4RCXA

Trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant) loop 3 deletion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTTVPMIKSFGIEWTILGHSERRDFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trichomonas vaginalis triosephosphate isomerase loop 3 deletion protein
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 82
structure length 235
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rcxA00
3M43A 1F73A 1RZMA 3W2JA 3DHDA 1WOAA 4UFJA 3TV8A 3GDKA 1WDWA 1JCYA 3KVJA 3NYZA 2WNZA 4NX5A 3CPRA 3TUUA 3QMSA 1KFBA 1TV5A 2NX9A 4O52A 1BTMA 4EVZA 1Q6LA 2Y7DA 3IIXA 3G8EA 4UFKA 1H7RA 4X2RA 2AGKA 3H53A 4IMFA 5T26A 4K36A 1DV7A 1W54A 4IOTA 3W7MA 3PF3A 4RZ6A 1KM6A 2FPTA 1G7UA 1VPXA 4FNPA 5AOUA 1WYIA 4L4MA 1TTJA 3QSRA 5DCBA 1YTDA 1VS1A 3OVQA 2CZDA 2DJXA 2NXHA 1ZAJA 5CZTA 4A29A 4CLMA 1LOQA 3OA3A 1O5XA 2QUTA 1EPXA 2CU0A 2C13A 1FWNA 1ZNNA 4K38A 4RXGA 1W31A 4JICA 3TIMA 1K8ZA 2QUVA 1IXPA 1YXDA 2BWGA 2YX0A 4NQ1A 4DBEA 1QWGA 4M6QA 4LVBA 4MZ8A 4B5NA 2QCCA 4JD4A 4YCOA 3FYOA 2WPBA 1G4SA 1TV8A 3FJLA 3W2NA 1KFLA 5HUPA 3IIZA 4YL2A 1RD5A 2OT0A 2PRLA 1G4TA 5IBXC 3PBUA 4JTHA 4XWUA 3M6YA 2CZEA 4GUHA 4AHPA 4QJ1A 3EWUA 5KZDA 1AL7A 3ATZA 4GUFA 4DO4A 1IXOA 2Z1BA 4GJ1A 1GVSA 4UTUA 3LCGA 2RDWA 1JULA 2RH9A 3NL2A 1DORA 2OX1A 2FLIA 4P61A 4E2BA 5LKYA 2J24A 3PC0A 3DFSA 1X1ZA 4IX2A 1TPC1 4CCCA 3P62A 3NQFA 4JTIA 1WXJA 4O57A 3LBCA 4PEKA 3W2KA 4QNWA 3SZ8A 3UZ5A 1UUMA 3EX4A 3GDRA 2X16A 1DVJA 2ZFAA 1YPIA 1VJIA 3FS2A 5H2ZA 1LORA 3NQEA 2YYTA 4JIPA 1HFBA 3O07A 5HINA 1SR9A 4K37A 5C5YA 3NPVA 2RFGA 3K30A 1DQWA 4UTTA 1XDLA 3W7OA 2TYSA 4A2RA 4HNUA 4QM1A 5K9CA 2QKFA 3EXTA 4DELA 3DFNA 4UCGA 2G95A 1SSGA 3TJXA 1W3TA 1T99A 3LB0A 1UASA 1RQBA 3HPSA 3NGJA 1SO3A 3CLMA 5CKSA 3S8HA 3UQNA 5C54A 3M44A 4RV8A 2LLEA 4M7TA 1IIHA 3FFSA 5HWNA 4EF8A 4XZ9A 3LDVA 3CWOX 4ORIA 1V7YA 4O4VA 5AB3A 3PUDA 2GPTA 2G97A 5KZEA 4R33A 2ZBTA 4R34A 4LNYA 1GVQA 5FF7A 3A23A 2NUWA 3LTPA 3BW2A 1SZGA 2QAFA 1LYXA 5LNWA 3UWWA 2VFGA 5G1TA 2C15A 3P5YA 3WJYA 3T78A 2TSYA 4JY8A 3I6RA 5F2MA 4BF9A 3UWUA 3W7EA 4A3UA 1MO0A 1DJNA 3BLFA 3M0ZA 1EWEA 2Z2UA 5CPNA 2A4AA 1LM1A 3O6YX 3IGXA 1MZHA 1SSDA 4DBDA 3E12A 1XDMA 2YYUA 3PAJA 4K7VA 3NPUA 1JQXA 3M5ZA 3RK8A 4EIVA 1G69A 1OYAA 5DBUA 1HG3A 1OX4B 5K4ZA 3W1RA 2ZZ4A 1H7OA 1AL8A 3GNDA 2QDHA 4LS2A 3W7NA 1K02A 3NQ6A 1ZALA 2BTMA 1YXYA 2PRMA 3N2MA 3FKRA 3PUOA 1GQNA 4XTDA 1FQ0A 1NF0A 3C3NA 4K7YA 1VQTA 3G1SA 2E6AA 4N9DA 5D38A 2BX7A 3BG5A 3MMTA 5HMSA 2XFWA 4TMBA 2H8ZA 3S42A 2KZHA 2WQPA 5KMYA 4LU0A 1DKWA 5AHMA 5DY3A 5LNSA 3C2RA 3T40A 2DP3A 1ZJIA 4CNPA 3CTLA 2X30A 3TFCA 2E77A 4Q4KA 5F2IA 3USBA 1FXQA 1THFD 3B06A 2C3ZA 4IX0A 3GKFA 2OT1A 4YWIA 3LV6A 5FESA 1I45A 5K4XA 2V9DA 3WJWA 4FX7A 1U83A 4LRTA 1GVOA 1ML1A 1W3IA 1D3HA 1L6SA 3G1DA 5EPDA 1ZENA 4ZL1A 3NA8A 3IIVA 1SO5A 4I7UA 3CU2A 3L9CA 3T55A 3L66A 3KRSA 2A21A 3EWZA 4P2VA 3OIXA 1OFPA 1SZFA 5AHLA 1W5OA 2FFCA 3S0CA 3MI2A 3HF3A 4ADTA 3STFA 3G0XA 3ABSA 4IPIA 2OJPA 5D05A 3W76A 5K3VA 4ZQPA 4JTKA 2OCZA 4NX0A 5BW6A 5LHEA 2VELA 2ABBA 3HG2A 4LT9A 4AWSA 3HB9A 2VFIA 1KFCA 1PIIA 3TROA 4O19A 3TXZA 2JKEA 3LHYA 2RHGA 7TIMA 1AMKA 3GXNA 3M5XA 2VFDA 3BLEA 3NQMA 4N9BA 4UFIA 2C18A 5D2VA 4WUIA 4IMEA 4RX0A 3U8GA 1H50A 2ZRXA 3SFKA 1C8VA 3VCRA 4UXDA 5AN7A 3TA6A 1OK4A 2E5DA 3A9IA 1H7XA 2ZA1A 2GQ8A 5D2TA 2ZZ7A 3L5LA 3NNTA 4O14A 1YXCA 2ZTKA 1LP6A 4K8EA 3QMTA 2NX3A 1B4EA 3W71A 3VE9A 1W5PA 4Y90A 3A24A 3MW7A 2ZZ2A 3LHVA 1H1YA 3CT7A 3S5YA 1Q6OA 4TX9A 2VXNA 2ZA2A 1TMHA 3NM1A 4BI5A 1J5TA 4AAJA 3A21A 1KTBA 1QOPA 3CM4A 4JIQA 1KFJA 1ICSA 5G4WA 2A6NA 4WD0A 3HPZA 2OMAA 1O4UA 4LS0A 2P1FA 3G1XA 2YW3A 3P7YA 5BNKA 2GQ9A 2P0OA 5CGQA 3D0CA 3TQ0A 2C1HA 3T44A 1YPFA 3B8DA 3DI1A 1XUZA 3R5EA 3OVPA 4LWWA 3W1TA 4JS3A 5AYXA 1XC4A 1NEYA 3LHTA 5DCEA 1KBIA 3WK0A 4IWWA 1KM5A 2ZZ5A 1JQVA 2OZ0A 4O15A 3I65A 3GX9A 3PBVA 3TU9A 3JR2A 1IXQA 1LOLA 3EEGA 4FO4A 3O6DA 5EY5A 2H3BA 1N7KA 3UWVA 1ZHAA 3DKLA 3TW7A 3P80A 3HOJA 1OYBA 4BWLA 4JX6A 5EBUA 4RLIA 3AJXA 1QPQA 2C16A 1EP2A 1PS9A 5DELA 1UBSA 3PR2A 3QQ0A 2A7RA 3LOTA 3SW6A 2CLFA 1JCNA 1KV8A 2VKZG 4O1BA 3S1WA 2FB3A 4OV4A 1XI3A 2A2IA 1QO5A 4MIMA 4FNTA 2QF7A 3HGJA 4UMCA 1X8FA 1RPXA 5TIMA 1SW3A 4O0KA 4IMCA 4FF7A 1TIMA 2H3DA 3W7DA 6ALDA 4FNQA 1PL9A 1WQ5A 3P61A 4XKYA 4K6AA 4LVDA 4JYEA 1N8FA 1TSIA 3CEPA 4NZJA 1FWRA 4ZVJA 1LRNA 3GDLA 3IGSA 1W5QA 3G18A 5EYWA 1VHNA 3NL5A 3C61A 1ME8A 4Z0SA 1ALDA 2XN0A 3FJ6A 2ZQ0A 1QCWA 4CCDA 3L68A 2QCEA 1F05A 3A5VA 1VC4A 1XXXA 1KM2A 4RZ4A 1GJPA 1V5XA 4DPPA 1N55A 2X1RA 1P5BA 3GDMA 2CLKA 1HO1A 4DXVA 2WJZA 3WK3A 4UTKA 1B3OA 5CSSA 3BPWA 3N14A 1OX4A 3IVSA 1LLWA 4YCPA 2HSAA 2PC4A 3MP3A 1J4EA 1NVMA 3NG3A 2PCQA 5D37A 4X22A 4LTSA 2CLIA 5F2LA 5K9XA 2V5BA 2QAPA 1VLIA 4NUWA 3V1PA 3F1QA 1M6JA 1GYNA 1S3HA 3NPXA 1SPQA 2O7QA 1YDNA 3Q37A 1KA9F 3OEXA 4W9TA 3NOEA 4ZQMA 1R30A 3L5AA 3C2EA 1O5KA 4L4LA 3L21A 4E0CA 5LZLA 5LNVA 2QR6A 3JS3A 1ADOA 3HG3A 2A6LA 3DFTA 3N2XA 5C55A 4QITA 4JTLA 1M5WA 4O1CA 2V81A 3S6DA 2GUUA 1FUYA 4OHQA 3ANYA 3E0IA 1R46A 5BRBA 1OF8A 5HWMA 2Y7GA 1SW0A 5HWJA 5J5DA 1KM4A 5K9DA 3OBKA 1OFQA 4GUGA 3PB0A 1TV7A 3LLFA 5A5WA 4HHPA 2IQTA 2NXGA 3NQ2A 1K8YA 5D2WA 2WNQA 2YXGA 1ZY9A 3L5MA 5D32A 3L65A 1A53A 4O1DA 3R89A 3P74A 1H1ZA 2HMCA 3NQ8A 1ICPA 3EX1A 3S9YA 2Q8LA 3CHVA 4DO6A 3NXFA 1OFEA 3SSJA 3LI0A 1A5AA 4X9SA 3WJXA 2H8XA 5GVJA 2Y7FA 2EAWA 2Y70A 1EEPA 2GVGA 2J9YA 2NWRA 4FB7A 1SO4A 4RCXA 3TJLA 4NJIA 3LCLA 4LOCA 4LRSA 2ISSA 1FDZA 1R47A 3MHGA 1P4CA 3A5FA 1T96A 4UR8A 3M5YA 4NXKA 1JCMP 4Q33A 4ORMA 1QPNA 1FXPA 1KM0A 3W1AA 4WXZA 4GRSA 1H7NA 2JK2A 3DAQA 3G1AA 1TREA 1OABA 1TRDA 2DZSA 5AHFA 2YGYA 2EPHA 3QW4B 1YDVA 4IPJA 3S1XA 5FF4A 4R7JA 4U28A 1UJPA 3R13A 1LBMA 3ABQA 1A50A 1YTEA 3FIGA 2A7PA 3R8RA 2YW4A 4MPQA 3C6CA 3PSVA 1PV8A 4HPXA 3RU6A 2YR1A 2QCFA 2CWNA 1RQHA 3TSDA 2YFNA 3M9YA 2YPIA 1FBAA 3MBFA 3ELFA 3WK2A 3W9ZA 2Q3RA 3B04A 1XUUA 4JGDA 1AW5A 5FI8A 2ZZ6A 4BK9A 4Y96A 3NR0A 1VCGA 4D2JA 1JCXA 1F5ZA 4UTWA 3G1YA 4NJHA 5DLCA 3W75A 5F4XA 1OVDA 5LNRA 1TTIA 1G4EA 5FEXA 3ABOA 1WBJA 4MZYA 1MEIA 1BWKA 2ALDA 3TQVA 4YLWA 2VOMA 1OFOA 5AC8A 5CPMA 3P5ZA 3VE7A 4UTHA 3HGOA 4LW7A 2A0NA 2DZXA 1AG1O 3O05A 3NL3A 3DHFA 4JTSA 2NX1A 2AQWA 3LXCA 4Q32A 3TDFA 1RR2A 4TMCA 4CQ8A 2ZRZA 3W7IA 3MO7A 1GZGA 1K7EA 2CW6A 3E96A 4MJMA 3S5OA 4KWVA 4AXKA 2ZTJA 3C0JA 1BEUA 1BWLA 1AK5A 2NWSA 4DEFA 1CX9A 3U6WA 1TPUA 3Q2DA 3KAOA 2Q8ZA 3W7PA 3W7JA 3UY7A 4C1KA 1PCKA 3QM3A 3W83A 5KINA 2TRSA 3GKAA 2YSWA 3L0KA 3RLVA 4AF0B 4PTNA 3BW3A 3ZR4A 1QR7A 4MLRA 1AW2A 3GXPA 2X1UA 3QYQA 5AYZA 2C6QA 3BK0A 4JY9A 3NPWA 3F4WA 1PCWA 1Z41A 3FOKA 4NU7A 4K8HA 4Z1CA 3ABRA 4PC8A 4KFNA 3PVFA 3PS7A 4O11A 3IVUA 1RVGA 5CPOA 2FQIA 4ZZ9A 1TYGA 2Z0IA 3WFAA 3KVMA 3O1NA 3THAA 4FHAA 1L2UA 4M19A 4NJGA 2QJIA 5F4SA 3QH2A 5HJLA 2JBMA 2V0TA 3MP5A 3HG5A 4ONVA 3AO0A 1K8XA 1KV5A 3SGZA 3UPBA 5EMUA 5G4EA 1YLVA 1Z44A 1LBFA 1GEQA 4O13A 4HSNA 3THQA 4PA8A 4JN6A 5E93A 2GQAA 3I7RA 4JXCA 2VEIA 4N9CA 3B0VC 2FB2A 4AVFA 1LBLA 2BSLA 1KTNA 3G1HA 3NAVA 3E02A 2Y6ZA 3Q58A 1T0OA 4IXXA 1JCLA 2EHHA 4N4QA 2VC6A 3HGSA 4JTUA 1H51A 4WOZA 5BMWA 1EX5A 4BI7A 1GWJA 1RV8A 3G3DA 4R53A 5BMXA 1B9BA 4AHQA 3DFPA 3PBYA 3STEA 1LRQA 2QCLA 5IBXA 5DY2A 5HQEA 2QJHA 2J88A 1F76A 1OFBA 3TH6A 4NJKA 3TFXA 4OBTA 2CLOA 1EA0A 3W74A 1QPOA 1OFDA 2CFFA 2EKCA 5F4WA 3G1FA 2GJNA 4LV4A 1ZCOA 4JTFA 2E6FA 2Q3OA 1JUBA 1EIXA 1A5SA 2ATSA 3IVTA 3NVTA 4XKYB 1XCFA 3UZJA 3JRKA 3MWAA 2V2HA 4O50A 3HQ1A 2H6RA 5F1UA 3C2FA 4UFHA 2GVJA 3NO5A 3UWQA 2ATMA 3TMLA 3H55A 3EXRA 3RMJA 3NM3A 1KLZA 3BO9A 5BOOA 4M5PA 1QOQA 1J2WA 3LBMA 2A5HA 4O17A 1EWDA 3P67A 3N19B 3EX6A 2WV8A 3M1ZA 4I9AA 3IIOA 1CW2A 5L6UA 3HJZA 4ZMGA 4KFOA 1UB3A 1YYAA 1KM3A 3QEZA 1C9DA 4O1AA 4Y9AA 3WJSA 5HR7A 2BZNA 2D73A 3GK0A 5KSWA 1Q6RA 4I7VA 1VR6A 1XL9A 4MKNA 1KBJA 1EUAA 3W88A 3VKJA 3TK7A 3GR8A 3MI3A 4MOZA 3LHWA 3B05A 3GLCA 5U4NA 4GNJA 2NZLA 3T4CA 5AC6A 3P84A 1CI1A 1LLZA 4CQ9A 3B0UX 4OT7A 3S1VA 3NQGA 3DI0A 1JR1A 3G0SA 3SIZA 2E09A 3G1VA 3B0PA 1K03A 4GWEA 4IXHA 3MYOA 1WX0A 3KRUA 4FXSA 3LM7A 5HULA 1FWSA 2GVLA 4WZHA 4GXMA 3LHUA 5HUOA 5DN1A 2R94A 5LNUA 3SY5A 3P82A 3E9AA 3GZ3A 3G8RA 3TQKA 1XBVA 4KWWA 1GTHA 1O60A 3NQDA 3GAKA 3PSWA 1PE1A 4AHOA 1AW1A 2YZRA 4QAIA 3N9SA 5MHBA 1G67A 3W6YA 4X3ZA 4HNTA 3TNOA 3W7KA 1FDYA 3CEUA 3ZWSA 5EKYA 3NQVA 3UD6A 1XKYA 3BGGA 1DL3A 2HS8A 5CZ0A 3W84A 3M47A 4JX5A 1X1OA 4MJZA 3EXSA 1IXNA 1L9WA 3BVJA 4H4IA 4O16A 2F84A 4ML9A 4DO5A 1NSJA 3VI2A 1IIGA 3O6CA 2RDTA 3PULA 1WBHA 1LOSA 1KFEA 1M7PA 1SFJA 5DXYA 3STGA 2YCEA 1S5TA 1I2QA 2PURA 5D2YA 4NT0A 4OQVA 4HPJA 3NQ7A 1TPEA 3PBWA 3B03A 4IUOA 3VNDA 4O12A 4YMZA 3B4UA 4O53A 3QJAA 3W23A 4C1LA 4N4PA 5AFDA 1KW1A 3FYPA 4GUJA 1QAPA 4AF0A 2Y7EA 3RNDA 3EWBX 3MHUA 4K39A 3LTYA 1H7PA 1Z48A 3EX3A 4N6EA 3MYPA 3O63A 1F2JA 4UFMA 4NZFA 4MY8A 3GB6A 4AEOA 4UTTC 1TQJA 3QZEA 2W6RA 1C29A 3EWXA 2V2DA 1EP3A 4Z0JA 3SJ3A 1UUOA 2WKJA 1GYLA 3PM6A 2ZYFA 5D09A 1W5NA 2ZZ3A 3BLIA 1PHWA 2B7OA 4LV9A 4Y8FA 3BV4A 4IJBA 4MUZA 1WOBA 3C2OA 4RK8A 3LRMA 2V5LA 2GOUA 3M16A 3W3OA 5ABTA 1W1ZA 1WA3A 3QFEA 1W56A 4AWTA 3S5NA 1O94A 3UXDA 2R14A 4UMBA 3W22A 1OYCA 1MXSA 5FF3A 1P0KA 4HNVA 4E2DA 4QIUA 4BR1A 1JRBA 4LC8A 4PFMA 3W1XA 2C19A 5E0KA 3KOFA 3UYCA 4ADUA 5TBOA 3N34A 3N73A 3R12A 2W0UA 3W70A 4DF0A 3NQAA 5G2HA 5LGZA 1MSSA 4UTMA 1VCVA 1L6YA 2QEZA 2C14A 1OK6A 2HTMA 6TIMA 5G5IA 4UTLA 5C6MA 3YPIA 2J6XA 3LHZA 1B4KA 1OX5A 4XBSA 3RLUA 4GBUA 2VENA 2TMDA 3LX9A 1LTDA 2QCDA 3TX9A 1M7OA 3QSTA 5CPLA 2J27A 3KHJA 3PB2A 3KRZA 3L0NA 3OHIA 1I2PA 1W37A 1FCVA 2B7PA 5CSRA 3TKFA 2E6YA 4JYDA 3W86A 3LLDA 2R91A 3HGRA 3HO8A 1VYPX 3N9RA 1SZEA 1FWTA 1FY6A 3EWWA 3I7SA 1TJPA 1ZFJA 4HSOA 2BLEA 3IRDA 2QJGA 2DZVA 4MVAA 4CNNA 1A5BA 4UMAA 4QSHA 2HS6A 2Y89A 4RZ5A 2B4GA 4XQ6A 3LCFA 5AHIA 2X2GA 3I68A 3LCXA 1TRIA 1YTKA 1Q45A 5D33A 3CB8A 4UNLA 5FF2A 3RFAA 1VCFA 3BG9A 3NZ1A 5J5RA 1R2RA 4JTGA 3BG3A 4BFAA 1GVFA 2J9ZA 4FNRA 3NL6A 3LCWA 4DPQA 1GG1A 3PY2A 4J9JA 3W85A 3EKZA 2ZRWA 4EF9A 4CCEA 3IGUA 1GG0A 1LROA 4WOQA 2W79A 1VHCA 1YADA 3QRHA 2QDGA 1JVNA 5AC7A 5CZJA 1NAL1 5U7SA 3TSMA 1TPWA 1Q3NA 4PCFA 3W7QA 2V8ZA 1JUKA 3TXVA 1QDSA 1FCBA 4TO8A 2A1YA 3CWNA 3STCA 2JGQA 2R8WA 3QC3A 1TCDA 5A8GA 1A5CA 4NNBA 4PL1A 1RQEA 3R2GA 2C0AA 3QPYA 3GIYA 3O15A 4AMAA 1W5MA 3HMJG 4O18A 4OGZA 1H63A 3QW3A 1SO6A 3TR2A 4IGHA 3W73A 3W87A 2YFOA 1I2NA 3OVRA 1K7XA 4O8RA 5C2XA 5I3JA 1F74A 3NQCA 1XBXA 4RJEA 3M5VA 1SUXA 2B0MA 3W2LA 2VFEA 3G24A 1GVRA 2X1TA 3P60A 4ZQRA 1VZWA 3W1PA 4N6FA 4O4WA 1WAUA 5K7JA 4JNMA 3EKLA 4LUIA 5KZMA 3IEBA 2WSYA 4MFEA 3P81A 5D04C 1S5WA 2F7FA 1Q6QA 3W7RA 1OFAA 3UNDA 2Y63A 3DGRA 3LRKA 1K3UA 3UY8A 3W1UA 3IIPA 2GJLA 4WY0A 1E51A 2A7NA 2EF9A 3SECA 4S2CA 4JTEA 5G2IA 3UWYA 4UTJA 1PHQA 5E1QA 4HIBA 4I7WA 5LSMA 3H54A 5D2XA 3GAYA 2E5BA 3FA5A 4WQ6A 2QCNA 4JDBA 1IGSA 1DOSA 2Z6IA 1GT8A 2Y85A 4QNEA 3LGEA 4EOUA 5DBTA 1W8SA 5G1YA 3PG8A 4AB4A 3S1UA 3G3MA 2VEPA 4DQWA 1B57A 1OHLA 3M41A 3NDOA 2ZA3A 3EB2A 5F1VA 2WO5A 4FXRA 3UPWA 2E68A 3DH7A 5KTLA 1KLYA 4MZ1A 2X1SA 2Y61A 1UCWA 3DENA 4ADSA 5D30A 4MY9A 3F03K 2FIQA 4NJJA 2ZRUA 1SZNA 5FEWA 1H5YA 5I3KA 1I8JA 3LTSA 4LC6A 3RF9A 1S5VA 5L9FA 8TIMA 3LXAA 1P0NA 1X7FA 2QUUA 3CIWA 3TMQA 3O8AA 1HO4A 4HNNA 1XFBA 4M6VA 1X6UA 2ZDRA 3QPZA 3UWZA 1G4PA 3MUXA 3W1QA 2B7NA 4ZQNA 5H91A 4ALDA 2A85A 3G22A 3DKJA 2J9XA 3T7VA 4WY0B 3VFLA 3G0UA 2CZ5A 2CLMA 1DJQA 3I7QA 1U5JA 2I14A 3FLUA 1FDJA 4LUJA 1I2RA 4NNCA 2WNNA 3GDTA 2CLEA 4TR9A 4POCA 3V75A 3INPA 1VYRA 5LGXA 4XBKA 3GVGA 4XUGA 3ATYA 2QCGA 3CQ0A 3W7HA 5EL1A 3DZ1A 3HIJA 3CIXA 1L6WA 1PVNA 2DZUA 4M7SA 4UTIA 2E1DA 3HPXA 4O54A 1D3GA 3NEVA 4JTTA 2QCDB 1FX6A 1F6PA 2DU2A 2JKAA 1GPWA 2ISVA 3C56A 3MI6A 3IV3A 4AWUA 1TQXA 2DZTA 1ME7A 3MP4A 4ICNA 3L67A 4O0ZA 1VGAA 1MEHA 1TPDA 1XM3A 2EGZA 4JR5A 4TIMA 3BARA 3KFTA 2BXVA 1VLWA 2Y88A 1XBZA 4Y6GA 4YXGA 2V82A 5HR6A 1I4NA 4BI6A 4DF1A 1OF6A 4H3DA 4ZQOA 2P10A 1SW7A 5G2WA 4IMDA 3LCHA 1O95A 2ABAA 1TTPA 2Y62A 4A22A 3HBLA 4A21A 1Z42A 4CQAA 4FX8A 3P8JA 2JGYA 4FIRA 3QQ1A 1BKSA 3EX2A 4UNKA 1LDCA 3W2MA 4LS1A 1KTCA 2ZZ1A 3A22A 3WJZA 3W72A 2PRHA 1H62A 3CC1A 1W3NA 4AH7A 1TPH1 4FEZA 3SGUA 3U2OA 5FEZA 2E5CA 1KFKA 1MEWA 2CZFA 3PWAA 3TAKA 4UFLA 3TC6A 1DBTA 3KVKA 1F7BA 1OG0A 2DZWA 4GUIA 3PG9A 5K2ZA 4FX6M 4GFSA 5KITA 2V30A 1HUVA 1TTQA 5EA9A 3TCEA 5AHNA 4FNUA 1FWWA 3W1NA 3MHFA 1TPB1 5FEPA 4FNSA 2DJLA 3S5ZA 5IM51 4GE8A 3LRLA 4HN4A 1T8XA 3DFQA 3N3MA 3FEMA 4LVAA 5I3GA 4PH6A 3ZS4A 1FCQA 1QPRA 2NUYA 1EB3A 1G6CA 3M7WA 5D02A 2WSRA 3TAOA 3GYEA 2VFHA 4S1FA 1LZOA 2E6DA 4JX4A 4Z1DA 3L2IA 1VRDA 3KX6A 4HKPA 4PODA 4N9EA 5I3FA 2ZCGA 2NUXA 2VFFA 4NXSA 3W07A 5CZSA 1SU5A 4UR7A 4ZQCA 1JCJA 2FTPA 4IQLA 3W2UA 3E49A 4GC4A 5HNRA 2CLLA 4Z08A 3L0GA 4NNAA 1QO2A 4OV9A 2QCHA 4OE7A 3SR7A 4S2BA 3ZFHA 3Q94A 5SWUA 4QQ3A 4UTWC 4NVTA 3LV5A 4U4MA 3GR7A 4XTIA 1W0MA 5LHFA 1FCUA 3F4NA 2ZRYA 2YDAA 1SQ7A 3QMRA 2PE4A 2H90A 1H60A 3SI9A 3OG3A 1WV2A 5FF0A 3TC7A 2VEMA 4JDYA 4N02A 3LI1A 4MYAA 3LCIA 4JYFA 3EWYA 3WK1A 4LY8A 4MFDA 4Z1AA 1TJRA 1XBYA 4Z1BA 2FDSA 1HL2A 3DXIA 2Z6JA 4RXFA 4FIQA 4UC5A 2I9EA 3DFOA 4JEQA 5CG7A 1TPVA 5DCDA 3W1MA 1JUEA 3TE9A 1NFBA 4MLJA 2G96A 5I3HA 1D9EA 4DF2A 2RDUA 1YDOA 1EUNA 1ME9A 1EP1A 3LERA 5AYYA 1R2SA 1OFRA 1IF2A 2WOQA 4E38A 4RKAA 4UUIA 1TB3A 1OX6A 3C4UA 3BW4A 3O16A 3KVLA 5AHEA 1I2OA 2CLHA 2DZPA 2RKXA 1ONRA 3W7CA 5TQLA 1H61A 3LXBA 4O10A 2UV8G 4CNOA 2NV1A 2NLIA 2XN2A 4MY1A 4M6PA 4KKXA 1P1XA 4PL2A 4BWLC 1F6KA 1ZAHA 2AAMA 1JRCA 2DORA 4WY0F 2I1OA 1H7WA 1QNVA 1VYSX 4WJEA 4EWND 3O06A 3UXAA 3PUEA 3QF0A 1K7FA 1DQXA 4LVGA 2WSQA 4UIOA 3W7GA 1QMLA 1DHPA 2NXIA 4OU1A 3NZRA 3W7LA 2QCMA 4LVFA 5D03A 1KM1A 2ISWA 1ZAIA 2FPVA 3GXTA 1QFEA 4H6KA 1GOXA 3W1LA 1LRTA 2O7SA 2VEKA 1TPFA 1VH7A 1HTIA 4HT3A 1TO3A 4O28A 2FPYA 3FKKA 3MJYA 2FJKA 2ZRVA 4RR4A 4A2SA 3C8FA 1JJKA 2XN1A 3TSBA 3HG4A 4G1KA 3GNNA 4WXYA 1Y0EA 5F2GA 3TW6A 4JTJA 4WX2A 4MYXA 3C52A 3DU0A 1LCOA 2JKPA 2B7QA 4KFPA 1G7VA 4TU1A 1SFLA 1NF7A 1OJXA 4OWGA 3KXQA 5DXXA 3BGJA 3DBPA 3C2VA 1GTEA 3P8IA 2TPSA 2V2CA 4IMGA 1ICQA 2G5WA 5I3IA 4N2YA 2NV2A 4QISA 1R2TA 3ZWTA 3MBDA
chains in the Genus database with same CATH superfamily
1DP0A 3T0DA 3RX4A 2G3JA 3W2JA 3DHDA 3GDKA 3NYZA 1X98A 2ZUUA 5E0FA 4V1YA 3TUUA 4Z2LA 2NX9A 4O52A 1GK8A 3PJXA 4UFKA 4PUJA 3H53A 4IMFA 2WZEA 2XIMA 4RZ6A 4NIRA 3RPTA 2FPTA 1VPXA 1WYIA 2VT0A 5FD0A 4DUOA 4OKDA 3O0FA 3T8LA 3OBAA 4DJEA 1C8QA 1L2QA 2XWDA 1ZAJA 3OG2A 3CQKA 3AYSA 1XIFA 1YBQB 3S2JA 4XD4A 3VIGA 1J10A 1FWNA 5H8UA 3KDOA 4WHBA 4R88A 2QUVA 4FAMA 2R24A 4I3GA 5M3WA 2YX0A 4M6QA 1S2WA 3ARQA 1VEPA 2DPEA 4GVFA 4RZBA 1KKOA 1RD5A 4JIIX 4XO7A 1KCLA 1G4TA 3E3HA 1JZ8A 1LWHA 3PBUA 3RO6A 3RUBL 4F48A 3WD1A 4XD6A 4ZFCA 3NCOA 1U30A 4UTUA 3MT1A 3LCGA 1Z9AA 4BS0A 2WJEA 4LCSA 2DEPA 1OM0A 2HK0A 3PN8A 5FACA 3WQDA 4IL0A 4YYFA 4LY4A 1X1ZA 5FJIA 2DY3A 2AMGA 3P62A 4JTIA 4GYPC 3ARVA 3BDKA 3QLLA 4W85A 2YA0A 3W2KA 1YMYA 3SZ8A 1OC7A 7ENLA 2QS8A 2ZFAA 1HFBA 3ITOA 3O07A 4KRZA 3OB8A 4JFVA 1DQWA 1TE6A 1XDLA 2TYSA 4A2RA 1HIZA 1FOBA 2QKFA 2GJXB 2FDMA 1UR9A 3DFNA 4UCGA 3LS9A 2J66A 1IEXA 1U1JA 4IP4A 1QUMA 3WMLA 1TUXA 3M44A 3RLHA 1ELSA 1E6NA 3EYPA 3LDVA 4ORIA 2XDFA 1XISA 4JKLA 2GPTA 2VC9A 2G97A 1WB0A 1PYFA 3WLIA 4L9XA 1XYFA 4PUDA 5FF7A 4JTCA 1R9XA 3LTPA 3EA1A 2Y2WA 1PKLA 4V1XA 3UXIA 2BBFA 3WUFA 3UWWA 2GDUA 3UERA 1VIWA 1QW8A 4L4PA 5G1TA 9XIMA 3T78A 1J2BA 2TSYA 4JY8A 1JCTA 1UD6A 5D9NA 1MO0A 3BLFA 1BLIA 3I6EA 2OQYA 3SN0A 2Z2UA 2A4AA 4UQCA 3RU8X 2FVLA 4TX6A 2I5IA 2QJNA 1UKPA 1XDMA 2CNCA 3PAJA 4K7VA 3PANA 1EO5A 5A6KA 1UJQA 3M5ZA 4DYKA 1XLHA 4EIVA 2J8TA 3CAQA 3H2OA 2YDQA 4A3QA 2PRMA 5CQ1A 3PUOA 3GBEA 4INFA 5LIXX 1AUSL 1JF5A 4K7YA 3H4XA 3AMKA 3APTA 4C6BA 3BZGA 3SCTA 3SUWA 1LLOA 4DNMA 2G3IA 3M0JA 4PCTA 2XFWA 2GSEA 1RA0A 4KEVA 3C2RA 4UB9A 2ZVIA 5HA7A 1ZJIA 4PMYA 3CTLA 4A4AA 4Q4KA 3GD6A 3ZM8A 3B06A 3FVDA 3GKFA 3LV6A 3KOWA 1A5LC 5FESA 3TN6A 5K4XA 3VNZA 2WZMA 2Q09A 4UZUA 2E0PA 4LRTA 3VKCA 1ML1A 1UWTA 3NA8A 2YOCA 5GJNA 3LPFA 3NYDA 5B80A 5A8QA 4CD6A 3GNPA 4D1IA 1QNSA 3HF3A 4ADTA 3G0XA 3ABSA 4ZQPA 4JTKA 2BOFX 4NX0A 1BYCA 1W9UA 4NKCA 3HG2A 3NXLA 4FOKA 3TXZA 1LF1A 3AIUA 7TAAA 2X7WA 3M5XA 3BLEA 3TN5A 3NQMA 3TYZA 2C18A 3N4EA 2VNCA 3KL3A 4IMEA 5ABFB 4CEUC 1H50A 3SFKA 4UXDA 3CHEA 1OK4A 2GQ8A 4RDVA 2ZZ7A 1NU5A 2SFPA 4BEUA 2ZTKA 3GHRA 1XLBA 5TF0A 2BFGA 3W71A 3U3HA 3DGBA 1V79A 1J0KA 3MW7A 5I02A 3N6JA 1UWUA 2ON3A 4GPNA 4DJFA 3NM1A 4AAJA 3A21A 4MUPA 1KTBA 4JL1A 3GTHA 1EJUC 3CO4A 2V38A 1W9DM 1O4UA 1I0BA 4EXQA 3G2GA 4LS0A 4BHYA 1UMLA 3G1XA 3MCMA 4J3SA 1RCOB 2GQ9A 2NV9A 4GOAA 4DZAA 3TQ0A 4OIFA 2XVGA 4MWAC 1YPFA 4RW3A 1XUZA 3BOXA 3GC4A 3QC0A 3AYTA 4MMWA 1B30A 1NEYA 3LHTA 2NW0A 7REQA 2ANUA 3L4YA 2ZDSA 3TU9A 2VX5A 3O6DA 5EY5A 2H3BA 1TUFA 2O0TA 4HMEA 3P80A 3HOJA 2D69A 5LIWX 4GXWA 4JX6A 4IGNA 2FZ9A 4D6EA 3PZNA 4PCSA 4FS9A 3AJXA 3PR2A 1XP3A 3LOTA 4XB3A 1KV8A 4O1BA 4HZ7A 2BG5A 5E9AA 2FZNA 1FWIC 1EOKA 1XI3A 4PTWA 2E40A 4KWSA 1QO5A 2VDGA 4FNTA 1PBGA 4D71A 1X8FA 3UJFA 1DJHA 1RPXA 2PLJA 3EBVA 1TELA 1SW3A 3I3EA 4PMJA 4AEFA 3W7DA 1ONEA 3S5SA 3QHNA 1VPQA 1NOUA 4EE9A 4EPEC 1W1TA 3P61A 4LF1A 1S5NA 4DWSA 4U3AA 3CEPA 4HQVA 1HJSA 3GDLA 2YXXA 2DSVA 5EYWA 2XFYA 3C61A 3F5LA 7REQB 3MCNA 4CCDA 3L68A 1VC4A 4D6JA 1XXXA 1KM2A 1UWAA 4QS5A 1OWQA 1N55A 2UY2A 2XVNA 3E2VA 3GDMA 4DXVA 1XF0A 1LLWA 4YCPA 2HSAA 2DV0A 5A3HA 1DXEA 3NG3A 3TWAA 3GC5A 4X22A 4LTSA 2V5BA 2QAPA 4HN8A 1CXHA 1E0TA 5DO8A 3QTGA 2WC3A 4V2XA 1Q8JA 4W9TA 2OYMA 2OFJA 3CPUA 5LNVA 2FGZA 2A6LA 2PU0A 4TVCA 4Z42C 4UQEA 1PTGA 1X6NA 5BROA 1XFCA 3EPNA 4DJFD 4Q4QA 3PWGA 3IJIA 3VZZA 2ZWZA 1SW0A 5J5DA 3V4BA 2O9PA 1JYNA 2QMKA 4BZYA 3SRKA 4JIEA 2RGLA 4H04A 2NXGA 4DYEA 2WNQA 1NDYA 2VGGA 5D32A 1Z7AA 3MPGA 1H1ZA 2XM1A 1EIBA 1S38A 2HMCA 1TA3A 3S6OA 3CYJA 1BXCA 4W8LA 1OFEA 5JBEA 2B31A 3LI0A 1A5AA 5BWFA 4BF5A 2XZ7A 2Y70A 1EEPA 2GVGA 4RCXA 4LOCA 4LRSA 2ISSA 1R47A 3MHGA 1P4CA 2Y8VA 5DRIA 1SM9A 4N7QA 2NT1A 4QG6A 5I03A 3ENLA 1AD4A 3CGTA 5LYRA 3W1AA 4WXZA 2O55A 1H7NA 1VBHA 2JK2A 1TREA 5AHFA 4AZCA 1NWTA 2EPHA 3QW4B 1YDVA 4IPJA 2E25A 1UKTA 1JL8A 4L64A 1PZ2A 4FLSA 1LBMA 3R8RA 2YW4A 4MPQA 1WDQA 3PSVA 4HPXA 2QIIA 2CWNA 1RQHA 2PWFA 2YFNA 4C6NA 1FBAA 4ICMA 4Y9OA 3W9ZA 2XM2A 3B04A 4CNTA 1XUUA 3P93A 1WKDA 2J47A 5FI8A 2A79A 4Y96A 3NR0A 1OD0A 1JCXA 1F5ZA 2J4GA 4IIDA 2CHRA 1A3XA 5D9OA 5BU9A 4MZYA 2PLMA 1JD7A 2ALDA 3KBNA 1HXJA 4C5ZA 3GDBA 1ISXA 3VE7A 3JZUA 1X6LA 4LW7A 4PE8A 4EANA 3B9OA 4KCUA 1AG1O 5D8ZA 2Y4SA 1S2CA 1U1UA 2NX1A 3LXCA 4Q32A 1O1HA 4TMCA 3GU9A 3XISA 4CQ8A 2HDJA 3W7IA 2C91A 1K7EA 2CW6A 3NVDA 3TA9A 3UGVA 3S5OA 4MJMA 3SQLA 2EPMX 1KC7A 3CQHA 4IT1A 2PZ0A 2WHKA 2NWSA 1CX9A 1TPUA 3W7PA 4GQBA 2VRJA 1UD5A 1QU4A 3W83A 3RLVA 2GJXA 3VD7A 5FAJA 3O6AA 4ACZB 2XIOA 5HQMA 1OY0A 3GG8A 3DIPA 1R9ZA 2WNWA 3EOUA 3BK0A 3NPWA 1PCWA 3QPEA 4NY2A 3REQB 1J0IA 4Z1CA 3ABRA 3SQMA 1IYXA 3KTXA 4PC8A 1ECQA 3UG5A 1BGGA 1UROA 3EWDA 4H01A 2Z0IA 4IFKB 1L2UA 3ORWA 2QJIA 1JPKA 3A3HA 2OSWA 3KBWA 1CGUA 2WBGA 3UBPC 1TVNA 3HG5A 4ZCWA 3VDAA 3MUIA 3UPBA 4ZO9A 4ERGA 2ZUNA 1GEQA 2XSBA 3LNMA 4O13A 3LMYA 5AY7A 4CQCA 2QGYA 5E93A 2OLSA 1RLCL 2BSLA 3HMCA 5FJJA 1JIBA 1FWFC 3Q58A 2V3EA 2OO6A 2VC6A 2PLKA 3E38A 2PMQA 4WSKA 4PMVA 3WUGA 4BI7A 5BMXA 2GDVA 1J01A 4XZMX 5I00A 1EEXA 1NELA 1D7FA 3NSMA 4C60A 3FGCA 1FP9A 1QWKA 1XS2A 1ZTVA 2Z7GA 5HQEA 3SCSA 3CASA 3BJFA 3IJLA 4MNKA 5B7YA 3LSCA 1RK5A 3T0BA 3DESA 5C2CA 1AH4A 2F6KA 3G1FA 1M03A 1ZB5A 1JUBA 3ME3A 3UZJA 3MWAA 1O66A 5D9MA 2GVJA 3NO5A 1X38A 3UWQA 5I3DA 3H55A 3QOKA 3EA2A 1TJ1A 5REQB 2VI0A 1KLZA 1YNYA 3A64A 2A5HA 2DIEA 3N19B 3C86A 2WV8A 2CITA 3IIOA 2P53A 3H4GA 5FSDC 2AKZA 3VOCA 4Y9AA 5HR7A 1E1CB 1VR6A 1T6MA 5PTDA 1KBJA 3N12A 3EMCA 3W88A 4V15A 2W67A 3MI3A 3U9IA 3B05A 1QJWA 1CI1A 4CQ9A 1CT5A 4HOXA 4OT7A 1R3VA 1OCBA 3G0SA 3SIZA 2E09A 4W87A 1XPGA 3R79A 1WX0A 3UT0A 2OEKA 4NZ3A 2PTXA 4GQGA 4XX6A 1FWSA 1PZ1A 1GOIA 5DN1A 2R94A 4P8VA 3RRAA 1CDGA 4KWWA 4DUXA 5C7VA 4CU6A 1ODZA 1RBAA 2BVDA 2DT1A 4AQLA 2HZGA 1OSEA 1G67A 1T40A 4HNTA 3NWRA 7PTDA 1F3EA 1KD0A 3I10A 4G5DA 4LANA 4W7VA 4DIAA 3CEUA 3ZT5A 2DW6A 2NQ9A 1IEWA 3VD9A 1DL3A 3VM7A 4JX5A 4BQ2A 3E2SA 1L9WA 4PUWA 1J79A 1KR1A 4DO5A 2I17A 2HXUA 1IIGA 2AL1A 3KBSA 1WBHA 1LOSA 2PURA 3S3GA 1VJSA 5D2YA 4NT0A 3IPWA 1Y7VA 3WO8A 3PBWA 4LCQA 3VNDA 4YMZA 1XYZA 2D23A 2PDMA 1REQB 6XIMA 4GA8A 4LXFA 4N4PA 5AFDA 3FYPA 3RCMA 3A3XA 3AU2A 1V3KA 4K39A 3LTYA 3ZLHA 2Y5SA 1Z48A 2FZMA 3H70A 4HA4A 2VD8A 4LUSB 1WXZA 3O63A 1F2JA 2HBVA 3GB6A 3IJDA 4UTTC 4JTRA 4Z0JA 2VP8A 4YHGA 4XD3A 1GYLA 4L1GA 2PS2A 3EOEA 4YTQA 2BDQA 1RAKA 3LRMA 2QXWA 2V5LA 3RN6A 1E70M 1MQQA 1A0CA 3LQGA 4WDWA 1WA3A 1FWCC 3BLDA 4AWTA 3S5NA 3FXYA 3UESA 3DX5A 3R1ZA 2R14A 3TYBA 5FF3A 1P0KA 3J7HA 3N2TA 3BE7A 5E0KA 3PZGA 1B1YA 5C71A 3KOFA 1AJ2A 2P8CA 3WMSA 1GHSA 3N34A 3N73A 3W70A 2OQHA 3NQAA 4AWEA 3AS0A 4GABA 1PTDA 1G1YA 2WXDM 3N2CA 1ZBKA 5G5IA 5C6MA 3YPIA 2J6XA 1ADSA 1B4KA 1KBLA 1OX5A 4XBSA 3RLUA 2ZX5A 2OWCA 3LX9A 3MANA 1FA2A 4U33A 3KHJA 2PWUA 3VOJA 4YTSA 3KCLA 1F07A 1TMQA 1FCVA 2B7PA 5CSRA 1XINA 3RX3A 2E6YA 2R91A 3Q65A 4QR6A 1VYPX 3W00A 1UQZA 1FH7A 4GISA 4C6MA 3BL3A 2BLEA 4A35A 4CNNA 1VIZA 3T0CA 1Q8AA 1IGWA 2B4GA 5AHIA 1JEZA 3DHPA 3ECQA 2WQDA 4AD1A 1YTKA 1Q45A 5FF2A 2VWSA 3HV8A 4JTGA 1A5UA 4FNRA 3PY2A 4HPGA 4J9JA 3AS3A 4JBRA 5CBJA 4EF9A 4CCEA 1V0KA 2VX7A 3WD3A 4JN8A 3IGUA 1FWHC 3H2EA 1OBAA 2W79A 1M3UA 3LEPA 1YADA 2QDGA 3IJQA 3WLLA 4S3AA 4DI8A 2OOGA 5FAGA 2Z00A 1N8WA 4MB5A 1L6GA 4LSBA 2BGNE 3V5OA 3TXVA 2IS7A 1CBGA 1J0YA 3NDZA 4C1NA 2O4MA 4FOUA 2A1YA 3HFTA 4DXXA 4P7QA 3STCA 1ITCA 4LAOA 2R8WA 3QC3A 4PBGA 3R2GA 4PMQA 2C0AA 1Q5MA 1VEMA 2EG8A 3GIYA 3O15A 4AMAA 4X60A 1VFSA 3HMJG 1SO6A 4AYGA 3W73A 4L56A 3E0WA 3VNKA 2P50A 1LQ0A 1H49A 2IQ0A 3W87A 4IQJA 2E28A 1KWGA 1I2NA 3P0XA 3AXXA 1V7AA 1GZJA 4DYJA 4RJEA 3PWIA 4D8LA 1SUXA 2VMFA 3W2LA 4ZQRA 1GVRA 2X1TA 4GHRA 1MXGA 4G6CA 4W89A 3B97A 4GCXA 3UNDA 4HU8A 2YXOA 1JG9A 1E51A 3H2FA 2R6OA 3VAVA 3WNKA 1NWRA 4Q4MA 3WQPA 3SCRA 4HIBA 2WCGA 5D2XA 1EJRC 3GAYA 4EPKA 1S2AA 3FA5A 3EAUA 3CK5A 3QFWA 4LYQA 1DOSA 3LGEA 3WDPP 1CNVA 4U2YA 3H6OA 5G1YA 3OZYA 4AB4A 3R6IA 3ZSTA 2VEPA 4KCVA 3HJEA 2P0IA 4ZOBA 2D2GA 5I09A 4DQWA 3EB3A 1WKFA 4NHVA 3M41A 1B2YA 2F6XA 2E68A 3T08A 2XWEA 3NZPA 2Y61A 2O9TA 4PSRA 1SZNA 1KCXA 1AZ1A 5I3KA 4LC6A 4HU3A 5BXSA 3A4WA 1SGJA 1NOWA 3WQOA 1JDAA 3LYEA 4R7WA 5DMNA 2WWDA 3V3WA 4HJWA 2HJPA 1X7FA 3TMQA 1BG9A 1R7OA 1J0ZA 3E2QA 4C6LA 4C7DA 1X6UA 2VZSA 2ZDRA 4KWUA 5GPRA 3UWZA 4D8AA 4J4KA 3MUXA 4ES4A 4ZQNA 3DKJA 1CGXA 1FWEC 2XJ7A 3KLLA 1FFRA 4NAFA 2V67A 2ZOXA 3G0UA 2CZ5A 2EO7A 5JIPA 2OGJA 1BAGA 3PJUA 2BVYA 2J7GA 3SRFA 2WNNA 4RUBA 1V3HA 5BOFA 4CN1A 4XBKA 4E4FA 1V0LA 1XSKA 4GXPA 3KEHA 3W7HA 2BASA 5CLTA 4E4PA 3HIJA 1L6WA 3QZAA 1PX8A 2E1DA 4MNMA 2QCDB 3GUWA 3C0QA 1LQAA 2ISVA 2R1NA 3C56A 1SVDA 3MI6A 4AWUA 1PEZA 4XAZA 1QTWA 3M4HA 4HA1A 4ICNA 2DZTA 2KX9A 4EKJA 3L67A 3KBMA 1VGAA 4O0ZA 4R5EA 2BODX 1XC6A 4LAMA 4GQRA 3WH7A 4IIHA 1XM3A 1HKJA 1DTUA 4JR5A 3D5HA 4TIMA 2DIKA 3BARA 3KFTA 1W91A 2F61A 4NP7A 2QDDA 4I5RA 1R3SA 4GJIA 4QE5A 1BSIA 5T91A 4DF1A 1KQZA 1LL6A 1OF6A 3WFLA 2VWTA 3GRIA 3I6TA 4PEEA 1W3KA 2GGIA 3HBLA 1DXFA 3TP4A 2FTYA 1HL9A 4FX8A 3TTQA 2YCLA 1TFVA 1CPUA 3NO1A 1XQLA 3K46A 4LS1A 4A05A 2J79A 2J78A 2PRHA 3VA8A 5CGTA 1H62A 1TPH1 3MV11 2CZFA 1OEPA 1EF2A 3PWAA 1DBTA 4QXIA 1IR2A 4EACA 3PG9A 5DQPA 5KITA 3TNBA 3VOFA 3CHFA 3RMEA 3SSZA 1HUVA 2YCJA 4CEXC 3AZRA 4QBXA 4E4UA 2J7DA 4FNUA 1FWWA 3NOYA 3W1NA 1TPB1 5A2CA 4AZGA 4M81A 5IM51 4GE8A 1XLDA 3DFQA 3B3DA 3FEMA 4LVAA 2NUYA 4PCPA 5I07A 3BLLA 3M7WA 1EYEA 2VFHA 2E6DA 5DMLA 4WVXA 3AC0A 2V3FA 4LBSA 4N9EA 1DWAM 4AU0A 4ZOEA 5I3FA 1L8NA 2ZCGA 5CZSA 4GY7A 1SU5A 2VJXA 4ZQCA 1H2JA 3UGRA 2CLLA 1EC7A 1GKQA 3H2AA 4OE7A 4CN6A 1Q6EA 3MDUA 4NVTA 3LV5A 1N82A 3R94A 4DVOA 3N2BA 3F4NA 1K8CA 2DT2A 1S1RA 1UR8A 2ZRYA 3MS8A 2WHJA 2PE4A 2H90A 2FZDA 3HPFA 1WPCA 4N02A 4LH8A 3D47A 1QW7A 2BXYA 2DT0A 2PWGA 2VGIA 4HMDA 1V0NA 4Z1AA 4DJED 4Q8VA 2FDSA 1C8XA 4UC5A 3DFOA 5CG7A 2P3EA 2XFRA 1ZGDA 5HATA 5I3HA 4MLJA 5JH1A 2RDUA 1EUNA 1ME9A 2DZAA 1P6WA 3LERA 1R2SA 3WQEA 1EJSC 1J0JA 2QJJA 5AC5A 3BAYA 1PKYA 1GHRA 1I2OA 4K1GA 3W81A 2CLHA 1F61A 2ISFA 2DZPA 4F8XA 3U5YA 2OGYA 4DUVA 3OLEA 2UV8G 3NSNA 4RNIA 4MY1A 2PTZA 2W91A 1P1XA 1VB9A 4J3WA 4I5XA 5EMYA 4JKKA 4HB7A 4WDTA 1DPMA 1QNVA 3RLGA 3WL0A 4EWND 3FDKA 4AIEA 1R3QA 3W7GA 3MMDA 3W0KA 1QMLA 2VUYA 1XIHA 3K8LA 1UC5A 3WYZA 1BHGA 1CLVA 3SCWA 1LRTA 4PTDA 2VEKA 4AVNA 4AZ5A 1UWQA 4W8BA 4WKFA 4F9JA 1ISWA 1XW8A 1HTIA 1UZ4A 3T1GA 1XG4A 1V4YA 1JJKA 2FHCA 5C8BB 1NFPA 4N0RA 2X41A 4GGBA 1Y0EA 5F2GA 3ARTA 5CC6A 4WX2A 3IK4A 4JTAA 2B7QA 4KFPA 1XWYA 1G7VA 3ARZA 4YN5A 3D3AA 4MJ4A 4F2TA 4PTMA 3DBPA 4WSHA 3WF0A 4FXJA 3P8IA 2TPSA 3BAWA 4HCLA 4XISA 4IMGA 2NVDA 1ICQA 3VIFA 1E5JA 3TVAA 3UP8A 3M43A 3VGEA 2PUZA 1XRSA 5IHSA 4Z17A 1RZMA 2GJRA 1CGYA 4D6GA 3KVJA 3V7PA 2A3CA 3CUGA 4IPNB 1BYAA 4RV3A 4WSJA 1X39A 3M64A 2BVTA 3G8EA 4X2RA 1HN1A 3S47A 4XZHA 5T26A 4K36A 4IOTA 3PF3A 1CXKA 4GQ0A 1XCWA 1CYGA 1XHGA 2F2KA 2UY3A 1PX3A 3WLPA 3ITXA 1B5TA 3VIOA 4L4MA 2PI6A 1TTJA 3QSRA 1WUFA 1A80A 3TN3A 1VS1A 3BMXA 5CZTA 4A29A 3OA3A 3WDHA 2QUTA 2C13A 4K38A 3GW0A 1OCQA 4XAFA 2YB4A 2VX4A 2V5JA 4F0MA 4DBEA 4LVBA 4MZ8A 1PZ3A 5A6BD 1E1CA 1TV8A 1EPVA 1UD3A 3FJLA 3W2NA 1E6ZA 5HUPA 1BG4A 1FH9A 3M6YA 1GVIA 3AAMA 1OZMA 4JEJA 4QJ1A 4DZHA 5KZDA 1AL7A 4GUFA 4Q8WA 2BB0A 1IXOA 5G4HC 1BQGA 4JQ1A 1E56A 2VVSA 4H6RA 3A47A 3OO2A 4J28A 4FR1A 9XIAA 2J24A 2YCKX 5JUVA 3EDFA 5CPTA 4IX2A 2F2HA 1TPC1 1KGUA 3NQFA 4RE0A 3AALA 3EDEA 3LBCA 1J96A 3R0UA 1TV2A 1UUMA 1E0XA 4US5A 1DVJA 3A6OA 1YPIA 1EBGA 1VJIA 3T0AA 2HPIA 4S3EA 4PR4A 1IZKA 2GFTA 4G1NA 3JVAA 3F2DA 1G0CA 3GTXA 4GGHA 3VO0A 4HNUA 5K9CA 2VO5A 1W3TA 5BXPA 3HPSA 3CLMA 3QGVA 3WY1A 3WBWA 3HQPA 3SM0A 1X96A 3KWXA 2GK1B 4Q7IA 2J8FA 4H7ZA 4NI3A 1TWSA 4NZ4A 3CWOX 1V7YA 1T5AA 5AB3A 3PUDA 3N17A 1OADA 1H0GA 1RJRA 1GVQA 2WMHA 2NUWA 3BW2A 2OPJA 5LNWA 2VFGA 1GGOA 5MKGA 5AKQA 4US5D 2C15A 2QHAA 5ECVA 3KDNA 1RALA 1X7IA 3UWUA 2BNJA 3W7EA 5AECA 2QF8A 1X1NA 5CPNA 1LM1A 1XKJA 1XGEA 3NURA 3TQPA 1I9CB 1HW6A 4DBDA 2PTDA 1MW0A 2IPFA 2PGRA 3ZMRA 2Y5EA 2IQDA 2TODA 3RK8A 1G69A 4GZIA 1HG3A 3IGHX 3W1RA 3ICJA 3EPOA 4JQ2A 1N8IA 4LS2A 2QDHA 3OVGA 1GQNA 2WSPA 1FQ0A 1NF0A 4BQ5A 4Y7EA 4I6KA 1TZ9A 2YA1A 4HP5A 3G1SA 3AHYA 5DMMA 3MMTA 5HMSA 2ZE0A 4TMBA 2WQPA 5AHMA 1AH0A 1RH9A 3T40A 4D72A 1VFHA 4Q6XA 5XIMA 2QNEA 2EJ1A 4JN7A 2X30A 2E77A 2X0SA 3USBA 4BQ3A 4IX0A 4MWAE 4YWIA 3TTYA 2HE8A 9CGTA 3WJWA 1DJYA 3AMCA 4ILSA 4FX7A 4G2DA 4J2PA 3KTCA 1W3IA 1BF2A 3G1DA 2PWDA 3IIVA 3I3BA 4DLFA 1YDYA 4CCZA 2A21A 4P2VA 3OIXA 1OFPA 1SZFA 2FFCA 3MU7A 3S0CA 5A8NA 3CAKA 1X8CA 3MV01 1BXBA 3BQ6A 4NAEA 1R6WA 4IPIA 3W76A 3ZXWA 3EMQA 3I4KA 2WKLA 2KAUC 5BW6A 5LHEA 3ARYA 4LT9A 1LL4A 2QVNA 4RE2A 4ERIA 4D9PA 4YNGA 3SFWA 2ZXBA 1JZ6A 4UZSA 1QI3A 2JKEA 3CO8A 4MGGA 3U4FA 2J74A 7TIMA 3WNMA 4YVVA 1AMKA 3GXNA 3BUVA 4TTGA 3MSRA 4N9BA 4UFIA 3T4WA 3MKKA 1W2PA 4WUIA 3EZ4A 4C6OA 3VDCA 5LA2A 2ZRXA 3ZZ1A 4X0VA 1C8VA 4WDUA 3VNJA 3TA6A 5LIUX 2E5DA 4QSFA 3O0KA 4O14A 1YXCA 1QT1A 4Z2GA 1Q6GA 2ZADA 1UR4A 3QN3A 4XAPA 2D0HA 1AODA 1W5PA 4HU4A 3A24A 4MAVA 2ZZ2A 1EA9C 4M8UA 3B8UA 3CT7A 1Q6OA 2OG9A 4TX9A 2VXNA 1KNWA 1TMHA 2ZA2A 1J5TA 4L6HA 5FJOA 3OPSA 3VU2A 3CM4A 3CT2A 1QNOA 3WD4A 2A6NA 3DYPA 4WD0A 2P1FA 2OZ8A 3T2PA 4E8GA 1UA7A 4LAUA 1VJZA 1OB0A 3IAPA 3P7YA 1IR1A 4C90A 3RJYA 3TZNA 4REQB 2E3ZA 1B90A 3B8DA 3DI1A 3OVPA 2DFAA 4GG9A 2VDIA 1R3YA 1CCWB 1KBIA 2OZ3A 1Y5VA 5A6TC 4O15A 3NZQA 1E9ZB 3PBVA 2GOKA 2CLPA 3JR2A 3ALFA 3EEGA 4FO4A 1N7KA 5CPSA 1ZHAA 4JCLA 3DKLA 2YA2A 4W93A 4L1WA 3KL0A 4H7CA 5DRCA 3VDGA 2ZKMX 5BYWA 5BOEA 5EBUA 4BEQA 4AZ6A 3WNOA 3AHZA 1S1PA 4Q8QA 1PS9A 2YBTA 3ITCA 5DELA 3BSHA 1JXJA 4ZO6A 1GW9A 3QQ0A 5CC5A 2A7RA 3SW6A 3EOOA 1JCNA 4WLCA 3UCQA 3SURA 3RR4A 4WKAA 3SRHA 2ZC8A 4YTRA 4ZE4A 1JZ4A 4WR3A 1UH2A 1ISYA 4AC1X 2QF7A 4CVWA 3HGJA 4UMCA 4JFUA 2AGTA 2WWCA 4H6EA 1V3LA 1UKOA 4O0KA 4IMCA 2D2HA 3OGRA 4F9DA 4ZTYA 1RJQA 3QLDA 1IWAA 2H3DA 4H83A 2OZTA 3UYIA 4K6AA 3BXWA 4QLKA 1CLKA 1TSIA 4NZJA 3VGFA 3C0LA 3UZZA 4REQA 4HPHA 2HK1A 2I5QA 4AEEA 3EKGA 2ACRA 5I7GA 3V0SA 1VHNA 2D0FA 3NL5A 1Z69A 4X9YA 4Z0SA 1ALDA 2ZQ0A 1QCWA 2J77A 3UG3A 1GOKA 2QCEA 2OWXA 1F8IA 4HTYA 4RZ4A 3IV8A 1V5XA 2V5KA 1EH9A 2PDIA 4DAIA 1B3OA 3BPWA 3IVSA 4Q4OA 7XIMA 3MP3A 1J4EA 1NVMA 4LYPA 1KXVA 3W6LA 1P0EA 1E73M 1RHCA 4KCWA 4NUWA 1VFLA 3F1QA 1Q4WA 3UA3A 1S3HA 1ZBWA 3M0XA 1SPQA 2O7QA 4ZQMA 3PK7A 1I1XA 3C2EA 2QR6A 3U57A 4TQTA 3RM4A 5C0QA 3AROA 1V03A 5C55A 3CUHA 4QITA 4JTLA 5HMFA 2V81A 2GUUA 5LXXA 1XLKA 2A3HA 5BRBA 1OF8A 5HWMA 4W84A 3TONA 3SUTA 5I79A 2W27A 2I9UA 2WW5A 1KM4A 2GVEA 3V36A 3WELA 3FJ4A 1FWAC 5K9DA 1OFQA 1YE4A 3BAIA 3VKDA 3PB0A 2IW0A 3KZSA 2IQTA 2PDQA 3NQ2A 1V3JA 3EOSA 1ZY9A 3O7UA 3UVAA 1A53A 2P8BA 3CH0A 4R9OA 3WD2A 4LB3A 3CHVA 2PA6A 4KGJA 3NTYA 3NXFA 3MTWA 4F0SA 4TX8A 3WJXA 1CXLA 5A1AA 1E6QM 5LIYX 2NWRA 3TJLA 5I23A 4HA3A 4NJIA 2G8ZA 2OELA 2FMOA 3GG1A 3A5FA 3L23A 1T96A 5CJ5A 1JCMP 4ORMA 1FXPA 2ZX8A 2Y24A 1LG2A 4M3PA 2DW7A 1M7XA 2DZSA 2X40A 3GVQA 5HJYA 1UJPA 3ABQA 1C8YA 4GMEA 4GZ7A 3LQLA 4WJ8A 3C6CA 3AJ7A 2A3LA 3QYSA 5A6JA 2YPIA 3OW1A 3FHQA 4JGDA 4AYSA 3Q67A 3DN5A 3VX0A 3ITGA 4D2JA 4GVHA 4UTWA 3W75A 1DJIA 1DIKA 2ACQA 3VCNA 5HJXA 2W63A 4JNYA 3WG6A 1G4EA 2REQA 4IISA 2VOTA 2JALA 5CPMA 4UTHA 1EGMA 1V3MA 4U5IA 1QVBA 2QT3A 4JTSA 2AQWA 3VIIA 3TDFA 1RR2A 4WKHA 2HV5A 3GTIA 1UR1A 3APYA 5BWAA 3MVIA 4PGLA 1M7JA 2WB5A 2CZVA 3T81A 3BWWA 2DUZA 2IPGA 1AK5A 4JFTA 4W88A 2D0GA 3Q2DA 2IKJA 1AJZA 2G4FA 5MF5A 3W7JA 3QM3A 1E43A 4XK2A 3RX2A 1KCKA 4GBDA 3ZR4A 3GC2A 5CPQA 4NG3A 1QR7A 4MLRA 3S9ZA 3GXPA 4N42A 5BU6A 1EJ7L 1QATA 1FKWA 3FOKA 2YCIX 4HHLA 1FHVA 4OUIA 2YKKA 3GVWA 2H9AB 3MO4A 3IVUA 1UP0A 2J7EA 4RPPA 1TYGA 3WFAA 4CD8A 1GQKA 3O1NA 2QGHA 1MNSA 3BCJA 5F4SA 3QH2A 3DDMA 1J6PA 2BY0A 2BV9A 2YDSA 3OQEA 3AO0A 1K8XA 3SGZA 4DWSB 5G4EA 3PTQA 5MKGB 1Z44A 2X09A 4E3VA 4PA8A 2PF8A 4A3RA 2VEIA 3WQWA 3ID7A 3MB9A 3QQWA 3NAVA 3BQ5A 2Y6ZA 2YL8A 4GYFA 2UZ9A 1T0OA 4IXXA 3TCSA 1DWIM 1JCLA 1I75A 2CKRA 2EHHA 3HGSA 3RR1A 5IRPA 4WOZA 3MUAA 4CU8A 4EPDC 3G3DA 2VEFA 2VTFA 3VIJA 3DFPA 1EQCA 3GH7A 1C9WA 4K8GA 2J88A 4ZODA 3TH6A 2CC0A 4OBTA 4IQDA 5F4WA 3CV2A 4QJ5B 2QQ6A 4MTVA 3BLKA 2XH7A 4JTFA 2E6FA 2POTA 2Q3OA 2FVMA 3NVTA 3ONCA 4IIFA 4XKYB 2PC8A 3JRKA 2FH8A 3AMLA 1W9VA 3HQ1A 4JHMA 3G5EA 3C2FA 4UFHA 4O8AA 4FA3A 4KW2A 3N15A 3KOYA 2Z1KA 3MCOA 1JNEA 4UOZA 3EXRA 1HKIA 3RMJA 3FEQA 2AOSA 5BOOA 3EDJA 2IKHA 1J2WA 5AZ1A 4O17A 3F7JA 3CUZA 3AHXA 4RL3A 3EX6A 3M1ZA 3LZ3A 4GZJA 5CJMA 2XH0A 1CW2A 4ZMGA 1JZ7A 1BKHA 4PMXA 2GL5A 3V0UA 3QEZA 3AXMA 1C9DA 1ADDA 4M1RA 5KSWA 2W9MA 1Q6RA 4MWAD 2WPGA 3N4AA 1XL9A 4MKNA 3TK7A 4MOZA 1AH3A 3GLCA 5U4NA 3T4CA 1LLZA 1SR0A 3VKBA 3VD3A 3UZWA 3B0UX 3R0KA 3S46A 3NQGA 1JR1A 3E74A 1MW3A 1R0MA 4IXHA 3MYOA 5GNYA 1CTNA 3KRUA 5HULA 3A4JA 1E4LA 1NDZA 4GXMA 3AXHA 4RNJA 3SY5A 3P82A 3GZ3A 3G8RA 2Q01A 3NQDA 2YZRA 4QAIA 3N9SA 3BMVA 1C7SA 3W6YA 1NM9A 4X3ZA 4FLQA 5ABEA 1EJWC 3W7KA 4W8AA 3MA8A 1TVPA 5EKYA 2XZ9A 1Y8BA 3UD6A 3ZR6A 1XKYA 1JPHA 3BGGA 1E4IA 1OC6A 5CZ0A 1XLFA 4MJZA 1X1OA 2EKGA 3EXSA 2TAAA 4O16A 3O6CA 5ABHA 4PYSA 4HBKA 1SFJA 2DDXA 5DXYA 4CD4A 1S5TA 4UCFA 3RG6A 1I2QA 1KXHA 2BMBA 3LGDA 1ZQ5A 1ZBVA 1MDRA 2J25A 3NQ7A 1TPEA 2VQUA 3B03A 2CERA 3G6LA 3SCPA 3MSDA 4PMRA 2O9OA 2GWNA 4O53A 3W23A 1MFUA 4AF0A 2HROA 2C0HA 3F2CA 5CC3A 1H7PA 3FVMA 2QPUA 5C2GA 1I60A 3QR0A 5DX7A 4NZFA 2XINA 3W24A 4U31A 1C29A 1XCXA 3N6HA 1UUOA 2WKJA 2EEXA 3OODA 1OGSA 3PM6A 2ZYFA 1W5NA 4LYKA 4IMAA 1A47A 3BLIA 1C93A 2B7OA 4GCAA 4V27A 1IQ8A 1QASA 1US2A 3B9EA 2Y8UA 5A6SA 2P3ZA 1QPKA 2VZOA 5ABTA 2WYSA 4XZLX 1OINA 4AX6A 4C6CA 3IANA 5AYBA 4IGSA 2JQXA 2PDJA 3UG8A 3BZJA 4YPJA 4HNVA 4E2DA 3NZGA 3W1XA 3TZFA 4ADUA 2XGZA 5TBOA 2VURA 1A0EA 1Q6CA 1YIXA 5LGZA 1W3JA 1PPIA 2E1WA 1K9FA 3RRXA 4ZXOA 1Q7MA 2CETA 3II1A 2VZUA 4UTLA 3KHDA 3KS5A 3FV9A 1FWDC 4DHGA 2BGQA 5DMYA 4GBUA 2VENA 6ENLA 2TMDA 1DIDA 1Q63A 3TX9A 2NQLA 5CPLA 5RUBA 1QI5A 4GO8A 2Z24A 3VGGA 3D3FA 1XLGA 4IG2B 3PZOA 3FCPA 5XIAA 2ZUWA 1SZEA 3EWWA 2HNHA 3ARSA 4AISA 4P8UA 4AUBA 2Y89A 3LCFA 1WKEA 4B5TA 3I68A 3LCXA 1TRIA 3TTSA 3RFAA 1VCFA 1V6VA 3CS2A 3BG9A 1ENUA 3TC3A 3GXFA 1TZ7A 6CGTA 4C6QA 4AIOA 3OZOA 4NAFB 4BFAA 3KOXA 3SUSA 3R0DA 3ZIZA 4C6FA 3GG0A 3W85A 2R1LA 2CKSA 1DWGM 4MB1A 1GG0A 1CXFA 4QRNA 3OU8A 3DCPA 2XIJA 5BZAA 5CZJA 4QAWA 5U7SA 4GY0A 2YCLB 3TSMA 2WLYA 2B81A 4CU7A 2PZNA 1Q3NA 1S2TA 3RCNA 3LK6A 3W02A 5CJNA 2V8ZA 3TJ4A 1JUKA 4Q7BA 1QDSA 2PAJA 4L9YA 2XH2A 2I57A 5C9WA 5A8GA 4NNBA 4PL1A 4OGZA 1H63A 3QW3A 4M51A 5I77A 4B4FA 2QV5A 2O92A 1K7XA 1PKMA 2QYGA 4AD4A 1XIIA 1PX4A 2QJMA 3MUCA 4ZXLA 5JBDA 1CGVA 2ZWYA 4K1WA 3T6CA 3HQNA 3G24A 3P60A 4LJ3A 1FVPA 2QPSA 4O4WA 5K7JA 4JNMA 4J3XA 3M0YA 3HN3A 3WBYA 2CXGA 3NEHA 5LA0A 4AMCA 3ES7A 4PTXA 2Y5JA 3POHA 1OFAA 2BOEX 2VZVA 3B9AA 3IIPA 1DXIA 1RLDA 2GJLA 4WY0A 1F3XA 5A2AA 2EF9A 2WKGA 4HGXA 1M1BA 3V5FA 4S2CA 4GH3A 5E1QA 1B3VA 1QI4A 5H6HA 3BOFA 3WLSA 4B2DD 3UJSA 1DJGA 1IGSA 1T7LA 4S38A 3WQ5A 1GT8A 3WF1A 1ZS2A 4EOUA 5DBTA 4B5XA 3S1UA 2PD9A 3E2RA 1BVWA 2X7VA 4LBUA 2ZA3A 5F1VA 1EX1A 2VCAA 3DH7A 1KLYA 2V5CA 3MVTA 1UCWA 3DENA 3BJTA 5D30A 3T09A 3H8AA 3KP0A 1TE1A 3F03K 2FIQA 2ZRUA 4IJCA 2E9MA 2X05A 3WX7A 2F38A 2XGIA 1S5VA 3K4AA 4H9UA 5L9FA 1CGTA 4L4OA 3EA3A 3LXAA 5IDZA 1P0NA 3UWEA 4OUEA 1XD0A 4DJDA 3O8AA 4Q8PA 4HNNA 2YLLA 4M6VA 4EAYA 3M0VA 4B5WA 2ICSA 1RY8A 1UPPA 4JFWA 3AICA 1FH8A 1BXNA 3W6MA 4WY0B 3VFLA 1DJQA 2WM1A 2CEQA 2I14A 4LUJA 3FLUA 1FDJA 1I2RA 4L6OA 3GDTA 4TR9A 4E6MA 4POCA 4I6VA 1G9HA 2VC5A 4XUGA 3WDIA 2PBGA 4PB4A 3KW3A 1Q66A 4WF7A 3APGA 4M7SA 1IEVA 1XIGA 2W3ZA 4QG8A 3SRDA 2JKAA 3HTWA 1TX0A 1YNQA 4J3UA 1RSCA 3IV3A 4DX3A 3SN4A 1UR0A 1TQXA 2EPLX 1DIEA 3LN3A 1KRBC 4W5ZA 2EGZA 3W29A 3BSMA 3LENA 4DAFA 5CZKA 1VLWA 2Y88A 1XBZA 3ITYA 5DT7A 3U0HA 4V33A 2P10A 4AZCB 4URIA 3LD5A 1WAWA 3AHTA 3LCHA 2ABAA 4HZ6A 1U5VA 1UYQA 4E2VA 3EMZA 4A21A 1IV8A 4LX4A 2HVNA 4CQAA 4H2CA 3P8JA 2FYMA 3RM8A 1LDCA 4J40A 1E1EA 1KTCA 1ZRQA 6REQA 2ZZ1A 2WVSA 1XR2A 3WJZA 3VIMA 3W72A 3CC1A 4AH7A 4B5SA 2E5CA 4OJYA 4C7FA 1MEWA 4Y9NA 2CHOA 1XLLA 2X0HA 1F7BA 1IT0A 3FA4A 4GFSA 1KWKA 3EDDA 2WVVA 5EA9A 2PGFA 5AHNA 2WMIA 3CHCA 3SGGA 5FEPA 3GQYA 1DE6A 2OKOA 3LRLA 1T8XA 3B8TA 2AKMA 4KGLA 3VNYA 3ZS4A 1QPRA 4J35A 4C6EA 3W37A 2VGBA 2G4JA 3GYEA 1K4GA 1JFXA 2EPNA 1SFTA 1O5RA 2EQDA 5ECUA 4QROA 1K6AA 4NYUA 1GOMA 1Q7ZA 4FMVA 2QV4A 3N9KA 2GSJA 3W07A 4UR7A 3HV9A 3IJ7A 4IQLA 3B9DA 3E49A 4GC4A 3TN4A 2OR2A 1H5VA 1QO2A 5GNXA 3URBA 3CXOA 1A49A 1XLEA 3WH6A 4UTWC 1EZ2A 3F5JA 3BICA 1UOZA 1U33A 4JTDA 3USZA 4QX4A 1B54A 1V8EA 1W0MA 5LHFA 1D8CA 1SQ7A 3QMRA 3KBJA 1GKRA 3UJRA 1H60A 3H2CA 1W3LA 3GHTA 2A3BA 4XKMA 1DTNA 4JYFA 3RGTA 4MFDA 1M9HA 4XBJA 1TJRA 3WNNA 1DWFM 3CZGA 3KWSA 4Z1BA 5GNZA 1HL2A 2Z6JA 4RXFA 5FL1A 1ESWA 4MHBA 3M0MA 1NARA 1XLIA 5DCDA 1NFBA 2G96A 1D9EA 3OP2A 3CUFA 1RP8A 1ZJBA 3NDYA 1BVNP 1OFRA 1I1WA 3VD4A 4E38A 3VNMA 1TB3A 3C4UA 3VNIA 3O16A 3KVLA 5CBIA 1V6UA 1MUWA 1ONRA 1H61A 5XINA 2NV1A 1A3HA 4M6PA 3LM3A 1TMLA 4DN1A 4BWLC 2AAMA 1JRCA 4ZFMA 1KO0A 4WY0F 1H7WA 4WJEA 5I6SA 4AIBA 3URQA 5FJUA 1DQXA 3MQTA 2WSQA 2P5NA 2Q71A 2WMGA 3KRBA 1R9YA 2PWEA 4OU1A 3NZRA 1CLXA 3UR7A 1MFVA 4LVFA 2YJQA 2PDPA 4ENLA 3GXTA 2J7BA 4H6KA 1AQ0A 1LUCB 3AXKA 1TPFA 1EJXC 4F79A 1VH7A 3S2LA 4R9XA 5REQA 1TO3A 4O28A 5BXRA 2FJKA 2O56A 4F40A 4RR4A 1UPMB 1EC8A 4Z1YA 3JW7A 1BYBA 2XN1A 2INZA 3MZ2A 3TSBA 4WXYA 4IIBA 4AY8A 4JTJA 1EL3A 4L61A 4FXFA 4MKVA 4GD0A 3MSYA 1LCOA 2JKPA 3NUKA 2E67A 4TU1A 1SFLA 1NF7A 2MANA 3GZAA 1E3XA 1OJXA 4HK5A 4OWGA 3RILA 1M53A 2Z1SA 3SY8A 5DXXA 2XUCA 4ZO8A 1XYAA 4QISA 1R2TA 3MBDA 3CV1A 3SIMA 1F73A 1WOAA 3TV8A 3G77A 3CPRA 4CNSA 3QMSA 1KFBA 2V5DA 3H22A 4A3YA 1TV5A 4EVZA 1BTMA 4AW7A 1Q6LA 2Y7DA 4BF7A 2OO0A 1Q65A 2AGKA 3ONBA 1SYTA 1VAHA 3DUGA 4GYPA 3WLHA 2PDCA 4C6JA 3FA3A 1DV7A 1W54A 5I5RA 3ARRA 1TIWA 2D2OA 3MZNA 5EBAA 1KM6A 2YBUA 2ZE3A 1PUDA 4FNPA 4PUNA 1FTXA 2D20A 4GO9A 4IPPA 1KCZA 1ODUA 5DCBA 1A4LA 4QTGA 2J7HA 4TOQA 1DJXA 3OVQA 1ZU8A 1QBAA 2WCSA 5A2BA 2DJXA 2NXHA 4CLMA 1LOQA 4EXAA 1O5XA 4PB3A 1EPXA 2CU0A 1ZNNA 4B4HA 1MQPA 4YTTA 3PZMA 4RXGA 1CXIA 4JICA 2QDEA 1IXPA 4LUYA 1L6FA 2BWGA 3MSGA 4NQ1A 3ANUA 3BANA 1QWGA 4B5NA 2QCCA 4YCOA 3RM9A 1L0PA 1PJ9A 3WN6A 3S2CA 2OEMA 1GJWA 1KFLA 3IIZA 2OT0A 3E0LA 4OTKA 4ATDA 5IBXC 4JTHA 3GXMA 2PDNA 3BAXA 2CZEA 3ZJ7A 1XLAA 1Z32X 1KXQA 2FZBA 4DO4A 4GJ1A 3U2CA 1ONWA 5CH9A 4FSAA 1JULA 3NL2A 1DORA 4OBRA 5EMMA 2FLIA 4Y9PA 3R7MA 1NP2A 3GNOA 1FP8A 5LKYA 3EOLA 4MB3A 3PC0A 3DFSA 3CPGA 2NQZA 1QK0A 2BP1A 2CBUA 4D6HA 4H8VA 3MMWA 1U5HA 3VXGA 4Z2KA 3IAQA 4GH1A 3EWCA 3GDRA 2BHUA 4HJFA 1W1VA 2VYOA 1EYWA 3P14A 3LA4A 4K37A 1QI0A 2PGWA 3NPVA 4M6UA 3F4CA 3BURA 3IARA 1DHKA 3QR3A 4IUGA 3V18A 2O4QA 2PDFA 2DH2A 1ZUAX 1SSGA 1MNZA 1T99A 2IKIA 2GGHA 5JVLA 1NWUA 3NGJA 3UQNA 3PTKA 3TYAA 3H7RA 1JI1A 4P8XA 3VDBA 3FFSA 5HWNA 4EF8A 4XZ9A 3RIKA 3DERA 5D4YA 2GGGA 4O4VA 1G01A 4WDXA 3CLWA 1TWZA 3Q4DA 4XSMA 3CL8A 3M0HA 4LNYA 2FFIA 1P0BA 4KIEA 2G3NA 1SZGA 2QAFA 3AWOA 1O1ZA 1LYXA 4JHZA 1UMYA 3FK4A 3WJYA 3FGCB 3WSUA 4NZCA 3R58A 3I6RA 4KCTA 5F2MA 4BF9A 4A3UA 1DJNA 1KKRA 3M0ZA 5ABFA 4EP8C 5AVHA 3OHMB 2OVLA 4AVOA 2CYGA 3CL7A 4QDMA 1HJUA 1EC9A 1Y5WA 5FIPA 3IGXA 4JNZA 4H2HA 1SSDA 3E12A 3M0LA 4QLLA 1JGMA 4CNUA 3GO2A 1LG1A 1XPYA 3NPUA 1JQXA 2DSWA 5DBUA 1OX4B 2BGSA 4OFCA 5K4ZA 3VUPA 3F4VA 1AL8A 3GNDA 4CGTA 3W7NA 1K02A 3NQ6A 3ZQ9A 2BTMA 1TA3B 3FKRA 3C3NA 4XD5A 3CMGA 5A6BA 4JKMA 1VQTA 3AOFA 4N9DA 1JFHA 5D38A 3BG5A 2H8ZA 3S42A 5KMYA 1RPKA 4LU0A 1DKWA 5LNSA 5DY3A 1JPIA 4ASTA 1SJCA 1TWWA 4TVDA 4OOUA 3TFCA 1TV4A 3SEPA 5F2IA 1IWPA 4BA0A 2C3ZA 3H24A 2OT1A 1UR2A 2Z2BA 3HURA 4IP5A 3VGBA 1MW1A 1BRLB 1E55A 4M24A 2V9DA 4DBUA 3NSXA 2VR2A 1U83A 1UP3A 3VC6A 3KL5A 4CQBA 4LUTA 3QV8A 1XRVA 3A4XA 5EPDA 5CSUA 1ZENA 4ZL1A 4I7UA 3T55A 3L9CA 3QKEA 3L66A 5J04A 4X61A 4HOZA 3EWZA 1PDYA 5AHLA 1W5OA 1PYMA 3MI2A 1UD8A 3STFA 5D05A 2X42A 2V6AA 2OCZA 2VELA 1ISZA 4AWSA 2D3NA 3HB9A 1KFCA 1PIIA 4L1XA 3TROA 4O19A 2PDUA 2Z4GA 8CGTA 2RHGA 5GQBA 3MWCA 2IXVA 1QOXA 2GYIA 2VFDA 3HU7A 3W01A 1RBOB 3BLOA 3S4TA 3W28A 1E9YB 1MVYA 1HJWA 5AN7A 3A9IA 3GWQA 3SCNA 5D2TA 3L5LA 3H4WA 1A5NC 3CMJA 1LP6A 3LNPA 1AQHA 4K8EA 4JCMA 2NX3A 4PTVA 1B4EA 3FSUA 3EB4A 3S5YA 4NI8A 3ZVHA 3VZYA 4BI5A 4UQ9A 4DJDD 4F66A 4JIQA 1U2YA 1BRLA 1ICSA 3H2MA 4LUSA 5G4WA 1EOMA 3OGVA 9RUBA 3QGAC 2ZUVA 2OQLA 3VNLA 3C0SA 1XIJA 5BNKA 3KBVA 2P0OA 1AJ0A 3O9NA 3B8SA 3THCA 2C1HA 2W66A 4IFKA 2IMRA 1B3XA 3R5EA 3T2QA 4JS3A 3WQ6A 3P0WA 5DCEA 1RP9A 4XV0A 3WK0A 3WLOA 4IWWA 1KM5A 4MNLA 1DEDA 2OZ0A 3SQSA 4H8UA 3WDRA 3ARPA 2Q8XA 2PB1A 1Q7QA 1JI2A 1OYBA 4QLJA 4BWLA 2HISA 3Q45A 4RLIA 4F0KA 3AIRA 3DHUA 5H8PA 4JZ5A 1EP2A 2VQTA 4HZMA 1WNOA 4PMZA 1V6WA 3V16A 2CLFA 4J3TA 3SUUA 4LEQA 3S1WA 1K1DA 4OV4A 3LGGA 3WLQA 4AZBA 2A2IA 4MIMA 5HQLA 1K9DA 2XIQA 1XIEA 3W4RA 1XLMA 3L4TA 1OZQA 3L7RA 2Z1XA 4QHRA 2QLYA 1OT1A 4FF7A 3WH5A 1TIMA 3KS6A 4PBFA 2DZBA 6ALDA 2WVTA 5T9BG 1OC5A 3K1DA 5E09A 2JF7A 4JYEA 3H23A 1JXKA 5EB8A 3IGSA 1EFZA 1H0IA 3ZJ8A 3VC5A 1ME8A 3FJ6A 5JQ9A 3WL1A 3COTA 1TR9A 4L80A 1AD1A 1F05A 3V1HA 1GJPA 4B3LA 2WZTA 4DPPA 1XV8A 3CUXA 1TZZA 4AFYA 1E72M 4MWAB 4UTKA 4H1ZA 3WK3A 3N14A 5C9XA 3C8NA 4R27A 1WDDA 2PCQA 5D37A 4Q8MA 2CLIA 1TG7A 3V1PA 1W17A 3NPXA 1UHVA 2I16A 4ATLA 4IZGA 1WO2A 4A8IA 1UH4A 1KA9F 3OEXA 3VTRA 3NOEA 3T07A 2C71A 1REQA 3RAOA 3L21A 2Z1VA 3N2XA 2E8YA 3CAWA 3K2GA 1M5WA 4O1CA 2WAGA 3S6DA 1WE5A 3LZ5A 3TYDA 4DRSA 3E0IA 1R46A 2DUXA 2FGLA 4F0HA 3OBKA 4MADA 4GUGA 3LLFA 4HHPA 1VFTA 1DWHM 1UWRA 4QE4A 1JZ3A 1R85A 2YXGA 3L5MA 3L65A 3WF4A 4O1DA 4YJ5A 3N18A 3DBNA 3VZXA 3NQ8A 3EX1A 1TWIA 4ACZA 5CC7A 3S9YA 2Q8LA 1QNRA 3LPPA 4HYVA 3VX1A 2EAWA 3LPOA 2BXZA 2JEPA 3ARUA 3CZKA 4GVGA 1JD9A 1SO4A 4IM4A 1HQTA 1YRRA 3LCLA 1FDZA 1CXEA 2V3DA 4H9TA 3M5YA 5DF0A 1KM0A 4FZIA 3G1AA 4QCFA 1TRDA 1OQFA 1YNPA 1MW2A 5FF4A 3HPAA 4R7JA 1O6IA 4U28A 3R13A 2ZX6A 3ABZA 4LPCA 1JAKA 1HGYA 2A7PA 3CIVA 3IK2A 1K77A 3RU6A 2YR1A 1Z89A 2DVUA 4X63A 3KE0A 4GI8A 3V0TA 3M9YA 2GVYA 5C9UA 3MBFA 2Q3RA 3D46A 1AW5A 3OBEA 4JL2A 1KRMA 4B15A 5A6AA 3BAJA 3T2OA 3N3TA 5LNRA 4QS6A 3FYYA 1UW9A 5FEXA 3ABOA 3T9PA 1WBJA 1XJBA 3VFCA 1BWKA 2CIPA 3TQVA 4YLWA 1FKXA 1OFOA 5AC8A 5FJRA 3P5ZA 3HGOA 3AISA 1VFFA 6REQB 2ZX9A 4FLRA 2A0NA 5ABGA 1YEYA 3O05A 1YW1A 3GG7A 3NL3A 3AIEA 3B8WA 2YLAA 4H8HA 4PZVA 3SJNA 3UPMA 3WH8A 4KERA 3VM5A 4AD3A 1YHTA 3MO7A 2G3FA 1UKSA 4U2ZA 4RPQA 2OWWA 3E96A 2G37A 2PP3A 4KWVA 2Z26A 1E0WA 1V02A 1BWLA 3AQUA 1S46A 4DEFA 3U6WA 3KAOA 2Q8ZA 1IEQA 4C1KA 1P43A 3EPMA 1PCKA 1QHOA 2TRSA 3GKAA 2YSWA 3L0KA 4AF0B 2QZRA 2F8QA 4PTNA 3BW3A 1FWGC 1JZ2A 3PJWA 1AW2A 1J5SA 3CAVA 5AYZA 2C6QA 3GBDA 3ABXA 1Z41A 4HHMA 2E7FA 4NU7A 1TJ0A 4KFNA 4I9JA 3U7BA 3ZJ6A 3GS6A 1RVGA 2FQIA 2OOFA 4ZZ9A 3T05A 1Z8AA 3KVMA 3ZVHB 4UOJA 4FHAA 4M82A 1L8PA 4J7RA 4L65A 1AA1B 5M03A 3WUEA 3QZ6A 2V0TA 3NJ3A 3MP5A 3VGDA 4ONVA 3MUY1 3RYSA 1KV5A 5EMUA 1ONXA 4RW5A 5C9ZA 4ML4A 4IFRA 2PLCA 3THQA 1ITUA 4HCDA 1R38A 3VGHA 1MUMA 4N9CA 4EAMA 2WM0A 5DFAA 4O1EA 1KTNA 5AVNA 3E02A 3AXIA 4N4QA 4B9YA 4IF2A 4JTUA 3ZT7A 3HZ3A 8XIMA 1RV8A 4HYWA 5A94A 4GNVA 4OVXA 3WUBA 1WXYA 3VOGA 3PBYA 4C7GA