4LAOA

Crystal structure of cordyceps militaris idcase h195a mutant (zn)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
molecule keywords Cordyceps militaris IDCase
total genus 135
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4laoA00
4LALA 1PSCA 2DVTA 4IG2B 1A5KC 3GTXA 4H01A 2PAJA 1O5RA 1YBQA 4LFYA 4NI8A 3MSRA 1PTAA 3EWDA 4WHBA 1FWHC 3FDKA 1ZZMA 3GU1A 2Z7GA 2FTYA 1RJRA 4KF1A 2OOFA 1JGMA 4QRNA 1EF2A 1FWGC 1RA0A 2VR2A 4LCRA 3GU2A 3TN5A 3GTHA 3IJ6A 5FSEC 4XAFA 1FWIC 4KETA 3OVGA 3ITCA 1YMYA 1QXLA 4OFCA 4DZHA 3PANA 2O4QA 1NDZA 4HK7A 1EJWC 4EPKA 1DPMA 2P50A 4Z42C 2D2JA 1V4YA 2VC7A 1YBQB 1RA5A 2GWGA 1WXZA 1V77A 3MKVA 3KM8A 4ICMA 4INFA 4RDYA 3O0FA 1RJPA 1EJRC 1KRCC 4GX8A 4JOMA 1A5MC 2R1KA 4G7EA 1K1DA 4KEVA 2VHLA 3URNA 1RK6A 1EJVC 4EP8C 4CEXC 4RZBA 3R0DA 3RN6A 2VM8A 3OU8A 4GXWA 2Z2BA 1IE7C 4CQCA 4G7EB 4IFKB 1FKWA 3F2CA 4DZIA 2BGNE 1XRFA 2W9MA 2Z2AA 2Q01A 2E25A 2I9UA 4KEZA 2WJEA 2QT3A 2PUZA 1NDWA 2HQAA 1NFGA 3AUOA 4B91A 4HK5A 2UBPC 4V1XA 2ADAA 4KIRA 3MVIA 2G3FA 3T1GA 3E3HA 3HM7A 1J6PA 3LU2A 4D8LA 4BY3A 3LS9A 3T8LA 1NDVA 2AMXA 4YIWA 4AQLA 3MDUA 1PB0A 3SO7A 1FKXA 3IPWA 5HMDA 2XIOA 1V79A 4H9VA 1YRRA 1E9YB 3B40A 4C6KA 3QY7A 1V51A 2GSEA 2DVXA 4KQNA 4LAMA 3F2DA 3LGDA 3NQBA 3GTFA 4XAGA 3WYZA 1EYWA 3URQA 4KESA 4KEUA 4XD4A 2A3LA 4H9YA 1HZYA 3IARA 3O7UA 4C6FA 1ITUA 1GKRA 3K5XA 4RDVA 4AC7C 2WJDA 2BB0A 3A3XA 1UIOA 1KRAC 4QS5A 4IFOA 3T81A 4H9TA 3DCPA 3GU9A 4GBDA 2FFIA 1I0BA 4XD5A 2ZC1A 1EJTC 1FWCC 3PAOA 2UZ9A 1A4LA 4NP7A 3LGGA 3GTIA 3ORWA 2EG8A 1EJXC 3GUWA 1M65A 4J35A 4L6DA 4DYKA 4QSFA 3CAKA 2HPIA 2D2GA 2E1WA 4C6QA 5AKQA 3MVTA 4MUPA 3IACA 4IQJA 1A5LC 1UMLA 2Z24A 4LEFA 1K6WA 3UR2A 4HK6A 2FTWA 4B92A 2D2HA 3URBA 1M68A 1FWFC 3ID7A 4CQDA 2YB1A 3D6NA 3E74A 2GOKA 2ICSA 4PE8A 2R1NA 2Z25A 4DI8A 4XAZA 4C5ZA 3RHGA 3UR5A 2Z26A 4IH3A 3ISIX 4QROA 2HBXA 2YXOA 4WVXA 4H00A 4C6OA 2Q09A 4LCQA 4EPDC 2PLMA 1A5OC 4GOAA 1GKQA 2F6KA 4C6BA 2DVUA 2R1PA 5G4HC 4CEUC 4DO7A 2HBVA 4WGXA 3FDGA 3G77A 4C6JA 1R9YA 1I0DA 2GZXA 3B0YA 4GX9A 3PNZA 4ERIA 1RK5A 3CS2A 1FWAC 2R1LA 4J2MA 1NDYA 1POKA 3TNBA 3UBPC 3RCMA 3S2MA 4DLFA 1YIXA 2WJFA 4F0SA 2AQOA 3OJGA 1ONXA 3DUGA 4PCNA 5LXXA 1R9ZA 4G2DA 3PBMA 2OGJA 2KAUC 3IRSA 4B3ZA 2R1MA 2EG7A 3FEQA 4BJHA 4ZSUA 1XGEA 3HPAA 1P6CA 4KERA 3URAA 4B90A 1J6OA 1FWJC 1EZ2A 4H9ZA 4H9XA 3TN4A 2HNHA 3E38A 4J5NA 3K2GA 4P5UA 2OB3A 3JZEA 4LH8A 4CNUA 1E9ZB 4C6DA 4C6MA 2EG6A 4LAKA 4XAYA 4C6CA 3UF9A 4C6IA 1WXYA 2I5GA 1V7AA 4CNTA 1UIPA 3N2CA 4L9XA 1J79A 3MPGA 2O4MA 2IMRA 1FWDC 4C5YA 3LA4A 1KCXA 2RAGA 1FWBC 1RJQA 2QVNA 5FSDC 4PBFA 4IG2A 3QGKC 3NEHA 2PGRA 4IGNA 5E5CA 4CNSA 3LNPA 1A4MA 3OODA 2Z00A 4C6PA 4DNMA 1P1MA 1O12A 3OOQA 4GZ7A 1ITQA 3K4WA 1EJSC 3TN3A 4ERAA 3S2JA 4C6NA 3AU2A 1EJUC 3QY6A 1RAKA 3WMLA 4RDZA 2Z27A 4CQBA 1XRTA 4GC3A 3LSCA 3HTWA 4F0LA 4DI9A 1KRBC 4ERGA 2FVKA 4V1YA 3S4TA 3F4CA 4RDWA 3A4JA 4HJWA 1FWEC 1KRMA 3MJMA 4UBPC 5CH9A 3QGAC 2FVMA 2VC5A 2YZ5A 5A6TC 2GWNA 3GG7A 3BE7A 3F2BA 4GY0A 3IV8A 2OODA 3E0FA 2VUNA 3EWCA 2CZVA 4IF2A 4E3TA 3S2LA 5HMFA 3EGJA 4GYFA 3SFWA 2OQLA 4GY7A 4C6LA 3QY8A 4C60A 4R88A 2HPMA 3ICJA 2AQVA 3LY0A 1XWYA 2Z4GA 4M51A 1QW7A 1UBPC 4I6KA 1VFLA 2ANUA 4BKNA 3LSBA 3B0XA 3GIQA 2YB4A 4XD6A 4QTGA 2Z29A 1R9XA 2PGFA 4I6VA 3AU6A 1K70A 3GIPA 4GY1A 4DIAA 1M7JA 4PCPA 1PO9A 4IFKA 3NURA 3WZ0E 3DC8A 4IGMA 4PBEA 3IGHX 4F0RA 3RYSA 4UB9A 4IFRA 3S2NA 4H9MA 3MDWA 3MTWA 2QPXA 3CJPA 4C6EA 2Y1HA 4H9UA 3GRIA 1S3TC 3A3WA 4LAOA 1J5SA 4QS6A 5HMEA 1BF6A 4R7WA 4ZSTA 1POJA 3TN6A 4RE0A 4XD3A 4R85A 4EPEC 3C86A 1ADDA 1GKPA 1P6BA 4DLMA 1YNYA 1W1IE 4NG3A 4EPBC 1ONWA 4C65A 4LANA 2Z28A 3OQEA 1A5NC 2QS8A 4GK8A 4TQTA 2WM1A 3UPMA 3F4DA 3V7PA 4LCSA 3PNUA 2P53A 3E0LA 3E2VA 4HA0A
chains in the Genus database with same CATH superfamily
4WSKA 4IXXA 2PD5A 4N4QA 5KTLA 3KDOA 3P93A 1N8FA 3W6MA 2Z1BA 5LSMA 3VKJA 1QBBA 4RCXA 1JGIA 4U10A 4TO8A 3B9EA 1FWIC 3DG7A 3KUMA 4XK2A 1TPFA 1X6UA 4DZHA 1C9DA 1EXBA 1W5QA 4HK7A 3NDZA 3C2VA 1EUAA 2V82A 4AF0A 2D2JA 3UWEA 3M0YA 1S2WA 2VC7A 3MJYA 1NQKA 2GWGA 3D47A 4MMWA 3WDHA 4M3PA 4UFJA 3ECQA 4CQ8A 1HF6A 2QJJA 2FZDA 4MKNA 3TAOA 3MY9A 1ZL1A 3N04A 3NL3A 3BSGA 4FNSA 1CGXA 4FR6A 1XFBA 3QR3A 2BOFX 2PI6A 5G2IA 3OVQA 2ZUUA 5A95A 3THCA 5FEXA 1OYCA 1XRFA 3ARXA 4W87A 3GX9A 1UKOA 3B8WA 1UKQA 3GFYA 2V5JA 2HQAA 2YYUA 3W1NA 1KB3A 3CMFA 2DZAA 5DN1A 2P3EA 3MVIA 1QNQA 4JFSA 1LDCA 4PB5A 4MWAA 1MEWA 1HW6A 1VCGA 3PTQA 2PTYA 3M5VA 3RDKA 3VTRA 2QF7A 4H9VA 3B40A 1XIIA 1DJNA 1WOAA 2WMKA 4ZFCA 3TCSA 3NQVA 5DXXA 1IHIA 2VZUA 2VKZG 3CWOX 3DAQA 2I16A 4LB3A 5J8LA 3AYRA 2JGYA 5FEZA 5HUOA 3GBDA 2PDWA 3WD3A 4OZOA 3NDOA 4AMAA 4K6AA 2EG8A 1S5MA 1TG7A 1US2A 2CXEA 4OJYA 3J7HA 4B5NA 1EKOA 4DELA 4D6IA 3G5EA 3BARA 4UWMA 3VILA 2ZFAA 3ZR6A 3A12A 3W3OA 1RBLA 2QCLA 4IJRA 3DFHA 4DF1A 4S3JA 4X61A 1QFEA 1X7IA 1QATA 3FYYA 1EB3A 2CKSA 2PF8A 3CZ8A 1BFNA 3HG2A 3ENLA 1T8XA 2R1NA 1NAL1 2Q3OA 4Z2JA 4WSJA 4POCA 3UWQA 4LPCA 4MDPA 4TTGA 2BXVA 3A13A 1THFD 3DYOA 4C6OA 5AB3A 5I02A 4J3SA 1XXXA 5KEZA 1J18A 4HP5A 2F6KA 3WO8A 3T42A 2WPGA 3W87A 4JTRA 4JHOA 4A2SA 4OECA 4FLQA 1U33A 1VFSA 1WA3A 2BVWA 3PULA 3O15A 5ABTA 4ROPA 1UOZA 4E2OA 2J6VA 4GQ0A 1ALDA 1G7VA 1EP1A 3RO6A 3STPA 1E0XA 3SUSA 4BS0A 3QQ1A 1EL3A 3XISA 2V5CA 3RXZA 2VEGA 2ZRUA 2A0NA 1JFXA 1XGEA 1I1XA 4J4KA 5EY5A 3SADA 1R0MA 4N42A 3BLIA 2WZMA 5DY3A 2OWWA 1OCJA 3BCDA 2DV0A 1WDSA 3PJUA 1U5JA 1US0A 2VXNA 4LAKA 3QOMA 4XBSA 2EAWA 1HIZA 1WBJA 2BFGA 3NR0A 2EPHA 2BLEA 3HG5A 2AQWA 4CNTA 2OG9A 3WLKX 3M7WA 3C2FA 2IMRA 4AD0A 4E38A 3C2YA 3AJ7A 4HNCA 4JIHA 3ATYA 3JVAA 3OIHA 2PTWA 3DN5A 2Y7FA 5FI8A 1OGSA 4Z1AA 2C71A 1YXYA 4AZIA 1FWNA 1EHAA 4B5WA 2O9OA 3AICA 4PFHA 3UQNA 3VOHA 1OFBA 3FHAA 3CQ0A 1ITQA 2ZIDA 2PLJA 3H2NA 3D46A 4KRZA 3H22A 4R27A 3KRZA 2F8QA 6TIMA 2Z27A 5KITA 2PDLA 1XW8A 2VCAA 3VOJA 2XWDA 1FXQA 4DI9A 4O0ZA 4PL1A 1EX1A 2WSPA 4KWWA 5E93A 1CT5A 3WDQA 3WJZA 4ADUA 2O92A 3LHYA 4W8BA 1VCFA 1DQWA 2WLZA 4JIEA 3U8GA 3RU6A 2YBUA 4C7GA 2X0YA 2CZEA 3ZFHA 4F4RA 4LVFA 3L4TA 2YL6A 1JD9A 3IK4A 4NNBA 3TROA 3KFTA 3LERA 1G94A 3WX7A 1OFRA 4FNQA 3PY2A 1KCKA 1Q7QA 2G8ZA 2MUCA 1VF8A 3V35A 1CGWA 3VIKA 2IPFA 2ESCA 2QJHA 2QUMA 4PUEA 4RZ6A 4ICCX 4QDPA 4MG4A 3N9KA 3TA9A 2GK1B 2V3GA 3IJ7A 4GO9A 2OVLA 1XPGA 5CBJA 3G3MA 2A5HA 3B8SA 4UMCA 1B3VA 1T0OA 4GQRA 3OPSA 3VM7A 4TQTA 3I3EA 4GFIA 4Q8WA 2TAAA 3RPMA 3E2VA 3TQKA 2ABAA 4Z1DA 3I4EA 2QZRA 4US6A 1XIGA 1O5RA 4O52A 2HXUA 3H4XA 1ICSA 2WSQA 3LM7A 4IPIA 2Y70A 2ZZ4A 4LCRA 1UR4A 3HQOA 3O1NA 2KX9A 5CEWA 2PZNA 3MSGA 5E9AA 2CCRA 1ZCOA 4Y8EA 4MJMA 2ACRA 2PCEA 2QDHA 1NDZA 3VMOA 4LF2A 3VIFA 4OBSA 5CC6A 4JEJA 3KW3A 1RVKA 1PX3A 4A22A 3W7RA 1UZHA 4LUSA 4ES4A 4RPQA 4CNOA 1ZBVA 4UTMA 4YPJA 1Q7MA 1QI5A 4CD5A 3N25A 1ZBCA 4G7EA 4A29A 3BPWA 2INFA 1TVPA 5A8MA 2AAMA 3WF2A 3RN6A 1HX0A 3PFRA 4P8VA 4P8XA 1LG2A 1KFWA 1RBOB 1WDPA 4UFLA 2DY3A 3OIXA 1A5UA 3GDLA 2J6XA 1OGBA 5AHMA 1RD5A 1EC8A 2EGZA 3W7JA 3IAQA 1P6WA 5A2AA 1HGWA 1YPFA 2BVYA 4LUSB 2W79A 1NDVA 3F1QA 2V5DA 4NJIA 3V36A 3IPWA 3WQGA 3P60A 5A5WA 1XLGA 4CQ9A 3SCNA 1UC4A 2GSEA 5REQB 4QJ3B 3OLEA 3TJ4A 3NPXA 1SW0A 3NQMA 1V0MA 3A9IA 2NVAA 4IJBA 2X2GA 3K8KA 1TV8A 7XIMA 2ZXDA 1QW8A 2BY3A 3I6TA 4XZNX 3RM4A 5G1TA 3YPIA 1BYBA 3VFCA 1XLAA 4B5XA 3CL8A 3RLVA 4P7RA 3CO8A 1EJTC 2X0HA 3FKRA 1A4LA 2E6YA 1ADSA 1SJDA 3G6MA 2V67A 5BWFA 1BEUA 4ACZB 2VGIA 3W7GA 3VPLA 1LLWA 1H7WA 4KFPA 1J2BA 2JIWA 4H7ZA 3SSZA 2QW5A 2TMDA 2ZUMA 2G95A 1XICA 2Z24A 4JN6A 3GYCA 1XV8A 2WZTA 3VX1A 4CLMA 3E74A 5A8GA 4DEFA 4HA4A 3TJIA 1DV7A 4X63A 4FNPA 4MM1A 3WNPA 2MNRA 1VGAA 3RCNA 3WCZA 1I60A 4LAUA 2E40A 3RNDA 3W1AA 2PLMA 4LY8A 2ZZ1A 3CLMA 2R6OA 4F2UA 1GJWA 2C15A 4HYVA 4DJEC 3SJ3A 1WZAA 4WGXA 3TMQA 4C6JA 4O1BA 2OZ0A 5ENLA 3UBPC 3RCMA 3VCCA 3FA3A 2V2DA 1YX1A 2XIJA 3VNZA 4B3ZA 3QLDA 3PZQA 3BVJA 3A22A 1VCVA 2WM0A 3WK2A 2YXXA 4IQLA 4NIRA 2POZA 1TMLA 3BOXA 1C8QA 3FOKA 1BSIA 3TXZA 4H41A 4Q8NA 4O1DA 2PDCA 2ZVRA 4JTUA 2EG6A 3E5BA 4XAYA 4F2TA 2BXYA 1ZSXA 1HXJA 2I5GA 3KBNA 2DZWA 2D0HA 4L6HA 2OEMA 4CCDA 1X38A 4HU4A 3R94A 4UTHA 5C70A 3A6OA 4YU1A 3W1PA 2XFRA 2CC0A 1W9PA 3VAVA 1RQHA 4JTCA 2DSKA 3NSXA 1VJZA 3TNOA 5EB8A 3HGSA 1Y7VA 3HGJA 4IG2A 3SIZA 2BHZA 3P74A 4IL0A 1Y0EA 4OGZA 3GWQA 4C6PA 3EBVA 4MJ4A 3UWYA 5CQ1A 4P7LA 1L6WA 1Z41A 4K36A 5HA7A 4H7VA 3QOKA 2J8GA 3EDKA 2ZX7A 4S3KA 1W0MA 2ZX5A 4V15A 4AH7A 1U22A 1YQ2A 2DH2A 2NLYA 1OF8A 4IMAA 5TAOA 1S2TA 1WOBA 4JKKA 4Z0JA 4HHLA 1FWTA 5E0KA 2BXZA 3O9NA 1XLIA 3GG7A 4N9BA 5T26A 3NWRA 2PC8A 2NT1A 1XJBA 5D2VA 4IPNB 4I8DA 3EWCA 4LEQA 3WUFA 5AOUA 3S2LA 4GYFA 4KCWA 4XG1A 3SFWA 2OYLA 3B06A 3M43A 2VYOA 2XDFA 1K6AA 1YADA 2CBVA 3AO0A 5HJLA 9XIAA 1I2NA 2W66A 1PL9A 4FNTA 3QLLA 4QE4A 4JNZA 2Y62A 1K70A 2F9RA 4L64A 3VUPA 1ITCA 2QDDA 3WL0A 3O8AA 4K7VA 4LNCA 3DC8A 1XGDA 3W7NA 4E4PA 1R2TA 2NQZA 4MFDA 2WC3A 2EJAA 1VH7A 1JCJA 2O7QA 4UTUA 4H9UA 3CV1A 3S42A 3E12A 3TN6A 2Y7GA 5EMLA 3F5JA 5CC7A 3UR7A 4DJFD 1BD0A 4M0XA 2X2YA 3HPXA 1UKTA 2TPSA 1AD4A 5CBIA 1E5NA 5CAKA 3L5LA 4GK8A 2D24A 3UPMA 2XGBA 5C7HA 2CWNA 2PBOA 3R5EA 4LALA 2PAJA 1R3YA 3GHSA 1PTAA 4DWSD 1Q45A 4PUNA 3MO7A 1FWHC 2J66A 3S5YA 1HJSA 4RNJA 1PBGA 3OHMB 1A80A 3CHVA 3GC5A 1G4PA 2YJQA 3NQ2A 4RLIA 3QF0A 2RKXA 3ONCA 3UG3A 4AWSA 1YPXA 1YE6A 5LHFA 1GOOA 3NVTA 3NOYA 2E6FA 4A3HA 1CIUA 2A6LA 2REQA 4FSAA 1RA5A 3AMKA 3HGOA 3UWZA 4LUYA 1Q65A 4DUVA 4L4MA 1RJPA 2VGFA 3GZ3A 5FA5A 4AVNA 1J2WA 3IAPA 5DQPA 3LCXA 2A1YA 2QCDA 5A6BA 2CZDA 3M16A 3UXLA 2GJLA 5FF3A 5J04A 5ABHA 3DH7A 5DX7A 2WMHA 4J9JA 4IFKB 2VX6A 1X8CA 3TLLA 4NZ4A 1HQTA 2AGTA 3LHVA 4AWTA 5AC7A 2J78A 1ZGDA 2QT3A 2PUZA 4B91A 4HKPA 3RX2A 4DF0A 4CKQA 3CQIA 3I3DA 5A6LA 4FOKA 1VAHA 3PPGA 3AMGA 3PWIA 3QTPA 2E67A 3W7DA 3DBPA 1Y5XA 1UH2A 1ZU8A 5I3DA 1E9YB 3GHTA 2WHMA 3QY7A 4LAMA 2V68A 1GOIA 4MF4A 8XIAA 3TH6A 3TJLA 1OFEA 4UFIA 4AF0B 4JIQA 4OVXA 5JH2A 2DT1A 3EPOA 3S3GA 1B30A 4UNLA 4GNKB 1OT1A 4ZQNA 4N0RA 2VFEA 1HKVA 5H1WA 2EO7A 1S5TA 1K8CA 2ONEA 1UPPA 2PWFA 4KWUA 3W26A 2V2CA 2XWEA 2O9TA 4O0QA 4P7OA 2IXVA 4CCEA 4LUJA 2CLIA 4AEEA 1JAKA 5EMJA 2Y5SA 2C1GA 4HU3A 3KOWA 3Q65A 4XZBA 3THDA 5GJNA 4XO6A 3JU2A 1FWFC 1W1TA 4OKDA 4JYFA 2Y8VA 1PJ9A 2ICSA 4UTKA 3KS5A 4GNVA 4UFKA 4A2RA 3EMQA 1KXHA 1MRQA 1GZJA 4IH3A 4LUIA 3C0SA 3FAXA 4DXVA 4WDUA 3RILA 3R8HA 3EPMA 1J5TA 5KZEA 2C13A 3NO3A 1C92A 2BTMA 2GGJA 3AAMA 4DBSA 1I2OA 5LA1A 4WOQA 1ML1A 3U57A 3KE0A 1UZ4A 3USZA 3FDGA 1R3TA 3U2ZA 3MS8A 3CS2A 4LQ1A 3B8TA 4N9CA 1KR0A 2C8NA 1OC5A 4M6UA 5FJIA 3FA4A 5TIMA 3OZMA 1HP5A 3VM5A 1W1ZA 2EBNA 1O1ZA 1R9ZA 4KWVA 1SO3A 2HZGA 3UYCA 2C0HA 3CV2A 1DP0A 3DX5A 1LF1A 4UQ9A 3PM6A 3BLPX 3V3WA 1GW1A 4BFAA 1V6UA 4FXRA 4B90A 1WKYA 3CYVA 1J8VA 3K2GA 1E9ZB 2SFPA 4DJED 3WK3A 4CVWA 5D9MA 3R13A 3R58A 4XTIA 2CLMA 1G01A 1ZJHA 1OABA 4LF1A 3LLDA 4HOWA 5MKGA 4WIWA 4G8TA 2Y7DA 3QPEA 2CITA 2O4MA 5LNWA 4F79A 1BXNA 1UCWA 4YWIA 1KCXA 1QNOA 3BC9A 2PWDA 1RJQA 3FA5A 1LQ0A 3H12A 2J75A 4K2SA 4IIDA 1V02A 3EA2A 1CB7B 3NEHA 3WBAA 3LNPA 4CGTA 3QYSA 5A6JA 1Q6QA 3ZR4A 1PV8A 4F40A 2PE4A 3VNLA 2ZUSA 1PCWA 4IUGA 1PDZA 3UFYA 4K39A 3C6CA 4YTTA 1H51A 3B0UX 4HQVA 2OSWA 3QRHA 3RMEA 2I17A 3QSTA 1MXGA 4LS1A 1L8PA 5JH1A 5C9XA 2ZZ2A 3OTRA 3LBCA 5CPLA 4IUOA 3CK5A 3WD2A 2YOCA 2ZX6A 2NWSA 4ONVA 2WXDM 3PZTA 3W2MA 4EXQA 4DUWA 2FZMA 2F7FA 2P8CA 4QBXA 5HOSA 2F38A 3CC1A 4QEEA 5CZSA 2OQLA 1JF5A 3P7YA 1WKDA 4O10A 1TJRA 2XHYA 1E15A 4S23A 1GZ1A 2ACUA 3ZT6A 4GXMA 3VO0A 3S9IA 3LCGA 3I6RA 1V3HA 3K46A 2YCIX 3M0ZA 5CPOA 1BVZA 3OG3A 2QIIA 2X1RA 3GG0A 1ISVA 1FQ0A 4DIAA 1RLDA 2P0OA 4QE1A 1SMAA 1WDDA 3AIBA 3T55A 1KFJA 5F7UA 4PBEA 1D9EA 1E4LA 1PYMA 4YVPA 1QMLA 4JBRA 3MDWA 4GZEA 1TWDA 1R8LA 1S3TC 3CV7A 4IT1A 2V81A 4R7WA 2XYLA 2IKJA 2QF8A 4XD3A 3SCUA 4EPEC 4QDMA 3W72A 3QZEA 3V4BA 3V16A 2GVEA 3CUXA 3NTYA 3G0SA 3GYEA 1YDNA 3WNNA 4W88A 4GBUA 3AHTA 1CWYA 5DCEA 1SJCA 3PZVA 3ZLHA 1DIEA 1H5YA 4HD5A 3GC4A 2Y85A 1OHLA 3S0CA 3HV9A 3IGSA 2Y89A 3T2QA 2PU0A 4LYRA 4WHBA 1TE1A 3GXIA 4IPLA 3MUXA 1EWEA 2VR2A 1P43A 1TJ1A 3M0LA 3VC6A 3FJNA 3WBXA 1UD4A 3UXKA 3BMVA 4C7FA 4GIAA 3QGVA 1X98A 2X1IA 1NIUA 1EJWC 4AHPA 4LS0A 3TSMA 1DPMA 2D69A 2YW3A 1VHCA 1GWJA 4V28A 1OWQA 2GUBA 3S5ZA 2VEPA 3E49A 1VB9A 4RDYA 5K9DA 3HB9A 4IGSA 1KRCC 1YYAA 3MMUA 2VZVA 2DIJA 2YCKX 3A5FA 3ZSTA 1EJVC 1V3MA 3CTTA 1TV7A 4MB4A 1MDRA 4MFEA 4PMQA 2WVTA 2BBFA 1UR3M 3N19B 3WQFA 2WHKA 1LBFA 4WDTA 3F2CA 3M0XA 2I9EA 4F8XA 5CG0A 3TSDA 1SJAA 5HINA 1FBAA 3NO5A 1IIGA 3ARRA 2DH3A 5M5DA 5JIWA 1RCOB 4H1ZA 1J6PA 3G2GA 4BY3A 1M1BA 4G9PA 4PTDA 4WD0A 4MYAA 1YTDA 3ZJ7A 2EPKX 4G7FA 3PJXA 4JZ5A 5K2ZA 3QHNA 2IQDA 3W24A 2YYTA 1UJPA 3KOFA 2WWDA 4G56A 3PZUA 4FO4A 1Q6DA 2JE8A 3AJXA 5HQMA 1UJQA 2YA2A 3P82A 5BOFA 4WKHA 1OYBA 4FX8A 3N1AA 2Y0FA 2VOMA 1K7FA 3H55A 4JS3A 2BB0A 4D1JA 1V0NA 5DF0A 4BR1A 3ZM8A 5FACA 3GU9A 3EDEA 2RDWA 1N8IA 2QLYA 3O6AA 4XD5A 3BLEA 1GT8A 3G1AA 3PAOA 1L6FA 2UZ9A 3UJ2A 2WSRA 4DJDA 4N7QA 4W86A 1M65A 1W5OA 3ZYZA 3KCJA 2QEZA 2D2GA 5GVJA 3MVTA 4M5PA 1V3LA 1ISXA 1A5LC 1JCTA 3N2BA 4ZQMA 2E5DA 4LB4A 2PEVA 1NF0A 2WMGA 3NUKA 2R94A 1IXOA 3E6EA 4UTJA 1DE5A 4GE8A 3APGA 3GD6A 1SYTA 4GH3A 3H7RA 3O05A 4HMEA 1H63A 1R3VA 3OB8A 5FF0A 3LCLA 1FFQA 2Y24A 4QJ5B 2VMFA 4NJHA 3QC3A 2C18A 2FJUB 2E4TA 2YBTA 3W29A 2OLAA 1XDLA 3WFLA 3O6YX 3SUUA 3E2RA 2H9AB 3SQMA 2NXIA 3EX1A 3G77A 4EK7A 4MTVA 1JYXA 2V3EA 3VZYA 2D20A 3REQB 1SO6A 4EIVA 4TIMA 2O9PA 5DXYA 4O1CA 3ATZA 1KWGA 1F74A 2PLKA 2TRSA 4DXXA 2JQXA 3NNTA 3UCCA 3VIPA 1DQXA 3WN6A 4AZ7A 4RNIA 4EVZA 5A2BA 2CLOA 4R34A 3BURA 4J27A 4DAFA 3LMYA 2HISA 2V8ZA 2PP0A 3GNDA 3CYJA 1AFSA 1SFJA 4KPLA 2WZEA 4NY2A 2YBVA 4AZBA 3PWAA 1E43A 3MP3A 4Q32A 4JIPA 3WQ4A 1XIJA 3AYSA 1GVQA 3VKBA 1FWDC 4QG9A 1WBHA 2VGGA 3CQKA 3II1A 4C5YA 3L4VA 2XFFA 3B05A 3CIWA 1MQRA 2WQPA 4H8NA 1Z69A 1WP6A 1E9IA 4I9TA 5BOEA 6XIAA 4J7RA 3WEZA 9RUBA 3W2UA 1NH6A 4I90A 4WGHA 4H2CA 4DWSA 1IZCA 1PTDA 4OBRA 4HNTA 3BLKA 2RDXA 1WV2A 1GVIA 4GC3A 4G1NA 4DHGA 2J7FA 4NZ1A 1CXKA 2WCSA 1LWIA 5C54A 4MPQA 4UQEA 4GIRA 1A53A 5TD4A 4PGLA 3UY7A 3W74A 3UP8A 3E0FA 1OM0A 3OBEA 5AZ0A 4FF7A 3OYXA 5DBUA 4PTMA 5HNRA 1UP0A 4GLEA 1QI2A 1KXTA 1LWJA 3ICJA 3P80A 5EA9A 3LY0A 4H19A 7ENLA 3WLNA 4OUEA 1G1YA 3A64A 4PMRA 4B2DD 4LVBA 3U7BA 4XD6A 4QM1A 1GOKA 3Q94A 3C8NA 5D03A 3L2IA 1PHQA 1EGZA 2HS6A 3KS6A 1FCUA 4IFKA 3G1XA 5LIKX 3E5PA 5DRCA 4TX9A 4IFRA 5JU6A 3W1UA 1R3RA 1Q4WA 1XLHA 2VP8A 2X0SA 3LDVA 4HNOA 2ALRA 4RR4A 3O16A 4HNVA 2C3ZA 3U3HA 2J47A 5IFTA 3RCYA 1W1IE 4EPBC 4E8DA 7A3HA 1XLLA 4HZ8A 2YCEA 3IJDA 1C7SA 1MVYA 5I3GA 4B5TA 4TVCA 5FJUA 4H04A 3V5FA 4W4QA 4LCSA 1M9HA 1JJKA 3M9YA 2CLEA 2YR1A 1A5KC 1KW1A 4ATDA 4S38A 5E0FA 2CYGA 3VIJA 3KVKA 3NL5A 5M2FX 2W91A 5F2GA 4QX4A 3S5NA 2EPMX 4QCEA 4PODA 1OIFA 1XLJA 1FWGC 2W5FA 2FGLA 4HZ7A 2VVSA 1GNXA 1XLCA 3ANUA 4XZHA 5A6KA 3AYTA 4XAFA 3P61A 3I4KA 1DIOA 1TTQA 4M1RA 1BWKA 1P5BA 2PP1A 3AXKA 3ZLFA 1A3HA 4GG9A 5B80A 3WJYA 2C19A 4PMVA 2CETA 4FX6M 4OV4A 4TVUA 1GHSA 3CLWA 1H0IA 4F2BA 3UGVA 3SCPA 2PU1A 3SCQA 2Y88A 2HK0A 3VINA 4UR9A 4XBKA 1AVAA 2PF0A 4ZOEA 1ZJAA 5IHSA 1WO2A 4IP4A 4A6GA 3C0LA 3GXMA 1MXDA 4QDWA 5FF4A 3KBVA 3GNPA 1RD6A 3T07A 2W6RA 5I3FA 1CW2A 3P6LA 3XIMA 2O56A 3PZMA 5ABFA 1WUEA 3SY8A 4UQCA 7REQB 1PKLA 3LS9A 1CGTA 1HUVA 1R85A 2BP1A 4ZXLA 1YRRA 1KM4A 4NZ3A 1XI3A 3UG8A 4F66A 3URQA 4BQ2A 4O19A 2PDUA 1K9DA 2FTPA 3T40A 3GKFA 3HJZA 4Q4QA 2ZA2A 3K5XA 1ADOA 4RDVA 1UIOA 4IMGA 4NZCA 4H9TA 3DCPA 5BXTA 1I45A 2OZ8A 4JFTA 5EPDA 2A7NA 1NU5A 3VZXA 1I1WA 3GVGA 1F6PA 2CLPA 2VZSA 3K30A 4LC8A 1EFZA 1XLMA 1CPUA 1W31A 2G4JA 4UQDA 5A6SA 4MKVA 3TTYA 5BWAA 2DIEA 3NPVA 4GI4A 4U3CA 4Q4SA 3BSHA 1FXPA 2VEKA 2YB1A 3LCWA 1TWIA 2Y63A 3W76A 2GGEA 2QJMA 1QOXA 4UR7A 3NYDA 3VGBA 1RP9A 2PDBA 3SRHA 3GHRA 3CIXA 2WZIA 5TQLA 1GOWA 1A50A 1O5QA 1AODA 1ODUA 1W56A 4NUWA 1P0DA 2PDQA 1M7PA 2JFEX 3NXFA 5HMSA 4LRSA 2HK1A 4J2PA 1A5OC 2YA0A 3NPUA 1GKQA 1NELA 3A9BA 1P7TA 1OY0A 1UC5A 3B0PA 4L6OA 5I2UA 4CQAA 4L80A 4DO7A 1LLZA 1P4CA 4H83A 1H7PA 4GWEA 3WF0A 1UZ1A 3LQLA 3LB0A 4GINA 1Q7ZA 8RUCA 3WY1A 4E2BA 4D9PA 3AZRA 2QGHA 5JBFA 4DLFA 3O6DA 4E2VA 4F0SA 2AQOA 1KM0A 1AMKA 2GQAA 1JXKA 1NWTA 1G67A 1EEPA 3CNYA 4ROQA 2PPGA 3BZJA 1AJ2A 2J74A 1E4NA 2O7SA 2QHAA 4IX0A 5GNZA 2CZFA 1S5NA 2WV8A 1P6CA 1SR9A 4HPGA 4HCLA 1HJUA 4J5NA 4BF9A 2BGSA 5CJMA 1B54A 3IANA 4DWSB 2ZUWA 4KWSA 4TX6A 1KM2A 1KD0A 1ZP4A 3M7SA 1MDLA 4PTNA 3SR7A 4HIBA 1MO0A 1DJHA 1RH9A 4L1GA 5CZTA 3LA4A 3PS7A 1X1ZA 5CGMA 2PWGA 3P67A 5A8QA 1DXIA 1JIBA 1EQCA 1G4SA 3CQHA 1SM9A 5FL0A 1JYWA 4J3VA 4U2ZA 4XB3A 3OZYA 3T0BA 1YDYA 1UW9A 3EX4A 2DJXA 3TN3A 2P5NA 4D6DA 1KFLA 3RUBL 3Q67A 4GYPC 3GNNA 3CUHA 1LJYA 4OU1A 5SWUA 1HO4A 2XVNA 4A8IA 2PD9A 3TYEA 5DANA 1VRDA 3S1XA 1JULA 1DQUA 4JTTA 4U4MA 2JF7A 2VI0A 4ZO7A 2E1DA 3RX3A 3OYZA 3KXQA 3B8VA 4M29A 3TYDA 2B4GA 3WF4A 4HGXA 3W27A 3FVMA 2QV4A 1O5KA 2FVMA 2VC5A 4ML4A 5I77A 3GXNA 3TFCA 2GJXA 1DIDA 1VFTA 2AMGA 3DGRA 2BODX 4GY0A 4H6EA 3M07A 1TPH1 4PMJA 2FJKA 4MJ2A 4CVUA 1QPOA 3QC0A 5AC6A 4YLWA 2DSWA 4KGLA 1E5JA 4ZA0A 5FOOA 3NJ3A 1KBBA 1FH8A 3KL0A 1SSGA 2XU2A 3EX6A 4W7UA 4NX0A 2VT0A 3F4NA 3HMJG 3LSBA 3SFKA 3DHUA 4M6QA 4DJEA 2FPVA 4TR9A 4YYFA 4HNUA 1M7JA 2P8BA 4R7OA 2A3EA 1MI3A 3GHUA 4KIEA 2J7DA 1ZALA 1I6NA 4KFOA 2ALDA 4O28A 1Y5VA 4H9MA 4E2DA 4QNEA 3DFOA 4C6EA 2Y1HA 1BXBA 4O11A 5BU6A 1POJA 3HMCA 4LV9A 2XIIA 1LOLA 2PGEA 1UD8A 3FJ4A 1YNYA 4S3AA 1FHVA 3FV9A 1Q8JA 3FN9A 2DZVA 3STCA 3WUEA 5HAOA 1XLFA 1VBRA 1O5XA 3LPFA 4H2HA 2P53A 4O54A 1RUSA 1I2QA 4WXZA 2HVNA 3N73A 1PSCA 3SCOA 5I07A 2ASHA 4H3DA 1AA1B 3ARPA 3G1HA 1GOXA 2W62A 3EWDA 4IX2A 3TEVA 2B81A 4K1WA 1XIMA 3KTCA 1JCLA 1JPIA 3B9OA 3BO9A 2C79A 3GU2A 2QULA 5HBFA 4FLSA 1BSLA 1QXLA 1AUSL 1I4NA 4EPKA 4WF7A 2P50A 3ZLGA 3CB8A 4H4IA 4Z42C 1UWTA 1VP5A 3POHA 5I0DA 1XUZA 4Q6XA 3TC6A 3QTGA 1F3XA 4BQ5A 4FB7A 1SZNA 3G0UA 3UU0A 4UQBA 1E72M 5EMUA 1XCFA 4N9DA 1XIDA 1MRAA 4CEXC 2XINA 4UZUA 3TYUA 2NQ9A 3ZWTA 4G7EB 3DHFA 2BGNE 4GABA 4PMUA 2ZQ0A 4NF7A 2CNCA 1JZ5A 4KEZA 4LC6A 3W70A 1M04A 1M6JA 2FGBA 4JNYA 4GQQA 4KIRA 3NEVA 3BOFA 4LWWA 1ONEA 6REQB 5LGXA 2V0TA 1DJYA 1FP9A 5F1UA 1ZENA 3GFXA 2FPYA 2QJNA 3NPWA 1KBJA 4R9OA 2QUVA 3H2MA 3KLKA 3M0MA 1JCXA 4AD5A 2IPJA 1M5WA 5I79A 1PE1A 1KRAC 5LKYA 4D1IA 2VEIA 2BWGA 5BRBA 4P7NA 4B9ZA 3PPFA 3ZVHB 4Q8OA 1UH4A 4J3UA 4ZQPA 1PX4A 3EX2A 2OQHA 1MFUA 3ARVA 3AUJA 4HSNA 3USBA 5AHIA 2G3JA 3ORWA 3GUWA 2GGIA 1QDSA 4CUCA 2V69A 4ZODA 1US3A 3TQ0A 3N9SA 1E4IA 3ES8A 4S3BA 1UASA 2R82A 1K6WA 5D8ZA 4JYEA 3ABRA 4DZAA 3GUGA 4XO7A 1LLOA 4S3DA 1ZJIA 2GOKA 1XBYA 2QYGA 1LUCA 2BOEX 4I9AA 3W1XA 4ZQCA 3UR5A 3D3FA 3WLJA 9XIMA 3BXWA 1OG6A 3CUFA 4U28A 3CWHA 1UUOA 4XUYA 3IJLA 3PBWA 4HZMA 3C4UA 4IMEA 3GXFA 3GH5A 4DBDA 4DO4A 4MY9A 2Q8XA 3NZRA 1B5TA 4GA8A 4C6BA 1UUMA 4W7WA 1KC7A 2YGYA 1RQBA 3QR0A 4QISA 1I0DA 3SCRA 4GX9A 3MSDA 2VOTA 5HANA 4J2MA 5D4YA 3NQ6A 1NDYA 1F76A 2WJFA 1QNSA 2DSZA 4AIBA 1ONXA 3DUGA 1XH2A 4BA0A 2WHJA 4DPPA 1RHCA 4JCMA 3I68A 2WC4A 1GYMA 1HL2A 2VFDA 3KWSA 7ODCA 3CO4A 3H2FA 1D3CA 2Z7KA 4J1OA 3R4IA 3H2CA 3CB3A 3L0GA 1OFPA 4O17A 1BPLB 3F03K 3HIJA 2HNHA 1IYXA 1EEXA 2XM1A 1Z32X 4JAWA 4FNRA 4LH8A 5CPNA 4NAEA 3UG4A 2V63A 1J10A 1MEHA 5AYYA 4GO8A 4L4LA 4XZ9A 4FIRA 4J3TA 2QXWA 1K9TA 1OGGA 4PRWA 3WH5A 5A94A 1JEZA 4EACA 1K03A 3OLIA 3LPOA 1IF2A 5DMNA 2VCCA 4BQ4A 5C55A 1S38A 5FSDC 4PBFA 3GKAA 2HXTA 3LHZA 4LYQA 3MV11 1A4MA 4QLLA 5XIMA 3UZWA 3QN3A 3HN3A 1OZMA 4AZCB 5A8OA 4ZO6A 2PTDA 3S2JA 1DVJA 1DJGA 1EJUC 4Z17A 1GQKA 4TVDA 3N13A 3HJEA 2HS8A 1W9UA 4RDZA 1JCNA 4JX4A 4U2YA 3PB2A 1V3KA 5I5RA 4XISA 1V03A 2DSUA 3EDFA 3HTWA 3TSBA 5K7JA 2NZLA 3U0HA 1JZ7A 2Z1WA 1PXGA 5EBAA 1KWKA 4V1YA 4WSHA 4DYEA 1W1A1 3B8DA 4JTIA 2VFHA 4C1NB 3DBNA 2QAPA 1ZY9A 4F9JA 2PURA 2XIMA 4UBPC 4FX7A 1GUVA 4GGBA 4DF2A 3JUGA 1S5VA 1VEPA 2VWTA 4ADTA 3F2BA 3IV8A 1ZJBA 2I5QA 2PTXA 3DOPA 2OGYA 4QLKA 2GDUA 2Q71A 1JNEA 1FDYA 2VO5A 4DBWA 1JD7A 4O15A 2HPMA 3H2EA 2PRHA 5BZAA 3L4YA 3KOXA 3L2LA 3PWGA 2F84A 1BAGA 3L4ZA 4MNLA 4I6VA 1HL8A 2R8WA 4JTSA 1Z44A 4EKJA 2A7RA 4DO5A 2ZOXA 4GMEA 1EO7A 2X05A 1T6MA 4JKMA 3RPDA 5DELA 1QI3A 1T7LA 4UR8A 2INEA 1JRCA 1TZZA 4GVFA 3B03A 1A0DA 1D2KA 4R85A 2WVVB 4DLMA 1NEYA 3NQ7A 1R2SA 1NTHA 3PBUA 3N4EA 4X9YA 2QS8A 4JR5A 2VX4A 1J93A 1TQXA 3O07A 5AVHA 3TAKA 5T9CE 1KV8A 5DCBA 4A4AA 5M03A 3TXVA 2QQ6A 5KZMA 5J5RA 4UFHA 1GQIA 4BEQA 5CLTA 2OOFA 1Z6KA 2ZTJA 4RXFA 2V3DA 3H4WA 4GACA 4ORMA 3W7QA 5K3VA 3WFAA 3MHUA 3R8GA 3ARZA 3SN4A 1FDJA 2VVNA 4Z2HA 4B2DA 4OFCA 1DWFM 1DOSA 1OG0A 5FF2A 3GNRA 3S1GA 1DJQA 1YDOA 1WXZA 3G18A 1LTDA 4INFA 3GAYA 3DI0A 3ES7A 2DZPA 4Q7NA 1Q2SA 2Z1VA 4Z0SA 1XD0A 4UXDA 2WC7A 2L5HA 1IE7C 2VR4A 2D73A 2ATMA 2WNZA 3WLPA 3MT1A 3QJAA 5MF5A 3GLCA 3QZ6A 3E96A 4A8NA 1N7KA 5AYIA 3H2OA 2ZX8A 3QQ0A 1F61A 2W3ZA 2ADAA 1GZGA 1PWMA 3TUUA 2G3FA 4LX4A 3E3HA 3HM7A 1IXQA 4YJ5A 2V2HA 4AQLA 1PB0A 1TPEA 2PFHA 2WANA 4Y9AA 2FIQA 2XSAA 4O0KA 5G5IA 3W75A 2Z0IA 4MADA 1IEWA 3RRAA 1JI1A 3GW0A 3WYZA 1JZ2A 1RBAA 4QIUA 4U5KA 1B90A 3KLLA 2OZTA 3ABOA 3MMWA 4ZVJA 5A3HA 3S5SA 4AISA 4HNLA 1U1JA 1I9CB 4IFOA 3SSJA 3THQA 4Q3MA 3UR8A 4A8RA 2XN0A 3UCDA 4GBDA 1E0VA 2ISFA 1DJZA 1PZ1A 1XYZA 3IIOA 5BMWA 4QE5A 5D2WA 5HR6A 1UR0A 2JKPA 5BROA 3T0CA 1CLKA 4PBGA 4L6DA 1YTKA 3LD5A 2X8RA 4W85A 1PX8A 2XISA 5CSSA 1BWVA 1EDQA 2D2HA 2I1OA 1L6SA 2PDIA 3W1TA 4GUHA 1W1PA 1L0PA 4X2RA 3TVAA 2PDPA 3GR8A 1OK6A 2Z25A 4XZMX 3WDIA 2PSNA 2ZRXA 3NDYA 1XDJA 3QW3A 3AMCA 1UQYA 3VNYA 3IGUA 1SPQA 3GVWA 1VFMA 2BG5A 4MWAD 3HQNA 1P0NA 1M41A 3CAVA 8TIMA 1NWUA 4Q4KA 4HOZA 4BQ3A 3QMTA 3TZNA 3VCRA 2BX7A 3K8MA 1MW1A 1NWSA 2CERA 4MPKA 4Q4PA 3FEMA 3SIMA 5HXMA 3UPBA 4DUXA 4P8WA 1XG4A 4JTAA 1UROA 3PPCA 1W17A 2GZXA 1W32A 4E8CA 4MKSA 3W71A 2DUXA 3RIKA 2R1LA 2CFFA 2WCAA 4XZLX 1POKA 4NAEB 1VJIA 2WLYA 1EGVA 4LBRA 4N6EA 3RLGA 3SAZA 2UV8G 2E6DA 3I7QA 4AX6A 5H8MA 1AH4A 4FHAA 5BOOA 1A5CA 1L2UA 2HNEA 4E0CA 4D6GA 3S9YA 5KINA 1ZB5A 5I7GA 1JVNA 4REQB 3UZ5A 4PEEA 3T0DA 3KTSA 1E40A 3TYZA 4EE9A 3D3AA 2ZCGA 3BAWA 3VABA 4JFWA 2GSHA 1OFQA 1K9FA 4AZCA 4MAZA 2GGGA 4L9XA 1W3IA 4UTWC 1OFDA 4Q22A 1YNQA 5M1TA 2NQLA 3MZ2A 1JPKA 5GNYA 4XTDA 5FF7A 5HUPA 3WDPP 4NXKA 1UP2A 4ZB0A 3CUJA 1ZUAX 4ZOBA 3JR2A 4LBUA 1FHUA 3A4AA 4HYWA 1SSDA 2WCGA 1ZHAA 2Y4SA 1XC6A 1O12A 1TE6A 3VNJA 2D23A 5A8PA 1UR8A 3VDCA 4HHHA 3QV7A 1XRTA 3LSCA 3TP4A 2FVKA 1QOPA 4RZ5A 2Z1XA 2DT0A 1ME8A 1EQPA 3L4WA 4LRTA 4GIEA 4FP1A 2W67A 2CPUA 2GWNA 3PSVA 4LVAA 3N34A 5I00A 3OLDA 1YPIA 4YNGA 1RLCL 2GOUA 2WMJA 2CBJA 1Y65A 3EWWA 3AHXA 1Q85A 3WLMA 2NQHA 2FB3A 3KCLA 4I6KA 3W7OA 4ZB5A 2IPWA 4D6JA 4CCZA 4Z2KA 1P48A 4HVXA 1JYNA 4IIHA 3TX9A 3QR1A 1G5AA 2X41A 2J24A 1AH3A 4S3CA 4XVEA 2NX1A 4A05A 1MUCA 3ARSA 3EWBX 4RNHA 4WZHA 3WEOA 4NNAA 4FIQA 3CUZA 3CTLA 5I24A 4XV0A 5AZ1A 3HO8A 3VGGA 3EXTA 5A6AA 2VFFA 3VKCA 1VYSX 1ZBWA 3NL6A 3L9CA 3A4XA 3STFA 2DJLA 1A47A 1ONWA 2ZE0A 2X1SA 5AN7A 2UY2A 4BF7A 5A6BD 1VD6A 4O57A 4NAFB 2IQ0A 1F6YA 2RGMA 3VU2A 3L23A 1PS9A 2G4FA 3DXIA 2G96A 3RO8A 4S2CA 2O55A 1BWLA 3O63A 4C90A 1MXSA 4GJ1A 5C9UA 2VELA 1CXLA 3FDKA 3RX4A 1RXOB 2EKGA 1GW9A 5T9BG 1KQYA 3N9RA 3QMRA 2PODA 1LROA 4QRNA 4J28A 5J5DA 3DG3A 1GYLA 3N14A 1K4HA 3CGTA 2CHRA 1XFCA 3BGGA 4I5UA 4GPNA 4DYJA 4IGHA 1H4PA 4MWAC 4DBUA 2WK2A 1JZ6A 4S3GA 4XKYA 4LOCA 3BJTA 1MZRA 1W1YA 3LNMA 3NQCA 3KM8A 3ARYA 1WXJA 3WQPA 1ZAIA 3N29A 3FK4A 4DB7A 3WLSA 1UKSA 4EF8A 3W22A 3S6OA 1RK6A 1XDMA 2D0GA 2GJPA 4RZBA 2VM8A 3OU8A 3THUA 3FYOA 4GXWA 4CQCA 2QCGA 3EXSA 3WQDA 1VR6A 1JNDA 3EOEA 3LGEA 3LV5A 2C14A 4FALA 4H8UA 3WIJA 1HG3A 5JBEA 5C5YA 3OGVA 1Z7AA 3BCJA 1TV3A 4ZO8A 4DJFA 1NVMA 3LRLA 1PUDA 4ZQRA 3SO7A 1BRLA 3O2LA 4URIA 3PBVA 2VQUA 4AD1A 1SFLA 3O3RA 3OBKA 4KQNA 4EF9A 2Z6IA 3FW6A 3OQ8A 4JICA 3EWUA 3UW6A 3QKEA 2C1IA 2GQ8A 3DIPA 3C5QA 3FIGA 3L12A 5MHBA 2WJDA 2PBGA 3FGCA 4GNJA 4LW7A 1KV5A 1H1NA 1P0EA 3WBEA 1M01A 2RJHA 2GVLA 4D2JA 2C6QA 2ZKMX 4FLRA 3E02A 4ASTA 1FWCC 3QPYA 2DT2A 3IWPA 2RHGA 4A21A 3W37A 4AZHA 1LORA 3SURA 3W23A 4QEHA 4YHEA 4NHVA 3CAKA 4WJ8A 2CLKA 3HURA 3S6DA 3VC5A 2VRKA 2WBKA 1EH9A 4HCDA 4I7VA 4IQJA 3LRMA 3QKZA 4OE7A 2PS2A 4B92A 3B0VC 3FSTA 4CQDA 4HBKA 5FESA 3D6NA 2YL5A 5FEWA 1VQTA 4PE8A 4FXSA 2PDMA 2ZUTA 3M47A 1TPUA 3H53A 1T41A 3UA4A 4H6QA 3N18A 3W81A 2YXOA 2FMNA 1CEOA 4O8AA 2Q09A 1BKHA 3VOCA 2NSOA 5HPCA 1A3WA 1NWRA 1V6WA 1R46A 4GOAA 1I2RA 4ZBCA 4RXGA 4D8ZA 1XIEA 1SFSA 4GVGA 4AW7A 1H5VA 1PKMA 4RE4A 1OX4B 3W6LA 1R9YA 4JN8A 1GVFA 1W9XA 4L7ZA 4UQAA 1FWAC 4DJFC 3S1VA 3V18A 3N12A 1VBGA 1KM1A 2RGLA 3BW3A 2WKJA 5DFAA 1DJWA 3PC0A 4BI7A 4O4WA 1C8YA 5C2CA 1XYCA 3PZNA 3WH9A 5LNSA 2GLKA 4DWSC 4BJHA 4DRSA 1FH7A 1W5NA 2P10A 4HYRA 5F2MA 3E38A 3G1FA 1QWKA 2FMOA 3N2TA 1E55A 1PCKA 3BH4A 5L6UA 3VUSA 2EXOA 4G5DA 1V7AA 3R25A 3N2CA 3BMWA 2ZWYA 2XVKA 2VZOA 1TVLA 4Z2GA 5D37A 1FWBC 3XINA 2YPIA 5BXPA 1OZQA 4JPGA 2EF9A 3P8JA 3QGKC 1GK8A 4W8LA 1QJWA 4MSSA 2BMBA 4XKYB 2JALA 1V93A 2DW7A 5I78A 2OWCA 3KOYA 5I6SA 1Q6EA 3TYCA 5HATA 3KEHA 2WAGA 1WAUA 3KL3A 1Q3NA 1TTJA 2YW4A 1REQA 3G1YA 1OC6A 2VQTA 3SJNA 3TIMA 2AAAA 3W00A 2RJGA 1AL7A 1IT7A 1KRBC 2INZA 5CXPA 3ITXA 1R3SA 2B7OA 3WMCA 3M5YA 5EFDA 1B4EA 3WH8A 4NQ1A 4JIIX 1DE6A 1UKPA 1TIMA 2Q02A 1QVBA 3M5ZA 3U7VA 1TPB1 3BE7A 3UZJA 5IBXA 3SRDA 1NARA 2QJGA 3HG3A 3EB2A 3P5YA 4RZ4A 3IVUA 1E56A 2RH9A 4Y9OA 1JQVA 3DESA 5GPRA 5IDIA 2DQWA 3QY8A 1Q4NX 1QPNA 4CCCA 4C60A 2Y61A 1AK5A 4JD4A 2OOGA 3BLLA 4NZ5A 4JTJA 5I09A 1EP3A 3L66A 2R9RA 1WNOA 5LIWX 1FFRA 2PGFA 3CQJA 3N6QA 3REQA 1MNZA 2IS7A 3S2NA 3KRUA 4GFSA 4Z1CA 3IV3A 3A3WA 1WZKA 3WLRA 2ISVA 4LTSA 2E9MA 1FUYA 1REQB 3NG3A 3WDRA 1F7BA 3W7EA 3C86A 1GKPA 2DDXA 1H7XA 2FVLA 4JQAA 4HTYA 1E0UA 3M0JA 4PH6A 3BJFA 3OZPA 3PZOA 1S1RA 1WYIA 3QFEA 2DZUA 1EHNA 2EKCA 3HQPA 3AXHA 4IG2B 4KFNA 3MHFA 1MWOA 1YBQA 4LFYA 3TJXA 4N2YA 4TUFA 3GU1A 3L4XA 5DY2A 1ENUA 4XSLA 3MYPA 4KF1A 1XYAA 2TYSA 5CGQA 2PMQA 1OX5A 1QWGA 2XSBA 3PTKA 8CGTA 2VX7A 4IQEA 2NX9A 2XG9A 1TUFA 1YMYA 1G7UA 4XKMA 2J9YA 2UY3A 5IXEA 1UH3A 3MCOA 1G4EA 3GDBA 3RJXA 3LN3A 1B0IA 2E9LA 3LLXA 1CGVA 2XN2A 2ZZ7A 4AZ5A 1OD8A 4HMNA 2XN1A 1TJ0A 5D9PA 2VHLA 3URNA 1KGXA 4O12A 3TKFA 2ZRZA 3VD3A 2QCEA 1G9HA 1XINA 5D30A 4NKCA 5CSYA 2W9MA 3AMLA 1UB3A 1V08A 3GK0A 3PUDA 2E25A 3AXMA 4O8RA 4LGXA 1KKRA 1TSIA 3C56A 2UBPC 1PKYA 3CIVA 2CHNA 4XIAA 1FCVA 3QW4B 4YIWA 3VD5A 3LV6A 1FKXA 3B97A 3L2MA 1OFOA 2GJNA 5F2LA 2VC6A 1VPXA 2O9RA 1GONA 3AOFA 3NQBA 5K9XA 1L8NA 2E5CA 3BSMA 4GD0A 3W0KA 4FS9A 1KBIA 1HL9A 1Y5WA 3VDBA 3QH2A 4JTKA 3O7UA 3UEQA 2WNQA 2OELA 4GXPA 3W01A 1H49A 2PP3A 1FOBA 4XIMA 3T05A 1CXIA 2VGBA 4HPHA 4GKTA 4L9YA 5TNVA 2ZC1A 2WJZA 3OO2A 1PKNA 3A21A 2LLEA 1UWQA 4AG0A 1MFVA 1XRSA 1AW2A 4J35A 1EX5A 3EDJA 1J4EA 1H50A 4JFVA 3L67A 3FFSA 1BTMA 3FXYA 4LEFA 4H6KA 3EOSA 2FTWA 1GTHA 1M68A 1GVOA 4JL2A 4K3ZA 1OF6A 5CCZA 3RM8A 4QAIA 3T4CA 3QHOA 2Z26A 4JEQA 1AW5A 5BXRA 2WHLA 3W7MA 2DFAA 2J7CA 1C8XA 3GG8A 1O66A 3P62A 2QKFA 4JQ1A 4EPDC 3LEPA 1FHDA 1X7FA 1W3NA 2GL5A 4XQ6A 3GTNA 5IHRA 4IWWA 4H7CA 4MNKA 4PN2A 1O4UA 1CYGA 6XIMA 1CX9A 3D0CA 3NGJA 3ZZ1A 2EPNA 3CH0A 2PCQA 4RX0A 4QQUA 4JNMA 3TNBA 2Y8UA 5A69A 3OJGA 1PZ3A 3CU2A 3EX3A 2WNNA 3VI2A 1SZRA 2CBUA 4LYKA 3IRSA 4HSOA 3VOGA 1UWUA 1IXPA 1C29A 4A3QA 2NVDA 1Z3NA 3GDRA 3UXIA 5ABFB 2VEMA 2WSYA 4K8GA 3E1F1 2GVJA 4LXFA 4H9ZA 3S83A 4I7UA 1FTXA 3TN4A 4B9YA 4IL2A 3W38A 4IMCA 3QV8A 4GUIA 1DKWA 1IWPA 3MCNA 1J0IA 1QO2A 4UMBA 3PF3A 2ISWA 1VC4A 2J7EA 3TOPA 3C0QA 3HQ1A 1W1VA 5K4XA 5JVLA 1CB2A 5D02A 2AL1A 2BOGX 3GH4A 2V5LA 4JTEA 3S47A 1JAEA 4CU6A 4IIGA 4LUTA 1DWHM 1W9DM 1W54A 2XH4A 4GJJA 2PGRA 4LYPA 3UNTA 3LPGA 3SB0A 3QPZA 5K9CA 4NAFA 2YIHA 2O0TA 3PB0A 1TX2A 1EJSC 4ACZA 3OP2A 1IEVA 4L1XA 3AS1A 1QK2A 3NQEA 4C1KA 5CZKA 2BY2A 2X1UA 1TQJA 4WUIA 4PMXA 1JZ4A 3W28A 4JY9A 2H3BA 5H91A 4MDOA 1MW3A 3BL3A 2XVPA 1KRMA 3MJMA 4JKLA 4US5D 1E1CA 5DCDA 5DMYA 3OGSA 5A6TC 1T40A 4Q8VA 3CHCA 1PDYA 2ZICA 1EPVA 1C9WA 5XINA 5C9ZA 3UJRA 2W27A 3MUIA 2IKIA 3UY8A 3V75A 5CSUA 3BDKA 3LK6A 4AMCA 1QCWA 2AQVA 3ONBA 3N6JA 1GORA 1QW7A 3KBJA 4GVIA 4TMBA 3CH9A 4P2VA 5FCZA 3BAIA 1EZWA 1VIZA 3EA1A 1U5HA 3PP7A 2ISSA 3BCFA 9CGTA 3GIPA 4GY1A 3GS6A 2KZHA 1UD3A 3UCQA 3BUVA 2B7NA 1UQZA 3VIIA 1J96A 4XX6A 1HJXA 1HP4A 5HK4A 4GQGA 5C9WA 1J5SA 1J0YA 3OLGA 4MHBA 3WQ8A 4WEVX 5D8WA 3LMZA 2OLHA 3RR1A 3BWWA 5CJ5A 1PIGA 5G2WA 2ZWZA 4U5IA 2YDAA 1EXPA 3PNUA 3I7RA 5AFDA 2NQJA 3MMTA 4NI8A 3CHDA 3FGCB 3B8UA 2J4GA 1ITXA 4L4OA 5RUBA 1KCZA 3TR2A 5H6HA 2QPSA 3AS2A 3EEGA 3WLIA 3HA1A 4E5TA 3M41A 3BV7A 1BQCA 2J9XA 3IVTA 2WVSA 3P5ZA 3LHTA 3CV6A 4QQ3A 1JPMA 3L5MA 2DSVA 4M6VA 4AYSA 4K68A 1F5ZA 1FRBA 5D2YA 4ZQOA 1EGMA 3LQGA 2QV5A 1MEIA 3Q58A 3VD4A 4ICMA 5D04C 2QUUA 1TMQA 4FPSA 3WF1A 4YTSA 1HFBA 2E3ZA 1KXQA 3QM3A 1V6XA 2GQ9A 3C3UA 1W3LA 2NXGA 4J3ZA 3CT2A 4KWOA 1ECEA 2Z2BA 4DM2A 2A21A 2W0UA 2WB5A 1VENA 3DYPA 7CGTA 4I9MA 5FD0A 1X97A 3VIGA 4AC1X 3MSYA 4GKLA 1P7TB 1JPHA 5FL1A 1OSEA 1UA3A 2XZ7A 3KCOA 1UMYA 4C1LA 1GVYA 1OX4A 3T1GA 1D8CA 4W8AA 4GI6A 4Q8MA 3WJWA 4BHYA 1K8XA 2XH2A 3FHQA 3BQ5A 1QHPA 3PK7A 1Z8AA 3NZGA 2PDYA 4PMDA 1H1ZA 1W5MA 4GYPA 3G1DA 4KEUA 5CJNA 5B7YA 1BRLB 2NVCA 1PAMA 4P7QA 1EA0A 1GVSA 4QR6A 5JBDA 5F4XA 2FFIA 1RZMA 1O68A 3UZZA 1P0BA 2X7WA 4LBSA 3QZAA 3MMDA 3NM3A 3GTIA 3KHJA 5BW6A 1Q6CA 3ARUA 3W25A 4PCFA 3GSMA 4QSFA 1W1B1 1QI0A 1F6KA 1XYBA 4MUPA 1SFTA 1DJIA 3KAOA 2XIQA 3OGRA 1R7OA 4HB7A 1YW1A 3UJEA 3SW6A 5C71A 4EXBA 5K4ZA 1CXHA 5LXEA 3DHPA 2XFYA 5EGRA 3MZNA 4PMYA 4UTTC 1BG4A 4FAMA 3ZSSA 1DWIM 4NX5A 5D05A 1EUNA 2JKAA 4CU7A 3PFMA 1XR2A 2OO0A 5EU9A 3GR4A 2VFGA 4K7YA 2DP3A 4C1NA 3C52A 4MJZA 3VIHA 1OVDA 4KMQA 1J12A 2CHOA 1V3IA 1WAWA 3STEA 3ITLA 4M7TA 4QJ4B 1GTEA 1YDVA 1U5VA 3WG6A 4HPJA 4F48A 4E4FA 4ERIA 1PVNA 4S3EA 3SUTA 5DMLA 4ZR8A 1HT6A 4Y9NA 1EOMA 3SY1A 3NZPA 1YIXA 5EMYA 4EAMA 4QG6A 5LXXA 2GVGA 1BYAA 4K38A 1HKMA 3UG5A 1KLZA 3TOYA 3O06A 3TWAA 3SZ8A 3TW6A 1BG9A 2UY5A 3G0XA 3H7VA 1FWJC 1H62A 1T96A 4JQ3A 5AVNA 3UPWA 1TV4A 1R30A 4PR4A 2GGHA 1R87A 1BTCA 3UZXA 4UTIA 4CNUA 3T9PA 3WEMA 1WDWA 5KMYA 3LXAA 5XIAA 5IFPA 5PTDA 3UF9A 2G3IA 2WVUA 1C8VA 4JHMA 1DWAM 3ALGA 3DZ1A 3HFYA 4OIFA 3TTSA 2PDKA 1ONRA 3MPGA 1QR7A 3W83A 3ZJ6A 4D6HA 1TR1A 4IOTA 4IIEA 3GG1A 2WW5A 3B9DA 3W53A 1MYRA 3LM3A 1SZEA 4EWJA 3M64A 2HDJA 3W4RA 1XYFA 1F3EA 3DC0A 1LRQA 1B3WA 3E0VA 2Z00A 4E4UA 3WL1A 2OYKA 3IIVA 3V0SA 4XUGA 4DWDA 2OT1A 4ERAA 3AU2A 3QY6A 4IXHA 3GNOA 3DFPA 3QYQA 2F6UA 1R86A 1XH0A 3S46A 1RPXA 1G4TA 2ZZ3A 1E3ZA 5C0QA 3QSRA 1QPKA 2ZZ5A 3K4DA 3IIZA 5HWJA 2GPTA 4FZIA 4EOUA 3PPHA 1FA2A 1T8QA 4W5ZA 4WRHA 1MNSA 2Y6ZA 5C2XA 4FLOA 1N2VA 1QTWA 1E6PA 2OLSA 2HSAA 4Q8PA 4HN4A 1LG1A 4ZEPA 4ZCWA 4GY7A 1SW3A 7TAAA 5D9OA 3DYMA 1AW1A 3A5VA 1TZ7A 1VFLA 4RK8A 4W89A 1GEHA 3L5AA 3GIQA 3H24A 3IUDA 2OPJA 5GJMA 1W3KA 3VK5A 1KFKA 2OT0A 4IISA 1IGSA 4NZJA 1R7AA 3WZ0E 4X3ZA 1E1FA 1PYFA 4I7WA 3N2XA 3RYSA 3RFAA 4MOZA 3GB6A 2IKGA 4BZYA 3MTWA 3GDTA 2D22A 3CJPA 4PMZA 4R3UA 2NW0A 1B57A 4MGGA 1M7XA 4MZYA 3SI9A 5AYZA 1F07A 3LYEA 1RQEA 3ANVA 4GISA 5F2IA 2ABBA 4C65A 3KP0A 1H7NA 1GGOA 2WQDA 4QAWA 2WVVA 3WUBA 2GJXB 3KP1A 3AZSA 2QUNA 1KFEA 1P0KA 2JKEA 1H41A 3FS2A 1E9LA 2A85A 1L9WA 1QRQA 2C91A 1A5SA 2A7PA 4LAZA 1ZZMA 4TOQA 2OU4A 1JGMA 2VEFA 4Z08A 3TN5A 3H4GA 3ZOAA 4JGDA 4FF5A 4HTBA 3TYBA 4AXKA 3U48A 3TWBA 2RUSA 1GOQA 1BXCA 2CEQA 4IM4A 2Z1KA 1YBQB 1BVWA 1KM3A 2JBMA 3Q4DA 4OUIA 1S2VA 3U6WA 4F9DA 4CNPA 4S39A 4Q7IA 3G1SA 4JOMA 1CNVA 1B4KA 4NRRA 1Q13A 3U2EA 3GVVA 5I03A 5AC8A 5FJJA 1HTIA 3NCOA 1F3TA 3MUCA 3VCNA 2B7QA 3NZ1A 1B1YA 1TTIA 3WD1A 1J0KA 1Q5MA 3GBEA 1JCMP 2QCNA 1GEQA 4FXFA 3DHDA 3AXIA 2AKMA 4IPJA 1NFGA 3AUOA 4ZGYA 3KHDA 2XPKA 1R47A 3G24A 2I7GA 1SR0A 2E0PA 4D8LA 3LU2A 3UNDA 3WQCA 1TYGA 4NYYA 1O1HA 3SRFA 2XIOA 1LL6A 3EWZA 4C6KA 3MI2A 4MNJA 4O53A 3WBYA 3GTFA 1KR1A 3WQWA 1JCYA 4KESA 1O60A 4AY8A 1AQFA 1L6YA 4GUGA 1WZLA 5ECVA 1GKRA 3GC2A 1B9BA 4AC7C 4DO6A 1OB0A 4U33A 3BZGA 3U4FA 1ZRQA 3LBMA 4GJIA 4GGHA 2W4XA 1EIBA 4B15A 5D09A 4W9TA 1E6SM 1K8YA 3IIPA 2VDHA 3TMLA 4AD3A 3BJSA 1W2PA 3NO1A 5BYWA 2CWXA 3LGGA 1R5YA 4O4VA 4X22A 2BV9A 3EWXA 4FA3A 2FHCA 5H2ZA 3P0XA 3GIYA 2HPIA 3L65A 4S3FA 5G4WA 1CECA 1K9EA 4PYSA 1AH0A 1ZFJA 3MCMA 1UMLA 1V5XA 3TW9A 3ZQ9A 1R38A 5DBTA 1SW7A 1RY8A 5DO8A 1Q6FA 1RV8A 1D8WA 1WX0A 4FK9A 4L61A 4LY4A 1HN1A 2J62A 3CL6A 1WZMA 4O50A 1ESWA 1IWBA 2HBXA 2J13A 3T2PA 4UFMA 2XJ7A 1JUBA 1TREA 1WDRA 1KM5A 1OT2A 1C90A 2QCCA 4LV4A 3CUIA 3PTMA 2VRJA 2V5KA 3ITTA 2R14A 5JXQA 4D71A 5LNRA 4WY0A 4FI4A 4JY8A 5AYBA 5G4HC 1UA7A 2QIWA 3A47A 4JX5A 3W1MA 5I23A 3FVDA 2V3FA 3B0YA 3RK8A 1NM9A 1S1PA 3PNZA 2CIPA 5LIXX 1E1CB 1U83A 5HNUA 1TJPA 3AROA 1CXFA 2PA6A 2F61A 3N3TA 4YTUA 3PBMA 4G2DA 3M6DA 3AIQA 4Q33A 2R1MA 4RE3A 1RVGA 2E7FA 2EG7A 1CGUA 5F1VA 3FEQA 1E0WA 4HPXA 3W02A 2POTA 1S46A 2YLLA 3HPAA 4NNCA 2FFCA 4GCXA 3DENA 1HKIA 3TR9A 4GH1A 3JZEA 1ZLPA 4RPPA 3IJIA 4OTKA 3RITA 2C1HA 3GDKA 4D8AA 3N4AA 2BVDA 1C7TA 4U31A 4Z2IA 3HFTA 1LZOA 4AEFA 1HKJA 2YLAA 3N15A 3LUTA 1TRDA 2H3DA 3FJLA 1S5WA 2RAGA 3H2AA 1Q8AA 3BV4A 5EMMA 3CXOA 2DU2A 3GXPA 3WMBA 4M56A 1JUKA 3KZPA 3HPZA 1X1NA 1B3YA 3ALFA 3B04A 1KO0A 4JTQA 4ZFMA 3GE7A 4BI6A 3BAYA 1XC4A 2FQIA 2ZTKA 4GZ7A 1WQ5A 1BVNP 4X9SA 3VGFA 4DPQA 1JDFA 3FNDA 2I57A 4ALDA 1XKJA 2VRQA 3VIMA 1TA3B 4QSHA 1XQKA 4ERGA 2RDUA 3BLFA 1W3TA 4WCJA 3CHFA 3ABQA 1LOQA 1V6VA 1DBTA 1DYSA 2R91A 2D0FA 1Q63A 2ACQA 4ILSA 4PCTA 5G2HA 5A2CA 3WLQA 4M81A 4Z1BA 3R0UA 1F8IA 3WLTA 3AALA 5HMFA 1UPMB 2V5BA 3WELA 4A3UA 3VNDA 6ALDA 4GI9A 3VNMA 3EYPA 1UR9A 1KTBA 5FJTA 1VBUA 5EFFA 2YB4A 4QTGA 2Z29A 3F5LA 5BXSA 4UOZA 2QCFA 4UZSA 3GO2A 5DLCA 1OINA 4A3RA 3WJSA 3CAWA 3JRKA 2VDGA 5EL1A 1K02A 5HWNA 4ZTYA 1JFHA 1TPDA 5LZLA 1A49A 1FX6A 3U5YA 4ZSTA 4O1EA 3N6HA 1ISZA 5A1AA 4YVXA 1BYDA 3EAUA 3KX6A 2A2IA 4RW5A 4NG3A 1EJ7L 3TFXA 4L1WA 4PUUA 1QK0A 2Z28A 2J79A 3MO4A 5HJYA 2VJXA 1B3OA 3RG6A 1OD0A 2F2KA 5CPQA 4GYJA 2WMFA 3PN8A 3VNIA 8XIMA 3AIVA 2VUYA 2AGKA 3V5OA 1GYNA 1KFBA 3KZSA 4H01A 3MSRA 5I06A 4MLJA 4PTXA 4KCVA 4HZ6A 2Z7GA 2EJ1A 3VGDA 1H60A 3WMSA 4N02A 3NQGA 2I56A 2Y5EA 3APTA 1DHPA 4BCEA 1XLKA 1W6TA 3BG5A 5FSEC 2PWUA 3PZIA 1H2JA 1HVXA 3NXLA 4FXJA 4OT7A 2WBGA 1B2YA 3VFLA 1V4YA 2JGQA 5U7SA 1V77A 1CI1A 2DORA 1TCDA 4W5UA 2PRLA 3KBWA 1EC7A 3PR2A 6CGTA 2OTDA 3DFTA 2E77A 1ZTVA 4RJEA 3K8LA 5JIPA 1UUQA 2BSLA 4KEVA 1X8FA 3DERA 3W2LA 2FHBA 5D9NA 4K8EA 1F9CA 3LCIA 3CZLA 3T0AA 5EBUA 1UYQA 1SGJA 1H1YA 4AVOA 4UTWA 1PEZA 3NQ8A 3LLFA 1G69A 2DGAA 1G0CA 2GFTA 1TRIA 3AI0A 3VMPA 4DM1A 4WK9A 4V2XA 4Y90A 3T8LA 3INPA 3GY1A 4FNUA 3ZR5A 2X09A 3RAOA 1V79A 4KS0A 3GDMA 4GHRA 1W3HA 1TIWA 4O16A 5FEPA 3PJWA 5ABEA 1J01A 2PC4A 4B4HA 2BGQA 3IIXA 1WUFA 2HWGA 3MQTA 1X6NA 4WR3A 1E0TA 1ITUA 3QV9A 4G1KA 3PBGA 4Q4RA 2YDQA 3T81A 3PSWA 5ABGA 1D7KA 4MZ8A 4ADSA 3WNKA 3MWCA 1RR2A 3CZEA 2OJPA 4HU0A 2XIBA 4MB3A 1KQZA 1JXJA 2QR6A 3B9NA 1QNRA 3BGAA 3GNXA 4O18A 3BMXA 5I3HA 1WDQA 2FB2A 4I3GA 2A79A 4FR1A 4HN8A 5HNTA 5DRIA 4NILA 3AWNA 2UWFA 1V8EA 4PSPA 2Z2UA 1FCQA 3UR2A 3MB9A 3URBA 3LTYA 3GAKA 4B4FA 1W8GA 2WPBA 3SQSA 3TU9A 1XP3A 3R2GA 4GC4A 4CD4A 1M7OA 3AIEA 1K3UA 3C61A 3GVQA 1IEQA 3ITOA 4YCPA 3ARTA 3ZIZA 4GYKA 1Q66A 4GUFA 3U9IA 4RKAA 5B7ZA 5AC4A 1A3XA 1V7YA 3SY5A 4HHMA 3EXRA 1GQNA 4CU8A 3C2RA 4FOUA 1WKEA 2CLFA 5D38A 2ZA3A 2E8ZA 5F4WA 3WLOA 3BOLA 1UWSA 3S2MA 2YFOA 1XD1A 1W2VA 5BU9A 2VDIA 1J11A 4B3KA 1LL4A 2BS9A 5GNXA 2KAUC 4Y7EA 4Q4OA 2VNCA 2YL9A 4MZ1A 1AQMA 1MQQA 1R3WA 4JXCA 2BASA 1EDTA 3EOLA 5CLWA 3I6EA 3FLUA 3CASA 4WKFA 1GJPA 3MHGA 4B3LA 2WKLA 1GVEA 3MI6A 2OB3A 1UD5A 2PDJA 1N55A 1ZNNA 1XM3A 4AHQA 3QEZA 1GPFA 3N4FA 2Q8LA 1KBLA 4C6IA 4PZVA 1S39A 2VFIA 1LM1A 1Z89A 3UESA 1EC9A 2ZXBA 4ZL1A 3SCSA 4I5RA 3WQOA 4NU7A 3WQVA 3QQWA 2FDSA 1FCBA 1NOFA 1OCBA 5E9XA 4NZFA 1EP2A 2OO6A 1R3QA 4OOUA 3CPUA 4JN7A 4JYDA 3DI1A 2FGZA 2JEPA 3CAQA 4IGNA 4HCHA 3OODA 1BHGA 2AL2B 1U2YA 3UERA 3GR7A 1UWAA 4FMVA 4PMNA 2RDTA 1UZDA 1PIFA 4AXNA 3UT0A 1HJVA 1P1XA 4RUBA 3BGJA 3VD9A 1YE4A 2YL8A 2NWRA 1ZS2A 2HTMA 5LGZA 3G8RA 4K37A 1HNYA 1M53A 4KKXA 2IQTA 3I65A 3KWXA 2Y7EA 1XLBA 1O95A 1Q2RA 2OKTA 1JDDA 1SO4A 3QGAC 3OW1A 3W2NA 2E8YA 2YZ5A 1JG9A 5KZ6A 4N9EA 1IZJA 4Q7BA 4UNKA 2J7GA 4RV3A 2CZVA 4LVGA 2BNJA 2XSXA 3S9ZA 1ODZA 5E6ZA 3WDJA 4J40A 4PL2A 4YS1A 1W5PA 3PBYA 5JUVA 1W8SA 2GQ3A 3PG8A 3TZFA 1BQGA 1NY1A 3I7SA 1G6CA 1PPIA 3QXBA 3CZJA 1GG1A 2XFWA 1TMHA 4QITA 3B8IA 3HF3A 3HBLA 3AU6A 3EOUA 3LHUA 1XUUA 2FH6A 3SRKA 3TV8A 3IGHX 5C7VA 3TQVA 3OVRA 5C8BB 5LNUA 5AHFA 3LOTA 1KTNA 1L2QA 1KFCA 1C93A 5AECA 2GYIA 4P8UA 2CBIA 3KOZA 4LAOA 4LNYA 4TMCA 2EPOA 5T8GA 1BF6A 2CW6A 3WQEA 3E0IA 3DFNA 3BK0A 1HKKA 3F4WA 4ZE4A 1EIXA 5MKGB 1IEXA 1SZGA 3HGRA 3VKDA 4B5UA 3L0KA 3GH7A 5HJXA 3MANA 3E0LA 1QPRA 4HA0A 2HRWA 1H11A 4TU1A 2J27A 2PDNA 3GTXA 5EKYA 4QCFA 1QAPA 3LG3A 5F4SA 2IKHA 1LRTA 4UTTA 1JDCA 1RJRA 5CGTA 2FYMA 4ATWA 1D3HA 1Q6RA 3TW7A 4IPPA 2A4AA 4AY7A 3S2CA 3B4UA 4DAIA 4JIRA 4WX2A 3UETA 4C91A 4YTRA 2W61A 2J88A 4DJDD 2EHHA 4MYXA 4YL2A 1GVRA 4O14A 3M0KA 3PJTA 3Q37A 4R53A 3GVRA 3WH6A 1V3JA 1TELA 2XVGA 1V02E 3AYVA 1ME9A 3NGFA 3DGBA 3G22A 4WJXA 1TWZA 4B5SA 3C3NA 1E4MM 4HNNA 1W9BM 4HMDA 3HU7A 6TAAA 5HQLA 4HA1A 5D33A 1IT0A 4AD2A 3B3DA 3DKLA 4HSHA 4HU8A 1FY6A 2FZNA 2P3ZA 1XLEA 4PCSA 1EA9C 4AUBA 4AIEA 2J7HA 1BYCA 2VX5A 1QHOA 2QAFA 1QW9A 5HWMA 2ZDRA 2I9UA 4WY0B 2Y5JA 1WCGA 3ABZA 3NQDA 3C8FA 4PEKA 1JRBA 1XLDA 4JDBA 4CD8A 4TXEA 4UCFA 4AVFA 2HCVA 2P88A 1MZHA 3HZ3A 2AMXA 3EPNA 3GW3A 4OQVA 4AEOA 2DUAA 3L68A 1FVPA 1XYLA 4ICNA 4JFUA 2DVXA 3ZMRA 3D5HA 4PB4A 3LGDA 1CXEA 3MYOA 3AZTA 2A3LA 1TV2A 3IUHA 4CD6A 2J8FA 1HGYA 2CU0A 3IARA 1NFBA 2DQXA 5TF0A 3SCWA 1IZKA 1CBGA 1UHVA 1OYAA 3S1UA 5IOBA 3C0JA 4ZOCA 3OA3A 4F0KA 3EWYA 3W9ZA 1EDGA 1A0EA 4AAJA 2Y2WA 1KGUA 2G3NA 3H70A 2WMIA 4JX6A 5FJRA 1H7RA 5G1MA 3BLOA 4NP7A 2GUYA 1MQPA 3W7CA 2QCMA 2VC9A 5U4NA 5C2GA 1OCQA 5CKSA 2HE8A 3LZ3A 5BRPA 3RGTA 4A3YA 8A3HA 3T08A 2E1WA 3ZXWA 1E6QM 2NQ5A 3IACA 1Z42A 2ON3A 4WQ6A 1EPXA 2IXUA 1OJXA 1MUWA 1RALA 3WKZA 2PZ0A 3WENA 4UIOA 4Y96A 2OSXA 4JTLA 5E70A 5E1QA 2H8ZA 3KBMA 3ISIX 5CBBA 5FJPA 2GDVA 3ITGA 4TV5A 2R24A 4LSBA 1CZ1A 2FH8A 1EOKA 1PHWA 3T4WA 1AQHA 1AMYA 2H6RA 3SN0A 3BAKA 4IMDA 3DDMA 3VA8A 4KEMA 3VE7A 3WNOA 2HBVA 4D72A 4KRTA 1N8WA 2QMJA 3MKKA 4Q4MA 2BHYA 4DBEA 2CZ5A 4DJDC 1K77A 1LL7A 1VJSA 4PUDA 2OQYA 3TK7A 1U1UA 4PTVA 4PCNA 4MY1A 4ACYA 1ICQA 3PUOA 4V27A 1RY0A 3CEUA 3ZO9A 1QOQA 3ZVIA 3DG6A 3U5UA 3M0IA 2GK1A 3OZOA 1IR2A 1IXNA 4ZSUA 3EB4A 3BAXA 3RJYA 3U2CA 2EPLX 1D3GA 2ZC8A 4H9XA 4BF5A 3MUAA 3RM9A 3BW4A 4P5UA 3V0TA 3VDHA 3TTQA 2FZ9A 3BANA 1DWGM 2HEJA 3TDFA 2ZADA 3Q2DA 1U30A 1WB0A 1UIPA 5M3WA 4ATLA 3AHYA 1CLXA 3MU7A 1H0GA 3WBWA 2ZRVA 4Z1YA 4ENLA 3WLHA 1D7FA 1ISYA 2A3CA 1QASA 3LXBA 4P61A 5JMUA 1GG0A 3L4UA 4UMAA 1DHKA 1OBAA 3CBWA 2BVTA 3V0UA 1RPKA 4QG8A 1JZ8A 1ELSA 3JZUA 4AYGA 4I5XA 2X16A 1VEMA 1UBSA 4JTDA 3K4WA 3VE9A 3TQPA 4O13A 1XISA 4KT2A 1SVDA 1IEIA 4F0MA 1B3ZA 3WK0A 2FLIA 4NSBA 4E3VA 2WWCA 2TODA 4L9ZA 1V0KA 1J0HA 2PDHA 1YHTA 1VYPX 4QLJA 7PTDA 3F4CA 2WSKA 1VBHA 2IUZA 4HJWA 1YNPA 3F5KA 5CPSA 4W84A 2VURA 3ANYA 4IICA 3N3MA 5IBXC 2NUYA 5E0CA 1JDEA 2OODA 1XL9A 3V1HA 1GCYA 1DL3A 2GDQA 5CPTA 4U3AA 5FAJA 2VR5A 5AHLA 2NV1A 2XVLA 4R88A 1AD1A 2FPTA 1XF0A 2AKZA 2NX3A 1UBPC 3AHVA 3FSUA 3TONA 4NASA 1JR1A 5REQA 4LT9A 2PTZA 2OKOA 3B0XA 1TWWA 3MP4A 2CLHA 5IRPA 4RE2A 3Q45A 4AZGA 3T6CA 3SGGA 2ZRWA 3AIRA 1E6XM 4GUJA 4QGCA 4EX4A 5JQ9A 1UWIA 4MIMA 3IJQA 4ZMGA 2PDFA 3WQ5A 1BLIA 4OOZA 3L7RA 2J25A 2CESA 1KGWA 3SCTA 3O0KA 2Q6ZA 1O6IA 2E9BA 2NSXA 1E70M 3ZWSA 1ADDA 1P6BA 1MSSA 1S2AA 1SZFA 3VOFA 5BRQA 1Q6OA 4CNNA 2BZNA 2PGWA 4H8VA 3OQEA 2YDRA 1A5NC 1DXEA 3FXGA 5FJOA 2CKRA 3P14A 2X7VA 3H26A 3NM1A 1LOSA 3AISA 3MC5A 4G6CA 4LUTB 2OSYA 1XKYA 2G3MA 3POCA 1LP6A 1EF2A 4NJKA 3W7IA 1RA0A 1TZ9A 4HOXA 4PB3A 4M6PA 2REQB 2YCLA 3W6YA 4OHQA 3W7PA 4KETA 3IGXA 1Y8BA 1FH9A 1S2CA 3W7KA 4NRSA 3AWOA 3EKZA 5A6MA 2EQDA 2VCBA 2XH7A 5H8UA 4IP7A 4NI3A 3MWAA 3NFUA 3MBFA 4M24A 2OXNA 3BAJA 3MKVA 3S6TA 2ZA1A 3O0FA 4JQ2A 1EJRC 1AQ0A 1TFVA 3P84A 1W91A 4PRRA 4UTFA 1K1DA 3KTXA 4EP8C 1VLWA 3MBDA 1NQ6A 4KGJA 3W7HA 2ZVIA 5CG7A 4JQ4A 3AS3A 3B4YA 2PWVA 4YMZA 2G50A 4DZIA 5E6YA 2QJIA 2YKKA 4UUIA 4YHGA 3HPSA 4XWUA 5AY7A 5LYRA 2ZUVA 2WJEA 4IIFA 1EO5A 5LNVA 3OEXA 3U2OA 1ME7A 4V1XA 5KZDA 1JZ3A 3M44A 3DU0A 3T44A 2ZYFA 1CCWB 3LXCA 1OQFA 1IWAA 4L4PA 2BY0A 3F4VA 1GOMA 1TWSA 1XSKA 4HMCA 4R7JA 3F2DA 1BGAA 3LHWA 1NFPA 1EYWA 2UY4A 3VNKA 3N11A 4PFMA 1UD2A 4XD4A 5LIYX 1FP8A 4WXYA 4CN1A 1DJXA 3BTNA 3T0TA 1O7AA 4MNMA 3LBOA 3N2OA 1QI4A 3UD6A 3SM0A 4QS5A 3OVPA 5BCAA 3PZGA 2J77A 4CD7A 4KW2A 3SDOA 1YTEA 3EKLA 7TIMA 4OWGA 2YZRA 3ABXA 2FDMA 1CDGA 1EJXC 3TE9A 3M6YA 1W37A 3SGZA 5LA0A 1OK4A 1WPCA 3R7MA 3DKJA 4YVVA 3H21A 4DYKA 4AWUA 1LT8A 3P8IA 3I10A 2J9ZA 1VHNA 3CT7A 2HMCA 3ITVA 4HK6A 1OX6A 3PAJA 3W84A 4CN6A 1RCQA 3ID7A 2DW6A 2FZBA 4ZO9A 2GJRA 3C2OA 4DI8A 3JS3A 4XAZA 5FIPA 2QNEA 1NP2A 1I75A 4ZENA 4Y2WA 5HNNA 1CTNA 3RLHA 4QROA 3R43A 3PTDA 4WVXA 3BG3A 2WZHA 1DTNA 1O94A 2V9DA 2YA1A 2VL4A 4EXAA 5DT7A 1E6NA 1DWJM 3S8HA 5LIUX 4PSRA 2BHUA 2HVOA 3UJFA 1TX0A 5CZJA 1OADA 4NL1A 3A24A 4AY1A 2X42A 3APYA 3VIOA 3NYZA 1ZAJA 2QUTA 4OV9A 4Q8QA 3NOEA 3MUZ1 1V6TA 3CMJA