5L6UA

S. enterica hisa mutant - d10g, dup13-15, q24l, g102a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
233
Chain Sequence
MIIPALDLIGGTVVRVVARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HisA
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 79
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5l6uA00
3P60A 5D38A 5F4SA 3NPVA 2BWGA 2FPYA 2H6RA 4U4MA 2CLOA 2WOQA 1WDWA 1TSIA 3M5VA 2YDAA 3S1WA 5L9FA 4FNTA 1FQ0A 1Q6QA 2A21A 1ZAIA 3TKFA 4BI5A 2ISVA 4WQ6A 2JKPA 4UFIA 3C2RA 1OFDA 3CEUA 3W2KA 1PV8A 2G97A 2VXNA 1I2PA 3A22A 3TW6A 4UIOA 2HMCA 2ZRXA 1VC4A 3DGRA 1A5SA 3M1ZA 1UBSA 3VE9A 1JCNA 1IGSA 3QW3A 4DO5A 3FS2A 3UWWA 4LS1A 3GKFA 4AWUA 5K2ZA 3O63A 4TX9A 4GUHA 3N9SA 3CIWA 1C9DA 1X1OA 3BLFA 3MWAA 3DFPA 4RZ6A 3GDRA 4QNWA 4A22A 1JCYA 5CZ0A 1V5XA 3F4NA 2VFFA 1VCGA 3EEGA 2CZEA 3QM3A 4RJEA 1I45A 3NPXA 3KVMA 1NEYA 3LCWA 1SZFA 4BF9A 1S5TA 4O17A 3I7QA 1FCVA 1H1ZA 1B57A 2E09A 5DELA 3QMRA 3CT7A 2RDWA 2J27A 1XI3A 5EPDA 4WX2A 3Q2DA 4JXCA 1SFLA 3LCHA 1HTIA 1L6WA 4IMFA 4IXHA 3B0VC 3RLVA 3USBA 4HIBA 2DZXA 1KFBA 1XBZA 1KLZA 1Q3NA 3R89A 5LZLA 5TBOA 4AXKA 4MPQA 3NR0A 5F2MA 3HJZA 3ABQA 4CQ8A 3Q94A 4XTDA 3W7NA 1FDZA 1FXQA 3LTYA 2Y70A 1D3GA 1OABA 3EWYA 2C3ZA 4GRSA 2NX9A 3JS3A 4OHQA 3M43A 3N9RA 3BG9A 5H91A 4Z08A 5A5WA 4Z1AA 3FYPA 1JUKA 2PC4A 3C56A 4UFMA 5CGQA 1S5WA 4MFEA 4NT0A 3M7WA 1K02A 3IGXA 4R33A 1K8XA 4UNLA 2I1OA 4DO6A 4N9DA 1KA9F 4Q4KA 3L0NA 4HSNA 2GJNA 2ZRVA 3EXRA 2Y89A 4MOZA 2ZZ7A 2V9DA 2Q8ZA 3EX2A 3ZWTA 4ZQCA 1A50A 3DU0A 4FIRA 1GOXA 4MY9A 3KRUA 2XFWA 3BW3A 4BI7A 3I7SA 5CPOA 1TQJA 3MP3A 3UYCA 2NV1A 1TV5A 4IWWA 1XXXA 1OYBA 2QCDA 1IXOA 1H5YA 1ZY9A 4AEOA 4IXXA 3BG3A 1TPH1 3W74A 1ME8A 5I3GA 3C2FA 3HG4A 2E6YA 3LI0A 2I14A 3BK0A 3QFEA 2JGQA 1XC4A 4XWUA 5D32A 3G1VA 4GE8A 4JX5A 3S6DA 5LNRA 1HO1A 1SZEA 2QAPA 3W7JA 1GVRA 3NL3A 3HG5A 3A5FA 3IV3A 3W1QA 6ALDA 3LXBA 4EIVA 3W7DA 5FEWA 5G1YA 3EWUA 3DFSA 1H60A 3VKJA 4Z0JA 3NNTA 1L2UA 5I3JA 4LT9A 5D2YA 3L5MA 3QQ1A 4JDBA 2QAFA 7TIMA 2YGYA 1AK5A 4A21A 3SIZA 1NF7A 1TCDA 1IIHA 1LLWA 2NX1A 3ELFA 2C19A 1SO3A 3TIMA 4CQ9A 1WOBA 3MI6A 1VYRA 2R91A 3LM7A 3G0XA 3LCLA 3G1DA 5U7SA 2GQ8A 2R14A 3NPWA 4AB4A 2QUVA 3P84A 3SI9A 4MKNA 4HNTA 4S2BA 3B8DA 1O4UA 2E1DA 3NM1A 1TJPA 1YXDA 3N2MA 3WK0A 5H2ZA 1BEUA 2DORA 4UTIA 4JTUA 5CZTA 4E2DA 3UPBA 3LCFA 3KAOA 3UXDA 1WOAA 1KTNA 4X22A 5CKSA 1A5CA 4Q33A 3EWWA 4WOQA 2VFEA 1SW7A 2DJXA 3D0CA 4PA8A 1E51A 3WJYA 1LOSA 3W07A 1RPXA 3S8HA 1O95A 3A23A 1XM3A 3EX6A 2V2HA 3E02A 3FIGA 1TV7A 2A1YA 3SJ3A 1P0KA 3W1RA 2CLEA 3GKAA 2QCCA 2GPTA 1O94A 3G1SA 4ALDA 2PRMA 3CC1A 3GZ3A 5FEXA 2A5HA 1BWLA 3CHVA 5F2IA 4CCEA 2RDUA 3TSMA 4ADSA 3Q37A 3TK7A 4OE7A 1W0MA 3W70A 5K9CA 2E6AA 3CPRA 4Y96A 3W7CA 5U4NA 4NJGA 3DKLA 4JDYA 3CWNA 2ZZ5A 3KHJA 3S5OA 3UD6A 2GJLA 1OFQA 5C2XA 3LXCA 1K7FA 2NUYA 5D2WA 1DKWA 4RZ4A 1H7RA 3C2EA 3RMJA 3PB0A 3PUOA 2B7QA 4O12A 3TSBA 3PAJA 1NVMA 3W76A 4PC8A 3UWVA 1PE1A 4ZL1A 2OMAA 3MMTA 4MUZA 5D2VA 1LRTA 1XUZA 3P61A 5G2IA 3STGA 1KTCA 3RF9A 2VFHA 4WOZA 3BO9A 2YPIA 3C2OA 3VFLA 2FB3A 4UUIA 3HO8A 2ZRZA 3HGOA 5D33A 3QPYA 3K30A 3I6RA 1VGAA 4FHAA 1JJKA 4PL2A 2Y7EA 1ONRA 4FB7A 1TPWA 3Q58A 3I68A 4GBUA 1MSSA 4JTEA 4LTSA 2OT0A 3IIPA 2YCEA 3EXTA 3TXZA 4LC6A 3F1QA 3U8GA 1ICSA 3T78A 4Y90A 2QCGA 1WYIA 3DI1A 4EVZA 4HSOA 3LBCA 4QSHA 4NNBA 5F2LA 3FYOA 5AYZA 3NQ6A 3WK2A 4BWLA 2R94A 2B4GA 3IIXA 4S1FA 2QF7A 3OBKA 1SPQA 3QSTA 3GDTA 2JK2A 4TR9A 4XTIA 3TSDA 2EF9A 4R7JA 1W56A 2E5DA 1NSJA 3CTLA 1OF6A 1KM4A 1VYSX 3B4UA 5BOOA 1TPFA 3MYPA 3LCXA 2X1TA 3RFAA 4GNJA 1P4CA 4AF0B 4O1DA 1YTEA 5G2HA 1W5MA 4ZQPA 4LS0A 2V2CA 4I9AA 2FQIA 4HT3A 3TROA 3L67A 4JR5A 4M6VA 1QO5A 1KM2A 3GLCA 1XBYA 3TFXA 3TFCA 1DJQA 1JCMP 5F1VA 5KZDA 3N3MA 3MHGA 4E2BA 4RLIA 3ABOA 5C5YA 3PM6A 1R2TA 3PS7A 2VENA 2B7PA 4AWSA 3DXIA 3PWAA 5D2XA 1K8YA 4ML9A 4KWVA 3ABRA 4H4IA 4IQLA 4ORMA 4AWTA 2C15A 1OFRA 3KRZA 3RU6A 3QW4B 3STCA 3GVGA 1KLYA 3MUXA 4K39A 3ZS4A 5HQEA 1IXNA 4MLJA 1RR2A 1WBHA 3GAYA 3G0UA 4TO8A 4J9JA 1W8SA 3R8RA 1KFJA 3W7QA 3S0CA 2QCEA 3UNDA 2OT1A 1GEQA 4W9TA 1ZALA 3QYQA 4IMGA 3M5YA 2G96A 4AH7A 3V1PA 3PBVA 3T7VA 1QPRA 4UFKA 1FUYA 4LVBA 3G0SA 5T26A 2ABBA 5D02A 1HO4A 2D73A 4DBEA 2A0NA 3V75A 1M7OA 5LNSA 1U5JA 2G95A 2JBMA 3C3NA 3QH2A 1K7XA 2J9ZA 1EIXA 3TUUA 1WQ5A 4N9EA 4JTIA 4BI6A 3BV4A 1IXQA 4NUWA 5MHBA 3DHDA 3OVPA 1EWEA 3NZRA 1LYXA 1TPDA 1ZJIA 4NZJA 2ISSA 1W54A 5AHLA 4N9BA 5G4WA 4NNCA 3CIXA 2CLMA 1SO6A 2NXIA 2Y7DA 1SZGA 4KFOA 3R13A 2CLLA 4TIMA 4OBTA 5L6UA 2GQ9A 2ZRWA 2CZ5A 3TQ0A 2Z2UA 4HHPA 4LC8A 5AHEA 3QZEA 4CNNA 4M5PA 3GR8A 3W7GA 4DO4A 2NWRA 5K9XA 4ICNA 1H50A 3TAOA 3TX9A 3NG3A 1X1ZA 1B4EA 3EX1A 1GT8A 3UZJA 1M6JA 3P8IA 3TU9A 3W1AA 1K3UA 3KVLA 2H3DA 1H62A 2ZQ0A 1SR9A 1IXPA 1ZFJA 3P80A 2A7NA 4IGHA 4WZHA 1FWSA 3NZ1A 3M44A 4LU0A 5AB3A 1VLWA 4NJKA 1DL3A 4O10A 3GX9A 3S5YA 3A5VA 4TMCA 1OFAA 2CZFA 1QPQA 2JKAA 5K4ZA 2A7PA 4LUJA 4XZ9A 3OA3A 4LVGA 4K6AA 2YYTA 5LGXA 3FEMA 2CLKA 3LV6A 3LTSA 3LTPA 2NV2A 4JIPA 5HWJA 3BPWA 3C52A 4GXMA 1PL9A 2VFGA 3JRKA 2H3BA 4RXGA 3MW7A 4MZ1A 2FPTA 2OJPA 5D03A 1WAUA 5EMUA 5HUOA 3DI0A 1KTBA 3CM4A 2BSLA 5IBXA 2V8ZA 1OYAA 4O1AA 1VHCA 1RV8A 2WQPA 5HUPA 3BW4A 1GVQA 1BKSA 3UWQA 3S5NA 1TTQA 1AW5A 1H63A 1AW2A 5EKYA 3TJLA 1F5ZA 4WXYA 3PC0A 5I3FA 5HINA 4O57A 1I8JA 5D2TA 4FNUA 1KFLA 2B7NA 2ZA2A 2ZRUA 1ZCOA 4WUIA 2YZRA 2GVJA 3T44A 4LRTA 3LX9A 3SSJA 1FCQA 3IGSA 1F05A 4LVFA 4QM1A 3TW7A 2CLHA 3W1TA 1FXPA 3LCGA 5K7JA 4OWGA 4HN4A 1A5AA 2DJLA 4C1LA 1H7PA 1VYPX 1VCVA 1DVJA 1T99A 4FX6M 1QO2A 1THFD 4NJIA 4JYDA 2WNQA 3EB2A 4FX8A 5AC8A 5DY3A 3C61A 4OV9A 3DBPA 3NGJA 4A2RA 4K7VA 4QQ3A 3ZWSA 1FDYA 3S5ZA 2XN1A 3H53A 1ME7A 1VJIA 1EUNA 5LNVA 4GFSA 1Y0EA 3W72A 1Q45A 3I7RA 2NUWA 4ZMGA 5TQLA 1GYNA 1ICQA 3W7RA 2BTMA 3SGZA 3G24A 4JYEA 3NQVA 3W1PA 3R12A 3O6CA 2Y7FA 4EF8A 2DZVA 5HR6A 1QMLA 3NAVA 2YFOA 4JTTA 2AGKA 4GC4A 4RKAA 3MO7A 5CZSA 3T40A 2F7FA 1I2RA 1FWWA 3G1XA 3EWZA 4RX0A 3P62A 2CLIA 1F7BA 4P2VA 3IIOA 3M16A 3FLUA 4LVAA 3EWBX 1X6UA 5D30A 3C6CA 1TB3A 1PS9A 5D05A 2C1HA 2VKZG 4UR7A 1SQ7A 5DY2A 1TQXA 4RK8A 2LLEA 5DBTA 4UFJA 4CNPA 2O7QA 4UR8A 3OVQA 1B3OA 1YXYA 4XBKA 3TR2A 1U83A 2VEIA 3NQCA 1EX5A 2RH9A 1LBLA 3MYOA 2DZTA 5G1TA 3O15A 3WJZA 2QEZA 4OT7A 1DORA 4DF2A 5EY5A 4Z0SA 5CPLA 3NOEA 1RZMA 1OJXA 3WK3A 1FX6A 3B06A 4GUGA 1RQEA 1VHNA 5CPMA 3FFSA 4NQ1A 2FDSA 1SSGA 3GDMA 4O0ZA 3E9AA 1LLZA 3CQ0A 4IOTA 1SO5A 1YTDA 4HPJA 2DZUA 3H55A 4IMDA 4JY9A 1PHQA 5E0KA 2BZNA 2V5LA 3OHIA 3DH7A 4AHPA 4ZZ9A 3W7EA 4ADUA 2AQWA 3M5XA 2HSAA 4LRSA 4NX0A 5HJLA 5AOUA 1S5VA 2P0OA 2ZZ2A 2J24A 3A9IA 8TIMA 1OVDA 1HG3A 2G5WA 3NL6A 3PSVA 3PBYA 1CW2A 1R46A 2UV8G 3W7OA 1LBFA 1K8ZA 5IM51 1X7FA 5C54A 1LRNA 3P81A 3TE9A 3W75A 3BVJA 1OX6A 3W7MA 4ORIA 2JKEA 4JIQA 1H7NA 1TTPA 1JQVA 1FY6A 2Y7GA 2ABAA 3RK8A 1Q6RA 3GR7A 4XBSA 1O60A 3NPUA 1RQHA 1WX0A 5LHEA 4IX0A 1TPB1 4UFHA 5AN7A 1H7OA 2NLIA 3M6YA 3VI2A 1MO0A 2OCZA 1XFBA 5LNWA 4Z1BA 2BX7A 4MFDA 3W84A 4CCDA 1AG1O 1ME9A 2H8ZA 3NDOA 1OG0A 2PRLA 2X30A 4M19A 4AAJA 5LGZA 4X3ZA 1HUVA 2V81A 3O6YX 3WJWA 3GXTA 1ADOA 4AF0A 1W5NA 3TDFA 2V2DA 2Y61A 4LV9A 4O14A 3CWOX 5LHFA 2J9YA 4JD4A 3DKJA 4EOUA 1D9EA 3TQKA 3O07A 4I7WA 2WNNA 1ZAJA 3LRKA 3W7HA 4DELA 1MEIA 3SFKA 2P1FA 3L68A 1T0OA 1LCOA 3STEA 3G1HA 1RD5A 2F84A 1TRDA 2Y88A 4ZQRA 2A7RA 1QAPA 2VFIA 2QJHA 2BLEA 1EA0A 5FF0A 1HL2A 2P10A 1J5TA 3LERA 1KM0A 3AO0A 2KZHA 1LORA 1RVGA 3GXNA 3MI3A 4N4QA 3N2XA 2A85A 3VE7A 3HF3A 1EP3A 2H90A 5CG7A 4UTWA 2E68A 2PE4A 4MYAA 5DBUA 4GUJA 1OFPA 3QRHA 1SU5A 1XL9A 3PSWA 1Z48A 4JTFA 5G5IA 1KFEA 3GYEA 2NX3A 2QCFA 1H61A 4RZ5A 5EA9A 5GVJA 3KX6A 1DQXA 1HFBA 1LZOA 1MEWA 3HG2A 2TYSA 2X1SA 1SUXA 1C29A 5K9DA 4A29A 3DFNA 3M5ZA 3HPXA 3PVFA 4NXKA 1RQBA 1JCLA 1H1YA 2W6RA 3LXAA 4XUGA 5EBUA 2NXHA 1GTEA 2B7OA 2V30A 3HPSA 1KBIA 1QCWA 1I2OA 2YW3A 3QPZA 4IMEA 1O5KA 3BLIA 3THAA 1ICPA 1VPXA 1JCJA 1GVOA 2J6XA 3NYZA 4NU7A 4FNSA 2B0MA 3ATYA 4IJBA 3WJXA 3KRSA 1JRCA 3S42A 4YLWA 3TQVA 4L4LA 2ZTJA 1B9BA 4FXSA 3GDKA 1EB3A 3CU2A 1LDCA 1FWNA 1Q6LA 4FX7A 3PG8A 1YPFA 2H8XA 1QR7A 4YMZA 3N14A 1YLVA 2J88A 4FNPA 2Y63A 4EF9A 1SSDA 3TMQA 4POCA 3G1FA 4MYXA 1F6KA 4JTLA 2CU0A 2NZLA 3KVKA 3S1XA 2DZSA 3W2NA 4XKYB 3KXQA 3UWZA 3EX3A 2GQAA 3W7IA 2R8WA 5I3KA 3HBLA 4MJMA 1FDJA 2E77A 1DHPA 3W1XA 4HNUA 4IPJA 5FF4A 4QIUA 4MIMA 3W2LA 1LOQA 4BFAA 4AHQA 3VCRA 4FIQA 5J5RA 3NVTA 3W6YA 3MHFA 1H7WA 1WBJA 1VRDA 2OZ0A 1JCXA 1TIMA 3WK1A 1EPXA 1KM6A 3UZ5A 4MY1A 2HS8A 3B0UX 1GG0A 4ONVA 1SZNA 2Z0IA 3CEPA 4L4MA 3P5ZA 4JX6A 1VLIA 2YFNA 3EX4A 2C18A 3DFTA 4DBDA 3GAKA 1P1XA 4O54A 3IIZA 4YL2A 2W0UA 3G1YA 4Q32A 3HG3A 4O16A 3TNOA 3LBMA 3NL5A 2E6DA 3C4UA 5CZJA 3HQ1A 5AHNA 4OU1A 3L21A 3W3OA 4WJEA 3R2GA 1I2NA 1VCFA 1JRBA 5CPNA 1BTMA 3PUEA 1OX4B 3LRMA 1TPVA 4QAIA 4NXSA 1OYCA 4BWLC 1P0NA 4LY8A 4JTKA 3E0IA 4O50A 2YSWA 3KOFA 1CX9A 3P8JA 2C13A 3BG5A 2QUTA 2V5BA 3QMSA 3PBWA 4X2RA 4BK9A 3UPWA 1UASA 3FJ6A 1VR6A 1ZAHA 1UJPA 2A6NA 3NQMA 3L65A 3ATZA 1OFOA 2Q8LA 3O06A 2XN0A 2WSYA 3H54A 3MHUA 5KTLA 1VZWA 4HKPA 3BGGA 5E93A 1JUBA 1TO3A 4MZYA 1F73A 2J9XA 1QPNA 2ZZ1A 3S9YA 3DENA 5C6MA 2C16A 5E1QA 5EYWA 3M47A 3KVJA 3SY5A 3VNDA 3HOJA 2EPHA 3G3MA 5DN1A 3YPIA 2Q3OA 4MVAA 1W31A 4UMAA 4RCXA 4N2YA 4PODA 3BW2A 1T96A 3UXAA 3KFTA 3STFA 3NQFA 4ADTA 1KM3A 1G7VA 1WXJA 4DF0A 4Y9AA 1FCBA 3M0ZA 2RHGA 4M6PA 3W9ZA 2A4AA 2YR1A 1R30A 1PVNA 4GWEA 5KSWA 2WSRA 1QOQA 3TMLA 3W88A 1TV8A 3W87A 1ALDA 2ATSA 3O16A 4CCCA 2FTPA 4AMAA 3LHWA 1W3IA 2QJGA 5BNKA 3TAKA 1EWDA 5AHMA 4CQAA 4IUOA 3NQ7A 3NQ8A 4N6FA 5DXXA 1R2RA 4YXGA 2A6LA 2ISWA 4N9CA 1KV5A 2Z1BA 3UWUA 1PIIA 3UY7A 1DJNA 4WY0B 3IVTA 1G6CA 5K4XA 1KFCA 2ALDA 1FBAA 2NXGA 2HTMA 6TIMA 4UTMA 4R53A 2ZA1A 4HNVA 4O52A 2C6QA 5HNRA 1XDLA 2WNZA 2V0TA 2QKFA 1F76A 3NEVA 3LDVA 2ZDRA 4JEQA 4O8RA 3TXVA 4O4VA 2C14A 3LLDA 5D04C 2PCQA 3THQA 4Z1DA 1DOSA 1W5OA 2EAWA 1DQWA 3S1VA 3PY2A 4O1BA 4WY0F 3HMJG 3BGJA 2X2GA 3L5AA 1QFEA 3GIYA 2TPSA 4DF1A 1G67A 2WV8A 2OX1A 3RLUA 1G4PA 4UNKA 2V82A 5BMXA 1SO4A 3LCIA 4ZVJA 3W2MA 5LSMA 4O11A 1EEPA 2QUUA 1NFBA 1YADA 1EUAA 3TCEA 5FESA 1LM1A 4OV4A 5G4EA 2X1UA 3IGUA 4UFLA 1I2QA 2E5CA 4M7SA 3GK0A 1KM5A 4OGZA 5KZEA 3IRDA 1LOLA 1G4TA 5FEPA 4N02A 3ANYA 4UTLA 5AYYA 3NXFA 4M7TA 3ZR4A 5KITA 3NM3A 1JUEA 1CI1A 3G3DA 4FXRA 1N55A 4KKXA 2O7SA 3TH6A 3MP4A 4D2JA 2YW4A 4X9SA 5CSSA 3SR7A 2BXVA 3M41A 1QOPA 2TMDA 3N73A 3LI1A 2FFCA 4JTGA 2WPBA 1OFBA 4QISA 2PURA 1GTHA 1OHLA 3OG3A 2CW6A 3NL2A 3FKKA 4ZQNA 3ABSA 1JVNA 4TU1A 1NF0A 1EP1A 1F6PA 5AHFA 2GVLA 1OX5A 2Z6JA 4MLRA 1I4NA 5IBXC 2VFDA 4O53A 5G2WA 5I3IA 4NJJA 2QR6A 4IPIA 4OQVA 2ZA3A 2CWNA 3INPA 3RNDA 4FO4A 5SWUA 2JGYA 5ABTA 5KINA 4CNOA 2VEKA 4DPPA 4FNQA 1P5BA 4PEKA 1AW1A 1R47A 3T4CA 3L5LA 1AL7A 4AHOA 3W2JA 2NUXA 3IVUA 3N34A 4B5NA 1UB3A 3IVSA 1QDSA 4JY8A 3TC6A 3W2UA 3F4WA 3W85A 1KW1A 2CLFA 4K7YA 1FWRA 1W5PA 1ZHAA 3OIXA 4LS2A 3UWYA 3PB2A 3NA8A 1W5QA 2FPVA 1SFJA 1TJRA 5F4WA 3W73A 3PF3A 3GNDA 3SW6A 3L66A 1GVSA 1MXSA 1L6SA 4K8EA 1UCWA 4K36A 1OFEA 5C55A 4O13A 5D09A 1MEHA 2RDTA 2QCMA 1LROA 2ATMA 1K03A 3MI2A 4IX2A 2QCHA 4CLMA 1OK6A 3I65A 3P5YA 4FNRA 3LOTA 2PRHA 3QEZA 4JTJA 4E0CA 4UTHA 3G8EA 1OF8A 4H6KA 2ZCGA 3LRLA 1LBMA 3C2VA 1GJPA 1L6YA 1XCFA 3DZ1A 4HNNA 5FF2A 4A3UA 4DPQA 2VOMA 3PULA 1YDVA 3EXSA 3DFOA 2EHHA 2TRSA 1VH7A 5LNUA 4LUIA 4YCOA 4Z1CA 1JQXA 1YYAA 3T55A 3E96A 3MJYA 4DXVA 3HGSA 3NQEA 3QC3A 3SZ8A 3NQGA 4PL1A 4XKYA 2RFGA 2CFFA 2ZRYA 4QJ1A 1XBXA 2DZWA 2XN2A 3LLFA 3HPZA 4O1CA 4G1KA 1W37A 3W71A 3AJXA 2AAMA 4E38A 3U6WA 4A2SA 2C0AA 4N6EA 4UC5A 1YPIA 3ZFHA 1SW0A 2WO5A 2E5BA 4JS3A 1QNVA 5F1UA 2IQTA 2ZZ4A 1GG1A 4JYFA 1VS1A 1UUOA 4O0KA 3UQNA 3P74A 4NX5A 4NNAA 3FOKA 1Z42A 4NZFA 1G4SA 1G4EA 3O6DA 1MZHA 3BARA 4PFMA 4UCGA 1IF2A 3MP5A 2GOUA 4UTTA 4PTNA 1AMKA 5AHIA 3LHTA 2ZBTA 1TREA 2DU2A 3G22A 1UUMA 1J2WA 1T8XA 2QCLA 4MY8A 5HULA 5AC6A 5DCEA 1H51A 3W1LA 1WV2A 5HMSA 3CLMA 5FF3A 4O15A 3QF0A 1F2JA 1D3HA 2QCNA 1YDOA 3W86A 5CSRA 1OX4A 1S3HA 1QWGA 4RR4A 1SW3A 5EL1A 3W7KA 3CB8A 5A8GA 3F03K 3FKRA 3HIJA 1XUUA 4JTHA 3LV5A 3P67A 2QDHA 1V7YA 3O05A 4KFNA 4DEFA 4ZQMA 3HGJA 4PCFA 2VEMA 3W22A 3E49A 4JTSA 1GPWA 2I9EA 4U28A 2QCDB 1B4KA 5DXYA 3O1NA 3IIVA 4JN6A 4JGDA 3C8FA 3P82A 3L9CA 1JULA 2Z6IA 4TMBA 5I3HA 4I7UA 1NAL1 1W1ZA 4K38A 1TTIA 3LB0A 2FLIA 3QJAA 3PG9A 2TSYA 3LGEA 1F74A 4GUIA 4QNEA 1DBTA 2GUUA 3HB9A 5BMWA 3HGRA 3WJSA 1VQTA 1WA3A 3GNNA 4UMBA 4FEZA 5HWNA 1GWJA 3PR2A 1ZENA 1EP2A 1TPUA 2ZTKA 5FF7A 2DZPA 4O19A 4UMCA 5BW6A 3E12A 4BR1A 1FWTA 4DQWA 3GB6A 1G7UA 1KBJA 3L0KA 1N7KA 5DCDA 2W79A 1C8VA 4RXFA 4UTTC 4JICA 2YX0A 3OVRA 3IEBA 3WFAA 2ZFAA 3QMTA 5LKYA 1PCWA 3TJXA 4UTWC 2X16A 4JNMA 2YXGA 1A53A 4LWWA 3DAQA 1LTDA 1TTJA 2VELA 4LVDA 5FI8A 3DHFA 2QJIA 4MJZA 3O8AA 4LNYA 3TC7A 5F4XA 3NQDA 4QITA 1X8FA 4S2CA 2CZDA 4R34A 1KM1A 2VEPA 2ZZ3A 4YCPA 3S1UA 4WXZA 3G8RA 3C0JA 3G18A 4LW7A 4K8HA 1TYGA 4WY0A 2HS6A 4UXDA 1XKYA 1PCKA 5AFDA 1GVFA 1M7PA 3B03A 5AC7A 3EKLA 2X1RA 2ZYFA 1ZNNA 2FJKA 3LHZA 3PBUA 3JR2A 1M5WA 4O4WA 3NO5A 5F2GA 1YDNA 3UY8A 2E6FA 3U2OA 3G1AA 1DV7A 3FJLA 5J5DA 1J4EA 3W1MA 3GXPA 5FEZA 2FB2A 4GJ1A 1PHWA 5DLCA 1Z41A 3TA6A 1TPC1 2EGZA 3LHUA 4NVTA 1TMHA 5KZMA 1GQNA 1O5XA 4FF7A 5K3VA 4PH6A 1GZGA 1LP6A 3GDLA 3LHYA 3A21A 2FIQA 3L0GA 3B04A 3W1NA 1TPEA 1AL8A 2EKCA 5D37A 1BWKA 1IIGA 1N8FA 4N4PA 3L2IA 1Z44A 3EKZA 4I7VA 1FCUA 3R5EA 4GUFA 1KV8A 5AYXA 5BRBA 1XDMA 1XBVA 3TV8A 3A24A 3QQ0A 4C1KA 4UTJA 3P7YA 2NWSA 3PUDA 3W1UA 4LV4A 5HR7A 1W3NA 4HPXA 3QSRA 4ZQOA 3NQAA 5TIMA 3BLEA 3W83A 2A2IA 3W23A 3N19B 1QPOA 3SGUA 1W3TA 4M6QA 3DFQA 2Y6ZA 2Q3RA 4UTKA 2VC6A 4Y6GA 1K7EA 4RV8A 1G69A 4WD0A 1A5BA 4KFPA 4UTUA 3SECA 1H7XA 1JR1A 2Y85A 3LHVA 4H3DA 2WJZA 4Y8FA 3OEXA 1R2SA 4YWIA 5HWMA 1YXCA 4LOCA 1YTKA 1KFKA 4IMCA 3W7PA 3NQ2A 4NJHA 3MBFA 3M9YA 1L9WA 3FA5A 4KWWA 3EWXA 1Q6OA 4K37A 1TRIA 4XQ6A 3W7LA 2Y62A 2DP3A 2WKJA 2RKXA 3B0PA 1ML1A 2YYUA 4MZ8A 2WSQA 4EWND 1OK4A 4P61A 3MBDA 5DCBA 4AVFA 1LRQA 5KMYA 4O28A 3B05A 1GYLA 2ZZ6A 4O18A 2GVGA 4JX4A 2QDGA
chains in the Genus database with same CATH superfamily
1LF1A 3WEOA 2G3IA 3POCA 4W7VA 5T91A 3IAPA 5D38A 4EXAA 2Y8KA 4CVWA 3OZPA 3RR1A 2BWGA 2CLOA 2WOQA 4LBUA 2NSXA 3T2QA 3M5VA 3AC0A 2O92A 1FQ0A 1V03A 1QW9A 2RGMA 5LIXX 2VC7A 1TJ0A 3GR4A 2HE8A 5GJMA 4F2BA 4UFIA 2PF8A 1GZJA 1OFDA 2QF8A 4KCUA 4LAKA 1UKSA 3PZMA 4UIOA 2ZRXA 1Q63A 2NVCA 3VE9A 4M1RA 4Q22A 1IGSA 3TTYA 1OGBA 3GKFA 3WF3A 3O63A 1F6YA 3PN8A 1KC7A 1MXDA 2WJFA 4QG9A 1XYMA 1K9TA 4QNWA 4A22A 1R8LA 1IT0A 2HV5A 3OZYA 5LA2A 5CZ0A 3BAYA 3U57A 2WB5A 4J7RA 4QE4A 1E3ZA 3NPXA 3KVMA 3ONBA 1AODA 3GG1A 3GIPA 1QBBA 1E9LA 4O17A 3I7QA 5D8WA 3CT7A 2VR4A 1DIDA 2VCBA 3UZYA 4GH1A 4F0HA 2XWEA 3ARSA 4WX2A 4C90A 1QATA 1HTIA 3B0VC 3OBEA 4XBJA 3CAVA 1XBZA 4W5UA 3VOGA 3R89A 5LZLA 3AS3A 4LEFA 4PULA 3PZ9A 4CQ8A 2GJRA 3W7NA 3PNZA 1J18A 1OABA 2C3ZA 3SCVA 4GRSA 1KRMA 2NX9A 5I79A 3JS3A 4OHQA 2ISDA 1GOQA 2XFYA 3QY6A 2PC4A 4TV6A 4F3HA 4MFEA 1UKTA 4NT0A 4V2XA 4LCSA 1K02A 2EJAA 5JBFA 3MV11 4RNFA 4H83A 5H1WA 3L0NA 2UZ9A 4MOZA 1ZRQA 2WAGA 2XJ7A 2Q8ZA 3U2EA 1CB2A 1GOXA 1R3TA 1UROA 5C7VA 4XUYA 3IJ7A 1C3FA 1SZRA 3MVIA 2XFWA 3IAQA 5CPOA 1KBBA 3L4TA 1WZKA 3AU6A 4IGSA 4IWWA 3BQ5A 1XXXA 2NT1A 1ZY9A 4IXXA 3BG3A 2ZX9A 2YBTA 2R6OA 2D22A 1S5MA 3C2FA 3SSZA 1V0LA 3H12A 3A4JA 3AFBA 4DYEA 1KGXA 4GE8A 3S6DA 1HO1A 2AMGA 1V3LA 1QTWA 4AUBA 3LXBA 4ZEPA 5CGTA 5FEWA 3EWUA 4PB3A 2E8ZA 3OJGA 1H60A 1LQAA 3Q4DA 3NNTA 1KFWA 2DH3A 5I3JA 5D2YA 2QAFA 1YDYA 5A95A 3WL1A 4X60A 4EANA 3KUMA 4HU3A 4HA3A 1HKMA 2YL5A 2QJNA 1K6AA 3LQLA 2C19A 1SO3A 3S3GA 1WOBA 1HZYA 3MI6A 1EOKA 1ESWA 1UW9A 3LCLA 3G1DA 2GQ8A 3LQGA 2W67A 2YL6A 2QPSA 1XINA 3SI9A 3QFWA 1XIGA 3GXIA 1NFPA 3NM1A 3RAOA 1C9WA 4BHYA 3W37A 3WK0A 4TVUA 4MMWA 1BEUA 2I17A 2DORA 5CZTA 1XPGA 4HCHA 4E2DA 3UPBA 3LCFA 3ZLHA 4PYSA 3RPMA 4X22A 1ONXA 4Q33A 2ZICA 4WOQA 1SW7A 3UXLA 5HAOA 3D0CA 5I0DA 4JQ1A 3UJEA 5BXSA 4GPNA 1E51A 3WJYA 2PWDA 4FLQA 3A23A 2V2HA 1TA3B 3FIGA 3GW3A 1FHLA 3VOIA 4LB4A 3V5CA 2QJJA 4GVGA 3HV9A 2PRMA 2FVMA 3A4AA 3GZ3A 5FEXA 1FHVA 2A5HA 1I1WA 3CHVA 4AFYA 4CCEA 2RDUA 3IJIA 4H8NA 3W29A 4AY1A 3W70A 5K9CA 2E6AA 3CPRA 3ZO9A 4IFRA 1HL9A 3DKLA 2GJLA 3LXCA 1K7FA 2NUYA 2NV9A 4PBFA 3LN3A 1AVAA 1SJCA 3W76A 4PC8A 4ZL1A 3MMTA 1CEOA 1WNOA 1LRTA 1VJSA 4GI8A 3THDA 1KTCA 3QY7A 2QPUA 3QZ6A 4IF2A 2YPIA 2G4FA 3QXBA 2ZRZA 4IFOA 1YRRA 1ISYA 1VGAA 3BZGA 1JJKA 2Y7EA 4V1YA 4FB7A 4C6QA 3Q58A 4KEZA 1IZCA 1BYBA 8A3HA 3F4VA 4D6GA 2V5JA 4HK5A 1IQ8A 2JQXA 4LC6A 3F1QA 5I02A 1AJ0A 3PPFA 1Q4WA 2BVDA 3GD6A 3T81A 1Q6CA 1ODUA 4Y90A 4GYKA 3DI1A 1J11A 3LBCA 4NNBA 1J96A 1AZ1A 5AYZA 3NQ6A 5GPRA 3NFUA 2Z4GA 1MNSA 3GDTA 2JK2A 3WLNA 1JNDA 3R79A 3TSDA 1W56A 1X97A 4X61A 3J7HA 1V6UA 1KM4A 1KKOA 3LCXA 4O1FA 1OD8A 3ORWA 4AF0B 4O1DA 4A05A 4HT3A 4QJ5B 4C6MA 4M6VA 3H6OA 5E0FA 1QO5A 4Q8TA 2REQB 1GK8A 1PUDA 4E2BA 3GM8A 3G6LA 3P6LA 3N2OA 3PM6A 3PAOA 5I6SA 2YA0A 3KDOA 3PS7A 4PN2A 4KRUA 1CXEA 5JIPA 5D2XA 1K8YA 1B3XA 2YA2A 1OFRA 3WF4A 3KRZA 3VIPA 4XZMX 2P53A 4GYFA 1N8WA 4FXFA 3VKAA 1UR8A 1E4MM 5HQEA 2P3EA 1IXNA 2RGLA 4ASTA 1JPKA 2XH7A 3G0UA 3R8RA 1Q13A 2PGEA 4P7OA 1UKQA 1KNWA 3W7QA 3L4WA 1H3GA 4FS9A 3R4IA 1GEQA 3TTEA 1TVNA 4IMGA 2G96A 1DJXA 3NEHA 4JQ3A 2PDNA 4ZENA 4JKMA 4UFKA 2QNEA 1ZQ5A 4F48A 2Q6ZA 3AAMA 3TLQA 2PGWA 1FUYA 3GC2A 1AQMA 4LVBA 5C9UA 5LIWX 4DBEA 2A0NA 3V75A 1BRLA 3AJ7A 4P7QA 1FH9A 1AH0A 1PB0A 3C3NA 4J1OA 1K7XA 3VNIA 3RRXA 4N9EA 4UOQA 2J8GA 3BV4A 3GW0A 5MHBA 1HKJA 3OVPA 3NZRA 1TPDA 4B9ZA 3F4CA 5AHLA 1IEQA 3APGA 4XX6A 4NNCA 2CLMA 2NXIA 1BXNA 1SZGA 4NAFA 2R1LA 3CHCA 3R13A 2CLLA 4M1BA 4GIRA 2PDYA 3FA4A 4IJRA 2HXTA 4PTDA 1MUMA 1F8MA 2ZRWA 3UR5A 4LUTA 3SRHA 3TQ0A 2JEPA 3OTRA 5AHEA 4LYRA 3URBA 5D9OA 3QZEA 1O5RA 1JF6A 4M5PA 3KOZA 3GR8A 4PR4A 2NWRA 4H6QA 1UG6A 4WGHA 5HANA 3NG3A 3P0XA 2INZA 3MDUA 3UZJA 1M6JA 3FY1A 2PDPA 1UP3A 3M07A 3KVLA 4DWDA 2H3DA 5ABFB 1SR9A 4AD1A 3WDPP 4IGHA 3UXIA 4GVIA 1OEPA 4EAMA 3IJ6A 4DJDC 1UPPA 5KZ6A 4H9VA 2JKAA 2BY3A 5K4ZA 4JIIX 2PDWA 3OA3A 4LUJA 2CKSA 1YMYA 4YNGA 4DVOA 4NILA 3LTSA 3BPWA 4EP8C 3NSXA 5DF0A 1MW0A 3CPUA 3EKGA 4IMAA 2FPTA 2OJPA 2BG5A 3S6TA 1KTBA 3CM4A 2VP8A 4LAZA 1VHCA 1RJQA 2WQPA 2NW0A 2AL2A 1GVQA 3P0WA 1AW2A 4XIMA 1NFGA 4MADA 3CAWA 4WRHA 5HINA 5T9CE 4HN8A 1OD0A 4FNUA 2B7NA 4R85A 2WVVA 1M68A 2YZRA 4LRTA 3EB3A 3LX9A 3QHMA 3KLKA 1Z89A 3AS0A 2PBOA 3IGSA 1W1IE 2HROA 2CLHA 5K7JA 4OWGA 4C1LA 4E8GA 2OGYA 3EEZA 4DUXA 2VYOA 1UC4A 2L5HA 4PB4A 4NL1A 1LL7A 3CZEA 2D1ZA 1MZRA 2OG9A 1VKFA 3W02A 1XR2A 2A3BA 4YVPA 4JYDA 1JD9A 4OV9A 3DBPA 3NGJA 2I7GA 4K7VA 4KWOA 3MSGA 5GQBA 3AUOA 2HPIA 1A0EA 1WDDA 1Q45A 2V3FA 4ZMGA 1AQHA 3CZKA 5TQLA 2J7FA 4E8CA 2BDQA 3W7RA 1GYMA 2VUNA 4D6HA 3G24A 1NELA 3NQVA 3GNXA 3QOMA 3O6CA 4Y8EA 5HR6A 4RKAA 1KXHA 3E0LA 5CZSA 3T40A 4M81A 3PHAA 1VFFA 5JQ9A 1FWWA 1KGWA 3MU7A 3P62A 1EH9A 3IIOA 3FLUA 3EWBX 4W84A 1X6UA 1IZKA 5D05A 4DBWA 1H1NA 2YCLB 1W2PA 1TQXA 4RK8A 2LLEA 3MPGA 4GVFA 1AQ0A 4Z2KA 2IKHA 3NQCA 2RH9A 3UG5A 4D6DA 5G1TA 3O15A 4D8LA 2C1IA 1DORA 2QDEA 3O2LA 1KRCC 3F2CA 1OJXA 3S2JA 3SFWA 3HN3A 1XLMA 2V5CA 1VHNA 1KCZA 3UW6A 1LWJA 1SSGA 1U5HA 1YE4A 2OEKA 1MWOA 1GORA 1V08A 3CQ0A 3BUVA 2G41A 4P7RA 2DZUA 4IMDA 1MQRA 1PHQA 5E9XA 5E0KA 2YXXA 3E1F1 4L1WA 1ZCCA 3L4ZA 1C7TA 4C6EA 4UTFA 4ZZ9A 1EBHA 1DYSA 2ZZ2A 1PKNA 2J24A 1HG3A 1RP9A 4IICA 1CW2A 2UV8G 4XD3A 3B97A 4NF7A 3BAJA 3PZTA 4G9PA 5C54A 1LRNA 3P81A 3L23A 3OLDA 4CVUA 2OZTA 1QHOA 3SN4A 1E6SM 1E0TA 2PD9A 1O60A 4KETA 5HMEA 2VX6A 2UY5A 2GZXA 3GXDA 3SCOA 1TPB1 1QI5A 4ZFCA 1H7OA 3AQUA 3M6YA 2O56A 3NOYA 1M9HA 2OCZA 5BRQA 1XV8A 2E7FA 4MFDA 4Z2HA 3NDOA 2PRLA 2RUSA 5FA5A 3ZQ9A 2O9TA 4X3ZA 2V81A 3WJWA 1W5NA 3TDFA 2V2DA 2Y61A 3CWOX 3WQFA 2J9YA 1M7XA 2GWGA 4Y7EA 1D9EA 3URNA 2F38A 3O07A 4I7WA 1K9DA 2GGGA 2WNNA 3GQYA 5JBDA 3CO4A 2GSHA 3S9ZA 2Z26A 1M01A 2DFAA 4MUPA 1B3WA 4CD6A 1QAPA 4F4RA 2QJHA 3HTWA 1HL2A 1DWAM 2EQDA 2YL8A 5FJRA 2ICSA 4G2DA 5PTDA 3GXNA 3B4YA 1XX1A 4N4QA 5FSEC 3N6QA 5CG7A 4FR6A 4MYAA 4GUJA 3PZGA 2ODOA 2IPFA 3WLQA 4WKHA 1SJBA 3BJTA 1XL9A 1Z48A 4CNTA 1NWRA 2WC3A 2QCFA 1AH4A 3KX6A 4Z42C 1LZOA 4Q4QA 3C5QA 3M4HA 3HG2A 2TYSA 2AKZA 2X1SA 1WP6A 3AWOA 3C3UA 1C29A 3MUCA 5IXEA 3M5ZA 3HPXA 4DNHA 2EO7A 1J6OA 3OGVA 1H1YA 4I5XA 3UR8A 2NXHA 2B7OA 3QV9A 5A6LA 3OW1A 4G7EA 3SY8A 2DEPA 2XM1A 3F2BA 2B0MA 4QFUA 1VJZA 3VZZA 3FSUA 3I6EA 1EXBA 4H9MA 4D72A 1B9BA 4S39A 3CU2A 4M56A 1YPFA 1K6WA 2OTDA 4YMZA 1R87A 3N14A 5G4HC 1UYQA 4RZBA 4Q8PA 1NQ6A 3CNYA 3RU8X 3TMQA 5EMJA 2PGRA 5CSYA 2CU0A 5EU9A 1OBAA 3RCNA 2PBGA 4EACA 1XRTA 4RDZA 4RL3A 3EX3A 3OHMB 4J40A 1DTUA 1X6NA 3VD3A 2CBUA 1Q8AA 1FDJA 1HP5A 4IPJA 3H2NA 4QIUA 3A12A 5ABEA 5HJXA 3HA1A 1C92A 2QLYA 4MIMA 4AHQA 3B0XA 4R7WA 4HB7A 4AXNA 5HOSA 4CNSA 1VRDA 2OZ0A 1TIMA 3VYLA 4NASA 2XSXA 3DECA 4QS6A 1UOZA 1GG0A 3WUBA 3VGDA 3WH9A 1WUEA 3DFTA 4C65A 3IIZA 2W0UA 3JZUA 3TNOA 1UR0A 1CGUA 5XIMA 4RV3A 5AHNA 4CD7A 1X8CA 4WJEA 3R2GA 1Q4NX 3WNMA 1OX4B 3THCA 4QAIA 1CCWB 1VP5A 4JTKA 3E0IA 4O50A 4GABA 4DWSD 3VOCA 4K3ZA 2C13A 3CBWA 4X2RA 3F5KA 1I6NA 3PWIA 1UASA 1UJPA 2XIOA 2QT3A 1OFOA 3WMCA 2WSYA 5A8MA 1S2TA 2D2OA 4DJEC 1T40A 2VRJA 4HKPA 2FZ9A 5KEZA 3ECQA 1XLLA 4AZ5A 1Z3NA 1JZ7A 2YCIX 2C0HA 1TR1A 1XIHA 1Z9AA 3KVJA 4G56A 4CQBA 4D6JA 3G3MA 1TWSA 4ZXOA 4RCXA 4N2YA 1TWIA 2XWDA 4FLSA 1WZLA 1T96A 4GC3A 3ENLA 3WQ8A 3NQFA 4UOJA 1XD0A 3COTA 1KM3A 1G7VA 3CUJA 4DF0A 1PX3A 3C2YA 3M0ZA 3W9ZA 1KXQA 3S2CA 4HJWA 3FGCB 3UZXA 2YR1A 1PVNA 3OP2A 4CQCA 3W88A 1ALDA 3O16A 4F2UA 2VNCA 1XWYA 3E6EA 4AMAA 3I3EA 4AWEA 1J0JA 3AYRA 5AZ0A 2D2GA 4CQAA 4IUOA 3BZJA 3NQ7A 4DJFA 2XGBA 1AA1B 4ZE5A 3QR3A 3GH4A 3TJ4A 4PCTA 3UY7A 4WY0B 5A6BD 1WKEA 3D46A 3UEQA 1UD2A 2J75A 3WMSA 2HTMA 6TIMA 1UWUA 2J78A 4UTMA 8RUCA 1FWBC 2R9RA 4O52A 1WZAA 3ARYA 1XDLA 5FCZA 2QKFA 4DM2A 2J62A 3LDVA 3NEVA 2ZDRA 4JEQA 2UWFA 4L9YA 3ME3A 3HU7A 3THQA 3A9BA 1DOSA 3RXZA 1G5AA 3UPMA 2UY3A 3S1VA 3PY2A 3ZSSA 1P0DA 2EPMX 3L5AA 3S6OA 2OQLA 3GIYA 3M7SA 1JPDX 1G67A 1Y5VA 2WV8A 3MV01 3H23A 4H8VA 5LXXA 2VR5A 2QUNA 5BMXA 1DJHA 3LCIA 3JUGA 5LSMA 1EEPA 4IQEA 2ACQA 3TLLA 1NFBA 1EUAA 1UWSA 1EQCA 5FESA 3LU2A 1LM1A 1VFHA 2PODA 4UFLA 1J0ZA 3OLGA 4GI9A 1O66A 1X38A 5FEPA 3ANYA 1UUQA 4C6OA 1JUEA 1CI1A 3JW7A 4JKKA 1N55A 3O7UA 4KKXA 3MP4A 4I8DA 2BXVA 2P50A 3SAZA 1XIIA 5BXPA 1CGYA 2WPBA 1UKOA 2XFRA 1OFBA 4QISA 1XIFA 2PURA 3ZVHB 1OHLA 2CW6A 3ABSA 3OQEA 1J12A 1JVNA 4TU1A 1TJ1A 4ZO8A 1CBGA 1JPHA 1NF0A 4DI9A 1BF6A 1F6PA 1OX5A 2Z6JA 1XH2A 4W8LA 4GI4A 1ZPTA 4MAVA 4O53A 1PO9A 4BQ3A 1BQCA 3S46A 3VK5A 3RDKA 1DWGM 1QI3A 4AYGA 4PBEA 4HZMA 4IPLA 2CWNA 5SWUA 1GHSA 1V7AA 4J5NA 2JGYA 3LNMA 1G94A 2VEKA 1PTDA 1AMYA 3O6AA 3Q67A 4JTAA 1P5BA 4PEKA 1AW1A 1R47A 2W63A 1AL7A 1AUSL 3T2PA 4AHOA 3WIJA 1UH2A 2CPUA 4PRRA 4JY8A 1JYXA 4DI8A 1CB7B 4LAUA 3W28A 3W85A 1KW1A 1DIKA 1OIMA 3OQ8A 2CLFA 1K4GA 4REQB 5AECA 1P48A 5REQB 1G0CA 1V3JA 3PFMA 4LXFA 2XDFA 1G9HA 3ZJ8A 3GNDA 5BWAA 3B3DA 3AOFA 3HQPA 1GVSA 2A3HA 1MXSA 2DW6A 4PRTA 1L6SA 4C60A 1OFEA 4FSAA 3TYZA 5D09A 3GBEA 3SDOA 3S5SA 3CZGA 1GOIA 3I65A 2F61A 2BVWA 3L4UA 1TELA 3OGSA 1UR9A 3G8EA 4H6KA 2BB0A 2ZCGA 3LRLA 3FVDA 3VOFA 4ILSA 2CC0A 4WJXA 5FF2A 1XGDA 1OADA 1JFHA 2WMHA 4IISA 4A3UA 1S1PA 1PYFA 2BV9A 3EXSA 2OO0A 2HWGA 4JHZA 4MSSA 5FOOA 1NOWA 4S3CA 4DXVA 4R5EA 4JCLA 4XD6A 4PL1A 2RFGA 3DDMA 3LZ5A 1FWIC 2ZRYA 1XLGA 1XBXA 2DZWA 4MB1A 2W92A 5LYRA 4G1KA 2OZ8A 3SBFA 1QRQA 3N2TA 3U9IA 4C6BA 4LSBA 2C0AA 3PK7A 1SW0A 2WO5A 3K2GA 4JS3A 1BKHA 5F1UA 3DYOA 4M82A 1UUOA 2V63A 2UY4A 1OZQA 4O0KA 3PPGA 3NO1A 4I5RA 4KW2A 4HZ8A 4HYRA 3VNMA 1IF2A 3MP5A 5AHIA 1VB9A 4M24A 1UUMA 1J2WA 1T8XA 2QCLA 4DZIA 5AC6A 1Q5MA 1H51A 4C6KA 5HMSA 3ZLGA 3SUUA 2UBPC 3SO7A 4MNLA 3QF0A 2G0WA 2QCNA 4QEHA 2Q71A 2ZXBA 4KERA 1UH3A 3WNLA 5HMFA 2WMFA 3FKRA 1ENUA 3LMZA 5BZAA 4IP7A 3O05A 1V7YA 3WQVA 4KFNA 3CGTA 4QCEA 1BLIA 3W22A 4ZCWA 4L9XA 3E49A 1RY8A 5C9RA 3D47A 3VINA 6ENLA 2WBKA 1A0CA 1E0XA 3IIVA 3B8WA 4OBSA 4TMBA 4QS5A 4HTBA 3APYA 4I7UA 3E3HA 1H09A 3PG9A 3T0BA 5EB8A 4W7WA 3DGBA 3KW3A 1DBTA 4H2HA 4UQEA 1T6MA 4XAFA 3GNNA 5HWNA 4FEZA 1TPUA 4O19A 2I5GA 5LXEA 1J6PA 1R7OA 5BW6A 2CLPA 2W62A 1XYFA 5E9AA 2IPJA 4BR1A 3PZQA 3ARRA 2V67A 3LENA 4H8UA 1G7UA 3L0KA 2HBVA 1IR2A 2VD8A 3PPCA 2W79A 4LBSA 1JGMA 4F66A 1X39A 3IEBA 2ZFAA 2F2KA 1VFSA 1ZJAA 4TVDA 1I9CB 2VELA 5FI8A 3DHFA 4QR6A 4MG4A 4MJZA 4UZUA 1D8WA 1P7TB 3AIVA 1HKWA 5AVHA 4XZIA 1A47A 4CGTA 3NQDA 3ZVIA 4S2CA 2CZDA 3QKEA 4A8NA 1UHVA 5FL1A 3S1UA 3WLMA 4WXZA 1P6BA 3CUGA 4LW7A 2Q01A 3ZT7A 1TYGA 4DRSA 2Z00A 2HS6A 3SADA 3B9AA 1XKYA 1GW9A 3GHRA 2Z24A 3B03A 3DX5A 4HOZA 3SJNA 2X1RA 3JR2A 3NVDA 5D9MA 2E25A 1M41A 5F2GA 3FK4A 4B4FA 2E6FA 5JH1A 4YYFA 3FJLA 3AXHA 5FEZA 4GJ1A 4L4PA 1UD5A 2VDHA 4Q8VA 3IGHX 4LEQA 1NQKA 2XVLA 1IYXA 1I75A 3AIBA 4ZOEA 4A35A 4S3KA 2PP3A 2OODA 3GDLA 4V28A 3B04A 3SM0A 3WH6A 1LWHA 1TPEA 1PDYA 1JDEA 1IIGA 4N4PA 3L2IA 2QIWA 3VNLA 3R5EA 3TNBA 2YDRA 2WZHA 1XDMA 3PJUA 2Y0FA 3A24A 4UTJA 3PNUA 2NWSA 3PUDA 4NI8A 5A69A 1EC9A 3U7VA 3KTSA 5TIMA 4ACYA 3VIHA 2J74A 3W23A 3IANA 2FFIA 2H9AA 3I6TA 1W3TA 4M6QA 3PZUA 4N42A 3CV1A 2VC6A 3OPSA 4Y6GA 1K7EA 1BVWA 1OCQA 1B3YA 3SURA 3WNOA 4UTUA 4JTRA 5CXPA 1W9XA 4HA1A 4PUUA 1XKJA 1Q2SA 4H3DA 3BCJA 1JEZA 1TR9A 4YWIA 1A49A 4BF7A 3U3HA 1GEHA 4IMCA 2OB3A 3H2FA 3MBFA 4KWWA 1E1FA 4K37A 4UZSA 1W9DM 2DP3A 1ZB5A 2RKXA 2YDQA 2YYUA 3BTNA 4MZ8A 2A3LA 5FSDC 3QVQA 3H70A 3EA2A 1BYAA 2GJXA 3B05A 3RRAA 2QDGA 3LGGA 4DY1A 3BSMA 1JL8A 3NPVA 5F4SA 1PZ2A 3T1GA 1I0DA 4BQ5A 3KM8A 1EHAA 2QYGA 2H6RA 1HT6A 4ZFMA 1WDWA 3U5YA 4RPPA 4EPBC 3S1WA 5L9FA 1T41A 2A21A 5CLTA 3TKFA 2ISVA 2CITA 6REQB 5JIWA 3CEUA 3W2KA 2X0YA 5AC4A 3OU8A 2FYMA 1ITQA 1YHTA 1XLIA 4IQDA 3VIGA 3N15A 3M1ZA 1UBSA 1J10A 4ACZB 3URQA 2XFFA 3QW3A 4DO5A 2NQJA 2ZXAA 4NY2A 4GUHA 3N9SA 1C9DA 3WQ5A 2VX7A 2V3EA 3MWAA 3T42A 4JFWA 1CPUA 2ONEA 4DJDD 2C91A 2VGGA 3OYZA 1TWDA 3CV7A 1GQKA 4HHLA 1O6IA 1EO7A 1VFOA 4QJ4B 2VFFA 1M7JA 1VCGA 4DJFC 4GCAA 4PUEA 2ZX6A 4G6CA 2ZADA 3NDYA 2C8NA 4RE3A 3EOUA 4AVNA 1C93A 7XIMA 3BICA 1FCVA 1H1ZA 3E2QA 1B57A 4MNMA 5DELA 3UZWA 4US5D 3RX4A 4F79A 5E09A 5EPDA 1R3VA 4US6A 3Q2DA 4C6NA 1XD1A 1LT8A 4JXCA 1XYZA 1GHRA 1SFLA 3LCHA 3RLVA 1EYEA 3BMVA 2VX4A 1IHIA 3P14A 4A3RA 3NTYA 1KLZA 1Q3NA 4KBXA 4MPQA 1RY0A 2HE5A 2GVYA 3TYUA 3DEQA 1DWJM 3ABQA 3Q94A 2Y70A 1D3GA 3MQTA 3IUHA 1V6TA 5CC3A 3M43A 5H91A 4Z08A 4F9JA 4XB3A 2WANA 3C56A 4PE8A 4UFMA 5CGQA 3PPHA 3N6HA 3V3WA 1XLCA 3IGXA 4UNLA 2Z27A 1BWVA 3SCUA 1G01A 4Q4KA 3SRDA 4WCJA 4B15A 2ZRVA 3EXRA 2ACRA 1D3CA 1QK0A 2ZZ7A 3W01A 2FHFA 4H19A 2V9DA 4IG2B 1A50A 4MY9A 3VKBA 2JF7A 1L2QA 2WMIB 4B3ZA 3KDNA 1US3A 1E1CB 4RDWA 1HN1A 1TQJA 3MP3A 3UYCA 2NV1A 4QAWA 4DYKA 1TV5A 2QCDA 1NWTA 3BV7A 4AEOA 1QW7A 2OO6A 1TPH1 1J2BA 4HNCA 4D6IA 5I3GA 4AD5A 2E6YA 2I14A 2JGQA 3VUPA 6CGTA 4XWUA 5D32A 1M3UA 5DMYA 5LNRA 1ISVA 3IV3A 4EIVA 3DFYA 2Z29A 4B3KA 3QLDA 3QQ1A 4U5KA 3D3FA 4KCWA 1CZ1A 3CH0A 5BYWA 1NF7A 2WHJA 2VM8A 1YIXA 4M6UA 3ELFA 2VC9A 3TIMA 2PZNA 3M0IA 3UP8A 3LM7A 1Q6GA 1JFXA 1HJUA 4YHEA 4MKNA 3UYIA 4HNTA 4S2BA 3B8DA 1O4UA 5DT5A 5IHRA 5HMDA 3CUIA 2F9RA 2PDMA 1TJPA 1YXDA 3WDHA 1FWHC 4UTIA 4JTUA 1XRFA 3B8SA 5CKSA 3WG6A 5DMMA 1KRAC 1AD4A 2HXUA 2VFEA 2DJXA 3TN4A 4PA8A 3TWAA 2CWXA 1RK5A 3H26A 3W07A 1CDGA 1SGJA 3BAXA 1FWJC 4E2OA 2OQHA 2VQTA 1OM0A 1XM3A 1V51A 3EX6A 3PP7A 4LANA 3MSDA 3D3AA 3U5UA 2A1YA 1A80A 3SJ3A 1P0KA 3ZR6A 4CD8A 3OB8A 1YQ2A 3G1SA 4ALDA 4C1NA 1A5OC 3CC1A 1JXJA 5FAJA 1BWLA 3ZJ6A 2WHLA 4Y96A 5U4NA 3BURA 4GGHA 3CWNA 3KHJA 3DCPA 1DKWA 4RZ4A 4E6MA 3C2EA 3VIJA 1NVMA 1DWIM 2QDDA 5D2VA 5G2IA 1WDQA 2Z7KA 3BANA 3WD0A 1WO2A 3BMWA 4LALA 4Z2IA 4RNJA 3BO9A 4D71A 3SCNA 3LK6A 3VFLA 2FB3A 2J13A 3HGOA 1ISXA 4GJIA 4F0MA 3QPYA 1UQZA 2FZDA 3K30A 3M0KA 1ZS2A 4XAYA 1ONRA 1S46A 3CYJA 4XIAA 4HHHA 1MSSA 1V3IA 2FDMA 1E4IA 3EXTA 3TXZA 2GK1A 3U8GA 3KWSA 3BAIA 3HZ3A 3T78A 2WVTA 3R8HA 4C7GA 3WLKX 2QCGA 1WYIA 4HSOA 4QSHA 5F2LA 3WK2A 4BWLA 2B4GA 4V15A 1F4AA 2PTZA 2QF7A 1P6CA 3QOKA 4QE1A 4XVDA 3QSTA 1XIMA 4ZB0A 4TR9A 1W6TA 2QV5A 3BGAA 4IIFA 1A5MC 3BC9A 4D6FA 5CC6A 2EF9A 2E5DA 1GOWA 2PDFA 3PTQA 1BFNA 3CMGA 1TUXA 2DSVA 3RFAA 2V2CA 4I9AA 2FQIA 5FJOA 2WM1A 1H0IA 3S2MA 5CJNA 3EPMA 2PLKA 3EB4A 3TFXA 4I3GA 2BHZA 2PI6A 1JCMP 5F1VA 5KZDA 3N3MA 3ABOA 3GFXA 1R2TA 3H2AA 5ABGA 2VQUA 2B7PA 4AWSA 3PWAA 4ML9A 4H1ZA 3ABRA 4H4IA 3UNTA 4IQLA 1XRSA 4ORMA 1EDTA 3PZOA 4MJ2A 2YJQA 1KLYA 1XYBA 2XG9A 1TVPA 4MLJA 1JDCA 1W8SA 1KFJA 3S0CA 2QCEA 3B8VA 5I2UA 2OT1A 4W9TA 3QYQA 3M5YA 1XW8A 2DQXA 3E2SA 2FJUB 1VBUA 4AH7A 1NOUA 1VAHA 5D02A 1F3XA 3WBAA 2IS7A 1E43A 1M7OA 5LNSA 2G95A 3GDBA 1NIUA 3G1RA 3TUUA 2G8ZA 4GX8A 4CD4A 4IIBA 4EAYA 2WXDM 3E5BA 1ZJIA 1XLEA 2ISSA 4H2CA 1NU5A 3MUAA 3KZPA 3AHYA 2X05A 3CIXA 1XRVA 3K1GA 4S3DA 1TV2A 2PFHA 2Z1KA 2FH8A 2GQ9A 4LY4A 2Z2UA 4HHPA 4HMDA 4GY1A 2POTA 1U33A 3MUY1 1JGIA 2CZVA 3N2CA 4DO4A 1VRXA 3H7RA 2QS8A 2HVMA 1R6WA 2PTWA 2PDBA 3EX1A 3K4DA 3TU9A 2HNEA 4M8UA 2F6UA 4D6CA 2ZUUA 4EXBA 4UB9A 1IXPA 1ZFJA 3F2DA 4M51A 3TYEA 1F3EA 1BXCA 3M44A 4LU0A 5AB3A 3UVIA 2VL4A 2ZC8A 3GX9A 2CZFA 2PCEA 1GVIA 1QPQA 4GNKB 2A7PA 4XZ9A 4AZ7A 1ZBCA 4DB7A 4CEXC 5LGXA 2WLZA 1A3WA 1ZP4A 1S2VA 4Q6JA 2NV2A 2HISA 1UIOA 5HUOA 3IACA 1R85A 4TXEA 2BSLA 1OYAA 5HUPA 1POKA 1F9CA 1GQIA 1BKSA 1WAWA 3S5NA 1TTQA 1K4HA 3T8QA 5EKYA 3TJLA 1F5ZA 4WXYA 1RVKA 5C9WA 5I3FA 3GVWA 1NH6A 3V16A 4B5UA 1I8JA 3TVAA 5D2TA 4DAFA 1KFLA 2ZRUA 2PWHA 1ZCOA 2GVJA 1F05A 5JH2A 3MT1A 2GQ3A 5TD4A 1FXPA 1RSCA 1WUFA 1A5AA 2DJLA 3VGFA 3HURA 1DVJA 1EGVA 3NZGA 5ECUA 1R86A 4B5WA 3TEVA 1Y7VA 3KS6A 2WNQA 5AC8A 5DY3A 2OWXA 3LG3A 1R3YA 3KE0A 1ME7A 4Q7IA 1EUNA 5LNVA 2CETA 2E40A 3FHAA 3MUIA 4NAFB 1XIBA 3ARZA 1ICQA 2BTMA 3SGZA 5IDZA 3BDKA 5FJPA 3Q65A 4XISA 3U2ZA 1JIBA 5I3DA 1FP9A 2XUCA 3AXIA 2Y7FA 4EF8A 2P76A 2DZVA 1QMLA 2CHNA 3NQBA 2PDGA 3OYXA 4JFVA 4HYVA 4Q8UA 3VDHA 2D23A 3EWZA 4RX0A 2DV0A 1TA3A 3CTTA 3URAA 4P2VA 1SJAA 3SEPA 4LVAA 4HJFA 5D30A 1JZ8A 3CQHA 4HQVA 5HA7A 3AMDA 3VMNA 4H9UA 1L8NA 4Q8NA 1VFUA 3FA3A 1OT1A 4UFJA 3N17A 1CGXA 3DERA 4UR8A 3ERPA 3OVQA 3UCCA 3CPGA 2ZC1A 2BY0A 3HFYA 4YVVA 2FH6A 1LBLA 2PDJA 2DZTA 4HTYA 3WJZA 4E4UA 4OT7A 5I07A 1KO0A 4LYKA 1RZMA 2X41A 3B8TA 1GNXA 3GTHA 2QXWA 4MAZA 5CPMA 2OFJA 3VGBA 4ES4A 2FDSA 1PEZA 4L5ZA 3E9AA 4GHRA 4IOTA 1YTDA 2IXUA 5F7UA 4JY9A 3H55A 4GZJA 1TFVA 2BZNA 1H41A 3SCQA 2AL2B 3OHIA 3WELA 3DH7A 3RR4A 3E0WA 4AHPA 3M5XA 4NX0A 1ZBVA 4OOZA 2P0OA 3CUFA 1PZ3A 3CQIA 3AZTA 3PSVA 3IJLA 2XIQA 4BKNA 4TTUA 4H04A 1FH8A 2HEJA 3TE9A 1GKQA 1OX6A 4FF5A 4L61A 3CS2A 3M0HA 4JIQA 1H7NA 1JQVA 5EGRA 2WJEA 3H4XA 1NTHA 4F0RA 2FTYA 3NPUA 3GIQA 1WX0A 1PBGA 4IX0A 5TAOA 3WD4A 1V93A 2PEVA 4OZOA 3MZ2A 1RBOB 5LNWA 2BX7A 4Q8OA 2WMKA 1ME9A 3VDCA 2J79A 2AAAA 4M19A 1HUVA 1E73M 3GXTA 1ADOA 4AF0A 1PXGA 4ZB5A 3WUEA 4LCQA 3F4DA 2NSOA 4GKLA 1XH1A 1SM9A 3LRKA 1ZAJA 3L68A 1T0OA 1Q7QA 1PSCA 1TIWA 1TRDA 1VENA 4MGGA 2VFIA 4C6IA 2GGJA 2BLEA 1HJQA 3II1A 2P10A 1XHGA 3LERA 1KM0A 4U10A 2KZHA 1B3VA 3MI3A 1J0YA 3KWXA 2H90A 5DBUA 2PE4A 2B31A 3QRHA 3ANVA 1E72M 2WCSA 3H22A 4RUBA 3AICA 4XZNX 4A3QA 4RZ5A 1M04A 5GVJA 1L0PA 1DQXA 1MEWA 1W17A 1VBHA 4FAMA 5K9DA 2V6AA 1XQLA 1FP8A 3PVFA 4NXKA 1JCLA 2W6RA 3LXAA 4XAZA 3H7VA 4OUIA 5EBUA 4AD4A 1GTEA 4GO8A 1KBIA 4WR3A 2YW3A 3QPZA 3EDKA 3WLJA 3BLIA 1ICPA 1MI3A 2IKJA 2J6XA 5BU9A 3NYZA 4FNSA 3WF1A 4AIBA 3ATYA 4IJBA 4JTCA 3KRSA 3S42A 2DPEA 2J7EA 2ZTJA 3PUGA 3R10A 3GDKA 1LDCA 1UH4A 1FWNA 1J0HA 2WC4A 2H8XA 1S3TC 1W3KA 4HMEA 2A3CA 4FNPA 1CT5A 4EF9A 1YPXA 1SSDA 4POCA 4YTTA 4MYXA 4L9ZA 4YWSA 1F6KA 3MWCA 3KVKA 3S1XA 2ZUWA 2OSWA 4B92A 1AZ2A 1E4NA 3W2NA 2Y1HA 1UD6A 4HU4A 1QNPA 3W7IA 2R8WA 1JZ4A 4MJMA 1PTGA 2E77A 3KCJA 1DHPA 3W1XA 3REQB 1BYDA 3WFLA 5FJTA 2QGYA 1CGTA 2D2JA 5J5RA 3VCRA 3WQ4A 3NVTA 4KWSA 4DWSC 4WIWA 4B91A 5MF5A 1H7WA 1US2A 1JCXA 2P5NA 3WK1A 4L6OA 3GC4A 4MY1A 1SZNA 1QK2A 2NQZA 3P5ZA 4JX6A 2YFNA 1PZ0A 2FZ8A 3CJPA 4ZGYA 1QNQA 3GAKA 1P1XA 3HG3A 1LQ0A 3LBMA 1IGWA 1EJTC 5CZJA 3T08A 4OU1A 3L21A 1I2NA 3UT0A 1JRBA 1YBQA 4PUMA 1BTMA 1BHGA 2PDUA 1SFSA 3LYEA 2X7WA 4PUKA 1OYCA 1BSIA 1OZMA 2PSNA 2X0SA 4BWLC 3UBPC 4RE4A 3G77A 2YSWA 1CX9A 2VMFA 2VTFA 1W2VA 1ZLPA 1UD4A 3UPWA 3N11A 1VR6A 5AVNA 1B5TA 1Z6KA 2Q8LA 3JVAA 1EKOA 1A4MA 5T9BG 1OIFA 5KTLA 1BPLB 1RALA 1GONA 3WH7A 2EBNA 4J3UA 2ZZ1A 4CCZA 4I6VA 3V35A 3L4YA 2CYGA 3S9YA 5LA1A 3ONCA 5C6MA 1V6YA 4W93A 3N18A 5EYWA 4JTQA 2P88A 2DIKA 3SY5A 3VNDA 3HOJA 3GVVA 4A8IA 1S2WA 4PODA 1UA7A 2WVUA 2VJXA 3UXAA 4PUDA 3UU0A 3KFTA 4ADTA 2PS2A 1WXJA 3QC0A 1FCBA 4HU0A 3AXMA 3TYCA 2BVTA 2A4AA 4CN4A 2J8TA 3FXYA 4AC1X 3OVGA 1TV8A 3WLSA 4C6LA 4CCCA 1BQGA 2FTPA 4KGLA 3CAQA 5BNKA 4A8LA 1KCLA 5AHMA 5M5DA 2D3NA 2BHUA 2P8BA 5DXXA 1BG4A 2DQWA 2VRQA 2NT0A 1QVBA 1KV5A 1QU4A 3UWUA 3LD5A 1PX8A 3BMXA 4AZCB 2J47A 4MWAA 1TJ2A 2FMNA 4B2DA 3FHQA 4RW3A 3QQWA 4C91A 4Q4RA 4R53A 4HNVA 4KS0A 2E28A 5HNRA 3TONA 2Q02A 3VZXA 5A2CA 1HJVA 3GHTA 4C6FA 3MKKA 1OQFA 3PFRA 4UCFA 4O4VA 5GNZA 2PCQA 3MSRA 4Z1DA 2AL1A 1XIEA 4GVHA 1PTAA 2EAWA 4H9ZA 3BGJA 4M80A 2VVSA 3BE7A 3RLUA 4MKVA 1POJA 2D24A 3V18A 4AQLA 4ERAA 3ZIZA 3OLIA 2E5CA 4E5TA 2EXOA 4PSRA 3RCMA 5KZEA 3IRDA 5EMKA 4N02A 5AYYA 3ZR4A 2OLSA 1JCTA 1EGMA 5KITA 4J27A 3SQMA 2GJPA 3A4WA 3TH6A 3U0HA 4Y9MA 3M0LA 4X9SA 1F3TA 3N73A 5HK4A 2CEQA 2FFCA 3T2OA 1GTHA 2OPJA 4EWJA 1W3LA 3AHXA 1S1RA 3AI0A 4P7NA 1TZ7A 4QLKA 2R82A 4JNYA 3GVQA 4PRWA 1QHPA 3IARA 3ZR5A 4IGMA 1S2AA 4C6PA 2WK2A 5LIUX 3R43A 4CNOA 4DJFD 3UVAA 1DXFA 4DPPA 1UMLA 2GVEA 3SCPA 4RNIA 3L5LA 2QW5A 1FWDC 4YN5A 2NUXA 3IVUA 3N34A 4B5NA 1QDSA 1ZU8A 2XIIA 4XKMA 5A6KA 4RNHA 1FWRA 3OIXA 3EOSA 3PB2A 2HRWA 4CNUA 1W5QA 4WKFA 2FPVA 4GFIA 4ATWA 1SFJA 4MDPA 1TJRA 3W81A 1DTNA 5A2BA 3V4BA 5B7YA 1Z7AA 4JL2A 3QHNA 4ERGA 3ALFA 5E6ZA 1H4PA 3OZOA 3L66A 1IT7A 2GGEA 4MDOA 2F6KA 3ARVA 3EWDA 1ZBWA 1QNSA 2Y5JA 3NSMA 3L4VA 4LUSB 3MI2A 2QGHA 1UQYA 3LEPA 2QCHA 3LOTA 4GY7A 2PRHA 4J3XA 5C9XA 1W9BM 2ZVRA 4JTJA 3ABXA 4PMRA 4GA8A 1RP8A 1LBMA 4B5XA 1GJPA 4JPGA 5HPCA 8XIAA 4DPQA 2WZEA 2VOMA 1GW1A 3WBEA 1YDVA 3K8LA 3IUDA 4UQAA 3RILA 3W26A 4Z1CA 4X0NA 1YYAA 4F9DA 4NZ5A 3AHVA 3T55A 3WLTA 1O12A 3SZ8A 4UWMA 1P43A 1Z32X 3K5XA 3K46A 4L1XA 1I1XA 4O1CA 4TX6A 4QP0A 3W71A 5LIYX 4QE5A 2XSAA 1BYCA 2A3AA 4LGXA 2E5BA 1JAEA 1QNVA 4AY8A 3UQNA 3CWHA 4NX5A 3T4WA 3FOKA 3WQCA 5EMYA 4YTRA 1G4SA 1TMQA 4Q7BA 1G4EA 1MZHA 3MY9A 5BWFA 4PTNA 3WLHA 2ZBTA 1TREA 3EGJA 2DU2A 4MY8A 3QTGA 5I24A 9XIMA 4QGCA 1U1UA 4LYQA 3HFTA 3KOWA 3OO2A 4R3UA 3VCNA 2GLKA 4O15A 1DWHM 3W86A 1OX4A 1S3HA 1QWGA 4PMNA 3F03K 3FW6A 3HIJA 3FDKA 3MO4A 1KRBC 4DBSA 3TP4A 4IL2A 4GOAA 3P67A 1E40A 2Y4SA 2OKOA 5AY7A 3M0VA 4ZQMA 4AG0A 1GPWA 3LPGA 1B4KA 5DXYA 3OGRA 2C79A 3KP0A 1D8CA 5I3HA 1GJUA 1IWBA 4K38A 1TTIA 3WZ0E 3LB0A 2FLIA 2P0IA 2TSYA 4IIDA 4GQQA 1JD7A 5BMWA 2AKMA 1V4YA 2XVNA 3C0LA 3ZZ1A 1EP2A 1RPKA 2DZPA 3WLOA 3CL7A 4TTGA 1JZ6A 1KQYA 4DQWA 3CL8A 2NQ9A 1VFTA 3GB6A 3N29A 1IEXA 2X2YA 2XH2A 1C8VA 3VU2A 4UTTC 2AGTA 3FGCA 2YX0A 3FXGA 3OVRA 1V6VA 3QMTA 1CXLA 1PCWA 2I57A 4AIOA 2X16A 2YXGA 3KP1A 1A53A 1VBGA 4GD0A 3KBNA 1LLOA 4JHOA 3HV8A 2AOSA 2XTKA 4E3VA 1MUWA 1TE1A 5AYIA 4JBRA 1OC5A 1GOOA 2IXVA 2Z2AA 2V38A 2VEPA 1EFZA 1IEIA 4K8HA 3PJXA 3GU2A 4WY0A 3OODA 3VILA 3A13A 1W3HA 1JI2A 5AC7A 1KWGA 2G3FA 1ZNNA 1DE6A 3LHZA 3WNPA 4NI3A 2AQVA 2ZE0A 3NO5A 5A6JA 1YDNA 3TYDA 1TUFA 5AZ1A 3QYSA 3G1AA 3W1MA 5I7GA 2CNCA 1H5VA 3CT2A 3TA6A 4A3YA 5BROA 5KZMA 2W5FA 1GQNA 1O5XA 1KWKA 5K3VA 3D6NA 3FNDA 4PH6A 1GZGA 3LHYA 1LL4A 3A21A 3ISIX 3L0GA 3W1NA 3BWWA 5CJMA 1AL8A 2EKCA 3F7JA 4MB5A 5D37A 1XLBA 1Z44A 2BGQA 4I7VA 4GUFA 1KV8A 4IQJA 1FWFC 3TV8A 3GE7A 2VD9A 4W8AA 2DIEA 1JPMA 5HR7A 1FKWA 1W3NA 3BAWA 4RPQA 2PDKA 1R7AA 2PDIA 3W6LA 1UP0A 2W66A 4NZ3A 1XFCA 3O0FA 2Y24A 2A2IA 3A3WA 1W9UA 1ADSA 1XG4A 3PZNA 3VIOA 3ARUA 3E5PA 1R3RA 4FOKA 5B80A 1LUCA 3TN5A 4HBKA 4XAGA 3LZ3A 3ZVHA 4KFPA 4WDTA 1JR1A 4QLLA 3LHVA 1DJGA 4Y9OA 5D4YA 5E70A 2QHAA 1RLCL 1BGGA 3OEXA 4MB4A 1R2SA 5CPSA 1OT2A 4LOCA 1YTKA 2YDSA 4DN1A 3FA5A 1Q6OA 1TWWA 4XQ6A 4I5UA 2Y62A 3QGVA 3LPOA 2WKJA 3B0PA 3MA8A 3N4AA 2WSQA 3UCQA 3KBJA 4P61A 4JNZA 3NXLA 4LF2A 4AVFA 1LRQA 1TKKA 2ZUMA 4P8WA 4O28A 4ML4A 2TAAA 4Z1YA 4JX4A 4QDMA 3P60A 2GL5A 4F8XA 1GVEA 3RM4A 1GKRA 3M64A 3N12A 1HNYA 3W4RA 4REQA 1LL6A 5REQA 4OUEA 1TSIA 3B8UA 4FNTA 1P0EA 1Q6QA 6PTDA 4KIRA 2DSKA 4HZ6A 4WQ6A 1RCOB 4MB3A 5C7HA 2JKPA 3PZIA 4IPNB 4GYPA 4L65A 1KB3A 5EBAA 3RG6A 1JZ5A 1PV8A 1UBPC 2G97A 4S3EA 2VXNA 3A22A 3WLIA 3DGRA 1A5SA 1WZMA 3TN6A 1JCNA 3UWWA 4LS1A 4AWUA 5K2ZA 1FWGC 3TN3A 5TF0A 2DZAA 1HJXA 1FOBA 1GOMA 1QUMA 5FACA 1XYCA 1X1OA 3BLFA 1GQLA 4RZ6A 1FH7A 1O1HA 3H8AA 1ZBKA 1ZP3A 3EEGA 3ZYZA 5CEWA 3VAVA 3QM3A 1LWIA 3CUXA 5M2FX 4S3AA 2H9AB 4DUWA 3CUZA 1KKRA 3LCWA 3WMLA 2VC5A 1S5TA 1MUCA 4Z2JA 3QMRA 4JQ4A 3SCSA 3BLLA 3V7PA 2J27A 4MWAC 4GKTA 4H7CA 3WN6A 1M53A 5CSUA 1L6WA 3HMCA 1OY0A 5DMNA 3UA4A 4CQDA 3USBA 1YNQA 1AJ2A 1R9ZA 1E5NA 5BXTA 1XPYA 5TBOA 4AXKA 2DVXA 1OCNA 1FDZA 2VZOA 3LTYA 2WSKA 4HOXA 2FZMA 2YOCA 4XVEA 1EJXC 4ATLA 3BG9A 2CBJA 5A5WA 4PUWA 1Y5WA 3S2NA 3WO8A 2PP1A 3WL0A 3RO8A 4R33A 3WNKA 1K8XA 4GNVA 3I4KA 1C90A 4PGLA 4N9DA 4PMYA 4HSNA 2GJNA 4WF7A 1DHKA 1QI0A 2Y8VA 5A6TC 2V69A 4IPPA 3SN1A 2ISFA 4KRTA 3KL5A 3RCYA 1OC7A 4FIRA 4HVXA 3OIHA 3O9NA 3KRUA 3BW3A 4BI7A 3AIUA 3I7SA 3AYTA 4GCXA 5M1TA 4PEEA 1XCXA 1H5YA 4KEMA 2BP1A 3FDGA 1FFRA 3BLDA 1ME8A 3HG4A 3LI0A 3BK0A 1V3KA 2TODA 3KBWA 4BJHA 3G1VA 4JX5A 2WM0A 4WHBA 4IL0A 2QAPA 1Q7MA 1UOKA 3W7JA 5H8PA 3HG5A 6ALDA 5IOBA 3D5HA 4W5ZA 5G1YA 3DN5A 3EOOA 1IZJA 1V6XA 4Z0JA 3C0SA 4LT9A 1XICA 4JDBA 3WCZA 4PBGA 1AK5A 4KIEA 4A21A 1TCDA 1S39A 3UR7A 3VX1A 1IIHA 2NX1A 4S38A 3M0JA 1E71M 4CQ9A 3AS2A 3IJ9A 1VYRA 1KXTA 4B90A 4LUYA 3SCWA 3NPWA 4AB4A 4H00A 3TCSA 1P7TA 3KCOA 4LYPA 1HX0A 3N6JA 3N2MA 5H2ZA 1JNEA 3GH7A 2FZBA 3KAOA 1DQUA 1FRBA 3UETA 5FD0A 2G50A 1ZJBA 4DAIA 3WNNA 1LQ2A 2A3EA 3ES7A 2BASA 3WQGA 1RPXA 4ZXLA 1MVYA 1EOMA 1MDLA 3E02A 1TV7A 4HMNA 3LY0A 4LAMA 3PTDA 1R0MA 3GKAA 4Q3MA 2O0TA 3E0VA 1O94A 2XH4A 3UESA 3CHEA 2ZKMX 5F2IA 1QASA 3TSMA 2CBVA 3TK7A 2GFTA 3SQLA 3W7CA 2BOEX 2P8CA 3CZLA 4JDYA 1V02E 3W82A 1OFQA 5D2WA 1CXFA 1H2JA 5A6MA 1GCYA 2OOGA 2WVSA 3FJ4A 3RMJA 4S23A 2B7QA 4O12A 4XZLX 1ITCA 2ZXQA 3RF9A 4NZ1A 2J7GA 2VFHA 2CHOA 4WOZA 1JZ2A 5LIKX 2V68A 2ON3A 4UUIA 4U31A 4DBUA 3HO8A 4FLOA 3LA4A 1UR1A 5D33A 2X8RA 3I6RA 4FXJA 1TPWA 5JVLA 3EDFA 1FWAC 3QGKC 4GBUA 3GSMA 4JTEA 2OSXA 4LTSA 3S83A 1OG6A 3TOPA 4DX3A 1JG9A 2YCEA 2XGIA 3DC0A 2VURA 2FVKA 3U48A 1ICSA 2O4QA 2XISA 1H11A 2VX5A 4R9XA 3FYOA 2CXGA 4PCPA 3IIXA 1XISA 4S1FA 1CENA 3OBKA 4XD4A 1QOXA 4INFA 1SPQA 3V36A 1MYRA 3TJIA 3BOLA 4OTKA 4R7JA 1QPKA 1NSJA 3CTLA 1QNRA 4OBRA 1OF6A 1PYMA 2J7DA 1VYSX 1TPFA 3MYPA 2BGNE 4HCLA 3ZOAA 1P4CA 1E55A 2X09A 1YTEA 5G2HA 1W5MA 4ZQPA 4LS0A 1PKMA 5FL0A 3L67A 4JR5A 3KL0A 1E9YB 3W00A 4H6EA 3M0XA 2Z1SA 3GLCA 3OG2A 1XBYA 3T05A 1FHDA 1C8YA 2OX4A 3WSUA 3H2CA 3RITA 1H49A 2VENA 3GHSA 3R0UA 4ICMA 3VKDA 7TAAA 2GOKA 1V0NA 2XSBA 4C1NB 2C15A 4PMQA 4IH3A 1CXKA 6REQA 1NDWA 3RU6A 3QW4B 4NAEA 4CU7A 2OR2A 5ENLA 4K8GA 3MUXA 3B9OA 2G3NA 9RUBA 2HCVA 3GUGA 3JZEA 4K39A 3ID7A 4WSJA 5CBJA 1RR2A 1WBHA 3GAYA 4KESA 3UNDA 4PMZA 1TV4A 4P8XA 1ZALA 3QLLA 2E4TA 3V1PA 3PBVA 3T7VA 4DWSB 4DZHA 1VBJA 3G0SA 4GIEA 2ABBA 1A5NC 2ZX5A 3SQSA 4CUCA 1U5JA 3BJSA 4HU8A 2JBMA 2PWFA 4JN8A 1EIXA 3WX7A 2CXEA 4JTIA 1TV3A 4H8HA 4BI6A 1IXQA 4NUWA 3DHDA 4B4HA 1LYXA 1Q85A 4NZJA 1W54A 4Q6XA 5FAGA 1NOFA 3QR1A 5XINA 1R3WA 2DGAA 2PTDA 1AH3A 2Y7DA 4GZIA 4KFOA 4TIMA 4OBTA 3SY1A 4A6GA 4QTGA 3UF9A 4LC8A 1XLDA 4C5YA 1ONEA 4UNIA 1N2VA 3W7GA 5K9XA 3IUIA 5H8MA 1V77A 3P8IA 5HDRA 1X7IA 1XC6A 3W1AA 1F07A 1K3UA 4KGJA 4AZIA 2A7NA 3H21A 3RX2A 4WZHA 1FWSA 3NZ1A 2O9PA 4ICCX 4NJKA 3HQNA 4FA3A 4O10A 1MW1A 3EDJA 2ZVIA 4L7ZA 1OFAA 4IG2A 3DBNA 3TWBA 2W4XA 5A8QA 1IWPA 3EMQA 4E4PA 2Y5EA 2WMIA 4LVGA 1R3QA 4U33A 2ZXDA 1E1CA 5J8LA 1OC6A 3DC8A 4QROA 4PCSA 3LV6A 3LTPA 1EPVA 5HWJA 4XV0A 2VFGA 3JRKA 2H3BA 4RXGA 4MZ1A 4ATDA 1WAUA 1VEOA 2EPOA 5EMUA 3DI0A 4I9TA 4CU8A 3GO2A 5IBXA 3VDGA 2V8ZA 4O1AA 3EWCA 3VXGA 1REQB 4K1GA 1AW5A 1H63A 1V79A 4UQCA 1MQPA 3AHTA 4IGNA 3VKCA 3TZNA 4R7OA 3BJFA 3T44A 1JYVA 2D20A 3SSJA 3ITYA 4LVFA 4QM1A 3TW7A 4HOWA 1EXPA 3LNPA 3W1TA 3RX3A 1SVDA 4WEVX 1Q8JA 1VYPX 1E6QM 1K1DA 1VCVA 3WDIA 3KHDA 2RDXA 1T99A 1K8CA 4FX6M 1THFD 4NJIA 3F5JA 3SN0A 3EB2A 3C61A 1M65A 4A2RA 3AU2A 4QQ3A 4GI6A 3ZWSA 1FDYA 3S5ZA 2XN1A 3H53A 1VJIA 1A0DA 2VDGA 2EPKX 3IJDA 2NUWA 3RM9A 4O8AA 4LQ1A 5DQPA 3GTNA 3KTCA 4FP1A 3ZXWA 1I0BA 4JYEA 3CMFA 1S5NA 4D8AA 3NAVA 2YFOA 4MJ4A 4JTTA 2AGKA 4Q4SA 2BODX 4JEJA 4GYPC 2F7FA 3AISA 1TMLA 1JDDA 4X9YA 2PLJA 3G1XA 4H6RA 4NYUA 2QMKA 3M16A 2MNRA 3C6CA 3I4EA 1PS9A 2WLYA 4U2ZA 2C1HA 2VKZG 4UR7A 1SQ7A 4GZEA 1LG2A 3R25A 1HL8A 3SB0A 1B3OA 1YXYA 4XBKA 3TR2A 1XQKA 1U83A 2VEIA 1EX5A 3MYOA 1RA0A 4LJ3A 2QEZA 1HKVA 4XD5A 4DF2A 5EY5A 4Z0SA 3PZVA 5CPQA 4C7DA 5CPLA 3K8KA 3WK3A 1HW6A 1FX6A 3LBOA 1RQEA 2QVHA 3DUGA 4O0QA 3EAUA 3OA5A 1F8IA 3GDMA 1FHUA 4HPJA 3TOYA 3AMLA 4W8BA 2JEQA 4J3ZA 1Q6FA 2V5LA 4L80A 2AQWA 4LRSA 2HSAA 5AOUA 1S5VA 4GYJA 3A9IA 3VNJA 1OVDA 4IP4A 2G5WA 4HK6A 1R46A 3UJFA 1JYNA 3W27A 3GY1A 2IQDA 5IM51 1X7FA 3W75A 2Z2BA 2E1WA