2CLIA

Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
258
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 101
structure length 258
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cliA00
3RFAA 4M6VA 5TIMA 3DZ1A 2DU2A 2CLOA 3QMTA 4BI5A 3SFKA 1EUAA 3ELFA 4FO4A 3SGZA 1ZENA 2CZDA 3M43A 1H1YA 1TV7A 1K03A 1SZGA 3NQGA 4NNBA 1TQXA 3W88A 1R2RA 2EPHA 3EKLA 3P81A 3MW7A 1IXNA 3GR7A 3M41A 2PC4A 2WNZA 1HFBA 2E6AA 4XUGA 2BX7A 5CZSA 4CQ8A 3PWAA 1X1OA 2YZRA 3N3MA 3V1PA 4M5PA 1GG1A 3P60A 4IX2A 5J5RA 4N2YA 1TCDA 4O14A 3W85A 4OV4A 1G4TA 4JTGA 2JBMA 5DLCA 4Z1DA 1HO1A 2ZA1A 2NZLA 3NPXA 3OA3A 4O4WA 2Z2UA 4FX6M 5CZTA 2C18A 3QJAA 1UJPA 4UXDA 1UCWA 3LBCA 3WFAA 4FIQA 3R5EA 3W87A 4ORMA 3PB2A 2X16A 3ATZA 4ADUA 4EF9A 5HINA 3GDLA 1TPUA 1A53A 3TAOA 4AWSA 4JX6A 1RQHA 2XN0A 3W76A 4IPJA 1XC4A 4UTTC 2Y88A 4AHPA 3TMQA 2RDUA 2TMDA 5EA9A 3VFLA 3FS2A 4K39A 3G1HA 3DAQA 1TV5A 4JTSA 2Q3OA 4UTLA 4NVTA 3UY8A 2VELA 3LCFA 3VNDA 5DN1A 3S1WA 3C2FA 5CKSA 1I8JA 2R94A 4MJMA 3W75A 1XDLA 4UTUA 5HJLA 3DI0A 2ALDA 1JRBA 3PBVA 3ATYA 3FYPA 1OG0A 2NLIA 1GVQA 2J9ZA 2YPIA 2I9EA 4K38A 1P4CA 1XFBA 1OFEA 4RJEA 5DELA 3UXDA 2ZZ4A 4UTMA 3ABQA 1IXOA 1H5YA 3BLEA 2YXGA 3ZFHA 1WA3A 3GK0A 1WBJA 5F2GA 3KAOA 1H62A 4GUFA 3C4UA 3MHFA 4LW7A 3HIJA 4LTSA 1YTDA 4KFNA 4NUWA 4PODA 1WOBA 1ZNNA 4UMBA 4MPQA 1S5TA 1W8SA 1BWKA 4K8HA 2ZBTA 3EX3A 4MFDA 3C8FA 4Q4KA 4AB4A 3Q2DA 1VYPX 4H4IA 4MY9A 2QAPA 2W6RA 3O15A 1VPXA 3HOJA 1B57A 1GWJA 3C6CA 1FDJA 3TDFA 4HNTA 4BFAA 1H51A 3S5YA 1VR6A 1DHPA 3EX4A 2A21A 3L21A 1M5WA 5FF0A 3PSWA 4K6AA 4ZQCA 4E38A 1EWDA 3EWYA 2C19A 4A3UA 2OJPA 4HKPA 4UC5A 4UFMA 4AXKA 3PF3A 2VFDA 3T7VA 3W7LA 4YL2A 1EX5A 2FLIA 3UPWA 3IRDA 3P61A 1EEPA 2CZFA 1KLZA 4OQVA 5U7SA 3O6CA 4X22A 5I3HA 3JS3A 1H7XA 3HG2A 3OIXA 1GJPA 2CLLA 1TJRA 5H2ZA 1OJXA 2A6NA 5G2WA 1FWWA 1WX0A 3HB9A 5D2TA 1R47A 1FCUA 2UV8G 4HNVA 1Z41A 2TPSA 4POCA 4MVAA 4MY8A 1R2SA 2VEPA 2E6FA 3CLMA 2ZRZA 3BGJA 4HT3A 5LKYA 1IXQA 1FDZA 2F84A 1TPWA 4OWGA 1VLWA 2H90A 4J9JA 4QNEA 4UFKA 4JYDA 4O1AA 2QCMA 4AF0A 1L6WA 4P61A 3NQ6A 3THAA 3QC3A 1B3OA 3LHYA 3VCRA 3DFTA 4LVDA 2YFNA 1LTDA 3GDKA 4O10A 2I14A 3TK7A 2ZA3A 3C0JA 3P80A 5KZMA 1WAUA 3TC6A 2W0UA 2RDTA 3GXPA 3LTYA 1YXYA 2RH9A 1PL9A 1X7FA 3HBLA 1W3IA 1FWTA 1DJQA 1LBMA 4RLIA 2E6YA 3MJYA 5G1YA 4O57A 3ZS4A 1P5BA 1B9BA 1QCWA 3NZRA 5LNWA 4JDYA 4QJ1A 2QR6A 1W5OA 3B06A 4IMEA 1LM1A 1IGSA 4Z0SA 4B5NA 1FWSA 3B05A 5AB3A 4QQ3A 1PVNA 4I7VA 3MI2A 1VCVA 1H7WA 3NEVA 5EYWA 4LT9A 3STEA 1TTJA 3EWWA 1Q3NA 4CQ9A 4XWUA 2WNNA 3L67A 3G1SA 3NQ2A 1SZFA 3NM3A 4FNPA 3DBPA 4O18A 2WPBA 1F5ZA 4JY9A 5F4WA 3MP5A 4OT7A 1DQXA 1VHNA 1OFBA 4LC6A 5CGQA 3QRHA 2ZRWA 5FF3A 1SO3A 2TRSA 2FPYA 3FKKA 3G0SA 3MWAA 1QPNA 4LV9A 4JIPA 1GG0A 1I2RA 3C3NA 3E0IA 3S1XA 2NWRA 1JULA 2A5HA 4JEQA 3P74A 4W9TA 5HMSA 3NGJA 4R33A 2GPTA 4ZQRA 3A9IA 3DGRA 5LZLA 3LCXA 2CW6A 1UASA 1OFRA 5HNRA 1LRQA 1SW0A 1VH7A 5FEXA 1T8XA 1G7VA 3W2LA 2HMCA 2Y61A 6ALDA 4WY0A 1GT8A 2YX0A 4AF0B 2OZ0A 3GXNA 4Z08A 2C13A 3EXTA 2NX1A 4TO8A 3O1NA 1O60A 3I68A 4UTJA 2QF7A 2VEIA 3KFTA 4FNRA 3GZ3A 5FI8A 4ORIA 2X1TA 2GJLA 2DZWA 1LOQA 1TPVA 1WV2A 1XBYA 3NQ7A 3W2JA 2EAWA 4X3ZA 4JR5A 4PFMA 4GJ1A 3DFOA 1XDMA 4WZHA 4OGZA 4JTUA 5AN7A 4QITA 4XZ9A 2EHHA 1DBTA 2XN2A 3I7SA 2QCEA 2QAFA 1OVDA 5CZJA 5K9DA 1TJPA 4N9BA 3G1XA 3DXIA 1AW2A 4Z1CA 1TO3A 3GDMA 2YCEA 4GWEA 3LHVA 1GVFA 1TRIA 2QJGA 3AJXA 3T4CA 4IJBA 3CB8A 5BMXA 2E1DA 1JQXA 3G3MA 2Q8ZA 4FHAA 1TPC1 4GE8A 4ADTA 3P5ZA 1T96A 1KV8A 3KHJA 3NM1A 1R2TA 3PC0A 3MO7A 3DFQA 2Z6JA 3L68A 2X30A 4DF1A 2X1UA 3P67A 3UPBA 3M47A 2DZSA 3G0XA 3TJLA 2CLKA 4EIVA 3NQAA 6TIMA 4FNQA 4JGDA 1TTPA 2G96A 1KFLA 5E0KA 1ML1A 1TPEA 3FA5A 4UFJA 4NXKA 3ZWTA 3MBFA 3TR2A 1YXDA 4Z1AA 2DZXA 3KOFA 2WSRA 5CSSA 5DXXA 3FJLA 1KM5A 5I3IA 1V5XA 4EVZA 1KM1A 5LGXA 3NQCA 3UQNA 1ZFJA 2CWNA 4M7TA 2WO5A 5BNKA 2ZQ0A 3W7RA 4FXSA 1THFD 4WY0B 1QPOA 3W6YA 1SSGA 3TU9A 3LV6A 4XQ6A 5T26A 3FIGA 3FYOA 1SFLA 2BLEA 1VCGA 3H53A 1NVMA 2IQTA 3LCLA 1VJIA 4CCDA 3MI6A 3PBWA 1XBXA 1SZNA 1MEWA 2GVLA 2JGYA 2VEMA 3P62A 4NZFA 5A5WA 1TB3A 2VFFA 2WSYA 1ZAJA 2YFOA 2YSWA 3T55A 1OX5A 3HPSA 5K9CA 2QUUA 3PUEA 4LV4A 3NDOA 4LVGA 3S5ZA 1Y0EA 2O7SA 3GNNA 4R7JA 3EXRA 3QSTA 3W1TA 3CQ0A 1TPB1 1Q45A 4UIOA 4KWVA 2XFWA 5LNSA 3LCWA 2F7FA 1W54A 3WJYA 3NQFA 1B4EA 4OBTA 3W7PA 4HPXA 4PCFA 1PCKA 2A0NA 3QF0A 4EWND 1DVJA 1VGAA 1A5BA 3NYZA 3EX2A 3HMJG 1KBJA 3PSVA 2W79A 3IGUA 3TROA 3E02A 3LB0A 2E68A 3MYPA 4OE7A 3TQKA 1QPQA 3G1YA 5LSMA 2Q8LA 1NAL1 2WNQA 3LXAA 3GXTA 1T0OA 1PIIA 4MFEA 3W71A 3FEMA 3HPZA 5D33A 1BEUA 3CTLA 1F76A 3EKZA 3G1DA 3WJWA 5D32A 1S5WA 1JJKA 5AHIA 4HSNA 1XBZA 3ABOA 4AEOA 1YLVA 5SWUA 1FY6A 1FWRA 3WK3A 2BXVA 4UTIA 3W74A 2EKCA 5FEWA 4MJZA 5K9XA 3ZR4A 4DPQA 4JTHA 4JNMA 3B0PA 2BSLA 2ZZ5A 4ZQPA 1SSDA 5CPLA 3MP4A 5DCBA 3NQ8A 5KSWA 3M0ZA 5H91A 3TMLA 3LTPA 2C0AA 4YWIA 1YADA 2GQAA 3B0UX 4FIRA 4N4PA 1MZHA 3C56A 4O50A 2VKZG 4JXCA 3E96A 4NJIA 2CLIA 3EX1A 1C8VA 2OT0A 5LHEA 3F4NA 1S5VA 3R12A 1TQJA 2YYUA 1ME8A 4N9CA 4FX8A 3S0CA 1RZMA 1J4EA 2PRHA 4DEFA 1SZEA 1TTQA 3S1VA 4Y96A 3K30A 1G4PA 3TX9A 3G8RA 5LNVA 3LM7A 5G2IA 3KXQA 3GAYA 4DELA 1ZJIA 3BLIA 3VE7A 3NAVA 4LS0A 4KWWA 2J24A 2NXGA 3I7RA 1OK4A 5U4NA 4IWWA 2DJLA 3M16A 1K3UA 4H6KA 4UR7A 4O16A 3SIZA 1AW1A 4IQLA 2V2DA 1OF6A 1P0KA 4IUOA 4O28A 4Q33A 1JCXA 1EP2A 3HPXA 3ZWSA 1JCNA 2ZFAA 1Z42A 5L6UA 1I45A 1I2OA 3L0GA 4Q32A 3NPVA 2GJNA 5D30A 1D9EA 1VYSX 2P10A 3QQ1A 1F7BA 1YDVA 2JKEA 3BK0A 5CPMA 4O52A 4DO4A 5BOOA 1XM3A 3O05A 4KFOA 3CWOX 3TCEA 2WOQA 3Q58A 3TA6A 1HG3A 1DORA 2X1RA 4O1BA 1W3NA 1Q6OA 3LOTA 3MHGA 4ZZ9A 1W31A 8TIMA 1KM0A 1K02A 5C55A 3O6DA 3W1RA 4N4QA 4Y6GA 2X2GA 3B03A 4K36A 4GXMA 4UFIA 2EF9A 3MMTA 3USBA 3TSBA 2ZA2A 1QR7A 3L9CA 3DH7A 3LHTA 3KVJA 1CW2A 5CPOA 4PL1A 5I3KA 2WV8A 1T99A 4U28A 5AC6A 2A2IA 4FNTA 3T78A 3W1NA 3NA8A 4JX4A 3GDTA 3P8JA 1FXPA 1QMLA 3EWZA 1ICSA 4FXRA 1UUOA 4GUHA 2Y7GA 4QSHA 3W7HA 1DL3A 4LVAA 3NQDA 1SO6A 2HTMA 1PCWA 5EKYA 3M5YA 1GTHA 2E5CA 3LRKA 2O7QA 3WJXA 3VI2A 2G97A 3W84A 4MZ1A 2FPTA 1OABA 3W1AA 2QEZA 2V2CA 1FCBA 3G3DA 5A8GA 2J6XA 1KTBA 2ZRYA 1S3HA 1YXCA 5DY3A 1LLWA 1FXQA 5TBOA 1UBSA 4AH7A 3TJXA 1LYXA 1H7RA 4JTTA 3N9SA 3OVPA 3LHWA 3VE9A 4LRTA 2B7QA 1XCFA 2CZ5A 3CEPA 3C2VA 1GYLA 2FFCA 4M6QA 1ICPA 3LCGA 3TKFA 3W73A 1KW1A 1X6UA 3QZEA 3DHFA 1ZY9A 5D2VA 3MP3A 1KFJA 2CZEA 1QO2A 1XUUA 3R8RA 1PHQA 1KTNA 4WQ6A 1XXXA 2FB3A 3H55A 2FB2A 1D3HA 1MEIA 1GPWA 1JUEA 1EUNA 3EWXA 3S1UA 3M6YA 4O54A 3PS7A 2WQPA 5G5IA 1G4EA 2C1HA 4U4MA 2ATSA 3PVFA 4WOZA 3FJ6A 4LU0A 4N6EA 2Z6IA 3T44A 3V75A 3W70A 3O63A 1JUKA 1UB3A 2NUWA 4YCOA 1L9WA 1PV8A 4A2SA 2KZHA 3CU2A 4LY8A 4TR9A 3W2UA 4ML9A 4CCEA 2VEKA 1D3GA 1TREA 5AC8A 1RVGA 3O6YX 3W2NA 1YYAA 5HR7A 3W86A 1W0MA 4XKYA 1QPRA 3G22A 1TPH1 2OCZA 4LUJA 1NSJA 1FDYA 2JGQA 2DP3A 3PB0A 3NL3A 4ZMGA 1Q6LA 3ANYA 2OX1A 1L2UA 1MO0A 3OEXA 2C14A 2H8ZA 1OFOA 3W1UA 2CFFA 1KM6A 1L6YA 3WJSA 3A5FA 4E0CA 4I7UA 1E51A 3NPWA 4MZYA 4A2RA 3NNTA 1VC4A 5KITA 4AVFA 1ZAIA 5L9FA 5LNUA 3ABRA 1WDWA 1ALDA 3C61A 3PUOA 3MYOA 5HR6A 3W1LA 1N8FA 3DKLA 5F2MA 5FF4A 4R34A 4PTNA 2VFIA 2QCNA 4RXGA 1MEHA 3TQVA 1EA0A 1BKSA 2VXNA 1DV7A 3G18A 3TW7A 4JDBA 1W1ZA 2ABBA 4MZ8A 3GNDA 3BW4A 2GQ9A 2VFEA 1TRDA 1OX6A 2RDWA 3KVMA 2QCDA 1ZHAA 1ZAHA 2NX3A 4UFLA 4ZQNA 1OFDA 2NUXA 3W9ZA 2NV1A 3INPA 3LBMA 4TIMA 2DZPA 1XBVA 3LLDA 3SW6A 3G0UA 2NUYA 3S9YA 2V30A 5HWJA 3NQEA 3W7QA 4UR8A 5D03A 5F1UA 4S2CA 3LHZA 4DBEA 4UTWA 1HL2A 4NJJA 4O4VA 4NNAA 2VOMA 5FEPA 5CPNA 4LVFA 4FF7A 5EL1A 1XUZA 4DF0A 5F4XA 3SSJA 4RZ6A 1P1XA 1RR2A 2DORA 3O07A 3L5MA 1XL9A 3W7NA 4JYEA 3DFNA 2GOUA 1IIHA 2QDGA 4WXYA 3RK8A 3SR7A 3N9RA 1SO4A 5E93A 5AOUA 3SI9A 3QMRA 1VQTA 2V5BA 4R53A 3BPWA 3IV3A 5C5YA 3G1FA 2H8XA 4BWLA 1HO4A 1ME7A 5C6MA 3UZ5A 5HWMA 1GZGA 1O4UA 3W1XA 1H7PA 3S5OA 2XN1A 3TUUA 4L4LA 1OX4A 4L4MA 4YMZA 4S1FA 3W3OA 1G69A 1H63A 2ZZ6A 3DU0A 3SJ3A 3S6DA 3CT7A 4ZL1A 3NZ1A 5J5DA 1GVSA 1H50A 1YTKA 4RZ5A 3W7CA 5K7JA 1C9DA 1YPIA 3P82A 2C6QA 3HG3A 5FEZA 1KTCA 5E1QA 2Y7EA 1F73A 4JD4A 2V9DA 3F4WA 1JVNA 1FCVA 3MBDA 1J2WA 4Y8FA 4GRSA 3PULA 3B0VC 3TH6A 1U5JA 4CLMA 2Y70A 2Y7FA 3GX9A 1GVOA 4XTIA 5F2IA 1SW7A 4TMCA 4GFSA 1YPFA 3CPRA 4FB7A 2A6LA 4NZJA 3LHUA 1PHWA 5IM51 4AHQA 4IX0A 5CG7A 1NF7A 3I7QA 2NV2A 3BG3A 4AHOA 4WY0F 4MLJA 3UNDA 1F6PA 2Y89A 2WSQA 3UWVA 1O5XA 3SECA 1JCMP 3Q94A 2ISVA 3QW4B 4PA8A 4C1LA 2GVGA 1W5QA 4LWWA 3CIWA 2Z0IA 2ZZ3A 2ABAA 3LCHA 4RX0A 3QQ0A 3STCA 3G1VA 5AYYA 1JQVA 1OFAA 1H1ZA 1GYNA 4DXVA 1RPXA 2QUTA 1A5SA 1X1ZA 3W7IA 3UWWA 4NU7A 1A5AA 5HULA 1TSIA 1F74A 1OFQA 2FIQA 2PURA 3W7MA 1FWNA 3FOKA 4LUIA 1OHLA 4BF9A 1DOSA 3L0KA 4WUIA 5AYXA 5I3GA 4MOZA 1W3TA 1GQNA 1NFBA 4JIQA 5KMYA 4BK9A 3BV4A 3LERA 3WJZA 2A7PA 3OG3A 4XBSA 3W1QA 1O94A 4UMCA 5KTLA 1TV8A 4TMBA 4WXZA 2WJZA 4HN4A 4H3DA 4HHPA 3BG5A 3EEGA 3GB6A 2E09A 1Z44A 3UWUA 4FEZA 3O06A 4MYAA 3RLVA 1LRTA 5K2ZA 1ADOA 2CLFA 4LOCA 1RV8A 5D04C 3B8DA 3P84A 4JTJA 1H7OA 1I2QA 3CWNA 1NEYA 3IIXA 4DBDA 5MHBA 2J27A 3E12A 3QEZA 3KVLA 1LROA 1AMKA 5AYZA 4DO5A 3L2IA 2QCLA 4C1KA 1QFEA 3YPIA 1H60A 2BWGA 4CNNA 1QOPA 5D2XA 1XKYA 1VCFA 4WX2A 4PEKA 4I9AA 5LGZA 3NG3A 1LOSA 3TW6A 3RU6A 1B4KA 1OF8A 4NJHA 1AG1O 1DJNA 1K8ZA 2LLEA 4JYFA 3R2GA 5AC7A 5D02A 2ISSA 1GOXA 3E9AA 4JICA 3TIMA 2GVJA 3TSMA 1EP3A 3P5YA 1JR1A 2ZTKA 3F1QA 1AW5A 3EB2A 3A23A 2B7NA 5K3VA 3BLFA 2TSYA 1ZCOA 3MUXA 1LZOA 3T40A 4QISA 1LOLA 1K7XA 1EP1A 4ZQMA 1SU5A 3W7EA 1KM2A 2I1OA 2YGYA 3PBUA 3UWZA 2ATMA 2ZRXA 3PUDA 1A5CA 1WYIA 2V2HA 2NXIA 4N02A 1G7UA 2AAMA 3SY5A 3N34A 3W83A 4AMAA 5IBXA 1KM3A 1ICQA 1LCOA 5DXYA 4E2BA 1GEQA 1K8YA 1P0NA 5BMWA 4NX5A 1VLIA 1UUMA 1M7PA 4O1DA 3P8IA 4GUIA 1H7NA 3STFA 3DKJA 2PRMA 1O5KA 3RLUA 1J5TA 5I3JA 3KRZA 3B04A 1SPQA 4JTEA 3LRMA 3N19B 3OVQA 2Y62A 3U6WA 4O13A 3M7WA 1G6CA 4WJEA 1WXJA 5DY2A 4A22A 3EXSA 2VFGA 2V8ZA 5C2XA 3WK1A 2FTPA 3RNDA 3UYCA 3IIOA 4NNCA 2NXHA 3R89A 4HSOA 4NJGA 2QKFA 2GUUA 5AFDA 4QM1A 3KRSA 1QO5A 3SGUA 2DJXA 2HSAA 2B4GA 3UD6A 2QJIA 3Q37A 5KZEA 3DFPA 1LDCA 1HTIA 4O0KA 3A24A 1YDOA 4OU1A 3TXVA 3C2RA 3TFXA 1RQEA 2A7NA 1NF0A 3W07A 1KV5A 4I7WA 4CCCA 2PE4A 5CSRA 3TQ0A 4O11A 5FESA 2X1SA 1N55A 3CHVA 4M19A 2C3ZA 5EBUA 1EWEA 1KFCA 3THQA 3O16A 1W37A 1BTMA 1TTIA 1K7EA 4BI7A 4JTFA 1W56A 4M6PA 5HUOA 2ZTJA 1U83A 1LLZA 1L6SA 1LP6A 3IVTA 3A22A 4UTWC 1TMHA 2FQIA 5HQEA 4FNSA 3M44A 3UZJA 4QAIA 4AWUA 2VC6A 1LBLA 3UWQA 2YDAA 5BW6A 1KFBA 4MY1A 2OT1A 4XTDA 1QDSA 4IXHA 3N14A 3NL6A 1OYAA 2H3BA 3S42A 2TYSA 3NO5A 3LRLA 3LX9A 1G4SA 3IIVA 1VRDA 3M1ZA 4UTKA 4BI6A 4HNUA 1O95A 4IPIA 4X2RA 3BG9A 4KKXA 3P7YA 4LS1A 2JKPA 1QWGA 4NQ1A 4O12A 4BWLC 4ONVA 4OHQA 1WQ5A 2ZRUA 1VYRA 4UFHA 3AO0A 2Q3RA 2NX9A 4LC8A 2GQ8A 4HIBA 2ZZ1A 3BO9A 4RZ4A 1KBIA 4ICNA 5D05A 4UUIA 4Z0JA 3PG8A 3S5NA 2QCHA 3IVSA 2J9YA 1RD5A 1AL8A 3PR2A 2D73A 3GIYA 2H6RA 2E6DA 5GVJA 3W1MA 2EGZA 5F1VA 3UXAA 1FUYA 4O15A 5G4EA 2R8WA 2Y6ZA 3M9YA 4MKNA 2QDHA 1SR9A 7TIMA 5DCDA 2JK2A 3TSDA 3R13A 4JX5A 4O53A 4RCXA 3HGJA 1ME9A 2VENA 2CLMA 4QIUA 3HO8A 4IGHA 4DQWA 3G24A 3RF9A 3GDRA 3TE9A 2ZRVA 3C2OA 5BRBA 1SFJA 2A1YA 4YLWA 1IIGA 3LGEA 3TFCA 4O17A 3PBYA 4DO6A 2A85A 5I3FA 3L65A 4CNOA 3HG5A 2Y63A 1Q6QA 2PCQA 1EPXA 2Y7DA 5CZ0A 1SUXA 3DHDA 5LNRA 1OYCA 4GUJA 3L66A 1AK5A 1TYGA 1W5MA 4E2DA 4TU1A 2P0OA 3L0NA 1V7YA 2E5BA 3NVTA 1YTEA 3UY7A 4UNKA 4WD0A 2E77A 3CM4A 2QCCA 1OFPA 1TIMA 3A21A 1OYBA 3G8EA 4FX7A 4K8EA 1FQ0A 1LRNA 4LS2A 3W7JA 1WOAA 5LHFA 1PE1A 2BZNA 4EF8A 3HG4A 2YYTA 3D0CA 4P2VA 4JTLA 3FKRA 5DCEA 2YW4A 2HS8A 3SZ8A 5FF2A 3STGA 3C52A 4PC8A 3TV8A 3W7KA 2QCFA 4NXSA 4A21A 4RKAA 4UTTA 4UCGA 3TNOA 3W7DA 1HUVA 3PY2A 2ZZ2A 4K7YA 4N6FA 5AHMA 1XI3A 3KRUA 1K8XA 2R91A 4JY8A 4CQAA 3WK0A 1JCLA 4BR1A 1KFKA 1MXSA 3QH2A 3PM6A 1GVRA 4JTIA 4CNPA 3TC7A 3KVKA 3FLUA 3N2MA 5HUPA 1QNVA 3CC1A 3OBKA 4RK8A 2OMAA 3HQ1A 4ADSA 3MI3A 5KINA 3DFSA 3GVGA 2DZUA 3U2OA 3S8HA 4HPJA 1F05A 4LRSA 2FJKA 2V81A 1VS1A 3HGRA 4QNWA 4N9DA 3E49A 3WK2A 3LI0A 1CI1A 3W7OA 1F6KA 4K7VA 3O8AA 1SW3A 2R14A 2YW3A 4Y90A 3LDVA 3IGXA 4XKYB 3IIPA 4JTKA 2P1FA 3LCIA 3LTSA 2PRLA 2ZZ7A 4OV9A 3VKJA 1I4NA 5KZDA 3LXBA 4RV8A 2C15A 3A5VA 3OVRA 4NJKA 5D37A 1DQWA 5EY5A 2E5DA 4DPPA 2CLHA 1I2NA 3DI1A 3BVJA 4EOUA 5K4XA 4UTHA 1EIXA 4G1KA 3HF3A 3M5VA 2FPVA 3W72A 3IIZA 3BW3A 1FX6A 2V0TA 5AHEA 4N9EA 4O0ZA 1TPDA 5D38A 1N7KA 1MSSA 4GNJA 1QOQA 4LNYA 2QUVA 5HWNA 4A29A 1IXPA 3LXCA 3PAJA 2DZVA 4XBKA 3EWBX 3GAKA 3QSRA 3TXZA 4AAJA 3QM3A 2C16A 4PL2A 4KFPA 4JN6A 5F2LA 5G2HA 4IXXA 4TX9A 2B7OA 5AHFA 3HJZA 1KA9F 1G67A 2RHGA 5EMUA 2NWSA 3NL2A 5IBXC 3W7GA 3CEUA 3OHIA 4O1CA 5TQLA 3MHUA 4YCPA 2ZYFA 4RXFA 3LI1A 3ABSA 2QCDB 1VHCA 4M7SA 2A7RA 4O19A 3L5AA 4Z1BA 1W5PA 5K4ZA 1K7FA 3H54A 2V5LA 2ZCGA 3N73A 3JR2A 4LVBA 1M7OA 4Y9AA 3QPZA 1Z48A 2B0MA 4O8RA 3N2XA 1SQ7A 1R46A 1PS9A 1R30A 5C54A 1JUBA 1W5NA 3NQMA 3NXFA 1JCYA 5AHLA 4X9SA 3BGGA 1H61A 3I6RA 4JS3A 1OK6A 5DBTA 3HGSA 1BWLA 2CLEA 1M6JA 1JRCA 2JKAA 4IOTA 3KX6A 3BARA 3IGSA 1WBHA 3LV5A 4YXGA 5G4WA 4ZVJA 2B7PA 4GBUA 3CIXA 3W2KA 4DF2A 1IF2A 3EWUA 4MUZA 4IMDA 4UMAA 1KM4A 4GUGA 5AHNA 2V82A 1FBAA 2QJHA 3GKAA 1LBFA 4S2BA 3QPYA 3LLFA 4IMGA 1FCQA 3B4UA 5FF7A 2Y85A 3W22A 3F03K 5D2YA 1GTEA 2VFHA 1SO5A 4WOQA 2Z1BA 2CU0A 3C2EA 3IVUA 1TPFA 4NT0A 4NX0A 1QAPA 3RMJA 3TAKA 4IMCA 2DZTA 1OX4B 3NQVA 5G1TA 2A4AA 2RFGA 2ZDRA 3GR8A 3G1AA 4ALDA 3FFSA 1C29A 1VZWA 1ZALA 3DENA 1KFEA 2QCGA 1Q6RA 3NL5A 3BW2A 2BTMA 1CX9A 1YDNA 4HNNA 4ZQOA 3GLCA 3NPUA 2FDSA 1KLYA 3NOEA 4K37A 1AL7A 4PH6A 3HGOA 3M5XA 3EX6A 1A50A 4MYXA 3UWYA 2AQWA 1LORA 2RKXA 4FNUA 2J88A 2YR1A 3W2MA 3M5ZA 3PG9A 2H3DA 5EPDA 3I65A 3W1PA 4AWTA 5ABTA 3QMSA 1EB3A 3GKFA 4MLRA 2J9XA 3QYQA 1RQBA 3GYEA 5DBUA 4RR4A 3QFEA 3JRKA 1DKWA 4GC4A 5F4SA 3QW3A 3IEBA 2G5WA 4IMFA 3W23A 1JCJA 1I2PA 2ISWA 2AGKA 1F2JA 5D2WA 5D09A 3NR0A 3L5LA 4UNLA 4MIMA 4D2JA 3U8GA 1X8FA 2HS6A 1ONRA 2WKJA 2G95A
chains in the Genus database with same CATH superfamily
3RFAA 4M6VA 5TIMA 4F40A 2ZVRA 2CLOA 3TYAA 3ID7A 4BI5A 1V3KA 2CZDA 3GH7A 4D1IA 2ISFA 3GTXA 4NNBA 3EKLA 1XH0A 1IXNA 1GOMA 2J6VA 2PC4A 3R8GA 1REQB 4IFRA 2BX7A 4BQ2A 3WQGA 3VKBA 3VNJA 4JFSA 4C6PA 4WVXA 3P60A 1JDFA 1IT7A 5CAKA 4TTGA 4N2YA 3FDGA 4OV4A 5DLCA 4Z2IA 5FJRA 3P14A 2Z2UA 3BC9A 3AYSA 3UXLA 3QJAA 4UQEA 3T6CA 1JAKA 4UXDA 3L4ZA 4FIQA 3BSMA 4EF9A 3GDLA 1PZ1A 4Q4SA 1J8VA 4AWSA 2QUNA 3NO1A 1T40A 1XC4A 2FTWA 2J74A 4JTAA 4LFYA 1IWAA 2DH2A 1TV5A 4NVTA 2VELA 3ISIX 3S1WA 3C2FA 1KKRA 4BA0A 4UTUA 3PBVA 1B31A 1GVQA 2OZ3A 3V36A 4K38A 3BLPX 4RJEA 1HJVA 2ZZ4A 3ABQA 3CYJA 4WRHA 1IXOA 5H8UA 1UR1A 2YXGA 3ZFHA 1J2BA 1H62A 4LW7A 3MHFA 4CQDA 3BV7A 1V3MA 2XH4A 4I9JA 2OODA 4KFNA 4J2MA 1FKXA 2PDMA 3UA4A 4E6MA 4FXFA 3SADA 2EKGA 1BWKA 3CQJA 3QY7A 4GQBA 1OCBA 4R3UA 3LQGA 1R87A 3PP7A 2QAPA 3AROA 3V0SA 2GJRA 4HMDA 3B8VA 3EPNA 4XZLX 1VPXA 3HOJA 3C6CA 1VJSA 2GK1A 3C0SA 3TDFA 4G1NA 4BFAA 3EX4A 3L21A 3WLJA 2OYLA 1E1EA 4K6AA 4ZQCA 2VUYA 4E38A 1EWDA 5LIUX 3EWYA 2DUXA 4PBFA 3XINA 3T7VA 6XIAA 1IEQA 3ZT5A 1I75A 3UPWA 3P93A 2Z27A 3IRDA 4I6KA 1H11A 2A3BA 3ABZA 3T2OA 1KLZA 4OQVA 3ARTA 1QNRA 5D8WA 3IWPA 1H7XA 2OYKA 1A4LA 5H2ZA 1UOKA 1DJZA 5G2WA 1TX0A 1WX0A 3HB9A 3KLLA 4DJDA 4HNVA 3URQA 1LL7A 4POCA 1EJTC 1R2SA 1UD3A 2DT3A 4U2ZA 1VEPA 2ZRZA 1O5QA 2PDWA 1TPWA 4OWGA 4J9JA 5EFDA 4XZIA 1J0IA 4P61A 4L9XA 2GZXA 3DFTA 2YFNA 1LTDA 3GDKA 3I3DA 1G0CA 3C0JA 5HBFA 4O1EA 3L4WA 1UKPA 1RBLA 3LBOA 1LT7A 1FWTA 1DJQA 3FHAA 4CU6A 1F61A 4QJ1A 1W5OA 3LD5A 2Q71A 1IGSA 5AB3A 4Q8PA 4QQ3A 2YKKA 1PVNA 1UQZA 1BTCA 4PUEA 4I7VA 8CGTA 1VCVA 3OZMA 3AJ7A 3ARVA 3OA5A 2I16A 4PUDA 2VGFA 2XSAA 3TLQA 4QP0A 3CL6A 1NP0A 4YYCA 4PFHA 3KEHA 4DJFC 1LG1A 3OOQA 5AZ1A 2CKSA 4UOQA 1KO0A 1DEDA 4FNPA 2XIMA 5JXQA 1TKKA 3VD4A 3CL7A 1DQXA 4PUUA 3AUJA 4LC6A 5DRIA 4RNJA 4LEQA 4I8DA 2W67A 4S3CA 4GBDA 4WSKA 3QRHA 1R3WA 2ZRWA 3GVWA 3MSDA 1JYXA 2FPYA 4E8CA 1QPNA 2PAJA 1SMDA 3C3NA 2NWRA 1E5JA 2E28A 5EMJA 2W27A 4R33A 3BXWA 4PMYA 2GPTA 4HHMA 5I2UA 2PDUA 5JBFA 3VGGA 3A9IA 3DGRA 4U3CA 5LZLA 1FWFC 2OYMA 1DWJM 2BBFA 2VRKA 4XD5A 4W5ZA 3GRIA 1SW0A 3PPFA 3VDBA 1UIPA 5AYIA 2H9AA 2YXXA 2HMCA 3SIMA 4LSBA 4PTXA 6ALDA 2OZ0A 3GXNA 4A8RA 4Z08A 2O0TA 4U33A 1V6YA 3R4IA 4PYSA 1XPGA 4GX8A 1TV4A 1BYCA 1GK8A 3UR5A 3GZ3A 3ZLGA 5BXRA 2FVKA 3AYTA 1LOQA 3PTMA 3RO8A 4PFMA 1DYSA 5JIPA 3R6IA 5A8QA 1XDMA 1RAKA 4XZ9A 4H9ZA 3AIVA 3PTKA 1RA5A 2G3FA 3P0WA 4N9BA 1MFUA 3VXGA 1VP5A 3KP1A 4X0VA 5G1MA 3T4CA 2VDGA 2AQVA 4IJBA 2BMBA 2ZXBA 3G3MA 4G5DA 1T96A 2GQ3A 1KV8A 4NAEA 1R2TA 3MO7A 3UR7A 3VNKA 3FNDA 1TZZA 3QGAC 4B92A 4P7QA 1AZ2A 4DF1A 2HXTA 3P67A 3UPBA 3M47A 2DZSA 3W25A 3TJLA 4EIVA 1PX3A 4GFIA 1YRRA 3NQAA 4FNQA 4DYEA 2POZA 1KFLA 3AS2A 1BF6A 4Q4RA 3OODA 4UFJA 3MBFA 1G94A 2DZXA 1V6TA 5CSSA 1KKOA 4QS6A 5LGXA 1EQCA 2H9AB 1Q2SA 1HX0A 1ZFJA 1NOWA 2XTKA 3QV6A 5ECVA 1THFD 1QPOA 2VX7A 1SSGA 3TU9A 1PIGA 2HQAA 3S9ZA 4HNOA 1J12A 1SFLA 1VCGA 4C6CA 3AXKA 1ZCCA 3IS4A 3MI6A 3FCPA 3GD6A 1KQYA 1TB3A 2VFFA 2WSYA 3BWWA 3MT1A 3AOFA 1ZAJA 3T55A 1OX5A 1NFGA 2WKGA 2AKMA 1Z89A 2O7SA 4B4HA 3GNNA 3EXRA 4CD8A 1A5UA 1EC8A 2XFWA 3WCZA 5LNSA 1JYVA 1QNQA 1W54A 4AUBA 1RVKA 3W7PA 1DVJA 1A5BA 3EX2A 3VM7A 4QHRA 3PSVA 1S38A 4EXAA 3E02A 2P8BA 3MYPA 3G1YA 3VOHA 2Q8LA 4DNHA 3LXAA 1PZ2A 2OU4A 1GOOA 1RLDA 4PMNA 1BEUA 3BAWA 3EKZA 2O4MA 3G1DA 5C9XA 4ILSA 3UVAA 3ABOA 3VU2A 1JPIA 5SWUA 4UCFA 1FY6A 2WBGA 3HURA 3VABA 3BOLA 1E56A 4JNMA 1P0EA 2KAUC 1SSDA 2WLZA 3M0ZA 2ALRA 3RXZA 2W5FA 3RR4A 3GFYA 3WUBA 3LTPA 3IPWA 4NRSA 1PKNA 2P76A 1MZHA 1OWQA 1N8IA 1A80A 4JXCA 4PCTA 4NJIA 5BRPA 3EX1A 1C8VA 1KNWA 1L6FA 3R12A 2Y8UA 2OLSA 3XIMA 1S2CA 1TQJA 1ME8A 3S0CA 2PRHA 1SZEA 3CH0A 3IJLA 4P8UA 1X8CA 5CH9A 3LM7A 5G2IA 1GJUA 4M82A 3NAVA 3PN8A 3TTOA 1FWDC 4S38A 4O16A 3PANA 4KGLA 2X7VA 4IQLA 3WELA 1FWHC 1ODZA 3WSUA 1P0KA 2ZKMX 3ARSA 4JL1A 2IXVA 3RO6A 3H2AA 3GYCA 2YXOA 5L6UA 1Q7MA 3AS3A 1XWYA 4A3HA 4Q32A 3R0UA 1DHKA 4BQ4A 5D30A 1AJZA 2P10A 1YDVA 1KXTA 1W9PA 3C3UA 4QLLA 1P6CA 1Q7QA 3O05A 4KFOA 1QW7A 1BLIA 3Q58A 3S2LA 1DORA 5DO8A 5KEZA 4JKMA 1XF0A 4NG3A 5C55A 4I90A 3NOYA 2X2GA 1T6MA 4GXMA 3L9CA 3T05A 1CW2A 2WV8A 4U28A 3ZJKA 1UKTA 4FNTA 2E8ZA 3W1NA 4AW7A 1NDWA 1AUSL 4GUHA 1HKMA 1YEYA 3APTA 3MUY1 2QGYA 4X9YA 5EKYA 5BXSA 1HIZA 2WHMA 2O7QA 3EB3A 3R7MA 3GC5A 3K1DA 4OBRA 3W84A 3N2TA 3H4XA 3UG5A 2QEZA 3HFYA 3G3DA 4ZE4A 2J6XA 3LENA 5I24A 1Y5XA 4A3QA 1R3SA 3KTSA 4OZOA 5DY3A 2VWSA 2WJFA 2X0YA 3N29A 4AH7A 1UPPA 4XSLA 4JTTA 1KBKA 3OVPA 3VE9A 1E6ZA 1Q6FA 2O55A 4LRTA 4KPLA 3WH8A 1S46A 4U10A 3KDOA 1A5LC 4QLJA 4Q4OA 3LCGA 2BP1A 4S3GA 1NM9A 1X6UA 5I03A 3DHFA 3MP3A 1KTNA 2CLPA 3ARQA 4WQ6A 3R25A 1C92A 5DEZA 1MEIA 1JUEA 4ZE5A 4RZBA 1L2QA 3GU1A 4LUTB 2VR2A 5FJUA 2CESA 2ZUNA 3R43A 3JVAA 4S3AA 4WOZA 3O63A 4QX4A 1PV8A 4A2SA 3LS9A 3CU2A 4TR9A 1UWRA 4LUSA 3BE7A 2HRWA 3RPMA 4CCEA 2O9RA 2FGLA 3CBWA 3VZZA 1ISYA 3O6YX 3W2NA 5HR7A 3W86A 4XKYA 2ZUSA 4GI8A 3BL3A 4YNGA 2OCZA 1NSJA 2JGQA 3BSGA 1DTUA 4B9ZA 1U30A 4B3ZA 3ANYA 3DBNA 4OKDA 2DPEA 3IJIA 2GUBA 2CWXA 4E2VA 1OD8A 3V7PA 2QT3A 3UGRA 1L6YA 1XRTA 4E0CA 3RMEA 3NPWA 2GGJA 4MZYA 1UR3M 4MWAA 3LA4A 1VC4A 4B3LA 4C6JA 4G56A 2A3HA 1Y5WA 5EBAA 1ALDA 3M6DA 3VNMA 4UZUA 5HR6A 4JFWA 4DI9A 3W1LA 9RUBA 3N11A 5GJNA 4XX6A 1MEHA 4ERAA 1EA0A 1BKSA 2VXNA 7ODCA 1DV7A 4D71A 3W27A 4AMCA 1E70M 4MZ8A 4PMUA 3T42A 4ERIA 1OX6A 4KWSA 2QCDA 1ZHAA 4ZQNA 1T7LA 3LBMA 3CS2A 4FF5A 5JIWA 1SJBA 4IQEA 5HWJA 3ITYA 1IEWA 4Y7EA 3W7QA 4IG2B 4R27A 4NP7A 4LUSB 5D03A 3CQKA 4G9PA 3TWBA 4O4VA 2SFPA 4HD5A 4LVFA 4FF7A 1J0ZA 5F4XA 3EA2A 3UJ2A 3O07A 2MUCA 3M0KA 3L5MA 1K4GA 1E9ZB 1JZ8A 3ARPA 3SR7A 3PK7A 3CUXA 3VZXA 3UVIA 2Y5EA 3GXFA 1POKA 1CCWB 2V5BA 3BICA 3TZFA 4LCRA 1XCXA 4U2YA 1E6PA 4Q22A 4BWLA 8XIMA 5C6MA 5FCZA 3S5OA 2XN1A 1TA3A 3TUUA 2D2GA 3CLWA 1X6NA 2WCAA 3DU0A 2WJEA 2VC7A 5J5DA 3VNLA 1H50A 3E0VA 1JYNA 1X97A 3W7CA 5K7JA 3MMUA 4H9UA 3P82A 5FEZA 3HG3A 3VD7A 5E1QA 2PF0A 1QJWA 3QBUA 3NEHA 4JD4A 3N6JA 3WBYA 1UOZA 4HPGA 3B0XA 1U5JA 4Z2LA 2Y70A 2Y7FA 2DIKA 1HKWA 1SW7A 4GFSA 2QDDA 1YPFA 1CBGA 4NZJA 2F6UA 3LHUA 5HNUA 5CG7A 4FMVA 3I7QA 4KRUA 2YBTA 3IUHA 3KBWA 4MLJA 3PTQA 1F6PA 3T08A 4ZO8A 3UWVA 4MADA 1O5XA 3OBAA 1TJ0A 3VZYA 4XISA 2Z0IA 2WZEA 1W3LA 4FSAA 3VIJA 3FX4A 3VTRA 2ZUVA 1OFAA 4KCVA 1EEXA 1GYNA 3USZA 1SYTA 4DXVA 1MNSA 4GJJA 3BLKA 3UWWA 4KMQA 3VIPA 3ITTA 4NU7A 4XZWA 5FD0A 4AXNA 1UROA 2PURA 1RK6A 1JEZA 2YLLA 5FSDC 4U5IA 2BVTA 4W88A 4ZXLA 5M1TA 1HF6A 3L0KA 4V15A 1VEMA 4QBXA 1TA3B 5AYXA 4LJ3A 5I3GA 3GM8A 3ZT7A 1NFBA 3E38A 3OYZA 4LAZA 2FHFA 4IIGA 3BV4A 2QZRA 4H01A 2ONEA 1B54A 3NWRA 4C1NB 1LWHA 2WJZA 4I5UA 3QPEA 4WCJA 4HHPA 4ZSUA 3EEGA 1Y65A 2E09A 1Z44A 3RG6A 3GU2A 3UWUA 2DDXA 4MYAA 5HNTA 1B5TA 4FXJA 1TR9A 3GG1A 4JQ3A 1ADOA 2CLFA 3AALA 4LOCA 1M65A 3P84A 4JTJA 1ISWA 2PFHA 1XRSA 2PWFA 3W01A 4DUWA 2J27A 3KVLA 1LROA 5AYZA 2WVVB 4JIHA 3L2IA 3P2VA 3WLKX 1QFEA 3YPIA 2BWGA 5D2XA 2GLKA 1VCFA 4PEKA 3CZLA 1E40A 5I09A 2MNRA 3TW6A 1BF2A 3AMCA 1MUMA 3BLLA 3UT0A 4GY1A 1AG1O 1W1YA 3KRBA 3GG7A 5D02A 3F2CA 4HCLA 2HV5A 4P5UA 1GOXA 3E9AA 4JICA 1TCMA 3TN6A 3SCSA 3EB2A 3KW3A 1H1NA 1W91A 3M46A 2W91A 7XIMA 3T8LA 4DWSD 1ZCOA 1LZOA 3UZZA 4H6RA 4PTVA 3RCMA 3LG3A 1EP1A 3W7EA 4TOQA 2DW7A 2J77A 2ATMA 1HKKA 2WMGA 3VPLA 1HN1A 5AZ0A 3WQCA 5JBEA 3N3TA 1ICQA 3TJIA 1K8YA 1P0NA 4Q8QA 1C7TA 4KESA 2AL2A 4GINA 1VLIA 5E70A 4C5YA 4GUIA 2Q8XA 2FHCA 3A12A 2BHZA 4DJED 5I3JA 3KRZA 2NQLA 1PWMA 3DGBA 1YDYA 1RK5A 4JL2A 1B1YA 1T8QA 3RNDA 2I17A 4I5RA 5BCAA 3VKAA 1FWGC 4BQ3A 1MRQA 4NJGA 2Q6ZA 1N82A 5CC6A 3GNOA 2GUUA 1E9LA 4MJ2A 3SGUA 4D6HA 1YBQB 3TTQA 1ISXA 3OO2A 2OWCA 2CBVA 1O66A 3MZNA 2W62A 2QJNA 2C0HA 4RDZA 3MCNA 2FYMA 3TXVA 4J40A 2A7NA 4KGJA 2VTFA 3TTYA 2VX5A 1P0BA 5CSRA 3TQ0A 4O11A 1EZWA 3CHVA 2XU2A 4AIBA 4NZ1A 1A47A 3MMDA 4BI7A 4JTFA 1ZBVA 4M6PA 4H8HA 3B8WA 1L6SA 2JIEA 2EQDA 3BZJA 3VNYA 2NVDA 1TMHA 2FQIA 3CZEA 3PZQA 4FNSA 4GMEA 4AWUA 3B3DA 3POCA 4MY1A 2OT1A 1QK2A 1OYAA 4ZA0A 5A6TC 1FWCC 3LRLA 5CQ1A 4KEZA 1VRDA 3M1ZA 3THDA 3WMBA 2JKPA 4NQ1A 4OHQA 4PMJA 3RHGA 3WLMA 3W82A 4LC8A 3DG6A 3KS5A 1A3HA 1KBIA 3DC8A 4XD6A 5D05A 4PCPA 4ZTYA 3DECA 3AXHA 3ZLFA 3QN3A 3KTCA 2OXNA 2J9YA 2QPSA 1MW3A 1TVLA 3VGEA 1EOMA 5HJXA 3W1MA 3UXAA 4O15A 1FFQA 2VQTA 3M9YA 4MKNA 4DYJA 4GQRA 4JX5A 4HZ8A 3IJDA 4W87A 4QE4A 4P8VA 3HGJA 2VENA 4QIUA 4HNLA 4B5SA 1YW1A 3GDRA 1AJ0A 3CUIA 1MI3A 3WNNA 1IIGA 3LGEA 1R85A 4DO6A 5I3FA 3V18A 1Q6QA 3EPOA 5CZ0A 4FLOA 1SUXA 3KOXA 1XIDA 3VAVA 4B16A 1AMYA 3K5XA 3L66A 2EBNA 1WP6A 3WFZA 3VINA 1RH9A 2E5BA 2WXDM 2ZE0A 5EMMA 2FZBA 1TIMA 2HBXA 2DUZA 2D1ZA 4IGSA 1KFWA 4FX7A 3GNXA 4K8EA 3GH5A 1BSLA 3A3XA 4NAFB 1EQPA 3WMLA 1ZL1A 4LS2A 2PB1A 5LHFA 1PE1A 3HG4A 4KETA 3IJ6A 2B31A 4JTLA 1EL3A 3E74A 3SZ8A 4DAIA 3STGA 4D6JA 3C52A 4B4FA 1I0BA 2QCFA 4A21A 4RKAA 4MNLA 3TNOA 4CVUA 3PY2A 1X39A 3WH7A 3BURA 1XI3A 4IP4A 2R91A 2Z1XA 4HA4A 4RW3A 1MMFA 4CUCA 4EXQA 1I9CB 3RYSA 3BTNA 1JYWA 3P0XA 1R0MA 1ELSA 3FLUA 3N2MA 5HUPA 3MI3A 5TAOA 4KBXA 3L4UA 2CCRA 1J0JA 4MNKA 3KZPA 3EOUA 3M0YA 2FJKA 3OLIA 1TV3A 1V0NA 4CCZA 4K7VA 1M1BA 4Y9NA 2R14A 4Y90A 2C7FA 3A3WA 4WLCA 3IIPA 1D8CA 1YPXA 3LCIA 2PRLA 2ZWZA 4OV9A 1XYZA 3LPOA 4MAZA 5DT5A 2PEVA 4WSJA 3UA3A 4B15A 1LL6A 1ZU8A 3OVRA 3OLDA 1B90A 3DI1A 2BGQA 1EYEA 4GJIA 1ECEA 4W7UA 2WM0A 3KBJA 4G6CA 3RIKA 1EJSC 2V0TA 4EPKA 3OP2A 3EA1A 3QYSA 4H9YA 1TPDA 2IPJA 2J8GA 4LNYA 1DTNA 3QV7A 2PLCA 3RX2A 4A29A 3LXCA 4FLRA 4XBKA 1SFSA 3GAKA 4IQJA 3IRSA 3QSRA 3TXZA 3ARZA 3DG7A 2VEFA 3KBMA 4KFPA 3B0YA 3MTWA 1RUSA 5G2HA 4IXXA 2B7OA 4LALA 1KA9F 4QJ3B 3NL2A 2PGFA 4O1CA 5TQLA 3R94A 3D6NA 4YCPA 2ZYFA 4JTQA 4RXFA 4GH1A 2DZAA 1F4HA 2UY3A 4M7SA 1VHCA 2V5KA 3KTXA 1W5PA 1UKQA 3C0QA 3N73A 1PX4A 4UOZA 4Y9AA 3NVDA 4UWMA 4W8BA 3AZTA 5C54A 1JUBA 3WDRA 3ZT6A 4X9SA 2XINA 1KR1A 2VD9A 4H7ZA 4LANA 2PC8A 1RJPA 5DRCA 3R79A 1UD6A 3HGSA 2CLEA 4PBEA 3DUGA 4IOTA 3KX6A 1Q4NX 2DVTA 1H0GA 1WBHA 4YXGA 4J3UA 3CIXA 4F4RA 5DMNA 1IF2A 1BQGA 4LB3A 4RPPA 3WD3A 4IMDA 4UMAA 2FZDA 4A05A 1FBAA 3H2FA 5AVNA 3QPYA 4DIAA 3LLFA 1VPQA 1L6GA 1FCQA 4RNFA 5FF7A 1GTEA 2VFHA 4DJFA 2W92A 3C2EA 1V4YA 2F2HA 1CTNA 4UR9A 1QAPA 3RMJA 5IFTA 1CIUA 1DE5A 1OX4B 3UG3A 3B9EA 1E3ZA 3WLOA 3K2GA 2A4AA 3CQHA 3S4TA 3G1AA 5PTDA 4ALDA 3FFSA 1C29A 1VZWA 4L6OA 1WDPA 1PEZA 1PKMA 1TJ1A 1KFEA 2WANA 4HNCA 2VUNA 2YL9A 3KUMA 2FVMA 5LIYX 2QVHA 1B30A 1A50A 5A8PA 3TYEA 1JZ4A 3BCFA 3OW1A 4FNUA 2YR1A 3ME3A 1YE6A 3VKCA 2H3DA 2WJDA 4PSPA 4AWTA 5ABTA 3K8LA 4P7RA 4Y2WA 1EB3A 1Q6DA 3GW3A 1K8CA 1A49A 4FK9A 5DBUA 4US6A 3QFEA 5F4SA 5JU6A 3WH5A 3QW3A 3IEBA 5C9ZA 3R1ZA 2ISWA 2AAAA 1F2JA 5AECA 5D2WA 1ZJBA 5C7HA 3U8GA 3MZ2A 2PI6A 1X8FA 1ONRA 4BF5A 4HMEA 2XM2A 2DSWA 1CGTA 2E0PA 3AMDA 4DWSB 1VIWA 2VVNA 2D23A 3QMTA 4AEFA 4TV5A 1H1YA 1UPMB 2PGWA 2IMRA 3NQGA 2PD5A 3W88A 1R2RA 2EPHA 3MW7A 1WUEA 4EANA 3UXIA 2CETA 4CQ8A 2V5DA 3PWAA 4Z1YA 4H9TA 1GQLA 1X1OA 3PJXA 1XR2A 3N3MA 1LQAA 4AZ5A 2XHYA 2CHNA 4H2HA 2XVLA 4OBSA 4O14A 2HNHA 4JTGA 2JBMA 4DYKA 4Z1DA 1NIUA 3Q67A 1HO1A 2ZA1A 1QUMA 3NPXA 1W1IE 3UCCA 2QHAA 2J75A 2D0HA 2C18A 2J78A 4CU8A 1IWBA 4WDWA 3LBCA 3R5EA 4YJ5A 4ORMA 3WNOA 1V3HA 3PB2A 4JIIX 2X16A 1UR4A 4C7GA 1TPUA 2HJPA 4R9OA 1C3FA 1A53A 1UKOA 4JX6A 1RQHA 3IARA 4P7LA 4EPEC 1XIEA 4GGHA 4RDYA 4DB7A 2Y88A 4AHPA 3TMQA 3FS2A 1UP0A 4J4KA 3DAQA 1XSIA 4RNIA 2R94A 4ECLA 5HJLA 4XIAA 1UC4A 4HA1A 3CAKA 3VGFA 2J9ZA 2YPIA 2I9EA 1MUCA 2QW5A 1XFBA 4BHYA 3FV9A 4D1JA 5DELA 2PA6A 1XISA 4PRRA 4Q8VA 1XLDA 2UY2A 3GK0A 5REQA 3SAZA 5F2GA 1S2AA 4K8GA 2DQXA 4LTSA 3SRHA 4PODA 1ZNNA 4MPQA 3H23A 1S5TA 2R1PA 2V5JA 3WQPA 2ZBTA 3EX3A 4MFDA 2Y8KA 4AB4A 3SCQA 3TTEA 4CGTA 1MW1A 4H4IA 4ZO7A 3PWIA 4GVIA 1IE7C 2XIJA 3LZ3A 3SCVA 2J8FA 1NARA 5HJYA 4C6NA 1ISVA 3O15A 4F0MA 1LG2A 2WZTA 3FHQA 2BASA 1GWJA 3SUTA 1FDJA 5BOFA 4HNTA 4A3RA 1M5WA 3A4XA 3EMQA 5FKYA 1XLCA 4HTYA 3TN5A 4U5KA 3SDOA 5I6SA 4BZYA 3I4EA 1OC7A 4RNHA 4UFMA 5ECUA 5CC7A 1TIWA 1EX5A 3SJNA 2GJXA 2C71A 1IEIA 3P61A 2YA2A 3TYDA 4ML4A 5U7SA 1G01A 3O6CA 5I3HA 7PTDA 3GFXA 4YHGA 1TJRA 1FOBA 2INEA 5D2TA 1VBGA 4PCNA 5E09A 4MY8A 3MSYA 1ITUA 3CLMA 2CXGA 3BGJA 1BQCA 4HT3A 3TA9A 5LKYA 2F84A 5A6KA 3E2VA 1VLWA 2H90A 4QNEA 3WLRA 4AF0A 1DWFM 1UQYA 3PNZA 3RRXA 1B3OA 1E72M 4LVDA 2F6XA 4O10A 2I14A 3VYLA 5REQB 1GHSA 3CYVA 3TC6A 4W7VA 2RDTA 1XIJA 2YA0A 4B5WA 4KERA 5JQ9A 3SCNA 4RLIA 2E6YA 4W93A 4YYFA 2HPMA 3UERA 4S23A 3ZS4A 5LNWA 4JDYA 1E1CB 2VCBA 2ZXQA 4IMEA 1CNVA 3HA1A 2WB5A 3ARWA 5E9AA 1WZAA 3MI2A 4Z2JA 4GVHA 2FZMA 4JQAA 1TTJA 2D3NA 1Q3NA 1UJQA 1VRXA 3L67A 3NM3A 4XAGA 5DANA 1F5ZA 3VIMA 1JFHA 3VCNA 1CXKA 1VHNA 2JE8A 3SCRA 5CGQA 3WDHA 5TNVA 4G2DA 1P1MA 1SO3A 2PCEA 2TRSA 2IPWA 1JFXA 5FJJA 1EC9A 1GG0A 1I2RA 3E0IA 3EAUA 3IACA 4WGXA 3HQNA 2XSBA 4ZO9A 3ZR5A 2A5HA 5HMSA 4NL1A 1K77A 4ZQRA 3LCXA 2CW6A 4OTKA 1OFRA 1VH7A 4DI8A 5FEXA 4LB4A 2OZTA 3T0AA 3SN0A 1F3WA 2PWVA 5A6BD 3A9BA 2YX0A 4AF0B 3EXTA 2GGGA 1GNXA 1DXIA 3O1NA 4DVOA 1XLIA 3G6MA 3OHMB 3KFTA 2VEIA 5D9PA 3WKZA 4ZB2A 3OZYA 2X1TA 1CB2A 1WV2A 4H2CA 4X3ZA 2FH8A 4K2SA 3IK4A 3ARYA 4GJ1A 3C86A 3PHAA 3DFOA 4WDTA 4JTUA 3U7BA 5AN7A 1FA2A 1V6XA 3GU9A 2EHHA 1DBTA 1F4AA 1XLAA 5BXTA 2QCEA 4RE2A 1EIBA 1HJSA 3OLGA 3DXIA 1AW2A 1EPVA 4TX6A 2YCEA 4GWEA 3PZVA 1GVFA 2EG8A 1UWSA 4QE1A 1GVYA 2XVKA 1VF8A 2E1DA 2Q8ZA 2OLHA 3P5ZA 4R88A 1TVNA 4ZR8A 3MO4A 3NM1A 3PC0A 1A3XA 3VOCA 4GACA 3WNLA 2Z6JA 1Q8JA 3L68A 1XLKA 2P8CA 4HA3A 5B7ZA 4BEUA 3G0XA 1HJWA 2WMFA 5CJMA 6TIMA 4ZBCA 1UZHA 1VKFA 4GIRA 1TTPA 3EKGA 2VC5A 1TPEA 4PRTA 3FA5A 4D6GA 1P6BA 3PJUA 4DXKA 4Z1AA 3KOFA 4J3XA 2WSRA 4IISA 3FJLA 1KM5A 4P7NA 5I3IA 1QI2A 2CWNA 3CAQA 4C6BA 4M7TA 4IHCA 1SZRA 2WO5A 1W2VA 2ZQ0A 4FXSA 2JF7A 2V3EA 3F5JA 3WL1A 4XQ6A 3WF0A 3WQVA 4WIWA 1UR9A 7TAAA 1V77A 3FYOA 4TVCA 3AIQA 3H53A 5FJPA 1Q6CA 4K3ZA 3AIEA 2X0SA 4GCXA 3PBWA 2YDRA 4ZENA 2GVLA 3P62A 4NZFA 5A5WA 3WQOA 1UW9A 2XZ7A 3HPSA 1WDQA 3ZZ1A 5K9CA 3PUEA 1Y0EA 4R7JA 1VAHA 3MKKA 3WUGA 3N6QA 3EDKA 3LCWA 2VCCA 4PCFA 1ITXA 3PAOA 3U0HA 3GSMA 1VGAA 3GXIA 3NSMA 2AL1A 3NYZA 1KBJA 4I9MA 2W79A 2C8NA 1BFNA 1RLCL 4DAFA 3SN4A 4JN7A 5LSMA 1NAL1 1PIIA 4Q8MA 4MFEA 3W71A 4ZOCA 1GW9A 1KWKA 3CTLA 1F76A 4KH2A 2WHKA 4L5ZA 3DC0A 5AHIA 2QULA 3K8KA 3H4WA 1BPLB 2ACRA 1FWRA 3WK3A 3W74A 2V5CA 3F2DA 5FEWA 3IJQA 5K9XA 1N8WA 4IFKB 4F3HA 3ZR4A 4XAYA 2WZMA 2ZZ5A 4IL2A 3MP4A 5DCBA 4EAYA 2W61A 4Q7BA 3PNUA 3NQ8A 1DJYA 2X42A 3TMLA 3FSTA 3W6MA 1E9IA 4YWIA 3MV11 1IZKA 2GQAA 4N4PA 3C56A 3FGCB 2YZ5A 2P50A 2YL5A 2J62A 2WM1A 3NYDA 4MPKA 4EK7A 4NF7A 4NRRA 1BXNA 3BJSA 2Y5SA 4N9CA 2PWDA 4FX8A 1RZMA 2Z4GA 1OBAA 4QG9A 4UZSA 4DEFA 3QHOA 2PDHA 1RALA 4Y96A 1G4PA 5LNVA 3QGKC 1QW8A 2PDJA 2OFJA 3VUPA 4DELA 1W3HA 3BLIA 4C6IA 2J24A 2NXGA 1C90A 1MQPA 4BCEA 2A3CA 3TC3A 3GY1A 5GQBA 2O9TA 2V2DA 3E6EA 3GHUA 4O28A 3GUWA 2CXEA 5E5CA 1XH1A 1JCXA 4CEUC 1JXKA 3ZWSA 1R3VA 5IDZA 3MUZ1 2ZFAA 4WKFA 1NY1A 4AD1A 1NWTA 1I2OA 3E2QA 3L0GA 1Q2RA 3N4FA 1UG6A 3B40A 1CXFA 3N2BA 3BK0A 4LYRA 4O52A 4DO4A 4F0SA 3EWDA 1XM3A 1GHRA 5BWAA 3LSCA 4KW2A 3TA6A 1HG3A 1WKDA 2GYIA 2X1RA 1W3NA 3AAMA 5CC3A 1W31A 8TIMA 3DN5A 1K02A 3KL0A 1JPKA 3W1RA 4N4QA 4Y6GA 1UC5A 1BHGA 4O8AA 2Z00A 4XD3A 1QR7A 3DH7A 1JL8A 3L12A 2YDSA 5JBDA 3GZAA 1T99A 1W9XA 1KCZA 3EPMA 3NO3A 5AC6A 3T78A 5I5RA 4J27A 3WD2A 7ENLA 5GJMA 3AUOA 1EJUC 4IQDA 3H6OA 3AMLA 3SEPA 1JZ6A 1DL3A 4HBKA 2XIOA 4LVAA 4N42A 1PCWA 2VGIA 4IIDA 1XP3A 3LRKA 2G97A 4GI9A 2WWDA 2FPTA 1OABA 3RCYA 2CPUA 1KTBA 3MMWA 1YXCA 1V02A 1H7RA 3N9SA 3WQ6A 2VGBA 1WDRA 4L9ZA 3LHWA 2MANA 1KC7A 1VD6A 1DE6A 1XYFA 3FJ4A 3CEPA 1GYLA 3ECQA 4MTVA 4LY4A 5D2VA 3S6TA 3R8RA 5FA5A 2A3LA 3NZPA 1XXXA 3AMGA 1QNPA 1RY8A 2OEJA 1CDGA 3EWXA 4C6LA 1B3VA 3M6YA 2YL8A 3PS7A 5TD4A 4CNTA 1RXOB 1G4EA 4D6EA 2VGGA 3PVFA 3FJ6A 4MB1A 4LU0A 4N6EA 2Z6IA 4XVDA 4YU1A 4ACYA 2Z1KA 2J66A 3T44A 1L9WA 4S3DA 2KZHA 1TWDA 3EBVA 1S3TC 4OVXA 3F4VA 3FYYA 2VEKA 1YX1A 5AC8A 1N2VA 1BGAA 1NDZA 3A47A 5HNNA 3URAA 2EJ1A 1F8MA 2Z29A 1TPH1 2WVTA 3ZVHA 1V03A 4Q4PA 1OC5A 3BAXA 4ZMGA 4ZGYA 2OX1A 1MO0A 4M1BA 5I23A 1KM6A 3DHPA 3VOFA 1ZPTA 3CHDA 1Q63A 4I7UA 3AICA 1GKRA 1NWSA 3NNTA 3GO2A 2PODA 1L0PA 1UD4A 4AVFA 2PDGA 1Q7ZA 5LNUA 3ABRA 2PDYA 4HZ6A 1Z32X 4XO7A 5IOBA 5IXEA 1N8FA 5F2MA 4Z17A 2VFIA 1DIDA 5A95A 2D20A 3T81A 3WQEA 4JDBA 4XO6A 2GQ9A 4EWJA 2RDWA 3KVMA 1M68A 2XWEA 1ECQA 2Q09A 3SW6A 3G0UA 2NUYA 3S9YA 1CLXA 4IUGA 4M81A 3FVMA 1CYGA 2Z1SA 2E7FA 3IANA 1KQZA 1NH6A 1V02E 5CZKA 4UOJA 5F1UA 3MPGA 4MJ4A 3KM8A 4MAVA 4NYYA 1XUZA 4DF0A 3AISA 2AMGA 1P1XA 3CGTA 1I1WA 1XL9A 3W26A 2WQDA 3DFNA 1IIHA 2QDGA 5LA1A 1IGWA 1E0XA 3AI0A 5AOUA 1POJA 3SI9A 3QMRA 4GZEA 5M3WA 3HV8A 3HMCA 3ZJ7A 2JEQA 3IV3A 1HO4A 1ME7A 1QATA 1NFPA 1JZ3A 4GQGA 1KCXA 1GZGA 1O4UA 2BOEX 3RDKA 3W1XA 1RY0A 3T07A 4J28A 4L4MA 3H7VA 2BGSA 1TMLA 1HKVA 1QI3A 3VD5A 3W3OA 1DWGM 3F4DA 4LAKA 3SJ3A 3TLLA 1OGSA 3TP4A 4ROQA 3THCA 1YNPA 1XGDA 3NZ1A 5EU9A 1HKJA 3HV9A 4UQBA 3RJYA 1C9DA 2GDVA 2C6QA 2EPMX 3NJ3A 2V9DA 3WBXA 1XIBA 1QHZA 1XS2A 1J2WA 4ZEPA 1QTWA 1CGXA 4R7OA 1AFSA 3E3HA 4CLMA 1UWIA 3QY6A 1LQ0A 1OCNA 2Z24A 4XTIA 1TVPA 3DERA 4GD0A 1TMQA 3MSGA 1YE4A 4TMCA 2VYOA 2VZVA 4L7ZA 3F5LA 1X6LA 2XFRA 3CPRA 3SQLA 2A6LA 4AHQA 1NF7A 1F9CA 1QNSA 5A8NA 4AHOA 2J25A 3UNDA 3WL0A 2WSQA 3GTFA 1V6WA 3R10A 3SECA 3HU7A 3Q94A 3TYCA 3QW4B 2EJAA 4C1LA 2V69A 4LWWA 4Q8OA 2OQLA 3MY9A 3CIWA 3L4VA 4QAWA 1TUFA 1OCQA 3BOXA 3UCQA 2GL5A 1PYFA 4DXXA 2ACSA 3LCHA 3STCA 2C79A 5B7YA 5AYYA 5HMDA 4E4PA 1OIFA 2D2JA 3NDZA 3SURA 2QUTA 1A5SA 3TQPA 6ENLA 4QLKA 3EDDA 4PUKA 1SJDA 2ZX9A 1F74A 1E4LA 1OFQA 4H83A 5BRQA 1FWNA 5CBIA 1EZ2A 3H4GA 1OHLA 2BGNE 1HW6A 2BS9A 1DOSA 1REQA 1BYAA 4AY7A 3MU7A 1GQNA 2OWXA 5KMYA 4BK9A 4U3AA 4AVOA 1G9HA 2A7PA 2WC7A 5KTLA 1IT0A 4P8WA 4TMBA 4HN4A 2VJXA 4XZNX 3KBNA 3EGJA 4HK6A 1PWLA 1DIEA 3M4HA 4JHZA 4AC1X 4LBUA 4F0KA 2BHUA 2FHBA 1L8NA 4S3EA 5D04C 3U5YA 2UY4A 3PUGA 3CWNA 1NEYA 5HQMA 3IIXA 4DBDA 3CZGA 3ZM8A 5JVLA 4H41A 4CQBA 3E12A 3QEZA 5D9NA 3SQMA 2GFTA 4GVGA 1KB3A 2I5GA 1H60A 3A64A 1VBRA 1J9YA 5I0DA 5E0FA 2NVAA 3RU6A 5MKGB 4D72A 1JZ5A 2WCSA 4NJHA 3ZJ6A 1DIOA 3O0FA 1K8ZA 4L6DA 3K13A 2LLEA 4R85A 3LEPA 1W3JA 2F2KA 3AHVA 3O6AA 3TSMA 3P5YA 2ZTKA 1AW5A 3W37A 2YJQA 1M3UA 2TSYA 4AY1A 4QISA 3TYZA 2NW0A 4B9YA 3Q45A 1K7XA 1SU5A 2BG5A 3UNTA 2ZRXA 3K4AA 5JMUA 4TVUA 3QHNA 1WYIA 2V2HA 5DX7A 4N02A 1G7UA 3N34A 8RUCA 5J8LA 3E5BA 1RHCA 4E2BA 1GEQA 2XH0A 2BHYA 2NQZA 1I60A 3OVGA 1UUMA 1M7PA 4O1DA 1K6AA 1WZKA 5M2FX 2IKIA 5D8ZA 2PRMA 4A8LA 3RLUA 4CNUA 1R3QA 1OINA 1SPQA 3LRMA 4S3BA 1JDEA 3U6WA 3NSNA 4O13A 3V5OA 4WJEA 1WXJA 3EA3A 5DY2A 3EXSA 1IZJA 1PZ3A 2BB0A 3TOPA 5C2XA 4QDPA 3WK1A 3UYCA 3IIOA 2OG9A 2NXHA 7REQB 3D3AA 3R89A 1E1FA 2QUMA 5AC4A 1MZRA 4MF4A 4DZHA 5I3DA 2OB3A 4KF1A 2RAGA 4KT2A 1CGUA 3U4AA 1OD0A 5A6MA 4IM4A 3EOEA 1NJJA 2QJIA 4WR3A 3WNKA 5LIKX 3UZXA 2CNCA 3VIKA 3OJGA 2X41A 3QTGA 1R9ZA 3TFXA 1RQEA 3UPMA 5FJIA 1KV5A 3W07A 2PE4A 2WKLA 5E0CA 5FESA 1GW1A 3ABXA 3RPTA 4E2OA 4AZCB 2ZX5A 1HL8A 3O16A 1RA0A 1EKOA 1K7EA 2DT0A 4V2XA 4E5TA 2ZTJA 1S2WA 4B90A 1LLZA 3IVTA 3A22A 4KEVA 4UTWC 1RCQA 5HQEA 3UZJA 4X0NA 5A6JA 1LT8A 4QAIA 2PWUA 2VC6A 2YDAA 4REQB 3WDIA 4GA8A 5BW6A 1KFBA 3UJRA 1GQJA 4IXHA 1KWGA 5FJOA 3N14A 3NL6A 3NDYA 4AC7C 3S2NA 3S42A 2TYSA 3HFTA 2V3GA 3V1HA 4IPIA 3BOFA 2V3FA 3P7YA 3R11A 4O12A 3QLDA 3KHDA 2OOGA 4D8LA 2GQ8A 5E9XA 4HIBA 7A3HA 2ZZ1A 3LQLA 3BO9A 4RZ4A 1DJXA 4ICNA 1XYCA 3SRKA 4Z0JA 4GX9A 4WF7A 4OFCA 1A5MC 1V79A 3IVSA 3VO0A 1EF2A 2D73A 3GIYA 1FUYA 1W1TA 4M6UA 1XCWA 1FWEC 1SR9A 2G4JA 3FXYA 4JIRA 5I79A 2FMOA 3MVTA 1IHIA 3OPSA 4RCXA 5A3HA 1X1NA 1C8QA 2QDEA 1FWBC 3G24A 1GZ1A 1SFJA 2RGLA 4IGNA 4WSHA 1M7JA 1B3YA 4AISA 3L65A 1E6XM 4CNOA 2HWGA 9XIMA 2Y7DA 3DHDA 3C2YA 1AK5A 5M17A 2P0OA 1I1XA 2WSPA 6PTDA 3VIOA 1YTEA 4UNKA 4WD0A 1OQFA 3V0TA 3W81A 1OFPA 4IT1A 3A21A 1OYBA 4DWSC 4ZOBA 1FQ0A 1KXHA 4JCMA 1LRNA 4C6MA 1OT1A 1VJZA 3W7JA 4F0HA 3HPAA 3I10A 3D0CA 4P2VA 1AA1B 3EDFA 2Y5JA 4D8AA 5BU9A 1CB7B 4H9MA 3VDGA 3W7KA 3CPUA 4HYRA 3FDKA 6A3HA 4QRNA 5CC5A 4JEJA 2TODA 1EBGA 4K7YA 2GSHA 4N6FA 5AHMA 1K8XA 4GHRA 3UJFA 4CN1A 5GNXA 3WK0A 4DJEC 1JCLA 3QH2A 3PM6A 4CNPA 2IXUA 4CD5A 3KVKA 2OMAA 4Y9MA 3PZGA 2WYSA 3WYZA 2DZUA 4OUIA 3U2OA 3N4EA 1O68A 4HPJA 3H70A 2V81A 3O3RA 4DM1A 3LK6A 4N9DA 3E49A 2NQ9A 3DX5A 3O8AA 1SW3A 3LDVA 3IGXA 2XVGA 3RGTA 1O1ZA 4JTKA 2P1FA 4HHLA 3LTSA 3WMCA 2ZZ7A 2DVUA 3CUJA 4UQDA 3LXBA 1AQMA 4NJKA 4F9DA 2E5DA 4GYPC 5K4XA 2DEPA 2I9UA 2OO6A 4G1KA 1QHPA 3K4WA 4JKLA 1GOIA 1KXQA 2ASHA 1FX6A 1JG9A 5AHEA 1JDDA 2I57A 3WBWA 2P3EA 3V35A 4LCSA 1V7AA 1GJWA 1TJ2A 2D69A 3VNZA 4IPNB 2YL6A 1N7KA 3UZWA 1EF3A 2CBJA 5HWNA 3N12A 3QKEA 4AEEA 2GGIA 4DLMA 3BAIA 4PB5A 1ESWA 4X60A 3QM3A 2C16A 2D2OA 4PL2A 2EPKX 3U2CA 4JN6A 3ERPA 5F2LA 1C91A 4TX9A 3DESA 5AHFA 4C60A 2RHGA 1G67A 2YCLB 2NWSA 1CEOA 1ZBCA 1H41A 2DSZA 2Q01A 2DIEA 3OHIA 3MHUA 4GI4A 4ZCWA 1WZLA 3LI1A 3ABSA 3LNMA 4J3SA 2ZWYA 3L2LA 2Z2BA 2A7RA 4O19A 4GYJA 4L4PA 2V5LA 3UF9A 3RJXA 4LVBA 3ITCA 3GTHA 4O8RA 3ZMRA 5ABGA 1CLKA 5I77A 1PS9A 1R30A 4ZB0A 1R3TA 1CGYA 1XD0A 3K4DA 5AHLA 2PBOA 5XIMA 4GISA 1H61A 4JS3A 5G4HC 2D2HA 2E25A 3C8NA 4F48A 1JRCA 4C6DA 3BARA 3IGSA 4FOKA 4H8VA 4AYSA 5G4WA 3UWEA 3WN6A 1JNDA 3N1AA 4DF2A 4PEEA 3EWUA 4ZODA 4MUZA 1KM4A 5HATA 4CNSA 1ONXA 4S2BA 3S47A 4YVVA 3WD4A 3B4UA 2XIIA 3RM8A 2YBUA 3W22A 3EDJA 1AZ1A 2IKHA 4WOQA 1ONEA 1W1VA 3RX4A 3VKDA 4NX0A 3OGRA 2DZTA 4S39A 3CMFA 3GVVA 4MB3A 3GIQA 3GR8A 4TTUA 2TAAA 3AIRA 2OTDA 1V3LA 4GVFA 1P6WA 1Q6RA 4WKHA 3AXMA 4FR6A 3VX0A 3S46A 2PPGA 1XDJA 5J04A 1YDNA 2HK1A 4HNNA 3GLCA 3NOEA 4K37A 2PP1A 3PZIA 5HANA 1EGMA 4KEUA 4MYXA 4C6EA 2GGHA 1NDVA 5EGRA 3OQ8A 3W2MA 1TUXA 1US3A 1FH7A 5EPDA 4B5VA 2AMXA 2G3IA 2WMKA 4ACZB 8A3HA 4AD0A 4GKLA 4MLRA 4PB4A 1OEPA 3B8SA 4RR4A 1NWRA 3JRKA 1DKWA 3ARRA 1SMAA 4IMFA 2WHLA 1I2PA 4QS5A 4FALA 2G41A 3MDWA 1JGMA 5D09A 3NR0A 4UNLA 4D2JA 5IFPA 3MUAA 4D6DA 3CUGA 3UXKA 3CUZA 3DZ1A 3SCPA 4PR4A 1EUAA 3SGZA 3M43A 2PDCA 1ZLPA 1S2TA 1O1HA 1EJXC 3N2CA 2WZIA 2J7HA 1HL9A 1E6NA 1IV8A 3TR9A 1TQXA 1MUWA 3V16A 3VKKA 3WDPP 3P81A 3GR7A 3M41A 2WNZA 1VFSA 1FHDA 1HFBA 2E6AA 5CZSA 1J5SA 1C7SA 3RLGA 2YZRA 1QPKA 3MKVA 1W1A1 1TFVA 5DT7A 5T8GA 4M5PA 2ADAA 4UTFA 3QLLA 1GG1A 3THUA 1UIOA 4IX2A 5J5RA 5H8PA 1HGYA 9XIAA 1XLEA 4EX4A 1XINA 2WCGA 2NZLA 4JCLA 3OA3A 1UR2A 1PXGA 4FX6M 3OGSA 1UH3A 4W8AA 1FTXA 2O4QA 1QVBA 1UCWA 1XYMA 1RD6A 3O7UA 1EBHA 1J0KA 3ALFA 1WKEA 4ADUA 4GZ7A 4JZ5A 1LQ2A 1OT2A 4NHVA 3CPGA 3TAOA 4NYUA 3ZSTA 1QBBA 3W76A 4IPJA 1ZS2A 4UTTC 2F8QA 2RDUA 4IGMA 2TMDA 3VFLA 4K39A 6XIMA 4LUTA 4E4UA 4UTLA 4ZOEA 5DN1A 3LCFA 1I8JA 3CB3A 4MJMA 3OZPA 3W75A 1XDLA 1JRBA 3FYPA 1QT1A 4UQCA 4IH3A 1P4CA 1OFEA 3UG8A 1VFHA 3UXDA 4UTMA 1XYLA 4AIOA 3D46A 1H5YA 3BLEA 3D47A 1WA3A 2E67A 4J3VA 4MB4A 1PKYA 4QXIA 2NSXA 4GUFA 1OGGA 3C4UA 1S2VA 3TCSA 5HDRA 2DV0A 5LYRA 4PMXA 4NUWA 3RPDA 2BY0A 1R5YA 3QR1A 1EO5A 3C8FA 3ENLA 3Q2DA 1VYPX 4M0XA 2R1LA 4NIRA 3EOOA 2W6RA 4ATLA 4QSFA 4CVWA 1V6VA 9CGTA 1B57A 3GQYA 1JGIA 4ROPA 1U1HA 4NSBA 1TE1A 3LN3A 3VIIA 5FOOA 2A21A 3UYIA 2P53A 2CHRA 4BKNA 4WJXA 1BRLB 2PZNA 1V0MA 3AU6A 4YN5A 3N25A 2P88A 4UC5A 3PF3A 1QASA 2BFGA 2VFDA 1HP5A 4ZO6A 2QIIA 2R1NA 1HT6A 3HN3A 4YL2A 1OC6A 2FLIA 3LPPA 4IL0A 2D0FA 1P7TB 1EEPA 2CZFA 3QOMA 4X22A 3JS3A 3RCNA 2PTXA 3GHRA 3JU2A 2RJGA 1GJPA 4L9YA 1OJXA 2ZOXA 1MQRA 1FWIC 2UV8G 4S3FA 2NVCA 2TPSA 4MVAA 4XKMA 4F66A 1WZMA 3ZR6A 2E6FA 4Z2KA 4L56A 1IXQA 1FDZA 3DYMA 3PPHA 4UFKA 4IG2A 4JYDA 2QCMA 4O1AA 3NQ6A 3THAA 2I5IA 3LHYA 2BOGX 1CENA 3H7UA 5HOSA 1NQKA 3S3GA 3M0JA 3BMVA 4H8NA 4YS1A 1WAUA 5KZMA 2W0UA 3GWQA 4FS9A 3GXPA 3LTYA 4YIWA 1X7FA 5C2GA 2ZXAA 3MJYA 4O57A 1B9BA 1QCWA 3NZRA 4PN2A 2QR6A 3B06A 1LM1A 1DPMA 3VOJA 1FWSA 3B05A 4G7EB 4F79A 4WGHA 2ZVIA 1UZ4A 5C70A 5ABEA 3E0FA 1EHNA 3VDHA 5EYWA 2ESCA 1GQKA 1SVDA 2ZDSA 4J3WA 3EWWA 3HQOA 4CQ9A 4XWUA 2WNNA 3EB4A 4I6VA 1SZFA 4DNMA 3GH4A 3L4TA 1CECA 1KBBA 2VX4A 1VBHA 2HZGA 4ZFMA 2NQJA 2YIHA 1W9VA 4CD6A 1S5NA 1XX1A 4V27A 1EHAA 4LV9A 4JIPA 4IJCA 4C90A 3G2GA 4GIAA 1JULA 4KCTA 4JEQA 4W9TA 2OGYA 3QKZA 4EACA 3M0IA 3U2ZA 3WLTA 5EFFA 3LSBA 1LRQA 4KWOA 2OSWA 1T8XA 1U22A 4QJ5B 2YA1A 2ZICA 3W2LA 5CGMA 2Y61A 4DJDD 2RGMA 4AIUA 4PMOA 4ICCX 1NTHA 2G4FA 2CZVA 5CLWA 3WLHA 3ANVA 4F9JA 1RJRA 1MXGA 3QR3A 3L4XA 1O60A 3I68A 3D3FA 1TZ9A 2WLYA 4UTJA 3WQ8A 2QF7A 2WW5A 4LYKA 5FI8A 3AQUA 4FPSA 4AY8A 1CXIA 2DZWA 3NQ7A 3KWSA 2XWDA 3WF1A 4IPPA 2EAWA 1BGGA 5C9RA 4JR5A 1MVYA 3VGDA 4JTCA 1FHUA 4WZHA 4P8XA 1C93A 3REQA 2E8YA 4QITA 3EZ4A 4QCFA 1KR0A 3S5SA 3I7SA 5C2CA 2PWGA 4HOWA 3H2OA 2QAFA 5CZJA 5K9DA 1TJPA 3KL3A 2GUYA 4Z1CA 5JH2A 1YNYA 1TO3A 4FLSA 3R58A 1BYBA 1TRIA 1WUFA 4B5UA 3W38A 4FHAA 1TPC1 5BU6A 4ADTA 4C7DA 4OECA 2Z28A 4PRWA 4PMDA 3KHJA 1V08A 2REQB 4C1NA 3G1RA 2XPKA 1GPFA 2X1UA 1J10A 2CLKA 1JF6A 4J3ZA 3CUFA 5E0KA 1ML1A 4HK5A 3S2MA 3ZJ8A 4K1WA 3TR2A 1SR0A 3KP0A 5DXXA 4EXBA 4W7WA 5ABFB 4AIEA 3UQNA 2DQWA 1XYAA 2WVVA 4NKCA 1O7AA 3W6YA 4MWAE 4CD4A 5T26A 1B9ZA 3NIYA 3KDNA 2XISA 2BLEA 1NVMA 3VMPA 1IR2A 2VR5A 1JI1A 2IQTA 3OTRA 1E0VA 2OOFA 1VJIA 4CCDA 3R8HA 3DFYA 1XBXA 3ARXA 1HVXA 2JGYA 2BVWA 2VEMA 1WXZA 2YLAA 2G37A 2QUUA 3REQB 2QLYA 3M0HA 4DM2A 1CWYA 1EXBA 2G3MA 4DX3A 2NLYA 1GONA 4UIOA 4KWVA 4CQCA 1FVPA 1MDRA 2X09A 1B4EA 4OBTA 1PCKA 4M3PA 3QF0A 4EWND 1EC7A 1UA7A 3HMJG 2X7WA 3IGUA 5LXEA 4JTDA 3LB0A 4OE7A 1XLHA 1EGVA 1QPQA 2WNQA 4B5TA 1T0OA 2Z25A 5GPRA 4R5EA 5D33A 1BG9A 5I07A 3K46A 3WLSA 1MXDA 1XW8A 4HOZA 3P3BA 3WJWA 1UWTA 1S5WA 1JJKA 2QPXA 2BVYA 4HSNA 3II1A 3WBAA 5A6LA 4AEOA 1A5KC 3IAPA 1US2A 4UTIA 2EKCA 1V0LA 1RCOB 3Q65A 4B91A 4DPQA 4JTHA 3B9NA 4L65A 2ZC1A 3AMKA 3B0PA 3B97A 3DCPA 2AQOA 4LPCA 1EO7A 3HJEA 1EJRC 1XSJA 1MDLA 4GYKA 4HZ7A 2ACUA 3N15A 2O92A 5H91A 1YBQA 4G8TA 3GHTA 1H5VA 1MWOA 2PSNA 4JFUA 4X61A 5IRPA 4EKJA 2C0AA 4FIRA 4O50A 1TE6A 2Q02A 3MA8A 1ADSA 5LHEA 3F4NA 2VZUA 1H2JA 4PE8A 2VX6A 5A6AA 1TTQA 3MWCA 2EEXA 3BJFA 4Q4QA 5I06A 3S1VA 3K30A 1ENUA 3A4WA 3G8RA 2R82A 2GWNA 1V3JA 2X05A 3KXQA 3IGHX 3VE7A 1PJ9A 4LS0A 4KWWA 4C65A 4IFOA 3I7RA 1OK4A 5U4NA 3R0KA 3OYXA 2DJLA 1K3UA 4UR7A 1ADDA 4MB5A 3AWNA 1DJIA 1AQFA 1DWHM 1XG3A 3AZRA 1OF6A 4E8GA 4CN4A 3CAVA 4Q8UA 3E5PA 4GLEA 3MSRA 4Q33A 4PZVA 2WK2A 1EP2A 3HPXA 1UHVA 3SSZA 1Z42A 1ZQ5A 1QBAA 4RE0A 3NPVA 1DJHA 2GJNA 3TWAA 1D9EA 2J7EA 1VYSX 3BLOA 1F7BA 3RX3A 2JKEA 3ORWA 4V28A 3RRAA 1FFRA 3TCEA 4LAOA 3AZSA 2PP3A 1EDTA 3H2CA 2I5QA 3QZAA 1Q6OA 3MHGA 4ZZ9A 1TWWA 3GG0A 4JFVA 3O6DA 3WF2A 4LGXA 3B03A 2DFAA 4K36A 5CSYA 4UFIA 2EF9A 3MMTA 3TSBA 4LBSA 2ZA2A 1VFLA 2ZUWA 4B5XA 1AH0A 1WKYA 2GSJA 5CPOA 4PL1A 5GNYA 5I3KA 2VZSA 2Y0FA 4LXFA 3N13A 3N17A 3CXOA 2QYGA 3RUBL 2JALA 3OB8A 2A2IA 2E4TA 5DQPA 1F07A 4JX4A 1ICSA 3EYPA 1UUOA 4F2TA 3ARUA 5A8OA 4QSHA 3M7SA 4LAMA 3SUVA 3NQDA 1SO6A 4JIEA 1JZ7A 3M5YA 1GTHA 2E5CA 3VOIA 2OWWA 3WJXA 1V0KA 3VI2A 4L61A 5CEWA 4N0RA 4C6OA 1XGEA 1OB0A 1GUVA 2V2CA 2HK0A 2ZRYA 2JFEX 1EDQA 1LLWA 3WLIA 4GI6A 1LYXA 3TNBA 2X0HA 5DMYA 2PWEA 1TR1A 1FWJC 4NAFA 1NP2A 5CLTA 1LLOA 5HK4A 2B7QA 1M9HA 1M04A 3VFCA 3F2BA 3C2VA 1EJVC 2FFCA 4M6QA 1ICPA 3W73A 3T2PA 3WQ5A 1KW1A 2PGRA 5FSEC 4QDWA 1ZY9A 2WHJA 2CZEA 1QO2A <