3V0UA

Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
337
structure length
282
Chain Sequence
HMPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSNKQIYYRIEALSQKHGCTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVKLTKEDLKEISDAVPANTPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Perakine reductase
publication title Crystal structure of perakine reductase, founding member of a novel aldo-keto reductase (AKR) subfamily that undergoes unique conformational changes during NADPH binding.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Oxidoreductase
total genus 98
structure length 282
sequence length 337
ec nomenclature ec 1.1.1.317: Perakine reductase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v0uA00
3BCJA 4L1XA 1YE4A 4NKCA 4JQ4A 4RPQA 3GHUA 4Q7BA 3R7MA 1QWKA 2BGQA 2PDWA 3LD5A 3C3UA 2IPJA 2PD5A 2ACQA 5C7HA 2R24A 3O3RA 4XZHA 3UYIA 2FZ9A 1Z8AA 5LIYX 1QRQA 4FZIA 4H8NA 3D3FA 4OTKA 4YU1A 3H7RA 1AFSA 1MZRA 1ADSA 3GHTA 1M9HA 3UZYA 4L1WA 2IQ0A 2IPGA 3R6IA 4Q3MA 1LQAA 3N2TA 1X97A 1AZ1A 1YE6A 2PDLA 1J96A 3B3DA 4ZFCA 3V0UA 4R9OA 1JEZA 4JTRA 1Z89A 2VDGA 3T42A 3ERPA 2PDIA 4XZLX 1VP5A 2IKHA 5LIKX 4LAZA 1Q5MA 4GACA 4GQ0A 3WCZA 4GIEA 2HDJA 2INZA 3M4HA 3S3GA 3MB9A 1PWMA 3FX4A 2PD9A 3M64A 2HVOA 3UZWA 2FZDA 3KRBA 2PDMA 5LIUX 2F38A 4FALA 4JTQA 4WEVX 2FVLA 3GUGA 2FGBA 4DBWA 4DZ5A 3G5EA 3LZ3A 2PDQA 1R38A 2WZTA 2PDXA 3BV7A 3COTA 2R9RA 2FZBA 1HQTA 3N6QA 3U2CA 1HW6A 1MRQA 1LWIA 3GHRA 5LIWX 2PDPA 3UP8A 2BGSA 3LEPA 1S2CA 2C91A 4XAPA 1RY8A 4XZNX 2WZMA 1YNPA 3WBWA 5LIXX 3BUVA 1S1RA 1XJBA 3V0TA 1T41A 3Q67A 2HEJA 3ONCA 4XVEA 2HE8A 4JIRA 3FJNA 2IQDA 2IPFA 1XGDA 4GCAA 4EXAA 3VXGA 2BP1A 1YNQA 3GHSA 4F40A 2PDNA 4JTCA 1GVEA 1EF3A 4YS1A 4YVVA 3O0KA 3F7JA 2I16A 1PWLA 3LQLA 1K8CA 4WDWA 1A80A 2ACRA 3EB3A 1AH3A 2PDUA 1OG6A 3BURA 2IKJA 2ISFA 2PEVA 4JQ3A 4JIHA 2J8TA 2DUXA 2DUZA 4YVPA 3Q65A 3P2VA 4FAMA 2IS7A 2P5NA 2INEA 4WDUA 3R94A 4JQ2A 4WDTA 2ALRA 1ZQ5A 4XZMX 4JIIX 3RX3A 3UZZA 3LNMA 3UZXA 4IGSA 3LENA 3NTYA 1EXBA 3RX2A 2A79A 2PDBA 3V36A 1RALA 3EAUA 3H7UA 5KETA 2AGTA 1EKOA 4HBKA 3M0IA 2DV0A 3V0SA 4PUWA 4FA3A 1IHIA 5HNTA 4XO7A 4JTAA 2IKGA 3DN5A 4LBSA 4QX4A 3CASA 1RY0A 4PMJA 3LUTA 4H7CA 3LN3A 2PDKA 3R58A 2ACSA 4LB4A 3EB4A 3LZ5A 5HNUA 3MC5A 3ONBA 4DBUA 4HMNA 1VBJA 4PRTA 2CLPA 4XK2A 3R8HA 3WBXA 5M2FX 3CMFA 4JTDA 4WDXA 4GA8A 1C9WA 5AZ1A 4GQGA 3WBYA 3CAQA 4LB3A 2PFHA 2PDYA 5DANA 3CAVA 4XO6A 2IKIA 3UGRA 3LBOA 2FZ8A 4AUBA 1X96A 4MHBA 3R8GA 1FRBA 2QXWA 1ZGDA 2HV5A 3QKZA 4QBXA 2PDCA 3RX4A 4WRHA 2ACUA 1S2AA 5JH1A 2HE5A 4JQ1A 5HA7A 4PRRA 2PDFA 2PDHA 4LAUA 2HVNA 1XF0A 4XVDA 1US0A 1T40A 3UFYA 2NVDA 2IPWA 1IEIA 2I17A 2PDGA 1PYFA 3V35A 1Q13A 3CV6A 4GABA 2PZNA 4IJCA 3CV7A 3DOPA 3LQGA 2PF8A 1PZ0A 3G1RA 1UR3M 2NVCA 4I5XA 1ZUAX 1ZSXA 3WG6A 4IJRA 1SM9A 1AZ2A 4XZIA 4ASTA 4PR4A 1S1PA 4PUUA 3UG8A 4JQAA 1PZ1A 1Z3NA 3R43A 5AZ0A 1MI3A 1AH4A 4DBSA 4QR6A 1EL3A 4LBRA 4EXBA 4QXIA 4WGHA 2F2KA 5JH2A 1Z9AA 1X98A 4YVXA 3UWEA 1AH0A 3H4GA 2PDJA 4G5DA 4ICCX
chains in the Genus database with same CATH superfamily
3KRZA 1NFBA 2JBMA 4X0VA 4Q4MA 2WNZA 3NYDA 3WK0A 4JFTA 5IBXC 2Z1XA 4UOQA 5EBAA 4X0NA 4B2DA 5ECVA 3E0LA 2CBUA 5CZSA 1E55A 1U5VA 3DBNA 1I1XA 3LG3A 3TR9A 4FLRA 2NWRA 1R7AA 2J27A 3QH2A 1R8LA 5I0DA 1J18A 2GWGA 4U5IA 4TTUA 1BXCA 1OK4A 4ZGYA 4KEMA 3UT0A 1UC4A 5FL0A 4H9VA 4PULA 4J9JA 4L80A 2OEKA 3QYQA 4HCDA 1A5KC 3M0VA 3HB9A 4HA1A 2Q8ZA 3MMUA 3FKRA 5D2TA 4JTFA 1U5HA 4ZA0A 1XV8A 1ODZA 3KAOA 4X60A 1UUQA 1ZENA 3HMJG 4CNTA 2OWWA 4DF2A 3EMQA 2P8CA 1KXQA 3MU7A 1RK6A 3FA4A 1R3VA 4MZ1A 5AHEA 1EH9A 2OO6A 3R10A 4DVOA 3T42A 1DEDA 1M3UA 2B7PA 1VBHA 2NLIA 1Q7ZA 1RJQA 3B8DA 4EF8A 3BG3A 3GKAA 1BYCA 2DY3A 1QT1A 3QJAA 1OYAA 3PZTA 3TWAA 3V16A 3L68A 3MUIA 3XISA 2XSBA 1V0KA 4U31A 4X9SA 8CGTA 4BQ3A 1KRCC 3PUGA 3JR2A 3U48A 4DUXA 3VMNA 4R85A 3VIOA 4JGDA 3RRXA 4Q8UA 3P84A 1WYIA 4H9TA 5I3DA 3UCDA 4UFHA 1ECQA 1Q63A 1UZHA 4KGJA 2NXIA 2X05A 3LZ3A 1GOXA 3M47A 4J35A 4QS6A 1TUFA 2C1IA 5DEZA 3FJLA 4ENLA 2W0UA 5E0CA 5FL1A 3TYEA 2ZQ0A 3NZGA 2R9RA 1IF2A 4WJ8A 3IIPA 1MXGA 1QPOA 3ITYA 1XBXA 4JFWA 3L4XA 2X30A 2VP8A 4MKSA 4UMCA 3SRHA 3FOKA 3LM7A 1F73A 4XUYA 4XAPA 3PSWA 4M6VA 4O8AA 3SSZA 1UWAA 3EOUA 1GOIA 4Q4KA 4GFSA 1N8WA 5EY5A 1UBPC 1XUZA 3HV8A 2A3HA 4HMDA 3QY8A 4ZBCA 3KVKA 1WKFA 5IBXA 2PGEA 2V30A 4XKMA 4MZYA 3WLIA 1JQXA 2XVLA 1W54A 3ARVA 1LG1A 1TV4A 1UR9A 5K4XA 2Z1KA 4DJED 2YGYA 5DN1A 4QGCA 1R46A 1D3HA 4U10A 3VTRA 1XLHA 4PTMA 4AY1A 4F40A 4H2HA 3THAA 4DJFD 3PFMA 4I90A 5FAJA 4RW3A 1WDWA 4X3ZA 3UJ2A 3IACA 4JHZA 1EJXC 1SR0A 3IJ7A 4GNJA 1HGYA 1PXGA 3QF0A 4P2VA 5F4WA 1E1EA 1Q65A 3DFTA 3BURA 3VILA 1XSKA 1TIMA 4JIHA 1DXFA 3AU2A 2XU2A 2OJPA 1NF0A 3LCGA 4LV9A 4HPHA 1QHZA 1P7TB 1VFLA 5GJPA 2A21A 1YIXA 3KXQA 3G3MA 4UTWC 1QPKA 5B80A 3GG1A 3VYLA 4TVUA 1QBAA 3WQVA 4UFJA 3CBWA 3NTYA 3MSDA 4IISA 1FTXA 3HQNA 4I6VA 2ON3A 3OW1A 4NF7A 1KM6A 1YDYA 5F2MA 1R9YA 2Z29A 3RCNA 2H8ZA 4GCXA 1OIMA 4LVAA 3WDIA 3GD6A 1PL9A 3PPFA 4EP8C 1VIZA 4ZQPA 3KDNA 4GINA 4DX3A 3NQVA 1IIHA 4L1GA 4WZHA 3CTTA 1JXKA 3KZPA 3W1XA 5BNKA 3B03A 3IUDA 1TWDA 2PU1A 4P7LA 2YLLA 3G0UA 3TZNA 2WV8A 4HU4A 3UWWA 1SYTA 4WDXA 3WKZA 5AZ1A 1LWJA 4N6EA 4CQDA 1QI2A 1MW2A 3DYPA 5AVHA 4ML9A 2WANA 2PFHA 5FJTA 2Y88A 1KBKA 4DF0A 3CZLA 3MWAA 1WZLA 4OGZA 5FJPA 2YBTA 3HN3A 1KFCA 2BODX 4WRHA 3S5OA 3KTSA 3TFCA 2D1ZA 2VEKA 3U7VA 1T6MA 1OCQA 4MY1A 4QHRA 2E5BA 2FQIA 3MY9A 5C9XA 1CXEA 3FK4A 3QGVA 1BRLA 3KRSA 1EJVC 2F6XA 3GG7A 3MQTA 1XP3A 4MTVA 2XINA 1GZ1A 1YTEA 3SI9A 3W6MA 4LH8A 4CGTA 1PYFA 3WBEA 2V2DA 3FCPA 1OBAA 2R82A 1UP2A 1HN1A 3FLUA 5GPRA 1S2UA 3BZGA 1DJNA 2E9LA 1Q8JA 2C79A 3UYCA 4PRWA 2NVCA 6ENLA 4JTTA 5G2WA 1ZUAX 1ZSXA 1G7UA 4UTWA 4QLLA 1KM3A 1NDVA 4LJ3A 4IFKB 1LORA 4PMOA 1B4KA 3SZ8A 3HURA 5DELA 1OFQA 4YPJA 1IQ8A 1MI3A 4HNCA 3CHVA 4MAZA 1JNEA 2ZRUA 3Q37A 2CNCA 5LGXA 1H5YA 1XLGA 4JOMA 1EDQA 2WPBA 1R47A 2WSRA 1GYMA 3TN5A 3LV5A 3W2KA 2NUYA 2H9AA 2PDJA 4HSNA 1BVNP 4PEKA 3PK7A 5ABHA 5T8GA 1OD0A 4H9XA 4HPJA 1MNZA 3G22A 1EJSC 4MNLA 4Q7BA 3BG9A 3O2LA 7REQA 2PDWA 2C8NA 3TXVA 5M03A 3ARPA 1C93A 2WC4A 4NNCA 3BK0A 3K5XA 1XLJA 3KOYA 3N6HA 4NASA 4ORMA 1JDDA 1A5LC 3UWUA 3AXMA 3LCLA 5BZAA 2ZWZA 2X1RA 5HNRA 3WJXA 3BVJA 4NJKA 1D3GA 3TE9A 1P4CA 1W91A 4AF0B 1M01A 5T91A 5GJNA 2VFFA 1M9HA 3GHTA 1M53A 3KEHA 2QF7A 5TIMA 2IPGA 4LALA 4URIA 4S3DA 1TPH1 4HP5A 2G4JA 3B3DA 4IQLA 1O5RA 4J3XA 3MKVA 1VEOA 1UD2A 2Z0IA 3W82A 4A8RA 1E9LA 1ISZA 2A2IA 3WDQA 1W1VA 3TNOA 2QF8A 5C6MA 3TX9A 4QP0A 3ZLFA 4J2PA 4GACA 1OGBA 2EEXA 2VFHA 4UOJA 5DT7A 4GIEA 3UJFA 3AXKA 3WL1A 3AHTA 1V6XA 2FHCA 4YMZA 1VJZA 4YTTA 2CLKA 1LCOA 3PAJA 5IM51 3WQCA 4P7RA 1KBJA 1OZMA 2FVLA 1XPYA 3PNUA 4WY0B 1W3LA 4UTIA 1WBHA 2V3FA 1X6UA 3NVTA 3IARA 1PX8A 4XKYA 3E38A 4GUHA 5G4HC 3C0JA 1DJHA 3TN4A 4GYFA 4ZFMA 2J74A 2CLHA 3FY1A 1ADOA 2VMFA 3FAXA 4BCEA 4IIEA 4LV4A 4PA8A 2HE8A 4KCUA 3EPOA 3FJNA 3UPMA 3P5YA 2QCGA 3H22A 4ZE5A 1E6QM 3I3DA 4GVFA 4JY9A 3VOJA 4E3VA 3TQPA 3GFZA 4CN6A 4WXZA 1TREA 1WE5A 1D9EA 2ISVA 1MQQA 3SCPA 1JIBA 3MI6A 5CJ5A 2QZRA 4DYEA 2ZXBA 2QIIA 1GQKA 1DORA 2P1FA 1KBBA 2XH2A 4OVXA 3CUFA 3VIPA 1VFUA 4LUIA 3NQEA 4J40A 4GD0A 4OBRA 1TV2A 3B0XA 1TE6A 4MIMA 1JD9A 3CNYA 2QR6A 1N55A 3DI0A 3F7JA 3PWIA 4M80A 1SJBA 3QLDA 1TPVA 2ISDA 3GVWA 2CLMA 2CLLA 3LQLA 4MDPA 4NAFA 1FCQA 2IKJA 3LDVA 3EPMA 1OYCA 1CXLA 1DIKA 5KEZA 3UQNA 3GNDA 3OG2A 3HA1A 1E6NA 4NP7A 1G94A 1S46A 4QQUA 2ICSA 2WMJA 1EGVA 2YDAA 5E09A 6ALDA 3GTHA 4O1BA 4YYCA 1WOBA 3KL5A 4LNCA 3ZR4A 2ZICA 2PDBA 4A2SA 4LBUA 4JZ5A 3H7UA 4DJFC 5KETA 1EX5A 3BAJA 1VHNA 2WJZA 4OECA 1IEXA 4DRSA 3V0SA 2NUXA 3TTQA 1QMLA 2DT2A 4FA3A 4XO7A 4K39A 1L6WA 3TROA 5LHEA 4PSPA 3QC0A 2CZVA 3AZTA 3B9EA 3ME3A 3LMZA 4GUIA 3LUTA 2ZA1A 3SCRA 4CN4A 2IW0A 2DT1A 1M5WA 1NEYA 3U2EA 3UG4A 4K36A 2PTWA 1H7NA 5AC8A 3MJMA 4E5TA 3OB8A 4OU1A 5I6SA 3URQA 1SJAA 3OVQA 1B4EA 1WQ5A 2ZX7A 3IJDA 4S3EA 1G0CA 3KHDA 1JPHA 4JL1A 3WQOA 4Q7IA 3M9YA 3DHDA 2X2GA 1MW0A 4D6HA 3GXPA 1HT6A 3DZ1A 1WV2A 3MUAA 5HK4A 1TFVA 4W8AA 4QM1A 1XH2A 1TV8A 9CGTA 3K30A 5K2ZA 3VNIA 2GVYA 2RH9A 3GXNA 4JBRA 4IPPA 4Q4SA 2B0MA 1T40A 2HPIA 4GOAA 2DZTA 4DWSC 4CEXC 1PS9A 3QSRA 2X1TA 4WD0A 4I9JA 3NL5A 3BCDA 2E6YA 4TTGA 3SRKA 5LXEA 1JCLA 4QSFA 1AVAA 3P74A 1QNOA 3SCVA 4C6FA 1UASA 1E6PA 3WFAA 2OSYA 2ZZ3A 3BLPX 5GNXA 5A8PA 1X39A 2E5DA 1TELA 3ITVA 3WH9A 5K9DA 1A50A 1FBAA 3WQ8A 2BY3A 1YDOA 3M0XA 1OCBA 1T99A 1VR6A 4FF5A 4C90A 4DJEA 3GZAA 1OCNA 3KBMA 3UG8A 1PIFA 2VFDA 4ACYA 4DJFA 1BKHA 3RU6A 4JICA 4HVXA 2Y1HA 3S5NA 3MA8A 5AC7A 1AODA 4WGHA 3T6CA 4M56A 2Y89A 2QVNA 3H6OA 3PHAA 3CEPA 1JZ5A 2EG6A 1DQWA 1J93A 4FXFA 1FP8A 3S42A 4NJIA 1TR9A 3IPWA 2I14A 2WWCA 4HPXA 4EXQA 3JZEA 4Q6XA 2ZTKA 1TTPA 2QJJA 3BMWA 3LD5A 3LPOA 2D22A 2Z1SA 1VBGA 1FHLA 3H7VA 4A2RA 3E2RA 3G8EA 3JZUA 5A94A 3FKKA 1ZAHA 4B4HA 4OTKA 1FWNA 5EA9A 4ACZB 4JIEA 3EX4A 3GFYA 2PCEA 4GIRA 4CVUA 2BVDA 1MEIA 4AISA 1KM5A 4KEVA 3RPMA 3QHMA 3K13A 4PSRA 7ENLA 3T9PA 3UZYA 4ADTA 1RP8A 5I79A 3TYCA 3JW7A 4TX9A 3BAYA 4CCCA 1E72M 1M03A 1RLCL 3CK5A 1JNDA 2O9TA 2DIJA 2A5HA 2GZXA 2QQ6A 4HU0A 4GXMA 1TPC1 2YA1A 4Q8VA 4KIEA 1RBOB 3UG5A 3MYPA 1JF6A 3WNKA 2UY3A 1E3XA 1JUKA 4GE8A 4MB5A 1UP0A 3R11A 3A3HA 1A3HA 4KWWA 4NVTA 4Y9OA 1RHCA 3FYOA 5IHSA 4BJHA 3W7JA 4NZCA 1TPB1 5C71A 4QJ5B 1KTBA 2HROA 2PWEA 2PD9A 3M0YA 3BGGA 3GR4A 3PZIA 4E8DA 2UY4A 4ERIA 2TMDA 4FXRA 4WR3A 1GVQA 2YXXA 4ZQNA 1C8XA 2ZZ1A 4DZ5A 5IDZA 3MPGA 3W1LA 2DH2A 2UY5A 1XW8A 2BASA 3H8AA 3UWVA 1OGGA 3SO7A 2ZUUA 3W7DA 4ZO6A 1GW1A 2WJDA 1RP9A 1KXVA 1GOOA 2QUNA 1PJ9A 3L0GA 1LG2A 3RU8X 1TJ0A 3VIMA 1R3YA 5IRPA 3U6WA 3O1NA 2DDXA 3WMCA 3OLDA 3VC5A 2A85A 1F61A 3MVTA 1GORA 1BWVA 1DWIM 3GVQA 1RH9A 3RNDA 4KRTA 3IK4A 3WK1A 2FH6A 1XLLA 1UC5A 3EKGA 3CL6A 3UD6A 1DL3A 2FB2A 5J5DA 2OSXA 5LXXA 1EXPA 4XTIA 1SZFA 1EEXA 3WMSA 3HGOA 5CZJA 3LXCA 4C6LA 3UNDA 4HN4A 4R7JA 4CU7A 2DQWA 5LHFA 2GSEA 1Y5WA 1A4LA 2ZX6A 3IJ6A 1RJPA 4B5TA 1YW1A 2NZLA 4Z0JA 1BXNA 5E0FA 3I3BA 5CQ1A 1H62A 1UKSA 3C56A 1LBMA 1XLDA 2AQWA 3GIYA 3S46A 4CUCA 4IX0A 2C13A 2PWUA 3GK0A 2G3JA 4Q22A 4BY3A 4XZ9A 5EPDA 1C29A 2CETA 4GYPA 4M81A 3FDGA 3NM1A 5FJRA 4JCLA 1TUXA 2H8XA 4XD6A 4KRUA 4J2MA 3ZR6A 3ZR5A 4X61A 1NP0A 2VR4A 3ZM8A 2GSJA 1RAKA 4JX4A 1JZ4A 5D33A 3B0YA 4LUYA 1L6GA 2AMGA 1E51A 2INEA 2XSAA 3I10A 3W0KA 4GQBA 4O14A 5A6AA 4Q8PA 2ALRA 2BBFA 3T0DA 4IGSA 4J3TA 4PTXA 1TWWA 3WD3A 3DXIA 4HB7A 3WYZA 1EC9A 3UF9A 1S2VA 1SQ7A 1KO0A 3UXKA 3A5VA 3TC6A 3SRDA 4GFIA 8RUCA 5FIPA 5AC5A 1CXKA 4K8HA 3ZZ1A 2PWFA 1H7PA 1GOWA 5AOUA 4C91A 3IJLA 1V8EA 4RXGA 5HQLA 3E3HA 3CH0A 1KRAC 4EIVA 4DAIA 1OGSA 3S4TA 4NG3A 4HMNA 1NY1A 2GJNA 2PI6A 4H9YA 4H7VA 4O1AA 1UKTA 1QI3A 4LF1A 2WSPA 1C9WA 3MHGA 1RCXB 1GVYA 3WL0A 3CAQA 4XD5A 4DPPA 3L67A 2F7FA 1SZEA 3C0QA 3B9OA 2VUNA 2CKSA 1F7BA 3SRFA 2P53A 1HTIA 3SQLA 5JBFA 1D8CA 4O15A 2VZOA 5C55A 4QBXA 4LVDA 2YB1A 5HJLA 2F8QA 5K7JA 3PF3A 1X8FA 3FN9A 2WJFA 3C3NA 1UWIA 2EJ1A 4HN8A 3UXAA 4MB3A 2V5DA 4TO8A 1YPFA 3G1YA 1PDZA 2XGBA 1EQPA 3GW0A 1DKWA 3UFYA 1RBLA 2OPJA 5AHIA 1H4PA 4HYWA 3KVMA 2HTMA 2Y63A 2PDGA 4RZ6A 2QCLA 4W5ZA 3GZ3A 3CO4A 3VM5A 5F2LA 1M04A 4Z2LA 2R1NA 3ECQA 3VDHA 4IJCA 3E6EA 4AHQA 3H2FA 4IICA 5DF0A 1IZJA 2OOFA 4JHOA 4MWAB 3D47A 3PPCA 2FGZA 1B90A 4GVHA 3WLSA 4GLEA 1XLEA 4AZ6A 3SUVA 3O7UA 4O17A 5H8UA 2O9OA 1CECA 1HVQA 4RV8A 3LK6A 1NDYA 5BROA 1E15A 1HXJA 3L4YA 3LPGA 1EX1A 4H8UA 4PTNA 4EVZA 2YB4A 1WB0A 3SUWA 4LBRA 3WQGA 4FIQA 2PC8A 2PWVA 1GKRA 4EXBA 3W24A 1OC6A 1B31A 3UWEA 2ZTJA 2OGJA 4FMVA 5HMEA 1YX1A 1DV7A 2WVUA 2ANUA 2E67A 4UMAA 1KCKA 2CEQA 2B7QA 2QCNA 4K6AA 1O1ZA 3B0PA 1KC7A 1FWEC 3MZNA 4OZOA 1IR2A 5CC6A 1G7VA 4J28A 2FMNA 2CZDA 3AU6A 2ACQA 2ZX5A 3SGUA 4XZHA 1KFJA 3SN4A 4GKTA 2WOQA 1J6OA 4AWUA 3RLGA 1HFBA 4KEUA 5TNVA 1CTNA 2BY1A 1T5AA 4H41A 2ZXAA 1EJRC 1ME9A 3PSVA 1GOMA 2H6RA 2WC7A 1UB3A 1ADSA 2OLHA 3U7BA 2QUUA 1AJ0A 3WUGA 1DXEA 2JGYA 1IWBA 3LNPA 4XX6A 4D72A 2GUYA 2J78A 3NA8A 1KXHA 3OVRA 2Z2BA 3N14A 2YDSA 2YFOA 4FPSA 5BU6A 5DQPA 3T1GA 3DC0A 3SCOA 4UBPC 2FDMA 3IJ9A 1ONXA 3QLLA 4XD4A 3M46A 2Z1BA 3PJXA 2GQ8A 1I2RA 1GVRA 1GG0A 4S38A 3W7GA 2QW5A 2W67A 4XISA 2EPHA 4LUSA 3CS2A 1I0BA 4DWDA 2YCLB 5BXRA 3MMDA 4JS3A 3WNPA 4IZGA 3MB9A 5A6BD 1JYWA 4DYJA 3M64A 4UZSA 5I24A 2P3ZA 2OZTA 1RA0A 1ECEA 3ISIX 5L9FA 3K8LA 3STGA 1ME8A 3TYUA 1VD6A 4R53A 4US6A 4DJDA 4I3GA 4IFRA 2PGFA 1ZLPA 3BV7A 1AK5A 1WPCA 3U0HA 3QOMA 1MRQA 3EKLA 1BVWA 7CGTA 2CYGA 3GHRA 2WNQA 2NXHA 2QNEA 2QVHA 3ICJA 3APTA 3B8WA 3LEPA 4ZO7A 2D69A 1NFGA 1VGAA 1QCWA 4IL0A 1OCJA 1JI1A 4C1LA 4EAYA 4WUIA 1EO5A 2PUZA 3CYJA 1XJBA 1F2JA 1ISXA 2YL9A 1CXFA 1IE7C 3C2RA 4ZB5A 2IQDA 3L2MA 2GQ3A 1A4MA 1XCFA 1Q4WA 3TK7A 4LYPA 5T9BG 2H3BA 1QXLA 3BCFA 3TJ4A 1HVXA 3GW3A 2BB0A 3NQBA 3GYCA 2WYSA 3ALFA 3H26A 4CN1A 1MNSA 1M6JA 3KL0A 1LL4A 4ZXLA 1ITQA 3C0LA 4OOUA 4B5UA 3VINA 4ZSUA 4WGXA 3OYZA 4IQJA 2EKGA 2ZRWA 4O1FA 7A3HA 1ZBKA 3STFA 1JL8A 1J0JA 1TPWA 4JD4A 4G7EA 3WLQA 1ZJBA 3B8TA 3HM7A 1LT8A 4JEQA 3AMGA 1I60A 4ZTXA 2QJHA 3ABRA 5DRIA 2OKOA 2WCGA 1WDPA 3FGCB 4QNEA 3ARXA 1NOUA 1WZAA 2XWDA 5HR7A 1BPLB 1KCLA 3EA1A 1Q66A 1U1HA 1UWQA 3T40A 3E0FA 4E3TA 3N25A 4RE4A 4RPPA 5H8PA 2FVMA 3RX3A 4JIIX 5A6KA 1EOMA 1WCGA 4B9YA 4L4MA 4E2VA 3LU2A 5DXYA 2ISWA 2JKAA 1TA3B 1VYSX 1SZRA 3EAUA 3QY7A 1SFTA 2A1YA 3FYYA 1CXIA 2VFGA 3WEOA 3TP4A 1U2YA 5CKSA 1OFBA 4G7FA 4XWUA 1C90A 3SADA 2ZE0A 3HV9A 2OYKA 3CYVA 3DENA 1D7FA 2BXYA 1LYXA 3QOKA 4NZ3A 4UQCA 1Q6OA 3W74A 1LOSA 2DW6A 3MC5A 3NDZA 3CUHA 3VGGA 1VBJA 1ZBVA 1LDCA 4IMEA 1EUNA 5D2YA 1JCTA 4JTHA 1S5VA 5AC6A 1V6YA 3WEZA 1TVNA 1NH6A 1R86A 4W8LA 1RCOB 5HJYA 4DIAA 1Z41A 3Q4DA 3LHTA 5DANA 4PL1A 4NJGA 1JAEA 4L65A 1HL8A 5E6YA 3N2CA 3AYTA 4MB1A 1UWRA 4TV6A 2YCEA 1UD4A 1K9FA 2WXDM 4UFLA 3WUEA 1BD0A 1XF0A 2PRLA 3FNDA 4ICNA 5GNZA 4IX2A 4O1EA 3W7RA 1TV7A 4C65A 1JDFA 4Q33A 1C3FA 2DUAA 1PTGA 3R89A 3T4CA 4LPCA 2PTZA 1IEIA 1EA9C 1REQB 4YL2A 1FWWA 2F2HA 2QGHA 1DPMA 2ALDA 4C6QA 4AG0A 4U5KA 3PBUA 3O6YX 3W2UA 3CT2A 2C1GA 4KFNA 4B5XA 4GABA 2VR2A 3TA6A 4O0ZA 3GLCA 1TQXA 2I56A 3AWOA 3PBWA 3CUZA 1DWFM 3DERA 1UR3M 3OPSA 5ECUA 1NJJA 5LA2A 4I5XA 1EHNA 2PPGA 3VIFA 4ES4A 1K7EA 4XZIA 4QROA 2Z1WA 2A3LA 3GR7A 3W70A 3URBA 5EMUA 2J62A 4P8UA 3SGGA 3GXFA 4S2BA 3NSNA 3NDYA 5CPSA 5FD0A 3FDKA 4WKFA 3T08A 3VIJA 3EGJA 3T4WA 1F3EA 1TWSA 4IPLA 2CZ5A 4ADUA 4JN6A 3W6LA 3W6YA 5D9MA 1FWGC 4DM1A 4OE7A 4JFSA 1E0XA 2D2JA 1XFBA 3PTQA 4A05A 3ARSA 4EPBC 4N9EA 5I5RA 2R1MA 3RIKA 4JCMA 3W28A 4XBKA 4BWLC 1XUUA 3LTYA 4JQ4A 2XN0A 5FAGA 1NAL1 5T9CE 1OSEA 3OGSA 4AZBA 3SCQA 2FVKA 3MI2A 2PD5A 2I9EA 1O94A 4H6QA 3FEQA 4BF9A 2A4AA 4H8VA 3VIGA 4FOUA 5LNUA 3HQOA 3PZ9A 1QI0A 4K7VA 1PKYA 1J5SA 4ZOCA 3CEUA 1XKYA 1GQJA 4Y9NA 1VAHA 3TJIA 1JCJA 3NIYA 3STCA 4IHCA 4C6JA 3RGTA 2WO5A 3ZJKA 3BOLA 1JF5A 1X97A 1UKOA 2KAUC 4U2YA 3VD3A 4AZCB 4J3SA 1JDCA 1A47A 6REQA 3O06A 5D30A 2DZUA 1XS2A 2P8BA 2ASHA 2PDIA 4RV3A 3VOCA 3DFQA 4M51A 2G3MA 1WNOA 4XB3A 4WSHA 4GQ0A 4JEJA 4GHRA 5K9XA 3W83A 3HPZA 3CV1A 1BKSA 1IT0A 3MHUA 4IQEA 3CB8A 1AW1A 3TAKA 2YOCA 3UZWA 2ZBTA 5FJIA 3PBYA 3WEMA 4DO6A 5BXPA 3S9ZA 1XKJA 3FSUA 3M0ZA 3AHVA 1V3IA 4WEVX 3A9BA 3LTPA 1HGWA 2FGBA 3LCWA 2J75A 1VPQA 1FVPA 3L4ZA 4HPGA 2MNRA 1UROA 3AMKA 1H7WA 2L5HA 3U5YA 3WZ0E 1HW6A 1XIJA 1NOWA 1GJWA 2VWTA 1MXDA 2O0TA 3EWZA 4PMXA 1FWFC 4QSHA 3G1FA 5A6TC 1V0NA 1SPQA 1RBAA 3RMJA 4QCFA 2VD9A 2AQOA 3CTLA 4TV5A 2E7FA 2RJGA 1A53A 3AMCA 3RR1A 3APYA 3IGHX 1GPWA 3RM9A 4PMDA 2CWNA 3H54A 1FDZA 3F4DA 4PODA 2D2GA 2W79A 1VQTA 1JZ2A 1E5JA 4EXAA 2FLIA 4M6PA 3QQ1A 5HPCA 1VFHA 4PUNA 3WDHA 2J7GA 1Q6DA 1I75A 1YNQA 1YDNA 3R5EA 4HNTA 2QJGA 4O28A 3L0KA 4I8DA 1OX6A 2PDNA 1OWQA 3QTPA 4MJ4A 4PZVA 3GX9A 1RPKA 3HMCA 1IIGA 5HWMA 5I02A 1XI3A 1CI1A 2XFFA 3AIQA 4D8LA 3LMYA 3NZ1A 5HMFA 4CVWA 3TIMA 2TRSA 2V5LA 1QNQA 3AI0A 1F3WA 2WCAA 1HP4A 3HTWA 1W5MA 3UNTA 3CQKA 2AQVA 3N18A 3ZQ9A 3ID7A 5CAHA 2ISFA 4D8AA 3ANVA 3EBVA 2BHYA 5D9OA 4OKDA 1U1JA 3D6NA 3FW6A 4IGHA 4PMYA 4L5ZA 1DXIA 3CQ0A 3Q65A 2E1DA 3MANA 1E4NA 9XIAA 3WNLA 3SURA 3ALGA 3STEA 5C8BB 5F7UA 3WX7A 3R13A 4KCVA 1TPDA 5FOOA 3EOSA 1EXBA 2CBVA 4F2BA 3HGRA 5F1UA 4D6JA 1EPVA 5HATA 3LHZA 2B4GA 1J01A 5MF5A 1EO7A 2ZZ4A 3WJWA 1W3IA 1AW2A 1HJSA 2FJUB 2BGNE 1V6VA 3FXGA 1JR1A 1T7LA 3P3BA 4B92A 3MSGA 3CQHA 4UC5A 1GVSA 4ZMGA 4TQTA 4GC4A 3TMLA 1EP2A 2CC0A 4QX4A 3LB0A 3DEQA 1N7KA 4F0HA 4XZBA 3DYMA 3KS5A 4O10A 4BQ4A 3SIZA 3URNA 3MUCA 3F03K 1UA7A 4AX6A 3FYPA 1SU5A 1QR7A 4O1CA 3GXIA 4AY8A 4HYRA 4HZ6A 2HK1A 4HMEA 1XXXA 3E2VA 1P7TA 1TRIA 4LB3A 4PEEA 1XRTA 5A6BA 2IKIA 3C86A 2HRWA 3CPRA 4AHPA 1ZGDA 3K1GA 4YN5A 1DOSA 3OIXA 2RKXA 1W3NA 1NWSA 3EWXA 4LU0A 4D6DA 4MPKA 4PRRA 4M5PA 1PBGA 2GGHA 4CNUA 3UA3A 4AEEA 4LWWA 5C70A 1AD1A 3CHCA 3QW4B 4ZOBA 4NYUA 3SY5A 1OC7A 3DU0A 3GU2A 1HP5A 1HKVA 1MEHA 5BMXA 2QV4A 4Z08A 4WVXA 1GVIA 4LANA 3CV6A 3IEBA 4G1KA 3CV7A 2CXEA 4O1DA 5KZDA 4JTIA 1DWJM 4IQDA 3TOPA 4LRSA 2B7NA 3RM8A 3OZMA 3GXMA 4GI9A 4M29A 1GYLA 4M7SA 4LUJA 3P81A 5C9UA 2OX4A 2FPVA 1E56A 3VZYA 4D1JA 1UH3A 1NELA 4JQAA 3MBFA 2XG9A 1AH4A 1CLXA 1MO0A 4QR6A 3QMRA 2CZFA 3MO4A 2YW3A 1FUYA 3U2ZA 2OMAA 3H4GA 1K4HA 2F6UA 3EMCA 3ZJ8A 4OV4A 1YE4A 3BJSA 3DCPA 4DEFA 2RDTA 5AHNA 1GQIA 1NSJA 1PCKA 1CW2A 1LT7A 1NVMA 3FXYA 5TD4A 3C2VA 1BYBA 2BXZA 3C61A 1PO9A 5I06A 2QMJA 3ANUA 1UD6A 2RDXA 3BW4A 4IFKA 1AFSA 2V38A 2JQXA 3W87A 3J7HA 4HHHA 5I3FA 3LRLA 1A5AA 4AQLA 1CGXA 3CL7A 4LCQA 2NT1A 4N02A 1RVKA 3LS9A 1O60A 3L5LA 3KUMA 4RDWA 2XTKA 4XAGA 2GL5A 4BEUA 3RF9A 4O50A 1GT8A 3VOHA 1PSCA 3ERPA 3WNMA 2DFAA 1L9WA 3IAPA 4PCTA 5LIKX 4LAZA 1YBQB 1TPEA 5TAOA 4J4KA 4UZUA 3REQA 2MANA 3QPEA 2V5JA 1ZJIA 2GVGA 4PB5A 3M4HA 1E73M 5C2XA 3AWNA 2DZBA 3K46A 4FLSA 2FH8A 3WLMA 4NSBA 3E9AA 9RUBA 2FTYA 4DZAA 3IV3A 3ARTA 3SUTA 6CGTA 4JDYA 2CHOA 4HA3A 4QG6A 4JFVA 4AF0A 1RJRA 1J0KA 2DSZA 2VRKA 2WHJA 3LX9A 4KWOA 1XHGA 2FZBA 1ME7A 1KR1A 3B8UA 2G5WA 1K7FA 4YTSA 4V1XA 3NEVA 3SQSA 1N8IA 1XL9A 6XIMA 5K3VA 1QHPA 3LRKA 1QOQA 2XDFA 2VKZG 3G3DA 3SY8A 3ARYA 3QTGA 2NQLA 3NOYA 1YDVA 1S2CA 5C7VA 5JMUA 4UTMA 2RHGA 4J27A 4B3ZA 4HKPA 3GWQA 5CJNA 1V3JA 2YKKA 2X41A 4TU1A 4GUJA 3HU7A 1QK0A 3A3WA 1J12A 3DG7A 1Q7QA 3N2OA 2G37A 3BZJA 1EIXA 1AQHA 3S1WA 1O6IA 2VC6A 4PC8A 1RR2A 3PZMA 4WY0A 1ZPTA 4TR9A 2BVYA 5I23A 3EA3A 4HA0A 4I6KA 4Q4PA 1PHQA 4IIBA 1J79A 4NRRA 4PMNA 2EAWA 3VDAA 5AY7A 1MW3A 4DI9A 4N6FA 2VCBA 3EB3A 4Z1AA 1K03A 3KS6A 1EGMA 3MSYA 2QDGA 1DIEA 1QHOA 4UCGA 6XIAA 2GQ9A 1KW1A 1BWKA 2AL2A 1GOKA 4CD8A 3HPXA 4R9XA 1ZP4A 1KRBC 2V68A 4FAMA 3GS6A 4MWAD 4IOTA 4WDUA 3NOEA 2HXUA 4JHMA 2XFWA 3VE7A 3ARUA 4RW5A 2WJEA 3OLEA 2B31A 3PY2A 3WJZA 1SO3A 4WLCA 5FA5A 2EF9A 1EA0A 2X1IA 1BF6A 3NEHA 3W02A 4ORIA 2HSAA 1OT1A 1OB0A 1W6TA 2BOGX 2VEMA 3GTIA 1Q45A 3TQKA 3LHWA 3TTEA 2J88A 3F4WA 2CXGA 3BAXA 1RY0A 4ALDA 5AHLA 1XBVA 5E1QA 4PMJA 1W9DM 1Q3NA 5A3HA 2NSXA 3GAKA 2WMFA 2J79A 3A4AA 3EB4A 1JZ3A 4GH1A 4L6OA 1KCZA 2Z2AA 1JI2A 1LJYA 5KSWA 1XRFA 4GA8A 3K4WA 4GQGA 4LF2A 5HPOA 4AIEA 1HIZA 4LY4A 4KRZA 2J24A 2C16A 2W9MA 4RZ4A 1V0MA 4PUDA 2AKMA 4MAVA 4PMRA 4PMVA 4FR6A 8XIMA 4W89A 5BOOA 3B05A 3OEXA 1KM1A 1KTCA 2WQPA 3N4AA 1G67A 3W23A 1TX2A 2EGZA 3L5MA 1HZYA 4F48A 4LT9A 2QCEA 4O8RA 1AQ0A 1YADA 3TTSA 3MZ2A 2EJAA 3N1AA 2EG7A 3AZSA 5D8WA 5CSYA 4CCZA 1ZAJA 2FHBA 1VKFA 4O13A 3T2QA 1DJXA 2YX0A 1ZHAA 3W1TA 1O5QA 1E9ZB 3VZXA 1UR4A 1H63A 4FI4A 5IDIA 1MDLA 2WBKA 4B5WA 4AMAA 1TJ1A 3T2PA 2V5CA 5B7YA 3W37A 4RK8A 1FHVA 5H8MA 1Q4NX 2PF8A 3HFTA 1TSIA 1WDQA 1PZ0A 2G0WA 4OV9A 5LKYA 1TVPA 3GNXA 2D0HA 1EJWC 4IF2A 3CU2A 4MFDA 3SB0A 1JRCA 1SM9A 4TVDA 1QO5A 1B0IA 1E4MM 1XICA 2J4GA 7TIMA 4MYAA 2OEJA 1VS1A 2XGIA 4RJEA 1H2JA 4IIDA 2XM2A 2CIPA 4GIYA 4DM2A 3NXFA 1X1OA 2D2OA 1SGJA 5H6HA 2B81A 4HJWA 2OXNA 4IP7A 3PBMA 1TTIA 2J13A 4ZL1A 2Y7GA 4RZ5A 3TV8A 2BSLA 2FIQA 2NV2A 1PPIA 3T09A 3WF2A 3V7PA 4H4IA 4NZFA 4E8GA 1XYLA 3VK5A 2VM8A 3LGEA 2V63A 5HAOA 4F0KA 3MP3A 5EMKA 4RNIA 3S2LA 1R2SA 5AYZA 3O6CA 4B4FA 4DUVA 2PE4A 1T0OA 1GKQA 3MW7A 1GVOA 3RFAA 3CUIA 3URAA 1OF6A 3UW6A 4L4OA 3VUPA 5J8LA 3W7MA 2V69A 4B5VA 5BWFA 3UWZA 5CJMA 4EF9A 3V5CA 1C8QA 5LIYX 2WMKA 1E70M 1J2BA 1H50A 4F3HA 1FP9A 1MXSA 2VTFA 4N9CA 1BXBA 1PIGA 4HNVA 3U4AA 1XIEA 3PG8A 1F4HA 5DBTA 3PC0A 2ZRXA 1VFOA 3TN3A 2J8GA 5A6SA 3N2TA 2OU4A 4L9XA 3USBA 1OF8A 3SAZA 8A3HA 4JX5A 4H8HA 3VKJA 4J3WA 4IWWA 4XUGA 1W9BM 1GONA 5FJJA 3FSTA 2WMHA 3LPFA 4GZJA 2ZX8A 4PBEA 1DTUA 3WLTA 4YJ5A 3L2LA 4CNSA 3DC8A 4MNKA 4NY2A 1QVBA 1AL8A 3L12A 4BZYA 4AD4A 4AEFA 4MPQA 3TMQA 4J3VA 2VYOA 4KMQA 2O9RA 5XINA 1L2UA 2BOEX 2XVPA 4F0LA 1US3A 4I5RA 2VZSA 4ACZA 5AHFA 5I00A 2HMCA 3N4EA 1R38A 4YCPA 1OG0A 4IP4A 3H55A 1FY6A 4O4WA 4PTVA 2BLEA 3QV9A 3DUGA 1NFPA 1KQYA 3N4FA 4FLQA 3TZFA 4UNLA 1J0YA 1LOLA 2QPUA 2Z7GA 1RY8A 2FMOA 3F5JA 3UXIA 4X2PA 4WQ6A 1YTDA 3ZVIA 1QOPA 1GEQA 1PTAA 4IUOA 1ODUA 3MMTA 3CWOX 1BF2A 4K8GA 1XGDA 5D9PA 3CPUA 1ML1A 3VXGA 4HHMA 3IVSA 1WX0A 3RCMA 4NJHA 4WK9A 2W62A 3GHSA 2BVTA 2FPYA 2JKPA 1GOQA 2GJRA 4N7QA 4PCNA 1TPUA 4YS1A 4YVVA 5D02A 1G01A 3CMJA 4H6RA 5GVJA 2VFIA 4AWEA 3G24A 4L7ZA 2ZUMA 3NDOA 3OGVA 1UQYA 1XSJA 3HZ3A 3NG3A 3B0VC 3O05A 1FWIC 1X7IA 1XQKA 2WHMA 2A7RA 2WVVB 4FIRA 5CGQA 3TYBA 4JQ3A 2OGYA 2P10A 3K4AA 5XIMA 2DUXA 1FHDA 1YNYA 1KNWA 4YVPA 4QE5A 2AKZA 3W1QA 4NI3A 1KTNA 1DWGM 3W2MA 1BG9A 4A3QA 3DG6A 3T0TA 2DVTA 3M5VA 3BARA 5FESA 4EPKA 2VRJA 3A4JA 2XH4A 4F4RA 3RLVA 5AN7A 1E4LA 3S6TA 4L4LA 1OEPA 5DMMA 3CZEA 2X40A 2Y62A 1C8VA 1EBHA 1EKOA 3WQPA 4A3HA 3AIBA 5K9CA 3M0IA 5I3KA 1PE1A 4LUTB 1I8JA 2Z28A 2WZIA 1CB2A 4LYQA 3ZIZA 1VHCA 4RNFA 5BXTA 4LY8A 1V6UA 4RR4A 4HK5A 2EG8A 4JTGA 3FA3A 3QRHA 4NRSA 4RE2A 4KBXA 2BY0A 2EPLX 3N73A 2XH7A 1XRSA 3NPXA 4YHGA 3AXIA 3U5UA 1TVLA 3LZ5A 4H2CA 4XZWA 1AJZA 1XYMA 3SSJA 1HKIA 4RZBA 6PTDA 3O16A 1K1DA 4RXFA 2VDIA 4GQQA 3KFTA 4PB3A 4WKAA 2WCSA 2C1HA 1FWAC 1TJPA 1CZ1A 3LGGA 3UU0A 3WQ4A 3SCTA 2OYLA 3CZKA 1QUMA 3FFSA 1B3ZA 4Q32A 3PN8A 2ZE3A 3WIJA 3ZS4A 3P7YA 3RX4A 5I09A 4AVNA 1OFDA 3GM8A 4NZ4A 3WUBA 3UR7A 1Y8BA 1XYAA 4LAUA 2D3LA 3ES8A 3MMWA 2R14A 4JYFA 3NWRA 3TKFA 4LYKA 5FI8A 1TCMA 1E0UA 3FIGA 2AMXA 4OIFA 1OYBA 3HO8A 1FKXA 1S5NA 3AYRA 5EMMA 3WLHA 5D8ZA 3PNZA 1W31A 4NXKA 1S5TA 2HXTA 3PTKA 1P6BA 1EJTC 3G1RA 3RR4A 1PYMA 3W07A 1V4YA 2VVNA 3LYEA 3PVFA 4R3UA 5A95A 1XC4A 4OBTA 1HO1A 4GY7A 3QR3A 4GY1A 3SY1A 1Q6FA 4H7ZA 1JGMA 4S2CA 3W1NA 4FF7A 4RNHA 3SUSA 1E6XM 3A23A 3P14A 3C2OA 4ERAA 3WK3A 4CCEA 2WPGA 2CESA 1Y0EA 1AH0A 2BTMA 1JULA 1LL7A 4S1FA 3WBAA 2VZUA 4HNNA 5E9AA 4DUOA 1JZ7A 4G5DA 2Z2UA 4EK7A 3PUOA 2IXUA 1E6SM 1H7OA 1TV3A 4EWJA 5EL1A 1UR2A 3CPGA 4X63A 3TTYA 1KFLA 1RCQA 3NPWA 1W5PA 3I7RA 5I3GA 5C7HA 3BJFA 5ABFB 4ZO8A 4MWAA 5PTDA 4DPQA 2OVLA 3PFRA 2HPMA 1XLBA 3SM0A 3W2JA 3H7RA 4H04A 4F66A 1AUSL 5HUPA 1NM9A 3H2CA 4P8WA 5HUOA 2G50A 3R6IA 1NWUA 5HDRA 3IGXA 1FX6A 4PMQA 2GDVA 3K2GA 5DCDA 2PDLA 2JGQA 4HHLA 2V5KA 4D8ZA 3BAKA 4HD5A 3V0UA 3QM3A 3E1F1 3L23A 3GG8A 1I6NA 4XIMA 1WUFA 2XYLA 2VOTA 4IMCA 1EEPA 2UV8G 4OBSA 2BHZA 3CWNA 5CH9A 1PX4A 3VU2A 2JF7A 4JN7A 5G2IA 3BSMA 3BQ5A 4BA0A 5HULA 3UERA 3FJ4A 4FNQA 1CT5A 3VX0A 1GK8A 3S2JA 2PSNA 4DAFA 4GNKB 1IXPA 4BI5A 1TX0A 3IANA 3WMBA 2OG9A 1EJUC 4MFEA 3NZQA 2NXGA 3G8RA 3L4TA 4DWSB 3KCJA 1FFQA 3T07A 4FLOA 3WDJA 2PDPA 4KCTA 4S3GA 1E6RA 2OFJA 4NAEB 4U2ZA 1UMYA 2OKTA 2G8ZA 4OFCA 1S2TA 4W7WA 3VI2A 4LCSA 1M7JA 4BEQA 3QZAA 4HT3A 4W87A 2J7FA 3M0HA 1L8PA 1LQ2A 2GJXB 2HCVA 4HPNA 3SDOA 2YCLA 3P67A 5KZMA 1UWTA 2GVLA 2PP3A 4UTTC 3QGAC 3E5BA 1OADA 2UZ9A 2VQUA 4PYSA 3R0UA 3PBGA 4A3RA 4WJEA 1YQ2A 1DJWA 2ZC8A 5LNSA 4P5UA 1TCDA 1BGAA 3R0DA 4ROQA 3LLXA 4JIQA 3TFXA 1A0EA 1GVEA 1KFEA 3VCCA 5HQEA 2XIOA 3H23A 2G3FA 1YRRA 3CM4A 4FNUA 1A80A 3HPAA 4LYRA 2EKCA 1VENA 3ZYZA 1F3TA 2QT3A 2R91A 3BMVA 2PBOA 3BV4A 4CLMA 2PEVA 3N15A 3HGSA 2J8TA 3U3HA 4N9DA 3UGVA 1F6PA 4PTWA 2PLJA 1G4SA 2XN2A 4GI4A 1SMAA 4I7VA 3NL3A 3P2VA 3B9AA 1FWJC 4FNSA 2WM0A 4FO4A 3NM3A 2QDDA 4HSOA 5CPLA 1NTHA 2A79A 3RPTA 4I9AA 2C7FA 4REQB 3LGDA 3L4WA 4AVFA 2C19A 3N2XA 3ZFHA 4NZJA 4EWND 3CUXA 1YEYA 4D2JA 3SGZA 4QE1A 3G18A 2PCQA 3DG3A 2ZUSA 2IKGA 3PWGA 2Y8KA 2V3GA 3F2DA 2AL1A 1NDWA 1S38A 3NVDA 3VNLA 2QEZA 4UFIA 1R85A 1GKPA 4ZXOA 2OELA 5B7ZA 7ODCA 1UBSA 2UWFA 3ZLHA 4A4AA 3OHIA 3O0FA 1Z7AA 2YXOA 4R34A 3FGCA 4W86A 3LTSA 4B16A 3UJSA 4CD4A 3ITXA 3REQB 4RDYA 4KEZA 5JXQA 5H91A 1KV5A 4GGBA 3CAVA 2CW6A 2ESCA 5DBUA 4B91A 1I9CB 4UTTA 2DEPA 1ZU8A 1WDRA 4MNMA 3L66A 3SIMA 1I2PA 1CIUA 1TA3A 4HU3A 2E28A 3WLKX 5EGRA 1NDZA 2WVTA 1F6KA 3BLEA 4UMBA 2HVNA 1R6WA 2FDSA 3AQUA 3QZ6A 3OVPA 1HKWA 3NJ3A 4F9DA 4TMBA 2OWXA 3BANA 1H09A 3TH6A 3TW6A 1YMYA 2IPWA 4BF5A 3QV6A 1KQZA 4RCXA 3CV2A 1O68A 2BFGA 5REQB 4C7GA 1QWGA 4D6CA 1XYFA 4MYXA 4O11A 1J6PA 4DXKA 2ATSA 1V6TA 3UCQA 2DIKA 3MYOA 3VNJA 4YWSA 1TYGA 1ENUA 3S1UA 3LQGA 1G5AA 3P0WA 3TYAA 3CHEA 3AHZA 3QBUA 2REQB 3QEZA 3B40A 3CZJA 2A3EA 5CSSA 3WG6A 2GJPA 3AHXA 4W9TA 4GY0A 4LOCA 3S6OA 4FHAA 4AD5A 2ZRVA 3A3XA 5AYIA 4JIPA 3NQ8A 1JUBA 2H3DA 1DE6A 2D0FA 4O19A 3WELA 3N6JA 1I2NA 4Q4RA 2NQHA 5FCZA 4QDMA 1Y65A 5JBDA 3LLDA 1I0DA 4BI7A 4RNJA 2QUMA 5K4ZA 1REQA 1BLIA 3AOFA 1J0HA 2CPUA 4B3LA 2DZPA 4AVOA 2OZ8A 3CUJA 4XBSA 2GVEA 3W2NA 4W85A 2AL2B 2WZHA 4PN2A 3VDGA 2V67A 2YFNA 4BFAA 3L5AA 3MVIA 4QCEA 1Y5XA 4NZ1A 2QCCA 1TKKA 3B97A 4XQ6A 2JEQA 3ORWA 4ERGA 3NYZA 3STPA 1UIPA 4CCDA 2NSOA 3KTCA 4YNGA 1MW1A 2UBPC 3UR5A 2FKPA 3IJIA 1MWOA 3EEGA 5EYWA 2VR5A 1H0IA 3W76A 2X42A 3RM4A 3W25A 3LY0A 3RITA 1SFSA 2E25A 2IQ0A 5A69A 1JPDX 4Q3MA 5TQLA 4GBUA 4WJXA 5BOFA 4C6EA 3HG5A 3RAOA 4PFMA 2FHFA 4GZ7A 2VDGA 3MDWA 1SFLA 1TTJA 4UQEA 4H1ZA 3BH4A 3UR2A 2QCDB 1UQZA 3MP5A 2VEGA 4S39A 2P88A 3O63A 3C8NA 4GX9A 3DIPA 3LBMA 3EDEA 3VE9A 3VNZA 3VD5A 1OINA 2PB1A 4AYSA 4IIHA 4RE0A 1JYVA 2J66A 5FF3A 5LNWA 1IT7A 2HVOA 1K77A 2O4QA 3SN1A 3C2YA 2D23A 2I5GA 6TIMA 1VF8A 4DJEC 2HJPA 3V3WA 4LEQA 3GYEA 4TUFA 3T7VA 2Z1VA 3L21A 5CXPA 4EX4A 1K3UA 3GIPA 4J3UA 1W9UA 3COTA 4O4VA 1ITXA 2V2CA 3QXBA 1JDAA 4ZQOA 2G96A 1D8WA 3S2NA 4AZCA 4RDZA 3GNPA 3HIJA 3UPWA 2YIHA 4OUIA 1KWKA 3A21A 4MZ8A 4GG9A 2NQZA 4PCFA 1BTMA 3WBWA 1LQ0A 4FR1A 3WD2A 1KFWA 4YXGA 2Z6IA 3TYZA 4DBDA 3BL3A 3ONCA 3THDA 1L2QA 2XSXA 2R6OA 1IEWA 3ARZA 3GDMA 5L6UA 3TW7A 2WLZA 4AD2A 3WD0A 4WIWA 3VCNA 3AJXA 4KKXA 4ATWA 2DW7A 5BOEA 4UQAA 3NO3A 3U8GA 1TB3A 1SZNA 4PUMA 1RQHA 3S47A 4DJDD 4FOKA 4UFMA 3FA5A 1C92A 5LA0A 3EWUA 3GTFA 1AW5A 3WLOA 1FDYA 3LI0A 3GB6A 4R7OA 3B8IA 1PWLA 1V08A 2Y70A 1MUWA 1OIFA 1E43A 1LOQA 2QUTA 1DP0A 4HGXA 3ZSTA 3ABQA 5FEXA 1R3QA 3WH5A 1V77A 4O0QA 3P62A 3BE7A 1QTWA 1LBLA 1ADDA 3TVAA 3L9CA 4FX8A 3EZ4A 1BGGA 4EKJA 3BLKA 1SSGA 2GGGA 4QE4A 1TO3A 2P5NA 4P7OA 2FFCA 1BQCA 3D3AA 3BW2A 3TR2A 3LNMA 3L2IA 3T05A 3PZVA 3EX3A 3NQAA 3VMOA 3TN6A 5J04A 1Q7MA 1G4EA 4DXVA 4Q8QA 2AGTA 2X2YA 2E1WA 2EQDA 1CGVA 3P93A 2PMQA 4PUWA 1V3KA 2QS8A 5HNTA 2DJXA 3KVJA 1KM0A 1XINA 1CENA 4LQ1A 4IGNA 2TSYA 1C8YA 4LBSA 3GBDA 2DIEA 4GO9A 3FAWA 4C5YA 4H3DA 4XV0A 3G0XA 2PDKA 1EIBA 2OLAA 4LC8A 1OFAA 4C6OA 1XYZA 3H2MA 4AD3A 4L4PA 3CH9A 3TC7A 4IPJA 4DBEA 4XK2A 1FOBA 1LRTA 3PG9A 3SQMA 5BW6A 1NARA 4J5NA 5F2IA 2Z24A 3KM8A 3SJNA 4GXPA 4E0CA 1P1MA 1OFOA 4AZGA 4QG8A 2ZZ6A 4PE8A 2PDCA 1V7AA 1P0DA 5I3JA 5JH1A 2HE5A 3NQGA 4GISA 3QMTA 1K8XA 3BC9A 2A3AA 4LSBA 1TMHA 3TJXA 4IPIA 2Z7KA 2QDEA 4BF7A 4K1GA 1XLKA 4FX6M 2VRQA 1GNXA 4L64A 2WC3A 2ZUVA 1F9CA 1TRDA 2BXVA 3CJPA 5EMJA 4GYPC 2C0AA 4CEUC 3SCUA 3B9NA 3ARRA 2ZVIA 4M3PA 3LBCA 1TMQA 1M1BA 4H6EA 3PR2A 3I7SA 2XFRA 1EWEA 3EA2A 3C2FA 4DLMA 3DI1A 3TSMA 2Y8VA 1VC4A 4QG9A 1KKRA 1GPFA 2ZOXA 3IGSA 1UD5A 1CYGA 1XD1A 3B8SA 1NOFA 3TSBA 1HX0A 3KP0A 1SO4A 3AIVA 2Z25A 4F0RA 5CSUA 2WLYA 2I5IA 4X9YA 2V3EA 1J10A 4AHOA 2CCRA 3M16A 3OGRA 3THCA 4BQ2A 4AIBA 4LTSA 3M0JA 4YCOA 1FH7A 5LZLA 3E0WA 1LRQA 2PA6A 1V3MA 5CC3A 1QPRA 5C0QA 4Z1DA 3NZPA 5TBOA 1ZL1A 3RO6A 2A3BA 4OQVA 2ZXQA 4JDBA 4C6KA 4OHQA 3TLQA 2J6VA 5I3IA 4I5UA 2E6DA 1W1PA 1V0LA 4I7UA 4NJJA 2TAAA 1U22A 3KZSA 4GQRA 3DFPA 3PZQA 2FTPA 2VURA 1VH7A 4JTEA 5A8GA 1SO5A 1TJ2A 1QRQA 4MWAE 4YWIA 3WH6A 1F76A 3AIRA 4JNMA 4AY7A 3BLOA 4JYDA 3GDBA 3P61A 2VEFA 4L61A 3NGJA 4MB4A 2ZDSA 2O92A 3KBSA 3LLFA 3Q58A 4MADA 1R9XA 4JTJA 4V27A 3T81A 1VJIA 4ZEPA 1HL2A 2DQXA 1V02A 1Z89A 2JFEX 2HBXA 3B4YA 4AU0A 3KWXA 1XDJA 2EPKX 2ZUTA 2GK1B 3AXXA 2QAFA 2AAAA 3UVIA 1UZ1A 1DJYA 1GUVA 3SCWA 2Y0FA 2Z00A 3EXSA 2ISSA 4UCFA 5DMYA 5G4WA 3AHYA 2O9PA 2XM1A 4K2SA 2INZA 5F4XA 2TODA 2CLIA 5CZTA 2BS9A 3ITTA 3DGBA 1F07A 1ITCA 4KGLA 5GQBA 4FALA 4JTQA 1R87A 3GUGA 4DBWA 4S3KA 2E8YA 3VNMA 4Y6GA 1YTKA 4JTUA 2WMIB 4PBGA 4Y9AA 2YZRA 3N6QA 5I77A 1LWIA 4S3AA 4W88A 3CQJA 3KBJA 3PB2A 3AMDA 5E0KA 1CBGA 1ZJHA 2WZMA 4KFOA 1BSIA 1XCWA 4HSHA 3UETA 3ZVHA 1ZZMA 3QGKC 2OR2A 2PAJA 4MSSA 1YBQA 3E0IA 3Q67A 1HJVA 4ZSTA 4XVEA 2E9MA 2IPFA 2QCMA 1J8VA 4PTDA 3WENA 2ZZ2A 1AQFA 2C6QA 2PZ0A 3VX1A 2BP1A 1QW8A 2BVWA 3OP2A 1W1YA 3W7LA 4PBFA 3VIIA 4I9TA 2J7CA 4ZQMA 3W1PA 4BKNA 2YZ5A 1DIDA 3VOGA 3T55A 1KV8A 3WUFA 3NQ2A 5XIAA 1K6AA 3BO9A 4A29A 3WY1A 2TPSA 3OQEA 1KXTA 4GO8A 3S1VA 5DLCA 3WQWA 5I07A 3AYVA 3M0KA 3LI1A 3INPA 3HPFA 4GVGA 3OA5A 1XCXA 1PAMA 2PODA 3NXLA 2QJMA 3BLDA 1OT2A 3MKKA 1W1IE 3USZA 4DUWA 1E71M 1DQXA 1NQKA 2RDWA 1IEVA 3CC1A 1VCVA 4G9PA 3P60A 2Y8UA 3WF4A 4HK7A 1YXYA 3VVGA 2IS7A 1BG4A 4Y90A 3WF1A 2ZXDA 4WDTA 2XVNA 5D09A 1RD6A 4FS9A 2VWSA 4UIOA 1MUMA 2XHYA 3LENA 3UBPC 1WAUA 2QHAA 1OHLA 1S3TC 1TQJA 5CLWA 4DF1A 2I57A 4YTUA 4WXYA 5LA1A 1FQ0A 3OIHA 4DJDC 2LLEA 4MLRA 4GYKA 2YL8A 3GC2A 2VDHA 3MS8A 4GZIA 3O07A 2EO7A 2R1LA 3UJEA 3WQ6A 1E1CB 5DT5A 5LYRA 5ABTA 1Q6CA 4MG4A 2E77A 4XTDA 1J9YA 1AL7A 1JXJA 2HNEA 2YCIX 4C1KA 2C0HA 3PWAA 3NQ7A 2XH0A 4UTLA 1ZTVA 5M2FX 1CGUA 4HQVA 2D20A 2PWDA 3W75A 2ODOA 2X1UA 3C0SA 3GXDA 5TF0A 4A6GA 3DYOA 2PC4A 1ZP3A 3R79A 4YTQA 3W88A 1L6YA 1E1FA 3S8HA 2F6KA 1PX3A 1U5JA 3OLGA 5DXXA 3GH5A 4JQ1A 2PDHA 5A6MA 3S9YA 4KW2A 3MTWA 4XVDA 1OJXA 4YIWA 1UHVA 2ZYFA 1FWDC 1K4GA 1ICQA 1EDGA 2BOFX 3W7PA 1US0A 1B5TA 4NXSA 1IZCA 4IG2B 4M7TA 1KGUA 2HK0A 3W1MA 1GEHA 2QKFA 2CU0A 1FFRA 4NIRA 1HJUA 2JK2A 5D9NA 3W7NA 4PMUA 3GKFA 3EOOA 4IXXA 4V28A 3CLWA 4FNTA 4RUBA 3WJYA 2VENA 4NX5A 5LNRA 3THQA 1E9IA 2D73A 2ADAA 4E38A 1AQMA 2NV1A 3HQPA 4O54A 2ZRZA 2R1PA 5G1TA 1S5WA 3AISA 4XD3A 1PKNA 3CZGA 7TAAA 2WNNA 3WLJA 5CAKA 1Z3NA 1FH8A 4Y2WA 3P80A 3IUIA 2V5BA 2OOGA 3TDFA 3ATZA 4QXIA 4I7WA 3KW3A 4DWSD 4YVXA 4F0MA 1LLZA 4IGMA 2GQAA 2GVJA 4V15A 4HJFA 4QEHA 3TJLA 2V0TA 3DFYA 3I4KA 3BDKA 3WQEA 4ICCX 3TAOA 3LV6A 3M7SA 3W3OA 3NQDA 1CB7B 1RK5A 5HOSA 2QJNA 1B3YA 4FNPA 3R7MA 1DE5A 1XLCA 5ABGA 4YYFA 1ONWA 2OO0A 3BGAA 1KR0A 2EPMX 3ATYA 3LHYA 1G4TA 1GW9A 3O3RA 4Z2HA 3UYIA 1MQRA 1SZGA 1DWAM 2YYUA 5AB3A 4MKVA 3H2NA 3DHPA 4QDWA 5KZ6A 1O95A 1TPFA 3KLLA 2IUZA 1BQGA 1OX4B 1Z48A 1A5OC 3GVVA 3W71A 2WAGA 4POCA 1WDSA 4WSJA 1XIIA 2FZMA 4RE3A 2Q3OA 3MI3A 3EDDA 4O16A 3AICA 1LQAA 4W8BA 3BGJA 4QS5A 4B3KA 6A3HA 4MJ2A 2YL6A 4S3CA 3ENLA 4PUEA 5KMYA 1LTDA 2WZEA 4XZLX 3TA9A 3QFEA 1LBFA 4D6GA 5JBEA 2A3CA 3WCZA 1ZCCA 4X2RA 4CQ9A 3L4UA 3ZLGA 3BWWA 2DVXA 3ITCA 3N19B 4FEZA 4EE9A 5AECA 4GH3A 1W1ZA 2JEPA 5F1VA 3E0VA 1VBRA 5LIUX 3KOWA 2WSQA 1W17A 3OVGA 3LA4A 3IVUA 4L9YA 7PTDA 2Y24A 4NX0A 3RG6A 2PDQA 2VGFA 1V7YA 4UFKA 2DSWA 3IRDA 3T0BA 1PTDA 5CC5A 4EACA 4TXEA 2NQJA 1HQTA 1V3HA 6TAAA 3GG0A 1FH9A 4N9BA 2CITA 4S3FA 4ZQRA 5BRQA 3UWQA 1C91A 2V82A 3W00A 3NSMA 4KCWA 1GJPA 5BYWA 4DXXA 3IK2A 4R33A 2EPOA 1X7FA 3V75A 3KTXA 4Z42C 1JZ6A 4AFYA 5A8QA 1YNPA 3W1RA 1R3SA 1YPXA 2VGGA 1IGSA 4GVIA 3FJ6A 1Q2RA 3S5SA 2HEJA 2XUCA 3QSTA 3AALA 1W1A1 1GQLA 4JIRA 4F2TA 1UD3A 1UH2A 2OX1A 3GC5A 2A6NA 4A35A 4FP1A 1JCMP 4B9ZA 2IMRA 2VVSA 1IXNA 3ABZA 1WP6A 1UPPA 3WD4A 1VRXA 5D37A 2VNCA 2FZNA 4V1YA 3U9IA 2WB5A 4CNNA 5BU9A 3AFBA 3VNKA 4ZVJA 2PURA 3C4UA 1F6YA 2RGMA 4TX8A 1EF3A 1XBYA 1M7OA 3LRMA 3EB2A 2DPEA 2ZFAA 2YCKX 2W92A 3IRSA 1NQ6A 2P3EA 4K37A 2Z6JA 3W73A 2ACRA 1W3JA 1W37A 3W7KA 4LC6A 4LS2A 1H11A 1JJKA 2CBIA 3UVAA 3O6AA 3ES7A 3QHNA 4S3JA 4IH3A 2AGKA 1DTNA 3QKEA 2VC7A 3C5QA 1RSCA 2XN1A 4DNHA 4QJ3B 4D71A 4ECLA 2VX6A 1H1NA 3N29A 2NVAA 1WZMA 3R94A 1WXYA 2ZDRA 2XIJA 3EDKA 1QW7A 3PPGA 2A0NA 3ABOA 1XG3A 2ATMA 2F61A 3DKLA 3KHJA 3W7CA 1HF6A 1XIMA 3T78A 3TQ0A 3TLLA 1EC8A 3O6DA 1TR1A 3QZEA 1C7TA 4DYKA 3S0CA 1KFKA 2XIBA 4MKNA 3SR7A 3AS1A 4MMWA 2Y61A 1A5CA 2ZRYA 3KWSA 2J6XA 4K38A 2PRMA 4M1BA 4BHYA 1WXZA 3QPZA 4W7VA 3AMLA 3ABXA 4WY0F 4DBUA 2WVVA 4HA4A 2X7VA 4J1OA 1JYXA 4PRTA 1NF7A 3SCSA 5A8NA 3CMGA 3H53A 3CMFA 3ZT5A 3KOFA 3VO0A 4HTYA 3GTNA 1MFUA 4UR9A 3GU1A 3POHA 2EHHA 4E8CA 3UGRA 3U4FA 4AUBA 1W9XA 3G6MA 3TTOA 1XPGA 2QXWA 2HV5A 2WVSA 5CPTA 5D32A 2NQ5A 4FOJA 2C3ZA 3WD1A 1VLIA 3WQ5A 1TG7A 1S2AA 2YSWA 1EQCA 4MUZA 1K8YA 5H1WA 2OSWA 2ABAA 1E6ZA 4HU8A 4LUTA 1A0DA 4ZODA 1ZY9A 4MY9A 3L4VA 3FHQA 4Z17A 2DP3A 2NV9A 1KB3A 3CLMA 1SW3A 1ZALA 3W29A 4PFHA 3GDTA 4O0KA 5CEWA 4CD7A 3HGJA 2OQLA 1U83A 1CWYA 4GMEA 4KQNA 5AYYA 1CLVA 1WUEA 3LOTA 3G6LA 1W9PA 3GH7A 3WMLA 3DGRA 3ITGA 3T8LA 2XZ7A 4AD0A 1VIWA 4ASTA 3WLRA 4K68A 1S1PA 3MCOA 2ZC1A 1XISA 1B3VA 3FVDA 4GZEA 4QJ1A 1P5BA 2E09A 4IPNB 3BG5A 5FEZA 3BLIA 1GJUA 4ZO9A 3DBPA 2R1KA 2F2KA 5JH2A 1CNVA 1K9TA 3AO0A 1J5TA 3PJWA 3TQVA 3VGHA 4H9ZA 1Q6EA 1VFFA 2FGLA 1JFHA 2PWGA 2JE8A 1OVDA 1UWUA 5CZKA 4NKCA 2E6AA 4Q8NA 3NR0A 4AIOA 3TWBA 2AOSA 4BQ5A 3GHUA 1LP6A 5IFTA 1QWKA 4C6PA 1LL6A 1QJWA 4XAZA 3C3UA 3ZO9A 4TVCA 1R9ZA 4A3YA 5CPMA 5MKGB 3D0CA 3OZYA 1RV8A 1OY0A 3BSGA 3VA8A 3E49A 2VX7A 3OODA 4C6CA 1F4AA 2VCAA 3N12A 2D2HA 1AMYA 3JVAA 1YXDA 5E93A 1GHRA 1MZRA 2RUSA 5HQMA 3THUA 1UR8A 4XSMA 3VDBA 1C7SA 3WN6A 3F5LA 4P61A 1ONRA 3KBWA 2X16A 4UTKA 4DO4A 3A12A 3M41A 2GDUA 3HG3A 2XWEA 4NT0A 2DVUA 4ZFCA 3IJQA 3GC4A 4ZENA 1VP5A 2XIMA 1V02E 4ROPA 1GGOA 1TIWA 5EBUA 3GY1A 4ZR8A 3M5XA 1QNPA 3AAMA 2FJKA 3B0UX 2Z26A 1JVNA 1BWLA 1T8QA 3BPWA 2G3NA 1MUCA 1UYQA 1PWMA 3KCOA 1H49A 5ABFA 5D05A 5U7SA 2DSKA 1UWSA 2DH3A 1JZ8A 4J3ZA 2Y5SA 1UP3A 5HWJA 2V8ZA 2P76A 3GFXA 4C7DA 4UWMA 5EU9A 1GHSA 4NYYA 1V79A 2FPTA 3CAWA 4QLKA 3RPDA 5JUVA 1Z42A 5IOBA 5M3WA 3ZMRA 3C52A 3VGFA 4ATDA 1NP2A 2WKJA 3CB3A 1XC6A 1B9ZA 3R4IA 1N8FA 4E4PA 3N13A 1X6LA 3UP8A 4AZIA 2MUCA 1W8SA 1XBZA 1CDGA 4XZNX 2J9ZA 1OK6A 1UIOA 3HJZA 5FF4A 4OJYA 3PBVA 5LIXX 1S1RA 3U2OA 3IVTA 2GJLA 5A2AA 3AROA 3JRKA 2VZVA 4Q4QA 1MRAA 3VD4A 1PUDA 3LCXA 4WCJA 1XSIA 4S3BA 3ZWSA 1WOAA 2JALA 3EX6A 3M44A 5CG0A 4JFUA 1Q6RA 3IIOA 4LFYA 4AH7A 3KL3A 1PZ3A 4KWUA 5E5CA 5F4SA 1UOKA 4W93A 3EX1A 1UH4A 1RA5A 3ANYA 1WA3A 1Z6KA 3IIXA 2Q8LA 1US2A 3BAWA 1LUCB 2I1OA 3M0LA 1VBUA 3I65A 1PDYA 1V93A 3GNOA 2GOKA 4DWSA 3W9ZA 1GG1A 1BVZA 4RDVA 4Y9PA 4GK8A 3WFLA 1EZ2A 4MJZA 4NAEA 3RYSA 2CZEA 4IMGA 3P8JA 3ZOAA 4AEOA 8TIMA 4NU7A 2KZHA 3K1DA 3IGUA 4LAKA 2ZKMX 1X1NA 2J7BA 5E6ZA 2QAPA 1MZHA 2F9RA 5DX7A 3DFOA 2DZAA 1SW0A 1ALDA 2GJXA 3KRUA 3M6DA 4Y8FA 4NI8A 1F8IA 2XIQA 3S9IA 2FTWA 1ZJAA 2GWNA 3EOEA 1I2OA 4E4FA 1RLDA 3A4WA 3RX2A 3EXRA 5EB8A 3QMSA 4JR5A 4GJIA 3WF0A 3H12A 1RALA 3JUGA 1A5MC 3NCOA 4HOWA 2IXVA 3E96A 4M8UA 2ZCGA 3CGTA 2ZADA 4HOZA 1W5QA 1IHIA 4O52A 3ITOA 4R5EA 3NQFA 3DESA 2DT3A 3VKDA 2B7OA 5EKYA 4M6QA 3VOFA 2NUWA 2NW0A 1EF2A 4M1RA 4Z2GA 4KWVA 5FJUA 2CLPA 1CEOA 3M5YA 3E2QA 3SW6A 4C1NB 3NSXA 4JTDA 1UMLA 3BLFA 4PMZA 4P7QA 1OM0A 5HANA 3NO1A 3GDLA 3F4CA 4QDPA 2ZVRA 3GTXA 5FACA 4G56A 1X96A 1IEQA 4MHBA 3NQMA 4P8XA 4N42A 4Z2JA 1JFXA 1JPMA 3F2BA 2OYMA 1YKWA 1J11A 4FSAA 1M65A 1G1YA 3S83A 1OFEA 4REQA 4QISA 5CZ0A 4U4MA 4QQ3A 3L0NA 1B57A 4DQWA 1G9HA 3LSCA 4Z1BA 3TU9A 4A8IA 1SUXA 1QBBA 1OC5A 1Q6LA 5DY2A 1UW9A 2DJLA 4QFUA 4Y96A 4D9PA 5FSDC 1PKMA 3CIWA 1FWTA 3C2EA 1G69A 3AJ7A 1E0WA 2VC9A 1Q13A 3ZVHB 1SSDA 4MOZA 4GI8A 3PB0A 2OQYA 1UUOA 3N3MA 3WNOA 3A4XA 3KDOA 4C6BA 4FB7A 3W7EA 3SFKA 1FCBA 2CWXA 3E5PA 3P5ZA 5JU6A 3PZNA 2Y85A 1I1WA 2GSHA 4PUUA 1ICPA 2IQTA 1VPYA 1BEUA 4DO5A 4IP5A 1J0ZA 2W61A 3O15A 4JY8A 4UB9A 2X09A 2Y7DA 1B3XA 4JPGA 5G1YA 1KWGA 1OX5A 3FEMA 3DAQA 3KE0A 1Z9AA 3CT7A 1X98A 2YBVA 4UR8A 2WNWA 2YA2A 3VGDA 1SFJA 1O5KA 1DHKA 2P0IA 4E6MA 1XDLA 4C5ZA 2YW4A 2OZ3A 3PPHA 4LAMA 3VAVA 5FF7A 5REQA 4RPQA 1FXQA 2F84A 4LXFA 2I7GA 3I6EA 1EUAA 3V1HA 2W66A 4GC3A 1PKLA 1KGWA 2IPJA 4RL3A 1SR9A 1ISYA 1G4PA 1EZWA 1VRDA 3KVLA 3F4VA 1EGZA 4CQAA 5A2BA 2REQA 2FZ9A 1IXOA 4AB4A 1OQFA 4FZIA 2OT1A 4H8NA 3W1UA 3NZRA 2YCJA 3D3FA 4YHEA 1NWRA 1I45A 3PAOA 3GNNA 2CLFA 2W63A 1LWHA 4CD6A 1V5XA 4D6IA 4LS0A 2ZA3A 3PZOA 2CLEA 2WSKA 1AZ1A 4GKLA 3ZWTA 4L56A 3HF3A 4ATLA 1HNYA 1XLMA 4HNLA 1AJ2A 2PF0A 1L6SA 1TWZA 3CWHA 3UA4A 1Q5MA 4UTUA 4Q6JA 3H4WA 3VZZA 4OUEA 5JIWA 1KRMA 4Q8WA 3MWCA 3CL8A 1O1HA 1H7XA 1K02A 1CLKA 1EC7A 4GYJA 3TC3A 1W56A 1KD0A 1W1B1 2PTDA 3K8KA 1S2WA 3IWPA 1CX9A 3JS3A 2OWCA 1X38A 1RQBA 4V2XA 2Z4GA 3AXHA 4EOUA 3NQCA 3VKKA 5KITA 3D46A 4DNMA 1E4IA 3VPLA 1ISVA 1QAPA 4EAMA 5BRBA 2VXNA 1KM2A 3LXAA 1TJRA 5AVNA 2UY2A 3XIMA 3UG3A 1TE1A 3FHAA 5C9RA 3LHUA 2A7NA 1QNSA 3WH8A 4O18A 3AS2A 4F8XA 3FVMA 3OOQA 3E2SA 2GDQA 3G1HA 1F74A 5HNNA 3MUY1 1W0MA 5AYBA 5AHMA 1E0VA 5FF2A 5BRPA 2PS2A 2NX1A 2QCDA 1TZ7A 4NILA 1V3LA 3WNNA 3RUBL 3QV8A 1R30A 4NUWA 5CGMA 1QW9A 5J5RA 1FWCC 2XJ7A 4H9MA 5FEPA 5GJMA 1WZKA 2Y6ZA 4N2YA 2HWGA 3VKBA 5LGZA 3VUSA 1POKA 3S5ZA 2QCFA 3GDRA 1VEMA 4PCPA 3R0KA 4JTCA 4AW7A 4P7NA 1UPMB 2HVMA 3W22A 3UY8A 4MM1A 5D2WA 4G2DA 4YLWA 4IFOA 4DHGA 2I16A 4ZTYA 2KX9A 2ZUNA 3RCYA 1YHTA 1K8CA 2GLKA 1NIUA 1EYEA 2Y4SA 1LM1A 2E40A 3FV9A 3T44A 1AH3A 1BYAA 1W5OA 8XIAA 1YYAA 1POJA 3GUWA 3BAIA 1SW7A 2CLOA 3DH7A 1XH0A 3C6CA 4U33A 4PGLA 3K4DA 4HZ8A 2INFA 2CBJA 1E5NA 2JIEA 2WMGA 1XG4A 5CSRA 3WK2A 4LGXA 1OZQA 3TEVA 3PM6A 3W1AA 1MMFA 2C15A 3A5FA 1Q8AA 1ZQ5A 1BYDA 2PP0A 1IXQA 1O7AA 2VL4A 3MT1A 2EBNA 3W53A 2O7QA 4TMCA 4QEEA 3DFHA 5U4NA 4HBKA 2O55A 2QYGA 2DV0A 1T8XA 3G0SA 3QW3A 1BRLB 3CIXA 2FFIA 4AAJA 3DFSA 2BV9A 1TZ9A 4J7RA 3TCSA 1FXPA 2X0HA 4MNJA 2PGRA 1S3HA 2Y5JA 4Q4OA 1XRVA 4PUKA 2X0YA 1UA3A 5CPQA 4TIMA 1R3WA 4U28A 3WBXA 5KINA 2HBVA 2YJQA 1FHUA 4QJ4B 1XFCA 1MFVA 3SCNA 4R7WA 2E9BA 2E5CA 1JQVA 4G8TA 1HKMA 3LBOA 3BQ6A 1W2PA 3R8GA 4HZMA 1JCXA 5T26A 1CXHA 1EB3A 3QKZA 4B5SA 4NHVA 4AD1A 1DJQA 2Z27A 5FF0A 1GZJA 1P6WA 3EOLA 5ENLA 2D24A 1P6CA 5M17A 3GR8A 3M0MA 1EJ7L 4BI6A 2VJXA 4DLFA 3UZJA 3GQYA 5AC4A 1D2KA 2H9AB 3PJUA 1VFMA 1XR2A 1GYNA 3W38A 1W5NA 4Z1CA 1ZB5A 4EPEC 1VCFA 4DI8A 3BXWA 2J7EA 1YLVA 4Q8OA 1W1TA 7REQB 3EWBX 2BMBA 1JRBA 1JYNA 1BTCA 4RLIA 4ONVA 1LZOA 2PZNA 1F5ZA 1XLFA 3MP4A 3TCEA 4HCHA 1AA1B 3PP7A 3H2AA 1KKOA 2ZUWA 2ONEA 2XIIA 4OWGA 4MUPA 1XM3A 2PRHA 1ICSA 2BX7A 4IJRA 5EFDA 1EYWA 3OA3A 3MCMA 1FWBC 3BMXA 3O8AA 4QAWA 5C9WA 4GBDA 2XGZA 4W5UA 1KBLA 4H00A 3N34A 3UXDA 2BWGA 2GGEA 1A5BA 4DZHA 1JCYA 1DJZA 1X1ZA 1EL3A 4Z2KA 1TMLA 3NFUA 5AYXA 1QFEA 3B4UA 4PH6A 3AYSA 2VT0A 1R3RA 1UJPA 3UXLA 1JD7A 1UD8A 3JU2A 1VFTA 1EP3A 2VHLA 5EMYA 5A8OA 4KPLA 3W72A 1XYBA 1MDRA 2VC5A 3F1QA 2BGQA 3N04A 4IL2A 2YXGA 3WLPA 1FWHC 4Z2IA 4JTLA 4GJJA 2OLSA 1YXCA 4Y9MA 4UXDA 2OCZA 1PEZA 1B54A 3W85A 2J25A 1KCXA 1C9DA 1Z8AA 4WOQA 4YU1A 3S1XA 1DWHM 4KF1A 1QI5A 4E2OA 5FKYA 4XKYB 1GVFA 2G97A 3ELFA 4ZQCA 3MHFA 2XVGA 3PTDA 2VEIA 1YE6A 2QUVA 1J96A 4GJ1A 1L0PA 3WFZA 5E70A 4HZ7A 3KBNA 1XYCA 4D1IA 4D6EA 3NNTA 2NQ9A 4ZE4A 2RGLA 5HBFA 4O53A 3VD9A 3UCCA 4IJBA 1B1YA 3RMEA 3PTMA 5JVLA 1M7XA 3GU9A 3N9KA 3QVQA 1P0NA 3GRIA 2QULA 3R8RA 5DMLA 4XIAA 1VEPA 3MCNA 2X1SA 1ONEA 3H70A 2VUYA 3GVRA 2FZDA 3KRBA 5C5YA 2CFFA 1HKKA 2PDMA 4A8NA 2NX3A 3QR0A 1P0BA 2F38A 4H19A 3APGA 3WO8A 2OTDA 1M68A 4XAYA 4KS0A 3EKZA 3LHVA 4UQDA 1XDMA 2OT0A 1ZRQA 1JDEA 1QOXA 1RPXA 3NURA 1Q6GA 4CQ8A 2YLAA 5ABEA 3VFCA 4JL2A 1XLIA 2QMKA 3U2CA 3GE7A 1P43A 3IAQA 5LIWX 4U3CA 5FSEC 5AFDA 3CXOA 3OBAA 2BGSA 1B9BA 4NAFB 1IZKA 3H24A 1XX1A 4M24A 1GZGA 3NL2A 2HZGA 3RLUA 4C6IA 3ZSSA 2GK1A 3D5HA 3UESA 2DGAA 4QTGA 1E3ZA 3I3EA 4LS1A 3NL6A 5D4YA 1IV8A 2ABBA 3LERA 4US5D 1R3TA 3G2GA 3PUEA 4AXKA 4MWAC 4CNPA 1H1ZA 1LLOA 2Y7EA 3N11A 4OOZA 2G3IA 5FJOA 1XLAA 1Z32X 4EPDC 1DIOA 4I8YA 3NO5A 2BY2A 4QRNA 3EDJA 4MF4A 3W7HA 1UG6A 2WMIA 2QCHA 1NU5A 3R12A 3O0KA 3GDKA 4GWEA 1K7XA 3HFYA 3TXZA 4A8LA 1DHPA 3CO8A 4NL1A 4A21A 2HNHA 3T8QA 1O66A 4UR7A 3N9RA 3IV8A 2PDUA 4HNUA 2RJHA 1B3OA 3H2OA 1UCWA 1Z69A 1I4NA 3EPNA 4X22A 1A5SA 3W7IA 4Z1YA 3OQ8A 4AC1X 5JIPA 3DHFA 3QY6A 4R27A 3ZJ6A 1EDTA 1XIGA 2VZTA 4XZMX 4GPNA 1XGZA 1FWRA 2QV5A 1WBJA 2EXOA 1ZAIA 5CBJA 1FDJA 4DO7A 2DZXA 2BNJA 1PIIA 1QASA 1KLYA 3CHDA 4B90A 3SFWA 1BAGA 3G1DA 3Q94A 2WWDA 1JUEA 3RK8A 2PLKA 2HISA 2YL5A 4JTAA 4IIGA 3CIVA 3DN5A 1WAWA 3SN0A 4KIRA 4LW7A 3AUJA 1Q6QA 1WDDA 4LVBA 2XFYA 4BWLA 5AKQA 3R58A 4AYGA 1PV8A 4Z0SA 3IUHA 5A2CA 4KT2A 4FXJA 3F2CA 3R8HA 2VD8A 5KZEA 2DSUA 4TX6A 4UNIA 2QDHA 4AWTA 2VFEA 3B9DA 3I68A 2PU0A 3KX6A 3EWCA 3DX5A 3R25A 1QPQA 3MKCA 3W84A 3I6RA 3ITLA 4WX2A 1XD0A 1HO4A 3MBDA 1M41A 2G41A 5DRCA 1A5NC 2V2HA 2E3ZA 3VC6A 1UJQA 2ACUA 3GSMA 4LVFA 1XQLA 3HG4A 2CHRA 2PWHA 2GPTA 4C6DA 3F5KA 1LROA 2NLYA 3S2CA 1A3XA 5C2CA 2D3NA 1QK2A 4LCRA 1W3HA 1HUVA 2G4FA 3VD7A 4UNKA 2YR1A 2NVDA 1E1CA 3AZRA 1E0TA 3EXTA 3CUGA 4H01A 4QAIA 2I17A 2PTYA 3QPYA 3CAKA 3V35A 5I03A 4HOXA 3I6TA 4ADSA 4PL2A 4IMAA 1ZBWA 4DZIA 2Q01A 3QYSA 3TYDA 3MDUA 3EEZA 4ICMA 1XGEA 1SJDA 4WHBA 4INFA 1QO2A 2HQAA 4F79A 1EP1A 2YDQA 3GAYA 3G1VA 9XIMA 3II1A 3OYXA 3UJRA 3KP1A 3BICA 1GWJA 1H51A 3RJXA 2WKLA 3LCFA 4ILSA 4I9MA 4CQBA 1K70A 5CCZA 2XZ9A 2A6LA 4DB7A 3OU8A 3WLNA 3TOYA 3MO7A 5DMNA 3VIHA 2PBGA 2DZSA 3MV01 5D03A 4IG2A 3F4NA 3K8MA 2WHKA 4ML4A 7XIMA 4HNOA 2YYTA 4UQ9A 3O9NA 4QLJA 4L1XA 2ZIDA 3BLLA 5EFFA 5A6LA 5HXMA 3WH7A 3T2OA 4OT7A 4QNWA 2W5FA 3H4XA 4S23A 4HMCA 2VEPA 4IMDA 4AZ7A 2ZZ5A 3ZT6A 5HMSA 1W2VA 1VZWA 4LAOA 5G5IA 4IIFA 5I3HA 1HL9A 5KTLA 4HYVA 1QU4A 4AXNA 2GUUA