3W7MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-3-063
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-063
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7mA01
4AAJA 3RMJA 3TFCA 1YLVA 4NNAA 3FIGA 2Z0IA 1CI1A 3V75A 3QSRA 1B57A 3P61A 1OYBA 3SI9A 3NEVA 4TX9A 1TJPA 1ADOA 2B7OA 2QDHA 3PBWA 2RHGA 3UWUA 4M5PA 1F5ZA 1AL8A 3NVTA 2E6DA 2WNZA 5DBTA 5FF2A 4CCCA 1HTIA 4KKXA 1P5BA 5F4SA 3B0VC 1DOSA 1VJIA 4GUHA 4Z08A 3M1ZA 3P62A 2VELA 3OBKA 5EKYA 1THFD 3C61A 2VEKA 3SJ3A 4JXCA 3TE9A 2ZRXA 4QIUA 4D2JA 2IQTA 1WAUA 5ABTA 4YMZA 3PF3A 3LXAA 1EX5A 1KTBA 2YSWA 3UZ5A 2FPVA 3O1NA 3CC1A 1G4TA 2YGYA 4M7SA 1OF6A 1OYCA 2QUTA 1OX4B 3TC6A 2QCMA 2BWGA 1FXQA 3UQNA 3W7PA 4OGZA 4JTSA 1GTHA 1YDOA 1GTEA 1LLWA 4PEKA 3A23A 2CLKA 2QJGA 3GXPA 1FWTA 3IRDA 3EWZA 1QPRA 4LTSA 3W76A 3C56A 3B06A 3WJYA 3O6DA 3QYQA 5IBXA 1KLZA 1TJRA 3BLFA 4XTDA 1KM3A 2Y62A 1JUKA 4XUGA 5AB3A 2G5WA 2JGYA 3CIWA 2GJNA 3GNDA 5IBXC 2Z1BA 3C8FA 2EF9A 5LGZA 5FI8A 1PE1A 4IX0A 3EX1A 4NVTA 3TK7A 3SIZA 1C29A 1TRIA 3VFLA 4MLJA 1ZENA 3G0UA 4GBUA 4ZMGA 2PRMA 4XZ9A 5TQLA 5D09A 3ZR4A 5DELA 3UWWA 4Z1DA 5AC7A 4C1KA 3QQ1A 3W7GA 1DQWA 5AYYA 1VGAA 4LC8A 4IJBA 2YDAA 3QW4B 4BWLA 2Y7GA 4AHQA 3FOKA 1H7WA 5AYXA 3HF3A 3NL6A 4BI5A 1T0OA 3MBFA 3STCA 3LLDA 1B3OA 1SZEA 4N4PA 3SY5A 4O4WA 3P81A 4GNJA 1QO5A 4JTGA 4FF7A 4BWLC 4DO4A 4UTLA 3L5MA 1F6PA 3TV8A 2QCLA 3GDRA 2JKAA 3QQ0A 3W9ZA 1P4CA 4I7UA 5CPLA 3UY7A 3F4WA 3W1TA 5MHBA 2ZA1A 1TPUA 1TPEA 2V9DA 2FJKA 1LRQA 1V5XA 3DI0A 3TMQA 2VFHA 2QCNA 3CPRA 4GE8A 3TAKA 5LNWA 4NZFA 3HG2A 1W5OA 1YXYA 4NU7A 1YDVA 3P67A 3INPA 1EP1A 1TTJA 3K30A 1ZJIA 1C8VA 3VNDA 3WJZA 5DN1A 2E1DA 3G8RA 5D03A 2FTPA 4RXGA 3M43A 4BR1A 1PV8A 3MW7A 3A5FA 1O4UA 4GXMA 1QOQA 1TIMA 4K38A 3P5YA 1VYRA 2FQIA 4FNSA 1XBXA 5HUOA 4A2RA 2H8ZA 3BO9A 1FWWA 4M6QA 3O16A 4MY9A 3PM6A 2PE4A 2H90A 2XN2A 4EF9A 2R94A 4GUJA 3LRMA 1OFAA 3IGUA 5EYWA 1LOQA 2J27A 4UUIA 4ZQRA 4M6VA 5CZTA 2EGZA 3O07A 1AMKA 5DBUA 1JULA 4ORIA 3KVLA 3MP3A 3LV5A 4E0CA 4MIMA 3GIYA 3P84A 3PG9A 1LBLA 1YDNA 4IMDA 1TTIA 3CT7A 3RLUA 1Q3NA 4UMBA 1SUXA 2B7PA 2ZRVA 4IMFA 3W1PA 3W1XA 4O17A 4DF1A 3CHVA 4JX4A 4LUJA 1CW2A 3G22A 1SFJA 4Z1CA 1VH7A 2ZQ0A 1JJKA 4TO8A 7TIMA 1LTDA 1SW0A 4AHPA 4UNKA 1PCWA 1K7XA 1JQXA 3TR2A 4TR9A 4BI7A 5I3FA 3G3DA 2DU2A 3NAVA 4FX8A 3N73A 3O06A 2EHHA 2C13A 1MSSA 2NWSA 2ATSA 2JKEA 3GLCA 1CX9A 2ISSA 2AQWA 4XWUA 5HJLA 1ZCOA 2J9ZA 3GYEA 3F1QA 5HR6A 2XN0A 1SO3A 3W2UA 4AMAA 3TUUA 1DHPA 3GDKA 3IVSA 1X1OA 1SPQA 2NUXA 3G0SA 4C1LA 4KWWA 4WOZA 4WY0A 3KVKA 1KTCA 4QM1A 3VE7A 3F4NA 3L67A 2A6LA 5AC6A 3BG5A 4MPQA 3LCWA 3TJXA 1FXPA 1JR1A 2QAPA 4Q32A 3W86A 3STFA 4PODA 2QUVA 2OJPA 3TSBA 3MP5A 3A21A 4JX5A 4X22A 2NLIA 2RDUA 5D2XA 1EB3A 1QPOA 3T55A 4N6FA 3G8EA 3M16A 3B05A 3Q94A 3RK8A 2VEIA 1XUZA 3PG8A 3BK0A 2JBMA 3W2JA 2ZZ6A 1ICSA 3EX4A 5L9FA 3MP4A 3A22A 1VYSX 4O0KA 3N2XA 1B9BA 3B0UX 4LV4A 1EUNA 4NJJA 4O4VA 4GRSA 2Y7EA 1NVMA 1RZMA 3NQGA 4JTJA 3SGUA 5CZSA 4EOUA 2C1HA 5KTLA 1EWDA 3DKJA 3HO8A 4M19A 4HNNA 3QPZA 2ZRYA 5EPDA 1H62A 4MVAA 5I3KA 2DORA 4R33A 2YX0A 4ZZ9A 3S1WA 1F73A 5HQEA 3P80A 3TSDA 3W7NA 5U4NA 1GVFA 1FUYA 3DGRA 3L66A 3S5NA 2NXHA 3ZWTA 1QO2A 3LBMA 4JY9A 1W37A 2CLMA 2NV1A 4N9BA 2V2CA 2Y61A 1KM5A 4P2VA 1DKWA 4K7YA 4CNOA 3LRKA 1Q6QA 1TRDA 3KRUA 3EXRA 5IM51 2ZZ1A 1A5SA 3C2RA 4E38A 2CW6A 2WQPA 1PIIA 3GDLA 3PY2A 4O28A 1OG0A 3H54A 1KBJA 4UMCA 3BPWA 1LDCA 4N9DA 5CKSA 3W2MA 1W8SA 3ABRA 3ZS4A 1GYNA 2JK2A 4AF0A 1GVQA 1VHCA 4R7JA 5EMUA 3EWUA 4BI6A 3FYOA 1PVNA 2VFDA 3ABQA 2E09A 4PL1A 4JN6A 1W54A 4KFNA 1I2RA 2NUYA 1HO4A 5F1VA 2ZRWA 2H3BA 4LS2A 3R89A 3TU9A 1FDYA 2FLIA 2ZTJA 4H4IA 1SO6A 5AHFA 5K7JA 1KM4A 3W70A 3NZ1A 3HMJG 5DXYA 5G4EA 4RKAA 1OFPA 4LRTA 3BARA 3QFEA 1RQEA 3R12A 2PRHA 5D2TA 5TBOA 1ZAHA 4JYEA 2H6RA 4NXKA 4N6EA 2P1FA 3EWYA 1IXNA 4MZYA 4LT9A 4OHQA 3L2IA 5FF7A 5F2GA 2ATMA 1J2WA 2YFOA 1SFLA 3TH6A 3N9SA 5LHEA 2NX1A 2ZBTA 1S5TA 3DZ1A 3LXCA 4OWGA 3NZRA 3QEZA 4O14A 3IGSA 1PS9A 4UFIA 3PUEA 2Y70A 1OFBA 1G6CA 3L0GA 3G3MA 2Y7DA 1BWKA 1ML1A 3BW3A 2GQ9A 4MJMA 2ZA3A 2VFIA 3G1DA 4JICA 2LLEA 2ALDA 4GJ1A 4ZQNA 4X3ZA 4JTHA 3MHUA 1H51A 1UUMA 2YZRA 3HPZA 4Y6GA 2DZSA 3PSWA 2QF7A 2GOUA 4MY1A 1NF7A 4Y8FA 1ME7A 4QQ3A 1RQHA 3LBCA 3PUOA 1IXQA 1D9EA 1SSDA 1C9DA 2H8XA 4LWWA 1JCMP 5F2IA 4J9JA 2DZPA 1EUAA 3PC0A 1W31A 3HG3A 4KFOA 1G4SA 4O10A 4CNPA 4FNTA 4NUWA 3UWYA 4JTKA 5AOUA 3FA5A 2YW4A 1TV5A 5FEPA 4NQ1A 1P0KA 2QEZA 4MFEA 3CEPA 2QCGA 4JTIA 1R47A 4NJIA 3E0IA 3P8IA 4DBDA 4AWTA 4TIMA 1LZOA 1L2UA 3W23A 5F2LA 2X30A 2X2GA 2ZRUA 1WBJA 2NXGA 3W84A 1VZWA 2NWRA 4O0ZA 2FPTA 3W7MA 2X1SA 3DKLA 3MWAA 1OHLA 4AHOA 3M5ZA 3M7WA 1P0NA 1Z42A 3W1MA 4FNRA 2E5CA 1X1ZA 5DCBA 3G1VA 3A5VA 1XI3A 3T4CA 2Q3RA 3CB8A 3BLEA 3UYCA 1JUEA 3STGA 2TYSA 5G5IA 2A7NA 4S1FA 3EB2A 2CZ5A 3TW6A 1H61A 3IIVA 1TPDA 4RCXA 2CU0A 3CU2A 2UV8G 4X9SA 5LNVA 2YPIA 3OVRA 4IOTA 1IIHA 2WOQA 1J4EA 2JGQA 4BF9A 3O6YX 2CLHA 4QJ1A 3W7DA 4O19A 2RKXA 3GAKA 5AFDA 5K2ZA 3H53A 3PB2A 2R14A 2C0AA 3B04A 3W7IA 3PWAA 3CWOX 3RLVA 4DO5A 3P7YA 1JCLA 4HSOA 1KBIA 4UFHA 4AEOA 4K8HA 2CLIA 1OFEA 1SZFA 1TPVA 2E77A 2ZFAA 3LM7A 3EEGA 3A9IA 1IIGA 4O11A 3IVUA 1O60A 5D04C 3E49A 3NYZA 3WK0A 2YFNA 3W7LA 4MZ8A 1QNVA 3GK0A 5HUPA 1NSJA 1HUVA 3S5ZA 3TDFA 3WJWA 4DEFA 3DBPA 2J9YA 2Y88A 5C2XA 3W7OA 2DJXA 3LX9A 4YL2A 5E0KA 4DPQA 5DY3A 4NJHA 3LCFA 3NM1A 3GDTA 5H91A 3PVFA 4LVFA 5D2VA 3ATYA 3D0CA 1Q45A 5AHMA 3QMRA 1XKYA 1XM3A 5BNKA 4HPJA 3BLIA 1VCGA 3BGJA 1RV8A 3WJSA 4LV9A 3C2EA 3LHZA 3SFKA 2NZLA 3W1LA 3EWWA 2RH9A 3FKRA 3TNOA 3MI3A 2A1YA 3QSTA 4S2BA 4GFSA 5A5WA 2ZTKA 2GVJA 1VHNA 1H63A 4K39A 3W74A 5DCEA 3E12A 1D3HA 1JCXA 1GPWA 3CM4A 1O5KA 2KZHA 1W5QA 4B5NA 3KVJA 2OMAA 3LHTA 3LCHA 4WY0F 2RFGA 1O5XA 3M6YA 4ORMA 3L9CA 1XL9A 3NNTA 5FF0A 2XFWA 1T99A 3DH7A 3GX9A 3M9YA 4JTEA 1NF0A 4RZ5A 3JRKA 5K3VA 2QCEA 4PCFA 3W2LA 4O1AA 4MFDA 3LRLA 4Z1BA 2A5HA 1KFJA 5LNRA 1ZAIA 3HPSA 3NOEA 3Q2DA 4XBKA 4RK8A 4K36A 2PRLA 3Q37A 5KZDA 4EVZA 1TYGA 1XFBA 3S5OA 1QPQA 2CLEA 4QSHA 3LCLA 1VCFA 4A3UA 5AYZA 3W6YA 2ZA2A 4LVAA 2V2HA 2HTMA 4HIBA 4O16A 3TA6A 5D30A 3NL5A 1J5TA 3C0JA 4HKPA 1V7YA 1XCFA 4CQAA 1SSGA 1SU5A 3P8JA 1WOBA 2O7SA 4TMBA 5I3IA 1G67A 4XBSA 3G1XA 1W5PA 3B8DA 4WZHA 2G95A 4UMAA 1TCDA 3S8HA 3GVGA 3L0NA 4MY8A 4DBEA 3NQAA 4WY0B 4IUOA 4IX2A 3T78A 4FHAA 1FWSA 3HPXA 5AHEA 3MMTA 1UCWA 4HSNA 2PC4A 3PULA 1B4EA 3UWQA 3KRZA 2FB2A 3H55A 5T26A 1W1ZA 1OVDA 5CSSA 3M5XA 4WX2A 1TV8A 1UBSA 3TJLA 2Z6IA 1JCJA 4ML9A 1BEUA 4UIOA 5BMXA 4FO4A 1SW7A 3HGSA 1OFRA 3FYPA 2Y89A 4HN4A 2PURA 4XKYA 3G1FA 4JR5A 1H7XA 3LV6A 5CPNA 3W85A 2QAFA 3L5LA 1IF2A 3E02A 4Q4KA 5LNUA 2ZZ2A 1HFBA 1EP3A 1GOXA 1Q6RA 1ZAJA 2E68A 4YLWA 3BG3A 3TKFA 4BK9A 1W3TA 3LOTA 2GPTA 3DXIA 3FJ6A 1OX5A 3CIXA 1M7OA 5D32A 2CZFA 1EIXA 1VCVA 1LRNA 4YCPA 1TSIA 1FY6A 3CTLA 5HWJA 3W88A 1SO4A 3L5AA 4FX7A 1EEPA 3UXDA 4Y96A 1MO0A 3O05A 1ZHAA 2F84A 3O8AA 5KITA 4RV8A 1W3IA 4R34A 5C6MA 1FBAA 4CNNA 3UD6A 4FEZA 2NV2A 5BW6A 3W7JA 2TMDA 1MEHA 3N34A 4O1CA 1XBYA 4LRSA 1R2RA 1QMLA 3O6CA 2OT1A 5F4WA 3G1HA 4EIVA 1R30A 1WV2A 4CQ9A 1HG3A 3DAQA 4L4LA 4M7TA 3UPBA 4LNYA 4AF0B 1I2NA 4LVBA 1DJNA 1FDZA 2QKFA 2R8WA 3VE9A 1I4NA 2A21A 2C18A 1LRTA 2W6RA 2WNNA 3DFNA 1Q6OA 3PBUA 4LOCA 1NFBA 4QITA 1A5CA 3DI1A 4MYXA 3BGGA 4ZQCA 1OX6A 3M47A 3KVMA 4GC4A 2OT0A 4AWUA 3EXTA 1B4KA 1U83A 1A5AA 2J6XA 4LVDA 3TC7A 5E93A 4GUGA 4CCDA 2X1UA 3W7CA 4FXRA 1GYLA 3UNDA 1ME8A 2E5BA 5C5YA 3M41A 4UXDA 1AG1O 2DZWA 4UR8A 5D2WA 5HR7A 1RPXA 4IXHA 1G7VA 4EWND 2V0TA 5TIMA 1R2SA 2QDGA 1I8JA 4UTMA 3W7EA 2A85A 3NR0A 3OEXA 1OFDA 2V82A 3CEUA 1W5MA 3R5EA 4JTTA 5KMYA 1UUOA 1T8XA 1F76A 1ZALA 1LORA 4OT7A 3GZ3A 3HJZA 3DFQA 4WD0A 2CWNA 4O13A 1JQVA 5AHLA 4EF8A 2CFFA 2R91A 5HMSA 3QJAA 3W7QA 1Z44A 2Y85A 5CPOA 5K4ZA 4FNQA 1H1YA 1EPXA 3G1YA 2ZDRA 4LW7A 3SGZA 1KM2A 3C2OA 2A2IA 4W9TA 1YXCA 1XC4A 3BW4A 4N2YA 1OK4A 3IIZA 3KAOA 4RZ6A 2I1OA 4PL2A 4Z0JA 3NQEA 3LCXA 4U28A 2WSQA 3PAJA 4AVFA 1X6UA 3OHIA 1LBMA 2YR1A 4H6KA 1U5JA 1T96A 3FEMA 4RXFA 3S5YA 4UTUA 5D2YA 5KSWA 5K4XA 1F6KA 4X2RA 3B4UA 4H3DA 3LB0A 2OX1A 3B03A 3ZWSA 1KFBA 4UFLA 3LDVA 4NT0A 3L21A 2E6FA 1PCKA 1ZNNA 2ZZ4A 3NL3A 1QOPA 3UY8A 4TU1A 1QFEA 1FCUA 1MZHA 5KINA 2BSLA 3QZEA 4MLRA 1LBFA 1WOAA 1BKSA 3YPIA 4JIPA 4ALDA 2H3DA 2X1RA 2VC6A 1DJQA 4HPXA 4O57A 3GXTA 3G18A 5A8GA 4AH7A 3BV4A 3THQA 3OG3A 4DF0A 3PBYA 3W1AA 5BRBA 4LU0A 5FEXA 1YPFA 4NX0A 5F4XA 2B4GA 5DY2A 3DU0A 1I2QA 1TTPA 3NQ2A 4YCOA 4PC8A 4UR7A 1GG1A 3I68A 2ABAA 1ZFJA 3QC3A 4QISA 2ZZ7A 3L65A 5HWNA 4IMGA 1FCQA 3W75A 1W3NA 3KOFA 1GVSA 1NAL1 3JS3A 3NQCA 2AGKA 1TV7A 3W71A 3HIJA 2BTMA 3TMLA 4WJEA 3QMSA 4I7WA 3TXVA 3W7RA 1VC4A 1ICPA 4WOQA 4MOZA 1SW3A 4CLMA 3VCRA 3W3OA 3EKLA 3TQKA 1TB3A 2NX9A 1K3UA 3T40A 3EKZA 4UTKA 3VKJA 4U4MA 3QH2A 4JTLA 2V2DA 2DZXA 2TSYA 4ONVA 2V81A 4N02A 5CZ0A 5K9XA 1UJPA 2CZDA 1RVGA 2DZTA 3LLFA 1IGSA 2P10A 4Y90A 5DCDA 4DF2A 3NPUA 2OCZA 3LHWA 3TQVA 4UFJA 2A7PA 2DZVA 5G2IA 1PHWA 2VENA 2A7RA 2YYTA 5G1YA 3ZFHA 1O95A 3IIXA 4RX0A 4JDYA 2V5BA 2P0OA 4O54A 3W1QA 4E2BA 5CG7A 4MJZA 4Z1AA 5DXXA 1OJXA 5KZMA 1AW2A 2DP3A 3EX6A 4WXZA 3NQDA 4E2DA 4O53A 4L4MA 4R53A 2ZCGA 3W87A 4ICNA 3IV3A 2XN1A 1R2TA 1DORA 4ZQPA 1VPXA 3M5VA 2CZEA 1SO5A 2A6NA 2WPBA 1L6YA 4WUIA 3RNDA 2RDTA 1L6SA 2FFCA 4JGDA 3O63A 2G97A 2TPSA 3IVTA 1MEIA 1WXJA 1H7OA 3HB9A 2BXVA 3PS7A 5FEZA 3OVQA 3S1UA 4FIRA 2F7FA 3PR2A 4JNMA 3IEBA 4K7VA 1IXPA 2W79A 1I2PA 3ANYA 1A5BA 3R8RA 1S5VA 1JCNA 3W72A 3R2GA 4P61A 4HHPA 3NQ8A 3GAYA 4OQVA 1YTDA 5AC8A 4Q33A 4UNLA 2Z6JA 2NX3A 1FQ0A 2RDWA 1ALDA 1Z48A 5H2ZA 4LS0A 4JDBA 4NNBA 5I3GA 4DELA 5L6UA 3R13A 1EWEA 3QM3A 5C54A 3SW6A 3W07A 4OV4A 3S1XA 2HS8A 5EY5A 1KM1A 1KLYA 2EAWA 4XTIA 2VEMA 3DFOA 2WO5A 5BMWA 3S9YA 2B0MA 3GNNA 1G4PA 6TIMA 3DENA 3KXQA 2YXGA 3NGJA 2Y63A 4ZQMA 2J88A 1M7PA 1H1ZA 4IQLA 5HULA 1KFLA 3N14A 1GQNA 4GUIA 4O1BA 3I65A 3NXFA 3DHFA 4MUZA 1QR7A 2WSYA 2YCEA 2Q8LA 4UTTA 3P60A 1NEYA 3G1SA 3SR7A 3QPYA 3HG4A 1BWLA 1QCWA 1L9WA 4O18A 3ELFA 4UTWA 3TXZA 4XKYB 2QCDA 1GG0A 3MO7A 4IWWA 4MKNA 4UTTC 1W5NA 3BG9A 4KFPA 4NJKA 4QNWA 3MYOA 4PH6A 3RFAA 4IPIA 1OFOA 5E1QA 4AXKA 1KTNA 3LHUA 3E9AA 3PBVA 3LCIA 1HL2A 1OABA 5DLCA 1AL7A 4UTWC 1G69A 2O7QA 1RD5A 2JKPA 3M0ZA 2GQ8A 2DJLA 4HNVA 3GB6A 1DV7A 4OU1A 3STEA 4O1DA 4K6AA 3HGJA 4PA8A 4M6PA 3NM3A 5FEWA 4JTFA 5SWUA 2CLOA 3SZ8A 1VLIA 3EXSA 4UTJA 2WNQA 5G2WA 3AO0A 3ABSA 3O15A 4ADUA 3M44A 3TSMA 1N8FA 4A22A 1N7KA 2NXIA 1AW1A 1BTMA 3HOJA 4K8EA 1YTEA 1H50A 4FIQA 3W83A 3TCEA 5CGQA 3KHJA 4IMCA 4LY8A 1KA9F 3P82A 3WK2A 3PSVA 3PB0A 5BOOA 1I2OA 4RLIA 1QWGA 1FWRA 1DVJA 4JIQA 1VLWA 1OX4A 1P1XA 1JUBA 3LHVA 5AN7A 2Q8ZA 3LTPA 3AJXA 2CLLA 3S6DA 3LTSA 1M6JA 1KFKA 2ZZ5A 4ZVJA 1LOSA 1VQTA 4AB4A 3C2VA 4JTUA 5EBUA 4PTNA 3WK1A 2HS6A 2YYUA 4OV9A 4A29A 3NQ6A 2A4AA 3DHDA 3N9RA 2NUWA 2VFEA 4DQWA 3TIMA 1EA0A 3L68A 3MI6A 3N2MA 5LKYA 4PFMA 2D73A 3W7HA 1LROA 4RR4A 1K8XA 1GT8A 1TQJA 3F03K 3QMTA 4UCGA 4WXYA 3W22A 2ZYFA 2C3ZA 1PHQA 3I6RA 4DO6A 1TQXA 4TMCA 1FCBA 2Q3OA 3NQFA 1GVOA 1K02A 4GWEA 4A21A 2X1TA 1GJPA 2GUUA 4OBTA 1SZNA 5FESA 4NJGA 3TQ0A 1TREA 3NPXA 3TAOA 3NPWA 3UZJA 5D38A 4KWVA 2C15A 5C55A 5EA9A 3ATZA 2WSRA 1ONRA 4RZ4A 4ADSA 4AWSA 1OFQA 2V5LA 3A24A 4QAIA 1JRCA 3NDOA 3C4UA 1K7EA 5EL1A 1K8YA 1O94A 3M5YA 4ZQOA 4LUIA 1UB3A 3G24A 2C19A 3MJYA 4CQ8A 3OVPA 3GR7A 4ADTA 3GDMA 2PCQA 1GVRA 3U6WA 4POCA 3NA8A 1X7FA 4FXSA 2FPYA 3VI2A 1WYIA 1HO1A 4N9CA 2QUUA 4HNUA 4YWIA 1TO3A 1UASA 2QJIA 5K9DA 1R46A 3TX9A 1H7PA 1LP6A 1XBZA 2VXNA 1YTKA 3L0KA 1F74A 3W1UA 4NX5A 2EPHA 1S5WA 5D05A 4IGHA 3LCGA 1Y0EA 1AW5A 1FX6A 3GXNA 3EX3A 1Q6LA 4IXXA 5I3HA 3ABOA 5CZJA 5J5DA 3I7QA 5I3JA 3NL2A 3KRSA 2VKZG 3LXBA 4FNPA 1F05A 3CLMA 1G7UA 1OYAA 3EX2A 2QR6A 5CSRA 4JX6A 2QCFA 4GUFA 1S3HA 4LC6A 5J5RA 2BX7A 3W1RA 3WFAA 4MYAA 1W56A 1YYAA 4N4QA 3U8GA 2J9XA 3T7VA 1LM1A 4BFAA 2TRSA 1K7FA 3TROA 4FNUA 1GZGA 3W1NA 2AAMA 1VS1A 1IXOA 4UC5A 2HSAA 3S1VA 3T44A 2BZNA 2GVGA 1OF8A 2CLFA 2GQAA 2Z2UA 3MBDA 3E96A 4UFMA 3P5ZA 3U2OA 1M5WA 1TPC1 1Z41A 5AHIA 5F1UA 3RF9A 1KW1A 4K37A 4CCEA 2WV8A 3NQ7A 1RR2A 1H7RA 4FB7A 3FJLA 1K03A 3USBA 4XQ6A 2WJZA 5HNRA 2E6AA 2J24A 5D37A 4UTHA 1KM0A 3SECA 2B7NA 1KV5A 1DQXA 2QJHA 5HWMA 3WJXA 4A2SA 2ZRZA 3LHYA 1JCYA 3LI1A 2I14A 4I9AA 1VRDA 3UWVA 3UPWA 3CQ0A 1W0MA 1WA3A 2VEPA 3IIPA 4JEQA 1JRBA 3NG3A 4DPPA 5LHFA 2GVLA 5D02A 3DFTA 1E51A 3KX6A 2ISWA 1TPB1 3Q58A 4JY8A 4WQ6A 8TIMA 5LNSA 1K8ZA 1H5YA 3V1PA 3LGEA 4MZ1A 5G4WA 1MEWA 1MXSA 1FCVA 2Y6ZA 1LLZA 2G96A 4O8RA 3GKAA 5CPMA 2VFFA 2V30A 3QF0A 1TPFA 2EKCA 2C14A 1ME9A 3FS2A 5AHNA 3C2FA 1GEQA 1F2JA 3HGRA 5G2HA 2YW3A 4IPJA 1LYXA 1YPIA 3GR8A 3I7SA 3EWXA 4JYFA 1SQ7A 3TW7A 1GWJA 3RU6A 1D3GA 1SR9A 2FDSA 4YXGA 5FF4A 3QRHA 3DFPA 3GKFA 4LVGA 4O15A 3FKKA 1X8FA 3BW2A 3QW3A 5G1TA 2BLEA 3JR2A 1WQ5A 1TMHA 1DBTA 4RJEA 3THAA 1XDMA 1QAPA 2VFGA 4OE7A 3SSJA 1PL9A 1XDLA 3W73A 3PUDA 3W2NA 3W7KA 2QCHA 3NPVA 2I9EA 1AK5A 2X16A 2C16A 4ZL1A 5F2MA 1ZY9A 2ISVA 3OA3A 3HBLA 1KV8A 4G1KA 2HMCA 1QPNA 1EP2A 1H60A 4HT3A 1KFEA 2ABBA 2WKJA 1JVNA 1L6WA 2E5DA 3P74A 2FB3A 3LTYA 4S2CA 5U7SA 3HQ1A 3NQVA 3IIOA 2OZ0A 4FX6M 5D33A 3UWZA 2DZUA 1YXDA 3OIXA 1TPWA 4NZJA 3UXAA 3C3NA 3EWBX 2V8ZA 4NXSA 1FWNA 4DXVA 5HINA 2ZZ3A 3HG5A 1F7BA 4Z0SA 3CWNA 4HNTA 3MYPA 2QCCA 3KFTA 4LS1A 1LOLA 2FIQA 1I45A 1A50A 1VYPX 1VR6A 3N3MA 1FDJA 5LSMA 4IMEA 3TFXA 3BVJA 5LGXA 3FLUA 4UFKA 2GJLA 4NNCA 3G0XA 1TPH1 3S42A 5FF3A 4JS3A 1DL3A 1WDWA 1XXXA 4O12A 3B0PA 2C6QA 1WBHA 4UTIA 1KFCA 3MHGA 5LZLA 1QDSA 3N19B 3LERA 3MI2A 4O50A 3DFSA 3LI0A 4Y9AA 3S0CA 3C6CA 4I7VA 3HGOA 1KM6A 3IGXA 1N55A 3WK3A 1H7NA 2Y7FA 3NQMA 3G1AA 3W2KA 2E6YA 1XUUA 3NO5A 4O52A 1ICQA 3MHFA 5KZEA 4JD4A 3FFSA 2QCDB 1A53A 5GVJA 4N9EA 1YADA 1XBVA 1WX0A 2VOMA 1LCOA 1G4EA 4JYDA 3I7RA 2W0UA 1TTQA 3C52A 3MUXA 5K9CA 2B7QA 6ALDA 1OK6A 1SZGA 4QNEA 2A0NA 1RQBA
chains in the Genus database with same CATH superfamily
4JFVA 3FIGA 1CI1A 3FSUA 2PB1A 3MSRA 1X6NA 4GQQA 1B57A 4CEUC 3P61A 1OYBA 4IF2A 1HJXA 3H2EA 2B7OA 3PBWA 4X0VA 3Q4DA 2DSUA 3GTIA 4GG9A 5C7HA 4ZGYA 3GHTA 3H2OA 1HTIA 3OQ8A 3URAA 3UG4A 3B0VC 3W53A 4KCVA 5I77A 3M1ZA 2VELA 3UERA 4EWJA 4B9ZA 3OG2A 4IFRA 4Q8UA 2DT3A 3BDKA 4G2DA 5ABTA 2WBGA 3LXAA 3B8SA 4J28A 3O1NA 2R1MA 3CC1A 3PZIA 1EHAA 1XRSA 2QCMA 3UQNA 4HK5A 3W7PA 1VRXA 1G9HA 1LLWA 2CERA 2QJGA 2OYMA 3GU9A 4LTSA 1RCQA 3B06A 2YL5A 3GTFA 4I9TA 1FHVA 4I8DA 3N17A 2OEKA 1TJRA 3M0XA 4CN6A 5H1WA 4QDPA 4W5UA 3ARSA 3CBWA 3H22A 1IE7C 4XUGA 5AB3A 2VZTA 3CIWA 1V0NA 1HGYA 2GJNA 4S3BA 1LG2A 2EF9A 2W61A 3C0QA 4DJED 5FI8A 3TK7A 1UIOA 1J11A 5A6TC 3WLOA 4MLJA 4ZMGA 2Y0FA 4M0XA 3A47A 1QK2A 1ZRQA 3VIJA 1I9CB 5DELA 3LZ5A 3UWWA 4IIGA 3IACA 4QJ4B 5TAOA 5AC7A 1GUVA 1DQWA 3GVVA 1DXEA 4GA8A 1VGAA 4IJBA 1XX1A 3QW4B 1UWIA 3AHTA 4QE4A 4WHBA 4LFYA 5CSUA 4J27A 3MMWA 4CGTA 1T0OA 3LLDA 4N4PA 4O4WA 3P81A 4DO4A 3KLLA 2PI6A 4XZLX 4B4HA 1TFVA 4HP5A 4KRUA 1WUFA 3W1TA 2V9DA 2FJKA 1UBPC 4NYYA 2VFHA 4US5D 1J2BA 4GE8A 1YNPA 5D8WA 5LNWA 4NU7A 1W5OA 1YXYA 1W1TA 1TR1A 1YDVA 3NO3A 3GFYA 3PPCA 4XB3A 2VYOA 1TTJA 3GXDA 2YBUA 1C8VA 4QG6A 1MFUA 4Z1YA 1V6WA 3S2JA 2W92A 4FLRA 1B3VA 4PMJA 5D03A 3F7JA 3M43A 4MNKA 2VRKA 3MW7A 2OU4A 2QMJA 2PGRA 4K38A 1VYRA 1CLVA 4FNSA 2QT3A 2H8ZA 3UCDA 3SDOA 4B3KA 2XJ7A 1RCXB 1Q6GA 4MY9A 2GSJA 2H90A 3H7UA 3WDIA 1RALA 1NDWA 1D8WA 3LRMA 3HA1A 2XH4A 1N82A 1LOQA 1YPXA 4HJFA 4A3HA 5CZTA 4EACA 2EGZA 3MDUA 1JULA 2X09A 3PBMA 1QWKA 3HV9A 5JBEA 2AKZA 3QV6A 1LBLA 1GZJA 3RLUA 4IMFA 2ZRVA 2C91A 3W1PA 3OLIA 3L2MA 1V08A 3LNMA 4LUJA 1SFJA 2ZQ0A 1E3ZA 4TO8A 7TIMA 2XGIA 3CL7A 1G1YA 3BMXA 2Z24A 3QN3A 1JQXA 1T40A 3RM4A 3K8LA 1MYRA 4P7QA 1A3HA 3CTTA 1QBBA 5CXPA 3NAVA 3CL6A 3AIQA 3EOUA 2YLLA 1P1MA 3QR1A 2NWSA 2CBUA 1UWSA 3SN0A 2ISSA 1TE1A 1ZCOA 2J9ZA 5FJUA 3F1QA 2XN0A 1K70A 3BANA 4JAWA 3RR1A 2X1IA 1DTNA 3GDKA 1X1OA 4F79A 3G0SA 4AZGA 4DAIA 4WY0A 4NZ1A 4WGXA 1BVZA 2QNEA 3F4NA 3H7VA 3L67A 1UHVA 5AC6A 3BG5A 4MPQA 3SCNA 1DJIA 3TJXA 4Q32A 4H8HA 1WDPA 2BASA 4J2PA 3MP5A 4GZJA 3A21A 2NLIA 2VVSA 4AD4A 5D2XA 1EB3A 4AX7A 2W9MA 3CUHA 1XUZA 2Z29A 4B5TA 3H23A 2ZZ6A 2C7FA 4HBKA 3STPA 2F38A 2DVXA 2ZUSA 4DX3A 4NJJA 1GHRA 3T09A 4CU6A 2R9RA 3BAYA 4EOUA 2C1HA 3ES7A 2QLYA 3ZIZA 3DKJA 1UWUA 4RDWA 4HNNA 1BSLA 5EPDA 4R33A 2YX0A 3R79A 4B92A 3VPLA 1FUYA 1W37A 1BYBA 2CLMA 2VHLA 4HZ6A 2NV1A 2D0HA 4ZR8A 2V2CA 1W8GA 1XLFA 1Q6QA 1TRDA 2JEPA 4F4RA 3EXRA 3VVGA 5IM51 3T0TA 3C2RA 2CW6A 2RAGA 3QR3A 1ONWA 3BZGA 2PWUA 3PY2A 4UMCA 1KBJA 1LDCA 4D8LA 3ZS4A 3BAJA 2XTKA 5EMUA 4W8BA 3FYOA 4LY4A 1BPLB 2PP1A 4KFNA 4XKMA 1A0DA 3W37A 3U2CA 1TX0A 2ZRWA 4QTGA 3GBDA 1BLIA 1FDYA 1KXVA 4XAYA 3NZ1A 5G4EA 1VFMA 4LRTA 1YEYA 3EDFA 3U5YA 2H6RA 1R5YA 3QKZA 2P1FA 3GO2A 3I6EA 4H01A 2BODX 4Z2JA 3QGAC 3N6JA 4OHQA 5F2GA 4HVXA 3TH6A 5ABHA 2NX1A 2BY0A 3CS2A 3NZRA 4XUYA 1B5TA 3QEZA 2J7BA 4O14A 4JQ2A 5CBJA 1OFBA 3LGDA 4HHLA 4D6GA 2PLCA 1W3KA 1G6CA 3G3MA 3L0GA 3ZR5A 3BW3A 4C6BA 3W00A 2GQ9A 1CB2A 4QP0A 4MJMA 4NF7A 4XSLA 4JICA 2ALDA 4GJ1A 4JTHA 3APYA 3OOQA 1UUMA 5C9ZA 3TYUA 1AJ0A 2BVDA 2DUXA 4MY1A 3UZZA 4MNMA 1SMDA 1KC7A 4DJFA 4JKMA 4B16A 2H8XA 3VKKA 1C9DA 3CNYA 1JCMP 4J9JA 1EUAA 4XZIA 3EB4A 4QG8A 2V3GA 2Z28A 1G4SA 1Q6CA 1ZPTA 1FVPA 4DJFC 3MV01 4YN5A 5FSDC 4JTKA 5AOUA 3FA5A 2ZDSA 2Y2WA 1X7IA 1WO2A 1MXDA 1R47A 4HU3A 1S38A 3OJGA 4JIEA 4TIMA 1M04A 4A35A 1FH9A 2ZRUA 1U30A 2NXGA 3MUAA 3WY1A 1O6IA 3DG6A 4G9PA 3HZ3A 3DEQA 2X0SA 3W84A 1VZWA 2NWRA 3W7MA 3MWAA 2PS2A 1XDJA 4AHOA 4XAPA 2FMNA 2OPJA 1P43A 1PKMA 3W1MA 2YIHA 3N15A 4DZHA 4PYSA 1M9HA 2FGBA 4PCSA 4P8UA 1XI3A 2QULA 3BLEA 3FA3A 1XG4A 3UYCA 3STGA 2TYSA 2WVVB 3EB2A 2E3ZA 3DX5A 3AUOA 3IIVA 5CJ5A 1TPDA 3R11A 5FAJA 2VTFA 3PZOA 4MDOA 3ONCA 4X9SA 5LNVA 3WD2A 3NWRA 1H09A 4PMZA 2OQYA 1B3ZA 1ITCA 4O19A 2PZNA 3TYDA 4IL0A 3PB2A 1WP6A 2GYIA 2ZC8A 3W26A 3JW7A 1RBLA 3PWAA 1JCLA 4IIEA 3OYZA 3SURA 2OO6A 3S4TA 1OFEA 3F5JA 2XIMA 2PCEA 3EEGA 1O60A 3E49A 3NYZA 5DFAA 3CIVA 4MZ8A 4UZSA 3SY1A 1NSJA 4Z2LA 3TDFA 1KRCC 4ZXOA 3V4BA 2DZAA 5I78A 2ESCA 2GJRA 5E0KA 5DY3A 5H8UA 4L4OA 3LCFA 3Q45A 2OZ3A 3J7HA 5AHMA 1ECQA 1IT7A 1J6OA 3BLIA 2J7EA 4LEFA 3CZKA 4EANA 3WJSA 4LV9A 1OSEA 4DM2A 3QOKA 2RH9A 3FKRA 3TNOA 2PDNA 4G7EB 2A1YA 2DQWA 3U3HA 4L9YA 4GFSA 4MMWA 2RUSA 2GVJA 1UZHA 3B8VA 4IP5A 1D3HA 1JCXA 1CXIA 1GPWA 5IDZA 1AA1B 3VGFA 1O5KA 4HTYA 2KZHA 1W5QA 3GY1A 3M6YA 1BTCA 1ONEA 4HYWA 1U1HA 2WKLA 2XFWA 1V03A 4UR9A 2QCEA 3TN6A 4JIRA 1GVYA 3W2LA 4LXFA 1Q8JA 4I3GA 2ODOA 4Z1BA 7CGTA 1Q5MA 4AY8A 1KFJA 2CC0A 1WZMA 3B3DA 3WLMA 5E5CA 4XBKA 4RK8A 1UH3A 1XFBA 1VBRA 3F4DA 3LCLA 1EQCA 1CDGA 3WO8A 2YL8A 3TA6A 3NL5A 3C0JA 1XCFA 3P8JA 1WOBA 3KTSA 5I3IA 2G95A 3DGBA 1L6GA 1BG9A 3PWGA 1R9ZA 4IUOA 4IX2A 3T78A 2NVAA 5AHEA 3MMTA 1XYAA 2G8ZA 2IXUA 3WLLA 5BU9A 3H55A 3OGRA 2FHFA 2VR2A 5T26A 3WNOA 1W1ZA 1F8MA 2Z2BA 1LG1A 5CSSA 4LB3A 4IJCA 4WX2A 2YB4A 1UBSA 1JCJA 4ML9A 2O9RA 4PUEA 4IIBA 4JCLA 4UWMA 4LCSA 4HN4A 1O1HA 4IUGA 4I8YA 3G1FA 9XIMA 2F2HA 2P0IA 4GH3A 4JR5A 3CV6A 4A4AA 4CD4A 3V18A 4UQBA 4KIEA 4MB3A 4UQAA 3W85A 2QAFA 3E02A 1XIDA 3CUJA 1HFBA 1UMYA 1QHPA 3BG3A 4IT1A 3C0LA 3LOTA 1TJ0A 3KL0A 3DXIA 3A4XA 5D32A 3L4YA 2CZFA 1V51A 1SYTA 1VCVA 2PDYA 3URQA 1GKPA 5HWJA 3IAQA 1SO4A 3AIRA 3BV7A 3UXDA 1EEPA 1Q6FA 5A8OA 3LPPA 3O05A 2GGHA 1MNZA 1W3IA 5GJMA 6A3HA 1VFSA 2Z25A 3FXYA 3UD6A 2J7DA 4BQ2A 4CVUA 5BW6A 2NV2A 4M24A 3W7JA 1MEHA 3N34A 1EYWA 4O1CA 4GYFA 2OT1A 2BDQA 1E73M 4CQ9A 1HG3A 4U10A 4JKKA 4M7TA 2O9TA 1W3HA 4LNYA 4AF0B 4LVBA 4L80A 3VYLA 1UZDA 3MCOA 2VURA 2WNNA 3DFNA 4DWSD 2ZWZA 1XGZA 4NZCA 2ZC1A 3SCWA 4DRSA 4LYPA 3BGGA 4ZQCA 1OX6A 4H7CA 1QOXA 4LCQA 3GNOA 4MTVA 4ZEPA 1V02A 4MJ4A 1B4KA 4LVDA 4J3XA 4KGJA 1RY8A 3BJTA 1GYLA 3UNDA 1Q66A 2YOCA 3PAOA 1RBAA 1J18A 5C5YA 4UXDA 4DUXA 4UR8A 1EZWA 5HR7A 3IANA 1CZ1A 1DWJM 1AJ2A 4GNVA 1XYCA 4P5UA 3BLLA 2YDSA 4C91A 1I8JA 2X42A 1SJDA 2X0HA 2XG9A 3TN5A 4DO7A 1XP3A 3R5EA 4B5XA 2SFPA 1T8XA 4XD6A 1R3RA 3GUGA 1ZALA 3AMGA 1MW0A 3DFQA 2ZX7A 1BFNA 4WD0A 1JZ7A 2QPSA 3FSTA 2CWNA 3ARWA 3MY9A 1RD6A 1CTNA 4EF8A 2R91A 3LPFA 5HMSA 4AD3A 5BZAA 3QJAA 3W7QA 3ARXA 5K4ZA 1PWMA 1KM2A 2BXYA 3C2OA 2A2IA 4PCPA 4W9TA 5BCAA 5I03A 1XC4A 2V5KA 3BW4A 3N2TA 4UNIA 2OYLA 3GXFA 2VZOA 4RZ6A 4PL2A 1VIZA 2VC5A 3LCXA 2OEMA 1EGVA 1RLDA 1KQYA 2WMKA 3PAJA 3BJFA 5C2GA 4H6KA 2PDQA 1XLAA 2OGJA 4GK8A 4L6OA 1T96A 3FEMA 3HU7A 3MKCA 2OQHA 3VOJA 1F3WA 2D3NA 2FKPA 4H3DA 3LB0A 3TW9A 1SZRA 3AC0A 3KHDA 5BXPA 3LK6A 1KFBA 4FSAA 1J5SA 3VGHA 1NM9A 3L21A 2E6FA 1CXFA 1GGOA 4JTQA 4KWUA 2NSXA 4DLMA 1PTAA 1IZKA 4XX6A 1FWIC 2JF6A 3ME3A 1FCUA 1PYFA 5C9RA 4MLRA 3UPMA 2ADAA 1WOAA 2OQLA 5TD4A 3YPIA 2H3DA 3M7SA 5FKYA 1CT5A 1GW1A 3CUZA 3OG3A 3PBYA 1F6YA 4PMUA 4AUBA 4LU0A 5FEXA 2DH2A 1TMLA 3WQ4A 1I2QA 1TTPA 5I02A 1Z3NA 2BHUA 3CB3A 4QISA 3L65A 1AH4A 1O66A 2OLAA 2EJ1A 3W75A 1W3NA 3CV7A 1S2AA 4LX4A 1TV7A 4Q6JA 5DMLA 5FJPA 2BTMA 1ECEA 2ACSA 3TMLA 4GIAA 1ZJHA 4AISA 2JE8A 1IHIA 3SCVA 4WOQA 4XBJA 4CLMA 1TB3A 1K3UA 3WBYA 3BZJA 3S47A 3T40A 3EKZA 1FWAC 3VKJA 1CGXA 3GQYA 3QH2A 4JTLA 1EGMA 1V93A 3O0KA 4ONVA 2DZXA 2TSYA 1V3MA 3EDJA 1JNEA 4Y90A 5DCDA 3OP2A 3DFYA 3LHWA 3RILA 2A7PA 5IFPA 2VENA 2A7RA 4J3VA 3S5SA 4KEUA 1OC5A 5G1YA 2PDHA 4CN4A 1B3XA 1KCZA 2ZVIA 3GD6A 3W1QA 2EBNA 4E2BA 5CG7A 1HNYA 3C8NA 1NWUA 4Q7NA 5DXXA 1AW2A 4LAOA 4WXZA 1XIHA 2PP3A 3QFWA 4HPHA 4E2DA 4O53A 3TJ4A 2VUYA 4X63A 5BOFA 1C7TA 1RJRA 2VEFA 3ZJ6A 7XIMA 2ZCGA 4HMEA 7TAAA 4S3FA 3EMZA 2DEPA 2EJAA 2RJGA 4ZOAA 2A6NA 4FK9A 4TUFA 4LEQA 2FFCA 3EGJA 2ZX5A 4EPDC 3PANA 4Y9MA 2GSEA 3OVQA 3S1UA 2F7FA 3PR2A 1MDRA 2W79A 4L4PA 1MQRA 1I2PA 3ANYA 1A5BA 3SB0A 3AXIA 3W72A 3NQ8A 2WZTA 2GGGA 2V5DA 3B8UA 1WB0A 8RUCA 1JD7A 4Q33A 4UNLA 1A0EA 2I9UA 2NX3A 3RRXA 2PDPA 4GZ7A 2RDWA 2JALA 1R3YA 1IEVA 4OBRA 4DELA 5L6UA 3R13A 3Q65A 3N2OA 4OV4A 1DXIA 3G1RA 1E1CB 3TEVA 1KM1A 3B8IA 4XTIA 3DFOA 1M53A 3T08A 1AMYA 3S9YA 3FYYA 3PNUA 2Z4GA 2J78A 3KXQA 1M7PA 1H1ZA 3V1HA 1E6RA 1GQNA 4GUIA 4O1BA 3GW3A 2PDJA 3I65A 2OXNA 2DQXA 2OOGA 3UG3A 1KXQA 1US3A 2GJXA 3P60A 1NEYA 1CGUA 3T42A 4HHHA 3QPYA 3E2RA 3GIPA 3ELFA 4D1JA 3FVDA 3MO7A 4MKNA 1W5NA 4KFPA 4PH6A 3I6TA 2OO0A 1EX1A 2VWSA 5E1QA 2Q09A 6XIMA 2VX4A 3ZMRA 4FP1A 3LHUA 3E9AA 4E4FA 5HMDA 2JKPA 2EPNA 7ENLA 4YPJA 3M0ZA 2DJLA 1BRLA 4DBUA 3AXHA 4OU1A 3CPUA 3PZNA 2G50A 4PA8A 3MC5A 4C7DA 4B5UA 5SWUA 5DT5A 2CLOA 3SSZA 4ZO9A 1LL4A 3ARZA 4Y7EA 4EXBA 2FH6A 4V33A 2UBPC 3TA9A 3WN6A 1N7KA 2C1IA 3W83A 3KHJA 4IMCA 4LY8A 1P7TB 5BOOA 5M1TA 4RLIA 2CXGA 3H70A 1EC7A 3N1AA 1UC5A 5T9CE 1P1XA 3VUPA 3O6AA 5AN7A 2Q8ZA 3AJXA 1KFKA 2VEGA 4PB4A 5I23A 2JEQA 6PTDA 2PTDA 3C2VA 3WK1A 4HU4A 1JF5A 4OV9A 3QY8A 3DHDA 1US2A 3UNTA 3TIMA 1EA0A 3L68A 1VIWA 5LKYA 4RR4A 1ONXA 1TQJA 4DNMA 4PMXA 3I6RA 3PZVA 2G41A 3JUGA 4ZB2A 4HYVA 3QXBA 1XW8A 1PX4A 3VIIA 1K4GA 1PPIA 4A21A 4L1XA 2GUUA 1R8LA 1UWQA 3W28A 5A94A 3N9KA 2WAGA 1CECA 1WXZA 3ARUA 4P8XA 5JU6A 1RH9A 1BYAA 4ADSA 3RM9A 1OFQA 4DJEA 4QAIA 2E28A 2XGZA 1FWHC 2PWFA 1K7EA 4QCFA 1TZZA 4C7FA 2Y5JA 1RK5A 1ZTVA 4P7RA 4DJEC 1BXCA 3BCDA 3RX4A 4AD1A 1C91A 4PBFA 3U6WA 4AQLA 1QNOA 4MGGA 2FPYA 2P8BA 3CAQA 3VI2A 4KS0A 1PO9A 1WYIA 4G6CA 2QZRA 2QJIA 2UY4A 3GHRA 2VXNA 5KETA 3K1DA 3M0IA 3W1UA 4NX5A 2GQ3A 5D05A 3LCGA 2WBKA 1CGYA 3GXNA 1AD1A 2UZ9A 3PJTA 3KRSA 1RA0A 3LXBA 4FNPA 1HF6A 3CLMA 4H41A 1G7UA 2Z26A 2ZVRA 3BLOA 2QR6A 2QCFA 4JEJA 4IFKB 1WPCA 4GUFA 2PBGA 4DM1A 5AZ1A 4LC6A 4AY1A 1W56A 4N4QA 2VVNA 3U8GA 1XIMA 1X98A 3LEPA 4MDPA 1RA5A 1R9YA 4NAFB 1GZGA 1JI1A 4IQJA 3OLEA 3KBJA 4BQ5A 4UC5A 1XH0A 1CLXA 4GH1A 3T44A 5DANA 2CLFA 1TE6A 3MBDA 1RBOB 3E96A 2Y24A 3KOZA 1NQKA 4CCEA 2WV8A 3NQ7A 3T2QA 3QHMA 1H7RA 2WJZA 5HNRA 2I57A 2C0HA 5FACA 3SECA 1ZBWA 2B7NA 1KV5A 3W01A 3V5FA 4LJ3A 3LHYA 4C6FA 4ICMA 4DZAA 1UKSA 2EPLX 1VRDA 3GVRA 3CQ0A 3HPAA 4JEQA 3S9IA 1E55A 3NG3A 1JDFA 1B90A 2YXXA 3QV8A 4BF5A 5D02A 3V35A 1RSCA 2VRJA 4JY8A 5LNSA 3LGEA 5G4WA 3GBEA 1EOMA 2G96A 1TVNA 2X7VA 5CPMA 1XKJA 4IM4A 3GG0A 2J13A 3VABA 2EKCA 2DSVA 1GW9A 3FS2A 3ISIX 1GEQA 1RHCA 3D6NA 3SFWA 3AISA 3I7SA 3EWXA 4JYFA 2E40A 1H1NA 3N3TA 1AQFA 1W2VA 1SQ7A 1DJHA 3TW7A 2PAJA 3AALA 1GWJA 2HZGA 5LIUX 1PAMA 2FDSA 3UZYA 4YXGA 3DFPA 3GKFA 3TP4A 4O15A 3BW2A 3RJXA 3EKGA 3DG7A 3JR2A 1WQ5A 4NYUA 1PKLA 2HROA 4F0LA 3THAA 5BXRA 3MB9A 1XDLA 2V3EA 3PUDA 3KRBA 4ASTA 2C16A 5F2MA 1OBAA 4QS6A 4RDZA 2KX9A 4OECA 3EWDA 4HT3A 4RV3A 2AMGA 2E5DA 5MKGB 2FB3A 1Z8AA 3IJIA 3VDGA 2E9BA 4S2CA 3MUZ1 3IIOA 2OZ0A 4GGHA 2PWDA 2ZUTA 1TPWA 2DT0A 1FWNA 3LGGA 5BWFA 4PSPA 2I7GA 4R27A 3HG5A 1F7BA 2OFJA 3IJDA 4O8AA 2QCCA 2XVPA 1LOLA 3ITOA 1E4MM 2FIQA 1XGDA 1I45A 4KH2A 2PTYA 3N3MA 3QTPA 1NY1A 2UY5A 1RAKA 3O9NA 2WW5A 2HBVA 4IMAA 2IPGA 1DJGA 1TPH1 3S42A 1GJUA 2BGSA 1DL3A 4LUSB 2XWDA 1UOZA 1WDWA 3VD3A 3CGTA 1KFCA 2E9LA 4ACYA 3N19B 2OWCA 4O50A 2ZUNA 5A8MA 3BLPX 1OINA 3VOHA 2NQJA 3WK3A 2Y5EA 1DHKA 2CESA 2GGEA 3MHFA 2PGWA 3U2EA 4N9EA 2AL1A 1WX0A 2VOMA 3RXZA 3V5OA 3MTWA 3I7RA 4TV6A 2W0UA 4F2BA 1TTQA 4A3QA 2A0NA 4RW5A 4KIRA 4YYFA 4DI8A 5A8PA 1IEIA 3E6EA 3CJPA 4CN1A 2XFYA 5M2FX 1SVDA 3P2VA 4TX9A 1TJPA 1W1YA 2QDHA 2V38A 1F5ZA 1AL8A 2E6DA 4N0RA 2DY3A 2PTXA 2V5JA 4AX6A 4BS0A 4CQCA 2TAAA 2G3MA 1WZAA 2W63A 2WK2A 1EYEA 2HVNA 4KKXA 2ASHA 1DP0A 4JTRA 3N6QA 5F4SA 3SRFA 1DOSA 3GFXA 1CXLA 1DIDA 1XLEA 3OBKA 5EKYA 1GOMA 2VEKA 4PRWA 4D6FA 4F0KA 3CXOA 1CXKA 2O4QA 3K13A 3R1ZA 4D2JA 3BH4A 2VQTA 2GDVA 1EKOA 3UWEA 1KTBA 3T07A 1G4TA 3VIKA 1H0IA 1OX4B 5HQLA 5XIMA 1K77A 5REQB 3ARPA 4PMRA 1XLCA 3MT1A 3CMJA 2J7FA 2CLKA 2H9AB 3IRDA 3PFMA 1R85A 4PCTA 4GYKA 1TUXA 4HCDA 3BLFA 4E8DA 4AXNA 3E3HA 1LLOA 4K2SA 4M29A 4NZ4A 5BOEA 1TZ7A 4IFOA 4L9ZA 1NOFA 4HTBA 4IX0A 4NVTA 2ZOXA 1T8QA 1VD6A 1TRIA 2G37A 3ZZ1A 3DHPA 3G0UA 4D6DA 1ELSA 1M41A 4ZOBA 3ALFA 3ZR4A 2Z1WA 4DYJA 3OW1A 5I0DA 4MKSA 4AD2A 2WVVA 3RHGA 3QQ1A 1VBJA 4MPKA 2VGGA 3EDDA 4LC8A 3NGFA 2E8ZA 1W9BM 4AHQA 1AH3A 1H2JA 5AYXA 3HF3A 5E0CA 3NL6A 2BGNE 3WNLA 3MBFA 3TYCA 3STCA 1B3OA 4D9PA 3EYPA 3SY5A 3AHXA 1QO5A 2HXTA 3T8QA 4MB1A 2QYGA 1EDTA 1YRRA 4I7UA 4HCLA 5CPLA 2X8RA 2ZA1A 1TPUA 1TPEA 1V5XA 2V3FA 3DI0A 3SY8A 3TAKA 4S39A 1XIGA 3WFLA 3LSCA 2FVKA 5IDIA 3INPA 1EP1A 1P0DA 3T9PA 3UW6A 2VZVA 1L8NA 4PMDA 3WJZA 5DN1A 1QHZA 2E1DA 4RXGA 2IMRA 2PDFA 3SCSA 4GXMA 3LLXA 1QOQA 4XV0A 3T2OA 3ZT7A 1A3WA 2FQIA 1XBXA 2XVLA 3GNRA 5BROA 5A6JA 2W66A 4BQ3A 2EPKX 4EF9A 3TLLA 4DUWA 2R94A 3LENA 1KRBC 1PZ2A 1TMQA 3F4VA 3PK7A 4MSSA 5B7ZA 4OKDA 2J27A 4UUIA 3NURA 4J3ZA 4W86A 2PU0A 6REQB 3SQLA 2ZX8A 2HCVA 1UZ1A 4LPCA 4ORIA 2ACQA 3CAWA 4S3AA 3CK5A 3P84A 5GNYA 4AIUA 2CNCA 3WKZA 5A6BD 4E3VA 4DF1A 3CHVA 1JNDA 1I1WA 1K1DA 4DY1A 2VC9A 3G22A 2CCRA 3H2AA 3WH8A 4REQA 1LTDA 2XISA 1PKNA 3QLDA 1F4AA 4UNKA 3SJNA 2I5QA 4BHYA 4QXIA 3VKAA 3WD4A 3SM0A 1Z69A 1IV8A 5I3FA 3G3DA 4PMQA 3GTXA 4LH8A 4BY3A 1HJUA 3DYOA 4QCEA 3N73A 4L56A 4R85A 2JKEA 3ICJA 3MKVA 3EOLA 3E2SA 4NAEB 1CENA 4DI9A 1JPMA 5HR6A 1BVNP 1CYGA 4AMAA 1KFWA 3QLLA 2NUXA 5CEWA 3EWCA 3BSHA 3OBAA 3C86A 2WJEA 3KVKA 1KTCA 3RDKA 2A6LA 3RN6A 1JR1A 2J74A 5HQMA 2OJPA 2Z1VA 3ZLHA 1WDRA 3VIGA 4X22A 4PBGA 1QPOA 1HKKA 2F2KA 4N6FA 3B05A 3GH7A 3Q94A 3R25A 3VCNA 2VEIA 3PG8A 3ZM8A 2JBMA 1NU5A 4H83A 4O0KA 3N2XA 1B9BA 3K46A 4TQTA 4LV4A 4GNKB 1VF8A 3KTXA 4GFIA 1UD4A 2Y7EA 1RZMA 4GRSA 3NQGA 2WZEA 4JTJA 4QS5A 3SGUA 4GI6A 5CZSA 1Q7ZA 3FX4A 3FCPA 2WYSA 3T1GA 3U0HA 4QHRA 2DORA 2J25A 1XSIA 3S1WA 3NJ3A 3WZ0E 3LPOA 1GVFA 1Q65A 1FFQA 1CGTA 4GXPA 3L66A 3ZWTA 1QO2A 3LBMA 4JY9A 4W88A 2X2YA 4PN2A 1WZKA 1TUFA 3ZJ8A 3B9NA 3GUWA 3QKEA 3DOPA 4E38A 3VZXA 1B0IA 1UIPA 2OG9A 3GDLA 3BPWA 3ABRA 2BGQA 1NOWA 5TF0A 4AF0A 4R9OA 4BA0A 3EWUA 1A5NC 4ZO6A 2E09A 3K2GA 4XZBA 1XFCA 4GD0A 3PN8A 1HO4A 5F1VA 3W38A 3SADA 1X96A 4CUCA 4D71A 2ZTJA 4H4IA 1GQIA 1YX1A 1YHTA 4X0NA 4H7VA 3HMJG 1H41A 1XQLA 5DX7A 3R94A 5FJIA 3QFEA 4NASA 2D0FA 3RGTA 2PRHA 1ZAHA 4XD5A 3II1A 4A8LA 4N6EA 4H7ZA 5BU6A 1GJWA 1ISYA 3IGHX 5FF7A 2ATMA 3M0JA 1FRBA 2QVNA 5LHEA 4HB7A 5ECVA 2AMXA 3LXCA 1UA7A 4PRRA 3W29A 5D9NA 4JIIX 1W17A 3CASA 3TYBA 1BWKA 2WJDA 1CLKA 3E0LA 3F5LA 3G1DA 4ZQNA 1YDYA 5I07A 3L4TA 3HPZA 3WH7A 3UETA 3BJSA 2QF7A 2GOUA 1ME7A 1MQQA 4QQ3A 5DMMA 1E0TA 2I5GA 2XM1A 3QTGA 4F66A 3L4XA 3PUOA 1IXQA 5C70A 5CCZA 1YKWA 4A6GA 1E4NA 4OBSA 1AH0A 3A12A 1CB7B 4HA3A 2V5CA 4XIAA 4DBSA 3EMQA 4O10A 3DIPA 2FGZA 4FNTA 1EC9A 1AQ0A 2YW4A 5C8BB 4M51A 4NQ1A 3UZXA 1P0KA 3WG6A 4U2ZA 3TR9A 2QCGA 4EXQA 3E0IA 3L23A 1S2CA 4DBDA 1L2UA 1RP9A 3ZSSA 2X2GA 1NTHA 1WBJA 4GYPA 1JXKA 1HKWA 5RUBA 1GQKA 4O0ZA 2ZUUA 4UQCA 2WM1A 1FWDC 1OHLA 3M7WA 3ITVA 3IK2A 2E5CA 4FXJA 1TWSA 4GYPC 5EBAA 5FL0A 5EMYA 3H2NA 3G1VA 5HAOA 3A5VA 1XISA 4TTGA 1MUCA 1NQ6A 2D0GA 2OR2A 4S1FA 4C7GA 3TW6A 3VNIA 3ZVHB 3PTDA 4RCXA 3UXIA 2NQLA 2VCAA 3IRSA 1J4EA 2F6UA 2QHAA 1V02E 3O6YX 2CLHA 4QJ1A 3MUIA 1WKYA 2RKXA 3GAKA 3SCQA 5CC7A 4PGLA 5K2ZA 3H53A 4C65A 3TC3A 3TNBA 4DAFA 2R14A 4BEQA 3B04A 1E56A 3N11A 5A3HA 4Z2KA 3RLVA 1ZBVA 1WXYA 3WIJA 2R24A 1DYSA 4ATDA 1KBIA 4AEOA 1VBHA 2D23A 4K8HA 4GVIA 4LSBA 3N2CA 2CZVA 2ZFAA 3VX0A 3KCJA 1IIGA 4O11A 2BVYA 3GU1A 1QNVA 4GX9A 5HUPA 3CQJA 3FGCB 4K3ZA 4UOZA 2Y88A 3LX9A 2DJXA 3VKBA 4DPQA 1OGBA 2YXOA 4H8VA 4C6MA 3ATYA 3P6LA 3F2CA 1XM3A 5BNKA 3I3DA 1P6WA 4Y9NA 3C2EA 4XZNX 3SFKA 1IT8A 7REQB 2KAUC 3WMBA 1XG3A 3FW6A 3THDA 1B3YA 5I79A 2ZTKA 3A3HA 4K39A 4UTFA 3PWIA 5C9WA 4WY0F 3L9CA 4DUOA 1WZLA 2W5FA 1T99A 4JTEA 5MF5A 4YVXA 1MW3A 4BKNA 3WQFA 4YHEA 4E8GA 4PCFA 1K9DA 4ZENA 4O1AA 3A4WA 4MFDA 1T41A 3LRLA 3GW0A 5LIWX 1K6WA 3C3UA 3WLSA 2A5HA 3K8MA 1ZAIA 1HJQA 2G3IA 3HPSA 1IEXA 5GJPA 4D6CA 1Q6EA 4N42A 1S2UA 1PB0A 2PRLA 5KZDA 4EVZA 2PBOA 2CPUA 2QIWA 2VR5A 2J77A 2BHZA 4EX4A 1VCFA 4A3UA 5AYZA 1W9XA 1VFFA 4LVAA 1XCXA 1MW1A 4TV5A 4EPBC 1UR4A 3MVIA 2WCGA 1L0PA 2HK1A 3AS0A 2FFIA 2O7SA 3D5HA 1E1CA 3B8DA 4WZHA 4UMAA 2DGAA 3L0NA 5BRQA 1T6MA 1FWSA 4O0QA 4B2DA 3UJ2A 3EA1A 4QROA 2FTWA 2PC4A 3UWQA 1V3IA 3AS3A 4F9DA 3KRZA 3ARQA 4FZIA 1R7AA 1JDEA 1KBKA 3A9BA 2DT1A 1JPIA 4DXKA 1GOOA 1BEUA 1REQB 4UIOA 4FO4A 4KEZA 1R9XA 4U5KA 1SW7A 3HGSA 1GCYA 1E6SM 2PURA 4H6QA 3U48A 1JGIA 1EGZA 3R0DA 4AYGA 1V3KA 3L5LA 4Q4KA 1ZAJA 4AMCA 5CBBA 1YQ2A 3FJ6A 1OX5A 4TVDA 1M7OA 1MI3A 2BB0A 1LRNA 1UP3A 2ZICA 2GDUA 3EEZA 3W88A 1ZSXA 4H8NA 3GIQA 4GY0A 3WENA 6TAAA 1S5NA 1W3LA 1ZHAA 2PWGA 2F84A 3O8AA 5AC4A 5KITA 4RV8A 4Q8QA 3DDMA 1NWRA 2PF8A 4M8UA 4BCEA 1AD4A 5D9MA 3VA8A 4GY1A 2XIBA 3GC2A 2TMDA 1R2RA 5G4HC 4FF5A 3EOSA 5F4WA 1L8PA 2DUAA 4GBDA 4Z2GA 5GPRA 1P7TA 4V28A 1R30A 3FDGA 3DAQA 4L4LA 2Z1XA 3UPBA 1DJNA 3MDWA 2QKFA 3VE9A 2GWNA 4B3ZA 1LWJA 2C18A 3ZLGA 3KS6A 4TVUA 1Q6OA 3OZPA 4MNJA 1W1A1 2DV0A 4R7WA 2INEA 1A80A 1A5CA 4QITA 5EMLA 4MYXA 2DPEA 3WLRA 1HXJA 1NIUA 3WUBA 1XV8A 1KQZA 2OT0A 4F0RA 3H8AA 1U83A 3AYTA 1A5AA 2WVTA 3TVAA 1H4PA 4CCDA 1JIBA 2X1UA 3W7CA 2DT2A 5AYIA 5AVHA 4HMDA 3OLGA 2G4FA 3W27A 1UP0A 1FWEC 3RYSA 4EWND 1JDAA 4W84A 4CEXC 4KMQA 5TIMA 3WF2A 4M56A 1EC8A 4I6KA 1WKFA 2QDGA 2A85A 1NFPA 2V82A 3ZO9A 3XINA 1KBLA 5CG0A 1LT8A 2NQ9A 4KETA 4JTTA 2ZKMX 4OT7A 1LORA 1IWAA 3HJZA 5HNUA 1IWBA 2OKTA 2CFFA 3S2NA 1Z44A 3T8LA 1H1YA 1EPXA 2ZDRA 4ATWA 1B1YA 1YXCA 3AMLA 1OK4A 3H4WA 1Q7QA 1XIIA 2I1OA 3TZFA 3VUSA 4U28A 2WSQA 4QG9A 2E67A 1X6UA 1E9LA 1X6LA 2J8TA 4P8VA 3WD1A 2YR1A 4H6EA 3S5YA 3NTYA 3K1GA 4P7LA 5M5DA 2ZXDA 5AVNA 3ZWSA 4ZSUA 3UR7A 3LS9A 4UQDA 1X97A 4NT0A 4XIMA 3WCZA 5JIPA 1Q8AA 2WC4A 4I6VA 3AICA 1GVIA 3QOMA 5ABEA 3UY8A 3BXWA 4JQ4A 1J0IA 4HMNA 4TU1A 1QFEA 3ITGA 3QZEA 3O3RA 4W7VA 3FV9A 4NAFA 1BKSA 2F61A 4XZHA 4ALDA 2X1RA 2VC6A 4ZE4A 4C5ZA 4O57A 2QMKA 1E71M 4EK7A 5A8GA 3BV4A 4RPPA 4UCFA 2IKHA 3ITXA 4DF0A 3W1AA 5BRBA 1VFHA 4XSMA 1YPFA 1S2TA 4B5SA 3CZLA 2WXDM 1PZ1A 1Q85A 4YCOA 4UR7A 3FA4A 2YL9A 3QC3A 5HWNA 4PMOA 2VL4A 1NAL1 3JS3A 1PUDA 2AKMA 2FGLA 4C6KA 4WJEA 4RPQA 3TXVA 3W7RA 1ICPA 2WSKA 4KPLA 1UD2A 4N7QA 4P8WA 3BTNA 1SW3A 1S3TC 2VZUA 3P0XA 3VCRA 3W3OA 3EKLA 2NX9A 5I7GA 4LANA 2P3EA 2V2DA 2V81A 4IJRA 3UZWA 5CZ0A 1XH1A 5HDRA 1EJTC 2PTWA 5AYBA 3VNMA 5G2IA 3MS8A 2VOTA 2YYTA 1O95A 1QNRA 4RX0A 5F7UA 1XLIA 3MO4A 1J01A 1I0DA 2P0OA 3E0VA 4MJZA 3WMLA 3WF4A 1IWPA 5KZMA 3AMKA 2DP3A 2PWEA 1MDLA 3VMNA 3V0TA 1E5NA 4D8ZA 4G5DA 1UPPA 1R2TA 1DORA 4ZQPA 3ENLA 4H19A 1GORA 2Z7KA 2CZEA 1CPUA 2I17A 3ZLFA 5HJYA 2PDCA 3GHUA 2RDTA 4JGDA 3WNPA 3O63A 1BGGA 2DUZA 2PLJA 2TPSA 1OG6A 1Q2RA 1WXJA 4XAFA 4PB5A 3LMYA 3I4KA 2BXVA 4PUDA 2NQHA 3IEBA 4H9MA 4QJ3B 2PD9A 3KUMA 3V7PA 4V1YA 3B97A 4E2VA 3MMDA 1YTDA 4F2TA 4WSKA 4Y8EA 3GH4A 3GHSA 2BBFA 3VC5A 1Z48A 2GFTA 2ACRA 1GOKA 4NNBA 1BHGA 1GNXA 2WLYA 1EWEA 1FHDA 3ARTA 3OZOA 3S1XA 1PX3A 3FVMA 2HS8A 4DNHA 5EY5A 3OTRA 3GM8A 3FHQA 4YVVA 3POCA 2CBJA 2PU1A 1G4PA 3RX2A 1JZ6A 3DENA 4ZQMA 3NGJA 2Y63A 5C2CA 4JFTA 2P53A 3AYSA 2J6VA 4LUSA 1RXOB 4IQLA 1KFLA 3N14A 2VO5A 1MQPA 3DHFA 1QR7A 2WSYA 2YCEA 4IGMA 3KM8A 5A2AA 3ARRA 2NLYA 3AXMA 1QCWA 2Z00A 3U9IA 4O1EA 3TXZA 3UVIA 2QGYA 4QNWA 2WHLA 1JZ2A 2PDUA 4NY2A 4AZIA 3G77A 4LGXA 1MUMA 1HL2A 3VIPA 1RVKA 1KXHA 1UD3A 1G69A 1UH4A 2O7QA 1Z89A 4HNVA 1XYBA 2REQB 1J93A 3STEA 4K6AA 1JCTA 3EXSA 4UTJA 3GG1A 5G2WA 4IQEA 4QDWA 1S1RA 3AO0A 1IEWA 4W5ZA 3M44A 3TSMA 5I6SA 4US6A 1N8FA 5CLTA 2DZBA 1DJYA 5EU9A 1PTGA 3HOJA 3VD7A 3JZEA 4IIHA 4K8EA 1ZQ5A 4FIQA 1FA2A 3TCEA 2Q8XA 3DECA 3RCNA 4KBXA 3PB0A 3WL0A 1T7LA 1FWRA 1DVJA 1OX4A 1R0MA 5FSEC 4DJDA 3S6DA 2CLLA 3N18A 1WE5A 5REQA 1M6JA 5HK4A 4ZVJA 2VGIA 1CNVA 3CV1A 2H9AA 4AB4A 5EBUA 2DH3A 3BE7A 4DJDC 2NUWA 3H4GA 1H49A 2WPGA 3RRAA 1A5UA 4FR6A 3W7HA 3QMTA 3E74A 3MQTA 2BNJA 3LU2A 3VNKA 2ZYFA 2C3ZA 5EFDA 1TQXA 4R7OA 1FCBA 1W6TA 2HEJA 2D20A 1TWWA 3ZXWA 5FL1A 3IS4A 1NOUA 1NWSA 1LL7A 1TV4A 2R82A 3ORWA 4GZIA 4L9XA 1TREA 3NPWA 5C55A 5EA9A 4Q8WA 4AWSA 4YIWA 4PUNA 1QUMA 3C4UA 1OM0A 2I5IA 4AU0A 3ZJ7A 4LUIA 1DJZA 5E09A 4WRHA 1FWFC 1DE6A 2C19A 4FALA 4CD6A 3EPOA 3MU7A 3OVPA 4QE1A 1MMFA 2ONEA 1HL9A 3N25A 3NA8A 1W91A 4ACZA 4FXSA 2ZIDA 1ENUA 4Q8VA 3VU2A 3WDJA 4HNUA 4YWIA 4HQVA 1E6QM 1UASA 3PZUA 2J7GA 4HNOA 5EB8A 4E3TA 3WNNA 4WDXA 1Y0EA 1AW5A 3IV8A 4MWAD 5I3HA 5I3JA 2HQAA 2VKZG 3H2FA 2HISA 3EX2A 4FA3A 5CSRA 4JX6A 1C93A 1Q4WA 1V6VA 3W1RA 4V1XA 3WFAA 1Y5XA 4GVGA 4WKFA 3WLTA 2WVSA 4BFAA 1K7FA 2FZDA 4MWAB 4ZTXA 1VS1A 2RDXA 1IZJA 3DERA 4JQ1A 1OF8A 2Z2UA 1FTXA 3N12A 3P5ZA 3U2OA 1VFUA 2PP0A 1Z41A 1XRVA 3VD9A 5C9UA 5AHIA 4ZB0A 3RF9A 4K37A 6REQA 3SUSA 3B9OA 3W6MA 1RR2A 3FJLA 4XQ6A 2YJQA 2E6AA 5D37A 3UJEA 4J3WA 2J79A 2QJHA 3VDAA 2ZRZA 2YZ5A 1JCYA 3LI1A 2I14A 3UWVA 5FA5A 4JOMA 1WA3A 3IIPA 3EA3A 3M07A 2AL2B 3E2QA 2XDFA 3WDRA 2XWEA 3DYPA 1H5YA 5CGMA 2UWFA 1MXSA 1LLZA 5A6BA 1OCNA 2V30A 3KDNA 2C14A 4H6RA 2QW5A 2YA0A 4NRSA 1ADDA 5AZ0A 5D9PA 2VX7A 3GR8A 1L6FA 3TTEA 4MB4A 3BMWA 4FXFA 1D3GA 3DCPA 4F8XA 3GE7A 5LA2A 5FF4A 2HBXA 5ABFB 3S6OA 4CCZA 4M80A 3DN5A 2R1KA 1UOKA 3WBWA 3U5UA 2VFGA 1P6CA 2ZXQA 4H04A 3W73A 2FMOA 5DQPA 3W7KA 2QCHA 4IGSA 2I9EA 2X16A 4ZL1A 3QVQA 1ZY9A 3DESA 3KW3A 3OA3A 3HBLA 2HMCA 1QPNA 2A3HA 2ABBA 2WKJA 4OIFA 2QDEA 3H26A 3W24A 3M46A 3P74A 3LTYA 4K8GA 3HQ1A 2P3ZA 5D33A 2DZUA 3C2YA 4C6NA 3TN3A 3OIXA 3WNKA 3UXAA 3PNZA 4AZHA 1LJYA 3XIMA 2Y1HA 3AIUA 1E0VA 3POHA 2VM8A 3AOFA 4Z0SA 5E6YA 3MYPA 2ZUWA 4LS1A 1ESWA 2VDHA 3FJNA 2POZA 3OVGA 1JF6A 3EMCA 1FKWA 3ANUA 3GU2A 3AJ7A 2ON3A 4IMEA 1AQHA 2VWTA 3BVJA 5LGXA 3U4FA 2GJLA 2A3AA 2WC7A 3UP8A 4NNCA 3IARA 3A6OA 2IKJA 4JS3A 3E38A 3AXKA 1BWVA 3A64A 4KQNA 4AFYA 2E7FA 3VX1A 4QGCA 2D2HA 3LI0A 4AD5A 3IUIA 4ATLA 4RUBA 2WWCA 1Z32X 3IGXA 4MG4A 2WNWA 3GDBA 3VDHA 4GINA 3W2KA 1XUUA 3NO5A 1X8CA 3R7MA 3WX7A 4XVDA 3SRKA 5KZEA 3I3EA 3FFSA 2QCDB 1A49A 5GVJA 2WCAA 1G4EA 4KRZA 3QV7A 1VPQA 3MUXA 2OWWA 2B7QA 1OK6A 3FAWA 1QXLA 1SZGA 5AC8A 4AAJA 3RMJA 1YLVA 1Y8BA 2Z0IA 3V75A 2C79A 4IIFA 2E9MA 3V0UA 2DIEA 4IISA 3SI9A 3NEVA 4GY7A 1YE4A 2QV4A 2RHGA 4M5PA 3NVTA 2WNZA 5DBTA 5FF2A 3K5XA 3RPMA 4GI4A 4CCCA 2VX6A 1YBQB 1EF3A 1D2KA 4RNJA 1VJIA 4AYSA 4Z08A 3P62A 1EJVC 3AUJA 3C61A 3DFHA 3QBUA 1TWZA 3TE9A 2ZRXA 4QIUA 4HPNA 4LAUA 4F2UA 1WAUA 2RJHA 3PF3A 2BG5A 3BAXA 5CLWA 2YSWA 3VGEA 4ZA0A 2YBVA 1EJ7L 2YGYA 4RE0A 7PTDA 3GRIA 4GOAA 1WNOA 4JBRA 1XPYA 1PDZA 4MUPA 4OGZA 4JTSA 1J0JA 4HA1A 4S3CA 5FJOA 3SBFA 2P50A 1UKOA 4C6PA 2INZA 3GXMA 4PEKA 1UJQA 3A23A 4L5ZA 4WSHA 3GXPA 1FWTA 1VPYA 3UR8A 2C8NA 3EWZA 1QPRA 2FZ9A 3C56A 3WJYA 1JZ5A 2D24A 2OSWA 4PZVA 3QYQA 4LB4A 5IBXA 1KLZA 4WIWA 1VEPA 4GCXA 4XTDA 2Y62A 4F0SA 3VNJA 3TCSA 3NYDA 3F2DA 1B54A 3A4JA 4YTRA 2X05A 1KCKA 2JGYA 2NT1A 4DZ5A 2IKIA 3GNDA 5IBXC 2CYGA 3C8FA 1M7JA 1PE1A 3F4CA 3L4ZA 2PGFA 4HNCA 3SIZA 1C29A 5G1MA 4YYCA 1UR2A 1XYLA 4GBUA 2PRMA 3CHFA 5TQLA 5D09A 2PDXA 5C0QA 3WDPP 2HWGA 3AROA 4WK9A 3AS2A 1QNSA 2PDWA 2OGYA 4ZFMA 1MXGA 3VNYA 4BWLA 2Y7GA 2PDBA 3G5EA 1D8CA 1YNYA 3FOKA 1J12A 4BI5A 4C6OA 2XFRA 2EKGA 1SZEA 4JZ5A 5JH2A 4XO6A 4JTGA 4FF7A 2EG6A 5E6ZA 4BWLC 1OQFA 3L5MA 4B3LA 3GDRA 2JKAA 3W9ZA 2VP8A 1P4CA 3UY7A 5MHBA 2CHRA 3RU8X 2QCNA 3CPRA 1KB3A 4HCHA 1KWGA 4L1GA 2Y5SA 4E5TA 1DWFM 2GK1B 3K30A 3BSMA 5LIYX 3HJEA 4NKCA 1ZLPA 3WLQA 3TONA 3VOCA 3VNDA 4L6DA 3FGCA 2XZ7A 4NHVA 2TODA 1EJXC 4LYRA 4PEEA 1PV8A 4IICA 1O4UA 1ZBKA 3A5FA 5FJTA 5HOSA 2Q01A 3GC4A 1KGWA 4W93A 4E2OA 2IUZA 2WHKA 3HPFA 5HUOA 4A2RA 3BO9A 3SCUA 4XG1A 5JBDA 1FWWA 4LBUA 1TKKA 3PM6A 4LBSA 2PE4A 4I9JA 2G3FA 1FOBA 7REQA 1JI2A 4GUJA 1OFAA 4NL1A 2IQ0A 5EYWA 1UUQA 3AQUA 5FOOA 2BFGA 4A8IA 2PFHA 2OOFA 4GKTA 1XIFA 4YTTA 3K4DA 4GYJA 5I06A 3KVLA 3PBGA 1EL3A 1PYMA 3AIVA 3PG9A 1TTIA 2JIEA 1NDYA 3L4WA 1I60A 2B7PA 1E0UA 2MANA 2WJFA 3T05A 3W1XA 1EEXA 4JX4A 2D2OA 4Z1CA 4FMVA 1VH7A 2BV9A 2JIWA 3VCCA 1EDQA 3BOLA 2YB1A 1K7XA 3TR2A 5A1AA 4CD8A 1SJBA 4TR9A 8CGTA 2A3EA 2Y8UA 3G6LA 1E5JA 1ZS2A 1C8XA 4NILA 3U2ZA 3WYZA 3BAWA 4HGXA 5LYRA 3UGRA 1FP8A 3GLCA 4BJHA 4HU8A 1L2QA 4XWUA 2AQWA 1TELA 4TXEA 3GYEA 1SO3A 4GABA 1UKQA 3OGSA 1DHPA 4H1ZA 3IVSA 1CWYA 3WMCA 1SPQA 1JDCA 2OSXA 4C1LA 4KWWA 3KTCA 2ZADA 1K9TA 4QM1A 3B40A 3VE7A 4EAYA 2PDIA 1B31A 3GXIA 3LCWA 3STFA 1OZQA 2QAPA 3W86A 4CNUA 1YIXA 2QUVA 4FOUA 3TSBA 1MWOA 3NCOA 5FCZA 4JIHA 4RNIA 4Q22A 4JX5A 4UB9A 3B0XA 2VX5A 2FVLA 3G8EA 3BCFA 1QNQA 3RK8A 1REQA 3ANVA 3ITLA 3BK0A 3EX4A 2IS7A 1UKTA 3B0UX 1NVMA 2XVKA 3MANA 4ZOEA 1W9UA 4AVOA 2QJMA 5KTLA 4QRNA 4G56A 3HO8A 4M19A 3KP1A 5GNXA 4HZ7A 3QPZA 1RUSA 3QPEA 2ZRYA 1H62A 4ZZ9A 1F73A 5HQEA 3W7NA 3WUFA 2NXHA 3H2CA 1BSIA 2WCSA 4N9BA 4A8RA 1KM5A 5H6HA 1M03A 4P2VA 4K7YA 1UR9A 3RCYA 3W81A 4CNOA 3LRKA 5D9OA 3KRUA 1E6ZA 1NH6A 3CMFA 1A5SA 1RK6A 2WQPA 4WF7A 1OG0A 1V3HA 4N9DA 4Q4SA 5CKSA 3RLHA 3W2MA 1EJSC 3G2GA 1VHCA 4QEHA 5I24A 4BI6A 1HX0A 1VFTA 1PVNA 2VFDA 4PL1A 1VEMA 1W1PA 1I2RA 4FOKA 2NUYA 3R43A 4LS2A 3R89A 5HNTA 2FLIA 5AHFA 5K7JA 3T0CA 2CHNA 1HJWA 5DXYA 4RKAA 1FWCC 1OFPA 3SQMA 3R12A 5D2TA 4JYEA 1H5VA 4AZ7A 4NXKA 3ONBA 4R88A 4K1GA 3EWYA 2XSAA 4MZYA 3DUGA 3ZYZA 4LT9A 2O4MA 3L2IA 3TTOA 2YFOA 2DVTA 1SFLA 1RPKA 1PZ3A 3N9SA 2ZBTA 3OODA 3VKDA 1J79A 2YDQA 1JPKA 3IGSA 1PS9A 4OOZA 3AIBA 1GQLA 1ML1A 3LNPA 1OT1A 2ZA3A 4HD5A 2VFIA 9RUBA 1J0YA 2YCLB 5LA1A 3MHUA 5KZ6A 4BZYA 1D7FA 4QDMA 4Y8FA 1K8CA 3U7VA 4V15A 1SSDA 4AD0A 2O92A 3CZJA 2WWDA 4DN1A 4CNSA 1HIZA 4PMYA 3HG3A 4KFOA 4W8LA 3UWYA 1R6WA 4MFEA 4ERIA 3CEPA 3PZ9A 3VKCA 3VIHA 3P8IA 4AWTA 3GZAA 5F2LA 2X30A 4TOQA 1RJPA 2QV5A 2P8CA 3I4EA 3WUEA 4JHMA 2X1SA 4X61A 3M5ZA 3NSXA 1P0NA 4H2CA 4H9UA 1HKJA 1TJ1A 1X1ZA 2A3CA 4UZUA 1BRLB 3T4CA 1JUEA 5G5IA 3QY6A 4GZEA 4GQ0A 4K1WA 2XH0A 1H61A 2BP1A 4RZBA 1W1IE 3CU2A 3OVRA 4OZOA 4IOTA 2BS9A 4IG2A 4BF9A 1ZU8A 4PTMA 3HURA 3PPGA 1UA3A 4NP7A 2WB5A 3D3FA 3JZUA 1M3UA 3GWQA 3CWOX 4DO5A 1WKEA 3P0WA 3P7YA 5TNVA 5A69A 3AU6A 1UZ4A 1OT2A 1SZFA 1TPVA 4Q4MA 2E77A 4B2DD 2Z7GA 3A9IA 5D04C 2WHMA 1E70M 2XIJA 3GK0A 2OZTA 1OCQA 4DEFA 3DBPA 3CUXA 2XVNA 5C2XA 4FI4A 4GVHA 3WQWA 4NJHA 2JFEX 1PKYA 1UQZA 3GDTA 3PVFA 5D2VA 4WVXA 3M0YA 3COTA 1WAWA 3BGJA 1RV8A 1EXBA 4YHGA 3W1LA 3EWWA 1C92A 3BURA 3MI3A 2ZE3A 3BICA 4S2BA 2AOSA 1QI4A 3W74A 3LD5A 3CM4A 3EOOA 3KBNA 3NEHA 3R0KA 4B5NA 3KVJA 3LHTA 3VM7A 3LCHA 5DO8A 4HMCA 2RFGA 1O5XA 2Z2AA 4ORMA 3UJFA 1XL9A 3WELA 4DWDA 5ENLA 4YS1A 3GX9A 5FD0A 3DH7A 1NF0A 3JRKA 2FTYA 3LN3A 5T9BG 2CHOA 1XLMA 4KEMA 1GKQA 3KCOA 4C6EA 3SCPA 2AGTA 4KEVA 3IJ6A 1LQ2A 4GX8A 3VIFA 1OC6A 3Q2DA 1NDZA 1TCMA 4K36A 3IUDA 5M03A 3Q37A 3W82A 1ITXA 2J75A 3S5OA 4QSHA 1KRAC 3W6YA 2HTMA 4O16A 4YVPA 3RR4A 2F6KA 1R3SA 4WR3A 4PE8A 2W3ZA 4QJ5B 3M0HA 3WNMA 2HPIA 1G94A 2WLZA 3QZAA 4CQAA 5M17A 3VMOA 4TMBA 4XBSA 3G1XA 1E15A 2NQZA 1TCDA 4IH3A 3KDOA 1QT1A 3GVGA 1UYQA 4DBEA 3NQAA 1GYMA 4Y9OA 3BGAA 5GNZA 1C9WA 4FHAA 4XK2A 4E4UA 1HKVA 3PULA 1B4EA 3FDKA 3GR4A 3CYJA 1ZJAA 3UCCA 1K9EA 1GOIA 3WH5A 4F40A 3UFYA 4ZOCA 3M5XA 3L7RA 1TV8A 1UD6A 4W7UA 2Z6IA 2YCKX 4GQGA 2XFFA 4GI9A 4JFWA 4QEEA 1OFRA 2OLHA 5FJRA 2PUZA 1OCJA 3CLWA 4XAGA 1V6YA 4QLJA 4DYEA 3B9EA 2ZX6A 1QRQA 1IF2A 3KBVA 5LNUA 4PTWA 3ZSTA 1GOXA 5A6LA 2Y8VA 4BK9A 2XIOA 1W3TA 1F4HA 2GPTA 5I2UA 1M7XA 3CIXA 2REQA 3UBPC 3RCMA 4YCPA 1AZ1A 2XU2A 3CTLA 1B3WA 1VP5A 3BQ6A 1R7OA 1MO0A 1U5VA 2V67A 1LL6A 1S39A 3CO4A 3W0KA 4AZCB 3VINA 3IUHA 3UU0A 3TWAA 5C6MA 3QHNA 2NQ5A 1FBAA