1YNPA

Aldo-keto reductase akr11c1 from bacillus halodurans (apo form)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
283
Chain Sequence
HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
molecule keywords oxidoreductase
total genus 103
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynpA01
1M9HA 3H4GA 1XF0A 1HW6A 4YVPA 2ACQA 2ACSA 2HEJA 4EXBA 4JTRA 3R43A 3CAQA 1Z89A 2WZMA 3D3FA 1ZGDA 1LWIA 1YE6A 4MHBA 1X96A 3R7MA 3WBWA 2PF8A 2PDUA 1ADSA 3DOPA 4GQGA 1YNQA 3UP8A 1OG6A 1IHIA 4PUUA 5M2FX 2PZNA 2NVCA 3BURA 4GQ0A 4XZHA 4JQ2A 3LD5A 3C3UA 2FGBA 1Z3NA 5LIXX 1MI3A 2PD5A 3LQLA 2PDLA 3DN5A 4EXAA 3RX4A 1Z9AA 1ZSXA 3U2CA 3QKZA 5HNUA 1QWKA 3BV7A 4JTCA 4JQ3A 3V35A 1R38A 2INZA 3CV7A 1JEZA 2AGTA 3MB9A 4LB4A 4XZNX 4GCAA 4RPQA 3M4HA 1X97A 2PDBA 2PDFA 3VXGA 2PDPA 3M0IA 4NKCA 3GHSA 2HE5A 2PDXA 1A80A 2FZBA 1XGDA 2DUXA 4WDTA 2PDQA 2I16A 2PFHA 3Q65A 4WDWA 2C91A 1S2CA 3N6QA 4IJCA 5LIKX 3LEPA 3UZXA 4IJRA 4OTKA 1RY0A 1EXBA 1Q13A 2PDNA 3WG6A 2ACUA 4AUBA 2I17A 2PDJA 1PZ0A 3FX4A 1LQAA 1AH0A 4XZMX 3LZ3A 5AZ0A 4XVDA 3Q67A 4FZIA 2ACRA 3R6IA 1EL3A 1PWMA 2P5NA 1T40A 5LIUX 3R58A 4PRTA 2CLPA 3CMFA 3EB3A 4PR4A 4QXIA 2A79A 2VDGA 1J96A 1Q5MA 4XO6A 2ALRA 3P2VA 1AH4A 1S2AA 2FZ8A 4FAMA 4XZIA 4WDXA 2J8TA 4WRHA 4HMNA 2BP1A 4QR6A 4JTQA 1MRQA 2R24A 5KETA 4L1WA 3S3GA 2FZ9A 3UZYA 1PYFA 2IPGA 4XO7A 3CASA 4JQ1A 2WZTA 4LAUA 3UWEA 3V0TA 1ZUAX 2NVDA 3ONCA 4R9OA 3LZ5A 1T41A 3CV6A 4DBUA 4L1XA 2PDMA 1PWLA 1UR3M 3M64A 3WBXA 4JIHA 3G5EA 1QRQA 1K8CA 3WCZA 2FZDA 4GIEA 4XAPA 3UZZA 3R8GA 4YS1A 1EKOA 2IQ0A 1US0A 4QX4A 2BGQA 3EB4A 1SM9A 3R94A 3V0SA 3GUGA 3COTA 1S1PA 3LBOA 2HDJA 1AH3A 2PDGA 3G1RA 1IEIA 4LBRA 2IPFA 3UG8A 4QBXA 3UFYA 2R9RA 3H7RA 1HQTA 3EAUA 2HV5A 5DANA 4XK2A 2PDYA 1PZ1A 3KRBA 1RALA 3LENA 3WBYA 4JTDA 3LNMA 4PUWA 3T42A 3GHUA 3ONBA 5HA7A 4XVEA 2FVLA 2DV0A 1YE4A 2PDKA 4F40A 2IKIA 2BGSA 5JH2A 4GACA 4WGHA 3B3DA 4ASTA 1FRBA 2IKGA 1MZRA 4H7CA 4FALA 3O3RA 3RX2A 4PRRA 3LN3A 4DBWA 4H8NA 3R8HA 4JTAA 4YU1A 2IQDA 4YVVA 2HVNA 4GA8A 1Z8AA 1AFSA 3CAVA 1ZQ5A 3V36A 2INEA 5LIYX 4G5DA 2QXWA 2PDCA 2PDHA 1AZ2A 5JH1A 3BCJA 4WDUA 3GHRA 4JIRA 4XZLX 5C7HA 3H7UA 4JQ4A 3RX3A 2PEVA 4HBKA 4LBSA 1S1RA 4FA3A 3F7JA 3MC5A 5HNTA 1C9WA 1VBJA 2HVOA 3O0KA 4ZFCA 4DBSA 3N2TA 2HE8A 1RY8A 2IPJA 1GVEA 2F38A 2IKJA 2PDWA 2ISFA 4JIIX 4PMJA 4IGSA 1X98A 3FJNA 4I5XA 3UGRA 2IKHA 4Q3MA 3ERPA 2PD9A 3GHTA 4LAZA 3NTYA 3BUVA 4YVXA 4Q7BA 4GABA 2IPWA 4ICCX 1EF3A 1YNPA 1VP5A 5AZ1A 3V0UA 3UZWA 5LIWX 4LB3A 2IS7A 1AZ1A 1XJBA 4JQAA 4WEVX 2PDIA 3LUTA 3UYIA 3LQGA 2DUZA 2F2KA 4DZ5A
chains in the Genus database with same CATH superfamily
3BW2A 1NWSA 3FYPA 3BG9A 2E7FA 4F66A 3LERA 3DHFA 1KKRA 7ENLA 2H8ZA 3VTRA 3SBFA 4B3KA 5AHEA 3IS4A 3MW7A 2FVMA 4MNLA 5TBOA 2XFWA 3CXOA 5D2YA 3B8TA 2D22A 2QDEA 3W70A 1ICPA 1ELSA 4DJEA 3WO8A 1SSDA 4QG9A 3DG3A 3CV2A 2QPSA 1VCFA 1HIZA 2F61A 1DV7A 2DIKA 4MNJA 1QXLA 1OIFA 3SUSA 4DO7A 4Z0JA 3F4NA 2OKOA 3UERA 4QJ5B 3SN0A 4FNTA 5C2XA 1UBPC 1B5TA 3WJSA 5AHFA 2Z1VA 4JTTA 1TZ9A 3LQLA 3LY0A 3WJXA 1DQUA 3LA4A 3G3MA 4PCSA 3M16A 4FS9A 3S1GA 2O55A 4S3BA 1A0DA 2ZOXA 2RKXA 3DYMA 2G3MA 3N4FA 4FPSA 1H62A 1U83A 4XZNX 3M4HA 4E2VA 1KM2A 4NXSA 3H26A 4LEFA 2DP3A 1FH9A 2XH0A 4LNYA 1EJSC 5G1TA 4GO9A 1JF6A 3T4CA 1KGUA 2VEKA 3KVMA 2BFGA 3RUBL 3T09A 3FIGA 3OGRA 1ZAHA 4CUCA 3R79A 2Z2BA 1RSCA 1EF2A 4WDWA 4EF9A 4IJCA 2FPTA 1VIZA 3DFOA 1FXPA 2RHGA 2QUMA 2R1NA 2VX4A 5HQMA 3WFZA 3MPGA 2TAAA 1U1JA 1PHQA 1NP0A 3W2NA 2BG5A 1RCOB 3OG2A 2OYKA 3LXCA 2VGFA 4GH3A 2OGJA 2X8RA 3CZJA 5EGRA 1IGSA 4RE3A 1UR9A 1GQJA 2WNZA 3DHUA 3RO8A 3CEPA 1AH0A 4XZMX 1EFZA 1N55A 3LZ3A 3KW3A 4BQ4A 3SIMA 4RV8A 3AJXA 4NU7A 1SZRA 3QOMA 5EMYA 5AC7A 1T5AA 1SFTA 2YDSA 1FHLA 3TWBA 4C6DA 1GVOA 5M03A 4YCPA 3CQIA 3W7RA 3P67A 1R7AA 1KWGA 5A8QA 4G56A 1POKA 3T0BA 1UWUA 1LBLA 1BXBA 1MQQA 3WELA 1WYIA 3MSYA 3CAKA 1JQVA 1UOZA 4AX7A 3SCTA 2OQHA 4IFOA 3I7SA 4DJED 3L2IA 4ZE5A 2Y62A 2AQOA 3KCLA 5LXXA 1K7FA 1MEHA 4LTSA 3ARZA 4PN2A 4JIEA 2NQHA 4NL1A 4FXFA 3KX6A 3SEPA 3MJYA 3U4AA 1R3WA 4ZO7A 1F73A 1IR2A 1LM1A 1S46A 3OLIA 4UR7A 3R12A 3VO0A 2WW5A 4MJ2A 4S3DA 1FWAC 1V3KA 5A8NA 3I3BA 5AYYA 1X38A 4WQ6A 3WLLA 5CJ5A 3FXYA 5BU9A 4DIAA 1XD0A 4OGZA 1UZ1A 3A24A 2BGQA 3GNXA 3UT0A 1M53A 1J0IA 1V8EA 3COTA 4NVTA 1DWIM 1XRFA 2PDGA 4XG1A 2ODOA 3AHXA 2WZIA 3N9SA 3AFBA 2OX4A 1Y5VA 2OB3A 3TR9A 3OEXA 4PL1A 4LPCA 4XK2A 3D46A 1QDSA 3E5PA 5ENLA 3F5KA 4EXQA 4ES4A 5I23A 1GJWA 3H2NA 4WJXA 3PUDA 5AOUA 3WUGA 3RHGA 2ZBTA 4AW7A 4JNYA 3NJ3A 2DSZA 1RD5A 3NOYA 1JIBA 3W88A 1DWGM 3KTSA 1JAEA 4RNFA 4DAFA 4JD4A 4JFUA 3RPMA 5JH2A 2G37A 1ZRQA 1NF0A 4A3YA 3T4WA 3C2OA 1O66A 1FRBA 3QHOA 3F4CA 3MI3A 4G6CA 3EA1A 1DL3A 3RX2A 4QNWA 3RR4A 3MP5A 4CKQA 5DCDA 3KVJA 2OLSA 5A8GA 1EH9A 4BI6A 3VDHA 1MW3A 1Z8AA 3WKZA 5ABFB 2BVTA 1AD1A 5CZKA 5C9WA 1W3KA 5LIYX 2EPNA 2D2JA 2OQYA 3W1AA 3DESA 3S46A 3QC3A 5FJOA 2Z25A 3W23A 1DVJA 3WQDA 5AYBA 4HHLA 3FKKA 1E73M 1H49A 4JFSA 4J27A 4Z2HA 3VDCA 2BDQA 1K9TA 5HNTA 4GLEA 3E2QA 2JALA 4HB7A 3W7NA 3SZ8A 2VX5A 1UWSA 3H8AA 3LPPA 3N2TA 4A29A 3VYLA 1PKMA 4HOZA 1GVEA 4PMOA 2IKJA 1V7AA 3FNDA 3W6LA 1H0IA 5BOOA 1RUSA 2CC0A 3UGRA 3HPXA 1HJWA 2KAUC 3WLPA 1BYDA 2GJXB 3FLUA 1A0CA 1XYFA 2VZVA 3NM3A 5EA9A 1OFDA 3BMVA 4DWSC 3AMLA 2WMIB 5JVLA 3D47A 3RLUA 2UY2A 5HMEA 3GXMA 3FAXA 3CZ8A 1VGAA 4YVXA 1MNZA 3UCCA 1FKWA 3AHVA 3PFRA 3NYDA 3HG5A 1XLEA 3GU1A 2J78A 2IPWA 4JHZA 4PMYA 3GIPA 2VOTA 3P7YA 4WR3A 4NX5A 1KQZA 2DZUA 3LI0A 4DPPA 1XJBA 3ZVHB 1QU4A 4HK5A 2V5BA 1OINA 4KF1A 3TH6A 3BAYA 1W5PA 1GOMA 3FJ4A 1LOQA 5F2GA 4NAEB 2I9UA 2FPYA 3HV8A 5LSMA 3QXBA 3L0KA 1Y5WA 3A3HA 1K7EA 4WK9A 2GFTA 2DJLA 2J6VA 1F74A 3GSMA 3SN1A 3AZRA 3KFTA 2WMJA 1YTKA 2WAGA 1B3ZA 3RMEA 4MHBA 1X96A 6ENLA 3PZVA 3MUAA 2HJPA 3NFUA 4QITA 2JEQA 4DUVA 1QHPA 1ZL1A 2FFIA 3UXKA 2DJXA 3E0WA 2OQLA 1GK8A 3P8IA 1VEPA 1QR7A 3P74A 1F3WA 1GGOA 3M41A 5I24A 3TX9A 1CLXA 3Q45A 4S38A 3A23A 3HQ1A 3TXVA 4DNMA 5CPMA 3IIXA 3WNNA 3I10A 4YIWA 1HP5A 2ZZ1A 2PWGA 3CQHA 3VDGA 4CQCA 2IXUA 1HNYA 4YYFA 5D03A 1SO5A 1US3A 1ZSXA 2WNNA 1VQTA 4OUEA 1E6SM 3U2CA 3A3XA 3N29A 4RLIA 4GX8A 4M1RA 3E0FA 3LXBA 4H6KA 1OADA 4GCAA 2NQ9A 2POTA 3PNZA 4R7WA 3CMGA 1M03A 1R3SA 3SQSA 2DQWA 2YCKX 3CHFA 4FXSA 4IMEA 1W1VA 3EYPA 1HJQA 4ZXLA 1A80A 5HMFA 3A6OA 5F4WA 2J7FA 4MAZA 4OUIA 7REQB 4PCPA 3B8IA 3RDKA 1CYGA 4NRSA 1AA1B 4C6MA 4OJYA 1E9IA 3DUGA 3REQA 5HWMA 5LXEA 3HPZA 5I06A 2JKAA 2G8ZA 3ENLA 2JK2A 4W87A 3C2RA 3LMYA 1Y5XA 2PAJA 2WVUA 4J3SA 1QW9A 1EBHA 2PSNA 5D9OA 5MF5A 3FSTA 3R6IA 4HGXA 3IGXA 3W82A 3S1WA 1GPWA 4LVGA 1YW1A 2DSWA 2YCEA 3EMZA 1CT5A 1G5AA 2JKPA 3W9ZA 3AALA 1XBYA 3E5BA 3GVVA 3VNIA 5C9ZA 4IL2A 4L9YA 1GVSA 3HN3A 5M1TA 1KFCA 3DI0A 2FB2A 2CZDA 1DWFM 3NNTA 2PCEA 4H9YA 1AH4A 4UTJA 5FEWA 5M17A 1J93A 3WLHA 1CXLA 3ITCA 3RCYA 2BS9A 3AZSA 3UW6A 1QNVA 3E49A 4CD8A 2OXNA 1V77A 4PZVA 1FWNA 4RDWA 3O2LA 5C55A 3QQ1A 1UD8A 2YL6A 3T8QA 4O1AA 1V6XA 4IFRA 2I57A 4D1IA 4RDVA 3FKRA 3QQWA 4Y9OA 2QJNA 2FHBA 3KWXA 3AYRA 3LZ5A 3UPBA 4DBUA 3CAWA 3C6CA 5FF7A 3U4FA 4QLJA 2YW4A 3R8GA 2EQDA 4GZ7A 4RZ5A 2NV9A 2C6QA 2VFIA 3TTOA 1X39A 1AK5A 5K4ZA 1Q6GA 4JPGA 4E2DA 4BJHA 4B5XA 2XM1A 1BFNA 3IJLA 4HPHA 2ZZ2A 1OFRA 1TWDA 4YMZA 3U9IA 1UZDA 1MUWA 4PFMA 1VJIA 2DZBA 1V6TA 2XN1A 4N6FA 3VNDA 1Q3NA 3W73A 3GKFA 4IPLA 2H6RA 3L2MA 3NIYA 4TX6A 3CL6A 3EOSA 1QJWA 3STCA 4R88A 1IEWA 1GVRA 4N4PA 4XUYA 2DSKA 3G0XA 4JAWA 5D30A 4K8EA 3URNA 4QG6A 1M7PA 4A3RA 2PRHA 1V0LA 1EP3A 5BMXA 1OF6A 4LU0A 1BHGA 4GX9A 1SQ7A 2HBXA 4J3TA 3I6TA 3TMLA 3LPGA 2DT3A 4DBWA 1SW3A 1UMLA 1UA3A 1VCVA 4UQ9A 1ZQ5A 3GIQA 2TPSA 2QS8A 1OFOA 1QNQA 3P60A 2VUNA 2QXWA 2WHLA 3SY8A 4Z2JA 5I03A 1LL7A 1D8CA 3BCJA 1QATA 3PPFA 1I8JA 3KLKA 4XZLX 1RQEA 4RNHA 5CPQA 3W86A 1A5AA 1W1A1 1KFEA 3NQ8A 2OWXA 1HFBA 3NDYA 2WHJA 1LG1A 1QNRA 3HIJA 2E1WA 4DB7A 3LHUA 2QV4A 1BXNA 3A12A 3OBEA 2IPJA 3M0ZA 2V5JA 1OJXA 1FDYA 3A47A 5EMLA 5D8WA 4MSSA 2X7WA 4PMJA 4IGSA 4X0VA 3WLTA 4DEFA 1WDDA 3MZNA 3EXTA 4K1GA 4EAMA 1JJKA 3CUXA 1QBBA 3W1LA 4HCLA 2QGYA 5G4HC 3GXTA 4I9TA 2CWXA 9RUBA 1P7TA 4JN8A 5FESA 1XYMA 3MO7A 2PGFA 3E38A 4IXHA 2GGIA 3UZJA 2BNJA 5EY5A 3B06A 2Y1HA 2V3DA 1LP6A 3VU2A 1W32A 3KAOA 5AZ1A 3O06A 4JNZA 3EDEA 3ATYA 3G24A 1CGXA 1EHNA 1ISYA 3S42A 3I7QA 1FWDC 2A7PA 3L2LA 2LLEA 4IQLA 3REQB 4MY1A 4KFNA 1GVYA 2EKGA 4Z1CA 1V51A 4LS2A 3ZLHA 4G1KA 2ACSA 4HSHA 1VHCA 3AIRA 4G1NA 2ZUMA 3WLKX 2QCEA 3KCJA 1UC4A 2ATSA 1HT6A 2VX6A 1NQKA 3V1PA 2W3ZA 1SR0A 3S5NA 2OLAA 2RFGA 3EPMA 3R7MA 4ECLA 3NVDA 5KMYA 5G4WA 4BF9A 1DTUA 1LRTA 4RKAA 2YYTA 5FD0A 4QROA 2OELA 3L67A 3P0XA 4IQDA 3VMNA 2J6XA 3C8NA 2BXVA 1ITCA 1E56A 5HAOA 4H2HA 4MWAD 3UG5A 3WLSA 5BRBA 2FDMA 3WIJA 4AZCB 4QAIA 3WMBA 4HOXA 1AL7A 3WDRA 2KX9A 2YBTA 3VKCA 5REQA 4MADA 1F6KA 3NPUA 4AY8A 3MA8A 3W02A 4MAVA 2GWGA 1KCXA 3ITVA 2EF9A 3O9NA 2PP1A 3NSMA 2VFDA 4IX2A 2XIQA 4ADTA 1I1XA 4Y96A 1R86A 3DBPA 1YPIA 2PLMA 4Q7IA 3CZKA 1UR0A 3UJEA 2HE5A 3V3WA 2QCDA 4DZHA 1B4KA 4PUMA 1LJYA 1PKYA 3N6QA 4CLMA 6ALDA 2TODA 1CB7B 1XKJA 3AIWA 1TTQA 1ZFJA 3GTNA 4JKLA 2YSWA 4TV6A 3AXMA 1KBJA 3W24A 1LG2A 1XG4A 1O68A 2RDWA 2V3FA 5H8UA 1L0PA 1VAHA 5M3WA 3DFYA 5C9RA 3UY7A 1J0YA 5DBUA 5DBTA 3WZ0E 1ZZMA 2YL8A 1HL8A 2EJAA 3NCOA 8A3HA 1A5UA 1O95A 3VFCA 3W38A 1HF6A 2VWTA 3BAJA 1W37A 1XPGA 4WSHA 2WO5A 3GVRA 5E70A 4RE2A 4HNLA 4N9BA 1B9BA 2ZE3A 1NH6A 4HHHA 3ABSA 4R53A 5F2LA 1XQLA 1WO2A 4XV0A 2B7OA 4C1NA 3ZJ7A 3DC8A 1QNOA 1NY1A 2BP1A 2CXEA 1SU5A 1GYNA 2UY4A 3S4TA 1MRQA 3BCFA 2YFNA 1IYXA 4UTMA 2FZ9A 2BWGA 1KW1A 5I78A 2PA6A 2PGEA 3TR2A 2FH8A 1GQIA 3C61A 3LNPA 1XFBA 3VD9A 1PTDA 4B91A 4OWGA 3WSUA 5E6YA 3VGHA 1UPMB 4I7WA 4L6HA 1S3TC 2QVNA 3S1VA 1BG4A 1T41A 3N25A 1MUCA 1UH2A 1B9ZA 4AG0A 1O5QA 1RJRA 2BV9A 4B16A 5KTLA 2Y6ZA 1V93A 4GY7A 2X2GA 1W1B1 3ITTA 1NJJA 4S3EA 3TAKA 5DLCA 1XIEA 3UWZA 3HGOA 4BKNA 2XH2A 4LY8A 2ZRWA 1JDAA 3IACA 1KGXA 2YLLA 3IV8A 1RVKA 4U2ZA 5L9FA 4Z1AA 4IG2B 4MZ1A 3EA2A 2BHUA 1KFLA 1AG1O 2WVVA 1XGEA 4JZ5A 5MHBA 1P0BA 3N19B 2V9DA 2VDHA 4ZQCA 2NV2A 1X1OA 4QJ4B 2J7EA 2OPJA 3EAUA 2BVDA 3W83A 3W1RA 3WEOA 1NFPA 3KRBA 3TYAA 3HMJG 4XUGA 3O6YX 1NSJA 2MANA 3T0DA 1B3XA 1JCNA 5LGZA 1WAUA 4FX6M 5I3KA 1WCGA 1TTPA 1YXDA 5E9XA 4BZYA 2X09A 2OT1A 2H9AA 4O13A 1I4NA 1PS9A 3MSDA 3OVGA 4ASTA 4MUZA 2WVSA 3ZFHA 4U10A 5FAGA 1TVPA 3EDKA 3W22A 5AHMA 1M41A 1I45A 4Y7EA 4PRRA 3RG6A 1GZGA 1Q66A 3RAOA 4JXCA 3WH5A 3WJZA 2Z4GA 3PHAA 3VIGA 1XGZA 2VTFA 1RPXA 1DYSA 5BWAA 2JQXA 4TVDA 3EDDA 5FEXA 1WZMA 5B7YA 1Q65A 3QSTA 3B4YA 4DY1A 3B8VA 5C7HA 2HNEA 1KR0A 4ZEPA 4XD3A 3T6CA 3GXNA 1JXKA 1PL9A 1E1FA 4NNAA 5E9AA 3CHDA 3VGFA 1TV8A 3OVPA 1GW9A 5A6TC 4MB1A 1MQRA 3C0QA 4FLOA 1JCTA 1ZBWA 5LNVA 1RD6A 3ZWTA 2FPVA 3G18A 2OOFA 1LCOA 4EPDC 4PBEA 2VFEA 5A8MA 3FJNA 3H55A 5FF3A 1DJZA 2PWUA 4L1GA 3B0VC 4U4MA 1VHNA 2VI0A 4B5VA 4GRSA 4Q4QA 1VF8A 1OABA 5BNKA 3CK5A 1H7XA 1CPUA 1YBQB 2VMFA 4IUGA 1XM3A 3OODA 4H1ZA 2YDQA 4CD4A 3CHEA 1ZU8A 3SR7A 3JU2A 3FV9A 1XS2A 2PUZA 4GBDA 2KZHA 1W3NA 4UNKA 2J9YA 5EBUA 1W6TA 3AWNA 4OFCA 4JQAA 3WK0A 3H2AA 3BARA 1TX2A 4O0KA 1NVMA 3GR7A 1S3HA 4GI9A 3PBWA 1WZAA 3N2XA 1PCWA 5LA1A 5C71A 1M9HA 3TW6A 1V02A 2ISWA 2BY3A 3R11A 1UIOA 1SMAA 3PZGA 3KS6A 2ACQA 3VFLA 3TSBA 1S2UA 4CQ9A 2Z00A 3BDKA 4HA0A 3PTKA 4GQRA 4QQUA 1FWEC 2XVKA 3KL3A 7TAAA 3VCCA 1JF5A 4DYKA 2V67A 3GG1A 2DVUA 1CXEA 1S2TA 4GBUA 4MFDA 2GLKA 2NVCA 4EVZA 4C6IA 2QCCA 3BL3A 2QJMA 1TPVA 5AVHA 1MI3A 1Q85A 2VDIA 3HPAA 3QJAA 3G3DA 2Z2UA 5HPOA 4AC7C 3OQEA 4LUJA 5HWJA 5A95A 4IIEA 2GZXA 3G1SA 1R3YA 1QW8A 1IEXA 2INZA 3SADA 1JEZA 1AQMA 3P14A 1CI1A 3INPA 1UD4A 1ZJIA 4DJDA 2A3HA 4V2XA 6TAAA 5A8OA 5LGXA 2PP3A 5U7SA 1LOSA 2QMJA 4F4RA 4WDTA 3K5XA 4DPQA 3T78A 2E0PA 5MKGB 4ENLA 6XIAA 2YDAA 3MBFA 3GVQA 3PWGA 1MXDA 2P8CA 3C56A 2YYUA 1TJ1A 2A6NA 5LNSA 3KBNA 1MYRA 3TA9A 3TJIA 3BW4A 5HPCA 3KHJA 1JDCA 4B5NA 3CQKA 4DI9A 1AL8A 4Y6GA 2PDJA 4G7EA 3EOOA 5KINA 1E6NA 4NZ5A 1FH7A 4URIA 4DWSB 2HROA 4UTUA 4RW3A 4Q4RA 1TFVA 4JKMA 3TOYA 3TQ0A 4JBRA 4Q4MA 1LL4A 4PR4A 3WD1A 3WLOA 1XQKA 3A5VA 2Z6IA 3VKDA 2ZDSA 3W7IA 3F5JA 3GD6A 1DJXA 4MLRA 3S1UA 4KESA 1ESWA 1SYTA 1OVDA 5AYXA 4AH7A 3W0KA 1TB3A 1DIEA 2ZXBA 2VVSA 1H5YA 4US5D 3NOEA 3AYTA 1IIHA 4AY1A 1K3UA 3PR2A 4AHPA 1E3ZA 2VZUA 3CYVA 2CYGA 4BI7A 2CZFA 3MDWA 5HJYA 2DW6A 2Z1BA 1SW7A 1J2WA 1EGMA 2QJHA 3DU0A 2EGZA 1JZ7A 5IHSA 2VR5A 4PB5A 2EPMX 1OK4A 1IXNA 1XBZA 1KTNA 1EIXA 3SSZA 4ZMGA 2CLLA 3P61A 5HATA 1FQ0A 4Z1DA 3M5VA 1RPKA 1JYXA 1T7LA 3WF2A 1M7OA 3E3HA 1QHOA 3GC4A 1FWFC 2X0YA 1QNSA 4HCHA 2PWFA 3OQ8A 3CT7A 2C13A 3LI1A 3M5XA 3ZMRA 5DCBA 1WBJA 3GY1A 4YN5A 4KRZA 3DEQA 1XLMA 3H24A 2BBFA 4KRTA 3STEA 4R7JA 3ABOA 1H7NA 4UFJA 3KBMA 3QPYA 1SPQA 4HJWA 1IXQA 1RBAA 4HYRA 5D37A 5DANA 1NDVA 2ZXAA 1PZ1A 4AYGA 4GYJA 4XD6A 1KWKA 5I5RA 1XG3A 2RDUA 1XIBA 4E8GA 3P93A 4RV3A 5C2GA 2ICSA 1Q8AA 2GGEA 1OWQA 2R1PA 3APYA 4MB5A 1Q6LA 1TPH1 4RNJA 3LGGA 4PMQA 3WJWA 4KWWA 2DSVA 1V08A 4FXRA 3SUUA 4GZIA 1D3CA 4DF1A 2GVGA 1R6WA 1Q7QA 4X2PA 1ADOA 1HJVA 4G7EB 1N7KA 4W88A 1YHTA 2BOGX 3TSDA 2QUVA 4B2DD 1E5JA 1SGJA 4UNLA 4GQBA 2GUYA 3EWXA 2OT0A 3GZAA 5BXRA 1IZJA 4YVVA 4NZ4A 2HWGA 3MMTA 5C5YA 1DBTA 4J3ZA 5FJJA 2D69A 1HJSA 3FCPA 4NJGA 2G5WA 4FLRA 2IXVA 1IGWA 2RDTA 1U5JA 4FSAA 1TPWA 4GFSA 2XG9A 1IF2A 3UWWA 4JOMA 3EOEA 4I5UA 2PEVA 2W79A 3MDUA 1EJ7L 1VRDA 3NSXA 2Q8XA 3SGUA 4QAWA 3WQWA 1SVDA 1PEZA 4DBSA 3QYSA 4ICMA 5GNYA 5CAKA 1WQ5A 4WCJA 1QWGA 3N14A 4QQ3A 4OT7A 3DFQA 4PUEA 4JIIX 3W7EA 1K9DA 4Y2WA 1W1YA 2O9RA 4QGCA 3GH7A 3VZZA 1OX5A 4PFHA 1FDZA 1L8NA 3RLHA 4AIOA 1RR2A 5A94A 4NJIA 3MWCA 1IWPA 4ML9A 1GYMA 2BVYA 1E6RA 2J7DA 4CEUC 2CLKA 2AOSA 2WKJA 3VGBA 1P4CA 4HTYA 2XHYA 2DZXA 2OG9A 5TQLA 3UZWA 3TC7A 3OIXA 3E2RA 2PDIA 2FHFA 2OEMA 3PBYA 2EPKX 3LU2A 2Y4SA 5EBAA 3MY9A 3SN4A 4M6PA 4IMDA 3L65A 3H4GA 1J6PA 1M5WA 1JZ8A 4JR5A 3AWOA 3TTSA 2G97A 3W7JA 1RLDA 5HQEA 3ZT6A 3GM8A 4DJFD 4TMCA 2J75A 3EKLA 2A7NA 4MY8A 3U2ZA 3VZXA 1P0KA 1W9XA 1QI4A 3AIBA 1QHZA 3E0LA 5BRQA 4NNCA 3MKCA 2VYOA 5CJMA 3VNZA 1XR2A 4NILA 5HUPA 1G4SA 3CPUA 3GFYA 4GKTA 1SJCA 4GWEA 5I02A 3ZO9A 3WJYA 4DZAA 1ITXA 4I9JA 4IP7A 4I8YA 1EDGA 1GPFA 2D24A 2GVJA 2FKPA 2Y0FA 3EKGA 1D3HA 3KOYA 3DHPA 1TMHA 4LVAA 4DZIA 1A5OC 4TIMA 2PDLA 2NZLA 1Q6CA 3WL0A 4GO8A 2Z1WA 2ISVA 4DXXA 1LRNA 2VURA 3HG4A 1AQFA 3VIIA 3RF9A 4JQ3A 3V35A 4A8IA 4HJFA 3NYZA 3TA6A 1OFPA 2GVYA 1SFSA 1QAPA 3PF3A 4ZO9A 1NP2A 3VZYA 4RPQA 2FQIA 3NZPA 1BVZA 1L9WA 3EA3A 3XISA 2PDPA 1XLIA 8XIMA 1BTCA 3GR8A 3A5FA 1ISVA 3W87A 3RFAA 2PDQA 3E02A 4I3GA 1KXTA 3ME3A 3WQOA 3O05A 4GQQA 3C2FA 1VFUA 1IE7C 2OODA 4J3VA 3UZXA 4HYVA 5G4EA 3RJYA 4DHGA 1Q13A 3VDAA 4L9XA 3U6WA 1L6FA 2ZA3A 3O16A 2V0TA 3FX4A 3L4XA 2F2HA 2C0HA 1HX0A 1TA3B 4P7NA 1QMLA 3UVAA 4XX6A 3IIPA 2HK1A 5HJXA 3GDBA 1XLDA 2W9MA 4XBJA 4XTIA 3CL7A 3PJXA 4GYKA 3NL3A 3ZYZA 1FWIC 2PE4A 3W7HA 2XU2A 3BLLA 2E5BA 1TE6A 2VFHA 3CQJA 4BQ5A 1EDTA 1CDGA 3FDGA 3CJPA 4RXFA 5BXPA 5F2MA 3NPWA 2VRQA 1ZBCA 4HT3A 2E9MA 4J2MA 4N2YA 1O7AA 3ZR5A 2XVGA 3TTQA 4RZ6A 1L2UA 4L80A 4L64A 4DX3A 1O5KA 2X42A 2ASHA 2ISDA 3TYCA 2RDXA 3JZUA 4L1WA 1XRTA 1XL9A 3PUOA 2ADAA 3ITYA 1ZCCA 5TD4A 1GUVA 1Z69A 2YLAA 4AEOA 4IIFA 2PTZA 3HQOA 4CNUA 3ITOA 4HPNA 1UUOA 1VFHA 3IJ7A 4K3ZA 4IISA 1W8GA 4A8LA 3LGDA 4BQ2A 3E96A 3IAPA 3M0YA 3TYBA 2ABAA 2P3EA 4AMCA 1PWLA 4GI8A 5FJPA 1YLVA 1H1ZA 3B9DA 3CMJA 4ZQMA 3N13A 1CXIA 3CIVA 5ABGA 3UJSA 4WKAA 4GGBA 1OCBA 3QKEA 3HPFA 1JDFA 4L56A 4BF5A 4DWSD 3BXWA 1QI0A 7A3HA 3N6JA 2XYLA 4O1BA 4HA1A 2C7FA 3MUIA 1PKLA 3IAQA 4R27A 2W66A 3FYOA 1JDDA 5DO8A 2HV5A 4A3QA 4XD4A 3W7OA 1G7VA 1HO1A 5LNUA 3AIVA 1ZBVA 4W84A 3AOFA 4Q4SA 3LRKA 4DBDA 4P8XA 1TX0A 1ISZA 5CCZA 4KERA 3IV3A 5C70A 3VGEA 3M0XA 3NL5A 3PBVA 2A1YA 3KRZA 1VJZA 2FVLA 1E72M 3G2GA 4HKPA 4LNCA 3BG3A 3VD5A 1YE4A 1Q7ZA 3LRMA 1UR8A 2POZA 1XH0A 3W29A 5IOBA 2VCAA 3VX0A 2Y70A 5HINA 2Y8VA 4N9CA 3T2PA 2AL2B 1VEOA 2W4XA 1OD0A 2FMOA 5XIAA 2CNCA 2YBUA 5EMJA 1JQXA 5RUBA 4W93A 2XIMA 1K9FA 2PDCA 1P1MA 1SJDA 3N4EA 4GXMA 5AHLA 3II1A 3OG3A 4IH3A 2D23A 4H9ZA 3TQKA 2VL4A 4QSHA 4AFYA 3VC5A 3I6EA 1E0TA 2OU4A 2D0HA 3WQCA 1J79A 3F7JA 3GZ3A 4ZFCA 3DIPA 2JE8A 2UBPC 4M80A 1LDCA 2GJPA 1JPIA 3A22A 1KFBA 1UWRA 3PPCA 3ZR6A 3CHCA 3UXAA 1CCWB 3H4WA 3C3NA 3GNOA 5JMUA 5REQB 3R0DA 2PZ0A 2J4GA 2PWDA 3QM3A 4F0LA 4L4MA 2NWSA 2E6AA 2X1RA 4QE4A 4HP5A 4S2CA 4CD7A 1E6ZA 4ZO6A 3TYZA 3AHTA 1G67A 1KM6A 2JGYA 2XSAA 4M81A 3Q94A 2ZUNA 2VFFA 1XW8A 3BJTA 4Q7BA 4IP5A 1A50A 5GPRA 2REQA 1TG7A 1UW9A 1W54A 1GQNA 3D6NA 1UUMA 4KWVA 4UUIA 1EO7A 5I2UA 2O92A 2CHNA 4OOZA 4JCMA 2C71A 4F79A 4H9MA 3MHUA 3PULA 1J5TA 8RUCA 1GJUA 1AJ2A 1HKIA 4UFKA 5BROA 1T8QA 1YE6A 1KCLA 1R0MA 1ME8A 1D7KA 2QCFA 3STPA 1R85A 5BWFA 2V2DA 2PDUA 5D2TA 3GQYA 1VBUA 4HIBA 1PKNA 4GVGA 4C6QA 2XINA 3UY8A 2E9BA 2VT0A 5CGMA 3BJFA 1X6LA 3WQ6A 4IWWA 3RU6A 4ZTXA 2BODX 2P53A 1EX5A 1UASA 1HL2A 2GWNA 4A05A 1C91A 4AZ7A 2YX0A 3C3UA 1JI1A 1A3WA 2BY0A 3QEZA 3E2SA 4LX4A 2BY1A 2Y7FA 4M6QA 1KTBA 5JUVA 2EG6A 2OCZA 4LS1A 3K1DA 2BVWA 1V5XA 1K70A 4L6DA 3FYYA 4DXVA 2F6XA 2MNRA 3VE7A 5C2CA 1R38A 1GCYA 3WD0A 1V3LA 1PE1A 4RZ4A 4ZR8A 2XGIA 4ZTYA 1X97A 2J8FA 3SJ3A 1DTNA 2PDFA 3SRFA 3HG2A 3OHMB 4LUTB 3WUFA 3RO6A 1W9PA 2HISA 2A3LA 4H8UA 1K4HA 1CEOA 2W91A 3VKKA 3LOTA 3MKKA 2FZMA 2VJXA 3M5ZA 2YJQA 1DJQA 3R0UA 5I79A 3PJWA 3T08A 2E40A 4MM1A 2Y2WA 4EWND 3UD6A 5CC6A 1OD8A 1W8SA 2G41A 3U2OA 2P76A 5E5CA 3VOJA 4JX6A 3UA3A 5CSYA 4DJDC 5HMSA 1TWZA 3ECQA 3OGVA 3CUGA 4P7OA 3LTSA 3V5OA 1T96A 4OHQA 4GVIA 5A69A 2V8ZA 4RX0A 4KKXA 5BU6A 3QMRA 2Y7GA 1OIMA 4F0RA 4FF7A 5DMNA 4NXKA 3LCXA 2RGMA 4FNQA 1BTMA 1ODZA 3WD3A 1YYAA 3IJIA 1THFD 5BXTA 2ALRA 3WNMA 3QLLA 1R9YA 1TJ2A 3WH9A 4WRHA 1GT8A 3RLVA 1JZ4A 2Z7KA 4AVOA 2H8XA 2NLIA 3WFLA 5IBXC 3NEHA 3GO2A 4E2BA 4L4PA 4BA0A 3AU6A 1LRQA 3GBEA 3ES8A 4UCGA 4ZOCA 1F2JA 1VH7A 4LYPA 3ARPA 1SO4A 3TTYA 3V0TA 2NQZA 1B2YA 1VZWA 3KZPA 5E0FA 4KPLA 1PX3A 2NX1A 2VR2A 2QV5A 3I7RA 4DYJA 4AZ5A 5JQ9A 2Z28A 2WXDM 3NQVA 3WUEA 2DZAA 4JFTA 2CITA 3UZZA 4YS1A 3OZOA 3N04A 4XZBA 4PMXA 3VABA 2BLEA 2PC8A 3DG6A 3AUOA 1NFGA 2ON3A 3PZ9A 4FOUA 2YA2A 3QRHA 4ZBCA 3WY1A 3GS6A 3MP3A 7ODCA 1I2OA 1VD6A 4FLSA 2WHKA 3MI2A 1CECA 3TC6A 4WXZA 4J3WA 1W31A 3T40A 3OP2A 1RALA 1FFRA 3WNKA 1J9YA 4EACA 3S5OA 4ZZ9A 2CETA 4NSBA 3C2YA 3GTFA 3U7VA 1ISWA 3ONBA 3PTQA 3IEBA 3IJDA 4XVEA 1UP3A 3AS1A 2DVXA 1DJNA 1RZMA 1PDYA 1BXCA 4IXXA 2PDKA 3AQUA 2YDRA 4MYXA 4F0KA 4TQTA 2DT1A 1EEXA 1W5NA 4KGJA 4F9JA 4LV9A 2C0AA 3TJLA 1KFKA 5DXXA 1M68A 2REQB 4LUIA 2IKGA 4WD0A 3VD4A 3A4AA 2WSPA 3NA8A 3ID7A 3YPIA 1EUAA 4F2UA 1AFSA 1OQFA 1YEYA 3BC9A 2VC6A 4OOUA 1ITQA 2A4AA 4QM1A 2GL5A 2PDHA 4HNOA 3AROA 4RK8A 1UG6A 1BYCA 1RBLA 3PBGA 1AJZA 3P5ZA 3GWQA 4IGHA 1MWOA 2BSLA 3LM3A 4HA4A 2WNWA 2ZRZA 4PBGA 4AHOA 4FA3A 5A6LA 2AKZA 1C9WA 4UQEA 3O0KA 1UP0A 4O50A 1JZ6A 3VOIA 2GJRA 3JVAA 2NLYA 5IFPA 2QF7A 2R1MA 4NHVA 2VGBA 3PC0A 3FFSA 3WQFA 4ZOEA 2CXGA 1X98A 3ZLGA 4YHGA 3G0UA 1AQ0A 4CQAA 3PBMA 4UZSA 2WZHA 3CUFA 4GC3A 5HR7A 3ERPA 3MVTA 2B4GA 4C60A 3GHTA 1ML1A 1O4UA 2BZNA 1EHAA 4HU4A 1FWHC 1FWJC 3B40A 2WMGA 3QMSA 1KCZA 5A2CA 1XSJA 4WVXA 5CXPA 4XD5A 4Z42C 4H7VA 4ICCX 5HQLA 4Z1BA 3GH5A 2H90A 4N0RA 4UMBA 4P5UA 1PX8A 3BMXA 3MYPA 4JKKA 1W9VA 3T0TA 1Q7MA 1ZENA 1UR4A 1J0ZA 3MCNA 2DUZA 2UWFA 4O0ZA 4M56A 3ES7A 1GHRA 2XIBA 2VD8A 4REQA 8CGTA 3SCUA 1ONEA 3EOUA 4KWUA 3OW1A 4PE8A 3CAQA 1RJQA 1M1BA 1CGYA 3W84A 1WBHA 1EEPA 4H9UA 4XAZA 2BY2A 4MNKA 4V28A 3T7VA 3MUY1 1W5QA 3THUA 1CXKA 3G1XA 2C3ZA 1I1WA 4GQGA 4JTHA 6REQA 1F4AA 5DFAA 5H1WA 2Z1SA 3VINA 4ORMA 2G3IA 3W7MA 4FNPA 1NTHA 2P0IA 1LLZA 2GQ8A 3L0NA 3HA1A 2BOFX 3LD5A 3KEHA 3VX1A 4DWSA 4PTNA 2VRKA 1WUEA 4WLCA 2DORA 2QMKA 5CEWA 1TKKA 3H2EA 1CGTA 3BLIA 1FWWA 3DN5A 5E93A 1NOFA 3KRSA 4AZ6A 1P6BA 1UB3A 4HU0A 3H7VA 2EEXA 3M6YA 1G1YA 3CGTA 4IX0A 1XIDA 1DWAM 4I9MA 1C9DA 4EX4A 4W4QA 4HN4A 3KUMA 3QV6A 2QCDB 5LKYA 4IOTA 1F05A 3HU7A 4UOQA 3DBNA 4GI4A 5AHIA 1WDSA 3TMQA 2WQPA 4J7RA 4TUFA 4ZENA 3S47A 1ONXA 3GR4A 4ORIA 1EYEA 3PSWA 5HNNA 1H0GA 1UROA 2R1LA 3KOZA 4MY9A 3ZIZA 3FGCB 4DM1A 3WYZA 3MMWA 3DFHA 4L5ZA 3CZEA 3MV01 5CKSA 2CERA 4US5A 1EXBA 3HGJA 2QHAA 4R33A 1UZ4A 5DMLA 1J6OA 2NX9A 4E3VA 1E1CB 2HPMA 3L66A 1PZ0A 2WPGA 3W7CA 1IV8A 3CPRA 5GJNA 3QY6A 2ZKMX 4UTIA 4S3FA 3E74A 4HN8A 2Z24A 4JY9A 4CCDA 5D2WA 2FZNA 3IRDA 2WSKA 1JRCA 4ONVA 1LUCB 4X2RA 1JFXA 4F2BA 3L9CA 3T55A 4TTGA 1ZJAA 2ZFAA 2GVLA 2QJJA 1B3YA 1T0OA 4MFEA 2CPUA 4V15A 1OC6A 4YTRA 4CU8A 2VKZG 2CU0A 3IIVA 4CD6A 4BR1A 1KRBC 3M5YA 5HNRA 4C1LA 3DGRA 1SZEA 2J8TA 2X7VA 1ZBKA 1CENA 2XH7A 4ZSTA 2ZX8A 2J7HA 3UPWA 1QK2A 2C1IA 1BVNP 2O0TA 4HVXA 3K4AA 2J24A 1JUEA 4JQ1A 2WZTA 4V1XA 4AQLA 3CB8A 3WNOA 3CIXA 1E15A 3VKAA 3S5YA 5A6MA 3WMSA 2FJKA 2YFOA 3UGVA 1PXGA 5AC6A 1MRAA 1W5MA 3OZYA 3CLMA 4JX4A 2G3JA 5AKQA 3ZJ8A 1UR3M 3WQVA 4JIHA 3PZOA 3G5EA 2WK2A 4IP4A 1QRQA 1XLHA 3WCZA 2ZWZA 2A3AA 1TA3A 3GW0A 4AF0A 5LA0A 1P7TB 3BSMA 2HDJA 3UA4A 4UWMA 1M7JA 1DJYA 4OV9A 4U5KA 3CWOX 4YYCA 1YIXA 5HUOA 4IIHA 3TLLA 3V1HA 3BG5A 1A4MA 1XICA 3MO4A 4I90A 1WDQA 2YA1A 2B81A 4A21A 3T42A 1KA9F 1KXVA 3DFTA 1TCDA 3USBA 1QOPA 1KC7A 3DC0A 3TOPA 3PJUA 4U31A 4F40A 4C6BA 2IKIA 1MDRA 3CTLA 5K9XA 3SECA 2DZPA 3BICA 1YNYA 3NL2A 3GX9A 2G4JA 4XB3A 1HVQA 3ISIX 2YB4A 3POHA 1YX1A 4EE9A 5BOEA 4UIOA 1IR1A 4H8NA 5KSWA 1C7TA 2NQJA 1VKFA 7TIMA 1HKJA 2IQDA 4PTVA 2E67A 4LYRA 4WSJA 1BWLA 1P0NA 3I4EA 1E0UA 4WX2A 3EWDA 4U3AA 1LYXA 4E5TA 2HXTA 1DHKA 3WQPA 2I5QA 3VIPA 3RCNA 3TONA 2P3ZA 1E1CA 1IWBA 3W1XA 2ZX7A 1W5OA 1FHVA 3HZ3A 2ZUSA 1FDJA 3QQ0A 1V3JA 2OSYA 5CBIA 2PU1A 3WDJA 3MHGA 1I0DA 3V18A 3LDVA 1BQCA 1Q8JA 3V16A 3NQEA 1YQ2A 1Y7VA 1V6UA 3E1F1 2PLCA 1J11A 4HHPA 3TK7A 3A13A 5T8GA 2OX1A 1OEPA 3VNLA 4L9ZA 4ZQPA 1RP9A 1GOKA 4UTWA 3V4BA 1KD0A 3WH7A 3QY8A 4MTVA 2GOKA 4JY8A 4Q3MA 5IXEA 2ATMA 2WCAA 3TN5A 3M07A 1TCMA 5B7ZA 3NTYA 3T81A 3SQMA 2GGJA 5FEZA 4XAFA 1TJRA 3NPXA 2VELA 3Q58A 3LHTA 1TUFA 5CZTA 1YKWA 2Z0IA 3FA4A 1NDZA 2TRSA 3W6MA 1KGWA 4KFOA 1V6WA 3CUHA 1KM3A 1UYQA 1LLWA 2DEPA 1GOQA 1J2BA 4NRRA 3QYQA 1SO3A 1UP2A 2DZWA 1TIWA 1RCXB 1XCXA 4QP0A 4QJ1A 3CH9A 3HOJA 4JEQA 3FOKA 1DWJM 5F1UA 2HEJA 4WJ8A 4LSBA 3EX6A 2WZMA 3R4IA 4BEUA 3GAKA 1R30A 1ZGDA 1F76A 2D73A 4IMAA 3HFTA 4AXNA 3RMJA 3TNOA 3MU7A 3ITGA 2V81A 3IGHX 5CAHA 3UJRA 4LCQA 3S2CA 4A35A 4TXEA 2WYSA 3LTPA 1V0KA 5AC5A 1BPLB 1D9EA 3S9YA 1ZCOA 4PMRA 5E09A 4OBSA 3W1MA 4E4UA 1F7BA 1FOBA 2OYMA 4JTUA 3SRHA 4B3LA 4JL1A 4A22A 3S2LA 3OZPA 2F9RA 5CBBA 2WPBA 2R6OA 3RCMA 3PFMA 1RVGA 1EDQA 3EX4A 4LGXA 5E1QA 4HZ6A 2RUSA 4J2PA 1FUYA 4HSNA 1QWKA 4M3PA 3HMCA 4UOJA 4DUOA 4JTCA 3O0FA 3W53A 1HJUA 1JUKA 4MG4A 2AGTA 4XBSA 2XVLA 4DJFC 4A8RA 3M7WA 4UXDA 3W76A 2G3NA 2RAGA 1KXQA 3BO9A 3RJXA 1EPVA 1XX1A 3N9KA 3UU0A 1S2WA 3TQVA 3WF0A 1OX6A 2ZTKA 3GNDA 4O8RA 4N4QA 1J0HA 1ZS2A 1EQPA 4ZB2A 1F61A 2GOUA 5HMDA 4DQWA 1FVPA 1PV8A 4S1FA 3FA5A 3HTWA 1EP1A 4RUBA 4B92A 3QVQA 4AISA 1XLBA 1MFUA 3LCWA 1F3EA 1WZKA 3NR0A 4NG3A 3RM4A 4D6HA 5JXQA 2RJHA 4MKNA 4NT0A 4I7UA 4FB7A 4D72A 3SJNA 2XIJA 4R9XA 3SDOA 1JR1A 3WEZA 5I0DA 1HP4A 4JYDA 2XVNA 8XIAA 4C6OA 2J9XA 1GJPA 3AMKA 1XYCA 3WLIA 3AXIA 3R58A 4IF2A 4M24A 5MKGA 2Z26A 2CFFA 3W37A 2DIJA 1XC4A 1AODA 1SFJA 5K4XA 1YXCA 4DJEC 1Q2RA 2QDDA 1X6NA 2E6YA 1J96A 1TZZA 1TE1A 5A5WA 2XUCA 5M5DA 3CL8A 5AB3A 1S2AA 1E71M 4ML4A 2W67A 3KBJA 1JI2A 4PUKA 1SZFA 3O63A 1KCKA 4TTUA 1G4TA 2PTDA 2J8GA 2R24A 2FLIA 4MGGA 5C8BB 4LANA 1UA7A 1F4HA 4PRWA 4AD1A 4PTMA 1OB0A 1RQBA 2EPLX 3FJ6A 3M6DA 2V82A 4D6IA 5K2ZA 1E55A 4YJ5A 5DXYA 1LLOA 4KETA 4NAEA 4BEQA 3CEUA 4ZVJA 2V3GA 4L4OA 2Y88A 4HTBA 3AXHA 1OZMA 2J13A 3ITLA 1QTWA 2IW0A 4O17A 4MJ4A 1V3IA 4OZOA 3OYZA 2FFCA 2A21A 4LVDA 1XISA 1UUQA 4INFA 2XVPA 1PX4A 4GIEA 1GKRA 5CLWA 5CPTA 4WXYA 3LGEA 4Q8OA 5E6ZA 3THCA 5AC8A 3MKVA 2DVTA 3TQPA 2XTKA 1JZ2A 3V0SA 3S2JA 2CCRA 5E0CA 4E6MA 2X40A 5FF0A 3QTPA 1EJTC 3MZ2A 3UWUA 3LTYA 1MXSA 2GJXA 4V33A 1GEHA 1A5CA 4WOQA 1VEMA 5DY3A 1W1ZA 1E3XA 4A3HA 4IGMA 1YTDA 1H1NA 4HHMA 1RAKA 1XIMA 1RCQA 1WXJA 1P1XA 2QJGA 3UQNA 1KM4A 3WLRA 1LQ0A 3L7RA 2QUTA 1HKVA 2PURA 2P10A 1TV3A 1HZYA 2B0MA 2Q02A 4US6A 2HTMA 5A6AA 2DV0A 3B97A 3IJQA 4IIGA 3PVFA 2XFFA 1FHUA 1V02E 3UR5A 2ZCGA 1GZJA 3W7GA 5BYWA 4HPJA 5BZAA 1EIBA 4FALA 2C1HA 3S0CA 2I1OA 1WKEA 1NDWA 4L6OA 4AYSA 3PZIA 3HQNA 3R8HA 4KRUA 1DJWA 1FH8A 4KEZA 2X1SA 5KZEA 1XBVA 1EJXC 3VAVA 2Q6ZA 1KRCC 4WOZA 2YL9A 4AZIA 3EX2A 1XDJA 1ZALA 1H7WA 2GDQA 4UFHA 4H3DA 4ZL1A 2E1DA 3QV9A 2QLYA 4TVUA 3A4JA 4XTDA 2GJNA 1KR1A 4LXFA 1B90A 2WCGA 1OFEA 4DI8A 1BG9A 5CZJA 2V3EA 1XYLA 2CLEA 2SFPA 1FP9A 1V79A 4LBUA 2RGLA 4IPPA 5G1MA 4EPBC 1WDWA 4K7VA 3GLCA 3PAJA 4AD3A 2A3BA 5H8MA 3KM8A 1UOKA 5DT5A 4LUTA 3QGAC 1K8ZA 5HJLA 2VM8A 1S38A 7CGTA 2QIIA 1IZCA 3K8KA 4NZCA 4C6EA 4GABA 3Q37A 4O14A 3U7BA 2BASA 1SR9A 3GE7A 5HULA 4H8VA 4CN4A 4TMBA 4UOZA 2Z27A 1XIGA 3TYDA 3MV11 4B5UA 2VZSA 1YPXA 2YZRA 4B5WA 1NARA 3AMDA 3RPTA 3G1FA 3I65A 4FP1A 1UD3A 3RM9A 4HOWA 1OC5A 4ERGA 3ARUA 1HW6A 3LB0A 4O15A 3FDKA 2VENA 2VP8A 4EXBA 2BXZA 3R10A 4LWWA 1QO2A 5D9PA 2OR2A 3IUHA 2NVAA 4XKMA 5A1AA 3WENA 1ZNNA 4ZQNA 3GTIA 4CCZA 4KWOA 2X16A 3SCSA 2TYSA 2NX3A 3FHAA 1ADSA 4U3CA 3P3BA 3W00A 1G4EA 3T1GA 3G77A 4MYAA 3APGA 3UP8A 4C65A 4NUWA 4MLJA 2IMRA 3TN3A 3MMUA 4EWJA 3GVGA 4MDPA 3IIOA 3W25A 3OO2A 4AX6A 1VB9A 1XLGA 5KITA 5GQBA 4U2YA 4L61A 1OM0A 2O9OA 1ENUA 4AD0A 1VENA 3N4AA 3OGSA 1FFQA 2YZ5A 5JBFA 1Z9AA 3S83A 3NQBA 4QDWA 5EKYA 4C91A 2VX7A 3VOCA 3VNJA 1NEYA 4O11A 1C8QA 2PLKA 1IXPA 4IL0A 4A3UA 1FWBC 3LMZA 4LB4A 2CLOA 3SQLA 5I3HA 2C14A 4GUIA 4O16A 3UEQA 3QFEA 1JDEA 2Y63A 1DXFA 1OT2A 3KP0A 4N42A 3S5SA 4WHBA 4AU0A 3VXGA 2Y85A 2WNQA 2YOCA 4C1NB 1BRLA 3P6LA 3IJ8A 3OA3A 4LEQA 1L8PA 2FZBA 4JIQA 1GVQA 3MQTA 4GXPA 1C3FA 1A4LA 4KCUA 1DE6A 3ABRA 3VNMA 1H09A 1ME7A 3QW4B 3SIZA 3WFAA 4LFYA 3BPWA 4LUSB 1E5NA 1HXJA 2I17A 2Z6JA 3BLKA 4IJBA 1DKWA 3OVQA 1PDZA 3VVGA 5I3JA 1TREA 4L7ZA 2ZZ7A 5CC7A 1W2PA 3VIFA 5EMUA 1XYAA 4KT2A 5GJPA 3AS0A 4C90A 2P5NA 3FVMA 2NWRA 3ZJ6A 1FWGC 1A3HA 1U1HA 3UYCA 2GDVA 2FGLA 3WMCA 4I9AA 3SUWA 1B31A 3CO8A 3NAVA 1XWYA 1UHVA 2WMKA 3GH4A 2ZA1A 1QW7A 2OGYA 5AVNA 4C7DA 2E3ZA 1FKXA 4PMVA 2O7QA 1S5NA 2WJFA 2JKEA 3AS3A 1ZJBA 4H4IA 1K03A 1WV2A 4PCTA 3THAA 1OBAA 3VGGA 1OX4A 1FCBA 3UZYA 2PBOA 5C9XA 1X1ZA 4IMFA 2EJ1A 3M9YA 1M6JA 2OO0A 4Y9MA 1REQA 3SGZA 4C6NA 1Z32X 5A8PA 3SW6A 3ONCA 3EOLA 1VPQA 1TPUA 4PTXA 4P61A 1E0VA 4LF1A 4L1XA 2D1ZA 5EMKA 1CB2A 1OC7A 5FAJA 4MVAA 1XDMA 4FIRA 1W1TA 4IPNB 1TWIA 5FSDC 4XAPA 1H50A 2GK1A 3VD7A 1RH9A 3MWAA 4J40A 4DWDA 4F2TA 4RDZA 3KP1A 4PYSA 3UR7A 2R8WA 3DAQA 4JTLA 3C0SA 1A5MC 2OSWA 3SRKA 1AH3A 3G1RA 4H2CA 2ESCA 2IPFA 3M7SA 1YRRA 2NQ5A 2PDYA 2OSXA 1RP8A 3R5EA 4MJMA 5GNZA 4XIMA 2Y24A 1CNVA 1I9CB 3K1GA 4O0QA 4JL2A 3MCOA 1TUXA 3A9BA 3TLQA 3UCDA 2CBIA 1XYZA 3AIUA 4HNCA 1A53A 3TUUA 2Y5SA 4XWUA 1IWAA 2FTWA 4S23A 1KM0A 1XLFA 5C6MA 5HK4A 1EOKA 1MO0A 1R46A 2YKKA 3NZRA 1K6WA 2DZSA 2E9LA 3QFWA 3LG3A 2FTPA 3MI6A 1VFFA 3ARQA 2VGGA 4K8GA 4R3UA 3I6RA 3CUZA 4GA8A 1NM9A 2E8YA 2HRWA 4PH6A 5IDIA 2O9PA 3GDKA 3VDBA 1JL8A 3A4XA 4AIBA 1W2VA 4UQDA 1A5BA 1TELA 4I8DA 1DWHM 1UJQA 3P0WA 4WY0A 3OVRA 4CGTA 3URQA 3B9OA 4D6CA 3BAWA 3RX3A 3N17A 3NEVA 4JGDA 4NAFA 4HD5A 1JAKA 2UV8G 1KM1A 1WA3A 1EB3A 3M46A 4ERAA 5FJTA 1VCGA 1XPYA 4NX0A 1TV7A 1VPXA 4KMQA 1SSGA 3FY1A 1EO5A 2OVLA 1OGBA 5FACA 1G69A 3URBA 2QIWA 1JD9A 1K02A 1MEWA 4KFPA 5SWUA 6PTDA 2GGGA 4DF2A 2E4TA 4NYUA 3WUBA 2JIEA 2Y7DA 4YNGA 2A7RA 1KV8A 4HK6A 5DT7A 1MUMA 4D71A 2BGNE 2DUAA 2QDGA 5I3FA 3W01A 1VP5A 3LRLA 1SJBA 3MT1A 1KV5A 2B31A 2E6FA 1WOAA 1QK0A 1B54A 3VIHA 1T8XA 3ANYA 3S2NA 1EJRC 3KXQA 3MUZ1 4LALA 4JDBA 3QR1A 1R9ZA 1W1PA 4AEEA 3XIMA 1YXYA 2F2KA 2NT0A 5JBDA 3K13A 7XIMA 1XF0A 1TQXA 4K38A 1XBXA 4A6GA 4C6CA 1LOLA 3CUJA 1FBAA 2QCLA 1E40A 2PGRA 2Z29A 1D2KA 3W26A 1FWCC 1XRSA 3ANVA 2OOGA 3EPOA 4PMNA 3E9AA 2PLJA 3NQAA 2BHZA 4X61A 4OV4A 3AAMA 5A2AA 3ZVHA 3ALFA 3DKJA 4DO5A 2YPIA 1UPPA 2QCHA 2VOMA 2F6UA 4WY0F 4UZUA 5FL0A 3WMLA 1C29A 3ATZA 4D6GA 3MCMA 3TFXA 4JQ2A 3AJ7A 2XFYA 2FMNA 1VFTA 1EJVC 3R13A 1DXIA 2WMIA 2BHYA 1UQZA 2J74A 4EXAA 3VD3A 4C5YA 4GNJA 2ZC8A 2VC9A 2I7GA 5IDZA 3QV8A 4KEVA 3OBKA 4M29A 1JNDA 1G6CA 3MYOA 4IIBA 4N6EA 5LHFA 3N73A 2Y8UA 5JBEA 3N3MA 3ZXWA 4EIVA 3GK0A 1GOWA 3MS8A 2EG7A 5CH9A 3N6HA 1MFVA 3IPWA 3WD4A 1ZAIA 2OZTA 2PODA 5BCAA 2WVTA 3EX1A 4WSKA 5C0QA 4B5TA 1TWSA 4BWLA 3GHSA 3VOFA 3GW3A 5FJRA 3CM4A 1MZHA 2CHOA 2G95A 3QR3A 3PZMA 1R3TA 3CWHA 4UC5A 1AMKA 4MPKA 3URAA 3Q65A 2FYMA 2ZADA 4H6RA 1YMYA 1EWDA 1OYAA 2DDXA 1QI5A 4AIEA 4LY4A 1WXYA 3BSGA 3LSBA 3A3WA 5A2BA 2GSHA 4F48A 1IZKA 1A0EA 4M6UA 3EB2A 3B8WA 3O15A 4Q7NA 5I00A 5LYRA 1VFMA 3TCEA 1KXHA 4KWSA 3RU8X 3FVDA 4FO4A 3SCRA 5IHRA 4Y9AA 3H2CA 5A6KA 1FCQA 3ZSTA 3GG7A 2OLHA 2GUUA 5LIUX 3U57A 4JTGA 1CZ1A 5HDRA 2CLPA 1ZLPA 3W2KA 2EG8A 4QXIA 5EU9A 2CZ5A 1QOXA 1UIPA 3OBAA 5FF4A 4DO4A 1R2SA 3SAZA 3CT2A 4MWAA 4IFKB 4XZIA 1YDVA 5H8PA 1JPDX 4IIDA 4GVHA 5I7GA 4JTQA 4IPIA 3PUEA 1TRDA 4F0SA 4GZJA 2CBVA 1I0BA 4DUWA 4Z08A 3L4WA 1Z7AA 3RRXA 3WLMA 3VM7A 1R3RA 3MMDA 3WK2A 3CZLA 5CGQA 2ZRXA 4TR9A 1GTEA 3NXLA 2J7BA 3W1PA 2WOQA 4XSMA 1WUFA 3R2GA 3KRUA 3DFSA 1J4EA 5ECVA 3T9PA 4WZHA 3V75A 3SURA 4HCDA 4J5NA 2FZDA 5CPLA 4H7ZA 3B8UA 4XQ6A 3FGCA 2VQUA 2IQ0A 2R14A 4AZHA 4H9XA 3A9IA 5DMYA 4GJ1A 1LORA 4M51A 4PB4A 3CIWA 1OGGA 2PC4A 2ZA2A 3GNNA 3BLEA 2WC7A 5AYIA 5FA5A 4KCVA 1AMYA 1GEQA 3EBVA 3DERA 1H63A 1LT7A 1MXGA 1V0MA 2E09A 1PTAA 1P48A 2HS8A 1LWJA 1DJHA 2WKLA 3M43A 4HPGA 1J12A 3W07A 2NT1A 3VE9A 3SO7A 2CBJA 2W92A 3P8JA 2VRJA 4LCRA 5BRPA 1XIJA 4FR1A 2FIQA 1I2RA 1MZRA 2VEMA 3ALGA 1F07A 4ACYA 5FJIA 4GI6A 4H04A 1EA9C 3CB3A 2ZXDA 4JTAA 1UR1A 2HVNA 4TO8A 3AYVA 4U5IA 4H8HA 3M0LA 4PEKA 3M0MA 2HZGA 1CLKA 4UMAA 3BQ6A 4FHAA 4FIQA 5D05A 7REQA 5JH1A 3CUIA 3GFZA 2J88A 4P7QA 4R85A 3B05A 4GPNA 1WKFA 3PZUA 4W7WA 2E68A 1POJA 4NF7A 1UKPA 3S2MA 3BOLA 2Q01A 2OO6A 4U33A 3B9NA 2OZ8A 5I77A 3RIKA 1K6AA 1OFQA 4ZB5A 2A0NA 4W85A 4G7FA 3AHZA 4OE7A 2C16A 4LUYA 4Q8MA 2J27A 3WLJA 4NJJA 2V2CA 2YA0A 4HMCA 4MOZA 4XKYA 3GDLA 3O7UA 3N2BA 4G8TA 4AZBA 3AMGA 2VEPA 1RXOB 4GKLA 1QPNA 1JZ5A 2A3CA 4CD5A 1FP8A 2DSUA 3S5ZA 5CC3A 3WLQA 3HM7A 4PB3A 1UC5A 4XZ9A 5DELA 4GISA 2I5GA 1XCFA 1VIWA 1US2A 1YNPA 4H00A 4W5UA 1X7IA 1QI3A 4FF5A 5G1YA 1OX4B 3VIMA 4HPXA 5CZ0A 1JCMP 3LLXA 4AVFA 5J5DA 4Y8FA 1OCQA 4K37A 4H6QA 1KRMA 3O6AA 3SCVA 4O1EA 1P6WA 4LAKA 3UYIA 1F8MA 4MZ8A 1DHPA 2ABBA 3SB0A 1A47A 4GC4A 1F3TA 1EJWC 3NDOA 2B7NA 5HBFA 3W1UA 4YLWA 2X0SA 1CWYA 3BZGA 4AWTA 1VLIA 4JTIA 1BGAA 1EBGA 1PO9A 2VCBA 4BCEA 1VFOA 3LYEA 3QV7A 1ZTVA 1MMFA 1U1UA 4W9TA 4UTFA 2H3BA 4Q8UA 4P7LA 3GYCA 3G0SA 4GINA 1MQPA 2WBGA 4AZCA 1WDPA 5JU6A 5H2ZA 5DN1A 5M2FX 2WHMA 4D1JA 2W27A 1ZP3A 3VOGA 3NURA 4GQ0A 4J4KA 1SJAA 1Z3NA 3NQCA 1DPMA 2EAWA 4Z2LA 1LL6A 4Q22A 4JEJA 3QPEA 2AMGA 3QKZA 3IJ6A 3GRIA 4X9SA 4NZ3A 1DE5A 4B90A 2VEGA 1W3HA 3VIKA 2I56A 3EWUA 1A5NC 3WD2A 3PG9A 3TNBA 1J8VA 1GQLA 1E51A 1NWRA 1ECQA 4IMGA 4ROQA 2ZQ0A 3WQ4A 4IT1A 2WLYA 4UTLA 1PZ3A 2BTMA 5ABFA 2VZTA 2HVMA 4MWAE 1UH3A 3H53A 4KIRA 1ODUA 1C92A 3PM6A 1VLWA 1E4IA 3TN6A 1XH1A 2ACUA 1RHCA 5DEZA 4AUBA 3KE0A 1Q6DA 5H91A 3QW3A 4Z0SA 4PTWA 1UCWA 4BFAA 1WE5A 3O8AA 4M6VA 1B3WA 5AZ0A 5AFDA 4XVDA 4XIAA 2X1UA 2AAAA 2ZVRA 2Q71A 1DQXA 1T40A 3UR8A 4JFVA 4DVOA 4Y8EA 4PRTA 1GQKA 2GSEA 4DJDD 5I07A 3T05A 3CV1A 4C6KA 1KBBA 3K2GA 3NZGA 4CVUA 3F03K 1SZGA 1K4GA 3TE9A 3VUPA 2FZ8A 4FAMA 4G9PA 3SUTA 3QZAA 4HMNA 4H19A 4L4LA 2J7CA 4MF4A 4DLMA 1TJPA 3IJ9A 3O6CA 3KOXA 3LS9A 1N8FA 4XO7A 4ATWA 2R91A 1VYRA 1PIFA 4XAYA 2CWNA 2YB1A 1OF8A 2XPKA 1XDLA 3OB8A 3N11A 2XWEA 9XIAA 4GNKB 3B0PA 1C93A 1JCXA 4I6VA 4GVFA 4QTGA 4I7VA 3VC6A 1H60A 5U4NA 2PRLA 2X1TA 3O6DA 4ATLA 4P8VA 4O53A 2PU0A 3CS2A 3OU8A 3R8RA 1QPOA 1TV2A 2AMXA 3PPHA 2NSOA 3KCOA 5BOFA 3ABQA 4QG8A 3B9AA 3LSCA 1WDRA 2WV8A 4GUJA 1EKOA 4GJIA 1JPMA 4Q4KA 3BAIA 3ZR4A 3CPGA 4QX4A 2V2HA 2NXHA 2V5KA 4RDYA 3R94A 3GUGA 3PB0A 4TV5A 1S1PA 3LBOA 4HNUA 4UNIA 1VYSX 1Z6KA 1BVWA 3N2MA 4LBRA 2Y5EA 4JDYA 4Y9PA 2CZVA 2GJLA 1TR1A 2QUNA 1JCYA 1O5XA 1ZHAA 4J3UA 4ZOAA 4KEUA 3WBYA 3W7DA 5GNXA 4HU8A 1O94A 1R3QA 2D2HA 5J8LA 2CLMA 3H21A 1BYBA 1I2PA 4RL3A 2AGKA 5PTDA 4HK7A 1K9EA 1RV8A 4O57A 4GACA 5D02A 5I09A 4UR8A 4CNSA 4QIUA 3LV6A 3VM5A 3KLLA 1TVLA 4CQDA 2DPEA 3VIJA 5FOOA 3LCFA 1I75A 1D7FA 3C2EA 4OIFA 1OG0A 2FGZA 1C90A 3N2CA 1MSSA 4PMZA 4I6KA 3UZ5A 2YBVA 4J3XA 3LXAA 3AC0A 1A5LC 1QBAA 1JULA 4S3AA 3L12A 4WDUA 4E2OA 1G7UA 4HA3A 3NXFA 2QNEA 2WJDA 3WH6A 5CC5A 1EP2A 4UTTA 1BYAA 4JQ4A 2QAPA 1DP0A 2ZZ4A 2A2IA 5LA2A 4M82A 1S1RA 1AW2A 1GWJA 5DQPA 3QZEA 1NDYA 1S5TA 3GU2A 3M0JA 4CN6A 4H01A 2D0GA 1XH2A 3LLDA 1T99A 3A64A 3EXRA 3NQGA 1J5SA 1G4PA 5G2HA 2A3EA 2PDWA 4NZFA 3BJSA 4HZ8A 1O12A 1R7OA 2Q09A 2GQ9A 2PMQA 1S5MA 2D0FA 4IICA 1HJXA 3VI2A 2C19A 3I3EA 1R5YA 3BLFA 3NQ6A 5ECUA 3FXGA 3W74A 4QS5A 3BUVA 3NG3A 4HMDA 1XP3A 3ABXA 4ICNA 2C79A 3KZSA 1H2JA 1MW1A 3W6YA 3TFCA 5EB8A 3SY5A 5E0KA 3UWYA 3KBSA 1HUVA 4Z17A 1EQCA 3T2OA 4D6FA 1SFLA 5CZSA 4BHYA 1KB3A 5HR6A 4JN6A 3S8HA 3JR2A 3CWNA 2B7PA 4FI4A 3LBCA 4C6PA 1V03A 2OWWA 2V30A 3QY7A 3PNUA 2OZ0A 3DYPA 2WZEA 1OT1A 2WSYA 1A3XA 3K4WA 4CN1A 4I5RA 2ZC1A 1PTGA 6REQB 1ICQA 3CH0A 4UFMA 1GTHA 1V3MA 3ARXA 3S9IA 4QE5A 1TV5A 2J66A 1GG1A 2WWDA 1LTDA 2ISSA 3IK4A 1IEVA 1ZP4A 2PF8A 2I9EA 4DRSA 3DGBA 4GXWA 2QJIA 3ZS4A 5LNWA 3UF9A 4AVNA 5HXMA 4PUUA 4C7FA 3P82A 4XZHA 3PG8A 3I4KA 2AL2A 3T0AA 4AZGA 4PTDA 2PP0A 5TF0A 1HVXA 3RILA 4O4WA 4OQVA 2EPOA 5I6SA 4QCEA 3VILA 4MDOA 1R2TA 4W7UA 2GQAA 2AQWA 4CNTA 2WJEA 3TP4A 1NOUA 5LNRA 1N8IA 3BV7A 3UG3A 4MNMA 1PBGA 4D6JA 3T2QA 4ALDA 3AU2A 3BW3A 5CG0A 2A5HA 4FNSA 2ZX6A 3CLWA 3FHQA 3F2CA 4J9JA 4GIYA 5IBXA 3W4RA 2CHRA 5AN7A 2QCMA 1JYVA 1Q4NX 2DUXA 3TYUA 4NZJA 2ANUA 2QQ6A 3RM8A 4GOAA 2WQDA 2ZVIA 2XISA 5LIKX 5FI8A 1XIHA 1L6GA 1JCJA 7PTDA 4EOUA 4RCXA 2VQTA 3ARWA 2WLZA 1NF7A 4ZODA 1JD7A 1ISXA 5FCZA 2VCCA 5EPDA 1UQYA 3AS2A 3PPGA 1E6XM 3SM0A 4HQVA 4PBFA 3GB6A 4YHEA 2XM2A 3GUWA 3U5UA 1EL3A 1SUXA 2Q8ZA 3IANA 4QDMA 3N9RA 1AJ0A 3K8LA 4W89A 1ZAJA 1E6PA 1NIUA 3EB3A 2HCVA 4S39A 4ROPA 2EHHA 2HK0A 2PI6A 4N9DA 4QS6A 1O6IA 2BOEX 4K2SA 1UMYA 5D2VA 3SCPA 1GW1A 4X63A 3TWAA 1EC9A 4HNVA 2ZIDA 1X8CA 4Q8PA 2YIHA 1DJIA 2GVEA 4O1FA 4GYFA 4ZGYA 1UKQA 2WANA 1CTNA 1PYMA 1OHLA 2QUUA 5CPOA 3W2LA 4S3CA 3F1QA 2I5IA 4Q8VA 3VNYA 3GKAA 2YW3A 1BSIA 3UWEA 3B8DA 3JUGA 2QKFA 2J77A 1JGMA 4MIMA 3WH8A 5G2IA 4D6DA 4NZ1A 4ATDA 3I3DA 4BS0A 1L2QA 1W9UA 1ALDA 1VRXA 3NM1A 4A2RA 1F6PA 9XIMA 4DBEA 4RNIA 3LCGA 5JIWA 1KLZA 4ZXOA 3S6TA 3AICA 1J01A 4O8AA 4DUXA 3WDIA 1Z41A 2XGZA 4W5ZA 3HJEA 4UCFA 3R89A 2EKCA 1KFWA 4YTTA 2G50A 4GIAA 3SCOA 1FHDA 4DM2A 1HKKA 3HB9A 3UNDA 3PANA 4UFLA 5T91A 1BRLB 2W0UA 2JFEX 3SCWA 4JN7A 5HOSA 4PUWA 4PL2A 1XIFA 2AQVA 3RN6A 1BF6A 4DXKA 2E77A 5ABEA 1VS1A 1MNSA 3THDA 5HA7A 1J0JA 2WMHA 1MW0A 5FF2A 1KM5A 2ZRUA 2DT2A 1DEDA 4RZBA 5CSUA 2BGSA 4IPJA 1I2QA 4GUGA 1PPIA 2Z2AA 1H5VA 3V5FA 3HPSA 4A8NA 1EXPA 3L4TA 3KS5A 1J18A 3NQFA 2ZUVA 4DO6A 4XSLA 1BF2A 3UXDA 3BZJA 1QOQA 4YU1A 1WNOA 3K46A 3RK8A 2P8BA 1U22A 2VXNA 3BQ5A 5A6BA 2CESA 3PZQA 4OU1A 4IQEA 5DX7A 1H7OA 4Q6XA 4CQ8A 3VMPA 3EEGA 4XBKA 1E9LA 5CSSA 3CTTA 3WQ5A 2YCLA 4HBKA 5CQ1A 1XCWA 4ZOBA 4RXGA 1BLIA 2DQXA 3BGJA 3GIYA 4B5SA 1JG9A 4WKHA 4PCNA 1JYNA 5CPNA 2YL5A 3B4UA 3FEMA 2H3DA 1OYBA 2ZXQA 3TSMA 2QEZA 4GYPC 1C8YA 3HV9A 2UY3A 3V7PA 3MHFA 2YGYA 1E0XA 1TMQA 4HZMA 4D8AA 1B57A 5IFTA 1OSEA 4Y90A 1E9ZB 3GC2A 3F4DA 3L4VA 1EZ2A 4YWSA 4UTWC 2FJUB 1O1HA 2FDSA 4EF8A 1W9DM 3STFA 1KLYA 5CSRA 4Q4PA 2CKSA 2IUZA 3ZQ9A 1T6MA 5CGTA 5CG7A 4O54A 2JBMA 4TU1A 3H2FA 3HG3A 3M0HA 1HKWA 3TW9A 4W7VA 2HS6A 2XH4A 1XXXA 4X9YA 5LIWX 2JGQA 4LB3A 1P5BA 4JHMA 5JIPA 4ZSUA 1FWRA 4NI8A 4WEVX 3APTA 2ZICA 4C6FA 2OEKA 4EK7A 3U48A 5CLTA 3C8FA 3EGJA 5D4YA 3AISA 4Q4OA 2XJ7A 4QE1A 1B3VA 3AHYA 2CW6A 2R82A 3ARSA 3GTHA 1F3XA 4B2DA 1EGZA 1A5SA 4JTRA 2G4FA 1KQYA 2QULA 1TPEA 4YCOA 1YDYA 2OFJA 1W91A 4QRNA 4GYPA 3OOQA 4IG2A 2DT0A 1DIDA 3VOHA 1YNQA 2V5CA 3L4ZA 1G01A 1D8WA 3C86A 1Q6RA 3B03A 5BW6A 1F9CA 1LT8A 5EL1A 2YXGA 3TAOA 4LVFA 3PS7A 4RJEA 3BANA 4F9DA 3EMCA 4LS0A 1Q45A 4B15A 2X41A 2OYLA 1TPDA 3L21A 3L4YA 3TYEA 3JRKA 3W2JA 4FNUA 3NUKA 4DLFA 4LYQA 2MUCA 4J35A 3TJXA 3OJGA 3B0UX 1TWWA 5A6BD 4Q33A 4D8ZA 4IGNA 1Z48A 3RGTA 3M47A 1B30A 2HPIA 3RRAA 4XKYB 3V5CA 1XHGA 2QR6A 3QHNA 1TQJA 3G6MA 3LV5A 1H3GA 2NV1A 3P80A 4GUFA 2WB5A 2QCGA 3H22A 1E4LA 4GGHA 2PDBA 3RYSA 2OZ3A 4K6AA 1B1YA 1P6CA 3W1TA 4QSFA 4TX9A 2XSXA 3WF4A 2F6KA 2PTXA 4KQNA 1EZWA 3G1YA 3Q4DA 4GUHA 2VEFA 2PFHA 1Q6QA 1KFJA 1Q6EA 4KH2A 1S2CA 5XIMA 4Z1YA 3MBDA 1VC4A 3SGGA 1U30A 4PUJA 4OTKA 1QCWA 2C1GA 2VD9A 1CGWA 2XSBA 1UKOA 2PTYA 3RNDA 1X7FA 3OLEA 3WG6A 3E12A 1Z42A 5FEPA 4GNVA 5XINA 4JS3A 4FK9A 2X0HA 4CU6A 8TIMA 3RITA 2XIOA 3PP7A 4NASA 2W6RA 1LQAA 3PZNA 1HG3A 3KTXA 1U33A 3E2VA 4HNNA 3U5YA 1KTCA 1TMLA 4GE8A 1SZNA 4C5ZA 2ZUTA 1CGUA 4U28A 1EOMA 5AHNA 3B0YA 3ARYA 3NO1A 1REQB 2CEQA 1V6VA 2J62A 2VC7A 3BLPX 5H6HA 1WOBA 4RE0A 3J7HA 3JW7A 1UWTA 4H83A 4REQB 2VDGA 1AW5A 3FK4A 3IVUA 2EBNA 1Q5MA 3H4XA 4XO6A 1PSCA 2Y89A 1NAL1 3ARRA 4AD4A 2WWCA 3E0VA 3NQ7A 5K9DA 3UWVA 2VEIA 3OIHA 3MP4A 4CNPA 4P2VA 5KETA 2OJPA 3W2UA 2J25A 1XV8A 2PPGA 2V6AA 1CIUA 3BAKA 4AD5A 3NDZA 4LAUA 3NQDA 1E1EA 2FTYA 1NQ6A 2YCIX 2NW0A 1FX6A 3N15A 4AXKA 3W7PA 6CGTA 4X0NA 4R9OA 4JYFA 4QHRA 4M7SA 2QVHA 3CV6A 2F84A 2XN0A 3W81A 1EJUC 3M64A 4LUSA 4S2BA 3E0IA 3HURA 3IVTA 2XN2A 4K36A 1K8CA 3VGDA 2HNHA 4H6EA 1DORA 1HTIA 1W1IE 5DRCA 4O18A 4TX8A 3KDOA 5A3HA 3HGSA 5F2IA 1TPC1 2WJZA 5G5IA 1OY0A 3U0HA 3TEVA 3OTRA 3MANA 5TIMA 1CXHA 2PTWA 1XSIA 4LV4A 3TV8A 3OZMA 4IUOA 3RPDA 2BB0A 3LENA 3SFWA 3A4WA 3LNMA 3NO5A 3BV4A 3DH7A 1EC8A 1EX1A 3C5QA 3GAYA 2YR1A 1TTJA 2P1FA 3SUVA 1K8YA 3ORWA 3NO3A 3QN3A 3H12A 4E0CA 2BMBA 5ABTA 3S9ZA 3DX5A 4W8AA 5I3IA 1GOIA 2A85A 3TN4A 3VCRA 1Y65A 3TROA 3POCA 3DCPA 4P8WA 1A5KC 4KEMA 1TPB1 3DDMA 4FEZA 2PWVA 1Z44A 5I3DA 1W3LA 3ARTA 4DYEA 3LN3A 1N82A 2QDHA 4AY7A 4YTUA 4CCEA 1GORA 2DFAA 4DAIA 3KHDA 3IVSA 3V36A 3TXZA 4LT9A 4XISA 3ZSSA 4PC8A 3OA5A 3B9EA 1HO4A 4CU7A 3F2BA 3G6LA 2O4MA 2AAMA 3QSRA 1V0NA 3QBUA 3IIZA 2EXOA 4EAYA 2W61A 2X1IA 4O12A 1G94A 5IM51 3CU2A 3VNKA 4LH8A 5DMMA 3M1ZA 3W1QA 1XLLA 3GDRA 3ITXA 2JEPA 3W7KA 3WQEA 3G8RA 3STGA 3D3AA 2JF7A 3PZTA 2VGIA 3CBWA 4EPKA 3AIEA 2QPUA 3GXIA 3ZWSA 4FXJA 1QFEA 3LHWA 2PD9A 4UQBA 1L6WA 3R0KA 3BK0A 2ZZ5A 2NUYA 3FSUA 4UQCA 2DH2A 4Z2KA 3KOFA 2XZ7A 1AD4A 2D2GA 9CGTA 2R1KA 2HBVA 3EX3A 4MKVA 3KBWA 1E9YB 1XYBA 3W3OA 3RLGA 1KBLA 2IS7A 3BOXA 1E6QM 2NQLA 1IT8A 1KBIA 1L6SA 4ILSA 3GU9A 4C1KA 3LUTA 3XINA 4NNBA 3TJ4A 3TU9A 2OEJA 2Q3RA 1FY6A 2TMDA 1V7YA 4YVPA 2CIPA 5D8ZA 3TZNA 2C15A 4NQ1A 1Z89A 1GOXA 3D3FA 4D9PA 2NXGA 3KTCA 5TNVA 2CLFA 4G2DA 3UVIA 3UXIA 3W2MA 3FJLA 1RQHA 3EWZA 2PWHA 4E8DA 1TTIA 2PZNA 1S5VA 4M1BA 3GC5A 5D09A 4IMCA 1X1NA 4CNOA 2INFA 4RE4A 1QT1A 3QGVA 1XLAA 2FGBA 4TOQA 3G1DA 2X05A 1F6YA 2AL1A 1W0MA 1VR6A 2ZWYA 3U8GA 3WQ8A 1BQGA 1JUBA 3HJZA 4AWSA 3FAWA 4DJFA 4R5EA 1KKOA 4PSPA 3WX7A 3BE7A 4R34A 3MB9A 4FX8A 3OHIA 3K8MA 4PEEA 4JX5A 4ZQOA 1OCJA 3HF3A 1UWIA 3U2EA 1VBGA 4JHOA 1QO5A 6A3HA 1M65A 3MUXA 4C7GA 1M3UA 1XLKA 2PDXA 1IQ8A 1XGDA 4FNRA 4KGLA 4NP7A 3MUCA 2NUXA 4KIEA 3S6DA 4O52A 4PMDA 1XUZA 5ABHA 3FW6A 1TRIA 5A6JA 1Q4WA 4IJRA 2XFRA 1VFLA 1XC6A 3WDPP 1PAMA 3LCHA 1DQWA 4M7TA 5K9CA 3HGRA 3DFPA 5F7UA 3GYEA 3BTNA 3Q67A 4FZIA 2ACRA 1PWMA 5EFFA 2O56A 3CC1A 4M19A 4GY1A 3PB2A 1BGGA 3CO4A 1IT7A 5K7JA 3EWBX 5CPSA 5F1VA 1BKSA 4ERIA 3CMFA 4MKSA 3BH4A 3LK6A 3SI9A 1OFBA 4OBRA 3BLOA 1P43A 1UZHA 1TSIA 1J10A 3TVAA 3QHMA 4B4FA 2CLIA 3MVIA 3DECA 1KRAC 4WDXA 1NOWA 2I14A 3UBPC 4NIRA 4K68A 1WXZA 3UXLA 1V4YA 4QFUA 3CYJA 3EWWA 3W1NA 2QW5A 4UR9A 3T0CA 2IPGA 1W56A 3AMCA 3CASA 2XIIA 4RPPA 3TKFA 3W27A 5AY7A 4UMCA 2L5HA 1ZUAX 1UD6A 4MWAB 2HXUA 4QEEA 3IGUA 3WBAA 3WEMA 4KBXA 1QVBA 2PBGA 3HFYA 2V5LA 2O9TA 1HGYA 2ZZ3A 1UKTA 4MMWA 2XDFA 3EPNA 2PCQA 1LBMA 1AVAA 3MSGA 3TZFA 4ACZA 1O1ZA 1MW2A 3PBUA 4UTTC 3N1AA 3QLDA 3DG7A 1TZ7A 5FIPA 5BXSA 3TW7A 1E4NA 1GG0A 4FMVA 3GXFA 3PUGA 3BGAA 6XIMA 4AWEA 1LZOA 2AKMA 1RA0A 2R9RA 2GSJA 3N12A 1XFCA 1KO0A 3CHVA 4QCFA 4P8UA 1O60A 4IQJA 1AW1A 3NQMA 1BKHA 3ZLFA 1DIOA 3DXIA 4MB3A 3GHUA 4JNMA 4JIPA 3WNPA 3EWCA 3QOKA 4UB9A 2YCLB 3BLDA 3NQ2A 4JFWA 5TAOA 1R87A 4WGHA 4GH1A 1R3VA 3PWAA 3CQ0A 4S3GA 1BAGA 3O3RA 3O1NA 4M8UA 3IUIA 3OPSA 3E6EA 4F3HA 4F0MA 2QGHA 3AUJA 1JFHA 2WSRA 2ZUUA 2VC5A 3GNRA 4UTKA 2EPHA 3AZTA 3DYOA 3KBVA 2PWEA 3IK2A 4JTSA 3LHYA 4B4HA 3IARA 1C8XA 1TR9A 1KBKA 1UJPA 4DELA 4OECA 4PCFA 1H1YA 3UCQA 4X22A 3NVTA 4PUDA 3MTWA 4EANA 2ZTJA 4MJZA 3UWQA 1HN1A 1XLJA 1X8FA 2Q8LA 4IFKA 3LPFA 2Q3OA 2IKHA 3EMQA 2QYGA 3I68A 2D2OA 4ZFMA 1EGVA 3K4DA 3L4UA 1V6YA 3WLNA 3UETA 2WCSA 3W75A 1UR2A 1BWVA 1R2RA 4YTSA 1QPQA 4F8XA 2ZUWA 3R25A 1UD5A 4AEFA 5C7VA 3QZ6A 4M5PA 4ZA0A 1NWTA 2OWCA 4AAJA 1TPFA 4HYWA 1P0EA 1WZLA 2GGHA 4F0HA 5LZLA 3IWPA 4BK9A 2V38A 4Q8TA 1QI2A 3VIOA 4Y9NA 3ZJKA 3LCLA 1VPYA 4C6JA 3O07A 3LQGA 3G1VA 1FXQA 4J1OA 4W8BA 3L5MA 5J04A 1E4MM 1Q2SA 4PULA 2QZRA 4JYEA 4AHQA 4CNNA 3H70A 4LC8A 4CCCA 4WIWA 5FJUA 4RR4A 3PTMA 4LAOA 4K8HA 1ZB5A 3R43A 2V63A 3W7QA 5LHEA 4B9YA 2QF8A 1LWIA 3KL5A 5F4SA