4RCXA

Trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant) loop 3 deletion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTTVPMIKSFGIEWTILGHSERRDFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Trichomonas vaginalis triosephosphate isomerase loop 3 deletion protein
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 82
structure length 235
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rcxA00
1G4SA 3M5VA 4RR4A 4PC8A 3MW7A 2CZDA 4FX8A 1N55A 2RFGA 1QNVA 3CU2A 1DQWA 2ZDRA 3RFAA 3ABOA 1JVNA 4S2BA 2PC4A 2YZRA 2VFDA 3NG3A 3RU6A 4UR8A 2X30A 2VC6A 5KTLA 3ATZA 4ZQMA 3NQ7A 5ABTA 4UTMA 1F76A 4HPXA 2CU0A 3OIXA 3TSBA 1ZALA 2ZZ6A 4HNUA 3W84A 4M7SA 1SFJA 1GVSA 1X6UA 4LNYA 2NLIA 3IIVA 3UWZA 1CX9A 3G1HA 3PVFA 2A7NA 1OX4A 2RKXA 2ZRUA 3S42A 1TPWA 1GZGA 2H6RA 4IPJA 3UWWA 4AAJA 3N2MA 4XKYB 2Z6JA 4IX0A 3CWNA 3NAVA 1XKYA 1MSSA 3LHWA 2NV2A 4GC4A 2WNZA 1JULA 3LXAA 1F6KA 3O06A 3TC7A 5LNVA 4IXHA 3QPZA 1S5VA 3TV8A 1PIIA 3A21A 3QMSA 3LI0A 3TUUA 3L5MA 4O54A 3PUDA 1OX5A 2E5CA 4DPQA 4UIOA 4BFAA 2HMCA 3S8HA 2A6NA 1H63A 2GUUA 1Q3NA 3R8RA 4PL1A 3NL5A 2ABAA 3EB2A 5FF2A 3G1DA 1C29A 2B0MA 3STGA 1TPC1 4MY1A 3EWXA 4OBTA 3QYQA 2Y63A 4GE8A 3BG3A 4JTLA 1NF0A 3PAJA 3NL6A 3O15A 4I9AA 3W70A 4XKYA 1FCQA 1O5KA 1SSDA 3S1WA 2NUXA 1FWRA 3NM3A 5AN7A 4TMCA 3FJLA 4IMCA 5AC6A 1H7RA 4ZQRA 3LCGA 1T96A 4PEKA 3TJLA 1ZFJA 3M16A 1K3UA 5TQLA 1H51A 1WDWA 2C14A 4UNKA 5K4XA 4IQLA 1J4EA 1GJPA 1QPNA 4IMDA 2NWSA 3MHFA 2FDSA 3TMLA 4FEZA 2VEIA 1L6YA 1KFEA 2J9YA 5HWNA 4JDYA 5CSRA 1OF8A 1WYIA 1LOSA 2QAPA 4OQVA 2YDAA 4UMCA 1EUAA 3QRHA 4CNPA 5I3KA 4K6AA 1OVDA 5FF4A 1QO2A 3M1ZA 3EX6A 5G4WA 3EXRA 3HOJA 3P62A 2E6AA 1RR2A 1I45A 5C2XA 1RQBA 3TIMA 5L9FA 1EUNA 3LOTA 1VYPX 2ZZ7A 3IV3A 1R2RA 4JX6A 5EY5A 3O6YX 4E0CA 4MLJA 5BMWA 1I2NA 3TR2A 1MEIA 5LNWA 4N9CA 4A22A 2TRSA 4IOTA 1F74A 1WV2A 3H53A 2CWNA 1SW3A 4WD0A 3CQ0A 1U5JA 5T26A 2DZXA 4JTIA 4WUIA 1SUXA 3N73A 3NQCA 1R30A 2VFHA 3W7IA 1VQTA 4B5NA 5IM51 3EWWA 2GVGA 4DO4A 2C1HA 2NXHA 2CZ5A 4GWEA 1S5TA 3NPXA 3UY7A 3L65A 4OWGA 2V82A 1XBZA 3O07A 3TFCA 3F4WA 1ME8A 4XTIA 1SU5A 4MZ8A 4NNAA 5GVJA 3UYCA 3NL3A 2V30A 5LNUA 1SZFA 2F7FA 4I7UA 1KFCA 2QUTA 3W1QA 4AH7A 1OF6A 4YXGA 4FXSA 1OG0A 4JD4A 1VC4A 3WK3A 2EKCA 3NL2A 4LY8A 3QF0A 5AYZA 3I65A 4KKXA 2CZEA 1W0MA 3KRSA 2O7SA 4AXKA 2AAMA 3LERA 1J5TA 3G1SA 3O05A 3KOFA 3SY5A 3CIXA 2OT0A 4FNQA 3B8DA 4BF9A 4PL2A 5KITA 1VYSX 3T55A 3FA5A 4AWSA 2YR1A 4W9TA 3W07A 2FIQA 3W1LA 3TK7A 1T99A 3NPVA 2NXIA 2QDGA 3LCLA 2W79A 4NXSA 1Z41A 4IJBA 2C16A 4HIBA 3G3DA 5AYXA 1W3TA 2Q8ZA 4UMBA 1P0NA 4ADUA 5D2TA 4BWLC 4TIMA 3MUXA 3TJXA 4I7VA 1SW7A 2NUYA 2CLIA 4O1AA 1RQEA 1OHLA 2P1FA 3ELFA 3LDVA 1Q6QA 1JJKA 2A6LA 3NNTA 4GBUA 4MKNA 4AWUA 3NQ8A 4HKPA 1JCMP 4K7YA 2A85A 5HULA 3B0UX 1N8FA 5D2WA 2Q3OA 4DF0A 1JCYA 4K8EA 3O6CA 1XXXA 4OU1A 1M5WA 1TQXA 4LVAA 2NX9A 3NQGA 3VI2A 2TYSA 3CTLA 3HPZA 1NSJA 2Z1BA 1I2QA 1SW0A 3P8JA 2HS8A 3NPUA 2QCFA 1DL3A 3DFQA 5KSWA 4HNTA 2CFFA 5BNKA 1I4NA 1A5BA 1DVJA 2A7RA 1PV8A 4UXDA 4CQ9A 2E5BA 3TC6A 1RV8A 3N19B 4JTSA 3W1UA 3TQ0A 1T0OA 3OVPA 4GUFA 1FDYA 1L6WA 1D3GA 2QCEA 3IVUA 1DV7A 1G67A 2AQWA 1GG1A 1YDOA 4DBDA 4RZ6A 3W6YA 3QH2A 2NUWA 4H4IA 3LLDA 3PS7A 1XUZA 3W7HA 3NDOA 2H8ZA 2J27A 4JYFA 5LZLA 3UY8A 2JGYA 3ANYA 3HIJA 4FNSA 3M5ZA 3W87A 1W1ZA 3GYEA 3G8RA 4WQ6A 2A4AA 2NX3A 3OVRA 3W7MA 5AB3A 2YW3A 3Q94A 5FEWA 2PCQA 4WOQA 1K7XA 4NJIA 3DGRA 3EX1A 2Y7DA 2YYUA 4CNNA 4PH6A 3KAOA 1PL9A 1B3OA 1KBJA 3S1XA 1DBTA 3DI0A 3HG2A 1H5YA 3NO5A 2B4GA 3I7SA 2ZZ2A 2FQIA 5HUPA 2H3BA 3LLFA 1LYXA 3EWBX 3DBPA 4JYDA 1JRBA 3IVTA 2XN0A 3QSTA 4PODA 4WJEA 3TSMA 1O5XA 3OVQA 1Q45A 1NEYA 1AMKA 3R89A 5D2XA 2QJGA 3T40A 5HNRA 5L6UA 2V0TA 1KV8A 1G4TA 1TPUA 3HPXA 1KTBA 2WNNA 1OFEA 3C61A 3S5OA 3LV5A 4NX5A 3I68A 4UTIA 1SSGA 3EKZA 3D0CA 3UQNA 3LCWA 5G1TA 4JYEA 2J9XA 2DZUA 2FB3A 1WOBA 2RDUA 3G1AA 1WBJA 4ML9A 4LS2A 8TIMA 3STCA 3W2JA 1QOQA 5D32A 3I7QA 5DY3A 5D2YA 1SZGA 2YPIA 5AOUA 1QAPA 3QJAA 3S1VA 3PUEA 4Z1DA 5FEXA 3UWYA 5TBOA 3B4UA 5I3JA 4O57A 3PG9A 1DHPA 3SJ3A 1SO4A 4DBEA 1TPFA 1TRDA 3KX6A 3O1NA 3SGZA 3A9IA 3W7OA 1L9WA 3G18A 3GDLA 2H90A 1KFJA 4CCDA 2YXGA 4L4LA 3B0PA 1IXNA 3QQ1A 3P5YA 4IMEA 4NJJA 4Z0SA 5HUOA 2V2HA 2FB2A 2GVLA 1HFBA 3C8FA 2PRHA 3LCIA 3G0XA 2C3ZA 1O94A 2G97A 3MBFA 1GVQA 1XFBA 3BG9A 3PB0A 1X8FA 4MZYA 4XZ9A 4CCCA 2WSQA 3L67A 3PF3A 1B4EA 3K30A 1R2TA 3EWUA 4E2BA 4MY9A 2G95A 1WA3A 4O18A 4DQWA 3ABQA 1LROA 3GNDA 3NVTA 5D09A 2XN1A 4OV4A 4R34A 4Z0JA 1VRDA 3S5YA 2B7PA 3W2MA 1NF7A 1IGSA 3OBKA 5BRBA 2DZVA 3O8AA 3PBWA 1D9EA 5CSSA 2QKFA 4R7JA 4O16A 3TAKA 3BG5A 4NUWA 3O6DA 1W5MA 2X1RA 2DZTA 6ALDA 4CCEA 3UWVA 1MEWA 4NNBA 5CKSA 2ZTKA 1PHQA 3BLIA 3TXZA 1VS1A 4HNVA 4QNEA 1GT8A 3PBYA 4QNWA 3STFA 3IGXA 2PURA 2VEMA 3NQ6A 4MPQA 1O4UA 4MYXA 1ALDA 3E9AA 2BZNA 3LHVA 3GVGA 2OCZA 2Y61A 1JQXA 3W2UA 3IGUA 3P60A 4LC6A 4MFDA 1S3HA 1W5NA 1TCDA 5KZMA 3A24A 4R33A 3DU0A 2J88A 2ZCGA 4LTSA 5C5YA 3MO7A 3DAQA 3TNOA 4IMGA 3WK0A 5F1UA 3HPSA 1G6CA 4QSHA 1FWNA 3W1XA 4LVDA 1T8XA 3HGSA 4EF8A 1Z44A 3B0VC 2TPSA 4N4PA 3NZ1A 5IBXC 3NXFA 1OFAA 5KMYA 1K7FA 3C2VA 3A5VA 4M7TA 4FHAA 4LVFA 3TROA 3WJSA 4NXKA 4DF2A 1SPQA 3RNDA 1LOQA 3GR8A 3C3NA 3BGGA 4O52A 4LS1A 2OX1A 1AW2A 4FNRA 5C54A 1XBVA 3GKFA 3L0GA 3HO8A 3IIOA 3W7KA 4K37A 4ONVA 2WSYA 2LLEA 1G4PA 5K7JA 4LUIA 2DJXA 4H6KA 1C8VA 3P80A 2JKPA 1JUBA 2OMAA 4N6FA 3MJYA 3QMRA 1HL2A 4KFNA 3LBMA 4ORIA 4JTGA 4MUZA 4OE7A 1PS9A 4MLRA 1PCWA 5E1QA 3OEXA 1U83A 3WK1A 1ZENA 3VCRA 3GLCA 3BLEA 1YLVA 2AGKA 3P8IA 4EF9A 1GOXA 3W7EA 1JQVA 1AK5A 4C1LA 2BWGA 3PSVA 2YCEA 3R12A 1R2SA 3S0CA 2BXVA 4NVTA 4M6VA 4LV4A 3ZFHA 3A23A 4PFMA 2ZZ5A 2PRMA 2TMDA 2FPVA 3F4NA 1SQ7A 4ZMGA 1W8SA 3W7CA 2PE4A 4LOCA 1TTPA 4YCPA 3RMJA 1EB3A 1OFQA 3TSDA 3BPWA 1PHWA 3BVJA 3KVKA 4UTTC 1W31A 1W37A 3N2XA 1H7OA 2KZHA 3W1AA 1FXPA 4DXVA 2QCMA 3VE9A 3L21A 1QR7A 4YLWA 4BWLA 5CGQA 2WV8A 4Q33A 3QC3A 5HR7A 2Y89A 3MYOA 2V2CA 3INPA 2HS6A 4HPJA 1GWJA 1GVFA 4WX2A 3UXDA 1ICSA 2WOQA 4UFJA 3NGJA 1UASA 1W3NA 4S2CA 3QM3A 3QEZA 3EEGA 1ZJIA 4AMAA 4A2SA 1Q6OA 3S1UA 3N3MA 2Y7GA 3AJXA 4A29A 6TIMA 3C2RA 2QEZA 4JTKA 3UZ5A 1KFBA 5CZSA 4QQ3A 4Z08A 1C9DA 3GXNA 4LC8A 1W5QA 1FBAA 3CHVA 3GB6A 1ONRA 3SW6A 3CPRA 5FF3A 3Q37A 1QPQA 1ADOA 2E6DA 3W83A 3ZWTA 4M6QA 1IIGA 2ZA1A 4NJGA 1JCNA 1BWKA 3ZR4A 3DKLA 3O63A 1OFRA 3THQA 3TXVA 3U6WA 1EA0A 4JTEA 5HINA 2QDHA 1FY6A 4RX0A 2X2GA 3MHUA 4UUIA 4D2JA 4FNPA 3GAKA 4X9SA 1JCXA 4IWWA 2JGQA 1GVRA 3GZ3A 3W71A 3P67A 1H7WA 5CPNA 4TO8A 1KTCA 3PR2A 4MY8A 3QSRA 2DZSA 4FO4A 3P84A 3G8EA 1F7BA 5CZTA 3I7RA 1P5BA 3CC1A 4K39A 4ZZ9A 4A3UA 1WX0A 5D05A 5HWJA 3WJYA 4Y8FA 3TAOA 4JIPA 2V81A 3U8GA 5FF7A 2R91A 3UPWA 3CB8A 1PCKA 3M5XA 3FKRA 1VH7A 5G2HA 5FEZA 1I8JA 2RHGA 1YPIA 1YYAA 3W2NA 2ZRYA 5H2ZA 1GG0A 3G0SA 5U4NA 3TA6A 5G2WA 3GIYA 1OFDA 5LHEA 2ZQ0A 4WZHA 2F84A 3MP4A 1H1ZA 3E02A 1R46A 3OG3A 1QPRA 3DXIA 4Q4KA 5EYWA 1OX6A 4KWVA 4EVZA 3C56A 1FDZA 4UNLA 4PCFA 3GKAA 3EWYA 1MXSA 3BW3A 2ZTJA 5AHLA 4DF1A 4N9EA 2QCGA 4TR9A 2QUUA 5K4ZA 1JUKA 5LNRA 3NQ2A 2OZ0A 1PE1A 3LB0A 4FF7A 2C15A 5TIMA 2JKAA 2ZA3A 1E51A 3A22A 4ADTA 3FYOA 1BKSA 4O0ZA 3ATYA 2Z2UA 4AB4A 3NQDA 4N9DA 4OHQA 4K38A 2WO5A 2NX1A 1A53A 2YW4A 1VLWA 4GXMA 4OT7A 3TX9A 1TV5A 1VGAA 3BK0A 3N14A 4R53A 1L2UA 3JS3A 4RCXA 1LP6A 3R5EA 1MO0A 4BR1A 2ATMA 1KBIA 4TU1A 1YDNA 3LHTA 4O10A 4CQAA 3LGEA 3KHJA 3W7QA 3CLMA 3CM4A 2Y70A 4HSNA 1WBHA 3NQFA 1Y0EA 3DENA 1D3HA 1A5AA 4O15A 4POCA 5HQEA 3W1PA 1QPOA 3LM7A 3NQAA 3P7YA 2UV8G 3AO0A 3MI3A 4GRSA 1M6JA 2FPTA 3C2EA 1HG3A 1LLWA 1UUOA 2ISSA 4Y90A 3W88A 2Y6ZA 4Z1CA 3S5NA 3TU9A 1YXDA 5CZ0A 3M7WA 2V8ZA 3FJ6A 3PBUA 4LVBA 3CEUA 2QAFA 1FDJA 1G7UA 3M0ZA 2ZYFA 4RXFA 2E5DA 1TPDA 3DFTA 3NZRA 2RDWA 4IXXA 3FIGA 5G5IA 1K8YA 1I2PA 1ICPA 3B03A 3FS2A 2GQ9A 4WXZA 1B4KA 2WSRA 3FOKA 1GYLA 4ZQPA 2VEPA 3EKLA 1IXQA 2ZZ1A 3MYPA 4WY0B 2V9DA 3C4UA 1IXOA 3O16A 4ORMA 1ZHAA 4Z1AA 4IUOA 2ATSA 4UTWC 2J6XA 1KTNA 3IVSA 2X1SA 3LXBA 1XC4A 3UNDA 3N9SA 4J9JA 1X7FA 3LTYA 1ZAIA 3NA8A 4O0KA 2CZFA 1DORA 1R47A 1KLYA 3NYZA 1H7NA 2D73A 1W3IA 2C19A 4Q32A 5LGXA 3GR7A 2Q3RA 3F03K 2GQAA 4M5PA 4WY0A 3SI9A 1EEPA 1AW1A 1XBXA 3MP5A 4YWIA 3RF9A 3GX9A 3L5AA 3NQVA 1EIXA 1O60A 4MIMA 4GUGA 3G1FA 3LHYA 3P82A 4CQ8A 5C6MA 1HO1A 1TPB1 2ISVA 5LHFA 2CLKA 4UFHA 1KM2A 2QUVA 1TV7A 5LGZA 3LXCA 1GYNA 5I3GA 4E38A 1EP2A 2V5BA 1V7YA 4UTJA 4GUHA 2V5LA 1H1YA 4K36A 1QFEA 2A0NA 2BLEA 4NQ1A 4JX5A 4MZ1A 3ABRA 1TJPA 1H62A 1GTEA 3CEPA 1K8ZA 5AHIA 2XN2A 3MMTA 1TYGA 2CLEA 3Q58A 4ZVJA 4Y6GA 2ZBTA 4JN6A 3ABSA 2WKJA 5E93A 4PTNA 3GXTA 3KVMA 2ZRWA 4IX2A 1W5OA 3NQMA 4MVAA 2Z6IA 3H55A 3DH7A 3LHZA 2WQPA 1HTIA 4TX9A 1H50A 5K9XA 4WOZA 3P74A 1P0KA 4O1BA 2QCNA 3WJXA 2EHHA 4O12A 4O50A 4MFEA 4NJKA 3UD6A 2R8WA 1F73A 3W73A 3P81A 4DEFA 4FIRA 2WNQA 3KVJA 1F05A 5F4WA 2TSYA 1S5WA 3NPWA 4QAIA 1V5XA 2B7QA 1OFBA 4X3ZA 3C6CA 3PB2A 4NZFA 1OK4A 3G1XA 5A8GA 1OFPA 1XBYA 4LV9A 1HO4A 2R94A 3MP3A 3FKKA 5SWUA 3FEMA 3C2OA 1WQ5A 2Y88A 3W7RA 1GEQA 1J2WA 1TTJA 3QMTA 3RLUA 3IGSA 1RVGA 4N02A 4Y96A 4UTUA 4ZQCA 4AHPA 3N34A 2YSWA 4RZ4A 2R14A 3PUOA 3SGUA 3WJZA 2NXGA 4UTTA 3W86A 5D33A 7TIMA 3W1MA 4N9BA 4HHPA 1TV8A 3TFXA 4RV8A 1TTQA 4X22A 1AL7A 1NAL1 5MHBA 3C0JA 5FI8A 5J5DA 4ZL1A 1OFOA 2GPTA 4WXYA 1JRCA 3EX4A 1ML1A 4Y9AA 3L66A 3WJWA 1TPVA 4JTUA 4LS0A 5D2VA 5AC7A 5DCEA 2VFGA 1Q6RA 3P61A 4LT9A 1G4EA 3FFSA 3UPBA 4ALDA 1Z48A 1Z42A 1LRTA 1H61A 2FLIA 3HMJG 1GPWA 5DXYA 4K8HA 1GTHA 3R2GA 2ZRVA 2ZA2A 5D30A 2H8XA 1OX4B 3E49A 4LUJA 4UFKA 5AHFA 4LU0A 5D02A 5I3HA 1LOLA 4FB7A 1FCBA 4P2VA 3V1PA 3OHIA 1LBLA 4AEOA 4AWTA 1VPXA 1CI1A 1P1XA 3VE7A 4QISA 2RH9A 4HN4A 2QCHA 5DELA 1YTDA 1GQNA 1JR1A 1A5CA 1F2JA 4MJMA 2W0UA 3L5LA 4X2RA 4DELA 1L6SA 1LBMA 3LHUA 3STEA 3T7VA 3LI1A 1FCVA 1XI3A 3VFLA 5F2MA 1VHNA 3BV4A 4ADSA 3NOEA 5EL1A 3TW6A 4HNNA 5DBTA 3UWUA 4KFOA 1GVOA 2O7QA 4YL2A 4JICA 2WJZA 1QMLA 3BARA 4JDBA 3LCXA 1G7VA 5BMXA 2A5HA 4IPIA 4GUJA 3MBDA 4XBKA 4A21A 4OV9A 5HWMA 4P61A 1FWWA 4N4QA 5HJLA 3NEVA 1FCUA 1ZY9A 5CPOA 1SR9A 1A50A 5AFDA 3B06A 5K9CA 2CLHA 1THFD 4EOUA 3NR0A 4H3DA 3V75A 2NV1A 1NFBA 2PRLA 3LRKA 1YXYA 1YTKA 3G0UA 1TPH1 4NJHA 3LBCA 2CLFA 4L4MA 4XTDA 4UMAA 3L0KA 4UTHA 4FIQA 4FX7A 3W2KA 5D03A 1P4CA 4ZQOA 1YADA 2G5WA 3W7JA 3EXTA 3IIZA 5LKYA 2Q8LA 5HR6A 4QIUA 3DFOA 3JR2A 3L68A 4JTHA 3GXPA 2EPHA 3M43A 4O1CA 2QCLA 4O4VA 2Y7EA 3KRUA 2JK2A 2NWRA 3FLUA 1QDSA 5CPMA 2E6YA 1BEUA 3VKJA 4FNUA 4BI5A 1ME7A 4ICNA 4JY9A 3SSJA 1ME9A 3W75A 1K02A 5KZDA 5DN1A 4AHOA 2VFFA 1OYCA 4HT3A 1RD5A 3C52A 3CT7A 1KM6A 1EWDA 3T4CA 3DKJA 5F4XA 4AVFA 4QITA 1O95A 3G1VA 2HTMA 3QQ0A 1FQ0A 5K2ZA 1M7PA 1VCFA 3MHGA 3PY2A 3A5FA 3GDTA 4QJ1A 1JCLA 4M6PA 1HUVA 1VZWA 5DBUA 3W7GA 2Y7FA 1RZMA 2Z0IA 2GQ8A 1EPXA 3QW4B 1KM3A 2DP3A 2X1UA 3QPYA 4JXCA 4XBSA 3SZ8A 2CW6A 1AL8A 2Y62A 3BLFA 5AHNA 3HGRA 2BSLA 3E0IA 3PM6A 2I14A 2CLLA 4LRSA 1W54A 2CLOA 2VEKA 3SECA 4I7WA 3W7LA 5EBUA 5DCBA 4BI6A 4UC5A 1QWGA 2VOMA 4U4MA 1KM5A 3KVLA 1EP1A 3P5ZA 3G3MA 2VXNA 3GAYA 3DFSA 1W56A 5U7SA 3WK2A 3W85A 3M6YA 2YYTA 3W22A 3W1NA 1SO3A 2NZLA 3F1QA 3HBLA 1XDLA 3BW2A 4BK9A 4YMZA 2V2DA 3EX3A 1I2OA 2J9ZA 1QCWA 2JKEA 3JRKA 3HB9A 4GUIA 1ZCOA 3NQEA 3LRLA 3M41A 4NNCA 3W7DA 3TKFA 4JR5A 2HSAA 5I3FA 3Q2DA 4O1DA 3W7NA 1ZAJA 3S6DA 3DHDA 2OT1A 4UTLA 3IRDA 1KA9F 1LBFA 3T78A 1JCJA 4UTWA 3W2LA 3M44A 4JIQA 5FESA 1KM1A 3QFEA 3M9YA 4UFIA 5BOOA 1WAUA 5EKYA 1EP3A 4O28A 2P0OA 4YCOA 1UBSA 1KW1A 1W5PA 4FXRA 1X1ZA 1OK6A 5EMUA 4LRTA 4IGHA 5F2IA 1TB3A 2X16A 3UZJA 4O19A 3TQVA 3EXSA 4JTFA 5AHMA 4UFMA 4O17A 2A2IA 1KFLA 1VJIA 3W1RA 1LCOA 1YPFA 5CPLA 2QJHA 3EWZA 1KV5A 3KFTA 2DZWA 2X1TA 5FEPA 5AC8A 4C1KA 3R13A 3HG3A 4GJ1A 3MI2A 1YTEA 2B7OA 3HGOA 4JTJA 4E2DA 3CWOX 3LTPA 4EIVA 1G69A 3PWAA 1TTIA 4WY0F 3DZ1A 1Q6LA 2FFCA 5K3VA 5F2GA 2DU2A 2GJNA 5A5WA 4MJZA 3M5YA 1WOAA 3IEBA 5D37A 1QO5A 1IF2A 5LSMA 3MWAA 2E68A 3HF3A 5CG7A 1LDCA 4BI7A 4S1FA 4N6EA 4XWUA 1LLZA 2DORA 1TREA 2ZFAA 1LRNA 3TQKA 4CLMA 1UCWA 3W76A 5CZJA 1VHCA 2C0AA 4UCGA 3S9YA 5FF0A 5F4SA 4GNJA 2G96A 3W23A 1NVMA 1VYRA 3GDKA 4OGZA 1UB3A 1H7PA 2YX0A 1K03A 1K7EA 2H3DA 1PVNA 3L2IA 1FXQA 4RKAA 3TH6A 3YPIA 3W74A 4JEQA 4RJEA 5LNSA 5H91A 1TSIA 3HGJA 3U2OA 4CNOA 4MOZA 3IIXA 2BX7A 3SR7A 2B7NA 1VCGA 1OYBA 2YFOA 2JBMA 5KINA 3HQ1A 1SO5A 2VFEA 3QW3A 4ZQNA 3CIWA 5EA9A 1B9BA 2E1DA 2GJLA 4FX6M 4HSOA 2C6QA 2VENA 2ZZ3A 3QZEA 2QCCA 3L0NA 4QM1A 3GK0A 1F5ZA 1UUMA 4DO6A 1EWEA 1JUEA 1TPEA 2ZRZA 4NU7A 1UJPA 1LZOA 4K7VA 3LTSA 1RQHA 3HJZA 3N9RA 4AF0B 5J5RA 1X1OA 2QJIA 3C2FA 3DHFA 2A7PA 5G1YA 1A5SA 3ZWSA 1FX6A 1DKWA 5DCDA 3L9CA 1VR6A 5G4EA 3S5ZA 2YGYA 2ALDA 4U28A 5G2IA 4O14A 3UWQA 3USBA 3RK8A 4UTKA 3BGJA 1TJRA 5AHEA 4LVGA 5KZEA 1SFLA 2VKZG 5K9DA 4O13A 1DJNA 4RZ5A 2ISWA 2C13A 2GOUA 3G24A 2EF9A 1YXCA 3DFNA 1SZNA 4RK8A 5DXXA 3KRZA 3H54A 2RDTA 4O8RA 3TCEA 1N7KA 2XFWA 4LW7A 5IBXA 4AF0A 2W6RA 1B57A 1XM3A 1QOPA 4NZJA 4XQ6A 1OJXA 2E77A 2EAWA 5DLCA 1FWSA 3HG4A 2DZPA 1ZAHA 1CW2A 2VELA 1IXPA 1ICQA 2Y85A 2BTMA 3PULA 1WXJA 3E12A 3G1YA 3LRMA 1YDVA 2FPYA 1BTMA 2VFIA 4JGDA 4A2RA 2ABBA 4M19A 1LRQA 4PA8A 4TMBA 1TO3A 3DFPA 4FNTA 2GVJA 3IIPA 2I9EA 1KM4A 2DJLA 4O4WA 3LCHA 3VNDA 2FJKA 4IMFA 4LWWA 4RXGA 1SO6A 3MI6A 3LCFA 3PSWA 3W72A 1EX5A 3TE9A 1MEHA 3UXAA 3G22A 2IQTA 4O53A 3GDRA 1TQJA 4DPPA 2QF7A 1FUYA 1I2RA 3HG5A 1K8XA 3T44A 3PG8A 1H7XA 3OA3A 5BW6A 4Z1BA 3LX9A 4JS3A 1DOSA 5F2LA 1VLIA 3SIZA 4RLIA 3GNNA 3LV6A 4O11A 3W7PA 1TMHA 3THAA 1VCVA 2ZRXA 3SFKA 4MYAA 1XUUA 3TMQA 1OABA 1H60A 3W9ZA 5D04C 4N2YA 1KLZA 1XCFA 1ZNNA 2J24A 4AHQA 3W3OA 2WPBA 1LM1A 1XL9A 3GDMA 4XUGA 2C18A 5DY2A 1OYAA 1RPXA 4KWWA 2E6FA 1XDMA 5E0KA 1KM0A 4JTTA 4JX4A 1TRIA 1BWLA 5AYYA 2YFNA 4JNMA 4JY8A 2QCDB 1LTDA 5D38A 4UR7A 1MZHA 2A1YA 3B04A 4DO5A 3W1TA 2I1OA 4NT0A 4G1KA 4NX0A 3EX2A 1SZEA 4UFLA 2EGZA 1AG1O 4KFPA 4EWND 2OJPA 2A21A 1DQXA 5F1VA 3TW7A 3WFAA 5HMSA 2CLMA 1KFKA 2FTPA 5EPDA 3TDFA 3ZS4A 1FWTA 3KXQA 3NM1A 4GFSA 1LORA 3PBVA 2QR6A 3I6RA 1M7OA 3E96A 2E09A 3PC0A 3B05A 3M47A 1IIHA 5I3IA 1F6PA 3RLVA 5C55A 3DI1A 1TIMA 1DJQA 2QCDA 3BW4A 2P10A 3FYPA 1AW5A 3BO9A 2ZZ4A
chains in the Genus database with same CATH superfamily
1G4SA 4RR4A 4CUCA 4PC8A 3MW7A 1N55A 4DAFA 3OU8A 1DQWA 2ZDRA 5JVLA 1JVNA 2YZRA 5BXSA 2VFDA 3D47A 2ZXBA 3NG3A 3ABXA 4UR8A 1NFPA 4QDWA 2VC6A 3T05A 3KOWA 3MDUA 1F76A 3CMFA 4J3XA 3I4KA 4CD5A 3MVTA 3NJ3A 3TSBA 4HNUA 1OB0A 3WQ5A 3W84A 4WDUA 3LPPA 2IPGA 3CQIA 5D9NA 2NLIA 3TYDA 2QGYA 3PVFA 3ITXA 2A7NA 5E9AA 1TPWA 2R6OA 3P6LA 1UC4A 4AAJA 3BOXA 1E56A 3CWNA 4PRWA 2OKTA 3NAVA 1XKYA 2BY0A 2WNZA 1DHKA 1F6KA 3SY1A 5LNVA 4HK6A 2E8ZA 1LUCB 3KZPA 3QMSA 1JD9A 2BVDA 1JYWA 2BXYA 3JW7A 4AQLA 4BFAA 2HMCA 3SDOA 2IQ0A 1Q3NA 3T0DA 3TP4A 5FF2A 1YEYA 2BMBA 3VOCA 3S83A 2YDQA 4RE0A 2HXTA 1F4HA 3PAJA 3NL6A 4I9AA 1FCQA 1OC6A 3S2LA 2XISA 2NUXA 3NM3A 5AN7A 4UB9A 4IMCA 4C6OA 3NO3A 4LNCA 3L2MA 3IJLA 4PEKA 2QZRA 1ZFJA 4FI4A 5I03A 5TQLA 1WDWA 3ZJKA 1GJPA 1IV8A 1QPNA 8CGTA 3FNDA 1E43A 2BGNE 2FDSA 2W9MA 3TMLA 1Q65A 2J9YA 2HE8A 1WYIA 3AJ7A 1EUAA 4CNPA 4J3UA 5I3KA 4K6AA 3B97A 1QO2A 3M1ZA 3KM8A 4H41A 3GIPA 1I45A 5C2XA 2GJPA 3LOTA 2DVTA 2AKZA 2VD8A 3VGFA 4JX6A 4AY7A 4MB1A 4HA4A 5BMWA 1I2NA 2GJXA 3FGCB 1R6WA 1B1YA 5LNWA 4A22A 3G6LA 4IOTA 1V03A 4X60A 2I57A 3VD3A 1SW3A 4DM2A 1AZ1A 1ECEA 4WUIA 3ARSA 2BY1A 2BOGX 2WYSA 5RUBA 3MC5A 1QNRA 1VQTA 2GGJA 2GVGA 3S4TA 4GWEA 3BSMA 3NPXA 3OJGA 2OGJA 1OD8A 2Y8UA 1SU5A 2BNJA 1IGWA 4NRSA 2OOGA 1AQHA 3UYCA 1YKWA 2NW0A 3AFBA 2O9OA 4FXSA 4QLJA 5PTDA 3NL2A 3QF0A 3I65A 2HPIA 2O7SA 4H9MA 1AJZA 4Q4MA 3A4AA 3DN5A 1J5TA 3IUDA 1ITUA 3OGRA 1R38A 3SCOA 3SY5A 4E8DA 4FLOA 1W6TA 3SFWA 3AIWA 2XH0A 4U5IA 3PNUA 5IRPA 3T55A 3FA5A 3FVMA 2YR1A 1SJBA 4CQCA 3NPVA 5BWAA 1BSLA 2QDGA 2INZA 4J4KA 1Z41A 3QV9A 2C16A 4DWSC 2WPGA 2Q8ZA 3CUXA 1J0KA 3CAKA 3SM0A 4TIMA 1FWAC 3MUXA 1P6CA 3TJXA 1OGSA 1GQLA 1OHLA 4JL1A 1Q6QA 4MKNA 4P5UA 4GBUA 3E2SA 5BRQA 4HKPA 1JCMP 5HULA 4PB5A 4DZ5A 1N8FA 3AXHA 3SSZA 3DDMA 4QE4A 1J9YA 2GJRA 4V1YA 1DJGA 1TCMA 1FH7A 3VGBA 1R86A 4LVAA 3URAA 4F8XA 1NSJA 1I2QA 1SW0A 3NPUA 3B9AA 3T0CA 1KWGA 4Q4PA 5MKGA 5KSWA 4HNTA 4QX4A 1K6WA 3A64A 2VWSA 4UXDA 3TZNA 4EXBA 4CQ9A 3ANVA 1NARA 4PUDA 3TC6A 3GBDA 4KGLA 4E6MA 3TQ0A 1XYFA 3VVGA 1DV7A 4DO7A 4TVUA 3TR9A 5BCAA 5XIAA 4RZ6A 2NUWA 3DYMA 4PGLA 3V1HA 4H4IA 3SB0A 3W7HA 2G3NA 1UW9A 1ODZA 2W3ZA 3PZVA 3RRXA 1TX2A 4W89A 4K3ZA 3UY8A 1ITQA 3ANYA 4JBRA 3L4VA 1W1ZA 3SO7A 1BVWA 3OVRA 1A5KC 3WF1A 4AZ5A 4LYPA 2YW3A 3S2MA 4Z2GA 1QI2A 4WOQA 4DWDA 4NJIA 3DGRA 4CNNA 3KAOA 4AG0A 4OBSA 3DI0A 1H5YA 2B4GA 2ZZ2A 3FJ4A 3DBPA 4AZHA 2XN0A 2JF7A 4WJEA 3ZVHA 1WPCA 4PUNA 4W8BA 1CB2A 1NEYA 3R89A 3TYCA 3T40A 5HNRA 1QI3A 1V7AA 1KV8A 1G4TA 4F2UA 4HYRA 2VVNA 1KTBA 4P8XA 5HQLA 1A5UA 3C61A 2ZKMX 3ARTA 1ZP3A 1Z9AA 3WZ0E 1X8CA 1MWOA 1OZQA 2DFAA 4IICA 5HATA 4R88A 2WVVA 1SGJA 1WOBA 1R3TA 1R7AA 2RDUA 3BLLA 4IPNB 4AEFA 4KWOA 1WBJA 2FZBA 4HOXA 3E2VA 5HPOA 3WDRA 8TIMA 3REQB 1QOQA 3TN6A 5D32A 4GYPC 1R87A 4I8DA 5FA5A 5D2YA 4JNZA 1SZGA 2DW6A 1XSIA 2B31A 3S1VA 3PUEA 4Z1DA 4Q8UA 2HE5A 4WLCA 1I9CB 5TBOA 2QW5A 1S46A 1V0LA 2WM1A 3MQTA 2WC7A 2W61A 1SO4A 1TPFA 1DP0A 3SGZA 3UCQA 3A9IA 3W7OA 1OBAA 4CN6A 1HVXA 1K9EA 3GDLA 2NSOA 1VIZA 1VRXA 4L6DA 4YU1A 2YXGA 1UD3A 1IXNA 3QQ1A 3P5YA 1UMLA 4IMEA 5CBIA 3JUGA 4Z0SA 2V2HA 3WD4A 4PSRA 3VNYA 2C3ZA 2BY3A 4AEEA 2EG8A 4GX9A 1W9BM 3RJXA 2WC4A 2UY4A 4HD5A 1AA1B 1AFSA 1BRLB 4ZEPA 3Q65A 4GKTA 4O18A 4ASTA 4MNMA 4NAEB 1XSJA 2PDPA 1LROA 3ABQA 4IUGA 1RJQA 2FDMA 3QR1A 1XFCA 4EPEC 3OYZA 4S38A 3VD9A 3W2MA 1UG6A 3OBKA 2DZVA 1D9EA 2OELA 2Z1KA 5CSSA 5FACA 3BG5A 3O6DA 1XRFA 1W5MA 1K9FA 4KEUA 4CCEA 3UWVA 4Q4OA 3H2NA 4WF7A 1DXFA 3TXZA 1WZMA 1VS1A 4QNEA 3WQFA 1GT8A 4QNWA 4XZMX 3VIFA 2W4XA 4MPQA 3WN6A 3T4WA 4ATDA 4GLEA 3VGHA 1JD7A 5M5DA 3C0QA 3EZ4A 3QHNA 4MFDA 3GO2A 3C8NA 4R33A 3DU0A 2J88A 4IP7A 4IPPA 1QK0A 4P7NA 1HF6A 3DAQA 3AHTA 2VOTA 3B0YA 2Y1HA 3P2VA 3HPSA 3M6DA 3AHVA 2XVPA 3WO8A 3W1XA 3HGSA 4EF8A 1Z44A 3B0VC 1K4GA 3FX4A 1XINA 2TPSA 4GGBA 1OFAA 4NASA 1Q6GA 4DJDA 3C2VA 3TTYA 3A5VA 3WF4A 2NQHA 1Q66A 3AYSA 1H3GA 4NXKA 1U1HA 1M7JA 5HNNA 4B9YA 3GR8A 2OX1A 1A49A 3G2GA 1AW2A 2D0FA 2Z26A 4FNRA 3KTSA 3TYBA 4J3VA 4GVIA 1XBVA 3IIOA 4WDTA 1FWBC 1D2KA 2QYGA 1K70A 4D1IA 2POZA 2DJXA 5C8BB 2PTDA 3SUTA 1JUBA 1Z8AA 2CBJA 1FFQA 1XIDA 1HL2A 4XD5A 2V69A 3ARWA 1W3HA 4ORIA 1Q8AA 5IDIA 4MUZA 1HL9A 5E1QA 2J66A 3OEXA 4RW3A 3GLCA 3P8IA 2AGKA 4EF9A 1RH9A 1JQVA 2BWGA 6TAAA 1NIUA 4DI8A 3R12A 1HJWA 2YA0A 2BXVA 2B81A 1ZBVA 2J4GA 4JTCA 1KCKA 1UR9A 2FPVA 4B3KA 4WJ8A 4ZMGA 3OZMA 5CPSA 3NURA 4CU8A 3W7CA 3CZLA 4O8AA 2V5CA 3UT0A 3TSDA 4A4AA 1PHWA 1KBLA 4JIIX 1TE1A 4HZ6A 3V5FA 1F4AA 2CCRA 1FXPA 4Q4RA 2QCMA 3KS5A 3PZMA 3L21A 3VE9A 5B7ZA 4YLWA 4BWLA 3GWQA 3R8GA 4ICCX 3VCNA 2CHNA 2WAGA 2WV8A 4Q33A 3MY9A 5FL0A 2Y89A 3CK5A 5AKQA 3EPNA 4ZENA 3VIGA 4LF2A 4Y9OA 3N2TA 1GVFA 1M1BA 3UXDA 1ICSA 4PMQA 1W3NA 2OEKA 4AVOA 3T9PA 2PDYA 1UOKA 2WJFA 3GTXA 2QEZA 4JTKA 4AZCB 1O5QA 1XDJA 2VUNA 4A3QA 3CH0A 5FF3A 1QPQA 2E6DA 1S5NA 3Q4DA 2VGFA 1UMYA 5A8MA 2W27A 1JXKA 3G5EA 1XD1A 1BWVA 3O63A 1BYBA 1EA0A 1A5NC 1WP6A 2CZVA 1ZGDA 2QDHA 5DMNA 5FIPA 3KEHA 5BOEA 3GS6A 3P0WA 3FY1A 1H7WA 4YWSA 3PR2A 4FO4A 1FH9A 3ARRA 4Y8EA 1FFRA 4UQEA 5CZTA 3UBPC 4U33A 4K39A 3N3TA 4ZZ9A 5CC7A 3WJYA 3TAOA 5CXPA 3BCDA 1KBKA 3FKRA 5G2HA 1KBBA 1KGUA 1EOMA 1DJWA 3W37A 5DFAA 3MO4A 4Z42C 3DC8A 2ICSA 5E9XA 3TA6A 4YVPA 3GIYA 4PMRA 4TV5A 1JAEA 4LUYA 4DXKA 2BVYA 3MP4A 3E02A 4GABA 4S39A 4TQTA 3KLKA 3DXIA 3C56A 3T0AA 1VF8A 1NDYA 1FDZA 2BOFX 4OKDA 1PJ9A 2GGGA 4TR9A 5LNRA 1JUKA 3PPFA 1PE1A 2XZ7A 4FF7A 1EQPA 2C15A 5TIMA 2JKAA 4G7EA 2VI0A 3VIIA 3B8TA 1P6WA 3KBSA 3PZOA 3CYJA 4O0ZA 3ATYA 4XSMA 2R82A 2AL2A 2GK1B 4K38A 2WO5A 3M0YA 2NX1A 4L5ZA 4XIAA 2YW4A 4OT7A 5GPRA 2OO6A 3CO4A 1HZYA 2ZX9A 3QR3A 1EJ7L 4DAIA 3JS3A 4B90A 1EJTC 4RCXA 1ONXA 2XGIA 4S3EA 2ATMA 1YDNA 3WENA 3LGEA 3CM4A 2I9UA 4HSNA 3UNTA 4H9ZA 1CBGA 4U31A 1UKTA 4PMXA 4DY1A 1XR2A 1OC7A 1A5AA 4XZHA 4O15A 1OD0A 3G1RA 3ZIZA 2PLCA 3NQAA 3ZJ7A 4YVVA 2FPTA 2DPEA 1HG3A 1M53A 4KF1A 4YTTA 2ISSA 3W88A 4Z1CA 1UWRA 3ZLHA 2CERA 3M7WA 1CB7B 3VOGA 1UZHA 3QVQA 2E4TA 2QAFA 1NM9A 1G7UA 2KAUC 2ZYFA 3CPUA 3NO1A 3N6QA 2OLHA 4IXXA 1A5OC 3FIGA 3N11A 4AISA 3U2EA 3B03A 4UWMA 3HMCA 1B4KA 2FGZA 4ZQPA 2VEPA 4TXEA 3WD2A 3RUBL 2F9RA 3R8HA 3VK5A 2WANA 4ZTXA 1UIOA 5JQ9A 4IQEA 4UTWC 3IVSA 3VOIA 3TEVA 2DH3A 2XINA 3PPCA 4HCHA 5FSDC 8XIAA 4XVEA 3N9SA 4EXAA 1LJYA 1Q4NX 1Q8JA 3BAYA 1MMFA 3LTYA 1ZAIA 5GJNA 4Z2LA 4U10A 1H7NA 2GVEA 4NZ5A 1J10A 1UZ4A 3EOUA 2DT3A 1EEPA 2ALRA 3RF9A 1J0ZA 5AZ1A 4MIMA 4GUGA 3G1FA 4XBJA 5C6MA 5BXRA 2ISVA 3WBYA 5LHFA 5LGZA 1TV7A 3LXCA 1W2VA 4D8LA 2ZICA 1V7YA 2VX4A 4UTJA 4D72A 2GDQA 3VIHA 4JX5A 3EWCA 1GTEA 2V6AA 3CEPA 1REQB 2VZSA 5AHIA 4YYCA 3MMTA 2C7FA 4PE8A 4Y6GA 3S6TA 3GFXA 5E93A 4C6PA 4PTNA 3GXTA 5E0CA 1VPYA 3M0JA 7ENLA 2RJGA 2Z6IA 3H55A 3R58A 3DH7A 1V6YA 4IG2A 3H22A 4J1OA 4GI8A 4M8UA 1RP9A 3F4DA 3MDWA 1H4PA 2EHHA 2PDHA 4MFEA 3UD6A 1J6OA 1F73A 4FIRA 3NPWA 3SCRA 1V5XA 2B7QA 1OFBA 3C6CA 3CQHA 3RMEA 2ZE3A 2I5GA 3PB2A 4IIHA 9RUBA 4BKNA 3G1XA 5M1TA 1HO4A 3U2ZA 4I5XA 1XICA 4WIWA 1KR1A 2VWTA 3UZYA 3FKKA 2FZDA 5SWUA 1B5TA 2P5NA 1A4LA 3FEMA 1BD0A 1WQ5A 3VA8A 4IIFA 3A4XA 2Y88A 5I7GA 3W7RA 1U1UA 6ENLA 1B90A 1J2WA 2AL1A 3RRAA 2OYLA 3IGSA 1RVGA 1T41A 1X6NA 4QROA 5GJMA 4L9ZA 1Q63A 2YSWA 5CC5A 3WJZA 2PA6A 3W86A 3ZSTA 1NWTA 4RV8A 1E9IA 1OCQA 5FOOA 2XH4A 5BROA 2D2OA 4JIRA 1FHDA 3MUAA 2PDXA 2ZXAA 4WKHA 1HL8A 1JRCA 2TODA 4MUPA 3RITA 3APYA 4ZE5A 4JTUA 1ONWA 4DWSD 1MUCA 4LT9A 4KEZA 3FFSA 3B8UA 4UQCA 1H61A 2FLIA 3ZLFA 1GPWA 3A4JA 3R94A 3WNNA 2EEXA 3VINA 4IQDA 2ZA2A 3E49A 1IZKA 1GJWA 5XINA 1LOLA 5JUVA 4FB7A 3BTNA 5A8OA 5JIWA 2JIWA 4HMEA 1EH9A 1CI1A 1DWGM 2QCHA 1UH3A 1YTDA 2VEGA 4GVHA 1B3WA 3IACA 3BC9A 4KCUA 4X2RA 1LBMA 3PJXA 3LHUA 5MF5A 1BXNA 3KUMA 3VNZA 3RLGA 5A6JA 1VHNA 2F2HA 4LB3A 3PZNA 2O4QA 3WD3A 3BV4A 4ADSA 3F2CA 2O7QA 2X05A 4YL2A 4JICA 3U0HA 4JDBA 3LCXA 2FH6A 5BMXA 1IEQA 1IHIA 2VCAA 2RUSA 2P3ZA 3ANUA 4H9UA 3WQVA 4A21A 1FWWA 5HJLA 4I6KA 5AFDA 5K9CA 1NWUA 1CPUA 2XIOA 2ZX7A 3R10A 2J7BA 1V02A 2IXVA 5DO8A 3AU2A 3WKZA 1R9ZA 3WIJA 1E9LA 2VUYA 4NYUA 1YTKA 2QMJA 1L2QA 4XTDA 1OSEA 3LBCA 2BHUA 4FIQA 2PAJA 3KBJA 4FX7A 3W2KA 2WXDM 4KEMA 4D9PA 4DXXA 4AUBA 3MWCA 4GC3A 1TJ0A 2AKMA 2O56A 4DWSA 1UC5A 1QW7A 3AIVA 1EDGA 3M43A 1KO0A 3V18A 3KRUA 4RDVA 1DYSA 2NWRA 1QDSA 2OQLA 2XFRA 1E0UA 3PJUA 1TJ1A 3G6MA 4ICNA 3N15A 4JFVA 1V6VA 5CZKA 5DN1A 2HBXA 1OYCA 3I10A 4Q8QA 3CT7A 1KM6A 1EWDA 4AVFA 4QITA 1FQ0A 1FKWA 1J0HA 3MHGA 3GDTA 3WUEA 4MADA 1HUVA 2DEPA 1E5NA 4JHZA 3AIBA 1RZMA 3QW4B 3QPYA 4MMWA 1DE5A 1Y5XA 2BSLA 2Q09A 3LZ5A 3E5BA 5E6ZA 2WZEA 3V7PA 4I6VA 5I2UA 1FH8A 5DCBA 2YL8A 3GHTA 1I1WA 4UC5A 4X0VA 2IMRA 2WKGA 1R3RA 1W56A 5FD0A 3EOSA 1KGXA 1AH3A 4PZVA 3AMLA 1EGMA 3BW2A 4WVXA 4YMZA 2V2DA 3I6TA 3HB9A 4B16A 1ZCOA 3NQEA 3LRLA 3BH4A 3FXYA 4S23A 4XD6A 1TZZA 2D0HA 3W7DA 2PDKA 3CUZA 3FW6A 1J01A 4E4PA 5GNXA 1R5YA 5M3WA 3W28A 3ALGA 3S6DA 3DHDA 1KA9F 4AIUA 3QFEA 4MB5A 5BOOA 5EKYA 2FH8A 3M0KA 1W5PA 3QGKC 3GC2A 4XD4A 1P0EA 4LRTA 4IGHA 1ZJAA 4ZFMA 1PYFA 3CB3A 4JTFA 5D8ZA 3VGEA 1V6XA 2TAAA 2A2IA 3W1RA 1J0YA 1VFHA 1J5SA 2QJHA 2FYMA 2DZWA 2RGMA 4PCSA 4JTRA 4JKKA 2ZX6A 4V1XA 3KTCA 2D69A 3R13A 1RP8A 3N4EA 4QCEA 4E2DA 4UQDA 2WVUA 3WLJA 4JEJA 4ENLA 4WY0F 3LU2A 2FFCA 1A5LC 4TVDA 3EYPA 4MJZA 3M5YA 2EPOA 1ISYA 5LA0A 1IF2A 1DIOA 1VB9A 2JE8A 5CG7A 1LDCA 4C6BA 4S1FA 4N6EA 3EPOA 5EMKA 2PFHA 4ILSA 1O1ZA 2DORA 1UR2A 1TREA 4ES4A 1JAKA 3W76A 1E6XM 4UCGA 5FF0A 1IQ8A 5F4SA 4GNJA 4B4HA 4LYKA 1NVMA 2QXWA 3T2OA 1VYRA 3A12A 3GDKA 1TV3A 4M3PA 3NUKA 2H3DA 1PVNA 4RKAA 3YPIA 1R9YA 4RJEA 4Z2HA 5LXXA 1JPMA 3BDKA 5H91A 5DANA 1HKJA 1TSIA 4KRTA 1ZJBA 2B7NA 4E3VA 1VCGA 2OSXA 3HQ1A 1SO5A 2G8ZA 4MNKA 1B9BA 5I09A 2E1DA 1AH0A 3CHFA 2C6QA 3JZEA 1YE4A 1RCOB 3QZEA 5FJJA 4W8LA 1YNQA 2DSWA 3KCOA 1POJA 3MMUA 4DO6A 3V3WA 2PEVA 1ISVA 4HHMA 4A6GA 1EWEA 5KZ6A 5T9BG 1V4YA 4ZO7A 4P7RA 1TPEA 4NU7A 4MWAA 1GOMA 3LTSA 4P8VA 4M29A 3VDBA 4LUSA 1X1OA 4KETA 3R7MA 4DJFC 1FX6A 1S1PA 4FAMA 1GNXA 2DT0A 1VR6A 1RXOB 2ZUVA 3USBA 3BMWA 2XG9A 3CUHA 3AMGA 1WDPA 4YIWA 1KCLA 2QIIA 3G24A 3WX7A 1S2WA 3DFNA 1JCTA 4MB3A 3KRZA 2XM2A 3RU8X 3ZR6A 2RDTA 3TCEA 4US5D 1N7KA 1VJSA 3UERA 4KH2A 4YPJA 4AF0A 4DRSA 1XM3A 4F9JA 1UR3M 1MDRA 2E77A 1FWSA 1P0BA 1ZAHA 1P0DA 4GJJA 1WXJA 2EKGA 3RR1A 3NSXA 4V27A 2R1KA 2ZIDA 4A2RA 3ZXWA 1MW2A 4M19A 5H1WA 1XG3A 3BJSA 1LRQA 4TMBA 1Q6EA 1FTXA 3TYZA 3TTSA 1KM4A 1Q2RA 2DJLA 4O4WA 3VNDA 1XH2A 4LWWA 4RXGA 4BCEA 2VX7A 1CZ1A 3LCFA 1M68A 1YRRA 3BQ6A 9XIMA 1MEHA 2DUZA 3LA4A 1ISZA 1TQJA 2QF7A 3A3HA 3HG5A 1VFFA 3T44A 2QVNA 5F2LA 3BXWA 3SIZA 4RLIA 3GNNA 3FSTA 4GQGA 4PCNA 1WDRA 1NDWA 5AECA 4MYAA 1XUUA 3E5PA 5CBBA 4OBRA 1H60A 3W9ZA 4AYSA 4N2YA 4C7GA 1V3JA 1KLZA 4C6JA 3IUIA 4WGHA 2PGFA 3OODA 5HANA 1TMLA 1NQ6A 1RLDA 3AYVA 1RPXA 1EO5A 4JCLA 4PUJA 3TOPA 5A1AA 4Q22A 4JNMA 1UH4A 2QCDB 4BHYA 3KCJA 4LSBA 3B04A 1B9ZA 4DO5A 4Q8WA 1E4NA 3IJ9A 4G1KA 3W0KA 1KB3A 3AQUA 3H6OA 4NX0A 5I24A 2OQYA 2HROA 1UWAA 4GG9A 4KFPA 4EWND 3CZEA 1DQXA 4RNHA 5HMSA 1V3MA 1KFKA 2ZUTA 3FVDA 1MQQA 4MF4A 5CPTA 2WJDA 3NM1A 4GFSA 2EG7A 1IWBA 1LORA 4Q8TA 5I02A 2PUZA 3BLKA 2VMFA 1JL8A 3EEZA 4W85A 4EANA 4QTGA 5REQB 2PF8A 4IZGA 3ERPA 5DQPA 4H8UA 1XIBA 4KERA 3C86A 3BO9A 2ZZ4A 4RE4A 5JBDA 4GA8A 1S2UA 2CZDA 2YZ5A 1DTUA 2RFGA 5JIPA 2O9TA 1K77A 2YL6A 4B3LA 4S2BA 2A3AA 2WBKA 2G37A 4C6IA 3PN8A 3ZM8A 3GXIA 3WLIA 1IT7A 5ABTA 4D1JA 4HCDA 5A6TC 3DHUA 1B31A 1DWIM 3WD1A 1ZALA 1GVSA 5LIYX 2XU2A 3IIVA 1DJIA 2HPMA 3UWZA 4JIHA 3G1HA 5AYIA 4E2OA 1U30A 4LGXA 1GZGA 2H6RA 3VDGA 3N2MA 3CXOA 4XKYB 5D9MA 2HK1A 2P50A 3O2LA 1JULA 3OGVA 5CG0A 2J47A 4AIEA 3QPZA 3AXIA 4NYYA 3TUUA 1UD6A 4O54A 1VJZA 2E5CA 2V67A 2ODOA 1IE7C 3SQLA 3R8RA 5IOBA 2ABAA 1R0MA 1TPC1 4MY1A 4IGMA 4W7UA 1GORA 1XIJA 2J8FA 1RHCA 4HMNA 3S2NA 1NF0A 3O15A 3W70A 3IJDA 1TIWA 3K5XA 4R27A 5H8PA 3WH6A 1LUCA 1UWUA 3THUA 5HA7A 3KRBA 3II1A 4PMOA 1PUDA 4UNKA 2WMKA 4LX4A 1J4EA 1X38A 3MHFA 3MV11 4OUIA 3RILA 1XLJA 3F5LA 2VEIA 1KKRA 1VEOA 3IPWA 4UZUA 4JDYA 4MNLA 4W7WA 1LOSA 2QAPA 3M0LA 4UMCA 3QRHA 5FF4A 3MS8A 1MW0A 3CAQA 3EX6A 3FDKA 4AD2A 4AD5A 1PB0A 3P62A 1H49A 3BSGA 3U57A 1RQBA 5L9FA 4S3AA 1VYPX 2ZZ7A 4IHCA 3IV3A 1R2RA 2FMOA 5HPCA 2R1NA 3UG8A 2ACSA 4ZR8A 1H0IA 5IHRA 2ZE0A 3TR2A 3JZUA 1MEIA 1QXLA 3GTFA 1VFTA 3AIQA 1Q7QA 2GVYA 4LALA 5EMLA 4WD0A 5LIUX 1VP5A 1U5JA 2XSAA 3UP8A 2VR5A 5E70A 5E6YA 5T26A 5I23A 3MCMA 2PF0A 4DJEA 1R30A 3W7IA 3EWWA 4I9TA 4DO4A 1S5TA 3TN5A 3KE0A 4PUUA 3HU7A 4OWGA 2V82A 3T1GA 4QSFA 4NZ3A 4L6OA 4GYFA 1A3HA 3FGCA 3SGGA 3C3UA 1MNSA 4NNAA 3ARXA 1BGGA 5GVJA 3WNMA 1SZFA 1NU5A 4GIRA 2F7FA 1KFCA 2QUTA 5BOFA 4AH7A 1C7TA 4YXGA 1RY8A 1OG0A 2J6VA 3WK3A 5AYZA 3KRSA 2AAMA 1POKA 3VFCA 5A8PA 3T2PA 3O05A 3M7SA 2Y8VA 1E15A 3CZ8A 4W84A 5LA2A 1A0DA 3NQBA 2OT0A 4BF9A 3B8DA 4PL2A 2UY3A 3GFZA 2X09A 3UZXA 5KITA 3VOFA 7TAAA 5JBFA 3F5KA 4W9TA 4GYJA 3XISA 1UP2A 3TK7A 3SY8A 2OPJA 1T99A 2PDNA 3DOPA 1E6ZA 2XHYA 1NDZA 2YOCA 3LCLA 1B2YA 4IJBA 2J77A 2QMKA 1VEPA 1EL3A 1OIFA 5D2TA 4UQBA 1IR1A 3UZZA 1SW7A 1IYXA 4D8AA 2XTKA 1UKOA 3LDVA 1JJKA 3NQ8A 3B0UX 1MW1A 1O68A 3GUGA 3UGVA 4DF0A 4PMYA 4CQDA 3O6CA 4RE2A 1XXXA 2NX9A 2ZC1A 3H24A 3NQGA 3TTEA 3VU2A 3P8JA 4GY7A 1V51A 5C9WA 1FP9A 2HS8A 4S3JA 2QCFA 1JDEA 3F5JA 3H7RA 2QULA 2CFFA 4AZBA 3K4WA 5A6KA 3K8LA 1I4NA 2YLAA 1A5BA 2A7RA 2E5BA 3C0LA 4ZO8A 1RV8A 2DSUA 3W1UA 3BAIA 1T0OA 3ZLGA 1D3GA 2QCEA 1G67A 4PB3A 1UD8A 1V3KA 3GVVA 3W6YA 3AIEA 3O3RA 3QH2A 3LLDA 3PS7A 3RN6A 2PLMA 3ITOA 3NDOA 4IIDA 4ACYA 2YXXA 2H8ZA 4MPKA 2JGYA 4FNSA 4ZFCA 3W87A 4IF2A 1WKDA 2A4AA 2VJXA 1I60A 3SN1A 3Q94A 5FEWA 1TV4A 3P3BA 4QJ3B 3EX1A 4LBRA 3W25A 2YYUA 3BMXA 4PH6A 1PL9A 1B3OA 1KBJA 5H6HA 4F2TA 4YTUA 2DQWA 5HUPA 2H3BA 2XIQA 1HKWA 4JYDA 1LL7A 4ZSTA 4P8WA 4PODA 2J62A 1AMKA 1RSCA 4GJIA 2QJGA 5L6UA 3WH7A 3HV9A 2WC3A 4D6EA 4CD4A 2X0YA 3MUCA 3ID7A 4MTVA 2QJMA 4W88A 1RAKA 1OFEA 3LV5A 3VTRA 3BLOA 4FR6A 1SSGA 3D0CA 3UQNA 4JYEA 2J9XA 2DZUA 3LG3A 2BHZA 1E0TA 3UCCA 3T09A 1XHGA 3W2JA 3HV8A 3D3FA 3I7QA 2YPIA 5AOUA 4KWUA 1QAPA 3QJAA 5LIKX 5I3JA 3PG9A 1BSIA 1DHPA 3SJ3A 3OTRA 3KX6A 3RX2A 2XJ7A 2G41A 1L9WA 1O6IA 4RL3A 4C60A 1TELA 3GHSA 4CCDA 2OXNA 3B0PA 3WLTA 1X96A 1JZ7A 4FR1A 3IRSA 4HU4A 1XYLA 1XIFA 3DECA 1W9UA 1B3YA 3MBFA 4C6EA 1GVQA 3REQA 3MT1A 3HPFA 1E4IA 2GOKA 2QUMA 3BG9A 3FJNA 3PB0A 3KS6A 3GBEA 1ZBCA 4LAZA 3MV01 3K2GA 1B4EA 4B15A 3EWUA 4JIEA 2FJUB 4MY9A 2G95A 3GE7A 4F0LA 1L6FA 2PTZA 4NG3A 2XN1A 1QNSA 1VRDA 1W9PA 5IFTA 3CL7A 1FWDC 1IGSA 4O16A 3TJIA 1O66A 5CLWA 4NUWA 5I79A 3VDCA 4EAYA 4QP0A 1S38A 6ALDA 3WNLA 2XIBA 3SQMA 1C9WA 1UIPA 3CQJA 1EA9C 1PHQA 3BLIA 2QJNA 1F9CA 3GZAA 3PBYA 1Y65A 1ZUAX 1S5MA 4I5UA 2VEMA 2QPSA 3S3GA 2VP8A 1O4UA 1BRLA 4MYXA 3MCOA 2OCZA 3CT2A 4NAEA 1IEIA 4LC6A 3TTQA 2EJAA 1TCDA 4Q8VA 3AISA 3B8IA 2ZCGA 4LTSA 4YNGA 3AU6A 2IXUA 2UY2A 3GXFA 2D0GA 3N25A 3WK0A 2PDGA 2VTFA 1E0WA 4GHRA 1G6CA 4ZB0A 1CENA 4L4PA 2WZHA 1T8XA 3SBFA 2CIPA 3DC0A 4FLQA 1GKPA 4PSPA 4HP5A 4N4PA 3VNKA 3T8LA 3OHMB 1J11A 5KMYA 2L5HA 1K7FA 1E4LA 4LVFA 2YLLA 2SFPA 3TROA 3WJSA 3ZYZA 4DF2A 1D8CA 4XZWA 2MANA 2FVLA 3BGGA 4LS1A 1VKFA 3TYEA 1R9XA 3QOMA 4TV6A 3FEQA 3L0GA 2F38A 3AXXA 3A3WA 3D46A 3HM7A 5A94A 3W7KA 4K37A 4ONVA 2LLEA 3O9NA 1WZKA 4HNCA 2FMNA 4LUIA 3XIMA 4H6KA 5I78A 3QTGA 3M07A 4GI9A 2PCEA 1TMQA 3MJYA 3W26A 4TOQA 1FWEC 4KFNA 3LBMA 4DWSB 3AS1A 3H2MA 4JTGA 7ODCA 3UXIA 2BOEX 2A3LA 5C7VA 3TTOA 1XLBA 3N9KA 1TV2A 1V6WA 3BLEA 1YLVA 3CHEA 1GOXA 1XLDA 1Q13A 3GG0A 1AK5A 3BOFA 1MI3A 1HVQA 4PN2A 2YCEA 1R2SA 4NVTA 1W9VA 4PFMA 4ZOCA 4DJFD 5IXEA 2TMDA 3F4NA 5T9CE 1SQ7A 1XYCA 1SJDA 1XH1A 4LOCA 4ML4A 4YCPA 3RMJA 3RR4A 2J25A 4WSJA 1EZ2A 2BGSA 3E2QA 1JFXA 3CUIA 1W37A 2Q71A 4Z2JA 5FJRA 4DXVA 1QR7A 3W24A 4ERIA 4I8YA 3QC3A 4CEUC 3EMCA 1JYVA 3P14A 5FAGA 3VOHA 4S3GA 4HPJA 4QCFA 4G9PA 4E4FA 3M46A 3QM3A 4AZ7A 4J27A 4GYKA 4A2SA 2VQTA 4IFRA 1Q6OA 2PGWA 4PTDA 3BZGA 3U48A 2QQ6A 2Y7GA 3AJXA 4A29A 5HNTA 3RO8A 1RLCL 6TIMA 1MFUA 5CZSA 2P88A 3GC5A 4Z08A 2PWHA 3GXNA 1FBAA 3CHVA 3SQSA 6REQA 3GB6A 1B54A 2CEQA 2X41A 2XH7A 3Q37A 2ISDA 1ADOA 2XVGA 4QXIA 3ZWTA 2ZA1A 4NJGA 1E70M 2DSZA 1KQZA 3TXVA 1E9ZB 2PD9A 2Z27A 3L23A 5HINA 4RX0A 5HJXA 4LJ3A 4IT1A 3WBAA 4F79A 4IWWA 3H7VA 2UY5A 3H26A 2DZSA 4HOWA 1BFNA 3P84A 1EC8A 3G8EA 3U7VA 4F40A 1F7BA 8XIMA 1AODA 2W92A 4JZ5A 4TX6A 4I9JA 5D05A 1CLKA 3PZIA 1FHLA 2R91A 3L2LA 3UPWA 4H9VA 1YPIA 1XLKA 1AJ2A 2ZRYA 1BYDA 5B7YA 3VMNA 3G0SA 5U4NA 2W67A 4ZGYA 4CKQA 4WZHA 3GU2A 2F84A 2ONEA 5EYWA 4EVZA 4UNLA 3EWYA 3BW3A 2ZTJA 4F4RA 4N9EA 2QCGA 3GU1A 1WNOA 2OZ0A 1NELA 3BL3A 4ECLA 3LGDA 4R3UA 4C6KA 2DSVA 4JPGA 4E3TA 5DMMA 1UQZA 1AD1A 2VZUA 1Z7AA 1XC6A 4N9DA 4OHQA 2ZOXA 1A53A 4GXMA 1QK2A 3WLOA 4PYSA 1VGAA 3N14A 1S1RA 5HQMA 1RK6A 1LP6A 3ZT6A 1KBIA 4TU1A 3RX3A 3LHTA 4O10A 3VNLA 5CEWA 4KGJA 1HQTA 3W7QA 8A3HA 2Y70A 2VDIA 1H2JA 3NQFA 4XSLA 1Y0EA 4XZIA 3DENA 2FGLA 4LQ1A 1FWCC 2VNCA 2DZBA 3GTNA 1XD0A 1XIHA 2GK1A 2UV8G 3GW3A 3PWGA 4GRSA 1M6JA 3KP1A 3S2JA 3S5NA 4NIRA 3UJFA 2V8ZA 1X1NA 3FJ6A 4LVBA 3CEUA 2Z1SA 2WCGA 1FVPA 4RXFA 1TPDA 3N4FA 1BXBA 3NZRA 2RDWA 1RBLA 2VC9A 4MDOA 4DIAA 4XZNX 1OCNA 1BVNP 1K8YA 1XG4A 3FS2A 3RIKA 2YCIX 3TQPA 2GQ9A 4WDXA 3FOKA 5FCZA 2WHLA 1FRBA 1LWJA 3EKLA 4WY0B 3QTPA 4A8NA 4G1NA 3C4UA 1IXOA 3O16A 4ORMA 1ZHAA 4Z1AA 3HA1A 4IUOA 3RLHA 2PU0A 2X1SA 3LXBA 2ZXDA 4ZO9A 4C6NA 1XC4A 2DZAA 4J9JA 4JHOA 3UR2A 1PZ1A 3ES7A 2ESCA 3DFYA 1NOUA 4O1EA 4IIBA 4OECA 4OTKA 4PUWA 3H23A 4KRZA 2XSBA 3HQOA 5LGXA 1M65A 3GR7A 4CN4A 3F03K 5BYWA 2GQAA 3CZKA 4H7CA 4YWIA 3GX9A 3NQVA 1EIXA 1Q4WA 5CAHA 1PYMA 4CQ8A 2C1IA 1TPB1 4PEEA 1MW3A 1KM2A 1GYNA 5HMEA 3LS9A 2V5LA 1H1YA 3RM4A 1QFEA 2A0NA 2NLYA 4NQ1A 3M0IA 1SYTA 2WSKA 2XN2A 4C91A 3Q45A 1TYGA 4O1FA 4D6DA 3Q58A 1NP0A 2ZBTA 2WMGA 2WKJA 2ZRWA 4C6FA 4C5YA 3EGJA 4QLLA 3DG6A 4RZBA 4TX9A 1H50A 4KCTA 1P0KA 4O12A 4O50A 4NJKA 2R9RA 1JZ8A 1GVEA 4DEFA 3ITLA 3M0XA 2WNQA 5F4WA 1A5MC 1S5WA 1MUMA 4NZFA 1OK4A 2VEFA 1REQA 1XBYA 3KCLA 1QHOA 3OLDA 3RGTA 1JF6A 4HA1A 4R5EA 1HJVA 4XISA 2J13A 1DEDA 2R24A 1GEQA 2ZC8A 1XV8A 1CGXA 2VX5A 4FOUA 3N34A 5CAKA 4JL2A 2GSHA 4RZ4A 5AC5A 4UTTA 4H7VA 3CV2A 3W1MA 4LAKA 1ZBWA 4HHPA 2D2GA 2CBIA 1CECA 5C9ZA 4IJRA 3C0JA 3ZR5A 2GZXA 2VC7A 5J5DA 4ZL1A 2GPTA 3S9ZA 4WGXA 3AIRA 4CNTA 3EX4A 4ZXLA 5TF0A 1TPVA 3GG8A 4LS0A 4PRTA 3MKCA 3K1DA 3CAWA 2OZTA 1Q6RA 3H2FA 3DBNA 1G4EA 3UPBA 1AJ0A 3C5QA 4BS0A 2PBGA 1LRTA 2PDUA 4HSHA 3GHRA 4RV3A 4J2PA 1GTHA 2DH2A 3R2GA 1EJUC 2Y5EA 3WQ4A 2ZRVA 4HJFA 1C90A 2QV5A 3EB4A 2EPLX 5AHFA 5ABGA 1GOKA 5I3HA 4P2VA 2CPUA 1VPXA 3NZQA 1P1XA 3E0FA 4QISA 2V3DA 1KRAC 3L5LA 4DELA 1L6SA 3I3BA 3VM5A 1SR0A 3STEA 3T7VA 1U5HA 3VFLA 1R3QA 1V6UA 1CCWB 3IJ8A 3EWDA 3ZO9A 1UWTA 4A3HA 2R1MA 3NOEA 2QDEA 5DBTA 5GNZA 1GVOA 5ECVA 3TW9A 1QT1A 1QMLA 2FTWA 5HMFA 1UPPA 2A3BA 4IPIA 1V0NA 4GUJA 2GYIA 4N4QA 1FCUA 1EJXC 1A50A 1GEHA 3NXLA 1THFD 2JIEA 1GCYA 5FJIA 2Y0FA 1KXVA 1XGEA 3LRKA 3ME3A 1YXYA 4HB7A 4AC7C 3G0UA 3MSDA 5I77A 1TPH1 4L4MA 2CLFA 4UMAA 3L0KA 3OIHA 1K4HA 4WRHA 2EBNA 3LY0A 4MGGA 4F66A 2G5WA 1QHZA 3W7JA 1S3TC 6A3HA 5LKYA 1PTDA 5ECUA 5HR6A 2E25A 1IT8A 3DFOA 3JR2A 3KP0A 1GOIA 3VMOA 2HWGA 3M4HA 2JK2A 3FLUA 4U2YA 3M0VA 5CPMA 3RO6A 1BEUA 4FNUA 4BI5A 4IM4A 1E6QM 3W75A 3BURA 1K02A 4FXFA 2I17A 4H04A 2VFFA 2E1WA 3WQDA 1J0IA 3EDKA 4NHVA 1OQFA 3DKJA 5JXQA 5M2FX 1O95A 3G1VA 1GJUA 4O0QA 5K2ZA 2GGIA 1M7PA 3A5FA 1JCLA 4M6PA 3N6HA 2ACQA 1A3XA 2OEJA 1KM3A 4JXCA 3AWOA 4BF5A 5CLTA 4LRSA 3UJSA 4DBUA 2CLOA 2C0HA 2VEKA 3LLXA 1UWSA 3QN3A 2V5KA 1ZTVA 5EBUA 1E1CB 1JPKA 4HPGA 3B9NA 1KM5A 3KVLA 3VZXA 4KCVA 5H8UA 4A8RA 5C9RA 1Z3NA 1SMDA 5U7SA 4CD8A 2XVNA 4JHMA 4JNYA 3W22A 2PTWA 2P8BA 3W1NA 3CNYA 1WDSA 4YS1A 1GGOA 2NZLA 4HQVA 3WNPA 1NH6A 4FLSA 1H41A 3M41A 4NNCA 2HSAA 5I3FA 4Q6XA 4PBGA 3Q2DA 4MB4A 1E3ZA 1A4MA 3W7NA 4IFOA 3OZYA 1JPHA 2OT1A 1X39A 4LUTA 2VM8A 4J28A 1LBFA 1JCJA 1OGBA 3D6NA 3NEHA 1UKQA 1TX0A 1XGDA 3AMKA 1NQKA 1WAUA 2PDFA 2P53A 3EA1A 1EP3A 4O28A 2PODA 2HXUA 2PDJA 1OK6A 2OYMA 3ZJ8A 5EMUA 1YE6A 4PCTA 3UZJA 4O19A 2Z4GA 3EXSA 1W1PA 4GACA 4ACZB 3RM8A 5FJTA 1KFLA 1FA2A 1VJIA 4AZGA 1PSCA 4WR3A 3PAOA 2EO7A 3ISIX 3HG3A 5G4HC 4GJ1A 2BVWA 3BZJA 3MI2A 1YTEA 4Y9MA 2YBUA 5CCZA 2B7OA 3HGOA 4JTJA 3CWOX 4OIFA 1ODUA 2HNEA 2XVKA 3PWAA 1EFZA 4FPSA 3DZ1A 3H2AA 1Q6LA 5F2GA 5A5WA 1XRTA 1WOAA 5D37A 2CNCA 3VUSA 1DJYA 5LSMA 2E68A 2OSYA 4XO7A 3DGBA 4XWUA 4GFIA 2ZUWA 4IGNA 1UP3A 1UPMB 3QOKA 5CZJA 3EKGA 1PKMA 2BXZA 3S9YA 3TNBA 4PTXA 2G96A 3W4RA 2JEPA 4B91A 2CETA 2YKKA 2BFGA 1UB3A 1H7PA 1WKYA 3PHAA 3H2CA 2HQAA 4H6RA 3CTTA 1CXLA 3TH6A 4JEQA 2DT2A 2QIWA 3PTMA 2VZOA 1I75A 3HGJA 3U2OA 4CNOA 4AVNA 4MOZA 3IIXA 4LH8A 1FWIC 1GQIA 3WMCA 3UG3A 1VBUA 4AY1A 4PUEA 4ZQNA 4J40A 2QDDA 5EA9A 4EAMA 2R1LA 4NL1A 4FX6M 1JZ3A 5A2BA 2QPUA 4AXNA 1E72M 2PB1A 2ZZ3A 1AZ2A 4QLKA 4YVXA 4J2MA 1QNOA 1UUMA 3WLPA 3CUJA 5EMJA 4I3GA 3H4GA 1YNPA 2ZRZA 4DX3A 1UJPA 1CXIA 4GNKB 3QLDA 1FWFC 1XQKA 1RQHA 3HJZA 1K6AA 3GNRA 4M51A 4GVGA 1TKKA 3C2FA 4IJCA 3BWWA 3SCWA 3AI0A 4K68A 3N12A 4M56A 5TAOA 2HZGA 3VNMA 4C6QA 3N04A 3S5ZA 2YGYA 3UWQA 1NWRA 1MVYA 4UTKA 3BQ5A 1IT0A 5BU9A 3WELA 4W87A 4W7VA 4LVGA 1TVLA 4L80A 1J6PA 2PS2A 3AXMA 3SUVA 2EF9A 1HKKA 1SZNA 4RK8A 1XRVA 2YXOA 3ITVA 5DXXA 3ZJ6A 4LW7A 2EXOA 4JKMA 5BXPA 1QOPA 1XYAA 4XQ6A 2YB4A 3QY7A 3LD5A 1OJXA 3WQGA 2HEJA 1GONA 2GGEA 4DLFA 2VELA 1ICQA 3WF2A 5AZ0A 2BTMA 3CIVA 3E12A 2V3FA 2XDFA 3G1YA 3UXKA 1CGTA 4L1GA 2ABBA 4PA8A 3LM3A 1TO3A 2CXEA 4FNTA 3IIPA 1WAWA 5E5CA 5A2AA 3B9OA 3GH5A 1W3JA 4NZ4A 3LCHA 5CSUA 4RPPA 1SO6A 3MI6A 3ZT5A 3PSWA 3V0SA 1ZPTA 1EX5A 3FYYA 3UXAA 2IQTA 1WXYA 3VPLA 1T8QA 3MPGA 1I2RA 3WQPA 1I6NA 1H7XA 2ISFA 4H01A 1XIIA 5BW6A 1M3UA 4Z1BA 3TLQA 3LX9A 4JS3A 5JH2A 2QUNA 3DX5A 2OR2A 3W7PA 1VFMA 2IQDA 4H83A 1TWSA 1TMHA 3THAA 3SFKA 1OABA 1EKOA 1J96A 1TR9A 2QS8A 3OG2A 1ADSA 1ZU8A 1OCBA 4AD0A 1XCFA 4GZ7A 4GMEA 4AHQA 2HV5A 3TYUA 1B3ZA 2WPBA 3AMCA 1XL9A 3GDMA 3UR5A 5I5RA 3CASA 5E0KA 4JTTA 1UKSA 1TRIA 3RPTA 2YFNA 1LTDA 2A1YA 2ANUA 5ABHA 2PU1A 4DLMA 1HKVA 1HJQA 1XYBA 4WK9A 3NDYA 1HKMA 4LCRA 4UFLA 2EGZA 1AG1O 4JN8A 2A3CA 3ARQA 2OJPA 2J7FA 3B9EA 1XLFA 4P8UA 2O55A 3L12A 3MB9A 4P7OA 2FTPA 3TDFA 3ZS4A 1ELSA 3KXQA 1AUSL 2Z28A 4QGCA 3V5OA 3BJTA 3PBVA 2QR6A 1PPIA 5JU6A 3RCYA 1M7OA 3E96A 3DHPA 4R7OA 1T6MA 4JFWA 4Q4QA 3B05A 2GQ3A 3VGDA 3M47A 1IIHA 4AD3A 3RLVA 3DI1A 2QCDA 3KDOA 5M17A 1SJAA 4YN5A 3DG3A 3JVAA 3FYPA 3W02A 2OVLA 3N29A 4GQ0A 4A8IA 3W38A 3RFAA 2PC4A 4E5TA 3O7UA 4B92A 5H8MA 5KTLA 1XLLA 2EQDA 1PX8A 4UTMA 2GUBA 4HVXA 4G2DA 4M7SA 1SFJA 1X6UA 5REQA 4XAYA 3DG7A 5FJOA 1BAGA 2WKLA 1OX4A 2RKXA 2ZRUA 2WMJA 3S42A 3UWWA 4H1ZA 4NY2A 3GXMA 2Z2BA 5EB8A 2QPXA 2CC0A 4REQA 4QEEA 2NT0A 2Z1VA 3LHWA 4HPHA 2NV2A 1GZ1A 4IL2A 4GC4A 3LN3A 3LXAA 3GRIA 4GNVA 4WCJA 3O06A 3TC7A 4IXHA 2BASA 3TV8A 4PMVA 3WBEA 4GXPA 1WB0A 1QHPA 3LI0A 3TJ4A 2AQVA 4G6CA 3RPMA 4DPQA 5BWFA 7XIMA 1PBGA 3VC6A 4FP1A 4UIOA 2PMQA 1EQCA 3S8HA 2A6NA 1H63A 2GUUA 3UZWA 4PL1A 3NL5A 3URQA 3GH4A 1C29A 1Z69A 2BV9A 4OBTA 3FK4A 5DEZA 3QYQA 5I07A 3IANA 4GE8A 3BG3A 3STPA 3CV6A 4XKYA 4BQ4A 3S1WA 1FWRA 3L4WA 4TMCA 3FJLA 1BF2A 5AC6A 5D9OA 1CIUA 1EEXA 1T96A 3TJLA 2PTYA 3UGRA 2BVTA 2C14A 1EGVA 4M24A 4IQLA 4KWSA 2NWSA 3KLLA 3QKZA 4KESA 3NZGA 6REQB 3QQWA 4FEZA 1LL4A 1L6YA 1KFEA 5HWNA 3LENA 5CSRA 3BAKA 2YDAA 1RY0A 2D3NA 3L4ZA 1OVDA 4HTYA 3RX4A 2D20A 5G4WA 4H9XA 3HOJA 1MQPA 1RR2A 3N13A 5C9UA 3ZOAA 4RW5A 4DBSA 3SRDA 1J2BA 3TIMA 1KR0A 2WLYA 1EUNA 4HMCA 3VIKA 4QEHA 4QR6A 4NZ1A 3MMWA 3CO8A 3SAZA 3BV7A 3THCA 5EY5A 3O6YX 3L4YA 3GH7A 4GH1A 1B3XA 1TZ7A 1JXJA 4N9CA 4S3CA 3W81A 4DJDC 4GCAA 4E8GA 1WV2A 3H53A 3S1GA 1GZJA 2CWNA 2UBPC 1WZLA 1Q6CA 2J8GA 1V93A 4JTIA 4G7FA 3AMDA 3SCSA 4CQBA 3NQCA 5LXEA 3AUOA 2VFHA 3T81A 4B5NA 5IM51 2IKHA 1G01A 3A9BA 2IKIA 1IWAA 3DYOA 4B5SA 1HNYA 4HYWA 2NVAA 3L65A 5I06A 1XBZA 3VDAA 1CDGA 4HJWA 4JFTA 1CGUA 5EMMA 3F4WA 1ME8A 3OLEA 3MTWA 4MZ8A 3NL3A 2V30A 5LNUA 2E67A 3CLWA 3UJEA 5EFDA 1K8CA 1VC4A 1HW6A 3H4WA 4LY8A 4PMZA 3CAVA 3N1AA 2CZEA 1W0MA 2V5JA 4MKSA 5A3HA 4AXKA 1R7OA 2XH2A 3VDHA 3RXZA 4GZJA 5KEZA 2J79A 3KOFA 2GL5A 4C6LA 4PCPA 2PDCA 4FNQA 1TWZA 1VYSX 3E0LA 5BXTA 3T42A 3RAOA 1P43A 3MZNA 3F4VA 2NQJA 3LYEA 2W79A 4HIBA 3G3DA 4RE3A 1DJZA 4UMBA 3CUFA 4DNMA 2C91A 3FV9A 3SN0A 4HK7A 4BWLC 4CVUA 2J7DA 1XISA 4URIA 4I7VA 3BE7A 3EDDA 1QJWA 3AS2A 2A6LA 3CPGA 4AWUA 1IR2A 3OBAA 3PZTA 4F3HA 5A69A 2A85A 4GZEA 1JCYA 2C71A 2X0SA 1K1DA 2QVHA 3JU2A 2F6XA 1TQXA 3EB3A 4UOZA 3VI2A 4L61A 3IV8A 1XYZA 4B5XA 2YCLB 1GKQA 4FOJA 5IHSA 1MUWA 1JDDA 4ATWA 4HK5A 1OC5A 1JGMA 1PV8A 3KTXA 1QTWA 4YTQA 3N19B 4AZ6A 4GUFA 3VNJA 4HNOA 4J3WA 1FDYA 1PKYA 4ZSUA 3IVUA 1VFOA 2VGBA 3U3HA 3N18A 1YDOA 1OIMA 1XUZA 2W91A 2PTXA 2Z25A 3U7BA 2FZNA 2J27A 1C8QA 1XIGA 1P6BA 3EDFA 1D3CA 2OEMA 5LZLA 3W29A 3M5ZA 1QRQA 4OJYA 2GWNA 3GYEA 4GOAA 4WQ6A 2NX3A 3IK2A 4Q3MA 4UBPC 3W7MA 2OQHA 2DIJA 5DRIA 3WQOA 1K7XA 3UXLA 1ZLPA 1C8YA 2Y7DA 4JQ1A 2D24A 1DBTA 3WSUA 4BQ2A 1C91A 1A3WA 1EF2A 4EPBC 1UP0A 1W3KA 1HJSA 3LLFA 1LYXA 3EWBX 1RUSA 3FHAA 3QLLA 1UZDA 1JRBA 4B3ZA 3IVTA 3WQWA 3QSTA 2PC8A 2W66A 3UESA 4L9YA 2WCSA 4L7ZA 1O5XA 3OVQA 1Q45A 3CJPA 3I4EA 2Q01A 2V0TA 3EMZA 1TPUA 1GHSA 4QE1A 2V3EA 2WMIA 4NX5A 3VZYA 3I68A 4UTIA 2WHJA 4HHHA 1PKLA 2PP3A 3H7UA 4W5UA 4H6EA 2ON3A 1Q2SA 2I5IA 5HDRA 3G1AA 1VFUA 1UD4A 4P7QA 4ML9A 2OB3A 1LG1A 3A47A 3TA9A 4ZE4A 4GQBA 3VIJA 5FEXA 3KWXA 3B4UA 4IMAA 1KRMA 4O57A 1HP5A 5DT7A 3O1NA 1TRDA 4XB3A 1B3VA 2XWEA 2PZ0A 4B5UA 1SJCA 5DMYA 2WW5A 2FB2A 3C8FA 1X6LA 1SMAA 1RBOB 3G0XA 3LNPA 2G97A 4Y2WA 1XFBA 2XSXA 2A79A 4K1GA 4MZYA 4XZ9A 4CCCA 3PPHA 3LPFA 1HJXA 5AYBA 3GUWA 1R2TA 1MRQA 4E2BA 2Q8XA 4DHGA 4CNUA 1QNPA 4DQWA 3U5UA 1VFLA 3P93A 3MA8A 4R34A 4Z0JA 3UG4A 3EA2A 4U5KA 4JKLA 4N7QA 4HA3A 3PBWA 3MUZ1 2QKFA 4R7JA 3CS2A 1GPFA 1D7KA 2J7HA 3SIMA 5CKSA 1RVKA 4F2BA 1AMYA 1SVDA 2NSXA 3WUFA 2AGTA 1VAHA 1XH0A 3IGXA 2PURA 2MUCA 3R25A 3BLDA 1ALDA 3E9AA 2Y61A 1JQXA 3KDNA 3W2UA 3P60A 3EMQA 3LMYA 5KZMA 4Q8PA 2GDVA 1VPQA 5C5YA 3MO7A 1W91A 1H11A 3TNOA 1JI2A 3DEQA 3PZUA 4UNIA 4LYRA 3GXDA 4RNFA 3NDZA 4QSHA 3R4IA 1FWNA 1JNEA 4LVDA 3N2OA 3LPGA 1F8IA 3UVAA 1CXFA 5IBXC 3FSUA 3H2EA 2VCBA 4DBWA 1T5AA 4M7TA 2CBVA 3LSBA 3AS0A 4MNJA 2PBOA 4DYJA 4JTAA 3LBOA 4INFA 3ITCA 4HBKA 1LOQA 2O92A 4O52A 1RALA 1BHGA 3VKAA 5C54A 3WLQA 3GKFA 2OG9A 3U2CA 4XAPA 4JTQA 4MDPA 2WSYA 3OW1A 4US6A 3W00A 1C8VA 3P80A 2PWDA 3EPMA 2OMAA 4GIYA 4N6FA 3K1GA 3QMRA 2IPJA 1XPYA 1RCXB 1XLAA 1PAMA 4JFUA 4OE7A 1E5JA 3DESA 4AZIA 2NQ5A 3WK1A 4N0RA 3W7EA 3I3EA 2FHCA 2BG5A 4C1LA 1KCXA 2DQXA 3GNPA 1FHUA 3ZFHA 1Z89A 3CGTA 1GHRA 2X1IA 1VEMA 4H2HA 1EZWA 1TUXA 1I0BA 1BTCA 1EB3A 1OFQA 2WWCA 2GUYA 3WD0A 3WQEA 5GJPA 1RK5A 1GW1A 4FALA 5I6SA 2HISA 3N2XA 1H7OA 2XFYA 5LIWX 1QPKA 3W1AA 3NFUA 4AX7A 4D6CA 5CGQA 1IEWA 4NSBA 4WKAA 2W62A 4DUOA 4KPLA 4B5VA 3INPA 2HS6A 2VT0A 4XV0A 4R85A 3SCNA 2WOQA 3NGJA 3QEZA 5IDZA 3W27A 4HTBA 2HVMA 4GH3A 3S1UA 3N3MA 4AC1X 1RPKA 2GSEA 4L9XA 3QYSA 1DWJM 4QG9A 3UZ5A 1KFBA 3NVDA 3WLKX 2PP0A 2YL9A 1C9DA 4LC8A 3UF9A 2FHBA 1KD0A 2J8TA 1ONRA 1R3SA 3S47A 3D3AA 3W83A 2VDGA 4M6QA 3OBEA 2FZ9A 3DKLA 2VHLA 4GO8A 3K13A 1PZ3A 1UKPA 1CGVA 1OFRA 4MWAE 3THQ