3W7MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-3-063
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-063
rcsb
source organism Trypanosoma cruzi
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7mA01
4RZ6A 1S5TA 4IMCA 4NJGA 3NQ2A 3MHUA 4M7TA 3HGJA 3E0IA 1FUYA 2Q3OA 2QAFA 4FX6M 3EX2A 2Y63A 3SW6A 4AF0A 1ZFJA 4O1AA 1W5PA 2W0UA 1JCMP 3DKLA 4A3UA 1MEHA 5CPNA 4HSOA 4MOZA 5FEXA 3V75A 3W2LA 1ZJIA 2FPVA 3TXVA 1VGAA 1OK4A 5G1TA 1DQXA 3LLDA 4JDYA 3EWWA 2E6FA 1JCXA 4IXHA 8TIMA 4C1LA 3UWUA 1LRTA 1EB3A 1OYCA 4IPIA 3LHZA 1PS9A 3G0UA 5K4XA 3PM6A 1TB3A 3AO0A 4O15A 3ELFA 4ONVA 5D2YA 1T96A 3NL2A 3LCXA 1T0OA 1VRDA 4AWTA 1K8YA 1C9DA 5HJLA 1B4EA 1YTDA 1A5AA 4TIMA 1NF7A 3M9YA 5AHMA 3H53A 5CPMA 3BGGA 1YLVA 2ZRZA 3G1YA 1SR9A 1DJQA 3TFCA 4JTKA 2Z6IA 2DZVA 1OFRA 3LCGA 2WV8A 4NUWA 3RFAA 2CZFA 3KVJA 3HQ1A 3P60A 2B7PA 2TPSA 3EXTA 1LBLA 2BZNA 2YW3A 3F1QA 1MO0A 1JR1A 1XBVA 2ZRXA 3TXZA 3CU2A 3U8GA 3G3DA 3BG9A 3UWQA 1K7EA 4MYAA 1P1XA 3MYOA 4ZL1A 3ZR4A 3KVLA 2ISWA 2E6YA 2H3DA 5FEZA 3M1ZA 4K36A 4JY9A 2F7FA 3ABRA 3NQ6A 1ICQA 3W7GA 3G3MA 3PC0A 5D2TA 4Q4KA 1H5YA 4NXSA 4NJJA 3QQ1A 1EX5A 3LHVA 1WYIA 1M6JA 4MJMA 3K30A 2ZZ7A 1SQ7A 5AHFA 1FY6A 2E1DA 4EOUA 1KFEA 1CW2A 1LCOA 4JDBA 3IGUA 2DZUA 2VEMA 5GVJA 1H63A 4WXYA 2E68A 2Y85A 3LM7A 3HIJA 4O16A 1WAUA 4UTLA 3OVPA 4RZ5A 4BK9A 4IJBA 2GJLA 3P5ZA 4KWVA 2CLFA 4JR5A 2VEPA 4WD0A 4HHPA 3BARA 2B0MA 5BNKA 1ZAHA 3L0GA 5FF3A 3NDOA 3C6CA 3NQFA 2PRLA 1LLZA 4Z0SA 4JEQA 2FPYA 3GR7A 3PWAA 2NUWA 3G1VA 3I68A 1E51A 3BV4A 1JRCA 1S5VA 1GG1A 2YDAA 3GDKA 3L68A 3GAKA 5BRBA 4IOTA 4JYFA 4WQ6A 2CLHA 4WOZA 2R94A 3UZJA 3R13A 3CLMA 1J2WA 1GTEA 2RFGA 2VFDA 4FEZA 2BTMA 4LV9A 3W74A 1UJPA 3QYQA 1QFEA 4QNEA 2V5LA 3LI0A 5LHFA 3G1SA 4OWGA 3DAQA 3QC3A 4WX2A 2Y61A 1GJPA 2GQ9A 3LI1A 4AB4A 4UTMA 3G0SA 1B9BA 5AOUA 1Z42A 4AMAA 1OVDA 3W7DA 2AAMA 1TJRA 1VHCA 2R91A 1Q3NA 4J9JA 3DZ1A 1ZY9A 3N9SA 1YPFA 1DORA 3EXRA 1QO5A 4DO5A 3M43A 3B0VC 1I2QA 2QCDB 2QEZA 4LS1A 1OYAA 3WJWA 1KM2A 2YCEA 1LRQA 3OIXA 1X1OA 3A21A 3DFOA 5HULA 4ZQPA 2V2DA 3L5AA 3NM1A 3QM3A 4IQLA 4PEKA 3ANYA 2JKPA 4LVAA 3GDLA 3O16A 4FIQA 2WNNA 3JRKA 3FEMA 3IV3A 5LSMA 4O1CA 5DBUA 3LTSA 3G1XA 5A8GA 2NLIA 1C29A 5CG7A 2CLMA 4P2VA 3QPYA 4UR8A 3FLUA 4TO8A 4K8EA 4E2BA 1B57A 2NWRA 2ISSA 2X1UA 2VOMA 1NEYA 4WJEA 2NXHA 3QJAA 1PV8A 5CZJA 1Q6OA 3O06A 4POCA 4E0CA 4Y96A 3PUDA 2QCFA 3W7OA 3ABQA 1FXPA 2I9EA 1HO4A 1XDLA 1EIXA 2ZA2A 4LVGA 4CNPA 3DI1A 3BW3A 5FESA 1IF2A 4JS3A 5U4NA 3W7PA 2QUUA 3TQVA 1FCUA 3GDMA 1SSDA 3TX9A 2NUYA 2ZBTA 4M5PA 4RJEA 1QAPA 2HTMA 3EEGA 3W1NA 1MXSA 3QQ0A 4FNPA 3AJXA 4KFNA 3W6YA 4OU1A 3C2EA 1AL8A 4BWLC 3KFTA 3NL6A 4Z0JA 5HWMA 4LVBA 4U4MA 2NX9A 2WSYA 2VKZG 1GVOA 1TV7A 1JQVA 4QISA 3GIYA 4UTWC 5LNSA 4MYXA 5I3JA 2YYTA 1SUXA 1F6PA 3UNDA 2WNZA 4Z1AA 5F4SA 4XKYA 4N9DA 5E0KA 2WJZA 4HKPA 5HMSA 6TIMA 4JX4A 1K3UA 5KITA 1EP3A 2ZZ1A 3O05A 3C2OA 1NFBA 5D2WA 2GPTA 2DZTA 1TTQA 1LOLA 1JCNA 2Z0IA 1IXQA 3TFXA 1GVQA 3CPRA 4MLRA 4MY8A 4JICA 3STFA 3PAJA 3LX9A 4K8HA 4NVTA 2ZDRA 3KAOA 3MP3A 1JUBA 4MZ1A 5DN1A 5SWUA 3NEVA 4NX5A 5CSRA 3DH7A 4GBUA 3B8DA 4N9EA 3M47A 4DBDA 1KFJA 4UFKA 1EWDA 5K2ZA 1P5BA 1A5CA 5EYWA 1JUKA 5D05A 4CNNA 4MZYA 4IMFA 2CLEA 2E6AA 1LYXA 2Y70A 3O07A 3GDRA 2ZA1A 2H90A 1RD5A 3EXSA 4UTTC 3TK7A 1Z48A 3DFPA 4LC6A 2Z2UA 3PR2A 3EX4A 4WXZA 3OEXA 1HFBA 3GAYA 1F05A 2ATSA 2VEIA 5J5DA 1S3HA 1DBTA 5C54A 4BI6A 4ZMGA 4R34A 5F2LA 3W23A 3M0ZA 3HG5A 4O17A 2YR1A 4AF0B 2E5DA 4IGHA 2E77A 1D3HA 1KV5A 1OABA 4N9BA 4Z1BA 1AW5A 3S42A 2Z1BA 1RZMA 2RH9A 4JIQA 1EEPA 3C0JA 4JX5A 3G22A 5FEWA 4DF2A 1RR2A 3TQKA 5BMXA 3UPWA 4RLIA 3PG9A 2ATMA 3TR2A 1DJNA 2OJPA 3I65A 3C8FA 3THAA 5CPOA 1TPFA 4LT9A 4OV9A 2V82A 1T8XA 2WOQA 3PS7A 5DLCA 4O4WA 1UBSA 4QITA 4K37A 1XCFA 1B3OA 1G7VA 3UY7A 1FCVA 4LY8A 5G4EA 3BG3A 2J9XA 5FF4A 3NQEA 4I7WA 1K8XA 3FJLA 4O1DA 1TPWA 4UFIA 4LVDA 4BI5A 5BMWA 5I3IA 1KM5A 4JTEA 1WBJA 3IIOA 2FIQA 4RV8A 2ZRVA 1BWKA 1BEUA 1H7RA 3I7RA 2WKJA 3PUEA 3N34A 2JK2A 4AXKA 5KZDA 2R14A 5G4WA 3W1LA 1Q6LA 2DJLA 3RNDA 2A1YA 4IMEA 3LHTA 2OT0A 4ADTA 3O63A 2EKCA 2QR6A 3TC6A 4PH6A 4DXVA 4RCXA 3DXIA 3DGRA 2CU0A 4CCDA 2G95A 2V30A 3JR2A 5FF2A 3CWOX 1RV8A 1L6WA 3NQVA 5HWNA 4IX2A 3L9CA 1PHQA 3UD6A 4MFDA 3TUUA 1Q45A 5KZMA 5IM51 4O52A 4LV4A 4O11A 1VCFA 2O7SA 3DFQA 2VELA 1D9EA 1XKYA 3JS3A 4DPPA 4GC4A 3TA6A 3E02A 1WOBA 3KX6A 3HGOA 3NQMA 3TW7A 1DQWA 1ADOA 1SW7A 4DF1A 3I6RA 3A24A 3H54A 2QAPA 4I7VA 4A2RA 4PCFA 3W9ZA 2JGYA 2OT1A 4TU1A 4OE7A 4DQWA 4A2SA 3TDFA 5D02A 1R2TA 4BFAA 1IXNA 4OQVA 4FNUA 3G0XA 2V9DA 1EWEA 1LOSA 4JGDA 3EWYA 2Y88A 4Z08A 1I2NA 3TIMA 5DY2A 2EGZA 1YXYA 4LUIA 1W5OA 3BVJA 2OX1A 4YL2A 3PUOA 4Q32A 1AW1A 4OBTA 3OA3A 5KMYA 3S5OA 1VC4A 1KM4A 2UV8G 4RXFA 2PURA 4AH7A 1UUOA 4EIVA 1I45A 2E6DA 3DKJA 1THFD 4GFSA 4LVFA 5DBTA 2ZCGA 2G97A 1VCVA 3HPXA 3E49A 1QOPA 2CFFA 3M7WA 1LZOA 3CIWA 4XBSA 1QR7A 3R89A 4NNAA 2ABAA 2DZPA 3GX9A 3CWNA 1FDZA 4S1FA 3OG3A 3MYPA 1FX6A 4IWWA 3STCA 5BW6A 1H7PA 5G2HA 1DOSA 5E93A 1A5SA 1XDMA 1Q6RA 2NX3A 1TRDA 2O7QA 1M5WA 4GWEA 4O57A 1KFBA 4XQ6A 3GXNA 4Y8FA 3M41A 4MY1A 1VLIA 4O14A 3C61A 3DFTA 1O60A 3SFKA 1K03A 2ZZ3A 3BO9A 3QMTA 2ZA3A 2QUVA 4O4VA 2J27A 2ZRYA 3U6WA 4HPJA 4ZQMA 5C5YA 2X1RA 3T7VA 3NQ8A 4ADSA 5I3HA 4JTFA 2Y62A 4S2CA 3DFSA 1XL9A 4LTSA 4PC8A 1W3TA 4K7YA 1YXDA 4Y6GA 1LBMA 1ONRA 1OFDA 3CIXA 1QPQA 3ATZA 5EKYA 1LORA 3IIPA 3PBWA 1W3IA 4N9CA 5G2IA 3PVFA 1W5QA 3EWUA 2VFEA 5HR7A 1PIIA 2QDGA 3HGRA 4NZFA 3FKKA 2A4AA 1KLYA 2A6LA 4UFLA 3QZEA 1JCYA 3UZ5A 3NPXA 2WSRA 3EWBX 3RK8A 5AC6A 1VH7A 4JYEA 3NPVA 5FI8A 4AVFA 2E5CA 3C52A 1XM3A 3LB0A 3GR8A 2NXGA 1HUVA 1JCJA 1KV8A 2C13A 4HPXA 3EX1A 2BLEA 4K6AA 4QSHA 5EBUA 2A7PA 4ICNA 1H1ZA 5HINA 1VZWA 4YWIA 1YDOA 2ZRWA 4L4MA 1MEWA 4YLWA 1D3GA 1XC4A 1TTPA 3I7SA 3TMLA 4QM1A 2PC4A 3A23A 2Q8LA 2EPHA 4EWND 1H7OA 3RMJA 3FYPA 4YXGA 4H3DA 2CLLA 4HNVA 4MVAA 1EUNA 4UC5A 1SO6A 3LGEA 1A5BA 4CQ8A 2VFGA 2NV1A 1SO4A 5AC7A 1CI1A 3LERA 2CW6A 2ZZ4A 3LCIA 4WY0F 1QO2A 4XKYB 1OX4A 3PULA 1N7KA 4OGZA 4I7UA 4R53A 4FXSA 3BW2A 3PBUA 4MIMA 4AAJA 3USBA 4H6KA 3TAOA 2J88A 1PCKA 3G24A 2BWGA 3O6CA 2VXNA 4NJIA 1KTNA 3TQ0A 4UMAA 3L67A 1H7XA 4HNNA 3NXFA 1ICSA 1YDNA 4BI7A 4UTWA 4UFMA 4TMBA 5ABTA 1KTCA 3NO5A 2PCQA 4UXDA 3T78A 1SW3A 3I7QA 2C15A 3PSVA 4A22A 3T4CA 2CZDA 3W2NA 3HMJG 3NNTA 3QW3A 1X8FA 1GTHA 3HO8A 5FF7A 3LOTA 4I9AA 2EAWA 4AHQA 2A5HA 3MW7A 2FB2A 2YPIA 1VJIA 3NAVA 1WDWA 2ABBA 4JTLA 4IMGA 1G4SA 1AL7A 4UIOA 5AC8A 2B7OA 3B4UA 3E96A 3P81A 1PCWA 1ZCOA 2ZFAA 3VNDA 3T44A 1H61A 2HMCA 4FNSA 5J5RA 2RDWA 3MBFA 1F74A 3NQCA 2QCGA 1B4KA 1SW0A 2YFOA 1MSSA 3TW6A 2ZQ0A 4OV4A 1SO3A 1L6YA 4O53A 2V0TA 3LV6A 4ADUA 4UCGA 4AHPA 4FHAA 3TH6A 1F76A 3FKRA 2X16A 3O8AA 3GZ3A 1SU5A 1LBFA 2CLIA 1UASA 1WV2A 2XN2A 2PE4A 1GVSA 4UNKA 3W76A 1KFLA 1SO5A 3CEUA 1LRNA 4UTTA 3M5ZA 3B0UX 4N4QA 3LTPA 3MJYA 2FFCA 1W31A 3LCHA 2IQTA 1GT8A 3WJYA 4DPQA 1TPH1 1TPDA 1SPQA 1ML1A 1XFBA 3GVGA 1GVFA 1ME8A 3LTYA 3W7NA 4U28A 1FQ0A 3MHGA 4MZ8A 2OZ0A 3N2XA 3MMTA 5H91A 1VCGA 3DBPA 3HOJA 3NYZA 5D30A 3S1WA 4Y9AA 4MLJA 1LLWA 1OF8A 1UCWA 3HPSA 3W1TA 3W85A 1O94A 2BXVA 3P62A 3EX6A 3ATYA 1ZAJA 1XBYA 1VLWA 3L0NA 1JQXA 4JTSA 4XUGA 5G5IA 4ZQOA 5LNRA 2B7NA 4M6VA 3P61A 2C19A 2C1HA 3VKJA 3UWVA 3SGUA 2NV2A 1PVNA 4GE8A 1JULA 1XXXA 4PL1A 4CNOA 1TTJA 1O4UA 1QWGA 5HR6A 1PHWA 3Q58A 3N14A 5DXXA 3THQA 4IMDA 3NQGA 3Q94A 5LNVA 5A5WA 1VHNA 3BG5A 1GEQA 1OFPA 3R8RA 1LTDA 3PF3A 1L9WA 5EPDA 2DZXA 2VC6A 4UMBA 2YGYA 2GVJA 4A21A 1ZENA 2FJKA 1KM1A 5HWJA 3CQ0A 3G18A 1ME7A 4EF8A 3C4UA 3MWAA 4NX0A 4YCPA 4O19A 4O10A 3TC7A 2WNQA 3EWZA 5AFDA 1YTEA 3PB2A 1Z44A 2A7RA 3FIGA 4NZJA 3OVQA 4NJKA 2QCNA 3S0CA 3SECA 5K4ZA 2C18A 1V7YA 2QJGA 3VE9A 5U7SA 3NGJA 3KOFA 1UB3A 3EX3A 3G8EA 5DCDA 1G6CA 1EUAA 1N8FA 1TV5A 2Z6JA 4UMCA 3VE7A 3W7HA 1KBIA 3GNDA 1LDCA 5AB3A 1FWTA 5KZEA 2XN0A 5C2XA 4CCEA 3BGJA 4KFPA 3HPZA 2P1FA 3R12A 2VFIA 1ALDA 4M7SA 5AHEA 3M6YA 3TSDA 4NNBA 2NZLA 1HO1A 1X7FA 2FB3A 3W1AA 4NQ1A 4GUJA 3UYCA 1L2UA 4KKXA 4OT7A 3UXAA 1K7XA 3SI9A 4UNLA 5F1UA 2GVGA 3GK0A 3OHIA 2VFFA 1TRIA 3GKFA 3B04A 4GUFA 3QW4B 5EL1A 2B4GA 3T55A 4L4LA 3VFLA 1QPNA 3IVUA 4PTNA 3EWXA 4S2BA 3ZWSA 5CSSA 3NPWA 1KM0A 3MI2A 3W2JA 3W87A 3W1QA 3G1FA 4UR7A 3LRMA 3TNOA 4QNWA 2H6RA 3DI0A 2ZRUA 4UTUA 3W73A 4AHOA 1VYRA 3TMQA 1WOAA 2YYUA 1AMKA 1ZAIA 4JTGA 2JKEA 3NZRA 5H2ZA 3H55A 1QMLA 2DJXA 2QCHA 1TJPA 5LGZA 3SJ3A 1SSGA 2D73A 2OCZA 4UTHA 3P82A 3IGSA 1GYLA 1AW2A 3F03K 2GOUA 4DEFA 4CCCA 1FCQA 4FF7A 4JTJA 5I3KA 4XBKA 3UWYA 3MHFA 3IRDA 3HBLA 3C56A 5L9FA 4CQAA 1DKWA 1SZFA 1IIGA 3W2MA 4JTTA 2DU2A 2EF9A 3A22A 3ZS4A 3TSMA 1I2RA 3WK3A 3SR7A 2J9ZA 3P80A 4ZQCA 4K39A 3N73A 4RR4A 1OJXA 1VR6A 2ZYFA 3BPWA 5F2IA 3WK0A 3OBKA 4BF9A 1OX6A 3L2IA 5D03A 3KRUA 5BOOA 3A9IA 3C2VA 4GNJA 4RXGA 5AHLA 2F84A 4JTIA 5KSWA 4OHQA 3RLUA 3TKFA 3DHDA 3WK2A 3QMSA 3W7MA 3Q37A 1WX0A 3P8IA 2ZZ6A 2QDHA 1G4TA 1O95A 1P0KA 3ABSA 5DELA 3BK0A 4X3ZA 2A0NA 4ML9A 4O50A 4TX9A 4R33A 3ZFHA 1TPEA 2HS6A 3N19B 4G1KA 4IX0A 4AWUA 1FWNA 1TV8A 3KXQA 2R8WA 3NM3A 1QCWA 4YMZA 4QIUA 1S5WA 1OF6A 4QAIA 4PODA 5D37A 4HIBA 1VYPX 1K8ZA 1TTIA 2YXGA 3PY2A 5F4XA 4FNTA 4UTIA 1H7WA 3IVTA 1RQEA 2WO5A 4LU0A 3L5MA 1I2PA 4LS0A 1TSIA 4WY0A 7TIMA 4FB7A 4YCOA 3PSWA 2Y7EA 2J9YA 3W1MA 2CLKA 1OX4B 4FX8A 4HN4A 2WPBA 2V2CA 5K7JA 2LLEA 3WFAA 3LHWA 4LRSA 4LUJA 4N02A 1F6KA 2CZEA 2J24A 5HUPA 3WJSA 4UTKA 3TU9A 5G2WA 1G67A 1H7NA 5CZ0A 4GJ1A 1C8VA 3SIZA 2ISVA 5LKYA 3S8HA 4FIRA 2YW4A 1AK5A 4GUHA 1TMHA 3TSBA 5TQLA 3EKZA 1FWRA 4A29A 3ZWTA 4FXRA 2TYSA 4RK8A 2GQAA 2HSAA 1K02A 5K9CA 1AG1O 1WA3A 2JGQA 5I3GA 5IBXC 4QQ3A 1TCDA 3B03A 3HG2A 3PBVA 3UXDA 1PL9A 1KW1A 4NJHA 3R2GA 1I4NA 4LS2A 4AEOA 2RDUA 2QJIA 3C2RA 2XFWA 5MHBA 5TIMA 1YXCA 2EHHA 3GLCA 3TAKA 2GQ8A 3WJZA 1O5KA 3TCEA 3NQAA 1J5TA 2C16A 3F4NA 4N6EA 2I1OA 3TV8A 1KLZA 1ZHAA 1OG0A 1W8SA 3QSRA 2AGKA 3BLIA 5FEPA 3P8JA 3CT7A 1UUMA 3KRZA 3W1UA 3W88A 1MZHA 1R46A 2NX1A 2QJHA 1KBJA 3G1DA 4GXMA 2C6QA 2H8XA 1N55A 5D09A 5KTLA 2A2IA 4GUGA 1RQHA 3NQDA 4WOQA 1WQ5A 1H1YA 2BX7A 3RF9A 1G7UA 1DV7A 3HG4A 1EPXA 4DF0A 3NR0A 1LM1A 2DZWA 1H51A 3B05A 1H62A 3TJLA 3U2OA 3GNNA 4MFEA 4O0KA 3W7LA 2NXIA 2FPTA 5K9DA 3W2KA 1GVRA 1XBXA 2ZTKA 3MO7A 3S5YA 2KZHA 4GUIA 4LW7A 2Y7FA 1IXOA 3F4WA 1RQBA 2VENA 3PB0A 5D32A 4JIPA 3S1VA 4IPJA 1W5NA 3D0CA 2NWSA 1F7BA 1JCLA 1GZGA 4ORMA 5AHNA 2NUXA 3L21A 3W83A 1FDJA 3SY5A 2C0AA 3QF0A 4MJZA 1GG0A 4AWSA 4ALDA 2P0OA 1BTMA 3DHFA 2FQIA 4FX7A 5DCBA 3P74A 4BWLA 5FF0A 3FYOA 1V5XA 5K9XA 3B06A 2RHGA 4UUIA 4JN6A 3W2UA 1NSJA 3NA8A 4B5NA 3NQ7A 3KHJA 2FDSA 1L6SA 2QF7A 4FNQA 4M6QA 4PA8A 1O5XA 3NOEA 2Q3RA 2ALDA 1SFLA 1W1ZA 1NAL1 3NPUA 1M7OA 2RKXA 4BR1A 3OVRA 1J4EA 3W1XA 1G4PA 3IEBA 5LNUA 4KFOA 1I8JA 4O8RA 4DELA 2BSLA 2FLIA 2V5BA 3QEZA 3LDVA 3UPBA 2E09A 4FNRA 1W3NA 3LLFA 2C3ZA 3GB6A 3W75A 1DVJA 5D2VA 4UFHA 5D33A 4M6PA 3WK1A 1XBZA 5KINA 1ICPA 3W86A 1H50A 2PRMA 4JYDA 3NL5A 3A5VA 3DENA 1FCBA 4DO6A 3LHUA 1A50A 5EY5A 5CPLA 3S9YA 3QH2A 3GDTA 4DBEA 1YDVA 1RPXA 2TRSA 3CEPA 5DXYA 4R7JA 3LXCA 3CM4A 4LNYA 3FA5A 3O15A 1EP2A 1GWJA 4HSNA 3W70A 5TBOA 3LXAA 2A21A 5D2XA 3WJXA 2ZZ2A 2QCEA 5EMUA 2WSQA 4N2YA 3LCFA 3EKLA 2QKFA 3P67A 5D04C 2QCLA 4QJ1A 1U5JA 3W71A 1OFQA 1KM6A 3LHYA 5CKSA 2Y7GA 2DZSA 2GJNA 3CC1A 3W3OA 3E12A 3FS2A 4JTUA 1SZEA 4X2RA 5F1VA 3NL3A 3SGZA 4PL2A 3W22A 3W7JA 1QPOA 5AYZA 3O1NA 1LOQA 3ABOA 3RU6A 2AQWA 4E2DA 2A85A 2V8ZA 3BLFA 3UWZA 1OK6A 3HG3A 4O54A 1R2RA 3PG8A 3HGSA 3L66A 1PE1A 3C2FA 5AN7A 4C1KA 4TMCA 5LZLA 1IXPA 3L5LA 3CTLA 3W7CA 4MUZA 2WQPA 4XTIA 1QPRA 4EF9A 3RLVA 1ZALA 3TROA 3IVSA 1DHPA 5HQEA 4DO4A 2YSWA 3HB9A 4RX0A 4X22A 3W7RA 3P7YA 4JD4A 4Q33A 4ZQRA 3S5ZA 3INPA 1F2JA 5AYYA 4NT0A 3NG3A 3HJZA 2H3BA 1M7PA 3W1PA 1HG3A 1W56A 1QDSA 4MPQA 5G1YA 1QOQA 2VFHA 3N3MA 4CLMA 1TYGA 3LCWA 5CZTA 3S6DA 5I3FA 6ALDA 3W7QA 3GKAA 2W79A 1QNVA 2B7QA 1HTIA 5LNWA 2Y6ZA 4O12A 3O6YX 1X6UA 3W72A 2X1TA 4Z1CA 1SZNA 1OFOA 4XZ9A 1TO3A 1TQJA 2X1SA 4HT3A 5F4WA 3L65A 1X1ZA 3B0PA 1OFEA 1G4EA 3DU0A 1XUZA 3SSJA 1TIMA 1R2SA 3O6DA 4LC8A 4IUOA 3P5YA 4X9SA 1JUEA 3LV5A 1XUUA 5L6UA 1I2OA 5HNRA 1OYBA 2Q8ZA 2GVLA 4NNCA 2QCMA 1W0MA 4IXXA 2QCDA 4LRTA 3QFEA 3W84A 1BWLA 4HNTA 3QSTA 1W5MA 4LWWA 3QMRA 3UQNA 1VQTA 3N2MA 2YZRA 3BW4A 1TREA 2CZ5A 1SZGA 2PRHA 3G8RA 3GXTA 1W37A 5EA9A 1KFKA 1YYAA 3GXPA 4PFMA 4ZVJA 3PBYA 4W9TA 1VYSX 3A5FA 2A6NA 2QCCA 1KM3A 2DP3A 1F5ZA 1XI3A 5LGXA 1YADA 2X30A 3W7KA 3P84A 1R47A 2X2GA 1YPIA 2E5BA 4WY0B 1KFCA 3MUXA 3IIXA 4JY8A 5AYXA 5K3VA 3UY8A 4JX6A 1TPVA 5DCEA 5HUOA 3W7IA 1FWSA 1DL3A 1NF0A 3MP5A 5C55A 5F2GA 3QRHA 1R30A 3G1HA 2Y7DA 5F2MA 1OFAA 1Y0EA 4D2JA 1BKSA 1Q6QA 1TPUA 3STGA 3W07A 5C6MA 3L0KA 3DFNA 2FTPA 4KWWA 3UWWA 2OMAA 4JTHA 1WBHA 4RKAA 2VEKA 2G96A 2ZTJA 1YTKA 1IIHA 1SFJA 1WXJA 3M5XA 4CQ9A 3FOKA 4O18A 1HL2A 2QUTA 3R5EA 3YPIA 3M5VA 2YFNA 1OHLA 1Z41A 2P10A 1GPWA 3LXBA 3LRLA 3G1AA 4FO4A 4NXKA 2GUUA 3MI6A 1EP1A 1T99A 4ORIA 3KVKA 3LCLA 1FWWA 1LROA 4RZ4A 2Y89A 5T26A 3W7EA 5D38A 3S5NA 2A7NA 4EVZA 1LP6A 1TPC1 1P0NA 1ZNNA 4NU7A 1RVGA 4JNMA 2HS8A 2DORA 1FDYA 3GYEA 1KTBA 1H60A 4O1BA 4MY9A 3SZ8A 1IGSA 4K38A 2XN1A 5DY3A 1MEIA 5CZSA 3NZ1A 4GRSA 5IBXA 3KVMA 1K7FA 4P61A 1OX5A 3IIVA 1F73A 1JJKA 3V1PA 1W54A 3MI3A 4ZQNA 3STEA 3EB2A 3FFSA 2J6XA 1P4CA 5E1QA 3M44A 3IIZA 1GYNA 1JRBA 2V81A 1TQXA 2I14A 2W6RA 1EA0A 3FJ6A 3M5YA 4UFJA 5CGQA 4XWUA 1TPB1 3KRSA 3LRKA 3LBCA 4HNUA 4UTJA 3BLEA 4MKNA 3TJXA 3HF3A 2TSYA 2CLOA 1FBAA 3Q2DA 1U83A 4K7VA 3T40A 4Z1DA 3VI2A 3W1RA 1GOXA 2CWNA 4TR9A 1NVMA 2JKAA 4Y90A 1KA9F 2YX0A 4WUIA 2ZZ5A 4O28A 3VCRA 1ME9A 5AHIA 3NVTA 2H8ZA 4ZZ9A 4LOCA 3M16A 3C3NA 3N9RA 1GQNA 4XTDA 3IGXA 4N6FA 3TE9A 2C14A 3CHVA 4O13A 3QPZA 4H4IA 3CB8A 4E38A 1CX9A 1G69A 4JXCA 1OFBA 3LBMA 1VPXA 2TMDA 1FXQA 2G5WA 2V2HA 1A53A 2RDTA 3S1UA 3MP4A 4WZHA 1VS1A 1JVNA 5LHEA 3MBDA 3S1XA 3E9AA 2JBMA 4O0ZA 4M19A 4N4PA
chains in the Genus database with same CATH superfamily
5E70A 3RJXA 3VOGA 3S2LA 3MHUA 1XIBA 4M7TA 1FUYA 1J0HA 2QAFA 5CXPA 4FX6M 4LEFA 4AF0A 1GOOA 3LNPA 4MNJA 3ALGA 4A3UA 1E4NA 1VRXA 4MOZA 4JZ5A 3W2LA 2FPVA 1PPIA 1PSCA 1P6CA 3QOKA 3CAVA 1VIZA 2X40A 2E6FA 1JCXA 1GK8A 2F6KA 3H2CA 5HAOA 4HNCA 3LZ3A 5K4XA 1CEOA 4LALA 1E1FA 2GSEA 5H6HA 2WHJA 2D23A 1Z7AA 1YTDA 2ZX7A 1EJUC 3PZ9A 3IUHA 5I02A 1W3HA 3H53A 4X61A 4B9YA 3UZZA 3BGGA 4AY7A 1C91A 1UZ4A 4JTKA 2Z6IA 4PUMA 3LCGA 4Z17A 3ARWA 2JIEA 3RJYA 4C5ZA 4M82A 4QROA 5J04A 2YA0A 2BZNA 3F1QA 2ONEA 3MKKA 1LUCA 7A3HA 3F2BA 3UWQA 1K7EA 4MYAA 3MYOA 2YIHA 4ZL1A 1V0NA 3KVLA 2H3DA 3GO2A 5FEZA 1V6YA 3NQ6A 1RH9A 1S2WA 3M4HA 4QCFA 3LQGA 4NXSA 3H22A 3C5QA 3LHVA 3KLLA 3WH9A 2ZZ7A 4XSMA 1CWYA 1SQ7A 3H2OA 1SJAA 4EOUA 4GG9A 1OY0A 3B8VA 3MDUA 1W1PA 3SIMA 3D6NA 2OYMA 5I77A 3IGUA 3L23A 2E68A 1MWOA 2ZE0A 2FFIA 4PMOA 3EDKA 4UTLA 3OVPA 3AXMA 4IJBA 4KWVA 1W1A1 2UWFA 2CLFA 1XH0A 2SFPA 3OZPA 4KESA 4W93A 3E2RA 3NDOA 4L9XA 2E0PA 3U2EA 5CEWA 2DSKA 4IMAA 1EEXA 4FLOA 1E51A 2W61A 1EHAA 4JTQA 1GG1A 5A6JA 2DPEA 3GAKA 4JYFA 3V0UA 4NILA 2CLHA 3O6AA 3UZJA 3CLMA 5BROA 3OHMB 1DHKA 2RFGA 2WMJA 1J5SA 4DRSA 2NQLA 3QYQA 1XLCA 3B9NA 4JTDA 2DUXA 4QX4A 3G1SA 3WMCA 5DO8A 2GQ9A 2ZXQA 3UNTA 5A6AA 2VR2A 3K4DA 1TJRA 1VHCA 2Z00A 1E43A 3DX5A 3DZ1A 1KQYA 3B0VC 1I2QA 1UIPA 3BAJA 4R3UA 3WJWA 1JZ2A 3APGA 4GA8A 3OIXA 4JHZA 1RA5A 3WQGA 4S3EA 3RDKA 5BXPA 1O1ZA 1RAKA 1K70A 2JF7A 1JDCA 4J2PA 2JKPA 4FIQA 1CZ1A 1A0DA 2WNNA 2F2KA 3CXOA 5LSMA 2PUZA 3H4WA 3CL8A 2PZNA 3OGVA 4YIWA 1JF5A 4JPGA 4US5D 3RG6A 2CLMA 3QPYA 1U1JA 1ZS2A 5B7ZA 3ITGA 4K8EA 1T7LA 3URNA 1B57A 4DNHA 1E9ZB 3SRDA 3NSNA 1WKFA 4MWAA 2WJDA 4B2DD 1PV8A 4FK9A 2XWEA 3IAQA 5CZJA 3VOIA 3H8AA 1PWLA 4I3GA 3QR3A 3PUDA 3W7OA 3QHNA 4QS5A 3HFTA 2J47A 4DUVA 2CKSA 1HO4A 3WH6A 2V5CA 1EIXA 2YCKX 1L6GA 1GQKA 3WQ5A 5FESA 4JS3A 1JPIA 2QUUA 3W27A 4RZBA 4V28A 3TQVA 3GDMA 1F3EA 1SSDA 2NUYA 4C1NB 4RJEA 2Y24A 3EEGA 3E74A 3GXIA 3QQ0A 1OB0A 4CD5A 3UR7A 2B81A 3JUGA 4OU1A 2HK0A 5EMJA 4BWLC 4CD8A 1EJSC 2QPUA 3WSUA 4B90A 4AYSA 1VFTA 2NX9A 4XD6A 5D9NA 2DT2A 3AMDA 3GIYA 4UTWC 1MFUA 4V27A 4N42A 1BF2A 2YYTA 4Z1AA 3VOCA 3BLPX 2DVTA 4IZGA 1UOKA 5E0KA 2WJZA 4FXJA 3OIHA 3NWRA 4WSKA 2ZZ1A 3O05A 1NFBA 1QI2A 1JAKA 1V0LA 2DVXA 5DEZA 4X9YA 4PB3A 3N25A 4ATDA 4KCUA 1IXQA 4JTAA 3KBJA 4X2PA 3V35A 1ZU8A 3CPRA 4QXIA 3UVIA 3ARRA 3LX9A 1BYDA 4I6KA 4K8HA 1REQA 4NVTA 1IEQA 1IQ8A 1JUBA 5SWUA 3WLOA 1K6WA 5E0CA 2J8TA 3DH7A 3W81A 4GBUA 4N9EA 2ZVRA 3ZQ9A 1BG9A 5E9AA 4UFKA 3UEQA 4GQRA 4KRZA 1U5VA 2E6AA 2Y70A 3O07A 2J7GA 3TP4A 3EXSA 1TUFA 4MJ4A 4RNJA 4XVDA 2Z2UA 3GAYA 1F05A 1AJZA 4PRTA 5J5DA 2AOSA 3ZZ1A 1DBTA 5C54A 1OBAA 4DWSA 3GUWA 3T8LA 2R1LA 3M0ZA 3HG5A 2QW5A 2E5DA 4IGHA 1OABA 3R1ZA 1AW5A 1HJWA 4H00A 4JFUA 2RH9A 3MTWA 3WDIA 4V15A 1EEPA 2WYSA 5FEWA 1KXQA 1RR2A 2PP1A 2XYLA 3AXIA 2FGLA 1HJQA 1JAEA 3THAA 4IQDA 1TPFA 2QGHA 4OV9A 2WOQA 3PS7A 2PDIA 4O4WA 3UGVA 4K37A 3R10A 2I17A 3UY7A 1I1XA 5G4EA 3R11A 4I7WA 1K8XA 1QUMA 1WXZA 1XSKA 1TR1A 4B16A 3PZNA 4LVDA 4DJEA 4BI5A 3A6OA 3UR8A 1RBLA 4JTEA 2FIQA 3KL0A 1KC7A 3AS3A 1PXGA 1JI2A 5BOFA 3N34A 2D20A 4L64A 2ZX5A 1BXNA 4O1FA 1DXFA 4W8BA 3LHTA 2D0HA 5A6SA 9RUBA 3W28A 4GX9A 2EKCA 3RUBL 1R38A 3UW6A 4PH6A 4DXVA 3POHA 1WCGA 1M65A 4A05A 1DXEA 5EBAA 2EG6A 1HL8A 2QF8A 3CHEA 5KEZA 3TLLA 1E15A 5A2AA 2Y5JA 3JR2A 5JH2A 3CWOX 3VC5A 4IX2A 3L9CA 1YEYA 1ISZA 1Q45A 5IM51 4O52A 4MADA 2OVLA 1UG6A 4O11A 1VCFA 3MCNA 1A5UA 2CZVA 4U5IA 3KP1A 2IPGA 3CO4A 2XWDA 3KX6A 1U1HA 1UR1A 1SW7A 5G1MA 3I6RA 4I7VA 4Z2JA 4W85A 2C7FA 3R43A 4AC7C 2OT1A 2J7CA 4DUWA 2EPLX 1R2TA 4BFAA 1IXNA 3CZJA 3S4TA 4D8LA 4DB7A 3G0XA 5BWAA 4KMQA 4JHMA 4XIMA 1LOSA 3EWYA 4Z08A 3TIMA 5DY2A 4DZHA 3BVJA 4I9TA 4IIHA 2OX1A 3PUOA 1AW1A 2BODX 2C91A 4AFYA 4GYFA 2WMKA 2FHCA 3PWGA 4AH7A 4EIVA 1ZCCA 3CUZA 2VRJA 1VCVA 3A3WA 3HPXA 3M7WA 4XBSA 3K8KA 3OZOA 4HD5A 5CPQA 1KGXA 2DZPA 2J13A 3GX9A 3OG3A 5JQ9A 2OQHA 4PB5A 4MNKA 5G2HA 2NQZA 4JNZA 7REQB 2NX3A 4ZFMA 5FJRA 1GJUA 2XM1A 5C70A 4EPBC 3QR1A 4IFOA 3SFKA 2ZZ3A 4D6GA 4INFA 4O4VA 3IS4A 4MWAE 3U6WA 4PBFA 1E6QM 4ADSA 4HPHA 5I3HA 4S2CA 3DFSA 2EEXA 4Z2HA 4K7YA 3W38A 3UA4A 4QHRA 1BYBA 3CIXA 1F8MA 4WCJA 1LORA 2BASA 3EMCA 1W5QA 1FFQA 2RDXA 3CUJA 4B5UA 2QDGA 1GKRA 1XLIA 4AIOA 2A4AA 2OX4A 1TIWA 3B8SA 3QZEA 3UZ5A 4NY2A 3EWBX 5HNNA 3RK8A 1AQHA 3S9IA 1Z3NA 1FWEC 1UD2A 2E5CA 3C52A 3KTCA 2G3IA 2NXGA 3VD3A 4MNLA 3WDQA 2C13A 3T2OA 4HPXA 2BLEA 4DIAA 2D2GA 2YCIX 3UXLA 1VZWA 3A4WA 3SN0A 1A4LA 4A3HA 1QOXA 3KOXA 3OGSA 1MEWA 1XC4A 4LQ1A 3I7SA 3TMLA 3TZNA 1ZBWA 3IJIA 4XAYA 3RCMA 4H3DA 3PNUA 4JAWA 1CGXA 2PGWA 3P0WA 4UC5A 3LGEA 4CQ8A 2WANA 2QDDA 2GDQA 5AC7A 1K9EA 1Q4WA 3LCIA 3REQA 3WQ6A 1QO2A 4XKYB 2DIKA 4PMDA 1SGJA 4OGZA 3K46A 4U5KA 4AAJA 2J75A 4H6KA 4HMDA 1XYBA 2D3LA 3CLWA 4NJIA 1KTNA 4BI7A 1XIJA 5IXEA 4TMBA 1UQYA 5AKQA 3T78A 1XGDA 4LBUA 3I7QA 1K4HA 1PX3A 3S2CA 3SCSA 4URIA 3QHOA 3PTQA 1VENA 3HO8A 4AD0A 4HK7A 3LOTA 3TTQA 4M8UA 2XTKA 2V69A 4CN1A 3NAVA 3LMZA 1WDWA 3FJNA 4JTLA 3K4WA 1AL7A 5H8UA 5AC8A 5XIMA 5FJPA 3P81A 2R1MA 3KWSA 3ANVA 5HK4A 2ZFAA 3VNDA 1H61A 4FNSA 3RO8A 2AMXA 4DWDA 4O53A 3B8TA 4AHPA 1LBFA 3LMYA 1UASA 3BWWA 1WV2A 1ZBCA 2PE4A 1GVSA 2PTXA 3OA5A 4AX6A 3W76A 1LRNA 3M5ZA 2BY1A 3LTPA 2IQTA 1GT8A 1A0EA 3WJYA 1TPH1 1TPDA 1ML1A 4C91A 1J0ZA 2I56A 1GZJA 1GVFA 1ME8A 3MWCA 1Q6EA 2J6VA 4MZ8A 2DSZA 3MMTA 4C6KA 1YIXA 1LLWA 2YOCA 3W1TA 4AMCA 4DUXA 1TA3B 3VMOA 1V8EA 3GH7A 4DZAA 3ATYA 1I6NA 3IAPA 3EOUA 1XBYA 5G5IA 4AZCB 3R79A 4R7OA 3BLKA 2B7NA 4M6VA 3P61A 2ZXAA 3CZ8A 2C19A 2C1HA 9XIAA 3T4WA 5HQLA 3VKJA 4GE8A 2VZTA 3UT0A 5EFFA 1JULA 5IHRA 3U2ZA 1TTJA 1GPFA 4LJ3A 1QWGA 1RP8A 1LJYA 3UCCA 2Z25A 3U7BA 1VHNA 5I5RA 2INZA 2FH8A 1IT7A 3B0YA 1RLDA 3CZKA 3PF3A 1L9WA 2PLJA 4Q3MA 2VC6A 4A21A 1ZENA 1KNWA 3OGRA 5HWJA 1ME7A 1CGTA 4OKDA 4EF8A 1E6RA 4YCPA 4RDZA 1QHPA 4F2BA 3MDWA 1EC9A 1EXBA 1YTEA 4RE3A 4G56A 1R7OA 3PB2A 1QWKA 3GHRA 1WE5A 3FIGA 3KL3A 2DT1A 4H9ZA 2WPGA 4HU0A 1RBOB 2PDYA 3N6JA 3S0CA 3SECA 4LX4A 2P0IA 3UZXA 3VX0A 3K8MA 8A3HA 4E4PA 2YCLB 1EUAA 1I75A 5BYWA 2J74A 3EMQA 3GNDA 2PI6A 1EHNA 3SADA 1KCZA 5C2XA 3BZGA 1JFXA 1JXKA 4KFPA 3HPZA 3UJSA 1EJVC 5E09A 1T41A 2WMIB 5I6SA 1ALDA 4M7SA 5E6YA 4AD4A 2NZLA 1HO1A 3PZVA 4L6OA 5FJJA 3UYCA 3CUGA 1ZRQA 3DC0A 4S3KA 3B9EA 2VVSA 1L2UA 3QTGA 3I6TA 4UQDA 1K7XA 3VX1A 1F07A 5F1UA 3IUDA 1PKYA 2GVGA 3NURA 1EO7A 1U22A 5EGRA 3B04A 3QW4B 5EL1A 5BOEA 1MMFA 2P5NA 4ERIA 3S2MA 4PTNA 3EWXA 4S2BA 1F6YA 3NPWA 3E3HA 4F8XA 3VO0A 1Z32X 4C60A 1QJWA 2R6OA 3FHQA 3TYCA 2J66A 4UTUA 2HQAA 3VCNA 4B5WA 3U3HA 1UR2A 5BXRA 1XHGA 3TMQA 3B40A 1WB0A 3B8WA 4JTGA 5H2ZA 1UOZA 1QMLA 1XLEA 2Y8VA 1U1UA 4EPEC 1TJ1A 3AUOA 2PS2A 4LAUA 3E0FA 2PGEA 3PJWA 3EMZA 3FCPA 4JTJA 5I3KA 4XBKA 4YTRA 3MHFA 2ESCA 1GCYA 4CQAA 2DU2A 3A22A 2VWSA 3TSMA 3MQTA 4AIEA 3SR7A 4QLKA 3P80A 4F2UA 1ZBKA 1Q7QA 2WNWA 1PO9A 4NAEB 5CGMA 4ZOBA 2Q71A 2ZYFA 1LG1A 4KEVA 3OBKA 1R3WA 2HE5A 4M24A 3A9IA 4PULA 2O9TA 5AHLA 1VFSA 4XUYA 2Z24A 3QMSA 3P8IA 4P8XA 2EPOA 2QDHA 3BSGA 1ODUA 3JZUA 2A0NA 2WJFA 4ML9A 4I5XA 4IFKB 3N19B 5DMMA 1FWNA 1NM9A 4PMZA 3EA3A 3CMGA 1JG9A 2R8WA 4UOQA 1QCWA 4QIUA 4DNMA 1OF6A 1XSJA 5D37A 3PY2A 3THUA 4FNTA 3RRAA 3LPFA 4HA0A 2ICSA 3ARTA 2C79A 2WO5A 1I2PA 4NKCA 1UKTA 2Y7EA 4GYPC 2J9YA 3W1MA 3TA9A 1XYZA 1WDQA 2CLKA 1EZWA 3ID7A 1EGVA 2Y4SA 1HIZA 4ZOCA 3EOEA 4QAWA 5K7JA 2LLEA 3IANA 1F6KA 3SRFA 5HUPA 3CS2A 4GABA 4UTKA 4H8NA 3GNXA 4CD6A 1H7NA 2ISVA 4KIEA 1ZZMA 4FIRA 2YW4A 1GONA 4GUHA 4R9OA 5TQLA 3EKZA 4A29A 3ZWTA 3ZJKA 1AG1O 3W37A 5I3GA 4PUWA 3HG2A 4IM4A 3PBVA 3GC5A 3WZ0E 3E38A 3R2GA 4LS2A 4A4AA 3RM8A 5MHBA 3CUFA 1E1EA 4UR9A 3W0KA 1O5KA 2PTZA 1H0GA 1XINA 4NYUA 2WMFA 3DHPA 2I1OA 3TV8A 2BHZA 3LK6A 3QSRA 4IH3A 1W1TA 5D9PA 3BLIA 2Z7GA 4GINA 4LYPA 4D9PA 3KRZA 4S3GA 4DLMA 2NSOA 1BYAA 5KTLA 2A2IA 1R9XA 2P3EA 3NFUA 2BX7A 1R3SA 4KW2A 1EPXA 3MCMA 1M3UA 4OECA 4KRUA 3AQUA 3B05A 1H62A 2H9AA 1PWMA 3GNNA 1M03A 1YBQA 1XSIA 1JZ8A 3W7LA 5K9DA 1XBXA 1BVNP 3S5YA 4GNVA 1DJHA 4FAMA 1CCWB 4LW7A 1IXOA 1JPDX 3F4WA 4QJ5B 1O7AA 1OGSA 4IPJA 2C1GA 1W5NA 1XKJA 1JCLA 4ASTA 2J25A 2REQB 4ORMA 2I9UA 2BVWA 3L21A 5C9UA 3VK5A 5C9XA 2C0AA 1BTMA 3FGCA 3OVGA 1EBGA 3A3XA 1NSJA 3NA8A 1AJ2A 3KHJA 1J18A 3ARPA 2XZ9A 1XLHA 4FNQA 4M6QA 4PA8A 4W7UA 4ACZB 1Z8AA 2VGGA 3Q65A 3NOEA 4ZTYA 2VGFA 2Q3RA 1GVYA 2XU2A 4WF7A 1W1ZA 3WFZA 3NPUA 5E0FA 3MC5A 1S5NA 4BR1A 1JF6A 1HP4A 3VKDA 5LNUA 5BZAA 1I8JA 3CGTA 1T40A 4FOJA 4WSJA 7ENLA 2DT0A 2V5BA 3UPBA 1W3NA 1X7IA 3LLFA 2C3ZA 5LIWX 1K9DA 4C5YA 3H26A 2ZKMX 2IUZA 1W9DM 2PBOA 1PB0A 4WIWA 3VIJA 1XBZA 2QUMA 3LENA 4GXPA 2PRMA 3DYPA 3TCSA 4Q7NA 2PP0A 4DO6A 1NWTA 5EY5A 3S9YA 4O0QA 1TMLA 4EPDC 1YDVA 3AICA 3L4UA 1TZ7A 2ZZ2A 5EMUA 5DMYA 2YL8A 3AJ7A 1J0JA 1W6TA 2QKFA 3QVQA 2WSKA 2QCLA 3CPGA 1OFQA 3LSBA 2FYMA 3EOSA 3LHYA 2NT1A 1E55A 2DZSA 3W3OA 4O8AA 4LCRA 1H3GA 1SZEA 4D6DA 5F1VA 5I24A 4HBKA 3W22A 3N17A 4JHOA 5BXTA 2VCAA 3O1NA 3RU6A 2Q01A 2AQWA 2BVYA 2Y8KA 1YNPA 4J3ZA 3UWZA 3RIKA 4AEFA 2NSXA 3S2NA 2PODA 3C2FA 5FAGA 3I3DA 3EAUA 5LZLA 3T9PA 1LT7A 3CTLA 4MUZA 2ZUSA 4P7QA 4IISA 1ZALA 4DO4A 4QRNA 4B4HA 1AA1B 5A8OA 4RX0A 3W7RA 4NAFB 4JD4A 2FKPA 1T6MA 3INPA 1F2JA 4ZQRA 1E6ZA 1E4IA 4QGCA 5GNZA 1FTXA 2INEA 4MPQA 5G1YA 1QOQA 2VFHA 6A3HA 4I5UA 4LANA 6ALDA 4U10A 3GKAA 5REQA 5LNWA 4O12A 2OOFA 1T5AA 5FJIA 1X6UA 4L4OA 1OFOA 3LG3A 3ES8A 2F9RA 4XZ9A 5F4WA 3ZSTA 4JCMA 3ZT7A 1UIOA 3SSJA 1TIMA 3K4AA 4BKNA 1J93A 5CGTA 4IUOA 1OT2A 3PPGA 3K5XA 5HATA 5HNRA 2I7GA 2Q8ZA 3R4IA 2PLKA 2FZNA 1UWTA 3GTHA 2R9RA 3A4XA 4Z2LA 4LWWA 4AD1A 4DI8A 5I0DA 1VQTA 5JVLA 2VQTA 1WNOA 4MWAC 4JIIX 4R9XA 3GXPA 4PFMA 4PSPA 1W2VA 1VYSX 2GJXA 2QCCA 1PZ3A 6REQB 2WZEA 3HZ3A 3P84A 3OZMA 2XH2A 4W8LA 1XYFA 1TE1A 4WY0B 5HDRA 5K3VA 3UY8A 4HCHA 1TPVA 4KEZA 1A5NC 1UC4A 5F2GA 3QRHA 3VABA 3EB3A 1W91A 1FKXA 2RUSA 3VUSA 1OFAA 1Y0EA 1QW8A 2BGNE 1VP5A 3RPDA 3TOYA 1FWHC 1E71M 1JYXA 2OB3A 2J7EA 4YJ5A 2F2HA 2ZWZA 2D1ZA 2OXNA 3AZRA 4CQ9A 3FOKA 3L4WA 3N2TA 4ACYA 1HL2A 4EAMA 1MW2A 2PWFA 1W1VA 4GH3A 4UBPC 4AZBA 1KRMA 3HQOA 4J7RA 4RPQA 4QCEA 4Q22A 5D38A 1MFVA 3T0AA 1XLDA 1R8LA 2PU1A 2VX6A 1ZNNA 1RVGA 1R0MA 2HS8A 4NASA 1NIUA 2PU0A 1OCBA 3WNNA 1FKWA 3W4RA 4M56A 3WH7A 4FMVA 2XN1A 4NI3A 1JXJA 2PZ0A 5IBXA 1K7FA 3USZA 2OSWA 1BG4A 1UH2A 1V6WA 1F73A 3V1PA 1V77A 1W54A 3C3UA 4H8UA 4ZQNA 2J6XA 1OG6A 3M44A 2BV9A 3I3BA 1TQXA 3FJ6A 3SM0A 3CL6A 4UFJA 5CGQA 3CV2A 5C0QA 4PEEA 3KRSA 4HNUA 1W32A 2NVCA 4MKNA 4LNCA 1S46A 2CLOA 4K7VA 2YLLA 4AD3A 2BDQA 5HMFA 2WC4A 4M1BA 4Y90A 3CNYA 3LD5A 3GUGA 2ZZ5A 1QRQA 1TJ0A 3DN5A 1ME9A 4OUIA 1A80A 2E28A 3WBWA 1XP3A 4LOCA 3C3NA 3M16A 4DWSC 3TE9A 1V3JA 1X98A 4ZENA 4E38A 1G69A 1OFBA 3OG2A 4IG2A 1FXQA 2G5WA 1A53A 2WSPA 3A9BA 3MP4A 4W88A 2BXZA 1JVNA 5LHEA 1BAGA 4XISA 3E9AA 4RZ6A 1S5TA 4AXNA 2FHBA 4JTRA 2DSUA 3B8IA 3QGAC 1AH4A 4FI4A 2ZUNA 3E0IA 3URQA 3H6OA 5I79A 5FJUA 1XPGA 1HVXA 1ZFJA 1JCMP 3DKLA 3OBEA 4NRRA 4JTCA 3VMPA 2QULA 3QQWA 2HEJA 7XIMA 5IFPA 3HN3A 3Q4DA 3SN4A 3TXVA 4BZYA 1VGAA 1BXCA 4DJEC 1H2JA 4F0LA 2PDMA 3AXKA 1OK4A 3EDJA 1DQXA 3F2DA 5JU6A 3VNMA 3AWNA 4OOZA 2D2HA 1OYCA 3EYPA 1QXLA 1PS9A 3G0UA 1TB3A 3AO0A 4O15A 4H7CA 1T96A 4EPKA 3LCXA 1VRDA 1C9DA 4PUDA 1XLAA 2PDBA 3OU8A 2O92A 3LM3A 1X1NA 1A5AA 2PWHA 3AAMA 4O1EA 4UZUA 1NF7A 3RO6A 4FPSA 3MS8A 2ZRZA 3G1YA 1SR9A 1DTUA 5BXSA 4KWSA 4GO8A 1OFRA 4ZXLA 2CBIA 3CUHA 2CZFA 2ZXBA 3HQ1A 4S39A 1J2BA 1LBLA 4U2YA 2YW3A 1I9CB 1Z69A 3RLHA 3TXZA 3CU2A 1CTNA 1TVLA 2J62A 3PUGA 1PBGA 1H1NA 2QLYA 2E6YA 1EDQA 4RNFA 3HQNA 1EJRC 4JY9A 4K36A 4Q4KA 4LFYA 3QQ1A 1HL9A 3VGEA 1M6JA 3QBUA 2BHYA 1FH8A 2V68A 4OBSA 3T2PA 1UD5A 4HQVA 5AHFA 4PMUA 4D71A 7CGTA 3QY6A 2WXDM 2DZUA 1IR2A 1CB2A 1XR2A 3B8UA 2Y85A 3GVQA 3HIJA 1S3TC 4BK9A 1FWCC 3VDAA 4YTTA 3BURA 4WD0A 5A8QA 2B0MA 4L80A 5BNKA 2G50A 3H4GA 1JI1A 3GNOA 1ZAHA 3L0GA 2PRLA 2RGLA 3B0XA 1LLZA 3OODA 3PWAA 1BPLB 2NUWA 3SFWA 4REQA 3MSDA 3I68A 5XINA 1CENA 1KWKA 4HJWA 4RDWA 5FCZA 1S5VA 1EPVA 1XLGA 2PDJA 3FDGA 1F61A 1ITXA 1BRLA 3C8NA 4C7DA 3NQBA 4FEZA 3RYSA 2BTMA 3UYIA 3SCQA 4OJYA 2QIIA 1QFEA 2V5LA 4OWGA 4GCAA 2W66A 1AZ2A 2DSVA 5I00A 2Y61A 3S2JA 1CXLA 3W6MA 4C65A 3CV7A 3LI1A 4UTMA 5A8NA 4DXXA 3CUXA 2CBJA 3GW3A 1Z42A 1TV2A 3B9AA 3WF4A 1OVDA 3QY8A 3W7DA 3DGBA 2VCBA 1QK2A 1YPFA 1DORA 3A64A 2GGEA 1J0IA 1PIGA 4ZB2A 1C90A 3F4CA 1VJZA 2QEZA 1OYAA 2YCEA 6XIAA 3A21A 4ZQPA 2VUYA 3L5AA 1AQFA 2VNCA 2WVSA 3CH0A 3HPFA 4GK8A 2DZBA 4WK9A 3MZNA 1TZ9A 3GDLA 3O16A 1LL6A 3JRKA 4OBRA 4LYRA 1RUSA 1DE6A 4O1CA 1XD0A 5A8GA 1VEPA 5M3WA 2NLIA 2ZX6A 1ZB5A 1D3CA 2O55A 5CG7A 2NWRA 3RPTA 2VOMA 2GJRA 5F7UA 1DIOA 4TVUA 4WJEA 3VOHA 1ISYA 2PDWA 3AYSA 1XYAA 1KR1A 4BQ2A 3C0SA 3O06A 2YCJA 1UP3A 2PDNA 3PZUA 4HHMA 3DG3A 2I9EA 1W3KA 3M0HA 3JZEA 2ZA2A 2XH7A 2WLYA 1IF2A 4K1GA 4E8DA 4Z1YA 3URBA 1C7SA 1X97A 4GY7A 4ZE5A 2Y0FA 4IPPA 3PWIA 1H4PA 4IQJA 3W1NA 1MXSA 1NDWA 3GZAA 4FNPA 1IZKA 4TTGA 4Q8OA 3W6YA 4LY4A 3OZYA 1V6TA 3ZYZA 1GKPA 1AL8A 3KFTA 3MPGA 2AQVA 5HWMA 5LA0A 4CCZA 1XIIA 2YB1A 4U4MA 3PTMA 1GOIA 1OWQA 2OQLA 2VKZG 3TYBA 5HJYA 4QISA 2O0TA 4MYXA 1MZRA 4S3BA 1F6PA 3WQEA 2GUYA 4AD5A 2GQ3A 3K1DA 4JX4A 1K3UA 4KRTA 3ICJA 1RVKA 4IGSA 4Z2IA 1W9XA 3ARSA 2FZ9A 4YNGA 2Z0IA 2MUCA 5E6ZA 3QZ6A 5D8WA 3FW6A 2XPKA 3PAJA 3EDEA 1W3LA 4QSFA 1L2QA 3MJMA 3KAOA 4MZ1A 5FL0A 1RJPA 2ZIDA 3B8DA 1JFHA 1UW9A 4DBDA 4C6IA 1EWDA 3TN5A 4MB3A 2JIWA 5D05A 3NZQA 2ZA1A 5JXQA 1PEZA 2H90A 1R3RA 3GVRA 4X60A 3U0HA 3TK7A 2UY3A 3DFPA 1HFBA 2GSHA 2ATSA 3VIOA 1J0KA 2A3EA 2GL5A 1AD1A 4P5UA 3BAWA 1IEXA 1ZPTA 3W23A 1GOKA 3WF1A 4AF0B 4JFWA 1GEHA 4N9BA 5T9CE 2Z1BA 3S42A 1RZMA 4PCNA 3WUEA 4JIQA 3AIEA 3SY1A 2VMFA 3QXBA 1RBAA 3C0JA 2XFFA 4DF2A 1F9CA 4FSAA 5BMXA 3UPWA 2W5FA 3PG9A 3TR2A 1DJNA 3I65A 4LT9A 2V82A 2VRKA 4ICCX 2ADAA 3GRIA 5HNTA 3VUPA 1SM9A 3ORWA 1CGVA 4LY8A 2EJAA 5FF4A 3NQEA 3FJLA 3QPEA 1QNQA 4YHGA 1VFFA 1Q6DA 4PE8A 4CKQA 1WBJA 1KGWA 4XAFA 2ZRVA 4PN2A 1BWKA 1BEUA 1H7RA 3GC2A 3I7RA 2WKJA 3PUEA 2E8ZA 5G4WA 2PPGA 3FXYA 1ESWA 4IMEA 2WMGA 3BJTA 1GOWA 3TWBA 1B3VA 2XVNA 1LUCB 4EACA 3O63A 1V0MA 5A69A 3V7PA 4H01A 1DE5A 3VOJA 3WQCA 2V30A 3PNZA 3PN8A 1RV8A 1TFVA 3NQVA 5LIKX 1PHQA 4ZO8A 3TUUA 4LV4A 3NO3A 2CESA 4CNUA 1E72M 2G3FA 1D9EA 1R87A 1WKYA 2P8CA 4PCTA 3E02A 3NQMA 3TW7A 3UJRA 4B92A 1ADOA 1BF6A 1ZJBA 2R1KA 3A24A 3H54A 2QAPA 2G3JA 2HDJA 4A2RA 4PCFA 2JGYA 3LNMA 4OE7A 4A2SA 3TDFA 4OQVA 1RCXB 2J8GA 2YZ5A 3QGKC 2G41A 3G6MA 1EWEA 1TX2A 1EOKA 2Y88A 3MZ2A 1IR1A 2BOEX 4AY8A 1TWDA 1XLMA 1YXYA 2NW0A 2QVHA 3EOOA 1ZL1A 4OUEA 4V2XA 1OIFA 5CC6A 2DGAA 1L8NA 3OA3A 2JEPA 3S5OA 1V3LA 4K8GA 2FTWA 3M0IA 3E5BA 5A8MA 1UUOA 4Y8EA 3VGHA 2PGRA 1THFD 4GFSA 5DBTA 1Q5MA 2ZCGA 1QOPA 3CIWA 5B7YA 4NNAA 2ABAA 5HA7A 4ZEPA 2VD9A 4QEEA 4WGXA 1CYGA 4S1FA 1QASA 3MYPA 3T09A 5BW6A 3PFRA 1DOSA 5E93A 1XDMA 4E8CA 3PZQA 1XIEA 2Y5SA 3ZJ7A 3A47A 1M5WA 4XQ6A 4GI6A 4IJCA 4Y8FA 2VQUA 1VLIA 3BZJA 2QVNA 1K03A 3BO9A 2ZA3A 1NH6A 3SRKA 1AQ0A 2X1RA 3NQ8A 3AS1A 1OT1A 4NRSA 1XRVA 3QHMA 1V7AA 3N2BA 5CC3A 4Y6GA 1LBMA 5EKYA 1GGOA 3IIPA 1W3IA 3VTRA 5CJNA 3V1HA 1OD8A 1V6VA 3WNMA 3MU7A 4N9CA 3EWUA 2F8QA 5HR7A 4MWAB 2BS9A 3SEPA 3HGRA 1NELA 3FKKA 4EKJA 1YX1A 4UFLA 1OQFA 2R82A 4Z2KA 1M04A 4S3CA 3NPXA 2WSRA 4F0SA 5CAKA 2Z1VA 4IIEA 4FA3A 2ACRA 5AC6A 1VH7A 4DJDC 4Q4RA 1YNQA 1HUVA 1JCJA 1NWSA 1B2YA 3R8GA 3EX1A 4K6AA 3IJ6A 5EBUA 2A7PA 2DV0A 4ICNA 4HZ6A 2AL2A 4HU8A 5DX7A 2PWDA 1YDOA 2ZRWA 4L4MA 1EX1A 5C2CA 3UF9A 2EO7A 1B3WA 2A3HA 1EDGA 1TTPA 3PJXA 4C6LA 4QM1A 2QJJA 2PC4A 3A23A 2OZTA 4CUCA 1H7OA 3AHVA 3RMJA 4JL1A 3I4EA 2CYGA 3VDHA 5KZ6A 1EUNA 3MUIA 3SCOA 1CI1A 2ZZ4A 3KBNA 1OX4A 3WQFA 3WELA 2V6AA 4H7ZA 3PULA 1N7KA 1GQJA 4LYKA 3BW2A 3MVIA 4MIMA 3WH5A 1K9FA 3UBPC 2V5DA 3G24A 1XS2A 2BWGA 3WBYA 4AZ6A 3UZYA 1H7XA 2Q6ZA 3NXFA 1O68A 1ICSA 4Y9MA 3MY9A 3QN3A 4KS0A 4JQ4A 3S9ZA 5ABTA 3FY1A 1OGBA 1REQB 1ZJHA 4KCVA 1CPUA 3V5OA 3L4ZA 1UA3A 2OLHA 3SURA 1TMQA 3IJ7A 3N6QA 2ZC1A 4AHQA 1A0CA 2VUNA 2Z27A 3KOWA 3MW7A 2FB2A 2YPIA 2ABBA 1J6OA 1FWAC 3U4AA 2CLPA 1E3ZA 5FJOA 2W62A 1DP0A 3CAQA 3B4UA 1YW1A 3E96A 3T44A 2CERA 5J5RA 3QV8A 3GG0A 1F74A 2CBVA 1TKKA 2XDFA 5I09A 1XH1A 3NQCA 4J27A 2XIBA 1IEWA 2ZQ0A 1CXFA 1L6YA 1IWBA 3CAKA 3TH6A 4DWSB 1DYSA 1AH3A 2VC9A 4XD4A 2FVLA 2VJXA 1W8GA 1PKMA 1KFLA 4GISA 3B0UX 1ISXA 1SR0A 1W31A 3LCHA 5FJTA 2HXTA 3A13A 2OELA 4MDPA 1VBRA 5AVNA 1XFBA 3GVGA 3GH4A 3KEHA 4BHYA 3LTYA 4U28A 3W7NA 5I7GA 4Z42C 3MHGA 1X8CA 2OZ0A 2WM1A 4J35A 2FMNA 4M29A 3N2XA 5H91A 4EE9A 3KCJA 3ABXA 1VCGA 3HOJA 3M0MA 4XAPA 3W85A 2BXVA 4LGXA 4WJ8A 1R3VA 4GLEA 1SVDA 2QPSA 3VKAA 1JQXA 2HBVA 3LQLA 4GKTA 5CH9A 4PTMA 3UWVA 2O9PA 1PVNA 1VFHA 2VGIA 2D3NA 1O4UA 1PHWA 3N14A 3ZMRA 3AS2A 2GWNA 3CV1A 5A1AA 1HJSA 3BG5A 1OFPA 1CLVA 4HOXA 5EPDA 2DZXA 4Q8NA 4P7RA 2X2YA 3VNLA 3IK4A 1UJQA 2XVKA 3GHUA 2WNQA 1E0VA 2PWGA 5AFDA 1XLFA 5TD4A 5I06A 1MNSA 1Z44A 2HJPA 1DTNA 1E3XA 5K4ZA 3BCDA 3MMUA 3TTOA 3VE9A 2Q8XA 1WAWA 3BGAA 5U7SA 4F0HA 3G8EA 4BQ3A 5MF5A 1ZLPA 1KXTA 4MDOA 1O5RA 2WVVA 1P0DA 4CCEA 2WK2A 2ZUVA 3BGJA 4GYJA 3NSXA 5DMLA 3SQSA 5AHEA 3M6YA 4P8WA 2D2OA 3TTEA 4ERAA 3WUBA 3R0KA 1M7XA 2I57A 4OT7A 3UXAA 4G1NA 3SI9A 4UNLA 3P0XA 1ZJAA 3GK0A 3OHIA 2YL9A 2VFFA 8XIMA 1TRIA 3GKFA 2ANUA 4GUFA 4N0RA 2B4GA 3KUMA 1B90A 1QPNA 3ZJ6A 3WQVA 3WENA 4PMXA 3V5FA 3MA8A 3W87A 1GUVA 4HGXA 1BGAA 3QZAA 1X96A 1W3JA 4C7GA 4UR7A 1MNZA 1UWIA 1PX4A 3M0VA 2V67A 4XZNX 1UPPA 1WOAA 3TOPA 3CBWA 2JKEA 2VR4A 4QBXA 1TJPA 5LGZA 2ISDA 2OCZA 3IGSA 1GYLA 3IRSA 1AW2A 1W17A 4DEFA 3AIUA 1V93A 3WF0A 1MYRA 3UWYA 3HBLA 3WBXA 3C56A 5HPCA 1TG7A 4JOMA 5L9FA 3W2MA 2NQHA 4JTTA 2EF9A 3RPMA 1XLJA 2PAJA 2HPIA 2PEVA 5C8BB 5CC5A 4ZQCA 4RL3A 2XIIA 4HA4A 4RR4A 1OJXA 1VR6A 3BPWA 3F5KA 5F2IA 3WK0A 2WHMA 4BF9A 3KRUA 3BMWA 3E0WA 5BOOA 4J3TA 2F38A 2DEPA 1Q13A 4H1ZA 2PWUA 2F84A 5KSWA 3VDCA 2DZAA 3DHDA 3WK2A 3W7MA 4H2CA 3WBEA 1FHVA 4GOAA 1O95A 2QT3A 3SN1A 3BK0A 4X3ZA 4IJRA 1MUMA 1RALA 4BEUA 4S38A 1J12A 1E9LA 4QG8A 4GI8A 4DWSD 4UQBA 2PC8A 4AWUA 1TV8A 4HNOA 4WDXA 2G4FA 1FWDC 3NM3A 5LA2A 2XSXA 3VGGA 3N2OA 4PODA 5F4XA 3O3RA 1SJDA 2FH6A 4LU0A 2QNEA 2Y2WA 4FR6A 3ARXA 4Q6JA 4FB7A 3WBAA 4YCOA 3QV7A 3LPPA 5ECVA 3REQB 4PRRA 2Z1KA 3COTA 3WMLA 4BF7A 3TYAA 1UKSA 4LRSA 3H2NA 3TZFA 2CZEA 2J24A 1KRCC 3WJSA 3C0LA 2XIOA 5G2WA 3U5UA 4J40A 1C8VA 3SIZA 3N3TA 3GHTA 3S8HA 7PTDA 1TMHA 3IJDA 4B5VA 3DFYA 4TVDA 4RK8A 1QI5A 5K9CA 1Z6KA 3H2FA 1JYVA 5IBXC 4QQ3A 4JFVA 3B03A 4NHVA 3AHZA 3MB9A 5M1TA 1PL9A 1CGWA 5HMDA 4A8IA 2XGIA 2RDUA 1OSEA 3S5SA 5CG0A 2XFWA 1X6NA 1YXCA 4C6DA 2VTFA 5TNVA 4GQBA 3TAKA 4F66A 1QK0A 3PP7A 2C16A 4R88A 4N6EA 4LYQA 1KLZA 4UQAA 1JDDA 2X41A 1LL4A 3CWHA 5CPSA 3GHSA 1VFMA 3BAKA 1J79A 3URAA 1R46A 2NX1A 2PDUA 3G1DA 4GXMA 1V02E 4NF7A 2DY3A 2H8XA 3B3DA 3T42A 1RQHA 4WOQA 2GSJA 2VT0A 1E6NA 2OLAA 3GXFA 1P6BA 5ABGA 1MDLA 3RF9A 3F5LA 3NR0A 1LM1A 4Q8UA 4X0VA 1H51A 1H0IA 4YWSA 1K8CA 4B15A 2L5HA 3U2OA 1HT6A 1DWHM 3ARYA 3W2KA 4WVXA 1IZCA 2HNEA 3DYMA 3VGFA 1J9YA 2Y7FA 2ACSA 4MTVA 4Q8MA 1C9WA 1RQBA 1B3ZA 2NVAA 3PB0A 3S1VA 1J6PA 1NFGA 4BQ5A 1F7BA 2EJ1A 4YYFA 4DBUA 1GZGA 3W83A 5BRQA 5RUBA 3N15A 4DM2A 2PCEA 4MUPA 2GDVA 3QF0A 1GG0A 4AWSA 2VX5A 1TJ2A 4FX7A 3SCNA 4B4FA 2GUBA 4BWLA 5K9XA 3B06A 3WLSA 2RHGA 4UUIA 3SCWA 3W2UA 1CBGA 3BUVA 4B5NA 3A12A 2VDIA 1R6WA 3KHDA 3UWEA 2FDSA 3KBWA 5HPOA 2IQ0A 4OZOA 1SFLA 3K13A 1JL8A 3IK2A 4UQEA 2J77A 1J4EA 5I03A 3IEBA 2XVPA 4DELA 4FR1A 1W9VA 2FLIA 2PB1A 3WLQA 2E09A 2QUNA 3NOYA 1RLCL 1DVJA 5D2VA 2PDPA 3MT1A 1JPMA 1J01A 2J4GA 3WK1A 3I6EA 1ICPA 1H50A 3KW3A 1SMDA 3CB3A 5GQBA 1HJXA 1FCBA 4IL2A 3TYEA 1POJA 3MSYA 1JZ5A 4F3HA 1A3WA 3QH2A 1EC8A 3HV9A 3LXCA 4LNYA 2X8RA 3FA5A 4JQ2A 4HSNA 3WJXA 1HKWA 3LXAA 2A21A 2IXUA 4KBXA 3T0TA 2WSQA 4S3JA 4YHEA 4G7FA 1VBHA 2R24A 2EPKX 3W71A 1JZ7A 2WZMA 2GJNA 3CC1A 3FS2A 2G0WA 3CYJA 4X2RA 2WVUA 2OEMA 5HANA 2P8BA 3V0TA 3ZLHA 3W7JA 4JN8A 1QPOA 3BLFA 3K8LA 1R2RA 1EKOA 3ITCA 1WZMA 1PE1A 3STPA 3L12A 2BOGX 4G2DA 1E1CA 2VZOA 3ITXA 1IWPA 3PBMA 2WQPA 1QPRA 1MW0A 2GOKA 4IIGA 2DW7A 1POKA 3DIPA 1PYFA 3RLVA 5AY7A 1P1MA 1NOUA 3NZPA 1C7TA 5G4HC 2J8FA 4X22A 3P7YA 3QLLA 1NTHA 4QQUA 3S5ZA 5AYYA 1XRTA 4C6QA 3NG3A 1N8IA 2H3BA 1UZHA 3W1PA 3WF3A 4PSRA 1HG3A 4LAOA 3N3MA 4PUKA 4AVNA 4CLMA 2IXVA 5CBIA 3LCWA 5I3FA 3QYSA 3W7QA 1FHUA 1MQPA 2OYLA 5C71A 1O5QA 4ROPA 3N04A 1W1B1 2X1TA 1EJXC 4YPJA 1KRAC 2PDCA 1TO3A 1TQJA 2V63A 3KDOA 1X1ZA 3B0PA 4H83A 3AMGA 4M1RA 1XUZA 1R2SA 2ISFA 4LC8A 2YBUA 3LV5A 5L6UA 1ITCA 1OYBA 2QZRA 2WC3A 3FJ4A 2C1IA 2QCDA 1RSCA 4UCFA 4HHLA 4CQBA 3QFEA 1BWLA 3WLIA 3QMRA 3OLGA 3UQNA 3BSMA 3N2MA 1PDYA 2CZ5A 1X38A 2PRHA 1XGZA 3LN3A 5I78A 3VIMA 3WIJA 2X09A 4BS0A 3WL0A 1FVPA 3VDGA 3UCDA 4JKLA 2J79A 1U30A 3A5FA 2A6NA 3BCFA 4Q4SA 2DP3A 3B97A 1F5ZA 3M0KA 5A6TC 4HK6A 1CXKA 3W7KA 1BHGA 3T0CA 4P7LA 3MUXA 3VKBA 3FHAA 1E70M 4JX6A 4XD3A 1G9HA 4C6OA 1FWSA 1IT8A 4Q8WA 1DL3A 1NF0A 3MP5A 3VVGA 3G1HA 2PDLA 2Y7DA 4JQ3A 1EIBA 5F2MA 1TPUA 1CXHA 1W1IE 2FTPA 4KWWA 4KH2A 2OMAA 3VD9A 1XYMA 4ILSA 1WUEA 1WBHA 4RKAA 2V5KA 3J7HA 1V3HA 2G96A 3DHUA 3E6EA 1UA7A 1N8WA 1CXIA 5AVHA 5CLWA 1AH0A 2ZC8A 4AY1A 3RM4A 3EBVA 1SFJA 4KWUA 4EXQA 4O18A 9CGTA 2HPMA 5CBBA 2QUTA 4G7EA 3R5EA 3YPIA 1XX1A 3MUY1 1N82A 4GACA 3R0UA 1YDYA 3AHTA 4AX7A 3CHFA 2P10A 4ICMA 3SCVA 4KQNA 3LRLA 3CIVA 1AQMA 3MI6A 1K9TA 1ISVA 4CN4A 1T99A 3UGRA 3LCLA 4RZ4A 3KBVA 3S5NA 4EVZA 2E67A 4DYJA 1P0NA 4NU7A 4WDWA 4JNMA 3GYEA 3I10A 1H60A 2VVNA 3VM7A 2AQOA 4ZODA 1UD6A 4ERGA 4O1BA 4MY9A 1HKKA 4E2OA 3SZ8A 4DM1A 5CZSA 3NZ1A 4ZE4A 1TWWA 1FOBA 2A3AA 4NYYA 4GD0A 1XJBA 1TCMA 1L8PA 4D6IA 3EB2A 1F8IA 5E1QA 3HM7A 1GYNA 3GQYA 2I14A 1ADDA 3M07A 4K1WA 4J2MA 3M5YA 4LPCA 3M6DA 3LRKA 4XO7A 2MANA 5AC4A 4WKAA 4AUBA 1ZP3A 3TJXA 3HF3A 2TSYA 1FBAA 1MUWA 1U83A 3BQ6A 3UR5A 2VC7A 3GU1A 1GOXA 5HJXA 2JKAA 5CLTA 2H9AB 2VDGA 4GIEA 1FWBC 2YX0A 4H8HA 1YBQB 5AHIA 4C6NA 3C86A 2JFEX 5EMMA 2C14A 3VKKA 3EKGA 3S47A 5A8PA 3LBMA 5J8LA 4L1WA 4NZ1A 1YE6A 2V2HA 2RDTA 3S1UA 3VINA 4WZHA 3S1XA 4R7WA 2PDFA 3HV8A 3EOLA 1FHDA 1H5VA 3NXLA 1D7KA 3NQ2A 3AIQA 3XISA 3BAIA 3IACA 1OCNA 1C92A 2Y63A 3G77A 1SFSA 1W5PA 2W27A 4IT1A 3FGCB 3MCOA 1MEHA 4HSOA 2XGZA 2KX9A 3V75A 1ZJIA 3DECA 4IP4A 5A95A 1BQGA 1M9HA 5G1TA 3LLDA 1JGMA 4JDYA 4IICA 2WHLA 1VEMA 4C1LA 4ZSTA 5FAJA 1PUDA 2WJEA 3H4XA 4Y9NA 4ZFCA 4IPIA 1XIHA 4GPNA 3LHZA 3PM6A 5D2YA 1P6WA 3NL2A 2PD9A 1T0OA 1DXIA 1K8YA 1UKQA 1Q8AA 4L1GA 1XLKA 3IJ9A 2DQXA 4N7QA 5FA5A 1NFPA 2AKMA 3H70A 2CXGA 3M9YA 5AHMA 1AVAA 5CPMA 1DJQA 2CITA 2WV8A 3KLKA 4NUWA 1EBHA 1IGWA 3M0LA 4CEUC 3KVJA 1VEOA 1W9UA 3P60A 2TPSA 1MO0A 5EB8A 2X1IA 3E2SA 3U8GA 1RK6A 1SYTA 3BCJA 3BG9A 4LUTA 2IQDA 3ZR4A 5T91A 2ISWA 4QJ3B 3G3MA 3PC0A 4YYCA 4NJJA 1EX5A 1XDJA 4JIEA 2TODA 3K30A 1XWYA 2YA2A 5CC7A 1WKEA 1FY6A 2E1DA 2G3MA 4DJDD 1KFEA 1KBLA 1LCOA 1UROA 1OGGA 5GVJA 5GPRA 1WPCA 2W63A 5DT7A 4TUFA 4H04A 1S1PA 4H8VA 4RZ5A 1GOMA 3P5ZA 5MKGA 4JR5A 1CGYA 1VFOA 3PZMA 3BARA 3TW9A 1G01A 1VBJA 1WKDA 3C6CA 3NQFA 2FPYA 2YXOA 2CEQA 2PMQA 3UCQA 1IEIA 4CQDA 2WQDA 2YDAA 2CKRA 3L68A 4DBSA 5BRBA 4IOTA 3VFCA 4WQ6A 3AMKA 1J2WA 3E0VA 5HXMA 1MVYA 2XVGA 1GTEA 2VFDA 2UZ9A 1S1RA 5A2BA 5REQB 4LV9A 2VC5A 3ITVA 4GJIA 4QNEA 1QW9A 2P53A 3LI0A 3CPUA 3DAQA 3QC3A 4RDVA 4WX2A 3VD7A 3DC8A 1XYLA 3WLKX 4AB4A 3AMLA 1B9BA 1P0EA 4AMAA 2AAMA 4JN7A 2R91A 1Q3NA 3LY0A 3S3GA 1K1DA 4J9JA 1ZY9A 3N9SA 1CECA 3EXRA 1QO5A 2WBGA 4TTUA 1UH4A 1E40A 1DWAM 1PAMA 2OODA 3EDDA 3O9NA 1KM2A 1LRQA 1S39A 4DZIA 1X1OA 3DFOA 1QT1A 1V0KA 3EPNA 4DLFA 4IQLA 4LVAA 3VXGA 1WDPA 4GNKB 2BXYA 3FEMA 3IV3A 3GG1A 3ZLFA 2GJXB 2ZUUA 5DBUA 3R7MA 3G1XA 1C29A 4TV6A 4KPLA 1FRBA 1G1YA 3APTA 4UR8A 1O66A 5C7HA 4E2BA 4D1JA 2ISSA 2WWCA 1QNOA 2VWTA 4M51A 4F0KA 4ZCWA 4BF5A 3FSTA 3QC0A 3L4TA 2QPXA 4DJFD 3II1A 2NXHA 3T07A 3WQWA 2W67A 2Y5EA 1P48A 4POCA 4E0CA 2ACUA 4PUNA 2QCFA 4IPLA 3SGGA 4IP5A 3ME3A 4HPNA 4XZMX 1FXPA 4OOUA 4B5TA 3G1RA 4WJXA 1UC5A 3EB4A 2WW5A 2POZA 3DI1A 3BW3A 1S38A 5U4NA 3U48A 3SO7A 2FTYA 1R9ZA 1FCUA 4AW7A 1V3IA 3U4FA 3TX9A 1TV3A 5CQ1A 4AC1X 1QAPA 4WHBA 3N4AA 5EMYA 3BOLA 4S3DA 2X05A 4QDPA 4KFNA 5A6KA 4GGBA 1QU4A 2VZVA 3C2EA 1Q6CA 3NL6A 5DANA 2WB5A 4GVIA 3H12A 4PYSA 2WSYA 2GGHA 4PMJA 3T1GA 1Q6GA 1GVOA 1TV7A 1JQVA 2YL5A 5LNSA 2WNZA 3MANA 4QLJA 4HKPA 4I6VA 3WQDA 3C2OA 3PZIA 5IFTA 5CAHA 1OC7A 2GPTA 2DZTA 1J0YA 1LOLA 1JCNA 3S83A 3TFXA 3WY1A 1S2TA 1GVQA 2CCRA 4MLRA 5JBEA 4JFTA 3TVAA 3STFA 1YHTA 4M0XA 3EA1A 2FHFA 4LAKA 2ZDRA 4FOUA 5A94A 3VIGA 3TJIA 3NEVA 3OQEA 4NX5A 5CSRA 3M47A 3NUKA 4TX8A 1U2YA 1PKNA 3IPWA 4DO7A 5K2ZA 1A5CA 1DWIM 1JUKA 1XQLA 4CNNA 4MZYA 4OFCA 1UR3M 2CLEA 1CIUA 3BC9A 3GDRA 5IHSA 4D8ZA 3GU9A 1TVNA 3S6TA 1A49A 4IG2B 4WXZA 3OEXA 2VEIA 4QDWA 3PHAA 2Z4GA 2HZGA 1S3HA 2E1WA 1LWHA 4HYWA 4BI6A 1FHLA 4R34A 2OZ8A 3AWOA 2HRWA 4O17A 3KTSA 5CSYA 4CVWA 4DZ5A 2MNRA 4Z1BA 4XKMA 5H1WA 3OTRA 5ABFB 1NP2A 4JX5A 4PMNA 3G22A 3GTIA 3HFYA 3TQKA 2PSNA 4LBRA 1U5HA 2OU4A 2ATMA 5CPOA 4UB9A 3L2LA 1NP0A 5DLCA 3OOQA 1UBSA 3N4FA 1XCFA 1B3OA 1K6AA 3BG3A 3IJLA 1US0A 4O1DA 3WCZA 1TPWA 1FWJC 2HVOA 2BG5A 4NZ5A 3IIOA 4XZBA 1W1YA 3L4YA 3TONA 2BP1A 2Y8UA 2JK2A 1Q6LA 2DJLA 2A1YA 4Q4MA 1TVPA 2OT0A 3V0SA 3ES7A 1VIWA 5LIUX 2OWXA 3ZR6A 2YLAA 3DYOA 1WZKA 4RCXA 3DXIA 3PAOA 4GH1A 4HA1A 2ZE3A 2CU0A 2I5IA 3GDBA 3ZVHA 4CCDA 1PKLA 3PK7A 2G95A 3WKZA 1G94A 5FF2A 1L6WA 4AIBA 5HWNA 3UD6A 3MUAA 5BU9A 1BVWA 4A8RA 5KZMA 4RE2A 1NQ6A 4Y9PA 4PTWA 3CJPA 4JIHA 2O9RA 3DFQA 1Y65A 2VELA 3D46A 2G3NA 3JS3A 3EPOA 3MO4A 4DPPA 4GZJA 3GNRA 1Q85A 3HGOA 5FIPA 4QTGA 1S2UA 7TAAA 4M80A 1PYMA 1DQWA 2Z29A 4B9ZA 4DF1A 2CIPA 5FL1A 4PGLA 3W9ZA 4H9YA 4TU1A 3A4JA 5D02A 4TVCA 3BL3A 3OYZA 1UMYA 4FNUA 3FK4A 1UWRA 4REQB 4C6BA 2PFHA 2WVTA 2IPWA 4Q8VA 3FSUA 1C8YA 4XK2A 2XZ7A 1XG4A 2QXWA 3QV6A 3NJ3A 4FS9A 3DG7A 4G5DA 4Q32A 1XC6A 3MV11 2VYOA 1BRLB 3ZLGA 1VC4A 4GX8A 1KM4A 2UV8G 4G6CA 4W84A 4JCLA 3GTFA 2PURA 5I2UA 1I45A 3DKJA 4KERA 4LVFA 3ZO9A 2G97A 2WBKA 2CFFA 4HTBA 2J7HA 1QNSA 1EJ7L 4W5UA 5FSEC 3R89A 3POCA 1XFCA 3CWNA 4GY0A 1JD9A 5D9MA 4IWWA 3STCA 4DUOA 5AZ1A 5CBJA 4GZIA 1Q6RA 3DBNA 1YPXA 2DQWA 1TRDA 4D6JA 2DH3A 2O7QA 4GWEA 1WP6A 3LYEA 2YDQA 3GU2A 3GXNA 4JKKA 4MY1A 4O14A 4TXEA 4GY1A 3C61A 3DFTA 2G37A 1GZ1A 2VX7A 4H9VA 2J27A 3VNYA 2ZRYA 2AAAA 3P6LA 4ZQMA 1RXOB 4JTFA 2Y62A 3VA8A 1XL9A 3KBSA 1NJJA 3UVAA 4LTSA 4PC8A 1W3TA 1US3A 2YA1A 4F9DA 3DDMA 3BOXA 1ONRA 1OFDA 1QPQA 3ATZA 1KXHA 1XIMA 1Q66A 3PBWA 2VEGA 4H9MA 5G2IA 2VFEA 1PIIA 1UWSA 4NZFA 1KLYA 2ZOXA 2A6LA 3W26A 4HJFA 1JCYA 2VI0A 4KEMA 4WDTA 2VRQA 3AIWA 2VEFA 3B4YA 4IGNA 4HCLA 4JYEA 5FI8A 3W00A 4AVFA 1V3KA 4W87A 2C71A 3LB0A 1O12A 4UOJA 6CGTA 1KV8A 5IRPA 2CWXA 1OD0A 5HINA 1M7JA 3RCYA 3ZXWA 4DAFA 3VDBA 2FZ8A 1XIFA 1D3GA 4MMWA 2ZDSA 2AKZA 2Q8LA 3U5YA 2EPHA 3FA4A 3FYPA 4YXGA 3NVDA 1M53A 1TWIA 1A5BA 5JBDA 2VFGA 1SO4A 3WMBA 1MW3A 4LB3A 1B1YA 2Z1XA 1E9IA 1IWAA 4M6UA 4I7UA 4C90A 4R53A 3AFBA 3USBA 3HMCA 3O6CA 2OKOA 2HXUA 4UMAA 3L67A 2DIEA 4S3FA 1IHIA 3ERPA 4UFMA 3FXGA 1KTCA 3NO5A 4PB4A 3LGDA 3AIBA 3SB0A 3W2NA 3NNTA 2CHNA 1GTHA 1XH2A 4I9AA 2QMJA 1XCXA 1DWGM 4XZIA 4IUGA 1VJIA 2D0GA 2HVMA 3NSMA 2A3LA 4NI8A 2HV5A 4NP7A 3VZXA