4RCXA

Trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant) loop 3 deletion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTTVPMIKSFGIEWTILGHSERRDFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Trichomonas vaginalis triosephosphate isomerase loop 3 deletion protein
rcsb
source organism Trichomonas vaginalis
total genus 82
structure length 235
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rcxA00
2ZZ2A 1EPXA 4MJMA 1WDWA 5CPNA 2Z2UA 5AHLA 5K9XA 4FF7A 4K39A 3LLFA 3L66A 2YYUA 1F6PA 1W0MA 4PTNA 2VFHA 1B57A 4CQ9A 1H7RA 3IGUA 2A0NA 5LZLA 3DKJA 1L2UA 3W6YA 3ZWTA 1W5QA 3P60A 5F1VA 5FEWA 1K7EA 5KZEA 3BLEA 4GRSA 2NZLA 3MW7A 4CNPA 5C6MA 4P2VA 2H3DA 3FLUA 3IIPA 3RNDA 1TTIA 2X30A 3S5ZA 3T40A 1DL3A 3IRDA 3LCWA 4LNYA 2EHHA 5CPLA 2B7OA 3EWXA 3QEZA 3PBUA 5C5YA 2YZRA 4ZQOA 1V5XA 1X1ZA 3IV3A 1S5TA 4JDYA 4TX9A 3M6YA 1AW2A 1VYRA 3C2EA 2ZZ1A 4FX6M 4HNTA 1LROA 1U83A 3TSBA 3NM3A 1W5MA 3GYEA 1PHQA 3MYOA 1O95A 2ZTKA 4MKNA 4GUJA 1VC4A 4R7JA 1UUMA 2I1OA 5A5WA 3OG3A 1RZMA 2OT0A 2QEZA 3TC7A 1J2WA 5HNRA 2FIQA 3HPZA 4DF2A 1AW1A 1TPB1 2CLOA 4FHAA 4IX0A 3L5AA 3HO8A 3S1VA 3THQA 1I8JA 3OIXA 3LBMA 1W3NA 4JYFA 1O4UA 1SO5A 2BXVA 2GPTA 3U2OA 4JTHA 1YTDA 4XTIA 3TUUA 4AH7A 3ELFA 5BRBA 4NJHA 4Y96A 1GVSA 3M41A 4NUWA 2Q8LA 3MBFA 2CU0A 1Q6OA 4O14A 1QOPA 3E12A 3O6YX 1OABA 5FF2A 1H60A 3FOKA 1FXQA 4WY0B 5AYYA 1SW3A 2OJPA 3EXTA 4K7VA 4WY0F 3W1AA 1GVRA 4FEZA 4M7SA 1MEWA 4O15A 3QJAA 4RR4A 4TU1A 3F1QA 3NPVA 3N14A 3VE7A 3BO9A 4O53A 3OVPA 4LU0A 1WBHA 1DV7A 1QNVA 3DI1A 3H55A 3KRZA 3ABSA 2V2HA 1OFEA 3W9ZA 2H90A 1OYCA 2G5WA 3KVLA 1H61A 4TMBA 4RXGA 1TRIA 1K02A 4HT3A 2A6NA 1Z44A 1ZAIA 3O15A 2PC4A 3IIXA 4FIQA 2B7QA 4GUHA 4O11A 3U8GA 3LB0A 2ISVA 2VELA 3LBCA 1AMKA 2X1TA 4OBTA 3QM3A 3W1NA 5KSWA 1KFEA 1W1ZA 3GZ3A 3M9YA 4R33A 1TO3A 3Q2DA 4GXMA 4Y8FA 3A5VA 4O57A 3ABQA 3KVMA 4JTIA 4UIOA 5D32A 3R89A 4BWLA 4IMCA 5IM51 2WQPA 3CB8A 1SO6A 3B06A 3UXDA 3HPSA 1YPFA 3QH2A 4P61A 3TMQA 4A22A 2FPYA 1G7VA 3BW4A 5K3VA 1TV7A 3WFAA 1R2RA 3MI3A 1FQ0A 3NXFA 1FY6A 3W7KA 1EP2A 1X8FA 2XFWA 3S42A 3S1XA 2E1DA 3MI2A 2WNQA 3W7PA 1KM2A 3USBA 4X9SA 3HG4A 4NX0A 2GJNA 2GVLA 1OYBA 1AL8A 4O1CA 4A21A 5FF4A 1KTBA 4CCCA 3MHFA 1C8VA 3ABRA 1O60A 2DP3A 3A9IA 3T78A 1VZWA 4Z1AA 1VYSX 1JR1A 1VCGA 1LP6A 1R2TA 4FXSA 3ZR4A 2ZBTA 2C15A 1NEYA 2QF7A 4O17A 4OV4A 4UR7A 1F05A 3NZ1A 4UFHA 1RQHA 4NNBA 1A5SA 2IQTA 2TYSA 3OBKA 4JEQA 1GQNA 1LBLA 3LX9A 1GPWA 3W83A 1EX5A 4AVFA 2CW6A 3LI0A 1LRQA 4NJKA 2YCEA 8TIMA 1LM1A 4FNPA 2Y7FA 1QWGA 4BK9A 3GKFA 2ZRVA 2CLLA 3FKKA 4ZQPA 3G1AA 1SZFA 1W31A 1TPH1 3KRUA 4U4MA 3SJ3A 1SSGA 1R46A 2C19A 5FI8A 5E93A 1N7KA 4UTWC 3YPIA 4U28A 2A7NA 1DHPA 1S5VA 4UTUA 3GLCA 4IWWA 3MP4A 1KBJA 2W6RA 2YW4A 4XKYB 3GAKA 1OF6A 2RDUA 3EX1A 2YYTA 5FF7A 1JJKA 3W22A 5LHEA 1NF7A 3BVJA 3STFA 4NXKA 1SZEA 3C3NA 4YLWA 1K7XA 1FUYA 3TFCA 2DORA 1FCBA 2ZA2A 2V8ZA 3W7JA 2DJLA 4O4VA 4IMFA 1KTCA 1WX0A 1Y0EA 1M6JA 4MLRA 3EX2A 4LWWA 3TR2A 3L0KA 4MZ8A 3INPA 4XZ9A 4DO4A 2QUTA 3HJZA 1QDSA 4UR8A 5LNUA 2EPHA 2VEKA 1X7FA 3L67A 4EF9A 2QCNA 1Q45A 3LRLA 3GR8A 2QJHA 3MWAA 5D03A 5HJLA 5G4EA 4JTEA 4Z1CA 4JXCA 1I2NA 5I3IA 5LNSA 3MI6A 5HWJA 1B4EA 2DZUA 5G2IA 3I7QA 3W73A 1DOSA 1ZAJA 1SZGA 2Z6JA 4DPPA 2NUYA 2VFFA 3G24A 1XM3A 2UV8G 4QJ1A 2QKFA 1WOAA 1VGAA 3BW3A 3GDLA 5EL1A 1H7PA 1VS1A 3LHVA 2DZXA 4HNUA 5DCDA 3IEBA 5HR6A 1ZFJA 2B7NA 3C2OA 3SY5A 5BMWA 1KM0A 2TMDA 4GFSA 4JTKA 4GJ1A 2FB2A 3O6CA 3W1MA 2A85A 3UWQA 1GVFA 2OZ0A 4HKPA 2B4GA 3DHDA 1ICQA 1SW0A 3H54A 1F6KA 5D2YA 5CZTA 2CLIA 4M7TA 2A5HA 3B03A 3MBDA 2B7PA 4ALDA 3HBLA 1N8FA 2WPBA 3EX4A 1JQVA 1G4TA 2QCCA 3RLVA 3LHZA 1Z41A 1TIMA 4AF0A 4WXZA 1QCWA 1YPIA 3UY7A 5AC7A 4GUIA 5D30A 5DY3A 4AEOA 2J27A 2ZCGA 3KFTA 5G1TA 4Z1BA 4MFDA 3HMJG 1GG1A 1GTHA 2DJXA 1FWRA 2KZHA 3LCGA 1YXYA 5G1YA 4ADSA 4O16A 3G1SA 4CCDA 1BKSA 3LTPA 1KM3A 1LBFA 2V30A 1GWJA 3EWWA 1VCFA 4I9AA 1NVMA 1VCVA 2VXNA 1S5WA 3L5LA 1XUUA 4A3UA 2BSLA 1GYLA 3O05A 3M47A 1P4CA 3KOFA 3P5ZA 2ZZ3A 2GQ8A 1G69A 4LUIA 2C16A 3G1FA 1TCDA 4O1DA 1SU5A 1PCKA 1KW1A 1A5AA 1FDYA 1MO0A 1OX6A 4IGHA 5CSRA 4PA8A 3S8HA 3S0CA 2NXGA 1S3HA 4XWUA 3I6RA 3E02A 3QFEA 1QFEA 3L68A 3WJWA 3CWOX 1I45A 3NQMA 4C1KA 5D04C 3KRSA 2QCDA 3R5EA 4TR9A 2A1YA 4AWTA 3DH7A 1T99A 1OF8A 5F2IA 3E49A 3NQDA 1RQEA 4GUGA 4UNKA 4ADTA 2OMAA 1SZNA 3CEPA 2DZPA 2EKCA 4MUZA 1OK4A 4MFEA 4AHOA 2DZTA 2ZA1A 1FBAA 2H6RA 3QPZA 4M6QA 1EUNA 3TXVA 3W1PA 1FCQA 4FNRA 4J9JA 1IIGA 4CCEA 2J24A 3P8IA 5CPMA 1THFD 1KLZA 3JR2A 4O19A 1W5NA 5KZDA 3C4UA 5I3FA 2CZFA 3S6DA 3DKLA 3CQ0A 5F2MA 3PB2A 3TH6A 3W7CA 1G4SA 3NL2A 3MUXA 2J9XA 3B4UA 1LLWA 3PUDA 2X16A 3GB6A 4AWSA 3PWAA 3SECA 1UCWA 3PULA 1D9EA 4EOUA 2E77A 1DQXA 1W8SA 2CZEA 4JDBA 1ZNNA 5LNWA 4JNMA 1IIHA 2PCQA 1ICSA 3W7GA 3T7VA 2GVJA 3PR2A 3W88A 3QSRA 1WXJA 1TPVA 3T55A 1QR7A 1RPXA 4ZQRA 5AHNA 1ZENA 3UWZA 4FXRA 4WOQA 2P10A 5F4SA 4AHPA 1XC4A 3IVUA 3VCRA 4A2SA 4LS2A 1H50A 1F5ZA 3LHYA 1XL9A 4ZQNA 1RR2A 2VC6A 4N9BA 3L0GA 2WV8A 3G1XA 4DBEA 3R13A 2OT1A 4Z08A 4IPIA 3VNDA 3C2FA 2WSYA 2E09A 3NQVA 5I3JA 3S9YA 1YTEA 4UUIA 2YW3A 4LY8A 3EKZA 3N9RA 3W1RA 4DQWA 1EWDA 4DBDA 1QPRA 3L2IA 2RDWA 1YDVA 1QMLA 5AHEA 4NVTA 5EYWA 4HPJA 5K9DA 1NAL1 3F03K 1D3HA 3W07A 1CI1A 1FCVA 3HQ1A 3DZ1A 1TPWA 1W5PA 3BLFA 3PG8A 3Q94A 3N19B 5KZMA 1GG0A 4JICA 4RXFA 1HL2A 4AMAA 5CG7A 3TJXA 1BTMA 3HG3A 1GJPA 1P1XA 4JYDA 3W76A 3C61A 1KFLA 5IBXC 5CZ0A 1JUBA 1KBIA 4M6PA 4RZ6A 3PF3A 3FJLA 1J5TA 1LRNA 4Q4KA 1FX6A 4KFNA 2ZDRA 3LM7A 2WSQA 5G4WA 3NA8A 1C29A 3E0IA 3TIMA 1ML1A 3VE9A 2JKAA 3KX6A 3LHUA 5HMSA 3QW3A 7TIMA 2Z0IA 3CIWA 4O0ZA 3W71A 2ZRYA 3BG3A 3SFKA 3W2NA 4R34A 3W85A 4DF0A 1WYIA 3LERA 2YGYA 5FESA 2V2CA 4JN6A 3W84A 1X6UA 4D2JA 5HWNA 5C54A 1AK5A 3W7IA 1FDJA 5EY5A 3ZS4A 2Z1BA 3LLDA 2GJLA 3QMSA 3NYZA 4B5NA 4FNTA 3EKLA 5K4XA 4XBSA 3H53A 4WXYA 4ZZ9A 2YDAA 3IGSA 4RCXA 3G1HA 4OT7A 3EWYA 1RD5A 3WK1A 3SSJA 4BFAA 4FIRA 5AOUA 1PS9A 2YXGA 1H1ZA 3P67A 1T96A 1SR9A 1XXXA 5FEXA 5U7SA 3DHFA 2QUVA 2JBMA 4E38A 2NX9A 3TW6A 1U5JA 2F7FA 2RH9A 4ICNA 5FEPA 1JCMP 4UTKA 1LRTA 2EAWA 4UNLA 1ME9A 4ONVA 2A7PA 2QDHA 1FWSA 1V7YA 4AB4A 2QAFA 1K03A 4N2YA 4NJGA 1JULA 2ZZ4A 4LT9A 3G3DA 5DBUA 3MO7A 3BARA 5I3GA 3W7EA 5D2TA 4L4LA 5DELA 3NL3A 2X1RA 4UCGA 2NLIA 4NNCA 2TRSA 2ZTJA 4O8RA 1JRCA 2ZRXA 3P84A 5D2WA 2Y85A 3O6DA 1L9WA 4QITA 1P5BA 3LXBA 1AG1O 4LOCA 3N73A 3G1VA 3L9CA 4IPJA 3DFPA 3T44A 5G5IA 4UMCA 1DJNA 2XN0A 5AHFA 3BV4A 5CZSA 1I4NA 1PIIA 4DXVA 5FF0A 4WD0A 5KTLA 2E6AA 3CTLA 4DEFA 3NL5A 1FXPA 3MJYA 3NAVA 1PHWA 4X22A 2BZNA 2XN2A 1JCJA 4UFIA 2CWNA 3STEA 3L0NA 3NQ7A 1Q6RA 4UMAA 3DXIA 5DBTA 4HPXA 4N6EA 2HSAA 3FYOA 1GEQA 1VRDA 2QJIA 4G1KA 4Z0JA 3FJ6A 3PB0A 1EP3A 3N34A 3N9SA 1YDNA 2EF9A 2ZYFA 1L6YA 5HULA 3PG9A 3A24A 3W2LA 1SQ7A 1VHCA 2YPIA 5HWMA 3TAOA 3CHVA 4MIMA 4K38A 1IXPA 3UY8A 1F73A 3LRMA 1WAUA 3PBYA 3NQ8A 3TSMA 1DORA 3P8JA 2C3ZA 1VLWA 1W5OA 4KFPA 5AYXA 2Y63A 1H7XA 4TMCA 4FB7A 3O1NA 4LV4A 4MYAA 3NNTA 3P82A 4UFLA 3M5ZA 2E6FA 4LVDA 4LV9A 1XDMA 2Y7EA 3NQGA 4LVAA 3W7HA 4NJIA 5FF3A 4MVAA 2G96A 5CPOA 3E96A 3B04A 3B8DA 4RLIA 1XFBA 5AC8A 2VOMA 2ALDA 2TSYA 1Q3NA 5D09A 1YXDA 2JKPA 3GR7A 4O13A 1HO1A 2VEMA 3L65A 4UFMA 4N9EA 4PL2A 1FWTA 1M5WA 3SZ8A 3ZFHA 2E5DA 3PY2A 1QPOA 5LGZA 3VI2A 4GBUA 1SFLA 1RQBA 4IX2A 1VHNA 3G0XA 1KM5A 4LC8A 1JUKA 3TMLA 4OE7A 1JRBA 4HN4A 4RV8A 4A2RA 3AJXA 2ZZ5A 5AC6A 4ML9A 5E0KA 1UJPA 3QYQA 3WK2A 4EF8A 3GVGA 4AXKA 3N3MA 3HGJA 1SSDA 2FQIA 3R2GA 1EB3A 4LC6A 3W7LA 2HS6A 1PE1A 3RFAA 1F7BA 1A5CA 3M0ZA 1HUVA 3P7YA 5CKSA 4HSOA 1K8ZA 2NX3A 3CEUA 5AN7A 1SPQA 2DU2A 3M43A 4RJEA 1ICPA 3WJZA 1OVDA 3ATZA 4JYEA 3UPWA 2PURA 3GKAA 1G7UA 3NM1A 3G0SA 5DXXA 4CQAA 3G1DA 1OX4A 4GUFA 2ZA3A 2GQ9A 3OEXA 5F2LA 3B0UX 1W54A 4Y90A 4LTSA 4X2RA 3BG9A 4H3DA 3NQFA 3UWYA 2P0OA 3D0CA 2W0UA 4ORIA 4UTTC 1BWKA 1OFRA 2FJKA 2HTMA 3NPUA 1SW7A 6ALDA 4O1BA 3HPXA 3EWUA 3W74A 5F2GA 3GDMA 3E9AA 1VYPX 2O7QA 4UTWA 4KWVA 1K3UA 3FA5A 3PUEA 4UTMA 2A6LA 4EWND 2DZSA 1A53A 4UTIA 3DI0A 1SUXA 5DXYA 2JK2A 3TU9A 4GC4A 5I3HA 3S5NA 1ZHAA 4UTJA 2VFDA 2Y6ZA 3GIYA 3UPBA 3NGJA 5LHFA 3C52A 3TQ0A 3QZEA 3CC1A 4HSNA 1TYGA 2ZZ6A 4PCFA 1EP1A 1C9DA 1SFJA 4K6AA 2R8WA 3TA6A 4PODA 3TXZA 1KM6A 3UZ5A 4QISA 4CQ8A 4QM1A 2XN1A 3FS2A 2PRHA 3EEGA 5D38A 5KITA 1XBYA 1EIXA 4NQ1A 1KM4A 2FPVA 3PC0A 4PFMA 3W2JA 3NQ2A 1VH7A 1TJPA 3EXSA 3PS7A 3GDRA 4JY9A 3HGSA 3HG5A 3G1YA 5HQEA 3GNDA 3C56A 5TQLA 4BI7A 2J6XA 1QOQA 3LXAA 4CNNA 1O5XA 4UFKA 3TCEA 1BEUA 4IMDA 2NUWA 3W7NA 4OHQA 1DBTA 1L6SA 3M7WA 4N02A 4WZHA 2C13A 1X1OA 4ZL1A 3QSTA 2R14A 1GVQA 2VFIA 2RKXA 3KHJA 4LVFA 4E0CA 3W1TA 3LV5A 5BW6A 4S2BA 3G3MA 1OHLA 4OGZA 5D05A 2YR1A 3PSVA 3QW4B 2Y70A 1OFOA 3DAQA 3W3OA 4K37A 1F2JA 3NL6A 2WOQA 4FNUA 3K30A 5AHIA 5AYZA 2Q3OA 1PVNA 4H4IA 3GK0A 3I65A 4NXSA 4N4QA 3Q37A 1XUZA 5GVJA 1JCNA 2E6DA 2ABAA 3W1XA 1R30A 4O1AA 3GNNA 1T0OA 4DF1A 3WK0A 3O63A 2NV1A 4TO8A 4YCOA 1MXSA 1GT8A 4UMBA 2WSRA 3JS3A 3S1UA 1WQ5A 4EVZA 1KM1A 3QQ1A 5BMXA 2A4AA 3STGA 1VJIA 1M7PA 3P74A 1IXQA 2NV2A 3W75A 4XQ6A 3MYPA 4NZJA 2Y7GA 2H3BA 3CIXA 3QC3A 4DPQA 3KVJA 3HOJA 4FX8A 5EMUA 2QCFA 4M5PA 3P80A 1W3TA 3TV8A 4LRTA 5SWUA 1A5BA 1TB3A 2CLHA 3SW6A 4YMZA 3W70A 4PL1A 3TC6A 4JX5A 4S2CA 5EKYA 3TE9A 1NFBA 1Q6QA 3HGOA 2W79A 1OG0A 4Z1DA 1RVGA 1AW5A 4NT0A 1A50A 3SGZA 1H62A 5KINA 4N6FA 4RK8A 5BNKA 3IIOA 2CZDA 3NOEA 4PH6A 1I2RA 1GTEA 1H5YA 3IVTA 3TKFA 5LKYA 1ADOA 2X1SA 1GVOA 2NXIA 3O16A 2GVGA 3DFQA 3PUOA 1XBVA 3TNOA 3MP5A 2YFOA 3THAA 3DGRA 3NDOA 2QCLA 3UXAA 1TV8A 3I7RA 3WK3A 1OJXA 2Y7DA 4MZYA 2HMCA 2V0TA 2ZZ7A 2CFFA 3A23A 2NXHA 1WBJA 2JGQA 3LCFA 1H7OA 1HG3A 1I2PA 1H63A 4ZMGA 4RZ4A 4BR1A 3HGRA 5L9FA 1ONRA 4NJJA 1ALDA 2YX0A 3NR0A 3BPWA 3CWNA 1KLYA 1XDLA 4GWEA 3NQCA 4TIMA 3TX9A 1D3GA 3SGUA 3KVKA 5LNRA 2QCDB 2CLMA 3KXQA 1YXCA 3HF3A 3O8AA 4HNNA 2EGZA 2ZRUA 3LHWA 2GUUA 4WY0A 5D2XA 4BF9A 3O07A 4E2DA 3S5OA 2FDSA 3CU2A 1YYAA 4RZ5A 2ISWA 3NQEA 1O94A 5F1UA 2QCGA 2WJZA 1W37A 4K8EA 3GX9A 3TSDA 3OVRA 3U6WA 2OCZA 4ZVJA 3LV6A 2PRMA 3EWBX 2DZVA 5G2WA 3QRHA 1IXOA 3BK0A 1ME8A 4S1FA 3O06A 3M44A 4MLJA 3NPXA 4POCA 1ZJIA 1F74A 4BI5A 3M16A 5AFDA 4O4WA 3IGXA 3IIZA 1FDZA 1TMHA 2AAMA 3NG3A 5F4XA 4WX2A 2X1UA 4GE8A 3M1ZA 3W1LA 5K9CA 1EWEA 1ZCOA 2C14A 1W56A 1H51A 4OV9A 4M19A 4O18A 4JTTA 5HINA 4QIUA 2Y61A 3W7QA 3IIVA 2QCHA 1TREA 5K4ZA 2VKZG 2C1HA 4LW7A 4XTDA 3W7OA 3FEMA 3T4CA 4JIPA 3W7MA 2Y88A 4KWWA 5CZJA 2VENA 5T26A 1IXNA 4HIBA 5IBXA 1PV8A 2J9YA 4DO6A 3P62A 3NZRA 4A29A 2D73A 3W1QA 2V81A 5LSMA 3IVSA 4JS3A 3HG2A 1IGSA 2Q8ZA 3PBWA 4MJZA 5CGQA 4QNWA 1JVNA 5F4WA 4RX0A 3QQ0A 4LS0A 3B05A 4DO5A 2WKJA 1FCUA 3R8RA 3W87A 1LZOA 1YDOA 2ZQ0A 4NX5A 4KKXA 1FWNA 2OX1A 2WO5A 4EIVA 3NQ6A 3A5FA 3G22A 4LVGA 1OFAA 4RKAA 1CX9A 3BG5A 3B0PA 2V9DA 4BWLC 3QMRA 3LOTA 3FKRA 3C8FA 4N9DA 1PL9A 5DY2A 1LLZA 3ANYA 2FLIA 3V75A 2F84A 3DFNA 3W72A 3B0VC 1T8XA 3DFTA 5D37A 1VLIA 2ZFAA 1G67A 3AO0A 5G2HA 2ISSA 2E6YA 1EA0A 1OFBA 1W3IA 2JKEA 1LCOA 2QCMA 2O7SA 4WQ6A 2R91A 3W86A 3JRKA 4IOTA 4OQVA 2I14A 5LNVA 4HHPA 3LCIA 4JR5A 4MY8A 5AHMA 3UD6A 3W7RA 5HUOA 4Q32A 3DU0A 1QPNA 5A8GA 3OA3A 3EX6A 3L21A 1OK6A 2A21A 4UXDA 3DBPA 1OFDA 4YL2A 2ATMA 1XCFA 2E5BA 1I2OA 1KFCA 3WJYA 4CLMA 2QR6A 3C6CA 3LCXA 2C0AA 4QNEA 4XUGA 1R2SA 4JTLA 2DZWA 2Q3RA 2WNNA 4N9CA 4JTSA 4XKYA 3NVTA 4GNJA 3C2VA 4L4MA 3GXTA 1H1YA 1B3OA 1AL7A 4IMEA 4IJBA 5BOOA 4I7VA 1TPDA 1LOSA 2J9ZA 3F4NA 3VKJA 4Q33A 1LOLA 3CM4A 3W2UA 3P61A 5TBOA 3EX3A 2BWGA 4XBKA 4LRSA 1WA3A 1HO4A 1K8XA 3R12A 3BGJA 4JTGA 4DELA 3GAYA 1KFBA 3TQVA 2A7RA 1XKYA 2A2IA 3NQAA 1XBXA 1Q6LA 5K2ZA 1O5KA 5C55A 1YADA 5D02A 5HR7A 3STCA 1K7FA 2I9EA 3UQNA 1TTJA 2VFEA 1HFBA 3N2MA 3TQKA 3I7SA 4UTHA 3EWZA 3G18A 3L5MA 1KTNA 1VR6A 2JGYA 1MEIA 1XI3A 2ABBA 3S1WA 4JTUA 4JIQA 3DFOA 4FNQA 1LTDA 2RHGA 5HUPA 3W1UA 4UTLA 3P5YA 4JD4A 1OYAA 2PE4A 2AGKA 1TSIA 6TIMA 3RK8A 3TAKA 1UBSA 5DLCA 2E5CA 1L6WA 2LLEA 1VPXA 4O10A 3TROA 2CLKA 1MZHA 1TTQA 1ME7A 1BWLA 3GDKA 3NPWA 4NZFA 1NSJA 4PC8A 3OVQA 3DENA 5DCBA 2BTMA 5EBUA 3RU6A 3M5XA 5DCEA 5J5DA 3G8EA 1KV8A 4LVBA 4MOZA 4K36A 3GXPA 2CLEA 4PEKA 1JQXA 1RV8A 1F76A 2V5LA 4I7UA 3M5VA 3W2KA 2FFCA 3W2MA 1B9BA 1TQXA 3N2XA 2QDGA 3TFXA 3TK7A 3EB2A 4MY9A 4JY8A 3UWUA 3C2RA 3CPRA 3MHUA 4MZ1A 1R47A 3LTYA 4HNVA 5I3KA 1TPEA 1SO4A 5ABTA 5E1QA 4FO4A 2Y62A 4IMGA 5K7JA 3LDVA 5DN1A 3I68A 2RDTA 1LBMA 1WOBA 3CLMA 1KV5A 4O50A 1IF2A 1DQWA 1N55A 3UZJA 3W7DA 4UC5A 2NX1A 3LCHA 5TIMA 5AB3A 4IUOA 4LUJA 4JX6A 3M5YA 3LXCA 3UYCA 3GDTA 4N4PA 2Z6IA 2GQAA 1QAPA 4K7YA 1EUAA 1QO2A 2NWSA 5CSSA 1GOXA 4E2BA 2GOUA 4ZQMA 3RLUA 1TV5A 4JX4A 3PSWA 4KFOA 2QUUA 3DFSA 5C2XA 4I7WA 4UFJA 1LOQA 2ZRZA 3V1PA 3G0UA 4QQ3A 2R94A 3S5YA 4WUIA 2WNZA 1OX5A 1TPFA 2G97A 1H7WA 4NNAA 3MMTA 4LS1A 1DJQA 1EEPA 1B4KA 1UUOA 3NO5A 4W9TA 1OFQA 3QPYA 3GXNA 4Y9AA 2V82A 1QO5A 4C1LA 1SO3A 1TRDA 2VEIA 3SIZA 3LGEA 3A21A 4UTTA 1KA9F 1VQTA 1K8YA 4IXHA 2FTPA 4OWGA 4M6VA 2BLEA 3PAJA 3HIJA 3PBVA 4QAIA 3UWVA 3FIGA 5D33A 4AWUA 2J88A 3W23A 5MHBA 5FEZA 5EA9A 4AAJA 1LYXA 2QJGA 1UB3A 3KAOA 1LDCA 3EXRA 4YCPA 1JUEA 3CT7A 1JCYA 4YXGA 1TPC1 3ATYA 2B0MA 3A22A 3TW7A 5KMYA 4OU1A 2P1FA 1OX4B 3MHGA 2C18A 1WV2A 3HB9A 1YLVA 2YFNA 1GYNA 3TDFA 1G4PA 4X3ZA 4H6KA 1Z48A 5H2ZA 1QPQA 5H91A 3BLIA 4CNOA 5D2VA 4MPQA 4BI6A 3BGGA 1MEHA 2TPSA 3Q58A 4Y6GA 1ZY9A 4JTJA 1ZAHA 2BX7A 1P0NA 3NEVA 4IQLA 3LRKA 3BW2A 2CLFA 3OHIA 3UNDA 1J4EA 3UWWA 4ADUA 3LHTA 3SI9A 1H7NA 2PRLA 1OFPA 4R53A 1GZGA 4O28A 2ATSA 3VFLA 4O54A 3WJSA 1YTKA 2H8XA 1HTIA 1MSSA 4NU7A 1JCXA 1TJRA 3C0JA 3FFSA 4WOZA 4IXXA 1ZALA 2QCEA 3G8RA 1CW2A 2E68A 3F4WA 1LORA 3QF0A 2V5BA 3WJXA 2FPTA 3RF9A 4ORMA 2YSWA 4O0KA 1DVJA 2AQWA 2ZRWA 5L6UA 3FYPA 1UASA 3RMJA 3LI1A 3QMTA 1P0KA 5EPDA 2HS8A 4AF0B 4YWIA 1DKWA 1TQJA 2G95A 3SR7A 1M7OA 1Z42A 2FB3A 1TPUA 5J5RA 4FNSA 2H8ZA 2RFGA 4AHQA 3TJLA 4MY1A 3P81A 2Y89A 1G6CA 5U4NA 2QAPA 3LTSA 1KFKA 3LCLA 3PVFA 2NUXA 4ZQCA 4O12A 2V2DA 1PCWA 2X2GA 3PM6A 4QSHA 1NF0A 2VEPA 1KFJA 2NWRA 1FWWA 1JCLA 1XBZA 4K8HA 2CZ5A 2C6QA 1I2QA 1E51A 4JTFA 2VFGA 3ABOA 4MYXA 4Z0SA 1G4EA 4WJEA 3ZWSA 1TTPA 5LGXA 4FX7A 4O52A 3MP3A 4JGDA
chains in the Genus database with same CATH superfamily
1WAWA 1FKXA 3M0MA 5AHLA 2FH6A 4FF7A 4K39A 1JDAA 3LLFA 2C1GA 3QV9A 3WLNA 1QWKA 2PZNA 5FEWA 5AC5A 1EC8A 3TYUA 4IFKB 3RG6A 4GY0A 1EBGA 3IIPA 2GGEA 3S5ZA 3MV11 2BGNE 4KS0A 2PP0A 3S9ZA 1DL3A 3LCWA 3WG6A 1ISWA 4LNYA 3CXOA 4NZ4A 1VBUA 1TJ0A 2MANA 5FJJA 3R7MA 3QEZA 4V2XA 3GC5A 4Z42C 3DECA 1BF2A 3VU2A 4IMAA 4J35A 4RNJA 4DJDC 4DB7A 4DJED 2J77A 4Z2KA 4FX6M 1J11A 4H1ZA 1TZZA 1LROA 4JFTA 4IM4A 3TSBA 3WNMA 3NM3A 2WK2A 2ZTKA 3VKDA 1VC4A 4R7JA 1W8GA 3S83A 3EBVA 3T9PA 2QEZA 3TC7A 5JIWA 2GUYA 3U2ZA 4QLJA 1SYTA 3LUTA 2WW5A 1W1IE 1I75A 3NOYA 4JYFA 1O4UA 1SO5A 2BXVA 4IF2A 1YTDA 4AH7A 5BRBA 4F4RA 1AUSL 2BGSA 2CU0A 1Q6OA 4O14A 1E43A 1CLVA 2D3NA 4EPEC 3O6YX 3MDUA 4M51A 3ZMRA 3FOKA 1AJ2A 1FXQA 4DWSB 3THUA 2OJPA 3ZR5A 3AXMA 3EXTA 3A4JA 1BG9A 1MEWA 1B3ZA 1LLOA 4LNCA 4RPPA 3NPVA 3WBEA 2GJXB 1PKLA 3BO9A 1UWRA 3H70A 3R4IA 4TOQA 4LU0A 2PU0A 4R3UA 7PTDA 1PX4A 1J5SA 3H55A 3KRZA 3DOPA 2Y8KA 1OYCA 4PUJA 3F2BA 1EO7A 4G56A 2C1IA 4ASTA 5ABFA 3PPGA 1ZAIA 3O15A 1PTGA 2PC4A 4FIQA 1BXCA 2Y1HA 3U8GA 2ISVA 2VELA 3DC0A 4OBTA 5GNXA 1TA3B 2FHBA 1VB9A 3W1NA 1KFEA 1W1ZA 1XYMA 4E4FA 1ZBVA 3BAWA 2R82A 4NAEA 5D32A 3R89A 3GVWA 4JQ4A 4C6FA 2WQPA 3I4EA 3W6LA 1A47A 3AS2A 4Z2GA 4EACA 2JIWA 1G7VA 5K3VA 3PPCA 3WFAA 3REQB 1S46A 4FLRA 3T6CA 3W02A 2HPMA 1EIBA 3NXFA 1X8FA 2E1DA 3MI2A 2NLYA 4EXAA 3W7PA 3LENA 1LUCB 3HG4A 1R7AA 1POJA 1IWBA 3H4XA 1R0MA 4P7LA 1IEWA 3MHFA 1DJZA 4Z1AA 1FVPA 5FIPA 1R2TA 4FXSA 3VCNA 1UWIA 2ZBTA 1EL3A 2QF7A 1N82A 1XIHA 4CQCA 2FDMA 3N6JA 3S1GA 1RQHA 4E5TA 4J3SA 4LB3A 3SEPA 1C7TA 1W1PA 1A5SA 3B0XA 1UIPA 3OBKA 5FJOA 1GQNA 2XIJA 1UBPC 2E0PA 4TX6A 3LI0A 1LRQA 4H7CA 5FKYA 4Z2IA 4I9TA 1N8WA 4GPNA 3FKKA 4GIRA 3MZ2A 1Q8JA 4UCFA 1CB7B 1WKFA 1W1A1 1TVNA 3R0UA 1XRSA 3SJ3A 1MRAA 2C19A 2OELA 3AHVA 1YE6A 3V4BA 2NW0A 1LT8A 1S5VA 3SDOA 1Y5WA 3MP4A 2YW4A 2RDUA 2YYTA 4HOWA 1NF7A 3STFA 1MMFA 1PSCA 3SN1A 1BHGA 1T7LA 1E72M 1FUYA 2DORA 1QW7A 2V8ZA 4ZO6A 2DJLA 1KTCA 4I5RA 5CBBA 2PPGA 4MLRA 3WQVA 1JPIA 1HP4A 1E9YB 4DO4A 2VEKA 3FA4A 3MWAA 4ZOCA 3R79A 4FXFA 5HDRA 3WBXA 3MI6A 3JUGA 4EPKA 4C65A 5G2IA 3ITXA 3N12A 3TONA 4B16A 1WXYA 5EBAA 4K3ZA 4PUKA 1SZGA 3QGVA 2Z6JA 1Q6FA 2NUYA 2VFFA 4IIBA 3RCMA 3EMZA 1CEOA 3T07A 2QKFA 1WOAA 1VGAA 2GWGA 3WNNA 3WUEA 1TZ7A 3CH0A 2QMJA 3GG8A 5G1MA 2TMDA 4JTKA 4GC3A 4HPHA 3ITGA 2FB2A 1UUQA 3O6CA 4ZOAA 2PLMA 3T2PA 3DHDA 1ICQA 3APTA 4J27A 3H54A 3I10A 2QVNA 3B03A 5FJUA 3MBDA 2WPBA 3UR7A 3EX4A 1JQVA 1TIMA 3T0CA 4WXZA 2Z1KA 4V1YA 3PFMA 1HF6A 3UY7A 3GHUA 3EWDA 1V6VA 4GUIA 2J27A 3KFTA 4Z1BA 4MFDA 4ENLA 1VEOA 4QE5A 5DX7A 1GJWA 1CYGA 4Y9MA 3WLIA 1GWJA 2EG6A 1TG7A 4GQRA 1C8XA 1GYLA 3O05A 4H9ZA 3M47A 1P4CA 3PFRA 1G69A 4LUIA 2C16A 3G1FA 2DPEA 1W9PA 4O1DA 2Z1XA 1SU5A 1WDSA 1GOMA 1A5AA 1MO0A 4PA8A 3HU7A 4BQ3A 2NXGA 3SQLA 4XWUA 2WPGA 1QFEA 3L68A 3NQMA 4HJFA 1REQB 5D04C 3VDHA 2Z27A 2REQB 3KRSA 3R5EA 4LJ3A 3WSUA 2A1YA 3DH7A 2QS8A 3STPA 4GVFA 1W9DM 5RUBA 2GZXA 2D2OA 2FJUB 1CIUA 3NQDA 2XGIA 5AZ1A 4UNKA 1SZNA 1FTXA 3BAKA 3CEPA 1OK4A 1QHPA 4IQEA 3KTSA 3QOMA 4L80A 2PB1A 1S5NA 4RE0A 2H6RA 1EZWA 1HJQA 1WB0A 2EEXA 3F2DA 2HBVA 4J3TA 1LL4A 1W9UA 3P8IA 1THFD 1OM0A 5JVLA 3JR2A 2PWDA 1XC6A 2HQAA 1W5NA 5BXSA 3APGA 2YDRA 3WNKA 3S46A 1UA7A 3QKEA 1CBGA 1G4SA 4PMJA 2RAGA 5BOEA 5AC4A 3PULA 4A3RA 4EOUA 1BD0A 1DQXA 2QQ6A 4JNMA 3W7GA 3PZ9A 4HNOA 1EDGA 4LSBA 3FDKA 3OGSA 1ZENA 1Q63A 3PBGA 1XCWA 4FXRA 1EPVA 4NY2A 1HN1A 3VCRA 5MKGB 2VD8A 1H50A 2VC6A 3CYVA 4XAGA 3RCNA 4TX8A 5I3JA 4QBXA 3QR0A 4LY8A 1VIZA 3W1RA 4DBDA 1ISYA 1T40A 3F5JA 1YDVA 4GX8A 4LAMA 4RZBA 1XIIA 5GNYA 4R7OA 5K9DA 1NAL1 5AKQA 3F03K 3N2BA 4DXXA 1UR0A 4C1NB 1VENA 3N19B 1R86A 3CV2A 1E3ZA 4JICA 2Y8VA 5C2CA 4LUSA 3E2RA 3HG3A 4IG2A 4RUBA 3AIBA 3C61A 1KFLA 3ZYZA 2WSKA 1JUBA 4URIA 4S3DA 3EWCA 1YNPA 3PF3A 2OU4A 1Q4NX 1V0LA 1KQYA 3CL6A 3FV9A 2EXOA 2WHMA 1IR2A 1OGBA 3PUGA 1X7IA 1XQLA 4Q8MA 3LHUA 1SVDA 4X0VA 4O0ZA 4A8LA 2V3DA 3W85A 3ZO9A 3UPMA 3OG2A 2YGYA 2HE8A 4JN6A 3OIHA 3W84A 3LNMA 2VC7A 4ZOEA 5HWNA 2CLPA 2XINA 3MMUA 1FDJA 3KL3A 3DG7A 1W3HA 3QMSA 1EGVA 1FKWA 4B3KA 3OQEA 5EU9A 4ZZ9A 4RCXA 1FWJC 1NOFA 2HCVA 3SSJA 1Q2SA 4FIRA 2XVPA 3KOYA 1ZU8A 3APYA 4Q8PA 2OOGA 3P67A 1RCXB 1T96A 5U7SA 1RY8A 3CUJA 2JBMA 1ELSA 3K8LA 3TW6A 2BY1A 3NSXA 3WBAA 3KDOA 2EAWA 3EPOA 2A7PA 2QDHA 1JPMA 1V7YA 1K03A 4NJGA 1JULA 1XWYA 3MO7A 4MPKA 3CZKA 3VMNA 3E0FA 2WZTA 3SM0A 4UCGA 4GLEA 3OZOA 2NLIA 1W1VA 3IJQA 1NDZA 4QITA 4ML4A 3RLGA 4ICMA 4MDPA 3T2QA 4FI4A 3LXBA 4PUEA 5JH2A 5TAOA 2QW5A 3G1VA 4QROA 4KQNA 4S3FA 2CXEA 4IGNA 2XN0A 3GFZA 3RM8A 5AHFA 3U9IA 3VVGA 5I0DA 3CUIA 1DJIA 5CZSA 3R94A 3NGFA 3SJNA 1PIIA 3SO7A 3A9BA 4X9YA 3CTLA 3NL5A 3MJYA 2J7GA 1UD3A 2BVYA 2X0HA 2BZNA 3AMGA 3GG1A 3E2SA 3C2YA 3F5KA 4I90A 3STEA 3L0NA 3WLSA 1MVYA 3LSCA 1R9XA 1Q6RA 2XVLA 2V3FA 3DXIA 5DBTA 1V3HA 1GEQA 2QJIA 3CUGA 4Z0JA 2F2KA 1XQKA 3DBNA 3GH4A 3N34A 1NJJA 1L6YA 5HULA 3OQ8A 4EPDC 2F38A 5LIYX 1IV8A 3UXKA 3ZXWA 3IACA 3QZ6A 3UY8A 1UQZA 5AVNA 2D2HA 1DORA 2C3ZA 1W5OA 5AYXA 1J10A 3O1NA 4J7RA 3L4YA 3M5ZA 3NQGA 4QJ3B 5FF3A 3VNIA 4HCHA 4QDPA 5AC8A 2WVVB 2F8QA 2TSYA 1YXDA 4UFMA 4MB1A 1W17A 4N9EA 2GGIA 1FWTA 3SZ8A 3XINA 4OVXA 3LY0A 5LGZA 3ONCA 4KCTA 1RQBA 4JQ1A 4LC8A 1JUKA 4OE7A 4C6KA 3FA3A 1VAHA 1UJPA 3QYQA 2HDJA 3KZPA 1W32A 3GVGA 4EF8A 4IIDA 3XIMA 5HXMA 3W7LA 1PE1A 1US2A 4UOQA 3VNZA 4A8IA 3P7YA 1J96A 3CEUA 1SPQA 3CQHA 2DU2A 4NYYA 3PPHA 4C6CA 4H9YA 4LUTB 1KRMA 1E0TA 4JYEA 4XO6A 3UPWA 4RNIA 2PURA 1G7UA 3G0SA 3WEOA 3M6DA 3VGGA 3G1DA 1X98A 1QNSA 3OHMB 3O6AA 4XSMA 4Y90A 2P5NA 3BG9A 4FLQA 4WGXA 4M24A 2W0UA 3WY1A 1NIUA 5A2CA 1BWKA 2HTMA 3GUGA 1SW7A 5JMUA 3O7UA 2GQ3A 4F0SA 3SSZA 4DWDA 3I6EA 4AUBA 4XD6A 1VYPX 2O7QA 4UTWA 4KWVA 1K3UA 3OLIA 4UTMA 1C92A 3ZT7A 2A6LA 3CT2A 4GABA 4UTIA 2Y4SA 3DI0A 4OIFA 3P2VA 1KGWA 3ARXA 5DXYA 1ODUA 3TU9A 1Z32X 1VJZA 1J0IA 5LHFA 1EJWC 3QZEA 4B9YA 1SR0A 3CUHA 1EF2A 2FGLA 1C9DA 2R8WA 5BWAA 1G5AA 2VYOA 4PODA 3UJ2A 3VZXA 4CQ8A 1K8CA 2XFRA 3NDZA 5KITA 1XRFA 2NT0A 1EIXA 2ZUSA 3ITTA 4F0MA 3NQ2A 3RLHA 3OJGA 1UR2A 2NQZA 2IPJA 3GTNA 3GDRA 1ISZA 3GH5A 4JY9A 2OYKA 3KWXA 3HG5A 2D0HA 1RCQA 3WH6A 4Q7NA 5LA0A 1QOQA 4IMDA 3T0TA 4OHQA 1DBTA 1L6SA 2G8ZA 4N02A 3PZGA 1X1OA 3G5EA 2J8GA 2F61A 3TN6A 5JBEA 4HJWA 2VFIA 2BVDA 2RKXA 4E0CA 1A5UA 3VGDA 4S2BA 3G3MA 4PTVA 5D05A 3VKKA 3QW4B 2Y70A 3DAQA 4OBRA 3W3OA 1R3VA 3SCQA 2CITA 2WOQA 3P0WA 3M0LA 2W9MA 1IZJA 2D0FA 1PVNA 1OIMA 3I65A 2PFHA 4N4QA 3AS0A 1R30A 3TYZA 3GNNA 4F2UA 1DTNA 1T0OA 1Q7ZA 4AEEA 1C90A 4YCOA 3WFZA 4S23A 2CPUA 1V4YA 2HROA 4GCXA 6CGTA 2A4AA 3STGA 1OT2A 4MAZA 3B40A 1M7PA 1ZPTA 4GY7A 4QQUA 4LB4A 3MYPA 4NZJA 3CZEA 2ZIDA 3CIXA 1V0KA 3VZYA 3HOJA 2ACQA 4ZXLA 1E4MM 2Z7GA 5FAJA 5CLTA 1Q85A 5GQBA 3DERA 4M82A 1JL8A 3UXLA 2CLHA 2J8FA 3W70A 4PL1A 4JX5A 4QSFA 1TMQA 5EKYA 3CBWA 3S6TA 2BV9A 2VGBA 1NFBA 1Q6QA 3HGOA 2W79A 1NU5A 3BDKA 1AW5A 1H62A 3BE7A 4G9PA 5KINA 4RK8A 5BNKA 4J2PA 3IIOA 2CC0A 1I2RA 1JFHA 1GTEA 3IVTA 1ADOA 1YHTA 2NXIA 4JTRA 4NAFB 3DFQA 3PUOA 2EPKX 5CQ1A 2QVHA 4DNHA 3NDOA 4U5IA 2AMXA 5A6LA 1WUFA 3K8MA 1TV8A 3I7RA 5M17A 4I6KA 2WJFA 1NH6A 1XFCA 2DIJA 3IAQA 1HG3A 1I2PA 1H63A 4DJFD 2I9UA 1ONRA 2YX0A 5I77A 3CWNA 3A4AA 3I3EA 4FALA 3H2FA 3AXXA 4WR3A 5FA5A 5DMMA 3SGUA 1H1NA 1N8IA 5LNRA 2CLMA 2VMFA 5ABHA 3FXGA 3HF3A 1LQAA 4HNNA 3W01A 3VOGA 2V5JA 3O07A 4E2DA 2FDSA 3CU2A 4RZ5A 2ISWA 3BUVA 3NQEA 4JIIX 5F1UA 3VGBA 4W7WA 2WANA 1SJAA 2QPXA 3VPLA 4HQVA 2WJZA 1W37A 5CC7A 1HJSA 4K8EA 1EKOA 4ES4A 3OVRA 1NOWA 2OCZA 2D2GA 3EB4A 1QNPA 5CAKA 2EJAA 1ME8A 1YRRA 3H6OA 1PZ0A 3QVQA 1MQPA 3EGJA 3RPTA 3QHMA 3IJ9A 3SCTA 5F4XA 4WX2A 3AISA 2R9RA 1S39A 5E09A 3W1LA 2QF8A 1EWEA 2XU2A 5K9CA 4MSSA 1W56A 4DYKA 1LG2A 4OV9A 3L4TA 2ZUWA 4JTTA 5HINA 2Z4GA 3WQWA 3W7QA 3CL7A 1O7AA 3F4DA 2E9BA 1P1MA 3BOFA 1TREA 1VJSA 1Y7VA 2Z2BA 2PDFA 4JIPA 2VENA 3M0KA 1IXNA 4GA8A 4HIBA 3K4DA 1FP8A 7CGTA 3KTXA 2FZMA 3NZRA 4A29A 2GJPA 3CHFA 4GNKB 2V81A 1XDJA 4MJZA 1NP2A 2WC3A 4OZOA 1JVNA 1Q66A 4GO8A 1CGTA 1E9ZB 3QQ0A 4LS0A 3VCCA 3KLLA 1FCUA 3R8GA 1Z89A 2JEPA 1BF6A 1V77A 4NZCA 1FWNA 2DUZA 2OODA 3E6EA 1M68A 3A5FA 4FOJA 4RKAA 1CX9A 4QG6A 3QMRA 4QAWA 2NVDA 4I5XA 3C8FA 3QFWA 1PL9A 4M56A 4TV6A 4YIWA 3QY8A 2BB0A 3K5XA 3LPPA 3ZJKA 1Q65A 5HNTA 3BZGA 3VIFA 2ZFAA 3QQWA 2G0WA 3WDRA 1XGEA 1W3IA 2JKEA 3V7PA 4RL3A 1R3TA 1XS2A 4OQVA 2CYGA 1IHIA 4MY8A 2POTA 1UROA 3DU0A 1J18A 5A8GA 3OA3A 2XIQA 1EQPA 4DI9A 1OFDA 3RGTA 3VIJA 1KKRA 2VGIA 1H11A 1JYNA 3LCXA 4CQDA 2AMGA 4W7VA 5I00A 3RR1A 2OSWA 2PGFA 4IP7A 1XJBA 4JTLA 2DZWA 4UTFA 1AH4A 2FHCA 1E0UA 1JGMA 1U1JA 1QI2A 5I02A 1H1YA 1B3OA 2ZX7A 3DYMA 5BOOA 4IJBA 4XVDA 3GVQA 4AIBA 3URNA 2CBJA 6A3HA 1XLEA 2WC7A 1LOSA 2E40A 4QTGA 1A80A 3WUGA 2BWGA 4ERIA 1CXHA 3R12A 3ARTA 3GAYA 3TQVA 2A7RA 3P3BA 2CHRA 2DT3A 3UQNA 2CETA 1P7TB 2CKSA 3N2MA 3U7BA 5BU9A 3G18A 4PN2A 1XYFA 3AJ7A 5HOSA 1MEIA 2E28A 1EXBA 5DRCA 2CWXA 3BAIA 5HUPA 1HX0A 1R9YA 3E0WA 4UTLA 3CAQA 3H21A 4L65A 5DLCA 1M03A 1LG1A 5A6TC 1VPXA 3L2MA 4O10A 3BLOA 1MZHA 1TTQA 1ME7A 4DLMA 3GNXA 3WQCA 1OCJA 1SJCA 4NZFA 3N29A 1NSJA 2BTMA 2GLKA 1ZJHA 4KESA 5EBUA 1QNQA 2I57A 3PZOA 4WSKA 1H49A 2BY2A 2P3EA 2QGYA 3BMXA 5J5DA 1UWTA 3GXPA 3GDBA 2OWXA 1RHCA 3OBEA 1V6UA 1ZP4A 3M5VA 3W2KA 3QN3A 1M41A 3WF1A 4WGHA 2WAGA 4LBSA 3WQDA 2GFTA 1OEPA 3C5QA 3TFXA 3UVAA 5I5RA 5BXPA 3EB2A 4HK5A 2DV0A 2DSKA 3C2RA 3HQOA 3CO4A 4D8LA 5I3KA 1TPEA 4FO4A 3WQEA 4IMGA 4DZIA 3QLLA 2HK1A 3UGRA 1E55A 1XKJA 2C71A 4O50A 4B2DA 3F7JA 3D3FA 1DQWA 1N55A 5CGTA 3JU2A 4UC5A 2NX1A 5TIMA 4IUOA 2QJMA 4E6MA 3CZLA 3UYCA 1P6WA 4K7YA 2NWSA 3UJEA 3WH7A 3NO1A 5I07A 1A5NC 3UZZA 7REQB 3A13A 5C2XA 1EX1A 1IZKA 1DEDA 2P8CA 3H2NA 3V1PA 3G0UA 4H9VA 4P8WA 3ZJ7A 4IGSA 4WUIA 3S5YA 2WNZA 1TPFA 4PRTA 3VIMA 3OZYA 1I60A 3AMDA 1EDTA 4W9TA 1U1HA 1OFQA 4Y9AA 3IANA 1O5RA 1V0NA 4C1LA 2Q01A 3LGEA 4UTTA 2FTPA 3HIJA 4CVUA 3ZLHA 4IIHA 2XH2A 4QCEA 4JKKA 5D33A 4AWUA 1B3WA 2J88A 5MHBA 5B80A 4GI9A 4O1EA 1E9IA 1LDCA 2VZTA 4MKSA 2R24A 3POCA 1JCYA 2R1LA 3ATYA 4YJ5A 4Y9PA 3TW7A 3BC9A 3SUVA 1OB0A 3VD7A 3W81A 1WDQA 1WV2A 1S2VA 1RVKA 3BH4A 1G4PA 3SRKA 4H6KA 3CLWA 3DUGA 4P7RA 1QPQA 1R38A 1NFGA 3O0FA 3GD6A 3UJRA 1KRCC 4AD4A 3Q58A 4Y6GA 1UP2A 4FZIA 1P0NA 3NEVA 1SM9A 3BV7A 1XLAA 3OHIA 3THCA 3SI9A 1H7NA 4R53A 4O28A 3EKGA 5CPTA 1KO0A 4HA4A 1TUXA 2ATSA 4N0RA 1ODZA 1E70M 3WJSA 4H9MA 1J0JA 1HTIA 5A1AA 4NU7A 2PDYA 3C0JA 4WOZA 1D3CA 2PGRA 3G8RA 1CW2A 2VNCA 3B8SA 3WJXA 3R43A 4S38A 3DC8A 4GMEA 3CTTA 3RXZA 4O0KA 4D6CA 2ZRWA 3E2VA 3LI1A 3PJWA 1P0KA 5EPDA 4YWIA 4QJ5B 1UC4A 6REQB 1WO2A 5J5RA 4G2DA 2H8ZA 2XIBA 2CNCA 4M1RA 4AHQA 3UR8A 4HK6A 5HATA 1E5JA 3LTSA 3GNRA 3LCLA 1GCYA 3QTPA 3A4WA 2J79A 1MXGA 1WZLA 2AQVA 2W67A 5H6HA 2VEPA 1KFJA 2NWRA 2G37A 3VFCA 1XBZA 1TV2A 4Q4OA 4OBSA 2O9TA 1PTAA 4BA0A 4PMZA 4HN8A 2VFGA 2WB5A 1RLDA 3KS5A 3ZWSA 2X8RA 3AIRA 1GVYA 3AWNA 4FX7A 1S1RA 2KAUC 4ROQA 2ZZ2A 4MJMA 1K4GA 5CPNA 3MTWA 2AGTA 3HURA 4GIAA 5K9XA 2VTFA 1A49A 3SCPA 3WQPA 2GDVA 2YYUA 1F6PA 4G7EA 4PTNA 3AYVA 1B57A 2A0NA 5LZLA 2PDBA 1L2UA 2ONEA 2VOTA 3P60A 1Q5MA 5F1VA 5KZEA 3BLEA 4GRSA 1KCLA 2NZLA 4J3UA 4CNPA 4JHOA 1XLBA 3T0DA 3FLUA 1B3XA 1OWQA 4YVPA 3T08A 1I1WA 3IRDA 3T40A 3FDGA 2EHHA 3GU2A 4L1XA 4KRZA 3EDKA 3WBWA 1XCXA 5XINA 2OSYA 4MWAD 5CPLA 4BQ4A 4WSHA 2ON3A 4U3AA 3PBUA 1KBBA 1X1ZA 4EK7A 1S5TA 3GTHA 4HB7A 1E1FA 3IPWA 5E9AA 2QPUA 2PDLA 1HJUA 2Z26A 3ABXA 2ZZ1A 3CIVA 1GVEA 1M7XA 4HNTA 1C7SA 1JI1A 2Z1SA 1Z7AA 2G41A 3RJXA 3GUWA 4H8NA 3SRHA 4CD5A 4MKNA 5A5WA 4PEEA 4K1GA 4S39A 1RZMA 1TR1A 2E7FA 2OT0A 3HPZA 4DF2A 5CPQA 3KHDA 3L5AA 3S1VA 3OIXA 2J25A 2J47A 2CZVA 2WCGA 1W3NA 3LBMA 4UQEA 3T4WA 2UWFA 1V6YA 3CZJA 3U2OA 2R1NA 5E9XA 4XTIA 3RX4A 4EP8C 2J66A 5IDIA 4NJHA 1OADA 1GVSA 5LA2A 3N4FA 2Q8LA 3FW6A 2ACRA 3E12A 2G4FA 3OVGA 1OABA 4YPJA 5M3WA 2BGQA 4WY0B 5AYYA 3BLLA 2DIEA 4K7VA 4WY0F 3U2EA 3W1AA 2DSWA 1XR2A 3BANA 1GVRA 4AD3A 4FEZA 3SQMA 3F1QA 3HPAA 3IK4A 3N14A 3VE7A 4PB5A 4GIEA 4ATWA 1T5AA 5E5CA 3OVPA 4QCFA 1WBHA 5BU6A 1FWFC 1QNVA 3DI1A 2V63A 1GKRA 1Z8AA 1HGWA 3W9ZA 3MVIA 2ZKMX 1EJVC 1DIEA 3GXIA 3KVLA 1EGZA 4V28A 1H61A 1NQ6A 1K02A 4HNLA 2ZC8A 4HT3A 5BROA 1Z44A 3IIXA 4GUHA 1IWPA 1RLCL 1DJHA 2QLYA 4FLSA 1RA5A 5I6SA 2F6KA 2BY3A 3ENLA 3B8WA 3Q2DA 5C0QA 1K4HA 1LF1A 4H83A 4BWLA 1LJYA 3S2CA 3CB8A 1YBQB 3GBDA 3HPSA 3TMQA 2PDMA 3BW4A 2ZUVA 4PCNA 1Q8AA 4R9OA 4C6PA 1EP2A 3IRSA 3U7VA 3S1XA 1DIKA 4XO7A 1GOOA 2GVLA 1OYBA 4D6FA 4ZO7A 4A21A 4O0QA 1Q6EA 2P0IA 1KTBA 1ISVA 4H8VA 2FKPA 2DP3A 1UH3A 3UXIA 3MKKA 1VZWA 4LXFA 3VNJA 1NFPA 1VCGA 5KEZA 1JAKA 4MB4A 1NEYA 4O17A 5GNZA 1F05A 3PWGA 2AOSA 4KH2A 4NNBA 3N4EA 5A69A 2VCBA 4JN7A 2AL2A 3QKZA 2ASHA 4JTQA 3EAUA 4IJCA 3OOQA 5C71A 3SQSA 1ZS2A 2HE5A 1GPWA 1EX5A 5ECVA 3EOSA 4Y9OA 5A6JA 4GD0A 3MANA 8TIMA 3QR1A 1GOIA 2X41A 3WKZA 3AIUA 1UJQA 3ZJ6A 2YL8A 1MXDA 1AH0A 3KBVA 4MWAE 3HJEA 5I7GA 7TAAA 2GOKA 3R25A 3KRUA 4U4MA 1CNVA 4DNMA 1SSGA 5AY7A 1ZB5A 3R1ZA 1UKPA 3QGKC 3LMYA 1SFTA 3UG3A 1GUVA 4U28A 5HNNA 2A7NA 3WLJA 3KWSA 4CU6A 2VZVA 3GLCA 3AOFA 4G1NA 1KBJA 3VNMA 1FFRA 1OF6A 3EX1A 4ZODA 5FF7A 3UNTA 1JJKA 4PBFA 3DX5A 4HHHA 2P8BA 3GR4A 4NXKA 3C3NA 4KW2A 5T9BG 5EMLA 1NTHA 3AROA 3TFCA 1FCBA 2ZA2A 4R5EA 5JQ9A 1PZ1A 3T1GA 2DSVA 2E67A 1WX0A 2D22A 1OC6A 1Y0EA 3VKAA 3PHAA 2XIOA 3VIKA 1WPCA 3EX2A 4ZEPA 3CUFA 1F07A 3INPA 3L4ZA 1QDSA 3LPFA 2EPHA 1BVNP 4XUYA 4HPNA 3GNOA 5D03A 5HJLA 5G4EA 4JTEA 1T6MA 3ZSSA 5KETA 1NY1A 2UY3A 5HWJA 1B4EA 2DZUA 4L6OA 2WMIB 3L2LA 4AZIA 3I7QA 4HSHA 4HOXA 2D1ZA 4WKFA 2VX4A 4I6VA 1QBAA 5LIKX 2PWEA 3EDDA 2DZXA 1ZFJA 5HMEA 4AXNA 1LWJA 3VGEA 1UD8A 1EJ7L 3QPEA 4MNLA 2Y0FA 3CPGA 4R9XA 3WQFA 5D2YA 5CZTA 4M7TA 2A5HA 2Z2AA 3HBLA 3MSYA 3TA9A 1G4TA 5C9XA 3KM8A 2QCCA 3LHZA 1YPIA 5FAGA 3BXWA 5D30A 4EKJA 2ZCGA 1G1YA 4WLCA 4X0NA 3HMJG 2VM8A 4ZSTA 3UA3A 1GG1A 2I5IA 2PGEA 3UW6A 4JIEA 1FWRA 4O16A 4O8AA 1S38A 4DVOA 1BKSA 1LBFA 3TNBA 2WKLA 3EWWA 1YDYA 4F9JA 4ICCX 3VZZA 1VCVA 2VXNA 4V33A 3L5LA 4A3UA 4ZB0A 1DJYA 3LMZA 3S2JA 3RRXA 4W8BA 1Z9AA 2ZZ3A 4MWAB 2OX4A 1TCDA 4PRRA 4B3LA 3VD9A 1KW1A 4B91A 1OX6A 4IGHA 3S0CA 3UETA 1K1DA 2RJGA 3I6RA 3QFEA 1E1EA 3ZLGA 3CWOX 1UR3M 3WDIA 4PE8A 4MJ2A 4TTGA 4B15A 4TR9A 3LYEA 4ZA0A 1T99A 1OF8A 1RQEA 3K8KA 4QS5A 4GUGA 4ADTA 1R6WA 2EKCA 4JBRA 5E70A 4ILSA 4MFEA 3R6IA 4GIYA 5JH1A 1EUNA 3TXVA 3NVDA 1YE4A 3VD5A 3ITOA 2YL5A 2YJQA 4C6EA 4J9JA 1BPLB 4UWMA 3TCSA 3B9OA 4O19A 4BEQA 5I3FA 4ZFCA 1K6WA 4AD2A 1I1XA 1S2CA 2DH2A 3TH6A 3FN9A 3W7CA 3NL2A 2VGGA 1FH9A 2X16A 1PTDA 3CQKA 4Q8WA 1WUEA 3DFYA 1W8SA 2CZEA 1E6SM 5LNWA 1ZNNA 1IIHA 1JYXA 3FEQA 2PCQA 1ICSA 3T7VA 5EMMA 4D6DA 3QSRA 1QTWA 4TTUA 4ZQRA 3SY8A 1JDEA 3WH8A 4WOQA 4AHPA 1XD1A 4IPPA 4EPBC 4CD8A 4OOZA 4JFWA 4MB5A 1QW8A 3L0GA 1P6CA 3G1XA 3R13A 1KB3A 1IEIA 4Z08A 5IDZA 4IPIA 1C3FA 3C2FA 4US5A 4CN1A 1CXLA 1YTEA 4IZGA 1UIOA 1MDRA 4DQWA 2WLYA 1K9DA 3WH5A 1IQ8A 5AHEA 4BQ5A 4XZWA 2GGGA 3SCNA 4GNVA 4L64A 3NZPA 1GYMA 1XD0A 1D3HA 1EC7A 1FCVA 3H26A 3HQ1A 3BLFA 3W28A 4AIEA 2XFFA 4ECLA 5KZMA 1GG0A 4A8RA 1GPFA 3OGRA 5CG7A 3TJXA 5FOOA 1BTMA 1IT7A 1W1B1 2ZXQA 4EANA 1MW2A 1NELA 4Z1YA 5CZ0A 1KBIA 3EA3A 1PKYA 1UR4A 1KGXA 2EPNA 2DVTA 3TTOA 4W84A 1FX6A 3W00A 2YCLA 2XM2A 2ZDRA 4L1GA 5G4WA 2FYMA 2XFYA 3MT1A 1C29A 3TIMA 4AZGA 1ML1A 3A64A 1MUWA 4XB3A 3KX6A 3QW3A 7TIMA 3CIWA 3NYDA 4M8UA 3W71A 3WNPA 2ZRYA 3SFKA 3RIKA 2J13A 3AHXA 2PEVA 1LWHA 3WENA 5FESA 2V2CA 3SGGA 3CK5A 3E74A 1X6UA 2GSHA 3UGVA 5C54A 1AK5A 4QP0A 1XH2A 1TE6A 3H7RA 4WK9A 2JFEX 5A6BA 2WZMA 2ZXAA 5A8OA 4W85A 1M7JA 4LY4A 1DXFA 4DBUA 2WWCA 2PDUA 4P8XA 4HZ6A 8CGTA 3MKVA 1HJXA 1EHNA 1HIZA 1JGIA 2HNEA 3FJNA 3UBPC 5E6ZA 3BJSA 3IV8A 1XXXA 3DHFA 1E4NA 2WMKA 3DCPA 4G5DA 2RH9A 4ICNA 1JCMP 4UTKA 3ES7A 1LRTA 4P8VA 4AB4A 1FWSA 4GBDA 2QAFA 5CC6A 2VD9A 2QMKA 2DUAA 3G3DA 4B90A 3BARA 3W7EA 5D2TA 2XZ7A 3PTDA 3F4VA 5DELA 3SCSA 3NL3A 4IIFA 4GJJA 2TRSA 2ZTJA 4O8RA 3LG3A 1JRCA 4Q8TA 1NDYA 3O6DA 3TR9A 3PTQA 6XIMA 1P5BA 5AYIA 3GG0A 1AG1O 3N73A 1GKPA 1VPQA 4IPJA 2GL5A 1J0KA 1BKHA 3AZSA 4CNSA 1GOWA 4MAVA 1E0WA 2YBTA 3UWEA 4HBKA 4KEZA 4DXVA 2E6AA 4PR4A 4DX3A 2VVNA 1V93A 3CGTA 1TJ1A 5IXEA 2XSAA 4FPSA 3V0TA 2CWNA 4WKAA 2BMBA 2VRQA 5JIPA 1TWDA 1EO5A 3UERA 4N6EA 1V6XA 2FGBA 3SCRA 3A47A 4LAZA 2CHOA 4KERA 2CCRA 3K13A 1WNOA 3FJ6A 1EP3A 3IS4A 2EF9A 4PMYA 4BHYA 4Q6JA 4JIHA 3A24A 4K8GA 1BYDA 3QLDA 4U31A 4LF2A 1BYBA 2G3NA 1BQCA 1RPKA 3QHNA 1XLGA 2PA6A 1KXVA 4D6GA 4ZOBA 2ZVRA 4CQBA 1VBRA 1WAUA 3MCMA 3NQ8A 3P8JA 4KFPA 4JQ2A 1H7XA 3PP7A 4TMCA 3FAWA 3NNTA 5C7VA 5I03A 4LVDA 4LV9A 4PTXA 4LVAA 4NJIA 2GJRA 3IJIA 1JYWA 1E6ZA 3QOKA 4RLIA 3WDPP 1XFBA 3NEHA 1X38A 3VOCA 5ABFB 4NASA 2JKPA 2VC9A 4PTMA 3ZVHA 2VEMA 3L65A 3V5OA 1UWAA 3RN6A 1PDYA 2UY5A 3LSBA 1KBLA 2E5DA 2QIIA 1QPOA 4AVNA 3CO8A 1TIWA 4A4AA 4GBUA 1SFLA 4IX2A 1VHNA 3G0XA 4DZHA 3TMLA 5BRQA 1AA1B 1JRBA 2ZZ5A 4GYJA 4S3GA 4NAEB 5C70A 3HGJA 1SSDA 3R2GA 1XIMA 3F5LA 3M0ZA 2TODA 2NX3A 2PZ0A 3VMPA 1FFQA 1QK2A 4L9XA 1I0BA 5EMJA 1GHRA 2Y5EA 4WVXA 3ATZA 3SY1A 1HT6A 2EPMX 3VNYA 4GUFA 3OEXA 1W3JA 3R0DA 4GJIA 4JCMA 4X2RA 1EQCA 1QRQA 3UWYA 2PLJA 4ATLA 4F40A 2QGHA 3D0CA 3QXBA 4ORIA 2WNWA 4QG9A 1DWGM 4IFOA 4OFCA 4XZMX 3AZRA 1E1CB 1R3QA 1Y65A 3HPXA 1A3XA 4PUMA 5I23A 2OGYA 4FMVA 4C5YA 3PUEA 4BQ2A 5CJ5A 1KFWA 4ZE5A 2DZSA 4ZXOA 1Y8BA 3WQ4A 5DMNA 2ZVIA 4UTJA 2VFDA 1S1PA 2XJ7A 2OR2A 4RNHA 3GG7A 3S9IA 2PLCA 3UPBA 5BXTA 3NGJA 3AQUA 1DE5A 3HPFA 5DO8A 1GGOA 4HSNA 4MGGA 1WE5A 2ZZ6A 4YNGA 1EP1A 1SFJA 4EAMA 3H8AA 4AZ7A 3HQNA 3TXZA 4GYFA 1KM6A 2IQDA 3MSRA 4I8DA 3UZ5A 4QISA 3FS2A 5REQA 3EEGA 5D38A 1PYMA 4UB9A 1TJPA 2NQHA 3PS7A 2WQDA 3OPSA 5A94A 2SFPA 2NT1A 4DUOA 3DESA 3C56A 3H2AA 4BI7A 4DUXA 3LXAA 1O5XA 4UFKA 4FP1A 4XD3A 3TCEA 1KCKA 3U4AA 2NUWA 3VDAA 3VIHA 1XP3A 4BF7A 2GK1B 3NQBA 1WXZA 2VVSA 3WF3A 2J7CA 4IT1A 3W1TA 4D8AA 3UZWA 4K37A 3AC0A 4AYGA 4F9DA 3GHRA 1VFFA 2Q3OA 3B9AA 3ITYA 5CCZA 1JZ7A 2VWTA 4XSLA 4NXSA 4AY1A 3Q37A 1XUZA 1JCNA 2E6DA 3R0KA 1OY0A 1ITXA 1UD6A 2A3BA 3SIMA 2NV1A 4TO8A 1VIWA 2E1WA 1WQ5A 4CCZA 2PBGA 4YS1A 5BMXA 3Q67A 1VJIA 3IJLA 1M9HA 3P74A 3TC3A 2NV2A 3KVJA 1E6RA 5EMUA 2Z1VA 4M5PA 3P6LA 3KEHA 4GQGA 3OZPA 4AX6A 3PZVA 3TC6A 4PCSA 3GTIA 3VIIA 3TE9A 3KS6A 1PXGA 1XRTA 1OG0A 1ZP3A 3EYPA 1NWRA 4RDYA 4Q22A 4N6FA 3AHTA 4PH6A 4NHVA 4NF7A 4C6JA 1H5YA 3TKFA 3GXMA 4U10A 1J2BA 1GVOA 1J0YA 2GVGA 3TNOA 3TQPA 3N15A 3THAA 3DGRA 4IQDA 4LF1A 2QCLA 3WK3A 2OFJA 1OJXA 4MZYA 2Y7DA 2CFFA 2OLHA 3A23A 2NXHA 2JGQA 3WELA 1RJRA 3BLDA 4BR1A 5L9FA 4NJJA 4C6OA 1KLYA 3CQIA 3NQCA 2BS9A 4NRRA 4PTDA 1D2KA 5AECA 4A3QA 1YXCA 3O8AA 2ZRUA 2GUUA 3S5OA 4H8UA 2WCAA 1XX1A 1O94A 4CEXC 1C93A 4DY1A 4E3TA 4KEVA 2QJNA 3BCDA 4YN5A 4PSRA 4JN8A 3U6WA 4ZVJA 1PYFA 2PRMA 1P6BA 3EWBX 5FSDC 1JF6A 3GE7A 4DM2A 5G2WA 3QRHA 3SADA 4F2BA 4DLFA 1PIFA 3NPXA 2ISFA 4JFSA 4BI5A 1F74A 2INZA 2WCSA 1XYAA 4V27A 4GFIA 3SCUA 4AY8A 1UR9A 1MQQA 4R27A 3IIZA 1HKIA 1C91A 1J0ZA 4GE8A 3ZT5A 3WMSA 3UJSA 1NWTA 2PC8A 2C14A 3R11A 3U5UA 2VC5A 4M19A 1F4AA 4O18A 4US6A 5ECUA 4QIUA 2CHNA 4WSJA 4W4QA 2QCHA 2XH4A 2VKZG 2OKOA 3GSMA 4ROPA 1EJXC 4XTDA 2B81A 3FEMA 5IBXA 1EH9A 3W82A 4DO6A 3P62A 1JDCA 4GK8A 3UESA 4KRUA 1RD6A 5CH9A 3W1QA 4QR6A 5ENLA 4QE1A 5DQPA 1OINA 2IKHA 4J5NA 1PAMA 3LPGA 3W87A 4X61A 2DT2A 4B5SA 2OX1A 4EIVA 1TELA 1DWJM 2VR2A 1OFAA 4LUSB 4KRTA 4HCDA 2HZGA 2YB4A 1KCXA 3LOTA 4PZVA 5DY2A 4IG2B 3ANYA 2XGBA 1M3UA 3K4AA 2BODX 3WQ6A 4DBSA 2HVOA 1T8XA 2OEJA 5D37A 1VLIA 1Q6DA 1G67A 2QJJA 3WDQA 5C2GA 1OGSA 4WQ6A 3W86A 4LAOA 4IOTA 2RDXA 4JR5A 5AHMA 4Q32A 1OSEA 1QPNA 5A2AA 1U22A 3EX6A 2ZWZA 4D8ZA 4UXDA 4Z2LA 2DUXA 3UVIA 4YL2A 2ATMA 3RDKA 2L5HA 3NIYA 4NG3A 4XD5A 2E5BA 4CEUC 1KFCA 4AW7A 4YVVA 2C0AA 4XUGA 5FACA 1XLLA 2X0SA 4N9CA 4QGCA 2NVCA 4XKYA 4AFYA 4GNJA 3M4HA 3WN6A 1AL7A 3MUIA 3GBEA 4I7VA 1XIGA 2G3IA 3BQ5A 1XF0A 1LOLA 4HTBA 3RCYA 3ALFA 3P61A 3NZQA 1UD5A 1HO4A 2OZ8A 3SN4A 3M0XA 2R6OA 1Z6KA 4DELA 2A2IA 1SMAA 1O5KA 1EJTC 1IEQA 1CENA 1YADA 2OVLA 4HOZA 2NQ5A 5HR7A 3STCA 4UOJA 2D24A 2HJPA 1TTJA 2VFEA 2DIKA 4LYPA 3TQKA 1E1CA 2BOFX 4FAMA 2RJHA 3L5MA 1JG9A 3B8IA 3MUY1 1K9FA 2ABBA 1JZ6A 3S1WA 1AODA 1IGWA 3K2GA 1LTDA 2RHGA 5DF0A 4TVCA 3TAKA 1UBSA 3TYCA 5H8MA 1ITQA 1L6WA 2HBXA 2HVMA 1SJDA 1BWLA 3PZUA 4P8UA 2J7EA 3N17A 3BCFA 1H09A 3BLKA 3DENA 1J93A 3CMGA 2CERA 3M5XA 1P48A 4J28A 4BJHA 1MNZA 3G8EA 3TW9A 1IE7C 4PEKA 3MWCA 3LEPA 1RV8A 1F76A 1GORA 9XIMA 1B9BA 3EB3A 4DYEA 1GW9A 1CT5A 5BOFA 2QDGA 4MY9A 2DVXA 4KMQA 1XYCA 3TOPA 2HWGA 1TVPA 3MHUA 1MW0A 3EOEA 1KWGA 3CQJA 2Y62A 2X1IA 4C60A 3I68A 1E73M 1LBMA 1XIEA 3KP1A 2OB3A 2GK1A 3CLMA 3PZIA 4HYWA 5CJMA 3VUSA 1IF2A 1R87A 2W91A 5FJRA 1E6PA 3LCHA 2WZIA 5AB3A 4MG4A 3MVTA 4N4PA 2Z6IA 4PMVA 1NOUA 2FGZA 4CD4A 4ZQMA 3KRBA 3RLUA 4JX4A 3PSWA 3A3HA 3DFSA 4MTVA 3M0HA 4I7WA 4R85A 4UFJA 1LOQA 1MRQA 3TTSA 1I0DA 4DJDD 2PP1A 2ZRZA 3E0LA 4S3JA 4FS9A 1OX5A 1X97A 1H7WA 3ARVA 3N18A 1DJQA 3CAKA 1B4KA 4YYFA 3NO5A 2NV9A 3B97A 3WD0A 4HPGA 1SO3A 1YKWA 3AIVA 3SIZA 1V03A 4GGHA 4RPQA 1VQTA 3WLHA 4IXHA 1QI3A 4W7UA 1WDDA 3PBVA 4REQA 1U30A 1MFUA 1POKA 2OWWA 1YIXA 4GZEA 4YU1A 1UB3A 3DYPA 4XV0A 3EXRA 1WZKA 1JUEA 3CT7A 4Q8NA 3LNPA 2BP1A 5KMYA 2VZUA 2GYIA 4HP5A 1Q6GA 1TJ2A 2P1FA 2IXUA 3MHGA 2DFAA 1HKKA 1Z48A 4DM1A 2YIHA 5D2VA 4BI6A 4YTUA 1UMYA 4DI8A 2D2JA 4JTJA 1F3XA 2WBGA 1ZAHA 2BX7A 1Q7MA 4HGXA 4NRSA 2YCIX 3UNDA 3QHOA 3K46A 1J4EA 5J8LA 3LHTA 4A8NA 3PTMA 1KRAC 2F6XA 4AD1A 3W37A 3OTRA 4PUUA 4IGMA 3WF4A 4WDXA 2Q6ZA 1MSSA 1XICA 1B31A 1E40A 3L4VA 2O9PA 1RBAA 2Z25A 2J7DA 1HVXA 4J1OA 1UP0A 3M64A 4H9XA 2E4TA 3NZGA 2FPTA 3G6LA 2YSWA 2VEFA 3LGDA 1DVJA 3LU2A 3FYPA 3TN5A 1JDDA 3ICJA 1VBJA 3VO0A 1WDPA 5CC3A 1X96A 1M7OA 1Z42A 5EGRA 2GGHA 2CKRA 2RFGA 2BNJA 3P81A 4GH3A 2GGJA 2NUXA 5AVHA 3WNLA 3DIPA 4E8DA 2V2DA 1PCWA 1PDZA 3PM6A 1MUMA 1RALA 4DWSC 1U5HA 4U2YA 3SUSA 3VM7A 4K8HA 2CZ5A 1I2QA 1E51A 1WKYA 4Z0SA 1ESWA 5M2FX 3GQYA 4KWUA 1TTPA 4PBEA 2ZX9A 4O52A 3MP3A 3UR2A 3AMCA 3WQOA 1WDWA 4H04A 2GSEA 4KCVA 2PMQA 2Z2UA 3LN3A 1V3IA 2DSZA 3VX0A 7ODCA 1X8CA 3FHQA 3NJ3A 3PTKA 3L66A 3IUDA 4CQ9A 4CUCA 3QV6A 3MCOA 4QEEA 4MUPA 3DKJA 4PB4A 1K7EA 3HV8A 1OZMA 2DZAA 3ARQA 4P2VA 2X7VA 4G7FA 3GFYA 4GYKA 1TTIA 4ZO9A 4WDUA 3IGHX 1KNWA 1GK8A 4B2DD 3SBFA 1JZ2A 3TJIA 5KZ6A 2X05A 1AZ2A 2ZXBA 1CZ1A 5T8GA 4LYKA 2B7OA 3EWXA 2HXTA 5C5YA 2YZRA 2V3GA 3WD2A 3OB8A 4E8CA 4EE9A 4TX9A 1AW2A 3C2EA 3PJTA 1KC7A 3GXFA 1JFXA 1JI2A 3MMDA 9RUBA 1D7FA 1W5MA 3GYEA 1PHQA 1O95A 1UW9A 4GUJA 4YVXA 4MKVA 4DO7A 3OG3A 2OXNA 5F7UA 1SZRA 1ZGDA 5C9RA 1AW1A 1TPB1 4FHAA 1UWQA 1PZ3A 4Q8UA 2GPTA 4JTHA 3I3BA 3TTYA 3TUUA 3ELFA 4ZBCA 4JNZA 3IJ8A 4NUWA 3MBFA 2R1MA 3NCOA 3H4GA 4AX7A 1H60A 3BOXA 1CXEA 4ZB5A 5FJTA 4JAWA 4RW3A 3KOXA 1MQRA 3CUZA 4Y9NA 1UZHA 4M7SA 3AIWA 4RR4A 4O53A 4GZJA 3GC2A 3KDNA 4ZENA 3V1HA 1RA0A 5PTDA 4JTCA 2V2HA 1BWVA 3M0YA 4AWEA 3T0BA 2G5WA 1RUSA 1FWAC 2PS2A 3SCVA 3CV6A 2OQHA 3S5SA 4RXGA 2DW7A 1DQUA 1R5YA 2A6NA 4JTDA 1TR9A 1P43A 2ZX6A 3LBCA 3R10A 4OUEA 3RR4A 1JXKA 3QM3A 3RILA 3GZ3A 1O66A 3WLQA 2ZOXA 4TUFA 4GXMA 2QV4A 2EPOA 4O57A 1E6XM 3ABQA 3KVMA 5HMDA 3UG4A 4KBXA 3PPFA 2JE8A 5CZKA 4LCSA 2QDDA 2FMOA 1SO6A 1M04A 4V15A 4P61A 4A22A 2GDUA 1R2RA 3MI3A 1FQ0A 3SCOA 4GKTA 3W7KA 3S42A 1UG6A 2VX6A 3W29A 1ZUAX 2WHKA 2WWDA 1KM2A 2HPIA 3VYLA 6TAAA 2XTKA 2ICSA 1AL8A 5B7YA 4O1CA 2HK0A 5FF4A 3ABRA 1O60A 4CN6A 2Y8UA 4Z2JA 4D6JA 1DJGA 3A9IA 4Q8VA 3T78A 4XK2A 4TV5A 4JIRA 1JR1A 3AXKA 1PUDA 3KE0A 3FVDA 4E3VA 3GHSA 3ZR4A 3PNZA 4D9PA 2ZX8A 4OV4A 4UR7A 3NZ1A 4UFHA 3FK4A 4W89A 2WVTA 3OW1A 4KIRA 4HU3A 1ECEA 5C9WA 2TYSA 3VIPA 3GW0A 5CSUA 1EDQA 3N6HA 1FWIC 3Q65A 1LBLA 3LX9A 4PMDA 4AVFA 2CW6A 5A6AA 2J4GA 4F0KA 3OLGA 4NJKA 3EDJA 2YCEA 3PAOA 4FNPA 1QWGA 2Y7FA 3RM9A 2EBNA 2ZRVA 3JZUA 3AU6A 1DWAM 4E2OA 5A2BA 4HYRA 4ZQPA 1SFSA 1SZFA 3VABA 3LBOA 5DEZA 1W31A 1X1NA 1TPH1 1E3XA 4LBRA 2BBFA 4H6RA 1RCOB 1TWSA 3MO4A 1R46A 5FI8A 3C86A 1PKMA 2PDPA 3ZJ8A 4UTWC 3YPIA 4J40A 1XISA 4LH8A 4QXIA 1DHPA 1W3LA 2ODOA 1MYRA 2Y5SA 4IWWA 2W6RA 1QASA 1H4PA 3GAKA 3AHYA 2VUYA 1Q6CA 3C0LA 3VXGA 3U4FA 3W22A 1KR1A 4JFUA 2BXZA 3N2OA 1SZEA 3DYOA 4DJEC 4YLWA 1K7XA 3PJXA 1J9YA 5FL0A 2BOEX 4JQ3A 1ZQ5A 2ADAA 3WF2A 4O4VA 3VDGA 3TR2A 4GI6A 2PGWA 3L0KA 2PDXA 4XZ9A 1XH0A 4HU8A 4JKMA 3BSGA 4UR8A 4EF9A 4QJ4B 2QCNA 4I3GA 3LRLA 1B3VA 4H2CA 4J2MA 4Z1CA 4JXCA 4UQAA 4J3WA 3G2GA 2J74A 3UP8A 4NZ3A 1QI5A 4YYCA 4FK9A 3MZNA 3AALA 1ADSA 3VM5A 1DIOA 1G0CA 1XPYA 3W73A 2HNHA 1ZAJA 4JZ5A 1EA9C 3ARRA 4B5TA 1Y5XA 4DPPA 1B9ZA 1GKQA 2VL4A 1XM3A 1ZJAA 2XGZA 2J7FA 2UV8G 4QJ1A 3BW3A 3GDLA 2VCCA 1H7PA 1VPYA 1XINA 3LHVA 1AQHA 5DCDA 3IEBA 2PSNA 2WMFA 2GUBA 5BMWA 1XH1A 1KM0A 2VI0A 2QHAA 3WFLA 4GJ1A 2IKJA 3W1MA 1AFSA 2A85A 3UWQA 1GVFA 2OZ0A 4HKPA 2B4GA 3LA4A 3CZGA 1QI4A 3H2MA 2CLIA 3H7VA 1AD1A 3AXHA 4DIAA 5HQMA 1KKOA 1UKSA 4GZ7A 1CLXA 1BXBA 3JW7A 5AC7A 3EA2A 5DY3A 4AEOA 4ZO8A 3A4XA 1R9ZA 2Y2WA 5D9PA 3KOZA 2DJXA 2FFIA 2KZHA 3LCGA 1YXYA 2BHUA 4CCDA 4UR9A 3LTPA 5CPSA 1KM3A 2V30A 5CJNA 1BXNA 2G3JA 1VCFA 4I9AA 4NSBA 4GXWA 1XUUA 2VZSA 4D71A 1QJWA 3FSTA 3P5ZA 2GQ8A 3AMLA 3CPUA 3OO2A 5DFAA 1FDYA 1A0CA 4YTQA 1TCMA 1GQJA 4IIGA 1S3HA 4HZ7A 3ME3A 3ARUA 2G50A 2QXWA 2QV5A 2A3LA 3G1RA 4J3VA 4BCEA 2QCDA 3J7HA 4AWTA 5LA1A 5F2IA 3E49A 3UJFA 4B5UA 3RAOA 4AHOA 2IPFA 2DZTA 2ZA1A 1FBAA 1W9VA 4CU7A 1D8WA 4FNRA 1IIGA 1YEYA 4CCEA 2WVSA 3U57A 5KZDA 1O1HA 1B90A 3PANA 2CZFA 3S6DA 5JU6A 3CQ0A 5F2MA 5CEWA 1OCBA 1JIBA 2V38A 3DHUA 3MUXA 2J9XA 1JZ8A 3GB6A 1CTNA 1LL6A 3SECA 4WCJA 4AZCA 1YNQA 4JDBA 1C8YA 4C6MA 4PULA 3PZNA 3PBMA 3S4TA 1WXJA 4U33A 1TPVA 4PCPA 1EEXA 3T55A 1ECQA 4S3BA 7A3HA 2FZDA 1O68A 4JEJA 1RPXA 2IPGA 5AHNA 4GACA 3ZM8A 3OA5A 1JXJA 3IVUA 4A2SA 4D72A 1XL9A 2E3ZA 4ZQNA 4N9BA 2XYLA 4QHRA 4LCQA 2WV8A 4DBEA 1GQIA 1DXEA 4GX9A 2FHFA 4HTYA 3C3UA 2E09A 3NQVA 1HJVA 3ZR6A 3S9YA 4YTTA 5G4HC 1TWIA 3RO6A 3EKZA 3SRDA 1EWDA 3B0YA 1QPRA 4AD0A 3KBJA 3AYSA 1RXOB 4NVTA 5EYWA 2VEGA 4HPJA 1CI1A 1L8NA 3DZ1A 1TPWA 1W5PA 3II1A 1TUFA 3PG8A 3ZVIA 4C5ZA 4B5XA 5CC5A 1A5LC 1HL2A 1UH2A 4AMAA 4AQLA 1P1XA 4JYDA 3OGVA 3MSGA 2HXUA 5LIWX 2H9AA 4M6PA 3NXLA 4RZ6A 3WMLA 1C8QA 1BRLB 4KFNA 4XVEA 3NSMA 2ZUTA 1R3SA 2WSQA 3MUZ1 3RUBL 4HMNA 2PTWA 4PMUA 4IHCA 2E25A 4C6NA 5HMSA 2Z0IA 1CCWB 4UQDA 3SCWA 3WO8A 4PUNA 3LERA 1VFMA 5BWFA 1OCNA 3SFWA 2AL1A 4MADA 1VFTA 3W7IA 5CG0A 4GVIA 3LLDA 4M29A 3N4AA 3MY9A 3QY6A 2PDJA 4HHLA 1WZAA 1IEXA 3NYZA 3EPMA 5K4XA 4QX4A 4ACZA 4XBSA 1MFVA 3H53A 4W8AA 2YDAA 3IGSA 5CBIA 3G1HA 3FNDA 4JFVA 5FSEC 3EWYA 3WK1A 1IEVA 4G7EB 1DIDA 3WLKX 3TN3A 4DJDA 1V7AA 5AOUA 3U48A 4HA1A 1PS9A 1XV8A 2YXGA 3HV9A 2PDWA 1XLKA 2EQDA 3IUHA 2AKZA 3O2LA 3CS2A 1AQ0A 4E38A 4GI8A 2F7FA 3LS9A 2BHYA 4ERGA 3CHCA 4O1FA 5DT7A 4UNLA 2XVKA 1J8VA 5D9OA 3AS3A 2ZZ4A 4LT9A 4GGBA 5DBUA 5I3GA 4H6EA 5LIUX 4L4LA 3IK2A 3QZAA 2X1RA 4FA3A 4MHBA 1R3RA 2G3MA 2ZRXA 3P84A 1K9TA 1L9WA 2BVTA 4AISA 2J75A 4C91A 2DW6A 1A3HA 3HM7A 4FXJA 4LOCA 1GOKA 3L9CA 2V5DA 4WDTA 3T44A 4UMCA 3W27A 1DJNA 1KWKA 1M53A 3HN3A 3BV4A 2XH0A 3A3XA 4P5UA 2BVWA 2V5KA 4ZR8A 5D9MA 1I4NA 2W92A 5FF0A 4WD0A 5KTLA 1Q7QA 4DEFA 1FXPA 4IISA 4X22A 4XZNX 1JCJA 2PWVA 3LZ3A 3T8QA 2I7GA 3COTA 3URAA 3NQ7A 4UMAA 4F0LA 3GNPA 4HPXA 3GC4A 1F3TA 1H2JA