3H2AA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
261
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 261
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2aA00
1AJZA 3NOYA 3H2CA 4MWAD 4PZVA 1TX2A 3H2FA 4S3DA 2DQWA 3H24A 3V5OA 2E7FA 4DJEA 3MCNA 4NL1A 1AD1A 4D8ZA 1EYEA 4S3AA 2Y5SA 1TWSA 4HB7A 4S39A 4DJDA 3H26A 4DJDD 4C1NB 4DJFC 3H2AA 2YCJA 1Q7ZA 1TWWA 2DZBA 4C1NA 4DJED 3MCMA 4NILA 3TYZA 3H2EA 4MWAE 3H21A 1F6YA 3TYUA 3TZFA 2VEFA 1Q8AA 2DZAA 3H22A 3TYBA 4S3EA 3TZNA 1AJ2A 4O0QA 1TX0A 1Q7MA 4O1FA 3TYEA 2Y0FA 4D9PA 4MWAC 3H2OA 3BOFA 2H9AB 3BOLA 2YCIX 4MWAB 3TYAA 4DB7A 3K13A 3H23A 4DAFA 4DJFA 4DJEC 2YCLB 2Y5JA 2YCKX 4DJFD 1Q8JA 2VEGA 4NHVA 2BMBA 3H2MA 4DAIA 2H9AA 4MWAA 1AD4A 1Q85A 4S3BA 4G9PA 1Q7QA 4S23A 3TR9A 2YCLA 5JQ9A 4DJDC 3MCOA 3TYDA 1AJ0A 3TYCA 1TWZA 4NIRA 4S3CA 2VP8A 4S3FA 2OGYA 4D8AA 4S38A 3H2NA 4CCZA 4O1EA
chains in the Genus database with same CATH superfamily
3LBOA 4IIEA 3GDRA 1OC7A 1DE5A 1O68A 3AXKA 1OFOA 4A8IA 3KBMA 3NIYA 1NAL1 2I57A 3KLKA 3UXDA 3TCSA 5I24A 4EANA 3LBMA 4ICMA 1KO0A 2OWCA 5D30A 4L5ZA 4EWND 4PCNA 3CUFA 3L4TA 1RALA 4J3TA 4AY1A 3B05A 3KBJA 3UNTA 4U28A 2VWSA 2G0WA 3N2XA 1W1A1 5EGRA 4V2XA 2XVKA 1JZ2A 3UW6A 1ADOA 1NQKA 4IIHA 3TZFA 3B97A 3KP0A 3KOWA 4AVOA 3WD4A 2EEXA 1R7OA 2R24A 4O1FA 4TMBA 3L4YA 1Q45A 4I5RA 2VRQA 3P6LA 2YX0A 2UY3A 3ES8A 3I3DA 3MHGA 1F4AA 1ZP3A 4MNKA 1C8VA 1FCVA 1MMFA 3M7WA 1Y65A 1E1FA 4S1FA 6XIAA 2F84A 2YZ5A 4J2MA 3UF9A 3P60A 2RDTA 4IUOA 3ZO9A 4XKYA 2FVLA 4TR9A 1E9IA 1FWDC 3L4UA 1VAHA 3ISIX 3RITA 5JBEA 2FIQA 5EKYA 2NQJA 4M6UA 1KM6A 1TVPA 1MZHA 3RXZA 4S3DA 1HP5A 3SURA 3H24A 3Q65A 3MUZ1 1LL4A 4HHMA 4D6DA 2EHHA 2A79A 1TWDA 3KVMA 3MV11 3RLHA 1CB2A 1R0MA 3W81A 3LTPA 5A3HA 3L7RA 5HATA 3GB6A 4IOTA 3KTCA 2PUZA 3QY7A 3ABXA 5T9CE 1FWEC 4XVDA 3KRSA 6ENLA 4KEUA 5AC5A 2B7OA 3IUDA 3R58A 3VILA 3B3DA 4FXSA 4LB3A 2A7RA 1YBQA 2VWTA 2ZVIA 3C2OA 1Z32X 3GG0A 3CWNA 3WH7A 1CIUA 5EFFA 3BCDA 3R6IA 1BWKA 1XH2A 3WBYA 1OFEA 3R0UA 1EBGA 3GZ3A 3T2QA 3UWWA 1EPVA 3W1PA 2POZA 3SSJA 3ARYA 5ABHA 1SMAA 3WFZA 4GVIA 3XISA 1Q6GA 2Z1KA 3WELA 5MKGA 2JE8A 3LLFA 1TV7A 4W86A 3W88A 3VDHA 4AXKA 1W1VA 3WDHA 4MYAA 3VDCA 1VHCA 4UCFA 1GVSA 1PBGA 2CLPA 3CT2A 4GI9A 3LSCA 4L61A 4NNAA 2WWDA 4O57A 4TV5A 1W9PA 1IWAA 4O8AA 3C0QA 1GORA 2XIJA 3NL5A 1MQQA 4KWOA 2ZXDA 3MBDA 4E2OA 1N7KA 5FJJA 2WJEA 2VRJA 3IGXA 4IM4A 2EG8A 3QZ6A 3MKVA 1ZNNA 4LUYA 3B9AA 1FWSA 5D8WA 1ZQ5A 2PWEA 3RLGA 3CS2A 4MNJA 3HOJA 4UQCA 4QIUA 4HNCA 5FA5A 4GACA 2G3JA 2QPXA 2I16A 2FMNA 4B2DD 3E5BA 3WLTA 2HCVA 1V8EA 1UC5A 1Q2RA 1JPDX 4EXBA 1Q8AA 4RZBA 5IRPA 4PYSA 1AH4A 3BXWA 4C6FA 5CBJA 1UIPA 1KFWA 3NO1A 1UD2A 1GOXA 2W0UA 3WJXA 3MYOA 3VIFA 4AX6A 3PZNA 2YFOA 3PAJA 4NU7A 1UWTA 3VXGA 4DJFA 1KA9F 4CD6A 2WNQA 4H7CA 3L23A 4MZ1A 1W91A 2EPLX 2VEMA 2D69A 4DLMA 3EZ4A 1BGAA 2HVOA 4DI9A 1XQLA 1EF3A 2Z27A 3D0CA 2J79A 2Q71A 5HA7A 1UZDA 3CIXA 4PC8A 3UWZA 1U83A 3NFUA 3GTXA 3UBPC 4A4AA 3A64A 1JNDA 1X1OA 3G1AA 3VIHA 4Q8PA 1DJGA 5FSDC 1E6XM 4FLOA 4DPQA 4NJKA 1REQB 3OLEA 3RILA 4CCEA 5LA0A 2HPMA 4GI8A 3I4KA 5F2MA 2E5DA 1ZAHA 4C1NB 5CPOA 4KETA 3LOTA 2R14A 4GYJA 2I14A 3KVKA 1W5NA 3DAQA 1BYDA 2I5GA 1M04A 3T0AA 4JOMA 1GPFA 2YFNA 5BMXA 4RDWA 4LF2A 3EWXA 5I00A 1T7LA 3W85A 3U2EA 3JVAA 1PJ9A 5IDIA 1PTGA 5AHNA 4TQTA 4WHBA 4EF8A 5C55A 4ZTXA 2VR5A 3LMYA 2PURA 3W7JA 1RJRA 1RQEA 3OQ8A 1S1PA 3IANA 5I3KA 3WSUA 3CT7A 3W29A 5FD0A 3SSZA 3CASA 4KS0A 3NUKA 1TJ0A 2E9MA 3R10A 1AQ0A 3K46A 1GVIA 4RX0A 3E0LA 4ZOBA 2WMJA 1KKRA 5J5DA 3USZA 1OZQA 4E8CA 2IS7A 1O7AA 1WQ5A 3CNYA 3WQDA 1XCXA 2WHLA 2ZA3A 3ARTA 1VZWA 3S6DA 2WVVB 2P76A 1MZRA 2FGBA 3VNZA 2PDQA 4KRZA 4LVAA 3QR1A 5D37A 1MNZA 2WWCA 3ITCA 1MEWA 3L12A 1HO4A 3ITYA 3I6EA 2Y89A 4E2VA 1GTHA 3AUJA 1ME8A 3S5YA 2WZTA 3E49A 3FGCB 4FNUA 4H19A 2O9PA 3GDLA 1FDZA 3G1SA 5ABGA 3UR5A 4X2RA 3R12A 3VGDA 4ZXLA 2ABBA 2YOCA 1MEHA 3LG3A 4V33A 2GSHA 3EBVA 3BLEA 4DB7A 3TYAA 1I1XA 3NYZA 3CU2A 4IFRA 1E6SM 3W73A 4NQ1A 2A3EA 4F9DA 3AUOA 2CWNA 3BG5A 1FHVA 2C1GA 1OFAA 3SFWA 3BSGA 3WMBA 1OJXA 1C8XA 2PWUA 1O1HA 1WZMA 3WF2A 4C90A 3AXMA 5CC7A 4XTIA 5AHIA 3PF3A 1TFVA 4L65A 1V4YA 5FF2A 4A21A 3G1RA 1FWHC 3WD3A 2Y63A 3CIWA 2XFRA 1PHQA 1XCFA 2XIBA 1YDYA 3UR7A 4E6MA 3V4BA 3ZJ8A 5HUPA 3WQFA 1KB3A 4JL1A 5C2CA 4PRWA 4ZEPA 3KX6A 5CKSA 2XM1A 2Z1BA 2VD8A 3BQ5A 3PZTA 2J62A 5CZKA 1QI2A 3TONA 1OVDA 5LGZA 1QFEA 4O1DA 2F6KA 3G5EA 4GGBA 3BWWA 3DX5A 1V6WA 3N2BA 1XDLA 1ISXA 3RM8A 3TJIA 3A3WA 3K4DA 4OIFA 4J9JA 2QUUA 5XINA 4FO4A 5I3HA 1ZB5A 4UQDA 3MZNA 4PL2A 3MO4A 1RZMA 4HYWA 4O0KA 1KTBA 2VDIA 3UYIA 1BEUA 3W7GA 2EGZA 3PTKA 3DG6A 2NXIA 5D03A 3KTSA 3OPSA 3FGCA 4NY2A 3RJXA 4EK7A 2TYSA 2VZSA 3NQBA 3GG7A 3DFQA 2UWFA 5H8PA 1UP3A 3MC5A 2BY0A 2C1HA 4O12A 4UTLA 1D8CA 4XZ9A 3VE9A 2E67A 5KMYA 4HQVA 2DQXA 1XBXA 2ZZ6A 1PKYA 3R8GA 2OCZA 3TWAA 2ON3A 3GY1A 2YA1A 3OBAA 5FESA 5HUOA 4LY8A 2WHMA 3U5UA 3T0BA 2PLCA 1XLLA 3GRIA 3ALFA 3CWOX 3VGFA 1TCDA 1UKTA 3SADA 2ZKMX 3EMQA 1K8YA 3B06A 3WUGA 3GXMA 1G7UA 3WY1A 5I3JA 1J9YA 4JEJA 1BXNA 1BF2A 4OZOA 4N4QA 2D2JA 1QW9A 1VPQA 1AQHA 4JXCA 2F38A 5CG7A 1K6AA 2RH9A 3NPUA 3EX3A 3NQ6A 3L67A 3DDMA 1DKWA 3AMLA 5D9OA 4GYPC 1XLBA 2VTFA 1FDYA 3BLKA 1WKDA 4E4FA 1E70M 3PZUA 2C14A 4HA4A 4IIFA 2O0TA 4DAFA 2YDQA 2V8ZA 5FJUA 2VGFA 1Q8JA 3QY6A 1B0IA 2A4AA 1AZ2A 1G4TA 5HWJA 3VM7A 1JD9A 4EF9A 1Q63A 1ICSA 2ZXBA 4WXYA 3WMSA 2WSQA 3G2GA 3R8HA 1FWBC 2IPJA 4B15A 3MMWA 3SY1A 4X22A 4RE2A 1TTIA 2E5CA 3H70A 1QW8A 4K39A 3LN3A 3N2MA 5C5YA 3AS2A 3HQPA 5LGXA 1PX4A 4PZVA 5U7SA 2O4QA 3PUGA 1V7AA 3RX4A 5LA1A 1O6IA 3GYEA 1MW2A 4URIA 3OVRA 1O95A 2C16A 1QPRA 1L6SA 4C6MA 4S3AA 1EPXA 2FZNA 1KC7A 5LIYX 1CB7B 3CAVA 3TTEA 3W7CA 1OF8A 4A8LA 2IKIA 5BRPA 2RUSA 5G1MA 3AHYA 3RUBL 2BSLA 4CNSA 2A3LA 2JK2A 3W2NA 3TX9A 2X2GA 1V02E 2Y6ZA 3PPFA 3IIXA 5MF5A 3N19B 3VX0A 3C4UA 3SECA 4J7RA 3P67A 1EOKA 4MG4A 4IPLA 4AMCA 4RNHA 2PWGA 3CL8A 5FEPA 3IAPA 3MKCA 2VELA 4ML9A 4AISA 3PUOA 3T44A 4CD7A 4QFUA 3ARZA 3TTSA 2C13A 3UY7A 2BY1A 1BFNA 1CGYA 1TJPA 1QHZA 2Q8LA 4GD0A 1FWIC 3IVUA 2FHCA 1XRTA 4KGJA 2CESA 3G1YA 4OKDA 1KM2A 1X38A 1PWLA 2D2GA 2CIPA 2O7QA 3AYSA 3REQA 4BEUA 4W4QA 4B91A 3JUGA 3TJXA 4KT2A 4BI7A 2SFPA 1UR4A 2GDUA 1UH4A 2PTDA 1NELA 2DSWA 1A5AA 3ZT5A 3I7QA 2BX7A 4AHOA 1UD3A 1DJXA 2ZRYA 1UJQA 4DJDD 1HKWA 4FHAA 3SGUA 2CC0A 2ZZ7A 3AYVA 3MW7A 1L6WA 1O5XA 3QGVA 3KHDA 1KXVA 5A8MA 1LBFA 3W84A 3GBEA 1J5TA 1QRQA 2VFDA 4Z2JA 3ZVHA 1I45A 4NKCA 3TA6A 3HGOA 3EB4A 5HJYA 2DVXA 4I8DA 2VL4A 1Z8AA 1J2WA 1E1EA 1LZOA 3T0DA 1V6VA 1GOKA 2BVWA 3CB3A 3M0XA 2ANUA 2PGRA 4PCPA 3QMSA 1P0DA 3PM6A 1IT8A 1FKXA 4CQ8A 4F9JA 2X40A 1HXJA 4MJ4A 4EKJA 3KOZA 5J5RA 3QM3A 1JCLA 2H8XA 3DKLA 3L5MA 4JKLA 4AD1A 1VJSA 3L5AA 4N42A 2PLJA 4BQ2A 4ATWA 4H9MA 1SSGA 2ZVRA 1PZ3A 1HKMA 3SIMA 3F4WA 2BDQA 2GJLA 2BOEX 4L9XA 1E15A 3WKZA 5CPNA 4FLQA 1GW9A 1NU5A 4O18A 2FJKA 4J27A 1EJTC 2FH8A 2VFHA 1B31A 1TJ2A 3DCPA 2AAAA 2ZWYA 4AUBA 1I2PA 1UCWA 2WLZA 3HMJG 3FYOA 3EDDA 4OOZA 3BAXA 3VIMA 1IIHA 2A7NA 5A8QA 4D1JA 4ECLA 3ZVIA 1OCBA 3P81A 4GXMA 5ABEA 2ZTKA 3VKDA 4B5UA 3RK8A 3PJXA 2GOUA 1RBLA 4OECA 3C2VA 5LYRA 4XIAA 4QM1A 4JQ4A 1W3TA 1DWFM 3WL1A 5A8PA 4O52A 1OWQA 2PTZA 1AL8A 1RP8A 1Q13A 1U5HA 3RCNA 3KWSA 3PG8A 4GYFA 1F8IA 3L68A 3P14A 4RW5A 4B9ZA 1GCYA 1ISZA 3R0KA 3KL3A 2POTA 5AKQA 1U30A 4P8WA 4HP5A 3GSMA 1X8CA 3KS6A 1E9YB 4Z1YA 1TWZA 1MO0A 1Z44A 1VPXA 2E6DA 3KXQA 4DBSA 3BCFA 4FR6A 3G0UA 4U4MA 3G0XA 1XFBA 1RJPA 1HJVA 1UH3A 1VQTA 4ZB0A 3BUVA 3PWAA 1KTCA 4AW7A 3COTA 3WNKA 4D6EA 3LHWA 9XIAA 3AC0A 2WC3A 2E6FA 3BMXA 3KCOA 3VOGA 3HQOA 1EGZA 1EGMA 4C6IA 1X7FA 2V68A 4JDYA 4F66A 2C3ZA 3PFMA 1SO6A 5BCAA 3LPOA 1GYNA 1D7KA 3GZAA 3PULA 3HA1A 1VIZA 4DPPA 3SRHA 4LY4A 1SZEA 3E0FA 3KUMA 3GFYA 4ZQCA 3AROA 3QW3A 3MANA 3LPPA 2PDKA 1D7FA 2YLLA 1BVNP 4KEVA 3URBA 1UH2A 2RDXA 4YVPA 5A8NA 4QG8A 4AZCB 1OX5A 4GYKA 1DTNA 2QHAA 2BVTA 3WQPA 1EP2A 1CGVA 5AC4A 3MT1A 1SYTA 3CTLA 4KWVA 1M7PA 4HU3A 4Q4QA 4M56A 2GJNA 4AWUA 1IT7A 1SM9A 4GO8A 1IZCA 3LCHA 1UMYA 4Q8NA 1VCFA 1RH9A 2DH2A 2E8ZA 2WNWA 1QWGA 3KLLA 1XIJA 2XU2A 3A24A 2BS9A 1YEYA 1GHSA 3HM7A 5DN1A 4AAJA 3G8RA 4D6GA 5DCEA 3NAVA 4UTJA 1R86A 4YTQA 4IMDA 3DIPA 3RG6A 5KEZA 5A6MA 3FN9A 3QHOA 1MVYA 4LUSB 1SFTA 2Z2AA 1PXGA 4GIEA 4LQ1A 4DO5A 4WVXA 1J79A 2OLAA 2BVDA 8CGTA 3EMCA 5FF7A 1NWTA 4KEZA 1F76A 4UTTC 4QBXA 3R4IA 3FEMA 1XIHA 3ERPA 1IYXA 1R3SA 4IQEA 2WM1A 4QG9A 4GZ7A 1F9CA 1YTKA 5H1WA 1EYWA 3GS6A 4OBSA 1O66A 4ZL1A 4PCTA 1I8JA 3BCJA 4J3UA 4UMBA 3SEPA 4OQVA 1H7WA 4C65A 2Z29A 2C79A 4Q4RA 1E40A 2G8ZA 4R9OA 1HL8A 3CZJA 1CGTA 5A6KA 4A35A 2DJXA 1Q4NX 1XXXA 1B3ZA 4E38A 1BSLA 3LLXA 5DX7A 1JVNA 4OGZA 1KLZA 3TQ0A 3CZKA 2VKZG 1UBPC 3TW6A 1W3JA 5A69A 1FRBA 1KXHA 1XC4A 1GG1A 1X6NA 2GGGA 2DZPA 3CO8A 1IHIA 3O2LA 1EA9C 5BXTA 1R47A 2ZRZA 3V18A 1WP6A 1MRQA 4LVBA 1JDFA 1DIDA 5LNWA 6REQA 4X9YA 5E0KA 1W5QA 4AZCA 4FK9A 4PUEA 3SUUA 3UZZA 5D2VA 1QW7A 5TAOA 4IGHA 2IXVA 4Z1BA 4FLSA 3LGDA 3UCDA 2VC9A 2P53A 2YLAA 2CNCA 3TSBA 4A3YA 5DBUA 1TIWA 3GR7A 4BHYA 1N8IA 3SW6A 4F2UA 4R53A 3WDJA 4IMCA 3U2OA 1XFCA 4M19A 4N6EA 3W22A 1RCXB 2WCAA 3ZWSA 4NNBA 5H8MA 5HPOA 4IXHA 5DXYA 3FAXA 3STPA 3U8GA 2ZX5A 1O94A 4POCA 4N2YA 3S3GA 3NZ1A 2VEFA 3MWAA 1AJ2A 4GNJA 4JTTA 5IHSA 2X0HA 3N9KA 3GNOA 5G4HC 4ERIA 3N1AA 3OZOA 1KM1A 3MVTA 4QEEA 2XYLA 4AZHA 1KRCC 5LZLA 4LYKA 2CW6A 3B4UA 3QPZA 1K03A 1XPYA 1KFKA 2ZDRA 2CETA 3AXIA 4BK9A 5A6LA 3PG9A 1XYZA 3I68A 4GG9A 1S3TC 4WDTA 1SO4A 4CCCA 2P0OA 3ARXA 3FW6A 1QK0A 3DFTA 3TVAA 1X6UA 2NX9A 3S1XA 1QBAA 3T0TA 3H2NA 3V3WA 5AN7A 3TXZA 3NJ3A 3BSHA 3W7OA 3C8NA 3U7BA 3PBWA 1J0ZA 3F2CA 3M5ZA 4ICCX 3RHGA 3VIGA 2WVUA 4PTXA 3LRLA 4CN4A 5C8BB 2VOMA 3MUIA 2XINA 4W7UA 2C71A 3GH5A 4BS0A 4O16A 1RP9A 3P5YA 1IR1A 4CQDA 4H1ZA 1UWSA 3S6TA 3U6WA 1KKOA 4ZO8A 1SR0A 4Y9PA 2ZRUA 3GU1A 4O1BA 4WJEA 1E6ZA 1XD1A 3MI2A 2QMJA 1FOBA 5F4XA 2BASA 4FNPA 4E2DA 3GXPA 3OHMB 1D3GA 4W8BA 1AW2A 3EX1A 2RKXA 3ME3A 1C7SA 5CJNA 1ZSXA 3L5LA 3VIJA 1GJWA 4I7UA 3E02A 4LOCA 5I2UA 5T26A 2J25A 3WZ0E 1F7BA 3WQ8A 1TCMA 2ATMA 1R9XA 4Z1AA 3ENLA 1OGGA 2OWWA 1G7VA 3M0KA 5BRBA 4H7ZA 5I02A 5HINA 3PHAA 3I65A 3MMTA 2YDAA 4DRSA 2ZUUA 3FSTA 2ACQA 1NARA 1XDJA 2DZUA 1YHTA 4WOZA 3TOYA 4GZJA 4Q32A 1GKPA 2CBUA 4D6FA 5JH2A 3N18A 3TN3A 1PDYA 3EAUA 1EH9A 3V7PA 3WLRA 3QY8A 3W7QA 1R8LA 4DO4A 1QO2A 2HE5A 3MBFA 3NO3A 1XLKA 1JYVA 5AC7A 3UPWA 1M5WA 3FV9A 1QUMA 5I03A 2PS2A 5C9XA 1IWPA 4P7QA 4X0VA 4EXAA 2CKRA 1ONXA 1ZGDA 6TIMA 4MAVA 1PSCA 3S6OA 1YNQA 3VINA 5F4SA 2QMKA 4GNVA 3UJFA 2XH4A 5C2XA 2AGTA 3G1DA 4F0KA 5LIWX 4JYFA 1MQPA 4RLIA 3S9ZA 4Q6JA 4DJFC 3SCNA 1VJIA 1F3XA 2CITA 2EPHA 1BXCA 5BRQA 3U3HA 3BGAA 2GUYA 4BI5A 2REQA 4I90A 5AB3A 4JX6A 2XH2A 1ZU8A 5DT7A 3VC6A 4TX9A 3NZRA 2EPMX 1JQXA 1WUEA 2JALA 3BVJA 1WKFA 1EGVA 4LCSA 3CO4A 2PCEA 3RFAA 3QZAA 2YXXA 2DZVA 4HCLA 1F5ZA 3JZUA 3SCRA 4WSHA 4R34A 1ONEA 3V1PA 1QMLA 4QS6A 3HZ3A 3DN5A 3GHSA 1PE1A 4LTSA 4AZBA 3BK0A 5HJLA 2VVSA 2FDMA 1A3XA 4OT7A 1WE5A 4J3ZA 5K9DA 3SBFA 4LYQA 1K70A 1XGEA 2J6VA 4ZQPA 4AF0B 3OZMA 1HKVA 1JQVA 2QVNA 2GQ3A 2QGHA 4P8VA 2PI6A 1S3HA 4D6HA 3T05A 4HTBA 3S1GA 3DESA 4WR3A 1ICQA 3UZJA 1KBLA 4ORIA 3TV8A 4UZUA 3PK7A 4LBRA 1PVNA 1GHRA 3N12A 3OVPA 5LSMA 2VUNA 1C3FA 3W1QA 4HJWA 2Y5SA 3N2TA 1MDRA 3ZR5A 2Q09A 2ONEA 1XW8A 4WKAA 5EMJA 4KEMA 3QTPA 3DI0A 3VNMA 1H09A 3QPEA 4MSSA 4AYSA 3PZ9A 4MWAE 4MOZA 1BAGA 1QNVA 3W0KA 3CH9A 1UD6A 3G1FA 1YIXA 3GU9A 3ZOAA 4E3VA 3OTRA 3WUFA 2NX1A 4MAZA 5M3WA 3PBUA 2WXDM 1ZP4A 4LCQA 3KBVA 2BXVA 2VEPA 3LUTA 1NTHA 2PCQA 4FF7A 5HWNA 1C9WA 4J3WA 2UY2A 1H41A 4AYGA 3WBWA 4F0HA 5CG0A 4S3BA 1WYIA 3BJSA 1FVPA 2DPEA 3LPFA 2TRSA 1H49A 5BWFA 4LCRA 4Q22A 4LV9A 3S2NA 3VKBA 3T0CA 4ZA0A 3ITXA 1UMLA 3D3FA 1VP5A 5PTDA 3L2MA 3G18A 5AHMA 2W67A 5CLWA 1DWAM 3P93A 5M03A 1V3JA 1E56A 4YXGA 5KTLA 1Q6RA 3WF3A 3SRDA 2WSKA 4O54A 1AD1A 1BTMA 1JAKA 3GKAA 1LOLA 4R5EA 1WKEA 1HTIA 3GVRA 3IRDA 4YTTA 2PSNA 3GVVA 2WZIA 3W01A 1HP4A 2XFYA 1DE6A 3EPMA 2PWDA 4AF0A 1GONA 4C6LA 2OKOA 3OA5A 3TC7A 3VYLA 4H3DA 1HL2A 1MEIA 3BLOA 4XX6A 1BRLB 1EHAA 3EWZA 2OXNA 4R7WA 3SY5A 2QAPA 1PO9A 4NRSA 4GIAA 4LF1A 2HK1A 4K1WA 4H6KA 4X0NA 5DLCA 1QNPA 1Q65A 1A50A 2YXGA 2YDRA 3H23A 3TWBA 3WEZA 1KRBC 4NF7A 1BHGA 3C2EA 1DIOA 2WMIB 3FXGA 3OVQA 5CC5A 1XYBA 4M7TA 2PDJA 1TKKA 1LWIA 1K7XA 3L0NA 1NFPA 4RJEA 3C3NA 1GJPA 2CLEA 2BOFX 4JTRA 3VE7A 4IMAA 1PCKA 3RRXA 3G6MA 1TZ9A 3ZQ9A 3AXXA 2OQYA 4DUOA 2QDHA 1ONRA 2OX4A 4JQ2A 3CHDA 1Q66A 1GUVA 4LANA 5EY5A 2YSWA 4H8HA 5FF4A 2R8WA 4ADUA 4B90A 3CUJA 4XO7A 4K1GA 4M80A 1A3WA 3F2DA 3HIJA 3UJEA 3APTA 1T5AA 2WW5A 1HJQA 3GDBA 4YS1A 4WEVX 1S5MA 1BQGA 1EIXA 2Z2BA 1HN1A 4IP5A 4AD4A 1UASA 5K9XA 3VAVA 5LIXX 2FTPA 4XZNX 3P0WA 4TTGA 2HDJA 4V28A 5CSYA 4H6RA 1V0LA 2D0HA 2UY4A 4QDMA 2XIIA 5DY2A 4GH3A 4IPIA 4I5XA 1MYRA 3ATYA 4RW3A 1CYGA 1EHNA 4W7WA 2PRMA 4JFSA 1S38A 3RU6A 4ZE4A 2WC4A 5AYIA 5G1TA 4HK5A 3TUUA 1VF8A 1S2CA 4IGMA 3TK7A 1BRLA 3WDIA 3W7PA 3TC6A 2V63A 1PCWA 4W87A 1HIZA 3K5XA 1LJYA 1UBSA 3AZSA 4HCDA 2Y8KA 1EJRC 4UNKA 2NWSA 2GSJA 1TV8A 1GGOA 1DL3A 1TELA 3ZFHA 3MTWA 4Q4KA 2FTWA 1QOQA 2AL2B 2R1PA 8TIMA 4QLJA 5XIMA 1RXOB 4W8LA 4NUWA 1O5RA 5KZ6A 1TR1A 3CBWA 1MW1A 3VD9A 2NLIA 5CAHA 2CHOA 3WQ6A 1G4EA 4QDWA 3CC1A 2Y88A 3LS9A 4O13A 1OC5A 8XIMA 2D2HA 3TOPA 2XH7A 3C3UA 1KGUA 2UY5A 3NM1A 3WLOA 4H7VA 3U48A 1IWBA 4HOXA 6XIMA 3T8QA 3TC3A 3VFLA 1MUWA 1EUNA 1L8PA 4W93A 3V36A 5E93A 1EB3A 1TPC1 2BXYA 4FP1A 4X9SA 1XGDA 5AYBA 4HNUA 1JFXA 1U1UA 1I2OA 2OZ3A 3LMZA 3RF9A 1FWJC 1YDOA 1JI1A 3SFKA 4ROPA 5HMSA 1S1RA 2DEPA 2W63A 1RPXA 1FH8A 3IJ8A 4GO9A 4JEQA 2OB3A 5I3GA 4PR4A 4JICA 1FBAA 1T8XA 1UIOA 3NSXA 4UR9A 3UETA 2O55A 3TN4A 1RHCA 4KCVA 3A22A 3CLWA 1OD8A 4GA8A 1CT5A 2ODOA 1NF7A 5G1YA 2PDYA 1ZS2A 2R82A 2X0YA 1IXPA 1AL7A 3T81A 3AZRA 3G0SA 2VI0A 4Z2LA 4DWSD 5JUVA 3LV5A 3WF0A 2YL5A 3GYCA 1ZUAX 4DBUA 4ENLA 5IBXA 1KRMA 3GBDA 2QPSA 3KVJA 4P7LA 4YWIA 3TA9A 2ISDA 1E4MM 1E9LA 4DEFA 4NP7A 3AIEA 2WJFA 3M0JA 4QLLA 3M9YA 4Q33A 1MXSA 2XN0A 3TEVA 3SI9A 2NLYA 4A29A 3BLIA 3H7UA 2V30A 3CHEA 5AVNA 2D20A 3S46A 4XAGA 3BDKA 4Y9MA 1IZJA 2OQHA 4UTFA 1RJQA 2GJXB 1M3UA 5CPMA 3S5ZA 4ZMGA 5IXEA 2YA2A 3VGBA 4K36A 2R94A 1PYFA 5A2AA 5EFDA 2P50A 3KL0A 1TPEA 5JIWA 4J40A 4CU7A 2AKZA 4AC7C 3AWOA 3LCWA 4Q8OA 3CUGA 4DN1A 3I4EA 1L0PA 4R7OA 3QV9A 2VX5A 4PMZA 1Y8BA 4AC1X 2X1IA 1AK5A 1I4NA 4MPQA 1K8XA 2BTMA 2WBGA 3AHTA 1MUCA 3VUPA 3IVTA 3IJ7A 1S2AA 4MZYA 3EX2A 2DQWA 1KD0A 4I5UA 3G77A 3AIUA 4M51A 3SJNA 4ADTA 3PVFA 4JS3A 3BARA 4PSRA 3CQJA 3ARPA 3E2RA 5CPQA 4JPGA 4JX5A 3F4VA 1CXEA 3ZR4A 1W5PA 2PF8A 1HVQA 3NG3A 3PJWA 4JQ3A 4PTDA 1JYNA 2CPUA 1NFBA 5I5RA 4X3ZA 2F7FA 1TTJA 4OU1A 3RO6A 3N2CA 2CWXA 4MVAA 4J3SA 5I7GA 2VM8A 1H0IA 3PC0A 5C7HA 4HYRA 3VDGA 4FNSA 1H5YA 3QRHA 1OZMA 1QHOA 1KBIA 4IT1A 1JULA 1TWIA 4HKPA 1RD6A 4R27A 4O4WA 1QO5A 4DNMA 3CM4A 1R3QA 3KL5A 5C9ZA 4PSPA 1E6NA 3VGGA 2ZX7A 1XH1A 2D1ZA 2A3HA 5GVJA 2ZFAA 2OZ0A 4LAMA 2H6RA 1UUMA 2ZXAA 3DGRA 1HX0A 1LORA 1W0MA 4AZ7A 4QHRA 4NIRA 3CAKA 2E4TA 4PFHA 4LEQA 3NPXA 3LD5A 2CYGA 4AQLA 3CK5A 1XF0A 4GCAA 3INPA 1PIIA 2BFGA 3W4RA 1TX2A 2QJIA 1N8FA 1JUKA 5HR6A 3MZ2A 5E9AA 4M0XA 4D2JA 1C92A 3NYDA 3I3BA 4XZIA 3B4YA 2RJHA 3GVQA 3S83A 4NZ3A 1TPB1 3MVIA 3NL2A 4ACZA 1SJCA 2TODA 4AIBA 3SCQA 1QNOA 3WLNA 4OBRA 2DIEA 1RLCL 4R3UA 2HPIA 1EUAA 1QK2A 1CI1A 3OODA 3QPYA 4QLKA 3FFSA 2GQAA 3W6YA 4KWSA 4NNCA 3KAOA 1FH7A 3A23A 4JFUA 3WH6A 1QXLA 3GFZA 1S2WA 3WN6A 3I3EA 3H55A 1XYCA 2V6AA 2CFFA 2YW3A 3M6DA 4ILSA 3VNDA 1BYAA 3NCOA 2VR2A 3N6JA 4CNTA 1LF1A 5LA2A 1LQ0A 3MJYA 4PTMA 3EKLA 5F2GA 2Y8VA 2MUCA 2IKGA 4DZAA 1AQMA 1LRTA 3O0KA 3G1VA 1RUSA 3KBSA 4I3GA 3FY1A 2ABAA 1KCLA 1WDSA 3D47A 3A9BA 3T07A 3ZSSA 1XLGA 2HBXA 1JYWA 1OYCA 2P10A 5A94A 1P6BA 3B8TA 3TFCA 2OLHA 3BG9A 4ZSTA 4FX6M 5D09A 4L7ZA 4MY8A 3AICA 3K8LA 4QCFA 1FX6A 1CXFA 3BOXA 2E9LA 5BW6A 1C9DA 1CLXA 4NX5A 4GHRA 4WQ6A 1DQUA 1FCQA 1EYEA 2QCHA 4R7JA 1GOWA 5HQLA 1IE7C 3PUDA 2DDXA 1XRSA 1KM3A 1TO3A 2OR2A 2VCAA 3HJEA 1KGWA 1RD5A 1NP2A 2I7GA 4F0MA 3E38A 4EWJA 4BWLA 4ZSUA 3NSNA 2OG9A 2EPNA 3KOFA 3HBLA 4O19A 2QEZA 6TAAA 2GGHA 4A2RA 1QT1A 1X6LA 1E71M 4FA3A 1SW0A 2UV8G 1T96A 3NVTA 4M82A 3BJFA 2GWGA 5AZ0A 2XVNA 3L0GA 2XGIA 1R6WA 1TJ1A 4D72A 2DP3A 2WCGA 4GUFA 3IPWA 2ZQ0A 4DAIA 3KZPA 1I0DA 1S2TA 3N14A 4EXQA 3RR4A 1IXOA 3GAKA 4L9ZA 1WXZA 4B5VA 2OT1A 3M0ZA 3O3RA 4J35A 3RM4A 5FAJA 1TZ7A 1V6YA 2R6OA 4AU0A 2GLKA 2HNEA 2OGJA 1QOPA 4K7YA 1V02A 1Q6OA 1VBUA 4Q7IA 3W1NA 4LS2A 3V0TA 2GVYA 1Z3NA 4KIRA 4TUFA 4Q8TA 1TYGA 1VBJA 3N17A 4RZ4A 4AG0A 1A53A 1JPKA 5JIPA 2J8FA 4FIRA 1DYSA 2VVNA 3I6TA 3CGTA 4Z2IA 3M46A 4LC8A 3LM7A 5IHRA 2E28A 5BROA 3CIVA 3GNDA 1LLZA 1OIMA 1M41A 4WIWA 2J6XA 3A4XA 4Q4OA 3WLMA 4JQAA 3BQ6A 4YPJA 4WDWA 4QJ5B 2JGYA 1J93A 4MDOA 4P2VA 5D2TA 2X1TA 2GUBA 3D46A 2C91A 3N15A 5KZEA 3RR1A 4CCDA 4IPNB 4M6PA 1D9EA 7PTDA 3Q67A 2VURA 1JPHA 2C18A 2NUWA 1HF6A 1W6TA 2GOKA 4AHPA 4F4RA 2A3AA 2FZDA 3SUTA 4S2CA 2Z4GA 3R13A 4A3HA 4GKTA 4PGLA 4Q8MA 1L6YA 4E8DA 4DBWA 2D3LA 3CUHA 5CQ1A 4A6GA 2HXUA 4Q8VA 2F6XA 3IIOA 5FF3A 1AZ1A 1BSIA 4RR4A 4QG6A 1YLVA 5K4ZA 3MSYA 4A3UA 3DYMA 3SCWA 2H8ZA 4U5IA 4HD5A 4KCUA 3CQ0A 2WPBA 1LG1A 1RK6A 3PZIA 4KFOA 5DRCA 1RY0A 1A0DA 3T09A 4PTVA 4RPQA 3STFA 4ZQOA 5K7JA 5FAGA 3KOXA 1EC8A 4I6KA 3BAKA 1FCBA 2PODA 4ML4A 4Z2GA 1LQ2A 1EF2A 1V08A 5FJRA 4FPSA 4XZWA 2P8BA 3EDEA 2BGSA 3LPGA 1Q6FA 1SFSA 1CLKA 1XIGA 5H8UA 2V9DA 5CGTA 3N3TA 3W53A 4JHZA 3IJ6A 3M0LA 2G95A 1B54A 2GK1A 5HQMA 4U33A 4DI8A 4HNNA 4PUJA 3UT0A 5CBIA 2RDUA 4U2YA 2VYOA 1XLEA 4O4VA 4UTKA 4I6VA 3TW9A 3IRSA 1G4SA 1XIMA 3M64A 3PANA 3TAOA 3DFHA 2OT0A 3W1TA 1T6MA 4AB4A 5E6YA 4IMEA 4MKNA 1KBKA 2AQVA 1XBYA 3GNRA 2V5CA 2W91A 3AYRA 3SCTA 2Y7GA 1DXIA 1KWKA 1A5KC 1ZL1A 3SIZA 1ZLPA 4DHGA 1Q3NA 4R85A 4PN2A 4PE8A 1QI3A 4JYDA 3VZXA 4FX7A 3NZPA 1P5BA 2OOFA 4RNFA 3UWQA 2PFHA 5BWAA 1TPH1 3IIPA 3TAKA 2IPFA 5DBTA 5TBOA 2PZ0A 1YXDA 2B7PA 3B9OA 3THUA 4YJ5A 2DIKA 4C7GA 4WZHA 1AMYA 1U2YA 3WK1A 5HWMA 3URAA 4KWUA 3VIOA 3H2AA 5HQEA 2YCJA 4DNHA 4H6EA 1VFMA 5KZMA 5IDZA 3ZJKA 1UUOA 3MP3A 3MCMA 3A3XA 3U7VA 5LNUA 1R38A 2Z6JA 4HZ7A 3QKZA 4YHGA 1GW1A 3PZOA 3ITOA 5CEWA 1XM3A 4NSBA 3LHVA 4NZJA 1U33A 3QKEA 3WK0A 1VR6A 3K4AA 3W9ZA 3IJIA 2HK0A 1XUUA 3DYPA 3UZXA 4IQDA 4C6KA 4CLMA 4RE4A 4FXJA 5CGMA 4HU0A 1XSIA 1M7JA 5JBDA 4IX0A 1W2PA 2X1SA 5G4WA 1KCKA 3EOUA 2H9AA 3LCFA 2J24A 4AD2A 3PB0A 1H62A 2BB0A 1J6PA 1UR1A 3BLPX 1V0NA 4FF5A 3TYDA 4BJHA 2FJUB 5D05A 4J2PA 2Z7KA 1SU5A 2IPGA 1C91A 1BGGA 3P62A 4HA0A 4QAIA 3MMDA 1SW7A 5CPLA 2QV4A 1MDLA 4XD6A 1RV8A 3FVMA 4ES4A 3F03K 1DV7A 1R46A 4ZFMA 4GK8A 1XLCA 3M16A 2P5NA 4WOQA 4GQ0A 1A47A 4O1AA 3M0HA 2I5QA 1F6KA 4Z2HA 5C54A 3B8SA 3FJ6A 2R1KA 3U9IA 2HJPA 4JN8A 4JCLA 1ISVA 4GY1A 3DC8A 3RAOA 1TTPA 4XWUA 1JPIA 1V6TA 2JKAA 2I17A 3HG5A 3HO8A 3KP1A 3H2EA 3IV8A 3H21A 1TA3A 1EC7A 4D8LA 2FVMA 5BOEA 1G94A 1X97A 2X30A 4PB4A 2IXUA 2OVLA 2YYUA 3C0JA 3B8IA 2VX4A 1IEIA 4QP0A 4D9PA 4ORMA 4P7NA 1LM1A 1DOSA 3LBCA 4O8RA 3SN1A 1R2SA 2A1YA 3A47A 3UCCA 2PGWA 4RNIA 2BV9A 1EDQA 2F8QA 3PJTA 4GZIA 1JDAA 2OYMA 2NVDA 1Q7QA 4FB7A 4KBXA 1ECEA 4C5YA 1A0EA 4IFOA 3G3MA 4GJJA 3NA8A 3PY2A 1O12A 2HE8A 3HPSA 5CLTA 4KFNA 1IGWA 1WDQA 2AMXA 1DTUA 1Y0EA 3DERA 4J3VA 5GNZA 2C0AA 3LLDA 4PL1A 3W02A 4NJJA 4D1IA 2WANA 2WHKA 2PP1A 4J28A 4PA8A 5HANA 3KEHA 4JNZA 4IL2A 1I60A 1VYSX 1RQHA 2FLIA 3A5FA 1XGZA 1FWCC 1QCWA 1F2JA 2PDIA 4WCJA 4G2DA 1F3WA 3SGZA 4IH3A 3LERA 9XIMA 4HJFA 3TJ4A 1LBMA 1NSJA 5HULA 6CGTA 4QISA 5AC8A 5BMWA 1K4GA 4LV4A 2H3BA 1WA3A 1LQAA 3SR7A 3BE7A 2C7FA 3DYOA 1BKHA 1X96A 4UNIA 3OZPA 1RR2A 2R1MA 3KOYA 4A8NA 3R7MA 4Z17A 3VCNA 4HVXA 3B04A 3GAYA 5EYWA 4WD0A 2PZNA 3WMLA 1W9DM 2VQUA 2Y0FA 4L4OA 3ANVA 2YZRA 2W79A 4DUVA 2E9BA 2R1LA 4AMAA 2EG7A 2ZA1A 4Q3MA 2EXOA 1WO2A 1NFGA 4JTIA 1HJXA 1JCXA 3H54A 3NGJA 1QAPA 5E5CA 2J78A 2I9UA 2PD5A 4OHQA 3KCJA 4OTKA 3B0UX 2YCLA 2VZUA 1VENA 4GNKB 1US0A 2OEKA 4RDVA 2GYIA 3NGFA 2NV9A 3CZGA 2VC7A 1VRXA 2XIMA 4LUTA 1NIUA 3GR4A 1SMDA 3C52A 1KFLA 2MNRA 4YTUA 1ZZMA 5ECUA 4G8TA 1C8QA 5KSWA 3GVGA 1Q6CA 3PSWA 2W92A 3NQ2A 3K8KA 2QDGA 1P6WA 2OSXA 1CGXA 1E0XA 2HZGA 1OFDA 2IPWA 2W9MA 2PF0A 3NQVA 5HNTA 3GDTA 4B92A 3BICA 1SGJA 1R3YA 3ITGA 4C6CA 4WY0F 4QNEA 1RY8A 4PBGA 2GFTA 3VOIA 5A2CA 1RBAA 1PYMA 3O15A 2QCDB 2BLEA 2QULA 2W61A 4E4UA 1UPPA 3UR8A 3UYCA 3T55A 3T2OA 2X42A 1EP3A 1XIDA 1Y5VA 3KBWA 1HVXA 3F1QA 3MB9A 2CERA 3WG6A 4Q8UA 2ZE0A 3T7VA 3TLLA 2VD9A 2VFIA 1BG4A 5A8GA 1QNRA 3WMCA 4DXVA 3N11A 1E5JA 3F2BA 2Q02A 4PRTA 3CMFA 1VRDA 4W5ZA 4OV4A 1W1IE 3GXDA 3HFYA 1KM0A 3GUWA 3SRFA 5FOOA 2FYMA 3QC3A 3FLUA 1F07A 1JZ5A 2GJPA 9RUBA 4HPNA 1SSDA 3AIQA 4QAWA 4UOJA 3GNNA 4QE4A 4L1GA 2FH6A 2V5JA 1HJUA 1ISWA 3PN8A 1GZGA 4U31A 4UMAA 3IJ9A 3I7RA 4K37A 1JRBA 4H83A 1U1JA 2ZWZA 4MUZA 3P7YA 4YU1A 4YN5A 1VB9A 3VNIA 4UC5A 4DJEA 1UKOA 2QF7A 1LLOA 5E9XA 1UP2A 5U4NA 2D3NA 4TVCA 4AWTA 2EBNA 3OYXA 2ZUNA 3WEMA 2GVGA 4YIWA 2UBPC 3S47A 2FPVA 1C93A 3FJNA 1J11A 1KV5A 1D3CA 4LFYA 1ISYA 4AHQA 2VX7A 2O9OA 3Q2DA 1QASA 4IX2A 3QH2A 2CLOA 3O06A 4UFHA 2QCEA 3FDKA 1BVZA 3W00A 4RNJA 4ZODA 1PB0A 5I78A 3SAZA 1SZRA 5EBAA 4GZEA 3W7DA 4Q8WA 5DCDA 2PDCA 2PDGA 4MWAB 1DJQA 1UR0A 2WKLA 3SJ3A 2A6LA 3W75A 3MS8A 2WK2A 3ITLA 2QCDA 1UWIA 4ROQA 4BZYA 3BGJA 2X41A 1AVAA 3LNPA 1BYBA 3FSUA 1FCUA 1JZ4A 5LNVA 1CENA 4DXKA 1UYQA 1RAKA 1SZFA 3B8VA 1H3GA 5GJPA 2GVLA 2ZUSA 1ZPTA 2XVGA 1LP6A 3W26A 4LT9A 3MUAA 3F4CA 3DUGA 3FA3A 3OG3A 4H9YA 1WOBA 2I9EA 2NSXA 3H2FA 3MSGA 4QGCA 3LXCA 3W82A 3MUXA 2NQLA 4H8NA 4LNCA 3KM8A 2O7SA 4KPLA 1LL7A 5CZSA 3LCXA 3FA4A 3NO5A 2PGFA 3FXYA 1EX1A 3IACA 4G7EB 2V38A 3VM5A 3NL3A 2GSEA 3EOLA 3N4FA 4QTGA 1US2A 1W31A 1NEYA 4L1XA 3FX4A 1UZHA 4JIPA 3BGGA 1DIEA 2PDMA 1ZY9A 1J18A 4O0QA 1FKWA 3TTQA 3KTXA 3TSMA 1LROA 1F8MA 3AS0A 2O4MA 1KFBA 1KTNA 1OX6A 1ITUA 3R43A 4HHHA 1W1TA 2CZVA 3NDYA 5T8GA 3VX1A 1VFHA 3TCEA 1W5MA 1K77A 4K6AA 1T99A 5IBXC 1UA7A 4RZ5A 3TQKA 2CBJA 1QPOA 4L6HA 5GJMA 2AKMA 1TMQA 4OBTA 2VFFA 2TAAA 2CBIA 4UQ9A 4S3CA 3UP8A 1PX3A 1ZJIA 4DUXA 4F79A 5FJPA 2NQHA 1YNYA 4QSFA 4KESA 4R33A 3LXAA 4JHMA 2PMQA 1QDSA 1PZ2A 1J10A 4FNRA 3VPLA 3VIKA 1UKQA 1GYMA 1REQA 1YKWA 1T0OA 1ZFJA 3ANYA 4MMWA 4QROA 4L1WA 4IXXA 3AOFA 3W1LA 3U4FA 1W56A 3EX6A 4WF7A 4JTGA 2ZCGA 5JBFA 3PJUA 5TF0A 4HMCA 4FNTA 1Z48A 4C1NA 3WLIA 2VGBA 5CSSA 4FMVA 3WQWA 3QVQA 3B9NA 1XICA 2Z1SA 1WZLA 3E0WA 1XYLA 1TV4A 4HCHA 1XX1A 2JIEA 2DU2A 3WD2A 3VDBA 3QYQA 1YXYA 2PTXA 3OGRA 4RKAA 2D24A 1Z7AA 1ZBWA 4I9MA 1ZAIA 1IEWA 4IL0A 1PKLA 4PMRA 1PPIA 1XYAA 5HNNA 5F1VA 2DT0A 4QJ1A 5A5WA 1R9ZA 3B9EA 3CMGA 4I9AA 5FEWA 3E12A 3T78A 1P6CA 1J5SA 4JTHA 5AFDA 5IFTA 2IQ0A 4WSKA 4US5A 1BPLB 2ZUMA 4JFTA 3CTTA 4D6CA 3USBA 3SCSA 4C1KA 3BMVA 3A5VA 4D6JA 3QC0A 1JXJA 1K7EA 2ZRVA 3UD6A 4ZXOA 1FFQA 1SPQA 1GQKA 5E09A 5L6UA 4AZ6A 2IW0A 4RZ6A 3WLQA 3A6OA 2TMDA 3WLKX 2HVMA 4UMCA 4ZOCA 1VCVA 5I0DA 3P8JA 5A6BA 3DHUA 1VFOA 2BY3A 2WVVA 1W8SA 4GMEA 3THDA 1A5CA 4Y8FA 7ODCA 4BCEA 2ZXQA 3E2SA 4HN4A 1RPKA 2NUYA 3W74A 4CU6A 4CNUA 4Q4PA 3H7VA 1OGBA 2EO7A 1AMKA 1JGIA 3B0XA 3MHFA 3AJXA 2NT0A 5I23A 2C15A 2J7HA 3C0LA 1TQJA 4NJIA 3TJLA 3RCMA 1I2NA 1NOUA 1GVOA 2VENA 1CCWB 5CSUA 1XLFA 4WKHA 2ZTJA 4NZ1A 5CPSA 2KAUC 3EYPA 1R3VA 3UZ5A 4M81A 4QR6A 3T08A 1JZ6A 5CXPA 1WB0A 2Y4SA 1ALDA 1W5OA 4GBUA 3AS3A 3RO8A 2YA0A 1AG1O 3HGRA 3FA5A 4HOWA 1R85A 2QQ6A 1B3OA 4WRHA 3MU7A 4WDXA 3C2FA 3IK2A 3UEQA 3LX9A 1XPGA 4OVXA 3UG3A 3WQ4A 3BURA 4MIMA 3UR2A 4HMNA 3DFNA 1GQIA 4XSLA 3OW1A 3BL3A 4LU0A 2PRLA 1DHKA 2XWDA 3LQLA 4JKMA 3GKFA 4AWSA 1TE6A 3IJDA 1TRDA 1XIEA 4KF1A 5BXRA 3WDQA 5JH1A 1F3EA 1HG3A 4DJED 4QE5A 3P74A 4DM2A 1GJUA 4LUIA 3G1XA 3W37A 2DZAA 4DYEA 1W54A 3NXLA 4UFKA 4AIUA 5L9FA 3P3BA 2ZDSA 1KCXA 4AD5A 4DVOA 2WCSA 2W66A 3IGSA 3W7MA 1KBJA 4W8AA 1P1XA 1KWGA 1WBJA 4W84A 4GVHA 3BJTA 4EE9A 1B5TA 4DJFD 1KM5A 1J0JA 1M9HA 5A95A 3AQUA 4B4HA 5HK4A 1N82A 3W1UA 1AD4A 2EQDA 4B5WA 1Z41A 3BV4A 1WDWA 1G01A 1R87A 2ISSA 3IGHX 5CZ0A 2QUMA 3W27A 4FI4A 3N29A 1W9UA 1TMLA 3NXFA 3V0SA 1WZKA 1EZ2A 3EGJA 2WJDA 2ZZ1A 3KZSA 4BWLC 4OE7A 5IFPA 3WJYA 4N0RA 3TR2A 4TX8A 4KRUA 4TV6A 4XG1A 3EB2A 1GNXA 1EA0A 3ZMRA 3S0CA 2XZ7A 1UR8A 2Z7GA 3BMWA 1IXQA 3WLPA 4LUJA 1VIWA 2WZEA 1F73A 3NWRA 1LTDA 1UZ4A 4G1KA 4CN6A 2I5IA 1IZKA 1Z6KA 3RN6A 3VD4A 1DQXA 1WX0A 2DSUA 5T91A 1MFVA 3QGKC 4FSAA 3J7HA 4NASA 5I06A 3CHVA 2CXEA 1HT6A 1E6PA 2P8CA 3WNMA 4O10A 3TMLA 3WDRA 4FLRA 2XG9A 3GG1A 1X1ZA 3PBMA 1UQZA 2D22A 1G67A 3C56A 4MJZA 4W88A 2I56A 3MUY1 1VGAA 4F2TA 2X8RA 3M5VA 4I9TA 5ENLA 1X8FA 4YNGA 3NQEA 1OG6A 1BF6A 3M5XA 2Y62A 3BW3A 1SUXA 1PAMA 4L6OA 3ONCA 2OPJA 3EDKA 3VD5A 4MLRA 3IEBA 3AIVA 3AHVA 5JVLA 2XSXA 5G2HA 4E5TA 2IUZA 4OUEA 3W86A 1FWWA 2LLEA 5TQLA 3TYCA 3S42A 4AIOA 1T8QA 1P7TB 2OGYA 1K9EA 3H4XA 3FYYA 1BLIA 2RHGA 3W07A 3WNNA 2PWFA 4UOZA 3OQEA 3BLFA 3MYPA 2CLMA 1XUZA 2AGKA 3CPUA 3CUIA 3VFCA 1E51A 2PLKA 2FQIA 3QN3A 2O56A 4AXNA 1E6QM 2DV0A 2HROA 1I75A 2G37A 3ARQA 4RXGA 4O14A 3W76A 5I77A 2GGEA 4IJBA 1W3LA 1IV8A 3R89A 4UFIA 3RCYA 4PCFA 1XIIA 2NVCA 3PZMA 1AUSL 3QTGA 2FDSA 4B2DA 4UQBA 2J7FA 1OINA 2TSYA 2YYTA 3PTQA 4B9YA 3PZVA 3TN6A 1XS2A 4AZ5A 4ICNA 4LPCA 1PIFA 1OYBA 3GK0A 2WSPA 1TPFA 2YBVA 1RCQA 2DW7A 3E96A 1BKSA 1EXPA 3TN5A 4LNYA 4LS1A 1EBHA 2V5DA 1WNOA 4R88A 3JRKA 2P3EA 3RU8X 3E5PA 3WENA 2QDEA 1JD7A 2Y5EA 3PPCA 4LYRA 4S23A 3RIKA 3EPNA 4RV8A 2Q8ZA 3VDAA 7CGTA 3THCA 2PD9A 4NJGA 1W37A 5DF0A 4F2BA 1OCJA 4HT3A 4H9ZA 4U2ZA 1DEDA 2QJJA 4H00A 4NYYA 5EMMA 3A12A 2C1IA 1QI0A 4P8XA 5HMDA 1VCGA 1Z89A 3V5CA 2ALDA 1H63A 1Y5WA 4LX4A 3GU2A 2PTWA 3LENA 3WDPP 1EL3A 4US5D 2G41A 1ADDA 1B30A 2O9RA 2A21A 3F5JA 4W7VA 1MXGA 1VC4A 1KLYA 4U10A 3UY8A 1UP0A 1P7TA 3SCOA 1XP3A 3PTDA 4GKLA 3MP4A 4GUGA 3LK6A 2V2DA 4EP8C 3BLDA 5FCZA 3S2LA 2B0MA 2WYSA 3P0XA 2DORA 3P80A 2P1FA 4M6VA 1SO5A 3RRAA 1H2JA 3W83A 2OEJA 2NQZA 3WF1A 3KCLA 4FXRA 5F1UA 2RGMA 5A6BD 2WSRA 4D71A 1Q5MA 3R5EA 4UCGA 2ZZ5A 3UA4A 5C2GA 2FZ8A 3HV9A 2YIHA 4AEEA 2CLFA 1B4KA 1CWYA 3NQCA 3SZ8A 3H7RA 1JUBA 2JF6A 1K9TA 2HS6A 4C6EA 2HISA 4MB4A 4M1RA 1J96A 4G7FA 3GIQA 3DH7A 1FA2A 3DBPA 1ZCOA 2FVKA 1L2QA 4GCXA 2AAMA 4S3FA 1AA1B 4CVWA 3LHZA 3TMQA 5RUBA 4GH1A 4FR1A 4H4IA 1FY6A 4HTYA 1UOKA 3HJZA 3NOYA 1GT8A 1LCOA 1H1NA 2VEKA 3FHQA 1AFSA 3KRBA 1JPMA 1TREA 5J04A 4A3QA 5GNXA 4LYPA 2QCCA 4WGXA 4DO7A 1Q6LA 2Y8UA 3M6YA 5K9CA 2V2HA 1L2UA 1N2VA 2G4JA 1UWRA 4TMCA 3TTYA 2RFGA 1VBGA 1JDCA 1YBQB 1M53A 1R3WA 4E0CA 1AW5A 3VMNA 1MFUA 4BQ4A 3VOCA 2VFGA 1Q6EA 5EMLA 4KKXA 2H90A 3WH8A 3R2GA 4W85A 5I3FA 2VHLA 4EOUA 1GOIA 4FOUA 1W9BM 5MKGB 2OTDA 5A6TC 2VT0A 3QR3A 4XAPA 1QJWA 4JIHA 1JF5A 2OYLA 3UQNA 4MTVA 1J0YA 3W2KA 3G6LA 4K8HA 3QMRA 5ABTA 1SJAA 3QLLA 1EJSC 1A5MC 3PTMA 2A5HA 4W9TA 4UTWC 3RYSA 3MDWA 4Z08A 3FCPA 5BYWA 3ITTA 2CXGA 4IICA 4ZOEA 3C5QA 1B57A 4IIGA 3BH4A 3IUHA 3W24A 4QXIA 2VRKA 3ABOA 2JEPA 3M0YA 4PULA 2VDGA 3GR8A 1S5NA 1S2VA 2VOTA 3TLQA 6A3HA 3FYPA 4GPNA 5FKYA 4KIEA 4DQWA 1ITCA 2G50A 4GBDA 3E3HA 1QNQA 1EJWC 2PTYA 3K8MA 1OT2A 1HGYA 4MFEA 3Q37A 3AIWA 4WSJA 1OQFA 1OFQA 3F5KA 2FMOA 3N25A 4MYXA 4TVUA 4XBSA 3B8UA 3MP5A 4JNYA 4E2BA 1A4LA 2DFAA 3ZLGA 2FZMA 2QJMA 4S2BA 4L4MA 5SWUA 4RPPA 2ZX6A 3UWEA 3PBGA 1VBHA 3MA8A 4NILA 2PB1A 3W23A 1WBHA 1XYFA 4Y2WA 3W38A 1LT7A 1GYLA 4LVFA 1VYPX 3M47A 4J5NA 3E6EA 4OV9A 3WQGA 3NVDA 1TRIA 1V3HA 4BY3A 4YHEA 4JR5A 5CJMA 2VC6A 2YR1A 1W1PA 1UB3A 2YXOA 2VMFA 5EU9A 1HZYA 3NQ8A 2DUZA 2HTMA 3WBEA 1YTEA 3VZZA 3G8EA 3IVSA 4UIOA 4F48A 1RBOB 4OJYA 3LCLA 1FWRA 5D2YA 1TV2A 1E73M 1Z42A 1XCWA 4NX0A 1I6NA 4IISA 3BAJA 1CGWA 3TQPA 5C9UA 5D9PA 1U5VA 3TIMA 1JYXA 5G4EA 2Y7DA 4Y8EA 5D2WA 2VUYA 2QLYA 1J01A 4I7WA 4A05A 4LUSA 1YDVA 4NAEB 3BW4A 2IQTA 5G2IA 3UVAA 1LOSA 3QYSA 5M1TA 3C2RA 7A3HA 1NDVA 2J88A 3FKRA 1VJZA 1OYAA 3CV7A 2FTYA 1NDZA 5M17A 3VUSA 4EPDC 2FHFA 2E40A 3O6CA 2PU0A 4M24A 4MUPA 2UZ9A 3RLVA 4ZB5A 1G1YA 5C6MA 4C7DA 3F5LA 1W3NA 3N6HA 4HZMA 4PB5A 2DSKA 3KFTA 5CH9A 2Z28A 1CGUA 2X09A 3N73A 2CLIA 3CHCA 2ZE3A 4H2CA 1MQRA 3RPDA 1EEXA 1GTEA 3EDFA 2QCMA 4UQAA 1DPMA 3CUZA 2QUTA 1V3MA 3GFXA 2BHZA 1WV2A 4DY1A 3F4NA 3T40A 2E1WA 1QNSA 3BV7A 2ZADA 4OOUA 1XC6A 4CQBA 2E1DA 4CD4A 2GL5A 3H4WA 2INEA 4GI6A 5C9RA 2XDFA 5GNYA 2J7CA 4XTDA 3AIBA 2BWGA 4FXFA 4JYEA 3ITVA 4XZLX 2ALRA 4F8XA 5HR7A 5E70A 4EAYA 1W17A 5AZ1A 3H8AA 3AXHA 5K4XA 1A0CA 4LAOA 1BWVA 4PTNA 1VEMA 3WL0A 4YVVA 4IQLA 4PMNA 4KH2A 1EZWA 1EQCA 2YPIA 5B7YA 1XISA 2PEVA 3MY9A 3C86A 4HHLA 3AMCA 2HRWA 2HBVA 2X16A 4UUIA 4RDYA 3VNKA 3EXTA 2DJLA 4DUWA 1CTNA 1LOQA 3UXKA 1ONWA 1UD5A 4PUMA 1XG4A 1UD4A 4BQ5A 2WV8A 1ME9A 5D04C 1V0KA 4YTSA 4S39A 3CEUA 1AW1A 3LGGA 1FWGC 3V5FA 1TE1A 3GUGA 1TWWA 1FHUA 3EWYA 3EWDA 1ITQA 4A2SA 1TMHA 4GY0A 1F74A 1KV8A 3W7RA 3TZNA 3PNZA 4PBFA 4JNMA 1NQ6A 3N9RA 5AHEA 4NAEA 3OU8A 5I6SA 1Q7MA 1XSJA 1E0UA 4XBKA 5E0FA 4UWMA 3HGSA 3ZT7A 3HF3A 2C6QA 3TNOA 5CBBA 3QLDA 1G4PA 2ACUA 2QGYA 3BTNA 3WJZA 1Z69A 5CZJA 4DJEC 2BOGX 4DF2A 4I8YA 3L4WA 2HNHA 2HQAA 4GJIA 4HNOA 1LT8A 4C6OA 1R2TA 3BO9A 1QPNA 4P61A 1F4HA 5D8ZA 4UTUA 3DKJA 4X61A 4DZ5A 3N4EA 1HKJA 1BD0A 4HSOA 1JDDA 4GXWA 4LS0A 1AJ0A 1FHDA 3U4AA 2OLSA 1IT0A 1ESWA 3RPTA 4AEFA 1PUDA 3AWNA 3ZR6A 1JF6A 3ZJ6A 5C0QA 3P8IA 1RA5A 3CYJA 1XDMA 3R0DA 4WUIA 3NQAA 3QBUA 5DY3A 5REQB 3EPOA 2P0IA 2NSOA 2QYGA 2PDBA 1A5OC 1R30A 2RGLA 1G6CA 1MNSA 5A6AA 3L2IA 1JI2A 5M2FX 2GGIA 1ZBCA 5M5DA 1UWQA 4LEFA 3RGTA 1WDRA 5LIUX 4HSNA 1DQWA 4PMXA 4DJDA 3BLLA 4FIQA 1OF6A 1DWGM 1BQCA 2QUVA 4UFLA 4C91A 4JY8A 1N55A 2Y1HA 2Z26A 1XYMA 2V67A 2A85A 4TOQA 4N6FA 4QRNA 1KW1A 4GVFA 1MSSA 2TPSA 4MKVA 4IGSA 5J8LA 1XR2A 1F6PA 3WUBA 4FZIA 3WH5A 1D8WA 2NX3A 2PLMA 2YL8A 5F2LA 4FX8A 4IMFA 4ERAA 2OU4A 4GC3A 4PH6A 2GVJA 2GQ9A 1XH0A 2FFIA 3S2MA 1KR1A 4ZVJA 1GKRA 4H01A 3TROA 3ECQA 1UOZA 1H7XA 3OP2A 2OODA 2WHJA 3AU6A 3WBXA 1CW2A 5DELA 4BF9A 3QR0A 2GPTA 2YB1A 2YW4A 2HXTA 1MW3A 3B0PA 1M7OA 3M1ZA 1SVDA 4M29A 5GJNA 3GTIA 4W5UA 4B3ZA 4DLFA 2B7NA 4EPKA 3VOFA 2DZXA 5CGQA 1V3KA 5C70A 3ATZA 4NZFA 2P3ZA 4GUHA 3FEQA 2PRHA 3KWXA 1DWJM 2WLYA 4H9UA 1J6OA 4RCXA 1XI3A 1FWNA 4B5TA 4U3AA 1G0CA 3AHZA 3WIJA 3ELFA 3W2LA 1EFZA 2FKPA 3DXIA 2PDUA 2ZZ2A 4IGNA 2DZBA 4HYVA 2YBUA 1PZ1A 3O0FA 5REQA 1B3VA 1FWAC 1H4PA 1A5SA 4A8RA 5I3IA 4WJXA 3H22A 1GOMA 4EACA 4H8UA 5CAKA 2CEQA 3VCCA 1TR9A 1WOAA 4UTIA 4DBEA 2DSZA 2VX6A 1H60A 1A5NC 3QOKA 4KGLA 4MWAC 1XD0A 4U3CA 3S2JA 2BHYA 4PRRA 3WF4A 2X2YA 4CQAA 1GQJA 3W25A 2PDHA 2PAJA 1KXQA 1E3XA 1V0MA 3AZTA 2YCKX 2DGAA 1TUXA 4KW2A 1XG3A 4DX3A 3LCGA 1KM4A 3F7JA 1QBBA 9CGTA 4I9JA 1UZ1A 2G96A 4AX7A 3OIXA 4IMGA 3GX9A 1UKSA 1J2BA 2XIQA 1X98A 2VP8A 2XWEA 4FS9A 3PWIA 2F9RA 1D2KA 2CZFA 4MLJA 3A4JA 3HQ1A 4PEEA 4K8GA 1OEPA 4ZFCA 4MADA 2WSYA 3UWUA 1HO1A 1FXQA 2QJNA 3LY0A 4A3RA 4JTSA 3NDZA 4MFDA 2PWVA 1DHPA 1EO7A 1R3TA 4H2HA 1EO5A 3CZLA 3GD6A 2OSYA 4N9DA 3A21A 5HMFA 3RLUA 2QIIA 2YBTA 1SFJA 4AVNA 1W8GA 3UGRA 4UFMA 3MI6A 3CV6A 2RDWA 1SQ7A 2XUCA 1PS9A 4MB1A 3TYZA 1HL9A 4FOJA 3QGAC 3R8RA 1E72M 2WAGA 4JTQA 4XZHA 4QQ3A 1VEPA 2IQDA 1P0NA 4ATDA 1Q6DA 2BY2A 4HGXA 3ZZ1A 2V5LA 3DGBA 3OYZA 3QV6A 4MGGA 1V5XA 1A49A 3JZEA 1V79A 1SJBA 2INZA 2X1RA 4AY8A 3P5ZA 3K2GA 2W6RA 2YCEA 1EXBA 1JUEA 4MHBA 1OFBA 1X39A 3TR9A 4ERGA 2JGQA 1EJ7L 4XD5A 1TUFA 4U5KA 2IKJA 3REQB 4JCMA 5AC6A 2FB3A 1QVBA 3N6QA 1B90A 3LQGA 1UR3M 3BZJA 3RDKA 3S1UA 1XBVA 3FVDA 1ZALA 4TX6A 1UJPA 1OT1A 4YTRA 1LDCA 2QCFA 4WLCA 5I79A 3AS1A 3KRZA 1XLHA 1XWYA 3E9AA 4GIYA 3FNDA 2VR4A 3AI0A 2GZXA 2ISWA 4N9EA 2FPTA 3CPGA 4JZ5A 4Y9OA 2ZOXA 3H26A 5A2BA 2YL9A 2CCRA 3ZVHB 3MSDA 4WK9A 3CYVA 5D9MA 3ZSTA 5JXQA 2JQXA 4LALA 4UBPC 3O6AA 5C9WA 2ZYFA 7REQB 4Z0JA 3K1GA 4LBUA 4AD0A 3THAA 3P82A 3VVGA 3O9NA 2WMFA 3EKZA 1GOOA 1E0WA 4H9VA 3VMPA 4WXZA 2QPUA 3VOJA 4GUIA 5BOOA 4ASTA 2F6UA 3TTOA 3DHFA 3GC5A 4FALA 4MJ2A 1XHGA 2EKCA 1FTXA 2PDWA 1M7XA 2NUXA 5XIAA 2ZX9A 1F3TA 2D0FA 2CLHA 1Q2SA 3HMCA 1FXPA 1QHPA 3DECA 5TD4A 4ADSA 1AH3A 4UXDA 2QJGA 3GTHA 3B40A 2WMIA 4Y9AA 2XGBA 3EWBX 4JTUA 4EPEC 3GXFA 3NQ7A 5DANA 2B31A 2V3EA 1HKKA 1VH7A 3EMZA 1BG9A 3LZ3A 2EG6A 1PTAA 4JIIX 1BVWA 3ANUA 3W7NA 4NL1A 4FAMA 1OGSA 3PP7A 3UNDA 4PODA 3U5YA 3MWCA 2F2HA 1DJYA 4Y6GA 1F61A 2PWHA 1DP0A 2F61A 3U2ZA 2A0NA 4M5PA 1OSEA 3OB8A 2Q3OA 4EPBC 3WJWA 1BXBA 3GHTA 3UVIA 3DFSA 1OCQA 2QNEA 1XQKA 1EOMA 1FP9A 3CLMA 4XAFA 3T4WA 4L4LA 1LG2A 4O53A 3UPMA 2Z24A 2NVAA 4C6JA 1W3IA 3UZYA 3OO2A 1K9DA 1XINA 3FDGA 3BG3A 4GC4A 1OG0A 4DZHA 3GLCA 3OBEA 5DO8A 4ATLA 3SO7A 1OABA 8RUCA 1QR7A 4H9TA 4JIRA 2NV2A 2J7EA 2XISA 2R9RA 1TVNA 3S5NA 2C0HA 3VZYA 1KFCA 4AY7A 4K7VA 7REQA 5AHFA 2XPKA 3PNUA 1JDEA 3LA4A 5H6HA 1O5QA 3W1XA 4CD8A 1V6XA 1CNVA 1UPMB 3UZWA 4JGDA 1NOFA 2VXNA 4AFYA 3KHJA 1PIGA 3WLLA 2Z6IA 5TIMA 1I1WA 2GUUA 3QSTA 1GK8A 2G5WA 3H2CA 2VJXA 8A3HA 1LWHA 3LYEA 2BNJA 5FI8A 4NRRA 1QWKA 8XIAA 3MUCA 3UJSA 5D02A 2WKJA 3NR0A 3QXBA 3WD0A 3POHA 3PB2A 3WCZA 1UW9A 2Q6ZA 3WBAA 2PDPA 4NG3A 2AL2A 4BQ3A 5FL0A 2J27A 4B5SA 1O1ZA 3CXOA 4E4PA 4L56A 3LDVA 5C7VA 4LVGA 3S1VA 1RQBA 1XSKA 1P0EA 4N02A 2FB2A 3EX4A 5A1AA 4AVFA 3TYUA 4GQQA 1TIMA 3EDJA 1CXIA 4Q8QA 3SN4A 4HPGA 4OFCA 5A6SA 1XKJA 4LAZA 1UR9A 1GQNA 4ZO7A 4OUIA 2QCGA 2XHYA 3O8AA 2DH3A 3WLHA 2G3NA 1KNWA 1OK6A 3UXIA 4LXFA 2EPOA 3ZIZA 2XTKA 4HMDA 1SFLA 1CBGA 3LI1A 3EXSA 2G4FA 2JFEX 2EJ1A 4PMYA 5AHLA 1DJNA 3CQHA 5EL1A 3E1F1 4GINA 4EX4A 1G9HA 3IJQA 2DIJA 3SQSA 5FEXA 3VNLA 4JTKA 1JGMA 5HMEA 3UERA 4IJRA 4GQRA 1UC4A 2PC4A 2OKTA 3HPZA 1QI4A 1CXHA 1RLDA 3VKCA 3VKJA 2INFA 4HN8A 3OLDA 3UFYA 1HQTA 1WCGA 4NT0A 1H11A 5CSRA 2ZX8A 3CUXA 4PFMA 2OZTA 2FPYA 3ES7A 1H7NA 2DVUA 1H7OA 1YYAA 1YE6A 1YRRA 2PDXA 4M7SA 4O11A 4K68A 3D3AA 3RMJA 4DYJA 3ZXWA 3URQA 1B2YA 4F3HA 4HMEA 3I6RA 1W1YA 3M7SA 2QUNA 3BW2A 2Y61A 2XFFA 2J66A 2W5FA 1A3HA 3DU0A 5A8OA 2VDHA 3A13A 3SUWA 3LHTA 4TXEA 1F6YA 1WUFA 3PBVA 2Y24A 4GXPA 4JHOA 2IMRA 1TPWA 1TX0A 3QFEA 3DFYA 3EA1A 4OWGA 3STGA 2VNCA 1JR1A 3ARVA 3CV2A 1PZ0A 4QQUA 1ADSA 2GJXA 2QXWA 2VFEA 1E6RA 3OGSA 3NQDA 2J8TA 2B7QA 4WDUA 4HPHA 3FHAA 4S3JA 1S39A 4HU4A 3W6LA 2VZVA 1S46A 4AWEA 2WM0A 1ELSA 6REQB 3QJAA 1K7FA 5LXXA 1IF2A 5D32A 1NWUA 4FOKA 2D23A 4F0RA 3C2YA 4JY9A 3HFTA 3P2VA 5EBUA 2ZUWA 2OFJA 4H04A 2WZHA 3WX7A 3GIPA 1E1CB 4XZMX 1XV8A 2J47A 1OADA 2OJPA 3PPGA 4QSHA 3GO2A 3O07A 4X60A 1I2QA 2NT1A 2XFWA 1YPXA 3S9IA 4JIQA 3TH6A 4Q7BA 2G3IA 3K1DA 4QS5A 4M1BA 3VCRA 3PFRA 4US6A 1M6JA 3RX3A 3TP4A 3LM3A 3DEQA 3GM8A 5AY7A 3EEGA 4H6QA 2HV5A 4L64A 3BAWA 3M0IA 4BR1A 3M0MA 3EKGA 5DMNA 3DG3A 4B4FA 1B3XA 1OBAA 1VLWA 3ABSA 3DC0A 3V0UA 3VU2A 3H12A 1FFRA 5HNRA 1LLWA 1JXKA 4NZ4A 5KINA 4NAFB 1EP1A 2CLKA 3HG3A 3SRKA 3IWPA 2CLLA 1M1BA 4NHVA 3ARWA 5DRIA 2XH0A 4Y96A 3W1AA 2FGZA 2XSAA 3FS2A 5DMLA 3Q94A 2DUXA 4P7OA 3N13A 4AZGA 4FEZA 5BZAA 4PMDA 3NNTA 4KERA 3MPGA 1NF0A 5DMYA 3WQ5A 3W7HA 2OX1A 4WKFA 2GJRA 5HNUA 3TQVA 4LVDA 4XISA 2Z0IA 4NXKA 2V5BA 3HG4A 4ZBCA 1O4UA 2V69A 2QR6A 1DXEA 1KCZA 2WC7A 2CKSA 3CWHA 1JCMP 2J77A 1IXNA 3B03A 4CEXC 1R2RA 1TWSA 2JBMA 4B5XA 5EMKA 3N4AA 3ABQA 3GXNA 4CUCA 3FAWA 3G24A 3O6DA 3HPXA 2J9YA 1Y7VA 1CLVA 4GWEA 4P5UA 1JCJA 5DMMA 1DXFA 1E1CA 4XBJA 3IK4A 2RJGA 3O16A 4Q6XA 1JZ3A 3UG4A 2BVYA 3LRMA 2XM2A 4IQJA 3VGEA 3ZWTA 4JTCA 2WOQA 2J7GA 4ZO9A 2QDDA 1I0BA 1V93A 5H91A 3SGGA 3GDMA 3II1A 5BXSA 2NWRA 7TAAA 1KR0A 5K3VA 4WY0B 4L4PA 4IHCA 1SZNA 2AQWA 4M8UA 3STEA 3Q58A 2YCIX 2CZ5A 3WD1A 4H8VA 1DJHA 4UFJA 1U1HA 1C90A 2WVSA 2V3GA 4P7RA 4GFSA 3WQCA 3LZ5A 2QT3A 2ZRWA 3LB0A 3ORWA 1IEXA 2D73A 1PKNA 1NH6A 4S38A 1JEZA 4CCZA 1YPFA 2Q8XA 4NAFA 1XLJA 3UXLA 3R11A 3V75A 2XVLA 3QW4B 1QI5A 4JTLA 4JTFA 2QCLA 1E5NA 5F2IA 5LNRA 1LUCB 3SM0A 2IKHA 1D3HA 2VO5A 1WAWA 3EA3A 5FACA 2WKGA 3QSRA 2CU0A 4RDZA 4XQ6A 1V03A 1GQLA 3UG8A 2CZEA 2REQB 4NVTA 5CZTA 4MDPA 1CX9A 1TSIA 2V3FA 1NVMA 2ZUTA 2VGGA 3QQ1A 1W1B1 1EDGA 1P43A 2Q01A 3APYA 1J12A 3PSVA 1YX1A 3VI2A 2I1OA 3G22A 3TYBA 3AIRA 2GDVA 3SCPA 1E4LA 3CZEA 4TVDA 3WNOA 3HQNA 1EDTA 4HZ8A 1OM0A 1CXLA 3RNDA 3QQWA 2BGQA 5AOUA 2O9TA 4Z1DA 3GH4A 1VFLA 4CU8A 1Y5XA 4DWSB 1LYXA 2HWGA 2MANA 3W7KA 4IJCA 3SQMA 3EWCA 1OFPA 4BI6A 3OBKA 1K8ZA 1V77A 2HVNA 3LV6A 4Z1CA 1XRVA 2QF8A 1LBLA 4NZCA 5GQBA 4WY0A 1ZCCA 2ZICA 1OHLA 4WX2A 1L6FA 2ICSA 3OEXA 4UR8A 1MRAA 4IF2A 5D33A 3OJGA 3FJ4A 3L21A 5FL1A 5LIKX 2E8YA 3GHUA 1VBRA 4RUBA 1LRQA 1H1ZA 3LEPA 2DT3A 2OYKA 3T42A 3IS4A 2X1UA 4UB9A 3W6MA 4PB3A 4Q4MA 1PL9A 5EMYA 3PZQA 4AD3A 3CJPA 4GQGA 3W2JA 3V16A 1VYRA 3S8HA 2HS8A 3E0VA 3GIYA 2AQOA 5H2ZA 3NQGA 4CNPA 1ZJHA 1E3ZA 2EJAA 3F4DA 3MKKA 1S5VA 3HG2A 3NL6A 1FDJA 2J75A 4LWWA 2V0TA 2GWNA 1YE4A 3T4CA 4JX4A 2ZC1A 1LUCA 1ECQA 1TQXA 2E6YA 4GIRA 4C6NA 3L4ZA 4MY9A 5DT5A 5FJOA 3CB8A 3PPHA 4EIVA 4PEKA 4KCWA 3GXTA 2WB5A 1JCYA 4HBKA 3AYTA 5DXXA 1IEVA 3K30A 4ONVA 1QPQA 1TVLA 1JCNA 4ZB2A 3WK3A 3I7SA 2CHNA 3FOKA 4JD4A 1J4EA 2Y2WA 2WVTA 3M07A 2D2OA 1DIKA 3VKAA 3V35A 1YDNA 4MNLA 4RL3A 4D6IA 2AL1A 1AJZA 3HV8A 3SCVA 2QVHA 4DWSA 4C5ZA 4DM1A 5CC6A 3QV8A 5I09A 2WMGA 1JJKA 2D0GA 3DZ1A 3P61A 4QE1A 3W3OA 4TIMA 2ZZ3A 4AIEA 2A6NA 1J0HA 5DFAA 2J7BA 2Y70A 4UTHA 3WFLA 3GNXA 3DFPA 1EEPA 4XD3A 1MWOA 1W2VA 4DWDA 2YB4A 2ZC8A 1UWUA 4KRTA 2R1NA 3HPFA 3HGJA 4BFAA 4L6DA 4INFA 4ZQMA 5C71A 5F7UA 4YL2A 1OFRA 3OLIA 4HU8A 1O60A 3FKKA 1LRNA 3VD7A 1I2RA 4HPXA 3SUSA 3A4AA 5EMUA 1BYCA 3FIGA 3UG5A 3GWQA 5KETA 3DHDA 3DG7A 1WAUA 3CL6A 3H2OA 3PS7A 3BOFA 4V1XA 3GC4A 4XO6A 1TZZA 3NOEA 2Y5JA 4L9YA 4BF5A 3O6YX 2J13A 1JFHA 4QEHA 1V3LA 2P88A 4IFKB 2E77A 3GC2A 3L2LA 1OIFA 4DJDC 5KZDA 1CEOA 3AO0A 3QMTA 2QIWA 3UJ2A 2PDFA 5DQPA 4UTWA 4IPJA 4D8AA 4V27A 2ZRXA 4ZE5A 3OLGA 4HHPA 4LBSA 1SR9A 3OA3A 3L65A 1QTWA 1EKOA 4D8ZA 4ALDA 3N2OA 3STCA 3C6CA 4C6PA 1THFD 5CC3A 3GVWA 3WYZA 2H3DA 2Z2UA 3EWWA 1RA0A 2OEMA 3PBYA 4HNLA 1JNEA 4JKKA 1YADA 2QCNA 2PDNA 4HK7A 1E0TA 2XN1A 1UA3A 1PHWA 3O63A 4XZBA 4DYKA 4C6BA 3GDKA 1UD8A 2YDSA 2VZTA 4PCSA 5AVHA 1H61A 1VS1A 3I10A 2ZIDA 4S3EA 3TDFA 2JKEA 4QDPA 1UHVA 4AH7A 1YNPA 3BANA 3W2MA 2BHUA 4QCEA 4JBRA 3ALGA 3W1MA 4A22A 3N3MA 1YXCA 1K9FA 5MHBA 3BOLA 4KQNA 2VCCA 3KW3A 1UWAA 2W3ZA 2DT2A 1A4MA 1UUQA 2F2KA 3AJ7A 2PP0A 3T2PA 3H2MA 4HA1A 1GPWA 3BSMA 3TFXA 1VFFA 2E5BA 4F0LA 4GABA 1M03A 1IR2A 1EWDA 1FWFC 2ATSA 1J0KA 4J3XA 4S3KA 1GVYA 1RVKA 2J8GA 3GXIA 4K38A 2Z00A 4JAWA 5JU6A 1NOWA 3Q45A 1U22A 4UZSA 4KFPA 5BNKA 4M6QA 4B5NA 1OB0A 3JW7A 3M41A 3QQ0A 4CNOA 3EXRA 1WDDA 2ADAA 3S2CA 3N04A 1POJA 3MMUA 4IFKA 3NPVA 4IIBA 3GHRA 1R7AA 1CXKA 3NEHA 2YGYA 1K4HA 1E0VA 3DOPA 4O0ZA 1KFEA 4CQ9A 1UROA 4Q4SA 2DVTA 3W7LA 3L66A 4AZIA 2NW0A 1MXDA 1XBZA 1E4IA 2JKPA 1VHNA 3SQLA 2JEQA 5FF0A 1BWLA 4X63A 3WJSA 5EB8A 3HU7A 6PTDA 1JG9A 2VZOA 2QKFA 3IIVA 4J1OA 1XRFA 2WQDA 4J4KA 3TXVA 1L9WA 1R5YA 3OIHA 3AISA 3ABZA 4PMQA 3CEPA 3CZ8A 1HW6A 3WEOA 3DENA 1T41A 2W27A 4LRTA 2WQPA 3AMKA 2Z1WA 4NZ5A 3KBNA 3ZYZA 5ABFB 1Z9AA 1OCNA 3LNMA 4GUJA 5B80A 4N7QA 1KFJA 5HBFA 4EAMA 4XB3A 2VCBA 3QHNA 2OWXA 3SY8A 4DF0A 1JZ8A 1P0KA 3NM3A 1KXTA 1DJZA 3AAMA 4K8EA 1JL8A 1JRCA 3LTSA 3NQMA 3OGVA 1ZHAA 5LHFA 3CV1A 1ZBVA 3MCNA 2W4XA 3RX2A 3LHUA 2YJQA 3RPMA 2PPGA 4QJ4B 1K1DA 4DXXA 2HEJA 1JAEA 3HN3A 4BF7A 3W7IA 3NZGA 3NZQA 1RVGA 4YCPA 1GWJA 3MHUA 3VC5A 4JFVA 3BPWA 5HJXA 3CPRA 4LJ3A 3EWUA 2ACRA 1W9XA 1PTDA 1C7TA 3LCIA 4ZTYA 4N9CA 1B3WA 1AODA 1QATA 3KRUA 1NJJA 2CBVA 5BOFA 1OK4A 5HDRA 1PKMA 3VGHA 4XKMA 2WO5A 4JL2A 1ML1A 1VFSA 4CKQA 4DELA 3BAIA 2QV5A 3VK5A 3WH9A 3B8WA 3W71A 4JTDA 1NDWA 4MM1A 3WK2A 2ZBTA 2JIWA 2V2CA 1UR2A 1JIBA 4X2PA 4DZIA 4HNVA 2ESCA 1X7IA 1TB3A 4H9XA 2BXZA 5D38A 1R3RA 2DSVA 4Z0SA 5CPTA 1GZ1A 2DUAA 3ARSA 3ARUA 1HJSA 2E3ZA 3S5OA 4TTUA 5BXPA 5F4WA 1HUVA 1GVRA 1QPKA 2A3CA 4NI3A 1EWEA 3VMOA 4I7VA 3E2QA 4MF4A 1BTCA 1AQFA 2AMGA 2PGEA 2E0PA 1TPVA 1PV8A 4MPKA 1H0GA 3B9DA 5E1QA 5ECVA 3R1ZA 5ABFA 3BAYA 3H53A 4IPPA 3M44A 1T40A 5LHEA 4UR7A 5D4YA 1JCTA 4V15A 4IP7A 2A3BA 3WNLA 2WMKA 1NY1A 3W7EA 2J9XA 2V82A 2CHRA 1DWIM 1DBTA 4BEQA 3EOOA 4LGXA 2DW6A 1HKIA 4G6CA 3WFAA 3T1GA 1VPYA 2GGJA 2WNNA 4RE3A 1EIBA 4ZO6A 1KGXA 2EKGA 2X0SA 4MKSA 1WXYA 3O05A 3NDOA 1Q4WA 3VA8A 1KQZA 4KMQA 2G3FA 1WDPA 1ICPA 2PC8A 1H1YA 3RJYA 5JQ9A 3MCOA 3UPBA 1OX4B 5AYZA 1XL9A 3AALA 1K8CA 4N9BA 3OG2A 5IOBA 5A6JA 4O15A 3W28A 4NXSA 2BGNE 3NSMA 3POCA 4YCOA 5EPDA 4NYUA 4AEOA 1E9ZB 2OO6A 1XLIA 3GE7A 2OMAA 1XIFA 1FUYA 4NJHA 2E68A 4B3LA 4ACZB 1XIBA 4XUGA 1UQYA 4XAZA 3RM9A 7XIMA 2RAGA 4C60A 1XJBA 4N4PA 3BZGA 3H4GA 4YVXA 4F0SA 1ZAJA 3M4HA 4JTJA 2DZWA 5K2ZA 3GW0A 2C8NA 3TNBA 1DORA 3E0IA 5E0CA 4LW7A 3R25A 1V3IA 2FHBA 1GZJA 3LU2A 5AECA 3IARA 1NM9A 2XIOA 2QAFA 1HFBA 3Q4DA 2BBFA 1HGWA 1GG0A 3AMGA 4E3TA 1VFUA 3UGVA 4G56A 1YPIA 1DVJA 3QF0A 4GY7A 4HSHA 3M43A 4UTMA 3LI0A 2VEGA 3ID7A 1VEOA 2YKKA 1N8WA 2GQ8A 3MDUA 4JFWA 4MWAA 3KDOA 5I07A 4PUWA 3APGA 3R79A 2J4GA 1J0IA 4GGHA 4PMJA 4YYFA 3THQA 1P48A 1POKA 4LAKA 1PEZA 3C61A 4IIDA 4XSMA 4KWWA 3VOHA 1C29A 3VNYA 3DI1A 1HJWA 1ITXA 4C7FA 2PDLA 2V3DA 2B4GA 1QOXA 4YMZA 4K3ZA 3V5OA 2G97A 2ASHA 3JR2A 3ZLFA 3MQTA 1V7YA 4MNMA 4HIBA 4DIAA 3T9PA 1OX4A 2XN2A 3NEVA 3W1RA 1IGSA 2XJ7A 2EPKX 5AYXA 4XAYA 1DJIA 2PBGA 2ISVA 5B7ZA 3W87A 5LXEA 2BZNA 3ZLHA 4G7EA 1NWRA 1QU4A 1WPCA 1XLAA 3IAQA 2QS8A 1ZJBA 1IIGA 1ZBKA 4GX9A