3H2AA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
261
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSGSYNEVDAAVRHAKEMRDEGAHIIDIGGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
total genus 95
structure length 261
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2aA00
4DB7A 3H26A 1Q85A 3MCNA 4NHVA 4S3CA 2Y5SA 2VEGA 3H21A 4MWAD 4S3FA 3TYBA 2YCLA 4DJDC 1Q7QA 3H2EA 3H2CA 4S3AA 1EYEA 2BMBA 4MWAA 3H22A 1AJ2A 3TYAA 3MCOA 2VP8A 4DJEC 3H24A 3K13A 3H2AA 4S3BA 3H23A 3TYDA 2Y5JA 4DJFA 1AD1A 3TZFA 2DZAA 1TX2A 4S3DA 2H9AA 2YCLB 3H2FA 4PZVA 4DAIA 1TWWA 4G9PA 4C1NA 2OGYA 4O1EA 4DJFD 3NOYA 5JQ9A 2YCJA 4MWAB 3TYCA 4MWAC 2Y0FA 2YCKX 4DJDA 3H2OA 1TWSA 4CCZA 2VEFA 4DAFA 4S3EA 4MWAE 1TX0A 4DJDD 1AJ0A 4D8ZA 4DJEA 4O0QA 3TYZA 4C1NB 1AJZA 3BOLA 4S39A 2DQWA 4NL1A 2E7FA 3BOFA 4S38A 1AD4A 1Q8AA 3TYUA 4DJED 1Q8JA 1Q7ZA 3TZNA 3TR9A 2YCIX 3H2MA 4NILA 4S23A 3TYEA 3V5OA 1Q7MA 1F6YA 4O1FA 4HB7A 4D9PA 4DJFC 1TWZA 3MCMA 4NIRA 2H9AB 2DZBA 4D8AA 3H2NA
chains in the Genus database with same CATH superfamily
4MUZA 4DO7A 3R7MA 1DJXA 1XRSA 4E6MA 2EKGA 5MF5A 4O54A 3T81A 1SR0A 1R86A 1QATA 4GO8A 4Z1DA 1DIKA 1LOLA 1ZBCA 4LPCA 1W91A 4GH1A 3TR2A 3RITA 3KTSA 3FJNA 3LCXA 5HJYA 2A5HA 3WBYA 2QF8A 3UPWA 1M5WA 4NI8A 1FDYA 3TWBA 1V3KA 3WDIA 4MPQA 3CAWA 1V3HA 4J7RA 4GA8A 3R94A 4NRSA 2QVHA 3F4NA 4NY2A 4JIQA 3NR0A 2PWGA 2Y24A 3WUGA 5FF4A 1ISXA 1KBLA 3K4AA 2UZ9A 2YZRA 3VKCA 4Q4OA 1GOIA 1WZAA 3RO8A 3WQGA 1JUKA 1RVKA 1RY0A 2Z1VA 4LAMA 4XZBA 3W7GA 1SFLA 1XG4A 4D72A 4FA3A 2DSVA 2P3EA 3OLDA 2EPNA 2XVLA 2GOKA 5HJLA 4X0NA 3GDBA 5ABFB 5KZDA 1R7OA 3ID7A 1QJWA 4MWAE 5M2FX 5XINA 3VZZA 5AHIA 1IT8A 1BVWA 1B3XA 2MNRA 1MZHA 5FEWA 4NUWA 4JIIX 5FJIA 4GUHA 1B3VA 2EPLX 1LJYA 1RCXB 5BXSA 1DJQA 3E9AA 1FCBA 3PUDA 1GVIA 2EJAA 1YXCA 2VD9A 1QASA 4Z2GA 4AZBA 3CB8A 5FJRA 1YDVA 1M7PA 2OWCA 3ZS4A 3XISA 4ONVA 1XLMA 2QPUA 1I4NA 4JICA 1DYSA 3PBUA 1VBJA 1E0VA 3MHGA 2QIIA 4HNNA 3EWCA 3VCRA 3QV8A 4LCRA 3TE9A 3N6JA 4MTVA 2ZRYA 2PWDA 4R7JA 1YMYA 3RG6A 2TPSA 2BOEX 4FSAA 1GQKA 2RGMA 3C2OA 3O07A 1KXVA 3EWYA 3GR4A 5FL1A 5DMYA 2V63A 2J75A 2VCBA 3R10A 4RXFA 3LRMA 3LHVA 1L0PA 2QDGA 4C1NA 1OG6A 2BS9A 3M0ZA 1RJQA 2R14A 3TCEA 1BSLA 1CECA 2VRKA 4GUFA 1G4PA 3BMXA 1X98A 4HPNA 2QCDB 3GR7A 4EIVA 2J9YA 3B04A 4TVUA 1XDLA 2SFPA 3A5VA 2C1IA 2NLIA 1HJQA 4H9TA 4Q8QA 3LGEA 3A47A 1R3YA 2V5BA 3BOXA 4DNHA 2RGLA 1Y8BA 1VGAA 1RPKA 2Y7EA 1F05A 3BE7A 4HQVA 2EBNA 2ZC1A 2PGRA 3DFOA 3MUY1 2D69A 2CBVA 2FVMA 3OQEA 3FSTA 3KM8A 2O56A 1CXLA 1Q85A 3AHZA 6REQB 5C8BB 2ATMA 1MMFA 4TMCA 4C60A 1K4HA 2PP1A 1VR6A 1GOKA 1TPFA 3GWQA 2V67A 4PL1A 3H54A 4DLMA 2WSPA 3OBAA 3ZWSA 1XLJA 4XAFA 1I60A 3NGFA 2EG6A 4XQ6A 4A05A 1O68A 2HISA 1WDDA 3AALA 1UD4A 1MW0A 4IIBA 4MGGA 3QPEA 3T7VA 4EPBC 1WDPA 3GH4A 3TZFA 3WK0A 3R8HA 1MFVA 4B5NA 1FP9A 3F4WA 1Q2RA 1QO2A 4ICNA 1VRDA 2YW4A 3O0KA 2DJLA 1RXOB 1OY0A 2WLZA 4HYWA 2WBKA 3QBUA 4A8IA 4FZIA 1AQFA 1FWDC 3TX9A 2BLEA 2CNCA 2VKZG 2UY4A 1IT0A 3EX1A 4I5UA 4DF2A 4O1BA 3GVWA 1XISA 3K46A 2REQA 4C1KA 2WMGA 5AYBA 3B9OA 2QHAA 3WY1A 3ZT6A 3ARYA 4GUJA 2YXGA 5A1AA 4PMVA 3O6YX 2WANA 1V77A 1ZSXA 1V8EA 1TV4A 3KOXA 3DKJA 2WAGA 4QS5A 3WJXA 2HQAA 1A5LC 1HKMA 1UD6A 3A6OA 2QDEA 4RX0A 5BROA 2PU1A 3CH9A 4HZMA 3DESA 1DTUA 3PAOA 4QG9A 1ZJAA 5AHFA 3PS7A 3W7IA 3C2VA 3G1YA 5H8PA 4QAWA 4GE8A 3ZT5A 4GI9A 4FOJA 1M1BA 1LM1A 3ENLA 4JIPA 3RF9A 1NQKA 5A6BD 4C1LA 4PZVA 1B3YA 3ZYZA 1EWDA 4NSBA 4O1EA 3CZKA 4OZOA 1N2VA 1R5YA 4KFNA 2WKLA 4W9TA 4GJ1A 1B3ZA 3T6CA 4R9XA 3M07A 4LCQA 3SUTA 4HU0A 1EOMA 5C55A 1QWKA 5M3WA 4EK7A 5TIMA 4H6EA 3DN5A 3S5ZA 1GVSA 5FJJA 4TOQA 3P74A 1R3QA 7XIMA 5CH9A 1A5NC 5CXPA 1F3WA 1J6OA 3PZOA 4CN4A 1JEZA 1GPWA 1FHVA 3A3XA 5EMUA 2X41A 1VFUA 3TN3A 1P7TB 1OVDA 4XZ9A 3WUEA 4RE2A 3MCMA 1QPKA 1P4CA 2OSXA 3CL7A 5BU6A 2FZBA 4UZUA 3QR0A 3AMLA 4MFDA 1C91A 1IGWA 1OEPA 1V02A 5I0DA 4L6OA 2D0GA 3CYJA 1JPKA 1M3UA 3VE7A 2HZGA 3N9RA 3HPAA 1NAL1 3MSYA 1JI2A 4Q7BA 1BAGA 2HDJA 3UGVA 2CHOA 3TROA 1JDAA 3I6EA 1VEOA 4BQ3A 4KFPA 1SO6A 1R0MA 3DBNA 1K1DA 2W61A 2ZVRA 2IMRA 3ITXA 1KR0A 1TPH1 1XC4A 5G1YA 2OXNA 4LB3A 2V69A 3TYDA 1IXNA 2ZYFA 2Z29A 2PD5A 4HU4A 4DJFA 1AD1A 2X1IA 4WOZA 2PDNA 4MB1A 3T0TA 2QT3A 3BAIA 3WN6A 1QPNA 3CNYA 3UCQA 3ME3A 5A6SA 3MMTA 3RR4A 3BUVA 3W87A 4DX3A 3A3WA 1ITQA 1X8FA 1OT2A 3CAQA 1L2UA 3SCTA 1GJWA 4LFYA 1K9DA 2V3GA 2WWDA 3OTRA 1IEQA 3DIPA 4D8ZA 1C8YA 3WNOA 5HNNA 3S4TA 2W27A 4FLOA 1UJPA 3TYZA 2WJEA 2W0UA 4OUIA 3VOIA 3EOLA 3KRZA 3LHZA 2UV8G 1R85A 1O66A 3B0YA 3M1ZA 2CZVA 3UBPC 2V30A 3CWOX 3NDZA 1CB2A 5BCAA 4GI4A 2BP1A 3BCDA 3GFYA 1HKVA 3GE7A 1L8NA 3PC0A 4HN8A 5EMJA 3MKKA 3W1MA 2AL2B 1R38A 1H09A 2V82A 4W8BA 1BG4A 1IXQA 4IMGA 2D0FA 1RHCA 4ZOAA 3UXDA 4HNUA 1H50A 2YYUA 1ZJHA 1O6IA 5REQB 2PDCA 2AL1A 1KV8A 4XIAA 1W3TA 5I79A 4UBPC 3DOPA 3M0VA 2VVNA 3EGJA 3EWXA 3UZXA 4JL2A 2C0AA 2VFIA 4KWVA 1L2QA 3UJRA 3EPNA 2F2HA 3WQVA 2QAPA 1G9HA 1EC9A 4KF1A 4GO9A 4MLJA 2ZE0A 3ZR5A 3CPUA 1P48A 4BZYA 4YHEA 3RRAA 4AIOA 1L6GA 3WMBA 2HK0A 5CZJA 1A5MC 1I0BA 2X0SA 4L61A 1NF7A 3O0FA 4XSLA 1X97A 1HN1A 3AISA 1VCGA 2Z1KA 3FKRA 2FTYA 2C71A 3QHNA 3UJEA 3VOFA 3CHEA 4QM1A 3BAJA 3AIUA 5AYYA 1E9LA 5DCDA 3DH7A 4C6IA 5FSDC 4HNVA 4EF8A 1P0DA 3W7PA 1TCDA 4Z2LA 3G8RA 1FFRA 2CHNA 3LX9A 1EO5A 5F2MA 1XFBA 5D9OA 2WM0A 3MA8A 4O14A 4LWWA 3VD9A 5EYWA 3HB9A 2WZHA 1J0ZA 1S2VA 2R94A 5A8NA 1KFWA 2FPYA 1V6YA 1XBXA 2Y5EA 2C91A 3GHRA 1VFFA 3S1XA 1W3HA 1LZOA 1G7UA 4WZHA 1V93A 3PWAA 1BTMA 3VCCA 4DZHA 3VXGA 5D2VA 3KWSA 1KO0A 1W3KA 4EX4A 3H8AA 1LWIA 2PP0A 2XIBA 3WL0A 3W85A 4XTDA 2V0TA 1FWNA 4U4MA 1FKWA 2NWSA 3UWZA 4D6CA 3PZNA 3T0DA 1OSEA 1BVNP 1MXGA 4LS0A 2VTFA 2R1NA 4LX4A 4H6QA 1MRAA 2JEPA 2ZZ2A 2QDDA 4IQDA 4S39A 1CXFA 3CUXA 1OFBA 4HKPA 1HFBA 3UERA 3BAKA 3AUJA 4PEEA 2V9DA 2XVGA 1E71M 1GHSA 2W66A 1CT5A 2PTZA 4ZVJA 4Y7EA 4L64A 5CGMA 1F3XA 4O57A 4Y9MA 5LKYA 4IP7A 4KWWA 2BGNE 1BSIA 4FNQA 3W7DA 3GXFA 1TQXA 5H1WA 1O5XA 2QJMA 4LEQA 3VIKA 5A6MA 5HWNA 2QLYA 3GG0A 3W7EA 4M56A 2R82A 3R8RA 2PTWA 4Q8NA 4H9ZA 4C6PA 1LL6A 1TREA 3SUUA 4C6KA 1TV7A 4IMCA 4B5WA 1TRDA 3I7RA 4JYEA 4BHYA 3CUZA 1ENUA 2QULA 2JGYA 2WMKA 2B31A 4X3ZA 3GX9A 2O9TA 2H3BA 3DG3A 2EHHA 2CXGA 4Q8WA 4D8LA 3FVDA 3L21A 3WKZA 3GFZA 2ZUTA 4MF4A 1N8FA 1XICA 1LL4A 4M7TA 3VM5A 1HUVA 2GJXA 4C65A 3SRHA 3PJTA 1JDEA 3CXOA 1PZ1A 3DX5A 4JR5A 1R7AA 3SCPA 3TN4A 2HMCA 2ISWA 3W1QA 1TTIA 4TR9A 3U9IA 3D6NA 3RLGA 4XD5A 3TZNA 5B80A 4IG2A 1U5JA 5BOFA 4OGZA 1DHPA 2G3FA 3CUJA 2FHCA 2Z6JA 3CO8A 1W56A 2J7GA 3M0IA 2NSXA 5HQMA 1QHOA 1MQPA 1RD5A 4HU8A 3HPXA 1TMQA 4J35A 3CB3A 1ZS2A 2JIEA 1NWUA 4TVDA 4PUMA 1KTCA 2WVVB 2VFEA 2P5NA 4DWSB 4DJDC 2W6RA 2VFGA 3TJLA 2YXOA 1UP3A 3SDOA 2GQ3A 3F4CA 1S46A 3RLVA 3R2GA 2ZXBA 1E9ZB 2G97A 3M41A 2D2JA 1QNVA 3DKLA 1FFQA 1F76A 5IDZA 2ALRA 1A5AA 2H6RA 1JCMP 3RCNA 1VP5A 4JTQA 3GTIA 5HUOA 3KCJA 3K8MA 2WCAA 4DJFD 4U2YA 1W1TA 2ZZ6A 8CGTA 2DT0A 3H6OA 3KS6A 1PYMA 1XIGA 4MWAC 3WQCA 3NSNA 3VOJA 2GVLA 2CIPA 4FPSA 4LB4A 1ZJIA 3CZJA 2IPFA 4DAFA 1CWYA 3OQ8A 4H8NA 1E0UA 3BLDA 3N29A 1PTGA 4ZR8A 2F6XA 1GJUA 1OG0A 1W2VA 4UTUA 1THFD 4CNOA 4M6PA 5LIWX 4AWTA 3N1AA 4BA0A 3K2GA 3OYZA 2FZDA 1ECEA 4LVGA 3L4YA 2YL5A 3A22A 3VD3A 3E12A 3WLNA 1NFPA 2GQ9A 2E6FA 2Y8VA 5C70A 2BY3A 3I7SA 4I7UA 5K3VA 3R89A 4A2SA 1PE1A 2GFTA 4H7ZA 3SUSA 3V18A 3MKVA 1DWHM 3OO2A 1RY8A 1XIMA 1ZPTA 5F4WA 5T9BG 3WH7A 4ZA0A 2X1SA 4GWEA 3CTLA 4E4PA 5TBOA 3CLMA 1SU5A 3QFWA 1MUMA 3B9AA 4KCWA 1E6QM 2J78A 3HZ3A 3HV9A 2HCVA 1GUVA 1E72M 3EOOA 1R3WA 4D6FA 1DJHA 2PDHA 4XBKA 1Q5MA 1UKPA 5D9MA 4HVXA 4WRHA 1RV8A 4KRUA 1PYFA 3BH4A 3PUOA 3B8VA 3V0TA 1ZP3A 2CZEA 2TODA 2IXUA 4YYCA 3HGRA 4WIWA 2G95A 4KCUA 3WQ4A 4EAMA 4QROA 2PURA 3PZQA 3WDQA 4CNSA 1CYGA 1D7FA 2BXVA 2E5DA 1I1WA 2X8RA 3H7VA 4FEZA 2YYTA 3QV7A 4OQVA 1Q8AA 1EH9A 2O4QA 1BEUA 3W7MA 3APGA 1H11A 5F2IA 4L7ZA 3OGRA 2J7DA 1EJXC 5G2IA 1UZ1A 3NZGA 3W7KA 2A7RA 3MO4A 4L4MA 3SY5A 4LEFA 1JRCA 4BY3A 2OZ8A 2FIQA 4LF1A 3XIMA 3W02A 3C52A 1ESWA 4IGSA 2PDWA 5JIPA 1MWOA 1CPUA 1UKTA 4C90A 1VFSA 3S0CA 3B8UA 2QEZA 1GZGA 4LBSA 4AIUA 4WHBA 1UOZA 5FJPA 5J5RA 4KWOA 1XSKA 1RCQA 3FHQA 1KB3A 3E1F1 5DRCA 3IWPA 2DV0A 3QGAC 2WLYA 3RHGA 3B8WA 4YVXA 3HPSA 2Q3OA 1F2JA 1E3XA 3QV9A 3W70A 4IX0A 5ABFA 1TB3A 2DVUA 4UZSA 1A47A 3PB2A 3QOKA 4XX6A 4N9BA 3D47A 4XKMA 3GIPA 4ACZB 4IFOA 3TTOA 4IIDA 4D1IA 2Y70A 2Z27A 1YDNA 2ZDSA 4GI8A 5I7GA 5CAKA 4JTUA 4Q8UA 1QW9A 4GG9A 3CHDA 2EGZA 3KP1A 3S9ZA 1S2UA 4MY1A 4E2VA 5C9WA 4PB4A 3QSTA 2ZKMX 3BOFA 4WX2A 1REQB 2YDRA 1B30A 4HPXA 1TPEA 3P62A 1YYAA 5FOOA 3WQEA 3WEOA 1HVXA 3GO2A 1QBAA 5HWMA 3HO8A 4O11A 3BO9A 1KBKA 1K8YA 4EWJA 3UG8A 4I7WA 3TSMA 1UROA 2PDLA 1EJUC 4DZAA 3CWNA 4GJIA 4G7EB 3VKAA 3WDPP 3P5YA 5CKSA 3W82A 1KXTA 2Y89A 4Z1YA 2HE8A 4PN2A 1NH6A 1AJ2A 3UCCA 4RW3A 1XD1A 4YLWA 5GJMA 1BWLA 3CJPA 1H63A 2PF8A 4GQGA 3SCWA 4UQBA 5C5YA 3UG4A 3P61A 3WK2A 1XIIA 2OCZA 5FL0A 1XC6A 3DEQA 4DWSD 1ZUAX 5MHBA 1AH4A 2PDIA 2C16A 1KLZA 5K2ZA 4GXMA 4CU6A 1E1CB 3G1XA 4W7UA 4IPIA 5JU6A 1B0IA 1F07A 2V8ZA 3NJ3A 3L5AA 4WJXA 1CGVA 3APTA 6REQA 5HPCA 4HSHA 1W2PA 3G0XA 4MOZA 4LANA 2PWHA 2EPHA 3SZ8A 1H60A 4N9CA 4Q32A 1AZ1A 4BR1A 1TELA 5C54A 3VDGA 1DIOA 5FA5A 1O12A 2OLSA 3CIVA 4N7QA 4P7LA 4DN1A 1RA0A 4AD3A 1U5HA 4QRNA 1CGXA 1NARA 3BGJA 2Y62A 3CEPA 2P50A 4NNCA 4I9MA 4LU0A 3NTYA 1R6WA 4LVAA 4PUEA 3M64A 1R87A 2FB3A 4C6EA 3AHYA 5PTDA 4QG8A 4YTRA 2GZXA 5L6UA 1ZU8A 4FLRA 4O16A 5EMLA 1H1YA 2LLEA 3SRKA 3NSXA 1QNSA 1GEQA 1SO4A 2VX6A 4EXAA 1XQKA 3PBMA 3GFXA 1YPIA 1VBGA 2VD8A 5CLTA 2TYSA 1RVGA 1PDYA 3B8SA 4QAIA 4L4PA 2RUSA 3KOZA 4GYPA 1ALDA 5HXMA 4IP5A 4CCZA 2VVSA 1UJQA 2P76A 5HNTA 3GZAA 1JFHA 2A0NA 4PL2A 5CZKA 3MANA 1TPDA 3C2FA 1AJZA 2G3IA 4J3UA 3OBKA 4KW2A 1DL3A 1S38A 4TX6A 3PBVA 1I1XA 2YX0A 3A21A 3W72A 3VNZA 2Z6IA 3C56A 3NG3A 2WQDA 4E8GA 1SZNA 4K38A 4LS1A 3VNKA 2XG9A 4V2XA 3EX2A 1EX5A 4JXCA 3RAOA 4QG6A 4ZL1A 4H3DA 5AYXA 2ZICA 4OTKA 1V0LA 4MDOA 2QJGA 2PF0A 5G4WA 5JBFA 4ACYA 3RJYA 4HA1A 3UZZA 1HL9A 2WNWA 2QCFA 4KRZA 1PX8A 1WCGA 2R24A 1P0KA 2OLHA 1SJAA 1YXYA 2YJQA 4AAJA 2QJNA 6A3HA 4QEEA 3AMKA 4PGLA 1TJ1A 4B4HA 5I24A 3NL5A 5FJTA 5EFDA 1HQTA 5HJXA 1LT8A 1VEMA 4NJIA 4DI8A 1TJPA 3WIJA 1IZJA 4OU1A 3N18A 1RJRA 2WKJA 1E55A 1BHGA 1CXHA 1GKPA 1QOXA 3LN3A 4R3UA 3HG5A 3TDFA 3DCPA 3M4HA 4W7WA 3TTYA 1JYXA 1JZ2A 4GIAA 1KCLA 3PSWA 5DFAA 1QMLA 5BOEA 3LOTA 1PKMA 2XFFA 2HS8A 1J0JA 1JI1A 3RYSA 1DWGM 1CGUA 2A2IA 1CGWA 4WOQA 4PUUA 3LENA 5DO8A 3ONBA 3KS5A 1QO5A 2PLCA 2J8TA 1TUFA 3C6CA 3M5YA 2HVNA 2WVSA 3VI2A 4ZOBA 4DBWA 4X9SA 1RALA 3BICA 3KVJA 5DEZA 2J25A 1K03A 2VGIA 1H3GA 4NHVA 4X60A 3V7PA 2Y5SA 2NV1A 3JVAA 2Y1HA 2KAUC 1D9EA 4XB3A 1LWHA 3N2XA 3UQNA 1OX5A 2OKTA 4L9XA 4LTSA 1H7PA 2VDHA 4CNPA 4IMAA 2OSWA 3GHTA 2XYLA 3ABSA 2GUYA 3M0MA 4HP5A 4GGBA 2H3DA 4KCVA 4IQEA 3MV11 3CH0A 1NP2A 2FGLA 2JEQA 4B5TA 4O8RA 5D02A 3INPA 2OEMA 2HJPA 2AOSA 1FXPA 1YHTA 4I6KA 1WNOA 3OVGA 2PGEA 4HZ7A 1RPXA 1L6WA 2QQ6A 3JRKA 3TUUA 3ZWTA 2X0YA 3N12A 4K6AA 5MKGB 3POCA 4ZO6A 2CZFA 1AL7A 2E67A 3B05A 4D6GA 1HKWA 4MM1A 4FX7A 3STEA 5A8OA 5K4XA 1EJSC 3FJLA 2NVDA 1V3JA 5DANA 1PHWA 4DBEA 1PKYA 4BQ4A 2ZX5A 3OZOA 3TYUA 2AAMA 2D3NA 4H2CA 1K9EA 2AL2A 5CSRA 5LA2A 4Q8VA 1LLWA 3TTQA 4HHPA 3FEMA 1NDVA 2DDXA 4FLQA 1UR1A 4QCFA 2H9AB 4U5KA 3W2NA 3SN4A 4V28A 4AXNA 3A23A 1JUEA 2R1MA 2UBPC 5REQA 4CNNA 3M44A 5D38A 1OX6A 4QFUA 1N8IA 3HFTA 3UF9A 1UD5A 3BGGA 3GXMA 1ZJBA 1JNEA 1XS2A 3O63A 1BWKA 2F9RA 3L12A 2A85A 1W5MA 4N6EA 4NYUA 2CZDA 3AIVA 2G50A 4E2DA 4AWSA 4GQRA 3KBMA 2AMXA 3WBEA 3GKAA 3LUTA 1EIBA 5A6LA 3F4DA 3K1DA 5DF0A 1V03A 3VGGA 2YCLB 4PCTA 1UYQA 2JKPA 4AZ5A 3WF4A 3PJWA 4OVXA 2VZSA 2YW3A 5KSWA 2OX1A 2ABAA 3R6IA 4D6HA 1XH1A 3MZ2A 4BCEA 1R2TA 1TSIA 4M1BA 3AXIA 2GVJA 4NJJA 2XGBA 4LCSA 3LZ5A 4IL0A 1KFBA 4GISA 2PGWA 3NFUA 4GYFA 2XGZA 3LXAA 4GK8A 1DQWA 3QTGA 3IVUA 2A21A 2QCLA 1IWPA 4FNPA 1N8WA 4K68A 1A3HA 4MHBA 2DUZA 4NILA 5JVLA 1OT1A 2WSRA 3WG6A 2BG5A 4IMFA 3D3AA 4F0MA 1A5SA 1NDZA 3QJAA 3A4AA 4H7CA 4Q6XA 3MCNA 2CZ5A 4BS0A 1HGYA 3S42A 2CLLA 3CIXA 3LYEA 3LNMA 3ZR4A 3L4VA 1V6WA 5C7HA 2BBFA 1VLWA 1EKOA 4ILSA 4IIGA 4EWND 4MKNA 3B97A 1IZKA 3MYPA 1HP4A 4J2PA 1CLVA 5I07A 1NM9A 4IHCA 1BG9A 2A3EA 2VC6A 7PTDA 1V6VA 4L5ZA 5E0KA 1D3HA 2PCQA 2WBGA 2WC4A 3LHUA 1FWFC 5EFFA 3MI3A 2D2GA 1ZAHA 1JXJA 4JDYA 1WKEA 1RAKA 3WLOA 4F0RA 2E8YA 4JFSA 4GY0A 3EWUA 3CL6A 4S3GA 3ZSSA 3L68A 1QI2A 1X7FA 2QCGA 1GZJA 2XDFA 3PHAA 4PBFA 3BLKA 3SY1A 3AZTA 4L9YA 3RIKA 2OG9A 1FKXA 4E0CA 3UR7A 4S3KA 3FN9A 1UR0A 4M6VA 1LF1A 4PMRA 3WLKX 3A13A 2E1WA 3S2MA 1J2WA 1PS9A 1QNQA 2BV9A 1I0DA 3QLLA 3M7SA 1ICPA 3KZSA 5I3FA 3WJWA 4DELA 3KL3A 1NOUA 5IDIA 1EX1A 2ACQA 4S3FA 1EF2A 1W5PA 4OBTA 3C0LA 3GZ3A 3SQLA 3ZJ8A 4A3RA 3STFA 1DEDA 1EP2A 3CUHA 3T8QA 4PUJA 2E09A 4HD5A 5D05A 3SIMA 2VQTA 4W89A 4MUPA 4QNWA 1QR7A 3Q58A 4S3BA 4P8XA 2GUBA 1EZ2A 4PRRA 1WA3A 3LTSA 2WVTA 3LBCA 5C6MA 1J01A 3N2OA 3UXAA 1UQZA 4Y8FA 3BVJA 1U5VA 4HCDA 3VIPA 4B2DD 4M24A 3MWAA 4RK8A 4NZCA 5BMWA 3C4UA 3AU2A 1H0GA 1XDJA 3MVTA 3B06A 4XD3A 2ZXAA 4C6NA 3MT1A 4J28A 4LQ1A 5FF7A 2AGKA 1AH3A 3EKGA 1G67A 1GG1A 2WVVA 1XPGA 3KVKA 5FJOA 3RO6A 3S5NA 1A5BA 2B81A 3CUIA 1ONWA 4Y2WA 3G1SA 1DJGA 1EFZA 2J62A 4PRWA 2INFA 3UVIA 2RDTA 1PO9A 3C2YA 4WSHA 2DZBA 3W71A 2JKAA 2TAAA 3OGSA 4H1ZA 4IIFA 4C6FA 3L2IA 4Q4MA 3C2EA 5E6YA 4M5PA 2GDVA 4IUGA 4OE7A 1E40A 4DF1A 2ACUA 3GAKA 3GNNA 2GSHA 4WXZA 3LDVA 4GVGA 5E70A 3PB0A 3QOMA 1Q13A 2ON3A 1K6AA 3TNOA 1LBFA 4UMCA 2BVDA 3LTPA 4WR3A 1F74A 4JFWA 4P2VA 2PWEA 3H53A 2VEIA 3DHUA 3BARA 3FXYA 4I8DA 3W84A 3K13A 1NDYA 4W4QA 4UCFA 1WBJA 3L4WA 7REQB 4UR9A 3CL8A 3L2LA 3VM7A 4Y9OA 3FXGA 3U0HA 1WB0A 4LAZA 3SCQA 3DU0A 4CQAA 4LUSB 1GQJA 4E5TA 1XSIA 2G37A 2I9UA 1R2RA 2PB1A 1F9CA 4XAZA 4ZZ9A 3GTHA 3UJFA 4GC4A 2NVCA 1VFMA 4DYJA 1J79A 3L0KA 4ROQA 4ZSTA 3II1A 3W7JA 4M7SA 5B7YA 2WHMA 3WSUA 3LB0A 1LDCA 4D6JA 2J13A 3BJSA 2P1FA 3TC3A 3IAQA 2PS2A 1A5KC 1KFKA 2Q8ZA 3T07A 3W73A 2FHBA 1WQ5A 2PEVA 2EJ1A 2I9EA 1F6PA 2ZRVA 3S9YA 3W7QA 3RGTA 4HMEA 1CLXA 4DPPA 4U33A 1HZYA 4JOMA 3OODA 3GDKA 4WVXA 2A3LA 4RDYA 3B03A 4FMVA 3VX0A 2A4AA 2NXIA 3UZJA 4KQNA 4LVFA 3G1HA 5FACA 4I8YA 3U4AA 3MUCA 5C2GA 4F2TA 3MUXA 2F7FA 1BYAA 4GFIA 3P2VA 4F8XA 4CVUA 4A2RA 4AC1X 3STPA 1MQRA 5HA7A 1AH0A 5BW6A 3SCOA 4E4FA 5IHRA 1LUCB 3GLCA 3IIZA 1VFOA 1Z3NA 3B0VC 3LGGA 1VPQA 2I5GA 3WD4A 3TQVA 4PCNA 4E3TA 2PC4A 3I3BA 4JFUA 3KVMA 4WY0F 4KMQA 4ASTA 5A3HA 1TVNA 1TZ7A 1LWJA 4FAMA 2XIJA 2ZX6A 3F7JA 4MY8A 4QITA 1TX0A 2ZXDA 3VPLA 3GY1A 1V6TA 3W6LA 3W2KA 2DQWA 3QV6A 3SECA 1KR1A 4AHPA 5BNKA 4RNJA 1XYZA 3A5FA 4GNVA 2DP3A 4G5DA 4RPQA 3T4CA 3H2MA 4LUTA 2IW0A 3PANA 3ARVA 4M8UA 2E3ZA 2WOQA 4HB7A 2E77A 4DJFC 1TWZA 3QQ0A 4D8AA 2VYOA 5I23A 2RJGA 4P7NA 1WE5A 2OQHA 5CG0A 4ZQRA 1EDGA 1JNDA 2WZTA 3ARRA 3CZ8A 1IEXA 3PWIA 2Z26A 2DZXA 1MUWA 2UWFA 4ACZA 4C6OA 3VFCA 3WL1A 3NXLA 1W3LA 2ONEA 3MI6A 3UESA 2FGBA 2IQTA 3WNNA 1UBSA 3SCVA 3JR2A 2J7FA 2PA6A 3LGDA 2VGFA 3U8GA 3SI9A 4F48A 5HR7A 1HJSA 3AWOA 4LSBA 1VLIA 1OADA 2ZRUA 3EKZA 3N4EA 3NO3A 2BY2A 2CLEA 4MWAB 4J9JA 1K7EA 3PTMA 5CG7A 1LRQA 1JDDA 4IXHA 4DZIA 2ZWZA 3PTKA 4NT0A 5FIPA 1US3A 1OFRA 4LBRA 3EZ4A 2WO5A 1BFNA 3W81A 5GNYA 2DUAA 2OOGA 2VZVA 2WZIA 1KXHA 2VR5A 4REQB 5H2ZA 4YWSA 3RXZA 1Q7ZA 4Q4RA 2PD9A 1T40A 3DFNA 1ADSA 1W9DM 4C6DA 4UOJA 4WY0B 4IJRA 1IYXA 4QXIA 1ITXA 1FUYA 2OO0A 3L2MA 1F6KA 2BXYA 1PCWA 1XWYA 1DE5A 2DVTA 4JTAA 1W3IA 2Y7DA 1F8IA 1UUMA 1PIFA 4F0HA 1EPVA 3CPGA 3MWCA 4ZO8A 3U2EA 4G56A 3W29A 3FJ4A 1RCOB 4H6KA 2V2CA 2BY1A 3T2PA 9RUBA 1KWKA 1KQZA 4NX5A 2QJJA 1R46A 1E1CA 1T99A 1K3UA 3BG5A 1H7RA 1HJVA 3XINA 1XINA 4XAYA 3WLHA 3VDAA 1AG1O 5JMUA 2YDSA 3VD5A 1VZWA 3S6DA 2IS7A 1V6XA 2XH0A 3VOGA 2P10A 3QPZA 4MJ4A 4YHGA 3W6MA 3W37A 3NA8A 1LCOA 1XLCA 4KT2A 3CPRA 3THDA 1W5OA 1PV8A 3C2RA 2P8CA 2XH7A 4R5EA 1Q3NA 2FQIA 1QHZA 4NKCA 4PB3A 2CERA 3NEHA 2DSKA 2VCCA 1NTHA 2QV5A 3WZ0E 5HQLA 4R33A 1V6UA 1S2TA 4O19A 2FKPA 1EHNA 3PK7A 2FDMA 5XIAA 3W53A 3SGZA 3KLKA 1MW3A 2CETA 4X0VA 1H2JA 3V75A 4LBUA 1KM0A 4E2OA 3BANA 2P0OA 4R34A 1W1PA 4V27A 3U2CA 3NQEA 3WF2A 4HSNA 3N14A 4UQAA 3LSBA 3H4XA 5C7VA 3LI1A 3AMDA 3S2LA 1YRRA 3KW3A 3RX2A 1C9DA 1EYEA 1B4KA 3BLLA 2PDYA 3SGUA 1D3GA 4N2YA 4HK6A 4ALDA 4AUBA 4G7FA 5A6KA 3R79A 1LTDA 1MQQA 3REQB 3VFLA 1Q6DA 5EMMA 3V1HA 2IQDA 4DF0A 3FA4A 3UWWA 1JPMA 1ISZA 2DZVA 5DBUA 3WEMA 1IGSA 1TR1A 3T40A 2OT1A 2C3ZA 3OHIA 1F61A 4NAFB 1L9WA 2CLHA 1GPFA 2VOMA 3D5HA 4HJFA 3P5ZA 2G41A 4Q4SA 3GH5A 5T9CE 3EYPA 3IK2A 3KLLA 3O06A 1JGMA 2WW5A 1QI4A 2CYGA 1M53A 2XH4A 4US6A 3CQKA 5AC4A 3PPGA 1XYAA 1XGDA 2BDQA 3GTXA 1UKSA 1BGAA 5AFDA 1KM6A 1R3TA 1TPVA 3F4VA 1R3SA 3WDJA 3ZSTA 5LIXX 4NZ3A 4FP1A 1VRXA 3CT2A 1RR2A 2WMFA 1ONEA 4Q8MA 1TPUA 2HRWA 3M7WA 2QJHA 1A0CA 4IJCA 4D6IA 1TMLA 3WF1A 4CGTA 3NOEA 2FVKA 3B40A 4WF7A 4NZ1A 4D6EA 1KRAC 2Z25A 3VGDA 5HR6A 2YA0A 4XK2A 2CLOA 3HGSA 3O9NA 4CNUA 2VP8A 4HHLA 5D2TA 1S39A 4AW7A 4P7OA 2XM1A 5I09A 3DFQA 2O4MA 2RJHA 4WDWA 3CWHA 1BYBA 3M5VA 1FX6A 1PX4A 4H00A 4RNFA 3WJZA 4TUFA 1WDSA 2VX4A 4Q7NA 1KM5A 2NQJA 1R3VA 2YCJA 3I6RA 3KTXA 2CFFA 3COTA 4JTFA 3EB2A 1LL7A 2OTDA 3W2LA 2C15A 1GW1A 3Q4DA 1SW7A 4GX9A 4PRTA 4J4KA 3VIJA 3F2BA 3C0JA 3Q67A 3VZYA 4B3ZA 2OSYA 3EEZA 3GH7A 2YLAA 4PR4A 2V5CA 2VZTA 2YCIX 1TO3A 2JF7A 3ITLA 3GXPA 4EKJA 2FZ9A 2J7EA 2FFCA 3AXMA 3LHYA 3N6HA 3OIXA 4GVIA 3FV9A 3GC4A 6XIMA 1FCVA 4D6DA 5F2GA 1ZFJA 3I10A 3SFWA 2D20A 5G2HA 3EXTA 3L5LA 3QHMA 3OBEA 3OHMB 1J0HA 4LNCA 2ZUMA 3TLLA 4EF9A 1QWGA 3WFZA 1JDCA 1W1IE 4M0XA 3S6OA 4TVCA 2D2HA 4GY1A 3GSMA 2POTA 3W1PA 2VXNA 5MKGA 2XZ7A 2FZ8A 3RCYA 1GK8A 4YPJA 3RM8A 2W3ZA 4LVDA 1POJA 1ML1A 4A4AA 3IIXA 3KCOA 4OHQA 2WJFA 4P5UA 1EHAA 2XVPA 4IM4A 1YE4A 5A6JA 3W7HA 2AAAA 3TQ0A 1WUFA 2D22A 1T7LA 3KVLA 1M01A 4NJKA 1JCLA 1L8PA 2A6LA 4OJYA 2VDGA 1V7YA 4AX7A 2X05A 4AVOA 2PDFA 2W5FA 3CMFA 1Q66A 4JFTA 3D3FA 3GKFA 1A49A 3U57A 1WXJA 4GUGA 1LP6A 3AHVA 1J0IA 5D2XA 2XIIA 2O7SA 4YN5A 2Y4SA 2Y61A 3BOLA 3I7QA 4HGXA 2GWGA 2DY3A 3GS6A 3OIHA 1MEHA 3G1RA 5AHLA 2OPJA 4O53A 4ZFCA 2OZ3A 1JQVA 1M7OA 2YPIA 1A4MA 4IMDA 4L9ZA 1XLAA 3AROA 3GG1A 1PKNA 1E43A 4DBUA 2XSAA 4M51A 9XIAA 6ALDA 1ZENA 5D03A 5BXRA 1ISVA 2AKMA 2YCLA 1OFDA 4GCXA 4H9YA 3NVDA 4ZXLA 2VRJA 4GH3A 4XZIA 1G6CA 3RCMA 1A5OC 4MNMA 2R8WA 4N02A 3S9IA 3GHSA 4FOUA 1NVMA 4Q8PA 3ANUA 2Z4GA 3NQBA 1VBHA 5T91A 4O0KA 4BWLC 3ATYA 3R0KA 3DUGA 1JJKA 4PFHA 1JCTA 4KWSA 4X2RA 3VIHA 1E5JA 4DM2A 4TMBA 1Z48A 3SCSA 4ADTA 3ZM8A 2HTMA 2ISDA 5DLCA 3EXRA 4R27A 2VR4A 3AI0A 1B9ZA 4CCDA 4ZO9A 3R13A 2G4JA 3U7VA 2FGZA 3UR5A 4JNMA 3T05A 3LEPA 3Q2DA 2C8NA 5LA1A 5EBAA 1EP3A 4WCJA 1DKWA 2I14A 2E1DA 1W32A 4AU0A 5TD4A 1HP5A 4UMAA 1YNQA 1HG3A 3OLEA 1NQ6A 3DG6A 1I6NA 2YDQA 4M82A 2WJZA 3EOEA 1U1JA 2CLKA 1VYRA 3W7LA 1US2A 4P61A 5EU9A 3KCLA 5E0CA 1CW2A 1U83A 4PMNA 4KCTA 3NL2A 2DSZA 3EWBX 1XLGA 1XLDA 1YDYA 1GW9A 2XJ7A 3LRKA 4HNCA 3BJTA 2YDAA 4LW7A 4E3VA 4Z1AA 1Q6FA 4XKYB 4OFCA 4KWUA 2PMQA 5BXPA 4QQUA 1D7KA 1W3NA 2FMNA 6XIAA 4UTLA 2VL4A 5JQ9A 4JS3A 1PEZA 3GNXA 3HIJA 8TIMA 2Y63A 4QDPA 3GIYA 4P7RA 4F66A 1NFGA 2X7VA 1SM9A 4NG3A 4ML9A 1RK6A 1K77A 3WUBA 2Q8XA 4YNGA 3ONCA 2WXDM 4A29A 1J0KA 2JF6A 2W91A 4HU3A 5HAOA 4LALA 2V5JA 1OIMA 3LXBA 4MZ1A 3G6LA 4C7DA 1XG3A 2Z1XA 3IJ8A 4GCAA 2FZMA 4UTWC 1UIOA 3USZA 3S5OA 1GOQA 3HPZA 5AHMA 3FAWA 3M0JA 3QF0A 4Z2HA 1UR4A 2XM2A 4GZEA 3BG3A 2C13A 1JFXA 1OCQA 3NZ1A 1M03A 4AB4A 4E38A 4TU1A 4UCGA 3FA3A 5TAOA 3GR8A 3VINA 3OYXA 1GQNA 1VYPX 2PDBA 1KWGA 1XIBA 5DRIA 1JULA 4AZHA 1XCWA 4IGNA 4I5RA 3QEZA 2JIWA 3ZZ1A 1O95A 1SSGA 1VIWA 3ZVIA 2WNQA 3FGCB 1WDWA 4R53A 4JTDA 4J27A 4US5A 2WK2A 2YGYA 1S1RA 3AJ7A 3LXCA 4QLLA 1J11A 2GJPA 4XZWA 1FP8A 2YBVA 3L23A 3UJ2A 4MKVA 2Y7FA 4GMEA 3GB6A 3S2CA 1SSDA 3E0FA 2VUNA 3ARUA 4RE4A 1EB3A 3UY8A 4YTSA 2WMJA 4LYRA 1E56A 1L6SA 3M5ZA 1DBTA 1KXQA 2HS6A 1UG6A 4H8UA 2HK1A 3VDHA 3TQKA 3FY1A 4PMJA 1JPIA 5KTLA 2XH2A 3CLWA 4GYKA 3VD4A 4NZ4A 4KH2A 5KMYA 3L4XA 1XM3A 2QUNA 5GVJA 3QC3A 5FKYA 3CYVA 3A4XA 4KEVA 1OK4A 1PIIA 4LRTA 2XPKA 2QGHA 5LHFA 4DIAA 4H4IA 4PA8A 5I02A 3TMQA 4N4QA 5M5DA 2QPXA 3PUGA 3VIGA 1BF6A 1A80A 1UWUA 2GJLA 1XHGA 4NIRA 4F4RA 2ODOA 1R47A 1JZ6A 5C71A 2DH2A 1TPB1 6CGTA 2MANA 3H26A 1HKKA 5K9XA 3IRSA 4IF2A 2V5KA 2XSBA 4ZQMA 1B1YA 4Q33A 1BXCA 7REQA 3MKCA 3GNRA 1GVEA 3I65A 3VZXA 5LNWA 4JX5A 4AC7C 4GYPC 2QCMA 3N2CA 3LTYA 2NQ9A 3NPWA 1X6NA 2Z24A 4LUSA 3WENA 3DBPA 2RHGA 5LGXA 3CZEA 4PUKA 4K37A 3O16A 3F2CA 3OLGA 3UFYA 1FHDA 4XAGA 3K4WA 4LT9A 5K7JA 1IIHA 3ISIX 3TN6A 4FALA 1ME8A 3MZNA 3URAA 4ZQPA 3UXIA 2ACRA 3KWXA 1AW5A 2PUZA 2XIOA 2DZPA 3NOYA 5F1VA 4C6CA 3WLRA 3CV7A 1DPMA 4J3ZA 3H12A 1FH9A 3JUGA 3G0UA 1S5VA 3BL3A 3MTWA 3IK4A 1VPYA 2VHLA 1WO2A 1BWVA 4C91A 2OEKA 1DWFM 2WSYA 2QXWA 1XV8A 3AFBA 3KTCA 1LRTA 4Z1CA 4RW5A 1H7WA 1L6YA 1OIFA 2DZWA 1AW2A 4FNRA 1UWQA 3SJ3A 2Q3RA 1RP9A 2GSJA 4GFSA 1M41A 2B7OA 3ZO9A 2YIHA 5GJPA 4JCMA 3OA5A 1UA7A 4RJEA 4GKLA 3GAYA 5BU9A 1E6NA 1VJZA 4TO8A 1VCFA 1FWCC 4IIHA 1MRQA 1DQUA 4WEVX 4WSJA 2VEGA 2X1UA 3GXTA 2QV4A 3PZ9A 1LUCA 2QNEA 2V5LA 2CESA 3S5YA 3CBWA 3W4RA 3QRHA 3TJ4A 4GIRA 1QW8A 1JZ5A 3NYDA 3WF0A 1EJWC 4JIRA 1N7KA 2ABBA 4L6HA 4KS0A 3RK8A 2AMGA 5A6TC 2XGIA 1SJBA 1EGMA 1F5ZA 1OK6A 4HOXA 4QNEA 1Q6CA 1E3ZA 1FH8A 3ELFA 5LYRA 4ZSUA 1Q6OA 3DXIA 3W1RA 1C7SA 1H61A 3MW7A 2HNHA 1KM3A 2BOFX 3UY7A 3W7NA 3LS9A 4PBGA 4QTGA 5F4SA 1JD7A 1HJUA 2CITA 2IXVA 3P8IA 3RU8X 1H7XA 3WLIA 2VZUA 5LNVA 3QY7A 3WCZA 2E7FA 4ZOEA 4F3HA 1UWRA 2RAGA 2W67A 3H4GA 1UQYA 2OZ0A 3UR8A 5AB3A 2GK1A 2ZTJA 4CN6A 1VFLA 2H8XA 3LPPA 4IP4A 4BF5A 1XCFA 2TMDA 3BK0A 4JTHA 1E4LA 5A8GA 5LNSA 4LS2A 2JFEX 5IHSA 3O6AA 1JCXA 4H01A 4KBXA 3R12A 1GNXA 1OHLA 1UBPC 5E93A 4F79A 1GEHA 4C6LA 3NQ8A 1XLBA 2VX7A 1B5TA 5I3HA 1UMLA 3E2SA 1GG0A 2ZZ1A 2HPMA 1XR2A 1KBJA 4MWAA 3VO0A 5A8QA 3VD7A 1EJVC 1LRNA 2Q01A 3P0XA 4DUWA 1OFEA 1CI1A 2NUXA 1HO4A 4HNLA 2Y5JA 2PDXA 4UTTC 5T26A 4JQ2A 4KPLA 4Y8EA 3GVVA 1FTXA 1QNOA 4QSHA 3SN1A 2IPJA 3IV3A 1KRCC 4REQA 4C6JA 1YNYA 3CV6A 1EEXA 3P14A 2QR6A 1DJYA 2I56A 3A3HA 4LV9A 4O4VA 1YADA 2PLMA 1E0WA 2BNJA 2VEFA 2D23A 4H9MA 2QDHA 3I4KA 4J40A 3N2BA 2ZDRA 4KFOA 4FIRA 4WY0A 1J5SA 1SFSA 1KRMA 3WMLA 4FF5A 4AYGA 4AWUA 4WUIA 1KFLA 4AZIA 3AHXA 1DIEA 1N55A 2QKFA 2WHKA 4QDMA 3MBDA 1AUSL 4NU7A 2GDQA 3B9NA 4GUIA 4C6QA 3P82A 3LCHA 3OJGA 5KZEA 2X2YA 3C8NA 1GJPA 3VNMA 4YMZA 3NDOA 3TKFA 1RH9A 3CZGA 3KRUA 5ECVA 1H62A 1J0YA 3H21A 3HQNA 1E0XA 5IFPA 4WQ6A 1SPQA 4AZ7A 1FWHC 4NI3A 3SN0A 1AL8A 3SJNA 1I8JA 3TOPA 4EANA 2CLMA 2Z7GA 3NQAA 3U2OA 1OFQA 4W84A 1O4UA 2YXXA 1KGWA 3PNUA 3ARTA 3MB9A 3PTQA 1SW0A 3IPWA 1FWWA 2NQ5A 1GOMA 3ERPA 2OWWA 3PJUA 1H7NA 4UMBA 1G01A 3B4UA 1RJPA 2JALA 1VAHA 3KX6A 1EUNA 3EB3A 3R25A 1H0IA 6ENLA 5CSSA 1DXFA 4CNTA 5AZ0A 3EWWA 4RNIA 3DI1A 4UFLA 1EA9C 3WBWA 2YA1A 2I17A 2XFYA 1JG9A 4CD7A 2Z00A 4LJ3A 5JXQA 1PSCA 2CCRA 2GWNA 3W7CA 5I2UA 3S2JA 3UG5A 3V3WA 3URNA 1E51A 5DX7A 5DMLA 1MEIA 1Z89A 2CWNA 4GPNA 4HNTA 2KZHA 4OOUA 4ERAA 1QVBA 3TJIA 3WDRA 1QHPA 2PP3A 3UGRA 1OF6A 2ZC8A 1TV8A 2A3AA 2C18A 4WLCA 4R88A 3K5XA 1PAMA 4ML4A 4B5SA 2R9RA 4V33A 4ZODA 3AYRA 3N2MA 3WQ5A 1IF2A 4PULA 1NJJA 4PUNA 4JQ3A 4FNTA 2J79A 4NAFA 4FHAA 1GVOA 5ABGA 5I3JA 3THAA 3EWDA 5DY2A 3L9CA 2INZA 3KBSA 4BKNA 2YFNA 3QSRA 1EJ7L 3ITVA 3HQOA 4KRTA 3LLFA 5CPLA 1DOSA 3C0QA 1QNRA 4IPNB 5D8ZA 2X7WA 4BQ5A 1EGZA 2VT0A 3SCRA 2PTXA 2V3DA 3ORWA 3GUGA 2IUZA 1VEPA 2PCEA 4K39A 2H90A 2VGBA 1TTJA 2NX9A 4ZQOA 3ZQ9A 4ORIA 2GL5A 4F9JA 3S3GA 1F4AA 4MZ8A 7TAAA 3W1LA 2D3LA 1SUXA 1PXGA 4LY8A 5CAHA 3WD1A 4A3QA 4DNMA 2PI6A 3N13A 3VNDA 3LCIA 4URIA 2ZADA 1J2BA 1F3EA 3MP4A 3F03K 1SMDA 4JKKA 4ATDA 3B0UX 3BLOA 1KKRA 4B3KA 2VFHA 1GOWA 3PP7A 2FMOA 1JGIA 3N25A 3TSBA 3U48A 1SQ7A 3MUIA 5M17A 3ATZA 3T08A 4MPKA 3MHFA 2QYGA 3H23A 3WELA 3LD5A 4AD1A 6PTDA 2X42A 3DECA 4FXRA 3WH6A 2V6AA 3R58A 2PWFA 7ENLA 3SQMA 1RUSA 1W8GA 2AQOA 5D32A 4A22A 4Q4PA 1IHIA 1J93A 2PTYA 2O0TA 4AX6A 3PJXA 4DEFA 4S3EA 5LGZA 1E0TA 4CUCA 1Y5VA 1PBGA 3BMWA 2YL9A 3F5KA 3STGA 5K9DA 1NEYA 4ZFMA 4XVDA 4O1DA 3W76A 3UT0A 2HEJA 5BOOA 2E9LA 2J6VA 5CEWA 4Z2KA 2OEJA 3TR9A 3OG3A 4UTFA 4F2BA 5E9XA 1M04A 1XX1A 5LZLA 4JX6A 1EP1A 1ZL1A 1DP0A 3ARWA 4Q8TA 3BTNA 1QRQA 1S3TC 1UUOA 1XXXA 1X96A 3CAVA 3HTWA 1E1FA 3L0GA 2OYMA 4B91A 2DGAA 1YPXA 2B7PA 5F7UA 3QN3A 2H8ZA 1TIWA 3V5CA 3FK4A 1ME7A 2GVEA 3CEUA 3F5JA 3NSMA 1H51A 2XU2A 2Z2UA 4MFEA 3VE9A 4QBXA 1G1YA 2DSUA 3W1TA 2YB4A 1M6JA 4JFVA 2XN0A 4MYXA 3A12A 1HL2A 3LCGA 1DWAM 4BI5A 3EPMA 2EEXA 4K7VA 1GONA 1TWWA 3EOSA 3ZVHA 2BHUA 4N9EA 4AIBA 3RPTA 4DUVA 1CGTA 1V3LA 4NASA 2KX9A 4XUGA 5AC5A 1X38A 2GOUA 4JIEA 4JGDA 3U5YA 2OO6A 2R6OA 3CAKA 1OCNA 3W22A 2DZUA 2XIQA 3OA3A 3B8IA 2NUYA 4GX8A 4QLKA 2VEPA 2WC7A 1TWIA 1TJ0A 4I90A 1SFJA 3EDJA 3PZUA 4ADUA 5CC3A 2PC8A 4H2HA 1TMHA 1TPC1 2DIJA 4ZXOA 3LRLA 1VCVA 4IPJA 1ZAIA 2VC5A 3BSHA 2GGGA 2G8ZA 4YWIA 4NXKA 3BG9A 4IGHA 1NSJA 3WLMA 5A2BA 5KITA 3U5UA 4TX8A 2AQWA 4PCFA 1ZZMA 5D8WA 2FFIA 3TFXA 3ARPA 3K8LA 3E74A 4XD4A 1H41A 2BZNA 4IL2A 1B3WA 4K8GA 3MMDA 3CIWA 1XYFA 2JBMA 4AEOA 3EWZA 3CS2A 4HMCA 4M29A 1CXEA 2Q09A 2B7NA 1TV3A 1QAPA 4FNSA 1RA5A 3ZMRA 1JPHA 3CGTA 1X1OA 2Z28A 3BURA 1ZCCA 3T4WA 2XTKA 1E6ZA 3IGSA 4PMZA 1TG7A 5FCZA 1UR8A 2FJKA 4O0ZA 4JNYA 3RN6A 4Y9AA 1SR9A 3M6DA 1LLZA 3ITYA 2YSWA 2VI0A 1WDRA 3MY9A 2RDXA 2RH9A 3QXBA 4A35A 3IS4A 1AK5A 4EVZA 5RUBA 2NLYA 1UCWA 1NF0A 4BF9A 2BFGA 1UWSA 2EPKX 4PFMA 3EMZA 3E5PA 3Q45A 3PBYA 5DMMA 1E73M 1JL8A 1TTQA 2ZZ4A 3DFHA 4ZE4A 1XIDA 3EEGA 4KKXA 3C86A 4TX9A 3H4WA 5CC7A 4ZO7A 3FLUA 3H7RA 3WD2A 3U6WA 4HK7A 5HMFA 1EO7A 1EC8A 4JYFA 3EB4A 1BVZA 1TVLA 1GYMA 4UTKA 1ONRA 3E96A 3R0DA 1V08A 4XKYA 1V0MA 2BGQA 2OFJA 1EZWA 2V2DA 2A3HA 4Z1BA 3SEPA 3W74A 2DVXA 5I5RA 4W85A 3NM1A 1PPIA 3W2MA 2HBXA 3LK6A 3VC6A 2HV5A 4LYQA 3QLDA 4BI6A 4CU7A 1IEWA 4WDTA 3AOFA 5C9XA 4IOTA 4GJJA 5CZSA 3UWYA 2VJXA 1LG1A 4BK9A 3ZLGA 3W26A 2Z0IA 4RDWA 3WJSA 5A6BA 3E02A 3AAMA 1K70A 5CPMA 3IJIA 4YTQA 1UIPA 3CUFA 5I77A 2ZUNA 4O12A 4Z2IA 3PWGA 2EG8A 3I4EA 3K1GA 1ZRQA 2J88A 4P8VA 4OUEA 5I3DA 4YJ5A 1S5TA 5JBDA 1B4EA 4GHRA 1FBAA 5C2CA 2CU0A 1T96A 1I2NA 3KDNA 2Z1BA 3EDDA 1M9HA 4HPJA 3RFAA 3T78A 3LV5A 1QTWA 5E6ZA 3WQ6A 3KUMA 1LQ0A 1UP0A 1AQHA 4IPLA 4AXKA 3QMSA 2G3NA 4UWMA 2Z7KA 3ANVA 1TE6A 2GGHA 2W92A 1WAUA 2OYLA 4QR6A 5A6AA 1XIEA 4F0SA 4DM1A 3FEQA 1OC7A 1XLKA 2PDMA 3PUEA 1XBZA 3THQA 3LG3A 3EX3A 4R85A 1J18A 1GWJA 1ZAJA 1W3JA 4RZ4A 2XHYA 3BZGA 1O1HA 1RP8A 3ZT7A 2QZRA 1EDQA 1XKJA 2PWVA 3MCOA 4QP0A 3WUFA 3NXFA 5XIMA 4GBUA 4E8DA 4LYPA 2QPSA 1VFHA 2PDKA 4HPGA 5BWAA 3NL3A 3CHFA 2IKJA 2GQAA 3GTNA 3QY6A 3WLPA 3VNYA 4IH3A 4JTSA 4P8WA 3B0XA 4DUXA 1J10A 1NOWA 3ECQA 1KTNA 1ZY9A 3U7BA 1XKYA 4QJ5B 1HVQA 1P1XA 1U33A 1XRFA 4DXVA 1LORA 2DT1A 2VFFA 2BX7A 1RD6A 2GLKA 3VOHA 1G4EA 4YCOA 3WNMA 2Q6ZA 3LMYA 4IFRA 3UWUA 4O0QA 5K4ZA 3WMCA 2ZX8A 1O5KA 2GGIA 1I45A 4H7VA 2G5WA 4IICA 3T8LA 3KFTA 3KBNA 1Q6GA 1CLKA 4HIBA 3SRDA 4OT7A 1QFEA 5HBFA 1IT7A 4QJ4B 1LT7A 2Y88A 3SO7A 5I3GA 5C9ZA 2QCDA 3Q37A 4WKHA 1QUMA 2CW6A 1EQCA 3TU9A 2G3MA 3WQOA 4NJHA 4UFIA 3KBWA 3C8FA 1ECQA 4IT1A 3BQ6A 2ZZ3A 2UY5A 4JHMA 2D0HA 3UA4A 1UWTA 4MJ2A 2EKCA 1JZ8A 1IXPA 2D73A 1CTNA 4E4UA 4LUJA 1TVPA 4QS6A 4M3PA 4L4OA 3N4AA 1A3WA 3LV6A 5D2YA 5CCZA 1IV8A 1GTEA 1NWRA 1R3RA 3R11A 1HNYA 3FS2A 3HBLA 3WLLA 1CEOA 3E49A 1V02E 1WX0A 2GDUA 2J4GA 4O13A 3WQDA 4JN7A 2QMJA 1MDRA 1DJWA 3QW3A 1PZ0A 5IRPA 7TIMA 5CPQA 2ANUA 4GI6A 2WQPA 1EPXA 4UTHA 4QISA 1SVDA 4JQAA 3IGXA 5LIUX 4JNZA 1CX9A 4YIWA 1AMYA 3PG8A 1XI3A 1KFCA 1UH4A 4RUBA 1TJ2A 3GNDA 5ABTA 4UFMA 1P0EA 4M6QA 4RDVA 1HL8A 4K7YA 5KINA 3WD3A 5CPNA 3A4WA 5CBIA 1LBMA 4EPDC 2V81A 4CCCA 3AXKA 1K8XA 1I75A 3U2ZA 1SJDA 4Z0SA 4PSPA 4CQ8A 1C92A 3N19B 1PIGA 1EXBA 2JGQA 2ZUSA 1OCBA 2ZRWA 1L6FA 1XLEA 4Q4QA 1MVYA 3LQLA 1GVRA 3NQ6A 4UQDA 1W0MA 3THUA 4GABA 1OD0A 1QXLA 3LHWA 4F40A 4G8TA 4FI4A 5T8GA 3UEQA 2OX4A 5J8LA 3LLDA 4C6MA 2NX3A 1QOPA 4LUYA 4IXXA 5BZAA 4AG0A 1YEYA 3HQPA 1XD0A 4JN8A 4AMCA 1V0KA 1M68A 4PUDA 4AEFA 3M46A 1XYBA 2EAWA 2XIMA 3B4YA 1V0NA 3VILA 4FXJA 3PY2A 4G1KA 3LPGA 3V1PA 3MSDA 4K36A 2ZUVA 3OZPA 1DJNA 3LMZA 2DZSA 1MYRA 2E5BA 2Q02A 3BXWA 1H1NA 2DSWA 3VCNA 1TPWA 3T0AA 5DBTA 3B9EA 1KGUA 3RDKA 3GC2A 1AQ0A 3SAZA 4DQWA 3EMCA 2QAFA 1JXKA 4XTIA 3L0NA 1M7XA 2E40A 4ZTYA 2DW6A 4YYFA 3NWRA 3PPHA 4D1JA 4K8HA 2WZMA 3V36A 5CJMA 1GCYA 1FDZA 1AFSA 3NQCA 5A8MA 1BKSA 5F4XA 3TLQA 1I2QA 4PMDA 4H04A 5I6SA 3BJFA 2FB2A 3AIWA 5A2CA 1UR9A 1OGGA 3JW7A 4PCPA 3S46A 5A8PA 4ICMA 1TCMA 4JPGA 3AZSA 4GC3A 1E6XM 3K4DA 1OQFA 2QCNA 3SUVA 4MY9A 3EX4A 4NP7A 4ZENA 2HPIA 4HA0A 1U1HA 3TCSA 4LYKA 1P7TA 3VK5A 3R5EA 3SGGA 4RXGA 2GYIA 1KBBA 4O1CA 5BRBA 4WJ8A 1X6LA 3D46A 4TQTA 2OKOA 4X9YA 4GXWA 5IXEA 1MFUA 1GYNA 2OWXA 4ZE5A 4IUOA 5CGQA 3SY8A 4OECA 2HWGA 1SZRA 2QUUA 3ZLFA 4DHGA 1JPDX 3VUPA 5TNVA 1CGYA 4P8UA 4DJEA 4BEUA 4AZCB 3VOCA 3TSDA 2QF7A 1EOKA 3NIYA 2IKIA 2G0WA 1V51A 2EF9A 4FX8A 4U5IA 3GYCA 1XUUA 3ARSA 5EKYA 3FCPA 3WLTA 1B3OA 2Y2WA 1KM2A 2Z2AA 3CTTA 1P43A 4D71A 4RZ5A 2C19A 4CD5A 5A2AA 5TQLA 1F4HA 3MMUA 3NQDA 1P6CA 2F2KA 3G1DA 2DORA 3P7YA 4NXSA 4JCLA 1BRLB 3BAXA 2W62A 3MVIA 1OFOA 5LA0A 3N17A 5HMEA 3KBJA 5FAGA 3QZAA 4JTGA 4NZ5A 4AD2A 5FF2A 5I3KA 3PFRA 3TYAA 1WDQA 3AU6A 5IOBA 4YVPA 1GZ1A 3LCLA 2YZ5A 1OINA 4O50A 3C3UA 3GD6A 3PBGA 3DHDA 1F8MA 2IKHA 1K9FA 1K8ZA 5C9RA 2PBGA 5D2WA 1M65A 4JEQA 2WSQA 4MAZA 4BEQA 3EDFA 2PZNA 1Y5WA 3RLHA 2VX5A 2J8GA 5D37A 3UVAA 2QMKA 1LROA 1P0NA 1AW1A 2ZBTA 1E4IA 1HJWA 4JQ4A 3W2JA 1OZQA 3NQGA 4XWUA 4PYSA 5AN7A 2VDIA 4XZHA 2OLAA 5C0QA 3IUDA 1WKFA 5GPRA 1CCWB 1UR2A 1QI3A 4ZTXA 1Q4NX 4K8EA 1IWAA 1S2AA 3KHJA 4BFAA 1Z7AA 1Q65A 5DN1A 4IQLA 5FEXA 1CNVA 1FQ0A 3PG9A 5I03A 2ESCA 1KGXA 1ZNNA 3FAXA 1EBGA 3NL6A 1IWBA 3TONA 4J2MA 3GU1A 4QE5A 4XSMA 2AQVA 4PTXA 3HG3A 4KEMA 4ROPA 1DJZA 3SURA 1K7FA 2BSLA 1XPYA 4H8HA 3HQ1A 1IE7C 1VIZA 1UWIA 3AXXA 4U2ZA 5BWFA 3LERA 4B9YA 3ALFA 3N04A 5FI8A 4EACA 3W23A 4E8CA 2WHLA 3FFSA 4MJMA 4UTJA 1X1ZA 2D24A 2J9ZA 2PRMA 5JIWA 4J3WA 4WGXA 1J12A 3LPFA 3N9SA 1C8QA 1WZMA 4KGLA 3ABQA 4W86A 3SQSA 1F73A 1G4SA 3UA3A 4OOZA 1UASA 4O1AA 3TYCA 1UP2A 1CENA 3UZ5A 2Y0FA 4A6GA 1Q6LA 4ATLA 3SR7A 5AOUA 3DG7A 4HT3A 1DWJM 2VEKA 1NY1A 3LY0A 3WFLA 5DXYA 8RUCA 4RZ6A 4DBDA 2ZCGA 2ISVA 1S5NA 3TA6A 1UD8A 4HYVA 5HPOA 3FDGA 4AD0A 4IPPA 4FOKA 1NWSA 2RFGA 4MB5A 3TYEA 4CQBA 1OF8A 4MAVA 1H49A 1ZCOA 1AZ2A 2NV9A 4EE9A 3A4JA 3TK7A 2E5CA 4NF7A 3BV4A 4O17A 2XFWA 4INFA 4L1WA 4GQ0A 4L56A 4H9UA 5G4EA 4L1XA 2E9BA 1Q7QA 1V79A 4B90A 3NEVA 2BVTA 1KD0A 4BQ2A 5IBXA 1GORA 4CCEA 5FSEC 1IR1A 3B9DA 2VEMA 3E2VA 1XH2A 3GNPA 2X2GA 5AVNA 3GW0A 2E68A 1W17A 4EPEC 4B9ZA 1N82A 4HZ8A 1HXJA 1IR2A 1QCWA 2Z1SA 3W25A 4X2PA 4Y9NA 3W7OA 1JAEA 3ES8A 1TRIA 4WXYA 4FK9A 5CJNA 5C9UA 1MDLA 4EXQA 4QHRA 3M5XA 1CXKA 3UNDA 1S2CA 1BKHA 1DXIA 1BYCA 4EXBA 4W8LA 3SUWA 3LU2A 4B3LA 2I7GA 3WD0A 5DCEA 3LM3A 3CV1A 3FYPA 3PZGA 2X16A 2DUXA 2ZIDA 3WLJA 1NDWA 1ICSA 1E6RA 2VNCA 3VC5A 1HO1A 1W9VA 2ZUWA 2NW0A 3EA2A 1I2OA 4XV0A 4MLRA 4S23A 4I9TA 4B5VA 1Z44A 1VFTA 3TXVA 2ZZ5A 4JX4A 3N4FA 3FJ6A 3QFEA 1GOXA 4TTUA 4A3YA 4QX4A 5AC7A 1JQXA 5K9CA 3TYBA 3GG7A 1PWLA 3IANA 1BGGA 3KE0A 1KM1A 2FH8A 3L7RA 4BI7A 2QS8A 5BYWA 4FIQA 3CASA 3NQFA 3T1GA 3M0KA 2PSNA 2XN1A 3ITOA 1LYXA 2I57A 3OU8A 4C5YA 4HOZA 4AF0B 4PC8A 1I2RA 1E70M 2F61A 1U1UA 3QVQA 4GVHA 2ATSA 2WKGA 3M6YA 4KETA 3W1UA 4ZOCA 2RKXA 3QMTA 5HOSA 3URQA 2Y6ZA 3RUBL 5FEZA 4B92A 1SFTA 2E6AA 4G9PA 4IISA 3ARXA 2ZX9A 3E2QA 1TR9A 3TC6A 5DCBA 2YL6A 2FVLA 3PZVA 3TH6A 2J66A 1U30A 2EG7A 4FX6M 3T2QA 1KRBC 3PTDA 3VX1A 1E5NA 3HPFA 4DWSA 1RZMA 4GACA 1VJSA 3WLQA 3GIQA 3AS0A 3GYEA 3WK3A 3ZJKA 4GQQA 1GYLA 2W79A 3PSVA 5I06A 4XZLX 4LH8A 4K3ZA 1XYLA 5FD0A 1KM4A 4DJED 4H9VA 2EQDA 4UTIA 1Q2SA 3LM7A 1G7VA 5CGTA 1JD9A 2Z2BA 4O15A 3N6QA 1Q7MA 2PLJA 5I00A 1W1ZA 3ABRA 4UR8A 4GZIA 3HF3A 3IVSA 4CQCA 2NZLA 1W8SA 4L1GA 1E1EA 3BDKA 5HK4A 3NQMA 3ZJ7A 5ENLA 1SZFA 3NZQA 2PBOA 3VIOA 1UKQA 1EQPA 3WQFA 4GY7A 4QJ1A 4IJBA 3WH5A 5KETA 4ZCWA 3NGJA 4RKAA 4L80A 4JTRA 4NYYA 2HSAA 3OEXA 4LC6A 2X1TA 1YBQB 3I68A 1GVYA 3MJMA 3FSUA 3AMCA 3QGKC 4W7VA 3O6DA 3GRIA 4TXEA 2OELA 2VM8A 4F0KA 3G1VA 5JUVA 1ITCA 3CMGA 3H2OA 2J24A 3QW4B 3THCA 1LOSA 8XIMA 3VKDA 1XRVA 3B0PA 3GC5A 1JYVA 2FTPA 3POHA 4M81A 4Z0JA 2Z1WA 3R43A 2GSEA 3RNDA 2ZA1A 3O3RA 4RDZA 1OBAA 4HHHA 1VBRA 3RILA 3TQPA 3PPCA 1GHRA 1SMAA 4PTWA 1OFPA 2DZTA 2CBUA 1O5QA 4DVOA 2PGFA 1CBGA 1FWRA 4I9JA 4JEJA 1WOAA 4NZJA 3TW6A 2OYKA 4HN4A 3WJYA 5M1TA 3UNTA 3ABXA 1FHUA 1UZHA 4GXPA 3R8GA 2WM1A 4FLSA 1NELA 2FPTA 5FJUA 2O7QA 5F1UA 2XUCA 1A0DA 1Q6RA 2BGSA 2UY3A 3QMRA 1FCUA 1U2YA 1XLIA 1LG2A 3G24A 3ZJ6A 2J8FA 3I6TA 5LIYX 2UY2A 2VRQA 4G1NA 1H4PA 2C6QA 3EXSA 3W3OA 2W4XA 3I3EA 3CO4A 2CLPA 4WD0A 1VC4A 3LLXA 5H6HA 2A1YA 7A3HA 3G6MA 5AYZA 5E5CA 3OB8A 1FXQA 1EBHA 1C8XA 4RLIA 2BY0A 1GKQA 3VNLA 4YTTA 3GVQA 1UPPA 3VDCA 3W7RA 3AYVA 2DT2A 3W1XA 3E0VA 3P3BA 2J7BA 1ZBVA 1QPQA 5D30A 1PHQA 1ZBWA 3MJYA 4DWDA 1WXZA 3IJ7A 1B90A 2PDGA 4IZGA 4KGJA 4S2BA 1EGVA 4N42A 1GVFA 1EJRC 1Q8JA 2QW5A 1Z42A 1SZGA 1ADDA 3U4FA 5BRQA 3QR1A 3AICA 4E2BA 4F0LA 5EL1A 4OV9A 1JZ3A 3G5EA 1JCNA 4PMYA 3USBA 5AECA 1UUQA 1QW7A 3GTFA 2X30A 1EIXA 5EGRA 4AISA 4GYJA 4MNKA 1W1A1 4BWLA 2ZZ7A 4MYAA 3EDKA 1TA3B 2IPWA 5EY5A 1REQA 4NX0A 3AQUA 4AWEA 1ISYA 1RQBA 4OBRA 4H9XA 1A3XA 1H7OA 3RX4A 1T6MA 2BB0A 5EPDA 3KRBA 3GDMA 2ISFA 3RM9A 4A8NA 1ZLPA 4LUTB 3BPWA 3N15A 3BCJA 2J9XA 4IQJA 1WP6A 1YNPA 2VZOA 2BVYA 5ECUA 3W38A 4K1GA 4FXFA 5G2WA 1PDZA 4G7EA 2VELA 4GINA 1RK5A 1Z69A 4Y6GA 1JR1A 5AZ1A 3IIVA 3CV2A 5D9PA 2E25A 1X39A 2FH6A 2C0HA 4ZB5A 3T55A 3WEZA 4FXSA 3G18A 2PDUA 3HM7A 3PVFA 2OVLA 4LGXA 1OABA 2XN2A 1XUZA 3IVTA 3R0UA 3ZLHA 5A94A 1X6UA 1KTBA 1T0OA 3VABA 3NPUA 1VQTA 2WMIB 4ORMA 1VHCA 4U3AA 2GQ8A 2YL8A 1PJ9A 4MIMA 3FYOA 2YA2A 1K4GA 2QUTA 2PRHA 3QKZA 2E6YA 4G2DA 1XIFA 1A0EA 4NAEB 3T0BA 1HIZA 3JZUA 1HW6A 5D04C 2WPBA 2XSXA 2QVNA 3EA1A 5BXTA 1MXSA 1JF6A 3WNLA 3GBEA 5DY3A 3H24A 4MZYA 4AH7A 3IJ6A 4KESA 3PN8A 3TW7A 2NSOA 3W0KA 1DORA 4DLFA 4JHOA 3AIQA 1K6WA 1QU4A 1XL9A 5ABEA 2WJDA 1ISWA 2O92A 4DAIA 4UTWA 5DMNA 4PMQA 1QPRA 1FWBC 4FR1A 4UQEA 3HN3A 5G1MA 5KZ6A 2Y7GA 2XWDA 2DQXA 3OOQA 3EPOA 4UQCA 2CC0A 2NV2A 3LPOA 2INEA 3G22A 4LF2A 3MHUA 4AHOA 4HZ6A 1G0CA 5HWJA 3VDBA 3G3MA 2FJUB 3GVRA 2EO7A 1MEWA 3VGEA 3IJ9A 3VAVA 2HNEA 3TAOA 3O2LA 1PVNA 4HK5A 1F6YA 3O05A 1A5UA 3VYLA 1EJTC 1VD6A 3O1NA 3W9ZA 1XSJA 5DT7A 3WX7A 1WZLA 2Q8LA 2HXUA 3QYSA 2GJNA 3IACA 4LNYA 1P5BA 1O60A 3OLIA 1T8QA 3N34A 4LVBA 1R8LA 4GZJA 4UNKA 3MSRA 1Z9AA 2ZUUA 2FHFA 1MW2A 5JH1A 3AUOA 3TJXA 3KP0A 4NQ1A 1V4YA 1BF2A 5HMSA 5CC5A 3GDRA 3VKKA 1AMKA 1NOFA 3G77A 2YKKA 1VHNA 3N11A 4Z17A 5CC6A 2GGEA 3T09A 3NDYA 2PTDA 3ZXWA 3LNPA 1OX4B 4AVFA 3VGBA 1OGBA 4TTGA 2PAJA 5E0FA 2NQHA 3WYZA 3MDUA 3W28A 2XWEA 1E6PA 4ADSA 1RBAA 2JKEA 4HYRA 1PWMA 3GHUA 3HJEA 1NU5A 1CB7B 1DE6A 1Z41A 3DYOA 3SADA 3M0LA 1CZ1A 1JF5A 3UCDA 1F3TA 3NURA 3WFAA 3QZ6A 4IFKB 4GVFA 1JZ7A 3UP8A 4AFYA 5J04A 4GNKB 3RR1A 4UFJA 3M9YA 3NPXA 4UXDA 3SM0A 1V5XA 4V1YA 1KBIA 1WZKA 3DFYA 3BLPX 2WCGA 3OZMA 4UC5A 2ZVIA 2F8QA 4J1OA 3G3DA 1X7IA 1DV7A 4S3CA 1QNPA 3QKEA 4GKTA 4N6FA 1XCXA 1TWDA 1WOBA 3P67A 1GQLA 3PULA 4GRSA 1C7TA 3C5QA 1UHVA 4A8RA 2BMBA 1IEVA 3LBOA 3UZWA 1ZALA 1LBLA 3VGFA 1EXPA 1SO3A 4GIYA 3RJXA 5CSYA 1TQJA 1KLYA 1EF3A 2VENA 2A3BA 1LLOA 4AZCA 4W87A 3A24A 2QGYA 5CZTA 2HE5A 3BW4A 3DFPA 4V15A 1GKRA 2ZXQA 1CXIA 2GPTA 3F2DA 4JKMA 3SRFA 2XVKA 4NJGA 1HJXA 1Z6KA 3OG2A 4B2DA 1ODZA 1P1MA 1E9YB 1A4LA 1JDFA 1J8VA 1Z32X 4MADA 4NL1A 3SIZA 4W5ZA 3IJDA 1AQMA 1BRLA 3QQWA 1OD8A 1E9IA 2V2HA 1C8VA 1C9WA 3NZRA 1MUCA 2PE4A 1QBBA 4UB9A 3GM8A 3LQGA 2ZOXA 1ODUA 4O10A 2NVAA 3GU2A 2DPEA 3BZJA 2WV8A 1T5AA 3VUSA 3VNIA 3AXHA 3WQ8A 2W9MA 2B0MA 3AC0A 3MP5A 4JTKA 5TF0A 4GQBA 1R9YA 2V38A 2G4FA 1X8CA 4H41A 3IAPA 3MPGA 1D3CA 1YIXA 1XQLA 4LV4A 2BXZA 2NT0A 3H22A 4GIEA 1SJCA 2EXOA 3CK5A 3UXKA 3GU9A 1WXYA 4KERA 3VMPA 1OFAA 2CKSA 3RM4A 1OWQA 1XBVA 1J5TA 1HF6A 4CQ9A 2DZAA 4B5UA 2H9AA 4S3DA 5D9NA 3VMOA 1FWTA 3M0YA 1XBYA 4PB5A 1C93A 1W5QA 2Y85A 3G1AA 4IMEA 4RCXA 1RQEA 3HU7A 5AC6A 1QDSA 1KV5A 1T41A 4C6BA 4QSFA 1XGEA 3E0IA 1FWAC 2GVYA 5SWUA 1HKJA 4IWWA 5GJNA 4UFHA 3M16A 5AC8A 3KOFA 1DWIM 4F9DA 1B54A 2ZTKA 3G0SA 1PB0A 1NP0A 2J7CA 2CBJA 5LHEA 5CPSA 1BD0A 3S6TA 2P8BA 2P53A 4U31A 5JBEA 2WMHA 1W1B1 2IPGA 3MMWA 4X22A 3SSZA 3W07A 2NUWA 3TMLA 3TAKA 2O9RA 3P80A 1XLHA 2A3CA 2OODA 3UXLA 5HULA 4LAKA 4UTTA 1ZP4A 4X63A 1T8XA 1G5AA 2Y8KA 1UW9A 4A3HA 2RDWA 4DPQA 4A21A 3V0SA 1FDJA 2VUYA 4AZ6A 1ZQ5A 4JD4A 3UWQA 2C1GA 1UMYA 4QIUA 3SBFA 1NWTA 2XISA 3H2AA 4NNBA 3C0SA 1KCZA 4FF7A 1JRBA 3EX6A 4GGHA 3FA5A 3FKKA 1IEIA 1TV2A 3GBDA 4WJEA 1H1ZA 2QCEA 3GDLA 2CBIA 4HMDA 4XZMX 4ERGA 3W88A 3A64A 2WVUA 3FYYA 3IRDA 4XIMA 2OGYA 3RMJA 4RPPA 1BXNA 1HGWA 1H5YA 3RX3A 2ZX7A 1BLIA 3APYA 5CSUA 1VS1A 2V3EA 3SCUA 4ICCX 3CZLA 3MP3A 4JAWA 4I3GA 5GQBA 3HGOA 4QGCA 1TKKA 1DQXA 1ZHAA 3C3NA 3P81A 3VIIA 3BQ5A 2A6NA 3TEVA 1AJ0A 3MS8A 1F7BA 2AKZA 3P6LA 5AY7A 3CQHA 1UD2A 1Q6QA 1V3MA 5AKQA 1FRBA 2J6XA 1A53A 3TC7A 3BMVA 3UETA 2BOGX 5LXEA 1JUBA 2VO5A 2WCSA 3CHVA 3LZ3A 2DU2A 3O15A 1TIMA 4WSKA 2ASHA 4W93A 3AYSA 3NM3A 5CPOA 3NPVA 2PZ0A 4JY9A 3QPYA 3AWNA 4QE1A 5IFTA 3RRXA 1POKA 2DIEA 4HTBA 4ZB2A 3RPDA 1XDMA 1A5CA 2QIWA 2R1LA 5HNUA 4Q4KA 5FAJA 2E6DA 1YQ2A 3IGHX 3BAWA 2FLIA 3W27A 3PR2A 3E0WA 5AHEA 3U3HA 2WNNA 3LI0A 3Q65A 1OB0A 2Q71A 3TIMA 3O7UA 4BJHA 4YL2A 3ITGA 3O8AA 4N9DA 1MNZA 1UH3A 2PDJA 1MNSA 1K8CA 1RQHA 4W5UA 4LAUA 3BW2A 4MB4A 2JQXA 3BCFA 5LSMA 1GQIA 1FY6A 4UTMA 5LNRA 4V1XA 3BGAA 4GBDA 4CQDA 3AZRA 2BASA 5G5IA 4AY7A 4XO6A 2EPOA 2BTMA 2NXHA 2ZWYA 2ZA2A 3L66A 4Z42C 1XLLA 3H70A 4S2CA 4UIOA 1Z8AA 2WZEA 5FF3A 1BTCA 3CC1A 5FESA 4ZQNA 4PODA 4AQLA 3TTSA 1YE6A 3FOKA 1X1NA 2GVGA 2I1OA 3M43A 3BW3A 4YVVA 1XLFA 1WUEA 1KCKA 5HMDA 1O7AA 1YDOA 4B16A 3IIPA 3QTPA 5H91A 5I78A 2FZNA 2A7NA 1J96A 2R91A 2O9PA 4AF0A 2PDPA 3WNPA 4YTUA 3FHAA 3N9KA 3ZR6A 2C7FA 3FNDA 1KA9F 3L4TA 3DI0A 3NCOA 3DZ1A 1FOBA 3NQ7A 4FO4A 4JTTA 2ICSA 1MZRA 1K7XA 1QOQA 3DHPA 4EOUA 3F5LA 1OM0A 3KL0A 3GUWA 2HXTA 1BXBA 2YCEA 2VMFA 3CM4A 4KEUA 4EPKA 3KOYA 4CEUC 3WF3A 3UZYA 4QEHA 1V3IA 3CT7A 1OGSA 2IKGA 4M1RA 1W5NA 5M03A 4Z2JA 5FF0A 5LIKX 3DFTA 1YXDA 2XVNA 2JE8A 3PNZA 1UZDA 4MSSA 2ZQ0A 3WQWA 1PTAA 1S2WA 1KNWA 5EA9A 4UOQA 2NWRA 5C2XA 4F2UA 3HG2A 3NO1A 3W00A 4C5ZA 4B5XA 4NZFA 2BODX 1FWJC 4DO5A 4MMWA 3ZFHA 4XVEA 4EAYA 2WSKA 3MSGA 1O94A 4GOAA 4Q7IA 2TRSA 1W31A 4W88A 2R1KA 1C3FA 2ZFAA 4WK9A 3VU2A 1VKFA 3UYCA 2VCAA 4QLJA 5EMYA 1TV5A 3E5BA 1YBQA 2ZE3A 3LBMA 3BWWA 1S5MA 2VQUA 1M7JA 1NFBA 3V4BA 2OGJA 4DYKA 2PRLA 3OVPA 1JCYA 4ENLA 1PKLA 5AYIA 3QM3A 4U28A 4O18A 2OQLA 2CLIA 3DFSA 4LRSA 1JCJA 3G2GA 3DGRA 4AVNA 1MSSA 3W2UA 4A8LA 3PFMA 1CIUA 4MB3A 1DJIA 1OC5A 3HJZA 3F1QA 5HNRA 3WQPA 4UR7A 5HUPA 3GXDA 4Q22A 3LHTA 3MO7A 1US0A 2WB5A 2YBTA 3L4ZA 4Y9PA 3TFCA 5E1QA 1PX3A 2PLKA 2NQLA 4CU8A 4ZEPA 4JYDA 4RE0A 1FH7A 3OPSA 3BSMA 2B4GA 4Y96A 2OZTA 3QH2A 2VC9A 1RLCL 3CQ0A 3ARZA 2VGGA 3DAQA 4M19A 3LCFA 3M0XA 3MDWA 4C1NB 1PUDA 1S3HA 4X61A 4S38A 4LUIA 3VNJA 3CQIA 2PODA 3MYOA 2AGTA 5GNXA 3MU7A 4J3TA 3MQTA 4UNLA 1B57A 1QK0A 1QK2A 2Y8UA 4LXFA 4U3CA 1BQGA 5L9FA 3G8EA 4XZNX 1YPFA 1J6PA 2DEPA 3LA4A 1PL9A 1KFEA 4DZ5A 5F2LA 2V3FA 3WMSA 3TV8A 4QQ3A 2CHRA 3CQJA 3OVRA 1BQCA 1R9ZA 4JTIA 4K2SA 3R4IA 1BYDA 5E09A 4QDWA 3P84A 1VB9A 4DJEC 5D09A 5HINA 3HFYA 3LSCA 2NT1A 3S8HA 4HSOA 1EL3A 2F84A 3UW6A 2RDUA 3RPMA 3WLSA 3OGVA 1W1VA 1W37A 1TZ9A 1B31A 1S5WA 1JIBA 4PEKA 3AHTA 4DJDA 5GNZA 3UPBA 2DW7A 2VWSA 1IIGA 3M0HA 3ZIZA 3NQVA 3EOUA 2QUMA 4OIFA 3HV8A 3GW3A 1ME9A 3AS3A 4HOWA 3W83A 3PAJA 3EDEA 1OYCA 3STCA 4HA4A 3TXZA 1YLVA 4N4PA 3W1NA 4O4WA 4PMXA 1I9CB 1P6BA 1PCKA 1TA3A 4HCHA 3HMCA 1TYGA 3QY8A 2J27A 2OQYA 1O1ZA 2OB3A 4DB7A 1FWGC 1MI3A 3KL5A 4WDXA 4Q8OA 5BMXA 4QE4A 1OYAA 3EKLA 5CQ1A 1FA2A 1OC6A 1XW8A 3DC0A 2REQB 4JKLA 1D8CA 3ALGA 2BHYA 3OP2A 1RBLA 4PTDA 4GZ7A 3H2EA 2F38A 1WV2A 2P3ZA 4ES4A 2P0IA 5LXXA 3ZOAA 1Q6EA 3OVQA 3PZTA 3NO5A 4JQ1A 5DELA 1D2KA 2I16A 1EDTA 4PH6A 4MG4A 4J3SA 5EMKA 3K30A 4O8AA 3UWVA 1UOKA 2ADAA 2GK1B 1UH2A 3M47A 3BAYA 2PDQA 4AMAA 1XIJA 5HDRA 4CD4A 5B7ZA 4I7VA 1W6TA 1EA0A 1J9YA 3VVGA 3W01A 3JZEA 1EC7A 4PMUA 3BLEA 1YTDA 2WMIA 5A69A 4D2JA 1JYWA 3CU2A 1KW1A 3W6YA 3HOJA 3AO0A 3FIGA 2J74A 3HGJA 4HA3A 1DHKA 4BF7A 4NRRA 2YFOA 2XZ9A 3UJSA 4DO4A 2C14A 4RR4A 3PZMA 1GT8A 4L65A 4HJWA 3FDKA 4AEEA 1GGOA 3UD6A 4NAEA 2ZA3A 4UFKA 3AIRA 1UC5A 3KEHA 1FWSA 1XF0A 1H5VA 2XFRA 3V5OA 1B9BA 4AIEA 3QGVA 5HATA 4IGMA 6TAAA 3VGHA 2HBVA 3HMJG 4L4LA 2F6KA 3EAUA 3H7UA 4C7FA 4OBSA 4AY1A 3P0WA 1HX0A 1VPXA 4US5D 3MUZ1 5KZMA 1VH7A 3FW6A 3W75A 1ZBKA 3ITTA 3V0UA 2X09A 4K1WA 3B8DA 3TTEA 2YBUA 3E38A 4S3AA 1P6WA 2CKRA 5IM51 1ITUA 3IUIA 7ODCA 3AMGA 3PF3A 4AHQA 4UUIA 2BHZA 3MUAA 4GD0A 3T2OA 4JN6A 4Q3MA 3KRSA 4RV8A 1QI5A 8A3HA 2MUCA 5H8UA 1HTIA 3DGBA 3ABZA 3JU2A 4NNAA 4ZMGA 1JAKA 4CEXC 4HTYA 5CBBA 4UQ9A 1K02A 5U4NA 3UYIA 4HHMA 3QC0A 4PTNA 5CBJA 4JY8A 1LOQA 5AVHA 3N3MA 3HA1A 4S1FA 1UPMB 4U10A 4CN1A 5CJ5A 4JBRA 2VFDA 1WPCA 1U22A 4ATWA 5G4HC 4MNJA 3L65A 1W9XA 4N0RA 4I6VA 2A79A 5J5DA 1R2SA 5IBXC 3ANYA 3AYTA 3WNKA 2VURA 3REQA 1RSCA</