5L6UA

S. enterica hisa mutant - d10g, dup13-15, q24l, g102a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
233
Chain Sequence
MIIPALDLIGGTVVRVVARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords HisA
total genus 79
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5l6uA00
1W54A 2YSWA 4OE7A 4NX0A 1YTDA 3BVJA 4YMZA 1MO0A 2WQPA 1VZWA 5GVJA 1GG1A 2QF7A 1KM4A 4MOZA 1AW5A 2QCLA 3JRKA 4HNTA 3CLMA 4AXKA 4TIMA 1F7BA 1RQBA 5I3HA 1ZNNA 2Z1BA 3W7LA 1R46A 2X1RA 5EMUA 4BI5A 3SGZA 1DV7A 4LC8A 3TSDA 3EWYA 2RDUA 2QCEA 3G1HA 1OYAA 3HF3A 4X3ZA 3DI1A 2WSRA 5D32A 2GUUA 5TBOA 1O4UA 4NXSA 3TSMA 3BO9A 3PS7A 2XN0A 3LBMA 1ZCOA 4X22A 5EYWA 3K30A 3T55A 1MZHA 4K37A 3TK7A 4N9DA 2V8ZA 2CZEA 2C3ZA 4O28A 5LSMA 3P67A 4O19A 3DFOA 2YFNA 3DH7A 3LHVA 4ZQOA 2QCHA 3E0IA 3B04A 3S42A 5DCEA 3HMJG 1VGAA 5DCDA 3KVJA 2R8WA 3LCHA 2C18A 1F2JA 1XFBA 2CWNA 2YZRA 4L4LA 1ZAIA 2GOUA 4LV4A 2AAMA 3W07A 4EWND 2WNNA 4JIQA 1K3UA 3F1QA 1VCGA 3L0KA 1GT8A 3E96A 5D37A 3TQVA 3LB0A 1QDSA 3W2KA 4A2RA 5D38A 3MBFA 4PTNA 1J2WA 3GYEA 1AG1O 1F76A 5G1TA 5U7SA 3QSRA 1WOBA 3GXNA 1H7NA 2FLIA 4E38A 3HG5A 4O57A 4NZJA 2PURA 2V81A 4I7VA 2CLHA 2CFFA 2E68A 1MXSA 3O06A 1TO3A 5AN7A 3KFTA 4NUWA 2DZUA 1XBVA 1W0MA 1UUOA 3W9ZA 1VYRA 4RR4A 3LLFA 3I68A 3M6YA 4O1CA 5AFDA 4MLJA 5LGZA 2X1SA 3C2OA 1DQWA 1PE1A 3PF3A 5IBXC 3PC0A 4M19A 2A85A 2QJIA 4GBUA 5G2IA 3TAOA 4M5PA 3WJSA 1YXYA 3NXFA 3W1QA 4O10A 3BW2A 3PG8A 1ONRA 4K7VA 2DZSA 3DAQA 1LZOA 1XDMA 5G2HA 4AF0A 3NM1A 3U6WA 1D9EA 4O18A 3QQ0A 3OBKA 1YADA 4UMBA 2E6DA 4JDYA 4BI7A 3RF9A 2ZRUA 4DO4A 2VKZG 3E12A 3LCLA 5C6MA 4XQ6A 3EB2A 1MEIA 1G4EA 4TR9A 3LV5A 5F4XA 2XN1A 4A2SA 3BW4A 3H54A 1KM3A 3NR0A 4QM1A 1EP3A 3CWNA 3UWZA 5EY5A 4ZZ9A 2OMAA 3KVMA 1ML1A 3LCWA 1HTIA 4OU1A 4YXGA 4PODA 3W87A 2DORA 2VFDA 3R12A 2BX7A 4M6PA 1VLWA 5F2LA 2C14A 2GPTA 1QWGA 3S1VA 3A5FA 2VELA 4OV9A 5FESA 3W70A 2GQ8A 2TPSA 3DU0A 4O0ZA 1LOLA 1QFEA 1KA9F 1HUVA 1J5TA 3O15A 3PM6A 3M9YA 4RJEA 3G1XA 1GTHA 5C54A 1LCOA 4K36A 4LTSA 1CX9A 4BWLA 4OQVA 4OWGA 2WPBA 3W7RA 3LDVA 2DZWA 3JS3A 5D30A 5FEPA 4HSNA 1I8JA 3SSJA 4UTWC 3MHUA 1X1ZA 1NAL1 1TSIA 4CQAA 1KTCA 3INPA 3W7MA 1YDNA 2A6NA 5F2IA 3HGOA 1PV8A 2V9DA 3IIZA 3O07A 1HL2A 4J9JA 2A7NA 3TW6A 2J9YA 3M0ZA 4MJMA 3P74A 1GEQA 4GUHA 1WV2A 3DENA 5BMXA 3CEPA 2C16A 4Y8FA 3DHFA 4DF1A 1LORA 2WSQA 1EA0A 1H62A 5D2XA 3MBDA 4N9CA 1FCQA 3P7YA 2FDSA 1VH7A 1K8XA 4H4IA 1X6UA 4MZ1A 2JBMA 3ABQA 1ZY9A 2ZZ5A 3QSTA 4ZQPA 3FJLA 1TPFA 2C13A 4JEQA 4M6VA 3GNDA 4N2YA 4EIVA 1TTIA 1NFBA 3WJXA 2BLEA 5CPMA 4BWLC 5DY3A 5J5RA 1DJQA 3NOEA 3WJYA 3I7RA 5FEXA 3SFKA 1XBXA 1VCVA 4K6AA 1YTEA 4LS1A 3STGA 2GVLA 3A5VA 2X16A 2DJXA 3Q58A 2BZNA 3L0GA 1J4EA 3IVSA 3W1PA 4R33A 5LZLA 5AHEA 5G4EA 4CNPA 4FEZA 4WY0A 1E51A 2IQTA 4GFSA 3KRUA 4UTTC 4MVAA 1M5WA 5F1UA 4MY9A 3TUUA 1PCKA 3PUEA 1N7KA 4JN6A 1H7OA 3EXRA 3NA8A 3UWUA 1JRBA 1BWKA 1LLZA 2OT0A 3CC1A 1B3OA 1WDWA 5F4SA 1VCFA 1KM6A 2H90A 4O12A 5I3KA 4PC8A 3SGUA 3VFLA 1BWLA 3NO5A 2TSYA 3QMTA 3TW7A 3MP4A 5FF2A 4A22A 1KM1A 4Z1CA 1W1ZA 4DPQA 4GC4A 2EF9A 1DKWA 4K38A 5HMSA 5KMYA 1QOPA 3I6RA 4ZMGA 2FJKA 2V30A 2FTPA 2YR1A 4RKAA 1FDJA 1NEYA 4JTLA 2F7FA 2WV8A 4KFPA 3NQMA 2ABAA 5CSRA 3EX6A 2GJLA 3QW3A 2C15A 3S1UA 2ZBTA 5C55A 3IVUA 1TPVA 1WXJA 1MEWA 5I3FA 1JCYA 3LRKA 3NGJA 4ML9A 2YX0A 1V5XA 3HGRA 3HG2A 3SI9A 2RFGA 1TQXA 1Y0EA 4FF7A 2VENA 3RLVA 3N34A 4JTJA 3TXZA 5K2ZA 4O13A 4YWIA 3TX9A 2V2HA 1JQVA 1TTPA 1Z42A 3S5NA 5LNWA 2PE4A 3FJ6A 3M44A 2PRLA 4WJEA 3RFAA 1F6KA 1S5WA 4AB4A 1TB3A 5D2WA 3ZR4A 4FX7A 5D03A 2V2DA 4PH6A 4CQ9A 1NF0A 5AB3A 5AOUA 3W7OA 4JYEA 2ATSA 3G3MA 1OJXA 2WKJA 3EEGA 4K8EA 4D2JA 1D3GA 4NJIA 2G97A 1T0OA 3EX3A 2RKXA 2EPHA 3BPWA 4FX8A 1TJPA 3EWUA 1C8VA 2JKPA 3W2MA 2QR6A 2QUTA 2G95A 1O5XA 3MYPA 3WJWA 4N9EA 4JYDA 4LVBA 4EVZA 2TRSA 4XBKA 2B7QA 4O17A 3GVGA 2OJPA 1XM3A 3CPRA 4POCA 3M5ZA 4UMAA 3KX6A 1AW1A 1QR7A 5EL1A 3QJAA 2Y88A 2NX9A 4DBEA 1EIXA 4U4MA 1SPQA 2NX1A 1T96A 3GDKA 1KBIA 3HG4A 3P84A 4OHQA 1YLVA 3CHVA 3TFXA 3C52A 5AC8A 1ZALA 2CLMA 1SW0A 3F4NA 1P0KA 4FXRA 1OFPA 1SFJA 4FX6M 4ZVJA 3W83A 3W72A 4JDBA 3G0SA 4MYXA 4TU1A 2WSYA 4HNUA 1YDVA 2FB3A 4MUZA 2FIQA 2NV1A 2ZRZA 3PR2A 1NVMA 4LT9A 2WO5A 3SR7A 4N6EA 1AW2A 4ZQCA 1LRTA 3RU6A 1F73A 2X1UA 4JX4A 1SU5A 3USBA 2ZCGA 3N2MA 3T78A 3BARA 3ZS4A 1T8XA 1O5KA 1GJPA 1KFJA 2AGKA 1TV8A 4P61A 1XKYA 1YTKA 3DI0A 2CLEA 3N19B 4QISA 4ONVA 3G18A 1Z41A 4XKYB 5D04C 4MZYA 1WQ5A 2VC6A 4NXKA 4LS0A 3GNNA 1NSJA 4GE8A 3NVTA 3VI2A 3QPYA 5HULA 4PFMA 3WK3A 1EWEA 4DO5A 2R94A 2BXVA 1G4TA 1WOAA 4CQ8A 3ATZA 4OGZA 3E02A 4XTIA 1M7PA 1KLZA 1JUEA 5U4NA 1W3IA 4M7SA 1GYNA 3W7CA 2Q3OA 3WK0A 2A21A 3BW3A 5KSWA 2YDAA 4U28A 5EKYA 1EB3A 3CTLA 3TV8A 4XKYA 4DPPA 5AC7A 3UWQA 1W3TA 3LHTA 4FB7A 4G1KA 1B4KA 2Y62A 3LERA 3TCEA 4GJ1A 1TPB1 1ICSA 2QJHA 3TAKA 1KBJA 3M5XA 1W5OA 2B7OA 3S5YA 3S6DA 3TH6A 3DFTA 2B7NA 4QNWA 4LVAA 1H1ZA 4JS3A 3QC3A 5K9XA 4LS2A 1W5PA 3G1VA 1YXCA 1DJNA 3LHWA 3LCFA 1H7WA 2Y6ZA 3CB8A 4O1BA 4RZ5A 4YCPA 3I65A 4S1FA 1TTQA 2DP3A 4JTKA 3MW7A 4O50A 5IM51 2QJGA 3IIXA 3NQGA 3HBLA 2ZZ6A 3LI0A 5K3VA 2Y61A 3GDTA 2NV2A 4AAJA 2VOMA 3C2EA 4HNNA 3O8AA 3GDRA 4BF9A 3W75A 3IGSA 2HS6A 3MI2A 1JRCA 5F2MA 1GWJA 3NQVA 4LWWA 4WUIA 3E49A 1VLIA 3MI3A 1ALDA 4JTTA 2P1FA 2FPVA 4O0KA 3LXAA 1JUBA 1RQHA 1SO6A 4GUGA 4I7UA 1QCWA 2H8ZA 3NQAA 2UV8G 1X7FA 5I3IA 3V75A 5FEWA 3GDLA 3MMTA 1M6JA 4ZQRA 3A9IA 1Q6OA 4WY0F 4WD0A 3TQKA 4UFIA 1I45A 1PL9A 4FIQA 1WYIA 1W3NA 6TIMA 3EX2A 1IF2A 3STFA 3L65A 4CNNA 2QKFA 3IV3A 4UMCA 1XC4A 4XTDA 5G2WA 1KFLA 1X1OA 4QSHA 3LTPA 4IGHA 4MKNA 1BKSA 3PUDA 4IMCA 5KZDA 4XUGA 4LRSA 2E5CA 3M5YA 3PULA 5G1YA 1PIIA 4JD4A 2CZDA 2J24A 4IQLA 4O15A 4FIRA 1OFBA 3FLUA 4UCGA 2VEKA 4AWTA 3TR2A 1ME8A 1QPQA 3C61A 4UTTA 2H6RA 4N9BA 3MUXA 1OX4A 2P0OA 1KLYA 3NQDA 5I3JA 3W88A 1VRDA 3G24A 2A7RA 2Z6JA 3GIYA 1TPWA 3B8DA 3W2JA 1P0NA 3UWYA 4RCXA 3GZ3A 1JCJA 3R8RA 1LBMA 2GQAA 4JR5A 4UUIA 3FYPA 3TMQA 3W23A 1TMHA 3LV6A 1HG3A 4ICNA 4IX2A 1PCWA 4JTFA 1OHLA 2NZLA 1H5YA 2I14A 3CT7A 1FX6A 3O63A 1W5QA 4Z1BA 2DZTA 3W1TA 4AWUA 1JJKA 1RPXA 4O53A 1SQ7A 3EWZA 3G1FA 3UYCA 2NUXA 3EWWA 1ICQA 2QUVA 5BMWA 4IOTA 3UY7A 1IXOA 2C19A 2J88A 3W7IA 1A53A 3TDFA 3MI6A 4JGDA 2VFHA 3L66A 4LNYA 3PWAA 5D2VA 1X8FA 5D2YA 4UFJA 3CWOX 4RLIA 1SO3A 4Y6GA 4Q32A 3QW4B 5D02A 1A5BA 4FXSA 3M43A 1YPFA 4DBDA 1TPDA 4YLWA 5K7JA 3C0JA 1SZNA 4WOQA 5G5IA 1KW1A 5DXXA 1LLWA 2QDGA 2ZRWA 4HIBA 3TXVA 1I4NA 4FNTA 2A4AA 4E0CA 3KRZA 4AWSA 3W7QA 3B4UA 4O4VA 3TFCA 3LI1A 1QO2A 1LROA 3C8FA 4TMCA 4S2BA 1TV7A 3RMJA 2HSAA 2A2IA 2Y7DA 3NG3A 3DKJA 5L6UA 4GXMA 4UNKA 4QITA 1Q6QA 2BWGA 1O94A 1EUNA 4FNQA 4R53A 1QPNA 5AHFA 2E6FA 2Y85A 3DXIA 1YDOA 2NUWA 3KOFA 3SECA 4EF9A 1FWTA 3QF0A 3HIJA 3PSWA 3W7JA 5HR6A 3M5VA 4Z1AA 3LHYA 2YGYA 3M16A 1XI3A 3UQNA 3KRSA 1H60A 3TJXA 1FCBA 3D0CA 3IIOA 3SW6A 4EOUA 1UBSA 3LXCA 3G0XA 4HHPA 1RR2A 1RZMA 1K7EA 2VEMA 4LW7A 1H61A 4LY8A 3N14A 2V0TA 5HUPA 3GXTA 1A5CA 1VHNA 2Y7FA 3BLEA 3UY8A 3LTSA 4GWEA 5D05A 3OVRA 1MSSA 3QYQA 4GRSA 5AHNA 5EBUA 3THAA 1EP2A 1L6SA 3FKRA 4MFEA 1H63A 2YFOA 4KWVA 3W6YA 4ADUA 4JIPA 2OX1A 2F84A 5CG7A 4PL1A 2X1TA 5CZ0A 4FO4A 1SSDA 3Q37A 3TSBA 3IVTA 1OF8A 1GVOA 3OVQA 4PL2A 3GXPA 3I7SA 8TIMA 5LGXA 1B4EA 2ZTKA 3UNDA 4DXVA 3W74A 5G4WA 3M41A 4JX6A 1DBTA 3IRDA 2DZXA 2ZTJA 3LOTA 3HOJA 5BW6A 2CLOA 3W7PA 6ALDA 3LX9A 1I2NA 3LLDA 1OX6A 3GK0A 3EXTA 3P8JA 1W31A 4MLRA 3BLFA 2CZFA 3PB0A 3EX4A 2ZA3A 4JY9A 1EWDA 4QQ3A 2ZRYA 4AMAA 1LP6A 1VC4A 1FCVA 2ZA1A 4UTLA 1VPXA 1UASA 3NQ2A 2RDTA 3EKZA 1Q3NA 4NQ1A 3W22A 1IXQA 2A5HA 3H53A 4FNUA 1KM2A 3HGSA 1QMLA 1LBLA 1WBJA 4P2VA 1SO4A 4XZ9A 4LV9A 3EX1A 3CQ0A 1SZEA 3LHZA 3W73A 3NDOA 3UWVA 3NPWA 3NL2A 3GR7A 1K02A 2OCZA 3EWBX 3WFAA 3BG5A 4HSOA 5LNUA 3O05A 5K9DA 1KV8A 3S5ZA 1I2PA 1W5MA 1FQ0A 4DEFA 5FEZA 4HPJA 4XWUA 2RHGA 2QCNA 3FYOA 4QIUA 2GVGA 3UXAA 5K4ZA 1EPXA 2FFCA 4TO8A 5TQLA 4LRTA 3T44A 4IPIA 3HQ1A 5KZEA 5DN1A 1A50A 3RLUA 1WX0A 5CGQA 3LTYA 2H3BA 4UTJA 3NQ8A 2VFFA 2EGZA 3NL6A 1KFBA 2QUUA 2PC4A 5CPLA 3GLCA 3W1AA 3I7QA 3STCA 2V5BA 2YXGA 3BGGA 1F05A 2YPIA 2QCDB 3L67A 3Q94A 4UFHA 3O16A 1UJPA 5LNVA 3UZJA 3NQCA 1BTMA 3OG3A 3SJ3A 2XN2A 3OVPA 2FQIA 2CW6A 3NQ6A 3FOKA 4O14A 3N9SA 3MP5A 2CZ5A 2WJZA 4WX2A 1OYBA 4WXYA 1LYXA 1ZENA 1ZFJA 4B5NA 4FHAA 4LC6A 3W2LA 3NPXA 1K7XA 1XL9A 3RNDA 1WA3A 1JVNA 3DFSA 1G69A 3ANYA 1IXPA 3NQEA 3P82A 4E2DA 4JTEA 1F74A 3TNOA 4RXFA 2LLEA 1DORA 5E0KA 3TE9A 2B4GA 2Q8ZA 3NPUA 3OIXA 4IJBA 4UXDA 4NJGA 3NZ1A 3LCGA 3R13A 2JK2A 3NM3A 5DBTA 4IMEA 3NNTA 1VYSX 3GKFA 4DO6A 3S1WA 3HG3A 1I2RA 4L4MA 3TMLA 1R30A 1H7PA 3P60A 1S5TA 1RD5A 4AEOA 2EAWA 3ZWTA 4DF2A 1TPH1 4IPJA 4M7TA 3W7HA 3VE9A 2NXHA 3QH2A 2FB2A 4Y90A 4MIMA 3L2IA 4QNEA 2DU2A 1HFBA 2ABBA 1VYPX 2QDHA 2QAPA 3T4CA 5AC6A 1KFCA 2G5WA 3UPBA 2QEZA 3Q2DA 3G1YA 5DBUA 1JQXA 3W1RA 3IEBA 4JNMA 1N8FA 4LOCA 3IIVA 3A21A 2A7PA 2ZDRA 3FS2A 5FF4A 5FI8A 3BG3A 1R47A 4LVDA 4UNLA 5ABTA 4AHQA 3W2NA 3A24A 4UTWA 3DGRA 2D73A 4RV8A 5KZMA 4MY8A 1EP1A 4FNRA 2X30A 3W1UA 4DELA 5LHFA 5BNKA 1AMKA 1LTDA 5DCBA 1ME9A 3F03K 2Y63A 4N4PA 1GTEA 1OABA 3W7NA 3QZEA 3PBWA 4UTKA 4MJZA 2WOQA 4XBSA 4IMGA 2OT1A 1SW7A 1Q6LA 3KAOA 5AYZA 2QCMA 3VE7A 2O7QA 4IX0A 2Z2UA 3BLIA 4FNSA 1W8SA 2Z0IA 5MHBA 3W84A 3FFSA 1Z44A 4BR1A 1OFQA 3MJYA 4PEKA 3CIWA 4UFMA 1A5AA 2E5BA 1OG0A 4CCDA 4DF0A 4M6QA 4ZQNA 2H3DA 3L5LA 5FF3A 4UR7A 4N4QA 3E9AA 5AHIA 5F4WA 4CNOA 3GB6A 1PVNA 2E6YA 1XBYA 5C2XA 1K8ZA 1UUMA 4JTGA 2VEPA 5KTLA 3S8HA 5IBXA 2ZZ1A 1ME7A 3JR2A 4NNCA 5C5YA 1LOQA 2R14A 1KTNA 1CW2A 2JKAA 4PCFA 3FA5A 1RQEA 1PHQA 5BRBA 2FPTA 3VKJA 4TX9A 3UZ5A 5AYYA 3NQFA 4Y9AA 2ZFAA 2YYTA 4JXCA 2PRHA 2VFIA 3EXSA 1OFOA 4AHOA 4R7JA 3HO8A 3ABRA 2TMDA 3PUOA 1TPC1 4O8RA 4QAIA 3W7GA 3C2VA 4O16A 1JCLA 4NT0A 3HGJA 2QCCA 3C3NA 1FWWA 1H1YA 1D3HA 2A1YA 5HWJA 1GVFA 1QAPA 3L5AA 3MWAA 4A29A 3TC6A 1S5VA 3R89A 1ZAHA 3UD6A 3P81A 3QQ1A 3LXBA 4O1AA 1B9BA 2VXNA 1JUKA 2ZZ3A 5CKSA 4MFDA 4IUOA 2ZRVA 2H8XA 1K7FA 4NJKA 2YW3A 1I2OA 1OX5A 5LHEA 4IMFA 1JCNA 2E1DA 1C9DA 1TV5A 3DBPA 1TRDA 5LNSA 4Z0JA 5HQEA 3ATYA 2OZ0A 3MHFA 3PSVA 1KFKA 1W5NA 4FNPA 3P61A 2NX3A 1V7YA 3LHUA 3B0PA 4WZHA 5HWNA 4O52A 4OV4A 1GG0A 3PAJA 2AQWA 1Q45A 3FEMA 3DFQA 3QPZA 2CU0A 1HO4A 1KM5A 5AHMA 1SFLA 4WQ6A 1SR9A 3DFNA 3NPVA 2O7SA 3DKLA 1FWNA 1U5JA 1LM1A 4BK9A 1GYLA 1YYAA 4W9TA 1FDZA 1UB3A 1H7RA 3C56A 2A0NA 4AH7A 3TQ0A 2YYUA 1VR6A 3P5ZA 1H50A 1K8YA 2GQ9A 1OF6A 1WBHA 1YXDA 1UCWA 4ZL1A 4HPXA 1FDYA 1L9WA 4NNBA 3AJXA 3LBCA 3C2FA 5D33A 3ABSA 3VCRA 1TIMA 2Q8LA 3MYOA 1QPOA 3G1AA 3P80A 5DLCA 4Y96A 3B0UX 2I9EA 1TPUA 5KITA 1P5BA 3QEZA 2HS8A 1SO5A 3G3DA 4Z08A 3OEXA 1G6CA 3O6DA 3G8EA 1TTJA 3KHJA 1GOXA 4AHPA 2E77A 5E93A 4UR8A 1TREA 4KFOA 1L6YA 5J5DA 4ALDA 4E2BA 3N73A 5F2GA 3NAVA 1C29A 2FPYA 3QMRA 1GZGA 3L9CA 3P62A 2J9XA 2DZVA 1F6PA 5EA9A 2NWSA 4JX5A 3B05A 3TA6A 1BEUA 3FIGA 3LRLA 3EKLA 1G7UA 3AO0A 1XUZA 1TQJA 3UXDA 4UIOA 4ADSA 3W76A 1Q6RA 3BK0A 2ATMA 5LKYA 2CLLA 5AYXA 4CCCA 4YL2A 2X2GA 1LRQA 2YW4A 5AHLA 1FBAA 3GDMA 3WK2A 3W7EA 1XXXA 3G8RA 3HJZA 3UWWA 3P8IA 1PS9A 2ZZ2A 3CU2A 1HO1A 3A22A 4JY8A 3O6CA 1IIGA 3IGXA 1SW3A 4UTMA 4LUJA 2B7PA 4N02A 3OA3A 1ZHAA 3HPSA 1OX4B 5CPNA 1FWRA 3NYZA 4X2RA 4Q33A 4RK8A 4RZ6A 4PA8A 3W1LA 5L9FA 1AK5A 4A21A 4NNAA 2W0UA 4JICA 3KVLA 1T99A 4KWWA 7TIMA 3G0UA 1FY6A 1O60A 3QM3A 2R91A 1GPWA 3PG9A 3PB2A 4MYAA 4NJJA 1M7OA 3N9RA 3ZFHA 3BV4A 3FKKA 4UFKA 3W3OA 2PCQA 4JTHA 5HINA 3V1PA 3NZRA 2Y7GA 3KVKA 1AL7A 2C0AA 4I7WA 1IGSA 1OFEA 2B0MA 4O54A 3IGUA 4ORMA 3O1NA 3B0VC 2Y89A 2I1OA 3P5YA 1L2UA 2PRMA 2QCGA 1MEHA 3W86A 3TC7A 4BI6A 1OK4A 1H51A 3PBVA 4Z0SA 3NEVA 3GR8A 4N6FA 1R2RA 1LOSA 1SZFA 3W7KA 2JGYA 3S1XA 3B06A 5HJLA 1VQTA 5H2ZA 1K03A 3U2OA 1F5ZA 2ISWA 3F4WA 1AL8A 3N3MA 1JULA 2ZA2A 1OYCA 4MZ8A 2CLFA 2V2CA 1VHCA 3HPZA 1L6WA 2V5LA 2QCFA 3HB9A 3N2XA 1U83A 2HMCA 1GQNA 2RDWA 1R2SA 1TJRA 1G67A 3C2RA 3GKAA 1TRIA 4Z1DA 3CEUA 4NVTA 1FUYA 4GUIA 2GJNA 1G4PA 4UTHA 3ELFA 4HN4A 2A6LA 1EUAA 4ORIA 5H91A 2BSLA 3L21A 4RXGA 4Q4KA 3W85A 4A3UA 1XUUA 3TU9A 2ZRXA 4OBTA 4DQWA 4R34A 1YPIA 2J27A 5D2TA 1RVGA 4QJ1A 3T7VA 3CM4A 4LU0A 2HTMA 2JKEA 4NZFA 2ISVA 4CLMA 5I3GA 1JCMP 4H6KA 2NXIA 3U8GA 3IIPA 1THFD 2WNZA 1N55A 2Q3RA 2XFWA 2KZHA 3WJZA 3QMSA 4GUJA 1TYGA 5CSSA 5D09A 1IXNA 1SZGA 3M1ZA 3RK8A 3SIZA 2DZPA 3H55A 3CIXA 5A5WA 4MPQA 3NQ7A 4NX5A 4NU7A 4LVGA 4C1KA 3M47A 1B57A 1OFDA 1ZAJA 1GVSA 1XBZA 2W79A 4GNJA 5E1QA 1NF7A 1O95A 4IXXA 4UFLA 5CPOA 3SY5A 1KV5A 5SWUA 2Y70A 4O4WA 5CZTA 3TROA 4MY1A 1TCDA 2J9ZA 2C1HA 4O1DA 4O11A 3LRMA 3MHGA 4LVFA 5F1VA 3W1XA 2G96A 3THQA 1SSGA 1OK6A 2E6AA 1TPEA 3W2UA 4I9AA 1ICPA 1S3HA 5DY2A 2P10A 2Y7EA 3LCXA 4HKPA 3YPIA 4TMBA 3L0NA 4BFAA 3G1SA 1JR1A 1QPRA 2W6RA 1CI1A 3GAKA 4RZ4A 5KINA 1SUXA 1WAUA 1QOQA 1VS1A 4JTIA 3LM7A 2C6QA 5A8GA 3LCIA 1A5SA 3OHIA 3G22A 3O6YX 4LUIA 3PY2A 5DELA 3WK1A 3W71A 2BTMA 2Z6IA 4OT7A 4JYFA 2ZZ4A 3QRHA 3T40A 2VFGA 1QNVA 2NLIA 1GVRA 4UTIA 3KXQA 4AF0B 1PHWA 3W1NA 3GAYA 1OVDA 5T26A 1ZJIA 2ISSA 2E09A 3S0CA 3BG9A 3EWXA 1XDLA 2EHHA 3MP3A 4WOZA 1RV8A 1GVQA 5EPDA 4X9SA 1DOSA 1KTBA 2JGQA 2ZQ0A 4EF8A 2QCDA 3S9YA 4IXHA 4C1LA 1DL3A 5HUOA 4AVFA 5HWMA 5TIMA 2RH9A 1G4SA 2CLKA 3GX9A 1EEPA 3UPWA 4NJHA 4CCEA 3PBYA 1QO5A 2NXGA 2YCEA 4WY0B 4YCOA 1I2QA 3W7DA 1G7VA 4GUFA 4WXZA 3B03A 3SZ8A 1EX5A 5K4XA 3C6CA 2DJLA 4ADTA 1XCFA 1LDCA 1KM0A 4S2CA 1ADOA 2CLIA 4ZQMA 2E5DA 2ZYFA 1DVJA 1JCXA 2WNQA 4JTSA 5CZSA 4KFNA 5BOOA 3ABOA 1KFEA 3C4UA 1H7XA 3S5OA 3STEA 4IWWA 1OFAA 2VEIA 4RX0A 3ZWSA 2ZZ7A 2TYSA 2J6XA 3PBUA 5DXYA 2GVJA 1FCUA 3M7WA 2QAFA 2NWRA 3R2GA 3R5EA 1DQXA 4HNVA 1OFRA 1IIHA 4K39A 5FF7A 4UTUA 4JTUA 5HNRA 4IMDA 3NL5A 3TJLA 3NL3A 5FF0A 4H3DA 2ALDA 3L68A 3QFEA 1W56A 2V82A 3LGEA 3TKFA 3TIMA 2EKCA 3MO7A 3BGJA 1P1XA 3HPXA 1P4CA 1LRNA 1VJIA 4KKXA 1W37A 3L5MA 3DFPA 1FXQA 4K7YA 1Z48A 1DHPA 4HT3A 3W1MA 5LNRA 2NUYA 1LBFA 3PVFA 3VNDA 4UC5A 5K9CA 1R2TA 2VFEA 5CZJA 3A23A 3G1DA 1FXPA 5HR7A 1FWSA 4K8HA 3DHDA 3DZ1A
chains in the Genus database with same CATH superfamily
3KTXA 5A6BD 3W01A 3LSCA 3MO4A 1RK6A 3VD4A 1BSIA 1E4NA 3VOIA 3R58A 3OZOA 4MOZA 1AW5A 3ARSA 2QCLA 3MSDA 4EKJA 1MW2A 1UWUA 1XIEA 1GOQA 4TIMA 4UR9A 1F7BA 5I3HA 2Z1BA 4C91A 1DV7A 4LC8A 2ZDSA 3TSDA 4E2OA 3WF4A 3EWYA 2QCEA 2PTDA 4TX6A 2JIWA 3PFRA 3WEMA 1XX1A 2WSRA 5D32A 3CXOA 5TBOA 3TSMA 2YBVA 5CLTA 2PDQA 3BLDA 1V93A 2I5IA 4CD8A 1DWJM 2V8ZA 2C3ZA 4O28A 1WXZA 3WKZA 5LSMA 1EJ7L 4S3JA 4B5VA 5C7VA 2QCHA 5A6BA 3B04A 5DMLA 2HVOA 5DCEA 5DCDA 1F2JA 2WHMA 4R9OA 1XFBA 1YKWA 2ZUWA 4L4LA 3CAVA 4LV4A 4XZLX 3S2JA 5I0DA 5GNYA 3BJFA 3APTA 3WMBA 2WNNA 3KLKA 4JIQA 2ISDA 4AZIA 1XYFA 4P7RA 3MS8A 3E96A 3LB0A 1HJWA 1BSLA 1VIZA 5I09A 1J2WA 3H22A 3THUA 3I6EA 5U7SA 3QSRA 3GXNA 4PRWA 4KETA 3HG5A 1E6XM 2XH0A 2HZGA 2AMGA 4I7VA 1SFTA 2E68A 3O06A 1TO3A 3KFTA 4L64A 4RR4A 3I68A 3AIVA 5AFDA 3WBWA 4LFYA 1DQWA 3PC0A 4M19A 3ZZ1A 4GBUA 3SURA 5G2IA 2X40A 1H0IA 1CXIA 1XHGA 2F6UA 3L4VA 4M5PA 3OOQA 3WJSA 1GPFA 3PZUA 2DZSA 4H7VA 5G2HA 3BAJA 1MQQA 3W02A 2VRJA 2GJXB 4CD6A 5IHSA 4O18A 3QQ0A 4AQLA 2PZNA 2E6DA 1GNXA 2VKZG 1FKWA 3SN1A 3UGVA 3E12A 4J35A 3MMUA 4Y9PA 4XQ6A 1MEIA 4GYPC 1G4EA 3U5UA 5F4XA 2BOGX 2BV9A 4QM1A 1EP3A 2GK1B 1X7IA 3L4WA 4DLFA 2CXEA 2E67A 1S2VA 2PLCA 5CPSA 4M29A 1NJJA 3OLDA 2SFPA 1JEZA 1SR0A 3AALA 3R12A 4QHRA 3ZQ9A 5F2LA 3QZ6A 4QRNA 1QNQA 2OB3A 7ODCA 3ONCA 3QOMA 4OV9A 1UW9A 5FESA 4QDWA 1QNOA 2GQ8A 4C6OA 1LOLA 1KA9F 3FXYA 1J5TA 2XG9A 1XSIA 2XM2A 1UZ1A 3KCLA 4BWLA 2J7DA 1E4IA 1UWRA 1NH6A 1I9CB 2WPBA 4LF1A 1O6IA 3TCSA 9CGTA 3LDVA 5D30A 3F2BA 1I8JA 3AYVA 3HZ3A 2VX4A 3MHUA 3CUGA 8RUCA 3LYEA 3WIJA 3QY8A 3W7MA 2A6NA 3IIZA 3O07A 2RUSA 4J9JA 2Y0FA 2BOEX 4B4HA 2ZUUA 4MJMA 3P74A 5HQLA 2QIIA 1KRCC 4WGHA 3ARVA 1OCNA 2C16A 1TA3B 4DF1A 1DJIA 2WSQA 3H70A 1EA0A 2BGQA 1H62A 5D2XA 3FV9A 4TOQA 3OB8A 4MZ1A 5LIKX 1WPCA 3ABQA 2ZZ5A 2Z25A 4JEQA 3V5OA 3AS3A 1TTIA 1NFBA 2Y1HA 5BRQA 4HP5A 4AD1A 1E3ZA 3NOEA 3UG5A 3H4GA 3DDMA 3I7RA 1NOWA 3SFKA 3L7RA 3EOOA 2V5DA 1VCVA 4RPQA 3GTXA 4LS1A 4ZSTA 5F7UA 1IQ8A 3DIPA 5CC3A 2WJDA 3IVSA 4XK2A 2WLZA 4S3EA 5G4EA 2WB5A 4WKAA 1LQ2A 1AH4A 4WY0A 1C8YA 4J3ZA 3VC6A 1OGBA 4UTTC 4MVAA 3ICJA 4MY9A 1PCKA 3PBMA 3SFWA 3EXRA 2PDXA 2ZX9A 3UWUA 4ATDA 3UERA 2VUYA 1JRBA 4S3DA 1MVYA 5JUVA 1VCFA 2H90A 4O12A 3SQSA 3WBYA 3SGUA 4ZFMA 5FCZA 3VFLA 2IPFA 2WWCA 4J3SA 4P8XA 3MP4A 1E70M 1W1ZA 4BEQA 3RPMA 2FTYA 4REQB 4F79A 2FTPA 4PTMA 3CZGA 1V6UA 1L8PA 4U3AA 2WV8A 3ME3A 3NQMA 2GJLA 2BHYA 2FZ8A 3B8TA 3KP1A 3S1UA 1J10A 1TPVA 5I3FA 3JUGA 1YPXA 4ML9A 4UQEA 1V5XA 3HGRA 4UZUA 1BG4A 4FF7A 4PCSA 3N34A 1B3WA 1MRAA 4PTXA 2CBJA 3TX9A 1JQVA 4JL2A 3CL7A 2WC4A 3S5NA 3HQPA 2PTXA 1XLMA 3LQGA 3M44A 2PRLA 2XWDA 3IJQA 3LPGA 3MV11 1VFMA 4E8DA 4U3CA 1JAEA 4C6KA 3PZTA 4Q8UA 4PH6A 4S38A 2DW7A 1UR3M 4GH3A 3W7OA 4RE2A 4IUGA 1BLIA 1HJQA 2IS7A 4YNGA 3EEGA 3K8LA 2DZBA 4TTGA 3UXLA 1T0OA 2Z26A 3ZJ6A 1C8VA 2QR6A 5FL1A 1PJ9A 3CZJA 4OOUA 5FSDC 1LG2A 1A4LA 2OJPA 3CPRA 1EHNA 3M0JA 4UMAA 4JQ1A 3DECA 1UKSA 2A79A 4PMYA 2ZICA 1EIXA 5LA2A 2IKGA 1J96A 3JW7A 4A3RA 2YL9A 4OHQA 4OFCA 1X6NA 3CHVA 1WDPA 1BVZA 1ZALA 1XPGA 3GS6A 1SW0A 4JFWA 3TN5A 2WMHA 2OWXA 3S6TA 2BXZA 3STPA 2Z1VA 4HZ7A 3OQ8A 4ZVJA 3QFWA 3G0SA 1UKPA 4HNUA 1CXKA 4LQ1A 1YRRA 1UROA 3ZOAA 4HMNA 2FIQA 2NV1A 1NVMA 3SR7A 5BU9A 1LRTA 2IPWA 1F73A 4AZCB 4V28A 4KWSA 4OBSA 3AHYA 3E6EA 3TYZA 3BARA 3ZS4A 3EMQA 1UD4A 1XD1A 2QLYA 2WANA 2E1WA 3XINA 3N2BA 4ONVA 4AIEA 3PN8A 4MZYA 3P6LA 4W7WA 3GNNA 3QQWA 3NVTA 3QPYA 3CQKA 2XIMA 3SDOA 3WK3A 4DJFC 3A4JA 3OPSA 4OGZA 3UJFA 1JZ6A 1JUEA 5TF0A 3LSBA 2QMJA 1GYNA 3WK0A 1C7TA 3GNXA 2WYSA 2HE5A 2V3GA 4MJ4A 4K8GA 3F5JA 3W24A 1EB3A 1Y5VA 5AC7A 3UWQA 3LHTA 3LERA 4F8XA 2X09A 5DT7A 5C7HA 2QJHA 1QBBA 3N3TA 7PTDA 1NFGA 2WMJA 2B7NA 4QNWA 4JS3A 1UKOA 1KBLA 1E6ZA 1EC7A 3G1VA 8A3HA 1FP9A 3LHWA 1H7WA 4NASA 2E9LA 4JNYA 1XIBA 2PWDA 3AHXA 3MW7A 3V0SA 5IM51 2QJGA 2ZADA 4QEHA 2OPJA 2VNCA 3H7UA 5K3VA 2Y61A 3UXKA 3GDTA 5JMUA 4RL3A 4GBDA 2RGMA 4LY4A 4GVGA 3O8AA 4AZGA 3GDRA 4XG1A 4BF9A 3IGSA 1XYBA 3L12A 3VU2A 1JRCA 5F2MA 3TVAA 1ONEA 3NQVA 4WUIA 1A80A 2VDGA 1XGDA 1TA3A 1RQHA 2J47A 1U5HA 4GUGA 3M0LA 2PDMA 3K5XA 2UV8G 4ZB5A 3UBPC 5I3IA 3ERPA 3V75A 3GDLA 1BYDA 2OQYA 4ZQRA 1Q6OA 4WY0F 3JVAA 4G7FA 3FGCA 3A12A 4FIQA 4P7QA 1FTXA 2PD9A 3EX2A 1Q7MA 4GGBA 4CNNA 3MMDA 4XTDA 5G2WA 4W93A 4QSHA 3LA4A 2NVDA 4IMCA 2PS2A 1JNDA 3PULA 5G1YA 1E4MM 3M0MA 3CPUA 1YIXA 3TZFA 4B9YA 1UP0A 4O15A 3R25A 4RPPA 1V6TA 4EACA 2CXGA 4DUVA 1SMDA 3C61A 2OELA 2H6RA 4QBXA 3RCYA 1B1YA 2P0OA 3B9OA 3NQDA 1VRDA 5IXEA 2A7RA 2Z6JA 4HU3A 3W00A 4NY2A 1A5KC 1P0NA 3KDNA 1CXHA 3T8LA 3O7UA 2MANA 4HN8A 3VINA 3T42A 4D6EA 3BH4A 3MVTA 3N18A 4GYJA 5BRPA 4HOZA 4ZR8A 3QR1A 4HHMA 4CNUA 1BTCA 2G3IA 4JTFA 1H5YA 2I14A 3KTSA 2DZTA 4AWUA 4O53A 4IMAA 3G1FA 2YLAA 2WM0A 1FWCC 3LZ5A 3GU2A 3ORWA 4IOTA 1VFFA 1NWTA 6ENLA 1A53A 2I16A 3TDFA 3MI6A 1I1WA 3GWQA 2VFHA 5FSEC 3L66A 3EDDA 2MNRA 5D2VA 4AVNA 5D2YA 1ECEA 4H2CA 1SFSA 3EOLA 2XPKA 1GVIA 4IP4A 5D02A 3MUAA 3WD4A 1K9EA 3C0JA 3QOKA 1Y5WA 2O56A 5CC6A 1NU5A 4AD0A 1W1IE 3UZZA 4ACZB 1DWGM 4DBUA 4B91A 1I4NA 2XVGA 3I4EA 3NO1A 3RR4A 2A4AA 1BF2A 3KRZA 3B4UA 3TFCA 4EANA 4PB5A 1LROA 4UQAA 2HE8A 4S2BA 3RMJA 3ARXA 3DKJA 1EYEA 3GXIA 3UVAA 4KCUA 1Z69A 2BWGA 3B8UA 4C7GA 5CPQA 2WHJA 1QPNA 5FOOA 1VB9A 2YCLA 2OLAA 1YDOA 2NUWA 2Y24A 2D22A 4N0RA 3W82A 1E6RA 3DG7A 3M16A 1FHLA 4HA0A 1OINA 1U1UA 3CHDA 2IMRA 5C2GA 3GUWA 3SW6A 4EOUA 3LXCA 2UY2A 3ARUA 3PFMA 1RR2A 4HHPA 2QV5A 1K7EA 2VEMA 4LW7A 1UA3A 4AW7A 3CO8A 5HUPA 1VHNA 1XICA 4DAIA 1UQYA 4GWEA 1QASA 3OVRA 3CUZA 1HKJA 2OZTA 1P7TA 5EBUA 1B2YA 3HJEA 4US5A 3VNYA 4D6CA 3W6YA 3MUIA 1OZQA 2GVYA 4XBJA 2OX1A 1SSDA 1ZSXA 1UWQA 2GYIA 3IVTA 1A5UA 6CGTA 1GVOA 3OVQA 8TIMA 5LGXA 1A5NC 2ADAA 1I1XA 2FJUB 2X0SA 3GU1A 3MY9A 3F2CA 4E6MA 3GW0A 4PCPA 1TCMA 3W7PA 2XM1A 1OX6A 3GK0A 5HNUA 3U2ZA 1W31A 4JTCA 1EWDA 2QXWA 2WBGA 4QQ3A 1LP6A 1VC4A 3SCUA 1FCVA 2I9UA 2ZA1A 3BQ5A 1R85A 3ZJ8A 4HTBA 1UR2A 4NQ1A 3IK2A 3RGTA 3PPFA 2PZ0A 4PYSA 3BXWA 4X60A 3BJSA 3MSRA 1SO4A 3EX1A 3CQ0A 1MUWA 3NDOA 1UHVA 1OD0A 3GNPA 3NL2A 3GR7A 1K02A 2OCZA 3EWBX 3VIPA 3WFAA 3CZLA 4F9JA 4Z2GA 2V38A 2HK1A 1A3HA 1UYQA 1CXEA 3ALGA 3O05A 4MSSA 1I2PA 1JFHA 1W5MA 1SGJA 1CLVA 4DEFA 1Q13A 5FEZA 2OTDA 2ZWYA 1H49A 4QIUA 4PE8A 5K4ZA 3SAZA 4IPIA 3EDJA 1PZ0A 4KGLA 1A50A 1ZUAX 1NOUA 4UTJA 5KETA 3UA4A 3M0VA 1G01A 4C6IA 2YL5A 1FOBA 5A6AA 7REQB 1LJYA 3WLNA 5JU6A 5HPCA 3BLPX 2YXGA 4Y9MA 3UP8A 1B5TA 3O16A 1PPIA 3V5FA 5H1WA 1BTMA 2XN2A 2CW6A 3NQ6A 4Z1YA 4Z42C 1XYAA 4JHMA 3L2LA 2P5NA 2INFA 3WLSA 2VL4A 4XO6A 4FHAA 4KF1A 2DPEA 3W2LA 3NPXA 1K7XA 3U0HA 1WA3A 3TTYA 3DFSA 4GG9A 2TODA 3VGFA 1GQIA 1JCTA 4RXFA 1JGIA 1XIGA 2LLEA 3D5HA 4GI6A 4B15A 3T0CA 4DBWA 1E56A 2YLLA 3FHQA 3NPUA 3OIXA 4HZ8A 4BZYA 4ZSUA 1QI4A 3GKFA 3TMLA 4WJXA 2W27A 2B81A 1DWHM 2EAWA 3ZWTA 4DF2A 4IZGA 2VEFA 3R79A 2FB2A 4Y90A 4AIUA 4MIMA 3K4DA 3WN6A 3E5BA 2QAPA 3UPBA 2VM8A 2EPOA 2QEZA 3Q2DA 4ES4A 4IIFA 3FA3A 4XSMA 1VFOA 1PBGA 2A7PA 3KL5A 4PSPA 5FF4A 3TN6A 4L6OA 3BG3A 4Z2LA 4LVDA 3B40A 4HA3A 3VIJA 5BXTA 3DGRA 1S38A 4FNRA 1UR9A 1J9YA 5BNKA 2BGSA 1ME9A 3WBEA 3BAKA 1UOZA 4N4PA 1W32A 3QC0A 3UCCA 3G6LA 4UTKA 1RH9A 4FLOA 5AYZA 2GOKA 2Y5JA 3VE7A 2O7QA 4KW2A 2Z2UA 1TE1A 4QTGA 1A5MC 4GZJA 1Z44A 7TAAA 3M64A 3EPOA 4BR1A 4Y2WA 1DWFM 3CIWA 2ZC8A 4CEUC 4CCDA 4J3VA 2XZ7A 3FNDA 1A0CA 4UR7A 3E9AA 3TLQA 4LBSA 3VD9A 3GB6A 4MGGA 2E6YA 1U1JA 3ZVIA 4LX4A 4JTGA 3S8HA 2V63A 1CGTA 1A5LC 5IBXA 5MKGA 4GXPA 4D6DA 5E6YA 1MWOA 4CNSA 4D72A 3URBA 2OO6A 1LOQA 1IEIA 3GTHA 3DFYA 2ZVIA 3VAVA 3CK5A 1PAMA 2PDCA 5AYYA 3ZYZA 1EA9C 5I6SA 4R7JA 3UZYA 3PUOA 4O8RA 4QAIA 2WM1A 1VP5A 3C2VA 5EFFA 3KOZA 2QCCA 1FWWA 4A29A 1QAPA 3AS2A 1PIFA 3GDBA 2NQJA 1OCBA 2UBPC 4O1AA 1CENA 2VXNA 4MFDA 3NXLA 2ZRVA 3B9DA 3NZGA 1ONXA 1ZRQA 4C65A 1XRTA 2ACQA 4NZ1A 4DWSD 4Z2IA 1MNZA 2DSKA 3AUOA 4R88A 3M07A 5BOEA 4O1EA 1KFKA 4FNPA 4FR1A 3GIPA 4JQAA 3HURA 2F38A 4WZHA 4ZTYA 2MUCA 1GG0A 1ZJAA 3DFQA 2GGGA 3QPZA 4Q8WA 2Z00A 4UOQA 1KM5A 2CBUA 2KX9A 1SR9A 4YTTA 1R3VA 1RHCA 1FWNA 1KR1A 1MYRA 1IT0A 1UIOA 3MB9A 1GYLA 4W9TA 4ICMA 4WCJA 1W1YA 5T9BG 3C56A 3KOYA 1GKQA 2EG8A 1ITCA 2JF6A 2RJGA 2GQ9A 4AIOA 4YS1A 4DIAA 1XLIA 9XIAA 1YXDA 4ZL1A 4HPXA 4NNBA 5D33A 4LAMA 3ABSA 4X2PA 4C6MA 3MYOA 3N1AA 2DH3A 1QPOA 2OYLA 4PUDA 2VTFA 2WQDA 3B0UX 1M03A 3ZVHB 4GY0A 1CTNA 3QZAA 3CHFA 5BXSA 3G3DA 4Z08A 3AWNA 3OEXA 2HV5A 3P0XA 4KEMA 5EMKA 4F48A 3IJ9A 4KFOA 1EX1A 1OC5A 1OT1A 4L6DA 4JIIX 4PRRA 5F2GA 3QMRA 1O7AA 4ML4A 5IDIA 5EA9A 1HJVA 2OQHA 3BOFA 4LCQA 4JX5A 2G41A 3WFLA 1BEUA 3EKLA 4Z2HA 3H2NA 4UIOA 2OLHA 1KXQA 4GABA 4BCEA 1JPMA 1UPMB 3WQFA 3OZYA 2I5GA 1OCQA 5C70A 3GG7A 4KWOA 1RCXB 3SY1A 4GD0A 3WK2A 3U2EA 2FHBA 1AH3A 1V8EA 3K46A 1HO1A 1S2CA 3A22A 3HTWA 4HCHA 2AKZA 4ZOEA 3S9ZA 3OA3A 4AISA 1ZHAA 1NTHA 3GVRA 1OX4B 3DEQA 1K4GA 2GUYA 4CQDA 4PA8A 1QK0A 4W7VA 3W1LA 4A21A 4NNAA 2W0UA 4KWWA 3O2LA 5DRCA 3VM7A 3LD5A 2R91A 2DT3A 1I75A 4MYAA 2IPJA 2PD5A 3OODA 1FA2A 4IF2A 1M7OA 3NSXA 3BV4A 7CGTA 4UFKA 3ONBA 3W3OA 3FW6A 4GZIA 4GCXA 1TIWA 2XVPA 4XVDA 2C0AA 4S23A 2B0MA 4ORMA 4O54A 3O1NA 3B97A 3BANA 4D1JA 3FGCB 1HKMA 3KBSA 1L2UA 2VGGA 2PRMA 2PWGA 1HN1A 1MEHA 4BI6A 3PBVA 4Z0SA 3SCWA 3GR8A 1LOSA 1SZFA 3W7KA 3DN5A 2GJXA 5H2ZA 3U2OA 1EFZA 2ISWA 1XLDA 3N3MA 1P6CA 1V3IA 4PUMA 2ZA2A 3C5QA 2D2HA 5TD4A 1VHCA 3CV1A 3B9NA 3N2XA 2HMCA 4P5UA 2RDWA 1GKPA 1RA5A 4LPCA 1Z3NA 1R2SA 1VFHA 1GYMA 1G67A 4H9TA 1ENUA 3E2RA 2J78A 4HNLA 4A8NA 3IK4A 3I4KA 3C0LA 1EC8A 3K8MA 2GJNA 4WJ8A 2NV9A 4IT1A 3LEPA 4HCLA 5A2CA 3PJXA 5CAKA 2QPSA 3LNMA 4IIBA 3M0IA 4JHZA 3TU9A 2ZRXA 3GG1A 3WQPA 5D2TA 1RVGA 4QJ1A 3GXFA 3TTEA 2HTMA 2ISVA 4HPNA 4H6KA 1JDEA 4B9ZA 3N04A 1THFD 3AYSA 3W28A 3M4HA 3VD3A 2XVLA 2Q3RA 1IWPA 1JDFA 2HWGA 1UA7A 1JL8A 1GOWA 3BSMA 3VKDA 1O5RA 4L4PA 4F2TA 3RK8A 3RM9A 4MPQA 2CWXA 1CLXA 4NU7A 2Y4SA 1PZ3A 4C1KA 1BXNA 3LY0A 1ZAJA 1XBZA 5ABFB 4GNJA 1UWIA 1GCYA 1AJ2A 4UFLA 5CPOA 3GW3A 2FGLA 5SWUA 2Y70A 2WCAA 2PDBA 3LRMA 3MHGA 4RW5A 1UD5A 1JGMA 3N25A 3W1XA 1SSGA 2E6AA 3H2FA 1TPEA 4AEFA 4DUOA 1S3HA 4L4OA 4LF2A 2FYMA 2VVNA 4AZ7A 3RLGA 4BFAA 2HROA 1QPRA 2W6RA 1QOQA 4JTIA 3BMXA 4WKHA 3G22A 5GJMA 3O6YX 4ZENA 2D1ZA 4US5D 1YNQA 2PDIA 3WK1A 2Z6IA 3V5CA 4OT7A 1Q65A 4YIWA 3QRHA 4AF0B 3GSMA 2WMFA 2XTKA 1EJTC 3GAYA 3E0VA 2XGZA 3GHUA 5T26A 1ZJIA 1GONA 2C8NA 4K3ZA 4IPLA 1XLHA 1XDLA 3OGVA 3MP3A 1T41A 3VDCA 3U4FA 4WR3A 3FYYA 5EPDA 3RPDA 2R82A 1UC4A 2ZQ0A 1OWQA 4ZCWA 5CPTA 1DL3A 2VP8A 1U2YA 1G4SA 3GX9A 4XAYA 4CCEA 3PBYA 1EKOA 1VEPA 4XAGA 4YCOA 3W7DA 4C7FA 3VMNA 2GSJA 3BURA 1OZMA 4GUFA 2WSKA 1EYWA 5K4XA 2DJLA 2XVKA 1XCFA 3AIWA 1ADOA 4TVDA 4AD2A 4HHHA 3UVIA 5IRPA 3LMYA 5AZ0A 3T0AA 5BOOA 2ANUA 4JTDA 3VK5A 3SCSA 1FFQA 1KQYA 2QJMA 2ZZ7A 4GY1A 2TYSA 3FVMA 2J6XA 4Q8TA 3VGGA 4HU4A 1XISA 2QAFA 3CYJA 5AECA 5I03A 1QI0A 5FF7A 5T8GA 4IP7A 4HYRA 1N8IA 4WKFA 3NL3A 5D9NA 4DJFA 4V27A 2ALDA 3S5SA 2BDQA 1Q6CA 1Q4WA 1FFRA 4QE1A 3MO7A 3BGJA 1P1XA 1P4CA 3W38A 5C9RA 3L5MA 4HMCA 1P0BA 3GHTA 3R7MA 2NUYA 4W8LA 5K9CA 2R6OA 4K8HA 2QJJA 1XLBA 2KAUC 1W54A 4NKCA 3GTIA 1W3JA 3NTYA 4C1NB 3BVJA 1MO0A 1FWBC 1Q4NX 3WMCA 4QLKA 3RXZA 2WHKA 4HK6A 3N9KA 3AI0A 2FVLA 3BL3A 2YKKA 4MB5A 5TAOA 1RY8A 1UKQA 1RQBA 2G37A 1ZNNA 1OG6A 1R46A 2GJRA 1QWKA 5EMUA 3SGZA 1XP3A 2PP3A 4S3BA 1M3UA 2ZX5A 3AU6A 2V3DA 4EK7A 1C7SA 2OSXA 1BD0A 3IV8A 1I6NA 1AUSL 3DCPA 4X3ZA 1JDDA 1O4UA 4NXSA 4MJ2A 4X22A 4LAUA 3K30A 2C91A 3TK7A 4IHCA 5FACA 1BHGA 3UESA 3QV6A 3CJPA 2HQAA 3P67A 3DFOA 3U3HA 4QQUA 3LHVA 3WDIA 3E0IA 1RBOB 3CAKA 4RE4A 2YCJA 1VGAA 1WDQA 5HJYA 3LCHA 1KKRA 2C18A 3IS4A 1RP9A 2P53A 4H8NA 4KRTA 1ZAIA 3RU8X 1E6NA 3P93A 4GQBA 1RY0A 3L0KA 4V1XA 5D37A 3I10A 3B8WA 3MBFA 1DJGA 1SMAA 3GYEA 1AG1O 1WOBA 1HW6A 1H7NA 2FLIA 3ARQA 4O57A 1MXDA 2GVEA 2PURA 4GA8A 1KQZA 1K9TA 3ALFA 4NUWA 1W0MA 2J7HA 3LLFA 2HK0A 4V15A 1W9PA 5IBXC 3AISA 2QJIA 4H6QA 2WKLA 3LNPA 1YXYA 3NXFA 3W1QA 3OLEA 3O0FA 3BW2A 4WHBA 1ONRA 1BG9A 1OY0A 3AQUA 3NM1A 3AIRA 1D9EA 1ZU8A 9RUBA 3HMCA 1YADA 4UMBA 4B92A 1V6YA 3LCLA 4PUEA 3AFBA 3BE7A 1E43A 2XU2A 2C7FA 3AYRA 4CQCA 4TR9A 2XN1A 3MPGA 3H54A 1KM3A 4O0QA 4E8GA 4IIHA 2FMNA 5CH9A 6PTDA 4MWAB 4ZZ9A 4HQVA 1IYXA 3WH9A 3LCWA 5CC5A 3WLLA 1TWIA 3DFHA 4OU1A 4HJFA 4PODA 1ITUA 5A8QA 3KE0A 4OJYA 1BVWA 2DORA 1GZ1A 1LWHA 4GLEA 1CNVA 4M6PA 1VLWA 2VWTA 2C14A 1VEOA 4PMNA 4CEXC 3A5FA 3CQJA 4O0ZA 1IT7A 3GBEA 5BOFA 2FZDA 1GTHA 3VNMA 1LCOA 1CX9A 2PTYA 4OQVA 2D2OA 1XLJA 4OWGA 3VDBA 4JCMA 2DZWA 3JS3A 3CUFA 3SSJA 4UTWC 3TYUA 1XSKA 1ADDA 1UMLA 1MNSA 1KTCA 2V3FA 2P50A 3UCDA 1Z6KA 2D24A 5F2IA 3HGOA 1GGOA 2A7NA 3NZQA 2J9YA 2Y8KA 3M0ZA 2XFFA 5C0QA 3POHA 3KRBA 3SRHA 1J18A 5HDRA 4H9ZA 3NSMA 4GUHA 2NQ5A 3CEPA 4LGXA 3DHFA 1LORA 2YBTA 4Q3MA 4N9CA 1FCQA 2BVDA 1IWBA 4H8HA 1X6UA 2XYLA 4M6VA 3VUSA 4TVUA 5CPMA 4BWLC 5DY3A 1Q85A 2F8QA 5J5RA 1DJQA 5FEXA 1JYVA 1GOOA 4QDMA 2DQWA 8CGTA 2GVLA 3A5VA 2X16A 3Q58A 2BZNA 4HJWA 5A6JA 1J4EA 3TYDA 2ISFA 4R33A 3AXHA 2PWUA 4AZHA 3IUIA 1CZ1A 1AMYA 1G0CA 3PUEA 1N7KA 4TUFA 3GY1A 1IZCA 4NZ3A 1TV4A 1W8GA 3NA8A 4XD5A 5LIUX 2DUXA 2O92A 1BWKA 1LLZA 3CC1A 3KWSA 5F4SA 1B3VA 5M3WA 2G4JA 4A3HA 4WEVX 5I3KA 5ABHA 4PC8A 4C6BA 1CGXA 2Z27A 2NVAA 1BWLA 1KD0A 4H9MA 3N6QA 4LEFA 5FF2A 1KM1A 4DPQA 4IQEA 4GC4A 4IG2A 1DKWA 1QOPA 1A5OC 2FJKA 2V30A 1NEYA 2PSNA 4JTLA 2F7FA 4KFPA 2ABAA 4Q22A 3ARRA 1KXTA 3PZMA 2O9OA 2C15A 3U4AA 2ZBTA 2WZTA 4C6LA 1UIPA 4HK5A 1BKHA 1JCYA 3NQBA 4MNLA 4YU1A 2VZSA 4H19A 3HG2A 3SI9A 2RFGA 5AY7A 1Y0EA 2PGFA 3RLVA 5BU6A 1CT5A 5K2ZA 4Q8PA 4O13A 5DFAA 4YWIA 2OYMA 1O5QA 2PE4A 3FJ6A 4U2ZA 2REQB 3GC5A 1W1TA 4AB4A 5XIAA 5MF5A 4FX7A 5D03A 2V2DA 3CV2A 5CJMA 3QBUA 4CQ9A 1HNYA 1NF0A 2VZTA 1PDZA 5AOUA 4JYEA 3KBNA 2ATSA 1ISYA 3G3MA 2DV0A 1VENA 2WKJA 3GBDA 3BLOA 4RDVA 3BSGA 3H4WA 4L1GA 2AGTA 2GGJA 1UJQA 2EPHA 1EJUC 3EWDA 4N42A 4N9EA 3MQTA 4LVBA 4L9YA 3CMGA 5DT5A 1VFSA 1J5SA 1QRQA 1E0XA 2PDNA 3MCMA 1AW1A 1QR7A 3R0KA 4P8VA 4A3QA 4BQ5A 3SUWA 1KGXA 3QJAA 4BF7A 2NX9A 1SPQA 1EQCA 2NX1A 3GDKA 1YBQB 1P0EA 1YLVA 3C52A 4Q4QA 2OZ8A 2PU1A 3F4NA 3MZ2A 1P0KA 3GHRA 1IEWA 2Z7KA 3W72A 4Q8QA 4JDBA 4MYXA 2WSYA 1WNOA 2VX5A 2FB3A 4JTRA 4MUZA 4LT9A 2ZRZA 2WO5A 3ITTA 4QROA 2X1UA 5A6TC 4JX4A 3SO7A 1L0PA 3WENA 1SU5A 4G7EB 4HU0A 3QTGA 1PZ1A 1XKJA 3T78A 2RAGA 4HVXA 4B90A 5D8ZA 5JH1A 1VJSA 1TV8A 4P61A 1PWMA 3VMPA 4H7ZA 2CLEA 3TTOA 2A3LA 3WSUA 3G18A 4NZCA 3WFZA 2DUZA 2VC6A 1IZKA 4NXKA 3NCOA 2QPUA 4LS0A 3QLLA 2GSHA 1NDWA 5BROA 3AROA 3VGBA 4Q8MA 5HULA 4PFMA 4BY3A 4BQ4A 3WLQA 4DO5A 2FKPA 3CZEA 2BXVA 3RILA 3W6MA 3WLPA 4CQ8A 2BXYA 3CZKA 1XRFA 3CAQA 4M7SA 3PK7A 3W7CA 1W9VA 3BMVA 3AIUA 3VZZA 3EDFA 1S1PA 3TV8A 1U30A 4F0MA 2F2KA 2W66A 4G1KA 2GLKA 4XISA 4AY1A 4XZHA 4HYWA 2WC7A 2B7OA 3S6DA 3RN6A 4R85A 5K9XA 2BY1A 3QC3A 1LL7A 1GEHA 1W5PA 2OEJA 4FLRA 1ZS2A 3APYA 2Y6ZA 2GZXA 3CB8A 3GU9A 1TR1A 1TMLA 4S1FA 3FCPA 2GQ3A 4O50A 1V0KA 4XSLA 3LI0A 1ITXA 4QG8A 3DERA 3TOYA 5LXXA 3HN3A 2NV2A 4AAJA 3C2EA 4QS6A 3VVGA 2E25A 3N29A 3WD3A 1GWJA 1T6MA 3E49A 4M6UA 4JTTA 2P1FA 4HA4A 1SZRA 1DJZA 4J40A 4O0KA 1NQKA 1SO6A 4ENLA 1LT8A 1PB0A 4LNCA 2PC8A 3PTMA 4H83A 1T40A 4JAWA 3MMTA 4W87A 3VKKA 1M6JA 4ASTA 4ZBCA 3ISIX 3A9IA 4WD0A 4PB3A 3TQKA 4UFIA 2FVMA 1PL9A 1WZKA 3STFA 1HXJA 5CLWA 2QKFA 3V0UA 4GQGA 3A64A 1OGGA 1XC4A 1KFLA 1Q6FA 3LTPA 2PDWA 1AJZA 1PIIA 4FALA 2CZDA 1WAWA 1ZB5A 3WQDA 2J24A 6TAAA 2VX6A 4IQLA 1FHDA 1AFSA 1OFBA 3FLUA 1M41A 1QPQA 4UTTA 1UUQA 3EMCA 1OX4A 1KLYA 3B4YA 4QCEA 3W88A 3BLKA 3VCNA 1ELSA 3GIYA 1KRMA 3W2JA 2E40A 1JCJA 4UTFA 1XGEA 1UBPC 4JR5A 4RE0A 1QNPA 4X0VA 1WP6A 2XIIA 3AMCA 1HG3A 4H7CA 4LAZA 5D4YA 3VMOA 1PCWA 1OT2A 2NZLA 3S83A 1JG9A 1R6WA 4FA3A 3O63A 5HMFA 1W5QA 4Z1BA 3W1TA 4ERAA 2PDJA 3WDRA 5C8BB 4YTQA 3IPWA 1SQ7A 3K4WA 2JE8A 4BA0A 4ROPA 2NQLA 1ICQA 2QUVA 1RJQA 3JU2A 1FVPA 3UY7A 2C19A 1HL9A 5CBBA 3W7IA 2OODA 1F3EA 1IR2A 1X8FA 3GG0A 2YDRA 4RLIA 4I5RA 1SO3A 4Y6GA 4S3AA 4E4UA 2DY3A 3N15A 3M43A 1YPFA 4NIRA 2O4MA 2FZMA 4GCAA 1A49A 5DXXA 2CETA 1HIZA 1P43A 2IKIA 2W63A 1UWSA 4FNTA 2ZOXA 4E0CA 1WZAA 1WE5A 2PP0A 3W7QA 1D7FA 3RX2A 2NQ9A 3AHTA 3C8FA 2ZXBA 1TV7A 1TE6A 2BHUA 2VGBA 4DM1A 2VZVA 4GK8A 5L6UA 4KIRA 2REQA 1B3YA 1C91A 4QITA 4LYRA 1Q6QA 4MUPA 2E6FA 2Y85A 3DXIA 1LLOA 3KOFA 4EF9A 4WSHA 2VR2A 3K4AA 3QF0A 4IJRA 1RA0A 3FY1A 4S3FA 4Z1AA 1J0KA 1NM9A 3RJXA 1H60A 4LAKA 3ZXWA 1FCBA 1VD6A 1UD3A 1UBSA 4E4FA 3G0XA 4OOZA 1RZMA 4ILSA 5BYWA 3UZXA 3UU0A 3GXTA 5I7GA 2Y7FA 1SJAA 3LTSA 1EJSC 4L56A 3E1F1 1UZHA 4GRSA 3PZQA 5AHNA 1GOIA 3GVQA 3FDKA 2Y5SA 1JF5A 1JDAA 1P48A 2YFOA 2YXXA 4KWVA 1I0DA 4JIPA 1J0IA 5CG7A 2F84A 4DI9A 5KEZA 3DG3A 4FO4A 1E3XA 2Y8VA 4KEZA 3TSBA 1RUSA 1OF8A 4PL2A 1G94A 3GXPA 4EPBC 1UPPA 3UNDA 1BF6A 5G4WA 4H01A 5FD0A 2DZXA 2ZTJA 1EDGA 2CLOA 6ALDA 3LX9A 3S2MA 1I2NA 3T05A 3LLDA 2PDKA 4XAPA 1JZ3A 2FGZA 1DIDA 3I3EA 3TONA 3H2CA 3H6OA 4MHBA 4DO7A 2ZA3A 4JY9A 4UOJA 5HMEA 1L6FA 2ZRYA 2NLYA 2XSBA 3M7SA 4GHRA 4D8LA 1E71M 1UASA 2NT0A 3EKZA 1PUDA 1Q3NA 4ZODA 3S9IA 3N2CA 4KGJA 2DT0A 2A5HA 1H2JA 3WZ0E 3SQLA 3OA5A 5CSUA 1CB7B 3HGSA 2UY4A 1QMLA 6A3HA 1TZ7A 3QYSA 1LBLA 1WBJA 1NARA 1SZEA 3LHZA 3W73A 3MKVA 4HD5A 3H23A 3UWVA 3UETA 3LUTA 3AZTA 3PZIA 4PMXA 3BG5A 4HSOA 5LNUA 5AVHA 2NQZA 1R3RA 4IGSA 2PWFA 4HPJA 4XWUA 2QCNA 4P8WA 3FYOA 2GVGA 1EXPA 1V7AA 3T44A 4LRTA 1UKTA 3HQ1A 4S39A 4NAFB 3CIVA 3FN9A 1FP8A 1VFTA 3AXMA 2EGZA 3EWCA 2V5CA 1XIIA 3NL6A 1KFBA 1PZ2A 2QUUA 3A4XA 2PC4A 5CPLA 3COTA 3GLCA 3W1AA 1XCWA 2V5BA 2EG7A 1F05A 1YNPA 3Q94A 3L67A 4RDYA 4IL2A 4UFHA 5LNVA 1W1A1 3SJ3A 1TWDA 3OVPA 3VNIA 3FOKA 4P7OA 3WD1A 4H8UA 4ZB0A 1OBAA 2CZ5A 4WX2A 3ARPA 1ZENA 3OU8A 5D9PA 4D6GA 4GX9A 4LC6A 3RX4A 3OYXA 4H6RA 1XL9A 1A3XA 1R5YA 4E8CA 2DSZA 1JAKA 2P3EA 3QTPA 4MWAC 3KHDA 3WYZA 4EPDC 2OX4A 4MWAA 4JTEA 3TNOA 5CCZA 4DYJA 2OEMA 5E0KA 2Q8ZA 3KP0A 4IJBA 4UXDA 5A6SA 4G5DA 4NJGA 3LCGA 3EB3A 5IFTA 3R13A 4C6NA 1W1B1 2J7GA 2JK2A 3B0XA 3NNTA 3FA4A 1VYSX 3SADA 1UOKA 4DO6A 3P3BA 4L4MA 4AEOA 2ZX8A 4IPJA 3PWIA 4M7TA 3W7HA 4IPNB 3QH2A 2WZIA 3KL0A 3KBWA 5HNNA 3U5YA 2DU2A 4RW3A 3WCZA 2PPGA 4V2XA 2BMBA 4WLCA 4IH3A 3CL6A 4CVUA 1VPYA 1DJXA 1NWUA 4U10A 1FRBA 2QUMA 1DQUA 1M1BA 3G1YA 1JQXA 5E5CA 1PKNA 3IEBA 1Q7QA 3A21A 3FS2A 4A8LA 4UNLA 3W2NA 4ZOCA 4TV6A 5CXPA 4MY8A 2BB0A 3W1UA 2YXOA 5LHFA 4FZIA 2AL2A 3WQVA 3W7NA 4MJZA 4L61A 4IMGA 1Q6LA 3NIYA 3TZNA 3WQ8A 2BS9A 2QCMA 3JZUA 3EA1A 1F4HA 2Q8XA 1W8SA 2YCLB 5C2CA 3RMEA 2DH2A 1X97A 3FFSA 3SN0A 2Z2AA 1OB0A 3NJ3A 1OG0A 4AXNA 4M3PA 1B30A 3WUBA 4A3YA 2DGAA 5FF3A 5EU9A 4CNTA 5A2AA 3GUGA 1O68A 4CNOA 1KKOA 1PVNA 3T9PA 3VPLA 3LS9A 1K8ZA 3TW9A 3UYIA 3TWBA 4HB7A 5KTLA 3SCVA 2HNHA 3E38A 3QHMA 2YB1A 4AD3A 1ME7A 3JR2A 1WUEA 3QN3A 5C5YA 1KTNA 3WLOA 3NYDA 3CS2A 3WNNA 1K8CA 2FPTA 4JCLA 4FOJA 1W1PA 4TX9A 4Z2KA 4Y9AA 2HISA 2ZFAA 3VD7A 3EXSA 3WQ6A 3SRFA 2PLKA 3EA2A 3KZPA 4IFRA 5FJUA 2TMDA 3W7GA 4O16A 1AA1B 2G4FA 3F5KA 3GFXA 5CQ1A 1D3HA 1ECQA 3ABZA 3BDKA 3MWAA 3L5AA 5AVNA 1KFWA 1VJZA 3TC6A 5JBEA 3P81A 3QQ1A 4IPPA 3G5EA 3HV9A 3REQB 4K2SA 4LEQA 4PCTA 3BCJA 2H8XA 3ZM8A 2F2HA 1LUCB 2YW3A 2W67A 1XG3A 1OX5A 5LHEA 1DTUA 1JCNA 2E1DA 1A47A 3K1DA 3SUTA 1TRDA 5LNSA 5HQEA 4UWMA 3LBOA 2X8RA 4A6GA 2QHAA 4LXFA 1V7YA 2XZ9A 3M46A 3LHUA 2EPLX 1VAHA 2G50A 3PAJA 4AZ5A 4MKVA 3ANUA 5DMMA 2BVYA 2CU0A 4MM1A 4PFHA 3N4EA 4WQ6A 3DFNA 4C7DA 4R9XA 2CIPA 4F4RA 1XYCA 1QW9A 1YYAA 1QHPA 3DG6A 2E4TA 2A0NA 2PDFA 1JIBA 3TQ0A 1VKFA 4K68A 2YYUA 3P5ZA 1H50A 1XPYA 4ATWA 2EQDA 1OF6A 2BFGA 1FDYA 3LBCA 2DFAA 3UPMA 3GQYA 1J12A 2Q8LA 4ACZA 4GJJA 1S2UA 1J8VA 3CT2A 1AQFA 5DLCA 2I9EA 1Q66A 1XS2A 4P8UA 2HS8A 1QW7A 3HPFA 4X0NA 3R6IA 4L80A 5MKGB 2VHLA 2ICSA 3G8EA 1TTJA 1K77A 2WMKA 4US6A 3UWEA 3BC9A 3APGA 5IFPA 3VZXA 4F3HA 2BY0A 1C29A 1NDZA 2FPYA 2PDLA 3L9CA 2DW6A 3KLLA 3P62A 1O1HA 2J9XA 2QT3A 4JL1A 3R0UA 4W84A 3EA3A 4QJ4B 3B05A 4CU7A 3ABXA 3TA6A 3XISA 3FIGA 4I6VA 3LRLA 2J7BA 2V5JA 1G7UA 1XUZA 2AQOA 3UXDA 3BGAA 4QE4A 3VOGA 3W76A 3BK0A 4DBSA 3MU7A 4YL2A 3NEHA 1F9CA 1BWVA 4U33A 1DXFA 2AL2B 1XXXA 3ARWA 3SUSA 3G8RA 3UWWA 4CN4A 4C6PA 2ZZ2A 3RX3A 1W3HA 5G1MA 3NFUA 1OD8A 3O6CA 5FJIA 1SW3A 4AZCA 4LUJA 2B7PA 1KGUA 3H24A 4LSBA 4QG9A 1FWRA 4X2RA 4Q33A 4DZHA 3HQOA 3BAYA 1CCWB 5E9XA 4AWEA 3GVWA 4MMWA 1AK5A 5M2FX 1MDLA 4PTWA 4JTAA 3G0UA 1O60A 3LLXA 3PG9A 5E0FA 3N9RA 5HAOA 3ITXA 1HP5A 3OZPA 4JTHA 4PBGA 5HINA 3B3DA 3ARTA 3V1PA 2Y7GA 3KVKA 3NSNA 1AL7A 4I7WA 3GC4A 1OFEA 5CAHA 3IGUA 5BXPA 3T0BA 3U57A 2X0YA 3P5YA 3KEHA 1Z32X 1DE6A 2QCGA 2P88A 1Z8AA 2HPMA 2VDHA 3TC7A 4GNVA 1H51A 4Q6XA 1EO7A 4N6FA 4RZBA 5HQMA 1FWFC 1F5ZA 1AL8A 1KR0A 5CZKA 2V2CA 2HPIA 4XD4A 3QHOA 1M65A 2CBVA 3VOJA 2V5LA 2QCFA 4DNHA 4D6JA 1U83A 1JDCA 4D6HA 1WKDA 1TJRA 2BOFX 4QP0A 4FOUA 1WDRA 2JALA 3CEUA 2WCGA 1FUYA 1IEQA 1XLKA 4Z17A 1G4PA 4GO8A 3EOUA 2A6LA 1EUAA 5H91A 1LQAA 4NAEB 3W85A 4RXGA 3EOSA 1CEOA 1K6WA 4R34A 1DIOA 1ZBWA 2J27A 5CC7A 4Q6JA 2J66A 4W4QA 1LQ0A 1TX2A 3U8GA 1M53A 4WF7A 1TFVA 1P6WA 1N55A 4HNCA 4ZE5A 2XFWA 2KZHA 4TTUA 4GUJA 2PDGA 5GQBA 5D09A 3IJ8A 4ACYA 2JQXA 3DHPA 4CVWA 3M1ZA 1AQ0A 3L23A 3H55A 4B5TA 2R1KA 4LVGA 2J8TA 3M47A 1B57A 1PX3A 1OFDA 1GVSA 4ATLA 5E1QA 2VJXA 4LUYA 2OWCA 1V0NA 2YIHA 1SJBA 4PUUA 4O4WA 4QG6A 2J9ZA 2P8BA 3PJUA 2NSXA 5F1VA 3AXKA 1OK6A 6XIMA 1XLCA 3D46A 5DY2A 3AHZA 3LCXA 3YPIA 4HYVA 3LG3A 1SM9A 5I07A 2OVLA 1SUXA 2EEXA 4PMZA 1JZ2A 1A5SA 3OHIA 3R1ZA 4LUIA 1W1VA 3W71A 1NDVA 1JZ8A 3BOLA 1DHKA 1J6PA 3T40A 3S1GA 1PHWA 2CYGA 3W1NA 5B80A 1OVDA 1R0MA 1ZP3A 4AFYA 2E09A 2AL1A 2VEGA 5CGTA 1MUCA 3GNRA 2J7EA 4IQJA 2Z1KA 3I3DA 2QCDA 2OG9A 1M9HA 4IXHA 3EMZA 3ECQA 5TIMA 2RH9A 3LU2A 5FJRA 2VD8A 1UC5A 1RLCL 2X05A 2YCEA 4WY0B 4R27A 4EE9A 1PTAA 2WK2A 3RO8A 3B03A 3SZ8A 1EX5A 3C6CA 4V33A 1U22A 3A9BA 3RYSA 4ZEPA 1ZPTA 1SYTA 4ZQMA 3THDA 2ZYFA 3CYVA 2PTWA 4J27A 4R7WA 1JCXA 5CZSA 5BWFA 5A2BA 4GVFA 1KFEA 3C4UA 4C5YA 3S5OA 2POZA 2XIOA 4IWWA 4DUWA 1OFAA 4B3KA 3A13A 3MUY1 2DSWA 3C8NA 1EHAA 3M7WA 5J04A 1DXEA 2C71A 5EMJA 2FHCA 1IIHA 4DI8A 5CG0A 4OUEA 4JTUA 4IMDA 4DJED 3TJLA 5CJ5A 1Q63A 2QULA 1MW1A 5E6ZA 3KDOA 1V02A 1EXBA 1ITQA 3LGEA 2EKCA 2WKGA 1LRNA 1VBHA 1J0HA 3DFPA 1FXQA 2PCEA 1Z48A 3DGBA 1O1ZA 1LBFA 3PVFA 2VFEA 2PF0A 2QVNA 4L5ZA 1FWSA 3RO6A 1EL3A 2OZ3A 1LF1A 2YSWA 1LL4A 4OE7A 1BRLA 1QK2A 1YTDA 3KTCA 2WQPA 1VZWA 4AMCA 1GG1A 2QF7A 3IJDA 3UW6A 3IGHX 4HNTA 3PHAA 2OU4A 3WEOA 1JI2A 1M04A 3WQ5A 3RAOA 3TTSA 2X1RA 4BI5A 4QS5A 1CGYA 3G1HA 1OYAA 2IKJA 3VXGA 3W27A 4DJFD 4V1YA 4QLJA 3HF3A 3I6TA 1OEPA 2WC3A 1GJWA 3MWCA 2R1PA 1S2WA 2GUUA 2INEA 3OBAA 3PS7A 1GORA 4FMVA 1ZBVA 2XN0A 1ZCOA 1T8QA 5EYWA 4JIRA 4H9VA 3SGGA 4K37A 3WH6A 4K1WA 2CZEA 5I00A 3QKZA 1J6OA 3EDKA 2YFNA 3DH7A 1N82A 1HF6A 4HU8A 1JD9A 3S42A 3HMJG 3AMDA 2GGIA 3HQNA 3LZ3A 2R8WA 1ODUA 1XIFA 2V69A 4IIEA 3WLIA 2GOUA 4GJIA 4EWND 2PTZA 5CEWA 2QUNA 5DEZA 1K3UA 3F1QA 1GT8A 3ZLGA 1QDSA 3PNUA 3W2KA 4A2RA 1LG1A 3MKKA 2W91A 1CGWA 4HPHA 5LIWX 2VQTA 2GL5A 4GIRA 1JZ5A 3WH7A 2QV4A 5GJNA 3WQEA 4NZJA 2V81A 1MXSA 5AN7A 3UEQA 3MCNA 3NURA 4QX4A 4MADA 1UUOA 1PKYA 2PMQA 3M6YA 1S3TC 3A4AA 5LGZA 1ZJBA 3K2GA 2DZAA 4AC1X 3TAOA 4XZMX 4CD4A 2JEQA 2J62A 1B31A 3E2SA 4O10A 3PG8A 4EAMA 1LZOA 2D69A 4AF0A 3TN4A 1BGAA 1K9FA 2R1NA 2ODOA 3H4XA 2I5QA 3H2OA 4E4PA 4JDYA 4BI7A 3O6AA 3RF9A 2C1GA 4H04A 4DO4A 5LA0A 1RJRA 1VFLA 5C6MA 3KBVA 5BXRA 3LV5A 4A2SA 5EMMA 3BW4A 1S1RA 3NR0A 1CXLA 3UWZA 1UD6A 5EY5A 4L65A 3V0TA 1EIBA 1ML1A 1QTWA 4EAYA 2VDIA 1E4LA 2ZXAA 3T6CA 1Q5MA 3WBXA 3QVQA 4FP1A 4MF4A 3C0QA 2XIQA 3FJNA 2GPTA 3S1VA 2VELA 1WO2A 2ACRA 3W70A 2VCBA 3M9YA 5A8OA 3G1XA 3RM4A 5C54A 3P14A 4K36A 4YVPA 4P7NA 4D8AA 2YOCA 1Q6EA 5J8LA 1Q8JA 1A0DA 1FWHC 1X1ZA 2PGRA 4UQ9A 2W92A 3RDKA 3INPA 4INFA 3WG6A 4S3CA 2OGYA 2V9DA 4Q8OA 1BYBA 2NVCA 3ZLHA 1GEQA 5DMYA 1WV2A 1IGWA 3DENA 3CB3A 1JPHA 3GTFA 5A3HA 2FDSA 1PYFA 3D6NA 2XFRA 4EPEC 2JBMA 3QSTA 4K1GA 1TPFA 2C13A 4QCFA 4N2YA 2Y5EA 3WJXA 2ALRA 3GVVA 4LALA 4BS0A 1PIGA 1MUMA 3WJYA 1J0YA 1GOKA 2RGLA 4CCZA 4DHGA 2J6VA 2VC5A 4K6AA 3STGA 1TZZA 4B3ZA 1XIHA 3L0GA 4AC7C 1ZTVA 5FAGA 2WVSA 3W1PA 5LZLA 2QPXA 3WMSA 4CNPA 1CPUA 2IQTA 4QDPA 4GFSA 3KRUA 3G2GA 4TXEA 5F1UA 2UWFA 1AQHA 5H6HA 3D47A 2OT0A 3WD2A 1EEXA 3CQIA 4JZ5A 1E9IA 1EDTA 1WDWA 5C71A 4M56A 1KM6A 3MUCA 4HNOA 1HZYA 1OSEA 3PP7A 3WF0A 3UJEA 4EXQA 3H7RA 4U5KA 2O9RA 1R7OA 1RCQA 3MSYA 1OGSA 3NO5A 3DHUA 3QMTA 4M82A 1TVNA 1JZ7A 2EF9A 2OEKA 2A3BA 1DWIM 4O1FA 5HMSA 5KMYA 2YL6A 4ZMGA 2YR1A 4RKAA 3WUFA 2UY5A 3CHEA 3PZGA 3N13A 1EH9A 5CSRA 3BWWA 3W0KA 1VBUA 5C55A 1KCXA 3IVUA 2PFHA 1WXJA 4Q4MA 1KBBA 1TKKA 3AMGA 1HT6A 4DVOA 3NGJA 4B4FA 2XIBA 1DIKA 2C79A 1K70A 2VENA 2XVNA 4JTJA 3TXZA 1YHTA 2V2HA 3W4RA 2D3NA 4YYFA 5JVLA 3H12A 1VBGA 3RFAA 1UZ4A 1YEYA 5D2WA 3ZR4A 5I79A 4W86A 3VKAA 4IFKA 3UXIA 2DIEA 4Q7BA 4I9MA 4E5TA 2GDVA 3A6OA 5EBAA 2X41A 1R3QA 2XHYA 1EJRC 3N17A 4D2JA 1XC6A 2BP1A 1D3GA 4NJIA 3EX3A 3EWUA 2JKPA 1UR4A 3WJWA 4EVZA 3NDZA 2TRSA 4XBKA 2WMIA 4F0LA 2BASA 3W37A 1MZRA 3GVGA 2WBKA 1BXCA 8XIAA 1XM3A 4POCA 3M5ZA 3KX6A 3WQOA 3S3GA 5E09A 3FHAA 2Y88A 3WL1A 4DBEA 2PBGA 3NZPA 3P84A 1C92A 1Z89A 2E9MA 1OFPA 1SFJA 3WLTA 1ESWA 3KW3A 4B2DD 3W83A 3VIFA 1WKFA 2GGHA 3NGFA 2IXVA 3O9NA 1AW2A 3EEZA 1YE6A 2P0IA 2XH7A 4GO9A 4IQDA 4LB4A 1RCOB 2ZCGA 4I9JA 4DWSA 1TWWA 1QI3A 2PDYA 3M0YA 4KS0A 7XIMA 2OQLA 1T8XA 4PMUA 1O5KA 1GJPA 1KFJA 3IJLA 3H2AA 4OUIA 2AGKA 2P8CA 2TAAA 1XKYA 3N19B 3R10A 4QISA 3AWOA 5TNVA 5C9XA 1Z41A 3AIQA 4XKYB 1W3KA 5D04C 3TLLA 1WQ5A 3QR3A 4JKMA 1NSJA 4GE8A 1ZCCA 3CV6A 3VI2A 2R94A 3REQA 3ATZA 3E02A 1M7PA 2Q3OA 2A21A 4LYKA 3QGKC 4JOMA 4KMQA 1E1CB 5KSWA 2YDAA 3AYTA 4C6DA 5EKYA 4XKYA 4DPPA 3WL0A 2XFYA 2Y62A 1RXOB 2ZXDA 2HVNA 3ZR6A 4IP5A 4Y7EA 3BTNA 4A8RA 1ICSA 1KBJA 3HPAA 3M5XA 4WDWA 1W5OA 2FH6A 4FAMA 3DFTA 3PZVA 1EJWC 4MNMA 3ES7A 1Q2SA 3BUVA 1YXCA 4KH2A 2Z29A 4I8YA 2O9TA 4YCPA 2ONEA 3WQCA 1TTQA 2VYOA 4J7RA 3RLHA 3T08A 2QZRA 3NQGA 1OC7A 3PAOA 3HBLA 1QPKA 3WX7A 1KO0A 5CBJA 1GKRA 4HA1A 1TVPA 3THCA 5HBFA 5I2UA 3W75A 2HS6A 3USZA 2WZHA 1HKKA 2WZMA 5DMNA 1GW9A 3MI3A 1ALDA 3AUJA 4KWUA 2FPVA 4FLQA 4JTQA 4I7UA 4ZO6A 2AQVA 1QCWA 1V4YA 4BQ3A 5A6LA 3UNTA 1X7FA 5FEWA 2QF8A 3GXMA 1EOMA 2VT0A 5DO8A 1UZDA 4RDWA 4PUKA 3UR2A 1E0UA 4YPJA 2PI6A 1WYIA 1W3NA 4AD5A 1IF2A 4YVVA 3IV3A 1TUFA 4IGHA 4MKNA 3SCRA 4XUGA 4LRSA 3E0FA 3FSUA 1XG4A 1H1NA 4NRRA 4JD4A 2XDFA 5BWAA 4GGHA 4UCGA 2VEKA 4PMRA 1V03A 1ME8A 4XAFA 4IIGA 4CKQA 4N9BA 4LYQA 4F0KA 4OBRA 4MWAD 3RITA 5I3JA 4JQ3A 4M8UA 3G24A 3R8RA 1LBMA 2GQAA 1P6BA 2YB4A 4UUIA 1TMHA 3ZLFA 4IX2A 1Z9AA 3GC2A 4RNIA 3WDHA 4HCDA 2WVVA 3CT7A 1P1MA 4FK9A 1XW8A 4H6EA 1FX6A 2YL8A 5I24A 3MVIA 2BVTA 4ZO7A 1JYWA 5LXEA 3DC8A 3QV7A 4C1NA 4H00A 3EWWA 3QKEA 1ZJHA 4XZNX 1QATA 3BQ6A 4YN5A 1VIWA 2J88A 5FIPA 4JGDA 4LNYA 3PWAA 5HPOA 3V35A 3GTNA 3OBEA 4Q32A 3QW4B 1A5BA 4DBDA 1DJHA 5K7JA 4U2YA 3O0KA 4WOQA 1KW1A 3QY7A 3N2TA 2X7VA 3N4AA 2QDGA 2ZRWA 1YMYA 4D6FA 1EZWA 4MB4A 3IAPA 4AD4A 2CHOA 4AZ6A 2CLPA 4O4VA 3LI1A 3VGDA 4M24A 1TUXA 4TMCA 1E6PA 2HSAA 2A2IA 2Y7DA 3NG3A 1NOFA 2B31A 1FKXA 4UNKA 3NOYA 3QGVA 1B90A 4X9YA 4FNQA 4R53A 3WLMA 5AHFA 4B5WA 3TTQA 1FWTA 4MNKA 2NQHA 3PSWA 3W7JA 4FSAA 5HR6A 3K13A 1RLDA 4DZIA 1PTDA 4OVXA 1TV3A