4RCXA

Trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant) loop 3 deletion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
b'MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTTVPMIKSFGIEWTILGHSERRDFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Trichomonas vaginalis triosephosphate isomerase loop 3 deletion protein
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 82
structure length 235
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rcxA00
2VFGA 5CGQA 2CU0A 4KWWA 3MI2A 1PIIA 4UIOA 3KHJA 5EPDA 1OABA 3JR2A 3PUDA 4NU7A 1RZMA 4RZ6A 4WX2A 3IRDA 5LNUA 3NA8A 1FWWA 1JUBA 4CNOA 4TR9A 2G97A 4JTUA 2KZHA 3HF3A 1SZGA 3A21A 3G0XA 4TIMA 3NPWA 4QISA 1FQ0A 2Q3RA 4BR1A 1CX9A 3NL2A 3W76A 2ZRVA 4UTKA 3I68A 5DELA 5AHNA 4LUJA 4RKAA 3L21A 2ALDA 3SIZA 2W0UA 4FB7A 3P8JA 1G6CA 3W1MA 1EWEA 4O15A 3PG9A 1RR2A 2Y7FA 1H50A 1QO2A 1DV7A 3NQ8A 4IMCA 4JTIA 5K9CA 2NV1A 1F76A 2Z1BA 3GZ3A 2YXGA 3PSVA 3W83A 3TSMA 1W3NA 3G1AA 4YWIA 2NUXA 3JS3A 1SZNA 3P61A 2B7QA 2ZBTA 1H5YA 4OGZA 4XTDA 4JX5A 4GFSA 1SQ7A 3N3MA 3FLUA 3WK3A 3TCEA 5LHEA 5HQEA 4TU1A 3FEMA 3W7EA 2EPHA 5AYYA 1W0MA 1B4EA 1TPUA 4NX0A 1VGAA 2QUTA 5D04C 1OFAA 2CZ5A 2I1OA 1CW2A 4WY0F 3S8HA 1OX6A 2X1SA 2Y6ZA 1SUXA 1H63A 2G96A 4AWSA 2A6NA 4NJIA 3BGGA 4CCEA 3LHTA 3W2KA 5HNRA 3PBYA 4O54A 1A5SA 2CW6A 3NR0A 2VFIA 3DH7A 4LVFA 3EWXA 3G1YA 3BLEA 3TAOA 3W1UA 4FO4A 3G18A 4DF0A 3H53A 3NZ1A 2QCGA 3QC3A 3G1SA 2W79A 1SW3A 3P84A 3FKRA 1ZCOA 4Y96A 4GUIA 1AL7A 5CPNA 3TXVA 1HUVA 1IIHA 5LNWA 1X1OA 3GDTA 3LCWA 1FWTA 1KTNA 4AXKA 4Q4KA 5BOOA 5KSWA 2B4GA 3TSBA 3BGJA 3PY2A 1R2RA 3MUXA 1LBMA 1SR9A 2E77A 1TJRA 2YW4A 3OVQA 1H62A 5D2VA 4NQ1A 3T7VA 4MZ8A 3E0IA 4Z1AA 4JDBA 3VKJA 3IGUA 3GDLA 1ME8A 4UFLA 3NQDA 5DCDA 3TUUA 1VYRA 4PODA 1FX6A 4O0KA 5EL1A 2RDTA 2X30A 1IGSA 1GTEA 4XZ9A 2VEIA 2H8ZA 3IIOA 3PB2A 2ZRWA 3G1FA 2DZUA 3HBLA 1SO3A 4BI5A 1KFCA 3GNNA 2QUVA 1QO5A 3EWUA 3LTSA 4R7JA 1FXPA 2CLMA 1DHPA 2YW3A 3M0ZA 4GRSA 5K3VA 3OHIA 1RD5A 4I9AA 1EIXA 1KM6A 3G1XA 3PBWA 5EY5A 1LOSA 3SW6A 3PUOA 2CWNA 3IVTA 4FIRA 2RFGA 3HJZA 3TMQA 3QQ0A 1EUNA 1A5BA 5AC6A 2YGYA 3C52A 1W5MA 3W1NA 4A22A 3O6DA 3RFAA 1F05A 3EEGA 2BXVA 4O57A 1TRDA 1FWRA 4RLIA 4HHPA 4UFMA 3DAQA 3S42A 1O95A 2OZ0A 1TV8A 5I3KA 3CT7A 4JTHA 4NX5A 5HUOA 2W6RA 4NJHA 1OFBA 4TX9A 3CC1A 3M5XA 2YSWA 1UASA 3CEPA 4UR8A 2YFNA 3W1XA 1EP2A 1YPIA 4JD4A 3CIXA 1ADOA 1KTCA 2ZA2A 4MY1A 2ZZ2A 5BRBA 2Z2UA 4PL1A 3STGA 2DZSA 3NPUA 4DELA 3C0JA 4XKYA 5D2WA 5D09A 1VZWA 3CIWA 5AOUA 4UFKA 1K03A 1TPB1 4U4MA 4NNAA 3SZ8A 1NSJA 4CCCA 1XCFA 1XBYA 4JY8A 4CQ9A 2Z6IA 5KZEA 1VCGA 5L9FA 1TQXA 1NEYA 1L6SA 3EX2A 5HWMA 3FKKA 4IXHA 4UTTA 5TBOA 4UXDA 3PAJA 5CPLA 1W5OA 1GVSA 4OE7A 5HWJA 3O05A 2O7QA 1O5XA 1VLIA 1RQBA 3LI1A 2EHHA 4JXCA 4JN6A 4HNVA 1W31A 1H51A 2QKFA 1AMKA 3W7HA 4Z1BA 1H1ZA 3LXBA 5DY2A 2FQIA 2EF9A 1DL3A 4O16A 1ONRA 1KM1A 3G1VA 1QR7A 2GVGA 4ORIA 1JULA 1S5VA 4GUJA 5G5IA 4DO4A 1VCVA 5HR6A 2ABAA 3MWAA 5CPOA 1KFLA 3DHFA 5FF7A 3BPWA 2WOQA 3HPZA 3P80A 3H55A 5F1VA 3UY7A 5LZLA 3LTPA 2VEMA 3T40A 1I2PA 1ZENA 4ML9A 3KVJA 5FF3A 1FDZA 4JIPA 1D3HA 3GKAA 1D3GA 1TRIA 1SFJA 1OFOA 3WK0A 4K37A 1ME9A 1OFDA 4UTIA 1GWJA 3S6DA 3VI2A 1OYCA 4POCA 3W71A 2PRLA 4Z1DA 3NPXA 1KBJA 1OX5A 1I45A 3H54A 1A50A 2A1YA 3VFLA 1Q3NA 3W7PA 4Q32A 3G24A 3W7GA 2YR1A 4QNWA 1B4KA 1WAUA 1KTBA 2XN0A 1I2RA 4GUHA 3GIYA 1S5WA 3MBDA 3P8IA 4QIUA 3GAKA 1IXPA 1VHNA 3HGRA 3U6WA 3DXIA 1L9WA 4WD0A 4E0CA 4LS1A 3GNDA 3P62A 4KWVA 4PA8A 3DBPA 3O6YX 2TPSA 4LS2A 3ABSA 4DBEA 3C2VA 4PL2A 2Z0IA 2NX1A 2WPBA 1M6JA 3HPSA 1S3HA 1KFKA 3R2GA 3G1DA 1TB3A 3PB0A 3C4UA 1GPWA 1W3TA 4HNTA 1OJXA 1U83A 2J9YA 3TMLA 3TW6A 2A4AA 3W7CA 4M5PA 1JCJA 3QSTA 1G7UA 3Q37A 3P5YA 3W7MA 1VLWA 2QCHA 1LRQA 4J9JA 4ZQNA 4NXKA 1HTIA 5G1TA 3TR2A 3ZR4A 4AHPA 1MO0A 5FESA 3R89A 1UJPA 3W2LA 2ZZ1A 2X1UA 2ZTJA 1SPQA 1R47A 1K8XA 2RH9A 4LVGA 2QR6A 3W7RA 3PS7A 3UWUA 1MEIA 4XBKA 1X7FA 2FPYA 4G1KA 1G7VA 2VELA 2FB3A 3OG3A 3LHVA 3D0CA 2J24A 4WXYA 3WJYA 4BWLC 5FEWA 4Q33A 4CNPA 1FDJA 1BWKA 4UMBA 4OHQA 2E5DA 3K30A 1ME7A 1K7FA 1JCMP 4DXVA 2OCZA 3BW4A 4B5NA 3TXZA 5EKYA 3P82A 3ZWSA 3DZ1A 1QMLA 3THAA 2AAMA 3IIVA 2Y63A 1E51A 4LRSA 4AVFA 2ISWA 4HKPA 4NJJA 3W73A 3KRSA 4UTUA 3CPRA 3PBVA 4JGDA 1P5BA 2X1RA 3NQCA 5C5YA 3W7OA 3LGEA 1M7OA 3QW4B 1FWNA 1NFBA 1PHWA 5K7JA 4UTWC 2CFFA 4JX6A 3NPVA 1I2OA 1F7BA 3IVSA 5H91A 3W07A 1X1ZA 3LXAA 4LNYA 1DOSA 1SO6A 2ATMA 1YTKA 4GWEA 1W5QA 3W70A 1MXSA 2NWRA 3EX1A 2YZRA 3O16A 5AN7A 1WYIA 1VJIA 3R5EA 1O94A 2FFCA 4UCGA 2V9DA 1TQJA 3PULA 1DBTA 4O1DA 3A22A 1F6PA 1X6UA 2E6FA 3M5VA 4N4QA 3N9SA 3GLCA 4L4LA 3QMSA 4QQ3A 4RCXA 1H1YA 1T96A 3GB6A 3V1PA 4O13A 5EBUA 2VFHA 3MP3A 6TIMA 2XN2A 3FJLA 1JQXA 1KFEA 4XKYB 1YLVA 5EYWA 3LV6A 1JCYA 2A85A 3STCA 5IBXC 3GDMA 2C1HA 1N7KA 1LBLA 1PVNA 2P1FA 4LC8A 7TIMA 3STFA 4M7TA 3LBCA 1KM4A 4RZ4A 3L0NA 1LYXA 3SECA 4CNNA 1J4EA 4FNPA 3P60A 2Y85A 3IV3A 2Q8ZA 1WBJA 2VC6A 2CZEA 4PTNA 2NWSA 5LNSA 3MP5A 4FX6M 4I7UA 2YYUA 1GZGA 1F74A 1WBHA 5LSMA 4ADTA 2WSQA 3W72A 5HULA 3KOFA 3BG5A 1YTEA 2E09A 3TW7A 1YPFA 3LV5A 3UPBA 4HPXA 1VC4A 2CLEA 4FNTA 3B0VC 2B0MA 2RDWA 4OT7A 1UUMA 3ANYA 1XC4A 2E1DA 1LCOA 2ZZ3A 1HO4A 1XKYA 3C8FA 4GNJA 4AAJA 1Q6QA 3QQ1A 4RXGA 2DZVA 1BKSA 4IMDA 2CLLA 3MYPA 2GJNA 1EB3A 1VQTA 2V30A 5CZ0A 4ZL1A 2G95A 2JKEA 3VCRA 3PG8A 1N55A 5EA9A 2J6XA 1AW5A 2NLIA 5E1QA 4RX0A 1YXYA 3NQVA 3L0KA 1P1XA 2NXIA 3BLFA 3MYOA 2CLOA 4O53A 1TPWA 4R53A 3OA3A 3NQ7A 3KFTA 4TMCA 1W56A 1TPDA 3N34A 3W1RA 2ZA3A 3A23A 5D33A 2NXGA 2ZZ5A 3W9ZA 1H7NA 4CQ8A 1C9DA 2X16A 4DF2A 1GQNA 4P2VA 1YDVA 4EF9A 1GVOA 3LRMA 5AYZA 2EKCA 2FIQA 1AL8A 1FCBA 1EA0A 4LRTA 4CQAA 3KAOA 3A5VA 1WOAA 4M6VA 1UCWA 1O4UA 1LORA 1YYAA 5CG7A 1KBIA 1SU5A 1XDMA 4XTIA 2QAFA 3HO8A 4XWUA 5D05A 5G4EA 4JICA 3M41A 3NQ6A 5LNVA 1SO5A 3L68A 3UPWA 1TCDA 1ICPA 2UV8G 5D02A 3M44A 2FPVA 4RJEA 1FCQA 3W86A 1WXJA 4OQVA 4N4PA 3SGZA 2VXNA 3DU0A 4DO5A 5F4WA 3ABQA 4MZYA 3T4CA 3LCLA 3DGRA 4QSHA 3BO9A 1N8FA 5CSRA 2QCLA 3R12A 4MUZA 3STEA 4K6AA 3W74A 1TV7A 3MO7A 3LTYA 3C6CA 1XBZA 3TK7A 3C2RA 8TIMA 4XUGA 4E2DA 1WA3A 3N2MA 3TV8A 1ZALA 5AB3A 3ZWTA 3M5YA 3PBUA 5HR7A 5LGXA 5D37A 5C6MA 3OIXA 4M7SA 4NZJA 4JYDA 4S2CA 3UWVA 5F1UA 1JRCA 1KFBA 1ZAJA 3FS2A 3TJLA 1FUYA 5MHBA 3ZS4A 1TREA 1FBAA 5FEXA 3DENA 3RNDA 1OFEA 1TPVA 1F5ZA 2YDAA 4EVZA 4O0ZA 4LV9A 2H90A 4A2SA 5C2XA 4FHAA 4JTGA 5KTLA 1PCKA 3TDFA 2A5HA 3NL6A 2ZRXA 3W7NA 3W7KA 2GPTA 1DVJA 3P81A 4C1KA 3WJZA 5I3IA 1DQWA 4I7WA 5KZDA 3HG3A 2CLFA 3DFQA 4IUOA 1RQEA 3W2JA 4IMGA 3TROA 1TV5A 4HPJA 1Q6LA 3NXFA 4NJKA 2OMAA 5AC8A 4O1AA 1F2JA 3KVKA 3IIXA 1K8ZA 4JYEA 1G4PA 1R2TA 1L6YA 3NG3A 5G2HA 3EWYA 1Z48A 1DORA 4O28A 1H61A 2AGKA 1G4TA 4NT0A 3DHDA 1EPXA 5I3HA 5I3FA 5D2XA 2ISSA 4Y6GA 2GUUA 2E5BA 3KVLA 4FXSA 1V7YA 1OFRA 3M43A 3GDKA 1PHQA 1ZAIA 4NJGA 1O5KA 4NXSA 3HB9A 5D38A 5AC7A 1XXXA 4FX7A 2X2GA 4UFIA 3HQ1A 3HGOA 3W2UA 4UTMA 2GQ9A 3NL5A 4ADSA 5CZJA 4ONVA 4M19A 3HMJG 1OHLA 3DFOA 4X9SA 2E6AA 1H60A 3EX4A 2DZPA 2ZDRA 5D30A 3B4UA 3N2XA 3G3DA 3MHUA 3F03K 4GJ1A 4FNSA 3MMTA 4IJBA 1GEQA 3S5YA 4P61A 3S1UA 2V2DA 5AYXA 3O1NA 4ZQMA 4MY9A 1UB3A 4UTHA 1GG0A 3NOEA 1RVGA 2P0OA 2GJLA 1W5PA 4UTJA 1RQHA 1ZJIA 4JTEA 1AW2A 1WQ5A 4O4VA 1LRTA 3CQ0A 3NDOA 5U7SA 4O1BA 1QNVA 3W7DA 3TJXA 4ZZ9A 2BTMA 2G5WA 3WJXA 4FNRA 4A21A 4N9EA 2JKPA 1YTDA 2OJPA 3M1ZA 2A0NA 3HG5A 4ADUA 1KM3A 1TTJA 3DFSA 2YX0A 4OWGA 3CM4A 3UWQA 5C55A 2X1TA 3G8EA 3S5ZA 4UNLA 4D2JA 3C3NA 2ZRYA 3BARA 4UFHA 5J5RA 4IPJA 3W22A 3DI1A 3S1VA 2QDGA 3L5MA 3I6RA 1OG0A 3F4NA 1MZHA 1VRDA 4IXXA 4LS0A 5HJLA 2VFDA 2QCMA 3UZ5A 1C29A 2NX3A 4LT9A 3L0GA 3ABOA 3G22A 3GK0A 3CEUA 2DJXA 1IXOA 3TQVA 3QPZA 4LVBA 2FPTA 2J9ZA 5AHEA 3M7WA 3W1QA 1HL2A 2B7OA 3P5ZA 3TFXA 1YDNA 4MIMA 4UTTC 4IX2A 5KZMA 4Y8FA 3UXDA 1XBXA 3PUEA 2ZTKA 3I7RA 2R94A 2VFEA 3NQGA 4HT3A 3R13A 4A29A 6ALDA 1LBFA 1K02A 1I8JA 2WJZA 5DLCA 3WJWA 5K9DA 4LOCA 2Y7DA 4FEZA 4LVAA 2B7NA 5K2ZA 3TSDA 3S1XA 3T44A 3SR7A 4RV8A 3B03A 3LHZA 1XM3A 3SY5A 1HO1A 4M6PA 3W88A 2V0TA 5IM51 2QCNA 5DBTA 5TIMA 2WNQA 4IGHA 4MLJA 3B04A 4FF7A 4UUIA 5EMUA 2QCFA 1A5AA 3SI9A 1ZY9A 3VE9A 4DQWA 1VPXA 2C18A 1R30A 1WX0A 2E6DA 1MSSA 4X3ZA 2ZYFA 1SO4A 4Z08A 1ZFJA 3CLMA 2HS6A 2P10A 2QCCA 4C1LA 1KM2A 3N73A 3QW3A 4K38A 5I3GA 3MHGA 4GE8A 5SWUA 4GC4A 2QDHA 4JTLA 4L4MA 5KITA 3KXQA 2V8ZA 3UWYA 1WV2A 2PRMA 3BW2A 2TMDA 1TTIA 2J88A 4PH6A 2QCEA 3E12A 1IF2A 3USBA 3UYCA 1JCNA 1TPEA 1TPFA 4JTFA 1LM1A 3W1TA 1OK4A 1VYSX 3JRKA 1GOXA 5F4XA 1FXQA 4AWUA 4EOUA 3S5NA 4AWTA 2QCDA 2JKAA 1KLYA 3UWZA 2YCEA 4MFEA 3EKZA 3RK8A 1P0KA 4MVAA 4Z0SA 1X8FA 4Z1CA 1ICQA 4K39A 3L9CA 3QSRA 3E02A 1QFEA 1IXNA 2WSRA 4JEQA 3UZJA 2A21A 4MLRA 2C6QA 3QZEA 1EP3A 4AMAA 2AQWA 1HFBA 3QYQA 1G4EA 3FYPA 2QJHA 2EGZA 2Y62A 2HSAA 1GVQA 5AFDA 1OVDA 2QEZA 4XBSA 3TU9A 4H4IA 2JGYA 2Y7EA 2H3BA 5DXYA 2OT0A 3EXRA 2HMCA 3OVPA 3TC6A 4HNUA 3W84A 3TE9A 3L5LA 3QMRA 2NUWA 2BSLA 2HS8A 2Z6JA 3LBMA 3IGXA 1KM0A 3EXSA 3N9RA 4YMZA 4A3UA 1QPNA 3IGSA 1H7RA 3TQKA 1SSGA 3FA5A 5KMYA 4WY0A 4JTTA 2NX9A 2ZA1A 2CZDA 1J5TA 3PM6A 4EWND 1G69A 2F84A 3T78A 3DKJA 3C2EA 2BLEA 4IWWA 1LOQA 3NQ2A 2PRHA 4LWWA 3W7QA 2PC4A 4KFNA 2FTPA 1K7EA 2JBMA 1ALDA 3I7QA 3QPYA 4Y9AA 3HGSA 2FJKA 2CZFA 2WNNA 1UBSA 2A7PA 3B05A 5I3JA 4AH7A 4FIQA 2RKXA 2ZRZA 4LTSA 2BWGA 5FF4A 1AK5A 5HINA 3EX3A 3OEXA 3ABRA 5E93A 3M9YA 1SSDA 3QF0A 3W1AA 1P4CA 2R14A 3YPIA 3PWAA 1B9BA 3E9AA 2PURA 4BF9A 1KFJA 5TQLA 1Z44A 3LDVA 3LLFA 1TPH1 3EWBX 5C54A 4LUIA 1L6WA 4FNQA 2WNZA 4LC6A 2DJLA 3F4WA 1F6KA 3E49A 4NUWA 3F1QA 1GYLA 5LNRA 1ZNNA 3PF3A 3ELFA 2Y70A 5CKSA 3MI6A 4ORMA 5D32A 5A5WA 2R8WA 2WV8A 2A7NA 4ZQRA 3EXTA 1B57A 5AHLA 1LLZA 1FY6A 4N9DA 3QJAA 4LU0A 3VNDA 1BEUA 4HN4A 1FCVA 4JR5A 1Q6RA 1YXCA 4WJEA 3THQA 2VENA 3IEBA 1GTHA 3W3OA 2ZZ4A 4ZMGA 1K8YA 3TFCA 2V2CA 5J5DA 1Y0EA 4MPQA 4PFMA 5DBUA 4AF0A 1TSIA 3NQEA 4BK9A 4JTSA 1UUOA 4S1FA 3INPA 2LLEA 3TNOA 2VEPA 1QOQA 4NNBA 3GR7A 3W87A 1Z42A 1Q6OA 3UWWA 2NZLA 4YCOA 4ZQOA 2A6LA 4JY9A 1YADA 5G2WA 3LERA 5LGZA 3ATZA 3KRZA 3L5AA 3A5FA 2GVJA 3ATYA 2GVLA 1YDOA 3DKLA 4TO8A 2Q8LA 1LRNA 3QM3A 1J2WA 1B3OA 3L2IA 4O52A 4AEOA 2V2HA 3U8GA 2QAPA 3NL3A 3AO0A 3EWWA 2ISVA 3C2OA 3KVMA 1XDLA 2GOUA 4UMCA 1PV8A 1TMHA 4MYAA 3O07A 4DPPA 2NUYA 4MOZA 1YXDA 3IIZA 2TYSA 2ZZ7A 5CZTA 3PR2A 3HG2A 1XI3A 1WOBA 1PS9A 3GR8A 1XL9A 1MEWA 3GXTA 2C14A 3EWZA 1SW7A 4O10A 5D2TA 3BV4A 3W1PA 1LOLA 1EUAA 3LXCA 4RZ5A 3QH2A 4WZHA 3RMJA 1S5TA 1XUUA 3CHVA 4JYFA 3W7LA 5F2IA 4EIVA 4YCPA 2WQPA 4LVDA 3C2FA 1OX4B 1TYGA 1VYPX 5F4SA 1G4SA 3DFTA 1ICSA 4R33A 2QJIA 2IQTA 5DCEA 4QAIA 4MFDA 5FF2A 2C15A 4LW7A 4MZ1A 2C0AA 2QCDB 2ZCGA 4JTKA 1RV8A 3NZRA 4NVTA 4O4WA 4FNUA 1FCUA 2CLIA 1DJNA 3W7JA 1W54A 2ZFAA 2J9XA 1ML1A 1ZAHA 2YYTA 4QNEA 3SGUA 3FIGA 3O8AA 4JS3A 1G67A 3KX6A 1L2UA 3Q58A 4H3DA 1Z41A 1TPC1 3GKFA 3CTLA 3LX9A 4O12A 4PEKA 4WQ6A 1JR1A 2ZZ6A 3EX6A 3M47A 4QJ1A 3SFKA 1Q45A 5CSSA 5E0KA 3G1HA 4ZQPA 1OK6A 4IMEA 3LM7A 1I2QA 1QPOA 1VS1A 2VFFA 3DFNA 1TTQA 1SZEA 2DORA 1I2NA 2RDUA 1K3UA 5F2LA 5A8GA 3RLVA 1TJPA 3NNTA 4GXMA 4W9TA 1AG1O 3O06A 1KV5A 3NYZA 1XUZA 4WY0B 3GYEA 5DCBA 2Q3OA 1IIGA 1GG1A 4DO6A 3M6YA 4JNMA 2YFOA 3DI0A 4CLMA 3DFPA 3O6CA 1QOPA 3BW3A 4UTLA 3RU6A 5FI8A 4EF8A 4U28A 2J27A 5KINA 3W23A 3L65A 4ALDA 3I65A 2XFWA 2R91A 3EB2A 1KLZA 1H7OA 2V81A 2E6YA 2E5CA 3AJXA 4YLWA 2Y88A 5D2YA 1NF0A 1GT8A 3HG4A 4JDYA 4K8HA 3IIPA 2JK2A 5HMSA 2DZWA 3LHYA 1IXQA 3LHUA 2C16A 5T26A 1EP1A 1PL9A 3RLUA 2ZQ0A 5AHFA 5HUPA 3HOJA 2B7PA 3QFEA 1KA9F 4ICNA 4IMFA 4A2RA 1C8VA 1F73A 1P0NA 1OF8A 5DY3A 2O7SA 3LHWA 1LLWA 2H8XA 4H6KA 2A7RA 4KKXA 3W75A 1AW1A 5G1YA 5BMXA 3SSJA 3G8RA 3GXNA 2OX1A 4KFOA 4IQLA 4E2BA 1JUEA 3UXAA 5LKYA 3NVTA 4FX8A 3T55A 4N6EA 3TKFA 3C61A 3NEVA 4BI7A 2Y61A 3P67A 4N9CA 3ZFHA 5G2IA 1JVNA 3BVJA 4O19A 4I7VA 3CWNA 2ATSA 4QITA 5BNKA 3MW7A 1QCWA 4WOZA 3MJYA 1LDCA 3NQAA 3GX9A 1RPXA 1WDWA 1W1ZA 4LY8A 3LLDA 2TSYA 5CZSA 5AHIA 1QDSA 1SFLA 1W8SA 3LOTA 5L6UA 1GJPA 3L66A 4N02A 3B0UX 2BZNA 4O1CA 4OBTA 4DPQA 5FEPA 2BX7A 4HNNA 1TO3A 4MKNA 3TC7A 1JJKA 1FWSA 5DN1A 5CPMA 3S5OA 2VEKA 4XQ6A 4JX4A 1O60A 5K9XA 3G3MA 3FYOA 3U2OA 2QF7A 4ZVJA 3CWOX 1H7XA 4AF0B 3NQFA 3OBKA 2WSYA 4GUGA 3GXPA 3KRUA 3UY8A 3EKLA 1EEPA 2HTMA 2H3DA 4IPIA 3OVRA 4X22A 5G4WA 2ZRUA 2VOMA 3QRHA 2A2IA 1CI1A 3RF9A 4K7VA 1TTPA 1PCWA 5HWNA 4K7YA 4UNKA 1PE1A 4UFJA 2ABBA 1JCLA 3LI0A 5F2MA 5ABTA 3WJSA 2C13A 3W6YA 1FDYA 1JUKA 4YXGA 4N6FA 2E68A 1BTMA 1M5WA 2V5LA 4MJZA 1XFBA 4HSNA 2QUUA 4MY8A 2FLIA 4N9BA 1JCXA 4OV4A 1T99A 5FF0A 3TAKA 2Y89A 2I9EA 4O11A 4WOQA 4LV4A 3S0CA 1V5XA 3W2MA 3C56A 4O50A 3FJ6A 1QPQA 1DJQA 4DEFA 3L67A 1T0OA 4IX0A 1T8XA 3BG9A 5BMWA 5LHFA 5K4ZA 3BLIA 3Q2DA 1M7PA 3W1LA 3E96A 1QAPA 2PCQA 1SW0A 5H2ZA 4BWLA 4OU1A 3CB8A 1OX4A 1KV8A 2FDSA 4RXFA 3HIJA 1W5NA 3O15A 3PVFA 4M6QA 4X2RA 3TH6A 3LCIA 3LRLA 1GVRA 4DF1A 1A53A 1NVMA 2D73A 5BW6A 4MYXA 3NM1A 3UNDA 3QMTA 1OF6A 1VCFA 3NO5A 5U4NA 4BFAA 4O18A 4FXRA 3O63A 4JTJA 1W3IA 3HPXA 3PC0A 4GUFA 3MBFA 4RK8A 3M16A 4AHQA 2F7FA 3FFSA 2GQAA 1ZHAA 2RHGA 4UTWA 1KM5A 1H7PA 3VE7A 2CLHA 4NNCA 4RR4A 4GBUA 1K7XA 4ZQCA 1EX5A 3Q94A 4R34A 1LZOA 1QWGA 3GDRA 1H7WA 2DZTA 4UC5A 3S9YA 4PCFA 1OFQA 4KFPA 4WUIA 1LP6A 3NGJA 1DKWA 2GQ8A 3B06A 4N2YA 3A9IA 3G0UA 3NAVA 1LROA 5D03A 4UMAA 1KW1A 4O17A 2EAWA 1R46A 1I4NA 1QPRA 1THFD 3GAYA 2DU2A 4NZFA 1W37A 3LCHA 4O8RA 3P74A 1U5JA 2Y7GA 3CU2A 3TQ0A 2VKZG 5F2GA 2V82A 3NQMA 3PSWA 1OYBA 3R8RA 3LCGA 3LRKA 2DZXA 1A5CA 3LCXA 4WXZA 1DQXA 1R2SA 3W85A 3MI3A 5IBXA 1LTDA 4TMBA 2XN1A 2CLKA 5AHMA 2C3ZA 3MHFA 3LB0A 1MEHA 4CCDA 3M5ZA 4QM1A 2PE4A 4OV9A 4O14A 1VH7A 1NF7A 3WFAA 4HIBA 1SZFA 3P7YA 4PC8A 1JRBA 5GVJA 4Y90A 1EWDA 3G0SA 1TIMA 3BG3A 3I7SA 4E38A 3N14A 4K8EA 2WO5A 3QEZA 3GVGA 2TRSA 2DP3A 2NV2A 2OT1A 4AHOA 2QJGA 3FOKA 4BI6A 1NAL1 3HGJA 3W7IA 3WK1A 4HSOA 3B0PA 3UD6A 2V5BA 1D9EA 4AB4A 1HG3A 2C19A 5DXXA 1VR6A 2H6RA 3N19B 4MJMA 2YPIA 4DBDA 1VHCA 2I14A 1OYAA 4UR7A 2FB2A 3LCFA 4K36A 2WKJA 3TA6A 4IOTA 3S1WA 3TX9A 3TIMA 2JGQA 1OFPA 4JIQA 3B8DA 3WK2A 3IVUA 4S2BA 5K4XA 3W2NA 4YL2A 3V75A 1BWLA 3NM3A 3A24A 4Z0JA 2NXHA 3UQNA 3MP4A 1JQVA 1XBVA 3BK0A 1GYNA 5FEZA 1GVFA 3SJ3A
chains in the Genus database with same CATH superfamily
2VFGA 1KCLA 1TVNA 1YNPA 3MI2A 4ZBCA 5H8PA 5EPDA 4ZXLA 1XIMA 2PLKA 2SFPA 4PMRA 3BLOA 1OT1A 4HNOA 3MUZ1 3TOYA 5LA1A 1YW1A 5LNUA 1JUBA 5ECUA 1TWDA 3WQFA 4DUOA 2DH3A 3HF3A 3G0XA 1TZZA 4MAVA 1FQ0A 4CCZA 3WUEA 1E4MM 4Q4OA 4W84A 1QJWA 4UOQA 4GQGA 4LUJA 4RKAA 3ZJ6A 3P8JA 1C91A 4A8RA 1EWEA 2IW0A 4O15A 2QDDA 4NAEB 2X8RA 3NQ8A 4TX6A 3D3AA 1PAMA 4K8GA 3EOUA 5K9CA 1TE1A 1WXYA 1F76A 3PSVA 5CH9A 3TSMA 1W3NA 4HU3A 2D0FA 1SZNA 3JS3A 2F8QA 2ZBTA 1H5YA 3SQSA 3R58A 4L4PA 2J7DA 2YDQA 3WK3A 3TTOA 3VFCA 5LHEA 3WLNA 3L12A 2FVMA 3H2OA 5HQEA 2W67A 2R1NA 2BGSA 1RY0A 1GOIA 2PDMA 1W0MA 1B4EA 1CENA 4NKCA 1OFAA 2CZ5A 2I1OA 3VIGA 4FK9A 1JZ6A 1V0LA 4WY0F 3S8HA 4K3ZA 1U30A 2OWWA 4AVNA 3VM7A 1X98A 1DIEA 4NJIA 3QR0A 4RE0A 5GNYA 3WNPA 5BU6A 3BQ5A 3QLDA 1KRMA 3DH7A 3BLEA 3TAOA 4I5UA 4DF0A 3ALFA 3QC3A 3G1SA 1SW3A 3CL6A 2RAGA 1KFWA 1ZCOA 4Q4SA 1AL7A 3V7PA 5E9XA 5LIYX 2I5GA 1L2QA 1PUDA 1KTNA 4Q4KA 5BYWA 1R3YA 1E9YB 1W6TA 2VCAA 4GX9A 1SR9A 2E77A 2YDRA 3JVAA 4JDBA 1XLEA 3TYZA 3EA3A 5DCDA 1HJUA 3SSZA 1FX6A 1BVNP 5EL1A 2RDTA 1OD0A 1A49A 1IGSA 2VEIA 2ZRWA 4IPNB 4BI5A 2QUVA 1QO5A 4LYPA 1DIOA 2P3ZA 3OHIA 4IPLA 4RV3A 1SJCA 2GLKA 1HKMA 3V0UA 5JH2A 1KM6A 3KM8A 3PUOA 1TJ1A 3H2NA 3HJZA 1A5BA 2YGYA 3H4XA 4FAMA 1W5MA 3FHAA 3EA1A 3GTNA 2A3AA 1B2YA 2GJPA 1TRDA 3CZ8A 3B3DA 1H0GA 4B3ZA 1YEYA 3MSRA 1O95A 1EDQA 2OZ0A 3TQPA 3UZWA 4EPBC 3LZ3A 3OGRA 4ZGYA 3WQ8A 2O92A 4QG6A 2BVYA 1HIZA 3CC1A 3WLMA 1AH3A 3M5XA 2VZSA 4IM4A 2BHZA 1K8CA 3CEPA 3IANA 7ODCA 2YFNA 3POCA 1EP2A 4MWAE 2ZA2A 4IIBA 2ZZ2A 4F3HA 4W7UA 2DZSA 3C0JA 1B5TA 1VZWA 2XH2A 3CIWA 1QI2A 3F5LA 5J04A 1CXEA 1XCFA 3DFYA 4PMUA 1VCGA 5C2GA 4J3SA 2WC7A 1TQXA 5RUBA 4LQ1A 3N25A 2J8GA 1E0TA 3S2JA 4OE7A 1O5XA 1VLIA 1RQBA 4JXCA 3WKZA 4HNVA 3KOYA 1VBJA 1M03A 4QDWA 2P5NA 3W7HA 5DY2A 5PTDA 2FQIA 3H2CA 4O16A 2O9RA 3I3BA 4F8XA 1CNVA 2CZVA 4JPGA 1OEPA 3UR2A 4KCUA 5G5IA 4DO4A 4GI9A 5BU9A 2HCVA 1KFLA 1E5NA 4LAMA 2WOQA 1FWHC 2WKGA 4H01A 1EXPA 5CJ5A 4ML9A 1E1CB 5FF3A 2XIQA 1FDZA 5I77A 2XDFA 1JZ2A 4IGSA 7ENLA 1GWJA 3WQVA 3VI2A 2PFHA 3QKEA 1W1YA 1KCXA 4MNJA 2GYIA 2A1YA 1LWIA 3VFLA 1A5MC 4ZOEA 3W7PA 1NM9A 3G24A 3H2EA 1WAUA 3BMWA 1U5VA 4NZCA 3EOEA 2AQVA 1YX1A 3GAKA 3RCMA 1JYVA 3UJFA 1L9WA 1B3YA 4E0CA 4CNTA 1UQYA 3CNYA 4KWVA 4D6FA 2R1MA 3V4BA 4PL2A 3A3HA 4FMVA 2WPGA 2NX1A 1ONEA 3U7BA 4REQB 1M6JA 2C1GA 3WIJA 1S3HA 3TLQA 2BG5A 5ABHA 2EXOA 3R2GA 1OZMA 1VP5A 1ZBVA 1BQGA 1TB3A 3H26A 3TVAA 2WC3A 2J9YA 2NVAA 1XIGA 4AX7A 1BXBA 4M5PA 3PZTA 3MVIA 2WWDA 2P53A 4RNHA 3A12A 4ZE4A 4ML4A 2QIIA 3OJGA 4NXKA 1P6CA 1HTIA 4HTYA 4CVUA 2CHNA 1UJPA 1A4MA 9CGTA 3GXFA 2X1UA 3VZZA 2OOFA 1PO9A 2QR6A 4RPPA 4S3KA 3W7RA 4XBKA 3E5PA 1G7VA 1KQYA 2FB3A 2E7FA 4PBGA 2J24A 2DSWA 3WJYA 4BWLC 3KW3A 4H9TA 4CNPA 1BF6A 4UMBA 5BRPA 1K7FA 3B97A 1NWUA 4HYVA 3LSCA 1ESWA 4B4HA 3G6LA 1PXGA 3WLTA 3TXZA 5HMDA 2PDQA 4QEEA 3DZ1A 4BQ3A 1QMLA 3THAA 3VYLA 2AAMA 3IIVA 4YVVA 4F79A 3ITGA 4NJJA 4G7FA 4ENLA 1EKOA 4C6MA 1ZCCA 3H70A 3PBMA 3CPRA 4KMQA 3NQCA 3M0VA 2PDNA 3W7OA 4H8HA 4B5UA 3QW4B 1FWNA 1F7BA 5H91A 4RE4A 4BJHA 3GC4A 3LXAA 4G5DA 4GD0A 3LPGA 2NWRA 5AVNA 1R7AA 5AN7A 3SCOA 4UCGA 3PULA 1TQJA 3WQ5A 2W91A 3UG8A 1U33A 4QS6A 3A22A 2DIEA 3VOHA 3TZNA 3E1F1 4IIEA 3NGFA 1JXJA 1VF8A 3D46A 3HV9A 4GGHA 1T96A 3V1PA 4O13A 5EBUA 4XZLX 3G5EA 3FK4A 1ZUAX 3HZ3A 5JIPA 2AOSA 3AS3A 3NSXA 3BOFA 1N7KA 1KGWA 2P1FA 3HTWA 5I02A 4ZFCA 4CNNA 3P60A 4TV6A 1RJRA 3IV3A 1LQAA 1WBJA 3U2CA 4GY0A 4O8AA 3MP5A 2QMJA 1DJWA 4FX6M 4I7UA 3QV6A 1R3QA 2YYUA 1OC7A 2IS7A 1M01A 4YIWA 3AMGA 3IAPA 1ZSXA 2ZUUA 1UIOA 5C71A 5D9OA 2HXUA 3OHMB 3Q45A 4U31A 1HGWA 4IP7A 4LCSA 4FNTA 3B0VC 4S3EA 1UUMA 3ANYA 1XC4A 2POZA 1DXIA 4NSBA 2ZWYA 1UWAA 2GSEA 2OX4A 2R82A 4PUEA 4AAJA 1Q6QA 4RXGA 3O7UA 3CAKA 1BKSA 4IMDA 2CLLA 1US3A 2GJNA 3MYPA 5CZ0A 1F9CA 2FZDA 1XCWA 2BVWA 5GNZA 1GOMA 1ADSA 3UF9A 3PG8A 5EMLA 5E1QA 3KDOA 1FFRA 4RX0A 2ON3A 4E8CA 4EXQA 1P1XA 2NXIA 3PZOA 4JFTA 1TPWA 4EX4A 2VM8A 2Z4GA 1JYWA 1F8IA 5CGMA 3S9ZA 1P43A 1MDRA 2DT1A 4A3RA 2WMGA 3BURA 2ZZ5A 3W9ZA 5HANA 4CQ8A 1YDVA 3AXMA 1GVOA 3LRMA 4M29A 3WLHA 1AL8A 1DJHA 4LRTA 2J66A 4OFCA 4M6VA 1O4UA 4A8IA 1LORA 4PRRA 5M03A 3ARPA 4XTIA 2QAFA 2EPNA 1M41A 5G4EA 3NQ6A 1E40A 5LNVA 1SO5A 3QLLA 3UPWA 3CBWA 3TR9A 4Y9OA 1WXJA 4GI8A 3QHNA 2ZKMX 3MDWA 1PZ3A 3SAZA 3DX5A 1IWBA 1XHGA 3ABQA 5DQPA 3AHXA 2UWFA 2HBVA 4OKDA 2CCRA 1OCBA 3W74A 1TV7A 3MO7A 4PUMA 1QI0A 4Y9MA 1UWTA 2VDHA 1XBZA 3A47A 2OU4A 3C2RA 2Y1HA 3GYCA 4PZVA 2GK1A 1WA3A 3N2MA 3SUSA 3KOXA 1BVWA 4PBEA 3PBUA 5LGXA 5D37A 2G4JA 3VM5A 4DBWA 4JYDA 3GHUA 1KFBA 4NZ1A 4CGTA 4LX4A 2OYKA 1Y65A 1BYAA 4O0ZA 4B5XA 5C2XA 4FHAA 3VIFA 3OQ8A 1PCKA 3TDFA 2A5HA 4V1YA 5EMYA 2I16A 3NL6A 3WH5A 1DVJA 5I3IA 3MS8A 1DQWA 4JFWA 1EDGA 4I7WA 3HG3A 5A6KA 2CLFA 3CAVA 3DFQA 3B9AA 1AD4A 1I0BA 4IMGA 3MUCA 2PLMA 1TV5A 2VDIA 3VU2A 1ZBKA 4D6GA 4QCEA 2FKPA 3R25A 1EL3A 2D0HA 4O1AA 5I00A 4JTDA 4WCJA 1UP2A 1XH1A 1G4TA 1BGAA 4QRNA 4GZEA 4LBSA 2PDCA 5I3FA 2GUUA 3KVLA 5A6TC 3QV9A 4NJGA 5AC7A 1O5KA 3GVVA 2J74A 4FX7A 4Q8WA 1DWGM 3HGOA 5HBFA 1Q7QA 2QZRA 1XC6A 1MW1A 4WSHA 1OQFA 1H60A 2OEJA 1EPVA 2RJHA 1R38A 1F3TA 1X39A 2VGIA 3WY1A 1XRTA 2VP8A 4KETA 1X6NA 5DRIA 3ANVA 4P61A 1MRAA 2PP3A 4C6QA 1UB3A 2GJLA 3B8TA 4ZB0A 2GGJA 1RQHA 4KEVA 3RPDA 1TKKA 4JTEA 5HDRA 2HQAA 4O4VA 3DEQA 5G4HC 1EIBA 3NDOA 5U7SA 1KRCC 4O1BA 2XISA 3TJXA 2G5WA 5IFPA 1F4HA 1HL9A 4WRHA 1CEOA 1IE7C 4L1GA 1T8QA 3CV1A 1KM3A 3DFSA 4BQ5A 3PANA 5C55A 2X1TA 3S5ZA 4D2JA 3OLIA 2J7EA 4IPJA 3VD9A 3W22A 5FJIA 4F0LA 1KQZA 3F4NA 1KBBA 3HU7A 3C0QA 3UZ5A 2B81A 1PIFA 4BZYA 2V67A 2PDPA 4AZGA 2NX3A 3RITA 3G22A 4G7EB 3GK0A 4WJ8A 4ZO6A 4EXAA 2HE5A 4WGXA 4JN7A 4TVUA 4ROPA 4D1IA 4FF5A 3M7WA 1S2UA 2WMHA 3SUWA 2XHYA 2X0YA 1YDNA 5A8OA 2OEKA 4IX2A 4EWJA 4D6DA 1H0IA 4PYSA 2XFFA 1FKXA 2OG9A 4HN8A 2ZTKA 2HWGA 1S2WA 4AC1X 4IG2B 3CUGA 4DN1A 5C9ZA 1DWFM 2WJZA 3WJWA 3M0LA 2Y5SA 1RCXB 4LSBA 4LVAA 2B7NA 4A3HA 3GFXA 1PYMA 3TSDA 1KWGA 3W02A 4RV8A 3VMNA 5DMLA 2ZICA 1IGWA 2C1IA 4AD5A 3AXKA 1HO1A 3W88A 2V0TA 1E6RA 2QCNA 4J7RA 5GJMA 4FF7A 4UUIA 4X61A 2ZX7A 3HN3A 4HTBA 4ZCWA 2L5HA 4P8VA 1WKDA 4GISA 3FX4A 4K38A 3P0WA 4Y8EA 1MXDA 4BCEA 4GC4A 2GVYA 4JTLA 2NQLA 1UKTA 2V8ZA 3ARUA 4NG3A 1GHSA 3BW2A 1RD6A 2QCEA 3E12A 3UYCA 4QDPA 3MJMA 1JCNA 3NEHA 4B3KA 1TR9A 2BS9A 1GOXA 1E1FA 2PSNA 1C8XA 2GDUA 5F4XA 4AWUA 2QCDA 1FWJC 1RK5A 3RM8A 3UWZA 2YCEA 3PZVA 4MFEA 1QXLA 4K1GA 1UR9A 4HB7A 2ZX8A 3AROA 1DTUA 1QFEA 3WZ0E 1FH8A 4H9XA 4O0QA 4HMDA 4PN2A 4B91A 3H7VA 1NFGA 3R7MA 4ZXOA 1HFBA 3GXIA 4LBRA 2Y62A 1UUQA 1IWPA 4Q4PA 2PEVA 3TTSA 3TU9A 2H3BA 5DXYA 3FSUA 2PDUA 3TC6A 3UJSA 4XUYA 3L2LA 3W84A 1ZB5A 3QMRA 1Q63A 2YA1A 2NUWA 4GZJA 4C6PA 3CIVA 2BSLA 3IJ8A 2G8ZA 4C6NA 4YMZA 1J0JA 4A3UA 3IGSA 3C0LA 4JTTA 1J5TA 1AJZA 2Y5EA 3PM6A 3AWOA 1S1PA 3ZSSA 7TAAA 3RIKA 3H22A 2X42A 1NU5A 4GZIA 3PZ9A 2HDJA 2IPFA 3DKJA 3AS2A 2OZ8A 4I8YA 1MMFA 3AIVA 4AIUA 5E0CA 6REQB 2OODA 2FTPA 2JBMA 4YTQA 3TTYA 3I7QA 3WLPA 3HGSA 2DH2A 2NQ9A 3LEPA 2C0HA 4FIQA 2RKXA 2ZRZA 3QBUA 2BWGA 2FZ9A 5HINA 5E93A 3B4YA 2QV5A 3W00A 4DB7A 5BZAA 2Y0FA 1D7FA 4Q8OA 4CN6A 3TCSA 4OVXA 1DWIM 4H8UA 1GVYA 3E9AA 3NDZA 2YCKX 4PMJA 4BF9A 1KFJA 3AZSA 1GZJA 3XIMA 4HZ6A 3LLFA 3PAOA 3VKAA 3EWBX 3OP2A 1DXFA 1F3XA 3RRXA 3E49A 1LL4A 4EKJA 3F1QA 4GMEA 1GYLA 5CPQA 2Y70A 3PJXA 1QI5A 1KXTA 2X7WA 3MI6A 2ZX9A 2R8WA 5ABFA 3PTKA 2C79A 4N9DA 4DZ5A 3T0TA 1SZRA 4LU0A 3K1DA 4R7OA 1FCVA 1YXCA 4U5IA 2AQOA 2VENA 2EBNA 1TV2A 4PRWA 3CV2A 3ZVHA 3AQUA 3TFCA 3GFYA 2QJJA 2V2CA 3BH4A 4IPPA 3NQEA 1REQA 1RBOB 1AQ0A 1QOQA 4NNBA 3DHPA 1XIEA 2J7GA 4JY9A 4C7DA 3GQYA 3LERA 3R6IA 2GFTA 1PBGA 3T05A 5C9UA 2GVLA 5G1MA 4B4FA 3APGA 4TO8A 3VGBA 1BF2A 4H9UA 2PDJA 4LAOA 3OB8A 4ICCX 3W25A 3KOZA 1XIFA 3IJQA 4GIAA 2OSWA 2ISVA 2PC8A 2GOUA 4UMCA 3B0XA 4JTAA 1WZMA 2J78A 3WN6A 2YCIX 4MOZA 4F2TA 5LA2A 2ZZ7A 3HG2A 1WOBA 4GJJA 1MEWA 3WBYA 4XG1A 3EWZA 1V6VA 4AUBA 3BV4A 5A8PA 3W1PA 1LOLA 3WCZA 4IQDA 5H6HA 2BVDA 3RMJA 1S5TA 1XUUA 3CHVA 5FSEC 2Q09A 3OA5A 4EIVA 2WQPA 4LVDA 5F4SA 2PTDA 2G4FA 3DFTA 4JTQA 3CZJA 4QAIA 4MFDA 2C15A 1MQQA 4LCRA 4JTKA 4NVTA 4MJ4A 1V3HA 2CLIA 2INZA 4L1WA 3UESA 1W54A 1XIDA 4F9JA 1V77A 3FIGA 4GVFA 4JS3A 4MTVA 3Q58A 1CGTA 1HJVA 1NOWA 3O0KA 5A6MA 2W4XA 3WF0A 4ES4A 3CTLA 1MWOA 3A13A 4O12A 5A8MA 3PZNA 4DJDC 3EX6A 4QJ1A 2WLZA 1W1VA 2HNEA 1Q45A 5CAHA 5C2CA 5CSSA 5E0KA 4ZQPA 4UZUA 4D8AA 4W89A 1I2NA 1TFVA 2V3EA 1WDRA 1TJPA 1UKPA 3OVGA 4Z2GA 1Z89A 4LXFA 2HJPA 2EEXA 4N7QA 3O06A 3LNPA 1KV5A 3OGSA 3E2SA 4CN1A 5ENLA 3A4WA 3W28A 2XTKA 2YXXA 1S46A 3ARRA 3M6YA 1W2PA 3XINA 1UZHA 3DFPA 1BRLA 1HW6A 1W2VA 3FXGA 1ISXA 3IJLA 1E1EA 2WVVB 3GXDA 4FPSA 4HP5A 2CBUA 2R91A 2BOGX 4X60A 4XAPA 1WKYA 2WSKA 1H7OA 2V81A 2E6YA 2E5CA 5E0FA 4YLWA 4C1NB 3H4GA 3HG4A 4K8HA 4D72A 3A3WA 3WMBA 5HMSA 2OELA 5HK4A 4US5D 4BEQA 4XVDA 4I9JA 2DSKA 3VO0A 1O1ZA 1EXBA 4PTWA 1W1TA 1QHZA 5AHFA 2IPGA 2IKHA 5HUPA 1KA9F 4HNLA 3AHTA 3O6AA 1C8VA 1P0NA 4QTGA 5LXXA 1RLDA 1OCJA 2E4TA 2W3ZA 4H6KA 2A7RA 1VJSA 3VNKA 3VDHA 5BCAA 2OX1A 1EF2A 4HCHA 1YE6A 4E2BA 3U4FA 4DI9A 2IMRA 3C61A 1QRQA 2Y61A 2YL8A 1XYCA 2ZADA 4I7VA 2PBOA 1XF0A 3T09A 4JQ4A 3WH6A 1AMYA 2QLYA 3GX9A 1VFMA 1WDWA 3WNMA 3LLDA 5CZSA 3WD3A 3MKCA 4DXXA 1W8SA 4YPJA 1EA9C 1QNRA 3S6OA 3VUSA 1CPUA 4RDWA 3B0UX 2BZNA 3M0HA 2Z26A 3VVGA 5I2UA 4MDPA 4MKNA 5DN1A 1L8PA 5CPMA 3S5OA 1J5SA 3AC0A 1EJTC 4JX4A 1O60A 3E3HA 3FYOA 2QF7A 3WNOA 4AF0B 1UWQA 5DMMA 1CGUA 4EAMA 4NAFB 3GXPA 4IIGA 3TN3A 2XVPA 2ASHA 4NL1A 1EEPA 2HTMA 2H3DA 2V5KA 4IPIA 2DIKA 2J47A 5DT7A 4O1EA 3EPNA 4J3ZA 4DYKA 3QRHA 4PRTA 1CI1A 2OKOA 3TW9A 5HWNA 4UNKA 4UFJA 5ABTA 3WJSA 3GG1A 1EQCA 3UCCA 1FDYA 4N6FA 4LAZA 3F4DA 4MJZA 1XFBA 1VRXA 4HSNA 2FLIA 3N4FA 3DG3A 4WSKA 4OV4A 4UQAA 1HJQA 1T99A 1WUEA 4OTKA 2VL4A 5FF0A 4O11A 4GH3A 4WOQA 1XLKA 3NSNA 1ECEA 4ACYA 3S0CA 2VUNA 3R0UA 1GORA 3W2MA 2BV9A 4Z42C 3ARQA 1LWJA 3B8SA 3RILA 4IX0A 3E0LA 4HPHA 1K9FA 4M82A 1QAPA 2PCQA 1V3LA 3VZXA 3W4RA 2J13A 5T91A 4S38A 4UR9A 2FDSA 2V5DA 4RXFA 3HIJA 4X2RA 3PVFA 3TH6A 2E3ZA 3CMJA 4ACZA 3D47A 3LRLA 4FLQA 4DF1A 1NVMA 4WJXA 2D73A 2PPGA 1ISVA 3MSGA 3NM1A 4GQQA 3QMTA 1J0YA 2ODOA 3VNIA 1UD6A 4O18A 4FXRA 4B2DD 2FGZA 4JTJA 2PMQA 2CBIA 5TF0A 2INEA 4GUFA 4C6CA 3FY1A 4LUSB 3HPFA 4UTWA 2CLHA 2JEQA 2VD8A 3SCVA 1QATA 4ZQCA 3Q94A 2IKJA 1LZOA 1QWGA 3BLLA 4PCFA 1DKWA 2FHBA 4N2YA 1Y5XA 2WLYA 1K4GA 3NAVA 1LROA 2VCCA 4W8LA 4UMAA 1A4LA 4AIOA 4S3FA 4M56A 2D1ZA 3KBWA 3NCOA 5DEZA 2BGQA 1SR0A 2VKZG 1US0A 1UD8A 2EJAA 2WMKA 3LCGA 3LRKA 4C5ZA 3UCDA 1A5CA 4WXZA 2PGRA 3W85A 1QT1A 3MI3A 5LYRA 3ZXWA 1PEZA 1LTDA 2WVVA 3LZ5A 7REQA 1VH7A 5CEWA 1NF7A 1EC9A 3IS4A 2CITA 2UZ9A 1SZFA 4IH3A 5HNNA 3FYYA 4FA3A 1EWDA 4TOQA 7CGTA 5FL0A 1DTNA 2E9MA 3G0SA 3JZEA 3EEZA 4E38A 2PCEA 2WO5A 1PKNA 3GG7A 2DP3A 3H7RA 4AHOA 2QJGA 3FOKA 4IP5A 4PMNA 4HSOA 4Z2IA 1AQHA 4PMZA 2P76A 4F0SA 3QGAC 1P6BA 1UWRA 3WF2A 2I14A 1UR8A 3BCFA 8XIAA 1OYAA 1XIBA 3EB3A 2GGIA 4K36A 2WKJA 1GZ1A 3V18A 3RO8A 2GZXA 1BYBA 2Q71A 3TIMA 1KC7A 5EGRA 2F6XA 4P7RA 3APTA 3IVUA 4S2BA 3W2NA 4YL2A 1BWLA 3UVAA 1XYZA 3MUY1 1GYNA 5FEZA 3COTA 4NZ4A 1OC6A 1GVFA 3NO3A 5CGQA 1IYXA 4OUIA 1PZ1A 2HVMA 1EX1A 1GJWA 1PIIA 4Q7BA 4UIOA 3KHJA 3RPMA 3QR1A 1LJYA 3APYA 3NO1A 2H9AB 2PDHA 4RZ6A 2A3EA 4XKMA 4BF5A 3WDRA 3N13A 4CNOA 4TR9A 1ZBWA 2G97A 4IQJA 2XIIA 4JTUA 4YHEA 4HU0A 2Q3RA 3W76A 1E6PA 2ZRVA 3K2GA 3AOFA 4Z2KA 4GIEA 3PTMA 5DELA 2XSBA 3T08A 4ROQA 5C8BB 2W0UA 2V5CA 4FB7A 3W1MA 1BXNA 1RR2A 4DJED 1C90A 1JNDA 3GW0A 3G6MA 1DV7A 4IMCA 4ZB5A 4YTTA 2NV1A 2Z1BA 5BRQA 3PZUA 3W83A 1V6YA 3GC5A 1KR0A 3P61A 1M3UA 3VILA 2B7QA 3EMCA 5ABEA 4JX5A 4GFSA 1SQ7A 3LMZA 3SUUA 4GKTA 4D8LA 2JALA 3QN3A 2HK0A 2HNHA 3W7EA 1TPUA 4L6HA 4U3AA 1OX6A 4J1OA 2G96A 1HJSA 1DWAM 1E3XA 5BOFA 3SGGA 4HHMA 1JF5A 1H49A 3C0SA 4PTMA 1MI3A 3NSMA 1BYDA 1JZ3A 1A5SA 2CERA 2VFIA 4LVFA 1R0MA 3W1UA 1R7OA 3G18A 2ZUSA 1YBQB 1E15A 2W79A 4KRZA 4KIEA 3KLKA 4Y96A 1BSIA 1JGMA 5CPNA 1IIHA 5LNWA 1MRQA 2WANA 1D3CA 1E0UA 3TJ4A 3EBVA 3VOCA 4KEMA 1NDVA 2ZOXA 4AXKA 5KSWA 1ODUA 5LIWX 3BGJA 1R2RA 3MUXA 1LBMA 4UBPC 4QLLA 5D2VA 5A2BA 3E0IA 2Z1KA 2RJGA 3UW6A 3VKJA 1CXKA 1ME8A 5HNUA 4GHRA 4UFLA 4L65A 2I7GA 2Z27A 3TUUA 1VYRA 5FJRA 3L4XA 2XGIA 1KB3A 3PJUA 1GTEA 1L8NA 2H8ZA 3ZM8A 3M6DA 1Z7AA 2IXUA 2DZUA 3HBLA 1SO3A 1E73M 4R7JA 1UZ1A 2CLMA 2VHLA 3GD6A 3ICJA 1W32A 1RD5A 3AIUA 4D6IA 3ITXA 4M1RA 5EY5A 3PBWA 1LOSA 2WBKA 4YJ5A 1C9WA 5AYIA 4FIRA 4Q7IA 5DT5A 4HZMA 1EUNA 3R94A 4RW5A 5AC6A 3C52A 2C71A 4DWSB 2G37A 3W1NA 1O1HA 3RFAA 4RLIA 4O57A 1FWRA 1NP0A 3O0FA 3DAQA 3E2RA 3S42A 4JNZA 5I3KA 3SB0A 2F6UA 3FCPA 4NX5A 1NELA 5D8WA 1OFBA 4P8WA 1XSKA 3W01A 2UY5A 3NTYA 3KWXA 4DJDD 5IHRA 1F3EA 3CHCA 3DYPA 2DVXA 3W1XA 1YPIA 1W3KA 1MW0A 1OWQA 1ADOA 1CIUA 4CD4A 5BRBA 2Z2UA 1YNQA 5FCZA 2R1LA 4XKYA 4GIRA 3RR1A 2QDEA 5D09A 3IJIA 3CS2A 3HPAA 1K03A 2BY3A 3OODA 2HISA 2HBXA 3D6NA 3T81A 5A2AA 4CCCA 4DM2A 2P3EA 2Z6IA 3B8WA 3W0KA 3BWWA 3O2LA 1L6SA 3EX2A 3U5UA 5HWMA 4GY7A 5CGTA 3FKKA 3R11A 3MSDA 4UXDA 3UA4A 3WL0A 2DEPA 1GVSA 3Q4DA 4BY3A 5I09A 3LI1A 2PLJA 3KCJA 5C9RA 4H2CA 1XR2A 2E0PA 4WKAA 2VX5A 5HJXA 1FHDA 4A8NA 4Z1BA 1H1ZA 1U1HA 4GJIA 1FA2A 1KM1A 1ZGDA 3E38A 5FJTA 4ORIA 1JULA 3SN0A 4DNMA 2ABAA 5CPOA 1L0PA 4AXNA 1TMLA 3PP7A 5F1VA 3UY7A 5LZLA 3GRIA 4WDWA 3T40A 3WLJA 3KVJA 1E4NA 4P8XA 3KTCA 1D3HA 3GKAA 4KF1A 2PDXA 4NZ5A 1TRIA 1SFJA 1OFOA 3JUGA 3WK0A 1ME9A 3A4AA 2DSUA 4HK6A 3S6DA 4Q8MA 1OYCA 3VKBA 4POCA 3C3UA 4Z1DA 2IKIA 3GY1A 1AODA 1I45A 1S5MA 4PMVA 4NRSA 4PSPA 1XRFA 3TEVA 4JFSA 1I2RA 4IFKA 3BQ6A 3MBDA 2Z2AA 4L6OA 3HGRA 1IXPA 3DXIA 1M1BA 3GNDA 4PA8A 3DBPA 3O6YX 3ABSA 3C2VA 2YB4A 3QOMA 1IT8A 4NI3A 3MV11 4QFUA 4FALA 1W3LA 2DPEA 3PK7A 4ZO8A 3G1DA 3AZRA 1P7TB 1Q6GA 4KBXA 2PWFA 2A4AA 3GIPA 4HOXA 2FMNA 1G7UA 2MNRA 3Q37A 1VLWA 2FH6A 3MUIA 3RX4A 1PKYA 2PWEA 4ECLA 1F61A 5G1TA 3KTSA 3ZR4A 4AHPA 1XH2A 2P0IA 2RH9A 4JKMA 1KBLA 2V3DA 3PS7A 1MEIA 1X7FA 5KETA 2ZUWA 3BLKA 1G01A 2RUSA 3D0CA 1JDAA 4S3JA 3VC5A 3H2AA 2JE8A 3AMLA 3CH9A 5FEWA 3G77A 4Q33A 1UG6A 4IJRA 1FDJA 1BWKA 2OLSA 4OHQA 2E5DA 4GK8A 1HNYA 3J7HA 1ME7A 2PWDA 4DXVA 1W9XA 3A4XA 4B5NA 3VC6A 1XLDA 1V0NA 5EKYA 3PZIA 4C6IA 1J8VA 4HMNA 2O9PA 3REQA 2VR5A 4XZNX 4AVFA 2ISWA 4PUKA 3W73A 3KRSA 4C60A 3BJFA 1P5BA 2QUMA 3OPSA 5C5YA 3LGEA 1M7OA 1WDDA 2VOTA 1J0HA 1IR2A 3E5BA 4YWSA 1I2OA 3IVSA 4EPEC 3FGCA 3W07A 1DOSA 1SO6A 1EYWA 4GWEA 4AISA 4Z17A 3W70A 3OYZA 1O5QA 4Q4MA 3EX1A 1DBTA 2HXTA 2VRJA 2W5FA 1A3XA 1Q6FA 1O68A 1X6UA 1Y8BA 1ITXA 3K4WA 3M5VA 3EKGA 2IUZA 3T0AA 2WJDA 3QMSA 4RCXA 2Y5JA 3CQKA 3EOLA 1UR3M 2QVNA 1N2VA 3CQJA 3LSBA 4DWSC 1GW1A 3N18A 4Q3MA 3AMDA 1XLFA 1JQXA 1YLVA 4HOZA 1CXIA 3LV6A 1JCYA 5IBXC 3IJDA 3U9IA 1Q6CA 1PVNA 1A3WA 4NIRA 5FAGA 5FD0A 3MCMA 1KM4A 2YCJA 3CO4A 3UP8A 1XS2A 3PJWA 2Q8ZA 2VC6A 5HNTA 3LLXA 2CZEA 1GOWA 3MY9A 3UXIA 1F74A 1WBHA 4PMOA 1F8MA 3WDIA 8CGTA 2ESCA 3DFHA 3TW7A 4H6EA 1E6ZA 3UPBA 1VC4A 1TWZA 2CLEA 1Y5WA 1UP0A 2CESA 2ZZ3A 1EHNA 2YA2A 4WEVX 3C8FA 4GNJA 2YIHA 5CJNA 3EMQA 4YVXA 5E6YA 8XIMA 3EWDA 1EB3A 1RJQA 4QHRA 5GJNA 4W4QA 5EA9A 5DO8A 1JIBA 2NLIA 2VTFA 2QT3A 2X2YA 3NQVA 3L0KA 1EQPA 3BLFA 1CDGA 4DUWA 1T7LA 2PTYA 3OA3A 4WKFA 4JL1A 4LFYA 1TPDA 4QJ3B 3V5FA 4PE8A 4GQ0A 3I3EA 1GQNA 4AZIA 4JIHA 1D7KA 1UJQA 2TAAA 1K6AA 4BEUA 1TIWA 1DJGA 1W9PA 1EA0A 4CQAA 3AWNA 4QE1A 5CG7A 2AGTA 1SU5A 2DT3A 1B30A 3HO8A 1EGMA 4XWUA 3UEQA 2PD9A 1A5LC 2DVUA 2O4QA 5FJJA 2FPVA 5DRCA 4OQVA 3AXIA 4N4PA 2YDSA 4ZTXA 2RGLA 2PGWA 3SY1A 1EJWC 5F4WA 3UYIA 2VCBA 1JPIA 4QJ5B 3WL1A 3QFWA 1A47A 1N8FA 5CSRA 2QCLA 3DESA 3R12A 4MUZA 3STEA 2WVSA 1A5OC 2W63A 2BXZA 4XZBA 3C6CA 4HJFA 2JIWA 2Z7KA 3TV8A 3VXGA 4F0HA 3M5YA 2J6VA 3VUPA 3OIXA 4M7SA 4S2CA 2AL2A 3UWVA 5F1UA 1JRCA 1ZAJA 3TYUA 5FEXA 1EBGA 3DENA 3RNDA 2ALRA 1AUSL 3SN4A 1F5ZA 2YDAA 4X63A 2W62A 3MKVA 2WCAA 1GOQA 1VD6A 4JTGA 5KTLA 3UXKA 1WZKA 1Q7ZA 5XIMA 4C1KA 2MUCA 4ERAA 3WUGA 1XG4A 3W2JA 2CNCA 4L9ZA 1XLCA 3TROA 1BSLA 1EZWA 3NJ3A 4JAWA 4JTCA 3FHQA 1YRRA 4NJKA 4ZEPA 4AD1A 5AC8A 4XZHA 2CBVA 1F2JA 3KVKA 1K8ZA 1LQ0A 1R2TA 5G2HA 2Z25A 5A6BD 2Q01A 2YXOA 1TJ2A 3E0VA 3MZ2A 4CU6A 2ISSA 3BGAA 2E5BA 1V93A 1EDTA 1V7YA 4HMCA 3M43A 3RLGA 3CUIA 5JH1A 2X2GA 1XWYA 4UFIA 1E3ZA 3AS1A 1V3KA 2GQ9A 1PWLA 1XH0A 4ONVA 1NH6A 4X9SA 5JXQA 2E6AA 2DZPA 2VI0A 1XIJA 1XFCA 4GJ1A 4FNSA 3GM8A 1Q7MA 3TTQA 4I3GA 3S5YA 1V6TA 2V2DA 4BHYA 2D20A 4GNKB 1VAHA 2AKMA 4MY9A 1RVGA 2P0OA 1W5PA 4UTJA 3GBDA 2YBTA 3GVRA 1ZJIA 4EXBA 1C3FA 1WQ5A 3BAYA 2VQUA 3FJNA 1DPMA 4B5WA 1I1XA 4AZCB 1UH3A 2CXEA 1QNVA 1ITCA 4ZZ9A 4L5ZA 2KAUC 3WJXA 4A21A 4QE4A 1O7AA 2JKPA 2YZ5A 4GFIA 1S2CA 5MKGA 1SGJA 3RU8X 3DCPA 3G8EA 2Z24A 4UFHA 4HK5A 3S1VA 2QDGA 3T2PA 1CGVA 1VRDA 2VFDA 2QCMA 2CHOA 5E09A 1IWAA 2WZMA 4LYRA 3CEUA 2DJXA 1E9LA 3ARZA 4F40A 1F6YA 3QPZA 1DJYA 2VO5A 3OW1A 3NYDA 2HZGA 3SBFA 1HL2A 2B7OA 3HQPA 3QYSA 4J3XA 3AICA 5REQA 1XLGA 4MIMA 1SJDA 4UTTC 3AYVA 1R87A 1KKRA 3QGKC 3PTDA 4FXJA 4QX4A 2DSZA 3NDYA 2F61A 2GSJA 3I7RA 1KD0A 3NQGA 4HU4A 1RPKA 3R13A 4HT3A 6ALDA 3L23A 4IP4A 2VGGA 3D3FA 1EJ7L 2BBFA 3PN8A 1W17A 1W1IE 1QUMA 5DLCA 5K9DA 3VIHA 2UY4A 2Y7DA 4UOZA 1M7XA 1MYRA 3IACA 3T44A 1DEDA 1JCTA 4C6FA 2DW6A 2OXNA 3B03A 2X05A 3S3GA 4M6PA 3M7SA 4AY8A 4DVOA 4WDXA 5IM51 3BAKA 5DBTA 5TIMA 2WNQA 3CK5A 2OO6A 1ZY9A 3DOPA 4B9ZA 1R30A 4X3ZA 3GVWA 3NZPA 1SO4A 4Z08A 1ZFJA 3FN9A 4NHVA 1KM2A 1V4YA 5I3GA 3MHGA 3HQNA 1Z32X 4U3CA 5I7GA 4S39A 4FSAA 2GJXA 4AZHA 4M0XA 4GXWA 1TELA 3KXQA 4GQBA 2PRMA 3ORWA 4Q8TA 3W6LA 4DIAA 1UHVA 1PKLA 3WNNA 1IF2A 1XYBA 3VGGA 5FIPA 4JTFA 3W1TA 1OK4A 1VFFA 3T42A 1H4PA 2JQXA 4EOUA 3S5NA 1JNEA 5FJUA 3DN5A 2JKAA 1V6UA 1KLYA 4OBRA 3TYDA 3BJTA 1P0KA 3ITCA 4MVAA 4RUBA 4Z0SA 1V6WA 2B31A 4FLSA 3H8AA 1BGGA 3E02A 3SCNA 2BHYA 3EDJA 2WSRA 4JEQA 3QV7A 3UZJA 3H12A 2V38A 3VABA 4UTFA 3OBAA 4FLRA 4AMAA 3Q67A 4H19A 1HVXA 4ERGA 3N15A 1G4EA 3LPPA 2QJHA 2G3NA 2HSAA 1J9YA 2XVLA 3VK5A 2QEZA 2I17A 3U57A 4ICMA 2WAGA 1K6WA 2JGYA 2Y7EA 4M24A 3OVPA 4LJ3A 2C8NA 1UD3A 3OIHA 3S2CA 4HHHA 1O12A 1PPIA 3C5QA 3WD0A 2JEPA 3IGXA 3EXSA 4ILSA 1QPNA 7XIMA 1WDPA 1NWSA 1RBAA 3FA5A 5M1TA 5KMYA 1G5AA 4L56A 2NX9A 2ZA1A 3AUOA 3M0KA 2GGGA 4H83A 1KGUA 3MMDA 3T78A 4XK2A 1LOQA 1EOMA 4ZB2A 3W7QA 2PZ0A 2DY3A 5CXPA 4DUVA 1XPGA 1XQKA 9XIAA 1ALDA 1AJ0A 4JIRA 5CBIA 1X96A 2OZTA 4GOAA 2XH4A 2CIPA 3N4EA 3I3DA 4IT1A 2VT0A 1TWIA 3B05A 4AH7A 4AZBA 4XIMA 1JL8A 2OTDA 2REQA 5FF4A 4B15A 4BF7A 3EDEA 3F5KA 1QI3A 1N8WA 3EZ4A 1A0CA 1XIHA 2R14A 4V2XA 1B9BA 4DYEA 2PURA 3PPFA 2O0TA 1Z44A 3USZA 5CPSA 1A0EA 5C54A 4LUIA 3GHSA 4V1XA 1CB2A 3K46A 4LC6A 1TCMA 4NUWA 3JZUA 1QHOA 4QR6A 5LNRA 1RSCA 4IISA 3U5YA 3ZJ8A 5A5WA 2NW0A 1WDQA 4RNFA 1UIPA 4Q8PA 4H9ZA 4TUFA 1FY6A 2CKSA 3VNDA 4DWSD 4B92A 3MCNA 1TE6A 1Q6RA 2FVKA 2ONEA 2ZUTA 3THCA 3CB3A 4ZMGA 3TYEA 2POTA 3THDA 4WKHA 5J5DA 3AI0A 1LUCB 3TONA 4BK9A 4CD6A 1UUOA 3R0DA 2OR2A 2PGEA 3GR7A 1Z42A 2D23A 2O9OA 1YADA 4XO6A 1EO5A 1XLIA 5LGZA 3ATZA 1V79A 3L5AA 3FDKA 4EP8C 1YDOA 3DKLA 1LRNA 4AW7A 1B3OA 3L2IA 4O52A 4AEOA 1VBGA 3U8GA 1W3HA 3EWWA 1XDLA 1JYNA 3V36A 3DG7A 1Q13A 3TTEA 1YXDA 3FDGA 4L9YA 3IIZA 4G6CA 4V15A 1PS9A 3OOQA 1VIWA 1I6NA 3GR8A 1EC8A 2C14A 3AIQA 4AZ7A 3PZGA 1B3VA 3UXLA 4J3UA 1KKOA 1VPYA 3R10A 3EB4A 3QH2A 4WZHA 4AD0A 4D6HA 1MUMA 4DLMA 4LB4A 4HU8A 3W7LA 3GC2A 3A4JA 4H04A 3TP4A 1VYPX 2OGYA 3DERA 4D71A 1OD8A 2NVDA 4KS0A 4H1ZA 5FF2A 1FFQA 3OQEA 1CLKA 2XJ7A 1DJNA 3B8VA 2ZFAA 3S2NA 2J9XA 2YYTA 3I4EA 4KEZA 3WUFA 3K8LA 3T2OA 1L2UA 3ABZA 4H3DA 4JCMA 1T41A 4EPKA 1GQKA 1Z41A 3LMYA 3CLWA 1TPC1 3GKFA 5HQMA 4CKQA 3K4AA 1MQRA 3CQHA 4WQ6A 2ZZ6A 3IK2A 2VYOA 3SFKA 5XIAA 2I57A 3GHTA 1E0XA 4H7ZA 1OK6A 4IMEA 1B3ZA 3MVTA 1VS1A 3DFNA 3OZYA 3PWIA 5F2LA 5A8GA 3RLVA 3NNTA 1GVIA 2J77A 5EU9A 1E0WA 2YB1A 3VAVA 1AG1O 4XV0A 4KRUA 4IZGA 4KGLA 1XUZA 3A9BA 4WR3A 4WY0B 3GYEA 3IRSA 2Q3OA 4JQ3A 1ONXA 1NIUA 4JNMA 5JUVA 4N0RA 3WSUA 4GYPC 3MCOA 4UTLA 3RU6A 1FOBA 4PCPA 4EF8A 1JYXA 2YL9A 2J27A 5KINA 3W23A 3L65A 3I65A 1R85A 2XFWA 4JHZA 1MW3A 1KLZA 2ZVIA 3WENA 2GQ3A 3AJXA 3HFTA 1E0VA 2WMIA 1NF0A 1GT8A 4JDYA 4MUPA 5ECVA 4KGJA 3VX0A 4CVWA 3AMCA 2MANA 2DZWA 3LHYA 3LHUA 2C16A 1EP1A 6XIMA 1T6MA 2CPUA 3OLEA 3BC9A 2HRWA 5A8NA 1G0CA 4GIYA 4IMFA 1OF8A 4V27A 3LHWA 1XLMA 1LLWA 1QVBA 1XLAA 5AC4A 3ARVA 4S3GA 3W75A 5G1YA 5BMXA 3GXNA 4CEXC 3CWHA 2PA6A 5LKYA 1QPKA 1NWTA 3T55A 4N6EA 3NEVA 3N2CA 5H8MA 4ZA0A 3BVJA 2ATSA 1G9HA 3MW7A 1QCWA 1EJSC 1RPXA 2IQDA 5AHIA 1QDSA 3T4WA 1GJPA 4ZSUA 4N02A 1R3VA 4OBTA 2V68A 2BX7A 2VURA 4DO7A 5CLWA 1JJKA 4LB3A 5K9XA 1CZ1A 4ZVJA 3CWOX 3NQFA 2FHCA 3OBKA 2WSYA 2PDYA 3KRUA 1FP9A 2I5QA 3SRDA 3EKLA 3N1AA 2QF8A 2HPIA 1QBAA 4S23A 4MNMA 4NAEA 1XINA 1HT6A 1PCWA 1TWWA 4K7YA 1PE1A 3LI0A 5F2MA 3SCUA 5LIXX 3FVMA 4YXGA 3TWBA 2NQZA 1KGXA 2VDGA 3AYTA 2QUUA 4N9BA 3VOFA 3KZPA 3H24A 2Y89A 4Q6XA 2I9EA 3GE7A 4YVPA 4MWAB 4JOMA 3ZLGA 4GBDA 1V5XA 4O50A 1QPQA 2I9UA 5FACA 3WEZA 3L67A 1T8XA 2Q8XA 3BG9A 1HKJA 4U33A 5BMWA 3BAJA 5LHFA 2YJQA 1DJIA 2PI6A 3FEQA 3IV8A 5C7HA 1M9HA 4L61A 1OC5A 3PWGA 4BWLA 1YQ2A 2ZXAA 1PIGA 3SRFA 3W81A 4M6QA 3LCIA 1GVRA 3Q65A 4PSRA 3ZMRA 4K2SA 3F4VA 5I78A 1VCFA 3AYRA 5U4NA 2HK1A 1XG3A 1W3IA 3HPXA 2EKGA 4MG4A 3UPMA 1NARA 3IUDA 1GUVA 3VIJA 2F7FA 1NDYA 1ZHAA 2RHGA 1KM5A 4GBUA 1G1YA 1J0KA 3FNDA 3B9NA 1K9TA 4R34A 3GDRA 5A6JA 2R1KA 1H7WA 3EPMA 5B80A 3WQOA 1WB0A 3BJSA 3S9YA 2V3FA 4UQEA 4WUIA 4UQBA 1LP6A 2GQ8A 3B06A 3BSGA 4Q4QA 4LGXA 1RA5A 4JFVA 2EAWA 1R46A 1I4NA 4DJFC 1THFD 1XW8A 1X6LA 5H8UA 2DU2A 4YTSA 1W91A 4XZMX 1U5JA 2Y7GA 3SUTA 1GGOA 1LF1A 3TQ0A 3UZYA 3DYMA 5TNVA 2NT1A 3DECA 1X8CA 3NQMA 2X40A 1P1MA 2WXDM 1MNSA 1DQXA 1ZLPA 2G0WA 3IUHA 2XN1A 2CLKA 5AHMA 4MM1A 3MMWA 1XKJA 4QP0A 3PTQA 4CCDA 1AZ2A 4QM1A 1MUCA 5GPRA 4OV9A 3P0XA 4O14A 4NRRA 1JRBA 4ZO9A 4Y90A 2PDGA 2PWVA 1TIMA 4K8EA 1S2AA 3VNZA 1NAL1 2NT0A 4PEEA 4BA0A 1K4HA 3B0PA 3VGEA 3T2QA 3UD6A 1D9EA 4AB4A 1HG3A 2C19A 5DXXA 4HA4A 2YPIA 2HPMA 1JZ7A 2XGBA 2J8TA 4X9YA 3L4YA 1KCKA 3WBXA 4IOTA 3S1WA 1B90A 1LG1A 4DX3A 4W8BA 2X0SA 1LT8A 3WF1A 3TZFA 2ACSA 4AD3A 4IIDA 2XYLA 5K4XA 3ZT7A 1BLIA 3QHMA 1JQVA 3BK0A 1GKRA 1VIZA 2NSXA 1Q2SA 5BXSA 3W6MA 2ZE3A 2CU0A 4HPNA 5EMJA 2ZUVA 4MB4A 4C6EA 3JR2A 1JGIA 3SCSA 4NU7A 4GO8A 1CT5A 1V51A 5IOBA 4AY7A 1SYTA 1UC4A 1FWWA 1XX1A 4H8VA 4IJCA 1SZGA 1Y5VA 3A21A 3NPWA 2EPMX 1OY0A 4UTKA 2JFEX 1E1CA 5AHNA 3UBPC 3L21A 3K4DA 2ALDA 3SIZA 1G6CA 1U22A 2YCLB 5T9BG 3PG9A 4XD6A 2D22A 3RR4A 2I5IA 2VEGA 2XIBA 1GW9A 3LM3A 2IPJA 3GZ3A 3R0KA 1HKKA 3G1AA 2NUXA 4DYJA 3UU0A 4XTDA 1S39A 3FLUA 4W93A 3TCEA 1V3MA 2XVNA 1ZJHA 3FEMA 4PBFA 2EPHA 3KS5A 4NX0A 1VGAA 2QUTA 5D04C 1CW2A 2X1SA 2Y6ZA 1H63A 4REQA 2VR4A 4AWSA 3L2MA 1IEIA 4CCEA 4WHBA 5EFFA 2ISDA 1QOXA 3LHTA 3W2KA 5HNRA 2BNJA 4O54A 9XIMA 3G1YA 3T0CA 2GL5A 3RCYA 3H53A 5IXEA 3NZ1A 3WO8A 4Y7EA 4PUDA 1HUVA 3WNLA 4XIAA 1EGZA 5I06A 3GDTA 5BOOA 2NV9A 2B4GA 4US5A 3N2OA 2A3LA 4MWAC 3TSBA 3NWRA 4MB5A 1TJRA 3T7VA 1DE5A 1QNSA 4Z1AA 8RUCA 2FDMA 3IGUA 3GDLA 3GR4A 1L6FA 3SRHA 5JBDA 3NQDA 3VCCA 1QTWA 1HKWA 1PTAA 3KBVA 4C90A 2X30A 6CGTA 3GHRA 1W9BM 4AD4A 2GGEA 4XZ9A 2IQ0A 3PB2A 2WQDA 1QNPA 1XYAA 4LYQA 3EWUA 3LTSA 3POHA 1FXPA 1DHPA 2YW3A 2BB0A 4GRSA 5K3VA 4I9AA 3S46A 3RYSA 3G1XA 5D4YA 3SW6A 2CWNA 2RFGA 3TMQA 3WDHA 3ES7A 5HPCA 4J3VA 4QAWA 1HP5A 1CXLA 4A22A 3O6DA 1JDEA 3EEGA 4XAZA 2BXVA 3RGTA 4AQLA 2VVNA 3VX1A 4W87A 4Z1YA 4FR6A 4ASTA 4B90A 3HV8A 1TV8A 3CT7A 4JTHA 3WMLA 3QY8A 3UERA 5HUOA 2FTWA 1UWUA 4X0NA 1WZAA 2W6RA 3OZMA 1LG2A 1HGYA 4HQVA 4TX9A 3L4ZA 4LAUA 2AMGA 2YSWA 3T9PA 4B5TA 1BG4A 1I0DA 3CIXA 2W9MA 1KTCA 4DELA 3EGJA 3P93A 4UFKA 1TPB1 4U4MA 1UH2A 2Z1VA 3T6CA 5MF5A 3SZ8A 1NSJA 1XBYA 4CQ9A 4KT2A 1E70M 5L9FA 1EZ2A 2I56A 4E8DA 1ISZA 4GINA 3VCNA 3ITYA 1X7IA 3PAJA 3QGVA 5CPLA 5CBJA 1HJWA 3JW7A 3K1GA 5HWJA 3IJ9A 3O05A 1OIMA 2EHHA 1H51A 4DBSA 2O4MA 4JZ5A 2QKFA 3AYSA 3LNMA 1AMKA 3N29A 4P7QA 1H2JA 2EF9A 1DL3A 5CC6A 5D9PA 2XSAA 4LF2A 3G1VA 2GVGA 3KEHA 5AZ1A 1VCVA 5HR6A 3MWAA 4OIFA 3DHFA 3GIQA 5I07A 3LPOA 4AZ6A 3LTPA 3SCRA 2VEFA 1ZENA 1W9DM 3AISA 2WVTA 4DI8A 1D3GA 1RHCA 4U2ZA 4UQDA 3V1HA 4QDMA 3ITVA 4K37A 3UJ2A 3MT1A 1XGEA 1OFDA 3GU1A 4C5YA 2QS8A 3W71A 2PRLA 3MANA 3NPXA 1JXKA 3WUBA 1FKWA 1A50A 1HZYA 1E43A 1Q3NA 4DUXA 2YR1A 3WH9A 1D8WA 1B4KA 2XN0A 4GUHA 1S5WA 3KL3A 4YN5A 5HMFA 3L4TA 3RO6A 3U6WA 3WQGA 2QPUA 2CYGA 2TPSA 5CQ1A 2F6KA 1OINA 1Q6EA 4JHOA 4X0VA 4M3PA 2Z0IA 2OLHA 2WPBA 3HPSA 1KFKA 3L4VA 4PUUA 4JTRA 4PCSA 1IHIA 5GNXA 4DAFA 1P48A 4AEEA 4P7NA 1GPWA 1FHLA 1Q5MA 1W3TA 4HNTA 1U83A 5A3HA 3U4AA 3W7CA 1J79A 3ISIX 5C7VA 2HVNA 1PSCA 1C92A 3V0TA 3LUTA 2QCHA 1M53A 1PZ2A 5EMKA 3WNKA 4J5NA 4XAGA 3H7UA 1MO0A 3R89A 4HMEA 4XD4A 3W2LA 2ACRA 2ZZ1A 2ZTJA 4AEFA 4EACA 2VC9A 3RXZA 3UWUA 2FPYA 2QPSA 2PU0A 4G1KA 2VELA 3VD3A 3LHVA 3SIMA 3VTRA 1JAKA 4WXYA 3LK6A 4DNHA 3GH7A 1Q4NX 3WH8A 3M0XA 3BW4A 3SCTA 4Q8UA 2V63A 4RE2A 3T0DA 4J27A 1E51A 3S47A 1GOKA 4HKPA 2F2KA 4UTUA 1V02A 1UD4A 3F2BA 3VGFA 2YKKA 1NFBA 1PHWA 2DV0A 2YL6A 5BWFA 1UZDA 2ATMA 1TMQA 1W5QA 1VEOA 3RM9A 2XH0A 2YZRA 5BROA 1PDZA 1VJIA 3R5EA 1O94A 3W27A 2V9DA 4E5TA 2D24A 3URQA 4UOJA 1F6PA 1VFSA 2E6FA 4QCFA 3GLCA 4QQ3A 1H1YA 3LU2A 1J96A 1UW9A 6TIMA 2XN2A 2UBPC 2CEQA 3QXBA 4DJFD 3HMCA 1WNOA 1TG7A 1H5VA 2C1HA 2X1IA 2ZC8A 3ZQ9A 3TWAA 1EFZA 1H3GA 3LENA 4LC8A 7TIMA 3STFA 4QJ4B 3L0NA 4AU0A 3SECA 4GYJA 5I03A 2YLLA 2R24A 3QQWA 4E3TA 4RE3A 1A0DA 3WQDA 1E4LA 4PTNA 2NWSA 1TVPA 2PWGA 4DJEC 2VZOA 2WSQA 5HULA 3KOFA 4WIWA 5CCZA 4J3TA 3V16A 4HK7A 1YPFA 1EC7A 1V6XA 4HPXA 2FZ8A 1V8EA 2RDWA 4G7EA 2GJRA 3MC5A 4HA0A 4DHGA 1TR1A 4NF7A 1XKYA 1JDDA 3QQ1A 3WELA 4AIBA 2DZVA 2V30A 4JQAA 1VQTA 3UGRA 4ZL1A 1L6GA 2QGYA 2G95A 3VCRA 2J7BA 1AW5A 2D0GA 4B16A 1PX4A 1YXYA 4NZ3A 2ZWZA 4IG2A 3MYOA 4G9PA 1EEXA 1RCOB 2CLOA 4O53A 4R53A 3AIEA 1T40A 3IGHX 3VOJA 1W56A 3N34A 2GOKA 4GABA 3W1RA 4DY1A 3A23A 2EQDA 1H7NA 1C9DA 1S2TA 1MNZA 4QLKA 4P2VA 3KBNA 3WLKX 2EKCA 1FCBA 3VKCA 3KAOA 1GYMA 3A5VA 1BWVA 1Q8JA 1UCWA 2YLAA 1JF6A 1YYAA 5CSUA 2WZHA 1XDMA 5D05A 4JICA 3M41A 3L68A 1ICPA 4OECA 1GEHA 2GDQA 2D3NA 2FZNA 5A95A 3VGHA 3FW6A 1FH9A 4RJEA 3W86A 4DLFA 4CQDA 4DO5A 1PDYA 7PTDA 3DGRA 3BO9A 1YE4A 5E6ZA 3IJ6A 3TK7A 1OT2A 8TIMA 4XUGA 1E72M 4DJDA 4E2DA 2GSHA 4W5UA 3QTGA 3A64A 2ISFA 4H9YA 1ZALA 4CN4A 5AB3A 1JEZA 4GGBA 1K9DA 5HR7A 6XIAA 4NZJA 3IUIA 5FA5A 1QNOA 3V5OA 4EANA 3ZS4A 2W66A 4C6KA 5AKQA 3H23A 3QVQA 5AY7A 3VKDA 3N3TA 3CO8A 1E56A 3NFUA 2ACQA 3ITLA 3VOGA 3W7NA 4TQTA 1PX8A 3WJZA 2V6AA 3S5SA 3SQLA 5KZDA 1UYQA 4NP7A 1RQEA 1VFOA 3XISA 4MKSA 4HPJA 1Q6LA 3NXFA 4OBSA 2EPKX 3QPEA 4WSJA 1SJBA 4JYEA 3A6OA 1G4PA 3WEOA 3NG3A 1H61A 4MWAD 1FH7A 5I3HA 5D2XA 1IZKA 4U5KA 1WO2A 5JMUA 4E4UA 4HNCA 1RALA 1OFRA 1PHQA 1MFVA 1ZAIA 4NXSA 5D38A 3HB9A 4J40A 1UMLA 3HQ1A 1LT7A 2PP0A 3WQPA 1GJUA 3NL5A 3ZOAA 3HMJG 3OZOA 3SURA 2PP1A 3N2XA 3G3DA 3B9OA 2Y8VA 1B31A 2G3FA 3MMTA 6REQA 5AYXA 4AG0A 4ZQMA 4UTHA 1GG0A 3NOEA 4NILA 3CASA 2JIEA 3M07A 1AW2A 1NJJA 3BSMA 1KXHA 1LRTA 4B5VA 4FZIA 3E74A 4FNRA 3VNYA 4N9EA 3GNRA 5F7UA 3UR8A 1UWIA 2A0NA 3S6TA 1TTJA 4LYKA 3KDNA 2YX0A 4LUYA 4OWGA 3CM4A 3UWQA 4UNLA 3C3NA 4QE5A 2ZRYA 5J5RA 5LIKX 3DI1A 4I8DA 5HPOA </