2CLIA

Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
258
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 101
structure length 258
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cliA00
1EP3A 1GPWA 5LSMA 4RK8A 1ME8A 4O4WA 4D2JA 1GYLA 4NJHA 4O1DA 1ZAJA 2B4GA 3ELFA 3W22A 2YW3A 1FDYA 1GVOA 2FPVA 2YZRA 1B9BA 4IUOA 1JCMP 1TREA 3SECA 2CW6A 1JUKA 2OT1A 1C9DA 3FYPA 4P61A 1K7XA 1ALDA 2BLEA 4ZQRA 2X1SA 3TAKA 1W56A 5TIMA 3A5FA 3CIXA 3DFPA 3M6YA 3HGSA 5I3HA 1KM6A 5AHLA 1VYSX 2FDSA 3C2RA 3CWNA 3NQCA 4O11A 1F73A 1OFOA 4IMCA 1TJPA 1OYBA 2Z2UA 3S5ZA 1TJRA 1UCWA 2ZQ0A 3DZ1A 5AC6A 3MBFA 3EWBX 1EWEA 3W9ZA 1LLZA 2Y7EA 3TC6A 3MUXA 2DZUA 4QITA 2AGKA 2O7QA 3THAA 3LCLA 4FNPA 4ZVJA 3MO7A 1TO3A 2ZZ5A 1OF8A 2E77A 2Y7DA 5G2WA 3O8AA 5LZLA 3G3MA 3W7KA 4HNUA 1P0KA 1KM3A 1MO0A 3TFXA 3QMRA 4C1LA 1Z44A 1YDOA 4JY8A 1LROA 4PODA 1OHLA 1KTCA 4NNCA 1WQ5A 1AW1A 1H60A 3R8RA 2TPSA 1UB3A 1DVJA 2FQIA 1OFBA 1SSDA 3JS3A 3I68A 3HIJA 4KWVA 2Y88A 3H53A 1FCQA 3TX9A 2Y89A 1ME9A 4AHOA 4OBTA 4UIOA 4NJJA 1QMLA 1TPEA 3MYPA 4O0KA 3TIMA 1ZHAA 5DCDA 2A6NA 5K9DA 2I1OA 1VHNA 3B8DA 3PULA 1RZMA 4RR4A 2QCMA 1R30A 1GVSA 3W23A 4DELA 4BF9A 4M7SA 4QNWA 2V0TA 4NU7A 2A2IA 3QMSA 1WBHA 4GWEA 3N14A 3IIPA 1BWLA 3U8GA 1ADOA 2ZA2A 1LORA 5FESA 3PF3A 4FNTA 3EEGA 3O05A 3TQKA 3UXAA 3GDLA 2VKZG 4O19A 3STEA 1F6KA 5DELA 1JCYA 4RXFA 3LHYA 4TU1A 1WXJA 4JX4A 3QW4B 1JCJA 5EY5A 3C3NA 3THQA 2G97A 3VE9A 4O18A 3QFEA 3QQ1A 3CEPA 4CCDA 3BVJA 4IMDA 2E09A 1LOQA 5HINA 5CSRA 2DZTA 5AC8A 3NQ2A 3G3DA 4NJIA 2Y7FA 4I7VA 4KFPA 1CX9A 3A5VA 1TTJA 4XTIA 2ZA3A 1EIXA 2ISVA 3CWOX 1WX0A 1YYAA 3S1VA 2R8WA 1Q6QA 2NXIA 3LXCA 3A22A 1ZALA 1IXQA 5EPDA 2J27A 5FEZA 1E51A 1IIHA 1IF2A 5SWUA 1VCFA 1KLYA 4M6PA 4DPPA 3NQAA 4MYAA 3L5MA 4KKXA 3CQ0A 3EX1A 1B57A 2XN0A 1P0NA 1VH7A 2DJLA 3FA5A 1TRIA 4GUGA 2BZNA 1TYGA 2QR6A 5HQEA 4A29A 1F76A 1AW2A 3MI2A 5FEPA 3HGOA 1OYCA 1NEYA 3EX2A 3E96A 1KW1A 1I2OA 3VCRA 3M16A 2FIQA 3W7CA 3EX3A 1KFBA 1XL9A 4NNBA 1JQVA 1Z42A 2QJGA 1PHWA 4LRSA 1UUOA 3UWQA 3OEXA 2Z1BA 1AW5A 3N73A 5C55A 4MVAA 4KWWA 4ALDA 1ONRA 4ADSA 2YCEA 1I2PA 3DI1A 1OABA 1XDMA 1O60A 2YX0A 2V81A 5D2XA 1LLWA 4GUJA 4XTDA 4MZ1A 3W84A 1H7PA 3UPWA 1I2RA 3E0IA 5LHFA 2NX3A 2Z0IA 5F1VA 3LTYA 2FB3A 3OVRA 4K8EA 1FWNA 3L0KA 3BGGA 2CWNA 4IX0A 1L6WA 3GVGA 3HG5A 1AG1O 5FF0A 4N02A 1ZJIA 3TNOA 1QPQA 1R46A 1OFAA 1G7UA 4LNYA 3AJXA 3N3MA 2W0UA 3MHUA 1UASA 5D30A 4XZ9A 5G2HA 3F4WA 3DH7A 1H51A 1XDLA 5U4NA 1XXXA 2A7RA 2A85A 3CIWA 3PSVA 2ZZ1A 3RMJA 3PB2A 3C56A 2DJXA 1MEHA 4WY0B 2DZVA 4NX0A 1M5WA 2WSYA 2NZLA 4O13A 2QJIA 4LVAA 1KTNA 1ICQA 5I3KA 4FF7A 1LCOA 1KV5A 1OG0A 2V82A 3BLEA 3HO8A 2G96A 1OFQA 5LNRA 5DY3A 3LCWA 5D2TA 1TTPA 4AHPA 1A53A 3NOEA 5K7JA 2JKAA 4ONVA 4N9CA 3RNDA 5EKYA 2F7FA 3P60A 2X1RA 3PS7A 4EVZA 4B5NA 1SFLA 4UUIA 4QM1A 3BW3A 5LHEA 1HTIA 3G24A 3HF3A 1WV2A 3C6CA 1RV8A 3A23A 4Z1AA 4AAJA 1PE1A 1F05A 4JX5A 1QWGA 4UTTA 4A21A 5AC7A 3STGA 5I3JA 3ATZA 3QSRA 3W1AA 4PL2A 2AAMA 2H90A 3L5LA 2QCDA 5T26A 4Y6GA 1P1XA 4TMBA 4UTTC 2VFHA 4HNNA 4AH7A 1O94A 4AF0B 5LNWA 1HL2A 3WK3A 3KVKA 3G1DA 4MLRA 3V1PA 1GVFA 3DHFA 1NF0A 1LOLA 1JULA 3DBPA 4JX6A 5D04C 2NUXA 3U6WA 1RQHA 3UYCA 5DCEA 1BWKA 1ZCOA 4WD0A 4WOZA 4JTJA 4MY1A 5D05A 2HS8A 2Y63A 3NG3A 2NXGA 3ABSA 4HKPA 3MP5A 3PWAA 2Y62A 1QR7A 3T4CA 4UR8A 2CLFA 4DO5A 1VJIA 1O4UA 5F2MA 3F4NA 5KSWA 4K38A 3UNDA 3CTLA 3KFTA 1QAPA 3PG8A 3FJLA 3O6CA 4WXYA 3DXIA 1KA9F 4TR9A 3DFOA 4ORMA 3UXDA 4YCOA 4XBSA 3SI9A 4BI5A 2E5CA 1X1OA 2VFDA 1EPXA 5D2WA 3NQGA 6TIMA 5C54A 3M43A 1QPNA 3W2UA 2QUTA 3PUEA 4JEQA 1PV8A 4DBEA 2GPTA 2R94A 5D02A 2VELA 4FNSA 5CZSA 4NQ1A 2A5HA 1X1ZA 5KITA 1XM3A 3RU6A 3TXZA 1LTDA 2B7NA 4CCEA 5KTLA 1VR6A 4GXMA 2YYUA 3S9YA 3UQNA 3IVUA 5TQLA 3TQ0A 3HMJG 1MZHA 3P81A 2W79A 3EXTA 3TDFA 1W0MA 1YDNA 2B0MA 5J5DA 1QO5A 2F84A 4BWLA 3GXNA 3O06A 3W72A 4UFIA 4TO8A 1B4KA 3L21A 4JTUA 3EX4A 3QZEA 1W3IA 4L4MA 5EYWA 4GJ1A 1NFBA 2W6RA 3LRLA 1EA0A 1KFCA 1ZAIA 1YTEA 4MOZA 4UTLA 4GE8A 2V5BA 5D38A 2NWSA 1W54A 3NVTA 5A8GA 1SW0A 4P2VA 2ZCGA 3OIXA 5BNKA 3BK0A 1GT8A 4MKNA 4CQ9A 2FJKA 4UC5A 3NR0A 3BG3A 3O15A 4QIUA 1LDCA 1RVGA 3CT7A 4MPQA 5ABTA 3NQ6A 1K02A 4N9DA 3W7RA 5HWNA 3FEMA 4IMEA 5H91A 4S2CA 4Z0SA 1KFLA 4POCA 3YPIA 3M1ZA 2GQ8A 3ZFHA 5DBTA 1VC4A 4JTSA 3DKJA 3BLIA 3N19B 3QC3A 4ML9A 3W75A 2YFOA 3SZ8A 1DORA 3TE9A 1VCVA 5FF3A 1PVNA 2DU2A 3I7SA 3F03K 3HOJA 3TH6A 4GUFA 3RF9A 1W3TA 1ZNNA 1WDWA 1YADA 2YW4A 3TKFA 1W5MA 3LXBA 3S0CA 4UTWA 4NJGA 1DQXA 1PS9A 3N2XA 5C5YA 5E1QA 5G4WA 4Q32A 4CCCA 3IEBA 4LUJA 4ZQCA 1JRBA 2JGYA 1LM1A 2OMAA 4UTWC 3W73A 3C8FA 1KM2A 3G8RA 1VS1A 3GXPA 2H6RA 3EWUA 2PRHA 1JCLA 1X8FA 2DZXA 3N34A 3GDRA 1I4NA 2YR1A 3E02A 3G22A 3TR2A 4AB4A 1SZNA 5BOOA 1AK5A 3DENA 4Q4KA 5C2XA 1A5CA 1H1ZA 4O15A 4IXHA 3PUOA 5HUOA 4RX0A 1YTDA 3DKLA 4BI7A 1HO4A 4HN4A 4RJEA 1KBIA 5LKYA 3H55A 4N4PA 5DLCA 2C18A 1XBXA 2HTMA 4JGDA 3ZR4A 3R12A 2EHHA 2QCDB 1LBMA 2P1FA 2DZWA 4WY0A 3L65A 3W7QA 2PURA 3QMTA 2XFWA 3QPYA 5K9XA 1Q6RA 2J24A 1LOSA 5DN1A 2GOUA 4LOCA 2ZZ6A 2NX9A 3PBUA 3UWYA 4MYXA 1W1ZA 1TPWA 5FI8A 3GAKA 3B03A 4RXGA 2CZ5A 2CLIA 4JTGA 4Y8FA 1NAL1 3HJZA 1M7PA 1TTQA 3JR2A 4JYFA 3FOKA 2WV8A 4CQAA 2CLEA 3HQ1A 4WXZA 2CZEA 4MUZA 4O1AA 3G0SA 3IVSA 2CLOA 3GDMA 2I9EA 3HG4A 3Q37A 1C29A 5F4XA 1YPIA 4UTHA 1GVQA 2B7PA 1TPDA 2VFFA 1U5JA 4JTIA 1FDZA 2VENA 5FEXA 1V5XA 4UFJA 4JS3A 4LC8A 1SUXA 5CSSA 1S3HA 4O0ZA 3GDKA 3U2OA 5AYZA 2Z6JA 2A6LA 2ZRZA 4PH6A 3LXAA 3NDOA 5HULA 1VRDA 5LGZA 3SSJA 2WPBA 3GDTA 4H4IA 1P4CA 2NUWA 4OT7A 3HGRA 3UWVA 4HIBA 1SO3A 4DPQA 3DFSA 3G0UA 2NUYA 4UTIA 3IGXA 3EWWA 2X30A 1XUUA 3PG9A 1W5QA 4AF0A 1SZEA 3L0GA 3K30A 3W2MA 4EF8A 2A21A 3W86A 4IPJA 1FWTA 4OU1A 4X9SA 5CPNA 1VPXA 4DO6A 1W5OA 3LDVA 4LUIA 3OHIA 4UCGA 1F7BA 4IMFA 1W37A 4NX5A 4LVFA 3VNDA 3E9AA 1OJXA 2PE4A 4FIRA 4BK9A 4HPXA 1HFBA 1FDJA 4Z1DA 1SR9A 3W2JA 1EP1A 1FX6A 3C61A 3FFSA 1JCXA 4M5PA 1EP2A 4LVDA 2X2GA 3L67A 4JNMA 4IPIA 3P67A 1JJKA 1PIIA 4LVGA 5HJLA 3KRUA 4DBDA 1RQEA 3W2KA 1TPVA 1SO5A 3L68A 4MY9A 4GNJA 4JDYA 4DEFA 2CU0A 4IQLA 1KM1A 2GJLA 3TMLA 1ZENA 4MZ8A 3BG5A 4AVFA 1K8ZA 3ZWTA 2E6FA 4DF2A 3W6YA 4IMGA 1QCWA 4NUWA 4MLJA 2ZBTA 3UPBA 4JN6A 5KINA 4ZQNA 2PRLA 2BXVA 4FX6M 4OWGA 2OX1A 4AHQA 3NL2A 1CW2A 2Y85A 1FXQA 4UTMA 2VFGA 4UNLA 3ABOA 2YDAA 1DJQA 3W88A 5IBXC 3GK0A 1JRCA 5KZMA 5F4WA 5DCBA 4RZ4A 3WK0A 1DJNA 3LTPA 3NO5A 1A50A 1P5BA 4AWSA 1L6YA 2QJHA 3NGJA 4UTUA 2QUUA 4JXCA 5G5IA 3GYEA 4AWTA 2ZZ2A 3CHVA 5AHMA 4HSOA 3GKFA 2E6DA 3EKLA 2QAPA 2AQWA 2NV2A 1H62A 2NV1A 1NF7A 2E5BA 3HGJA 1M6JA 3TV8A 3QH2A 3F1QA 3M9YA 1H1YA 1U83A 4JY9A 5F2GA 2H3BA 1GZGA 3I7RA 3JRKA 1GG1A 3UY7A 4H3DA 3UZ5A 2PCQA 1D3GA 4O57A 1YXCA 2H8XA 4QNEA 3GB6A 4IOTA 4OHQA 1IGSA 4ZQPA 4U4MA 2C6QA 4RCXA 1TB3A 3C2OA 3NYZA 1XI3A 3NQ8A 3DAQA 5CZTA 1SW3A 4ZL1A 1DOSA 3IRDA 3HPXA 2UV8G 4YLWA 3P74A 2J9ZA 2XN1A 1Q6OA 1K8YA 3SR7A 4RKAA 3UWZA 4HPJA 3FIGA 3W3OA 3I6RA 3MP3A 2I14A 4MZYA 4Q33A 3VFLA 2VFIA 2RH9A 3QJAA 3IIVA 3KAOA 2ZA1A 5LNVA 4LRTA 3SGUA 3W71A 4H6KA 2Y61A 3BG9A 4O16A 4DF1A 1VHCA 4X22A 2WQPA 3W76A 3W1NA 5D2VA 4I7UA 2Q3OA 2Z6IA 1EUAA 4K8HA 3ZWSA 1H50A 3RFAA 4NXKA 4A2RA 3LBMA 3MWAA 3N9RA 3Q94A 1MEIA 3LHTA 3WJSA 2CZFA 3PBWA 1KLZA 3LERA 3Q2DA 3BO9A 4BFAA 4N6FA 1Q6LA 3L0NA 4LS2A 2ISSA 4JR5A 4ICNA 3S1UA 4C1KA 3IIZA 1SQ7A 2A0NA 5CZ0A 4WUIA 1TQXA 5FEWA 1S5TA 1O95A 3P7YA 3W83A 2E6AA 1AL7A 4CQ8A 5AFDA 2QCFA 1GQNA 4ZMGA 3IVTA 1Z48A 3S5YA 1SZGA 5AHFA 3ATYA 1PL9A 3W87A 4IJBA 4Y9AA 2Q8LA 3FYOA 3SIZA 4FO4A 3W7NA 2CLMA 3OA3A 2J9XA 3IGSA 1I45A 4YL2A 3A24A 4M7TA 3P5YA 4U28A 1KV8A 3P62A 3MBDA 1EUNA 2R91A 2V9DA 4IXXA 4JTKA 4PFMA 4UMAA 1RR2A 4X3ZA 3M5XA 3PAJA 1VQTA 4RZ5A 1H7RA 4K36A 2ZFAA 1OYAA 2WO5A 3NM3A 2V2CA 2YGYA 4EF9A 1K7FA 3QRHA 1KM0A 4Z0JA 4GC4A 4JIQA 1QNVA 3NQEA 2PC4A 2BTMA 3L9CA 5BMXA 5CG7A 5H2ZA 5F2IA 2TMDA 4JDBA 4WX2A 2P10A 3S6DA 2E1DA 3M5VA 2HMCA 3NQMA 4FX8A 3M0ZA 4CNOA 1FY6A 1YTKA 3IIOA 3W7IA 1J4EA 3WJZA 1YLVA 1JUEA 4JTLA 1Z41A 1LZOA 3G8EA 1H61A 4PTNA 3TSBA 4E0CA 5AN7A 1J2WA 1DBTA 1OFEA 1H7NA 3MYOA 5F4SA 3W7MA 4UNKA 4A2SA 1JR1A 4M19A 1H7WA 1TTIA 3G1HA 4AWUA 3LM7A 5HWMA 4FX7A 3FKKA 2H8ZA 3MI6A 2JKEA 2ZTKA 1RQBA 4OE7A 4OV4A 3W70A 2CLHA 4MIMA 3GZ3A 1FCUA 2EPHA 3MP4A 3P80A 5FF4A 1ZAHA 3FJ6A 4O50A 3NL3A 2BX7A 1IXOA 1R2TA 3W1XA 3OG3A 3G18A 1NVMA 3Q58A 5CPOA 3TMQA 3EWYA 2G95A 3KVJA 4LVBA 1GVRA 1A5SA 4DF0A 5LNSA 4KFNA 2RDTA 4NZJA 1EX5A 1XBZA 4UFLA 3RK8A 2X1TA 2A1YA 3N2MA 3TCEA 4I9AA 3LCFA 1K3UA 1TCDA 2HSAA 2C0AA 5G4EA 1TPH1 3LOTA 5HNRA 3BGJA 1MEWA 3LHZA 5D2YA 4AXKA 3MHGA 3GLCA 4NT0A 3SGZA 2CFFA 4LT9A 5BMWA 4L4LA 5HWJA 1TPB1 4IWWA 3INPA 3QSTA 3PBYA 4LS1A 1BTMA 1YXYA 2PRMA 4OQVA 4RV8A 1TV8A 2R14A 2NWRA 4MY8A 3W1UA 2QDHA 4HT3A 4GRSA 2RHGA 1FUYA 5A5WA 2E5DA 3P8IA 1FBAA 1VLWA 4RZ6A 1TQJA 4WJEA 3W7OA 1FWWA 1QO2A 1T96A 2A4AA 3CB8A 1SO4A 3WJWA 4QSHA 3TROA 3QEZA 2ATMA 2OJPA 2LLEA 3LHWA 4O54A 1JVNA 4O53A 3W7GA 2E68A 3S42A 3TFCA 2JK2A 3GNNA 1NSJA 2VXNA 3P61A 3PR2A 3TXVA 1T8XA 2DZPA 3W7HA 2ZYFA 2ABAA 4NZFA 3GR7A 1IXPA 2TSYA 5LNUA 4LU0A 4K37A 4PL1A 3C4UA 1O5XA 3LGEA 5G2IA 3WJYA 4IX2A 4CLMA 4DQWA 1X6UA 2QCNA 3EXSA 1ICPA 4ADUA 1GYNA 2GVLA 4LS0A 5E0KA 5K4XA 1FQ0A 4DO4A 3TK7A 2JBMA 1EB3A 2FTPA 2ZZ3A 2YSWA 3M41A 3EWZA 5E93A 5CKSA 4QQ3A 1F5ZA 1WAUA 3SJ3A 1B4EA 1BEUA 4MJMA 1OF6A 1F6PA 1G69A 3FLUA 4S2BA 2EKCA 4E2DA 3S5OA 1FWRA 4GUHA 2FB2A 1EEPA 4UMCA 3TSDA 1BKSA 3ABRA 3EWXA 2GUUA 2Q8ZA 1XKYA 1TIMA 4J9JA 3BV4A 4ZQMA 4EWND 3UY8A 3C2FA 3DFQA 3DFNA 2QUVA 3IGUA 4ZZ9A 3T78A 5AYXA 4QAIA 4BR1A 2FLIA 3L66A 3HPZA 3TUUA 4OV9A 5J5RA 4FNRA 1G4SA 4FNUA 4Z08A 3MJYA 4YCPA 4HHPA 1SPQA 1S5WA 3QPZA 1OX4A 2VEKA 3CEUA 1W5NA 3PY2A 1G7VA 3KRZA 3WK2A 1AL8A 3KVMA 4ORIA 3NZ1A 3W1LA 5BW6A 1KFKA 3LV6A 4FXSA 4HSNA 1X7FA 1Y0EA 1WOBA 3P5ZA 2WSRA 1KFEA 1PCWA 3PC0A 6ALDA 3LHUA 5IM51 2DORA 2RDWA 3A21A 1XC4A 1F74A 3BARA 3VI2A 3G1FA 3RLVA 2NX1A 3KX6A 3TW6A 1SFJA 3VE7A 5HMSA 2RKXA 5K2ZA 3R2GA 1EWDA 2YYTA 1G67A 5L6UA 3OVPA 4LV4A 2QEZA 3HPSA 3NXFA 2GVJA 5G1YA 5LGXA 3EB2A 1H63A 4YXGA 2TRSA 1RD5A 3G0XA 3T44A 5HR6A 2YPIA 2WJZA 3E49A 3M47A 3L5AA 4A3UA 3NNTA 3NQVA 1QFEA 2YFNA 5EL1A 5KZEA 3LCXA 1FXPA 4WOQA 3KHJA 3B06A 2P0OA 4JD4A 3I7QA 5KMYA 4BI6A 3CC1A 5DXYA 2QCEA 3MW7A 1I2QA 3DI0A 2VFEA 3CM4A 4MFEA 4PC8A 5AHEA 1XCFA 1A5BA 4FXRA 3LI1A 5D09A 2QCCA 3LV5A 1WA3A 2QCGA 2FPTA 4LWWA 3CPRA 2JKPA 1ZY9A 4FNQA 1XFBA 2CLLA 4FHAA 1CI1A 4AEOA 1S5VA 3TW7A 2OT0A 3GX9A 2WNNA 3G1YA 5AB3A 3O63A 3C2EA 4K6AA 3GAYA 2C1HA 5CPLA 3PB0A 2C15A 4KFOA 2O7SA 1OX5A 2ATSA 4N6EA 2DP3A 2V30A 5G1TA 2ZRXA 1G4PA 4FB7A 3W1PA 3PM6A 1LBFA 1WBJA 3AO0A 1W5PA 2QKFA 4K7YA 3S8HA 3CU2A 3QYQA 3DU0A 3WFAA 3FS2A 4XUGA 3BPWA 5IBXA 3LRKA 2HS6A 3EKZA 3EX6A 4JTTA 2C3ZA 3USBA 4PEKA 3B0UX 3W7DA 1G4TA 3M44A 4O8RA 2WOQA 2OCZA 2ZZ4A 3OBKA 2Y6ZA 4M6QA 3NPUA 5EMUA 4N9BA 4WY0F 5D37A 1MXSA 4PCFA 3C0JA 4XBKA 1THFD 4UFKA 3TC7A 3WJXA 3UZJA 4W9TA 4N9EA 1W31A 3W74A 2FPYA 3PSWA 3NEVA 4JICA 4X2RA 3WK1A 4JIPA 3GR8A 3O07A 4UXDA 5MHBA 4K7VA 3G1VA 2XN2A 1XBYA 4R33A 3I65A 2J9YA 1H5YA 3R89A 3KVLA 4JYEA 1HG3A 1WOAA 1T99A 3R13A 1DKWA 4QJ1A 2GVGA 1QPOA 4O28A 3W2LA 1VYPX 1JQXA 3TJLA 3B04A 5EA9A 3GXTA 2G5WA 1SSGA 1JCNA 2CZDA 3O16A 2RDUA 2V2DA 2J88A 3G1XA 1HUVA 1M7OA 1H7XA 3MHFA 4XKYA 3BW2A 3NQDA 1J5TA 1MSSA 1OFDA 3ABQA 3W2NA 1LP6A 1LBLA 1YDVA 2DZSA 3NPWA 2ZZ7A 1UJPA 4Y96A 2WNZA 3SFKA 4R34A 4HNVA 1KFJA 4NVTA 3N9SA 5I3IA 1QOPA 4UFHA 3PVFA 5D32A 3T55A 3LB0A 1TMHA 3W1RA 3LHVA 3M5YA 1D3HA 4GFSA 4CNPA 1KBJA 1GWJA 1OX4B 2ABBA 2BWGA 5DBUA 1C8VA 1DHPA 1TRDA 5U7SA 4ADTA 1SU5A 2Y7GA 4LV9A 4DXVA 1K03A 1T0OA 2ZRUA 3NQ7A 4LTSA 5BRBA 3NL6A 5CPMA 5FF7A 3TJXA 4NJKA 3VKJA 1ZFJA 1QPRA 3TAOA 4GUIA 3A9IA 2VOMA 3B0VC 1N7KA 3T7VA 3NA8A 3CLMA 1OK4A 4I7WA 4O17A 4LW7A 2GJNA 2ISWA 3NPVA 3PUDA 4UFMA 3DHDA 1TPUA 4EIVA 2QCHA 4O4VA 3LCGA 5L9FA 1TPFA 4O14A 5HUPA 3HG2A 1WYIA 1OK6A 3TSMA 2A7NA 1VYRA 3IV3A 3NQFA 1I2NA 3FKRA 5EBUA 4E38A 2ZDRA 2FFCA 4UTKA 5K4ZA 1GJPA 4UTJA 4JTFA 1DL3A 1G4EA 4HNTA 3D0CA 3MMTA 3C2VA 2B7QA 4O12A 1R2SA 1FCVA 2VC6A 3NL5A 3H54A 5K9CA 2EGZA 4FEZA 2J6XA 5CZJA 1LRTA 3PBVA 1GOXA 1PHQA 1ICSA 3P8JA 3G1AA 1UUMA 5F1UA 1F2JA 3RLUA 3HBLA 4MJZA 1D9EA 2ZRYA 1A5AA 1B3OA 1SW7A 2ZRWA 5DY2A 1N8FA 3UWWA 4Z1CA 3TA6A 3W7PA 2CLKA 2RFGA 4NXSA 3DFTA 5F2LA 4R7JA 3QF0A 4OGZA 1K8XA 4XWUA 5AHNA 1ML1A 3LLFA 4JYDA 3W1QA 1IXNA 1FCBA 4M6VA 5DXXA 4Z1BA 1XBVA 4GBUA 2WKJA 1SZFA 3LTSA 5GVJA 2ZRVA 3L2IA 1N55A 3E12A 3LI0A 4QISA 2C13A 2ALDA 3NPXA 1SO6A 4R53A 5C6MA 3C52A 3QQ0A 2Q3RA 3HB9A 3NM1A 4N4QA 4A22A 2WSQA 3O6DA 2C16A 3GKAA 4O10A 2EAWA 4MFDA 4YMZA 1TSIA 3S5NA 1LRNA 1GG0A 3LCIA 1DV7A 1VCGA 3QW3A 1OFPA 1OFRA 3G1SA 4TX9A 2C19A 2V2HA 1IIGA 3W7LA 4FIQA 1VLIA 7TIMA 4PA8A 5AHIA 3GNDA 1L9WA 5TBOA 2VEIA 1I8JA 5AOUA 1TV7A 1L6SA 3IIXA 1KM5A 1V7YA 2X16A 1Q3NA 4G1KA 4TMCA 1TV5A 1JUBA 3B05A 1OX6A 1UBSA 5D03A 3KOFA 4LY8A 1LYXA 2GQAA 1AMKA 3TU9A 1W3NA 2QCLA 1G6CA 4WZHA 3LRMA 4CNNA 2IQTA 3SW6A 2VEPA 3GIYA 4YWIA 3ANYA 1GEQA 3LX9A 2YXGA 2JGQA 3O6YX 1L2UA 1LRQA 3KXQA 3W07A 3W85A 2TYSA 4LC6A 4AMAA 4EOUA 1R2RA 1OVDA 2X1UA 4ZQOA 4O1BA 1Q45A 3M5ZA 4UR7A 2B7OA 1PCKA 2V5LA 4UMBA 8TIMA 3NZRA 2EF9A 5FF2A 3OVQA 4O1CA 3QM3A 4O52A 4BWLC 2NXHA 2KZHA 3P84A 2ZTJA 1YPFA 4XKYB 2D73A 1VZWA 3O1NA 3LCHA 3MI3A 1H7OA 4JTHA 4E2BA 2GQ9A 3T40A 3R5EA 3NAVA 2V8ZA 3W7EA 4N2YA 3S1XA 3STCA 4TIMA 5D33A 1QDSA 3M7WA 1FWSA 2H3DA 3EXRA 5I3FA 2WNQA 1VGAA 2C14A 5CGQA 3HG3A 1TPC1 4XQ6A 1GTHA 1HO1A 2BSLA 1W8SA 3B0PA 3LBCA 4S1FA 4K39A 1DQWA 4RLIA 3BW4A 3P82A 2QF7A 3BLFA 3ZS4A 5HR7A 2QAFA 2OZ0A 1KTBA 3W1MA 2A7PA 1YXDA 3STFA 2QDGA 1R47A 5K3VA 3UWUA 3TQVA 1ME7A 4NNAA 1K7EA 5AYYA 2VEMA 2Y70A 3LLDA 3W1TA 5I3GA 3UD6A 3S1WA 1QOQA 3V75A 5KZDA 3B4UA 3DGRA 4WQ6A 3KRSA 1RPXA 4IGHA 1XUZA 4Y90A 1KM4A 3W7JA 1O5KA 2E6YA 2NLIA 1GTEA 3SY5A 4JTEA
chains in the Genus database with same CATH superfamily
1EP3A 3LQLA 3GO2A 2FGZA 2CWXA 4O4WA 2EPLX 4O1DA 4PRTA 2YW3A 3BMVA 1FDYA 2EEXA 1JCMP 1HGWA 1TREA 1M04A 2OT1A 1US3A 3WQOA 1R3VA 4P61A 1K7XA 2BLEA 4ZQRA 1LQ2A 2X1SA 1WKFA 3TAKA 1W56A 1XLMA 1OB0A 3CIXA 3N4FA 4HK6A 3NQCA 4IIEA 4O11A 3EOOA 4IMCA 3MTWA 2Z2UA 1TJRA 3DZ1A 2Z1VA 5AC6A 3MBFA 4AX6A 1EWEA 4QHRA 2ONEA 2Y7EA 3SEPA 1KGUA 3OP2A 1PYFA 5C9WA 2NQ9A 5A69A 2AGKA 1XW8A 2G4FA 4ZVJA 4HZMA 2PCEA 2VP8A 2Y7DA 5IXEA 5G2WA 3URAA 3BURA 1ECEA 8A3HA 2VDHA 2ZKMX 5LZLA 3G3MA 1MW3A 3NDZA 1KGWA 2OLSA 1EBGA 4LBSA 1RUSA 1KM3A 4C1LA 3S2NA 4JY8A 4PODA 3LG3A 1RHCA 2EG6A 1A47A 5JQ9A 1AW1A 4WHBA 2OSWA 2BY2A 2DW6A 1UB3A 1DVJA 1OFBA 1OC7A 3UG4A 2Y88A 4Z17A 3TX9A 4AHOA 5B80A 1AQMA 4UIOA 5H8UA 4RV3A 2BOEX 4XBJA 1H0IA 2FZMA 1GVSA 1LF1A 4DELA 1TMLA 3CWHA 4MMWA 3AWNA 2GQ3A 3N14A 4H01A 1SR0A 1BWLA 1ADOA 4C6JA 2ZA2A 3EDJA 4GY7A 4WEVX 2XWEA 2Q02A 3PF3A 3O05A 1NARA 3FDGA 1DPMA 2VKZG 1NOWA 1F6KA 1IV8A 4X9YA 5EMYA 2AKMA 1XLFA 4EAYA 4GG9A 1WXJA 3QW4B 1JCJA 4CD5A 4EAMA 2G97A 4JBRA 4CCDA 1IT0A 2VD9A 1RD6A 4F0RA 2WWCA 2XFYA 3GQYA 1TR1A 4NJIA 4LF1A 4I7VA 4BZYA 4X0NA 2C1GA 2XSBA 3G77A 4MPKA 3ZOAA 3PANA 2X41A 3A22A 1ZALA 3HV9A 3GIQA 3TN5A 3WQVA 1VCFA 1KLYA 3DFYA 3VD9A 3NQAA 2FGLA 4QS6A 5IRPA 1VH7A 4DUXA 3T1GA 4D8LA 3AROA 3WQ8A 2QVNA 1AW2A 3MI2A 3BAKA 5DO8A 3WMBA 5FEPA 3HGOA 1NEYA 3E96A 4UWMA 3K1DA 2VGFA 3B4YA 3GTFA 2J7FA 4XG1A 4XAZA 4QLKA 4NNBA 3GG7A 4HOXA 5CPTA 3UWQA 2Z1BA 5JBFA 2VI0A 1I2PA 1O60A 2V81A 4NZ1A 3N18A 1P6WA 1HJQA 3ZLFA 1A4MA 1LLWA 4RDWA 1H7PA 1I2RA 5LHFA 1MW2A 1XIJA 2Y8KA 1ZBCA 2IPWA 2Z0IA 2FB3A 3OVRA 5C71A 3L0KA 2CWNA 1B3WA 1L6WA 1AG1O 1EZWA 3SM0A 3F2CA 1QPQA 1G7UA 5JU6A 3AJXA 3MV11 1EJVC 1R3QA 3QGAC 1UASA 2A79A 2YLLA 4OUIA 3T0DA 4RE0A 1XDLA 3GVRA 1VB9A 2WB5A 3U2ZA 1XXXA 2A85A 2D2GA 4Y2WA 4C5YA 4AZHA 3VOCA 1MEHA 4BEUA 1GQJA 3SRDA 2DZVA 4NX0A 5FJTA 3PBMA 4R85A 1U1UA 2QJIA 1EC8A 4FF7A 3RXZA 1KV5A 1OG0A 3BZJA 3HPAA 3BLEA 1TV4A 1OFQA 5LNRA 5DY3A 4OZOA 2XH2A 4OTKA 4N9CA 3UCCA 2QMKA 4FP1A 1T5AA 1M03A 4EVZA 4ZTXA 4DJDD 3IRSA 1JPDX 1LWIA 3BAWA 1HTIA 2GJPA 1HL8A 3HF3A 3C6CA 4YS1A 1RV8A 4ZOEA 4YYFA 1OINA 1PE1A 1RJQA 1F05A 4JX5A 4CN1A 1XHGA 1XICA 3ZLGA 3T81A 2H90A 3L4VA 1MRQA 3GU9A 4A3YA 2O0TA 3MPGA 3UA3A 3E6EA 4Q8OA 2PUZA 3LU2A 3W0KA 2VFHA 4GD0A 4OOZA 4AH7A 5LNWA 2P50A 3PJTA 4PCSA 3V1PA 1LOLA 5BU6A 3F4DA 3RPDA 3DBPA 4JX6A 5D04C 4IISA 3QBUA 3ANVA 5EB8A 4LUYA 2VGIA 4EKJA 4QBXA 2VQTA 1MFUA 4WOZA 3EOLA 4JTJA 4F48A 1WDQA 4ZBCA 1O7AA 1V6VA 1B2YA 1UW9A 2XIBA 3MP5A 3PWAA 3T4CA 1CGVA 2VC9A 4GQBA 4DO5A 5F2MA 4MHBA 3VM5A 4E3TA 1J18A 1G1YA 2DGAA 2DIEA 4ORMA 2DT1A 3OQ8A 2XJ7A 2PDMA 1DEDA 4GVGA 5C54A 3M43A 2IXVA 4NIRA 3U57A 2QUTA 4DBEA 2GPTA 2R94A 1B0IA 2VELA 5CZSA 4KRUA 2DUXA 2PDXA 1X1ZA 3KTXA 1XM3A 1LTDA 3CL6A 2B7NA 4CCEA 2XZ9A 5C2CA 1H41A 1VR6A 3OA5A 3S9YA 5D9OA 2W79A 1J93A 1IHIA 3CHCA 3TDFA 2DIKA 4UCFA 4OJYA 3H4GA 3C0SA 4DY1A 4L9XA 4J3XA 4K2SA 3W72A 4MSSA 3QZEA 1BXCA 5CXPA 4L4MA 3PZ9A 1XPGA 2J6VA 2W6RA 1KFCA 1EJRC 3AHZA 2INFA 4X0VA 2IS7A 4JFUA 4R7WA 7ODCA 5REQA 1B1YA 5CJNA 1W54A 2XISA 6XIAA 4P2VA 2DPEA 3T8QA 1TVPA 4AX7A 4NKCA 1ZBVA 4MKNA 4ZO8A 4GYPA 3M46A 4LCSA 3AFBA 5ABTA 4JIHA 2HVNA 5BOFA 2NVAA 2CKRA 3FEMA 2C7FA 1UWUA 4POCA 2WMIA 2AL2A 1XIBA 4IP7A 1VC4A 3PFRA 4JTSA 3DKJA 5HJYA 3AYVA 1UKPA 6PTDA 4AIOA 3SZ8A 4IIGA 4NAFB 2DU2A 4RNFA 2VYOA 4XO7A 3HOJA 4GUFA 3EDDA 2VR2A 3TKFA 2GJRA 3LXBA 2HV5A 3S0CA 3WUBA 1DQXA 2IKJA 1PS9A 3N2XA 5E1QA 4Q32A 3SFWA 3IEBA 1PEZA 4KEMA 1M01A 4LUJA 2JGYA 2X7WA 3W73A 1UD5A 1KM2A 3N4AA 3OLDA 4HNCA 5ABHA 1JCLA 1X8FA 1XRTA 3GTIA 1E0WA 3GS6A 3H2NA 3SSZA 2YR1A 4AB4A 4MJ4A 1SZNA 3WLRA 2GFTA 3S2JA 4Q4KA 4LH8A 5FACA 3HZ3A 3PUOA 1TMQA 3RM4A 4HA1A 3AMLA 1Y7VA 4BI7A 1S2CA 3PZOA 4NYUA 5DLCA 3L12A 2C18A 1XBXA 4JGDA 1ISZA 3I6EA 2QCDB 2WC3A 1LBMA 5ABEA 1UP0A 4WY0A 3L65A 4DUVA 1JEZA 2PURA 2WVUA 3FGCB 3QPYA 1GONA 2J24A 1LOSA 3QGVA 5A6TC 4FLOA 1S2WA 5FI8A 1JI1A 2CZ5A 3EA2A 3O7UA 1NAL1 4GQQA 1CEOA 3R0KA 4W8LA 3HJZA 5HPOA 3AU6A 2UY5A 3FOKA 4M1RA 2WV8A 5A94A 4CQAA 3G5EA 2CLEA 4D6IA 4WXZA 2CZEA 4MUZA 3G0SA 3IVSA 3GDMA 2I9EA 3Q37A 4AQLA 3U7BA 4PRWA 2ZXQA 1YPIA 1JNDA 4UTHA 5C8BB 2B7PA 2JE8A 4JTIA 1FDZA 3V0UA 2QNEA 4JS3A 1MUCA 3CAWA 1SUXA 3UR2A 5A2BA 1M7JA 2XIJA 3KOXA 4KGJA 4GJJA 1ONWA 4AZ7A 4PH6A 2ZRZA 4WDUA 3NDOA 5HULA 1VRDA 3EB4A 4BKNA 3GDTA 3HGRA 3UWVA 3BSGA 1SO3A 4DPQA 3DFSA 1Z69A 4MM1A 5A8MA 4EX4A 2X30A 1XUUA 2GK1A 3K30A 3W2MA 4EF8A 2FMNA 3W86A 4IPJA 1FWTA 3P2VA 1R9ZA 4HHHA 5AY7A 4FALA 1L8NA 3CNYA 4IMFA 2NSOA 3N2CA 4DNMA 1ITUA 3E9AA 4HU8A 1DP0A 4WRHA 3OPSA 1JZ6A 4K68A 4M5PA 2RGMA 4JNMA 3EOSA 3ZQ9A 3VMNA 1Q85A 3ORWA 3P67A 1JJKA 3OGVA 3PK7A 3ZT6A 3GC5A 3RUBL 3WCZA 4L4PA 4DEFA 3MDUA 3VGGA 2IXUA 3CUZA 1ZENA 3PZQA 3HN3A 3N13A 3BG5A 4KRTA 1K8ZA 3ZWTA 3PTKA 2E6FA 2DSZA 1EDGA 2OZTA 4DF2A 2XYLA 4JTAA 3W6YA 1QCWA 4YTTA 1K9FA 5I3DA 2A3CA 3WLIA 5CBJA 2PTDA 4QEEA 3K46A 2PLKA 3RILA 2PRLA 3LPPA 3R10A 3BUVA 3NL2A 1XFCA 2Y85A 4UNLA 3WLQA 3RDKA 1VFLA 1JRCA 1E1FA 1ESWA 1JYNA 1XPYA 4N42A 5DCBA 1OSEA 5E9XA 4XZLX 1ZBKA 5XIAA 1P5BA 3MMWA 2ZXDA 1L6YA 3GFYA 3NGJA 4NZ3A 3VXGA 3FHAA 4IFRA 3LEPA 1FFQA 3B0XA 5AHMA 4HSOA 2E6DA 2HBVA 4U3AA 2YL8A 2AQWA 2NV2A 2NV1A 1M68A 3HGJA 1M6JA 5D4YA 3H2FA 3NEHA 1EXBA 3A4JA 1U83A 2Z27A 3QLDA 1E3ZA 1BHGA 3CV7A 3UY7A 3IGHX 1N2VA 1XYCA 3UZ5A 2OGYA 1D3GA 3FW6A 4KGLA 2AKZA 4J1OA 3BC9A 1Q13A 4QNEA 2GWNA 4HP5A 1R7AA 4JTDA 4OHQA 1KWKA 4B2DD 3VNMA 4QDMA 4RCXA 4AZCA 4CU8A 1XI3A 2V3GA 3NQ8A 3DAQA 1NDVA 1SW3A 5FOOA 2UV8G 3E2QA 4NZ5A 3SR7A 4RKAA 3UWZA 4HPJA 5M17A 3TYEA 3BAXA 1WZAA 2OQHA 3I6RA 1YBQA 3QJAA 4MADA 2ZA1A 5LNVA 3TCSA 3SGUA 3BG9A 1K9TA 2VZOA 4X22A 4Q7NA 5DMMA 3PTDA 3VKAA 1KQYA 3H12A 4E4UA 4A2RA 4NXKA 2ISDA 2FTWA 2Y8VA 2R1KA 3WJSA 1X1NA 3LERA 3GH5A 4TTGA 4B5SA 2A0NA 1JDAA 2D3LA 3R6IA 3KE0A 1HF6A 1W6TA 2PZNA 3IVTA 3S5YA 1W3JA 5AHFA 1PL9A 2O9OA 3W87A 1NFPA 5HANA 1XSIA 1PO9A 1E6ZA 4H19A 3TOYA 7TAAA 1AQHA 3IGSA 2F6KA 3REQB 3KBSA 3A24A 1RK6A 1S2VA 3WDQA 4U28A 3W6LA 3P62A 4IQEA 3OW1A 4LAMA 4X3ZA 3RU8X 5IFPA 4RW3A 3PAJA 3HMCA 4Q4PA 4RZ5A 1R86A 4L6DA 2WW5A 2ZFAA 2VX5A 2V2CA 2YGYA 1YHTA 4L65A 1KM0A 5ABGA 3E3HA 3ZIZA 2Y24A 3AS1A 5HXMA 4JIQA 5HNTA 2PC4A 1NQ6A 4REQB 1E43A 4HCHA 2E40A 4AD3A 3OBAA 3XIMA 1OCNA 4FX8A 4CNOA 2D69A 3W7IA 1V3HA 1FHLA 1YLVA 5FJOA 1TWIA 4LAOA 3F5LA 3SCRA 1Z9AA 4M6UA 3G8EA 2PDFA 5AN7A 4IIDA 1BVNP 3GUWA 1CT5A 3CPUA 3BQ6A 2VR5A 2HE5A 1JXJA 4AWUA 4B9ZA 3FKKA 4QCFA 3SRHA 3W70A 4ZOBA 1VFFA 3GZ3A 2EPHA 2ZIDA 3MP4A 3S46A 5FF4A 3FJ6A 4DLMA 5LIXX 2WANA 5B7YA 3WD1A 4JFWA 3RCNA 2BX7A 1E15A 2OYMA 2I16A 1P7TA 1VBRA 1UKTA 4LUSB 3Q58A 3S6OA 3EA3A 3EWYA 3KZSA 1DWGM 3OZMA 2VRJA 1CWYA 3PUGA 4B5TA 1BYCA 3OZPA 4LYQA 3LCFA 5C7HA 4GACA 4F2TA 1HVQA 1QHZA 5G4EA 1TPH1 3GVVA 4PMXA 1HJVA 5HNRA 1W3KA 2PC8A 2V38A 4MAZA 2PI6A 3KRBA 1ADSA 4LCRA 3GLCA 3LZ3A 1M1BA 1HKMA 4M3PA 5BMWA 3J7HA 1TPB1 4IWWA 3WEMA 1YXYA 2R14A 1FWEC 4MY8A 3QKEA 4HT3A 3MVIA 1H49A 5A5WA 1CXKA 2E5DA 5DANA 2X09A 4RZ6A 5C9RA 3QHOA 3QKZA 4WJEA 1FWWA 1UD3A 2HXTA 3O2LA 3W29A 3CB8A 1C9WA 4HOZA 3WJWA 1VEPA 5FAGA 3TROA 1YQ2A 1JZ5A 5AVNA 4O54A 1KGXA 1QJWA 2E68A 5CGTA 3PR2A 3TXVA 4L64A 1T8XA 3GW0A 4P7RA 3TN6A 4K37A 1O5XA 5HJXA 1XLKA 5G2IA 4M51A 1WKEA 3BSHA 4DQWA 1X6UA 2OO0A 3ES7A 3CQJA 1DJGA 2DZAA 5I03A 5E0KA 1PBGA 2GGIA 3TK7A 2JBMA 3KBJA 2YCLB 4PCPA 4HNLA 1TV2A 2XIIA 4DJDA 1SMAA 1TZ9A 4FK9A 3ANUA 3V5FA 1J0ZA 3CYVA 3SJ3A 3SY1A 1BEUA 4U5KA 1BAGA 1OF6A 1G69A 3FLUA 4US6A 3T2PA 3GD6A 4NAEB 3CQKA 1PKNA 1W1IE 2ZUTA 3EWXA 3VUSA 3BV4A 4ZQMA 5JBEA 1ZU8A 3DFQA 1E9LA 3R4IA 3EPNA 3T78A 3IJIA 4CN4A 4DJFD 3WO8A 3LK6A 3LPFA 1QNRA 2FLIA 3L66A 2E3ZA 2PTWA 2QW5A 2V63A 3TUUA 3IANA 4FNRA 4Z08A 4UOJA 3MJYA 4UBPC 1LUCB 1KCXA 5FL0A 1WUFA 4JKKA 1F07A 3CEUA 2A3LA 2C91A 3CZKA 4ZENA 1EDTA 3B8UA 5MF5A 3W1LA 2F38A 3WUEA 3BCJA 3LV6A 3LUTA 3AXHA 1UJQA 1FA2A 1KFEA 1WDSA 1XC4A 4UOZA 2NX1A 3KX6A 3TW6A 1SFJA 3VE7A 4PUKA 4H83A 5L6UA 4LV4A 2QEZA 3NXFA 2GVJA 1H63A 4IM4A 2TRSA 1RD5A 2WZEA 3T44A 2J7DA 2YPIA 1VBHA 3PZTA 3E49A 3M47A 4Q6JA 3NNTA 2F2KA 2BS9A 2YFNA 3H4XA 1UBPC 1OGSA 1C7SA 4HPNA 4WOQA 4GYKA 2DSVA 3ZSSA 1ZP4A 5CBIA 4C7GA 1E40A 4YYCA 3M64A 3MW7A 1I2QA 2PGRA 1SZRA 1OZQA 1F4AA 4C6OA 2CCRA 3VD5A 2ZE3A 1FRBA 1F8IA 4PC8A 3ZT7A 4L4OA 5JUVA 2PU1A 3LI1A 3S4TA 1WA3A 4GHRA 3VX0A 1V6UA 4LWWA 4FNQA 2CLLA 5F7UA 1UC4A 2EXOA 3R0DA 4AEOA 2G3FA 4L9ZA 5HMFA 4QEHA 1V0NA 2XWDA 3ZLHA 3UZZA 2WNNA 4AG0A 1UPMB 3UCQA 3UESA 5CPLA 5LXEA 2O7SA 2NQ5A 1OX5A 4WK9A 3ZJ6A 4WR3A 2V30A 2FZNA 1BSIA 4KCVA 3PM6A 4LBUA 2O9TA 4C1NA 1E6SM 4K7YA 3S8HA 4J2PA 3AJ7A 5I79A 2XZ7A 4LUTA 3QYQA 4KWOA 1R7OA 3WFAA 2QJJA 3OJGA 3KBWA 4XUGA 5FCZA 3EKZA 2D2OA 4K1WA 4KIRA 3USBA 2YL6A 3B0UX 1U22A 3M44A 4O8RA 2WOQA 2OCZA 2ZZ4A 4UQBA 2I5QA 3MB9A 3VILA 4QRNA 5A95A 3ARRA 2V3FA 3L4XA 1THFD 3WJXA 1BXBA 4WVXA 5LA0A 1W31A 2WMGA 4K8GA 4OUEA 2WHLA 3TW9A 7PTDA 3GR8A 5GQBA 5MHBA 7A3HA 1EDQA 2J9YA 3KVLA 3WELA 1HG3A 1T99A 2EO7A 3ARXA 1DKWA 2GVGA 4ATWA 2B81A 1JQXA 3AZSA 2ZXAA 1Q7ZA 4CVUA 4S3BA 4M82A 4DUWA 2V2DA 2Z4GA 1HUVA 4XKYA 3NQDA 1V0MA 2VCAA 3ABQA 3L4YA 3W2NA 3CAVA 4Q8PA 4DNHA 2I5IA 1YDVA 4Y9MA 1PZ1A 5E70A 2DZSA 4Q4MA 4IIFA 4YVVA 2WNZA 3GNRA 2D23A 5DEZA 3W28A 1KFJA 3SUVA 3F2BA 2VZVA 1F3WA 4UFHA 2PWVA 4PTWA 3VZZA 3DC0A 1G0CA 1YNYA 4BCEA 2J8TA 5I00A 1D7KA 3W4RA 3RPMA 3CMJA 3LHVA 3M5YA 2ZUWA 3NXLA 4DLFA 4MGGA 3TYCA 1Z7AA 4GFSA 3VD4A 1HT6A 1TRDA 3N9KA 1SU5A 4H9MA 3HQPA 2Y7GA 3VO0A 2ZRUA 4JKMA 2XVGA 3EOUA 1J8VA 4GH3A 1WNOA 3B8SA 1CCWB 1QRQA 3ARTA 3F4CA 2ODOA 3A9IA 6REQA 2OOGA 2QIWA 1OK4A 2XGZA 4I7WA 3VDBA 1OGGA 1A5OC 3PUDA 2CERA 7REQB 1XGDA 2PMQA 1R3SA 4RNIA 3PZGA 2CHRA 3LCGA 5HUPA 1UOZA 4O14A 3SURA 2IPFA 1VYRA 3NQFA 4YNGA 5EBUA 4E38A 2ZDRA 2FFCA 5EMMA 4UTKA 3VX1A 1GJPA 1LJYA 1DL3A 4AVNA 4ZGYA 4HNTA 2WVTA 4H9TA 5DT5A 4DAIA 1R2SA 2BGQA 4UQDA 3B9OA 3RO6A 1CIUA 1XYLA 1A5KC 2EGZA 5CZJA 3PBVA 1PHQA 2OWXA 3RM9A 4P5UA 3V4BA 3LM3A 1WP6A 1D9EA 4TQTA 4P7QA 1DE5A 4HYWA 4MB3A 4Z1CA 1MUWA 4CQDA 2CLKA 5F2LA 3ARUA 4R7JA 3F5JA 4OGZA 1PUDA 4GYFA 4XWUA 5C7VA 3CQIA 4KEVA 4JYDA 3FJNA 3VK5A 1C7TA 3ARWA 1KCLA 2WKJA 3UYIA 3L2IA 1N55A 3E12A 3LI0A 1DJIA 2A3AA 4KT2A 1V51A 1CYGA 3K4DA 4R53A 3BJTA 4D8AA 3DBNA 3HB9A 4LFYA 4D6FA 3VIIA 3WNOA 1QI0A 4MFDA 3WUGA 1GW9A 1DV7A 3H23A 3QY6A 3NQBA 4DRSA 4UQAA 2V68A 3G1SA 4TX9A 2C19A 4W84A 1IIGA 2CXEA 4HPGA 4FIQA 3Q45A 4PA8A 1QASA 3UW6A 3LMZA 3I10A 1XLIA 3S9ZA 1I8JA 4OKDA 2YIHA 3E5PA 5E09A 2WCAA 2E4TA 1Q3NA 3WIJA 1TV5A 1JUBA 2GL5A 2PLCA 3KOFA 4LY8A 3LYEA 3K4WA 1LYXA 1W3NA 1G6CA 3KTSA 1ZUAX 2IQTA 3ANYA 4MB1A 1GEQA 2A3EA 3DG7A 1PZ3A 4XD4A 2PODA 2O9PA 1H1NA 4MKSA 1LRQA 4QROA 3W85A 2TYSA 4AMAA 3VIMA 1GKQA 5DRCA 4B16A 2WC4A 8TIMA 2XDFA 1E9ZB 3QM3A 4Q8UA 3R58A 2ZTJA 4C6NA 3TA9A 4KCWA 4Y9OA 1C8XA 1H7OA 5FJIA 3KP0A 4B5XA 1CXLA 6CGTA 2EQDA 2QV5A 3WLJA 3Q4DA 3O0FA 1PIGA 4ICMA 1QDSA 2OQYA 3FY1A 4IL2A 2CBJA 1Q65A 2VMFA 2WNQA 5CGQA 3T2QA 1W8SA 3Q65A 2X0SA 5FL1A 1RCQA 1TX0A 3BW4A 3BLFA 2QAFA 3PHAA 4HB7A 1KTBA 4HK5A 1YXDA 1TWDA 1XLEA 3Q67A 5T9BG 1Z32X 4PMVA 5I02A 4YU1A 3TQVA 4CD6A 1ME7A 1OBAA 4AW7A 2VZSA 5AYYA 3LLDA 2G3IA 1GK8A 4PMUA 1IWPA 3S1WA 4B5WA 5IDZA 3B4UA 3SCNA 1OD8A 4WQ6A 4QCEA 1RPXA 1O5KA 3EBVA 5HBFA 4M8UA 5EBAA 2QYGA 3VOGA 5CG0A 4RK8A 3LPOA 1ME8A 4D2JA 1DIDA 3ELFA 3U48A 4XO6A 3GHSA 4JOMA 1PTDA 4OBRA 4AVOA 3EOEA 3TR9A 4OECA 2G3MA 3KOZA 2YZRA 3VOJA 1LG1A 2WHJA 4R3UA 3FSTA 3I4EA 4ROPA 1UQYA 1TG7A 3CLWA 1VKFA 2DVTA 3WDIA 3PJXA 5TIMA 2QVHA 3A5FA 3MU7A 3EKGA 3M6YA 4C6LA 5AHLA 4MNLA 4NASA 1LT7A 1F73A 3C0LA 2VUYA 1P1MA 2DT2A 1BRLB 1OFOA 1OYBA 3S5ZA 2E9BA 1AZ1A 2ZQ0A 4CD8A 1XGZA 3TC6A 3HQOA 4PMNA 3MUXA 2O7QA 3THAA 4FNPA 3MO7A 2E77A 3O8AA 4WSKA 3MO4A 4M81A 1VFHA 1MFVA 1Z44A 1V08A 3TTOA 1LROA 3UJEA 3GSMA 1OHLA 1KTCA 1WQ5A 2EJ1A 5BROA 4ATLA 5DX7A 5E0FA 2EG8A 1UH4A 4W7WA 2OODA 3I68A 4CN6A 3BCFA 3K2GA 3H53A 2R6OA 4UOQA 1FCQA 2Y89A 4KERA 3C0QA 4NJJA 1QMLA 3MYPA 2A6NA 5XINA 1VHNA 2QIIA 3FCPA 3V5OA 2XUCA 2QULA 1IT8A 4PUMA 3VFCA 2QGHA 4M7SA 4QNWA 1UKOA 3UF9A 3U8GA 2Z1XA 1S2AA 5FD0A 4FNTA 4GNVA 4LJ3A 2FHCA 5A6KA 1MQRA 4GI6A 5DELA 3QPEA 4UR9A 3LHYA 4TU1A 2ZX7A 1DWJM 1V02A 1UIOA 3GH7A 3A47A 3C3NA 2Q8XA 3THQA 1JF5A 4O18A 5D8ZA 2Y2WA 3WF2A 3BVJA 2E09A 2X2YA 3I4KA 4Q8QA 4B15A 3P14A 5AC8A 3OLIA 2Y7FA 3FK4A 1TJ0A 1QT1A 1TFVA 1WXYA 3A5VA 4HVXA 1TTJA 2QUMA 1EIXA 3A9BA 5H8MA 3L4WA 1WX0A 2E9MA 2WK2A 3S1VA 1IEVA 1GQIA 1Q6QA 3LXCA 2OKTA 3VD3A 1HX0A 2W61A 4HU3A 1JDFA 1IF2A 3R8GA 2DUZA 5SWUA 4HA4A 2R1NA 2VGBA 4M6PA 1W1B1 3PTQA 3CQ0A 2WMIB 1P0NA 3SUUA 3FA5A 3GNXA 1E1CB 1TYGA 2QR6A 5HQEA 2NQZA 1F76A 3UP8A 2WXDM 1DYSA 2EJAA 4G6CA 1KW1A 5CJ5A 2MANA 3DIPA 3M16A 3OYXA 2FIQA 1EXPA 4DWSC 3CMFA 3EX3A 2GJXB 3MSYA 4LRSA 1E1EA 3OEXA 4IG2B 4Q8WA 2FVMA 4LB3A 3ZSTA 1DJWA 3AYRA 2VGGA 1H0GA 1JFHA 4DJFA 1XDMA 5D2XA 4GUJA 1UWQA 2J74A 3E0IA 1XX1A 2NX3A 4I5XA 4ZE5A 3PZUA 3LTYA 2XH4A 7XIMA 3TC3A 3VGHA 3N2OA 3HG5A 5FF0A 4N02A 1OD0A 3WD0A 2PWHA 3N3MA 3FJ4A 3UR5A 4WGHA 5D30A 1UYQA 4NAFA 1AD4A 4QLLA 5U4NA 3CK5A 2A7RA 3PSVA 4LGXA 3PB2A 1XSJA 2YDSA 4L7ZA 5PTDA 1ZL1A 1MVYA 2CZVA 4WY0B 3CV1A 1M5WA 1E6QM 2BG5A 3RGTA 4U3CA 2V82A 5D2TA 1TTPA 4AHPA 1M41A 4FI4A 2YL5A 3USZA 4C91A 3RNDA 5LIYX 2X1RA 1CGYA 2ON3A 4FA3A 1T7LA 1F9CA 2J62A 2OLHA 4QM1A 4IP5A 3G24A 1GUVA 3UETA 1XV8A 4Z1AA 5LIKX 1CLVA 4AAJA 5IHRA 4V1XA 5I23A 1E3XA 4A21A 1TR9A 3WL1A 5AC7A 3SCVA 4I5RA 3EPMA 3L5LA 2QCDA 5T26A 3VA8A 3NDYA 3ARQA 1DJZA 1P1XA 3FGCA 4CD7A 1NM9A 1QXLA 1S3TC 3TYZA 1UROA 3DERA 2XVKA 2HE8A 3UBPC 1O94A 3WK3A 3GFZA 3DX5A 3R79A 3ZO9A 4D1IA 5A8OA 1K6WA 4B5VA 3E5BA 1RH9A 2NUXA 3QFWA 3U6WA 2GOKA 3UYCA 3EMCA 3T42A 1M9HA 4MY1A 3VD7A 2BVWA 1B3YA 2E25A 4D6DA 2NXGA 4U31A 3V0TA 2FHFA 2XSAA 3NWRA 1O68A 4D6JA 1E4IA 1QR7A 4UR8A 2CLFA 1PYMA 1VJIA 5KSWA 3CTLA 3S3GA 4OIFA 1QAPA 1XJBA 4WXYA 3DXIA 1M3UA 3KL3A 2E5CA 1X1OA 2VFDA 1YIXA 4ES4A 4KH2A 1PKLA 1J79A 3B0YA 3NQGA 6TIMA 1KO0A 4C6QA 5HMDA 2UY4A 1JZ2A 5D02A 4C6CA 3I6TA 5KITA 1QTWA 3RU6A 3TXZA 1NFGA 4HD5A 5AYBA 3VABA 4AWEA 4H9XA 2YYUA 3ENLA 4LEQA 3UQNA 3HMJG 4DI9A 1JG9A 3N17A 2ICSA 4GCXA 1Q6GA 1VFMA 3EXTA 3PZMA 2PSNA 5J5DA 2B0MA 4IP4A 1BD0A 1QO5A 3BXWA 4BWLA 1UMYA 1ONXA 1W1TA 3ALFA 3LMYA 4H6EA 3L7RA 1NFBA 4FR1A 1YTEA 4UTLA 5D38A 4RNJA 3OU8A 3NVTA 5A8GA 2ZCGA 5DT7A 3WBEA 3AHYA 3GNPA 5BNKA 3BK0A 2CXGA 3NR0A 1CXIA 2ESCA 1BXNA 3SADA 4QIUA 4WKFA 1LDCA 2P8CA 1RVGA 3QV6A 4MWAD 1R9XA 3F5KA 2F6UA 1Q6CA 2AOSA 1KFLA 2PZ0A 2NT0A 3ZFHA 2HNHA 4AZCB 5A6BA 2VRQA 5DBTA 4LAUA 3WMSA 3SO7A 2PP3A 1F61A 3QC3A 4AZBA 2C1IA 3SN1A 3W75A 3DHPA 1DORA 2QDEA 3TE9A 1VCVA 1GQLA 1U30A 3KL5A 4DWSD 4RZBA 2PU0A 1ZNNA 4IPPA 2YW4A 1AA1B 4GC3A 4UTWA 2WM1A 2E8ZA 3IUDA 3HFTA 4EXBA 1MYRA 3S47A 4A3RA 4C6EA 2OMAA 4UTWC 1K4GA 1VS1A 3GXPA 3P93A 2JQXA 3PPCA 3AMKA 3QLLA 3N34A 5CC7A 3G22A 1C92A 2G41A 1A3XA 2D2HA 3DENA 4LSBA 4ZB5A 1OCBA 1AMYA 2IPGA 1XRSA 4O15A 4Q7IA 3MCOA 3MANA 2H9AB 1YMYA 3F4VA 1B5TA 1V6WA 3BAIA 5LKYA 3H55A 4ZXOA 2PDIA 4DZHA 3ZR4A 3R12A 3GRIA 4KPLA 4GIYA 3W7QA 2HVMA 2FDMA 1JPMA 4KEZA 5K9XA 4F66A 2GOUA 3PBUA 3BZGA 3UWYA 4MYXA 1W1ZA 1XYFA 4Y8FA 4JEJA 2FVKA 1TTQA 3FVDA 4JYFA 3MZ2A 3LSCA 4HHMA 3HQ1A 2W66A 4E8GA 4O1AA 1KD0A 2CLOA 1QNQA 2WSPA 5F4XA 1I60A 4JQ4A 4Y9PA 4A8NA 1U5JA 1QUMA 1T6MA 2WLZA 4UFJA 2XTKA 1S3HA 4JL2A 3ZVIA 4GO8A 3LXAA 2WPBA 2NUWA 3CAQA 4OT7A 3REQA 1KFWA 2QHAA 3IPWA 3G2GA 3IGXA 4JAWA 4FLQA 1E4MM 1W5QA 1S1RA 3AHXA 2A21A 2W62A 3LNPA 1EYWA 3GW3A 1TWZA 1VPXA 4DO6A 3LDVA 3OHIA 4FR6A 1GZJA 1UZHA 5BWFA 1JPHA 1NU5A 1W37A 4BY3A 4LVFA 1P7TB 3VNDA 4CU7A 4XSMA 1HQTA 1OJXA 2PE4A 2Z00A 4B3LA 4BK9A 1HFBA 1BLIA 4REQA 2WMJA 1FDJA 4YTRA 1EP1A 4D8ZA 1LWJA 1EP2A 1HJSA 1W8GA 2R24A 1EGVA 4IPIA 4LVGA 4DBDA 3W2KA 2I57A 3L23A 3L68A 4MY9A 4GNJA 4JDYA 5AZ1A 5ENLA 4P8WA 4BJHA 3ITOA 1KM1A 2GJLA 4W87A 1BG4A 1JYXA 1V3JA 2P3ZA 1BKHA 3TTSA 4IMGA 4LY4A 4AY1A 1XLHA 2ZBTA 1TE6A 4JN6A 4ZQNA 2VOTA 2QPXA 2BXVA 4PULA 2OGJA 2G3JA 4F40A 4LUSA 4AHQA 4U5IA 1CW2A 4UTMA 1DJQA 2HQAA 4NSBA 5F4WA 2Z1KA 1DJNA 3LTPA 3DYMA 2Z25A 3A13A 1A50A 4JQ2A 1GQKA 4GZJA 3QHMA 4AWTA 4US5D 3CHVA 5HMEA 4O0QA 3GKFA 2PDGA 3VC6A 3HJEA 1D3CA 3ZZ1A 3TV8A 3U5UA 3WLOA 2PFHA 5T91A 1BGGA 2QGYA 5RUBA 3BTNA 5F2GA 3FA3A 3JRKA 1GG1A 2J7GA 4H3DA 4ENLA 2PCQA 1YXCA 3CASA 3I3BA 4IOTA 1VPQA 2JIWA 2G8ZA 1XLCA 2C6QA 3MV01 2JALA 4DIAA 1V3LA 1A4LA 1DOSA 3IRDA 3HPXA 2PLMA 5J04A 4W85A 2AQVA 3FIGA 4W5ZA 1PJ9A 2I14A 4Q33A 2OX4A 4H8NA 3S2CA 3VFLA 2VFIA 4DJED 3B9EA 1UR8A 3KCOA 2WMHA 3S2MA 4AD1A 4DF1A 5HQLA 1H3GA 1JD7A 2WQPA 3EWDA 3W1NA 5CC6A 5D2VA 4PBEA 2Z1WA 2Z6IA 3MY9A 2YCLA 2HEJA 4XD3A 3LBMA 2UZ9A 3VMOA 1MEIA 2INEA 2VZTA 4NY2A 2CZFA 3PBWA 4XKMA 3Q2DA 1J0JA 3UNTA 2OU4A 4BFAA 4N6FA 1Q6LA 3L0NA 4LS2A 4JR5A 3S1UA 4C1KA 1RP9A 4NAEA 3LENA 5CGMA 3R43A 4RNHA 2YCIX 2PDUA 3B8IA 5FEWA 2FZBA 1O95A 3NCOA 3P7YA 4PR4A 3W83A 2E6AA 3ZJKA 3TJ4A 1AL7A 4CQ8A 5AFDA 3WG6A 1GQNA 4JIEA 4FAMA 1SZGA 1FP9A 5A2CA 2Q8LA 4FO4A 3IAQA 3W7NA 2J9XA 1W91A 2DV0A 1LUCA 1I45A 4CU6A 1DXIA 1NTHA 4M7TA 1KV8A 3MBDA 4JTKA 4PMZA 4PFMA 1RR2A 4JIRA 4LQ1A 4QXIA 2JF6A 1ZB5A 4NI3A 1UKQA 3ARSA 2PDNA 4K36A 4L1WA 1OYAA 1ZQ5A 5GNZA 3DEQA 4P8VA 5E6YA 1K7FA 4GCAA 2VL4A 4B4HA 4GC4A 1QNVA 1KBKA 2HXUA 5CG7A 5H2ZA 5F2IA 3SUSA 5I2UA 2HBXA 4JDBA 3WMLA 4WX2A 2P10A 4XZIA 3M5VA 1J4EA 4Q6XA 1JUEA 1VIZA 3N4EA 3WH6A 1Z41A 3WQ5A 1SFTA 1LZOA 3TSBA 4PTNA 4E0CA 1UMLA 5A6LA 3MYOA 1WAWA 2ZUMA 5F4SA 4X2PA 1K1DA 4A2SA 1AH3A 3R0UA 1X6NA 1C8YA 3G1HA 2GLKA 3LM7A 4S38A 5HWMA 4FX7A 1SM9A 4UQCA 3RO8A 1P6BA 2WAGA 3DHUA 4OV4A 3GE7A 4DYEA 1Y5WA 1WUEA 4MIMA 1FCUA 3P80A 2HCVA 5IDIA 3NSNA 4HMNA 2CIPA 1IXOA 1R2TA 4H9UA 3W1XA 3OG3A 1VP5A 3THCA 4INFA 5D9PA 4QAWA 4K1GA 4LVBA 1A5SA 1PIFA 2ZUNA 4KFNA 4Q8TA 3WX7A 4ZEPA 3CYJA 3AS3A 4UFLA 2X1TA 3ARZA 1Q8AA 5CSUA 3GHTA 2DFAA 3KS6A 1K3UA 1W2VA 2HSAA 1RBOB 1V6TA 1IZCA 3H2OA 4H8UA 5D2YA 2CFFA 3AS2A 4LT9A 3TJIA 4GZ7A 3G1RA 5HWJA 4DI8A 3TNBA 3CMGA 2I5GA 2NWRA 2QDHA 1E0VA 1A5LC 4GRSA 2CBVA 1DJYA 3P8IA 1FBAA 1G9HA 3IWPA 1QW7A 4UTFA 5A6JA 4IQJA 2MNRA 1T96A 2A4AA 2TAAA 2C71A 2VC5A 3OZOA 2LLEA 3W7GA 3S42A 3GNNA 2VXNA 3P61A 1WPCA 2DZPA 3W7HA 3CJPA 1DIOA 1GOOA 4NZFA 4RDVA 3BWWA 4AYSA 1KBLA 1X38A 2YBVA 2Y0FA 3LGEA 3WJYA 4F0LA 4CLMA 1V3IA 1TWSA 1UZDA 1ICPA 3G6MA 1NELA 3WNPA 2V6AA 3H21A 2NV9A 1FQ0A 1W3HA 4CNUA 4DO4A 2GGHA 2VR4A 1S46A 2WQDA 2ZZ3A 3S2LA 4E4PA 4DHGA 1UWRA 3AQUA 1XSKA 3M41A 4BF5A 2I7GA 4LYPA 3AXKA 3M07A 1UR3M 4MJMA 3W26A 1F6PA 2ZX8A 2EKCA 2VQUA 3KM8A 4XK2A 4ZB0A 3OIHA 1MMFA 2FZDA 3OLGA 2ZICA 2Q8ZA 1REQB 1EJXC 3ZVHB 4EPDC 4EWND 1EF2A 3DFNA 2QUVA 4ZZ9A 3QGKC 4F8XA 5AYXA 4Z1YA 4YTUA 3RN6A 2RAGA 4BQ2A 4G8TA 1ZZMA 3CZEA 1S39A 5FJPA 4YCPA 1GOIA 4ZA0A 4HHPA 3NTYA 1S5WA 3MS8A 3CZGA 5CAHA 3PY2A 4KWUA 3LN3A 3R7MA 3KVMA 4ORIA 3NZ1A 5DRIA 4FXSA 4ERIA 2WWDA 1WOBA 1RXOB 2ACSA 3W6MA 3LHUA 1GHRA 4F2UA 4YVPA 5IM51 2DORA 1F74A 5CBBA 2WZIA 1R38A 3WFLA 5GNYA 5HMSA 3IARA 2IPJA 1QOXA 1CZ1A 1XIGA 1HJWA 2YYTA 1G67A 2P0IA 3OVPA 1FWDC 4MNJA 4EP8C 1XRFA 1KRAC 4ACYA 1HP5A 4YXGA 7REQA 5HR6A 4NF7A 1MWOA 4G5DA 2WJZA 1KKRA 3NQVA 1EJTC 2PTZA 1KQZA 3EB3A 3QZ6A 1W3LA 5DF0A 3M7SA 2PTYA 4BQ4A 5KMYA 3CC1A 5DXYA 3H7VA 1D8WA 4L5ZA 4RUBA 3CM4A 1D8CA 2QCGA 2FPTA 2PGEA 1MRAA 3GG1A 3H2AA 3N29A 3BDKA 2Z2BA 3CPRA 3QZAA 3GDBA 5EMJA 5I06A 4TX8A 2GUBA 3ITLA 1S5VA 4DWDA 4G9PA 3WZ0E 3GX9A 4MAVA 3OBEA 1JDEA 3V7PA 5AB3A 3QV7A 4RPQA 3XISA 4DXKA 3C2EA 4K6AA 2C1HA 5I6SA 4KFOA 4O1EA 2ATSA 1P0BA 3MC5A 2DP3A 4N6EA 3VNYA 8XIAA 3CHDA 5G1TA 2ZRXA 4Z2KA 2QLYA 1C93A 3W1PA 1BQCA 3OG2A 1WBJA 4CNSA 3KWXA 3D3FA 1IYXA 2QKFA 3SDOA 4X60A 3CU2A 4C6MA 1JAKA 4MWAA 1JDCA 3FS2A 3GBDA 3KTCA 4E5TA 3MJMA 4JQAA 5IBXA 2HS6A 1XIEA 4PB5A 3VIJA 1V77A 2C3ZA 3HA1A 3RLHA 3AMGA 5A8PA 1ZRQA 3W7DA 1EOKA 4CCZA 2PPGA 3OBKA 3KEHA 3NPUA 3DYOA 4TV6A 5EMUA 3UZXA 1L8PA 5D37A 1V6YA 1MXSA 2PD9A 1C3FA 4DN1A 1LT8A 4QJ4B 3R11A 3TC7A 2E1WA 2WYSA 4W9TA 4N9EA 1EX1A 4PCNA 3W74A 3LQGA 3ITVA 2J7EA 4X2RA 3WK1A 2XHYA 2ZWZA 3RM8A 1QPKA 4ECLA 1E0UA 1DJXA 4PMQA 3G1VA 2XN2A 1XBYA 3I65A 1RJPA 4PGLA 3SRKA 3RRAA 3R13A 1NY1A 4AXNA 4S23A 3B04A 1GOQA 4A8RA 2G5WA 2X1IA 3NSXA 1JCNA 3SJNA 1O66A 2RDUA 1R85A 2PWDA 3BW2A 1MSSA 1Y5VA 3RYSA 3WD4A 3NO3A 3VGBA 1P6CA 2OEMA 4LYRA 1W9DM 1O5RA 4CQCA 3AC0A 4H8HA 2X8RA 3OGSA 4NVTA 4N0RA 3PVFA 5D32A 3PPFA 1E71M 2WVVB 4NG3A 3LB0A 1E70M 1MQQA 1GEHA 3W1RA 1D3HA 4FXFA 1A5UA 3RAOA 2GSEA 1KBJA 1GWJA 2ABBA 4B91A 2YCKX 3RHGA 1LL7A 4MWAE 1BFNA 2DDXA 1BF6A 3AMDA 3GFXA 5BRBA 1E72M 2VTFA 5EMLA 3UU0A 5CPMA 3PZNA 3MUZ1 5AVHA 3RJXA 3KCLA 2Z24A 1SGJA 2ZDSA 3SCPA 3VKJA 1ZFJA 3URQA 1QW9A 3TAOA 2BB0A 4KIEA 3T7VA 3CLMA 4DBSA 2GJNA 1PWLA 3V5CA 1QK0A 4XVDA 2VM8A 1AUSL 2PDBA 2BHZA 2Q01A 2HK1A 4O4VA 2W91A 5L9FA 3ZJ7A 1VFSA 1WYIA 2A7NA 3B9NA 1I2NA 3T05A 1G4EA 2V5KA 5ECUA 4Q4RA 1Q8JA 2VC6A 3GHRA 5K9CA 4PN2A 1ZSXA 4XB3A 1NWTA 1ICSA 3G1AA 1UUMA 5AYIA 4B4FA 4GNKB 4ERAA 2ZRYA 1A5AA 3GNOA 1B3OA 1SW7A 3AHTA 5DY2A 1BRLA 3UWWA 2TODA 2Z28A 4MTVA 3W7PA 1XLAA 2RFGA 3AIBA 4AFYA 1JAEA 5AHNA 5M5DA 2Z7KA 3A4WA 1IXNA 1GW1A 4Z1BA 5DXXA 3UR8A 4EPBC 5IFTA 2Y8UA 3PPHA 5GVJA 1SYTA 5BZAA 2VDGA 1KCKA 1G94A 2J25A 3T4WA 2BOFX 4PTVA 2C13A 2ADAA 1UIPA 2WVSA 2Q3RA 3DECA 3LNMA 5E9AA 4Q8NA 3SUWA 1ISWA 2WSQA 3O6DA 4TUFA 2C16A 3GKAA 1TSIA 3S5NA 3SIMA 1VCGA 4ZODA 4B92A 4WCJA 4Z2LA 1E4LA 1RY8A 7TIMA 4F0HA 3EZ4A 4PBFA 3NJ3A 2BHYA 2VEIA 4JFTA 2IQDA 3DN5A 3IIXA 4GI4A 3POCA 1NDZA 2X16A 3RCMA 2YB1A 2DT3A 3B05A 5GJPA 4NP7A 4UZUA 1AMKA 4ZSUA 2QCLA 4CNNA 3LRMA 3ZT5A 2VEPA 1PDZA 3LX9A 3W27A 4PCTA 2JGQA 5CPQA 4RDZA 1L2UA 3NO1A 1QNSA 3KXQA 3W07A 4HMCA 1R3TA 1R0MA 4O1BA 3PZVA 1JIBA 1PCKA 1XKJA 2VX7A 4YPJA 4QJ3B 1HNYA 1MZRA 3NURA 2EF9A 4WSJA 1V0KA 4U2YA 5CC3A 4O52A 1PTGA 4XD5A 1N82A 4PMRA 2VD8A 2VC7A 2OQLA 4QR6A 2R9RA 1QI2A 4E2BA 2GQ9A 3R5EA 3WF3A 2VT0A 4N2YA 4TIMA 5D33A 4PMJA 2NQLA 5I3FA 1BYBA 2C14A 3BOFA 3SGGA 3I3EA 4XQ6A 4YIWA 4GYPC 3B0PA 3DFHA 1XIFA 2PLJA 1AODA 1E1CA 2A7PA 3H2MA 4D72A 3STFA 2QT3A 3T0BA 3JW7A 1EHNA 1XYZA 1FHVA 4L6HA 5BWAA 3OQEA 3WQ4A 1A0EA 2GJXA 2J77A 2WBGA 3GM8A 4IG2A 4XZBA 5KZDA 4EPKA 3SCWA 4IL0A 4JZ5A 4IGHA 4H2CA 3VNKA 3W7JA 4PEEA 1GTEA 2F8QA 4HTBA 2WZTA 4HYRA 4R9OA 2EPMX 1XH0A 1K70A 4RE3A 1GYLA 4NJHA 4E8CA 1ZAJA 2B4GA 1W1PA 4LB4A 3NFUA 3W22A 4Y8EA 3ZR6A 2OOFA 1RCOB 4V33A 1B9BA 3ARVA 5D9MA 3SECA 2CW6A 4W88A 1X97A 1JUKA 3URNA 2ZUVA 1C9DA 1KXVA 2CBUA 1HP4A 4Q8VA 4ZO9A 4AU0A 1HVXA 3DFPA 5FSEC 5I3HA 2FDSA 3CWNA 3PN8A 6A3HA 4JCMA 4AZ6A 2OEJA 4R88A 1KXTA 3GH4A 1UCWA 1MW0A 4PUEA 3AUJA 1LLZA 4U33A 4D1JA 1EA9C 1J9YA 2DZUA 4QITA 5IHSA 3WBXA 1EJ7L 3W81A 1IEIA 3BOXA 3KOYA 1FWCC 4HNUA 3VOIA 1MO0A 3QMRA 1UA7A 1YDOA 5IOBA 4NNCA 5BCAA 5JVLA 3WYZA 1H60A 3R8RA 5HK4A 4JTRA 1GVYA 4GI8A 2TPSA 3WFZA 1XYAA 3SY8A 3HIJA 1XWYA 3MUAA 4OBTA 1B31A 2EKGA 3TIMA 4O0KA 5DCDA 2PEVA 2I1OA 4PTDA 1E55A 3PULA 1RZMA 2HK0A 6XIMA 1XG3A 4RR4A 5CAKA 1VFUA 2QCMA 1R30A 4H7ZA 1PB0A 3W23A 3QVQA 4BF9A 4DYJA 2WSKA 1I1WA 2G50A 3QMSA 2VURA 2ZE0A 1DQUA 5E6ZA 3IIPA 4AMCA 1DIKA 5H8PA 4I6KA 1NP2A 1LORA 2BNJA 5FESA 2DQXA 3EEGA 1XH1A 3GDLA 4O19A 3STEA 4C7DA 2BVYA 3AALA 1TJ2A 2GSHA 4Q4OA 2GDVA 4C5ZA 1JCYA 3VUPA 3WQWA 4JX4A 4IZGA 2XIQA 3QFEA 3W01A 3QQ1A 3VIOA 3T0TA 3CEPA 1LOQA 5A1AA 4JFVA 2YBTA 5CSRA 2DZTA 3P6LA 4C7FA 4R27A 1KNWA 3G3DA 3ARPA 1GCYA 1CX9A 1FHUA 3TYAA 3MA8A 2ZA3A 2CYGA 1AH4A 3CWOX 4QQUA 4GH1A 2NXIA 3N2TA 2XH0A 4XD6A 5EPDA 5EFDA 1TE1A 5FEZA 1IIHA 1GOMA 4MB4A 3E0LA 2ZC8A 4MYAA 3L5MA 2FJUB 3EX1A 4AZ5A 2XN0A 2OR2A 2XM1A 9XIMA 1TRIA 4GUGA 1UZ4A 2BZNA 2INZA 1PPIA 3COTA 2VRKA 2E7FA 1EGZA 3VCRA 3B97A 3W7CA 5HPCA 4GA8A 1KFBA 1JFXA 1XL9A 2VX4A 4H04A 4S3AA 1Z42A 2QJGA 4HPHA 4IQDA 1UUOA 4MVAA 4OBSA 4FOKA 4FXJA 4IGNA 1ONRA 2YCEA 4AEEA 1RJRA 3DI1A 3NGFA 1OABA 2UY3A 3P3BA 1UHVA 4M24A 2ZOXA 5M03A 4S3KA 4XTDA 2POTA 3UPWA 3UXKA 1YE4A 1P43A 5F1VA 1BVWA 4ZR8A 1MI3A 3BMXA 3GVGA 1POKA 1Q6DA 4CEUC 1B9ZA 1ZJIA 3TNOA 1R46A 1B3ZA 1AJ2A 3LGGA 3WLHA 3MHUA 1MXDA 5G2HA 2DVUA 1H51A 1ELSA 4OOUA 4WDWA 3K4AA 3WBYA 1UA3A 3CIWA 3RMJA 2DQWA 1W17A 1XQKA 2FFIA 3FHQA 4XAYA 3TQPA 2VUNA 2NZLA 2IQ0A 1ICQA 1KR0A 3W25A 5C2GA 2G96A 3ONCA 1A53A 1C90A 2JKAA 4ONVA 3FDKA 4ZFMA 1NP0A 4E2VA 8CGTA 1XCWA 3PS7A 3GIPA 4GKTA 1SFLA 3KCJA 4Z2JA 2P53A 3VIFA 3L4UA 2P5NA 5LHEA 3TLQA 1WV2A 2H9AA 1OEPA 2BDQA 4MG4A 2D20A 1QWGA 4UTTA 1QI5A 3STGA 4PTXA 3C5QA 3QSRA 2QJMA 4KETA 4PL2A 2JFEX 2AAMA 1V6XA 4OVXA 1RY0A 1B54A 1EL3A 3DESA 4TMBA 1EJSC 4UTTC 3T08A 1TV3A 4AY7A 3KVKA 4MLRA 3T6CA 9RUBA 3KBMA 1WDPA 1GVFA 1NF0A 1DHKA 3IACA 5LA1A 1JULA 5CEWA 4KF1A 3BCDA 5DCEA 4F0MA 4A6GA 2IMRA 1ZJAA 3CUFA 1VBJA 4WD0A 2E9LA 5D05A 2HS8A 3NG3A 4JTCA 4D6GA 3UG3A 4YN5A 1UR4A 1FWGC 5A3HA 1KRBC 2Y62A 3HURA 1ODUA 3N15A 3KFTA 2UWFA 3FJLA 3O9NA 1XF0A 1KA9F 4TR9A 3DFOA 1KR1A 1XGEA 4XBSA 2FHBA 4BI5A 3SB0A 3IJDA 3TWAA 1RK5A 2E28A 3HM7A 4PBGA 3W2UA 1PV8A 3N1AA 3IUHA 9CGTA 4FNSA 3EGJA 2WHMA 2YZ5A 4A3QA 1LQ0A 4W7VA 2PTXA 3UEQA 2YBUA 2L5HA 1SJCA 4GXMA 1TX2A 4GGBA 2J7CA 4ZOCA 2DIJA 2PDKA 3T09A 4HN8A 1YDNA 2C8NA 2PDLA 2F84A 1MUMA 1LL6A 4TO8A 3L21A 3QYSA 4JTUA 3VMPA 1XYMA 1EQPA 2FKPA 3LRLA 1EA0A 3JU2A 4MOZA 1Q2RA 2NWSA 1TIWA 3KBVA 1SW0A 4U10A 3OIXA 1JZ4A 1UOKA 4E8DA 1GT8A 2E8YA 2FJKA 3LA4A 4UC5A 3BG3A 3VOHA 3NZQA 4MPQA 4PZVA 4N9DA 3A12A 1UR0A 1UQZA 4JHOA 3ZXWA 5HWNA 1CPUA 1RSCA 3BLDA 2XIMA 4S2CA 4Z0SA 5GJMA 3M1ZA 2GQ8A 1QHPA 3EMZA 1UH2A 4R7OA 4W8AA 2F9RA 4PMYA 1GJWA 4EXQA 3N19B 4C6PA 3H70A 4ML9A 4YHEA 2YFOA 3LBOA 3RCYA 1AJZA 2A3HA 2GYIA 1PVNA 4KW2A 3WEZA 4CKQA 4XZWA 3TH6A 3VVGA 1W3TA 4L1GA 1FWFC 1WDWA 1YADA 4NJGA 4YWSA 3HFYA 2J7HA 4XV0A 5C5YA 1O5QA 3AAMA 4CCCA 1FHDA 1R3RA 1JRBA 1LM1A 3C8FA 4LX4A 5LIWX 2H6RA 3EWUA 1J12A 4WGXA 1I4NA 3E02A 3ITXA 4DJDC 2ASHA 1PX4A 1AK5A 2OWWA 3S1GA 3SQSA 4IXHA 5HUOA 4L9YA 4RX0A 1EOMA 1ISYA 1EZ2A 1HO4A 1KBIA 2XSXA 3EDEA 3GVWA 2HTMA 2EHHA 1GYMA 2P1FA 1YRRA 3WLKX 1OZMA 1Y8BA 3WL0A 3WBAA 2XFWA 3H26A 1Q6RA 5DN1A 1E6PA 2NX9A 2CBIA 2Y5SA 3GAKA 3B03A 4PTMA 3WH8A 1M7PA 3AIUA 1MNZA 3AS0A 5HNUA 1EJWC 3QOKA 3WQDA 2PDWA 4E3VA 3N6HA 3PPGA 3POHA 2PDPA 1XDJA 3UG8A 2BBFA 1QNPA 4ZE4A 3S9IA 1GVQA 3KL0A 1TPDA 2VFFA 5T8GA 1E5JA 1V5XA 1QVBA 1JYWA 4GZIA 3ARYA 5AYZA 2CLPA 3UVAA 3LSBA 3VC5A 5LIUX 1UWIA 3SSJA 4B90A 1J2BA 4H4IA 1P4CA 2X40A 4NZCA 4Q22A 4HIBA 4RDYA 3EWWA 3PG9A 4AF0A 1SZEA 3L0GA 4IPNB 1FOBA 4Z2GA 4X9SA 2WJFA 5CPNA 2VVNA 4HHLA 4LUIA 4UCGA 1IWBA 4F0SA 1EHAA 4EANA 2DUAA 1SFSA 4ICCX 1SMDA 1JZ8A 3F2DA 1NH6A 4QX4A 3AYSA 4FIRA 3BV7A 4HPXA 1HZYA 1VEOA 1SR9A 3W2JA 3C61A 1JCXA 4JQ1A 1Z8AA 1ZGDA 2KX9A 5CLTA 4J7RA 2A3BA 2VEGA 5TD4A 4I3GA 1GGOA 3KRUA 1TPVA 2EPKX 1SO5A 5M3WA 5XIMA 1BSLA 4GLEA 1ZP3A 2CU0A 1FH7A 2VNCA 4IQLA 1XD1A 2GGGA 1XRVA 3SN4A 4QGCA 3VOFA 3TMLA 4MZ8A 4AVFA 2REQB 1V4YA 2UY2A 1UD6A 3IJ7A 3N11A 2D22A 4MLJA 4NRSA 3ERPA 1PAMA 1JGMA 1GJUA 5FIPA 4FX6M 4OWGA 2OX1A 2PBGA 5CZKA 2PDHA 2VFGA 2YDAA 3W88A 2OYKA 3GK0A 3N12A 3NUKA 2PF0A 2OLAA 1M7XA 4RZ4A 4P8XA 4IF2A 1HKIA 1UP3A 5D8WA 1OCJA 2QJHA 2QUUA 1R3YA 4IHCA 5M1TA 3GYEA 1W9PA 4HZ8A 3AHVA 1JXKA 2ZZ2A