4RCXA

Trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant) loop 3 deletion protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTTVPMIKSFGIEWTILGHSERRDFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEPGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trichomonas vaginalis triosephosphate isomerase loop 3 deletion protein
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 82
structure length 235
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4rcxA00
1LROA 4QSHA 4R7JA 2YSWA 2NUYA 4FF7A 4AHPA 2TRSA 5CZSA 1KLYA 4C1LA 3MUXA 2Y88A 1WOBA 4U28A 3LCLA 4EOUA 3KHJA 3CIXA 2B4GA 4N4PA 1TPB1 3W86A 1JCLA 3I68A 2A85A 1WXJA 2YYUA 5HR7A 5F1VA 1F76A 4EF8A 2Z6JA 3RMJA 3ELFA 1OFEA 5F2GA 4CLMA 1TSIA 1SZGA 3LCXA 4LTSA 1JRBA 2ZYFA 1OX5A 1TB3A 1TPWA 1XI3A 3EKZA 3BLEA 3NQAA 3HG3A 3W7KA 4JX6A 2VFIA 4ORIA 3BV4A 4BFAA 2Y7GA 1W5OA 3LGEA 3W71A 1HTIA 2WSQA 3LRKA 4CNNA 4WXYA 1OX4B 3S5NA 4RK8A 2EKCA 2A6NA 2YR1A 5DN1A 2QUVA 4JICA 3TK7A 5K9DA 1PCWA 3E9AA 5E93A 3UWVA 5SWUA 3P84A 1TQJA 4DO4A 1GJPA 5D38A 1XXXA 4NJKA 3QSRA 3NL2A 2Q3OA 3W1RA 3O05A 3N14A 4MIMA 1M7PA 5K9XA 1K8ZA 1K02A 1OFAA 3LXAA 3DENA 3HGOA 3NR0A 3OVRA 5DXXA 1SZEA 1W0MA 1AMKA 3TC7A 1CX9A 3FA5A 2NUWA 3F1QA 2QAFA 5J5RA 5G4WA 3PG8A 3A21A 3KVKA 4MYAA 3LV5A 4JS3A 2AQWA 5HR6A 3W2NA 3BG9A 4S2CA 4JTEA 3VE9A 1VH7A 3B05A 1OFDA 3MI2A 4O13A 3CPRA 3TU9A 3W7OA 4O4VA 1I45A 5TIMA 3MBDA 3G22A 4KFOA 1VPXA 1TO3A 2CZ5A 3G18A 4HT3A 1TJPA 4JYFA 3I7RA 2DZSA 2E77A 4M7TA 2ZDRA 1H60A 3NPVA 1VC4A 3LOTA 3O07A 3G1AA 3TXVA 3HGRA 5D2TA 4WXZA 4GFSA 4AB4A 3ZWTA 4PH6A 1W5NA 1DORA 1EPXA 4Z1AA 1IIGA 3S1XA 1L2UA 5DCDA 3NQ2A 5TBOA 5IBXA 5EPDA 2RDTA 1M6JA 1LLWA 4JIPA 1JULA 1TRIA 5IBXC 3QYQA 2QDGA 4DF2A 1G4EA 1DJQA 3TFXA 1L9WA 3EKLA 2WNZA 1N7KA 3RFAA 2Y7EA 3TQVA 1TTJA 5KZMA 4FX8A 4DBDA 4IPIA 2ATMA 5D2VA 5LNRA 1GEQA 5F2MA 1XBYA 3DKLA 3P67A 4OQVA 1RQBA 2ZFAA 5F4XA 2V5LA 1SFLA 2JK2A 3DFNA 4BI6A 1K03A 5CSRA 3QF0A 3SFKA 4K6AA 3C8FA 3W7JA 2FPYA 3W6YA 2WSYA 1OF6A 5AHLA 3FYOA 3SZ8A 2VKZG 2OZ0A 2VXNA 1UB3A 4N9BA 1A53A 1SZNA 4O54A 1QMLA 3NQ6A 3TA6A 2A7NA 4UCGA 3M5YA 1ZAIA 2WOQA 4K39A 1SO5A 2YFNA 3W7HA 3O6CA 3M41A 2EPHA 3UWYA 4JN6A 4AVFA 5F4SA 1GTEA 2Y62A 3S1WA 4M6QA 3LCGA 3SY5A 2H6RA 2Z0IA 1SFJA 1XDMA 2DU2A 2V0TA 3LTSA 3UY8A 3P62A 1XL9A 1PV8A 3NQ8A 4A21A 1SUXA 1O5KA 3DAQA 5K4ZA 1GYLA 3HG5A 5H2ZA 1LDCA 2W6RA 2WNNA 4UTKA 3TSMA 1XBXA 5EA9A 3UYCA 4IUOA 1ME7A 1R47A 3QW3A 2PRHA 4MZ1A 4NJHA 4RZ5A 6ALDA 2PRMA 2O7QA 4TU1A 3E02A 1JCXA 2NZLA 1VCGA 1W3TA 4ZQOA 1VS1A 1EIXA 4PEKA 3M7WA 4PODA 3NQDA 5D33A 4MVAA 3NQEA 2R14A 2C18A 3G24A 3W7GA 4LRSA 1I2PA 3PY2A 4HSOA 2ZRVA 3CT7A 3GNDA 4IPJA 2H3DA 3G0UA 1DVJA 4BWLC 2VFDA 4RJEA 4ZQCA 1K8XA 1R2TA 3NEVA 3LB0A 3HG2A 4LY8A 3KFTA 1H51A 1QPRA 5KZEA 3RLVA 4JTUA 1B4EA 1F73A 1ZNNA 3T4CA 4ZZ9A 1K3UA 3EWUA 5LGXA 5LZLA 3HJZA 3EX6A 1P5BA 4N9DA 4OV9A 3THQA 1X8FA 1WDWA 3C56A 4A2SA 1HUVA 2G97A 5I3IA 4X3ZA 2CW6A 3N3MA 5C6MA 1Z42A 4DF1A 1XCFA 4A2RA 3C2FA 2Y63A 4NNAA 4N9CA 4KFPA 2FJKA 2C16A 2RFGA 2ZRZA 4LS2A 1JCYA 1W31A 4WY0A 3W7IA 4DO5A 1OYAA 1BWKA 3IIZA 3ATZA 4I7WA 3MHUA 3VFLA 4X2RA 1H61A 2QCCA 2NXIA 2OT0A 4UXDA 1ALDA 3HMJG 1C29A 2ZBTA 1MEHA 2J88A 5BRBA 3NQGA 4ZQNA 4AHOA 3AJXA 4RKAA 2E6YA 3GYEA 1FWWA 4JTSA 5C54A 3M16A 4PL2A 4AWUA 3CU2A 5LHEA 5K2ZA 1ICQA 1W56A 2X1SA 4UUIA 3W7RA 4PA8A 4E2DA 1VLWA 1OJXA 1KM6A 3THAA 3OIXA 4O28A 1XKYA 2FPTA 3STEA 4UFIA 4IWWA 1O4UA 4LVBA 1H50A 3UPBA 3UY7A 1DKWA 4EVZA 3PVFA 3LCHA 3VKJA 1ZAJA 3L0NA 4KKXA 4I7VA 1GVFA 2QR6A 5HWJA 4JGDA 5LHFA 4E2BA 7TIMA 1LBFA 1FQ0A 4NT0A 3IV3A 5T26A 4N9EA 2YYTA 4UFMA 1IXOA 2RDUA 4GE8A 1TV7A 3NM1A 4NJGA 3W1PA 3LHYA 4TMBA 3PAJA 1KV5A 2Y70A 4FNQA 4GUJA 2WNQA 1OYBA 1TQXA 3LX9A 1SW7A 3N9SA 1KTNA 3HOJA 4HNTA 4AEOA 4L4LA 3O8AA 3MP4A 1DJNA 2PCQA 1JQVA 2E5BA 3M6YA 1GTHA 2GOUA 2QF7A 1SO3A 1O95A 5LNVA 4FIQA 4FNUA 1I2NA 4BI5A 1FCUA 1GPWA 1SU5A 1XUUA 4RCXA 3E96A 3HGJA 4Q33A 2ZCGA 4GWEA 4LUJA 1S3HA 3LHWA 3FFSA 1ME8A 2Z6IA 3BGGA 3W7QA 4MY1A 5CPNA 3UXAA 3W88A 3CTLA 1SZFA 3QC3A 3WK3A 2AGKA 2R8WA 3P8JA 3ABQA 1IF2A 3HPSA 2H8XA 1T96A 3SIZA 2QCMA 3G0SA 2J9ZA 4OE7A 1R2RA 3P5ZA 2OX1A 1UUMA 1Y0EA 1TPUA 2BLEA 1W5QA 3G1HA 4CCDA 2W0UA 4HNVA 3HO8A 1JRCA 2HS8A 3LI1A 4IOTA 3G1YA 1B4KA 2NUXA 2B0MA 2QCDB 2ZRXA 1D3HA 3C2OA 1YYAA 4O12A 3H54A 3LV6A 3L5LA 3GXTA 4I9AA 2OMAA 3TAKA 2QAPA 1XFBA 5G5IA 2BZNA 4FXSA 3NGJA 1KV8A 4FNRA 3NL3A 5D37A 3GDTA 3G1XA 3OG3A 3NDOA 4HNNA 3WJZA 1OX6A 1RZMA 3W84A 4NNCA 3QQ1A 1G4TA 3G0XA 3NM3A 1B9BA 4N6EA 5D2WA 4UFLA 3QW4B 3TMLA 3Q37A 1T0OA 4DQWA 2A7PA 5I3JA 2P1FA 3L67A 4ZQMA 1UASA 3MJYA 1HG3A 1VCFA 2E5CA 1KLZA 1SPQA 3STCA 1LRQA 4AH7A 3LHZA 3O15A 4JDYA 4LUIA 3NQMA 3W1MA 1JCNA 3C0JA 1RR2A 4OBTA 2WV8A 1G67A 1FWNA 3EX2A 4O1AA 1W1ZA 4M5PA 1UJPA 4DXVA 1H7OA 4ICNA 3EX1A 1SO4A 4O10A 2BTMA 4FNTA 5AN7A 2JGYA 2F84A 4Q4KA 1DV7A 1JUEA 1LP6A 3DHDA 2RH9A 3MI6A 3W1QA 5CGQA 2QUTA 3IVSA 1FXPA 3QMRA 3TC6A 3I6RA 2H8ZA 1FBAA 2BSLA 3G8RA 2DZVA 1OFBA 1VRDA 4IXXA 5KZDA 3BG5A 3NAVA 3PF3A 1HO1A 4CNOA 1LBLA 2J27A 3ZR4A 2QCDA 1WV2A 2CLFA 4O0ZA 1WQ5A 4WZHA 3W9ZA 3O16A 1KBIA 2A0NA 3GK0A 1OFRA 5HWNA 4QJ1A 2HTMA 3W7PA 3RF9A 4Y9AA 5G2WA 2FDSA 3BVJA 1SW3A 1GYNA 3C3NA 3DXIA 4ML9A 4UTUA 4M19A 4I7UA 3S5OA 4NNBA 4MLJA 2ZTKA 4GXMA 3ZWSA 2NX3A 5AHNA 4WOZA 1YLVA 1TPDA 4NZJA 2B7PA 2YXGA 1H7WA 4LVGA 1WA3A 4NX5A 1I2OA 2RHGA 1RVGA 4IMCA 1H7PA 4Q32A 4UMBA 3W72A 3OVPA 3W73A 1NF7A 1SO6A 1KA9F 1WX0A 5KINA 1ZCOA 1J5TA 3W87A 1K7EA 5G2IA 1ZFJA 1NF0A 5MHBA 3NXFA 3GKFA 2V5BA 1FCQA 3STFA 4NJIA 1W37A 3KRSA 1V5XA 3PUEA 4AWTA 1W54A 3DFOA 1XBVA 2QCHA 2E5DA 3BPWA 1VYPX 4EF9A 1OK4A 4HHPA 3TMQA 3KXQA 5H91A 5LNWA 3GNNA 3WJYA 1KFBA 4LWWA 4AF0A 3SGZA 1IGSA 1TMHA 3NL6A 5HNRA 3LCFA 2B7NA 4AWSA 3B0PA 3QMTA 1TIMA 3LBMA 4BF9A 4QIUA 3O6YX 3M9YA 1KFLA 4NXSA 2V2CA 4XZ9A 3M47A 3DH7A 5HULA 3UWQA 1JR1A 5DLCA 1A5AA 1AW5A 1VJIA 5D2XA 3TKFA 5BMXA 1F6PA 3YPIA 5D02A 3M5ZA 3TCEA 3G8EA 2I9EA 3QH2A 3W7CA 3HBLA 2XN0A 1LYXA 1HO4A 1VR6A 1NEYA 3N19B 2C15A 3P80A 4J9JA 2ZZ4A 1PIIA 1D3GA 3G1VA 4JX5A 1Z41A 3C2EA 5BOOA 2NXHA 3FS2A 4EIVA 1DHPA 2QJIA 1IXPA 4ONVA 2QKFA 3KVLA 1TPEA 3O1NA 3ANYA 3LERA 3HGSA 1QWGA 4H4IA 3F4WA 3HF3A 1LOQA 1LRTA 2VFGA 4XKYB 3R89A 3ABSA 3I7SA 1YDNA 1LM1A 4IGHA 3ABRA 3UD6A 1QFEA 3TW6A 4MFDA 1GVQA 1KM2A 4OHQA 2BX7A 2X1TA 5F4WA 5KMYA 3IEBA 2OJPA 2NWSA 2WO5A 4IMDA 1SSGA 2QCLA 3W1AA 1KFEA 3MHFA 3L2IA 3W2MA 4B5NA 1QCWA 2HMCA 5K9CA 2KZHA 1M5WA 3R12A 4TIMA 2FB2A 3E12A 1A5BA 3PSVA 4DPPA 5AHEA 3IVTA 3RNDA 2DORA 3WJSA 1NSJA 1CW2A 1H5YA 1G69A 2TYSA 1W3NA 1JUKA 2NXGA 1X1ZA 2HS6A 3WK2A 3W23A 1XUZA 1OF8A 3G3MA 3R13A 3CEPA 3STGA 4JTJA 1ZALA 3L5AA 1QO5A 5FEWA 4RV8A 4Y8FA 2FIQA 1TV5A 3PBVA 2ZQ0A 3BK0A 3SGUA 4JTLA 4O4WA 3DFTA 4HSNA 4M6VA 4DBEA 3VI2A 1F05A 5DELA 4HPJA 1LORA 3KOFA 3VNDA 4NJJA 4LVDA 5CPOA 4ZVJA 2VEIA 2V30A 3T40A 3HQ1A 4MYXA 3GIYA 2G96A 2PE4A 4IXHA 2H90A 3EX4A 5AOUA 2VEMA 5C55A 2V81A 2OCZA 3PUDA 1TTIA 3O6DA 5D05A 1EWDA 4MJZA 4MOZA 4UMAA 4E0CA 2UV8G 4Z1CA 2P0OA 3TXZA 3OVQA 4JD4A 1FWTA 1EA0A 1JUBA 5AC7A 3LBCA 2Y6ZA 4YWIA 1XC4A 4Z1BA 3SR7A 4JTKA 2Z2UA 4XBKA 4BWLA 1XDLA 3S5YA 1EP1A 1FXQA 3TIMA 3T78A 2NWRA 3GB6A 3LLDA 3WJXA 3S9YA 2E6AA 1U5JA 3S1VA 3P74A 2ABBA 2ZRUA 2ZA3A 4H6KA 3PS7A 3IGUA 3L5MA 5BMWA 4JX4A 3P5YA 2VFHA 3EXRA 1EUAA 1BTMA 3A9IA 5J5DA 1FWSA 2TSYA 2I14A 4A22A 4AMAA 4NX0A 2QJGA 3MMTA 2CZFA 2X1RA 3P61A 2ZZ2A 4XTIA 3SSJA 3UQNA 2YX0A 5G4EA 2EHHA 4QNEA 1YPFA 4JNMA 2PC4A 1G4SA 1UCWA 1H63A 1L6SA 3CIWA 3UZJA 2QCEA 2XN2A 2CWNA 5AYYA 4G1KA 3RLUA 4DEFA 1L6YA 2WQPA 1JCMP 3MO7A 3EEGA 2ZZ3A 1PHQA 3ZS4A 4C1KA 2A6LA 1B3OA 1I4NA 3JS3A 3U8GA 4NU7A 3EWXA 4ADUA 3M1ZA 3B4UA 4IX0A 2QUUA 2YW4A 1XM3A 2DP3A 2F7FA 3NOEA 3QRHA 4RLIA 2C19A 3PBYA 3N2MA 4CCEA 3UWZA 5LNSA 2A2IA 3MWAA 4NQ1A 2WSRA 1T99A 3L68A 3LXCA 5D30A 3CLMA 3QMSA 2VENA 4DPQA 2QJHA 2C0AA 3H55A 2CLHA 1PHWA 2D73A 2VOMA 5DBUA 3LLFA 2CLOA 4R34A 5AHIA 3NQ7A 4D2JA 3TDFA 4ZL1A 3BW4A 3S42A 5BW6A 2V9DA 3TJXA 1GG1A 1H7NA 1MZHA 2GVJA 2C3ZA 1FX6A 1M7OA 1Q45A 3ZFHA 5CG7A 4E38A 4WQ6A 2GJLA 2FFCA 3I7QA 1QOPA 3GVGA 3L9CA 3TR2A 1O60A 2E6FA 3HG4A 3W7DA 1KTBA 4O16A 2A4AA 3GDKA 3NPXA 4FNPA 1FDZA 2QCGA 1JVNA 1Q3NA 3KRZA 1JQXA 3M43A 1QAPA 5DXYA 1VYRA 3QPZA 1OFPA 3OA3A 1RD5A 2GJNA 2ZA2A 3F03K 4HN4A 3PR2A 4Y6GA 5FF4A 1GT8A 1ZY9A 3BO9A 2ALDA 1PVNA 4YCOA 3N73A 3TSDA 2Q8LA 1I8JA 1VYSX 3A22A 4WOQA 4JY9A 3TQ0A 3MP3A 5GVJA 3W2JA 1YXYA 3CWNA 1JCJA 4XQ6A 2DZTA 5D04C 5F2LA 3SI9A 4JTIA 4BK9A 3MHGA 1GZGA 2ZZ6A 3TJLA 3NPWA 4K37A 4RR4A 2NV1A 4BR1A 3LHTA 3OEXA 4IMGA 3PB0A 3HB9A 4YMZA 4LVAA 1QO2A 1OX4A 2GQ9A 4LW7A 3TROA 1IXNA 1MO0A 4JR5A 1EX5A 3BG3A 1YADA 4GUIA 1T8XA 4UFJA 3QQ0A 5CKSA 4TX9A 4Y96A 4X22A 1KM1A 1GQNA 2ZZ7A 4ZQRA 2ATSA 2CLMA 5FEXA 1HL2A 3PSWA 1MXSA 4FX7A 4GRSA 4XTDA 2BWGA 1K7XA 4FO4A 2V2HA 5I3KA 3W2LA 1X7FA 3EWWA 1KFKA 3C6CA 4O1CA 2YCEA 3QZEA 4QQ3A 3N9RA 4K7YA 5CSSA 1ME9A 4K7VA 5EMUA 4Z0JA 3FKKA 4Z08A 4LVFA 4P61A 4R53A 1KM5A 3EXSA 2JKPA 3HPXA 3Q2DA 4LV9A 4O1DA 5K3VA 3ABOA 3JR2A 3NA8A 5DY3A 1G7VA 2R94A 1AK5A 3P7YA 1Q6OA 3NVTA 4FXRA 4S2BA 2VEKA 3CWOX 4KFNA 3T55A 1QDSA 1WAUA 1R46A 2ZTJA 4QITA 5HUPA 1FWRA 5EYWA 3QFEA 1BWLA 1XBZA 3FLUA 1Q6LA 1GWJA 5HWMA 3W1NA 5EY5A 5AC6A 4UR7A 1ZENA 1X1OA 4UFKA 3UZ5A 2YDAA 2E68A 3GDRA 1G4PA 4CNPA 3HIJA 1LRNA 5AC8A 1VCVA 1S5TA 3W07A 1SR9A 2ZRWA 4AXKA 1HFBA 1DL3A 4IX2A 2OT1A 4NZFA 5KITA 1RQEA 4IMEA 2DJLA 3M5XA 1S5WA 5AFDA 1ICSA 2YW3A 1PS9A 1TPVA 4UNKA 4S1FA 1H7XA 4MZ8A 3FJ6A 3W76A 1DBTA 5A5WA 3LRLA 4XKYA 6TIMA 1K8YA 3INPA 1ADOA 3G1SA 2EAWA 3KX6A 5AHFA 1C9DA 3BGJA 4NVTA 4LC6A 1H1YA 8TIMA 2YZRA 5K4XA 1TTPA 3I65A 3GR7A 1ZAHA 2CLIA 2JGQA 4JXCA 4RXFA 2EF9A 2XFWA 3QM3A 3QSTA 1OFQA 1FDJA 5HMSA 1EP2A 3TW7A 3OHIA 3FYPA 1H1ZA 4HNUA 3LCWA 1YTDA 1UUOA 1WOAA 3FKRA 2A1YA 3SJ3A 1Q6RA 1A50A 5K7JA 1J2WA 1R30A 5HQEA 3TNOA 2VELA 4UR8A 1TV8A 1Z48A 2V8ZA 3MYOA 4EWND 2FB3A 2DZPA 2C14A 4QNWA 5G2HA 2H3BA 1EWEA 4LU0A 3QJAA 5EL1A 3CHVA 3H53A 3FEMA 4TR9A 5D03A 4N4QA 2Q8ZA 1FDYA 3W85A 1OFOA 5F2IA 2DZXA 4RZ6A 4AAJA 3GXPA 4OV4A 4UTMA 4K38A 5E0KA 3LTYA 4RX0A 4XUGA 3MBFA 1D9EA 1N8FA 3DBPA 1G7UA 3NQVA 2Y7DA 4O50A 1YXDA 5G1TA 2NV2A 3LI0A 3KAOA 3W1TA 1FUYA 3B0VC 3M5VA 3Q58A 3TX9A 1VLIA 2X30A 1G6CA 5CZJA 2CZEA 2P10A 3IIVA 3GX9A 2CU0A 3BLFA 2R91A 1DQXA 1GOXA 3N34A 3NG3A 3WK1A 5E1QA 3TH6A 2J24A 3UWUA 1WYIA 5CZ0A 1SSDA 2J9YA 3DFPA 2Y61A 5FF3A 4NXKA 3U2OA 4GUHA 4ORMA 2ISWA 1YTEA 1DOSA 4O14A 4IJBA 3G1FA 5U7SA 2GVGA 4WUIA 1TPC1 4LRTA 1OG0A 3W83A 2YGYA 3LHVA 3MYPA 3W7MA 1VGAA 3BLIA 5L9FA 4O1BA 1AW1A 1J4EA 4O17A 4KWWA 3TSBA 4GUGA 3P82A 2NX9A 3L0GA 1MSSA 1TPFA 1W5MA 3G3DA 3NYZA 4O52A 4PL1A 3DGRA 3GR8A 1W3IA 3C2RA 2A21A 1ML1A 2NLIA 3TV8A 4GBUA 1F7BA 3V1PA 1X6UA 1FY6A 1NVMA 1DQWA 3PWAA 4DF0A 5CPLA 5KSWA 2C1HA 4GNJA 1WBJA 4Y90A 1OVDA 1QOQA 4U4MA 4UTWA 3DI1A 3DHFA 4K8EA 3R8RA 1F5ZA 1ZJIA 3NQCA 1P0KA 1TPH1 1V7YA 2ZA1A 2GUUA 3C2VA 4CQ8A 5LNUA 3P60A 1GG0A 3O06A 3W2KA 1VZWA 3WK0A 5DBTA 3MI3A 5C2XA 4DO6A 1Q6QA 3P81A 4O53A 3MP5A 3O63A 4HIBA 4ADTA 1W5PA 1QPNA 1LZOA 1IXQA 1RQHA 3W2UA 5HJLA 2CZDA 4AF0B 5I3GA 2WKJA 1F6KA 4MUZA 2QDHA 4W9TA 3VE7A 2CLEA 1YPIA 1U83A 1GVSA 2V2DA 3L21A 3U6WA 3T44A 1H7RA 4MZYA 3IGSA 3DU0A 4L4MA 5AYZA 2CFFA 4XBSA 3EX3A 1AL7A 1R2SA 3S5ZA 4WJEA 1OYCA 2I1OA 5FEZA 3UNDA 1E51A 1EUNA 4LT9A 1SW0A 2EGZA 4LC8A 3C61A 3K30A 1KFJA 3TUUA 3C4UA 4POCA 4JTHA 3QEZA 4PFMA 5ABTA 5FEPA 1P0NA 4YL2A 1F2JA 3JRKA 1THFD 4N2YA 3EWYA 2GQAA 3NQFA 4M7SA 3IVUA 3TE9A 4JEQA 1LCOA 4TMCA 1EB3A 2FQIA 4AHQA 3RU6A 5G1YA 5TQLA 1O94A 4BI7A 2BXVA 5C5YA 2X16A 4UTJA 5LSMA 3CQ0A 5EBUA 2ZZ1A 3W74A 4MJMA 3GAYA 4UTWC 1QPQA 1S5VA 3DFQA 1LBMA 1AG1O 1C8VA 2C13A 5CPMA 2VFFA 1CI1A 3LXBA 3PULA 1B57A 2E09A 1KM3A 3W7EA 3IIPA 4N02A 2TMDA 2FLIA 3IIXA 3A5VA 3W3OA 1TRDA 3DZ1A 1Z44A 2Q3RA 3GAKA 3IGXA 3PM6A 1KFCA 3G1DA 3NZ1A 4QISA 3KVMA 4A29A 3PUOA 1A5SA 5D09A 3LM7A 3CB8A 4PCFA 3E0IA 4GUFA 5AHMA 4MKNA 3D0CA 1F74A 3C52A 5FF2A 4JYDA 4XWUA 3PG9A 1AL8A 1MEWA 3GKAA 5IM51 4Z1DA 3BW2A 1LOLA 2DZWA 1ZHAA 4MLRA 4Z0SA 4UNLA 4CQAA 1ICPA 4WX2A 2C6QA 2HSAA 3A24A 3LDVA 5LGZA 1KW1A 3LTPA 4IMFA 2G95A 3W75A 4CQ9A 3VCRA 4X9SA 2VEPA 3TQKA 1LTDA 1N55A 4WY0B 3DKJA 1AW2A 3W70A 2LLEA 4ZMGA 2Y7FA 5U4NA 3FOKA 5FF7A 5FF0A 3LHUA 2XN1A 1VHNA 4H3DA 5HUOA 3R5EA 2X2GA 3QPYA 5FI8A 1P4CA 3M0ZA 3TFCA 1OK6A 1YTKA 2Y85A 4LNYA 4O57A 1I2QA 1RPXA 2G5WA 3A23A 3V75A 4FIRA 3A5FA 4OT7A 2B7OA 5A8GA 4HPXA 2TPSA 1OABA 4O8RA 4TO8A 4ALDA 5FESA 4UFHA 5L6UA 3W1XA 1TJRA 2Y89A 2YFOA 4PTNA 4GC4A 1K7FA 4UC5A 4MFEA 1TCDA 3B06A 3GDLA 1KBJA 3SW6A 3NO5A 4JY8A 3RK8A 5AB3A 3WFAA 4FX6M 4JTTA 3CEUA 5D32A 5I3HA 1OHLA 2RKXA 2QCFA 4JTGA 4A3UA 3UWWA 4QM1A 4OU1A 3R2GA 2WJZA 5CZTA 4PC8A 3S6DA 4UTIA 1L6WA 4OWGA 3OBKA 2CLLA 3TAOA 4UTLA 3IIOA 3LCIA 4MY8A 3E49A 3NNTA 4QAIA 5F1UA 1TTQA 3PBWA 4O11A 3L65A 3UPWA 4JIQA 2X1UA 1SQ7A 1A5CA 5DCBA 1PCKA 4M6PA 4UTTA 2QCNA 1KTCA 4JTFA 3W22A 3USBA 4MY9A 4FHAA 1RV8A 2A7RA 2J6XA 3KRUA 1LLZA 3KVJA 3EXTA 1TREA 1VHCA 3BARA 3N2XA 4LS0A 4UTHA 1KM0A 2ABAA 1H62A 2A5HA 4JYEA 3B03A 3CM4A 1KM4A 2PRLA 3W1UA 1QPOA 1FCBA 1P1XA 4O18A 1YXCA 4WY0F 3NZRA 3GDMA 4YLWA 4YXGA 5I3FA 2VC6A 1I2RA 1IIHA 4OGZA 5DCEA 1GVOA 1PL9A 2Z1BA 1LOSA 1ONRA 3B04A 3GZ3A 1TYGA 3B8DA 2IQTA 4DELA 2ISVA 3PB2A 2W79A 2GVLA 3NL5A 3S8HA 5EKYA 3EWBX 3M44A 4ADSA 2ZRYA 2WPBA 3Q94A 4MPQA 4O0KA 1EP3A 2JKEA 1QR7A 4LV4A 4O19A 1QNVA 2J9XA 4K8HA 4JDBA 4FB7A 4HKPA 2DJXA 4LS1A 5DY2A 2O7SA 4UTTC 2PURA 2E6DA 4LOCA 3UXDA 1GVRA 4P2VA 4ZQPA 1O5XA 3W7NA 3W7LA 1JJKA 3F4NA 3CC1A 5LKYA 3NPUA 5KTLA 1YDVA 2VFEA 3MW7A 3BW3A 3L0KA 1PE1A 3WJWA 2JBMA 2YPIA 2NX1A 3B0UX 3L66A 3IRDA 2CLKA 3GXNA 3PC0A 3P8IA 2RDWA 3DI0A 3S0CA 3DFSA 4KWVA 1MEIA 1NFBA 5AYXA 3LRMA 3FJLA 2AAMA 3HPZA 1W8SA 2GQ8A 3EB2A 2FPVA 2FTPA 3ATYA 4GJ1A 4R33A 5BNKA 4YCPA 4NUWA 1FCVA 1NAL1 4K36A 4FEZA 1WBHA 3FIGA 4FNSA 1BEUA 3SECA 3S1UA 3W1LA 2B7QA 3EWZA 3T7VA 2QEZA 2ZZ5A 4UIOA 3GLCA 1BKSA 1VQTA 2E1DA 1YDOA 3AO0A 2GPTA 3PBUA 2DZUA 4RZ4A 4IQLA 4RXGA 4O15A 5D2YA 2JKAA 2ISSA 4CCCA 1UBSA 1EEPA 5HINA 2V82A 4WD0A 4UMCA 4N6FA
chains in the Genus database with same CATH superfamily
3AICA 3THCA 4AHPA 3BLLA 1MVYA 4W93A 1QUMA 3MUXA 2PDYA 2Y88A 1BYDA 1XC6A 1TR9A 3CIXA 5ABGA 3I68A 1WXJA 2QLYA 5F1VA 1SZRA 4EF8A 3ELFA 5AKQA 1SZGA 1XLGA 1A47A 1JRBA 1TPWA 1XI3A 3NQAA 3HG3A 3BV4A 3MUIA 4HCHA 3LGEA 4YWSA 5CBIA 2WCSA 1OX4B 2IKHA 4JPGA 2J7DA 3VOIA 3VVGA 1PJ9A 3LNMA 4NILA 1HGWA 3CL7A 3GD6A 5K9DA 4J3UA 4HVXA 1HL8A 5DO8A 4IG2A 3DG3A 2Q3OA 3VNYA 4C6FA 3N17A 3W1RA 3N14A 4RPQA 1M7PA 1K8ZA 3TW9A 2EKGA 3ORWA 3LXAA 5I23A 4L65A 1H1NA 2JIWA 2WAGA 1XLLA 1XSIA 3U2CA 1RJQA 1AMKA 3VGHA 9XIMA 3FA5A 5LIWX 1E6QM 5HNNA 1QOXA 2HROA 5G4WA 5PTDA 4JS3A 2AQWA 3N11A 4O8AA 3A4AA 2ZXAA 4LAMA 3CASA 3ZJ8A 5CBJA 3KHDA 3BJTA 3B05A 1OFDA 3T81A 4O13A 5I6SA 3CPRA 4DWSA 3CV1A 2PWGA 5H8UA 3MBDA 3G22A 4KFOA 2WK2A 1TO3A 2BHYA 1XQKA 4XD3A 3KCOA 4G6CA 3WH5A 1FHVA 2AKMA 4CN4A 2DZSA 2E77A 1XV8A 2X7WA 4H1ZA 3NPVA 4HHHA 1KR1A 1VC4A 3OVGA 5A2AA 2GOKA 3TXVA 1EOKA 3HGRA 5XIAA 4ZFMA 1KQZA 3WF3A 3ZWTA 1DORA 3CXOA 2WHJA 3GM8A 2HEJA 4OUIA 4R9XA 5TBOA 3NQ2A 5IBXA 3EZ4A 2RDTA 3RITA 2XVPA 1ONWA 1AH0A 1LLWA 4JIPA 3QYQA 1DJQA 3EKLA 2VCCA 2WNZA 2F6XA 2Y7EA 4XX6A 3TQVA 3FN9A 4LUSA 4FX8A 1LWIA 3P0XA 1V79A 3WEOA 1Y8BA 2C79A 4DNMA 4QJ5B 3WLPA 5BU9A 1RQBA 2ZFAA 4REQB 1SFLA 3UVAA 3DFNA 1PZ0A 1W3LA 2ADAA 2HDJA 3QF0A 5CSRA 4K6AA 3C8FA 3ARVA 3AMLA 2WSYA 3CV7A 4AZHA 2OOGA 5M17A 2PDXA 2RJHA 2VKZG 1CLXA 2VXNA 3BMWA 1A53A 1SZNA 3WMCA 3TA6A 3NCOA 3CZEA 4UCGA 4P7QA 4WDUA 3H2EA 4H6RA 1IWAA 1JEZA 2EPHA 4EXBA 1KBKA 3UWYA 1JZ3A 1M7JA 2OO6A 2XINA 2Y62A 3S1WA 4M6QA 5HDRA 2Y5JA 3LCGA 3T05A 1YNPA 2DV0A 1E4MM 1UKTA 2DU2A 2VDHA 4X0VA 4YTUA 2OZ8A 1PV8A 5LA1A 1R9XA 1O5KA 1CXFA 1XIDA 3DAQA 3QTGA 1LDCA 2WNNA 2VX5A 1JGMA 4UTKA 1XBXA 3PZIA 2MANA 4GGBA 5FAJA 4RZ5A 4HYRA 2NZLA 1VS1A 1EIXA 4PEKA 4Z1YA 1OY0A 4P7OA 5D33A 4UOZA 3LYEA 4Z2JA 3G24A 4GIEA 4AYSA 2VURA 2WCAA 1YE4A 3K1GA 2WW5A 1R2TA 3EDDA 4HMNA 5KETA 4LJ3A 1BVNP 1VJZA 3AALA 4IFRA 3V1HA 1KWGA 3S9IA 3CK5A 1R3WA 4IPLA 5BCAA 3P0WA 4KIEA 3C56A 3F4VA 1B5TA 1Z42A 4QE5A 3SEPA 3H4XA 1XCFA 2NQJA 5FACA 4NNAA 4N9CA 2A3EA 5BRQA 5I24A 4S3AA 3EMZA 1JCYA 1W31A 3VDCA 1S38A 3ATZA 2XFYA 3MHUA 3VFLA 1H61A 4WJXA 1N2VA 5ENLA 4ACYA 2NXIA 3PZMA 3H2MA 2G41A 3VKBA 5BRBA 4AHOA 1R3TA 3PZVA 4X61A 1UWTA 4HZ6A 2C7FA 1FWWA 3KRBA 3CU2A 1W56A 2X1SA 2P5NA 4PA8A 3WMBA 1KM6A 1XH0A 3STEA 2FPTA 5CC6A 3BOLA 4UFIA 3B0XA 2I16A 4XAPA 4EVZA 4FLQA 3LCHA 4KKXA 1OB0A 3L0NA 2OLSA 3VNLA 4PMUA 3CMJA 3TR9A 4B2DD 1NDVA 4GINA 4L9XA 4DJEA 1QNPA 3GFXA 1IXOA 2ZVRA 4GE8A 1E5JA 3NM1A 3AS2A 4KERA 4HU0A 3BLPX 8XIMA 1KV5A 4I9TA 2Z25A 1JFHA 4URIA 3L12A 1OYBA 5H1WA 4HNTA 5FL1A 1MYRA 3MP4A 2PCQA 2EPKX 4QLLA 3WLTA 3M46A 4BI5A 1FCUA 1AJ0A 4PUJA 4GBDA 3M0HA 1MI3A 3HGJA 1SR0A 1WZKA 3LHWA 2DW6A 2Z6IA 5I02A 4MJ4A 3MKCA 5CPNA 3UXAA 4WCJA 1X8CA 1E9YB 1ZCCA 4XB3A 3TTYA 3WH6A 4B3LA 1IF2A 3HPSA 3FGCB 3G0SA 3MDWA 1L6GA 2YL9A 3P5ZA 4RE4A 1R0MA 4J1OA 4J3VA 2OX1A 1EX1A 4U5IA 3V0TA 1UR0A 3WQEA 5TNVA 4FR1A 4V28A 1Q7MA 4HNVA 3UGRA 1JRCA 5D9MA 2HS8A 2HNEA 2NUXA 2QCDB 4NYYA 3V3WA 2J7FA 4O12A 2I5QA 3DFYA 4S38A 4PE8A 3TAKA 4FZIA 1WDPA 5DFAA 3C3UA 5HATA 3J7HA 1KCKA 1K77A 4LB3A 1JPMA 3NDOA 1FWIC 3QQ1A 3ZLHA 2ZXQA 1KWKA 4DQWA 2XIOA 1FOBA 1OCJA 3L67A 1VCFA 3STCA 1AQHA 4JDYA 4L1WA 3BUVA 4TVCA 3APYA 4J3TA 2WV8A 1FWNA 1WXZA 4ZOEA 4O1AA 1W9VA 3V5CA 3A9BA 3GVWA 3WO8A 4PB5A 1UJPA 1UIOA 3K2GA 2INFA 2GDUA 1PIGA 1SO4A 1V7AA 3BTNA 2YCLB 1JZ7A 4Q4KA 1DV7A 1JUEA 1E0TA 1TA3A 3QMRA 2WB5A 1A5NC 2BSLA 4B3KA 4DX3A 4D8LA 4S3CA 5KZDA 1K6AA 2DFAA 2E8ZA 3KP1A 2B31A 1MNSA 4CNOA 2WJDA 2J27A 3ZR4A 2D2GA 1XICA 2QCDA 1M41A 1WV2A 4O0ZA 1XSJA 2TODA 2GVYA 2A0NA 2E1WA 3GK0A 5HWNA 3G5EA 3G2GA 3W7PA 3RF9A 2FDSA 2GWGA 5EGRA 3ZR6A 3I6TA 2C1IA 1P6CA 3WD0A 4C7GA 4M19A 3S5OA 4NNBA 4MLJA 4GXMA 1ZU8A 4E8DA 3CQHA 3E0FA 1LWJA 2YXGA 1WA3A 1N82A 3HPAA 3WN6A 3W72A 4QROA 3SRDA 2ZVIA 3CYJA 1SO6A 1WX0A 5KINA 3B8TA 2CIPA 2PP1A 1J2BA 5TD4A 3NXFA 3GKFA 1VB9A 4S3JA 4NJIA 3KRSA 2DIJA 1V5XA 3PUEA 3D47A 2Z1VA 1Y65A 4ATLA 1XBVA 1PX4A 2QCHA 1OK4A 5H91A 1XYZA 1KFBA 1GVYA 1FWDC 1ZPTA 3NL6A 3OW1A 3WQ6A 3B0PA 1TX0A 4AG0A 1OCBA 2E0PA 3BQ6A 5G4HC 2NSXA 3FCPA 3T8QA 4B2DA 3VIGA 1O1ZA 1A5AA 1AUSL 3TYAA 1AW5A 5D2XA 3TCEA 2EG7A 3K4DA 1HO4A 1J10A 1NEYA 4JX5A 3C2EA 2HWGA 5H6HA 4QE4A 2Z1WA 2F2HA 3M0IA 4AU0A 2QKFA 1QWGA 3H22A 2VFGA 4XKYB 2BXYA 3I7SA 1YDNA 3IWPA 2IKGA 1V4YA 1UWIA 1KM2A 3FYYA 3VA8A 2ZUMA 4OHQA 5KEZA 1H0GA 4NRSA 2OJPA 2O55A 2QCLA 4MWAA 3MSGA 3R0DA 1EOMA 4EANA 3R12A 3E12A 1OT1A 2VUNA 4S3EA 1UZ4A 3E0LA 4IQJA 2DORA 1H5YA 1Q2RA 1MQRA 4HMCA 4I90A 1FWHC 2NXGA 1GJUA 1Q6DA 1XUZA 3ALFA 2VR5A 3STGA 2X0YA 3GW0A 4RV8A 3PBVA 3SGUA 3DFTA 3H7RA 4M6VA 3VI2A 2WZTA 5DELA 1LORA 2VRQA 3M7SA 4B15A 5FSDC 3U5YA 1F8IA 1XX1A 2P50A 4GZJA 1K9FA 4MYXA 3F2CA 3GIYA 2G96A 2PE4A 1A0DA 2H90A 1TE1A 2HK1A 3KBMA 3EX4A 4H7VA 1P0DA 2QXWA 2B81A 1Z9AA 5DMLA 1Q7ZA 2OQHA 3RYSA 4L4PA 3DESA 1TTIA 5DRIA 4MJZA 3MMUA 3BAKA 4S3BA 2WC7A 2WKGA 1E5NA 1TX2A 4Z1CA 1E6XM 3AMKA 1TR1A 5AC7A 1BG4A 4EAMA 2Z2UA 4XBKA 1DJIA 3R94A 3TIMA 4Z2LA 4NZ1A 4CQCA 4IMAA 1J0HA 1L0PA 1TZ9A 1U5JA 3S1VA 4PMXA 4H6KA 2G3FA 2DSVA 4H2CA 3LQGA 3L5MA 4KPLA 2NQ9A 2VFHA 1D8CA 2PDQA 5ECUA 4FAMA 3TOPA 1O1HA 4A22A 4AMAA 4NX0A 4AC7C 3O7UA 5A69A 3MMTA 3BGAA 4TV6A 2CZFA 1EA9C 1Z69A 2ZZ2A 1AFSA 2XM1A 3SSJA 3L4VA 2YDSA 5G4EA 1J9YA 4QNEA 1YPFA 2PC4A 4JEJA 2PTWA 1LT7A 3U57A 2PD5A 1E6RA 3RLUA 1L6YA 1F6YA 2ZZ3A 3GU1A 1PHQA 2XVKA 4C1KA 3UJFA 1B3OA 4EXAA 3MSRA 3A4JA 4NU7A 4AD4A 1I60A 1UZHA 3B4UA 3V4BA 2QUUA 1XM3A 1S5NA 2DP3A 2F7FA 2X0SA 3QRHA 5J04A 4GJIA 1Z8AA 4YNGA 4A05A 4NQ1A 4K3ZA 5D30A 3IK4A 3GIQA 3QMSA 1IHIA 2C0AA 1ZP3A 2WHLA 1PHWA 2Z1XA 4H9VA 4IQDA 2D73A 2VOMA 1R5YA 3V35A 2XH0A 4AWEA 1H7NA 1XCXA 5BWFA 2C3ZA 3ZFHA 4E38A 2FFCA 3GVGA 3L9CA 2E6FA 2VC7A 3W7DA 2C71A 3EDJA 2A4AA 4P8XA 1KGWA 2CKRA 1IWPA 4DI9A 3M43A 1VFMA 4HNOA 4FR6A 3ONBA 3QPZA 3G6MA 4GYJA 3PR2A 5T91A 3PTDA 2FTYA 3BO9A 4MJ2A 3ARWA 3DIPA 2VM8A 1WKFA 5DMYA 4FXJA 4HN8A 5CSUA 1VYSX 3A22A 1ISXA 1XDJA 3VIIA 1EKOA 2E9BA 1JCJA 1GKRA 4J40A 4XQ6A 3XINA 4JTIA 4QDWA 1GZGA 3TJLA 2WHMA 2NV1A 2IXUA 1EF2A 3II1A 4F0RA 1RCQA 4H9TA 4UBPC 1ITUA 1Z7AA 4UCFA 4YMZA 3VIFA 1DQUA 4LVAA 1OX4A 2AKZA 5M1TA 5DF0A 4GYPC 1IXNA 4C6DA 4A8IA 3SCTA 1EX5A 3BG3A 3NQBA 3S9ZA 5AZ0A 2GVEA 4Y96A 3WQ5A 3D3AA 1GQNA 4Q8OA 2VO5A 1EC8A 3E2RA 1HL2A 4FX7A 4GK8A 4WVXA 4PUWA 2POZA 3WQWA 2V2HA 3W00A 5ABFB 3K46A 4Z42C 5C0QA 1IYXA 4O1CA 2CXGA 3OZPA 2V38A 1VBGA 4GIYA 3T2QA 3N9RA 3PAOA 4PB4A 5TF0A 5CSSA 3KBVA 3B9NA 4Z08A 3IS4A 2OZ3A 1AQFA 1Q2SA 1ZQ5A 3HPXA 3Q2DA 4O1DA 4PMRA 3DUGA 3GG0A 3RJYA 3B8WA 4XVDA 2VZSA 3CWOX 1EBHA 2AAAA 1Q6FA 3T55A 3EMQA 5A6LA 2ZX7A 1FWRA 1RP8A 5EYWA 3WNPA 5HWMA 3W1NA 5AC6A 1PTDA 2E4TA 3PPHA 1TE6A 1NWSA 1ISYA 1UQYA 2DVUA 1JPHA 4R5EA 4J3SA 1ONXA 2F61A 5AC8A 4I9JA 4KH2A 4AXKA 1JYXA 1JAEA 2OT1A 4YIWA 1RQEA 5FA5A 3M5XA 4HOWA 4FLOA 1QBAA 6PTDA 1H7XA 3FJ6A 1TMLA 3NDZA 4C1NA 3T6CA 5FCZA 4XKYA 4DO7A 4CD7A 4M56A 3VCNA 4QCEA 1IT8A 3KX6A 3SN4A 1TTPA 3I65A 3VINA 2ALRA 3CUJA 1UWAA 1UR1A 2CLIA 5FJPA 2EF9A 1BYBA 1FDJA 3QV7A 2IXVA 4XZMX 3TW7A 4ZB0A 2WMIB 1YTDA 3FKRA 2A1YA 1Q6RA 3T08A 2REQA 2MNRA 1J2WA 1E43A 1B3ZA 3BWWA 4EWND 2Y8UA 1IEWA 2C14A 4E2VA 1XLKA 4I5XA 4BY3A 3ES7A 3F7JA 1EWEA 3B4YA 3QJAA 4LU0A 4Z2HA 5C9WA 3H53A 4Q8NA 3MUZ1 4FOUA 3FX4A 3POHA 2FH8A 1GCYA 3WQ4A 2JIEA 4HYVA 4WKHA 4DRSA 3JVAA 4RZ6A 2ZE0A 4UTMA 4UB9A 1R8LA 2W62A 4KQNA 5EU9A 3LTYA 3CLWA 3MBFA 1S2VA 3AUJA 5G1TA 4GX9A 4AVNA 3WFZA 3KAOA 1XG3A 3W1TA 3M0LA 1E0XA 3M5VA 4QRNA 1A3XA 1G6CA 1LQAA 2PSNA 3ARYA 2WVVB 3NG3A 2RDXA 1CTNA 5CZ0A 1CGUA 2CYGA 4PULA 2GK1B 2WJFA 2PWFA 2E28A 5FF3A 1NWTA 5C9UA 5A6BA 1H4PA 3F5JA 2Q09A 2OWCA 1JYVA 4C7DA 4IJBA 3G1FA 4BA0A 3WY1A 2Q01A 3O0FA 4LRTA 3W83A 1J11A 3CNYA 3LHVA 3MYPA 1UZ1A 2GDQA 2GLKA 3GS6A 1J01A 3MQTA 1HKMA 3AQUA 4O17A 1JYWA 4KWWA 1E56A 1W9XA 1WDSA 4GIRA 1AJ2A 5CQ1A 3BAYA 3UFYA 3BOFA 3SURA 3LY0A 1NTHA 3FJ4A 3B3DA 1W3IA 4B3ZA 2NLIA 3CPGA 1A5OC 1F7BA 1X6UA 3LSCA 3BANA 4CU6A 4AFYA 5A1AA 3H12A 2CITA 1JZ2A 5E0CA 3OGVA 3CQJA 4IIDA 4Y90A 3FSUA 1OVDA 1QOQA 4PN2A 3T4WA 3OYXA 3WYZA 3N6QA 4EE9A 2FKPA 4QDMA 4W7WA 3AISA 3RO6A 3W2KA 1P6WA 2R1KA 3WK0A 3OB8A 4PYSA 3P81A 1EL3A 3BLKA 4I8YA 4MB5A 1WAWA 4ADTA 3CH0A 4QFUA 5HJLA 3UZWA 3UA3A 2WKJA 1F6KA 3UERA 1A3WA 4MUZA 4W9TA 1R86A 3R8HA 1YPIA 4M51A 3O3RA 4M6UA 1RSCA 4QS6A 2J78A 2KAUC 2HNHA 1F3XA 3BH4A 3S5ZA 4HZMA 1GOQA 4ZODA 4EXQA 3UNDA 2GJPA 3TA9A 2EQDA 1VJSA 4MM1A 3C61A 4NZ5A 1R7OA 1DIOA 1E6ZA 3TUUA 3C4UA 4XD5A 2I5IA 1VFHA 4TVDA 3W82A 3HU7A 1NM9A 4N2YA 3F5LA 3TE9A 1TMQA 3MWCA 1EO7A 1V3LA 4QHRA 4PR4A 4D6GA 4Q6XA 3MY9A 3SCNA 3RU6A 4DJFA 1JPDX 1KKOA 3PPCA 1S1RA 4UTJA 1DE5A 4MJMA 4LB4A 1Q13A 3GAYA 2VYOA 3LPOA 3OYZA 3SCWA 1LBMA 1C8VA 2C13A 4S3KA 4GO8A 3EWDA 3UW6A 2VGBA 2JFEX 1KM3A 3DGBA 1Q4WA 3DZ1A 2Q3RA 3GAKA 1YHTA 1UG6A 3G1DA 5EB8A 3NZ1A 3KVMA 4HCDA 1A5SA 3D5HA 5D09A 3LM7A 5ABEA 3CB8A 4DNHA 3E0IA 3MV01 3RHGA 2QPSA 4DJEC 1F74A 3C52A 4JYDA 3N4AA 3HV8A 4JN8A 4MLRA 3SQLA 3TWAA 4UNLA 4CQAA 1ICPA 1XIFA 4A3QA 3I10A 3TEVA 1XRTA 1GOWA 3E1F1 3TTQA 3TN4A 3PK7A 4PRWA 4M3PA 1VFUA 4R7WA 3TQKA 3WBYA 1LTDA 4B4FA 4WY0B 5CZKA 1AW2A 1K8CA 3W70A 2LLEA 3QHOA 4GKLA 4ZMGA 2Y7FA 3RILA 5FF0A 1EO5A 2XN1A 3AXXA 1VHNA 4CNUA 3QPYA 2G4JA 1P4CA 3EKGA 3M0ZA 4ZOCA 1IV8A 1YTKA 4PMJA 1RPXA 2G5WA 1HJVA 4C6IA 4BKNA 3K1DA 3VXGA 4V1XA 1W9BM 3W38A 1VFTA 3TTSA 4TO8A 1W9UA 4JTQA 2OLHA 3W1XA 1FKXA 1EDGA 3QLDA 2Y89A 3QBUA 3U5UA 3GHRA 4PTNA 5I00A 1XJBA 4M1RA 1B3WA 3B06A 4MWAC 3W53A 3WLSA 1XLEA 4MSSA 1G5AA 3SW6A 3WF0A 1FWFC 1WZLA 3WFAA 1OM0A 4DJFC 3MZNA 1B54A 4JTTA 3NGFA 5D32A 5D9OA 3TLLA 4F0HA 5I3HA 2RKXA 4JTGA 2XIJA 4QR6A 3FNDA 2VGIA 4I9MA 4PBGA 4QM1A 4UTIA 1HVQA 4F2TA 4BQ2A 3OZYA 5FJJA 3OQ8A 3TAOA 4UTLA 3PANA 4QAIA 5F1UA 3LQLA 4DWSB 3RPDA 2DDXA 1UUQA 4O11A 4E2OA 2X1UA 3PZ9A 1SQ7A 4UTTA 2XPKA 3VGEA 2PDGA 4JTFA 3W22A 3USBA 2WWDA 1X6NA 4IGMA 2J6XA 3I3EA 2DIEA 2WM1A 2PWDA 5ECVA 3GNOA 1BLIA 3EXTA 3BARA 4IP7A 4P8VA 1D7FA 1XRSA 4JYEA 3B03A 2PRLA 3W1UA 4GQGA 4M81A 4YTTA 1YXCA 3NZRA 4YLWA 1IT0A 1CGVA 1IIHA 1ZTVA 3S2JA 1PL9A 1LOSA 1ONRA 2VC9A 2CHNA 3B04A 3GZ3A 3HFYA 3LNPA 5B7ZA 2DVTA 2ISVA 2YL5A 3NL5A 1R3QA 3AWOA 1RPKA 2DSUA 2ZRYA 2XGZA 2WPBA 4O0KA 2VWSA 4MB1A 3SUUA 3RLHA 4KF1A 3MKVA 1HF6A 4WRHA 2JKEA 2DJXA 5DY2A 3CAWA 2PURA 2XISA 1J79A 3CO4A 4E4FA 1XYCA 3W7NA 4WLCA 1AD1A 1C7SA 5LKYA 2PTYA 3NPUA 1L6FA 3MW7A 4J28A 1OZQA 4ZO7A 4QG6A 2PU0A 3MT1A 1V0NA 1WDDA 4DM2A 1BYAA 2NX1A 1F8MA 4C7FA 1IT7A 1FFRA 3L66A 3VZZA 2P3EA 3IRDA 3GXNA 2YOCA 4GQ0A 3A4WA 4B92A 3NJ3A 3DI0A 4PUMA 2VRKA 1CLKA 3BAXA 2OR2A 1NFBA 1DHKA 1XW8A 1TJ1A 1KQYA 2R82A 2GQ8A 3ITOA 1WKEA 2ESCA 2E9MA 1TWIA 4JFSA 5BNKA 2WYSA 4UOJA 2IS7A 3FIGA 2PF0A 4M8UA 2YA1A 2WVUA 1FTXA 3S1UA 4Y9MA 1DIEA 2B7QA 1FWBC 3IGHX 1KR0A 3DYPA 4UIOA 2ZZ5A 2DIKA 2PBGA 5BOEA 2OGJA 2GPTA 2CCRA 4RXGA 4O15A 2ISSA 2YLLA 4CCCA 1EEPA 3C8NA 2D3LA 5HINA 1V0MA 2V82A 2XGBA 5JXQA 4N6FA 2RGLA 2TRSA 5CZSA 4C1LA 1OZMA 3AHXA 1TZ7A 1WOBA 4U28A 2AOSA 5FJTA 2CBVA 2DUAA 1XSKA 3KHJA 1T40A 1TPB1 1JCLA 4WSHA 2J77A 2YYUA 2J7BA 5BRPA 3SRFA 2PTXA 4C6QA 1TSIA 3LCXA 4INFA 2ZYFA 3Q65A 3FK4A 1TB3A 3MVIA 1P0EA 1K1DA 3BLEA 4GI8A 4FLSA 3VNMA 4HK5A 1B1YA 4ORIA 1Q8JA 5CBBA 1KXTA 4JHMA 2Y7GA 3W71A 2Z29A 4B9ZA 3DERA 3C86A 3F5KA 2EKCA 4H8UA 4GYFA 4PTDA 3SCVA 5DN1A 4B5VA 2BOFX 4JICA 3TK7A 1PCWA 3E9AA 5E93A 5FJUA 1PEZA 1QHZA 4DB7A 1I75A 5D38A 1XXXA 3NL2A 1GQLA 2FYMA 2W92A 4MIMA 5K9XA 4GGHA 3WD1A 4BCEA 4BEUA 4PUUA 3OVRA 1J6PA 3FGCA 3WMSA 1W0MA 1VBRA 3IV8A 3RDKA 1CX9A 3V5OA 2NUWA 4GYPA 1E9IA 2QAFA 1GPFA 4MYAA 2R9RA 5HR6A 3W2NA 1UD6A 3QV8A 4S2CA 3WLOA 4C6KA 3WLIA 1LUCA 1VH7A 3GQYA 2QIWA 2R1LA 1EC9A 2Z24A 3TU9A 3W7OA 3I3BA 2QNEA 2CZ5A 1MW2A 3M0VA 1W17A 4WKAA 1Q85A 2ZADA 1NIUA 3I7RA 3LEPA 2ZDRA 1H60A 3T8LA 2PZ0A 4G9PA 3O07A 7REQB 1TUFA 5D2TA 4PH6A 4Z1AA 1AVAA 3S1XA 3BCJA 1L2UA 4JL1A 5EPDA 3VX1A 1XIEA 2Q6ZA 1JULA 1MUMA 3ITGA 1KBBA 1TRIA 2QDGA 1EJRC 1ZB5A 1G4EA 2BHUA 3H2FA 5A94A 1N7KA 2UY4A 4JHZA 1TTJA 1NP0A 1O68A 3UR2A 5D2VA 5BROA 1YEYA 3UJSA 3ZOAA 2V5LA 3WNKA 3H8AA 2JK2A 3USZA 4M1BA 4ZXOA 2VEGA 1RLDA 2FPYA 2OQLA 3W6YA 1FP8A 1U2YA 2PBOA 5AHLA 2DT1A 3SCSA 1UB3A 4N9BA 5HNUA 3HQNA 3NQ6A 3W01A 3M5YA 1ZAIA 2WOQA 1JZ8A 3HQPA 3O6CA 3KS6A 3VD7A 4AY1A 1CXIA 3VK5A 4E3TA 1LL4A 3SJNA 4WJ8A 3UY8A 1DEDA 1XL9A 2EEXA 1UOZA 1RALA 3HG5A 2W6RA 1K9EA 4AZ7A 3NSXA 4IP4A 3UYCA 3SUSA 2PRHA 3AWNA 5M2FX 1FH8A 1WUEA 5CJMA 4BF7A 1G9HA 3E02A 1W3TA 4MKSA 5BYWA 3M7WA 3VM5A 2WMIA 3NQEA 2R14A 2C18A 1XYLA 5D8WA 1I2PA 3CT7A 4IPJA 4DWSD 1CIUA 1S5MA 2QHAA 4X60A 4ZQCA 3HG2A 4ECLA 1H51A 1QPRA 5KZEA 3VO0A 1PKNA 3T4CA 4ZZ9A 2Y2WA 1K3UA 5HNTA 3EX6A 3H2OA 4N9DA 3TYZA 1ZUAX 4JAWA 2G3MA 1PZ2A 5I3IA 2CW6A 4GVGA 4GZ7A 4KMQA 4MMWA 3G1RA 1UBPC 1P1MA 4KEMA 5BXRA 2FJKA 2C16A 4LS2A 1O5QA 2YBUA 1U33A 1TFVA 4NG3A 2W3ZA 1C3FA 3OTRA 2NSOA 2OTDA 5LIUX 3CGTA 1WB0A 3AJXA 3UR5A 1DTUA 2E6YA 3GYEA 4JTSA 4PL2A 1JIBA 4AWUA 2GJXA 4PB3A 5K2ZA 3ECQA 1E1EA 4UUIA 3W7RA 1VLWA 1OADA 1NOWA 5I7GA 3THAA 4O28A 1XKYA 3UETA 4IWWA 3HFTA 1O4UA 1FKWA 4LVBA 4PFHA 4LYRA 2GGHA 3MU7A 1DKWA 4IJCA 1HP4A 4CD6A 3ES8A 2QR6A 4JGDA 7TIMA 2W91A 3N4EA 2O92A 1FQ0A 4N9EA 2YYTA 1E55A 1TV7A 2RAGA 2WC4A 3W1PA 3AYTA 3FXYA 1GOOA 2BV9A 1XYFA 2XHYA 2Y70A 3RAOA 1REQB 3T2OA 1W91A 4H9ZA 1T6MA 2WNQA 4HD5A 1J18A 1SW7A 3HOJA 3QOKA 1F4HA 2CPUA 3O8AA 4OTKA 5CAKA 3CZGA 4HA0A 5EFDA 2GOUA 1O95A 5LNVA 1E9LA 4L9ZA 3H7UA 4ACZB 2V3GA 1XUUA 2AQVA 1FWCC 2PF8A 4Q33A 1TVPA 1QATA 4RNJA 3LG3A 4P7LA 4H7ZA 3PWIA 4WGHA 3CTLA 4E3VA 1SZFA 1K9TA 2AGKA 3WK3A 1S2AA 2R8WA 3P8JA 4PTXA 3AI0A 3HMCA 3SIZA 2J9ZA 1C93A 3AUOA 3EDEA 4F4RA 2XIMA 1V3IA 1UUMA 1Y0EA 1TPUA 2BLEA 5JH2A 1W5QA 4GCXA 3CHDA 3G1HA 3VYLA 1XISA 1LQ0A 3VNKA 3WLNA 3HO8A 4UNIA 2XVGA 4H9UA 4IOTA 1DWGM 3KOXA 2NLYA 2D0FA 1S3TC 3C2OA 1YYAA 2EG8A 3FA4A 4WSJA 2YBVA 1UW9A 1ECEA 1KV8A 2WQDA 4FNRA 3Q45A 3NL3A 3GDTA 1FA2A 3BLDA 3G1XA 4HNNA 4KCUA 1RZMA 3VD4A 1HNYA 4NNCA 1G4TA 2JF6A 5D2WA 3Q37A 3W6MA 2IKIA 3DECA 5I0DA 4ZQMA 2YCKX 3MJYA 1HG3A 1KLZA 2XSBA 1FWJC 3AZTA 3T07A 3H4GA 4AH7A 4PSRA 5H8PA 4E8CA 3C0JA 1RR2A 4OBTA 1G67A 2OPJA 3EX2A 1S46A 4DXVA 3E5PA 2O4MA 2BTMA 1YE6A 3CB3A 2A3LA 3WNNA 1JI2A 4UQAA 2RH9A 3TYCA 3W1QA 5CGQA 3UXLA 2QUTA 3IVSA 2OSXA 3TC6A 3I6RA 3VOHA 2H8ZA 4DJFD 3G8RA 3PZUA 4IXXA 3V0SA 3EWCA 4RE2A 3ANVA 2VZVA 5D9PA 3ABXA 1V0KA 2PTDA 3W26A 3VIOA 3N6HA 2CLFA 1DP0A 2VRJA 3RLGA 1KBIA 4B5WA 4QJ1A 3PJXA 2ZC1A 4Y9AA 5G2WA 3VABA 3BVJA 3LGDA 3CBWA 1KRCC 3DXIA 4ML9A 4ZB5A 3W4RA 3APGA 1YLVA 3OLDA 4PUKA 3AYVA 4NYUA 3GNRA 3WCZA 4D8ZA 4NX5A 1I2OA 2FZDA 1OG6A 1F3WA 5HPCA 1QVBA 4Q3MA 1VFFA 1J5TA 3W87A 1K7EA 4WHBA 4F0LA 5G2IA 3QY6A 1NF0A 2DSKA 5DRCA 5MHBA 1ODZA 4LPCA 1MW1A 4XO7A 3STFA 1W37A 4Q4MA 4DXXA 3BC9A 3AHVA 4AWTA 3EDFA 1T8QA 3DFOA 4EPBC 2ZXBA 2E5DA 3ZJ7A 1IZCA 1VYPX 3GVQA 3TMQA 4HHPA 5E09A 5LNWA 3CL6A 3ARZA 4ZSTA 5HNRA 4NAFB 2B7NA 1UP0A 3QMTA 3LBMA 4AISA 4QIUA 3VDHA 1XYMA 3ARUA 4LCRA 1GGOA 1Q5MA 2BXZA 1XGZA 4EACA 2ANUA 4JQ2A 4XZ9A 3M47A 1CPUA 1BVZA 5HULA 1ZSXA 3UWQA 2BY0A 3SUTA 4TV5A 3OLIA 4QLJA 4D71A 5IDIA 5BMXA 1BQCA 1F6PA 2NV9A 4HTYA 2I9EA 3LU2A 2OG9A 1US2A 2AL1A 2GUYA 2VZTA 3KL0A 4XZWA 2C15A 3P80A 4J9JA 2ZZ4A 2W61A 4QXIA 4MWAB 2NXHA 4EIVA 2QJIA 5AC4A 1IXPA 4F2BA 2OX4A 7TAAA 3DBNA 4P7NA 5JU6A 1TPEA 3O1NA 1MDLA 3HGSA 4H4IA 2YL8A 3RX3A 2QJMA 5GJPA 1BSIA 3ABSA 1LM1A 4IGHA 1TWSA 4Q8VA 3P3BA 3UD6A 4ZFCA 2PDPA 3ARTA 4MFDA 2OKTA 2PDMA 4CN6A 3OBAA 1PX8A 4GQBA 3REQA 3L4YA 5JMUA 2JALA 1UD3A 2NWSA 4IMDA 4HPGA 3P93A 1UYQA 3W1AA 3L2IA 4K68A 2HMCA 5BXTA 5K9CA 4TIMA 5AHEA 3ARPA 3RNDA 1G69A 2QGHA 3FY1A 1W3NA 3W23A 1OF8A 3G3MA 3R13A 2EPNA 1JDEA 2ONEA 4DN1A 4JTJA 1ZALA 3L5AA 4Y8FA 3LMZA 2FIQA 1TV5A 1UOKA 2ZQ0A 4O4WA 1EYEA 3IPWA 3WSUA 2D22A 4DBEA 1F05A 3UP8A 3E2QA 3VNDA 4GI6A 4PMDA 3EAUA 3WBEA 4NJJA 1QI3A 2Y24A 4S3GA 2Z1KA 1RHCA 2VEIA 4YS1A 3HQ1A 2VTFA 1KBLA 5DEZA 2PLJA 4NY2A 4I5RA 1CGTA 3EPMA 2OCZA 4J3XA 3PUDA 5T9CE 1J8VA 3WUBA 1XD0A 1EWDA 4DYJA 4U31A 3AIQA 2P8CA 1TA3B 2HVOA 5A6MA 3VGGA 2E3ZA 2PMQA 2PP3A 4JD4A 4GKTA 1M01A 1JUBA 3LBCA 2Y6ZA 2VI0A 3S5YA 1FXQA 4IGNA 2YJQA 3GB6A 1GHRA 2CBUA 3S9YA 3UXKA 3GH7A 3P74A 1EGVA 2ZA3A 1IGWA 5DX7A 2WMHA 3NSMA 3PS7A 4NI3A 3IGUA 4JX4A 1M3UA 4LUTB 1EUAA 1BTMA 3A9IA 3C5QA 1FWSA 2TSYA 1VF8A 2I14A 6ENLA 4D6FA 2QJGA 1V6XA 2X8RA 3JW7A 3DHUA 3W6LA 1NQKA 1CXLA 3R6IA 3NTYA 3VMPA 2PGFA 5M03A 2EHHA 3PPFA 4F40A 3SN0A 1VFOA 4XO6A 1L6SA 4LEQA 3CIWA 3UZJA 2XN2A 2BOGX 4L5ZA 2ZIDA 4ZEPA 3CHEA 2CWNA 2INZA 1TJ0A 4XZIA 4G1KA 8RUCA 1UC5A 4LYQA 3OU8A 5IDZA 4GACA 5EMLA 3ZS4A 5LA0A 4Q8TA 2ZX5A 3H6OA 3M1ZA 1W8GA 2YW4A 4IT1A 1TWWA 2OYKA 4GIAA 1ZZMA 4ASTA 4RLIA 8XIAA 3R25A 2R24A 1EQCA 2A2IA 1ZRQA 3MWAA 2WSRA 1T99A 3VCCA 1A5UA 2PFHA 4DPQA 1AH3A 4HOXA 3OP2A 1R7AA 2CLOA 4D2JA 4TTUA 3VZYA 5BW6A 4MTVA 3TJXA 4FA3A 3VILA 3CAVA 5CG7A 1E70M 4UQDA 4EPDC 1VEPA 4DXKA 1QOPA 1XGDA 3HG4A 1FVPA 3CTTA 1KTBA 2QCGA 5JQ9A 3BV7A 1Q3NA 1IZJA 3WEZA 1QAPA 2XWDA 5B80A 4MG4A 5DXYA 4AXNA 2OWWA 1OFPA 3F03K 5AZ1A 2ALDA 1JF6A 1TWDA 2HQAA 3QGAC 3KTXA 2BGNE 4D72A 2I56A 4WOQA 1X98A 4W8AA 2GJXB 1XF0A 1YXYA 3SAZA 1WUFA 3W2JA 5JVLA 3U2ZA 3AXIA 5D04C 1XKJA 4GLEA 2FMNA 4BK9A 3MHGA 4LYKA 2ZZ6A 3NPWA 2PDHA 2PI6A 2J79A 1YRRA 1IWBA 1OC5A 1CGXA 3PB0A 5DMNA 3VAVA 2VCBA 2HISA 3CO8A 1PZ1A 4GUIA 4C6PA 4UFJA 3QQ0A 4Q7BA 2OQYA 1ADDA 3A3HA 2ZZ7A 5M5DA 3ZJ6A 3UVIA 4UQ9A 4J35A 2VWTA 1WCGA 1V3MA 4XTDA 2J7EA 1GONA 5I3KA 3W2LA 3EWWA 2WXDM 5LA2A 1EJTC 4K7YA 4UQEA 1ME9A 4WF7A 4V27A 3ZT5A 1C8XA 1KM5A 3EXSA 4LV9A 2PGWA 3JR2A 3NA8A 5CC5A 1EJWC 3NVTA 4S2BA 4A35A 1UH4A 2OEJA 4XBJA 1EC7A 1R46A 2FZMA 3AIRA 2ZTJA 2YB4A 1E0VA 3QFEA 4IM4A 1BWLA 1XBZA 1S39A 4W89A 2WSPA 1QT1A 1BXCA 2DH3A 1QI2A 1ZENA 1SVDA 2ZWYA 2PWEA 5A6TC 2YDAA 3UZ5A 5JBFA 2E68A 2G3NA 4PBEA 3GDRA 4JQ1A 4LANA 1XLDA 2PTZA 4IISA 2PB1A 2ZRWA 2POTA 4IX2A 3T9PA 3D46A 4NZFA 5KITA 1WDRA 1PX3A 2GL5A 3K13A 2XZ9A 4AIEA 4S1FA 4MZ8A 3W76A 1XRVA 3OGSA 3VOJA 1OIMA 6TIMA 1K8YA 3INPA 3BGJA 4LC6A 8TIMA 5K4XA 2ZICA 3T0AA 3V36A 4LGXA 4PMYA 4JXCA 2XFWA 4IZGA 1OFQA 3QSTA 3ITTA 4GO9A 1EP2A 3CUHA 3KZSA 4J5NA 2E9LA 3FYPA 3TZFA 3GHSA 4HNUA 3LCWA 1KD0A 4AY8A 1WOAA 3DG6A 2WJEA 1A50A 1R30A 3ZT6A 3TNOA 4YVVA 3S6OA 2VZUA 1TV8A 1Z48A 2EBNA 4Z17A 2V8ZA 3MV11 3JU2A 2H3BA 4MB4A 5EL1A 1T7LA 4L64A 3CHVA 1U30A 3PZGA 2XU2A 1NDWA 3FEMA 3AJ7A 2IUZA 3AC0A 1A0EA 2D69A 2WLYA 3PNZA 1AA1B 3U3HA 1OFOA 4QE1A 5F2IA 3WBAA 2DZXA 3S47A 3OBEA 4AAJA 4OV4A 3UBPC 1DXFA 1B31A 3W02A 1D9EA 4GA8A 3DBPA 1G7UA 3NQVA 2Y7DA 1NFPA 4O50A 5TAOA 4JHOA 1E0UA 3KEHA 3B0VC 3MO4A 4C60A 2UY5A 1ZP4A 3GX9A 1JDAA 1RJRA 3BLFA 5C7VA 2R91A 1DQXA 3WK1A 5E1QA 4TXEA 1R9ZA 3VD3A 3TH6A 3LMYA 3MCOA 1NH6A 1DPMA 1UH3A 4CD5A 1U1UA 2Y61A 4H6QA 4NXKA 2X05A 2DSWA 3AIWA 4RW5A 5GJMA 3STPA 3NZQA 3U2OA 4C65A 4ORMA 4QTGA 4H04A 3WNMA 1S2WA 2DH2A 1GNXA 3FW6A 2YKKA 3BJSA 5JBEA 3CHFA 4OBSA 3CMFA 5JH1A 3BXWA 3W7MA 3BLIA 5L9FA 4O1BA 1AW1A 3LPGA 3TSBA 5HMEA 5LIKX 1MSSA 5C71A 4TX6A 1UA3A 1TPFA 1W5MA 3G3DA 4O52A 2PPGA 1MXGA 4PL1A 4ZXLA 4LAKA 3WQPA 4OZOA 3DGRA 1V6VA 3T0DA 1V6WA 3GSMA 3PNUA 4GBUA 3H21A 4CVUA 4UZSA 4GNJA 1WBJA 1SJCA 4NF7A 3IJ9A 4UTWA 2DT0A 5A2BA 3L4WA 5IOBA 1ZJIA 3ME3A 3NQCA 1MDRA 1EEXA 1P0KA 3R11A 3C2VA 4AC1X 5LNUA 1UWRA 5DBTA 3DHPA 3QGKC 4DO6A 2WMKA 1Q6QA 2EJ1A 3MCNA 4E5TA 3O63A 1W5PA 4AZCA 1LZOA 1M04A 1IXQA 1RQHA 3W2UA 3OOQA 2CZDA 5HAOA 3ZVIA 4R85A 3GXIA 2CLEA 4CKQA 3WD4A 1RK5A 1GVSA 1U83A 3LK6A 4GQQA 2V2DA 3T44A 1QNQA 4N0RA 1K9DA 2PODA 4FOJA 4XBSA 3EX3A 4O1EA 1CXKA 1OYCA 5FEZA 2Y5EA 1B2YA 1E51A 3NOYA 3HA1A 3ABZA 4LT9A 4ZOBA 3B8SA 4XSLA 3WD3A 1QXLA 4LC8A 5GNYA 1HJWA 3AU6A 4D6CA 1PKMA 4BHYA 1KFJA 4JTHA 4PFMA 4TTGA 1THFD 2QMKA 3EWYA 3O9NA 1LCOA 1F07A 3U7VA 2FQIA 2DUXA 1EDTA 4ILSA 5G1YA 2HPMA 4BI7A 3T0BA 4RNIA 5C5YA 3AYRA 4AZ5A 4YN5A 1J96A 2PDBA 5EBUA 2P3ZA 5GNZA 3RU8X 5HANA 3SIMA 4UTWC 1QPQA 2PCEA 1AG1O 5A6BD 1J93A 4QQUA 4MGGA 1CI1A 3LXBA 3PULA 1B57A 3WDIA 2E09A 3PHAA 3W7EA 4N02A 2NVDA 3CQKA 1P7TB 3IGXA 1QI0A 2AQOA 3PM6A 4QISA 1E6PA 3OLEA 4JKKA 4GY7A 3EA2A 3GNPA 2E40A 3B97A 2VHLA 3AS0A 4PCFA 3QC0A 3D0CA 4I3GA 2HE5A 4XWUA 2NVCA 5JIPA 1R85A 3GKAA 2CKSA 1CCWB 3DC0A 1KO0A 3UJ2A 3PFRA 1CLVA 4GNVA 4MADA 2XJ7A 2HSAA 3LDVA 1KGUA 3LTPA 1O7AA 1RUSA 3RXZA 2EXOA 3VCRA 4X9SA 4EKJA 1V02A 4XVEA 4Q8PA 1N55A 5GJNA 3GC5A 2GGEA 1BQGA 1WDQA 3FOKA 5FF7A 2Z1SA 4H3DA 5HUOA 2VNCA 3GC4A 2X2GA 4HBKA 3UF9A 1EZ2A 3UCQA 4HA1A 3N2OA 2P88A 3U4AA 1I9CB 2Y85A 4H83A 2G8ZA 1C9WA 5JUVA 3A5FA 2BVWA 4QS5A 2PWUA 4RW3A 3TOYA 5AYIA 2TPSA 4AD2A 4ALDA 5FESA 4JFUA 3PJWA 4Q6JA 2AL2B 2FGBA 4EK7A 1JG9A 1K7FA 1MMFA 3PTMA 4MFEA 5BU6A 3RRXA 1OD0A 5I5RA 2AMXA 2DT2A 3M0MA 1KBJA 1OGGA 2O9TA 1Y5VA 3NO5A 4BEQA 4HYWA 3RK8A 2CBIA 2FGZA 4NZCA 3CEUA 5T9BG 1R3RA 1OHLA 1YBQB 5D8ZA 4CGTA 4A3UA 1BXNA 3UWWA 4HSHA 5CZTA 2ZUWA 4OWGA 2CLLA 3IIOA 3WFLA 1E6SM 4CD8A 1TTQA 1G0CA 3CV6A 2ON3A 1A5CA 1UD4A 1RLCL 2FH6A 3NFUA 1CNVA 3V16A 1KTCA 4QJ3B 3AHZA 4FHAA 3PN8A 3O6AA 1RV8A 3FAWA 1RD6A 5A8QA 1ZBCA 1LLZA 4MNKA 3ZMRA 5CH9A 1H62A 3XISA 1EPVA 3CM4A 1QPOA 4K1WA 4WY0F 4GC3A 4X63A 5I3FA 5AECA 4JNZA 2ZOXA 3T42A 1TYGA 1DIDA 3GBDA 4B5TA 2GVLA 3WEMA 2Z27A 3KM8A 3S8HA 3WQDA 3SFWA 2OVLA 4MPQA 3VC5A 3BCDA 2NT1A 4OUEA 4FB7A 1ZBVA 4LS1A 4GYKA 2O7SA 4UTTC 3DYMA 1XQLA 2FZNA 1HP5A 3UXDA 4KS0A 4P2VA 4ZQPA 4D1IA 3U2EA 5XINA 3W7LA 1JJKA 4ZSUA 2ZKMX 3CC1A 4ZO9A 2C91A 3C2YA 1PE1A 1Z3NA 4W5UA 2F6KA 3B0UX 4DWSC 1B30A 4QJ4B 4PRTA 3PTQA 4ROQA 1IQ8A 3S0CA 4KWVA 1MEIA 2Z2AA 3IJLA 4G8TA 3FEQA 2EJAA 3LRMA 2AAMA 3BSGA 2XH2A 3LA4A 4KGLA 2FPVA 4JZ5A 3ATYA 2XGIA 1C7TA 4R33A 4NUWA 4L80A 4PCSA 4K36A 4ZO8A 2RUSA 2PDKA 3LENA 3WD2A 2I17A 4FEZA 3OZOA 1QJWA 3ZQ9A 3SECA 1DJXA 1QTWA 2VUYA 3W1LA 3EWZA 4ZCWA 3T7VA 3UZXA 1Q65A 2EO7A 2J13A 1VQTA 1YDOA 4IL2A 3GG7A 3PBUA 4IQLA 2D2HA 1TVLA 1UBSA 3V5FA 1UR9A 2FVLA 4IICA 4WD0A 1R38A 1G1YA 5HA7A 7ENLA 4R7JA 1JXJA 2PDJA 2XIIA 5MKGB 3CAKA 3LCLA 4EOUA 1NARA 1H49A 4X0NA 2I9UA 2B4GA 2GSJA 4YHGA 4EX4A 2YB1A 1GW9A 2QVNA 4C6EA 4D1JA 1RBAA 1F76A 3GRIA 2NQLA 2Z6JA 2YXOA 2Y0FA 4CLMA 2FTWA 3COTA 4DIAA 1GZ1A 3BMVA 2DW7A 4YPJA 4PCTA 4Q4OA 2Y8KA 3SCUA 3W7KA 4HPHA 2VFIA 4C6OA 4UOQA 4CNNA 4WXYA 1SMDA 1D8WA 2FMOA 3AIBA 4DYKA 4M80A 4FALA 5HK4A 1MFVA 4DO4A 4NJKA 3AFBA 3QSRA 2XZ7A 3MJMA 1ZJHA 3TN3A 4F3HA 2PDNA 1K02A 5BWAA 5HMFA 1V51A 1C8QA 4W7VA 4K2SA 4DJDC 4AX6A 3NR0A 1X39A 1ZGDA 4REQA 5DXXA 3ID7A 1SZEA 4IG2B 3TC7A 4WEVX 3JZUA 3VC6A 5I77A 4M24A 1NDZA 5J5RA 1PAMA 3PG8A 1JPIA 4QG8A 3KVKA 4H19A 3EB3A 3LV5A 4XZBA 2W9MA 1TVNA 1JGIA 1X7IA 1RXOB 1GJWA 1JI1A 1HL9A 3BG9A 3GXDA 4OIFA 2BFGA 2YLAA 3VE9A 2GSEA 3B9EA 4AD3A 3KCLA 1MXDA 3MI2A 4AIBA 1MFUA 5TIMA 3VUSA 4R88A 2Z4GA 1VPXA 2UY2A 2ZX8A 3ITLA 1TJPA 1HKIA 4JYFA 2CZVA 1BPLB 3MB9A 4CNTA 3LOTA 3G1AA 2D2JA 4GFSA 4AB4A 2V3EA 1W5NA 1R3VA 2R1NA 1QU4A 1BSLA 1M6JA 1Q6CA 1ZL1A 2WHKA 1JYNA 3TFXA 1ZLPA 3WNLA 4MNMA 3BAJA 5KZMA 1XIBA 2VJXA 3BQ5A 5LNRA 2JQXA 1GEQA 5F2MA 1XBYA 1VRXA 3P67A 3AS1A 3SO7A 5F4XA 1L8PA 1IEVA 4W88A 2V5KA 3AOFA 4BI6A 1K03A 2W67A 3W7JA 4KIRA 4NHVA 4OVXA 1OF6A 1W1A1 2A3BA 3FYOA 3NIYA 6CGTA 2D3NA 4AW7A 2OZ0A 3N25A 2BVDA 3AMGA 1SO5A 3W7HA 4GXPA 1HJUA 2HZGA 4JN6A 4RDZA 3SY5A 1ZJAA 1ITXA 2FZ8A 4DJED 2Z0IA 1WO2A 1XDMA 3LTSA 2V0TA 3P62A 1X1NA 1M53A 3NQ8A 4A21A 1SUXA 1DIKA 5K4ZA 1GYLA 3H70A 5CJ5A 3CPUA 3VIJA 3BICA 1M68A 5IXEA 4NJHA 2PRMA 5CPSA 3KL5A 1KXVA 3VKAA 1XGEA 4ZQOA 3RM4A 4PODA 1V6UA 3HN3A 3NQDA 2MUCA 3AMCA 1FHUA 4A8LA 3IJIA 2GJRA 4MVAA 4UQBA 4MDOA 3W7GA 4LRSA 3AXHA 4HSOA 2H3DA 1DVJA 3H2NA 1WZMA 4PGLA 3NEVA 3LB0A 4F9DA 3KFTA 4GQRA 3RLVA 3S46A 4JTUA 1B4EA 1XP3A 1MZRA 1ZNNA 4L6OA 4DJDD 3GTXA 2FDMA 3EWUA 5T8GA 5LGXA 4H8VA 5I07A 4KCWA 4QGCA 2J47A 3QPEA 1D3CA 4HU4A 3ZYZA 2GUBA 2BGQA 1OEPA 4MUPA 3MZ2A 2G97A 5REQA 3SCOA 5C9XA 1UJQA 4DF1A 1J0KA 5CCZA 1VP5A 3GU9A 3BSMA 2ZRZA 3PFMA 4WY0A 4DO5A 3MC5A 1OYAA 1BWKA 3U7BA 1YDYA 2KX9A 4X2RA 2VDIA 1BF6A 2QCCA 2FZ9A 4UXDA 4BF5A 4QP0A 1C29A 3S2MA 2ZBTA 3AMDA 3VD9A 1MEHA 2J88A 4XZNX 4IIFA 1J12A 4ERIA 3IACA 3KL3A 5LHEA 3VTRA 3WLLA 4WKFA 3ZVHB 1OJXA 3N2BA 2BVTA 3A47A 3F4DA 3A12A 5AY7A 3UPBA 3VUPA 1OC7A 1GYMA 3PVFA 3VKJA 1ZAJA 1HJXA 3N12A 3S1GA 4IIGA 3E74A 5HWJA 1Q6EA 4E2BA 1NWUA 5T26A 4UFMA 4GISA 1YIXA 2RDUA 4PTVA 4FP1A 1GOMA 3FXGA 3WNOA 4FNQA 2HXUA 5I06A 4GI4A 2Q71A 4DZHA 5HOSA 2WZMA 1TQXA 3QYSA 3LX9A 3N9SA 4ENLA 1A0CA 1YX1A 1X38A 2XDFA 4L4LA 1JQVA 3M6YA 1GTHA 2QF7A 4LCSA 3UPMA 3WL1A 2GZXA 3N9KA 2E67A 1SU5A 3M0XA 3E96A 4XD4A 1XINA 4NI8A 2ZCGA 3BE7A 4GWEA 4LUJA 1S3HA 4W87A 4JFWA 1RVKA 3BGGA 4KCTA 4KWUA 4MY1A 2GQ3A 1EXBA 5CLTA 3W88A 1PTGA 4NL1A 1MRQA 4FF5A 3KBNA 3KBSA 1HJSA 3KOWA 2H8XA 2QCMA 3S4TA 1HJQA 2HK0A 2O9PA 4US5A 4CU7A 1UMLA 3L2MA 2I57A 1B3VA 2WCGA 3CT2A 3LM3A 1WNOA 4XD6A 1J6OA 4NIRA 2W0UA 4A3HA 4H9YA 1UWUA 4JIHA 1S2UA 3LI1A 3XIMA 3WELA 5BZAA 2BS9A 3G1YA 5F7UA 5HJXA 1E1FA 2ZRXA 1D3HA 4WDTA 4HPNA 3H54A 3W29A 3L5LA 3LS9A 2OMAA 2QAPA 3ZLFA 1NOUA 1XFBA 5G5IA 2BZNA 4FXSA 3NGJA 3ITXA 2EPLX 4H8NA 4J3ZA 2WANA 4MNJA 5D37A 1KXHA 1CB7B 2WZIA 3OG3A 2HJPA 2VZOA 1UC4A 1EGZA 1UPMB 4FXFA 3NM3A 3RR4A 4PTMA 1RH9A 4N6EA 4UFLA 4PZVA 2PGEA 4PSPA 2A7PA 3S6TA 3K5XA 2P1FA 1UASA 1RJPA 4UZUA 1SPQA 2GYIA 4C6MA 1LRQA 3LHZA 4YJ5A 3NQMA 1JCNA 4MB3A 1O6IA 3HTWA 1R6WA 3VU2A 1P0BA 3VMNA 1W1ZA 4Y9PA 3MVTA 2PLCA 4OJYA 3AHYA 2VD9A 4ICNA 3VGBA 3EOSA 2UZ9A 5LYRA 4R27A 2BY3A 5AN7A 2JGYA 2F84A 3VKKA 3L4XA 3W25A 3QR1A 3D3FA 6XIAA 1EIBA 2VEFA 1UZDA 3KCJA 4AZCB 3TYDA 1FBAA 1XFCA 1OFBA 1VRDA 3ALGA 3SCQA 3CZJA 3EA3A 4C6JA 3NAVA 1EBGA 3HJEA 1LBLA 4JIRA 3VGFA 4OOZA 3O16A 4R7OA 2HTMA 4JNYA 3WLHA 3NWRA 4O1FA 1PDYA 2Z00A 1M1BA 1SW3A 7PTDA 3C3NA 4LUSB 4PRRA 3DDMA 1DJGA 2BY1A 3SM0A 4A4AA 3MUAA 4GZIA 1JCTA 2ZTKA 1P48A 2NX3A 1EFZA 2VP8A 2WVVA 1J0YA 1BHGA 2NQHA 1DJWA 1UKQA 1SGJA 2RHGA 5CGTA 1LT8A 1ZCOA 4CNSA 3ZLGA 3A13A 3DX5A 3QV6A 3OQEA 1ZFJA 2V5BA 1OGBA 4GOAA 4ZR8A 3KLLA 1W54A 1FHDA 4C5ZA 2QS8A 3SQSA 3KXQA 4KEVA 2V3DA 3E5BA 3PZTA 1W9DM 1TMHA 4AWSA 1QK2A 5AVNA 4BF9A 3UU0A 3CMGA 1KFLA 4NXSA 1EJSC 3KBWA 3DH7A 4D9PA 4JTRA 1JR1A 5DLCA 4GY0A 3WQFA 1VJIA 2VX6A 4DHGA 3GTIA 4DY1A 3EDKA 2PDCA 3M5ZA 3SUVA 3QH2A 2XN0A 2V5CA 3NDYA 3AHTA 3N19B 5CEWA 3F4CA 3G1VA 1D3GA 1Z41A 1YQ2A 1VEOA 5BOOA 8CGTA 1K70A 1DHPA 6XIMA 1W1VA 4ONVA 4QLKA 3FSTA 3ANYA 3LERA 4UQCA 1PWMA 4C1NB 1LRTA 2C1GA 4Q7NA 3ABRA 3D6NA 3TW6A 4LCQA 1H11A 1YMYA 3PP7A 4K8GA 3UJRA 2F6UA 2BX7A 5F4WA 1SSGA 4H9XA 2WSKA 4A8NA 1KFEA 3MHFA 3W2MA 4B5NA 1QCWA 1PDZA 2KZHA 1U5HA 1M5WA 3RMEA 1XLIA 2JE8A 1EXPA 1A5BA 3PSVA 5CPTA 1NSJA 1CW2A 3GYCA 3GG1A 1W3HA 1JUKA 1X1ZA 4UWMA 3WK2A 2GGJA 2V5DA 4YYCA 4AY7A 3GDBA 4HPJA 3KOFA 4Q22A 4GY1A 5IHSA 3PZOA 1LL7A 3FHQA 2V30A 5JIWA 4HJFA 1EZWA 2AGTA 4JFTA 3K8KA 4B91A 3ANUA 2VEMA 1E9ZB 2D0GA 3KP0A 3O6DA 2ISDA 1LUCB 4MOZA 4FMVA 4UMAA 2BODX 4GH3A 4E0CA 5I09A 2XSXA 1W1TA 2WNWA 1Q8AA 2P0OA 3TXZA 4GVFA 2XTKA 4W84A 4WK9A 1I6NA 4YWIA 4Z1BA 1FRBA 3SR7A 4JTKA 4G56A 4BWLA 1DWJM 1XDLA 1GOKA 3GTFA 3T78A 2NWRA 3LLDA 2EG6A 1I1XA 1EDQA 1LLOA 3DEQA 1RK6A