA 1O6IA 2X41A 4ZFMA 2JGYA 3P60A 1KFEA 1SO6A 3W6YA 3CB8A 2RGLA 4A2SA 2Z4GA 4Z1AA 5I03A 2VX7A 1S1PA 3KAOA 3WH9A 5D32A 3UU0A 1IXPA 2HJPA 2X42A 4ZO8A 4FO4A 4JTUA 2C13A 2VFIA 1JIBA 3H22A 5HWJA 5CBJA 3PNUA 4AQLA 5GPRA 2V2DA 1LLOA 5D4YA 2YL9A 4Z1YA 3KUMA 4X9YA 4PFMA 1IHIA 2G3MA 4JY8A 5D04C 3BOXA 3QV7A 5HATA 3E74A 1E6NA 4QITA 2A7PA 4IPPA 5A8OA 3TFCA 2DZVA 4S3GA 3P61A 5D9MA 3WLOA 3DERA 3C8NA 2O0TA 2Z24A 2QPSA 3TQ0A 2DIEA 5CJ5A 2V0TA 2WVVB 3PZGA 5G2HA 1ELSA 2PDIA 3ES7A 3IJ7A 4V1YA 3ZZ1A 3B4UA 4P8VA 2GYIA 4JIRA 2UWFA 5HUPA 1H5YA 2ZBTA 4ZTYA 1I4NA 2J7HA 2OJPA 3G22A 3N6QA 4NZ4A 3W1MA 4QQ3A 4PUJA 3AUOA 5FCZA 5EL1A 3VGDA 1S2WA 1XLKA 1UMLA 4AEOA 3GIQA 3VDHA 4Y9MA 4O1BA 4FNRA 1JRBA 1ZCOA 3GDLA 3ZSSA 3KBNA 2E6FA 3KCJA 1HO1A 3U4FA 1TG7A 4H41A 3KFTA 2X1IA 3HBLA 3LQLA 2RDWA 4GI4A 4GIRA 3D3FA 1C90A 3VM5A 2Q8ZA 1O5QA 4Y9AA 3RM4A 2QAFA 3EBVA 1TV8A 2VNCA 3USBA 5C9WA 1WV2A 1CDGA 1XW8A 2QJJA 3C3NA 4WY0F 3O9NA 1DWGM 2FZ9A 3B9EA 3I6EA 1XKJA 4R34A 4WQ6A 2W9MA 1XR2A 5J5DA 3BQ6A 1DEDA 4B5WA 1AH4A 3AS1A 2ACUA 3LRKA 3H24A 4EWND 3AYSA 3U57A 2A3CA 4L1WA 2ZUVA 1XSIA 2AL2B 3M0YA 1QPOA 4RDZA 3SY1A 1CEOA 4IIHA 3GXDA 2VZTA 1W3LA 3U0HA 2Q01A 3D46A 1CT5A 3AAMA 4AWTA 1J96A 1B9BA 4IF2A 3LUTA 4M5PA 2D23A 1CGYA 1ME8A 2VL4A 4Q4RA 4ENLA 2VX5A 3W85A 3UETA 4DJFD 2V2CA 1D3HA 3PB2A 2E09A 2VM8A 3CT7A 2H9AB 4NQ1A 2GUYA 4ZGYA 3AXIA 3NQGA 3TQPA 1PUDA 4H2CA 1VB9A 3QC3A 3NQ8A 3O6DA 4I3GA 3W02A 4JN7A 1L0PA 4D8AA 1F73A 4BQ4A 1V0KA 1LTDA 4PH6A 4HA0A 5HWMA 3M5ZA 4L1GA 3E0IA 3BLLA 4FS9A 9CGTA 1C7SA 4S3CA 2Y7EA 2WSYA 3LLXA 4L80A 2VFFA 1TX0A 1FHUA 4I5XA 4C5YA 4I6VA 4PRWA 4MDOA 2FH6A 5BYWA 3ZJ6A 1BPLB 3AJXA 2IQ0A 1OABA 4UTFA 2FTPA 4BJHA 5D8ZA 2ZX7A 4QE1A 1TVLA 1OX6A 3A24A 1XICA 2YXOA 4HP5A 2CZEA 1VC4A 3BGAA 3ITVA 1QNOA 1KW1A 3RX4A 4J28A 1PL9A 1GOIA 1WOAA 1L8PA 3UCDA 2HDJA 4UFIA 4D71A 1OZQA 3W7RA 3LTSA 4PMQA 4ZE5A 3B03A 4PTVA 4JQ4A 1KCLA 2XFRA 4LS2A 1E55A 2FZBA 4PCSA 3GUWA 2DSKA 3P74A 1Q65A 1UJQA 3GKAA 1FWFC 2EPOA 1TUXA 4XO6A 4EE9A 2FFCA 3NL2A 4C1NB 3IWPA 2DFAA 1PKMA 5AYXA 2GDQA 1MXGA 4IJBA 4ORIA 5FF0A 1RLDA 4P7QA 5A6JA 1MW3A 2JK2A 1UIOA 4I8DA 5A95A 1JCXA 2YA1A 3NYZA 5C0QA 2ZXBA 3OLDA 2D0FA 2WVTA 5M03A 3WLJA 1PKLA 1ZZMA 3UVAA 3S1VA 4F0KA 2PF8A 4WJ8A 1HG3A 2WJDA 3RG6A 2Y2WA 6TIMA 5A6TC 4CEUC 3PJXA 1FCBA 2X05A 4AXNA 4RNJA 4NAEB 2JEPA 3KHDA 2ZRYA 3ALGA 1DE6A 3EEGA 5L9FA 3CWNA 4DF0A 4AHOA 2V5JA 4E4UA 1EJ7L 4Q7BA 2C19A 5HXMA 2DW7A 2J74A 3UJEA 1DJIA 3CUZA 1US2A 3FJ6A 1R7OA 3U7VA 2R14A 4Z08A 4TTGA 3OLEA 3NUKA 3PZ9A 3BE7A 1QBAA 1HTIA 2J78A 7REQB 2CZDA 4Q4OA 2FKPA 3UD6A 3N2MA 1X98A 1EXPA 4UIOA 3N4EA 1ISVA 2ZOXA 4ROQA 3ARSA 4Q32A 3G1AA 2R6OA 5CLTA 3PR2A 3JW7A 1GVOA 1E43A 5C8BB 4PUNA 3N29A 1IZJA 1R9XA 4PMRA 4QRNA 3W1QA 3LS9A 5A2CA 3IJQA 2Z2AA 3TONA 2VTFA 2YPIA 3GVGA 1A5SA 4O14A 2ZVIA 3LPFA 2QT3A 5DEZA 4B4FA 3VE7A 3Q94A 1TPC1 1GJUA 4ZB2A 1J4EA 1Y5XA 1RP9A 2WSKA 1W9XA 2VCBA 3LERA 5LXXA 3OHIA 1XLFA 4AU0A 2INFA 2J27A 3RN6A 1JI1A 3S5NA 2VEMA 3O6AA 5FIPA 2E9MA 3DFYA 1FUYA 2HBXA 4JTCA 4ACZB 1RCOB 1UA7A 4HHHA 5HMDA 1M01A 4GCXA 3ABOA 1SO3A 2WKLA 2QJMA 3WH7A 2Y8UA 3W81A 1GYMA 3NL3A 2ZTJA 3EB4A 2QVHA 5JBEA 3EA1A 4ATLA 2W5FA 2MUCA 1LLZA 3QMRA 3BL3A 4GQQA 4ZB0A 1PIFA 4IGHA 4IQDA 3CHEA 1RK6A 3WD0A 3VABA 3ZR4A 3BPWA 2ZC8A 3NQCA 3M7WA 3TLLA 1P6BA 1F6YA 4LRSA 1R6WA 1R3YA 3QN3A 4DNMA 4RCXA 3CJPA 3UFYA 5AHNA 4HHPA 3TW7A 5T8GA 2BP1A 2A79A 1FH7A 3CZGA 3TXVA 3NYDA 4HMCA 4MM1A 1BEUA 3OVGA 2YL5A 4BI5A 4C7DA 4IMEA 4RE0A 3E49A 4TX8A 3KCLA 3OA3A 4V1XA 4FF5A 4K7YA 4YTQA 3A5VA 1XG4A 1ODZA 1WDWA 4GX9A 2QCCA 3W87A 4NY2A 4M6PA 3DI1A 1WBHA 1MMFA 1E71M 4JTKA 3JU2A 2VX4A 3FV9A 4XO7A 1XD1A 3GNRA 4A8NA 1A49A 1P0DA 4GOAA 1SFJA 4GQ0A 3LBCA 1FQ0A 1GVSA 4R7JA 3LM7A 2WM1A 1S39A 3ZR5A 1LWIA 2X1UA 5BMWA 2V9DA 1YXYA 2QCLA 3GFZA 3MUCA 5XINA 2I7GA 4CKQA 5ABGA 5T9BG 2YLAA 2ABAA 1VENA 5K9DA 1OC5A 5CPQA 3QLLA 1Q6OA 2ZXQA 3LRMA 2E3ZA 2X16A 4YWIA 2OT0A 2A85A 1LRQA 2PCEA 2PRHA 1TPB1 3EWBX 2PGWA 5HJXA 3VAVA 3L66A 2AQOA 4N9DA 2YXGA 3DHDA 3MS8A 4UTWA 2GQ3A 1OD0A 3OQ8A 3EDDA 3LGGA 3ABRA 4JIEA 4QE4A 1L8NA 4HNUA 1W54A 4JOMA 3RLVA 1IV8A 3LLFA 3WG6A 1VRXA 3MW7A 4H8UA 2ZUTA 1Z7AA 5D37A 3RGTA 4LB3A 2XN0A 5J8LA 3EOEA 1AQHA 1WKFA 1FDJA 1R3SA 2XISA 4MIMA 2C16A 5D9PA 3O7UA 5C2GA 1O1HA 2UBPC 1OD8A 3VD3A 3AS3A 2VC5A 4JTGA 1M5WA 2VRJA 2CLOA 2DUZA 4DWSA 7XIMA 3CIVA 1E15A 3B9NA 1QATA 4HYVA 4S2CA 1E51A 1K7EA 4A29A 4QHRA 1DJQA 2FH8A 2HMCA 3RCYA 3C2RA 3WUBA 2X0SA 1VCFA 3STFA 1BTCA 4GVHA 4FIQA 1KV5A 1R2TA 4INFA 1WCGA 4NXKA 5IM51 2HE5A 3L4WA 3IARA 4I7WA 4MZ1A 3FSUA 5D05A 1SZNA 6REQB 4K36A 2DORA 4GWEA 3OBEA 1J0YA 4GQRA 4JFUA 2JIWA 1M41A 3AWOA 1GJPA 4Q8PA 4UR7A 2X40A 3DU0A 3GR4A 4OWGA 1N8FA 3CGTA 1JDCA 2D2GA 3LY0A 3V36A 3VNJA 3DECA 3RRAA 5I78A 2QAPA 1QT1A 2P10A 4C6QA 2IXVA 3PWAA 5HQMA 3ZS4A 4ZCWA 4O15A 2DEPA 4GZ7A 1XIFA 3UZ5A 2WCGA 1UQYA 3C2OA 5CCZA 3TV8A 1GQIA 1BWLA 1LBFA 1BD0A 3QZAA 3EDKA 2VCAA 1UR0A 2RJHA 2PLCA 2OZTA 4IXHA 4QGCA 7CGTA 2V5LA 3FXGA 4F79A 3F5KA 2FVKA 1JPDX 3VD4A 3B8VA 1OFRA 2PDJA 3CIXA 3C2FA 3SRFA 3SO7A 3NOYA 1KBLA 1MW0A 3NQFA 4D6JA 2A6LA 4O10A 3PVFA 4AX6A 1CGUA 1A5KC 1PDYA 2NV2A 4F66A 3THAA 4KT2A 1IEVA 3TNOA 2QCGA 3QF0A 5I79A 1LLWA 4D72A 2V30A 3CASA 2WCAA 4OV9A 4N7QA 4LXFA 1D8WA 4MJMA 4UQ9A 2P8BA 3B05A 1OX4B 2PTDA 3MI2A 2J77A 2V5BA 4LY8A 3TYDA 3AZSA 2OYMA 2XVPA 5BCAA 4ZQMA 4D8ZA 3W76A 1XHGA 1NU5A 3CAVA 1V7YA 3TN4A 3V5OA 4UWMA 5HNRA 1Z6KA 1R3WA 4X2RA 1O5XA 4R7WA 4FNPA 4IISA 1WBJA 1SW7A 1ZL1A 1SYTA 4UCGA 3BAXA 2ZUSA 1J10A 3FDKA 1UWAA 1KFCA 5I5RA 3W2LA 4DO6A 3MI3A 4ZOCA 2WBGA 4B5SA 3GG7A 2PP0A 5M5DA 3WLRA 4R27A 3MV01 3M41A 2DZUA 2YCJA 4AFYA 5I3JA 1BYCA 1K8YA 1WE5A 1LL4A 3UXKA 2OOFA 3N11A 2PTXA 3LPPA 3THDA 1YNYA 3ZOAA 5DXYA 3GHSA 1DWFM 1FY6A 3FYYA 4UB9A 4H9MA 3BAWA 1VH7A 4XK2A 4GQBA 4CEXC 3Q37A 2EEXA 1ONEA 4WKAA 4L6OA 4N6FA 5EMKA 3L12A 2F2HA 2OGJA 3AIWA 4GJJA 3WK2A 3IAPA 4E8CA 1YADA 2IPGA 4LVAA 3PWGA 2BS9A 4BF9A 2D69A 1TTPA 3CQ0A 3HMJG 1EF3A 4WVXA 3NO5A 4F8XA 4IHCA 1JL8A 3F4NA 5IRPA 3OU8A 1D8CA 1TSIA 1QO2A 4EVZA 1Z32X 3UCCA 3W27A 3QR1A 2ALRA 1ZGDA 2I9UA 3VDAA 3B9AA 1TJ2A 2Y8KA 1B3ZA 1UKTA 2HVOA 3H53A 4UZUA 3P3BA 3CEUA 1RK5A 4BEUA 5I3KA 1BG9A 2WMIB 3EMQA 4FOUA 4BEQA 1H0GA 3IGSA 1IR1A 4P7OA 1UP3A 5MF5A 5DY3A 4K38A 5LNWA 3WQDA 1XIIA 1Q5MA 1GPWA 2DIJA 3H2MA 3Q67A 4IFKA 4KMQA 2NUXA 3G1SA 4LC8A 4E2DA 5EMYA 5CAKA 4XVDA 3LCXA 1NP2A 1UZHA 2O92A 1E0UA 3QY8A 5I00A 2PRMA 2ANUA 4JCLA 4LAOA 2QZRA 4S3EA 1E6PA 3CLMA 4PCFA 4DYKA 4CNOA 1A5MC 1AW2A 1K9DA 3F2DA 4JR5A 3T4CA 1Z44A 3RLUA 2V6AA 2P50A 2VGIA 4GQGA 1JI2A 1GK8A 2P88A 4DIAA 2VDGA 3E12A 4AHQA 3FAWA 1W9UA 4RX0A 2CBJA 4HNLA 3W29A 1LG1A 3QSRA 6CGTA 2GVLA 3IVUA 2DW6A 4F9DA 1V79A 4TQTA 4C7FA 1XLBA 3OQEA 2JALA 3S6DA 2J7GA 3KOZA 2E6AA 1PIIA 1PPIA 4M6UA 1TB3A 4HZ8A 2W92A 4PMVA 1Z69A 4WOQA 5FESA 4W9TA 4HA3A 3VINA 1RSCA 4TV6A 1OQFA 1NP0A 4AEFA 4DY1A 1ONWA 2R1LA 4W7WA 4H7CA 5LNSA 2Q3OA 5BZAA 2BOGX 4JIIX 1YPIA 1HKWA 3SGUA 5T91A 4REQA 4N4QA 1JYWA 2ZZ4A 2CLIA 2OYLA 3EXSA 3GR7A 3O1NA 5JU6A 4N9CA 1OFOA 3AYTA 4HMEA 4HCLA 1K3UA 1KLZA 1F4AA 2ZE3A 5BRBA 2PFHA 1PVNA 4G7EB 2HRWA 3L0NA 3SN4A 1WQ5A 3GNOA 3BSHA 3H4XA 2C14A 5LGXA 4PCTA 2OFJA 3GKFA 4AWSA 3UJFA 1JAKA 1G94A 3KP1A 4UBPC 3T7VA 4DO5A 1YLVA 3P5ZA 1XS2A 5K9CA 3SY8A 2HTMA 4CQBA 3AMCA 1H61A 4EPBC 3CZ8A 2WB5A 2XHYA 2XM1A 3W7LA 3NM1A 4W89A 4ZR8A 2PWDA 2PODA 1M65A 2GQAA 3QEZA 1T96A 2WSRA 3VIFA 2Z26A 4IGMA 4Y9PA 1MXSA 4K2SA 5LA0A 1XYCA 3QZ6A 4JTQA 1UD2A 2HBVA 1N8IA 4IL2A 2PDUA 1LQ0A 2D24A 2QDEA 4WR3A 3OBAA 3ZJ8A 3FA4A 5D2XA 3GYCA 2F6UA 5FJTA 2I14A 4NILA 3GFYA 4H9YA 2FDMA 1PYFA 3IGXA 3PZUA 1LCOA 3H4GA 2IS7A 4WX2A 2BLEA 3VZXA 3MP4A 2IPJA 4RNHA 4PR4A 1BXCA 3MKVA 2VEFA 4LX4A 3C5QA 2RAGA 3UXAA 5CH9A 4DAFA 2QF7A 1A0CA 3FDGA 2VYOA 4AZGA 3RX2A 4ICCX 1OGBA 3LV6A 2VELA 2J25A 2R1NA 2FHCA 1XINA 5LIKX 3VU2A 3ERPA 3G1YA 2E6YA 4DWSB 2J9ZA 5LGZA 4U3CA 2E25A 1EHAA 1YTKA 1KWGA 1I45A 1SQ7A 5CC5A 3NPWA 5AYYA 3WF1A 5I09A 5A1AA 1J93A 1ML1A 4CNUA 4U2YA 4OTKA 3CUGA 1W3IA 4MDPA 4DJEC 3W7OA 1GPFA 3UWQA 1TWZA 1RZMA 3XINA 2HVNA 2WM0A 3COTA 2QULA 2IXUA 2G50A 2P3EA 2Z2BA 1X8FA 3FJLA 4OHQA 3TH6A 4JQ3A 2IQTA 5CSRA 1AODA 4OOZA 3N3MA 1C8QA 3VOGA 4LYQA 4DNHA 1PTAA 1WKDA 3PTDA 4MG4A 4PB3A 3LSCA 4X61A 2WLZA 5CZTA 1U33A 2WV8A 1EPXA 1ITXA 1XXXA 2VUYA 1PE1A 3QGVA 3WBYA 4AEEA 2P3ZA 2C91A 3QHOA 4W87A 4ADUA 2QS8A 1DIOA 5JIWA 1PTGA 3ISIX 4HU4A 1JDDA 4IIEA 5E0KA 4RDVA 1A3HA 1E72M 5A5WA 4YPJA 3P6LA 2C1HA 2EG6A 3BZGA 5MHBA 3A4AA 1MNSA 5D2TA 4LAKA 3AISA 1ITCA 5EMMA 5FEWA 1FXPA 4MOZA 1SW0A 1ECEA 1A4LA 4Q7NA 3WQOA 1YX1A 5C7VA 1HT6A 3EDFA 4JTFA 3MO7A 4UTHA 3P0WA 1JJKA 1WYIA 2DH3A 1G7UA 3EZ4A 2OWWA 3F1QA 2VGFA 3MSGA 1CNVA 3S9IA 2JE8A 1XFCA 4Q4MA 4IMGA 3GK0A 3D6NA 4RW3A 2ZDRA 3IUDA 4S3JA 5HINA 4M7SA 1A50A 3NEVA 1VFOA 1BF6A 4DEFA 1B0IA 3O8AA 1EX1A 1QCWA 4DXVA 5C7HA 2INEA 5AC4A 3WQ5A 1KM6A 4Z2JA 1FWHC 3TN6A 1OM0A 1JRCA 4JQ1A 2YYUA 4LJ3A 3LRLA 2PBGA 4FI4A 3WBXA 1AL8A 2B0MA 3NZQA 3UGRA 4UFKA 3EX6A 1P48A 3G2GA 3FOKA 5G2IA 5D02A 1E5JA 1WA3A 3GXNA 3V3WA 1JD9A 1O1ZA 3L4VA 4IIBA 1RY8A 1RA5A 5TF0A 3RM9A 4ONVA 1BQCA 5I3DA 2VZOA 3LYEA 1NDZA 2WAGA 1UPMB 1TV3A 4C91A 3SQSA 5F4SA 1EJTC 2ZYFA 4HB7A 4GI8A 3JZUA 2EPKX 2POTA 2PRLA 5HA7A 3HPXA 4PMDA 4Z1CA 2J13A 2WNNA 1A53A 2PDGA 3G8EA 2DH2A 1QR7A 1AZ1A 2Y88A 1TREA 5HMEA 3I7SA 1H7NA 4HJWA 1JR1A 3CV1A 4GG9A 3OTRA 2ZX5A 4OBRA 5HNTA 1DTUA 1TE1A 2OT1A 3ZJ7A 4E6MA 3IJ9A 4XZNX 3RFAA 4RL3A 1EDTA 2ZZ1A 1C8VA 1BYBA 1UD6A 4JFWA 2PZ0A 3W7PA 1F61A 1TV5A 2HQAA 4TVUA 3KOFA 3TYZA 4XSMA 1I2PA 1WNOA 1E6ZA 3OJGA 3CYJA 3LEPA 1DPMA 5BU6A 4KEVA 2VOTA 2WHKA 5LIUX 3WNKA 5LSMA 4E8DA 3AIUA 4IFKB 5DFAA 2WC4A 1UKQA 3PWIA 4MWAB 2TAAA 3TP4A 2EPMX 4MKSA 2EF9A 3QJAA 4C5ZA 4ZQRA 5C9RA 1XSJA 3MC5A 3ELFA 4Q8NA 1UKOA 3W86A 2QDDA 4UNLA 1EB3A 1KV8A 1TRDA 3S5OA 3UNTA 2H3BA 2OTDA 2XINA 3QV6A 1EGZA 1FBAA 5HWNA 3UA4A 5C55A 1TIMA 4WY0A 4CLMA 5JH2A 2NXHA 2HPIA 5IDIA 3GFXA 5I07A 2NVCA 5AFDA 2V38A 2CERA 1MRQA 4DJFC 1QRQA 4GVGA 4JZ5A 1FH9A 2EBNA 1D3GA 1DQXA 1S2TA 3BLFA 2I17A 5CG7A 5FEZA 3GXTA 3AIVA 1VPXA 4S2BA 2VUNA 1QNVA 3SB0A 2YCLB 4G1KA 3A12A 3WQWA 1GOOA 3LCFA 1CXLA 3FY1A 4UZSA 4ZOEA 4BFAA 3BZJA 3MDWA 2Z25A 3R79A 3F5LA 3W1AA 1UQZA 5G4EA 3ITOA 4ASTA 4GIYA 4O12A 2DT2A 2JF6A 2Z28A 1YNQA 1YE6A 3TZFA 1QWKA 4Q22A 1F6KA 4RR4A 2CYGA 4S39A 2VGGA 3TOPA 4YTSA 3QQ0A 1VEMA 1EJXC 1GJWA 1TR1A 4LV9A 1Q13A 5CPMA 3UWUA 3APYA 1ITQA 4DUXA 1W3TA 1BLIA 3VFCA 4BI6A 3T0BA 4QJ4B 3W7QA 4KKXA 3L68A 2QCMA 2UV8G 4UQCA 1A5CA 4AH7A 1W1B1 3GXMA 1R86A 3IRDA 3KEHA 2C7FA 4DYJA 1Z3NA 2VVNA 4CGTA 5FF4A 2X1RA 5CC7A 4OZOA 5AC5A 2NQZA 3EEZA 5FF7A 1AJZA 4O1DA 3QPYA 2X0YA 3A9BA 3T6CA 2QGYA 4D8LA 3SN0A 4UOQA 1R9YA 4S3DA 1XGEA 1XDJA 3LN3A 3QVQA 4C6BA 3W7JA 1F07A 1EKOA 5CGMA 1J6PA 2WPBA 3W75A 3ES8A 1UP0A 1RD5A 2IKIA 4M6QA 5CZKA 5KZEA 3DYMA 4NZ1A 1K7XA 3GC5A 3N9SA 1E40A 1ECQA 3GW0A 3B06A 1UC5A 1XBZA 1QNPA 4JKLA 3UP8A 1O68A 4N02A 2WKGA 4L4MA 4TTUA 4LS0A 1XYBA 5EYWA 3MUZ1 2Y7FA 4IQLA 1KNWA 1YKWA 2PWUA 1H2JA 4JKKA 3H12A 3S2CA 3W7DA 2PDXA 3MPGA 1KXQA 3SRDA 1XBXA 3ARRA 4POCA 4Z2HA 2Y7GA 4Q4SA 4A3HA 4LCQA 2Q6ZA 3OZPA 4JNMA 3RAOA 4AIEA 4LGXA 3KL3A 3SI9A 3LZ3A 3GE7A 1Q3NA 2WHLA 1P0EA 3MP5A 1P6CA 3QFWA 4FZIA 1DXEA 1CB7B 3ARVA 1KM3A 3ONCA 5BMXA 3P80A 4CQDA 3GDMA 3C61A 3AJ7A 4JFSA 3AMLA 3POCA 3TVAA 3WL0A 1DBTA 4DO4A 4FK9A 1F9CA 4QXIA 4I8YA 3PG8A 2L5HA 1AG1O 4BI7A 3QFEA 3ZVIA 3M7SA 4B5TA 4DI8A 2BODX 1JYNA 4WXYA 4ZO6A 1V0LA 4KRTA 4YCPA 3TC3A 1E3XA 3PZMA 4MFDA 4DPQA 3WYZA 3WNPA 2AOSA 2PPGA 4Y9NA 5DY2A 4MAZA 4JIPA 1VGAA 3M07A 4RV3A 1OIMA 1ENUA 5HPOA 4RW5A 3S9ZA 4GC4A 3T81A 2NWSA 1HL2A 1OFQA 3VGGA 1EA9C 1FHLA 1TRIA 3KL5A 4JHZA 2QJNA 4EP8C 3MUAA 4DM1A 3LBOA 1EFZA 3AIQA 5L6UA 3NJ3A 2UY2A 1XPYA 4GFSA 1D7KA 3ZWSA 1K8XA 3DDMA 2Q8LA 3W71A 1E4MM 2NT0A 3QGAC 3ITGA 5REQA 3V5CA 5BXPA 4FR1A 2X0HA 2EAWA 3U2OA 2B4GA 4LQ1A 3BG9A 1E6SM 1P4CA 3ATZA 1BGAA 2DT3A 2YIHA 4ROPA 4LVGA 1BSLA 5HQEA 2QQ6A 3H2AA 3AXMA 4GO8A 4FLRA 1GVEA 4Z42C 4MLJA 2QLYA 4TR9A 1VEOA 4B3KA 3GM8A 2NW0A 4LBRA 2WVUA 1DWAM 3REQA 1OX5A 1J5SA 4GD0A 3TKFA 3O05A 3UG8A 3WDPP 5BRPA 4Q8WA 3SCNA 4JYFA 5IOBA 5DF0A 2GSEA 3FN9A 4I6KA 1R3TA 3LHTA 1RXOB 2P53A 3OVRA 1VFHA 4ECLA 2XIQA 4JN8A 1E0VA 1FRBA 1SSDA 3LCIA 4UQAA 3QW4B 1K77A 4NKCA 3M0LA 2BZNA 4H04A 3GNNA 3T40A 5XIAA 3CL8A 1W17A 5JBDA 2ON3A 3S2MA 4H6QA 1O5RA 3KTSA 1X6LA 2GL5A 1G1YA 2W27A 1I1XA 3MV11 1H7RA 2EGZA 1BG4A 2UY3A 4C6IA 2OR2A 5DRIA 1N7KA 3PFMA 1ZALA 1H41A 3C8FA 3PZTA 1NDWA 3OZOA 2PDCA 1CLXA 1KR1A 1WB0A 3FFSA 1J6OA 3CAWA 1DJNA 1W32A 1ZRQA 3IGUA 3K13A 5E6ZA 1DL3A 2EQDA 2C0HA 3GQYA 4KFOA 3MYOA 2O9TA 3KLKA 4I9MA 4TOQA 3ABXA 3THUA 3SY5A 5CSSA 3B8DA 4CVUA 1OC6A 1EWEA 2JKEA 1F3EA 3T0CA 2DUAA 3ZR6A 1JYXA 3LNPA 1S46A 3BAYA 5D2WA 1UH3A 2EPNA 4D6HA 4YLWA 1TA3B 4WHBA 3NGJA 5M2FX 3NQMA 3ANYA 2QJIA 3PAJA 4WDUA 4DJEA 2CBIA 2Y6ZA 1QNSA 1KQZA 4WOZA 2BXZA 1FDZA 4PMJA 1V4YA 2CKRA 4BR1A 3TSBA 4MAVA 2EKCA 4A3YA 4IMCA 3SEPA 1M7XA 4H1ZA 2QDHA 4NJKA 3V1HA 1QOQA 1FVPA 1O4UA 2AAMA 2VEKA 3UJRA 1IQ8A 1RPXA 1OBAA 2HCVA 4M1RA 2PGRA 2E8YA 3GG0A 4H6RA 3WO8A 3UXLA 1A3XA 1SSGA 1MUWA 2OQYA 3VA8A 4LU0A 3TQKA 3SR7A 3FJNA 1V08A 3IJ8A 1LZOA 1S1RA 4P8UA 1BTMA 3OYZA 2XH0A 4K39A 3QPEA 3K8MA 2ZDSA 1X8CA 5U7SA 4G9PA 3DESA 2BHUA 5KITA 2AGTA 3AIRA 1C93A 5A6BA 3A4WA 3M46A 2VX6A 1ZPTA 4A3QA 1V3JA 3WLMA 1T41A 5DBTA 2JQXA 4HPGA 4YNGA 3JUGA 1B2YA 2I57A 2B31A 2BWGA 1M7JA 4ZFCA 1SVDA 4BZYA 1TO3A 3N25A 5M17A 4GVIA 1VQTA 1LWHA 3HG4A 2GGGA 3AXKA 5DMMA 1EYEA 2R1KA 3VIKA 4GKLA 4BF7A 4LT9A 2VI0A 2XWDA 2R94A 3CQJA 4L6DA 3LV5A 3CUFA 1L6SA 4LW7A 3VE9A 1XD0A 4MB1A 3BG5A 2REQA 3WK0A 1TVPA 4FXJA 4XTDA 4C6CA 3E0FA 4U2ZA 1C8XA 4K8GA 1EL3A 5G1TA 1VFSA 4LANA 2GOUA 1NAL1 4U4MA 2WQDA 5B80A 1RQEA 3V16A 3NVTA 1H7OA 4NU7A 2I5QA 1AD4A 1VIZA 3IANA 4KGJA 4KWVA 1JZ2A 2WZTA 3FIGA 4E5TA 1M68A 4DUWA 3NL6A 4WD0A 1HX0A 1H60A 4QNEA 1TZ9A 3WKZA 3MB9A 4PTNA 3OIXA 4RUBA 1W2VA 2ZICA 1JXJA 1ZNNA 4IP4A 1ZENA 3TWBA 3APGA 1B3OA 3CTLA 4LNYA 4PMZA 4R9XA 1PX8A 3A4JA 3WJWA 3AU2A 1R0MA 2ICSA 4HA1A 3B0VC 1P7TA 2QUNA 4HJFA 1NELA 4EACA 3G1RA 4EPDC 2B81A 1JCYA 1WXZA 3TFXA 3RCMA 3F4VA 1VFFA 3IGHX 4DXKA 8XIMA 1SMDA 1JAEA 3OPSA 1DWHM 2ZC1A 1H7PA 2VEGA 3PZQA 3RMEA 4P7RA 3TCEA 1QAPA 2E1WA 2GGHA 4ZTXA 1KBBA 5DMYA 5IBXC 1IEIA 3WD4A 3H8AA 1X1NA 2DQXA 3TEVA 5ENLA 4JEJA 3S8HA 1NWUA 2PWHA 1J01A 4AD4A 3MUY1 1WP6A 3ARXA 4JN6A 1EUAA 2OZ8A 3CO8A 2E4TA 3WMLA 1TMLA 4HYWA 4IM4A 3WQEA 1DE5A 4NI3A 1TPDA 1O12A 3OB8A 1RJPA 1EF2A 1V6YA 4RDWA 2YBVA 3AZTA 2WBKA 1HGWA 1V02A 4JNYA 3W38A 1AH0A 4LTSA 2YSWA 1UR8A 4R3UA 3T55A 3A22A 2VFDA 4U5KA 1ZJIA 4GZIA 4M3PA 1X39A 4X0VA 3N19B 1KCZA 1KWKA 1EBHA 3UPWA 3C52A 4IJRA 4DN1A 1CENA 5IFTA 4JYEA 1DQUA 1RBAA 3UYCA 1CGXA 2YCEA 4UQEA 1J0ZA 4HMDA 4ZB5A 4KH2A 4PYSA 4Q4KA 3WBWA 1OY0A 4XIMA 4R85A 4HCDA 1C92A 4WSHA 1CI1A 2VJXA 4R5EA 1KTCA 5JVLA 2XIMA 4PULA 3B97A 4XZ9A 3MHGA 3TJLA 2GJPA 1E1CA 2XUCA 1PCWA 4J2MA 4XZWA 4B4HA 4JQ2A 1GVYA 4MF4A 4C1KA 3F4DA 3UZZA 3N6HA 2Z27A 4DZAA 4JTHA 5LXEA 3ZMRA 1V7AA 1QXLA 1KLYA 1R3QA 1E70M 4MJ2A 2OLSA 4DJFA 4UOJA 3CWOX 4JPGA 3SCSA 5EY5A 5ABFA 2V67A 3HQNA 1MYRA 2WSQA 1X6UA 3TCSA 3WDIA 3G3MA 2PDMA 4J3VA 3HPFA 3N34A 5LHEA 3KLLA 1UR4A 3W7EA 1SJDA 2HNHA 3JS3A 4GY7A 5A8MA 4H6KA 1W3NA 5AECA 4Y96A 3Q58A 4WEVX 2E6DA 5GNZA 5REQB 4WDXA 3AO0A 2IKGA 5TBOA 3CV2A 4O16A 3HPAA 3NWRA 3VUPA 4YN5A 1XL9A 3ZFHA 3ZT7A 2ZZ7A 3P7YA 2PTWA 3BUVA 4I90A 4I9AA 9RUBA 2DT1A 3TYEA 1TV2A 3HGRA 1FP8A 3VYLA 3HM7A 1P0KA 5F4WA 4L7ZA 1FX6A 4M7TA 3UESA 3W7CA 1CBGA 4ATDA 3HG3A 1H0IA 1OFDA 1VIWA 3REQB 1OF8A 2QPXA 4Z0JA 1GYLA 1XRFA 2OPJA 2PDFA 2J4GA 1SM9A 4Q8MA 4IJCA 4GUFA 4NYUA 2VD9A 2PMQA 3ZYZA 1RAKA 3GG8A 4PA8A 4O53A 2D0GA 4E4FA 4LCRA 3O15A 3NCOA 1IT0A 3WNLA 4Z2KA 4IG2B 3WUEA 3FEMA 4JCMA 3SJNA 3IUHA 5LHFA 1B90A 2VP8A 2WSPA 1IXQA 1IEQA 3R94A 2QUUA 5DCEA 4EXQA 2FJUB 4LYKA 1DQWA 1U83A 3CUIA 3IEBA 3G0SA 5I77A 2TRSA 2VFHA 4E8GA 4QNWA 2QJGA 1EPVA 4C65A 1W9VA 3WENA 2ZQ0A 2GQ9A 4IFOA 1VYSX 3ONBA 3G6LA 1RPKA 4HOZA 4DF1A 3PC0A 2DZAA 2Z1BA 3C0LA 5A69A 5GNXA 1H62A 1DTNA 3UJSA 3W83A 1EIXA 3BLIA 3M4HA 3GTHA 1J18A 1PX3A 1V3HA 4Z2IA 4GABA 4OIFA 1O5KA 2P8CA 4RNFA 1GCYA 4G6CA 3SUUA 4LUTA 4IQJA 4XVEA 4GCAA 4AX7A 4MNJA 5FAGA 3UA3A 4KCWA 1CXHA 3UWWA 2WC3A 3IJLA 4F4RA 4PL2A 2ISWA 3XISA 2H8XA 4GC3A 4FIRA 1OGSA 1RUSA 1SJBA 3PSWA 3U9IA 2AGKA 1JD7A 3NZGA 4C60A 5FKYA 4AHPA 1GONA 2VZVA 2GWNA 2G8ZA 1GG1A 2VENA 2V5CA 3THQA 1Z89A 1CX9A 3DIPA 2OYKA 1JXKA 4HPXA 3BG3A 5A6MA 5FACA 4WGHA 5CZJA 2NXIA 4UTUA 5DT7A 2CXGA 1JCTA 1SMAA 1FCUA 1SR9A 5A6AA 3WNNA 1UJPA 3DG7A 4Q33A 5BROA 3PANA 1S3HA 3CZKA 2J6VA 5JUVA 2DT0A 3K4AA 2G41A 3V35A 4NASA 3CS2A 1MSSA 3KTXA 4L5ZA 3G0UA 1B31A 1FWWA 3PUGA 5TQLA 2QKFA 2PDKA 3SCRA 1TPH1 3W28A 3DYOA 3IK4A 5AC7A 2GOKA 4JYDA 2Y8VA 4R53A 1EJRC 5FJPA 3M5YA 1XLDA 2XGZA 3N17A 3ICJA 1VJZA 3VKAA 3HGJA 2ABBA 4PZVA 3NPUA 5D2VA 3W73A 4OBSA 3MZNA 4IMAA 2CETA 3LU2A 2O4MA 1AA1B 1J0KA 4S1FA 1H4PA 1WDPA 2XIJA 4QEHA 1EJUC 4CQCA 1TKKA 4PMOA 2WNQA 3BICA 2BVWA 5C71A 2FTYA 3OGVA 5DMLA 1UWUA 3W70A 1RCQA 4BCEA 3HV9A 3PJTA 1W3JA 2ZA2A 4Y9OA 4QS6A 1VEPA 1KTNA 3NO3A 4JHMA 1VYRA 5HNUA 3WK1A 4OGZA 3CL6A 1OFEA 3WH6A 3UG5A 5HR7A 5A8GA 1E1EA 2PLKA 5IXEA 3NOEA 2DVXA 3LXAA 4G5DA 4L4PA 2W4XA 3O0KA 2OSXA 3S2JA 4GA8A 4ZL1A 4KBXA 4GZJA 2HK1A 1UCWA 2OLAA 1GHSA 3PJUA 4KESA 1B1YA 2HXUA 4AD1A 4JX4A 1ZBVA 4PUKA 4C6DA 3LCLA 3WBEA 5ABHA 1EC7A 3LPGA 3KBVA 1V0MA 1OFAA 4DBWA 3F4WA 4HMNA 4HSNA 3WJYA 2P0IA 4KWOA 2DVTA 2CHOA 3TX9A 3T0AA 4H7ZA 2VO5A 5CAHA 1P7TB 2VXNA 2DZPA 1UW9A 2QUTA 4MFEA 5CPLA 4E4PA 4ZOAA 1HVQA 4GK8A 4XAFA 4E0CA 2WKJA 3PZIA 1N55A 2W67A 2FFIA 3W82A 1ZTVA 3K4DA 3W07A 1K8ZA 2B7OA 3LGEA 1I0BA 3PB0A 1UD4A 3RU6A 3TSDA 4HU8A 3AYRA 1DWIM 4TV5A 4HTYA 4S23A 3C0QA 1O94A 1T6MA 3W0KA 3BLKA 2O7SA 4JTJA 1JCMP 1G67A 3K1GA 3UXDA 3U48A 3AMKA 2R9RA 3LI0A 1BF2A 1NM9A 1EO5A 4CN4A 1W8GA 4AIBA 2ACQA 4JIQA 1UWSA 4R33A 3QR0A 3ZVHB 3VUSA 2ZRZA 4MWAD 4PEEA 1GTEA 1KFBA 4JX5A 3A64A 5IDZA 1IXNA 5F2IA 3T9PA 5FJIA 1EUNA 5D9OA 2VWTA 3ZXWA 3KBSA 4GPNA 1G7VA 4G56A 5D30A 3NNTA 1PYMA 3UZYA 1TJRA 1UUOA 2BVTA 2DZSA 3FHQA 3OA5A 7TAAA 1R47A 3VILA 3EMCA 3LHYA 1YEYA 4JXCA 3P62A 1I0DA 1MVYA 2I5GA 2PDWA 1ZP3A 5H1WA 1KD0A 2BY0A 3LZ5A 3MYPA 2QCHA 3MZ2A 2TYSA 5FA5A 2GJNA 1IF2A 1VRDA 3DGRA 1BXNA 1PDZA 3BURA 1WZKA 2YBTA 4XISA 1JYVA 2WZHA 1DIDA 3HQPA 3EA3A 1UP2A 3LK6A 2PA6A 4C90A 3ANVA 1M6JA 3PULA 3LLDA 4IFRA 4F0SA 1B3XA 4TMBA 4MHBA 4X2PA 2C15A 2V63A 1E1CB 4V28A 2RH9A 1AVAA 2CLHA 2ZWZA 5LA1A 1FXQA 1NOWA 1V3IA 1OSEA 3EPNA 1ISYA 3QYSA 5CGQA 4O1AA 1YPXA 4QSFA 2WZIA 3L65A 1W37A 2W66A 2VEIA 3B3DA 2W61A 1TWWA 5ABTA 1U2YA 2ZKMX 2I1OA 4RNIA 4ZXOA 4LC6A 1QW8A 3NSXA 1T7LA 2OZ0A 1P5BA 3WMBA 2XN1A 1IYXA 1JDAA 1Q8JA 3M0IA 1NARA 2G96A 1IT8A 3W00A 1V6VA 5M3WA 1UR9A 1QUMA 3EWCA 5CJMA 1A47A 1BYDA 4DBEA 3DHPA 3HN3A 3E2QA 4KRUA 4F40A 1OFBA 2WHJA 4PFHA 4DYEA 4AB4A 1LQ2A 2OCZA 4XAGA 4BA0A 2OX4A 2E7FA 4A4AA 1IWAA 4IQEA 4HNOA 4TO8A 4EF8A 1QPRA 1EQCA 1ZU8A 4IP5A 2CIPA 3VDCA 1T40A 3U2ZA 1MXDA 1QI0A 2WJEA 2BGSA 5CZ0A 3AFBA 1JUKA 1T8XA 3S4TA 3A3HA 3WNOA 4DUVA 3K2GA 3GYEA 5A6LA 2YDRA 2VDIA 3VCNA 6TAAA 2V3EA 3WCZA 1PXGA 2XJ7A 4PTWA 3WLIA 1A5LC 3S1GA 3HV8A 2A3AA 3PN8A 2DJLA 3GW3A 2GFTA 2GK1A 1VKFA 5IBXA 3MMTA 3WUGA 1GORA 5BOOA 3VNIA 3UW6A 2XH4A 4C6KA 1UD3A 3VXGA 4H00A 1E3ZA 1OVDA 1XLIA 2CLMA 5CGTA 5ECUA 4C6EA 4JTTA 1EA0A 5K9XA 1WX0A 4GYPC 1T0OA 3TZNA 2DZBA 2VZSA 3W74A 1LT8A 1QI5A 4BWLC 4NZCA 4GO9A 4AIUA 1FA2A 1WDDA 4XTIA 3CHVA 5IHSA 4EK7A 1REQA 1W9DM 1AMYA 3FYOA 3GXPA 4RZ6A 1EJVC 3A9IA 4LSBA 4C6NA 2ADAA 3PTKA 1Q7ZA 2A3EA 3PJWA 3R8GA 2DSZA 3URBA 2BBFA 3UZJA 3QM3A 3N4FA 1A5NC 1R85A 1EH9A 1PWMA 1V0NA 1W5PA 2XTKA 3TR2A 1X7IA 2J7CA 1JNEA 1YMYA 4XAZA 1HVXA 3ENLA 2PDBA 1PS9A 3A5FA 3BV4A 4ADTA 3PG9A 4BS0A 3NQVA 1KGXA 3A47A 4LUTB 1JDEA 5A6SA 1DV7A 1VAHA 2YDAA 4PMXA 2Y0FA 4HBKA 3KOXA 5EMLA 2GJXA 3N1AA 1BYAA 2J7DA 3L7RA 2GVJA 4ICNA 5CBIA 1KKOA 3FGCB 4IOTA 3N2OA 1L6WA 3BK0A 1H09A 4NF7A 2CU0A 4D6FA 3O6YX 1ICQA 3BGJA 5A2BA 1YDOA 2Y4SA 2BXVA 4WSJA 4N9BA 3UNDA 4NL1A 1KBKA 1QASA 4WJXA 4IGSA 4M29A 1EOKA 4LF1A 3DOPA 1QNRA 5EA9A 5LNVA 1H7WA 3GH7A 4I9TA 2DSUA 2I56A 3AU6A 5E93A 5E1QA 2GSJA 4MNMA 3N3TA 4TXEA 2WOQA 3WF2A 5FEPA 1ZLPA 3E96A 2MANA 1HNYA 1GOKA 1CLVA 4V27A 4B91A 1AW1A 2WMKA 1VBHA 4GUGA 4RXGA 1W1ZA 2GVGA 5JMUA 2I16A 5F1UA 5BOEA 3AHYA 3NDYA 3DZ1A 2FMNA 3BLPX 3MU7A 1PZ1A 3E0VA 2VCCA 5HDRA 3WMSA 1EJSC 3EWYA 4XBSA 3QY7A 3U7BA 4KWUA 4XAPA 3VZZA 3QHMA 3WJZA 2GVYA 3TA9A 3SCWA 1Q4NX 2A3LA 2BMBA 1ZAJA 4B3ZA 1FCQA 1O95A 1HO4A 2ZCGA 2HEJA 3W7NA 1DJYA 1MWOA 2A1YA 1P1XA 2Y1HA 2YKKA 4DLFA 1XLJA 2A2IA 4ZVJA 1QNQA 1TWIA 2HISA 3BQ5A 5CSYA 1KKRA 4H19A 5FL1A 1ZAHA 1LRNA 2V82A 2ZX6A 3L5AA 2DZXA 2A7RA 1HXJA 4Y8EA 1Q6RA 4HQVA 2FGZA 3FLUA 5FOOA 1UH4A 3C4UA 2VHLA 4M56A 4LY4A 3O07A 4RE4A 3ZO9A 1W3HA 2OELA 3QRHA 3LHVA 2IPWA 4D6IA 4UCFA 3GBDA 1XYMA 3QOMA 1XG3A 3DI0A 4H9VA 3H2EA 2CPUA 1NFPA 1TR9A 3EKZA 4Z2LA 3KDNA 2BOEX 5DLCA 2PD9A 4NUWA 1LUCA 4QCEA 4XZBA 3ARYA 5D2YA 4PUWA 2PDYA 2XFWA 5AHFA 3ARUA 1ONRA 3FVMA 2H6RA 2CHRA 2BSLA 2ODOA 4ZXLA 3A21A 2POZA 5BWAA 4GIEA 2X7VA 4YHGA 3ZWTA 3TJIA 1S38A 3KRZA 4QCFA 3GUGA 4WRHA 1FOBA 1QMLA 2PDHA 3W1LA 5J5RA 4M82A 3H4WA 3WDRA 3DHUA 1BRLB 3SW6A 1K4GA 2BDQA 3W72A 5GJMA 4ORMA 4YCOA 3PP7A 2GDVA 3HJZA 2EJ1A 4O57A 4MYAA 4WK9A 4DXXA 4HPHA 1VFMA 1GUVA 1LOSA 3S3GA 4CD4A 1NF0A 1NOUA 5FSEC 4O8AA 5AKQA 2GVEA 1M53A 4HT3A 3BAJA 4PUMA 1DIKA 4HNNA 4B3LA 4OJYA 2AAAA 1QVBA 2A3BA 1EHNA 4N2YA 1FWRA 3A3WA 2ZXAA 1CCWB 1F5ZA 2C0AA 4HOWA 2V69A 1E5NA 3EDEA 3R1ZA 4UUIA 4JBRA 4AVFA 1F2JA 4NJIA 4TIMA 3SFWA 1UZ4A 4FX7A 3ZT5A 4GIAA 1R7AA 2EKGA 3VO0A 3VNKA 2EPHA 4HSHA 5HNNA 4UR8A 4MKVA 3ZM8A 1EGVA 4PC8A 3LCWA 1CB2A 3SBFA 3R58A 1MQPA 4MNLA 4Y2WA 1K4HA 3NQ2A 1YNPA 3B8UA 3DFPA 4JNZA 3WJSA 1NWSA 5I3FA 4LS1A 1W56A 4ZBCA 2G3FA 2JBMA 1Z42A 3FW6A 3G18A 3UG4A 1V3KA 1Y65A 4RZ5A 1X38A 4FOKA 1UROA 3MUXA 3CQHA 3OP2A 5AVHA 5I3GA 1I75A 1XYLA 3GNXA 3H26A 1H1ZA 4WXZA 3GU2A 3L9CA 4Z17A 5BXTA 2V5DA 3ZJKA 1OCJA 4ZQOA 2OO0A 2O9RA 3DG6A 2DSWA 3G1HA 2VT0A 2G4JA 4CCEA 3E2RA 4A6GA 3KM8A 1BQGA 2CXEA 4QS5A 1AQMA 3M0JA 4XV0A 1RV8A 1SJAA 2I5IA 3KZPA 4BHYA 2NSOA 4ADSA 3VKCA 1XCFA 2OVLA 1W6TA 1OC7A 1W5MA 4OFCA 3DFHA 4M51A 4YU1A 1V6XA 1R8LA 4BQ5A 3MJYA 3UWZA 4JTIA 3CUJA 4AUBA 4DBDA 3IIXA 3UJ2A 5F7UA 2VC9A 8RUCA 1UG6A 1FP9A 4NP7A 3HO8A 1LOQA 3NQDA 1AFSA 4KWWA 1J0HA 4I7UA 1I2RA 3EA2A 4FX8A 4PBFA 1K9EA 3UVIA 2AQVA 3F2BA 1W3KA 1PAMA 2CKSA 3P93A 1EP1A 3OBKA 1IGSA 4FXSA 1SR0A 1UIPA 1XRSA 4AZIA 1LYXA 1C8YA 3VGHA 1GKPA 4ZSTA 3WIJA 5A8QA 1M7PA 3VFLA 4KCTA 6ENLA 4WDWA 2HS6A 4Q6XA 4N9EA 3MP3A 2F7FA 4FXFA 5JBFA 1HKVA 1Y5VA 2TMDA 3PM6A 3UXIA 4GNJA 3W88A 4AD5A 3LPOA 3OGSA 3KWSA 3FEQA 3OVPA 2ISFA 4JDBA 3VMPA 3WELA 3AHZA 3EWDA 1E6RA 4JS3A 2DDXA 3G3DA 1ZAIA 4F0MA 4DJDD 4M80A 4FAMA 3NM3A 1W31A 3BC9A 4WSKA 1B9ZA 1MDRA 1NY1A 1VLIA 2GK1B 3CH0A 4ZOBA 4QG9A 2ISSA 4DPPA 5XIMA 3LNMA 1VHNA 2PF0A 3MSYA 3UZXA 5H91A 2V3DA 3ZT6A 3CIWA 3HOJA 1QK2A 2O9OA 2DJXA 3KZSA 2F9RA 4QDPA 2A5HA 5DX7A 3L67A 5GJPA 5LNUA 2QIWA 4XZLX 1G4TA 1PHWA 3BTNA 3K4WA 1XWYA 2WJZA 2C1GA 3RHGA 2XDFA 1REQB 3WFZA 3WUFA 1YW1A 2P76A 5HMSA 1KFKA 2OQHA 3BJSA 2HROA 3RR1A 2Y5SA 4GY1A 1QTWA 1V8EA 3MA8A 3N6JA 1EJWC 3WLNA 1QFEA 4Y7EA 3NR0A 3O16A 3CL7A 2OMAA 4ZSUA 4LEQA 1L6FA 2EO7A 1Y0EA 3DN5A 5AZ0A 4GH3A 4C6FA 3EWUA 4HZ7A 1JFHA 1Z8AA 4MLRA 3NL5A 4O50A 2X1TA 3SCTA 3N04A 3WZ0E 1NIUA 3NVDA 2GJXB 1WDRA 2G0WA 4N6EA 4F2UA 1W5QA 4YXGA 2GGIA 2H9AA 3NZRA 3E3HA 3DGBA 2Q02A 5KSWA 1JZ6A 3KRSA 4HIBA 2HPMA 3WFLA 1ZJHA 5EKYA 4HNVA 2TPSA 5DCBA 5LIXX 3EXTA 4DB7A 3GDKA 4HTBA 5HBFA 3CLWA 4QDWA 3KBWA 1EX5A 3TYBA 4W4QA 1ISZA 1KBIA 3IVTA 2FB3A 2W0UA 3QSTA 2JKPA 4XSLA 3U4AA 4XAYA 3D0CA 3NQAA 8CGTA 4UQBA 3UPMA 4FNSA 1XDMA 3V0UA 3L4YA 3W23A 1LROA 5E0FA 3GDTA 3N4AA 4LFYA 3TQVA 1A0EA 4MYXA 5HJLA 4JX6A 1GZGA 4B92A 3PZNA 4HNTA 3VOIA 4OV4A 4WJEA 1XRVA 3EDJA 4GXPA 3DEQA 3TN5A 3KBMA 3L0KA 1EOMA 1HIZA 3M0VA 3KP0A 3T8QA 2XIBA 4DM2A 2Z1XA 1E1FA 5A6KA 4DELA 1QBBA 3B04A 3SUVA 4S3FA 2NUWA 3RCNA 1VPQA 1XKYA 1GW9A 4JFTA 2A21A 1KM5A 4NAFA 3S1XA 1UZ1A 4C1NA 4PUDA 4UQDA 3WQGA 1XH2A 4WGXA 2D3LA 4DHGA 1E9YB 4E38A 3NIYA 3YPIA 1ME7A 4TUFA 4Q8TA 1HGYA 3PZVA 1M04A 4UFLA 2XU2A 2A6NA 1H7XA 1I2NA 4JKMA 4KPLA 5CJNA 1UH2A 1XM3A 1WDSA 1UKPA 4GHRA 2FZMA 1VBRA 5TIMA 4GYPA 3CEPA 1CW2A 4BF5A 2W6RA 3BJTA 4PMYA 4BWLA 1OCQA 3HPZA 3I65A 1RJRA 3W24A 3ORWA 1QPQA 3TJXA 2O55A 1X7FA 4DUOA 4TX9A 1TCMA 5K7JA 4IT1A 2QCFA 3J7HA 1R5YA 2VURA 1IXOA 3LTPA 2G3NA 5CBBA 3D47A 3FS2A 4TMCA 1UZDA 2NSXA 1GVFA 1TTIA 4ERIA 1GHRA 1FHDA 7REQA 2FZNA 3K30A 1Q66A 4QAWA 3KRUA 4MB3A 3GU1A 4I5RA 3W37A 4YYFA 3A23A 8XIAA 4OUEA 2KX9A 4Z0SA 1L6GA 1LBLA 2YW4A 4HSOA 3HPSA 1QI4A 3C0SA 3TU9A 4RZ4A 2CZVA 4XBKA 3SM0A 1A5AA 4MY1A 3NG3A 1EO7A 1ICPA 3D5HA 3C2VA 1Q4WA 3WLKX 1XC6A 3S6TA 3S5ZA 1IWPA 3VGFA 1WUEA 1AJ0A 2E77A 2GPTA 3UR2A 4H9ZA 2F38A 3ARZA 4HPJA 7PTDA 3HIJA 5ECVA 1X1ZA 5AC8A 1BKSA 1TELA 3R0UA 1EZWA 5AHLA 4LUJA 4ACZA 3STGA 1XPGA 2CZFA 3L4TA 4LB4A 3BARA 4KRZA 1BKHA 1XLLA 3GHUA 1HP5A 3C0JA 4C6OA 3H6OA 1QOXA 1DKWA 1SFTA 2YCKX 1IR2A 1TTQA 2RDXA 3F03K 2YZRA 2GJRA 2XH2A 1XIMA 3LTYA 1LL6A 1PZ0A 3Q45A 4H8VA 4NJJA 1SFSA 3BSGA 3CM4A 1H50A 4IXXA 3M5XA 5C70A 2NX1A 4DVOA 2FLIA 2D20A 3GIYA 4O1FA 5FI8A 2Q71A 1RQHA 2X2YA 1HJXA 3SGZA 3UF9A 4AZ7A 1AD1A 3OZYA 1XLCA 3OZMA 5F2LA 3TJ4A 4HU0A 3LCGA 3V0TA 2BGQA 4A21A 2WWCA 1Z48A 1YBQA 1ADDA 1JCLA 1AH3A 3LOTA 3KOYA 4PUUA 3O2LA 1OWQA 3SUTA 1FWJC 4CU8A 3M0KA 5J04A 4Q4QA 3R89A 4D9PA 4UTKA 4FHAA 3EOSA 4CD6A 2E5BA 4U28A 3GIPA 4B2DD 3E1F1 3WD1A 4XUYA 1W9BM 4MZYA 4IUGA 3VKJA 1I1WA 2E1DA 4GI9A 3P14A 3S0CA 3VC6A 4CD8A 2JIEA 3DAQA 3U5YA 5BOFA 3TTSA 3PPHA 1G01A 1I6NA 1OG6A 4Q3MA 5A2AA 3SRHA 3S1UA 1GOXA 1QHPA 1QHZA 1K02A 3CUHA 3NGFA 1B54A 5CC6A 1IZKA 1SZEA 3VD9A 4ZE4A 4S3BA 3V18A 2E40A 4BK9A 2XGBA 3W9ZA 4AMCA 1YTDA 3BMVA 4QG6A 4GYFA 3KW3A 5AHEA 4UTTA 3G6MA 4JL1A 1O60A 1X6NA 5DO8A 1FWDC 1J79A 4GISA 3I68A 4UC5A 5C9XA 2ZXDA 1HKKA 4XKYA 5BWFA 4MGGA 2PTZA 4UTIA 4B9ZA 1F3TA 1JGIA 5FJOA 4ZO7A 2INZA 3GTNA 2VEPA 5CPOA 4L64A 2CLFA 4KFPA 4J3TA 3UCQA 2HZGA 3QHNA 3N12A 1KRCC 2PDLA 4W7VA 4NVTA 3TTYA 2CFFA 3CK5A 1IWBA 4GLEA 3CMFA 2BASA 3STEA 1JF5A 1TPFA 1PB0A 3GZAA 4W88A 3AZRA 4LPCA 2J8FA 3N15A 3HTWA 5M1TA 3S42A 2QIIA 5F2GA 1S5VA 3N9RA 2XSAA 3W2JA 3HFYA 1QW9A 2XFFA 2ZZ3A 3RX3A 2J9XA 1R87A 2WO5A 2RFGA 2BVDA 4GYKA 3AMDA 1EEPA 1E9IA 3RLGA 3T09A 3GDBA 1H11A 2GZXA 1EXBA 4YTUA 4K6AA 2ZUNA 3CMJA 3PZOA 3EB2A 1M1BA 2GGEA 3DBNA 3Q4DA 3AXXA 3CBWA 6REQA 3SZ8A 5ABEA 1UR2A 2CWXA 1UC4A 1K8CA 1YDYA 3CC1A 3DG3A 3AROA 4M19A 1JQVA 4QEEA 4JEQA 3I6RA 3T05A 1JPKA 1W2PA 5C2XA 5PTDA 1EYWA 2YCIX 3IIOA 5E6YA 1MFUA 4KETA 4QQUA 3MCNA 4NRSA 3RJXA 2CHNA 4LAUA 3OYXA 4GMEA 2Z7GA 2WNWA 1MO0A 3U6WA 1OK4A 4ES4A 1LF1A 4LOCA 1EC9A 2E9LA 3RIKA 4MWAC 4EPEC 3GU9A 2YBUA 5I3HA 3WQ4A 5KTLA 1SGJA 3M5VA 2DV0A 4JTDA 1H63A 4PCNA 1KR0A 4Z1BA 1JUEA 4MUPA 3TXZA 1HJVA 3HG2A 4C7GA 4H9XA 3R11A 2VC6A 3QR3A 2D0HA 3F5JA 1U30A 1F4HA 3H2CA 4QAIA 2J6XA 2WMGA 2XGIA 3Q2DA 5CSUA 1D7FA 2UY4A 4JTAA 3N2TA 2Z29A 2PI6A 1OG0A 4J3SA 1RHCA 1V93A 2O9PA 3CU2A 4P2VA 2Z6IA 4B5NA 3DFQA 1E73M 4AVOA 1N2VA 3PUEA 3WH5A 4F2TA 1LORA 2VVSA 3W3OA 7A3HA 5E09A 2ZFAA 1RCXB 2QUMA 4O1CA 2FDSA 1EQPA 3RO8A 3BCJA 1EP3A 2VRQA 1W1A1 3T1GA 3B0UX 1OX4A 1HZYA 2QYGA 3QZEA 1NSJA 4DI9A 1YQ2A 3MHFA 3AIEA 3W2NA 2WZMA 1VBUA 3LB0A 3V7PA 4QP0A 1Q6DA 3MKKA 3R0DA 3URNA 1CIUA 3IACA 4IIDA 1W5NA 3VIHA 3DC0A 3B8SA 4UTJA 3DFOA 1C7TA 3M0HA 4Y6GA 1X96A 2OEMA 4GNVA 1M3UA 4HK5A 4C6MA 4PSRA 1XIHA 3VOCA 4TU1A 2OSYA 3THCA 1KO0A 3T4WA 4NAFB 3WLSA 3WLLA 5EPDA 3L0GA 1Z41A 4OECA 3IIZA 3RK8A 3IJIA 4W8AA 3VTRA 1J0IA 4PB5A 4O4WA 5G5IA 2E9BA 2A4AA 2KAUC 3N9KA 2R82A 3HF3A 3GC4A 2PWVA 3C6CA 2ZZ6A 5CPSA 3QV8A 2V81A 4R7OA 2XWEA 3OOQA 3B0XA 1CGVA 4GJIA 3NSNA 1JG9A 1N8WA 3P8JA 3IIPA 5CZSA 2NXGA 2NX9A 3QBUA 3W53A 1NOFA 4LUSA 2NQ9A 2CLLA 1L2UA 3GH5A 5H8MA 1YHTA 1DYSA 3FVDA 1THFD 4O1EA 3R8RA 3F2CA 2CLKA 4CN1A 4BKNA 4MSSA 1HKIA 1EIBA 1V6TA 4MY9A 1QPNA 2PLMA 3B8TA 3TYAA 3CPUA 2WMIA 1LDCA 3TYCA 4NX0A 3RU8X 3MVIA 3QKEA 2IKHA 1PKYA 4EIVA 5KEZA 4KEMA 2QR6A 3PFRA 4HA4A 1LT7A 1OIFA 3VDGA 3R7MA 3FA3A 1RR2A 3H2NA 1BVZA 3PPFA 5B7YA 2CWNA 4QR6A 4WKFA 1JF6A 4DAIA 3M0XA 2XN2A 4Q7IA 3M64A 4O17A 4QJ3B 4ZO9A 3I10A 2QF8A 3ECQA 3JRKA 3AUJA 2W3ZA 3I4KA 3ARWA 3ZSTA 1XV8A 5KZMA 2Q3RA 3EGJA 5HULA 3O3RA 3GS6A 1OZMA 1K6AA 1I9CB 3T08A 1D2KA 4U3AA 2EJAA 2ZA3A 5CQ1A 4GXWA 4IGNA 4REQB 2VQUA 3CQIA 3P82A 4CCZA 3HZ3A 1C9WA 4US6A 2J8TA 3WBAA 3AIBA 3AWNA 1XI3A 3CO4A 3D3AA 2PWFA 1DJZA 1SPQA 3DC8A 2E5CA 4E3TA 2NV9A 1H51A 5DELA 2HWGA 4IX0A 1YDNA 4PL1A 1EP2A 1HKJA 4YWSA 1UMYA 2DP3A 1AQ0A 4O13A 2PU0A 1OCBA 4NJHA 3B9OA 1PCKA 1YBQB 1DP0A 1TFVA 3M1ZA 3QY6A 1FKWA 4GUJA 4HOXA 2YR1A 1KCXA 1BXBA 3I7RA 3G24A 2DQWA 3PSVA 3T44A 4KIRA 4J3UA 1MZRA 3ARPA 2O7QA 4AZ6A 1UUMA 2NLYA 2PP1A 1PBGA 2F2KA 4G7EA 2D2OA 4QIUA 4FF7A 1VJSA 4EWJA 1MEHA 4XX6A 3VX1A 2DPEA 1LQAA 4FSAA 1K9FA 2VR2A 4J3ZA 3USZA 3GXFA 5SWUA 2E5DA 3QMSA 1DJWA 4ML4A 5C5YA 3IVSA 2OOGA 1PZ2A 5D8WA 1P1MA 1W1TA 2HNEA 1CYGA 1VP5A 2YXXA 3PPGA 3A3XA 3TNBA 4PEKA 2I9EA 2VMFA 2WC7A 4GNKB 1FTXA 3WL1A 3T42A 3EX2A 2E8ZA 2BHYA 3U8GA 5HJYA 3CZLA 2PLJA 4B5XA 9XIMA 3GHTA 3SECA 5E5CA 3ABQA 4US5A 1IEWA 2R8WA 2A7NA 2OO6A 1KRAC 3KVMA 3EOUA 4XKYB 3CYVA 1HN1A 1E9ZB 1EZ2A 1QK0A 4J40A 5KETA 2GSHA 1GQNA 2ZUUA 2C1IA 1EBGA 3WD3A 3NSMA 3PPCA 5HOSA 3FXYA 5G2WA 1F6PA 5E9XA 2J75A 2DGAA 3WNMA 1TX2A 2ZVRA 2O4QA 1AK5A 3TW6A 2VD8A 3QPZA 1V03A 1ZQ5A 5F1VA 1ITUA 4LUYA 2E28A 1OF6A 2J9YA 1TZ7A 2Y61A 2YB4A 8TIMA 2QGHA 3KS6A 1NQKA 2Z1KA 3Q65A 3RR4A 2CBUA 1OK6A 4RV8A 5FF2A 2RDUA 3S2NA 3VPLA 3KVLA 1YXDA 3MQTA 4QFUA 4FLSA 3WX7A 3ITTA 3L2MA 5K2ZA 3PUDA 2X09A 2QW5A 3G1VA 3VX0A 3VIJA 1MW2A 4GBUA 4W5UA 1RVGA 3S6OA 1TV7A 1PKNA 1GG0A 1GQJA 3GH4A 1FWCC 2H8ZA 4X63A 1VF8A 4O18A 4QM1A 2R1PA 3BJFA 3VIIA 3PBMA 4GUIA 3BAKA 4J5NA 2VFGA 4L9ZA 3SIMA 1GVQA 3BO9A 1QDSA 3M0ZA 2H3DA 1BGGA 4GVFA 4W7UA 4L65A 4X9SA 3S47A 4B90A 3K8KA 3GRIA 2NVAA 2XIOA 1W5OA 3PK7A 2EPLX 4UMBA 3EXRA 4NG3A 4J4KA 5I23A 2OG9A 3PS7A 4IL0A 4O28A 4XUGA 3AC0A 5FEXA 1Q2RA 2QXWA 3MSDA 3W1PA 1XSKA 5CLWA 1XH1A 4NIRA 4K8HA 1S5TA 2PUZA 3ID7A 2X7WA 4J35A 4H8HA 3W7KA 3W2UA 1E6QM 1S5NA 1BHGA 1F3XA 5HQLA 4QX4A 1XYZA 2XSXA 4KERA 4NNBA 4AMAA 5H6HA 5FJJA 4E2OA 3W84A 3I6TA 1TQJA 4FLOA 1NTHA 2TODA 1SO4A 4Q8VA 3QTPA 7ODCA 3T2QA 1ZJBA 3WH8A 3AALA 1LG2A 5HK4A 3TMLA 4UFHA 1XYFA 3SADA 1GOMA 4KW2A 3NFUA 4R88A 3VNMA 5JQ9A 4AC7C 3SCVA 1IT7A 4WIWA 4C6PA 1G4PA 3HB9A 5T26A 2BX7A 3SGGA 3NA8A 3RNDA 3TLQA 1RD6A 2NQ5A 2HXTA 4YYCA 2FGLA 3GC2A 1C9DA 4AZHA 2BXYA 2NUYA 3TMQA 1AZ2A 2QCDA 1GQKA 3K46A 3O6CA 3OODA 2YA0A 4H7VA 4EXBA 5T9CE 1FWBC 1POJA 2ZRWA 2XYLA 2EXOA 1Q2SA 4JAWA 3CHFA 4JGDA 3B4YA 5H8UA 1R3VA 3SSJA 4F0RA 1GYNA 2OEKA 3K8LA 2CC0A 4AYGA 1JNDA 3APTA 3URAA 1UASA 1RVKA 4AWEA 1KGWA 4HKPA 1ZJAA 4A8IA 4A8RA 4U33A 3MKCA 2B7QA 3H23A 4FA3A 3QTGA 1HJSA 3VDBA 4L1XA 3VOHA 1V51A 2FZ8A 1GOQA 2ISVA 2P5NA 2EG8A 1OEPA 1TCDA 3PHAA 4PTDA 4J1OA 2ZX8A 1CXIA 4HHLA 4AZCA 1RBOB 3EX1A 4O11A 4YVVA 4HZ6A 4L4LA 1VLWA 5AHIA 5GQBA 3BGGA 3R13A 3CZEA 3GBEA 6PTDA 1CGWA 3P84A 4ALDA 4AD2A 8A3HA 4W8LA 4K37A 4CNTA 4P5UA 7TIMA 2EG7A 4NXSA 1TPWA 1ZBKA 4LUSB 2IPFA 1JGMA 3EWWA 3GSMA 3INPA 3TDFA 2J7BA 1XIBA 3I3EA 4CUCA 4XQ6A 4NHVA 1U1UA 1MW1A 4CN6A 1US0A 3VM7A 2FPVA 2BG5A 2WXDM 4DJDC 3GAYA 3TN3A 4XB3A 3LM3A 3VI2A 2Y7DA 1KXTA 1IIGA 4UTMA 4HVXA 5LKYA 3QGKC 3ALFA 3HGSA 2OB3A 2Z1SA 1EDGA 3L4XA 4F2BA 1V77A 5EMUA 3W1NA 4DZ5A 1CXFA 1W8SA 3W2MA 1ISWA 2Y63A 4G2DA 3RPTA 1S2AA 1YPFA 2XVNA 1FWGC 4LYPA 3S2LA 1YTEA 4LV4A 5FF3A 1G0CA 5K4ZA 3UBPC 4D2JA 1WZAA 5K4XA 5CC3A 1XRTA 4WY0B 4MWAA 1WUFA 5E70A 6XIAA 4S3AA 3DFNA 3CAKA 5IHRA 4QJ5B 1L2QA 2BVYA 3DKLA 4QLKA 5GJNA 4J7RA 3DENA