3W7PA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-4-031
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-4-031
rcsb
source organism Trypanosoma cruzi
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7pA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7pA01
1UUOA 3HIJA 2V5LA 3H53A 3LX9A 4N6FA 3C6CA 2FPVA 4BI5A 3NQAA 3CQ0A 1EA0A 1ME7A 3QW3A 3IEBA 4MFDA 3CIXA 4UC5A 3LCGA 3LCIA 1X7FA 1VCGA 1DV7A 2YXGA 4O11A 1H61A 1W1ZA 4UFLA 4N4QA 4WY0B 3L5AA 3QM3A 4UFMA 2ATSA 1Q3NA 4NXSA 1K8XA 3FLUA 3I6RA 3ATZA 5DY2A 1F76A 1TPUA 5D38A 1LRTA 3NQEA 4KWVA 1B57A 3MW7A 3E0IA 5KZEA 3QSTA 1W8SA 2VEPA 1GWJA 5A8GA 3MBDA 1R2RA 2I9EA 3N19B 1X8FA 1L6YA 3UYCA 1HO1A 2Y6ZA 2NV2A 3MI3A 4TMCA 3FKRA 3NL6A 3EWWA 3MHGA 4UFKA 4WD0A 4X2RA 3NL5A 2V5BA 3MWAA 3T7VA 1GT8A 1LORA 2WNQA 4Z0SA 5DY3A 4Q32A 3QPZA 1ALDA 3S8HA 1QNVA 4XTIA 3R2GA 1KV5A 3W7KA 1R2SA 5F4XA 4JX5A 2F7FA 1YDVA 4BWLA 4O14A 4HSNA 4FEZA 1O5XA 4IMFA 3W7DA 4OWGA 3S5ZA 2YFNA 4L4MA 1OFBA 3NQFA 3RU6A 3W85A 3LCWA 1JCXA 3STCA 1VCVA 4OGZA 3HG3A 5FF7A 1EUNA 3Q37A 3TW6A 5EY5A 2XN0A 1VCFA 2X2GA 3BGJA 3A5FA 2YZRA 2WV8A 1IIHA 4AHOA 1CX9A 2Y7FA 4LRSA 2ISWA 1EP1A 1L6SA 4GC4A 4N2YA 5F2IA 1W5MA 3ATYA 2GQ8A 1VZWA 3HPXA 1FWNA 1FWRA 5TBOA 3VNDA 4FX7A 2DZTA 1W37A 4JTJA 2XN2A 4I7VA 3W2LA 3CEUA 4XKYB 5D2WA 5AHEA 3QQ1A 3HOJA 3W1PA 1WYIA 3IGSA 1Z48A 4RK8A 3SZ8A 3O07A 2GUUA 3TA6A 3EWUA 3O63A 1KLZA 2TSYA 2B0MA 2ZRWA 4ADTA 1MSSA 4R34A 3CEPA 4ZVJA 1XDLA 2V82A 3NDOA 3PBWA 2A1YA 1KBJA 1FX6A 3W2NA 2WSRA 4HIBA 2LLEA 3PBYA 3GK0A 5D32A 5CPLA 1OK6A 3OIXA 3LRLA 1B4EA 1Y0EA 4JY9A 1TPDA 4AWSA 4A21A 5LNSA 1XUZA 1I2PA 2R91A 2V81A 4QAIA 3L0NA 4IQLA 1G6CA 2ZRVA 4P2VA 2CWNA 2G95A 4GRSA 5FESA 3PC0A 5CKSA 1PL9A 1W3TA 3G24A 3CTLA 2FDSA 4QJ1A 2F84A 2FJKA 3MP5A 5HULA 1FWTA 2QDGA 3IVSA 3UZ5A 3PSVA 1H7WA 1E51A 4JD4A 1YYAA 1XXXA 2A7NA 3DFPA 4MZ1A 1RD5A 3TQKA 2X1RA 1SW7A 1J4EA 3LBCA 3G0UA 3QSRA 4DQWA 5FEXA 3GIYA 4N9CA 2CW6A 3W1XA 4M7SA 4UCGA 3TSDA 1BWKA 2DP3A 3P74A 3INPA 3S1VA 3HF3A 3W1LA 1XFBA 1G4PA 3ZWTA 4YMZA 1FWWA 1SR9A 4PODA 4NNAA 1EP2A 1TIMA 3HGJA 4JYFA 3FA5A 4JDBA 4DO5A 1SU5A 4GJ1A 3GDMA 4JNMA 1W5PA 4PCFA 4K36A 3BLIA 1UCWA 4JYEA 1TREA 4NJJA 1G69A 4G1KA 5LHFA 4BR1A 1DHPA 2H3BA 2A21A 1F5ZA 3L67A 4K38A 3W7GA 1TTQA 4FX8A 3SR7A 4IWWA 1XL9A 2Y88A 3BLFA 4UNLA 4K6AA 1W5NA 4NVTA 2DZVA 3W2UA 3MUXA 2JBMA 4MZ8A 4O53A 4DF2A 2ATMA 3IIOA 1MEHA 3H55A 2NV1A 1OVDA 2C1HA 2A6LA 4M5PA 3NQVA 1EWEA 1F74A 1QDSA 5AN7A 4LVDA 1DQXA 4DO4A 4O0KA 2CLIA 5CZSA 3W86A 2QR6A 4RZ5A 4O28A 4LVAA 3IV3A 4JTSA 3S1XA 2Y62A 1FXQA 4W9TA 1I4NA 4E38A 2QEZA 5AHLA 4MYAA 2NXGA 1OG0A 2WO5A 1DQWA 1G7VA 1LLWA 4AXKA 3W7HA 1B9BA 1JUBA 4K37A 4UTLA 1K3UA 1O60A 4FNQA 1GYLA 1XBYA 3C4UA 2ZYFA 1ONRA 1JCJA 3LCXA 1W0MA 3P84A 1B3OA 4Y96A 1K7XA 2OJPA 2ZZ3A 2AGKA 3PF3A 2O7QA 4K7YA 5AHMA 3G1YA 4WY0F 1SO4A 4JX6A 1FDZA 3L9CA 1KM3A 5D03A 2CLEA 3BG3A 3C3NA 3L65A 5CSSA 2IQTA 5K7JA 5L9FA 3W7LA 3DFTA 4IPIA 3W7NA 5D37A 1PHWA 3W83A 4LRTA 3W6YA 1SSGA 2OT0A 1FDYA 3P5ZA 3TXVA 3AJXA 4NNCA 1PCWA 2ABBA 3G18A 3G0SA 1A50A 1VLIA 1RQBA 2EPHA 2WQPA 1WX0A 1V7YA 4C1LA 4AF0A 2TYSA 2RKXA 5AC7A 2HTMA 3LHUA 1TPFA 2PC4A 1S3HA 2H8ZA 1H62A 4AMAA 1F6PA 1K7EA 3STEA 1KM0A 1FQ0A 4XBSA 2ZBTA 3JR2A 4TX9A 3W7OA 1KBIA 3LTPA 5C55A 1T96A 4JIQA 3S42A 3MO7A 1GTEA 4UR8A 2GJLA 2ZRUA 1G7UA 4PEKA 3UWVA 3UWYA 3O6YX 5HR6A 4QITA 3C0JA 3KXQA 4JGDA 4NJHA 2CLKA 2Z1BA 3ZFHA 5CSRA 5EMUA 1VLWA 3NQGA 3G1HA 1K7FA 3B0UX 3W73A 1GVRA 2BLEA 2YYUA 3EXSA 3PVFA 4UTWC 3MHFA 1T8XA 1OX4A 2CFFA 3FKKA 4CNNA 1YPIA 3NZRA 4RV8A 3EX2A 3DI0A 2Q3RA 4OBTA 1KV8A 4UUIA 3EKZA 1H1ZA 3W1MA 2G97A 2W6RA 1DVJA 4GUIA 2CLOA 2YW4A 4MUZA 4NJGA 1Q6RA 2DZSA 2Z0IA 1I2RA 1TPVA 1N55A 1ZFJA 4HPJA 1H50A 3VKJA 4FIQA 4ORMA 4BI7A 1P0NA 3WJYA 1AK5A 3UPBA 1OF8A 4UMBA 5HWNA 5D05A 4ORIA 3TUUA 1XBVA 3A9IA 3N34A 1TV7A 4UTMA 4QQ3A 5BOOA 1TQJA 1TTPA 5HWJA 5HUPA 4O1CA 4RXGA 3C8FA 5IBXA 4NZFA 1YTEA 4H3DA 1G67A 3M16A 4BWLC 2CLFA 1OABA 4FNRA 3ABSA 3GAYA 4Z1CA 5F2LA 4DF0A 2CLLA 3PBVA 2J9YA 1ZHAA 4BF9A 3D0CA 4MLRA 4O0ZA 2ZTJA 3G1DA 1IXOA 2H6RA 1HTIA 3B06A 4NU7A 4UR7A 2VFFA 1BWLA 3LRKA 5HNRA 2FQIA 5HJLA 4RZ6A 1CW2A 3GXNA 4TO8A 5LKYA 2RDTA 3DFQA 5G2WA 3NQCA 1EIXA 4YL2A 5TQLA 3R5EA 4FO4A 5E93A 3O6DA 1KTNA 3SECA 3JRKA 3MHUA 3NEVA 3A21A 4LT9A 4ADUA 3S6DA 2DJXA 4UXDA 3NZ1A 3NPWA 2GVGA 3G3MA 1O94A 5A5WA 3NQMA 2VEKA 4JTTA 1YLVA 4AAJA 1IXNA 3DI1A 3P8IA 3GDLA 2W79A 1ME8A 4KFOA 4Q4KA 4LNYA 2RDWA 3O1NA 3W76A 2CLHA 3C61A 2JK2A 1ZY9A 4MLJA 1LOQA 3V1PA 2A2IA 4CQ8A 3L2IA 4TR9A 3DZ1A 4JTGA 2O7SA 3HG2A 1G4TA 3W7JA 3GVGA 3JS3A 5MHBA 1H60A 1LZOA 4FNUA 2GQ9A 4JTLA 4UTJA 3NO5A 3LXBA 1FY6A 1M7PA 4AWTA 3WFAA 5HMSA 1EX5A 2PE4A 5F2MA 3G1FA 4ZQRA 1W31A 2YPIA 3CU2A 4HPXA 3N3MA 1I2NA 2E6AA 3TMLA 2CZFA 4AF0B 5FEWA 3TDFA 1W54A 5HUOA 4GBUA 1LBMA 3M43A 3W2MA 3TFXA 4X9SA 1T0OA 2QUTA 5AFDA 3NQ6A 4M6PA 1FBAA 3IRDA 4MPQA 3KRSA 4YCPA 1JUKA 4UTKA 2QF7A 5G5IA 4HSOA 3PULA 2DZWA 2VENA 2V9DA 1D9EA 2QCNA 2C0AA 1OHLA 4IXHA 3BW3A 1RZMA 4O19A 2VEMA 3PB0A 2QKFA 1OX4B 3ABQA 5EPDA 1OFEA 1ICPA 4JYDA 3EXRA 3NQ7A 3QW4B 2BXVA 1IIGA 4UFIA 1X6UA 3DAQA 4O12A 5EYWA 4DBDA 4OHQA 3B0VC 2RH9A 4TIMA 1HL2A 1V5XA 1THFD 2WSYA 1RV8A 1A5CA 1WAUA 7TIMA 3W70A 2ZA1A 4LTSA 1KFJA 3LXCA 2OZ0A 3A5VA 4FXSA 8TIMA 1TRDA 2QAFA 3GNNA 1I2QA 4JY8A 3N2XA 4JDYA 3G1SA 2NX9A 1QAPA 4O16A 5AYYA 2Q3OA 1QCWA 1GG0A 3S1WA 4BI6A 3NL2A 3H54A 3DFOA 1PIIA 4XBKA 1ML1A 3L21A 3M7WA 4ALDA 5D02A 2Z2UA 2R8WA 3C2EA 1EB3A 5G4WA 4LWWA 2QCGA 3EKLA 2GPTA 2G5WA 3N9SA 3VE9A 4O18A 2QJHA 1MEWA 3HGOA 3DBPA 4KWWA 3OG3A 4LS1A 2HS6A 3W7PA 4DBEA 3GAKA 1VQTA 1IXQA 5EKYA 3U2OA 6ALDA 3TX9A 1ZJIA 3G1AA 3O8AA 3WJWA 2WNNA 3KVKA 3B05A 3BG5A 1G4SA 5KZMA 2BTMA 3M5YA 2YW3A 2YYTA 1GVSA 1R30A 1Q6LA 3NVTA 1ZALA 2VFGA 3E96A 1TPH1 4FX6M 1UB3A 2ZZ7A 3L5LA 5D2VA 1H63A 1LCOA 1VH7A 4GNJA 3L66A 1YPFA 4EF9A 1MZHA 3LERA 1JQVA 3S5OA 2X16A 5E1QA 4K7VA 3GXPA 1W56A 4U4MA 1WXJA 4WUIA 2WPBA 1DOSA 3HG5A 2NUWA 3TV8A 3G22A 1Q6OA 1YXYA 2A0NA 4CNPA 1TO3A 2ZA3A 3NQ8A 3TQ0A 3LI1A 3C52A 2YFOA 3BGGA 1YXCA 4NXKA 4AHPA 3TE9A 2ZRZA 3B8DA 2BSLA 4HNUA 4AH7A 1PCKA 2FB3A 4UIOA 5LNVA 1AL8A 3LHWA 3PG9A 2FPTA 3NR0A 2XFWA 1L6WA 2W0UA 1C9DA 2E5DA 2X1SA 1QO5A 3NXFA 3G1XA 2Y7EA 3LV6A 3IIVA 3PM6A 3PWAA 3SY5A 1JRCA 1TTJA 5C5YA 3EWZA 3TU9A 3R12A 3PUEA 5T26A 1K03A 1BEUA 2J9XA 4KKXA 1KLYA 1NFBA 5H91A 3UWWA 2ZZ2A 4GUHA 4O52A 5BW6A 4NQ1A 4O10A 1LRNA 3RLUA 2YSWA 3HGRA 1A5SA 1QPRA 1RR2A 1TCDA 4MOZA 1UASA 5K4XA 3I68A 3OVQA 2X1TA 5GVJA 1TPC1 3C2RA 4PTNA 3I7RA 5DXXA 4O4WA 3I7SA 3L68A 1TPEA 3P5YA 3VE7A 1FCBA 1EWDA 3A23A 3VI2A 3TROA 3W7IA 3F4WA 4N02A 3M0ZA 1K8ZA 1Q6QA 4LVFA 3UXDA 1GG1A 1YADA 1Z42A 5IBXC 1H5YA 5G1YA 1LBFA 1KFLA 5DCBA 4JN6A 4AEOA 3DENA 5F2GA 4WXZA 4AVFA 3W72A 1O5KA 4ZMGA 1AG1O 3W7EA 3NPUA 1RVGA 3O6CA 5G2HA 3PB2A 4YXGA 3BW2A 1O95A 1AW1A 3T44A 1JULA 2V30A 1TTIA 4PA8A 3USBA 3LGEA 2TMDA 3TCEA 3DFNA 5U7SA 1JQXA 3FEMA 5G4EA 4UTTA 5EBUA 3PG8A 1F7BA 2ALDA 5J5DA 5K3VA 1OFOA 3CM4A 3M44A 3E02A 3UD6A 1BTMA 1IXPA 1JVNA 3LCLA 3WK0A 2A7PA 3KVJA 2QCEA 1NEYA 1JCYA 1GJPA 2P0OA 2OX1A 2Z6IA 5C54A 3O16A 5BMXA 1H7XA 1C29A 1H7NA 1KM6A 2Y61A 3WJZA 3W88A 3R8RA 3QH2A 5I3FA 3T78A 3BVJA 2CU0A 1KTBA 4LY8A 2C15A 3S1UA 4RLIA 4LS0A 3W1UA 4R7JA 5FF0A 4A22A 4U28A 1B4KA 3EWBX 4CLMA 4QISA 4UFHA 5LNRA 4HKPA 2NXHA 1OYCA 2JKAA 4UMCA 1LOLA 2ZZ6A 3M5ZA 4R33A 5HWMA 1VYRA 3MI2A 1EEPA 4XWUA 2Y70A 1DBTA 1WA3A 1A53A 1CI1A 4I7WA 1KW1A 1HG3A 2BX7A 3VFLA 2B4GA 5KINA 3Q94A 1H7PA 3R89A 3TC6A 1N7KA 3IGXA 2E5CA 3M41A 3PS7A 5EL1A 1PV8A 2B7NA 3HO8A 4O13A 3O15A 3EB2A 3P7YA 2DORA 2Y85A 4QNEA 5D2XA 2Q8LA 3W2KA 3KRZA 4RX0A 5AHNA 1AW5A 3NL3A 2AAMA 3LHVA 4PL1A 2V8ZA 3QYQA 2VFEA 2QCMA 2V2CA 1W3NA 1FCQA 3P81A 4P61A 3BARA 5AB3A 5E0KA 2A6NA 3NNTA 3O06A 3BG9A 1GPWA 4RXFA 2OMAA 1OFRA 4O57A 4MY8A 3CPRA 3UPWA 1LRQA 2EF9A 3YPIA 1HO4A 3P62A 4IX0A 3IIXA 4NT0A 3P61A 2NX1A 4M6QA 4QNWA 5KSWA 3GLCA 2JKEA 2NUXA 2XN1A 3LHTA 4OV4A 4WXYA 1SZNA 5I3IA 5CPOA 1AW2A 2OCZA 4GE8A 1WV2A 4PL2A 4MIMA 3SI9A 3UWQA 2EKCA 1TV5A 2NWSA 2B7PA 3EWYA 5DXYA 3QMRA 1X1ZA 5CZ0A 4LUJA 1T99A 4E2BA 3NPXA 3CT7A 1OX6A 4WJEA 3NYZA 3IIZA 1SO6A 1D3HA 3T55A 4ADSA 3TXZA 4RR4A 4YWIA 4O1DA 1R47A 2A85A 4FNTA 3SJ3A 4N9EA 1HFBA 4O8RA 3M1ZA 1NF0A 5HINA 1DORA 5C2XA 3P8JA 3EEGA 3MJYA 4AWUA 2ZZ4A 5U4NA 3IIPA 5LNWA 2NUYA 3M5XA 3MP3A 1AMKA 3GKFA 1UBSA 4L4LA 2ZTKA 1DKWA 3FYPA 3EX4A 2TRSA 1IGSA 2EAWA 4X3ZA 4FB7A 4OU1A 2C16A 1VYSX 2EGZA 2AQWA 2EHHA 5DBUA 4N9DA 1GZGA 2FPYA 3NAVA 4DELA 1FWSA 3OBKA 3SGUA 3W7QA 1P4CA 3UY8A 4ZQPA 3GR7A 1QPNA 3DKLA 1DJNA 3HB9A 4ONVA 4N6EA 2FTPA 5F4WA 4QSHA 1TSIA 4OQVA 5LNUA 4LOCA 3CWNA 3CLMA 3M47A 4GWEA 1I8JA 4XZ9A 4IOTA 1OFQA 2GVJA 2A5HA 3LM7A 4D2JA 3I7QA 3IVTA 1JUEA 1GOXA 1DJQA 3ZS4A 4FF7A 5L6UA 3STGA 1OFAA 4KFPA 3W2JA 1Z41A 3QZEA 1S5VA 4M7TA 1SFLA 2QCCA 1YDNA 4A2SA 4DPPA 1OFPA 2DZXA 3TC7A 5DCEA 1VRDA 2CLMA 4NJIA 1GEQA 1WOBA 4NX0A 1VPXA 1AL7A 3OVPA 3R13A 4GUGA 5D2YA 4LUIA 2QCDA 3K30A 1I45A 1PVNA 3WK1A 3T40A 1ADOA 3E9AA 4MY1A 2ZFAA 2H8XA 5CGQA 3W7MA 1F2JA 1EP3A 3FS2A 3BW4A 3MYPA 4LC6A 2ZDRA 4PFMA 3RMJA 2GOUA 3ANYA 3DU0A 1RQEA 5KMYA 4PC8A 1WDWA 1O4UA 3LDVA 2Y7DA 3G0XA 4KFNA 4DO6A 2E1DA 3CIWA 3GDTA 2VFHA 3LLFA 5TIMA 2FB2A 3LOTA 2VEIA 1XM3A 4HT3A 1IF2A 2CZ5A 1TYGA 3CC1A 1OF6A 2TPSA 4RJEA 1LP6A 5IM51 3UY7A 1KA9F 3U8GA 3L0GA 2HS8A 1YDOA 2VXNA 4IMCA 4UMAA 2E68A 4DEFA 1WOAA 5LZLA 3KHJA 4IMEA 1NF7A 4N9BA 3DKJA 1J2WA 1LM1A 3LRMA 2YCEA 2C6QA 3DHDA 4FNPA 3HPSA 2E6YA 4XUGA 3L0KA 1EPXA 3M9YA 1QO2A 5I3KA 3U6WA 2VELA 5BMWA 3NQDA 3GZ3A 1MO0A 5FI8A 2QCLA 3BO9A 1VS1A 4MKNA 4OV9A 3BLEA 1OK4A 3PSWA 4IX2A 4IMGA 3BK0A 4UTWA 3N14A 3C2VA 2FLIA 4MY9A 2I1OA 3QMTA 2GVLA 4GXMA 2QJIA 3O05A 2X1UA 3NM3A 2UV8G 4Z08A 2J27A 5KITA 4ICNA 3DGRA 4LVGA 2Y89A 1NSJA 1EUAA 1TJPA 5FEZA 4H4IA 4NNBA 3P82A 3MMTA 1TQXA 4FHAA 5D04C 5CPNA 5AC6A 5K9DA 1ME9A 1W3IA 1LLZA 3EWXA 2VOMA 1ZAHA 2PRHA 4LVBA 1FDJA 4BFAA 2Z6JA 4UTUA 1WBJA 3W84A 4TMBA 5KTLA 5DLCA 1QFEA 4WOZA 1QMLA 3QQ0A 5AYXA 3KRUA 4NX5A 4ZZ9A 1OX5A 3BPWA 1W5OA 4GFSA 5D30A 1KM4A 1VR6A 2PURA 4H6KA 2FIQA 3L5MA 2DU2A 4IUOA 5CPMA 4MJZA 4LV4A 3DXIA 4JTUA 3LHYA 2ZZ5A 4AB4A 2QJGA 5D33A 5H2ZA 1A5AA 1L9WA 3E12A 1QR7A 4CQAA 1TJRA 4UTTC 5HQEA 1WBHA 1UJPA 3TAOA 5G2IA 4YCOA 2YGYA 3TIMA 3BV4A 4LV9A 1JR1A 5LSMA 3F4NA 2C19A 4MZYA 3FOKA 3P60A 1C8VA 2YDAA 3LB0A 2E5BA 3UZJA 2E09A 3TJLA 1JCNA 3W1RA 2A4AA 5SWUA 4IMDA 2ZA2A 3DH7A 3QF0A 4OE7A 4CCCA 5K4ZA 3B4UA 3C56A 3RNDA 4Y90A 4LW7A 1XCFA 3P80A 1OYBA 2B7OA 2G96A 3OHIA 3UWUA 2QCFA 3ZWSA 1UUMA 3UWZA 2VC6A 3STFA 3G1VA 1SZGA 2J9ZA 3S5NA 3QFEA 4FNSA 4O1BA 3WJSA 4UTHA 1FCVA 2OT1A 1OFDA 1W5QA 2JGYA 4ZQMA 3HBLA 5AHIA 3TFCA 1VGAA 3TSBA 4NZJA 2QCDB 1X1OA 3EX1A 1ICQA 3LV5A 2BWGA 3QRHA 4LU0A 2C18A 1KM1A 4IJBA 4XQ6A 2YR1A 3W07A 3FJLA 2FFCA 3NG3A 2QCHA 3S5YA 1Q45A 3TK7A 4WOQA 2ZZ1A 4J9JA 4XTDA 5DBTA 3PY2A 2VKZG 3LCFA 5DCDA 3KOFA 4Z1BA 1XBZA 3TNOA 1OYAA 3SFKA 3HG4A 2CZDA 3RF9A 3RLVA 1QPQA 5F1VA 1KFEA 2C3ZA 3GKAA 2WOQA 1F6KA 2RHGA 3TH6A 3WK2A 3GDRA 2VFIA 1G4EA 2JGQA 3TAKA 1QWGA 4K8HA 4O50A 3MI6A 3GXTA 3SGZA 1RQHA 2PRLA 4HNVA 3KVLA 4S2CA 2J6XA 3LHZA 3N2MA 4Y8FA 2DZUA 4B5NA 2WKJA 4UTIA 3KX6A 1KFKA 4QIUA 3THQA 1U5JA 4EF8A 4EVZA 5AHFA 4JICA 1SZFA 1RPXA 4A3UA 4ZQOA 5LGZA 2PRMA 3HGSA 2P10A 4O15A 2GJNA 3NQ2A 1QPOA 1M5WA 4S1FA 1PHQA 4I7UA 4RCXA 4O1AA 3G3DA 3HPZA 1SZEA 2WSQA 1XBXA 2QDHA 4CCDA 5KZDA 3NGJA 1LBLA 1MXSA 4Z0JA 2RDUA 5AYZA 4Q33A 3TQVA 1M6JA 2I14A 1S5WA 1ZCOA 1H1YA 3QMSA 4HNTA 3GX9A 2HMCA 4DF1A 1ZNNA 2E6DA 3UXAA 1JJKA 3I65A 1XUUA 5K9XA 1GVFA 2B7QA 1SUXA 4EIVA 3A22A 3WJXA 1SW3A 3OEXA 3MP4A 5I3JA 4JXCA 1GYNA 1KTCA 4JTHA 4O17A 4S2BA 4E2DA 3QPYA 3RK8A 2Y63A 1R2TA 5FF2A 5G1TA 3LBMA 2ZRXA 4M19A 2C14A 4GUFA 1SPQA 1QOPA 3P67A 3PR2A 4I9AA 4MVAA 3PAJA 4JS3A 2R14A 1A5BA 3LXAA 1LROA 1LTDA 3FIGA 5K2ZA 1M7OA 1H51A 1U83A 4ML9A 3MBFA 5DELA 3RFAA 4C1KA 5LHEA 1GTHA 1XC4A 4Z1DA 1ZENA 4UNKA 3W7CA 3Q2DA 4IPJA 4DPQA 2NXIA 2QAPA 3LLDA 1R46A 4HHPA 3LTSA 1K02A 1XI3A 5D2TA 4WX2A 3QEZA 1TRIA 3C2OA 2KZHA 1BKSA 2X30A 3W22A 4K39A 3MYOA 1TMHA 3FYOA 4MFEA 4EOUA 1J5TA 3ELFA 4Z1AA 3NA8A 5FF4A 1HUVA 3Q58A 3DFSA 4JX4A 1SQ7A 3B03A 3KFTA 3F03K 2V2HA 3W74A 2RFGA 2P1FA 1ZAIA 1LOSA 5CZJA 2J24A 2QUUA 3IGUA 2E6FA 3ABRA 3W1NA 3GYEA 4JTIA 5K9CA 5EA9A 2WJZA 4JTKA 3ABOA 1LYXA 4X22A 4YLWA 4JIPA 4MYXA 1I2OA 3CWOX 5I3HA 3W1TA 3W7RA 3TW7A 3E49A 3EX6A 1PE1A 5F4SA 4HN4A 1VHNA 1XDMA 2D73A 2VFDA 5C6MA 4WY0A 5CG7A 1OJXA 3TMQA 1WQ5A 3FFSA 2WNZA 4JEQA 2NX3A 3GB6A 3GDKA 3W87A 3OVRA 4JTEA 1P0KA 1GQNA 5AOUA 2R94A 3HQ1A 3AO0A 1Z44A 4RZ4A 3NOEA 2NLIA 4IXXA 4RKAA 4FIRA 2ISSA 1TPB1 3NM1A 4O54A 4EWND 1JCLA 3G8RA 4R53A 2CZEA 4K8EA 1S5TA 2DJLA 1N8FA 2A7RA 4NJKA 1K8YA 2BZNA 4A29A 1H7RA 5FEPA 3W75A 4Y9AA 2V2DA 3FJ6A 3DHFA 3ZR4A 2J88A 4E0CA 2YX0A 3HJZA 4LS2A 3S9YA 3KVMA 3PUOA 3CHVA 1SFJA 2PCQA 1DL3A 3VCRA 1VHCA 4CNOA 4ZQCA 4JTFA 2E77A 2ABAA 3LCHA 4ZL1A 4DXVA 4O4VA 1VC4A 1L2UA 2H3DA 3GNDA 1YTKA 4WQ6A 1YTDA 2ZRYA 5AC8A 1NVMA 2DZPA 3B0PA 4POCA 3S0CA 1QOQA 1F73A 3TKFA 3HMJG 1ZAJA 3IVUA 4CQ9A 1MEIA 3N9RA 1GVOA 3F1QA 5I3GA 2ISVA 5J5RA 3QC3A 4GUJA 4TU1A 4XKYA 3V75A 3PUDA 4UFJA 3TJXA 2C13A 3PBUA 2V0TA 2GQAA 1YXDA 1H7OA 3W71A 1FUYA 1SSDA 4Y6GA 4LC8A 1JRBA 3A24A 3THAA 1KM2A 1VJIA 2JKPA 3LI0A 3SIZA 3NPVA 2QUVA 1KFCA 1GVQA 3N73A 3C2FA 1FXPA 3SW6A 3UQNA 1NAL1 3EXTA 1D3GA 4HNNA 3W1QA 3W9ZA 1FCUA 1SW0A 4PH6A 1P1XA 1TB3A 3OA3A 5BRBA 5ABTA 2Q8ZA 3QJAA 5CZTA 3SSJA 3KAOA 2NWRA 2HSAA 4CCEA 1ICSA 1XKYA 5FF3A 4AHQA 5DN1A 6TIMA 1VYPX 3LTYA 1KFBA 1SO5A 5F1UA 1PS9A 5D09A 2ZCGA 5HR7A 1TPWA 3M5VA 4JR5A 4NUWA 5LGXA 4ZQNA 1JCMP 3W23A 3WK3A 2ZQ0A 3T4CA 3GR8A 4WZHA 3TSMA 4N4PA 1LDCA 3EX3A 1F05A 4IGHA 3UNDA 4M6VA 3B04A 4MJMA 3CB8A 4OT7A 3W3OA 2Y7GA 4BK9A 3TR2A 3W1AA 4FXRA 1P5BA 4QM1A 1KM5A 1TV8A 1SO3A 2NZLA 3M6YA 5BNKA 4A2RA 3G8EA 2H90A
chains in the Genus database with same CATH superfamily
1UUOA 2GQ3A 3M0JA 3LX9A 2PGFA 2YOCA 2FPVA 4DXXA 2VGGA 4XZHA 3WLTA 3KHDA 4DJEA 3UP8A 4INFA 1UD4A 5EMLA 4IFOA 3LCIA 2DSVA 4ZXOA 1VCGA 1PX4A 2Q71A 2V3DA 3H2CA 1H61A 4WY0B 3KEHA 1DPMA 3AZTA 3QM3A 1Q6GA 3MSYA 3ATZA 3TN5A 5DY2A 1TPUA 3CS2A 3BLPX 3NQEA 3EPOA 1ADSA 3C0QA 4G7EB 3B0XA 4C6KA 1X8FA 1L6YA 1RA5A 1PDYA 4DYEA 5A6KA 2QXWA 3AUOA 1OGSA 5DY3A 1ZZMA 3PZ9A 2QT3A 1ALDA 1OEPA 3BE7A 1QNVA 1G0CA 4L56A 2Z27A 3W7KA 3W6MA 3R1ZA 5F4XA 2F7FA 2Z4GA 4HSNA 4FEZA 1O5XA 3S5ZA 2WYSA 3RDKA 3NQFA 5A3HA 1MI3A 3G5EA 3STCA 5FSDC 2HROA 2XN0A 5B7ZA 3BGJA 2YLAA 1W1B1 2YZRA 1G94A 3WFLA 1AQFA 3MTWA 2Y7FA 1EP1A 4DZ5A 4XV0A 1W5MA 1FWNA 3OIHA 3VNDA 4FX7A 2YB1A 3EDJA 4JZ5A 1W37A 3CL8A 3W2LA 2V6AA 1W1VA 3QQ1A 4QG9A 3HOJA 3EYPA 1WYIA 2WM1A 1NDVA 3IGSA 1DYSA 1SJBA 1EGMA 3O07A 2GUUA 4R85A 3O63A 2TSYA 3R4IA 3CZ8A 2ZRWA 1MSSA 2FHCA 4ZVJA 3NSMA 3NDOA 3S2LA 4PUDA 4JFSA 2A1YA 2VCCA 3W2NA 5MF5A 4DHGA 5BOEA 1XINA 5D32A 5CPLA 3N25A 3VNMA 4KIRA 1G9HA 4JY9A 1BQCA 1TPDA 4AWSA 4EACA 5LNSA 1CTNA 1T8QA 2CERA 3EPNA 3UCQA 3U0HA 3ZQ9A 1FWEC 4P2VA 1G6CA 2CWNA 3GNRA 3VIMA 1UD3A 3UEQA 3V3WA 4QR6A 1ZU8A 3OHMB 5HAOA 2ZUVA 4QJ1A 3ICJA 3WMBA 1FWTA 3DX5A 3W82A 2QDGA 3IVSA 3WDIA 3WNPA 1E51A 4KMQA 4JD4A 1BRLB 2I5IA 2D24A 1J4EA 1A5KC 3G0UA 3QSRA 3BLDA 5FEXA 4N9CA 1BWVA 1CXLA 1Z3NA 1RCOB 3U3HA 3TSDA 3P74A 3KLKA 1ZB5A 3S9IA 1EGVA 2UBPC 1XFBA 1D7FA 3I3EA 2R24A 1O5QA 1LG2A 2DIEA 1V08A 3EA1A 4GJ1A 3GDMA 1GOMA 2FDMA 1V6YA 8XIAA 4NJJA 2GZXA 3J7HA 5LHFA 4BR1A 1BD0A 2B31A 5BXSA 4UNLA 2Y88A 4K6AA 1C7SA 3QTGA 1DXFA 4Q8UA 1PJ9A 4NVTA 2DZVA 1RA0A 2BXZA 4MZ8A 3RJXA 3SJNA 1HVXA 2XH0A 3VPLA 3IIOA 1FKWA 2FJUB 2NV1A 1XYMA 3HURA 2CNCA 2A6LA 3NQVA 4Q8NA 3S9ZA 2GFTA 2DVUA 1DQXA 2WW5A 4DO4A 4O0KA 4IIBA 4PMRA 5CZSA 1OG6A 1E70M 3W86A 4J3ZA 4JTSA 3S1XA 2Y62A 4LF1A 4NZCA 2QEZA 1VRXA 1OG0A 4DZAA 4I9MA 2CHNA 3FA4A 4Q6XA 1B9BA 3VMNA 1S46A 1O60A 1GYLA 1OCNA 3DN5A 3WEOA 3C4UA 2ZYFA 3LCXA 3AUJA 1REQA 4REQB 3POCA 3PF3A 1WZKA 2ASHA 4XZMX 2WB5A 1KD0A 4PE8A 3UR8A 1F8MA 1ISVA 1QW9A 2D2HA 4MF4A 2WSPA 4XSMA 1KM3A 1MW2A 3C3NA 4AY7A 4FR6A 2QHAA 3LK6A 5HQMA 4C6QA 1XGEA 5L9FA 3W7LA 2PDBA 3W7NA 5D37A 3W83A 3KE0A 2E8ZA 1SSGA 3TOPA 2OOGA 3ABXA 3AJXA 4PZVA 2J62A 4ZCWA 1A5UA 2HTMA 1TPFA 4IL2A 1S3HA 2EXOA 1H62A 4AMAA 3ERPA 1KM0A 1FQ0A 4AVOA 2ZBTA 3C3UA 1QNOA 3W7OA 1KBIA 1YNQA 7ODCA 1FKXA 1TA3B 2Y8UA 2ZRUA 1G7UA 4GQQA 4PUKA 5HR6A 4QITA 4WKFA 4HJWA 3K4DA 3KXQA 4JGDA 4NJHA 1IGWA 4KWSA 2J75A 1K7FA 2GUYA 3W73A 1GVRA 4DJEC 5C0QA 8CGTA 2BLEA 2E40A 3F4DA 3B8TA 1DWGM 3MHFA 3FKKA 5EB8A 4EK7A 3S1GA 3VKCA 3NZGA 1JZ8A 3I4KA 4C6FA 3EX2A 3FGCA 4OBTA 2PLKA 1V6UA 4UUIA 2VHLA 2PMQA 4KH2A 3ZT6A 4EXQA 1Q13A 2W6RA 3CJPA 4GUIA 2WQDA 2CLOA 3VOCA 5C2GA 4U2YA 3QV7A 1XCXA 4WDWA 3VKJA 2W61A 1NDZA 3WJYA 1OF8A 3AIWA 1A5NC 4GVFA 3A9IA 3N34A 1FWDC 1XHGA 3R11A 2J77A 4QQ3A 3ANUA 1TQJA 1TTPA 5HWJA 5HUPA 4RXGA 2QMJA 4GYPA 3BMWA 2J7FA 1G67A 1H0GA 3E2VA 2YL8A 4PTXA 1OABA 2NLYA 3MKCA 1M7JA 3OU8A 5F2LA 1K4GA 2CESA 1EO5A 4GKTA 3UXKA 3D0CA 2ZTJA 3AIRA 2INEA 1HTIA 3CZKA 4NU7A 2RJGA 4IIHA 3BSMA 2VFFA 1FH7A 3IARA 1IEIA 4L65A 1KWKA 3VZYA 3AMDA 3UJRA 4TO8A 1E56A 4NZ4A 5G2WA 4LY4A 3AHZA 2DFAA 3NQCA 1EIXA 1KCXA 4YL2A 5FJJA 3K4AA 5TQLA 3O6DA 1KTNA 3MHUA 2MUCA 1NP0A 4QE5A 1KR0A 3G3MA 2PC8A 4MDPA 1S1PA 1FRBA 4PMJA 3R0KA 1PX8A 3ES7A 2WAGA 1A4MA 1IXNA 1V0MA 3GU1A 3DI1A 5AZ1A 2VQTA 2W79A 4LNYA 4PBEA 1JYVA 3WD4A 3W76A 3DESA 4MLJA 1PWMA 1EYWA 4CQ8A 5D8WA 1V0LA 1C7TA 2VRKA 3NO3A 1C8YA 2O7SA 4IQJA 2W62A 3W7JA 1QNSA 3QGVA 4UQBA 3AFBA 4UTJA 4JTLA 4Q22A 5JH1A 1M7PA 1EKOA 4ZQRA 5B7YA 7REQB 1X6NA 1TMQA 2YPIA 3CU2A 1I2NA 4HPHA 2CZFA 4AF0B 3OB8A 4KQNA 4HNOA 1QNQA 4KPLA 4ZEPA 2JALA 5JH2A 4GBUA 1Y5VA 1LBMA 4KESA 1T0OA 1NQKA 1U30A 1XIJA 4NL1A 5FSEC 4M6PA 1EXBA 1FBAA 2PTZA 4MPQA 1HKIA 4YCPA 1CECA 3S2JA 1JYWA 3PK7A 3WELA 1FTXA 1UC4A 3EEZA 1RAKA 5A69A 2VENA 4KW2A 3OZPA 3GHTA 3DYPA 3PB0A 2OPJA 2Y5SA 4JYDA 1A47A 4GX8A 4UFIA 1X6UA 3OBAA 1XV8A 3B0VC 3SFWA 3SCSA 4RW3A 4M3PA 1ITXA 3D3AA 3URAA 1THFD 1KO0A 1MNSA 4O0QA 3UNTA 4H2HA 3AS2A 3UVIA 3W70A 4LTSA 3VGDA 1CXKA 4A3YA 2OZ0A 5CLWA 4FXSA 2QAFA 3GNNA 3GC5A 4UQEA 1I2QA 4JY8A 3SADA 3WDHA 1RY8A 3QTPA 3CH0A 1CZ1A 1QAPA 4O16A 5E0FA 4U5KA 2WWCA 4GY1A 5AYYA 3S1WA 1GG0A 4Z42C 1KXQA 3H54A 4JIRA 3TW9A 5EMJA 4FPSA 1ISWA 4H6QA 2GPTA 2PEVA 3VE9A 3VGEA 2QJHA 1MEWA 4KWWA 4LS1A 2HS6A 3W7PA 2FKPA 3ABZA 3LD5A 5EKYA 3MMWA 3TX9A 3B05A 3BG5A 5KZMA 2BTMA 2JFEX 1GVSA 2XWEA 2PZ0A 3PZMA 2HRWA 3NJ3A 1UB3A 2ZZ7A 5CBBA 2G3JA 1TG7A 5D2VA 4NYYA 1U1HA 3UVAA 1UD6A 4G2DA 2F2HA 3MUIA 7PTDA 4F0MA 4CN6A 4GG9A 2XH2A 5M5DA 1OWQA 3S5OA 2X16A 5E1QA 3W26A 1J2BA 5I5RA 2WPBA 4ZOCA 3R8HA 3TV8A 4ERIA 3G22A 4CNPA 4XAPA 3SN0A 2DSWA 2BG5A 3VM7A 2G41A 3IACA 4JQAA 1MQRA 2YFOA 3C52A 3EPMA 4U31A 1BF2A 4AU0A 1UR4A 4NXKA 4AHPA 3AQUA 4IMAA 3B8DA 2GSJA 1NWUA 4UIOA 1D3CA 2PCEA 3KRBA 3O0KA 4L80A 4FALA 3VGBA 2XFWA 2W0UA 2E5DA 2YCKX 4TUFA 5E6ZA 3PWAA 3L2MA 4P8UA 1I6NA 5C5YA 4W8LA 5CAHA 3MUCA 2XM2A 2F2KA 4DM2A 2DUAA 4R9XA 1SMDA 1XQKA 2FHBA 1NFBA 3UWWA 5BW6A 4NQ1A 4FI4A 1OB0A 1AA1B 4F0HA 2YSWA 4GACA 3ARXA 3OVQA 1DTUA 3KWXA 1NQ6A 5GVJA 1TPC1 3UYIA 1IEVA 5A6JA 1TPEA 1ZPTA 3P5YA 4IF2A 3DOPA 1DWJM 4ACZB 1EWDA 2BVTA 3A23A 3WQPA 1YKWA 3TROA 4N02A 2Z2AA 3M0ZA 1K8ZA 2BNJA 2D2JA 2EEXA 1YADA 4HJFA 2QYGA 4GYPC 1H5YA 1UIPA 3IGHX 1LBFA 2FGLA 2Z1VA 1RJPA 3R43A 4AEOA 3CO4A 3WLKX 3H4WA 3RM9A 5F2GA 1XS2A 3W72A 1EJXC 4EPDC 2VR2A 5EMMA 4HYWA 2VC9A 5G2HA 3VOGA 5JXQA 3PB2A 1AW1A 4S3EA 3LGEA 2TMDA 4QLLA 3TCEA 3DFNA 1WKFA 2WZIA 1T6MA 4F2BA 4TV5A 3PG8A 2ALDA 1GHSA 3K8LA 3CAKA 3UD6A 1C9WA 4WR3A 5D9NA 4YTUA 4XD4A 1VFUA 3WK0A 2A7PA 3O7UA 3UR2A 2WHLA 2DT0A 3NEHA 3KVJA 2QCEA 1CGUA 3OA5A 4S3GA 1RK5A 3GFZA 4CU7A 1H7XA 3IK4A 5BMXA 1C29A 1P1MA 3URBA 2HVOA 3W88A 3R8RA 4HYRA 3PZIA 1OGBA 4Y9NA 3VKAA 1KTBA 3R58A 3DFYA 4LEQA 4ZTYA 4B4FA 2JF7A 5DX7A 2ISDA 5FF0A 4MHBA 1B4KA 1PBGA 3LZ3A 1M01A 4GFIA 1EC9A 1LUCA 2NXHA 5M1TA 5IXEA 1N8IA 2JKAA 4UMCA 3AYTA 5HWMA 3MI2A 4W5UA 1H5VA 2PDKA 3SRFA 4HPNA 2DEPA 1DBTA 3VNIA 1A53A 1R86A 4I7WA 3V16A 3TZFA 4ZFMA 5CAKA 1UQZA 4V1YA 4C7GA 1W9UA 4BJHA 3GUGA 3AC0A 2PDNA 2E5CA 3CHFA 3LMZA 5EL1A 4GZIA 2XYLA 4O13A 2PGEA 1TWWA 3UETA 4W7VA 2X0SA 3T0BA 2IMRA 9XIAA 3W01A 3O3RA 3PJUA 4HU4A 2AAMA 3FHAA 2H9AB 2XIMA 1W3NA 1FCQA 3P81A 3EA2A 3VKDA 3NNTA 1AJ2A 3CTTA 2P3ZA 4EAMA 1GPWA 1GQKA 1ODZA 1XD1A 4WJ8A 4D6GA 3YPIA 3P62A 4IX0A 1TELA 4NT0A 4QNWA 2NX1A 5LIXX 3LHTA 4DX3A 4LCQA 1AW2A 5I6SA 1YX1A 4MIMA 3Q45A 4MNLA 1WUFA 2ZX9A 3GTHA 1KR1A 2BP1A 3EWYA 5DXYA 3IANA 4DNHA 3CQIA 4E2BA 5BRQA 2ALRA 4WJEA 4JHMA 3IIZA 1XLAA 2AL2A 4ADSA 4IFRA 4FNTA 1HFBA 2NT0A 3QY6A 1NF0A 5HINA 3P8JA 3VNLA 3DECA 4M6UA 1QI0A 3REQA 1UKSA 1VD6A 3SUTA 4HK7A 1PWLA 2CITA 1GEHA 1DKWA 3T81A 3FYPA 2HNHA 3AWNA 4JTDA 1V6XA 2XJ7A 4FB7A 3BJTA 1S5MA 1R3RA 4IM4A 2EGZA 2AQWA 3WBWA 2EHHA 1GZGA 2FPYA 1FWSA 3OBKA 3LBOA 3UY8A 1HNYA 2P53A 4WSHA 2QNEA 2WM0A 1FHVA 5F4WA 4LOCA 1V0NA 3QHNA 3CWNA 3CLMA 3M47A 2P8CA 2INFA 3LM7A 2J7DA 1WDSA 1DE6A 1JUEA 1XLCA 2Y8VA 3QR0A 1OCJA 4Q8VA 1Q7ZA 1S5VA 1QTWA 1YDNA 3SY1A 3UXLA 1AODA 4A2SA 4DY1A 4HA0A 1GZJA 1UR8A 1GEQA 2ZUMA 1VPXA 1AL7A 4E8CA 1KQYA 4G56A 4ATLA 1UMLA 1PVNA 5LIWX 1QI2A 3E5BA 2E3ZA 2NSOA 3F5JA 3W7MA 4AC1X 4W88A 1EP3A 4PB4A 3BW4A 4GINA 5AVHA 2BY3A 4QS6A 4F66A 1WDDA 3CIWA 5EU9A 5TIMA 1BGAA 4E8GA 1FHUA 4HT3A 4RJEA 1TYGA 4PYSA 1VBHA 1XYFA 5HJXA 5I02A 1WOAA 3KHJA 5I06A 2YCEA 3OLEA 2X0YA 3DHDA 4J3UA 1NWSA 4A05A 2ZE3A 3RXZA 2QF8A 1QO2A 2PLMA 3KBSA 4WKHA 2Q6ZA 3U6WA 3VIPA 2VELA 3NQDA 3BAJA 4H9YA 1MO0A 4OV9A 4PMXA 4IMGA 3EGJA 3II1A 1UROA 2GJRA 2EKGA 3QMTA 2QJIA 2VR5A 3TYEA 4ZE5A 1RCQA 1SFTA 3AWOA 5A6MA 5KITA 4ICNA 1IE7C 5E70A 2Y89A 1NSJA 2OODA 2OU4A 4ZBCA 5JMUA 4FHAA 1K1DA 1J18A 5K9DA 1LLZA 3EWXA 1BG9A 1W2PA 1W3JA 2PRHA 3VGFA 1E0TA 1FDJA 3SURA 3B8UA 3QY8A 2Y8KA 1OQFA 1TV2A 5KTLA 1WE5A 5DLCA 4WOZA 1XG4A 5AYXA 4ZZ9A 1W5OA 4JNZA 3WO8A 5KZ6A 3L5MA 3S83A 2CLPA 2VMFA 5CPMA 1XSKA 4GIYA 4QG8A 1C3FA 4JCMA 4K1WA 3IWPA 3RITA 4PUWA 3WD1A 2QJGA 3E12A 4HMEA 4HSHA 1TJRA 4GIRA 4J27A 3WSUA 3KM8A 5HQEA 1WBHA 1UJPA 3PZOA 3TAOA 3S3GA 3TIMA 3OGSA 3SUSA 3BV4A 1BVNP 4LNCA 3VD3A 3P60A 1C8VA 2YDAA 2E09A 1CGTA 1XLEA 3MJMA 4A8NA 4Q4QA 3XINA 2A4AA 2ZC1A 3MQTA 4C65A 2J7EA 4XZNX 4GD0A 3WBXA 1HVQA 3WLJA 1R3SA 4CCCA 5K4ZA 4MAZA 3NIYA 3C56A 4R7WA 3DHUA 4LEFA 4NI8A 3TR9A 3NO1A 1XCFA 4GVGA 4GXWA 2B7OA 2JE8A 4BA0A 1GKRA 5D8ZA 2XDFA 3STFA 4GI9A 1R3WA 2INZA 3BQ6A 2XGBA 3H23A 3QFEA 3G6MA 4O1BA 3GNXA 4UTHA 1NDYA 3CL7A 3I4EA 2A3LA 1VGAA 3GRIA 5DMLA 2GWGA 2DIKA 4LXFA 2QCDB 1GQIA 1FH8A 4KS0A 1NP2A 1DEDA 4PUMA 4LU0A 1BLIA 4IJBA 2YR1A 1W6TA 1BFNA 4NHVA 3BOFA 1VFMA 1RXOB 1R3QA 4WOQA 1W3LA 3ARSA 3PY2A 2DPEA 2VKZG 1PPIA 3KOFA 4YTTA 5ENLA 3GQYA 3ZIZA 4U10A 4EE9A 1WO2A 2CZDA 3RF9A 3RLVA 3RG6A 3GKAA 5HANA 4KETA 4D6HA 3WQ4A 4IG2B 3WK2A 5I2UA 3CB3A 2JGQA 1QWGA 4O50A 4PMNA 1E1CB 3RO8A 4Z2LA 4R5EA 3P6LA 1MUWA 1W2VA 4S2CA 2DZUA 1TZ7A 1FH9A 3NUKA 1XX1A 3H2EA 4EVZA 3TN3A 2I17A 5JBEA 1EF2A 1XYAA 3BCFA 2PRMA 2CBUA 3WMSA 4DM1A 4HOXA 2P10A 1O66A 1M5WA 2RGMA 1PHQA 3GC4A 8XIMA 3G3DA 3FX4A 4I5RA 1MXSA 4Z0JA 4I6KA 5M03A 1XLMA 3SN1A 1S5WA 1GKQA 4LB3A 4OECA 1V6VA 2GK1B 1F61A 2HMCA 4A4AA 3L23A 4NG3A 1ZNNA 3UXAA 1V8EA 1JJKA 4DYKA 1R38A 4ACYA 1PZ1A 2F8QA 3A22A 1GYNA 4PCSA 1KTCA 3CV7A 2XVPA 3QPYA 3RK8A 2WJEA 4HU0A 1JPIA 3CASA 2C14A 3CNYA 4JS3A 2VD8A 2WMJA 3IJQA 1CLXA 3DYOA 1O7AA 2WMHA 3PZNA 1U83A 3H70A 1AFSA 4D6IA 1GTHA 3F5LA 1ZENA 1TCMA 3H22A 4IPJA 4J3SA 2NXIA 4Q8MA 2ACQA 3U2ZA 1K02A 2XZ7A 2XVNA 5D2TA 3QEZA 1LQAA 4PMZA 4IJCA 4MJ2A 1MRAA 3BICA 2VX7A 3C0SA 1SJDA 3WF1A 3FYOA 3WQCA 3T9PA 4EOUA 1J5TA 2BHUA 4DZIA 2DUZA 1CLVA 3NA8A 5FF4A 3UF9A 4ZE4A 3BOXA 4FLRA 4S3BA 2GVYA 3FAXA 1DJZA 1OY0A 2QUUA 3RPMA 3IGUA 3KL5A 2HNEA 4GMEA 4JTIA 5EA9A 4LUSA 2OSYA 4X22A 2WZMA 4MYXA 3CWOX 4NYUA 3RUBL 2DUXA 2BBFA 2OKOA 3EX6A 2D73A 5CG7A 2G50A 1OM0A 1WQ5A 3B97A 3IAPA 3FFSA 2WNZA 3H6OA 2CBIA 4PR4A 1MW3A 1A0DA 3WEZA 1EC7A 5AOUA 1A3XA 2J7GA 1Z44A 3S6TA 1LT8A 3E38A 3W24A 1V6TA 5BU6A 2HJPA 3APYA 3G8RA 1EBGA 2PGWA 2CZEA 1QJWA 4K8EA 3CUXA 1S5TA 2DJLA 2WBKA 1DXIA 3PTDA 4KGLA 2BZNA 1H7RA 3DHFA 3HJZA 4LS2A 1M65A 1J11A 3CHVA 1LT7A 2OWXA 4HK5A 3N4AA 4O4VA 4D6EA 1L2UA 1Q7MA 2AQVA 1NVMA 3KDOA 3WL0A 1SJAA 2QV4A 1F3XA 3N9RA 3LSCA 3R0UA 2ZXAA 5M17A 3B8IA 2OFJA 4HMNA 3A4AA 1E6ZA 3G6LA 1Q2RA 4NRSA 3V75A 1UJQA 3TJXA 3WLNA 2C13A 3PBUA 2OLSA 1ISYA 2V0TA 4AZIA 1K9DA 1S2AA 2D0GA 4HNCA 1FVPA 5H1WA 3THAA 1KM2A 1J12A 1VJIA 2CZVA 2JKPA 3GXIA 3CAVA 1KBBA 3TEVA 4XD3A 3GIPA 2BDQA 4TTGA 6REQA 4LPCA 1J93A 3M0XA 3W1QA 3DCPA 3G77A 4ROQA 2ACSA 3W0KA 5IOBA 1TV4A 3QN3A 5LYRA 2ZUSA 2HEJA 3T0AA 1SW0A 4PH6A 4QFUA 4A8RA 2I5GA 2ZUUA 5CZTA 2QUMA 1JAKA 4HK6A 4TXEA 5FF3A 2WCSA 1KFBA 5FJRA 4N0RA 1XP3A 1XYCA 4PSRA 3VDGA 2VRQA 2Z00A 5REQB 4WKAA 1NOWA 3AIVA 4JEJA 4GGBA 4ZQNA 3QPEA 3T4CA 3WIJA 4EPBC 1LDCA 3EX3A 4IGHA 1HL9A 4M6VA 4IT1A 1LJYA 3AROA 4M1BA 2Y7GA 1H41A 4LCSA 4JNYA 3M6YA 4A2RA 3G8EA 1VF8A 3IK2A 3PN8A 4N6FA 4A35A 4BI5A 3CQ0A 3VD4A 1ME7A 3QW3A 2TODA 4GA8A 3GVRA 3IEBA 1ZTVA 2G0WA 4HA3A 2PWHA 2IW0A 1X7FA 2YXGA 2WVVA 1W1ZA 4N4QA 1YMYA 1PX3A 1GK8A 3KLLA 4JOMA 1H2JA 2ATSA 3AZSA 1JI1A 1Q3NA 3FLUA 3I6RA 3TWBA 3GFXA 4ZGYA 3T6CA 3IJIA 1BAGA 4XKMA 3MW7A 1FFQA 5KZEA 3GVVA 2X42A 2QQ6A 1W8SA 4H1ZA 3QSTA 4V33A 5A8GA 3KTSA 3MSDA 4LF2A 1HO1A 4N42A 2VC5A 2AKZA 1TE1A 3MHGA 2ZX5A 4UFKA 1I0DA 1A49A 3T7VA 2WNQA 4Z0SA 3QPZA 2HBXA 3VD5A 1HJWA 2IKHA 4QGCA 2BHYA 4BWLA 4RDZA 3GC2A 1WP6A 3GU9A 4H01A 1FWHC 4WGHA 4GQ0A 1OFBA 1UWUA 1XQLA 2TAAA 3W85A 4HBKA 1ZBWA 1E4MM 3TW6A 5HJYA 5EY5A 1VCFA 1LWJA 2X2GA 4HA1A 1XRVA 2DZAA 2PPGA 5C9ZA 1QHZA 3PWGA 1US3A 1T7LA 4A8LA 3CQHA 1AD1A 6PTDA 4WRHA 3JUGA 4S3JA 3PFMA 5FKYA 2A3BA 4YTQA 4I7VA 3CEUA 2F6UA 3MUZ1 3W1PA 4HQVA 2WHMA 2QGYA 5GNZA 5C71A 3GH4A 3GH7A 1QWKA 3EMQA 4AX6A 1IWBA 2WSRA 4HIBA 2LLEA 3QYSA 3LQGA 1OK6A 4MNJA 4M81A 4AG0A 1O12A 3ITTA 3BSGA 3OIXA 2YZ5A 4PGLA 2YBUA 1TJ0A 1Y0EA 2CKRA 2X1IA 4M24A 1XUZA 2R91A 4TX8A 5FJIA 2ZVIA 3L0NA 3IUIA 2ZRVA 4LUTB 1EL3A 2XTKA 2NQJA 3HV8A 4KEZA 3SCRA 3PC0A 1PL9A 2PDFA 3EOLA 3CTLA 2FDSA 5JBFA 3AMLA 1Q63A 2F84A 4JHZA 1E9YB 5HULA 3UZ5A 1H7WA 1XXXA 3DFPA 2ZX8A 2X1RA 1DWAM 3WLIA 1SW7A 3UZZA 5AC5A 1BYBA 2GJXA 4DQWA 1JF5A 3MZ2A 2REQA 1UP3A 2CW6A 4KWOA 3W1XA 1XDJA 4B2DD 4XZIA 4Q7NA 3S1VA 3MANA 1G4PA 1FWWA 4NIRA 3SCVA 1TIMA 2AGTA 1W9BM 4YYCA 4JNMA 1Q6CA 1OIMA 1H49A 3I3DA 3M46A 3OYXA 4JCLA 3L67A 4YTRA 2ZXDA 4QROA 2XWDA 3SR7A 3BLFA 3C2YA 2PDUA 3W2UA 3P0WA 2HBVA 4GYJA 4O53A 4J28A 1FHDA 3LGDA 5RUBA 2CXGA 3UCDA 4JHOA 2HPIA 3CMFA 5JVLA 3A6OA 3AISA 4ZFCA 1CNVA 5JU6A 3VZXA 4M5PA 4ECLA 1EWEA 3GZAA 2PS2A 3UW6A 5E6YA 3BAYA 2W4XA 2CLIA 1GUVA 5EMKA 2WCAA 2QR6A 4RZ5A 2PF0A 1ELSA 4EXAA 2GOKA 4WIWA 1RJQA 1Y5XA 3IUDA 4W9TA 1WDQA 2HISA 3K4WA 2O9TA 4L1XA 4E38A 2ZOXA 1ZLPA 1E0XA 2O9OA 1DQWA 1LLWA 3TN4A 1WZLA 4Z1YA 1JZ7A 1D8WA 1KXHA 1EJTC 1XBYA 1EPVA 1XLDA 1ONRA 1JCJA 3JZEA 1W0MA 1B3OA 1R0MA 4XVEA 2ZZ3A 4FZIA 3ZVHA 2AGKA 4MB1A 1UH3A 3G1YA 4WY0F 1Q4NX 5A95A 2D1ZA 3VCCA 2OZ3A 3CYJA 1N8WA 2AKMA 3VA8A 2IQTA 1AQMA 1UZDA 3KOXA 1DJYA 1PHWA 4F48A 2QIWA 3W6YA 2OT0A 3P5ZA 1BXNA 2ABBA 3G18A 1RQBA 2EPHA 1WX0A 1V7YA 4C1LA 1VPYA 3LHUA 2ICSA 2WMKA 1W9DM 1LWHA 5CBIA 1K7EA 1YW1A 3STEA 3B9AA 4L4PA 2HVMA 3QOKA 3UG8A 1T96A 3UT0A 4JIQA 3S42A 1GTEA 1IT0A 1JF6A 1O5RA 4UR8A 4CKQA 3SUWA 3UWYA 1CGXA 1PAMA 2CLKA 2Z1BA 5EMUA 3PTMA 1VLWA 4A8IA 3CV2A 4YIWA 1ISXA 1DQUA 4X60A 2YYUA 3EXSA 1YBQA 2DGAA 2QVHA 3JZUA 3VIIA 1T8XA 1OX4A 1UKTA 2CFFA 3BZJA 1YEYA 3PZQA 1YPIA 3DYMA 3DI0A 3MDWA 1JD7A 2Q3RA 4ZB0A 4EPKA 3RYSA 1H1ZA 4QEHA 4KT2A 1HKVA 2VM8A 4NJGA 4MUZA 2DZSA 4CGTA 2Z0IA 1I2RA 2OEJA 4QJ3B 2J47A 1TPVA 1ZFJA 4HPJA 2CKSA 5HK4A 1FWJC 1NELA 3UR7A 4FIQA 5FIPA 4BI7A 1AK5A 2FMNA 2ZX7A 3NSNA 3QV8A 4UMBA 5HWNA 1KQZA 6CGTA 3TUUA 4ORIA 3M0YA 4J35A 4JKMA 1ZGDA 3MCMA 3M7SA 1EH9A 1EO7A 1UZ4A 2QUNA 1S5NA 3MKVA 3ZO9A 4IP7A 5ABGA 4NZFA 4H3DA 2BVYA 2YB4A 4BWLC 3PANA 5J8LA 1XWYA 2E1WA 3T2PA 3TJIA 3R7MA 1YRRA 4MUPA 5G1MA 3VVGA 3E6EA 1JZ2A 1VFLA 3M0LA 5FCZA 3E0WA 1JG9A 4J1OA 4UR7A 4ZB2A 3LRKA 3BL3A 2FQIA 3EDEA 1J6PA 3IPWA 4B2DA 4RZ6A 3WLHA 5BCAA 1RY0A 2HCVA 3VNKA 4DBSA 5LKYA 1J01A 3WF2A 4ATWA 2E67A 1J0KA 1F3WA 3R5EA 4IP5A 4FO4A 5XIMA 3SECA 1EBHA 3A21A 4UOJA 4UXDA 4CQBA 1VFHA 5A5WA 2VEKA 1TUXA 3H7UA 4JTTA 3VNJA 3BURA 4AAJA 4B5UA 1V79A 3GDLA 1REQB 2WC7A 4IL0A 4O1FA 1ME8A 1RLDA 2PTYA 3O1NA 2YKKA 1XH0A 1ZY9A 4LAOA 4GKLA 1IT7A 3V1PA 2A2IA 1KB3A 3WQ5A 4JTGA 4P7QA 3JS3A 5MHBA 4B9ZA 1K8CA 1H60A 1Y5WA 1LZOA 1W17A 3IV8A 1K4HA 1E73M 1JCTA 3GE7A 3H2AA 4P8WA 3WFAA 5HMSA 2YXXA 3G1FA 1VKFA 1RLCL 2J4GA 4WF7A 3N3MA 3TMLA 4MNMA 2FFIA 5HUOA 4C60A 3W2MA 4AEEA 2G37A 4Z2KA 4X9SA 1DWHM 3XISA 3MY9A 3AU2A 3IRDA 1W9XA 1GNXA 1IQ8A 5G5IA 1JL8A 1P0DA 1RSCA 1AZ1A 2DZWA 1E4IA 1DWFM 2C0AA 3BW3A 4XUYA 1E6QM 4AD5A 2VEMA 1SM9A 5HOSA 2QKFA 3ABQA 4BQ3A 4IIFA 1J8VA 1OFEA 2PD9A 2HE5A 1KCLA 3FGCB 2YDSA 3WF3A 2PI6A 3DAQA 3MCOA 4O12A 3WNKA 1R7AA 4RE2A 4DBDA 2DSUA 4OHQA 3KBJA 5FJUA 2PA6A 4Y9MA 1RV8A 1WAUA 1HJQA 3PTKA 1IR2A 3FVMA 3A5VA 1XD0A 4I6VA 3W38A 5LA0A 4GABA 5I7GA 3COTA 1HL8A 2VX6A 1XH2A 2Q3OA 5CLTA 3VMPA 1KXTA 4BI6A 2G4FA 4JKLA 1PIIA 2VX4A 3UJSA 2QGHA 1ML1A 3GHSA 3M7WA 3E2SA 2P8BA 4DN1A 3T8LA 3C2EA 4B90A 2W67A 4Y2WA 4UNIA 2P50A 2ZWZA 3WEMA 3I10A 3DBPA 4Q8WA 1UR3M 4DBEA 1VQTA 2EO7A 2VVNA 1TE6A 2R82A 3G1AA 4ZOEA 2WNNA 1MQPA 3TYBA 2YW3A 2YYTA 1R30A 3GYCA 1Q6LA 3TA9A 2VFGA 4FX6M 1TPH1 3HZ3A 3GUWA 4NASA 3L5LA 1R9XA 4M80A 1QRQA 3HM7A 1PUDA 1E6SM 1E0WA 1Z32X 1YPFA 1AQ0A 3WLPA 3SCTA 1DIKA 4EF9A 3LERA 3PPFA 4K7VA 3GXPA 1W56A 1WXJA 4WUIA 3TYDA 1DOSA 2VGFA 1Q6OA 2WC4A 3AIQA 3DC0A 3KBNA 4AW7A 4J3VA 1JGIA 1TO3A 3NQ8A 3TQ0A 3LI1A 3VTRA 3BGGA 1YXCA 2XFYA 3A3WA 2ZRZA 4AH7A 1EZ2A 5A1AA 4C6CA 3BDKA 3LHWA 3PG9A 4AXNA 1JFHA 3NDYA 5GPRA 2RAGA 1C9DA 2VNCA 4I3GA 3NXFA 1KCKA 3G1XA 2Y7EA 1XLGA 2X0HA 3PM6A 1NTHA 2EJ1A 3SY5A 1ZJBA 2F38A 1XRTA 1UP2A 1WKYA 2WMIA 5T26A 4OOUA 1E71M 4JQ3A 2V5CA 4AZCB 4GUHA 4O52A 4QDMA 1OBAA 4O10A 1LRNA 4D6JA 5A2CA 3RLUA 2HE8A 1QPRA 3OPSA 4EANA 1RR2A 1X7IA 6A3HA 4GOAA 2QDDA 1BYCA 1JZ4A 3I7RA 4O4WA 1E5NA 3WBAA 4HTYA 3I7SA 3L68A 3VE7A 4MG4A 1FCBA 2XIJA 1US0A 3VI2A 3ARTA 4LAKA 3W7IA 1JXJA 4DB7A 2MNRA 5BU9A 3KBVA 3THDA 3B3DA 1Z42A 5G1YA 3GBDA 2O92A 5DCBA 3WQDA 3KL0A 4UTFA 1GVIA 3DENA 4WXZA 4AVFA 4ZMGA 2XSAA 1AG1O 1TVPA 1G5AA 3FV9A 1RVGA 3O6CA 2GDVA 3LUTA 1S2UA 3T44A 1JULA 4PA8A 1TTIA 2J66A 5U7SA 3FJNA 1JQXA 3D47A 3FEMA 5G4EA 5EBUA 1OFOA 1F9CA 2E0PA 5KEZA 1B3XA 3ARYA 1EJVC 1W9PA 1Z69A 2R6OA 2VDIA 1NEYA 2P0OA 3VO0A 2UY3A 5LA2A 1H7NA 2Y61A 3WJZA 2J7CA 5F7UA 2OX4A 1XYZA 3O2LA 3BVJA 2CU0A 3TWAA 3S1UA 4LS0A 3EB3A 1D2KA 4R7JA 3AS3A 1PIGA 4A22A 4U28A 3EWBX 4CLMA 2HVNA 5CCZA 4JN7A 2QMKA 3TOYA 1LOLA 3ZJ8A 1VYRA 4DBUA 1EEPA 4XWUA 4HVXA 4A3QA 1X1NA 5AYBA 4S3CA 4AIUA 5IHSA 2BX7A 4H83A 3BUVA 1YNPA 1XGZA 3AS0A 2Z29A 1EYEA 3AXMA 3M41A 5KETA 3OODA 4H8HA 3M4HA 2B7NA 3HO8A 2D0FA 3PPGA 3O15A 3P7YA 2DORA 4ES4A 3CZJA 3CT2A 3W2KA 3GG1A 3KRZA 5AHNA 3U2CA 4GLEA 1AW5A 3NOYA 4I8YA 4F40A 4HHHA 9XIMA 4KEMA 2YCLA 3U2EA 3VUSA 2VEGA 2VFEA 1QUMA 1V3HA 5E0KA 2WVSA 2Y1HA 4RDWA 5MKGA 4P7OA 3PPHA 2OMAA 1VEMA 1NDWA 1LL6A 1YE6A 4O57A 3VUPA 3ARPA 3CPRA 1LRQA 2XHYA 4RNHA 4IFKA 1TWDA 4H2CA 4ML4A 1UR9A 1AUSL 5CPOA 3EAUA 3U4FA 4Y9OA 4Z17A 3UWQA 1TV5A 4LFYA 3QMRA 5GQBA 5CZ0A 2PTWA 3VOHA 1K9EA 1V02E 1OX6A 1XPYA 5BWFA 1D3HA 3T55A 3T2QA 4YWIA 4O1DA 4AZ6A 4N9EA 4O8RA 3LPPA 3UG4A 3VIHA 3IIPA 4PMVA 4IPLA 2NUYA 3QR1A 2QW5A 2SFPA 4TOQA 2OSWA 1IGSA 1Q7QA 2CC0A 2EAWA 5JQ9A 2X7VA 4OU1A 4B5TA 1VYSX 5DBUA 4P8XA 3W7QA 1NIUA 4BEQA 4ERAA 2VVSA 4ZQPA 3BZGA 3GR7A 3DKLA 5CZKA 1DJNA 1AH4A 3WF0A 4QSHA 3FYYA 1TSIA 1V3KA 4Q4SA 1NFPA 2E4TA 4GWEA 4WGXA 2VEFA 4QE1A 4XZ9A 2DW7A 1OFQA 1ZL1A 3V7PA 4OBRA 3IVTA 3VIGA 3OZYA 4EXBA 5HDRA 2A3AA 2V3EA 4AY8A 4P8VA 2CETA 3GVQA 5L6UA 3ZJ7A 3W2JA 3ZM8A 5HA7A 1SFLA 2F6XA 2OSXA 2XSXA 2DZXA 3TC7A 1KKOA 4KCUA 4YHGA 4LANA 2V3FA 2PWVA 3CZGA 1RVKA 3R13A 5A2BA 1TX2A 1ADOA 3E9AA 2ZFAA 4GK8A 1V4YA 4WSKA 2GLKA 4HHLA 5CGQA 3C5QA 5FD0A 2VGIA 4LC6A 2ZDRA 1IV8A 4QLKA 3RMJA 1E9LA 3DU0A 1RQEA 2QPXA 4PC8A 4E4PA 4DO6A 1LUCB 4YNGA 3LLFA 3V35A 2J6VA 3LOTA 1IF2A 3BMVA 2GGIA 1KA9F 3U8GA 3L0GA 2HS8A 4IMCA 1YIXA 5LZLA 3SSZA 4N9BA 1NF7A 3VYLA 1KRMA 1R5YA 1VAHA 1LM1A 2C6QA 3APGA 1JDDA 4C6IA 1EPXA 1XLIA 4GI8A 5I3KA 2FYMA 3GZ3A 4W7WA 1XKJA 3UWEA 1AJZA 3BLEA 3PSWA 3N14A 4QDPA 2FLIA 3KZSA 4X2PA 2GVLA 3GHUA 4DUXA 3O05A 2X1UA 3NM3A 1R9YA 3U4AA 2UV8G 2R1KA 5CEWA 2J27A 3DGRA 2XPKA 1TJPA 4NNBA 1ZP3A 1UD5A 4HZ7A 1P48A 5CPNA 1ENUA 1W3IA 2VOMA 2OYLA 3QHMA 3GSMA 4LVBA 2VL4A 4UTUA 4TMBA 2NQZA 2PDWA 2NVDA 1DWIM 2JEPA 1QFEA 1XYLA 1E5JA 4QQUA 3BPWA 5XIAA 3VGGA 3GM8A 2DU2A 4IUOA 2BMBA 3SCUA 3HMCA 1XFCA 1EC8A 4Q7IA 3DXIA 3LHYA 2OR2A 2ZZ5A 3CHEA 3EKGA 5D33A 1JYXA 1WKEA 1A5AA 2AL2B 1HJUA 2J78A 1UQYA 2G8ZA 3BMXA 4W7UA 1JR1A 3F4NA 2CPUA 3REQB 5C2CA 4JTQA 2C19A 1DHKA 3LB0A 3U7VA 3SCPA 5DQPA 4YJ5A 5CSYA 1JCNA 4EAYA 3W1RA 1PIFA 5SWUA 4J2PA 4AD2A 3CHCA 2DQWA 3TTEA 3H8AA 2FVMA 1UW9A 3C86A 9CGTA 2JF6A 2V67A 4Y90A 3WQ6A 1CWYA 1AD4A 2O9PA 3P80A 1MFVA 4PCTA 5T8GA 1I1WA 3QZ6A 1Z89A 3BAXA 2DY3A 3G1VA 1SZGA 4UOZA 1ONXA 4KIEA 4IGMA 4W87A 1OFDA 5AHIA 3TFCA 2H9AA 3GTNA 4AISA 1X1OA 1ICQA 4BKNA 2ZXQA 3LV5A 2BWGA 1UP0A 1KM1A 4YPJA 3STPA 2BFGA 1PTAA 3LLXA 1ECEA 1ECQA 3FJLA 1VB9A 1WCGA 1J0HA 2EJAA 1HJSA 3H7VA 3LCFA 4G1NA 4KCTA 2X09A 1OYAA 3HG4A 2X40A 3GG8A 1EJRC 3L4XA 3MS8A 1KFEA 3FEQA 2WOQA 4CUCA 1OT2A 4B5VA 8A3HA 3TTSA 1P0BA 4ILSA 2HQAA 4AYSA 4YU1A 3MSGA 2QVNA 1OT1A 1BVWA 1BYAA 1J0IA 2VI0A 3RPDA 3M0IA 3M64A 1ZSXA 3B9DA 3KX6A 1KFKA 4EF8A 1TIWA 3VDHA 1SZFA 1B2YA 4ZQOA 3HGSA 1YQ2A 2GJNA 1QPOA 1L8PA 2X2YA 4PB3A 5C70A 1DIDA 4KEUA 7A3HA 5KZDA 2UZ9A 4U33A 1IWPA 2F61A 3K1DA 4ZO7A 2FZ8A 2VR4A 3OQEA 1M6JA 2I14A 1ZCOA 4HNTA 5HNUA 4DF1A 4ZB5A 4XBJA 2JEQA 2PF8A 4ICMA 4OUIA 1XUUA 5K9XA 2B7QA 1SZRA 2XFFA 3H12A 1C93A 3HQPA 3MCNA 3WJXA 1SW3A 2EPKX 4JXCA 3MU7A 3THUA 2VC7A 3LPFA 4JFVA 4O17A 3OJGA 1NARA 4E2DA 3GTIA 1RBLA 4D1IA 3WY1A 1R2TA 4ZR8A 2PDPA 2DQXA 5G1TA 3LBMA 4M19A 1SPQA 1XLBA 2WMFA 1QOPA 4I9AA 4MVAA 3PAJA 1XYBA 4FOJA 3WQEA 4GI4A 1JPKA 5TNVA 1OINA 1RALA 1UMYA 3SB0A 5DELA 4PRTA 5LHEA 1XC4A 4LX4A 4Z1DA 4JTAA 1W1YA 4DPQA 3RRXA 4HHPA 5I0DA 4NZ5A 1XI3A 1PTGA 3RLHA 3FY1A 4WX2A 1O6IA 1TRIA 5A6SA 4W84A 2Z1KA 3C2OA 2KZHA 1WZMA 3MYOA 4DUVA 1TMHA 1FHLA 3OOQA 1EX1A 3ELFA 1EF3A 5A94A 1E6NA 3DFSA 1BGGA 3AMCA 4KGJA 3F03K 1Q65A 2P1FA 4AUBA 5CZJA 5BXPA 1MUCA 4A3HA 1BG4A 5IFPA 1BVZA 3F7JA 4PMQA 2IXUA 4CN1A 2WJZA 1NH6A 4JTKA 2PZNA 4YLWA 3MPGA 4C6LA 4XX6A 2KAUC 1X97A 2XH4A 3P0XA 2IKIA 3W1TA 3E49A 3LMYA 1NM9A 4QTGA 1WZAA 5C6MA 4CU8A 1I1XA 2HK0A 3APTA 4JEQA 4KCVA 1XF0A 4HMCA 2NX3A 3GB6A 4MAVA 5CC6A 1P0KA 5TAOA 5DRCA 1ZS2A 3F4CA 2ISSA 3LN3A 3AS1A 4EWND 5EMYA 2ZVRA 3DG6A 1JCLA 1OSEA 3T42A 5CJ5A 4A29A 3T4WA 4PMDA 3FJ6A 1TX0A 5CPTA 1LQ2A 1QVBA 2YDQA 4LB4A 2A3CA 3ZSSA 4NAFA 1SFJA 3VCRA 3LEPA 2WC3A 3KOYA 3GHRA 4ZL1A 4PTVA 1VC4A 1YTKA 3GNDA 2G3IA 1YTDA 3E2RA 5AVNA 5CC3A 3VNZA 1HF6A 2DZPA 4GJJA 4POCA 2XGIA 3S0CA 5HXMA 3HMJG 4M0XA 1MEIA 4PFHA 3QR3A 3F1QA 5GNYA 5I3GA 1ZQ5A 5J5RA 2NT1A 3QC3A 3POHA 3PNZA 4GUJA 4XKYA 3PUDA 2YJQA 3WBEA 4UFJA 2BASA 2GQAA 3W27A 1YXDA 1VENA 3W71A 1FUYA 2OELA 3AAMA 1OZMA 1B3YA 4Q8QA 5H8UA 4BF5A 1F3TA 3RX2A 4MTVA 4E2VA 3TCSA 3AHYA 3N73A 3HU7A 3V0TA 3EWDA 1WXYA 1HQTA 4HNNA 4XAZA 1CB2A 4LUYA 4F0SA 1FCUA 1FWIC 3LM3A 5BRBA 3UZWA 3QJAA 4R9OA 4AWEA 3SSJA 2HSAA 1FWAC 1ICSA 1XKYA 5XINA 4CCEA 3HN3A 2X8RA 6TIMA 1VYPX 3LTYA 1SO5A 4MB5A 3WMCA 4XSLA 4PSPA 2OYKA 1HX0A 1TPWA 4F0RA 2R1NA 3A4WA 3M5VA 4JQ4A 5LGXA 1U1UA 1JCMP 2ZQ0A 4M8UA 3W25A 3TSMA 3KZPA 3UNDA 3WN6A 2ACUA 3W37A 2XVKA 3W3OA 4H8UA 2YCJA 3CBWA 3ALGA 5AECA 4CCZA 1V03A 3HIJA 4XAGA 2PAJA 3H53A 3ZJ6A 4C91A 1UPMB 3NDZA 4GZEA 3WDQA 3U7BA 4LUSB 2FTYA 2VP8A 1EA0A 1XIFA 3WL1A 7CGTA 4MWAD 2PB1A 4UC5A 2VJXA 4KWUA 4H6EA 5T91A 2AMGA 1E1FA 5I07A 4O11A 5E09A 4D71A 4MGGA 3N6QA 2Y5JA 2CHRA 4NXSA 1F76A 4PULA 5D38A 4UCFA 1B57A 3OZMA 1A4LA 3E0IA 1E1EA 1EHAA 3E2QA 3MBDA 1R2RA 2I9EA 4M1RA 1HJXA 3N19B 5A6TC 3UYCA 3SRHA 2Y6ZA 2NV2A 3MI3A 4TMCA 1ZBKA 4TV6A 4D72A 5DF0A 4WD0A 1E6XM 3BXWA 2IQ0A 4H8VA 1GT8A 1LORA 2BY0A 1EXPA 4I8DA 2FHFA 1KV5A 3H2MA 4JX5A 3NTYA 4ZXLA 4K68A 4DBWA 1XISA 4IMFA 4IHCA 4OWGA 1O68A 3ZMRA 3OW1A 1GORA 3LCWA 1JCXA 4OGZA 1H4PA 3HG3A 4R7OA 3Q37A 4H7VA 1XJBA 2WV8A 1IIHA 2GVEA 4LRSA 1L6SA 1JZ5A 4N2YA 3N4EA 5F2IA 2G3NA 3ATYA 4IIEA 3RR4A 2DIJA 3V5FA 1VZWA 5TF0A 3RCYA 1FWRA 4ASTA 2RDXA 4JTJA 4V27A 4NZ1A 2XN2A 4RW5A 5D2WA 5T9CE 5AHEA 2W66A 4JKKA 2POTA 2PLCA 1K6AA 5DRIA 4IPPA 3GTXA 4RK8A 3SZ8A 3UG3A 3EWUA 1KLZA 2B0MA 4ADTA 4TVUA 3S4TA 1XDLA 2PBOA 1U33A 3PBWA 4H9XA 3S2MA 1KBJA 1CCWB 1FP8A 3CQJA 3PBYA 3GK0A 4PRWA 1VJZA 3LRLA 5AC4A 1S39A 1ONWA 4L6HA 1UKPA 2OWCA 3ES8A 3SQMA 1JGMA 2V81A 3CK5A 3U57A 3CGTA 4LYRA 5DMYA 2W63A 4QAIA 3N9KA 4URIA 4IQLA 4C7FA 5H8PA 4IZGA 2G95A 4GRSA 4OFCA 5FESA 3UA4A 1W3TA 3G24A 4NI3A 3T09A 3IJ8A 3PFRA 2PLJA 3MP5A 2QIIA 1YYAA 2A7NA 2OB3A 4BZYA 1M41A 1HP4A 2J8GA 3LBCA 4PBFA 3VIFA 2VZVA 1HJVA 3GW0A 2HZGA 4UQCA 3K5XA 4FXFA 4M7SA 3ZR5A 1KBLA 2XIBA 2VOTA 3INPA 3SEPA 3HF3A 3W1LA 2G3MA 2X41A 1W8GA 4C90A 3BV7A 4DRSA 4NNAA 1TWZA 1EP2A 3HGJA 4EX4A 1NJJA 4JDBA 2E28A 3WDJA 1V51A 3WNMA 4DWDA 4ATDA 4PCFA 3WH6A 4K36A 5IRPA 4JYEA 1VIWA 2EG8A 3EOUA 4B9YA 2QDEA 1UWTA 3NYDA 1G69A 3KOWA 3GDBA 2A21A 1BYDA 2GJPA 1F5ZA 4GZJA 4K38A 4FX8A 4KRTA 1A3HA 2JIEA 3NWRA 1XCWA 2WVVB 4IWWA 1FA2A 1XL9A 2D3NA 1Q2SA 1W5NA 5BOFA 1EHNA 1KGUA 3MUXA 2XIIA 4DF2A 2ATMA 1Q85A 2J79A 1CXEA 2ACRA 3H55A 2PU0A 1OVDA 2OXNA 1TKKA 1PXGA 4I5UA 1HN1A 5DT7A 1F74A 1QDSA 2QULA 3CPGA 5AN7A 3FSUA 3CV6A 3UZXA 5HMEA 4O28A 3A3HA 4CVUA 5LIKX 4LVAA 3CL6A 4FSAA 2Z28A 3AIUA 4KBXA 1E40A 4MYAA 3H7RA 4MWAA 1G7VA 4AEFA 5A2AA 3SCOA 3W7HA 3TYCA 5HNTA 1QK0A 1JUBA 4JFTA 1K3UA 4FNQA 3ME3A 4W4QA 4D6CA 1TFVA 2OJPA 2YXOA 4B4HA 2O7QA 3AZRA 1VBJA 5AHMA 1PTDA 3BTNA 4WCJA 1SO4A 4JX6A 4RNFA 3WNNA 2CLEA 3BG3A 3L65A 5K7JA 4ZO6A 3DFTA 3AIBA 1IR1A 1IHIA 4LRTA 4QEEA 1GOIA 2EPOA 3PJWA 3OZOA 3LYEA 1WDRA 1FDYA 4NNCA 1TR1A 1MDRA 1PCWA 4D1JA 3G0SA 2PDGA 2WQPA 3RAOA 3CIVA 2PC4A 3V36A 3ARWA 2HV5A 1F6PA 3WFZA 4NZ3A 4XBSA 3JR2A 2VYOA 3LTPA 1HW6A 3MO7A 2GJLA 2D20A 4S3KA 4PEKA 5A8OA 4OTKA 3O6YX 3C0JA 3JVAA 3ITVA 3UXIA 3ZFHA 3AYVA 3B0YA 4HCDA 3WUFA 2BXYA 1GW9A 3G2GA 5GJPA 1D8CA 2NQ9A 3U5UA 2PWDA 4ZO8A 3G1HA 3B0UX 1K77A 3PVFA 4UTWC 2WPGA 2EG7A 2Q02A 4Q4RA 3NZRA 4DYJA 4RV8A 2G3FA 3KDNA 1KV8A 2A79A 3EKZA 1HKJA 4S38A 1VIZA 3W1MA 2WHKA 2GJXB 4IPNB 1Q6RA 2REQB 7XIMA 5CH9A 1NOFA 3UJFA 2NQ5A 3BCDA 1H50A 1UR0A 4H04A 3SUVA 3UPBA 1CT5A 4LQ1A 3R25A 3LA4A 3PP7A 1XBVA 4K2SA 4I90A 5BOOA 4DI9A 1GHRA 4UQAA 4CD5A 4O1CA 3VZZA 3ITLA 3C8FA 5AKQA 5IBXA 2AQOA 3W4RA 4FNRA 3MV01 3ABSA 2HXUA 3GAYA 1YE4A 4Z1CA 2CLLA 3SCQA 2J9YA 1XW8A 1W3KA 4MLRA 4IIDA 3G1DA 1J96A 4DNMA 1IXOA 5HNNA 2H6RA 4DWSD 2I56A 4K1GA 1XLHA 2UY2A 5HNRA 3W00A 5HJLA 4E6MA 1CW2A 1J10A 3GXNA 2XU2A 1E43A 5HMFA 1G01A 1ZP4A 2F9RA 3H4GA 1CLKA 1VEPA 4IH3A 3T0DA 5GJMA 2C1GA 3B8VA 3GTFA 3JRKA 1OIFA 1P6BA 3NEVA 4LT9A 3LG3A 1ODUA 2ESCA 4ADUA 3S6DA 2QV5A 1R7OA 2O4MA 2GVGA 3DUGA 1O94A 2V63A 4JL2A 3NQMA 1W32A 4E3TA 5DEZA 1OD8A 1YLVA 4D9PA 3AXHA 3RGTA 3P8IA 4C1NA 1H09A 4H7CA 4QG6A 4KFOA 1SR0A 3LPOA 3K46A 3ZVHB 2RDWA 1HT6A 3RX3A 1QPKA 4HCLA 4TR9A 3DZ1A 3T0TA 3HG2A 1G4TA 4F0KA 1I0BA 1UBPC 2VUYA 2WWDA 1J6OA 4AD0A 1WDPA 2GQ9A 1EEXA 5FACA 3WD0A 3LXBA 1FY6A 1DJGA 4AWTA 5ABFA 1ITCA 3IS4A 5F2MA 4F9DA 1A5OC 2C71A 1W31A 4GQRA 5CGMA 4BEUA 1V3IA 4HPXA 2E6AA 1UA3A 3ZSTA 1P6CA 2Z2BA 1FWCC 5FEWA 1CEOA 3GXDA 3F2DA 3DEQA 3NZPA 4GH1A 3HPFA 3URQA 1E6PA 3ITXA 1UD2A 4G6CA 3FDGA 3KRSA 4X63A 1JUKA 4ZSTA 4L5ZA 2QF7A 4HSOA 3AXIA 3PULA 3F4VA 3CUJA 5PTDA 3LNMA 3WLQA 4IXHA 1OHLA 4A3RA 1RZMA 3H2FA 1LL4A 2QPSA 3SM0A 1UOZA 4O19A 4PMYA 1YBQB 2D23A 2AOSA 2C1IA 1OX4B 1GQLA 2WK2A 4IUGA 1ICPA 3EXRA 3NQ7A 4HZ6A 3QW4B 2BXVA 1IIGA 1A5LC 5EYWA 3TYUA 4DUOA 1R3TA 5A6AA 3DBNA 3BLOA 2W9MA 3N3TA 2Z26A 2RH9A 3N18A 4TIMA 2PBGA 2E25A 3MMUA 1XG3A 2WSYA 4ZO9A 1IZCA 7TIMA 1OZQA 4L1WA 1JXKA 1KFJA 3W29A 1TRDA 4Y8EA 2BVDA 3N2XA 3G1SA 2NX9A 2V5DA 3BLLA 4MWAC 3KW3A 1QCWA 4PN2A 2GDQA 3BJFA 3NL2A 2X7WA 2W5FA 1V0KA 4XBKA 3DG3A 4ALDA 2Z2UA 2R8WA 1EB3A 5G4WA 3VU2A 1PKYA 3TC3A 1D7KA 2XGZA 2W91A 1RK6A 4O18A 3HGOA 2ZUWA 2OYMA 3U2OA 1R9ZA 2BGNE 3D3FA 3WJWA 3U48A 3KVKA 1F3EA 3M5YA 3TYZA 4V28A 3NVTA 3UA3A 3M0VA 4PCPA 3PTQA 4GHRA 4B5WA 4DUWA 1AH0A 1H63A 1LCOA 2WLZA 4GNJA 1W1TA 3VD9A 2CIPA 1MZHA 1JQVA 4H00A 3GNPA 2NUWA 2I57A 4HYVA 1YXYA 1UPPA 2ZA3A 3BOLA 2DVXA 3MB9A 3HJEA 4DWSA 2J8TA 4KCWA 5BZAA 4HNUA 5LNVA 3WLMA 4JBRA 1SJCA 1CBGA 4PMUA 4EKJA 3GXFA 5I78A 3IIVA 2ZUNA 5C9WA 1JRCA 4XIMA 1TTJA 4IP4A 1FP9A 3EWZA 1XICA 4KKXA 5H91A 3I3BA 1V93A 1KXVA 3N6JA 2WKGA 4GISA 3HGRA 1A5SA 1TCDA 3IJDA 5K4XA 3AALA