4LAOA

Crystal structure of cordyceps militaris idcase h195a mutant (zn)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cordyceps militaris IDCase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 135
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4laoA00
3TN3A 3O7UA 4BKNA 2PUZA 1A5MC 1RK6A 3IACA 2OGJA 4EP8C 4V1YA 1J5SA 4XAFA 3QGKC 3N2CA 4TQTA 3HPAA 1XWYA 2DVUA 2GWNA 2WJFA 3MDUA 4IGMA 3T8LA 2Z7GA 4IG2B 1YNYA 4ERIA 2OB3A 2ADAA 1EJTC 3HM7A 4NG3A 2G3FA 1PB0A 1FKWA 2RAGA 4H9XA 4G7EB 4IQJA 3ISIX 2HBVA 4D8LA 2HNHA 3S2MA 2FVMA 2QT3A 3CS2A 4GC3A 4GX9A 4LANA 3PBMA 4GBDA 1P6BA 1YIXA 4XD3A 4B90A 3GIQA 4R7WA 3R0DA 4IGNA 4JOMA 1FWDC 3EWDA 4GY7A 1FWEC 4LFYA 1J6OA 4L6DA 4KETA 1YRRA 4P5UA 4YIWA 3F2DA 2Z29A 4DZHA 2Z4GA 2OODA 2A3LA 4DZIA 4QTGA 4C6FA 1POKA 2D2HA 1A4MA 4J35A 1EJUC 3F4DA 4BJHA 2PGRA 1RK5A 4PBEA 3LGGA 3MPGA 3MTWA 3MVIA 4DYKA 3QGAC 3BE7A 4R85A 1JGMA 3RN6A 4KEZA 3ID7A 4HK6A 1RJPA 5FSEC 2WM1A 5HMDA 3OOQA 2Z24A 1KRAC 2Z2BA 4LALA 4H01A 3QY8A 1M68A 3AUOA 4B3ZA 3GG7A 3O0FA 1YBQB 3TN6A 4LCSA 1V7AA 1J6PA 4EPKA 5LXXA 1EF2A 4KEVA 4R88A 1PSCA 4KERA 2VC7A 4RDVA 4C6LA 3GRIA 4F0SA 4B91A 3S2JA 4HJWA 4OFCA 1I0DA 1FKXA 2AMXA 3TNBA 1FWIC 3EGJA 4IFOA 4ZSTA 1IE7C 2Z27A 4HK5A 4GOAA 3CAKA 3UBPC 4IFKB 2E25A 4RDYA 1DPMA 4QROA 2AQOA 1EJVC 3IRSA 3A3WA 4KF1A 4RZBA 1V51A 3TN5A 4CEXC 1O12A 2W9MA 1V77A 4GX8A 4L9XA 2AQVA 3SO7A 3GUWA 4KIRA 1M7JA 3B0XA 2R1LA 3HTWA 3GTXA 1EJWC 4WHBA 3S4TA 3DUGA 3LSCA 1RJQA 4EPDC 4DIAA 4ERGA 3E0FA 4C6IA 4IF2A 4LAMA 2YXOA 4XAYA 4F0RA 3B40A 3PNUA 4IFRA 4CQBA 1EJSC 2WJEA 2I5GA 1FWBC 1P6CA 2OQLA 4XD6A 1A5NC 2PAJA 2Z25A 4C6NA 3NURA 4C5ZA 1R9XA 3GU2A 1POJA 4DNMA 2Z28A 1WXYA 1PO9A 4KESA 1V4YA 1VFLA 2FTWA 3QY6A 3UR2A 2VR2A 1QW7A 4RDWA 2Q09A 3MSRA 1GKPA 1I0BA 1KRBC 1RAKA 3GTHA 2R1KA 3MVTA 3GTIA 4J2MA 2Q01A 2ANUA 3IPWA 3SFWA 4GY1A 3OVGA 1W1IE 3LGDA 4NP7A 3IGHX 1UIOA 2BGNE 2VUNA 1UMLA 2O4MA 4BY3A 3IARA 1ONWA 4GYFA 3URBA 1WXZA 1XRTA 2UBPC 2P50A 3UR5A 1FWCC 3QY7A 2Y1HA 1J79A 5E5CA 2Z00A 4INFA 2E1WA 3TN4A 3IJ6A 4DLMA 3F4CA 2GWGA 3IV8A 4LAOA 3LY0A 4NI8A 3MKVA 4H9ZA 1K1DA 4LCQA 3URNA 3UPMA 1FWFC 2EG8A 4H9MA 4C60A 3DCPA 4LCRA 2VC5A 5HMEA 3RYSA 2XIOA 4PCNA 3PNZA 1R9ZA 1RA5A 3UF9A 1RA0A 1BF6A 3ORWA 1A5LC 5A6TC 1KCXA 4XD5A 2R1NA 4LH8A 1NFGA 3OJGA 1ONXA 2OOFA 3E0LA 2VM8A 1KRMA 4GY0A 1GKQA 2DVXA 2QVNA 1FWGC 2YB4A 3E74A 1K70A 2R1PA 5FSDC 1RJRA 4UB9A 1YMYA 4CEUC 4F0LA 3KM8A 4QS5A 4C6MA 4ICMA 1QXLA 4ERAA 2KAUC 2R1MA 3JZEA 2O4QA 2YB1A 3GU9A 4HA0A 5AKQA 4G2DA 4H9UA 3E38A 3URAA 3E3HA 4KEUA 4AC7C 4DLFA 2PGFA 4C6DA 3T81A 1FWAC 4J5NA 1A4LA 1E9ZB 1O5RA 4C6KA 3RHGA 3E2VA 3GU1A 4I6VA 2YZ5A 3MJMA 1E9YB 4CNTA 3S2LA 1EYWA 3WZ0E 1HZYA 3LU2A 3C86A 1XRFA 4LAKA 4C6PA 4QSFA 2HBXA 4CNSA 3FEQA 2I9UA 2IMRA 3LA4A 3A4JA 4H00A 4HK7A 2VHLA 1XGEA 4ZSUA 3RCMA 1NDZA 4WGXA 4XD4A 3AU2A 2GZXA 4PE8A 3S2NA 2WJDA 2Z26A 2CZVA 1NDWA 2P53A 4KQNA 3URQA 2DVTA 4IG2A 4C6JA 3GIPA 3F2CA 2UZ9A 5HMFA 4G7EA 4GXWA 3K5XA 4C6OA 4CQDA 1ZZMA 4V1XA 3AU6A 3NQBA 2Z2AA 4Z42C 4H9TA 4PBFA 2F6KA 3B0YA 5CH9A 4DI9A 4EPBC 3K2GA 1NDYA 5G4HC 4QS6A 2QS8A 1A5KC 4I6KA 4C6EA 3D6NA 4QRNA 3WMLA 1S3TC 4RDZA 2FVKA 1V79A 4RE0A 4XAGA 4XAZA 3EWCA 4GK8A 1GKRA 4MUPA 3LSBA 3DC8A 3T1GA 2GSEA 3LS9A 1K6WA 4WVXA 3OU8A 2QPXA 1M65A 4DI8A 4PCPA 3NEHA 2D2GA 3FDGA 2EG6A 4GZ7A 4CNUA 1UBPC 2PLMA 4IH3A 4C5YA 3ICJA 3PANA 4C6QA 1FWHC 1PTAA 1UIPA 2BB0A 3CJPA 1YBQA 3A3XA 3WYZA 4H9VA 2FFIA 1KRCC 3PAOA 4E3TA 4LEFA 2GOKA 3MDWA 4AQLA 1ITQA 2HPMA 1EJRC 1R9YA 3V7PA 2ZC1A 1ADDA 3LNPA 3GTFA 4EPEC 4C6BA 4IFKA 4CQCA 4B92A 3OQEA 1NDVA 4DO7A 1FWJC 2D2JA 2EG7A 4M51A 2ICSA 4C6CA 3FDKA 4UBPC 1ITUA 3ITCA 4C65A 3F2BA 1EZ2A 3OODA 4H9YA 3G77A 2HPIA 1EJXC 1A5OC 2HQAA 2FTYA 3K4WA 1P1MA
chains in the Genus database with same CATH superfamily
1Q7ZA 4JX5A 3M43A 4YTUA 4LYKA 1A5MC 3STPA 3M0MA 1HQTA 3WQCA 4JFTA 2FLIA 2BVWA 4B5XA 4QCEA 1FOBA 4UFJA 4O57A 1A50A 3N6JA 4MMWA 4AVNA 2VKZG 3F4WA 5REQB 3ZJ7A 4URIA 1MXGA 2VCAA 4S2BA 4YXGA 3BO9A 1BG4A 4H9XA 4G7EB 4JTUA 3SUUA 4D8LA 1R46A 1Z41A 3FOKA 1RBOB 4PEKA 3LI1A 4W5ZA 1JDFA 2WVUA 4UTIA 5I0DA 4RV8A 1TO3A 4XUYA 1J2BA 3HQPA 3MJYA 1N55A 2Z4GA 2PP1A 4IQDA 3U4FA 3DX5A 4AH7A 1VRXA 1DIOA 3PZMA 1G6CA 4I90A 1OYAA 1IEQA 2EQDA 2X05A 2JF7A 3IWPA 4HKPA 2VCCA 3GH5A 1EF3A 3AUOA 5TD4A 1W5QA 4QQ3A 4AU0A 1KV8A 3IJDA 2C1GA 5K9DA 1E70M 3ZR5A 3NZPA 3GXMA 4LJ3A 1WPCA 2A2IA 3LB0A 1KBKA 2MANA 4K37A 5C55A 1QT1A 4LUIA 3ANVA 1MEWA 5AC8A 1UH3A 4OGZA 8CGTA 2B7PA 5FJOA 4UOQA 4E3VA 1XLIA 3GUWA 3B0XA 3CHDA 1PIFA 4AX6A 1B3WA 3L4WA 1RJQA 4PTXA 2C0HA 4H6EA 3H2NA 2ZVIA 1J4EA 3BAYA 5AVNA 1OBAA 3IIZA 3ABZA 1BSIA 2VEPA 2FFCA 5M2FX 4TO8A 3I7SA 1ZLPA 3NQFA 1EJSC 1WA3A 1E0TA 1V03A 4KCVA 3S1VA 3GXNA 2EPNA 3VDGA 1UR4A 3R0KA 3W76A 1KM5A 3BLKA 4DNMA 2KZHA 1Y5VA 4S3BA 3ZT5A 2E6FA 1GNXA 2VR2A 4A3HA 3QLDA 4Z1DA 1FDJA 1XIEA 1W1YA 1AH3A 2NXHA 3UY7A 1AJ2A 3CQ0A 2OYLA 1QFEA 4GMEA 1K9FA 3WNLA 4DJFA 1K7FA 1L6YA 1YHTA 4TUFA 1W1IE 2WSQA 1C9DA 1Z7AA 3VM5A 1G01A 1EJ7L 4ORIA 1UROA 4LSBA 3KBWA 2B81A 3EYPA 2A3BA 3H53A 4MB4A 4DAFA 4CU7A 4EOUA 2WLZA 4GUIA 5F1UA 3URBA 4JFSA 3QY7A 1G5AA 2PWDA 3AWNA 2WSKA 4IP5A 1CXLA 1QDSA 4LB4A 3LHWA 1FQ0A 1HGYA 1H09A 1FHDA 2SFPA 5JU6A 1QNOA 4GC4A 4DJFC 3K4AA 2Z1BA 3WK2A 1QNPA 3LY0A 3VOHA 1Q6DA 4DVOA 1XYAA 2VX4A 4XSLA 2WSPA 2G4JA 4OKDA 3RX2A 1IWPA 1QR7A 3H2MA 4C60A 3C2FA 1EYEA 1TCMA 1ICSA 1QNSA 1QWKA 4JQAA 3B8DA 3EPOA 4U3CA 1OYCA 1U5HA 1TWSA 3WDPP 2OYKA 5D9OA 1OGSA 1KXHA 1VBUA 4FIQA 4QLKA 4GI4A 3VZYA 1G4EA 4MSSA 1FWGC 3VVGA 3O07A 4NRSA 4N6EA 2B7OA 3P14A 4W87A 1W3HA 4HA0A 3CHFA 2L5HA 2EBNA 3C56A 3M07A 4F0HA 2BY2A 1TV8A 1AD4A 1EP3A 3ENLA 1TMQA 1UKQA 4DJED 4JTGA 5AB3A 5FF3A 3OLDA 1AG1O 3MZNA 2V3EA 2VWSA 4HP5A 4HNNA 4ZSUA 1J0KA 1ICQA 3UXLA 1OGBA 1M7PA 1TV5A 2EKGA 4R5EA 2RKXA 1FH8A 4EANA 1C9WA 1CXFA 3TONA 3LXBA 4K39A 4MKVA 2QUTA 2WHLA 1M1BA 3FA4A 4QE1A 4CQDA 2REQB 3MUAA 8XIAA 1TV3A 5TBOA 1NDYA 5A6MA 1UR0A 1SJBA 2CITA 2GGHA 3NQ7A 1MEIA 5CLWA 1KLZA 4MFDA 1PKLA 3IS4A 3VILA 3AS2A 4MNMA 4PN2A 5AC4A 1ME9A 4GQRA 3MYPA 4F2UA 3W28A 3LPFA 4XKMA 2QPXA 9XIAA 3TROA 2DJLA 1BVWA 4A21A 4JFUA 4ZO6A 3TR9A 3RAOA 4C6QA 2WQPA 1IT0A 1JULA 2GGJA 4PSRA 1PYFA 1YBQA 4E2DA 3O6AA 2XGZA 5LZLA 3N2XA 4NRRA 3ZLHA 3ZOAA 5FA5A 3T4CA 4MNKA 2YYUA 4TX9A 4CLMA 3L0GA 5CZSA 3TE9A 4JFWA 2PGWA 3S5ZA 3UA4A 3OVQA 3ZYZA 3GNDA 3W7DA 2XH7A 3H70A 2VC6A 1TTPA 3VOIA 4HZ7A 3DZ1A 4UTWA 1CXEA 1GG0A 3M0XA 1NOFA 4E4PA 1EJXC 1SM9A 2VFIA 5TNVA 1ZBKA 3W0KA 3PF3A 3UWEA 3W82A 3USZA 1RP9A 3BW2A 2IW0A 4V1YA 4UQBA 1JPMA 4NJKA 3ZT6A 3VIMA 4HMEA 4Q32A 4FP1A 4ADUA 5I07A 2QDHA 3LHZA 1FY6A 3NNTA 4QEHA 3PTMA 2G3FA 6A3HA 4FF5A 2Q8XA 3WH8A 1WE5A 4IQJA 4G8TA 1XLJA 4DWSD 4O1AA 3TSBA 1N8WA 4LS1A 4ZO7A 2RH9A 3RX4A 1YDOA 4X2PA 1TV7A 4ZFMA 2C14A 1TFVA 1SFJA 4M6PA 4DWDA 1B3ZA 2WSRA 4DZHA 1XIDA 3TQVA 2WJZA 4DZIA 1TJPA 2WLYA 4PL1A 4D6EA 3KXQA 2D2HA 1XIGA 4BR1A 1NQ6A 2QMJA 3W85A 2DH2A 3S5OA 1VFOA 3ITOA 4C1LA 3AMGA 3M4HA 4GVFA 4W7VA 3RXZA 5DN1A 3OVRA 2WM1A 3V1PA 2VDHA 3OYXA 3AYTA 4L4OA 5D4YA 4MNLA 3FJ6A 1V3IA 3O0FA 2QV4A 3FKRA 4MY1A 2XIMA 4DJEA 5JIWA 1J6PA 2XIIA 1IIHA 4KW2A 1KM4A 4F0SA 2EXOA 5CQ1A 4H7VA 4Z2HA 2GUBA 4BI5A 4E0CA 4LTSA 3HGOA 1NARA 3ABOA 2HV5A 5EU9A 3KL0A 4CUCA 3HV9A 2OEJA 2IPGA 3A23A 2DPEA 3FN9A 1W1TA 4HHMA 2OT1A 5XIMA 2QUUA 3N18A 3W9ZA 3II1A 5IHRA 3BWWA 3KBNA 1UC4A 4KF1A 4S3CA 3KVMA 1PV8A 3QMRA 1CI1A 5DT5A 2VX5A 1EJWC 4QAIA 3W71A 4UMBA 1UWAA 3ZFHA 1W5PA 4C6IA 4IOTA 4NU7A 5D9MA 4UTLA 3MT1A 1A3XA 3ARPA 3SGUA 3GSMA 3LCLA 3XINA 1S5MA 3DESA 2OYMA 1DYSA 1JQVA 2O9OA 1KWKA 1UP3A 1HVXA 1OFPA 3PPGA 3T7VA 2OLHA 3L5MA 3RRAA 1NF7A 1GKPA 2D2OA 2X09A 3U2OA 1Z48A 5CEWA 3KTXA 3L4XA 1TVPA 3GYEA 3EWBX 4JCMA 5FJIA 4UCFA 4FNRA 5HMSA 3W6LA 3TOYA 2XUCA 3I6EA 3PAJA 1R3VA 1F73A 4YTTA 3L5AA 1JEZA 1SR9A 1W3JA 3LV6A 1XL9A 3AXXA 2UBPC 2Z1WA 1Q2RA 2DSWA 3S2CA 1E1CA 5I7GA 3VKKA 3UYIA 1N7KA 1VKFA 4IJBA 3PSWA 2XM2A 1JCXA 2A1YA 1EO7A 3BSMA 3NPVA 1XD1A 5FJPA 1UA7A 4F66A 3VC6A 1EEXA 3NIYA 3URNA 3UPMA 1RHCA 4NNAA 5FL0A 2VYOA 1IR1A 4DX3A 1UR3M 3WQ4A 3VOFA 4GZEA 4JNMA 3WJWA 2WPGA 4KGLA 3O06A 4IJCA 5A8GA 1RA5A 3ZVIA 4Q6JA 5KEZA 3HGSA 2DT3A 2WB5A 3ARVA 1VBJA 1KCXA 1AQHA 1CCWB 2Z1SA 1K9EA 2QCHA 3N2MA 1KCZA 2GSJA 5IFPA 3AOFA 3CK5A 3NAVA 3UYCA 3SRFA 1W2PA 4B5NA 1P0DA 1R85A 4DWSA 3LM7A 3DFNA 4JTFA 4J28A 3LRMA 2XPKA 1Y5XA 4C6MA 3E0IA 1QXLA 4QG8A 4ERAA 3L4ZA 4AWTA 4MIMA 3GTNA 5BMWA 3RO6A 1W56A 1D8CA 9CGTA 4Y9OA 7TIMA 1Z42A 3W1RA 2A6LA 3U6WA 1OIMA 3B04A 3W7LA 4C6KA 3T05A 3WL1A 3CZEA 3S2LA 1BXBA 1HL2A 1XI3A 1AW5A 4AD4A 5JH2A 4NYUA 4JY9A 2E9MA 4A3RA 1V5XA 4JHZA 1RH9A 5LHEA 5DMNA 1E5JA 2FZ8A 3E2RA 3UR7A 5I3IA 3DERA 4NZJA 4PUKA 2CKSA 4FNTA 1QW8A 2VFGA 4C7GA 3LZ3A 2X42A 4QFUA 1UG6A 5E70A 3V0TA 1A5KC 2DIKA 1QHOA 3QPEA 1E6NA 3QYQA 1WDSA 5CPMA 3L12A 4I9JA 2VQUA 4FMVA 4LUJA 2OGYA 4MUPA 4ZB0A 3STCA 1KBIA 3JZUA 3W1UA 4K8GA 2PWGA 4E8CA 3MW7A 5CBJA 4AWEA 3NEHA 2ZUUA 2E6DA 4L65A 3GW3A 1R6WA 3UW6A 1S1RA 3KOZA 1WDRA 1LORA 1XBXA 1RXOB 1YTDA 3V0SA 3BLFA 1RCXB 3WQVA 3PAOA 2CLOA 2W67A 1W37A 3WLLA 4HNLA 2J6XA 5I03A 1QPQA 3B3DA 1OADA 3NL2A 1FXQA 3SCOA 1LOQA 1LQ0A 4A05A 3OQEA 2OVLA 4DO7A 1KD0A 1T41A 1C91A 3K8LA 5IDIA 1XIJA 2E9BA 3M46A 2FJKA 2DZPA 4EF8A 2V0TA 1P1MA 4B9ZA 3BGGA 1EZWA 2A3EA 4YL2A 3DG6A 2VO5A 4MY8A 3DFPA 1GUVA 2H6RA 2GQ3A 2WJFA 3QTPA 1R2RA 3H22A 2ISWA 3P67A 4AX7A 1LTDA 1PXGA 2WMHA 4AD1A 4QJ1A 1N2VA 4NZ1A 1EJTC 3S8HA 4AFYA 2WV8A 3P62A 2PDMA 6XIMA 3FGCA 1WOAA 1I4NA 2PA6A 3CWOX 3CS2A 4JIRA 3T07A 2J8FA 3IVTA 3OZPA 5C54A 1MDLA 4P8XA 5AOUA 3N9KA 1YIXA 4MJMA 4R7WA 2QQ6A 2J7DA 2PRHA 3MA8A 4AD0A 1VPQA 4A8RA 1E4IA 1ZGDA 1J6OA 4NL1A 3PZGA 1XSKA 4O18A 2QZRA 1NP0A 5C9XA 1OX4A 3UJSA 2BMBA 2DP3A 1H50A 3ANUA 3L2IA 3EPNA 1JFHA 4MY9A 1W32A 4V33A 2F84A 3ZLGA 3L0NA 1R7AA 4RPQA 2JIWA 2WWDA 3BAXA 3G8EA 2OG9A 1NM9A 4F0KA 4XAPA 4MKSA 1G94A 2DFAA 1XIHA 3OIXA 2WCSA 1YBQB 3AWOA 3O15A 5CC3A 4PMUA 4L5ZA 1LG1A 5JMUA 3PSVA 1I45A 5HBFA 3VZZA 3TW9A 3ABQA 4GA8A 4NY2A 3CZJA 1K8YA 3LLDA 1FWIC 4IFOA 2PF0A 2X0SA 1FP9A 4G1KA 1PAMA 1JJKA 2ZRXA 1B31A 1XLEA 3HGJA 3W27A 3CZ8A 1HIZA 2A7RA 2FZDA 1E0UA 2C79A 1UKPA 2XSBA 5G2WA 1LWJA 1HXJA 1ZAJA 5AHLA 2Y8KA 1VCGA 4OU1A 2DW7A 3C2RA 1XYFA 2NV1A 4EWJA 1R3TA 3VYLA 5AHMA 1DJWA 1KXTA 2CFFA 3AS3A 3TYAA 4LAMA 1VF8A 2DZVA 5G4EA 4BWLC 1EPXA 1FWBC 2PTWA 3D46A 3PY2A 1E1EA 2YIHA 2E9LA 3UR2A 3PUGA 2P8CA 3QV8A 4J3XA 3M0IA 3NCOA 3UZ5A 3QOMA 4HU8A 1O4UA 5F2LA 2PDPA 3O6YX 3TAKA 4V15A 3W7OA 3FFSA 2VURA 3FXGA 2NXIA 3WNPA 4JS3A 4MNJA 2INEA 4ZOBA 2ZA3A 1L0PA 1QI0A 1IEVA 1XRTA 2P50A 4IIFA 3ZS4A 3R8GA 1YTEA 1GOXA 1QPNA 2ZIDA 4TVDA 4ZOEA 4JTQA 2HTMA 5FAJA 5DXYA 2VGFA 3VO0A 1GEHA 3PG8A 2OWXA 2V9DA 1D8WA 1K1DA 3MMTA 3QR0A 4PRWA 1ISZA 1E4NA 3DAQA 3QSRA 2V81A 4YJ5A 2VDIA 2O0TA 3PZIA 4KCUA 4W7WA 2DIEA 3NQEA 4B3KA 1YDVA 3CIXA 3LYEA 2J4GA 3Q58A 1RA0A 2EPMX 4ZB5A 3U7VA 4K38A 4QR6A 2R1NA 1FBAA 3EKGA 4Q33A 1JD9A 1VLIA 1ADSA 2Y62A 1PIIA 3BAWA 3WNOA 3AHYA 4AXKA 4PRTA 1TMLA 2QGYA 3V5OA 4HNOA 4L64A 5I3FA 4CN1A 4UB9A 4GBUA 1ZTVA 9RUBA 3WBEA 1WKFA 3M7WA 4AIBA 4MM1A 3G6MA 2PGFA 4C6DA 4A3YA 1JGIA 3H6OA 2VTFA 3N34A 3MC5A 2OKOA 2PD5A 2I7GA 1HZYA 4LNCA 1DIDA 1UR8A 2YCEA 4P2VA 2J77A 1RCQA 3EDFA 4FO4A 3SCTA 3A4JA 4FR1A 4HK7A 1P1XA 3MI2A 1XYZA 5F7UA 2CBUA 3S2NA 2ZOXA 3QVQA 2C13A 5EGRA 4KCTA 2E09A 2P5NA 3CIVA 3SQLA 3WH7A 3ME3A 4JN8A 1DJGA 3I68A 4MWAE 1ISWA 4YTQA 3SM0A 1BHGA 3H2AA 3VFLA 2F7FA 4Z42C 1E9LA 2IQTA 1L2UA 4Q4OA 1KB3A 4UC5A 3D6NA 3C61A 4UTUA 1E1CB 3O2LA 3UG8A 2NQZA 3GXTA 2POZA 1OGGA 3SI9A 3VKJA 2NQ9A 3TYEA 3H24A 1F3WA 1L9WA 1GVIA 3CQKA 3HMJG 3GE7A 1XYBA 4AD2A 2PWEA 3VCCA 2IPFA 3DFOA 2CBJA 4CU8A 4H7CA 3VMPA 1JI2A 1XFBA 3KP0A 2QKFA 1AK5A 2QHAA 4JIHA 2VZTA 2CLFA 1XH1A 2PC4A 2BLEA 2D3NA 2PDYA 1JPHA 2VOTA 2ZVRA 1PS9A 2DSKA 5ECUA 4QDWA 2YDSA 3MUY1 1L6GA 1R86A 5LIKX 4DWSB 3KFTA 3APYA 3AIUA 4I9AA 3THDA 5IDZA 3KLLA 6TIMA 4ZOAA 1TPB1 3KRSA 3AHTA 5FJUA 2PDHA 5I23A 1E6XM 1ITUA 3TAOA 1JUKA 1W9DM 4CN6A 3PZ9A 1LL7A 2J9ZA 1S46A 2XN1A 4KWOA 1Y7VA 5K3VA 2QNEA 4XBSA 1C8YA 1NF0A 3IIOA 2BOFX 3T0DA 1ZP4A 3KBSA 2JK2A 4XZ9A 1GZJA 2OT0A 5FF0A 4Q3MA 4AY1A 3UU0A 3HPAA 2X1SA 3B05A 4YWIA 2FMOA 1ML1A 4IGMA 1HJVA 4HA1A 3OHIA 3IIVA 1S2UA 1TJRA 1YNYA 4LNYA 4D9PA 4XG1A 1GJPA 2P88A 3WLMA 2HNHA 4GBDA 2CC0A 3V5CA 4IGNA 2EJAA 5DLCA 4GY7A 2FZBA 1MMFA 4LFYA 4PH6A 1YRRA 2OSXA 4NXKA 3TCEA 1J12A 1VENA 2OO0A 4UQDA 2YLAA 1MNZA 1CXHA 3SCNA 5KZEA 3PN8A 4I5XA 1ADOA 5A6SA 2NUXA 2ZKMX 5D9NA 2ZXQA 1JGMA 5A6BD 4O0QA 2E40A 3CL8A 2XJ7A 3QZ6A 4HSNA 2ZTJA 1DVJA 2Z2BA 3TJIA 1JF6A 4LAZA 4XZNX 4AZ6A 4RNFA 1ALDA 3WFZA 5LXXA 2ZDRA 1W0MA 1VJZA 2PTYA 3BOXA 1G9HA 4F4RA 4HJWA 4WCJA 3FHAA 2J75A 1Y0EA 4O52A 1G67A 1FWNA 1AL8A 1IE7C 3QV7A 1H11A 2JKPA 4CU6A 1S39A 2VOMA 3TW6A 2FJUB 3NA8A 4J4KA 1JUBA 4WSJA 4JICA 4PUUA 4V2XA 1XYMA 2QW5A 4Z0JA 4GIRA 4W89A 1EKOA 1W2VA 1PZ1A 1U30A 3IGSA 3E1F1 3E0FA 1R8LA 3KHJA 4LU0A 1W8GA 1OB0A 2BZNA 3R11A 1X7FA 2GL5A 4RE3A 2G50A 3DGRA 2FYMA 2PAJA 3VIGA 1FP8A 4JTAA 4X9SA 3DECA 1KFLA 4OWGA 5E9AA 2FTWA 2PZNA 3FGCB 4ILSA 3UZWA 2Q09A 3VKCA 1YEYA 1TJ1A 5DCBA 3KL3A 2OJPA 1EO5A 2OXNA 1B5TA 3KZPA 4XO7A 2W79A 3AMCA 2O55A 1XGDA 1G4PA 3FYYA 3WQPA 4JY8A 3TEVA 4KRUA 2W0UA 1F6KA 1OX4B 5G2IA 1CX9A 1NSJA 3EX2A 3GNOA 4DRSA 1KGWA 4LW7A 1B9ZA 3RMJA 2DZAA 1XIIA 3ABXA 3HU7A 4L56A 3WEMA 3ANYA 2D1ZA 2I14A 1QI5A 3CYVA 1B54A 3I3DA 1H7XA 4TOQA 3IJ6A 4HD5A 3DHFA 4EAYA 4HCHA 1US3A 2ATSA 4AVFA 1V6VA 2R94A 2OU4A 2PWVA 4PUEA 4N4PA 2QDDA 2QCMA 4RR4A 3HB9A 3A22A 1EDTA 3G0SA 2Z0IA 3CEUA 1GHSA 4GO9A 2ACUA 5DF0A 2OZ3A 2PDGA 3NFUA 1R9ZA 4W5UA 3CO4A 5PTDA 4EKJA 4FOUA 4GACA 5FD0A 5A6TC 4MWAD 5CG7A 4O1EA 4EK7A 4PUJA 1DJQA 3WDRA 1UJQA 3QW3A 3KEHA 4TV6A 3KUMA 4OV4A 3A5VA 2ZUMA 1CYGA 1UKOA 4KKXA 1VLWA 2WMKA 4RLIA 3V4BA 6ALDA 1NQKA 3HQ1A 2Q8LA 3ZR4A 1S1PA 1V6WA 4JFVA 3URAA 1RLDA 2OLSA 4R53A 1UD3A 5BZAA 1FWAC 4J5NA 1E9ZB 4KCWA 5A94A 4I6VA 4RZ4A 4KFPA 1XP3A 2YCKX 2VHLA 1OG6A 4OT7A 4TIMA 3FJ4A 2C71A 4FNPA 3S46A 3TZNA 4O17A 1E72M 2A79A 1BYDA 4ZQRA 4L9ZA 3T2OA 2PGEA 3RCYA 1BKSA 2DQWA 1JRCA 3A64A 2ZZ6A 3MO4A 1O95A 1K02A 1WZAA 3VU2A 3WLKX 4G56A 2TRSA 4IWWA 4PZVA 1OC6A 4N42A 3DI0A 3KVJA 4QRNA 5FEXA 2QIIA 3CASA 3L68A 2CLPA 1PDZA 2J78A 1ZJAA 3M0YA 4EIVA 3LS9A 2PLKA 3DHPA 3FCPA 3L21A 2Q71A 2D2GA 3IJIA 1VPXA 1EX5A 3OYZA 4GGBA 4JIPA 1EDGA 1OCJA 3UGRA 1PTAA 2VMFA 4CCCA 3FJNA 5G1TA 3GLCA 3LBOA 4PMDA 1RPXA 2VEMA 4A2RA 3QHNA 5KMYA 5TQLA 2BOEX 3P0XA 3W73A 3BSHA 4GI6A 3GTFA 4GQGA 4UXDA 3S6TA 5C71A 1FWJC 1FCUA 5KINA 4WZHA 1U33A 3R10A 1VJSA 4C65A 1EZ2A 3OODA 1F6YA 4YTSA 3A47A 4A29A 3SN1A 3TN3A 4MKNA 1XQLA 2E0PA 1KFCA 4LWWA 1EPVA 1HT6A 4GHRA 3N2CA 3NZGA 3VOCA 2H90A 4ZE4A 2C8NA 5JBEA 1Q3NA 1DL3A 3CO8A 2HDJA 1A47A 5JIPA 1Q6EA 1CGVA 3S3GA 2G5WA 2RAGA 4HYRA 4UIOA 3VAVA 2CESA 2HBVA 2FVMA 1TIWA 1XLDA 1NEYA 3MWAA 1T0OA 4JQ3A 1FWDC 1OYBA 3B8IA 4WLCA 3C8NA 4IPJA 2QF7A 3EDEA 4MWAA 3T08A 1BQGA 4N9DA 4IMCA 3ABRA 4ZQPA 1X96A 3BICA 5EYWA 4YYCA 1Q8JA 3UR8A 4Z2JA 5CGMA 4P61A 1JIBA 4Y96A 3W37A 3GBDA 3LGGA 1QMLA 1B4EA 3BE7A 5BXTA 1CBGA 2TYSA 1J18A 1P0KA 5T91A 4MFEA 1GVEA 1VD6A 3P0WA 3GK0A 4UCGA 4MWAC 3VFCA 5LIXX 1P4CA 5E9XA 1FTXA 2OEKA 2XIBA 1QNQA 1PJ9A 2CZ5A 2VZOA 2XWEA 4HHHA 3RPMA 5CC5A 3A13A 5BROA 4YMZA 3OVPA 2WC3A 2YCIX 5D03A 2J7CA 3B9AA 3UT0A 5HPCA 1EJVC 1KV5A 3A9BA 4LF2A 3UWZA 1PTGA 4JQ2A 2RDTA 3U0HA 3S0CA 2YFNA 3RFAA 2W9MA 1SU5A 4I5UA 3NZ1A 5A5WA 4N0RA 1SQ7A 3IK2A 2FDSA 4IMAA 1SGJA 2VEKA 2GPTA 3H7VA 3W7PA 4P7QA 2DY3A 3ITGA 3H12A 5BRBA 1XDJA 4W9TA 1TPEA 3O6DA 3N73A 2XTKA 3OP2A 4N7QA 2PS2A 1VB9A 2WJEA 4RW5A 4XTIA 1SR0A 3TMQA 5A3HA 3LOTA 1CGWA 1AJZA 4AWSA 2Z28A 3PK7A 1JZ2A 3IVSA 1XR2A 5LGXA 3O0KA 3QY6A 1SYTA 3B4YA 4RDWA 1PX8A 3IJ7A 2GQAA 3PWGA 1W8SA 1MW3A 2VJXA 1H0GA 4ZO9A 3VOJA 1PKYA 1YQ2A 7CGTA 1GW9A 1DXEA 1KGUA 2V5DA 3B03A 3OEXA 1EBGA 4JTTA 4Z2KA 1Q6CA 3VNJA 3C2OA 4ORMA 5HNUA 2O4MA 4TXEA 2WM0A 4BF9A 3RLGA 4JN6A 1KM6A 3FYOA 3A9IA 5E5CA 2ONEA 2FZNA 4RV3A 2XISA 1LCOA 2WBKA 3WLJA 4U31A 1I8JA 4JEJA 2C16A 5C70A 2B0MA 2NX3A 3SDOA 3TC3A 3WH9A 5CSYA 3NM1A 4FXJA 4OJYA 5F2GA 2WYSA 2PDQA 3ES7A 4OZOA 3E5PA 2XVLA 3H8AA 4F8XA 1ZALA 3H2CA 2WBGA 3EAUA 1YPIA 1YW1A 1GPWA 2FIQA 3RU8X 1O5QA 1WCGA 4KS0A 3LLFA 2CLEA 1P0BA 2W61A 4AC1X 2WKLA 3WD3A 5ECVA 1ZFJA 1AW2A 2V2HA 2OELA 2OOFA 2VZVA 3HPZA 1XLBA 4QM1A 2WZHA 5CZTA 2VELA 2QVNA 3PUEA 3PZQA 3EPMA 5L6UA 3KS6A 2GUUA 2H3BA 4LVAA 4UOZA 3NQAA 1DQWA 5LNUA 4HPXA 4AAJA 4MF4A 4WDWA 4LGXA 3LEPA 4PUNA 1E6RA 5E6ZA 1BWVA 2J24A 3W7KA 1Q85A 2YDRA 2E5DA 2HMCA 4K68A 3ZJ6A 2Q02A 1ITCA 1GHRA 1U83A 2VZUA 1V3LA 4GZIA 4LAKA 3GC5A 3TFXA 1UUOA 2RGMA 3M0JA 3LA4A 4OQVA 4UTFA 3EMQA 1AH4A 4K1GA 4GG9A 2CLLA 1LT7A 3IIPA 4RJEA 1XIBA 3PUOA 3LK6A 3BDKA 2A4AA 5AC6A 3B0VC 3I65A 3W1PA 4FNQA 4HOZA 5CZJA 3WDQA 3AIQA 2AAMA 3G3DA 2I57A 2QJIA 1UZDA 1UKSA 5H8UA 1LOLA 1OCBA 2QYGA 3MI6A 3N2BA 3LI0A 3CZLA 2FVKA 3KBVA 3TJ4A 4Z1YA 3LHYA 1GKRA 3SRKA 5HK4A 1R3QA 1UD5A 1HG3A 2C19A 1SJCA 4GXPA 1XHGA 2JKEA 1OC5A 3CPGA 3LPGA 3E9AA 5BWFA 2AGTA 2PF8A 4GZ7A 2ACRA 4IH3A 4C5YA 1B4KA 4WKFA 1SZNA 5I3GA 3LTPA 3VCNA 1HL9A 1MYRA 3G1HA 5L9FA 3E6EA 5C8BB 3G1DA 3UEQA 5BCAA 2QJGA 1KCKA 1EXBA 3C3NA 2J25A 4GIYA 3TA9A 1Q4NX 4WR3A 1JZ6A 4M24A 3WSUA 1OT1A 4Q8PA 5E1QA 4GRSA 3XIMA 4S38A 2VGGA 4J3TA 4KWUA 1L6FA 1JCYA 4XIMA 2RJGA 4LF1A 3HFTA 1EA9C 3P93A 4AIOA 5J8LA 1SZGA 1HKJA 2ZICA 4O15A 4XZWA 3LCIA 4RZ5A 4UWMA 3HG5A 3QN3A 1HKMA 4DUOA 1I1XA 1QU4A 1VRDA 3M0KA 4TTGA 3WQOA 2PRMA 4X9YA 5IRPA 2CETA 2F6UA 4H19A 3SCUA 3MDUA 3I3BA 2Z7GA 5A2CA 1RQBA 1HNYA 5A95A 4LEQA 1ICPA 3WH6A 1RV8A 1P7TA 1V6UA 2FQIA 2WNNA 5I5RA 1DJXA 5BXRA 1QI3A 4GC3A 3U4AA 4QQUA 1JZ7A 4W7UA 1GONA 4GQ0A 3UPWA 1H4PA 2ZE0A 2YA2A 4PL2A 2NQHA 4HOWA 4IUGA 3KWXA 3ARRA 3GH4A 4H4IA 2E8ZA 3CMFA 3BLDA 3VPLA 1KLYA 4JHMA 6XIAA 3AS0A 1OM0A 4QBXA 2VWTA 2WKGA 3ZT7A 2ZX6A 1EJUC 3WUFA 5D02A 3MVIA 3MWCA 4FIRA 4PB5A 2YR1A 3H2EA 3OGSA 4JKLA 3P8IA 3OBEA 4YCOA 1X38A 3DIPA 1A5AA 3NWRA 2OWWA 5D2YA 3SCQA 1TREA 3FIGA 4GIEA 1SPQA 2ZE3A 1TPUA 3T0CA 3GNXA 3CB8A 1S2AA 4EAMA 3IK4A 5JBDA 1EF2A 3TYBA 1V0NA 3M0VA 3W25A 4OFCA 3QZEA 5HWJA 3IJQA 3KL5A 2CKRA 1V0MA 1VEOA 3AXKA 1A3WA 1M7XA 1X39A 4RDYA 4S2CA 2O9TA 3GFYA 2O9RA 1EIXA 2VX7A 4E2VA 2ZYFA 5BXPA 7PTDA 3EX1A 3BV7A 1TSIA 4IXHA 1QW9A 2Q6ZA 3FNDA 4GKLA 5CC6A 2VRKA 2QCFA 1FDYA 6CGTA 3S4TA 4YPJA 5I02A 3EXRA 4LC6A 1XLAA 4RZ6A 4MDPA 2CLHA 1CPUA 2BOGX 3DGBA 5D33A 2WK2A 3MUZ1 1SSGA 1V6XA 3GFXA 4AD5A 2ON3A 4C5ZA 4Z2GA 4LBRA 3IUHA 1V4YA 2PCEA 3VGFA 2XFYA 3PZTA 1EH9A 4XBJA 1I0BA 1LWIA 4WXZA 4R9OA 2J47A 2GUYA 3LPPA 1OQFA 5I06A 4HIBA 4MWAB 2IKIA 4NP7A 4NNCA 3TQPA 4J1OA 5CPOA 1W5OA 1UJPA 3AIWA 5C7VA 2HCVA 3WLQA 2NSXA 4BY3A 3WIJA 1V7YA 4GYFA 4CCDA 1TVLA 3NYDA 4IIDA 2F61A 3LNMA 3TN4A 3LMZA 3VE7A 1MRAA 1A80A 5G5IA 3R79A 2NWSA 4ZENA 3SR7A 4LYRA 2O56A 2X2GA 3W26A 1LQAA 2OWCA 5DRIA 1ZENA 2C0AA 1ZY9A 3N1AA 4K36A 3VD5A 4JTKA 4GYKA 2Y0FA 1XXXA 1XF0A 1K7EA 1WXJA 1MQPA 1WKYA 3AIEA 1WX0A 4FOJA 3OGVA 1BXCA 5LNRA 2X1UA 4RNIA 1I2NA 1EOMA 1SFSA 3LENA 4ZEPA 1W31A 3GS6A 4S3KA 1JRBA 3TSDA 2NQ5A 2DZWA 2XG9A 3W7MA 5DMYA 3H7UA 3L7RA 4J3ZA 2TPSA 3ZO9A 4NHVA 1OX5A 4BZYA 1I2PA 5HUOA 3KRZA 1A53A 1UOKA 3EDKA 1PCWA 4ACZA 4U10A 4L4PA 4OTKA 5CZ0A 1FH9A 1T6MA 3V75A 3WZ0E 3N04A 5BWAA 4Q4KA 4YCPA 4HJFA 2TAAA 3BVJA 2B31A 2HBXA 1FDZA 4QDMA 2R14A 4M19A 5CPTA 1NDZA 1GQJA 3L23A 3ZMRA 4GZJA 4Q6XA 3W1NA 5JXQA 3G0UA 3M41A 1JFXA 2QJNA 2D0FA 3NG3A 1ELSA 1MO0A 2C7FA 5GPRA 2GVGA 5EMUA 3CQHA 5CXPA 1IZCA 2GDQA 3W6MA 2ZUTA 3AAMA 2EPOA 3WY1A 3W72A 1I9CB 1MZRA 4QS6A 1LBMA 2QS8A 3OTRA 1XBZA 3QGVA 4YVPA 4IQEA 1MFUA 4B3LA 5HR7A 4RDZA 5A2BA 4UQ9A 4TVCA 2OSYA 5C7HA 1KW1A 1Q45A 3TC7A 4GXMA 1FA2A 1VR6A 4GCAA 4W8LA 4K7VA 2P3ZA 2FH6A 1XUZA 4FNUA 1M65A 4ZQCA 1EDQA 5K4XA 3W7EA 3S5SA 1DEDA 2BTMA 1HX0A 4A22A 1EUAA 3LX9A 2BY3A 3PWAA 1UIPA 3QMTA 1OWQA 3QV9A 3ELFA 3KTSA 4M7SA 4AB4A 1Y5WA 1VYRA 5HQEA 4LY8A 4ZTXA 4PMYA 3LCFA 3MANA 5IBXA 1XIMA 4E3TA 3QEZA 4ZQNA 4HT3A 1JDAA 4RL3A 3V35A 1SSDA 3EWXA 2QCLA 4NX0A 3IRDA 4ZE5A 4JTJA 3GQYA 2WSYA 5I3JA 1KFKA 3W2KA 1AZ2A 3TTEA 2FGLA 1R87A 5AHEA 5I6SA 1H7WA 3B97A 4MZ8A 3BANA 4RXFA 4GH1A 3TR2A 4L1XA 1V3JA 1X7IA 2HQAA 3QFWA 4WEVX 2GDVA 8RUCA 4EWND 3GXPA 1EC9A 1WZMA 3E2QA 2Q8ZA 1UD6A 4XAFA 1GJUA 4TQTA 4GI9A 3ARYA 1NWTA 3LGEA 4HU3A 3KBJA 3HM7A 4PC8A 1F2JA 4JTCA 1RY0A 4HGXA 4CNPA 4CCEA 3UZZA 3L0KA 3ZIZA 1CTNA 1QBAA 1A0DA 3R25A 4WJEA 3QBUA 3UXAA 1BYCA 3NO1A 3UJFA 4QAWA 4Y9NA 4M6QA 1KC7A 4WRHA 3N14A 3B9OA 3CV6A 1ZJHA 3W2NA 4J35A 4PTNA 2PGRA 3UESA 2PD9A 2VCBA 3T42A 1ZRQA 1GOMA 3K13A 3AIRA 4R85A 1NOWA 1NIUA 3LN3A 4TVUA 3TX9A 3VX1A 2J74A 1RJPA 3DBPA 3OOQA 4FAMA 5CGQA 3G1AA 2G97A 1E55A 3NL5A 5BOOA 3RIKA 4D6JA 3NOYA 3CM4A 3D47A 4EPKA 4UQEA 3KOFA 2GVJA 4O1FA 4I5RA 4BS0A 3S2JA 1I0DA 1GZ1A 2W62A 1O60A 2FGBA 3WD4A 1F74A 3RITA 1JCLA 2G41A 2ZXDA 1A5SA 2C1HA 5LYRA 2RDWA 1E4LA 5FF2A 2ATMA 5HR6A 3FLUA 2VGBA 1DV7A 2ZUNA 4M80A 1UWUA 4KFNA 1I1WA 3SCRA 1ZAIA 3OBKA 2VNCA 1VYPX 4PTDA 1HTIA 1Q8AA 3Q4DA 3PTQA 4ZXLA 5FEWA 4IP4A 4NZ4A 4XD6A 4LUTA 3NQVA 2Z25A 4D8ZA 4PUMA 5MKGB 3WQGA 3GNNA 4MUZA 4KESA 1IF2A 3SAZA 3IANA 1PPIA 1P7TB 4UTTC 1J2WA 3CIWA 2VD9A 1XFCA 1H41A 3GZAA 2JKAA 2NQLA 5AN7A 2V2CA 2H9AA 2OX4A 4S3JA 3SFWA 3AXMA 2QAPA 3VD3A 4AY7A 3OIHA 2XH4A 1SMAA 1A5BA 3ATZA 3FK4A 3I4KA 3PB0A 4WKHA 3APGA 2PTDA 5I2UA 2NQJA 3IARA 1Q6RA 5D2XA 3L66A 3ZWSA 3TK7A 3WL0A 4E5TA 1WDPA 1J79A 5A1AA 2E6AA 3OZYA 4HYVA 4GUJA 4U28A 4CNNA 4B4HA 2TSYA 4OIFA 1E3XA 1PVNA 2GWGA 3JR2A 1IHIA 4AZIA 2XSXA 1QO5A 1Q6GA 1CWYA 3MKVA 3HO8A 2E6YA 3CEPA 1TB3A 1TV2A 4W8AA 4A35A 1W6TA 1VC4A 3CQIA 3WK3A 2GK1A 2E68A 3AC0A 5FESA 3R5EA 2YXGA 2X1IA 4ZQOA 2VC5A 3E2SA 3RYSA 2ZCGA 1XRVA 4F2BA 4FA3A 2YL5A 1UPPA 4DJFD 4FZIA 3C4UA 4OBRA 2QAFA 2I5IA 3UJ2A 3ONCA 4P7NA 3ZJKA 1NFGA 3CUZA 3UZYA 3N6HA 2VM8A 3FAXA 2PU0A 3F03K 3MKKA 3BG5A 3P5YA 3UWQA 1W9UA 3JU2A 3E74A 1K70A 3AXIA 4U5IA 1JYVA 2V67A 4YYFA 1QRQA 2C6QA 1YYAA 1SZFA 1UH4A 4H2CA 3EOEA 3KHDA 1GVRA 4WXYA 4DLFA 2DT2A 4E8DA 4F40A 3H2FA 3SN0A 2V3GA 3KOWA 4Q8TA 1IXOA 1ZSXA 2G96A 1S5VA 3DFTA 4EE9A 2XVNA 7REQA 3GC4A 1J9YA 3KCJA 2HE8A 4DHGA 4ONVA 2WOQA 1XM3A 4MADA 4FXSA 4Q8OA 1J0IA 2WVVA 4GVHA 3M44A 8TIMA 1V0KA 1DXFA 4TX6A 5IM51 2QCEA 4YN5A 4R7JA 3LTYA 3WQ6A 1BRLB 1KM1A 2Z2AA 3R58A 1Q2SA 5IHSA 3UJRA 3I10A 4G7FA 1BPLB 1JAKA 5D38A 4OBTA 2ISSA 4NYYA 3DG3A 1K8XA 2Y5EA 2E8YA 1XIFA 4XAZA 1XCWA 1V02E 4AMAA 1MW1A 2XHYA 2FZMA 1QHZA 5BU9A 4US6A 1JXJA 1Q7MA 3ECQA 1TJ0A 2A21A 3MU7A 2KX9A 1B30A 4DNHA 3SEPA 5I3HA 4AIUA 3F4NA 4RE4A 3GVQA 2PP0A 4GO8A 3OLGA 3MUXA 5CPQA 4WF7A 1UYQA 1E6SM 2YBTA 3LCXA 3UWUA 2Y24A 5AHNA 1JYXA 3S1WA 4BA0A 1JPKA 1VCVA 4M8UA 3A3XA 3MO7A 4DJDD 2J13A 1X6LA 1KRCC 1JNDA 3EKZA 1ITQA 1UUQA 3CZKA 1WDWA 3PJUA 3WFAA 2CHOA 3LNPA 2ZUSA 3C5QA 5CKSA 2ZDSA 3ITLA 3DXIA 3EB2A 3WQFA 1HJQA 3THCA 4UFKA 1OY0A 1SW7A 2XSAA 1ISVA 1CGXA 5CCZA 1UCWA 3ITCA 3SY8A 2CERA 2QGHA 2VRJA 3CAVA 1X1OA 3GO2A 3UG4A 3ATYA 3VIKA 2JBMA 3W22A 3GKAA 4JIQA 3EX3A 2GQ8A 2OGJA 1RR2A 1BWLA 1J5SA 1L8NA 1DE5A 2HISA 3WF2A 4OVXA 4IPIA 3MI3A 4O8RA 2E5CA 3VC5A 1KGXA 1Z89A 1W1PA 4IICA 1NP2A 3HJEA 1BTMA 1XC6A 1GOIA 3ARTA 4GUGA 2AOSA 4NG3A 3WD0A 2OEMA 1M7OA 3RX3A 4O4WA 1ZP3A 3CAQA 3MUIA 3BARA 1IT7A 2IPWA 3Q65A 4QLLA 2MUCA 3WENA 3UVAA 1KFJA 1J0YA 1SO6A 2PI6A 2Z1XA 3EWZA 3IV3A 2YA0A 1U2YA 5G2HA 1X8CA 1YPFA 4NF7A 2V2DA 4DBWA 1A4MA 5CC7A 4ZCWA 2E4TA 1UA3A 1EEPA 1FCQA 4LX4A 4A3QA 1DHKA 2ZRYA 4DUXA 4R9XA 5HJYA 4KFOA 1EHNA 4FNSA 1XBVA 3BC9A 5K4ZA 2VL4A 1M68A 3BSGA 4DF2A 3HG4A 4I7WA 3GNRA 1TPDA 5AECA 4FF7A 3TN6A 1TELA 2Z1KA 2A7NA 2AGKA 1K77A 2DZUA 4RDVA 1JDDA 3UNDA 3F4VA 2CLMA 2J8GA 4ZSTA 4AISA 1HUVA 1B0IA 1S2CA 4JTHA 3LCWA 4GOAA 4AF0A 1JZ5A 3W01A 3CYJA 1TUFA 2V82A 1VCFA 1AQFA 1Q63A 4O28A 4D6FA 2PEVA 5D05A 4MDOA 1FFRA 4NZCA 3TN5A 3ZZ1A 4RX0A 5LIUX 1NELA 1E9IA 1KQYA 4B16A 1NY1A 3W70A 4CQ8A 1NH6A 2QCGA 3GWQA 4U33A 1WO2A 5I79A 3P2VA 2E67A 4IF2A 1W9XA 2CLKA 2O7SA 1S2TA 3KOXA 3G24A 3CTTA 2A7PA 3AZSA 2WPBA 4HB7A 4IIBA 4E2OA 1SUXA 4TX8A 2J7FA 3AROA 4HSHA 1R9XA 1GEQA 3I7RA 4NVTA 3L65A 3C8FA 4K1WA 1H2JA 4H7ZA 3LBMA 1ENUA 3R8HA 1XW8A 4PYSA 2PSNA 2Q01A 4GGHA 4IGHA 4QISA 1OD0A 4PA8A 4DJDA 4F79A 1XKJA 3M6DA 3NL3A 2PCQA 2J7HA 4PEEA 5HJLA 2OQYA 3W7GA 3GC2A 1J0ZA 3GVGA 5LNWA 1CGYA 5GNXA 4HHLA 4JXCA 2ASHA 2OKTA 3N3MA 7ENLA 1WXZA 3MQTA 4AHQA 4L61A 3SJNA 2BSLA 1YADA 2FB3A 4HA4A 2BNJA 4L1GA 5A6KA 2VP8A 3QR3A 4DJDC 4NI8A 3N6QA 1I2RA 3EKLA 3PBVA 2YGYA 4LCQA 4UUIA 3R8RA 3VGDA 4JDBA 3W74A 4Y7EA 1V93A 3AYVA 3VNDA 4LUSA 4I7UA 5HWNA 1Q5MA 1IYXA 1UQYA 4MAVA 2QJJA 1I60A 3LBCA 2ZXBA 2IQDA 2VZSA 3BURA 3BTNA 3P8JA 1L6SA 1BSLA 4HMDA 3CWNA 1HKWA 3O05A 3CUJA 3OB8A 5HXMA 5DANA 1O5KA 2ZUWA 1QBBA 2QUVA 2R1PA 2FTPA 1B90A 3FW6A 4NJIA 3CLWA 4N9CA 2Y63A 3WDJA 4ATWA 4XO6A 4UNLA 3GU9A 1N82A 3RM9A 1M53A 1UWIA 3SY5A 1F76A 3GHRA 4HPNA 1TR9A 3IVUA 3LHVA 2XN0A 3MJMA 4LUTB 1OIFA 1UD8A 1WAWA 3E12A 2OOGA 1XRFA 4XVDA 1XICA 2YDAA 4QSFA 1AVAA 4GVGA 1ZAHA 3QF0A 1AH0A 1XGEA 4O13A 1OFAA 3VX0A 2GZXA 1ZHAA 1OZMA 1W9VA 4QEEA 1MUMA 2IKHA 2PPGA 4KQNA 3W88A 2V5JA 3QFEA 3CV2A 3NQ6A 3WBYA 2H9AB 3K1DA 2IKJA 1K03A 2QULA 2VT0A 1C90A 4W4QA 3WMCA 3WELA 1X8FA 3S9IA 1OVDA 3SIMA 1IEWA 1KR0A 4R33A 1REQA 1KFWA 3A24A 2F6KA 5HNRA 5B7ZA 2VFHA 3LMYA 2G37A 5XIAA 4FI4A 1MI3A 4I6KA 1DORA 1JUEA 1S3TC 4O53A 2J62A 1WBHA 5M03A 1T96A 1V79A 2Z2UA 4GI8A 1VIZA 3VI2A 1O68A 2QR6A 5D04C 3SFKA 2DUAA 4WVXA 2F38A 3BJSA 3AHVA 3DENA 2QUMA 3OA5A 3F7JA 3PHAA 4PCPA 3ABSA 3GR7A 5IFTA 5CJMA 4QHRA 1FWHC 3G5EA 1EB3A 2GGGA 3TTQA 2BB0A 3N15A 1M9HA 4MPQA 1O6IA 3APTA 1FWSA 1EXPA 4K8HA 2G4FA 3TVAA 3V5FA 3VGHA 1MFVA 3KX6A 4DO4A 1H1YA 3BW4A 1WDDA 3FAWA 4DYJA 2J9YA 1PWMA 2HZGA 1TPC1 3R2GA 3N17A 2PBGA 3TTOA 2W4XA 3CMGA 1E56A 1X6NA 1T99A 3HF3A 1UD2A 4Y90A 1JYWA 3GAYA 1XLMA 1XD0A 3NQGA 1XLGA 3VTRA 1H3GA 5FOOA 1VHCA 1IT8A 4MZ1A 3AFBA 4AWUA 4GUHA 2BV9A 2R24A 2ZRVA 2PUZA 7REQB 5HQLA 1WDQA 2ISDA 3QV6A 5JQ9A 5EL1A 1GYLA 1D3CA 3CBWA 5AZ0A 5GVJA 3TKFA 4DELA 1UWTA 1FCBA 3T8LA 2RHGA 1HFBA 2NZLA 2WVVB 3V16A 2OB3A 3EA2A 2DZTA 3TTSA 3TYCA 1F6PA 5EBAA 4CD8A 5HWMA 1K3UA 2IXUA 2XZ7A 3ZQ9A 2WXDM 4PTWA 4B90A 3LUTA 2WVSA 3EWDA 4LVFA 4CVUA 3YPIA 3HMCA 3EA1A 3GFZA 4KETA 4YIWA 2H3DA 1VBGA 3WD2A 4S3AA 5CAKA 3PJXA 3AISA 3VD9A 4UTKA 3TDFA 4BI7A 3STEA 4ROPA 4W88A 4QXIA 1V02A 2BG5A 3RLVA 4HK6A 5AYZA 2CIPA 2XDFA 5AYYA 3PPHA 2UY4A 1DXIA 3MMDA 4O0KA 2PDCA 3TWBA 2PDBA 4JEQA 2P0IA 3HQOA 4LS0A 3DFQA 4R88A 1PSCA 1FWRA 4LT9A 4C6LA 2YOCA 5A6LA 1F8MA 3VKDA 3E0VA 3KVLA 1TPWA 5D30A 4NJJA 1EGMA 1YLVA 4LYQA 3MMUA 1LZOA 1GYMA 3CQJA 4HTBA 1ECEA 5CG0A 1US0A 2ISVA 9XIMA 4Q7NA 4XWUA 4MG4A 1QI4A 4ZBCA 5JUVA 4AZ7A 5A8PA 3WK1A 4XX6A 1P48A 1TYGA 4BEUA 1QASA 3GDLA 3BQ6A 2WQDA 3LV5A 3BGAA 3W07A 2XFRA 2YXOA 5CPLA 1BGGA 3B40A 3N3TA 4IM4A 4QLJA 1GYNA 2XINA 1YDYA 4IPNB 4F2TA 4HCDA 4MVAA 4ZFCA 2PDKA 1POJA 3UXIA 3OLEA 1IXPA 1HP5A 3LZ5A 4CD4A 4OV9A 4LYPA 4F0MA 3LLXA 3SN4A 3PULA 1E6QM 5AY7A 3JW7A 1FWWA 4REQA 3BAKA 2ANUA 3BMWA 3E49A 1RD5A 3IPWA 1RVKA 3OZMA 1XLLA 4AVOA 2PDXA 3GDBA 2DUXA 3MS8A 1AFSA 1LLOA 2GJRA 3CUGA 2XM1A 4WY0F 2YX0A 2VXNA 3TYUA 3WQ8A 4UFLA 2G8ZA 2C1IA 3EA3A 3GUGA 5DCEA 1IR2A 3H55A 1LWHA 1YPXA 2J8TA 2YYTA 2QPSA 4KT2A 1BLIA 3IV8A 3SQSA 5KSWA 1OX6A 2I5QA 5G4WA 4PULA 1NTHA 3CGTA 4M7TA 3EB3A 2A5HA 4HMNA 2XZ9A 3RNDA 5CSUA 1S5NA 1GOWA 3BCFA 2ZBTA 3VOGA 3H23A 6REQA 3UF9A 4AF0B 3DYPA 2ZADA 3NL6A 4HSOA 3QR1A 4HPHA 4DY1A 1GKQA 4GNVA 4LQ1A 1LQ2A 4KRTA 4YU1A 4O54A 1DWAM 3MUCA 1JDEA 5FSDC 3GD6A 1GTEA 4ZMGA 5EY5A 4JQ1A 3WNKA 4UR9A 1UZHA 2KAUC 5BW6A 3LG3A 2ESCA 1N8FA 2Y61A 3Q45A 1OZQA 5HANA 4C7FA 4UTHA 5JBFA 3MCOA 4EXAA 2YL8A 4M81A 3T81A 3EX6A 1CT5A 1C7SA 4D1IA 2P8BA 3CUIA 1U1HA 1Y8BA 1XH2A 1H7RA 1VAHA 3DN5A 1MWOA 1NWSA 2I9UA 2A3AA 4H00A 3W84A 1VGAA 1C93A 4S3GA 4E4FA 3LHTA 3T9PA 4PUDA 4RPPA 3UETA 1JDCA 3WLIA 1R3WA 3GIPA 3DHUA 4M56A 4PMZA 4DYEA 1RZMA 2QJMA 4B2DD 2VQTA 3MP3A 1ZZMA 1IEIA 3BMVA 1X98A 5CH9A 3RG6A 4C6EA 2R6OA 4XIAA 3NQ2A 4QJ3B 1SFTA 3U3HA 4IHCA 2YDQA 4O50A 2OO6A 2Y89A 4A4AA 3KLKA 4NNBA 3AI0A 4WIWA 3GDTA 4DN1A 3G1FA 2PWHA 2GJXA 1XSJA 1KKRA 4Y8EA 5DCDA 2PDLA 2OTDA 3NPWA 1E4MM 4D1JA 2RGLA 1KA9F 1MDRA 5ABTA 1PBGA 1PX4A 4C7DA 4LEFA 3QTGA 3JUGA 2Z6JA 2ABBA 4CQAA 1Z8AA 4Z1AA 3AIBA 3CT7A 3SB0A 4UFMA 4HBKA 1PZ2A 4BWLA 3GW0A 4GFSA 1U5JA 4GUFA 5MHBA 2EG7A 2UY3A 8A3HA 2FPTA 3S9ZA 4ZR8A 3F2BA 1XPYA 5H6HA 5EBUA 2I16A 4BK9A 5D2TA 2FTYA 4L4MA 2I9EA 1IIGA 2DORA 3IIXA 2O92A 1DJIA 3PR2A 1PX3A 1MVYA 2CWXA 3BG3A 3FKKA 4HN8A 1W9PA 1EP2A 3VIHA 1GOKA 2EHHA 3CV1A 4Z1BA 4PMXA 4KPLA 3EXTA 2P1FA 1TPH1 4JYEA 3OLIA 2QVHA 3W87A 1W91A 1ZS2A 4ICNA 1F7BA 1FKWA 2V3FA 3WH5A 1AMYA 1REQB 4GX9A 1W5MA 5D8ZA 2I1OA 1FWEC 1YNQA 4XZIA 4ADTA 3R89A 2ZA2A 3HBLA 3Q94A 3TLQA 2Z29A 4GYJA 2A85A 3C2EA 1DWJM 4GYPA 3A12A 1GVYA 4J27A 2NW0A 1JD7A 1WBJA 3E96A 3F4DA 1R5YA 2WZTA 4IX0A 4IMDA 1K7XA 5CBBA 4DYKA 3T8QA 3VKBA 3PZUA 1XBYA 2GLKA 1UOZA 5FSEC 1A5CA 3H54A 3OBAA 1DIKA 1L6WA 1EUNA 4O10A 1UH2A 3QY8A 5HOSA 3VGEA 5CSRA 4HU4A 4KEVA 4GYPC 4NXSA 3WMBA 5A8MA 4Q4QA 2ZTKA 5LIYX 4Y9MA 3VINA 2AKMA 2JFEX 1LRTA 2Z27A 3UBPC 4ZZ9A 5HULA 1GT8A 3MKCA 3MMWA 1U1JA 4B2DA 1AQMA 1V77A 4H3DA 1GVFA 1M7JA 2Y8VA 5H91A 1FFQA 3DUGA 3NJ3A 3MV01 4UMAA 3L2MA 3R6IA 4ERGA 3W86A 5ABGA 3QJAA 5KZ6A 1ECQA 4DB7A 1UD4A 1SW3A 3KDNA 3VNIA 2VGIA 3GVVA 4J3SA 3AJXA 4CQBA 2I5GA 4NAFA 1A5NC 3ZJ8A 2WHKA 4DPPA 2Y2WA 3JRKA 1VFSA 3WF4A 3GU2A 3N4AA 4DM1A 4AZGA 1PO9A 1VJIA 5LIWX 4AEFA 1VFLA 4DXKA 3TQ0A 4LAUA 3WJZA 4Y9AA 2FH8A 3M5ZA 3AS1A 3AO0A 1KRBC 4L4LA 2NVAA 1UASA 3S6OA 2W5FA 2JGYA 1QUMA 1UB3A 1S2VA 3IGHX 5JVLA 1ZB5A 3TSMA 2BGNE 2JALA 2XH2A 2HS8A 1EQCA 5K9CA 3T09A 3DFYA 4MHBA 4E8GA 4IP7A 3W29A 1EA0A 3NVDA 1QPOA 2BY0A 2Z1VA 3BH4A 4L80A 3QRHA 3QC0A 1P0EA 1R7OA 3P5ZA 4AZBA 4JIIX 3TXVA 3BL3A 3SGGA 5D09A 3FEMA 4LY4A 5FJTA 1G7VA 1TR1A 1S38A 4Y6GA 1ZCOA 1ONEA 5CJ5A 1MSSA 4RXGA 3WFLA 4KMQA 4J7RA 1SVDA 1X1NA 2IKGA 3ITXA 1B2YA 2YCJA 5F4SA 1MQQA 2ZA1A 4AW7A 1CW2A 1S5TA 2WC7A 3P3BA 4HZ8A 1B9BA 4FHAA 1LJYA 1Z6KA 2PDFA 4LH8A 3U2CA 3D5HA 2YFOA 4B5TA 4NZ5A 5KTLA 3K8MA 1WP6A 4LPCA 4FR6A 4OHQA 4UFHA 2D24A 4IMEA 2VRQA 1TQJA 1RJRA 1IGSA 3B8WA 1D3HA 4QSHA 1TQXA 1P5BA 1C8XA 1HKVA 4H9UA 3E38A 3GDMA 2VEGA 1ZBWA 4M6UA 3WLNA 1O5RA 1FHUA 1IWAA 3RHGA 3GU1A 2A3HA 1J11A 5E09A 2WWCA 5F4WA 6PTDA 3LU2A 1TE6A 1Q6LA 2PURA 1GVQA 1HN1A 1PKNA 3PTDA 1M03A 5M3WA 3R12A 4NJGA 3R94A 4JCLA 1KFEA 1K6AA 5AHIA 3HJZA 4REQB 2X40A 3UGVA 2PP3A 1J5TA 4UR8A 7ODCA 3G22A 3W7RA 2V69A 3VNKA 4P8WA 3RPDA 1TPVA 3STFA 1KNWA 3HOJA 3S1UA 3EBVA 3W4RA 4GJJA 4ML4A 3ZVHA 3ZLFA 3L4TA 4V1XA 1RBLA 2V30A 4WK9A 4C1NA 1K8ZA 4EXBA 5LKYA 1AL7A 2VFEA 4K7YA 2GVYA 3LXAA 4RE0A 3W00A 3GHUA 2YZRA 1I6NA 2XYLA 3K1GA 4H6KA 2HVOA 4BQ5A 2FKPA 1C29A 5B80A 1K6WA 3BG9A 1LL4A 3NGJA 1QOXA 4S3FA 3BAIA 5EMMA 3MSGA 3I4EA 1GORA 2BODX 3WEZA 4N2YA 4IIGA 5FACA 1LM1A 2XH0A 4PR4A 6REQB 5HPOA 4WDXA 1OF8A 3IJLA 4MB5A 3FV9A 3R43A 1B3XA 5ABEA 3HQNA 5HA7A 4O1DA 2BP1A 1CLXA 3N9RA 3QC3A 5AHFA 2HPMA 3O6CA 4IJRA 5BOFA 3PG9A 1OCQA 3IUDA 3LQLA 1CENA 4GQBA 4UQAA 2NUWA 4CQCA 3P81A 1TMHA 5M17A 4A8LA 3N25A 4ROQA 1JVNA 2YW4A 4C6CA 3UY8A 2WVTA 3AALA 1EWDA 3WBXA 1KWGA 1WNOA 2E7FA 4DBEA 2JEPA 1N8IA 3K4WA 4PB4A 3W7JA 1TV4A 5E0FA 3U7BA 2PDJA 3SUSA 2HE5A 1KR1A 4BKNA 4PMRA 4JQ4A 1IZJA 1KTBA 5AFDA 4JX4A 4GD0A 1UMYA 5BRPA 1V3HA 4HNUA 3CHCA 5D8WA 2ADAA 4K6AA 3DFSA 4GE8A 3L9CA 5M1TA 4JHOA 1ITXA 2CEQA 3GR8A 3V3WA 3CL7A 3UCQA 3ZR6A 2D3LA 3U57A 3UWYA 3WLPA 2D22A 2BHUA 4GABA 3H21A 4DXVA 3F2DA 1PTDA 1EGZA 5GJNA 1KM3A 3L4UA 4UQCA 3U9IA 4GQQA 1KTCA 4QTGA 1POKA 2FB2A 4R34A 4LXFA 4N4QA 3EMZA 4PBEA 3MTWA 1DJNA 3PJWA 5C9RA 3QGAC 4JNYA 2C15A 3AMLA 2ZRZA 1PL9A 5D37A 4LC8A 2GJXB 2Z24A 1CDGA 1JYNA 5J5DA 3WF3A 5K7JA 4B3ZA 2OZTA 4QJ5B 4PCSA 5U4NA 1XRSA 4LCSA 2J7BA 3P61A 3GG0A 5I24A 4EXQA 3NQCA 1MXDA 4O14A 4O0ZA 2AMXA 2QCNA 1TJ2A 3EOLA 4IIEA 2Q3OA 4LOCA 1K4GA 2ALRA 2JF6A 3GIYA 4FALA 1DPMA 4LB3A 4O19A 2HJPA 2DGAA 1LUCA 4RNJA 3TYZA 3OG3A 4RZBA 1V51A 4HVXA 3INPA 3SW6A 2B4GA 3SO7A 3T6CA 1H61A 2PTZA 4CVWA 1QO2A 2ZZ1A 2OR2A 3EMCA 5HNTA 5T9BG 2QCCA 3AZRA 3W24A 1G4SA 1PIGA 3P7YA 3ZSSA 4DXXA 1DIEA 2YBVA 3JS3A 2VR5A 2XWDA 2OQLA 4IPLA 3VIJA 4DUWA 4GIAA 2PFHA 3R1ZA 5KZDA 4UTWC 2ZZ5A 2BDQA 3RUBL 3P6LA 3T2PA 5H8MA 3TU9A 3DYOA 1CECA 1RAKA 4GVIA 3HZ3A 3HPSA 1HJWA 1UWQA 3M5XA 1MZHA 1H7NA 1WQ5A 3OVGA 1RVGA 3TOPA 5CZKA 1ZJBA 3NEVA 1H1ZA 1UIOA 3FA3A 1OK4A 1I75A 2J7EA 2E3ZA 3L5LA 1ONWA 3UD6A 2QIWA 7TAAA 2VVNA 1YXYA 1VFFA 5I78A 2BVDA 5KETA 4C91A 4XV0A 5A6JA 3KZSA 1AJ0A 4QG9A 5DT7A 1KM2A 3CPRA 3FXYA 4NZFA 4KBXA 1FWFC 4P8VA 4ZGYA 3MHUA 2PU1A 4LCRA 1BVNP 1E40A 1LL6A 3W7CA 3NO5A 1GOQA 4PCNA 4AEOA 4OOUA 3RF9A 3HIJA 3A4AA 1NFBA 2HSAA 3K46A 4JTIA 4D6IA 1I2OA 3RK8A 1JAEA 5HAOA 5KITA 1ONRA 3E0LA 3UP8A 1HJUA 1KRMA 2W3ZA 4MTVA 4BFAA 3NGFA 4DJEC 1UWSA 4WUIA 4GJIA 1WZLA 4JD4A 2R1MA 3JZEA 2YB1A 1OSEA 2F2HA 4QG6A 4XZHA 2X2YA 4S3EA 1YDNA 2JEQA 3LERA 5I3KA 1M04A 3TIMA 3BAJA 4BF7A 4NAFB 3T55A 1E9YB 1JR1A 2BHYA 1BQCA 5BYWA 4C1KA 1WZKA 2AKZA 3ERPA 3VIOA 3CT2A 3IAPA 1NJJA 3FEQA 1JPIA 2Y88A 3PPCA 4DEFA 3BK0A 4HCLA 2X7WA 4PE8A 1WB0A 1TIMA 2BHZA 1BXNA 4AMCA 2ZZ7A 4WDTA 3SRDA 2ZXAA 5HMFA 3PBUA 4Q22A 3M0ZA 2WMFA 4D8AA 1F3EA 1WAUA 2GVLA 2DV0A 3NQBA 2PBOA 3VXGA 4EPBC 1W3TA 5G4HC 3VUSA 2ACSA 3W1AA 1R3SA 4OE7A 1FVPA 3P80A 3GKFA 1KBLA 1RPKA 4LV4A 3D3AA 2NUYA 3E0WA 3W23A 4X60A 3T1GA 1J0HA 3LPOA 5FAGA 1OF6A 1M01A 1TA3A 1MUCA 3OHMB 3AZTA 4UR7A 2PLMA 3DOPA 3HPFA 2X0HA 1UC5A 2WW5A 4WOZA 3NDYA 3NQDA 2EPKX 3HGRA 3CJPA 4M29A 3T0TA 3CAWA 2P76A 4ML9A 3WYZA 3B4UA 4H9VA 4UNIA 3FVMA 3MDWA 2V5BA 3I6RA 4HA3A 1EJRC 3GDRA 2AL1A 2ACQA 2Y4SA 3H7RA 4HMCA 4ENLA 5H1WA 2WO5A 1UZ4A 4IFKA 3UCDA 1SJAA 2FHCA 3VDBA 2CCRA 3E5BA 3NXLA 4PBGA 2DW6A 1F4HA 1PKMA 4AEEA 3W1QA 2EKCA 1Z32X 4TTUA 4UNKA 2NLIA 2YJQA 4FXFA 2ZWZA 3O1NA 3WK0A 3I6TA 3WUBA 4ACYA 5M5DA 2C91A 3CC1A 3BCDA 4IZGA 2OZ0A 4O12A 3MBFA 3B8UA 1DE6A 3OGRA 2GSHA 5E0CA 4DWSC 1RK6A 4PFHA 4Q8QA 1OCNA 3VMOA 1RALA 4MLJA 2V5KA 1EWEA 2DVUA 4W86A 4X0NA 4H6QA 4PRRA 1Z3NA 5DY3A 1JNEA 3WJXA 1LBFA 3T4WA 1TUXA 3DHDA 5C9ZA 2ODOA 1PB0A 4CD6A 4MB1A 3F5KA 3CPUA 3ISIX 3ZVHB 2H8XA 1OABA 3MSDA 4DF1A 3GIQA 2HXTA 4Q8VA 4C1NB 2XVGA 1BWKA 3EDDA 4ZOCA 1MRQA 1UBSA 3S47A 2YXXA 1A3HA 4IPPA 4NQ1A 1BG9A 2ZRWA 3ALGA 2RUSA 3WJSA 3C52A 4EACA 1G4TA 2A3LA 1IXQA 4F48A 3PFMA 5DQPA 1THFD 1QNRA 4C6FA 1KTNA 1XCXA 3CLMA 4JBRA 2FHFA 1HJXA 1RLCL 2NVDA 1RK5A 4Z0SA 3CUHA 3UQNA 3DKJA 4LRTA 3PTKA 3GYCA 3RN6A 3RM4A 5HMDA 5FIPA 1XG4A 3HURA 2J88A 3PBYA 3VMNA 3PZVA 1J93A 1F3XA 4Z08A 1IWBA 4O16A 3O8AA 5J04A 3PC0A 2QPUA 1ME7A 1G1YA 2J7GA 5GNYA 7A3HA 3U2ZA 1EBHA 2GQ9A 4HK5A 1R2SA 4QROA 3B8VA 3A3WA 1Q13A 1WOBA 3BW3A 4CEXC 1E51A 1P0NA 3S83A 4L9XA 2CZDA 4KIRA 1U5VA 5A2AA 2R1LA 1QWGA 4WHBA 4CD5A 5T8GA 4Q4RA 4UTJA 4FOKA 3RR1A 4EPDC 1AZ1A 3CZGA 2A0NA 3EXSA 3KWSA 4RKAA 3PBGA 2CLIA 4MOZA 4IFRA 1HGWA 3S6DA 1FH7A 1Q6QA 3IUIA 2A6NA 1PZ0A 2WZIA 4JL1A 3A5FA 4IMFA 5FF7A 1CIUA 2PZ0A 2YA1A 3DG7A 5A8NA 3BLOA 5EKYA 5GJMA 4Q7BA 3OQ8A 1PEZA 1TRDA 3TZFA 4HNVA 1R3RA 5CPNA 2JE8A 2J27A 2D73A 4M1BA 3NPUA 1SZEA 1JG9A 1Q7QA 1HVQA 3AYRA 2ZX7A 4PMJA 3ARUA 1BF2A 3M64A 1XG3A 1XLHA 1S3HA 3VD4A 1G69A 1A0CA 4H8VA 4TMBA 1H63A 4A2SA 4DBUA 4YVXA 4J3WA 3R13A 1JQXA 3N11A 5DELA 4PMOA 3WUEA 5MF5A 4FLQA 3UR5A 1OFQA 2Y1HA 1RD6A 4HZMA 1ODUA 4OUIA 1IXNA 1HKIA 3EWUA 5C0QA 1E0WA 2HWGA 2YPIA 3KBMA 4YVVA 4AZ5A 3NQ8A 4H9ZA 3F5JA 3N2TA 3B9EA 1VIWA 4K3ZA 4MJZA 4QJ4B 3T0AA 3NZQA 1NWRA 3UWWA 1BEUA 1WYIA 5TIMA 1TE1A 5BXSA 2XU2A 3G6LA 2VENA 2DU2A 4FPSA 1O5XA 5EMJA 1LRQA 2WC4A 1KXVA 5FJJA 3WQWA 1A5LC 4MAZA 1LUCB 2EEXA 4GFIA 3WLOA 5FKYA 1ZBCA 1TX0A 3TH6A 3AQUA 2TMDA 5F2IA 2GOUA 4XZLX 2WZEA 1YE6A 4GH3A 1RQHA 1ZJIA 3KM8A 1J10A 5C9WA 5AKQA 3REQA 4O1BA 3T40A 1VP5A 2V5LA 1T40A 4QNEA 4MYAA 1R0MA 2G3MA 4IL2A 2BXZA 2Y5SA 3HG2A 3USBA 5DXXA 3QKZA 1DWFM 1JCMP 1W3KA 1KKOA 1NAL1 2Z26A 3NSNA 4V27A 3PPFA 2DVTA 2VX6A 4IL0A 1X1ZA 2UZ9A 1RCOB 2J9XA 3WDHA 1DTUA 4KWWA 1JI1A 4GXWA 3K5XA 4C6OA 5C6MA 3XISA 2P10A 1TKKA 4GNJA 3A21A 4GKTA 1H49A 1VFUA 3K2GA 4LBSA 1QJWA 2W27A 3LCGA 2BFGA 4L9YA 4WJ8A 3RGTA 3WMLA 3VKAA 2PODA 4DBDA 5ABHA 3OPSA 4WSKA 3KTCA 3LSBA 4HPJA 3B9NA 3BZJA 3DC8A 1LP6A 4X63A 3OU8A 4WOQA 2O9PA 4JNZA 4CCZA 1RY8A 1TWWA 1YXDA 2XGIA 1UBPC 1BYAA 1Q6FA 4PUWA 3FSTA 3UWVA 1S2WA 1U1UA 4HU0A 5T26A 4O1CA 1E6PA 3PJTA 2J6VA 2X8RA 1EHAA 2ZX9A 3V7PA 3DI1A 4QGCA 3G0XA 1FUYA 4H41A 4B92A 1UKTA 1V6YA 2BGQA 2WKJA 5LA0A 3BLPX 1ZNNA 3L2LA 1A0EA 3B0UX 1AD1A 2ICSA 2FVLA 3FDKA 3CUFA 3QH2A 3FSUA 1ODZA 4IIHA 1UWRA 3GDKA 2IPJA 1T7LA 3L4VA 1A5OC 1Q4WA 1JZ3A 5FEZA 3KE0A 1YTKA 3MHGA 3MB9A 3PB2A 2PB1A 1MW0A 2DT1A 1EC8A 1CGUA 3IACA 1FXPA 1ZQ5A 2WANA 1MW2A 1ZBVA 2I17A 4ADSA 5LXEA 1XWYA 3PZOA 4LRSA 4XSMA 5EB8A 3EOOA 4FX7A 5HDRA 5CLTA 3QM3A 5GQBA 3D3FA 4PCTA 4QE4A 4M1RA 1KM0A 1F07A 4TR9A 3SQMA 5K9XA 2NVCA 3SSZA 3RLUA 3RR4A 4GPNA 2CYGA 2QT3A 1LOSA 1B3YA 4D71A 3PBMA 4UZUA 3DBNA 2J66A 2QDGA 4JTRA 2C18A 2OQHA 1SJDA 4L6DA 5D2VA 1KFBA 3LQGA 3ARWA 1F61A 1TTJA 1IEXA 4WD0A 1YX1A 3BQ5A 4Y2WA 1H5YA 4NASA 1LROA 1TA3B 4P8UA 4JTEA 3ID7A 1W54A 4W85A 2BBFA 3GXDA 1PZ3A 3NDZA 3VD7A 4W84A 5DO8A 2EGZA 4X0VA 4AG0A 2X0YA 1LF1A 1V7AA 2Y7FA 1H51A 4JR5A 4BQ4A 4KERA 2VC7A 1CXIA 3BOFA 1ISYA 2F2KA 3TNBA 5IXEA 2POTA 1AODA 3ITVA 3GXIA 1B1YA 3VGBA 1R47A 3VIPA 4IFKB 2E25A 2HRWA 1QPKA 3QMSA 1T8XA 1F9CA 2NSOA 2QMKA 1XLFA 1M3UA 3Q67A 4GX8A 1V6TA 4AYSA 1TRIA 2J79A 3GTXA 3HPXA 2DH3A 2P3EA 3QLLA 1QOQA 2FPVA 3FJLA 2W92A 1C8QA 4D6DA 4POCA 1Z44A 4JPGA 2RDUA 4NIRA 4AIEA 1Q6OA 1DQUA 2HNEA 1KBBA 2ZX5A 4F0RA 3PNUA 5DFAA 3UCCA 4MYXA 6ENLA 3W3OA 4KWSA 1R3YA 5LNSA 5DBTA 1H7OA 1JXKA 3CWHA 3T0BA 1MEHA 3DH7A 2PWFA 1SO5A 3MBDA 4YLWA 4DZ5A 4R27A 3B0PA 1EX1A 1A49A 3GTIA 4J2MA 4S23A 4JAWA 3UVIA 3N29A 3QHOA 3MCNA 4XISA 5EMLA 5HATA 2V5CA 5C2GA 3A3HA 3BXWA 1E71M 2VUNA 3M7SA 1W5NA 5G1MA 4YWSA 1K9DA 1VFMA 3VDCA 4M6VA 4S3DA 1R38A 4NX5A 5CAHA 3UFYA 4E2BA 2IQ0A 3A4XA 1D7KA 4IQLA 3UPBA 3J7HA 4XQ6A 4INFA 1P6WA 3RU6A 1FWTA 2IS7A 3P60A 1GG1A 2CPUA 4EF9A 5D9PA 3F4CA 1Q65A 5HJXA 3A4WA 3S42A 5SWUA 3G8RA 4LAOA 3L67A 3S9YA 3WX7A 4WX2A 2EG8A 1F3TA 4D72A 1VBHA 1V0LA 2LLEA 3M16A 4IISA 4R3UA 3WNMA 1VEPA 2GGEA 1HW6A 4P7OA 5HMEA 5LA2A 2YL6A 4B5SA 4QE5A 3KP1A 3QHMA 1V3KA 3RLHA 3AYSA 2DIJA 1VH7A 3M0LA 1J01A 4FSAA 5E93A 4B5VA 4M0XA 1F4AA 4HNTA 4XD5A 3KVKA 4QDPA 3OJGA 5DBUA 1ONXA 1H62A 2BXYA 5JH1A 1DOSA 3I3EA 3KRUA 4WY0A 1PE1A 1QCWA 4IGSA 4QP0A 3W75A 2D0GA 2DSVA 1YMYA 4CEUC 4JX6A 4QS5A 2PDUA 1JF5A 2ZWYA 3RPTA 4G2DA 2NV9A 1EGVA 2AL2A 3M6YA 3TUUA 5FI8A 4GNKB 3EB4A 2QLYA 4QX4A 4X22A 1FHLA 4N02A 1T5AA 2BGSA 1SO4A 4C6PA 1JCNA 1FRBA 1OFDA 3O3RA 1W1B1 4J2PA 1LBLA 1DJYA 2IMRA 3LCHA 4GJ1A 1HO4A 3VDAA 2UY2A 5I77A 1VFTA 2GDUA 2CWNA 3AU2A 4DQWA 3WQDA 1VHNA 3CNYA 2WJDA 2CU0A 1RUSA 3AHZA 2ZX8A 4ZTYA 1X6UA 3URQA 5C2CA 1MUWA 5D2WA 3CH9A 4B9YA 1IV8A 1GGOA 2P0OA 3ARXA 3JVAA 4ICCX 1RSCA 3W02A 3EEZA 3O9NA 1JZ4A 1OFEA 3F5LA 3TW7A 1SZRA 2QF8A 3AUJA 3EZ4A 3IAQA 1XKYA 2B7QA 3GVWA 2GJNA 4CD7A 3SECA 3KW3A 5A8QA 3IEBA 1D9EA 2G3JA 1DKWA 4MLRA 1KBJA 3GH7A 3KS5A 2DZXA 1QNVA 4JIEA 4DI8A 3TP4A 1QK0A 3CUXA 1WUEA 1DWGM 5E0KA 1K8CA 3CL6A 3NTYA 4KEMA 4L7ZA 3NSXA 4H1ZA 3TMLA 4MJ4A 4ZXOA 3EWYA 2PRLA 1S5WA 1LLZA 1TCDA 1XLKA 3AMDA 4JDYA 2HVMA 2VEFA 3SCSA 4W93A 2INFA 2GOKA 4AQLA 5CBIA 3UERA 2OCZA 3FYPA 5EFFA 2ZC1A 2YSWA 1E0XA 3CTLA 4XB3A 3HA1A 4Z2LA 1NVMA 3K8KA 4H6RA 5A6AA 3DU0A 4U2ZA 3HFYA 4E6MA 1LLWA 2V3DA 3REQB 3G1YA 3W2JA 4UBPC 2BWGA 1DJHA 2E77A 4PCFA 4UTTA 2XIQA 2TODA 4FX8A 3GAKA 4JTLA 4Q8WA 1UPMB 4AZHA 1QAPA 1Q66A 5A6BA 3WLRA 3GX9A 4EP8C 3F1QA 4Z1CA 2XN2A 3P82A 3IGUA 5HQMA 1U22A 2PLCA 3WJYA 1PHQA 4PTVA 4BCEA 5C5YA 1PUDA 4Q8NA 3M9YA 3B9DA 2QXWA 3SGZA 4UMCA 4XTDA 4A8NA 4ERIA 4G1NA 1C7TA 5I00A 1XLCA 4NAEA 4LANA 3MCMA 1P6BA 2QEZA 4XK2A 2MNRA 1GJWA 4JOMA 3T2QA 1XCFA 5IOBA 1TVNA 1AW1A 4IMGA 2Y70A 2BVYA 4JYDA 2OODA 3S5NA 2HK0A 1TWZA 3NPXA 4I9TA 4OBSA 4BJHA 3FY1A 3DKLA 2F9RA 4YTRA 3MPGA 3KDOA 2G3NA 3KAOA 3MZ2A 3AXHA 1ESWA 5EMYA 4LVBA 3LM3A 3VDHA 4NZ3A 1CXKA 3S1GA 2PTXA 4MJ2A 2B7NA 1EP1A 4ATDA 3NUKA 2E28A 3OA3A 1OG0A 3G1SA 1O1ZA 3UJEA 1DTNA 3EDJA 1JZ8A 2EF9A 1CGTA 3W83A 1D3GA 3ALFA 1BGAA 1UZ1A 4B91A 1FKXA 5FF4A 1XGZA 4NT0A 2CXEA 3NO3A 3PS7A 2D69A 1UP0A 1G7UA 1KXQA 2OZ8A 2Y7EA 3N2OA 3CXOA 3LXCA 2AQVA 3MYOA 3HTWA 4TV5A 4I3GA 2PE4A 4CN4A 1YE4A 4FLRA 2WNWA 3PUDA 1SFLA 3T44A 4FX6M 2CZFA 4XBKA 4UZSA 4WKAA 1MNSA 2BY1A 4PFMA 4NSBA 3GNPA 1ME8A 4B5UA 1V08A 2VEIA 1OHLA 4C6NA 3TQKA 4S1FA 1WXYA 4UOJA 4Z17A 5KZMA 3GR4A 3NM3A 3WO8A 4U5KA 4PB3A 3QKEA 1Z69A 3GTHA 2NV2A 4F3HA 4HTYA 3GVRA 3I7QA 2PWUA 1W1VA 1A5UA 2Y7GA 1XQKA 4JKMA 4GY1A 2DDXA 1W17A 2H8ZA 4FXRA 1CEOA 3WF0A 1SMDA 3RCNA 5RUBA 1RP8A 4JZ5A 7XIMA 3QPYA 4HOXA 1EOKA 4CGTA 4KWVA 5LGZA 3DDMA 3P84A 2HXUA 3RJYA 4CQ9A 4DLMA 2Y8UA 4HZ6A 3VCRA 3CHEA 5AC5A 5A69A 1EIBA 1QTWA 4D6CA 1BVZA 4YHEA 3DCPA 5H8PA