5L6UA

S. enterica hisa mutant - d10g, dup13-15, q24l, g102a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
233
Chain Sequence
MIIPALDLIGGTVVRVVARLRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISAGNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords HisA
total genus 79
structure length 233
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5l6uA00
1E51A 1ME9A 4UFMA 2WNZA 3EX6A 3VNDA 3WK2A 4IPJA 2YW3A 1SZFA 1P5BA 5HUOA 4JYEA 3NL6A 2DZVA 3NAVA 5DXXA 5K4XA 1LOLA 2C16A 4Y90A 3WJSA 4FIQA 3W85A 2YCEA 3FIGA 2ZRZA 4WQ6A 4NZJA 4FXSA 4GJ1A 2V2CA 4CQAA 3MI3A 4N9EA 4MZYA 4I7UA 3G24A 1M7OA 1N7KA 1WOAA 2V81A 3NPUA 4MFDA 5C5YA 4Z1BA 4GRSA 3QQ0A 3GK0A 1CI1A 4Y6GA 3B03A 5HQEA 3FJLA 3F4WA 2NUXA 5LGZA 1LP6A 5I3HA 1BTMA 1AK5A 4N9CA 4DBEA 2NLIA 3GAKA 1QDSA 4JTLA 2WSYA 2V9DA 4H4IA 1BWLA 3M16A 3G1XA 4OWGA 3FLUA 4Q32A 1HL2A 3NNTA 2TMDA 3P67A 4JTEA 3W75A 1WOBA 1OFPA 2R91A 1HG3A 4YLWA 5DY2A 3M5XA 4WY0B 3HGRA 3FS2A 1PCWA 3TR2A 3RLUA 3O63A 3LCLA 3BV4A 1WA3A 2PURA 1LLZA 4JIPA 1EWEA 3NM1A 3V1PA 1I2PA 3UXAA 3QFEA 3KRSA 4S2CA 1A5AA 3ABSA 3M7WA 4PFMA 4O50A 1NSJA 4AB4A 4ORIA 3NQMA 1K3UA 4AH7A 5AYXA 1MEIA 5TBOA 3S42A 2JK2A 3UD6A 3HIJA 2VEIA 3N73A 1OF8A 4JR5A 4OT7A 4HNNA 5LNVA 3CEPA 3DKLA 4YCPA 1LRQA 2HMCA 5D2YA 1VR6A 5BMWA 3WJYA 2ZA1A 3UNDA 4UFJA 4KFNA 2TPSA 3CB8A 5ABTA 1VRDA 4IWWA 2Z6IA 1MO0A 1W5MA 3L5AA 1KV8A 1I2RA 4GNJA 4HN4A 5EL1A 5DY3A 1H1YA 3W07A 1OFEA 4RR4A 3SI9A 5DN1A 3ABQA 4O13A 4HKPA 3W23A 4GBUA 2NUWA 5TIMA 1XUUA 3KHJA 3L0GA 4PEKA 4NX5A 5F4SA 4W9TA 1RZMA 3TXZA 3D0CA 1H61A 3WK3A 2X30A 2A5HA 2WQPA 4O1BA 4K39A 5K3VA 1T0OA 3GNDA 3ATYA 5D32A 4HT3A 3TE9A 5D2XA 5F2LA 3HGOA 2Y7FA 2B7QA 5FEZA 1G67A 4DO4A 1EB3A 1JCMP 5FF3A 4I9AA 2CLEA 4FO4A 5HWMA 1SW3A 4FIRA 1VHCA 2PRHA 1ICQA 1L6YA 1J4EA 3S1WA 4JX6A 2QEZA 3TKFA 5KZEA 6TIMA 4RLIA 2D73A 3NQGA 2O7QA 2V0TA 2HTMA 3ZR4A 3MYPA 2FFCA 3PAJA 3WK1A 2XFWA 5C2XA 3P80A 3L5MA 1RQHA 4NNCA 3B0UX 1VHNA 3SR7A 4N9BA 3QC3A 3KXQA 3DKJA 1CW2A 1TSIA 2C19A 3G1YA 1DORA 1LBLA 3ZFHA 3TU9A 4MYXA 3T40A 3G1HA 5HULA 1SZNA 4HHPA 3HG2A 3U8GA 4AWSA 4HPJA 4TU1A 1EP1A 3W84A 3G8EA 3HPSA 3NQCA 5KSWA 4O16A 1YDOA 2YFNA 3IEBA 1KTCA 2NV2A 1OYCA 3NO5A 1ALDA 3LRLA 2EKCA 2P10A 3AJXA 3UPWA 2PC4A 4JXCA 4FNUA 3S6DA 4UC5A 3WK0A 3IIOA 3JS3A 1ZAHA 2V2HA 1ZJIA 3QM3A 2ZZ2A 2CU0A 4UR8A 4P2VA 5D37A 1FQ0A 1TV5A 3W72A 4UR7A 5AYZA 3NYZA 3R8RA 4IOTA 4PCFA 4O1DA 3TC7A 4WX2A 3YPIA 1Q6OA 5HINA 3TXVA 4DXVA 3BW4A 1OX6A 3E02A 4MIMA 3B0PA 5C6MA 3MBDA 1TO3A 5EBUA 3IV3A 3ANYA 1DOSA 4K37A 3N2MA 4DF2A 3DZ1A 3MUXA 3EWXA 3IVUA 1WYIA 3S0CA 1KTBA 1PV8A 3PBYA 2YSWA 3NGJA 4RX0A 2I9EA 2EHHA 2FDSA 2B7PA 2G5WA 1H62A 3GZ3A 1L2UA 2JKAA 2DZXA 3HB9A 2WSRA 3L68A 5EMUA 4DO6A 1QR7A 3P84A 2BSLA 3QMTA 1R2SA 3UZ5A 5L9FA 1FCBA 4ML9A 2Y6ZA 1TV8A 1SFJA 1TPVA 3TX9A 1YTKA 5LZLA 5FF7A 3W2LA 2QJIA 4LOCA 1D9EA 3S5NA 2WKJA 3W9ZA 4Z1AA 3NZRA 1ZENA 3KFTA 1IXNA 3GR7A 4GUGA 2NX1A 1G7UA 4XBSA 1NVMA 3OVQA 1Z41A 2GQAA 2ALDA 4UTHA 1W3TA 2GJLA 1LZOA 4UTWC 3TNOA 2FB3A 3I7SA 3GVGA 1VYPX 1JQVA 2IQTA 2WPBA 5DELA 3W2KA 2VFGA 2E5CA 3N3MA 5K7JA 1AW5A 1R47A 3THAA 1OYAA 1G7VA 2YPIA 4M19A 3USBA 6ALDA 3UY7A 4AXKA 1L6WA 4X22A 3VE7A 5D2TA 5CZTA 1VPXA 3CLMA 4CQ9A 1OFOA 1XXXA 3P60A 1AL7A 3OHIA 1QWGA 3ZWSA 3S8HA 3LHTA 3P61A 1JCJA 1EX5A 5HWJA 3BVJA 3LTSA 3QPZA 3BG3A 2OJPA 3SFKA 2B7OA 1QPQA 1LCOA 1X1ZA 3QSRA 1XDLA 2ZA2A 4FX6M 4O0KA 3DI1A 4DQWA 2ZDRA 1H51A 1SW7A 2ZZ4A 4UTUA 5CSRA 3QZEA 1W0MA 3A22A 1ZAJA 4RK8A 5G1YA 3P5YA 1JCNA 3AO0A 3OG3A 1F7BA 3L66A 5AOUA 2H8XA 2WJZA 4IPIA 4AVFA 4C1KA 1BEUA 4UTKA 1DQWA 3NDOA 1THFD 3QF0A 4JTKA 4UCGA 1SSDA 4N4QA 1H7XA 4MZ1A 1YPFA 3B0VC 3GXPA 3HMJG 3C2VA 2ZFAA 3BLEA 1SO6A 1A5SA 4O57A 4UFHA 4JICA 3GKFA 4CNOA 2CLOA 4ZQCA 4WXYA 2QCMA 2XN2A 1H7RA 3ZWTA 1G6CA 2OCZA 3PUEA 4A22A 1OG0A 1KLYA 2V5LA 1FDZA 3NXFA 2I1OA 2VEKA 4G1KA 5AC8A 4BK9A 4LVGA 1G4TA 5AYYA 2QCHA 1TTJA 4A3UA 1PHQA 1TPUA 1GPWA 3NL5A 5F2GA 1GYLA 4RCXA 4S2BA 3CC1A 3SY5A 5LHEA 4ZVJA 2X1RA 5G4EA 4CLMA 1HTIA 3W6YA 4O53A 1JUKA 3W2UA 1Q6LA 2YZRA 2FPTA 1NAL1 1OHLA 1GVQA 2C15A 3CU2A 3NOEA 4A2RA 4E0CA 1LOQA 1KM4A 4UMBA 3TFXA 1P4CA 2RFGA 2QUVA 3M6YA 2CLMA 1VCVA 4O11A 4L4LA 3U2OA 3I7RA 3MI6A 3W7KA 4WJEA 4IXHA 1OFAA 3UQNA 1FCVA 4WOQA 1K02A 4NQ1A 4JS3A 3W2JA 2JBMA 3MP3A 4R33A 4EOUA 1AW1A 1FUYA 4IMCA 3CTLA 1J5TA 3M5YA 1TPWA 5D38A 4Y8FA 1TIMA 2Y61A 4AF0B 3GDTA 1H50A 3IIVA 3QW4B 5K4ZA 1U83A 3MBFA 3STCA 3SSJA 3TCEA 3NEVA 3W74A 1EA0A 4OE7A 4AHPA 1VYRA 2J24A 3M44A 1AW2A 3L0KA 3TAKA 5BRBA 4HSOA 4OQVA 2JGQA 4JN6A 2RH9A 3W7DA 2C1HA 1OX4A 4UTTA 4Y9AA 1QNVA 1ZAIA 1MEWA 1F6KA 2CZFA 4LNYA 1X8FA 4MFEA 4NXSA 1RD5A 2CZDA 4NZFA 3LGEA 4RKAA 2ISVA 3KVKA 3LDVA 4A29A 4BI7A 2DZPA 2NXGA 1EP3A 1OJXA 3T7VA 3IIZA 3LTPA 5CPNA 1GJPA 3IRDA 1OVDA 5C55A 1SPQA 3LRKA 1I2OA 3W1UA 3PULA 1F73A 5KITA 3L5LA 4ALDA 2CLIA 3NQDA 3LCXA 4ICNA 4WXZA 1VH7A 1Z42A 2VXNA 3LI1A 4IJBA 4S1FA 3EWWA 3H53A 2AAMA 1N55A 1ZALA 3LCIA 1C9DA 3QW3A 5F1UA 3M1ZA 4LS1A 3STGA 4X2RA 2X1SA 3S5OA 3Q2DA 1W37A 1JULA 1PS9A 3P62A 7TIMA 2OMAA 5K2ZA 1SZGA 3BPWA 4FNTA 4A2SA 1SO4A 3LXBA 3EKLA 2NWRA 2ZQ0A 1ZHAA 2J9ZA 2A6LA 4IMFA 4I7WA 3EKZA 1YADA 3DFPA 4N4PA 1JUBA 5L6UA 4QM1A 2HS8A 1LBMA 4LUIA 1SU5A 3STFA 1KM6A 2ZTKA 5LNRA 3NVTA 2YX0A 1K8XA 1TPC1 2JKEA 4MLJA 4FXRA 3HOJA 1WDWA 4JDYA 2BTMA 3P74A 4KFOA 5IM51 5T26A 4BWLC 1KM5A 3NM3A 4UTIA 3M47A 3C4UA 1SUXA 2Y70A 3TK7A 2VFIA 4IMDA 2ZRWA 3PB2A 4NJHA 1O5XA 1K8ZA 3P7YA 3UYCA 1P0KA 3NL3A 3W1QA 4OV4A 1B4EA 3PBWA 2FIQA 3L2IA 4UMAA 4FHAA 3C61A 3W7EA 4FB7A 4MPQA 2ABBA 1FWWA 1GWJA 4O28A 2NXHA 4NUWA 3TV8A 1TTIA 5G2HA 1TPFA 5AN7A 1GTEA 3NQAA 4RZ4A 3S1XA 2F84A 3C52A 4ADUA 4Z0JA 2WV8A 3DHDA 1C29A 3OBKA 3G0UA 2EAWA 3R5EA 1JRBA 1VCFA 1EPXA 5U4NA 2OZ0A 3S1VA 1VZWA 2WSQA 3PF3A 4K7VA 3P8JA 2QDGA 5G2IA 1K03A 1M7PA 1YTDA 4LTSA 5AHLA 3LXCA 1T8XA 2DZTA 3LCGA 4NJGA 3L21A 2E6AA 2QKFA 5A8GA 4U4MA 4JD4A 4LC6A 2O7SA 3C2FA 1K7XA 5D04C 5EA9A 3G0XA 3NQVA 1W5QA 4R34A 3TW6A 3IIPA 5LHFA 3SGUA 1VLIA 1UCWA 4MY1A 2Y7EA 3C8FA 4NXKA 5LSMA 4CNPA 2A7PA 3QEZA 1GVOA 3HG3A 3THQA 1XBZA 4DPQA 3TJLA 3DXIA 1H60A 1XUZA 5FESA 3VKJA 2Z2UA 4LS2A 3NZ1A 3O1NA 2VKZG 1W3NA 4O17A 1GVFA 4R53A 2Q3OA 1OK6A 5F4XA 5MHBA 3Q37A 1OFRA 1GYNA 1QO2A 1XL9A 4N02A 2RKXA 2DU2A 3EX3A 1K8YA 2ZRVA 3W1PA 2NX3A 4OBTA 4OHQA 5E0KA 4JTFA 5AC6A 5EPDA 4IMGA 3C2RA 2GVJA 2FTPA 3B8DA 1O5KA 4RZ5A 3T55A 1ZY9A 2R8WA 3E9AA 4HIBA 4LT9A 3ZS4A 3G3DA 4YXGA 1B9BA 5C54A 2X1UA 1TJPA 4NJJA 3UWQA 3W7MA 2GPTA 3W1TA 5IBXC 5FEWA 1YDNA 1IF2A 2ABAA 5CPLA 3E12A 2E1DA 5A5WA 1W54A 4LVAA 1SZEA 5E1QA 3JR2A 3P5ZA 2WNNA 2VFDA 5BNKA 5DBTA 3VE9A 3HF3A 1B3OA 5CPOA 3LI0A 3WJZA 3G8RA 1IIGA 4UTWA 2QUTA 2Y7DA 2HS6A 1KV5A 4JX4A 3LM7A 5KTLA 5AHMA 2PCQA 1VJIA 1WBJA 3O05A 3A5VA 1EUNA 3EX2A 3W88A 2BX7A 4WY0F 3KRUA 2QDHA 1UUOA 3NQ7A 2Q3RA 3KRZA 1J2WA 2A1YA 3W3OA 5LGXA 4WOZA 3SZ8A 4PH6A 2ZA3A 1OFBA 3HG4A 1QOQA 4BR1A 2ZZ5A 4LY8A 4O19A 3LLFA 4IMEA 3Q94A 4PL1A 3TFCA 1RV8A 1TYGA 3ABOA 3TMQA 1UASA 4AHQA 3MHUA 2NWSA 4WY0A 4AHOA 1RVGA 5CZSA 4LS0A 3IGUA 1NF7A 4QNWA 3GDKA 3R89A 3B4UA 1H63A 3EWZA 4LUJA 3T78A 4K36A 3GXNA 4ZL1A 1PCKA 3LHWA 5CZJA 3OIXA 3RF9A 4KFPA 3EWBX 3W7HA 2FLIA 2JKPA 3L67A 3GDMA 5U7SA 1VCGA 2PRLA 5HNRA 1QCWA 1KM0A 3LLDA 2ISWA 1BKSA 2NXIA 1G4PA 1TV7A 3W7LA 3LXAA 3PG9A 4UIOA 3QRHA 5J5RA 2V2DA 3ATZA 4LRTA 2Y7GA 3ELFA 5I3FA 1DHPA 1H7WA 3HG5A 3O07A 1SO3A 4O0ZA 1W56A 3CWNA 2DJXA 3DGRA 4POCA 3TIMA 2PRMA 2VFEA 1W8SA 4EF8A 3O6CA 3NG3A 3PSWA 4L4MA 3GIYA 1JRCA 3P81A 4O52A 2X2GA 3F4NA 3W1AA 1JCXA 4UNLA 2GVLA 5KZDA 3NQFA 1EP2A 3A5FA 4MJZA 1UUMA 2QF7A 4XQ6A 3LV5A 2YW4A 1DQXA 1S5WA 4B5NA 1TMHA 2WNQA 2YFOA 3DFSA 3RNDA 1SSGA 2G96A 2ISSA 3QYQA 1B57A 2NZLA 3LHYA 3KOFA 1FCUA 3W22A 3GDLA 4HPXA 5HUPA 5I3JA 3QSTA 2AGKA 2ATSA 3A23A 3BO9A 3TQKA 2E09A 4ZQRA 2QAPA 5EY5A 3TQ0A 4JDBA 3P82A 1FWRA 4XWUA 4DEFA 1EUAA 3PWAA 4HNUA 2H6RA 3CEUA 4TR9A 4A21A 3PC0A 1R30A 1SR9A 1MXSA 2TRSA 2Q8ZA 4LV9A 4O8RA 4MY8A 2H3BA 1YLVA 4EWND 4FF7A 3BLIA 4ADTA 1O4UA 1JQXA 3LV6A 5CPMA 5BMXA 1UB3A 1A5BA 5EKYA 3M5ZA 4CCCA 5FF4A 3MWAA 3CPRA 1NF0A 2YGYA 4LVDA 4IX2A 4GUIA 4JIQA 1Q45A 1SQ7A 4J9JA 4LRSA 1DBTA 3EXRA 4UFKA 1TPB1 3SW6A 2ZZ1A 2QCLA 4JTGA 4O54A 3DI0A 4OGZA 5HR7A 4GUHA 3GB6A 3MP4A 1UBSA 4TMCA 4U28A 3EX4A 1VQTA 3L0NA 3NL2A 4MYAA 2VENA 1H7OA 3W2NA 1H7PA 3MJYA 1VS1A 3DFTA 3GNNA 5CKSA 4O10A 1JUEA 4PL2A 4IQLA 2Z6JA 1GOXA 3NQ8A 4YMZA 3LHVA 4JX5A 2GUUA 1ME8A 3PBUA 2VELA 1ML1A 3RK8A 1FWSA 3KAOA 3W7RA 4RV8A 2C18A 4MOZA 1AG1O 1JR1A 4XKYB 3W71A 4DELA 2GVGA 4Z0SA 3LCFA 2V5BA 3FOKA 2E6FA 1HUVA 1KFEA 2ZZ6A 1GEQA 2CW6A 3TC6A 1TRIA 4JTSA 1Q6QA 2V30A 3G0SA 3KVMA 3S5YA 4O4VA 1TPH1 1XM3A 1KM3A 1TQJA 1L6SA 2QCEA 1XDMA 2G97A 1SW0A 3O8AA 1TPEA 1IXOA 1H1ZA 3MP5A 3N2XA 3CT7A 1NFBA 3KVLA 1FDYA 3R13A 4UFLA 4QNEA 1XKYA 2BXVA 1YXCA 3A24A 5KMYA 2YDAA 3LRMA 1TRDA 1VC4A 2HSAA 5AHNA 1R2TA 3E49A 2OX1A 2WO5A 1WBHA 4N9DA 1FWTA 4NJKA 2C3ZA 1IIHA 4H6KA 4XKYA 1I2QA 1EEPA 5DXYA 4Q33A 1S5VA 1U5JA 3K30A 2E6YA 4FX8A 2RDWA 3M9YA 1MZHA 3STEA 4Z1CA 3S9YA 3G1FA 3UWWA 5AB3A 1G4SA 4BFAA 1G69A 4K8EA 3LERA 2RHGA 3I6RA 3FYPA 4CNNA 3B04A 1GQNA 2A4AA 1R46A 2H3DA 5G4WA 2DJLA 1XBVA 5AFDA 1OK4A 2H90A 3FA5A 4DO5A 1OF6A 4WUIA 1T99A 1Z48A 1VLWA 3DFQA 3BARA 1C8VA 3BLFA 4JEQA 8TIMA 4UTTC 4WZHA 3VCRA 1QFEA 2DZSA 4E38A 4JNMA 1JCYA 3IGSA 1FWNA 5D09A 1L9WA 1D3GA 4XBKA 3GX9A 1LBFA 4EIVA 1MEHA 1PE1A 2AQWA 3C2EA 5TQLA 3FJ6A 1OABA 4NX0A 5DCEA 1YXYA 4OV9A 2J88A 1IXQA 1F74A 4MUZA 1DJQA 3BK0A 4N6FA 2BLEA 4GE8A 1PIIA 2XN1A 3MHFA 1XI3A 3W87A 1GG1A 4RXGA 2GQ9A 4JTIA 1KFBA 2GOUA 5FEXA 2UV8G 1FXQA 3QMSA 1KBJA 2QUUA 3C0JA 4DF0A 3EWYA 2J9YA 2Q8LA 3CIWA 4PTNA 2C0AA 3W86A 2E5DA 3FKRA 4UTJA 2FJKA 1SFLA 4UMCA 2RDTA 1T96A 4O4WA 4TIMA 2VEMA 3I7QA 3PY2A 3L9CA 5HMSA 1AL8A 1WAUA 4N6EA 3NPXA 3Q58A 4TX9A 5I3IA 4UXDA 4D2JA 2ZTJA 3FFSA 4TMBA 1VYSX 3P8IA 2C14A 4GWEA 1RQBA 1TB3A 3RLVA 3A9IA 4P61A 3RMJA 1ZNNA 2VFHA 3NPWA 4FEZA 2Y63A 1LOSA 2NX9A 2QCFA 1KFKA 3GKAA 3FKKA 3KX6A 4JTUA 3RU6A 4ZQMA 3INPA 4XZ9A 2B7NA 1QAPA 4Z08A 3QQ1A 3LX9A 1IXPA 2Z1BA 5DBUA 1O95A 1QPOA 3O15A 3W7NA 5FF0A 5J5DA 4JY8A 4AF0A 4IXXA 4DBDA 3DENA 5CZ0A 2P1FA 4PA8A 3DHFA 2NV1A 3G1SA 3WJXA 4Y96A 2ATMA 3W7IA 2QJGA 2DP3A 3G1VA 4YL2A 5G1TA 1D3HA 2Y85A 3UPBA 2YXGA 4LW7A 1HO1A 3N19B 1GZGA 3DU0A 1KM1A 1R2RA 3I68A 3W7JA 1V7YA 3PSVA 4MKNA 2CWNA 1N8FA 4RXFA 4UTLA 3GXTA 2FB2A 2VC6A 4ZQPA 5E93A 2F7FA 1Y0EA 2NUYA 2BZNA 1LLWA 3BG5A 2YYTA 4JTHA 4MY9A 4GFSA 1JJKA 1I4NA 4NNBA 3NPVA 4M6PA 1OFQA 4TO8A 4M5PA 3B06A 5EYWA 5KZMA 5LNWA 1RR2A 3BGJA 3PG8A 1HO4A 3DFOA 4R7JA 5D03A 2OT1A 4JYDA 3IGXA 1KFLA 2PE4A 4BF9A 3MI2A 1P1XA 3GR8A 3HPZA 4AAJA 1QPRA 1UJPA 4MLRA 2Y62A 1YXDA 3O6DA 3H55A 1H7NA 1A50A 1KM2A 1IGSA 4FNPA 1I2NA 5H91A 1TTPA 1ZCOA 5AHEA 4LVFA 3IVSA 1XCFA 4K7YA 2B0MA 1OX5A 2A6NA 3N14A 1O60A 2CZEA 3QMRA 4QQ3A 2W0UA 3W1MA 3PR2A 1WV2A 3NQ6A 3EB2A 4ORMA 3GDRA 4K6AA 4JGDA 2FPYA 4YCOA 4QJ1A 2TSYA 2QCDA 3N34A 1VGAA 3EEGA 5BOOA 5DCBA 3SECA 2E5BA 4AEOA 1QO5A 4UFIA 4HNVA 3QPYA 4FNQA 1LRNA 2EPHA 1CX9A 4O1CA 3WFAA 1EIXA 1M5WA 4HNTA 2A7RA 2C13A 3NQ2A 3GLCA 1FX6A 4NT0A 4QAIA 2A21A 1WQ5A 5K9DA 4QISA 3E0IA 2E77A 1YDVA 4GXMA 2XN0A 3UY8A 1PHWA 1RQEA 4JTTA 1W5PA 3FYOA 3TROA 3RFAA 3LBMA 3PBVA 2GJNA 2OT0A 2WOQA 3DFNA 4RZ6A 5DLCA 2GQ8A 1KFJA 3MYOA 1FXPA 4HSNA 4O18A 1QMLA 2A7NA 1TREA 4CCEA 2QCGA 3W1NA 5H2ZA 1M6JA 3W76A 2W79A 3W1XA 3EXTA 4M6QA 4GUFA 1LRTA 2TYSA 2Y88A 5I3KA 4BI5A 3W2MA 1LTDA 5GVJA 1ONRA 3H54A 5HR6A 4UTMA 2QCDB 1Q6RA 3UWZA 3MMTA 3BW3A 1K7FA 2ZZ3A 3F03K 3BGGA 5FI8A 3PVFA 4IX0A 2V82A 1Q3NA 4DPPA 4KKXA 5I3GA 4EF9A 1A5CA 3TMLA 1KFCA 2YR1A 3OEXA 4XTIA 3LOTA 1GVSA 1O94A 5G5IA 1FY6A 4M7SA 3LB0A 4LWWA 5AC7A 1JVNA 2J27A 3UXDA 2DZUA 3ABRA 5G2WA 3QJAA 1LORA 4BI6A 4Q4KA 2VOMA 3S1UA 3W7QA 3DBPA 3HJZA 3C56A 3TW7A 1XBXA 3G3MA 1W5NA 1DKWA 1EWDA 4RJEA 1LROA 3HGJA 1DL3A 5F4WA 3KVJA 5D02A 5CGQA 4K38A 2G95A 2J9XA 2DZWA 4ZMGA 1SO5A 4E2BA 3EWUA 3I65A 4ZQOA 4FNSA 1TQXA 1AMKA 4XUGA 1LDCA 3TAOA 4FX7A 3LHUA 4O12A 3CIXA 2ZCGA 4O15A 4BWLA 1W1ZA 3CWOX 4DF1A 3G1DA 4LU0A 1HFBA 5F2IA 4LV4A 1KLZA 2ZZ7A 3SIZA 3GAYA 2CLFA 5D30A 2Z0IA 1WXJA 5FEPA 1G4EA 3IVTA 5CSSA 3NQEA 5K9XA 1I45A 3A21A 3BG9A 3HQ1A 1F05A 1W5OA 4AWTA 2CLLA 4PC8A 3E96A 3R12A 4M6VA 3TSBA 1TJRA 3MHGA 4EVZA 3LHZA 4AWUA 3C2OA 1WX0A 4ADSA 3VI2A 3G18A 2ZBTA 3PUOA 3C3NA 2QJHA 3DH7A 3SGZA 3O06A 4CQ8A 4LC8A 4O1AA 1P0NA 5LNUA 3OVRA 3PS7A 2R94A 4H3DA 4MZ8A 4C1LA 1PVNA 5DCDA 2ZRUA 2EF9A 4QIUA 1YTEA 3G1AA 2CLHA 4NNAA 3NA8A 5IBXA 1FDJA 5AHIA 3L65A 3M5VA 1ICPA 3IIXA 3W7GA 4MVAA 1FCQA 1GG0A 3DAQA 3W1RA 3O16A 1YYAA 4UNKA 3LCHA 2JGYA 3OA3A 3UZJA 1TCDA 3QH2A 2QAFA 3UWVA 4IUOA 3TJXA 2DORA 1KTNA 5D2VA 4Z1DA 3HPXA 5LNSA 4GUJA 3W7PA 5F1VA 1XBYA 3VFLA 4OU1A 3LCWA 1H5YA 1TTQA 4KWWA 1TPDA 3HGSA 1DV7A 3S5ZA 3UWYA 3FEMA 3W7OA 2BWGA 3SJ3A 3NR0A 4IGHA 1ME7A 1F76A 2VFFA 2P0OA 2FQIA 2ZYFA 2X16A 1KW1A 3TSDA 5F2MA 5AHFA 3R2GA 1W3IA 3PM6A 2FPVA 3GYEA 4JY9A 4N2YA 3CM4A 3BW2A 4ZQNA 5D33A 3LBCA 3JRKA 3M43A 3UWUA 1F6PA 4I7VA 3WJWA 4ZZ9A 3LTYA 1S3HA 4X3ZA 1GT8A 4UUIA 3TSMA 1XC4A 3C6CA 2QR6A 2A0NA 2CLKA 1ICSA 1QPNA 1K7EA 5HWNA 2H8ZA 5FF2A 4FNRA 4K8HA 2C6QA 1OFDA 3OVPA 4GC4A 1MSSA 1GTHA 2B4GA 1QOPA 2W6RA 4O14A 3W73A 3W7CA 1DJNA 1X1OA 4NJIA 3TA6A 4NU7A 3O6YX 3U6WA 1ADOA 4M7TA 1KA9F 2QCNA 3MO7A 1LM1A 4QSHA 5BW6A 4X9SA 1NEYA 1KBIA 4KWVA 2E6DA 3N9RA 3T4CA 4AMAA 3HO8A 1RPXA 3PUDA 1LYXA 1YPIA 4E2DA 2KZHA 2RDUA 2X1TA 2A2IA 3W70A 1I8JA 2J6XA 2VEPA 2QCCA 2YYUA 5CG7A 1F5ZA 4YWIA 3W1LA 3W83A 1XFBA 2ZRXA 4XTDA 2EGZA 3TH6A 3EXSA 2CZ5A 2CFFA 3N9SA 1F2JA 3B05A 1BWKA 5LKYA 3G22A 3HBLA 4PODA 1X7FA 5SWUA 4ONVA 2R14A 3TQVA 3T44A 1S5TA 2I14A 5HJLA 2ZRYA 2LLEA 3F1QA 1JCLA 3V75A 2Y89A 3CHVA 4NVTA 3TDFA 5K9CA 1W31A 1V5XA 3MW7A 1DVJA 3M41A 3EX1A 1GVRA 4JYFA 4MJMA 1OX4B 5D2WA 1ZFJA 3M0ZA 3CQ0A 1PL9A 1X6UA 1A53A 1OYBA 3TUUA 4QITA 2V8ZA 5D05A 4CCDA 5KINA 4LVBA 2E68A 1B4KA 1Z44A 3PB0A 4WD0A 4JTJA 1FBAA 2A85A
chains in the Genus database with same CATH superfamily
2WMFA 5HANA 2OGJA 2QVHA 4UFMA 3V0UA 5H8MA 1BSIA 3T2QA 2E8YA 4V15A 3T09A 3GXFA 4LUTA 4HPHA 4YYFA 3NL6A 2XGZA 1TVNA 2ZICA 4S3CA 4XSMA 3MU7A 3OU8A 3WJSA 3W85A 2YA2A 5TD4A 3CASA 4BQ3A 3ANUA 3G6LA 1RHCA 3GDBA 4AZHA 2G3IA 2V2CA 4CQAA 2OYLA 4XZMX 2GGJA 4I7UA 4MFDA 4Z1BA 4N7QA 4DJFC 3QQ0A 3QY6A 1S38A 1CI1A 3FJLA 1RAKA 3CAVA 1US3A 3MMDA 5LGZA 1C92A 1BTMA 1AK5A 1J9YA 2ZX6A 4N9CA 3PZQA 1V4YA 1BWLA 3G1XA 1QHZA 2HK1A 1ZBCA 1KRCC 2EBNA 3FLUA 4HMDA 4Q32A 1UQZA 2VM8A 4C91A 2XWDA 2HRWA 3W75A 2R1MA 2UY3A 1HG3A 2KAUC 5DY2A 1Y5XA 5CC5A 3C0QA 3ID7A 4I6KA 3LCLA 1ZLPA 4HYRA 3BV4A 1WA3A 1MUWA 4QG8A 3KBVA 3UZYA 3O3RA 3BAYA 3CK5A 1I2PA 4AD3A 5FOOA 1HJUA 3QFEA 4PCNA 2XVPA 5EMYA 2G3MA 4BCEA 1S2WA 3P2VA 1UR9A 4PFMA 2V38A 3MSRA 2NW0A 2HNEA 4HNNA 2F2HA 4QCFA 1NFGA 1WKDA 5CAKA 2MUCA 3AIBA 3WJYA 3TN5A 2GZXA 4Q8PA 3UNDA 4GI9A 2YCJA 1K70A 1V02E 3JU2A 3NDYA 4HNCA 3SN1A 1KV8A 3QZ6A 4HN4A 2BS9A 4Q8UA 1OFEA 3SI9A 1PZ2A 3ABQA 1OIMA 3UA4A 5DRCA 2PDYA 3AWOA 2WMIA 3KHJA 1UA7A 1JI1A 3AMDA 5F4SA 3TXZA 3WK3A 4CN4A 1POKA 4O1BA 2H9AB 3OO2A 4HT3A 4MF4A 1MQPA 3O2LA 1E4NA 1P0DA 5F2LA 3HGOA 3FNDA 2Y7FA 5FEZA 3U4FA 4IG2B 3ARRA 3PPGA 4JTCA 3TP4A 3M0XA 2CLEA 4FO4A 5FJUA 3EEZA 1SW3A 1U1UA 2PRHA 2GSHA 1L6YA 1DIKA 4RDVA 1IZCA 2QEZA 2AAAA 6TIMA 2BMBA 3GBEA 3Q4DA 4HNLA 4H41A 2V63A 3I3BA 3SY8A 1SZRA 3P80A 3MUAA 3KXQA 2FDMA 3EBVA 1LBLA 3ZFHA 1VBJA 3TU9A 3AZTA 1SZNA 4HHPA 2BDQA 3P93A 4HPJA 3K8MA 3TCSA 2Z1XA 5KSWA 4F2UA 1K1DA 1OYCA 1ALDA 3UPWA 5DMLA 2XFFA 3ZSSA 1JZ7A 3A4WA 1ZJIA 4X61A 2VC5A 5D37A 3W72A 3XISA 2GVYA 1GZ1A 4A8RA 1C9WA 5CBJA 4IOTA 4ZO9A 1QI5A 1F3XA 1Q6OA 2OO6A 3B40A 3URBA 1E0XA 1ZBWA 1V8EA 3E02A 4MIMA 1F6YA 4LXFA 4PBGA 1ONWA 1X6LA 1GUVA 4Q4QA 5EBUA 4B15A 3ANYA 4RE0A 5T91A 4WDTA 4K37A 3N2MA 3DZ1A 4K8GA 1P43A 4G7EB 2D0HA 1JDFA 4AX6A 3M46A 1GOOA 3S0CA 1PV8A 2PDGA 2PP3A 4S3DA 3BZGA 3UCDA 4RX0A 3TYZA 4Q4OA 2FDSA 2CKSA 1UZ4A 2WSRA 3FA3A 3SB0A 3KCLA 4DO6A 1X7IA 1QR7A 4HU8A 4QS5A 2C91A 5T8GA 3UZ5A 4DM1A 4DBUA 2XDFA 1FCBA 1WXYA 5T9CE 1TPVA 3TX9A 2JQXA 5EFDA 4B3ZA 1QOXA 4E6MA 4AXNA 1KWKA 1XH2A 3LPPA 3NZRA 4QE1A 2NX1A 3EOEA 3QHMA 1Z41A 4ZFCA 3H4XA 3H4GA 4GG9A 1XIMA 3ITCA 2F38A 4XVEA 1BPLB 5DELA 1LL7A 4E2VA 3N3MA 4ECLA 3THAA 5IDIA 1OYAA 4KH2A 3EGJA 3SRKA 3UY7A 5BWFA 1E9IA 3W81A 2IUZA 5B7YA 4CN1A 3APTA 2YLLA 1A3HA 3SUVA 3UW6A 4F9DA 2QZRA 1VPXA 3GVVA 2ZKMX 1XXXA 3NUKA 1UWUA 3NFUA 1EX5A 5HJYA 3BVJA 2FZMA 1J0HA 3QPZA 3N4FA 1LCOA 4C60A 3QSRA 1J79A 4FX6M 4O0KA 3V5FA 1H51A 3WDPP 2ICSA 2ZZ4A 4UTUA 3QZEA 1ZJHA 1W0MA 5I02A 4XIAA 3L4WA 1ZAJA 3AMCA 3OG3A 1F7BA 5AOUA 2X7WA 4IZGA 1POJA 4PN2A 3NDOA 3QF0A 4UCGA 3VU2A 1H7XA 2XVLA 3GXPA 1PX8A 5CC6A 1E6XM 2OKTA 1SO6A 3CAKA 3GKFA 1UWIA 4ZQCA 5HATA 4FR6A 1X1NA 1G6CA 5GNZA 2EPOA 3ZJKA 4EWJA 5LIWX 1NWSA 2VR4A 2I1OA 3TVAA 4G1KA 1VB9A 4BK9A 1FKXA 2QCHA 4MB1A 1PHQA 2Q02A 3NL5A 2D24A 1YBQA 3VD3A 3EA2A 4XG1A 3ZVHB 1OM0A 1JDEA 4NZ5A 4CLMA 4O53A 3DOPA 1Q6LA 3WY1A 1LWHA 4OBSA 4UNIA 1GVQA 2C15A 3GNOA 2XFRA 4MNJA 1ZZMA 4MAVA 5CXPA 1K9FA 4Z2GA 4HHMA 1XIGA 2P3ZA 2B81A 4L4LA 4PCSA 3TA9A 3W7KA 1OFAA 1L2QA 1K02A 2PDXA 4JS3A 2J7CA 3MCOA 1LL6A 2JBMA 1FUYA 4F0LA 2G0WA 2PLMA 3VKDA 1M1BA 1TIMA 4J3UA 5EMJA 3ES8A 1PWMA 1P0EA 3MBFA 1XW8A 2O4MA 3VILA 4MM1A 1AW2A 2XFYA 2WVTA 1TWSA 1BG9A 4H04A 1V3IA 4HSOA 3QOKA 3RLGA 3AUOA 3NGFA 1DJYA 2G3NA 2CZFA 4FP1A 2ZC1A 2J4GA 4LNYA 1X8FA 1RD5A 3B0YA 3QLLA 2A3EA 1GOIA 3U7BA 4X63A 5FL0A 1KGWA 2NXGA 1NOFA 4P7RA 4PTVA 1OJXA 1SFTA 3S4TA 3LTPA 5CPNA 3VZZA 5C55A 1SPQA 3LRKA 3VDHA 1I2OA 3W1UA 3PULA 3LCXA 3AYTA 5DANA 4HOZA 1JZ8A 3EWWA 2Q8XA 3H53A 4H8VA 1N55A 1V0MA 3ZXWA 1E0VA 4LS1A 3STGA 2AKZA 2X1SA 3EPNA 4IPLA 5A8PA 3Q2DA 2XVGA 2WKGA 3P62A 2OMAA 1JCTA 1H49A 3WQVA 1ZCCA 4GD0A 1SO4A 3GU9A 4IL2A 2J9ZA 2A6LA 4I7WA 3EKZA 3V0TA 1GGOA 2J74A 4XZNX 4AYGA 4EANA 4LUIA 1SU5A 4F79A 3STFA 3AHYA 1P48A 2YX0A 1K8XA 3VIPA 1CNVA 5A95A 2GSEA 1VFUA 3MO4A 4U5KA 3NM3A 4UTIA 3TK7A 2VFIA 4LAOA 1XRSA 3H70A 5E6ZA 1OSEA 3PBWA 4DLFA 4KEUA 3L2IA 3C61A 1QK0A 1B3ZA 1TV3A 1YX1A 5BRQA 2UWFA 5I5RA 1A3XA 2NXHA 3RR4A 5AN7A 3O0KA 4ADUA 2YL8A 2WV8A 3G0UA 3R5EA 1EPXA 1VZWA 2WSQA 3PF3A 2VVSA 3BCJA 5G2IA 1UC5A 2WLZA 3VKBA 2DZTA 1U30A 4NJGA 3PFMA 3C2YA 1RA0A 2CETA 3VA8A 1K4GA 5A8GA 4PUNA 4QEHA 4JNYA 4IIGA 1K7XA 5C71A 4W4QA 1W5QA 3T2OA 4MNMA 1RBLA 5LHFA 4J3SA 1VJZA 4FLOA 4MY1A 2Y7EA 1MWOA 3T0CA 2J7BA 4AZ5A 3BXWA 2A7PA 3HFYA 4JPGA 3THQA 1OEPA 3DXIA 1H60A 3PTDA 3D3FA 2Z2UA 3CZGA 3O1NA 1W3NA 4O17A 2BVTA 1E40A 1M04A 1OFRA 3TYEA 4PRTA 4ZO6A 3N4EA 3WD1A 4OBTA 3VIMA 1UP3A 2OXNA 2I5GA 1CXKA 1VENA 3EDKA 4B2DA 5CSUA 3GNRA 3M07A 4B5WA 2FTPA 3HN3A 2R8WA 4HIBA 4LT9A 4YXGA 1B9BA 5C54A 3TOPA 1TJPA 2J62A 4NJJA 3UWQA 3UFYA 3T42A 5FEWA 4LEQA 5CPLA 5A5WA 4LVAA 4KGJA 3AHZA 3JR2A 1G1YA 3P5ZA 2E7FA 1O1ZA 5CPOA 3WJZA 3G8RA 1IIGA 4UTWA 2QUTA 1DXFA 4EXAA 3PJXA 1KV5A 2J78A 4GKTA 5AHMA 2PCQA 4XIMA 3AYSA 5CCZA 4WCJA 4JL2A 3TLQA 4CD6A 2XSAA 1HKJA 4D6CA 3KRUA 4YTQA 2W63A 2WBKA 2RJGA 1J2WA 3QV9A 5LIYX 2Y5EA 5LGXA 3SZ8A 1HP4A 4I5RA 1B90A 1QOQA 2J13A 3LLFA 4IMEA 6XIAA 4DYKA 1UASA 2Y8UA 5A94A 1T8QA 3T8LA 4DYJA 1NF7A 4GQQA 4Q3MA 3GDKA 4JTQA 3EWZA 3CWHA 2ALRA 2PDNA 1WXZA 1DYSA 2VCBA 5CZJA 2FHFA 4G9PA 4F2BA 3TJIA 1AJ0A 3WG6A 1G0CA 3N12A 3WMLA 2JKPA 3SRFA 1CTNA 3VIHA 4HSHA 3H7VA 5ECUA 5HNRA 3P14A 1KM0A 1UIPA 4R27A 3K5XA 4ZA0A 3B0XA 2NXIA 3B8VA 1QW9A 4AG0A 1SMAA 1GKPA 3W7LA 2P53A 2D23A 3VKKA 4NAEB 5J5RA 2Z1KA 5BZAA 2Y7GA 4ZCWA 1F8IA 3U48A 3HG5A 1SO3A 2EPKX 3CWNA 3DGBA 4POCA 1W8SA 4Q7NA 5F7UA 3PSWA 4PMQA 4RE4A 4EXQA 3F4NA 4UNLA 2GVLA 3NQFA 3CTTA 3A5FA 1UUMA 1CXFA 1XHGA 2QF7A 4XQ6A 4EPDC 2QS8A 4DLMA 1ODUA 5BXSA 1E1EA 4C6LA 3PTQA 4GQBA 1SSGA 4B4HA 1B57A 3FX4A 3RRXA 4BQ4A 1YNYA 2GOKA 2GGEA 1AJ2A 4GISA 3BO9A 3HMCA 2QAPA 3TQ0A 3M0YA 4Z2KA 1TWWA 1GONA 1J8VA 2H6RA 2Y4SA 4M1BA 4GYKA 2TRSA 5BRPA 4HTYA 4LCQA 2H9AA 4PMUA 1DHKA 3LV6A 4KRZA 4FAMA 2O0TA 3QN3A 3TONA 5IXEA 2D2GA 2TAAA 4CCCA 1V6UA 3WL1A 2IKIA 4IX2A 4JIQA 3CZEA 4KW2A 1DBTA 1TPB1 4Q8OA 1A5NC 2CZVA 2YKKA 4UQEA 4A3RA 3EOSA 1R87A 3HZ3A 4JTGA 3DI0A 4OGZA 3S83A 4HYVA 1XYAA 1UBSA 4U28A 3L0NA 4MYAA 2VENA 4E4PA 4RE2A 3W2NA 4A8NA 5H8PA 4I8DA 5D9OA 4V1YA 4IQLA 3CQKA 1GOXA 1EXPA 4YMZA 3WNPA 2DVUA 1ME8A 1HW6A 2MNRA 1XIJA 1E73M 2B31A 3TYBA 3WD2A 1JPHA 4GIRA 2C18A 4GKLA 5A6BD 1XP3A 1AG1O 1JR1A 4DELA 5JUVA 1WP6A 3O0FA 4GCAA 3LS9A 2WSKA 1KFEA 3EB3A 1F9CA 4GX8A 4JTSA 4L1GA 4NI3A 2DEPA 3T08A 3TW9A 4O4VA 1TPH1 2WM1A 2R1LA 2XZ7A 3A3XA 1EBGA 2G97A 4H9YA 3MP5A 3KRBA 1NFBA 4JFUA 3B9DA 1MDLA 3S1GA 1XKYA 4WSHA 1UPPA 1KKOA 2BXVA 4MPKA 2PC8A 1OADA 1YEYA 1TRDA 3N15A 3WQOA 1R2TA 3RDKA 3GTHA 1EJWC 1AD1A 1WBHA 1FWTA 5C2GA 2VC7A 1CEOA 2HQAA 3ARTA 4MB5A 1RCOB 3WN6A 1I2QA 3GVRA 3K30A 2E6YA 1M03A 2FFIA 3IUHA 1QJWA 2WZMA 1REQA 3M9YA 3EPMA 1MZHA 2VD9A 1YNPA 1TZZA 1G69A 2GSJA 4BQ2A 4K8EA 2WSPA 4DNHA 3NDZA 1JEZA 1A5MC 5G4WA 4BEQA 2DJLA 1EO5A 1OF6A 4CU8A 4CVWA 8TIMA 4UTTC 4F0KA 5JMUA 1GQKA 1QFEA 4E38A 4JNMA 3H2MA 4QLKA 4Q8VA 3SM0A 1L9WA 3GX9A 1MEHA 1T41A 2AQWA 3PHAA 5HMDA 3C2EA 4NX0A 3AWNA 4OV9A 1IXQA 2BLEA 4GE8A 4Q4MA 3UGRA 2ANUA 1PIIA 5D4YA 3MHFA 1XI3A 3H2EA 1O6IA 1GG1A 1ZRQA 1GQLA 5FEXA 2UV8G 3QMSA 3W02A 2QUUA 2J9YA 4P7LA 1JZ6A 2Q8LA 1FHUA 3CIWA 1U22A 2FJKA 3EDDA 3KUMA 2RDTA 1RBAA 1ADDA 1KBKA 2ACQA 1AL8A 1HIZA 1WAUA 3BURA 4N6EA 4BEUA 3Q58A 4TX9A 4F0RA 3H6OA 4W8AA 4GWEA 3H7UA 2HXTA 7XIMA 4P61A 3WLNA 1H0GA 2QCFA 3GKAA 2PODA 1HXJA 3FKKA 3KX6A 4ZQMA 3INPA 1WDDA 4OUEA 4XZ9A 2B7NA 3LN3A 4I9JA 3RMEA 3LX9A 4AIEA 1IXPA 2PDBA 2GDVA 3RCYA 1I0DA 4PA8A 3DHFA 3G1SA 3WJXA 5B80A 3G1VA 2WAGA 3M7SA 1XLLA 3P0XA 4LW7A 4PCPA 3T2PA 1UP2A 3T1GA 4PTXA 2QDEA 2FB2A 1PDZA 3WQ5A 2VC6A 4IMAA 1PWLA 5E93A 2F7FA 1IYXA 1JF6A 1Y0EA 1LLWA 2CIPA 4JTHA 3FHAA 4M24A 4PGLA 4L61A 3GVQA 2Q01A 1OFQA 1R9XA 3B06A 3IJLA 5EYWA 5EU9A 4Z2HA 1RR2A 3BGJA 4U5IA 3D3AA 1R6WA 4ATLA 3WNKA 4D72A 3FN9A 4ZTYA 4JYDA 4QLLA 1CECA 1BVZA 3N4AA 3HPZA 1UH3A 3H55A 1AUSL 1A50A 4FNPA 1Q6GA 1TTPA 1LG1A 2YL9A 5AHEA 1QI0A 3ZT6A 4B3LA 3IVSA 3DCPA 3WDQA 3HM7A 1OX5A 3PFRA 2RUSA 3H2FA 5MF5A 1OCJA 1HP5A 2QUMA 4YTSA 1O60A 3L7RA 4QQ3A 2W0UA 1WV2A 3GDRA 4WSJA 4K6AA 3OIHA 4GQRA 1QNOA 2FPYA 4YCOA 4QJ1A 2GQ3A 1PTAA 3G5EA 2QCDA 3N34A 3HURA 2E5BA 4UFIA 2WQDA 1LRNA 2EJAA 4HNTA 1GHRA 4D6EA 2C13A 1D7KA 4DHGA 3CL7A 4PUUA 2DSZA 1AA1B 2A21A 4QAIA 3WLRA 5KETA 2E77A 1VPQA 1YDVA 2BVDA 4CGTA 2XN0A 2G50A 3LD5A 2OT0A 2WOQA 5DLCA 4F3HA 1KFJA 3MYOA 3BOLA 1FXPA 5HAOA 1R85A 4LNCA 1VD6A 1UZHA 1UH2A 4CCEA 1GW9A 1P7TA 3EXTA 4M6QA 1LRTA 5I3KA 4BI5A 3R8HA 2CBJA 1W1TA 5GVJA 1UD4A 1PBGA 5HR6A 4XZHA 4YHGA 3IS4A 4QQUA 3AFBA 1KO0A 2O55A 4PUDA 4IIFA 2PUZA 2RAGA 4FPSA 1Q7ZA 1ODZA 5CQ1A 3ITVA 1BGAA 4KKXA 1HVXA 1A5LC 4U2ZA 3RUBL 2WC4A 3TMLA 3GFYA 3OEXA 3LOTA 4GQ0A 1I60A 1JVNA 3QJAA 3UJEA 4Q8WA 4BI6A 1PAMA 4Q4KA 1BYBA 5E5CA 4US5A 3HJZA 3RO6A 3RM9A 2INFA 4K1GA 3UR2A 1EWDA 3NURA 1UH4A 4YNGA 4LBUA 3T07A 2W62A 3PPFA 3B8UA 1BXBA 4J3TA 2J9XA 4PTDA 1KFWA 1MW3A 3I65A 3RM8A 2XM1A 3LK6A 3WQ4A 1B54A 3SCVA 1LDCA 4FX7A 4TVUA 4EPKA 2ZCGA 3EAUA 5AYIA 4DF1A 3W0KA 3G1DA 5LA1A 3CV6A 1RALA 1O1HA 3G6MA 4PMXA 4PMJA 1Q4NX 3GAYA 2CLFA 5D30A 2Z0IA 1EXBA 3NOYA 4CEXC 2OEKA 1G4EA 4LJ3A 3R11A 2G41A 4XX6A 1FHDA 1F05A 3SCWA 1OD0A 1S5MA 4AWTA 5LA2A 1KD0A 2BY3A 4KRTA 3C2OA 1UIOA 2VQUA 4JTRA 2X09A 2PMQA 2QJHA 3CAQA 1I0BA 4O1AA 1DWJM 2E3ZA 4DJEA 4Z2LA 3AIRA 2ZOXA 4H3DA 1UOZA 2VVNA 4DN1A 1BXCA 2ZRUA 2EF9A 3KCJA 1YTEA 5CAHA 2CLHA 3L2LA 3NA8A 4KEZA 3AS3A 5IBXA 3H24A 2WCSA 4P7QA 5AHIA 2ISDA 2P88A 1NELA 3IIXA 4CD5A 3W7GA 4L65A 1E55A 1XLBA 1YYAA 4HVXA 3WLQA 4UNKA 3QKZA 1NU5A 4I3GA 3HPXA 5JIWA 1NIUA 4GUJA 3W7PA 3RCMA 5EGRA 3VGGA 5FAJA 5JQ9A 3TEVA 2VGIA 3HGSA 1RP9A 3W7OA 3WQ6A 1UWQA 3VDAA 3UP8A 4INFA 2WVVA 2X16A 1KW1A 2Z2BA 4AISA 5AHFA 3R2GA 1W3IA 3PM6A 2NVCA 1KQZA 2GWNA 1C7SA 3CM4A 4G1NA 4NAFB 4ZQNA 4WF7A 5D33A 1YE6A 2J7FA 4ZZ9A 1S2TA 1S3TC 2WMIB 5HK4A 3T0AA 5AECA 2H8ZA 1WUFA 1U1HA 2GJRA 2V5DA 4GC4A 1TWIA 1MSSA 4OECA 1GTHA 4O14A 2W6RA 1R3WA 1DJNA 3K4DA 5I2UA 1QK2A 1IGWA 4TX8A 2BHUA 1LF1A 3MO7A 1LM1A 3WD4A 1JYXA 3E2RA 3BQ5A 1NEYA 4FOJA 5A6MA 4PYSA 5AZ1A 1B9ZA 4HQVA 1LQAA 2I5QA 3N9RA 4Q6XA 1RPXA 1UC4A 3PUDA 3SN4A 3UJSA 1JPMA 3F4DA 1YPIA 3ITXA 2A2IA 3W70A 1I8JA 3RAOA 3CHDA 2YYUA 4S3FA 1RCQA 4AC1X 3E2SA 3PZNA 5MKGA 3ANVA 4QP0A 3W83A 3PZGA 2ONEA 1W3KA 3WLTA 3GTFA 3NSMA 3TH6A 1OCNA 2CZ5A 4R88A 2CFFA 4PMOA 3DIPA 1OT2A 2NQHA 2VMFA 3MSDA 1BWKA 3SDOA 2ADAA 3CUJA 1J5SA 3G22A 2DUZA 2R14A 4MNKA 4JFTA 5HJLA 2ZUNA 3F1QA 2YDSA 4JCLA 3VGDA 2OGYA 3BCDA 2W67A 3ARPA 4NY2A 1GK8A 4NVTA 2HVNA 1W31A 3E0WA 2VRJA 3MW7A 4MG4A 1K9DA 2ZUVA 1DJXA 1OX4B 4MWAB 5D2WA 3D46A 3GQYA 1K4HA 1G5AA 1E6PA 1A53A 1OYBA 4DM2A 5KINA 4NSBA 3L4ZA 1B4KA 4L64A 2PGFA 4WD0A 4HZ6A 1FBAA 2VGBA 4Q7IA 2A85A 3SJ3A 4O1EA 5DX7A 4I8YA 3EX6A 4GI8A 4AD2A 2YW3A 3CAWA 3AUJA 1S1PA 3DESA 3QPEA 2BBFA 3LQGA 5DXXA 5K4XA 1NDVA 2C16A 3VIJA 3U2ZA 3U4AA 4FIQA 3VIFA 3S9IA 3FIGA 2PB1A 4DWSA 5M2FX 2OKOA 3PUGA 1BYCA 4N9EA 2Q6ZA 1WOAA 3NPUA 1JFXA 2CESA 2R24A 3DFHA 2OB3A 4QLJA 5HQEA 4XD3A 1FWAC 2NUXA 4MB3A 2VP8A 4LAZA 5I3HA 2E8ZA 1EHAA 4UOJA 4DBEA 1TFVA 3VNMA 2V9DA 3ABZA 4H4IA 2HBXA 4OWGA 2P8BA 4GH3A 4AWEA 4L4OA 1HL2A 1UZ1A 2DH2A 2TMDA 2ACRA 4NASA 3IANA 2R91A 4YLWA 3VK5A 1EJSC 1Q8JA 2UY5A 4C6EA 2C7FA 2WWCA 1PCWA 4AVNA 5I09A 3V7PA 4JIPA 1LLZA 1EWEA 3SCQA 3EWDA 3V1PA 3UXAA 1E1CB 1H41A 1LJYA 4AZ6A 1RK6A 1A5AA 3ABSA 3M7WA 4FR1A 4IIEA 1NSJA 4G56A 4AB4A 3T6CA 4ORIA 4H9XA 2JK2A 4D6GA 4C6KA 4JL1A 3PBMA 1J93A 5CBIA 3WFLA 4OT7A 1Q66A 3K8KA 4PBEA 1ZJAA 2HMCA 5D2YA 1EDQA 1AFSA 1VR6A 5BMWA 4WRHA 4UFJA 4E2OA 1QASA 4TTGA 5DEZA 3CJPA 1VRDA 3WF3A 4R7OA 2Z6IA 3DFYA 4JOMA 1W5MA 3L5AA 3EA3A 1JDAA 1XG4A 5EL1A 1IR2A 5DN1A 1J01A 4O13A 4C6MA 3W23A 2NUWA 5TIMA 5TAOA 1CGVA 3L0GA 4GZEA 2DSUA 5FJTA 2D3NA 2DH3A 1H09A 1H61A 3E5PA 2X30A 3GTIA 1W9DM 4YU1A 1T0OA 2HBVA 1W9BM 5D32A 1V03A 4DJDC 3ZZ1A 2O56A 1NH6A 3LZ3A 4DWSD 3VOGA 1E43A 1OT1A 3KS6A 1LT8A 5I78A 3HQOA 3UJ2A 1J4EA 3S1WA 3CB3A 2R82A 4GHRA 4PMRA 3ARVA 1W2PA 1ISYA 2FFCA 1FTXA 2DSVA 1RQHA 4NNCA 1KCXA 3OZOA 1VBRA 4N9BA 3MV11 1TWZA 1X96A 3QC3A 3TR9A 3U7VA 4C90A 1H5VA 2DIKA 2E1WA 3GNPA 1QPKA 1V3LA 3NO1A 3G1HA 5HULA 2CWXA 3A13A 1NWTA 1YRRA 1MUMA 1TX0A 2ZXAA 4RW5A 3RX2A 4O16A 3VXGA 2ZUWA 1E4MM 2NV2A 2GK1A 2ZE3A 3LRLA 2EKCA 3AJXA 4QDMA 4QR6A 1A4MA 2Q71A 4UC5A 3WK0A 3CPGA 1ZAHA 4RNFA 2V2HA 1UUQA 2WW5A 2ZZ2A 4IQJA 2QNEA 1TV5A 2Z27A 4YYCA 3NYZA 1SMDA 2Z1WA 1W3HA 4PCFA 4GABA 3VPLA 4WX2A 3YPIA 5HINA 3KTXA 4DXVA 2EJ1A 2QW5A 5C6MA 1SJDA 3MBDA 1S39A 3M6DA 3U5YA 3EWCA 1TR1A 3TTYA 4DF2A 1UA3A 4B16A 1BKHA 4DXKA 4JQ2A 2XU2A 1Q4WA 3TYUA 1EC9A 3PBYA 4DWSB 4H1ZA 4ASTA 4U31A 2I9EA 2BY1A 2B7PA 4ZBCA 1H62A 3ME3A 2DZXA 3HB9A 3L68A 3GW3A 1UMYA 5EMUA 2NLYA 2DT2A 1K9TA 4HPNA 3QMTA 3D47A 1R2SA 2WHKA 3PANA 3CH0A 2Y6ZA 1SFJA 2D69A 3NJ3A 2CXEA 5BOEA 3JZEA 3VDBA 3S5NA 2WKJA 3VMOA 3W9ZA 1PKLA 4XO7A 3GR7A 1NVMA 2ZUSA 3KDOA 1DQUA 1ECQA 3O6AA 2YA1A 4P8WA 2GQAA 2ALDA 3WELA 1W3TA 1ZB5A 4CVUA 3KL0A 2FB3A 1CXHA 1JQVA 2IQTA 2WPBA 1XD0A 2E5CA 5K7JA 1R47A 2FH6A 1G7VA 2VCCA 4M19A 6ALDA 3ZJ8A 1K8CA 4QFUA 1ZP4A 4FALA 4PTWA 5I79A 1VAHA 2WCAA 1CB7B 4D1IA 1YIXA 1OFOA 3AISA 3ZMRA 3LHTA 3B8WA 1U33A 3P61A 5KEZA 5HWJA 3ZLHA 3DG6A 1A0DA 3ZVHA 4IP7A 2OJPA 2VZOA 1QPQA 1X1ZA 4HA4A 1IR1A 2ZA2A 3DI1A 4DQWA 1E0TA 3E0VA 3FA4A 5CSRA 3OGSA 2E9MA 3R8GA 5BOFA 5G1YA 3AO0A 1IHIA 3F5LA 4LX4A 3FYYA 4KIEA 3L66A 1E1CA 4UTKA 2WMKA 4IPIA 1BEUA 1DQWA 2HXUA 1QTWA 4N4QA 4MZ1A 3EKGA 1AH0A 3BANA 4Y9PA 2ZFAA 3BLEA 2YB4A 3SSZA 3VZYA 4OKDA 4H8HA 4WIWA 1VFLA 1GORA 5I3DA 5REQB 2CLOA 2WZHA 3Q67A 4A4AA 2IKJA 2QCMA 2XN2A 1H7RA 3WQCA 5FSEC 5D9NA 4KS0A 4NZ3A 1FDZA 3VD5A 2HISA 1YHTA 2PWVA 3W4RA 3LUTA 1N2VA 3UCQA 1ENUA 3I3DA 1GYLA 2VT0A 4ZVJA 3W6YA 4KT2A 2FPTA 1NAL1 1ONXA 3RCNA 3H4WA 4Z17A 1GOWA 4Z42C 3ZO9A 4AZCB 1X8CA 4UWMA 3GC5A 4OOZA 1YQ2A 4HP5A 4RNJA 1RLCL 3G1RA 1XFCA 3BMXA 4TX6A 3VDCA 1XJBA 4MSSA 1RP8A 2CHRA 3MP3A 4R33A 4EOUA 1J5TA 1TZ9A 1W1B1 4OFCA 2VDHA 3GDTA 1H50A 3SSJA 3NEVA 2XIIA 3LQLA 4W87A 4AZBA 2CNCA 4OJYA 2QV4A 3CMJA 2JGQA 1C8YA 1UPMB 3OJGA 2X05A 3UT0A 4UTTA 2WMGA 1MEWA 2Z1SA 4NZFA 2CZDA 3BJSA 3LGEA 4JN7A 1A4LA 2P50A 1IZJA 5CC7A 1GCYA 3T7VA 3IIZA 4XZWA 1GJPA 3IRDA 4D1JA 1OVDA 1F73A 1E70M 1U5VA 3NQDA 4ICNA 4I90A 4IJBA 2PTWA 3DDMA 1Z9AA 4PMZA 3SCUA 1ZALA 3CHEA 3M1ZA 3U0HA 4X2RA 1CXIA 2WBGA 3RPDA 1L8PA 2ACUA 5K2ZA 2VWSA 3EKLA 1SJAA 3KWXA 1B3WA 2ZQ0A 1EIBA 4YVXA 4N4PA 1T5AA 1EGVA 1Q6DA 3KW3A 4QJ4B 2HS8A 3HJEA 4M8UA 3WFZA 2ZTKA 5LNRA 3NVTA 1B30A 1TPC1 4MLJA 4F48A 3ITLA 4FXRA 1WDWA 1XRFA 4HA3A 4JTDA 2PGWA 1KM5A 2EKGA 1QXLA 2VDIA 2VX5A 2J79A 4IMDA 1KXTA 1O5XA 3NL3A 1ZUAX 3BJTA 2FIQA 4DAIA 1PEZA 4PUEA 2VNCA 4TV6A 1PX3A 1FWWA 7ENLA 2E9LA 4NI8A 4O28A 1S46A 1QUMA 3KM8A 1TTIA 1TPFA 4GO9A 2NQLA 4RZ4A 3S1XA 3N6JA 3NCOA 3OBKA 5LIXX 1VCFA 3DN5A 2OZ0A 3OGVA 4X0NA 3S1VA 1ZBKA 1EYEA 1YDYA 1AQMA 3P8JA 2QDGA 1UP0A 1M7PA 2JIEA 5AHLA 4H8UA 1T8XA 1OC5A 1OG6A 1QNRA 3RM4A 3GIPA 3LCGA 4XZIA 3LG3A 2OQYA 4QTGA 1ZJBA 1C3FA 4U4MA 4J2MA 4E3TA 1RXOB 5D04C 3NIYA 3NQVA 1D8CA 4GIEA 4R34A 3TW6A 3IIPA 3AS2A 1XR2A 2DIJA 4F4RA 1Q7MA 4CNPA 3GBDA 4TQTA 3HG3A 3AC0A 1XBZA 3TJLA 1E9YB 1XUZA 5FESA 1F8MA 3VKJA 4LS2A 5E6YA 3M4HA 3BCFA 3H26A 4GI6A 3BAXA 3BAKA 2Q3OA 1GYNA 3VFCA 1XLIA 3V18A 3N2TA 4QBXA 4OHQA 4WDWA 1HZYA 5AC6A 1XQLA 2O9RA 3CYJA 5EPDA 2WCGA 1MRQA 1MW0A 1VBGA 2GVJA 3VGBA 4RZ5A 3T55A 2I16A 3BMWA 3G3DA 2FZ9A 3W7MA 2FZNA 4A3HA 3W1TA 3LNMA 4CUCA 4XD5A 2Y24A 1SZEA 4C6QA 4D6DA 5BNKA 1GZJA 3VE9A 3HF3A 7TAAA 3NZGA 4ERGA 2QGYA 3TC3A 3KBWA 3LM7A 4GZ7A 3O05A 3A5VA 3MDWA 3RPMA 4YVVA 3F4VA 2BX7A 3NQ7A 2WHJA 1E71M 1E9ZB 1HX0A 3KRZA 4IPNB 4DZHA 8A3HA 2VURA 5IFPA 5XINA 1JGIA 4BR1A 1ZSXA 2CPUA 1TYGA 3ABOA 3TMQA 1YW1A 3DC0A 1FWCC 3S2LA 5CZSA 2VX7A 2PTZA 3IGUA 4CCZA 1N82A 3E0LA 4HCLA 5I23A 3R89A 4D6HA 4BS0A 4UR9A 3A64A 3TYDA 4ICMA 3T78A 3W27A 4ZL1A 3M0VA 4CU6A 4LBRA 1PCKA 4IIHA 3LHWA 4ACZB 3OIXA 1DIOA 3RF9A 3H22A 4KFPA 2D0FA 5IDZA 3CUXA 4J3VA 3RILA 4L6OA 3FVMA 3GDMA 1AZ1A 4H19A 1VCGA 4F40A 2PRLA 2WB5A 5IOBA 1QCWA 4S3JA 4DRSA 2WLYA 4QSFA 3M0HA 1G4PA 1Z32X 1GYMA 3K13A 3POCA 4WKHA 2QF8A 1PZ1A 1A80A 5I3FA 1DHPA 2REQA 1H7WA 1U5HA 3THDA 3W24A 3O07A 4K2SA 3WLKX 3T9PA 4ZXOA 1W56A 3TIMA 1EZ2A 1DWAM 4H8NA 4AZGA 4EF8A 3NG3A 4MKVA 4L4MA 1JRCA 3BSHA 4RV3A 2OODA 3MSYA 7CGTA 3LV5A 2PFHA 2YW4A 3AJ7A 1TMHA 4CQCA 2ISSA 2HROA 3LHYA 4NYUA 3W22A 3N1AA 1GOQA 2PD5A 1L0PA 3II1A 5I3JA 3QSTA 2AMXA 3AS1A 3GHTA 4ZQRA 2PF0A 4JDBA 5FCZA 4MWAC 3PWAA 3ENLA 1R30A 4KCWA 3WLHA 4GO8A 5FKYA 1E3ZA 5A2CA 1YLVA 3BLIA 3A3HA 4ADTA 4EKJA 1O4UA 3I3EA 3AU2A 5D9PA 5CPMA 2PU0A 5AVHA 4LY4A 4GJJA 3M5ZA 7PTDA 2QLYA 4GPNA 3CPRA 3BJFA 2YGYA 3M0LA 2J7DA 4LVDA 1SQ7A 4J9JA 5EMLA 4UFKA 1AVAA 5DQPA 3OYZA 3MTWA 2KX9A 1ESWA 3SCTA 4QGCA 5I07A 3W00A 4QEEA 2Y2WA 1MNZA 2X40A 3DYMA 2BP1A 1MXGA 4YTUA 4KMQA 3MJYA 4IL0A 5FSDC 1N8WA 3GNNA 4MWAE 4FZIA 1LWIA 1XV8A 4O10A 4PL2A 3NQ8A 3PBUA 2VELA 3KAOA 3BUVA 2C0HA 3WBEA 2J7HA 6REQA 1SJCA 3GG1A 3MZ2A 4XKYB 2GVGA 1W91A 3VCCA 4X0VA 3HU7A 1FH7A 2E6FA 2ZZ6A 1EGZA 2E67A 2FH8A 4AY7A 2V30A 3G0SA 3KVMA 1UKOA 4LYRA 1XM3A 3MVTA 1TQJA 4ACZA 3O8AA 4QROA 2Z26A 3DEQA 1WZAA 3CT7A 3SUWA 4UFLA 3R13A 3R43A 3RO8A 1RY0A 4DXXA 1LUCB 3LRMA 1B2YA 5ABEA 1D3CA 1EF3A 1QVBA 4N9DA 3E5BA 4HBKA 4NJKA 1IIHA 1JYNA 1J0IA 5DXYA 1S5VA 4HHLA 1E72M 1RLDA 4Z1CA 2Y5SA 4GYPA 5AB3A 1G4SA 2RHGA 3I6RA 4D71A 3B04A 4LCSA 2A4AA 2H3DA 4FLQA 3SCNA 1XBVA 4QRNA 1OGGA 5GNXA 2PDWA 3FA5A 5FD0A 3S46A 4DO5A 3OZMA 1C91A 1T99A 1BYAA 1Z48A 4QAWA 1TA3B 4N0RA 3BLFA 4G8TA 4JEQA 3UJRA 4UQ9A 1JCYA 5A8MA 4XBKA 2C79A 4PFHA 1PE1A 5TQLA 5DCEA 2D2JA 1TG7A 1AD4A 3I10A 4N6FA 3M64A 1RK5A 2IQ0A 5AC5A 2ZIDA 3T0DA 2XN1A 3QV8A 1BRLA 3TZNA 4RXGA 2GQ9A 1EHNA 1HKMA 4ZOAA 1W3LA 2YDRA 2R1PA 2R6OA 2IPGA 5I06A 3W86A 3FKRA 3IAQA 1FFRA 4UMCA 3UJFA 1CT5A 4RUBA 3UZXA 3I7QA 1KQYA 3PY2A 4DZIA 5E70A 5HMSA 4AIUA 3ALGA 4GZJA 3QY8A 5BWAA 4GK8A 2P0IA 4UXDA 3KZPA 4BQ5A 4DZ5A 3WQGA 4TMBA 1VYSX 3P8IA 3ONCA 1TB3A 3RLVA 1KFKA 3DUGA 1TKKA 1XCWA 1A49A 1A5KC 4US5D 3UYIA 3A9BA 3DG7A 3RU6A 4PEEA 4PR4A 1GHSA 4E4FA 4IP5A 5FACA 5J5DA 4JY8A 4IXXA 4DBDA 3LNPA 3WYZA 2P1FA 2FVKA 2GWGA 2WJEA 4H2HA 1WE5A 4ZSUA 2O9PA 3REQA 2Y5JA 3W7IA 2DP3A 4YL2A 3SFWA 4IFKB 1XYFA 5G1TA 3UPBA 2YXGA 1HO1A 1GZGA 2GJXB 3H12A 4PZVA 1R9ZA 1V7YA 4UTLA 4C6CA 1IEIA 3GXTA 4K1WA 1S5NA 3IV8A 2XPKA 1PZ3A 3COTA 4C6IA 4ZQPA 1TR9A 2CCRA 2YYTA 3BG5A 4DJEC 1I4NA 3NPVA 2PDKA 1KRAC 5EBAA 4OBRA 1HJSA 1L6FA 3AYRA 3SQMA 3WEMA 5EB8A 2OT1A 5AY7A 2XH0A 3PAOA 1MZRA 2J75A 1DWHM 4BF9A 3MI2A 1P1XA 4AAJA 3BH4A 1UJPA 2Y62A 1KGUA 4IICA 4RPPA 1YXDA 1R3VA 1JI2A 3WEOA 1W1YA 1H7NA 3W37A 3VIOA 1KM2A 3OLIA 1WDPA 4YIWA 3OP2A 4MMWA 1XCFA 5C2CA 4K7YA 2B0MA 2CZEA 3BDKA 3QMRA 3DX5A 2GDUA 4ILSA 3PR2A 4PUJA 5G1MA 3EB2A 1CB2A 4PB5A 4IJRA 5HBFA 1CBGA 2HJPA 2XJ7A 4AEOA 1E6ZA 1B0IA 1J96A 3QPYA 2EPHA 3L4XA 3BOXA 4HGXA 3WFAA 1M5WA 4M29A 2YBTA 3WD0A 3NQ2A 1JFHA 3CH9A 3GLCA 1C7TA 3IK4A 3OW1A 1TMLA 1FX6A 4NYYA 1KCKA 1YPXA 4ZTXA 3TYCA 2W4XA 1Q8AA 5C7VA 3KHDA 2WZIA 4PRWA 2Z24A 1EC7A 3RFAA 3UVIA 3DFNA 4RZ6A 4QJ3B 1I6NA 2GQ8A 3VUSA 2DZBA 4WHBA 3ARSA 4AUBA 3A12A 1TREA 2BY0A 3W1NA 2VGGA 4WEVX 5H2ZA 1XQKA 4S3AA 1GQJA 3V3WA 2BODX 3PNZA 3PN8A 3W25A 5HA7A 2D3LA 3GXMA 1OQFA 4KPLA 4UTMA 2QCDB 4IGNA 1K7FA 3F03K 1M68A 4Q4PA 4IX0A 2WJDA 2J47A 1ZTVA 3CGTA 3URNA 1A5CA 2YR1A 2F6XA 1Q6CA 1R3TA 1O94A 4KCUA 4TV5A 4M7SA 1CIUA 2J27A 2Z4GA 5G2WA 3IJ8A 3OODA 3UA3A 1TUXA 1UHVA 2V5CA 3BLLA 3WLLA 5BCAA 1V3HA 2OFJA 3C56A 3TW7A 1PKYA 1W5NA 1WZMA 4LSBA 1F3TA 4RJEA 5D02A 5CGQA 3FGCB 3ONBA 2DZWA 3MMWA 3WX7A 1OZMA 1SO5A 2VI0A 1JXJA 1DIEA 1TQXA 2CBIA 2YXXA 2G37A 3C0LA 2AMGA 2W91A 3LHUA 4ZR8A 4O12A 4O15A 1EPVA 2SFPA 1S2CA 5F2IA 1HFBA 4LV4A 1KLZA 2ZZ7A 3SIZA 1NTHA 1US0A 4ZOCA 1E5NA 1WXJA 5FEPA 3CYVA 1XIIA 1GVEA 4J40A 5CSSA 2OYMA 3MVIA 3NQEA 1I45A 3A21A 1ELSA 3HQ1A 1W5OA 2D22A 2ASHA 3GXIA 4MB4A 1WX0A 3SY1A 4ADSA 2YLAA 3G18A 2ZBTA 3PUOA 4LC8A 5HOSA 3VGFA 4GZIA 5LNUA 4C6DA 2HNHA 3GY1A 3WBYA 2OZ8A 2V5JA 4C1LA 1PVNA 5DCDA 4QIUA 1BG4A 2Y1HA 3LYEA 4NNAA 1FDJA 1CPUA 3L65A 1GG0A 3DAQA 5DMMA 4QJ5B 2C1GA 4B91A 1B1YA 3LCHA 3BOFA 4NKCA 2JGYA 3UZJA 2V3GA 4DWSC 3UWVA 3R0KA 2A3CA 1EKOA 1X97A 3HQPA 3WH7A 1XLGA 3GIQA 4JIEA 2WXDM 5LNSA 1E4IA 1XBYA 1MQQA 3ALFA 4B5UA 4OU1A 4GNVA 3QV6A 4S23A 1TTQA 3CPUA 3H2CA 2BWGA 3BMVA 3NR0A 4IGHA 4JHZA 1QNSA 3A3WA 1PJ9A 3SCRA 3TSDA 3UERA 4P8VA 3VOIA 3WQPA 2GJPA 3GYEA 3EMCA 3VAVA 1IEXA 2ZUMA 3CL8A 3BICA 3F5KA 3LBCA 3M43A 3GD6A 3DC8A 4QDWA 3WNMA 2A3LA 3WIJA 1DWGM 4HCDA 3WJWA 1S3HA 4ICCX 4X3ZA 1GT8A 5A2BA 4H7CA 2QR6A 1ICSA 3I6TA 5HWNA 3OVPA 3S2NA 2INZA 5G4HC 2I56A 1A0EA 4U3CA 1EGMA 3U6WA 3WENA 3P3BA 1KA9F 1V0NA 3B8TA 3PBGA 3UF9A 4QSHA 4KQNA 1BSLA 3U9IA 4NAFA 4AMAA 3NXLA 2CITA 2KZHA 5I24A 2RDUA 2J6XA 3NSNA 2WYSA 2QCCA 2OWCA 3R79A 5CG7A 5E09A 1F5ZA 3WF1A 2NQJA 3IARA 4HPGA 1CZ1A 3B97A 2ZRXA 2F6KA 1V51A 3EXSA 4Q8MA 2WC3A 1EF2A 4AEFA 4LYKA 2NV9A 3B05A 5LKYA 4PODA 2MANA 4ONVA 3TQVA 1XH1A 3MWCA 2Z2AA 1S5TA 2I14A 3QGVA 2ZRYA 3MUZ1 1JCLA 3HFTA 1WZKA 3TDFA 5K9CA 1VIZA 1OC7A 3SGGA 4I5XA 4US6A 1GVRA 4JYFA 3NWRA 5I6SA 1E3XA 4MJMA 2W3ZA 4J7RA 2QJMA 4GIYA 2PDMA 3DERA 2POTA 4G5DA 4LF2A 4ACYA 4QITA 2V8ZA 2OR2A 5D05A 4CCDA 1VIWA 4LVBA 3AMKA 3GC4A 3PB0A 5BU9A 4JTJA 1VRXA 3W6LA 1YNQA 3N17A 3PJTA 3APYA 1E51A 2BFGA 1U2YA 5C9ZA 2WNZA 3VNDA 3WK2A 4LCRA 4IPJA 4LB3A 1P5BA 1AODA 1PDYA 5LIKX 5HUOA 3V36A 2DZVA 2VC9A 3NAVA 3AIVA 2FTWA 4Y90A 4KWOA 2YCEA 2BV9A 2BHYA 3OPSA 4WQ6A 4NZJA 4FXSA 3QKEA 4GJ1A 2PDHA 1X39A 3MI3A 4GC3A 2WANA 1N7KA 5FA5A 5C5YA 1UR1A 3LPOA 4GRSA 4DJED 3USZA 3GK0A 4Y6GA 3IK2A 4PSRA 1LP6A 1KWGA 3OQEA 2OU4A 3ARXA 5TF0A 4JFSA 4C6OA 3CLWA 2FVLA 1VJSA 2DSKA 3PJUA 3G2GA 1VFMA 2PZ0A 4R5EA 3NNTA 1X98A 3P67A 1TUFA 4B9YA 2PLJA 4W7WA 1WOBA 4NHVA 4GY1A 4QG9A 4GXWA 3M5XA 2ZX8A 4WY0B 2VCAA 3UR7A 3HGRA 3FS2A 5FAGA 2R9RA 2IS7A 1BAGA 3O63A 4JFWA 3SUSA 2VRQA 3V1HA 2PSNA 3WUGA 2QPXA 3NM1A 2JFEX 1XLDA 4S2CA 3WL0A 3DG3A 4BF5A 1GOKA 3UZZA 4O50A 2E0PA 3DBNA 3S42A 3QY7A 3UD6A 3HIJA 1OCQA 1SYTA 4JR5A 5XIMA 5LNVA 3WSUA 1Z7AA 2XIMA 1A5OC 4ZO8A 3PTMA 4J35A 4RDYA 2ZA1A 1VFOA 3GH4A 3CB8A 3SADA 1B5TA 4XO6A 3BC9A 4H6QA 1E6RA 1P6WA 4IWWA 3VCNA 2J7GA 1MO0A 5E0CA 1E6SM 1ZQ5A 4J3XA 1LUCA 1XYBA 4ZB5A 1HGYA 1VFSA 2W9MA 5DY3A 3WLSA 1H1YA 2YDQA 3V5OA 4J28A 3MANA 1XUUA 1C8XA 2DPEA 4HD5A 1RD6A 3EOLA 3QZAA 3U3HA 3A4JA 3L4VA 2W92A 3U5UA 1FWGC 4PEKA 2EEXA 1VFTA 3K4AA 2XZ9A 1RZMA 3D0CA 5DF0A 4LAMA 4GX9A 4K39A 1CGUA 3GNDA 1K9EA 4KWUA 3TE9A 3TTQA 5D2XA 1ADSA 4O1FA 1G67A 4DO4A 1RVKA 1W1PA 3ABXA 4P5UA 1JCMP 5FF3A 5C9UA 4E8CA 2WNWA 5I03A 2XGBA 3W38A 3UCCA 4PSPA 5H1WA 4C1NA 3GU1A 3UNTA 1Y8BA 1PXGA 5KZEA 4KRUA 4I5UA 2YL5A 2D73A 3OQ8A 4HJFA 2O7QA 3UU0A 2HTMA 1GOMA 3MYPA 3PAJA 3WK1A 1RSCA 2VZUA 1VHNA 3SR7A 3ZSTA 2OOFA 4Q4RA 2NSXA 3WQ8A 5HNNA 5C9WA 1XLCA 2IPFA 2C19A 3G1YA 4DX3A 1E6NA 3GU2A 1DORA 1JYVA 4MYXA 1V93A 3T40A 4Q8QA 1A5UA 3QYSA 3U8GA 4OTKA 3BLDA 1EP1A 3W84A 3G8EA 3NQCA 2J77A 3AI0A 4MADA 1B3XA 2YFNA 3IEBA 1KTCA 3OBAA 2P10A 4WDXA 2JEPA 2PC4A 4JXCA 4FNUA 3S6DA 3TN6A 3IIOA 3QHOA 3AAMA 3QM3A 4DYEA 2CU0A 4UR8A 1F61A 1FQ0A 1J11A 2OLHA 4UR7A 4BHYA 1CYGA 7REQB 2V3EA 3R8RA 3LEPA 5E9XA 4O1DA 4TVDA 4Q4SA 4UOZA 1AZ2A 3AXXA 2BXYA 2WK2A 3B0PA 2DT0A 3QC0A 3A4AA 3IV3A 4W7VA 1FWDC 3K46A 2Z00A 3MUXA 3UEQA 1M7XA 3WDJA 3EWXA 4H9VA 3IVUA 4KEVA 4GOAA 2FHBA 3VMPA 3GHUA 5HQMA 2DT3A 2YSWA 4WKAA 3HA1A 3IUDA 2EHHA 3E6EA 4L1WA 3OLDA 2G5WA 4L4PA 2JKAA 3H2AA 3SUTA 4GGHA 2DVXA 3RJYA 3P84A 4LUTB 2BSLA 3WQFA 1BQCA 4DUVA 5L9FA 3MS8A 2JEQA 3FK4A 3WMSA 1TV8A 3LENA 5LZLA 3OG2A 3TLLA 3W2LA 2QJIA 4J2PA 3TWBA 4LOCA 4Z1AA 2V69A 3KFTA 2P76A 1XYCA 4XBSA 4GUGA 1G7UA 3N6HA 3K4WA 3VC6A 3TNOA 4AQLA 3GVGA 3W2KA 2VFGA 4JFVA 1AW5A 5FJIA 4C6BA 2YPIA 3AROA 1RJQA 1L6WA 4BZYA 2NQ9A 5D2TA 2XIQA 1V6VA 2E40A 3L2MA 3P60A 3ZWSA 1QWGA 3S8HA 3N9KA 4UQAA 2A3AA 4LBSA 3VMNA 3ITOA 3LTSA 1PIGA 2VYOA 3SFKA 2B7OA 3U2EA 2ZDRA 1SW7A 4R9OA 3VD7A 4IM4A 3VX1A 3WMBA 3VVGA 2OSYA 2CHNA 4RK8A 2PDQA 3FDKA 3P5YA 5E9AA 1BHGA 3FXYA 4A8LA 2H8XA 4AVFA 4XD6A 4LUSB 4C1KA 2AKMA 3VGHA 3I4EA 3BLOA 1TE6A 1BYDA 1YPFA 2FMNA 3HMJG 4UZUA 4RDWA 3QR0A 2QIIA 3CS2A 3ZWTA 4WVXA 2G4JA 3ZR5A 4A22A 1KLYA 5CEWA 2OX4A 1OGSA 1G4TA 5AYYA 4A3UA 1TPUA 2D20A 4JIRA 3AXHA 1GPWA 1L6GA 4S2BA 4YTRA 5EMMA 2I17A 3A4XA 5G4EA 1HTIA 1H3GA 1JUKA 4PUMA 2YZRA 4REQB 2VR2A 2IW0A 3U57A 3CU2A 3NOEA 2XSXA 4A2RA 3FSUA 4E0CA 1S2VA 1TCMA 1BD0A 2J8TA 3TFXA 1P4CA 2XWEA 3M6YA 4IQEA 2CLMA 3VABA 4O11A 3U2OA 3I7RA 1CGYA 2ZX9A 4DUXA 4WJEA 4NQ1A 2OSXA 3W2JA 3E1F1 1AW1A 3CTLA 1GJUA 2AL1A 3QR1A 1TPWA 3N2BA 2F8QA 4AF0B 3FV9A 3QW4B 5IHRA 2ZVIA 1U83A 2NT0A 3STCA 2FKPA 1VYRA 2J24A 3LLXA 5IHSA 5BRBA 3EYPA 1MFVA 2ZWYA 1IZKA 1Y65A 5XIAA 1XYMA 3W7DA 2C1HA 4LEFA 2VDGA 4ZENA 2Z29A 3SRDA 1OX4A 4YVPA 1FP8A 4Y9AA 1ZAIA 2G3FA 4MFEA 1P0BA 4RKAA 3H23A 3LDVA 1JF5A 3ZLGA 4JQ1A 4ZOEA 3N04A 4NAEA 4R9XA 2CLIA 4WXZA 3B4YA 1VH7A 2QQ6A 4D6IA 3LI1A 2ZUTA 3WLMA 4S1FA 1UD8A 2AAMA 3LCIA 2XHYA 3QW3A 3VNJA 3S5OA 1JD9A 3TN4A 1W37A 1JULA 1PS9A 2IQDA 3CHFA 2GUYA 1KXQA 3QTGA 1BRLB 4ZE5A 3WDIA 5ECVA 1HGWA 1ZHAA 1E4LA 4IMFA 4W84A 4D6FA 4EP8C 1JUBA 1NQ6A 1KM6A 2VRKA 1ECEA 2XH4A 3M0JA 4PULA 2EPLX 3PZUA 2X7VA 2BTMA 4KFOA 5IM51 3GVWA 2OWXA 2YCIX 4URIA 3S6TA 1PX4A 1A0CA 3C4UA 1SUXA 2Y70A 4Y7EA 4A3YA 4HMEA 1AQ0A 4AZIA 3PB2A 3W1QA 1B4EA 3E38A 4LH8A 4UMAA 4FHAA 4S3KA 3HTWA 4FB7A 2ABBA 1GWJA 3OVGA 4GFIA 4O0QA 4Z0JA 3DHDA 5CPQA 2VOTA 5A6KA 2EAWA 1JRBA 3MJMA 5U4NA 5CJNA 3DYPA 3CXOA 4K7VA 2Z7KA 4H7VA 1K03A 4CQBA 1JYWA 3LXCA 2QGHA 1UROA 3L21A 1Q2SA 1ITCA 2E6AA 5M3WA 3S9ZA 2QKFA 4W5ZA 3SBFA 3VOJA 2QMJA 3FXGA 4HHHA 3V5CA 1JD7A 4LC6A 3KP0A 3C2FA 5A8QA 4C5YA 4UQBA 1IT0A 9CGTA 3BTNA 3R6IA 4XZBA 1V02A 1B3YA 4YJ5A 2YCLB 3UG5A 4NXKA 5LSMA 1FP9A 5CC3A 1TZ7A 4EX4A 3WQEA 2QV5A 2J8FA 5EFFA 4CNSA 2WZTA 2PPGA 3IJ7A 4MNLA 2F2KA 4DPQA 1W17A 1KBLA 4RZBA 4DJFA 2QPUA 4MWAA 1GVFA 3QLDA 1OK6A 5F4XA 3Q37A 5FL1A 1XL9A 2ZWZA 2GGGA 4N02A 2DU2A 2IPWA 2ZRVA 1WAWA 3D5HA 3QR3A 5E0KA 2VWTA 2YIHA 3PP7A 2GDQA 3B8DA 3IRSA 1O5KA 1ZY9A 3ZS4A 3LU2A 1EYWA 3OZYA 3TJ4A 2OEMA 3FJ4A 1IF2A 1UKQA 4QXIA 1W54A 4HYWA 2VFDA 1F4HA 3T0BA 5DBTA 1V0KA 1B3OA 3LI0A 1AQHA 1NDZA 2F9RA 2Y7DA 2HS6A 1KCZA 3KLKA 3LPFA 1VJIA 2XIBA 1WBJA 4HOWA 1EUNA 3JZUA 4V1XA 3W88A 1GVYA 4WY0F 2FZBA 4UTFA 4H2CA 2Q3RA 1D2KA 3XINA 1KXVA 3W3OA 2ZADA 4WOZA 1QHPA 4PH6A 1O5QA 4ZB2A 3F2CA 1BXNA 1Q13A 1UZDA 1RV8A 1XLEA 4FOUA 3O7UA 1OWQA 2NWSA 2OO0A 4CKQA 4QNWA 4AX7A 2IPJA 1H63A 1UG6A 5CLWA 4K36A 1FOBA 1IE7C 5C8BB 3EA1A 3MT1A 3IACA 3EWBX 2DIEA 3W7HA 3C8NA 3N3TA 3PTKA 3S2JA 3ITYA 2ISWA 3AHTA 1BKSA 5DT7A 1TELA 1E6QM 2OLSA 4QDPA 2D2OA 2V2DA 3ATZA 4LRTA 2ZX5A 4QE4A 4LUYA 4DAFA 3WNOA 1OGBA 1P1MA 3MY9A 3P81A 4O52A 5FIPA 3B9OA 3FW6A 5KZDA 1EP2A 2HDJA 3WNNA 4MJZA 2DZAA 2F6UA 1QW7A 1XISA 1DQXA 1S5WA 2YFOA 1HL8A 2O9OA 4PMYA 4OIFA 3VIIA 3RNDA 2BOGX 2G96A 3F4CA 4IFKA 3MUY1