1YNPA

Aldo-keto reductase akr11c1 from bacillus halodurans (apo form)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
298
structure length
283
Chain Sequence
HMKKRQLGTSDLHVSELGFGCMSLGTDETKARRIMDEVLELGINYLDTADLYNQGLNEQFVGKALKGRRQDIILATKVSKAYIKEAVKDSLRRLQTDYIDLYQLHGGTIDDPIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGVSVVVRGPVARGLLSRRPLPEGEGYLNYRYDELKLLRESLPTDRPLHELALQYCLAHDVVATVAAGASSIDQVKANVQAVEATPLTAEERQHIQKLAKAAVYEQHRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oxidoreductase
publication title High-resolution Crystal Structure of AKR11C1 from Bacillus halodurans: An NADPH-dependent 4-Hydroxy-2,3-trans-nonenal Reductase
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
total genus 103
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ynpA01
1K8CA 3BUVA 2P5NA 1Z3NA 2PDQA 2F2KA 3LD5A 3D3FA 4XZNX 4YS1A 4FALA 1JEZA 4EXBA 4OTKA 1LWIA 4PUUA 4JTQA 4XVEA 3B3DA 4GACA 2IQDA 4PRTA 5LIUX 5JH1A 1Z9AA 2HE5A 3GHUA 1XF0A 1AFSA 1Z8AA 2PDLA 4YVPA 1QRQA 3UZWA 1UR3M 3N2TA 2ISFA 2IKJA 3QKZA 2ALRA 2HV5A 1EF3A 5LIKX 1Q5MA 4XZHA 4QXIA 3CAVA 2HDJA 4PR4A 4FZIA 4HMNA 4JTDA 3UWEA 2BGQA 2F38A 4ASTA 5HNTA 3V0UA 4GA8A 4G5DA 3GHSA 4JQ1A 1MRQA 5AZ0A 3NTYA 4L1WA 2ACQA 1C9WA 2PDFA 4NKCA 4WGHA 1IEIA 4JTRA 1QWKA 3GHTA 2PF8A 3LQGA 1J96A 1RALA 3UYIA 4DBWA 3WCZA 3R43A 4XVDA 4YVVA 2FZBA 2R24A 3O3RA 3WBWA 1OG6A 1YNQA 4DZ5A 1EL3A 3LEPA 2IPFA 4GQ0A 4JQAA 1S2CA 3LZ3A 4YU1A 4QBXA 3R94A 2INEA 1PWLA 1MI3A 3N6QA 2A79A 3WBXA 1SM9A 2IPJA 4WEVX 4H7CA 4JQ3A 2DUXA 2PDPA 4GABA 1LQAA 3LENA 2PDYA 2FVLA 3R6IA 2DV0A 3H7RA 3ONBA 3Q65A 3H7UA 3UFYA 1T41A 3R7MA 3UP8A 4R9OA 3UZYA 1S1RA 1ZQ5A 3RX2A 3R8GA 2IS7A 3CV7A 5LIXX 1AH0A 4IJRA 1Q13A 2PDHA 3KRBA 2IPWA 5M2FX 3T42A 3VXGA 2BGSA 2AGTA 3LZ5A 1S1PA 4XAPA 4EXAA 1EXBA 3S3GA 3V35A 4XZLX 1GVEA 3ERPA 2IKIA 2NVDA 1FRBA 3ONCA 2INZA 4XO6A 3EB4A 3UZZA 4IGSA 4PRRA 4Q3MA 3LBOA 3LUTA 4ZFCA 4Q7BA 1S2AA 2PZNA 1RY0A 2DUZA 3WBYA 1AH3A 2PD5A 4WDTA 4WRHA 5LIWX 4XZMX 5JH2A 4PUWA 1PWMA 3H4GA 3WG6A 1MZRA 4HBKA 2PDKA 2FGBA 2NVCA 4LB3A 1A80A 4XZIA 3BV7A 4YVXA 4JQ2A 4LBRA 3GUGA 4AUBA 4WDWA 3M64A 3C3UA 1YE4A 1HW6A 3P2VA 3DOPA 5HNUA 3MB9A 3CAQA 1AH4A 3CV6A 4LBSA 1VP5A 3LNMA 2IKGA 3V0TA 2HVOA 4GCAA 2ACRA 3V36A 4LAUA 3Q67A 2R9RA 3M4HA 3BURA 1YE6A 1EKOA 4WDXA 3U2CA 4WDUA 1X97A 1R38A 1ZGDA 4FA3A 4JIRA 4GIEA 2PDCA 3BCJA 2BP1A 4QX4A 3V0SA 2PDNA 2VDGA 5KETA 3CASA 3GHRA 4DBUA 1X98A 2HE8A 4F40A 4L1XA 1T40A 4JTAA 4GQGA 1YNPA 2WZMA 4JIHA 2PDGA 2PEVA 2C91A 3M0IA 1RY8A 4H8NA 2PDJA 3UGRA 3R8HA 4FAMA 4XO7A 3MC5A 4JQ4A 2QXWA 4LAZA 3COTA 1M9HA 2HVNA 3CMFA 2IPGA 2PD9A 4DBSA 2FZ9A 1PYFA 3RX4A 1US0A 2PDIA 1Z89A 3UG8A 1VBJA 4PMJA 4LB4A 2IQ0A 1ZUAX 2HEJA 4ICCX 2PDMA 3EB3A 3O0KA 4RPQA 4JIIX 2FZ8A 4XK2A 3LN3A 5HA7A 2PDXA 1IHIA 1AZ2A 3G5EA 5C7HA 4IJCA 3FJNA 2CLPA 2PDWA 5LIYX 3UZXA 3RX3A 2FZDA 3G1RA 3EAUA 1PZ0A 2I16A 1ADSA 2ACUA 3LQLA 2PDBA 1ZSXA 2PDUA 4JTCA 2IKHA 2WZTA 2J8TA 4MHBA 1HQTA 3DN5A 4QR6A 1X96A 5AZ1A 2ACSA 2PFHA 5DANA 1XJBA 1AZ1A 1PZ1A 4I5XA 3FX4A 2I17A 3F7JA 1XGDA 3R58A
chains in the Genus database with same CATH superfamily
1K8CA 3GG0A 1K03A 1P43A 1XYFA 4AZIA 3B04A 5D37A 1NQ6A 1P7TA 2A5HA 3WQFA 2PDQA 1O4UA 1XLGA 2OVLA 4L4MA 3ARZA 4Z0JA 4HNCA 1XYAA 4TXEA 3WUEA 1LWIA 2UZ9A 4PUUA 4JTQA 3MTWA 1ME9A 1U5JA 2GVJA 1KXQA 3I10A 3A4AA 4GACA 3BH4A 1KCZA 2EKCA 1DVJA 5JH1A 4C6BA 3RO8A 4DO4A 1W5MA 3FN9A 1FWCC 2P10A 4HZ6A 4O53A 4B9ZA 4W85A 5MHBA 4JCMA 4KIRA 2FYMA 4Y90A 4F0HA 2X2YA 4JHOA 2P1FA 3WNMA 1EF3A 3MCNA 3TYAA 1XLFA 1QNRA 2DJXA 1JAEA 3KE0A 2VEFA 4DI8A 2POZA 5BCAA 1HKMA 3JR2A 3FHAA 3LI0A 3WBAA 3QVQA 1TRIA 2ZRWA 3PJWA 3GHSA 3ZLGA 2PTYA 5TNVA 3FGCB 3NTYA 1A3WA 3U3HA 1HF6A 1F05A 3CWOX 1E9YB 1U1JA 4IIBA 2FPYA 1QBBA 1XIFA 5CC3A 1EA9C 1LT8A 3M6DA 3SBFA 3ZQ9A 5DLCA 1I0BA 3GR4A 4H19A 2ON3A 3A4WA 3NDYA 3HQ1A 2WWCA 3VVGA 2DP3A 3NL6A 1EWDA 1R85A 1V3JA 3EKLA 2R1MA 1NWTA 2CEQA 1YXCA 3P80A 3GX9A 4KWSA 2FVLA 3VIIA 4GBUA 3JS3A 4GY7A 4AF0A 4FOJA 4J4KA 5F2GA 2QCEA 3IV3A 3BZJA 4NNAA 3UFYA 1IWPA 1OT1A 1XKYA 4LJ3A 5A8MA 2V0TA 1QBAA 2Q01A 3N1AA 3N17A 3VGBA 3CV7A 4RDZA 1ICSA 4ZFMA 3K4AA 4XKMA 1POJA 3URNA 3T42A 2DORA 3TSDA 4NRSA 1G7UA 1EO7A 3LPPA 4DX3A 3EA3A 3USZA 2HPIA 1IWAA 3RLVA 4BQ5A 2PC4A 2O9TA 4XZLX 3GDLA 1M3UA 4OBRA 4HJWA 2VX6A 1FRBA 2J7EA 1UWQA 4XIAA 2E1WA 3K4WA 3KW3A 5FJTA 1XLCA 2ZYFA 4Z0SA 1DWJM 3AALA 1JZ3A 3M16A 1K9DA 3OEXA 4H9XA 3QQ1A 4WRHA 4G2DA 4KGJA 1LT7A 2Z6JA 1TZZA 3QZ6A 1MSSA 4HU0A 4NZ5A 3MSDA 4XAYA 3F5JA 2X09A 4I9MA 5FL0A 4HBKA 2BASA 4PMYA 1EOKA 1F4AA 4D6GA 3LLDA 5AVHA 4RE3A 2ZVIA 4JQ2A 5T8GA 2YR1A 1F07A 3VDCA 4C90A 3KDOA 1K9FA 2XPKA 3AOFA 4JNMA 1JGMA 4HPGA 1XGZA 2C6QA 4C6EA 2PGEA 3GVRA 2ZUTA 3VOJA 3N2OA 2VRJA 1XD1A 4GUHA 5BRQA 3LNMA 2X7VA 3R10A 1F3XA 4HU3A 2XFRA 3M0JA 2HQAA 1KV8A 4OWGA 2X8RA 3MJYA 5JBFA 4TR9A 3MI3A 1BQCA 4N7QA 2H9AA 2I9EA 2BVYA 4IMCA 4UWMA 1W1TA 4AF0B 3K8MA 4AD2A 1EEXA 2HZGA 1CCWB 1V02A 1LCOA 2GGGA 4MFDA 4A3QA 3W76A 4E2BA 4HHHA 4PTDA 1KFJA 4GZJA 5EMKA 3B05A 1EEPA 3TJ4A 4TMBA 4L80A 2H3DA 4LUJA 3VINA 3OIXA 5L9FA 3NVTA 3TYZA 5CZJA 1A5AA 2XM2A 9XIAA 3MW7A 4TVCA 4IICA 1DBTA 3WKZA 3UCQA 4PMQA 3HFTA 3UGRA 3GB6A 2WSPA 4GIAA 4EIVA 1VBUA 4XO7A 1P6WA 2HNHA 5D9OA 2A3HA 1JZ2A 1PKYA 3HN3A 3COTA 1M9HA 3HA1A 3R13A 2EPOA 2C0AA 3TK7A 1UMLA 1CLXA 1SR9A 4MYAA 3AHYA 2EQDA 1JRBA 1ZUAX 4EKJA 2XIQA 2ZZ2A 4ICCX 2VZSA 3V75A 4DLMA 3U7VA 3BPWA 4QNEA 2YCKX 1SSGA 3SUTA 1V6XA 1IHIA 3SJNA 4C91A 4QEHA 2J7CA 2VKZG 5A6LA 1JYNA 2Y8UA 4YPJA 3FW6A 3CZJA 1J10A 3HPXA 3MV01 5D8WA 1TUFA 2BB0A 4XSMA 3QPZA 4WHBA 2WCAA 4GQRA 5EGRA 1PV8A 5E70A 4LEQA 4KKXA 3CYJA 3PULA 2YL5A 1LF1A 2BHYA 2HXTA 4QR6A 2NWSA 3KS6A 5BMWA 5BXTA 2BMBA 2J9ZA 5CLWA 4XBKA 3RN6A 4P61A 1VCGA 3MY9A 1S5MA 4DJDA 1GVFA 3S1UA 1GOMA 4JYEA 3KBNA 4U3AA 3VKBA 4PMNA 4XZNX 1EZWA 2A7RA 2RHGA 4FALA 2J47A 4KCVA 3KBSA 1G0CA 3SCUA 2VFFA 3AHVA 3SIZA 4O8RA 1L8PA 4EF9A 3WL1A 2PDLA 1QRQA 1XDJA 1SFSA 3CTTA 3V3WA 3LS9A 4JNZA 3C56A 3TYBA 5CAKA 2ZBTA 3G18A 5IHSA 3IJ7A 3QZAA 2HISA 1LOQA 4H01A 3MP3A 4UTKA 1R30A 3NNTA 5LIKX 3FVMA 4LV9A 1Q2SA 1BVNP 5K3VA 3UWVA 2ZDSA 2EBNA 4LY8A 3I7QA 1WBHA 4GPNA 1TWZA 1LRQA 3LHUA 4WCJA 3QN3A 5DRIA 4JTFA 1BFNA 1R3QA 2CESA 3E74A 4J3SA 1YXDA 3GUWA 3WLHA 3LSCA 1XLAA 4R34A 1TTIA 3VZXA 3CQJA 1QO5A 5HMFA 1TTQA 3UZ5A 2BSLA 3ZS4A 3TAKA 5DBUA 3HQPA 4WZHA 1DWAM 1G01A 4R85A 4P2VA 3ATYA 1JPIA 4HPJA 4LRTA 4Y8EA 1XINA 1JAKA 1N8WA 3ES8A 3LEPA 3TN3A 2V3GA 4HCLA 3AYSA 4F9JA 1XLLA 2ASHA 4UTMA 5HAOA 1XBZA 4KWUA 3WQ5A 3WNLA 2F84A 4UOZA 2ESCA 1WNOA 4PFMA 2Z1BA 4B2DD 1LQAA 2PLCA 3PM6A 2OQYA 3AICA 2VR2A 4EOUA 3MS8A 1ZAHA 3MBDA 4ICMA 3SQLA 3NR0A 1DWHM 1UD2A 4GXWA 3GXTA 4LUSA 5TF0A 2DFAA 3H7UA 4LYPA 3DU0A 3CV2A 1XL9A 1FUYA 4AHQA 1XM3A 3S47A 3DECA 4ZCWA 2DSKA 1KM5A 1EOMA 3LGGA 1EHAA 3SGUA 1KR0A 4KS0A 4GY0A 4GVGA 4R88A 2J7GA 1QNVA 2BY1A 2AAAA 3BAYA 3GNXA 2PP0A 4L6OA 1GG1A 3NZGA 3TDFA 3IGSA 4RL3A 1OC6A 2C16A 5DFAA 3T81A 3H23A 4HPNA 4GFIA 3GH5A 1XIGA 2PD5A 3K1GA 1XRSA 2GVLA 3LG3A 4GE8A 3O9NA 2X42A 5JH2A 2NWRA 1OIMA 2NVAA 3HV9A 3S6OA 1QI0A 1X7FA 4EWND 3I6RA 4CU6A 1VEPA 3WEZA 2LLEA 3ITVA 2ZXQA 1S5VA 4D6DA 4XD6A 3CH0A 5D8ZA 4GUFA 3RUBL 5ABEA 3ZWSA 1KCKA 3V4BA 4HYVA 2QLYA 1Z69A 3DOPA 3D5HA 3CGTA 4I7UA 4MNJA 3BJFA 6XIAA 3W7HA 2WJZA 3GDRA 3W4RA 1J79A 1J12A 1QPRA 5I3KA 3THAA 3DG6A 1QFEA 2P76A 1Y5WA 1VP5A 1HN1A 4IPLA 3VOGA 5CPNA 5HDRA 2C0HA 3H22A 3UXIA 3V36A 2OSYA 3Q67A 2XGIA 3STPA 1DJXA 2ZIDA 4I8YA 2YW3A 4TMCA 1UASA 1WKYA 3OZMA 1S39A 4R9XA 1J4EA 2PBOA 1PCKA 1W54A 5DN1A 3EDJA 3G0SA 1VHNA 6ALDA 3MI2A 3DERA 1R46A 1JI1A 2PI6A 1K8XA 1F4HA 5HULA 3DUGA 4OQVA 4TV5A 3WUBA 4FO4A 2VMFA 2WHKA 1Q6GA 5U7SA 5DXYA 2EAWA 3SEPA 1RAKA 3ZT5A 4ZGYA 2C91A 4C6CA 1E73M 5DRCA 3EDKA 2VCCA 3N6JA 3M0VA 2D0HA 4OV9A 3TYCA 3NO3A 3EB2A 2R1KA 2EHHA 1FHVA 3GAYA 3AU2A 3TLLA 4GFSA 1XDLA 1PHWA 3ICJA 2XINA 6A3HA 3E12A 2YL8A 2QPXA 1TJ1A 1X1NA 1KGUA 1UC5A 1P1MA 3G1SA 1BEUA 4W9TA 2V5KA 2INFA 3GDTA 4F0RA 4E38A 1U5HA 5G1TA 4EP8C 3ABZA 4M6UA 3CNYA 1TMLA 4LX4A 4D9PA 4CLMA 4BK9A 1KKRA 3LM3A 3GTIA 1TZ7A 1M7JA 3B8WA 2DW6A 4AY7A 4EPKA 2QNEA 4R7WA 3AAMA 3C52A 4RW3A 3WLLA 7TAAA 3GFYA 1VC4A 2FZDA 1T8QA 2V81A 3CEPA 5T91A 4GD0A 3HQOA 1YX1A 4PEKA 1F6KA 1EJRC 3M43A 4QJ1A 1OD8A 4ZTYA 3USBA 2BLEA 3ELFA 4QTGA 2CBUA 4E5TA 1ZP4A 2X0HA 5A6AA 1MZHA 1ISVA 4V33A 1UWRA 2W3ZA 3HB9A 1RJPA 2I56A 4ZOBA 3TFXA 4HNOA 4BEUA 1TIMA 4GWEA 2FDSA 1GZJA 1X6LA 1ZALA 1C93A 5AHNA 1VF8A 2FHFA 4C6NA 2YBUA 4HPXA 3GC5A 3CB8A 5I3DA 3NQMA 5RUBA 3HURA 5E09A 4JY8A 4JTJA 1BYAA 2AMXA 1DTNA 4DRSA 2IQDA 4C7FA 3AHTA 3HV8A 2PGFA 4Q8WA 4FNSA 3QJAA 2V8ZA 2WKLA 3MO4A 5H1WA 1E3ZA 4ZXOA 4E2OA 5HBFA 1Q6LA 1OGSA 4MNKA 3HOJA 4JL2A 3G77A 3KM8A 3T2OA 2Y88A 3W2NA 4O52A 1DIEA 3MZ2A 3UA4A 2W62A 3I7RA 1H61A 3OA3A 5C8BB 2WK2A 3MSGA 4HOXA 1K7XA 4DZHA 3UR7A 2BXZA 4GGHA 5I78A 1LZOA 3A47A 3ZM8A 3NFUA 2PPGA 3PTKA 3FK4A 4OU1A 4ACZB 1O5XA 3AXKA 4MAZA 3SDOA 3F5KA 3W1TA 4ROQA 1YRRA 2PF8A 3KL5A 4OBTA 4DUXA 1KD0A 3TQPA 1XX1A 1CLVA 2QVHA 2DVXA 1V0MA 3IJ6A 1T8XA 3S5SA 2FZBA 2R24A 2G3MA 1OFRA 4O8AA 1OG6A 4KRUA 1BSLA 5HJXA 4L6HA 3QY6A 1UH3A 1MI3A 5KZMA 4JCLA 3A5FA 2V5BA 1ODZA 4UZSA 2EPHA 3NL3A 4WEVX 3Q37A 3FDGA 2Y62A 3NDOA 3F03K 2VFEA 4BWLC 2YDSA 2OSWA 1VENA 3NAVA 3ALFA 4F0SA 2W91A 2EG7A 3R6IA 1TA3A 5A6KA 3GDKA 2QUTA 1QI3A 3M0YA 5FEPA 1K8YA 3HIJA 5CPOA 3UZYA 1ZQ5A 3RX2A 2RGMA 1R7OA 4ATWA 5I06A 3WD4A 5A94A 2OOGA 1WQ5A 1F61A 3VXGA 4XX6A 3RLUA 1TO3A 3ZT6A 4NT0A 3TTQA 3F1QA 4FOUA 3WF3A 1Z41A 2AQOA 2FDMA 4DJEC 3ZLFA 2E68A 4P8VA 4YN5A 3UESA 4NJJA 4UMCA 4EXQA 3E3HA 4YCOA 2I5GA 1KM1A 1GVOA 3V18A 3LBOA 4GYFA 1AG1O 4ZFCA 2ATMA 3D47A 1VPXA 4MNMA 5E1QA 4TTGA 1BRLA 2J62A 4GOAA 1JNDA 4UCFA 2PWDA 4YJ5A 3PANA 2B7PA 3OODA 3AMDA 2OZ0A 1ZY9A 1KM3A 4F9DA 3RITA 1O1ZA 3PBUA 3VIKA 1ITCA 3TXVA 4AMCA 2O9RA 1EP2A 2CC0A 1FQ0A 4HCDA 4PUKA 1OYAA 1KBKA 2NSOA 2VGIA 3NIYA 3B4YA 4KGLA 4GI6A 4QISA 4X9SA 4LS0A 2WV8A 2WCSA 3C8FA 1UC4A 3G1AA 3WMCA 1W9PA 3W2JA 3RXZA 3VTRA 5HNUA 3GH4A 3MB9A 2J7BA 4E2DA 4AXKA 5FOOA 4LAKA 1OFEA 2WMHA 4C7GA 1SZNA 3S1VA 1W31A 2JF7A 1TV4A 2V5DA 1IF2A 1OG0A 3V5FA 3CZLA 1F74A 3KVKA 3VCNA 4Y9MA 3EWXA 1ZBKA 2V82A 1FWGC 3N25A 1H5VA 3G1FA 2GK1A 1DE6A 3GRIA 5GNYA 5CJ5A 1Z44A 4JR5A 2BS9A 1E6PA 1V3KA 3VD4A 5DXXA 3BCJA 1UKOA 2VZVA 1PZ2A 4AYGA 2HK1A 2QMJA 4GIYA 1FWSA 1JZ5A 1XS2A 4X2PA 4OV4A 3VNMA 3NPWA 5FJJA 3C0QA 3W7KA 3N9KA 4O0QA 1PX4A 2DVUA 3EMZA 1R3WA 3INPA 1J6OA 4K6AA 1FFQA 1EJTC 3WNKA 5FF4A 3CUZA 1P6CA 1B31A 1E56A 4JYFA 4MY1A 4F2TA 1F73A 1BRLB 1WBJA 2DSUA 4FX7A 2WJDA 3ARUA 4FP1A 4MKNA 1BWKA 3RM8A 1EFZA 1QASA 3WQDA 1B90A 3I6TA 4GH3A 1MRAA 4E4UA 1LLZA 1OEPA 1HNYA 1CDGA 3HG5A 4AZGA 1XR2A 2FTYA 3OG3A 3IK4A 4B91A 3WLSA 1WV2A 4YHEA 3WMSA 8TIMA 5GJMA 3T4CA 1R2RA 3GXIA 3VU2A 4GVHA 1TFVA 1AZ2A 1BVWA 4LVGA 2ISWA 4AC7C 1E70M 4DVOA 1K4GA 4RV3A 1DWFM 1SUXA 3RX3A 2BVTA 4ONVA 1OC5A 4UNIA 3W25A 5CBJA 3F5LA 4LTSA 4DXKA 5D2XA 4QLLA 1TZ9A 1W2PA 6TAAA 5LGXA 4IIDA 4MLRA 1NOWA 3B0XA 4UTFA 3DDMA 1XH1A 3EBVA 4W5ZA 1X96A 4LS2A 1ALDA 2P8CA 4QROA 2WC4A 3GG8A 1XKJA 1OFOA 5LNUA 1KBBA 1PZ1A 3LSBA 4O1DA 1WDSA 1QPNA 1T99A 3HO8A 3A3WA 2GK1B 1OCNA 5LGZA 3UWZA 3NO1A 4AG0A 4CN1A 1LL7A 2Z1WA 4AFYA 4KF1A 2OLAA 4YS1A 1LORA 5FJPA 3GDMA 5D38A 5BRPA 1J01A 3SRDA 1JULA 5D2YA 1ZJBA 4IXHA 1RCXB 2UY2A 4CCEA 3UYCA 1AODA 2HE5A 3GHUA 4UNKA 2V38A 1ITUA 4TU1A 1PJ9A 3LRLA 5E6ZA 3OVRA 1JPMA 2VHLA 1YEYA 3A4JA 5AC6A 4L9ZA 4D6FA 4BF9A 3LK6A 2OEJA 1SW7A 3KZSA 3VZZA 3SR7A 5MKGB 2L5HA 4ZO9A 2ZVRA 5M3WA 3AI0A 2RDTA 2YYTA 1W17A 3T6CA 4N9CA 1CZ1A 4FZIA 4I6VA 1W1VA 2J9XA 4GHRA 3VIHA 3S1WA 2EPNA 3QLDA 4KETA 5FF3A 1O1HA 4GZ7A 2W6RA 2QV4A 4ZOAA 4Q8UA 3S1GA 4WGHA 5AYXA 3PZMA 1TV2A 2B7OA 1S5NA 1W1YA 1HGYA 4FF7A 4B16A 2R1NA 2CLIA 3WCZA 3A21A 5D4YA 3GW3A 3PZQA 5I09A 3QW4B 2UBPC 2VUNA 3DBNA 5DT7A 3W74A 1M6JA 4GG9A 1H7NA 2CZ5A 1FKXA 4WD0A 2PSNA 4QBXA 4X9YA 5BRBA 3ABOA 5CJNA 3ZSTA 2CW6A 3N6QA 1U5VA 2D0GA 3THQA 3FFSA 2DSWA 4UIOA 1UJPA 3QM3A 1ZP3A 5H8PA 5F4SA 3DCPA 4GABA 1HT6A 3LXAA 1PAMA 5JU6A 4BZYA 4LW7A 4DUOA 5T9CE 4ZVJA 3IUDA 4ZO7A 1E6QM 3SB0A 1FKWA 2CLLA 1VPQA 2AKZA 3MYPA 4DWSB 2HS8A 3P60A 2H8ZA 3O07A 5C9UA 2WNZA 2XSBA 1MNSA 2DZTA 2DZSA 1K77A 2I5IA 6REQA 5JUVA 5D9PA 4W87A 2WMIA 3MA8A 2J75A 2A3LA 3W1NA 1DXFA 1TE1A 1Z7AA 4A3YA 3IJDA 5LA1A 3UWQA 1C8VA 3R1ZA 4AIEA 3OB8A 1G1YA 4Q3MA 1WDQA 2I14A 1MFVA 4Q8OA 4HYRA 1IEWA 2QUVA 3M5YA 1NF7A 1CT5A 4JICA 3WLPA 1TV3A 1WXJA 4EAYA 4HA3A 4GUGA 1UWIA 1W6TA 1LBLA 4NASA 4HA0A 4KPLA 1HO4A 1LOSA 4PTMA 3TR9A 1DP0A 2BWGA 1V8EA 4FF5A 1H1NA 2WVTA 3CPRA 3OHIA 1I4NA 1BXBA 3EXTA 4HKPA 3LLXA 1EDTA 4U2ZA 1GTHA 5BOOA 1TPDA 1RBLA 3NZ1A 3ID7A 4WJ8A 3T05A 3ZWTA 3FYPA 3DYOA 4IGHA 4HSHA 3K13A 1E0VA 1BQGA 2C71A 1YBQA 3H21A 3L2IA 3L12A 4LWWA 2TAAA 4U10A 4GCAA 3CT2A 1HO1A 4RXGA 1P0NA 2Z24A 4EANA 3FDKA 1UZ1A 4DZIA 3CXOA 2VVNA 1EJXC 3WK2A 1EKOA 3BL3A 4R7OA 3UWYA 1S2UA 2GGEA 2F8QA 4MMWA 4NYYA 2F7FA 3CB3A 2NT0A 2G0WA 5I7GA 5JBDA 4YWSA 3VKKA 5AECA 4I8DA 1TUXA 3G1VA 1AMYA 1B5TA 3QV8A 3TFCA 3GQYA 1EQCA 1ZNNA 4RZ5A 5FEWA 1OCBA 1L2UA 4W8BA 2NQZA 1RSCA 2ZA3A 6REQB 3AJ7A 3N13A 3IUHA 4X60A 4IG2A 1Q85A 4MB4A 4V1XA 3U6WA 1UUMA 1OF8A 3S9YA 1UWUA 3M44A 1T96A 4GGBA 3W7OA 4L61A 3ANUA 2CYGA 2CLOA 3SN4A 2ZTJA 1XBVA 2Z26A 2VZOA 2VD9A 4DBEA 1W2VA 1HIZA 3L66A 5HWMA 2PLJA 4UTUA 5CG0A 3W22A 4ML9A 2ZUWA 3Q45A 4CNSA 4KQNA 3RNDA 2JFEX 5FAGA 4ADUA 3P74A 3DG7A 1A4MA 2EPKX 4HYWA 1K02A 3UPMA 3EB3A 3AU6A 4HCHA 1UW9A 3PZGA 4RPQA 1V3IA 1VYPX 3STGA 1H50A 1KC7A 3S6TA 2WNWA 1DL3A 3L4ZA 3EKGA 2ZZ4A 3M5XA 1H41A 2NLYA 2R91A 2CLPA 3A13A 1QNQA 1F6YA 3IVSA 4DLFA 3TU9A 3WLQA 3NQGA 1AQFA 2EPMX 1ISWA 3FS2A 1TCMA 3AJXA 2Z7GA 2F6XA 1AUSL 3GZAA 1IGWA 2IKHA 1TJ0A 1WYIA 4ZQNA 1F3WA 5KMYA 2DW7A 4MAVA 3DN5A 2NT1A 4IF2A 3W7PA 3WDHA 3U0HA 1QR7A 2MNRA 1QK2A 5DANA 3TW7A 3IVTA 1ONXA 2W27A 3GXFA 1GJWA 5HJYA 2I57A 3C2EA 1RVKA 4FIQA 3G22A 2I17A 5G4EA 4MKVA 5CGMA 5H91A 1RK6A 4U3CA 3ES7A 1FWNA 2HROA 1O5KA 2GSEA 2FB3A 4RE2A 4W4QA 3QGAC 3N2XA 3QHMA 4HP5A 2GJLA 1XLDA 5D9MA 4ZSTA 4BQ3A 4MSSA 3W38A 3W7CA 4HOZA 4RDVA 3JVAA 4B5TA 3GYEA 4RNFA 3UPBA 1PKLA 3RHGA 1UP0A 4CQDA 1TWSA 1Z9AA 5CPLA 4IG2B 3AXIA 2BOFX 5BYWA 1F3EA 2XVGA 4C6IA 1TG7A 3R25A 1J2WA 1FY6A 1BYDA 1HP4A 2DZUA 3EXSA 4NHVA 3S2CA 2FLIA 2BNJA 3N34A 5E6YA 1Q5MA 2ZUNA 1I45A 4KFNA 1JQXA 3RK8A 1E6RA 4UFLA 3YPIA 3FSTA 1S2VA 3LHWA 3FNDA 3OZPA 4G5DA 1TV8A 1QHZA 3DFPA 5AYZA 1ZRQA 2DSZA 4L1WA 1TPB1 4IUGA 2JKEA 1IIGA 1XG3A 4AWTA 3VGEA 4AWEA 2VJXA 3BGAA 2VC5A 4M29A 2QCDB 3O7UA 1E43A 1OVDA 4M82A 3HQNA 4D71A 1OADA 2IPFA 1JFHA 3IUIA 1VFMA 1EJVC 1EGVA 5HPCA 2QIWA 3O0FA 4O15A 4TUFA 5LNVA 2KAUC 4O28A 4ZZ9A 3LYEA 4MUPA 1A5CA 1SM9A 1ITQA 2W79A 4DAFA 3CIXA 5ENLA 3PC0A 1V3LA 1S2WA 2EKGA 1ECQA 5EFFA 4O16A 1HZYA 3W81A 3H2EA 1UWSA 2PF0A 4WSJA 1GYMA 3HU7A 1KGXA 1QI5A 4OOUA 6TIMA 2D1ZA 2WMGA 3BSGA 3U5UA 4JBRA 4YHGA 3C4UA 3KCOA 3QXBA 4A8LA 1R47A 1KBJA 4UFMA 1VFUA 4IJRA 4HJFA 2XM1A 2IPWA 3DHDA 2CLEA 2BGSA 4JXCA 1V6VA 4M1BA 1W1ZA 2WWDA 3SRKA 3I7SA 3IJ8A 1Q3NA 1QATA 3OO2A 2OZ3A 3H6OA 3GC2A 4MJZA 1NDWA 1W5OA 5BU6A 4B5XA 5E0KA 4BHYA 3BMWA 3TJXA 3FJLA 5I07A 3LHYA 2HBVA 3BW4A 4MZ8A 3AS3A 1HJWA 4M3PA 3GG7A 2A2IA 2A21A 3ZJ6A 2WQDA 1N8IA 1V6YA 3EOEA 3SCNA 2VCBA 5HPOA 4I7WA 3H4GA 3W07A 1XIMA 1BGAA 4JX4A 4PUEA 2WB5A 5G5IA 4JD4A 4Y9NA 4DJDC 2X30A 3VMOA 4DPQA 4U2YA 4WDWA 3CIWA 3WF2A 3TV8A 1WE5A 5FESA 1W5PA 1Q6DA 2W66A 3TC6A 5XIMA 2NQLA 3QY8A 2MUCA 4QP0A 4MUZA 1DJNA 1XYZA 4AVOA 2YL9A 1UIPA 2VI0A 1FWAC 4J7RA 3W6MA 1GONA 4M6QA 3IRDA 3MI6A 3WQ6A 1FCBA 1K70A 5GQBA 1PE1A 3BANA 2ACRA 1NIUA 4GCXA 3OLEA 4JNYA 1QW8A 3QBUA 4XBSA 3H26A 4K3ZA 4R27A 3BMXA 3NURA 1YE6A 2JE8A 3F4NA 3ZZ1A 2ZA1A 4IISA 1K9TA 3C8NA 1NU5A 1W3TA 3S42A 4C6KA 4AEOA 3PWAA 3W87A 5C55A 1UR9A 3MVTA 3WZ0E 2H8XA 3F2CA 3BTNA 4XZBA 5FEZA 3GR7A 3SCVA 2XGBA 5A69A 3AZRA 3HPFA 4I9JA 1V0KA 1ZB5A 4AISA 2NX1A 4N2YA 4L64A 4IGNA 2VC9A 1OC7A 3T0TA 3B03A 1SZRA 4IPPA 1POKA 3K2GA 3XISA 1WOBA 4A8RA 3G0UA 4F0LA 4C65A 3A9IA 3UNDA 4BY3A 5KZDA 4E8GA 3UEQA 4KRTA 3G0XA 1H49A 5EMJA 3WQVA 1KNWA 5DO8A 4LAZA 3CL8A 4L7ZA 4UUIA 4URIA 1W5NA 5DT5A 5GJPA 3CBWA 3F4WA 4CN6A 4AQLA 2Y85A 1ME8A 3LERA 3AFBA 5H6HA 3QSRA 4IQEA 2PDIA 4B92A 3I68A 4HK7A 4WOQA 3NZRA 2E6YA 1JCXA 1X7IA 2W92A 4Z2KA 4DWSD 2QCHA 3QMRA 4M6PA 3VGHA 4DBDA 1X8CA 2HEJA 3OZOA 4ZQMA 4O1CA 3HZ3A 3FJ6A 2YB1A 1TTPA 1UA7A 2C7FA 3PTQA 1G6CA 4DJFC 5I6SA 4XK2A 5GNXA 3LN3A 1UH2A 1YXYA 3MZNA 3PG8A 1GQLA 4HGXA 3FJNA 4FR6A 1US2A 4IHCA 4G7EB 2OWWA 3TSMA 3A24A 3GXPA 2I16A 3P67A 3TIMA 2J77A 1EX1A 1ZSXA 2PDUA 2VVSA 2PUZA 3RG6A 2XG9A 3WD2A 4NP7A 4O10A 3RDKA 3WYZA 3L9CA 1GYLA 3RMEA 8XIMA 5G4HC 2CZEA 5CGTA 3M07A 1I1XA 1KTCA 3FX4A 3W1PA 2ZXDA 1NP2A 3SFWA 4PCFA 4Z08A 4ENLA 3W2UA 3MHGA 1KM6A 2NQ9A 3REQB 2F2KA 4JTHA 2KZHA 4PZVA 4L4PA 3RGTA 2QYGA 2A7PA 4GLEA 4JTIA 1O12A 4PUDA 1H3GA 3H54A 3TC7A 3LBCA 3LPOA 2RDXA 1DORA 1WZAA 1WKFA 3PAJA 4A2SA 4OHQA 3QGKC 1RQBA 3VI2A 3KX6A 3WH6A 1L9WA 2GJRA 2OKTA 3EPMA 3PVFA 1RJQA 5H2ZA 1OF6A 1GW1A 4UTTA 2E8YA 3A9BA 2PU1A 3R0KA 2GPTA 4JTDA 3PZ9A 3W6YA 1JGIA 2CZVA 3T0CA 3BOLA 1WXZA 2Y6ZA 1D3CA 5DCBA 2ACQA 2IXUA 2OGYA 2A3BA 3GHTA 2NV9A 1BPLB 3W1AA 5LHFA 2XVNA 4XISA 3ECQA 4AXNA 1IE7C 4XG1A 1NY1A 3WLKX 3LCWA 3GKFA 4W7WA 1HG3A 1YNQA 1TQJA 4CD6A 1QPQA 3G1XA 1S2CA 4YU1A 4FNUA 3THCA 2GQ8A 4R53A 3U57A 1YPFA 3TR2A 1E4IA 1DOSA 3WBXA 1VFSA 4AEFA 1BXCA 2GSHA 2B7NA 2OX4A 1V3HA 3TZFA 4IZGA 3DC0A 1SPQA 1TB3A 3B9EA 4TOQA 2Q71A 5MF5A 5FJRA 3LENA 4X3ZA 1XH2A 5FIPA 2EEXA 3FA5A 1V7AA 5I3GA 2W4XA 2FJKA 5IDIA 4PEEA 1NDVA 1T41A 3MUY1 3QPEA 4AD1A 2PAJA 5FL1A 1ZCCA 2JBMA 1ICPA 2CXEA 3KRBA 4YTRA 4A35A 2A6NA 4GKTA 5IRPA 2QR6A 1C8YA 2TPSA 4JIPA 4WJEA 4XAPA 3E2QA 3SGGA 1HJVA 1UP2A 4KCWA 2OOFA 3V35A 2XWDA 1UMYA 3OBKA 1FP9A 3VNJA 3T1GA 1A0DA 1NQKA 3M0KA 1AJZA 3OU8A 2ZE3A 3PAOA 5EY5A 1K1DA 4QS5A 1A5UA 1J5TA 4WDTA 3UR2A 3GU2A 4AVNA 2JGYA 3LV6A 3UQNA 3BG5A 1C90A 4A8IA 3WH5A 1J6PA 3M7WA 5C9WA 1GOXA 2VGGA 1MZRA 4DF1A 1CB2A 4LB3A 1RH9A 4B3KA 4QE4A 3GKAA 4YVXA 4V28A 1XIEA 5HOSA 4J40A 4V2XA 1O60A 1SZGA 3W71A 4GUIA 5F2IA 1KM0A 3CUIA 3B8UA 1OFDA 4FS9A 1W8GA 2JQXA 4B3LA 1C8XA 2CLKA 2OCZA 5G4WA 4IXXA 1EUAA 1RBAA 4C6PA 1KRAC 4DJEA 3DYMA 1S3HA 3C2VA 4K7VA 3OW1A 3K8LA 4XKYA 5A1AA 2ZOXA 1L6YA 1X1OA 3ARXA 1F6PA 1NH6A 2NQJA 1H09A 1XYBA 2OYLA 1TVPA 2R9RA 5CPQA 1H60A 5C9RA 4WDXA 3C6CA 1GHSA 4PCNA 5AHFA 1MEHA 3SCOA 4IUOA 1WOAA 2H6RA 1G4EA 4FNPA 4WDUA 9RUBA 2XUCA 3C5QA 4S2BA 3I3EA 1EUNA 3ABSA 1S3TC 2HSAA 4B3ZA 4GIEA 2DZPA 2BP1A 2XISA 2Q8ZA 1VIWA 5HJLA 1XD0A 3M0MA 1M04A 1JRCA 2QJGA 4QCEA 1MUMA 1AW1A 3JU2A 2FPTA 3A5VA 3U9IA 5HR6A 3T0BA 3QPYA 3UG5A 3LA4A 3GFXA 4UXDA 5KSWA 1OFAA 3MSRA 1Q7QA 2WSYA 3TTYA 3ZIZA 2OG9A 1JXKA 4KWWA 3VC6A 2YA0A 1F9CA 3DHFA 4PMRA 2OWCA 3QR3A 1EJUC 3P82A 3R4IA 4IIGA 1EGZA 7XIMA 2PD9A 5F2MA 4YTSA 3P8IA 4RNJA 4H2HA 5EU9A 3GIYA 4NYUA 4C1LA 2ZKMX 4EACA 5DY3A 3T44A 4AZ5A 3FAWA 3ZR4A 1ZBCA 1IV8A 2VRQA 4YXGA 2VGBA 3AIWA 3UVAA 3DESA 2P88A 5HXMA 3TYEA 1PDZA 1XLKA 4HMCA 3I3DA 2FH6A 4PTNA 4AZ6A 1XBYA 3WLIA 3KLLA 2D69A 4L9YA 3PZOA 3HFYA 3WL0A 3GM8A 3ABXA 5LIYX 1LLOA 3EX3A 3NGFA 4B4HA 5C9ZA 2ZA2A 3AMGA 4F48A 2V5JA 3WFZA 1OY0A 3MMUA 2PZ0A 2PWVA 4JTCA 5REQA 3TTEA 1UUQA 3TTOA 2X16A 4NX5A 3NSNA 4G9PA 1SR0A 1UPPA 1HKJA 2BHZA 4GVFA 4K1WA 1Q4WA 4IWWA 1UQYA 2QDHA 4I5XA 2D22A 3RM9A 3K30A 4J3ZA 3OLGA 3GBDA 1UKTA 3CUJA 1XGDA 3UA3A 3GO2A 3BUVA 3TJLA 4ZQOA 4OGZA 4H2CA 3TN6A 4DYJA 1Z3NA 1EJWC 2UY5A 5CZ0A 3E9AA 1H2JA 1PSCA 1KTNA 3AMKA 3OVPA 1A5NC 1QMLA 2VYOA 4IJBA 1JEZA 3D3AA 1J93A 2FB2A 2E6AA 5F7UA 1YKWA 4CQAA 2BY2A 4XVEA 1JYVA 4PRTA 2PGWA 3N18A 4W93A 2BVDA 3RLGA 4JTTA 1YDYA 1AK5A 1OGBA 3QC0A 1H5YA 4O50A 5CZSA 4MIMA 3OG2A 1L6WA 1SZEA 1DYSA 4GUJA 3IANA 2VEMA 5CC5A 3ARWA 3C0LA 3AUOA 1KWKA 3BVJA 1TPUA 4XZHA 1VGAA 3NQAA 4QXIA 4UQCA 1WKEA 4PUNA 1GOKA 8CGTA 2E9BA 4US5A 2PWGA 1M65A 1XDMA 1E4LA 2X1RA 3B4UA 4HZMA 1BF6A 2ICSA 3SURA 4UR8A 4P7NA 4OKDA 1RHCA 4GYPC 1XSKA 4QNWA 4Q33A 3NQFA 2GJNA 4F66A 1FXPA 1NOFA 1XPYA 3BLDA 2Q3RA 4WLCA 2AQVA 3CL6A 1XCXA 4NSBA 1VPYA 1GW9A 1RALA 1FDJA 3BJSA 1W32A 4E0CA 4YVVA 3BZGA 3E5BA 4HOWA 2E67A 3S5ZA 3WJSA 3M47A 2ZX5A 1MWOA 4I90A 3OYXA 4G8TA 5G2IA 5REQB 1V77A 4MWAE 2WSQA 2C1GA 3CQIA 4H6QA 1CLKA 3NEVA 5FJOA 3VCCA 1WUFA 1AL7A 3VKAA 4OE7A 5XINA 3UJ2A 1PVNA 3ABRA 1MEWA 1XRFA 2G3FA 2R6OA 1RP9A 4AH7A 4KT2A 4NZFA 3SY5A 1K6WA 3B9OA 2ZRZA 2DV0A 4UC5A 3AISA 5C6MA 5BWFA 5C71A 1E5NA 1EPXA 3ANVA 1E3XA 3N12A 1NEYA 4A8NA 3PPHA 4Q4MA 1VJIA 2W5FA 3TUUA 1FHUA 5DBTA 3ZSSA 1V3MA 1UKQA 4J3VA 4J9JA 4QRNA 2W61A 3DFYA 2VELA 4RR4A 2ZX7A 5A95A 1RVGA 2QKFA 3SADA 1GVEA 3DZ1A 3B97A 3W00A 3UR5A 4IX2A 5HINA 4XO6A 5A6BA 2Z29A 1ZAJA 2GWGA 4MWAA 4QHRA 2OGJA 5AHEA 3G2GA 5H8UA 2PZNA 4XAFA 4TX9A 4W7VA 3EPOA 2QZRA 4BI6A 3AIRA 4BEQA 2BY3A 1YTDA 2PRHA 1GVQA 3IJ9A 2PTWA 2V3DA 5CPTA 2WC3A 3NXFA 4LT9A 2HWGA 5LA2A 1AL8A 5LXEA 3IJQA 4MDPA 2PS2A 3VIMA 3OLIA 4M8UA 4FNTA 4HNVA 4XZIA 3AXXA 3LPGA 4QQUA 2QPSA 2VTFA 3LRMA 4GC4A 2OYKA 2NX9A 2PLKA 5H8MA 1XC6A 3G3MA 3NQ6A 3T0AA 5A8GA 4IP7A 3ARVA 3IS4A 3WH7A 5TIMA 3DX5A 5DX7A 4UTLA 5E9XA 3EX6A 4G7FA 4LBSA 3VDHA 4MNLA 4RNHA 5FF0A 4Q4RA 3N9RA 4KFPA 3W2KA 4AY1A 3ITTA 1J0KA 2EF9A 1IT8A 1JCLA 3BW3A 2NQ5A 4UFKA 3GXDA 3LRKA 1Q7MA 3QFWA 4DO5A 1DQXA 3W1QA 4K37A 3O16A 1UQZA 4FMVA 2O9OA 5AHIA 1E6ZA 1EC7A 2TRSA 4YYCA 1BWLA 4HD5A 3SCSA 1W9VA 4S1FA 4JIRA 2PLMA 3VOHA 1JCMP 3BE7A 2IXVA 4QX4A 3N14A 1XLEA 2XHYA 2XWEA 1A0CA 4NZ4A 3FKKA 4HNLA 1IT0A 3SECA 4GI8A 3W72A 2WKJA 1GVIA 3W2MA 1FWEC 2VR4A 5EKYA 5D2VA 3OHMB 3E02A 5EFDA 2C3ZA 4B9YA 3V16A 5M5DA 4N6EA 2E9MA 1RY8A 1QXLA 3TOYA 1FXQA 4WY0B 1E0XA 2DEPA 1B3OA 2DIEA 4H9MA 4Z2HA 5A6MA 1EA0A 3TA9A 3M0LA 1G5AA 1CB7B 4CQBA 2VO5A 4RZBA 4XD5A 3ZJ8A 1BKHA 4C7DA 1K7FA 5LNRA 3HMJG 2FZ9A 1JDAA 2OO0A 3P3BA 3C86A 3UG3A 4S3BA 1TELA 4NXSA 1VBJA 3BV4A 1UWAA 3H2OA 3GTNA 1W8SA 3UJEA 2WHLA 3UXAA 3O0KA 4Z1DA 3M7SA 5AVNA 1AD1A 1JFXA 3QR0A 1OINA 5HA7A 2ISSA 2REQA 3WMLA 4ZB2A 2XFYA 4NJGA 4H9TA 4C6MA 4JYDA 2ZX6A 4ILSA 1UZ4A 3W23A 4FSAA 1E1EA 5BW6A 2E40A 4MPQA 4HMDA 4A2RA 5IDZA 2WANA 3IPWA 4C60A 1V6TA 4U4MA 3LQLA 3B8VA 3A12A 3TTSA 3WDPP 3TONA 4KEMA 4Q7NA 2ACSA 4M6VA 4EPDC 3ITYA 4TVUA 3W7GA 1LTDA 3PP7A 4H04A 4Q8PA 3BC9A 3L5LA 2VFDA 2RJGA 5HWNA 4ZOCA 4HPHA 4D6CA 2ZDRA 3NG3A 4KH2A 4LANA 3LV5A 3D3FA 5SWUA 1P7TB 3L21A 4CCCA 1H7OA 2ZC1A 1E9ZB 5D05A 5CLTA 3URBA 1I9CB 3OTRA 3BLIA 4R5EA 4JTUA 3CLMA 5I77A 1P48A 3R79A 3GNDA 1GJUA 4O1AA 4DF0A 3KL0A 1W1PA 5TQLA 1ZPTA 5A8NA 4S3CA 3EOLA 3BLLA 3CZKA 1IT7A 3IIXA 4M5PA 2YXGA 4DHGA 4LYQA 2R1LA 4YTTA 1B3XA 3CHDA 2HDJA 1KW1A 1E5JA 2WM0A 4ASTA 5HNTA 3V0UA 1VFHA 3PF3A 3CMGA 3UY7A 1O5RA 3VABA 4JQ1A 1MRQA 3SM0A 1PPIA 3VMPA 1M7OA 2GOUA 4NKCA 2FH8A 3NSXA 2YX0A 4KMQA 1QNSA 1LLWA 3KWSA 2BV9A 1W3JA 4REQA 2ISDA 5DCEA 2DZVA 2WZHA 5AC5A 2E6FA 1MO0A 1ADDA 2B4GA 2CERA 4IGMA 4BJHA 2FGZA 2REQB 3R43A 3NJ3A 3GXNA 2AKMA 3TXZA 4OECA 1XH0A 3L4WA 1KBIA 3DFQA 4L4OA 1NOUA 4LS1A 1TWWA 4ZB5A 2YJQA 5FJUA 4K38A 2INEA 4AZHA 1IXOA 2YB4A 2A79A 3UXLA 3PB0A 5A6TC 1GUVA 2XN2A 1XCFA 4JQ3A 3GTXA 1EQPA 1JYXA 2WPGA 3KOWA 3G8EA 1H11A 3N3TA 5KINA 4ATDA 4RE0A 1I2QA 2O9PA 2QDGA 2QUNA 3CJPA 1P1XA 3LM7A 1J0HA 3TP4A 3MP5A 4FLSA 1PDYA 4MGGA 3EOUA 2JKAA 4P7OA 1JIBA 4BFAA 3QV7A 3SN0A 3UPWA 4R9OA 3IIOA 2FKPA 1WB0A 4O12A 3VYLA 1E0TA 4E4PA 5EMYA 4DJED 4Q4OA 3TMQA 3W70A 4PCTA 5DY2A 1D8WA 3LZ5A 1I6NA 4FNQA 5CBBA 1PX8A 2XZ7A 3ZXWA 4ZOEA 5DEZA 1IZKA 3WQPA 2Y2WA 2A3AA 4IP4A 2GYIA 4ERAA 2XIIA 5EA9A 5HWJA 2KX9A 3KTCA 5XIAA 1X8FA 1SO6A 4U31A 4MJMA 4PRRA 1H0GA 3ME3A 1S2AA 3W1LA 3CM4A 4DXXA 1W56A 5LA0A 2FQIA 1XLHA 4Z1YA 2J8FA 1ML1A 1R2SA 4RUBA 3AMCA 4HB7A 4Z1BA 3MYOA 2QCCA 3H7VA 4TX8A 3WIJA 4JKLA 1TR9A 2D2JA 5M17A 1OM0A 4AY8A 3RRXA 1YTKA 3O6YX 1YE4A 4IIEA 3P61A 3UZJA 3QEZA 4V1YA 2QF8A 5A2AA 1I75A 2NLIA 4LAOA 2WMKA 2NXHA 1UBPC 2UY3A 1ZFJA 4QDPA 3L65A 4IPNB 2VC7A 2VEPA 4L9XA 2XYLA 3M4HA 3TSBA 1I2OA 1WZKA 3G6LA 4UQBA 2BG5A 3WUGA 1UD3A 1KQZA 3UCCA 2QJIA 1D2KA 2Y7GA 1ZGDA 3W01A 2H9AB 1S5TA 3GBEA 3VNLA 2POTA 3PJXA 1LDCA 4LCRA 4YWIA 2PDCA 4HU8A 4AWSA 1WX0A 3W83A 2YBVA 3WJWA 5IXEA 3KLKA 3QHNA 2VGFA 1F76A 2C19A 2HE8A 4M7TA 4HSOA 4L1XA 4UFIA 3E96A 1OK4A 1GQKA 3S46A 2XFFA 4JIHA 1L8NA 1WDWA 3N11A 3M0IA 4L5ZA 1TV5A 3CK5A 1LUCA 3GZ3A 4JX6A 3BQ5A 1HL8A 4AX6A 2FGLA 2RJHA 2EG6A 3BMVA 2WMFA 2YW4A 2R14A 5C9XA 3KP1A 2X05A 4YYFA 1L2QA 4DBSA 1RCQA 2WHMA 2V9DA 3RX4A 3KUMA 3P0XA 3KBJA 3FJ4A 3TE9A 4A3HA 5K9DA 3R12A 1SW0A 3M1ZA 1D9EA 4UFJA 3N04A 3HJZA 1ZBVA 2Y0FA 1FWHC 3CZ8A 1JD7A 1EIBA 1HVQA 4WXZA 3MP4A 4DY1A 1W3KA 2FFIA 4UTJA 1NELA 2ZADA 3KFTA 5TAOA 4W8AA 3R89A 5FF2A 4CNTA 1JPKA 4C6LA 2Y5JA 1QHPA 3T8QA 3VM5A 1OYBA 4O18A 3K8KA 3S2NA 7CGTA 2QCFA 1XSIA 4JEQA 1XISA 4GYJA 1KGWA 1U30A 4L65A 4LNYA 2E9LA 1JUEA 4L56A 4EF8A 3R0UA 3C2OA 1GKRA 3F7JA 7ODCA 3POHA 1DJHA 1GQIA 4J3WA 3GNNA 2P5NA 7PTDA 1Z42A 1SO5A 4F79A 3E0WA 2BOGX 3WDQA 4LVAA 1UUOA 2PWUA 2AL1A 4JS3A 4A3RA 4AAJA 2VX4A 4DJFA 3TYDA 2OR2A 1MXDA 1R87A 2PWEA 3T7VA 1FCUA 4M81A 4M19A 4C6QA 4GXPA 3WQGA 1WO2A 3W88A 1M7PA 1TCDA 1Z8AA 3IV8A 3NOYA 1B3WA 2PCEA 2XN1A 1E40A 1ZENA 4QLKA 1TPEA 1CI1A 1XYMA 1LUCB 2E28A 2F61A 2BXVA 5I02A 1O7AA 4H6KA 4ACYA 2GGIA 1FVPA 1WXYA 2ZWZA 6ENLA 1ISYA 4PL2A 2VP8A 4FI4A 4AU0A 1DXIA 2EPLX 1MUCA 3RO6A 2J27A 2XH2A 3E2VA 5FKYA 3ITGA 2WAGA 3GNPA 4I9AA 4LC6A 4IT1A 2J66A 4UQ9A 4QG8A 2F38A 2D20A 1DIOA 4HK5A 4GA8A 2XSAA 4KCTA 1BYBA 5F1UA 5D33A 3SJ3A 2PDFA 1IEIA 1QWKA 2NV1A 4ZB0A 3ZVHA 1LL6A 4PSRA 1XYCA 1NWRA 3B8TA 3WUFA 2QUUA 3F4CA 1W1A1 5A6BD 1X39A 3WBWA 1UG6A 3GAKA 1BHGA 2FTPA 1VB9A 3NOEA 1VD6A 3UNTA 3R8RA 1OBAA 1SJBA 2NXIA 5DMYA 1OJXA 3G1HA 4J35A 4QCFA 5CKSA 3B0PA 3UG4A 3P0WA 1OCQA 3RAOA 2IPJA 3WNPA 3KOFA 2ZZ7A 1OB0A 3TROA 2E3ZA 2WNQA 1ZJAA 4J3XA 3T8LA 3TJIA 4C6DA 5LHEA 4RJEA 4AD5A 1CW2A 2W67A 4QDWA 4RV8A 1AQHA 2O4QA 3NSMA 4O14A 3E2SA 4LUSB 2D2GA 1A5BA 1PTGA 1ZZMA 1GEHA 1VFTA 4GQBA 1BD0A 3JZEA 3S2JA 4DUWA 3AO0A 1U33A 2EG8A 2QW5A 1W1B1 2OFJA 3ARYA 4LU0A 4UMBA 2VZTA 3KVMA 2V5CA 2C1IA 2QS8A 2BBFA 2G3NA 4J27A 2E77A 3ERPA 2OWXA 2AOSA 1TJRA 1QOXA 3M41A 2OU4A 1JG9A 1V03A 3EB4A 1GHRA 1V6UA 5D02A 1EB3A 3KP0A 4PH6A 3TQVA 1VLWA 2CHRA 5CXPA 4F0KA 1B3VA 1AH3A 3P5YA 5C5YA 5JMUA 1J0YA 3WH8A 3UGVA 4XZMX 1XGEA 4PUWA 4ZA0A 3DFHA 4KIEA 4AIBA 3VDGA 3WG6A 3GSMA 4CCZA 1OX4A 1THFD 1XPGA 2YXXA 2Q09A 3B06A 4S3FA 3O63A 9XIMA 5HMEA 3GUGA 3STCA 3SUSA 3RRAA 3ZVHB 2JF6A 2JEPA 1JXJA 4DF2A 1EO5A 2XGZA 3LTYA 2YPIA 3PNUA 1EP3A 1XV8A 2WSKA 3GVVA 1HW6A 1R6WA 1GVYA 3P2VA 5DCDA 1E9LA 1Q7ZA 3ARQA 1GOQA 3W7NA 1JDEA 5KTLA 4PODA 1VH7A 1LROA 1NFPA 3MHUA 3MMDA 3PS7A 3PJTA 3IGUA 5FSDC 3EYPA 1UOKA 3V7PA 3A3XA 4D8AA 2QGHA 3M0HA 1L6SA 5LKYA 3I4EA 1IR1A 3W0KA 4C1NA 3L0GA 3W7MA 3VNYA 4H7VA 4X0NA 4N4QA 4NUWA 4CD5A 1CIUA 4FLRA 3WN6A 1V79A 1WDPA 2P8BA 1CYGA 4QIUA 3SIMA 4UTTC 4FA3A 2O92A 5B7ZA 5D09A 1VIZA 4GQQA 4XV0A 1DV7A 4RDYA 4MZYA 2WSRA 4AZ7A 2C1HA 3GWQA 4LVDA 3CASA 1TPH1 4S23A 3GHRA 3W1MA 3ITCA 2ZRYA 4RDWA 4UFHA 3PZVA 1LWJA 2ZZ1A 2HRWA 3V5OA 1XRVA 2V5LA 3A22A 2GUUA 3OP2A 3NPXA 4Q32A 4WY0F 1RPKA 2PDGA 4A05A 5E9AA 3VC5A 3LTSA 3R8HA 3NL5A 3LDVA 3W7IA 3WJXA 1GPWA 1N7KA 3PHAA 4MVAA 3RJYA 4NZCA 1YNYA 4ECLA 4HU4A 4L4LA 2XN0A 4B2DA 3L4YA 3MJMA 2B7QA 1VS1A 2PDMA 5JBEA 1X1ZA 3LGDA 2VWTA 4MY8A 3EWWA 3GIQA 4GNVA 1JF6A 3OYZA 3THDA 1RQHA 4CN4A 5IBXC 1A3HA 2B31A 4POCA 4AD4A 4AD0A 3DEQA 1I2PA 2E5CA 2MANA 1Q8AA 5AYYA 3UZXA 3W7LA 4JN7A 2A3EA 1IEQA 2J13A 1MXSA 1FP8A 1R8LA 2PE4A 2BVWA 1GZ1A 4GX8A 2YZ5A 5E0FA 1UA3A 4V27A 3FXYA 4PN2A 1SJAA 1CXHA 3ZMRA 1ZJHA 4E2VA 4C1NB 2G4FA 2AGKA 2X1UA 5M1TA 2BY0A 2PFHA 2QCGA 3TQ0A 1TPFA 1L6FA 5I3FA 3KAOA 2DGAA 2QUMA 1M5WA 3DFTA 3TC3A 3U8GA 1WA3A 3WJZA 4FOKA 1A0EA 2OZTA 3GH7A 2RDWA 3NZPA 3H55A 2D3NA 3E0FA 3N4AA 3AYRA 3PG9A 3BGGA 2Z2UA 3KBVA 4GC3A 4ZL1A 3T07A 1OABA 3UWWA 4DAIA 4XTIA 1XC4A 1J0IA 3QV9A 2Y5SA 1UIOA 2YFOA 4OOZA 4LOCA 3B3DA 4NXKA 2VOMA 5CSRA 2CZFA 5LIUX 4F3HA 1TR1A 1UP3A 2NSXA 3D46A 4WGXA 4U28A 4PSPA 1UZDA 4M1RA 3LXCA 2Y7EA 3GLCA 1XIBA 3FSUA 3NVDA 4F2UA 1IEVA 3CQ0A 1ESWA 4D6IA 3KOYA 1N82A 4ZO6A 2BGQA 5U4NA 1BTCA 3AROA 4W88A 2VFHA 1LM1A 4GVIA 5FSEC 3W29A 1K6AA 3UERA 1U2YA 3QOMA 4M7SA 2CCRA 4CNUA 4H6EA 4N9BA 5FCZA 4UTWA 3XINA 1HXJA 2GVYA 2OO6A 4PMUA 3II1A 1ZS2A 1W9BM 1W91A 1P0BA 1UROA 2A85A 2WMJA 2ZFAA 4QGCA 3UYIA 3IGXA 3CHVA 3T4WA 1UR0A 1R5YA 3W75A 3S9IA 1KTBA 4XSLA 3EEZA 2WW5A 1AVAA 3AQUA 1L0PA 5KZEA 3OA5A 4PMDA 4JQAA 3LZ3A 3SCTA 1JL8A 1PWLA 1XHGA 4QSFA 1H62A 1ZBWA 1PYMA 1KO0A 3BSHA 3VCRA 3VPLA 5BOFA 3W1UA 1EZ2A 1C8QA 1C29A 1HVXA 4NAFA 1J8VA 4S39A 3KL3A 4P7RA 2ZWYA 3BICA 2CNCA 4HZ8A 1V7YA 4GYPA 3QW3A 4EVZA 1J2BA 5JQ9A 4DELA 1J18A 1UB3A 1TA3B 4K2SA 1EDQA 1H1ZA 3T0DA 3N73A 3UP8A 4Y96A 4S3KA 5CCZA 1AH0A 4RLIA 3VKDA 1ADOA 2BGNE 1DJZA 2AGTA 1BTMA 3E0VA 3SQMA 4E6MA 4Z2JA 2WCGA 1AD4A 2XIBA 3EWYA 2YGYA 1EXBA 3MBFA 4K8GA 1W3LA 2OYMA 4Q7IA 2QEZA 1A49A 4O11A 2HCVA 1HJQA 3W7EA 4Z2IA 3SUWA 3LUTA 3SSJA 4Q7BA 5CSUA 2DUZA 2SFPA 2RAGA 5F4WA 2OPJA 1OX6A 3THUA 2VQTA 4CU7A 3QMSA 2HS6A 4LYKA 1ISZA 4DJDD 1BVZA 3CHCA 3TCEA 3VZYA 3OZYA 1OIFA 2DZBA 4XB3A 1E6NA 3DENA 2GZXA 3RCNA 3BO9A 2RH9A 4JN8A 1H63A 3UJRA 1F3TA 1FTXA 3BV7A 1IQ8A 3BG3A 2ZUSA 2A4AA 4LUYA 4LGXA 1YADA 2ZZ6A 2O0TA 3C3UA 1BF2A 5AYBA 4DUVA 3I6EA 2QDEA 1ONRA 1QWGA 3DFNA 3SUVA 1WDRA 2XDFA 4IMFA 5E93A 1OYCA 4ZEPA 2CXGA 3W2LA 2VWSA 4UNLA 3I65A 3L4XA 4MFEA 3K1DA 3QLLA 2DDXA 2D73A 3WNNA 4ZO8A 4QM1A 1CPUA 4M24A 1CGVA 4JFVA 5CSSA 3BURA 3S2LA 2DQWA 4NAFB 3NQEA 2GUYA 1FDZA 3FYOA 2PMQA 3VO0A 3TW9A 1ZTVA 3N2CA 2Q02A 3WLRA 3MT1A 4FXFA 3AIUA 4UZUA 4FK9A 2Y61A 4X22A 1KBLA 4NX0A 4JTKA 3NYDA 4RX0A 1YMYA 3DIPA 3DXIA 4JPGA 1MNZA 4HA1A 2YZRA 4DBUA 1DTUA 3F2DA 3IACA 3U2EA 1G4PA 4LXFA 1ZLPA 1WZLA 4FNRA 4IM4A 1QO2A 1Q6CA 6PTDA 1H7PA 1DQUA 3VIPA 1Y0EA 1PL9A 1R7AA 3NXLA 4ES4A 1UWTA 5A6SA 3LHZA 4WK9A 2OEMA 1S5WA 2CWNA 3NO5A 5HUPA 4S2CA 3VIFA 4JQ4A 2QXWA 1KLZA 2FIQA 2HVNA 4JFSA 1V02E 1CXIA 4QJ4B 1IIHA 4LRSA 2G96A 2VCAA 1GWJA 1MW2A 2Q8XA 2G50A 1ICQA 3ISIX 2QT3A 1NWSA 4Y9OA 4DJFD 5C2CA 4RZ6A 4CEXC 4YMZA 3VILA 3WFAA 3ZJKA 1VFFA 4D72A 4NJKA 3CMJA 1KFKA 3C0SA 2Z1KA 2H90A 3WLTA 3KVLA 4J3TA 4NJIA 2WJFA 2VM8A 3RPTA 4ROPA 2DT2A 5A5WA 1H4PA 4IJCA 2B0MA 5FAJA 4CQ9A 2DPEA 3L23A 2TYSA 4ATLA 3APGA 3H12A 5FI8A 1ADSA 3V5CA 2ZUMA 3AHZA 3N2BA 2OB3A 4AVFA 1AJ2A 1KLYA 4MHBA 3DBPA 4Q8MA 4B5WA 3WF0A 1CWYA 1AQ0A 4LVFA 5HNRA 1Q6OA 4LYRA 4PB5A 2PA6A 1KRCC 4MWAC 1IGSA 1A50A 5I0DA 1CXEA 5HR7A 1R9XA 3DGBA 1LQ2A 3MUZ1 1XQLA 4PB3A 2EJAA 3H8AA 3PPFA 1PCWA 3KBWA 1CXLA 2I7GA 3LHTA 4QITA 1XICA 2FVMA 3IIVA 3PUDA 4MB3A 4TV6A 1UKSA 4OTKA 4BF5A 4XIMA 1OCJA 1QI2A 1VQTA 2J7HA 1SJDA 3ANYA 3TQKA 1JZ8A 3PJUA 1R3TA 2A7NA 2HXUA 3APYA 3WO8A 2XIMA 2YDQA 2Z27A 1O5QA 3CWHA 1LRTA 3VUPA 3P93A 1DIDA 2C13A 3EDFA 4AX7A 5M03A 1ENUA 3QTGA 1XLBA 2CLFA 1DJIA 2CLMA 1PHQA 4J1OA 5LYRA 2JEQA 3Q58A 4G56A 3WDRA 4QG6A 1NFGA 3TNOA 3VDBA 3Q4DA 1VRDA 2JGQA 1QPKA 4QAIA 2EGZA 4W86A 1C9WA 4O13A 4ZQCA 2Z28A 4L1GA 3GS6A 3JW7A 3CO4A 3ITXA 4Q4PA 1GQNA 1KFCA 1C91A 5AHLA 1IXQA 1E1FA 5DF0A 1VFLA 2ZRVA 4CU8A 3O3RA 1OWQA 2W9MA 3NM3A 4LCQA 4YCPA 3IIPA 2J6VA 1JCNA 4LC8A 2DY3A 3R94A 1HL2A 1G4SA 1DXEA 3IARA 3OGVA 1T5AA 3GNOA 5C2XA 4Q8TA 3PZUA 2C18A 4Q4SA 1Q63A 3WDIA 1YTEA 4M80A 3WF4A 3CO8A 1G4TA 4A29A 3WLJA 3LLFA 3Q65A 2DVTA 3CAWA 3WK0A 1MEIA 1A5LC 4JX5A 2PBGA 4P8UA 3BGJA 1RUSA 1BG9A 1XLIA 4NZ1A 4LCSA 3BOFA 3R8GA 2E5DA 3LCXA 3UWUA 3MVIA 4IMDA 1QOQA 2X0YA 5LIXX 4GY1A 1EJSC 4XUGA 1Q13A 2DH2A 3ZR6A 2FHCA 4PMOA 5J5DA 1RBOB 1E4NA 2ZICA 4O17A 1REQA 3VX1A 2RUSA 3T2PA 1LL4A 1V0NA 4FXRA 3DHUA 2YDAA 4N9DA 2WMIB 4NAEA 1B9ZA 4Q8QA 3ARRA 2JK2A 2VFGA 1XIHA 3PK7A 4FEZA 5CBIA 2ZUUA 3NPUA 3QF0A 3BAXA 1RY0A 4WJXA 3EXRA 2CU0A 2ZCGA 2VURA 1AQMA 1TPVA 3WK1A 3KRZA 2E8ZA 2O7QA 1HKIA 5HQEA 4K36A 2PDKA 2FPVA 3K5XA 2F6KA 3DHPA 4NJHA 1A80A 4JTLA 1AW2A 2VL4A 1H1YA 3EEGA 1R9ZA 2DSVA 3NL2A 3AWOA 3T2QA 3H2CA 3IAPA 3QR1A 1V08A 3KS5A 2NZLA 3VX0A 1GT8A 2J88A 1OX5A 3VGDA 1CGUA 3V1HA 3ARSA 4XD3A 3CYVA 4Q8NA 1FWJC 3PUGA 1KCLA 1V6WA 4WKAA 3VD9A 3AWNA 2RDUA 1R3VA 3WQWA 1Q6FA 3WD1A 2VXNA 1WAWA 1XIJA 1ITXA 5F1VA 4JEJA 1YBQB 5I2UA 3WNOA 3W7DA 1MYRA 3FOKA 2WLYA 4H00A 1G69A 1S46A 4Y8FA 3ENLA 3DH7A 4ZTXA 4C6OA 3E2RA 4AWUA 2PC8A 2V67A 3QYQA 1X38A 1JI2A 4CNOA 5A6JA 5I3IA 3OIHA 1M03A 5D32A 2CIPA 3SUUA 4S3DA 3OGSA 4GISA 2Q3OA 2TODA 3VM7A 5AFDA 2DIKA 3W26A 3RCYA 4ZQRA 4D6HA 1FWIC 3VA8A 5KITA 1W37A 4XAZA 4JTAA 3T78A 4HA4A 3IJIA 4KCUA 3ZOAA 1REQB 3PY2A 1UR1A 3UU0A 3PZIA 3NQCA 4BA0A 4Y6GA 1WKDA 3IK2A 4NAEB 4U5IA 1O94A 3MHFA 3U7BA 5TD4A 2IW0A 3GVGA 2WVSA 4O0KA 4PYSA 4A3UA 4W84A 4RZ4A 3FCPA 2IPGA 3FHQA 3QHOA 2QIIA 3F2BA 1QCWA 1IXNA 1US0A 1H0IA 5AB3A 4US6A 3QKEA 3W86A 3LI1A 2WPBA 1ZHAA 2IQ0A 1D3HA 3LCGA 2OT1A 1DE5A 3VGFA 5A2CA 4PE8A 2VOTA 2Z6IA 4R3UA 1YDOA 3L68A 1X6NA 2NUWA 2J74A 3H4WA 1B3ZA 3PNZA 4BKNA 3G1DA 3DI1A 3E38A 4LUIA 3SO7A 3AYVA 2YL6A 3BAJA 4KERA 1CTNA 1IWBA 1TJ2A 2G97A 3S8HA 2X7WA 4NI3A 4I5RA 5C0QA 2UY4A 3TLQA 1N8FA 2E0PA 4C6FA 5F4XA 1K4HA 3HGRA 2GFTA 3RM4A 4INFA 3WD3A 1XXXA 2WZTA 4TO8A 1EYWA 4HK6A 1BWVA 2YCIX 1SO4A 1FWFC 5TBOA 4LVBA 3E0IA 4GX9A 2PURA 5AZ1A 5HQLA 1RJRA 2XVPA 2B81A 3QV6A 4O19A 2VD8A 1BXNA 1DJQA 2WQPA 1VCVA 1OSEA 2QULA 3HG3A 1ONWA 1JPDX 1PXGA 3EDDA 4IMGA 3NCOA 1WDDA 2UV8G 5ABTA 4K1GA 3XIMA 3EZ4A 1O95A 3P14A 2G3JA 4I9TA 4B5UA 1GNXA 2J6XA 1LWHA 3GW0A 1XQKA 4QG9A 1CGYA 1SMAA 2CHNA 4I7VA 1B2YA 1XF0A 2GSJA 2OSXA 1JR1A 1EWEA 3IWPA 4MYXA 1MDRA 4DNHA 4O54A 2HPMA 5GJNA 1RCOB 3LPFA 1IYXA 2G37A 3L0NA 4ZR8A 5I3HA 2PWFA 3CTLA 1LBFA 4DWDA 4NILA 5F2LA 3GYCA 4PL1A 3HPZA 4OFCA 3BAWA 4FX6M 4DZAA 2Y89A 3CH9A 1W5QA 4BI7A 1M41A 1UCWA 1QAPA 3AIVA 3CAVA 3M0XA 3N4EA 4DO7A 1Q66A 4PGLA 3M9YA 1KFLA 1SJCA 2J25A 4HMNA 4BS0A 1PB0A 1JZ4A 4ACZA 2DH3A 4AEEA 1CENA 5DMLA 2X1SA 5AZ0A 1UBSA 1RA5A 3EKZA 1YIXA 3O1NA 4X61A 4JTRA 4IIFA 1CEOA 1EH9A 3LCIA 4XTDA 1E4MM 3VOIA 1VAHA 2XSXA 1FH9A 5LNSA 2QJNA 1HP5A 5HMSA 3JZUA 5EMMA 2O56A 1E15A 1VKFA 2XH0A 4DZ5A 8RUCA 1FCQA 3CS2A 4ORIA 3UJSA 3VKJA 2WBKA 4UB9A 4EPBC 3SZ8A 3QYSA 4MDOA 3U4AA 3ORWA 4CQ8A 2AL2A 1UD6A 3CT7A 3IIZA 1BLIA 2DUXA 2O55A 1Z48A 3EMCA 2PDYA 1TE6A 4A6GA 3M6YA 4S3AA 2OLSA 4ZSUA 3U5YA 1BSIA 3S1XA 2G5WA 2NQHA 3G1YA 2X40A 4UR7A 3S83A 1WP6A 3N15A 2YBTA 1Q6QA 3T09A 4LFYA 4E8DA 3UBPC 1NWUA 4WR3A 2Z25A 3P8JA 5EMLA 2FVKA 4ZQPA 4GINA 5M2FX 2OQLA 2XVKA 4IPJA 2YA2A 2R82A 3O6CA 4WX2A 1B0IA 1OK6A 3B8IA 3FVDA 4EXAA 1TVNA 5I00A 5CQ1A 4HHMA 3RLHA 4HTYA 3RILA 4UBPC 2NVDA 5CG7A 3RR1A 3ONCA 1FH8A 3LBMA 4W5UA 2E6DA 2INZA 3UZZA 1Z32X 3PWIA 4DB7A 1W3HA 2CBJA 3T40A 1ZU8A 3M0ZA 4W7UA 1V5XA 1D7FA 3NM1A 1YHTA 1XWYA 3NQ7A 5A2BA 1EHNA 1DJWA 3MUCA 1OHLA 4CCDA 3NZQA 2J79A 5D30A 4WXYA 4ERGA 4FLQA 5DQPA 4BCEA 1US3A 3L4VA 3BQ6A 1W1IE 1RK5A 2YCJA 1TX2A 3J7HA 2PTXA 3SCPA 3WSUA 1JCTA 1YQ2A 1ZAIA 5CC7A 4JKMA 1OQFA 4LALA 3ZT7A 3PUOA 4B15A 1KM2A 3TA6A 1AH4A 1NDZA 1LG1A 4A22A 9CGTA 2J7DA 4AC1X 7A3HA 1XW8A 3L4TA 3V0TA 1TMQA 1SW3A 1NDYA 2AL2B 4OUIA 4IFKA 3AXHA 3HPAA 5JXQA 1LJYA 4UCGA 4NRRA 1NARA 5FEXA 3JUGA 4HHLA 5DMNA 2D0FA 2A3CA 3W28A 5BXPA 4GZEA 1M1BA 4U33A 5G2WA 1R38A 2QJHA 1TMHA 3AS2A 1UPMB 1NJJA 3LXBA 4Y9AA 1UD4A 1KV5A 2YKKA 3STFA 3MANA 4GIRA 3GG1A 4PC8A 1SMDA 3KZPA 1IXPA 2WM1A 1QOPA 2NUXA 3MUAA 2HMCA 3FA4A 4GBDA 3GU9A 2J24A 2J7FA 4WVXA 3S6DA 5ECUA 4MF4A 4H4IA 4QQ3A 4QSHA 2Y8KA 4IMEA 1W9DM 4H9VA 3VD7A 4GO9A 2GUBA 4H8NA 1SYTA 3W37A 1MFUA 2EXOA 1HL9A 3UW6A 2GGJA 1P0KA 3UD6A 2YIHA 5I3JA 3URQA 3P6LA 1BYCA 4QFUA 1JZ6A 1N55A 2QMKA 3BLEA 4N42A 4CGTA 1KRMA 3QMTA 4GRSA 4YLWA 1VBGA 2WNNA 1S2TA 1FHLA 1Z89A 3G24A 1EC8A 3DAQA 2G95A 4I3GA 4PMJA 3O6AA 1SQ7A 3STEA 2DU2A 2GJPA 2YLAA 3HGSA 5EMUA 3CUXA 4JIIX 4PMVA 3PPCA 2FZ8A 4X0VA 3EWDA 3EOSA 2D2OA 3KCLA 4O1FA 4NG3A 3DYPA 2NX3A 4EWJA 4XD4A 5C7HA 2HNEA 3BSMA 3UXDA 1I2NA 4H41A 3WBEA 5EYWA 4PBGA 1EDGA 4G6CA 2WYSA 3S5NA 3N3MA 2PODA 3H2AA 2OX1A 3BCDA 4MG4A 3KEHA 3ZVIA 4LEFA 2V69A 4IFKB 1HQTA 3BLFA 2XVLA 4IL2A 4MM1A 3KRSA 1XJBA 4NI8A 3P7YA 2PP1A 5FJIA 1E0WA 4LY4A 1I0DA 4JTSA 4ML4A 3OBAA 4G1NA 1LOLA 2VR5A 3R58A 4EAMA 5AHMA 4A4AA 3C0JA 4NZ3A 1WPCA 3CZGA 4O4VA 4I5UA 2Y8VA 5IBXA 1HKVA 4O0ZA 1CBGA 1GORA 1HUVA 1PO9A 5K9XA 2OTDA 3EMQA 3TEVA 2DJLA 3VE9A 5I23A 2FFCA 4O57A 1GZGA 1O68A 3QQ0A 4PMZA 4RK8A 2ZRUA 3UZWA 4AIUA 4KWVA 4GNKB 1YPXA 4Q4QA 2Y24A 3DC8A 1UYQA 4RNIA 1JCYA 4K68A 3W1RA 4P7QA 1JVNA 2UWFA 3G6MA 3QKZA 2ALRA 1NP0A 5MKGA 2QDDA 3FY1A 2BXYA 3UR8A 3SY1A 3CLWA 2G4JA 1IEXA 4Q6XA 2BX7A 3BLKA 3AYTA 2ALDA 1EGMA 4IP5A 1XFBA 2X0SA 1MW1A 1V51A 4CVUA 4UTIA 3H24A 1R3SA 3FA3A 4PUMA 2QGYA 3LQGA 2O7SA 4Q4KA 4PRWA 5J5RA 3W53A 3SGZA 4QDMA 4AIOA 1CXKA 4CEUC 3OLDA 4C5ZA 4YIWA 3OQ8A 2HJPA 5FACA 2DZAA 2PB1A 1KXHA 3Q94A 1TWIA 4P5UA 3EDEA 1LYXA 4MJ2A 1VLIA 2WKGA 1TV7A 5ECVA 1VEOA 3HGOA 1BAGA 2QAFA 1B54A 5HATA 5K7JA 2PDPA 2WHJA 3PSVA 4O1BA 4LF2A 2PTZA 2OELA 3CQKA 4B5SA 4GZIA 4AB4A 1FWBC 3HBLA 1H51A 3NA8A 3LY0A 4DWSA 3MKVA 3N6HA 3QC3A 3R7MA 4D8LA 1SFLA 3GU1A 3QQWA 2W0UA 3UT0A 4QJ3B 3BARA 4N4PA 3MMTA 4MJ4A 1M68A 2V30A 4KESA 4PTXA 1L6GA 1YDVA 1S1PA 3W9ZA 1MW0A 4CVWA 4BR1A 3CZEA 3W02A 2GL5A 3IVUA 4K7YA 2V2DA 2PRMA 1U1HA 2Y5EA 1U1UA 1GJPA 2C15A 4O1EA 2VNCA 3KWXA 1PKNA 4GJIA 3QH2A 4Y7EA 1DQWA 1NTHA 1PWMA 1CECA 3K4DA 1H7XA 3NQVA 3JRKA 2D24A 2E5BA 4C1KA 3VD5A 3GTHA 1U83A 2NVCA 2WZEA 3CPGA 1Q2RA 3M5ZA 5FD0A 2ZXAA 5CJMA 1KXVA 4AUBA 1QI4A 3KOXA 2X1TA 2FZNA 4OZOA 3NDZA 1GTEA 4JTGA 1JUBA 3MPGA 2V2CA 3GD6A 1NFBA 2VQUA 1BGGA 3PTDA 5EBUA 4Q8VA 2BHUA 2DIJA 4J28A 4TVDA 4CNNA 2ANUA 1Y5XA 1PZ3A 4H1ZA 3FV9A 1GG0A 1Q65A 2R1PA 4ORMA 1P0DA 2IKGA 3AZSA 3BWWA 4BF7A 4N6FA 2QCNA 4IL0A 4IPIA 2PU0A 4XKYB 1XP3A 2QPUA 4JIEA 4LAUA 3C2RA 3L5MA 5BROA 4F4RA 2WJEA 4QJ5B 3B40A 5CAHA 2R94A 4CKQA 5KZ6A 3H4XA 3MWAA 1H7RA 3NYZA 1CGXA 1X97A 3FXGA 4HQVA 2W63A 1RP8A 2NW0A 2F9RA 3L5AA 4BQ2A 5A8OA 1UR2A 4HZ7A 3B9DA 4ZODA 4GJJA 3PWGA 4UTWC 3OBEA 4S38A 1QU4A 3IAQA 1X98A 4YTQA 1C9DA 1RV8A 3VK5A 3SY8A 1QNPA 3TZNA 4DXVA 1T40A 4AZBA 4C5YA 4UQEA 2ZQ0A 1EF2A 2Q8LA 3UF9A 3SN1A 1FBAA 3HMCA 5AOUA 3EWBX 3A3HA 2PEVA 4GI9A 3VD3A 2PDJA 4M56A 2XIJA 2VDHA 4PMXA 3VIOA 5G2HA 3I4KA 3APTA 3MCOA 3UETA 4PCSA 3BXWA 2EJ1A 3MO7A 5I5RA 3C61A 1W9XA 1ZL1A 3WQOA 3LU2A 5GVJA 2G8ZA 1H7WA 2VEIA 5E5CA 1GKQA 2X2GA 4LB4A 2YOCA 3AZTA 2JALA 3C2YA 4HTBA 3AXMA 3ZR5A 3NUKA 2HVMA 1RPXA 5KEZA 3DFSA 2BZNA 3GVWA 1A47A 2FMOA 1GQJA 3KDNA 3TMLA 2PDXA 3GK0A 3PSWA 3G5EA 2Z7KA 1MXGA 5ABFA 3BJTA 2P0IA 4MB5A 4KFOA 5CSYA 3URAA 2DZWA 1JNEA 5CZKA 1R3RA 3IGHX 5E0CA 3NGJA 2ACUA 2PGRA 2VT0A 3W73A 1E9IA 4JFWA 3BK0A 3NQDA 4FB7A 1FA2A 4DYEA 2CBVA 4XZ9A 1WCGA 1OD0A 4AHOA 1R3YA 4HNNA 3AMLA 4G1KA 5ABHA 3GFZA 1UR4A 3VFCA 4PTWA 1CGTA 3ZJ7A 3POCA 1KCXA 5IFPA 1OGGA 4UOQA 1Y7VA 1QNOA 1MMFA 3RJXA 2XFWA 1O6IA 3SSZA 3GC4A 3VNIA 4ERIA 4ADSA 1VRXA 4ADTA 1S38A 2CETA 1JQVA 4PUJA 1I1WA 3DI0A 3VGGA 4D1IA 1XCWA 4Z42C 4YVPA 1DHPA 3H53A 1GK8A 4WSKA 3VKCA 2DT0A 1UR3M 2PCQA 1OFQA 2NXGA 4ZXLA 1NAL1 2IKJA 4RE4A 5HUOA 2HV5A 2V68A 4JDYA 1F8MA 4MY9A 2V6AA 1TPC1 4LH8A 1GCYA 2WOQA 4PR4A 2ZZ3A 2VFIA 4B90A 3UWEA 2I1OA 3RPMA 2GDQA 3PFMA 2QVNA 1XBXA 3EA1A 1PBGA 2CHOA 3RPDA 2NUYA 4DM1A 3NEHA 1JJKA 2ZRXA 2FJUB 4JOMA 4PB4A 1G67A 1HGWA 2QCDA 2WBGA 2Z1SA 5K2ZA 3EWUA 1KM4A 4DBWA 3RU6A 5ABFB 5CEWA 1PUDA 1OT2A 2ADAA 1XUUA 4H6RA 2GJXA 2OJPA 1HJUA 1YPIA 2ZE0A 2VEGA 3KRUA 4E3VA 4Z1AA 3B8SA 3EA2A 3SFKA 4WOZA 1CNVA 3GNRA 2BDQA 5BMXA 3CU2A 3CPUA 1E51A 3WQCA 4WUIA 3PZNA 5ABGA 2YFNA 2E25A 5AC8A 1EXPA 4DN1A 2ZZ5A 3CUHA 4X63A 3QZEA 3PR2A 3ONBA 1RLDA 3H7RA 4WIWA 2OT0A 6CGTA 2GDVA 3SCWA 1KWGA 1UOZA 3W6LA 4KBXA 1A4LA 1M7XA 4H8UA 4GK8A 1LBMA 1TREA 5J8LA 5AY7A 3UJFA 5C70A 2Y7FA 3P62A 4PTVA 1OFBA 2J78A 1EJ7L 3UVIA 4D2JA 4E3TA 3CUFA 4KEZA 3S3GA 4GNJA 1A5OC 1WUEA 3WF1A 2BODX 1EC9A 3DKJA 3DGRA 2IKIA 1ODUA 3BG9A 4GKLA 4H9YA 1MVYA 3BOXA 3T08A 4D1JA 2CKRA 2YXOA 2VENA 4LNCA 5L6UA 4MWAB 4GO8A 4JHZA 1KFWA 5G1MA 4CUCA 2NV2A 4B5NA 1G9HA 2TSYA 1LG2A 1DEDA 4KWOA 3LCHA 3CEUA 3MUXA 3FIGA 3ITLA 4OIFA 2YLLA 3VOCA 1Q4NX 1F7BA 2FGBA 4JTEA 5T9BG 3AIEA 3A64A 3N4FA 1JUKA 3GE7A 2OXNA 3IJLA 3PZTA 4H8HA 5JIWA 4GYKA 2ZTKA 1E6SM 3M5VA 3HPSA 1EX5A 2WO5A 5D2WA 2GJXB 1LP6A 3GR8A 3PBWA 4AHPA 3M46A 5BNKA 2J8GA 1W0MA 2P50A 4M51A 1RD5A 4QS6A 4PA8A 3LOTA 4CD8A 2RGLA 3KCJA 2PWHA 8A3HA 2J4GA 2YCLA 4GH1A 5CZTA 5AC7A 2ISVA 4MPKA 5EL1A 4CD7A 3ALGA 7TIMA 3G8RA 3WEOA 3L2MA 4JKKA 5IFTA 4DIAA 3NWRA 4HNUA 1AJ0A 2PDNA 5KETA 2HTMA 5JVLA 1ECEA 4QLJA 1GYNA 2GVGA 2G3IA 2Z00A 4RKAA 1JD9A 4K39A 2FTWA 4S3EA 3CV1A 3TNBA 2WZMA 3FAXA 1MDLA 4P8XA 1B9BA 1JCJA 3HTWA 1TIWA 1NVMA 1VYSX 2Y70A 3EOOA 1BKSA 2PTDA 2GQAA 3WJYA 4H83A 1W3IA 1OFPA 3CMFA 1CGWA 1ISXA 4HIBA 2GVEA 4FXSA 3QOKA 1SVDA 4DO6A 2X41A 3WMBA 1QT1A 1EYEA 1WAUA 3L4UA 5I24A 3C3NA 5DMMA 3UXKA 3TKFA 4LQ1A 1TKKA 1TYGA 2P3ZA 3O2LA 1SGJA 4Z2LA 4DYKA 3VAVA 3TAOA 1FWRA 1JPHA 4EE9A 4J2MA 3KHJA 4H8VA 4DM2A 4G7EA 5FF7A 2ABBA 2YSWA 1E0UA 1RZMA 4KW2A 4TQTA 4WKFA 1PZ0A 3W84A 4FXJA 4DEFA 3PBVA 3EWCA 3ZYZA 5HQMA 1K8ZA 5C2GA 3CL7A 5AKQA 4HHPA 4GXMA 1GOWA 2Y1HA 2Z0IA 4JIQA 2C79A 2YCLB 1KQYA 3C2FA 2CKSA 1TTJA 1Q6EA 2XTKA 1B57A 3ARPA 1ME7A 1RXOB 1VFOA 4JL1A 2VDIA 4QAWA 1TPWA 5IOBA 3UCDA 2AQWA 1KB3A 3RFAA 2QQ6A 3PBGA 1QTWA 3GTFA 3REQA 2CFFA 4Z1CA 1EBGA 1G7VA 3VNZA 1M53A 1GEQA 4RW5A 1RQEA 3VOFA 1FCVA 2PP3A 3LD5A 1C7SA 4OVXA 4WF7A 4L6DA 1HKWA 1TX0A 3MKCA 4IIHA 5EPDA 2PRLA 5DELA 3MU7A 1C92A 1B3YA 3CHEA 1R0MA 1JF5A 1D7KA 1AFSA 1BG4A 3CUGA 1J9YA 1TVLA 3U48A 2DT3A