1YNPA

Aldo-keto reductase akr11c1 from bacillus halodurans (apo form)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
283
Chain Sequence
HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords oxidoreductase
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
total genus 103
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynpA01
4L1XA 2HE8A 1YE4A 4PRTA 2ALRA 2DUXA 1XF0A 3D3FA 4LB3A 5LIUX 4JTQA 2I17A 4XO6A 4XZNX 2C91A 2IS7A 2PDPA 3CAVA 2ACUA 1MI3A 4JQ1A 5M2FX 2PFHA 3WCZA 2QXWA 2IQ0A 4QR6A 4GA8A 3DN5A 1ADSA 2HV5A 4FAMA 4L1WA 2IPGA 1IEIA 1AH3A 2FZ9A 2PF8A 5HNTA 3R58A 3RX4A 3VXGA 4RPQA 2BP1A 2PZNA 4XZIA 4MHBA 4AUBA 5JH2A 3KRBA 4DBUA 2R9RA 3O0KA 2PDGA 1MRQA 3N6QA 1RALA 1R38A 2ACSA 4FALA 3O3RA 1XGDA 1PWLA 3LZ5A 1HW6A 2HVNA 4JQ2A 4YU1A 2PDMA 4QBXA 2HVOA 2J8TA 5LIXX 2PDHA 3COTA 2HE5A 4YVXA 5LIKX 3GUGA 2PDJA 2IPFA 4DBWA 1S2AA 4YVPA 3H7UA 3FJNA 1Z9AA 1AH0A 4IGSA 1PYFA 4IJCA 3ONCA 1Z89A 3LZ3A 3DOPA 3ONBA 1YE6A 2PEVA 1S2CA 5KETA 3G5EA 3M64A 4IJRA 4XVEA 2DV0A 1Z8AA 2A79A 5JH1A 1RY0A 3GHTA 2FZDA 3B3DA 5LIWX 3R7MA 1J96A 3S3GA 4FZIA 3T42A 3UGRA 1UR3M 4XZLX 1SM9A 3R43A 4JIRA 1LWIA 3U2CA 2PDCA 3LBOA 3V0SA 1AZ1A 1X97A 1Z3NA 4JTRA 1EF3A 2FVLA 2PD9A 3EB4A 4DBSA 3EB3A 4EXAA 4ZFCA 3CAQA 3CV6A 1JEZA 3LENA 3LNMA 1Q5MA 5AZ1A 1ZSXA 4GQ0A 1PWMA 4LAUA 1AZ2A 3GHRA 4XZHA 4JTCA 4JTDA 1YNPA 3BURA 3GHSA 1EL3A 2PDWA 3LN3A 4LAZA 5AZ0A 4WDUA 4YVVA 3V35A 4GCAA 2AGTA 3RX3A 3BCJA 4NKCA 4Q3MA 4WDWA 4GQGA 3WG6A 3CASA 5HA7A 1S1RA 3V0UA 2PDBA 3WBWA 3LD5A 4JIIX 4XK2A 3Q65A 4GACA 4HBKA 3C3UA 3R8GA 3FX4A 3WBXA 4DZ5A 3R6IA 4QX4A 4EXBA 2PDNA 2NVCA 3UP8A 3LQLA 4WGHA 1VBJA 1RY8A 2F38A 3MB9A 2PD5A 3R94A 2ACQA 2INZA 3V0TA 4I5XA 4XZMX 1AH4A 2IQDA 1AFSA 4LB4A 4WDTA 2PDIA 3BV7A 2INEA 1XJBA 3BUVA 3UZXA 3UG8A 4YS1A 4R9OA 4PR4A 1MZRA 4GIEA 3UZYA 3UZZA 5DANA 3V36A 4LBSA 4JIHA 4JQAA 4GABA 1T40A 3NTYA 4XO7A 5LIYX 3MC5A 3CV7A 2IPJA 3M4HA 3EAUA 2ISFA 2IKJA 4G5DA 4F40A 5C7HA 4JQ3A 2WZMA 4QXIA 3G1RA 4OTKA 2IKIA 4WEVX 1HQTA 2CLPA 3WBYA 2FZBA 3UYIA 3R8HA 3N2TA 2ACRA 4PRRA 2P5NA 3ERPA 1C9WA 1X96A 3LQGA 2HEJA 2IKHA 4H7CA 1M9HA 4Q7BA 2FGBA 3LUTA 4JQ4A 1PZ0A 4XVDA 2VDGA 2FZ8A 2HDJA 3H7RA 1EKOA 1Q13A 1QRQA 1IHIA 1ZGDA 3P2VA 3Q67A 3CMFA 1K8CA 4XAPA 4HMNA 1VP5A 4FA3A 4PUWA 1PZ1A 1OG6A 4WRHA 2PDKA 1LQAA 1GVEA 5HNUA 1ZQ5A 1US0A 2DUZA 4PUUA 3M0IA 1QWKA 4JTAA 2WZTA 3UZWA 1FRBA 2R24A 4WDXA 4ASTA 3LEPA 1YNQA 1T41A 1S1PA 4LBRA 3RX2A 2PDLA 1EXBA 3H4GA 4H8NA 3QKZA 3F7JA 3GHUA 2NVDA 2PDFA 4PMJA 1A80A 3UFYA 2BGQA 3UWEA 1ZUAX 2PDYA 2IKGA 2BGSA 2IPWA 2PDUA 4ICCX 2F2KA 1X98A 2PDXA 2PDQA 2I16A
chains in the Genus database with same CATH superfamily
3QXBA 2QCLA 3GG1A 1QCWA 3FLUA 5HNNA 2VGFA 3R1ZA 1EQCA 3APGA 3UR5A 5LA0A 2VX6A 3S6DA 1VKFA 4H01A 2OEKA 4JQ1A 4NT0A 2HZGA 3UYCA 2YFOA 3QTPA 2IQ0A 3E1F1 2X05A 2VMFA 1EJ7L 2EXOA 1U2YA 3AXXA 3HGSA 3L4WA 4Q8QA 1ODZA 3WNNA 5C6MA 4MAVA 1KB3A 1GEQA 1EP1A 2RH9A 4W8AA 1TTPA 4K3ZA 4L1WA 4DM2A 3H55A 4OOUA 2XVPA 1TWDA 3GX9A 2VI0A 2CXGA 2V3DA 3JRKA 5BXTA 3W38A 4RW3A 3K8LA 4FIQA 3LX9A 3CL7A 3CUXA 3CWHA 1TZZA 3S9IA 7REQB 4W7WA 3O0KA 5T91A 3W2LA 3SSJA 1MQRA 3B05A 4AU0A 5CZKA 4I6KA 4IFKB 3QJAA 4BJHA 3HV9A 3N4AA 3IARA 3UD6A 4S3JA 3LZ5A 3L4VA 3STCA 1SSGA 4BK9A 4KF1A 1KCKA 1H11A 4C91A 4FOKA 3WLPA 4AHQA 1DE5A 1D9EA 2KZHA 4DO4A 2GQ9A 2GPTA 3OBAA 3W88A 1TMLA 2PTXA 5DXYA 3B8TA 4P7NA 1JCMP 3ZR5A 5FCZA 2CITA 4KQNA 4WJ8A 3VE9A 4GH1A 1OC7A 2WK2A 1E73M 4XD5A 1KGWA 8RUCA 4M6QA 5FA5A 4GBUA 2QPSA 2GOUA 4ZVJA 3BXWA 3T4WA 4Q8MA 4HN8A 2A7RA 2RUSA 1GVRA 1J0ZA 2WVVB 3PAOA 5BRQA 2CLMA 2X0YA 1E4LA 5I3GA 2R82A 1V79A 3JU2A 1SW3A 3HQPA 4KWOA 1QDSA 4MKSA 1EDQA 1GVOA 3TONA 1K77A 1A5SA 4WHBA 4FLRA 3A3HA 5FJJA 4KETA 1XLAA 2PUZA 2WYSA 3UR8A 3V4BA 1Q5MA 2PLJA 1AJ2A 2GGIA 1DJNA 3MSYA 3GQYA 3V1HA 3WK2A 3QV7A 1IXPA 1AZ2A 3T40A 4HPGA 4B9YA 4JX4A 3LXCA 2XG9A 4RNJA 4JTDA 3TN4A 2YCLA 5DMYA 3KOZA 3QHOA 1A5BA 3WLTA 4PEEA 4GY1A 3NL5A 1SR9A 4HJFA 5AFDA 4TTGA 2IXVA 1V77A 1MW0A 2VCCA 3RX3A 3CASA 1W5PA 1E4MM 3PUDA 1SMAA 3IGUA 5D04C 2CC0A 4FLQA 1SJCA 2ZUSA 1GG1A 3HJEA 4JIIX 3BLKA 2JKEA 2DT0A 3IUIA 2JK2A 3STGA 3PP7A 4I9TA 2Y7EA 4EXBA 4FR6A 4L5ZA 1W0MA 1VJIA 4W8BA 4HZMA 2VYOA 2QJJA 2E67A 2Q3OA 4LY8A 2PWFA 4LCSA 3LRKA 3W7IA 1Q2RA 1HN1A 3ZJ7A 3L2LA 5JU6A 1BYBA 3EDFA 2I57A 2DT2A 1GTEA 1MW2A 3THUA 1W2PA 3SGZA 1OF6A 2OODA 3KRSA 2QPUA 2A3EA 2TRSA 2VDHA 1LWHA 4D6GA 4ECLA 4A29A 2OZ0A 3ITVA 1RD6A 3WD1A 4EWJA 3FGCA 3V36A 4JCMA 4EF9A 3L0NA 2Z24A 4WGXA 1BSLA 5GNXA 4DX3A 3TK7A 4JXCA 2VP8A 3SADA 4US6A 5C9ZA 3LTSA 1ZNNA 4TTUA 1X1OA 1MW3A 5ABHA 4DI8A 4W86A 3IV8A 3TA9A 2BVDA 4UQCA 4AD4A 1UWRA 1XH1A 1W8SA 5C7HA 2OJPA 3DAQA 3ZM8A 4GZJA 5EBAA 1QO5A 3GVGA 4S1FA 2V8ZA 2C3ZA 1BQCA 2VENA 1VIZA 2CNCA 4YHGA 4JTIA 3H2OA 1X6LA 3MP5A 1W3NA 2X8RA 1WQ5A 5CKSA 3U2OA 1ZJAA 4K7YA 1ECQA 1ZHAA 2BOGX 1PCWA 1WDSA 2C1IA 3DDMA 2BFGA 1XGZA 4LVFA 3O06A 3AICA 2C16A 3P5YA 3AJXA 1PIIA 1S38A 4AWEA 2ABBA 3A5FA 1PSCA 3BLIA 1BHGA 2A6LA 5FEZA 4KH2A 4B5WA 1BQGA 1TKKA 1PTDA 3PBWA 2PWGA 4XZBA 1KFCA 2ZTJA 1KRCC 1F4AA 1BG9A 2F6XA 2ZUWA 2A7NA 2Z1KA 2QJMA 1PE1A 2ZXDA 4ASTA 4MUPA 4M81A 3GLCA 2GL5A 4HTYA 4DQWA 5E09A 1DOSA 3BJSA 3WLIA 4B9ZA 2PDFA 3LLDA 2QUTA 1XIBA 1JZ6A 1ME8A 3EEGA 3N6JA 3W7QA 3KWSA 5LNWA 3H12A 5T26A 3U57A 2GVLA 5BXSA 1YE4A 1HT6A 3W02A 2O9OA 1YXYA 3POCA 1P5BA 3RCMA 5M5DA 1A5UA 3QEZA 4J3WA 1NELA 3GTHA 2YXGA 2YA1A 4O1EA 3TC6A 2XH0A 4N9EA 2V2DA 4R7OA 3PJWA 4UNIA 3UNDA 4O10A 1UMYA 3GE7A 5BRBA 2Y62A 1OABA 4BWLA 1ZZMA 1AODA 4ACZA 5I24A 3VNLA 1N8IA 3F4WA 3KS5A 1L6SA 1EDTA 2C18A 5I06A 5I6SA 3DUGA 3AXIA 2YYTA 4AD2A 3VIPA 1PS9A 1EJUC 3PBUA 7TAAA 3G0UA 2DSZA 4BS0A 3GDKA 2OMAA 4ILSA 1P6BA 5DX7A 4GYJA 1S5VA 2EPMX 1Q4NX 5TNVA 3PFRA 4V2XA 2FDMA 3DENA 2Q8XA 2ACSA 3PULA 4FALA 1C90A 3GDLA 1SJBA 4ERAA 1X38A 5DBTA 4C6DA 1Q3NA 3VMPA 4FNQA 1HW6A 4HSNA 3GKFA 4IGHA 2FVKA 1FKWA 1GOKA 3E9AA 4WIWA 1O6IA 4O1BA 3GUGA 5FL0A 2PMQA 3H7UA 1UD4A 1CXKA 3Q58A 3B9DA 4FXJA 3EX6A 3VNZA 3M7SA 3TC3A 1ZY9A 1O1HA 3GDRA 3U8GA 3NO3A 3W29A 4PC8A 2CW6A 2YDSA 4DHGA 4Y9OA 4IPIA 1VBHA 2YL9A 2CKSA 2YKKA 1RR2A 1XYFA 2DP3A 2GUBA 2YPIA 4DYKA 3FKRA 4PE8A 3S3GA 4UB9A 2OX4A 1FKXA 1U5JA 4HPXA 3WLOA 1UG6A 2ZE3A 1TA3B 1US2A 4JTRA 1XUUA 3WNMA 5BWFA 4KRZA 5DQPA 4GIYA 1Q2SA 4XTDA 3W1MA 3UNTA 4OUIA 1JEZA 1M65A 3CHVA 3URAA 2BY2A 4CEXC 4PUKA 1G7VA 3RLHA 4P7QA 1YX1A 1BKHA 2DIJA 4QG6A 3BW2A 3TJ4A 3CPRA 4G6CA 3B0XA 4PGLA 5D8ZA 3U48A 3OGVA 4CN1A 3MKKA 1W1VA 4WVXA 1B54A 5HR6A 2JGYA 4Y8FA 1X1NA 4HD5A 4WDUA 4NHVA 4GCAA 3M43A 1KCZA 1SO4A 5D30A 3WF2A 4GVGA 1OD8A 4FOJA 1ITUA 3HO8A 2PDBA 4UTWA 5JIPA 1C91A 3O6YX 1LL7A 1UWTA 2YFNA 3MU7A 4LS2A 1EJVC 3RF9A 3RGTA 4HHHA 4A3HA 4HBKA 3W1RA 1GQIA 1LRNA 2IW0A 1VPXA 2VM8A 4MNJA 3PZUA 4PSRA 3R6IA 4QX4A 3GM8A 4RPPA 1O7AA 5C2CA 2D23A 3WD3A 1MUCA 4I8YA 3VPLA 3SCNA 4XKYA 1VFSA 1JNDA 1JRBA 1C93A 3SJ3A 2ACQA 4K8HA 3H2AA 1ADDA 1E1EA 1KM5A 3LGDA 3HPZA 3BSHA 4IF2A 3U5YA 2PDIA 3FYOA 3K4AA 1QAPA 4R3UA 1OYBA 5KZDA 1XLGA 1GKRA 1FWDC 1QMLA 3AIBA 1QPOA 3A4JA 3BSGA 5C54A 1J9YA 3H21A 5D9OA 1UW9A 4EXQA 2E9BA 4F0HA 3IGXA 4UFIA 2NXHA 4QE5A 1TUFA 3T7VA 4C7DA 1E9IA 3UWYA 4XO7A 2Q01A 2WHMA 1KXHA 4X3ZA 4K1GA 2DVUA 4NAEB 5DMNA 1F73A 2J78A 3B4YA 3IJ8A 4MWAC 4N0RA 2VEGA 4HYVA 3NGJA 4K8GA 1GKPA 3S8HA 3IS4A 3WQ8A 1WZLA 2WJEA 2CERA 4A21A 3IJ9A 3T81A 3WYZA 2W62A 2Q02A 1IEVA 1KFKA 4Z08A 5FJRA 1JFXA 3MVTA 3LOTA 2O9RA 4PRRA 1FCQA 3S2NA 4YMZA 3VOJA 3GNOA 1XPYA 1RCQA 3MO7A 4HJWA 4UFJA 1E1CB 2AOSA 3B9EA 1T96A 4OV4A 3VIMA 3S2CA 1QRQA 3ARTA 3W53A 5LGZA 3TTEA 2RGLA 3U2EA 3SRHA 5SWUA 4GZIA 5ENLA 3MMDA 2VC5A 5G1TA 1FHLA 3UWUA 1S5WA 3WF4A 2CHRA 3TW7A 4WKAA 2XM1A 2ABAA 1EOKA 4XAPA 5LYRA 4JYFA 1H1ZA 2H6RA 4YL2A 3W3OA 4FA3A 2QUUA 2R1NA 1V7YA 2VD9A 1QW9A 1MFUA 3C8FA 3ABZA 2V9DA 3MWAA 5DXXA 1HGWA 2Z1VA 4N9CA 3ZFHA 4O4VA 1S46A 1QK0A 3VKJA 3L5AA 3ABQA 4Q8OA 3WF0A 2FGLA 5H6HA 3QF0A 5DCDA 3G77A 4JHZA 1TZ7A 5HUPA 3CIXA 2A6NA 1JJKA 3DG6A 4ROQA 2XISA 2YBUA 3BZGA 2ZFAA 3SDOA 4HSOA 2GZXA 5E70A 4GQRA 3UFYA 3N9SA 2W27A 3H54A 3QC0A 1BVNP 4OV9A 4NRRA 1TPFA 1VIWA 1S3HA 1JZ2A 5TF0A 3H2CA 3O6CA 1JYNA 2BLEA 4K7VA 3N12A 1FVPA 3MUY1 4S3KA 1A5NC 4NI8A 2XFYA 3MUZ1 2AGKA 1W2VA 4C6PA 3WQGA 1B3XA 3BGAA 3D3FA 2YX0A 4BQ3A 2QDHA 4RKAA 3QZ6A 1XFBA 1ZL1A 2J7DA 1RVKA 3RCYA 1PDYA 5IOBA 3NL3A 3PJXA 4ALDA 2OZ8A 3E38A 1BSIA 4GVIA 3W1AA 3GC2A 3PZQA 4PTDA 2PF0A 4LEFA 4Q22A 4JL1A 4W93A 3STEA 5E93A 3FKKA 2F6UA 3BCDA 3I6RA 1A5CA 2BOFX 4F3HA 1AH3A 2FZ9A 1GOWA 3M0VA 3AAMA 3W7DA 4GVHA 4LF1A 2X1TA 5AYBA 2XIQA 3W1PA 3SSZA 2VEMA 4B5NA 1VEMA 3BICA 3CQIA 1CW2A 3D46A 1V8EA 4PFHA 3NVTA 2D73A 2CBUA 3SCRA 3TX9A 1RALA 5HQLA 4E4UA 1P7TA 3BAXA 3ISIX 2J7CA 1ZBWA 4UQDA 4PCPA 1IGWA 6REQA 2HRWA 3DC8A 3TN5A 3C2OA 4Q8NA 4CD8A 2PDMA 4JY9A 2LLEA 2Q6ZA 6TIMA 4DYEA 4ML9A 2BVYA 3LTPA 4XD4A 4GO8A 1KXTA 3HG2A 4RL3A 4HZ7A 4C6KA 3EKLA 4IGSA 1PYFA 3TYEA 1V3HA 3W2JA 2QMKA 2E25A 8XIMA 4LAKA 5HULA 1PZ3A 2QCGA 1LLOA 3GY1A 1K6AA 1S2CA 2Z00A 1NAL1 3LB0A 5I79A 4XVEA 1VFUA 3SJNA 3FS2A 1WDRA 4AY1A 1R85A 5FL1A 1PAMA 1NARA 2HK0A 3W2UA 4M6VA 1B3VA 1FWRA 4GG9A 4L6DA 1K9TA 1ZTVA 4XZLX 3G1YA 1EO5A 1ZJIA 2XTKA 3SQMA 2FVLA 4JHMA 4E4PA 4IFKA 2P50A 4IQDA 2O92A 3MBDA 3HPFA 1EBHA 1KWGA 1GZGA 1I45A 4N6FA 3STFA 5KINA 2XWDA 1VHNA 1FWEC 4RXGA 3M5YA 4H6EA 3SI9A 3O1NA 3PPGA 2BODX 2Z7GA 4DYJA 4JL2A 4HPJA 4MFDA 4LX4A 4QE1A 4W87A 4I9MA 4E38A 5FJTA 3TYDA 2RDTA 1H49A 1XYAA 3BCFA 3DI0A 1FDZA 4V15A 1XC4A 5E0KA 1Q6OA 4TX6A 4PL1A 1EL3A 4NYUA 3TUUA 4O8RA 2XN1A 4NZFA 3LN3A 4URIA 3T0AA 1EJWC 4ROPA 4OUEA 5JMUA 4AIEA 2YA2A 4QE4A 3MKCA 3BCJA 1A53A 4ATDA 3GK0A 4WDWA 4GQGA 3QLLA 5L6UA 3WG6A 1H3GA 1E72M 5BOOA 3WLKX 4AX7A 5IDZA 3ABOA 1W5QA 3UGVA 4HU3A 2DZXA 4YXGA 5AC7A 4JEJA 4MLRA 3GH5A 2WVVA 1PVNA 5IXEA 1KBKA 4MAZA 3WBXA 3QLDA 4TV5A 1TWZA 1XH0A 3BG3A 4CD5A 4E8GA 3G0XA 5LA1A 1EC9A 4GFSA 1HJWA 2WNNA 2C0HA 3UPMA 1GOXA 1UZHA 4UIOA 2B4GA 4C6OA 4D8LA 2QVHA 1LOSA 2I1OA 1JCTA 4US5D 1OHLA 4WXZA 3TSBA 4S2BA 2V81A 1TVPA 4IICA 3O63A 1IV8A 4KGLA 3TIMA 1DWIM 5CZSA 3VX0A 5MHBA 1O66A 1MW1A 2PP1A 3S1WA 1FCBA 3P93A 3WUFA 3RM9A 3OO2A 1WP6A 1PTAA 4JNZA 2Q71A 4LRSA 5GQBA 4H9ZA 1KV5A 5I78A 1UBPC 1NWRA 4L6HA 1M04A 1Y7VA 4HP5A 4GWEA 3CV7A 2Q3RA 5KTLA 5H2ZA 3GXMA 1QO2A 2OO0A 3I65A 3U4AA 4FOUA 5BZAA 3P7YA 4X63A 3CT2A 3SCOA 2GK1B 4KWSA 3KVMA 4DJDC 3N14A 1VH7A 2H3BA 3GR8A 3NQDA 1U33A 2J8FA 4HMEA 1P0DA 2FZBA 9RUBA 1QOPA 4RV3A 3B9AA 1WKEA 3RRAA 4R7WA 4CNTA 3L9CA 4UQAA 1GYMA 4BA0A 3A4XA 1E0XA 4WXYA 4GYPC 4Q8TA 1I4NA 5G5IA 1JD9A 2VDGA 3NQAA 2WHJA 3PPFA 4C90A 3H7RA 3PBVA 3VGFA 3MUCA 3M0YA 1CZ1A 2QKFA 3ANUA 3FIGA 3E3HA 1DWHM 5XINA 4YWSA 2OLHA 3VOFA 4C65A 1EGMA 1QI5A 2QV4A 2PGWA 4AY8A 4UTKA 2BV9A 2IMRA 4LAOA 4F0KA 1GVQA 3GU2A 5XIMA 4DWSB 1Q6GA 1DVJA 1EDGA 4A3YA 2GWNA 3E2RA 2PCQA 4J3ZA 3UZWA 3S6TA 3P81A 3KDNA 3UETA 3TP4A 3TJXA 1UPMB 2D69A 3S1VA 2O4MA 4XTIA 3DH7A 1C92A 2XU2A 2CESA 1DORA 2PDLA 5DBUA 3AYTA 3CQHA 3ZS4A 2VX7A 4JN7A 4QNWA 1DKWA 4ZQRA 5HWJA 1XQLA 3M9YA 4EK7A 1ZUAX 1PJ9A 2YXXA 5BWAA 1KRBC 2PDYA 5TD4A 4C6FA 4UMAA 1O60A 2YJQA 2F2KA 2ZCGA 2X16A 3EMCA 3IIVA 5FEWA 3UY8A 4UQEA 4LB3A 1SO6A 4PMNA 3LHVA 3FJ4A 2D0HA 3W7HA 2RKXA 4XD6A 2Z0IA 3EX2A 2XJ7A 3VMNA 5KZEA 4NNBA 1OT1A 4NJIA 3T08A 2EG7A 2X1RA 1IR2A 2OT1A 4JBRA 3IUDA 3V3WA 3L4TA 1VJSA 2I5QA 5DN1A 1I75A 2HROA 3B06A 1YADA 2NZLA 3NGFA 1DIOA 3MDWA 3E0VA 1ISXA 3PZGA 3CZJA 2JFEX 4Z2JA 1XLHA 3AHYA 2WLYA 4ADUA 1RP9A 3N13A 3T07A 3OG3A 3VD9A 4DF2A 4GIRA 3LCGA 3DG7A 1LBFA 2J62A 2HVNA 4LY4A 1GJUA 1JAKA 2HVOA 3I3DA 4ZSUA 5LIXX 4D8ZA 2PDHA 3B03A 3JR2A 3TH6A 3UPBA 1UUMA 3IGHX 5G4WA 3NVDA 4L6OA 3FJNA 2X30A 3I3BA 1X1ZA 3RPDA 4GI8A 1OB0A 3W37A 3LERA 4JICA 2L5HA 1B9ZA 4MKNA 3M64A 2XFFA 1R9YA 1V51A 5MF5A 2A79A 5I3JA 2XH2A 5C9UA 1E6NA 4Z2HA 4YTRA 3VD7A 2HCVA 4PUNA 5HOSA 1UH3A 2D3LA 3NZPA 3ZYZA 3RCNA 1VBRA 4H2CA 5TIMA 4QCEA 2VR4A 2XHYA 4XG1A 3WK0A 4ZQOA 1HKKA 1JULA 3QYQA 4HNCA 1QI4A 1G4SA 3QR1A 4FO4A 5A6TC 4C6QA 2EEXA 3N2BA 2XIOA 4AMAA 3AMCA 1XSIA 3CUFA 4Q4RA 1W6TA 5HDRA 3IEBA 3THQA 1UR8A 3XISA 4DJFC 1KRAC 3HA1A 3MANA 1TV2A 3WLSA 4FPSA 1JNEA 4U4MA 4TVUA 3KP0A 4LAUA 1XKJA 2BX7A 3ME3A 4NIRA 3GAKA 3L7RA 1D8WA 4RCXA 4DLFA 1JXKA 3REQA 2FVMA 2WBGA 1H5VA 3HMCA 5EMJA 1M7XA 5LNUA 3LS9A 3BVJA 3ZVHB 1R7AA 1AUSL 2E5DA 4NAFB 5CGQA 3N29A 1WNOA 2V5DA 3A4WA 1XG3A 3AMKA 1MO0A 1XPGA 4NKCA 3SR7A 3NZQA 4DELA 1LQ2A 1ISWA 1MEWA 2UZ9A 1O1ZA 4LV9A 4RE3A 1RJPA 3TW9A 4D6HA 3GXDA 3WLJA 4K2SA 1UP0A 3Q65A 1V6XA 2E6YA 4GACA 1OK4A 2VCAA 3R8GA 3I6TA 2NQJA 5H8PA 3CZEA 4DZ5A 4O52A 3CJPA 1RBAA 1J0YA 4Z42C 3R8RA 2EAWA 1TSIA 2PWEA 4AW7A 1XSJA 3UP8A 3LHZA 3UJRA 4ZO6A 3G8RA 1X8CA 2W67A 1EJXC 3FSUA 3R94A 1K9FA 1R9ZA 1GOIA 1EHAA 4KPLA 1ZP3A 2HBXA 1OQFA 1UUQA 5TBOA 2WNWA 5F2IA 3ES8A 4IISA 1IQ8A 3MBFA 4LB4A 1UZDA 2ZRUA 3I7QA 3DYPA 3BAWA 1I2NA 1ZJHA 1H41A 1FH7A 3QC3A 3S1GA 3TYBA 1TWSA 1MQQA 5D05A 2WHLA 4JQAA 1XUZA 1LLZA 2RDUA 1T8XA 1AW1A 1QPNA 2NLYA 1PYMA 4HA1A 4AF0A 1ALDA 2GJXA 1D3CA 4U28A 2YYUA 4LT9A 1IIHA 2IPJA 4H4IA 1A49A 4NVTA 1TELA 2VFDA 3SY1A 4OQVA 1W3JA 2VNCA 1P0NA 1IEXA 3IJLA 4ZGYA 3CIVA 1POJA 2Z7KA 3APYA 4G2DA 1FWAC 5D8WA 4IPNB 3HJZA 4HCLA 1FH8A 2CCRA 3NL6A 2VQUA 1F6KA 2FMNA 3FN9A 3I4KA 3LQGA 2WM1A 3SFKA 1N8WA 4GXPA 3TWBA 1BVZA 1PZ0A 3S47A 4ORIA 4CGTA 4E5TA 1O5RA 3W76A 2DT3A 4U3AA 3GU1A 4BEQA 4F66A 2GJRA 1XP3A 2ISSA 2FGZA 1M6JA 1GHSA 4GD0A 1PHQA 2Z25A 3IJDA 1B4EA 1YMYA 3FDKA 1LL4A 5BCAA 2B31A 3W82A 4XV0A 4JDYA 4EAYA 1HVXA 5IFPA 1GOMA 4B2DA 1GK8A 1CNVA 3SW6A 1R2RA 3F4NA 4NAEA 3TCEA 2HS8A 4WRHA 5A8GA 1HVQA 1FFQA 1LQAA 2ALDA 4DZAA 1QOQA 3W72A 4C1LA 4QJ3B 4AIBA 1QWKA 2QDGA 3FK4A 1UA3A 1GCYA 3VD5A 2ADAA 3IIZA 1ZB5A 1VD6A 1WDDA 3DYMA 4IH3A 5HUOA 4G9PA 4PTMA 3P0WA 1S1PA 4PTNA 1EQPA 3RR4A 3T8QA 4IPPA 4K68A 2FHFA 4GNJA 4LGXA 3CZ8A 4GUFA 1EX1A 1P1XA 2QHAA 5DMLA 1UR9A 1FTXA 1KWKA 1HF6A 3C0QA 3QZAA 5I5RA 2BY1A 3UF9A 3SBFA 3QH2A 3FDGA 4M7SA 2Z2BA 3TWAA 3DZ1A 4O54A 2NXGA 2ZZ3A 3NZGA 1EYEA 1NEYA 3BOXA 1KBJA 9CGTA 4IM4A 3G18A 1PCKA 3WQPA 5IDIA 4PRTA 5LSMA 3G8EA 4IP4A 4FX7A 1V6TA 3LHTA 3PWIA 3G3DA 4JTQA 3GAYA 3WMBA 2XYLA 4I8DA 3W2KA 4G56A 3QMSA 4NX5A 4W7VA 1YBQB 4P8XA 5EMMA 4LUTB 4TVDA 3SZ8A 3FVMA 1Q6CA 4R34A 2AMGA 2GQ8A 1UMLA 4HCDA 1FHUA 2X1IA 3VDHA 1W9DM 1O94A 2ZZ6A 5I09A 3S2JA 2O0TA 4IMCA 3M46A 3LCWA 1F9CA 3PTDA 4F9JA 1XH2A 2RHGA 5HNTA 1XBYA 3PG8A 3EWDA 3SUWA 2VUNA 2VC7A 1J12A 2WMFA 4XZIA 5CAHA 4X2PA 4UFHA 4EVZA 3USBA 3E6EA 2WANA 2TAAA 3DESA 5FF3A 1YQ2A 1TV4A 3GYCA 3T05A 1R3VA 2PLKA 1ZCOA 5FJIA 2C19A 3HOJA 1R38A 4GKLA 2WMGA 2OSXA 4GUHA 3PY2A 3FYYA 4IQEA 4GYKA 4FXFA 4EPDC 1GVYA 1XYBA 4QEEA 4GX8A 4UR9A 4F0MA 4DBWA 5HQMA 4H2HA 1A50A 2OFJA 3HG3A 4IUGA 1MVYA 4M51A 5F2GA 3CGTA 1NQ6A 4Z17A 3PVFA 5G2IA 2PTWA 4H83A 2VOTA 1S5NA 3VU2A 3FA5A 1Z7AA 2X2YA 3WH7A 3D0CA 3IVUA 4XZWA 4LOCA 3VVGA 4AZBA 2J9ZA 3G24A 1F3XA 1FWNA 4KT2A 4WK9A 1QNOA 2RGMA 1EB3A 3UCCA 2FZDA 1KFEA 2ZUTA 4QQUA 2GYIA 4TVCA 2R1PA 1Z48A 4MNKA 4C1NA 3HFTA 5DCBA 3ZQ9A 3PB0A 4O1DA 1JRCA 1W9BM 4DBSA 5DO8A 3ZZ1A 1JZ8A 5FEXA 1LTDA 3M0LA 3WUBA 2E8YA 5A1AA 3CHDA 3LENA 1XWYA 4WJXA 4ICMA 3E2QA 1B3ZA 2E8ZA 1DQUA 3EX3A 1MYRA 4F0SA 5AHNA 1PWMA 1XQKA 3GHRA 4LCRA 1Y5VA 3A3WA 4GISA 1AW5A 3BQ6A 3QKEA 1C7SA 4IQLA 3WH9A 2RDXA 3RPTA 3GHSA 4IQJA 3RR1A 1Q8JA 3B0PA 1R3WA 3WQ4A 4LAZA 3DHDA 1H62A 2ZZ4A 1WV2A 3SUVA 2I14A 2AL2B 3G6LA 2QEZA 4OECA 1NTHA 1OCJA 5K7JA 5I3IA 4IMEA 1J11A 4HMCA 4JFWA 5GPRA 5HAOA 1K4HA 2VGBA 4NNCA 3WQWA 4ATWA 4KGJA 1HUVA 2VUYA 1W3IA 1QOXA 5A8NA 4ACYA 5DT5A 1W9UA 3KW3A 4A35A 2RDWA 2OKTA 2CLEA 4N7QA 2V0TA 5AECA 3WLLA 1ME7A 3JZUA 5CGTA 3WMCA 3I68A 4AD5A 3B8VA 3N2MA 3TR9A 5AC6A 5KZMA 1AFSA 1PUDA 1HP5A 2MNRA 2WMIB 2ZA3A 2J79A 2A3HA 3GG7A 4NZ5A 1ISVA 2OT0A 2VEFA 4CD4A 2DZTA 1AQFA 1OCQA 5M17A 4DWSC 2UY4A 4RK8A 3ZJ8A 2W61A 4JAWA 4W4QA 1R46A 1RP8A 5C8BB 3WQOA 4G7EB 5FESA 1GJWA 1OFOA 1H7NA 4WKFA 4GABA 1J2BA 3PWGA 1SFSA 3SB0A 1KFJA 5HATA 1K6WA 4H9VA 3CV2A 3PG9A 3AHTA 3EAUA 1LDCA 3NXLA 3NPWA 4QITA 2D1ZA 2ZRYA 3K4DA 4AXKA 4C6LA 4IMGA 1PX4A 4MG4A 5H1WA 4Q8VA 3EDDA 2CLPA 5DF0A 1U5HA 4QSFA 4EF8A 1ZFJA 2QGYA 1W3HA 2NQ9A 1RJQA 4L56A 3UA4A 4RNHA 3WX7A 4OBRA 4IJBA 2J9YA 1XSKA 3VUSA 1KRMA 5D2YA 4TR9A 2FZ8A 2EPKX 4AWUA 4QDPA 4UXDA 6ALDA 3RYSA 1DTUA 1I6NA 3WD0A 5EFDA 1MNSA 1K8YA 4OE7A 3II1A 4LAMA 1JYWA 2ZX7A 1XM3A 3G3MA 4WLCA 4NJJA 3EEZA 3DU0A 1V3MA 2DW7A 1GG0A 2BASA 4JDBA 1EWDA 1W91A 3CWNA 4DUXA 1LOQA 4RLIA 3G0SA 4QLJA 3MUIA 3CPGA 4OGZA 4GKTA 1J0JA 2OEJA 4OKDA 1WZKA 1EH9A 1UD6A 2ICSA 1EZ2A 1LORA 3I7RA 4Z1CA 4ZR8A 4GO9A 3APTA 4QG8A 2GK1A 3BQ5A 1A4LA 1FRBA 1AMYA 4MZ8A 1IT7A 2E1WA 3QYSA 3R0UA 1QR7A 1XLMA 3HG4A 4WF7A 5A6SA 4QAWA 3TOYA 1LUCA 4NQ1A 4JTSA 1DWGM 2CLLA 3EX1A 3GHUA 5DELA 1GZ1A 1OX4B 3PC0A 3UWEA 4ZBCA 2JBMA 2EO7A 2OTDA 4ZXOA 1Q7MA 1XIMA 1P0KA 9XIAA 2BXZA 2YGYA 1H7PA 2OLAA 1K8XA 1G69A 1K9DA 1TTQA 1RZMA 2QVNA 4CCCA 4NP7A 1CXHA 1Q85A 4XO6A 1RQBA 4R9XA 1QASA 3LNPA 4NASA 3KE0A 2GGHA 4U33A 4PCTA 3WCZA 2YZRA 3WLRA 5DT7A 4QR6A 5CC3A 5T8GA 3AIRA 1HKWA 4GA8A 4LEQA 2OQHA 5B7YA 3E0LA 3N18A 1FOBA 3MMTA 4M1BA 3LA4A 4Q8UA 2TPSA 1YPFA 3IWPA 1LT8A 3PNZA 1BAGA 1GWJA 4LFYA 2EF9A 4M3PA 3GIPA 1EF2A 4RXFA 1QPQA 3B04A 1NDZA 1MXSA 4WSJA 4HNOA 5KSWA 2P0IA 4MHBA 4A8LA 2C8NA 4RUBA 3MZ2A 1HNYA 4AIOA 3LPPA 2ZX9A 4MZ1A 2ZX5A 2UV8G 1WZAA 4GNVA 2AAAA 1ZLPA 2RJHA 3UU0A 1XGDA 3K2GA 4YYFA 3W2MA 2X0HA 1VC4A 2J6XA 3NSMA 5REQB 4CN6A 4E8DA 1DIKA 1S2AA 3AS2A 3QQWA 2ZVIA 3BW4A 5A8PA 4XBJA 3ZOAA 1E71M 4WUIA 5D2VA 4S3EA 3G5EA 2PWUA 3HPSA 3GVQA 1BGGA 2OEMA 4L9XA 4Q4QA 1RV8A 3GRIA 3EYPA 1ONRA 4Y9PA 2ISWA 1V03A 1VB9A 3FA3A 1OIMA 4GOAA 1XHGA 3B40A 1E43A 4L4PA 3EDKA 1QPKA 3TU9A 2YB4A 4JIRA 4AD1A 1QBAA 1E0TA 3U2CA 2JQXA 3GC5A 2EJ1A 3VDAA 1TVNA 1GW1A 4DO6A 1PL9A 3F5KA 4HMDA 1EZWA 2VRQA 3CTLA 1C9DA 4DUOA 1AJ0A 1REQB 3HPXA 3O9NA 5F4XA 2QCFA 1G4EA 3KTCA 4PULA 5AYZA 4WY0F 4MB1A 1SUXA 4GQ0A 1PBGA 2A21A 3CPUA 4XAFA 1YNPA 2CPUA 3VGBA 3K1DA 4CLMA 2OG9A 1TPH1 1HP4A 1UR4A 3AJ7A 1XKYA 1AL7A 4ZO7A 3GSMA 2E0PA 2VCBA 2VC6A 3GNDA 3VAVA 1S1RA 1OFPA 3GG0A 3SCQA 4PRWA 4WD0A 1XDMA 3URNA 1Y0EA 4CVWA 5C0QA 2QMJA 3PBYA 1EIBA 1A3HA 1IE7C 3LCIA 4CCZA 3KVJA 3NDZA 3PFMA 4M80A 5BU6A 3KRUA 3MYOA 4HU8A 2PDNA 1V93A 4QISA 3ATZA 1TTJA 1AA1B 3VKBA 3AROA 4N02A 1FWTA 3A13A 1NSJA 1O95A 3MS8A 4CU6A 3W7OA 4FK9A 5CZTA 2D2OA 3O8AA 4AYGA 1OCNA 4RV8A 5LXXA 3EWXA 5AHFA 5G2HA 1OX5A 1DIDA 1FP9A 1YDNA 2V82A 3WK1A 3BK0A 2IQDA 5BOFA 1CGVA 2J27A 4MPQA 3BMVA 2VX5A 3EWZA 3PZ9A 4AXNA 1PX3A 3BUVA 3F4CA 4GBDA 4ZOCA 1FXQA 2BGNE 2NX1A 5CPLA 3EA1A 4PR4A 4PBFA 3UZYA 4A6GA 3UZZA 4NAFA 3W7RA 1UD5A 3UXIA 3WLQA 4JIHA 1TV5A 4Q4MA 1KBLA 1HX0A 1IXQA 3TQPA 1NY1A 1SZFA 2GVGA 4ZCWA 4CN4A 4MJ4A 1VFLA 5D38A 1R3RA 4N9DA 4BY3A 3W7CA 3E96A 3G1DA 3RO8A 4B5XA 4F4RA 4AB4A 2FMOA 4DF1A 3DFSA 4DBEA 1VPQA 1AQMA 3TSDA 5A6LA 3UJEA 1UKPA 5CJNA 1X7FA 3IPWA 4GY7A 5IHSA 1A3WA 1T0OA 1JPKA 2NT0A 4L61A 4HYRA 2R8WA 3EDEA 1HGYA 3WD2A 1M9HA 2P8CA 5K9XA 3M7WA 1EOMA 4A05A 4HOZA 1ICSA 3W7PA 5H8UA 3T78A 3CAKA 2JALA 2CZEA 1YDOA 2OVLA 2J7BA 3FV9A 3SCUA 5F2MA 4CQAA 4LU0A 3MP3A 1HJUA 2QCCA 1Q4WA 2YL8A 2BVTA 1IZCA 1U1JA 2CHOA 4KRTA 3UA3A 3NO5A 4PMOA 3ATYA 1ZPTA 4HNNA 2PP0A 1CEOA 4M24A 3SCPA 1DHPA 4JIQA 4JR5A 2EPHA 3M1ZA 5AYIA 2WZIA 1E3ZA 2WKJA 2C13A 2WAGA 3T9PA 3PZIA 2J9XA 4K8EA 3W87A 4X0NA 4CCDA 1GONA 1CGYA 1XRTA 3N19B 1ONXA 3UG5A 4KCVA 3QV6A 2BHYA 1YIXA 4V1YA 1F4HA 4NZCA 2PDXA 1IIGA 1EFZA 1WAUA 4GXWA 2Z6IA 4UFMA 7A3HA 3TJLA 3A64A 3WJYA 5E1QA 3VGDA 1Q65A 1QVBA 1KW1A 1XLDA 2ZQ0A 1OVDA 4F9DA 3H2MA 2IS7A 3EX4A 1B2YA 3CAVA 3NWRA 2ACUA 5ECUA 1BYDA 4RX0A 3NQ2A 3UWZA 1BYAA 1XYCA 4LQ1A 1L8PA 1W54A 3CUIA 3EKGA 5BYWA 4DJFD 4HIBA 3MQTA 1SZEA 3OB8A 1J6OA 2A3CA 2FFIA 3C2YA 4QTGA 5HPOA 4QGCA 2CHNA 2NUXA 3TMQA 3CH9A 3VDCA 4LC8A 4FI4A 1UP2A 4IG2A 4PTWA 2R14A 4WR3A 3R58A 1EGZA 4JYDA 4H9MA 1VRDA 4CNPA 3LLXA 1OX6A 2WW5A 2PZNA 4CKQA 4ZEPA 1KQZA 5KMYA 4QS6A 1XCFA 3FW6A 5AVHA 4C6JA 2F6KA 1VS1A 3PBMA 5HNRA 4FX8A 3BG5A 2ZICA 4XUYA 1UIOA 4BFAA 2AKZA 3O3RA 5G4EA 3TVAA 5EMKA 2UBPC 3F4VA 4HN4A 3B8SA 3MVIA 4JQ2A 3GO2A 3R0DA 4K1WA 4QJ1A 3N6HA 2OYMA 1XYZA 4AZCB 1XXXA 2IQTA 2BHUA 4IOTA 2UY3A 2Z1BA 4LUTA 5ABEA 3PZOA 5JXQA 1C3FA 4H9UA 2YDQA 3G1HA 4IJCA 3C4UA 3V75A 3P74A 4HGXA 4UTTA 3H8AA 5KETA 1GORA 3WQEA 4IJRA 4S3FA 2D24A 3EA3A 3ZSSA 3AHVA 2ESCA 3FYPA 3M0HA 3K8MA 3PR2A 3L23A 1SPQA 5BRPA 1W1TA 2J4GA 5HANA 3R11A 4A3UA 5GNYA 1OJXA 4F8XA 2ASHA 4TO8A 1YNYA 2J24A 3V7PA 1XLBA 3EB4A 2A3AA 1KO0A 1YDVA 4MY1A 3TSMA 3VGGA 1XC6A 1RLCL 4AZ5A 3ABXA 3A4AA 2XGBA 1U1HA 1UJQA 5HWNA 3OVQA 3LNMA 3DERA 1CCWB 1Z6KA 1FCVA 4IFOA 2CWNA 1TG7A 3AMDA 1DTNA 5AY7A 3HV8A 5CBIA 5XIAA 5D2WA 3BURA 3PWAA 1U83A 4UTJA 4HNUA 4AZHA 3CUHA 3G1FA 4AD3A 1N8FA 4QEHA 4YCOA 2VFFA 5E6ZA 1C8VA 1JDFA 4MGGA 1B5TA 3TEVA 2WSPA 4OOZA 4QHRA 2JKPA 5C9XA 3T2QA 2ZE0A 5I3FA 2X7VA 1Z69A 3AS0A 3C0SA 4DJEA 3E5BA 1FWIC 3EOSA 3VNMA 1VFMA 2W92A 4GGBA 2X42A 2EJAA 2HXTA 5CGMA 2RFGA 2F38A 3VIKA 3K46A 3FJLA 2GJPA 4LH8A 1BF2A 1RA5A 4UMBA 1XD0A 3V0TA 3N34A 3URBA 2NX9A 3DBPA 1TJ2A 1YLVA 3VZZA 3VO0A 3WSUA 1AH4A 1QW8A 1M1BA 1CB7B 1I1WA 2DSKA 4AH7A 2ATSA 3ZT5A 3EWCA 4NZ1A 2SFPA 4MWAB 3W6YA 3SCVA 5HJLA 3SRFA 3MCMA 4GIEA 3POHA 3GR4A 3GFZA 1UD3A 2W66A 4MM1A 2JEPA 3OIXA 4UTUA 3NQCA 7CGTA 1F8IA 3M44A 5FF2A 4I9AA 2AL2A 3GYEA 3PK7A 4FP1A 2IUZA 2BOEX 3NM1A 4G1KA 1RBOB 4JTEA 5M03A 3WUGA 5JUVA 1E0UA 1TB3A 2BG5A 2D0FA 4FLSA 2W91A 4LYQA 2YCEA 5FKYA 3TN3A 4ZA0A 3UESA 1H7WA 1ZBVA 3LCFA 4ZQMA 1WDWA 5CAKA 3UYIA 4S3AA 4ZMGA 3TLLA 4HNLA 5IBXC 3O6AA 4DO7A 1M7OA 1P43A 2HBVA 3LUTA 4QNEA 5C9WA 3S6OA 2VZTA 4C6NA 2PE4A 3WLHA 3QHNA 3BARA 1DXFA 2GGJA 3S9ZA 1R3TA 5D4YA 1K3UA 4KFNA 1LL6A 3CC1A 2BS9A 5AYXA 3CO8A 1OADA 2DDXA 3LM3A 3VZYA 3PTMA 5JBEA 4U5IA 3GR7A 1E55A 2ON3A 2ZRXA 5EMYA 4PH6A 3CK5A 2D0GA 4YNGA 5CSRA 2PGEA 3U7VA 4QJ4B 4W5UA 3RNDA 1JF6A 3M0IA 3BPWA 1W5MA 3OOQA 3QFWA 4O0ZA 2WVSA 5DY2A 2NLIA 1VYSX 3UJFA 4S2CA 2VT0A 4E6MA 4OWGA 1W1YA 1TCMA 1Y8BA 2PC8A 2VL4A 4QP0A 3OHMB 1ZP4A 2V5LA 3ARPA 3EWUA 4JOMA 4LUSB 4BKNA 3CO4A 1VFHA 3P62A 4Z2GA 4ICCX 3G6MA 3TYZA 4US5A 2A4AA 2ZZ1A 2HE8A 1RVGA 1JXJA 1R30A 4ZL1A 2OELA 2CEQA 4MTVA 5CCZA 1HL2A 1PPIA 3AC0A 2ZKMX 4IL0A 3AI0A 3TTOA 1WZMA 2XSXA 4NRSA 4S3DA 3WL1A 4BEUA 1Z42A 2QXWA 2ZUUA 4O18A 3WMSA 3G1AA 2QGHA 4UC5A 3N2CA 1A0DA 1TPC1 3RN6A 2VFHA 1VZWA 4REQB 3KFTA 1ADSA 4UFLA 5D37A 5EKYA 4PBEA 4R53A 1M68A 1TV7A 3AO0A 3UY7A 3LDVA 2OQYA 2NQHA 3AXKA 1RLDA 1P48A 1SR0A 3BDKA 4FNTA 1SO3A 3HZ3A 3R12A 2VX4A 5PTDA 1R6WA 1GGOA 2KX9A 3CNYA 2X7WA 3SGUA 2NUWA 3GFXA 3IJ6A 1A5AA 1XIEA 3D47A 4JN6A 4JS3A 3KRBA 4KCUA 1A47A 3WMLA 1Q6FA 1QXLA 1E51A 4YCPA 3HU7A 2E4TA 1XCXA 4PB4A 5LKYA 2MANA 4PUEA 5U7SA 1XBZA 1TJRA 5G4HC 2DSWA 3OYXA 2ZA1A 3N04A 4Z1YA 4YU1A 4JTHA 1JD7A 1GVSA 2YZ5A 4PBGA 3LYEA 4QFUA 5BXPA 7ODCA 4D72A 5LIKX 8XIAA 2IXUA 1NOFA 1CYGA 1KXQA 4J35A 3AYSA 1BWKA 5A6KA 1WKYA 4EPKA 4XIMA 2CFFA 3MUAA 3NOYA 1W3TA 1YE6A 1IWAA 2W9MA 3WH6A 5DEZA 3IAQA 2ZVRA 1HIZA 4DWSD 5J8LA 5LIWX 3DFYA 3QV9A 5LZLA 5EFFA 4ZENA 1VLWA 3LV5A 2V6AA 4IGNA 1SM9A 1WXJA 3ALFA 3K13A 2WQDA 1AZ1A 2B7NA 1EJSC 4RE0A 2PP3A 4Q6XA 1PKLA 2HNHA 3AUOA 4X61A 3EB3A 3GH4A 2R1LA 1PKYA 1T99A 4QIUA 5CPMA 3W6LA 2XN2A 2QUVA 2WHKA 1NF0A 1TREA 3GDTA 1ZSXA 1JQVA 3TFCA 5REQA 2WKLA 1UD8A 3GG8A 2JE8A 1CIUA 4O17A 1VCVA 1ZBCA 3QMTA 3OGSA 3VCNA 2RAGA 3JVAA 3MV01 2WV8A 1S5TA 2VEPA 1D3GA 3MP4A 4RZ5A 2PB1A 2G5WA 3THDA 3CUJA 1CXIA 3V35A 4Q3MA 3UXAA 3TTQA 3MTWA 3UJ2A 1Q6RA 3M6YA 3N9KA 1XRVA 1FA2A 4L4LA 3LD5A 2OB3A 4GK8A 5I2UA 3Q37A 5TQLA 3OZPA 4A3QA 3FX4A 4KFPA 3UCQA 3VMOA 3AYRA 9XIMA 3LGGA 5T9BG 1F2JA 3FEMA 3K30A 4HQVA 4BQ5A 4I6VA 1PTGA 1FCUA 2O9TA 4I7VA 1REQA 1KD0A 4YJ5A 3N2XA 2INFA 3BW3A 4XKMA 2YCLB 1J0KA 1JGMA 4E2VA 4QDWA 4UTLA 1MUMA 4S3BA 3KTXA 1KM3A 2QULA 4ZQPA 5BROA 3AU6A 2ZYFA 1MXDA 4JYEA 2BSLA 4Q4OA 1XJBA 4A8NA 5E6YA 3UZXA 3LCLA 1RSCA 3N73A 3QRHA 1XINA 2GGEA 4BI7A 3T0DA 2VFIA 1KFLA 3V5FA 3IIPA 2PBOA 3ZLHA 1AVAA 3C2RA 4JIEA 3S0CA 2FDSA 4Y6GA 2ISFA 1HJXA 2G95A 1NU5A 1WBHA 2JIWA 5ABFB 4JTGA 1ISZA 1F7BA 2OZTA 3OODA 1W1A1 2J6VA 2B0MA 4S38A 3NG3A 2W3ZA 3GTNA 4DN1A 5AC5A 1B0IA 3VNYA 1UA7A 4LNYA 2AAMA 2V67A 1ESWA 4GQBA 3KXQA 1CXFA 3FGCB 4UR7A 4XVDA 1V0LA 1WUFA 1I9CB 5HR7A 1JZ7A 4J27A 4D6CA 1LM1A 1OG0A 1LYXA 1ZGDA 1OINA 3P14A 3HQOA 4LALA 2V63A 1O5QA 1XICA 2D22A 4KEZA 2C1HA 3NOEA 1BPLB 4GRSA 1VP5A 2YDRA 1GHRA 5C9RA 2HVMA 3N9RA 3P3BA 4H9YA 1H63A 3DX5A 2CLKA 1TWIA 3M0ZA 4M6PA 1VFOA 2CU0A 1LQ0A 4IP7A 5GJPA 1D7KA 4FS9A 3SCWA 3M0JA 3CZKA 2G0WA 4BZYA 1E15A 1T41A 4KESA 1ZALA 3UWQA 4DZHA 2E6AA 1ZENA 3VIJA 2B7QA 3OLIA 4NL1A 3I4EA 4JNMA 3LM7A 3TE9A 1PIFA 2IKGA 3DHPA 4IWWA 5DFAA 1KLZA 3WJXA 3VK5A 2AQWA 3L4UA 3RM4A 4JTKA 2KAUC 4WZHA 1M03A 5LIUX 1W56A 4Z1DA 1WE5A 5CJMA 3TN6A 5M2FX 2XINA 2DIEA 1KCXA 1LBLA 2F8QA 3UERA 3KZPA 3F03K 4DBDA 5K2ZA 1HKVA 4IIGA 2QYGA 3C86A 2E1DA 5AHMA 3WELA 3VIOA 1BKSA 2OX1A 5L9FA 3P8IA 1KCLA 3NQFA 3ARZA 3Q2DA 2OWXA 3W6MA 3C2EA 3UZ5A 2XIIA 3PHAA 3AISA 3W1XA 6TAAA 5C55A 5E0CA 2ZZ5A 3WLNA 3IACA 4XQ6A 5D2TA 3NQ7A 2PRHA 4QG9A 4AVFA 4JTTA 1XW8A 1NP2A 2Z29A 1CXLA 2WC3A 3LCXA 1XBXA 2PCEA 3QHMA 2O7QA 3N6QA 1VJZA 3UXKA 3ID7A 2C15A 3VIFA 5ABTA 3QW3A 4ORMA 3KVKA 1FQ0A 4IUOA 4MFEA 3OQEA 3ARXA 2J8TA 3NQGA 3BOFA 4Q32A 1FY6A 5CG0A 5JBFA 2HE5A 3DECA 3W7EA 5A69A 2IPFA 4GLEA 4S23A 4NZJA 4GGHA 4LS1A 4DB7A 4LPCA 3WD4A 4UOZA 1K02A 4KEUA 2UY2A 3BLPX 1Z44A 1Z89A 1BEUA 3R13A 5CSYA 1TX0A 2YW3A 3VOIA 3FAWA 4GJ1A 4LVAA 3VD3A 4Y9AA 2DV0A 1HL8A 2CWXA 4JFUA 3WNKA 4C6EA 2XWEA 4OJYA 5IFTA 3GHTA 2FB3A 4YTSA 3W1UA 1UR3M 2YIHA 4MDOA 4NI3A 3W83A 3W86A 1OFRA 4R27A 3V0SA 1E6PA 1OD0A 1X97A 3PUEA 1EF3A 3M0XA 1LT7A 1E56A 2GJNA 3ZR6A 1T5AA 3FEQA 2PTZA 3OLDA 2VRKA 3BAIA 3L0GA 3OBEA 1WOBA 5DCEA 3R79A 4DAFA 1PIGA 3ITXA 1SFTA 1ZBKA 4WJEA 1UUOA 3RAOA 2D20A 4XSLA 2WSRA 4AZCA 3JW7A 2D2JA 4WCJA 4P2VA 1DP0A 5FAJA 2VZUA 1RA0A 3JUGA 3T2PA 4O28A 2C1GA 1EXPA 4HNVA 1CXEA 3O05A 2GDVA 3ALGA 4X0VA 2VTFA 3BGGA 1OWQA 1VYRA 3DFPA 4H3DA 2HISA 3TA6A 2D2HA 3GVWA 1X6UA 5M3WA 4DPPA 4DM1A 1VCGA 3EOLA 1WX0A 1P6WA 4JX6A 3TLQA 5D9NA 1TE6A 1XIGA 3V5CA 4LVBA 4WKHA 3NA8A 2OLSA 2G3IA 3IANA 4RDWA 2CBIA 4X9YA 1RHCA 1VBJA 2OSYA 1E4IA 4MOZA 4PMYA 2DU2A 4F2UA 4KWUA 1LWJA 4M8UA 2F61A 2Y4SA 5T9CE 4AEEA 3L5MA 3NPVA 1U22A 1FWCC 2INZA 3VCRA 2A3BA 5A3HA 1BFNA 4NYYA 1DJIA 4ZQNA 2WOQA 1JI2A 1MFVA 1SQ7A 1BYCA 3F1QA 2V2HA 5LA2A 2GJLA 3B9OA 3FAXA 4IZGA 2DZSA 1IR1A 4JTJA 2FHBA 4J3UA 1LG2A 4YS1A 3SCTA 1UIPA 4IIHA 4R9OA 3P67A 3LY0A 1LOLA 3SFWA 3CTTA 4I9JA 4TQTA 2G4JA 4NJHA 1DWFM 3W01A 1XV8A 5E9XA 4PB3A 2QJNA 1K7EA 2FYMA 5C5YA 1TCDA 1WAWA 3M4HA 1AJZA 2J7HA 4ZB5A 3W7MA 5I77A 5IHRA 1WXZA 1Q45A 4FSAA 4WY0A 3WEMA 2X41A 2PBGA 4D2JA 5F4SA 3GZAA 3MHUA 4OTKA 4NXKA 2IKIA 1HQTA 3QGAC 1MXGA 4AZ7A 1JCYA 3K8KA 4LJ3A 4KEVA 1CENA 3NFUA 3MHGA 1RXOB 2Y8VA 1OGBA 4DJED 2XGZA 2DH3A 5A94A 2WC4A 1SYTA 2PTDA 2QQ6A 1GPWA 2DQXA 1L8NA 4XIAA 3KEHA 5I7GA 2AQVA 3ZT7A 4MWAA 4R85A 2W4XA 3DBNA 1FFRA 2O7SA 1J10A 5A8QA 1C7TA 4GVFA 3SEPA 1QTWA 3ARYA 1HJSA 2XM2A 3EPOA 2GFTA 4NX0A 3A24A 4H8HA 4LRTA 4HMNA 1JUBA 4AX6A 4PUWA 4QSHA 2JIEA 5A6MA 3AZSA 3NQ6A 5D33A 4FX6M 1FWHC 1M41A 3MSDA 4OVXA 2QCNA 3A12A 3U2ZA 3USZA 2YLLA 3SIZA 1YPIA 2PWVA 2V5CA 3DHUA 1NDWA 3WDIA 2EBNA 4GZ7A 3VYLA 2WMJA 3MUXA 2DY3A 2C79A 1DQXA 1OGGA 3G22A 1LZOA 1E9ZB 3VZXA 3RX2A 3QKZA 4B92A 3SECA 2FH6A 4F2TA 3RXZA 4AC7C 4OU1A 1JPMA 2FIQA 2VR5A 3GB6A 4E8CA 2WWDA 2EGZA 3KZSA 2ZRZA 1PKNA 3EXSA 3IVTA 3ITOA 1R3YA 2HSAA 2PDQA 3VE7A 1B1YA 3A47A 3OG2A 3NSXA 2WMKA 2XVLA 3OZYA 3NNTA 7REQA 4XB3A 5JBDA 3W0KA 5AN7A 1X6NA 1ISYA 1VYPX 4KCTA 3HQ1A 2ZUVA 3L2IA 4WSHA 4NJKA 1FHVA 3OBKA 5C71A 2D3NA 1EYWA 3ITYA 3KBSA 4TMCA 2OWWA 2OKOA 4W85A 5J5DA 1FXPA 1QU4A 4DUVA 3NDOA 4IP5A 4X9SA 2HV5A 3H22A 1W17A 1FWFC 4O4WA 3NQEA 3V1PA 1I1XA 2PWHA 4B3KA 3QZEA 3VIHA 3JZEA 1ONEA 4B3LA 2QJIA 3F5LA 1WUEA 2PURA 3DFOA 4FNPA 2GUYA 1QNVA 3GDMA 3S83A 1DWAM 1H4PA 2REQB 2Y8KA 3GIYA 1NP0A 4Q7NA 2E6FA 1OEPA 1DJZA 1Y5XA 3MJMA 3K4WA 4S39A 3FJ6A 4OZOA 3LHWA 3MY9A 2GSHA 2YL6A 2AKMA 3WQDA 2DW6A 4R33A 2WXDM 2W79A 3WJSA 2P3EA 3SCSA 4AHPA 1WYIA 1R86A 2R94A 4KMQA 4V28A 3AFBA 4Z0SA 4YVXA 2A5HA 1FH9A 4LBUA 3R89A 4MVAA 3U9IA 4HOXA 5DRCA 4REQA 3SY8A 5CG7A 1VFFA 3U0HA 2YDAA 2NXIA 5FEPA 2UWFA 2WNQA 3FXGA 4YLWA 2DZVA 5A6AA 2XIMA 4L65A 3OQ8A 3QSRA 4C6MA 4FNUA 3XINA 3PPHA 4JIPA 4CUCA 4GUGA 2EKCA 1I0BA 4JKLA 4O8AA 4HA3A 2VELA 2E5BA 1P7TB 5HWMA 5JVLA 3UGRA 3KX6A 3O2LA 3R43A 6REQB 3G1XA 3GU9A 1NJJA 4KCWA 2YOCA 1YXDA 1QHZA 3WQ6A 2F9RA 1PZ2A 4ZXLA 3WF1A 3CUZA 4EXAA 1EBGA 1V7AA 3NJ3A 2ZRWA 1W1PA 4M82A 1KGUA 1W5OA 1NWSA 5CZJA 3WDRA 1JZ3A 4J3XA 1LLWA 4N4QA 4ENLA 3FFSA 1J8VA 1ZAHA 4RZBA 4XZHA 3TDFA 4JTCA 4UTMA 3BOLA 1Q63A 4CQ8A 3DG3A 3WNPA 4IGMA 4P7OA 4I5RA 5CZ0A 3OTRA 2JF6A 1GYNA 1D7FA 6XIAA 1VF8A 2Z28A 3MA8A 4CQ9A 3RM8A 4UFKA 4HZ8A 5I00A 1AQHA 5AZ0A 3UPWA 4YVVA 2X2GA 2PA6A 4LUIA 3VNKA 1UROA 1OT2A 3QBUA 1UR1A 1JQXA 4YIWA 2BB0A 2YBVA 3BAJA 1G67A 2J7EA 1AK5A 2H8ZA 1RK5A 1QFEA 3BO9A 1E4NA 1UJPA 1UBSA 3I6EA 3Q94A 3W00A 4ES4A 4MADA 2I5IA 3RFAA 3PPCA 1R0MA 3SO7A 1LG1A 2QPXA 3KOWA 4N2YA 2CZ5A 5HXMA 1JVNA 2J88A 2DH2A 3B0UX 4M29A 3LPFA 5CLWA 1BD0A 3VFLA 2DFAA 1SZRA 3SGGA 2INEA 1WPCA 2Z2UA 1TR1A 2NT1A 1KM6A 4QROA 3G1SA 3AOFA 3CL8A 3RMJA 4K39A 1K03A 3LTYA 3U6WA 1IZKA 5K4ZA 2DZBA 2YBTA 3HGOA 4I7WA 1QNPA 2XIJA 4UTFA 4HSHA 2ZUNA 4HCHA 4XAZA 2V2CA 4AFYA 3KBNA 1SSDA 1XLLA 2BY0A 4GUJA 2W6RA 4I3GA 1KTCA 2JEQA 4W84A 4HA4A 1LRQA 1R5YA 3HN3A 1YEYA 2ATMA 1B3OA 4XD3A 5BNKA 2IKJA 3CZGA 4F40A 1DJXA 3DGRA 5EY5A 4JQ3A 4PL2A 4B5VA 3PTQA 3SRKA 1P0BA 5HJYA 1FWBC 3ELFA 4UNKA 4AAJA 4O1FA 4EIVA 1B90A 3CHEA 3GUWA 1W9PA 4R7JA 3EWYA 3NQVA 4TMBA 4X22A 3WO8A 4R5EA 1QI3A 2HDJA 5K9CA 3LGEA 2G8ZA 3AALA 3OHIA 1Q6QA 3KL5A 1W1ZA 2TMDA 4QAIA 3MV11 4F0RA 3W27A 1QI2A 4DJDA 4H9XA 1S5MA 5FF7A 1ITXA 1TR9A 3L66A 3P61A 1PX8A 1UCWA 1UOZA 1V0MA 1UH4A 1CTNA 3T0CA 2OU4A 3HGRA 3PUOA 4NNAA 1PZ1A 4GYPA 1W8GA 3CHFA 5HNUA 1GPFA 5LGXA 2QV5A 2WSYA 4JGDA 2H8XA 1Q7QA 2RJGA 5ABFA 3UG3A 3MYPA 4NUWA 5J04A 1R3SA 2XUCA 2PAJA 1EP2A 3WUEA 4WDXA 2NSOA 5CPNA 1H1YA 1DBTA 2QCDB 3UWWA 4MB3A 1V02E 3E74A 3E0IA 3N3TA 4Y8EA 5EL1A 2I9EA 4DNMA 1J4EA 3AXHA 2WPBA 2ODOA 1CECA 3PM6A 1F3WA 1CLXA 4RDVA 3WJZA 2BGQA 2VRJA 4BI5A 1TQJA 4GI9A 4LCQA 6CGTA 1XFCA 3W85A 4BWLC 2HPIA 3THCA 1JYXA 2BWGA 4LVDA 2ALRA 3GW0A 1PO9A 1XF0A 3H2NA 1UWIA 2QJGA 4QLKA 1BXNA 4C6BA 1OZMA 3EKZA 3AS3A 3TQKA 2A1YA 2PFHA 2FPVA 3L67A 3KLLA 5HINA 1UWQA 3SUTA 3LHYA 2FH8A 2FQIA 3R5EA 3CU2A 1MDLA 1N55A 5LNVA 2C7FA 1ME9A 1KKOA 1W32A 4FXRA 8TIMA 4ADTA 3VOCA 1XBVA 3URQA 3IIOA 3MPGA 1TMQA 4D8AA 3A5VA 4IMDA 1N2VA 4A2RA 2P10A 2J7FA 2P8BA 3BL3A 4Y90A 2XN0A 5EBUA 1A4MA 1THFD 4H8VA 2HK1A 1V0NA 3MDUA 3GW3A 1HKMA 3H2FA 4O57A 3GNXA 2R9RA 1DJYA 1H2JA 3PSVA 5I07A 3CAWA 2DQWA 1V3LA 4H7ZA 4ZOBA 5KZ6A 1AD4A 1PWLA 1KXVA 2TODA 2VZOA 2YB1A 3KTSA 3W7LA 1TA3A 1HJQA 4DXXA 2XZ7A 3LSCA 3W2NA 5AYYA 1EJRC 4QDMA 1KNWA 4FNRA 1V0KA 1G6CA 4GH3A 4PMZA 4ZB2A 3WEOA 2HJPA 2XSBA 4DIAA 3ES7A 2FJUB 2FB2A 3V16A 4BI6A 3SQLA 1UB3A 4UZUA 2H9AB 1IZJA 4CU8A 3E49A 3WQVA 3LZ3A 1GQJA 3AS1A 3W23A 3LMYA 4B5UA 3W73A 4RE4A 1MDRA 3CB3A 3J7HA 1DXEA 2PRLA 3UR2A 4H9TA 2I5GA 2XPKA 4XSMA 3CLMA 4R88A 3R7MA 3TYAA 1TVLA 1KM0A 2Y2WA 3LI1A 4J3TA 3A23A 1VPYA 2OYLA 1J93A 1G1YA 1TTIA 1C8QA 3H2EA 3O07A 3C0JA 1LWIA 3QGKC 4X60A 4H04A 1P0EA 2OXNA 4HT3A 3BLDA 1R7OA 3B0VC 4MB4A 4KWWA 3PANA 2ZADA 4C1KA 1E5JA 1KBIA 2GSEA 1ML1A 3FHAA 3MI3A 4MSSA 3HG5A 3KHDA 4FF5A 4ZB0A 4AD0A 4UTWC 4YYCA 5FF0A 4LYKA 4J40A 1ICPA 3LSBA 1R8LA 4AC1X 3CHCA 3KP1A 3W75A 2E9MA 3CV1A 4LANA 3NCOA 2CLIA 1RPXA 1T6MA 2DZUA 3NAVA 2PDWA 1JCJA 3KM8A 3WDJA 1QK2A 4B4HA 4LW7A 3LPGA 4IX2A 1V02A 1XR2A 4GC4A 3QSTA 3L2MA 1XS2A 4GYFA 4CVUA 1TJPA 1S2UA 4DJFA 1MNZA 1HKJA 3PUGA 1VHCA 5A8MA 3DIPA 3AYVA 1B4KA 3L21A 3ORWA 3ABRA 1F74A 5C7VA 1UWUA 3P80A 3PJUA 3IJIA 1J0HA 2HXUA 4KIEA 4AEFA 3PS7A 5M1TA 3FVDA 4W8LA 3R0KA 5BW6A 2FZNA 3PZTA 2YCKX 5A6JA 3REQB 1GVFA 1EC8A 3QTGA 1F3EA 1VBGA 3WNLA 2H90A 2XFWA 3AUJA 4NG3A 4L4OA 1C29A 3TV8A 1RAKA 3WBAA 4UMCA 3MI2A 1LCOA 1ZS2A 2OZ3A 1RQHA 1ZJBA 3P82A 3MKVA 3AIEA 2PC4A 3ZIZA 3NEVA 1DXIA 1VCFA 3VGEA 3W24A 1G4TA 1SGJA 1UASA 3IAPA 1E1CA 1V3JA 4LBSA 2AQOA 3TJIA 4FXSA 4D71A 4O53A 3UG4A 3BMXA 1X8FA 2CLHA 5AB3A 2DJLA 4MIMA 3KBJA 2R1KA 3OA5A 2Y5EA 4E4FA 4MLJA 4H7VA 3GVRA 5B7ZA 4NILA 3QV8A 1EPXA 2VO5A 2WZMA 4DXKA 2CETA 2X1UA 1HXJA 1XL9A 2E7FA 4OHQA 4ZTXA 5D02A 2ZUMA 3W1QA 3GNRA 2X09A 3GIQA 1L9WA 1ZCCA 5ABGA 4FB7A 1OIFA 1RUSA 3WKZA 2BMBA 1SFLA 1DV7A 1QUMA 2VWSA 3WZ0E 2Z1WA 2Y89A 1OYCA 4GY0A 4AF0B 4U31A 5FIPA 3U5UA 2GJXB 3PNUA 2P1FA 1R3QA 2BVWA 1WCGA 4J28A 1UHVA 2QIWA 5GVJA 1JUEA 3CH0A 1JF5A 4K37A 4XZ9A 2NSXA 3UBPC 3O6DA 4P7RA 4PMRA 3MJYA 3I7SA 4RJEA 4EACA 4PODA 3ZO9A 2WZEA 4E3TA 4IPLA 1WXYA 3DGBA 3HQNA 1TPEA 4BQ2A 3W7GA 1YDYA 2E3ZA 4MUZA 3LRMA 4C6CA 2BTMA 3IK4A 2VXNA 1OC6A 1H0GA 4UNLA 1E5NA 1EXBA 2P76A 2WVUA 2R91A 1RCOB 5I3DA 2NVDA 1VFTA 3QN3A 4F79A 4PTXA 3VTRA 3GS6A 1TE1A 3LCHA 1HFBA 4M1RA 2Y1HA 1MEHA 2G37A 4NY2A 1TPWA 4B5TA 3P6LA 5GJNA 1DPMA 5HQEA 4PCSA 3KS6A 1M5WA 4J4KA 1M7JA 4W5ZA 1UR0A 4D6IA 1UH2A 3CYVA 1BVWA 1I0DA 3WH5A 4K38A 1R47A 2YLAA 4HNTA 3U4FA 3H4WA 4MWAD 2Q8ZA 4IL2A 5I3KA 2J77A 3UVIA 1JAEA 3SUSA 2DSUA 2E09A 3MSRA 2Q8LA 2Y8UA 3OIHA 4IXHA 3IGSA 3VCCA 2V68A 3PZVA 4MDPA 3DC0A 3EBVA 6XIMA 4UZSA 4S3CA 4PMUA 5I3HA 4ONVA 3NL2A 5KITA 2V5BA 3E12A 3AU2A 2PF8A 3EPNA 1E70M 2GLKA 3B9NA 1KKRA 3M16A 1RPKA 3UCDA 4H1ZA 3BE7A 2A7PA 3GC4A 3NZ1A 2GDUA 5G1YA 3SRDA 2PDGA 3GNPA 1WBJA 4HPNA 3KLKA 6ENLA 3CQJA 3NSNA 5EB8A 4RR4A 3WJWA 1G5AA 3GDBA 3TYCA 1J5SA 1XYMA 1FWJC 4L9ZA 3ARSA 3R2GA 3T1GA 2FPTA 3QY7A 3EA2A 3M5XA 1GYLA 2EG8A 1I2QA 2PU1A 2WSKA 1NDVA 5DRIA 2I56A 3IUHA 2OOGA 3TW6A 2CYGA 2PDJA 4RW5A 1TPUA 1JCNA 3NR0A 1NDYA 1EJTC 1XD1A 3ARQA 3W28A 4Q8WA 3OVGA 1T8QA 2EPOA 3DOPA 3MMWA 1FX6A 2FFCA 1LROA 4MNMA 3EMQA 1JDAA 5A95A 3IK2A 1EA0A 1H7XA 2WZHA 1F5ZA 5JIWA 4JPGA 3EXRA 3W1NA 3KWXA 3CLWA 4JKMA 1HKIA 1RH9A 2G97A 3KBWA 1XX1A 1RBLA 4FZIA 5LHFA 1JFHA 3DXIA 3NPXA 2VGGA 2REQA 1ITCA 5LXEA 3VM5A 2PDCA 3AXMA 3N11A 3KCOA 5F7UA 1V5XA 5C70A 1YTEA 1K70A 1XIHA 4NJGA 3TZNA 4MZYA 4U5KA 6A3HA 1M53A 1BRLB 3M47A 6PTDA 3UWVA 1BG4A 3S9YA 4QRNA 3VNIA 4XISA 4AYSA 4UTIA 3N1AA 3B8UA 2OGYA 1G4PA 2G41A 1YTDA 4PUMA 4XBKA 3E0FA 4UUIA 1FP8A 1H1NA 3L4YA 2A0NA 1UC5A 4LWWA 1K4GA 4W88A 1L0PA 3HF3A 3RJYA 1VAHA 3CMGA 4MYAA 4GQQA 3QGVA 1GOQA 4C1NB 1Q8AA 1OZQA 3S1XA 4OFCA 3VNDA 7XIMA 3N3MA 3GD6A 2F84A 5K4XA 1E40A 5IM51 1U5VA 2E40A 2VOMA 4GHRA 3YPIA 3LMZA 1NFGA 4H6RA 2Y85A 1G9HA 3MT1A 1D3HA 4O16A 4H6QA 1Z41A 1YW1A 4LV4A 5AKQA 1JL8A 4UR8A 3ANVA 3CM4A 3OJGA 3TNOA 3G2GA 1QATA 2G3MA 2FTPA 2PD5A 4TIMA 1X39A 4INFA 3VKAA 1EUAA 1QNQA 1KM1A 3NQ8A 4O11A 1G01A 1H7OA 3S5OA 1WOAA 3WDQA 1VR6A 2VDIA 3GH7A 2DEPA 3GBDA 1MZRA 3S2LA 1IEQA 5DANA 3LHUA 1CBGA 3DHFA 5F1UA 3WLMA 1B3YA 5FAGA 4TV6A 4IXXA 4TX8A 4CQBA 2FTWA 5K3VA 3NTYA 1C8XA 4K36A 3MC5A 4E2BA 3KOFA 2VR2A 4Z1AA 1BGAA 4W89A 4AMCA 3FCPA 4G5DA 1TJ0A 4GI6A 5A2CA 3RDKA 3RLGA 3UZJA 4QXIA 3NXFA 4ZO9A 5EMUA 3ZWSA 2P88A 3QOKA 4AVNA 2A2IA 4DWSA 5CQ1A 1KBBA 1WB0A 3WBYA 4B15A 1DIEA 3N2TA 2P0OA 3K1GA 8CGTA 5EYWA 5FJOA 3ERPA 4CCEA 4JY8A 4ICNA 4H7CA 3AWOA 1Y5WA 3U7BA 4P5UA 4Q7BA 2FGBA 2WWCA 5F1VA 2GDQA 3ARUA 3BLOA 3DKJA 4YN5A 3IIXA 3ZJ6A 1XRFA 3OVPA 4PTVA 1UQZA 4DUWA 3A6OA 1ADOA 1E0WA 1QNSA 1IHIA 2CZVA 4E0CA 2QZRA 2ZC1A 3UEQA 1Q6EA 4EOUA 3WF3A 4WSKA 3CMFA 2V3GA 1TFVA 1SJDA 1E6ZA 1UPPA 1DYSA 3DFTA 2PGRA 1E6RA 1DHKA 4POCA 2QJHA 2XVKA 3RG6A 1GTHA 3W26A 4HK5A 3BC9A 2NQ5A 1V6VA 1O5XA 1IGSA 1SZNA 1US0A 2DUZA 2WZTA 2Z27A 4PCFA 3WY1A 2BXVA 3LEPA 4PN2A 1GUVA 1DWJM 3LV6A 2HTMA 3V5OA 2WKGA 4MKVA 4EPEC 2CLFA 1UZ1A 4Q4PA 4PMJA 4D1IA 4J7RA 2V5JA 3GXPA 4X2RA 3CXOA 2J25A 3E2SA 1BWVA 1X7IA 4MPKA 2OR2A 1PKMA 3RLVA 3IVSA 4IIBA 1U30A 3CS2A 1SMDA 1K7FA 4M19A 2XFRA 2QF7A 3W4RA 2NW0A 3ZLGA 4DRSA 2Z26A 5CLTA 1W9VA 4BF9A 3DFNA 1B3WA 1CGXA 3W07A 2HQAA 2E77A 2WB5A 5BOEA 3L68A 1IYXA 2Y5SA 3TMLA 2VD8A 3A21A 3K5XA 1TPVA 4C60A 4F48A 4DJDD 2ZWYA 1E0VA 4EE9A 1LUCB 5AC8A 2V3FA 4LTSA 5LNRA 4C6IA 4IT1A 4MJMA 5D2XA 2F7FA 4UQBA 4FAMA 3FOKA 3FA4A 3EWBX 1CT5A 2IPGA 2QCDA 5AHIA 3IJQA 2D2GA 1NQKA 1L6GA 2YW4A 4YWIA 4LUJA 4CU7A 4RPQA 1R2TA 4GE8A 2WC7A 4MY9A 2OO6A 4HTBA 5JH2A 4FLOA 3VFCA 4ZFMA 4Y96A 1MMFA 2BHZA 2UY5A 2OGJA 3M0MA 2XH7A 1UP3A 2Z6JA 3ICJA 1UKOA 3N4EA 2VZSA 3OU8A 3NEHA 1MQPA 3C52A 4IMFA 2AL1A 3OLEA 1V6YA 4GCXA 4KEMA 5EGRA 3E02A 1UYQA 4DNHA 1TPB1 2QCHA 3VD4A 3IJ7A 4DWDA 1CDGA 3QQ1A 2VEKA 1EPVA 1SFJA 3TTSA 3PSWA 1S2WA 2Y7GA 1E1FA 2WSQA 4EAMA 1CGTA 4U2YA 1AH0A 1W1B1 3H53A 2POZA 1M3UA 3ONBA 2QUNA 4ZTYA 1UKSA 1H50A 4CEUC 2FZMA 1KQYA 1TRIA 2PLCA 3LRLA 4Z2KA 4BCEA 1WKDA 1ENUA 2NWRA 2B7PA 1TV8A 3ZVHA 1GT8A 5CXPA 1P4CA 1J96A 3SN0A 4BF7A 2Y5JA 4RE2A 2ZA2A 4O13A 1GJPA 3VKKA 3RU6A 2NVAA 3L12A 2J47A 3D5HA 1K7XA 1Z3NA 3INPA 4NZ4A 5LHEA 2WLZA 3KVLA 4O12A 2ISDA 2NV2A 3L65A 1JCXA 2GUUA 4PUDA 4JFVA 1SZGA 1JPIA 3C0LA 2GQ3A 2ZZ2A 4ATLA 3CV6A 1QHOA 4GJIA 5AZ1A 4G8TA 4WX2A 3KAOA 4I7UA 3BLLA 3ENLA 3THAA 2CIPA 5A2AA 2DPEA 3STPA 4AISA 1F07A 3TYUA 7ENLA 2WQPA 2H9AA 2OWCA 3B8WA 4OBTA 3EB2A 5CBJA 5FSEC 1KV8A 1EC7A 1XG4A 3T4CA 4LF2A 4JFSA 3N4FA 2QCMA 3C3UA 1TO3A 3GZ3A 4GC3A 4DI9A 4D6EA 1H09A 1E9YB 3V18A 5CC5A 2XH4A 3XIMA 4EPBC 3LQLA 3W1LA 4HYWA 3WDPP 2PU0A 2WJZA 4QM1A 3QMRA 5MKGB 1RY8A 1H5YA 4UCFA 3WENA 3DI1A 1Q7ZA 3QR0A 3GXIA 5I0DA 1K1DA 1M7PA 1PXGA 4I5XA 3MZNA 3RK8A 4MMWA 5F4WA 4M6UA 2I7GA 3LBMA 1AW2A 4WDTA 2C6QA 3BV7A 4AZGA 3ZVIA 3DCPA 2PTYA 1V3KA 2NX3A 4DY1A 2HWGA 1UKTA 1IWPA 1C8YA 2B81A 1KTBA 4JD4A 4KFOA 1JPHA 1UWAA 4A22A 4ML4A 1TZ9A 4Z2LA 1I2RA 3AMLA 5FSDC 1I8JA 1V4YA 2O55A 3VABA 1JDCA 5EU9A 1T40A 1HZYA 1O12A 1CX9A 5LIYX 3VILA 1KR1A 3OLGA 3OGRA 4M5PA 5HPCA 2WPGA 4EKJA 3BH4A 3SN4A 3F2DA 1CGUA 2CBJA 5A5WA 3E0WA 1OBAA 1AL8A 2ZOXA 3AZRA 3OA3A 4QS5A 4M56A 4WOZA 4ADSA 1GVIA 3B8IA 4JHOA 4JKKA 4B4FA 4EP8C 3MO4A 3TROA 1XLCA 3MI6A 1ELSA 4U10A 1F76A 1TMHA 2ZX6A 4LC6A 4HZ6A 5A2BA 2HEJA 2J8GA 3RITA 4JTUA 1G94A 2PPGA 4Z0JA 4HKPA 1JYVA 4E2OA 3H70A 2BZNA 1HJVA 4GI4A 1EEXA 3M0KA 3PJTA 4QLLA 1EWEA 4ZZ9A 1DJGA 1D2KA 4G7FA 2ONEA 2F2HA 3GNNA 3HTWA 4V33A 3UJSA 1TX2A 5FOOA 2Y61A 1QPRA 1A5OC 2J75A 2PODA 1S3TC 1NOWA 3HURA 4QCFA 4GXMA 3H23A 1GKQA 3UR7A 1Q66A 5H8MA 3MWCA 4LVGA 4GIAA 3UXDA 1YNQA 3VOGA 1YBQA 7PTDA 2HNEA 4LBRA 5E0FA 3H4GA 2O4QA 2Y63A 2ZXQA 4H00A 3F7JA 3M07A 1H0IA 5C2GA 3ZJKA 4FMVA 4ZOEA 3RPMA 1IEWA 1H7RA 3HB9A 2PS2A 4IMAA 1HTIA 3WBEA 4ZE4A 3QM3A 3C8NA 3T0BA 1JR1A 3ANYA 3W7JA 3IRDA 3BTNA 4KERA 3OYZA 2Y7DA 4L1XA 2DUXA 2GWGA 3B97A 3PTKA 2A3LA 3ITTA 1JPDX 3AHZA 3CWOX 3RHGA 2C91A 2R1MA 4O0QA 3NPUA 4MY8A 3RJXA 3R10A 4Y2WA 5EA9A 1EEPA 4OIFA 3BZJA 4UCGA 3CB8A 1UKQA 1XLJA 3T8LA 3DN5A 1NM9A 4FEZA 3KL3A 4UOJA 1J2WA 3VDBA 1VBUA 4L4MA 1TJ1A 3NYDA 5D09A 4Q4KA 1AQ0A 7TIMA 4J9JA 1IEIA 3L5LA 2W0UA 1SJAA 3OW1A 3TQVA 4HOWA 2NQLA 1FUYA 5JQ9A 2FJKA 1IXOA 3SN1A 3VI2A 4HU4A 1MZHA 4AUBA 4G1NA 4L1GA 4LYPA 5CPSA 2OSWA 1TRDA 1P6CA 4NZ3A 1KFWA 2GVEA 1F8MA 1ZU8A 1YKWA 5G1MA 3QVQA 4PMQA 2GQAA 3W71A 3UW6A 1W1IE 3TXZA 3ZSTA 2EG6A 3VX1A 4BQ4A 2Y7FA 3M5ZA 5HK4A 4HK7A 1HO4A 5D32A 2X40A 3CMJA 3GXFA 4IG2B 4I5UA 1V08A 1J0IA 1OK6A 1EO7A 3HBLA 3VOHA 1H61A 3RIKA 3FY1A 2G3FA 2ZBTA 1MWOA 3SUUA 3EZ4A 3OPSA 3QPEA 1PDZA 4PYSA 3ITLA 4RZ6A 3S2MA 1RK6A 1RCXB 1AMKA 3WFLA 3ITCA 4N9BA 1QNRA 3FNDA 1ZAIA 3T42A 4MNLA 4A3RA 4LXFA 4TUFA 3N25A 2QDDA 3NQMA 1L2UA 1S39A 5I03A 1VLIA 3S46A 2E68A 3O0FA 2DUAA 3WL0A 2YR1A 1OY0A 3DEQA 2TYSA 4IIFA 2VZVA 2PD9A 4O0KA 4Y9MA 5CPTA 1BF6A 1OGSA 3B8DA 4A8RA 4GFIA 3VM7A 1MRAA 5DMMA 3FSTA 3L0KA 3W74A 3C2VA 5CC7A 1DL3A 3P0XA 2DVXA 1KM2A 4DZIA 3WFZA 3KHJA 4Q33A 2Y70A 3PF3A 1BWLA 4EX4A 4TOQA 3I10A 1IT0A 4YTUA 1CPUA 2ZTKA 4ZO8A 1KA9F 3LLFA 4U2ZA 1EP3A 1K9EA 2WMIA 3WK3A 5A6BA 4J3SA 4Q8PA 3MSGA 1QWGA 1QI0A 3O7UA 4WOQA 2QR6A 2TSYA 4XK2A 1RJRA 4G7EA 4HHMA 1TWWA 4N6EA 2E9LA 3W7KA 4GJJA 2NVCA 3ARVA 3OEXA 4PMDA 2QDEA 3WQ5A 4RDZA 1BRLA 1KR0A 4HK6A 3MB9A 5D9MA 2W5FA 4MJ2A 4O14A 4AWSA 4W9TA 2QLYA 3KOXA 4GINA 4ZQCA 3VKDA 4DXVA 1YRRA 3UQNA 3MW7A 1XI3A 2CZDA 2ZX8A 2Q09A 5B80A 4KW2A 5FD0A 1RD5A 1JIBA 2J7GA 1JI1A 4LSBA 3BG9A 2EPLX 3C6CA 1B9BA 4OBSA 2CBVA 4EANA 2PZ0A 4C7GA 8A3HA 3HM7A 4CD6A 1SW0A 2VURA 3G1RA 4ERGA 4J5NA 1Z32X 2WCAA 5CEWA 3OZMA 2O56A 4QQ3A 4DEFA 1XLFA 3ABSA 3R8HA 2P5NA 2HPMA 1C9WA 3A22A 4N42A 3BANA 1XIJA 2Z1SA 1KGXA 2XVNA 2FTYA 4UOQA 1J79A 1OX4A 3P2VA 3Q67A 1Q6DA 3BJTA 1VQTA 1K8CA 1VEOA 1UQYA 1FWGC 3BV4A 3S1UA 1VGAA 5IBXA 4J1OA 1NVMA 3C61A 3WDHA 4E3VA 1A3XA 1LRTA 4BR1A 3VA8A 1GVEA 1XLIA 3BJFA 4L64A 1ZQ5A 3LXAA 4PUUA 3AWNA 3AIVA 1WDQA 2R24A 1JDDA 2OPJA 2DZWA 2V30A 4RDYA 4HPHA 2QAPA 3EWWA 1GW9A 1YHTA 1XISA 2GVYA 5H91A 1KTNA 4XBSA 2DVTA 3HMJG 3CEUA 3KL0A 4TX9A 4LYRA 3WEZA 4Q6JA 3O16A 5CJ5A 1H51A 4OT7A 1LBMA 2C0AA 1HO1A 2VFEA 3HPAA 4P7LA 5U4NA 2I16A 1EHNA 4XAGA 3QW4B 2B7OA 2Y24A 3EPMA 4D6DA 4H19A 4H41A 2DIKA 3R4IA 1B57A 2XDFA 2FHCA 2I17A 4XZNX