3H2AA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
261
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 95
structure length 261
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2aA00
4DJFA 3H26A 4NIRA 4DJEC 2VP8A 4S3EA 1Q7MA 4MWAA 3H23A 2Y5JA 4O1FA 3TYAA 4DJDD 2YCLA 3H2CA 4PZVA 2VEFA 3TZFA 2Y0FA 4DJEA 4D8AA 4D9PA 3MCMA 3H2MA 3H24A 3TYBA 4O0QA 3TYEA 4S23A 2YCJA 2E7FA 2H9AB 4G9PA 1TX0A 1Q7QA 2DZBA 2Y5SA 4DJFC 1AD1A 4MWAC 4S3FA 5JQ9A 2VEGA 3H22A 1AD4A 4DJED 4S38A 4S3DA 2YCKX 3BOFA 1Q8JA 1Q8AA 4C1NB 3H2AA 3MCOA 2YCLB 1Q7ZA 3BOLA 3TYCA 2H9AA 2OGYA 1F6YA 4MWAD 3TYDA 4D8ZA 4CCZA 3NOYA 3V5OA 4MWAE 3TZNA 3H21A 3TR9A 4S3AA 3H2NA 3MCNA 4S3CA 4HB7A 4S3BA 1AJZA 4MWAB 4DJFD 2BMBA 2YCIX 3H2EA 1TWZA 4O1EA 4DAFA 4S39A 1EYEA 3H2OA 4DAIA 3H2FA 4DJDA 4C1NA 1AJ2A 1TX2A 4NHVA 4NILA 1TWSA 1Q85A 2DZAA 4DB7A 3TYUA 3K13A 4DJDC 4NL1A 2DQWA 3TYZA 1TWWA 1AJ0A
chains in the Genus database with same CATH superfamily
2CYGA 4XZIA 2FZNA 1VAHA 2VRKA 3STCA 2E28A 1AQFA 3SUWA 3UXLA 1VCFA 1PTAA 4O1BA 2VR2A 2VRJA 1EEXA 1DTNA 5C2CA 4MZ1A 4HN4A 4IX0A 4L7ZA 3HB9A 4XKMA 1UWAA 4MB1A 1H49A 4L4OA 2RHGA 1Q63A 3BDKA 4X2PA 5F2GA 2OWXA 1QW8A 4IISA 4CQ9A 2UWFA 5HNTA 2XIIA 3L68A 3T2PA 4EX4A 3UCDA 4B4HA 1EX5A 3DKLA 2DSUA 1WKDA 1KGXA 5FF2A 2Y1HA 3ITCA 2ALRA 2GVGA 2XPKA 3MU7A 4XZNX 3POHA 3AO0A 4GPNA 1H0IA 3ZXWA 1GJWA 1C8YA 4JPGA 1DV7A 1IGWA 4M7TA 3LEPA 2PWDA 5AB3A 3ARXA 1G94A 3FGCB 4XD3A 3PZOA 4WRHA 3TN3A 1UOKA 4GIYA 1HIZA 2JKEA 2CLIA 1LLZA 3FYOA 4D6EA 3WF1A 3U2EA 3HGOA 3C3NA 3BLLA 2PRMA 4DYKA 1R86A 3FIGA 1WAUA 2J77A 3CTLA 3FFSA 3P61A 1GVFA 1R3SA 4ML9A 1EO7A 3VOJA 4HZ6A 1KLZA 1SO5A 3NJ3A 3TN4A 1J12A 4WGHA 3LX9A 1E4MM 1TTJA 3OEXA 4QS6A 3CXOA 4DYEA 1JFXA 4IIFA 5LNRA 3QOMA 2QMJA 4O1FA 3IGHX 3SCWA 1C7SA 5AHIA 1KFLA 1UROA 3NZGA 1E0TA 3B9DA 3SY1A 2ZFAA 5F2LA 1DE6A 5DRIA 3IRDA 2Y5SA 1PAMA 2GWNA 2YDAA 4NP7A 2ADAA 5JQ9A 3AMCA 2ACSA 2HISA 1PXGA 1A3WA 3DC0A 4G7FA 3EEGA 3EDKA 2GGGA 1J8VA 2YL6A 4JKKA 3LZ3A 3O0KA 3OU8A 3NQ7A 1BHGA 2EKCA 3PJXA 4JXCA 1TKKA 1CZ1A 1XLIA 2VFHA 3FK4A 3KUMA 1D3GA 3FA3A 4NI8A 3BVJA 3FA5A 3PPHA 3OLEA 3N25A 3V5OA 2AKMA 1K8XA 1V0MA 3NL6A 3STEA 2H90A 3VZYA 4HK6A 1SMDA 4XX6A 5EY5A 3VMPA 2J6XA 3VNYA 4JTTA 1Q6GA 4ROPA 1DJXA 3F4DA 4B5TA 1VBHA 4K39A 2XN1A 2J88A 1E71M 3F7JA 5FJUA 4W85A 3VO0A 3B9AA 2ZA3A 2RDWA 2ZX8A 4RXFA 3VNJA 3UFYA 3P2VA 4NX0A 4Z0SA 3AZTA 3IUIA 3A9BA 3CWNA 4OBSA 2DIJA 4U3AA 3C2YA 3RCMA 3OODA 1UD8A 1BD0A 4HT3A 4GACA 4HHLA 1NQKA 4DJEA 3OBKA 4CQAA 1A4LA 4JYFA 3PSWA 5FAGA 4F66A 3TW6A 1DJQA 3GKAA 3BW2A 1HJWA 3MANA 1VPYA 5H91A 4FNSA 3I6TA 3I7SA 4MPQA 3PTDA 1E9ZB 4XZWA 1F61A 4M6PA 1Q2SA 1GOMA 3VMNA 4UFHA 1BYDA 4MY9A 2QCHA 1QPOA 1ZZMA 8RUCA 1JNDA 3AI0A 1H51A 3GHRA 3GHUA 2D3NA 1IWBA 1XUUA 1OFOA 1MEWA 3W7PA 2PI6A 3GR8A 1WUFA 1D8CA 3SJ3A 3HIJA 4LJ3A 2YBTA 1LUCB 3H55A 2NT1A 2GSEA 1WNOA 3AIQA 2VJXA 5A6BD 2CITA 5DMMA 4IMFA 3QGVA 1JDAA 4HK7A 3SIMA 3A5VA 1OD8A 3ONCA 3TNOA 2WXDM 1M7OA 1LQ2A 3TW7A 3A4WA 1TMHA 3OBAA 4ML4A 3VIIA 1UCWA 5A6LA 4PH6A 4A21A 2DZSA 2OB3A 4UB9A 2PDKA 1QI0A 3TMQA 1B5TA 5K9CA 4L9XA 2GJXA 4O14A 5E0CA 4US5A 3BJFA 3AFBA 3VAVA 1UC4A 5BW6A 1W8GA 2E5CA 1O5RA 5CGTA 3DHPA 1BAGA 2GQ3A 3WMSA 2NUXA 3LSBA 4A2SA 3B0VC 5GNYA 1F5ZA 1A5MC 4WIWA 3VDGA 5GJNA 1ZY9A 1VLWA 3W4RA 3ZVHB 4TO8A 4BCEA 3ARQA 2P53A 4QCFA 3NSXA 3FXGA 1CX9A 3VIOA 4RE4A 3WH5A 3ZWTA 4K7YA 3U9IA 3BAXA 3VD4A 3NNTA 4ZR8A 3W07A 4QDPA 1ODUA 3E2RA 2V69A 1BPLB 3BICA 2QJHA 1XLLA 3CL8A 4L5ZA 3T4WA 1C7TA 4Y8FA 4L6DA 3EWDA 3TROA 4L64A 2CZVA 3HPAA 4Y9PA 3I3BA 2Y8UA 1G4TA 3DOPA 3EX2A 1GYLA 4N9DA 5FF3A 4D71A 3THDA 1E9LA 1SFSA 1J0HA 1Q6EA 4CN4A 4QE5A 4O17A 3AICA 5FL1A 2Y24A 1O60A 4PTWA 3QC3A 2AQVA 2VFIA 3M0LA 5HWNA 1W56A 3URAA 3UETA 2B7OA 4Z17A 3EB4A 4KIEA 3WJWA 1QI2A 5I5RA 1MW1A 3JS3A 3N11A 1ALDA 3RU6A 1SJCA 1T5AA 4P8WA 4JL1A 2JIWA 3EOSA 3H53A 3EKGA 4XUGA 4HNTA 1XF0A 5L6UA 2YCLA 4PODA 1GGOA 1G5AA 1OBAA 2OZTA 4GUHA 1FXQA 1XBXA 1YHTA 2V30A 3OZOA 1JZ4A 1KTNA 4HKPA 1CECA 1N55A 2JEPA 4KPLA 5GNZA 5HNNA 3GH5A 4P7NA 1VFFA 4W84A 1KRBC 4K38A 4I9JA 4N7QA 1WPCA 3OB8A 1LWIA 3SQMA 3WO8A 4C6QA 4HNLA 4JFVA 3W22A 1G67A 1O7AA 3LGGA 1MNZA 4L65A 4UC5A 2WJDA 1OSEA 1WBHA 1WUEA 1ICPA 4J3XA 2HROA 1C9DA 4JR5A 2ABBA 1ISWA 1Q45A 1E43A 2X0YA 3WIJA 3VC6A 1L8NA 1LBLA 2BOGX 1GVQA 4J3TA 3N1AA 5LIXX 4ATWA 5IDIA 4HB7A 4KFPA 5REQB 4ZE5A 1CXEA 1T96A 2D23A 3EDJA 2PURA 1LL7A 2G3IA 5D2VA 4RZ4A 1VB9A 1EGZA 2EG8A 3I3DA 2PDNA 1V03A 2PFHA 1SZGA 1A5UA 1P0DA 3N04A 4M8UA 1BF6A 2WKGA 4S3KA 2FH6A 4IL0A 3AUJA 4WSHA 1E4IA 1TWIA 1A5LC 2J75A 3PAJA 4RL3A 3WG6A 3K8KA 4A35A 2O56A 5J5RA 3N3MA 4DO4A 2HV5A 2L5HA 4GBUA 3GNDA 1DWIM 5A8MA 4ES4A 4PMRA 4C6DA 2XJ7A 3NUKA 3NSNA 4E2DA 3GDBA 1VS1A 4GQ0A 5GNXA 4EACA 4LUTA 1NWRA 3XIMA 3PVFA 4YWIA 3DAQA 2VI0A 3QN3A 2NX1A 1DXFA 1Q6RA 1JPDX 3LLXA 1KWKA 3UYCA 4PBFA 3VGDA 2O7SA 4OTKA 3V1PA 3UERA 2HPMA 4X63A 3URBA 9RUBA 3PSVA 3U7BA 3B0XA 1SZEA 3PN8A 5IFPA 2DSWA 1UH2A 5I78A 4GHRA 2QVNA 4RE0A 1WA3A 2CLOA 3WDRA 2OVLA 3RLUA 3OBEA 8XIAA 1B1YA 3LLFA 2QDEA 5BWAA 3M43A 3UJEA 2HXUA 4FLSA 3N2BA 3PM6A 1KFWA 5A6AA 4ZO8A 3W7NA 4MHBA 4XZLX 4W9TA 1GW9A 4HYRA 2W5FA 3L0GA 3W27A 4KETA 2DZUA 5HBFA 4ATLA 1UP3A 5CG7A 3QBUA 3L5AA 1GVSA 3BCDA 1K8CA 1YXYA 3GY1A 3T44A 4BF5A 1HJSA 4XQ6A 3GE7A 3R4IA 4C1KA 4L4MA 3LQLA 5EFFA 2HS6A 2VX6A 1VFTA 1GUVA 3KCOA 3QEZA 2BGNE 2GDUA 2FJKA 1OWQA 4CCDA 3LGEA 4AW7A 2HE5A 3KP0A 1XG3A 4XZ9A 4C6MA 3G2GA 4G1KA 1NELA 5D4YA 1ICQA 2NXHA 1KM3A 2E9LA 2ZYFA 4BQ2A 4TX6A 3PAOA 5F4XA 1KXVA 4EPDC 4JEQA 4FAMA 1RP9A 3DU0A 3MI2A 3C0LA 4UCFA 2OR2A 4QITA 1X1OA 3B3DA 2INZA 1PKLA 1XYBA 4Q8NA 3WN6A 4RDVA 5RUBA 3WFLA 2PLCA 1QMLA 1X7FA 3GWQA 3WQ8A 1DHKA 4O0KA 3WLIA 5D32A 3PANA 4GD0A 2RDUA 2XIOA 3N2TA 3H70A 4JCMA 5PTDA 4MKNA 3KVLA 4PUUA 4AZBA 1F8IA 4UTWC 3E6EA 3WH7A 2WSQA 3L0KA 1DJNA 4R3UA 1TMQA 1EYEA 3VCCA 2XVNA 1XISA 2DY3A 1JDCA 2FDSA 7REQA 1A0EA 3VC5A 3TC7A 1TRDA 4ZTXA 4W8BA 3OYZA 4AHOA 3VX1A 3ZLGA 1UJPA 1F4AA 2R94A 4HQVA 4KWSA 1FTXA 3MSGA 5TD4A 3WEZA 3I6RA 1NQ6A 4FXJA 3UBPC 5C70A 3D0CA 5EPDA 2IQDA 3FX4A 4E8CA 2PD5A 2V5KA 1J96A 4HSHA 3T55A 3L21A 2PB1A 1K9DA 4D6IA 4QG6A 4BFAA 3WNLA 1EJ7L 1DBTA 5FEZA 1BGGA 2A85A 4KWUA 3W74A 1R7AA 2YSWA 3WNKA 4Q8OA 5A6JA 5AHNA 2ZE0A 4IIDA 2E0PA 3BLOA 2GOUA 3APYA 1MDLA 4RDYA 1DYSA 3T81A 4AIOA 4A8RA 1AJZA 5CPTA 3GXMA 4Q7BA 4XD4A 1UD6A 3W01A 3VMOA 2Y5EA 2DVXA 2Q01A 4EPBC 1RK5A 4OQVA 1IT7A 4GZJA 2J8TA 3MSRA 3TQPA 5BOOA 4N4QA 2OOGA 4DB7A 2HSAA 4PUDA 2HVOA 3GS6A 1W31A 1ZTVA 1RCOB 2QGHA 4W93A 2FPVA 3N4FA 3MSDA 4XVDA 3CB8A 4XBSA 4TV6A 3WFZA 3AC0A 3BUVA 1RR2A 3N19B 2CW6A 3DYPA 1PIGA 1EL3A 4IMEA 3GB6A 3CL6A 1QR7A 4A05A 3NZ1A 5I3GA 3MC5A 3JRKA 3TA9A 3W7KA 1GORA 4H04A 3O3RA 2WBGA 5HATA 3THAA 2Z29A 2TYSA 4YTQA 2QHAA 3S5NA 1A4MA 1NSJA 1OFPA 3RLHA 2C15A 2ZTKA 3WLLA 5CZ0A 3UZJA 3L12A 1NFPA 3PZQA 2PDBA 2OZ3A 1KNWA 4XWUA 3UPWA 3OHIA 3F4VA 2BOEX 4AISA 1HL8A 1UZDA 5I2UA 3HMJG 1FWDC 4Z1DA 3CHFA 3D47A 3LHVA 2CFFA 4JQ3A 2X1IA 2EPNA 2VQTA 2WQPA 5A8NA 2AQWA 3WD3A 3RIKA 1LROA 2V5LA 4UTHA 2HEJA 3THQA 1D9EA 1XCFA 5IHSA 2BOFX 3MTWA 5D2TA 1CXLA 3VIJA 1W1ZA 1W9BM 3CZJA 5KSWA 4ZB0A 1K4GA 1V93A 2YCIX 1KM2A 4BEQA 4C6BA 4JQ2A 3SRDA 1ZSXA 2QDGA 4AWUA 4C1NA 4NQ1A 1YNPA 4KESA 1LLOA 4QNWA 3TYZA 1M53A 3HBLA 2ZZ4A 4PEEA 3H26A 4JY8A 4UWMA 2ZBTA 1KQYA 3W37A 1ZBKA 4IL2A 4CD5A 3VUSA 2V0TA 3TNBA 4QISA 5E9AA 1ESWA 3OGSA 4QP0A 3KP1A 4C6PA 2YOCA 4M51A 3EWUA 1XXXA 2ATMA 4BQ4A 1W9UA 1NWUA 4YHEA 3KX6A 4ERGA 2I5IA 5EMLA 1PO9A 3K2GA 1J10A 5D09A 1ZBVA 3E12A 3ORWA 3ZT7A 3AYSA 1DXEA 4GVGA 4OKDA 2D73A 5H8MA 3A4AA 3A3XA 1IZJA 2GJPA 5HR6A 3H12A 1IEQA 4HNUA 5H6HA 1CDGA 4O54A 3CHVA 1YX1A 2INFA 4LH8A 1W9XA 4JTGA 3UWYA 1TE1A 3ARUA 4DRSA 2PP1A 2CWNA 4AC7C 5H2ZA 1S39A 2ZUVA 1ITQA 1QO5A 1RBLA 3UP8A 1DIDA 2WYSA 4GUJA 3AMDA 1JGMA 1E9IA 3MI6A 2X05A 2INEA 4FF7A 3KRSA 1TWWA 3M0MA 1U2YA 1J01A 1O12A 3DG6A 3KS6A 2I5QA 4GY1A 4B2DD 4GY7A 2NQ5A 1AZ1A 3O07A 4DBWA 3VUPA 5E70A 3LY0A 3NXFA 3WQ4A 1TJ2A 1XKYA 2WBKA 5LXEA 2HS8A 1EIXA 4GJ1A 5FA5A 1EJXC 1XSKA 5LNWA 2J7CA 3TCSA 5DO8A 5D8WA 3WKZA 3CZLA 2XIMA 4URIA 3E2VA 3WMCA 2UY2A 5AECA 1W3NA 3CHEA 4PCSA 4GH1A 4GYFA 4S38A 3WELA 2XWDA 4M1BA 3GVQA 3CUJA 4U5KA 7A3HA 1ADDA 5T8GA 1NU5A 1OFQA 4REQA 1UWQA 1BG4A 2Z28A 3OLDA 4DWSD 3FY1A 3GTNA 1UQYA 4C7GA 2XGBA 2B7PA 5D02A 2WMIB 3K30A 4GOAA 2OSYA 4PSPA 3LMYA 4J2PA 4ZO9A 4IT1A 3S47A 4DF0A 3OLIA 4YVVA 3FJLA 3D3FA 3O6DA 5HQLA 1UR8A 2XFFA 5D2WA 1QO2A 1OYCA 4Q8QA 3WK0A 3E9AA 4WF7A 3I7QA 1B31A 3ARPA 1L6GA 3URNA 2EO7A 4WDWA 3VKAA 1AH3A 4I6KA 2DZAA 2DV0A 1UIOA 5EKYA 2DQXA 3DHUA 4ZXLA 4PMOA 2POTA 4HU4A 4E4UA 3GIQA 2Q02A 3IVUA 2X1SA 3WBWA 3HO8A 3W1UA 4IX2A 1TUXA 4HPNA 4GKTA 3GG8A 2PDPA 3WQGA 4RW5A 2OU4A 4DEFA 3VE7A 3O15A 3C8FA 3H24A 1B30A 4LV9A 3E5PA 6TAAA 3ME3A 1RALA 5LIYX 4G9PA 2C79A 2G50A 1B0IA 2ZZ5A 4GKLA 3MJYA 4L1XA 4NZ4A 2FIQA 1D3CA 1JYNA 2WJFA 2CBUA 4H41A 3T0CA 3SI9A 3O1NA 2YLAA 3FKRA 5HUOA 5HMFA 1HTIA 2YZRA 1CLXA 4O10A 3NQ6A 4ZVJA 4ENLA 4D6DA 4J3UA 3N2OA 4H01A 2H9AA 4DN1A 3PZ9A 5A2BA 3F03K 5GJPA 5LZLA 3CO4A 3S46A 2GQAA 1UJQA 4M5PA 4ZL1A 3GX9A 5D38A 1E73M 4I9AA 1UQZA 4H1ZA 4QLLA 3DG3A 2Y7FA 4N2YA 1P7TB 4UQCA 3M44A 3SFWA 1XYMA 4R85A 1AW5A 1IXOA 2WNWA 3A24A 1F74A 4JFTA 1PS9A 3MUAA 1JFHA 1ML1A 1Y0EA 4DYJA 3G0SA 3P82A 4R88A 3W28A 2HBXA 4TVCA 4JTEA 2JBMA 2FDMA 1X6UA 4UNLA 1OCBA 1O94A 4WXYA 2IPFA 2PE4A 2Z1BA 3W85A 2Y89A 1O1ZA 2DUXA 2WZMA 2GWGA 4PZVA 2FLIA 3ITGA 4Y6GA 2O55A 5EMJA 1QNOA 3HU7A 3T2OA 3TYEA 2CIPA 3DI1A 5AYIA 2WWCA 1AQHA 1TPC1 1EIBA 1E6NA 2VL4A 1RK6A 3LLDA 3AWOA 3REQB 3EWZA 2BWGA 4MZ8A 5A94A 1KRAC 2D24A 3FJ6A 3F5LA 1WE5A 4LC8A 1EOKA 3SB0A 5U4NA 3H2AA 1JDEA 1ICSA 2JEQA 1BVNP 1RJRA 4YVPA 2Y63A 2VCAA 4HHMA 4QNEA 3BOLA 2WVVB 3POCA 1WDWA 4A29A 1QAPA 2VD9A 4IQJA 4MWAE 3RHGA 5D2YA 3YPIA 4AUBA 4YLWA 3FVMA 3UJFA 4CD4A 1B3WA 2ZX6A 4J27A 4I7VA 2G3MA 4JQ1A 4NZJA 3M0YA 3WQOA 1RJQA 3PJUA 3TTOA 1XLGA 2NUWA 4UZUA 2GL5A 3E2QA 1OGGA 4RNHA 1NOWA 4JN7A 4J7RA 4DJDD 5IHRA 4H4IA 2YJQA 1SW7A 5LYRA 1QU4A 4AD0A 4IIEA 3USBA 1FHDA 1LZOA 4UTFA 2ANUA 1TFVA 4IGSA 3S42A 4F8XA 3KAOA 5FAJA 4GABA 4AEFA 1XR2A 3NO3A 1MXGA 1J9YA 3KBNA 1VPXA 1FH9A 3R5EA 3RK8A 3KVMA 3WBXA 4DPPA 3CYVA 5HR7A 1WKEA 4LS0A 4WJEA 3VIMA 1KWGA 1OX5A 3FCPA 3P67A 2VEPA 1YPFA 4GUIA 3LBOA 4IM4A 4OHQA 3R7MA 1EJVC 4JHZA 4LY8A 3S9IA 4AX7A 1I75A 4XK2A 5HMDA 2V5JA 4IFRA 5CSRA 3BSHA 4PMUA 4R27A 3W73A 1LP6A 3VDAA 3BGAA 3EGJA 3V0TA 4U3CA 4O4WA 3EDEA 3IAPA 2ZUWA 2OZ8A 3QVQA 1CW2A 2E9MA 3H7UA 2H3BA 4E2BA 3HM7A 4Z2JA 2GDQA 2FTPA 5LA1A 4YCOA 2OEMA 4JN6A 4PRRA 3UJ2A 3O9NA 1LG1A 4K36A 4EAMA 2HVMA 2QUMA 4XSLA 1T7LA 3H2CA 4ORIA 4ERIA 2VFEA 1FWJC 5ENLA 4LUIA 4G56A 4D9PA 3CJPA 3RM8A 2ON3A 1W2VA 4LEFA 3VIHA 5E6YA 1Z8AA 1O1HA 4GZEA 5BWFA 4M3PA 2VOMA 4O1DA 4XKYA 3BG9A 2PF0A 1W17A 1Z48A 1EC8A 4HNOA 4C6IA 4WDXA 4MLJA 2BSLA 2IPJA 2V3DA 2O9TA 1TPH1 2PTWA 1E6QM 2I9UA 5A8GA 5LA2A 2KZHA 1TZ9A 2ISDA 2IXVA 3R1ZA 3WQWA 3DX5A 5A6BA 4PCNA 2YBVA 3V75A 4ASTA 3W70A 3HJZA 2PU0A 2RGMA 2WHKA 4AEOA 2IKGA 1MFUA 5E6ZA 4DZ5A 3TYDA 4HOZA 3A12A 3BMXA 3RG6A 5I02A 4Y8EA 5AHEA 1TCMA 4MTVA 1P48A 4EPKA 3ZQ9A 3S0CA 4DF1A 3NYZA 1Z32X 3PZMA 5CSUA 2ISWA 3AAMA 3GVWA 3ATZA 4Y90A 1I45A 1VRDA 2O4QA 4AU0A 3KEHA 3V0SA 1VFSA 2WJEA 2GJRA 4JIQA 2C16A 4TOQA 4GUGA 7TAAA 2HK0A 5AFDA 1A5SA 1H62A 4OJYA 4LNYA 2VENA 3W87A 2FHFA 2WVSA 3VOHA 2E3ZA 3HQNA 4WDUA 3M0IA 4WKAA 3CLWA 4UQAA 1K9EA 1BTMA 3T05A 1HP5A 5FESA 1LOQA 2E25A 2F38A 2QCFA 4AH7A 4AFYA 1FY6A 2A3EA 1CBGA 3TVAA 8TIMA 1XGEA 4UOZA 3QY8A 5IXEA 1FUYA 3CK5A 3L4XA 1HL9A 3HGRA 4KGJA 2X0HA 4NZ3A 1LT8A 1HXJA 1PKYA 3B03A 1GVOA 1DL3A 1Q65A 5E5CA 3MHFA 3PBWA 2OWWA 2D2OA 2B81A 3PBVA 3VD9A 3NEVA 1EYWA 2VC6A 4QFUA 2YL8A 2ZE3A 1W5PA 4GRSA 2RFGA 4Q8PA 3W3OA 3U57A 4JTKA 1H2JA 1Q13A 2XVKA 3PBUA 4PUMA 3T7VA 3QH2A 5I0DA 1N82A 4GVIA 3H8AA 3B04A 1H5VA 2OLSA 1K3UA 1JZ7A 3WLHA 4WKHA 1ZALA 4QCEA 2XYLA 1EGMA 1V5XA 1SMAA 2B0MA 2Y61A 3AYTA 1JD7A 1BXNA 2HZGA 3ENLA 1JCLA 2DZXA 5E93A 1RCXB 4XTDA 4ZB2A 5CJMA 4AZCA 2WZEA 4MUZA 2NW0A 1XWYA 3D46A 3F4WA 4DM2A 4LPCA 4IFKB 2JK2A 3N15A 3EX4A 2XISA 4S2BA 3PS7A 3N9SA 3W1PA 4WX2A 2VC9A 2A1YA 5AHFA 1PX8A 4W8AA 4IFKA 3GIPA 3SCSA 3NWRA 4DX3A 1P0BA 5AYXA 4NU7A 3N4AA 2AGTA 1NDWA 5KZDA 5T9BG 3N6HA 1MW2A 2QQ6A 1WB0A 4JNZA 4RZBA 1EZ2A 5CZTA 4AD2A 1XRSA 1LL4A 4IQEA 3G18A 3QMSA 2BHUA 2DVUA 4JQAA 1D2KA 6ENLA 4NVTA 4RLIA 2WZHA 2DPEA 3M16A 2X41A 2P3ZA 2ACQA 3P81A 5CPOA 4A3RA 2G3JA 2WHMA 2W79A 1YQ2A 3S1UA 3NQCA 4PL2A 2QDHA 1GG0A 3IJLA 3BJSA 1K02A 2WM0A 1DIKA 4YYCA 4QIUA 1WCGA 3CZ8A 4IXHA 3A64A 4CNOA 4YIWA 1ZQ5A 4PUKA 3B06A 5EBUA 1FWIC 4EK7A 2FVLA 1EX1A 1IR2A 4Y9OA 1FWFC 1UUQA 3LHWA 1PZ1A 4NRRA 4IZGA 1TTPA 3A4XA 3BZGA 4KEZA 3I68A 1DPMA 4ZTYA 4BA0A 4KEUA 3BLEA 5G1YA 2TODA 1PIIA 5IM51 1I0DA 4YCPA 3UPBA 2EBNA 2QLYA 4RW3A 4IIGA 4GVFA 3UESA 3EWBX 4DJFA 1JYVA 2FGBA 4J28A 1HVXA 5I09A 2OLAA 1GWJA 4X60A 2ZUUA 1W9VA 4FXSA 2IKJA 3O6YX 4DNMA 4L1WA 3EXTA 4Q4QA 1KXTA 4LTSA 5KMYA 2QJGA 1FH8A 3W2NA 5D9NA 2C1HA 4RCXA 5KTLA 4JHMA 2VXNA 3UR2A 1K9FA 2A7NA 3PR2A 3WNNA 2XUCA 1Y5WA 4GMEA 1JF5A 3EMZA 5K9XA 1E70M 3L65A 1A5AA 1W0MA 2Q09A 1Z69A 3TIMA 3LD5A 4AC1X 4H3DA 5HMSA 4GNVA 4H8NA 3S5ZA 3VIFA 3B0UX 5AC5A 5E09A 3QMTA 4TVUA 1O4UA 1JPKA 3KW3A 1B2YA 2YW3A 2GGJA 4K1WA 1E15A 1IV8A 1WV2A 3UNDA 3SZ8A 5JUVA 1M7XA 1EBGA 4IOTA 3W2MA 3SN1A 1DWGM 1MUWA 3VNLA 3M7SA 2EEXA 2HXTA 3AYRA 2EQDA 3C4UA 1HQTA 4MJ4A 5G4HC 1LOLA 2GVLA 2V63A 3CH0A 3W24A 3PWGA 3EAUA 1DKWA 2XIQA 5B7YA 3W7CA 1L9WA 4NJKA 3GR4A 4V28A 3P5YA 1RV8A 1B4KA 2HRWA 3R79A 3MUY1 1AMKA 3ICJA 1D8WA 1ISXA 1V3LA 1VLIA 1RPXA 4D6JA 1TIWA 5C5YA 3DN5A 4MJMA 2ZXAA 1AD1A 1ECEA 3BLPX 1CPUA 3WL1A 1PDYA 1JI1A 2YKKA 1GZGA 4LVAA 1U1UA 1HVQA 2FPTA 4JHOA 3KRUA 3TC6A 4CN6A 2DJLA 2W9MA 3RXZA 3PZUA 3WLJA 1H7XA 5CBJA 1EPVA 3LQGA 1V3JA 4GI6A 2BODX 4ZQNA 2GOKA 2BLEA 1XL9A 2PS2A 3HTWA 1JZ5A 4LB3A 2WC7A 1RUSA 3VI2A 3LHTA 4BQ5A 4W7UA 2BG5A 4PTMA 2IXUA 5FOOA 1BRLB 4GG9A 1ZJIA 1OG6A 3W7GA 3M0JA 5DY2A 2QV4A 3WQDA 2H8ZA 2QUUA 4MJZA 5A5WA 1VYSX 1C9WA 1PVNA 1AL8A 3ZJ6A 1N7KA 4PMYA 3GG0A 1ME9A 3BOXA 4F4RA 1VYPX 1FWTA 3QHMA 4C7DA 3A4JA 3R8GA 1RY0A 2J7EA 3ZFHA 1TV2A 1TV7A 2F6XA 3RR4A 2GUYA 1QVBA 4GY0A 3OLGA 1TA3A 4Q8VA 1Z42A 1PTGA 4LWWA 3LCHA 1TZZA 3QQ0A 3I3EA 1J0YA 4Y7EA 3IK2A 4QLJA 3U7VA 2WOQA 4DWSB 1EWDA 5BROA 4WK9A 2IQ0A 2P5NA 6XIMA 4QLKA 4OV9A 4E8GA 3DG7A 3EMQA 4UTKA 2E6DA 1RD5A 4QSFA 2YIHA 1DTUA 1CCWB 3BLIA 1GQJA 4H6EA 1CT5A 3TQKA 1V7AA 2G97A 5A8OA 2AMXA 1IQ8A 4JKMA 1W1TA 1WXZA 2XH7A 1DHPA 1D3HA 3CUGA 2EAWA 3WEOA 3GLCA 3VNMA 3N2MA 3H4GA 4UR7A 3VM5A 1LQAA 3BAWA 3B8SA 2HPIA 4MFEA 2QF7A 2Q8LA 3GZAA 1ZB5A 1YTDA 3AWNA 3RX3A 3KVKA 3N13A 1ECQA 4QXIA 2Z2UA 4HCDA 4TXEA 4XAYA 3SSJA 4DVOA 2FJUB 1VD6A 1N8FA 4MAZA 1P6BA 2VX7A 2BVYA 3GVVA 4ZMGA 3CLMA 1T0OA 1ITUA 3B0YA 5EGRA 5C55A 3W9ZA 4N42A 1B3YA 4X22A 3CM4A 1XSJA 4JTFA 4AIUA 4UMAA 3AYVA 3NXLA 3CMGA 2Y6ZA 3DFYA 2QGYA 2PDXA 3OPSA 3QGKC 1MO0A 3DHFA 2P3EA 4Z2LA 4BI7A 1HKVA 5CKSA 1DORA 2NX9A 1XLMA 4S3GA 4AHQA 3HG4A 5LIKX 1S5WA 2XSXA 3KBWA 1S2WA 3C56A 4O18A 4Z08A 1AZ2A 3FLUA 4ACZB 3EYPA 5M03A 3PJWA 1PKNA 2PF8A 3IGXA 1S5TA 4YU1A 3WDIA 4D2JA 3P6LA 4TX9A 5TIMA 4MYXA 4JEJA 4H83A 4AWEA 1XLFA 3B8UA 1ZNNA 4XD6A 4GWEA 3FYYA 3QHNA 3PNZA 2GK1B 2GLKA 4CQDA 3L4TA 3KCJA 1JPHA 4DXKA 1JCNA 4C6NA 1MQPA 3EKLA 3MZ2A 2FQIA 2A3HA 4IF2A 1W5NA 2VKZG 4ZSUA 2PDUA 1KV8A 4DO7A 3ABZA 1JCMP 4HOXA 1H7OA 1NJJA 3W23A 1V0KA 4KERA 2E8YA 3MMWA 4LEQA 3WBEA 4EXBA 3DH7A 4EWJA 3UWEA 5CQ1A 2WLZA 4N9EA 1I60A 1TX0A 5HULA 1VPQA 3MJMA 2GGHA 1UR9A 4H7CA 4LUYA 4N6EA 4AG0A 4AB4A 1IIHA 4AHPA 4ACZA 2QIIA 1DWFM 4KS0A 3ARVA 3IJ9A 3GXTA 3W2UA 3NURA 1VHNA 2BNJA 3RO6A 4Z2HA 2OT0A 1DWHM 4XO7A 3W7LA 2PA6A 1W1B1 4AZ5A 5C7VA 4F40A 3HG3A 2WV8A 4IP5A 1O66A 1KGWA 1Z6KA 3AXIA 2E68A 4EWND 1XFCA 4Q8TA 1V6WA 3DEQA 4B3LA 3A5FA 1PDZA 4GE8A 4C6CA 2RAGA 4INFA 3L66A 2WSRA 2WPGA 2CXEA 2ALDA 1DWAM 3EDFA 3HGJA 3KZPA 2A5HA 3TTEA 1C8VA 2PDCA 3P93A 3QZEA 4NF7A 1DJWA 3AROA 3S5YA 4MB5A 4RNFA 4A6GA 1AQMA 5K3VA 3E5BA 3BAIA 3DFTA 1FHLA 3G1HA 3DFOA 1Q7MA 1IEVA 1UR1A 1XIFA 2Q8XA 3P84A 1FQ0A 4E4PA 3PFRA 1UR2A 1FH7A 5HNUA 2ZADA 2A6LA 2ZUMA 1BLIA 4Q33A 1TA3B 4CNSA 5AHLA 3CO8A 1UC5A 3T0DA 4K6AA 3UZYA 1R3VA 3U2CA 3ZOAA 1SQ7A 5I3HA 3URQA 2P8CA 4ZO7A 3UGVA 4DZAA 4FHAA 1EH9A 4EOUA 1GJPA 2R24A 3SY5A 2G37A 1XLEA 2DT1A 4KH2A 2DSZA 1GW1A 3QR1A 4PUNA 3DUGA 3SGUA 4KCWA 4FEZA 3Q2DA 4LNCA 3MP5A 2DDXA 3WNOA 4CVWA 1TV5A 4WQ6A 3QY7A 2OQLA 2QJNA 3IIOA 1WDDA 5JMUA 4U28A 2EF9A 1VIZA 2OQHA 4GISA 3WF2A 3PG8A 5BRQA 1EFZA 5CC6A 3KCLA 4F3HA 1W1VA 1QDSA 2VZSA 1JPIA 4D6HA 3WF3A 1G7UA 3PWAA 4CGTA 2PP0A 1EP3A 4UCGA 2NQHA 4I6VA 2JF6A 1W54A 3SN0A 3IJ6A 1THFD 4CNTA 3LNMA 4I5UA 3LCFA 3R58A 1XH1A 3MVIA 3UEQA 2C1IA 2DVTA 1JCXA 4JOMA 2DH2A 4UXDA 4M1RA 4D6CA 1MSSA 3MV01 1CXHA 3G6MA 4GQBA 1JYWA 3PWIA 4E2OA 3VIKA 4US5D 3VDBA 4YTTA 1HNYA 5I00A 2PWUA 1KBIA 4JYEA 5G2HA 1KD0A 3TV8A 1PV8A 2YYTA 3TEVA 4G2DA 3GHSA 2PTXA 2GDVA 4C1NB 2ZZ6A 2FVMA 4PC8A 1PB0A 3L5MA 4NX5A 1L2UA 2CPUA 1P7TA 2BY1A 2X2YA 2ZRXA 3NPVA 4L6HA 4DIAA 5I24A 3S2NA 3GH7A 2ISFA 5JIPA 1CI1A 2VR5A 5D30A 1KXHA 3P0XA 1FCUA 2YR1A 1Z9AA 3ZYZA 3QLLA 4LFYA 5AHMA 2QCMA 3S5SA 4WXZA 4O8RA 3LXAA 4ICCX 4IGMA 3RJXA 3L2MA 1OYAA 4GI4A 1QOQA 4YHGA 4WY0F 3PTMA 5JBFA 4CLMA 1LOSA 5HDRA 1TWSA 3CEPA 3RLVA 2AAAA 3OJGA 3W2LA 1YXCA 2EGZA 3PZIA 4BHYA 3GNNA 3K8LA 4RZ6A 1EWEA 2W62A 3DERA 4OFCA 5LGZA 3KVJA 5T26A 4H9TA 3W7QA 5FSEC 3LTSA 1JZ2A 4GJJA 3T40A 4IPNB 4GIAA 4LYKA 3UZZA 1E56A 1RY8A 4UOJA 4Y9AA 1XW8A 3AXMA 4JX5A 3SGZA 3UF9A 1VEPA 4UTUA 2MNRA 4LU0A 3WF0A 4IGHA 2WVUA 2OGJA 4LY4A 4PB4A 3IV3A 1W1PA 2DFAA 3GG1A 4FR1A 2I14A 2NQ9A 5HPOA 3W81A 4G6CA 1X6NA 3PUEA 4V27A 3LERA 2ZZ7A 3BLKA 2Z4GA 2PGFA 3CH9A 5ABTA 5FJJA 5DCBA 1KRCC 1A5BA 1ONEA 5FL0A 2PLMA 1OIMA 2VGGA 3TLLA 2J27A 4N9CA 3S1GA 1GONA 3VKJA 3ARZA 3H6OA 4NZFA 1I1XA 1FDYA 2XVLA 3LI1A 4ZQMA 2PCQA 1A5KC 1YLVA 5TBOA 2OZ0A 3T9PA 2Z1KA 2QS8A 1TG7A 1BSIA 1R7OA 4G7EA 1HGYA 4LAMA 2IS7A 2O9OA 5FEWA 3DGBA 2Y85A 3AHYA 3E0WA 1DWJM 1QW9A 2ZDSA 1EJWC 3UXKA 1ZAIA 1ZJAA 2FZDA 1ZLPA 1UPPA 1CB2A 5MKGA 3G3MA 3LU2A 2QCDA 1S1PA 2XM1A 2EPKX 3IJDA 1OY0A 4MPKA 2DIKA 1V6VA 4B5XA 2V81A 4FB7A 1IXPA 3C61A 4O8AA 4F79A 3E0IA 3MP4A 2F6UA 1SO6A 2EXOA 4NZ1A 2R91A 3TQ0A 1TV4A 2X2GA 1F8MA 4XISA 5A8QA 1GEHA 1VBRA 3WJSA 3R0UA 2FMNA 1WAWA 5DX7A 4IPLA 2W27A 3PF3A 4F0SA 1U1HA 1GOIA 1J0IA 4IPJA 1WQ5A 2YFOA 4NJJA 3SRFA 2VCCA 4AXKA 4YTUA 4TUFA 3G1XA 3BOFA 1VGAA 4Z1AA 3IVTA 1TPB1 1VJSA 1SO4A 5C7HA 4AEEA 5ABFA 2CLEA 1GK8A 1BTCA 3CQKA 5CEWA 1WOBA 2AQOA 3MMDA 3OZYA 4ZEPA 1OGSA 2CHNA 2GPTA 3QRHA 3WK1A 4O19A 3PZGA 3Q67A 3QV8A 5G5IA 1Q2RA 1W37A 5EYWA 3KE0A 2TRSA 1K9TA 2BHYA 4ZENA 2Z1SA 3NL3A 1Q4WA 3ABQA 4NNBA 3VDHA 3ZJKA 5CJ5A 2R14A 3H54A 3LNPA 2VURA 3UVIA 1MUMA 2X1TA 1QK2A 1H1NA 1LG2A 4GH3A 4JTAA 5G2IA 3PTKA 4LRTA 4XZHA 3GU2A 4QAWA 3VABA 3BJTA 4NI3A 1TPEA 4IFOA 1YTEA 3AQUA 1UZ1A 1DIEA 1P4CA 1XPGA 3TOYA 2ZVIA 2QCNA 5GQBA 4O11A 3UW6A 1A3HA 1F05A 2XH4A 4M6QA 5BXTA 3T8LA 1UKSA 2ZUTA 5D8ZA 3L2LA 1E40A 1HN1A 3NZPA 3V36A 3JZEA 2X0SA 2OO0A 3FEQA 4MNKA 2UZ9A 2DSVA 4K8HA 4PB3A 1YEYA 1UB3A 3AALA 4Q8WA 3QF0A 3WDQA 3WLQA 3VVGA 1UWUA 1V3KA 3Q37A 2G96A 2ICSA 3ZSTA 1JI2A 3C0QA 3ARSA 2W67A 3ABRA 6REQA 4KRUA 4L61A 4E6MA 1R47A 1BXBA 1OCJA 4R7OA 2BV9A 4QJ1A 2OYLA 3MCNA 3I7RA 1D7KA 4ZXOA 3WK2A 4MWAB 2WSKA 4OIFA 1MFVA 1X6LA 2A79A 1XP3A 3CGTA 3HMCA 3H2OA 3B8DA 3F5KA 1IE7C 5D2XA 2PTDA 1SU5A 1RQBA 3V4BA 3AJXA 4H7VA 1F2JA 1B3ZA 3GXPA 4TIMA 1IGSA 2IPWA 3ONBA 3U3HA 1H7WA 1CXKA 3AIRA 2E4TA 4NKCA 3GYCA 2PDMA 2Z6JA 1J0ZA 1Z7AA 1ZU8A 3IPWA 5BNKA 3RITA 4MM1A 4PRWA 1R30A 1OFRA 2DW6A 3WJXA 4WKFA 5ABEA 3I65A 1M41A 3WMBA 5K4XA 4JTHA 2BFGA 3C5QA 3G1AA 2Y4SA 3T0TA 3QV7A 2VVNA 4DHGA 4J5NA 1JQVA 2VQUA 1TQJA 5AY7A 1FKXA 3TLQA 2ZDRA 3VTRA 2MUCA 2W92A 4MYAA 1QNSA 1LL6A 1T8XA 3SBFA 1VIWA 1XYZA 4I8YA 1Q66A 3WMLA 5C71A 5HJXA 1W1YA 3LDVA 2C0HA 4CU6A 4WGXA 1XSIA 5CSSA 3NOYA 2IMRA 3LPFA 1UD3A 5HWMA 3TU9A 2PU1A 4JIIX 3BW3A 5AC6A 1WDRA 2GYIA 3NPWA 4S39A 4TQTA 4XAPA 3N2CA 1KCLA 2ISVA 2R1NA 2Z6IA 1T41A 1XCXA 3LPPA 1RPKA 1BF2A 2BXVA 4F2BA 1M6JA 3QM3A 2OX1A 2G3NA 4UQEA 3EWYA 1E3ZA 4AX6A 1H50A 6TIMA 1W1IE 1W5OA 2YDQA 2ZX7A 2PD9A 4DUXA 4KW2A 4WY0A 1Y5XA 1YNQA 4FNUA 1US0A 4GX9A 3LCGA 4B5UA 1BVZA 2CZ5A 4UFJA 3P14A 3GHTA 3WLPA 2IUZA 1EB3A 4IMCA 3W6MA 6CGTA 2YYUA 3EOLA 4JX4A 5G4EA 3VIPA 4OUIA 5J5DA 3CV2A 4XSMA 1I0BA 4U5IA 4H2CA 1R9ZA 5FEPA 1FBAA 3VKKA 1FHUA 1C91A 2WPBA 1G7VA 1E6ZA 3BL3A 1NWSA 4PMQA 3OTRA 4AD3A 2GFTA 1JYXA 1MWOA 2ZUSA 1LLWA 1DE5A 3LXCA 2I16A 3OVRA 3TOPA 2PGRA 3ARWA 4HBKA 5CGMA 2WHLA 2VO5A 4GJIA 3OA5A 3DGRA 1OD0A 1E1EA 5I3DA 1SSGA 4UFMA 3E3HA 1S1RA 1PZ0A 1NP0A 3K8MA 2XIJA 1IWAA 3DESA 3SCOA 4I5RA 1J0JA 1K8YA 3RJYA 1TUFA 1ZP3A 4RXGA 1R3QA 3GKFA 1MMFA 3AOFA 4AXNA 4KBXA 3GH4A 1PZ2A 4W87A 3R12A 1Z3NA 3W83A 4OOZA 2FZ9A 2X1UA 2RUSA 7REQB 4AD1A 1S38A 4XAFA 1EXPA 1JL8A 2AL2A 2E9BA 4UFLA 5KZ6A 1RAKA 1X8FA 1F7BA 2A3LA 4ZFCA 1XCWA 2J7DA 3MMTA 4O1CA 1V3IA 2D0HA 2I7GA 3APGA 4MY8A 1TB3A 3A21A 1TREA 1HJQA 5CPLA 4UNIA 3ITVA 1E5NA 4QBXA 2BXZA 1ZAHA 1R3WA 1PUDA 1B3OA 4Q4PA 4E5TA 1KO0A 4UTLA 3TYCA 5M3WA 2I5GA 2G5WA 1HJXA 2QUTA 3LCIA 4H9MA 3WLKX 4LW7A 3QSRA 2Y70A 3WY1A 2CZEA 2VMFA 1PTDA 2V9DA 1FP8A 4UUIA 3S2LA 1NFGA 3W82A 1ZGDA 4JY9A 3KWXA 2Y8VA 1V6TA 3CS2A 5HAOA 4TTGA 1TR9A 2E8ZA 2P1FA 4ILSA 4WLCA 4R9OA 1X39A 5MHBA 3W86A 4DO5A 1OGBA 1AJ0A 1E1CB 2F84A 2ZX5A 4ZQOA 1JAEA 5EU9A 3TH6A 3WD1A 1QI3A 2ZUNA 4XZMX 4B9YA 2YDSA 1EDQA 2FGLA 4MWAA 1G1YA 3G77A 2ASHA 1V02E 3M6YA 1Q6FA 1MI3A 4D6FA 1OABA 1H1ZA 1XS2A 2CNCA 4BZYA 3WQFA 3VCRA 2ZA2A 3WBAA 3L2IA 5IDZA 3EWCA 5DANA 1J11A 1R2RA 4A3QA 4FOJA 4QDMA 3UNTA 3S3GA 1E4LA 3BMVA 1TPFA 1KBKA 4GZ7A 1FWSA 1LCOA 1QWGA 3P62A 3S1WA 2ZXDA 4CUCA 4FP1A 1H7RA 1CGXA 1SFJA 2O7QA 4WOZA 1MEHA 3NQFA 3WLSA 3SUSA 3VIGA 3CL7A 1PX4A 3A3WA 3UJSA 3IV8A 3VXGA 1J2WA 4FMVA 4W5ZA 2SFPA 1WZLA 1RVKA 4X2RA 2J47A 2XFRA 4UZSA 1KW1A 3RR1A 1SJDA 2FTWA 3WJYA 4PMZA 3W7HA 4ZQRA 2X8RA 5BU9A 4AZ6A 2IQTA 3LN3A 3UG5A 5C9UA 3EWWA 3LI0A 2X42A 5A2AA 5AOUA 1WBJA 1QPNA 1I2QA 4GCXA 4PA8A 9XIMA 3QQWA 2CLPA 3GZ3A 3MQTA 2PZ0A 3BCFA 3KBSA 4O0QA 5DXXA 3EA1A 4FLRA 3NM1A 2WCGA 1UZHA 1B54A 1LTDA 1E55A 4W8LA 3GW0A 4DJFC 1L6YA 3F2CA 4H8VA 1OC5A 2WSPA 3ZLFA 3TJIA 3S5OA 3O6CA 1G4SA 1S5NA 3NIYA 4Z2IA 1VRXA 3WNPA 1W2PA 4BR1A 1FVPA 3SCPA 4ADSA 4IH3A 1F3XA 3MO7A 4QTGA 1UOZA 4XKYB 1SW0A 4WD0A 1QJWA 3CC1A 2RJGA 2EG6A 2Q3OA 2OJPA 4IICA 3BO9A 4X0NA 3XINA 3TR9A 3SM0A 4JFSA 2J8FA 4P7RA 2BBFA 3BARA 2TMDA 2J7HA 3CIWA 4DUOA 1F9CA 1UG6A 2BDQA 1Z41A 2WLYA 1Q4NX 4WHBA 4C6OA 7XIMA 2AGKA 1OQFA 4ORMA 3W25A 3T6CA 4E38A 2XZ7A 3NL2A 1LBFA 1PHWA 4E3VA 5K7JA 2HVNA 1E9YB 5CPNA 4PUJA 3QKZA 2D2JA 3FDGA 4N02A 1A53A 4JIPA 3KTSA 4AYGA 2CU0A 4GINA 2ZWZA 3E02A 1ISYA 1ADOA 1CTNA 5DBTA 4WZHA 1J93A 1RLDA 3IVSA 4GK8A 2AAMA 4D8AA 2PCEA 1SFTA 3FA4A 3U4AA 2NV9A 3UG3A 4ATDA 2OCZA 2ZTJA 4HU3A 4BEUA 3QSTA 4F2TA 4IJBA 4HA4A 1HFBA 4E3TA 1AQ0A 4CQBA 1XH2A 5CGQA 4RE3A 4PCFA 2VGIA 1QUMA 1UA7A 1ONWA 1QPQA 3QGAC 3AS2A 1OF6A 1A0CA 1M7JA 3BAYA 2VZVA 2FB3A 3CBWA 1DJIA 3SEPA 3UXDA 1K6AA 3JW7A 4UMCA 1HW6A 1ZFJA 6PTDA 4U10A 1FFQA 2ZICA 4DZHA 4PL1A 2WNQA 1EJUC 2R9RA 2NWSA 2DT2A 4LC6A 3W76A 1TPDA 4N4PA 3SQLA 1PHQA 2QCLA 4I3GA 2QPSA 3FEMA 3TE9A 4QJ4B 3WYZA 3STGA 4JKLA 2VFFA 2YXXA 1CLVA 4BY3A 2Q6ZA 1NAL1 4G1NA 1P6WA 2E40A 1DQXA 2X09A 2WWDA 3MDUA 5HPCA 1J5TA 4WUIA 4KCTA 5A69A 3W26A 4DBUA 3ZSSA 3R0KA 3N73A 1XGDA 4H6QA 4XVEA 3W2JA 3IACA 1BSLA 5A6TC 1W91A 1WZAA 4P8XA 3W29A 4EKJA 2WVVA 5G2WA 2XVPA 4H8HA 3KOXA 3K1DA 4DZIA 2QV5A 4JCLA 3DZ1A 3RMJA 2RH9A 6REQB 1SM9A 2YB4A 2PDLA 1B90A 2PTZA 2YXOA 3IJ8A 1M01A 1YNYA 4YMZA 2ONEA 5CAHA 3LMZA 2JALA 2FZ8A 3S6DA 5D9PA 4Q8MA 5CC7A 3SCNA 2PWGA 1GYMA 4JTRA 4DM1A 5I23A 1V3MA 3W88A 4Q4SA 3GIYA 1RQEA 1IEXA 3CNYA 4MDOA 4Q32A 3CAWA 1WKFA 1HT6A 4M6VA 3WQVA 4KMQA 3TONA 3EEZA 3DI0A 4G5DA 4PMDA 5CZKA 1KKRA 1S46A 2P8BA 2HDJA 1UYQA 1SVDA 1UKOA 3GXNA 3MSYA 3IIXA 3GVRA 2QT3A 1FA2A 3PY2A 2JQXA 3VZZA 4Q6JA 1QTWA 5AN7A 3V3WA 1GVIA 2NX3A 3OIHA 1NOUA 1FWAC 3EXRA 4IJCA 3AIUA 3WENA 3QOKA 2YBUA 1O6IA 1MW0A 3DIPA 1VHCA 3M64A 2NXIA 1QNQA 2XN2A 1Q6LA 4DF2A 2J6VA 1F4HA 3F5JA 3UYIA 3G1DA 4FSAA 2XG9A 1KM6A 1IT0A 2PDHA 2H9AB 2MANA 2NQJA 4CU7A 3QLDA 3WCZA 4I7WA 5J8LA 1TR1A 1R3YA 1VCVA 4ALDA 3NYDA 2V2CA 5C6MA 3IGSA 4ZGYA 4LALA 2XSBA 2VRQA 4I90A 3W1QA 1IYXA 3VD5A 3OYXA 2V2HA 1G4PA 2XGZA 4HNVA 1XC6A 3FOKA 5AYZA 4ROQA 3GC2A 4J3WA 5EMMA 2RKXA 3QZ6A 1R2TA 5DEZA 1XIHA 1LRTA 2OMAA 1F6PA 2ZWYA 4GI8A 3ISIX 4HMEA 1J5SA 1XIMA 4IPIA 4AWTA 3K4AA 4A3HA 2WMKA 2Y88A 3MB9A 1YE6A 3IEBA 4O53A 4DAFA 1R9XA 3FJ4A 5BRPA 5JH1A 2A3CA 1BEUA 4NNCA 5HINA 3VK5A 9CGTA 4RPPA 5F4SA 3FS2A 2GGIA 5ECUA 5D33A 1ME8A 3B40A 3SRKA 1WKYA 1M3UA 4TR9A 3FV9A 2ZX9A 1PL9A 5FI8A 3HFYA 1Q5MA 3II1A 2E5BA 3OVPA 4UFIA 3LM3A 3W72A 1DP0A 1HG3A 4HA1A 4IPPA 2WMIA 2J7BA 3DCPA 5D9MA 4LAZA 8CGTA 1VQTA 3CPGA 3VX0A 3SCTA 3AIEA 1W5MA 3UD6A 1FWRA 2CXGA 4K8EA 2P0OA 4KCVA 4BJHA 2C13A 4LYQA 1ZPTA 3DBNA 2XH2A 1V79A 2GVJA 4LF1A 1OF8A 2OSXA 2PBGA 4IP7A 1JDFA 2E6FA 2HK1A 4WR3A 1KBBA 2BVTA 2Q8ZA 4MB3A 1E0XA 4L4LA 3N6QA 1F3TA 2D0FA 4ZZ9A 1RCQA 3BGJA 3AS3A 3ERPA 1VEMA 2QAFA 3H21A 3CWOX 3K1GA 3ALFA 2OEKA 1NDYA 3PK7A 3BPWA 3O7UA 3B8TA 2CZFA 2G41A 4AMCA 1PZ3A 3H2FA 4X3ZA 2E77A 1DJYA 3UA3A 1XD1A 5EL1A 4LBUA 1BG9A 3WDJA 3LRKA 3OZPA 1DQWA 4GYPC 3ZLHA 3QXBA 4J3ZA 1LDCA 4DJEC 1GKQA 4MOZA 1NTHA 1DOSA 1OK4A 2EPMX 3PULA 1NARA 3WH8A 3DECA 4JFWA 2XZ9A 1LYXA 2EKGA 4EF9A 1K7FA 1DEDA 2QYGA 4OU1A 5G1TA 3RX4A 2ZC8A 3E2SA 1ME7A 1JVNA 3G3DA 2B4GA 3M7WA 3RCYA 3SN4A 2C91A 2B7QA 3QJAA 3LPOA 3PHAA 2NWRA 5BZAA 1Q8JA 1XPYA 4QX4A 4C5YA 2W6RA 2HMCA 4B9ZA 2NQLA 3KBVA 4JNMA 1XDJA 1OM0A 4LYPA 1EF2A 2Y7DA 3C8NA 1VENA 1J6PA 1CB7B 1XC4A 2NV1A 3EOEA 2ZVRA 4NJHA 1QI4A 1PKMA 4CEUC 3COTA 1CXFA 4UMBA 2BTMA 2PDYA 4GXMA 4QQUA 4E0CA 3VZXA 2H3DA 1O5KA 2Z1XA 3LCXA 4RDZA 4LUTB 1GTEA 3G1VA 1C90A 3UG8A 3QHOA 1NOFA 2QR6A 3BW4A 3N14A 1NFBA 3LS9A 2BY0A 2LLEA 3NQGA 1UKTA 4MJ2A 3OP2A 4YN5A 5FJPA 2HNEA 3MT1A 2Y7EA 3KRBA 4NRSA 1HL2A 3G6LA 1CGTA 1H4PA 1SGJA 3NCOA 3ABSA 3APTA 1ZAJA 2W66A 3LOTA 5FF7A 3U4FA 5C9XA 3DBPA 2DJXA 2F9RA 5F2IA 3W1MA 5HWJA 3MW7A 3W1NA 3UY8A 2G0WA 1TSIA 1H11A 2GVYA 4NJGA 3S83A 4ZBCA 2WC3A 3QR3A 2ISSA 5DY3A 4B92A 4O12A 3NAVA 1B3VA 2AL2B 1JG9A 3OW1A 3RUBL 4ICMA 1IWPA 3IJQA 1YIXA 2GJNA 4QSHA 1CENA 4UR9A 4FI4A 4AAJA 1EKOA 4ZQPA 4FO4A 4I9TA 4MNMA 3T78A 4C65A 1WDQA 2J25A 1T8QA 5U7SA 3ZIZA 3R8HA 3KZSA 4PFHA 3FAXA 1NVMA 1VBGA 4BWLA 2BGQA 2C1GA 4B15A 4HVXA 3VD7A 1R87A 2QJMA 1XBZA 3SDOA 4BI5A 3P80A 5FJTA 4DI9A 4JNYA 4HZ7A 3WUGA 4JDBA 3LYEA 4ZE4A 3WEMA 1TELA 3KTXA 2DQWA 1JCTA 4AQLA 1V02A 3BV7A 3INPA 3S2CA 1QPKA 3LPGA 1TV3A 4W89A 1V77A 1J4EA 2B31A 1M9HA 1OINA 1UBSA 1XBVA 1QRQA 2JGQA 4UTTA 2QCGA 3WBYA 4HTYA 3M0KA 2C71A 3HQPA 1UA3A 4J3VA 1L8PA 1V08A 3VNIA 3CV7A 3H2MA 5A3HA 5I7GA 3L67A 3EB3A 4CCCA 2VEKA 1ISVA 3GUWA 3L4WA 3IIVA 5JU6A 4DBDA 4R9XA 3GBEA 1I8JA 3THUA 3PBYA 4LBSA 1TV8A 2VEGA 2E6AA 1MZHA 2ZC1A 2REQB 3AZRA 1TCDA 2X40A 3W75A 5HJYA 3LCWA 1FRBA 1V6UA 1ZJHA 2FTYA 4ECLA 5C54A 2JKPA 4Q22A 2OGYA 1TMLA 1PCKA 3GNPA 1QHOA 3S6OA 4HCHA 1E3XA 5HMEA 3RNDA 5TAOA 2RDTA 3OG2A 1XDLA 3MVTA 3KBJA 3ATYA 3SADA 3IIPA 4LAOA 1FDZA 2Q71A 4UQDA 3GFXA 4NAEB 4K2SA 4ACYA 1AJ2A 1C8XA 5JXQA 5K2ZA 4LAUA 4AIBA 2QJIA 4MAVA 1J18A 2CBJA 2J7GA 2WW5A 1A50A 1XM3A 2JE8A 2GK1A 1R3RA 3O2LA 1XRFA 3DYOA 4Z2GA 2A7RA 4HZ8A 4PB5A 1ZL1A 1UMYA 5LIWX 3LBCA 3WLOA 1EJSC 2OSWA 4NZ5A 3ZVIA 2WCSA 4PTNA 5H8PA 3P7YA 4FNQA 2I17A 2QUNA 4YPJA 4C1LA 2CLMA 2D2HA 4JDYA 4MWAC 3GDTA 4FK9A 4MG4A 2PGWA 1GOOA 2PRHA 1J0KA 3R11A 3KHJA 2BZNA 4LUSA 2NV2A 3PPFA 3KL3A 4JN8A 1WO2A 4MUPA 3B97A 3T8QA 4HCLA 3W0KA 1JZ6A 3B9NA 1E0UA 3VOFA 4R33A 4XZBA 2V3GA 3RPDA 2W63A 4FOKA 1WZKA 5HUPA 3O6AA 2EPOA 4L80A 5LHEA 1EEPA 2QZRA 2G3FA 1X8CA 4CQ8A 3TSMA 3UGRA 3R25A 3T07A 3CEUA 5I3JA 3WSUA 2F8QA 3CPUA 4AIEA 4MMWA 2J7FA 1LT7A 3CPRA 3B0PA 3JZUA 3TUUA 5LNUA 1H7NA 2PWHA 2JF7A 3GAYA 3L0NA 2DIEA 5HA7A 1C93A 1XYLA 1L6SA 4LVDA 2PWVA 3QV9A 3KWSA 3GXFA 1XIGA 4IQLA 1I2PA 3VINA 3UQNA 3NDZA 3SR7A 1S2UA 4NAFB 1GT8A 2QULA 2J78A 4C6EA 2G4FA 1I9CB 3GR7A 4IG2A 2QJJA 1AK5A 3S2MA 2ABAA 1CGWA 1R38A 3OVQA 3UVAA 4M29A 3SCRA 3T4CA 1KM5A 1MEIA 4HPXA 2GQ9A 1XRTA 2OTDA 1RH9A 3GDLA 5M5DA 4IGNA 4DBSA 3E0LA 3MZNA 2X7VA 2I9EA 2JGYA 3IUHA 2WMJA 4UFKA 1GEQA 3HPFA 3C2RA 1FFRA 1GVEA 1Y65A 1RJPA 4LQ1A 3GYEA 3D5HA 4H00A 1XD0A 4R34A 4IG2B 3A13A 2I1OA 1J2BA 4EE9A 3CT2A 3WUEA 3PZTA 3RN6A 3IAQA 2HCVA 1NDZA 1UWIA 4S3CA 1H60A 3VD3A 2IW0A 2ZOXA 3KDNA 2QAPA 3NQAA 2FPYA 4DAIA 3FVDA 2CEQA 2WAGA 5BU6A 3UA4A 5H8UA 4WSKA 2WNZA 4MLRA 3W7DA 3BG5A 3S1XA 3M5XA 5CAKA 3B05A 3VKBA 3G0UA 3HGSA 1RSCA 2PGEA 2V6AA 3GU9A 3C86A 4S3EA 4JTDA 5MF5A 2Y5JA 3A6OA 2DZTA 5MKGB 3MUXA 2Z7GA 3BCJA 2WSYA 1GZ1A 1DJGA 5LIUX 3D3AA 4M24A 2GJLA 2ZRZA 3M9YA 3VNKA 4GQGA 1VFOA 2VDGA 4DO6A 1O95A 1W1A1 1QPRA 2J79A 4B2DA 1UWSA 3TK7A 2V68A 2BXYA 5DBUA 2OELA 1QOPA 3V1HA 4B5VA 3TAOA 1AUSL 3M47A 3KOZA 3M41A 2F2KA 4W5UA 1EPXA 3OGRA 4W88A 4H7ZA 3QYQA 3SAZA 2PLKA 1Z89A 3TJLA 4IIHA 4A22A 1KFJA 2BMBA 1KFCA 5CSYA 4WY0B 3KFTA 3H4WA 2AMGA 3E0VA 3KXQA 2P10A 4GGBA 3F4NA 1JEZA 3SRHA 1S2VA 4JTLA 3M0ZA 5DRCA 2VT0A 1JIBA 2OX4A 5EMYA 1IEIA 2O9PA 3BTNA 2VZTA 4JD4A 1EBHA 2QF8A 3U5UA 2BVWA 1E6XM 1RA5A 4XO6A 1U5JA 4Z1YA 3Q4DA 3CU2A 1GCYA 1SPQA 1H1YA 2WKJA 5SWUA 3AMLA 3WQEA 3BV4A 2D22A 4JQ4A 3JU2A 3A23A 1FCQA 3NQBA 3PJTA 4IMGA 4YJ5A 4KWWA 4GVHA 4FOUA 3WH6A 1ZCCA 3CUZA 5A1AA 4JIEA 1I2NA 2W3ZA 3JR2A 4PMNA 4A8IA 1W8SA 1OB0A 4DELA 4UQ9A 4C7FA 4QJ3B 2WZIA 1EC7A 1MXDA 5F4WA 2QUVA 1LUCA 4YTSA 5L9FA 2GGEA 4XIAA 2X7WA 2PAJA 3LB0A 3BZJA 4F9DA 3R6IA 2Y2WA 4GQRA 3HG5A 1TE6A 1CLKA 1ONRA 4XUYA 5F2MA 4YVXA 4U33A 2A2IA 4QG8A 2NVDA 4KT2A 1WP6A 3QQ1A 4NAEA 3OQEA 5T91A 1XQKA 3GXIA 5AYYA 4HMDA 3L23A 4UTIA 1KQZA 3C52A 2F2HA 4MB4A 4BF9A 3H2EA 1TTQA 4E2VA 3LA4A 2PWEA 4EANA 3C2EA 1WYIA 1TWDA 1U5VA 3CIVA 4RDWA 1VJZA 4UOQA 2Z25A 3AIVA 2QMKA 4UQBA 1GZJA 1E6PA 2FHBA 1IXNA 2C3ZA 3XISA 2VFGA 1YPIA 4RE2A 5DF0A 3W7MA 3O06A 1PYFA 3GFZA 1Q6OA 3IWPA 1QHPA 3NPUA 1UPMB 1UBPC 4LSBA 4QQ3A 4IUGA 4LVFA 3N18A 5LKYA 1WOAA 4FR6A 2PUZA 4J40A 1HKKA 1FWBC 1XIJA 3CQHA 2O9RA 3LZ5A 4FIQA 4W7VA 2XINA 3SECA 4PBGA 4GBDA 3VGEA 1H61A 1PJ9A 3ITYA 1ITXA 3GC5A 1U33A 4EIVA 3NQEA 3OO2A 1OZQA 3RRAA 4O50A 3MPGA 2BB0A 4X61A 3HQ1A 3TW9A 4RKAA 3ZR5A 2PDJA 1MXSA 4V33A 3VFLA 4Q4MA 3V5FA 2CHOA 5CCZA 1P43A 1IHIA 1FX6A 3NOEA 1XH0A 3F1QA 4QEHA 3GNOA 3UWZA 4K68A 2CBIA 3T09A 3IS4A 1S3HA 4KCUA 1RZMA 4MWAD 3TTYA 4LCSA 1VFHA 1OCQA 3BAJA 3KHDA 3M07A 1PWMA 3GBDA 4Q3MA 4NJIA 1S2AA 1QK0A 1OT1A 4FF5A 2CC0A 2X30A 5KETA 5M17A 1V0NA 1YMYA 4ZOEA 1W32A 3GUGA 1YPXA 2J74A 3KRZA 3CB3A 3NFUA 4HYWA 3TJXA 3QTGA 3O16A 4B90A 4UTJA 1B9ZA 3C2OA 2UBPC 3N4EA 3CQ0A 3E96A 3VGGA 3LUTA 3R10A 4DLMA 5I06A 3RGTA 5CH9A 5A6MA 1W3IA 2R1KA 2C14A 3QPZA 3UU0A 3VDCA 3W2KA 5HOSA 3BG3A 4RZ5A 1VF8A 4AYSA 3VGHA 4UTTC 1TPUA 3LV5A 2NQZA 1J6OA 3VGBA 1RVGA 2YA1A 5FJRA 4DY1A 4YL2A 1JAKA 3SUVA 1WDSA 2P76A 2ZA1A 3HZ3A 1LF1A 1M68A 2PBOA 3PFMA 9XIAA 3F2BA 3WLNA 2J62A 3VU2A 4WJXA 4JL2A 5FSDC 2CCRA 4TMCA 2J9ZA 1L6WA 2HBVA 3LRLA 5FIPA 5ECVA 2G4JA 4Q8UA 3UWVA 4L1GA 1K1DA 3VA8A 3MV11 3W84A 4CN1A 1IZKA 1A80A 4QE4A 2V5CA 1JCJA 2WO5A 2G8ZA 2O0TA 4RV8A 3C6CA 2WNNA 4Z1BA 3TCEA 1W5QA 1MQRA 3GK0A 4UTMA 5E1QA 3ZM8A 1OADA 2J4GA 3KOYA 5BOFA 2OPJA 4J35A 2AOSA 4DXVA 1R6WA 1TX2A 1UZ4A 4V1YA 1LRQA 3N3TA 3NQ8A 1KCZA 4UIOA 4LAKA 3LHUA 5BMXA 1C29A 5DELA 3WLMA 3V0UA 3EPOA 2B7NA 2VCBA 1BYBA 3OGVA 4I5XA 1HKIA 4JTQA 3ARYA 1GTHA 4NIRA 4QROA 1O5XA 4IIBA 4MIMA 4K37A 2YGYA 2XM2A 1YYAA 2ZRUA 3CQJA 4G7EB 4FXRA 1GJUA 4C5ZA 3NM3A 3HG2A 1DJZA 5BXSA 3A22A 3UG4A 3WQ6A 1IXQA 3FGCA 4OZOA 1FOBA 2Z27A 1MDRA 3CUHA 4YNGA 4DBEA 1G0CA 4FA3A 4D72A 1IZCA 3GM8A 4B91A 1XLHA 1VBUA 2W0UA 3E49A 1QATA 1Q8AA 2HTMA 2DSKA 1XUZA 3GAKA 4XAZA 3FW6A 4J1OA 1Y5VA 2VC5A 3VGFA 1LORA 2X16A 2V2DA 1S3TC 1SJAA 3ANVA 3EKZA 1WZMA 2H8XA 5XINA 1ZHAA 1CEOA 3L4YA 4GIRA 5KEZA 4HSNA 2WK2A 1XGZA 4MNJA 2Z00A 3PPGA 1HJUA 1QASA 1E1FA 1TO3A 5DMLA 2OODA 4BS0A 4Q4RA 4BK9A 3LCLA 2BS9A 5EBAA 3CIXA 1TZ7A 3DC8A 3NR0A 2VHLA 3GTIA 4HHHA 1IR1A 2XFYA 4EXAA 4OE7A 4KWVA 4FNRA 4F0LA 4PTXA 2Z0IA 4JGDA 1PCWA 4OWGA 4FXFA 3NPXA 5M2FX 1MRQA 2Y0FA 2A4AA 4F0RA 4PULA 1P0KA 1AODA 4QHRA 1JR1A 4GCAA 3VPLA 4NG3A 3TKFA 3TA6A 1E6SM 3CUXA 4KFOA 3TC3A 3L4ZA 7ENLA 4RNIA 3EWXA 1S2TA 1N8WA 1UASA 1YDVA 4EVZA 3R89A 3VNDA 4F9JA 1XLCA 4Z2KA 5CLTA 2WJZA 5IBXC 1HP4A 1E5JA 1VFLA 5CPSA 1PX3A 1XRVA 1MUCA 3NVDA 4P7OA 3L4UA 1I2RA 2CERA 2ZZ1A 1UIPA 5DLCA 3WQPA 1BQGA 3KL0A 1E0WA 3THCA 2PDQA 4V2XA 5FEXA 3N34A 1U83A 1EOMA 1ISZA 1KR0A 1TJ0A 3C3UA 2QCCA 3N9RA 4Z0JA 3TXZA 1XX1A 3J7HA 1XHGA 3IJIA 5CPMA 4E8DA 1SSDA 4REQB 3HA1A 4O13A 3WL0A 1TQXA 1UHVA 1OCNA 1HZYA 1V3HA 1EO5A 1ZCOA 3DHDA 4Q4OA 3MHGA 4H9VA 4IMDA 3LXBA 4E4FA 4LUJA 2UY4A 4W4QA 2W91A 4RX0A 4FX8A 1GVRA 1ZS2A 3PB2A 3RF9A 2XIBA 2ACUA 3CMFA 3F4CA 4ZCWA 4DQWA 3AIWA 4XBKA 4YWSA 2RGLA 6ALDA 3GU1A 4AZIA 4DWSC 1GQLA 1KCXA 3TTQA 1NDVA 5LGXA 3H4XA 4HK5A 3LTPA 1K03A 4XB3A 3TFCA 1P1XA 3HJEA 4KQNA 4WOQA 2FZBA 3W6YA 1EDGA 3M1ZA 3H7RA 3MDWA 2CKRA 1MZRA 2ODOA 1OJXA 3ZR6A 2CLFA 3ZT6A 2BASA 2XDFA 3BGGA 3MMUA 3CZEA 5B80A 1UR0A 2R1MA 1UH3A 2ESCA 3NTYA 1XKJA 3QPYA 1XYCA 2FVKA 7CGTA 1H63A 3QR0A 3RM9A 1JZ3A 1X1ZA 3BE7A 3ITXA 5DT5A 3BC9A 3MKVA 1LWJA 3NDOA 3WDPP 4AMAA 1EJRC 2OKOA 2D69A 2E6YA 3REQA 1L0PA 1XFBA 4S3AA 1HO1A 1BYAA 2J24A 2J8GA 3EPNA 3WF4A 1B3XA 3UR7A 5AC8A 3ANYA 2CESA 2GZXA 3V5CA 4A8LA 2H6RA 1SJBA 1YDNA 1UW9A 4U2ZA 4AZGA 1EXBA 2V5DA 1TJ1A 1H0GA 4M82A 4DI8A 2C0AA 1AG1O 1POKA 3T2QA 2J9XA 5K4ZA 1KB3A 3AMKA 5F1VA 5KITA 1F07A 4PMJA 4ADTA 3PTQA 3QZAA 3RAOA 4M19A 1UR4A 3CZKA 3BQ6A 3UWQA 3U8GA 5T9CE 1BKHA 2Z7KA 1PEZA 4OUEA 3IJ7A 4POCA 3WUFA 1XI3A 1DXIA 3IIZA 4CU8A 2HWGA 4L4PA 3B8IA 3PPCA 1M04A 2YB1A 4NY2A 5A8PA 4XIMA 1KCKA 3NQ2A 3UZXA 4XD5A 1CYGA 7ODCA 3FSUA 5CZJA 4LVBA 4JTSA 2PDIA 2WCAA 1JZ8A 3I6EA 1EA9C 3JUGA 3L4VA 4HPHA 1OX6A 3TXVA 4CD8A 1GYNA 3M0VA 3U0HA 5AC4A 4P7LA 5DN1A 4S3JA 1F6YA 2PDGA 3RILA 4KKXA 4IMAA 1TVLA 3Q94A 2NSXA 3GSMA 2DGAA 3BH4A 4MSSA 4ZOBA 3DFNA 5A2CA 4GIEA 1CGYA 2E1DA 3TZNA 1C92A 4MF4A 1JUEA 1GOXA 1POJA 5G4WA 5J04A 1ONXA 1S5VA 1CXIA 1LM1A 2E5DA 1MYRA 3L7RA 3PUDA 3GVGA 3W02A 5AZ0A 2YZ5A 3TDFA 2EJAA 3CMJA 5HANA 4LGXA 3BLDA 1HKWA 4AY7A 3O8AA 1PSCA 1PBGA 1FWCC 3FSTA 1S5MA 3KTCA 1C8QA 2FH8A 3EA2A 3FDKA 4O15A 3NVTA 7PTDA 3LENA 3QFWA 2OXNA 1F3EA 3HF3A 4EF8A 4XBJA 4TU1A 4GXWA 4NT0A 3FAWA 5CG0A 1CGUA 2VYOA 4M56A 3DKJA 3B8VA 1VFMA 1XLJA 2DZBA 2D1ZA 4A2RA 1YKWA 4P8UA 3UR8A 3QTPA 2DW7A 1QBAA 2C7FA 5IRPA 5FF4A 3SW6A 2VWTA 4H9XA 3ITTA 2VX5A 4F0KA 4LANA 5F1UA 1JPMA 2KAUC 3N2XA 4N9BA 1BGAA 5DT7A 2GVEA 5GJMA 1XQLA 3B4YA 4JTJA 4HD5A 3AXHA 4OOUA 2WANA 1PWLA 2XWEA 3WH9A 3SQSA 1GHRA 4M80A 3VOGA 1W6TA 4RV3A 3ABXA 1UD2A 1UKQA 3KOWA 4P5UA 3QW3A 2DORA 3LM7A 3AJ7A 2Y8KA 4LCQA 1QXLA 2ZCGA 3TYUA 1M5WA 1NP2A 1BKSA 3K13A 3EBVA 1MVYA 4C91A 1SZNA 4US6A 4AZCB 2VR4A 4M7SA 3U2ZA 1K8ZA 1F3WA 2A3BA 3HV8A 4O4VA 4CD6A 3GDKA 3LSCA 4PN2A 2BP1A 4JX6A 5DQPA 1HKMA 1BWKA 3ES7A 3TZFA 2EHHA 4CEXC 1V7YA 3PBMA 1XYAA 5AVNA 5KZEA 4D6GA 3IGUA 4RJEA 5EMUA 2E7FA 3P8IA 5C8BB 1OG0A 1P0NA 1KRMA 4M0XA 2OWCA 1A5NC 3NG3A 4U31A 3QYSA 4PSRA 2NUYA 4I9MA 2EPLX 3NO1A 5C2XA 4HNCA 1CWYA 3M5ZA 3DFSA 1OYBA 1YXDA 5I79A 4AZHA 2ZZ2A 4RR4A 1JRCA 4Z1CA 1TRIA 2HNHA 3W1TA 2CWXA 1G4EA 4GYKA 1G01A 2OO6A 4MKSA 4NAFA 1TYGA 3T42A 2FMOA 2VZUA 3PZVA 4AF0B 3RRXA 3A9IA 4LVGA 1GNXA 4GO9A 1EP1A 4GQQA 3UCQA 3NO5A 1TVNA 3NEHA 3SCQA 1TJRA 3GDRA 3HFTA 4O1EA 3QPEA 2A6NA 2Z24A 1RXOB 1M65A 4AVNA 1P1MA 1SYTA 4DJDA 1SO3A 2VVSA 4DUVA 5ABGA 1E51A 3Q45A 2DZWA 1H41A 1ZJBA 3ZO9A 1R3TA 2R1LA 5LA0A 1X97A 3N9KA 1JXJA 2BY2A 3W1LA 3MYOA 1V4YA 1UKPA 4Q7IA 3SCVA 2WVTA 3HV9A 1QNPA 3HPXA 1WDPA 1HX0A 2ZRWA 1MW3A 1AH0A 1YDOA 4H8UA 4ONVA 4Y96A 2YXGA 3H7VA 3B9EA 5FF0A 3TWAA 3ZZ1A 3WZ0E 3QMRA 3RCNA 4BWLC 2VZOA 3V18A 3GXDA 3T0AA 3DFPA 4LUSB 2P88A 3ITLA 3HPZA 5CC3A 4GYPA 2WM1A 4X9SA 1XLKA 1NIUA 4Y9NA 1QOXA 1JJKA 2W61A 4W7WA 3K4DA 3L9CA 3W7RA 3EXSA 2VEMA 1SZFA 2Z1WA 2DUAA 1DJHA 3M5VA 3Q65A 1QW7A 3S9YA 1N2VA 3TWBA 2YA0A 1E4NA 4XAGA 1DQUA 2D2GA 3W6LA 1JQXA 3IRSA 5FJOA 1EUNA 3PB0A 3H2NA 3Q58A 5AKQA 5BXPA 5B7ZA 1ELSA 3G1FA 5I3KA 4ZQCA 2DZPA 4EPEC 1VEOA 4MNLA 3GG7A 3SUTA 1GHSA 3IK4A 3OVGA 4IXXA 3C2FA 1E6RA 1TPWA 5C9RA 3KS5A 3G1RA 3F2DA 3G0XA 3MO4A 4QAIA 3W7JA 3KLLA 1QCWA 2PSNA 1QNVA 1PE1A 4HSOA 2VWSA 3W71A 3TMLA 1GVYA 2BX7A 5REQA 4PFMA 4HJFA 3MY9A 1K6WA 1CNVA 4U4MA 4ZB5A 1Y8BA 2QPXA 1LRNA 2XVGA 1F73A 4YS1A 3MWAA 4AY1A 1SW3A 3MBFA 1YRRA 3W7EA 2VDHA 4L56A 2ACRA 2QPUA 4S3FA 5E0KA 2OYKA 2IKIA 1HF6A 1IT8A 4OV4A 1JNEA 3R2GA 1FHVA 4QDWA 3WD4A 1RBAA 3GO2A 3WUBA 3FNDA 4NUWA 3RYSA 1OIFA 1Q7ZA 2TAAA 1GG1A 1FDJA 5K9DA 3WFAA 3EZ4A 4CCZA 3M46A 1OX4A 1H5YA 1XINA 2V67A 3RU8X 4R7JA 3W53A 1GOQA 3HN3A 2QCEA 2Z26A 3R43A 1XLDA 1DVJA 4ZSTA 3PBGA 2G95A 1L6FA 4HYVA 7TIMA 5D9OA 3MS8A 4J4KA 1OT2A 1REQB 5KZMA 5KINA 4MKVA 4QS5A 3FXYA 4WDTA 4U2YA 1OFEA 5HK4A 1L2QA 2OLHA 2QVHA 3RLGA 3TYAA 3NSMA 4HPJA 5LNVA 2A21A 5FD0A 2AL1A 2XH0A 3R8RA 3ZWSA 5AYBA 3SURA 3ID7A 4D1IA 5IFTA 4UR8A 1GQIA 3DENA 3RFAA 4O1AA 2FZMA 4YYFA 1SUXA 1G69A 2Y62A 3DYMA 2CLKA 2IKHA 4ZOCA 1BFNA 3CHCA 3KM8A 3BLFA 3UWWA 3OG3A 4S3DA 1UH4A 1BRLA 1HUVA 1XIDA 3GD6A 3E1F1 4KFNA 3ZVHA 4HOWA 5CC5A 1RP8A 4PMXA 2R1PA 3MUZ1 5CBIA 3ANUA 1YDYA 2A7PA 4EAYA 5TNVA 3O63A 1HKJA 3NDYA 3FJNA 2NVCA 4JS3A 1V51A 4AD4A 3RM4A 1RD6A 3ABOA 1W3TA 1XDMA 4FPSA 4S1FA 2PZNA 4X0VA 2X1RA 5A95A 3UY7A 3OZMA 5G1MA 4NILA 2VUYA 2NXGA 5LHFA 1JGIA 3GTFA 4NL1A 3CQIA 2PTYA 2HE8A 4ZFMA 4H2HA 3P0WA 3TQVA 4Q4KA 1K4HA 2QXWA 3PG9A 1TTIA 4O16A 2C6QA 3BXWA 4G8TA 4HNNA 5CBBA 1UWRA 4PGLA 1AW2A 3GW3A 1JF6A 3TYBA 1OK6A 2YA2A 3AHXA 3R0DA 4RK8A 1NY1A 4NSBA 1BWLA 4WVXA 3AISA 3G1SA 3ITOA 1XIIA 1Y7VA 3O05A 4IQDA 1ZBWA 2WKLA 4C60A 5E9XA 5LXXA 3UXAA 2CZDA 4LCRA 1US3A 1V6XA 2VGBA 3P60A 5D37A 4PCPA 1QT1A 3LV6A 1BYCA 3ZS4A 1OFDA 6A3HA 2HQAA 1NM9A 4MVAA 2OT1A 4YXGA 1OEPA 5LNSA 1OZMA 4WJ8A 5H1WA 3AHVA 2YPIA 4S3BA 2V38A 3AZSA 4H19A 3S2JA 3LRMA 2QW5A 3W00A 3O0FA 2NSOA 1J79A 3W1XA 4JICA 1EHNA 3DFQA 3WQCA 1F6KA 1TJPA 4NHVA 2CHRA 2C18A 1Q6DA 4TX8A 2QEZA 3C2VA 2NVAA 4AF0A 1KM0A 2VD8A 1Q6CA 3QKEA 1PPIA 3AXXA 2PRLA 3LGDA 1P6CA 1VJIA 3WLTA 4UNKA 4ADUA 2KX9A 1Q6QA 3MCMA 4C6LA 4LS2A 4H9UA 3NQVA 1OHLA 3G22A 2BHZA 4HA3A 4B5SA 4DPQA 2WC4A 2DH3A 3S9ZA 5ABFB 1Q7QA 3WQ5A 1XLAA 4PE8A 4GNJA 4TMBA 1VFUA 4GNKB 4KEVA 3HOJA 1VBJA 1GOWA 1R8LA 1ENUA 3TAKA 4O0ZA 2ZQ0A 2VOTA 5HQMA 2VNCA 5HNRA 3M0XA 4OBTA 3A3HA 1KM4A 1AFSA 5I3FA 1UUOA 4CD7A 4IUOA 5I77A 1RA0A 2OYMA 2VDIA 4OBRA 3MI3A 4H6KA 3R94A 4HJWA 2XSAA 4KF1A 3UPMA 4HA0A 2XGIA 4MGGA 3BWWA 2AKZA 3CASA 5IBXA 3RO8A 3GTHA 5JIWA 1F76A 2PC8A 2ATSA 4DUWA 1SZRA 1MRAA 4PTVA 3EDDA 1KBLA 2VC7A 4ERAA 3TN5A 3BQ5A 5TQLA 3UCCA 2PPGA 3NQMA 3BAKA 3KL5A 2PC4A 2YFNA 3DDMA 1B57A 4CCEA 1M1BA 3I4KA 2DZVA 4NXKA 1GQNA 1GKPA 4F0MA 1OFBA 3HPSA 3T1GA 1W9DM 1B4EA 5IOBA 2V3EA 1KA9F 3PC0A 3QFEA 2FB2A 2GSHA 1R46A 4GI9A 4AD5A 4JAWA 4B5WA 4K1GA 5C2GA 2QIWA 1FCVA 2E67A 2VX4A 2FYMA 5D05A 4AVFA 2F61A 3EOOA 3S4TA 3UWUA 3SCUA 1R2SA 4C6KA 3SIZA 4DWSA 5I3IA 4PUEA 4HZMA 1D7FA 5CPQA 3CWHA 1DIOA 1KR1A 1TPVA 1VC4A 1S2CA 3BMWA 4F0HA 4KEMA 4B16A 5A6KA 1EDTA 2A0NA 4JZ5A 4H9YA 3TSBA 2W4XA 1NF7A 3GRIA 1MNSA 1CIUA 1RBOB 4QJ5B 5FKYA 3SGGA 4FALA 4BQ3A 3E74A 4S2CA 4FLQA 4WEVX 1U1JA 3PNUA 4ZOAA 1YTKA 3M4HA 2OEJA 3FN9A 4PMVA 2YW4A 2R6OA 2GUUA 3LTYA 3AUOA 1PYMA 3KOFA 1G6CA 3ELFA 4IJRA 3TN6A 4WCJA 4H9ZA 3WD2A 3CV6A 4DJDC 1B9BA 1VZWA 3DFHA 1W9PA 4QRNA 3ZJ7A 3B9OA 1XYFA 3HURA 4WSJA 1C3FA 3U6WA 4V15A 3H23A 4AY8A 4P2VA 4QE1A 2BVDA 2OG9A 1OX4B 2YL5A 4H6RA 1RLCL 4GYJA 4OT7A 4JIRA 1O5QA 1JCYA 3BURA 3QW4B 3AHZA 5XIAA 4IHCA 2GSJA 2NLIA 1KTBA 5CZSA 2WHJA 5BMWA 3B8WA 3EX3A 1HGWA 2DU2A 1QI5A 4QM1A 1UP0A 5C0QA 4OECA 3VILA 2TSYA 4KRZA 4JFUA 5HQEA 1UP2A 1VCGA 1BVWA 3ZMRA 2JKAA 3MKCA 4Y2WA 4OVXA 1ODZA 1AA1B 1OVDA 2CBVA 1K7XA 2GJXB 3G8RA 5HJLA 3TSDA 4LV4A 4MADA 1KFBA 3GNXA 4JTCA 5LSMA 4LYRA 1ADSA 2PODA 3FYPA 4FX6M 3L5LA 1EC9A 3SO7A 4BKNA 4NZCA 3VCNA 5I6SA 5JBEA 2RDXA 5C9ZA 1QNRA 3IARA 5BOEA 4L9ZA 3SUUA 1NWTA 3RMEA 3EMCA 5I07A 1YE4A 3A47A 4MFDA 3KDOA 1YBQB 3KBMA 3ZR4A 1ZRQA 3P5ZA 2VP8A 1XG4A 4J3SA 4L9YA 2VGFA 2PDFA 2IPGA 3VOCA 2FKPA 4KGLA 2QKFA 3WK3A 3U2OA 5HXMA 3VE9A 4PEKA 1WXJA 1QWKA 3CAQA 3N29A 2XFWA 3CV1A 3W7OA 2HJPA 1UD5A 5M1TA 3N12A 4W86A 3USZA 3NZRA 4ZODA 2PWFA 1QHZA 3MYPA 1G9HA 4FS9A 2Q3RA 4P61A 4GFSA 2RJHA 3M5YA 3H22A 3R13A 3S1VA 3V35A 1R5YA 3ECQA 1KBJA 2EG7A 5E0FA 1YADA 4O57A 1A5CA 2P0IA 2OKTA 4B5NA 3G1YA 3M6DA 2VUNA 2V82A 3OQ8A 3GDMA 2ZIDA 2DEPA 2ZZ3A 2D20A 4MY1A 5TF0A 1FKWA 5JBDA 6XIAA 3PUGA 3W7IA 4PR4A