3H2AA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
261
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 261
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2aA00
3K13A 4NIRA 4NILA 1Q7ZA 4S38A 4MWAD 4DJFC 1AD1A 3V5OA 4NHVA 4DB7A 2VEFA 3H21A 1Q8AA 3H2CA 3TZFA 3BOFA 2VP8A 3TYUA 2Y5JA 4D9PA 4DJFD 3H2EA 4D8ZA 2H9AA 1Q8JA 4NL1A 2Y5SA 3TZNA 3TR9A 4S39A 2YCIX 1TWSA 4CCZA 2YCLA 4MWAB 2DQWA 3TYEA 3TYDA 1EYEA 4S3CA 1TX2A 3H22A 3NOYA 4S3FA 1TWZA 4MWAE 4G9PA 1AJ0A 2BMBA 2YCJA 4C1NA 2VEGA 4DAIA 4DJEA 3H2MA 1Q7MA 4S3EA 3TYCA 2E7FA 3MCMA 1AD4A 3TYZA 4S3AA 1TWWA 4D8AA 2DZAA 1Q85A 1Q7QA 4PZVA 4S3BA 3H26A 2H9AB 3H2FA 4C1NB 4DJDA 4DJDC 1TX0A 4DAFA 4S3DA 3BOLA 5JQ9A 3H24A 3MCNA 3H2OA 2Y0FA 2YCLB 3H23A 4DJFA 2DZBA 4DJEC 1F6YA 3H2AA 1AJZA 3TYBA 4O1EA 1AJ2A 4S23A 4O0QA 3MCOA 2YCKX 4MWAA 4MWAC 4DJDD 4HB7A 3TYAA 4O1FA 4DJED 3H2NA 2OGYA
chains in the Genus database with same CATH superfamily
4JNZA 3BL3A 4HGXA 3OVRA 3ATZA 1R0MA 3GBDA 1CXLA 1ZPTA 1B3ZA 4LYPA 3CQ0A 4QLJA 3VKDA 2C15A 4K8GA 4OUIA 4M80A 1LL7A 3UW6A 4H00A 1P1MA 2WYSA 3G2GA 4C6PA 5FJRA 5BOEA 4XZMX 4TX9A 3CO8A 2NW0A 4JICA 2YL5A 1UJQA 1I2PA 4ICMA 2X8RA 3TCEA 3TYEA 1IWAA 5KSWA 2QDGA 1EFZA 5TNVA 1L2QA 2YR1A 3TC3A 1NFPA 1ECQA 3BURA 3TTSA 1WCGA 3VIIA 5FA5A 2GQ8A 2V6AA 5BRPA 2ZUSA 1UR3M 1I60A 3OPSA 1XD0A 3F1QA 1FWIC 3ZYZA 4MJMA 5KTLA 4EACA 2Z2UA 4Q7NA 1V02E 4CN6A 2ISVA 4H7ZA 4QBXA 1MNZA 3L4VA 3AIRA 4B90A 2IXUA 1UKOA 4F66A 4IX2A 4Q3MA 2OR2A 3T55A 2ONEA 1SO4A 2FVKA 4TQTA 4GLEA 4R7WA 1K70A 4WJXA 1JCXA 1J11A 1H1ZA 5HOSA 2YDSA 3UWEA 3OB8A 5CG0A 4CEUC 4LALA 1MVYA 1SZNA 2IW0A 4MWAA 4U31A 4MWAC 1PXGA 3BTNA 3SCTA 1US0A 4B5VA 3UNDA 5AN7A 2L5HA 4ZGYA 3CZLA 4EAYA 1WOAA 5CPLA 3VOHA 4Y90A 3NPXA 2CHNA 3GTXA 1HN1A 4HOWA 2PWUA 4NHVA 1E4NA 2GGGA 2D20A 4UTHA 2NUWA 3G1AA 1MMFA 4LY8A 4F9DA 4Z0SA 4PBEA 3PTDA 1OFQA 4IIFA 3GC5A 2QCFA 4JTRA 3PK7A 3VIMA 4YCPA 1R3WA 2WSYA 3OBAA 2YL8A 2O56A 3TUUA 1VPQA 3MU7A 1NH6A 3COTA 5JBDA 1A5KC 1HJWA 1F3XA 1OFPA 1BLIA 5DRCA 3W37A 3WUFA 1XFBA 5REQB 3TW7A 4ZB0A 1OX4B 4NXKA 3TV8A 1EP1A 4HU0A 3NQEA 3FDKA 1W1YA 3CUHA 3NG3A 4UTFA 2CKRA 4D8AA 1ZBWA 4AG0A 3L0GA 1EP2A 3MO4A 4HSNA 3T6CA 3UJFA 3LTYA 4DVOA 2P8CA 3K8MA 3QGKC 1VCVA 1EC7A 1HL2A 5LZLA 2JE8A 4XD4A 3EX1A 4KFPA 3FHQA 5M17A 3E5PA 4MJ2A 4AISA 4M8UA 2XH4A 3GW3A 4DJDD 3DXIA 4M6VA 4J28A 5FF0A 4WEVX 2P53A 1CGVA 1AL8A 1IXPA 1S2VA 3CQHA 3TN3A 2JF7A 1L6FA 3VNJA 3EX4A 4JX6A 1EH9A 4E4UA 5A8OA 3EX3A 3C0QA 4HHMA 2WJFA 1KV5A 4C6EA 3ENLA 5FCZA 3MKCA 2FB2A 1XLLA 3NIYA 4NZ3A 1WDQA 3OIXA 1NF7A 3ZSSA 2FDSA 5BWFA 1W5OA 1IT8A 3KVKA 1GVOA 1EKOA 3N12A 1YE4A 3OG2A 1JAKA 1EJUC 3VNKA 2ZX9A 3TAKA 4KRTA 3BE7A 2EAWA 3GQYA 1EQPA 2PDHA 1TG7A 3U8GA 4ACYA 2WC3A 4LCRA 1DE6A 1WBHA 1O94A 3R89A 1P48A 3WUEA 2GUUA 2NQHA 5HJLA 1EEPA 1PX4A 3PJWA 4FXFA 3PTMA 4GXPA 1JDAA 4QCEA 4M5PA 3PANA 2OKTA 4KWOA 3BV7A 5CJNA 1QBBA 5JQ9A 1G94A 1RK5A 1BKHA 3OBKA 2CITA 2BLEA 5DMYA 5BMXA 4Z0JA 1BG4A 3SADA 5C7VA 2NXGA 2TYSA 3QVQA 2QJJA 1NDZA 4PTNA 4Z17A 1VIWA 1E3ZA 3KLLA 1IIHA 1VBRA 3SAZA 4B3ZA 1T99A 1TQXA 2OX4A 3TNOA 5AYIA 3TQ0A 3M0IA 3V5OA 2DV0A 1PSCA 1TB3A 1J8VA 3UCCA 3GFXA 3AIWA 3WLSA 4UQBA 2WHLA 2XIMA 3T0CA 3EOUA 3IGSA 3SZ8A 4O0ZA 1HKIA 4DWSD 3G8EA 3NNTA 4DWSB 3C8NA 1OB0A 1R2SA 1E0XA 2VNCA 2PRHA 3DYMA 1XICA 5CC5A 2GJXA 4FEZA 3BLLA 1X6NA 4MFDA 1XGDA 1YDNA 2ZRZA 3QMSA 5HMFA 1HUVA 1M04A 3T05A 3QV8A 1WAWA 1AL7A 3F2CA 1NEYA 3NPVA 3RAOA 4W4QA 1U1HA 2IQTA 1KM5A 2D22A 1OG0A 2POZA 3BMXA 2BY2A 3N19B 1SSDA 3VYLA 1TPWA 2CERA 3HMJG 2XFWA 4NX0A 4REQA 4P8VA 5LNVA 3C61A 2QCGA 3TKFA 4HK7A 3VD7A 4GI8A 2E09A 3JW7A 4KCUA 1E1FA 3PAOA 4HPHA 4DM2A 3DIPA 3W07A 4JIIX 5C54A 3ZLGA 1PB0A 1B30A 5MKGA 3CZGA 2J9ZA 1QPNA 1LTDA 2PGRA 3RCYA 2WSRA 1QI0A 1MW0A 1S5WA 5I3IA 2ACSA 5F4SA 1FWDC 2YDAA 4BKNA 2CW6A 3W4RA 2QIWA 2ATMA 1OINA 2VENA 3LERA 1DJQA 1B9ZA 1V7YA 4C6MA 1ZCOA 4OJYA 2ISDA 4C1LA 1PCWA 4F2BA 2KZHA 3U7BA 3CMJA 1MDRA 1J0HA 3MBFA 3PB2A 1ZAIA 3NEHA 4L4OA 1F7BA 2XFRA 4MB3A 1YADA 3VGGA 3CAQA 1XRTA 4GIRA 1V3IA 1UKSA 1D7FA 2CZ5A 3RLUA 1ISXA 1Q7MA 3C2EA 1HGWA 4AZ6A 3PZGA 1UUQA 5HQLA 4A6GA 4YU1A 1XHGA 4GNVA 4FX8A 3UXDA 5CGTA 1A3WA 3R10A 4IFOA 1A49A 1WO2A 4GJIA 2Q01A 4LANA 3V7PA 3ZR6A 3QKEA 1S38A 4L4PA 4LEFA 4DZAA 3EXRA 4O50A 4Z1DA 1NY1A 5D8WA 3LHUA 3MZ2A 3R25A 4GZJA 1A5UA 5TQLA 4ZSUA 4RPQA 2VDHA 3GAKA 2YPIA 4GD0A 1FY6A 2UZ9A 1CB2A 2A85A 3WD2A 3N2OA 2ACUA 2AAMA 5D04C 1FBAA 3MKVA 1TVPA 4PMYA 1X39A 2KAUC 3T0BA 3NQ2A 2O4MA 3TP4A 2VX7A 8A3HA 4NIRA 4PB4A 1IXNA 4Z2GA 3CHEA 1OZMA 1ZP3A 4DB7A 1S1RA 3WBYA 1GGOA 2XSAA 5D8ZA 3NQMA 4YWSA 1OYCA 2JIWA 2PODA 3O6CA 1D8CA 1MEHA 4JGDA 5D2YA 4RDWA 1WKEA 1H51A 3IACA 2QULA 1RLDA 1W9PA 3GZAA 2P10A 1LT7A 3GH7A 2A4AA 1WXJA 3SN4A 1P1XA 1UB3A 4LRTA 4RX0A 1HFBA 2DVTA 1LOSA 2OELA 3HOJA 4XZHA 2VURA 4ZOEA 4H8VA 3H2MA 5AVNA 3NM1A 3TFXA 2WNWA 4A3UA 3M0XA 2E8YA 3VKBA 2BVDA 3B3DA 1ZY9A 4PTVA 1VAHA 3MB9A 4YJ5A 4HNCA 3C52A 5M5DA 4ZCWA 3DH7A 4G7EB 1EDQA 3VNDA 3CLWA 3KX6A 4S3DA 3VOCA 3VNMA 5DBTA 3PN8A 3B4UA 2XJ7A 1XW8A 2CLPA 2DT2A 4KWWA 4D6GA 5K4ZA 4FNQA 2VUNA 3WCZA 1PTGA 4FZIA 1EEXA 1V6TA 2NXIA 2CXGA 3S2MA 1H2JA 3NOEA 2WSPA 1Y5VA 3KVJA 4D2JA 4Z42C 3TA6A 4AZ5A 3HFYA 3OA5A 3GU1A 2GJNA 4HOXA 1OFBA 3M0LA 5LGXA 2PDGA 2QLYA 2PURA 1ITQA 3LDVA 3PNUA 3XINA 1Q8JA 3EOLA 4GVIA 4UTWA 4UTWC 1EL3A 3O8AA 4JFVA 2VFIA 1XKJA 4O18A 2R24A 1DQWA 3HPXA 4S3FA 3LM7A 1GYNA 4DLFA 3S9YA 4C90A 2LLEA 4MVAA 1KV8A 1Z41A 4QIUA 3WH7A 2G50A 4O1DA 2PWGA 3RDKA 4ASTA 1F73A 5FI8A 5TAOA 2C1HA 1KKRA 3P0XA 1YE6A 3CH9A 1XYAA 3DENA 3V1HA 3TTOA 3FHAA 3LTSA 1H63A 4GKTA 1WPCA 4QS6A 1B2YA 2INEA 1EJXC 1F6YA 4ROQA 3LSCA 5CPSA 3GIYA 4N4PA 4B5XA 4C7GA 2UY4A 1GORA 4LYQA 3BMVA 4JTEA 1JPKA 1E40A 4TX8A 1FCVA 1VJIA 3BZGA 4UZSA 2YBUA 5CC7A 4JTKA 4PBFA 5CSSA 4KWUA 2DZTA 4JOMA 1UKPA 3TZFA 2FMNA 3NXFA 3QTPA 1T0OA 4WJEA 2VEPA 2PCQA 3QMTA 1AQ0A 4NRRA 3ZM8A 1AMKA 1WV2A 3WUGA 4Z2JA 3EWUA 3EWCA 3GC4A 1RVGA 2ALRA 1JVNA 1NAL1 1V6UA 4JIHA 3W23A 4N0RA 3RN6A 4AVFA 3WQVA 2D0HA 4RL3A 3HV8A 3OZYA 3RYSA 1XX1A 2QJMA 1RSCA 1OWQA 2JGYA 3GG1A 3URAA 1GKPA 1BQCA 2FTWA 3LCLA 1WDDA 1RR2A 4I9MA 4AD1A 5CCZA 1TTIA 3SY8A 1X8FA 3OU8A 3QBUA 1VJZA 4DJEC 4KCWA 5CJ5A 3W2JA 1HZYA 3EA3A 5GJPA 2UV8G 1VQTA 2Y5EA 2TODA 4Y8EA 3UQNA 2E25A 4PMXA 3M5ZA 5REQA 4K1GA 1OX4A 9XIMA 1RALA 5C9ZA 1JCNA 3L5AA 3LMYA 1W91A 4GYKA 2I56A 3GB6A 2J25A 4O28A 4D6EA 3KTCA 1WKFA 3SUUA 5L9FA 4F0SA 4L4MA 3G1HA 2OQYA 4MZ8A 2D23A 4M24A 3WDJA 3FGCB 3FSTA 1SO5A 3NFUA 2EG7A 3NURA 1G6CA 4CNPA 3PPFA 3GXNA 2Y6ZA 5CC6A 5EU9A 2ON3A 1LRQA 3DOPA 4DBDA 1DJGA 3IRDA 4CLMA 4Q8OA 2VCCA 4KT2A 1F8MA 3N4AA 3A9IA 1QI3A 2XGBA 3RX3A 3M0HA 4I3GA 2XN2A 3MKKA 4HTYA 5AFDA 4XBKA 3F2BA 1P0KA 1W6TA 5G2IA 3G6LA 2DT3A 1JQVA 2BVWA 2H8XA 3W26A 3HM7A 2C16A 2NVDA 2F2KA 3GXMA 4PEKA 2CXEA 3LCWA 1WUEA 4M6UA 1YPIA 1DE5A 3IAQA 2Z6JA 4WSKA 5JXQA 2I14A 3AOFA 3C8FA 3GU2A 3U3HA 2XVPA 3OVGA 1KCZA 3TTEA 1QWKA 5H6HA 3PWAA 5T9BG 2XH0A 1LJYA 1IXQA 3W29A 3I4EA 3V35A 4MG4A 1K7EA 3V4BA 4GE8A 1IXOA 1FHVA 3WFLA 3VPLA 4DF2A 2OG9A 3NZGA 4BI6A 3TX9A 2EXOA 2NLYA 3BGGA 4PA8A 4K7YA 3TN4A 4GPNA 5HNUA 3UG5A 4GG9A 1SU5A 5TBOA 4IFKB 9CGTA 1IZJA 3RXZA 5IHSA 4AMCA 5M1TA 4PE8A 1XWYA 1MI3A 3IEBA 1GQNA 2XIOA 3A5FA 4L9ZA 3LRLA 3VGDA 4X60A 1JAEA 2BOGX 3WLTA 1ZBVA 1AK5A 4W84A 4K39A 1RJQA 2YA0A 2CHRA 3LU2A 1FHUA 4Q4OA 1AUSL 1FWCC 2Z24A 1BEUA 1OG6A 3JR2A 2V5LA 3GYCA 5HA7A 3C2YA 5D9MA 3S5NA 4DWSA 3MMTA 4QDWA 1A0DA 1JGMA 2KX9A 1KM2A 1N82A 5G1TA 2Q02A 4FO4A 5J5RA 1MDLA 3AWOA 3EA2A 3WBEA 5HJYA 2JGQA 2NXHA 1W3IA 1RBLA 3RILA 3WMSA 4V1YA 4MF4A 1YW1A 1LG1A 2NWRA 2Z1SA 4UOZA 1Q6FA 1R9YA 4LYKA 1G4EA 3APYA 4FF7A 1JIBA 4RE3A 1YPFA 4IH3A 1TV3A 4PRTA 4POCA 1U5JA 1E51A 2A3CA 3POCA 1ONWA 5FEWA 3W7QA 3W1NA 3PJUA 5I79A 3TJLA 4Q22A 1IQ8A 1E6NA 5EY5A 7PTDA 4QG6A 2YSWA 4KGJA 4DO5A 5IRPA 2PDJA 4I9AA 4CCZA 2NV1A 1KLYA 5CLWA 4YPJA 1WX0A 4RE2A 2IPGA 1EGVA 5K3VA 3N4EA 2GGHA 2C18A 3WLHA 2J8TA 3W02A 2OFJA 2FHFA 1TYGA 4GYPA 5D05A 4GYPC 1IZKA 1BQGA 3DFSA 1VLWA 1I9CB 4C6OA 4K7VA 5HMEA 3WQWA 3SSZA 5K2ZA 1SSGA 1WUFA 3UJSA 5HULA 3E0VA 3KBVA 2Q8LA 1S2UA 5BU6A 4EP8C 3HPAA 3EWZA 3OLIA 5HANA 3UY7A 4K6AA 4LY4A 1TCDA 3DECA 4LSBA 1XRFA 3ZVHB 3W82A 4HZMA 1E0VA 1Q6RA 3E02A 3QGAC 3WQFA 1CGXA 3KWSA 4HB7A 2XG9A 3AS3A 4MNKA 3MSDA 3M41A 2YFOA 4JZ5A 2CZEA 3B9EA 4Q8NA 2PEVA 3SECA 1FXPA 4ZQPA 1QK2A 3W1TA 2PCEA 2IPJA 2TMDA 4IMDA 4W88A 1ITUA 3HA1A 2ZX7A 1XBVA 4LVAA 1XINA 3EWWA 3N9RA 4JYEA 4PSPA 4O15A 1KGWA 1W2PA 2P3ZA 2D2OA 2YCEA 3J7HA 1HVXA 3M0YA 1UH2A 1ODUA 3TDFA 1E4IA 2WJZA 4KRUA 1FQ0A 3TNBA 3TWBA 3FYOA 5AHMA 3DBPA 4GABA 4ZQNA 2X7VA 2VJXA 1BXCA 4PMJA 1YDYA 1OT2A 1US3A 3MV01 3O2LA 4DBWA 3BPWA 1H4PA 5DT5A 4C1NA 4W7VA 5AZ1A 2QCDB 3MUZ1 4AZBA 2RJGA 3GNOA 3RCNA 3IJIA 1E70M 3M9YA 1R6WA 1GVIA 3T07A 3EX2A 2G5WA 3LI0A 1K8YA 1JYVA 1AZ2A 5D02A 4IGHA 1XUZA 1ZTVA 4RE0A 3VD4A 4B5UA 4B5TA 5FF3A 4JN7A 4O14A 3KW3A 4HTBA 4YTTA 3DC8A 1L9WA 2CZDA 7REQB 2DSKA 1SO3A 1CX9A 5HMSA 1ZHAA 3SN1A 3VC5A 2VL4A 4V33A 2A0NA 1QRQA 1OC5A 3KTXA 2VMFA 4O19A 1TMLA 3S2JA 1ZS2A 4O1CA 2PRMA 3WMCA 3W22A 4F9JA 2UBPC 4JBRA 1SO6A 3PFRA 4ATLA 1YPXA 3TXVA 1JR1A 1EHNA 4OU1A 4G7EA 4AXKA 3KWXA 4JHMA 4RNIA 1TSIA 3LM3A 3P67A 1V5XA 3L65A 3Q67A 1XQLA 1HNYA 2FJKA 1B4KA 2PP1A 1TR1A 4J3SA 1JQXA 1ZAJA 3QSTA 4LX4A 3W83A 5A95A 2XUCA 4WDWA 4HNTA 1B3WA 3HG2A 1KCKA 1UW9A 3CMFA 1KGXA 3O05A 5A2CA 1OK4A 1RV8A 1KM6A 4JX5A 3O1NA 3EMCA 2FZNA 3VMNA 3OVQA 1EGMA 5DX7A 1PPIA 2RKXA 1YTKA 3NZ1A 4L80A 3L68A 3EMQA 3IGUA 2PC8A 4EPDC 1RXOB 3CJPA 1BVNP 4I8DA 1JEZA 1E4MM 4UTUA 5DCEA 1JF5A 1ESWA 3TQPA 4JHZA 4JFWA 4AD0A 2BV9A 4O1EA 1YKWA 2PDLA 4GHRA 1ADOA 1M7PA 3U4AA 1F05A 1TJ0A 5CPOA 4N6FA 1T96A 4C65A 4FPSA 1JZ3A 2GVJA 4XK2A 2CESA 3MANA 1GG0A 1J0YA 2I17A 2Z25A 4X2PA 2Y7DA 3EKLA 3H21A 2PDKA 3TEVA 2OOGA 1VR6A 3SDOA 4E2VA 3W88A 3TA9A 4D6JA 4QR6A 2VP8A 1JULA 1TPFA 4XZWA 3I68A 3VK5A 4RW5A 2HJPA 1J6OA 3RO6A 3OGVA 2VGFA 1SW0A 1HIZA 2FFCA 2Z27A 3C0SA 2QT3A 5A8PA 1TE1A 1AH3A 3ELFA 3ARTA 3TE9A 3W70A 4IISA 1LOLA 3JUGA 2E28A 3THAA 2UWFA 1IEXA 2WQDA 3FEQA 4D8LA 2BDQA 1DIOA 3UZXA 3W7CA 3BXWA 3CB3A 4GUJA 2XIIA 3KBJA 1PBGA 3E1F1 2DY3A 3CUIA 1A5LC 1GZGA 3KBMA 1YBQB 4MNMA 5CJMA 3QW3A 1WA3A 4DELA 1N8IA 1PZ3A 1WYIA 2JFEX 1KRBC 1PV8A 1OQFA 3I3DA 3W25A 3VGEA 1O5KA 2QS8A 1EJSC 2WM1A 4RCXA 1F2JA 4WGHA 2X16A 1V0MA 1NQKA 5E0FA 1ZB5A 3TN6A 2ZE3A 1S2CA 4CU6A 3P8IA 3S47A 4O1FA 4IWWA 4RUBA 4XUGA 1Q13A 5EMKA 2QDDA 2OSWA 4GO9A 4D6DA 2QVNA 1TV5A 4NILA 2J6VA 1TQJA 2P5NA 4ADTA 4KIEA 4Y8FA 3CAVA 3RLGA 3UT0A 3RRAA 3PM6A 2YLLA 3E6EA 4FHAA 3N2TA 3THQA 1A3HA 1SGJA 1MO0A 4RK8A 1DJNA 2Y8UA 1RHCA 2DSZA 5G4WA 4RZ6A 4IMAA 4LUYA 2HNHA 4C6CA 1YLVA 3O7UA 3MWAA 1WDPA 1P6WA 2HSAA 3W7HA 2ZTJA 2UY2A 7TIMA 3K2GA 4RPPA 3W1XA 1C93A 1K8ZA 1X1NA 5FD0A 1Q2RA 4MJ4A 3KCJA 1UZ1A 1Z89A 1H7WA 2G3MA 1G4PA 3IIVA 3UR5A 1XI3A 1OEPA 2B4GA 5FAGA 4Y9MA 4AEEA 1TZ9A 4YS1A 3W2LA 2R6OA 3DI1A 1IR2A 3WH8A 3P7YA 4YN5A 3RNDA 2G37A 2YLAA 1GWJA 3BJTA 5FAJA 3BVJA 1U1JA 3FGCA 4HHPA 2OOFA 4S3GA 1C8XA 1GEQA 4N02A 4HK5A 4QQUA 2X1TA 4AWUA 2PMQA 1OFOA 1X7FA 2FZMA 2V82A 4FXJA 2VXNA 1K9FA 1LUCB 1VHCA 1M7OA 1TV8A 1PS9A 2ZRUA 3B40A 3CK5A 3KM8A 2PC4A 3H2CA 1THFD 3QZAA 3UXIA 1ZU8A 4HNUA 3P61A 4W5UA 4H6EA 2EG8A 4QDPA 3PUEA 2OYMA 3KDNA 1XLAA 1TJPA 3EAUA 1A80A 2DQWA 5CC3A 3AFBA 4WDUA 3BG9A 2GLKA 5HWJA 4JQ4A 2WWCA 5BMWA 3WNLA 4K68A 3I7RA 4G9PA 1EBHA 3QC0A 4DRSA 2O9PA 1OF8A 1W5NA 4NY2A 2J7BA 2DGAA 1UC5A 3EA1A 3BSHA 3SCQA 3NL2A 1FWAC 3OZMA 2A21A 1QNQA 1LWJA 5ABFB 3OA3A 4P8UA 1GVYA 1L2UA 2WMIA 3HV9A 4MOZA 3T44A 4GY0A 2I9UA 2HXUA 4GI9A 1R30A 5TD4A 1C91A 3GNNA 4TTGA 2V8ZA 1QJWA 3P60A 5I03A 4IFKA 1KRAC 1W1B1 3WJSA 3C2RA 1UJPA 1C7SA 2WV8A 5D37A 3AAMA 4DPPA 2BOEX 2YOCA 2CZFA 4OTKA 3BW3A 1VRXA 4JQ3A 3KHDA 1H61A 5D2TA 1KRMA 2UY5A 4G1KA 2FVMA 2BG5A 3QQ0A 4IQEA 1TELA 2V69A 3L4YA 3BAWA 5CZTA 2V38A 3REQA 3UZWA 4UTIA 1DWHM 1Q66A 4PUKA 2W62A 1Q5MA 3KE0A 1GT8A 1UBSA 3OQEA 4PUDA 1GOIA 4ZXLA 3GH4A 1U22A 1GJUA 2QF8A 1POJA 3BMWA 4O52A 2GL5A 2PB1A 3IV3A 4MWAE 4GIAA 3UA3A 2NZLA 3CPGA 4H2HA 3DAQA 3KUMA 3WLJA 1FCBA 2RGMA 4J9JA 4H9UA 1J2WA 1KQZA 4FNTA 4O57A 4XX6A 4XKMA 2PLJA 1BGGA 4UCFA 1XKYA 3ALFA 4X0NA 2A3AA 1JF6A 3GS6A 3MJYA 4M19A 3B8TA 3N9SA 4DAFA 4YXGA 3BOLA 4HMEA 4HCHA 2DDXA 3R0UA 5A6BA 3MVIA 3EPOA 1QW8A 3ARYA 3RLHA 2G4JA 4ADUA 1ZL1A 3UG8A 3URNA 1J5TA 3QV7A 2WPGA 3MSYA 3LBCA 3WKZA 3EOSA 1AVAA 4XKYA 1MWOA 3T1GA 1LWHA 2PU0A 1P0EA 4F40A 3MYPA 4LAUA 4D6CA 4HZ7A 1DQUA 3ZR5A 4C6DA 3WLNA 1GTEA 1EUAA 4A8IA 4J3XA 3WJZA 2GOUA 3AS2A 5BOOA 4IHCA 1WE5A 2WCSA 3FK4A 3B04A 3G1DA 2DU2A 3WF2A 3KOXA 4GINA 3UWUA 1VBHA 5F2IA 3VFCA 1TPEA 1DJXA 4LYRA 1UKQA 1W37A 3PNZA 3ZVHA 3CHFA 2GVGA 4PCFA 2VC9A 4M6PA 3W85A 1ME7A 3EWDA 2Z00A 4JYDA 3TONA 4HBKA 1QU4A 3WSUA 2A6NA 4F8XA 4IIGA 2CWXA 3KS6A 1GW9A 5E93A 4DN1A 1I0DA 2EPLX 2FZ8A 1UWIA 3DFHA 3UFYA 4IPJA 1EXPA 3T78A 3VAVA 2DZAA 2HV5A 1XG4A 1UMLA 4MTVA 4AZCB 1X96A 4YWIA 3LV5A 4IP5A 1W9VA 2GVYA 4IPNB 4ILSA 3APTA 3H24A 3LN3A 4DHGA 2QCNA 5DT7A 5CXPA 3GDLA 2W79A 3EZ4A 3GM8A 3IAPA 5FEPA 3U57A 3YPIA 1DHKA 1TV2A 2C7FA 3W75A 1J4EA 2E5CA 4MUZA 2OTDA 4AWSA 1CDGA 4W8LA 5C9UA 1Q6DA 2V2DA 3R43A 3SGGA 2I5QA 3ARVA 4DUVA 4PMUA 2C3ZA 2RDXA 4NZJA 3TW9A 2QCDA 3GXTA 1I2NA 4OOUA 4BHYA 4BZYA 3OEXA 3S2NA 3ZWTA 5I24A 4GZIA 3LV6A 2ZZ6A 3RU8X 1E5NA 4ML4A 5I78A 1EOKA 3S1WA 4UTTA 3S6OA 4N6EA 3VIKA 1DORA 3GAYA 4IFRA 2GSEA 3V36A 3EBVA 4K38A 5C6MA 1Y7VA 3NOYA 1UP3A 2EPNA 2PS2A 3SCNA 2ZC1A 4MAVA 1Q6OA 4ZEPA 2HQAA 7REQA 2X1IA 1HJQA 1H7PA 4XD3A 1NWTA 3EPNA 2P0IA 4HZ8A 5I3JA 1MRAA 4JQ2A 4GOAA 2WVSA 2YB4A 1LP6A 2PWVA 4R5EA 3LRMA 1KC7A 1XSKA 3NSNA 3ZO9A 1YXYA 1GOOA 3VZXA 3NGJA 1EHAA 1GOMA 5DN1A 1FWJC 4LUTB 3CZKA 4IXXA 1H41A 4H3DA 5F4WA 1HJUA 1OCBA 2R1NA 1HKWA 1E72M 3SY5A 2OU4A 1SFLA 3LBMA 5HNRA 2WBKA 1V0LA 2VZVA 4JHOA 4J40A 3BV4A 4JD4A 6A3HA 3ALGA 1P5BA 2FH6A 2CPUA 1X98A 5A8GA 4IP7A 4HD5A 4W89A 1XC6A 1AW5A 3UVAA 4DJFC 2Q09A 2EBNA 3CAWA 1CT5A 4JYFA 1LBFA 2PE4A 4F0RA 3KP0A 6XIAA 1L6YA 2YW4A 1JNDA 3VINA 2J13A 4H7VA 2WHJA 5XIAA 1RCOB 3MUY1 4H1ZA 1IEWA 1E55A 2ZBTA 4GY7A 2QEZA 3TU9A 3DCPA 4UMCA 1MQRA 1UA3A 2EPMX 4DBSA 3WD3A 3INPA 1J9YA 4HYRA 3V0UA 1G1YA 3BH4A 1XLDA 3G1YA 3W9ZA 2QF7A 5U4NA 3CQKA 3DHUA 3LPOA 1OX6A 1R9XA 4XO6A 2WNNA 5M03A 1RCQA 5ECVA 4GBUA 4HPJA 3WNNA 4ZBCA 3MI6A 3GR4A 5EBAA 2FHCA 3GHRA 3OODA 3HJEA 4MYAA 1ZBCA 3NQDA 5LA1A 3N34A 2PLCA 3NZRA 3NDYA 3B9DA 4DUXA 2O92A 2D1ZA 1TUXA 1G5AA 3O6YX 3S1GA 4O8AA 4A4AA 3S5ZA 4JTHA 3NVDA 1UQYA 2ZRXA 3THCA 1UUOA 2WCAA 3AICA 1LORA 4UR9A 3GW0A 3ARSA 5IFPA 1PTAA 3FIGA 1YNQA 1JDFA 1OX5A 3S42A 3CZEA 4V15A 2QW5A 1EPXA 7ENLA 4UFLA 5JBEA 3E38A 3TQVA 3OO2A 4D9PA 1CGWA 1ICPA 4B91A 1YBQA 1E9LA 3SB0A 1YRRA 2E9BA 1V08A 2A1YA 1WZMA 3G1VA 2MANA 5G2HA 1W9DM 4EKJA 3S5OA 5A6MA 1Q6QA 3NPWA 1EA0A 3M1ZA 3L67A 2BSLA 3PUDA 3HJZA 4KFNA 4B9ZA 3F03K 3WLKX 3ABRA 1XIBA 1KBKA 5HWNA 3K4AA 2VX6A 2BWGA 2Y70A 2VDGA 4E2DA 4OKDA 3SFKA 3KAOA 2R14A 1ZCCA 5I6SA 1KXTA 2PBOA 5G1YA 2E8ZA 3S9ZA 3LTPA 1NOFA 4QX4A 1JXJA 2XH2A 4AIOA 1EWDA 2CLIA 3AZRA 1DHPA 4WKAA 2QUUA 2AOSA 3BUVA 4MLJA 5A6LA 3CIWA 4H2CA 1JYXA 2PBGA 3T81A 5G2WA 1ICQA 3N3MA 2WAGA 1F76A 1JZ4A 4XSLA 3O6AA 2JEQA 1NWRA 4EF9A 4E4PA 3VX0A 4AQLA 4MWAD 1DWGM 3AISA 4MYXA 5FJIA 3VOJA 4AZGA 3LGGA 1EF2A 3AI0A 5GNZA 2A5HA 1YHTA 1RP8A 4CQAA 1R9ZA 1GHSA 3D0CA 3LGDA 3PBWA 2X0SA 3HQPA 4QP0A 3NTYA 4MPQA 1E1CB 3TFCA 4C5ZA 2I5IA 3U2EA 4KEMA 2R91A 3S5SA 2WC4A 4LVBA 1E56A 3VE9A 5CZ0A 3MI3A 1IEIA 3O07A 2A6LA 1EGZA 3WG6A 4FLOA 3ARXA 4UFIA 1V03A 1W3HA 4PN2A 4CUCA 2ZUUA 4XISA 1QOQA 1XV8A 4U2YA 3FAXA 5F1VA 4BY3A 1U5HA 1ALDA 1LUCA 3GD6A 1B9BA 1V6WA 9XIAA 1PYFA 3A13A 1Z69A 1RAKA 2B7OA 1UP2A 3BICA 5B7YA 2H9AB 5T91A 1FWNA 3RK8A 2ZOXA 2ZRYA 4O1BA 2IS7A 3NQGA 4CNUA 4RKAA 4QDMA 2QZRA 4LXFA 1U5VA 3KL5A 3BWWA 4N42A 2ZRWA 2IKIA 1KLZA 4UMBA 4UFKA 3AU2A 4LB4A 2WMJA 5BU9A 4I5RA 3VVGA 1CLXA 5LIUX 1KW1A 5M2FX 4AW7A 1I6NA 2VZOA 4RR4A 1PUDA 1TPB1 5LHFA 4EF8A 1UWUA 4IUGA 4US6A 4Q32A 1VFHA 1E0TA 3GDBA 5LSMA 4PUMA 4C6NA 1UA7A 3BLIA 4FNSA 1IR1A 5ABFA 3TJ4A 1JZ2A 4L1WA 4NZFA 3M5VA 4IL0A 4U28A 2J8FA 3IK2A 3OJGA 4HSOA 3N9KA 2XZ9A 3MUXA 2ZXBA 4DNMA 1NWSA 2PRLA 3R8RA 2J27A 4XBJA 5LYRA 3PS7A 2GSJA 4EXAA 3DFYA 3GTIA 4IIDA 2GDVA 4RNFA 5CBJA 5HK4A 3SQLA 1IT7A 4GH1A 4W86A 3P81A 4X0VA 3PJTA 3PHAA 5I3HA 1NDWA 3B8SA 1QI4A 2FGLA 2QCMA 4DIAA 5HUPA 1O5QA 1SW3A 1FTXA 3UZYA 3VKKA 2GVLA 3GK0A 1XCFA 4PFHA 3SIMA 1PCKA 1XS2A 2EQDA 3B8DA 2PZNA 3IJ6A 1SZGA 1YDOA 3WNPA 4HNNA 4AZHA 3BW2A 3B0VC 4IGNA 1MW3A 4I9TA 3LSBA 3XISA 4XAGA 4CCEA 1E6PA 3LEPA 3OTRA 2O4QA 4AY1A 2ACQA 3LMZA 3VZYA 1RPXA 3TYAA 2NT1A 3QPYA 2GWGA 4MB1A 1I8JA 3CV1A 3M6DA 2ZDSA 3BARA 2PGWA 3W1LA 5J5DA 3BAYA 2G8ZA 1EPVA 3T0AA 1TA3B 1EOMA 1VEMA 2ZXAA 4CNTA 1UZDA 1O12A 3ONCA 1CCWB 3SURA 3GFYA 4QJ1A 1H7NA 4G1NA 2WNZA 3N13A 3AQUA 3M0JA 3LB0A 4DLMA 1M01A 3SQSA 5DLCA 4GQ0A 2PDXA 4GNJA 4MZYA 5I02A 5IDZA 1V3MA 2ZUTA 4BQ5A 5FSDC 3L4XA 3D47A 1W5QA 4LS2A 4XIAA 2QNEA 4A8RA 1A3XA 1KR1A 5AKQA 4XTDA 2DZWA 1XC4A 4GUGA 3W01A 1PJ9A 1FP9A 4DXXA 4ZO9A 5FKYA 2PLMA 1XFCA 3FOKA 4UQEA 4UOQA 3RJYA 6REQB 4G7FA 4LV4A 3RITA 2HBXA 2EJ1A 2ZTKA 2E9LA 4W7WA 4NNBA 4NP7A 2PD5A 5I07A 1S2AA 4UCGA 6PTDA 3A4WA 3E74A 4J3TA 3ITVA 3PFMA 4G6CA 5DMNA 2X0YA 1VFLA 1ZJIA 5LKYA 2ISSA 2P8BA 5ABGA 4Y7EA 3FAWA 4ZQMA 4B2DA 4CU8A 7A3HA 1GYMA 1QUMA 3O0FA 3NZPA 2QR6A 3I6RA 3PZIA 1ZJHA 4YTQA 3M0VA 2WHMA 1XIDA 3DERA 5CPMA 4LH8A 1KFWA 1KFKA 1NP2A 2B7QA 1J18A 1N7KA 2G95A 1XDMA 3HQ1A 1A4MA 2Z2BA 5FACA 4ICNA 4E38A 1QI5A 4B5WA 2E6AA 2DIJA 1KM4A 3UWVA 4AZCA 3UWWA 2HDJA 2F6XA 1SR0A 3WF3A 1VP5A 3HB9A 4U33A 2ESCA 1CPUA 2A3HA 4PL1A 1O4UA 2NQJA 3M47A 3EB3A 3STGA 1L6WA 3OLDA 3DUGA 3ANVA 3CHDA 3MC5A 1XIEA 2R82A 4MY9A 2GUYA 2G97A 1TZZA 1PWLA 1TO3A 5EL1A 3N1AA 1PKYA 2Y4SA 1XBYA 3IUIA 5I23A 3OQ8A 4OQVA 2ZX8A 3T2OA 3L12A 2VGIA 4H8NA 4FS9A 3ABOA 4CNOA 4QGCA 1F4HA 3STCA 4CN1A 2FJUB 1JD7A 5GJNA 1LBLA 4P5UA 3SRDA 5CGMA 1A4LA 2YBTA 4AVNA 1ODZA 3BDKA 1FKWA 3WJWA 3KRSA 3N17A 3ANYA 1W3JA 4TV6A 4Y96A 3ZT6A 3G0UA 1W9XA 1WNOA 2VX5A 1BYAA 4KRZA 4XAZA 3IK4A 1KGUA 1JUKA 4FIRA 3ITLA 1M5WA 1T5AA 3G18A 3PP7A 2DT1A 1V6YA 2PDIA 2OYKA 3CXOA 1JG9A 5HBFA 3DBNA 1S1PA 1KQYA 2YKKA 3WLOA 3RHGA 1VBUA 3H2EA 4TX6A 2NT0A 4UQAA 3H7RA 4LUTA 3JS3A 3VOIA 2DUXA 3PBVA 1W1VA 2JKEA 3MSGA 5JBFA 1QNPA 3WJYA 4V28A 4RXGA 4XZNX 2AAAA 2ZA3A 4JIRA 3G1FA 5C71A 2YZ5A 4UFMA 3QYSA 4H6RA 4OE7A 1V77A 3ITGA 7XIMA 1UZ4A 2YCJA 1V7AA 3WYZA 3WK2A 3DGBA 4A21A 3AIUA 1M53A 4HA0A 4H41A 5KZMA 4FLRA 4YHEA 2GOKA 2V5CA 3AXKA 1R38A 2FPYA 1V0KA 2CLFA 1TX0A 3FW6A 4H8HA 3UYCA 2VR2A 3WENA 3UBPC 1P0NA 4X22A 1UPPA 2WJDA 3OP2A 4AF0B 4AFYA 2OEKA 3W6LA 4HNOA 2HPMA 2YL6A 3AXIA 1S2WA 4O11A 4AMAA 4IL2A 4EWND 1QPRA 1D8WA 4NG3A 4DO4A 4DF1A 1MQQA 1UG6A 4KW2A 4NAEB 2QXWA 1XM3A 4RNHA 5A6JA 3QOKA 4O10A 4GVGA 4E8DA 3GHUA 1GPFA 3KTSA 3PG9A 1Z44A 1H7OA 3EMZA 3HMCA 2DW7A 4QE4A 4ZE4A 1XLGA 3G8RA 3RO8A 1TR9A 3WBAA 5F2LA 1C92A 2XIQA 3A21A 1HJSA 3R0DA 4CGTA 3CPUA 3BAIA 4AXNA 2CBVA 4G56A 4Q6XA 1ZUAX 5JIWA 4XAPA 4W7UA 1REQB 1CLKA 3UXLA 4WVXA 2ANUA 5G4EA 1UD6A 4JL1A 1G4TA 4ZFMA 4JTLA 3R13A 4H9XA 2OWWA 4JY8A 1C8VA 1V3LA 2NUXA 1TWWA 2Z26A 1BRLB 3ITYA 2RDWA 4OHQA 3IIZA 2JKAA 1BHGA 9RUBA 4QCFA 1L0PA 3FA4A 3FYYA 4JX4A 3UY8A 4PCSA 1P0DA 3PWIA 4ZQOA 3WQCA 3O15A 4Z2IA 2J9XA 4MUPA 1JPIA 3WNOA 1CNVA 2H3DA 1E5JA 5EPDA 3R8GA 4FF5A 1QNSA 4YLWA 3STPA 2R1PA 2IMRA 1W9BM 3URQA 4D71A 5A94A 2OZ8A 5A8MA 4C7FA 4QSFA 4A29A 3HBLA 4LUJA 1OGGA 1JCJA 2D0GA 2DW6A 4FB7A 4PMRA 1P6CA 1JCLA 3MHGA 2D73A 2VWSA 3OZPA 3L4ZA 1UZHA 4D8ZA 3W74A 3APGA 2J47A 5HQEA 2EPHA 3G77A 4IIBA 1Q3NA 2HK1A 4JFSA 2XM2A 4FNRA 3GY1A 3SGZA 3ZMRA 4W87A 2F8QA 3N04A 2NSOA 1VRDA 3HPFA 2PTZA 3UEQA 1XIHA 2OZTA 1TPDA 2QGHA 3A3WA 3AMKA 1K8CA 1E73M 1YNPA 4N9EA 2I5GA 4IGSA 5I2UA 4ML9A 3WL1A 3WH5A 4GA8A 4RZBA 1YDVA 3WK1A 3EX6A 1E1CA 2EPOA 3PPCA 3ZOAA 4AEOA 1HG3A 2ODOA 3PBUA 1SYTA 1DL3A 1LF1A 1EJRC 5MHBA 3M0MA 4IPIA 3EWYA 4ATWA 4GI4A 4AX7A 3B97A 1UR8A 3VFLA 2NQ5A 1PWMA 1QCWA 4I6KA 2YL9A 3VGFA 1H7XA 3QH2A 2Y89A 4DJED 4PB5A 3DX5A 1D3CA 1FDZA 4A05A 3FCPA 2HS8A 1UOKA 3ME3A 4KFOA 2GWNA 2REQA 3V3WA 3EOEA 3BCJA 4JS3A 4Q8MA 3M07A 1CBGA 3TIMA 3ITOA 2H9AA 1EDGA 2AQWA 4S3JA 4BR1A 5DANA 3JRKA 1W8SA 4S39A 2VC5A 2FKPA 1XLJA 3VDHA 1S5NA 1TE6A 2DVXA 4WSHA 1UD3A 3TH6A 4M82A 3LZ3A 1XLCA 4W93A 4I5XA 2YX0A 1E4LA 5CBBA 4EPEC 4ZFCA 1SQ7A 2V0TA 1A53A 3U4FA 1AQMA 3MVTA 3QOMA 3C3UA 4J27A 4QJ3B 3WD1A 1LQ0A 1RQEA 4S3EA 5BROA 3ZFHA 3ABXA 4S3AA 1W17A 1KCXA 5A8QA 3VKAA 2BNJA 2BX7A 4YIWA 3CHCA 1R8LA 4XD6A 1Y5WA 3S8HA 2D3NA 3BAJA 2NQZA 4MNJA 1XH2A 4C6IA 2PDQA 4HCLA 5LGZA 4FLQA 3MI2A 3MCOA 3TLQA 4HK6A 1OC7A 5E70A 2CIPA 4S1FA 2OLHA 3G0XA 5D2XA 4CNSA 1E0UA 3PUOA 1ZNNA 4P2VA 4IJCA 3AALA 1ONXA 2YA1A 3L0KA 1B31A 3W7NA 3E5BA 4QSHA 3VXGA 1L6SA 4D6HA 2V9DA 4ICCX 2G96A 4CQ9A 1VCFA 2WNQA 4IPLA 2WB5A 2CLOA 3T0TA 1XYLA 5CGQA 1EYEA 1R86A 3K8LA 5I3GA 3SBFA 3RX4A 1XYBA 4WIWA 4JN6A 1DWIM 1NM9A 4TTUA 2HRWA 4TVCA 4AHQA 3H54A 4JTSA 4DZIA 3W7EA 3NR0A 5BXTA 3EKGA 2ZWYA 2AL1A 1TA3A 1X1OA 4PZVA 4PEEA 2VFHA 2YGYA 3O3RA 3G1SA 3DKLA 2BOFX 5HMDA 1LLWA 2BODX 4PBGA 1XIFA 1DJYA 4MZ1A 3U2ZA 3ZQ9A 2ZYFA 2XSBA 3O16A 5CZSA 3VIHA 6TAAA 1WKYA 3UGVA 4OWGA 4QQ3A 2GGJA 5EB8A 2W67A 4B5NA 4YVVA 3I6EA 1GJPA 3ITTA 8RUCA 4YMZA 3T9PA 6REQA 4OBTA 3W7LA 1PAMA 3PZ9A 3A4XA 3CLMA 4R34A 2SFPA 2IPFA 5E9AA 4YYFA 3USBA 3C86A 5DEZA 3C2VA 4EPKA 4XWUA 5CZJA 1XPGA 4MKVA 1TWIA 1VFTA 3TOPA 3VKCA 3AZTA 4HA3A 1H11A 4MM1A 2Z1VA 2ZCGA 4CKQA 4LAOA 4KESA 2XPKA 3AC0A 4KBXA 3V18A 4LU0A 1I1XA 2P1FA 4WOZA 4J1OA 1GPWA 1JZ5A 3UXAA 1Y65A 4AZ7A 2QQ6A 3HO8A 4R85A 4FOJA 1F8IA 2BHUA 2Z1KA 3NQ6A 5H91A 3LCFA 1RK6A 3VNZA 2YDRA 5F2GA 1K8XA 1VFOA 4X9SA 5CQ1A 3C0JA 5KITA 2CBJA 1Z6KA 4HNLA 5SWUA 4U10A 3VDCA 5EMLA 1PE1A 1TMHA 3NL3A 1UWTA 1W32A 3HG3A 3DKJA 5ENLA 1VD6A 2VC7A 4U5KA 2DIEA 4NXSA 3ABQA 2GK1B 1E6ZA 3IJ9A 4C6JA 1W3TA 3T2PA 1V4YA 1RVKA 3ES8A 3GSMA 1XDJA 3L4WA 3H70A 1PZ0A 1R3VA 3PSVA 3WQ4A 5DFAA 3VD3A 2VR5A 4CEXC 4BCEA 1DJIA 3VCCA 4WSJA 1XLMA 1TWSA 4LUSB 4DI9A 3PZVA 3MMWA 1XJBA 1XIJA 3RPMA 3DG7A 3DFQA 4QEHA 4O4VA 1H09A 3P5ZA 5JUVA 3KCOA 2ZQ0A 3CAKA 4JTTA 2FLIA 3R11A 3E0IA 2TPSA 3S5YA 1VGAA 3WK3A 3LHVA 4EAMA 1S2TA 3DEQA 4PSRA 3QY7A 3OBEA 1DQXA 1UKTA 1I1WA 3QKZA 3RR1A 3LENA 4PTXA 1XLFA 3LPPA 3P93A 3AHZA 1A5NC 1BGAA 4C1NB 4YVXA 2PWDA 3BW4A 3I7QA 2WO5A 1DIEA 1VB9A 2BB0A 1VFUA 4TOQA 1EO7A 4GIEA 3SCPA 3GNXA 3M46A 1QWGA 1FRBA 1UWSA 1N2VA 1BYDA 2HMCA 7ODCA 2HCVA 2BHZA 2RAGA 4P8XA 2AQVA 2I7GA 3A4JA 3M5YA 2HTMA 1BYCA 1EYWA 4TMBA 4GGBA 3AHVA 4F2TA 1WDRA 1SFSA 4Y9OA 3EWBX 4JQ1A 4LBUA 4F0KA 3VD5A 4JTUA 1DVJA 3EDDA 4KWSA 1UROA 2O9OA 1B1YA 3C5QA 5HPCA 4E4FA 4B15A 3QLDA 1CXFA 3TSBA 3NQAA 2JKPA 2OWXA 4DZ5A 3I3BA 4AF0A 3LHYA 1QBAA 1Z42A 2XVLA 2Y8KA 4G8TA 2WZIA 3CS2A 1CI1A 1E0WA 5FJPA 3W7IA 2R94A 4G5DA 3L4UA 2VDIA 4O4WA 1J0IA 3QR3A 2W9MA 3CYJA 3VO0A 3ZJ7A 3AHTA 3ZVIA 3TYCA 1YTDA 1VH7A 3M43A 4WLCA 3QPZA 3ZS4A 4NAEA 5C55A 2VOTA 3LQGA 4L56A 2Q6ZA 1E1EA 4XV0A 3GVQA 4A8NA 3HN3A 4WZHA 4AC1X 2GQAA 3NDOA 2YJQA 4H9MA 1XF0A 2PTWA 1R3SA 2PDYA 1Z32X 4R9XA 3A6OA 3LLDA 4KEVA 1JD9A 1T6MA 4FX6M 3CIXA 3PF3A 4URIA 5FJUA 1XIIA 3NGFA 4WY0B 1C29A 1GK8A 4HP5A 2AGTA 1REQA 1MXDA 1JUEA 3H55A 3ZSTA 3SO7A 5DO8A 5E09A 4KMQA 1XCXA 4ZO6A 1V3HA 3EDFA 2O7QA 1TRIA 4LAZA 1TRDA 1W56A 4D6FA 3FSUA 3UU0A 4DZHA 1JZ6A 1BRLA 4YTRA 8XIMA 2QDEA 4PB3A 4IG2A 1X6UA 1MRQA 5IXEA 4Q8VA 1FVPA 2WWDA 1QNOA 4LPCA 2V67A 2NX3A 4HPNA 1NSJA 3I7SA 4Y9NA 3RF9A 1DEDA 5AC4A 1HTIA 3V5CA 2DPEA 2ISFA 2XIJA 3L2MA 2YZRA 4B4FA 4B16A 4NJHA 4XSMA 1E71M 4PMDA 3SJNA 2VRQA 3PAJA 4DX3A 2WPBA 4LUIA 2WZEA 3RCMA 1GW1A 1OFDA 2ZZ1A 4J5NA 2DT0A 4C6LA 3S6DA 1UCWA 4HHHA 4OIFA 4A3YA 3R0KA 3N2XA 2X1RA 2NSXA 1K7FA 1RJRA 3GDTA 3CC1A 2Y61A 4M0XA 2OYLA 3RX2A 4LF2A 2C79A 3CQJA 3W1PA 4CCCA 2A7PA 1VLIA 1LWIA 1J79A 4H9ZA 4M1RA 2HXTA 1U33A 1KFJA 3U6WA 4S2CA 4HPXA 3FFSA 3NWRA 2V63A 2E40A 3JZUA 4HYWA 1SJAA 1Q65A 1OCNA 1E9YB 2X1UA 2X7WA 4LAKA 4DXKA 3S9IA 1B57A 4GQGA 4HHLA 3ID7A 3S2LA 2NQ9A 2QUTA 4QFUA 2ZXQA 2PF0A 1YX1A 4H4IA 1OYAA 3M4HA 3PUGA 4E0CA 1OIMA 3W2KA 3WIJA 3W7MA 3GBEA 3N2BA 3V1PA 3H7VA 3BO9A 2J88A 1IHIA 1Q6CA 3OG3A 4NJKA 4HA1A 4GUFA 1K02A 4RW3A 1A0CA 1R3TA 3SCRA 4DJEA 4NRSA 4IQDA 1PX8A 1QTWA 1Z48A 3MJMA 4L4LA 3OVPA 3E3HA 2NV2A 4XQ6A 2CCRA 3S6TA 4UTMA 4LWWA 3RRXA 5DY2A 2PDWA 6ALDA 2D0FA 3AROA 3W1MA 4DBEA 4KIRA 1DTUA 3NDZA 3LCIA 4NU7A 3A3XA 3PZTA 1QR7A 4DEFA 1RA0A 3S0CA 1EC8A 2E77A 4MKSA 4GCXA 2MUCA 4EPBC 1ELSA 2BP1A 1X38A 4B5SA 3NCOA 3C6CA 3LUTA 3PY2A 3QXBA 1O7AA 5J8LA 4E3TA 4GGHA 1AFSA 3VABA 3SGUA 2NUYA 5DBUA 5HINA 3WQEA 1TPUA 1V3KA 3OGSA 4CQCA 2UY3A 1IEQA 3CUJA 5EMUA 1NVMA 2QKFA 5L6UA 3HTWA 1OJXA 3M0ZA 2PWHA 4F79A 4IM4A 2GDQA 5GQBA 5D9OA 4CD4A 2RHGA 4CN4A 1QAPA 3GHTA 4XG1A 1VPXA 3ECQA 1KFBA 3UWZA 3CYVA 1A5SA 3FNDA 3W76A 3TAOA 2QCEA 5T9CE 3USZA 3H22A 3RUBL 2G3JA 5AC8A 1B90A 5CSRA 3R7MA 3WDIA 3R6IA 1G01A 1CIUA 3L2LA 3HZ3A 2H90A 2Z7GA 4Z2HA 2XSXA 3QF0A 1M3UA 3QFEA 1U83A 1F3EA 2PGEA 1UR4A 3L5MA 2V5JA 1S3TC 5D38A 3W0KA 5AECA 4E8CA 4QE5A 2XVKA 1J01A 1J2BA 1W1ZA 3UWQA 1SFTA 4JR5A 5K7JA 1RUSA 4UOJA 3WH6A 3TWAA 3CL7A 1WXZA 2QV4A 4INFA 4CD7A 1XIGA 3H2AA 1LT8A 2PA6A 1SVDA 4MMWA 1QPKA 2QJGA 2WMIB 1ZZMA 2Z6IA 3FXGA 2E0PA 3M64A 3SI9A 2D2GA 4ZE5A 4AB4A 3P0WA 3N2CA 2DZVA 5DRIA 8TIMA 4ZSTA 4TVDA 1Q6LA 3FV9A 2AMGA 4JTGA 1WZLA 3PBGA 3W86A 4O16A 1R3QA 1PIIA 4AH7A 3WMBA 3PB0A 4IJRA 3GR8A 4QLKA 4LCQA 5E1QA 1UIPA 2YB1A 3HPSA 2ATSA 3S46A 1M65A 4GC4A 1ITCA 1VKFA 3F2DA 2ZX6A 4L1XA 4DO6A 4IP4A 3KEHA 3REQB 3KHJA 3N14A 6TIMA 2E3ZA 3AXHA 2X42A 1OZQA 3WDQA 4QISA 3HU7A 3WEMA 1W31A 1UWAA 1K9DA 3GU9A 3GE7A 3QV6A 3RR4A 1RP9A 1K6WA 3ARRA 2PTXA 4YHGA 1KTCA 4HOZA 4UIOA 2YIHA 2CFFA 5FF4A 2HE5A 3LPFA 3R2GA 5LNWA 1G69A 2ZXDA 1XLKA 2ZUMA 3IJDA 1GTHA 3F5KA 2ISWA 5D9PA 4GNKB 3LX9A 4RLIA 5LXXA 4U4MA 1K3UA 5FIPA 2ZRVA 2Z29A 1GEHA 2RDTA 2ZZ4A 5A6BD 1Z9AA 1GVQA 3QHOA 4MIMA 1US2A 1XD1A 2W4XA 4Z2KA 3WF1A 3GNPA 1YMYA 1JI1A 4XKYB 4J7RA 1ZQ5A 1XLHA 2I16A 4PTDA 4LC8A 1VYPX 3IPWA 3UYIA 2F6UA 6XIMA 2ZFAA 2YXOA 2BVYA 2WXDM 2H8ZA 4QE1A 1YQ2A 4BEQA 3W53A 2PSNA 4KEUA 2HS6A 4AY8A 4JDBA 4M6QA 5I3KA 3TROA 5D4YA 1JGIA 2J77A 1VYSX 1TIWA 4ZENA 2RFGA 3CUXA 1TVLA 2RDUA 5BWAA 2XTKA 3WLQA 1AZ1A 1M68A 4JFTA 2GK1A 1DJHA 5D03A 1AD4A 2C8NA 4GFSA 1O5RA 4LEQA 2PDCA 4ZR8A 3MW7A 1DPMA 3U2CA 2E4TA 2XWEA 3QR1A 3ABZA 3B0UX 1O95A 4EXBA 2OLAA 1Y8BA 1F6KA 1JFXA 3KBSA 1QFEA 3VC6A 4LUSA 1GVRA 2FFIA 5LNUA 2I1OA 3M16A 3AUJA 3C2FA 3LNPA 2VQTA 3W72A 1JRBA 5HR7A 4J3WA 4NUWA 5BRBA 1GOWA 3ZJ6A 3SUSA 3LD5A 1FFQA 3WEOA 5H1WA 5FF2A 3TQKA 2VD9A 1PKMA 3UETA 2J4GA 4UTLA 2O7SA 3DN5A 3MDWA 3MDUA 3QR0A 3D5HA 4PUUA 4NYYA 3T8LA 1MEWA 3BOFA 4IIHA 4XTIA 2Q8XA 3SR7A 3U5UA 1WBJA 2DIKA 3AIEA 4EXQA 3N11A 1GHRA 3RM9A 1ISVA 4AC7C 1S5VA 3D46A 3G6MA 4GMEA 4UXDA 3W2MA 1E43A 3UVIA 2ZZ7A 4ERIA 4JDYA 2BGNE 1BTMA 2BMBA 4UTJA 3EXSA 3CHVA 5AYYA 1J96A 2AL2B 4JN8A 3UNTA 1J12A 1YXCA 4FIQA 5LIXX 1HJVA 3MMDA 4XZBA 1W1IE 4ZB2A 4FOKA 3QMRA 2QCLA 3EDEA 2W92A 3OZOA 4PR4A 2PTYA 2Q8ZA 4R9OA 4FNUA 1R7AA 3AMGA 3W7OA 3VU2A 2HBVA 2XGIA 2WCGA 1H50A 1ENUA 4JXCA 4P7RA 5LIWX 1QW7A 2FH8A 1BTCA 4NKCA 3CTTA 4NASA 4KCTA 2XINA 3LBOA 2VI0A 2XGZA 5LXEA 2WKGA 3E96A 3U5YA 3K4WA 2FZDA 6ENLA 2A2IA 4K37A 1R47A 1V0NA 1J0KA 2OEMA 1HO1A 3E2SA 2ZZ5A 3L9CA 2C14A 1XLEA 2DUZA 1FHDA 4IZGA 1IV8A 4LNYA 4LRSA 2R1KA 4CD5A 4DJFD 1SJDA 3UGRA 4Q8PA 2WKJA 5BYWA 1RBOB 1MFUA 4RNJA 2JQXA 4KQNA 2CLKA 4MHBA 3WO8A 4LF1A 3W1QA 2GJPA 3QHMA 2V30A 3L0NA 4TU1A 4AY7A 1HF6A 1S5TA 4WD0A 2GZXA 3MZNA 1AJ0A 2BBFA 3AMLA 4WY0A 3C0LA 4L9YA 3BC9A 2ZUVA 4OZOA 2BASA 3HPZA 3ANUA 4IPPA 1XYZA 3NA8A 1MUCA 2Y7EA 1CGUA 1E9ZB 4P7QA 4KETA 2PF8A 2FVLA 2XZ7A 3NVTA 4GVHA 4ACZB 3WELA 3BANA 3H2FA 2QIIA 3V75A 1YXDA 1Q6GA 3TJIA 5I09A 5E9XA 4X2RA 4YNGA 2QAPA 2GJRA 1QDSA 3UR7A 1P6BA 4DXVA 4X3ZA 5RUBA 1CZ1A 4RDZA 5XIMA 3JU2A 2W61A 1NOUA 4O13A 4UNKA 4OUEA 4L6HA 2RJHA 2WM0A 3GHSA 5AHIA 4H6KA 3FDGA 4ZL1A 1O66A 3PZNA 1I45A 1XCWA 4XD5A 3SUWA 4K36A 4Q6JA 1C8YA 3VIJA 2AKMA 3W7DA 3G22A 1ONEA 3BCDA 2J7GA 4IMCA 2HK0A 3MQTA 4AIUA 5TF0A 1IEVA 4LW7A 3QGVA 1MXSA 3IUHA 5C2GA 1FKXA 2P88A 4PUEA 1HGYA 3P82A 4QS5A 3GR7A 1WAUA 2CLHA 4UR8A 5K9CA 3ABSA 4EE9A 5I3DA 1K9EA 5AZ0A 5HNNA 1HKMA 4TXEA 1A5BA 1EA9C 2G3FA 2OO6A 3VIPA 4L1GA 1I0BA 3NL6A 3UWYA 2E1WA 4WXYA 3S83A 4MSSA 1KFLA 1GQJA 2WW5A 4TMCA 4JTQA 4L9XA 3KVLA 2FTPA 5AYZA 5CAHA 2VKZG 5AB3A 3NZQA 3ZJKA 3QRHA 4Z2LA 4GH3A 1LOQA 4DBUA 2HEJA 2Q71A 4Q4RA 2HWGA 2DORA 1QHPA 1K4HA 2DQXA 5C70A 5G5IA 2I9EA 4RE4A 1ISWA 2WMKA 2CWNA 1GQIA 3QPEA 1PDZA 1XLBA 2G3IA 2E1DA 1DXIA 4DYJA 1VPYA 3A22A 4K1WA 2WMFA 4OBSA 1QPQA 1PO9A 3DFNA 4O0QA 1MUWA 1JRCA 1VFSA 2QJHA 5DXYA 2QYGA 4HN4A 3T09A 1TTQA 2BGQA 5U7SA 4QJ5B 1FDYA 2GQ3A 2WVVB 4FXRA 2YYTA 1R3YA 2BXVA 2Y7GA 3GLCA 3QTGA 1FP8A 2WVTA 2VGGA 1AH0A 5CLTA 1QATA 5EMYA 5A6KA 4NJJA 3AIBA 3A24A 4I9JA 3DGRA 4XIMA 1UC4A 3BLPX 3L7RA 2V3GA 4GYFA 1HL9A 1DKWA 4Q8WA 4ECLA 4GX8A 1JYNA 3SIZA 3VDAA 3GKFA 4ZO8A 1ZRQA 3H12A 4DF0A 3GXIA 1XG3A 1RA5A 2YBVA 2EJAA 4PGLA 3TC7A 1EX1A 1NP0A 1PZ2A 2QMJA 3R4IA 4C6BA 1PKNA 3FYPA 3Q2DA 4LV9A 4MLRA 2O55A 1XGEA 1EO5A 3UZZA 2FYMA 3VDBA 3OW1A 4CNNA 3DHDA 4PCPA 1CECA 1TCMA 4FR1A 1X7IA 3U9IA 3OHMB 5KETA 3W6YA 3C56A 4EK7A 2DVUA 2F6KA 2FB3A 4RV3A 1V93A 3H4WA 3AJXA 3UF9A 3CV6A 1XRVA 1FCUA 3WLPA 2CNCA 3GO2A 3LNMA 1AJ2A 3LXCA 3F4DA 3G3MA 1S39A 2Z4GA 1HP5A 3VDGA 1XL9A 3AYRA 3PULA 3ES7A 5AYBA 3S3GA 2QVHA 2W27A 4JFUA 4PMVA 3WZ0E 3LA4A 1P0BA 1LQ2A 1EZWA 5EFDA 2HPIA 4Y6GA 5D09A 1TKKA 4O54A 3SN0A 3VNYA 1UPMB 1RD6A 2Y24A 2V68A 3NYDA 4YTSA 4A2RA 5K9DA 3AUOA 3GNDA 1OIFA 2PUZA 3W38A 1UD5A 3HGOA 1UOZA 4NI3A 2EG6A 4FSAA 4UNIA 4UZUA 1QO5A 4XAFA 4DUWA 1GVSA 4HN8A 3EEGA 4E6MA 4AHOA 4R7JA 5FEXA 3ATYA 5AC7A 3CO4A 1ZGDA 4K8HA 5D30A 4QXIA 3VIFA 4GRSA 3LCXA 3TTQA 4U2ZA 1F9CA 4O12A 4ZZ9A 2X1SA 3QM3A 1ML1A 4TVUA 3UG4A 3WJXA 1JCYA 1IIGA 1LZOA 1P4CA 3H4XA 3H6OA 5E0KA 5HQMA 1K1DA 3UP8A 3LXBA 3RPTA 4H7CA 4P7LA 2DJXA 1D3HA 1KRCC 4ZVJA 3KDOA 4M51A 3O9NA 2C19A 3HGSA 4E5TA 5CH9A 2CLEA 2F38A 1QNRA 3EXTA 4FNPA 1TIMA 1MYRA 3IANA 1IT0A 3ZLHA 1PIFA 3KZPA 1ME9A 2VOMA 4B3LA 1B3VA 3UJ2A 4M7TA 1D3GA 4DNHA 3KCLA 2P50A 1O6IA 3QY6A 4TR9A 2YDQA 4CQDA 3NPUA 3R5EA 4QTGA 4NAFB 3E0FA 3VKJA 2Y5SA 4NJGA 4W8BA 3LS9A 4MADA 3KL0A 4IICA 5A3HA 3BLOA 4QNEA 2EHHA 4Q4QA 3L66A 3N6HA 4HNVA 1ME8A 1SPQA 1BXBA 1UR0A 4IMEA 4H04A 3W7JA 1AA1B 2OPJA 3CGTA 1H62A 3GVWA 1DXFA 1MEIA 3RU6A 1SZEA 1O5XA 2GGIA 4C6FA 3TMQA 5KZ6A 3K1DA 4OV9A 3GIQA 4HIBA 2VT0A 4M3PA 5EBUA 4N2YA 2HVMA 4ZMGA 1VIZA 3NM3A 4S3BA 1PX3A 1OSEA 3HURA 3WDHA 2OWCA 3D6NA 1E6QM 1J0JA 2V5DA 1ECEA 4K3ZA 4M29A 4EIVA 1VYRA 1S5MA 3WEZA 2VFEA 3WX7A 1KWKA 1QK0A 1UASA 3NEVA 1XIMA 2OGYA 2OLSA 4B2DD 3TK7A 3W2NA 3WLLA 2VVNA 3WQ6A 4JNYA 4HU3A 3WN6A 4Z1YA 4AVOA 2O0TA 2W91A 3EGJA 2PWEA 2VUYA 5D2VA 3GX9A 1OY0A 1ICSA 1RQHA 1GG1A 5C8BB 3OOQA 4PMZA 2PGFA 3GDMA 2HISA 4Z1CA 1X1ZA 3SQMA 4H9YA 1R2TA 4J3UA 4AIEA 4DI8A 4KS0A 5D2WA 3PBMA 1AW2A 4BF5A 4NZCA 1LROA 2VC6A 4Z08A 5C7HA 3DESA 3AIQA 1KD0A 3DZ1A 1LL6A 5I7GA 4DYEA 3KZSA 3B9AA 5HATA 4LBRA 1W3LA 1HL8A 3AMCA 3MV11 4Q7IA 4E8GA 5GJMA 2DZXA 1VC4A 4I90A 5EMJA 1KXVA 1OK6A 2I57A 1DIDA 1GZJA 1C7TA 2VFDA 2FDMA 4AHPA 1T8QA 3IWPA 3MT1A 4E3VA 4WF7A 3ZJ8A 4HPGA 3BSMA 1O68A 1MUMA 4LS0A 5D33A 3L5LA 4XO7A 3LCGA 5K4XA 2VZUA 1VEPA 3FKKA 3MP5A 3VCRA 2FHBA 1LM1A 4WDXA 1KXQA 4YYCA 1KWGA 3I3EA 5CSYA 4NVTA 2WKLA 1W0MA 4CU7A 1GOQA 1PKLA 3ISIX 5JMUA 2JF6A 4GO8A 2DZPA 4PH6A 5DCDA 4GJJA 2XYLA 4RV8A 4S38A 2JIEA 5C0QA 2E67A 1W8GA 3FKRA 1E9IA 1NFGA 3NL5A 3W1AA 5BW6A 2AL2A 1BVWA 1SJCA 1IGSA 3NAVA 2OKOA 3V16A 3ARPA 1U2YA 4BWLA 4BWLC 3G1XA 2Z1WA 5AOUA 1DIKA 1K77A 1GOXA 3GZ3A 3BG3A 4JTAA 4MGGA 1B5TA 3B0PA 1KM0A 1YEYA 4ZTXA 1LQAA 4HJFA 1MSSA 4N4QA 2PTDA 3CL6A 3WNMA 2AQOA 2OJPA 3EKZA 1C9DA 5IM51 1XH0A 3KBNA 5A6TC 1VCGA 2PDMA 4LNCA 1HKJA 4H9VA 3MA8A 2FGZA 4J35A 4XZLX 1AQFA 2QDHA 3QSRA 3IIXA 2V81A 4E2BA 4NYUA 1FWEC 2DH3A 5BXRA 1SJBA 1TPVA 1E6RA 4DJDA 2GFTA 4HQVA 4DJDC 3QV9A 1KBBA 1KO0A 4UMAA 1O1ZA 5A2AA 2YCLB 2D69A 2WLYA 4DJFA 3JVAA 3ONBA 1CXEA 3BLDA 1PL9A 3G5EA 2DSWA 3OHIA 2YCKX 3AMDA 3WDRA 4QLLA 1NU5A 1CEOA 4CD8A 3WFAA 2VX4A 3MUCA 4WKHA 3AHXA 4JCMA 1UD2A 4ADSA 1R7OA 2IKJA 4LAMA 2QHAA 4GQBA 3GH5A 1FXQA 3T0DA 2V2HA 4JAWA 4ACZA 5FESA 5CEWA 4CQBA 1BG9A 3GC2A 4RZ5A 1DYSA 4Q8QA 4YTUA 1WDSA 5JH2A 1PTDA 3ZXWA 1BPLB 2EF9A 3SM0A 3RFAA 3JZEA 3N25A 3V5FA 3BOXA 1POKA 5I77A 5C5YA 1BF2A 4QRNA 1QXLA 2IKHA 3VM5A 1JNEA 3LK6A 2ZKMX 4BQ2A 2GJLA 2F61A 2QGYA 1XH1A 5CKSA 5C9XA 3WH9A 3VCNA 4HKPA 1EDTA 5AC5A 2CBIA 3WQPA 2GVEA 1FDJA 5CBIA 3SUVA 1R2RA 1WQ5A 1R5YA 3DG6A 1AJZA 4R3UA 3RM8A 4L6DA 2WSQA 1NOWA 5DF0A 2XU2A 3GFZA 1EX5A 4WKFA 3A5VA 5CG7A 1W9UA 1BWKA 1ZENA 3UR2A 3I65A 1EZ2A 5JIPA 1CWYA 4Q7BA 4V1XA 4DWSC 3GTHA 4ROPA 5LNRA 3TC6A 3FA3A 2FPVA 4UC5A 3AYSA 4JQAA 3UZ5A 1FWRA 3E0LA 2R1LA 1L8PA 3D3AA 1HP4A 3LZ5A 3ZT7A 4IQJA 3H53A 4HVXA 4HYVA 1ONRA 3F5JA 5F4XA 3TZNA 1KKOA 2C71A 4UTKA 3CWHA 1FCQA 4KPLA 5GPRA 2E6DA 3IJ7A 1TPC1 3GVRA 1A47A 5AVHA 3LLXA 4QITA 1TTPA 4QM1A 3H8AA 4EOUA 4R88A 1PVNA 2WVVA 1LLZA 3A4AA 1EJTC 4NJIA 2VWTA 1W54A 2ICSA 3SRHA 3SSJA 3K1GA 4G2DA 1N8FA 3W1UA 1CXHA 4W5ZA 3QYQA 3AYTA 4M56A 4EWJA 4TV5A 2IXVA 1Q85A 5AHEA 4CCDA 1WZAA 2DEPA 2A3EA 4C6KA 4XVEA 3N73A 4K2SA 3PR2A 5DMLA 3WD0A 3IV8A 3R12A 3SCWA 1T41A 1FWTA 3GUGA 1BXNA 3FVDA 3ICJA 4W9TA 1HO4A 4JTJA 4HCDA 4MB5A 4F0LA 1LBMA 1BSIA 4GISA 2BHYA 1BWLA 4LOCA 2FZ9A 1FWGC 1Q4NX 1XUUA 4FMVA 4TIMA 4F4RA 3IUDA 3MPGA 2PAJA 4QG8A 5HAOA 2XHYA 4JKMA 2F9RA 4UFHA 3AXXA 1M7XA 3UPBA 3QW4B 5A6AA 1TREA 2DSVA 3BAKA 4Q4SA 4MY8A 5HDRA 3ORWA 4AYGA 3TR9A 3U7VA 5I06A 1H49A 2V3DA 1D9EA 3K5XA 3W7KA 3TOYA 2DZUA 1WB0A 2REQB 3PC0A 4P61A 2A3LA 1F4AA 1SFJA 1WKDA 1XP3A 2C91A 3EB2A 3E9AA 4JY9A 1O1HA 3KOWA 1K4GA 3W7PA 3VA8A 4LC6A 3TVAA 4D1JA 8CGTA 3G3DA 3LI1A 3NUKA 3QLLA 4HU8A 2F7FA 2YXGA 3R8HA 1UUMA 1MZHA 1CW2A 1RH9A 1BSLA 2J66A 4KERA 3RIKA 4K8EA 1H7RA 3CV2A 3KVMA 3MUAA 5J04A 1TV7A 1A5MC 1QI2A 1WOBA 4WDTA 1CGTA 1ZBKA 3QQWA 2GQ9A 1UBPC 4F2UA 4EX4A 1EWEA 1X97A 2INZA 2Z0IA 5LNSA 3UR8A 5F7UA 4HMCA 4WQ6A 5ABHA 4PMNA 4ENLA 2OMAA 3CZ8A 1BYBA 3UJRA 5BRQA 1I75A 1VZWA 5FOOA 2WC7A 4O0KA 3ZIZA 5T8GA 3EEZA 3RMJA 5D9NA 4OVXA 1V02A 4P7NA 3I10A 4L7ZA 4J3VA 5H2ZA 1GJWA 4J2MA 2EKCA 5CAKA 1PHWA 2HNEA 3P6LA 3DHPA 2PFHA 1H1NA 1MW1A 2DH2A 2X2GA 4BQ4A 1F74A 3OYXA 1PEZA 4JTIA 1BWVA 3HG5A 4FK9A 1QHOA 3A47A 2ZWZA 1HVQA 4A22A 1OBAA 4GC3A 2QV5A 1BD0A 1XPYA 5JU6A 3SW6A 5DXXA 1HX0A 2H3BA 1GQKA 2ZZ3A 2E5BA 3TTYA 3B0YA 1SZFA 2B7NA 2ZIDA 4Q33A 4DYKA 2X30A 2MNRA 3W84A 2CLLA 5HNTA 2ADAA 5GVJA 1MQPA 4C5YA 3GVVA 4PTWA 4WR3A 1UHVA 2OVLA 1NARA 1S3HA 3GG7A 3DFPA 2HE8A 4QROA 2Y0FA 7TAAA 3A23A 4NAFA 4AU0A 2TRSA 3NQBA 2ZVRA 4AD5A 1U1UA 4BFAA 1GQLA 1JPMA 3B06A 3CH0A 3IIPA 1EJ7L 4BI5A 5FJJA 1PHQA 2J74A 5LIKX 3IGXA 1RY8A 1GNXA 2YFNA 2JALA 1LL4A 2FGBA 2OCZA 2DSUA 3AU6A 3VTRA 5FF7A 3PVFA 4ZODA 2PDUA 1EJWC 1Z8AA 5LA0A 4MDPA 2NV9A 4AD4A 1Q8AA 3PTKA 2X09A 2OXNA 4JTCA 4R7OA 1RLCL 1UR9A 3LXAA 4NSBA 2XISA 3KOYA 1EIBA 3TYUA 3ZZ1A 3STFA 3ARQA 4KF1A 3G24A 4H8UA 4NI8A 2XIBA 3HG4A 2PDFA 2OSXA 3F4CA 1XYMA 3QHNA 3F7JA 3IS4A 3V0SA 1H0IA 2E5DA 2W6RA 4FOUA 5HR6A 4AX6A 2VELA 1BAGA 1V6XA 3VZZA 4TUFA 5CPTA 3WQ8A 3E2RA 2BTMA 1OD0A 4I7VA 5GNYA 1NTHA 1AW1A 1MFVA 2VM8A 3HIJA 4IMGA 4A3HA 5C9WA 3TXZA 4FXSA 4NZ5A 2VO5A 3ZR4A 2W0UA 3O0KA 3VE7A 4GK8A 2ZADA 2EGZA 1B0IA 3FS2A 4I7WA 3TYBA 3FXYA 5BZAA 4O17A 1FUYA 4UQCA 4GQRA 4B3KA 2NQLA 4HMNA 2A7NA 1W1A1 3B8UA 2OEJA 2B31A 3WBWA 2ZE0A 4ZO7A 4JIPA 1I2OA 3XIMA 1A5CA 4UWMA 5T26A 1J0ZA 2XN1A 2YXXA 2B7PA 4N9CA 2ZZ2A 3SJ3A 3WFZA 4MFEA 4PUWA 4WX2A 2J8GA 3GIPA 1AMYA 5IOBA 1V8EA 1W3KA 4HJWA 4GJ1A 3W2UA 3WD4A 4MDOA 1EB3A 1TJ2A 4AWTA 4KH2A 1H3GA 3BLEA 1M1BA 1VJSA 1XR2A 2ALDA 1TWDA 3W1RA 1IF2A 3N2MA 3B8WA 2WLZA 3VD9A 2DZSA 1EBGA 3SRFA 2INFA 3UCDA 4NF7A 3IJLA 3E49A 4JIEA 3CQIA 2VD8A 3G1RA 8XIAA 1IE7C 3NSMA 1J6PA 1M41A 2Z1XA 1DBTA 2AKZA 5I00A 2E7FA 3F5LA 5BOFA 3TYZA 1XSJA 1LYXA 4C60A 5B80A 3B03A 3Q4DA 1WP6A 3DG3A 4GI6A 1FOBA 1C8QA 4MAZA 1Q45A 2D3LA 3BJSA 1E15A 1L6GA 4C6QA 1EQCA 3QZ6A 4YCOA 1JDDA 3CT7A 3BAXA 4F0MA 3AIVA 2X05A 3KS5A 4L64A 3M5XA 1LDCA 1FWBC 4FX7A 1NELA 3P74A 3ZLFA 2XFYA 1UR1A 2XWDA 3PZMA 3NO5A 3AHYA 4WK9A 2C13A 3E2VA 3DYPA 4MPKA 3W81A 4IQLA 1RBAA 4NNCA 4Q8UA 1TZ7A 3NXLA 1L8NA 4GIYA 1J10A 3KLKA 2ZA1A 1OCJA 2Y2WA 3Q94A 2Y1HA 2CBUA 1HT6A 4GUIA 3U48A 1J93A 2DP3A 5CSUA 1DJZA 3SEPA 1GZ1A 1IWBA 2NVCA 5LHEA 1AH4A 3MO7A 3KP1A 1G67A 2YCLA 3N15A 5DCBA 1V51A 3BQ6A 4GYJA 5IHRA 5I5RA 2TAAA 3AWNA 4XZIA 3NO1A 1ZFJA 1U30A 2CC0A 2OZ0A 2DFAA 3C3NA 3N4FA 3I4KA 4U5IA 2J78A 4BA0A 3W27A 3Q37A 2IPWA 3OLEA 4J3ZA 2NX9A 2QJNA 4V2XA 2EO7A 5K9XA 2QMKA 3VOGA 2JK2A 3P5YA 3H2OA 3H23A 3K30A 2DZBA 1C9WA 2VVSA 1TUFA 2G3NA 4FI4A 4PMOA 5I3FA 1ZP4A 1CTNA 3TN5A 2RH9A 2FPTA 1JZ7A 2VCAA 5B7ZA 4PCNA 7CGTA 2Y85A 3Q45A 2ZVIA 3AS0A 4HU4A 2GPTA 4OGZA 1KBJA 1CLVA 3KL3A 3IJQA 5C2XA 1FWFC 3IJ8A 3KOZA 3B0XA 1UYQA 4GCAA 3GG0A 1KFEA 1Q6EA 2EPKX 5F1UA 1TJRA 1NF0A 3CPRA 3GXFA 4Z1BA 3N18A 3WQGA 1FH8A 2WJEA 1ZAHA 2WHKA 5AHNA 3PTQA 1FH9A 3KOFA 1H60A 4AD3A 5A69A 2OODA 4UQ9A 1R87A 3LPGA 2RUSA 3K8KA 3LY0A 4H19A 4IG2B 2V3FA 3LHTA 1YTEA 5DELA 1BVZA 3WQOA 1AG1O 1K03A 4IJBA 1OGBA 1DTNA 4L65A 4PULA 3VMPA 4W85A 1GVEA 3L21A 4DO7A 3UA4A 1W5MA 2CU0A 2E6FA 5TIMA 4D72A 3H7UA 2WSKA 2BGSA 4DPQA 5PTDA 1KTNA 3TSDA 4S3KA 2FMOA 2HVNA 3WUBA 1QASA 3E12A 4M7SA 1XYFA 1DWJM 5E6YA 1ADSA 3NQFA 2OO0A 2VCBA 1ZALA 3P3BA 5HWMA 4X63A 4KWVA 3F4NA 3RG6A 3GDKA 3SFWA 1P7TB 3DI0A 2D2HA 3F4WA 3LHWA 1QW9A 4ZXOA 1OCQA 2QJIA 2X41A 4WRHA 3E2QA 5HPOA 1GUVA 1T7LA 1YIXA 1A0EA 1DXEA 3CUFA 2OQHA 2HZGA 4D6IA 3CBWA 4LVGA 4ZOBA 4XB3A 4H83A 3AYVA 1EC9A 3UD6A 1XSIA 3VX1A 4QG9A 2DJLA 3Q58A 3POHA 2P3EA 1GYLA 2V3EA 4LVFA 1Q2SA 1OYBA 3LG3A 3EB4A 2PP0A 2QPSA 4PL2A 3BSGA 1Z3NA 1W1PA 3LGEA 5BXSA 4OT7A 3DFOA 1GONA 1C3FA 4CD6A 5KMYA 2ZICA 3CWOX 2OZ3A 1OM0A 2F84A 1NDVA 2PZ0A 5FJOA 3ITCA 2D24A 1G0CA 1Y5XA 2VEMA 1TPH1 1OFRA 3TR2A 2VEKA 3B05A 1JUBA 3STEA 1GVFA 3C2OA 4Q4PA 2J75A 3PJXA 4U3AA 3GWQA 3QJAA 3KXQA 4ZA0A 3TMLA 5KEZA 4IGMA 4AYSA 3P84A 1QNVA 5C9RA 3HGRA 4BK9A 3HQOA 5I0DA 2OGJA 4QAWA 3CM4A 5ABEA 3FN9A 3LCHA 3UPMA 4AUBA 4Y9PA 3KRBA 3T2QA 3GUWA 3S2CA 4LFYA 3LQLA 1DWFM 1UH4A 5ECUA 1RZMA 3CZJA 4Q8TA 1R85A 3B8IA 1UQZA 1TMQA 4RDYA 1BF6A 1K6AA 3VIGA 3CV7A 1NFBA 4I8YA 4QNWA 2GGEA 4JL2A 3G0SA 3FEMA 3U0HA 2QPXA 1I2QA 5A6SA 2VZSA 2WVUA 3SY1A 3SCUA 4M81A 4YL2A 3P62A 4CQ8A 4ORIA 4ATDA 1KR0A 2O9TA 2Y88A 4E2OA 4NL1A 5G4HC 3VIOA 1K9TA 4R33A 3WDPP 3EOOA 3MY9A 1ZLPA 1ZSXA 4ORMA 2BS9A 3PWGA 3VGBA 4Q4MA 2J79A 3GTNA 1OC6A 4F0HA 2WANA 1JI2A 4OOZA 3FA5A 1M7JA 1RQBA 3OLGA 2R9RA 1UMYA 2GUBA 1HKKA 4UTTC 1H0GA 1GKQA 4DUOA 3ARZA 1TTJA 2CZVA 1E6SM 2QCCA 3MCMA 3GDRA 4HT3A 5IBXA 3UG3A 5IBXC 2C1IA 4FLSA 3RJXA 3CEUA 1GCYA 1EJVC 4GZ7A 4US5D 2PU1A 3SCSA 1JXKA 3WK0A 1DJWA 1TV4A 1E6XM 2XVGA 4Y2WA 2WMGA 1K7XA 3VOFA 1W3NA 3AS1A 3I6TA 5CZKA 1F6PA 4R27A 1X6LA 4JTDA 1SW7A 1KFCA 3BGJA 2VRKA 4PFMA 5DQPA 2ZUWA 2R1MA 4L61A 3DHFA 2O9RA 3HGJA 3UERA 3MSRA 1FHLA 4IF2A 5GNXA 3PPHA 4JPGA 1EXBA 1YYAA 1XDLA 3QY8A 3W3OA 2Y8VA 1M6JA 3SRKA 5BXPA 1QOPA 3M7SA 2WBGA 3QEZA 1HQTA 4WHBA 3T08A 2J24A 1HW6A 2V5BA 4IX0A 1W1TA 4EANA 4IT1A 2PI6A 3GKAA 5HUOA 2A3BA 2Y5JA 3CWNA 2POTA 3CU2A 1I2RA 3QZEA 3UXKA 5CPQA 3S1XA 1VFFA 2WOQA 3PZQA 1JPDX 4UUIA 3P80A 1OABA 3BG5A 4ZB5A 1QMLA 2WZTA 1UWRA 5LA2A 3PBYA 1G9HA 1N55A 1KBLA 4KKXA 5ABTA 5FEZA 3NJ3A 4DAIA 1NDYA 4TO8A 3T42A 4A8LA 1FWHC 3HQNA 2W3ZA 1X8CA 1XBZA 2BY1A 3B9NA 3ARUA 2XM1A 4DY1A 2P0OA 2CETA 2NWSA 3Q65A 4O8RA 2YYUA 3AXMA 1CYGA 4BQ3A 1FH7A 2V5KA 3R1ZA 3EPMA 3NSXA 3O06A 2E9MA 3CUZA 1GOKA 1C90A 1RY0A 3A12A 5EYWA 3W24A 1P43A 2PDPA 2XDFA 3BJFA 1JL8A 2GSHA 5G1MA 3S1VA 2QUMA 1B3OA 1UWQA 3KRUA 4JKKA 4DQWA 4PCTA 5A8NA 3ZT5A 3P8JA 1VBJA 1Y0EA 1F3TA 4PUJA 4Y9AA 4MKNA 5BNKA 4RDVA 2PWFA 2P76A 4GZEA 3FJ4A 3IGHX 1E3XA 3W00A 1IZCA 4ALDA 1AQHA 1HXJA 4GWEA 4NQ1A 2EEXA 2J7HA 4GFIA 3TSMA 1BKSA 1B3YA 3FLUA 2ZDRA 4UQDA 3W7GA 2QUNA 4GX9A 3IVTA 3UCQA 1D7KA 2IKGA 3FJ6A 4A3QA 3IRSA 2GYIA 5JVLA 3F4VA 4C7DA 4W8AA 2JEPA 1FFRA 1UD8A 2PDBA 4WUIA 2D2JA 1RJPA 5IFTA 1OT1A 2W63A 2W66A 4QEEA 3W7RA 2ABAA 4O1AA 3EDKA 2GDUA 4ERAA 3MCNA 2VHLA 4X61A 4QAIA 3LOTA 3DC0A 4FP1A 2JBMA 6CGTA 1PDYA 2Y63A 3FY1A 1OGSA 2C0AA 4LQ1A 4N9DA 1PIGA 2VYOA 3BGAA 3ARWA 4HZ6A 3MS8A 1SR9A 3BK0A 4UR7A 2J6XA 1WZKA 3L23A 1DWAM 3K13A 4JEJA 2NLIA 2ZUNA 5AYXA 1Q7ZA 4L6OA 5KINA 1SUXA 4V27A 2HROA 3VM7A 3B4YA 3KFTA 4IIEA 4ZOCA 4L5ZA 5E6ZA 3SCOA 1UH3A 1QVBA 3N3TA 4IOTA 1LRTA 4PC8A 3WLIA 3TJXA 3ZWSA 1KTBA 1A50A 4JKLA 2X2YA 4GBDA 4MWAB 5FJTA 1TX2A 3UPWA 2WK2A 2H6RA 4BEUA 1TWZA 1JCTA 4NX5A 4XZ9A 1MW2A 3GYEA 4F3HA 3AZSA 1FA2A 3R58A 4N7QA