1YNPA

Aldo-keto reductase akr11c1 from bacillus halodurans (apo form)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
283
Chain Sequence
HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
molecule keywords oxidoreductase
total genus 103
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynpA01
4Q3MA 2PDKA 3S3GA 3GHSA 1C9WA 1RY8A 1ZQ5A 3DN5A 2IKHA 4XAPA 3CAVA 4F40A 4JTDA 3LNMA 3CMFA 3V0UA 2IPJA 1AH0A 2PDMA 3WCZA 2INEA 3RX2A 3WG6A 4JTCA 1ZGDA 4HBKA 2R9RA 3H4GA 1QRQA 2PFHA 2ACRA 3R8HA 4IJRA 2FZBA 4FAMA 3CAQA 2FZ8A 2ISFA 4L1WA 1J96A 1EXBA 1PWLA 5LIYX 4FA3A 4DBSA 4YU1A 1LQAA 4LB3A 2DUXA 4GQ0A 2IQ0A 1VBJA 4JQ4A 1EKOA 4JQ3A 3UP8A 1S2AA 3LENA 1S1RA 3UZZA 4ASTA 1ZUAX 5AZ0A 1HQTA 3O3RA 1ADSA 4H8NA 3P2VA 2PDCA 2PDYA 1R38A 4NKCA 4JTQA 1S1PA 1OG6A 4JTAA 1YE4A 4GABA 4AUBA 1XGDA 5LIKX 4LBRA 2PDWA 3VXGA 1Z9AA 2J8TA 1AZ2A 4JQAA 2F38A 3WBYA 3H7RA 2PZNA 2HE5A 3LQLA 4PUWA 1T40A 4GACA 3KRBA 4YVVA 3CASA 3LBOA 4XZLX 4FZIA 1K8CA 4GIEA 3M64A 1AFSA 2PDFA 2HE8A 4XZHA 3FJNA 5HNTA 1MZRA 1Q5MA 4JIHA 3ONBA 4WGHA 2PDXA 1T41A 2VDGA 3G1RA 3R6IA 2IPFA 3N2TA 4WDXA 3UG8A 4IJCA 5HNUA 4GA8A 2PDPA 3BURA 3GHRA 1MRQA 5LIUX 3H7UA 3UZWA 1YNQA 3R8GA 4LAUA 1HW6A 3GHTA 2R24A 3EAUA 2BGSA 1Z3NA 4GCAA 4JIRA 4JQ1A 2FZDA 2HVOA 3M0IA 1XF0A 4WDTA 2ACQA 1YNPA 3Q65A 1SM9A 3UWEA 4WDUA 4QR6A 2BGQA 3R7MA 4LB4A 4DZ5A 1Z8AA 5M2FX 3V35A 4WDWA 1IEIA 1A80A 3T42A 4LAZA 3LD5A 3BV7A 2INZA 1X97A 3ERPA 4XVEA 1YE6A 3M4HA 3LN3A 3WBWA 3V36A 4XK2A 5JH2A 2IPGA 2ALRA 3LQGA 2PDIA 2IQDA 2PDUA 2PF8A 4JIIX 3WBXA 4PR4A 3F7JA 4G5DA 1PWMA 1MI3A 4RPQA 2A79A 4YS1A 4LBSA 3C3UA 3R43A 2PDJA 2C91A 2ACUA 2QXWA 2IS7A 1X98A 4QX4A 2I17A 1UR3M 1RALA 2ACSA 2NVCA 4ZFCA 1PYFA 2DUZA 4JQ2A 1JEZA 1ZSXA 3MB9A 2NVDA 3UFYA 2BP1A 4R9OA 3Q67A 3O0KA 3GHUA 2HVNA 5JH1A 3LZ3A 2HV5A 4DBUA 2PDQA 2PEVA 3R94A 2FZ9A 1M9HA 2FGBA 1US0A 2PD5A 4QBXA 3LEPA 2HEJA 3BCJA 5DANA 1FRBA 2DV0A 3EB4A 1S2CA 2CLPA 4XZIA 4HMNA 1VP5A 4MHBA 3V0SA 3RX3A 4FALA 2FVLA 4JTRA 2IKGA 2I16A 5KETA 3UYIA 4PRRA 4EXBA 4I5XA 2PDGA 3QKZA 4OTKA 4WEVX 5AZ1A 1EF3A 2PDBA 2PDHA 2WZMA 2AGTA 4Q7BA 3LUTA 4XO7A 4EXAA 5LIWX 3BUVA 3U2CA 2PDNA 4PRTA 1XJBA 2P5NA 4XZMX 4XVDA 1IHIA 4XO6A 1AZ1A 4PUUA 2HDJA 4IGSA 1Q13A 3UZXA 3DOPA 3COTA 4GQGA 5C7HA 1EL3A 2IPWA 1GVEA 2F2KA 3CV7A 2IKIA 4L1XA 5LIXX 1LWIA 4YVXA 1Z89A 2IKJA 3N6QA 4ICCX 1RY0A 3V0TA 2WZTA 5HA7A 2PDLA 3NTYA 4H7CA 3GUGA 3UZYA 3UGRA 1AH3A 4PMJA 1PZ0A 3LZ5A 3B3DA 1PZ1A 3RX4A 3ONCA 3FX4A 1X96A 3R58A 4XZNX 2PD9A 3CV6A 3D3FA 4DBWA 4YVPA 3MC5A 1AH4A 4QXIA 4WRHA 3EB3A 1QWKA 3G5EA
chains in the Genus database with same CATH superfamily
4DI8A 4L4OA 4NJIA 2A4AA 4IF2A 1NOUA 3BOLA 4B5UA 3WNLA 1K4HA 1MXSA 4MKSA 3LPFA 4F40A 1U5HA 2CZ5A 3H8AA 3VINA 3GR7A 2QZRA 3AIWA 4LVAA 1KFWA 2UY3A 3WG6A 2UBPC 3IK2A 3FA5A 1GKPA 2XIQA 3TA9A 2YDSA 1QRQA 3AIVA 1ME7A 2ACRA 4TV5A 5IFTA 3A4AA 3WEMA 1LTDA 2X41A 3OQ8A 3FJLA 3C3NA 1MQQA 3NEVA 1DWHM 3NO5A 3W72A 3NQDA 1ZB5A 2PWEA 4IFOA 3DESA 4K3ZA 3VZYA 2XN1A 1FWFC 3W74A 4ZXLA 1TWZA 5A6SA 5D2XA 4U3AA 3F2CA 1OINA 1JCNA 1AJ2A 4XSLA 5HUPA 1ECEA 1KV5A 1R38A 4A3QA 2DU2A 2VI0A 2ATSA 4M6QA 3VKDA 2EQDA 5AFDA 3MO4A 3RDKA 1FWSA 3BWWA 4EPEC 1G6CA 3OB8A 3NIYA 1EX1A 2TRSA 3LCFA 3OO2A 1O5XA 1X1OA 4C1NA 3I65A 3AISA 1YDOA 4D71A 3H7RA 2PZNA 3C56A 1TPVA 1IGWA 2J25A 4Y90A 4M8UA 2Z1KA 4GGBA 3WFAA 3LK6A 2DT1A 3O05A 2WBGA 3DKJA 2CWXA 4O0ZA 2QCHA 3VE7A 3LRKA 3GXTA 3KOYA 2NX1A 3OLEA 2GQ8A 2WV8A 3TMQA 4A2SA 4CN6A 3TV8A 3VD9A 1SJBA 3H6OA 1I4NA 1T41A 1M7OA 3A3HA 1SO5A 4DI9A 5EMJA 4Q4OA 3MUY1 1OBAA 1ZCOA 4W7UA 1DVJA 2XWDA 2XM2A 4M0XA 1BYCA 4QNWA 1MQRA 5A8PA 1DJHA 4BQ4A 3S2JA 1OX4B 1XIBA 2Z7KA 2XVPA 5E9AA 5HR6A 3TJ4A 1VGAA 1G4EA 4V28A 5JMUA 3E0LA 1WDDA 5D04C 2HVOA 3PNUA 1BKSA 1TB3A 1AK5A 3PS7A 4DJEC 4C7DA 3L66A 4GGHA 1J0ZA 1F61A 3VPLA 2WQDA 4KRZA 4TIMA 4L64A 2BGQA 3AMCA 3ES8A 1F6KA 3VNMA 1E9IA 5K7JA 2B0MA 3V35A 1HJVA 1TV8A 1UKSA 1GZJA 5HMEA 2WPGA 2C3ZA 2Y8VA 1RBAA 1TV3A 3LTPA 4A3RA 2OT1A 2Z25A 1UYQA 2EPHA 4FF5A 3AMLA 1TPH1 2WZIA 2F9RA 3V1HA 2J88A 4GPNA 2CFFA 3BZJA 3S5OA 3OBEA 4JCMA 6CGTA 1J8VA 1YTKA 2MNRA 3DHUA 4HYRA 3B8SA 2GGGA 1V7AA 3EWWA 3BK0A 1A0CA 4CNOA 3DC0A 3NWRA 3RITA 4LW7A 3WDIA 1TPC1 1VPXA 4G5DA 1XIDA 4KWUA 4GXWA 3WF3A 4D6JA 3W82A 4Q4KA 4LC6A 3GG7A 3SFWA 5A8MA 4R5EA 1R86A 2H8ZA 2Y8UA 3FJ6A 3HG4A 5DRIA 1H09A 1WDSA 1WV2A 2H90A 2D2HA 4JEQA 4AMCA 3ITVA 3KL5A 4I8DA 5AYYA 4PFMA 1AQFA 3SY5A 1W9XA 1MW1A 2QUTA 2BDQA 5AYXA 5D32A 3VOCA 1KD0A 2ZXAA 2WM0A 1DEDA 2HV5A 3FOKA 4Q4RA 3H2OA 2XYLA 4HHHA 3U5YA 3QR1A 3R1ZA 1R8LA 1LROA 2PRLA 2PD5A 2O9TA 3F4WA 3VNYA 1KM1A 3LV5A 1I45A 3ZJ6A 4DJDC 2HPIA 4XZIA 3D46A 4IIBA 3W38A 3ZVIA 3MKKA 1UROA 3VD4A 4RXGA 5GJNA 2IKGA 3VDCA 1MUMA 2VGGA 1QI0A 3UXAA 1GQJA 4PRRA 3UCCA 3GDBA 4RZ6A 3N1AA 3TKFA 3HU7A 4NAEA 3WY1A 1LRQA 4YLWA 2PDGA 1JI1A 5AZ1A 2PTZA 3IANA 1P1MA 3VVGA 3STFA 2VXNA 2J75A 1W9VA 1G1YA 5E0CA 2ZUNA 1X7IA 2H6RA 2J27A 1XQLA 1GQLA 3REQA 1AZ1A 3QGAC 2QJNA 1RHCA 3E0VA 5BRPA 4H8HA 4QISA 3A13A 3EB2A 1JD9A 3GUWA 3KLKA 2OTDA 3FLUA 4KEUA 1K02A 1OK4A 4JX4A 5FF4A 3M6DA 2OQHA 5AHMA 4FSAA 1E5JA 2I5QA 1OM0A 4MNJA 2HBVA 2DZAA 2CESA 4B5XA 4D6IA 1GYMA 3RK8A 3P74A 3QHNA 4P7NA 4MY8A 3WFLA 4NRRA 3ARVA 1W1IE 2Z2UA 4H2HA 1GOKA 2JIWA 3P67A 1YXYA 2ZDRA 1HP5A 4XZNX 2YFNA 1TTIA 2PD9A 3VM5A 4REQB 3SCSA 1GW1A 2HZGA 3U7BA 5A95A 1XCFA 3P8IA 4J3UA 2ZA3A 3WQPA 5FF3A 4RJEA 3O16A 3WKZA 3MC5A 1EUAA 3UXLA 3UZJA 5H6HA 3BJFA 2PDKA 4WOZA 3VGHA 2VTFA 3GHSA 1FP9A 1ZBVA 4GIRA 3W73A 1W3LA 3FV9A 4ICNA 3WDRA 3APGA 2DZVA 2Y63A 4J3VA 4W4QA 1FWTA 4AD0A 3H22A 1KR1A 3K13A 5LA0A 2EKGA 3QC0A 1GYLA 2IXVA 3IJ9A 4Q8QA 3OVQA 3QLLA 3NFUA 2ZVIA 1XC6A 2P1FA 5LIYX 3TYBA 1JDFA 3MI6A 1PIGA 4N7QA 3PZUA 4DBSA 1YTEA 1DWIM 1VIZA 3GD6A 1M68A 1HL8A 2QCGA 3U3HA 5HQEA 2HISA 4LUIA 1VFMA 1Q63A 3L4UA 4O15A 1XLIA 2OWWA 1QW9A 4GWEA 1ADDA 1L6FA 5C9RA 4NZFA 1J0HA 4UMCA 1HQTA 5LZLA 2WSYA 3TUUA 4GBDA 1HN1A 1UWAA 4IH3A 1TWSA 2PDYA 2NSOA 3EOLA 2X8RA 3M44A 4C65A 2CZEA 4GHRA 5LIKX 3W7OA 3B0PA 1I60A 4B2DA 1K8XA 4RDZA 1ONXA 1RQHA 4PUJA 1T96A 3GR8A 3EOEA 1FXQA 3REQB 2CNCA 4B90A 4AAJA 4OJYA 1W9PA 2QVNA 1I2OA 3LTYA 2QDGA 2PUZA 3ZOAA 5EMUA 1P6WA 2D2JA 4D8LA 2QCEA 1F5ZA 5I23A 2FZNA 3GFYA 3ONBA 1OFPA 3OZYA 1OFBA 1TIMA 2NT0A 2NZLA 2QS8A 1YXCA 3D5HA 3IJQA 2VFIA 4HKPA 3G0XA 3PPGA 3SR7A 4A21A 1JR1A 4NUWA 3R10A 3WF2A 3BOFA 1FWCC 4AZ6A 1ZALA 1GGOA 2FPVA 2I5GA 2O56A 3O6YX 3U8GA 3PWGA 5DMLA 3PULA 3WMSA 1KGWA 2V30A 1SQ7A 3ZYZA 4PEEA 1YXDA 2ZX7A 3NPVA 2V68A 4QJ5B 2CLFA 3B03A 4DO7A 5G4EA 5I3IA 2E5DA 1C93A 3ZSTA 1CENA 3IRSA 1TVLA 3M0JA 4DAFA 4QRNA 3OYXA 2OYKA 3EMZA 3TCSA 3QMRA 4A6GA 3STPA 1A80A 3T42A 3A3XA 4DWSD 2OQLA 3OYZA 4AHQA 4LH8A 2Y8KA 3DECA 3GFXA 3S6OA 4LU0A 3BANA 3ERPA 3AO0A 1K7XA 4HPNA 3M4HA 3E2RA 4G2DA 4W88A 3VC5A 1VS1A 4BQ3A 1JPDX 2QNEA 3GKAA 1XHGA 3E38A 1NFGA 1WZAA 2VC7A 3FHAA 3VOIA 1AJZA 2VFGA 3DGRA 1GOMA 3DIPA 1RBOB 4XD6A 2JEPA 2OEKA 3SCVA 1EP2A 3V1PA 4RPQA 1PO9A 3WLJA 3M46A 4KEMA 5EFFA 2YPIA 4MF4A 2XSXA 5HK4A 3NNTA 1JCTA 4DIAA 2E9MA 2I17A 1ZFJA 2J74A 4GYFA 3VKAA 4XTDA 3G1FA 3WD2A 5KTLA 1OC6A 4O18A 3THDA 1R3YA 2HK0A 1LM1A 1DOSA 1FWJC 1LL7A 4MNMA 3HG2A 3T0BA 2PWUA 4PMOA 2HNEA 3OG3A 3FYOA 4QCEA 4WSKA 3GHUA 3WQVA 1L2UA 4UMAA 1H3GA 2XWEA 1E51A 1XIHA 1S5VA 5A6BD 1O4UA 4XV0A 3DX5A 4ERGA 2Y5EA 2V0TA 3C8FA 4FLOA 4YMZA 5I3DA 2GWNA 2YYUA 3UXKA 1FA2A 5IDZA 2VX7A 4GYPA 3EBVA 2ZUSA 1ONWA 1BRLB 1TR9A 3IPWA 3OP2A 3SCUA 5A2BA 1W54A 4TX9A 2DORA 1LP6A 4V27A 2E6AA 2DSZA 1VFSA 3IJ8A 1NOFA 2X42A 5IRPA 1ISZA 4YL2A 3SJ3A 1V0MA 5DBUA 2C0HA 2CLHA 3UPWA 5LKYA 4XO7A 1E6PA 1IF2A 3CL6A 1DXIA 2E6FA 1LOLA 3I3DA 2ZZ2A 1LZOA 2XSAA 3WELA 2X2GA 3RM8A 2ZBTA 3TC6A 1ZRQA 2QMJA 1ZCCA 1ZZMA 3HO8A 1ZNNA 1DJZA 1U5JA 2GPTA 2VEMA 4FX7A 4UNKA 1AQHA 2J6XA 3P3BA 4GQGA 3ABQA 4S3AA 4X0VA 4KEVA 3ZFHA 1E15A 1N8WA 3LPPA 2BBFA 1KR0A 3C4UA 1V3KA 3QBUA 4GE8A 4CD8A 4JICA 3A9BA 1H63A 2VM8A 1DHKA 4A3YA 4GK8A 4AY8A 2GUBA 3W1AA 1QHZA 1SR0A 5G2IA 4H7CA 2EO7A 1OF6A 1S2WA 2BWGA 1UKPA 4ZMGA 1KRBC 3FDGA 2BNJA 3UXDA 3SN1A 3L4VA 2X2YA 3T7VA 1YLVA 4RNFA 3AMKA 4MB1A 4EOUA 1GOQA 3KS6A 4YVPA 1WKEA 1NWUA 4X9SA 3T0CA 4QXIA 1J9YA 5DT7A 1HGYA 1JDEA 3CH9A 4DJEA 2YZRA 3INPA 4TVCA 2QDEA 4I5UA 5GNYA 4NNCA 4MY9A 1FWEC 4FNQA 4PMDA 4Q8MA 2FDSA 1M41A 1TZZA 3N73A 2R1PA 3S5NA 3PFMA 1YBQA 3MANA 3CC1A 3LTSA 1U22A 4UZUA 1FDZA 2E8ZA 1VHCA 4DO4A 3QTPA 2ANUA 3H4GA 4IMCA 1BEUA 3MYPA 4FI4A 3KBMA 2WCSA 4S3BA 1OSEA 3M0XA 3NQ8A 3R8HA 1PYMA 5CCZA 1PUDA 5K9CA 1FWAC 1GOXA 5E93A 2ISFA 1X39A 1QNQA 5A8QA 3NQ6A 1ZS2A 4WUIA 2WVSA 3W7LA 3TWAA 5GPRA 3GXMA 2CBJA 4ZCWA 4JQ3A 1W3HA 3LXBA 3NQEA 1IWPA 3I6RA 3ANVA 5M1TA 1ZUAX 4EF8A 4MUZA 3K1GA 4ACYA 2WHMA 3SRKA 1NAL1 3AWNA 4KCWA 1V02A 4GUFA 5FJJA 3GH4A 3V16A 3TZNA 2W4XA 5DCDA 2E40A 4YIWA 3P5YA 4NKCA 3V4BA 4LVDA 1UOKA 4GCXA 3OA5A 4QM1A 3W87A 4EIVA 1JPKA 1AMYA 2CHOA 1EYWA 2PWDA 3S1XA 1K8YA 2DH2A 2WMIB 4IFKB 3IIXA 2VUNA 4LUTA 4NXSA 1Z7AA 1F76A 5JVLA 4J4KA 1MMFA 4J2PA 1A3HA 4PUWA 4HSNA 2VUYA 1XDJA 3KRBA 4WJXA 4YTSA 3WQGA 1TREA 3UR8A 2PDFA 2CKSA 2HE8A 5G2WA 2XFRA 3LM7A 2PDXA 3HA1A 3BXWA 2WWDA 3TSDA 1RV8A 4E8GA 1KXHA 1NSJA 1NEYA 1TA3B 1KNWA 3SCTA 1F8MA 2XVNA 1SW7A 3JUGA 4BJHA 4FXFA 4CCCA 2BGSA 3W00A 1KW1A 2V5LA 5BWFA 2F6KA 3SGGA 3GYEA 1TE6A 4X2PA 1RA0A 4O4WA 3CQHA 3WH7A 1UR1A 2VWSA 3ELFA 1XL9A 1XFCA 3DFYA 3W24A 1VKFA 2EHHA 3CUGA 4QR6A 1WYIA 2QW5A 4AYSA 1EDQA 5M2FX 1UOZA 2Y6ZA 1PV8A 4O8AA 5D2VA 1HO1A 2ZUMA 3I7SA 5I09A 1F6YA 2FQIA 4P8UA 3IEBA 1P0KA 4S3FA 3TJLA 3MCNA 1TUFA 4HPJA 2YKKA 4GX9A 1EC7A 3LN3A 1TPB1 4W7WA 4A2RA 2AOSA 3IVUA 6ALDA 4MUPA 2Z1SA 1GK8A 3QZAA 2XM1A 2PDIA 2NXHA 4IIGA 3KRUA 3WBXA 2QIWA 1H7RA 3BMVA 1UWQA 3SN0A 2PLMA 4I90A 4QDPA 3I10A 3MP3A 2NQZA 1MXGA 2DZUA 2V81A 3W6YA 4GYPC 1VC4A 4I3GA 4ZO6A 4ZTXA 3ZR6A 3NURA 4BFAA 1EPVA 1IZKA 4PMQA 3W2NA 2PDJA 2H3BA 1X98A 5K3VA 1RPXA 3G1HA 4HYWA 5BZAA 2J47A 3LSBA 1W56A 1QK0A 3C0SA 3MB9A 4DUWA 2NW0A 4TX6A 4ZQMA 5FEPA 2ZZ4A 2ZRVA 2H3DA 1PX4A 2PRHA 4GKTA 4ZEPA 4PCSA 5ABFA 2HQAA 4XAYA 3NXLA 3ECQA 5D9PA 1VH7A 1KFEA 2CLIA 2VJXA 5KITA 2FGBA 5FF0A 4M1BA 3B8WA 1V6XA 1UCWA 3GB6A 1UKQA 3MUXA 1UWTA 1YTDA 2E1DA 1OHLA 4BEQA 1W5NA 4PFHA 5C55A 2Y5JA 4QNEA 2A1YA 5B7YA 2YBVA 1UKOA 4S39A 1W1VA 1XBZA 4L1GA 5CAHA 3S83A 4CN4A 3QR0A 4AYGA 2E8YA 5G4HC 3KBJA 2QV4A 2OSWA 2ZVRA 1UJQA 2CBIA 2YXGA 1US2A 3AOFA 3MWCA 4WEVX 1B3OA 1ODUA 4ERIA 2CW6A 3A6OA 2WZMA 3WL1A 3EDFA 3WQ8A 3EXTA 3HIJA 5LIWX 3TAKA 3W23A 4AEEA 2V5DA 2XPKA 1UJPA 3LHTA 2JF7A 1G01A 5MKGB 4PUUA 4NAEB 3KCLA 3AJXA 4AIEA 2R6OA 1HKWA 3IJLA 3UCDA 4F8XA 3CV2A 1L6YA 2ZWYA 3GE7A 3H4XA 2YCIX 3ARZA 1KBKA 1CB2A 3S2MA 2HK1A 1RY0A 5DCEA 1T7LA 3UZ5A 4AXNA 3MMUA 2DQWA 3AHTA 3FDKA 4CQ9A 9CGTA 3CAKA 4US5D 4C6BA 3SI9A 3WMCA 1JNEA 4MPQA 3TK7A 4DRSA 3W6MA 4HNLA 3R12A 2PP1A 2X09A 3R58A 2G0WA 4NJGA 3OLGA 2W92A 1CYGA 1PKNA 1M7XA 4HB7A 1RLCL 2OOFA 4F0RA 1VBGA 1FP8A 1M7JA 3TQPA 1G4PA 2EPNA 1UUMA 2JKEA 5ABTA 1CCWB 4X61A 3WK2A 1GVOA 3S3GA 4NYYA 4RX0A 3W0KA 4Y9MA 2FKPA 2IKHA 3KX6A 1DXFA 1OZQA 3M5ZA 2BY2A 1WCGA 4ZXOA 1ME9A 4L6DA 3T2OA 7REQA 4R33A 2FMOA 2VEIA 4O4VA 4CCDA 4AC7C 1KKOA 3DG6A 1BF2A 5HQLA 5I03A 1K6WA 1PB0A 3B8DA 2Y62A 3DXIA 1H0GA 3FEMA 3U7VA 3SIZA 1EZ2A 1J96A 2ABAA 4H83A 4QDMA 2NQ9A 1IXPA 2PGRA 4J28A 4B2DD 1SZNA 4FA3A 5H91A 3C0LA 4XWUA 5HPCA 3PTKA 2EJ1A 2X1TA 1IYXA 1GOOA 1E4MM 3W85A 3MV11 1F6PA 3CAWA 5LSMA 3L5MA 4V33A 5IXEA 3QH2A 1V93A 1G9HA 1WO2A 1D8WA 3NQ7A 2WMFA 4MYXA 4JNZA 3RJYA 5C9WA 3ATZA 2NV9A 3B9DA 4CVUA 3UWVA 3RLHA 3WIJA 4J3XA 1GPFA 3P82A 3THUA 1B4EA 1SJAA 4R85A 1XP3A 1PJ9A 1S1PA 3F2BA 1V03A 4JHOA 2CLMA 5EGRA 4MOZA 2ZKMX 3B9AA 3KHDA 2YL5A 1Z9AA 1LJYA 2B7QA 1S2TA 2VZUA 3IIVA 5LNVA 4J2MA 2YL8A 1TZ7A 3QEZA 3ZQ9A 4ZGYA 1QXLA 1J0YA 5CJMA 3ZJ8A 1GOIA 2XIMA 5CSSA 1O1HA 4IZGA 1RJRA 1SUXA 1GONA 4FNUA 1Q8AA 4K1WA 3WNKA 1VQTA 2DZXA 6REQA 3M64A 3QGVA 3L4ZA 1VJZA 1MW2A 4NZ1A 4I9MA 3D0CA 3HPFA 3DFQA 1TCMA 2YZ5A 3B04A 4WGHA 3UY8A 1Q6CA 4EWND 2CWNA 2C71A 3VD5A 4AX6A 2HBXA 1MRQA 2FMNA 2XH0A 3SCQA 5CBBA 3AFBA 2YL9A 1WKFA 1Q2SA 4P7QA 3B8UA 3QMSA 3UA3A 3G1AA 1TR1A 5AC6A 1EBGA 1KV8A 3VIPA 1SZFA 2BHZA 4MWAE 4LS1A 1U5VA 5C2CA 2Q01A 4GZIA 2WPBA 1AJ0A 3LS9A 2EAWA 4BCEA 2QDDA 1P0DA 3MP4A 4MAZA 4AZ7A 3M7SA 1O5KA 4PTXA 4QEEA 1B3YA 2G41A 1LQ2A 1L8PA 2BG5A 4H2CA 3W7CA 2EPMX 1TIWA 3S42A 2X0SA 5I02A 2PTXA 3OQEA 4LB4A 4LS2A 3GG8A 2GQ3A 4AF0B 1PL9A 5DXXA 4C6NA 4DN1A 5CXPA 4FNRA 2TSYA 2YOCA 2W61A 4CVWA 5J04A 4WSHA 4IMDA 1UIPA 2V3GA 2NSXA 3G24A 5D9OA 2YSWA 1GVYA 1B9BA 1J4EA 2GVLA 3LG3A 1TTJA 1HVQA 4M7SA 1CIUA 3G1XA 1SFTA 2BOEX 4NX5A 4PR4A 3EPOA 4UNLA 4Q7NA 4ZSUA 5D2YA 4FMVA 2B31A 1B54A 5MKGA 1XG4A 4TTGA 2YLAA 3C3UA 1D8CA 4HT3A 3R43A 1M03A 3GAYA 4FNPA 3GVQA 4G7EB 5D33A 2QJMA 1LBFA 2FGLA 2ZWZA 1KLYA 1V3IA 3R89A 1TV7A 4MJMA 3L0GA 2ACSA 1PYFA 1QOXA 4UFMA 2XIJA 1YX1A 4XIMA 4K38A 5CH9A 4UQEA 3ZT5A 1OIMA 2FJKA 5C2XA 3UFYA 3HB9A 1TV4A 2BXZA 1V0LA 1LT8A 3N2XA 3WEOA 1ISVA 1XLDA 2ISVA 4HP5A 4UR9A 3NZ1A 1VEMA 1NDYA 3DFOA 1NH6A 3FW6A 1US0A 1KFJA 4U2YA 1TZ9A 3QXBA 3LCLA 5FCZA 4B5NA 2QF7A 4K37A 3H2CA 1OY0A 2ZX8A 3UW6A 1AL7A 1SO4A 4HMNA 2GWGA 4HMCA 1SFJA 4MHBA 1JZ2A 1F07A 1RLDA 2I16A 5A6MA 5BOOA 3LSCA 3F2DA 4C6DA 3TQ0A 5E1QA 4AHPA 2FHCA 1H7PA 1XISA 4AWEA 4HA1A 3L5LA 3E2SA 3FA4A 3O2LA 4JX5A 3GXPA 3VI2A 8XIAA 4LCSA 5REQA 1LCOA 3CL8A 4AXKA 2WM1A 1V0KA 1DQUA 1JCMP 4CNTA 4OOZA 3WNOA 2DZTA 1E56A 3SEPA 1KLZA 1A5MC 4C6IA 1VF8A 4BA0A 3JRKA 2G3IA 3RIKA 4BI6A 3CZLA 1EGZA 5D37A 2DVUA 1QCWA 4QIUA 3VU2A 2NWRA 3AMGA 3RHGA 2NLIA 4U28A 2F2KA 3OHIA 3GBDA 4DUXA 4GYJA 5CGTA 2IKIA 5LIXX 1XICA 3N34A 1V4YA 3UYCA 2J7EA 4MLJA 3V0TA 1G0CA 3BLEA 1YPIA 1NDZA 1E1CB 3RLGA 3OOQA 1W5MA 4QG8A 6TAAA 1DJGA 3MO7A 2UY5A 3ALGA 4XSMA 1D3CA 1LQ0A 1RCOB 2B7PA 4FO4A 4H3DA 3TVAA 3N2MA 4QP0A 2O9PA 4MPKA 4Q7IA 3IGUA 1FWDC 3NGFA 2X1SA 1UD5A 3QYSA 2EPOA 1J11A 2VCBA 4RV8A 3EB3A 1XBVA 3IV3A 3CTLA 5A6AA 1XDLA 1O60A 5DN1A 2GGJA 4XKMA 5HOSA 1MFVA 4JKMA 1XSIA 4AZIA 1HIZA 3PAJA 1R3RA 4Q22A 1YEYA 3NL6A 4IMEA 2AMGA 3TEVA 5A6KA 3WF0A 1FWWA 3H54A 3WCZA 3E6EA 2GDUA 1V3HA 4IG2B 3VNKA 4GI8A 2A6NA 3WMBA 2R9RA 1OGGA 1H7NA 4ZO7A 4XUYA 2YX0A 3B4UA 5A6LA 1XIIA 3T0TA 3TZFA 4PTDA 1QFEA 4S3DA 1XGEA 4H01A 1O68A 4IQJA 1AA1B 1WZLA 3VNIA 3DFNA 5M5DA 4PRWA 1AG1O 2IQ0A 2DSWA 2H8XA 4DXKA 1RJQA 2QCFA 2JQXA 2J66A 4IG2A 4MB3A 2P8CA 3R8RA 1GTEA 2RAGA 4O50A 3W29A 1R9XA 3O3RA 1Y5XA 3GTNA 1W3IA 2I9EA 3PZNA 1JRBA 4CQDA 1FFRA 4ACZA 1ESWA 3DCPA 3CUFA 1YDVA 3PBUA 5I79A 4GABA 1F4HA 4ZO9A 2G95A 2VT0A 4US6A 3JW7A 2VMFA 3TLQA 1KFBA 1DYSA 4IL0A 2PU0A 4JN8A 1XXXA 2GJXA 2HE5A 2XVKA 1DHPA 1XH0A 4ORIA 3YPIA 4ZB0A 5TQLA 3TNOA 2ZTKA 2REQA 4W93A 1NP2A 3RGTA 1AMKA 4GIEA 3RFAA 3HMCA 4QQ3A 3GU9A 3I7RA 4JIHA 2O9RA 1CXIA 4O57A 3U2ZA 1EBHA 3GNNA 1GJWA 4IMAA 1BXNA 3WJWA 2VZTA 3N04A 4LRTA 3MHUA 1W9DM 2E6YA 1V08A 5LIUX 1K03A 3AIQA 3K5XA 3S0CA 2ZUUA 2QCDA 4J1OA 3ZM8A 3BLPX 3SRHA 4DUOA 4MMWA 5CC3A 1UC5A 2WSKA 4AIUA 4M6UA 4HN8A 3UJFA 4AVNA 4WKHA 3G6LA 2QUNA 1NDVA 1QR7A 4QTGA 1VFOA 4UFKA 3WQ5A 3KOFA 2DFAA 1YNYA 1RAKA 3M0KA 1X1ZA 4I8YA 2ACQA 3C2YA 4KWWA 3Q65A 1J5TA 5HMFA 1TPDA 2WSPA 2NLYA 4YTQA 4F0KA 4AZCA 2JKPA 3K46A 4K8GA 4DJFD 3W6LA 3R0KA 1D3GA 2GQAA 4UTTA 3VMNA 4LAZA 1ZLPA 1P7TB 2POZA 2X16A 4LAOA 2J9YA 4DWDA 3HV9A 4FIQA 4AWTA 4F0SA 2WKGA 4HQVA 3WBWA 4CQBA 2J13A 3NQCA 2G3NA 5T8GA 5JH2A 2OZ3A 1AW2A 2IPGA 4YHEA 4HPHA 1NQKA 3POCA 2YB4A 4XB3A 7CGTA 1W1B1 3MVIA 5DY3A 1XYLA 1OIFA 1IZCA 3BSGA 3PZQA 3H4WA 3AXIA 1PWMA 2XHYA 3QZ6A 3D6NA 3I6EA 3AS2A 1K4GA 2QF8A 1J2BA 1HVXA 4LYRA 1XSJA 5DMMA 2ZA2A 4O10A 3OVRA 3T78A 3OG2A 2X1RA 2XZ7A 2BZNA 1KWGA 5DCBA 3NZQA 4QE1A 2V6AA 5RUBA 4UFHA 3Q45A 2YYTA 4JHZA 1HO4A 3O0KA 4WJ8A 3NQMA 3H2NA 2Y85A 3W27A 1TQJA 4JD4A 3A5FA 4C5YA 4QAIA 1EP1A 3WD1A 2OGJA 3UCQA 4YCOA 4CEUC 3PZMA 3TMLA 3SADA 3PG9A 5A3HA 3NSXA 1CGUA 2CLKA 1VPYA 3TWBA 4JTRA 3VCNA 4NNBA 5D8WA 3CB3A 3EX2A 3UYIA 2ZE0A 4F9JA 1QASA 4MZ8A 1LUCB 2A3AA 3AU6A 3WBEA 4FXJA 1W2PA 5GNZA 3QMTA 3UQNA 4W85A 2PGEA 3VD7A 3VD3A 1VFLA 2X1IA 4O16A 3S9YA 4XG1A 3R25A 1EX5A 3O15A 3WLQA 1OC5A 1GWJA 2RKXA 2P3EA 1OD0A 5BOFA 3RILA 3WNPA 1JXJA 2R8WA 4ZODA 1FH7A 3G1VA 3A4JA 2OX1A 3TNBA 1WOAA 1OZMA 4ZR8A 4F2TA 1BVWA 1G7UA 3S2NA 3BJSA 2HMCA 1VYRA 4XZMX 3PZGA 4GO9A 1IHIA 1VYSX 3TU9A 3UPMA 2VVSA 3MKCA 5FEZA 3BH4A 3QY8A 3CUZA 3G3DA 1XD1A 2IPWA 1QBAA 1MYRA 2V2CA 2OO6A 4OHQA 4PUEA 4ZQPA 2VC5A 3AZSA 2GOUA 5EKYA 5B7ZA 2C13A 1E70M 3U57A 5FACA 5BWAA 3BL3A 1LDCA 3GM8A 3TC7A 2XUCA 3TXZA 1TPUA 1BTMA 3T4CA 4DYKA 4JXCA 3VCCA 2GUUA 4LQ1A 4MKNA 5CPMA 1W1A1 4XKYA 3TW9A 3WFZA 2BY3A 4LANA 1M3UA 1T8XA 3QVQA 4GUIA 3SJNA 4YXGA 3L12A 5FAJA 1GHSA 5EBAA 4PZVA 2ZZ7A 4LUSB 4H6KA 6XIMA 1TV2A 3VDHA 2UV8G 1VFHA 5K9XA 2GGEA 1KWKA 1WBHA 4UQDA 1TRDA 2EG7A 1F8IA 3H2MA 1XX1A 2V5CA 5EFDA 4LAKA 2DY3A 2WKLA 3AIRA 3QYQA 3UERA 3VKCA 1DE5A 4GZEA 2GJXB 2IPJA 1P0NA 4IX2A 4TUFA 2E1WA 3FYPA 4JTCA 2WYSA 4JY8A 2VEPA 4EF9A 4OT7A 1JUEA 3CT7A 1AW1A 1JQXA 3C0QA 4DWSB 4P61A 1NELA 5CZSA 3CWOX 2OGYA 4AWUA 4TTUA 1PWLA 3KZPA 3EDKA 1JI2A 3N2OA 4LAMA 3LCHA 3WLIA 3WQFA 2DUXA 2G3FA 2O7SA 1XYZA 4NY2A 5CGQA 3C2RA 4FLQA 4U3CA 4OBRA 1QO5A 5FIPA 4KFPA 1D3HA 1S5TA 4MDPA 1A47A 4S2CA 2NQLA 3AROA 4HNNA 2NV1A 3QFEA 2OJPA 3TYAA 2BTMA 4EAMA 1FBAA 2QUMA 2PBOA 3N29A 3WQWA 4OV9A 3MSRA 3PBMA 2VR4A 1JCJA 2VC6A 4L7ZA 1AZ2A 3CIWA 4NL1A 1JZ7A 4IPIA 4IT1A 1JPMA 5KZDA 1XBYA 4MWAA 2ZRZA 3L5AA 4M24A 5CQ1A 1WDQA 1V0NA 2W79A 4WJEA 4LYQA 2INFA 3A5VA 3W2MA 5D38A 2FB2A 2QUVA 1L2QA 3W71A 5F7UA 4IIEA 1P4CA 4JL2A 1K8CA 3EMQA 4KT2A 4GG9A 2WVTA 1MRAA 1DJIA 4YYCA 5C7VA 3ITTA 1TX2A 4FK9A 2IPFA 3W02A 3BMWA 5HNUA 4GA8A 2PU1A 1M01A 1EEXA 9RUBA 1R0MA 2O4MA 3W7RA 5A1AA 4DJFC 3CH0A 3TLLA 5I78A 4Z42C 1V6WA 4M6PA 3TSMA 3BLDA 4CCZA 1ZP4A 3BICA 3EZ4A 1XLCA 3NZRA 3EAUA 6REQB 4ZB5A 1AODA 1UUQA 3FKRA 3PTQA 5F1UA 2FZDA 4HYVA 3QGKC 4ZQRA 4CU7A 5FL0A 4Y7EA 4XBSA 3MUIA 4I9TA 4W5ZA 1EQPA 3MSYA 1T99A 1ZBWA 1JDDA 1LF1A 3P14A 2W6RA 1QK2A 1W5QA 1N8IA 1TV5A 4PSRA 1LOQA 1TPWA 3NDYA 3CMGA 3L0KA 2GVYA 2G96A 3LXCA 1EGVA 2WLYA 1OT1A 5A2AA 3CPRA 3R4IA 3TP4A 5J5RA 3CV1A 1OYAA 4XVEA 1PIFA 1E71M 3GIYA 4Y9OA 1D2KA 1O1ZA 5HNNA 3WLTA 2PSNA 4FXSA 2A3CA 3OZOA 3F4DA 2ALRA 1HJXA 4GQBA 3UJEA 3ITOA 2IQDA 4BK9A 4AEFA 3SB0A 4R7OA 3HM7A 4KF1A 3H70A 4HCLA 4CD5A 3F4CA 1Q2RA 3NCOA 3KTCA 4PL2A 4UOJA 1XLBA 3BG9A 4IFKA 2J6VA 4Y96A 3ZR4A 4B5SA 4L61A 1K9EA 3WF4A 3MKVA 3IS4A 4PODA 2VHLA 3LGEA 3G77A 2NVCA 1J2WA 1U2YA 1JD7A 3HOJA 3TW7A 1ZSXA 2ISSA 7REQB 5I3FA 3L67A 3ARRA 4IM4A 3LY0A 1QJWA 4DZHA 3ZIZA 1UBSA 3IACA 4H00A 3UY7A 3I68A 2PEVA 1F3WA 3RF9A 1ALDA 1OGBA 1FRBA 3EB4A 8RUCA 4GVFA 1PKYA 3LBCA 4IFRA 2OG9A 3O1NA 5EU9A 4N42A 4N2YA 1B3XA 5CG7A 3BCFA 3WD4A 1VBRA 3A21A 5DLCA 1DIEA 4C6QA 1JF5A 4PCPA 4C6KA 3W81A 3LI0A 4J3TA 3DG3A 3E49A 1XIFA 2DJLA 4MLRA 1QVBA 1O7AA 2Y70A 1EF3A 1GYNA 2PDHA 1TYGA 3DUGA 3WJZA 1XC4A 3GSMA 3EX3A 2YW4A 3RM4A 4ZVJA 3SM0A 1GEHA 4UNIA 2PDNA 3TTOA 4JTTA 4WY0B 3S9IA 2OPJA 3KVMA 4AD4A 4CGTA 5BU6A 2VZSA 4QITA 3TAOA 2HDJA 4IGSA 3TJIA 4W89A 3VGDA 3LNPA 2Y7DA 4JS3A 2J7BA 1JFXA 3G1SA 1V3MA 4MVAA 4LV4A 4DF0A 1HNYA 4YVXA 1HKVA 2Y61A 3NEHA 4GFIA 3KS5A 3N17A 2OLHA 3LCIA 4LYKA 1J6OA 4O1DA 3VK5A 4B15A 1W1PA 3BC9A 3PBWA 3BG3A 3LMYA 3LLDA 4U33A 5DRCA 3LZ5A 4DLMA 2OLSA 1J12A 1O12A 3ITGA 1QNPA 3T09A 2GJPA 4M19A 3TCEA 2YIHA 4JFVA 3UWWA 2ZUVA 2ZIDA 1HJUA 1TJPA 5HQMA 1VENA 2VR2A 1W3TA 3WLKX 1CGYA 4S23A 1G7VA 1QWKA 4NSBA 2HNHA 4XQ6A 9XIAA 4K39A 2QKFA 3LHWA 4PTNA 1WE5A 4LTSA 4GIYA 4HTYA 4TMCA 1HT6A 4JTDA 5LNRA 5F4SA 3W7DA 4ILSA 1XRTA 4EVZA 1F3TA 4JFTA 3AHXA 2WHLA 4D6CA 5BNKA 2XIIA 5FAGA 2ALDA 1HG3A 3GYCA 3MP5A 1H7WA 2FPTA 2VD9A 1GKQA 2YJQA 1TCDA 3GTHA 5H8PA 1E72M 2DSUA 2E4TA 2EG6A 2I14A 1E0WA 1ITUA 1R6WA 4WF7A 4NHVA 4HNCA 3A64A 3OLDA 1F74A 3MMDA 4CLMA 5A8OA 3NO1A 3URNA 5HDRA 1X6NA 3DAQA 3P2VA 4M80A 5TNVA 1J79A 1PTAA 3Q94A 3GDKA 2JBMA 2X7WA 1B1YA 3EDDA 3AYTA 1C7TA 3VUPA 4PTWA 4AISA 3QKEA 4GQRA 1TUXA 2PDWA 1R9YA 4O0QA 3XIMA 1GZGA 4Q33A 3U0HA 4HGXA 2VYOA 3BCDA 3WH8A 2C6QA 1IZJA 4YTRA 3LQLA 2AKZA 1NF0A 1VFUA 1A5LC 3QR3A 1ZENA 1FWRA 1LOSA 3TX9A 4ZOCA 3SUWA 2IW0A 5CPTA 5TIMA 4YJ5A 4AHOA 2WC4A 4G7FA 4OZOA 2G50A 3W4RA 4UOZA 5D2TA 1JNDA 5TD4A 1EPXA 2WKJA 2E67A 3N2TA 1UD4A 1GVFA 3NOYA 5M03A 3IARA 1A5KC 5CSRA 1HJWA 2GGIA 4YCPA 2OKOA 1CGXA 1TWIA 3GHTA 3GW3A 5CKSA 3RLVA 1Y8BA 3ZVHA 2OZ8A 3KW3A 3ZO9A 3EEGA 4MWAC 1JZ4A 2ZZ6A 5REQB 5AKQA 3OGVA 1WDPA 1EH9A 2F7FA 5AHNA 2PB1A 3TN4A 4HPGA 1VB9A 2BB0A 1PHWA 4ADTA 3APTA 3CT2A 3SBFA 3T40A 3PANA 4UTFA 3QW4B 4KERA 3WSUA 4OUEA 2I57A 4M51A 1NARA 4QQUA 2G37A 5D09A 2OYLA 4GC3A 2CHRA 4ICMA 1IEIA 3OTRA 2JGYA 3GDLA 3NGJA 5CEWA 4BQ5A 4DELA 3BV4A 4F48A 4D1IA 1TSIA 1BSLA 4DWSA 5BOEA 1I2PA 4AW7A 1LL6A 4UOQA 4HZ7A 4C6JA 4E2VA 5BMWA 2FHFA 1I2QA 3N6HA 5SWUA 3R0UA 4C7FA 5K4XA 1DL3A 1QHPA 4XK2A 1NTHA 3GZ3A 3DFHA 2ZFAA 4JZ5A 4LSBA 5A5WA 4NU7A 2KZHA 3DI0A 2OU4A 1S2VA 3K8MA 1E4NA 1YQ2A 4H7VA 3PUDA 3SY1A 1UASA 3DGBA 3M0HA 7TAAA 3UNDA 1UWSA 2WHKA 2FTPA 3NQBA 1LWHA 1YDYA 4LBSA 4HHPA 2PP3A 1DP0A 4Q4MA 3MPGA 4OE7A 1B5TA 2QXWA 5AC7A 2PA6A 3IAPA 4D6EA 3CQIA 2NQJA 1JJKA 3OPSA 3RO8A 1PKMA 2DUZA 4F3HA 3BQ5A 2Q3OA 4DX3A 2GLKA 3VFCA 4NVTA 2DGAA 1PZ2A 3MT1A 1S39A 2FZ9A 3GG0A 1BKHA 5HULA 3QV8A 1BF6A 3PJXA 1DPMA 2PTWA 2ZUWA 4LALA 1S2CA 4RDWA 3TJXA 4MB5A 5CGMA 3E5BA 3W07A 3RX3A 2ZQ0A 2FVLA 3CWNA 1TELA 3N4AA 4GLEA 5KETA 1MXDA 1ONRA 2PURA 1I75A 2W27A 7ENLA 1TVPA 1H1YA 2Z00A 2D0HA 3WDQA 1EQCA 3DH7A 1ZHAA 1XRVA 1XLKA 4LCRA 1O5RA 5BRQA 3CYVA 1FTXA 3B0XA 4XZWA 5DY2A 2AGTA 1XRFA 5AYZA 4B5VA 5F2MA 1A50A 4EACA 1H0IA 5H8UA 1IT7A 5LA2A 4PN2A 1W9UA 4MFEA 2P5NA 1EJSC 3CQKA 2J24A 4GC4A 4N9EA 3WENA 3MVTA 3SW6A 3UZXA 3HGOA 3B8TA 4HOZA 3P80A 1XSKA 1EHAA 4H4IA 1C91A 2B4GA 2B81A 4GVGA 3O6DA 1KGUA 3S2LA 2ABBA 2D1ZA 4QSFA 3UWZA 4TU1A 1LL4A 2QCDB 2GK1B 4M3PA 4RV3A 3NA8A 2VENA 1W2VA 3CUXA 3MDWA 4LPCA 4L9XA 4TX8A 4NILA 2QDHA 1UR2A 2RJHA 2GJLA 3M5XA 4DNHA 1N82A 5FEWA 4HMEA 1DIOA 1NU5A 3A4XA 3HBLA 1X96A 3SUTA 1EJUC 3W70A 4PBEA 2XH4A 4HSOA 5BXPA 8CGTA 2XH7A 4Y9PA 3QRHA 3WQ4A 3O7UA 4NZJA 1P6CA 2VVNA 3APYA 2NUXA 5I3HA 3RRAA 4MKVA 4WGXA 4C5ZA 3G5EA 2TAAA 3CS2A 1EJVC 2CBUA 2IUZA 1C3FA 4LJ3A 4XTIA 1NWRA 3IGSA 3VCRA 1K1DA 1ONEA 3PWIA 1GVRA 4Q32A 2VRQA 4DJDA 3FN9A 4TV6A 4EPBC 5IBXC 4BI5A 1JL8A 3VILA 1KXVA 2FZMA 3RXZA 3MJMA 1A5NC 4Q8UA 5AVHA 4AIBA 3AYSA 5LNUA 4HPXA 2VELA 1EXBA 4NX0A 3MSGA 1IE7C 3CLWA 4RCXA 1JPIA 1E1CA 2EJAA 2J78A 3NPWA 1LQAA 2DSKA 2J9ZA 3NDZA 3EKLA 4TXEA 1VBJA 1R3QA 3W9ZA 1UP3A 1S5NA 3SSJA 4KQNA 3LENA 1W37A 1RD5A 1S1RA 3GNOA 4F0MA 1MVYA 3PPHA 5AZ0A 1DKWA 1EGMA 3WO8A 1IEQA 4D1JA 3TE9A 1QATA 2O92A 4LBUA 1LBMA 3N3TA 2BXYA 2XN0A 4Z2HA 3W88A 3F03K 2V5BA 1WPCA 1P0EA 2WVVA 2RJGA 1W3KA 3PFRA 1F9CA 1UWUA 1DJYA 1E0TA 1XGDA 1TPFA 1ECQA 1X6LA 2W67A 2XISA 2J8TA 4IQLA 3URQA 4QS5A 3VDAA 4F79A 5AY7A 5B80A 3VKBA 1EUNA 1Z42A 3PF3A 4K6AA 3C2OA 1UB3A 3BLLA 3QQWA 4ROPA 4AVOA 3STEA 1PCWA 2BOGX 3MBFA 1HL2A 4OBSA 3UGVA 4JTKA 4M7TA 2D69A 5GJMA 5CJ5A 1ZAIA 4B4FA 1WBJA 4LX4A 1QHOA 4QCFA 2X40A 1RA5A 5JIWA 4YWSA 4ZOEA 1GUVA 3L4TA 4L80A 1LYXA 3G1RA 2V38A 1WX0A 3O6CA 2ZXDA 3EYPA 2QAPA 2HWGA 2QCCA 3C86A 4B9ZA 2A3EA 4KS0A 3WDJA 1BTCA 4Z1DA 3UZWA 2FTYA 4W87A 4JYFA 2HVMA 4JL1A 4JFWA 3CU2A 2DPEA 2DEPA 1KCXA 2R24A 3BAKA 4D8AA 1BG4A 1BXCA 1EZWA 1TWWA 2P8BA 1KRAC 2Y89A 3LHVA 4M81A 3MY9A 5I77A 2WO5A 4HTBA 1A0DA 3URAA 4JIRA 3PZOA 2Z28A 3M47A 2FGZA 4XAFA 4IQEA 4CQAA 1T0OA 4HU4A 4MNLA 4R88A 3WQEA 2WWCA 1VLIA 4IIDA 2FTWA 5AOUA 2J62A 1JYNA 2QVHA 1ZBKA 3UEQA 1CLKA 1HJSA 1W5PA 3USBA 3FJ4A 2ZRUA 2QJIA 4FLRA 4H19A 3SURA 4WSJA 3MV01 1E5NA 1BG9A 1S2UA 4UTWA 2WXDM 6PTDA 3ES7A 4AD2A 3PPCA 4CUCA 1EEPA 2ADAA 3ITLA 1NDWA 3LQGA 4GXMA 4Z2KA 3BOXA 3N2CA 1ADOA 5KZEA 1ODZA 3AXXA 1FWIC 3EOOA 1J01A 5KINA 4O54A 3F7JA 4AF0A 1BRLA 3AMDA 3P0XA 1QMLA 4UFJA 3T07A 1AW5A 1P7TA 3R0DA 3WDHA 1P43A 3HQPA 5I7GA 3FXYA 2Z29A 3I4KA 2Y4SA 4EXQA 1JYVA 4K2SA 4HN4A 5F4XA 3I6TA 1ZJIA 1KFLA 2CXEA 2PF0A 1PBGA 3L2LA 3LMZA 4IMFA 1O6IA 3B40A 4KGLA 3UR7A 3EWUA 3VYLA 4IPPA 3RU6A 1FQ0A 2ZC8A 3HZ3A 4NJJA 4G9PA 1JXKA 2ZZ1A 3N19B 1IXQA 3R13A 4X0NA 1EO7A 3GTIA 5D2WA 4JBRA 4UFLA 3HJEA 4C6CA 3HPAA 2QCMA 5DEZA 4QJ3B 2BVWA 3PZIA 2HTMA 4FOJA 4FR1A 1FX6A 3C5QA 1U1UA 3VA8A 3SDOA 1FCBA 4HK7A 3K8KA 5DQPA 1QBBA 1VCVA 2G3JA 2WSRA 4X2RA 5F4WA 3R2GA 4UTUA 3DFPA 4DBDA 1K6AA 1C29A 4N4QA 3TQKA 2ZDSA 3QF0A 4NRSA 4A35A 1RUSA 3NZPA 4KWVA 2Q09A 4XO6A 4ZE5A 3WF1A 4A8IA 2P53A 5AN7A 4JHMA 5HJYA 2TMDA 4CD4A 1UH4A 5E70A 2JFEX 3CHVA 3EPNA 4E4PA 3KM8A 4BR1A 3CV7A 3FVMA 3AUJA 4O1CA 2JK2A 3POHA 2VFEA 4HK5A 2WZTA 2HJPA 5HA7A 3W2KA 2ZX5A 2NQHA 4TO8A 2P88A 4AC1X 4M1RA 1M1BA 4JR5A 3DC8A 2UY2A 3TSBA 3VDBA 4U4MA 1VRXA 3MUZ1 1Z32X 1CGWA 3L4WA 1QOQA 1S5MA 4P8XA 1NVMA 3THQA 1QPRA 1EIBA 4ERAA 1TTPA 3MQTA 2OWXA 2RGMA 5PTDA 2P10A 4Y9NA 2DH3A 4W8BA 2YGYA 2UZ9A 3W7GA 3R11A 1C9WA 2EBNA 2ZICA 3DN5A 3SQMA 3UD6A 1WXJA 1KTCA 4I7VA 1QW7A 2VR5A 3QHOA 2VGIA 5A6TC 2INEA 4IOTA 3S1GA 2JKAA 5HBFA 4UR8A 3L4YA 3QPEA 5CBJA 1A4MA 3EA1A 1EOKA 2DZWA 2F84A 1W3NA 4PB4A 3UWUA 3OGSA 1SZGA 4L4LA 3USZA 1J0IA 1WA3A 1KM0A 3KRSA 1KC7A 2XFYA 5DX7A 3VNDA 4YU1A 1GEQA 1F2JA 4MIMA 1EWDA 1B3ZA 2XU2A 1S46A 3H2EA 3W26A 4BY3A 2C19A 3CPGA 2A7RA 4IWWA 4YPJA 3QQ0A 3UZZA 4B16A 4DJDD 2VZOA 3THCA 1EDTA 1QI3A 1JUBA 2ZRWA 2Z1XA 4KBXA 1Q66A 1K70A 1XR2A 4MWAB 5AVNA 3WLLA 3G22A 5DXYA 2OEMA 1ITCA 4ZL1A 4KIRA 1XIGA 4JOMA 4TVDA 4GIAA 3MDUA 2QHAA 1SSDA 1QPNA 3ID7A 4Y6GA 3RPDA 2XINA 3B0VC 4E2BA 1RQBA 1KBIA 1TE1A 3GAKA 4GACA 2I1OA 1GQIA 4E38A 2CZDA 1OCQA 1IIGA 1KFKA 5GNXA 4NJHA 1XBXA 4PMUA 5ABGA 2G3MA 1P1XA 3VIGA 1DJQA 4N02A 4YYFA 4K8EA 4YTTA 3DBPA 4UFIA 1BXBA 3GR4A 2FFCA 3OZMA 3GRIA 5D9NA 4DAIA 1BQCA 3UG8A 2IMRA 1HTIA 2E7FA 1WDWA 1FHLA 1P5BA 4Q4PA 1EWEA 1C8XA 1EP3A 8TIMA 1THFD 4ROQA 4IPNB 3CIXA 4BZYA 4PYSA 2GSJA 3NVDA 4PMNA 5D02A 4O28A 3ORWA 2V5KA 1FWGC 3K2GA 4DHGA 4C91A 6ENLA 5MHBA 1KBLA 1YNPA 5I3KA 4A05A 4KH2A 1SM9A 2R1MA 3WLPA 2GYIA 1H41A 4ATWA 4PEKA 4JDBA 4WY0F 1UG6A 1N7KA 5FEXA 3PBGA 3RG6A 1E0VA 2Q8LA 1EJXC 4WDWA 4ECLA 2OYMA 4GJ1A 1VZWA 1HFBA 3SSZA 5BRBA 3GNXA 4A3HA 3W3OA 3RMEA 4ADSA 4GVIA 3WH9A 1H2JA 3BAJA 1CXEA 3UNTA 3GC5A 3SCWA 2ZX6A 2P0OA 1RD6A 2CLLA 2BV9A 4JIIX 5H8MA 3ZT7A 4H9MA 4NIRA 1QTWA 3KHJA 2ZA1A 3CQ0A 3N14A 2J7DA 4YWIA 5FESA 5AC8A 5EYWA 4AZBA 2A79A 1E55A 3LU2A 4P7OA 3SAZA 2A6LA 5FKYA 3LPGA 5AC5A 2PAJA 2O7QA 4QX4A 3EX4A 3VIOA 1SGJA 4GNVA 2QPUA 3ZJKA 2ODOA 2ZRYA 3C2EA 4MZ1A 4AY7A 3AIEA 3NPUA 1G69A 1RVGA 3JZUA 1H1ZA 1J6PA 1FOBA 5FF7A 3WMLA 3LZ3A 2OLAA 1V5XA 3GVVA 3V3WA 1SFSA 1ISWA 1RBLA 4D8ZA 5CPLA 1TFVA 1ME8A 5U7SA 2C0AA 1TKKA 3NAVA 5CSYA 5DELA 2DV0A 4B3LA 4MYAA 5DBTA 3CZEA 6A3HA 3EGJA 2PLJA 1Q7MA 3CHFA 4WOQA 2TPSA 5H2ZA 5IHSA 3GO2A 1GOWA 4O1AA 4JFSA 1UQZA 2NXGA 5CC5A 1XLAA 1JCXA 1QI2A 2E5BA 3FVDA 1KQYA 4WD0A 2G5WA 3BGGA 1E6SM 2R82A 3AS1A 3DFTA 5HXMA 2KAUC 3UVAA 2R94A 1UA7A 4EPKA 4LUTB 1H50A 3T2PA 4NI3A 2D22A 4WR3A 5EMMA 4OVXA 1R87A 3M7WA 1W17A 3WLRA 2ONEA 1FCVA 2Y24A 5U4NA 2XDFA 3DHDA 1BVZA 1DORA 2NQ5A 1VD6A 3BPWA 2PBGA 4H6RA 4WKAA 3TYZA 2QIIA 3S6TA 2Y7EA 4QROA 1EL3A 2F2HA 4HOXA 1R3WA 2DIEA 4LCQA 1CI1A 3AI0A 3LXAA 3N18A 1IT8A 1TWDA 3NO3A 3SY8A 1QT1A 4C1KA 5FJIA 3OVGA 4DF2A 1W3JA 4I7UA 1V7YA 2DVXA 3SN4A 1CBGA 1Q8JA 2NX3A 2Z1BA 4GI4A 1DTNA 3CJPA 5I6SA 4KRUA 1KM6A 2ESCA 4HOWA 3EA3A 2WK2A 4BF5A 2V9DA 3NSNA 1JZ5A 2DDXA 2WJZA 2EXOA 5JU6A 5KSWA 4ENLA 1PDZA 3OIHA 3BLOA 2DZPA 4Z2JA 3VIIA 1ZPTA 2E25A 3ABZA 4GZJA 1VHNA 5FD0A 1S38A 1JCYA 4EKJA 5C0QA 3GDRA 4UXDA 3PJUA 5ECVA 3TN6A 2O9OA 1CECA 3L2IA 5D9MA 4WRHA 5BROA 2AL2A 4MZYA 4PC8A 4RXFA 3ZMRA 1SZRA 5HAOA 3W2LA 2E77A 1E9LA 3RN6A 3JVAA 4QJ1A 1UR8A 3T8LA 1X38A 3AU2A 2Q8XA 3A23A 2CZVA 3ZT6A 1P0BA 2DT3A 1MQPA 3CMFA 3QV6A 5EL1A 3EWXA 2W3ZA 1WAWA 1G94A 4R34A 8A3HA 1MW0A 1E0XA 3EXSA 1ICQA 3CAQA 3EWCA 4REQA 5C9XA 1TX0A 4F2BA 3H12A 2BY1A 2VRKA 2YL6A 3H53A 1H62A 3H55A 3O9NA 3GTFA 3ZWSA 4QE5A 3IUIA 4LS0A 1EKOA 5G1MA 4HNTA 3LPOA 3UP8A 3QJAA 4ASTA 3AJ7A 1E6XM 3H7VA 4OBTA 1LUCA 1CPUA 5HNRA 1EJRC 3W1QA 1UMLA 4QJ4B 1VEPA 2V2HA 1IIHA 2E68A 1KB3A 5AHFA 3EMCA 3NQ2A 1PX3A 4Y9AA 1OB0A 1U83A 4UWMA 4GQQA 2Q71A 1TMQA 1MEIA 2VX4A 3WQ6A 1LLZA 3WZ0E 4D9PA 5LNWA 3M1ZA 2V82A 4DYJA 3WUGA 3ARTA 3ME3A 4MB4A 3HQOA 1KTNA 1PDYA 3TOPA 4HVXA 1RK6A 4H41A 1EB3A 2I56A 1GKRA 2V8ZA 1B4KA 3QOKA 1U1JA 4FNSA 4FF7A 4JTUA 4S1FA 1SJCA 4CN1A 3LI1A 4XAGA 1XH2A 5A69A 3KOXA 4IHCA 3GTXA 3PP7A 4IXXA 1J18A 3MZ2A 4AU0A 2P50A 1BAGA 4N9DA 1W31A 4D6DA 4JTLA 1HKJA 4JIQA 3M0LA 2A7NA 3A4WA 1VR6A 1ZP3A 4AVFA 3VZZA 4Q8PA 4ZZ9A 4MY1A 4WVXA 2C79A 4NAFB 5HATA 3M6YA 3WN6A 3FY1A 1HL9A 3KLLA 3QPYA 1OG0A 2E28A 5A2CA 1A5UA 4ZOBA 5AYIA 2YDQA 5ABFB 5JUVA 1Q6OA 1XLLA 3D47A 4H04A 1QPQA 3MZNA 3BGJA 3OIXA 1Y5VA 4KFNA 4RL3A 4C6MA 5CLTA 4MAVA 2VX5A 1I2NA 4WDUA 1H60A 4E4FA 3WH5A 2NXIA 1Q6GA 3IRDA 3OZPA 2C1IA 4AEOA 2BGNE 2JIEA 1HJQA 4KESA 4K36A 4B4HA 3KBVA 3FK4A 2A5HA 4LYPA 3NG3A 4NAFA 3IAQA 3BV7A 2NUWA 3WLNA 1R3VA 3UU0A 1K7FA 1TMLA 4AH7A 1ICSA 1RCXB 3GC4A 3VIJA 1ZU8A 2F6UA 4OECA 4DVOA 4S3GA 7TIMA 1EC9A 5I3GA 1NF7A 1DJNA 1EXPA 1Q45A 2RHGA 4UUIA 1MSSA 2FB3A 3NVTA 3AHZA 1C9DA 2D2OA 1UD3A 3BAXA 3UR2A 1TA3A 1F3XA 2CERA 1CWYA 3WQDA 2ACUA 4FOKA 1SMDA 3KDOA 1PAMA 1DJXA 2C16A 1RALA 1GORA 3VMOA 3VABA 4IPLA 3KTXA 3S5ZA 3O63A 3T4WA 4RZ5A 2OT0A 3IGHX 2QT3A 3GNRA 4HCDA 5FSDC 4FX6M 2R1NA 3B06A 4Z17A 4A4AA 2A0NA 3RNDA 2C1HA 3M9YA 3UBPC 4YNGA 3T0DA 5HUOA 5HWMA 1Q6LA 3SGZA 1UWRA 3E2QA 4U31A 1X6UA 3KL3A 4DO5A 3W7QA 3F4VA 4NQ1A 1SYTA 4CCEA 1C7SA 3PZVA 4DPQA 3KL0A 4PH6A 1HX0A 1XIJA 2BOFX 5AHLA 4RW3A 3NXFA 3BLKA 3B8IA 3TTEA 4Q8TA 3FFSA 1WP6A 4QGCA 1KA9F 4M56A 3ATYA 3GBEA 4DUVA 1JZ6A 4G1KA 4HSHA 4OV4A 3E5PA 1SJDA 1KXTA 5J5DA 1QU4A 2P76A 4DXXA 1J10A 1NIUA 5FOOA 3HGSA 2PODA 5CZJA 1XJBA 3LB0A 4UMBA 1A3WA 4W8AA 3PBVA 4H9TA 2VDHA 2GJNA 1O66A 4WK9A 1EJ7L 5C7HA 2Z24A 4RK8A 4GO8A 5JBDA 3L0NA 2IKJA 3KBNA 2V63A 5FSEC 4LNYA 2JEQA 2CLEA 3BARA 3L9CA 3B0YA 3FSTA 3RCMA 3SUSA 1OX5A 2PRMA 1UR4A 1I9CB 4TR9A 4NYUA 5HMSA 3B97A 3QLDA 5ABHA 1PZ3A 4QDWA 1ZJAA 2VKZG 3W83A 2XVLA 3PSVA 2GSHA 4V2XA 1J93A 1CDGA 3B3DA 3RX4A 3GXNA 3WBAA 2F6XA 5I2UA 1B31A 3A12A 2YW3A 1E9ZB 1Y5WA 3F4NA 1SO3A 1XH1A 3KWSA 2HCVA 4INFA 4Q8VA 2CC0A 1EJWC 3VAVA 1GT8A 3NQGA 3KOZA 4PGLA 2Y7GA 1MW3A 1I2RA 1RY8A 1D9EA 2QPSA 3CEPA 1BQGA 2FVMA 3V0UA 4O53A 4HBKA 4R27A 3WLSA 1S3TC 2EEXA 3NM1A 2YFOA 4EK7A 2PFHA 1ZBCA 4NZ5A 3JU2A 2RFGA 3P7YA 4FPSA 2FZBA 4DWSC 2ZYFA 3UWQA 1XYCA 3MCOA 1UP0A 3N9KA 3HFTA 3M0ZA 2WSQA 3MBDA 1E4LA 3ICJA 4D72A 4GISA 1VEOA 1QW8A 4JTIA 4GH3A 1GCYA 2YA2A 4UTKA 4S3CA 1BHGA 1LLOA 3IV8A 2QGYA 2QUUA 4S3EA 1KCKA 3TC3A 3RMJA 1GPWA 3VUSA 3CQJA 3AZTA 4R9XA 4PL1A 1JVNA 1GG0A 2PDCA 3QSTA 1SPQA 5D4YA 1KBJA 3ANYA 1U33A 3VX1A 2WMIA 5BCAA 4L9YA 3WNMA 1EYEA 5GJPA 2OZ0A 4KEZA 2YXXA 3ZSSA 4GRSA 4CEXC 3J7HA 3ARYA 3IGXA 5A6JA 3HMJG 3M41A 5FI8A 1V3LA 4Z2LA 1L6GA 1DBTA 1EC8A 3W75A 3K4DA 4H7ZA 3LBOA 1FVPA 3EPMA 3ABOA 2J7CA 3FJNA 4BQ2A 3BW2A 1WZKA 2PCQA 2I7GA 4DXVA 3E74A 3LM3A 1TJ1A 4JTHA 1V6TA 4IJCA 3HQNA 1CT5A 3U48A 2QJGA 3AALA 1KM4A 1KKRA 2ICSA 2AQVA 2E3ZA 2VEGA 1PEZA 2RDTA 4C6FA 1FWNA 2G4FA 4MJZA 3VDGA 3CL7A 4ALDA 3CHDA 1QUMA 3HQ1A 2A3BA 4S38A 3CYJA 1B57A 2V5JA 3T81A 3WLOA 4XX6A 4HNVA 1V51A 3UG4A 2IXUA 4AIOA 3VC6A 2J8GA 3KP0A 1Z6KA 1CX9A 1NY1A 3FSUA 3VIFA 3QN3A 1FXPA 4ORMA 2ZXBA 3SRDA 1BWVA 2PS2A 1MEHA 4IICA 1OFDA 2DIJA 4KCUA 3CUHA 1PS9A 2VFHA 4JNYA 4DM1A 5XIAA 1TJRA 3PM6A 3DHFA 1E6ZA 1XYBA 3LCWA 3SZ8A 1E3ZA 1I0BA 2WZHA 3NOEA 2VL4A 1E9YB 1OEPA 3FGCA 1A49A 2CEQA 2VP8A 2DW6A 1EA9C 1JAKA 2GK1A 4JKLA 2DJXA 4DF1A 4U2ZA 2PE4A 3SQLA 3QFWA 2XJ7A 2PP0A 5HR7A 2UY4A 3C2FA 3E3HA 4LNCA 1UPMB 5EBUA 1A5CA 2YDAA 4GJJA 2C1GA 4QAWA 3W1XA 5C71A 2WJEA 3SCRA 3ARQA 2OSYA 5H1WA 5HINA 3GK0A 1DE6A 2C91A 1M6JA 4H8VA 2D24A 2R14A 3TR9A 4F0HA 4O1BA 2Z0IA 1VPQA 4LOCA 3GDMA 2HXUA 5DMNA 1KXQA 3MUAA 2VZVA 1GTHA 4HZ6A 4HZMA 4LXFA 4LC8A 4JKKA 5JH1A 1SMAA 1YDNA 1R3SA 2A3HA 3P6LA 4B3KA 4FP1A 2WVUA 3KCOA 1CW2A 2DQXA 1Q85A 4GXPA 2OQYA 5DANA 3CK5A 2ZOXA 3KEHA 1QPOA 1KRMA 1N55A 1VP5A 1BYBA 4V1YA 2VOTA 1CXKA 3FHQA 1I8JA 3HTWA 4WY0A 4N9CA 1WZMA 5D05A 3A3WA 2EPKX 1K9FA 1VLWA 4GFSA 3DKLA 1PPIA 4XBKA 5AYBA 1NJJA 1VJSA 1E1EA 1JGIA 3SCOA 3P84A 1R9ZA 4H8UA 4RE3A 1BYAA 2BHYA 3ZR5A 4HMDA 2NT1A 3RUBL 3W22A 4EE9A 5I00A 4F2UA 2D0GA 3CLMA 5A8GA 4E8CA 4G8TA 3MYOA 3U2CA 2RGLA 1D7KA 5G1TA 1D7FA 4GZ7A 5FJUA 1XLHA 4RNHA 4P8WA 3H2AA 4PMVA 3C6CA 3STCA 4RNJA 4DZAA 3S1VA 2G8ZA 3BE7A 4X22A 4BHYA 3AXHA 3W1RA 3AXMA 5HJXA 1A0EA 3BQ6A 2WMJA 2R1LA 4WX2A 2H9AA 1OX6A 3VOJA 3AS3A 4DJED 4NP7A 4XZBA 4KIEA 2DP3A 3W1TA 1QWGA 3LHZA 3AIBA 4RNIA 4QEHA 3HV8A 5DO8A 1GQKA 2GUYA 3ONCA 2FHBA 4KGJA 4PSPA 1XYMA 3PNZA 1LBLA 4LF2A 3CZ8A 4NXKA 3GC2A 2X0YA 3HPXA 4QLJA 1AH4A 5EMYA 4OFCA 5C5YA 3QW3A 3DYOA 3MU7A 2YCKX 3B9NA 3N11A 1WAUA 1BWLA 5DF0A 1ZQ5A 3FIGA 1DJWA 4XAPA 2CCRA 2HS6A 2A3LA 3G1YA 4J35A 3AZRA 3UA4A 1GNXA 3E0WA 3EWDA 3TYUA 4IL2A 2HROA 3DDMA 1K9DA 4D6GA 1PTGA 4HJFA 1DQWA 4I6KA 3N25A 4HD5A 4DO6A 1GVQA 5L6UA 1XUZA 2GVJA 3CWHA 4IGHA 2QEZA 4E0CA 5CLWA 3S5YA 3LLXA 1G67A 3ABXA 2YLLA 4LF1A 1B3VA 4LB3A 5BW6A 1UP2A 4PMXA 4Q6JA 2PTYA 5XINA 5MF5A 4HA0A 3HN3A 4IISA 1R2TA 1RJPA 1UZ4A 2E9LA 4AD3A 2V67A 3RCNA 1BFNA 2HRWA 4GOAA 1KQZA 4HJWA 5E0FA 2OWCA 3IUHA 1OX4A 1HKMA 3CO8A 1OG6A 4JTAA 4JYDA 3WK3A 4MNKA 2J7GA 3WJSA 4XAZA 4MADA 1R2RA 5TF0A 3AHYA 1UZ1A 3HFYA 4J3ZA 3TOYA 4LUJA 1CNVA 4W86A 4HU8A 1EA0A 5KEZA 2O0TA 4KFOA 2HS8A 1FFQA 3EX1A 5BXTA 5DMYA 4PBGA 5I24A 2PTDA 5AECA 2WB5A 4J27A 2F8QA 3EX6A 2Z27A 4J3SA 4UQCA 4ML9A 1MO0A 4H9XA 4KPLA 1J0JA 3RPMA 1XI3A 3GWQA 4ATLA 1Q5MA 3DERA 2OMAA 5C2GA 1XYFA 3W1LA 5FJRA 4K8HA 3EOUA 4HA4A 4QLLA 3PB0A 3VIHA 1MNZA 3R6IA 3WD3A 5C70A 4ZOAA 3GU2A 1WUFA 3BURA 3MUCA 1BLIA 3VIKA 2WC3A 1LLWA 1YNQA 5C54A 3PUEA 3NQAA 4CNNA 3R8GA 1BGAA 4JEJA 5HANA 1R7OA 4GY7A 2X1UA 3PY2A 3GY1A 3F5LA 3LBMA 3VOHA 3EWYA 1MWOA 2OVLA 2QAFA 1F3EA 2VGFA 1UD8A 4JQ1A 1E3XA 3LX9A 3AC0A 4XISA 4CNSA 3BVJA 3FS2A 1BVNP 1A3XA 4B91A 4JN6A 1WDRA 2FLIA 3EEZA 4IP5A 1B30A 3W1PA 2WCGA 1H61A 1UZDA 1WKYA 2J7FA 3H23A 3UWEA 3L4XA 3WYZA 3JR2A 1JCLA 5JBFA 3GVRA 3RPTA 2AMXA 1KCLA 4S3JA 2JGQA 3PZTA 4F4RA 3S47A 4DZ5A 1Q6RA 4KWOA 4IGMA 1QNSA 3HJZA 1XRSA 3LOTA 4WHBA 1PSCA 1E6NA 3H24A 3N12A 4JN7A 1AQMA 1OCBA 2INZA 3LERA 1V6UA 1XLGA 3TN5A 1EDGA 1G4TA 2FPYA 3PWAA 3PZ9A 4N6EA 1HGWA 2X30A 1N8FA 1CZ1A 2P3ZA 1GW9A 2V3EA 4AFYA 1MZHA 3L7RA 2ASHA 4OKDA 2PDUA 4F0LA 2PF8A 3ISIX 2O55A 5EA9A 1ITXA 4PB5A 3GG1A 1MI3A 3P93A 1X7FA 3B9OA 2ZXQA 3W25A 4YS1A 2WLZA 3AIUA 4NT0A 3GKFA 4LVGA 3NUKA 1EHNA 2IS7A 3PR2A 5AHIA 1W1YA 5CAKA 4M82A 3VNLA 1OFEA 2QV5A 2YBTA 1MUCA 2DVTA 3G0SA 2CZFA 2BHUA 4GD0A 4DM2A 4JTGA 5D03A 5GQBA 1TG7A 4TQTA 3KAOA 1AQ0A 3O06A 2MANA 1IR1A 1FCQA 4UBPC 1R7AA 4V15A 1C90A 3BG5A 1EF2A 1REQB 1JULA 1N2VA 1YPXA 1XINA 3AUOA 3KZSA 2PC4A 1REQA 4P7RA 1H1NA 3KOWA 1L8NA 3MW7A 2CXGA 4S2BA 1WXZA 3NDOA 1VJIA 1R46A 1W6TA 3TXVA 4PE8A 4DZIA 1EFZA 1T6MA 4GUJA 4JTSA 2GZXA 1RZMA 2RDXA 1JYWA 3STGA 3W01A 4Q7BA 3LUTA 3A9IA 3W1NA 5HPOA 2E9BA 3S4TA 4GJIA 2TYSA 1QPKA 3GLCA 1PVNA 2OR2A 1E0UA 2DZSA 1EIXA 4H1ZA 2Z2AA 4RE0A 1FUYA 1M5WA 4A8LA 4K7VA 4JIEA 4EX4A 1IXNA 4UCFA 4WKFA 3WK0A 4G6CA 2BASA 3FCPA 1OGSA 1BYDA 1QNOA 5G2HA 1Z89A 4ZSTA 1W1ZA 1E40A 3I4EA 3GNPA 1I6NA 4ICCX 1V6YA 3UJSA 2OZTA 1S3HA 3BLFA 3LGGA 5BU9A 3VMPA 2A85A 1FH8A 2CYGA 2PDLA 3O07A 4W7VA 1G4SA 1UA3A 2BMBA 4NZ4A 4E5TA 1Q6DA 3ARUA 1PZ0A 4V1XA 4ZFMA 3G1DA 4N9BA 1IT0A 3FX4A 2BSLA 1SFLA 2ATMA 3D3FA 3MSDA 1SZEA 4TOQA 4DBWA 4PCFA 2J79A 4MGGA 5EMKA 3QHMA 4P8VA 2J9XA 3LDVA 3GVGA 1UQYA 5CJNA 1W0MA 4L56A 2QJHA 1V02E 1TTQA 3MMTA 3ZWTA 3EOSA 1OWQA 3W7MA 3BAWA 1M04A 4US5A 4WIWA 1KM5A 3ANUA 3JS3A 1LRNA 1W9BM 2VQUA 3C52A 1FWHC 2H9AB 1JQVA 3N15A 1L0PA 3VKJA 1CLVA 3RR1A 3ZJ7A 1XG3A 2WCAA 1I1WA 4FAMA 4POCA 4L1WA 2QQ6A 7A3HA 3N2BA 1IEWA 1JG9A 3N6JA 4PTVA 1GZ1A 1W5OA 1RPKA 3V7PA 4CNUA 1AUSL 1Q6EA 1K8ZA 4HZ8A 4OQVA 4DQWA 4AX7A 1C92A 1FDJA 4XZ9A 3EDEA 4ADUA 4RW5A 1SW0A 1DWGM 4XD3A 1Z48A 2OXNA 1PXGA 4JTQA 3FA3A 4PUDA 3WH6A 3ABRA 1ZL1A 2BS9A 5E5CA 3AHVA 5C6MA 1WXYA 1YE4A 3FGCB 3KP1A 3WUBA 1PX8A 4W9TA 5K9DA 3WDPP 1CXHA 3VXGA 3DHPA 5LXEA 3KBWA 3ARSA 3BW4A 4MTVA 2C15A 4IUGA 4H9UA 4XBJA 3HG3A 3N4FA 3VKKA 3PVFA 4AG0A 4HA3A 3CASA 3R79A 2GGHA 1Q7QA 3DG7A 1POKA 2PMQA 1DWAM 2W0UA 3PTMA 1VCFA 5HMDA 3N9RA 4LGXA 4JTFA 3B05A 2CIPA 4FHAA 5C8BB 3VO0A 4EANA 3H2FA 1ZJBA 3GHRA 4IJBA 2F61A 3VZXA 2PCEA 3TQVA 4UQBA 1R5YA 3BZGA 3UG5A 1QAPA 3PUGA 2REQB 3WX7A 3UG3A 1UMYA 1Z3NA 4JY9A 4C60A 4A8NA 5CPOA 3RRXA 1DTUA 2OCZA 5FA5A 3M0IA 4WDTA 1LRTA 1RXOB 3NM3A 1T5AA 5CZTA 4GVHA 4ZB2A 4O52A 1MNSA 1UKTA 2IQTA 2C7FA 5BMXA 1Q3NA 1RP9A 2RDUA 3FNDA 2OKTA 3AYVA 3R7MA 5LXXA 3PSWA 1Z8AA 2W5FA 2WHJA 3LHUA 4HK6A 5JQ9A 2AAMA 3WK1A 1HKIA 3OGRA 4UIOA 1H51A 1ISYA 3M0YA 4JCLA 4CQ8A 5E09A 1Z69A 4KMQA 5CZKA 1QOPA 4H9YA 4QS6A 4UZSA 2GJRA 4ZTYA 3QY6A 2L5HA 3W28A 4MM1A 4Y8EA 2PLKA 5FJPA 4AWSA 1TPEA 3OA3A 5E6YA 4J5NA 4N0RA 4PUKA 3GDTA 2O4QA 3QM3A 1MDLA 1QI4A 4DNMA 5BXSA 3U5UA 3HGRA 3U4FA 3E0IA 3RYSA 1NQ6A 1HP4A 4JFUA 1TRIA 1CXFA 1K9TA 1YBQB 4ZE4A 4M6VA 3PN8A 4RPPA 4ZQNA 2VGBA 3LA4A 4A29A 3TYDA 3FAXA 4DBUA 3T44A 3GX9A 3N9SA 2VRJA 2JF6A 3T2QA 4K68A 4QBXA 4R53A 3LEPA 3BDKA 3EKGA 3WEZA 2CLPA 3V75A 1MUWA 5T91A 1XPYA 3P8JA 2ZCGA 2AKMA 2Z1VA 2GOKA 3RLUA 1XGZA 4CKQA 2D73A 4OU1A 4LUYA 1E6QM 3U2OA 3A47A 5AB3A 4PB3A 5GVJA 4PA8A 4C6LA 4DEFA 2XH2A 4HCHA 2GQ9A 3NYDA 3PB2A 3T9PA 2ZC1A 4JNMA 1U1HA 4AY1A 4Z1BA 1FKXA 3E02A 3IIOA 4I7WA 4G56A 4LWWA 1XIMA 4PRTA 3AXKA 1KBBA 3FYYA 4H6QA 1XW8A 1FCUA 3LGDA 3SGUA 3QC3A 2XGZA 5HJLA 3QY7A 1BWKA 2J4GA 5F2IA 1XDMA 3PC0A 3WL0A 1B0IA 3CXOA 3N13A 5IM51 1LWIA 3Q58A 4LEQA 1E43A 1A5OC 3AICA 1HUVA 2CETA 2BLEA 1F05A 4ZA0A 4B5WA 4YN5A 1LG1A 3NQVA 3UPBA 3VGGA 1I1XA 2VFFA 3B0UX 2ZX9A 3ZVHB 1GJPA 4PMJA 2D3NA 3CIVA 3S1WA 1TJ0A 2WMKA 2DSVA 4Z1AA 5CPSA 4L65A 1W8GA 3SUVA 3ZLFA 5BYWA 1OFOA 4KKXA 5EMLA 3CV6A 4E4UA 3TW6A 4YHGA 2KX9A 1YADA 2VCAA 4JPGA 3CBWA 4A22A 1L9WA 4PMYA 4XIAA 3D3AA 3CHEA 2Z4GA 4O13A 4FOUA 4MG4A 4IMGA 1US3A 3PJTA 4IP4A 2ZE3A 2A2IA 3F1QA 4ZQCA 4AD1A 3LNMA 2JE8A 2PDMA 2E09A 3CM4A 3EA2A 3R5EA 4IQDA 1ZGDA 4JTJA 4O0KA 4IIHA 3T8QA 3K4WA 2OELA 3GIQA 3GS6A 3DFSA 2QPXA 2BVYA 3HG5A 1B2YA 3B8VA 4MFDA 1ICPA 2FZ8A 2YB1A 2NWSA 2VDIA 3LV6A 2YCLB 2UWFA 3NZGA 3OLIA 4GQ0A 3P60A 3CGTA 4JQ4A 4RKAA 1QI5A 3AAMA 3HPSA 4URIA 3BSHA 5IDIA 4WZHA 4Z0JA 2PC8A 1JRCA 3QSRA 3W7EA 1Z44A 3P62A 3THAA 3WQCA 2VEFA 1YIXA 5I3JA 1XLEA 2QULA 2ZRXA 2ZADA 4PBFA 2WMHA 2QCNA 3Q2DA 1PHQA 1JZ3A 4E6MA 3HURA 1OD8A 3N3MA 4C90A 1XLFA 3AS0A 4ACZB 3WLHA 4LRSA 2F38A 2W91A 4UTLA 2D3LA 1JPHA 1IQ8A 2YXOA 4A8RA 2XSBA 3EWZA 4RDVA 4YVVA 2R91A 1J0KA 4EWJA 1M53A 1V77A 1UBPC 3CPUA 1GG1A 2J8FA 3VGFA 4OGZA 1BD0A 3RU8X 4MDOA 5HNTA 4Y8FA 1SR9A 1IGSA 1MZRA 1KO0A 2Q3RA 2FH6A 2EKCA 4WDXA 1GHRA 3GQYA 2WC7A 1EO5A 3KXQA 3BSMA 3TYCA 3GVWA 4MJ4A 2WBKA 2VQTA 3QOMA 4TVUA 4BWLA 1ZAJA 3L23A 4GI6A 4ONVA 3OEXA 4LAUA 4FIRA 3MHGA 4OWGA 4X63A 4AMAA 1P6BA 2ZZ5A 3L68A 1DQXA 1MEWA 1PKLA 1HF6A 1OK6A 3EWBX 4JAWA 2GFTA 1XF0A 3P81A 4RE2A 1FHUA 1L6SA 2D23A 3QTGA 4Q8NA 1QO2A 3OVPA 1XLJA 2PGWA 3PUOA 5CC7A 3GZAA 3CNYA 1UD6A 1MFUA 1UH2A 1XLMA 3S1UA 3S5SA 1ZTVA 2OSXA 2P0IA 2CLOA 2ZZ3A 1QDSA 1V8EA 4O19A 3HPZA 5LYRA 3G0UA 4PUMA 4ZO8A 3E0FA 1KGXA 4N4PA 3KVKA 3W76A 1DV7A 4DJFA 1H7XA 4U10A 2PWFA 4K1GA 5G5IA 5A8NA 3IIZA 4PULA 4KETA 1GVIA 5L9FA 2W9MA 1TMHA 3ZS4A 2YCEA 3TIMA 4J3WA 5A6BA 2QR6A 3RCYA 2ISDA 2XIBA 3HF3A 1ZJHA 2OEJA 4QHRA 3T55A 2Y7FA 3SCNA 2VOMA 4ATDA 5CZ0A 2WZEA 1CB7B 2NUYA 1DIDA 4IIFA 3IK4A 2XFFA 1WNOA 2VNCA 1V3JA 3G8RA 3UJRA 5EY5A 2FYMA 4Z0SA 3UWYA 2J7HA 2BP1A 4OUIA 3Q67A 1CGTA 3A22A 2X05A 2HVNA 2Y1HA 1R30A 4C1NB 3L65A 2W62A 3W7HA 4YTUA 3PJWA 4O12A 4Q8OA 1XD0A 2NVAA 4PCTA 3V0SA 4CD7A 1VFFA 5AHEA 3KFTA 2WANA 5KZMA 2VURA 5K2ZA 2BVTA 3WNNA 1W32A 1B90A 4EXBA 4L4MA 1UC4A 3A24A 4B92A 1B9ZA 4N6FA 4HIBA 4I5RA 1XCWA 3QKZA 1KRCC 5C9UA 1ZY9A 4DY1A 4W84A 3M0VA 3W7JA 3V5OA 2VX6A 1Y7VA 3W7KA 2YCJA 5LA1A 2WMGA 1GJUA 4RR4A 1A5SA 1NFPA 4EP8C 2DT2A 2QMKA 4BI7A 4ML4A 1YW1A 3AQUA 4K7YA 4PUNA 4XVDA 4NF7A 5EPDA 1XKYA 3ZLHA 4HNUA 4BF9A 1ENUA 3COTA 3AYRA 4XKYB 8XIMA 3IUDA 2POTA 5DT5A 4L1XA 3BMXA 4NJKA 1YYAA 3QPZA 3T1GA 1XFBA 3TH6A 3IWPA 1OABA 2WNQA 2X7VA 3BAYA 3S46A 2DUAA 3G3MA 3F5JA 3T05A 3NJ3A 2ZTJA 3K8LA 1RCQA 3GUGA 2V3DA 3UGRA 2OFJA 1XWYA 2TODA 5I06A 3TONA 3WLMA 1XYAA 3S8HA 1UW9A 3KDNA 4D6HA 3KVJA 3UF9A 5KMYA 1PTDA 3LCXA 3TN3A 2WAGA 1Y0EA 4C6EA 2Z26A 4JDYA 1UZHA 1NWTA 1C8YA 1FH9A 2PI6A 1H5YA 4KW2A 5I5RA 4U5IA 2XFWA 4Q4SA 5LHEA 3GU1A 1UHVA 3ITXA 1F4AA 3M0MA 5T9CE 3PG8A 1RR2A 1VBUA 3CAVA 5DFAA 3FEQA 3TFXA 2WJDA 3MCMA 3P61A 3UESA 4Z2GA 2CITA 3RX2A 2XGBA 2Q02A 3VE9A 2PZ0A 4GUGA 1VFTA 1FDYA 4PMZA 3QV9A 5FF2A 1NFBA 2XN2A 3Q37A 4IJRA 3TR2A 3M07A 3DBNA 3H26A 3MHFA 4W5UA 1V79A 2PGFA 3MI2A 3OU8A 2FIQA 4J9JA 3DZ1A 1YKWA 3VX0A 3ALFA 4GNKB 4P5UA 4PCNA 1R3TA 3HGJA