2CLIA

Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
258
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 101
structure length 258
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cliA00
2XN1A 5AHEA 5U4NA 2WO5A 4JR5A 3UY8A 5F4SA 3H53A 5AB3A 3NPWA 3B04A 4JTHA 3CWNA 2J9YA 1OFPA 5G4EA 1OK6A 4UTMA 3PAJA 3PBUA 3WJZA 1JCJA 2V9DA 3NVTA 4FNTA 1J5TA 1KM6A 1X1OA 3MI6A 4AHPA 3PBWA 4RZ5A 3IVUA 1Z48A 4JYEA 5FF0A 2GVLA 3TQKA 1SW0A 2QJIA 1NVMA 2C0AA 5BMWA 4MFEA 3W86A 3W7JA 1SO3A 3CTLA 4UNKA 1DVJA 1GWJA 1MO0A 3W1MA 5HNRA 4MFDA 2XN2A 4DEFA 5CGQA 3W87A 4PA8A 2GJLA 3UWZA 3PR2A 4CQ8A 4MVAA 1N8FA 3ATZA 3QRHA 3QMTA 3LHWA 5FEZA 1EUAA 3LI0A 3U8GA 4O1CA 4YL2A 1U5JA 3Q94A 3TC6A 1FDZA 4O1BA 1FWSA 2QCLA 3W3OA 3BO9A 3W7OA 2C15A 5LNSA 4UMBA 1WX0A 5DXYA 1BKSA 4JYDA 3QPYA 3OA3A 1RD5A 4NXSA 2FIQA 1OFEA 4UMAA 5D2WA 2W79A 1JULA 2E1DA 4FX8A 1SZFA 2ATMA 1H63A 3G1SA 4RXFA 4EWND 2PE4A 5U7SA 3DZ1A 2RH9A 3BARA 4O8RA 3LGEA 4MLRA 1XFBA 3GDTA 4O12A 1UUOA 4JX4A 1J4EA 3PUDA 4KFNA 2YCEA 2FFCA 3W7KA 1W3NA 3ZS4A 1W5QA 3GXNA 4FX6M 4LUIA 1QAPA 2CZEA 4UTWC 1TJPA 4A3UA 2Y61A 3ABRA 4OU1A 1H60A 4HKPA 4I9AA 4R33A 3W88A 3A21A 1N7KA 1VPXA 2J88A 1O5XA 3IEBA 2QUVA 3SZ8A 3W7DA 5DY3A 4JTUA 1ONRA 2B7OA 2YFNA 4NNCA 2DJXA 3A23A 1ZFJA 3HPXA 3THQA 3W1TA 3B06A 3KVMA 4AHQA 3UPWA 1FXQA 3HGJA 1SZNA 1NF0A 3INPA 2NX9A 3JRKA 3SI9A 1OX4B 3OIXA 3OBKA 4JNMA 3PBVA 3P80A 1K8ZA 2BLEA 2NWSA 3M5XA 5CZSA 2GUUA 1TQXA 1VYSX 3QMSA 3C52A 1M7PA 3MI2A 1NF7A 3ZFHA 1LYXA 5IBXC 3NGJA 3STEA 2VFEA 1KM0A 5LNRA 2ZRVA 4Y6GA 3GXTA 2YZRA 2G96A 4OV4A 5CKSA 2A21A 1IXOA 4BWLA 3EWZA 1ZALA 3PWAA 2ZRUA 4NZJA 1DHPA 3PUOA 2C6QA 2WV8A 2VFGA 4LS2A 1KTBA 3G0SA 4GUJA 2C1HA 2X1TA 5HMSA 3M7WA 4B5NA 3T40A 5CG7A 4MY8A 3HMJG 3CC1A 3DBPA 2A0NA 1H7NA 2A6NA 3P60A 2QUTA 5AFDA 1M7OA 2GQAA 2B7PA 1B3OA 1B4EA 1I2QA 4DPPA 5EBUA 1LROA 1E51A 3STFA 4K36A 2R14A 2YSWA 4S2CA 3H55A 2A2IA 4JY8A 3TQ0A 4OWGA 4C1KA 3Q58A 4NQ1A 2PRLA 3S6DA 4NVTA 4HNVA 5BMXA 3E9AA 4XUGA 1S5VA 5I3GA 1QNVA 4WQ6A 1KTCA 6TIMA 1GYLA 4MLJA 2DU2A 3EX4A 3V75A 1VYRA 1UB3A 3STGA 3EWBX 1KFLA 3T44A 4ORMA 2JGQA 4IMGA 3TROA 1S3HA 5FF2A 1PVNA 4ZQMA 3AJXA 3I6RA 1IIHA 1KFKA 3JS3A 1KFJA 2ZA3A 1D3HA 2PC4A 2E09A 1G67A 1TTIA 4QQ3A 1ZJIA 5DLCA 3USBA 4CLMA 1ML1A 3W7GA 5HUOA 2GVGA 3UD6A 1GYNA 3IIPA 1SW3A 5HWJA 3TJLA 4FNPA 3G3DA 2BX7A 1KV5A 2ISVA 2HS8A 3B03A 2AQWA 1L9WA 4FIQA 3S0CA 5IBXA 4N6FA 1Q6QA 3W7MA 4JTSA 3QYQA 3M43A 1LORA 1F73A 3SGUA 2UV8G 5DCEA 5DBTA 3W7IA 3NQ2A 3TFXA 3L0NA 5K9CA 3W1PA 3MP4A 3R12A 1TPH1 1TRDA 3UQNA 1FWRA 4O10A 3W72A 3S5OA 1KTNA 4AXKA 3TJXA 4O0KA 1VR6A 4JTGA 3SIZA 3L67A 3UXDA 3O1NA 1ZAIA 3BW2A 4LY8A 4WX2A 4ADTA 2H90A 3C3NA 3W73A 4UFMA 4RK8A 3GDMA 3FS2A 4J9JA 2NX3A 1UUMA 3A5FA 3MP3A 3CB8A 4K8HA 1LRQA 3G0XA 4IX2A 4NJJA 2HTMA 1LCOA 3QQ0A 3PVFA 3P62A 1QO2A 5D33A 4M7SA 5I3HA 2JKPA 3TSMA 5I3IA 1ALDA 3QH2A 2CLEA 1R46A 5C2XA 3HPZA 1GEQA 5T26A 1XUZA 1L6SA 3VCRA 1EIXA 1RR2A 3N2MA 3QMRA 3T7VA 3UWYA 2FQIA 4UTHA 2V2HA 3CU2A 2C13A 2WNZA 2YX0A 1EA0A 1F74A 4XWUA 3FKRA 5E1QA 4YXGA 4S2BA 2Z1BA 2QCCA 5CZJA 3NQ7A 1XXXA 2FLIA 2NXGA 3Q37A 4PCFA 3KX6A 3N19B 5KITA 1ZAJA 3E96A 4MPQA 1OYCA 1RVGA 3EXTA 4HN4A 5DY2A 3EWXA 2O7QA 1Q6LA 4NU7A 3MP5A 2A1YA 1TV8A 3QSRA 4DO4A 1TCDA 1H5YA 4BF9A 3L65A 1MZHA 2J9XA 1GTEA 3W1LA 1IIGA 3LERA 4CNNA 2F7FA 3O07A 3UWVA 1KFCA 1OFRA 1HG3A 2WKJA 2EHHA 1B4KA 4LUJA 3NOEA 2ABBA 1L6YA 4K6AA 3HO8A 3W83A 4IX0A 1AG1O 4IUOA 2EF9A 3SGZA 1SR9A 4Z0JA 1SO6A 1IF2A 2A6LA 4ORIA 2ZRYA 3M1ZA 1WQ5A 1XBZA 3P67A 1QPOA 5CZ0A 2G97A 4O0ZA 2CW6A 4C1LA 4AWTA 5D2XA 3IIOA 3L21A 2DZPA 3BGJA 3DI1A 3TH6A 4UNLA 1P0KA 4BI6A 1A5BA 2Y85A 2BZNA 5I3KA 3ZWSA 3NQEA 4HPXA 3P82A 4TIMA 3W7PA 2ALDA 5DELA 1RV8A 3S42A 4GE8A 1K7FA 2YR1A 5HWMA 2AAMA 1H7XA 5K4XA 4WXZA 1HUVA 3IGSA 2ZYFA 1XI3A 3W2LA 1YADA 2I9EA 4ZL1A 5KZEA 1K7EA 5C55A 3HB9A 5MHBA 4ADUA 3CIWA 2OJPA 1IXPA 3L68A 1V5XA 3NPUA 1XBVA 4JX5A 3TMQA 3LOTA 4WOZA 2RDWA 3CQ0A 3W7CA 3FJLA 4BFAA 3LLDA 4O1DA 3OHIA 5G1YA 2VEKA 1TV5A 5BW6A 5EPDA 5HR7A 1H7WA 3STCA 3SFKA 2ZTKA 4JEQA 2TYSA 3LHTA 4TMBA 3UNDA 3DFNA 1F6KA 1GVSA 2CLHA 4DPQA 1QPQA 1O60A 2HMCA 4O18A 1HL2A 2VOMA 3L9CA 1W5NA 2G5WA 2C19A 2HS6A 2X1UA 3QF0A 2R91A 3NQGA 1OFBA 4E0CA 4IXHA 1FBAA 2V5BA 1SZGA 1W5OA 3HOJA 3WK1A 3NM3A 3GLCA 3FEMA 1TPVA 4M6VA 5FF7A 2TSYA 1AW2A 4LS0A 4YMZA 4O28A 3W1QA 4O19A 3P5YA 4JIQA 4PL1A 1EP3A 5D32A 3W85A 3ZR4A 2NUWA 3O06A 1OYBA 1FWWA 4NNAA 3M5ZA 2P10A 3TW6A 3C2FA 4N9CA 1TJRA 2YW4A 3LV6A 4WY0F 3RFAA 4AHOA 4RLIA 3LHZA 3DFPA 3WJSA 3LXBA 1G69A 2E68A 3GYEA 2PRHA 4TU1A 3S1UA 1TMHA 1KLYA 1KW1A 2V2CA 2RDTA 4UTWA 3OVQA 2ZQ0A 2CLMA 4ALDA 1WOAA 2JK2A 1PL9A 5AYXA 2Q3OA 1SFLA 3LCGA 1G4TA 5AC6A 4HSOA 2CFFA 3G3MA 3P8IA 2RKXA 3OEXA 3A22A 3LTYA 2VC6A 3KAOA 3FYPA 1THFD 4OBTA 4M6QA 4N4QA 4G1KA 4Z1DA 2NUYA 4WZHA 5CPNA 3NM1A 1LP6A 2Q3RA 3EEGA 5FEPA 3BG3A 2QDHA 4H4IA 3B0VC 1SQ7A 3NQ6A 3U2OA 3CHVA 4CCCA 2FDSA 2YYUA 3NNTA 1YDOA 3ATYA 1GOXA 3G1AA 4POCA 1TTPA 4LV4A 4PC8A 5LHEA 2C14A 4ZQRA 1DQXA 4K7VA 3H54A 2Y6ZA 1VJIA 4LTSA 3KFTA 3HGRA 4I7VA 3W76A 1O5KA 1QO5A 3QSTA 3O05A 1P1XA 1F7BA 1UJPA 1A50A 4UTTC 5D05A 2I14A 4AVFA 2NZLA 1ICQA 5F2GA 3LXCA 3FKKA 3L2IA 3GDKA 1TB3A 4Z1BA 4QJ1A 2DZSA 4LOCA 3TK7A 1WOBA 2QJHA 1S5WA 2FPTA 2JBMA 2QJGA 1WAUA 3QZEA 1JUEA 3QW3A 4NT0A 3C2VA 1XDMA 4JYFA 1VRDA 4GUFA 4MYXA 4ML9A 1H7OA 1ME7A 2DJLA 3LCFA 3N9SA 3T78A 1AW1A 3OG3A 4FB7A 2A7PA 5KINA 2NV2A 1TPB1 1ZAHA 3NDOA 1V7YA 3O16A 5D02A 2QDGA 5KMYA 3GZ3A 2DZTA 3QC3A 1EWDA 3W70A 2Q8LA 2A85A 3TAKA 1XUUA 1EUNA 1SO4A 3C2EA 2NV1A 2KZHA 4GRSA 4JTLA 1K02A 4A29A 2H6RA 4KWVA 1TYGA 1VHNA 1K7XA 1XBXA 3DFQA 5FEWA 3MUXA 1QOQA 4Y90A 2WSQA 2V81A 3IIXA 1HO4A 3LCWA 3U6WA 1TRIA 5G4WA 3M9YA 5HULA 1J2WA 2ZZ1A 4XQ6A 5G2HA 4U28A 4TR9A 1GG0A 3TW7A 1F2JA 1W5MA 2NWRA 1SFJA 4JN6A 1VZWA 4UFHA 1Z41A 3W2KA 3NO5A 1KM2A 3PBYA 5LNWA 3C6CA 3UZ5A 5HINA 5H2ZA 4JTIA 2NXHA 4BK9A 4NJGA 1JCMP 4FHAA 3IVTA 2OMAA 4EIVA 2ZZ2A 3NQDA 4JIPA 4UTUA 3RLUA 3P84A 3KHJA 4E38A 3SSJA 3LCIA 3MYPA 4BI7A 4O54A 2XFWA 3PUEA 1LOQA 2J24A 1TPWA 1R47A 3G18A 1W1ZA 4IMDA 3NR0A 3ANYA 4O1AA 1JJKA 3EXRA 2BTMA 2R94A 3TE9A 3W7HA 1B9BA 1FQ0A 3DAQA 3MBDA 4NJHA 5AN7A 1VLWA 2I1OA 4M5PA 4HNNA 3HG2A 3S5NA 2Y7FA 1GVRA 1W31A 1RPXA 5F1VA 1ME8A 1H61A 3TQVA 1KM4A 3VKJA 1ICPA 5G5IA 4Z1CA 2YW3A 3T4CA 2E5DA 3PB0A 4IMFA 4KFPA 3GXPA 1JCXA 1DV7A 2FJKA 1PIIA 4Y9AA 4LC6A 3W7QA 2YGYA 1T0OA 2Z0IA 4QITA 5F2LA 4LVDA 2H8XA 1BWLA 1KBIA 2QKFA 3DENA 3A24A 3FLUA 4N9EA 4H3DA 4HSNA 2NLIA 4DF0A 2GQ8A 4LVGA 4JTTA 3L5LA 2LLEA 3SR7A 2DORA 2E6AA 5BNKA 1K03A 5H91A 3NZRA 3LRKA 5F2IA 4MZ1A 1H62A 1NSJA 3TIMA 3V1PA 1OJXA 4AAJA 3W7EA 4CCEA 1OYAA 5DCBA 3PSWA 3WK0A 1B57A 1XDLA 2R8WA 4HT3A 1DBTA 1O4UA 4DXVA 1Y0EA 2WSYA 5CPOA 3R5EA 4WJEA 5F1UA 5D30A 2GQ9A 5F4WA 4A22A 1ADOA 3R13A 3UY7A 3NG3A 1QOPA 3PSVA 4LV9A 4X22A 3BLFA 4OT7A 4D2JA 1QCWA 2CLIA 1RQEA 3LB0A 3GK0A 1YPIA 3HPSA 4DBDA 1SO5A 3DXIA 4X9SA 3RF9A 5L6UA 3A9IA 1I8JA 5TIMA 3B0PA 3OVRA 5I3FA 5DBUA 4LVFA 4K8EA 4FNUA 2YXGA 2QUUA 4GUIA 3SJ3A 3K30A 3W23A 1U83A 2ZFAA 3DHFA 4N9DA 5DN1A 1EP2A 1YLVA 4DF2A 3LXAA 2QCGA 3LX9A 4DELA 3UZJA 1LTDA 1OX4A 1C8VA 4LVAA 4ZQNA 1GG1A 1LBMA 4S1FA 1LDCA 3BW4A 2Z6JA 3UYCA 3NPVA 2Y63A 3G1VA 4U4MA 2ZRXA 5AHMA 3TCEA 3I65A 3EX6A 3S9YA 3TNOA 4FX7A 1LLWA 3PB2A 4MOZA 3LBCA 3NQAA 3G1DA 3G1XA 5FF3A 2VEMA 2ZZ6A 3GNDA 3KRZA 3W2UA 1KBJA 4AMAA 1SSDA 1X8FA 3MHGA 3FYOA 3NL6A 1MSSA 1FWTA 2EKCA 1L6WA 2DZUA 1OABA 1SPQA 3CT7A 2ZBTA 1WXJA 1HFBA 2QAPA 4ZQOA 1PE1A 2J27A 1XC4A 1X1ZA 2RFGA 1EB3A 5AYZA 4JTJA 3IGUA 3B4UA 4IWWA 1BWKA 1X7FA 2VFDA 5D03A 2YPIA 1WA3A 3D0CA 4GBUA 5BRBA 3W6YA 1I2PA 1H50A 3LRLA 1AMKA 1DORA 1GVQA 3EB2A 1MXSA 1RZMA 3LBMA 3P74A 3WK2A 4L4LA 2DZVA 1M5WA 2ZZ3A 5CZTA 1W0MA 3IGXA 3MBFA 1LOLA 5HQEA 5KSWA 4ZZ9A 3N34A 1WBHA 4HHPA 5TBOA 1TIMA 2CLOA 1KV8A 3KVLA 1WDWA 4EF8A 1GZGA 1JR1A 3MW7A 4WXYA 1W37A 4M6PA 2EPHA 3S8HA 2CLKA 4MJMA 1GQNA 3FIGA 1FCQA 4P2VA 5LNVA 2VENA 3HGOA 2ISSA 1JRBA 3QPZA 4MY9A 4FXSA 2A7NA 2RDUA 3W1NA 4EVZA 1PHWA 1K3UA 2GVJA 2TPSA 3PC0A 1ME9A 2CLFA 4O17A 3SW6A 5J5DA 3BLEA 4ZQCA 1NFBA 4KWWA 4QSHA 3TU9A 3DHDA 3NL2A 1SZEA 4O11A 3MWAA 1ZENA 2P0OA 4MY1A 1XBYA 3W2NA 4O52A 4CCDA 2ZZ7A 4GJ1A 4QISA 3LCXA 4MZ8A 4JGDA 5EL1A 3FOKA 5D04C 1G7VA 1XKYA 3WJWA 2ZDRA 1YPFA 2Q8ZA 4LRSA 2QCHA 2C3ZA 1OFQA 4LNYA 3GAYA 3PULA 3VFLA 1G4EA 3SY5A 1FCVA 4MIMA 2E6YA 4A2RA 4PH6A 1H1ZA 3EX1A 3WFAA 3NQ8A 3QFEA 3TMLA 4A21A 3BGGA 4FO4A 3JR2A 1OFDA 2BXVA 3B0UX 3W75A 5C54A 3I68A 4DO6A 4UTKA 2B0MA 3NYZA 3C2OA 5A5WA 1KFBA 1PV8A 4ONVA 3GNNA 3N9RA 4FNRA 3R2GA 4RZ6A 1SUXA 7TIMA 2Y89A 4UMCA 1W54A 4XTIA 4A2SA 3P5ZA 2GJNA 3MJYA 1VYPX 1D3GA 3MHFA 1LLZA 2YDAA 5K7JA 3EX2A 1YTKA 2ZA1A 1FDJA 4UC5A 3LHYA 1KM3A 1VGAA 3M41A 5K3VA 4JTKA 1OHLA 4PL2A 4K38A 5A8GA 1KFEA 1LOSA 2FTPA 1G6CA 3W7RA 1EX5A 5D2YA 2V5LA 2VFIA 2VELA 2X16A 4XZ9A 4MJZA 4CQAA 3DI0A 5G2WA 5SWUA 2C16A 4DQWA 5E0KA 5AOUA 4P61A 1W3IA 3TKFA 4Y8FA 5FI8A 3VE7A 4GC4A 3TFCA 4JY9A 3TAOA 3HBLA 1NEYA 1F5ZA 2O7SA 2QCFA 1P0NA 1TTJA 3T55A 4XKYB 2Y62A 4BR1A 3W1RA 4K7YA 2YFOA 5AHNA 3PY2A 4ZMGA 4K39A 1O95A 1G4SA 4IJBA 5D37A 2ZRZA 4NX5A 4WD0A 3BW3A 4GFSA 1H51A 3IIZA 4WY0B 2X1SA 3LHUA 1VCGA 5LSMA 4UCGA 3N3MA 3NL3A 3WJXA 1I4NA 3G1YA 4JX6A 2BWGA 1W3TA 5F4XA 2WSRA 5CSSA 3OVPA 4XTDA 3EKZA 4NX0A 3NXFA 3S1XA 3QEZA 3P7YA 5AHFA 1PS9A 4ADSA 5AC8A 1GPWA 2ZZ5A 3IV3A 4LC8A 5K9XA 3DKJA 1H7RA 2OT1A 3GR7A 4TO8A 3HG3A 3FA5A 4FEZA 3W1UA 3I7SA 4MYAA 4JS3A 3BG5A 1LBLA 1OG0A 1VCFA 1FDYA 3UWUA 3W1XA 3GIYA 3MI3A 1H1YA 1OF6A 3GDLA 4GXMA 2OT0A 3MMTA 4AEOA 4BWLC 4Y96A 2QAFA 4ZVJA 1W56A 2Z6IA 4QAIA 1BEUA 3LTPA 3W7NA 4M19A 2WQPA 4O16A 4NZFA 2JGYA 1ZCOA 4UTLA 3ABQA 4UTJA 4HNTA 4NUWA 1YDVA 2B7QA 1R2RA 1JCLA 2ATSA 5CSRA 4IGHA 4TX9A 3TSDA 3SECA 3L0KA 5DCDA 1YXCA 2D73A 4OV9A 3LCLA 3W84A 3CWOX 4IXXA 3UXAA 1TPUA 4O50A 1MEHA 2Z2UA 2V30A 3QW4B 4UFLA 4DBEA 3LDVA 5KTLA 3F03K 4O4WA 3DKLA 2E6DA 3C61A 2PURA 4JXCA 4JICA 2CZ5A 3L66A 3W2JA 3EXSA 1JCNA 2NUXA 3E49A 1OX5A 4LWWA 4Q33A 1A5CA 5C5YA 3R8RA 5BOOA 5D09A 2V0TA 2GOUA 3TX9A 1NAL1 1OFOA 3O6CA 4BI5A 3RU6A 3C56A 3GB6A 4R7JA 4M7TA 3ABOA 1ICSA 2QCNA 1QMLA 2ABAA 4N4PA 3IIVA 3MO7A 3EX3A 3W71A 1Q6RA 4JTEA 3W1AA 1VS1A 4GNJA 2QEZA 3O6DA 3W7LA 1Z44A 1WYIA 1TO3A 2A7RA 1DOSA 1LRTA 5AHIA 3ZWTA 1EWEA 2HSAA 4WOQA 3CPRA 2JKEA 1A5AA 4O13A 3FJ6A 1PCKA 5ABTA 1JUBA 3BPWA 4RKAA 2P1FA 3W74A 4AWSA 1ZNNA 1OFAA 3EWWA 3G0UA 2ZZ4A 1M6JA 3N2XA 4ICNA 2ZRWA 2W0UA 2ZCGA 2BSLA 2IQTA 4OHQA 3HG4A 4UFJA 5FEXA 4L4MA 1YTDA 1SSGA 2QCDA 3CLMA 1YTEA 2RHGA 3CIXA 4UFIA 3G8RA 3LLFA 1MEIA 1TREA 2CLLA 4XBKA 4OGZA 3G24A 1VCVA 4RXGA 2B7NA 1F6PA 4RZ4A 2VKZG 1DJNA 3DFTA 4HIBA 1R30A 4AF0A 5KZMA 4RCXA 1TV7A 3A5VA 2VEIA 4FF7A 1KLZA 4X2RA 2YYTA 1LBFA 3HIJA 1G4PA 2V82A 4EF9A 2E5CA 1T99A 4YCPA 2WNNA 4W9TA 1TPEA 3BVJA 3S5YA 1C29A 4Z1AA 1A5SA 5EYWA 1UCWA 3UWWA 1IXNA 5FESA 3W2MA 3N73A 1TPDA 3P81A 2TRSA 1Z42A 5GVJA 1A53A 4UTIA 2QCDB 4N6EA 4FXRA 2FB3A 4CNOA 3QJAA 4PEKA 1C9DA 1DL3A 1GT8A 2V2DA 4RX0A 2OZ0A 3O63A 1CW2A 4UR7A 5L9FA 1GVOA 2EAWA 5AHLA 4UR8A 3NA8A 4FNQA 4UTTA 3M6YA 5KZDA 3KRUA 1N55A 1OVDA 1QPNA 2Y88A 4MUZA 3NQMA 1JQVA 1AK5A 3NQVA 3GKFA 3PG9A 2DZXA 3NPXA 2H8ZA 2QCEA 4R34A 4LRTA 1RQHA 1JQXA 2TMDA 3HGSA 3HJZA 1FX6A 2VEPA 4NJKA 1XCFA 1OX6A 4RR4A 3NAVA 5HR6A 3NEVA 3CEUA 4LW7A 4I7WA 1JVNA 2NX1A 3RK8A 2WJZA 1T8XA 2CWNA 3L5AA 5C6MA 4QNEA 3CM4A 1DJQA 1ZY9A 5I3JA 4H6KA 1KA9F 2QR6A 4XKYA 1CI1A 3FFSA 2X2GA 3LM7A 3AO0A 3TA6A 5EA9A 1X6UA 2E6FA 4E2DA 4FNSA 1DQWA 5HJLA 1K8XA 3GX9A 3O8AA 1AL7A 8TIMA 1QDSA 1QR7A 3DU0A 3TC7A 4K37A 1JCYA 4NNBA 5LKYA 1IXQA 3EKLA 2QF7A 2PRMA 3ABSA 2DZWA 1Q6OA 1VQTA 3M16A 4IQLA 4IMEA 1S5TA 3LHVA 1TPC1 4UIOA 4PODA 4JDBA 4Q4KA 3NL5A 4EOUA 1K8YA 5K2ZA 4OQVA 1I2NA 3BV4A 3LTSA 3QM3A 2JKAA 3NQFA 1RQBA 1TSIA 3RLVA 3M5YA 3PF3A 1F76A 4UXDA 3C4UA 2PCQA 3UPBA 3O15A 5HUPA 1YXDA 5AYYA 1TTQA 3DFSA 4X3ZA 2WOQA 1QPRA 1BTMA 1L2UA 2DP3A 4XBSA 3GDRA 1JUKA 1F05A 4O57A 4KFOA 3TR2A 3G22A 2X1RA 2EGZA 5AC7A 1YYAA 1VC4A 3PG8A 2G95A 4IPJA 1EPXA 2FPVA 3B8DA 5LNUA 3C0JA 1MEWA 3VI2A 1Q45A 1VLIA 1W8SA 1YXYA 3MYOA 1HTIA 2X30A 2Y70A 5D2VA 1TQJA 2ISWA 3P61A 4N9BA 4Q32A 2Y7GA 4WY0A 3EWYA 3O6YX 4MKNA 4I7UA 2VFHA 3WJYA 3RMJA 1SW7A 3GKAA 1WV2A 4GWEA 3CEPA 3G1FA 4Z08A 5G2IA 2GPTA 4TMCA 3TUUA 1FCUA 4HNUA 5IM51 4PFMA 3W07A 4YWIA 4GUGA 1VHCA 2XN0A 5FF4A 1R2SA 3N14A 4WUIA 1GVFA 1KM1A 1I45A 1P5BA 3LRMA 3F4NA 1FCBA 1LM1A 4IOTA 3HF3A 4JD4A 3GVGA 3KVKA 3M0ZA 4OE7A 4UFKA 3I7RA 2WPBA 2QCMA 1OF8A 3IVSA 4O53A 5DXXA 3WK3A 3M5VA 3KRSA 3S1WA 2CZFA 2NXIA 1EEPA 1T96A 1YDNA 5E93A 5CPLA 4PTNA 2OCZA 3C8FA 3MHUA 4DO5A 4DF1A 2J6XA 4E2BA 4N02A 3RNDA 2B4GA 1AL8A 5D2TA 4UUIA 4AH7A 3DH7A 4IPIA 5EMUA 4AB4A 3E0IA 1W5PA 3UWQA 3M47A 3W22A 2ZA2A 5LGZA 1R2TA 3DGRA 3W9ZA 4LS1A 5G1TA 2FPYA 5F2MA 1AW5A 4RV8A 3S5ZA 5LGXA 1ZHAA 1P4CA 1LRNA 1XL9A 3NZ1A 3LI1A 3I7QA 3DFOA 5K9DA 2VFFA 1LZOA 3E12A 3TSBA 3LV5A 3ELFA 3TXZA 4CNPA 4Z0SA 5LHFA 5D38A 2H3DA 3YPIA 2ZTJA 3NQCA 3VNDA 4JDYA 3GR8A 3G8EA 3TXVA 1XM3A 5TQLA 1GJPA 2F84A 3F4WA 2Y7DA 3GAKA 1EP1A 3KOFA 4JTFA 5K4ZA 4HPJA 4FIRA 3Q2DA 2A5HA 2E77A 2J9ZA 1G7UA 1I2RA 1WBJA 1SU5A 3M44A 3TDFA 3E02A 4KKXA 1UASA 3THAA 2W6RA 3TV8A 1FXPA 3G1HA 4LT9A 4CQ9A 2CU0A 4RJEA 1PHQA 4AWUA 2C18A 3EWUA 4YLWA 5EKYA 4QNWA 4O4VA 3BG9A 3KVJA 4NXKA 3PM6A 4ZQPA 4LU0A 1OK4A 4QM1A 5HWNA 6ALDA 1FUYA 4MZYA 2Y7EA 3IRDA 2E5BA 5CPMA 1HO1A 1TPFA 3PS7A 5J5RA 3HQ1A 4IMCA 2A4AA 3P8JA 2AGKA 3HG5A 2H3BA 1CX9A 1FY6A 1D9EA 5LZLA 3QQ1A 3F1QA 4O15A 2CZDA 3L5MA 1H7PA 1VH7A 4GUHA 2V8ZA 4LVBA 3S1VA 4YCOA 3R89A 1O94A 4R53A 3LCHA 4O14A 2WNQA 3BLIA 1I2OA 1QWGA 2VXNA 1UBSA 4NJIA 2OX1A 3C2RA 1JRCA 1KM5A 3BK0A 1PCWA 3KXQA 5EY5A 1QFEA 1IGSA 4QIUA 4AF0B 1FWNA 3B05A 3L0GA 4N2YA 1GTHA 1Q3NA 3VE9A 2FB2A 1DKWA
chains in the Genus database with same CATH superfamily
5JU6A 5AHEA 5U4NA 3H53A 2DQWA 3NPWA 2E7FA 2J9YA 1OFPA 4JTQA 1YNPA 4GY7A 4UTMA 4JPGA 3PBUA 3VD9A 1SM9A 2V9DA 4RE0A 3N2OA 2IS7A 4KCVA 5AYBA 4FNTA 1J5TA 2QT3A 4WEVX 3MI6A 3PBWA 4DJEC 3MCOA 2Z1WA 3IVUA 4GYPC 4JYEA 5FF0A 1J93A 1Q8AA 1Y7VA 5BMWA 4MNLA 1ZJBA 1GWJA 4PB5A 4RDWA 4MDOA 1UZ4A 5CGQA 4PA8A 1YX1A 2VGFA 4ACZB 3UWZA 2XH7A 3BQ5A 4MVAA 3R8HA 3CUJA 4YTUA 4EXBA 1XYAA 2QUMA 1U5JA 5C70A 1UD2A 3WZ0E 4L1GA 2DUAA 3W3OA 4LAZA 2XGBA 1CB7B 3MMUA 4NIRA 4JYDA 2PD9A 2FIQA 2W79A 5T8GA 1JULA 2V68A 3H2FA 4FX8A 2PDGA 2VZVA 3R7MA 1H63A 1RAKA 3GYCA 5A2AA 1QBAA 4Q6XA 1RXOB 3DZ1A 4FP1A 2I16A 3VTRA 3LGEA 3I6TA 4MLRA 1R3SA 2E40A 3HPFA 4KFNA 3OZYA 1W3NA 1XLCA 3FVMA 3GXNA 3WD0A 3NSXA 4FX6M 4IG2B 4LUIA 3WDRA 1QAPA 2E28A 2XWDA 2WLZA 3WQ6A 4UTWC 1H41A 1TJPA 3ABRA 5HA7A 5C9WA 4HKPA 1R3WA 4I9AA 4R33A 3A64A 2QUVA 4KIRA 5DY3A 4NNCA 3A23A 3UPWA 4JEJA 3KS6A 3APYA 1OX4B 3K46A 2Z7KA 4MGGA 3ALFA 5E9XA 4JNMA 4H41A 5CBJA 4YVXA 2NWSA 3M5XA 1EJWC 2GUUA 1E0UA 3QMSA 3ES8A 5IBXC 3NGJA 3STEA 2VFEA 3B0YA 1UMLA 5LNRA 3REQB 3H22A 1G01A 2EXOA 2A21A 1OCBA 3MTWA 3PWAA 1US3A 2ZRUA 3W01A 1IT7A 2VO5A 5HMSA 4ZE5A 2YB1A 2OOFA 3LS9A 1V0LA 1K9TA 1K1DA 4XSLA 4MY8A 4JTDA 2NVDA 3AMLA 3CC1A 1PO9A 4AY7A 1QW8A 1B3OA 3SCNA 3SB0A 4P7RA 3ZT7A 4Z2LA 2POZA 1GVEA 1JFXA 3CUZA 4S2CA 1HKVA 1S2WA 3WEOA 4XAFA 3CHEA 4D8ZA 2D2HA 3A12A 2VX7A 2DU2A 4UOJA 2XZ9A 4FLQA 3KZPA 1VYRA 4Y9OA 3STGA 4ORMA 4KW2A 4HHLA 3GXIA 4W88A 5FF2A 1NOUA 2EG6A 3LZ3A 3EA3A 1IIHA 3M46A 1KFKA 3TVAA 3WMLA 5GNZA 1KFJA 4X9YA 3SCPA 1J11A 4PFHA 1QVBA 4DWSB 4QQ3A 1J12A 4URIA 1XG3A 1GYNA 3PJUA 1SW3A 2ISVA 3FW6A 3VOFA 4LAKA 4MM1A 2XVGA 1L9WA 1Q6QA 2Q09A 5AVNA 5C71A 1KRAC 2UV8G 5LXEA 5DBTA 3NQ2A 1K9DA 3C0LA 4UR9A 3QGKC 1S3TC 5FA5A 2OYKA 1TRDA 3OZMA 3UQNA 3L7RA 2ZXBA 4G1NA 4FMVA 3W72A 1J6PA 3UCDA 3TJXA 3LEPA 1VR6A 3SIZA 5D4YA 4QDMA 3CUGA 3K1DA 3BW2A 3CH0A 2OO6A 4CQDA 2H90A 5HK4A 3JU2A 4UFMA 3M0MA 4DJDD 3GDMA 3FS2A 4JQ1A 2NX3A 3G0XA 4IX2A 1LCOA 4W85A 2BV9A 2G37A 3UW6A 1ONWA 4M7SA 5I3IA 1ALDA 4C6DA 3QOKA 4ZO7A 1E1CB 1ZJAA 4GX8A 1R46A 5HNUA 5BROA 1EX1A 1UR2A 2PGEA 3VCRA 2GSJA 3T7VA 1A0DA 1B3XA 3KLLA 3VMNA 4IHCA 1J0JA 2V2HA 4KF1A 2QV4A 3VOCA 4YXGA 4S2BA 5CZJA 3NQ7A 3QR3A 1C93A 3Q37A 4PCFA 2OGJA 4C7FA 3PZMA 1OYCA 3EXTA 4HN4A 3VD5A 4UQDA 3CO4A 5HJYA 3XIMA 4NU7A 4F0SA 1V51A 3TNBA 1BXCA 3N13A 1LG1A 2J4GA 4LAMA 2QIIA 3MO4A 4FS9A 2BGNE 1TA3B 4M81A 3DCPA 1E72M 1X96A 1V02E 2F7FA 1OFRA 4YYCA 1HG3A 2WKJA 4U2YA 3WY1A 3AISA 4DBUA 4GYPA 3NOEA 4HVXA 1GQKA 4IUOA 3TYBA 3RIKA 5I0DA 3WLQA 4QG8A 3XINA 3GHRA 1NQKA 1IF2A 1W3HA 1TA3A 2ZRYA 1XBZA 4NZ4A 2Z7GA 1A0CA 5D8ZA 4C1LA 3QZ6A 1L2QA 5D2XA 1UG6A 3MMDA 3CAVA 2BZNA 3ZWSA 3VM7A 4HPXA 4TIMA 1OGGA 3ARWA 3S42A 4GE8A 2YR1A 4Y9PA 3OP2A 3W38A 2JIEA 3RUBL 1J0ZA 5K4XA 2EPLX 4WXZA 1HUVA 3W2LA 3WNMA 1DJZA 2XVNA 1K7EA 3AS0A 3CIWA 3VK5A 4E5TA 2OJPA 2Y2WA 1V5XA 1XBVA 2J62A 2F6XA 3W7CA 4HP5A 3AHTA 3SCQA 3OHIA 4JL1A 2VEKA 2HJPA 1P0EA 1H7WA 1ECQA 5CC5A 3Q4DA 1V0MA 3SFKA 2ZTKA 3W27A 2WVVA 3UVAA 4ES4A 1EJVC 1OBAA 3DFNA 4X0VA 4AFYA 1F6KA 4DPQA 2BVDA 4JQ4A 3SCRA 4O18A 3WD2A 4TV5A 1J6OA 2HISA 1XC6A 2C19A 4OVXA 1FWBC 3NQGA 4BQ4A 4B2DD 3E74A 1R9XA 3HOJA 3PAOA 1W9UA 4HMNA 4F2TA 1DIKA 1M1BA 3MSRA 4I9MA 1TPVA 2G4JA 2TSYA 3EWCA 4JIQA 4PL1A 1ZUAX 5CQ1A 2OQYA 3ZR4A 2NUWA 4AIUA 3O06A 1O68A 3IACA 2P10A 1XGDA 4HMEA 3BAKA 3P6LA 2GGEA 4N9CA 1C90A 2P0IA 1TJRA 2CPUA 1EDGA 2PDMA 3RFAA 4RLIA 3CUXA 3DFPA 3VGDA 3LXBA 4H6QA 2RDTA 1BVZA 3JZUA 3ORWA 3BWWA 3KBSA 4ZODA 3TQPA 5FSEC 4XAPA 1PL9A 5AYXA 1H09A 1SFLA 2J6VA 1OC7A 4HSOA 5AC6A 4DZIA 2FZMA 5LXXA 1KCZA 1PPIA 3LSCA 3G3MA 1E70M 3PZQA 2VRJA 2VC6A 2XISA 3NJ3A 1QHPA 1EYEA 4OBTA 4ZOEA 4M6QA 2HE5A 4J3WA 4G1KA 3UVIA 5CPNA 3ARYA 3WQ8A 3NM1A 4DM2A 5FACA 4NY2A 3EEGA 3B0VC 1SQ7A 2HPIA 3NQ6A 3U2OA 2FDSA 2YYUA 2BODX 1B3WA 3LZ5A 3E6EA 1TTPA 1VEOA 5LHEA 2C14A 1HNYA 3V0TA 3A4WA 3H54A 3W76A 3HGRA 3KOZA 3E0FA 1UJPA 3V7PA 5D05A 4AVFA 1MUCA 2EJAA 1JDEA 3UYIA 1EZ2A 1OD0A 3LXCA 3TWBA 4K8GA 3GDKA 2BFGA 4Z1BA 3GTIA 3I10A 1E43A 2BOEX 1XGEA 1I60A 1S5WA 3L2MA 2FPTA 3QZEA 1JUEA 1VFLA 4H7CA 3CQIA 3SJNA 2IKGA 4MYXA 5A8QA 3N9SA 2EBNA 3T78A 3PTDA 3KL3A 4FB7A 4PE8A 5DMMA 2A7PA 5KINA 1ZAHA 1FFRA 2PWFA 1Q6CA 3NDOA 3W24A 1V7YA 2OFJA 4QG9A 4GC3A 2QDGA 4AZCB 3GZ3A 1JEZA 3QC3A 4IGMA 4D6FA 2A85A 3TAKA 1XUUA 3N6JA 2DVTA 2P88A 1PTAA 2PTDA 2XIOA 3MCMA 1TE6A 3WNOA 4I5UA 1JZ6A 1VEMA 1NDZA 3DHUA 1NOWA 4INFA 4G8TA 2WSQA 3UG3A 1HO4A 3AIUA 3LCWA 3U6WA 4XQ6A 1BFNA 1LL7A 1F2JA 1W5MA 3ID7A 9XIMA 1YBQA 3OLIA 3IANA 4LPCA 1XSKA 1KM2A 3PBYA 3C6CA 3EMCA 4GO9A 1S2UA 3ERPA 4FHAA 4XK2A 2ZZ2A 5HAOA 3TTSA 3WO8A 3RLUA 2DZAA 4FOUA 3MYPA 4DY1A 1B9ZA 1O1ZA 3BICA 4F79A 2XFWA 2VRKA 2J24A 4N7QA 3NR0A 2OX4A 3DFYA 2BTMA 4DI8A 3TE9A 1VENA 3B8IA 2J7BA 4XVEA 3DAQA 1VLWA 1S2AA 3S5NA 2OZTA 1W31A 1BGGA 5F1VA 2XDFA 3K13A 3VKJA 1OC5A 5G5IA 1EXPA 3S6OA 3T4CA 3PB0A 4IMFA 2DDXA 2HVMA 4KFPA 3GXPA 4NHVA 3NIYA 5JBEA 1JCXA 3SEPA 4H2CA 3GO2A 3W7QA 2Z0IA 1OINA 1BWLA 4H8UA 2QKFA 3MUZ1 1A47A 1F8IA 2W3ZA 1E4IA 1CGXA 5I77A 4XSMA 2NLIA 3VABA 4IIFA 3L5LA 3SR7A 3KBWA 1DJYA 4PRTA 2X2YA 1A4LA 5H91A 3SIMA 1V3MA 4RPPA 4MJ4A 3RPMA 4ZCWA 3A4XA 3WK0A 1KNWA 1B57A 4WKFA 5CPOA 4D6DA 1DJXA 5F1UA 5F4WA 3NTYA 1ADOA 3NG3A 4LV9A 2Y0FA 3BLFA 5C2GA 1AZ1A 2G0WA 4OT7A 2X41A 4Q8NA 1QCWA 1S2VA 2PDJA 3BMVA 1NWRA 3HPSA 1SO5A 3OBAA 1LWJA 1UP0A 5L6UA 2UZ9A 3B0PA 4KWUA 1N8IA 1EFZA 4KEUA 5DBUA 4LGXA 1R86A 2Q01A 4GH1A 5CG0A 4FNUA 1QNRA 2FGLA 1W1VA 3FHAA 3LXAA 2GK1A 4AD1A 3EPNA 4UOQA 4ZQNA 3TYZA 1GG1A 1VJZA 3IUIA 1LDCA 3BW4A 5BRPA 3TCEA 3VZXA 3S9YA 4HK5A 1LLWA 4MOZA 3CNYA 1JYVA 1IWBA 2RJGA 5FF3A 1KBJA 5C9RA 3FYOA 3IRSA 3NL6A 3ANVA 3UZXA 1OZMA 2INEA 1OABA 3QR0A 3CT7A 2WAGA 1FHLA 2ZBTA 2PDLA 2QAPA 2V69A 1D7KA 3ZLGA 2J27A 3A4JA 4B2DA 5BXTA 2PDFA 5AYZA 3H26A 2P76A 2XIBA 1YE6A 3CV2A 2VFDA 5D03A 3C0QA 3GTNA 4GBUA 4FA3A 5BRBA 1VRXA 4LX4A 5TF0A 2E9LA 3KRBA 3UXLA 1S46A 3EMQA 1SR0A 1GVQA 3EB2A 3LBMA 2Z24A 4Z2GA 2ZZ3A 5CZTA 3MBFA 4HGXA 4I5XA 3ZT5A 1WBHA 3GC5A 4MTVA 3R1ZA 1GZGA 1JR1A 5REQA 1YW1A 5LYRA 2VEGA 3UETA 3VUSA 3MV01 4MJMA 3RAOA 4ROPA 3LSBA 5CSYA 2WVSA 2GL5A 1UH3A 6CGTA 1ME9A 5E70A 3AC0A 5J5DA 2PS2A 1A5UA 3MUCA 1NFBA 4ZOBA 3BUVA 5CJ5A 4KWWA 3WBEA 1SZEA 2ZOXA 1IEWA 1FHDA 2P0OA 3LYEA 3T4WA 1XBYA 3VO0A 2WZMA 3L4XA 2PDWA 3P0XA 1D2KA 4HCDA 3CYVA 3AICA 3ARSA 1XKYA 3S83A 5F7UA 2C3ZA 1OFQA 1Q7QA 3GAYA 3O0KA 4PH6A 4PR4A 3A9BA 3B9OA 3N2TA 3UCQA 3QFEA 2VX4A 4GI8A 4AYSA 4J7RA 3KL5A 3EOUA 1KFWA 2ZVIA 1S38A 1F4HA 4DO6A 2B0MA 3NYZA 2XWEA 4DBSA 1BD0A 1PV8A 4P7OA 3GNNA 4IMAA 1XYBA 3CHDA 1W54A 4XTIA 4A2SA 3M0XA 1ISXA 3WLRA 1AQMA 4P7QA 3VDAA 2HV5A 4CU8A 1VB9A 3S4TA 1A5NC 4AZ6A 1FDJA 2OVLA 3LHYA 2CERA 3M41A 3MUAA 3Q67A 3ZJKA 4G7EB 4O8AA 1OIFA 3WLTA 2GOKA 2ESCA 3GD6A 2QPSA 5FJRA 1CTNA 1WB0A 3SCTA 3LPOA 4MJZA 4KWSA 1UWQA 4CQAA 3DI0A 5G2WA 1E0WA 4G7EA 2OPJA 4DQWA 3S1GA 3A4AA 2G3FA 1NEYA 1XPYA 4HNOA 4IGNA 2IPWA 1VFSA 2Y62A 3OZOA 4X2PA 4K7YA 4W86A 4C65A 2O92A 5AHNA 4Q6JA 3PY2A 4E4FA 1O95A 1FVPA 3HQNA 2ZRZA 4QX4A 3BW3A 4ILSA 3B3DA 1G1YA 2V67A 4WY0B 2VD8A 2X1SA 3LHUA 3GZAA 2V3GA 3N3MA 1GQJA 3NL3A 1DJHA 4B5WA 4QSFA 1F07A 1OCJA 3EKZA 1AMYA 1M7XA 3FVDA 4ZSUA 3NXFA 3I4EA 4AQLA 4MB1A 5LA2A 3EDKA 4H01A 4LC8A 3HM7A 1JFHA 3F4CA 5I7GA 4FEZA 3W1UA 1RLCL 3ZJ7A 4GFIA 2WHMA 2VTFA 1OF6A 1V3JA 3AJ7A 3UFYA 1T8QA 4US6A 5A94A 2VGGA 2QAFA 5HMEA 3REQA 4F8XA 3VMOA 3TJIA 3NZQA 3B8SA 1BEUA 1DP0A 2QV5A 1CB2A 1WXYA 4GIEA 4TVUA 3VIFA 3W7NA 1W1YA 3CT2A 3LG3A 3WQGA 1KRBC 1RJQA 4NZFA 4AZ7A 3BJTA 3CUIA 2X1IA 3VMPA 3TSDA 3CHCA 3KWXA 5DCDA 1YXCA 1OB0A 2D73A 3WMBA 4OV9A 2WWCA 1UZDA 1N82A 3UXAA 1A3WA 1TPUA 2BB0A 3SUSA 4C60A 3SCSA 4UFLA 2V30A 3QW4B 1XLKA 1E40A 3H2AA 2L5HA 1JNEA 5GJMA 3ALGA 2VR4A 3UA3A 1UW9A 1M68A 8A3HA 5C7VA 3DKLA 1KB3A 1TR9A 5HOSA 3T8LA 3WLMA 4JICA 2KAUC 2CZ5A 1UBPC 3GRIA 3E49A 1OX5A 4LWWA 4HN8A 3H12A 4Q33A 3K8MA 5ABGA 1A5CA 5C5YA 1UROA 5D09A 1NAL1 1OFOA 4BI5A 3AWNA 1UR9A 2CZVA 4HJWA 4N4PA 5EFDA 1AODA 5FAGA 2XFYA 4GNJA 3KTSA 3W7LA 4H19A 4TOQA 1JGIA 3APTA 3N17A 4IIDA 1DOSA 1LRTA 4M0XA 3ZWTA 4E3VA 4H9MA 3EB3A 1EF3A 4NAFB 1P0BA 3PFMA 3RM4A 1PCKA 1R6WA 2BASA 3BPWA 3C8NA 1ZNNA 2ZUVA 1AJ2A 5DANA 1WO2A 3QN3A 4OHQA 1I1WA 4GD0A 4KBXA 1TZ7A 5FEXA 1UKPA 2RHGA 4UFIA 3POCA 2GGHA 4IICA 1NH6A 1GOMA 3IJ9A 4WGHA 1XLEA 3G24A 2BXYA 2B7NA 1F6PA 3F4DA 4JFWA 4JQAA 4AF0A 3WL0A 2VEIA 2F8QA 1UD3A 3RN6A 1ODZA 1LBFA 3A3WA 3AMGA 2ZUUA 2V82A 4EF9A 1T99A 1AZ2A 4UZSA 4W9TA 1TPEA 1C29A 4XAYA 1Q5MA 1UCWA 2IMRA 1HKWA 4AC1X 1WKEA 4GNKB 3W2MA 3HFTA 1Z42A 5GVJA 3CK5A 4L9YA 2QCDB 4N6EA 2BVTA 3CPGA 3AMCA 2FB3A 3MVTA 2EPNA 2V2DA 2ZIDA 4GY1A 2EAWA 4UR8A 4YTQA 4FNQA 1C8XA 3NQMA 1JQVA 1SYTA 4EXAA 3TN5A 1AK5A 1CGTA 5BCAA 1MDLA 3DYOA 2DZXA 3PWGA 3WYZA 2CKSA 3NPXA 1JQXA 4UBPC 1FP9A 3HGSA 4R85A 4NJKA 1OX6A 2WW5A 1Q8JA 3M0LA 1JVNA 5CCZA 1FA2A 2NX1A 4QXIA 3QV6A 2WJZA 3D5HA 3UXIA 1T8XA 3EEZA 1VKFA 1DJQA 1VIWA 4H6KA 4XKYA 4KPLA 1CI1A 3FFSA 4P8WA 3LM7A 3ZLHA 3TA6A 3L4TA 3EDDA 1EIBA 1DQWA 3OQEA 5D9MA 2EPKX 1R3YA 3ABSA 2PRMA 2OLHA 3C2YA 1E0VA 3QVQA 1S5TA 4UIOA 1TPC1 4E6MA 4Q4KA 3BZJA 4EOUA 2P50A 1WXZA 2JKAA 1RQBA 4ZENA 1F8MA 4WVXA 3LNMA 2PCQA 3UEQA 5HUPA 4XG1A 2WHJA 1L6GA 3O6AA 1VBGA 2FH6A 5B7YA 2WZIA 1J18A 1XSJA 2G50A 3OU8A 1BTMA 1N8WA 2DP3A 4ZE4A 4J3VA 3GDRA 1LT7A 2EG8A 3BGAA 4O57A 2WWDA 2IKHA 4K2SA 1FWDC 1YYAA 3GFXA 2FPVA 2PWGA 2BHUA 1PIFA 1OGSA 3C0JA 1EYWA 1Q45A 1VLIA 4B9YA 3RG6A 1PXGA 5I6SA 2Y70A 5D2VA 1KCXA 2Q02A 1GPFA 2ISWA 5BZAA 1GCYA 4F48A 3EWYA 3O6YX 3K8LA 4MKNA 4I7UA 2VFHA 1JPDX 3VNJA 3WF0A 4DUXA 5G2IA 2GPTA 3FAXA 3E2QA 4HNUA 2HXTA 4PFMA 3W07A 1VPQA 4IPLA 2XN0A 4PRWA 3M0ZA 3I7RA 2GZXA 2VD9A 1OF8A 3CH9A 4KRZA 4G9PA 3S46A 3IVSA 5DXXA 4E8CA 1XKJA 3ITYA 3HURA 2CZFA 1W3JA 3UPMA 1VAHA 4AD3A 3EMZA 3UZZA 5E93A 1MNZA 5E0FA 2OCZA 3MHUA 3QOMA 4DF1A 3CHFA 3MS8A 4UUIA 3ZVHB 2OSYA 3QLDA 3XISA 3TLLA 3W9ZA 3WDJA 5G1TA 4DJDA 1ZSXA 1AW5A 2WZHA 3S5ZA 4ZOCA 3NZ1A 1NARA 3PPFA 4HPNA 2XZ7A 5K9DA 1REQA 3U3HA 1KKOA 2YL9A 1LZOA 1ZQ5A 1JF5A 1GUVA 2ZICA 5FAJA 5E5CA 3QHMA 1R5YA 1JXKA 4CNPA 3LMYA 5A6BD 1OIMA 2SFPA 3GR8A 3WG6A 3DN5A 5TQLA 2F84A 3CZGA 3F4WA 1UKSA 2CHRA 4HPJA 1E4LA 1SU5A 3TDFA 2WC4A 4KKXA 1OY0A 2W6RA 3G1HA 4CQ9A 2HK1A 4RJEA 3S6TA 4QNWA 3NYDA 2Y4SA 3BG9A 4KRUA 2F2KA 4FOKA 4NAEA 4JHZA 1FUYA 1HKKA 2GUBA 3N4AA 5J5RA 4UQEA 3H70A 1H0GA 3HQ1A 3S2LA 4DZAA 5H1WA 2JF7A 4IMCA 3GU1A 3HG5A 2AGKA 2CWXA 2H3BA 1FY6A 1D9EA 1Q6EA 1Z32X 4RPQA 2ICSA 4QEHA 3IPWA 1FWIC 2QS8A 4PMJA 2PWVA 3RR4A 2RDXA 5I23A 3AIRA 1SMAA 2V8ZA 4YCOA 3R89A 4O14A 4XZLX 5HQMA 2VXNA 1O66A 3ISIX 3RU8X 2IPGA 1KM5A 1HGWA 3PTKA 2Q8XA 1K6AA 3MWCA 3RM8A 1Q3NA 1UR0A 3EB4A 3VE9A 3VGHA 3F7JA 1I75A 2XN1A 4V15A 1QI5A 5F4SA 2JEQA 5AB3A 1EC7A 3RPTA 3B04A 1NIUA 2NQHA 4DZ5A 3PAJA 1WAWA 1JCJA 5D9OA 3NOYA 2FKPA 2WM1A 1X1OA 4Q4OA 4C6PA 4B4FA 1XLJA 2P8CA 4RZ5A 5CLWA 2GVLA 3ARRA 3GNXA 3TQKA 1SW0A 1NVMA 4MFEA 3DG3A 1NP2A 2J77A 4JQ2A 3CTLA 2X42A 1BSLA 2QLYA 1MO0A 2PLJA 4ROQA 2CITA 4MFDA 3W87A 3NZGA 1DXEA 3GDBA 1QW7A 2GJLA 1US0A 4CQ8A 3JUGA 1N8FA 3ATZA 3QMTA 3LHWA 4OIFA 4C6EA 5HPOA 1GGOA 3PZOA 4UTFA 3TC6A 3BO9A 4D72A 3L4WA 1NP0A 2ACUA 4XBJA 2C15A 3HTWA 1E4NA 2X0YA 4LXFA 2ONEA 1YDYA 1LQ0A 7REQB 5DXYA 1IZCA 1BKSA 2CXGA 4HK6A 3QPYA 1RBAA 1I9CB 5A8PA 1ZBWA 3IV8A 1QK0A 1CXKA 3H7UA 4AZIA 4GZEA 4Z2HA 4QAWA 2ATMA 2FMOA 2GVEA 3G1SA 4RXFA 4QDPA 2YJQA 3BL3A 5GNXA 1JPMA 4HZ6A 1U1JA 5HDRA 3E2SA 4KCWA 3WQEA 5ABEA 1Q7MA 3GDTA 2HXUA 2YXXA 4H2HA 3PUDA 4IFOA 1ZLPA 2YCEA 2FFCA 3W7KA 2BBFA 1W5QA 3NSMA 3LENA 5A6BA 3WUEA 3A13A 1R0MA 2Y61A 1B1YA 4Q8VA 1H60A 4DYEA 3A21A 2J88A 3KEHA 1ONRA 1E5NA 3HPXA 4S3AA 4H9TA 1XHGA 4PMOA 3SSZA 2WMIB 1CENA 4TX6A 3SI9A 3FXYA 4JN8A 1WP6A 3RHGA 4ZTXA 3P80A 4AG0A 1TQXA 2VJXA 3C52A 2VZTA 3H4XA 2ACQA 3MI2A 4TVDA 1QI0A 1LYXA 2ZRVA 2G96A 3B8VA 1GVYA 5PTDA 5KZ6A 1HP4A 3EWZA 1ZALA 4R3UA 3TLQA 3PUOA 4JFUA 4LS2A 2C1HA 3M0JA 4Q8PA 3TZFA 4B5NA 3T40A 1ISWA 4GQ0A 4FAMA 2TAAA 5CG7A 4HPGA 3EGJA 2V5JA 4Z17A 1U1UA 2PAJA 4IZGA 5JH1A 3DIPA 3K8KA 3RX2A 4XZIA 2A6NA 3BOLA 5AFDA 2GQAA 1QWKA 1B4EA 4XB3A 1V0KA 4DPPA 4PMRA 5EBUA 1AVAA 1XYFA 4U10A 3H2NA 1Z8AA 4C1KA 3Q58A 1PZ0A 1KBBA 3S6DA 1XIMA 1LQ2A 5BMXA 4WJ8A 3E9AA 3H2MA 4XUGA 1S5VA 4QE5A 1MUMA 2BHZA 3G6LA 3EX4A 2GJPA 1UB3A 2QHAA 3UERA 1PVNA 4ZQMA 3AJXA 3I6RA 5M5DA 1S1PA 3EOOA 3JS3A 2VM8A 4GK8A 2DVXA 3GC2A 2DGAA 1G67A 3ZJ8A 1TTIA 4OOUA 1ZJIA 1PX4A 3USBA 4LNCA 4AXNA 1UQYA 4ECLA 3UD6A 5HWJA 5HPCA 4I6KA 3G3DA 5BXSA 2BX7A 4NILA 5IBXA 4N6FA 3W7MA 3KOYA 3QYQA 1EHAA 3BE7A 3S9IA 1UH4A 2P5NA 2W9MA 2D0HA 2FZNA 2QDDA 3W1PA 1IWAA 1TPH1 1FWRA 4AZBA 3GG7A 1KTNA 3GXMA 3GHUA 5A3HA 4O0KA 1PYFA 3H2EA 2VWTA 3O1NA 4WX2A 2D3LA 4GNVA 1MZRA 3B9EA 1O12A 5CC7A 4PBEA 3A5FA 3SRDA 4S3GA 4LBUA 4FI4A 3VILA 2OGYA 1DEDA 5M17A 4AUBA 5D33A 3EA1A 2JKPA 2FVKA 3QH2A 3W25A 1EGVA 2XFRA 3HPZA 4B91A 5T26A 4H9YA 4CCZA 1RJRA 4Y2WA 1EIXA 1R3QA 4I90A 4XD4A 3CU2A 3WDIA 2WNZA 4XWUA 4HZ7A 2FLIA 3SGGA 3AXMA 2Y5EA 3VINA 1QNQA 3URNA 3BLLA 3ZO9A 1RVGA 1XYCA 3WQ5A 2ZVRA 4F9JA 3MU7A 4CEUC 3VYLA 2O7QA 3MZ2A 1EQPA 4H04A 4LANA 4C6MA 1TV8A 3AHXA 1XWYA 2J7HA 4DO4A 1TCDA 3L65A 2AKZA 1MZHA 2J9XA 1R7AA 3LERA 1D7FA 3O07A 2PDUA 1KFCA 3WBWA 4Q7NA 3AUOA 1XRSA 2O9OA 4H7VA 1L6YA 4K6AA 3WMSA 2DZBA 2UWFA 3W83A 2R1KA 3II1A 1W91A 1A5OC 3R25A 1CGUA 3VKAA 3H2OA 2W5FA 3QPEA 2OYLA 1SO6A 4IIHA 4WR3A 1J0YA 4BQ2A 3U0HA 4B5UA 2RGMA 1DTNA 3P67A 5CZ0A 4GIYA 2YCLB 1TG7A 1GOQA 2DZPA 3TH6A 2VGBA 1P0KA 2Y85A 3NQEA 2YBTA 1QJWA 4YHEA 5DELA 3WDHA 1RV8A 1K7FA 3OA5A 1G5AA 1H7XA 4Q7BA 1ITCA 3QLLA 4J35A 3IGSA 1IYXA 1YADA 4ZL1A 5C55A 2D69A 3IWPA 3VAVA 2HBXA 2PI6A 3BMWA 4LYPA 3L68A 1EGMA 2FVLA 3NPUA 3IJDA 3LOTA 1W1B1 3WUFA 3CQ0A 1NDWA 2R1NA 1XGZA 4L6HA 2R6OA 3VGBA 4PSRA 3MY9A 3STCA 4JIIX 2X7VA 1VJSA 2XIIA 3LHTA 3GH7A 2WPGA 1GVSA 4B16A 1JD7A 2IQ0A 2HMCA 3FYYA 4LUSB 3BTNA 1ZP4A 3L9CA 1W5NA 2HS6A 2CLPA 1JL8A 1H11A 2V5CA 3TTYA 4GY0A 1OFBA 3EOLA 1ITUA 5EGRA 1SZGA 3MCNA 3H24A 1REQB 2FFIA 5A8OA 3QTGA 4GI9A 2E1WA 2Z29A 4P5UA 5FF7A 4LS0A 1AW2A 5IRPA 4YMZA 6ENLA 2FZBA 1WDSA 5E09A 2UY3A 3R79A 1OYBA 4CVUA 3G77A 4NNAA 1OADA 3MJMA 3OG2A 3NDZA 2QF8A 3NQBA 3LV6A 4YVPA 2HVOA 4HJFA 2QJNA 1G69A 2E68A 2PRHA 3S1UA 5HNTA 1JZ4A 4DAIA 3WBAA 1IWPA 2V2CA 2ASHA 4UTWA 1GQLA 4ICCX 5BOEA 4D6JA 1WOAA 4IPNB 3ZSSA 4GINA 1F4AA 3LCGA 4GI6A 1G4TA 2J7GA 4Z2IA 3WQPA 1CXFA 1TWWA 3FYPA 1D3CA 3N18A 2GWNA 3UJFA 4N4QA 1JZ7A 2AQVA 1LP6A 5FEPA 4H4IA 3CXOA 3VKKA 3HJEA 3CHVA 4CCCA 1YDOA 2GSHA 4V33A 4KRTA 1GOXA 4TTGA 2ZUMA 4RE3A 3G1AA 2V5DA 1YIXA 4POCA 2Z1XA 3VIIA 1DQXA 4R9OA 4E4UA 1O5KA 3QSTA 1E6RA 1P1XA 3B40A 1A50A 2XVKA 4UTTC 2QMKA 5F2GA 2YDRA 2EEXA 1POKA 1KR0A 3TTOA 3L2IA 2HK0A 1TB3A 3V4BA 2DZSA 1H1NA 4LOCA 4RZBA 1NWSA 2ODOA 1JI1A 5JVLA 3VKBA 4GVGA 2JBMA 1WAUA 3QW3A 1IHIA 2WHKA 4L61A 4JYFA 1VRDA 2VRQA 2YLLA 1H7OA 4OKDA 2BY0A 2Z2AA 4QFUA 3OG3A 2ZX5A 1V03A 1BRLA 2HROA 2PDPA 3P14A 2NV2A 4FOJA 4BZYA 4BF5A 3QKZA 4IQEA 2I9UA 5D02A 1KCKA 2XSAA 4DUWA 3LD5A 3W70A 2VT0A 3KHDA 4FLRA 4X63A 3C2EA 3ABZA 3VGFA 3WLLA 4GRSA 1YPXA 4A29A 4W89A 1ODUA 1TYGA 5FEWA 4Y90A 2REQB 3IIXA 1Q13A 1P43A 2A3AA 2YLAA 4KEVA 4XV0A 5HULA 3M9YA 1J2WA 3IUDA 5CZKA 5G2HA 4TR9A 4JTAA 2POTA 1NTHA 1VZWA 4DLFA 3W2KA 2PB1A 1M03A 5HINA 5CJNA 1E3ZA 1KXVA 1JCMP 3IVTA 1UP2A 3NQDA 5EMKA 4B3ZA 4WJXA 4E38A 3H8AA 4H1ZA 3SSJA 4O54A 3HFYA 3SCOA 3GIQA 4CVWA 3LGGA 1LOQA 4EANA 1TPWA 2HVNA 1R47A 3GS6A 1UZ1A 4IMDA 4O1AA 3GTHA 3EXRA 1V3KA 2Z28A 1B9BA 1BYDA 4HNNA 1GVRA 3VOJA 2WB5A 1RPXA 1XDJA 3GWQA 3K2GA 3UR8A 1H61A 1KM4A 1TE1A 2ZX8A 4QEEA 4Z1CA 5GJPA 3SUTA 1DV7A 2PTWA 4DJDC 1PIIA 1LLOA 1KBIA 3DENA 2D22A 3OJGA 2VUYA 3FLUA 4HSNA 4GZ7A 4DF0A 3PWIA 3QBUA 4LVGA 3ITXA 2LLEA 4U33A 3K1GA 4C6JA 5BNKA 1EEXA 1ZGDA 4MZ1A 1NSJA 3V1PA 1OJXA 4AAJA 3W7EA 2X09A 4CCEA 1OYAA 1XQKA 1WE5A 4A8LA 3BAIA 1O4UA 2WSYA 3FJNA 3R5EA 4S3FA 5D30A 4H9UA 4Y8EA 3DXIA 4X9SA 3D46A 1B3YA 2NVCA 3RF9A 4Z42C 4EE9A 3A9IA 4DWDA 3ARVA 5I3FA 4LVFA 4K8EA 5MKGB 2QUUA 3SJ3A 1XV8A 1J10A 2ZXDA 2ZFAA 4N9DA 1YHTA 3SN0A 1EP2A 2ZE0A 4UWMA 3VIOA 2W92A 3OQ8A 1LTDA 4JIHA 2Z2BA 4LUYA 3DBNA 1LBMA 2OWXA 4YYFA 4CU6A 4S1FA 5AHMA 5T91A 3EOEA 3E2RA 3I65A 3SFWA 4S39A 3NQAA 1ISVA 2ZZ6A 1SSDA 1X8FA 1J0KA 4AIBA 4D6EA 4ACYA 2EKCA 1L6WA 4MNKA 1Q6DA 5BRQA 4F2BA 3VDHA 4AMCA 1WXJA 1T41A 1XICA 2PDYA 1PE1A 4I6VA 5ENLA 3VX0A 2RFGA 1AH3A 1XLIA 1O1HA 3I3BA 2V63A 1X7FA 5CEWA 1WPCA 4MB3A 5DMNA 3W6YA 1U1HA 3BQ6A 1KGWA 1AMKA 1MXSA 1QPKA 1RZMA 3WK2A 4JTCA 2QIWA 4L4LA 2DZVA 1K70A 3IGXA 1LOLA 5HQEA 2NQJA 1RCOB 4ZZ9A 3N34A 1XH2A 5HATA 2PLCA 6A3HA 3DC0A 2CXEA 1KD0A 1K77A 4P8VA 1XISA 3GHSA 3LPGA 1WDWA 2J47A 3GW3A 4EF8A 4JKMA 2YCKX 4WDUA 4WXYA 3GXFA 1OQFA 2C1GA 3S8HA 1NM9A 1GQNA 1UR3M 4HBKA 1FCQA 4P2VA 4LCSA 4K3ZA 1JRBA 4F0HA 4DBWA 1J96A 2A7NA 4BEUA 3MPGA 3VIPA 2PZNA 2PTYA 4DWSC 2RDUA 2D2GA 1PHWA 2TPSA 1AFSA 4LBRA 4R7OA 3PPHA 2ISFA 2CLFA 4XZWA 3B8TA 5JXQA 3BLEA 3F4VA 5D9PA 5HMDA 3NL2A 2XJ7A 3FA3A 1ZENA 4AD0A 3W2NA 4O52A 2YL6A 4J3XA 3RDKA 3FDKA 1QHOA 3RLGA 3PTMA 1IE7C 3RCYA 2NQZA 3IK4A 3LCXA 4JGDA 1EJ7L 5DF0A 5D04C 2ZXQA 4C1NA 3ITTA 3N11A 4JTRA 1YPFA 2QCHA 4HZ8A 3FNDA 4LNYA 5H8UA 3VFLA 1G4EA 1FCVA 4LYKA 1K4HA 2DSVA 4A2RA 1IR1A 1JGMA 2XSBA 2AMXA 3QZAA 3TMLA 4BHYA 3BGGA 5E6ZA 5A6AA 4DZHA 1JPHA 3SN4A 2VX6A 3MQTA 4S3CA 5C54A 4QLJA 4OFCA 5A5WA 1HL8A 5CBIA 4W87A 4ONVA 3ZSTA 2X0HA 3R2GA 4RZ6A 7TIMA 2Y89A 4UMCA 3FJ4A 4RNJA 2PWHA 2GJNA 1DWFM 1ZBCA 4QJ3B 1W8GA 3VOGA 1YBQB 2WJFA 3EX2A 2QPUA 1LT8A 2J79A 4W7VA 5K3VA 2PFHA 3T2PA 3VC6A 1N2VA 1OHLA 2ZDSA 4KEMA 3CAWA 4K38A 5A8GA 1RK5A 2CIPA 1POJA 2KX9A 2ADAA 3W7RA 2C91A 5D2YA 2V5LA 4AD2A 2X16A 4GO8A 4P7LA 1E6XM 4HHHA 4Y8FA 1DHKA 3W00A 4GC4A 4MJ2A 3TFCA 1TV3A 1F5ZA 3T55A 1HKMA 4BR1A 3T0AA 3KOXA 1KQZA 1JZ3A 2AL1A 1BHGA 5AZ1A 5IHSA 1WDDA 3DHPA 4ZMGA 4LUTB 2WQDA 2DUZA 4GFSA 4ZB2A 1H51A 2NT1A 3DDMA 2FZDA 2PF0A 1Y8BA 4B3KA 1VCGA 2G3NA 3G1YA 2H9AB 2NVAA 4MF4A 3TTEA 4EPEC 3CZ8A 2WSRA 4GQGA 4XTDA 1RHCA 4PCPA 2J66A 4XO7A 2QNEA 3P7YA 9RUBA 5AHFA 1PS9A 1EBHA 2ZZ5A 3IV3A 1IV8A 2OT1A 3R58A 3W28A 7ODCA 3FA5A 4JIRA 3ZM8A 1GNXA 3BG5A 1UWSA 1LBLA 1VCFA 1FDYA 3GIYA 3MI3A 1XIHA 2CBUA 3LPFA 3OYZA 3FV9A 3WQVA 4AEOA 4QE4A 4C5ZA 4DHGA 3UNTA 4HMCA 5JIPA 3KCOA 3AFBA 2VR2A 2YKKA 2WQPA 3U48A 3WLHA 4UTJA 5G1MA 1YDVA 1KGXA 3QR1A 4RE4A 1RA5A 1MUWA 2W91A 2ZUNA 4TUFA 3Q65A 2YA1A 4IXXA 3VIJA 2PTZA 4G7FA 4O50A 1UD5A 4DBEA 4MKSA 1VEPA 5LIXX 3WEZA 3LDVA 3MSYA 1R9ZA 2ACSA 3PZ9A 3TWAA 4FALA 2WJDA 1ZJHA 4CQBA 3DFHA 5XIMA 2X7WA 1V0NA 1K9EA 4JXCA 3OOQA 3W2JA 1GOWA 3B9DA 2MNRA 3TX9A 4GG9A 2WMKA 3O6CA 4GQBA 1XYLA 4EPKA 3R0KA 2ABAA 4MAZA 3F5LA 3VUPA 4WK9A 4RDZA 3T8QA 1VS1A 3PBMA 4IQJA 1UR4A 3NDYA 3GH4A 4J4KA 3PZIA 1PBGA 1TKKA 4LAOA 5A6KA 2PEVA 5J04A 2G41A 5H8PA 1J2BA 1R7OA 3FJ6A 5ABTA 3BJFA 4HNCA 2ZX6A 4I8DA 4AWSA 3EWWA 3G0UA 3N2XA 1LUCA 2DIKA 1XLMA 3VIKA 1JZ5A 1RPKA 4HA4A 4U5KA 2ZCGA 1IQ8A 4H9XA 2BSLA 5KEZA 2QVNA 3L12A 1SSGA 2DT2A 2QCDA 3UG4A 3CLMA 2DVUA 3LLFA 3CWHA 1LUCB 1VCVA 1PJ9A 2VKZG 1E1CA 3WLSA 3WQCA 5E6YA 3N4FA 4FF7A 1KLZA 2YYTA 3HIJA 1G4PA 3SCVA 4DXXA 4HA0A 4S3KA 2E5CA 5J8LA 3KZSA 1A5SA 4RDVA 4J5NA 5FESA 3L4ZA 1TPDA 3ARQA 1KQYA 1CGVA 4CNOA 1U5VA 2ZC8A 3R94A 3QJAA 1DL3A 3VD3A 1G94A 4M1RA 1ITXA 3O63A 3T09A 4R7WA 5L9FA 1GVOA 2PA6A 5CAHA 3E0LA 4GI4A 3A3HA 3KRUA 4LAUA 2Y88A 4MUZA 3RX3A 3CMFA 1QI3A 4R5EA 3C0SA 5I24A 3GKFA 2XUCA 2H8ZA 4R34A 1K4GA 2OTDA 4FLOA 9CGTA 1RQHA 2VEPA 3VC5A 4UQBA 2YCIX 1V3LA 1UC4A 1XCFA 3NAVA 3NEVA 3CEUA 3RGTA 4FXJA 4LEFA 3RK8A 2GJXA 3LUTA 4A3RA 2CWNA 1MFUA 2BVWA 3L5AA 4L6DA 4MNJA 5C6MA 3CM4A 5I3JA 2QR6A 1E9IA 1XR2A 2PU1A 2X2GA 4F2UA 3AO0A 4PGLA 1RALA 2E6FA 1E9YB 4FNSA 1TZ9A 2BXZA 3TYEA 1DQUA 3O8AA 3PJTA 4NNBA 5LKYA 3AMDA 1IXQA 3EKLA 2QF7A 1DE6A 2ZE3A 3CZJA 4OOZA 4L4PA 3M16A 4G5DA 2GVYA 4XVDA 4QR6A 1I2NA 3UU0A 3WQDA 3QM3A 4DIAA 1TSIA 1B0IA 1KWGA 4GX9A 1I0BA 3M0HA 3O15A 4E8DA 1W9PA 1YXDA 2DT3A 3AQUA 5AZ0A 1UKQA 1TTQA 5I00A 5CPSA 1QPRA 1L2UA 1AQ0A 2FH8A 3N4EA 4P8XA 1J8VA 1E5JA 3WX7A 3TR2A 1FKXA 2BOGX 4IP5A 3G22A 2X1RA 2EGZA 1DPMA 1VC4A 3SCUA 1C9WA 4IPJA 1XLLA 4AX7A 3WH9A 4BY3A 5LNUA 3TYUA 5C8BB 3VI2A 3MYOA 1YXYA 2EPOA 1HTIA 1TQJA 1MRQA 3P61A 1HKIA 2V6AA 3WF4A 4CNSA 4CN6A 4REQA 4WY0A 1E3XA 2E4TA 4MMWA 1PWLA 2PP3A 2OLSA 3GKAA 4M1BA 3CEPA 4Z08A 3GG8A 3BSHA 1K8CA 3TUUA 5FJIA 4W4QA 2VDGA 1JAEA 3N14A 4WUIA 1F61A 1ONEA 4GJIA 4W7UA 1I45A 3LRMA 3FXGA 1W9DM 4AD4A 1HW6A 4BQ3A 3LK6A 4KCTA 2F9RA 4IPPA 4F0LA 1OC6A 3KRSA 1XIIA 4ICMA 8XIMA 4H8NA 3U5UA 3IJ6A 3EDFA 1OD8A 3EOSA 4ERAA 2B4GA 3E38A 4OBRA 3RX4A 3SRHA 1TJ0A 4Y9NA 2CESA 5EMUA 4AB4A 1TFVA 2DT0A 2XIQA 4ZR8A 4AU0A 2VGIA 2XYLA 4IP4A 3DGRA 2O9PA 2JALA 4RV8A 1ZHAA 1QK2A 1LRNA 4LCQA 1BLIA 2YL5A 2NQ9A 3OPSA 4JNYA 1WKDA 1TR1A 2O9TA 3LV5A 3ELFA 3H23A 2WKLA 4Z0SA 3TN3A 5DRCA 2VC7A 2H3DA 3UG8A 3YPIA 3EDEA 4WKHA 5T9CE 4GCXA 1GJPA 3GAKA 3E0WA 2A5HA 3BANA 2E77A 1JG9A 1TMQA 4C1NB 1MRAA 3EDJA 5FJJA 3E02A 1BKHA 1UASA 3TV8A 3N25A 2CU0A 4AWUA 2C18A 1GOKA 4YLWA 5EKYA 4Q8WA 2DIJA 3PM6A 4W93A 2E0PA 1KXHA 3ZYZA 6ALDA 4MZYA 3OYXA 5EBAA 2OEJA 3V16A 5CPMA 4PTWA 2Y24A 3WLOA 1IT0A 2VWSA 3GNOA 2A4AA 1CX9A 5LZLA 3U5YA 3QQ1A 3L5MA 3VDGA 3S2JA 1H7PA 3E2VA 8XIAA 2CBIA 1LJYA 3M64A 1XPGA 4PYSA 2WNQA 3BLIA 3MMWA 1QWGA 4C91A 4IH3A 1HJUA 2OX1A 3C2RA 2NSOA 3ZXWA 1XFCA 3KXQA 4IFRA 3KBMA 1FWGC 4PB3A 1QFEA 5FIPA 2EJ1A 1IGSA 4AF0B 1B3VA 1P0DA 1PB0A 3BCFA 1P6CA 3QV7A 1FWJC 3GVVA 3AOFA 4JR5A 2CHOA 1UWRA 4MDPA 4D6HA 4LALA 3AYVA 3CWNA 1OK6A 4YN5A 5HQLA 3IS4A 2ACRA 5M3WA 4IUGA 1Z48A 4ZO9A 3S2MA 1BXNA 1MQQA 3WFLA 4Q8TA 2PDQA 1SO3A 4PRRA 4MKVA 2D23A 4UNKA 4US5A 4PN2A 1W3LA 2OB3A 3W6LA 5HNRA 3ARXA 4F3HA 1Z69A 1AH4A 2FGZA 2DFAA 3R11A 1BTCA 2Y8VA 4IGSA 1ZL1A 1MWOA 3PBGA 4RV3A 2F2HA 2GJRA 5FEZA 3LI0A 4ZGYA 3U8GA 1WNOA 1R3VA 3MANA 4M56A 4YL2A 3Q94A 1LWIA 3UGVA 2CBJA 3OB8A 3AZRA 4XZHA 1C8YA 4H8HA 3THDA 3W7OA 5LNSA 4UMBA 1DJGA 5EMYA 3U7VA 2OSXA 1WX0A 3UJSA 1M01A 3SQMA 3OA3A 1RD5A 4NXSA 4UMAA 1V3IA 2E1DA 1SZFA 3PNZA 3R6IA 3U2CA 1V6XA 3MKVA 2XM2A 1W9VA 3BARA 3ZIZA 2BMBA 2XG9A 1XFBA 4O12A 1UUOA 4JX4A 3W4RA 4J3ZA 4KESA 2XTKA 1JDDA 1TJ1A 3JZEA 3PNUA 4MWAD 3QV8A 3V5FA 3CASA 3E3HA 1BXBA 2GFTA 2BY1A 1T40A 3W88A 1N7KA 1O5XA 4YIWA 1PEZA 2B7OA 2DJXA 1ZFJA 3W1TA 3T07A 3B06A 3KVMA 4AHQA 1FXQA 3HGJA 1SZNA 3JRKA 2G8ZA 1C92A 4GKLA 1K8ZA 2BLEA 3TOYA 5IXEA 4B3LA 4XD6A 3DERA 1NF7A 3ZFHA 3WQWA 3K4DA 3GXTA 4OV4A 5CKSA 2OYMA 5CH9A 4NASA 1TV2A 2C6QA 2WVVB 2WV8A 3G0SA 4GUJA 4Z2KA 2X1TA 4QLKA 1B2YA 3M7WA 2VDIA 3EAUA 5I3DA 3WF1A 3HMJG 4JHMA 1W9XA 4MWAB 3DBPA 1H7NA 2DW6A 5XIAA 4FSAA 4M82A 1OT2A 3VCNA 2QUTA 2B7PA 1XLBA 2VQUA 1I2QA 5DT5A 1LROA 2ZX7A 3STFA 3TOPA 3ZR5A 4K36A 2R14A 2YSWA 2Z00A 2OEKA 1US2A 1Y5XA 1Z89A 3W26A 3H55A 2A2IA 3LQLA 3MKCA 3TQ0A 5I02A 4OWGA 4NQ1A 4TX8A 4HNVA 4NVTA 2RUSA 2J25A 3PANA 3BH4A 4WQ6A 6TIMA 4WHBA 1GYLA 4FR1A 4MLJA 3BAWA 1RD6A 4JNZA 3V75A 3MUIA 4HK7A 1CGWA 4WSKA 2JGQA 4IMGA 3CS2A 1V7AA 4FK9A 1T6MA 3B97A 4JBRA 4AZ5A 2HQAA 1D3HA 3WQ4A 2ZADA 5A69A 5DLCA 1KCLA 3W7GA 2GVGA 3IIPA 3KLKA 2BDQA 1S2TA 2OQLA 4B92A 3TJLA 4FNPA 2BHYA 3GUGA 2BGQA 1KV5A 3B03A 4JTSA 2GYIA 1FH8A 1S5MA 3M43A 4IJRA 1F73A 3SGUA 2R24A 3VKCA 3TFXA 1XYMA 5K9CA 3DECA 3MT1A 3MP4A 3R12A 1BYBA 1Z7AA 1VBJA 3NVDA 4LYQA 4D9PA 3S5OA 4BS0A 3URQA 1E73M 4EPDC 1CLKA 5CJMA 3R10A 2J78A 3UXDA 3ZT6A 1ZAIA 2IKIA 4LY8A 3QQWA 4ZB0A 2QQ6A 4MB5A 3W73A 4RK8A 2OZ3A 4OECA 1FP8A 1TIWA 1UUMA 3LU2A 1EH9A 3CB8A 4V28A 3QQ0A 2O4QA 3P62A 1JZ8A 2PDHA 5I3HA 2HNHA 3CQJA 3TSMA 4CNUA 5C0QA 2CLEA 5C2XA 4I3GA 3H2CA 2IQDA 3GSMA 3QMRA 2FQIA 1EZWA 3TYAA 4OJYA 2C13A 2YX0A 4Q22A 1F74A 4O1EA 3FKRA 1TWDA 3CL6A 2Z1BA 2O4MA 1XXXA 3V3WA 3ARTA 3N19B 5KITA 1V6YA 1ZAJA 4K1WA 4QE1A 4L64A 1F6YA 3EWXA 3U9IA 1Q6LA 1VPYA 4YVVA 4B4HA 2VZUA 1RCQA 5C9XA 4PMXA 1V77A 2CBVA 4I9TA 2NW0A 1J9YA 1H5YA 3P3BA 4BF9A 2GQ3A 3EZ4A 2WBKA 3WELA 1IIGA 3I3DA 4PUMA 2B31A 1B30A 2EHHA 2YCJA 3WNNA 4A8NA 2ABBA 1IEIA 5I07A 2PWEA 3HO8A 2FVMA 1UOZA 4IX0A 3SGZA 4Z0JA 1GORA 4B90A 3R8GA 3SURA 3TC3A 2G97A 4LB4A 1GW1A 5FSDC 2DH3A 2CW6A 1XIGA 4GYFA 4IG2A 5BOFA 2X05A 5IDZA 3IIOA 3L21A 3BGJA 3DI1A 4IIGA 1S1RA 4UNLA 4BI6A 1C7SA 1UWTA 3P82A 3W7PA 1T7LA 1I0DA 1NFGA 2AL2B 4IIEA 2AAMA 2FTYA 3CUFA 3AU6A 1KR1A 3RPDA 1LF1A 2ZYFA 1XI3A 3OW1A 4XKMA 1V08A 4HOWA 3HB9A 5MHBA 4ADUA 5DQPA 1S5NA 1EJXC 3OHMB 2J7FA 1IXPA 4JX5A 4QS6A 4E4PA 1TVLA 3TMQA 4WOZA 4XAGA 4ZXLA 1NWUA 2RDWA 4D8LA 3TTQA 4JKLA 4BFAA 5BW6A 5G1YA 5EPDA 4PTMA 4ZO8A 2VHLA 4DVOA 4JEQA 2TYSA 4TMBA 3WCZA 2P53A 2VC9A 1QPQA 1O60A 4OZOA 4G2DA 4HSHA 2IXVA 5M03A 3N04A 4HA3A 2G5WA 2X1UA 2R91A 3T0BA 2C71A 2Z26A 4WLCA 3H7VA 3N2CA 4IXHA 1FBAA 2V5BA 5MF5A 2R82A 1GZ1A 3ES7A 3HN3A 3NM3A 3GLCA 1D8WA 1A5MC 3MKKA 4CD5A 4M6VA 2Y8UA 4E2OA 1HX0A 4O28A 3W1QA 3GM8A 2E3ZA 1BPLB 5D32A 1HJVA 4LB3A 3EA2A 3PFRA 1ISYA 3W85A 3BAXA 1FWWA 4H6EA 2D0GA 3TW6A 2NT0A 2D0FA 1UKTA 4WY0F 4BA0A 4AHOA 3T81A 3LHZA 3NURA 1EC8A 5LIWX 3WJSA 3F2BA 4OTKA 1TV4A 2IW0A 1SJBA 1PX8A 3VOHA 4ALDA 2JK2A 3NCOA 1FWFC 1YNYA 1UP3A 1X98A 2IXUA 4JZ5A 2CFFA 3WDQA 3P8IA 1V02A 2RKXA 3OEXA 3A22A 1PX3A 3CL8A 3KAOA 4AW7A 1YQ2A 2XINA 4FXFA 4Z1DA 2NUYA 3HQOA 2Q3RA 1PSCA 3BG3A 2FZ9A 1CXLA 4DWSA 3S2NA 1DJIA 4M6UA 1RVKA 3GBDA 4LV4A 1WUFA 1TUFA 4ZQRA 2Y6ZA 1VJIA 2VNCA 4I7VA 4XO6A 1QO5A 1F7BA 1ZU8A 1E9ZB 4PMDA 2I14A 2NZLA 1CBGA 3DX5A 1P7TA 3AUJA 3R4IA 4AEEA 4QJ1A 4J28A 1GVIA 3TK7A 1JPKA 1WOBA 2O0TA 4F0MA 1EDQA 3VGEA 3KOWA 3GY1A 3UR7A 2QJGA 4PUEA 4J2PA 3VIGA 4C6QA 4PTXA 1JYXA 5ABFB 3BXWA 2CEQA 2XVLA 2DJLA 1P7TB 2MANA 2DQXA 4EWJA 1EOMA 1BF6A 4ZA0A 5C7HA 4A3YA 3ITGA 3UCCA 1RY8A 4L65A 1Q6GA 3O16A 4WSJA 1JYNA 1VFTA 2DZTA 4DB7A 2Q8LA 3FHQA 4BEQA 1M7JA 3H4WA 1EUNA 4YTSA 1SO4A 2NV1A 1U2YA 4D1JA 3THUA 4JTLA 1K02A 4DI9A 2P3EA 3M0IA 1X38A 2WANA 4J1OA 1PZ2A 1A0EA 4GZJA 1VHNA 1K7XA 3DFQA 4F66A 3MUXA 1QOQA 1KGUA 1EHNA 3LA4A 1EKOA 5G4WA 2ZZ1A 1UYQA 4DNMA 2GGGA 4U28A 4W5ZA 2NWRA 1SFJA 5TD4A 4JN6A 4UQAA 2ZC1A 1R9YA 1Z41A 1XIFA 3NO5A 4BKNA 4GA8A 2GSEA 3UZ5A 3PHAA 5H2ZA 1PTDA 2JFEX 4JTIA 4BK9A 4EIVA 2OMAA 5DX7A 3BJSA 3ONCA 4JIPA 4UTUA 3KHJA 3BAJA 4BI7A 3DG7A 3FSUA 3PUEA 5FJOA 2F61A 4CD4A 1ECEA 3GFZA 1Q6FA 1W1ZA 1NELA 1JJKA 3W7HA 5CAKA 1A5LC 1FQ0A 3MBDA 4NJHA 2I1OA 2YB4A 2DEPA 3HG2A 3KUMA 3RILA 5CGTA 4HCHA 4ML4A 3TQVA 5I03A 3E1F1 2YW3A 2E25A 2PDNA 4PMUA 2E5DA 3P93A 3AZTA 1Q85A 4Y9AA 4LH8A 4QITA 5F2LA 4NZ5A 4LVDA 2H8XA 2AGTA 3BAYA 1RJPA 2FDMA 3O3RA 3A24A 2X8RA 3ZQ9A 4N9EA 4PMVA 2JE8A 4JTTA 3RJXA 4HZMA 2E6AA 3VCCA 3NZRA 3WIJA 3LRKA 5F2IA 3WLJA 1H62A 3TIMA 3VXGA 1NOFA 5DCBA 2PDIA 1HJQA 3PSWA 1XDLA 3SQSA 2Z1KA 4HT3A 1DBTA 4NRSA 4DXVA 1GOIA 2DPEA 1V79A 1PIGA 5LIUX 4A22A 3R13A 1WDPA 4GIRA 5I06A 3FK4A 3WUGA 3LB0A 3GK0A 4D6IA 5T9BG 1YPIA 1M65A 1UD4A 2EO7A 2PDBA 5TIMA 3OVRA 2DUXA 2PMQA 5JMUA 3W0KA 5ABHA 3IAPA 2YXGA 2WHLA 4RNFA 4C6CA 1BGAA 3W23A 1U83A 5EMLA 2XH2A 3DHFA 4F40A 3VDBA 1YLVA 2QCGA 3LX9A 5CGMA 1OX4A 4TV6A 2ZUTA 2BVYA 3DESA 3CMJA 1VBHA 2I5GA 2PD5A 2Z6JA 3UYCA 3NPVA 2Y63A