5L6UA

S. enterica hisa mutant - d10g, dup13-15, q24l, g102a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
233
Chain Sequence
MIIPALDLIGGTVVRVVARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords HisA
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
total genus 79
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5l6uA00
1GTEA 4O54A 1I2PA 4RJEA 4BFAA 3MWAA 1O95A 4OV9A 3TC7A 4JTUA 3M47A 1VCFA 1R47A 1W5PA 1QPRA 3MHFA 1SW0A 3W83A 1FWNA 3W70A 5H2ZA 5K7JA 1DJQA 2YW4A 3AJXA 1RR2A 3LHUA 3N19B 4XUGA 1GVSA 2QUVA 2QUUA 3A5VA 1H7PA 2GVGA 4NJJA 4H3DA 3PUOA 2QKFA 1EWDA 4D2JA 3OVRA 4JS3A 1Q6LA 3EX3A 2F84A 3VI2A 4LVFA 3HG2A 4UMCA 5FF4A 1JVNA 3LV5A 3W7KA 3EXRA 5I3FA 2YFNA 3FLUA 3P5ZA 3W1QA 1BWKA 1YDNA 4Q4KA 3HB9A 1RPXA 4AWSA 2NXGA 4KKXA 3CU2A 3BG3A 3KHJA 2V5LA 4KWVA 4FNQA 4M5PA 3EWWA 3MUXA 4O53A 4QISA 2PCQA 1FDYA 1L9WA 4YLWA 4O52A 4UTJA 5K4XA 4O11A 5BOOA 4JTKA 4L4LA 5J5DA 1UUOA 5D2XA 1THFD 1XXXA 5CPLA 5LNUA 2ZRYA 3NZ1A 1HTIA 3HGRA 3PBWA 3V75A 3P61A 2X16A 2BX7A 5CSSA 4I7VA 1TJRA 3NQ6A 5AC8A 1P5BA 4O17A 4YL2A 2DZXA 1W3TA 3L5AA 1M5WA 1AW2A 4TU1A 5KMYA 1YDOA 5F4SA 1K7XA 2VEMA 4JTFA 2DU2A 4OE7A 1X6UA 4ZL1A 2XN0A 5KZEA 5HNRA 2Y7DA 2TPSA 1TYGA 4JY9A 3W85A 4QAIA 1K7FA 3TV8A 2YDAA 4S1FA 2QJGA 1EUAA 2GVLA 3A22A 1DOSA 1JCNA 1GWJA 2Y85A 2CLEA 2OJPA 1NFBA 2A2IA 1UB3A 3DU0A 2QCMA 4HPJA 1OABA 2ZRUA 2QCEA 3ABSA 1FUYA 3CC1A 4WD0A 3LRKA 1DBTA 2QDHA 1VR6A 3CLMA 5A8GA 2EHHA 1JUKA 1VZWA 2B4GA 5CKSA 3LDVA 3ABOA 3W7PA 1C29A 3UWQA 3M0ZA 4JNMA 4U28A 2WO5A 1ZFJA 3O6DA 3PR2A 1KM3A 5DY2A 4X2RA 3W7HA 2Y61A 4IX2A 2OX1A 1VLWA 4A3UA 1CW2A 1AL7A 1ICPA 2FLIA 2ZRXA 3W7EA 3EX4A 4AXKA 3OG3A 4QQ3A 2Y88A 3P67A 1DORA 3LRLA 3S42A 3G1AA 5EA9A 5K9XA 1LTDA 3WJYA 4JDBA 1SR9A 1X1ZA 5HR6A 1TPB1 2WQPA 1OX4B 3C3NA 3BVJA 1OX6A 3NQAA 1B4EA 3B0UX 5FF2A 4AVFA 1LLZA 1T96A 4GFSA 4IMEA 4UR8A 2FB3A 2FPTA 2RHGA 3MBFA 4KFNA 1KTCA 2B0MA 2QCFA 3QQ0A 3LCIA 4IGHA 3MP4A 3STGA 3QJAA 4JTJA 1DQXA 2NUYA 2KZHA 3PB0A 2E68A 1LRTA 1SO5A 2ATSA 3NQ7A 1VGAA 4ORIA 3W7IA 3HO8A 5K4ZA 4IOTA 2A1YA 3KVMA 4M6QA 3W1NA 3GNNA 3QF0A 4FNUA 5IBXC 2J27A 1EUNA 3PC0A 1G67A 1K7EA 2TYSA 1O5XA 2R91A 3LV6A 4AHOA 3LLDA 5EY5A 1TREA 1D3GA 4K36A 4XTDA 4LUJA 1LLWA 1X1OA 3NPVA 1TV5A 3GVGA 3HPXA 2B7OA 3FJLA 1XBYA 3GAKA 1KLYA 1BKSA 3H54A 3IVUA 2A7RA 2X1UA 3EWXA 4BWLC 2CLKA 3IVSA 4AH7A 3LBCA 1GOXA 4UTTC 1Q6OA 2JK2A 4X22A 2ZA1A 1W56A 1A53A 3EXTA 3FIGA 5G2HA 2VFIA 3Q37A 3O06A 3G1HA 3QC3A 2QCGA 3UWWA 3NPXA 1TPDA 5KSWA 3CM4A 3MO7A 3DZ1A 4JTLA 1I45A 3EKZA 4PTNA 1UCWA 4RX0A 3TR2A 5G1YA 3W76A 4QIUA 3Q94A 4M6VA 1S3HA 1TPWA 4LU0A 4AEOA 3I7RA 1NSJA 4RXGA 4Y8FA 2IQTA 2WSQA 4PA8A 1KTNA 2A6NA 4JYEA 2NWSA 3W88A 4N4PA 4QJ1A 4TMCA 3ATYA 3BW4A 1RVGA 1QAPA 1ZY9A 5HINA 4UFLA 1FY6A 1H63A 2E6DA 3G1SA 2J9ZA 3A9IA 3N9RA 8TIMA 4YMZA 1SSGA 3CHVA 5HWNA 1LZOA 2ZQ0A 3M5VA 4GUJA 4O0ZA 1MO0A 2H8XA 2OMAA 2CZDA 2X30A 4MVAA 2ZZ5A 1W8SA 2YYTA 2ZTKA 5MHBA 5D33A 4FF7A 1Q6RA 5HULA 3RFAA 3L67A 5EBUA 3HOJA 5DCBA 1XDLA 2V30A 3I65A 2CWNA 4UC5A 3SR7A 4UTUA 5LGZA 2RKXA 1KTBA 1RQBA 3S1UA 3NM3A 3GR7A 4JTHA 3L0GA 4O28A 4ZQNA 3C4UA 2QEZA 3AO0A 5D2TA 2A85A 3GXPA 3W7DA 3WJZA 2X1TA 1OK6A 1TPUA 3LERA 5I3HA 1B9BA 1WV2A 4N2YA 3P81A 1H7WA 3DKLA 3SIZA 3NG3A 3FKRA 3TXVA 2X1RA 1TJPA 3T55A 1UBSA 3CEUA 4QITA 4XBSA 1RV8A 3GLCA 3TJLA 4MFEA 2YR1A 1ML1A 4LS1A 3GKFA 2ZRWA 4O15A 5KZMA 1ONRA 3ABRA 3TNOA 5HQEA 1FDZA 4LVAA 4FNSA 4O19A 3RNDA 1QR7A 3C2EA 2OZ0A 3OBKA 2CZEA 2RDTA 1I2QA 1TTJA 4JYFA 3TW7A 1R2RA 1EB3A 1C9DA 2H6RA 2VKZG 1D3HA 1EX5A 3USBA 5G5IA 1HL2A 3W07A 4CQ8A 2Y70A 3NPUA 3TE9A 3M44A 1RD5A 1JQVA 4HHPA 4MIMA 4ADUA 4NJHA 4QSHA 4GC4A 5CZTA 4FNRA 1XKYA 3G1XA 4C1LA 5A5WA 3ZWTA 5E1QA 2NX3A 3EB2A 4EIVA 1AL8A 1B57A 1DV7A 1JCJA 1T8XA 1WOBA 1I2OA 3L0NA 3B4UA 3BLFA 1L6SA 3TFCA 1FCBA 3N73A 4KWWA 4PC8A 1DQWA 1OX5A 4M19A 4NU7A 1XDMA 2J6XA 3C0JA 4NJGA 1TPH1 5KINA 5TQLA 1KW1A 2VFFA 1K8XA 3HG4A 1OFOA 3LCFA 2VOMA 4IX0A 2H3BA 3NQ8A 3W73A 2O7QA 1TPVA 3FYOA 3M7WA 3TQVA 2WSYA 2ZCGA 3N2XA 4K8EA 1QFEA 3W1MA 4RR4A 3UY7A 3W1TA 1WOAA 1KM4A 4RLIA 1VCVA 2LLEA 3F03K 1PCWA 2JBMA 1L2UA 4IMCA 1WYIA 2YCEA 4CLMA 3IGSA 4LOCA 4O50A 3UYCA 3CB8A 1VLIA 1UASA 3THQA 4OGZA 3LTSA 4ZVJA 1R46A 2AAMA 2FTPA 3N34A 3QMRA 4HSNA 4I7WA 1OFDA 3LBMA 3BGGA 3LHTA 2QCCA 1SO6A 1XUUA 4O18A 4O12A 1TTIA 4IXHA 1GYNA 3FJ6A 2WNZA 1J5TA 2E5DA 3NQVA 5FF3A 3NQGA 5HMSA 3LCWA 3PVFA 1OFAA 2CLOA 3GAYA 1TTPA 3SFKA 3A24A 1T99A 3C8FA 3R13A 4O4WA 3OIXA 2ZZ1A 5LHEA 3MYPA 2DZWA 1XUZA 2C18A 3DHFA 2EF9A 4IPIA 4FXSA 4DF1A 4AF0A 2E6YA 3CEPA 2WOQA 4MZ8A 1IXOA 2J9XA 2BSLA 4O14A 3NAVA 5DBUA 2E5BA 3M9YA 4UXDA 3STCA 3UPWA 3KRZA 4HPXA 5D30A 5D37A 5KITA 1ADOA 1VH7A 3FA5A 3TSMA 5AHMA 3B0VC 2ZZ3A 4LVBA 4ZQOA 3QEZA 3TH6A 4Q33A 2EKCA 3LCXA 1TIMA 1KBJA 3L5MA 4TR9A 1QPOA 4Y9AA 3KXQA 1KFEA 1R30A 1WQ5A 2OCZA 2TRSA 5EPDA 3QPYA 1VQTA 2AGKA 3S5ZA 4PL1A 3NQCA 3QZEA 1H51A 3NGJA 3UWVA 3G1VA 4R7JA 3IIXA 4IMGA 1Q6QA 2DORA 1KM1A 3M6YA 4ZQMA 2XN2A 3P80A 3I7QA 4UCGA 4S2CA 3LXCA 1N55A 1K8YA 3S5YA 5IM51 1LORA 3V1PA 1LOSA 1S5WA 4XKYA 4JIPA 1W37A 3G1YA 3UWUA 3O16A 2CLHA 3G0UA 1IIHA 3G8EA 1AG1O 4O1DA 5D02A 5K3VA 2ZZ4A 3F4NA 3MW7A 3SY5A 4JN6A 3PULA 4AWUA 2R94A 1WBJA 3CPRA 1EP1A 1QO5A 1QPNA 1IXPA 3KX6A 5E0KA 3HGJA 1V7YA 1P0NA 1YDVA 5LNVA 1JUEA 3T44A 3S8HA 4RKAA 1OK4A 1N8FA 4R33A 1TPC1 1EA0A 1ZCOA 1SFLA 4FIRA 2A5HA 4BI7A 1BEUA 3P62A 1GZGA 4P2VA 4FXRA 1LOLA 4O1AA 3O6CA 3TJXA 3W1UA 2BXVA 3PB2A 2YPIA 3L68A 1BTMA 3W2MA 1SW7A 5IBXA 4TO8A 3L65A 3GXTA 1YPFA 1W0MA 1Z44A 3LGEA 1JJKA 3DFPA 1QMLA 3W1XA 2CU0A 1RZMA 5F1UA 5CG7A 1DJNA 4OBTA 2XN1A 1ICQA 3G22A 1TO3A 3VFLA 3W2LA 3A21A 2ISWA 2QAPA 4DF0A 5HWJA 2VEPA 4LVGA 3NZRA 5LKYA 1H1YA 1ZALA 4BWLA 3E0IA 3UPBA 5F4WA 1LM1A 2ZDRA 3S1XA 3LHWA 4HNVA 1VC4A 2QJIA 3GDRA 3OVQA 5DLCA 4NUWA 4UTTA 1SZEA 4K6AA 4EF8A 3M43A 2V82A 3JR2A 5LZLA 4QNWA 4OU1A 3NQMA 4CCDA 3W23A 1SPQA 1KBIA 1XC4A 1PVNA 3S0CA 4GWEA 3QRHA 4J9JA 4NNBA 4I9AA 3WJWA 1YYAA 4O1BA 4ALDA 3PS7A 4NXSA 4TX9A 2RFGA 1XM3A 1RQHA 3LHZA 4BR1A 3DENA 1LROA 2J88A 3STFA 2NX9A 3TAKA 1JCMP 2ATMA 2B7PA 5SWUA 3W7QA 3CWNA 4GUHA 3NQFA 4UUIA 4YCPA 3HBLA 1W31A 1I8JA 1LP6A 1YTEA 1XI3A 5DY3A 4WY0F 1VPXA 3O8AA 2YXGA 4JGDA 2GPTA 4M6PA 3W7GA 2NLIA 2VXNA 2NUWA 4K7VA 1FCQA 3GDMA 3PG9A 2ZRZA 4JR5A 1YLVA 1CI1A 4A21A 4K7YA 3FEMA 1Z41A 4WX2A 2FIQA 3W1LA 3R89A 2QDGA 2ZYFA 3M16A 4W9TA 4CCEA 3WJSA 2ALDA 3I68A 4IWWA 1JCXA 1SZFA 2V0TA 2H90A 3SJ3A 3MI6A 4LW7A 3W2UA 3MJYA 3W2JA 1ZAHA 1HG3A 3PM6A 5CPNA 1JUBA 5D05A 4DBDA 5HWMA 1ZAIA 2DZUA 5HR7A 3UXDA 2EGZA 3BG5A 4UR7A 4WOQA 5CZSA 2YSWA 3BARA 1SQ7A 3TA6A 4AAJA 1TPEA 1TTQA 2X2GA 1GEQA 2B7QA 1H50A 4I7UA 1YADA 1HO4A 2QR6A 3GK0A 3QFEA 5C6MA 1IXNA 4RCXA 2UV8G 4PL2A 1OFPA 3GDTA 4RZ4A 1SW3A 2Q8LA 1OF6A 2Y63A 4UFJA 1FXQA 3STEA 1KV8A 3K30A 4BK9A 1VYPX 5L9FA 4Z1AA 2VFEA 5T26A 2E6AA 1GVQA 1MZHA 2VENA 3KFTA 1XBZA 5D2WA 3QW3A 5DCDA 4RV8A 5F4XA 4MY9A 4O8RA 3KOFA 4UFMA 3EEGA 3RK8A 2V8ZA 1SZNA 1S5VA 2P0OA 4MOZA 2FQIA 4Z0JA 4GUFA 4IMDA 3TKFA 5BW6A 2HTMA 2E5CA 3BK0A 2WKJA 3EWUA 2AQWA 2QJHA 5GVJA 4CQ9A 1K8ZA 1FWWA 2QUTA 4Y96A 4NNAA 4TIMA 3NR0A 3MYOA 5K9DA 2JGYA 4LUIA 3U6WA 4JTIA 3W7OA 2R14A 1NF0A 3EXSA 4UNLA 1Q45A 2G97A 3G3MA 3MP5A 4IUOA 5FEPA 3UQNA 1VYSX 4LNYA 3IIPA 5G2WA 2C0AA 5I3IA 3VKJA 2PRLA 5KTLA 4XBKA 2G5WA 4Z1BA 1SSDA 4A22A 4UTMA 4WZHA 4ADSA 2ZZ2A 3LB0A 4HT3A 5HUPA 3A23A 4CQAA 3NEVA 3RLUA 2OT0A 1I2NA 3ZR4A 1LBMA 3WJXA 5CPOA 3W7MA 3H53A 4LY8A 3W9ZA 5F2IA 3DXIA 3TMQA 2ZZ6A 1IIGA 2C19A 3GR8A 4Z08A 1KV5A 5I3GA 3UWYA 1HFBA 1QDSA 3P5YA 3D0CA 4WOZA 3TROA 1XBVA 4MY1A 4UMBA 1PHWA 3S5NA 3UZ5A 3LOTA 1OHLA 1ME9A 3BGJA 5FEWA 1W54A 3PSWA 1K02A 4LS0A 3HG5A 2RDUA 5LNWA 3VE7A 1W1ZA 3ELFA 4HSOA 2V2DA 1R2TA 4AHQA 3NQDA 3DFSA 3PBVA 2E1DA 3ABQA 1OYCA 1S5TA 3G1FA 3N2MA 1T0OA 1KA9F 4N6FA 1UJPA 3DFNA 4KFPA 4UMAA 5BNKA 3C2OA 4HNTA 5DCEA 5EL1A 5BMWA 4QM1A 2Y7GA 3KVLA 2C3ZA 2PE4A 1EP2A 1FCUA 4N9DA 3T4CA 2NWRA 4N9CA 4NNCA 3O07A 4ZZ9A 2Y62A 3W2NA 5L6UA 4POCA 3N9SA 4DELA 1FX6A 2RDWA 3DAQA 3LXBA 3WK1A 3E12A 3QMSA 5CSRA 4O16A 2W0UA 4ONVA 3GZ3A 5AHNA 4FX7A 2VC6A 3NO5A 3PY2A 3G0SA 1EP3A 4LTSA 3I7SA 2QCDA 3RU6A 3GYEA 2VFGA 1J2WA 3UY8A 2E09A 2GQ8A 4WY0A 3O63A 4Z1DA 1V5XA 4JEQA 1PIIA 2PRHA 1UUMA 1ZNNA 2NV2A 2RH9A 1YXDA 1IF2A 3S5OA 1F7BA 2ISSA 3EX2A 2G96A 1F05A 2NUXA 1TQXA 2V5BA 4Q32A 1F2JA 4XWUA 1YTKA 3TXZA 1YPIA 4GJ1A 2QCNA 5EKYA 4XKYB 1WAUA 3HG3A 1SFJA 2E6FA 2J9YA 4GRSA 4IPJA 3KRUA 3YPIA 5AYYA 3DFQA 1CX9A 4K39A 4K37A 3CT7A 4PFMA 3LCLA 4E0CA 3DI0A 3L5LA 4JTTA 4LV9A 3QMTA 3IGXA 4JIQA 3EWYA 4Y6GA 2VELA 3KVKA 4XQ6A 3IIVA 3TAOA 2GOUA 2P1FA 3TDFA 2I1OA 1AMKA 2PRMA 3P8JA 3R12A 4E2DA 3G24A 4EF9A 3R2GA 1VRDA 1FDJA 4N9BA 3VNDA 3W1AA 3C52A 1F76A 3F1QA 5F2GA 3BW3A 4OT7A 3LI1A 3IIZA 3GXNA 4LT9A 4RK8A 2E77A 2JKAA 5KZDA 3SZ8A 2BWGA 3GX9A 3MMTA 2ISVA 3BPWA 3L2IA 1KFJA 3W22A 1OJXA 1QO2A 3INPA 4DPQA 4FNTA 3P60A 3TSBA 3W7JA 1OFQA 3W87A 1P4CA 2B7NA 2ABAA 3SGUA 4JX4A 2Z6IA 4JD4A 4OHQA 1GT8A 4FHAA 4PEKA 2FDSA 2YFOA 5G2IA 1W3IA 4MJZA 1AK5A 1O5KA 1TQJA 1JQXA 1PS9A 2I14A 2P10A 2VFDA 1SZGA 3HIJA 5AYZA 3O05A 1H1ZA 2XFWA 3G1DA 3QQ1A 2GQ9A 2YZRA 2Z6JA 2V2CA 4H4IA 3IVTA 4UTWC 3QYQA 4DO4A 1K03A 1D9EA 4B5NA 1PCKA 5FF7A 1WX0A 2Q3RA 3LHVA 4GUIA 1EIXA 5DBTA 3VCRA 1QOQA 4UTLA 1JRCA 2NXIA 1TV8A 2H3DA 4MJMA 3W1PA 4DPPA 1G4EA 4DO6A 4JTGA 1JR1A 2X1SA 1DKWA 5AHIA 1X7FA 2A6LA 2Y89A 2BLEA 3L21A 2WJZA 4IXXA 3C2VA 1OFEA 3VE9A 1G4TA 1W5NA 2JKEA 3BV4A 3DKJA 2Y6ZA 4FIQA 3Q2DA 4BI6A 4NX0A 2YX0A 4FX8A 1ICSA 1DHPA 3LCHA 3THAA 3S1WA 3LTYA 3WFAA 1VJIA 3C61A 1BWLA 3JS3A 3TCEA 4HNUA 2ZRVA 5G4WA 1W5MA 3GKAA 2NV1A 2DZTA 3L0KA 1QNVA 1Y0EA 4BF9A 5FEZA 4EVZA 3NXFA 2HS6A 1G7VA 4C1KA 1KM6A 1PL9A 5LHFA 1GG1A 2GQAA 1OYBA 5TBOA 4NQ1A 5AC6A 3GDKA 3H55A 5H91A 1K3UA 2HMCA 3NYZA 3MHGA 4EWND 3NL2A 3LM7A 4O13A 3QPZA 1FQ0A 3W74A 1HO1A 1U83A 2O7SA 3HJZA 3CQ0A 3FYPA 1Z48A 2BTMA 1DL3A 2C14A 3F4WA 1LBFA 3R8RA 4JX5A 2V9DA 4BI5A 4UTHA 3PAJA 4E2BA 3OVPA 3NOEA 4UNKA 1MEWA 3P82A 1GPWA 4MYAA 5AC7A 3W86A 5DXXA 4JDYA 2WNNA 4DO5A 1WBHA 3W7NA 3PBYA 1A5CA 5E93A 3DH7A 1JCYA 3ZFHA 5DXYA 3UXAA 1GYLA 2DZVA 3OHIA 3FKKA 1Q3NA 3TUUA 4OWGA 4O0KA 2A0NA 5U7SA 3DI1A 2C1HA 4N9EA 2OT1A 4XZ9A 1X8FA 3WK2A 4PCFA 4AWTA 1QCWA 3UNDA 3DBPA 2Q8ZA 4A2RA 4CNNA 1ZJIA 3DFTA 2H8ZA 1F73A 2D73A 1NF7A 5CGQA 2DJLA 3EX1A 5FF0A 3PG8A 1H7OA 4ADTA 4X9SA 4N02A 2YGYA 5C5YA 3T7VA 3TX9A 4NX5A 3C6CA 1G4SA 4FEZA 3BO9A 5AN7A 2NXHA 3G8RA 4IMFA 4MZ1A 5C54A 4HKPA 1GVRA 4O1CA 3L66A 4HIBA 4WXYA 3NA8A 5I3JA 3O6YX 3W71A 1MXSA 5LNSA 3CWOX 3M5YA 4MUZA 1GJPA 3E96A 4G1KA 3KVJA 4NXKA 1TB3A 4ZQPA 3HGSA 3NNTA 3GIYA 2Z0IA 5HJLA 4E38A 4AB4A 1TPFA 2GUUA 4OQVA 3PBUA 3GB6A 1KM2A 4K8HA 2W6RA 5F1VA 3ZS4A 1GG0A 3T40A 3TQKA 1GVFA 3QH2A 3W7RA 4CNPA 4R53A 3B0PA 4K38A 1OVDA 2GJLA 5I3KA 1MEIA 4FX6M 4IQLA 2A21A 2Z1BA 1L6WA 3TW6A 4X3ZA 1WA3A 1QWGA 2VFHA 2A7NA 1H60A 3IRDA 4UFIA 1I4NA 4LRSA 1SUXA 3FS2A 1N7KA 2JGQA 2R8WA 1M6JA 4O57A 1RQEA 1VYRA 1A5SA 3JRKA 3LXAA 1YXYA 5D2YA 1FBAA 3P8IA 3OEXA 1QPQA 1F74A 3ANYA 4FB7A 3SI9A 1U5JA 3U8GA 1A5BA 1KFCA 3M1ZA 3M5ZA 1TV7A 1VS1A 4GE8A 3CIWA 3Q58A 1PHQA 3DGRA 2GJNA 3MI2A 2G95A 1WDWA 4A29A 5AYXA 2FPVA 3CIXA 1SO4A 1W5OA 4MLRA 1JULA 2WNQA 3W3OA 3HF3A 3G0XA 2A4AA 1AW5A 3MBDA 3PWAA 4H6KA 3QSTA 2J24A 3W1RA 1XBXA 1A50A 2HSAA 3B04A 5AHFA 4ZMGA 2JKPA 3B05A 1LCOA 3L9CA 3P7YA 3TC6A 3RMJA 5ABTA 5LSMA 2PURA 3W6YA 1O4UA 1OFRA 4DXVA 3S9YA 1LOQA 5HUOA 5LGXA 4IJBA 1EPXA 1O94A 5AHLA 1QOPA 4LC8A 1WXJA 4N4QA 5TIMA 4WUIA 4MFDA 4L4MA 4MYXA 4HN4A 3W7LA 1ME8A 2QCDB 1TCDA 4DQWA 5BRBA 4CCCA 1H7XA 3ATZA 4ML9A 4GUGA 3HGOA 4WY0B 1YTDA 4MLJA 1G6CA 1EEPA 4YXGA 1B4KA 2CW6A 3LTPA 2C13A 3W75A 1VHNA 2ABBA 1OG0A 1F6KA 2A7PA 4NZJA 3BLIA 3GDLA 4YCOA 2VEKA 4Z1CA 1F6PA 2CLMA 2ZA3A 4TMBA 3BG9A 3FOKA 3N3MA 2EPHA 1P1XA 4JTSA 2EAWA 4PODA 3UD6A 3G3DA 1H5YA 5DN1A 1PV8A 1TSIA 3NL3A 3W72A 3NVTA 2WV8A 4M7TA 7TIMA 2Y7EA 4UTKA 1H61A 3NQEA 1FWRA 1KM0A 1J4EA 2C16A 1O60A 4UFKA 5LNRA 3P84A 3B8DA 4LRTA 1OX4A 1A5AA 3HPSA 3GNDA 1XL9A 3MI3A 4AHPA 1JCLA 3IIOA 4N6EA 3LCGA 2V2HA 1FWTA 4LVDA 4ORMA 1I2RA 2YW3A 3HMJG 1NVMA 4Y90A 3M5XA 1HUVA 3KRSA 2YYUA 3PUDA 2CLIA 3B03A 5D32A 1C8VA 5AHEA 3SSJA 4RXFA 1TRDA 3NL5A 1B3OA 2BZNA 5D2VA 4UFHA 3MHUA 4A2SA 4AF0B 2CFFA 1KM5A 2WPBA 4U4MA 3WK3A 2F7FA 3EWBX 1FWSA 3SECA 3TIMA 1OFBA 3LX9A 1M7PA 4GXMA 4O4VA 1MEHA 3N14A 1LRNA 4FNPA 1H7RA 1H7NA 3MP3A 4UTWA 4JYDA 3A5FA 5CZ0A 2CLLA 1ZENA 1KFLA 4NJKA 5K9CA 3W7CA 4RZ6A 3C2RA 5CPMA 1G69A 3FFSA 3EKLA 3TQ0A 3TFXA 3TU9A 4R34A 5G1TA 1AW1A 1NAL1 3PF3A 3LRMA 4WQ6A 4M7SA 5FESA 3RLVA 4JICA 5F2LA 4PH6A 5FEXA 3NM1A 1PE1A 3QW4B 3BLEA 1KLZA 5FI8A 4RZ5A 2NZLA 5D04C 1F5ZA 3SGZA 3W84A 3DFOA 4LV4A 1XCFA 4WJEA 2CZFA 5EMUA 5C2XA 5AOUA 3RF9A 3E02A 4ZQCA 4JY8A 2ZFAA 4EOUA 4MKNA 4FO4A 5G4EA 3HQ1A 1P0KA 3EWZA 3E49A 4WXZA 3OA3A 4MY8A 1EWEA 2QF7A 4JTEA 2CLFA 4LWWA 1KFBA 5DELA 6ALDA 2DJXA 1Z42A 3QM3A 3DHDA 3S6DA 4QNEA 1IGSA 4Z0SA 2FFCA 2C6QA 3NDOA 3SW6A 2TMDA 4O10A 1XFBA 3R5EA 1LYXA 2GVJA 3C2FA 1H62A 4GNJA 1IXQA 5K2ZA 1NEYA 3TK7A 4NZFA 1SU5A 4MZYA 3UZJA 5D09A 1KFKA 3QSRA 4UIOA 2I9EA 3G18A 1M7OA 1R2SA 2NX1A 1G7UA 3UWZA 1ZAJA 3NL6A 3IEBA 2DP3A 1LRQA 5AFDA 2TSYA 1OYAA 2QCHA 4AMAA 2QAFA 2HS8A 4HNNA 4P61A 3TSDA 3CTLA 1VCGA 2Z2UA 2C15A 4KFOA 4CNOA 3E9AA 3M41A 2FPYA 2DZPA 2W79A 3T78A 4YWIA 4GBUA 4JXCA 2CZ5A 2V81A 3LLFA 3NQ2A 1ME7A 1L6YA 4UTIA 5J5RA 1ZHAA 3IV3A 3PUEA 4MPQA 1W5QA 3U2OA 3HPZA 4NVTA 5CZJA 4S2BA 3LI0A 1G4PA 1W3NA 1YXCA 2Q3OA 3S1VA 4JX6A 3W2KA 5AB3A 4LS2A 6TIMA 4ZQRA 2DZSA 4NT0A 4OV4A 2VEIA 4NJIA 3ZWSA 3C56A 3LHYA 5BMXA 1JRBA 1FCVA 2ZZ7A 1E51A 4XTIA 2PC4A 2ZBTA 3BW2A 4DBEA 2ZA2A 3TMLA 3O15A 1GVOA 2FB2A 4LC6A 1LDCA 3I6RA 5U4NA 4DF2A 1MSSA 3WK0A 1FXPA 1DVJA 2FJKA 3B06A 1ALDA 1LBLA 3EX6A 3O1NA 5F2MA 1GTHA 2ZTJA 3KAOA 5EYWA 1TMHA 5D03A 1OF8A 1VHCA 2WSRA 4DEFA 1TRIA 3P74A 4ICNA 5D38A 2Y7FA 5C55A 2QCLA 3PSVA 1SO3A 1GQNA 3IGUA 3NPWA
chains in the Genus database with same CATH superfamily
1GTEA 4O54A 1U1JA 4HNCA 4JTUA 4RW3A 1R47A 1UIOA 4IISA 3EDFA 3MHFA 1G9HA 1H3GA 1XR2A 3VIOA 1V03A 5H2ZA 1DJQA 1SFTA 3WEZA 4H8NA 4FOKA 1RR2A 1V0NA 3N19B 2PGRA 4WVXA 2GVGA 2QKFA 4NG3A 4D2JA 1EJUC 4MSSA 2I5GA 1D7FA 1Q6LA 3EX3A 1SVDA 1XRFA 1OSEA 3P0XA 2EPLX 3LEPA 4GVIA 1KB3A 4L80A 1LG2A 3EXRA 3P5ZA 1P0BA 1SR0A 1FFRA 1QU4A 5T91A 1RPXA 2V69A 4Z2HA 1US2A 4RL3A 3VMNA 3AZSA 3MUXA 5JMUA 4QISA 1ZRQA 1FDYA 2BVDA 3OZPA 5DO8A 2HBXA 4O11A 3WNPA 4NY2A 1M7XA 5J5DA 3HFTA 1UUOA 2YCJA 1CXFA 2XZ9A 2ZKMX 5C7VA 5G1MA 3NZ1A 1HTIA 3HGRA 3PBWA 1R3QA 3MSYA 3E2SA 1RBLA 1CPUA 2AMXA 3MKCA 1M5WA 4B2DA 2HISA 4TU1A 3I6TA 2ZWZA 5F4SA 2QT3A 2VEMA 4JTFA 3VGBA 3H7RA 3RMEA 1MNSA 1TMQA 5AYIA 2CKSA 2BY3A 4WR3A 4JY9A 3W85A 4GI4A 3DHPA 1DOSA 1GWJA 4A35A 3K4DA 4CU8A 3ABSA 1KR1A 3PWGA 1FUYA 4CQDA 1DBTA 1Z89A 2QDHA 1VR6A 4XZHA 3VM7A 3CLMA 4F2UA 1JUKA 4CD8A 1FA2A 2B4GA 4I3GA 2P88A 4DUVA 2W62A 2AL1A 1C29A 2JE8A 3AS1A 2WO5A 1UD4A 3DG3A 1KM3A 1ZCCA 3WIJA 4X2RA 5JQ9A 2V63A 3OJGA 4DVOA 1CW2A 3WUEA 2DIJA 2ZRXA 2CBIA 3W7EA 3EX4A 3ZLGA 4AXKA 3OG3A 4QQ3A 3LRLA 5K9XA 2GJXB 4JDBA 2G3NA 1B3ZA 4BEQA 4C5ZA 1OX4B 3C3NA 3UR2A 3H8AA 4BY3A 2HV5A 1B4EA 5LIXX 1UOKA 4WSJA 4JCMA 1FWGC 1LT8A 4AVFA 2PLKA 3LPFA 4GFSA 2XPKA 4UR8A 1FKXA 2FB3A 2FPTA 3TNBA 4YVXA 1BXNA 2O4MA 2GUYA 3STGA 4HMCA 4XZMX 2NUYA 3PB0A 4R5EA 2ACUA 4GHRA 1SO5A 3KBWA 1VGAA 1DHKA 4ORIA 3R4IA 1DJZA 3HO8A 2VX4A 4MF4A 3KVMA 4ZXOA 2VM8A 3VFCA 2GK1B 5IBXC 2J27A 1EUNA 1NOUA 3PC0A 2TYSA 3GTIA 2R91A 1K9EA 3CYJA 4UQEA 3BOLA 2VCCA 4H6RA 3WD1A 5EY5A 1Q65A 2HROA 1D3GA 1BQCA 4IM4A 3PJTA 1X1OA 5A6AA 1TV5A 2P76A 3GVGA 3T09A 4PFHA 2XINA 4K68A 1BKSA 5JBEA 3LYEA 1D3CA 1W3HA 5D9NA 3BE7A 4AH7A 4XIAA 4IIHA 1ZBCA 4X22A 3MUAA 4JKKA 3EXTA 2VFIA 3O06A 3LGDA 3G1HA 3WLLA 4LUYA 2PP3A 4ZO6A 3ARXA 2MANA 3UWWA 4R7OA 5DQPA 1Y7VA 4AQLA 4FAMA 4JTLA 4H9VA 4XD4A 4QE4A 1GKQA 4G7EB 1W6TA 4H6EA 4Y8FA 2ACQA 4PA8A 4JYEA 2MNRA 3QGAC 3UXIA 1UZDA 4LBSA 1V3IA 3WO8A 3LPGA 1VFUA 1JFXA 1QAPA 4LEFA 1ZY9A 5HINA 4UFLA 3STPA 3UG8A 1T40A 2XIBA 2E6DA 3C3UA 3N9RA 8TIMA 5HWNA 1LZOA 2H8XA 2O9TA 2ZC8A 3PBGA 2YIHA 1TWSA 1XC6A 1VPQA 2FVKA 2X30A 4PTDA 3U7VA 2PU0A 2GJRA 1JPKA 2YYTA 2ZTKA 2QV4A 4GABA 4EPEC 4X0VA 5EBUA 3KCOA 1XLKA 1XH2A 3OZOA 2GGEA 4UC5A 4UTUA 5FIPA 2OSWA 3SR7A 5M1TA 4JTHA 4PULA 5XIAA 2E7FA 2QEZA 4I6KA 1ADDA 4LAZA 5D2TA 1LWJA 2EQDA 1X8CA 3GXPA 4R7WA 3W7DA 3WJZA 2X1TA 1OK6A 3UGRA 3LERA 2WM1A 1B9BA 1WV2A 5I3HA 3FKRA 3T55A 1S38A 3ONBA 2P8BA 1MRAA 1TE1A 4CNSA 1RV8A 2Y2WA 2GZXA 3KTCA 2DH2A 1U5VA 4O15A 1TKKA 1YKWA 1T5AA 5KZMA 2JF6A 3QR3A 4X9YA 1QR7A 3C2EA 5ENLA 2OZ0A 5FL0A 1R0MA 1C9DA 1JI1A 4JTQA 1VAHA 4DAFA 1EX5A 5G5IA 3DGBA 3W07A 4C1LA 3ZWTA 2NX3A 1RP8A 2BP1A 4GXWA 4IP7A 2OX4A 4AU0A 4A3QA 1DV7A 1TUXA 2EO7A 1VFSA 3DC8A 3RRXA 3BLFA 2ZXQA 1WKYA 3MO4A 1OX5A 1S5NA 4ZB0A 3C0JA 1M3UA 2DSUA 5CAHA 5CPSA 1IWAA 2VFFA 3NIYA 3R0DA 2SFPA 4WJXA 1UWTA 1RHCA 2BS9A 4INFA 1HVXA 3R94A 5I00A 2OOGA 2WSYA 1Q2RA 3OQ8A 4RNFA 1NOFA 5DF0A 1UUQA 2DUAA 4RR4A 3W1TA 3WLRA 4DBWA 2JBMA 3UVIA 1L2UA 4IMCA 4CLMA 3QZAA 3CTTA 3TYDA 2BY0A 1WKFA 3K2GA 4LNCA 1C8YA 3QMRA 3N34A 5GJPA 2J79A 1Y8BA 3BGGA 1ISYA 1SO6A 1Z32X 3W24A 2DSZA 4RDYA 2WNZA 3BCJA 5JU6A 1D8WA 1M68A 3LCWA 1OFAA 1L6GA 3GAYA 1TTPA 1T99A 3C8FA 3OIXA 2ZZ1A 4C6JA 4B16A 3MYPA 2DZWA 1XUZA 2C18A 3BZJA 4IPIA 4CNTA 1UWIA 4XB3A 2J9XA 4OJYA 4O14A 5DBUA 1BVWA 2WPGA 1YPXA 4UXDA 4M24A 3STCA 3UPWA 3KRZA 5D30A 2YL6A 4UOQA 1VH7A 3PP7A 5AHMA 4KETA 4ZQOA 4MJ2A 4L56A 4CD4A 1UWSA 3PZIA 3L5MA 3S6TA 1AD4A 1UR8A 1WQ5A 4S23A 2R24A 2OZ3A 2W67A 2Z29A 1GJWA 1DIOA 3GFYA 4J7RA 1YX1A 4WDUA 1WNOA 1EXBA 3W26A 3NQCA 4R7JA 1ONWA 4Z42C 2DORA 3BMXA 3CZKA 4GBDA 4GIRA 3OTRA 4S2CA 3ARYA 3LXCA 3WQCA 1N55A 4KCUA 1ZBVA 4F8XA 1ZJAA 1PWMA 3G1YA 3O16A 3SUTA 4DY1A 1IIHA 3SCWA 2E28A 1AG1O 2ZZ4A 3SY5A 3MW7A 3PULA 3RDKA 4LUTA 3CV6A 3HPFA 2D2HA 1EP1A 1QO5A 4ZOCA 3KX6A 5E0KA 3HGJA 5LNVA 1LT7A 1JCTA 4RKAA 4R33A 3VZZA 3HV8A 1ZCOA 2VR2A 3TLLA 1SFLA 2F38A 2Y5SA 2B31A 4DJDD 3QR1A 1NWTA 3VKKA 1GYMA 2WVTA 3W2MA 1FTXA 4TO8A 4CQCA 4HQVA 1W0MA 3PJUA 3DFPA 3W1XA 3TJ4A 3AIBA 5CG7A 1DJNA 4JPGA 4HJWA 5GNXA 3WL1A 5M5DA 1C92A 3VFLA 2ZXBA 4WDTA 3AOFA 5HWJA 4LVGA 1XLMA 4GYPA 3VUSA 3UPBA 3G6MA 4ZO8A 4GY1A 1VC4A 3V5OA 4EF8A 3ZLHA 3CL6A 4GI8A 2OXNA 4CCDA 1EH9A 3U9IA 1CXLA 2YCIX 4I9AA 3WJWA 3CJPA 4MWAE 6ENLA 4NXSA 3RX2A 3GFXA 2WWDA 1LROA 2J88A 3VOFA 1JCMP 2B7PA 1I8JA 4HGXA 5LIYX 5ECUA 1VPXA 4J3WA 2YXGA 1XD0A 3ARWA 5IFPA 1JF5A 4M6PA 5A6TC 4BQ5A 1UMYA 5FJJA 1CI1A 4WRHA 4A21A 3FEMA 1Z41A 1KRMA 3R89A 3O0FA 2ALDA 3I68A 4IWWA 3E1F1 4FLQA 1N8IA 2V0TA 3MI6A 3W2UA 3EA2A 2W92A 3PM6A 4FPSA 4Z2IA 1XICA 1W2PA 3BAXA 1Q5MA 1ZAIA 3Q45A 1BTCA 2DQXA 3CHDA 2EGZA 3ITGA 2FH8A 4F2TA 3CMJA 1S2VA 4GCXA 2YSWA 3PBMA 5A8PA 3TA6A 1TPEA 2X2GA 3S1GA 1JZ2A 1TELA 1XQKA 2YBTA 3GK0A 1ODUA 3QFEA 2CZVA 4RCXA 3KBNA 4O8AA 1MUMA 3GDTA 1SW3A 2Q8LA 3CIVA 1OF6A 1LJYA 1MQPA 3MA8A 5HMFA 2G50A 2YCLA 1K4HA 5F4XA 3A4WA 2Z2BA 2FVLA 3EEGA 2RUSA 4NZ3A 2P0OA 4MOZA 3EMZA 2FQIA 1W8GA 2ZX6A 1SMDA 3TTYA 4GUFA 2GDQA 3VNYA 1XQLA 1PB0A 2OSYA 3BK0A 3SN1A 1BQGA 5GVJA 3WQGA 3A13A 4GIAA 4NNAA 1IT8A 5M3WA 2PD9A 4IUOA 4AEEA 4LNYA 3IIPA 1O7AA 5G2WA 2C0AA 1C93A 4PR4A 2PRLA 2PP0A 4EP8C 2BOEX 3HV9A 4A22A 2FDMA 1LQAA 2XTKA 2BGNE 4R3UA 2VC7A 1NP2A 2OODA 4RE2A 1WKEA 3FK4A 2AL2B 1IEIA 4FMVA 3MZNA 4AZ5A 5CPOA 1ZGDA 1EHAA 2PDKA 5F2IA 3DXIA 4B5UA 4Z08A 2OGYA 3QTGA 5I3GA 2J8GA 2WC7A 3FXYA 3TROA 1XBVA 4MY1A 4D6FA 1HVQA 4Q4MA 5HJYA 1H09A 2FFIA 4LS0A 4GG9A 2QUMA 3VE7A 3KWXA 2V2DA 1R2TA 4R9OA 3DFSA 3ZO9A 3PBVA 2E1DA 3AIEA 1CTNA 5BWFA 1A5NC 1T0OA 4N6FA 1UJPA 1MW0A 3WNMA 1NP0A 3D3FA 4V2XA 1R9XA 3RM8A 4E4UA 3ARQA 2BY1A 2XIJA 3WD4A 3C2OA 4HNTA 4YVVA 4LH8A 3COTA 2PE4A 1RLCL 1FH8A 4N9DA 3T4CA 1TG7A 3N04A 3WQ5A 1H0IA 3URBA 1E73M 1V08A 5I06A 2PDGA 4LQ1A 2IQ0A 1FX6A 2V3FA 4LCQA 3DAQA 3L4UA 2QHAA 1FHDA 3E12A 3AC0A 3QMSA 2YCKX 4O16A 4QJ4B 2VC6A 3DDMA 4NAEB 3EPNA 3I7SA 1XYCA 2ONEA 3AIWA 2VFGA 4HCLA 4HCHA 2GQ8A 4WY0A 1XPGA 2X05A 3WLOA 3VOJA 2PTXA 4JEQA 1PIIA 5C8BB 2V68A 1UUMA 2YDQA 4PEEA 2NV2A 2RH9A 1FHUA 5I3DA 5BYWA 1A3HA 3WCZA 3B8UA 4MNMA 4MB4A 4REQB 3IGHX 1F2JA 4LYPA 5EKYA 4TV6A 1QW9A 1WAUA 3BDKA 1U30A 2J9YA 3UPMA 1C90A 4ZSUA 1NARA 1XIEA 3RN6A 4K39A 3CT7A 3FX4A 1FWBC 2VURA 4URIA 1ISWA 3L5LA 4XZBA 4U5IA 1LL4A 2J66A 3H2FA 3IGXA 1OGGA 4JFUA 4NYYA 4XQ6A 3KDOA 3WMSA 3DBNA 2PS2A 4WLCA 2P1FA 1TFVA 3M7SA 1VRDA 1EQCA 3BSGA 1DYSA 3BW3A 4H7ZA 3GXNA 2E77A 2JKAA 1C8QA 4F0KA 1OINA 4CD7A 2BWGA 3DFYA 3GX9A 2ISVA 3BPWA 1KFJA 3WDPP 5E70A 2NSXA 4XX6A 3T9PA 8A3HA 3WNLA 1P48A 1R8LA 3N4FA 1UPMB 3G1RA 3CO8A 2INZA 3POHA 4JD4A 2OZ8A 1GT8A 4J2MA 4PEKA 1NJJA 1UZHA 2FDSA 2Y4SA 1W3IA 5A6MA 3DG6A 4MJZA 1JQXA 2WBGA 2I14A 1KGUA 1SZGA 2O55A 3O05A 4F48A 3JUGA 3QQ1A 4HYWA 2JIWA 1FP9A 1V3LA 4J1OA 4DO4A 2HXTA 1WX0A 2CKRA 3LHVA 3NXLA 5DBTA 4Y7EA 3VCRA 3GVVA 2J7HA 2XGBA 4KCTA 1JR1A 1X7FA 5AZ0A 5DMNA 1TWDA 2Y89A 3WSUA 4IXXA 4W87A 3REQB 4LALA 1W5NA 3URQA 2UZ9A 1Q63A 3BL3A 1KNWA 4BI6A 5EGRA 2QJJA 2REQA 1EPVA 3LCHA 2BODX 1VJIA 3M0XA 4HJFA 2ZRVA 1BSLA 3APGA 1PDYA 2XSXA 2CCRA 3E38A 3U0HA 1FHLA 5DFAA 3L0KA 1HNYA 1Y0EA 3L4XA 4BF9A 4WGXA 2BMBA 4XKMA 4EVZA 2PWGA 3NXFA 1KM6A 1PL9A 1QASA 1OYBA 1X1NA 5AC6A 4A4AA 3GDKA 5H91A 1K3UA 2HMCA 4KT2A 3NYZA 4QEEA 1JAKA 1F8IA 3QPZA 1RXOB 3WEMA 1BYAA 1U83A 2IKHA 3R6IA 3FYPA 3GDBA 3IAQA 1RJPA 2BTMA 3F4WA 4ERIA 3R8RA 3M0IA 2V9DA 3PAJA 3TOYA 3OVPA 3FDKA 1GPWA 1PBGA 2WJEA 5AC7A 3W86A 5DXXA 2WNNA 3W7NA 1SJAA 1WXZA 2A3CA 4JNYA 5DXYA 3UXAA 3I4EA 2DZVA 1LF1A 3RPMA 3ZZ1A 3PK7A 4OWGA 4O0KA 1W2VA 4C6EA 2EPNA 5U7SA 4GO8A 3WK2A 1T8QA 4A2RA 2FJUB 4HYRA 3DFTA 3UCQA 1UZ1A 1KRCC 5CGQA 3AMDA 5FF0A 1JPDX 4YS1A 2J47A 1E72M 1K1DA 1OC6A 4W8BA 3V0UA 3DCPA 1E55A 4NX5A 4AISA 2HE5A 1J6OA 1E43A 1S2TA 2EKGA 4IP5A 2NXHA 3BQ5A 4AIOA 4HIBA 4WXYA 1EGVA 1DXEA 3E5BA 3KL0A 3W71A 2ISFA 1MXSA 5LNSA 2Y1HA 1KO0A 1RCXB 1TVNA 2Q01A 2UY5A 4P7NA 2XM2A 3KVJA 1TB3A 4ZQPA 3WQWA 2VEFA 2X0YA 2Z0IA 3GIYA 4NAFB 1ESWA 4PB3A 3KLKA 1Q6GA 1IEWA 1TPFA 3VGDA 2GUUA 4N42A 2QZRA 2INFA 4MNJA 3GB6A 1KM2A 4K8HA 2GGIA 2V6AA 2X0SA 1GG0A 1GVFA 3QH2A 4CNPA 4R53A 3VTRA 2J4GA 2CNCA 2GJLA 4N0RA 5E0FA 1PZ1A 5RUBA 2Z1BA 1L6WA 1VB9A 1I4NA 1VJSA 1N7KA 2BOFX 2JGQA 2XVLA 3WLTA 1VYRA 3PFMA 5D2YA 1FBAA 4D6GA 4D8LA 4CEUC 3K13A 1VBUA 4IPPA 1AQ0A 3UXLA 1A5BA 1GUVA 1UOZA 2YA0A 3B0XA 5I09A 5EMKA 1HF6A 3M1ZA 4GE8A 2QV5A 5C9UA 2DT1A 1HQTA 2G95A 1E3ZA 1IR2A 3M0KA 4A29A 2FPVA 1BGAA 1XLEA 1KR0A 3CQKA 1SO4A 1ITQA 1W5OA 3CAWA 4JN8A 1JULA 2WNQA 3M07A 4PMQA 4I90A 1TR9A 2HVOA 3RJYA 3CV1A 4DJED 1ENUA 2A4AA 1VFFA 4DN1A 3QSTA 2HSAA 4ZMGA 3B04A 3TC6A 1QPKA 2NSOA 2PURA 1J11A 5I5RA 4NRSA 1CECA 5HAOA 1S3TC 3HMCA 3UERA 1QOPA 4LC8A 4DUOA 4MFDA 4JIRA 4L4MA 3NZPA 1ME8A 4W93A 3D6NA 3PPFA 5BRBA 4NP7A 4GCAA 1H7XA 3ATZA 4GUGA 4C7FA 2PDPA 3AZTA 1XRSA 3BUVA 2C13A 4AVNA 4QG9A 3ZR6A 1VFLA 1OG0A 1F6KA 1XLGA 3GDLA 4YCOA 4C6FA 3DYPA 1F6PA 4D71A 1FP8A 2WB5A 1E3XA 3BG9A 2WAGA 3VX0A 3FOKA 1V6YA 1P1XA 2EAWA 3SM0A 4HU3A 3PZQA 1H5YA 5DN1A 3BSHA 3N6HA 3VXGA 3EZ4A 3GY1A 1H61A 3NQEA 3VKBA 1J4EA 1BXCA 1UKPA 3AIVA 3ZT5A 3P84A 3B8DA 4K1WA 3UR7A 1A5AA 2E67A 3MI3A 3H7UA 1JCLA 3IIOA 4DWSC 3XINA 2V2HA 3W00A 1FWTA 2D2JA 2E9BA 4J3SA 4D6JA 4ORMA 3ZVHA 3HMJG 1NVMA 4Y90A 1JPMA 1ITUA 2Z25A 1DJWA 1YDYA 2HE8A 2CBJA 2EJAA 1E5NA 1JXKA 4U3CA 1J5SA 3VD4A 4IJCA 5CGTA 1TRDA 2NT0A 3W37A 3MHUA 4A2SA 3CUGA 1KM5A 4U4MA 1T7LA 3SECA 1OFBA 1JF6A 1M7PA 4O4VA 4FNPA 4IG2A 1H7RA 1H7NA 3MP3A 3QTPA 4UTWA 1KFLA 1LL7A 3SSZA 3C2RA 5CPMA 1UWRA 4OBSA 2VCAA 3S2CA 3T1GA 4PUWA 3EKLA 1XD1A 3TFXA 4B2DD 2XVPA 3R10A 2ZX9A 5FESA 3RLVA 4JICA 5H8UA 4C6CA 5FEXA 1PE1A 3QW4B 2A3AA 4H83A 4Y8EA 3BLEA 1KLZA 1QOXA 2V67A 1MYRA 1IT7A 4EAMA 2V5KA 3SCQA 2CZFA 5HK4A 1RVKA 3WMCA 1A4MA 4JY8A 1REQA 5A2CA 2HVNA 1RJQA 3HQ1A 4UCFA 3N6JA 2QYGA 4QE5A 3KM8A 4JKMA 2GGHA 2X7WA 3MMDA 3QM3A 4HTBA 3S6DA 2GLKA 2XWDA 2GWNA 4H19A 4O10A 1XFBA 2GVJA 4Q7NA 3DEQA 4R85A 3C2FA 1P1MA 2P0IA 2PWFA 4GNJA 3RCYA 1IXQA 1XLFA 3WFZA 3RLHA 3TK7A 4MZYA 3UZJA 1KFKA 4JFTA 4M8UA 2WK2A 2I9EA 4PMDA 2RGMA 2NX1A 3PFRA 3LN3A 1LRQA 2VOTA 5AFDA 3P6LA 4FF5A 3CZGA 4TXEA 2QAFA 3UR5A 5REQA 3TSDA 4UB9A 4JQ2A 1VCGA 4JFVA 4KW2A 2Z2UA 3KRBA 1JYVA 1DJYA 3VNLA 4KFOA 2O0TA 4GISA 1AZ1A 2FPYA 4QX4A 2QMJA 1VEMA 4AEFA 3AYRA 3LU2A 4JXCA 1R85A 3WQ8A 3KBVA 4H41A 5J5RA 3PUEA 4MPQA 1KQYA 4L5ZA 5AECA 1H4PA 3M0MA 1DIKA 3LI0A 1G4PA 4JX6A 5AB3A 1XIFA 4EXAA 5FJRA 3CBWA 4GVHA 4PCPA 5CC5A 4ZQRA 4NT0A 1CYGA 1E56A 3ZXWA 2D2OA 3LHYA 1QW7A 1CDGA 2ZZ7A 2PDJA 4XTIA 2PC4A 3G2GA 3LMYA 3H6OA 3PHAA 1PWLA 3ARSA 1KBLA 3WK0A 1FXPA 4D6CA 1ALDA 5EYWA 3AHZA 5D03A 1OF8A 4DHGA 3CAQA 2E4TA 2BG5A 3ZJ7A 1DWJM 3P74A 3ABZA 5C55A 2QCLA 3JW7A 1Q8JA 1XG4A 1GOOA 6XIMA 3PSVA 4IPNB 1WDRA 2J8FA 4MAVA 4RJEA 1EX1A 4OV9A 3M47A 3DC0A 4FALA 5A94A 3NWRA 3T0CA 1QUMA 2A3LA 1FWNA 3PJXA 3AU6A 2YW4A 2QUVA 2ADAA 3A5VA 2WC3A 4IH3A 2BGSA 1EWDA 5E9XA 3OVRA 4JS3A 2KAUC 4ILSA 3VI2A 3LZ5A 1BHGA 1PKNA 4HB7A 2P3ZA 3N6QA 4OOUA 3HG2A 3CPGA 3W7KA 3LV5A 3QFWA 2YFNA 3UXKA 2Z1WA 1NH6A 3R8GA 4Q4KA 3HB9A 2D2GA 3CU2A 3BG3A 1EZWA 2GL5A 1US0A 3WQ6A 1G0CA 1TWWA 4O53A 2PCQA 3W6LA 4O52A 2O92A 4UTJA 2FH6A 5BOOA 1GQJA 1THFD 5CPLA 1XG3A 1QWKA 4AG0A 4DLMA 2ZRYA 3ZJ8A 3V75A 3NOYA 3P61A 2X16A 5AC8A 1P5BA 3F7JA 4O17A 3L5AA 3BTNA 3B9NA 1AW2A 4XAGA 4AZCA 2WCGA 3VPLA 4HMEA 2DIKA 3RO8A 2YCLB 4AUBA 1YE4A 1GORA 2Z28A 1J2BA 8XIAA 2Y8VA 1K7FA 1JYWA 4S1FA 1EUAA 4DLFA 4O0QA 3GH5A 4GIEA 1GZ1A 2IXVA 1SZRA 2PDWA 1P7TA 3TCSA 4WD0A 4YTTA 1FRBA 3LSBA 3AWNA 1VZWA 5CKSA 3WY1A 1R3YA 3ABOA 2PTZA 3GUGA 3W7PA 1XLDA 3M0ZA 1J12A 4AD3A 4DI9A 3PR2A 5DY2A 3A4XA 1S2CA 3URNA 3WMLA 1DP0A 1CWYA 2O9RA 3S42A 1FHVA 4GVGA 2JF7A 1UPPA 1SR9A 4IQDA 1GJUA 4JTCA 1TPB1 3N17A 4QRNA 5XIMA 3BVJA 1UP3A 4ZGYA 4HK6A 1ZJHA 3B0UX 3KOXA 5C2GA 5FF2A 1EJ7L 4QR6A 3E2RA 4LB4A 3MBFA 5FSEC 3WLPA 4Z17A 2B0MA 2QCFA 3QQ0A 2YXOA 1EC7A 4RPQA 2QIWA 5GPRA 1DQXA 3VGFA 3VGGA 4PTVA 3BZGA 3R8HA 2A3BA 1MDLA 4IOTA 1XW8A 4M6QA 2L5HA 3MY9A 2Q8XA 3QF0A 4FNUA 3FJ4A 4YIWA 2ZWYA 3NDYA 4WDXA 1G67A 1QHZA 4HOWA 4J40A 2WMHA 5AZ1A 3OGSA 5IFTA 1TREA 4KMQA 1KWKA 2R1KA 2DEPA 1B9ZA 2XUCA 2B7OA 4E2OA 3FJLA 3GAKA 4UZUA 1H1NA 3SCUA 1QNRA 4JEJA 4CN4A 4BWLC 3FSTA 2CLKA 3IVSA 1KKRA 1X7IA 3CUJA 4UTTC 2JK2A 5DT5A 1XH1A 1A53A 3Q37A 3QC3A 2QCGA 5TD4A 1YNPA 2XVKA 4H2CA 1TPDA 3MUZ1 3VIFA 4QDPA 4IIEA 5JBFA 3WUFA 2PD5A 2NQZA 3ARUA 1GOQA 4RUBA 2E40A 4CGTA 4AEOA 3GBEA 2IQTA 2WSQA 4YJ5A 2A6NA 4QJ3B 2NWSA 4N4PA 2YJQA 2IPJA 3WNKA 3UNTA 1A0CA 1P6BA 1RVGA 4KGLA 1VPYA 3G1SA 5DMMA 4GGBA 1C7SA 3AHTA 2V5JA 5CC3A 1J79A 4H04A 4BF7A 2OMAA 3SADA 2CZDA 2Y8UA 1BLIA 1D7KA 1A3XA 4OFCA 3VYLA 2V30A 1QATA 2NVCA 1RQBA 3GR7A 3FHAA 4O28A 1Q13A 1SYTA 3AO0A 4Q8MA 4KEZA 2C1IA 1GQLA 1E40A 1H7WA 3SIZA 3NG3A 1XCWA 1BRLB 1PTGA 3TXVA 1TJPA 2NQLA 2ZOXA 4XBSA 4DIAA 4LJ3A 4LAOA 2DV0A 4MFEA 3TJLA 2YR1A 4AYSA 4PTMA 1W1VA 1ONRA 3ABRA 3TNOA 2G0WA 4PUJA 1EXPA 4LVAA 3T2QA 1XLBA 2PLCA 3GSMA 3O2LA 1MXGA 1BD0A 3OBKA 2RDTA 3LNPA 3SCPA 1R2RA 1EB3A 1OG6A 3U2EA 3USBA 4YN5A 1DWFM 3A3XA 2PWEA 3NPUA 1JQVA 2DH3A 4MIMA 4QSHA 4GC4A 5A5WA 4OVXA 5DEZA 2QXWA 1A5MC 4DZIA 1V6VA 3WELA 3EB2A 3R0KA 4EIVA 4U5KA 1UROA 1E9ZB 1B57A 7A3HA 4GC3A 1WOBA 3L0NA 2Q71A 3B4UA 4YYFA 3TFCA 1FCBA 3N73A 3EOEA 3KP1A 2UY3A 3VZXA 4G6CA 4NU7A 3WQPA 2Z1SA 1TPH1 3WQOA 3EDEA 4JHZA 1VEPA 2GSHA 4TVUA 3B3DA 3I4KA 4IX0A 3KOWA 3VU2A 3HQOA 1XGEA 3W73A 3MCNA 2O7QA 3TQVA 1LUCA 4AZ7A 4IHCA 2ZCGA 1VBGA 4K8EA 4HBKA 3UESA 1WOAA 3T4WA 1VCVA 3C5QA 4DJDC 3F03K 2YCEA 3NFUA 1B3XA 2H9AB 4LOCA 4O50A 1VLIA 1UASA 1HKMA 2E3ZA 3LTSA 1JDDA 4KPLA 4TQTA 1W32A 4L9ZA 2AAMA 2FTPA 3LBMA 3D5HA 5CGMA 3MVTA 2HCVA 1XUUA 4JTDA 1LG1A 5GNYA 3TA9A 3H23A 4GZJA 3GG7A 5I23A 2NLYA 2QULA 4PMVA 7PTDA 3V5FA 1P6CA 4H8HA 5LHEA 1O66A 3DHFA 4A8IA 1UD8A 4ASTA 3CZ8A 2E6YA 1WCGA 3CEPA 2BSLA 3ONCA 1FWJC 3CUHA 2VGBA 3M9YA 6REQB 4D6IA 1P0EA 2PWDA 4C6QA 5D37A 5KITA 4MWAA 4Q33A 4S3BA 3VNJA 1D8CA 5DX7A 1QPOA 5CSUA 1IE7C 1U33A 1R30A 3CL7A 2VUYA 4GLEA 1JG9A 4B4FA 2VC9A 3QPYA 1UR2A 1VQTA 4DO7A 2PLJA 3CS2A 2PP1A 1RP9A 4PL1A 3KBSA 3QZEA 1K70A 4DAIA 5EMMA 3UWVA 5LXXA 3IK4A 3IIXA 4NI3A 1CT5A 2R1PA 3EPMA 4UOZA 3I7QA 4UCGA 1CGYA 3CAVA 4Z2LA 1LOSA 4XKYA 3AS0A 3K1DA 1CLKA 3AMKA 1YBQA 1W37A 3EB4A 4K3ZA 3UWUA 3IANA 1QTWA 6TAAA 3MJMA 3PZVA 3WH5A 4O1DA 3QQWA 3F4NA 4JN6A 2QJMA 4AX6A 1UH4A 4DWSB 5LA0A 1UKSA 3B0YA 1A5LC 5LIUX 4C5YA 3T2OA 4UQ9A 1JUEA 3I10A 3T44A 4HMNA 5E6ZA 5AY7A 1OK4A 4XG1A 3V7PA 1TPC1 2OVLA 5BOFA 3VX1A 1UC5A 4FIRA 4BI7A 4AZ6A 3WQ4A 1GZGA 4P2VA 4FXRA 4O1AA 2BXVA 1X98A 5ABEA 5I02A 3B9DA 3L68A 4B15A 1SW7A 4WEVX 3L65A 4I9JA 3BCFA 1QK0A 3LGEA 3VM5A 1JJKA 3KP0A 2NQJA 1J0HA 4OBTA 4A8NA 5EMJA 5CQ1A 3W2LA 3EB3A 4P8VA 2QAPA 1A5KC 1H1YA 4Q4PA 2I57A 1IYXA 2ZE3A 1MQRA 1H0GA 4KCWA 3S1XA 3GDRA 1SZEA 1TJ2A 1RA0A 2V82A 4JBRA 1MZRA 4OU1A 4MDPA 1KBIA 1RSCA 1PVNA 1XC4A 2YL5A 2OO0A 4P7QA 4NNBA 1UR4A 4O1BA 4ALDA 3K8MA 3PS7A 4G8TA 4TX9A 3GTFA 1XM3A 4RZBA 2A3EA 1RQHA 2XVGA 3E3HA 3TAKA 4LYQA 3AJ7A 5SWUA 3W6MA 3NQFA 4YCPA 3PTMA 1MNZA 1YTEA 2WHKA 2BVYA 3W53A 5DY3A 2C91A 2WXDM 2W4XA 4ERAA 3W7GA 2VXNA 4DM2A 4K7VA 4OKDA 4FK9A 4BA0A 4A3RA 3KDNA 4ECLA 1E6ZA 3K8KA 4MTVA 4E6MA 3W1LA 3EMCA 2EPMX 3RCMA 2ZYFA 2HNHA 3IACA 3B8VA 4GOAA 4G5DA 4YNGA 1SZFA 2OU4A 2H90A 3W2JA 1HG3A 1AZ2A 5D05A 2TAAA 2VZTA 3V1HA 3FVMA 2J25A 3UXDA 3F4CA 4PMXA 5JIPA 3EDJA 3BG5A 3CUZA 5CZSA 4GZ7A 2IKIA 5FJOA 1SQ7A 1Q85A 2GWGA 4B5XA 3VD7A 2B7QA 3IARA 4NRRA 4E8DA 2QR6A 3OB8A 4WHBA 5CCZA 2VR5A 3L12A 3MTWA 4HTYA 2WW5A 5C6MA 1IXNA 1K9TA 3IV8A 1FKWA 5FKYA 3BJFA 4L6HA 2Y63A 3ID7A 1FXQA 2XSAA 3OHMB 4BK9A 1VYPX 4HHMA 5MKGA 2R1NA 5T26A 1MZHA 2VENA 2Z4GA 3KFTA 1XBZA 5D2WA 4QS6A 3I3EA 1V3KA 2V8ZA 2IS7A 3WQDA 4RDVA 4B91A 5C70A 3H4XA 4I5UA 4E8GA 2WKLA 1MFVA 5BW6A 3QLLA 3EWUA 1DIEA 2FGLA 2WKJA 4GI9A 4YHEA 1TA3A 4PUUA 1K8ZA 3BOXA 1CEOA 2FHBA 4Y96A 1PDZA 3ENLA 4HD5A 4MJ4A 3UETA 3U2CA 1PX3A 3MYOA 3WUBA 1CBGA 3U6WA 2PGWA 3WBAA 4JTIA 2R14A 4ACZA 3EXSA 1AFSA 2VTFA 4FLRA 2G97A 3MP5A 5FEPA 1RUSA 2PBGA 2W66A 3VKJA 2VL4A 5KTLA 4P7RA 1W1YA 4B92A 2FGBA 2G5WA 4Z1BA 1SSDA 1I1WA 4QLJA 5ECVA 3RM9A 1CZ1A 4WZHA 4ADSA 2ZZ2A 4A05A 4C60A 4U2ZA 1ONXA 4LANA 4HT3A 2VO5A 3NEVA 5HOSA 2WHLA 1S1PA 3ZR4A 5REQB 2WVVA 4C90A 2ZZ6A 1IIGA 4LFYA 4AD0A 1KV5A 2OZTA 3UWYA 3OOQA 3P5YA 3T0AA 3D0CA 4WOZA 1NTHA 1F8MA 1EOMA 3WF4A 1PHWA 1I9CB 1OHLA 3HTWA 1UA3A 5FEWA 1R3RA 3HG5A 1PEZA 3EBVA 4QQUA 1SMAA 5TNVA 3ELFA 1VFTA 2EPOA 4HSOA 4AHQA 3MKKA 1ODZA 3ES8A 4DB7A 2XDFA 3THDA 2FMNA 2ZVRA 4S3JA 4KFPA 4PSPA 4B5VA 3HQNA 2EEXA 4JN7A 1E9LA 1POJA 3RHGA 4C6IA 1UC4A 5BMWA 3GXFA 1PAMA 2Y7GA 3QLDA 3G5EA 2VX7A 1EP2A 1FCUA 1S2UA 3SEPA 2ALRA 4AY7A 4R9XA 3K4AA 1HX0A 4ZZ9A 2Y62A 1W9DM 2PTYA 1LLOA 3RAOA 3WK1A 1CB7B 9CGTA 1E6QM 4ONVA 4FX7A 2NW0A 3NO5A 3PY2A 1EP3A 4LTSA 3F4DA 3GYEA 3AQUA 3GHUA 1AMYA 2CWXA 1V5XA 4GJIA 4FR1A 3VGHA 3AALA 5BRPA 2PRHA 3OLIA 3WBWA 2XFYA 3S5OA 5C7HA 1J93A 3EX2A 1Z9AA 3WH7A 1AJZA 1GOIA 2FZ8A 4M1RA 1EC9A 2VRJA 1GCYA 1YTKA 2HPIA 2WM0A 3HG3A 3IUIA 3ITXA 2E6FA 4IPJA 3YPIA 1S39A 1XCXA 3R58A 3PWIA 5AYYA 1XLIA 1VF8A 1CX9A 1XYZA 1RLDA 1ISXA 4PFMA 3LCLA 4WKFA 2RDXA 3DI0A 4GY7A 3UEQA 1UJQA 3VNIA 3QMTA 4JIQA 3EWYA 1CENA 4PYSA 3IIVA 3TAOA 4QS5A 4DYEA 2I1OA 2CBUA 3P8JA 3R12A 4E2DA 3VNDA 5ABHA 2EG8A 5BZAA 4ROPA 2DQWA 2CERA 5CLWA 3S9ZA 1FWAC 3APYA 4NASA 4LT9A 3SZ8A 4V27A 5LA1A 3GIQA 1QNSA 3W22A 3TSBA 3W7JA 1OFQA 1JD7A 4KEUA 3NEHA 4XZNX 3SGUA 2Z6IA 1XYBA 3WD2A 2IMRA 4IUGA 2QVNA 2YFOA 2Z1KA 1OCBA 1SFSA 1O5KA 3NZGA 2P10A 3GU1A 1H1ZA 2XFWA 1YNQA 3G1DA 4CU7A 2GQ9A 2I5QA 2Z6JA 4H4IA 2D69A 3IVTA 4Q8UA 3N2TA 1QNQA 4J3ZA 3LNMA 3GO2A 5HPCA 4P8XA 3N29A 4EACA 3U4AA 1EIXA 1P7TB 4XBJA 4DPPA 2NVDA 1G4EA 2HK0A 2BOGX 1EF3A 2X1SA 4GQ0A 2RJHA 4EXBA 5HATA 1R86A 2FYMA 2WJZA 3GFZA 2NV9A 4LEQA 2XISA 1B54A 1C7TA 2JKEA 3BV4A 3M0JA 4PMJA 3NO3A 4RE4A 4FX8A 1ICSA 1DHPA 5FACA 3THAA 3S1WA 3WFAA 3ARRA 3JZEA 1BWLA 3GXMA 3JS3A 3RCNA 1JZ6A 5AVHA 5G4WA 3ZLFA 4H8VA 1W5MA 4HNLA 2NV1A 1ADSA 3APTA 1TVLA 1M7JA 1AQMA 2GQAA 1RY0A 2EG6A 2R1MA 3PUGA 3TQPA 1GVYA 4C91A 8CGTA 4KERA 1CGTA 3LM7A 3N11A 2PI6A 3ANVA 3HJZA 3CQ0A 5JIWA 4KRZA 3WDJA 3A3HA 2C14A 4LX4A 2AKZA 1LBFA 2OWWA 4GA8A 4UTHA 4J2PA 2PC8A 4DJEC 1MEWA 2W9MA 3CGTA 4RV3A 2J74A 4MYAA 1DXIA 4JDYA 4DO5A 3PBYA 1YNYA 1A5CA 1M1BA 1JCYA 3PPHA 1GVIA 4QG6A 2WZEA 4P5UA 3SRFA 2VZSA 4LPCA 3SCVA 1UR9A 4HU4A 3AXMA 4N9EA 4OIFA 4AWTA 2Q8ZA 3AHVA 2YZ5A 3WMBA 2ZICA 3WYZA 2DUXA 1F73A 3S83A 2D73A 1NF7A 1KXQA 3GW0A 2DJLA 3EX1A 4S3KA 3R0UA 1EO7A 5C5YA 3T7VA 1B5TA 4IFKA 2QMKA 3C6CA 1G4SA 3ZJ6A 5AN7A 4H9UA 1W3JA 1FWIC 1Z6KA 1LQ0A 4MZ1A 4HKPA 1GVRA 5I3JA 3AS3A 3TYZA 3LK6A 2PUZA 3H2AA 3CWOX 2ON3A 3M5YA 1W3LA 1W91A 3E96A 4G1KA 3VKDA 2VVSA 3S9IA 3HGSA 3NNTA 3HU7A 3R1ZA 4Q6XA 3TR9A 3SBFA 1DPMA 3PBUA 3W28A 2DT2A 4NZ1A 3KS5A 2VRKA 1TZ9A 3EDKA 4Q8QA 3TQKA 3T40A 1K6WA 3VDCA 3GVWA 4GD0A 4KGJA 1AQHA 3UGVA 1UKQA 1DJGA 2DSKA 3KWSA 5I3KA 2YA1A 4IQLA 4X3ZA 3VC5A 1WA3A 4ZOEA 2A7NA 3USZA 4LRSA 1SUXA 1MXDA 4QFUA 2R8WA 3BQ6A 1MRQA 4O57A 1RQEA 4CD5A 4QLKA 2R6OA 3KTXA 1QPQA 2D23A 4QSFA 2WVSA 3PJWA 1Q6EA 3M5ZA 3AHYA 1VS1A 3WF1A 3E2VA 4I8DA 2OG9A 4J35A 2P3EA 3AYSA 4D72A 3FY1A 3K1GA 3CT2A 4MLRA 4HMDA 1QVBA 1NFPA 3W3OA 3PWAA 4RE3A 1CXIA 1L8PA 1JDFA 1XBXA 1EDTA 2JKPA 3B05A 4YTRA 3L9CA 2CEQA 5ABTA 3W6YA 1FWCC 3S9YA 5LGXA 4MKVA 3PZ9A 1Y65A 5AHLA 3TTQA 2JFEX 1E0TA 5TIMA 2FVMA 3NSXA 3W7LA 2QCDB 1UH3A 4DQWA 4CCCA 2AGTA 5I0DA 3UG5A 2YL9A 1V0MA 1E1FA 4GO9A 4E3TA 2HEJA 1EEPA 4J3VA 4GQGA 1RCOB 1Z8AA 3MKVA 2CW6A 4TX6A 1F07A 4LAUA 3WX7A 3ZJKA 4US5A 4NZJA 2VEKA 2YOCA 1KKOA 4TMBA 2ZA3A 4B3ZA 4KBXA 4QXIA 3GVQA 4PODA 4JTSA 4Q4QA 3UD6A 3G3DA 1XYAA 1M53A 3NGFA 1TSIA 1ECEA 2PDNA 5A6SA 1E1CA 1V3MA 4M7TA 2XM1A 2HNEA 7TIMA 2Y7EA 3GG8A 2PZ0A 4WIWA 2C16A 5AC5A 1BG9A 1O60A 5DANA 4MUPA 1OX4A 3WQFA 1KD0A 1XL9A 5I6SA 1ZU8A 4K2SA 4W7VA 1EJXC 3GVRA 2XVNA 4WDWA 1A5OC 3A47A 3NZQA 1HUVA 3KRSA 1NU5A 3ZSSA 1WP6A 1FVPA 1EJTC 3SSJA 3NL5A 2D20A 3EAUA 1B3OA 4H9ZA 4UFHA 3T0BA 4U3AA 2CFFA 4EANA 2F7FA 4HZ7A 2HBVA 4HZ8A 3GRIA 4GNVA 4GXMA 4DBUA 4TVCA 2CLLA 3O0KA 4NJKA 2Y8KA 3W7CA 4RZ6A 5AC4A 1UA7A 4MWAB 2DSVA 4XUYA 1HGYA 1JD9A 3TQ0A 1AH4A 4PBGA 1UQYA 2WZMA 3LRMA 3PF3A 4LAMA 2HVMA 4EPBC 3WBEA 2WJDA 5A6BA 1EBHA 4RZ5A 3WDIA 5D04C 4LV4A 1V4YA 5C2XA 5JH2A 5FAGA 4HPGA 4R27A 3ARPA 3A12A 3MC5A 2ZFAA 4M80A 1GOKA 1VD6A 3VKAA 1P0KA 4WXZA 1EWEA 2QF7A 4G7EA 4LWWA 3KE0A 5FD0A 4UOJA 2FFCA 4CUCA 5E0CA 2C6QA 3SW6A 4GZIA 4GPNA 2BY2A 3R5EA 1LYXA 3PANA 4V28A 5ABFB 1KXVA 4LUSA 1HJSA 1V3HA 3GR4A 1XISA 1TX2A 4P7LA 3CWHA 2CHRA 1TE6A 4CEXC 3U5YA 2VNCA 1V6UA 3UWZA 3NL6A 3NO1A 3BAJA 2BV9A 1OYAA 2QCHA 3CMGA 1WDQA 1HJVA 2C15A 1HJUA 4CNOA 3M41A 5HA7A 2D3NA 2BHYA 2W79A 4GJJA 3CZJA 4GBUA 4QLLA 3F2BA 2V81A 4XIMA 1XHGA 3FSUA 3H22A 3LGGA 3CASA 4NZ4A 1E6SM 4WGHA 4ML4A 2ZUMA 3IV3A 3GD6A 3HPZA 3AROA 4RNIA 4FXFA 2ZUSA 3A64A 2Q3OA 4GI6A 3NJ3A 3BH4A 3ERPA 3W2KA 1NQKA 4KWUA 3W81A 3TJIA 3SCOA 4X0NA 2VEIA 3ZWSA 3C56A 4KS0A 1VKFA 1E51A 4AFYA 4ZCWA 1UIPA 3KW3A 1PZ3A 3GC4A 3O15A 4LC6A 1LDCA 3I6RA 3FA4A 1TCMA 4F79A 1DVJA 2FJKA 3B06A 4C6OA 3EX6A 1UKTA 4DYKA 3AMLA 3IJ8A 2UBPC 4W86A 1PXGA 3RUBL 5CXPA 4XZLX 2Y7FA 4FOJA 2BB0A 1R6WA 4ZB5A 1SO3A 3ZOAA 3HM7A 2IPGA 1RBOB 1Z7AA 4IPLA 2VJXA 4BFAA 3MWAA 1O95A 1F6YA 4W89A 3CH0A 3BCDA 1W5PA 1SW0A 5GJNA 3WQVA 1J0IA 1YMYA 5C9WA 1BKHA 1EDGA 3M0LA 1GVSA 2QUUA 3NDZA 1H7PA 4Q22A 2C8NA 4J3UA 1MUCA 1UD2A 3WDQA 2UY4A 1OB0A 2PDQA 4L4OA 1F3WA 1CNVA 3VUPA 2PDUA 4C6LA 3L4VA 2XFFA 4LVFA 4UMCA 5HJXA 5FF4A 3U2ZA 1O5QA 3AMGA 5BU9A 5I3FA 2E25A 3W1QA 3QV9A 5JH1A 4KKXA 3KHJA 3MDUA 3EWWA 3SRDA 2Z2AA 2IPFA 3W27A 4KESA 3QPEA 4YLWA 2OLSA 5MF5A 1QXLA 3FGCB 1WUEA 3FXGA 4ZO9A 3OBEA 3JU2A 4H00A 4JTKA 3W02A 1YW1A 4CD6A 1DE6A 1TJRA 1J9YA 3FAXA 1K8CA 4YL2A 2XYLA 2DZXA 3QC0A 4XVDA 1RAKA 2WMGA 3B9OA 5HMEA 2YXXA 4OE7A 1ZP4A 4ZL1A 1BGGA 3W01A 5HNRA 4QBXA 3VDGA 3CH9A 2PLMA 2F2KA 4KQNA 1WXYA 3TV8A 2YDAA 1V93A 2QJGA 3A22A 1JCNA 4H7VA 3ME3A 2CLEA 2YLLA 4GINA 2A2IA 3UZYA 3V5CA 3DU0A 2QCMA 1OABA 3B8TA 4RPPA 1GOMA 1IEVA 2ZRUA 1BYBA 2XIOA 1X97A 3C8NA 4RW5A 4HPNA 1MQQA 3CC1A 4G56A 4QAWA 4KIRA 5A8GA 3LDVA 3TEVA 5DRCA 3UWQA 5A8MA 2VI0A 5BWAA 1DQUA 4JNMA 1ZFJA 3AIQA 1RD6A 3O6DA 4X2PA 4LXFA 3AMCA 2OQYA 2WANA 4L61A 2Y61A 1TV2A 3T8QA 2OX1A 1VLWA 1AL7A 2FLIA 1KC7A 1OCJA 4GY0A 4C6NA 1UW9A 5EA9A 1W9BM 3WL0A 1A5UA 1E6PA 1E70M 2WVVB 7TAAA 3VMOA 3VIHA 5HR6A 2WQPA 4M56A 3N12A 1DEDA 2ZUNA 1OX6A 3NQAA 1OZMA 4EK7A 3UZXA 1LLZA 1EFZA 2OOFA 3WLSA 1T96A 1Q6CA 2HXUA 4M51A 2RHGA 4HYVA 4KFNA 4GQRA 4PRWA 3ARZA 4IGHA 1WAWA 3VOIA 3TTEA 3MP4A 1XDJA 2PBOA 1V3JA 5EFDA 1JL8A 4H9TA 1X96A 2QGYA 3LY0A 5K4ZA 1VFHA 3KHDA 2QQ6A 4AZHA 1K9DA 1UWUA 3VIMA 1O5XA 4DJFA 4GZEA 1VENA 2EXOA 2I5IA 3LV6A 5LIKX 3MDWA 3SRKA 4AHOA 1JXJA 3LLDA 1E4LA 5IDIA 4K36A 1QT1A 2ZX5A 4LUJA 3MANA 3IAPA 3NPVA 2ZUTA 5EFFA 1WDDA 1KLYA 2BHZA 1J01A 2GDUA 3UCCA 4AD4A 2X1UA 4X61A 4EWJA 4GYPC 2PDHA 1P0DA 4D8AA 3LBCA 1GOXA 5GQBA 2ZA1A 5FJPA 4M1BA 3FIGA 5G2HA 3GXIA 5FCZA 4GK8A 3VC6A 1HL8A 2OWCA 2D24A 3DYMA 4LY4A 4RNJA 1RBAA 1N2VA 4TX8A 3EKZA 1UCWA 3FA3A 4MWAD 3KBJA 3W76A 4TV5A 4QIUA 1PKLA 2DSWA 3PZNA 3B8WA 3N25A 4RXGA 2PPGA 5CBJA 1I0BA 1HP4A 3EWCA 3W88A 1JPHA 4QJ1A 1IWPA 3ATYA 1VBRA 1XIJA 2HQAA 1KCXA 3OP2A 1H63A 2J9ZA 5T9CE 3A9IA 5FAJA 4YMZA 1SSGA 3M0YA 3AFBA 3CHVA 4O0ZA 3N2OA 3FCPA 2WYSA 4MVAA 3LQGA 1EBGA 3LENA 5D33A 3L4WA 3GH4A 4ZOBA 5HULA 3RFAA 3HOJA 4JQ4A 5DCBA 4AY1A 5LGZA 3HA1A 1KTBA 4LAKA 3NM3A 1PZ0A 3KOZA 2WMIA 3C4UA 5A8OA 3P3BA 1TPUA 2E9LA 1P6WA 3RM4A 3P81A 3DKLA 4MG4A 3CQHA 1UBSA 3CEUA 3O7UA 4QITA 1MUWA 1HKKA 1F3EA 1V02A 2R1LA 1RK6A 1U22A 1ML1A 2J7CA 4LS1A 3VNKA 3VNZA 5KEZA 1EO5A 2ZRWA 4DZAA 2G37A 3UJEA 5HQEA 5A8QA 1AH3A 3LPOA 4PMYA 3RNDA 5TAOA 2PWVA 2DVXA 2CZEA 2X2YA 3K5XA 4D1JA 5DT7A 2DIEA 2G3FA 1N8WA 2H6RA 1M04A 1D3HA 2VC5A 2Y70A 4CQ8A 3TE9A 1V6XA 3VILA 1R3VA 4ADUA 4F40A 3UWEA 4NJHA 1WB0A 3PPCA 5E1QA 4BQ3A 3DFHA 3OGVA 3GXDA 3PNZA 3EKGA 3M6DA 1T8XA 3UBPC 8RUCA 1I2OA 1L6SA 2OKTA 4KWWA 1DQWA 1BYCA 4M19A 1XDMA 2J6XA 3CQIA 4NJGA 3IUDA 1JZ8A 3UFYA 4HN8A 1KW1A 1K8XA 3HG4A 1OFOA 4TOQA 3LCFA 3U48A 2O56A 3T0DA 4L1WA 4AIEA 2H3BA 3B9EA 2AKMA 3UJSA 1M03A 1TPVA 3M7WA 2R82A 2OB3A 1XINA 3N2XA 1XLLA 1SM9A 3UY7A 1W9XA 1KM4A 4RLIA 1UHVA 1GHRA 1WYIA 4BZYA 5G4HC 3IGSA 3AXXA 1JFHA 4DUXA 2VDHA 2G3MA 3AIUA 4XAYA 4E3VA 4ZVJA 4QDMA 1R46A 4J3XA 5M03A 1OFDA 1POKA 4K1GA 4F2BA 1MFUA 3PNUA 3N18A 2V3GA 2VMFA 4O12A 1R9YA 1BFNA 4IXHA 7REQA 1GYNA 1YE6A 3FJ6A 3BJSA 2OR2A 3NQVA 2ZX8A 5FF3A 3NQGA 1UR3M 2CLOA 3SFKA 3A24A 3R13A 4DX3A 1BF2A 4ZTYA 1XLCA 3W25A 4Q8VA 2EF9A 5D9MA 4FXSA 5A8NA 1G5AA 4DF1A 4AF0A 3GNRA 4NZCA 3Q65A 2NQHA 4MZ8A 1IXOA 4AIBA 4AZGA 3WH9A 3SN4A 4F9DA 2E5BA 1SJDA 3A6OA 3MT1A 4HPXA 4IFKB 2YB4A 3S5SA 3TSMA 1NELA 1ZPTA 4FOUA 3QEZA 2YL8A 2EKCA 3G77A 1KBJA 4TR9A 3GWQA 4Y9AA 5IRPA 1YIXA 1KFEA 1PJ9A 3EPOA 1C3FA 3MCMA 5CG0A 4MAZA 3I6EA 2W91A 1RPKA 2YBVA 1K9FA 2IKGA 3G1VA 2WMKA 3QOKA 1GGOA 3M6YA 5H1WA 4REQA 4YPJA 7ENLA 3SO7A 1K8YA 3S5YA 5IM51 1LORA 2FZNA 3KCJA 4XO6A 4JIPA 1SJBA 1OCQA 1S2AA 2VGFA 4V1YA 4IGNA 3EA1A 5K3VA 1QK2A 4CN1A 3M64A 3QHOA 3SCTA 4AC7C 4ZO7A 1CXKA 1RALA 4AWUA 1G1YA 2R94A 3OYXA 5JUVA 1IXPA 1FWFC 4IICA 1V7YA 1P0NA 4BS0A 5AVNA 4W5ZA 3N3TA 4TVDA 3RRAA 3S8HA 4R88A 3RPDA 1N8FA 1EA0A 3N1AA 1GVEA 2A5HA 1BEUA 3P62A 2QVHA 3B8SA 3CB3A 3V35A 1KCZA 3F5KA 3GZAA 1LOLA 3HFYA 2X09A 3C0SA 3O6CA 5IHSA 3EMQA 3W1UA 3PB2A 2YPIA 5J04A 2QS8A 1NM9A 5IBXA 1WDSA 1YPFA 2GVYA 3MVIA 1Z44A 1QMLA 3VKCA 2CU0A 4UBPC 5F1UA 5C9XA 3FAWA 1ICQA 3G22A 2VUNA 4B90A 2UWFA 1TO3A 4Y9MA 4DF0A 4FLOA 4ICMA 3CNYA 2VEPA 3NZRA 1ZALA 3E0IA 3GUWA 5F4WA 3VVGA 1LM1A 2ZDRA 4HNVA 4YWSA 3OVQA 5DLCA 4K6AA 1TUFA 3M43A 1B1YA 1GQKA 3JR2A 4LBUA 5LZLA 2I56A 1FFQA 1SPQA 1EF2A 3GNOA 3S0CA 4GYJA 2YA2A 4AW7A 3AXKA 4GH1A 3T07A 5HQMA 2ZUWA 1EEXA 1J96A 4QEHA 3LHZA 5DMYA 3DENA 4MADA 3REQA 3VO0A 3EEZA 2ATMA 1HXJA 3CWNA 4UUIA 2I9UA 2J77A 1W31A 2F61A 3MZ2A 2XIMA 3EGJA 2WHJA 4Q4SA 3DG7A 1E1CB 5I2UA 4FP1A 2OQHA 3DUGA 2GPTA 3LQLA 1H49A 2NLIA 1IV8A 1FCQA 3N4EA 4JQAA 4JOMA 4H6QA 2ZRZA 4HU0A 2QJNA 2WC4A 4UR9A 4K7YA 3EOUA 2J6VA 4XSMA 3MUIA 4ENLA 2MUCA 4IQEA 2QDGA 3M16A 3QY6A 4A6GA 3FN9A 1JCXA 3MJYA 1ZAHA 1B2YA 4AC1X 1JUBA 2WMJA 3B40A 4DM1A 4L1GA 1TR1A 5HWMA 3FJNA 2V38A 5M2FX 2D0FA 1RA5A 4M81A 3BJTA 1GK8A 5EU9A 4WOQA 4GQBA 2QGHA 5TF0A 1EIBA 3C0QA 3BMWA 4CVUA 4AAJA 1EOKA 1KWGA 2DZBA 1F61A 1TTQA 1A0DA 1M01A 1H50A 1QHPA 4I7UA 3L4YA 1YADA 1YEYA 4W8LA 3UZZA 4QP0A 4UNIA 3T0TA 2UV8G 1OCNA 3H4GA 1EGZA 1Q66A 1JDCA 1F4HA 1XYFA 1F3XA 4UFJA 3K30A 1DWGM 2D0HA 5L9FA 1UKOA 1YRRA 4Z1AA 2VFEA 2E6AA 3QW3A 2GFTA 3UG4A 4CN6A 4O8RA 3KOFA 4UFMA 5I7GA 2C71A 3RK8A 1S5VA 2FMOA 3ICJA 4Q7IA 5CZKA 4IMDA 2AQWA 3IJ6A 3OIHA 2QJHA 4C6DA 3S46A 3WDRA 4CQ9A 3IJDA 2QUTA 2ZX7A 1XWYA 3WLNA 1D2KA 4PGLA 4TIMA 2G3IA 2JGYA 3VIPA 4B9ZA 1NF0A 4LUSB 1AJ2A 3FVDA 5HPOA 1DE5A 4W7UA 3V4BA 1MWOA 4NAFA