4RCXA

Trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant) loop 3 deletion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTTVPMIKSFGIEWTILGHSERRDFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Trichomonas vaginalis triosephosphate isomerase loop 3 deletion protein
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 82
structure length 235
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rcxA00
2C15A 4UTWA 3CPRA 3GB6A 3HGRA 5EY5A 2QJIA 3NQ2A 1SR9A 4R33A 5CZ0A 4CQAA 4JN6A 3DAQA 4X2RA 3DH7A 3DENA 3WK2A 4JYEA 1TPH1 1TV5A 2H8XA 4LS2A 1EUAA 1QO5A 1AW1A 1F74A 3FLUA 4IWWA 5U7SA 3HB9A 2HTMA 3WJWA 4DBDA 1KFKA 3HBLA 3FEMA 4R53A 4KFPA 3INPA 2HS6A 3IV3A 3LTYA 1R30A 5FI8A 1Q6QA 3M5VA 3QW3A 1VRDA 3S5OA 3BLEA 2W79A 3PG9A 4MFEA 3PG8A 3DFOA 4JTSA 4DO5A 2QCFA 1IXNA 4XQ6A 3NZ1A 4O8RA 2NV2A 1K8XA 1OFAA 2B0MA 2RDWA 2FLIA 4UTMA 3R12A 3JS3A 3MI3A 4RK8A 3SW6A 3GR8A 3LXAA 1TPC1 4ADUA 3M0ZA 4MUZA 1NSJA 1WOBA 2CLHA 4TIMA 1YDNA 2I9EA 5D38A 3TDFA 3STFA 2QEZA 3LCIA 5D09A 3W2JA 2X2GA 4POCA 3A9IA 3IIZA 3CC1A 4NZJA 3LBCA 5CPMA 3TAOA 4WY0A 4LTSA 3M44A 1JRBA 1KW1A 1Z44A 3RNDA 2D73A 3HQ1A 3MUXA 3TFCA 1J4EA 2GPTA 3MYOA 5HMSA 1OFPA 2Q8LA 4QM1A 4BF9A 5IBXC 4L4MA 1AW5A 4EOUA 4GXMA 2C16A 3EWWA 3RLUA 3DFQA 1QWGA 3SY5A 4GUJA 4IPJA 3W83A 1U5JA 4A2SA 3WJXA 1K7FA 1ZCOA 2E6AA 1UB3A 2Y63A 5FEZA 1IGSA 3G0XA 4UTTC 1W8SA 2ISVA 1KFBA 5I3KA 3A22A 3PM6A 1VH7A 2J9ZA 4UMBA 4AHPA 1OJXA 1SO5A 1H7NA 3UY7A 4O19A 2JKPA 4O50A 3G8RA 6TIMA 5FF4A 5I3HA 4A2RA 5I3GA 2WNQA 4N4PA 4JYDA 2E6FA 1IIHA 4N02A 1XM3A 3N2XA 3W85A 2WKJA 2TMDA 4QQ3A 4ZQOA 3QFEA 3PUOA 3LERA 3TSBA 3NL3A 1OFQA 4RV8A 3KRZA 4N9CA 1IXQA 3UD6A 5LKYA 1BEUA 2WSRA 3B4UA 1XFBA 3DXIA 3O6DA 4HNNA 3RK8A 4MZ8A 4GNJA 5CGQA 4OQVA 4XZ9A 1Q3NA 2Y61A 3PB0A 3N19B 5HINA 2E68A 4JS3A 2B7NA 1IXPA 3HG2A 2QKFA 3MWAA 2Q8ZA 4Z1DA 3W7KA 5CPLA 3TR2A 2QUTA 3KVMA 5L6UA 4O0KA 3LLFA 4AWTA 1R2TA 4UFHA 1QOQA 3W07A 3DZ1A 5A8GA 2QCDB 3TXVA 4FX6M 2G96A 4LC6A 3VFLA 5AHIA 3NPXA 1ZAHA 3NQAA 4PFMA 3HO8A 4A29A 1DQWA 1KM4A 1L6YA 2A7PA 3P60A 3B05A 3NYZA 3W1RA 1VCFA 1FBAA 3O05A 1V5XA 4PODA 3TSMA 3LCGA 1S3HA 3LM7A 3S5NA 4GUIA 3W1QA 3N2MA 4BR1A 3L0KA 2NX3A 4NJJA 2DP3A 2X1RA 5ABTA 2VENA 1TV8A 3OVQA 4JEQA 3QSRA 2GQAA 1RQHA 1Z41A 4FB7A 1H63A 5GVJA 4H4IA 3E9AA 1FCBA 2GVGA 3C2VA 1SW0A 2YGYA 3GLCA 5EYWA 2JGQA 3L66A 3S5ZA 1PS9A 1DOSA 3MO7A 4PEKA 1PCWA 1G4SA 2VEMA 3KVJA 1FWWA 3NQ8A 5D04C 5EKYA 4UFLA 4QITA 1OFEA 3W7CA 4RXFA 2NX9A 3P84A 4WOQA 1W5MA 4LC8A 3TQVA 5D2VA 2VEIA 4EVZA 2QAFA 4NZFA 5D32A 2BWGA 3R2GA 4O4VA 2DU2A 3C4UA 1B3OA 4GUGA 4P2VA 1QCWA 3HIJA 3PY2A 3LHYA 1IIGA 1FWSA 2ZTKA 3FS2A 4JTEA 3G3MA 1EWEA 1H62A 2ATMA 4FX8A 3NDOA 2J24A 3WK3A 1KFLA 3A5FA 4RZ5A 3STEA 3TMLA 3UYCA 4UC5A 3M5YA 3W76A 5I3FA 1Q6LA 3RFAA 4KFNA 2C19A 4FXSA 4A22A 3DI0A 4LVFA 2DJXA 2BZNA 1SZEA 2NV1A 5G1TA 1XDMA 3G1DA 4HSNA 2TSYA 2CZEA 1LRTA 1H5YA 3EB2A 4JD4A 3N73A 1H50A 3MHGA 3MJYA 1QPOA 4HNTA 5AC8A 1FDZA 2ZZ2A 3JRKA 4E2DA 4N6EA 1EB3A 1XUUA 1K8YA 1LBLA 3U8GA 3M16A 1JCYA 1DKWA 1YXDA 5AFDA 3LOTA 2Q3RA 1W54A 3QJAA 3EWZA 4ZZ9A 1SUXA 3C2OA 3CEPA 1YYAA 1TPDA 3C2RA 3ATYA 1W3NA 1ICSA 2CLMA 2JGYA 3G1YA 4I7UA 5BMWA 2YXGA 1W5PA 4O11A 2V9DA 3H53A 4UFJA 4RLIA 2ISSA 4XBSA 1V7YA 4WJEA 4O57A 4YXGA 1JCNA 1OYAA 4O1CA 3W87A 4O1BA 4JTHA 3W7NA 3A21A 2ZZ7A 5AHMA 4PL1A 5G4WA 2A21A 2RHGA 1WDWA 5DN1A 1IF2A 2ATSA 3GDMA 3P5ZA 4IMCA 1QFEA 2EGZA 3NO5A 2A7NA 4NJKA 2I1OA 2EPHA 6ALDA 1GVQA 2A6LA 3TROA 3BO9A 3W7IA 3R8RA 4A3UA 3A24A 1KA9F 2CLLA 2PURA 1W56A 1XUZA 1LLZA 1SZNA 2Q3OA 1WBHA 4EIVA 3LI0A 3C61A 2FPYA 4J9JA 1A5BA 4XWUA 4ZQNA 4UTWC 1YPIA 1HG3A 3NQDA 5DCEA 2TYSA 4Z1CA 4Y6GA 4QNWA 3PWAA 4QNEA 4UR8A 4O10A 4ADTA 4XUGA 3PBVA 2H8ZA 4UNKA 3UWZA 2TPSA 2EF9A 3O07A 4ONVA 4XTIA 2OT1A 1ML1A 5CZJA 2GJNA 5J5RA 4RZ6A 1TPWA 3O06A 3C8FA 3I65A 1GOXA 1U83A 4R7JA 1NF7A 1DVJA 1C8VA 1RQEA 3O63A 4OV4A 1H7PA 8TIMA 4O1AA 3NPVA 1X7FA 1TTIA 2QCDA 3NQ7A 2ZTJA 3NQEA 1OFRA 2CW6A 4XTDA 3S6DA 3M5ZA 2OZ0A 4OU1A 4HHPA 1QAPA 2FFCA 3RLVA 3W7QA 4UTHA 1GTHA 1LLWA 5IM51 5HNRA 3HGJA 2WNNA 1ALDA 3L5AA 1I45A 1EP2A 1I2QA 3R5EA 1DJQA 3LGEA 2DJLA 3NQ6A 2WJZA 3UZJA 3VCRA 1LRNA 4AAJA 1NVMA 4PC8A 1AL7A 4UMCA 4MJZA 2E09A 3LDVA 1Y0EA 2CLKA 1PHQA 2R91A 3CWNA 3LCWA 3EWUA 4UNLA 1SSGA 1MEWA 4O4WA 1SU5A 1T0OA 4X9SA 1FXPA 4OWGA 1KM2A 4C1KA 5EMUA 3FYOA 1H7RA 2WPBA 4JXCA 4M5PA 4X22A 3FYPA 2Y7DA 4ML9A 4ORMA 1O5KA 2DZVA 1K8ZA 1KFEA 2YFNA 2G97A 1UUMA 4O28A 5HWMA 3LRLA 3N34A 2V8ZA 1VHNA 4JX4A 4XKYB 4NNCA 1H1ZA 4AWUA 2WV8A 4ZVJA 4IOTA 3W7OA 3L0GA 1K02A 4FIQA 1KTNA 1FXQA 3P8IA 3M1ZA 1W0MA 1K7EA 2Z6JA 3G1XA 3CEUA 4HN4A 3WK1A 4LT9A 3MI6A 2QF7A 3S9YA 3B8DA 1VQTA 3TXZA 1RZMA 1ME9A 1F5ZA 3LTPA 5F2LA 1W5QA 5EA9A 2PRLA 3W1AA 2J27A 2NX1A 1O60A 3G1AA 1E51A 3HG4A 5KTLA 1HUVA 4QJ1A 4HIBA 3UWVA 3QPYA 2WO5A 1YDVA 4PH6A 2QR6A 4Y9AA 2H3BA 4JTFA 1SFLA 3E02A 2HSAA 3W88A 1SO4A 2ZA3A 1EUNA 2GVJA 4TMCA 3IIXA 3O6CA 1TQXA 3W86A 1T99A 3A5VA 3WJYA 1DL3A 3GVGA 5A5WA 5DBUA 3R13A 5T26A 3GYEA 4JYFA 2H3DA 1M7OA 1L6WA 2FTPA 1BKSA 1SFJA 4DPPA 3VI2A 2NUYA 4RX0A 1CW2A 3C2FA 3UPBA 1P1XA 2ZRZA 4ZMGA 1O95A 2YCEA 1H1YA 3G1HA 3W1XA 3IIVA 3STGA 3SZ8A 1S5VA 2Z1BA 2ZRVA 1XBVA 2VEPA 5HULA 3O8AA 1M5WA 1WQ5A 3GNDA 1B4EA 2P0OA 3SR7A 3W71A 1ME7A 5E0KA 3TQ0A 4WXYA 3VE7A 1ZAIA 3H55A 4FNTA 3GDRA 4TR9A 4LNYA 4NJHA 2GOUA 3PVFA 3QRHA 2Z0IA 2Y7FA 1VZWA 2DZXA 4FX7A 4YCOA 4IXHA 4NNBA 1XI3A 4AMAA 4IQLA 3CB8A 3G0SA 3P62A 5MHBA 4UR7A 3A23A 1OF6A 2ZDRA 5DCBA 1EA0A 3L0NA 3G1VA 4Q4KA 2YZRA 2B7OA 1WA3A 4WY0F 3L5LA 3SIZA 4UFKA 5D33A 3TK7A 3L2IA 4K39A 2A7RA 5I3IA 2JK2A 2F84A 4HNVA 1J2WA 3GKAA 5FEXA 4N9DA 3HG3A 3L65A 3LXBA 4O54A 5FF7A 1J5TA 1HTIA 3GDTA 2CU0A 3S1WA 2ZYFA 4IMEA 4EWND 1H7OA 2VELA 3EX6A 1DHPA 3W7MA 2ABBA 1Q45A 1KLZA 3LXCA 2PC4A 4Y8FA 1MO0A 5KINA 2CLEA 4MY1A 3N14A 3Q58A 2ZZ6A 4K37A 3W84A 5AC6A 4U4MA 4UIOA 2VFHA 3I7RA 2X16A 2DZSA 4O17A 5F2IA 3GXNA 3IVUA 3P67A 1GYNA 3TUUA 3TC6A 4FNUA 3KRSA 4O53A 1KM0A 3F4WA 2DZTA 1B4KA 3S42A 2VEKA 2YPIA 3I7SA 3SFKA 1WYIA 1GVOA 2Y89A 1D3HA 4DXVA 2C18A 2WOQA 1JCXA 4KWWA 3EX3A 2PRMA 2V5LA 4H3DA 2C6QA 3G1FA 3KOFA 5HQEA 5KITA 5EPDA 2DZWA 5AHFA 5LNRA 3LCHA 3W73A 3QSTA 5LNVA 4LVAA 1AL8A 3THAA 1VYSX 3NR0A 3ELFA 3S1XA 3GAYA 1ONRA 4IX0A 4M19A 3P80A 4K8EA 2YW3A 1TPEA 4M7SA 4RKAA 3GX9A 1MEHA 4YMZA 1GTEA 5KZDA 3BW4A 2QCGA 2KZHA 1XC4A 3Q2DA 4UTUA 1TREA 2A1YA 1OG0A 3BK0A 3ABQA 5BMXA 3NQMA 1K03A 1MXSA 4ZQPA 1DQXA 3W22A 1C9DA 1R46A 4WXZA 2NXHA 3NAVA 2OCZA 2NWSA 1W37A 1JULA 1VLIA 7TIMA 1GT8A 2PCQA 1OFDA 2QCLA 4UTLA 4E0CA 1HO4A 1I2OA 3NEVA 2GVLA 2OMAA 2E1DA 3ABOA 4FNRA 5G2HA 3DFSA 3W6YA 2EAWA 1TTJA 3S1UA 2VFIA 3I6RA 4XKYA 4AHOA 4DBEA 4O12A 1X8FA 3TU9A 1ZJIA 4B5NA 1G6CA 3TNOA 3EXRA 3P81A 3IRDA 3CM4A 3NA8A 1LBFA 1YXYA 1P5BA 3OIXA 4IXXA 1XL9A 3DKJA 1O5XA 2R94A 5SWUA 3M5XA 1QR7A 2X1TA 3PR2A 5CKSA 1VJIA 3NNTA 4LRSA 3RF9A 3HGOA 5LHFA 4Z1BA 1W5OA 2ZZ5A 1TIMA 2CLFA 4ALDA 4BI6A 4NU7A 4HPXA 5LGXA 3IVSA 3FFSA 4O14A 4NX5A 5AC7A 1TTPA 4CNOA 3LRMA 3P7YA 4IMFA 4S2CA 3DHDA 1NFBA 4BWLA 2TRSA 3M41A 1THFD 5K4XA 3W7JA 4GWEA 3LCLA 3W2UA 5D03A 1EIXA 3JR2A 3AO0A 4MY8A 1KM3A 4H6KA 1JQXA 2ZZ3A 2V2DA 1ZENA 2BSLA 2ZCGA 2YSWA 3HPSA 3T78A 3NQCA 2P1FA 3PAJA 3DKLA 4OHQA 2O7SA 1TSIA 4DO4A 3O15A 3W7LA 1G69A 5TQLA 4YL2A 1TPUA 5LGZA 2E77A 3IIOA 5BNKA 4YWIA 3UXAA 2GJLA 3CT7A 2YDAA 3KXQA 3QMSA 3SECA 2Y62A 4MOZA 3GDKA 2V2HA 5AYXA 3E49A 4JDYA 2HMCA 5C2XA 2Y6ZA 4CQ9A 5D05A 1VS1A 2V81A 2YW4A 2R14A 4DEFA 1G67A 1L2UA 2EHHA 3MBDA 4PTNA 5H91A 1M7PA 4N2YA 1N8FA 3KAOA 2E6YA 4FEZA 4EF9A 5BOOA 1MSSA 5K4ZA 1OX4B 3PULA 1Z48A 3G1SA 2CZDA 3P74A 1QDSA 3B0VC 3I68A 4Y96A 1KFJA 3PSVA 4JX5A 4UCGA 5EBUA 4CNNA 1OABA 1KBIA 3EWXA 1EEPA 2QAPA 4NX0A 1LOSA 1F2JA 1KTBA 1UCWA 1G4TA 2ZFAA 3CIWA 3HOJA 2OT0A 4GBUA 5CSRA 4IX2A 2DZPA 2J9XA 1VYPX 2FIQA 4CLMA 1B9BA 3W7DA 3PF3A 4MVAA 4JR5A 3TW6A 3G0UA 5F4SA 1GPWA 5F1UA 3W7HA 4UMAA 5HR6A 2G5WA 5FEWA 1L9WA 1LOQA 2ALDA 4TMBA 1ZAJA 5FF2A 5D2XA 3OA3A 4K36A 2VKZG 3LI1A 1TPFA 3W1PA 1T8XA 3QYQA 3ZR4A 3FJ6A 1JR1A 3CIXA 5E93A 1QO2A 4UFIA 1HL2A 2CFFA 3HF3A 1SZGA 4FNQA 1XXXA 5C5YA 1RV8A 1F76A 3PBYA 3ZS4A 4LOCA 3BW3A 3OHIA 3NQVA 4E2BA 2WSQA 1YLVA 1M6JA 4MLJA 3MYPA 4CCDA 3IVTA 1WOAA 3KFTA 3K30A 1GEQA 5HR7A 3CU2A 3PS7A 1JUKA 3GAKA 1TJPA 2QCHA 3W1TA 1GG0A 3E12A 1FCQA 1F7BA 3TE9A 3W2LA 2WSYA 1HO1A 4CCCA 5C54A 3TW7A 2BX7A 2H90A 3IGUA 3L21A 4DF2A 3N9RA 3ZFHA 1PCKA 1I4NA 1WBJA 1MZHA 5AOUA 1RVGA 1TV7A 4BK9A 1WV2A 1WAUA 2VC6A 3KVKA 4N4QA 1LTDA 1W3TA 5KMYA 1GVRA 1VLWA 4JTGA 1OVDA 3NPWA 4OGZA 3D0CA 3QQ1A 3TA6A 3W75A 1W3IA 4WUIA 4HSOA 3AJXA 2X1UA 3ANYA 4N6FA 1TRDA 2ZRWA 4EF8A 2FJKA 4UFMA 4Q33A 3UQNA 1W1ZA 2NWRA 2X30A 5AB3A 3GNNA 2IQTA 5E1QA 1G4EA 1JCMP 2Y70A 1XDLA 2VFEA 3T55A 1JCLA 3MHFA 4IMDA 4M6VA 3WJSA 2CZ5A 5H2ZA 5F2MA 3C6CA 3TX9A 3BVJA 3USBA 1P0KA 5KSWA 2C13A 2RH9A 3M9YA 3LCXA 3YPIA 2H6RA 5D02A 1A5CA 5CPNA 2AQWA 1UJPA 1GVSA 3W7EA 1UBSA 4K7YA 4FNSA 4O18A 3MBFA 1VGAA 3IIPA 3QM3A 4WX2A 5G4EA 3TV8A 4MYAA 4LV9A 1FWTA 1KV8A 1TPVA 4JTTA 3QZEA 1AMKA 2E5BA 3N3MA 3LHTA 3VNDA 4ADSA 3LHWA 1XBZA 2QUUA 3BW2A 4CCEA 3MMTA 4R34A 2V30A 5KZEA 1VR6A 3NVTA 4LY8A 5FESA 5AHEA 2A6NA 1TRIA 1N55A 4LU0A 1N7KA 3MI2A 4Z0SA 3W7RA 3QQ0A 1G4PA 2W0UA 5HWJA 4L4LA 2QDHA 2WQPA 1RQBA 4YLWA 5AYZA 2NLIA 2ZQ0A 3NXFA 3C0JA 3BV4A 3CLMA 3UXDA 4MZ1A 3W1NA 1T96A 3BGJA 2Y88A 3NM3A 3C2EA 1PL9A 4N9EA 3B0PA 3SJ3A 3IGXA 5BRBA 4JGDA 3KX6A 3HPZA 2C0AA 5DCDA 2X1SA 3TAKA 4AH7A 1OX4A 2J88A 3VKJA 2YYTA 3OVPA 1TTQA 3GR7A 3WFAA 1OX6A 5G2WA 1LDCA 3T44A 2OJPA 5K9XA 5TBOA 3NGJA 4YCPA 3P8JA 3L68A 1XKYA 2CLIA 4AHQA 1X6UA 3B06A 2YX0A 2C1HA 4KWVA 1D9EA 4HNUA 3MHUA 3NZRA 4A21A 1VC4A 5AYYA 2CLOA 2C14A 2B4GA 4GC4A 3IGSA 1TMHA 1OF8A 1B57A 1BWLA 3B04A 1UASA 2A2IA 3UWYA 4NQ1A 4NJGA 2A0NA 3KVLA 3U2OA 1H60A 4DELA 3THQA 4FHAA 3W2MA 4NXKA 2QCCA 4QSHA 3LCFA 4RR4A 3NL2A 4NUWA 3V1PA 4Z0JA 1WX0A 1W31A 4JDBA 4CQ8A 5CSSA 4JX6A 2V0TA 4FO4A 1VYRA 3DU0A 2CZFA 1H61A 1EX5A 3M47A 4TO8A 1RR2A 4BWLC 1SZFA 2VOMA 3DGRA 5K9DA 3F03K 4Y90A 3EEGA 1QNVA 1QOPA 1GWJA 3PSWA 4GUHA 2NUWA 4IPIA 4K8HA 1PHWA 3CTLA 4OE7A 1AW2A 1OHLA 1JUEA 3NL6A 1R47A 4LS1A 3FKKA 1RD5A 1I8JA 2QDGA 2B7PA 2FB2A 3F4NA 2FQIA 1K7XA 3N9SA 3FJLA 5BW6A 1EPXA 3MP3A 2Z2UA 2DZUA 1F6KA 3LHVA 3BG5A 3NG3A 4M6PA 2BLEA 3LLDA 2ISWA 5K3VA 3NQGA 5FEPA 3ATZA 3C52A 4FNPA 4S2BA 3S0CA 2FPTA 3EX1A 3MP4A 4I7WA 3V75A 3EXTA 5AN7A 5DY3A 4JIPA 3W2NA 1F05A 3QC3A 5LNUA 2J9YA 1LZOA 3TSDA 4WQ6A 4C1LA 5KZMA 3QPZA 3S1VA 5D30A 3BG9A 4M7TA 4P61A 3W2KA 3L5MA 4WZHA 5LZLA 1TCDA 3KHJA 2E5CA 3QMTA 1XBXA 5HWNA 3RMJA 3TFXA 2I14A 3LHUA 3CQ0A 4MLRA 3B03A 2QCNA 3FA5A 3GXTA 3UWWA 5LHEA 4K6AA 1FY6A 5DXXA 1VCVA 4MZYA 2QJHA 3FKRA 3LV6A 3BLIA 1G7VA 3B0UX 2E6DA 4MFDA 3IEBA 4GFSA 3KRUA 3LHZA 5TIMA 4PCFA 4S1FA 3W7PA 5LNSA 1AK5A 5HUOA 5L9FA 3OVRA 4K7VA 4JY9A 4IUOA 2ZBTA 1SO6A 1VPXA 3S8HA 1NEYA 2DORA 1EWDA 5D37A 1DORA 1L6SA 4LRTA 2BXVA 3GK0A 1JVNA 4IGHA 4BFAA 3ABSA 4X3ZA 1I2RA 4QIUA 4M6QA 1VCGA 2VFDA 5DBTA 4UUIA 1LYXA 1X1ZA 2YFOA 1QPRA 1QMLA 3EWBX 3O16A 4IJBA 4LV4A 5CPOA 2F7FA 4DPQA 2BTMA 1YTDA 2AAMA 1PIIA 2V5BA 2RDUA 2O7QA 1EP1A 2ZRXA 3R89A 2Y7GA 2GUUA 3S5YA 1HFBA 1H7WA 1KM1A 2A85A 3UZ5A 2XN0A 1WXJA 1FX6A 4NVTA 1TPB1 1F6PA 5F1VA 3TH6A 4FXRA 2VFGA 4Z1AA 1OK6A 1QPQA 3E0IA 3PB2A 2ZRUA 4JTIA 4UTJA 2RKXA 3PUDA 4AVFA 3G24A 5AHLA 1Z42A 1YDOA 2G95A 4KFOA 5LNWA 1OFOA 1KLYA 4JTJA 1K3UA 4BI5A 1KTCA 4KKXA 4PA8A 5J5DA 4MPQA 1LM1A 2E5DA 3EKLA 4JICA 5DY2A 3G22A 4MY9A 1S5WA 4HT3A 3DFPA 1PV8A 3PC0A 3HGSA 4JY8A 4RXGA 1TO3A 1KM6A 1AG1O 3G3DA 1YTKA 1VHCA 1SSDA 1GVFA 3UWUA 2QCEA 4AF0B 2RFGA 4AWSA 3BGGA 4FF7A 1P4CA 4NT0A 3ABRA 3FOKA 3GZ3A 4I7VA 5CZSA 3W1UA 1A5AA 2JKAA 3M7WA 3LX9A 3DFNA 4LUJA 1MEIA 2XN1A 5K2ZA 1OYBA 3NL5A 4ZQMA 3NOEA 1ICQA 3MW7A 2Z6IA 1LP6A 4PL2A 1F73A 5IBXA 1OFBA 2VFFA 2J6XA 5D2TA 3QH2A 5CG7A 2VXNA 1FUYA 1BTMA 1ME8A 2EKCA 4UXDA 4UTTA 1QPNA 3T7VA 1ZALA 4MJMA 3GKFA 1PE1A 3LTSA 4G1KA 2XFWA 2C3ZA 3QMRA 2ABAA 3E96A 3EX4A 1UUOA 1X1OA 2GQ9A 3T40A 2R8WA 3DI1A 5C55A 3SI9A 1Q6OA 3GDLA 2NUXA 3EXSA 4AXKA 5FF0A 2QJGA 4QAIA 3W23A 2ZZ1A 2NXGA 3EX2A 4JIQA 4O16A 3STCA 1KV5A 3UPWA 3W1MA 3C56A 5HUPA 1H7XA 4NNAA 4E38A 5DELA 3O1NA 1OX5A 1TB3A 1W5NA 1PVNA 4Q32A 2FPVA 4LW7A 3HMJG 1XCFA 3T4CA 5U4NA 5DLCA 1FWRA 1NAL1 3WJZA 5HJLA 1BWKA 1SO3A 3NM1A 3GIYA 3LRKA 2HS8A 3VE9A 5G5IA 4GUFA 4LUIA 5EL1A 1FCVA 2ZA2A 1YTEA 3QW4B 1FDYA 2A5HA 1P0NA 5C6MA 4U28A 1SW3A 1DJNA 2XN2A 2FB3A 4MYXA 1CX9A 5D2YA 3EKZA 3P82A 1R2SA 3F1QA 4FIRA 5F4WA 3DFTA 3PBUA 1KBJA 3QEZA 4OV9A 3UNDA 2P10A 3W7GA 4DO6A 5DXYA 4UTKA 3FIGA 2PE4A 4ZL1A 3W3OA 2FDSA 1LORA 3QF0A 5FF3A 1I2NA 4XBKA 1Q6RA 4AB4A 4O1DA 4JTLA 4Z08A 2QUVA 2GQ8A 4HPJA 3TIMA 1ZY9A 1OYCA 3HG5A 4WY0B 1NF0A 5K9CA 2WNZA 2Y85A 1IXOA 3NPUA 1CI1A 4JNMA 2ZZ4A 4ZQCA 1FDJA 1G7UA 4LWWA 1LROA 1TYGA 2B7QA 3WK0A 3MP5A 1JRCA 1JCJA 4WOZA 1O4UA 3TJXA 1LBMA 3W72A 2PRHA 4QISA 3TQKA 3BG3A 3I7QA 2YR1A 1EP3A 1H51A 3LV5A 1A50A 1YXCA 3TC7A 4ICNA 3BARA 1JQVA 3L9CA 3PUEA 1A5SA 3G18A 3U6WA 3M43A 1GJPA 3HJZA 3RU6A 4LVGA 3LB0A 4CNPA 1FWNA 3W1LA 5K7JA 4RCXA 4ZQRA 4MIMA 4K38A 3SSJA 1SPQA 5CZTA 1GZGA 4TX9A 1RPXA 1ICPA 4DF1A 2W6RA 3SGUA 2AGKA 4GRSA 4JTUA 5LSMA 3OBKA 3GXPA 4DF0A 4W9TA 3ZWSA 4DQWA 1JJKA 4OT7A 4MKNA 2V82A 4GJ1A 4BI7A 2CWNA 4LS0A 1TJRA 4N9BA 4AEOA 4D2JA 1GYLA 1GQNA 4LVDA 3LBMA 1LRQA 3TJLA 3NQFA 3ZWTA 4AF0A 3M6YA 3HPXA 4RJEA 4O13A 2NZLA 4IMGA 3CHVA 3W74A 4NJIA 1C29A 2LLEA 3SGZA 3W9ZA 3BLFA 3G8EA 1LOLA 1FQ0A 4NXSA 1A53A 4TU1A 3Q94A 1GG1A 3TKFA 3Q37A 4ORIA 3UWQA 1SQ7A 4O0ZA 1ADOA 4HKPA 2NXIA 1ZNNA 2UV8G 4OBTA 1KM5A 5G2IA 3OG3A 4LVBA 4O52A 3EWYA 2JBMA 5AHNA 3L67A 3DHFA 3W70A 1ZFJA 1I2PA 2QCMA 1R2RA 3TCEA 3CWOX 2Y7EA 4I9AA 3P5YA 4JTKA 1DV7A 4UTIA 1YADA 4WD0A 1OK4A 4RZ4A 3TMQA 2A4AA 1SW7A 3UY8A 1S5TA 3C3NA 1LCOA 2YYUA 1YPFA 2OX1A 1D3GA 2JKEA 1KFCA 2RDTA 3PBWA 1XBYA 3P61A 5G1YA 1TQJA 1DBTA 1O94A 3OEXA 1FCUA 5F4XA 5F2GA 2ZRYA 2ZA1A 3BPWA 3O6YX 2V2CA 4GE8A 3DBPA 3H54A 5D2WA 1JUBA 5I3JA 1ZHAA 4O15A
chains in the Genus database with same CATH superfamily
4A8RA 4FZIA 4H7CA 2V38A 2C15A 2VT0A 4UTWA 3CPRA 3FHAA 3GB6A 2BVDA 5DMLA 5EY5A 4L1XA 1SR9A 3LG3A 1XLHA 4GIAA 2X05A 5T8GA 1TPH1 1HW6A 1UWQA 4M81A 1EUAA 3F7JA 1KXTA 5U7SA 4JQ1A 2E25A 3HB9A 4ZXLA 3CJPA 1J9YA 1AUSL 1XG3A 3CUZA 3UR5A 3FEMA 2YDSA 3MZ2A 4C7DA 1VF8A 3INPA 3IV3A 3LTYA 1Q6QA 4JN7A 4M51A 2OR2A 3PNUA 3S5OA 3BMVA 2PWEA 4MFEA 3DFOA 1ZUAX 1I1XA 4DO5A 1IXNA 3WLHA 2J13A 3NEHA 4B3KA 3J7HA 1NM9A 5CCZA 2PDNA 3ARRA 4IP7A 4MUZA 1NSJA 4M80A 5I09A 2DZAA 1OG6A 1PTDA 3CS2A 1PWLA 3DBNA 4POCA 1KKRA 4BHYA 3IIZA 4FA3A 3A3HA 4P7LA 4AD1A 3RR1A 3RPDA 3TAOA 4Z42C 3SUVA 4IIHA 2IPWA 2XIJA 1KW1A 1Z44A 4WDWA 2FZ8A 4HJFA 3HQ1A 3CUHA 4QM1A 5IBXC 1AW5A 1S1RA 3WMCA 1QWGA 3SY5A 4GUJA 4U5KA 2YA2A 3W83A 1E5NA 2WHLA 1K7FA 2E6AA 2ZWYA 1UW9A 1OD0A 3G0XA 1W8SA 1PX3A 4AUBA 1W32A 2XSXA 1VH7A 4UMBA 5C0QA 3UY7A 1SO5A 3MS8A 4XBJA 3F2DA 5I3HA 5I3GA 4F0SA 2WNQA 4MDOA 1JPHA 4RNHA 5M2FX 4X9YA 4PTDA 1IHIA 3W85A 4QQ3A 4ZQOA 3QFEA 3R0KA 3CUFA 4EAMA 2WW5A 1O6IA 4XO6A 4N9CA 1IXQA 4PTXA 1ISVA 3P93A 2WSRA 2YL6A 1CENA 1XFBA 3DXIA 3WNLA 2PF8A 4LYPA 4XZ9A 3ARSA 4UBPC 5HINA 1QHPA 1S39A 3MDWA 5ABFA 2I57A 3ORWA 3KVMA 5A6MA 1R2TA 2XYLA 3W07A 1W1IE 2QQ6A 3TXVA 4FX6M 3VFLA 3GNRA 4HU4A 3R10A 4TQTA 1UP2A 5DMYA 1L6YA 3NIYA 3NYZA 1V5XA 1YNPA 3VOFA 4FSAA 4Q4SA 3JZEA 4Z1YA 3T08A 3W1QA 3N2MA 1X98A 3SB0A 3U3HA 4QXIA 2DP3A 1IR1A 1FKWA 4J27A 2X1RA 3OJGA 4RDWA 1YMYA 2J6VA 2VENA 4RDVA 2IKHA 1E43A 3RX2A 2EPMX 3NCOA 2PDMA 4U3CA 3E9AA 1FCBA 1MVYA 3C2VA 2HV5A 1BRLA 1K9FA 3S2JA 2YGYA 4DHGA 2JGQA 2ZXDA 1PS9A 1LUCA 1C91A 1NH6A 1G4SA 1FWWA 4J3VA 3OPSA 5JVLA 2NX9A 3MDUA 3PJUA 4WOQA 3TQVA 3LMZA 4OIFA 1W9XA 4XZHA 3ITTA 4O4VA 4ZOCA 3C4UA 1B3OA 1CLXA 1P6WA 4A8LA 3LHYA 1IIGA 2ZTKA 3FS2A 3G3MA 4FX8A 3WDJA 4WDXA 3RG6A 1VFOA 4P7QA 3APTA 2EJAA 3U57A 3TMLA 2UY3A 4UC5A 3M5YA 1Q6LA 7TAAA 2OVLA 4KRTA 4QG8A 1OZMA 2E7FA 5FAGA 5EB8A 1SZEA 4HSNA 2TSYA 2CZEA 3UPMA 1OT1A 4R9OA 3N73A 1H50A 1HJXA 2J74A 4EPKA 3MHGA 3MJYA 1WNOA 4YS1A 4HNTA 5AC8A 1I60A 2ICSA 1XYLA 3IANA 3UP8A 4N6EA 3OB8A 4R88A 4PMZA 1DKWA 1JCYA 4LAZA 5AFDA 5I79A 3EWZA 2C91A 4ZZ9A 4LUSA 1BXNA 3L4ZA 2NQJA 1ICSA 2PMQA 3BUVA 4LUTA 5H1WA 4O11A 2WMIA 2D2JA 2DUZA 4UFJA 4RLIA 5FJRA 1AQHA 3OLDA 4IFKB 4YXGA 3CK5A 1OYAA 2FZDA 4JTHA 3A21A 3RRXA 5AHMA 5LXEA 2Q8XA 3U0HA 3WMSA 2QV5A 4BS0A 4AX7A 5DN1A 1IF2A 3P5ZA 3NO5A 3KWSA 2I1OA 2INFA 2EPHA 3RYSA 3VGFA 2A6LA 2VZUA 1Z8AA 3R8RA 4X61A 3CQIA 2OQLA 3I3BA 4V1YA 4HU8A 1NIUA 1W56A 2PDHA 1ODZA 3V1HA 3B9DA 4D8LA 2YCKX 4JCMA 1TJ1A 4XSMA 4DNMA 3ME3A 1A5BA 3UFYA 1V7AA 1EDGA 4EPDC 4QNWA 1I0BA 3A9BA 4AZ5A 2INEA 3UWZA 2R1MA 4KEMA 4ONVA 1IWBA 1RK5A 3VOIA 3M0YA 5J5RA 1TPWA 1UR2A 2PLCA 3SUTA 1V0MA 3VIOA 1B2YA 4HCDA 1GOXA 1U83A 1NF7A 1C8VA 1NP2A 4B9YA 4OV4A 8TIMA 5JIWA 3NPVA 4S38A 1QK0A 2DPEA 2V3GA 1N8IA 1H0IA 4DIAA 4JBRA 3S46A 5EMMA 1GOIA 1W3HA 2B31A 1QAPA 2FFCA 1GTHA 3SCSA 5JMUA 2WNNA 3SCTA 1I45A 4B90A 2YBUA 2VZTA 2WJZA 3GVWA 4GLEA 1AL7A 4UMCA 2J62A 3CQHA 4S3BA 5IHRA 3ITXA 3LCWA 2VM8A 4UNLA 1T0OA 4IGSA 1LQAA 1UR9A 1G5AA 1UZDA 1OWQA 1DJGA 4Q4QA 4DJED 4P8UA 2DZVA 1K8ZA 3EOOA 5CJMA 1KFEA 3SCNA 3N34A 2BFGA 1H1ZA 1KNWA 4IOTA 3W7OA 1EQCA 1K02A 2GGHA 4UQBA 4HN4A 3GVQA 3MI6A 2QF7A 3E2SA 1ME9A 1XLEA 1W5QA 5EA9A 2J27A 2NX1A 4S3KA 1CCWB 3E2RA 3KP1A 3ITOA 4ERIA 3VGDA 1F4AA 2WO5A 4QCFA 4KEVA 1J11A 3IAQA 1GKRA 2GDQA 4FLSA 3VD5A 2HSAA 3IIXA 3WLKX 4REQA 3FYYA 2PD9A 2XINA 2OSYA 3AMKA 1SGJA 2GJRA 3M4HA 3WJYA 3UCDA 1AH3A 2YJQA 4IQDA 1M7OA 2FTPA 3H2CA 6PTDA 1BKSA 3Q45A 4RX0A 3SEPA 4Q8VA 2R82A 1CT5A 1JYWA 4ZMGA 5T9CE 1O95A 3SDOA 4Q6JA 4D9PA 2ONEA 2Z27A 1OGSA 4IL2A 2ZRVA 3BZJA 1XBVA 2D2GA 2PWFA 5HULA 1G1YA 3B97A 3W71A 1AA1B 3CV2A 3UNTA 2WZEA 3U2EA 1XX1A 4WXYA 3GDRA 3N29A 1OADA 3V16A 3QRHA 2XM2A 2Z0IA 4CD7A 2XG9A 3IJIA 4NNBA 4AMAA 2PD5A 3P62A 4UR7A 3A23A 1EQPA 4BQ2A 1K9DA 4Q8MA 3HN3A 1DIDA 4Q4KA 1WA3A 5CC3A 4NRSA 4C6FA 2V5CA 3QGVA 4UFKA 3L2IA 4GINA 1HJQA 4QAWA 2F84A 5FEXA 2XH4A 3M0XA 3LLXA 1J5TA 1F3TA 2CU0A 1JDAA 3GXDA 4EWND 3URQA 2VELA 4PE8A 1DHPA 3W7MA 1AH0A 4JHOA 1ZJHA 4H6RA 2CLEA 4HJWA 4K37A 2DW6A 2ZZ6A 4M29A 3E2QA 1Y8BA 2VFHA 2X16A 2YKKA 2DH3A 2A3CA 2IKJA 3IVUA 3P67A 3TUUA 3AMCA 1R5YA 4O53A 1KM0A 3SCOA 5GNXA 2CHOA 4X2PA 2Y89A 1D3HA 2OLHA 4EAYA 1JCXA 4PMJA 1G01A 2PRMA 3ZIZA 3AYRA 1HVQA 5AHFA 3L4YA 5LNRA 3LCHA 3W73A 5LNVA 1UHVA 3VNIA 3E6EA 3VD7A 3QV7A 4PBGA 1TV2A 3GAYA 4GQRA 1E9LA 4K8EA 2ZUSA 4RKAA 3GX9A 4PGLA 1OCQA 4GQ0A 1WZMA 4LANA 2QCGA 4PMOA 2W61A 3PFRA 3BK0A 3ABQA 2FVKA 3NQMA 4I9TA 1K03A 4I5XA 2YB4A 4ZQPA 3BAYA 4A3QA 3GVVA 1W37A 1JULA 1VLIA 1HJWA 4FR1A 4GIEA 4E0CA 1DE6A 3BANA 2BNJA 1QHOA 3NEVA 2GVLA 3ABOA 1FWFC 5TAOA 4AVOA 4O12A 1R7AA 1ZJIA 2XIMA 4D8AA 4N7QA 1JFXA 4I5UA 1AQMA 1LL4A 3IRDA 1VRXA 4IXXA 1XL9A 2R94A 4D6JA 1KR1A 2D0GA 2OZTA 1B3XA 5LHFA 3MANA 1TA3A 3RR4A 1CEOA 5D9OA 1TIMA 4YIWA 2CLFA 1PJ9A 4W5UA 1QUMA 3LBOA 5DF0A 4HPXA 3EYPA 1KFWA 3IVSA 4O14A 1TTPA 1MI3A 2DVTA 3LRMA 1OT2A 4CGTA 4R27A 4C6CA 3DHDA 4BWLA 2TRSA 1THFD 4FOKA 3BAJA 1WDDA 4GWEA 4W7WA 5D03A 1XLDA 1M53A 4MY8A 1K4HA 1KM3A 4H6KA 1ZENA 2BSLA 1R8LA 3OQEA 4GABA 2NQ9A 3WQPA 1VBRA 3BLDA 4H9VA 2HVNA 4LCRA 2JF6A 2GK1B 4DO4A 3O15A 3W7LA 5TQLA 1CB7B 4YL2A 5LGZA 3OYZA 2L5HA 2CZVA 2Y5EA 1OC7A 3LA4A 2PDPA 2O55A 4GNKB 4JDYA 1HJSA 1U5VA 2C0HA 2EBNA 1KRMA 5D05A 3R94A 5I24A 3L2MA 2O92A 1UWIA 3HU7A 3PPFA 4AU0A 2EHHA 4PTNA 5HPCA 1CXKA 2YL8A 2E6YA 4DNHA 5BOOA 1MSSA 3UT0A 2RGMA 1W9PA 3VGBA 3LZ3A 4MNMA 1Z32X 2CZDA 5XIAA 5KEZA 1XCWA 1OABA 1UJQA 1KBIA 2WB5A 1WDSA 3SQLA 1DJWA 3RM9A 2R1KA 1KTBA 3V35A 1UQYA 3HOJA 2OT0A 4GBUA 1RY8A 2DZPA 3VGGA 1VYPX 2FIQA 3CZKA 4JR5A 4PUJA 2Q01A 3PBMA 5HR6A 5CPTA 5HANA 5HNTA 5HJXA 4UOQA 3T81A 1EZWA 4IHCA 2XGBA 1ZAJA 3VKAA 4NKCA 4HZ6A 2KX9A 3MY9A 3BAWA 3QYQA 4G6CA 1Q13A 4GCXA 3IS4A 1QO2A 3HF3A 5HBFA 3B8WA 1RV8A 3PBYA 1C8YA 2VDHA 3BW3A 4H9UA 5REQB 2OELA 3GTHA 2OEJA 1A80A 1ITXA 2WMJA 1YLVA 1M6JA 3KDNA 1WOAA 3VM5A 2PFHA 1QI5A 5I3DA 2DIKA 2ACQA 3PS7A 3BL3A 1ISZA 4Q22A 1TJPA 3H70A 4DJFA 5BWFA 1GG0A 3E12A 2F8QA 3TE9A 1E55A 2OPJA 3GBEA 4AZHA 3H8AA 5A1AA 3K4DA 5C54A 3O2LA 2H90A 3L21A 4UZSA 3UEQA 4R3UA 3AXMA 1WAUA 3KVKA 3EDJA 4DRSA 4JCLA 4N4QA 3BOXA 1OD8A 5KZ6A 1OVDA 5B7YA 5CJ5A 2YB1A 3ISIX 3AXXA 4WUIA 1JZ5A 4HSOA 2X1UA 1NQKA 3ANYA 4D6HA 4QDPA 1XV8A 1FFRA 4Q33A 1W1ZA 2NWRA 2MUCA 5HA7A 3N6HA 1X38A 3ARYA 1JCLA 1EYWA 4IMDA 1SJBA 3WJSA 1V6UA 3B8SA 3TX9A 3USBA 3V0TA 3JUGA 1P0KA 4GVHA 5CH9A 1BG4A 4D6CA 4B5UA 2G3IA 1R38A 3BTNA 1VD6A 3CQKA 5CPNA 3W7EA 1FWDC 4EK7A 2VVNA 2AQVA 1FWGC 1JAKA 1S2TA 1H2JA 5G4EA 5JXQA 5E9AA 5EMJA 3ITLA 4NASA 3PPHA 3N3MA 4ADSA 5C2GA 5GNZA 2QUUA 3QN3A 2QDEA 3AHYA 1D8CA 3VDAA 3FVMA 5AHEA 4TV5A 3W38A 1N7KA 3W7RA 3APGA 4ERGA 3QQ0A 5HWJA 4L4LA 3VC5A 1P7TA 3FXGA 1RQBA 1BSLA 2BGSA 2DUAA 5AYZA 2ZQ0A 3C0JA 3CLMA 3UXDA 2DVXA 1XJBA 3BGJA 3GDBA 3NM3A 4WLCA 1PL9A 1J10A 5BRBA 2VC7A 3HPZA 1MFUA 1B30A 2X1SA 3TAKA 1OX4A 3MV11 5FSDC 4XZNX 3GR7A 2Y8KA 1OX6A 1LDCA 2Z29A 3QXBA 3OYXA 5TBOA 3NGJA 4GYPC 2GVYA 2BBFA 3FHQA 5CJNA 2PI6A 2C1HA 4KWVA 1W3JA 3MHUA 4A21A 1TKKA 5T9BG 5AYYA 3VNJA 3U7VA 1JGMA 1GZ1A 3IGSA 1TMHA 3KLLA 2PTZA 3RM4A 1F6YA 1UASA 4AVNA 1TZ9A 2G3NA 3WD4A 2A0NA 3KVLA 1H60A 3F5LA 2ZVIA 4FHAA 4WSKA 3THQA 4DELA 4NXKA 3VNMA 3ERPA 3NL2A 4NUWA 1FWBC 2NQ5A 4AIEA 1WX0A 3ZXWA 3WNPA 2NLYA 4BJHA 4JDBA 1KXHA 2CZFA 2VCAA 5JBDA 3WFZA 3UF9A 1J12A 3DGRA 3UJSA 3WMBA 1W6TA 5C9UA 1QNVA 1GWJA 3PSWA 4GUHA 1GW1A 2FVMA 3WEMA 1GOWA 4K8HA 1U1UA 3CTLA 3THDA 1OHLA 2QDGA 3VIKA 3TW9A 3N9SA 3FJLA 5ABHA 3EDEA 3GC5A 1KWKA 5CPQA 1XYBA 2Z2UA 3MP3A 3LSBA 4S3DA 2EPOA 4P7NA 4UZUA 4LF1A 4MJ4A 1LLOA 3NG3A 1XYFA 4M6PA 5FEPA 1Q6EA 4FNPA 3LM3A 4NZ3A 2FPTA 1VFLA 1QK2A 4DXXA 3IUIA 3P0WA 3EXTA 3CMFA 1XRVA 3W2NA 1UD8A 3U7BA 4DY1A 5CBIA 2J9YA 1PZ3A 1QT1A 3TSDA 4WQ6A 3A6OA 3BG9A 4I9MA 3W2KA 2XIQA 5I6SA 2P50A 3L5MA 4WZHA 5HOSA 3KHJA 1UP3A 4IL0A 3TFXA 3LHUA 1OCJA 4GIRA 1RCOB 3B03A 3MTWA 3Q67A 4C91A 4L65A 3RN6A 1XYAA 1OCBA 1OBAA 1HGYA 5A6TC 1ZPTA 3DCPA 1VCVA 1KBBA 3BLIA 4O8AA 3VOGA 4GFSA 5TIMA 5E70A 1NWTA 1IEWA 2HCVA 2IS7A 5LNSA 4ZTXA 4ZO9A 4JY9A 2ZBTA 2Y8VA 3S8HA 2E3ZA 2O9TA 3RXZA 3R8GA 3Q4DA 2W92A 5ENLA 4X60A 4M6QA 2WVVA 1LYXA 1WZKA 2R24A 1BYAA 2VURA 5MKGA 1YW1A 1K8CA 4HMCA 2V5BA 1KB3A 3G1RA 1XIDA 3AI0A 1KBLA 2A3LA 3CZLA 3QOMA 3S5YA 5C9XA 5G1MA 1HFBA 1KM1A 3S5SA 1TPB1 3KBWA 3DX5A 3TH6A 4WHBA 4Z1AA 1OK6A 1ZS2A 3C5QA 1MW1A 1YNQA 4K1WA 2RKXA 5AHLA 3UR8A 1YDOA 2G95A 3TTSA 4KIRA 4KFOA 1OFOA 1SMDA 1WB0A 3LGDA 4GX9A 4JTJA 2E4TA 1KTCA 2PDUA 3AFBA 4ZCWA 2E5DA 3G22A 3THUA 1S5WA 3CGTA 3CL6A 4Z2HA 3W27A 2VRKA 1H3GA 4RXGA 1P43A 1TO3A 3PTKA 3BZGA 9CGTA 2FH8A 3L4TA 1SSDA 1GVFA 3UWUA 5AC5A 5H8MA 4AWSA 3BGGA 3ABRA 2CWXA 1WO2A 7REQA 3OZMA 5CZSA 1Q85A 1A5AA 2JKAA 1RALA 4LSBA 2VWTA 4LUJA 2PS2A 4HVXA 1QVBA 2ZUVA 1OYBA 3D3AA 4LYQA 1ICQA 1XPGA 2Z6IA 5IBXA 1PKNA 3PJWA 5D2TA 4DBUA 1S2UA 3WIJA 1ME8A 2EKCA 3BQ6A 4UQEA 3WMLA 2RDXA 3B40A 4UXDA 1CGYA 4ATDA 4U2YA 2V68A 3T7VA 3M0VA 1XSIA 3GKFA 4HK5A 3R4IA 2C3ZA 3E96A 4Q8TA 3CO8A 3EX4A 1E0VA 4HYRA 1XS2A 4GOAA 2R8WA 3SI9A 1Q6OA 2WAGA 2C7FA 2QJGA 3IUHA 3DHPA 3OGRA 3W23A 2INZA 3ZO9A 1UD6A 4XAYA 3W1MA 2DW7A 4F40A 4NNAA 4E38A 4MM1A 1W5NA 4EP8C 1TE1A 4Q32A 4LW7A 5B7ZA 4HK6A 3T4CA 1XQKA 1UA3A 1TX2A 1FTXA 4YTUA 3WJZA 4DAIA 5HJLA 3T9PA 1Y7VA 1SO3A 2IMRA 1XYZA 4EE9A 1Z69A 3GNOA 1D3CA 5H6HA 3QW4B 2WPGA 2A3HA 1OY0A 1SW3A 2WM1A 5CXPA 1HQTA 1VENA 3GH7A 1E9IA 4GH1A 1JZ7A 1JDEA 1X97A 4FIRA 5F4WA 4OV9A 2P3ZA 1HJVA 5HMFA 4MTVA 3NO1A 2OGYA 1S38A 4CD4A 2W63A 1OGGA 4DJDD 2FTWA 3KS5A 4XBKA 4AB4A 3QBUA 5JQ9A 2GQ8A 3SRKA 3CAKA 1ADSA 3TIMA 4KESA 3WEZA 5K9CA 2WNZA 3KOYA 2WK2A 4GGHA 1UH2A 1J8VA 3NPUA 4WKFA 4LY4A 1O5RA 1QBAA 4G5DA 4JL1A 5FOOA 1O4UA 3TJXA 1LBMA 3W72A 1Y5VA 4QISA 2WKGA 1EDTA 2DIJA 4JKLA 4UR9A 2J4GA 2WZTA 9XIMA 3UU0A 2XVGA 3BARA 1JQVA 2Y5JA 3L9CA 4C60A 3ICJA 3UXIA 4FAMA 3ONBA 4JTDA 2GL5A 4F2TA 3MSRA 4CNPA 1FWNA 3W1LA 4RCXA 3SSJA 3VIJA 4TX9A 4CD5A 1XYMA 4MSSA 1FWAC 3B9AA 1Q8JA 3E0VA 2QGYA 1J96A 2AGKA 1LG1A 1BVZA 3W6LA 3SY8A 2WC7A 1UZ1A 3VAVA 4LBSA 2A79A 1M01A 3ZWSA 1TJ2A 3FN9A 3R25A 4NAFA 4NZ1A 2OYKA 4BI7A 2CWNA 3QQWA 4AEOA 4I5RA 1SJCA 1XICA 2BHZA 4QG9A 3U48A 4QFUA 3TJLA 2QYGA 4AF0A 4E8CA 2ZVRA 3HPXA 4RJEA 3TQPA 1QI3A 4H9XA 3G8EA 3VUSA 5ABFB 1FP9A 3Q37A 3ZT6A 1ZTVA 4O0ZA 5CC5A 1UYQA 1TZ7A 1RY0A 5G2IA 1EL3A 2F6KA 3HV9A 3WH5A 3GR4A 5AHNA 2FDMA 3I4KA 3CWOX 3TYDA 4INFA 4JTKA 4ZR8A 5A95A 1DV7A 4WD0A 5ABGA 1GK8A 5JU6A 1CIUA 3UG3A 1S5TA 3C0SA 2PPGA 2YYUA 3CQJA 2RDTA 3MMDA 3E5PA 1J93A 4C6PA 5G1YA 3VCCA 1ISWA 4AY8A 3N2BA 5F2GA 2JEQA 1OM0A 3IPWA 3O6YX 3GWQA 1Z6KA 1A5LC 1BRLB 3DBPA 3OW1A 3S1GA 2PEVA 1LUCB 2VCBA 3VNZA 2PBOA 4Y8EA 3URBA 1N2VA 3NQ2A 4R33A 5CZ0A 4CQAA 4CVUA 3DH7A 1VEMA 1Q7ZA 1Z89A 3BSMA 3WK2A 2QUMA 4JYEA 1GORA 3EWDA 4IG2B 4OBSA 3WUBA 1QO5A 4IWWA 1GEHA 1SVDA 1NWRA 1BYBA 1TWWA 4HNOA 3WJWA 3BQ5A 4DBDA 1TE6A 1IT0A 2EO7A 1KFKA 1JPKA 3AYTA 4IF2A 1M3UA 5E6ZA 5FI8A 5LIKX 4J1OA 1RD6A 3ZYZA 9XIAA 4HN8A 1RJPA 3FX4A 4QGCA 3PG8A 3UA4A 1XLAA 4XQ6A 3NZ1A 4O8RA 2NV2A 1OFAA 2B0MA 1W8GA 2FLIA 3HQPA 4UTMA 3VD9A 2VC5A 3R12A 2BY1A 2E28A 3KEHA 3MI3A 2GGGA 2P88A 3SW6A 1DWHM 5BXPA 3E38A 3M0ZA 3M6DA 2CLHA 3LPOA 5D38A 3STFA 3LCIA 5D09A 3W2JA 4Q3MA 1OIMA 3EOSA 4GG9A 3R0DA 4LBRA 4QR6A 3BWWA 4R9XA 2OYMA 3S47A 4LUSB 4JTAA 2VI0A 3VDHA 1CGTA 1QNRA 4H41A 1JRBA 4RDZA 2D73A 3TFCA 4LUTB 1E9YB 2GPTA 3KTSA 3PZOA 5HMSA 4B92A 2WMIB 3CHFA 1FH9A 4M82A 4EOUA 2PP1A 4FALA 1J5SA 2C16A 1XGEA 3DFQA 4IPJA 1W1VA 1U5JA 4HZMA 3LS9A 4JQ2A 3VIFA 4A2SA 3WJXA 3HFYA 1OEPA 4GI9A 1DIKA 3PFMA 4DXKA 1HKJA 3PM6A 4XG1A 1H7NA 1Q6DA 2JKPA 3G8RA 3VMNA 4MAZA 4Q7IA 2E6FA 2ACUA 2ZIDA 4N02A 3GQYA 1EJXC 2TMDA 2WKJA 4DX3A 1XLIA 3VINA 6XIMA 4LQ1A 5C7HA 1W9DM 3UD6A 3B4UA 1UKPA 2PWDA 3D47A 4HNNA 5JUVA 4S3FA 3IK4A 5I77A 1EF3A 1OIFA 5CGQA 3WBWA 1Q3NA 3PB0A 2E68A 4D6DA 1TVPA 3HG2A 4DWSB 3MSYA 3TR2A 3FK4A 4A35A 1W1B1 5DRIA 2WMGA 3D46A 3LLFA 3ZLHA 4AX6A 1XIFA 4UWMA 4URIA 4LC6A 3RITA 3U4FA 1DIOA 3C86A 3NPXA 3VO0A 4A29A 4G2DA 1TIWA 2Y8UA 4MB1A 4HOXA 4GACA 3P60A 3O05A 1FBAA 4DJDC 3SRDA 3TSMA 4W84A 1S3HA 4H2CA 2VUNA 3LM7A 3W26A 3WUGA 4GUIA 1D8WA 3WX7A 3I6TA 2QVHA 3L0KA 2NX3A 4BR1A 4NJJA 3EPMA 3AWNA 3FA3A 4S3GA 3PTMA 3BSGA 3VNKA 2GQAA 1Z41A 3GNPA 3SQMA 5GVJA 1EOMA 2BB0A 3M46A 1NWUA 3TYAA 1SW0A 3H6OA 2Q09A 3WF1A 4OBRA 1PCWA 3KVJA 5D04C 5EKYA 4UFLA 3AC0A 4RXFA 5M5DA 3P84A 1O1HA 4IUGA 4LC8A 5D2VA 2EG6A 4EVZA 2QAFA 4NZFA 2NV9A 2WJDA 3GIQA 3R2GA 4LH8A 2DU2A 1V4YA 1IEIA 4GUGA 1B0IA 2PCEA 2VX4A 3ALGA 4JTEA 3USZA 3NFUA 2CKRA 3Q65A 1EWEA 1RJRA 2QJNA 1KFLA 3WH7A 4RE4A 4XVEA 3S3GA 3W76A 2VP8A 4YTTA 3CL7A 4E2OA 1JNDA 3RFAA 3W81A 4GZEA 4PMQA 2AAAA 3QLLA 3DI0A 2CHNA 5G1TA 2JF7A 3TWBA 3S4TA 3EB2A 3DG3A 4DB7A 4REQB 4BQ4A 1FDZA 2ZZ2A 3A4JA 3JRKA 3UR2A 3RJXA 3VIGA 2GUBA 1EB3A 1E40A 1K8YA 1LBLA 1E56A 3WYZA 3LOTA 1DIEA 2Q3RA 1BQGA 3QJAA 5A3HA 1X6LA 3CEPA 1JXKA 4AIBA 3M0MA 4HMEA 1UG6A 3C2RA 3ATYA 4OZOA 1W3NA 1MW0A 2CLMA 3SCQA 2VGBA 4I7UA 3PANA 1W9UA 5BMWA 2YXGA 4DBSA 3WBAA 1RH9A 3H53A 2GUYA 2NVDA 3AXKA 3OODA 2BDQA 2R1PA 4O1CA 3WF4A 3H2FA 1P1MA 3LSCA 4PL1A 5G4WA 2A21A 2RHGA 1WDWA 4PULA 2GZXA 1MXGA 3GDMA 4NJKA 4ROPA 3BO9A 3FAXA 3W7IA 3PHAA 5LA2A 5XINA 5PTDA 3A24A 4QLJA 2CLLA 2PURA 2PWVA 3WF3A 1EJ7L 3PWGA 1OCNA 1XUZA 4N42A 3KBSA 2NW0A 1SZNA 1KD0A 4F66A 1M68A 2AQOA 3LI0A 4DLMA 2DT0A 4ZQNA 2VRJA 3BGAA 5DCEA 4Z1CA 4IMAA 2XUCA 3PWAA 9RUBA 1DTUA 4UR8A 2WJFA 4ADTA 2XDFA 3PBVA 2TPSA 1TWZA 2QPUA 4XTIA 5FJTA 3MKCA 2OT1A 1PDYA 5CZJA 3HQOA 5EMLA 4QX4A 3C8FA 3I65A 4AEEA 4B3LA 4NYUA 4Q4MA 4R7JA 3OG2A 3H23A 4DJFD 3ZVHA 4UOJA 3O63A 4KWSA 1UIOA 2Q71A 4E4PA 3GH5A 4O1AA 4PMUA 3GFYA 4MADA 2QCDA 4RE0A 2D2OA 5CZKA 3WQ5A 1T40A 2CBVA 3S9IA 3OLEA 3VABA 1OFRA 2CW6A 2VX7A 1CTNA 2J79A 2OZ0A 4OU1A 4HHPA 2EKGA 4E6MA 3B3DA 2CLPA 5DANA 2ZUMA 4US6A 3LGEA 3NQ6A 2DJLA 5BZAA 1UWTA 3VOHA 3UZJA 3VCRA 3E0LA 4PC8A 1NVMA 1O68A 2VX6A 3CZEA 2E09A 1V3KA 3LDVA 5HNUA 4E4FA 1J6PA 3EOUA 3QHOA 3L2LA 1SSGA 1MEWA 2I16A 4O4WA 5TNVA 2ZE0A 2VEGA 1NWSA 1K6WA 1YE4A 2V6AA 3T6CA 1HT6A 3WQOA 1RP8A 4JXCA 2FFIA 3KL0A 1V6XA 4ORMA 1O5KA 2YFNA 2G97A 3KBMA 1VHNA 1D7KA 4JX4A 4QCEA 4LXFA 1PYFA 2HISA 1IYXA 3CV1A 4FIQA 4Z2KA 4QJ3B 4ZE4A 1FXQA 3UGVA 1K77A 1K7EA 2Z6JA 3G1XA 4PUEA 3CEUA 3WK1A 3B8DA 3TXZA 2REQA 1A0CA 4BA0A 3WLNA 1F5ZA 3N4EA 1EYEA 1TA3B 3WH9A 3W1AA 3CTTA 4B4FA 1O60A 4I8DA 3LNPA 3PZ9A 3AHXA 2FZNA 3G1AA 3HG4A 4GPNA 5KTLA 4QJ1A 1IV8A 4WKHA 4KERA 3UWVA 3QPYA 1YDVA 2QR6A 3IUDA 4Y9AA 3KM8A 3AZTA 3O7UA 4JTFA 5I5RA 1WCGA 4TMCA 1UMLA 3H7RA 4AW7A 5DMMA 1XPYA 3AIWA 3W86A 6A3HA 2V5KA 4QDMA 5A5WA 1U5HA 3S83A 4AIOA 4JYFA 1E1CA 3QV9A 1SFJA 4MNLA 4PMDA 4DPPA 4ZOBA 2WCGA 3C2FA 5H8UA 3UPBA 1RHCA 3UCCA 1QNOA 4W7VA 2PWGA 2FZBA 3BCFA 3AIBA 1VFFA 1Y5WA 4XZIA 3W1XA 3IIVA 3GIPA 1UOZA 3SZ8A 4XZBA 4LAKA 4V27A 4YVPA 3VIHA 3O8AA 3STPA 1M5WA 4HA1A 1B4EA 1A47A 3CL8A 3TQ0A 5I00A 4ZEPA 3TN6A 4FNTA 4TR9A 3ZMRA 4GJJA 1DP0A 4IIEA 1ENUA 1XI3A 4KT2A 4TV6A 3SN4A 2YL5A 2EPNA 2CNCA 1JI1A 3HZ3A 2EQDA 3L0NA 4S39A 1JI2A 3SIZA 3QOKA 2UZ9A 1R3RA 2JK2A 2PDQA 1VPQA 4R85A 4O54A 5FF7A 3GDTA 3VNYA 3CH9A 1H7OA 4PUNA 2PC4A 2QPXA 1TZZA 1UPMB 5KINA 5JBEA 3Q58A 4US5A 4YU1A 4UIOA 2ACSA 2VZOA 4UQ9A 5D4YA 4F9DA 2JQXA 3WCZA 1ZBKA 3MMWA 5BU9A 4LNCA 2QVNA 1B4KA 3S42A 2VEKA 2YPIA 3I7SA 1NDVA 1GVOA 2Z1WA 2PBGA 4DXVA 3UXLA 1JPMA 5D9NA 3A4XA 2V5LA 4H3DA 4CKQA 3MUZ1 1PXGA 5KITA 3AYVA 5EPDA 4PTWA 3WH8A 2PDBA 2BASA 3THAA 4JFWA 3ELFA 2W4XA 5BYWA 3N2OA 1ONRA 4M19A 3MZNA 1ZJAA 3NURA 1TPEA 4GKLA 3M7SA 4YMZA 2ZC1A 2KZHA 1XC4A 5FJOA 4UTUA 2DGAA 3HA1A 1DJIA 5BMXA 4O1FA 4B91A 4QS6A 3KZPA 2WC3A 7ODCA 1C9DA 3FY1A 3NAVA 7TIMA 1L2QA 3QKZA 1VAHA 2ADAA 2QHAA 1L6FA 1ODUA 2E1DA 4FNRA 4GYPA 3W6YA 4XISA 5A2AA 1TTJA 2VFIA 4FXJA 1J79A 4AHOA 1DWAM 1T7LA 2E0PA 4QG6A 1G6CA 3GHRA 3FV9A 4GQQA 4IJRA 3F4VA 3CM4A 3NA8A 1LBFA 2AGTA 1P5BA 3OIXA 3TC3A 3DKJA 1EC8A 1XDJA 3M5XA 1VJIA 1WP6A 3RF9A 3POCA 1QJWA 1H1NA 2IQDA 4Y9MA 3GO2A 4ALDA 2XPKA 4AG0A 5LGXA 2PZNA 1H09A 4CNOA 4NAEA 1JDCA 2R9RA 3DGBA 1R9YA 3AWOA 2W27A 2X40A 5K4XA 3SN1A 1QI0A 3LCLA 3FGCA 1EIXA 3APYA 4PUWA 4ZOEA 1JQXA 3WLQA 2AMGA 2ZCGA 1E4IA 3NOYA 4AD5A 3T78A 3QR0A 1XIMA 1JYVA 3DC0A 1W17A 3RO8A 2AL2A 2ZDSA 4ZFMA 1G69A 4JIIX 2G3MA 5BNKA 2YDAA 1OSEA 3KXQA 3WQEA 1BVNP 3QMSA 1PZ0A 2Y62A 3GDKA 1BFNA 4D71A 5AYXA 3QTGA 2VGFA 4AD0A 5GPRA 1TR1A 4DZAA 4AMCA 3F5KA 3AMDA 2V81A 1Q5MA 1P7TB 1PX4A 2YW4A 4GVGA 2R14A 1G67A 1ECEA 2R1LA 3MBDA 4L6OA 3WLPA 2VL4A 2QZRA 5K4ZA 2ZX6A 1OX4B 1NFPA 1Z48A 3WF2A 3AXHA 3VMPA 1P0EA 1RLCL 3BLLA 2HZGA 3I68A 4Y96A 4MB5A 4JX5A 4UCGA 4CNNA 1EEPA 4J3WA 1V6VA 2MNRA 2NQHA 4CNTA 2FGBA 1Q8AA 2WCAA 4HOZA 1F2JA 4UQAA 4KETA 2TODA 1UCWA 4PRWA 1G4TA 2CCRA 2ZFAA 3CIWA 2NVCA 2G50A 4ZENA 3HQNA 4GISA 5IOBA 2J9XA 3CHDA 1B9BA 1S3TC 3M64A 4OFCA 4MVAA 2QULA 1GPWA 4F0HA 3M0HA 2G5WA 3WLTA 5FEWA 1L9WA 1LOQA 3PJTA 3AQUA 1PZ2A 4IFOA 4C5ZA 1OGBA 1CBGA 5D2XA 4K36A 4D1JA 3LI1A 3V18A 1QW8A 3QGAC 3UVAA 3ZR4A 1JR1A 5E93A 1XLMA 2CFFA 3SUSA 4PRTA 1PX8A 1XXXA 2V67A 5C5YA 4PBEA 4LOCA 3VXGA 3OHIA 1NTHA 4I9JA 1X6NA 4E2BA 1DXEA 4PUDA 4MLJA 3NXLA 1TWDA 1FWJC 4ATLA 4HB7A 4H6QA 1WKDA 1GEQA 5BXTA 5HR7A 1E3ZA 3CU2A 2D3NA 1JUKA 2X2YA 2QCHA 2Y4SA 2WSYA 4QEHA 4JNYA 3GZAA 3WD1A 4DF2A 2ODOA 2BVTA 2FHFA 1WBJA 3LPFA 1RVGA 2WMHA 4GY0A 1D2KA 1TV7A 4LCSA 1IEXA 1LTDA 2ZC8A 2FGLA 1QNQA 1EGZA 3ZJ6A 4YTRA 4PCTA 1W3IA 5GQBA 2EEXA 2QF8A 3AJXA 1XYCA 3TTEA 4CN6A 2ZRWA 4UFMA 1BYCA 2C79A 4L9YA 5AB3A 3GNNA 1CLKA 5E1QA 2QXWA 1N8WA 4JTQA 1XDLA 1TCMA 4QLLA 3T55A 3KBJA 4M6VA 3F5JA 4J28A 2CZ5A 5F2MA 1B54A 5ECUA 3NUKA 2C13A 5A6AA 2RH9A 4XD3A 3M9YA 3TEVA 4IJCA 3DN5A 3R6IA 4GNVA 1H49A 1EPVA 5D02A 3UVIA 2AQWA 4WEVX 1UJPA 4PN2A 4JPGA 4K7YA 2I5GA 4FNSA 4EWJA 4O18A 4JFSA 4MWAB 3MBFA 2WVVB 1VGAA 3QM3A 1EJRC 1UH4A 1XRSA 2J75A 4FI4A 4LV9A 3QZAA 1BG9A 1TPVA 4JTTA 5MKGB 4AZCA 3QZEA 3GY1A 4CN4A 4PBFA 3LHTA 3VNDA 1LF1A 2PLMA 3BW2A 4GX8A 2QIWA 4DUXA 5FESA 1N55A 3FAWA 4RE2A 2PDLA 4J3XA 4L9ZA 2CPUA 3A3XA 1E6NA 4QJ5B 2WQPA 4C6IA 1U22A 1KCXA 1E6RA 3NXFA 2XIIA 1Y5XA 3BV4A 4MZ1A 3W1NA 1T96A 3C2EA 4GY1A 4XD6A 2PU0A 3B0PA 2OQYA 3KX6A 1W1A1 4AH7A 5GJPA 1UC5A 2J88A 3EEZA 4NHVA 5HATA 3BURA 2Z26A 3WFAA 3R8HA 4QEEA 1WZLA 4L1GA 2F61A 1XFCA 3WLLA 1XKYA 3B06A 4LCQA 1D9EA 2HBVA 4HNUA 2HXUA 2XZ9A 3SGGA 1ONEA 3V0UA 3IV8A 2QLYA 7REQB 4DUWA 2B4GA 3W4RA 4GC4A 3GXIA 4OUIA 3SBFA 3CBWA 1BWLA 4BKNA 4KPLA 4XK2A 3U2OA 1M03A 3W2MA 4QSHA 5A6JA 2FGZA 3VKKA 4NZ4A 1W31A 2VDIA 3GW0A 4JX6A 4FO4A 1VYRA 3DU0A 3RPMA 1H61A 3M47A 2DT3A 1RR2A 5HMEA 3NZPA 3BC9A 5K9DA 1GVEA 2QMJA 1UKOA 3F03K 3O6AA 4Y90A 2DV0A 3EEGA 1QOPA 4G7EA 4KRZA 4P7RA 1PHWA 4OE7A 1AW2A 3NL6A 1JUEA 4B2DA 5E0FA 4GVFA 1RD5A 3A4WA 2IW0A 1DJXA 2FB2A 1K7XA 1J6OA 5BW6A 3WLRA 4L6HA 1EPXA 4V2XA 1VFMA 2ASHA 3BLOA 4MJ2A 2DZUA 2J7BA 3FNDA 1NOWA 5GNYA 1IE7C 2ISWA 5K3VA 3NQGA 3ATZA 3S0CA 2GSEA 2XWDA 3S6TA 1DJYA 3V75A 3H22A 1MDLA 1F05A 5LNUA 2QNEA 3RX3A 1CNVA 4PFHA 4C1LA 5D30A 4P61A 4MAVA 1REQA 2XJ7A 3PTQA 4YJ5A 4QJ4B 1EIBA 3OIHA 5HWNA 2IUZA 4C6LA 4XAFA 4MLRA 3UGRA 3FA5A 2DDXA 5LHEA 1HNYA 3N3TA 4F9JA 3FKRA 3CHEA 1TUFA 1DYSA 4LFYA 3LHZA 1FP8A 3ARQA 3H12A 1BHGA 3FXYA 4HA3A 4TUFA 4S1FA 4B5SA 1AH4A 2FH6A 2OGJA 3PZMA 5HUOA 1QPKA 4K7VA 1FHDA 1SO6A 1VPXA 3AISA 1XWYA 2NT1A 2W3ZA 1UC4A 3MUAA 1E6SM 1NEYA 1L6SA 3O0FA 4FXFA 4IGHA 2OOGA 1PTAA 1TMLA 6XIAA 1I2RA 2VRQA 4MKVA 1R9XA 1QPRA 4LV4A 4XVDA 2F7FA 1QRQA 4DPQA 4MHBA 1PIIA 1EC9A 3AMGA 4ATWA 3B8VA 1W1PA 2GUUA 5ABEA 1UD2A 3SJNA 3VOJA 6REQB 4NZCA 2VX5A 1FH7A 2XN0A 1FX6A 4NVTA 4A4AA 1F6PA 4QROA 1KKOA 2D0HA 1QPQA 3QPEA 1OZQA 3PB2A 4BF5A 1RJQA 4JTIA 4UTJA 1H4PA 4YHGA 3OGSA 5LNWA 1VBHA 1KLYA 1UKTA 3N04A 1K3UA 1QATA 3BDKA 3TCSA 4KKXA 4BI5A 3ARTA 3BAXA 3QZ6A 2GYIA 5DY2A 4DWSC 1UD3A 3CAWA 5HQMA 4NAFB 1PV8A 3EZ4A 3S9ZA 4PZVA 3CYJA 1E70M 2O9PA 1ELSA 2V3DA 4RW3A 1ITUA 4MF4A 4L7ZA 1YTKA 2BOFX 3KTCA 3AZRA 3K8LA 4AF0B 1EH9A 1EBGA 1TUXA 3VDGA 3ARZA 2IKGA 2BXZA 4NT0A 4FLQA 3FOKA 4JIRA 3GZ3A 3W1UA 1J2BA 2Q6ZA 3DFNA 1MEIA 2J25A 2CITA 1Q4NX 4PYSA 4ES4A 3IJLA 3NL5A 1Q2SA 3NOEA 3MW7A 4J40A 4XUYA 1J0KA 1DJZA 1GUVA 2VXNA 1FUYA 4GC3A 3N9KA 2NT0A 4DO7A 1NDYA 1V51A 4IIDA 2XISA 3DEQA 1JPIA 3QMRA 4E8DA 2WZHA 1UUOA 3WQ6A 3T40A 3DI1A 3RPTA 4OOUA 5A8PA 3EXSA 4AXKA 3MUY1 4R7WA 1F3XA 4AIUA 2ZZ1A 3H7VA 3EX2A 1BSIA 3LUTA 3SAZA 4HBKA 4ZO6A 4CU8A 1R86A 2HRWA 3CO4A 1MQRA 1HL8A 4HD5A 4AFYA 2R1NA 3IJ7A 2WM0A 4GFIA 2W62A 1TB3A 2FPVA 4LEFA 3RILA 1GJUA 1PKMA 5U4NA 4PMVA 1FWRA 1NAL1 3GM8A 3W02A 2G4FA 3NM1A 3LRKA 2WSPA 3MCNA 3EB3A 5EU9A 2HS8A 2I5QA 2F2KA 1M41A 1U2YA 2Z2AA 1UZHA 3BLKA 1J01A 5G5IA 5I06A 3T0TA 5EL1A 1FCVA 3H7UA 4B3ZA 5C6MA 4U28A 2XN2A 2AL1A 1PDZA 1GQJA 3OVGA 5BXRA 3EKZA 2P5NA 3WBXA 1R7OA 3F1QA 3S2MA 3DFTA 3D3FA 3PBUA 5DX7A 5HDRA 3UNDA 1JFHA 3W7GA 4DO6A 4DJDA 2OODA 4NI3A 4U3AA 3I3DA 3UG5A 4S23A 3NWRA 4Y9OA 4UTKA 5BROA 3QHMA 1F3WA 4ZL1A 3W3OA 3AHVA 2DFAA 3QF0A 5AZ1A 5FCZA 2CETA 2QUVA 3B9NA 1WKEA 1ZY9A 1OYCA 1W2PA 2XTKA 2J7DA 1K1DA 1ZRQA 3AXIA 1NF0A 2Y85A 1EGMA 1V3HA 1KCZA 2W67A 5CBBA 3BE7A 2VWSA 3PZGA 1CLVA 1G7UA 3ABXA 5HMDA 1JD7A 1HKIA 3ARPA 2WQDA 1JCJA 2P3EA 4GZIA 3NZQA 4ZBCA 3H2OA 3G2GA 2PRHA 3TQKA 3DC8A 2WCSA 5I23A 2HVOA 4AXNA 1A50A 1YXCA 2HDJA 4ICNA 3PTDA 1A5SA 1XF0A 1LG2A 3G18A 3KP0A 4WJXA 2GGJA 3FA4A 3LMYA 1WDPA 3HJZA 3RU6A 1K9TA 4J35A 4HP5A 4LVGA 2GDVA 4YNGA 4K38A 2OEKA 1SPQA 1XH1A 4K3ZA 4J2MA 1RPXA 1ICPA 3MA8A 3ARUA 2W6RA 1UP0A 1GVYA 3URNA 2PB1A 1NFGA 3GXPA 7PTDA 4A3YA 4OT7A 4MKNA 2V82A 4F0RA 3KS6A 4LS0A 1H0GA 3CNYA 4HOWA 1GYLA 1GQNA 4LVDA 2WMFA 5A94A 3NQFA 2HROA 3ZWTA 3M6YA 3UZXA 3CHVA 3PK7A 3W74A 1C29A 2GK1A 3O0KA 3SGZA 4W8BA 3BLFA 1FQ0A 1Q6GA 1A53A 3TNBA 3WY1A 1GG1A 2PF0A 3UWQA 2J7FA 4CD8A 4K1GA 3H4WA 2NXIA 1EXPA 5GJNA 1ZNNA 4QSFA 4OBTA 3T09A 1LWJA 3EWCA 2Y0FA 3SQSA 3ZOAA 1AJ2A 2JBMA 4UNIA 3DHFA 4H7ZA 4HHMA 3MQTA 2DQWA 3O3RA 1R2RA 3TCEA 2Y7EA 3CT2A 2XFRA 1SFSA 2DEPA 4J5NA 4RZ4A 1MQQA 3ARXA 3CZGA 1SW7A 3HMCA 3UY8A 4ACZA 1SMAA 3C3NA 1EOKA 2FYMA 4M3PA 3NTYA 2DSUA 4P7OA 5IDZA 3WH6A 2IQ0A 3B8UA 3PBWA 4J3SA 4AY7A 1XBYA 4DZHA 3P61A 4OJYA 3PZVA 4AD4A 3H2MA 4CQCA 3OEXA 1FCUA 1PO9A 5F4XA 4F0LA 2ZRYA 2PDJA 3MSDA 3IJDA 3BAKA 1PYMA 3AS0A 4NZ5A 4S3CA 3FEQA 1DWFM 1ZHAA 3V5FA 1BPLB 4O15A 1QNSA 2QUNA 3W82A 1E6PA 3HGRA 2QJIA 5FAJA 4X2RA 3WBEA 2GJXA 3REQA 1FHVA 4PCSA 3IWPA 1TV5A 4RW5A 3DFYA 1F74A 3FLUA 4W93A 2VR2A 4D72A 3WSUA 1GHRA 4GYJA 1XRFA 3T8LA 4R53A 4KFPA 4XD4A 3WD3A 3KWXA 1KR0A 2HS6A 3QW3A 3EDKA 3BCDA 3BLEA 3PG9A 1NY1A 2D3LA 4JTSA 2PTYA 1B3ZA 2G41A 4HCHA 1KXVA 3NDYA 2ZXBA 3JS3A 2WZIA 4RK8A 3N25A 1GOQA 2QIIA 1WOBA 4TIMA 1YDNA 2I9EA 3MKKA 1V6YA 3N17A 4NILA 2QEZA 2GWNA 2VZSA 3EDFA 2WMKA 2PDIA 1VEOA 4NZJA 3LBCA 5CPMA 3GYCA 3GUGA 3M44A 2E8YA 5I0DA 1ITCA 3RNDA 4GYKA 4BQ3A 3ZZ1A 1J4EA 3MYOA 2Q8LA 2YA0A 4L4MA 4L5ZA 5CEWA 2J66A 2Z1KA 4GXMA 4JAWA 4FF5A 3EWWA 3KLKA 1AZ2A 4ZB2A 1ZCOA 4WCJA 1UB3A 4UB9A 1IGSA 3R79A 4US5D 5I3KA 3A22A 2Z1XA 3AHTA 2HE5A 1A49A 1OJXA 1VBUA 4AHPA 3WUFA 3GTNA 4O19A 3LK6A 3GG8A 5FF4A 4A2RA 2OSXA 4N4PA 5J8LA 4JYDA 1RAKA 4CUCA 1IIHA 1XM3A 4QTGA 4TXEA 3N2XA 3PUOA 3LERA 3TSBA 3NL3A 4RV8A 3KRZA 2B81A 3ZJKA 1TV3A 2VTFA 5LKYA 3O6DA 3I3EA 3RK8A 4F4RA 4MZ8A 4Q7BA 3GG1A 3RCNA 4GNJA 3VGHA 1XIIA 5EMYA 1WUFA 5AYBA 3QY8A 4J7RA 3W01A 3KE0A 1MDRA 5JH2A 8XIMA 1X8CA 3VYLA 1E72M 1VJZA 2QKFA 3MWAA 3VKBA 2Q8ZA 3QVQA 3F2CA 4M1BA 5CPLA 3MCOA 2QUTA 3SRFA 4AWTA 4RUBA 3ZVHB 3LPPA 4PTMA 1RBLA 4UFHA 3VX1A 3DZ1A 5FJUA 2QCDB 3AYSA 2OO0A 3GU1A 4C6OA 1XG4A 4XAGA 5AHIA 1ZAHA 3ANVA 4PFMA 4AEFA 1KM4A 3PPGA 1KQYA 1RA5A 3W1RA 4DAFA 1V02A 4PODA 1XSKA 2RJGA 1JYNA 3QYSA 3S5NA 3CXOA 2QS8A 2YLAA 5ABTA 3E0WA 3TN5A 1YPXA 2BVWA 4KCTA 2DZBA 1P48A 4JEQA 3QSRA 4XAPA 3KCOA 3H26A 4FB7A 2X7VA 1H63A 4XZWA 5FL1A 4L1WA 2QT3A 1J18A 3GS6A 3OLGA 4C65A 3L66A 1DOSA 1RVKA 3MO7A 4PEKA 5D9MA 4KGJA 2VEMA 3NQ8A 1XD1A 3OP2A 1LQ0A 1OFEA 4QITA 2GFTA 3DESA 1DQUA 1BQCA 1C8XA 1I9CB 3RJYA 4C1NA 2VEIA 1XISA 1FA2A 1PB0A 5IFTA 4YTQA 4P2VA 3R7MA 3HIJA 3PY2A 2I17A 1C92A 2W9MA 1JNEA 1FWSA 2SFPA 2GLKA 4PSPA 1WAWA 2REQB 1UOKA 3VK5A 2ATMA 4E5TA 3NDOA 2J24A 3AROA 2X1IA 3WK3A 3A5FA 4V1XA 3UYCA 3GSMA 3LD5A 4FXSA 1PTGA 2VGIA 1GQKA 3V7PA 2GGEA 2BZNA 2NV1A 4LJ3A 1AQ0A 4Q8PA 1GOMA 3MSGA 4DI8A 2Z1SA 1TFVA 4ZODA 1QPOA 3BCJA 4JFUA 4I3GA 4E2DA 4FR6A 3A3WA 1XUUA 1V8EA 3ANUA 3U8GA 1JZ4A 3M16A 1E1CB 4CVWA 1W54A 5AVHA 3UBPC 2W66A 2ON3A 1SUXA 3WNOA 1HXJA 4GI8A 3DFHA 3K8MA 3WD0A 1ONWA 3G1YA 1V08A 1W5PA 1E71M 2RAGA 5A8OA 2ISSA 4XBSA 3CIVA 1QTWA 1V7YA 3T42A 4O57A 4O1BA 2ZZ7A 1AFSA 3RCMA 3JW7A 3WL1A 3II1A 5D8WA 4IMCA 2PU1A 2EGZA 4ICCX 3NQBA 3TROA 5CAHA 4D6FA 4Y9NA 1Y65A 3KHDA 4H9ZA 1C9WA 1A5OC 5XIMA 5JBFA 3CAQA 4PMXA 4K8GA 5CLTA 4BEUA 4GI6A 1V3LA 1WBHA 1JYXA 4EIVA 2EXOA 3C61A 2FPYA 2E40A 3LZ5A 4GHRA 4IM4A 1YPIA 2PDGA 1HG3A 3VZXA 5CLWA 1LL7A 2ZE3A 5BOFA 4QNEA 3CUJA 5FIPA 1BF6A 4A3RA 2PGEA 1GCYA 2G4JA 1OC5A 2Z2BA 5EGRA 3WQ4A 3H4GA 3TOYA 4WF7A 5F7UA 3L7RA 4RZ6A 1GPFA 3LNMA 2V3FA 4FLRA 2F38A 4JKMA 1DVJA 1RQEA 1XH0A 1RBAA 1LT8A 3CPGA 4I6VA 1TTIA 1Z7AA 3ZLFA 2VCCA 2ZTJA 4ENLA 4TVCA 3NQEA 4ERAA 2BY3A 3XISA 1U30A 2TAAA 4XTDA 3M5ZA 4U10A 3VIPA 3RLVA 3OU8A 1TX0A 4GK8A 3W7QA 3F2BA 4UTHA 1O66A 3HGJA 5BXSA 4NP7A 1ALDA 4GH3A 3DYOA 3L5AA 3UERA 3OLIA 1EP2A 4WSHA 4I8YA 1DJQA 1YIXA 1KGWA 2D69A 3WF0A 2HVMA 3O9NA 3GC2A 1Y0EA 2CLKA 1PHQA 2BODX 2R91A 3CWNA 5EMKA 4C7FA 3EWUA 2ZX5A 1S1PA 1SU5A 1HGWA 4L56A 4QBXA 2GOKA 5A6BA 4YPJA 1FXPA 4OWGA 1KM2A 5EMUA 2WHJA 3QV8A 2WPBA 4JOMA 3NGFA 4X22A 3FYPA 3P2VA 1XIGA 1J0HA 3WFLA 2GVEA 3KRBA 1FFQA 2GJPA 1UUMA 3NZGA 1O1ZA 1WXZA 4NNCA 1HP5A 2WV8A 3L0GA 3U4AA 1V77A 3P8IA 1IT7A 3RCYA 3TZNA 4RNJA 4H8UA 4LT9A 2O4QA 1VQTA 1TR9A 2DY3A 1H11A 2DQXA 5FKYA 1E51A 1HKMA 1HUVA 2WSKA 1NARA 4HIBA 4CNUA 5IHSA 3K2GA 4NAEB 5DRCA 4F79A 2H3BA 1HKVA 2Z00A 5D9PA 4MWAC 4ICMA 1SFLA 3E02A 3B9EA 2GVJA 3FGCB 1TQXA 4G1NA 5C70A 1T99A 3A5VA 1DL3A 3GVGA 5DBUA 3R13A 4MB4A 5T26A 2POZA 1L6WA 2XFYA 1A4MA 3QTPA 2P0IA 1CW2A 1P1XA 2ZRZA 1H1YA 2AL2B 4PB3A 5FL0A 1EX1A 4EXBA 3STGA 4P5UA 1S5VA 1E0UA 1IEVA 1O7AA 4HZ7A 2G3FA 1WQ5A 4YVXA 2P0OA 3SR7A 4U31A 1ME7A 2BY0A 5E0KA 5LYRA 3VE7A 1ZAIA 3H55A 4LNYA 1P6CA 1UR0A 2Y7FA 2DZXA 4YCOA 4AWEA 2XH0A 3CB8A 3SCVA 5MHBA 2ZDRA 4ZTYA 5DCBA 2OZ8A 4NRRA 2PDYA 4PCNA 1EA0A 4EACA 3BMXA 3G1VA 3QGKC 4WY0F 4F2UA 3L5LA 2OWCA 1WKYA 2EJ1A 3TK7A 1ISYA 4K39A 2WHKA 1L8PA 2A7RA 5I3IA 4KQNA 3GKAA 3L65A 3LXBA 1UROA 1VEPA 3VGEA 1CYGA 2OO6A 4IMEA 3L4XA 3WENA 1AD4A 3EX6A 2ABBA 3HTWA 3LXCA 3DUGA 1XH2A 4QE4A 4MY1A 3N14A 4QDWA 4B2DD 1OB0A 1B3YA 4HNLA 3W84A 4U4MA 1LJYA 3I7RA 4C6QA 4O17A 7ENLA 5F2IA 3GXNA 3TC6A 2OB3A 4FNUA 2NQLA 3F4WA 2DZTA 4RV3A 3MU7A 1WYIA 5C8BB 2O9RA 3RX4A 2A3BA 1XD0A 3PNZA 5CSUA 4IPLA 4KWWA 5I03A 1T8QA 4JQ4A 1V0NA 1V02E 1D7FA 4HQVA 3BSHA 2DZWA 4W87A 2JALA 3QSTA 5LXXA 1NU5A 2FZ9A 4M56A 4PEEA 1ECQA 1VYSX 3EOLA 3EB4A 3S1XA 4E3VA 1UWSA 4IX0A 1Q66A 1X96A 2O0TA 3P80A 4GY7A 4M7SA 5FSEC 1BXCA 4EANA 5HQLA 5AECA 4JIHA 3BW4A 4ZOAA 1TRE