4LAOA

Crystal structure of cordyceps militaris idcase h195a mutant (zn)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cordyceps militaris IDCase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
total genus 135
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4laoA00
4C5YA 1XGEA 1QXLA 4KESA 3S2LA 1GKPA 3E2VA 4LAOA 3LGGA 4DYKA 2OOFA 4R7WA 4CQDA 4L6DA 3TN3A 1I0BA 4EPKA 2VC5A 3UR2A 3EWDA 4XD3A 2XIOA 2GSEA 4CQCA 4MUPA 1JGMA 3LSCA 2D2JA 1A5OC 2GWGA 2EG8A 4DI8A 3T8LA 3NEHA 2ADAA 1WXYA 4PCPA 3OVGA 3F2BA 2ZC1A 3K2GA 3B0XA 1FWJC 1R9YA 2Z7GA 3HTWA 1NFGA 2OGJA 3DUGA 2IMRA 4PBEA 4DNMA 3IV8A 4AQLA 4CNTA 4C6KA 4IFRA 3QY7A 1ITUA 1NDZA 4EPBC 3O0FA 3GU1A 4LEFA 4IH3A 2R1NA 1EJSC 1YIXA 3A4JA 4KQNA 1XWYA 5HMEA 4F0LA 1EJRC 4LCRA 3V7PA 4KF1A 3S4TA 3TN6A 3GTFA 1FWGC 4DLFA 4C6JA 2KAUC 2VHLA 4QS6A 3F2CA 4CNSA 1POJA 1ITQA 3IJ6A 4H9XA 1V77A 4V1YA 1EJTC 1IE7C 5HMDA 1KCXA 4INFA 2PLMA 4C6IA 2BGNE 3QGAC 1GKQA 1A4LA 1UIPA 2YZ5A 3MDUA 4NP7A 3LA4A 1W1IE 1E9YB 3D6NA 3URBA 2QT3A 3QY8A 4WGXA 4DZIA 3B0YA 3F4CA 5A6TC 3GUWA 2EG6A 3OODA 3E38A 3TNBA 4H9YA 4LAMA 2HPMA 3MSRA 4KIRA 3PNZA 1FWBC 4H9VA 4PCNA 4F0SA 1FKXA 1HZYA 4LCSA 3K5XA 4GC3A 4GXWA 4GY1A 4CEXC 4H9ZA 1EF2A 4HK6A 2Z28A 4XD6A 1K70A 4I6KA 3T81A 3PANA 3PBMA 3ID7A 2P50A 4Z42C 3PNUA 2QVNA 1EZ2A 2Z29A 4C5ZA 2AMXA 4C6DA 1NDYA 1XRTA 3GG7A 4XAZA 4IF2A 3F4DA 1KRBC 2DVUA 4KEVA 2Z00A 2Z2BA 1RA0A 3RHGA 4GOAA 4DI9A 3MDWA 2HPIA 4TQTA 4GX8A 3PAOA 1A4MA 5LXXA 4H9TA 5FSDC 4LAKA 1YNYA 3E0LA 1EJUC 4IGMA 3S2MA 4RZBA 3WZ0E 3IACA 1UMLA 3GU2A 2VC7A 3E74A 2YXOA 3MTWA 2HBVA 2Q01A 4RDYA 2R1PA 4XD5A 4LANA 2P53A 2VUNA 2Z25A 3IPWA 4DIAA 2HBXA 1PB0A 3ICJA 3RN6A 2VR2A 3UF9A 2A3LA 2RAGA 3S2JA 3LY0A 1KRCC 4ERGA 2VM8A 3CS2A 2ANUA 3TN5A 2PUZA 1A5KC 3LS9A 4LCQA 1RK5A 3HPAA 2DVTA 2Z24A 4AC7C 1S3TC 2FTWA 3NURA 4DLMA 1ONWA 4WVXA 4J5NA 4KERA 1FWFC 3LNPA 1RJPA 4IGNA 3B40A 3BE7A 2O4MA 3FEQA 3EGJA 4C60A 4GK8A 1QW7A 3LU2A 1BF6A 1WXZA 4C65A 3A3XA 4PE8A 4OFCA 1J6OA 4EPEC 1V79A 4HK7A 3HM7A 4XD4A 2Z27A 2DVXA 1RK6A 4F0RA 3AU2A 1YRRA 1K1DA 2FVKA 3O7UA 1A5MC 2F6KA 3TN4A 2WJDA 1DPMA 3IARA 4IG2B 2R1MA 4L9XA 5HMFA 3R0DA 2FTYA 2GWNA 4RE0A 3F2DA 2I5GA 2AQVA 4ICMA 3N2CA 2G3FA 3LGDA 4GX9A 2QS8A 1M7JA 2UBPC 4IFKA 4JOMA 1RA5A 3EWCA 4GY7A 4QRNA 3JZEA 3UR5A 3KM8A 4BKNA 4BY3A 4C6LA 4C6FA 4R85A 1M65A 3MVTA 2OQLA 3T1GA 3ITCA 3UBPC 5FSEC 1XRFA 1E9ZB 4UB9A 3CJPA 4ERAA 4KETA 4PBFA 2GOKA 3QY6A 1A5NC 1J5SA 2Y1HA 2YB4A 4IFKB 3UPMA 3AUOA 1R9XA 1FWAC 1ZZMA 4H01A 4G7EA 4HJWA 3GTIA 3E3HA 2PGFA 5G4HC 2CZVA 4J35A 3IGHX 4C6NA 4H9UA 1EJWC 4KEUA 2WJEA 3MVIA 1O12A 1O5RA 1YBQB 3URAA 1FWDC 4M51A 1UIOA 4C6QA 1FWIC 1P6CA 3NQBA 3URNA 4BJHA 4RDWA 3ISIX 2E1WA 4XAYA 1J79A 1POKA 1RJQA 1FKWA 2UZ9A 4NG3A 3K4WA 4ZSUA 3DC8A 4C6BA 2I9UA 1EJXC 4DZHA 4KEZA 3AU6A 1ONXA 2Z2AA 1GKRA 5AKQA 2W9MA 4IG2A 4G7EB 3SO7A 4XAFA 2GZXA 4C6PA 3URQA 4XAGA 2PAJA 3E0FA 1ADDA 1I0DA 2PGRA 4GYFA 4RDZA 2WJFA 4B90A 4J2MA 2FFIA 3GTXA 5CH9A 3RYSA 3WYZA 4C6EA 1K6WA 4H9MA 2YB1A 2Z26A 2R1LA 2ICSA 4H00A 3FDGA 1VFLA 4HK5A 4UBPC 4GBDA 4QSFA 2HQAA 1A5LC 3GTHA 2AQOA 1NDVA 4I6VA 4R88A 4HA0A 2WM1A 1PO9A 4DO7A 4IFOA 4QROA 4B91A 3CAKA 3IRSA 2BB0A 2R1KA 4C6OA 4EPDC 1R9ZA 4CQBA 2OODA 4QTGA 1RJRA 4QS5A 4V1XA 2QPXA 1J6PA 2D2GA 4GZ7A 1KRAC 4D8LA 3MKVA 1V7AA 1YMYA 1P1MA 3GU9A 4WHBA 1FWEC 4LFYA 3A3WA 3GIQA 3S2NA 4RDVA 2FVMA 1M68A 3GRIA 3LSBA 1FWCC 5E5CA 4ERIA 1EJVC 3MJMA 1YBQA 3OU8A 3FDKA 4CEUC 1EYWA 2OB3A 2Z4GA 3RCMA 4C6CA 1RAKA 3QGKC 3MPGA 4CNUA 3OQEA 4B3ZA 3ORWA 2E25A 1V51A 4LALA 3WMLA 2D2HA 4NI8A 4GY0A 4G2DA 4LH8A 3GIPA 4YIWA 4P5UA 4E3TA 1NDWA 4ZSTA 4IQJA 1V4YA 2O4QA 3DCPA 1FWHC 2HNHA 1PTAA 2EG7A 3OJGA 3C86A 3G77A 1PSCA 3OOQA 2Q09A 3SFWA 1UBPC 1P6BA 4EP8C 1KRMA 4C6MA 4B92A
chains in the Genus database with same CATH superfamily
3ZSTA 2O9RA 4YTTA 3GHRA 1Q7QA 4E8GA 5I5RA 1QW8A 1U1HA 4IL2A 1A0EA 3W1TA 1C9WA 1U33A 3NO3A 3CXOA 4KT2A 3BSGA 2CESA 4W5UA 4P2VA 1P0KA 2WV8A 4WDXA 4M1RA 3NQEA 7XIMA 2ADAA 1WXYA 2IMRA 5CPMA 3CTLA 3HQPA 4JIPA 4Y9NA 2AAAA 3MZNA 3DEQA 2I16A 1P0EA 4LUTA 4GFIA 2R1NA 4DXVA 1R6WA 2ZX7A 5D2TA 5CBJA 1MUMA 3K8MA 1FWTA 1VQTA 2J7BA 4KF1A 3LHWA 4X22A 1CXLA 2KAUC 3VMOA 3HQ1A 4PTDA 2YBVA 4CD7A 1XJBA 3KDNA 1JZ6A 4YLWA 4MB3A 1R46A 4LUTB 2V8ZA 1UWIA 5MKGB 2QDHA 4UNLA 3V4BA 4ADUA 1T41A 4LAMA 2XZ9A 1ESWA 2DIJA 3WBYA 4TXEA 4H19A 2A4AA 1EF2A 3M07A 1OC5A 1Z89A 3IJ9A 5C9XA 1DJYA 3LD5A 1B90A 3M5VA 1GJPA 2XG9A 2FZBA 3VIKA 1B54A 3OEXA 2XVNA 3W37A 1OADA 1LQ2A 1VBUA 1DBTA 5CLTA 4NI3A 4J2PA 1JZ2A 3TH6A 2V2CA 3EX3A 3TYCA 1RY8A 1H5VA 4BF7A 1JZ5A 3P7YA 5F7UA 1FWWA 3GBEA 5JMUA 2RJHA 3A4XA 1XLLA 1R3RA 2QUNA 1G4PA 3SJNA 3MO7A 3APYA 2ZXBA 2PTDA 3UESA 1PPIA 1PB0A 2NW0A 2WC4A 1DJHA 5FA5A 4HCHA 3KW3A 3SFKA 4US5A 2PDIA 2GQ3A 1X38A 4M29A 3LS9A 1H7WA 4KCTA 5BCAA 3GDMA 3L21A 1G69A 4EE9A 3UW6A 1NU5A 1DEDA 1W6TA 4KFPA 3ZWSA 4GK8A 6ALDA 3RR1A 1WXZA 5I78A 2WK2A 3W7KA 2ACSA 3ITXA 3WLOA 4OV9A 1RK6A 1BFNA 1C93A 1WKEA 1K1DA 1HIZA 3FA4A 3GXTA 4GZJA 3MMTA 1PHWA 1GQNA 4DZ5A 2XTKA 4RE0A 1EHAA 1R87A 3QSTA 1QNOA 2V68A 3KHDA 3PBYA 5I0DA 3B8DA 4NL1A 2BS9A 4XO7A 3H53A 3QMRA 5AHEA 5LNRA 3G2GA 3KTCA 4P61A 4M56A 1IXNA 3EAUA 1TTPA 4O50A 1N82A 3ZYZA 4IZGA 3PS7A 1F3WA 3TR2A 3VKKA 5C0QA 2DIKA 1LQAA 1QNRA 4XTDA 5CKSA 3BV7A 4QDMA 3WNNA 1J2BA 2DW6A 2FPYA 2ZC8A 4TUFA 1NFBA 2YPIA 1IT7A 3KBJA 4NKCA 5I09A 2NVCA 2ACUA 3B04A 2TODA 3PP7A 4OBTA 2VT0A 3DZ1A 1ZAIA 1YBQB 2GVJA 1HGWA 4YWSA 4RV8A 7CGTA 2FZNA 1P6CA 2VEIA 2PWGA 3NQBA 4S39A 1AZ2A 4W85A 4PEEA 1HW6A 4JQ4A 4ZSUA 1TWZA 1ISXA 1GJWA 1KBJA 5U7SA 1GWJA 1ZBKA 2E8ZA 4Q22A 3GNDA 3OW1A 3V16A 3E0FA 6XIMA 3ZR4A 1GVIA 4RDZA 3FJLA 5A8OA 1J5TA 1SR9A 3SJ3A 1HKMA 2FTPA 5GJPA 3VMNA 4H00A 1MNZA 3VGHA 2C79A 4HK5A 2XGIA 3S47A 5TQLA 1NELA 5LSMA 1PO9A 3STEA 4LS2A 3QQ0A 4AZBA 3NDZA 4CQBA 2CPUA 1DJGA 3MUXA 1CCWB 3VGGA 2ZRZA 3H2FA 1QHZA 4J7RA 4XIAA 3TONA 1XSKA 3MUZ1 3HG3A 3S2NA 1CW2A 1U83A 1D9EA 3NGJA 4O28A 5E5CA 4Z2JA 3S6TA 2JKEA 4CEUC 5EYWA 3EMCA 1V3HA 1UP0A 4CNOA 3OQEA 3NTYA 1XM3A 4LALA 4LPCA 3DH7A 1MQPA 1BRLB 3CB3A 1WKDA 4WSJA 4GY0A 3VO0A 2CERA 2YGYA 1SFJA 1MEWA 4UTHA 3E12A 5D37A 2E5CA 3WQDA 3RX2A 1VHNA 5DY3A 3SFWA 4QEHA 4AZCA 1UBPC 2YCLB 1EDGA 5D9NA 4V27A 1HTIA 1ZPTA 4QM1A 4W89A 2ZA3A 4YPJA 4B4FA 4CU8A 4PMJA 3S2LA 5D9PA 1GKPA 3TQKA 3GXIA 2EEXA 1TG7A 1K7EA 2CKRA 4D9PA 3W7JA 3ONCA 3CUFA 4UQAA 5D8WA 2PI6A 4TMCA 3GIYA 4IQLA 3CQJA 2WWCA 3TOPA 2WVSA 3ERPA 2GWGA 3QR1A 4AZCB 2VP8A 3KOYA 4AHPA 2ISFA 3WH5A 3NJ3A 4EXQA 5AYXA 1FWJC 1WAUA 1CLXA 5DELA 3H2EA 4FB7A 1S2AA 4DY1A 2Z1VA 3PFRA 3EMZA 1VCVA 4KWOA 1R3TA 5G4WA 3S1VA 4MAZA 1JNDA 3CZGA 4A8RA 2VEGA 3KUMA 4M24A 1TQJA 1KR1A 3PZMA 4M3PA 1NFPA 3TVAA 3Q65A 1LL7A 5FOOA 4F0LA 1E55A 4RNJA 3LI0A 2XUCA 3G0XA 2XWDA 1VPXA 3M0JA 1EZWA 2V5LA 4CCEA 1F74A 4L5ZA 2NQ9A 2GDQA 2QJGA 4NXKA 2BSLA 4Q4KA 3AIWA 3H12A 1MI3A 4Z1CA 4V1YA 3WQGA 1IE7C 2R91A 3CZ8A 5KETA 2WM0A 1VKFA 4Y96A 3ZVIA 2E9MA 1UIPA 2WC3A 3MDUA 3EWBX 1LBFA 4PL2A 3GBDA 3G6MA 3R25A 3P82A 3AZTA 3QLLA 4J9JA 2WQDA 3JUGA 1P48A 2G37A 2CIPA 4KIRA 1R8LA 3KOZA 1VYRA 4UMCA 3S1UA 3W7RA 3RX3A 3RU6A 1X6LA 2KZHA 1ZAJA 5D2VA 4OWGA 4O54A 2DH3A 3AWOA 3E49A 3HJEA 2VD9A 1LG1A 4O11A 2QCNA 3QVQA 1AJZA 4HJFA 2VELA 1AH4A 1WYIA 2PE4A 2I14A 3RJXA 1MW1A 3VIHA 3DBPA 3F4DA 3E2RA 3PB0A 2Z2BA 2GUUA 4MB4A 1KM2A 3SBFA 5G1MA 5CPNA 3SQMA 3WJZA 3GZAA 2DZPA 1IZKA 2DUAA 3CLMA 2ZOXA 4WDWA 3GM8A 2YLAA 2PDBA 2CBUA 1GQJA 1XS2A 2DQXA 3IPWA 4Q7IA 3OLEA 1XH2A 2A3CA 3O8AA 3CUXA 1X96A 1W5OA 4D6IA 4UOQA 3QV6A 4U3CA 1PUDA 4DAFA 3HB9A 2DJLA 2BGQA 2EQDA 4UNIA 1RK5A 1CLVA 2Z6JA 3EZ4A 1KBKA 4YS1A 1P0DA 4I7VA 1XBZA 3ME3A 5E0CA 1U22A 3G1SA 3AIBA 1C8XA 3S2CA 3U8GA 3GW3A 1LWIA 4KWWA 1XH0A 2B0MA 4EPEC 3BLFA 1UJPA 5EMKA 2VX6A 4IMDA 4JCMA 4OIFA 2RDWA 4P7QA 2DVXA 4HKPA 1TPWA 2WBGA 5A95A 3ZT5A 2DV0A 3IARA 1I9CB 3PAJA 4JZ5A 3VDHA 1QNSA 5HMFA 1UD4A 1SQ7A 3CEUA 4S3BA 1DE6A 1Q3NA 1NTHA 5BU9A 4IFKA 1ISWA 5HUPA 1ICQA 2GPTA 1KBIA 3WLNA 3V3WA 2W63A 1A3XA 3SRHA 4C6LA 4QR6A 2VZVA 1L6YA 3CAQA 2VRKA 3CMJA 3GR8A 3WLTA 5AB3A 2Q8LA 4WK9A 4NNBA 2MNRA 3G24A 1FH7A 3N2OA 1ZFJA 3T2PA 5FSEC 1E72M 4DF1A 9XIMA 1J93A 4P8XA 3OG2A 1OYAA 3DG3A 5DRCA 5GQBA 4MB5A 4J3XA 1SZRA 2W66A 2QJNA 4IFKB 2QKFA 4AIBA 2GJXB 3NM3A 1KR0A 2R6OA 2PLJA 4M1BA 4GUHA 3VK5A 2YL9A 1HJSA 2HJPA 3SUUA 4FI4A 3DFPA 4U2ZA 3AXKA 4X9YA 3UP8A 4FLQA 3E5PA 4U10A 2G95A 3THDA 3T42A 3P6LA 1C29A 2B7PA 3GR7A 3P14A 2ZQ0A 3KE0A 1H7PA 4UFJA 4QCEA 4NF7A 2HROA 1DJWA 3WF4A 2VGFA 3B9AA 4H2HA 3RM9A 1KFJA 3EOOA 1XI3A 5FCZA 4F79A 2P10A 3OPSA 1YE4A 3KWXA 5CH9A 3RYSA 4H8NA 1S2CA 3MCNA 4CQ8A 4HZ6A 4WJXA 1RVGA 3BARA 4EKJA 4I6VA 1GOMA 4MSSA 2QPUA 3FY1A 2VR5A 2BB0A 3KZSA 2ACRA 3WQFA 2CLFA 1IGSA 6PTDA 3WY1A 2EJ1A 1AVAA 3E1F1 3MP5A 1PV8A 3I65A 2Y2WA 4V1XA 3IIPA 4ALDA 5FESA 2X30A 1V7AA 5DXXA 1XF0A 3ARYA 4AWEA 3TC7A 4AX7A 1K3UA 1OFEA 4AH7A 3OBAA 1QNPA 1TZ9A 4B5XA 2PTWA 4MFDA 1HFBA 5A6KA 1LL4A 3QGKC 1EEPA 2QR6A 5A8PA 4AXKA 4NJKA 4ZQMA 3H2AA 4OZOA 3CHDA 4IQJA 4GIRA 1VGAA 2V5DA 1SFSA 3AWNA 3FIGA 1UP2A 1MO0A 1XL9A 4NQ1A 4QG6A 1QNQA 1DWAM 1EL3A 1CB2A 4RE3A 4ZTYA 4K8EA 2DW7A 1EOMA 2HK1A 3MYOA 3U48A 2CEQA 2ZUVA 4LAOA 5CBBA 4Y90A 4CQDA 1QPNA 1CENA 2JF7A 2YCEA 3ZT6A 3R94A 4DBWA 4LOCA 1JUEA 2XIOA 2GSEA 3E0VA 1XBYA 2E40A 1XLIA 4MIMA 3SGUA 1R3WA 1J0YA 5EU9A 1UUQA 3C2VA 1FTXA 3HJZA 4A8NA 3C61A 2A3EA 3PY2A 5DT5A 3FKRA 4G5DA 4U31A 4EPBC 1EC8A 4JAWA 2G50A 3LMZA 4FNTA 4WD0A 2C19A 4IH3A 3VNJA 1K8YA 1W1TA 5I3HA 2QNEA 3ITTA 1YIXA 5CZJA 3E9AA 4WUIA 3UQNA 1NWUA 1F5ZA 3E2QA 2GVLA 1E56A 3KOFA 1B31A 1FWGC 2WKLA 1L2UA 2CLEA 1ZJBA 1JRCA 2WZTA 1R5YA 3HV8A 1BEUA 2FLIA 2DPEA 1MRQA 3MHUA 4UFLA 3CM4A 3CZLA 1BG9A 1I8JA 1PIGA 4N6EA 1ZJAA 4NP7A 1OBAA 1E9YB 4IMGA 2NXIA 3D6NA 3QY8A 4DZIA 4NJIA 1O7AA 4UFKA 3U2EA 1JF6A 4LYKA 5CCZA 4O16A 2OSWA 1TPH1 4XVEA 4R5EA 1W2VA 1A5AA 2AGKA 1TPB1 3BAIA 4PRWA 2POZA 2WVVB 3GTNA 3GH4A 4LNCA 3ITOA 2ISWA 3VC5A 1J96A 2OFJA 5IBXA 4NNCA 1OIMA 4ZQOA 3BTNA 3C52A 5J5DA 1CDGA 1EZ2A 1LUCB 3DG7A 3MP3A 4TVUA 1E6NA 4JTCA 1RLDA 4F9JA 2ZZ7A 3BLEA 1F8MA 1JZ4A 2QQ6A 4FPSA 4CQ9A 3REQB 4REQA 4MNJA 4L64A 3PM6A 5ABTA 3R5EA 1TQXA 1A4MA 3P74A 2D73A 1MXDA 3ARQA 1UZ4A 3GDRA 4FIRA 4GD0A 3RM4A 2VUNA 3R6IA 5M2FX 5HJYA 1PYMA 1QPOA 2F38A 4N02A 3LM3A 2RDXA 4CUCA 2QEZA 3NGFA 3GHSA 1XFBA 2CKSA 1XD0A 3ZIZA 2CLMA 4B5WA 1UPMB 4K1GA 5DCEA 1KKRA 1XIGA 3K30A 4S3EA 5T8GA 3CHFA 3ALGA 3O1NA 3M41A 4F40A 1Q65A 4FXSA 3QFWA 3ABZA 4OFCA 1R30A 4GWEA 1ZP4A 3N2MA 4RPQA 3ZJ7A 3QGVA 4LVBA 3BC9A 4F0RA 3WUFA 3EKGA 2E09A 1A5MC 4IG2B 1EQCA 5M03A 3LBMA 1W5NA 3LCIA 3FAXA 4JOMA 3BG5A 3TTSA 2QGYA 2F7FA 2XJ7A 3WD3A 1X7IA 3EKZA 3POCA 1OCJA 4E38A 4J3VA 3GC2A 1TPEA 3AIUA 3FV9A 2PRHA 4WGHA 4S3DA 3AS2A 3WH9A 1CXIA 1I1WA 1GVQA 5AY7A 1DORA 3C2YA 5DX7A 5A5WA 1O1HA 4FLOA 1XGZA 4JTKA 4H01A 2GDUA 1ZGDA 3H4WA 4FX7A 3MUY1 1V5XA 1O12A 1ICPA 4MHBA 3APGA 1HP5A 1FWIC 5E9AA 4AD0A 1B4KA 1W91A 4BEQA 3NZGA 3T2OA 2ZVIA 1HN1A 3K4WA 5CAKA 1FWNA 5FF3A 1KQYA 4JN6A 4HQVA 3RM8A 1E3XA 5D30A 4NZJA 3NAVA 4KIEA 4Y9PA 3T40A 2GL5A 1HVQA 1RBLA 4DBSA 1KD0A 4LEQA 4ZFMA 5A6SA 2PGRA 3NVDA 1E4IA 3KLLA 2OU4A 4J2MA 2XH7A 1BD0A 3VD5A 5E09A 3VNMA 3GNOA 2HMCA 2PFHA 2PURA 3WJWA 2DSVA 5D09A 4XKMA 1VJSA 2R1LA 1XIDA 1EEXA 4XX6A 3ATZA 3GTHA 4F4RA 1FVPA 2AQOA 3WFZA 4HA0A 4B91A 1C8VA 1TV4A 3A4AA 1HL8A 3UR7A 4G9PA 4WEVX 2EPKX 3V18A 3W28A 2OYLA 1ZLPA 1N8FA 3UGRA 4MWAD 4UFHA 3VE9A 3WFLA 3WF2A 3ITYA 4S3AA 1UKOA 1PJ9A 3EOLA 3B9OA 2A7PA 4CN6A 1EFZA 3QW3A 4WDUA 2PP1A 4GQBA 3CV2A 4EVZA 4Z1AA 3Q94A 1XUUA 5T9BG 4GZIA 3IUDA 3CBWA 3SUSA 1A5SA 4NI8A 1UA3A 4UNKA 3T08A 3DDMA 2V3DA 5K9XA 1XC6A 1LRNA 4PMXA 5IBXC 3C86A 5CSSA 3VDCA 2WSPA 2FYMA 1JCMP 1BHGA 2IPWA 2VVSA 3WUGA 1TWSA 1H11A 4HNTA 5KMYA 2ON3A 2X8RA 1QXLA 3N29A 3LHYA 3ZXWA 1QI3A 2GGEA 1K9TA 4OJYA 5DY2A 3DG6A 4PRRA 4R7WA 4L6DA 4ICCX 1CIUA 4QQUA 4YVPA 3M47A 1B9BA 2PWDA 3U2OA 3DFTA 5AC7A 4M7SA 3I6EA 2WO5A 3UZYA 3MW7A 5HJXA 5AC5A 3NSNA 1MRAA 4HOXA 3G6LA 1OG0A 2JBMA 1AJ2A 3AALA 3C2EA 4U28A 4B4HA 3M46A 2O9PA 3IV8A 4Z2LA 4LNYA 3MUIA 2YCJA 4WX2A 1NDZA 1OABA 1B4EA 1EKOA 4FHAA 4IPIA 1I2PA 1EWDA 3GU1A 3OP2A 4S23A 3MYPA 2J78A 4ML4A 3ZSSA 4ENLA 1MFVA 2QCDA 1EOKA 1SGJA 1QOXA 1FCVA 2DZWA 4W8AA 1QMLA 1ADSA 1F6PA 2KX9A 3LUTA 3NUKA 1M3UA 3WFAA 4B5VA 3NYDA 3R4IA 2YCKX 4C6JA 2I56A 5E93A 4XSMA 3U57A 1MYRA 3W1PA 2RGMA 4HTYA 5HMDA 3GWQA 4MJ4A 5LIWX 1LCOA 1UA7A 1WA3A 2V30A 2J7DA 1I4NA 2WMIB 2QT3A 2QCDB 3N2TA 5A6TC 1QFEA 4H9YA 2O0TA 3MSRA 4I5XA 4NJGA 5H91A 2C91A 2V3EA 4HU8A 4EF9A 3HA1A 3QKEA 1TPFA 1FOBA 7PTDA 3TTOA 3R10A 3SURA 3T81A 4L4MA 4WJ8A 3TJIA 3GFXA 3DI0A 3HGRA 3RPDA 3SM0A 3TX9A 3OB8A 4AY1A 1LLZA 2PWFA 1AUSL 1IT8A 1CYGA 2F9RA 2OELA 1C3FA 1BSLA 4IF2A 3T4WA 2Z00A 3U9IA 3WDPP 3AMKA 2CWNA 2FB2A 4DI9A 3UCDA 1O5KA 2PS2A 3PAOA 3G0UA 4P7LA 4H8UA 1QK2A 4LTSA 5EGRA 4TIMA 3L5LA 3JRKA 3IS4A 3EB3A 4JTUA 1TWWA 2Y8VA 3NOEA 2QMJA 1CXKA 1SW3A 2QPSA 3OBEA 3SCRA 2HBXA 7A3HA 2CLLA 3BAKA 1EX1A 1OFBA 4Q8PA 3WDRA 4TR9A 3UZXA 1ONWA 4J5NA 3T44A 5AFDA 1RUSA 5AVHA 4LT9A 4M19A 2Y85A 5K4XA 3DBNA 4HU4A 4XBKA 3AZSA 5C2GA 1XDLA 4Y9AA 3EXTA 2XFYA 2XVKA 2J8FA 4A05A 3IRDA 4OGZA 4P8VA 1F4HA 3F03K 2Y63A 3P60A 1EBGA 3EPNA 4ONVA 3OZMA 5JH2A 2VC9A 2FVKA 3AHVA 1JVNA 3SI9A 5H1WA 4WQ6A 4L9XA 3V1HA 4MWAA 1I2NA 1MUWA 5A8GA 2NUXA 1MEHA 3TZNA 3TW7A 1PYFA 2QCFA 4E8CA 3HIJA 1OB0A 2OQLA 1XXXA 4BQ2A 1E1EA 4M7TA 4S1FA 1KXQA 2DSZA 1KNWA 1E9ZB 9CGTA 4O10A 1ZJIA 4ACZB 5CPOA 4KMQA 1W5MA 4NSBA 4UOJA 1ISYA 2DZBA 4YTQA 4GE8A 3HU7A 4RCXA 3SN1A 8XIMA 3BQ6A 3ABXA 1E3ZA 3WK1A 2HSAA 4J35A 2J75A 2YBUA 2PD9A 2PDUA 3S1XA 3W1NA 3WLJA 3VUSA 2IQ0A 4UMAA 4GKLA 4GNVA 3ISIX 2HVMA 3IIZA 1Q45A 1H51A 2XINA 2EGZA 1TVLA 4NG3A 2Z7KA 2UY2A 4C6BA 2QF7A 4KWUA 3HOJA 1YX1A 2Z2AA 5LHFA 1H61A 1Q8JA 4IJBA 1CXHA 2GZXA 1G4TA 5B7YA 3O15A 3CYVA 4WKHA 5LHEA 1KXHA 5FAJA 4GLEA 2OYKA 4QQ3A 4C6EA 3SRFA 2OJPA 4O1EA 1XYFA 4CLMA 3PFMA 4Z2IA 1JDCA 4MVAA 1A5LC 4A3HA 1OSEA 3S6DA 4HP5A 5LNSA 1YDNA 3SY1A 3IRSA 4LVFA 3R89A 3SCWA 4C6OA 5CZ0A 4YCPA 1E6RA 2ZRUA 5PTDA 3ARXA 4OE7A 3QTPA 1VFMA 5HQEA 5I2UA 1H4PA 1FXQA 2NV9A 2QPXA 1GONA 3BLOA 5HAOA 4O8RA 3STPA 4WHBA 5CLWA 3GLCA 3N17A 1Q4WA 3BLPX 1N55A 5A3HA 4UFMA 3HQNA 2RFGA 3EEZA 1PZ3A 1BTCA 3AXMA 5XIAA 4QFUA 3VKJA 4HHPA 3ORWA 1Q6QA 2YBTA 3E6EA 2D2HA 4YIWA 2F2HA 5TIMA 1FX6A 4YMZA 4K39A 3A23A 4QX4A 3U5UA 1X1NA 2FQIA 1XGDA 3VPLA 3UWUA 3UT0A 4OOUA 4AEOA 5LIYX 3B4UA 4GVFA 2YR1A 5EKYA 1XCFA 3VABA 3FHQA 1X6NA 3UG4A 5EMLA 2WMKA 2EKCA 3BUVA 1KC7A 7TIMA 2XH4A 3M0KA 3LERA 5C9ZA 3CAWA 2J9XA 2VGBA 4MG4A 3GR4A 1E0XA 5LA1A 1GJUA 3PTKA 3G8EA 2YW4A 2BXVA 3DFQA 3W25A 1W9UA 2XN1A 4ECLA 2A2IA 1XLKA 4ZTXA 3GAYA 3T8LA 4LF1A 4PMYA 4Q8TA 1PVNA 1TVNA 2PF0A 3OVGA 3I68A 1DL3A 4AD4A 1GYNA 1DQWA 2CBIA 1OGGA 1RD6A 4C6KA 3R43A 4BK9A 5DMLA 1JCJA 3O0FA 1SO4A 3Q67A 3EPOA 3SIZA 3A12A 3CC1A 3P81A 3HG2A 4PA8A 4GPNA 4ZGYA 1UD3A 3V0SA 5BXPA 1E51A 1GTHA 3DFSA 4EK7A 1XDMA 3NSMA 2ZWZA 2Y7FA 4FXFA 4OV4A 3L5AA 1WNOA 1C8QA 1XW8A 2W4XA 4Y8FA 2D0HA 3H2MA 1EJTC 3QPYA 1G67A 1BWKA 1VFUA 3LHZA 4MWAC 2ZZ6A 3STGA 4C6IA 3QGAC 1OYCA 2QJIA 1Y7VA 3NL3A 3LA4A 1THFD 1H7RA 5CGQA 3UG8A 1JI2A 4DPQA 3OODA 3S1GA 3VD7A 1UR0A 2WZHA 4KKXA 3PBGA 2VDHA 2IPJA 1OM0A 3PNZA 1FWBC 3SQSA 1PTDA 1W3JA 3OTRA 4UR7A 3MSGA 3O6YX 1KBLA 2PDFA 3P8JA 2OQYA 4BQ5A 3PUOA 1EO5A 2ATSA 3H55A 3KS6A 3POHA 1UJQA 2OZ3A 4GH3A 3FYOA 5C70A 1N7KA 3CT7A 3UZWA 2RGLA 3PJWA 1R3YA 2AMXA 3KBNA 1E5JA 5D33A 4JKLA 1VFHA 3QTGA 3SRDA 2W91A 1BYBA 1UOKA 3O07A 3NA8A 5HUOA 2OLHA 4TQTA 5EB8A 3O2LA 4AD5A 5FSDC 3LZ5A 2VGIA 1E40A 3FW6A 2E5DA 1IWBA 1EJUC 2GQ9A 3L4ZA 4BFAA 4ZR8A 2VC7A 2IQDA 4CU6A 1XIMA 3OVPA 5H6HA 2Y8KA 2P53A 3IANA 2PWHA 3T2QA 3W07A 2Z25A 4F0KA 3M0XA 1FDYA 1J10A 1UWUA 3PPCA 1R2RA 3N2XA 4OUEA 3LCGA 1MQQA 4OECA 1BGGA 4Q6XA 3ITLA 1I45A 3AHZA 2EBNA 1KM1A 1CPUA 2ZWYA 3KAOA 1B3VA 3TN5A 1VD6A 3M0ZA 4IIBA 4RXFA 1EGZA 3MSDA 2R94A 4FS9A 4KERA 3H22A 4L1GA 4JIQA 4H2CA 1BGAA 1RHCA 4FLSA 5FJUA 3WQ8A 4CN4A 4M6PA 1LYXA 4ZB5A 3VKAA 2Y61A 3L4TA 2P0OA 1Q6RA 3AYSA 3C8NA 1AH3A 1UMYA 3KZPA 3WEOA 1CECA 2VL4A 3RU8X 3TN4A 3I7RA 1KGWA 2FHBA 3SB0A 2BMBA 3RK8A 4FA3A 2BXYA 4ICMA 3U7BA 2NUWA 3T09A 3WQ6A 2CBVA 1PE1A 4GY7A 2XGBA 1TB3A 4DJDD 3R2GA 6TIMA 1LOSA 4LWWA 3HGOA 1ONEA 5AYYA 1CEOA 1T8QA 3MVTA 1XH1A 1SU5A 4N9CA 5U4NA 5D9MA 3RJYA 4JQ2A 1L6FA 2J79A 3MQTA 4WXZA 3UBPC 5HJLA 3RXZA 2A3HA 3G1YA 2YA0A 3WD0A 2F6XA 3WNMA 2BFGA 5K2ZA 2E8YA 2V81A 4GCXA 1KM6A 3FFSA 3C0QA 3KL0A 3FLUA 1SJAA 1K8CA 3AXXA 4H9UA 1JQXA 4GGHA 4A3RA 4RZ5A 3URAA 3VDGA 2YIHA 5TD4A 2IKHA 3T7VA 4WOQA 4Q6JA 3L68A 2QDGA 1J79A 1XLMA 1GW9A 2Z1XA 4MLJA 1UB3A 5TBOA 1XLJA 5HWNA 1EX5A 3ZO9A 3CAVA 3BJSA 4GJIA 5CPTA 5HANA 3UR8A 1OFOA 4E5TA 4EOUA 3GTXA 3WDHA 2WCGA 4X0NA 3G0SA 5C7HA 1EC9A 4J3WA 1H09A 3AZRA 4DM2A 4LC8A 4GBDA 4LX4A 2CC0A 4HYWA 5BOOA 3IAQA 4A8IA 3W7GA 4PRTA 5FF7A 3LZ3A 4DF0A 4RUBA 4NZCA 4CD8A 5A94A 4GI9A 1E0TA 1Q63A 3MKKA 4M8UA 3NQDA 1UWQA 3GVVA 4UTMA 4JTFA 3PF3A 5AECA 2XSAA 3VDAA 4R34A 4UZUA 4KRTA 1J6PA 4QJ3B 1YPFA 4O0ZA 4UQEA 4M81A 3MKVA 1VPYA 4TMBA 1F7BA 5C9WA 3VNLA 3KTSA 1VLIA 4FXRA 1BWLA 1UD5A 3LXCA 5J8LA 1LORA 2PTXA 1AFSA 4NJJA 3BL3A 3WLRA 3Q37A 1V0LA 4JD4A 1TMHA 4D6JA 2JGYA 1XG3A 4DWSB 1G7VA 3O9NA 4NX0A 3PZVA 2PCEA 4G2DA 1ZJHA 2NVDA 3WD2A 2Z0IA 1F8IA 2DU2A 1Z41A 3FK4A 3KBWA 1WUEA 5E1QA 2D23A 3WEZA 2A3BA 4HHHA 2PMQA 3THUA 4AZ6A 3W83A 1FP9A 3ONBA 4W8BA 2FH6A 1KWGA 2YDSA 2XN2A 1S5WA 3R13A 3LTYA 3CU2A 3AMGA 1Q4NX 1B1YA 3CQHA 3GH7A 4TV5A 4JYDA 3QLDA 3DFOA 3W4RA 4DX3A 2WW5A 4GMEA 1GOIA 1OCQA 3WH6A 4V33A 2QF8A 1OCBA 1R47A 4HPJA 4E3VA 5LZLA 2E7FA 3AYRA 1OCNA 3B8VA 1NFGA 1S1RA 4CNNA 3EX2A 4WLCA 3W0KA 4WOZA 2RDUA 3PB2A 1K8ZA 4LEFA 4LSBA 2RUSA 4OU1A 4UTUA 1J0HA 5HATA 4HTBA 4Q7NA 1SZNA 1CZ1A 1TMLA 4J40A 1OX4A 2W6RA 3I4EA 1V6YA 1XC4A 1KO0A 2PCQA 4LCRA 2DSUA 4AIUA 3PHAA 1PKLA 5AZ0A 2QLYA 3W9ZA 3AJ7A 3VTRA 5AOUA 1LZOA 3KVJA 1M1BA 3K1GA 1RY0A 1X7FA 4INFA 1Q6EA 4DJDA 3GC5A 3P93A 2ZX6A 1W1IE 2D0FA 5BMWA 4P8UA 4D8AA 1YXCA 1F76A 4M6UA 3E0WA 4CNPA 4MADA 1VEOA 1US2A 2WC7A 3UCCA 3VU2A 3K5XA 4GC3A 1Q6OA 1SPQA 4GY1A 3D3AA 4PH6A 5GJNA 1OFDA 1Z44A 3EMQA 3A47A 2VEKA 3GS6A 4MKSA 3ZMRA 2E77A 3LYEA 1EYEA 1G4SA 4CCDA 3VGFA 1DHKA 4C6DA 4YU1A 2PLCA 3P3BA 3TR9A 2L5HA 1RA0A 3W1QA 4KEMA 2PA6A 2HXUA 3T78A 4GX8A 3QBUA 4QNEA 4E2OA 4ROPA 3GNRA 1YNYA 5FEPA 1TCMA 3GQYA 1HNYA 1OD0A 1TJPA 2YFNA 3GKFA 2Q01A 2FMOA 3BQ5A 1P0BA 3BZGA 1S2VA 2ZZ5A 5AHNA 3RN6A 1K4HA 5FKYA 4DUVA 1QRQA 3PBWA 5AHMA 2DT2A 4F2BA 1W3IA 1S2TA 2HS8A 4HNNA 3QV9A 4W93A 4D6FA 3M16A 2YX0A 3D5HA 5DRIA 4V15A 1NOUA 2C1GA 1B3YA 2ONEA 3N19B 2DEPA 1DOSA 1UOZA 1D3CA 4JY8A 2V5JA 2WCAA 2J7EA 1V79A 2OT0A 5I7GA 5HK4A 2BHYA 2GK1A 3DN5A 3W74A 3BLDA 1TE1A 1V7YA 4Q4MA 2WKGA 1JNEA 4JTSA 4FOKA 3O7UA 2R14A 3VKBA 3CB8A 2INZA 1CGTA 4P7RA 4A2SA 1ODZA 1EDTA 4AUBA 2AQVA 4QDWA 3KX6A 2PDNA 1NY1A 5KITA 2O7QA 1V08A 4UTLA 3B97A 5GNXA 2IKIA 5TAOA 3CEPA 3AQUA 3QHOA 4BCEA 5MHBA 3BW3A 4JTJA 3WLQA 3ANVA 1EUNA 2BY2A 5ABHA 4P8WA 1QPKA 3W1AA 3U0HA 1RBOB 2HTMA 2VOMA 2ZRXA 4EWND 3EDJA 3FJ4A 3H4GA 4WSHA 3QY6A 2V2HA 2PWEA 2HNEA 1MFUA 4N2YA 1KBBA 3DFHA 2A5HA 4CD5A 1XLAA 2ZBTA 3ZJKA 1IIHA 5C2CA 2FB3A 4KPLA 1TFVA 3P80A 1I2QA 1UR2A 1HT6A 3M43A 3VCRA 2X16A 4MMWA 2WJEA 4HSNA 1CGXA 3W7OA 1LG2A 1FCBA 3M1ZA 2C15A 1ZY9A 3URNA 1US0A 4ATDA 2XSBA 1RJQA 3LEPA 3RPTA 4HA4A 3FA3A 1EJXC 1PZ2A 4IIGA 5XINA 2PEVA 1V8EA 1AW2A 1V02E 1XKYA 2NLIA 3M0VA 3CZJA 3WUBA 3HPXA 4O1DA 1ADDA 3KRBA 1DE5A 1UD8A 1GG1A 2GGGA 3CWHA 3FN9A 1X8FA 3DXIA 1WP6A 2ZXAA 2YB1A 2VVNA 3QEZA 4ZENA 3W7QA 1CT5A 3C8FA 3WNLA 1YNPA 1K77A 2TRSA 1PL9A 4JKKA 1RLCL 4K8HA 4DO7A 1YYAA 3N9RA 2XIJA 4KWSA 2P3ZA 4Z2KA 4FR1A 1W56A 4DJFD 1Y5WA 3UZ5A 4Q32A 1RJRA 3U6WA 1A47A 2PGEA 3TW6A 4U3AA 1UQZA 2NT1A 5CJMA 2JFEX 3ZR5A 4ZEPA 4N0RA 4M6VA 4JX4A 4DJDC 1W17A 1M68A 5BRQA 3AYVA 3NO5A 1TR1A 5LGZA 1E4MM 1TWIA 3TTEA 4GFSA 1O95A 1SSDA 3TCEA 3QOMA 3MJYA 4F9DA 5HULA 1K9FA 2V67A 1OK6A 1RAKA 4HU3A 4B3ZA 4HPGA 5H8UA 3UFYA 4YYFA 3W87A 4N9EA 1TJ1A 2Q02A 3GZ3A 2QV4A 1M9HA 1WOAA 2Y4SA 1PTAA 3AS1A 5TF0A 2DH2A 2P0IA 3BLLA 3BGGA 1KRMA 4GNJA 4D8ZA 1E6SM 2VQUA 4KESA 5ABFA 2FZMA 4Q3MA 3NQAA 5H8PA 1P4CA 2QW5A 4IPLA 3EWXA 2BNJA 1WBJA 2CW6A 3UA3A 3NNTA 2XVLA 4AD3A 1QAPA 1GOQA 4LUSB 4C1LA 5FJJA 3EOEA 3B0XA 5LIUX 1OT2A 3DUGA 4WR3A 4PBEA 5I07A 3OG3A 3AOFA 3VD9A 4GABA 3OGRA 3ZLGA 5I3JA 1TTIA 4IFRA 4Q8NA 9XIAA 1XPGA 1WO2A 3AHTA 1DIEA 2X05A 4HA3A 1AJ0A 1GT8A 3W6LA 3LOTA 2JEPA 1SJCA 4HOZA 2YA2A 3PJUA 3PTMA 2A0NA 2VC6A 4TTGA 4NZ5A 2RKXA 4IP4A 4JFSA 5FJRA 1E9IA 4JIIX 2BHUA 1JR1A 3VIOA 3L2LA 4D2JA 1JJKA 3GYCA 1FH9A 4I7UA 1GVSA 2I1OA 2ABBA 4GH1A 1A4LA 3IIVA 1GPFA 4KGJA 1NF7A 4E4UA 4GBUA 4LC6A 3L2MA 4GO9A 3B0YA 4X3ZA 1BPLB 1TVPA 3OZYA 1HJXA 2JF6A 1RVKA 3LBCA 3ATYA 3CQ0A 1RALA 2NSXA 3A64A 3UXLA 2J8GA 4YCOA 1YE6A 4GVGA 5J5RA 5C2XA 2ISSA 2Q8ZA 4D1JA 3VYLA 3TQVA 2Y5SA 3NXFA 1JCXA 2YDQA 2OG9A 1XLDA 5AZ1A 1SFLA 1K9EA 4DUWA 9RUBA 2WPGA 3HGSA 4LV4A 3AIQA 2DVUA 4KEVA 1UUOA 4ZXOA 3B9EA 1ZS2A 5LXXA 1GVEA 4HHMA 4Q8WA 2FIQA 1CXFA 1T96A 4DNHA 2V3GA 3S83A 1PKYA 2BY0A 1UPPA 4PUDA 4LANA 5F2IA 4AWSA 3UF9A 3AS0A 4UOZA 1YLVA 1A0DA 3WNPA 1A50A 1TA3A 4UCFA 1C92A 1H2JA 1XLHA 3CUHA 4ERGA 1J0JA 3BOLA 3PSVA 1L9WA 4AC7C 1S3TC 3NURA 1DIOA 1JD7A 4LYQA 1U5VA 1CXEA 5DO8A 3GXNA 2IXUA 3N4FA 5CPLA 3VCNA 2CZDA 4LBSA 4PFHA 7REQB 3OA5A 3BCJA 3QYSA 1Q6LA 3KEHA 1UYQA 3LCLA 4DJFA 1UH2A 1WDPA 4PMZA 1XCWA 3FVDA 4BR1A 5BRBA 2PC4A 2ZZ3A 3GDBA 4GO8A 5DMNA 2CNCA 4GVIA 2F6KA 3NXLA 4P7OA 4DO4A 1SMAA 4EIVA 5I3GA 3W85A 2G3FA 2NV2A 1VBGA 1EXPA 3II1A 1AL8A 2E0PA 4JFTA 2E4TA 3VZYA 2E68A 2YL8A 4DYJA 3B8TA 1F9CA 3EKLA 1VZWA 1FQ0A 2P76A 3PUEA 2PD5A 4R7OA 2XSXA 3GHTA 2QDDA 2AMGA 2C6QA 3CJPA 1JYXA 3FKKA 3PZGA 3RCYA 2GOKA 2BDQA 4O0QA 3UPMA 1AG1O 3CNYA 1TPVA 2VCCA 5CJNA 4XBSA 3E3HA 3UVAA 2ZXQA 2ZUSA 2CZVA 3P84A 4Y7EA 4ROQA 3LRMA 1EJWC 3SQLA 3W26A 1FWDC 1R2SA 3BDKA 1P1XA 4HZMA 1UH4A 2WZEA 3VINA 2WLZA 3F4WA 1FKWA 4XIMA 7TAAA 3LRKA 4FEZA 3DC8A 5LNVA 3I7SA 3TTQA 3I3DA 2BTMA 4MWAE 4RZ4A 2OOGA 3IK4A 3ARUA 4F0MA 4C6PA 1XIFA 4Y9OA 2XIMA 4O19A 1OC6A 2V0TA 3VVGA 3CUGA 3G8RA 1WB0A 1I2RA 2ZRVA 4QBXA 3ANYA 3G1XA 5GNYA 1UD6A 4MDOA 1W31A 1XINA 2ICSA 5BWFA 5CGMA 3FDGA 3DHDA 4FO4A 2AL1A 1T6MA 4ZOEA 2HCVA 1YDOA 4IPNB 2G3IA 1XRSA 1BQGA 3SCTA 4Q8VA 2H3BA 3LG3A 3OQ8A 5HDRA 2EF9A 2VO5A 3OLIA 1XIJA 1XFCA 4ZB2A 3BMXA 3AC0A 3BZJA 1EGMA 3PULA 2VX7A 3KCJA 3UYCA 5ABGA 4A22A 4YTUA 4DUXA 2CLKA 1SW0A 3CGTA 4D8LA 4LFYA 1R38A 2NX9A 4I8YA 1PAMA 4KFNA 3MWCA 1S1PA 3LSBA 1WV2A 1WDDA 4OBSA 3NQ2A 3GXDA 3SGGA 3TQ0A 5KZ6A 2P1FA 4L6HA 2OEJA 3NPXA 3EBVA 3T55A 3O6DA 3WMLA 3TV8A 4ATLA 1EF3A 3OYXA 2VWSA 2AL2A 1NF0A 5CXPA 4PB3A 4GUFA 4NT0A 3AJXA 3M9YA 3HG4A 1CI1A 1J11A 1P7TA 3R8RA 4FXJA 1W9BM 3OJGA 3G77A 3MMDA 1CBGA 4ADSA 1PHQA 2REQA 3GXFA 4X9SA 5G4EA 1LWJA 4UQ9A 1JQVA 3T4CA 1HKJA 4C5YA 1S2UA 1HUVA 2FGZA 3HQOA 5A8QA 3CIWA 2TYSA 3GX9A 1EPXA 2ISDA 1I1XA 3LGGA 1UR9A 3NVTA 1JXKA 3IVUA 4ZE4A 2G0WA 3G1DA 2HXTA 3GB6A 5A69A 2ZDSA 3M0HA 4UUIA 5C8BB 3VNZA 3QMTA 1HKIA 3QV7A 3NOYA 2VX4A 3HF3A 2OGJA 4IQEA 7ENLA 1IZCA 3WLSA 4DNMA 1M7XA 2ZX9A 3G22A 1JDFA 3EOSA 4G56A 1YXYA 3WQWA 2D24A 4JQ1A 1ITUA 1ZAHA 2XIIA 1LL6A 2FHFA 3ZLFA 4FMVA 5IHRA 4CD4A 2CLIA 2B7OA 2YDRA 1EJRC 5D2XA 3NFUA 3S4TA 1GVRA 2FPTA 4HPXA 4DJFC 2F6UA 3PSWA 4WY0F 4D6EA 3B8SA 5F4XA 1LF1A 2P8BA 4PB5A 1ME9A 1CWYA 2WXDM 3IJ6A 3G1VA 1GG0A 3K46A 2QVHA 3LPOA 5K7JA 1F05A 3TTYA 3NQVA 3UY8A 3URBA 3VFCA 3TJ4A 1ITXA 1ALDA 2XISA 2RJGA 3SUTA 4ZE5A 1ONRA 5D4YA 4US6A 1G6CA 3WMBA 3LXBA 4H9VA 3UVIA 5DBUA 2VI0A 3C3NA 1KFWA 4AVOA 2AQWA 2ZIDA 1RPKA 3W72A 4GUGA 1V03A 3EDEA 3OYZA 1ZTVA 3VDBA 3PNUA 1Q2RA 4NYYA 3M5YA 3RNDA 1V0NA 1KFEA 1TE6A 4KCWA 4L80A 4PODA 1Q85A 3GC4A 4FK9A 4XAZA 4G7FA 1JCYA 5E0FA 2OT1A 2VRQA 1I6NA 4WKAA 3RHGA 2UWFA 5LNUA 4MY1A 1JPHA 3VIPA 5CC5A 3B05A 1RCXB 1AQHA 3PZIA 2FZ9A 3MV11 1G7UA 4PTMA 2NQJA 5LA0A 4Q4QA 4XD5A 1GOOA 3TE9A 2V5CA 3EWZA 3C56A 4JBRA 1Y5VA 2X0YA 1XPYA 4J4KA 3S2JA 3P62A 4LUJA 2VNCA 2WB5A 3OVQA 1A5KC 4XSLA 1NVMA 1F07A 2VWTA 4PMOA 4C1KA 2OCZA 4YVXA 1MWOA 3N13A 4JX5A 4ATWA 1KFBA 3KP1A 2QXWA 4GQQA 2GQ8A 3H26A 3NZPA 4O8AA 3SGZA 2ZA2A 3HM7A 1BTMA 1PDZA 1UASA 2YDAA 1Q7MA 3AU2A 4Y2WA 1U5JA 3LN3A 5EY5A 3WNOA 1YRRA 4QLKA 2WJDA 4GNKB 1QI2A 2UV8G 1H50A 4W7WA 1QU4A 1H0IA 2X7WA 3FYYA 4HNCA 5HBFA 4ZO8A 3BICA 3EWCA 3TUUA 5EMJA 3VI2A 3W7HA 4H7CA 1S5NA 2I7GA 1L6SA 1LQ0A 2Y7EA 4JHOA 2J27A 3BOXA 1G1YA 3NL6A 5BXTA 3RX4A 3TEVA 3TJXA 3W88A 2V2DA 2PDKA 2ZTJA 5DQPA 3B8WA 1REQA 5REQA 1X6UA 4PBFA 3NM1A 2Y88A 1UR3M 3W7EA 3W7PA 3W23A 1KB3A 5FIPA 1LJYA 4Z17A 8TIMA 1VENA 4E4FA 3NDYA 4WIWA 4B5SA 3ZT7A 1AODA 2Y24A 3IGHX 3MT1A 1FP8A 4TOQA 1EGVA 3N4AA 3C6CA 5FI8A 3PZTA 2ZE0A 3MVIA 4QJ1A 3M44A 3LGEA 1QBAA 2H90A 2CETA 1UIOA 2MUCA 3FYPA 3K1DA 1H1YA 3VGDA 3OGVA 2PU1A 1AQFA 4XAYA 2YLLA 3W75A 4MYXA 1KM3A 1WZKA 3AIEA 1KCZA 3UXKA 3TZFA 1VP5A 4AW7A 1E6QM 2QHAA 4R27A 4I9TA 1FWRA 3PZNA 4TVDA 2OO0A 1ONXA 1FBAA 2R24A 3HBLA 1ZUAX 1ZBWA 2W9MA 1XICA 3F7JA 3W00A 5FEWA 2BP1A 4N7QA 5CC6A 3YPIA 1B30A 2A85A 1TJ2A 1DWFM 4HBKA 3B8UA 3KVMA 1GQKA 2X1SA 4Y6GA 3QR0A 3S1WA 3RO6A 4IIHA 3G5EA 3KRZA 2XGZA 3G1AA 3HMJG 3CMFA 1OC7A 4LU0A 1V3JA 1JCNA 2YXGA 3QQ1A 4JTEA 3ZM8A 1VJIA 1NH6A 4PUEA 4QITA 3BAWA 2NQZA 5I02A 4YNGA 3UCQA 4NIRA 1KFLA 2D3LA 2VD8A 1IGWA 1DJXA 1EWEA 3TCSA 3A3WA 4EXAA 4UTWA 5EBAA 5C9RA 4NJHA 1KTNA 3STCA 3GRIA 2RH9A 4AD2A 2DZAA 3VC6A 2DP3A 1L8NA 1AQ0A 4URIA 3EDDA 3ABRA 3CT2A 5BOFA 4DXKA 2XU2A 4CNUA 5C71A 1F3EA 4K38A 4H3DA 1NAL1 4YJ5A 3GIPA 3L4UA 1DQUA 1V3LA 2JKPA 3F4VA 2O4QA 4B5UA 2ZYFA 1DTNA 4JEQA 3N34A 3D0CA 1ML1A 2G96A 3AYTA 3AHYA 3M7SA 4FAMA 3VD4A 2PDLA 4NVTA 4H6QA 4C6MA 1FDJA 4DPPA 4AF0A 3PPHA 1SM9A 5DEZA 4B9YA 1ZSXA 4N4QA 3NCOA 2P88A 2DJXA 4QE1A 4QLJA 5TNVA 4DYKA 3VAVA 3EYPA 4WZHA 4O12A 1BQCA 3UR2A 4TX9A 1H1NA 2NVAA 4B9ZA 1E4NA 1PIIA 3MI6A 3LSCA 3RGTA 1FY6A 3T0TA 2JKAA 1UR8A 1HX0A 1JAEA 3LLDA 1P6WA 3BURA 4AF0B 1GEQA 5I23A 1U30A 1I2OA 1LLWA 1M41A 2ZTKA 2GVEA 2W3ZA 2YJQA 3E5BA 3M0YA 3N73A 1GHRA 4LQ1A 2EPNA 2XHYA 1VRXA 3IJQA 1GQIA 3N11A 3M7WA 1JDDA 4JIRA 4K8GA 2GDVA 3XISA 1FHLA 2WQPA 3W29A 5BW6A 3LCWA 3GTFA 2UY5A 2BVTA 2VX5A 5EMMA 2WHLA 1ITQA 4TTUA 3I3BA 1DIDA 4B2DD 1D2KA 4U4MA 3H2CA 1D8WA 1QVBA 1C91A 2CZFA 4BQ3A 3PC0A 4NZ1A 3WDQA 3MP4A 3MV01 3LPFA 2VUYA 2Z1KA 1TZ7A 1G4EA 1GVFA 1QHOA 2G4FA 1M01A 1VPQA 2HRWA 1SO6A 1Z6KA 1E5NA 4ZCWA 3MZ2A 3QZEA 5FJTA 3W1LA 4I6KA 1GZGA 2QIWA 4ZL1A 4KH2A 3IV3A 4HIBA 5CQ1A 1MVYA 1OFQA 1E15A 2QVNA 4JY9A 3VGEA 2BY3A 3VX1A 4MZ8A 3MKCA 3GG7A 3VNDA 3R8GA 3LM7A 1TPUA 3RPMA 3TQPA 2IW0A 4IGHA 4JEJA 4QLLA 4FZIA 2FPVA 4LY8A 4NNAA 5LYRA 1AW1A 3S5ZA 1TX0A 3MTWA 3CMGA 4PB4A 5A6LA 1RBAA 1XSJA 4V28A 4M82A 1TCDA 4CVWA 5G2WA 3J7HA 2INEA 3VIFA 3W2JA 4ZB0A 3DYMA 1GZJA 2J6VA 4N9BA 4RNIA 1U1UA 4ILSA 3EX6A 3UJRA 4L4OA 3L0GA 4C60A 5KINA 3TYDA 3A3XA 4QDPA 3DAQA 3RDKA 1CGWA 4EANA 4IM4A 1OFRA 3MHGA 3HPFA 3D46A 3HN3A 2O92A 1OFPA 2NUYA 1HJWA 3TROA 2R8WA 4UQCA 2VFHA 3CL7A 2VFIA 1RCOB 1E1CA 4PTXA 4HNVA 2QCHA 3GKAA 4I9MA 2E5BA 1MW2A 5D9OA 1RA5A 1YKWA 5CZSA 3AI0A 3JZEA 3ZLHA 4XBJA 4UTWC 2OYMA 3IVSA 3WF0A 1JF5A 4WY0A 1XIHA 1UZ1A 3PTDA 4XK2A 2JIEA 5IM51 3W82A 1HJQA 2I5QA 1K9DA 1BG4A 3WBWA 1GYLA 4LUIA 4ERAA 3CHVA 1E1CB 4RX0A 4LB4A 2INFA 3A9IA 3QC3A 1J5SA 2WYSA 2VQTA 5MF5A 4GYJA 4ZA0A 3WQCA 2P8CA 3SUWA 2A6LA 4DQWA 4MNLA 3UPWA 3VOCA 3V0TA 3ZFHA 1JIBA 4IOTA 2VURA 4EX4A 3XIMA 3LHVA 3EDKA 4PTVA 2W27A 5I3DA 3USZA 2SFPA 1NWSA 2I9UA 3SCOA 4JHZA 1V6WA 2VCBA 4WDTA 4KBXA 2QCEA 1VC4A 1EC7A 1O60A 4JFWA 4B15A 3SR7A 1EHNA 5JXQA 5E0KA 2VCAA 4X61A 4I7WA 1JUKA 4BF9A 3ENLA 3H23A 4MJMA 1R3VA 2ZUMA 3C2RA 5EFFA 4JPGA 1XLEA 3QFEA 3S9ZA 2PRLA 5T26A 3UNTA 4U2YA 3MBDA 7ODCA 3FGCA 1NDVA 3WLHA 3DGBA 5AYIA 4XKYA 2QUMA 4QGCA 1L0PA 1GEHA 4AVFA 2DQWA 4L61A 2OKOA 4B2DA 3CPRA 1JD9A 3RRAA 3QH2A 3TA6A 5HPCA 2QYGA 2BVWA 3GIQA 1IWAA 3RRXA 3WQVA 1QHPA 3VKCA 5CC7A 1VFSA 4Z1BA 4NAFA 3V5CA 5JBDA 3W27A 3L4YA 4NRRA 3DENA 3ZJ8A 3H2OA 3O6AA 4XG1A 5JUVA 2WKJA 3B3DA 3MPGA 3IUHA 2QDEA 2OLAA 1CB7B 4RZ6A 2X1IA 2FJKA 4MY8A 3ABQA 5DFAA 4LAZA 3VILA 2ABAA 1OHLA 3LENA 1EP2A 3OZOA 2XFFA 3L0KA 4NZ3A 3GNPA 5IFTA 5CSYA 1Z8AA 5LKYA 2X2YA 3QOKA 2A6NA 3FVMA 5T9CE 1VIZA 3MI2A 3A6OA 4AMAA 5HWJA 1V3KA 4G1KA 5D38A 3TSMA 3V5FA 1H0GA 3E02A 1JAKA 3UWQA 2CXEA 4XD3A 4L1WA 1JGMA 3SCVA 1YPXA 2B31A 3BVJA 4KCUA 4NASA 4AZ5A 4DI8A 1ECEA 1KLYA 4PUKA 4PR4A 3SY5A 3VNIA 1C90A 3H6OA 4JGDA 3WBXA 1OFAA 3K2GA 1VBJA 1VFTA 3HTWA 1E6ZA 2QUUA 1PBGA 4CNTA 1VIWA 1UR1A 4TO8A 3EXSA 5I03A 5K3VA 1XLBA 4REQB 3G1RA 1DP0A 2VDIA 2G5WA 5IRPA 1VBRA 1CX9A 1H3GA 3UNDA 4J3ZA 4FNSA 2WLYA 3R12A 4W9TA 1XWYA 3KRUA 4Z0JA 4IUOA 4KW2A 5E6ZA 1MQRA 3GO2A 1UH3A 3W7CA 2MANA 1EJ7L 1QR7A 3CTTA 3VM5A 4QS6A 3FHAA 1C7TA 4CNSA 2PBOA 3EWUA 1RXOB 4QISA 3U4AA 1WUFA 1V02A 2V38A 2AKMA 1XIEA 1ODUA 2HDJA 1OVDA 2A1YA 2TMDA 3AUJA 3GUWA 2PDXA 3GY1A 4MNMA 4Q4RA 4JCLA 1EIBA 2NX3A 4ZMGA 1LLOA 3UZZA 4B5NA 5AHLA 1C9DA 3W7IA 4CVUA 5CEWA 4GXWA 2OMAA 4D6DA 1BXNA 3N9SA 3R7MA 3DFYA 2P5NA 4ZOBA 2Z28A 1DJQA 3BW2A 1Y8BA 3MC5A 3PR2A 5CSUA 4JX6A 4E2VA 4HNLA 3ZOAA 4F2TA 2QMKA 4ML9A 3H4XA 2VFFA 1MW0A 1U2YA 1KRBC 2Y6ZA 3V5OA 1ECQA 2PF8A 3F1QA 2HPIA 4S3KA 4S2CA 3BLKA 3TFCA 1ZP3A 2VZSA 2WNNA 1J2WA 5F4WA 3W2MA 1ISVA 1M7PA 5EBUA 5FJPA 4L6OA 1K02A 3K4DA 3ICJA 2Y8UA 2BHZA 3W2LA 3M0MA 5DXYA 5C5YA 1WDQA 3IGUA 3NPWA 3O6CA 1KRCC 3M6DA 1M7OA 1N8IA 4HT3A 4KCVA 1PCWA 4NHVA 3HPAA 4Z2HA 2D2OA 4RW3A 5KZMA 3WMCA 5MKGA 1JL8A 1RJPA 2W92A 2F8QA 2W61A 1M03A 4C65A 3CV7A 4JXCA 4HK7A 3GNNA 3LLFA 5LIXX 1ZALA 4FX6M 2DORA 1ELSA 2E28A 1OIFA 3Q2DA 2YOCA 2J24A 2EJAA 5I77A 3TLLA 1W32A 3A13A 2V82A 4DF2A 3KOXA 1ZRQA 4H7ZA 1B0IA 5F1UA 3LGDA 1PZ0A 2ZUUA 1MZRA 1M5WA 3GHUA 4K1WA 3P5YA 3TAOA 4N6FA 4D6CA 2JIWA 4TU1A 3RG6A 6CGTA 1W9PA 4RNFA 4C6FA 2XVPA 2IQTA 3FX4A 2E9BA 2VENA 3W2UA 1WOBA 3AHXA 5BXRA 4QEEA 2OXNA 2ZRWA 2QAPA 3F5KA 4GA8A 4DHGA 4UWMA 4PMNA 1A5NC 3JS3A 4F66A 1W8GA 2Q71A 2W79A 1IZJA 2WNWA 1TRDA 1IR2A 4L9ZA 3WLKX 4G7EA 4HJWA 2O56A 4KGLA 2PSNA 1Q2SA 2ZUNA 3B9NA 1EQPA 5HPOA 3TOYA 3TYEA 4EAMA 1SW7A 3ES8A 3NZRA 3A4WA 4MNKA 4IJRA 3IAPA 3XINA 2PP0A 1Q7ZA 4RDWA 2QCMA 2E1WA 2H9AA 1HKWA 2X40A 2EPHA 2ESCA 4IX0A 1MDLA 1IF2A 4G8TA 5EMYA 3DECA 1JDEA 4PSPA 3O06A 1EDQA 3PPFA 2I57A 2EAWA 1X39A 3C2FA 5A2CA 4GJ1A 5AKQA 4NXSA 2G41A 4G7EB 4JTRA 4KS0A 4HMCA 1PXGA 2WMGA 5AC8A 1TIMA 4K68A 5E6YA 3RAOA 3IJLA 1RCQA 3I6RA 4TVCA 2A7NA 1O68A 3A9BA 2J7CA 3UA4A 1BYCA 3WX7A 4W88A 2H9AB 1FCUA 4GI8A 3W6MA 1QI4A 3UETA 3WEMA 4ZFCA 5KSWA 4UTIA 2BODX 3QSRA 4DWDA 2AGTA 2R1KA 4IQDA 4Z1DA 1P5BA 3HV9A 3TMQA 1GHSA 3TSDA 5D32A 2BASA 2Y5JA 2AAMA 1TWDA 1Y5XA 5EPDA 5C54A 4UR8A 3F5LA 3IJ7A 3BO9A 4G1NA 4GZ7A 4WF7A 2X41A 1O5QA 3W1MA 3QV8A 2G4JA 2C71A 1ZBCA 5F1VA 1XDJA 4BHYA 4HMNA 4A3QA 4XZNX 4O53A 1FWCC 3L4VA 4S3FA 2C13A 1YBQA 2GUBA 1HKKA 3FDKA 3NWRA 5BYWA 3LV6A 5C6MA 4PGLA 2V6AA 4NYUA 5K4ZA 3L9CA 1AA1B 3CHEA 3EX1A 1NOWA 3WL0A 4PN2A 4MY9A 2B4GA 3DI1A 1S2WA 2YXXA 2BOFX 3UGVA 3QF0A 4RLIA 2C3ZA 4GRSA 1A80A 3TDFA 1GVOA 2R9RA 4IJCA 3EPMA 1UCWA 1O1ZA 3M5XA 3LK6A 3L12A 4R9XA 4GXPA 3H8AA 3DU0A 4EP8C 4L7ZA 1WXJA 3SW6A 3I4KA 3MI3A 1VAHA 3TKFA 3WQOA 5I06A 1UROA 3KTXA 3TP4A 4DB7A 3BSHA 2VC5A 1ISZA 3RLVA 4HNOA 5JIWA 2VFEA 1A5OC 4ZO6A 4CGTA 2GJRA 1UR4A 5K9DA 3ARSA 1W1ZA 2CWXA 4PC8A 1Z42A 4M5PA 5HR6A 2ASHA 1OYBA 5CZTA 1TV2A 4AU0A 1PDYA 2YL6A 1IXQA 3NDOA 4HCLA 4HA1A 4XO6A 5CG0A 4UZSA 4HHLA 4I90A 3OZPA 4FALA 2VFGA 3A4JA 5ECVA 1DHPA 2O9TA 1D7KA 4QG9A 1BRLA 4JN8A 5A2AA 6ENLA 4Q33A 2Q3OA 4I9AA 4PEKA 5FAGA 6TAAA 2NXHA 1KCXA 3L66A 4Q8QA 1XSIA 2PLMA 3MY9A 3RLUA 4IICA 1Q6GA 2E3ZA 2J9YA 3AROA 2YCLA 4UXDA 1JPMA 3WN6A 2FJUB 3DERA 4JIEA 4RE4A 1HKVA 1NQ6A 2QJMA 4OTKA 3CWOX 1W5PA 4YHGA 1EUAA 2ZXDA 4RPPA 3S42A 3W1XA 3W3OA 2WVTA 5K9CA 4CEXC 4H9ZA 2OO6A 4BI7A 5EL1A 1BVNP 3PZ9A 2NLYA 4MWAB 1W9VA 1YW1A 4CN1A 3W7DA 4A21A 3W7LA 4U5KA 3MA8A 4O57A 1PWLA 4AISA 4YXGA 1UWSA 3C0SA 5BZAA 4BI5A 4JHMA 3QW4B 5BU6A 4LW7A 4UR9A 1DQXA 1L6WA 4AHQA 2WVUA 3DKJA 5ECUA 3IJIA 3THQA 3W73A 1SO5A 1HGYA 3H70A 4IGMA 3S2MA 3VOIA 3T0BA 4ASTA 4H7VA 3MWAA 3AIVA 4FOJA 2GFTA 3PBUA 3THAA 1DIKA 1TIWA 3HPZA 4HB7A 4ES4A 3B4YA 1TMQA 5LGXA 3LY0A 3FEMA 4LS1A 2CITA 3MMUA 4LCQA 4YL2A 1FCQA 1T7LA 1DXFA 1IQ8A 5A6AA 3HO8A 3BAXA 2ZZ2A 4GISA 3GVQA 3KVLA 3NQ7A 4BZYA 3BJFA 2DGAA 4AG0A 3ARRA 2HVNA 2UY4A 3NPVA 3MUAA 3UXIA 3N14A 4O18A 5GNZA 2NX1A 2OX1A 2BOEX 2PDQA 3ZQ9A 1LDCA 1OX5A 2DT0A 3F2DA 3V1PA 3EA2A 4W86A 3FNDA 3THCA 1UG6A 4G6CA 4AZHA 4EF8A 2YSWA 1A3WA 3KM8A 5GPRA 1V6XA 4R85A 3RLGA 2CU0A 2WSQA 1T40A 4LRSA 3EA1A 3RF9A 2VZUA 2BBFA 4X2RA 2EHHA 1YTDA 1US3A 5DMMA 2GGIA 1B9ZA 1BYDA 3QZ6A 2PTYA 2XM1A 4ZVJA 3PUGA 2Y5EA 2X0HA 2WAGA 2AKZA 2Y1HA 2YB4A 5DF0A 1IEVA 1W9DM 4ZQNA 4JL2A 3CUJA 1OK4A 3BMVA 2O7SA 4BEUA 5FL1A 1KWKA 1JCLA 3IEBA 3R0UA 3M64A 1HL2A 3M0IA 1S38A 4X63A 3DKLA 1HJVA 1Z9AA 1UKQA 3IVTA 3SIMA 3MO4A 4BJHA 4Q8OA 1OGSA 3MU7A 1POKA 1K6AA 4YYCA 3BSMA 3AIRA 1ZL1A 1IV8A 4F3HA 1JCTA 3GVGA 2ZZ4A 5XIMA 4XAFA 4JTHA 4XTIA 3CASA 4DXXA 3HFTA 2YYUA 3SCQA 1W3KA 2FFIA 1GQLA 4OOZA 2Z26A 3V35A 1BVWA 2DUXA 1XYAA 1GOWA 4UBPC 2Z1WA 1FFRA 3CH0A 4XUGA 1J0ZA 4L4PA 2WJZA 2B7NA 5FF2A 2VFDA 1DXIA 2GJLA 4IMAA 3TYUA 3NQGA 4YVVA 3WJXA 3E2SA 2XWEA 2HV5A 3JVAA 4UFIA 1R9ZA 4O13A 2BOGX 3SSZA 1X97A 2PDJA 4MJ2A 1TSIA 1P43A 4ZZ9A 2XVGA 1JXJA 2ZDRA 1GZ1A 3ARPA 2GJXA 4M0XA 3C4UA 2ZE3A 3QZAA 2TAAA 2WWDA 3TWBA 3VD3A 1YDYA 3UXDA 1EJVC 2GUYA 3VMPA 3LQLA 1MNSA 3KBMA 3OU8A 3L4WA 1TTQA 4GIEA 2E25A 3WJYA 4HOWA 1J9YA 2OZ0A 1J0IA 3A5FA 3S0CA 3NG3A 3AISA 1NM9A 4W5ZA 1RV8A 1GVYA 3BK0A 5FD0A 1Y65A 1RQHA 4MYAA 5IFPA 3C3UA 1PSCA 1R7OA 2J7HA 2NWRA 3UZJA 1W1VA 1AQMA 1VLWA 4JICA 3H2NA 3OA3A 4K7YA 4HPHA 1X1OA 1SJDA 3LV5A 2Z1BA 4WKFA 2YYTA 2NQ5A 1WE5A 2ZRYA 4AEEA 2WMFA 1I0BA 1S39A 3GG0A 1GW1A 2ODOA 3MCMA 2DZTA 3Q4DA 3DHFA 2V63A 1OQFA 1PKMA 1TUXA 1R9YA 2TPSA 3LCHA 4BF5A 1U1JA 4XZIA 4XZHA 4MF4A 5B7ZA 5JU6A 1PS9A 4GYKA 1H49A 3ES7A 5DCBA 4JTQA 3UU0A 3CL6A 3JR2A 4UCGA 1VEMA 4O52A 1UHVA 3TSBA 1E1FA 1KFCA 3E96A 2J8TA 3LCFA 3TN6A 5B80A 5G2IA 4DLFA 2V5BA 4J27A 2YA1A 2VJXA 1V3IA 2QCLA 2WHMA 3UERA 1K03A 4AYGA 4IMEA 1XD1A 5HQMA 1W3HA 3WG6A 4MB1A 2GVGA 2H8ZA 2GLKA 2PDMA 5C55A 2D3NA 3BGAA 3E38A 3WLPA 1SUXA 1AH0A 2HPMA 3B03A 1GOXA 3WH8A 4PCNA 4FSAA 3BAJA 3UEQA 3GDTA 5CPSA 1HZYA 3UG5A 2VEFA 1Z48A 2BGSA 1VCFA 1XQLA 1W1YA 3ZWTA 3PANA 3PBMA 5HINA 3UXAA 1FUYA 3DYOA 4PUJA 4Z42C 2QUTA 1GOKA 2Z29A 1YEYA 4C5ZA 3QYQA 3R58A 3SY8A 3KP0A 1XRTA 1QK0A 3CHCA 5D05A 3IUIA 4JFUA 2Z6IA 3QN3A 4JTIA 4PMUA 3A3HA 3TYBA 2PODA 3N12A 3K8KA 2G97A 3NZQA 3NIYA 1VJZA 5SWUA 4RDYA 1YNQA 3P2VA 1SFTA 1S5VA 4E4PA 3EA3A 1VCGA 5D03A 1QI5A 2IUZA 3BJTA 2RAGA 4O1CA 1L6GA 3SCSA 3KBSA 4H04A 2YCIX 3PK7A 1TJRA 2PUZA 2FTWA 3AMLA 1LT7A 3STFA 2DFAA 3U2CA 4JYFA 5C9UA 1KCKA 3L23A 3DOPA 3FSTA 5HNTA 2BVDA 4GQRA 4PE8A 3KCOA 4LY4A 1J6OA 5HMSA 3HGJA 1EP3A 1OD8A 2Z27A 4R9OA 2GJPA 1NIUA 4GUJA 1FHUA 4LVAA 3DYPA 1HF6A 1SMDA 2WVVA 4WSKA 5AC6A 2IKJA 3MCOA 5LIKX 1RR2A 3UYIA 2H6RA 4K6AA 4H6KA 2J7FA 1TV8A 2FTYA 2GWNA 3SCPA 3U2ZA 1TPDA 5AC4A 5FL0A 1LUCA 1M7JA 2UBPC 1XHGA 3GVRA 3VCCA 1V6VA 3REQA 4B5TA 4GINA 2JK2A 4BKNA 3H24A 3KBVA 3CQKA 1XRVA 5AYBA 1QW9A 2Y7DA 4AY8A 2Q6ZA 3IJDA 1VH7A 3H21A 1TX2A 1E9LA 2OZTA 4BWLA 3GVWA 1FXPA 3PZQA 2J77A 4A2RA 2EKGA 2NQLA 3BWWA 1JPIA 3BLIA 1XYBA 4GACA 4PZVA 3TWAA 3LBOA 3BXWA 3EWYA 2C18A 5HR7A 1ZZMA 3GFYA 2PGFA 5G4HC 1YTKA 2PDYA 3GW0A 3V36A 4M80A 3UJFA 4ACYA 3G3MA 4Z0SA 1JFXA 3ITGA 4ZXLA 3FJNA 3UD6A 2DSWA 4GG9A 1S3HA 4M51A 4DRSA 1ZBVA 1KA9F 4LV9A 3GH5A 4QAWA 2W67A 3H7UA 1W3TA 1XG4A 2Y62A 3H54A 1IEXA 3IJ8A 3BV4A 4QP0A 5H8MA 4YTSA 1JGIA 4IG2A 1BAGA 3TA9A 1HG3A 3DIPA 3NYZA 4XAGA 4V2XA 1XCXA 1BWVA 3AAMA 3QRHA 3T05A 4W8LA 3G1HA 1H62A 3AFBA 5CBIA 3CPUA 3QPZA 3WYZA 1MXSA 2FGLA 3B8IA 3UWZA 4AZIA 5BMXA 3T0AA 2PDGA 1VFLA 4GXMA 1AD4A 3NPUA 3MS8A 1R3QA 2OPJA 3BANA 4IFOA 4FP1A 3V75A 1DJZA 3USBA 2DT1A 2C0HA 4EPDC 2OLSA 1VFOA 3VFLA 1KXVA 4JDBA 3P5ZA 5LA2A 3WLMA 1ZCOA 1A3HA 1UBSA 4CU7A 5G2HA 3WLIA 2D2GA 2DZVA 4E6MA 1P1MA 2Q3RA 4GCAA 1VYSX 4E0CA 4QE5A 4Q8MA 1WDSA 2OQHA 1XIBA 4H41A 1K8XA 4FNPA 2Z1SA 1VF8A 3VOHA 3PWIA 1OX4B 2GQAA 4H8VA 5AN7A 1NSJA 3L7RA 3W2NA 4PMDA 3KLKA 3RMJA 1YADA 1NDWA 4ZSTA 4FNRA 4BI6A 4MPQA 3NSXA 2FZ8A 1YQ2A 4HD5A 4J3UA 2WSRA 2BLEA 3DHUA 4N9DA 5DN1A 1JEZA 2ALDA 1PKNA 3VNKA 5KTLA 3RO8A 1XX1A 2CXGA 2XM2A 4O4VA 3OVRA 1OF8A 2VEMA 1VBHA 1X98A 1UC5A 4L65A 3CZKA 1V6TA 1O5XA 3OIHA 2PZ0A 3A5VA 1RQEA 4HSHA 4TV6A 1GGOA 2X1TA 3F4NA 5A2BA 1AK5A 1C8YA 4MUPA 4RXGA 4D6GA 5F2LA 4YTRA 2D2JA 3K8LA 3W02A 4F48A 1MSSA 2PBGA 3KL3A 2ZC1A 1CGYA 1IT0A 1TV3A 5AHIA 3L0NA 4AQLA 1VFFA 3L2IA 3QY7A 2OZ8A 4LS0A 3WDIA 4I5UA 4YHEA 1MUCA 5A1AA 4PL1A 1B57A 1JDAA 1NP0A 1X1ZA 4JNYA 1EJSC 1GPWA 3DX5A 2BY1A 4QSHA 3OGSA 4QCFA 3DC0A 2HE8A 2XH2A 1QPQA 2A21A 4DO5A 3NL5A 1Q6DA 2VXNA 5F2GA 4GKTA 1F73A 4JYEA 2BV9A 3CIXA 4F0HA 2QJJA 3NO1A 3TMLA 3W38A 1JG9A 1IXPA 1FWSA 1EBHA 5HQLA 4JTAA 1MW3A 3HMCA 2OVLA 4U5IA 2EPOA 3WQ5A 3ZZ1A 4H6RA 3NQ6A 5M1TA 4MZYA 3LX9A 3WO8A 1DJNA 3S3GA 1EH9A 3PN8A 4XZWA 2GK1B 3W7NA 4RR4A 4UQDA 4I9JA 3AMCA 3DFNA 4AC1X 1UWRA 4AAJA 3GXMA 3WMSA 5BRPA 1KKOA 4BWLC 4D71A 3CV6A 2P50A 4ICNA 1H7NA 2WNQA 4DJED 5AYZA 3NR0A 3P0WA 1ZHAA 2IS7A 4ZQRA 4IXHA 1KFKA 5G1TA 4HGXA 2C1IA 3S6OA 2OWCA 2DY3A 1TPC1 4GUIA 3PWAA 3EDFA 3ZJ6A 1VYPX 5FJOA 4GOAA 2OSXA 3MDWA 1FDZA 4ZBCA 4LAKA 1Y0EA 1KGXA 2XDFA 1U5HA 2JGQA 3TC3A 3CV1A 3E74A 2XN0A 1I60A 4L1XA 5GJMA 1LROA 3R11A 1A5UA 2V69A 4H4IA 4NILA 2J62A 2VR2A 2A3LA 4N4PA 2D20A 1Z32X 3QR3A 2VM8A 1IR1A 2ANUA 3N6QA 2POTA 1ME7A 3EX4A 2DVTA 3PZOA 1GCYA 1FWFC 3LNPA 2WMIA 3UPBA 1G0CA 2O4MA 1V6UA 4CCZA 3UY7A 1A5BA 2DSKA 5T91A 3LU2A 4A29A 4F2UA 2DZUA 2CHNA 1H60A 3FCPA 1UWTA 2FGBA 1Q8AA 4JDYA 1QWGA 4C90A 3OLDA 3VNYA 3W22A 2J6XA 1XLGA 3R0DA 1BYAA 1DXEA 2XFRA 2IXVA 3QHMA 1DYSA 4PMRA 1SJBA 4XB3A 4Z2GA 1J01A 2ACQA 2VZOA 3L4XA 3T9PA 3VM7A 3VA8A 4TX8A 4B3KA 2GSHA 2R82A 4MKVA 1XBVA 2TSYA 3W1RA 4NZ4A 4MM1A 3VIGA 4FF7A 1R85A 4MPKA 3ITCA 2NSOA 1QO5A 1H1ZA 4HNUA 3WDJA 2HK0A 4KETA 2OSYA 2PC8A 4LYPA 3PVFA 2X1UA 1R9XA 1B3ZA 4FIQA 3TFXA 3NZ1A 4S3JA 3S8HA 3W81A 2W0UA 3EOUA 4KEUA 5HNUA 2CHRA 1JULA 4HPNA 3VIJA 2Z2UA 2Y70A 3TW9A 5FJIA 3KFTA 2GJNA 3RCNA 1D3GA 5ENLA 1ZCCA 3W01A 3GD6A 3JU2A 2RHGA 3ALFA 3KWSA 2HE5A 3URQA 1TO3A 3PUDA 2PZNA 1MDRA 3GG1A 2QCGA 3WENA 1Z7AA 1FRBA 1XLCA 4MZ1A 3RILA 5ABFB 4JQ3A 1YDVA 3SEPA 1MZHA 1UWAA 1W0MA 3ARTA 4QROA 1G94A 3CAKA 3TAKA 4BQ4A 4UMBA 2PDHA 1KGUA 1G01A 5D2YA 2WBKA 1WCGA 4IIDA 4ACZA 1W8SA 2OODA 5F2MA 5KZDA 1XYLA 1O4UA 3WK3A 2PPGA 4DN1A 4HMDA 1IXOA 2DZSA 4CD6A 3I10A 3SUVA 4IXXA 2A7RA 3ECQA 3GU9A 1YMYA 2OKTA 3GDLA 4W4QA 1XYCA 1WZLA 2VR4A 2Y89A 2A79A 2FVMA 4Q4SA 2BZNA 3S9IA 1GORA 1I75A 4MKNA 4RKAA 1MEIA 3MJMA 3BOFA 4ZO9A 4GIYA 1BKHA 4R33A 2IPFA 4C6CA 1XISA 2D0GA 1V51A 4DAIA 1GYMA 1E6PA 4NU7A 3DESA 1KTBA 3QKZA 4IPPA 2I17A 2DZXA 3O0KA 4LYRA 1TKKA 4DJEA 1AW5A 1SVDA 1NQKA 4I5RA 3BPWA 3SDOA 4H8HA 5JH1A 5JBEA 1UP3A 2FDSA 1TV5A 3SCNA 1AZ1A 3LNMA 4EACA 3S5NA 2Y7GA 3FJ6A 4JTGA 3KOWA 2VEPA 3FS2A 3AO0A 5DCDA 1GTEA 2RDTA 2X09A 4B92A 1D7FA 1PZ1A 1DV7A 2EPMX 3AICA 3PZUA 3T0CA 2OOFA 2Y0FA 5HXMA 1KW1A 2Q8XA 2J88A 2J4GA 3Q58A 1W1B1 4O17A 8CGTA 1IEWA 1F3TA 4EPKA 3LB0A 3EWDA 1O94A 2ZX8A 3N4EA 3KDOA 3RR4A 4GJJA 2EG8A 3IWPA 4A6GA 1J8VA 5JVLA 3NEHA 5BNKA 3CLWA 3AS3A 2Z7GA 4JKMA 4ZODA 4A3UA 3RMEA 4R53A 5I6SA 4ZQCA 1Q66A 3TIMA 4ORMA 1TR9A 3SCUA 3T8QA 1F4AA 4C1NA 2QUVA 1M53A 1YTEA 1VHCA 3P61A 4KFOA 3RUBL 4AXNA 2PLKA 5CG7A 4AIOA 2C0AA 4NUWA 1OEPA 3A22A 1ME8A 1TYGA 5HMEA 3V7PA 4CKQA 4A8LA 1EA9C 1SYTA 3WKZA 4B16A 2FZDA 2PRMA 3NQCA 4HMEA 3LCXA 3N25A 1TA3B 1POJA 3KVKA 3N6JA 1V77A 3PJTA 4OVXA 2G3MA 4J28A 3H7VA 3GG8A 4L56A 4O4WA 2VRJA 4C1NB 1KM5A 1WDRA 1XYZA 3OO2A 3WCZA 4IX2A 1QBBA 4WGXA 2IPGA 4PCFA 4HN8A 3C0JA 4S38A 2HZGA 2V5KA 4ZQPA 3VX0A 1VS1A 4CCCA 2NQHA 3TNBA 4NY2A 1LBLA 4OQVA 1XYMA 3U5YA 2QIIA 4X60A 1TRIA 1OJXA 4WXYA 4D72A 2D22A 4FF5A 3QPEA 4HK6A 1K70A 3SRKA 3T6CA 2ZUTA 1PX3A 1TUFA 3ID7A 4WRHA 3WF1A 3WF3A 4MOZA 4Y9MA 2WHKA 1TZZA 3I6TA 2HISA 4PUMA 2HWGA 5D8ZA 4O1BA 5I24A 1SR0A 3PPGA 5IDIA 1J4EA 3LMYA 2DIEA 4MJZA 1WX0A 4O1FA 1Z3NA 4AIEA 4UTKA 4L4LA 2HVOA 3PG9A 4IWWA 1OY0A 1LT8A 3AXHA 3KRSA 1CTNA 1IEQA 1H63A 1K7XA 4LAUA 1PEZA 2YXOA 2HBVA 3WK0A 1XP3A 3M6YA 3S9YA 5CGTA 3CWNA 1PCKA 4FNUA 1IWPA 2G8ZA 2CLPA 1RH9A 1Q5MA 4D1IA 2C16A 1LRTA 3CS2A 2V9DA 4DLMA 4QHRA 4WVXA 1NOFA 3ABSA 4HCDA 1HO1A 3B40A 1EPVA 1QW7A 4BA0A 3GYEA 4IISA 4KRUA 3EEGA 2D69A 3IIXA 1E43A 5C7VA 1BXCA 2J25A 4S3GA 2J13A 3I3EA 1NJJA 1QASA 4DWSD 1XKJA 4D6HA 1XLFA 1SZGA 5DLCA 2G3JA 2I5GA 4UQBA 1SSGA 4PUWA 4DBUA 3R8HA 1EP1A 1V0MA 5M5DA 3VOJA 5D2WA 1WDWA 3FAWA 4PULA 3U7VA 3UR5A 2C1HA 2BVYA 5FACA 4I3GA 3IGXA 3PJXA 1M65A 2E1DA 3FOKA 1PTGA 4HYVA 4ZO7A 4FX8A 2F61A 3QHNA 1E0VA 4YN5A 4JIHA 4NAEA 4JS3A 2B81A 4UB9A 2HEJA 4HVXA 1JI1A 3QJAA 4UTTA 3QQWA 4DJEC