3V0UA

Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
337
structure length
282
Chain Sequence
b'HMPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSNKQIYYRIEALSQKHGCTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVKLTKEDLKEISDAVPANTPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Perakine reductase
publication title Crystal structure of perakine reductase, founding member of a novel aldo-keto reductase (AKR) subfamily that undergoes unique conformational changes during NADPH binding.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Oxidoreductase
total genus 98
structure length 282
sequence length 337
ec nomenclature ec 1.1.1.317: Perakine reductase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v0uA00
4JIRA 4EXBA 1Q5MA 2HVOA 4HBKA 2IKHA 3P2VA 1PZ1A 1US0A 4YS1A 3LQLA 3LN3A 4NKCA 3R94A 1EL3A 3R6IA 1Z3NA 3WBXA 4LBSA 1X97A 2FZBA 3D3FA 5AZ1A 1R38A 4PMJA 4LAZA 4LBRA 2PF8A 3FX4A 2NVDA 3LZ3A 3KRBA 4GIEA 3LZ5A 1EKOA 1AFSA 4Q7BA 3UWEA 4PRRA 2HDJA 4XO7A 1K8CA 1X98A 3V0TA 3H7UA 5LIWX 4GCAA 4PUWA 1QRQA 3R8HA 5AZ0A 1MZRA 4QX4A 3G5EA 2IPJA 4AUBA 2PDBA 3ONBA 3LD5A 3R7MA 3U2CA 4LB3A 4DBSA 3ONCA 3RX4A 3DOPA 2ACQA 4XZIA 1AH0A 3UGRA 2PFHA 1EXBA 3RX2A 1QWKA 1VBJA 1ZGDA 1UR3M 2ALRA 4JTDA 1Z89A 1J96A 1IEIA 1X96A 4YVXA 4H8NA 3GHUA 2VDGA 4I5XA 3CV7A 3M0IA 4R9OA 3C3UA 4XZHA 2PD5A 2J8TA 3MC5A 4ASTA 3R43A 2PDMA 3UZZA 2ISFA 2PDLA 1JEZA 2PDCA 2FZDA 3COTA 2P5NA 3UYIA 5M2FX 2FGBA 1ZQ5A 1XJBA 4FZIA 1EF3A 3N2TA 2ACSA 2R24A 4WDUA 2PDXA 1RALA 4DBUA 1OG6A 1PWLA 4IJCA 2IPFA 3BV7A 3GHTA 4EXAA 4OTKA 2DUZA 1GVEA 3ERPA 3QKZA 2PDNA 1Q13A 2PDUA 2IS7A 3Q65A 3V36A 3BUVA 3UFYA 4JQ1A 5JH2A 2ACRA 3UZYA 3M4HA 4GQGA 5LIUX 4FALA 2ACUA 3LUTA 2R9RA 1S2CA 4WGHA 5LIKX 4G5DA 1M9HA 4IGSA 5DANA 2PDIA 3GHRA 3Q67A 2I16A 3H7RA 1AH3A 2IPWA 3DN5A 4GABA 4XO6A 1T41A 4WDXA 1IHIA 1S1RA 1VP5A 4JQ2A 2PEVA 3EB4A 2PDJA 1RY0A 2BGSA 1MRQA 4JTQA 4WEVX 3LENA 4JQ4A 4JIHA 4GACA 1AZ2A 2IKIA 3F7JA 4XZMX 3G1RA 3V35A 4JIIX 4F40A 4JQ3A 4LAUA 2HEJA 1SM9A 2PDHA 3WG6A 3R8GA 3RX3A 4L1WA 2PDKA 3CV6A 2F2KA 3CAVA 1PYFA 2WZMA 1XGDA 1ADSA 4QXIA 4JQAA 3WBYA 2FZ9A 1HQTA 2INZA 4XZNX 4XAPA 2PDYA 1A80A 3CMFA 4YU1A 2BGQA 2IPGA 4DBWA 3O0KA 4FAMA 3NTYA 2HVNA 3LEPA 2DUXA 3BCJA 5HNUA 2HE5A 2PZNA 2BP1A 1C9WA 1HW6A 3WCZA 5C7HA 3R58A 1ZSXA 1YNQA 3CAQA 1YNPA 3V0UA 1AZ1A 3FJNA 3UZWA 4HMNA 1ZUAX 3M64A 2IQ0A 3VXGA 2QXWA 2WZTA 4YVVA 2C91A 1MI3A 1S2AA 5LIXX 3UP8A 4XVEA 4DZ5A 5KETA 1LWIA 1FRBA 4WDWA 2PDGA 4QR6A 2CLPA 3BURA 4Q3MA 1LQAA 4PUUA 4WRHA 2PD9A 2INEA 4ZFCA 1YE6A 5LIYX 3V0SA 2AGTA 4PR4A 3UZXA 3CASA 3LNMA 4JTAA 4JTRA 3GHSA 4L1XA 4FA3A 3EB3A 3LQGA 4XK2A 2HV5A 2PDPA 1S1PA 2IQDA 4MHBA 1YE4A 3O3RA 3EAUA 3MB9A 1XF0A 4RPQA 4ICCX 2I17A 2FVLA 5JH1A 1Z8AA 3B3DA 4JTCA 4LB4A 4IJRA 5HA7A 2NVCA 3S3GA 4QBXA 2DV0A 4XVDA 3UG8A 3GUGA 2A79A 1PZ0A 1AH4A 1T40A 3T42A 2IKJA 2HE8A 1RY8A 3H4GA 4PRTA 2IKGA 4WDTA 2PDQA 4GQ0A 3WBWA 2PDWA 2FZ8A 3N6QA 4XZLX 4YVPA 2PDFA 1Z9AA 2F38A 4H7CA 3LBOA 1PWMA 4GA8A 5HNTA
chains in the Genus database with same CATH superfamily
4P5UA 2ISSA 2HROA 1Q5MA 1YDYA 1E5JA 3GG7A 2X1IA 4C1LA 1WO2A 1WE5A 3XISA 4OQVA 4I9AA 1EL3A 2HCVA 2W91A 3IGXA 4IGMA 3AS0A 1UH4A 5M3WA 3W1RA 3C2YA 1FFQA 1TX0A 2FMNA 3N17A 3U2EA 2QDEA 4V27A 3TOYA 2XVGA 5I07A 4KFNA 4O19A 1KV5A 3KRBA 3VINA 4UTMA 3TLQA 4GO9A 3CV2A 2D69A 4ZE4A 2OLAA 3EX2A 2PGRA 4EIVA 4EP8C 4G6CA 1TE6A 2J88A 1RP8A 4DJEC 2NWRA 4X9YA 4NX5A 1ML1A 5AHMA 4PFHA 4CCDA 3BCDA 2GOUA 2WKJA 4W86A 1DTNA 4L6OA 4FF7A 1VENA 1TB3A 4CEXC 1A3WA 5I3FA 2PLJA 4NJHA 4TIMA 2PTYA 3BMXA 4C91A 1H63A 1F8IA 1YDVA 3GAYA 4HPGA 5AB3A 3GWQA 4PTNA 2H9AB 2ZZ5A 5FAJA 1H41A 1H7XA 3T78A 1Q6FA 4Y7EA 2CBJA 4HD5A 3NZRA 4BEQA 4JIQA 3CZJA 4IQLA 4U33A 2C15A 3S1XA 1N2VA 1EC7A 4OJYA 2V68A 5I24A 1A0DA 4MB1A 1G69A 1B3XA 1E6QM 4XZ9A 3LHVA 1QOXA 3TW7A 1SSDA 3DFTA 4H9MA 2WM0A 3UYIA 3EZ4A 2DZSA 4NAFA 3R0DA 4FIRA 1TPUA 6ENLA 4NAEB 4DWSB 5DF0A 5BW6A 1Z32X 4EX4A 5A95A 1E55A 3UG5A 1KCZA 1DJZA 2BNJA 3B8VA 4F0MA 4YWIA 1KFEA 3G1DA 2YKKA 1U1JA 1G94A 1GEQA 3IAQA 2BS9A 3N1AA 3FKKA 1R3SA 3B8IA 4DXKA 3HU7A 4JQ1A 1XH2A 4H2HA 3QW4B 3M6DA 1OCQA 3T05A 3SY8A 1XDJA 3KBWA 3PZNA 4CU8A 2GJPA 4WGHA 1PB0A 4BWLC 1UZHA 2VVNA 4JIEA 4FOJA 5I02A 1FKXA 4D6IA 3H7RA 4IWWA 1OK4A 1OQFA 1EBGA 4UTUA 1SFJA 1A49A 1FFRA 2ZYFA 4DZAA 1DVJA 5CSSA 3P67A 4UCFA 3NXLA 1ZS2A 4YYFA 4PUDA 1E5NA 2Y63A 3QY6A 5G4HC 3I6RA 2O9OA 1CGVA 1SZNA 3CM4A 4LQ1A 1E3XA 2H90A 4JIHA 2J66A 3KDNA 2V6AA 1DJYA 3BV4A 2VRJA 3NM3A 4XD6A 5H8UA 1DHPA 4L65A 2Y7EA 4J27A 3FJ4A 2OVLA 3RRAA 5DMMA 3PULA 4GUHA 5EU9A 2QMKA 4GNVA 5JIWA 3MMUA 4QCEA 4M51A 5REQB 1AJ2A 1MMFA 2C0HA 2FJKA 3BAWA 2WSYA 3XIMA 3RF9A 2GOKA 1OCBA 5G2IA 2O92A 4DJFC 1H2JA 2ODOA 2XIOA 4LVAA 3UBPC 3QMRA 5ABFB 1ZJHA 2IPGA 4DBWA 2BY0A 3KL5A 3M44A 1J6OA 4ICNA 1FWNA 4LCQA 3NZQA 4LYPA 2DUXA 2P50A 5G5IA 1E0XA 3PJTA 4S3CA 1P4CA 1HKWA 4QEHA 1HW6A 1E73M 3EX1A 4HU8A 3SDOA 3OJGA 3GDMA 3O6AA 2A3LA 3S5ZA 3XINA 3MP4A 3UA4A 3N2MA 3ITXA 4UOJA 4YTSA 4UIOA 1JYXA 1E70M 5DMLA 6A3HA 2FVMA 2XSXA 2J79A 2UY5A 5C7VA 1TRDA 1F6YA 1GQNA 2YIHA 1EYEA 1HTIA 2W79A 1MYRA 1TQXA 3DECA 4LUTA 1Y65A 1MXDA 3BURA 3GTNA 1EH9A 2YGYA 3K4WA 4U31A 4XAFA 4UR7A 1YE6A 3CV1A 3QMSA 4PR4A 4EK7A 3IJIA 3C8NA 2Y5SA 1H7PA 3L66A 4M29A 3B9AA 2VENA 4XZBA 3B0UX 3RJXA 4ZA0A 5GJPA 1OFQA 1VPYA 2BY1A 3T0CA 2J74A 4MB5A 1JGMA 2RHGA 1AQMA 3AIRA 3B04A 3LHWA 3TMLA 3FA4A 3W7GA 1QK2A 2BXVA 1W1YA 1Y5XA 1KCXA 1T8XA 1R3QA 5D04C 1E6PA 1WAWA 4URIA 3DFPA 4DHGA 3A5VA 3CHVA 4Q4RA 3MO4A 1U30A 3WNNA 3KFTA 1RBAA 1KCKA 2A3EA 1NDVA 2H8XA 1WZAA 1WDSA 3S9IA 3N18A 5EMMA 1EA0A 4PZVA 2QCDA 1HL8A 1XYLA 3QLDA 1XIEA 4MAVA 3M7SA 4EPDC 4QSHA 4GCXA 2E6DA 4DF0A 3W02A 3GXPA 1R2TA 4ZCWA 1UP2A 2D24A 1UWTA 1BD0A 2UBPC 1H11A 1O60A 1IT0A 1VCFA 2GSHA 3INPA 1B3YA 2ZE0A 4DYJA 4MKSA 3SO7A 3MBFA 1Q7QA 5D32A 5HWNA 3TCSA 4BEUA 4UBPC 3VD4A 1XD1A 2WZIA 3FA3A 1KBBA 3EDJA 2XFRA 4DAFA 1VEOA 3PUOA 5EBUA 1I2OA 2V82A 4O4WA 1KXTA 1JF5A 3CUIA 1TA3A 3UPWA 1BVWA 3V0TA 1MFUA 3ZLHA 4LF2A 1MDRA 3CUXA 2H8ZA 3NOYA 4PUEA 2ISVA 3UWQA 4L9ZA 3R8HA 2D2JA 4DWDA 5HNRA 1TELA 1UIOA 1V3KA 1QI0A 1LJYA 3VNMA 3VM7A 4MB4A 1E1CA 2ZXQA 5DBUA 2QCLA 1JDAA 1S3TC 1SZGA 4MIMA 1F5ZA 2XIQA 3N9SA 3ZS4A 2NXHA 3RO8A 2DZVA 1EGMA 3CQIA 2J7EA 4AMCA 5A6TC 2DH2A 4AHPA 1AW1A 2ATMA 3UZJA 2OR2A 3QRHA 1KV8A 1M53A 3LB0A 4I5RA 3TXVA 3VNYA 3CV7A 4K6AA 5EB8A 2XGZA 3UY7A 2UV8G 3SR7A 4J2MA 4QHRA 2B81A 3M0KA 1K8ZA 3WMLA 3MHUA 1JEZA 2XTKA 1DP0A 1E6RA 3PG8A 4DXXA 2CESA 3MUY1 2FGBA 4MAZA 4O13A 2ATSA 1Q65A 3EWYA 1FDYA 3HJEA 3W83A 3WK3A 4RE0A 3W7EA 4D6FA 1FWRA 1RSCA 2DZPA 2GFTA 4XSMA 4Z1CA 4DZHA 2XVNA 1NWSA 1CBGA 1M7PA 2OJPA 3GHTA 4DJDD 1GOIA 3VVGA 1FCQA 2QJGA 3ERPA 2F6UA 3LBMA 2PDUA 1W91A 1FWDC 2XWDA 4IX0A 4V15A 5C55A 4JBRA 3A47A 2ZA1A 2BDQA 3LI1A 1P0KA 5FF3A 3H2FA 1J0YA 3FIGA 3AISA 1GK8A 5LIKX 3PUEA 3GM8A 1XQLA 1U2YA 1YEYA 2O0TA 2OEMA 2OO6A 5SWUA 1D7KA 4NZ1A 3HGSA 3GXDA 4K37A 2JKEA 4B5XA 3I6TA 4LRSA 5FD0A 1DIEA 5LGXA 2DQWA 3ANYA 1PZ3A 1HN1A 5CBBA 3EB4A 3NAVA 2OT0A 2WHJA 3TSMA 5LNVA 1E6SM 1LBLA 3F2CA 3GYEA 2JF6A 2E4TA 3GVGA 3BARA 2G37A 1VYPX 4JFWA 1BF2A 1QO2A 1AVAA 2V5LA 4Q8WA 2Y0FA 3L2MA 3POCA 4IUOA 3SRDA 4UTWC 1LP6A 4JTLA 5DQPA 2V0TA 5IRPA 2ZZ3A 2VCAA 4DRSA 4O4VA 1X1NA 4C6KA 4L5ZA 3DCPA 1LUCB 3B05A 2INZA 5KEZA 1O68A 3CMFA 4Q8QA 4QROA 1QNVA 2BGQA 2DEPA 4Q6JA 3DC0A 3GD6A 1H7RA 4GIRA 2Y85A 3WN6A 3M5YA 1W1VA 2ZX8A 1H3GA 1YHTA 3AO0A 1R2RA 3QN3A 4GXPA 4E4PA 3KAOA 2QAPA 4UCGA 2W3ZA 1GTHA 3N2XA 4KESA 4Y90A 4A8RA 1F3XA 1C92A 2CETA 2VX5A 2ZC1A 3L4TA 1XYZA 3S42A 4IISA 3W01A 5FSDC 1J10A 1WXJA 3DHUA 1QDSA 1AZ1A 1BXBA 3WH9A 2VFHA 2VUNA 3BGAA 3SRKA 2Z2UA 3WMCA 4Q7IA 4DJEA 3W29A 1ZALA 4YPJA 3AIVA 2FPTA 2KAUC 4O8AA 2GSEA 2NQJA 1ZJAA 3N3TA 1TIMA 4KCTA 1W6TA 4IPJA 4P7QA 1DQWA 4QR6A 4IL2A 4XKYA 4QDWA 1KO0A 2PD9A 4JX4A 2QCFA 2VO5A 5LIYX 1PL9A 3MBDA 5HANA 1OFEA 4LC6A 4HMDA 3CL7A 3LNMA 3L4YA 3TJIA 4LAMA 3GHSA 3VK5A 1GONA 3W1QA 3UWYA 5A94A 1UP3A 1IT7A 2YXOA 2IQDA 5GNZA 3SGGA 3THUA 3W2MA 3BC9A 2YPIA 3GC4A 3UXKA 1Q4WA 1XSJA 4DN1A 4U5IA 2WQDA 3IIZA 1RCXB 7TIMA 3RGTA 2R14A 4UQ9A 3DFNA 4QIUA 1WOBA 3WX7A 4E0CA 3TROA 2DV0A 1BG9A 1SPQA 4HT3A 1G9HA 3LPPA 4C1NA 2A79A 1XBZA 4JX5A 4Y9NA 2PCEA 4QG9A 3DDMA 1RY8A 4RNFA 1L6FA 5L9FA 3M0HA 3RDKA 3WBWA 3NZ1A 1RLCL 3TW9A 4MWAD 3L0GA 2EJAA 1UJQA 4K1WA 1DWJM 3RM9A 2CLIA 5J8LA 3TYBA 4UQEA 2VX6A 4ZENA 4DBEA 2WSQA 5A69A 1W0MA 4HBKA 2X05A 3MI2A 1OX6A 1CWYA 4GHRA 4BWLA 3KBMA 1XLGA 5FCZA 1XL9A 3OIXA 3LPOA 4LY4A 5A8QA 3NVDA 4IIGA 1UMLA 4HPXA 2FJUB 5CC3A 1KTNA 4EF8A 4QS5A 2VQTA 3BL3A 5K4XA 1XINA 4DPQA 2D3LA 3AJXA 4UB9A 4CD6A 1TV5A 4ZOBA 5FKYA 4AEFA 3A64A 1NQKA 3IRSA 4W4QA 3TWAA 2CWXA 1WPCA 1OC6A 1TWIA 3Q37A 3ZLGA 4CKQA 4AZGA 2FPVA 4QISA 5FF0A 3PG9A 3LD5A 4PMXA 4C6IA 3RU8X 4KW2A 1FDZA 1TKKA 4OBRA 3CO8A 3ZT6A 3VDBA 5BROA 4LPCA 2REQB 4YHEA 4LV4A 1I6NA 3ZVHA 2Y4SA 4TVCA 4ZGYA 3UZ5A 4BQ3A 4TU1A 4PBFA 2WLZA 4U4MA 5D05A 2PF0A 2A6NA 3O7UA 4HA1A 1JD9A 4UUIA 1VCGA 4MJZA 2O4QA 5CPLA 2W67A 3W1NA 4YLWA 5HWJA 4NASA 5MHBA 2VXNA 1SUXA 4QEEA 1JCJA 3SSJA 2EPNA 3T1GA 3TE9A 1E9ZB 4DELA 4AY7A 2G95A 3BAJA 3M6YA 4JR5A 5I77A 1NF0A 5ABTA 3MPGA 3HPSA 5M2FX 2HK0A 3EGJA 4FZIA 3VDAA 4B5WA 3AIBA 2C0AA 1E6ZA 5LHEA 4ZO7A 3RLVA 4PMOA 4J28A 4W7UA 1EZWA 1I4NA 2E9MA 4GC3A 1WKEA 2NT1A 1IGWA 1QHZA 4UQDA 1DKWA 1Q4NX 3ZR6A 4JTUA 2PI6A 3RR1A 3ABRA 4NIRA 1Q13A 2IS7A 3GNNA 4ZQMA 2QUMA 2C14A 1NOWA 3TX9A 3VOJA 1S38A 5JH2A 1BWVA 2ACRA 2PWDA 1DL3A 4A2SA 3M4HA 3GIQA 2YXXA 5AC6A 1KM1A 4HU3A 4K38A 2V5CA 3SN0A 2QV5A 1UKOA 4IOTA 5HULA 2OO0A 1WBHA 1ME7A 3CHFA 5BOEA 4UC5A 3H4XA 4KIRA 1CX9A 4B5NA 3QY7A 1GJWA 4GG9A 4N4PA 1E0UA 1VB9A 1OBAA 4WDXA 4HYRA 2WAGA 3RLHA 1I2RA 5ABHA 5FJTA 4AF0A 2QULA 4RXFA 5IDIA 3LTYA 2RJGA 3VIIA 5A1AA 2KX9A 4JTTA 1JUBA 1A4MA 4V1YA 3POHA 3KOZA 4ZVJA 3WF3A 3F5JA 1UPPA 5D9PA 5FL1A 5I3GA 1KGUA 2JKAA 3S2LA 1K8XA 5MKGA 3HV8A 4EPBC 1QU4A 3UR7A 3W73A 1SJAA 4MG4A 3WEZA 1PYMA 2QPSA 1XH0A 4XIMA 3WDQA 3FAXA 3IV3A 3NQ8A 2VHLA 3RXZA 1QNPA 2GK1A 5EMLA 3B0XA 1HG3A 3S5NA 3LG3A 1OC5A 1KRMA 3TN5A 4H4IA 3WUFA 4E4FA 3NL2A 3VKCA 2HPIA 1UYQA 1A0CA 3W86A 1VKFA 2J27A 1XYMA 2QT3A 1F9CA 4GYJA 5HNUA 1M65A 5F4XA 1B3ZA 2CCRA 5A8PA 4TMCA 2JEQA 7REQB 1MW0A 3ES7A 3M7WA 3SUUA 3PTMA 1DE6A 3FJNA 3UZWA 3WJZA 4LNYA 1KNWA 3GR7A 2FIQA 2RJHA 3S1UA 3SQSA 2O9TA 3IS4A 4FNQA 1PIGA 1WB0A 5F1VA 1MNSA 4C6DA 2E6AA 1IZKA 1PKMA 3H8AA 5I06A 3KOWA 5PTDA 4GKLA 1WQ5A 1QNOA 1EJXC 1XW8A 3CZGA 4QE5A 4KIEA 4S3BA 1KM5A 3E12A 4O1AA 1S39A 5M1TA 1X39A 4PBEA 1WA3A 3HV9A 3OIHA 1PHWA 4M82A 1IEVA 3KVJA 2YFOA 6CGTA 1FWWA 4X0NA 2FVKA 4AIUA 4JTAA 3L0KA 2PLKA 5A6KA 5GPRA 4IHCA 1OVDA 2GGJA 2Z6JA 1XFCA 3L7RA 1OGBA 4L7ZA 3M07A 2IMRA 4KCUA 4N4QA 3PN8A 3V1HA 1HJQA 1KR0A 2QIIA 2VX7A 2VZTA 2ZXDA 3G1AA 5FJJA 1XLBA 2GJXB 3WZ0E 5K9CA 1D2KA 1VPXA 3QTPA 2FZMA 3LOTA 4GUFA 1THFD 1WKFA 3PJWA 2VC6A 3VIGA 2GWGA 1R2SA 3W7QA 3CT7A 5DBTA 1M5WA 4LUSB 1OT2A 3ZT5A 3EXRA 1HJWA 1WZLA 3OZPA 3EMCA 3STPA 3TDFA 2ZRXA 1QBBA 3CHDA 1KFLA 5D2WA 2CBUA 2PDFA 3L4WA 3H54A 5AC7A 3UWZA 3LCXA 4O0QA 4BQ5A 1F74A 4AW7A 1AMKA 4A8LA 1GG0A 2PC4A 2IKHA 4PTXA 4YS1A 3S47A 1VZWA 1Q2RA 4NKCA 1HZYA 1ICQA 2FGZA 2QS8A 3MVIA 4KEMA 3BLDA 2QJJA 4C7FA 2NXGA 2AL2B 3PZIA 2I56A 1S5VA 4ZQOA 2VRQA 5AHIA 1DIOA 3BMVA 1LG1A 1DTUA 1SJBA 1XXXA 1AFSA 2FDSA 3UCCA 4O11A 3KXQA 3M0XA 5C54A 3WD1A 1JDCA 3WLMA 1YADA 1H5VA 5JQ9A 3QR0A 3PF3A 4J3UA 3SIMA 4B5TA 4GCAA 1EP2A 4CLMA 2I9EA 1TR1A 4PB4A 2YYUA 2E8YA 5XIMA 4GYPC 1QI4A 2G97A 1MZRA 1B90A 4UTWA 1FH9A 2O7QA 4POCA 1T5AA 3NG3A 5T9CE 1PX3A 4AXKA 4XQ6A 4CNTA 2OGYA 3GNRA 1ZRQA 1EWEA 4RZ6A 3LM7A 3GTHA 5A8GA 2BLEA 1CGYA 1QWKA 3EA1A 4HOWA 3ZJ8A 1J96A 4OE7A 3B9EA 4H8NA 5D9NA 4NI8A 1LDCA 5FEPA 2Q3RA 2XIJA 3TYDA 1V6YA 1QPOA 1XRSA 2PD5A 3K13A 4E2OA 3K8MA 3PC0A 2ZTKA 4F66A 1UKTA 2TYSA 3TYAA 2PDMA 4EANA 1EJVC 3CQHA 5LA2A 4N7QA 3LSBA 5EA9A 3VNZA 1EP3A 4B16A 2F2HA 3IJLA 3WEMA 2XPKA 1EWDA 3VIFA 4ATDA 3TJXA 3I10A 2Y8VA 3SJNA 2WMHA 2GUBA 4WZHA 1UWIA 4H8VA 3WK1A 3MV11 3USZA 2FMOA 2VX4A 1UH3A 1NWUA 1X6NA 3N2BA 1AQFA 5C9RA 2P3EA 5AVHA 5CC6A 2VWTA 3PZOA 1RQHA 4HQVA 2QDHA 1A5SA 1ITXA 4LUTB 1EUNA 3V5CA 2G4FA 5HAOA 2FHFA 3CAKA 5D38A 3PBVA 1HJXA 2EGZA 5TF0A 1JRBA 4ZB0A 4J2PA 2INFA 3VCCA 3DG7A 1SU5A 4OBSA 1S2TA 4QRNA 2YB1A 3WENA 3W7JA 1PEZA 1XV8A 3AHVA 2P53A 1WKDA 4DNHA 3EDFA 1EHAA 3B4UA 1RR2A 4ZL1A 5FESA 1MQPA 3BJTA 5DEZA 1EJWC 2PP0A 4Y6GA 1XUZA 3K4DA 5DN1A 2PTWA 4PTDA 1H0IA 4XUGA 1DV7A 2D0GA 3S1VA 4JEQA 1X6UA 3T0AA 3LDVA 5F2GA 4AZCB 4Q8TA 3OTRA 1ITUA 1PKYA 3HOJA 4DVOA 4HTBA 4HPHA 2QCDB 4FX7A 3L12A 4RKAA 3CV6A 4JD4A 4P8VA 1TMHA 3IIVA 3WF2A 4O14A 2WJFA 3QZEA 2F84A 4JQAA 1CW2A 4B2DD 1E3ZA 4DWSD 1XM3A 1IXOA 3C5QA 5EBAA 1DOSA 5CSYA 1US3A 3TSDA 1XLAA 3QEZA 3AU6A 4XAPA 3TYCA 1FVPA 5B80A 1J11A 1MEHA 3A22A 3SN4A 1RQBA 3PBGA 1XDLA 4GVFA 2YCLB 3NVTA 4LVFA 3E5PA 3NOEA 3N4AA 5HJLA 1FH8A 1SW0A 3WDJA 1RCQA 3JW7A 5I23A 1AW2A 4N6FA 3VUSA 2QAFA 1N8FA 3PZVA 1CLXA 5AOUA 2WC7A 1W1ZA 4M56A 4WCJA 3VXGA 2QXWA 4OHQA 4Z2HA 3BJSA 4S2BA 3NNTA 2YJQA 2BVTA 3IJQA 3GNXA 2OU4A 5JUVA 4OGZA 1K9FA 3PTQA 4ERAA 3W72A 3W1AA 3DYOA 3W22A 2QPUA 4WDWA 1KM3A 5FEWA 4NI3A 4D6EA 1G4TA 4Q3MA 1QPQA 4ZQPA 2EKGA 1TPB1 4Y9OA 2H6RA 1JJKA 1XPYA 3A5FA 2EPHA 5ENLA 4PUJA 1IWBA 3A13A 4G7EB 3NPXA 3H2AA 3KCOA 2TMDA 4XUYA 2Z29A 4RE4A 4HYVA 2PZ0A 1E4NA 2VCCA 4TTGA 1A5LC 2PDPA 1EPVA 3KBNA 4XTIA 4DUOA 1GKRA 3GG0A 3ARSA 1GJPA 1FDJA 5CG0A 2OPJA 3M1ZA 4GNKB 1TMLA 1K4HA 2FKPA 1NM9A 2CHOA 4M81A 4QBXA 4AX7A 4B9YA 3EKLA 3CAWA 3VUPA 4YTUA 2CLMA 4UXDA 3KHJA 1FKWA 2TSYA 1VD6A 5I6SA 2E5BA 3FOKA 4W8BA 1W1A1 2D3NA 4LSBA 3BMWA 3VI2A 4JFUA 3LXCA 1CIUA 5HMSA 3VGDA 4RE3A 1BWKA 2XSBA 3VIPA 3FS2A 5EYWA 5I03A 2GDVA 3A4XA 4LEFA 1XQKA 4XD3A 3W25A 5C6MA 3UPMA 1AA1B 1WDWA 2EPKX 1PZ1A 1US0A 1LWHA 3P81A 3HG4A 3VDGA 3TP4A 3TMQA 2OQYA 3EDDA 1TTJA 2QF8A 1X1ZA 2C6QA 1CB7B 2XGBA 4QJ5B 3NPUA 4ICMA 3NSNA 5BYWA 1YPFA 3AS2A 3OLGA 1K6WA 3H23A 1LM1A 4GFSA 1UD8A 4NYYA 1W1IE 1QBAA 1KC7A 3TTQA 3CMGA 3G1HA 4PRRA 4ZTXA 1V6UA 3LRKA 4CQ8A 3E74A 4XV0A 3E6EA 4MY8A 2E9BA 2VC7A 4M80A 4MKNA 1US2A 1KFKA 3SZ8A 1Q63A 3UVAA 4KWUA 2HTMA 3NL6A 3CTTA 3G5EA 2GUUA 3O6DA 1KRCC 3L5MA 1XPGA 3DC8A 3QTGA 2YB4A 1BQGA 4C5YA 3C2EA 1BSIA 2X1UA 3WQ8A 1KA9F 1WDQA 4EOUA 4FX8A 4QS6A 4DUXA 2PFHA 3RX2A 1TYGA 4Y9MA 3BLOA 1XYCA 1LBMA 2ZZ7A 4ORIA 3GFYA 1GOKA 2XVKA 3VCNA 4Q4PA 3SGUA 2VGFA 2VDGA 3AC0A 4WR3A 1TR9A 2UWFA 3OLDA 4R9OA 4F48A 4P8UA 1LQ0A 1E9YB 1UASA 1TCMA 3SUTA 4JN6A 1JULA 4FR6A 2PDLA 4ZO6A 3SFKA 3COTA 3O2LA 4PC8A 1YDNA 4ZEPA 1XJBA 3V3WA 4FXFA 3E5BA 4L6DA 1EF3A 1WXZA 1YLVA 2W92A 2WMGA 1E9IA 3WNKA 3W7IA 1RXOB 1ONWA 2WCAA 3MSDA 1XLJA 3CNYA 3PB0A 4A35A 1B54A 3FEQA 1Y0EA 3AYRA 1D3HA 4JY9A 4BF7A 7XIMA 3P61A 4MY9A 3G1SA 3Q65A 3PJXA 2E3ZA 2GDUA 3CEPA 1KRBC 3M41A 2VFFA 1XLEA 1DWIM 1C9DA 3GU1A 3EOUA 4QSFA 4XSLA 2VGIA 4FF5A 4C5ZA 1ELSA 1M41A 1OADA 1M9HA 4P2VA 2RGMA 5D09A 3O15A 2PDIA 4ZB2A 5D33A 3G2GA 2CU0A 3N12A 4FXJA 3BJFA 3CLMA 3VDCA 3KTSA 3CQ0A 3T7VA 4DM1A 2PWUA 4GK8A 2OEJA 1S1RA 2E9LA 4V28A 3BG5A 4MJ2A 4GY1A 3MI3A 1XIHA 4FSAA 1UUQA 4MDOA 3LENA 4LGXA 3IJ6A 2G96A 3CZLA 4ZO8A 3FYPA 3A4WA 3LS9A 1YKWA 1EIBA 2OZ8A 1AZ2A 3ANVA 3S2NA 4I7UA 3UJEA 3QGKC 2HRWA 3H2OA 3K46A 4JKLA 1ODZA 4JTKA 3RRXA 2EQDA 3UD6A 2CHRA 3GDTA 3WG6A 8XIMA 4G2DA 1OF6A 1UQZA 4GJJA 5JVLA 1TTPA 3KRSA 2RDWA 3KW3A 1TG7A 3SADA 2OB3A 3W81A 3TAOA 3WBYA 4HOXA 2JQXA 3C0QA 3B8SA 2YCKX 1P6CA 4XZNX 4Z17A 2TAAA 4KPLA 2OX1A 3GZAA 3KS6A 3T07A 1TMQA 5LA1A 1WYIA 4ACYA 1UWUA 1W3NA 1JI2A 3SUSA 4XTDA 1OM0A 4BZYA 3SGZA 1W3HA 1QMLA 5C7HA 2O56A 4M6PA 4AY8A 4W7WA 3TZFA 1QI5A 3I4EA 3GK0A 4WGXA 3NPWA 2NVAA 2QVHA 2X2GA 5DMYA 1XIBA 2RDTA 8CGTA 2C91A 3WH8A 1J8VA 1P7TA 3W27A 4C90A 5FJIA 4DJDA 1UA3A 4DQWA 3A24A 1KXQA 4NT0A 3W1MA 2ZUMA 4C6OA 5G1TA 4RL3A 4E3VA 3SW6A 1V6TA 4D8LA 4X3ZA 4JTFA 2DJXA 4NP7A 1LOSA 4HTYA 4ACZA 5H6HA 3G3DA 3FCPA 1N82A 1P0DA 1KWKA 2V2HA 2A1YA 5JBEA 2EG6A 3UZXA 1UZDA 2FTWA 1KM6A 4GZEA 4BS0A 3ZVHB 3TA6A 3NEVA 2E0PA 3VGHA 1QW7A 4TO8A 1XI3A 3GE7A 2VNCA 2ZZ2A 1M7OA 3HG3A 3I7RA 1XF0A 3BK0A 1PZ2A 4PUMA 1FP9A 3AWOA 2GVLA 1RK5A 4QE4A 4IFOA 1CXLA 1LCOA 1MNZA 5KZ6A 2CLHA 3C0LA 3T09A 3BAYA 3GU2A 3L23A 1WOAA 1MW2A 2CEQA 3GUGA 1YTDA 3ZT7A 3F2DA 2IKJA 1DQXA 1UUMA 5A2CA 4HHLA 3V7PA 1R46A 1IZCA 2V3GA 5CPSA 4R88A 5KINA 3A23A 1J5SA 4GX8A 3RLGA 4C6PA 4EVZA 1MSSA 4QG6A 2BWGA 3U2ZA 3PPHA 1JPIA 3DXIA 5CPOA 2CLFA 2O9PA 4LY8A 4RNIA 5HNTA 3LI0A 3HFYA 3W26A 4J9JA 4G56A 1H60A 4LRTA 1Q3NA 1ZCCA 1C7SA 2QCGA 1DORA 3UJFA 4F0HA 2AGKA 2YL6A 4KWWA 3WK2A 1P0BA 1AMYA 3B9OA 3DUGA 2GQ3A 4L4OA 3AHXA 2DZUA 3CL6A 3JZEA 1TJPA 3VMNA 4NZ5A 3SBFA 4X2PA 1P6WA 1V79A 2QCMA 4PCTA 1FUYA 5J5RA 3PP7A 1EJ7L 1N8WA 4QP0A 2POZA 2J8FA 2ZWZA 4GVIA 3ALFA 3NO5A 4INFA 1A5OC 1QPRA 3OHIA 5D2VA 5F4WA 5JU6A 3LU2A 5K2ZA 2XHYA 4Z2JA 1P6BA 1J2BA 1JCXA 3UCDA 2ZX5A 1R3YA 1E1EA 1PDZA 3ONBA 1TPC1 5HWMA 2Y70A 1ZFJA 4IF2A 1ZZMA 1KQZA 3RX4A 2DSKA 4XZIA 4BKNA 2GL5A 3BICA 3LX9A 2V9DA 2IXUA 4JFTA 1ONRA 3RLUA 3STFA 3GSMA 2ALRA 4IGNA 4JTDA 4O1CA 1R6WA 1CTNA 4YVXA 1YQ2A 3APGA 3N19B 3OQ8A 1VFLA 4NQ1A 1VYRA 1N7KA 4ATWA 4GUJA 3WF1A 3C3UA 4IIFA 4IQJA 3S46A 4J3WA 4IMGA 1A5NC 2PMQA 3UETA 2J9ZA 4M24A 3IPWA 2ZRZA 3ITVA 1TZ7A 4UQBA 3EMZA 3E2QA 3WMBA 5E5CA 3P62A 3I6EA 3RILA 3N2TA 5I7GA 3VD5A 2R1PA 2QF7A 3UXAA 4E3TA 2PDXA 3LLDA 5J04A 4DBUA 1LLZA 2Z1KA 4H01A 4MWAA 2NX9A 1RBOB 4PULA 3LSCA 4EXAA 4Q8PA 4MZYA 1MW1A 1GVEA 4MPKA 5FA5A 4IMDA 1KBIA 1G0CA 1LROA 4LXFA 3HN3A 4XWUA 3UFYA 4GZIA 1J79A 6TAAA 5C70A 5LIUX 2J7GA 4TVDA 4UOQA 2AKZA 4W9TA 4CNOA 5M03A 3PBUA 4B3KA 3HA1A 5AYIA 5TAOA 1VEPA 4PL2A 4IJBA 3MT1A 4UFLA 4I5UA 1H62A 4UNIA 1UC5A 1CYGA 2NX3A 4RUBA 2AQOA 5CZJA 3WNPA 3GXIA 3PPFA 2C7FA 4FR1A 3CUHA 1TWDA 4HNVA 1OX4A 1U1HA 4B4HA 3SUVA 2WWDA 3K8LA 3GVWA 2PBGA 1HO1A 3RK8A 2J4GA 4GNJA 3FY1A 6REQB 1QHOA 2E6FA 3RO6A 3GR8A 3TNBA 5H8MA 3MTWA 1W8GA 4LYQA 3W37A 4AWSA 4L80A 2CPUA 4ONVA 1H51A 1FWAC 1NTHA 1G67A 4DUWA 4CNNA 4Q4SA 2V5JA 3SIZA 1ESWA 4GC4A 2QCEA 1CPUA 3TVAA 4AD0A 1XGZA 3C6CA 4HSHA 1V3HA 3P0XA 3OZYA 1RBLA 3VE7A 4HIBA 3IARA 1DJNA 3M0ZA 4NZCA 3GLCA 2QMJA 2Z27A 1HFBA 1HIZA 4GUGA 1UR9A 3EEZA 1EF2A 4QITA 1YX1A 2W61A 4GY7A 3PZ9A 1ICPA 2CLEA 1OCJA 1SO4A 4PMUA 2R82A 4S39A 2DSZA 4XISA 1LLWA 1V02A 3YPIA 2BVYA 3FAWA 4OKDA 4PL1A 3KCJA 4FPSA 4UTKA 3ZVIA 2OWXA 2ZRYA 4WQ6A 1O1ZA 4I9JA 1EJRC 2DIJA 2GGEA 4QAIA 2ZKMX 3OU8A 3TN6A 1MQRA 3E96A 3WJXA 3VOCA 2PWGA 4LU0A 4CD5A 5A6LA 3WELA 2YW4A 3V0UA 2VYOA 1KFBA 1CNVA 3H22A 2Y7FA 4ZXOA 1GVOA 1T96A 1UKQA 5DMNA 1PS9A 5DO8A 4AXNA 3TUUA 4LFYA 2BX7A 3D6NA 5FJRA 2ZZ6A 7TAAA 4XVEA 4H9VA 3RCMA 1H0GA 3QLLA 3ZLFA 5I3IA 3MDWA 1V7YA 1RUSA 4RV8A 2PAJA 3VNLA 2WZHA 1EJUC 4MNLA 2NLIA 2W66A 4RNHA 1S2VA 1ZTVA 2GQ9A 3QGVA 4AVOA 3CASA 5A6SA 5JBFA 3TYZA 3VGBA 3ITYA 3R10A 2GGGA 1X8FA 1RLDA 2QUUA 3MJMA 3VTRA 3OBKA 2YDRA 4N0RA 3W4RA 3F1QA 4H9UA 4H3DA 2UY4A 4ICCX 1ZCOA 2ZA3A 4QM1A 4D8ZA 1JL8A 2NVCA 3WJYA 3GDLA 5F1UA 4JAWA 3C0JA 1UA7A 3S83A 1ME9A 2ZFAA 1R5YA 1BRLA 1K1DA 2VCBA 2TODA 3T42A 2CFFA 3H24A 3WH5A 3SUWA 3P8JA 5DELA 1G01A 2JGYA 4IP5A 3F03K 2PDWA 2TPSA 4MYAA 3RPTA 2FYMA 4PEEA 4NZFA 4AHQA 1NELA 1XLDA 1H5YA 4I6KA 1MZHA 4PCNA 1ZBCA 1HJSA 3H70A 1SJDA 3TU9A 3LGEA 1P1MA 2WC3A 4BA0A 4JY8A 4JFSA 1XYBA 5HMEA 1BXCA 5D30A 5G1YA 1Q6CA 3CIVA 1B2YA 3CZKA 1X1OA 4AVFA 4LCSA 4Q8OA 4G8TA 3R6IA 4IFKB 2OFJA 1G4SA 1OZMA 4IICA 3RHGA 1R38A 1EX5A 3W85A 1PKLA 1U33A 2WQPA 4YWSA 3U48A 4D9PA 3VD7A 1M68A 3WD0A 3TFXA 3VAVA 4Q4MA 3FGCA 4NXSA 1XG4A 4JTGA 1W9DM 3NQCA 3U8GA 2FFIA 2Z1BA 4PEKA 2P8CA 4D6JA 3W2KA 4PODA 1KFCA 3KHDA 1VJZA 4JFVA 3R12A 4M3PA 3UXIA 1QRQA 2PWVA 4J3VA 4BFAA 2X42A 3AUOA 1PKNA 1A3XA 1LRQA 4HJWA 3ZO9A 3IVTA 2NSOA 4GYFA 3TH6A 3NZGA 1OGGA 1GQKA 2YZRA 5CZSA 1ZENA 4HP5A 4M8UA 2DSVA 3AHTA 4DM2A 5TQLA 1XFBA 3W2JA 3I4KA 3CPRA 4K3ZA 1ZLPA 4M1RA 3W2UA 5ABEA 1VBJA 3C2VA 4P7RA 1JR1A 1R8LA 3W53A 3VFCA 2QDDA 2ON3A 4S3EA 2BHZA 1UR0A 3HPZA 1L2UA 4QE1A 2ZOXA 1YYAA 3MC5A 4ASTA 3LPFA 1UD4A 3BOFA 2XSAA 5FACA 2ISFA 4JTHA 3TAKA 3U4AA 3A3WA 2P5NA 3NIYA 1J18A 3UCQA 1ZQ5A 1J0JA 3KRUA 3VD3A 3P6LA 1OX5A 4KGLA 3S9YA 3QH2A 2CBVA 1BF6A 3M0YA 4L6HA 4IG2A 4DYKA 3W7RA 3AOFA 1GQLA 4V33A 3A6OA 1H09A 2IPFA 3EOEA 2WVVA 3LV6A 4Q4OA 1K7FA 4UWMA 1V6WA 1N55A 1EUAA 5E93A 2E09A 3KTXA 3S9ZA 1R30A 2WKGA 2XM2A 2HXUA 4HHMA 4RV3A 1G7UA 3H21A 3ARWA 3UY8A 1GW9A 3IIXA 2OWCA 1I2PA 3TC6A 2DFAA 3T6CA 2XUCA 2QUNA 1DWFM 2JIEA 4C6NA 1J0ZA 2NX1A 4R5EA 4XO6A 1JPMA 4RDWA 4FNPA 1PX8A 5BWFA 1W1TA 1Z44A 5LXXA 1W17A 4YJ5A 3R79A 5LA0A 4MJMA 4AWTA 3WQFA 1JF6A 1FY6A 5E0KA 1CI1A 4R27A 3ABQA 1W9PA 1OD0A 4A3QA 1YIXA 3SCOA 3WLKX 3DZ1A 2BXZA 1L6WA 1W1PA 4IQEA 3K2GA 1UQYA 1Q6GA 3DAQA 2HEJA 4O52A 3R8GA 3EWXA 1RV8A 1F8MA 3N6HA 2D2GA 5IOBA 1QOQA 1BYAA 3TR2A 1TPEA 2A3BA 3AFBA 1UD2A 3AS1A 3E9AA 2YXGA 3OGSA 4U10A 3NPVA 3RJYA 1JZ7A 3IRDA 3PTKA 3AXXA 2EPLX 1REQA 3CZ8A 4R33A 1A53A 2AMGA 4OOZA 1I1XA 4I7VA 1IEXA 2GJLA 5BXSA 2X1TA 1OB0A 2XIMA 3Q4DA 2PB1A 1NY1A 1EO7A 4KWOA 1YNQA 3CAQA 3THCA 2WHLA 1JDFA 1DJWA 4K36A 1FX6A 2H3BA 2WJEA 5HATA 4RZ4A 1Z69A 4N9DA 1SW3A 1JDEA 3N4FA 2WMIB 1C90A 3H12A 1EP1A 1GG1A 7ENLA 5CSRA 1E6XM 4IQDA 3KOXA 1UZ4A 2DIKA 2J7BA 4KCVA 5K9XA 5LIXX 1XIIA 4H6QA 3UP8A 3DYPA 4DZ5A 1HP4A 2Q02A 4PCFA 5CEWA 1K4GA 3U5YA 2PDGA 2VFIA 2VR5A 1DEDA 5GNXA 1LQAA 1WXYA 2BG5A 3DENA 2F8QA 1QO5A 4H19A 4ZFCA 1AL7A 2QJIA 4KCWA 4HNLA 1PV8A 4NRRA 3U4FA 4ZE5A 1UWSA 4EPKA 1CGXA 2CIPA 3U9IA 3W6YA 4FNTA 1MWOA 3DFHA 3VPLA 2I57A 4C6QA 1Q45A 4ORMA 5A6JA 1KCLA 4Q4KA 3WQPA 4YXGA 4B91A 2DUAA 4RPQA 4MNKA 3SI9A 4DZIA 3GNOA 3O6YX 4RR4A 1TJRA 1TCDA 1EHNA 2CNCA 3MUAA 2YLAA 2OEKA 2V30A 4AZ7A 4ADTA 1K6AA 2PP1A 4DLFA 1YRRA 3Q58A 2HE8A 2Z2BA 1UP0A 4DO7A 4FHAA 2XVLA 1HJVA 5CSUA 1ONEA 3VKAA 3S5OA 1PTGA 1QI3A 3PNZA 2DVXA 3W1TA 2DSUA 2RFGA 2X0SA 1EO5A 3VU2A 5EFFA 2DQXA 1ITQA 2D2OA 4Y8EA 5BRQA 4NAEA 3B03A 4EXBA 1NDYA 4R7OA 4B2DA 4DWSA 4CD7A 4H9ZA 2ISWA 1ZY9A 1B5TA 3LCFA 3FW6A 4L1GA 3H2NA 1EPXA 3LQLA 4DNMA 4H8UA 2ZRWA 4H04A 3QYQA 2G3IA 3E0LA 3QQWA 2DH3A 4G9PA 3P5ZA 4QLKA 3WF0A 2FZBA 3PS7A 1ZAHA 3TWBA 2QHAA 3W82A 4RCXA 1S5NA 1QW8A 3CH9A 3SEPA 4CNSA 2Y8UA 2GQ8A 3T4CA 3H6OA 4IT1A 2B7OA 4JS3A 2A4AA 1IGSA 4AIOA 4IM4A 3CO4A 1G4PA 3VC5A 1XRVA 5BU6A 4OOUA 3GNDA 1MUWA 2VFDA 1ZB5A 3GZ3A 3AYVA 4Z1AA 2SFPA 5CH9A 2YBUA 3G77A 4RK8A 1Q2SA 4OU1A 3D3AA 2IUZA 1VFOA 3A3XA 3SRHA 1ZBWA 3LLXA 1B0IA 2D22A 3LPGA 1DXFA 4AIBA 3VIKA 2DSWA 2FLIA 1D7FA 4TXEA 3Q45A 1OYCA 4I9MA 2JALA 3B8WA 1F4HA 3S4TA 4UOZA 1TX2A 3QPZA 4PB5A 1P0EA 1I1WA 1B4KA 2NSXA 2W0UA 4RJEA 1RVGA 1Q8AA 4I5XA 1MXGA 3M0IA 3EEGA 5CXPA 4FLQA 5G2HA 5A8MA 3PB2A 4PCPA 2CW6A 1O5XA 3NQGA 1EC8A 1E0VA 3B0YA 5REQA 1ICSA 3P3BA 5D2YA 1YNYA 1UC4A 1HO4A 3T55A 1FHDA 3G8RA 2R1LA 2PRLA 1T99A 5EFDA 2W5FA 3TCEA 3EWCA 5ABFA 4IPNB 4JICA 1L6YA 2ZX7A 1HNYA 1RHCA 1OFOA 5DFAA 3V18A 3OGVA 4WXZA 1IEQA 2DDXA 2EHHA 4HMEA 3VO0A 4DEFA 1LG2A 2A85A 5FSEC 2DUZA 3ME3A 4US5D 2NXIA 3QYSA 1M3UA 1XSKA 2Y5JA 3ALGA 3BAKA 3V5FA 3T44A 3V36A 2YW3A 2ZX6A 2Y61A 2WBKA 4GIYA 5D8ZA 3WFZA 1XLLA 3B9NA 5KITA 3M47A 4BK9A 4XD4A 1IT8A 2WWCA 4CVUA 3HTWA 3I3EA 3A12A 3ZWSA 1OD8A 3SCTA 5HBFA 1V93A 4IIEA 3F4VA 4UTTA 3DN5A 1HVXA 3FDGA 4LANA 1IQ8A 3PBMA 3H4WA 5I00A 2GDQA 2HS8A 2RAGA 3M0JA 9XIMA 1A4LA 3BANA 4JTQA 3QVQA 1L6SA 2Y88A 3LY0A 1U1UA 3LNPA 3R0UA 4NJKA 4D2JA 1VLWA 2OX4A 1GHRA 2VEKA 3WDPP 5C2CA 4LUIA 1M04A 3S1WA 3MP3A 4XBKA 2YBTA 1XIFA 3PR2A 4L1WA 3QZAA 1GOOA 3BG9A 3WIJA 1NSJA 4WJ8A 4FK9A 3VMPA 2PDKA 4AY1A 3TR9A 3LA4A 1F7BA 3OYXA 4NZJA 4KKXA 2XVPA 1HKMA 3BO9A 3HPFA 3T2QA 5BOOA 2Q8LA 4YU1A 1FHVA 4MUPA 1JGIA 4UR9A 3WK0A 2XZ7A 4FAMA 2Z00A 4KRTA 3NTYA 1TUXA 4DJED 3VOGA 4IZGA 3PZGA 5CJMA 5GQBA 4US6A 1PBGA 3M9YA 5F7UA 3UG4A 1QNSA 1RH9A 5TIMA 4JL1A 5CAKA 2BOFX 2FDMA 3LV5A 1RJRA 1YNPA 1J01A 1S5TA 2XDFA 1L0PA 1NARA 3PPCA 4GUIA 1ZUAX 2PWEA 4OFCA 3WD2A 1O5QA 1TV8A 4NG3A 1MI3A 2E1DA 4CN4A 2WXDM 5BU9A 1QK0A 2ZDSA 4A8NA 1EDTA 3SURA 2WVUA 3ABSA 2A6LA 4WIWA 3WFAA 3W6MA 3NXFA 3GFZA 1O4UA 1HKJA 2CWNA 1HL2A 5EGRA 4J4KA 3WY1A 3L68A 5BNKA 2INEA 3DHPA 4Z0SA 1HX0A 1POJA 4ZODA 1MQQA 4MUZA 1WCGA 4U5KA 1OF8A 1JXKA 3G0SA 3AMGA 3TNOA 2WO5A 1S5WA 3TKFA 5JXQA 4W85A 3TEVA 5C9WA 1DIKA 3OZMA 3ZJKA 2OXNA 1C7TA 3HIJA 1RJPA 2Z7GA 3GIPA 1P43A 3I65A 1R7OA 5IFPA 4IP7A 3WQDA 1FWJC 2V5BA 1IXNA 1FTXA 1W3LA 3S6TA 3QQ1A 4W8AA 1K70A 3CB8A 3GFXA 3UR2A 3W2LA 5K3VA 1ZBVA 2ZUVA 3OB8A 5AYBA 3DKLA 5CLWA 4AFYA 1DJQA 4F2UA 2J47A 1QNRA 3IEBA 2F38A 4HU4A 2ZUWA 4JX6A 3TC7A 2J75A 1W3KA 3KWXA 3DFSA 2CZVA 4N9EA 1O66A 4NL1A 5BMWA 3FVDA 2JEPA 3BOXA 3KM8A 2E68A 1XS2A 4AIEA 4AD2A 1F05A 1UWAA 1SR0A 2ZRVA 1GTEA 3EXSA 4DAIA 3S6OA 4AG0A 4E2VA 2PLCA 3U2OA 4LAZA 2NVDA 4AD5A 4OIFA 4J3SA 5HINA 3P7YA 2FB2A 3GDBA 1A5MC 2XG9A 1OX4B 3DIPA 3FN9A 5E0FA 4AAJA 1X98A 3NDZA 4PMZA 1E1FA 1KTCA 4GH3A 1RP9A 3IUIA 5LIWX 4PUWA 4QTGA 1JZ2A 4DJFD 1JI1A 3RG6A 1SZFA 4QX4A 3L9CA 5A6BA 2DZAA 4DO5A 2Q8XA 5A2AA 3KP0A 3NQ7A 2YFNA 3AIQA 3STCA 3U2CA 2WHKA 1AG1O 4A29A 2C1IA 5I78A 2BB0A 2X8RA 4LVGA 4Z1DA 5EMUA 1PJ9A 4HZ6A 4YIWA 2X2YA 3QHNA 1IEIA 4K7VA 4WY0B 1VQTA 4P8WA 2PA6A 4A3HA 4E2DA 3GH4A 4HHHA 3N15A 7A3HA 3QOKA 4Y8FA 4AZIA 3KL0A 1JZ3A 4NU7A 2NW0A 3UZZA 1EYWA 6TIMA 2DVUA 4KWSA 2GVYA 5HPOA 4NNAA 3RPMA 4ZOAA 3TIMA 3CWHA 2BY3A 4LT9A 1SJCA 1LUCA 5D2XA 3WD3A 2YL5A 1CGUA 1CCWB 2I5QA 1F61A 3BQ5A 3EWUA 4MNMA 1KBLA 3NQVA 4XAYA 3IJ9A 4RE2A 2QPXA 4P7LA 4HNUA 4AEEA 3URNA 3QKZA 1GQIA 3OQEA 1QJWA 2ZVRA 4MOZA 1A5UA 4L56A 5HR7A 1QVBA 3OO2A 3CIXA 2EPOA 3DBPA 1VHNA 3LCHA 3SY1A 3JZUA 3NSXA 2P0OA 1VLIA 2AQWA 3FVMA 4YMZA 1U22A 4Z0JA 3M46A 1I2QA 5DANA 1F73A 3TLLA 1J2WA 5D02A 2Q6ZA 4MFEA 1JUEA 3WLSA 3DHDA 5BXPA 1TWSA 3OZOA 1H61A 4PN2A 4GABA 5I09A 4ZOCA 2YCEA 3WQCA 5E0CA 1VC4A 4QJ4B 4BHYA 3NL5A 2VDHA 3E49A 4C6LA 4Q8NA 5I79A 3I3BA 4HA3A 2WLYA 1KWGA 1L9WA 1D8CA 2WNZA 4ECLA 2P88A 4I8YA 1UOZA 2WMKA 5DT5A 3NL3A 4DIAA 5DXYA 3N11A 3G6MA 1KKOA 3KLLA 1WDRA 3F7JA 4FLSA 3UERA 3W7OA 3VD9A 2JBMA 4W7VA 4X9SA 3VKJA 4RLIA 4E38A 1WAUA 3PVFA 2C71A 3B97A 3VA8A 4C1KA 3ZJ7A 3ZSSA 2F2KA 5BOFA 2OODA 2A7NA 1ADSA 2AAAA 1V0KA 1JPDX 3IGUA 5DCEA 3SRFA 4LVDA 3VNDA 3T08A 3UF9A 1W56A 4QJ3B 4F3HA 2HXTA 3N13A 2V2DA 2DT0A 2VZSA 1T6MA 2Q3OA 4UMCA 3LEPA 3AMCA 4UZSA 3GTXA 1RD5A 1C9WA 1E4MM 4QNWA 3W84A 3GH5A 1BPLB 1E15A 1P5BA 3EMQA 1GNXA 5TD4A 4DO6A 3G18A 1UJPA 3MDUA 3ISIX 3APYA 3UGVA 1GYMA 1KXVA 2DU2A 5FEXA 3AZRA 4R9XA 3EX6A 4JDYA 4RDZA 2VQUA 2HQAA 3NDYA 5DRCA 3VKBA 2IQ0A 3FGCB 1BYDA 2OSYA 2CERA 4LUJA 4H9YA 4Q8UA 3EKGA 3DH7A 4HCDA 3E0VA 1LWIA 1FRBA 2J8GA 3L4ZA 1QNQA 1UR1A 2DIEA 3G1YA 2YBVA 2CLPA 1BSLA 3NO3A 4O8RA 3FJ6A 4PUUA 3CC1A 1UKSA 4CGTA 3IWPA 3TC3A 3R0KA 1K3UA 4JTRA 4Q4QA 5CJNA 3WUEA 4XZWA 3VIOA 2X1RA 1LL7A 5LHFA 2RUSA 1OGSA 3G1XA 4FS9A 2UZ9A 2J9YA 4F0RA 1GYLA 4F2BA 2VTFA 2J6VA 2REQA 2I17A 1MFVA 3EDKA 4D6CA 1JAEA 4IIDA 2A5HA 4R53A 1YXYA 3NWRA 1Q7ZA 2WCGA 1WX0A 4GINA 4MFDA 5HA7A 2QCNA 2QJNA 1DJGA 4HA4A 2Y24A 4QDMA 3RFAA 3WFLA 3ECQA 1PZ0A 1JAKA 1J5TA 1R3RA 3KCLA 4TVUA 2OGJA 1YTEA 4PTWA 1W8SA 5HDRA 2J13A 2CHNA 4JN8A 4GI8A 1TZZA 2BGNE 3ARYA 1IR1A 1EJSC 1LRNA 4WK9A 1L8PA 3AWNA 3KS5A 3MZ2A 3UA3A 1CGTA 3CQJA 1BLIA 2B4GA 4GA8A 1SO3A 1WUFA 3P0WA 2HVOA 2R6OA 2A3CA 4NUWA 4QFUA 1UWQA 2PTDA 2Q71A 3P2VA 3CPUA 1O5KA 2VKZG 1FHUA 3WBXA 5FJOA 3PAOA 2XZ9A 1BKSA 4IP4A 2C18A 3ABOA 3AXIA 1W37A 1EZ2A 2CZFA 1BYCA 1W9VA 1AJZA 2GGIA 2PF8A 3BSMA 4YTRA 2ZE3A 1C8VA 4IIHA 4Q32A 3SM0A 1EGZA 1W5OA 1J0HA 4UNKA 3UJSA 3HBLA 4NRSA 1TPVA 2QZRA 2Y89A 3OG3A 2JF7A 4UFJA 4K2SA 5HQMA 1A5KC 1TJ0A 2ZIDA 3RM4A 3NYZA 4A05A 1UW9A 3I3DA 1Q66A 3PBWA 3MMWA 1CXKA 4M19A 1VBRA 1LOQA 1RPXA 5IDZA 1XISA 1GQJA 1XCFA 4M6VA 4D72A 3CEUA 5BWAA 3SCRA 4ML4A 4JNYA 3C2FA 2G4JA 1IIGA 4I7WA 3LBCA 1TSIA 5GNYA 1UR3M 4AZBA 5ECVA 3AXKA 4KGJA 3PFMA 5EL1A 1B9ZA 1TV7A 4GJ1A 4M7TA 5F2LA 2OCZA 2OYKA 1YPXA 1I9CB 2QVNA 2VFGA 3AHZA 1EB3A 4LTSA 1VIWA 4UTHA 1OYAA 3UWWA 4UFMA 3NURA 1B3WA 3FFSA 3DYMA 1KM2A 2R24A 1I8JA 4WDUA 4ZSUA 3WKZA 1XR2A 1ADDA 2R1NA 3AUJA 4JTSA 1PHQA 4WSKA 2VDIA 1GKPA 1XIGA 3ITGA 1I0DA 2G8ZA 3BV7A 1YTKA 3OA5A 4OTKA 4Z1BA 4PMRA 1B9BA 4BF9A 1MXSA 7REQA 3TV8A 4GI4A 4E5TA 4CQAA 1TREA 1OABA 3WLLA 2QR6A 5CZ0A 4OZOA 3UW6A 3VNKA 3SCWA 4DBDA 3LCIA 3S1GA 4JDBA 4QCFA 4JL2A 3QHOA 3LUTA 4B3LA 1FCBA 3L2IA 3QXBA 2PUZA 1FP8A 3VNIA 1KM4A 1SGJA 3O05A 4G5DA 5FL0A 3OW1A 4IGSA 5AVNA 3ZM8A 1C93A 3Q67A 3N04A 2E77A 4JYDA 4LJ3A 3WYZA 1MRAA 4JTIA 2IPWA 4AISA 1PAMA 3WEOA 5ABGA 4D6DA 4ZZ9A 1BWLA 3IAPA 3URBA 4N42A 1IHIA 2ZZ4A 1XBVA 3IACA 3G8EA 5CAHA 3O8AA 1XHGA 5AN7A 5A8OA 4C60A 3AIEA 3GTIA 3HGRA 4CN6A 1UZ1A 2Q8ZA 3QR1A 3DKJA 1JG9A 5C9UA 1JZ5A 1LT8A 3EX3A 3QFWA 3A3HA 3BWWA 4AQLA 1XKJA 4WXYA 1R87A 1B3VA 1W54A 1EDQA 5CJ5A 3H26A 1SM9A 2OKOA 3IJ7A 1UBSA 3AXMA 1OJXA 4GIAA 5LNWA 2GJXA 2C79A 3WQOA 2QCCA 1Q85A 2D0HA 3CAVA 3H2CA 1PYFA 3MKVA 1TJ1A 5CPMA 1TUFA 3QGAC 2J77A 1C8YA 4NAFB 1OY0A 3NR0A 4LUSA 5DXXA 3THQA 2O7SA 2PE4A 4HHPA 1AQ0A 4REQA 1TWWA 2V3FA 1QI2A 4ML9A 3ARTA 3CPGA 2ZZ1A 3F5LA 1V03A 3IJ8A 4GVHA 4XAGA 3OA3A 3FXYA 1FOBA 3GVVA 1XLCA 2HE5A 4M5PA 3G22A 3S5SA 4ZQCA 1GCYA 3M16A 1X6LA 5BXRA 1H1ZA 2Y7GA 1VJSA 3NQAA 4DPPA 1H1YA 4R7JA 5AY7A 4MTVA 2D73A 1QASA 2E5CA 3HMCA 4ES4A 4G1KA 3RPDA 4QDPA 3VOFA 2WZTA 4HCLA 3UU0A 1C91A 1B57A 4GZJA 1TTQA 2AL2A 2GVJA 3ATYA 1VYSX 4Q8MA 3G6LA 3EB2A 3TN3A 5DY3A 3MWAA 3WQVA 4A3RA 1MDLA 1OFAA 1OINA 4H7VA 1W9XA 3TYEA 3WQ5A 3MCMA 2Y2WA 1VFHA 2YR1A 4LYKA 1Y8BA 4W8LA 3AROA 4DLMA 5T8GA 3QKEA 3E2RA 2V8ZA 3MUCA 2HJPA 3U6WA 4L1XA 4N6EA 1VHCA 2CXGA 1GVIA 2J25A 4H9XA 1V51A 3HQNA 1PSCA 1Q6DA 1TPDA 4DJDC 2CITA 1T7LA 1VAHA 4H8HA 4MWAE 5CC7A 1QHPA 2CYGA 3LXAA 1XYAA 4ZFMA 1VFUA 3PY2A 2Z6IA 4ZSTA 3IGHX 3WNLA 2BFGA 3NA8A 3T0BA 1SW7A 2YYTA 3TN4A 4UFHA 3APTA 1XLMA 1XG3A 4UQAA 1GPFA 4OBTA 4A6GA 3ENLA 4F2TA 4PUKA 3L4UA 2WVTA 5CPNA 3TJ4A 4O15A 3K5XA 4WUIA 4N2YA 1T40A 4J3XA 3E2SA 5CGMA 5D2TA 3TQPA 5U7SA 1SR9A 2IKGA 3VGFA 3WL0A 1ODUA 1EX1A 3O16A 2QUTA 3LMYA 2FPYA 3W38A 4W84A 4OT7A 2KZHA 4HSNA 1U5VA 3PPGA 3OLEA 3BCFA 2VOTA 3AIUA 2GVEA 4OUEA 3ZJ6A 4F0KA 3U57A 1R9XA 4MSSA 4QLJA 3LHYA 1FA2A 4HPJA 2VGGA 4CNPA 3GDKA 3GAKA 5IXEA 2X0HA 3BSHA 3GNPA 3DI0A 3WJWA 4RW3A 2C19A 3UNTA 2GPTA 3EA2A 4F79A 1R9ZA 2XINA 3D3FA 3ZSTA 1VR6A 3MMTA 3O0FA 1I45A 1NWRA 1H7WA 2D20A 4RXGA 3PK7A 3DG6A 1FQ0A 4PTVA 1SMDA 2VZUA 3CTLA 2HK1A 3LZ3A 4GIEA 1GORA 4OVXA 2VD9A 3VOHA 2FHBA 1XYFA 1SQ7A 3AYSA 1K8CA 4AD4A 9XIAA 1V77A 1GT8A 1PCKA 3KBVA 3OODA 2E40A 2ASHA 3OOQA 1R3WA 1KTBA 3CL8A 4O18A 4F0LA 1V02E 4RX0A 3BLIA 2EG7A 3II1A 3ARXA 1XDMA 4AUBA 2PDBA 2F9RA 5BXTA 4PUNA 4KS0A 4V1XA 1BGAA 3W1LA 4CQCA 4UTLA 1IEWA 5CC5A 3UVIA 3ZR5A 4FIQA 3C4UA 3SCVA 1W2PA 1NP0A 1S5MA 4J3TA 3IV8A 4YCOA 1AODA 1WZKA 1L8NA 3MYPA 1UCWA 2BZNA 5M17A 3TTEA 3IIPA 5EMJA 3A21A 2YA1A 1R86A 3ARPA 2E1WA 4R7WA 2BHUA 3M5ZA 3E0WA 5CPTA 2XH7A 3EPMA 4CCZA 3UR5A 4W87A 1DBTA 2PTZA 3CGTA 4AZCA 2I1OA 2J8TA 1E51A 1J0IA 4H6KA 1V6XA 5FF4A 3GH7A 1E9LA 3QMTA 4O1BA 3PSVA 1EQPA 3DG3A 2XFWA 1HF6A 3ITTA 2B7QA 4E8CA 2VGBA 3CHCA 2BVWA 3FK4A 3P14A 2WSKA 2RGLA 1FCUA 3LGGA 3B0VC 4RDYA 2ABAA 4DY1A 1OSEA 1TFVA 1VPQA 4JIPA 2YCLA 1OG6A 3TQKA 9RUBA 1JIBA 4AB4A 1FWGC 4HCHA 3L21A 4Q22A 2QKFA 2FB3A 1W1B1 4A21A 3W1UA 3BAXA 3BLFA 2W6RA 1K02A 3QV7A 3FLUA 4Q8VA 3BUVA 1W3IA 2W63A 2FFCA 2PP3A 4FNRA 4EWJA 3VKDA 1I75A 3N9KA 3NQ6A 3G1VA 1TA3B 2C13A 3D5HA 4A4AA 2WM1A 4MWAC 2VWSA 1NH6A 1ISYA 5LGZA 4B3ZA 3GHRA 3G0UA 4MKVA 4MNJA 4JHZA 4NJGA 3U3HA 4DI8A 4PGLA 1T41A 1HGWA 4BQ2A 1ECEA 3LCGA 4F8XA 2DZTA 1E1CB 1AW5A 2PWFA 4JHOA 1ZNNA 3A9IA 4G7EA 5D03A 4I8DA 1DYSA 3CUZA 5CLTA 3BGJA 1PE1A 1RY0A 4MB3A 4AX6A 3PAJA 4A2RA 3NYDA 1JNDA 4HNCA 3PUGA 1LLOA 3W6LA 1KKRA 3CJPA 3BW4A 1FWBC 1OEPA 3TFCA 1BEUA 1PUDA 4QQ3A 3LK6A 3C86A 1LL4A 4OWGA 4E8GA 3F2BA 4H7ZA 1QCWA 4NF7A 5D9OA 3VMOA 2VT0A 2DP3A 2ZCGA 1SMAA 2WVSA 2V5KA 2E25A 3GTFA 4QXIA 3VZZA 4AC7C 5AC4A 2ZX9A 3WLIA 3GC2A 5AFDA 3NUKA 5EMKA 3MSGA 2Z0IA 1WDPA 4AHOA 3MJYA 5GVJA 5AKQA 2WW5A 2UY2A 4H6RA 4B9ZA 1CXIA 1QTWA 4CCEA 1F2JA 2HPMA 4O1EA 3FDKA 1QR7A 3QBUA 4LOCA 5C8BB 3KX6A 1IYXA 1M7JA 1J0KA 2PZNA 4PRWA 4GH1A 1OHLA 4UQCA 1V3LA 2QQ6A 1Z6KA 3WSUA 3KVLA 2Y62A 4UFKA 3WQEA 1X7FA 1J6PA 4LEQA 4HU0A 4M6UA 4D8AA 2W9MA 2RDXA 1FXQA 4B90A 4LC8A 2WPGA 4LV9A 1S2UA 1UB3A 1I0BA 3BLKA 4O12A 3VX0A 3ORWA 3BW2A 3PZUA 1NVMA 2NZLA 3HPAA 1JQXA 4US5A 4J3ZA 2PS2A 1UWRA 4ZR8A 2YCJA 2R94A 2FQIA 2PGWA 2NQHA 3HURA 4HSOA 3B06A 3WQGA 4GOAA 4UZUA 1A0EA 3P74A 2AGTA 2ZTJA 3EOOA 1HXJA 1U83A 2WHMA 4FNUA 1SFLA 3PANA 3EB3A 1PCWA 1W31A 4GX9A 2I7GA 3P82A 3DBNA 1EC9A 4MHBA 2Y5EA 3ZFHA 2H3DA 2V2CA 3WLJA 1LWJA 1SVDA 4C6FA 2EKCA 3ICJA 3QPEA 4TQTA 5F2IA 1CZ1A 1ZJBA 3B3DA 4PSRA 2OLHA 1E40A 2G0WA 4IJRA 1CECA 3TYUA 1NFBA 3IVUA 1EGVA 4XVDA 4MY1A 3R89A 2PPGA 2DY3A 5B7YA 3CLWA 3S2CA 4X2RA 4GQ0A 2J9XA 2W27A 1TV3A 4C6CA 1QW9A 4F9DA 4XZLX 4MZ1A 3ABZA 1SZEA 3WMSA 4H7CA 2BOEX 2WSRA 1GKQA 5G4EA 2E67A 1H4PA 3V4BA 1GVSA 3KE0A 3M0MA 1XCXA 3G0XA 4JIRA 4IGHA 1SO6A 5AYXA 3NO1A 5IHRA 3WDHA 5DY2A 3WLOA 3HGJA 3LN3A 2YA0A 3A4AA 1XP3A 4LBSA 4AH7A 3GW0A 1GW1A 1V3IA 3TSBA 3UWUA 3QF0A 4N9BA 5AZ1A 2DZBA 4DI9A 3VFLA 2IXVA 4HYWA 4PYSA 1UOKA 3E02A 5BMXA 1A5BA 4A3YA 1HVQA 1JZ4A 4NZ4A 3RNDA 2VMFA 4Q7BA 2EXOA 3IIOA 2OKTA 5LYRA 1DPMA 1EJTC 4XKYB 3VIHA 3T4WA 4B5VA 4L9XA 1JCMP 3MHFA 3CUGA 2VUYA 3CXOA 1BGGA 4GFIA 1ZL1A 1W2VA 4PCSA 1LT7A 1SSGA 4QGCA 4GXWA 1UD5A 2D2HA 4M6QA 3UXDA 2QUVA 3PM6A 2G3JA 3NSMA 1YBQA 4KETA 4FOUA 4UFIA 3F4DA 4GJIA 2IPJA 4GO8A 4AVNA 5A8NA 2X7WA 2OMAA 1UIPA 2G50A 2C3ZA 1DJHA 2PU1A 2Z2AA 1L6GA 3I68A 2V3EA 2BBFA 4YCPA 1WP6A 2NQ9A 3VABA 4EAYA 3CB3A 2GWNA 2WV8A 3M0LA 1TPFA 1PO9A 4LS2A 2WMJA 3V75A 2X41A 4C1NB 2CZ5A 3I7QA 4EXQA 1ZJIA 5H91A 4H9TA 3MV01 4B5UA 2MNRA 3QOMA 4TOQA 2X16A 3KRZA 3KEHA 3NGFA 4J7RA 4AEOA 1UH2A 1JZ8A 2OYLA 3GXTA 3R43A 1L2QA 4CD8A 2OG9A 3BDKA 3WBAA 1JYVA 4OV4A 2P0IA 3PZTA 2VC9A 1KLYA 4OUIA 1CXHA 1FWSA 1K7EA 4DF1A 3KTCA 1ZP3A 2ACSA 1XLIA 5AHLA 3L5AA 3E0FA 2WBGA 3KZSA 4IMAA 1JPKA 3THDA 5LXEA 3LCWA 1R3VA 1HT6A 3ARRA 4AYSA 4XIAA 4MADA 5T9BG 5F2MA 4GD0A 3LHUA 4JPGA 1VRXA 2DORA 1YMYA 2VEPA 5AYYA 3C3NA 2EG8A 3UZYA 1X38A 4S23A 3BE7A 4FALA 4CQDA 4KRZA 2OELA 3W7HA 5JBDA 3QR3A 3N29A 1J4EA 3LCLA 4U2YA 2D0FA 1Q8JA 3T81A 2NWSA 4ZB5A 3QPYA 1Z42A 3N2CA 3WNOA 1JQVA 1LF1A 3GRIA 1OFDA 4OV9A 1TRIA 1FH7A 3MUXA 1W9UA 2D1ZA 1VP5A 1RA0A 3MMDA 3DERA 3VM5A 1P0NA 5HQLA 4MDPA 1O12A 1TIWA 1J12A 2CLLA 8XIAA 3C61A 5E6YA 2BTMA 1Z7AA 4DJFA 4KQNA 3M43A 3EPOA 4HZMA 3G1RA 4ADUA 1DQUA 1NIUA 4LALA 4K68A 1V08A 4M7SA 4JIIX 4JQ3A 4Q33A 3OHMB 3T0TA 2P10A 5HNNA 5CQ1A 4PMVA 3W07A 5C2XA 2W62A 1UKPA 3ZYZA 3LGDA 1WV2A 3SFWA 4EACA 3MY9A 1LQ2A 1XGDA 3NQMA 3CWOX 2OLSA 3HG2A 3MSRA 1YXCA 1POKA 4RW5A 2BHYA 2PBOA 1KB3A 3NQDA 2PDYA 1AQHA 4S1FA 3O0KA 4NNBA 4JOMA 5TBOA 3GU9A 4KWVA 4I9TA 3MO7A 2AAMA 3C2RA 3W7LA 3M5VA 1GUVA 4AWEA 3CWNA 1WDDA 2FH6A 1ME8A 3AAMA 3WCZA 1VFSA 2VI0A 2ZADA 3WO8A 3W28A 2R1KA 2YLLA 4LS0A 2VEMA 5L6UA 1Y7VA 1SZRA 2V38A 3PWAA 3GBDA 4IPIA 1NF7A 1H7OA 3W23A 3AICA 2Q09A 2TRSA 3HMJG 4H41A 4TX8A 4AC1X 3M64A 4KMQA 1YDOA 1BYBA 4CD4A 2HNHA 3QM3A 3OLIA 1QAPA 1YPIA 1RJQA 1K03A 4H6EA 1OG0A 1GVQA 2ESCA 4TV6A 1K8YA 3VNJA 1NU5A 5HMDA 3UYCA 5CCZA 1V0NA 4WRHA 4TV5A 1KBKA 4JHMA 2ADAA 1JCTA 3TONA 1GZ1A 1NFGA 2ZUNA 3BZJA 4AF0B 5E6ZA 3TK7A 1Q7MA 3AYTA 1WZMA 3RU6A 2AL1A 4XD5A 1DJXA 3ZQ9A 1XLKA 1S1PA 4MMWA 2X0YA 3S2MA 4E6MA 2IQTA 1AUSL 4HVXA 5MKGB 1PIFA 3FNDA 4TUFA 1VH7A 1VBUA 3CYJA 4IL0A 4ILSA 4JTCA 5KTLA 4LB4A 4LNCA 4XBJA 2OOFA 4HN4A 3C2OA 3PZQA 4LVBA 4BI5A 4R85A 2GK1B 3M5XA 4IXHA 4KFPA 4PRTA 4FLRA 1F4AA 3F4NA 3UJRA 3WLQA 2PDQA 1FWEC 3K1DA 2JFEX 3EA3A 5E1QA 3N6QA 2GUYA 4AZHA 1KXHA 1XICA 2WK2A 4MLJA 4Z2KA 4GGHA 4AYGA 4O50A 5BCAA 3URQA 2V63A 5C9ZA 2E28A 3LBOA 1RAKA 2J62A 5C2GA 3AXHA 2OZ0A 6PTDA 2OQHA 2EPMX 3QC0A 4LAKA 1WUEA 3OPSA 4HZ7A 2WYSA 4GVGA 2XM1A 3EKZA 3BH4A 1ITCA 1Z3NA 6ALDA 2EO7A 3W74A 5CGQA 4BI6A 1V0LA 3CS2A 1TVPA 3UPBA 2JGQA 2BXYA 3KBSA 5C9XA 1XWYA 2PU0A 3EDEA 1GVFA 2ZUSA 1XH1A 4BQ4A 4O28A 4DWSC 2Z26A 4YYCA 2W4XA 3B8DA 4XO7A 4DUVA 3FSUA 4HNTA 4FMVA 4LYRA 2V67A 3C8FA 2F61A 3ARQA 3WF4A 3ID7A 4KH2A 4Y2WA 2JKPA 3BLLA 1V8EA 2YL9A 1V3JA 2G3NA 1VJIA 5IHSA 1XRFA 1NOFA 3B4YA 1FWFC 3IVSA 3URAA 2AKMA 1GYNA 1W5NA 3VILA 4LB3A 3IUHA 4DBSA 6REQA 1XKYA 2QGYA 5CBIA 1SO5A 3QJAA 2OSWA 4RZBA 3WDIA 2VEGA 4W88A 1NJJA 4JTEA 2WB5A 1UR2A 1GOXA 3KVMA 4P7NA 4B15A 3G1FA 4S3FA 3ZOAA 2PWHA 1M01A 1JZ6A 1GOMA 1OCNA 3QC3A 5D8WA 2HMCA 1F6PA 3NQEA 4XZHA 4O1DA 4ROPA 3THAA 3LMZA 1RD6A 4REQB 2DZXA 4D1JA 2PCQA 4MZ8A 2P76A 2FZDA 1K7XA 2VL4A 4HGXA 1KD0A 1U5JA 3AIWA 4HNOA 3VIJA 2NQZA 1HL9A 1NAL1 4JCLA 1TPWA 3IJDA 1XBXA 3CYVA 3W7NA 4K8GA 3NDOA 2XFFA 1ISWA 3KOYA 3FXGA 3P84A 1S46A 3W88A 2C1GA 1QXLA 2XH0A 4UNLA 4A3UA 1XLHA 3TQVA 2NQ5A 3SECA 1OFPA 3LTPA 3KLKA 1IIHA 4GQRA 3HJZA 5FAGA 1A3HA 3CU2A 1NWTA 1A50A 3VIMA 5I5RA 1JCNA 1OC7A 1UBPC 2ACUA 3BGGA 3TA9A 3UWVA 1DJIA 4L4PA 3W24A 4S38A 1VIZA 1KGXA 2EEXA 5E9AA 3GIYA 1VGAA 5CZKA 4DX3A 1O6IA 3D47A 1AH3A 3E1F1 4CQ9A 4G7FA 3CUJA 4EF9A 3BG3A 3STEA 3MCOA 3MVTA 2R8WA 3RUBL 1HGYA 4L64A 4FEZA 3BVJA 1P1XA 3TQ0A 4GKTA 2PEVA 1F76A 2PDJA 1KRAC 1VBHA 2BGSA 4GBUA 1MRQA 4S3JA 3T40A 4O54A 2BSLA 3EWZA 1IZJA 4JQ4A 2PLMA 3UXLA 2BODX 2HSAA 5FOOA 1PTDA 4XX6A 5IBXC 4Q7NA 1K9DA 5J5DA 3EPNA 2ICSA 3FSTA 4UTTC 3WNMA 2FH8A 1QWGA 2DT3A 4NHVA 4AD3A 1EXPA 1D3CA 4MM1A 1IV8A 2C1HA 5TNVA 4WJXA 3PFRA 2QEZA 1AK5A 1LYXA 1JFHA 5H2ZA 4DB7A 3V5OA 4HN8A 3TOPA 3HFTA 3Q94A 2GJRA 4A22A 1RCOB 1D9EA 3DFOA 2DJLA 3ZWTA 3N73A 5KZDA 3GDRA 3OBEA 5HJYA 3W3OA 2WJDA 8RUCA 2OQLA 3SCSA 3MU7A 3AALA 3GKAA 3RYSA 1VFMA 2CC0A 1GGOA 3WH6A 3QZ6A 4KT2A 4P7OA 1F3WA 3LM3A 8TIMA 2L5HA 3CK5A 3S8HA 2WPBA 3ATZA 2VP8A 1FWTA 3T8QA 4U2ZA 5T26A 2OZ3A 5I3HA 2J24A 2QV4A 5HOSA 4HMNA 4IFKA 1E56A 3O06A 2PGFA 4LS1A 3UJ2A 1GOQA 2X30A 1EIXA 1TV2A 2OSXA 2OTDA 5HUPA 1ALDA 5LZLA 3REQA 3W7KA 2NQLA 3Q2DA 3O07A 1TZ9A 5I3DA 5KETA 4GXMA 5D4YA 4DYEA 2Q01A 3N14A 5FI8A 3E0IA 4NX0A 3DFQA 3L65A 1DIDA 1GWJA 2CXEA 2V3DA 3EOLA 4GE8A 4JNMA 1XIDA 4GQBA 2J7DA 3SSZA 1FWHC 1ZP4A 1VBGA 1D8WA 1WBJA 2PRMA 3UNDA 2WNWA 2CZEA 2JK2A 3OVRA 1IE7C 2HS6A 2ALDA 1PX4A 2A3HA 1LL6A 1CT5A 2HV5A 5F4SA 3GX9A 3GVRA 4AD1A 2FTPA 1XCWA 2ZQ0A 5I2UA 4I6VA 4ZTYA 3IK2A 4U3AA 2GZXA 1TWZA 4ZO9A 1IR2A 3FYYA 3AQUA 3MQTA 1XIJA 2A7RA 5XIAA 1CXFA 4L4LA 5KMYA 3ARUA 1AL8A 2Z1XA 1TO3A 1S2WA 3UG8A 3NZPA 5JIPA 1AH4A 4HNNA 1VS1A 2DW7A 4MVAA 4WDTA 3OEXA 5D9MA 3MANA 4YNGA 2X09A 1CLKA 1LTDA 1E71M 4XB3A 3EWDA 2WNNA 3RMEA 3EXTA 3TTYA 2NT0A 3P5YA 4DXVA 4O10A 3VKKA 1LZOA 4C7DA 1JNEA 1FHLA 4JCMA 3SJ3A 1C29A 3DFYA 2DZWA 3AU2A 2WNQA 4JN7A 5H1WA 3M0VA 2FGLA 4XBSA 2CKSA 3OP2A 2G5WA 4HK6A 1X97A 1QFEA 3DGRA 5HUOA 2QIWA 4BY3A 1OYBA 3UG3A 1DXEA 3MUZ1 4PMJA 3W76A 3L4XA 2AQVA 3HQOA 1ZPTA 3OVGA 3AHYA 1EA9C 3BLPX 4LBRA 3FX4A 4FNSA 4MF4A 2B31A 1LBFA 3HO8A 4C6MA 1OIMA 1HKIA 3QV8A 1EKOA 1H50A 3UWEA 4XKMA 4GI6A 1D3GA 2G3FA 5CGTA 3K4AA 2JE8A 1EDGA 3SN1A 1W3TA 1BG4A 1F6KA 5C71A 3R5EA 3QW3A 4IFRA 2I5IA 4CUCA 4N9CA 2G41A 1GHSA 4Z42C 3NQ2A 2Z28A 4RNJA 5AZ0A 4KEZA 4GQQA 1CEOA 3P80A 3T8LA 3U5UA 5HJXA 4D71A 3WLHA 3R7MA 3PWGA 2BV9A 3E3HA 1A5CA 4IH3A 1K77A 4RPPA 2POTA 3GXMA 1WNOA 3UQNA 1QT1A 3ONCA 3B8UA 1Q6RA 4ZQNA 1J9YA 2DT2A 3WQ6A 1VFTA 1EXBA 4X61A 1ZGDA 3T2PA 3W7CA 1J93A 2GVGA 3GQYA 3KUMA 3TTOA 4N02A 1VRDA 1R9YA 4K7YA 4UTFA 1M6JA 2J7FA 3AMKA 4KEVA 1ZAJA 4NZ3A 3KBJA 4HK5A 5HMFA 3GB6A 2QLYA 3AS3A 3WQWA 2Y6ZA 3GKFA 3HQPA 1XLFA 1I60A 4BI7A 3W7PA 2VURA 4PE8A 3E38A 4DO4A 2A3AA 4YN5A 2BASA 1MW3A 5HXMA 2FTYA 2YDAA 1ZAIA 4HOZA 5IFTA 3SY5A 1BTMA 4HZ8A 5KSWA 4IJCA 3E2VA 1SYTA 1OFBA 3RCNA 2YX0A 3ABXA 4LUYA 2X40A 1FBAA 5LNRA 4GWEA 3T2OA 2VJXA 1I2NA 5K7JA 1GZGA 3TZNA 3ZZ1A 4ERGA 4F4RA 2V5DA 3KDOA 2XGIA 4HK7A 5E09A 2XU2A 4FI4A 1JPHA 4ZBCA 4Z2IA 4YL2A 1MEWA 2XN2A 2WMIA 4H00A 3STGA 3DX5A 4MGGA 1UG6A 4BJHA 4K8HA 2ZC8A 3RN6A 4Y9AA 4FXSA 4W93A 1HUVA 1XBYA 3ITCA 1TQJA 3SQLA 1XGEA 3RIKA 1Q6QA 2I16A 2R91A 3TJLA 2E7FA 2HVMA 3FYOA 3SQMA 5M5DA 3N6JA 1X7IA 4CNUA 2RKXA 4EAMA 4V2XA 4BCEA 2OZTA 3WBEA 2VZVA 4X63A 1NP2A 3H2MA 5K4ZA 3MP5A 4PMQA 4J1OA 2VVSA 1R47A 4JQ2A 1PTAA 3R2GA 1RVKA 4PSPA 5DCBA 3O9NA 1LORA 1K9TA 2QYGA 4NJJA 1XC4A 2QNEA 4I3GA 1O1HA 4Q6XA 1UD3A 4XZMX 4UTJA 1BKHA 2ABBA 2DT1A 3LHZA 4F40A 3QV6A 1JD7A 1JFXA 2F6KA 2PDHA 1CGWA 2GGHA 3P60A 2Z1VA 3H7VA 2H9AA 3L67A 2FHCA 2J7HA 1E6NA 1UUOA 5CG7A 3W9ZA 1GJUA 3S5YA 3BTNA 4KFOA 4YTTA 3G3MA 3R13A 2Z7KA 3VZYA 4IMEA 4TMBA 1MUMA 5BZAA 1K9EA 2ZXAA 5G2WA 2HVNA 1QPNA 2CLOA 5U4NA 4QLLA 3BCJA 1IF2A 2CZDA 2BP1A 3LRMA 3R58A 3FJLA 2BOGX 3DGBA 1ZSXA 3DEQA 3MI6A 2QDGA 1GZJA 1Y5VA 3R11A 1O7AA 1R3TA 3GO2A 4YVVA 3A4JA 2GYIA 4O17A 1C8XA 2VELA 4FLOA 5LNSA 5GJNA 4IX2A 3J7HA 3RAOA 2WSPA 1BQCA 2X7VA 1W32A 1V4YA 1IWPA 5A6AA 3O1NA 1CENA 4AZ6A 1UPMB 3FKRA 1YBQB 4S3GA 2J7CA 2O9RA 1H7NA 4JTJA 4H1ZA 2PC8A 3GBEA 3ZXWA 4X0VA 3UEQA 4LW7A 3B40A 3MS8A 1HKVA 4E8DA 1O5RA 4PMNA 1BTCA 1OWQA 2ZA2A 1O95A 1V6VA 1OK6A 1OZQA 8A3HA 3O3RA 3WUGA 4B5SA 2ONEA 3U7VA 2FVLA 2ZBTA 5JH1A 1Z8AA 4EWND 2JIWA 3IUDA 4WSJA 4UR8A 5AHEA 3B0PA 3TTSA 3DESA 1SFTA 1O94A 3LTSA 3QSTA 3UT0A 3G24A 5XINA 1RK6A 3LHTA 3BPWA 3SAZA 4WOZA 3ES8A 2D23A 3P8IA 4AMAA 1NDZA 2NV9A 2VR2A 2FZ8A 1GVRA 5RUBA 3L2LA 4YVPA 1LRTA 5DX7A 3K1GA 1Z9AA 1MUCA 1Q6EA 2VR4A 2XN1A 3KL3A 3ITLA 4WSHA 2HISA 2J78A 2VM8A 2WKLA 4GBDA 5EMYA 1UR8A 3GC5A 2GQAA 2XYLA 3T9PA 4GRSA 2HNEA 2YZ5A</