3W7PA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-4-031
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-4-031
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7pA01
4N9BA 3BLFA 5EYWA 4M5PA 1F5ZA 1PCKA 4EF9A 2GUUA 3NZRA 3T40A 3R12A 4WXZA 3THAA 4M6VA 2ZZ5A 4GUJA 2P0OA 4C1LA 3LCXA 5C6MA 3CWNA 2E6AA 3DBPA 5DXXA 1EWDA 4WD0A 2H8XA 1I2OA 2O7SA 1W54A 2VOMA 5U7SA 2J9ZA 4O28A 4FO4A 1ZENA 4LWWA 2AQWA 1FCBA 4QISA 1VR6A 2A1YA 3VCRA 2EF9A 3P5YA 4CQ8A 4AF0A 3C0JA 1X1OA 3HGRA 5F1UA 4UFKA 3EWWA 4GWEA 4PA8A 4MYXA 4RLIA 3N2MA 1XC4A 2CLHA 2BTMA 3WFAA 4HNVA 3TW6A 4AMAA 1JCYA 4UNLA 4ZVJA 3N9RA 2Y63A 3P8IA 1H1ZA 5K9XA 3KX6A 4ZQNA 3HJZA 3KVJA 1J5TA 1VZWA 2W0UA 1QOPA 4A2SA 1TPH1 1O60A 3GKAA 4FNRA 5EL1A 3RFAA 3O8AA 1ZFJA 4FX7A 2RDTA 2NWRA 3OEXA 5HINA 4DPQA 4JTSA 3LDVA 4ZZ9A 3TC6A 5D09A 5G2WA 5I3IA 2WNZA 1A53A 2PURA 3C52A 3M1ZA 1NF0A 5E0KA 2C18A 3FA5A 4N4QA 1RVGA 3E02A 2KZHA 2RDWA 1OYBA 4QAIA 2WNQA 3HIJA 3I7QA 3IGSA 4G1KA 5E93A 5DELA 3M5YA 1VPXA 2V9DA 3UYCA 3NOEA 2ZCGA 4JR5A 4Y8FA 2TSYA 1T99A 4AWSA 1TV7A 4N9CA 4GC4A 4JDYA 3NA8A 4U4MA 3DKLA 4DEFA 2X1TA 1OYAA 4CQ9A 2B0MA 4GBUA 3ABOA 1NFBA 4JTUA 2CLKA 1D3GA 5HUPA 3ZFHA 3OHIA 4OWGA 1EEPA 3UWVA 3LX9A 4YCOA 3OVPA 2X2GA 5GVJA 5HJLA 2YYUA 2QAPA 4J9JA 3O06A 3NQEA 1YTKA 1H7WA 3NQ6A 1QO2A 2C15A 5MHBA 3DZ1A 2YSWA 3T4CA 1Q45A 1XUUA 1CW2A 4OV4A 4R33A 1I2NA 4AHQA 3OA3A 1SO3A 4N6EA 2RDUA 4ZL1A 3CLMA 3DI0A 1G7VA 2A21A 2O7QA 4ALDA 3UPBA 5D02A 5EBUA 4I9AA 5D2YA 3DFPA 3GDRA 1EUAA 4RX0A 2H6RA 5DXYA 2WOQA 1AW5A 1G4EA 3C2RA 4FXRA 3WJYA 1PV8A 5DY3A 1VJIA 3TXZA 4OV9A 1WDWA 3PWAA 2Q3OA 3MP4A 6TIMA 2ZRYA 4IWWA 5U4NA 3UY8A 1YXDA 3TJXA 3LB0A 3R5EA 1VS1A 2Y70A 5BMXA 4MFDA 3WK0A 2R94A 4IMDA 3FIGA 1LZOA 3A5FA 1TRDA 3M16A 5CSSA 3PS7A 4IGHA 1WOAA 3KHJA 4UTMA 5DN1A 3W2UA 1QOQA 1PHQA 2X1SA 4NZFA 1WYIA 1OVDA 2NX1A 4CNOA 5KZMA 2NXIA 4A22A 3G1HA 2ZZ7A 3E49A 3K30A 5EMUA 3PBYA 4ML9A 4NUWA 5J5RA 5F2IA 2DZXA 1SZEA 1R2TA 3T55A 1L6SA 5AHEA 1PVNA 3THQA 2Q3RA 1KFLA 2YX0A 4FNSA 1A5AA 4JICA 3EKLA 4XBKA 4A2RA 1YYAA 5AOUA 1BTMA 3AJXA 3LBMA 1THFD 4KFOA 1KM1A 3MI2A 3TH6A 1KM3A 4LUIA 1EIXA 4HN4A 1O94A 2VFFA 4NU7A 4UR7A 5LNRA 1KTCA 4JX6A 1LOLA 3F4WA 4DO5A 1H61A 4JTLA 3DKJA 3CTLA 4BI5A 1VLWA 1GOXA 3CEPA 1QR7A 2CZFA 1GT8A 1TTIA 4DXVA 4AHOA 4NX0A 3A23A 5F4WA 4Z1CA 1ME9A 2C14A 2JK2A 3IVUA 2RHGA 2J24A 2GVLA 3W87A 3W7IA 3S5NA 2QCDB 1KFCA 1P4CA 1GVFA 2YFNA 3SGUA 5HNRA 3CB8A 1DOSA 1K7EA 2AGKA 2X1UA 4O4VA 4YWIA 1FXPA 1PE1A 3PY2A 2BSLA 4HNNA 1A5CA 1P1XA 1H50A 4NQ1A 1ME7A 1YADA 1Z42A 4JIPA 1DKWA 1OFQA 4NT0A 5TBOA 1QPRA 2CWNA 2A0NA 4FIQA 3TR2A 3BG5A 3LLFA 4OU1A 1KBIA 2ATMA 3GR8A 1RD5A 3O05A 3U8GA 5LNSA 3G1DA 3MO7A 3TK7A 3P8JA 3G18A 1ML1A 1BWLA 3L0GA 3QF0A 5DCBA 4K36A 2J9YA 1TPEA 2V30A 5IBXC 2YPIA 4GRSA 3TV8A 2Z0IA 2RFGA 1LORA 1Q3NA 4IX0A 3B4UA 1GWJA 1AK5A 3N9SA 2B7QA 3PBUA 4BR1A 1KV5A 2G95A 1XM3A 5D38A 3NVTA 1V5XA 4TIMA 5C55A 3W2LA 1T96A 1VHCA 2QCEA 4KKXA 3DFTA 3M5XA 5AYZA 3DAQA 5FF2A 3UWZA 4IMEA 3ATZA 4K7YA 4JTTA 2QCLA 3R13A 4LTSA 3GDTA 4NJIA 3SECA 5D04C 2DZVA 4IOTA 2V5LA 4JTFA 4DPPA 1IGSA 5H91A 1SR9A 1ADOA 3B03A 3S0CA 3H54A 1HFBA 3GZ3A 2A2IA 2JKPA 4A21A 1X6UA 1K8YA 4UC5A 4UTHA 3DH7A 4LRTA 1ICQA 2PE4A 2I14A 3EB2A 1F6KA 2ZA1A 5CZJA 3OVQA 1F2JA 4P61A 1MEWA 5D05A 4PH6A 2FB2A 2VXNA 3C2VA 2CLLA 3UXDA 1MEIA 5K2ZA 2VFHA 2JBMA 2VKZG 4IMGA 3F03K 4A29A 4QJ1A 3L66A 3SW6A 1P0NA 4UFHA 2DZWA 2BWGA 3NM3A 3LHZA 4CCCA 1ZAHA 4LS0A 4O1AA 1F7BA 1WBHA 3CWOX 3W1AA 1JCXA 2ZRZA 4RCXA 3D0CA 3HB9A 1JCNA 2W6RA 2C1HA 2A6LA 1BKSA 1LRTA 2GJNA 3NNTA 1FWRA 1QFEA 4ZQOA 1SO4A 4N02A 1SSGA 3T7VA 3VKJA 1XUZA 3BO9A 2Y89A 4JY8A 5K9CA 2V81A 5FF4A 1DHPA 1K3UA 3HG3A 3L21A 4I7UA 4Z0JA 3EX3A 4PL1A 4NVTA 3PUOA 1XDMA 3S6DA 4XTDA 3LRLA 4RV8A 1KFBA 4LY8A 3S5OA 3TU9A 3S5YA 1I8JA 2QCCA 2GJLA 2AAMA 1GYNA 1DL3A 2ZBTA 3M7WA 2CLIA 4L4LA 4E2BA 1P5BA 1OFBA 3LCIA 4K8EA 4RR4A 1HL2A 4OT7A 3HPZA 1OG0A 4AEOA 3PC0A 3DXIA 3NG3A 3OBKA 5CZ0A 3TQ0A 4LS2A 1JQVA 5D2VA 3P61A 3TE9A 1A5SA 1Q6OA 2NV2A 1E51A 1FDYA 2A85A 3EX2A 3BV4A 3LHWA 1ZALA 2FPVA 4IMFA 4MPQA 4Y90A 5CG7A 5LNVA 3G1VA 4DELA 3PB2A 3STEA 3W83A 1W31A 1YTDA 3GXNA 3TUUA 1PCWA 5SWUA 4JD4A 5AYXA 4IUOA 4O19A 3S1VA 1B4EA 4TR9A 4HNUA 1XBYA 2CLMA 4UTLA 3BLEA 4BI6A 2GQ8A 1QPQA 4TMCA 3W22A 3VI2A 1XBZA 2YFOA 2P10A 1SQ7A 2VFIA 4WOQA 4LVBA 5D33A 3W70A 3UWQA 3HPXA 1TPFA 4IXXA 4QIUA 5I3KA 3NL3A 1F05A 1LCOA 4MZ1A 1KM2A 1O4UA 3F1QA 1I2RA 3L0NA 4H4IA 2H3DA 3W7EA 4JYEA 2B7PA 1LM1A 5J5DA 4Q32A 1U5JA 4WY0B 3WJSA 1I4NA 1IXOA 4M6PA 5LGZA 3DFQA 5K4ZA 2C6QA 3W9ZA 4YCPA 1K8ZA 3IEBA 3W1TA 2ZA2A 3LM7A 4O18A 1GQNA 4AXKA 1TYGA 3G1AA 1T8XA 1VRDA 4FB7A 3QPZA 3EKZA 3S1XA 4O10A 4WUIA 1OX5A 1H7OA 3PULA 1T0OA 4FNUA 3GYEA 4GUFA 3W1XA 5FEPA 4W9TA 3NR0A 1KBJA 4GFSA 4X22A 3W1RA 5AHLA 3DENA 1S5WA 3HG2A 3I7SA 1RV8A 3M5ZA 1OHLA 1OK6A 3QSRA 1WBJA 4UR8A 3IGUA 3T44A 2B7OA 3I68A 1IIHA 1KM6A 4TO8A 2QF7A 3W7CA 1GVRA 4POCA 1AW2A 2QCHA 4UMBA 3BW3A 1TREA 3L65A 2QJIA 2GQAA 3QSTA 3G1YA 1F76A 3S42A 2A7NA 1J4EA 4OQVA 3B0UX 2VFGA 3S5ZA 4O15A 5CPMA 3T78A 4JTJA 3PBVA 5CZTA 5AYYA 3O1NA 4GXMA 1KM0A 1OABA 2RH9A 4E38A 2ZZ3A 2ZZ6A 1GYLA 1K8XA 3BLIA 3GR7A 3G3DA 5HULA 1XDLA 2QUVA 3UZJA 3ZWTA 3L5LA 2VFEA 2IQTA 1JCMP 1TPC1 2FTPA 3MYPA 3IVTA 2DZSA 4JDBA 3P60A 2FQIA 4CNNA 3L68A 2FPYA 3W7DA 3C2FA 1NSJA 1TPB1 5DLCA 2E5DA 1R2SA 3MYOA 3G3MA 1LTDA 1AG1O 3LI0A 3ABRA 3EWXA 2FLIA 3L0KA 3NQCA 1M6JA 1FWTA 1QDSA 2YW4A 3W7QA 4UXDA 5K4XA 2ZZ2A 2TMDA 1B9BA 4N9EA 2NUWA 1Q6QA 2DJLA 3NPXA 4Z0SA 3O07A 1SO6A 5F4XA 3C2OA 3MJYA 4PODA 1R46A 3TJLA 4H6KA 3RLVA 4DF1A 3IRDA 3GNNA 3UQNA 1OFPA 3B8DA 3NAVA 3P67A 1N8FA 4K8HA 4X2RA 5IM51 2PC4A 1QO5A 4RZ5A 3W74A 2Y7DA 3YPIA 5AHNA 1QMLA 5F2LA 3IIZA 5F2GA 4FHAA 1ONRA 4ADTA 4RK8A 2QCGA 1H51A 3QMSA 4R34A 1DORA 2V2HA 4UTWA 3W75A 2WQPA 1J2WA 3MI6A 5H2ZA 3G8EA 1DQWA 3QZEA 3E9AA 4QNEA 3LHTA 1MXSA 1UUMA 1JULA 1U83A 3CIWA 4Z08A 3JR2A 4XZ9A 3W2JA 3IIXA 2R8WA 5D30A 1ZAJA 2GQ9A 2E6FA 1OFOA 1FWWA 2UV8G 4RZ6A 5AC8A 1G7UA 1QAPA 3PUEA 3C61A 1W5QA 5I3GA 4CLMA 1VCFA 5D32A 1LOQA 4LC6A 4MZ8A 1IXNA 2GPTA 4ORIA 3B05A 1TPVA 3G1XA 3W72A 5HWNA 4O17A 3TCEA 1GG1A 1WAUA 2CLEA 3G0UA 1FCQA 2V82A 1R30A 4IPJA 3OG3A 4LVFA 5KZEA 3OIXA 4Y9AA 5AC6A 1OYCA 5LGXA 4ZMGA 5HWMA 4S2BA 1SO5A 5AHMA 3TMLA 6ALDA 3P84A 2J88A 4K7VA 2X1RA 3S1UA 4OGZA 4DO6A 3KRUA 4JNMA 3UWUA 4DF0A 4JTKA 4NZJA 5FESA 2VENA 2VEMA 3DHFA 5K3VA 3C4UA 1TV5A 5KTLA 1F6PA 3NM1A 2ZRVA 3QW4B 3WK3A 3IGXA 1V7YA 3G1SA 3NQ2A 3EXRA 3FEMA 3QRHA 3L2IA 2E6DA 1TPDA 3OVRA 3O6CA 2WKJA 1KA9F 1W5OA 1K7XA 1JR1A 2EHHA 3LHUA 4IXHA 1YLVA 1SW0A 3W07A 1B4KA 1GZGA 2OT1A 4IX2A 1G4SA 4AH7A 3WJXA 1KFJA 1UB3A 3W2NA 1TJRA 4MVAA 4PC8A 5ABTA 2J9XA 4XWUA 5AFDA 3NPUA 3IV3A 3NQVA 2QJHA 4WY0A 1H7RA 4FEZA 3RK8A 3GAKA 3MP3A 5C5YA 3HGOA 1TO3A 4O50A 5F4SA 1Q6LA 4D2JA 1SZGA 5CPNA 4GUIA 2E09A 3HPSA 3NEVA 1Z41A 4O52A 4HPXA 1PS9A 5EKYA 3W71A 1DJQA 4O0ZA 4AF0B 1O95A 2H8ZA 8TIMA 4HNTA 3DHDA 1KLZA 3HF3A 3NQ8A 5F2MA 3UWWA 2FIQA 4JIQA 2FPTA 3N73A 1I2QA 1L2UA 1EA0A 2A4AA 3TAKA 3GKFA 4YXGA 1W3NA 4FXSA 3W7JA 3G8RA 3W3OA 2Z2UA 2YYTA 4QITA 3M41A 2ATSA 1X8FA 2NV1A 1OK4A 4NX5A 4WOZA 3H55A 1H7NA 3LV5A 1AW1A 3TX9A 1QNVA 1TTJA 1GG0A 4WQ6A 3TSDA 5G4WA 5TIMA 3MHGA 2PRLA 2WSRA 1OX6A 2CLOA 4KWWA 3C3NA 3V1PA 2GVGA 2NUYA 3BARA 4PCFA 1CI1A 4UFJA 3VFLA 1H63A 1GJPA 5LNUA 1FBAA 1VGAA 3NQFA 4UFIA 1H7XA 3A22A 4L4MA 3QEZA 3GB6A 2R91A 4MLJA 3FS2A 3MWAA 3LTPA 3EXTA 3EX6A 1DV7A 5KMYA 3GLCA 5FF7A 2DZPA 2VEIA 4UCGA 1HO4A 3TSBA 3VE7A 4WJEA 5E1QA 3NXFA 3GNDA 1OF6A 4RKAA 1LBLA 1ICPA 4JTIA 4FNPA 3KOFA 1NF7A 5L6UA 1JUEA 3BGGA 3L9CA 2FB3A 4EF8A 4LUJA 2E77A 2YW3A 3V75A 1W0MA 3ABSA 4MKNA 3A24A 3LRMA 3G22A 3F4NA 3ELFA 1NEYA 1RR2A 4LNYA 3FKRA 2JGQA 4IMCA 4E2DA 3E0IA 3EWYA 2CFFA 4WY0F 1JUBA 3GDLA 2Y88A 4I7WA 3ZS4A 3INPA 4LVAA 3DFNA 3TC7A 1TQXA 2E68A 3P81A 1C9DA 1FCVA 2Z6JA 2Y7FA 2F84A 3GXPA 1WQ5A 3W7GA 4YL2A 3W1MA 3UZ5A 1EP2A 4NNCA 5HUOA 1TCDA 2ZTKA 3TA6A 2FJKA 3NPVA 2C13A 3LCLA 2VEKA 1JUKA 3GXTA 4LV4A 2NLIA 2A7PA 1SZNA 3WK1A 1HTIA 1XBXA 1GVOA 5DY2A 2QCFA 2I1OA 2PRHA 4AWUA 4ONVA 1LROA 1M7OA 3C56A 2G97A 3SR7A 1ME8A 1XXXA 3UXAA 1SPQA 5D03A 2HTMA 2QDGA 1W1ZA 2CZEA 4ZQCA 1KV8A 3PVFA 4FIRA 3TQKA 5HWJA 1KM4A 4GUGA 4AWTA 4UMCA 2CLFA 3LLDA 1JRBA 3LCHA 1LLZA 4M7TA 3CT7A 1ZCOA 4QNWA 3UY7A 1SUXA 3TFXA 2Y7GA 4DQWA 2HS8A 4GJ1A 4UNKA 3DU0A 4TMBA 3LRKA 3GDKA 3R8RA 2B7NA 4KFPA 2QUUA 5L9FA 1LOSA 3G1FA 4CNPA 3LCFA 1LDCA 3IIVA 3M47A 3CQ0A 4HIBA 3Q94A 4R7JA 3MUXA 4CCDA 3ANYA 4O4WA 5G1YA 5FF0A 1WV2A 2ISSA 4H3DA 4RJEA 4GUHA 3NDOA 3BG3A 1XCFA 4BFAA 2G96A 2F7FA 5FF3A 4FNQA 4JY9A 3DFSA 4PEKA 3TDFA 3ZWSA 5KITA 1XL9A 5T26A 2Y61A 1OX4B 5AC7A 2A7RA 7TIMA 2YCEA 3M6YA 1DJNA 3W85A 3NQDA 3PF3A 4O14A 3S1WA 5LNWA 1TB3A 4YMZA 3LOTA 4HT3A 1D9EA 5A5WA 4JGDA 2VC6A 3QH2A 2E5BA 2DP3A 5C54A 4UTIA 1GPWA 1K02A 3FLUA 4DF2A 1VCGA 4MYAA 3USBA 1XKYA 3N34A 4JXCA 1ZAIA 4UMAA 3IIOA 3PG8A 3QMRA 2OCZA 3QW3A 2CZ5A 1SU5A 3I65A 4IJBA 1LP6A 3A9IA 1PL9A 2QCDA 3Q58A 2Q8LA 2CU0A 4O1CA 4XBSA 1PHWA 3PSWA 1FDJA 3SZ8A 1YXCA 4X3ZA 4B5NA 2ISVA 1VC4A 3O15A 3E96A 1TPWA 4HSOA 4CCEA 4UUIA 3FYPA 1W3IA 2ZRUA 4M6QA 4A3UA 1TRIA 1TMHA 5AHIA 4P2VA 3RU6A 3GDMA 3EX4A 4PL2A 3MHFA 4O12A 4R53A 2FFCA 2V2DA 2OMAA 2ZTJA 4WZHA 2C19A 2NXHA 3EWUA 4MY8A 1XBVA 3FYOA 3W2MA 4AB4A 3R89A 3TNOA 3TKFA 1FWSA 1OJXA 4MOZA 4AVFA 4MY1A 4RXGA 3RNDA 2ISWA 1KW1A 3GIYA 4EOUA 5I3JA 1ICSA 4UTKA 1YPFA 1XI3A 2Q8ZA 3HG4A 3W23A 3BPWA 5G1TA 2PRMA 1TV8A 2ZA3A 1Q6RA 4EWND 3GX9A 3UD6A 3M0ZA 3MBDA 2BLEA 3R2GA 1IXPA 2WJZA 1CX9A 1L9WA 4TX9A 4DBDA 3PBWA 3W7MA 2JKEA 3W86A 5FI8A 1G69A 5BW6A 3L67A 3CPRA 4PFMA 1RQBA 5K7JA 3E12A 4HHPA 4EIVA 5BNKA 4ZQPA 1WOBA 1F74A 1L6YA 2WSQA 3WJWA 3W88A 3NL5A 3TROA 2XN1A 1YPIA 3TSMA 2DJXA 3G24A 3HO8A 5CPOA 4XKYB 3NQ7A 2Z1BA 5FEZA 1W56A 4UTWC 3I7RA 3JS3A 1QPOA 4LVGA 3AO0A 3W7OA 1I45A 1ALDA 1RQHA 3M5VA 4O0KA 5KINA 2WPBA 4EVZA 3IIPA 1RZMA 2V2CA 3STGA 1EB3A 3S8HA 2Y62A 2QCMA 3W84A 3HGSA 2V8ZA 4O1BA 1B3OA 4LT9A 1WX0A 1X1ZA 2ABBA 1EP1A 2YDAA 3NQAA 3O6DA 4NJJA 2DZTA 3I6RA 4AAJA 4OE7A 5CGQA 2C16A 5DCDA 2B4GA 1G67A 4CQAA 3CHVA 5I3HA 2GOUA 3O63A 3TQVA 4MUZA 4JS3A 2ZRXA 2QKFA 4FX8A 4LV9A 4JYDA 1KFKA 4JX4A 1O5XA 3QMTA 5HQEA 4JYFA 1KTNA 3C6CA 4FNTA 2ZZ4A 5F1VA 5BMWA 1EX5A 5KZDA 4Z1BA 3BVJA 3KRSA 1LBMA 2W79A 5D2WA 1TTQA 1ZY9A 4MJMA 1YTEA 2VFDA 1Z48A 1DQXA 1P0KA 3PB0A 4RXFA 4KFNA 3W6YA 3ZR4A 4QM1A 3HGJA 1K7FA 3FJLA 4K37A 5BOOA 1EWEA 1TJPA 3EEGA 1VCVA 1JQXA 3L5AA 4JTHA 1C8VA 3LCGA 3A5VA 1W5MA 3SJ3A 4M19A 4MIMA 4GE8A 3BG9A 4OBTA 1EPXA 3W1UA 3H53A 1VYPX 1W37A 1RPXA 3STFA 3TXVA 1NVMA 4HSNA 4Y6GA 1ZNNA 1R47A 2WV8A 4LC8A 3N2XA 2OT0A 3ATYA 4NXSA 3IVSA 1ZJIA 3HG5A 1A5BA 4O57A 2JKAA 3RLUA 3CIXA 2QR6A 1L6WA 2QJGA 3W7RA 5CKSA 2J27A 1FY6A 3CU2A 4NXKA 3W1QA 2NZLA 4BI7A 1UJPA 3LV6A 1FXQA 4GNJA 2V0TA 2JGYA 3EX1A 3SGZA 4O1DA 4S1FA 4JEQA 3L5MA 3LBCA 3NQGA 3SY5A 1G4TA 3FFSA 1GTHA 4HKPA 2CZDA 4ZQRA 2ZZ1A 2OX1A 3QYQA 4LU0A 5CZSA 4UIOA 2VELA 3KXQA 5FEXA 5LKYA 1PIIA 3STCA 1LRNA 5LHFA 2HS6A 3RF9A 1TPUA 2NWSA 3NO5A 5G5IA 2BX7A 5G2HA 3CM4A 2HMCA 1WA3A 1JRCA 4TU1A 2ZRWA 3KVMA 3A21A 3NGJA 3SFKA 3FJ6A 1B57A 1UASA 2X30A 4HPJA 4MZYA 2QEZA 5HMSA 1VYRA 5DCEA 4AHPA 3O16A 1LLWA 2RKXA 3DFOA 3BW4A 1DBTA 2H90A 2I9EA 1JCLA 1X7FA 1FDZA 3DGRA 2Y85A 1OX4A 3B06A 4XUGA 5D37A 4NJKA 3KFTA 4N6FA 4ORMA 3BGJA 5D2TA 1OF8A 3S9YA 4M7SA 3M9YA 4IPIA 3EWBX 2J6XA 3LHYA 1SW7A 3EWZA 3MHUA 2NX9A 3GAYA 1F73A 1SZFA 3W7KA 1DVJA 4QQ3A 5BRBA 1H5YA 2PCQA 3UNDA 3W7LA 4E0CA 2NX3A 4O16A 2EAWA 3P82A 3NL2A 4LW7A 4O54A 5G2IA 3TFCA 1A50A 2C3ZA 3Q37A 1FCUA 3B04A 4MY9A 3N14A 3TW7A 1Y0EA 3FOKA 4JTEA 3LTSA 1JVNA 4O13A 4U28A 2DORA 4Q4KA 3WJZA 3LERA 1HG3A 1YDNA 1VHNA 3VNDA 4UTJA 3NQMA 1SW3A 3UWYA 3M43A 5CSRA 3BK0A 3MBFA 3NPWA 1JJKA 1MO0A 1MSSA 4XTIA 4MFEA 1HO1A 5LZLA 1KFEA 3TAOA 3PSVA 3C2EA 4IQLA 4Q33A 2QCNA 1QCWA 2DZUA 1TSIA 3QJAA 1W8SA 1GVQA 4WXYA 4KWVA 1G6CA 1TQJA 4JN6A 2EGZA 1FWNA 2OZ0A 4Z1AA 5HR7A 1AL7A 1N7KA 3B0VC 2Z6IA 2EKCA 1LYXA 3GK0A 4PTNA 3HOJA 5LHEA 4LS1A 4UFLA 5AN7A 3W1LA 4YLWA 5TQLA 1UCWA 1H62A 3NZ1A 5FEWA 4XQ6A 5A8GA 3TMQA 4O53A 3HMJG 1OFEA 1H60A 3BW2A 4K6AA 3GVGA 2CW6A 4DBEA 4FX6M 3PG9A 4UTTC 3W7PA 1SFLA 5AHFA 2XN2A 1MZHA 5DBUA 5EY5A 3P62A 1W5PA 1S5VA 2LLEA 1O5KA 3KVKA 1YDVA 3NYZA 5HR6A 4XKYA 1TIMA 2ZFAA 1FQ0A 4UTUA 4NNBA 4BF9A 4MJZA 4N9DA 3LTYA 5IBXA 2XN0A 3PUDA 4RZ4A 4MLRA 2ZYFA 3B0PA 1GVSA 1MEHA 1UUOA 3W7NA 3LGEA 4BWLC 4Y96A 2DU2A 1QPNA 3QM3A 5DBTA 1R2RA 3LXAA 3P5ZA 1VQTA 3P7YA 4S2CA 5D2XA 3QPYA 4BK9A 3W1PA 1H7PA 3O6YX 3U6WA 4LVDA 3CC1A 2QDHA 3C8FA 4DO4A 3CEUA 2ABAA 4K38A 2D73A 4K39A 1UBSA 2YGYA 2XFWA 3G0XA 3U2OA 1NAL1 4UTTA 3WK2A 1HUVA 4I7VA 3W2KA 3MMTA 1EP3A 2A5HA 4Z1DA 1YXYA 4JTGA 1N55A 3LI1A 4ADSA 5K9DA 4UFMA 4N2YA 4NJHA 2H3BA 3EXSA 2GVJA 2TYSA 1SSDA 1XFBA 1JCJA 2OJPA 2YZRA 3LXCA 2X16A 3G0SA 3DI1A 2QUTA 3VE9A 1BEUA 1SFJA 2BXVA 2V5BA 5G4EA 5AB3A 2R14A 1C29A 4O11A 1VLIA 4BWLA 1IF2A 3KAOA 3P74A 1FUYA 1H1YA 5EA9A 3P80A 4LRSA 2G5WA 4NJGA 2Y7EA 1OFRA 2E5CA 5CPLA 3SSJA 2WO5A 1S5TA 2E1DA 3N3MA 3N19B 3MI3A 1AMKA 3JRKA 2NUXA 2Y6ZA 1W3TA 3W1NA 4QSHA 1OFAA 3MW7A 3M44A 5I3FA 4LOCA 4FF7A 2ALDA 3FKKA 1GTEA 1GEQA 1I2PA 2WSYA 3Q2DA 1IIGA 2HSAA 3PR2A 4ZQMA 2VEPA 1LBFA 2P1FA 2BZNA 1K03A 4ADUA 1QWGA 2YXGA 3NL6A 4WX2A 2NXGA 1M5WA 3W7HA 2C0AA 2FDSA 2TPSA 4N4PA 1D3HA 3MP5A 1BWKA 1EUNA 1KLYA 3QC3A 3QQ0A 2ZDRA 4NNAA 1YDOA 3LXBA 3HQ1A 3ABQA 1KTBA 1W5NA 3SI9A 4JX5A 5EPDA 1AL8A 5KSWA 1LRQA 4ICNA 3LCWA 3RMJA 1RQEA 2EPHA 2E6YA 3TIMA 1VH7A 5LSMA 2TRSA 1G4PA 2YR1A 1KM5A 1M7PA 1WXJA 3QFEA 1S3HA 3W73A 1ZHAA 1OFDA 1IXQA 3KRZA 3KVLA 4O8RA 1VYSX 4OHQA 5C2XA 2WNNA 3PM6A 1Z44A 1FX6A 2ZQ0A 3LHVA 2A6NA 3W76A 4X9SA 4C1KA 3QQ1A 3SIZA 1TTPA 3UPWA 3HBLA 3PAJA 2QAFA
chains in the Genus database with same CATH superfamily
4N9BA 3BLFA 4DNMA 4GVIA 5EYWA 1GNXA 3MT1A 2MNRA 1DWFM 4EF9A 1F3EA 3PZOA 4WXZA 4A6GA 4GGBA 3SCRA 2E6AA 2WMGA 5DXXA 4ZTXA 5ABFA 1EWDA 1M03A 2H8XA 4Q8WA 1I2OA 3BL3A 2O7SA 1A3WA 5U7SA 1J96A 1E6ZA 1ZENA 1NDZA 3PFRA 4RV3A 4QISA 2GFTA 3VCRA 3U2CA 1YIXA 3P5YA 4HJWA 4AD4A 1UPMB 1UR4A 1SVDA 1X1OA 5F1UA 3EWWA 4GWEA 5IOBA 3PHAA 4NIRA 5T9CE 3RAOA 4BS0A 3WFAA 4HNVA 1KQZA 1CXKA 3SCWA 1OQFA 3UR8A 3N9RA 4JFVA 4QJ3B 1MNSA 2HZGA 5K9XA 3VIOA 3H4GA 5HANA 3KVJA 3ZO9A 1YPXA 3K4WA 1O60A 1UC5A 3BV7A 5EL1A 5HMEA 2Q01A 4FX7A 1MNZA 5HINA 1I9CB 4GQBA 4JTSA 4ZZ9A 3HV9A 3ES8A 4JKKA 1L6GA 3S47A 2WNZA 1H09A 3VOFA 3ZR6A 3F4VA 1NF0A 3M1ZA 3N9KA 2C18A 4GINA 4N4QA 4EPDC 4E4PA 2ZXAA 2KZHA 3FA4A 1OYBA 2CESA 2J79A 1R87A 4WDTA 4IHCA 3IGSA 4G1KA 3CMJA 5DELA 1IWBA 4F0KA 4DJFA 3M0IA 1I60A 3W0KA 4MGGA 4Y8FA 1PZ1A 1V6TA 1TV7A 1XSKA 4HMEA 3DKLA 4DEFA 1W1YA 2X1TA 1RH9A 3GFZA 2B0MA 4QGCA 1E1CA 2GJXB 3VMOA 4V1XA 2CLKA 3DBNA 3RPDA 3SUVA 4AIUA 1BF2A 4AZHA 4JEJA 2GL5A 3WF2A 3VGGA 4C1NB 3EA3A 4F0LA 3N2CA 1QO2A 2NQ9A 1DJWA 1FWBC 2VDGA 5MHBA 2QUMA 4OV4A 1I2NA 2G3JA 3FJNA 4N6EA 2RDUA 4ZL1A 3CLMA 1VFTA 4ALDA 2O7QA 3UPBA 3R25A 3OQ8A 5FJPA 5A6TC 1ZBVA 3P6LA 3GDRA 4FMVA 2HK0A 2IMRA 2PGEA 2H6RA 4Q6XA 2CERA 4C6BA 3W25A 3T07A 2Z26A 3DYMA 4GKLA 3KOXA 4GIRA 4PBEA 5DY3A 7REQA 2R1NA 3TXZA 4L64A 6TIMA 3TJXA 3EA2A 1VS1A 4H1ZA 5BMXA 2YXOA 4XUYA 3FIGA 3KOZA 2XJ7A 5CSSA 4IGHA 3KHJA 2WVVA 3W2UA 1TFVA 2P3EA 2X1SA 5IHRA 1UH4A 2WKGA 1OBAA 1WXYA 1OVDA 2NX1A 5KZMA 2NXIA 1F61A 3E49A 3FDGA 3REQA 3QYSA 3OB8A 1SZEA 2IUZA 3T55A 3TYBA 2XG9A 3EOLA 3HPFA 1A5AA 3DDMA 4JICA 4XBKA 1HT6A 2E25A 4D6EA 2W63A 4ROQA 3ICJA 1P0BA 3WQ6A 3LBMA 3FA3A 1KM3A 3HM7A 1EBGA 3VO0A 1EIXA 2VFFA 4UR7A 1KWGA 1KTCA 1OINA 1LOLA 2GOKA 4PUDA 4KCTA 1AQ0A 1QR7A 5BRPA 2OSYA 3KP1A 4LAZA 4NX0A 5F4WA 1QUMA 1ME9A 2JK2A 2J7BA 1PB0A 3A3XA 3L4ZA 2ZX6A 1CGUA 2QCDB 1P4CA 1GVFA 3BLOA 3SGUA 3V0SA 1K7EA 3TTOA 5I3DA 1VFHA 3AIEA 4B90A 3EOEA 4YTSA 4OFCA 3UVIA 2WJDA 2O56A 1Z42A 1DKWA 1OFQA 4B4HA 4RPPA 5DMYA 3G1DA 1MXDA 3IANA 4P5UA 3TK7A 3B8VA 2OELA 3G18A 4HNCA 1YE4A 4B15A 1C8XA 3QF0A 4K36A 3NO3A 2QNEA 4GRSA 2IXVA 3WO8A 5I00A 1CT5A 1YBQA 1AK5A 4NY2A 3N9SA 2VOTA 3NVTA 3GHTA 3TLQA 3VX1A 2QCEA 4KETA 4KKXA 4M29A 4R3UA 3BOFA 1R8LA 1F8IA 2XGIA 4K7YA 1WDPA 2DT1A 1TZZA 4AUBA 3SECA 3WSUA 2PWUA 2Z2AA 5H91A 3CYJA 4GKTA 3B9OA 1VFMA 4QG6A 4GYFA 1LQ0A 2DQWA 4LRTA 4PMYA 3L12A 4S3BA 3KDOA 2Z1VA 4JKLA 1F6KA 1X96A 1XYAA 1F2JA 5CGTA 4E6MA 4DM1A 1HJQA 1AA1B 5DO8A 3GNPA 2DZAA 2QDDA 1MEIA 1US2A 4JTAA 2VKZG 5I03A 2FVKA 4JOMA 4E4UA 1XRFA 1A0EA 4UFHA 1V3JA 2BWGA 3NM3A 3LHZA 3S3GA 4F66A 3GXIA 1WBHA 2OYLA 4IIFA 3NJ3A 2WWDA 3FW6A 4H9YA 4AYSA 1FWCC 1LRTA 1FWRA 4HYRA 4A4AA 1IV8A 3E2VA 2JEQA 5BZAA 4ZQOA 4PCTA 4V15A 2ADAA 2OO0A 1XUZA 3O6AA 2Y89A 4JY8A 2VZVA 3CO4A 1UKSA 4MPKA 1K3UA 2BXZA 2GSJA 4FPSA 4PB3A 1QTWA 3MUIA 3B9AA 2NLYA 3S5OA 3MDWA 3WQ8A 1PKMA 4LQ1A 3GXDA 2CLIA 1E73M 4X0NA 8XIAA 1OFBA 2QVNA 4FS9A 3E2SA 4WRHA 2B81A 1KC7A 3OBKA 1J6PA 1OSEA 1JQVA 5D2VA 1N8WA 3TE9A 1XP3A 1EBHA 3UT0A 4IMFA 3OOQA 1CTNA 4DELA 3OW1A 3PB2A 3A9BA 1MYRA 2DVTA 3W83A 2GGJA 3TJIA 5FACA 3TUUA 1PCWA 4JD4A 2Y5SA 3S1VA 3TTEA 4TQTA 4C6JA 4YNGA 3UR5A 5LIWX 4LEQA 1L6FA 1XGEA 4BQ5A 1QPQA 1Y5WA 2D1ZA 3T1GA 5HQMA 4WJXA 2AKZA 1XBZA 2OQLA 2YFOA 3HPAA 1VFUA 3WNPA 1TPFA 2BGQA 5I3KA 4HA3A 1F05A 1A47A 1O4UA 3BLPX 5IFPA 3F1QA 4U10A 3AAMA 2CHRA 2Z7GA 3L0NA 2B7PA 1LM1A 4Q32A 1YX1A 3ID7A 1U5JA 2PDCA 4KEZA 3DFQA 1K9DA 1X97A 2C6QA 4GGHA 3W9ZA 5K4ZA 1MW1A 1K8ZA 1NM9A 1P7TA 3IEBA 3OZOA 3PZVA 2WHJA 1R3WA 2OG9A 2ZA2A 1GQNA 4AXKA 3PNZA 5CLTA 3S1XA 4WUIA 2PLCA 3GQYA 3ORWA 3UCQA 3V5CA 3GYEA 4GUFA 4HQVA 1QI4A 3WLKX 4JFWA 1KBJA 5H8MA 2RUSA 1EDGA 3I7SA 4M8UA 3M5ZA 1OK6A 1WBJA 2VQUA 4UR8A 3SJNA 1Z32X 3I68A 4A35A 2FYMA 3KWSA 2PDWA 3W7CA 3CH9A 1KKOA 5HOSA 5BOEA 1AW2A 4KRZA 3GTXA 2O92A 4DNHA 4TTUA 3BOLA 4UMBA 1HKVA 3BW3A 2PWVA 1HKIA 2QJIA 3KOYA 2RAGA 4GO9A 2A7NA 2JIEA 1UW9A 5A6JA 4GABA 2VFGA 4O15A 4PRRA 3VOIA 2ZXBA 3KBVA 1V7AA 2PGWA 3O1NA 4GXMA 4PMVA 1O1HA 4ZSUA 5CLWA 3WF4A 3FK4A 2MANA 1EA9C 1KR1A 1E6NA 3PNUA 5HULA 1M9HA 1NOUA 4B3KA 2NW0A 2QUVA 3ZWTA 3L5LA 1VIZA 3MMUA 1JCMP 1TPC1 4H41A 3WUBA 4J4KA 2D2JA 1VEMA 4JDBA 2ZUNA 4BQ2A 1JI1A 5EFFA 4I6KA 1H41A 5DLCA 5A95A 1AJ2A 4HA0A 4ZENA 3LI0A 1QDSA 2XFYA 3W7QA 4TUFA 1OZQA 3TONA 1B9BA 2DT2A 3NPXA 5A69A 2PTWA 4Z0SA 4IFOA 3GBDA 1SO6A 5F4XA 3C2OA 2ZIDA 5LIXX 3RLVA 1CGWA 3GNNA 1ZRQA 1BYAA 4K8HA 4X2RA 5IM51 2PC4A 3UXIA 3QZAA 3W74A 1D8WA 1OB0A 1LWIA 2BOEX 5AHNA 5F2LA 3WUEA 1V6UA 4AZCA 1ONRA 4RK8A 2QCGA 1RVKA 1H51A 3AUJA 3BAYA 1W6TA 1DQWA 1GEHA 1PPIA 2J7HA 4PMNA 1MXSA 1O68A 3S1GA 4Z08A 1ONEA 3WBWA 4XZ9A 4K1GA 3N13A 1E15A 1R9ZA 4EP8C 1VPQA 1ZAJA 3POHA 4IP4A 1FWWA 4RZ6A 2D69A 3S2MA 2HPMA 2VURA 3C61A 1XRTA 2YDSA 4CLMA 1XINA 4LC6A 3B05A 2IKJA 4WK9A 1V3MA 5LIUX 1WAUA 3SCVA 1C8QA 4NI8A 4DBSA 3VCCA 2V82A 3QVQA 3OG3A 1GOKA 4UQCA 4D8LA 2EPMX 4HOWA 2O9PA 3M46A 5MF5A 1O5QA 4JN7A 4PMJA 1FKXA 1SO5A 2GK1B 1FFRA 4GA8A 2WPGA 3TMLA 2OOGA 4Q7BA 3GHUA 4NZ5A 4PMZA 1ITCA 2JE8A 2X1RA 3S1UA 5A6MA 2WLYA 3KRUA 3QV8A 4JNMA 4DF0A 3VAVA 2PDQA 3C0SA 1EPVA 3AOFA 3L23A 4B3LA 1F6PA 4NZCA 3SBFA 2FZDA 2E6DA 4J3VA 3VABA 1TPDA 5GJPA 2PWEA 2OVLA 3DIPA 1W5OA 2C71A 2EHHA 2OODA 1YLVA 6CGTA 2OT1A 3NSMA 3WQVA 2QDEA 1G4SA 4AH7A 5FSDC 2Q71A 3E74A 3WJXA 3S2JA 1KFJA 1TJRA 2IKGA 4PC8A 2ZDSA 1W9PA 1YNYA 2J9XA 5AFDA 1OG6A 3CASA 4ZB2A 3AS2A 3NQVA 4WY0A 1H7RA 3RK8A 3EB3A 3ITVA 5JBEA 1VF8A 3QHNA 4O50A 2ASHA 5CPNA 3HPSA 2BOFX 1KB3A 4L80A 2QPSA 3UR2A 1Q8AA 1SJCA 1E55A 1QASA 4HHLA 3VIHA 3HFYA 4HNTA 1KLZA 1VEPA 4HD5A 2FPTA 2IS7A 3ZLFA 4LB3A 1UA7A 3WUFA 4V28A 4MWAE 1SJAA 1PZ0A 3WEZA 1V03A 1EJUC 1W3NA 4FXSA 3T0DA 2E4TA 2YYTA 4QITA 5ABGA 1XLBA 1ZP4A 1OK4A 1IEWA 5A3HA 1GG0A 4XG1A 5TIMA 1GGOA 5BXPA 3C3NA 3V1PA 3PFMA 3S5SA 3BSGA 1S1PA 4BKNA 2HVNA 1UWTA 3VM5A 1QNOA 2XM2A 4UFIA 3TYUA 5G1MA 4MLJA 5J8LA 4HHHA 5TD4A 3EX6A 2EJAA 5KMYA 1UIPA 1TWZA 4LAUA 4EXQA 3EDEA 3N17A 4HZ8A 1GHRA 3RO6A 1TKKA 5E1QA 1RA5A 1R3RA 1CXIA 4IGMA 4E2VA 4Q8OA 3SDOA 1OF6A 4RKAA 1ICPA 3TWAA 1NF7A 2DSWA 1JYWA 5E09A 1XSIA 3U7BA 3QOMA 4Q8PA 2E77A 3KBMA 5BU6A 3DX5A 1HKMA 3ZYZA 3T8LA 1O5RA 2E67A 4J7RA 2GJXA 3DESA 1TR9A 3LBOA 4JIEA 1E9IA 1F4HA 3PZNA 4RDWA 4WY0F 4CGTA 3CJPA 4NRRA 1E0UA 4I7WA 4C91A 4C1NA 3ZS4A 1Q4NX 1DTNA 4LVAA 3DFNA 2E68A 2J13A 3VX0A 2EO7A 1JZ2A 3ITCA 3MANA 2A3AA 4NL1A 1KRBC 5GPRA 2ZE3A 1FWEC 4YL2A 3W1MA 3SRKA 3XISA 4H9XA 4NNCA 3RRAA 1JUKA 1TMQA 1VJSA 1SZNA 1XLMA 3TN6A 2HQAA 3M0VA 2RGLA 3A4JA 1XBXA 1GVOA 3ARSA 3C0QA 3BTNA 2I1OA 5C9WA 3BXWA 2HTMA 5I07A 2CZEA 1NWRA 2DZBA 1EHNA 3U9IA 3MCMA 5HWJA 1TWDA 1XLCA 1FTXA 2CLFA 3LLDA 4M7TA 1W2VA 4QNWA 4QXIA 3H24A 1RA0A 3AIQA 3ES7A 3AHXA 3GDKA 1RJQA 1GJUA 4DXXA 4XZHA 1CBGA 6XIAA 2PLMA 1BWVA 2CEQA 1LOSA 3G1FA 3CQ0A 4W8BA 2HVMA 1XYCA 4O4WA 1AODA 9XIMA 1SJBA 2YB1A 1DIDA 2ISSA 3PJXA 3WH5A 3NVDA 4X2PA 1CGVA 2DIKA 4S3DA 1BLIA 3DFHA 4XD4A 5FF3A 5FA5A 3VOCA 3DFSA 3FN9A 4GQGA 4PEKA 3IK4A 5T26A 5KITA 1Y65A 4MMWA 1DJYA 1DJNA 3W85A 4X60A 1EYWA 4AQLA 1TB3A 4YMZA 2V38A 4HT3A 3ARYA 1V02E 4LB4A 5A5WA 4JGDA 2XVNA 3AHYA 3L4VA 4S38A 1V6WA 1K02A 1D3CA 4TVCA 3WUGA 1W3HA 1YHTA 4IFKB 3N34A 5AC4A 3LMZA 3CL6A 1QI0A 4LBRA 1QPKA 4UMAA 3WIJA 3BLDA 3VMPA 3QMRA 2R82A 1SU5A 4YVPA 2WK2A 2QCDA 1HJXA 4O1CA 3VGDA 5BYWA 2VR5A 3O15A 3E96A 1NWUA 3VPLA 4ZCWA 4M6QA 4GX8A 3TCSA 5AHIA 2HROA 3RU6A 4DJDA 3EX4A 3UCCA 1E6RA 4R53A 3TTYA 4DJFD 4WZHA 1H5VA 3EWUA 4R27A 3W2MA 3THCA 1U5HA 3TKFA 4MOZA 4JIRA 4WSJA 2ISWA 1KW1A 4EOUA 4UTKA 2YL9A 3AYRA 5G1TA 3CXOA 1PSCA 3TN3A 1K9FA 3UD6A 3SY1A 1IXPA 3ABXA 3WZ0E 3CPUA 1P0EA 3GTNA 3W7MA 2JKEA 4PTWA 4HN8A 5BW6A 3L67A 3GU1A 5K7JA 1DWHM 5A6KA 1B3YA 1V77A 4F2UA 1MDLA 1L6YA 3WJWA 1T40A 3SGGA 1JGIA 1YPIA 3G24A 2VWSA 1R86A 4IIGA 1E0XA 1R3TA 2PDLA 1RK6A 3GWQA 2CXEA 4LVGA 1I45A 1NDVA 3M5VA 4B91A 5KINA 5T91A 2W4XA 4NYUA 2V2CA 1ISWA 1TZ9A 1HX0A 1UR9A 2QCMA 2V8ZA 4QE5A 4I5UA 4AX7A 1WX0A 2ABBA 4YVVA 3KM8A 2DZTA 4MDPA 4NAEB 2DSUA 3VGEA 5DCDA 4E5TA 2VI0A 4IM4A 1EKOA 4CQDA 4YTTA 3O63A 4XAFA 1R38A 2QKFA 3WFZA 2INEA 4JYDA 1ISZA 1MW2A 1O5XA 1D7KA 3N4AA 1XRVA 1Z3NA 2P50A 4Z2HA 1R3VA 2FGBA 5KZDA 1S38A 2C91A 3N6QA 3ZIZA 4JTCA 4MTVA 1FKWA 1QU4A 2Z00A 4MHBA 1TTQA 4GZEA 6PTDA 4C6LA 1YTEA 1JDAA 2OSXA 5I5RA 4F79A 1DQXA 4J3TA 3PB0A 4KFNA 3W6YA 4QM1A 3URQA 3FJLA 4K37A 1DTUA 1EWEA 1TJPA 3CL8A 5LIKX 3TR9A 1C8VA 3LCGA 3A5VA 4C6PA 3GHSA 3OZPA 4M19A 3H53A 3TTQA 1KCKA 1IZCA 4HSNA 4Y6GA 1R47A 2QW5A 3N2XA 2YCLB 4NXSA 3ARUA 4YWSA 4Q8TA 3IVSA 3HG5A 2Z7KA 4O57A 3B8IA 3RLUA 1XG4A 1L6WA 3LPGA 4QP0A 5I06A 3W1QA 2FHFA 3GC4A 3LV6A 1MQRA 1FXQA 3PPFA 1VB9A 4IPNB 2IQDA 2JGYA 2V0TA 1QHPA 3LBCA 5MKGA 3IJ7A 3V7PA 3WNMA 1G4TA 3H2CA 4DY1A 3CZEA 3K8LA 2ZZ1A 2OX1A 3QYQA 4UIOA 2Y8UA 2VELA 3KXQA 3LSCA 1PIIA 4I8YA 2PDXA 3W24A 5T8GA 2OGYA 3H7UA 5LHFA 2XIOA 4GI4A 3RF9A 1HL9A 5EMJA 4PUJA 5FOOA 1TELA 5G5IA 4Q8MA 3TZFA 2BX7A 1E6PA 2QMJA 4WIWA 3CM4A 4GVHA 1WA3A 2ZRWA 4CD7A 5F7UA 3BQ5A 1S2WA 3IRSA 4NG3A 3A4AA 3W28A 2NQHA 2X30A 4HPJA 1TA3A 1BSIA 4WKFA 1DXIA 1VYRA 5DCEA 1LLWA 1DBTA 2CIPA 4GO8A 4JTRA 3C8NA 1JCLA 4H2HA 4JCLA 5GNXA 1VIWA 3DGRA 3M0XA 1OX4A 4PGLA 1UROA 4NJKA 4GFIA 4JHMA 4CEXC 4UZSA 2XIJA 2V5DA 2OWXA 4GIYA 1OIFA 3HMCA 2WXDM 2NX9A 3QZ6A 3GAYA 1F73A 3LPPA 1PWMA 4QQ3A 3F2DA 1J12A 4K8GA 2EAWA 2GWGA 3B04A 1Y0EA 1RALA 1Z9AA 4QE4A 4RNHA 1TE6A 4Q4KA 4DI8A 3EEZA 3LERA 1RLCL 1VHNA 5BRQA 4L6DA 3M43A 4UNIA 4MG4A 1R5YA 3UXLA 1JJKA 1MO0A 1V79A 3MZ2A 2A3BA 4XTIA 1B3WA 4P8XA 1KFEA 3TAOA 3DG3A 1NQ6A 4IQLA 4Q33A 3VC5A 1XIHA 4QS6A 1OD0A 4CN1A 2BV9A 2PDHA 3R79A 4WXYA 4KWVA 3RXZA 4JN6A 2EGZA 1PTDA 3WDQA 1FWNA 3KP0A 2REQB 5A1AA 4Q8QA 5HR7A 3E0WA 2QIWA 3N29A 3B0VC 5BU9A 4O8AA 4LS1A 5AN7A 3W1LA 4A8LA 3F5LA 3IJQA 2NT1A 3VU2A 4X61A 4XQ6A 5A8GA 5EB8A 1OFEA 4L1XA 3ZMRA 1B3XA 2QXWA 4JFUA 4GJIA 1CXFA 1GQKA 1LWJA 3I4EA 5EY5A 3P62A 1W5PA 1S5VA 1AQHA 3KVKA 1R7OA 1YDVA 3Q45A 1EZ2A 5HR6A 4XKYA 1TIMA 3W81A 4BF9A 3V0UA 2ALRA 4NILA 3H7RA 5DT5A 1GVSA 4KS0A 3CGTA 3TYAA 2INFA 2PBOA 3W7NA 1W3KA 2J8FA 1POJA 2YLLA 3E0FA 1QW7A 3IJIA 3LXAA 4AZGA 1VQTA 3QPYA 3O6YX 3U6WA 4LVDA 2QDHA 3WY1A 3DHPA 1W1VA 4PULA 2ABAA 1IR1A 3U5UA 1OGSA 2Y24A 1ZS2A 3BCFA 1M65A 4MAVA 4B9ZA 3U2OA 1NAL1 1HUVA 4I7VA 3W2KA 7CGTA 2A5HA 5E6YA 3VDCA 1YXYA 1N55A 3LI1A 3EA1A 2VZTA 3R8GA 4NJHA 5DMLA 2QV4A 2PP1A 3VUPA 1SSDA 1XFBA 3F2BA 1A5UA 2WCGA 2YZ5A 3G0SA 2QUTA 3VE9A 1BEUA 3POCA 5HDRA 5G4EA 1XIIA 5AB3A 6ENLA 2ODOA 1NOWA 2R14A 4O11A 1X6LA 1J2BA 1IF2A 1FUYA 2WSPA 4BZYA 1RP8A 3UR7A 1OFRA 1A0CA 3KBWA 3P0WA 3W6MA 2E1DA 2NUXA 3WF1A 3KTXA 1XCXA 3HU7A 3B8SA 4LOCA 3GTHA 1Q5MA 3LN3A 2HJPA 1GZJA 3Q2DA 1Q2SA 1IIGA 3PPHA 1OEPA 4ZQMA 4AX6A 1HP5A 3AHVA 1K03A 1JIBA 4GX9A 4ADUA 1QWGA 4QROA 1HGYA 3NL6A 2NXGA 4C7DA 1M5WA 5DX7A 2PZ0A 2FDSA 4IGNA 2TPSA 1XKJA 3NTYA 2DT3A 4PMXA 1KLYA 3EB4A 4XX6A 1YW1A 1O12A 2PGRA 3HQ1A 3ABQA 2C8NA 1KTBA 2GK1A 3SI9A 3ITGA 1AL8A 5KSWA 1LRQA 4ICNA 4PRWA 3LCWA 3RMJA 2POTA 3TIMA 1E43A 1VH7A 4WF7A 3ARWA 4S3EA 2YR1A 2OSWA 4PFHA 1M7PA 4PCPA 2ZX8A 1WXJA 1S3HA 3FVDA 1CPUA 1JG9A 1ZHAA 1NOFA 4LCSA 5C2XA 3PM6A 1Z44A 1FX6A 3UF9A 3LHVA 1BQGA 2JEPA 3W76A 4C1KA 4H00A 3OLIA 3UPWA 2VCBA 4D6CA 3DOPA 2GSEA 1ODUA 4J2MA 4HVXA 3ZJ7A 3SSZA 5FSEC 2J62A 4WEVX 4M6VA 2ZZ5A 4C1LA 3GXMA 2WKLA 1XIFA 4AD3A 1LJYA 3N18A 1OADA 4WD0A 1C92A 2GVEA 2XH7A 4EACA 1RUSA 3JW7A 2J9ZA 3S46A 3AIWA 2AQWA 1FCBA 2BGSA 3BMWA 3SCNA 2A1YA 4CU6A 1HVQA 1WNOA 3D5HA 4Q8UA 2ZE0A 4LUSB 3VD3A 2Z4GA 1BGGA 4MYXA 3F7JA 1XC4A 4KWOA 2CLHA 1M7JA 5DF0A 2Z1XA 4FOKA 4QCEA 3TW6A 1JCYA 1M01A 1DIKA 1XPYA 1FA2A 1H1ZA 4ENLA 1XR2A 2W0UA 1JGMA 4LALA 4FNRA 4XAPA 4GY7A 4GZJA 3RFAA 5AKQA 5BXRA 1R3SA 4LYRA 2NWRA 2GYIA 1B0IA 3LDVA 1T8QA 3LZ3A 3LM3A 5D09A 1F3TA 3IWPA 1A53A 1WP6A 3FA5A 3IGHX 4CNTA 2WZHA 1XW8A 4D71A 2RDWA 5FJRA 1JPMA 4QAIA 2WNQA 3HIJA 3I7QA 4W89A 8A3HA 2DPEA 4GVGA 2V9DA 3I6TA 1Z6KA 2PDFA 1MW3A 4GHRA 3UYCA 3NOEA 4GVFA 4ILSA 2PF0A 3V1HA 1XGZA 2TSYA 4DN1A 3OGSA 4U4MA 2FJUB 2ZOXA 4BCEA 2X05A 1OYAA 4M56A 1NFBA 3K8KA 1GK8A 1CECA 5FAGA 1LF1A 3QKEA 1ENUA 3UJ2A 5D8ZA 3CLWA 2QAPA 2DIJA 2PAJA 3D47A 1YTKA 1MWOA 1UPPA 1M68A 1H7WA 1D2KA 3OTRA 1X8CA 2DUXA 3DZ1A 2YSWA 1Q45A 1XUUA 2DQXA 4L1WA 4AHQA 3PBGA 1G7VA 2OQYA 3MVIA 2D20A 3N11A 4I9AA 2W91A 1FH8A 3VFCA 1ZTVA 4KEVA 1DJXA 3VVGA 3VNKA 4XSMA 5DXYA 3M0JA 2D0FA 2FHCA 4LEFA 4FXRA 1PV8A 1VJIA 3PWAA 1Z89A 1US0A 5U4NA 3UY8A 3R5EA 4OIFA 2Y70A 5DFAA 2R94A 4IMDA 3A5FA 2ZC8A 3DC8A 3M16A 3QKZA 1QOQA 1OC7A 4MNKA 4KCVA 4LUYA 4A22A 1XF0A 5EMUA 1PKYA 4NUWA 1XLLA 5J5RA 5F2IA 4LH8A 2DZXA 4RW5A 3CB3A 2P53A 4MDOA 1L6SA 1PVNA 2FMOA 2CLPA 3PTKA 2GUYA 3SCTA 4LF1A 3LUTA 4AZ6A 1XGDA 4A2RA 1YYAA 4UQAA 3AXIA 5AOUA 1IHIA 2CCRA 1THFD 4KFOA 1KM1A 1HKKA 4XZLX 1QW9A 3G6LA 4LFYA 4NU7A 4O1FA 4JX6A 3TN5A 1Q7QA 2CC0A 3GR4A 4BI5A 1WO2A 2W27A 1BYCA 4DXVA 4JQ4A 2JQXA 3IVUA 2V68A 1UZ4A 2DVXA 4IFKA 3B0XA 2CBJA 2PTXA 5HNRA 3CB8A 3BGAA 1MW0A 2GLKA 2AGKA 1WB0A 2X1UA 1ZPTA 1PE1A 3WH8A 3MV11 3PY2A 2BSLA 4QQUA 3A64A 4QEHA 1P1XA 1H50A 1ME7A 1WPCA 3VC6A 3VNJA 4PMRA 3E6EA 3URBA 4JIPA 4X9YA 3LLXA 3TR2A 3R7MA 3LGDA 2MUCA 4OU1A 1KBIA 3GR8A 3U8GA 1RD5A 1Y8BA 1K6AA 3VK5A 1YMYA 3USZA 4GY1A 4QEEA 2PBGA 1IEQA 3P8JA 2JF6A 1ML1A 1BWLA 4IICA 2VUYA 1TPEA 2V30A 4N7QA 1LORA 3GTFA 4L9ZA 4IX0A 3B4UA 3EGJA 3XINA 2G95A 5CZKA 5JH2A 4KRTA 4TIMA 5C55A 3W2LA 2VP8A 2I17A 1T96A 4DUWA 5HNTA 1G0CA 5C0QA 2FH6A 4PB4A 4F0MA 4AY7A 5AYZA 5FF2A 1ITQA 3BAKA 1BTCA 4IMEA 3ATZA 4JTTA 4LTSA 5CSYA 1MI3A 3BICA 3GDTA 3B3DA 4ATLA 3QHOA 1UD2A 2J7DA 5D04C 5C9XA 2DZVA 2V5LA 2FDMA 4JTFA 1IGSA 1ADOA 3B03A 3EDKA 3PZ9A 2A2IA 4UB9A 4FXJA 2JKPA 1IT0A 4M24A 1XLIA 5ECUA 1K8YA 3DECA 1ICQA 4KEUA 4S23A 4ZXOA 4KEMA 1JZ7A 1L0PA 2VTFA 5EMLA 2I14A 2F61A 2ZA1A 2OZ8A 3VIKA 3OVQA 4M51A 1T6MA 1MEWA 2VXNA 1W9VA 2O55A 2CLLA 1V3HA 3N04A 1XS2A 4NAEA 4FLQA 1PUDA 2VFHA 4Z42C 3MU7A 3ABZA 1H0IA 3BCJA 2ZKMX 3F03K 4A29A 5FJIA 4AIBA 3RM9A 3VIPA 1P0NA 2VGFA 4QDPA 1EGZA 1ZAHA 3UG8A 3PUGA 3W1AA 4RCXA 3N3TA 3K46A 3HB9A 4RNIA 2A6LA 2NQLA 3RITA 4AVOA 1QFEA 4XSLA 1V3KA 3VOJA 1SO4A 4N02A 2V5KA 1DWJM 1M7XA 1SSGA 3BMVA 3T7VA 1V51A 4LXFA 3SUTA 3VKJA 2WHLA 1XG3A 1WCGA 4Q4RA 2HXTA 4HMCA 3H2OA 1DHPA 4ZO8A 2UZ9A 4Z0JA 3S6DA 3MB9A 2GDVA 3GU2A 4BF7A 3TU9A 3S5YA 2QCCA 5EBAA 4L4LA 2YBUA 3KBNA 1MQPA 4E2BA 1P5BA 3ZJ6A 1V3LA 4RR4A 2X7VA 5C7HA 3H23A 4AEOA 3PC0A 4ACZB 3E5PA 4D1JA 1FVPA 2XGBA 4LS2A 3P61A 1QHZA 1KD0A 1A5SA 4DJDD 2G8ZA 3WF3A 1E51A 1FDYA 2A85A 4REQB 3LHWA 2POZA 4H04A 1ZALA 4Y90A 5CG7A 5LNVA 4HZ6A 3KW3A 3MUAA 5GNYA 3GXNA 3IUHA 3B40A 1HP4A 5SWUA 1UMYA 1B4EA 3IUIA 5FJOA 3WQWA 3MCOA 1XBYA 1W3LA 5CAKA 4QJ4B 2GQ8A 1A3XA 2YA0A 2HNHA 4TMCA 3BE7A 1LUCB 4WOQA 3HQNA 4J3ZA 3HPXA 1XRSA 3E1F1 2DSVA 1ZJBA 4MZ1A 1DE6A 3AMKA 1JDFA 3QQWA 4H4IA 1TX0A 3W7EA 5J5DA 1QOXA 1S5NA 3ARTA 3U57A 1I4NA 1Q6EA 1QT1A 1LL4A 4YCPA 2FVMA 4B4FA 3LM7A 4O18A 4E3VA 1VRDA 2ZX5A 3EKZA 4KQNA 4O10A 3UG5A 5M1TA 4MM1A 1E4LA 4M80A 3PULA 3AALA 4TVUA 1T0OA 2E9LA 3NXLA 4TTGA 3FGCB 1GVYA 1T7LA 3W1XA 4Q8NA 5FEPA 4W9TA 3NR0A 4GFSA 4X22A 5AHLA 2VVSA 1WZKA 4I9JA 1JL8A 3HG2A 3W38A 2XVLA 3QSRA 2WZIA 4XAGA 4FALA 2VC9A 2B7OA 2GUBA 2WBKA 1AZ1A 3CAWA 4TO8A 2J74A 4HPHA 3CAKA 4Y8EA 2GQAA 4S39A 3B0UX 4OQVA 2REQA 3S5ZA 4CQBA 3T78A 2A79A 4RE2A 4UOQA 4HCDA 3RILA 4C5ZA 5AYYA 1KM0A 4P8WA 2ZZ3A 2ZZ6A 1K8XA 1UA3A 1BXCA 2CITA 4FA3A 3UNTA 3OLEA 3GW3A 1NH6A 4HBKA 3UU0A 2BY0A 1FHVA 3MYPA 3IVTA 2DZSA 1SJDA 3P60A 3C2FA 3KTCA 4ZBCA 7XIMA 4S3AA 5ECVA 1RBOB 5CAHA 2E5DA 1R2SA 4IT1A 3TYCA 3G3MA 1LTDA 1AG1O 1IEVA 3L0KA 1FWTA 3CWHA 4MUPA 3DG7A 3EDJA 2INZA 5K4XA 1XH2A 2TMDA 1EGVA 2NUWA 1Q6QA 1EHAA 2DJLA 2PLKA 2BVTA 4TV6A 3WFLA 4PTXA 2J8TA 2BG5A 4PODA 3RX3A 3WDHA 2F38A 1NU5A 2DSKA 3JU2A 4G1NA 4ZSTA 1OFPA 3P67A 3NAVA 1ZLPA 4RZ5A 2Y7DA 1ISXA 1HKJA 5F2GA 4FHAA 4ADTA 3ZLHA 3QMSA 1NP2A 1EF2A 5CJMA 3W75A 2WQPA 1XC6A 3E9AA 1LT8A 2PFHA 3S2NA 1E6SM 2P88A 2DDXA 4J5NA 4MJ4A 3LHTA 1JULA 1DJGA 3HTWA 3OLGA 2Z2BA 4IH3A 2WHMA 1UKPA 4GACA 5AY7A 2PEVA 1SFSA 2ICSA 2Z1SA 2E6FA 5AVHA 3QV7A 2G3IA 4H01A 1QAPA 5A2AA 5HK4A 1W5QA 3WMBA 5D32A 4FR1A 2GPTA 1IT8A 4ORIA 3G1XA 1JAEA 5HWNA 3UFYA 2RJGA 3WQEA 1FCQA 4UQEA 1EFZA 3VM7A 3CPGA 2VGIA 3VKCA 1V8EA 3UW6A 4LVFA 4WR3A 4KIRA 2PWFA 2OLHA 5DMMA 5AC6A 1XLKA 5HWMA 3CAVA 4S2BA 5I77A 1HKWA 2CZVA 3EPMA 3GZAA 2ZUTA 4GLEA 6ALDA 4MJ2A 2J88A 1V6VA 3WEMA 4DO6A 3NEHA 5JBFA 3I3BA 1F3WA 4WDXA 3W01A 5AC5A 3N6HA 1CZ1A 2VENA 2VEMA 3DHFA 5REQB 3WL1A 2DH2A 2DV0A 1NTHA 3BZGA 3R0DA 3T42A 3VGHA 2GJPA 1V7YA 3GVQA 3NQ2A 1NWTA 3FEMA 4CN4A 3O6CA 3OJGA 3LHUA 1V0LA 5DQPA 3ZJ8A 2HXUA 1OCJA 3B0YA 2R24A 3W2NA 1S5MA 2DSZA 1UD8A 4BQ4A 4GMEA 3EMCA 4KIEA 3GAKA 2YCKX 1NY1A 4HCHA 3HGOA 3LEPA 2PD9A 1AQMA 1SZGA 1S1RA 1JZ4A 4RNJA 4U5IA 2FGZA 4WDWA 4J2PA 2ZVIA 1IGWA 2PDBA 4C90A 1CNVA 3IPWA 3NYDA 2OGJA 2V5JA 1A4MA 3UWWA 1UD4A 3N73A 3W37A 2A4AA 2DEPA 3GKFA 3KZSA 1WKFA 2ZC1A 3MS8A 1FP8A 2R1MA 4LUSA 3G8RA 3W3OA 2Z2UA 1X8FA 4UOZA 4WOZA 4ICMA 1RK5A 1AW1A 4PBGA 1TTJA 4N0RA 3KOWA 4PMOA 3TSDA 1KXVA 1ZJHA 5G4WA 1JPHA 3RU8X 3CUZA 2WSRA 1OX6A 2ONEA 2NUYA 2O9TA 3PWIA 3VFLA 1H63A 4KBXA 1FBAA 3NQFA 4QDWA 1H7XA 2BNJA 4L4MA 3AXMA 3GB6A 3FS2A 4ACYA 4H6EA 4Y9OA 1WDRA 1NP0A 1DJIA 1DV7A 3GLCA 2Y5EA 3CMGA 3SUSA 3CV1A 3H2NA 1HVXA 3VE7A 4WJEA 2NVDA 4CU8A 1KO0A 1E0VA 3NXFA 2W3ZA 4JTIA 3VD9A 4FNPA 3L9CA 2FB3A 2CKRA 3QTPA 3B8UA 4LUJA 3RN6A 5BWAA 2P0IA 1UOZA 2PU1A 4Q4PA 1B30A 3U4AA 5HA7A 2R1LA 3ZLGA 4MKNA 3G22A 3F4NA 5CPQA 1EL3A 1Q66A 1V08A 4HU8A 3FKRA 2JGQA 1LWHA 3ONCA 3I3DA 1U5VA 1V0MA 3E0IA 3EWYA 3H4WA 2CFFA 3OODA 1GQJA 3GDLA 3PJWA 3WQDA 2Y88A 2YL8A 3RLGA 3LU2A 3SRHA 4QRNA 5JBDA 2Y7FA 3UZ5A 3SCSA 5HUOA 5I2UA 1TCDA 2FJKA 3LCLA 4LV4A 2NLIA 1RCQA 2XH4A 4QHRA 4S3KA 1M04A 2PRHA 4AWUA 1GVIA 1M7OA 4H9ZA 3UXAA 1C7SA 5JMUA 2CWXA 4MKVA 4FIRA 3K5XA 4A3YA 1FFQA 2J7FA 4AWTA 1JRBA 1VP5A 3LCHA 4J3XA 3CT7A 1ZCOA 3UY7A 3G2GA 1DQUA 1VD6A 1S39A 2HS8A 4C5YA 1H4PA 3LRKA 2W67A 3R8RA 5BXSA 2QUUA 1IYXA 2HVOA 3Q94A 2D3NA 2G3MA 4C60A 5G1YA 1WV2A 1ONWA 5AYBA 4RJEA 4GUHA 3BG3A 1XCFA 4Y9NA 1RBAA 2A3EA 4W8LA 2F7FA 3TDFA 3ZWSA 3CHCA 4HHMA 2Y61A 3C3UA 4HPNA 4L7ZA 3TTSA 2YCEA 1XLJA 3PF3A 4JQ3A 5LNWA 3S1WA 3LOTA 1D9EA 1UMLA 3KUMA 5C54A 4UTIA 4HU4A 4ZOAA 4DF2A 1TIWA 1VCGA 2VRKA 3USBA 4C6QA 3SCUA 3TWBA 3UJFA 1ZAIA 1DJHA 1AMYA 3PG8A 3EDDA 1GW9A 1VFOA 3QR1A 2E28A 3WLQA 3A9IA 3M7SA 1PL9A 5FAJA 1WDQA 3Q58A 2VX5A 2Q8LA 4D6HA 4JIHA 1PHWA 3N25A 1YXCA 1Z69A 1BKHA 1OCNA 4X3ZA 4B5NA 2ISVA 1TPWA 4CCEA 1MQQA 2ZRUA 4BF5A 2WZMA 5CG0A 2E9BA 3GDMA 1UP3A 2FFCA 1B1YA 2IPJA 5A6LA 1MZRA 4KMQA 2ZTJA 4DAIA 3AROA 4H9VA 6TAAA 3R89A 3TNOA 4AVFA 3PTQA 3AMCA 1F4AA 4URIA 1RBLA 2VR2A 3GIYA 5I3JA 2CBUA 1ICSA 3VOHA 3WYZA 3FY1A 2Q8ZA 3HG4A 1TV8A 3KCOA 1Q6RA 5AZ1A 4F2TA 4YTUA 5AVNA 1L9WA 3CQJA 7ENLA 4DBDA 1YKWA 3PBWA 2AGTA 3CQIA 5CC6A 1G69A 4DBWA 3CPRA 1RQBA 4L9YA 3E12A 2VCCA 3GYCA 4B5TA 4D6FA 5BNKA 3HN3A 1BD0A 4JBRA 2XISA 1A80A 3TROA 4QAWA 2XN1A 2DJXA 3ECQA 2Z1BA 1W56A 2DT0A 4HMNA 1UR2A 3I7RA 4I9TA 3W7OA 1ALDA 1RQHA 4JQ2A 1QHOA 4EVZA 1RZMA 3STGA 2Y62A 3W84A 2BFGA 1B3OA 4LT9A 2HNEA 3KS5A 3QHMA 7A3HA 2X7WA 5CQ1A 2ZUWA 2B4GA 1T5AA 4CQAA 3CHVA 1RJPA 3CUXA 4MUZA 1HZYA 2ZRXA 3QGVA 4JX4A 3M6DA 1MVYA 5HQEA 1KTNA 3C6CA 5F1VA 2G37A 1L2QA 4XO7A 1CWYA 5D2WA 3IARA 2VRJA 1P0KA 3VTRA 3RLHA 3VDGA 3HGJA 1KFWA 1K7FA 5BOOA 1W5MA 1PTGA 2IW0A 1XIGA 1BVZA 3BG9A 3VOGA 2EPLX 1W37A 4IPLA 1NVMA 4LC8A 2WV8A 5D8WA 4EWJA 4NF7A 4ZB5A 1TUXA 3GW0A 3R94A 2QJGA 2PODA 2H9AB 5CKSA 1BSLA 1LL7A 2OWWA 4BI7A 3ARZA 1I6NA 1OT2A 2V63A 1JYVA 2OXNA 3EX1A 5I79A 3NQGA 3MUY1 2HK1A 3DUGA 3H26A 1J11A 5CJNA 4HKPA 1QNQA 4ZQRA 5FEXA 1PDZA 2OX4A 2QULA 4REQA 3A4XA 3NO5A 2NWSA 3ZJKA 2HMCA 3CH0A 3T0TA 2Q8XA 1P1MA 3A21A 3NGJA 3MCNA 4DLFA 3NSXA 2ANUA 3IJ6A 2BB0A 1VJZA 1G9HA 3BH4A 5H1WA 2QEZA 2AQVA 2WMJA 4AXNA 3N2BA 3TZNA 1X7FA 5HBFA 5TF0A 2BVYA 1FHLA 1LUCA 2Y85A 2YDRA 4XUGA 4CD4A 2J78A 2V3EA 4ORMA 4OECA 1YE6A 3N1AA 3SRFA 4IPIA 4ICCX 2FZ8A 1TV4A 3EWZA 5A2CA 4AIOA 3IAPA 4CUCA 5I7GA 3U3HA 1Q4WA 5FJUA 1H5YA 2PCQA 4R7OA 3W7LA 4E0CA 4ROPA 3VNIA 4F40A 3NL2A 1A50A 4MY9A 1Q13A 4JTEA 3LTSA 3P0XA 4O13A 1FP9A 3D6NA 3CZGA 1YDNA 3VNDA 2GGGA 4UTJA 3NQMA 5GNZA 3SEPA 3A3WA 2Y8VA 2I16A 4Q4OA 2OPJA 3MBFA 3NPWA 3T2OA 4LGXA 3GDBA 3FGCA 1AQFA 1HO1A 5JVLA 1J0YA 4Q4MA 4IF2A 3WDPP 4HK5A 1TSIA 3F5KA 1W8SA 1EC7A 1TQJA 2OZ0A 4GXWA 1XIJA 2QUNA 4Z1AA 1GJWA 1G1YA 3PAOA 4PTNA 2CETA 1B2YA 3OPSA 3EYPA 5A6AA 1PX4A 4XZNX 4US6A 1H62A 3APYA 4JL2A 3FSUA 4Z2GA 5FEWA 3TMQA 1ZGDA 4NAFB 4FK9A 4K6AA 4PBFA 4DBEA 3PJTA 4FX6M 2I5QA 3W7PA 1SFLA 5AHFA 3NOYA 1W1PA 3URNA 1MZHA 1UH3A 4NKCA 1O5KA 3NYZA 4O1EA 3VD4A 2ZFAA 4NNBA 4HP5A 2ACSA 2WC3A 4MJZA 1GORA 3EOSA 5B7ZA 3LTYA 4RZ4A 3AC0A 2PCEA 1UUOA 4G5DA 1LG1A 1JFXA 4PZVA 4B2DA 2UY5A 3MMDA 1QPNA 2J77A 3QM3A 1IQ8A 2ISFA 3GXFA 5HQLA 4AMCA 4BJHA 3P7YA 5D2XA 5E5CA 1H7PA 4MNLA 2EPNA 4V1YA 4M1BA 4K38A 4YTQA 2YGYA 8RUCA 3G0XA 1XIMA 4UTTA 1UD3A 3KBJA 1G01A 1U1JA 1YDYA 4UFMA 2X42A 4N2YA 3AMGA 3EXSA 2UY2A 2UWFA 4PSRA 2E0PA 1JCJA 3LXCA 5A8PA 5TAOA 4ZODA 3RM4A 1SFJA 2BXVA 3MWCA 1RY8A 1C29A 3VMNA 3GBEA 4QFUA 1VFLA 4LCRA 4LYKA 3CTTA 3P80A 4LRSA 1V4YA 1KCXA 4NJGA 3VKDA 2XZ9A 2BY2A 3RX2A 3N19B 4ML4A 1Q6GA 2QJNA 1VBHA 1AZ2A 1PXGA 2Y6ZA 1W3TA 3W1NA 3MW7A 4B5XA 4Q7NA 2FTYA 1JZ3A 1S2AA 2FZ9A 2ALDA 2CYGA 4MB5A 1E9LA 4L6OA 3REQB 3VIJA 2YBVA 1GEQA 2PGFA 1UR0A 2WSYA 3LPFA 4AIEA 3WKZA 4DO7A 2HSAA 5J04A 5A94A 3L4XA 4DWSC 3LNPA 3ZQ9A 4RW3A 3AIVA 3MP5A 1BWKA 4QR6A 3QC3A 3QQ0A 4NNAA 2ZDRA 1YDOA 3BZJA 3O2LA 2YXXA 3D3AA 3H22A 3MDUA 1E0WA 5HNUA 4CEUC 4AD5A 3QY7A 3IK2A 3AS3A 1CLVA 4MSSA 5LSMA 1G4PA 3LZ5A 3ONBA 5REQA 1RJRA 4LF2A 3W73A 1IXQA 4O8RA 2WNNA 3VGFA 2VCAA 2ZQ0A 4AVNA 3TJ4A 4AEFA 4L61A 3QQ1A 3PN8A 3HBLA 3PAJA 3ANVA 2GVYA 4F2BA 2O9OA 2BDQA 3R12A 4GD0A 2GZXA 1FWJC 2BHYA 4J28A 3DBPA 2XIMA 3AISA 2WVTA 4FOJA 2XU2A 1RD6A 2D2HA 2VOMA 1W54A 2VNCA 4FLOA 4FO4A 1VAHA 1KRMA 4U3CA 4AWEA 4L5ZA 2EF9A 2EQDA 1S3TC 4IIEA 1GOOA 4Z2IA 3FVMA 5C9ZA 1TJ2A 3N2MA 4YU1A 3K2GA 2BTMA 1KXQA 1PTAA 4AMAA 4UNLA 1XIEA 5JU6A 2VR4A 3FX4A 2ZX7A 3P8IA 3FXYA 4ZQNA 3HJZA 1J5TA 1VZWA 1DJZA 4D6DA 4IQEA 5BCAA 1EJWC 1QOPA 1TPH1 1GPFA 2NSOA 3NZQA 9CGTA 1BRLB 3VNZA 7ODCA 1IEIA 4AD1A 3O8AA 4E2OA 2RDTA 5IRPA 3OU8A 3IAQA 4DWDA 6XIMA 2OEJA 3TC6A 3BAJA 1POKA 5G2WA 1GUVA 2PURA 3C52A 4PUNA 2I5GA 1RVGA 4AZBA 2B31A 4KESA 1VBGA 1PX8A 4GK8A 2Q6ZA 3FHAA 3AZSA 1TVNA 1UC4A 1T99A 4AWSA 4N9CA 3CL7A 3NA8A 3CHDA 2BODX 1HJSA 2V3GA 2HDJA 1D3GA 3M0HA 4JHOA 3ZFHA 4OWGA 4DAFA 1EEPA 1XWYA 4CVUA 3GIQA 4XIMA 1NIUA 3OVPA 3WQ4A 3W82A 4WGHA 2PS2A 2EKGA 3UZYA 4J9JA 2DFAA 2ZUVA 3NQ6A 2WM1A 2ZUMA 3FXGA 2C15A 3AIBA 3H2EA 4FR6A 3SQLA 4I5RA 1CW2A 4R33A 1ADDA 3OA3A 3DI0A 3ITTA 3BANA 1TG7A 3RJYA 1WXZA 3GS6A 3UZXA 3AZRA 3MSRA 5C7VA 1KGWA 1H1NA 2C1GA 2WOQA 4I6VA 2C1IA 3M0LA 1JZ6A 4OV9A 1WDWA 2PTDA 4Q8VA 4H19A 2XVGA 2O4MA 1PIGA 4IWWA 1YXDA 4JFTA 2OYMA 4PN2A 2SFPA 1LZOA 1TRDA 3PS7A 4YHEA 4UTMA 1A5OC 3TYEA 2PA6A 1PHQA 4M0XA 2WNWA 4NZFA 1WYIA 3HJEA 4CVWA 4CNOA 2HWGA 3G1HA 3K30A 5I02A 2UBPC 3PBYA 1J0IA 2Q09A 3FNDA 3MUCA 1V6XA 4BEQA 1UZHA 5AHEA 3THQA 2Q3RA 1KFLA 2YX0A 3KL0A 4NHVA 4XK2A 1PJ9A 2O4QA 1ZZMA 2Z24A 4GG9A 1GZ1A 1BTMA 2ACUA 3AJXA 3MI2A 2VUNA 4HN4A 1O94A 4ZB0A 2NQJA 2VO5A 3F4WA 1CGYA 3BLLA 4JTLA 3CTLA 3WBXA 4F4RA 5G4HC 2Y5JA 2CZFA 3S6OA 1GT8A 4AHOA 1P7TB 3GFYA 2C14A 1B3ZA 1XH1A 2J24A 2GVLA 2PTZA 1A0DA 1JPKA 3W87A 3W7IA 4EAYA 2YFNA 3B97A 1R85A 3WNNA 1DOSA 2AAAA 4B9YA 4DWSB 4O4VA 4YWIA 3BSMA 1JXKA 3CAQA 1Q85A 3BOXA 1YADA 3LQLA 3SM0A 3L2MA 1OZMA 5FIPA 2I5IA 4NT0A 5TBOA 1QPRA 2GDUA 4RDYA 3LLFA 2D2GA 3O05A 2GDQA 5E6ZA 1IE7C 3Q4DA 2W66A 2PDGA 1ZQ5A 4BEUA 3QXBA 1ESWA 3L0GA 1JZ5A 4LPCA 5IBXC 2YPIA 3GTIA 4W84A 2Z0IA 2RFGA 3JZEA 1GWJA 2B7QA 3MUZ1 1KV5A 1I1WA 2X0YA 1VHCA 3QN3A 4PUEA 1ONXA 3RJXA 1P0DA 3DAQA 3BUVA 3R13A 3SFWA 4NJIA 1DIEA 4DPPA 2NVCA 3DYPA 1J0ZA 1WKYA 5EMKA 4E4FA 3H54A 1HFBA 3GZ3A 1VEOA 4A21A 4UC5A 4UTHA 3DH7A 1XYMA 1REQB 2CPUA 4GZ7A 3K4AA 5ABEA 3UJRA 1WKDA 3EB2A 3M07A 2XYLA 4UTFA 2BXYA 4P61A 3T09A 5LXEA 4AC7C 4W5ZA 3W00A 4Q6JA 3PANA 3A47A 2JBMA 4IMGA 4H9MA 3H21A 2WZTA 5I78A 2FGLA 1FH9A 4QJ1A 3L66A 2DVUA 4AZCB 3T81A 1HNYA 2DZWA 3WQCA 4CCCA 4DHGA 3CUJA 1F7BA 5C9UA 3CWOX 1JEZA 1JCXA 2ZRZA 4CNUA 5XINA 4LY4A 1DWIM 2F6UA 2W6RA 4OOUA 2JFEX 1BKSA 2GJNA 3NNTA 1BHGA 3RM8A 3T8QA 1Q63A 3M0MA 3ZOAA 1DXFA 2PU0A 3W4RA 3VIMA 4MB1A 4Y7EA 3V5OA 1W91A 5K9CA 2I9UA 1EOMA 3HG3A 3L21A 4I7UA 4C7FA 3EX3A 3GU9A 1QI2A 4NVTA 4PL1A 2HBVA 1XDMA 1WDSA 1XQLA 1K4HA 4XTDA 4DYEA 3LRLA 5FD0A 1K4GA 1FWHC 4LAKA 4LY8A 2FMNA 1YNQA 4YHGA 1DL3A 2H9AA 2L5HA 1HL2A 4OT7A 2ZICA 2OEMA 4XZWA 3WBEA 3HPZA 4F0SA 1OG0A 3MA8A 4R85A 3DXIA 3PPCA 1Q2RA 4DYJA 4DUXA 3PTMA 1GONA 3EX2A 2VZSA 3G1VA 3MY9A 3RIKA 4R9OA 5BWFA 1E40A 3NZGA 4XIAA 2Z29A 2D23A 1NFGA 4FI4A 5HXMA 3MSGA 4OZOA 4IUOA 3E2RA 4HNUA 2CLMA 1WZMA 3BLEA 4BI6A 3W22A 4DYKA 2P10A 1SQ7A 3PZUA 1J0HA 2YJQA 3UWQA 4EPBC 4LAOA 2AMGA 1W8GA 4IXXA 4QIUA 3WD1A 2F6XA 1KM2A 1JNEA 3FHQA 1IWPA 1I2RA 4U3AA 2P8BA 2H3DA 4JYEA 3RHGA 1UIOA 4ZEPA 1ZJAA 4JCMA 3QV6A 4WY0B 3UG4A 5LGZA 4HGXA 1KKRA 1S2UA 1TYGA 3LY0A 3WLSA 4HJFA 4FB7A 4W8AA 3VINA 1R3QA 2VMFA 1JCTA 1EQCA 1KBKA 3SUWA 1WDDA 1I1XA 2VHLA 2QHAA 4PR4A 3EOOA 1RHCA 3W1RA 1GOWA 2VT0A 4U31A 1F3XA 3DENA 1RV8A 1OHLA 2A3HA 3GUWA 4XB3A 3IGUA 2G3NA 1IIHA 4GYPA 1C7TA 1KM6A 4IQJA 4C6DA 1GVRA 1PZ2A 2EBNA 4POCA 2DH3A 2PD5A 3WLRA 1OY0A 3RR4A 2DIEA 5FJJA 3RR1A 5DMNA 1TREA 2PMQA 3L65A 4KWUA 1CENA 4GCAA 4UWMA 5C2GA 3KDNA 4WJ8A 3B4YA 3QSTA 1F76A 2I56A 2IKIA 3S42A 3SIMA 1EJRC 4FLSA 5CPMA 2GQ3A 5HPCA 1A49A 1OABA 2RH9A 2DUAA 4B92A 3WLLA 3UJEA 1ZUAX 5EGRA 3AMLA 3LENA 1XDLA 4NAFA 1C93A 3UERA 3CT2A 2VFEA 3D3FA 2IQTA 2FTPA 4E8CA 5I24A 1A5LC 3KLLA 2FPYA 3W7DA 1TPB1 1OC5A 3EBVA 1BGAA 3O7UA 1TZ7A 3EWXA 2FLIA 3NQCA 4S3GA 4FLRA 5E0FA 2YW4A 2PWHA 1NELA 4F3HA 4D6IA 2OEKA 2PI6A 4V27A 5CBJA 1UZ1A 3MJYA 3LA4A 4O0QA 1R46A 4QCFA 4H6KA 1FH7A 3P14A 3B8DA 3WMSA 3BAIA 1KRAC 5I09A 4KRUA 2BGNE 3GH4A 4W7WA 2V2HA 3BCDA 1MRAA 3T0AA 3MI6A 5H2ZA 1ADSA 4P8UA 1GHSA 4QNEA 3LQGA 2WMFA 4XD6A 1U83A 4IG2B 2XPKA 4H6RA 2E8ZA 3GC5A 4DJEA 3IIXA 5GJMA 3KS6A 5D30A 3UVAA 4EE9A 1P6WA 1UP2A 5CC5A 2UV8G 3U2EA 5AC8A 1G7UA 3SQSA 1PKLA 5I3GA 4W86A 3WH7A 1VCFA 2E40A 2NQZA 3EDFA 3N6JA 3PP7A 1IXNA 4GH3A 3WLNA 1EXPA 1TPVA 2EPKX 4O17A 1MFVA 3M0KA 1GG1A 2CLEA 4F8XA 4AC1X 4WKAA 1R30A 3I10A 4IPJA 3WH9A 1JYNA 4CN6A 2TODA 1CGXA 4Y9AA 1BXBA 1OYCA 5LGXA 4ZMGA 3VNMA 1TUFA 1GCYA 1AUSL 3UGRA 1ECEA 3GC2A 4B5SA 3R6IA 4K7VA 4PUMA 4OGZA 2F6KA 4CD8A 1LLOA 3UWUA 4JTKA 4NZJA 3C0LA 4Q4QA 2WCAA 2JIWA 1TV5A 5KTLA 3JZUA 3THUA 5CPSA 2ZRVA 1W1B1 3IGXA 3SO7A 3G1SA 3EXRA 5HMFA 4HZ7A 4F9DA 2WKJA 1TWSA 1KA9F 1J8VA 3MVTA 1BG4A 3W07A 4IXHA 1SW0A 1OGGA 4IX2A 4GYJA 3TEVA 3WLTA 1MDRA 4ASTA 1GOIA 1ZP3A 4G7EB 1UB3A 2YA1A 4MVAA 3L4UA 3CBWA 4XKMA 3NPUA 3IV3A 1VENA 2QJHA 4FEZA 4J1OA 2D0GA 2AL1A 1H49A