4LAOA

Crystal structure of cordyceps militaris idcase h195a mutant (zn)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
370
structure length
370
Chain Sequence
TPVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLAPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cordyceps militaris IDCase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 135
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4laoA00
1EJUC 2UBPC 1RA5A 1FWGC 4CNSA 2Y1HA 3E0LA 2HPIA 1J6PA 5E5CA 4IQJA 4I6KA 4WVXA 3GG7A 2HPMA 1R9YA 2PLMA 2Z27A 4C6IA 4CQDA 1POJA 1J6OA 4GY7A 3T81A 4INFA 2OOFA 2HNHA 1A4LA 4C6FA 1KRCC 4GX8A 2QVNA 4KERA 2D2HA 2HBVA 4XAZA 2R1KA 3G77A 4C5YA 3URBA 3QY8A 1R9XA 1FWCC 4IGNA 4EPEC 3E74A 5HMDA 4M51A 3MVIA 1VFLA 2FVMA 2GWNA 3LGDA 3FDGA 4LCSA 1HZYA 3K5XA 1I0DA 2FTWA 3OJGA 1YBQA 3GTXA 4ICMA 4C6CA 4C6DA 3MSRA 5G4HC 2YZ5A 3QY7A 4PBEA 3SO7A 2Q01A 4DYKA 1POKA 3ISIX 3K2GA 3AU2A 4ZSUA 2Z7GA 1V7AA 1UBPC 1EJWC 1EJXC 4H00A 2VR2A 4V1YA 4XD6A 3IGHX 2AQVA 3WMLA 4C6LA 1P6BA 1K1DA 3A3WA 3RN6A 1GKRA 1PSCA 2D2JA 4GC3A 4QS6A 2A3LA 4LH8A 1I0BA 2QT3A 1FWIC 2P50A 2YB1A 2DVXA 1XGEA 1XRFA 4C6MA 3QY6A 4H9TA 4C5ZA 1FKXA 3LSBA 4GX9A 4XAGA 4ZSTA 2XIOA 2GWGA 2BGNE 1FKWA 4RDYA 2ZC1A 4GXWA 4F0LA 4XD4A 2I5GA 1V51A 4DI8A 4J35A 2FVKA 3WYZA 2P53A 2VM8A 1K70A 1UIOA 3S2MA 3PNUA 2YXOA 3UBPC 4P5UA 1FWDC 1XWYA 5HMEA 4B91A 4PE8A 1YRRA 3HTWA 2OGJA 1ONXA 3A4JA 3RHGA 4RDVA 4XD5A 4KEZA 2Z00A 5FSEC 4H9MA 2GZXA 2WJEA 1A5NC 4EPKA 3D6NA 2Z4GA 3N2CA 4R7WA 3AUOA 1FWAC 3PNZA 3OQEA 4CNUA 1J5SA 2I9UA 4Z42C 1QW7A 1W1IE 2KAUC 1R9ZA 1J79A 2OQLA 4H9UA 2HBXA 2Q09A 1A5KC 3B0XA 4DLMA 1E9YB 2WJDA 3ITCA 1PB0A 4H01A 2VUNA 4TQTA 4F0SA 3MKVA 2WJFA 4B3ZA 3DC8A 3V7PA 3GTIA 1YIXA 3URQA 1PTAA 2D2GA 4F0RA 2RAGA 2W9MA 1YNYA 4C6JA 4H9XA 1ADDA 4QTGA 1M68A 3IARA 4LCQA 2E1WA 4GK8A 4DLFA 3LGGA 3S2JA 4HK5A 4LAMA 4WGXA 4J5NA 1V4YA 1O5RA 3NURA 2FFIA 3MJMA 2R1NA 4C6BA 2VHLA 2Z2BA 1K6WA 4C6NA 2Z28A 3NEHA 1RA0A 1A4MA 1V79A 1KRBC 4CEUC 4LAKA 2GOKA 3GRIA 3TN3A 4H9YA 2PAJA 3ICJA 4GY0A 3FDKA 3HPAA 2AQOA 4IGMA 4R88A 4HK7A 1P6CA 1E9ZB 4B92A 3LU2A 2Z29A 4KESA 1KRMA 3DUGA 4H9VA 1NDZA 3GTHA 1ONWA 4QSFA 3IJ6A 4GOAA 2CZVA 4C65A 2F6KA 4MUPA 3LY0A 4QRNA 4PCNA 4EP8C 3GTFA 3ID7A 3B0YA 1FWHC 1PO9A 4R85A 4ERIA 3C86A 2Z24A 1YMYA 4IFOA 4NG3A 2G3FA 4DZIA 1EJVC 3IV8A 3F2DA 3EGJA 4NI8A 1V77A 4KETA 4B90A 3MDWA 3AU6A 4RE0A 4IFRA 1GKPA 4EPDC 4H9ZA 4KEVA 4IF2A 4G7EA 3DCPA 4QS5A 1RK6A 4XAFA 3O0FA 1M65A 1EYWA 1JGMA 3O7UA 1RJPA 3MPGA 3ORWA 4IFKB 1S3TC 4D8LA 4QROA 3URNA 2Z25A 3PANA 4GZ7A 3EWDA 3TN4A 4JOMA 1FWBC 1WXZA 2IMRA 2Z26A 2AMXA 3CJPA 3CS2A 4OFCA 4BJHA 4DO7A 4ERGA 4V1XA 3IPWA 3LNPA 1NDWA 3GU2A 4IG2B 4PBFA 4CQBA 3A3XA 3S2NA 4CNTA 2BB0A 2Z2AA 3R0DA 1FWFC 2OB3A 2VC5A 4C6EA 4DZHA 3KM8A 2R1MA 2PGRA 3CAKA 1EJSC 3LA4A 3UF9A 4CEXC 3F2BA 3RCMA 2QS8A 3OVGA 5CH9A 2DVTA 2VC7A 4LCRA 4KQNA 4CQCA 1IE7C 3GU9A 3EWCA 4GBDA 3MTWA 4NP7A 2QPXA 3T1GA 4HA0A 4DI9A 2ICSA 2DVUA 3SFWA 4GYFA 1A5LC 3E2VA 3F4DA 2YB4A 2EG6A 3TN6A 3QGKC 3LSCA 4EPBC 4UB9A 1NDYA 2WM1A 2R1PA 3RYSA 5LXXA 1EJTC 1KRAC 1QXLA 1FWJC 4RDWA 3F2CA 3E0FA 3TN5A 3GIPA 3LS9A 4C6KA 4LFYA 2UZ9A 1EZ2A 1NDVA 1GKQA 4DNMA 4I6VA 4RZBA 3QGAC 4LAOA 4C60A 4KIRA 4YIWA 3WZ0E 3GU1A 1EF2A 1ITQA 2PGFA 1A5OC 4LALA 4ERAA 4LEFA 1M7JA 1RJQA 1YBQB 3E3HA 2ADAA 4XD3A 2PUZA 4GY1A 1XRTA 4LANA 4L6DA 4L9XA 2HQAA 3OODA 3UPMA 5FSDC 4WHBA 1BF6A 2GSEA 4HK6A 4AC7C 4BKNA 3B40A 2EG8A 2OODA 1UIPA 3OU8A 3HM7A 5AKQA 1KCXA 1ZZMA 2E25A 2R1LA 4XAYA 1FWEC 2O4MA 4IFKA 1RAKA 1WXYA 4BY3A 2EG7A 4DIAA 3UR5A 2O4QA 4UBPC 3FEQA 3K4WA 3MVTA 3OOQA 1DPMA 3IRSA 1UMLA 3S4TA 3GUWA 4KEUA 1EJRC 4AQLA 4RDZA 5HMFA 4HJWA 3BE7A 2ANUA 3IACA 4C6PA 1O12A 1RK5A 4IG2A 4IH3A 5A6TC 3TNBA 4G7EB 4KF1A 4C6OA 4J2MA 1NFGA 4PCPA 3PAOA 3URAA 3S2LA 4E3TA 3T8LA 1A5MC 1ITUA 1P1MA 3F4CA 3JZEA 2FTYA 3MDUA 3PBMA 3E38A 3GIQA 3UR2A 4C6QA 1RJRA 3NQBA 4G2DA
chains in the Genus database with same CATH superfamily
4DEFA 5D4YA 1LF1A 1XH1A 1OZQA 5BZAA 5KZ6A 1D3CA 3E0LA 2VEIA 1WKYA 2QNEA 2QDDA 2VZOA 2O9RA 3TMLA 3IRDA 4UFMA 3S5NA 1E6ZA 4MIMA 1J6OA 1LWJA 3Q67A 3WQWA 1THFD 4GYKA 5CZKA 1M9HA 4H3DA 5HATA 2FMOA 4JAWA 2HWGA 3D46A 1XIEA 1XYMA 4M56A 3W7OA 5D37A 3E74A 3SSJA 5C0QA 3CYVA 4NJKA 1UMYA 3THCA 1UR1A 5H8UA 3DFTA 2OOGA 1QW9A 2VMFA 1SJCA 1ISVA 2A21A 1MNZA 4DUWA 4MFEA 3C2YA 4O19A 5CPSA 1U1HA 1W5NA 4NRSA 2WSKA 3WMLA 3AS0A 2FHCA 1R8LA 2GGEA 3AIWA 1CXFA 4KRUA 3DH7A 3LSBA 2VWTA 4PFMA 4JNMA 3MO7A 3C0LA 4OV9A 3O2LA 1ISZA 3LB0A 4XD4A 3APGA 3N17A 5D04C 4ZODA 3BOFA 3TOPA 2VM8A 2P0IA 1OFAA 3VUPA 3N2OA 4OV4A 3GNOA 3R89A 3NM1A 1H7OA 4J28A 5BWAA 4J3WA 2FH6A 1DL3A 4XZBA 5TF0A 1DJZA 2ZRWA 3DKLA 3LQLA 4JPGA 3HG5A 2GZXA 4Z2IA 3LCLA 4LGXA 5I02A 1VEOA 4Y2WA 3AMLA 4U2YA 4GJIA 1Q5MA 1S5MA 1O66A 3JUGA 4NZFA 3W7NA 3KVKA 1KV5A 1J79A 2CESA 3KAOA 2UV8G 1QPOA 4O14A 1WZMA 3EDDA 2EQDA 3B0XA 3H2OA 3K8MA 4DRSA 1GYMA 1OX5A 3RDKA 1DQWA 2MNRA 3U4AA 1KA9F 3TSDA 3IUHA 3TTYA 3RF9A 1KGXA 3URQA 2WWDA 3N2TA 4UC5A 3B8TA 3EEZA 1A49A 1ZBKA 5DEZA 1KM1A 1S2VA 2E7FA 4PTVA 3IVTA 2J24A 3KVJA 1TPDA 3WBXA 3MCOA 1IIHA 4HK5A 4JIPA 1OB0A 1FA2A 1YYAA 1PKNA 4BS0A 2FFIA 4UIOA 2QMJA 4BQ3A 3RO6A 4RE4A 3NEHA 1AQ0A 3J7HA 3W7EA 1QI4A 4O8RA 1CBGA 2GOKA 4GNJA 1TRIA 1BVZA 2V2DA 1RCXB 3W2MA 2ZXBA 1MZRA 2CLMA 5D38A 7XIMA 2I5IA 5LA2A 1EC9A 4EWJA 1O6IA 2VR4A 3VOJA 4UTWC 3LU2A 3OYXA 2OTDA 4XG1A 2W4XA 8XIAA 2WVSA 5BYWA 2KZHA 1JYWA 3BMXA 4XKYA 4PCNA 3KBVA 4PSPA 3LHWA 1UH3A 4MB3A 4H83A 6XIMA 2WPGA 3AICA 3JW7A 1F9CA 3G18A 2J13A 1ZGDA 2EO7A 3OO2A 3H53A 1P0BA 1TMLA 5G4EA 4RZ5A 1N82A 5C5YA 4AX6A 3E1F1 1B3OA 1RQHA 1MWOA 2BBFA 4FOJA 4G7EA 1T8XA 3OPSA 5EB8A 5DT5A 1JF6A 3EA3A 4I90A 3VGGA 4FXSA 4H2CA 3URNA 3JRKA 3LTSA 4G5DA 4AWTA 2AMXA 2NQJA 3QGVA 3MHGA 3U5UA 4MJ4A 1E0XA 5CCZA 2IXVA 1MXDA 3GNDA 4LB3A 4FF5A 1NH6A 3EOOA 4DZHA 1XL9A 2H3BA 1SSGA 4FLRA 4RE2A 2VD8A 3R94A 4AY1A 2OXNA 5IHSA 3R8HA 1NVMA 2CZEA 4D1IA 1A3HA 2FIQA 3SUSA 4S3KA 1T41A 2W92A 3I68A 4DI9A 4DUVA 2GVYA 2V5JA 1A80A 3T2OA 3N15A 4HTBA 4LUIA 3RLGA 3WUEA 1KWKA 1A5LC 3N9RA 4O1CA 3LDVA 4LNYA 3U7BA 3WFZA 1PX8A 2GVEA 3IIVA 3UERA 1FXQA 4JIEA 1R3SA 4O1DA 3F4VA 4P7NA 3Q65A 1JPIA 1FQ0A 1TVLA 3GIPA 2I57A 3IGXA 4DNMA 4RZBA 1TMQA 3STPA 1DJHA 4R5EA 2C1IA 1H1NA 1OABA 3RM4A 1A5OC 3RO8A 1XFCA 4ERAA 5LSMA 1EX1A 4TVUA 3BSMA 2E6AA 3QTPA 1JQVA 1YBQB 1D7FA 2BODX 2AMGA 1P6WA 1RALA 4YVVA 1Z9AA 5HXMA 2G50A 3GC5A 4LRTA 3CPRA 1WPCA 2JEPA 4PGLA 3HGRA 2EG8A 1LYXA 4LB4A 3UEQA 1VYPX 4WSHA 1ZZMA 2J47A 3W7RA 1D8WA 2QIIA 3RRXA 5CXPA 1ADSA 3ANVA 1AJ2A 4FXRA 1R85A 4PCSA 5KTLA 3K4WA 5C2CA 7REQB 1Q4NX 3IRSA 2EPKX 1C91A 1EJRC 2VWSA 2Z0IA 2QYGA 1CNVA 1XG3A 1GK8A 2QDHA 3B0UX 4XTDA 4KWUA 4UQEA 2WVVB 1DJYA 4ZE5A 3R11A 3SCUA 1C7TA 4GFSA 5T26A 2J75A 1HP4A 1DTNA 4B5UA 3GW3A 3MYOA 4Z08A 5EFFA 1XLBA 1UWUA 4HQVA 3KBNA 2CW6A 3L4XA 4QJ1A 3WF4A 1J6PA 2EPHA 4ML9A 4NZ3A 1TIMA 1TE6A 1E55A 2FB2A 3SCSA 1JCXA 1RY8A 1LJYA 1Y8BA 2G3NA 5DLCA 4LTSA 1A4LA 1J01A 2C0AA 4C6FA 3ERPA 2QVNA 1SZEA 4KERA 2PODA 1C8VA 2D2HA 2HBVA 3MP4A 5EMUA 3ZR6A 7A3HA 3RU6A 1HO1A 3QR0A 2WJZA 4ZVJA 1RP8A 4FNTA 4RX0A 3K30A 4LCSA 3A5FA 2VP8A 3ZZ1A 4UTMA 3L0KA 3SGUA 1I0DA 1FCQA 2QR6A 3M0IA 4PB3A 4N6EA 1OINA 2FVLA 2WPBA 5I03A 1GUVA 3SM0A 1I1WA 2YCIX 4M3PA 4GQQA 1OC6A 4YWSA 4NSBA 1GKRA 2HSAA 2D2JA 4FLOA 2JIWA 2ZXAA 3A21A 2E8ZA 4HP5A 3BLKA 3VIKA 2D3NA 3CT2A 3QH2A 2DSKA 3PG8A 1XGEA 2VI0A 1E3XA 4D6JA 4D6IA 5EPDA 1CXIA 4QEEA 4A2SA 3VABA 2BGNE 3HGSA 2CWNA 2XIQA 1Z7AA 4LYRA 1WZKA 4WJXA 4B2DD 3W1UA 4J35A 4JTJA 2FVKA 4UTTC 3WQ5A 2R82A 2GDVA 1BG9A 3PNUA 2YXOA 1LQAA 4XZNX 5FL0A 5TAOA 2E09A 5E1QA 1I45A 3LD5A 3AMCA 1BD0A 2JKAA 5CJ5A 1GZGA 5F4SA 4MLRA 2QHAA 4JX6A 1SR9A 1UKSA 3WD3A 5DT7A 3U0HA 4AXNA 4UWMA 4Z42C 2LLEA 2FHBA 1LOQA 2E8YA 3BMVA 3P14A 1QU4A 4GG9A 5HNNA 4EAYA 4G1NA 3CZGA 3BLDA 3M47A 2A6LA 3S42A 5H8PA 2QJIA 3NL2A 3FNDA 2W9MA 1HKVA 1TREA 2AL1A 4NVTA 4KCVA 3W6MA 2DIEA 4OOZA 3N2BA 4JL1A 2D22A 5IHRA 4WY0B 3SUUA 1ODUA 4B4FA 4I8YA 3NURA 4C6BA 1MI3A 4PUJA 4PN2A 1UJPA 1X1OA 4WDTA 1SSDA 3I3DA 4Z2LA 4GUGA 2GFTA 5AHMA 7ENLA 4RE3A 4ZB0A 2EJ1A 3ICJA 1I6NA 4W9TA 3VD3A 3M16A 4GVGA 2F84A 4WR3A 3IGSA 2WBGA 3TTSA 1HX0A 3AJXA 4KWOA 3WUBA 1VYSX 2CLOA 1W3JA 3H2AA 1YXYA 4HA3A 1GHRA 1OK4A 4XISA 1H09A 3EX2A 5CKSA 3C86A 4DBUA 7REQA 3AUJA 4O1FA 4DM1A 2IKGA 3VKAA 3ITVA 2YX0A 2VENA 1ZNNA 3ZLHA 1LQ2A 4WEVX 1EUNA 3NNTA 1WUFA 5E0FA 4KMQA 4H9ZA 1BKSA 4HHHA 3BXWA 3ABRA 3VK5A 3HOJA 3XINA 5MF5A 3PS7A 4QS5A 3EWXA 1J0HA 4MAVA 2WVVA 3O7UA 3ORWA 4U3AA 2J8TA 2WSQA 4F2BA 1AMKA 3KRSA 5D30A 3RPTA 4JOMA 4DF0A 3OHIA 1O5QA 3SN1A 3GK0A 1Q6GA 4UQ9A 4B3LA 4W7UA 1DJXA 3RR4A 3CHCA 4ZOCA 4OIFA 2Y61A 5AB3A 2CLHA 3R0DA 5D9MA 3PP7A 4A2RA 3KM8A 1FHDA 1UP0A 2NXGA 1H7XA 2Y6ZA 3VINA 2V2CA 2WZTA 3RCMA 1HVQA 5FD0A 1UD4A 1VEMA 4ZXLA 5AVNA 3LK6A 1YQ2A 5D03A 4NP7A 3E9AA 3T1GA 2WSYA 3U7VA 3CTTA 3TN6A 3MP5A 3CWHA 1FHVA 3B9AA 1VFMA 4FP1A 3GUGA 3UR7A 4CQAA 2QGYA 4IQLA 4E2OA 4AWEA 5JUVA 5LXXA 1D2KA 1U30A 4ZQMA 3VO0A 3TYZA 1V0MA 2GJXB 4LYPA 1EZ2A 4UR9A 1IXNA 5HWJA 2BVWA 1L6WA 3BJSA 2WNZA 4JTAA 1TIWA 4FF7A 3VIFA 2QZRA 4L80A 1ELSA 3E3HA 3L2MA 1GCYA 1LWIA 2GGGA 2UWFA 3BSHA 3KP1A 3I10A 4ILSA 4GKLA 2YIHA 1UB3A 5CJMA 2PDXA 4FB7A 3IK4A 4NF7A 4DJEC 4IIBA 1E6NA 1FRBA 4BKNA 4N9BA 3C2EA 1O68A 5C9WA 2QULA 2HVOA 3R8GA 4C91A 3GLCA 3I7RA 2WCGA 3GB6A 4FO4A 3QPEA 2GQ8A 3M5YA 3OVPA 4UMBA 3FJLA 5U7SA 3K1GA 3VKBA 1QHOA 1CT5A 3PSWA 1GVEA 3LHVA 1RK5A 3G24A 3B97A 4PCPA 3VDGA 1E51A 4IP4A 1JZ4A 3GXMA 3URAA 3CEUA 2CEQA 5AFDA 3RCNA 1XSIA 4K68A 4AY7A 2C1GA 1P7TA 1XC6A 5A2CA 1W37A 1UWIA 4JYEA 2C91A 3HF3A 4L9ZA 1TPH1 2QAPA 1DWJM 4E3VA 2ZX8A 1U2YA 4WY0A 4GZIA 4A8IA 3NOEA 1SZNA 2PE4A 1VCGA 2F61A 2A3AA 4NZ4A 3LRLA 5A8PA 1HL8A 3W76A 1EIXA 2YR1A 3SCNA 3TQ0A 2ZRXA 1LL7A 1ODZA 3L0GA 3VGEA 4AVNA 5T9CE 2PRMA 3NQ7A 4FR1A 3WN6A 1EOMA 3HZ3A 5EBAA 3MVIA 4XSMA 1WKFA 1KBBA 4DB7A 4F3HA 2VFGA 2J9ZA 5I0DA 3FOKA 4PB4A 1SW7A 1TV2A 3BAWA 1OF6A 3OJGA 1H7PA 3WNPA 4UTIA 4HNVA 2BY2A 1US2A 4RNIA 1UD6A 4DYKA 2WKJA 2BFGA 1RBLA 1UBPC 4XZIA 1N55A 1E15A 4LYKA 4KT2A 4HNLA 4UUIA 1VHNA 2G96A 4KS0A 4LOCA 3FYOA 1LT8A 3SUWA 3IJ8A 5BW6A 2QT3A 1UR2A 1Z44A 2P50A 3GWQA 2QJHA 3U3HA 2YCLA 8A3HA 1TG7A 1OG6A 1TWZA 1CYGA 4PTNA 5HULA 3NIYA 1QW8A 3UJ2A 4Q7NA 3S3GA 3Q94A 4FPSA 1Z6KA 1L8NA 1UIOA 4NI3A 4D6CA 3WF1A 1DEDA 1EJ7L 4UQBA 1EIBA 1ISYA 3A22A 1GEQA 4G1KA 1E71M 2O9OA 3HTWA 3LHTA 3GH5A 3LXCA 3CUGA 3TDFA 3HA1A 3EB4A 4FXFA 4JFWA 1C92A 4IPIA 5AC5A 4MNJA 3H7RA 1MW0A 5FAGA 3ELFA 3TKFA 1JDCA 3AUOA 3WQVA 4CNUA 2FFCA 1OFEA 2Y5SA 4H9UA 1S2UA 1VJSA 1JRBA 1TPFA 4S2BA 1UPMB 4LVGA 3O6AA 4F79A 2BASA 2WMIA 4HZ6A 2WJFA 1K8CA 2Y7EA 3LCHA 1OGBA 4M6QA 3CNYA 4H9XA 4W8AA 3SJNA 2J7HA 5HJXA 3BGAA 2JEQA 3APYA 1Y5XA 3VDBA 2W66A 1L2UA 3DHFA 1G0CA 3FJ4A 1L6GA 3DOPA 3L5MA 3LGGA 3S2JA 2C0HA 1KQZA 1GG1A 1O5RA 3VCRA 3MJMA 3AHYA 2ZFAA 4GNVA 1ZHAA 3HN3A 3AHVA 1KRBC 1R3TA 3UYCA 1WDSA 4O18A 1IT7A 1SJDA 1XYFA 3S1XA 2QDEA 2XN1A 2V2HA 2WKGA 1P6CA 1FTXA 5CSSA 1HTIA 2X30A 2A3BA 4S23A 4TX9A 2ZVRA 5K9DA 1QWGA 3DN5A 1MRAA 3IJ6A 2DZTA 4JIIX 3W87A 4Z1BA 2NLYA 4KBXA 1YX1A 3OGVA 4UOQA 3WK2A 3RILA 4GACA 2Z24A 1EPXA 5AC6A 3ARXA 2OLHA 3T44A 2Y0FA 1J10A 3WK1A 1Z89A 4GI9A 3KCOA 2CFFA 1XYBA 4MZYA 3W25A 4O15A 1REQB 1EEPA 3CMJA 5D2TA 1JDEA 3AOFA 1KR0A 1VBRA 1NWSA 2PDBA 3MS8A 1XC4A 1HJUA 3OQ8A 3STCA 2WHLA 1CPUA 4FS9A 3W7KA 3TN4A 1HXJA 1RP9A 3MWAA 1IT0A 4LRSA 5DBUA 3CJPA 5U4NA 2VZUA 1JXJA 3QM3A 3VYLA 4ERGA 3HGJA 2ASHA 4ORIA 3AWOA 2HROA 1DWAM 1HJVA 4UTLA 1OM0A 3UFYA 4YL2A 3P0WA 2V81A 4MNKA 3PJXA 4C6EA 4QSHA 1H1ZA 3KP0A 1EJSC 1DP0A 3B8DA 3UF9A 1OYCA 3EMQA 4KCUA 2A7RA 2VOTA 4MYAA 2DVTA 4HKPA 3TYBA 5REQB 3GS6A 1K9FA 3EEGA 3F5KA 3HQPA 3W7MA 4YYFA 3MV01 1Q6EA 1FY6A 3ONCA 3WQ8A 3E2VA 2PP0A 4KKXA 3CZJA 5L6UA 1PZ0A 3GAKA 2I56A 2WM1A 3W1QA 3NQEA 4ZCWA 4MGGA 4QAWA 1T0OA 1XCXA 3A6OA 4O12A 4Z1DA 1IR2A 2PU0A 1AMYA 1JCTA 2UZ9A 1F7BA 4R9OA 1QHZA 4M82A 1SJBA 1R47A 3KBMA 1ZENA 5E09A 3T42A 2V3EA 3TU9A 5LIYX 4M6PA 3JZUA 1I75A 1KBJA 5A8GA 4L9XA 4I5XA 3UPMA 1E72M 4ROQA 2YSWA 4HK6A 1A47A 4ZOBA 3P74A 3TC6A 1G1YA 3A47A 2HMCA 2R1LA 2ZX6A 1S3HA 3WJZA 2O4QA 5B7ZA 3BG5A 4NJGA 1OVDA 3ZMRA 1MFVA 1DIKA 3ARVA 4MFDA 1BGGA 2XN0A 3C0JA 5DF0A 3V0TA 4CKQA 4DJDC 2D0FA 1PDZA 4TMBA 1RLCL 4Q4RA 4CUCA 1YDNA 3PAOA 1E56A 1MUCA 3OIHA 5BWFA 1XIFA 2NQZA 4UMAA 1PDYA 5L9FA 2W79A 4XUGA 4UFHA 3WSUA 1B3ZA 5FI8A 1AL7A 3GIQA 4QAIA 1EJUC 1LBFA 1BKHA 1ZSXA 3ANUA 4FNQA 5E0CA 4B5TA 4EE9A 2OWXA 3AS2A 3S6DA 4CCCA 3KTSA 1R5YA 2A2IA 1GPFA 4IQJA 1T6MA 1GNXA 3LMYA 1FFQA 1GTHA 1WP6A 4ZEPA 1R9YA 3PBGA 4L9YA 1VFSA 4CQDA 1HP5A 1PIIA 1B9ZA 4S3BA 4JS3A 4JKKA 4W85A 2J4GA 4L4LA 4YXGA 2MANA 4N6FA 2DFAA 2V0TA 2ABAA 2GVLA 4TXEA 3B4UA 3L2IA 3GXTA 1O95A 3VGBA 3SRHA 5DBTA 3BTNA 4MADA 3QY7A 1IR1A 2BVDA 2Q01A 3TW9A 3G1VA 1Q6CA 3GE7A 1LRQA 3PZMA 1EJWC 3TQPA 1XH0A 4B5NA 3PZOA 1GOQA 1VD6A 1TPUA 4JTFA 2E28A 3LRMA 3UZYA 1UUQA 1DYSA 1REQA 3VVGA 3ZYZA 2WMJA 1E43A 4FR6A 4C5ZA 3BLIA 3AZTA 1E1FA 2XIOA 1PCKA 3UPBA 1OGGA 2JQXA 1ZALA 2PU1A 2PB1A 1J2BA 4UFJA 3LOTA 3BARA 2H90A 2RGLA 2X40A 4YHEA 3NQMA 1VKFA 3WKZA 1UH2A 4DELA 2NT1A 1LP6A 2OO0A 1VCFA 3TAKA 3I3BA 1QASA 2REQB 2G0WA 3A24A 3R10A 2R94A 3G1YA 1V6XA 1JAEA 1WKEA 2Z4GA 2QW5A 3GIYA 3V0SA 1JCMP 4CNNA 1VLIA 3N6QA 1B5TA 1UC4A 4B5SA 4GWEA 4JTKA 1GWJA 1V3LA 4CQ9A 3GC4A 1DJNA 1OT2A 2RDWA 1WBHA 3N34A 1PB0A 4F0SA 3SN4A 2RH9A 2CZ5A 3C6CA 3VDAA 1PTAA 5IDZA 1OK6A 1LZOA 4C6JA 3TQVA 5F7UA 4ZE4A 1A5AA 1IXOA 2JKPA 5A94A 4M81A 2DJLA 5FEPA 2YL5A 2Y70A 3FHAA 2DV0A 5GJMA 4QLKA 2OLSA 1X1NA 2R1NA 3S1GA 5RUBA 3S9IA 2VX5A 4C6NA 1Y0EA 1AG1O 3G5EA 3TH6A 1AH4A 3U4FA 2YFOA 1QI0A 4I5UA 3ZVHA 1PZ3A 4DNHA 2AQOA 5HR7A 2PFHA 1FXPA 3F5JA 3TYAA 3JU2A 1JQXA 2I1OA 1Q45A 3BVJA 4MWAC 1GOXA 3QTGA 2B7OA 3LLFA 4PUEA 4AD3A 3BCJA 2WMFA 1UZ4A 3THDA 5HQMA 4PMYA 2Y8UA 4HPXA 3SEPA 1ZP3A 3VPLA 4DZIA 4NI8A 1XYLA 2D69A 3G8RA 3FJ6A 2D1ZA 4R7JA 3LM3A 3PSVA 1BWKA 4WXZA 2R24A 1XLHA 4HNOA 4XAFA 1RK6A 4W87A 9XIMA 1RJPA 1XV8A 5LIWX 2X2YA 4GXPA 3NA8A 1CLVA 3WK0A 1M1BA 3VA8A 3E49A 3CIWA 3NOYA 1FWWA 4W7VA 1FWBC 1O4UA 3DECA 1TCDA 2Z1BA 4U3CA 2VVSA 4B9ZA 3I65A 1G5AA 1M7XA 3W00A 2V5CA 3M64A 4D9PA 1W5QA 1AL8A 1KR1A 1GOWA 3THAA 1VH7A 2PTXA 2PA6A 4F0HA 4GVHA 2Z2AA 1GORA 3VMOA 2ZDSA 1RV8A 1US3A 1AQFA 3TJLA 4GUJA 3BW2A 3FV9A 4QHRA 3F2BA 4JQ2A 4ZTYA 4GUHA 2X8RA 2QS8A 5FF7A 4LU0A 1SO5A 3NVDA 4J3UA 4GIYA 1JDAA 1AUSL 4G8TA 4AY8A 2XFWA 1XRSA 4DO5A 1KCKA 1BPLB 1JNEA 1VR6A 2J25A 2YDAA 1JYXA 4HPNA 1J0YA 2QCHA 4X63A 3KDNA 2HS6A 1EJTC 3RX4A 4HNCA 1KM3A 1V0LA 4DVOA 1XBZA 4AZBA 2P76A 3B0VC 3B06A 2VEMA 2E0PA 1H41A 1ZQ5A 1TB3A 3ZT7A 3E2SA 1WAWA 1WCGA 5ABHA 1RCOB 2GUUA 1KM0A 4AHPA 3UWUA 2D3LA 4KIRA 5ENLA 3M44A 1FUYA 2YA1A 1F73A 2I7GA 4NIRA 5D2VA 3TXVA 1NWUA 2XH4A 3UGRA 3BOXA 1RSCA 2ZTJA 4XTIA 1G6CA 3D3FA 1EC7A 2NVAA 4LEQA 1UUMA 1JPHA 4NASA 2C79A 1SW0A 4JY8A 1WDPA 5C8BB 1SZGA 5T9BG 2OODA 3KL0A 3EX6A 5I06A 3W71A 1X6LA 4N42A 4JQ4A 3W1MA 1OCQA 5C9RA 1TA3A 4GO8A 4UMCA 4D6DA 3S5SA 5E6ZA 1EHAA 5KZEA 2DW6A 1D8CA 4KPLA 1F5ZA 4A8LA 2B81A 3ABXA 3PBWA 3GBDA 3AHTA 1XCFA 4NZ1A 3AIBA 4IG2A 2PP3A 4PZVA 2PI6A 3GXNA 1BFNA 4J4KA 1A0DA 4KWVA 1TQXA 4BF9A 1TJ2A 4UFKA 3MSDA 4O13A 1R3WA 3U5YA 3U57A 4TTGA 3M07A 1ICSA 1W31A 3F1QA 1IV8A 4BF5A 2TRSA 2MUCA 4KWSA 3EB3A 3VIHA 1XD0A 2Z1XA 1X6NA 4QGCA 1XIJA 3UG3A 3VAVA 1BHGA 2NQLA 1OC5A 3KS5A 1F07A 1UUOA 1BRLA 3PJWA 2G3IA 2OGYA 4RZ4A 2X0HA 2ON3A 2BHUA 3BOLA 3WLHA 3WEZA 4AMCA 5LNVA 4ALDA 4C5YA 1SO4A 1C93A 4M51A 4HPHA 3GFXA 1X96A 4L5ZA 2AGTA 1KFBA 1VFOA 3SN0A 3CV2A 1OSEA 4AVFA 4O50A 3PPFA 3MUXA 2DZPA 5GQBA 4C6DA 1T96A 3HPSA 4HSOA 1HW6A 4PUNA 1HJSA 1PWLA 1V5XA 1YDYA 1POKA 1LRTA 2J9YA 4K7YA 3WEOA 3ARWA 4NXKA 2EPOA 4GZJA 2VTFA 3LX9A 4QS6A 4W5UA 2A3LA 1FWIC 2YB1A 2ACSA 5CC5A 1J9YA 2WSRA 1EC8A 4MTVA 3UXLA 3ZWSA 1BQCA 2CERA 3WDJA 1FKWA 1E9IA 3LPFA 4POCA 3FK4A 3PG9A 4H8HA 5EMMA 4OVXA 4HU0A 3WF0A 1IZKA 3VE7A 4P5UA 1FWDC 1RCQA 1CIUA 3MY9A 3W07A 4L7ZA 4Q8VA 2NLIA 3QMTA 1CTNA 3MZNA 1CGTA 1TV8A 4KEZA 2Z00A 4BQ2A 5BMXA 2AOSA 2ZUUA 2WJEA 3EWBX 2DIJA 3W37A 2H9AB 3H2MA 5G2HA 2XN2A 1J5SA 1K7XA 1H5YA 3NZ1A 1XIMA 3KVLA 5HA7A 3CQJA 3STGA 6TAAA 1DJQA 5HMSA 5EYWA 4RNHA 3W2KA 3ABZA 4IPPA 3IUIA 4DBSA 3TTOA 4Y8FA 1N7KA 1X7FA 4LUSA 5BRBA 3AFBA 2RUSA 1EDQA 1ADDA 1LL6A 2J7EA 4KW2A 1PZ1A 3K8LA 4N4PA 1IWAA 1VCVA 4YN5A 1CGXA 3QW4B 2WWCA 2ACRA 4KGLA 1KD0A 1LLOA 1V4YA 3T05A 2I14A 1M04A 4Z1CA 3DC0A 3QHMA 1K6WA 3VDHA 4GE8A 4A4AA 1XG4A 1F61A 3TR2A 3N6JA 5DMLA 1AODA 1K7EA 2FB3A 3CXOA 1YNPA 4HCDA 3ZM8A 1JL8A 3BW3A 2X1UA 5CJNA 1LRNA 4R3UA 4GISA 3TQKA 5HDRA 5D8ZA 4Q7IA 1W0MA 4CCDA 2X42A 4NX0A 1SFJA 1Q6OA 1ONWA 2B0MA 3RX3A 2HCVA 3RJYA 1EO5A 2CLPA 1PO9A 1L0PA 2BY0A 2FZMA 1AH0A 3MI3A 1XUZA 2AQWA 3WLKX 1YTEA 3DI0A 3GR8A 3MDWA 4NKCA 4LBRA 3H4XA 1TUXA 3FY1A 1PX3A 2PURA 4DWDA 4JTGA 3TNOA 3QKEA 5I79A 2XZ7A 2VDHA 3G1RA 1MMFA 3PTKA 4FLSA 3L4YA 4RK8A 2DSWA 2HEJA 1LROA 2OEJA 2Z25A 2ZYFA 3S1UA 3C56A 4OHQA 2DEPA 2IW0A 3CBWA 3P8JA 2W0UA 1JCNA 2BXVA 3C3NA 4DZAA 6REQB 4M24A 4F9JA 1PCWA 1NDWA 4PBFA 1PHQA 3WD0A 3NFUA 3GXDA 3AIRA 4HMNA 3BLEA 4R7OA 4US6A 5I00A 1RQBA 1WQ5A 1FCBA 2ATSA 5BOFA 4CEXC 4CGTA 1J5TA 2CBJA 1J4EA 3IIZA 2C14A 1IE7C 4O4VA 2BP1A 5JXQA 1SFSA 1DWGM 4K39A 4PRRA 3N3TA 1MSSA 1WDDA 3GR4A 4B3KA 1VBJA 3N4FA 4NU7A 5FJJA 3WD2A 5DXYA 1F4HA 4MWAE 2R1PA 5M03A 4XAPA 3UYIA 3OHMB 4O52A 4OE7A 2PRHA 3M7WA 3NTYA 1AFSA 3FYPA 4S3FA 4NAFB 3M6DA 4ZO7A 1J0JA 4NT0A 4V2XA 4LALA 4O1AA 4AMAA 1W3TA 4UQDA 5KMYA 3WLSA 5AHIA 2P1FA 1IEIA 4X61A 4Q4MA 2CLKA 2G3JA 5FSDC 2PPGA 1K8ZA 1XDLA 2D23A 4JTEA 4P7LA 1BF2A 1W1TA 4I9MA 3B40A 3B8VA 3NVTA 3PZVA 1XINA 5CPLA 1EHNA 3FEMA 3K4AA 4N9DA 4V15A 5BU9A 4TR9A 3Q4DA 3HPXA 1D3GA 4RNJA 5D05A 4KEUA 4QM1A 3NZRA 4AQLA 3TVAA 5HUPA 2DU2A 3W6LA 3ATYA 3BE7A 4C6PA 3TCSA 3W2LA 2O7QA 3LBCA 3UVIA 3WUFA 3TE9A 1Q2SA 3S2CA 2A3EA 2PWGA 3TJ4A 1PKYA 3WQOA 5FEZA 3VMNA 4X9SA 3CEPA 1UW9A 1A50A 4MY8A 4IPLA 3LZ5A 4JYFA 2J78A 1GQKA 3VKDA 3ZO9A 1VFHA 1X97A 3IAPA 3T55A 2ZC8A 1G9HA 2HPMA 1A5BA 4XX6A 5BCAA 5CPOA 4HN4A 3H22A 4GX8A 4NNCA 1PWMA 1E9LA 3FA4A 4FXJA 1FWCC 3SDOA 4YTTA 2VZTA 4CU6A 3UXKA 3LGDA 3FDGA 1PYFA 4W8BA 1L6YA 2VRJA 1KO0A 3DI1A 1XGZA 3SB0A 4DF1A 2VNCA 3BANA 3SO7A 4EXAA 3PWGA 3M1ZA 1A53A 3W38A 3LLDA 2DT3A 1EOKA 4WJEA 4XKMA 5DRCA 1DBTA 5I78A 4X9YA 5DCEA 3CQHA 2ZRVA 4WOZA 1ICPA 2PZ0A 2Y85A 3E5PA 3R0UA 4JR5A 2DVXA 4K1WA 1TWIA 1A5UA 3QV9A 3UZZA 1XS2A 3NSNA 1WZAA 5JQ9A 4S2CA 2J88A 2VGBA 4C1NB 3QVQA 1UA7A 4NYYA 4DI8A 3M0YA 3WYZA 1IGWA 2HZGA 2XVNA 3S2MA 1VBHA 1KFEA 3UBPC 7ODCA 2IS7A 3UU0A 2I17A 5HMEA 4X3ZA 2XFFA 3P7YA 3KCJA 4GVIA 4BR1A 4QCEA 2Y63A 2WXDM 1W9PA 1CB2A 1LLZA 3GHTA 1H50A 1TPB1 5FSEC 3VKJA 2WVTA 3GG1A 2R6OA 2X41A 4ZOAA 1KKRA 1FWAC 1I4NA 4HNTA 3OTRA 3GD6A 1W9UA 3PB0A 1ZLPA 3W01A 2V5BA 2BS9A 1M5WA 4IMCA 3I4KA 4UTFA 4JICA 3VNJA 3WMBA 2D2GA 3GFZA 4LT9A 4OZOA 3TYDA 2ZZ1A 4Q4SA 3SCQA 2NXHA 2GK1B 3E2RA 3NO1A 3B04A 2OWWA 3ZWTA 4H1ZA 4BZYA 3AYTA 1XI3A 4US5D 3NJ3A 1W9BM 3O0KA 1RA0A 2EKGA 3CLMA 2WCAA 4QDWA 3SADA 4Z1AA 4ZO8A 3GRIA 3ARPA 1UJQA 5KZDA 5G2WA 4IGMA 2Y4SA 1CGYA 2CYGA 3LPGA 5AZ1A 2ONEA 2WZHA 2VEPA 1YDVA 5MKGB 4F4RA 1CXEA 5A8MA 3EKGA 2FDMA 2BVYA 2QUVA 2VOMA 4MKNA 3T40A 1NFBA 1JZ6A 4CCEA 2W6RA 2NQ5A 4MUPA 5IRPA 4O17A 4R53A 4GPNA 4NG3A 4YCPA 1XYAA 2XU2A 1GG0A 6CGTA 5HQEA 1EDTA 1I8JA 1VBUA 1E0TA 4QIUA 2C19A 4IL2A 3BAJA 1PBGA 2NXIA 6ALDA 2DSZA 3EPMA 3DCPA 2FLIA 4CCZA 1OT1A 4OU1A 2YL6A 3W29A 1TVNA 4HIBA 1NTHA 3SSZA 2O55A 5HWMA 3EX1A 2D0HA 3THQA 2IMRA 2WHJA 2WW5A 3W1RA 1P0KA 3KE0A 1TZ7A 1UD5A 1PTGA 2QKFA 4Z0JA 3W23A 3PPCA 3S2NA 4QX4A 5DX7A 1AQHA 3REQA 1K8YA 1CXHA 2V67A 1KM4A 3P67A 1RVGA 1YXCA 2X7WA 1TJPA 1B9BA 2XH2A 2Y8KA 3HGOA 2PWUA 4IIEA 4OUIA 5HPOA 2QVHA 3UW6A 2ISSA 1QAPA 5DY2A 3CAWA 4Q4PA 5I24A 3WNMA 1TO3A 1E73M 4X0NA 2ZZ6A 4REQB 4ZO9A 2PDQA 4PC8A 2DZAA 5G1TA 3T2QA 4D1JA 1ZS2A 4L61A 1AJZA 4E2VA 2CHNA 4MWAB 3R13A 2YLLA 3PTDA 5CSYA 2BSLA 2QJGA 1E0VA 2ADAA 1JEZA 2PRLA 4U5IA 4LANA 1YHTA 3WQ6A 3P80A 3H7UA 1BYDA 5HUOA 5CBBA 4I5RA 4UNLA 5DELA 2E6FA 4YU1A 3HM7A 1M6JA 3VIMA 2FKPA 4QJ4B 2Q8LA 3PWAA 4IFKA 2BLEA 1C8YA 2BTMA 2ZZ3A 4RKAA 4C7DA 3GUWA 2ISFA 1EBGA 3ITTA 3OLIA 3CUJA 4ADTA 3CYJA 2FTPA 3C52A 1SFLA 4B9YA 4HA4A 4GQBA 3VNKA 1NFGA 4IMDA 1SM9A 1S39A 5A69A 1D9EA 3AWNA 3NDYA 4R27A 3BQ5A 1E4LA 3FKRA 5CLWA 5FJOA 3TTEA 2UBPC 5AHLA 1VPXA 2EHHA 4FI4A 2DZXA 1UA3A 1XLGA 3LV5A 4D6GA 3UG5A 4RUBA 2YLAA 3AALA 5E5CA 2CIPA 4A3RA 3BGJA 1VS1A 5IBXC 3P93A 3GG7A 1EP3A 1QATA 3SURA 4QG9A 5EMJA 3GVQA 1JG9A 2IKIA 2FH8A 5A6MA 1N8FA 1U33A 3G77A 4IGNA 1TCMA 1EWEA 3AXHA 1KFLA 1QPNA 2XFRA 3WDPP 3DIPA 2HVMA 2VURA 1BXBA 4NY2A 2Q3OA 3W1AA 2VGGA 4DBDA 1SZRA 4MB4A 3WFLA 4AYGA 5JBEA 4K7VA 4C6CA 1GQIA 3BSGA 1FWSA 3G3DA 1QHPA 1Z69A 1S5NA 4QLLA 1TPVA 3LV6A 1K8XA 1TX0A 4DPQA 4GYPC 3FCPA 3P3BA 4JD4A 4Y7EA 3MO4A 1XRFA 3KOFA 4XAGA 1F6KA 1FP9A 5A8NA 1EX5A 3VD4A 4RW3A 1M41A 4K38A 2NSXA 2HNEA 2ZC1A 4DJFD 2YFNA 4LWWA 3W24A 2OYLA 4H8NA 4IHCA 2PDPA 4GCXA 1O60A 3GDTA 1TVPA 3R25A 2VC6A 3NPUA 1XWYA 1IEWA 4WJ8A 3N04A 3NL6A 4LYQA 2BZNA 3RHGA 1V3KA 2A5HA 1GOKA 3L4VA 2Z6JA 2VDGA 1QR7A 1TTQA 3ZJ7A 1GQJA 4UTKA 4JKMA 3CC1A 4R7WA 1W1A1 2X0SA 3RIKA 4EVZA 1F8IA 2ZWZA 2KAUC 3TEVA 3CPUA 1P5BA 2Z6IA 2A1YA 2ZQ0A 4TQTA 3ZXWA 4A8NA 1X6UA 2PLKA 3MKVA 3H2NA 3ZIZA 3W9ZA 3A4WA 3GTIA 1R2TA 1TV5A 4QCFA 2HTMA 1F2JA 3QZ6A 1JIBA 5D09A 3WLPA 4JTDA 4FIRA 4PTDA 3R8RA 3T9PA 1BSIA 1MQPA 2HE5A 2BOGX 4P8WA 4GUIA 2XFYA 1EWDA 3HPZA 2ZADA 3GFYA 3T7VA 1PZ2A 2QF8A 1PTDA 3KW3A 1PHWA 3PZGA 3DESA 3GDRA 3WNNA 4LC8A 3B03A 4AF0B 3QR3A 4AIBA 1SUXA 4PCFA 4JFSA 1NWRA 2P10A 3C2RA 4GXMA 1JNDA 3N2MA 4OECA 2FPTA 4LAKA 4RL3A 3SCWA 3H2EA 4H9YA 1Q3NA 3W7HA 4HK7A 4MDOA 1JZ7A 3NPXA 1XKYA 3EDEA 4Q32A 4DYEA 1GT8A 2NWSA 2HE8A 4JTQA 5HJYA 1ZFJA 1AW2A 2RDXA 2A85A 3CZKA 4GI4A 4XZWA 4QRNA 1PVNA 1A0EA 3EKLA 1BWLA 1TTPA 1U5VA 1FWHC 3B9EA 4B4HA 3W2NA 3STEA 4JL2A 3L23A 1NY1A 3LLXA 1JZ3A 2EGZA 3VZXA 1NELA 1GKPA 4EPDC 1VZWA 1Y65A 2XVGA 4O4WA 3G6LA 4Q8UA 4QNWA 1M65A 3GX9A 3L5LA 4GVFA 4L4OA 1QOQA 4WX2A 2X2GA 1FDZA 1AW1A 1I2OA 1VP5A 4GZ7A 4US5A 1EPVA 4IL0A 3W7GA 2W91A 2JALA 3E2QA 4P7QA 3B9OA 4DO7A 2XGZA 4ZZ9A 1UR8A 4W4QA 3TV8A 4H7ZA 3LNPA 4PEKA 4CQBA 2BB0A 2ZZ7A 3DZ1A 3MBFA 3W53A 3WLJA 4N9CA 1KWGA 1LBLA 8XIMA 1Z42A 1TYGA 4DN1A 1B57A 4JIQA 3WLTA 1VPQA 4JDBA 4FNPA 3OVGA 5HINA 4CQCA 3V75A 5C2GA 1F6PA 3EKZA 5GPRA 1W8SA 3S83A 3O06A 4ZGYA 2AKMA 2ICSA 4WOQA 1SMDA 1ENUA 2F38A 4LQ1A 5CGTA 3NGJA 1QJWA 1BYCA 5LGZA 1JFXA 1OX4A 3EOSA 4D72A 1FWJC 4O0QA 5I23A 4YCOA 5ABFA 3TN5A 4PFHA 3W7PA 4Y6GA 4RV3A 2C7FA 4AHOA 1MFUA 2QCGA 3G6MA 3CUXA 3BZGA 4LAOA 4XB3A 2OJPA 2F2KA 2J7FA 3BCDA 3GU1A 1TRDA 1SGJA 4YNGA 1M7JA 4AZHA 4XD3A 1R7OA 3ANYA 3FSTA 5C54A 5A3HA 2Y62A 5CPQA 3UWEA 2A79A 3UESA 4JHOA 3YPIA 4HVXA 4DZ5A 2E68A 4JFUA 4XZLX 3VOGA 4R9XA 4DWSD 4OJYA 3KOZA 4GBUA 4I7VA 3HFYA 3ZS4A 4YLWA 1GJWA 2FZBA 4X2RA 5CC6A 2G95A 1E40A 2F8QA 2G37A 1Z48A 4G6CA 2GVGA 4Z17A 4P8XA 1E1CA 3VCCA 2Q6ZA 1G4EA 4ZQPA 4AD0A 1V02E 1W1YA 2NVCA 1RY0A 4U10A 4NX5A 3OG2A 3T8LA 1EKOA 4UNKA 2QV4A 2F7FA 5FF4A 1SW3A 1R87A 2FTYA 3MW7A 3VCNA 2IQTA 1YNQA 3O6DA 3HFTA 1RA5A 2CLIA 3NZGA 2DUXA 5AYIA 2HPIA 1XPYA 2V38A 1R2RA 3BURA 4J3TA 1ZCCA 4AF0A 1Q7QA 3KL5A 5M5DA 1QOXA 2A7NA 1VBGA 2PLMA 1POJA 3T81A 1UD8A 3IJQA 2HNHA 5HR6A 4IIFA 3GAYA 1AJ0A 2VELA 2ODOA 4PB5A 4XQ6A 1F05A 3HV9A 4AEOA 5A6AA 4AD5A 2QEZA 3QY8A 4GQ0A 4EPEC 4WD0A 2CETA 2XUCA 2F6XA 1RZMA 4FLQA 3QV7A 3DFQA 3SZ8A 2WLYA 1LLWA 4ML4A 2E5BA 2DSVA 3K5XA 2QIWA 1M03A 4AZCB 4UTUA 3LPOA 1J96A 2WVUA 3MANA 1UZ1A 5CAKA 2QCFA 1XD1A 3ISIX 1K4GA 1BYBA 2ZX7A 2PDUA 1KM2A 2QCNA 2PBOA 1KQYA 1PPIA 3TSBA 1TPC1 2E5DA 4YTUA 5I3IA 3WG6A 5AY7A 1KNWA 2Q8ZA 1JI1A 4IMFA 2GQ9A 1UWSA 3F4NA 4H9TA 1U5JA 2V5LA 5K9CA 2PWEA 2QCDA 3I6TA 4QFUA 1LCOA 5KZMA 3MI2A 4FOKA 1B4EA 1K70A 3T6CA 3FHQA 1WBJA 1NOWA 1TR1A 3GVWA 4LAZA 1UC5A 2GUBA 1O1HA 4TX6A 4FNUA 1NU5A 3QKZA 3CZEA 3ZT6A 5AN7A 3LXBA 2XHYA 3B9DA 2QGHA 3B8SA 5CC3A 1HJXA 2ZRZA 2WOQA 3GH4A 3N2CA 4AX7A 2VFFA 5I3JA 1OCBA 3M7SA 3BJTA 4R34A 4QJ5B 2FZ9A 2YYUA 1L6FA 4NXSA 1TWWA 2HBXA 2Q09A 3PBYA 1H51A 3LCXA 2VUNA 5CZJA 4B3ZA 3K8KA 3NGFA 2FPYA 4J3ZA 3QOKA 5HOSA 4BQ5A 2ZZ5A 3SQMA 4N02A 4BWLA 4AZ7A 3QN3A 1OEPA 4LCQA 4GRSA 3N2XA 2PF0A 1CDGA 1JD7A 3W74A 2NX1A 2PGEA 4J5NA 2WYSA 1TTIA 1JF5A 4DJFA 2FDSA 1D7KA 3KLLA 3AS1A 3CQ0A 4U33A 1QMLA 2Z28A 4F66A 2PDLA 4L64A 3SRFA 4DWSB 4AH7A 4X0VA 2AL2B 3TX9A 1HQTA 3TZNA 3DFPA 3SY1A 4ZQRA 1GEHA 1GTEA 3HPAA 3GXIA 2ACUA 3MJYA 3GKAA 2YBVA 2PDNA 3AZRA 4UTHA 1MQRA 2CZDA 3ZR4A 1HGYA 4LXFA 4PMUA 3LY0A 2WBKA 2UY3A 3NSMA 1A3WA 4EP8C 5EMLA 3UJEA 6XIAA 3UG4A 1EB3A 4Z1YA 2B7PA 4XZHA 4MMWA 4J3SA 3T0AA 3EGJA 3DBNA 3GHUA 8TIMA 3W3OA 1ITXA 1ADOA 3EDJA 3R2GA 3V0UA 1ZAJA 2J8GA 3GC2A 3AIEA 4BF7A 2W62A 4DO6A 3QSTA 4EWND 4IWWA 4CU7A 1L6SA 4PSRA 3AXMA 1R3VA 4IXXA 5FJRA 1H7RA 5CGQA 3EMZA 4H7CA 1OYAA 1R46A 4NYUA 3QMRA 3OLEA 2D24A 2XIJA 2JGYA 4EANA 3IJ9A 2J7BA 3VC5A 1F74A 2YBTA 3MUY1 4PUMA 1R3YA 5C7HA 3HO8A 2BWGA 1LQ0A 1JJKA 4CLMA 4RZ6A 1XP3A 3RUBL 1X38A 4UR8A 3TWAA 2JGQA 3CAKA 2IUZA 3TA9A 3COTA 4N9EA 3U6WA 3QR1A 5TIMA 1GOIA 4MB1A 3GHSA 5CH9A 3FJNA 1UQYA 5MHBA 1BEUA 4YS1A 1GVIA 2YYTA 3F7JA 4PCTA 1BLIA 3TK7A 5AOUA 3GDBA 4EK7A 5J8LA 2DVUA 4AZCA 3LSCA 1FCVA 4MF4A 4JKLA 5H6HA 4WSKA 2WHMA 3TZFA 1B30A 3WCZA 2Q3RA 1PXGA 4UOJA 3PZIA 1V6UA 2DPEA 4I7UA 4YIWA 3AMGA 3BW4A 4JN8A 4ZMGA 5LGXA 5C7VA 4U2ZA 3LG3A 1XKJA 1OZMA 2Y2WA 4ECLA 1ZJIA 4M6UA 4OBSA 2YA0A 3WF2A 1UWQA 2BOEX 3CMFA 4JFVA 2H6RA 2DUAA 2GSHA 3M0MA 3WENA 1OCJA 4M1BA 4IX0A 1LM1A 4MB5A 5EMYA 1XQKA 3NQGA 3QV6A 1ME9A 5G1MA 3PFMA 3CZ8A 2EJAA 3AXIA 1R0MA 3OU8A 4GGHA 1WV2A 1TKKA 2GJRA 5F1VA 3W7DA 1ECEA 4QLJA 2EG7A 4DX3A 2PLJA 2VL4A 3SUTA 4HNNA 3HU7A 2O9TA 3LENA 1PIGA 4N0RA 4ATLA 4K36A 2G97A 3QEZA 1UR4A 3INPA 1XBXA 1Z41A 1QNPA 5BXRA 4F8XA 4IH3A 3W85A 2OELA 4C6OA 2PC4A 3O15A 3GR7A 3ITLA 4W88A 3EXRA 2FYMA 3L4ZA 3CTLA 4M7TA 3OA5A 3MDUA 3CZLA 4U5KA 4TVDA 4O0KA 4JTHA 2XH7A 1FDYA 1AK5A 2INFA 3VTRA 4BI6A 5XINA 3XISA 5BRPA 3BDKA 1BTMA 5F4XA 2CKSA 1JI2A 1GONA 3DERA 1DORA 1GZJA 2AL2A 1KRCC 3W7IA 3BG9A 2YDQA 2PDJA 1U1JA 4NHVA 2NZLA 5CZTA 4LY8A 4ZL1A 4JTSA 4HOXA 4O10A 2DT1A 4KCTA 5M3WA 1XIBA 5ABTA 2C15A 5CQ1A 4PUUA 4E4PA 1YBQA 1IXQA 3R4IA 3WBYA 2ALDA 2RFGA 4O8AA 1UKPA 4GC4A 1ALDA 1UKQA 3SUVA 1Q2RA 1E4IA 4D6FA 1K1DA 4NAEB 5BXPA 3RN6A 3FXGA 1QTWA 3EOUA 4LH8A 5D2XA 1I0BA 3UWVA 2XSXA 2ZUMA 1J0KA 3ITXA 4FNSA 4LAUA 4C6MA 3P5ZA 4ZSTA 1I2NA 2JE8A 4Z2KA 4LS2A 2FZNA 5A8OA 4HSHA 4M5PA 2BNJA 4DPPA 3UZWA 4LUTB 2ISDA 2ZA1A 1BSLA 1XLCA 2DORA 1HN1A 5I3KA 3UJFA 4ATWA 3N25A 1VHCA 3EYPA 4HT3A 4P2VA 4B91A 3SAZA 5LYRA 1FDJA 1GVOA 4PMXA 5H91A 2PDFA 2VEKA 3MQTA 1YEYA 2UY4A 3R1ZA 3IJIA 1JZ2A 3WJYA 4CD6A 1TTJA 4QE1A 3CHFA 1CENA 1S46A 1WB0A 3LEPA 5GJPA 3VNYA 2POZA 4E5TA 3ARYA 2F2HA 1KLYA 3G3MA 1QW7A 1BQGA 1U22A 5FKYA 2Y5JA 1H7WA 5JH2A 1A5KC 4Q4QA 4Q8TA 4ZQNA 4L6OA 2V30A 3VIIA 3DC8A 3V7PA 4OT7A 4AC1X 2DZWA 1KTCA 3USZA 1YNYA 4HSNA 5D9NA 3NO3A 4F0MA 1JR1A 1LUCB 4Y9AA 1R3RA 3QQ0A 1MEHA 3KOXA 4JQAA 4GK8A 2C3ZA 3A13A 2J8FA 3W6YA 3LTPA 1EGMA 4E8CA 3WJXA 1J2WA 5C70A 1J11A 2Q02A 3UPWA 1A5SA 2OEKA 3KBSA 3FGCB 5GVJA 5FJIA 1NJJA 4H8UA 2PD5A 1T99A 3WQPA 4AG0A 1AZ2A 1K03A 4GY0A 4EAMA 1I2RA 3DG6A 1F3XA 2A0NA 4W8LA 1S38A 3IIPA 4H8VA 1JDFA 1QBBA 1YPXA 1TPEA 1HL9A 1JPDX 4G7FA 3A4AA 4RW5A 5LNUA 1C29A 4AXKA 2YDRA 3CAVA 1B31A 1EXPA 3DGRA 2QXWA 3GZAA 4R85A 1BVNP 1EJVC 3G1DA 3WQFA 4ES4A 1S1RA 3PPHA 1RPXA 1XUUA 1Q7ZA 1E6SM 3RM8A 3S6OA 3O0FA 4JY9A 2WNWA 5DCBA 2GJPA 5AHFA 5LA0A 3W1NA 4XIMA 2PSNA 1KTNA 1VRXA 1B3VA 1HKIA 3PANA 1V02A 3NYDA 3W2JA 5M17A 3VD5A 4AVOA 3VOIA 3CS2A 2XWEA 4D8ZA 1QFEA 5I07A 2DDXA 2BY3A 2PDIA 2JBMA 1W5OA 1EEXA 1XSJA 3G8EA 1JCJA 2VC5A 3VFCA 1GVSA 1TJ0A 1RLDA 4PL1A 2NV9A 5BXSA 3LZ3A 3CQIA 4QBXA 5JBFA 1EA9C 2Y8VA 1VLWA 3MSYA 3VGDA 3ARRA 2WB5A 3V1PA 3TC3A 1CB7B 3R5EA 1RR2A 1AQMA 4JNYA 5DMMA 3SFWA 4TX8A 2EG6A 4J1OA 1J8VA 1JGIA 2BOFX 4NILA 3GDLA 2QAFA 3QC3A 1GJUA 3V35A 3PBVA 1WAUA 2O92A 2XIIA 3PJTA 3GYCA 1IGSA 3KOYA 2PMQA 3GNXA 1ZL1A 3GW0A 4IMGA 5FJUA 1IEQA 1ITQA 2PGFA 1DJWA 3CLWA 4LEFA 4C1KA 1W1ZA 3DHDA 2J74A 2AAAA 4L6HA 2GSJA 4L6DA 3RLVA 3C0QA 4AD2A 3AISA 1EQCA 3I7QA 1E5JA 3UJSA 1LOSA 1UR0A 1OFPA 1G67A 4MAZA 1G7VA 5E6YA 2EAWA 2GVJA 1VC4A 5IM51 3UG8A 3A64A 2VJXA 5C9ZA 4BFAA 2DH2A 4PMNA 5JIPA 1PIFA 1U83A 1HVXA 4S38A 1FWTA 2VR5A 1YADA 5D2WA 2X1IA 1AVAA 1CLXA 1TFVA 3TW6A 4HTYA 1EP2A 5D32A 4MJ2A 1FVPA 5A6TC 1V6WA 4A05A 2DZVA 5D8WA 1XLAA 5C2XA 5AZ0A 3BV4A 2ZUNA 4ONVA 1ITUA 4U28A 1I1XA 1EO7A 2VFIA 3GXFA 1VENA 1W3HA 4CD7A 1U5HA 1LUCA 3W86A 5DMYA 4GA8A 4U31A 3VGFA 2VYOA 4O0ZA 2ZX5A 3QC0A 4PMQA 4B5WA 1AD4A 2QLYA 3CGTA 1P0DA 1IYXA 5FF0A 3MWCA 2WKLA 5HWNA 2X1RA 3BLLA 2X1TA 3NQFA 1NEYA 2WMGA 1R2SA 1MW1A 2TODA 4HCHA 1QPKA 3ZJ8A 1EF3A 3P2VA 4QQUA 3VM7A 1Z8AA 3ONBA 3ZQ9A 3URBA 1TZZA 2GJXA 3H8AA 4WIWA 3WQ4A 3KS6A 3QW3A 3ARZA 3ITOA 2PWFA 4E2DA 4B2DA 2QQ6A 2WK2A 3CM4A 2VX6A 4OKDA 3DBPA 2TAAA 3KLKA 3CB8A 4HNUA 3T0DA 4ZSUA 1V7AA 5FA5A 3MKCA 4V1YA 4XSLA 2VD9A 3MP3A 2OQHA 1LG2A 1PSCA 1W32A 1ZJHA 1TV7A 4HHPA 1MEWA 3QY6A 4RXGA 3HJEA 3UWQA 4XWUA 3M9YA 3W4RA 2WC4A 2BXZA 4XKYB 3OZYA 1OFBA 2VKZG 1XRVA 3WD4A 4MY9A 3FN9A 6TIMA 2J27A 3BJFA 1NQKA 3GSMA 4EXBA 2ZCGA 2ZZ2A 1DWFM 1PE1A 1SZFA 3PZNA 1ZJAA 3W0KA 1EQPA 3K46A 2DJXA 2E6YA 4GI6A 2ZOXA 3H2FA 4GYJA 4YVPA 1PJ9A 3BAXA 4IGHA 1A5NC 2BXYA 4EPKA 3IIOA 3EOEA 4S3AA 1UD3A 3PNZA 5DFAA 4M29A 1ZAIA 1JUEA 2IPWA 1TELA 3RGTA 4Q8MA 3PF3A 2FZ8A 2VX4A 3MCNA 5T91A 2P3EA 3H4GA 1H60A 3IGUA 3VNMA 3D0CA 5FF3A 1F76A 1SYTA 4LVBA 4CNOA 5FJPA 1LORA 1GQLA 1I9CB 3FVMA 3F5LA 3NEVA 4C7FA 2D2OA 3GTNA 2E1WA 3POCA 1P43A 2WNQA 1KBLA 5LNRA 4GH3A 1GOMA 4DUXA 4UR7A 4HU3A 1OD0A 4ZENA 3WJWA 5EA9A 1W6TA 3E0VA 4AWSA 2NQ9A 1XX1A 2IKHA 2J66A 4ICCX 5K4ZA 1FH8A 3RFAA 4LV9A 3OZPA 1GVRA 4IP7A 3IJDA 2GUYA 2P3ZA 3TOYA 3N4AA 3V5CA 2ZUTA 3K13A 4XUYA 2V8ZA 5G5IA 1YLVA 2NWRA 4QSFA 4MSSA 2CZVA 3CAQA 5LIKX 1W54A 3W27A 3HQOA 4G9PA 4Q8WA 1JVNA 3JR2A 2ZTKA 2A3CA 4XO7A 3WEMA 4EKJA 3IV8A 4I9AA 1V77A 1OIFA 2YDSA 3B4YA 5M1TA 1QT1A 3VKKA 1C8XA 3PBUA 1OADA 3CO4A 1K6AA 2GQAA 1CX9A 2AKZA 4FX7A 1R3QA 2ZE0A 4YTRA 3NO5A 5C9XA 3LXAA 3CHDA 2W27A 1FP8A 1DIOA 3V5FA 2OX1A 4ZOEA 4CVUA 1KCZA 5XIMA 2HJPA 3CH0A 3TUUA 3PZQA 1G01A 1IZJA 2YZRA 3NAVA 2QJMA 3A3XA 4CNTA 2OB3A 1VEPA 1WDRA 5I3FA 4KGJA 2QPUA 2H3DA 3RXZA 5CGMA 1VFTA 3NQ2A 2UY2A 3GQYA 4Y9OA 4KEMA 2ZXQA 4KQNA 3D5HA 3N18A 4GBDA 2XISA 3WQGA 4WKHA 2A7PA 3P62A 3T4WA 2OSWA 4KIEA 3KRUA 1WOAA 3WH5A 2XWDA 1O5KA 2VEGA 2I5QA 3BLFA 2Z1KA 3CMGA 4I9TA 3TCEA 3UXDA 1DJGA 1KRAC 1ML1A 5BU6A 1UYQA 1GHSA 3RJXA 3IV3A 2ZZ4A 2YCJA 4XIAA 1H61A 3CO8A 3RAOA 3W81A 3VIJA 2HS8A 4JX4A 2UY5A 2OCZA 2D20A 3M0LA 5DMNA 5F2MA 1VPYA 4GIAA 3WDRA 1QO5A 1OD8A 4ZO6A 4YVXA 1F3TA 2HXTA 2CWXA 3P84A 4AZ6A 1LBMA 4HZMA 2GSEA 4A3QA 4CD5A 2WQPA 4FIQA 1YTDA 1GQNA 3HV8A 4L56A 3RLUA 1Q13A 2OPJA 3UZXA 1G69A 3VNDA 2VCCA 4O54A 3T07A 4OBRA 4A3YA 4HCLA 4O1EA 4JN7A 1E4NA 4H19A 1GYLA 4PR4A 5AC7A 2HRWA 4UBPC 2YXGA 1A0CA 3QHOA 3HJZA 3PFRA 3KXQA 3W82A 5F2GA 2QCCA 3EB2A 2IQ0A 3W02A 1UWRA 4HMDA 2BX7A 3DAQA 1MVYA 4H6RA 3L0NA 3HG3A 1DWIM 1QNQA 4TTUA 2V9DA 3MYPA 5BOEA 2Z1WA 3SR7A 1TX2A 1ZP4A 2NUYA 1H7NA 2GPTA 5F4WA 2E77A 1NP0A 3E38A 3PM6A 3ABQA 4QE4A 5REQA 3CB3A 2XGIA 3LMZA 2VGIA 1CGWA 3LUTA 1WUEA 4KRTA 4MVAA 2EEXA 3G0XA 2YCKX 3PHAA 4DY1A 4I6KA 4LY4A 3DXIA 3QRHA 5H2ZA 2OQYA 3M43A 2Y7GA 3D47A 3PAJA 3EWWA 1GOOA 4UTWA 5KINA 4CVWA 3LHYA 4AZGA 3PY2A 3S9ZA 4PL2A 3BLPX 2CBVA 1TV3A 2E6DA 1HZYA 3Q2DA 2PDCA 1YPIA 1E6RA 2PWDA 2DQXA 4HBKA 3MSRA 3QXBA 1CCWB 2YXXA 1PV8A 3R12A 4GO9A 3MHUA 5CG7A 3W72A 3A3WA 4ZFCA 3POHA 1XLFA 3QHNA 3W28A 3AYSA 2CXEA 3MI6A 1SU5A 4A21A 3I6EA 1VGAA 2CHOA 4PMDA 4M8UA 2QUTA 2IKJA 1L9WA 2DP3A 4MJMA 4P8VA 5IXEA 3NDZA 1KFJA 2J6XA 5AHEA 1WZLA 9XIAA 4DQWA 2VO5A 2QCEA 2QV5A 4LF1A 4AFYA 4DJED 4NQ1A 1WE5A 4MPQA 2KX9A 4J3XA 1E5NA 3AXKA 3TA6A 1V6YA 1MXGA 4RDVA 3EPNA 1ZJBA 3E12A 4E4FA 3AYRA 3KCLA 3U2CA 1DQUA 1EDGA 4Q4KA 3WIJA 4MOZA 4JIHA 3D6NA 1K4HA 1GZ1A 3CQKA 4Q33A 1WX0A 3SJ3A 4IX2A 7PTDA 1O94A 2XDFA 3BLOA 1H0IA 5FESA 3S8HA 3EDFA 1R6WA 1V3JA 2OQLA 5K4XA 1K7FA 4Q8NA 1VQTA 3GM8A 2EPLX 1ZU8A 3KTXA 4MPKA 1W3KA 4K2SA 3FW6A 1YIXA 2PTZA 1FH7A 1RUSA 3IIXA 4MY1A 5A6SA 4QTGA 1OY0A 4WY0F 4XBJA 1M68A 1UOKA 3W75A 4IQDA 4KFOA 1KXTA 2ZDRA 4GQRA 3SI9A 1GYNA 1YPFA 3DFHA 4GIRA 5A95A 1FWRA 4NNAA 2NQHA 4EXQA 4NZ5A 4ENLA 4HZ7A 3PUEA 2R9RA 3PZTA 4H2HA 2ZWYA 2OT1A 3TN3A 5HNRA 1UOZA 4BEUA 3UY8A 1QNRA 3C4UA 3AMDA 1JPKA 4F2TA 1LOLA 2Z29A 4X22A 1KRMA 1ZPTA 4LW7A 2ZICA 3PR2A 3CIXA 1T5AA 3BCFA 4GOAA 5G2IA 3P8IA 2F9RA 2X0YA 4K8HA 4FNRA 3MMDA 4V28A 3B0YA 3NSXA 2QMKA 5KEZA 1GGOA 4GD0A 4GIEA 2JF7A 4KETA 3FVDA 2HISA 1EGVA 2VZSA 3AU6A 4PYSA 2V69A 1W17A 2G8ZA 2IPGA 4K8EA 3VGHA 2W5FA 5KITA 3O07A 3WLMA 2REQA 1KXHA 3MPGA 4C90A 5DQPA 2FPVA 3LCWA 2PWHA 1EZWA 3W1TA 3MSGA 5AYBA 4IQEA 3UZJA 2ABBA 4XO6A 1UPPA 1AA1B 4UFLA 3UVAA 4IM4A 5I5RA 1HJQA 1UWAA 3NL5A 2OZ0A 1P7TB 2PBGA 2OFJA 3ME3A 1QI2A 2PCQA 1TSIA 1XBYA 4U4MA 4ZTXA 4LCRA 2OR2A 3HMCA 4JQ3A 2YPIA 3T08A 3W22A 1XLKA 1ONEA 3SCOA 4S3GA 3F4DA 1W3NA 1DXIA 4EPBC 4UB9A 1NDYA 3M0HA 5A1AA 3AROA 4AEEA 4HZ8A 3S1VA 1OJXA 2E40A 4S3JA 1E3ZA 3CUIA 3WL0A 3R7MA 4K1GA 1UHVA 4P8UA 2VZVA 4WK9A 1DJIA 3MUIA 3ZJKA 4DF2A 1E6XM 3W26A 1KB3A 5CZ0A 3RX2A 3SCPA 1OQFA 3IEBA 4UTTA 3O6YX 1XQLA 1RD5A 4GINA 1UQZA 3KHDA 1G4TA 4K8GA 4PTWA 3OODA 2WQDA 3EX4A 1KGWA 4M80A 5CSRA 1I2QA 5ABEA 3LYEA 1H2JA 1OFOA 4AC7C 3UJRA 3M0JA 3WQEA 1A5CA 1UIPA 1OWQA 3RLHA 3DFSA 4ROPA 2YCLB 4Y9PA 3C8FA 4KCWA 3SCTA 3OOQA 3QZEA 3QF0A 3EWUA 4ZB5A 4IICA 3S4TA 4WDWA 4LUYA 1ZB5A 1JUKA 1C9DA 1V93A 4H7VA 1E4MM 1S5VA 2JIEA 2V82A 1TWSA 2POTA 4C7GA 4HU8A 3UY7A 3VX1A 3M5XA 3KTCA 2YKKA 3DDMA 3Q45A 3MZ2A 5AC4A 1KKOA 1HJWA 1JXKA 2VGFA 3TMQA 4RNFA 3UR2A 2OKOA 2XYLA 3NQBA 3GXPA 1JYVA 4JTCA 4PH6A 2XG9A 1KXQA 1ZRQA 1PAMA 4AU0A 3PULA 3G1XA 1RBOB 4K37A 2WMIB 3DYOA 2QUMA 3SQSA 3NQ8A 1V03A 4LF2A 2Z27A 3N9SA 4C6IA 3PZUA 4INFA 1FH9A 1UZHA 1XISA 4IMEA 5A6JA 2WM0A 4XAZA 4GLEA 4BI7A 1XH2A 4P7RA 3CHVA 2BG5A 5AYXA 3M5ZA 2G4FA 5C6MA 3V4BA 1H5VA 3P0XA 2VDIA 3QZAA 4AIOA 3APTA 4ICMA 2TPSA 3L9CA 3GG8A 1W9XA 4PBEA 3NWRA 2O0TA 4ZQCA 4H4IA 3AIVA 3O8AA 4UNIA 5I2UA 2AQVA 3GNPA 3BH4A 2HK0A 3MU7A 1L2QA 3GNRA 5EGRA 3DFNA 5FJTA 4DUOA 3N14A 5JU6A 2Y7FA 3TW7A 5BNKA 3M0XA 1HFBA 4ACYA 2C1HA 1HKJA 5FEWA 1IQ8A 1ZBWA 1OYBA 3VKCA 3QJAA 4F0LA 3E02A 2W3ZA 1V51A 5I3HA 1W56A 2NUXA 3VM5A 2X16A 4Q3MA 4GCAA 5KSWA 1XLJA 1SJAA 4QISA 3T0BA 4AW7A 1XJBA 4N4QA 1KBKA 1MQQA 1CLKA 1DE6A 1ONXA 5FCZA 1J93A 3QYSA 5FACA 1WOBA 3PWIA 4PEEA 5J04A 3T4CA 3IJLA 1KGUA 4BI5A 1P0EA 3GNNA 2J9XA 1LTDA 2C13A 2WC3A 4MLJA 4OGZA 4TOQA 1H62A 1W9DM 2O56A 2DZBA 1W2PA 2CBUA 3CWNA 7CGTA 1S2WA 2OEMA 3IUDA 1E9YB 3N19B 4DJDD 1XLEA 1CWYA 1X1ZA 2PDGA 3EMCA 3OZOA 3LN3A 4OTKA 4MKSA 4W84A 4IMAA 3KVMA 2RAGA 2J62A 2G3MA 3NM3A 4HPGA 1S2CA 1R86A 2INZA 1WDQA 3GBEA 3OZMA 4OWGA 3UD6A 4DAIA 4IPNB 2OMAA 3WH6A 3UA4A 1W3LA 4CU8A 3MC5A 3VX0A 1V79A 4J7RA 4CN1A 4H6EA 3M0KA 4GJJA 4CEUC 4DJEA 5ECVA 3OIXA 3GDKA 2JKEA 3QOMA 1FHLA 3OYZA 2PC8A 3SECA 4PMZA 4KESA 4XZ9A 4ATDA 3NQAA 4H9VA 4AEFA 4JTRA 3WDHA 3GTHA 1M01A 3QV8A 4P7OA 4W86A 4KRZA 4F40A 4YHGA 1ITCA 1XR2A 1MDLA 3QFWA 3GTFA 3P82A 3C61A 3S5YA 3K1DA 4ADSA 4ERIA 3VOCA 1OFDA 4MDPA 3AO0A 4A29A 5FOOA 1B3WA 3HURA 4HD5A 3VNIA 2QDGA 4KFNA 3WD1A 1F4AA 3RPDA 3BICA 2ZX9A 2TMDA 5E70A 3NZQA 3OW1A 3GVRA 3S47A 2H9AA 2CLEA 5HQLA 3TFCA 3IVSA 2CBIA 2XSBA 3TYCA 2G41A 4YWIA 2YJQA 2EPMX 1QPQA 3RM9A 4URIA 4F9DA 2QCLA 3BQ6A 2J7CA 4IT1A 1E6QM 1OX6A 2X09A 3E96A 5A8QA 2PGRA 1TZ9A 5GNZA 2C6QA 2HDJA 3ZOAA 1XFBA 1V3MA 2Y88A 3TSMA 3GVVA 1DE5A 3CV6A 3MTWA 1KCLA 3O1NA 2BHYA 1QNVA 3ARQA 4HA0A 4F2UA 4UCFA 4WKFA 4GYFA 4M1RA 3JVAA 2C8NA 1YTKA 3UNDA 3QQ1A 2L5HA 1X39A 3RYSA 2VCBA 4OBTA 2SFPA 3L66A 4RDWA 1E0WA 2CKRA 4Z2GA 2E4TA 5GNYA 3OG3A 4Z2HA 3HB9A 2ALRA 1FBAA 3AIQA 3BV7A 1IWPA 3BMWA 2BGSA 3GG0A 1V0KA 1RJQA 4ZB2A 4PTMA 2PWVA 4IP5A 1XDJA 1XRTA 3H70A 1OG0A 4Z0SA 1NSJA 1BF6A 2EF9A 1T8QA 4LVFA 3UETA 1G4SA 1ZY9A 3CL8A 4YMZA 2DW7A 1QNSA 3BAIA 4EF9A 2E25A 2V68A 2V3GA 1VIZA 2B4GA 2VQTA 3KWXA 2OLAA 3H55A 2O4MA 4MWAD 1NP2A 5HAOA 3G1SA 3V1HA 4E8DA 2DUZA 2ZIDA 3MMWA 1IEXA 3SRDA 1EL3A 4RDZA 2CC0A 4HYVA 2NX9A 4MM1A 6REQA 4AZ5A 4HA1A 3OVRA 2HXUA 5JVLA 3C5QA 3TNBA 4IPJA 1JCYA 4XZMX 1B0IA 1DXEA 1XGDA 2ZUWA 4PMOA 3UR8A 4GUFA 3S2LA 1GW1A 1P1MA 5FF2A 3OBAA 3PBMA 4A3HA 1ISXA 2EXOA 2RDTA 4RXFA 2V5KA 1PUDA 1FWGC 1Z3NA 4CNSA 3G0SA 3TJIA 1V8EA 3R6IA 4TO8A 4QEHA 3DX5A 1MW3A 4UZSA 4BQ4A 3W7QA 4Z2JA 4LV4A 3FFSA 4UFIA 1RHCA 2VFDA 4H6KA 1PS9A 3AZSA 3A12A 1X8FA 2OOFA 3FKKA 2DZUA 6ENLA 4IUGA 3TTQA 2R1KA 3QMSA 4PMVA 1XLDA 3E0WA 5HMDA 1VF8A 3NQCA 2YL8A 3RPMA 4NAFA 2NUWA 3VZYA 4BA0A 3M4HA 3FYYA 4JGDA 4EACA 2FTWA 4XBSA 1Y5WA 3FX4A 2H8ZA 1B2YA 1V08A 3C2FA 3KHJA 5A6BD 3CV7A 4LPCA 4ORMA 3ZVHB 3U8GA 1P6BA 4EF8A 1B3XA 3MMTA 3NQ6A 2PDWA 1WO2A 2Y7DA 3AQUA 2HK1A 4L4MA 3G1AA 3KRZA 3U48A 1V6VA 1T40A 4RDYA 5EFDA 3TROA 4QNEA 1Q6DA 5EBUA 1PKMA 4O16A 5I09A 4Q8QA 4L4PA 4PTXA 3AJ7A 1UR3M 4NZCA 3ARSA 3N1AA 3WBAA 1OBAA 3NQDA 2B7NA 2YCEA 3PJUA 2VEFA 3RMEA 4QG8A 4AZIA 1CZ1A 5LA1A 4IGSA 3DG3A 4P61A 3C0SA 3OBEA 5A6KA 4RJEA 4NUWA 3LNMA 4W5ZA 3MB9A 1WA3A 3VD7A 3ITCA 2WJDA 3EXSA 4XBKA 1SFTA 2WANA 4O11A 3VOHA 3VMPA 1G7UA 1WXJA 3FLUA 3RU8X 1ICQA 4X60A 1QI3A 2XM2A 4S3EA 1IWBA 1QNOA 2CXGA 5FL1A 2VFHA 2Z1SA 1TJRA 4GABA 3T78A 1B90A 3RITA 3WNKA 4MZ8A 2H8XA 1L8PA 3EA2A 4I7WA 3EDKA 2PDMA 4QXIA 4M19A 3OB8A 3GO2A 4IISA 1E1EA 5JH1A 1Q66A 2Z2BA 4MNLA 3BL3A 2JF6A 1GPWA 1DVJA 3B05A 3WDQA 2QUNA 1LWHA 2OU4A 3C2OA 1J0ZA 4MZ1A 3SIZA 4PODA 4R88A 1HG3A 3GY1A 1T7LA 1LG1A 5JMUA 9RUBA 3HBLA 3CUZA 1XICA 2OZ3A 3A9IA 3MA8A 1KFKA 5LKYA 3LM7A 4S39A 1YE6A 3TFXA 2IXUA 2QJNA 4C1NA 3G22A 4IFOA 3OVQA 4NJJA 5DRIA 2G3FA 4NJIA 1V0NA 3F2DA 1W8GA 4WXYA 3U2OA 4DJDA 5LNWA 2CU0A 3VU2A 4KEVA 3AYVA 4M0XA 1TUFA 4IF2A 1KXVA 5F1UA 4CN4A 4TUFA 2ZUVA 2GYIA 1H63A 1AZ1A 2FJUB 1EYWA 1S2TA 4Q6XA 3U2EA 2WCSA 2XINA 5DN1A 1UH4A 3SBFA 4D8LA 1TA3B 4QROA 1XYZA 3LTYA 4RPPA 3N73A 3ZR5A 1XW8A 2Z26A 4YYCA 1BTCA 3N29A 3N4EA 4LS0A 4V1XA 4TU1A 3ZLGA 1ONRA 4QDMA 2ZXDA 4IG2B 1MDRA 4YTQA 1Q8JA 3S6TA 3PB2A 2NSOA 1MZHA 3NUKA 5JIWA 1Q8AA 7TIMA 4J27A 4B5XA 1V3IA 3KDOA 3LA4A 3QLLA 3WELA 1QRQA 3GVGA 3SFKA 3BO9A 2BMBA 3QBUA 2GK1A 1R30A 3I7SA 5FAJA 5IDIA 3VC6A 2OSYA 5CG0A 4CD8A 4PUKA 1RVKA 3L65A 1N2VA 4A8RA 3QGKC 1BRLB 2P88A 3LI1A 3PC0A 1WNOA 5LZLA 3PN8A 4FX6M 4D6EA 3E0FA 5A6LA 4Q7BA 3W70A 4XV0A 3LS9A 1ZTVA 1EA0A 3C8NA 4I6VA 5MKGA 4AAJA 2GL5A 4Y9NA 3SQLA 3Q58A 2E9MA 1ZAHA 1EF2A 4N2YA 3STFA 4O53A 2INEA 5C9UA 2GJNA 3V18A 3DFOA 3GKFA 3CH9A 4RR4A 1H3GA 2VT0A 1XLMA 3L4TA 4MJZA 4JEQA 3AHXA 2Z1VA 2VRKA 3T09A 1X8CA 5B7YA 4JTIA 4C1LA 3MUCA 1GVQA 2YA2A 2BV9A 2ZA2A 1K9EA 2YOCA 1UKOA 1QVBA 2Y24A 5AKQA 4GI8A 2Y89A 3NL3A 3KBJA 3N9KA 3WQDA 4HYRA 3ITYA 4JCLA 3WFAA 2XH0A 3WBEA 1Z32X 1X98A 3S1WA 3GZ3A 4EIVA 1D3HA 3MUZ1 4RPQA 3HQNA 4Q8OA 3LCIA 4JFTA 3MBDA 2D73A 3LCFA 4CQ8A 4EX4A 1Q63A 2VCAA 3IACA 3L67A 1NM9A 1OGSA 2J77A 4KF1A 1DHKA 4E38A 2GGHA 1V6TA 4AD4A 5EL1A 5I3DA 4JNZA 1SO6A 3ES7A 4MNMA 4DM2A 1UCWA 1Q65A 2AAMA 4RLIA 4HGXA 3JZEA 3LBMA 2WO5A 3KEHA 2GJLA 3SGZA 4G2DA 1MUMA 2ZUSA 2Z7KA 1QUMA 3QSRA 1GW9A 2D0GA 1GJPA 1RBAA 1VJZA 3ZSSA 4AB4A 4Y9MA 2I16A 4WVXA 2WHKA 2WMKA 2DT2A 4HOZA 1TWDA 4R33A 1H11A 4REQA 3WNOA 4LUSB 4B15A 5BRQA 2A4AA 4Q8PA 2O9PA 5AYZA 4MKVA 3IJ7A 1VFLA 4MWAA 2GWNA 1CXKA 1XBVA 9CGTA 2FMNA 1HNYA 3QPZA 2ISVA 3BK0A 3PVFA 4GMEA 4G56A 3GTXA 3UQNA 3LHUA 1JUBA 4A3UA 3K2GA 3AU2A 1JCLA 3KZSA 3RNDA 4XD6A 2OT0A 3IGHX 1AH3A 4WLCA 1P1XA 3BAKA 4K6AA 3ATZA 4GC3A 5CPNA 2WV8A 2GLKA 5TBOA 5J5RA 4JYDA 5LIXX 1P0NA 2QF7A 1AW5A 4Y8EA 1SPQA 4HMCA 3WL1A 1NIUA 4FSAA 3BAYA 8CGTA 1TJ1A 2ZKMX 1MEIA 3H7VA 4JZ5A 5HJLA 1RH9A 4H6QA 3ALGA 4WKAA 3TR9A 2X05A 5TNVA 3TLLA 1J12A 4MYXA 4QE5A 3FS2A 1YRRA 3WH7A 1UD2A 3A5VA 2XVKA 2XVPA 3BC9A 4WCJA 1FX6A 5K9XA 3G1FA 4XD5A 5I7GA 2NX3A 4H9MA 3RG6A 4UQAA 5LNSA 5GJNA 2FQIA 5EU9A 4PBGA 3MMUA 1FOBA 3OP2A 4B5VA 2R8WA 4WRHA 4TV5A 5CC7A 3LGEA 5A2AA 3OQEA 2ZA3A 3EXTA 4DXKA 1R9ZA 3AI0A 4AHQA 5CSUA 1OFRA 5D9PA 3SGGA 2QCMA 5EY5A 1MW2A 1BXCA 5A6BA 4DLMA 2VC9A 3WLLA 4LBSA 3BGGA 3FXYA 4ACZB 3FA3A 3SRKA 5ECUA 1NWTA 4M6VA 2IQDA 2OZ8A 2PTDA 1HO4A 1DIDA 1HL2A 3TC7A 1H1YA 2YW3A 1IEVA 1Q6FA 3IARA 2Y5EA 1Q6QA 2V3DA 1NF0A 3AC0A 4DHGA 1OCNA 4DBEA 4WDUA 2XVLA 3H2CA 4LAMA 2C18A 4L1XA 2GOUA 4NL1A 4S1FA 2E9LA 2E3ZA 2CCRA 3IANA 2OKTA 2VHLA 1HT6A 3UWWA 1C90A 3PUOA 3WQCA 3II1A 3RMJA 3T8QA 1GVYA 1PX4A 3LBOA 3NDOA 4O57A 3DHUA 3AS3A 3TAOA 1UASA 2Z2UA 4GH1A 3KWSA 4FOUA 4QDPA 4GNKB 3H23A 1K9TA 1UROA 1VRDA 4JXCA 1DIEA 1LT7A 5BOOA 3XIMA 3I4EA 1NDZA 4MUZA 1IZCA 3V16A 5BXTA 4C65A 2F6KA 1NAL1 2OWCA 3RRAA 6PTDA 3C3UA 2DH3A 3KRBA 5SWUA 3NXLA 3FSUA 4LJ3A 1W9VA 5AHNA 3MHFA 1XIGA 1IXPA 3GDMA 2PDHA 1W5PA 4J2PA 3P61A 2HV5A 3R58A 3OLDA 1NQ6A 2PEVA 2V3FA 3LQGA 4AUBA 1CGVA 1DQXA 1EH9A 3HIJA 4JQ1A 2ZRYA 3L4WA 4YPJA 2WZEA 2XIBA