3W7MA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-3-063
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-063
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7mA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7mA01
3K30A 3Q37A 4PTNA 2FDSA 1MZHA 3W72A 1NFBA 2V2CA 4O52A 4DO4A 4MOZA 1QWGA 1G7VA 4OQVA 4MJMA 3LHWA 3BGJA 4Q4KA 5F4XA 4NT0A 2CLEA 5LNSA 2Y7EA 1Q6LA 4UTJA 5LGXA 1UUMA 3MBFA 2CFFA 3EWWA 5AHNA 6TIMA 5D33A 4UUIA 3W7IA 4LC6A 3G1VA 3TQKA 5CPLA 4M6VA 4DF2A 5KZMA 3LHVA 2ZDRA 2B4GA 3W7OA 3L2IA 1GVFA 3DXIA 4QISA 2Q3OA 4MYAA 1DV7A 3G1YA 4KFOA 5FEZA 1VJIA 3NL2A 5IBXC 2QAFA 1X6UA 3M43A 2WSRA 1KFJA 1XC4A 4JYFA 2LLEA 2A6NA 4MY8A 3GDTA 3KOFA 3S5NA 4LVBA 4GUGA 3I7RA 4HNVA 1VYPX 2BSLA 2VENA 1KLYA 1TMHA 1O95A 1YTDA 3P84A 1DKWA 3M47A 1ICSA 3ZFHA 1GT8A 3W7PA 4IMDA 1RV8A 3G0SA 2G95A 4NXKA 2ZYFA 4WOQA 2GPTA 4N02A 3P67A 1KM3A 4XTDA 1H63A 2W79A 2Y63A 5CGQA 1Z44A 4O15A 1T99A 2BLEA 3GX9A 3PBUA 3W86A 4M19A 3DAQA 1AL8A 4AB4A 4LS2A 4XBKA 2NX3A 5D2YA 3VKJA 3O05A 5G1TA 3UWYA 4MY9A 3CHVA 1FXQA 2ZRUA 3CWNA 3PVFA 3UQNA 2GVJA 1P4CA 3B8DA 1GWJA 3L0GA 5C55A 2FPTA 3W71A 3NQ2A 1FBAA 2JGQA 4O4VA 4EOUA 1C8VA 5K4ZA 2QCGA 1NSJA 4E0CA 3W1XA 2ZCGA 5AC6A 2ZRXA 2CLOA 1YTEA 4XKYA 3TMQA 4GE8A 3MHUA 3T7VA 2DZSA 2VFDA 4Z1BA 4UFKA 5EKYA 2XN1A 2QCDB 1S3HA 4MFEA 1OFPA 1SFLA 5I3KA 1G4EA 1TPWA 2I9EA 3OIXA 2NLIA 3HPXA 3KRSA 3WJSA 1TIMA 1JR1A 3EKLA 1VR6A 3TMLA 4RZ5A 4AHPA 2C16A 3HG3A 1ZY9A 3W1NA 3LHUA 1LCOA 3NQMA 1LM1A 4KFPA 2Z6IA 5G4WA 1TRIA 4P2VA 3LCWA 2B0MA 2QUTA 1D3GA 1K02A 2O7QA 2TPSA 3C2OA 1PIIA 3IVUA 1M6JA 3PC0A 4UR7A 3GR7A 1ME7A 5FEWA 4FNSA 1TPC1 3NGJA 4NNAA 2CU0A 3TNOA 5F2LA 3RFAA 1OYCA 4JNMA 1H51A 1RZMA 2J27A 4RK8A 3QPZA 3C2RA 1PV8A 1YXDA 3C61A 1SW3A 1QPRA 1SZEA 2D73A 1G67A 3PSWA 3H53A 1WQ5A 5FF2A 1JQVA 5E93A 4RZ4A 1GVQA 4XZ9A 3GDMA 2B7OA 3W2LA 4O10A 5EY5A 3GAYA 3WK0A 5KSWA 4AWUA 3NAVA 2A4AA 4JIPA 1VLIA 1H60A 2WJZA 4IX0A 4HHPA 4GNJA 3B0PA 4JS3A 4WJEA 3GDKA 2PURA 4A2RA 4ZQPA 2ZBTA 2FLIA 4I7WA 3FJ6A 3S42A 3P82A 2WPBA 3WJZA 1TTQA 1G6CA 2J9XA 1FY6A 1LDCA 1F76A 5TIMA 1J4EA 1FWSA 3S1XA 1EWEA 1V5XA 3C2VA 4J9JA 7TIMA 4RXFA 2PE4A 2X1SA 3HGRA 3KFTA 4N4QA 3MUXA 2DORA 3DFNA 1KW1A 4WY0B 4FX6M 1Z41A 3LTPA 5KINA 5AHMA 3ATZA 4FB7A 5J5RA 3ZR4A 2QDGA 1A50A 1MXSA 2PRMA 3JRKA 4U4MA 2DZWA 1B9BA 1QPNA 1WV2A 4K37A 3W07A 2GJNA 1QR7A 5LNUA 4Q32A 4PC8A 1RVGA 3W1UA 3IIPA 3S6DA 3WK3A 2Y7DA 5F1UA 3SY5A 1I2RA 1LRTA 4YWIA 3O6CA 3O15A 4LS0A 2IQTA 4FX8A 1F73A 1H61A 1SQ7A 1EUAA 4N2YA 4FIRA 1AL7A 3CEPA 3O16A 2C18A 1IF2A 1ALDA 3O07A 4KFNA 3LCLA 2NWSA 2CLMA 5C2XA 2HS8A 3N34A 3HIJA 4UTTA 5DY3A 3W2NA 3W7QA 4H3DA 4FO4A 4LVAA 3M41A 5CZTA 1KBIA 4QSHA 3OBKA 2WKJA 4GUJA 4JICA 5DN1A 1AW2A 3KXQA 3GYEA 2YGYA 3W1RA 1IXOA 4FNRA 1JVNA 1W54A 2C0AA 2JGYA 1FDZA 1Q45A 1KV5A 2F84A 1JCJA 5D02A 1B3OA 3SSJA 5BW6A 4YCOA 1IXQA 5GVJA 4PL1A 1G4PA 1QAPA 2VEMA 4WUIA 4YLWA 2NUYA 2FB3A 1YPFA 4YL2A 1VCFA 5I3GA 2H8XA 4POCA 5TBOA 1YPIA 5EL1A 3NQ8A 3STGA 3CC1A 3CIWA 2QR6A 2G96A 1DVJA 3W7GA 4N4PA 5HMSA 5AC8A 4PODA 4XQ6A 5AHEA 1AG1O 4ZZ9A 5FEPA 3A9IA 1LROA 3N14A 3TFCA 3HPZA 1H7PA 5HUPA 1LRNA 1JCMP 3RF9A 3PWAA 5C5YA 1A5SA 1R2RA 4JYEA 3TC6A 5K3VA 1VHCA 1XUUA 1FCUA 1O4UA 1BTMA 1D9EA 3L5AA 1SSGA 5L6UA 1WYIA 3G8EA 4UNLA 2I1OA 1YXYA 4A3UA 4QIUA 1XDLA 2R14A 4FNUA 3LERA 3DGRA 3W7CA 3G3MA 4NZFA 1C29A 3L9CA 3CPRA 5K2ZA 3IIXA 1A5BA 2C19A 3RK8A 1PHWA 5DLCA 1N7KA 2Y7FA 2ZA1A 1SU5A 1ZENA 4OV4A 3IGXA 5BOOA 1H62A 1XXXA 3Q58A 4K36A 1LLWA 4LVFA 4JD4A 1NEYA 4X3ZA 5D2TA 3I68A 3NOEA 4Z0SA 2ISSA 1KLZA 3LTSA 3NQDA 3CM4A 2ZTKA 3HGSA 4DPQA 1OFOA 2ZA3A 3BG9A 3S9YA 4QJ1A 3S8HA 1NF7A 3B4UA 5E1QA 3LOTA 2X16A 3W84A 3L68A 4PA8A 3NM3A 1TJRA 1MEIA 4Z1DA 3UWQA 3PUDA 2QCHA 3EWUA 1F05A 3W85A 3C2FA 2WO5A 2XFWA 3TV8A 3OG3A 4GRSA 3LLDA 2A5HA 3QQ1A 1JUKA 2V2HA 3ELFA 3VI2A 3NL5A 1PS9A 3NA8A 1H5YA 1KM4A 4QNEA 3NQEA 2H3BA 1DORA 4ONVA 1LORA 1DJQA 2QEZA 4KKXA 3S5YA 1O60A 4TO8A 1SO5A 2QCLA 3L0KA 1OG0A 5AYZA 3MI3A 4MLRA 3EWXA 5LNVA 4NX5A 2Y61A 5A5WA 3TX9A 3FYOA 1UCWA 2GJLA 4GUHA 3LHZA 1H50A 4HNTA 4YCPA 3LV6A 1LTDA 2YZRA 1PCWA 3EX6A 4ORMA 4CNPA 4UTIA 5DCDA 2G97A 1HTIA 4LT9A 3V1PA 2DJXA 2O7SA 1BKSA 1VLWA 3MP5A 3HB9A 2Y89A 2Q8ZA 4N6EA 3C3NA 3G22A 1CW2A 3PBWA 3WJXA 3QSRA 3MHFA 5DBTA 3BW3A 1UBSA 4BK9A 3Q94A 1GEQA 3R5EA 4FXSA 4XKYB 4N9CA 3F1QA 4UTWC 1OX5A 2NXHA 2X2GA 3KVKA 3V75A 1OX4A 3QF0A 4HSNA 3CEUA 2J24A 3WK2A 2NX1A 5I3IA 4K7YA 4O50A 4NQ1A 4NJKA 2C13A 1FCVA 3S1UA 1NF0A 1HUVA 4FNTA 4K7VA 1KM6A 4MZ1A 1DJNA 1X1ZA 1I4NA 4JR5A 3BW4A 1R47A 2QJGA 1TYGA 4XBSA 3TKFA 3P81A 2C1HA 4O57A 1TPB1 1N55A 4Z1AA 1Q6RA 3NQ7A 4ZQOA 3FJLA 1W56A 3DFPA 3SI9A 3I7SA 2CZ5A 2X1RA 1D3HA 3MW7A 3BK0A 2YYUA 1JCYA 1ZJIA 4CCEA 5BNKA 1RPXA 4RR4A 2QCNA 1SR9A 3SGZA 3SGUA 1EWDA 4N9EA 5U4NA 3BVJA 4O13A 1LBMA 1ICQA 4CNNA 1SW0A 2Y6ZA 3PM6A 5T26A 5BMWA 3LXAA 3B0UX 1B4KA 1WA3A 2UV8G 3TW7A 5SWUA 3F4WA 3W1AA 2PC4A 4Z1CA 5C54A 4NJGA 1O5XA 2TMDA 2WQPA 3T4CA 1T0OA 4ICNA 2E6FA 1JRBA 2YW3A 5FF7A 3GK0A 2RDUA 4IWWA 4GBUA 2ZZ7A 3G1XA 4K6AA 2YR1A 3LI1A 1ADOA 4N9BA 3R13A 1FWTA 2OX1A 1LOSA 3IIVA 5KTLA 5CG7A 5MHBA 3C56A 5AFDA 4AF0A 3LBCA 4LVGA 3E02A 3MYOA 3FLUA 4UTHA 1OYAA 4EWND 3IIOA 3IEBA 1SZNA 3NNTA 3T55A 1FWNA 2RDTA 3NL3A 1AMKA 1VGAA 1XDMA 4GXMA 4O0KA 1VCGA 5DXYA 5LKYA 3LV5A 1PVNA 4H4IA 4MYXA 3LCHA 4AXKA 1OFEA 2V5BA 2V8ZA 4JTHA 4JXCA 4PCFA 3LCIA 3AO0A 3W2UA 1L2UA 3G1HA 4HT3A 3GIYA 2VFHA 1FCBA 1QOQA 1FWWA 1Z42A 1ZCOA 4YXGA 5I3HA 3EWZA 1I2NA 4IMFA 3D0CA 3G8RA 4GUIA 2GOUA 1ML1A 3L66A 1KBJA 1R2TA 3W87A 5HJLA 3SJ3A 1TB3A 1HO4A 3L21A 3HF3A 3C52A 1OFQA 3RLUA 5F4WA 2KZHA 1RR2A 1HL2A 4K8EA 2ALDA 4OV9A 3QMRA 4AEOA 1F5ZA 4LVDA 4I7VA 2QJIA 3W9ZA 5HR7A 3CTLA 2VXNA 2GQ9A 1FUYA 2Z0IA 4TR9A 1THFD 3M16A 2FQIA 2ISVA 1PCKA 2GUUA 3DFOA 3W1TA 4NNBA 3NPXA 1V7YA 2Y7GA 4RLIA 1CI1A 1G69A 1BEUA 2OJPA 4JX5A 1GTHA 3EXRA 3DENA 3INPA 1A5CA 3A23A 3HOJA 3W1MA 4E38A 1SFJA 3O1NA 2DZPA 3W76A 1W3IA 1EX5A 4LTSA 1EA0A 5D03A 4ZQCA 3O6YX 3NM1A 1T96A 1XFBA 3C0JA 1WOAA 5I3JA 1EUNA 2DZVA 3G0XA 3W70A 4S2CA 2EKCA 4I7UA 2QCCA 3EXSA 4WOZA 1OABA 3STCA 2VFGA 4JX4A 4LNYA 2HMCA 4LW7A 3LX9A 3CT7A 3NVTA 1Y0EA 1VRDA 4PH6A 3P74A 3QQ0A 1I8JA 3DI0A 3NPWA 5AHLA 2OMAA 4IOTA 5LNWA 3P5YA 4K38A 1QO2A 1QNVA 4BFAA 1B57A 1OF6A 2JBMA 4RX0A 3WFAA 3O8AA 5U7SA 5IBXA 4MIMA 3LCGA 3SECA 1QMLA 3SW6A 2CZEA 3TR2A 1LYXA 3KVLA 3U2OA 4UTUA 2YDAA 4RV8A 2E77A 3FIGA 1Q6QA 3TIMA 4HPXA 2ABBA 1LZOA 2AGKA 1N8FA 3QC3A 4BI5A 4LV4A 2JKEA 3IGUA 3P80A 2BWGA 4Y96A 2H6RA 3MMTA 1VHNA 1K3UA 2E1DA 3O63A 3HG5A 1W3TA 2WOQA 4NX0A 2V9DA 1LRQA 4O19A 3FA5A 2J9YA 4UC5A 4BWLC 1KTNA 4GUFA 2QCFA 5F4SA 3MJYA 3LHTA 3QM3A 4XWUA 3PB2A 2VEIA 2CLIA 2Z6JA 1XI3A 3T78A 3M5YA 4UMBA 3W7EA 5DBUA 3PUOA 4WQ6A 4HN4A 1DBTA 3W7DA 1Q3NA 4CQ9A 3PUEA 1FWRA 1JCNA 2OT0A 3W6YA 1O94A 1SSDA 1LOQA 2ZZ3A 1FXPA 1W5MA 5G4EA 2OCZA 2B7QA 2CLFA 2ATMA 3MI6A 5D2VA 4DQWA 4LC8A 1UB3A 6ALDA 3S1VA 1R46A 3LXBA 1IXPA 3F03K 3MHGA 3BGGA 4FXRA 3ANYA 3EX4A 1QDSA 3G1AA 4O1BA 3QSTA 1OVDA 3ZWSA 3GDLA 2A85A 1VYSX 4JTTA 1OFBA 3CIXA 3HBLA 5G5IA 3W7MA 3TA6A 1VZWA 4AAJA 3R89A 2PRLA 1EP2A 3NPVA 1TV7A 2DZXA 4CQAA 3NPUA 4IPIA 1H1YA 2OT1A 4G1KA 3C2EA 2HTMA 5HWMA 1XCFA 4B5NA 3G0UA 5HULA 1TREA 1R30A 3N9RA 1TCDA 5F2GA 1OHLA 4EF9A 2JK2A 1W37A 5FF3A 3JS3A 5A8GA 3GVGA 1TPFA 3UPWA 2EF9A 1H7NA 2GQ8A 2QCEA 3R2GA 4DEFA 2CW6A 4AWSA 3UXAA 2ZZ1A 1T8XA 3TU9A 3R12A 1G4SA 2FJKA 1LBFA 3G3DA 3KAOA 3DH7A 4M6PA 2J6XA 3NG3A 1VQTA 2DZUA 4LRSA 5EBUA 3P5ZA 3PF3A 2HSAA 3NQFA 3W75A 2A0NA 1U5JA 3E0IA 4JTLA 2WSYA 4WXYA 5CZ0A 1DL3A 5D32A 3EX2A 4TMBA 3KHJA 4MLJA 3FEMA 5AHFA 3EXTA 3CLMA 3PG9A 3TSDA 4EF8A 1J2WA 1GYNA 1VCVA 3OVPA 3HO8A 1H7WA 3UD6A 3RNDA 3QPYA 1AW1A 4UCGA 1KFBA 1ZNNA 2E68A 4OBTA 3N73A 3UPBA 1PL9A 1OFDA 4AMAA 4MZ8A 1L9WA 4RCXA 1BWKA 1KFEA 1VH7A 3QW4B 4UFMA 3TSMA 4XTIA 2H8ZA 2ZRVA 2FB2A 1ME8A 4TMCA 3BARA 4LS1A 1OX6A 5FEXA 1I2QA 3KX6A 1TTJA 3CB8A 1IXNA 1H7XA 2NV1A 3W83A 5D2XA 3L67A 4LY8A 3L5LA 3M5ZA 2VFEA 4W9TA 1YADA 3GR8A 4AF0B 2NXIA 2GVGA 1JJKA 4JY8A 1GVOA 4NU7A 3O06A 3QJAA 1XBZA 5CPMA 4DO5A 1K7FA 4KWWA 4JY9A 4KWVA 1EEPA 3IVSA 1IIHA 2FIQA 2Z2UA 2E5BA 3B05A 3O6DA 4FNPA 4JGDA 4O0ZA 5HR6A 3W2MA 5D38A 2B7PA 2YPIA 2ZRWA 3UZJA 3EWBX 2Q8LA 2BTMA 2YFNA 4L4MA 2WV8A 3T44A 3N3MA 1GYLA 4GFSA 2BXVA 3FOKA 5F2MA 4FF7A 3A22A 2Q3RA 1TTIA 2P10A 1QOPA 2YXGA 1WOBA 4CCCA 5CKSA 2CLHA 2FPYA 3BG3A 4QM1A 3ZWTA 1KM5A 4UTLA 3UWUA 3UXDA 2J9ZA 1YDVA 5G2IA 1L6YA 4ZMGA 3DHDA 4R53A 1IIGA 5G2HA 1FCQA 1HO1A 3HG4A 2Y70A 4LV9A 4P61A 4BI6A 4NXSA 1P5BA 1GQNA 3HJZA 2V30A 5H91A 4JTUA 4JIQA 3B03A 1FDYA 1I45A 2V0TA 5FESA 1XM3A 3QEZA 2CZDA 3S5ZA 4A29A 2YFOA 3C4UA 4X9SA 4UTKA 3W2KA 3N2XA 2OZ0A 3LTYA 1H7RA 1TV5A 5J5DA 3LM7A 3QH2A 2C15A 3TW6A 3W7LA 1W3NA 3TQ0A 1ZFJA 2A1YA 2A2IA 2E5CA 2CLKA 2ISWA 5K9CA 4I9AA 3TUUA 1GPWA 3HQ1A 4IMEA 2HS6A 3TAOA 4AHQA 3S0CA 4A21A 3USBA 3L65A 4JN6A 2X1UA 1L6WA 4K39A 1S5WA 4D2JA 4A2SA 2CZFA 4NJHA 3MO7A 3TSBA 3NZ1A 2P1FA 2ATSA 1BWLA 2ZRZA 3PR2A 3E49A 2VFFA 4RXGA 2W6RA 3TC7A 3VE9A 1ZALA 3ABQA 5CZSA 5AYYA 2XN2A 5AYXA 1ZHAA 2A7PA 4OT7A 2FFCA 4UFHA 3ABOA 3A24A 4WY0F 5K4XA 1LLZA 1SW7A 3M0ZA 4FIQA 1TSIA 3H55A 4QNWA 3M7WA 4PEKA 3BLEA 5HWJA 3N19B 1YYAA 3KRZA 3B06A 1C9DA 2EAWA 3THQA 1GG0A 3P60A 5D05A 1MSSA 3MWAA 3DFTA 3W7HA 3BLIA 3BV4A 3PB0A 3T40A 3L0NA 3QZEA 3ZS4A 2E09A 2QCMA 4IGHA 4UR8A 2ZZ5A 2A21A 2DU2A 5D04C 1KV8A 2ZFAA 3PULA 1H7OA 4R33A 4RJEA 2J88A 5LNRA 2QDHA 1VS1A 3E12A 5CSSA 1JCXA 3I65A 1XL9A 4JTKA 3OA3A 5K9XA 3GB6A 3W88A 5LZLA 5D2WA 4IXHA 3B0VC 4O16A 1DHPA 2RKXA 1GG1A 3U8GA 1MEWA 3IGSA 1W5PA 1QCWA 1DQWA 3UWWA 4IPJA 2R8WA 1YDNA 4LWWA 1MO0A 3P62A 1G7UA 2YSWA 3CQ0A 4IJBA 4MPQA 1KM0A 3M6YA 4QITA 3LRKA 5LSMA 3MI2A 3NQCA 2QJHA 1IGSA 1LBLA 1ICPA 1YTKA 4AWTA 5E0KA 1SO3A 4GC4A 3LB0A 4JX6A 1G4TA 3EX1A 4NUWA 1GJPA 3EKZA 1U83A 5LHFA 3EB2A 2TSYA 3W7RA 3DKJA 1OJXA 4FNQA 2VEPA 1TJPA 2I14A 3PBVA 4EIVA 1LP6A 3TH6A 4UTWA 1GTEA 1EP1A 1OFRA 4PL2A 3UYCA 1NVMA 1F74A 5D37A 3A5FA 4R34A 3TQVA 1GVRA 3WK1A 2YYTA 4O11A 3W1QA 5AB3A 2Z1BA 4WX2A 1TQJA 1K8XA 1VC4A 3GXPA 1P0KA 1UUOA 2ABAA 1PHQA 4C1KA 1TPDA 3DHFA 3GNDA 1Z48A 5AC7A 3QW3A 4MVAA 1JUEA 5G1YA 4O4WA 1M7OA 5DCBA 5KITA 5HNRA 5I3FA 5ABTA 4XUGA 4ZQNA 1EP3A 3UWVA 1VYRA 2X30A 4L4LA 1PE1A 1P0NA 3TAKA 4FHAA 4UTTC 3W23A 1K7XA 3NZRA 4C1LA 4O28A 2V81A 3LGEA 1RD5A 4ZQMA 4IX2A 2RFGA 3LI0A 4M5PA 3W3OA 1A5AA 2VKZG 3A21A 5LGZA 3SIZA 1X8FA 2QUVA 2RDWA 5AOUA 5FF4A 4MJZA 2NV2A 2RHGA 4UMCA 3WJWA 5DCEA 2EGZA 1HFBA 3W74A 3S1WA 1TRDA 1UASA 1EIXA 4JDBA 4NNCA 2JKAA 4IMCA 5HINA 1TO3A 2EHHA 1A53A 3ATYA 3SZ8A 3H54A 3W7KA 3I7QA 3SR7A 5H2ZA 2VFIA 3MP4A 3PS7A 4O53A 4IQLA 1X1OA 4BI7A 1K8ZA 4LUIA 4IXXA 3IVTA 1MEHA 1TV8A 4OE7A 1P1XA 4HKPA 3RLVA 3HGJA 2BZNA 3PBYA 4MZYA 4MY1A 3STEA 5EMUA 4Y90A 2AAMA 1LOLA 3NXFA 1WXJA 1OFAA 3VNDA 5TQLA 1HG3A 2XN0A 4OHQA 3G1DA 2V5LA 1M7PA 3NQGA 3TXVA 3TFXA 1ME9A 1TPEA 3TJLA 4AVFA 4NJJA 2Y85A 3DI1A 1W5NA 2FTPA 2QUUA 2NX9A 1SZFA 3DFQA 5DY2A 5IM51 2NUXA 1XBXA 1L6SA 3W22A 1TPVA 2QAPA 4E2DA 2R94A 1W5OA 2YW4A 1VPXA 4FX7A 1F2JA 5KZDA 3QMTA 3FS2A 3DKLA 1EB3A 2VEKA 3WJYA 4NZJA 4NVTA 3FKKA 4LUJA 3DBPA 5DXXA 2YCEA 3DU0A 2WNNA 3LDVA 1TPH1 4O1DA 1TQXA 4E2BA 3RU6A 5K9DA 4MKNA 2ZA2A 1SZGA 2QF7A 3W1PA 2DP3A 2WSQA 1X7FA 2GQAA 3NQVA 1JRCA 1KTBA 2ZZ6A 2A6LA 4OWGA 3G1FA 3EEGA 3DFSA 3PAJA 4ALDA 2E6AA 2CWNA 3P8IA 4TX9A 2DZTA 2F7FA 1CX9A 4O1CA 5CPOA 2A7RA 4M7TA 2NUWA 2WNZA 3DZ1A 3KVJA 4UFJA 5KMYA 1SPQA 4MUZA 2ZZ2A 3HPSA 3HG2A 4S1FA 5HQEA 4ADTA 4HIBA 3NQ6A 1AK5A 3GDRA 3KVMA 4CLMA 3BO9A 4UNKA 5F2IA 1UJPA 3M5XA 3M5VA 3MBDA 4H6KA 3YPIA 1KM1A 4DO6A 5AHIA 4O17A 2QCDA 2QKFA 1OYBA 5HWNA 2NXGA 3GKAA 4QAIA 2X1TA 4UXDA 4ML9A 4ORIA 4O1AA 4IMGA 3LRMA 4O14A 3OVQA 4A22A 3STFA 4PFMA 1KFLA 2Y88A 4JYDA 3PG8A 2VELA 5DELA 3N9SA 2EPHA 2A7NA 4Z08A 1F6PA 1OX4B 3THAA 4ZL1A 3QRHA 4HPJA 2VC6A 4HSOA 4GWEA 3F4NA 3UNDA 3LXCA 3M1ZA 1R2SA 3W73A 1DQXA 1GZGA 1JUBA 3A5VA 1EPXA 3GAKA 4OU1A 1K7EA 3M9YA 3NEVA 2TRSA 1GOXA 1I2OA 2C6QA 1ZAHA 4DF0A 1JULA 4DXVA 1WBJA 3ABRA 2CLLA 2BX7A 4N6FA 3IRDA 4YMZA 3GZ3A 3U6WA 1KM2A 1RQHA 4EVZA 1W0MA 3E96A 3GXTA 1OK4A 1QO5A 3W7NA 3OHIA 3P7YA 1WAUA 4R7JA 4O8RA 4UFLA 3HMJG 5D09A 1Q6OA 2P0OA 4WD0A 3IV3A 3M44A 2Y62A 4BWLA 4CQ8A 1OF8A 4CCDA 4FEZA 3GNNA 3Q2DA 3TJXA 3EX3A 1FX6A 1NAL1 4X22A 3HGOA 5K7JA 4CNOA 4MFDA 1WX0A 3G1SA 5CPNA 3W1LA 3PSVA 3R8RA 2PRHA 3TCEA 2ZZ4A 1OK6A 2E6YA 4OGZA 4Y8FA 3N2MA 3FKRA 2YX0A 1SO4A 4DELA 1JCLA 2JKPA 4Z0JA 2FPVA 3PY2A 4LOCA 5L9FA 1JQXA 2ZRYA 1KFKA 1GVSA 3ABSA 3S5OA 3QFEA 3B04A 3G18A 4AH7A 5G2WA 1YLVA 3TXZA 4UIOA 5C6MA 1XUZA 2NZLA 3MP3A 4WY0A 4TIMA 4UTMA 1RQBA 4HNUA 1WDWA 1S5VA 2WNQA 1ZAJA 2E5DA 3W2JA 1XKYA 3LCFA 1RQEA 4ZQRA 4JTJA 3OVRA 2H90A 5CZJA 1I2PA 1KTCA 3RMJA 3AJXA 4WZHA 3L5MA 3LHYA 4BF9A 4TU1A 1TPUA 1XBVA 1S5TA 2ZTJA 4RZ6A 4JDYA 3IIZA 3KRUA 2R91A 5AN7A 1W31A 3C6CA 3TK7A 1XBYA 3BW2A 3LCXA 4X2RA 4UMAA 3MYPA 1W5QA 3BPWA 4M6QA 4ADUA 2E6DA 1M5WA 1QFEA 8TIMA 3NDOA 1K03A 3LRLA 3UY7A 2ZQ0A 3QYQA 4JTIA 1J5TA 4N9DA 3E9AA 2TYSA 3P8JA 3G24A 3GLCA 4ZVJA 3I6RA 1F7BA 2RH9A 2H3DA 5EA9A 4DF1A 4JTGA 4GJ1A 3CU2A 3VCRA 4DPPA 2VOMA 1KFCA 3NQAA 1K8YA 3TE9A 2B7NA 1F6KA 3SFKA 5FF0A 3UY8A 4IUOA 3NR0A 5CSRA 1QPOA 3FYPA 5FI8A 4HNNA 3NL6A 3LLFA 4DBEA 3C8FA 4U28A 5D30A 1YXCA 4AHOA 4LU0A 3TDFA 2GVLA 2NWRA 3GKFA 4Y6GA 2C14A 3BG5A 1FQ0A 4O12A 1QPQA 1H1ZA 1DOSA 4WXZA 4O18A 1SUXA 2V2DA 5KZEA 4Q33A 5LHEA 3JR2A 4K8HA 3VFLA 2V82A 1FDJA 1E51A 3FFSA 1TTPA 5BRBA 4Y9AA 4LRTA 1W1ZA 2AQWA 4NJIA 4JTEA 3UWZA 4M7SA 3UZ5A 2W0UA 4ADSA 3EWYA 5EYWA 2DJLA 2PCQA 1WBHA 4QQ3A 1W8SA 1SO6A 5BMXA 4DBDA 4S2BA 3TROA 3W7JA 2C3ZA 3P61A 4BR1A 3NYZA 3GXNA 3VE7A 4JTSA 5EPDA 4RKAA 3BLFA 4O54A 3LBMA 3NO5A 4JTFA 1O5KA 2G5WA 4UFIA 1ONRA 5F1VA 5HUOA 3OEXA 1B4EA 1KA9F 4JEQA 3QMSA 1YDOA 1AW5A 1ZAIA 3CWOX
chains in the Genus database with same CATH superfamily
1WKEA 4JTCA 1V93A 3UU0A 3Q37A 4GG9A 3ITTA 3SRHA 3WLNA 4O52A 4MOZA 3C8NA 4V2XA 4CN4A 4MJMA 4CKQA 1EH9A 2ACUA 8RUCA 2ZX5A 5D9MA 5FJRA 2VCBA 3NQBA 3EDKA 2EKGA 4JQ4A 3MBFA 3FJNA 5AHNA 5D33A 4UUIA 1UOZA 3S9IA 3T81A 4LC6A 3W0KA 3CXOA 4MB3A 5CPLA 4M6VA 4C7FA 5KZMA 1K9FA 3L2IA 4QISA 4NAEB 1GPFA 4KFOA 3UCCA 1VJIA 3BLKA 2OG9A 3M43A 1XC4A 2E0PA 2RJGA 3PJXA 2A6NA 3GFXA 4S3JA 3VIJA 2CBUA 3RAOA 2ACRA 4TX6A 2YLLA 2BSLA 3IS4A 1ISZA 3QBUA 1YTDA 3P84A 3SN1A 2F6UA 1QXLA 2BVYA 2GFTA 1CLVA 3VOGA 1T8QA 2FFIA 4ERAA 1XRFA 2O92A 2J8TA 2HJPA 3RXZA 2FTYA 3BZJA 2PWVA 2Z1VA 1Z44A 1YMYA 3BSHA 4L65A 3W86A 4AB4A 1AL8A 3PTQA 2QVHA 5A2BA 4J2MA 3R4IA 1DJYA 1KB3A 4HBKA 3LQGA 3CHVA 4INFA 3NGFA 3CWNA 4FK9A 2OO0A 4QDPA 2EPOA 2AAAA 5C55A 1FBAA 3CZLA 1OSEA 1R3TA 1YX1A 1NSJA 4TOQA 4NZCA 2PLMA 4AYGA 1Q6GA 5AC6A 2CLOA 1YTEA 3NWRA 3TMQA 3MHUA 1BVZA 4Z1BA 2VQTA 4V28A 2XN1A 4RE0A 2ALRA 1OFPA 2Y5SA 3WJSA 1AQHA 2G3NA 2I5QA 4NZ4A 1A3HA 1K4GA 3TMLA 4RZ5A 3KL0A 1QPKA 3UYIA 2JEPA 4FOUA 2E28A 4P2VA 1K02A 1EKOA 5HMDA 4TUFA 1E4NA 3QGVA 1M01A 3IVUA 1M6JA 3WBWA 2GJRA 4UR7A 4ZO6A 3GR7A 1ME7A 1EJSC 1TPC1 4NNAA 3FVDA 5JIPA 3F2DA 1HL8A 5F2LA 4Q6JA 1RZMA 4TVCA 2J27A 1NU5A 4RK8A 3QPZA 3C2RA 1PV8A 1YXDA 1SW3A 3VC6A 1SZEA 2BHZA 2E9MA 3OBEA 4RZ4A 1GVQA 4XZ9A 3WDRA 3FK4A 4Z2HA 2Z25A 3BCJA 1AJZA 1FFRA 1SGJA 5JMUA 2A4AA 5CSYA 4ERGA 2WJZA 4CVWA 2AKZA 4GNJA 3B0PA 1NOFA 2WJDA 5H8MA 3CAWA 2PURA 3CZKA 3LA4A 3G6MA 4A2RA 5HNUA 4LUSA 2FLIA 3VCCA 4ZXLA 4JHMA 1VD6A 1FY6A 4G7EA 1LDCA 1FWSA 3WF3A 3AMKA 3WLHA 1V5XA 3C2VA 3XISA 3QY6A 2XIQA 1EO5A 2Z00A 4GCXA 4XSMA 2X1SA 3HGRA 1LQAA 2V3GA 4Q8OA 1MQQA 3W29A 3NUKA 4CU7A 4YPJA 3U48A 5AHMA 5J5RA 2QDGA 1A50A 1KKOA 5I2UA 3GO2A 2PRMA 1HJWA 1DTUA 4YIWA 6CGTA 1TV3A 3JRKA 4GK8A 1QPNA 1CXFA 3BLLA 1NELA 1ELSA 1DWFM 4J3TA 4PC8A 3IIPA 1M65A 3WK3A 1OC7A 3ALGA 5BXPA 1LRTA 3O6CA 3VOJA 4U33A 3S9ZA 1F3TA 2IQTA 1EUAA 4N2YA 3WO8A 1DJHA 1RK5A 2QV4A 4A3QA 3QXBA 3CEPA 4S39A 3O07A 1DWGM 2PDJA 3N34A 3HIJA 4MG4A 3W7QA 4H3DA 1J10A 4GVHA 3S2JA 4QSHA 3OBKA 2WKJA 4JICA 3CIVA 2ONEA 4QDMA 1AW2A 3MT1A 1IXOA 3FA4A 4FNRA 1JVNA 1RVKA 1C7SA 3WH5A 3UZZA 4PEEA 1JCJA 1V7AA 4EXBA 4YCOA 5GVJA 1ZRQA 4PCTA 3EOLA 2Z29A 4AEEA 1QAPA 2VEMA 4WUIA 2NUYA 1P0EA 1NH6A 1EHNA 5AYIA 2H8XA 5LIKX 5TBOA 3ZOAA 1YPIA 5EL1A 1MNZA 4DRSA 3WF4A 3CZJA 1EJWC 1DVJA 1ZB5A 2HDJA 4JNYA 2YL5A 4XO6A 5AHEA 1U22A 3PZIA 3N11A 5FEPA 1LRNA 4X61A 6TAAA 3EOEA 5CAKA 4PB3A 3WCZA 3SDOA 1AVAA 1HJXA 1XUUA 1SSGA 1NTHA 3KOWA 3PTMA 4M6UA 4BCEA 4IFOA 4UOQA 4H1ZA 3G8EA 3V16A 2OKTA 4D6EA 1YXYA 4HMEA 4QIUA 2DV0A 3NDYA 2OZ8A 2WLYA 1UPPA 4LUTB 4ICMA 3L9CA 1TA3A 4UR9A 2C19A 2VVNA 3RK8A 2YZ5A 1I60A 4W87A 1NP0A 2F9RA 4GFIA 4KGJA 3GNOA 2VUYA 1XKJA 2IKGA 3WQEA 4KRTA 4U5KA 1WZAA 1LLWA 4GOAA 1V3JA 3NOEA 1GOKA 2ISSA 4UZUA 3LTSA 4U5IA 2QZRA 2JFEX 3HGSA 1CLKA 1E4IA 2NQLA 3S9YA 3G5EA 2YCKX 3VGDA 5E1QA 2OWWA 3V18A 1A0EA 4DZIA 2X16A 1XYFA 2VR4A 3W84A 1QVBA 3NM3A 3BZGA 4RPQA 4S3BA 1SJCA 2J47A 3UWQA 2QCHA 2OTDA 3EWUA 5D8ZA 3W85A 4TX8A 2QV5A 3CO4A 5E9AA 3VNLA 5D9OA 5TF0A 3VI2A 4C6LA 1BG9A 1H5YA 3NQEA 1LORA 3QR0A 1DJQA 3WDIA 4GC3A 1ZBKA 3K13A 1HJVA 2J74A 4ICCX 2QCLA 2CBIA 5ECVA 1XW8A 1OG0A 5AYZA 3ZVIA 3EWXA 2KAUC 4NX5A 3MZNA 2Y61A 4IZGA 4IGSA 5DT7A 2GDUA 1H2JA 1Y7VA 2GSJA 4B15A 3FX4A 1XH2A 1PCWA 2IS7A 3ARZA 4AZ5A 4FA3A 3FY1A 4C65A 2PDQA 3MP5A 3HB9A 1ZGDA 3BGAA 2HK1A 4N6EA 4HA1A 1CW2A 3PBWA 5LIUX 1FHUA 1C9WA 3QSRA 1ZJAA 1RP9A 3BLPX 4YU1A 3BW3A 3Q94A 1BGGA 4UTWC 1OX5A 5CC6A 3KVKA 3EB4A 4HSNA 3CEUA 4WSKA 1I0BA 4PB5A 1QNOA 3KOZA 1FCVA 2HISA 3IV8A 3S1UA 1XLDA 3U57A 3BW4A 3VGFA 2WMHA 2QJGA 5ECUA 1TYGA 3OO2A 3P81A 1PKNA 1B3XA 4XK2A 4ZQOA 4ATDA 2CZ5A 2ZICA 5CLWA 4CEXC 1TR9A 3W26A 4JQ1A 3SGZA 3SGUA 3BQ6A 1FWAC 4Q4MA 3WIJA 5U4NA 2ZXAA 2ODOA 4B4FA 3ZR5A 2OQYA 4W4QA 4YJ5A 1E0WA 5FKYA 1NQ6A 1SW0A 2Y6ZA 3PM6A 3UPMA 2VQUA 4HK7A 2G3MA 2PC4A 2X41A 4NJGA 2P0IA 1OB0A 3ZO9A 2TMDA 2WQPA 1T0OA 3TWAA 2OZTA 4PMDA 1Q65A 4XSLA 4K6AA 4KCTA 4REQA 3W25A 3AZTA 4N9BA 4QX4A 1LOSA 4GKLA 3GR4A 3O6AA 1FP9A 3TCSA 2FYMA 3SN0A 1CTNA 1B90A 3C56A 5AFDA 1T5AA 3LBCA 4LVGA 2BNJA 3MYOA 4KEVA 4W8LA 3TYCA 4HYRA 3PAOA 3LGDA 4HPGA 1XG4A 3EKGA 2V68A 1CYGA 3WBAA 1VGAA 4GXMA 1F8MA 1VCGA 3AMGA 3LV5A 1XWYA 5LIWX 2XJ7A 2VYOA 1A3XA 1JDEA 3LCIA 3W2UA 1L2UA 1H5VA 1QTWA 3CUZA 2VNCA 3BURA 4L6OA 2WBGA 2BXYA 4JIHA 1XLKA 1PKYA 1R7AA 1FWWA 1ZCOA 1JPDX 3RR1A 4YXGA 3EWZA 2Y5EA 4IMFA 1KBBA 3GIPA 1ZPTA 4GUIA 2FMOA 2GOUA 3SCWA 2HV5A 1ML1A 3GH4A 2ZUTA 5I07A 1JZ3A 3W87A 3G2GA 4L4OA 3L21A 1OFQA 5F4WA 4K8EA 1MYRA 4AEOA 1WDDA 3WNLA 4B9ZA 4H9VA 2Z0IA 1DIEA 1THFD 4FXFA 1YHTA 1PCKA 1RA5A 3DFOA 1ITXA 1GQJA 1V7YA 2Y7GA 3BAYA 3BSMA 3C3UA 5AC5A 4DJDC 2ZXBA 1G69A 3WNMA 2VO5A 4DBSA 2ZX8A 3A23A 4PR4A 3HOJA 3LSCA 4E38A 1SFJA 4BY3A 2DT2A 2YOCA 2WCAA 1EA0A 5D03A 4ZQCA 4IIBA 3NM1A 2Q71A 4Q8WA 4L1GA 4H9UA 3ZJKA 1EUNA 1FKXA 4S2CA 2EKCA 4GVGA 3UR8A 3WD4A 4LBRA 1Y0EA 2A3HA 3AYTA 4A6GA 3P74A 1I8JA 3DI0A 2AQOA 5TAOA 2P50A 1W6TA 3P5YA 1WP6A 1B57A 4D8ZA 4E6MA 1OF6A 3WD0A 5U7SA 1YPXA 4GVIA 4RL3A 5EMKA 1OIFA 2CZEA 4R7WA 4AW7A 1RBAA 2BY1A 4M1RA 3KVLA 4WGXA 2YDAA 5CPTA 4DVOA 4RNFA 1EJUC 2GUYA 1AZ1A 2DGAA 2XH4A 1E0VA 4HGXA 3R10A 2AGKA 2F61A 4Q4SA 3T0TA 3L4WA 4LV4A 1U1UA 1I1WA 1OG6A 1X39A 3P80A 1OBAA 2BS9A 1E1CB 1W2VA 1K3UA 1O68A 2BXZA 2WOQA 1Q7ZA 2OQLA 1NDZA 1LUCA 4GJJA 2V9DA 4I90A 3U2CA 1LRQA 1O12A 4E2OA 1QNPA 4BWLC 1NOWA 2X0HA 3M0KA 3WSUA 3MJYA 3LHTA 3L7RA 3UVIA 4XWUA 2VEIA 2CLIA 2DIKA 1XI3A 3T78A 2OEJA 4GA8A 3MU7A 5A8NA 4IG2A 5A8QA 3PUOA 1S2AA 3BOLA 4WQ6A 4HN4A 3EDJA 1JPMA 3AXMA 3G1RA 2OT0A 4M51A 4UBPC 2PDPA 4C60A 1W5MA 5G4EA 4XZWA 4EANA 3DCPA 4FLRA 3OLIA 1RBLA 3MI6A 4DQWA 3THCA 2PCEA 3S1VA 4JHOA 3SY8A 6ALDA 1R8LA 2FTWA 2X40A 2D0FA 4FXRA 5D4YA 1XH0A 1B1YA 1QDSA 3G1AA 1B0IA 3DG6A 3CO8A 1PZ1A 2G50A 3ZWSA 3GDLA 3WY1A 4HD5A 1RLCL 3VNZA 4IIDA 3NJ3A 4S3DA 4F0RA 6A3HA 3UESA 1OC6A 3TA6A 1US0A 3UXIA 2G8ZA 9CGTA 4IPIA 4MWAD 1QI4A 4IIFA 1J6OA 4G1KA 3C2EA 4Z1YA 4HOWA 3L2MA 3ZLGA 4L4PA 2XSXA 4GYPC 1TCDA 4UOJA 1NWRA 4EX4A 2PWFA 1R86A 3UPWA 2PB1A 1K1DA 1XLMA 2CW6A 2P5NA 3KE0A 4BQ2A 2VOTA 3R12A 3G3DA 3GUGA 4M6PA 4EWJA 3ZLHA 3GBEA 1K9DA 3FGCB 3AYRA 4LRSA 4PRTA 3W6MA 3PF3A 3B9OA 1EXBA 7A3HA 3E0IA 3QKZA 3U5UA 1RY8A 2L5HA 3H4XA 1BPLB 4MLJA 2XVKA 1WCGA 4UQ9A 3QGKC 4E3VA 3PG9A 3TSDA 1J2WA 3P6LA 2IQDA 3TYUA 3VMOA 3OJGA 1H7WA 4RW5A 3RNDA 3QPYA 3VM5A 2CERA 1AW1A 2YL6A 4YHEA 4I3GA 1ZNNA 2YA2A 4AC7C 1Q7QA 1PL9A 1RK6A 4AMAA 3ZT6A 4DHGA 4RCXA 4QAWA 3QW4B 3TSMA 4XTIA 2H8ZA 1XIGA 3PPFA 3MUIA 4LS1A 1OX6A 4NRRA 4DM2A 3KX6A 4QHRA 2B81A 1OCNA 1RXOB 5C9WA 2REQA 5D2XA 3L67A 3L5LA 4W5UA 4W9TA 4EK7A 1BYDA 2OO6A 3RX3A 4AF0B 3OZMA 1JGIA 4MB4A 3KCLA 1T41A 5T91A 3SQSA 1XBZA 4F79A 4ZO7A 3N4AA 4KWWA 1VJSA 1W32A 3IVSA 2E5BA 3EPMA 4GCAA 1MFVA 5D38A 1PJ9A 3VD4A 2Q8LA 1T7LA 3O0FA 3T44A 1A3WA 3N3MA 1GYLA 4MNMA 2EJ1A 2HZGA 2ZUSA 2BXVA 3MVTA 3G6LA 3LM3A 4XZHA 2Q3RA 1WXZA 1QOPA 1DQUA 1H4PA 5CKSA 3OG2A 2CLHA 1MXDA 2FPYA 3PBGA 1KCXA 2E25A 1YDVA 2WWDA 4F2TA 3N6HA 1GK8A 3FVMA 2OXNA 4R53A 3R58A 3V0SA 1K6AA 1HO1A 5BOFA 3AI0A 3MANA 4NXSA 1HKMA 1GQNA 4WHBA 3UGRA 1JZ5A 4ZFCA 1XX1A 2PLKA 5KZ6A 3QPEA 4JTUA 1I45A 1XM3A 5EMYA 2CZDA 2OLSA 1V4YA 2PZ0A 4XD4A 4UTKA 2FZDA 3LM7A 3QH2A 3CHDA 3A4JA 2A2IA 4MAVA 1R3WA 4I9AA 4H9YA 1GPWA 1V6XA 1QUMA 4A21A 3USBA 1CZ1A 2X1UA 1ECQA 2GUBA 3GVWA 4A2SA 4NJHA 3E2QA 2GJPA 3NZ1A 2ATSA 2F6KA 3PR2A 3C0LA 4RXGA 3U3HA 4F0SA 2JF6A 3VE9A 1HKKA 1ZHAA 2CHOA 3SQLA 5I5RA 1Y5XA 4UFHA 3ABOA 4W93A 1LLZA 3K4DA 1H3GA 5FL0A 3WDHA 3K2GA 5C0QA 2ZVIA 5HBFA 4F48A 1CT5A 3KRZA 1YYAA 1C9DA 1Z9AA 1GG0A 2BFGA 5D05A 3A3HA 1MSSA 3DFTA 3W7HA 2FGZA 3SO7A 4LJ3A 4PTWA 3RCYA 3UZXA 2OQHA 2DU2A 5D04C 3WYZA 5CEWA 3OLEA 1VS1A 3TLLA 4PMYA 3OA3A 3WH8A 2VL4A 5HMEA 3QY8A 5D2WA 3B0VC 2RKXA 3U9IA 2X0YA 1MEWA 1W5PA 4R5EA 2NV9A 2R8WA 1ADSA 3LZ5A 1P6CA 3CQ0A 2G0WA 1KM0A 1H41A 2HPIA 4QITA 1BXCA 4DYEA 3MI2A 3NQCA 3LNMA 1C90A 3BLOA 2ANUA 2WCSA 5I03A 3M6DA 1G4TA 3EKZA 6ENLA 3ITGA 2J77A 2XVNA 1CCWB 1EJ7L 3EB2A 1E4MM 1H49A 4NI8A 4AZIA 1OJXA 2VEPA 1SZRA 3SN4A 4UTWA 1GTEA 1EP1A 1UWTA 4B5SA 5D37A 3U7VA 1GVRA 3WK1A 3KBJA 1B3WA 4IJCA 2XYLA 1O1ZA 4KWUA 3VYLA 2WQDA 1UUOA 2ABAA 4HTYA 4ZOAA 3MCMA 3M0YA 1Z48A 3TEVA 1K70A 5G1YA 1IGWA 2IW0A 1RP8A 3DECA 5ABTA 3RR4A 4ZQNA 3WQCA 1IQ8A 1VYRA 4RNHA 2BGNE 1PE1A 1X96A 3GW0A 3N4EA 3ONBA 3VUSA 1XIFA 4W7WA 5DMLA 4O28A 3KWXA 4HN8A 3KZPA 1RD5A 2RFGA 1UR2A 3W3OA 1S38A 3CH9A 3DX5A 3SIZA 2QUVA 4A8RA 2RDWA 5AOUA 5FF4A 1MVYA 3MVIA 3D47A 2RHGA 3T6CA 4Z2IA 1WB0A 3WJWA 4LF1A 4UNIA 3HPAA 4NNCA 4IMCA 2D69A 2YKKA 3ATYA 1CGWA 3MDUA 2ACQA 1O6IA 3SR7A 2GGIA 2XWDA 3UWEA 2J6VA 3CNYA 3WEZA 2BVWA 2MNRA 4GY0A 5A2AA 3LGGA 4EE9A 1TV8A 1P1XA 3T2QA 4B92A 2IPWA 2DSWA 3RLVA 3A12A 3HGJA 1PUDA 3PBYA 2O55A 3STEA 5FL1A 2AAMA 4U10A 4OUEA 1WXJA 4C1NB 4E2VA 4LX4A 3VNDA 1FKWA 3LMYA 1W3KA 4DWDA 2VRJA 4NAEA 3B0XA 3OZOA 2WVSA 1J5SA 4CNSA 3DI1A 1BXNA 3DYMA 3AXKA 4IFRA 1R3YA 2NX9A 2PWUA 1SZFA 3DFQA 2OVLA 3WLKX 2NUXA 4JIIX 4AQLA 2EBNA 4IPPA 3W22A 2QAPA 1IR2A 1ECEA 5EMLA 5B80A 4JPGA 1VIZA 1IWAA 4FX7A 3MUZ1 4S3KA 3QMTA 5KZDA 3U2EA 3MB9A 2O4QA 4U31A 5XIAA 4JZ5A 5C9ZA 4H6RA 3WFZA 2D23A 1XDJA 5DXXA 1AA1B 1LWIA 3LDVA 3CPGA 4PULA 4E2BA 2D22A 2ZA2A 1SZGA 4L1XA 5HNNA 4XKMA 1Q8JA 2GQAA 1KTBA 1DXFA 2A6LA 3AHVA 3F5LA 3PWGA 3DFSA 4TX9A 3QTGA 2F7FA 5B7YA 1OCQA 4M7TA 4UOZA 4KETA 3MDWA 4DJDA 2CBJA 4MUZA 2INZA 3S3GA 3MC5A 1GHSA 1US2A 3GDRA 3KVMA 4ZOEA 1MW0A 1ODZA 1YKWA 2WXDM 1UJPA 3BL3A 2CESA 1JZ8A 5IHSA 1XIIA 1GGOA 3WBYA 3SSZA 1OYBA 2IKIA 4QAIA 2DUAA 3BJSA 2J25A 4DI9A 2NT1A 3VPLA 3OVQA 1J6PA 2YBVA 5BU9A 1KFLA 3GXDA 4JYDA 3BC9A 3EMZA 2VELA 5DELA 4C6CA 5MKGB 1UROA 3PZGA 2A7NA 2F8QA 1G1YA 4Z08A 1OX4B 3THAA 4D1JA 2PDMA 4GWEA 3ZT5A 1L6FA 4W8AA 2YXOA 1FRBA 3U0HA 2V3DA 3VIPA 1US3A 2HNHA 4FI4A 3SFWA 1E9ZB 1S2CA 8CGTA 1GZGA 3UGVA 4A3YA 4G7FA 2J4GA 3SUSA 3TYEA 1K7EA 2VZUA 3M9YA 2TRSA 2C6QA 1ZAHA 2BDQA 1JULA 4LB4A 4U3AA 4NASA 5A8OA 4YMZA 3VKAA 1QT1A 4H01A 1W9DM 2AMGA 2OEKA 2PGEA 3AROA 3W01A 2CBVA 3P7YA 3HMJG 5HQLA 1V0KA 4ECLA 4QG6A 4HOZA 5GNZA 2BGQA 2NLYA 2JF7A 4BWLA 1LL7A 4CQ8A 4CCDA 1ZTVA 3GNNA 5M1TA 3KS6A 3BOFA 2D2HA 4MFDA 4M81A 4PYSA 2DH2A 4D8AA 4OGZA 4R3UA 3N3TA 1O7AA 3LPOA 4ROPA 1SO4A 4DELA 2JKPA 5C2GA 3ABSA 3S5OA 1SFSA 5G2WA 3TXZA 1RH9A 3TOYA 3PPHA 4LAMA 3ZM8A 4UTMA 4F66A 3FN9A 3W2JA 3LCFA 1S1RA 4JTJA 2XDFA 1KTCA 1MDLA 1NFPA 2Z4GA 5HPOA 3RMJA 3AJXA 4FLSA 1V3MA 3IARA 3RGTA 1P48A 4JDYA 4NI3A 3KRUA 2R91A 1FWHC 2GDVA 4A05A 3LCXA 2VUNA 3BPWA 4ADUA 4HOXA 4HNCA 2QMJA 3MKVA 1RLDA 1CENA 1P0DA 3LRLA 1J5TA 4BZYA 3E9AA 3SCQA 2TYSA 1C7TA 3P8JA 4HCHA 4QCFA 3KOYA 4S3CA 3I6RA 4GINA 1XCXA 4GYPA 3GHTA 3TE9A 4JFWA 4K3ZA 1F6KA 4AZ6A 3SFKA 2OOFA 4WLCA 3Q45A 4YWSA 2PDNA 1QPOA 1W1TA 3FYPA 1V08A 3E5PA 3NL6A 2W63A 1GVEA 4DBEA 3AWNA 3C8FA 5DEZA 1YXCA 4AHOA 4LU0A 2GVLA 3T8LA 4HHMA 4NIRA 4O12A 3BG5A 1BKHA 1DOSA 3DHUA 4O18A 2PDIA 5LHEA 3HPFA 4K8HA 1HX0A 5A95A 1EX1A 2FH8A 3L12A 1IYXA 1R9YA 4NJIA 2NQJA 4JTEA 2QVNA 3UZ5A 1ZL1A 4G6CA 4ADSA 3EWYA 2CKRA 1IWBA 2PCQA 6XIAA 4M0XA 4YTQA 5BMXA 1P1MA 2VRKA 1XGZA 3WMSA 3W7JA 2C3ZA 3FHQA 3P61A 4BR1A 1JZ4A 4AD4A 4MPKA 3VE7A 3VGGA 4XV0A 1XC6A 1U2YA 4RKAA 1XFCA 1UMLA 5E6YA 2FHFA 1QHZA 3WLJA 5HQMA 3UG3A 3OEXA 4LUTA 4ERIA 1ZAIA 5JVLA 1M03A 1M3UA 4FLQA 4WSHA 5A6AA 1QWGA 4OQVA 4XISA 2PSNA 4UQCA 3AC0A 4D71A 1E73M 1ISWA 3DN5A 3L4TA 5D8WA 5LGXA 4ZR8A 4M80A 2PWHA 2CFFA 5I0DA 6TIMA 3RRAA 4GO9A 3W7IA 1HKWA 4B91A 3G1VA 5HK4A 1WE5A 3LHVA 4QBXA 4QLKA 3SRKA 3AYVA 4Q4PA 1GVFA 2WHLA 1AH4A 3OW1A 3OIHA 2Q3OA 3NL2A 5IBXC 1X6UA 3RX2A 1TFVA 4Z2JA 4WDXA 2PS2A 2LLEA 4MY8A 3GDTA 3MO4A 3NSMA 5DQPA 2OU4A 3M7SA 3IJ9A 4H9TA 3TTOA 3CUJA 4ZA0A 1VYPX 1KLYA 1OD0A 3T9PA 1O95A 2Y2WA 1DKWA 1DJZA 4KEUA 4XAPA 2BASA 4LALA 4IMDA 1RV8A 2G95A 1HQTA 4NXKA 2HEJA 1PSCA 3LBOA 1KM3A 4XTDA 2YDSA 2WSPA 1S3TC 1T99A 2P76A 3CZ8A 3GX9A 2XFFA 4M19A 3DAQA 5I78A 4LS2A 3ARQA 5FJIA 5JQ9A 3UWYA 5DRCA 1HP4A 3M46A 1JYXA 1JZ2A 1B2YA 1F6YA 2FPTA 4CU6A 3WQDA 3DIPA 1C8VA 5K4ZA 4FXJA 2QCGA 3GW3A 1LWJA 4CN1A 5E0CA 2ZCGA 3CQJA 4JKMA 4V27A 2ZRXA 4HVXA 2ACSA 4F0HA 3MSGA 3T7VA 2WVUA 5EKYA 3RM9A 2GYIA 2E3ZA 2EG6A 1OT1A 1TPWA 2I9EA 3OIXA 2NLIA 1OQFA 1KR1A 3HPXA 2V69A 1GKPA 1JR1A 2WZTA 4FLOA 4AHPA 3HG3A 1GKRA 4N7QA 3N6JA 2Z6IA 2B0MA 3PNZA 1UKOA 2O7QA 5FEWA 3NGJA 1LT7A 3AHZA 4GZ7A 1M04A 3TNOA 1PX4A 3PK7A 3NDZA 1J18A 1H51A 3IANA 4PFHA 1S1PA 1R3VA 5GNYA 4TTUA 1W91A 3GNPA 1KWGA 5HDRA 3WEOA 4JN8A 1VB9A 4DWSB 3THDA 2D73A 3VMPA 3PSWA 1WQ5A 2BY0A 5FF2A 1TWWA 1JQVA 5RUBA 5E93A 2ZIDA 4HZ8A 3W2LA 3VOFA 1UMYA 1XIHA 2J62A 4AWUA 3CL8A 4YYCA 2HRWA 1VLIA 4GO8A 4QRNA 3VD9A 4HHPA 4WJEA 3UP8A 2CC0A 4B5TA 1PTAA 1POJA 3AUOA 2ZBTA 4I7WA 1KBLA 3FJ6A 4AMCA 2GGEA 1D7FA 4W85A 5CGTA 3WJZA 1TTQA 4NL1A 3AU2A 1VPQA 5TIMA 1EWEA 4AZBA 4IGMA 3VNYA 2P3ZA 2CETA 4RXFA 3H21A 1P0BA 1W2PA 2BODX 4HNOA 4WY0B 3DFHA 2Z7KA 1TE1A 3RM8A 3LD5A 2VZOA 2DZWA 4Y2WA 3QZ6A 3W38A 4K37A 5C8BB 1JFXA 5A8PA 4FOJA 4OJYA 2HE5A 1Q5MA 4GYJA 2Y7DA 1ESWA 4MWAE 3SY5A 1TWDA 2O9TA 4IQDA 4XAFA 4JEJA 4FX8A 1H61A 4ENLA 3W02A 3KEHA 3O16A 2C18A 2WM0A 1IF2A 2VGBA 1JDCA 4ILSA 1B3ZA 4US6A 2NWSA 1DE5A 4CQBA 4LVAA 5IHRA 4MNKA 3W81A 5DN1A 1K9EA 4DUVA 3GYEA 3M0HA 1W54A 1A5OC 2C0AA 1JL8A 3VZXA 5A6BA 4FAMA 5MF5A 1J01A 4NYUA 3AS0A 3SSJA 1A80A 3FYYA 2OR2A 1WKYA 1JNDA 3REQB 1VEPA 2R9RA 4KWOA 3NQ8A 1L2QA 4GABA 2QR6A 4R9XA 4PODA 1VEOA 3WF0A 3A9IA 4D6IA 1XCWA 1NWTA 3HPZA 5HUPA 1HL9A 1JCMP 3RF9A 3WL1A 2PEVA 2OGYA 5K3VA 3LS9A 4NZ3A 4QS6A 1O4UA 3L5AA 2NSXA 2Q01A 5L6UA 3N29A 3SAZA 1WYIA 4J28A 4R88A 3E0LA 1AJ2A 1XDLA 2R14A 1Z3NA 4FNUA 4A8IA 1UP3A 3G3MA 4NZFA 3NOYA 1C29A 4WJXA 1XV8A 3RU8X 5DLCA 1ZENA 3TP4A 1E1CA 4XD3A 2J7GA 1XXXA 3ERPA 4Q4QA 4K36A 1W3LA 4JD4A 1NEYA 4X3ZA 1XGDA 3QY7A 5CAHA 4Z0SA 1EJXC 3CM4A 4DPQA 1OFOA 2RGLA 5D9NA 7PTDA 2ZXQA 3EDEA 2ZXDA 4I9MA 3E0FA 3L68A 1J0JA 4IGNA 2EQDA 1XD1A 1E55A 3PUDA 1J12A 3O0KA 4Q8UA 4YHGA 3SM0A 1JGMA 3P0WA 3C2FA 4G9PA 2WO5A 3WDJA 3LLDA 1XSKA 2E1WA 2A5HA 1JUKA 1Z32X 3GNRA 1VFOA 1PS9A 3WF1A 4S23A 2H3BA 3AZSA 1DORA 1IHIA 2QEZA 3QOKA 2WMFA 4CQCA 4RDVA 3GH7A 1SO5A 2VVSA 1MUMA 1S2UA 3MI3A 4MLRA 3TNBA 1BAGA 1XQLA 2GJLA 4FS9A 5M17A 4HNTA 2NVCA 4YCPA 2GZXA 1OWQA 5HNTA 5XIMA 4Z2GA 5HMFA 4BEUA 1XPYA 3UXLA 3VNJA 3LV6A 1LTDA 3VTRA 3EX6A 3ZT7A 4ORMA 1CGUA 4K1GA 3POCA 4UTIA 3CMFA 2YCJA 4W7UA 3V1PA 4QXIA 2DJXA 2A3EA 2O7SA 1VLWA 1XLIA 4Q22A 3ZIZA 4H6QA 3C3NA 2VJXA 3W27A 5DBTA 1J2BA 4QSFA 1GEQA 4XKYB 4N9CA 2OB3A 2X2GA 3GDBA 3QF0A 9RUBA 3OA5A 1E5JA 2NSOA 4NQ1A 2ZOXA 3PZTA 3C86A 1ENUA 2ZC8A 1JYWA 4F0LA 1HUVA 3FGCA 3BTNA 1DJNA 1KRCC 1X1ZA 4LSBA 4JR5A 4XBSA 4S3FA 3KBNA 3UG8A 3E2RA 4O57A 2VC5A 3V7PA 1VFUA 4QFUA 3SY1A 3TLQA 1EZ2A 1JD7A 3I7SA 3R94A 4NF7A 3VGHA 3MW7A 1GZ1A 1W9UA 1JCYA 1ZJIA 4CCEA 5BNKA 4RR4A 1SR9A 4L1WA 1TJ2A 7REQB 2G37A 3UNTA 2VZVA 3MMWA 5KETA 1S2WA 1AQ0A 1SMAA 1IEIA 3B9EA 1A5UA 5T26A 1RBOB 4OOZA 2E67A 2UV8G 3TW7A 3C0SA 3Q4DA 4K1WA 2DIJA 3VX0A 3W1AA 5C54A 1O5XA 3HU7A 1S46A 4ICNA 3ZR6A 1JRBA 2XIIA 5I7GA 3RJYA 4KT2A 3G1XA 3UJ2A 4HMCA 1FWTA 3P14A 5BXRA 5CG7A 5MHBA 3OLGA 5B7ZA 4L7ZA 3V35A 1E5NA 1YBQB 4JOMA 3FJ4A 2ZUVA 5E0FA 4AF0A 1V51A 1Y8BA 3IIOA 1SZNA 2GGJA 2RDTA 4DYKA 1XDMA 1DE6A 1I6NA 5DXYA 5IOBA 3CB3A 4HP5A 4NG3A 3KBSA 2V5BA 4JXCA 4GXPA 3CWHA 3BICA 2PDFA 3L4ZA 1W3JA 2IPJA 3M0JA 2EXOA 5CCZA 3GIYA 4B3KA 2A3CA 4Q4OA 3SUWA 1QOQA 3MUCA 3VVGA 1KXVA 3R0DA 4DB7A 1I2NA 2P8CA 3D0CA 1DWIM 1PWMA 1R2TA 3N15A 2JQXA 4XD6A 1TB3A 2OGJA 1EGMA 1HO4A 3HF3A 2VR2A 3C52A 2O56A 4P7QA 1F5ZA 4LVDA 2OWXA 4I7VA 1Q85A 4E4UA 1EJRC 1NQKA 3IUIA 4I6KA 5E6ZA 3T0AA 1B5TA 2HE8A 2FQIA 4DUWA 3GU2A 4XG1A 5T9CE 3W1TA 3A47A 4WCJA 3CTTA 4JX5A 4H9MA 3W1MA 5DX7A 2DZPA 3W76A 1EXPA 4QJ4B 1EX5A 4LTSA 2P53A 3BAJA 4GYKA 1T96A 3TN4A 1XFBA 3C0JA 3OGRA 2XFYA 1WKFA 3WUBA 2DZVA 3QZAA 4I7UA 3NSNA 4WOZA 3EXSA 5A6KA 3VIHA 2VFGA 4JX4A 4UTFA 3L4UA 2RAGA 5CZKA 3NVTA 4MF4A 1VRDA 4PH6A 1PTGA 3IAQA 2DT3A 2XIOA 2CWXA 3DGBA 5AHLA 4IOTA 5LNWA 1XGEA 3QQWA 1QNVA 5IBXA 3LCGA 4ZGYA 3L4YA 4WDUA 1TZ9A 1V6YA 3H23A 4LPCA 4RV8A 1Q6QA 3WMCA 2ABBA 2NQZA 4TXEA 4DWSC 3UG4A 3ZVHB 3QC3A 3WENA 4BI5A 4Y9OA 2JKEA 3OGVA 5FACA 1JD9A 4Q7IA 3PBMA 2V3EA 2P8BA 4H04A 2QGHA 4NX0A 2DT0A 3RPMA 1D3CA 4AY8A 2QIWA 3FA5A 4DN1A 1QI2A 4D6GA 4IFKB 2WANA 1K4HA 4MB5A 4HSHA 3EEZA 1VKFA 3PB2A 3PUGA 2Z6JA 4L9ZA 1R5YA 3N9KA 5DBUA 3W7DA 4CQ9A 1XYBA 1JCNA 3GFYA 3W6YA 1O94A 4GZEA 4PUDA 1JPKA 1JEZA 5JH1A 2B7QA 2W66A 4G2DA 4WVXA 2CLFA 2ATMA 1W3HA 3LZ3A 3V5FA 1OC5A 1IXPA 3F03K 3LXBA 3LU2A 5A6MA 2C0HA 3MY9A 3AUJA 2FHCA 4GISA 4J2PA 3TYZA 1VBHA 2X8RA 2DPEA 4A3RA 2QJNA 4JTTA 2GL5A 4LGXA 2WNWA 3GIQA 3H2FA 1LG2A 2BHUA 3GU1A 4AAJA 1EP2A 3NPVA 1UQZA 4CQAA 1XINA 2DW6A 1MQPA 3P3BA 2C8NA 2PWGA 2OT1A 5BXSA 4PUNA 3F2BA 2FVLA 5DFAA 3LPGA 5HULA 4CNTA 1OHLA 4EF9A 2Z2AA 2JK2A 5FF3A 2D2GA 1VBRA 2GQ8A 1H7NA 3R2GA 2OPJA 3SADA 2ZZ1A 1T8XA 1HT6A 2V6AA 3WN6A 4AZGA 2JIEA 1LBFA 3IJLA 3KAOA 3DH7A 2J6XA 1X98A 2DZUA 2F2KA 3VIFA 2R1LA 3P5ZA 3W75A 2A0NA 4ZSUA 3CL7A 1EDQA 3DUGA 2ZKMX 2OKOA 3EX2A 3KHJA 1HN1A 4GLEA 2A3AA 3FEMA 2DUXA 4QE1A 1N2VA 3EXTA 2J7BA 3M07A 2XHYA 3PZUA 4C1NA 4V15A 2EPKX 2HK0A 3VFCA 1VCVA 4LYKA 2DSVA 4HA4A 1E9YB 4DX3A 4DJDD 4AY1A 1R0MA 2E68A 3D6NA 4OBTA 3N73A 3UPBA 1OFDA 5DMNA 3RLGA 4MZ8A 1L9WA 3GH5A 2BY2A 1RD6A 4L61A 3AS3A 4J1OA 5FJJA 1UG6A 1ME8A 2XPKA 4Y9NA 5I24A 4HTBA 3UW6A 1IXNA 3QVQA 2G3FA 2GLKA 4PMQA 1M1BA 1BVNP 3SCPA 4ZCWA 1FFQA 2ZADA 2UY2A 2VP8A 3IJQA 3IJ8A 5GNXA 2ZX9A 4IJRA 4H41A 2NXIA 5BWAA 3GTHA 2NT0A 3OU8A 4QLLA 4GQ0A 5CPMA 4C91A 1K7FA 3NVDA 1AH3A 4JY9A 4KWVA 3UEQA 2FIQA 3B05A 1S2TA 2HBVA 5HR6A 3W2MA 2B7PA 2ZVRA 2ZRWA 1DYSA 2YFNA 4Q8TA 4KIRA 3A22A 4ZXOA 1TTIA 3WQ8A 2YXGA 4CCCA 2V5JA 1DWJM 3DEQA 1A5LC 4B90A 3BAWA 3DHDA 1IIGA 2PDLA 3R11A 1FCQA 3HG4A 4H83A 3HJZA 2PBOA 2V30A 4M82A 2F6XA 3B03A 3ES8A 2IKHA 1EL3A 2V0TA 3QEZA 3S5ZA 3JVAA 3AALA 2YFOA 3UR7A 5I09A 3C4UA 3W2KA 1VBUA 2XGBA 1E9IA 1H7RA 4GIEA 1T6MA 1YE4A 3KRBA 2CKSA 2CHRA 4OOUA 2GDQA 1UR3M 3HA1A 1W3NA 4XZBA 5BU6A 3T07A 3TQ0A 3WQ6A 4ATLA 1ITCA 2A1YA 1WZMA 3TUUA 1HNYA 1V8EA 3OLDA 3RO8A 2HS6A 3D3AA 3S0CA 2GK1A 3B8UA 2OSYA 1WUEA 4EXAA 3VMNA 1L6WA 4AISA 3JUGA 4EXQA 1YRRA 4O1FA 2P88A 3MO7A 4P7OA 1R6WA 2P1FA 2PTDA 4GNVA 1XLEA 3TZNA 3GVRA 3NCOA 3E1F1 3TC7A 4HU8A 5CZSA 5AYXA 2A7PA 3I4EA 1VFTA 4KMQA 1TV4A 1QU4A 2CPUA 3A24A 1NIUA 3TTYA 5K4XA 3S83A 3MKCA 3RO6A 4FIQA 1V6UA 3NXLA 3KBVA 5M5DA 4QNWA 2AOSA 1EC8A 1VPYA 4C6OA 3N19B 2EAWA 1EPVA 3P60A 1Z6KA 2Z1WA 2X7VA 4Q3MA 2MUCA 3BV4A 4AIOA 3PB0A 3ICJA 2YA1A 2QLYA 4YS1A 2QCMA 4V33A 2WMJA 1EQPA 3AIEA 4QG8A 2ZZ5A 3QOMA 1KV8A 3QKEA 4R33A 3VABA 1UKPA 3ZQ9A 3E0VA 3QR1A 3E12A 5CSSA 1D8CA 3EOOA 2XINA 4H2CA 2OYKA 4AC1X 3CUHA 3GB6A 5LZLA 1BXBA 4DZHA 1OCJA 4MDPA 1DHPA 3WX7A 1GG1A 3HJEA 3GG7A 1XISA 5A1AA 3KP1A 2D3LA 3RHGA 2Y1HA 1ZP4A 4M8UA 2EO7A 3VO0A 4KCUA 4IJBA 3UG5A 4TVUA 4J3ZA 3K1GA 3LRKA 5GPRA 3AU6A 3FAWA 3FNDA 1K6WA 1IGSA 1UH3A 3UJSA 1LBLA 5REQA 4FMVA 4AWTA 4GC4A 4LXFA 1YDYA 1WZLA 3E0WA 1J0HA 4JX6A 3CUIA 3EX1A 2CHNA 5JBFA 5BZAA 1U83A 5FOOA 3B9DA 1J11A 9XIMA 3DKJA 4EAMA 4EIVA 3TH6A 1UR8A 1OFRA 2I7GA 3BQ5A 3UYCA 1NVMA 1F74A 4R34A 3WELA 2QQ6A 3B8IA 1TZ7A 2Z1BA 2PLCA 3RPDA 1TQJA 3ZYZA 1W1VA 2PWEA 1PHQA 4C1KA 3RX4A 1TPDA 3DHFA 3GNDA 3WLMA 2FZ8A 5AC7A 1P7TB 4KQNA 4L56A 4GBDA 5DCBA 5AY7A 2W92A 5KITA 1N8WA 2GVEA 5I3FA 3IUDA 2WVVB 4F3HA 4UQDA 3N13A 1WAWA 4L4LA 3TAKA 2PC8A 3W23A 1V0MA 4ZQMA 4DBWA 4MGGA 4PRWA 4D9PA 1NDVA 4M5PA 3WUFA 5JH2A 3CAKA 2VKZG 3A21A 5LGZA 1ONXA 4RZBA 1MW1A 2XUCA 1GZJA 1TRDA 1EIXA 1YNQA 1XYAA 2EHHA 4HMNA 3U4AA 1A53A 3A3XA 3SZ8A 3ENLA 3VDCA 1AQFA 5I02A 3W7KA 2D24A 3ARSA 4O53A 1X1OA 4BI7A 3T05A 1KGXA 4IXXA 3IVTA 2OELA 4F4RA 1GEHA 2BZNA 1W9XA 2QJJA 3F5KA 2DVTA 1W9VA 2QDDA 4FPSA 4XX6A 1E43A 1Q2RA 1OFAA 5TD4A 5ABFB 3MQTA 4C5YA 3AHXA 3NQGA 1M7PA 2VGIA 1ME9A 3TJLA 3A6OA 3EWDA 4HNLA 3H6OA 2G3JA 4WKHA 3GTFA 1HJSA 3MWCA 1H1NA 2QPUA 4E2DA 1F3WA 2YBTA 1J0KA 2R94A 1W5OA 4HZ6A 1F2JA 1AFSA 3MS8A 2C91A 2YDRA 3H4WA 1PKMA 1WUFA 1EB3A 2VEKA 3ARWA 1A0DA 1YIXA 3UA3A 3DU0A 1W8GA 2WNNA 1A47A 4H9ZA 5H8UA 1TPH1 1NFGA 2BV9A 3NIYA 5K9DA 1BF6A 3W1PA 2QF7A 1GQKA 2PP0A 5ABEA 4KERA 3NQVA 3TTSA 1E15A 4RDWA 3OQ8A 1XLBA 1S5NA 4O1CA 2A7RA 1RSCA 3R25A 4F8XA 2WNZA 3EZ4A 2PGFA 4QP0A 4UFJA 1SPQA 4IHCA 3KBMA 2YCLB 3HG2A 4ADTA 4HIBA 2IXVA 1AK5A 4X9YA 4GI4A 2QGYA 4UNKA 5F2IA 1BSIA 2Y8VA 3BLDA 3M5VA 4AEFA 2Q02A 3D46A 3MBDA 3YPIA 1KM1A 3W82A 4DO6A 1REQB 1J8VA 2QKFA 5CQ1A 4PMVA 3LNPA 4XO7A 2X1TA 3FDKA 4O1AA 3V1HA 4RV3A 3LRMA 2DIEA 4HPNA 3MV01 4A22A 2E9BA 3ITCA 4PFMA 2Y88A 4L5ZA 3VGBA 3PG8A 2OSXA 3N9SA 3OP2A 3ANVA 5JUVA 1DPMA 3EA1A 4HU3A 2DT1A 2VC6A 4HSOA 1X6LA 1V02A 3ITXA 3F2CA 5CJ5A 3APTA 3LXCA 4P8UA 2R1KA 2WPGA 1ISYA 5I6SA 8XIAA 1U30A 5C9UA 1JYVA 3H7VA 3NEVA 2CLPA 2WJEA 1HXJA 3WQ5A 4DF0A 3KCJA 3UCQA 1WBJA 3ABRA 1QK2A 2W4XA 4DXVA 3IRDA 1BYCA 4DWSA 1BYBA 3AMDA 3U6WA 5BYWA 3AHYA 1KM2A 1W0MA 3NURA 1RCOB 3GXTA 4X0VA 1WAUA 4O8RA 4YTUA 4UFLA 5D09A 5CGMA 1PAMA 1FTXA 1P6WA 3F4VA 2AKMA 1TR1A 2AQVA 4IP4A 1UWSA 1TMLA 3TJXA 3EX3A 1FX6A 4X22A 4JL2A 5K7JA 1NARA 2ZZ4A 2E6YA 4Y8FA 2XGZA 3N2MA 5AVNA 3V3WA 3FKRA 4QEHA 1JCLA 4Z0JA 4D72A 3H2OA 1XD0A 5L9FA 5A6BD 1KFKA 1GOWA 3B04A 3G18A 1JFHA 2PLJA 3CL6A 4MADA 2Q09A 4UIOA 2NZLA 3MP3A 4WY0A 3NYDA 4TIMA 3QV9A 4JCMA 1H0GA 4HNUA 1IZJA 4G56A 1S5VA 1MQRA 2E5DA 4AVNA 1XKYA 1RQEA 1A5MC 2H90A 4HA0A 1I2PA 3B9NA 1OGBA 3LHYA 4BF9A 1XBVA 3K8KA 3VDAA 1V77A 5ENLA 3QHMA 5A3HA 4C6DA 4JIRA 4A4AA 3BW2A 4JNZA 5FCZA 4X2RA 3MYPA 5AZ1A 1QI3A 4GY1A 2VX7A 4H8UA 3OTRA 4ZTYA 3DG3A 3N6QA 4JTIA 4N9DA 1DP0A 1RCXB 3S2NA 4PTMA 4L80A 1K9TA 3G24A 3GLCA 1F7BA 1UZHA 2I17A 2RH9A 3SURA 2H3DA 3TVAA 4DF1A 1XIJA 4LUYA 1PX3A 3U5YA 5LA2A 4W84A 2VOMA 4GGBA 1KFCA 1FH8A 3HV8A 5FF0A 5C9XA 3NR0A 4A3HA 3WF2A 3DDMA 5FI8A 2O0TA 4ZOBA 3QYSA 5J8LA 4QTGA 4K68A 4Y6GA 4JIEA 1QPQA 1H1ZA 2DUZA 3REQA 4FSAA 3MSRA 3JR2A 4S3AA 4M29A 1GONA 3OQEA 5T9BG 1FHDA 3CASA 4LRTA 4HU4A 4GI9A 1W1ZA 3UWZA 3PZNA 3TC3A 1Q8AA 4M7SA 3AAMA 3WNOA 2DDXA 4PBEA 1EHAA 5LIYX 1W8SA 1SO6A 2HBXA 3CT2A 1X8CA 2W27A 4D6FA 1Z69A 1GOIA 4TTGA 2IPGA 1VRXA 5EPDA 1DIKA 3BLFA 1VAHA 4P7LA 3LBMA 2E8ZA 2F38A 3NO5A 4JTFA 1O5KA 4HZ7A 4UFIA 3SRFA 2QUNA 1XYCA 1RAKA 1VFMA 3QMSA 3WD1A 4B5WA 1MUWA 4LNYA 3CBWA 5BROA 4TQTA 5CC3A 4DO7A 2PI6A 4PTNA 1J96A 2FDSA 3W72A 1NFBA 2V2CA 2Y5JA 1G7VA 3BGJA 5F4XA 2CLEA 3VILA 2Y7EA 3E2VA 3EWWA 2OOGA 4EACA 2PD5A 2D2JA 3TQKA 4ZENA 4C7GA 2ON3A 3ZZ1A 4DF2A 3SGGA 1RHCA 3W7OA 2WHJA 3WLLA 4MYAA 4MKVA 3G1YA 3PANA 2DZAA 2WSRA 1KFJA 3J7HA 1X6NA 3GWQA 1UKTA 3B8WA 3S5NA 2YLAA 3ZLFA 4AX6A 3HURA 1UR0A 4EPDC 3CLWA 3M47A 1ICSA 3ZFHA 1GT8A 4JQAA 3W7PA 1U33A 5FJPA 3G0SA 2ZYFA 4WOQA 3QLLA 3ES7A 2V63A 3P67A 1PZ0A 4N02A 4F0MA 1H63A 2W79A 2Y63A 3PZ9A 4RUBA 3RMEA 4O15A 3PBUA 2JE8A 1ZZMA 4XBKA 2NX3A 1JG9A 1QJWA 1JNEA 3U7BA 3O05A 4LYRA 4MY9A 1HF6A 3SCSA 1UZ4A 5E09A 4MTVA 3PVFA 7ENLA 3UQNA 2GVJA 3B8DA 3I4KA 4B3LA 3WL0A 3Q67A 3NQ2A 2IKJA 1RALA 4O4VA 3BSGA 4E0CA 3W1XA 4KW2A 4XKYA 1E40A 3GTNA 2VFDA 4UFKA 2QCDB 1S3HA 3TR9A 2NW0A 3W53A 5I3KA 1G4EA 3N12A 1CLXA 1TIMA 3EKLA 1OZQA 3N2CA 2C16A 3LHUA 2W5FA 1LM1A 2Y8KA 3B97A 1A5NC 3VNIA 1GW1A 1TRIA 1D3GA 3SB0A 2V5KA 4JQ2A 2TPSA 2I16A 4UWMA 1O66A 3GHUA 1WDPA 4OFCA 3PC0A 5D9PA 4FNSA 1K8CA 4ACZB 2CU0A 1IE7C 1L0PA 4J4KA 7REQA 3RFAA 2WYSA 1OYCA 4JNMA 2XH7A 3L4XA 1E6NA 3TYAA 4BQ3A 1CXKA 2EEXA 3K46A 2G3IA 8XIMA 3ZJ7A 2R1MA 1QPRA 5BOEA 1G67A 4JTDA 2FDMA 3GDMA 2B7OA 1MW2A 1V0NA 4IQEA 2XVPA 3VU2A 4IUGA 3TYBA 2NQ5A 3NAVA 5M3WA 4JIPA 1GNXA 2B31A 1EDGA 4IX0A 5FJUA 2TODA 1YBQA 3GDKA 1LL6A 3AICA 5FAJA 1E0UA 2QUMA 3S42A 1HP5A 3CV6A 3P82A 2WPBA 4PUUA 1G6CA 2PWDA 2J9XA 3MCNA 2VT0A 2REQB 2GWNA 7TIMA 4F2UA 3TTEA 3S5SA 2DORA 1KW1A 3B9AA 3B8SA 4FB7A 3HQNA 2VI0A 1L8PA 1OD8A 5E5CA 1B9BA 2VHLA 1WV2A 3N4FA 3ARPA 1QR7A 5LNUA 4Q32A 1RVGA 1E1FA 4DBUA 1I2RA 4YWIA 2VGFA 5BWFA 4WR3A 3OPSA 2VEFA 3SCVA 5EFFA 3ORWA 1UBPC 1QHOA 3GG1A 4AYSA 4F9DA 4E3TA 5C2XA 1N8IA 2HS8A 1RCQA 5DY3A 5BRPA 3W2NA 4FO4A 4H7CA 3FXYA 3M41A 4YTRA 5CZTA 2XH0A 1H09A 4HCLA 3DBNA 4RNIA 1OM0A 2YGYA 4KEZA 3VIMA 4S3EA 4P8XA 2W67A 1SVDA 5C7VA 1FDZA 3S4TA 5D02A 4A35A 1B3OA 5BW6A 1IXQA 4PL1A 2BBFA 4I9TA 2XU2A 4YLWA 2FB3A 1YPFA 3PZVA 4H8HA 3UCDA 2GOKA 4FALA 1WPCA 3CC1A 1UR9A 3WEMA 1XQKA 3EPNA 5AC8A 3P0XA 4XQ6A 2FHBA 1AG1O 1DWHM 2CEQA 4B5UA 4ZZ9A 1LROA 3ITOA 2ZWYA 1NOUA 3TFCA 1EZWA 3JZEA 1A5SA 5M03A 1FCUA 3BAXA 3CGTA 1BTMA 2J8FA 1UD5A 2I1OA 5AVHA 1TVPA 2FH6A 2PTYA 4KRUA 3DGRA 3W7CA 4C6BA 1UR4A 3CPRA 3IIXA 1A5BA 1PHWA 1XH1A 4JTQA 3ZVHA 1WDSA 2ZA1A 4OV4A 3IGXA 1UD2A 5BOOA 1H62A 2Z7GA 1M53A 1MWOA 3Q58A 5D2TA 1U1HA 1KLZA 3ABZA 3WMLA 3NQDA 1AMYA 3HZ3A 3GZAA 3WQGA 3STPA 2Z1KA 2ZTKA 4QEEA 4IPNB 4BKNA 4IFKA 3BG9A 1DJGA 2ICSA 3S8HA 3B4UA 1HGYA 1B3YA 1W1B1 3CHEA 3LOTA 4NAFB 2ISFA 1B31A 1TJRA 3VKBA 3KUMA 1EO7A 2CNCA 5A6JA 4GY7A 3E6EA 1XIMA 3V0TA 1BD0A 4GJIA 3TV8A 3OG3A 1IZCA 1OGSA 4YNGA 2DVUA 2V2HA 3ELFA 1XLGA 3NL5A 1Y65A 2AL2B 4WK9A 4ONVA 1UQYA 3KDNA 4DJFC 2C71A 4KH2A 1FWGC 3KS5A 4TO8A 1IT7A 4LBUA 3GUWA 2QYGA 5LNVA 1PX8A 3BXWA 4PSRA 3GRIA 3FYOA 1H50A 4GQRA 4JN7A 4V1XA 3WH6A 2YZRA 3IGHX 1XRTA 2G97A 1HTIA 4LT9A 4DUXA 1BKSA 2Y89A 2FZMA 2Q8XA 1XS2A 3B40A 1F4HA 4OZOA 3C0QA 4WGHA 2BHYA 3A3WA 1LLOA 1PB0A 4Y9MA 3WJXA 3MHFA 3CUGA 3S1GA 1I1XA 1UD3A 2Y4SA 1UBSA 3EWCA 1IEVA 4FXSA 3F1QA 2NXHA 3MPGA 2OEMA 1VP5A 4CCZA 2VURA 4CEUC 3PPGA 3AIWA 5I3IA 1DIDA 5FSEC 4K7YA 2XVGA 4O50A 1JDDA 3PWIA 4NJKA 2C13A 4FP1A 1PWLA 3T2PA 4XIAA 4FNTA 4PMXA 4K7VA 1KM6A 3HMCA 4MZ1A 3K8LA 1I4NA 3KLKA 4WRHA 3VD7A 1XLJA 4X63A 4PUWA 3WG6A 3TKFA 3WDQA 1DJWA 1TPB1 1N55A 2TAAA 1Q6RA 3NQ7A 1YNYA 4GIRA 3SI9A 4IICA 3WH7A 1D3HA 4E4FA 4JTRA 4DXXA 1W17A 2WC4A 4YVXA 1DWAM 1ZS2A 2GGHA 4O13A 2BOEX 5CPQA 5BMWA 3LXAA 1GYMA 1FWCC 1RUSA 3F4WA 6REQB 3WZ0E 4WKFA 2Z24A 3GHSA 3T4CA 1I9CB 3R1ZA 4GBUA 4GACA 2ZZ7A 3LI1A 2OX1A 5KTLA 1XRVA 4LAZA 1EIBA 4UQAA 4WDTA 4GXWA 1UP2A 3FCPA 2WMIA 5CBBA 1J93A 4UTHA 3FHAA 4EWND 1ZUAX 2QIIA 2VTFA 1FWNA 3NL3A 5LIXX 3VX1A 2J66A 1BVWA 5LKYA 3ARYA 3ZSTA 2Z28A 4MYXA 2V8ZA 1J0IA 1TX2A 3QLDA 4PTVA 2GSHA 4HT3A 1DHKA 2Y0FA 3CZGA 1FA2A 5EBAA 1Q4WA 4MNLA 1LF1A 5AZ0A 1F3EA 1GOOA 1FCBA 3PFRA 3MJMA 2W9MA 4PCPA 9XIAA 5I3HA 2EPNA 1QNRA 3G8RA 1EGZA 2FGBA 3TJIA 5CH9A 3L66A 4X60A 1KBJA 1Q6FA 1BG4A 3SJ3A 1PDZA 5DMYA 1HL2A 2ALDA 1QK0A 4OV9A 3ARRA 2QJIA 1GORA 5G1MA 4M56A 1NDWA 3W9ZA 1C8QA 2VXNA 3M16A 3T0CA 2ISVA 1L8NA 3HQPA 4J3SA 4NNBA 2GUUA 3NPXA 3WLOA 2Z2BA 1CI1A 1CDGA 4I8YA 2OJPA 5C9RA 1VEMA 3TWBA 2PPGA 3EXRA 2RUSA 3VDHA 4GX8A 1VBJA 1O1HA 4CD8A 3VIGA 4YVPA 1WDQA 3O6YX 1PXGA 1XHGA 5I3JA 5GJPA 2QCCA 1OABA 3STCA 4FZIA 3D5HA 2HMCA 3CT7A 3UXKA 3OGSA 4Q8MA 3NPWA 3WQPA 3W37A 2OMAA 3CHCA 3OZPA 3EMQA 2V5DA 2ISDA 3H2CA 4RX0A 3O8AA 2PBGA 2G41A 3WQVA 4PBFA 1Z7AA 3SECA 1QMLA 4LH8A 2PD9A 2Z1XA 3U2OA 4QS5A 4ZFMA 2E7FA 3E74A 3TIMA 5EU9A 4HPXA 1A5KC 3EBVA 1N8FA