1YNPA

Aldo-keto reductase akr11c1 from bacillus halodurans (apo form)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
283
Chain Sequence
b'HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oxidoreductase
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
total genus 103
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynpA01
4F40A 4I5XA 2ACSA 2HEJA 3RX3A 3COTA 5LIXX 2ISFA 3DN5A 4ZFCA 5AZ0A 3GUGA 4AUBA 4EXBA 2IKGA 1S2AA 2PDQA 2HVNA 5JH1A 5DANA 2PDXA 5M2FX 1YNPA 4JQ1A 1Z9AA 5LIKX 3H4GA 3LZ3A 2HVOA 2DUZA 3UZZA 4FA3A 4WDUA 3B3DA 1XGDA 5LIUX 4IJRA 3UZXA 2F2KA 2AGTA 1MRQA 3WCZA 3UP8A 1X98A 2IS7A 4GQ0A 4LBRA 4PRTA 4HBKA 4JTAA 1R38A 1Z89A 3LQLA 4WDTA 1Q13A 3UYIA 3EB4A 4DBWA 4GIEA 4H8NA 2HE8A 4XVDA 1C9WA 1J96A 2WZTA 2PDIA 3Q65A 1AFSA 4GABA 4JIIX 3WBYA 3RX2A 1X97A 2HE5A 2PDWA 4H7CA 1EXBA 1EL3A 4EXAA 2PDFA 2PDUA 4GA8A 1PYFA 2IPWA 4XZIA 2IPFA 1LWIA 2BGSA 1Z8AA 1S1PA 2CLPA 1MI3A 3R43A 2FZBA 3BURA 2HDJA 2IQ0A 3WG6A 1X96A 3CAVA 1EKOA 1RALA 4ASTA 3O0KA 3H7UA 4FAMA 1AZ2A 3BV7A 3LZ5A 2BGQA 2BP1A 4L1WA 3S3GA 2FZDA 3EAUA 3N6QA 3V0SA 3LEPA 3CV7A 4XO7A 1GVEA 5C7HA 3UG8A 2PDNA 3M64A 3LNMA 4LB4A 4Q7BA 3GHUA 4JTRA 3R58A 2FZ9A 2R24A 4R9OA 4YVXA 1AZ1A 4LAUA 2I16A 4XZNX 4XZMX 2PDHA 4YVVA 4PRRA 4XAPA 3FX4A 1VP5A 3V35A 1YE4A 3ERPA 2INZA 3UZYA 3VXGA 3WBXA 5AZ1A 1PWMA 2PDLA 4XZHA 2I17A 3M0IA 3Q67A 2IQDA 2PF8A 4JIRA 1PZ1A 1ZSXA 3V0UA 2J8TA 4JQAA 4JTDA 4FALA 3R8GA 3UFYA 3UGRA 3UZWA 1K8CA 2DUXA 2R9RA 3R94A 1ZUAX 2WZMA 3LBOA 3LQGA 1EF3A 3F7JA 3GHSA 3O3RA 4WRHA 4OTKA 3FJNA 1IHIA 3UWEA 1ADSA 2NVCA 4YS1A 5JH2A 1XF0A 4JQ4A 3M4HA 3LD5A 1JEZA 1LQAA 4Q3MA 4JQ3A 3RX4A 1IEIA 1UR3M 1HQTA 2IKHA 3ONCA 2PD9A 4GACA 2FVLA 2QXWA 2IPJA 2PZNA 4LBSA 4MHBA 4XVEA 3H7RA 4JQ2A 3EB3A 4WDXA 4QR6A 1FRBA 4DBUA 4GCAA 2PDJA 3D3FA 2PDGA 1VBJA 3BUVA 4L1XA 2PDCA 3QKZA 3MB9A 1YE6A 3LN3A 2HV5A 5KETA 4QXIA 2PDPA 2PDKA 2IKJA 1RY8A 4JTQA 1OG6A 1AH4A 4PUUA 3MC5A 2IKIA 5HA7A 3V0TA 4LB3A 1T41A 4RPQA 2PDBA 3WBWA 1US0A 3P2VA 2PFHA 1MZRA 4YVPA 1PZ0A 5HNUA 2FGBA 3KRBA 4PR4A 4XO6A 4WGHA 3CAQA 2ACUA 3T42A 3BCJA 4LAZA 2IPGA 3LUTA 1S1RA 5HNTA 3V36A 3LENA 2A79A 4DZ5A 4GQGA 3CASA 3C3UA 2F38A 2PEVA 4JIHA 4QBXA 3R8HA 1S2CA 2C91A 3NTYA 1T40A 1PWLA 3ONBA 4FZIA 1AH3A 4PUWA 2FZ8A 1AH0A 3GHRA 4XK2A 2PD5A 2NVDA 2PDMA 5LIYX 4WEVX 2ALRA 4PMJA 4NKCA 1SM9A 4QX4A 4WDWA 2ACQA 4HMNA 1A80A 4XZLX 2INEA 3N2TA 3R7MA 3R6IA 2DV0A 3U2CA 5LIWX 3CV6A 3G1RA 4IGSA 3G5EA 1QRQA 4G5DA 4ICCX 1QWKA 3CMFA 2PDYA 1ZGDA 4IJCA 2P5NA 4YU1A 1Q5MA 2VDGA 1XJBA 3DOPA 4JTCA 1YNQA 1ZQ5A 3GHTA 1HW6A 4DBSA 2ACRA 1RY0A 1M9HA 1Z3NA
chains in the Genus database with same CATH superfamily
1EF2A 1ZJIA 4R85A 3K4WA 2INFA 2PPGA 4RV3A 1X6LA 3GUGA 3ZSTA 1NOUA 3W7PA 4EXBA 2IKGA 1KR0A 1ECQA 2AQWA 3W29A 3VC5A 1XRTA 1DJZA 2ABAA 3A5VA 4LAOA 2A85A 1R30A 1EBGA 1YNPA 3PJWA 2WNQA 1LWJA 5LIKX 1QBAA 3GD6A 3GU2A 3QV6A 3H4GA 1B3WA 4F2UA 3LZ3A 4G1NA 4B15A 1M7OA 2PGEA 4TX9A 3EYPA 4WDUA 3QFWA 1H7WA 1TV8A 3LRLA 3GTFA 2P3EA 1H49A 3HMJG 5JVLA 2Y5SA 3AS0A 1KFLA 3T05A 3P61A 4JNZA 1IZCA 3VIPA 3GKFA 3T8QA 3UY7A 2ZDRA 3QSRA 4XKMA 2Z24A 4AHQA 3STGA 3GXIA 3BW4A 2XISA 4CQBA 1R3TA 3TCSA 1SJCA 4B91A 4EKJA 3U57A 1L0PA 3PZMA 4WDTA 1A3XA 2OLHA 3VAVA 3MHFA 4GVFA 3LHWA 4GFIA 3QV7A 3ABZA 1IWPA 1C9WA 3DHPA 4Q6XA 4LEFA 1RVKA 4XAFA 1TCDA 4Q8QA 3GTHA 5I24A 1XICA 3CV1A 3AIQA 4JBRA 4V27A 3K8LA 5MKGB 3DENA 5HNNA 2DZVA 2DSKA 5DY2A 2DSUA 5CSRA 4U4MA 2OU4A 3ZFHA 1AVAA 1L6WA 2B0MA 4HIBA 3TW7A 5CAHA 3E2RA 3FAXA 4JS3A 1CXIA 4DO5A 1Z41A 2BHUA 3B4UA 3WMLA 4BKNA 2L5HA 2HDJA 1CTNA 2DSZA 3L5LA 4IGHA 4JHZA 5AN7A 1RQBA 2JIWA 4JIEA 1SVDA 4DJEA 4YJ5A 2W0UA 4FAMA 1JZ7A 3TVAA 1E55A 1XIMA 3STPA 2WB5A 3YPIA 2ZA2A 4URIA 1UMYA 3KCJA 5LHEA 4LNYA 4IP7A 5HJYA 3WLIA 2JIEA 3VCNA 4UQCA 2YA2A 1K4HA 2CNCA 3BARA 1Y5WA 3M64A 4RXGA 2YCLB 4IHCA 3GTIA 5HMDA 4KEVA 1BAGA 5GNZA 6PTDA 1CZ1A 3NFUA 1WDWA 3SQLA 1HKWA 3T09A 1RK5A 5RUBA 3ZWSA 1FX6A 1CDGA 5BYWA 3G1HA 2ESCA 2BWGA 4LAUA 3NQCA 1VFMA 2W9MA 4O0QA 4JDBA 1PSCA 1UJQA 4O0KA 1A5BA 1V77A 1KRCC 1JXKA 2O4QA 3WLHA 4A3YA 4IISA 4P7LA 1M7JA 3WDJA 3FX4A 3C56A 4WJEA 2DPEA 3H2OA 1TQJA 3KVJA 3UF9A 1J9YA 2X8RA 1JUKA 1H41A 5DCBA 4I8DA 3NSMA 4M1BA 5CJNA 8XIMA 4JEQA 3BG3A 2ATSA 4ONVA 1W1PA 2PDLA 3QYQA 3M5XA 1S5VA 2PWVA 3VOCA 1OB0A 4C6JA 3ATYA 5CZKA 1JQVA 2JK2A 4JQAA 3G0SA 3NPXA 3EWDA 2BOEX 1CGXA 5LZLA 4FB7A 3OPSA 1JG9A 5DX7A 1EJ7L 2Y8VA 4MDPA 1UH2A 4WXZA 4O17A 4HKPA 2I5GA 3UG3A 2NVCA 1GZ1A 5D4YA 1MMFA 1QPKA 4WY0A 3LD5A 2VFFA 3G1DA 3HGJA 3W02A 3RIKA 2YIHA 3AICA 3N73A 3WK2A 1P0KA 4C90A 5M5DA 1D3CA 2VD8A 2A3LA 4XVEA 4D9PA 1PZ2A 5PTDA 1B30A 4ORMA 2DZSA 5KMYA 2VRQA 3WMCA 4A3QA 2PP1A 3FLUA 5D2VA 3VOJA 1YTEA 2E6DA 3C2OA 4QRNA 2D23A 1QR7A 3ANYA 2UBPC 1WKEA 2OWWA 4L6OA 3DFHA 1S5NA 4LEQA 1OD8A 4IQDA 4PUEA 1EQCA 2W66A 1I2RA 3OBAA 2VC6A 3FW6A 4HK6A 4LS0A 3MCOA 3R5EA 1QI3A 4ZGYA 4I7WA 1BKHA 4EP8C 3QZ6A 4C7GA 3GYCA 3M6YA 4PMOA 3G3MA 1D3GA 3T78A 1GVSA 3TQVA 1XIGA 3G1VA 2AMGA 3KFTA 4U33A 3BCJA 2HXUA 2XIBA 4HP5A 4DLMA 1YTKA 2HK1A 2IPGA 3LUTA 4KQNA 3W1TA 4PTXA 4M7TA 3VUPA 2HNHA 5LGZA 2PEVA 3UNDA 1KM2A 2B4GA 1G01A 4QBXA 4C6KA 1O5RA 1XRVA 2ZXBA 3OB8A 4DXVA 1SZNA 3WF3A 3W7KA 6REQB 2JF7A 5A8GA 1WQ5A 3WLJA 3THCA 1UPMB 2PD5A 1VPQA 2YFOA 5BXRA 2PDMA 1T0OA 1XYBA 4Z08A 5A2CA 3N9RA 4WJXA 4IMEA 2RKXA 2GJXA 4W5ZA 1EC7A 1XSKA 1KBJA 3CV6A 3C52A 1DP0A 1VPYA 4ICCX 2V2DA 3ARYA 3TV8A 1G9HA 2RDTA 1ZGDA 1QMLA 5CKSA 1TV3A 2Y8KA 4IPPA 1Q5MA 1XLGA 4UTUA 4JL2A 3TQ0A 4DWSD 3LHTA 1XG4A 2CITA 1Z3NA 1CW2A 2EPLX 4UQEA 3UWZA 1F4HA 5LGXA 2ACSA 4ADSA 3K8KA 4PUNA 2PTDA 3PWIA 1ZFJA 3ZT6A 5A6JA 1XLIA 4EF8A 3WSUA 2E77A 3A47A 3BG5A 4HU0A 1G4SA 4RNHA 1DXFA 1GKQA 1Z9AA 2ABBA 4P8UA 2DQXA 3B8SA 2OKTA 5D2XA 3KBMA 3L4WA 3FV9A 3NCOA 3KZSA 3GQYA 3QXBA 3NGFA 5MHBA 3UZXA 5M03A 1K9EA 3QBUA 2OGJA 4JTFA 3RCYA 2JF6A 4O10A 2ODOA 1RBAA 4IL0A 2W67A 3LNPA 4PMUA 3HG4A 4GOAA 4HNNA 1LBFA 1UKSA 3LPPA 2UY2A 3LLXA 2IS7A 3IIPA 4YXGA 4P8XA 3ARPA 4ZQCA 3CQIA 1E6NA 3M16A 3FN9A 1GZJA 4V15A 3E74A 3QVQA 3MJYA 5GNYA 1Y0EA 4L4OA 3AS1A 1J96A 1PX4A 2HWGA 2WZTA 2JE8A 4ZXOA 5BXSA 3CQJA 2CFFA 4DLFA 1H62A 1P43A 3BH4A 4LVFA 2PTWA 4XD4A 2J7BA 1QHOA 4HOZA 3N34A 2VEIA 2RFGA 2WANA 2DW7A 2YKKA 4E3TA 4JTKA 1BF6A 5DCDA 1XIEA 1XYLA 5KZ6A 1Z8AA 3QQ0A 4RW3A 1FWJC 1MI3A 1DTNA 3ZXWA 2C1GA 2E9BA 7ODCA 1W8GA 4ZB5A 2V63A 3VKKA 3TYBA 2RGLA 5HBFA 4KW2A 2VI0A 4F48A 1GJWA 1LBMA 3NEVA 3AIUA 4W4QA 4AZ7A 3E0FA 2DT2A 4CLMA 3VKAA 3CPGA 1OFAA 4HPXA 1F8IA 3LPFA 2WKLA 3WQ5A 4O13A 3ENLA 4A05A 1RZMA 4C6CA 2Z27A 5T8GA 1MUMA 3RM8A 1ADOA 2BXZA 1KCZA 2CKSA 1QI2A 5D2WA 3B0PA 1P1MA 4NF7A 5A1AA 2GUBA 3KUMA 3WFAA 1LYXA 5B7YA 1B2YA 3S4TA 3A21A 1MW3A 2F8QA 4OIFA 3VIMA 5CPTA 3LBCA 3UXDA 3S83A 4MG4A 3TA9A 3ARVA 4BF5A 3NR0A 1ZP4A 4PEEA 4J7RA 1PWMA 4HU4A 5J5RA 2Z1WA 3U48A 1OX5A 4WKAA 3ZIZA 2VOMA 3SDOA 5IFTA 3FAWA 1NP0A 1RQEA 1S5WA 4D1JA 5IBXC 4NJKA 1AD4A 3AIBA 5F4SA 1B4EA 3BCFA 1UG6A 4FALA 4L80A 3SY8A 3W07A 1ZUAX 4LVAA 1WDQA 1QJWA 3M0ZA 3PBYA 4FNTA 1DJQA 2Y4SA 4OFCA 4GZIA 3SY1A 1OEPA 2VEMA 5TF0A 5G2HA 3BC9A 4W7UA 5I77A 3S9ZA 1WZMA 1ZU8A 2CLLA 3L5MA 3STCA 1A5LC 1H1YA 1ICQA 3SEPA 2H3BA 1UR3M 4HZ6A 4PMVA 5H6HA 1G94A 3LCHA 3WY1A 1RD6A 1XD1A 3MSYA 4LX4A 3FFSA 5BOOA 1XYZA 7CGTA 3W73A 4C6DA 4GUHA 3VGBA 3HFYA 3AHYA 1P6WA 4N0RA 1UD3A 1P7TB 3LPGA 3QKZA 2JALA 4IPIA 4MJ4A 3H54A 3GZAA 4HSNA 4H1ZA 1VYSX 3ABQA 4AWUA 5H8UA 3C0QA 1KFJA 3B0UX 3FSUA 3WUEA 3GDKA 2VX5A 3FKRA 2E3ZA 3GIQA 2NQ5A 4I3GA 1E4NA 3MSGA 1SR0A 1ME7A 5A8QA 3OEXA 3S0CA 3NQMA 4HNOA 3CB8A 1US0A 4LS1A 5D05A 3E9AA 2QZRA 1BLIA 1OC6A 1T99A 1NFPA 1JCLA 3GXDA 1UWSA 3T42A 3I7QA 3PNUA 2GVLA 2RUSA 4JX6A 2A3BA 3WF0A 4GQBA 3V36A 3THDA 2TODA 5HDRA 2FDSA 3CL8A 3WUGA 4D1IA 2G5WA 4HTYA 1V6UA 4RL3A 1SO4A 3KXQA 1UROA 4CVUA 1GVRA 1ZBCA 3GX9A 3WEOA 4LOCA 4FXSA 3WLKX 4QQ3A 4LT9A 3IACA 2DVXA 4Q4QA 3AAMA 4IQEA 2NLIA 2J8FA 1PIFA 1XIBA 3U2EA 2D22A 4QSHA 3T55A 3O6CA 5KTLA 4UTFA 3GK0A 3M7WA 3A5FA 3RRXA 2CEQA 4MSSA 3T7VA 1A80A 4UC5A 3UJSA 3KOYA 4DI8A 1Q6OA 2A3CA 2VC7A 3PF3A 1WAUA 2CCRA 4HU8A 1IWBA 1EYEA 4N4QA 4U5KA 4UZUA 3LI0A 3VKBA 2J7FA 4RNFA 3UYCA 2QJNA 4AZ6A 3QY8A 3VA8A 5AC5A 5DY3A 1UWIA 1AQMA 1GTEA 1VBUA 3GZ3A 1RY0A 2OO0A 3L4XA 2AOSA 3HG5A 3DI0A 3N4AA 4NYUA 3DN5A 1M01A 4ROPA 1HZYA 5E1QA 4FIQA 4KIRA 1TA3B 1FOBA 1QWGA 2GOUA 4C6EA 4QM1A 1L6YA 3PWGA 1J0JA 4N6EA 1NDWA 3E2QA 4OBSA 4W7WA 4TV5A 1H60A 1KBIA 4GMEA 1Q63A 1R8LA 5DRCA 4WF7A 1QW9A 2B7NA 1J79A 1TWZA 1OADA 2H9AB 4FA3A 4LFYA 1HJXA 5LIUX 2Z2UA 4AZ5A 1H4PA 3BSGA 3F03K 3M41A 3II1A 4CD7A 3P3BA 3SCWA 3LXBA 3W7LA 4JN6A 4C60A 1WBHA 2VX6A 3SAZA 3VZXA 3NPWA 1JCYA 1QOPA 3LCXA 3UG4A 5J04A 3W7GA 1XLJA 3UR5A 4DBWA 2VR4A 3O0FA 3SQSA 1XIDA 1E1CB 3LS9A 1YBQA 3MANA 3F2DA 2GUUA 2A1YA 5I09A 4J3UA 1UWQA 2O7QA 3CUXA 1RJPA 3RX2A 3KWXA 1KKOA 1W3JA 2HE5A 4KFNA 3TEVA 1XKYA 2GK1B 5D38A 3DECA 4EXAA 3B8DA 4DEFA 3CUIA 1XYAA 4I7UA 4H9UA 3BZJA 4C7DA 6A3HA 4S39A 1FH7A 2ZA1A 1L2UA 2EPMX 3DFTA 1XC4A 2BGSA 4GZ7A 2XH7A 1UB3A 5DXXA 4S38A 3UJRA 2Y24A 3MMDA 1SUXA 3EOUA 5EFDA 4HOXA 4XBJA 4IMCA 5F7UA 1E9YB 1DWJM 2QCEA 1BWVA 3LZ5A 3UWVA 3N17A 4DVOA 5CZJA 5IFPA 4LUTA 2VDIA 2QPSA 2XM1A 2OZ8A 3NAVA 3ABOA 5T9BG 4K8GA 1PYMA 4AIOA 1AJ2A 1SW0A 1TPVA 2GZXA 1CXLA 3CJPA 2BOFX 3HGRA 4XIMA 5F1UA 1RPXA 3VD7A 4O4WA 2ISDA 2FZ9A 2G8ZA 1GW1A 1WKDA 4QS5A 4Q4RA 1JCJA 1TMHA 2W6RA 1I0DA 4WSHA 3TSDA 4E6MA 3TW9A 1ENUA 1B1YA 1KCLA 4H2HA 5CPSA 1U5HA 2VR5A 4DM1A 3ERPA 9CGTA 1HJQA 3W0KA 4TMCA 3P93A 3UZYA 1MXGA 5DEZA 2F7FA 3G0XA 4P2VA 5JQ9A 4KEUA 4XSLA 4BS0A 2ZRYA 3OODA 3W1NA 1XQKA 1E43A 1P6BA 2PB1A 1DQUA 1OGGA 3WF2A 1ZAHA 5IXEA 2NXIA 1GTHA 2DJLA 5EB8A 4Z0SA 4XSMA 4PSRA 3W9ZA 1UJPA 1HL8A 2ZZ2A 3F2CA 3DBNA 3T08A 3ZR6A 2Q8LA 1DWHM 1OX4A 3LQGA 4C6MA 4BWLC 1WZLA 3PBMA 3EDKA 1GVQA 1DV7A 4EPDC 3FJNA 3NSNA 2E68A 3WNKA 4F0HA 2QS8A 2PBGA 3DH7A 4YS1A 2ZXDA 1A5UA 2DJXA 4NIRA 3S6OA 4YYCA 5HQLA 3K13A 2Y88A 4AQLA 4GNVA 1JI2A 2XVNA 3W1LA 4JTJA 2RDWA 4AEOA 1PUDA 1JAKA 2GJLA 1R3YA 4HT3A 1C8VA 4PBGA 4G8TA 3HA1A 2PZNA 4GH3A 4YTQA 2OB3A 3SGZA 3HB9A 1XW8A 3IVUA 3WDPP 1EDGA 3GB6A 1H61A 3W7MA 1AK5A 4NP7A 2G96A 3A4JA 4AD4A 3PZIA 4JFSA 1GG0A 4H6KA 2PDJA 1B3YA 3CLWA 3NZGA 4IFKA 1G7UA 1JNEA 3BUVA 4Q22A 1FWGC 3VGFA 4O52A 3FA5A 3EXTA 1KRBC 3MBFA 3S8HA 3REQA 3SCQA 3USBA 4LBUA 5AVNA 1OM0A 3CWHA 4QXIA 2VFEA 2QCHA 4JL1A 4OQVA 1H5YA 1X1OA 3BE7A 4QCEA 3VNLA 4H9VA 3PY2A 3TXZA 3OVPA 1DYSA 4X22A 4ZZ9A 3GVWA 2XH0A 1O94A 4S3CA 4WVXA 1SZGA 1Q45A 1UWUA 4RLIA 1E9LA 2ZWYA 3T2PA 4K1GA 3CHFA 2ZUWA 1JPMA 1XCWA 3ECQA 3JR2A 3EPOA 3HJEA 2WJFA 1DHKA 2PFHA 5I3JA 3SCRA 3IAQA 4PYSA 4NT0A 2MUCA 3ZZ1A 3RN6A 3HGOA 3WLSA 1E0TA 3M5YA 2D2HA 3MDWA 2Q3RA 3W72A 2VVNA 4FLRA 2A79A 5HJLA 2F38A 2QCCA 3H22A 3BMWA 4IUGA 2QDEA 1JYWA 1LP6A 3UR7A 2F84A 5LXEA 4C7FA 2PU1A 1V6WA 2REQB 3FA3A 1ME8A 2D2GA 1T8QA 3VD5A 3GDMA 6XIAA 4L56A 3W00A 4J3SA 2EGZA 3KL5A 4D72A 1XLHA 1O95A 2UZ9A 2NW0A 1K9TA 2ALRA 3S2NA 2YYUA 1QCWA 1UA7A 4QX4A 4MWAC 4U2YA 3CH0A 2INEA 1JRBA 3RPMA 4KMQA 1Q8JA 1NWUA 1EJRC 1TR9A 4RZ6A 2WLZA 3VILA 4Q7NA 2QR6A 3C86A 4UTHA 3TLQA 3KHJA 4J3ZA 4J3XA 1PB0A 4MF4A 1M9HA 4I9AA 3N9SA 1QDSA 4P5UA 5CJ5A 4WSJA 1P4CA 1LL4A 4WX2A 1XLAA 2OSXA 4AVNA 3UESA 2JGQA 1W9VA 4HA4A 4JYFA 3QFEA 2D0HA 3EDEA 3DHUA 3SUVA 1T7LA 1ELSA 4FX7A 3KVLA 2QEZA 3MJMA 3T07A 4Z2IA 1QI0A 4X63A 3URAA 3CV2A 3SGUA 1X6UA 3K46A 3DZ1A 1SU5A 3SFKA 1XYFA 3B3DA 1QNQA 1AODA 4IJRA 1I6NA 3W71A 1MYRA 4J2MA 1E71M 1CCWB 2BVDA 4M6PA 1BVZA 2G4JA 2DVTA 3L21A 1I8JA 1OC5A 3E12A 5AHNA 3DC8A 4AEEA 1WPCA 2E6YA 5CLTA 5CPOA 7REQA 2PWEA 4LU0A 1R38A 2ZTJA 3FEMA 3OBKA 5G2WA 2R8WA 4XVDA 2ISVA 2V5KA 2C19A 3GLCA 2V9DA 4E4FA 2XJ7A 2WBGA 4BF7A 1ZHAA 1EWDA 3TN6A 4M56A 2QUNA 4HOWA 3OQ8A 4EOUA 3NOYA 2VT0A 4DJDA 2X1SA 1H50A 1E56A 2PDUA 4WGXA 1ONWA 3L4ZA 4U31A 2VEGA 2IPFA 3WDIA 4LRSA 1H11A 3MKCA 1DHPA 3HGSA 1KD0A 3R43A 2W4XA 2XVPA 4J1OA 3EBVA 3WJZA 2NSXA 3CAKA 3IRSA 1E4IA 2GGEA 1VBRA 3CEPA 3WN6A 2R91A 1Q85A 3EWWA 1ECEA 2BGQA 4O54A 3G1YA 5CGQA 3HPAA 4XAYA 2WVSA 4IMGA 3DYMA 3WZ0E 2YCIX 4FNQA 5H2ZA 2QF8A 2Z1BA 3VFCA 3OTRA 1PDYA 2WNWA 1E4LA 5AC7A 3DFQA 3R2GA 4Q7BA 4CD5A 2C14A 2ZZ7A 5AHFA 2QQ6A 3GHUA 3LCWA 1TJ0A 2BASA 2WCSA 4Q8TA 4JTRA 9XIMA 2XU2A 2NQ9A 1SFTA 1JFHA 2OZ0A 3GXFA 3D6NA 4BY3A 3CZJA 3CM4A 1GG1A 5A8PA 3LV5A 1NFGA 3ARSA 1E0UA 4R7JA 2V3FA 2QCGA 2WSPA 3G6LA 1LL6A 1GNXA 4NX0A 5FI8A 3TWBA 3VMOA 3N2CA 4LUYA 3N3MA 1B90A 3GE7A 5REQA 4JYDA 5DRIA 3TSBA 3CAWA 3S6TA 3WQPA 1FWNA 1IZJA 3HPXA 3T4CA 1FKWA 3EPNA 5A5WA 2I17A 2BY1A 4GIAA 1ZRQA 1F5ZA 1LRNA 2PF8A 3IIVA 1KTCA 4GY1A 2J8TA 4QEHA 4QE4A 4PBEA 3NDYA 3UERA 4F0KA 4MAVA 1FH9A 4UCGA 3W7RA 3I6RA 4FLQA 4C1KA 2VHLA 3T0CA 1B9BA 3WIJA 2GWNA 2WC7A 4MZYA 2XN1A 1J6OA 3BW3A 3GG7A 1N2VA 3WKZA 1Y5XA 1RLDA 3B40A 4Q4OA 1ADSA 2J9XA 5A2BA 4D8AA 5EMYA 1I4NA 1XF0A 2BTMA 4R53A 1ZPTA 2YJQA 1JEZA 3MKVA 4Z42C 2TYSA 2VNCA 4O1CA 1EFZA 1QPNA 4YNGA 3NIYA 1R9YA 1H5VA 4EPKA 2QXWA 2IPJA 1ODUA 4MHBA 1CGWA 1M68A 2NQHA 3G77A 2NSOA 3CL7A 1W1YA 5I06A 2V81A 2IW0A 5F4XA 3DBPA 1B9ZA 2ATMA 3BMVA 5I00A 4R33A 3CWOX 3LN3A 2XZ7A 1DORA 4NILA 2GQ9A 4UMBA 1KXVA 2R6OA 4AU0A 3W4RA 4OGZA 4QG8A 2Q8ZA 3DG7A 3TQKA 1JPDX 2J75A 4FNSA 1L9WA 3BPWA 2WHKA 1V4YA 1YKWA 3VIIA 1TE6A 3VKDA 1NWRA 2ZXAA 4Q8NA 3P5YA 4NAFA 1D2KA 3NSXA 1L8NA 3VX1A 3WL0A 4B5XA 3WLMA 2WNZA 1QPRA 3LMYA 4DYEA 5D8ZA 3WD2A 4TX6A 2YFNA 1GORA 4DUOA 1QW8A 1S1RA 4BI7A 2XGIA 3KCLA 3ITCA 5C0QA 1W1TA 3VDBA 3M0VA 2ZX9A 3NOEA 1XLMA 3NZQA 4NI8A 2WWCA 2CU0A 3B9DA 1OFOA 3UQNA 5CC5A 1SJBA 5JBDA 2YA1A 3CPRA 4A3HA 4GUJA 2C1HA 3REQB 5HWMA 4N4PA 1UP2A 3VMNA 4JX5A 1GOQA 2VD9A 1QNPA 3GIYA 3HPFA 1KA9F 1JZ4A 5KINA 4RZ5A 2XWEA 3OZYA 4B5NA 4TTUA 3EWXA 4CU7A 1GQLA 1ICPA 3VDGA 2ZZ4A 3L9CA 4LVDA 2XIQA 3S2CA 3SN4A 3GFXA 1IEXA 4F0MA 1XH1A 1ISXA 4EVZA 5C7VA 1A47A 1TWSA 1OGSA 1ZQ5A 4MUZA 4G9PA 1J6PA 1Q2RA 1PKNA 4AC1X 3PVFA 4AWSA 3IK4A 4LXFA 5A6KA 5DQPA 2OLSA 4IJBA 1K9FA 4DAIA 4Z0JA 2FGZA 1QXLA 4XIAA 3SCPA 3IJQA 5D33A 5A95A 1GQKA 4MWAD 4S1FA 1G6CA 3G1SA 4QQUA 1CYGA 3WLTA 3KBNA 2CERA 3B03A 5D2YA 3FGCA 2D1ZA 4PODA 6ENLA 1M65A 1KB3A 4RDYA 1F3WA 5I3KA 4H6RA 1UD8A 2A3EA 4ZB2A 5AYBA 5HULA 4NY2A 1REQA 3IVTA 3HTWA 4JIQA 5I3DA 2R1LA 3H70A 2Y5EA 1FCQA 1VH7A 4HHPA 3TC3A 5C2XA 4YTTA 3SCTA 3R79A 2ZWZA 3DKJA 1WKYA 1UKPA 2VVSA 1AMYA 1T5AA 2IXUA 1FWCC 4LS2A 2V5DA 2Z6JA 3UWUA 2QUVA 3RLVA 4AX7A 4MGGA 2YLLA 3H4WA 2QVHA 1Q4NX 1GWJA 4K6AA 4S3FA 2CLFA 4GZJA 1W1IE 1OX6A 3MPGA 4DI9A 1DJWA 1XLLA 3APTA 1W31A 4UWMA 3PZ9A 2PDFA 3PANA 2QPUA 4CU6A 1AQ0A 3IJLA 5DF0A 3U4FA 4PUDA 3C2EA 1C90A 1OG0A 2R1MA 1WZKA 2DY3A 4FXJA 3W2UA 3SB0A 3L5AA 3CUZA 3G1FA 3WG6A 3RU6A 1EKOA 3IGHX 1HJVA 3SO7A 1JNDA 1KCKA 2ZICA 3OGVA 2DIEA 1A0EA 4AAJA 4GG9A 1FWSA 2FTYA 4DPPA 3N6QA 1W1B1 7REQB 3H24A 5E6YA 4W7VA 3TZNA 4INFA 3GH5A 3OYXA 2Z26A 2X0HA 4FOUA 4AISA 1E4MM 1W17A 1N8WA 4AY7A 3KRUA 3UJEA 4PMQA 4Q4MA 1W9DM 1R9ZA 4HMEA 3I3DA 3QC0A 4S3AA 4YVXA 1V3JA 4CEXC 3PHAA 1XV8A 3AXKA 1G4PA 2V5LA 3FSTA 2E5BA 2EBNA 4PMNA 2DP3A 1TPC1 1KCXA 1FHLA 3VZYA 2J74A 1HO1A 4G7EB 3C0JA 4NAEA 4R7OA 1M41A 1F6YA 4G2DA 1VP5A 4CN4A 4D6HA 3G2GA 3W2MA 4TO8A 1S2UA 1IT0A 2J24A 4ZQNA 4S3GA 3RM4A 1BG9A 4H83A 3GNDA 4GYKA 1HUVA 1A5CA 5D8WA 4LANA 5CBJA 1FBAA 1UC5A 2G3IA 5EBUA 3WQ6A 4BI5A 2VX4A 4FX8A 2BHZA 1G0CA 1U5VA 1L8PA 1JDCA 1MEIA 4JN8A 2XDFA 4RE2A 5C5YA 1W8SA 3A24A 1TX2A 2JGYA 2AAMA 5XIAA 4AG0A 2WVTA 1K8CA 4DNHA 2P0OA 3KHDA 4J28A 5DFAA 3D47A 4QIUA 3HQOA 1C91A 2YOCA 4FK9A 4TUFA 5C9XA 1J0YA 1TPWA 4W8LA 2V5BA 3CUGA 3ZSSA 5JH2A 3T44A 4NHVA 3GU9A 3N2MA 1OBAA 2V3EA 4LF2A 3W1UA 3HZ3A 1ONRA 3URBA 3EDJA 2E09A 3LHVA 1XIIA 3UVIA 3NG3A 4JDYA 1HQTA 1IZKA 1XP3A 3ONCA 5BROA 4M8UA 2P88A 4JTLA 3W22A 4L4MA 1ISWA 1GJPA 2QJGA 4JQ2A 2J77A 5CCZA 1E0XA 4KT2A 3WFLA 3LX9A 3ES8A 2AL2B 4LCRA 5H8MA 2OQLA 4EE9A 5BU9A 1DBTA 4AY8A 3TP4A 3P74A 2DGAA 1MW2A 2C13A 3V5OA 5I23A 4NSBA 4FNUA 4HMDA 3PUOA 1LDCA 2FTPA 1HL2A 4RPPA 4UQBA 1ONXA 3EOLA 4Q8WA 4ZOAA 4RV8A 1PBGA 4GJJA 4I9TA 2OXNA 1K3UA 3R0UA 4PMRA 2X41A 2V67A 2F6XA 1YDYA 4A8RA 4L4PA 4ERAA 5FF2A 1LL7A 4JKLA 2P0IA 4ZQOA 3HG3A 2NQZA 1G69A 2G97A 5HK4A 2ZZ3A 3BK0A 1J18A 3WQGA 2IXVA 3M7SA 3NL2A 1MDRA 3B8IA 5LHFA 3W7CA 2NWSA 1SW3A 3OVGA 3QLLA 2VM8A 4DZ5A 4YHGA 1TSIA 3T0TA 4XUYA 3TTYA 4AZCB 3CH9A 1JPKA 3BGAA 2D3LA 5FJTA 3SRKA 4CQ9A 3TN3A 2OFJA 1KGUA 4CN1A 1VGAA 4PUWA 3L4VA 5ABFA 3W24A 3SIMA 4I5RA 3KTSA 1VS1A 3KOXA 1IE7C 3TDFA 3MVTA 4DWSB 1HKKA 2DVUA 4AIUA 1UQYA 4IH3A 1QVBA 1N7KA 4WEVX 3P14A 1SM9A 4GO9A 2Z25A 3ZQ9A 3HN3A 3H4XA 1B3XA 1C93A 5C9WA 5FF3A 1E70M 3R7MA 4LV4A 3W1AA 2CETA 2FQIA 5EY5A 3GKAA 4PUJA 4UFMA 5LIWX 5M3WA 4JFUA 3EOEA 4TR9A 2E7FA 1OD0A 3LHYA 4NAFB 5LA1A 2FFIA 4ZSTA 5KSWA 3WQFA 4ZE4A 3IAPA 3T2QA 4ZA0A 2VDGA 2WSQA 4DWDA 3G18A 5E0KA 2DSWA 1PVNA 4DBSA 4KS0A 2OWXA 1GVYA 2Z6IA 1M04A 4I5XA 1DVJA 1D7FA 1PX8A 2QT3A 4ZOBA 1P5BA 3LGDA 3BGGA 4AWEA 2EF9A 3WNMA 3JUGA 3ZYZA 3IVSA 1K8YA 2HVNA 4D6DA 4DO7A 2J25A 1ONEA 1VENA 2FDMA 4FF7A 4W8BA 3TJLA 4C5YA 2QULA 3UVAA 1N8IA 4WUIA 4MY8A 1V8EA 3TSMA 1DQWA 4DYJA 3RMEA 3EDFA 4C6OA 2BNJA 3RCNA 3VE9A 1A53A 2AGTA 4KWVA 1A5KC 1W0MA 1A3WA 1RCXB 2WPGA 3W1RA 2Z29A 1E5JA 2J7HA 4OUIA 5CZTA 5BCAA 1HGYA 1KRAC 4NZFA 3BZGA 3ZVHA 3PULA 3I10A 3T0AA 3V5FA 1EXPA 4POCA 1V0MA 5FKYA 2HE8A 1E40A 4XTIA 1EA0A 2P76A 2PDIA 3Q65A 4IP4A 4GBDA 1W37A 2NWRA 4LYPA 1JD7A 4UNLA 1T6MA 3PPHA 4RE0A 5A6AA 2VXNA 1EXBA 5AOUA 4BCEA 3MV01 4ADUA 1I1WA 4GA8A 4PEKA 1Q6EA 1HKJA 3QYSA 1PTDA 5CZ0A 3KCOA 2G3FA 3WEMA 4AD1A 5FAJA 1TKKA 1TJ1A 3OHIA 1U1UA 1REQB 4F0SA 1ISVA 2IQ0A 3R11A 2XN0A 1RALA 3AMCA 4TIMA 3O0KA 1P1XA 2J47A 2WWDA 4B3LA 4UZSA 4EK7A 2FGLA 4EF9A 1EPXA 3MSDA 1OWQA 1LQ2A 4MUPA 2DH2A 5F2MA 3DG3A 4JFTA 2H90A 1EJUC 3UEQA 3N4FA 1GVOA 3GNPA 1YTDA 4X0NA 4FXRA 4Z2HA 3VOFA 1CBGA 2QVNA 4H41A 1PZ3A 2O7SA 3QV9A 4PTNA 3SJNA 3OOQA 1P6CA 3IWPA 1H09A 2J13A 2VO5A 2WMKA 4UFIA 4S23A 2VZOA 3N2BA 1Z7AA 1MW0A 3HQ1A 2YDQA 1V02E 4UQAA 2XIJA 3W6LA 1EP2A 1G4TA 3MW7A 2D20A 2OVLA 3HBLA 2OWCA 2OKOA 4LW7A 4WHBA 3OBEA 3H8AA 1G5AA 3C61A 2NZLA 1AJ0A 4RXFA 3BLIA 4JCLA 3RLHA 5G4HC 3RCMA 5BMWA 3GVGA 1UD5A 3U6WA 3V0UA 3WLNA 3MUCA 1WXZA 4QFUA 1GOWA 3KBJA 4M81A 4DXKA 3VIKA 3LCLA 3ELFA 2RHGA 2CYGA 2VZUA 2CHNA 2DUXA 3S5NA 1E6SM 4WR3A 2QIIA 3LBOA 1F3XA 4D2JA 4P8VA 2EXOA 3Q45A 4ZO8A 3GHSA 4OTKA 4KESA 1JAEA 1Q6RA 5BXPA 1S2VA 3UR8A 4RE3A 4CCCA 2AL1A 1IV8A 4L6HA 3H26A 4V33A 4DELA 3QZEA 3CXOA 4MAZA 4Q3MA 4NZ5A 2FVMA 4JQ3A 5E0FA 4PN2A 1GVFA 1IEIA 2VUYA 4NAEB 4AZIA 1RCOB 2QGYA 3MHUA 3SRHA 1DEDA 3PZTA 1BYBA 1UR1A 1XKJA 2OQYA 1F6PA 1A5NC 1T8XA 3D3FA 2WJZA 3WX7A 3U5UA 2V3DA 1KWKA 2HS6A 5AC4A 4EWND 1Q6GA 4DO4A 4CNPA 3VK5A 1R3QA 4CQAA 4DQWA 5MKGA 3DG6A 3PB2A 3U7BA 3AJ7A 1BQCA 3M44A 3WK1A 2A7NA 2CLOA 4DX3A 4GI4A 5XIMA 5HA7A 1A49A 1R2SA 3AXHA 3AYSA 3APYA 4MLJA 3OLIA 4WKHA 1ZCCA 2Z0IA 1XIJA 3OLDA 1GOOA 3GG8A 4NJGA 1BWLA 3GDRA 3TX9A 3O8AA 1PZ0A 3VGHA 2X2YA 3MO4A 1PS9A 3PP7A 4MKSA 1US3A 4ZSUA 1RCQA 1VR6A 4LAZA 3U9IA 4XISA 1KC7A 3OA5A 1QPOA 2D2OA 3MUY1 1SFJA 2X1TA 4AZGA 5HNTA 5L9FA 1IR1A 1JYXA 3LENA 4EANA 3QMSA 2G95A 1KV5A 3DXIA 2Y61A 2NV2A 4JIHA 2TSYA 1QNOA 4DZAA 3H6OA 2QJIA 4PE8A 3CZGA 5G1TA 4PH6A 2E4TA 3RR1A 2YCLA 4ZE5A 3PG9A 4M6UA 3S5OA 3P62A 3ONBA 2F61A 4XX6A 3CHVA 4J40A 3KTXA 2OX1A 4Y90A 4GY7A 8A3HA 2Y0FA 4ZO7A 1YHTA 2CBVA 1E6XM 3PNZA 1NF7A 4WQ6A 4DJFC 1IT7A 3TCEA 4H9ZA 1IEVA 4YWIA 4HGXA 4BF9A 1W32A 1A50A 1D8CA 3T4WA 2HQAA 3KEHA 2FH6A 3KVMA 3NL6A 3OIHA 1UHVA 3P80A 4NG3A 4PB5A 3CMJA 2QUUA 3MKKA 2QCDB 4ICNA 3RPDA 3V1HA 4GI9A 2PLJA 3AHVA 2CHRA 3CMFA 4I5UA 2RGMA 2DZPA 4JTCA 3L65A 3BJFA 4MYXA 3NXLA 2I5QA 3FKKA 3CU2A 2CBIA 4KRZA 1CNVA 2EHHA 4AVFA 2YYTA 4B5TA 3CZKA 5A6LA 2WZHA 4UNKA 3STEA 3GFZA 4LUSB 1S38A 5DELA 3OIXA 1EC8A 4G1KA 1VEPA 4PL2A 1TV5A 2POTA 1JDAA 3VU2A 2GVJA 4JTHA 1EHNA 3PWAA 1NQKA 3E2SA 4KGLA 5HWJA 3EKLA 4O8AA 1KLZA 3QQ1A 1M03A 1SMDA 1KM5A 4CCEA 4AX6A 4FMVA 2C18A 1EEPA 4GH1A 2J6XA 3GC4A 1A5SA 2OSWA 1WDDA 2G3MA 2VELA 1ML1A 1KM4A 3BANA 4PTVA 1NH6A 4Y9NA 1XWYA 3TQPA 1NQ6A 1LUCB 3S2LA 2VWSA 3WMSA 4DO6A 3ZJKA 5HR6A 3NZPA 1SFSA 3O9NA 1GEQA 4O14A 4JIIX 3AHZA 4R5EA 1EWEA 4JICA 2QIWA 1EQPA 1IEQA 3H53A 1OFRA 2AMXA 2VGFA 2GQ3A 3FA4A 1S2WA 4OV9A 5HMSA 4UR7A 2YR1A 1DWAM 5GVJA 1UOKA 4ZOEA 4O1BA 3O6DA 2G0WA 3A4WA 4PGLA 3BGJA 5IHRA 2ZZ1A 4NVTA 4QNWA 5BMXA 1HX0A 5J5DA 1K7XA 1RBOB 2NV9A 2ZZ6A 4RCXA 2NUXA 1AW2A 1UZDA 1UR9A 4GI6A 2VFHA 4XTDA 5E9AA 3EAUA 1MQRA 5KZEA 5F1VA 4IGNA 3WO8A 4ERGA 1BKSA 3AYTA 1R0MA 5I07A 5C7HA 4B5WA 1YXYA 4GGBA 1XRSA 1DJXA 1IXQA 1BGGA 4UMCA 2E8ZA 5KZMA 3XINA 4L65A 3PC0A 9RUBA 3ABRA 5JIPA 1E3ZA 1W1A1 3UPWA 2YLAA 4XAGA 2DIKA 1VJZA 3J7HA 1QHZA 5T9CE 3BJSA 2OZTA 3UCQA 1JI1A 1TPFA 5CBBA 1MUCA 3TTOA 3MSRA 1OK6A 3O15A 1K8XA 4LY4A 2FPVA 2WSKA 2W27A 3G1XA 4GGHA 5A6TC 1J5TA 3IJDA 3EB2A 3PJTA 4EX4A 3M6DA 4W85A 4AXNA 4REQB 3WBXA 5AZ1A 1H63A 4NXSA 3PZQA 3T40A 1GPFA 3VKJA 1W91A 3IIXA 1HT6A 4E5TA 4CD8A 4NNCA 3FYPA 4KWSA 4DB7A 3A4AA 1I9CB 5DT7A 4GX9A 3UW6A 3DFPA 1UR4A 3QKEA 4JTDA 2OQHA 4A29A 1NDZA 1YX1A 4E2VA 4OUEA 2ZX8A 2NX9A 4MPKA 4NZJA 4O4VA 2HBXA 2D0FA 1CEOA 1EJVC 3WQEA 2PUZA 2BSLA 2GPTA 1WDRA 4U10A 1UQZA 5JMUA 1V6YA 2HCVA 1XIHA 1XPYA 2WMGA 4HSOA 1CLXA 4TXEA 2C3ZA 1QPQA 3ZJ7A 3OZOA 4H9MA 2PC4A 4GHRA 2ZTKA 3KOZA 2YBTA 4IUOA 5CG0A 4GC3A 2PD9A 3QHNA 1SYTA 3CZLA 3O6YX 1WZAA 3SW6A 1FWHC 3UCCA 1VFLA 3QOKA 3BV4A 2CLIA 4L9ZA 3VZZA 3W81A 1VKFA 4GCAA 1R2RA 3MI2A 4TVCA 1VHCA 3TXVA 4XUGA 2XHYA 1TG7A 3WQDA 2X1RA 4L1XA 2QJMA 3MB9A 4Q8OA 4KWUA 2ISWA 1UWRA 1KQZA 5FA5A 1OF8A 4MJ2A 4JIPA 1W5NA 3UD6A 2FZNA 5A69A 5D9PA 3ZS4A 3W28A 2I9EA 1EJWC 2GUYA 1SW7A 3RLGA 5HQEA 4H9YA 4GFSA 4GD0A 4WSKA 2GJNA 1EO7A 1QUMA 1AMKA 3NQ6A 4JXCA 1LORA 1XBYA 1IIHA 4GX8A 1QW7A 3LTPA 4S3BA 2XINA 3MBDA 5LNWA 2DZWA 4R3UA 2MNRA 3TA6A 4J3TA 4F9DA 3NQBA 2NUWA 3NM1A 3KLKA 1EJXC 4DJED 1LROA 4Y96A 1AH3A 3KDNA 1NEYA 1AH0A 1R9XA 1OJXA 2PP0A 4E4PA 1E1FA 3AXIA 4HNTA 4LWWA 5D09A 3O2LA 3MZNA 4IL2A 3N9KA 4EAYA 3OGRA 4FX6M 3AXXA 3LTYA 4MY1A 3RR4A 2OX4A 3CHEA 3GDLA 5F2IA 3U8GA 3N29A 5CZSA 3GAYA 1DOSA 3TROA 1DE6A 1VEOA 3IUIA 1I2OA 1SGJA 5AY7A 3O07A 3S9YA 3RF9A 5FIPA 4HYWA 1YXCA 4GNJA 1TO3A 8RUCA 3RX3A 3DHDA 1EC9A 1LTDA 3SCVA 4AUBA 4MZ8A 4J3WA 1B3OA 3VM5A 4DBDA 5MF5A 2JKAA 3KL3A 3LDVA 1A0CA 2DT0A 1FP9A 4KH2A 4GINA 4AZHA 3AYVA 2PDXA 4B90A 3N11A 4BI6A 5C8BB 3CZ8A 3GG1A 3UNTA 1TTPA 1ZAJA 2ADAA 1NTHA 1KV8A 4CQCA 2WC4A 2ZKMX 3P84A 4CD6A 1IEWA 5LNVA 4IXXA 3OA3A 2E6FA 2CXEA 4ATWA 4IT1A 2ASHA 4E8GA 3CC1A 2ISSA 1SSDA 1FWWA 4TU1A 2WKGA 4WOQA 4DJFA 1QNRA 5I02A 5A6MA 5K3VA 2CKRA 3NQVA 4DF0A 3EGJA 3NGJA 3F5LA 1Z89A 1GVIA 1KBKA 1EP1A 4H8NA 4CNTA 1TRIA 3Q4DA 3UWWA 1P7TA 2YL5A 2Y1HA 4HYRA 2AKMA 2XZ9A 3EOSA 2CZDA 1AFSA 1U33A 1EGMA 2Y7DA 5DMNA 4E0CA 2YCEA 3EXRA 1YYAA 3FOKA 2XSXA 1HJWA 3OW1A 3WD3A 4BQ4A 1E5NA 4GYPA 2HPMA 3N1AA 3EWZA 1J0IA 1FUYA 4XWUA 3WK0A 4MJMA 1PHQA 4ML9A 1EEXA 2CLEA 3GH4A 3OLEA 1U83A 5E0CA 5JBEA 2BY2A 5CQ1A 1VRDA 4ASTA 2JBMA 2PSNA 2E5CA 3MMUA 2RH9A 3AIVA 1SZRA 4U28A 1J11A 4EPBC 1GYLA 4GIRA 4HYVA 2XSBA 1PL9A 1SZFA 3PUDA 4W84A 2D2JA 4H9TA 3BAXA 1XL9A 1KFKA 2VTFA 3WDRA 2PCQA 1DPMA 4GO8A 4B5SA 3OZPA 3SCSA 5TNVA 5DLCA 2QKFA 3V1PA 1TZ7A 2XFFA 4KGJA 1WXJA 5C9UA 4DZHA 2QAPA 2GDUA 3C3NA 4ATLA 1WXYA 1M7XA 2OMAA 5K4XA 3PK7A 1NFBA 4Y9OA 3GBEA 2UY3A 2QLYA 2ZZ5A 1K7FA 4GKLA 2YBVA 5F4WA 3L23A 3URNA 5A8NA 1V5XA 3V16A 2EG6A 3GVVA 2AQVA 2O9TA 1TFVA 4R7WA 4XBSA 3NPVA 1H0IA 3SR7A 4C6QA 1CIUA 4RNIA 1F74A 3WL1A 3NEHA 5AFDA 1L2QA 1RD5A 3R8GA 1JCTA 4PUMA 3KZPA 2P8CA 2HISA 3TYAA 1YMYA 3VTRA 1TA3A 4I90A 2R9RA 3WNPA 3M0LA 3RJYA 2VRJA 2ZUNA 6TIMA 2XH2A 3KLLA 1TREA 2IMRA 1IHIA 1EZ2A 3BAYA 3A6OA 5D04C 1DJGA 3A3HA 3KTCA 4A3UA 4N6FA 1KXTA 2CZVA 4JY8A 5DMLA 1O1ZA 1UZ1A 3PPGA 2FTWA 2I1OA 3SADA 2H9AA 1H1NA 2J6VA 3EX1A 3JS3A 3UXAA 2WZEA 1LZOA 1UZHA 5U4NA 4EACA 1ADDA 3IS4A 4PFHA 3HM7A 1VIWA 2GOKA 2VZSA 1L6GA 1FXPA 3GY1A 1LRTA 2QAFA 2WQDA 1MEWA 4DBUA 2VR2A 4GVIA 2PDGA 4AXKA 1E1CA 1FWBC 1H1ZA 2WAGA 2HV5A 2NVAA 4MKNA 3NL3A 4J35A 2GK1A 1ME9A 1IXPA 5FL0A 4HVXA 5HATA 2PRHA 2Q8XA 2IKIA 3U7VA 3U5YA 4LCSA 3UJFA 2C16A 4UXDA 4AB4A 5HMFA 3NVTA 1YIXA 1TPDA 4JD4A 1HKIA 3E96A 1XLCA 4GCXA 1VFTA 4LYRA 3MZ2A 4PR4A 4M7SA 1EH9A 5C70A 3LCIA 3LERA 1S5TA 4MM1A 4XZBA 5F2GA 1H51A 2DDXA 4OBTA 3PFMA 1EBHA 5EL1A 3JVAA 4MZ1A 3B06A 3TAOA 4ENLA 4ZODA 4PCNA 4QS6A 4WZHA 3TR2A 4MYAA 1I75A 2I57A 4WD0A 1H7NA 3TKFA 4GYJA 3LCGA 1YXDA 2ZFAA 1D7KA 3GHRA 1GYNA 3Q2DA 1SZEA 3WQ8A 4ACZA 2YDSA 5HUOA 4X9YA 1K6AA 1ITUA 2VX7A 1KM6A 4IM4A 1KBLA 1LOSA 4RZ4A 4LC8A 1V3MA 3WJSA 1LWHA 4KKXA 1S3TC 1LG1A 7PTDA 1Q7MA 1XLFA 4IG2B 3GDBA 2P3ZA 1RP8A 1XX1A 4MWAB 3AMKA 2BG5A 1DWGM 3H2MA 4MWAE 5KEZA 5FAGA 3GU1A 3G0UA 3B9AA 2BB0A 2J7CA 3QTGA 4YMZA 1BD0A 3HURA 5HOSA 3IIZA 3K30A 2ACRA 1MNSA 1FHVA 4U3AA 5GJPA 4FS9A 4QISA 1J0HA 1DTUA 3R0KA 2OJPA 2ISFA 4QG9A 2J78A 1Z48A 4QGCA 2C0HA 3QM3A 4CCZA 3V7PA 3RO8A 1BXNA 3NYDA 4YL2A 2QHAA 1UIPA 4AH7A 5JH1A 1SSGA 1Y65A 3RRAA 5FJRA 1CECA 3G22A 1IIGA 3UXLA 2CW6A 1QO5A 2QUTA 3M5VA 4C6LA 4D6FA 4MMWA 2FPTA 1H2JA 3ATZA 2DUAA 2D0GA 3C4UA 2DUZA 3UZ5A 3DX5A 1AW1A 4IP5A 1K4GA 4Y7EA 3EX2A 4B5UA 4DY1A 3RAOA 1XM3A 3W7QA 1JL8A 3NO1A 4H9XA 4MADA 3W84A 4GVGA 4E2DA 4IFOA 3UP8A 3BLFA 5AYZA 3B4YA 1E0WA 2CBUA 2D3NA 2FZMA 4IIGA 2DZUA 2OT0A 4YTUA 3HG2A 4IMAA 2Y85A 4IIHA 3AO0A 3QOMA 4XV0A 3WBYA 3TTSA 4LNCA 1K8ZA 3I7SA 2GLKA 4Q8MA 3HF3A 1GEHA 2Z2AA 5J8LA 4BQ2A 5FJJA 1C8QA 1EL3A 2YPIA 4PCPA 3W2KA 2NX1A 2ZQ0A 1BHGA 3M0HA 1PPIA 4N7QA 2Y63A 5CAKA 1DJYA 4PUKA 5HMEA 2VEKA 3R89A 3BWWA 3GUWA 3WYZA 3W53A 3P0XA 3MP3A 1JQXA 2QPXA 5AHLA 4RX0A 3N12A 1U30A 2OOGA 2ZXQA 2BP1A 2G41A 4F3HA 3S3GA 3W85A 2BY0A 1JYNA 3PTMA 2PA6A 1Q6LA 4A8LA 2A0NA 4K68A 3QPZA 5IDIA 4L5ZA 1HIZA 3GRIA 5EMJA 4P7RA 3ARXA 3WH7A 4D8LA 1F9CA 4XZ9A 3ZJ6A 4Z1DA 4K2SA 3EKGA 2REQA 4L9YA 2CPUA 3PAOA 3ZM8A 5G5IA 1GQJA 1V3IA 1V0LA 2VJXA 3A9BA 3NUKA 4WKFA 2BVWA 4K7YA 1NAL1 1OK4A 2YGYA 4Y8EA 1YDVA 3WBAA 4XAPA 1UD4A 4G56A 3I4EA 2INZA 1EP3A 3SUUA 1MXDA 5CPMA 4GVHA 1CXEA 3CEUA 4OJYA 3BJTA 1XH0A 3RUBL 1V0KA 4Q7IA 5EMUA 4XD3A 3M0IA 2QF7A 2PBOA 4JIRA 3UT0A 2FPYA 2FHCA 3JZUA 2NT1A 4P8WA 3PUGA 3MO7A 4OE7A 3F4CA 2C15A 1EGZA 2V82A 4QDPA 2DIJA 5FACA 3W87A 2QDHA 3CK5A 1YPIA 3R94A 2WZMA 3EWYA 3BO9A 6ALDA 3T81A 2X0SA 2GQ8A 4GXWA 5IHSA 4C6IA 1X6NA 4AF0B 1C9DA 2GWGA 1JZ2A 4HQVA 5A8MA 3AU2A 1VBGA 4MFEA 5EU9A 2DH3A 1S39A 4KRTA 4ILSA 1WCGA 1ZL1A 2VFGA 2O9OA 3AFBA 4GZEA 4S3EA 3N2OA 4X2PA 5JU6A 4QITA 3PTQA 4WDXA 3GR8A 3FJLA 5AC6A 4NJJA 1XGZA 2EEXA 3DFOA 1OCNA 1VBJA 1JF6A 4DJDC 3L0GA 2PDCA 1TPEA 1DXEA 2OEJA 3I3BA 3GBDA 1ZNNA 1K03A 3VD9A 2OTDA 3E0WA 1EIXA 1XDMA 4AIEA 1JUEA 3IIOA 2PDKA 4W89A 2IKJA 3M0XA 5HPOA 4YIWA 3IUHA 3CL6A 4BQ3A 4JEJA 3V0TA 4GLEA 3WF1A 2J8GA 4O28A 1CXHA 4M6VA 1EHAA 5D37A 2WOQA 1V51A 3BMXA 1UMLA 1MZRA 2FGBA 1TIMA 2ZOXA 7TAAA 2XG9A 3BAWA 2OOFA 2DSVA 1J2WA 3E2VA 3TMLA 3FXYA 1ZS2A 1J01A 3C3UA 3R10A 4J2PA 2BGNE 1CLKA 3WLQA 2E6AA 4O12A 3WQWA 4A6GA 2W92A 4RNJA 2FHBA 2HZGA 1VPXA 3F4VA 3R4IA 3V4BA 5E5CA 1LM1A 2Y70A 4B2DD 2OYKA 3NA8A 2V5JA 3AYRA 3VGEA 3JZEA 4NRRA 3W3OA 1POKA 3QW3A 4R9XA 3VIHA 2A3HA 3B9EA 1V3HA 4HTBA 1JCMP 4WDWA 1X1NA 1O7AA 1OZQA 1BXBA 5ECVA 4UTWA 1XH2A 5TD4A 2YZ5A 3E5PA 4UCFA 3RXZA 4Z1CA 1UBSA 1EJTC 4ORIA 3DDMA 1O68A 3SURA 2PWHA 3G1RA 4L61A 1VYRA 1VCFA 3IANA 5BNKA 2V2CA 1XJBA 1MFUA 3CQ0A 1OT2A 5I2UA 3GHTA 1OY0A 4B2DA 1MUWA 5C9RA 1CPUA 3W25A 2GVEA 1N55A 1I1XA 1V7YA 4GXMA 1XLKA 5DCEA 4B4FA 1SJAA 8CGTA 2GGIA 4UR8A 3TN5A 2PDQA 3VOHA 4HZMA 2YXXA 4QJ1A 1BSIA 4JQ1A 4KPLA 1VC4A 3C0LA 4ACZB 3SRFA 2PP3A 4I9MA 1K9DA 2ZYFA 5I5RA 4Y8FA 3R1ZA 3VNKA 1W5PA 3UA3A 4AHPA 4FHAA 3H2FA 4KEMA 3W26A 4M82A 1TJRA 1Z6KA 4MY9A 3S9IA 3UA4A 2JEPA 2ZUTA 4NQ1A 1F73A 2OPJA 4LBRA 1VFFA 4CQDA 5I3IA 4XB3A 3GNRA 5I7GA 3NQ2A 1Q13A 3GTNA 1XFCA 1QATA 1BEUA 4AYSA 4DUXA 2WM0A 3ITTA 3SI9A 3NZRA 4ZFMA 2A5HA 4YHEA 2VCBA 1RLCL 3C2VA 5HJXA 4AEFA 1PTGA 2CLMA 3BAKA 3LMZA 3IUDA 1EIBA 3CYVA 2A3AA 1US2A 5CEWA 2XVLA 2C7FA 1H7RA 2FYMA 1GJUA 1P0BA 3BDKA 3IJIA 4OT7A 1GONA 3SSZA 1XG3A 4O1DA 1JZ6A 2WMHA 3DESA 4EXQA 3BURA 4UTKA 3ZLGA 1BQGA 1WV2A 1E6ZA 3TYCA 3PPFA 4ZL1A 4CN6A 1C7TA 3UCDA 4RDZA 1D9EA 5LYRA 2PZ0A 4W5UA 3LLFA 1VBHA 4GY0A 3V0SA 3G6MA 4MNMA 3S5YA 1ISZA 3ZWTA 3VI2A 3VMPA 3VINA 1F2JA 3E0VA 3FS2A 2H8XA 1ZJHA 3MU7A 2PODA 2OLAA 3WLLA 1VFHA 2I14A 2Y62A 2V3GA 4PSPA 4QAIA 3P7YA 2GDQA 2R24A 3CO8A 3NQ7A 1BRLB 3GW3A 3PG8A 3TYUA 3ANUA 2EPNA 3G8EA 2V5CA 4QE1A 4C6PA 1HTIA 4RDVA 5FJOA 4QLLA 3IPWA 3GC2A 2WNNA 2PDHA 4C1LA 5DXYA 3S47A 1W3IA 5GQBA 3UR2A 5G4EA 1W5MA 1NELA 2PTXA 4LTSA 3V35A 4A3RA 4P7QA 4H6EA 2VCCA 3RHGA 1BVWA 5FL1A 5GNXA 3S6DA 2NX3A 1UOZA 1UYQA 3DU0A 2A6NA 3CB3A 1PZ1A 2ZUVA 4OV4A 4QP0A 4MNJA 4Z17A 1WUFA 3N14A 3UJ2A 2WLYA 3CIWA 1IYXA 2OYLA 1H3GA 2ZADA 3F5KA 1IQ8A 4DF2A 1V6VA 3LHUA 4I6KA 1EF3A 4AD2A 4EAMA 3WMBA 3AROA 1EGVA 1DJNA 1XBZA 5AC8A 4JKKA 2DEPA 3UWEA 1FDJA 3FDKA 3MWCA 3RLUA 1GYMA 2OSYA 5FJUA 1OGBA 3ZVIA 2OGYA 1WUEA 4ZEPA 2KAUC 3TMQA 2Q09A 1BWKA 3ITGA 4ALDA 4JOMA 3IARA 2IKHA 4QLKA 3KS6A 5FEPA 3QQWA 1PCKA 5CLWA 2XWDA 5B7ZA 2Z4GA 4O19A 3Q94A 3S1UA 3O1NA 1FRBA 3M9YA 4NJIA 1FQ0A 3BTNA 3B8TA 4IPNB 4UTJA 1V0NA 1WO2A 3KRZA 5HAOA 1J0ZA 2WHMA 4MFDA 2X7WA 3E0IA 3EEZA 2BV9A 2BODX 2YW4A 3OGSA 4NZ4A 4MB1A 1OYAA 2HXTA 3NDZA 4O15A 4D6IA 3L4YA 4WCJA 3P8JA 3MP4A 4LV9A 3MC5A 5FEZA 4E3VA 1JXJA 4DYKA 1E9ZB 3E3HA 1FY6A 3WDQA 4FPSA 1PTAA 4MB3A 3P2VA 1KM3A 2Y8UA 3GXPA 4JHOA 5BW6A 4HA3A 3E0LA 3LLDA 4I6VA 2ACUA 4DJDD 1FWRA 2PRLA 1FCUA 2YBUA 4HSHA 1FWAC 1ZBKA 4N42A 4AYGA 3LXCA 4UUIA 3VNZA 5EMMA 1SO6A 3MWAA 2FB2A 4IWWA 1YQ2A 1TTQA 1TUXA 1X7FA 3I6EA 3RM9A 4IQLA 3QN3A 4FEZA 2Z28A 3NTYA 4YPJA 3W88A 1RJRA 3WELA 4RJEA 3KS5A 1DWFM 5DT5A 3TTQA 2WPBA 4NZ3A 4K38A 2FZ8A 2JFEX 2ZA3A 4MIMA 2PC8A 1G4EA 3HQNA 4CNOA 1RP9A 5LIYX 1XDJA 1RA0A 3WLRA 1EPVA 2I7GA 2CWXA 3AU6A 3S1GA 1MO0A 1QNSA 4L4LA 4FLOA 2C1IA 4G7EA 2GVYA 3PJXA 4DIAA 4HJFA 2PURA 3VPLA 2ZIDA 1W3TA 2ZRXA 3RK8A 2VGIA 4A8IA 1UR2A 4UTTC 4B4HA 3DOPA 3KX6A 5K7JA 4PRWA 2A7RA 1IT8A 3E6EA 4Z1BA 1EOKA 3WK3A 2Z2BA 2HEJA 4LCQA 4CEUC 3UY8A 4HK7A 1W56A 2CZFA 2DZTA 1JCNA 2EAWA 1O66A 1DL3A 1OYCA 3VE7A 4JR5A 3KAOA 5A94A 2VFDA 1R6WA 2DW6A 2B7OA 1W5QA 1TQXA 2JEQA 4X9SA 3K4DA 4QDWA 1IGWA 4A21A 1KBBA 2ZUUA 4V1XA 5DBUA 3R25A 1MFVA 4B16A 3DFNA 4GBUA 2J27A 3B9NA 4H8HA 2CZ5A 1QASA 4OKDA 5AECA 2VCAA 1R5YA 5CPQA 4C1NB 1GOIA 4Y9MA 2Z7KA 4UMAA 1FWFC 3GS6A 4TVUA 2Y6ZA 4JTAA 1TWWA 3CBWA 3TONA 1GGOA 2WMIB 3P0WA 3UYIA 2AL2A 3TFCA 4ACYA 3SM0A 2Y7GA 2JKPA 1GUVA 3LY0A 4ZQPA 3W1PA 3W6MA 5C2GA 4KEZA 3ZR4A 5LNRA 1PIIA 2X09A 3T0BA 4ICMA 3PTDA 4ERIA 3Q37A 4Q8UA 2HVMA 1ALDA 1H7OA 3WENA 2NXGA 4ZVJA 4LRTA 2QMJA 1EX5A 2GGJA 3P5ZA 1JULA 1CX9A 2QYGA 1VYPX 1LQ0A 4CKQA 4GYFA 4YWSA 2W5FA 2FZBA 2RAGA 2VL4A 2CIPA 1R46A 1Q2SA 2VC9A 5EMKA 4NU7A 2VKZG 2OEKA 1GKPA 1FFQA 4JHMA 5I3FA 1Z44A 1EB3A 2VWTA 5BU6A 1K1DA 3ARRA 1V6TA 5IDZA 5G1MA 3I6TA 1X39A 3W2JA 3CV7A 4J3VA 1OT1A 1RQHA 1SQ7A 3PBGA 1D8WA 3UU0A 3CPUA 1F76A 3GVRA 1EX1A 2PDNA 5DO8A 3UG8A 4AZCA 3TH6A 1Q6QA 1UZ4A 2B31A 2XGZA 3F1QA 4BR1A 1NDYA 4W86A 1PKLA 1HGWA 5GJNA 1PX3A 3R58A 4XD5A 3MQTA 1UD2A 2EKGA 4NYYA 4DWSA 1KFWA 2ZUMA 5LKYA 3EX3A 1R85A 2SFPA 1N8FA 1RBLA 2ZC8A 1U2YA 4LAMA 3BLLA 4XZNX 1CENA 4PBFA 1W1ZA 3BXWA 3VNJA 4GUFA 3QSTA 4IXHA 3DI1A 3AXMA 4H6QA 3OVRA 3TUUA 1HVQA 3WBEA 2X1IA 2PRMA 5D30A 1VIZA 3A13A 4N2YA 5AHEA 3P67A 1SMAA 3QGAC 3UBPC 2HK0A 4UFHA 4D6GA 4XZHA 4PTDA 1ODZA 9XIAA 3THAA 2O9PA 3UXIA 2A21A 4HA0A 3GFYA 2G3JA 1OIMA 4IIEA 2WM1A 1TUFA 4HJWA 3UGRA 4AMCA 3PBVA 3L2IA 5BRPA 3O3RA 2J79A 3POHA 3VDHA 3OJGA 1B54A 2YX0A 1NSJA 3H21A 4MNKA 3CUJA 4EWJA 4JQ4A 5LA0A 6CGTA 1HNYA 5F2LA 3FY1A 2VYOA 4ZQMA 4P7OA 3LGEA 4Y2WA 4C91A 4AIBA 4GACA 3ES7A 3F4WA 3FK4A 3AI0A 1NWSA 2ZX6A 1JPHA 3PB0A 1B3VA 2VC5A 4QG6A 2PWGA 4HHLA 3MYPA 4LF1A 4CU8A 1J10A 1W54A 3DYOA 3UPBA 4Z1YA 2YA0A 1RH9A 4A8NA 5BXTA 2NLYA 3MHGA 2WMFA 1QI4A 3MUZ1 2TRSA 2Q02A 4NRSA 3UGVA 4NX5A 1W9PA 5C2CA 1OQFA 7XIMA 1AH4A 1A5AA 3FJ6A 3VUSA 1QOXA 4ML4A 4FSAA 2YSWA 4UB9A 1RV8A 5TAOA 1AL7A 4O0ZA 2CLKA 3AZRA 3EA2A 4PB3A 1E15A 3FVDA 5HNUA 3EX4A 1AQFA 5E6ZA 5B80A 1KGWA 4OZOA 3CS2A 3SN1A 2F6UA 5KITA 1KTNA 1WOBA 2E67A 3QPEA 3QRHA 4DUWA 3CASA 1XSJA 3RJXA 1XD0A 1OINA 1E72M 3AC0A 4W88A 1S2CA 5BOEA 1ZCOA 1OFEA 1VF8A 5D02A 1T40A 3O7UA 1K6WA 2WVUA 3GAKA 1JR1A 1NOWA 2GYIA 4H7ZA 3O05A 1CXFA 4ES4A 3BLPX 1C29A 3DFSA 3KOWA 2X16A 3GIPA 4WIWA 4ZMGA 2QCFA 3B8WA 4OOZA 1XCXA 2VDHA 3USZA 2ZBTA 4JNMA 4Y9PA 1E6RA 1XLEA 4RK8A 2Y7FA 1V02A 2PGRA 4GQRA 5CC7A 3SIZA 1F6KA 3ZT5A 3KWSA 3UETA 1B4KA 3G5EA 4IGSA 1PO9A 2R1KA 3GH7A 1I2NA 3EMZA 4QAWA 5ABGA 3WLPA 5HQMA 2C8NA 2BVYA 4K8EA 4UQ9A 3C2FA 4YU1A 2HBVA 3ORWA 2GGHA 1JPIA 5HXMA 2BHYA 3VNYA 3WF4A 4H4IA 1I45A 1TRDA 3HPSA 5AZ0A 1UIOA 3NXFA 1PKYA 5HNRA 1W9BM 3A3WA 1AL8A 1XISA 2R94A 5D9OA 3PPCA 3QMRA 2BMBA 5H1WA 4Z2LA 2YB4A 5FF0A 2ALDA 3UPMA 2E1DA 1FP8A 1WOAA 4M1RA 3MYOA 2GVGA 4W93A 2O92A 4AVOA 1W6TA 1B31A 1WNOA 4RE4A 4WY0B 2WYSA 1O5XA 3DIPA 3TWAA 4H7VA 3OQEA 4AFYA 4HK5A 3VIGA 4JTTA 1NARA 4QROA 3SUTA 3W7EA 1EJSC 2J9ZA 4ZQRA 3S1XA 1KGXA 2Z00A 1Q6CA 2E0PA 2PI6A 4HBKA 1JDFA 4IMFA 1RK6A 4N02A 2V8ZA 3SSJA 2ONEA 2FH8A 4KCVA 2QDGA 4GPNA 4HNUA 1ITXA 2ZX5A 3DEQA 2YL8A 4D6CA 4UTTA 1ZBWA 1S5MA 3AZTA 1CGYA 4IPLA 3S5SA 3ZJ8A 2WVVA 1XI3A 1HL9A 2PWUA 2VRKA 5D9NA 5HPCA 3ABXA 4KBXA 1HF6A 1CXKA 4TTGA 1GT8A 3GNXA 1T96A 5I3HA 4PFMA 1LLOA 3K8MA 3SN0A 1UASA 5CSYA 5LNUA 4UFKA 1X96A 3CAVA 3G1AA 1JUBA 2WSYA 3T1GA 1GHSA 3H7VA 4Y9AA 4JTIA 3EDDA 3BSHA 2VENA 1AUSL 3DAQA 1B5TA 4DBEA 2R82A 1HJUA 3LEPA 3IGUA 1XDLA 1BG4A 3RNDA 4W9TA 3HMCA 1K02A 4PC8A 4NXKA 1UKQA 3N4EA 1Q6FA 4QLJA 3FCPA 5FEWA 3RMJA 3W76A 3FHAA 4KETA 1NP2A 4QCFA 4Z2KA 1GQNA 2GSHA 1J4EA 4KF1A 1J2BA 1NIUA 4LVBA 4GXPA 5TQLA 4M6QA 2MANA 4M3PA 1J93A 2YCJA 5M1TA 3U3HA 1UPPA 2QW5A 3A22A 5EBAA 4D71A 1UCWA 2GJXB 1JFXA 1CLVA 4RDWA 3HJZA 3IGXA 4F66A 4PRRA 2QCDA 2EG7A 2W62A 3P8IA 3VXGA 4PTWA 4CQ8A 5CBIA 1HP5A 2OCZA 2POZA 3MA8A 1UW9A 3C6CA 4ZCWA 1XIFA 3E38A 1C92A 3NL5A 3S1WA 3QJAA 1YW1A 1UP3A 1BYAA 4M80A 2ANUA 1TCMA 1B57A 1XUZA 2AQOA 2ZX7A 3K5XA 1TVLA 4IQJA 3H12A 3CTTA 3QC3A 5CPLA 3P81A 2IUZA 1ZZMA 8XIAA 4GE8A 4BJHA 4QEEA 3TK7A 3WLOA 1WYIA 1J5SA 4LUSA 2X7VA 1A5OC 2Q71A 3N04A 1BFNA 1R3WA 5EGRA 1YEYA 1R2TA 2QCLA 3CQHA 4NUWA 5EA9A 1FDYA 3C5QA 2WW5A 1OFQA 1U1JA 5C54A 1RR2A 4F9JA 3M4HA 4HU3A 4GISA 3ABSA 3EA3A 4N9DA 5FF7A 1E0VA 1F4AA 1HG3A 3ZO9A 1ITQA 1PCWA 3VD3A 1TPUA 1IF2A 1YNYA 3D3AA 3H7RA 3EB3A 4E4UA 4K3ZA 1LUCA 4FIRA 5AB3A 2GGGA 3RILA 1WBJA 4CNNA 1F3EA 3O6AA 3SUSA 3VO0A 3BOFA 3W37A 3BQ6A 4L1GA 1W9XA 2W63A 3QR3A 1TPB1 1EOMA 2PDPA 2OZ3A 2XIOA 4HA1A 2TMDA 1FKXA 4TVDA 3W01A 4PCFA 1TTIA 3EWUA 5JBFA 2VZVA 3CHCA 1WB0A 1MVYA 2PDBA 1PIGA 3URQA 1MWOA 1M3UA 1PHWA 2VOTA 4H19A 5EPDA 2XVGA 3V5CA 3H23A 3VKCA 1TJPA 3WEZA 3NURA 3MMTA 2EKCA 5A6SA 3KM8A 3KRBA 3E1F1 1ZY9A 2EG8A 1KXQA 2O55A 2P53A 3QHOA 3A23A 4ROQA 4Z1AA 3UXKA 1I2PA 1LCOA 1W3HA 1ZP3A 3KRSA 1KQYA 4XBKA 2WCAA 3QY6A 5K4ZA 1KXHA 4AD5A 4FOKA 3AMGA 1GOMA 2X05A 1XPGA 3H2AA 3BG9A 1PWLA 2PTZA 3AUJA 1AD1A 2GL5A 4BFAA 4F2TA 1W3KA 3MVIA 2CESA 4GJ1A 4XK2A 3IRDA 1QBBA 4PTMA 3CUFA 1O60A 3EKZA 4WOZA 4NKCA 2VUNA 1DXIA 1XUUA 1A3HA 1XBVA 3I7RA 3R6IA 4DZIA 3SCNA 4RKAA 4F0RA 2W91A 1QRQA 2VZTA 3BAIA 4LJ3A 1V79A 3M47A 4REQA 2E8YA 1PEZA 3ARWA 4E2OA 3ITVA 3XIMA 2GSEA 3HU7A 3VNDA 5C9ZA 3GNNA 1VB9A 2A2IA 5LSMA 3C8FA 4D8ZA 3L7RA 4EIVA 2Q01A 4HZ7A 1C8XA 1VLIA 1QI5A 4V28A 3TYZA 3OG3A 3L2LA 1CWYA 2WSRA 5IBXA 2E25A 1GCYA 5M2FX 4U3CA 4NZCA 2R1PA 1G67A 1K77A 2HVOA 2FJUB 2X1UA 3LSCA 3VABA 1W1VA 2PWFA 4X0VA 5CH9A 4RW5A 3W7NA 3RU8X 3ITXA 5I03A 1UUOA 4IGMA 1Q7ZA 3RPTA 1GQIA 1MZHA 3W86A 4O1EA 1TTJA 3BLEA 4ZBCA 3VM7A 3GM8A 4PRTA 1ZALA 3WJWA 1A4LA 1MRAA 2HTMA 2PS2A 2V6AA 1XFBA 2VQUA 4JN7A 3QY7A 3GXMA 2FKPA 3EB4A 4B3KA 1XCFA 1TB3A 3U0HA 5CC3A 3EMCA 1U5JA 4ZB0A 3CO4A 4Q32A 5DMYA 3BICA 3FVMA 4A2SA 4U2ZA 2CXGA 2WV8A 1RXOB 2BY3A 1X97A 4UOJA 1V08A 4QTGA 2TAAA 4K8HA 3GR4A 2V2HA 2WZIA 1M6JA 3AS3A 1X8CA 2D69A 3ITLA 1D3HA 1AJZA 3PBUA 4J27A 1R87A 2XH4A 2V38A 2AAAA 2PLKA 4XZIA 5D03A 2CWNA 5M17A 3ZR5A 4QHRA 2VGBA 3LM3A 3A9IA 1S1PA 4HMCA 3W7IA 5I6SA 3M0JA 3LK6A 4DN1A 1KFEA 4UIOA 3CYJA 1RVGA 3GC5A 5AVHA 4MTVA 2BDQA 1VZWA 3H7UA 3GWQA 4M5PA 1VFOA 4L1WA 2FZDA 1IWAA 3VYLA 1MNZA 3OVQA 4PA8A 4QJ3B 3AQUA 3DGBA 4V2XA 1GPWA 2V30A 1F05A 2NUYA 1LF1A 1KWGA 4C6NA 1TR1A 4FXFA 3HIJA 3AIWA 2ON3A 4NZ1A 3APGA 3SBFA 5SWUA 3EWCA 4R9OA 2YDRA 1TIWA 1Z69A 3KP0A 3K2GA 3VIOA 3B8UA 1EZWA 3SZ8A 3SCOA 5E93A 3MUIA 2G50A 2WVVB 3F5JA 1NU5A 4HZ8A 4TMBA 2E9LA 3PTKA 3KOFA 2I16A 2PTYA 3VCRA 4WXYA 3ARQA 4FO4A 2PE4A 1BGAA 3VNIA 3OP2A 4HN4A 3MI6A 1EO5A 1GK8A 1QU4A 2WMJA 1XHGA 1UWTA 4MNLA 4PL1A 2XUCA 1JGMA 1YE4A 3TOYA 1SO5A 1TE1A 1X8FA 2QJJA 1UUQA 3ALGA 3LBMA 3Q67A 4LSBA 2PWDA 2OEMA 4ZO6A 3HQPA 3L66A 4UFLA 4HNVA 1OC7A 3W38A 3UWYA 5AKQA 4PMXA 3NPUA 3I65A 1VCGA 4GKTA 4DAFA 1IXNA 1UH4A 4H2CA 3GXNA 4YN5A 3UZWA 1J12A 4NL1A 2Y2WA 4MJZA 4TOQA 4D6EA 1S46A 3NJ3A 3M43A 1A0DA 3B04A 1F3TA 3A64A 3TAKA 2Z7GA 3ARUA 5ENLA 3LSBA 4CCDA 4FP1A 1MDLA 4BHYA 4JFVA 4LYQA 5IRPA 3PZOA 4JKMA 2F9RA 4DF1A 3L68A 3BQ5A 5FSEC 3CHDA 4X60A 3N25A 5D2TA 3ITYA 2Z1SA 3R12A 3M0MA 1EDQA 4QR6A 3CTLA 2HSAA 2QMKA 1PV8A 3DC0A 2EPHA 5EYWA 1KKRA 1OFBA 3CUHA 2XVKA 1TMQA 2VMFA 4LQ1A 1YBQB 1DE5A 5HINA 5AYXA 4UOZA 3U4AA 3KW3A 4GYPC 2ICSA 3PSWA 2XTKA 2R1NA 5AYYA 3B9OA 2YL9A 3ISIX 5TBOA 4IIDA 4XD6A 4Z2GA 1ZBVA 2PGFA 1PXGA 1TV7A 1FWIC 1GHRA 4Q4PA 1RY8A 2WKJA 2OO6A 2DT3A 3G24A 5H91A 3M0KA 4LB3A 3WQVA 4RPQA 4ZR8A 1UH3A 1W5OA 3WNNA 3ZLHA 1NY1A 3AIEA 1CB2A 4WGHA 3CAQA 3POCA 4PMYA 3TJXA 3P60A 3ZMRA 5CXPA 3KL0A 2ZC1A 1OCBA 1WE5A 4GQGA 4LUTB 2GJRA 4FI4A 5FJPA 1G1YA 3LG3A 2C91A 1FWDC 1JZ8A 5TIMA 1OSEA 2UY4A 1E73M 3LCFA 3NQAA 3ICJA 3VIFA 5LXXA 2HMCA 4DHGA 2DORA 3IEBA 5ABHA 5HWNA 4H01A 2NVDA 3MCNA 5KZDA 2VEPA 5K9DA 1VHNA 1ZLPA 2WBKA 5L6UA 1RPKA 1Z32X 3WD4A 3GO2A 2G3NA 1O1HA 4ZO9A 4E8CA 4HB7A 3B0XA 4ADTA 1XC6A 1DJIA 4XAZA 2IQTA 1QT1A 4KCUA 1BTMA 3P6LA 4LGXA 1QWKA 3C8NA 4P61A 5ABEA 4IJCA 2P5NA 2PAJA 1R3RA 3MUAA 5I79A 2X30A 1E51A 1W2PA 1HW6A 3WH5A 4PZVA 5FF4A 5EFFA 1E3XA 4A2RA 1DKWA 4F40A 4QE5A 5DBTA 4LPCA 1SJDA 3GNOA 2J7EA 1X7IA 4ZFCA 1ZAIA 1OZMA 4HNLA 1A5MC 1FCBA 4US6A 3B8VA 5G4WA 2B81A 4XKYA 5CSUA 1OX4B 1S2AA 2AKZA 1GOXA 3QR1A 1BSLA 3VOIA 4GI8A 1FVPA 4PCSA 1DQXA 4GRSA 5DANA 3MS8A 4B9YA 1NJJA 4IF2A 5A3HA 3EA1A 4TV6A 1UUMA 1EYWA 2PCEA 3AMLA 5CC6A 3KVKA 1UKTA 4CNUA 3UZZA 4BWLA 4IMDA 1YDNA 1XGDA 2F2KA 1R7OA 2BX7A 3FYOA 1MRQA 3TNOA 4UQDA 4X3ZA 1KFCA 3QMTA 3NQ8A 1X98A 3I4KA 1SFLA 3MMWA 4JPGA 4GQ0A 4K36A 1R47A 3A12A 4DXXA 3W1MA 2NV1A 4H8VA 1FWTA 2RJGA 3PM6A 4IFKB 2I5IA 1TYGA 1XGEA 3IJ6A 1SR9A 5A8OA 1HP4A 4QDMA 4GABA 1SO3A 2YCKX 3V3WA 4Z2JA 3HPZA 2F2HA 4IX2A 3EXSA 3NM3A 3CT2A 2PDWA 5FD0A 4K1WA 2QGHA 1PYFA 2Q6ZA 3R13A 2IPWA 3W6YA 5C71A 4P7NA 2O4MA 4S3DA 2G37A 3T9PA 1KRMA 3PFRA 3SCUA 4OWGA 3CGTA 2A7PA 2C79A 2YDAA 3B0YA 4HN8A 1TVNA 2HNEA 1E6QM 1UC4A 5JUVA 1Z42A 3TIMA 2RDUA 4F8XA 1MEHA 1VFSA 2QDDA 4JX4A 3MTWA 1M53A 5IM51 5CSSA 3C0SA 4C6BA 5CGMA 1XYCA 4E2BA 4IZGA 4KWWA 3VFLA 3EX6A 1LOQA 4F4RA 3AZSA 3GYEA 3AWOA 2XFWA 1PKMA 2ZRZA 4ECLA 1JZ5A 3QH2A 1DIEA 3TTEA 4AW7A 1WX0A 4C6FA 3BCDA 4GNKB 5K9XA 1AZ1A 2ZE3A 3PN8A 4R34A 2KZHA 2X0YA 1C8YA 3VC6A 3E02A 4YVVA 4Q8PA 4IG2A 2OR2A 2BLEA 3NO5A 1NVMA 4M29A 1I2QA 4RZBA 4MWAA 1RUSA 1Q66A 3N13A 3WNOA 1HO4A 3WDHA 3N19B 5C55A 2P50A 2IQDA 1Q7QA 3SECA 4AZBA 1XRFA 2BBFA 1JYVA 3MV11 5CGTA 6XIMA 2Z1XA 2B7QA 3NVDA 2FJKA 2FIQA 1KLYA 4DRSA 1YRRA 2FFCA 5D9MA 1X38A 3AIRA 3CT7A 3IK2A 4YCOA 3MDUA 3NQGA 4M51A 3F7JA 4GWEA 1EDTA 1W2VA 3D0CA 3F4DA 2DZXA 5HANA 4NASA 3W23A 3WQ4A 5I0DA 2XSAA 2PLCA 2QV4A 1OFDA 4WJ8A 1ZENA 1QOQA 3KDOA 3NZ1A 3IJ7A 3QEZA 5C6MA 1WKFA 3V18A 4PB4A 1TV4A 2WXDM 1UWAA 2BXVA 1QO2A 4E38A 2FVLA 3AHXA 3M46A 1YADA 4B9ZA 1TV2A 2D73A 1K7EA 4CNSA 1NF0A 3DGRA 4PMDA 4BK9A 4UTIA 1OFPA 4AD3A 4PCTA 5AHIA 4NNBA 2P10A 1O5QA 1OCJA 3HFTA 5GPRA 1ITCA 1P0EA 1JZ3A 1RSCA 4O50A 3VCCA 5KETA 3ZT7A 4DJFD 1KFBA 3VDAA 1CB7B 1KR1A 3K4AA 3R0DA 4KCTA 4L6DA 3U2ZA 1LLZA 2E5DA 4JTQA 4CUCA 2Q3OA 4KWOA 4HNCA 2H8ZA 3CIXA 4L9XA 1DJHA 3VIJA 1KNWA 3KBWA 1GOKA 4W8AA 1FA2A 3HV9A 4I8YA 4IICA 2WK2A 1RJQA 4UNIA 2C71A 1FDZA 2WJDA 4YVPA 2B7PA 4S3JA 3EZ4A 1THFD 1MQPA 3WUFA 4O53A 1TPH1 3LTSA 2XFRA 5I3GA 1VEMA 4L64A 3ME3A 4B92A 4OU1A 1BYCA 5BZAA 3ANVA 4F0LA 4ZTXA 4FR1A 4UTLA 4C5ZA 4KFPA 1NWTA 4KRUA 3W27A 3SUWA 3LOTA 3WJYA 1W3LA 4YYFA 4LAKA 1WDPA 4B5VA 3ITOA 5G2IA 1BF2A 1DIDA 4UTMA 5BWFA 1CT5A 1O6IA 2EJAA 3T6CA 1VLWA 2XFYA 2QCNA 3NQEA 1YLVA 1N82A 2PGWA 5E70A 1OYBA 3OZMA 2ACQA 3LXAA 3FNDA 4PMZA 1KM0A 4XZLX 3O06A 3N2TA 5DMMA 4X2RA 3ALFA 1HKVA 2I9UA 4KERA 3U2CA 2V69A 5REQB 4YTRA 3C2YA 4G5DA 2FMOA 3AJXA 4ZXLA 4MKVA 2PDYA 4Q4KA 4AD0A 1XLDA 3TC7A 2GQAA 3BLDA 5U7SA 3COTA 4A35A 5LIXX 2YXGA 1JD9A 3L4UA 1DIKA 1E9IA 3DKLA 3TNBA 4KIEA 4OHQA 1AW5A 4QSFA 1PJ9A 3N15A 3PZNA 2FHFA 4OECA 2J4GA 1V93A 1F8MA 2J66A 3KP1A 1NOFA 3OYZA 4AF0A