2ZX8A

Alpha-l-fucosidase complexed with inhibitor, f10-2c-o
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
441
structure length
441
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 163
structure length 441
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx8A01
1L8NA 3B9EA 3F5JA 1WNOA 5DO8A 4AIUA 2F61A 1DWAM 4BCEA 1TQVA 2E9LA 4MAZA 4XZWA 2VUYA 5JIWA 2YA0A 1KWGA 1CDGA 3RM4A 1ITCA 3TP4A 4JHOA 3CZEA 4FNSA 3F4VA 1TZ7A 3VD4A 1VFOA 1EA9C 3WN6A 4EK7A 2J7EA 5A95A 3VMPA 2XVNA 4KGJA 2EAEA 1E0VA 4AWEA 4J3VA 2WM0A 2YL9A 2XWDA 3OB8A 4IPNB 4D1IA 3WD1A 3M6DA 1EO5A 1JNEA 2BVYA 1ISYA 2AAAA 4U2ZA 4E8CA 3F5LA 3VIMA 1BPLB 1QWUA 5D9OA 2WANA 1KQYA 2VJXA 3GDBA 2VCAA 5C70A 1NWUA 1C93A 2D0HA 1OD0A 4JZ5A 1N82A 2BHYA 1HVQA 3OLGA 3PZUA 1H2JA 2WK2A 2JEPA 2CXGA 1JF6A 4HZ6A 3BCFA 3LPGA 4HP5A 1CGWA 4JFVA 2G3JA 5EFFA 4JCLA 3AZTA 1UR2A 4D6CA 2WBGA 3WMCA 3AISA 3BVWA 3WNOA 1M7XA 4E8DA 5CQ1A 2XSAA 2XFRA 1V6VA 3BMVA 1C8YA 4XUYA 1J9YA 2EABA 1JXKA 5BXRA 3CPUA 1JF5A 4NXKA 3AOFA 1V02E 1V6UA 5I24A 5CGMA 2E8YA 4UQAA 1MW2A 3BLBA 2WHKA 1H09A 1W3HA 4NZJA 4LX4A 1KR1A 4AMCA 2FE0A 1ESWA 1H3GA 2GJPA 3GNOA 4MDPA 4NF7A 2TAAA 3WD3A 1V0MA 4W8LA 4CCDA 4HOZA 4CD4A 3AIQA 3GH7A 1QI2A 3AMLA 1W1PA 1XYZA 5AY7A 1V3JA 1GVYA 3AJ7A 3KWXA 1E6PA 1BQCA 1JDDA 5I79A 2Y5EA 1F4AA 3UERA 3VIGA 1UHVA 1HL9A 3ARVA 3ZT5A 3SCNA 4JHZA 1EGZA 2ZX6A 1B1YA 1KR0A 5FCZA 3L4XA 3N15A 2W62A 1MQQA 2IUZA 5GQBA 4D6GA 3WDPP 3TV8A 1OB0A 1JGIA 3ZJ6A 5M17A 1P6WA 3OBAA 3VU2A 2A3AA 1GOOA 5HOSA 4FMVA 3A4WA 2E40A 2YL5A 1VBUA 3D5HA 3POCA 5A6KA 2PWDA 3OGVA 2XYLA 3CHFA 1TQUA 2OLHA 3VSTA 5AYBA 3SUSA 3VD3A 4U33A 1E55A 1S46A 1TCMA 4AZCA 1D3CA 2Z1SA 5CLTA 4JL1A 1NH6A 3CLWA 2C7FA 1VIWA 5EMYA 3FW6A 4H8VA 4JFSA 5E70A 1WB0A 4YPJA 1IZJA 4AZBA 1E4IA 3OLDA 1CGVA 2VR5A 4A4AA 3VGHA 3MSGA 2ZXQA 1MVYA 5ABFB 4J28A 3NIYA 1ODUA 4UZSA 4D6HA 2RGLA 5CSYA 2HVMA 3N1AA 2ZXDA 1I1XA 2CETA 5A8NA 1A47A 3DX4A 1O7DC 2CHNA 3BAJA 3EJTA 4ACYA 2D0FA 1H5VA 2GK1A 3WEZA 5I5RA 1WPCA 4HTYA 5ABEA 2DT2A 3BMWA 2VX6A 1W9DM 2ZUTA 1MQRA 1C7SA 2DT3A 5CJ5A 2QPSA 4PMVA 1GQLA 4MB4A 1BAGA 4Z2GA 3AIEA 2PBOA 2Q8XA 5ABGA 1QI5A 5D9PA 1RP9A 1SFSA 2DIJA 2VI0A 3HG4A 4BA0A 1HJQA 4MJ2A 1EO7A 4OJYA 3WNNA 5I23A 1LF1A 3I3DA 4HPHA 1WZKA 4TVDA 3ARXA 4CD7A 4LQ1A 4M1RA 4C7GA 3WEMA 2ZUVA 4KGLA 2W66A 2A3CA 3WENA 1CXHA 2WMFA 2CPUA 3CHCA 3WUBA 4B9ZA 2C0HA 3CHEA 3A6OA 5A6AA 4W8BA 3OLEA 1TG7A 1PIGA 1OT1A 4ZEPA 4H8UA 3MUIA 4Z2KA 2WHLA 1G1YA 3SCOA 4UFMA 4BQ2A 4TX6A 5I77A 3QHNA 1SZNA 6TAAA 4AISA 3HG5A 1QVBA 4X0NA 1MYRA 4F79A 1Q6EA 3RCNA 1NQ6A 1WZAA 5A1AA 4B15A 3IJ7A 1JIBA 1KXHA 2YA1A 3TTQA 4N0RA 1ISVA 1M01A 4OGZA 1CLVA 2VT0A 3BLKA 4YN5A 3ECQA 1G01A 4AZ7A 4F9DA 3QR3A 3WQ6A 2ZX8A 1GOKA 2XGBA 3VMNA 1R75A 3AIBA 1GPFA 3VD5A 1QHPA 2WWDA 1TVPA 2WLZA 1KWKA 3GXPA 4PMDA 4ZXLA 2E8ZA 2V5CA 2YFNA 1GW1A 2BXYA 4URIA 1UD6A 1H49A 2YIHA 3WF3A 1B30A 3T08A 3W29A 1VEPA 1TQTA 5EB8A 4J3UA 3PTMA 3OG2A 2VL4A 2ZOXA 5M03A 1WP6A 1HJXA 3WH8A 1GHRA 3AMGA 2W91A 3DYMA 4PMRA 1XHGA 2F18A 2F7QA 3VNYA 1OT2A 4W5UA 1VJZA 3M46A 4CUCA 4J7RA 3W24A 3NCOA 4JKLA 1E6XM 2F1AA 1GJWA 1NOFA 2MANA 3HMCA 5FKYA 5A6BD 2NW0A 2J7HA 4FNTA 2WMIA 2XN1A 1ZJBA 1WKYA 2D24A 2VZTA 5CZKA 4B16A 2UY3A 3ZR6A 1HKKA 4XV0A 4IPLA 3AHTA 3N11A 3ZR5A 3U5YA 3GXMA 4GQRA 1E5NA 1UASA 3AIRA 1JZ3A 1BGGA 3BAWA 2WAGA 3D4YA 3EDEA 2XTKA 3PN8A 4H8HA 1PX3A 2EPOA 3S2CA 2WXDM 1WDRA 2UY4A 1CGTA 2YFOA 4R5EA 2WCAA 2OWXA 2PB1A 4NXSA 4AW7A 3WQ8A 3WMBA 1V3LA 1G94A 3PTKA 1NM9A 4PSPA 1QX1A 4UTFA 3AMDA 4DWSD 1JL8A 1UA3A 1V3KA 1W9UA 4GQQA 3OGSA 2IXVA 4BF7A 4DWSA 5A2CA 4DM2A 3BUIA 3VDBA 5LYRA 4JAWA 2PWFA 4CN4A 1E70M 5BRPA 5FL0A 3KEHA 5KEZA 4CCEA 5A94A 4OOUA 1HX0A 3BVTA 1R87A 2CBIA 3ZT6A 3JUGA 1HXKA 1YHTA 1ZU8A 3VINA 3BVUA 2WVUA 1X1NA 1H0IA 2J74A 3VD7A 4QLJA 4ACZB 1JZ5A 3S6TA 2IGTA 3T2PA 1CEOA 1K9FA 3BAIA 1W9VA 3WEOA 1MQPA 4UQ9A 3ZT7A 4S3JA 1CWYA 4ATDA 1KGWA 1E71M 3SURA 3MUZ1 4P7RA 1B0IA 1V0LA 1W2PA 3BAKA 3PZ9A 1FP9A 4AZ6A 2VRKA 7TAAA 3KZSA 4AEEA 4BS0A 1MFUA 1GQKA 3CZJA 3SCTA 3W37A 3THDA 1DWJM 3DECA 3GXTA 1NWRA 4AMXA 3EDJA 1HKJA 2G8ZA 3FAWA 4JKMA 4QDMA 2EPNA 2J7DA 2JFEX 1QI0A 1EOMA 1JXJA 1TVNA 2X05A 2NSXA 4AD2A 1MWOA 4AIEA 4PCSA 5E0CA 1WZLA 1E6NA 4AD4A 3K1DA 2DSUA 2VX5A 3FY1A 3PHAA 4P7QA 1BVNP 2CCRA 4B3KA 1J12A 2A3BA 1OGSA 3VO0A 2VZSA 2WYSA 4D6FA 4M81A 3BC9A 1JNDA 4GI9A 3NSMA 2OSXA 3WL0A 2Z1KA 3GBEA 1K6AA 5A69A 3CZ8A 1LLOA 4DO4A 1J0IA 3O9NA 1BYBA 4DM1A 1E6QM 3MU7A 1ZL1A 1LQ0A 3VTRA 3WSUA 1DTUA 1ISZA 4FNUA 5ABFA 4TVUA 3WUFA 5A6JA 4C7DA 1JD9A 4HMDA 1CGXA 4AXNA 2CKSA 1X6LA 4UZUA 1G5AA 1CENA 3CMGA 1E4NA 3BH4A 1UR8A 1G0CA 3WY4A 3AFBA 4PEEA 3TTOA 3SCWA 2WHJA 3AROA 3PZOA 1C3FA 3T0DA 5A8OA 4U3CA 4WIWA 1E1FA 2FGLA 1CPUA 3WF2A 1BYCA 4CVWA 1UWTA 1R86A 4PCTA 5BXTA 1TE1A 1R34A 2X2YA 1U33A 2J78A 3SUUA 3HU7A 3HJEA 2YBTA 5HDRA 3GTNA 5TD4A 7CGTA 3GH5A 4WSJA 5FL1A 1A3HA 3PZIA 4E2OA 1GOQA 2ZICA 3LRMA 5CSUA 4R27A 5CPSA 2AMGA 1E4LA 1QHZA 1OIFA 2O9RA 1HVXA 3POHA 4MJ4A 5BXSA 1E5JA 4M80A 4CVUA 1BSIA 2CESA 1CLXA 2V38A 1KTCA 2Y24A 1O7AA 3MMDA 5A8QA 3K4AA 3EMCA 3CUFA 5IFTA 4PTXA 4PTVA 1XH1A 4RE4A 3CGTA 4MAVA 4FF5A 1RP8A 3MUY1 4P8XA 3AXXA 1XSIA 4K68A 4NRRA 4CU7A 2Y8VA 2GSJA 1PBGA 4GZJA 4AIOA 2J7FA 3WY2A 4ML4A 3W6MA 1JFHA 3NUKA 1US2A 1HJVA 3W0KA 2W67A 4YHEA 1JZ8A 2VRQA 3A4XA 4JCMA 1BHGA 3H54A 1XV8A 4M56A 2VCCA 5HXMA 1TUXA 5HBFA 5D9NA 1TQWA 2XJ7A 3OLIA 4DUXA 1OGBA 4OKDA 2J7GA 2J25A 1XYFA 4JFTA 4AZCB 1SR0A 1V0KA 1ZB5A 1ODZA 2YOCA 1WDPA 4MB3A 1BLIA 5CPTA 2WW5A 2FHBA 2G41A 3B8SA 2E0PA 2QV4A 3L4ZA 4D1JA 1VRXA 2YL8A 3E1F1 4EE9A 3SUWA 5BWFA 1FHLA 2VMFA 1ITXA 1DWIM 3WH7A 1JZ2A 3CZKA 3ZJ8A 2BV9A 1B9ZA 3AI0A 4GI8A 3EDKA 2CERA 2J62A 2ZUMA 4V28A 1XD1A 4W7VA 1UR0A 4CD8A 1W3KA 4JIEA 1W91A 2GDVA 4W84A 3UETA 5AC5A 3NYDA 2EBNA 2VOTA 1XCXA 4OBRA 1E0XA 2CBUA 1W1VA 2CIPA 2W92A 3GNPA 3OA5A 2VVNA 1CGYA 1CBGA 1J0ZA 4M24A 4J3SA 2VZVA 1LL7A 2X2JA 4ZE4A 3BUQA 1VFFA 1GCYA 1HTYA 2WNWA 3RO8A 3VDAA 4U2YA 2DEPA 5EFDA 3AZSA 1WE5A 1FA2A 4L4OA 3W81A 3WY3A 2VX7A 1M53A 4WLCA 3GM8A 4WJXA 1MXGA 2WBKA 3VSVA 3VIFA 3O6AA 3AHVA 3DX3A 1UWIA 3WELA 1G9HA 5I0DA 3IANA 4J27A 5LA1A 5IXEA 8A3HA 1JYWA 4W7WA 2DH2A 4WKFA 4AZHA 1FH7A 1ZJAA 4TXEA 4UFLA 1GNXA 3WDHA 1WZMA 1QOXA 3MV11 1HT6A 3EJSA 2RGMA 2QMJA 1EQPA 2GVYA 2JEQA 3A22A 3DC0A 3ZJKA 1JAKA 3ARWA 5D9MA 2O9PA 1C8XA 4TUFA 1W3JA 1QI4A 2BNJA 4P8UA 5AC4A 3LRKA 1PEZA 1JZ4A 4LPCA 1JFXA 2BFGA 4PTMA 1W1TA 1OCQA 3NDYA 3OIHA 5BXPA 4H41A 4PMUA 3WIJA 1E40A 1XSJA 3AMCA 1CYGA 1ECEA 2J8GA 4UFKA 1E56A 1KTBA 3M07A 3GNRA 4HZ8A 4FNQA 1JDAA 4QLLA 2EEXA 1E15A 3AIWA 3B9DA 2FH6A 3RJYA 3N17A 3TA9A 2A3EA 2IXUA 1Q6CA 3WQVA 2GFTA 4FK9A 3LXAA 4PSRA 4P8VA 3VIHA 3ARTA 3A3HA 1R33A 3AYRA 3NSNA 3WQ4A 2XVKA 4AYSA 2ZX7A 3LXCA 3BVVA 1UZ1A 2WZIA 1W9BM 4RE3A 2XIIA 1ZBCA 1JZ7A 2ZX9A 3WFZA 1AQHA 3UR7A 2ZWYA 3VVGA 4A3HA 1U2YA 5A2AA 3WF1A 3CIVA 2WMJA 4CN6A 2G3IA 5JBFA 5FIPA 1RPKA 3D3AA 3UG3A 2ZUSA 1QNQA 5HNNA 1QNSA 2DIEA 3W82A 3J7HA 3WDIA 1CTNA 1QWNA 1WDSA 1AMYA 3RM8A 4CU8A 5IFPA 1H0GA 2CKRA 3CTTA 4X9YA 4PTWA 2YDRA 2V3FA 4HA3A 1J11A 4MNJA 4NZCA 2YKKA 1NP0A 4E4PA 4LGXA 3DHUA 3EBVA 1IZKA 1CZ1A 4DWSB 3BUDA 3PZNA 2ZWZA 4AYGA 2XVGA 2GJXA 3G6LA 2XM1A 1R7AA 2V3GA 4UFJA 3WKZA 2NT0A 3II1A 2VR4A 3T09A 2CYGA 4FLRA 1HXJA 5DT5A 3AIVA 3WL1A 4DUWA 3ZOAA 3GYCA 4V27A 1HN1A 2GJXB 2EO7A 2D23A 2WB5A 4MDOA 2PBGA 1T0OA 2ALWA 2XVPA 2VZOA 3PBGA 5E6ZA 3BXWA 1ISXA 2VNCA 4GO9A 4OBSA 1PX8A 2VVSA 3VNZA 2F7PA 1UWUA 3WNMA 2V3EA 3MMWA 5DEZA 5D4YA 3WD2A 4ZENA 3HG3A 1HJSA 4C7FA 2DGAA 2FHCA 1FFRA 3DDGA 1DWFM 2XN2A 4KWUA 1NOUA 1UWQA 5E6YA 3WNKA 2YJQA 4BZYA 2J7CA 3U7VA 5A6LA 2EJ1A 4UQCA 2FDMA 4KMQA 3A21A 3T2OA 4MNKA 2X0YA 2VTFA 2WMHA 2BHZA 3KLLA 2W63A 1W1YA 3BCDA 3SEPA 1HWWA 2BXZA 1VF8A 1GOWA 2VCBA 1AQMA 5KZ6A 4AMWA 4D6IA 1ZBVA 2DPEA 4IUGA 3WQWA 3WH5A 3QOKA 1UA7A 2JIEA 3RM9A 4XB3A 4OOZA 4DO6A 1QNPA 3ZJ7A 1V0NA 2OW6A 3GBDA 3GXFA 2VQTA 2XPKA 1QNRA 3WMSA 3CV5A 4GPNA 2QMKA 5E1QA 5F7UA 3ARUA 1JD7A 1B90A 4DUVA 1R8LA 4AD5A 1E73M 3VIPA 5A2BA 3U7BA 2BY3A 1Q6DA 2X1IA 1UD5A 2Y2WA 4S3KA 1B3ZA 4ACZA 4GO8A 1KGUA 2ZX5A 3UEQA 2VX4A 3AICA 3VGBA 4PMOA 1IT0A 1UD3A 2ESCA 3LPOA 2XVLA 2G3NA 1UKOA 3VD9A 1EXPA 1JYVA 1MXDA 5JBDA 1E3XA 1R7OA 1W3LA 3D52A 3CUIA 4WK9A 2J7BA 3ZMRA 2PWHA 5FOOA 1D7FA 2YDSA 1WO2A 1MW1A 1W2VA 2G4FA 3RJXA 4AY1A 5DT7A 1V3HA 3BUBA 2F8QA 1PAMA 1J18A 1V03A 4L4PA 3BLPX 2WMIB 4PRWA 4OIFA 1FFQA 1QW9A 3DYOA 3HG2A 4W87A 5E0FA 1GUVA 4AD1A 1VB9A 3AS2A 3D50A 3D4ZA 3EJRA 3ARQA 2DDXA 3GZAA 5E09A 4KH2A 4PMYA 5IHSA 4HZ7A 4QLKA 3PZQA 2EXOA 1FH8A 1JI2A 2XUCA 3MS8A 3F5KA 2BHUA 1XC6A 6CGTA 4ZFMA 1C91A 2WMGA 4JKKA 1I1WA 3PTQA 2YA2A 1UQYA 3DX2A 2DT1A 4UQBA 2OYMA 2WZEA 9CGTA 1VFUA 2DSWA 3VX0A 3VDCA 1NP2A 3APGA 2ZIDA 3BAXA 4QFUA 2D0GA 4AEFA 3RDKA 2F7RA 4Z2JA 1R85A 2JIWA 4BQ5A 2F2HA 1XGZA 1GORA 3SCRA 1MW3A 3H53A 3IJ9A 2QHAA 1HL8A 4UNIA 3HN3A 3DDFA 4W5ZA 1X6NA 1WDQA 4U3AA 3RILA 1K9DA 5EBAA 1HP5A 5HPCA 2AOSA 3LX9A 2XWEA 1FP8A 4A3YA 1J01A 4RL3A 1M03A 4AD3A 4B3LA 1UYQA 2OSYA 3VPLA 1NWSA 4U5KA 1JZ6A 3QHOA 2D3NA 4UOZA 1E9LA 1JYXA 4H2CA 4RE2A 3ARSA 1D2KA 5BYWA 1XH2A 5CXPA 3AS0A 5D8WA 1HF6A 2ZUWA 1H11A 4QAWA 4MPKA 4KRUA 3HZ3A 2J4GA 5E9AA 1TFVA 1C8QA 5C71A 1UKTA 5JIPA 3VKKA 1Z32X 2J47A 4KRTA 3SUVA 3NDZA 1JAEA 3SCSA 3VGFA 2ZE0A 1QBAA 3CZGA 2GUYA 2J79A 4J3WA 1UWSA 4CN1A 2BY1A 3W6LA 1GONA 1BGAA 1KCKA 2OW7A 3WH6A 1LG2A 4W86A 4B9YA 3LMYA 3WDRA 4PUDA 2WCGA 5JUVA 2W61A 3SCUA 4D71A 3WUEA 1JDCA 3LRLA 5CG0A 1UD8A 4PYSA 2OYKA 4TX8A 3G6MA 4NZFA 4MADA 3S5ZA 4HPGA 1SMDA 1KXVA 4NRSA 3ZIZA 4LYRA 3AQUA 3TTYA 2CEQA 1E4MM 4HOXA 2EPLX 1KBBA 2BY2A 1UUQA 2VRJA 3L2LA 4HMEA 1C92A 3TONA 1QHOA 2F1BA 4BQ4A 1GJUA 5JBEA 1TMQA 2O92A 3ARRA 1KBKA 1KB3A 1LWJA 1W9XA 3CMJA 3WF0A 1OGGA 2DSZA 1C90A 1B31A 3ARZA 3VX1A 2WVVA 1R46A 1PIFA 1BVZA 2YL6A 2WKLA 3CUGA 1H1NA 3VMOA 4W89A 4ZE5A 2EPMX 1J0HA 2XFFA 3B9AA 4Z2HA 1JI1A 1V6XA 2VQUA 4W7UA 5A8MA 4DWSC 1BYAA 3EMZA 1U30A 3WBEA 3BSHA 1K9EA 3H55A 2E3ZA 3AS1A 3WD0A 3S5YA 1VENA 4EAMA 3ZO9A 4FLOA 5LA0A 4WKHA 4GINA 1KFWA 2WZHA 5A8PA 1L0PA 3ALFA 4ATLA 1KXTA 2W5FA 2X2HA 2YLAA 2ZXAA 4Y7EA 2FHFA 4J3TA 3BGAA 2HISA 3TTSA 3VILA 1SMAA 4PMXA 3SCQA 4EKJA 1OIMA 1EHAA 2XIBA 2J75A 4MB5A 2PWEA 5GNXA 1US3A 3UCQA 4Q22A 1PS3A 3IAPA 2WVTA 3VGDA 3N12A 3KE0A 1UG6A 3EDFA 1FHDA 1K9TA 1HIZA 2UY2A 3DHPA 3UG5A 1E6RA 1CNVA 5BROA 2C8NA 2EQDA 1ZBKA 1CXLA 3TOPA 3W28A 2JF6A 3QGVA 4OZOA 3D51A 3AYSA 1FOBA 4H04A 4NX0A 2OYLA 4YHGA 3VM7A 1H41A 5ECUA 4PN2A 2NT1A 3ARPA 1CGUA 1E6SM 5I2UA 3BUPA 5D8ZA 3SCVA 2CITA 4F66A 2DSVA 4NI3A 4P7NA 1EH9A 3CUJA 3RPMA 3IGUA 2OWWA 4D6JA 1M04A 3AXIA 4IISA 1PPIA 4TTGA 4DO5A 1V08A 4GZEA 2F7OA 1QI3A 2QLYA 2XG9A 3I3BA 2G3MA 8CGTA 2XSBA 3CUHA 4TVCA 5M5DA 1EOKA 4TTUA 1UH2A 3QOMA 2BS9A 3FXYA 1E72M 4W93A 2D22A 4TOQA 4X0VA 7A3HA 2Y4SA 3A23A 2UWFA 5DF0A 1RH9A 2VC9A 2D2OA 1CECA 1UR4A 4UQEA 1J10A 3WDQA 4FNPA 3LPPA 4J3XA 1GHSA 4UCFA 4P7OA 3CHDA 1R47A 3AHXA 1GOIA 3W53A 4QCFA 2FH8A 1OD8A 2XGIA 4CD6A 1XCWA 3LXBA 3IAQA 3NJ3A 1PX4A 3EJQA 3KL3A 1VAHA 1VFMA 1V3IA 1PJ9A 3N04A 4H7VA 2JF7A 3AXHA 4HA4A 1LL4A 2WPGA 5HPOA 1UR1A 1H4PA 2V3DA 3SUTA 2E9BA 3WDJA 1EDGA 1PZ2A 1GVIA 3PZGA 2E9MA 3VDHA 3WUGA 4LYQA 1UD2A 3PZTA 1PZ3A 2PC8A 1BTCA 3FHAA 3CH9A 1UWRA 3N18A 5IHRA 1UKQA 3CO4A 3MKKA 3N13A 3W25A 2O9TA 5I3DA 3WQ5A 2J77A 2BVDA 4F9JA 1VJSA 1IV8A 4QP0A 1UD4A 1DP0A 1OINA 3L4TA 2YDQA 3VUPA 1BG4A 3UESA 1ISWA 3GH4A 4GIAA 3CZNA 1SYTA 2FGZA 3GXNA 4UFIA 2XFYA 4M8UA 1HKIA 4GKLA 3AMKA 4PUEA 4HOWA 1HNYA 1FH9A 4P8WA 3CBWA 1QBBA 5GNZA 5BRQA 3DX1A 3FAXA 3W4RA 3L4VA 2DT0A 3FNDA 1B3VA 2D3LA 2X2IA 3A5VA 1V02A 3WNLA 5A3HA 3VOCA 4CKQA 2Y8KA 1I75A 1EHNA 3AIUA 1DWHM 1JG9A 3VM5A 3UR8A 2DQXA 1AVAA 4QCEA 3GXIA 4AZ5A 3W38A 4D72A 3DYPA 5AYIA 5ABHA 1EDQA 2XHYA 3WY1A 1NARA 2WSKA 1OM0A 5A6SA 4AD0A 4EANA 1UZ4A 3WD4A 1KCLA 1HP4A 4UOJA 3IJ8A 1CXKA 4AZIA 2ZUNA 1C7TA 4PMZA 3VSUA 4GI6A 1CXIA 3KL5A 1UR9A 4Q7NA 2X09A 2PWGA 1BG9A 3L4UA 2WLYA 3KLKA 1EDTA 1GQIA 3AS3A 1MW0A 1J0JA 1WCGA 5IDIA 3T2QA 1UKSA 1GZJA 1BYDA 1BF2A 4BQ3A 4GXPA 5DFAA 3I3EA 4V2XA 5CLWA 3A4AA 2YBUA 4CD5A 3CC1A 4UOQA 2VZUA 4XZBA 3T0BA 5I6SA 3N9KA 4UR9A 3WNPA 4PBGA 3VIIA 1JYNA 1DWGM 4UQDA 4WSKA 4CGTA 4PMQA 1NOWA 1TA3A 4WKAA 4HU0A 3VIOA 2PF0A 2XN0A 2GJRA 3OGRA 5BCAA 3MUAA 2YLLA 3WF4A 3WH9A 3KL0A 3FN9A 4MTVA 2BY0A 1Q6FA 1YQ2A 4F8XA 2OSWA 4Z2IA 2WMKA 3ZSSA 3EJPA 4W8AA 3UG4A 5I78A 3SCPA 3ZM8A 2ZXBA 2O9OA 5C8BB 1B2YA 2WCSA 1OBAA 1TQSA 3NSXA 2GDUA 2EADA 3WFLA 1VBRA 5GPRA 4M82A 4MNLA 1XH0A 3SIMA 1UOKA 4XX6A 2WVVB 1QNOA 2UY5A 3GXDA 4P7LA 1KQZA 4CU6A 1UQZA 4UFHA 4U5IA 4AC1X 5DMYA 3PZVA 4MB1A 3RMEA 1OSEA 1UH4A 3K8LA 1CXFA 1HKMA 1XRVA 2WC7A 3MANA 1E3ZA 1O6IA 1HJUA 1W32A 3U5UA 5CGTA 1KGXA 1QPKA 1TA3B 2WC3A 3VIJA 4GZIA 5FD0A 1WAWA 3WBAA 4AZGA 3BVXA 1ZS2A 3OZPA 3MMUA 1EQCA 4U31A 3AZRA 3K4DA 1QW8A 4Z2LA 1XD0A 3IK2A 2WHMA 3FHQA 4WF7A 2QPUA 3THCA 3EDDA 1EIBA 2CBVA 4IM4A 1E6ZA 4OUEA 3MSDA 3RIKA 1Y7VA 1V6WA 1B3YA 1UH3A 1AQ0A 4D6EA 4HMCA 2X8RA 1B3XA 2ZUUA 1LWHA 2D73A 3VGGA 4ATWA 1J0YA 1VEOA 1LJYA 2VO5A 3L4YA 1GQJA 6A3HA 1KXQA 5LA2A 1E0WA 3U57A 1ZBWA 1UKPA 4N42A 2JE8A 3EMQA 1Q6GA 2OWCA 1MFVA 3M7SA 3EJUA 1W9PA 1F4HA 4LXFA 1V6YA 2PI6A 3VIKA 2D1ZA 2GK1B 2WC4A 4W88A 5A6MA 1CXEA 3W26A 1CIUA 2EPKX 1DHKA 2QF8A 3MO4A 3AHYA 3L4WA 3VGEA 4MNMA 4JL2A 2EACA 3AHZA 2E4TA 3DX0A 3K8KA 1DEDA 2B31A 3O2LA 2V5DA 4JFWA 1TR1A 3EYPA 2A3HA 3ZSTA 4HA1A 4ZXOA 2CHOA 1E43A 3LPFA 5M3WA 1BFNA 1E1EA 3T0AA 4CCCA 3PZMA 2DH3A 5CPQA 4HU8A 2BVTA 4FNRA 1NWTA 2DSKA 3K8MA 3ARYA 3QHMA 3A24A 4FLSA 1B3WA 1J0KA 2JALA 4PMNA 2WWCA 1LG1A 3CZSA 3CZLA 1Q4NX 1V3MA 2WVSA 2CNCA 2W4XA 1VEMA 4FLQA 3W27A 1OWQA 4NSBA 4M29A 2D20A 2X0HA 1HJWA 3MV01 3BAYA 2J8FA 1LL6A 3BSGA 3ZQ9A 2WSPA 2WKGA 4LYPA 5A6BA 2CBJA 1RD6A 3OZOA 2VURA 1GOMA 4W85A 5GNYA 2XM2A 3MI6A 3ALGA 3K46A 2FYVA 3L2MA 3A47A 4D6DA 1XSKA 4JFUA
chains in the Genus database with same CATH superfamily
1Q72L 4LANA 4E5TA 3L5AA 1FH5L 2WAQA 2BFVL 1AGEA 1TJXA 3GMMA 4OI9A 2IQTA 3DC8A 3FYPA 3QW9A 4BCEA 1A5LC 5D37A 3MGAA 5F7FA 1DXEA 2E9LA 5CJQL 2P5EE 3L3OA 3KPOA 4DGVH 1ITCA 1GYLA 4GRLD 4JHOA 4UBDD 5A6IA 3JVAA 4BKNA 3S35H 5GS2D 3QSKB 2WYHA 1PDKA 2V7HA 4R0LB 4WI7A 2OOGA 2R0KH 3KZPA 2J7EA 2X1WL 3OMAB 2V6AA 4M5ZL 1FORH 2AQWA 4OT1L 2ZCKH 5T33H 4FKKA 4LLYB 1M71B 4OZFB 3RGVC 3WHXA 5D9SA 5HD8D 2D8KA 4F8NA 3RY6C 4F91B 3R10A 1IT8A 2VDNL 3MRRA 3ARBC 5FEZA 3HFMH 2CD0A 2W6RA 4ZOAA 1GKOA 1RUQL 4IPNB 3LTSA 4HVBA 1U83A 1RZQA 3LGDA 1EO5A 3WXVL 1JNEA 3BZGA 4ZZKA 4A2GA 5EU5B 3H7BB 3FFCA 2O4QA 1S1PA 4MY8A 3F5LA 1AGBB 1T21B 3ZUCA 2P5WD 4I48B 4F5CE 3OHIA 2FPTA 4PJ6A 1GMIA 1KIRB 1D5IH 3S37H 4QIUA 5KN5B 3TJ4A 4KROB 3OV6A 4GQ9H 2VJXA 4PBXA 3UYCA 5HYEA 3NJKA 3PUEA 4M8VA 4JM4H 2R23A 3GDBA 2VCAA 4Q7IA 5AOZA 2AZUA 1NWUA 1PHWA 5DRZA 4Q8PA 1U8KA 2D0HA 4FTDA 4JZ5A 1BFSA 1ZPUA 25C8L 3CIXA 3WO3B 4LAQL 1FNEA 2Y1VA 1H2JA 3K7UA 2WXIA 2GQ9A 2CXGA 3GG7A 4QHKJ 4WFHD 1NFIA 4N8UA 1JF6A 2ITFA 4LUTA 2WYTA 2CA3A 1GA2A 1JRBA 3RNKB 3Q7JA 4HNLA 1AE6L 5K9KB 4L7ZA 3W0WD 1NOAA 5EFFA 3TYGH 2G3JA 3R06B 1Z7JA 3G6JF 4IKKA 2HG5A 3XISA 3LKSB 4JCLA 3ARDB 3WU1A 2WBGA 4Q2ZB 3WMCA 4D6CA 3ZTJG 5E08L 4AYFA 4X98A 5DT1H 3IIVA 4G56A 4L4JA 3DO7B 1BZ9A 1MJJA 2IPKA 4NIKB 5C9ZA 5F7EH 1RHCA 1BXVA 2WM1A 1YRKA 4MIMA 5CQ1A 1L9NA 1I9JH 1MDRA 2C34A 2XFRA 5C8JA 1A7PL 3RUGA 1C8YA 4IMAA 4JD4A 3QUMH 3C0LA 4TTUA 2EABA 3QEHB 4C6MA 1JF5A 3SPJA 3LHWA 2XQYA 2FLBT 3EO1B 5ISZA 4ANKA 1TJHL 2NQJA 4OJDH 2NQZA 4MA8H 1FPTH 3TPKA 5CGMA 1BQSA 1WAAF 5CJ8A 3A64A 4O18A 1YN7A 5DJ0A 4PGDA 4ZQPA 3TA3A 1N64L 4YDLB 3SPVB 4AYBA 1W3HA 1FV1B 2DJ4A 1BIIB 3GKZA 4L2LA 4FTVD 1YPZA 1PZ1A 4H40A 2JGYA 4NASA 5KSVA 4ZXBD 1KJ2A 1OE3A 3KPQB 3UYPB 1Q9KA 4EX4A 3GAKA 4A6YL 4O2EA 3MVIA 2G75B 4AVHA 2MCPL 4XE0A 1ZPLA 3LD8B 3ZK0A 2GJPA 1OWWA 4EVNA 1AH0A 1GVFA 4K7YA 1W6WA 4MYPA 2ZBTA 2XTJE 1Y1DA 3FB8A 2TAAA 3R18A 4NFBA 5EMLA 3WD3A 4Y1AB 3QJQB 5E2VL 2QGDA 2VABA 3GSOB 1FE8L 5EC1B 1E51A 4PFHA 4HOZA 3F8UB 1ZOXA 3LI0A 2Z7KA 3RYMA 3GH7A 1E5ZA 2ZKYA 2C9RA 3RR1A 5T26A 1DVSA 1XYZA 3P3TA 4KCUA 3Q45A 4R97C 2YXFA 4AG4L 2F38A 2X5PA 4N8VG 4NZTH 3I02A 3LPWA 4HJUA 4ZFOB 4KK9D 1GVYA 3NK4A 3LN3A 4KKAD 4MJ6A 1BQCA 2DJLA 1Z48A 4K7PL 3W7KA 2OMAA 5JH2A 2R4SL 1RBAA 4PV9A 4GE8A 1S5IH 4AQEB 2AJZB 2UVEA 5KSBE 1JNHA 4PTDA 5FK9A 3GO2A 1I9CB 2HTMA 4GJJA 5HQMA 2YD6A 4HLZH 8TIMA 3S1GA 2MWCA 3SQOH 2OQYA 5GJSL 1T7YA 4N2NA 4JHZA 4KY1L 1D5XA 1I7RA 3FA4A 1LLAA 2ZX6A 4G11A 3L4XA 3N3EA 3TROA 2WINA 5D2VA 1NDMB 2GAZA 1BGXH 4EIBA 3TESA 4I5RA 5I1AA 2KZKA 1IEWA 1TEGA 5TK2A 4QO1B 4NAEA 3CVIH 1EWDA 3DSFH 5GQBA 4WV1A 1V8EA 2I16A 4LPTA 2IMMA 1WUNT 3WKYA 1DUZB 3TV8A 3WDPP 1LDCA 4NWUL 1JWUB 4OCLC 5KSAC 4LNCA 1HYRC 2QLVB 1PJWA 3FO9B 4EZJA 1XX1A 3WJJA 1X4YA 1QK2A 3ZJ6A 2X4RB 1IZCA 3M5YA 1Q8MA 1ROCA 1ZHBA 3UH8A 4J6RL 2YPVA 2AQ3A 2OKTA 3CEPA 1L5GB 3BKYH 1N26A 3OPZL 5TIMA 1GOOA 3CV2A 2MJWA 1A1NA 4PRTA 4X9SA 1RVFH 1H19A 4PJAB 1KBJA 2CIIB 2OTPA 4RXFA 5TE7H 4YLQT 1MNSA 3ULUL 4GBDA 3P3BA 3EWXA 3EX3A 2VD9A 1HKVA 5AW4B 3RHWF 2BIMA 2Z31B 5AYBA 1EEZB 3N44F 4OLWH 1E55A 3ITLA 4P9HC 1PKQA 2L7QA 1AR1B 4ZQMA 4MD5B 3DRQA 3I6GB 5JZ7C 2Z1SA 4ADJA 3P69A 3KDMB 1NH6A 4ELME 4Y9PA 2QTEA 2ORBH 4TIMA 1UXWA 1LM8V 1VIWA 2W1NA 5D7IA 3RL1B 5HK4A 4H8VA 1G5GA 1Q9LB 4N20A 5DS8B 3SE6A 4FX7A 5IQLA 4GG6B 4JO3L 3G24A 1UCBH 3W7DA 2VR5A 3V52L 5EC1A 4HDIA 5EO1A 5I28A 1AY1H 3KDNA 2NUPA 4QDPA 4A4AA 1KTLA 4RVBA 4ZTPL 3RFZC 3LJ3A 1CD8A 1KGCD 5B3NA 5LCVH 4NNAA 2ZXQA 5ABFB 2OGYA 4J28A 2F19H 3MBXH 3QVAA 3MO1B 4R88A 2DM4A 3MCLH 4P48A 4D6HA 4WJKB 5CSYA 2R2HA 4JO8A 4KC3B 2XGZA 2VXQA 3F2CA 4MXQC 2MCAA 5I1IH 1R3IL 2ZXDA 1IBHA 3N1AA 2CCLA 4MAUL 5D7JD 1EC9A 3A4FA 3BAJA 1UXWB 4NJHA 3L5XL 4KO6A 4ACYA 4L9LB 2GK1A 3QR2A 1BV8A 4ALAC 3ETSA 1VFHA 3RLUA 3U2ZA 2EC9U 3WEZA 3CK0L 4G7VL 1WPCA 1XYLA 2DT2A 3BMWA 4DP0X 3Q3GB 1X4ZA 3GIVA 4KTEH 1FKXA 1AKJB 1DANU 2CUAA 3MT1A 2XG5A 3U2SA 4OGYH 5D1XC 3VD1A 3SY6A 1KFLA 1JR1A 2DT3A 1HXMB 4J1OA 4DWSC 1EJUC 1M05B 2EKSB 3D0VA 2BFVH 2QPSA 4PMVA 2IAMD 3U7YL 3OXSB 5CKAA 1T21A 4DH2A 3H2FA 4MB4A 4YSRA 3PB2A 1BAGA 4WY0A 4E0RA 3X3GH 5GIRB 3QIUA 1QRQA 3U0PA 4Z2GA 1P4IL 4MWFB 4JN1L 3MREB 1C9WA 5DJYB 5ABGA 4BXSV 1DKWA 1YTDA 1QI5A 3AXMA 1RP9A 3TKFA 2VI0A 2ZC1A 2O5YL 3T4YA 3VXUE 2Q7YA 4E9VA 3RAJH 2E1DA 4OT1H 2ZCKL 5T33L 4BYHA 1EO7A 4XBJA 2FBJH 1PWLA 4FZ8L 3QZWA 1EMTH 1FFNA 2ZKMX 2DP3A 4KOCA 4OH2A 4YVUA 1WZKA 4GRLB 3O8XA 2NV2A 4US5A 4C4KO 4CD7A 3FVDA 1LUCA 1PNDA 4JPIA 1KYAA 4Q6IC 1TO5A 5ID1A 4OV6F 4PBWD 3E9TA 1BEUA 4HCRH 3CLEH 4K7PX 3V5DB 4IOTA 3B2MA 5H4YA 4BUHA 2FAUA 3APCA 2JGQA 3MR9B 1IM3A 4B6ZA 2WMFA 3P73A 4A3QA 2B1HL 3DGRA 1W16A 4GQ9L 4L05A 4E5XB 2ZYHA 2C0HA 1KPVA 5IB5B 2PDFA 2R1YB 2XWCA 3I10A 5EORL 2W65A 2E9JA 1CDCA 3QARA 4MLRA 2C9QA 5JR1L 4R96B 2IDFA 1TPVA 2IWEA 1ZY9A 2B08A 2TMDA 4BFRA 3GRBA 4M43H 3IWPA 5SWSD 1MG3C 4TX6A 3PHQA 2Z65C 5JW4M 1YEIL 2M26A 2DZXA 2HUHA 3QFJB 1SZNA 2O1AA 2WBJD 3QJSB 3DX5A 2LU5A 1EXGA 6TAAA 5I17A 4GJ1A 4NP9A 2AXJA 3IACA 3INPA 1MYRA 4RXGA 4LH8A 1Z9MA 3U5UA 3TZVB 2GIXA 4F79A 2IGFH 3BSZA 3RWEB 1KRBC 1KZYA 2A6JA 4WY0F 3I6KB 4NERA 1IEXA 4N1EA 4OZHA 5GGQL 4H20H 1OAJA 1KXHA 1ND0A 3UAAA 2PMZA 1EXHA 1OFAA 2IALB 4F1ZA 1ITUA 5C0JB 4N0RA 1I8LA 4KQ4H 2EYTA 3RPIA 1FCGA 1LO3H 3H22A 3CHVA 3TYUA 3BWAB 5ALBL 3E2RA 3FRPA 1CLVA 1FZOB 3FU5A 4KY2A 4R7NA 3SRFA 4NENB 2EIDA 5F7LB 3PAOA 3GGWB 4CBZA 1OK6A 4YN5A 1TKWA 4CNTA 3QUML 4AJ0A 1A9BB 1MHEA 5IGXH 4DCQA 4BFJA 1ETB1 4JFEA 1GOKA 1E8XA 4AYMC 4Q9RL 3VMNA 3KYKH 2VWEC 1R75A 3TYFA 3KBFA 2XGBA 3SAZA 3I2CL 3T0XA 2Z2UA 2BNRB 1FPTL 4MA8L 3O2WH 4RGNE 5AYUH 3VD5A 2H26A 4RJEA 1ED3A 5DJZA 1DBJH 1QHPA 3KOZA 4IG2A 5BZAA 3KPTA 1BWWA 4X83A 3OBKA 2DI9A 2J1WA 1TZGH 3GKWH 4OLVL 4AJWA 3ECBB 1RFDL 4FFWC 2OEMA 4H1LB 1FZJB 1M65A 2A6DB 1HJBC 3UIZA 2NXGA 5GJMA 1P69B 4TNVF 5D2NA 2NUTA 4HS3A 3PY9A 5DJ8B 1QUMA 2C79A 4RW5A 4PJGB 3O8XB 2J57A 5F71A 1CICA 2E8ZA 4NAFB 1JQXA 4OZFG 4KK6D 3EYFA 4H19A 2DPKA 3WF3A 1UD6A 1OANA 3NIFE 2YAHA 4AXWA 2AJ3A 4JQ2A 3N91A 2W0KA 4JY9A 2XH7A 2R4RL 4OGXL 3T08A 3GYEA 3W29A 1VEPA 1S7WA 2C9VA 3KPLA 6PTDA 2WB7A 1GYUA 2XXMB 4QOKD 4J3UA 4B7IA 5F7BA 1W5QA 2Y89A 3KXQA 4D0DA 3PTMA 4QAIA 1FWCC 3GIZL 4PJ5A 2MQCA 2VL4A 3OF6D 1BZDA 2I7GA 3G1AA 4YWIA 4PBEA 2HP4A 4K7PH 4LHUD 5M03A 3ETBF 3MJWA 5I3JA 3QJHA 4HU3A 3WH8A 5I2IB 4D94A 1N5YH 2AQSA 1BJ1J 1S5IL 4N0UB 4RDBA 3DYMA 3CMOH 5AYTA 3SE3A 2FCBA 3DFSA 4GA8A 3QDJA 2PP8A 4QRQB 5EY5A 4UT6A 3BFOA 5AQ0A 2CA4A 4L1WA 1P7KB 3EBIA 5I17B 1IVLA 3Q6FB 4QRUA 1FNHA 2JI3A 1OCWL 4G3YL 4N1HB 4DOHB 2CGZA 1J48A 4CUCA 2E6FA 4J7RA 4JFZL 4UOW1 1PQZA 4GUOA 3KTSA 4RGND 4XP9L 4ECNA 5D55A 3II3A 1LMIA 4M7ZC 4XX5A 3C5ZB 5EOCL 3KFTA 4N02A 3VXMD 1P0DA 2GTQA 4B5XA 4UTUA 2XIOA 3GINA 3DRQB 2F8VA 4LHJB 5D6CA 1IEAA 1WBZB 2FGWH 1HZHL 4FTVB 4L1LA 5D93C 5TH2A 1E6XM 2WMPA 2YD1A 3SPGA 3O3BB 4HPXA 3P02A 4NBXB 1RZGA 3VXUB 4S1RH 5E6IB 4XNUH 4AUYA 1ZJIA 1FCCA 1YNPA 3PSVA 2W0UA 3EOBB 3SDXF 2YN3A 4YWGH 3QZEA 5A3ID 2X70A 3C6EA 2OO6A 4L6OA 3DESA 4S23A 3FFCB 4IX0A 4EXQA 2ED8A 3O4LB 3ZHFA 1XLAA 2YO3A 4XZNX 3ZZ1A 3JV0A 4FIQA 4NPJA 1CFMA 3ZPDA 3EX6A 3T0TA 1ODAA 3IF1A 4TQ8A 1ZT4B 4FNTA 4NYLA 5TE7L 4UT6H 2OTDA 4J3OD 2WJEA 1HAUA 3RIAF 2WMIA 4NQVB 2XN1A 4ERSL 3UC0L 4PB3A 3V0GA 1WKYA 4LEBA 4OLWL 1KN4L 1I0BA 5JDSB 5H37H 4JTSA 1DUZA 4Z95L 3UXFA 3TQKA 1UOVA 1MF2H 4DJED 2VZTA 2WY3B 4JVUA 4TTDC 3VWKA 6PCYA 3QPYA 1NOLA 3L5LA 1E8YA 4UV4L 1HKKA 2WKOA 3MRGA 5DJ8A 2BK8A 1S7QA 2BS71 2LT9A 3GI8H 4P46A 1DXIA 3O0FA 3WJZA 2OOFA 4HUWA 4XAKD 3A3WA 1XF3A 3GXMA 1FVCA 1RKRA 4CMMA 1CW2A 2Z7WA 1JPFA 3CZUB 1KLZA 3PWGA 2EDEA 2ZXEB 1YE6A 2IQAB 4QRRA 3L1OH 1AY1L 4NO3A 1BGGA 3MVTA 3BAWA 5LLIC 2WAGA 1Q45A 1RK1B 3URQA 4WUUD 5LCVL 1SW3A 1I82A 1O7SA 3ZIMA 2GBUA 2EDLA 2ENSA 2CNZA 1IBGL 2EE2A 1A5CA 1IRAY 4HCDA 2EPOA 2P53A 3B0VC 3ZKSD 2VLRD 1PD6A 2UY4A 1CGTA 5J5DA 4X63A 1U3HD 4K7PY 1JPGA 5I1IL 1I8MA 2YFOA 5FM8A 1RBLA 4RNJA 4AEIH 4UUJA 3BJFA 2GAZB 2X9ZA 2XZCL 3STLB 2WCAA 2OWXA 2PB1A 2KC0A 2MQ3A 4XMUA 1TTRA 3ANYA 2OZ4H 3QQ4B 2NLYA 1DANT 3P61A 1VP5A 4AW7A 3CK0H 4G7VH 4FQ2H 3V5HA 2EYRB 4Y5YC 2BG5A 1I8JA 4PGCA 1NM9A 5IROD 1EFXB 1QFUH 2A6KA 3JVGC 2ACUA 3ES8A 4JDTH 2OMXB 3KRUA 4PJFF 2CH8A 3AMDA 1F6YA 4OV5A 3P6LA 4RE0A 1JL8A 4HIHB 1ET8A 1NCBH 4Z7UB 4NM4L 1BZ7B 5C2CA 1R3KB 3V5OA 1CB4A 4GQQA 4ZOEA 4UCGA 2IXVA 3HS0C 1DVTA 3W7QA 2DLFL 4R4FL 4DELA 3WTTA 4GYJA 3LH2L 1UTDA 4HFUL 4PUKA 3D39B 3ENEA 1KN2H 4CN4A 3QXVA 4JN1H 2GGIA 4E42B 5I3IA 1NIBA 2FWLB 3MUJA 1ES0A 5JNYA 1J5CA 1XYMA 2WQSA 3RIFF 3FK3A 4JQXA 4WO0A 4B9FA 5IW1A 1RA0A 4AEOA 5E2UH 4M61B 3VRIB 1F45A 3N73A 1TJIL 4Y4HC 1A8ZA 1AS8A 5IV2A 5SV4A 4N24A 1ZU8A 4HZ8A 3TGXA 2HJKB 2GLKA 3LYRA 5H94A 1R3VA 2CXEA 4B90A 3TO4B 2NXZB 4QLJA 4I8YA 4IRSA 3QZBA 4KJYA 4XVTL 4XAFA 1MNUL 2OLSA 1TSIA 3IPEA 2DZTA 1MQPA 1CWYA 1JOIA 4ATDA 2L7UA 2OR7A 2R8SH 5M2FX 5IREA 2XETA 3KMDA 3T42A 1L0QA 5K9CA 1UOWA 3PZ9A 1EVTC 4I1RA 3NO5A 3ZR4A 1LP9B 4HYRA 4OM0H 1JPSL 1VKFA 3UBPC 2WXGA 3B9NA 2VW7A 2NLIA 2D7PA 3V55A 1FL6A 1KTDA 4LAZA 3CZJA 3MODL 4JVWA 5DD5L 3H3KA 5E8PA 1AD9A 3W37A 1KPUA 4GIYA 2ZT9C 3GXTA 4WI6A 4BFBD 1PBYA 1MIMH 3EDJA 3M4HA 5FECB 3N3MA 4FI4A 5I3GA 1X7FA 2G8ZA 1LEKB 3QORB 3S5LB 4YVPA 3MFGB 4EF8A 1R3TA 1I8IB 4QDMA 2R23B 5EF0A 3UTTE 5E8EB 1QI0A 1HU8A 4PJAF 1JXJA 1GOXA 1E4JA 4JTUA 3FTGA 1MWOA 5D2YA 4PRPB 4A68A 2O72A 5E4IA 5IM7A 2NUTB 1E6NA 1NMAL 2DSUA 3GVWA 2HT2C 3A3YB 1UJ3B 4JFEE 5EBGA 5BJTA 2IAMB 4KEMA 2WNQA 1FDZA 3HAEA 1KELH 3HE6B 4MXVF 2QHLA 3FFCD 2BVPB 1XXDC 2V63A 4XNZC 2Q7NA 3AT9A 5C08B 2UWEB 2CDGB 4AZUA 3ZFHA 5HHPB 3DA0A 3RUBL 5EMUA 2VISB 3UGEA 5FSEC 1A6VH 2J3SA 5MKGB 2Z1KA 3IMVA 2IQ9H 2ZSVA 5AVWB 1OB1A 1XO8A 1ZE3H 2X4TA 1G7MB 5D4HA 1JUFA 2Y6SC 5DK0B 4Y2DB 4BDVB 4Z7NE 4JK0D 4LY8A 1IKOP 5T5FH 4CMHB 5EEXA 3MNVA 4PJCF 3WEBA 4V1DE 1GW6A 5CP7B 2SEBA 3BZJA 3MU7A 5FF2A 4Q56A 1ZL1A 4L61A 4HBKA 3PJXA 3VTRA 1ML1A 4F58L 3RNQB 4ALAL 3KPPA 1DTUA 3IJEB 5I1LA 1YBQB 3T7VA 1A2YB 3ELFA 4UTIA 5ISZB 4IMFA 1AS7A 4Y16B 4IHCA 4L4TE 5FLUA 2BVEA 2P43B 5L2JB 1VQTA 3O6DA 1X6LA 3QPQD 4UZUA 4AM0A 2NZ1A 1HI6A 2W27A 3EOEA 4CBPA 4M24A 1G5AA 1BD2E 3CUPB 4GRWE 4HPNA 2ALDA 5I09A 2EDBA 1FNSH 2HK1A 4HKJB 1P5BA 3NCYP 5I1HH 1L7IL 1H0DA 2QQNL 2WLNA 2X6AA 3FN3A 5JPNA 4Y2NA 1ZD6A 3L3OB 3AXKA 4RDYA 2WLLB 4P2CG 5C0ND 4Y6GA 2BSDA 4IPIA 3ERXA 2WPBA 5HI3C 3HRPA 3RB5A 2XG5B 3TT3L 1LO0L 2WHJA 1XJBA 2XWJA 5TDNB 2VO8A 4PGEB 3T0DA 4GYPA 4MM1A 4B5VA 2PCFA 2GEQA 1IT9H 3RNKA 1E2ZA 1IAOB 1EEQA 4XN7A 4BH7A 2FGLA 4I6VA 4GAYB 1F11A 2HPOA 1XQLA 3GPSA 2B7QA 3WF2A 1BYCA 2WYZA 2E6QA 3FO0H 2NY1C 1FO0A 3GSWA 1OAUL 5JIIA 1UWTA 2K4AA 1Y5XA 1QDSA 3F7YA 4DBDA 1P4LA 2W3ZA 4YHYB 5BXTA 2J9ZA 5EU7E 4NNYA 1KCRH 5ICZA 2NV1A 3FXIC 4OCXL 2PDUA 2GSGA 4E3VA 3G6AA 3QS3A 3V7PA 2APWA 5D2TA 4XPHL 4DF2A 2PDQA 3HB3D 5CC3A 2FGWL 2V0AA 4PQXA 3TLLA 3QZWB 1M2VB 3HJEA 4XN2A 1CFVH 5I6KA 2CWNA 3ABSA 1IJ9A 4LCYB 1V55B 4XNMA 3GTNA 1HIMH 3TN5A 3TC7A 3GH5A 4B4HA 4YWGL 4OZIB 1BMGA 5HJLA 1KZQA 3LRMA 3TXZA 1HFUA 2VGLM 2VXQH 4R27A 4UU9A 1R6VA 8PAZA 3V0SA 4WR3A 3HZYA 4W4OA 5DMGC 1OVDA 4ZQRA 4NKDB 4F40A 1D5BA 3GC4A 4IJBA 4MMYB 4JDVA 1XL4A 4G82A 4MJ4A 2PPFA 3BFWA 2GGHA 5BXSA 5FWQA 4PP2B 4CVUA 5K9KA 4HUUA 5F21B 1B4RA 3GVVA 3QY6A 4KETA 1O66A 3RU8H 3AALA 1FYHB 2C4XA 3MA9L 1PLGH 2YCJA 1U8IA 4M6UA 7TIMA 3JU2A 4Q7DA 1N8WA 2CHXA 4AIZA 1KJ2L 3K4AA 3BRFA 5A8QA 2O7SA 2BOLA 5HHXL 2WXLA 1JK9B 3WHE1 1XXFC 3TU6A 3W39B 4X7DC 5L9DL 1TPEA 4WW1A 4PTXA 4LCUA 4CCZA 5ISZD 2HXAA 2F54D 2H6UA 4FF5A 2DS4A 1FZMB 1ZLVH 1RP8A 3EOTL 4ILDA 4Y5XA 5E6UB 2JQZA 4P8XA 4ERAA 4QYOB 3OHXC 4OZHB 4XNYL 1IAIM 1YECL 4Q4IA 3IJQA 3AUWB 4LAMA 3TUUA 4QTIL 4Z5RB 4JTIA 3WGUB 4TVSa 1MCQA 2YZRA 4B3VA 1HE7A 5DUPH 5EO1B 4EZMA 3P82A 2WXFA 4FXKC 2W5PA 2QSCL 2J7FA 2V5KA 3UZZA 1P6AB 1IGCH 2GUOB 2E9WA 3C09B 4ML4A 2EDHA 1AXTH 1MCBA 1NUGA 4H0LC 2AK1L 3N2JA 5DGQA 3ZM8A 4NZ5A 1A4KA 1NBVL 2OZ4L 3EF4A 1HWGB 1KDJA 3NUKA 5ANMB 1H7OA 1IARB 3QCVL 3SBQA 1FWFC 2Z0IA 2PFHA 3W0KA 2W67A 1BQHB 4V1YA 3JWDH 4FQ2L 3GJFH 2GSIB 5HDBB 4YHEA 3B0UX 2CDEA 1U5JA 1FC2D 2BNRA 1OLLA 1BHGA 3H54A 3FCGA 1FNGB 2P8MA 3D39D 4MHBA 1SUHA 5I73B 1XV8A 4M56A 1QQDB 1NCBL 1PV8A 4MZIA 4M1GH 4Y7OC 4C1NA 4KZCA 3C87A 2OXHB 1WITA 4B9KC 1ZIBA 3ONBA 5HBFA 4TTGA 5DZNA 2VMEA 3AT8A 2VL5A 4PJ5E 3CAWA 4JHAL 3LH2H 2OKOA 3BPLC 2DD8H 4L4LA 1ONXA 4XD3A 1E42A 4NFCA 43CAA 1ZS8B 2O5NA 6ALDA 3BPOB 2YSSB 4I3GA 4OCMC 4Q0XL 2J7GA 1XICA 2IBBA 4AZCB 5FGSA 5ENWA 1PYMA 4HWNA 3NN8A 1NCAH 1SR0A 1A22B 4D9LL 2ATMA 5G4EA 4K5NA 2GSIA 2YCEA 2K70A 5T1KD 2HFFB 4A39A 2P3EA 4G8EB 3QC6X 5CPTA 5FV2A 1KPUB 1PZBA 3CS2A 1JTOA 3U48A 1A14H 2G41A 2IFFL 3FCTB 5KBMA 4LIQE 4GIPD 3DMMA 1T1YB 3NSCA 5C7ZA 2G5WA 3DHFA 1VRXA 1FIGL 3UY7A 3K6DA 2YL8A 4EE9A 3SUWA 3IVSA 3HZVB 1FHLA 1T83A 1BWKA 3LV3A 3WD5H 3BG3A 2G4GA 4GS7C 4KKLD 2G0WA 1MCSA 1ITXA 5LHEA 1JZ2A 3VNLA 3IMWA 4PAZA 2VN5A 4A37A 5E24E 3TX9A 3WK0A 3GLEA 3MPCA 3CZKA 4JN6A 1H51A 1KG0A 3B2VL 3SE3C 4WOZA 3WQFA 2BV9A 1V10A 3K13A 4GI8A 4LCUB 3UWEA 2ICWJ 2ZUMA 4V28A 4H1LH 4U7KA 4HPJA 1XD1A 3AITA 4ISVA 1ET5A 3EWYA 1JUBA 3E3QC 1UR0A 4WDIB 3F7JA 3F7VA 4LSDA 3MMEB 4CD8A 1W3KA 1BF5A 1R5VA 3DWTA 15C8H 1NAMH 1W91A 2GDVA 4WW2F 3GHEL 1P6BA 4QKTA 2JXMB 4ZR8A 1ILSA 5AC5A 3QDME 3A6BL 5FYLL 1HCVA 2YPVL 3MRJA 1E6JL 4JGDA 4KKXA 3ME0B 3CVHH 1E0XA 2CWRA 1ZA3B 2Z1PA 4EUPG 2CIPA 4KZ0A 2A3TA 2WSQA 3QUMA 4NJJA 3JBG7 2VC5A 3VTTA 2VVNA 3V5KA 1NGQL 1TDQA 2QUUA 4FOMA 4IJ3C 4QHUA 3WI9A 4WFGE 3U0PB 4M6VA 2Z31D 2OSLB 3FB5A 4JBSA 4P05A 5E8PB 3G5XA 3N1FC 5DQDH 1VFFA 3LLXA 1SJXA 5LQBL 1GCYA 2N7SA 1UIPA 1W1IE 4PGLA 4Z0SA 3DUUA 3ZVHA 4G83A 1MI5B 4Z7VE 4Z7IA 2FFCA 4WK0B 4ELMF 1FSKC 3G5WA 3SGUA 3SKOB 2WNWA 4M61A 3VRIA 3WFDL 1OO2A 4JTRA 4E5XG 3IS4A 4US5D 1GH7A 3TN0C 3FA5A 1TREA 1W3IA 4NAMA 2ADFH 3OKEB 5D2NE 1FA2A 3NO3A 5IB4A 3W81A 3TBWB 2DLEA 5TGBA 3RDTA 3V9CA 1BRLB 2VDPB 4MKSA 1YEKH 1M53A 5H4ZA 4ZOCA 1RQEA 1OHLA 1HINH 2WBKA 4OGAC 3X11A 3B0YA 4GVIA 1F41A 3VIFA 1UT1A 3OYXA 3AHVA 4RESB 3VOHA 4KMLB 1BM3L 3QVQA 3PCYA 4I0CC 2V17L 4JR9H 4IGMA 4XISA 4YJ5A 1XX9C 3P40A 2NXIA 1I3GL 5DEFB 3NJVA 3WELA 2QCFA 1CZ8H 1P9MC 3LBMA 1ZGLA 1SBSH 3FT3B 3OAZK 3PWPB 5SWSA 3U1SH 4DP6X 1EUTA 1K3UA 4KDTA 1T6VN 5IBXC 4FPSA 3STLA 1NC4B 1NGXB 3LIZL 3WJLA 1NICA 4D9QE 4AZHA 3NSYA 1KSRA 1Z8AA 1AMKA 2NX5B 5AKSA 3C08H 1UZ6F 2Z1WA 4UFLA 4PJFB 4RBPH 1NMCC 1RURL 2HPTA 4DJMA 1GNXA 3VRLE 1IEQA 2G3FA 3K5XA 2E7CA 3QMRA 4KQ0A 1PYFA 5DHVB 2Y0FA 1LO0H 5K39B 1QOXA 3OPSA 3QV6A 4PJDE 4P2AA 3F4DA 2EEBA 4M6NH 2PO6D 2XDHA 3FQ2A 1LE5A 1EQPA 1RBOB 1NCGA 2GVYA 1TNNA 3FU8A 3MACH 5DA0B 3JV6B 3DX7A 4PV9B 3SPHA 1QPPA 1AQFA 5BOEA 5C2XA 4N6RA 5B1CA 3ZS4A 3MLYH 1JAKA 1CFTB 3INUH 1G7VA 3W7IA 2QADC 1UIOA 1DBBL 2OELA 3NL2A 3WLTA 1UB6B 3QUXB 4YL9A 2GGJA 4J4PD 1W3JA 3LTPA 2BNJA 4DVBA 4P8UA 5LG6A 4XPHH 4EXPX 3CN3A 1JZ4A 1CK0L 1T6WA 3D05A 4WU7A 4MJJA 4PTMA 2IQDA 4GSDL 4HCIA 1OCQA 1W1TA 3B0PA 2ZZ7A 3ZTEA 4KQ3H 3GD6A 3OIHA 3URBA 3MOBL 5BXPA 2NY4B 4WV1B 3KLHD 1ZLDA 2BVPA 3GVQA 4GRLC 4BBWA 1IC7L 3DKLA 2J8GA 3UIYA 3IGAA 2HMIC 4G9FE 2FPYA 1Z5YD 4IL2A 3MC5A 1OK4A 3HNSH 2VGIA 1DQJA 2SODB 3M07A 4I13B 1U21A 2OPJA 4P0DA 4FNQA 4JVPA 3O2DA 2BSTA 2Y5QA 4JPKL 4DY1A 2EEXA 1E15A 5HGDB 1UWGL 2ADGB 5K59E 3BP7B 1DLFH 3B9DA 3B9OA 3ME3A 4IEFB 5AC8A 1LJMA 4Y4HA 5TBOA 2H1PL 1KJVA 5DRNB 3RKDC 3N17A 3TA9A 4H5SA 4WDXA 2GFTA 3CL8A 4F33B 5CJOL 3ZYIA 5I71C 3SRDA 3QW4B 4PSRA 4Z3GA 4ZQKA 3ZE0B 3IJEA 1EJTC 3UJ2A 3A3HA 4MJ6B 3K1GA 3P60A 3QHZH 1SOKA 2FQDA 3P7YA 2CGYA 5LNRA 4AYSA 3FQNA 4Z77B 4ODWA 1MEIA 1UZ1A 5CAKA 5FYJD 5AZ2H 2FQEA 5D7LA 1S9XB 4KS0A 4R7OA 3SDYH 2R69A 3SSZA 4KNQA 4RE3A 2XIIA 4XO8A 3TYDA 5F7YC 3QF0A 1ZGLB 3QPKA 1I31A 2EIJB 3EOTH 3L7FB 2HT2D 4HT1L 4JN7A 3KWTA 1OGTA 3VVGA 4FQHB 4EOUA 2Y7FA 5DQJA 2XV3A 1YECH 4A55A 5CZVL 1TJGL 3WIHH 1Z89A 2DZWA 3K74B 4XAKE 1KJ3H 3CIVA 1PLCA 1H7NA 1WIOA 3DENA 2YRLA 1MVUB 5DC2A 2B81A 5FIPA 3W76A 4ACTA 4YXGA 3GBNH 4J3OG 1XI3A 2G97A 4C56E 2HXUA 1FF5A 3EG9B 1NJ9B 4LSSH 1R3RA 5J1AB 3LKRB 1RH8A 3O6FC 3QCVH 1E9YB 5JQ9A 1BAFH 1NAMB 1DSFL 4M48H 1CTNA 1JV2B 3WIFA 1QWNA 2NDFA 3WDIA 1F18A 4CU8A 2VLRE 5B7MA 5F3BA 1RK1A 3IE4A 1AH1A 4BKSC 2PTDA 3DX6A 3U30B 3UBFA 1TV8A 4NAFA 5DJ2B 4OQTA 4M1DL 4LEXH 3ZL4L 5FR3A 4LEOB 2ERJB 5DWPA 4ETQA 2V3FA 1TU2B 1QPNA 1UT2A 3IPFA 3IDMA 4OAWB 5CEXB 1ID2A 1CF8L 1F2QA 1ZHKB 2OMVA 3C5XA 3PM6A 3UTQA 3HZYB 3UFIA 4BRJA 3OXRB 1UB3A 2QJMA 2VLLB 4M0XA 5DZLA 1BZ7A 3GK0A 5DR5L 2AJVH 4C59B 1CZ1A 4P57B 3X1NA 3BUDA 2C1OA 2X4NB 3MLXL 3TIEB 3EOUA 5KVGE 4AYGA 3F01A 4CVXB 1EFXA 3K6OA 3IARA 4B3EA 3LHVA 2VFEA 4TOYH 2FR4B 1WA3A 3ML9A 1TKKA 3VNKA 1R7AA 1H5BC 3QO0A 3FGCA 4H9VA 4MLJA 2C1PB 2NT0A 4NC0B 1EJRC 4LP4A 2XKNB 2CUIA 1RIHH 1QMLA 2CZNA 2FNBA 3VJ6A 2AEWA 5IHUL 3W1UA 1GK8A 3TNBA 1N2RB 1VA9A 3VKJA 1SW7A 2GQHA 4YTQA 4MMZC 1U8HB 3A4EA 5FGBA 4O5LH 1J9RA 2FBRA 4XP5L 4BWLC 4DXXA 3MVSA 2D7TH 4DUWA 2F54B 3ZOAA 4EMZA 1IR1A 1MJ8H 3LNEA 1OF6A 1RI8A 4NKIL 1VD6A 1XIIA 3GYCA 4V27A 1IEAB 1WBZA 4FTVA 3T2LA 2EO7A 2D23A 2PTYA 2X28A 1LO2L 3X3FL 1Q0EA 3DZ1A 2PBGA 2ALWA 3HB3C 5HDQH 4IMLB 1NCNA 1MAKA 1UEYA 5TQ0L 3PBGA 1A7OH 4DEFA 2Y25A 4OBSA 3L23A 1QUNA 4GO9A 3FCTA 1PX8A 3TURA 5EEZA 3EGXA 1XGYL 3VNZA 15C8L 1NAML 3MUXA 1AAJA 1ZT7A 4G6AC 4U1MA 1UWUA 3KG5A 3T9PA 2VXUL 5HNUA 1BDYA 1PEWA 3NFSL 4YMPA 5F7HA 3LGGA 1WBYB 4EUPB 1ONEA 4ZNEE 1JS4A 1EDYA 2CBMA 2HH0L 1TQBB 1A1MA 1A6PA 2HLFD 5E6IC 4ZFFA 1U2CA 5C9UA 5JDSA 2QQLH 2ZXCA 4WHYH 1HJSA 1YNLL 1X5AA 5HQEA 1HDMA 1WFNA 2E47A 3DDGA 4M7SA 1PW3A 1DWFM 1W1ZA 4FOUA 1QSEE 3ZDZB 3BJLA 3CN2A 3F12B 4BZYA 4JTTA 3SADA 1P1ZA 2DQFA 4UQCA 4KMQA 4HAFA 5C6TH 3EPOA 1LBFA 3SZ6A 4B91A 3CIWA 4JBRA 4MNKA 3WFDH 4X7TA 1NDTA 2VTFA 1BVLA 3PWVA 4HQVA 3LHTA 5ECVA 3K5SA 1RULH 4ES8A 1LP6A 4HWBH 4AGOA 3P9LB 3RWDB 4G42B 4J35A 2ZQKA 3SBPA 5LBVA 3VAVA 4PFMA 4GSUA 1YEKL 5FX3A 2L0DA 1GOWA 4OZHF 2VDQL 2MHAA 3IGHX 1CT8A 3ZLGA 2EGZA 1AGDA 3CVCA 3MBEA 1XPGA 3KOWA 5LIKX 4B2DA 1BM3H 3CT7A 2CHWA 5C0FA 1I3GH 1QACA 1F3JB 2ESVB 2ZKWA 3B3BA 3O4OB 4QOKA 3GZKA 3LS5L 5FYKH 3DSNB 4BFIA 4OOZA 1WAAA 1V0NA 1F8TL 1U91B 5JHDD 3FSAA 2H4EA 4LLUB 4WNJA 3GSRB 4Y19E 3W7NA 1JVKA 2F53D 4G72B 5ICYA 3K80A 4TYUA 4HJJH 3RDTB 1DBKH 3H70A 4NQ1A 1LILA 4K3ZA 3D09A 2VDQB 4WY0B 2C1IA 4G8GD 5B1KA 1ZHAA 2VJ0A 4HBCL 4GMSL 4Q58C 4W6XB 1QNRA 2CBQA 5CNHA 4GPNA 4FZEH 4XH2B 4TX9A 4YHML 4ERGA 5E1QA 4Q4EA 4X7EC 3WFHA 1TQCC 3ARUA 1B90A 1SDAB 3KJ4B 4MXQD 4JICA 4DUVA 5EZLA 1MIEH 4W9JC 4QDGA 2ZCZA 1V7NH 4ZODA 1G7JA 1NPJA 1ZT7B 4P3CH 4U1MB 4G7QB 3T3ME 5CPMA 4Q8VA 4Q3MA 2UV8G 1KC5H 3U7BA 2V81A 4DZHA 2OSLA 2HVKA 4MFHA 4ANWA 3H56A 1DBBH 5I74C 4ZZFA 5I1CL 3UABA 5BVJA 5HR7A 4ACZA 1KGUA 2WUBL 3UEQA 3VGBA 3W00A 3SDDA 1A5FH 1VZHA 2FWOA 4IRJC 4L3EA 4PMOA 1DQDL 3PGFH 4XP6L 1UENA 2BMKA 3U6RA 3IDUA 5DJZB 4OTKA 1J1XH 1KPVB 5DX7A 2EPHA 2NNRA 3WFHB 1EXPA 1FLRL 32C2B 5GS0D 1F73A 2EIKB 3CXDL 4UQ2A 1R7OA 1W3LA 3MLPA 3TK7A 1IILE 3LS4H 4ZMAT 5KVDH 3WG7B 4DIXA 2OU4A 2OEKA 3HNSL 5A2JH 3BLFA 3UJTL 1XFPA 3VK5A 1SN2A 1EK3A 1Y18A 2YDSA 4DZBB 1EUNA 3KWVA 1SJHA 3BHBA 2G4FA 4AY1A 1QSFD 5DT7A 1V3HA 1DLFL 3NJNA 4BZ1A 3KYNA 3G3DA 1T80A 4ZMNA 1T03H 2EDMA 5CJXC 4HFWA 1V03A 3N44B 5IT2L 3CLFL 2WMIB 3A9IA 1AG1O 1LQ2A 4DPCX 1AGFB 4M6ML 5DJYA 3DYOA 3LCHA 1VYRA 4MWAA 3QHFL 4X50A 4PW4A 3PRZA 1AGDB 1R5IB 2Q7AA 3S9YA 3HV8A 3V6ZB 3CWHA 1VB9A 5DCEA 3UP8A 3AS2A 2R56L 3PUGA 3ARQA 4QF1A 4XAGA 4LAJH 1F5ZA 4F2ME 3CDZA 7ODCA 3PWPA 3QEQD 5SWSB 1S4IA 3BAEH 4KH2A 5IHSA 4KI5F 2Z31C 2XX1A 3GXUB 5D1XA 5EPMA 3K6IA 5JMRA 3I7RA 4CQBA 4ICXA 4QLKA 2YC1A 4B95C 1OJXA 4DVOA 2XJKA 3QZWG 4LBAA 1A5UA 3CSGA 1ICTA 4F5CA 5KZCB 1EP3A 1FH8A 1IM3B 2HT4C 2GW5A 2EE3A 1VADB 1RV6X 4FG4A 2J8UB 4WUKH 2BHUA 4YK4B 3ZKMD 1J6PA 3MS8A 4YSSA 4JFYA 1EIXA 4NAEB 4ADSA 4C6FA 4MKTA 2K0RA 2F58H 2OL3L 3PHOB 5GGSB 5XIMA 3QUXA 3JUZA 1FBIH 3W7CA 1GC1C 1MCOL 1IWPA 1ETJA 1XGDA 4UIKH 4LPXA 2DT1A 3S8FB 2A9NH 4PJ7F 3TWCL 4QIRA 4YIQA 9CGTA 1MRQA 3CQKA 1BAFL 1VFUA 2CDFB 4M48L 4PJ7B 4LVHC 4RMTA 5E8OB 5LAXB 3VDCA 5AAPA 1NP2A 1ZQ5A 1YO4A 4XP4L 3B0XA 1DUYA 4OGAD 3BAXA 1T0NB 1CL7H 5T1JA 2R0ZH 4XQ6A 2MRYA 5FYJH 4AEFA 5AAMC 2ZRYA 1QSFE 4HUMB 2HRPH 1TMHA 2F7RA 5EU4B 4Z2JA 2FWOB 4L3EB 5IB2B 2IKJA 2JIWA 1ZT4A 3OP2A 3OVRA 5FF0A 4YDKL 3VRJB 4EIGB 3OKKA 4RISL 5L8KB 4YTUA 3ABGA 1A6AA 1MI5D 2ADJB 5DZ9A 1OC6A 1VZWA 3KGSA 2AJVL 5CEZD 4UNIA 3FUKA 4XD4A 3GC5A 3TZNA 4WEBL 1WDQA 3L65A 5K3VA 1FORL 5IG7A 3S97C 3GG8A 4AH7A 2XU2A 3AUOA 3PUOA 2OLDA 3DX6B 2AJYH 4AE1A 2C5DC 3VSQA 3OMZA 3QUGA 1FP8A 4R5TA 3UTZB 1J01A 3NNTA 3WMPA 4MKNA 5HDWA 3FQTB 1F9CA 3MRPA 4WWNA 2H8ZA 4LOUD 2HPIA 4B3LA 5IHUH 2G2RB 3CH0A 3PJUA 4I5XA 2HFEB 2Y6ZA 4DKFH 4HG4K 2EUZA 4U5KA 3VNIA 1YMMA 3HOGA 5MHSE 1XH3A 3MO1A 1FV1A 1LDSA 4KEVA 4NCC1 4TU1A 1L3WA 4XP5H 1H15A 1TETH 4UOZA 3VZXA 1TJ1A 5AAWA 3NQAA 3PFRA 2HN7A 3OKDA 1UWYA 4H2CA 3MRNA 1XR8B 1MJ8L 1AH4A 1D2KA 1JCXA 4ORMA 1U3HA 1CUOA 1XH2A 4XBMA 3H23A 4QRSA 4P59H 5D70H 6PAZA 2QKIB 1IGMH 3CM4A 1W0YT 3FXGA 1UC4A 1IGFL 25C8H 1A3QA 2PYED 5D8WA 1ECQA 3L7FA 2X42A 3EUDA 5TQ0H 5HYJD 3QULB 2MQGA 3CZFB 4G7FA 4K36A 3UA3A 3R79A 4G43A 1E28A 5KSUA 1PL9A 1FWBC 4MCZB 1WCBA 1TFVA 3D2UA 1TNMA 4KUCD 2EG8A 2X16A 3AUJA 2IW0A 4FIRA 2J47A 3MNWB 3B4UA 2QFPA 2E4FA 4F7CB 4GYBA 5F9DC 3LCIA 3PBYA 3TH6A 2C9UA 2AQTA 5JYMA 1GPOL 3DGCR 3HRZA 3REQA 4BI5A 1I4NA 1F07A 2GUYA 4F7TB 4A7QA 5CEZE 4ONFH 1QSEA 1Q5MA 1YNLH 1NAMA 4LPVA 3WIFB 4ZMYA 1JPIA 2ZA2A 5HTSA 1EV2E 3IUDA 4GISA 3W6LA 4H2HA 3O16A 2KI6A 1JGEB 2BSTB 2X3CA 2JK5A 3LQGA 5TJWK 3ZXAC 1EJVC 4AI7A 2OXHA 3C75A 2Y07L 4HGXA 3WH6A 4ENZA 2FB4H 3CV7A 4GBXB 4JO1H 1IR2A 5A7BA 1G67A 2QGCA 3OL2A 3MHUA 1VCGA 4XIMA 4GMEA 2NMSA 2RMNA 2FL5A 2GG1A 1X96A 1NC2A 4X22A 1BECA 4NNPL 4O0ZA 4MY1A 3T78A 1AH3A 1QNVA 5HHPA 3EKLA 1KYUA 3MNDA 4PJ9C 4BWUA 1Z66A 1XGPA 3BZ4B 4OLZL 2WP3T 3KPQA 3UYPA 2C4FU 4L8CA 1JVOA 2ROXA 3GTFA 5D8JL 3LZ3A 4RFOH 1S9XA 4FXFA 2ATKA 2XKUA 1MCKA 2N4IA 4FL4B 4I85A 4N2AA 3SOBL 2RFXA 3IDYB 2PDMA 1BFOA 4LVGA 1BF6A 4HPGA 4MRBA 1TXKA 2YCLB 3BDYH 1R3YA 4AX6A 3GNDA 4I0KA 2DIAA 3JWDC 1K4DB 1PKLA 2QYGA 4O1DA 2PPDA 4LCSA 1WBXB 1RZJL 2CDEB 2XQBH 2NY0C 1MCHA 3WLOA 3IRCA 4EIVA 1KBBA 3SGDH 1UUQA 2Z0BA 2MNJB 1URLA 4IOIA 1CDBA 1YJDL 3C8KB 3W0WB 3I02B 1NFBA 2FKPA 4XSMA 3V4BA 1QHOA 2F1BA 1TR9A 4QG8A 2FDBP 3VWJC 3OAWA 1OX4A 4AG4H 3IFNH 1N5AB 1K77A 4DJFD 2NVDA 4E8GA 3FT3A 2VL5B 3HG1D 1XBYA 3ARRA 2O92A 4Y9AA 4DBSA 5KMYA 3GFZA 1A4BA 1XIWD 2WNGA 3OF6A 4YHMH 1VPXA 3CMJA 32C2A 1BMWA 1A65A 3MRCB 1U3HC 2P1FA 5I8KL 4UM9A 3EH2A 3JWOH 1FGNL 4OF0A 1Q6QA 5HDLA 1RK6A 3DXAD 1V7NL 3KPSD 2HRHA 4K8RD 3BOLA 4KY1H 1F6FB 4JTLA 3BQVA 3QKEA 3QUYD 3K1KC 1K1DA 1H1NA 3W2DH 1H50A 1RJZA 5D1ZB 3V5DA 1LO4H 4PJXA 2CG9X 1QFEA 2EPMX 3BKML 1YHPA 1HCZA 4UQIM 4HG4J 2WWKO 3HHSB 1A5FL 4KX7A 3CVIL 5FM5M 3MRBB 3PS6A 2DVTA 4KRPB 3BSHA 5HJGA 1X1ZA 2NY6C 4ZXBA 1O9WA 2H2SC 1LE5B 3QQ3B 2ZJSL 1MI5A 3QDGE 1VENA 3BE7A 1J7VR 4S3FA 1TPWA 5LWYH 3RWGA 1TSRA 3IJYB 5CN2A 3BKYL 3OPZH 1F2XK 2J12B 2HNEA 4YBLC 4YU1A 3VDGA 3APNA 2E67A 1E67A 1FL6B 1KTDB 1RVFL 2YAQA 4YGVB 5JLZB 1QPRA 4GVHA 4WI4A 4Y90A 3MJYA 1SJVA 2PTTA 1I1YA 3U1QA 4JNYA 4JTDA 4NZ3A 2CKBH 2BGNE 1ELSA 1SHXA 3R06A 1DBTA 1L0PA 3GF8A 2IOOA 1MLCA 2WLMA 1F3JA 2ESVA 4Q2ZA 4QOKB 2W5FA 2PZ0A 4DYJA 5C5YA 1LQAA 2YLAA 3BV7A 4Y7EA 3ITYA 4DP9X 3BGAA 3HG1B 1N8ZB 3MRQB 5KBPA 5IIEB 3R5EA 4OM1L 5IJVB 4GG6A 4PMXA 2AJXL 2IMRA 3VKAA 5C0IA 3U6WA 1CLCA 1Z5LA 1OIMA 3PBUA 2XIBA 2B3RA 4MB5A 2IPGA 2HJKA 2YPKB 3ECVA 3C2VA 4N5EC 3GMOA 1XIBA 5HJXA 5EIIB 3IAPA 3S36L 4F27A 3SE4A 4MJ5B 4KDWA 3KE0A 4PI0A 5BV7B 1T1XB 4FABH 4FFTA 1FN4B 2CO2A 1Y6KR 1XQ4A 1S38A 3HUJE 4XWOD 3WO4C 4C54A 2P24A 3ZDZF 1FHDA 1HIZA 5K9JH 4UNLA 3DHPA 4OCNC 1H8LA 4YFDB 1E6RA 5K2ZA 4Z8FL 5FXCH 2A6DA 2SEBB 4HSCX 1ZBKA 3FS9A 2IPJA 3JYBA 3NPSC 3AU6A 4KQNA 3VXPB 5DMMA 1U8JA 2INFA 2E27H 1SJEB 4TNGA 1HUVA 2FQGA 3U4EB 4A8LA 3OU8A 3D51A 4OZOA 4HIEA 1T89C 4WFFD 3AYSA 3M0ZA 3E0GA 4A2HA 2QAPA 4F3FB 1OFBA 1CL7L 4RIRB 2OYLA 3IVKB 4OGYL 1EF2A 3CBRA 1R24A 3DTUB 4WQOA 3VUSA 1QNZH 4HXBH 1SJDA 3U2OA 4X4ZA 1H41A 5ECUA 4Z7UE 2G5RA 4LPWA 4XBGA 4HK7A 1SO5A 2OJEB 1PDKB 4OD1L 1Y18B 3R6IA 2G4EA 5I2UA 5E4AA 4K2SA 1QJWA 3SCVA 2ODHA 3U9UB 1P4IH 4KI5E 1Q94B 4OJAA 1GL4B 2EYTB 3GEWB 1A3LL 4I2XB 4L5FL 4PJCE 3RPIB 4LNYA 4Y5YB 1PSKH 1NDVA 3AU2A 1DJSA 1AL7A 1FA4A 5JQHC 2VXTL 4DP8X 2AJUL 1K4HA 1M04A 2XI9A 4HPYL 2AJYL 2X7VA 3EKZA 3GG0A 4IISA 1WK0A 4G6JL 5EU3A 3DFQA 1GJIA 2EVJA 3LEYL 3CSBA 3D2UB 5ERWA 1KKRA 3MBDA 1K8IA 2OS7A 3BN9C 2P8LA 2OK0L 1BOGB 1CLKA 1ZLSH 4B7LA 2J55A 4I5BB 2G3MA 4HCRL 3CLEL 3MGTA 2XG9A 2Y22A 2NR6D 3M0JA 3WJLC 4JN2A 4JG1H 2RCSL 2X7LA 4A7UA 1EEXA 1PDYA 2XSBA 1QKZL 4P4KC 2V8LA 1RY8A 3CUHA 3D0LA 4HTBA 4XAPA 1O68A 2FJHB 1L8PA 1AC6A 2GKIA 1KGJA 2AXGA 1WFTA 3LNFA 3Q0HA 4MDIB 3TZVC 5IVOA 3U4KA 5CJXA 1V7YA 3EOYG 2FR4A 3FOKA 2BS9A 4Z1YA 2G0LA 1JK8B 5AW5B 5EORH 2Z6IA 3HA0A 1FBAA 4NJKA 1SR9A 1QRND 2VC7A 1NC4D 1KY6A 4Q97A 3Q2VA 1N6UA 1F7BA 2D22A 1KCUH 3KAAA 3QAZB 4LCWB 2E7HA 1VHNA 1G7LA 1OAKL 5DF0A 1RH9A 2IIJA 2P80D 5BNKA 5BW7C 3LGEA 1FZKB 1JV5B 3WDQA 2CO6A 1CVSC 1FRGL 5HHOE 2Y63A 4LASH 3W1ZA 3VKBA 3W7MA 3FU9A 3D12B 1GHSA 3CHQA 4A2MA 4EIUA 1XLHA 4AHPA 2XIJA 1R47A 1CIDA 3AHXA 4P9HL 5B3JE 4HUUB 5MERA 5IOPA 4N2OA 3HI1B 3BLDA 5D96B 4IP7A 1JV2A 2HSIA 3VACA 3NSFA 1DVZA 4CD6A 4Y5VA 3NP3A 1SZEA 6FABH 1BQUA 1LO3L 1AZCA 2VLLA 2HA1A 3NCMA 5IR1B 4J4KA 3SDXB 4MXWH 2WNZA 3BFQG 4U3SA 4L3ED 2UXFA 2OTUA 3T77A 1JVNA 3HQOA 4BHUA 3Q6FA 4QRUB 2APXA 4QRTA 5JXED 3F4WA 1V3IA 1PJ9A 4QMEA 3N04A 5AW8B 2VEMA 2JF7A 3QUKA 4GYFA 2R0LL 3AXHA 2BNQB 4Q9RH 1LL4A 2WPGA 5HPOA 1UR1A 3WUWA 1ZP4A 4DKEH 4AM0Q 4NNPH 1H4PA 4P5UA 5L9FA 4FQHA 4GRSA 3O2WL 5AYUL 5C07D 3WLMA 4FD0A 2VGGA 2DN7A 1PZ2A 1GVIA 1NPNA 1U8NB 4FHBD 5CSBA 3BLEA 5RUBA 3IDNA 1BW8A 1RL1A 5CD5C 2W88A 1WICA 4XXDB 4JZOA 1OY3B 4A1RA 2I5IA 2WLHA 2IDTA 4UUJB 4DNHA 2X7WA 2AGTA 3QQDA 4O8AA 3VFTA 2ZCHH 3CN4A 4HVXA 5TE4L 2VEFA 1U95B 2GHWB 3RX9A 4MS6A 3DU0A 1XCTA 3V10A 3BDYL 5A16B 3BZFB 1IU1A 3FKKA 5FPIA 3W25A 2QCLA 4UNVA 3VFRA 4B5UA 4EDXA 1JGUL 3MV8E 2DQGH 2J77A 3KCPA 5LKYA 2WZ5A 5HHNB 2IC2A 2WLIB 4CMHC 1VJSA 2AVFA 5CM1A 4HN8A 5HHOD 3SYAA 5INCB 2VC2B 1UD4A 3EGXB 3E5PA 1UFGA 1AQDA 1KRCC 3PBMA 2J2ZA 3D39A 3IFNL 5CLZA 3GIZH 1OINA 3RTQA 1F02I 1EEYA 1L3NA 1TCRB 3L4TA 2YDQA 2XFGB 3FTGB 3FTXA 4NZUL 4KZDH 1ISWA 1SRDA 4IIZA 5D04C 2RH9A 3GH4A 2IXQA 3FO2B 5AKTA 4TM9A 1YEJH 2Q86B 3CZNA 3MNZA 5IWLC 3PR2A 1Q0XL 3GXNA 3JWOL 2BOCA 1HGWA 2DYSB 3CIAA 4PR4A 5DSCB 4UFIA 5A2LH 5EZPA 3FKRA 3PIQB 3KOXA 4N0YL 3CSTA 1IAKA 1IIIA 4GKLA 3STZB 1HKIA 4N4PA 3W7HA 3L5HA 1WQVT 2HE5A 3FOMB 1NC2D 1SEBA 3W2DL 1FH9A 4XKYB 4ODHH 5F9WB 1QBBA 3VJ6B 3X1GA 2PTUA 4IU2B 1HDMB 5EOCH 3U46A 1G7MA 1JPGB 3DX1A 4C83A 4ZTEA 5FOBA 4PRHE 3FNDA 4I9AA 1AGEB 2D3LA 4YHIB 5E6IA 1H5BA 4HISA 4O1BA 2VJ8A 1XAKA 2Y8KA 2BSSB 2FZBA 2J5LB 3ZMNA 2GUUA 3NZ1A 3R13A 2OI9B 2JB5L 5J3HD 4U7SA 1Y0LB 1DQLH 3ARBB 3BUTA 43C9A 3AIUA 2NQHA 4FXGB 4OLUH 2DJUA 5FHBH 3ABKB 2HRLA 1LYQA 1RZFH 2DQXA 2XV0A 2VFDA 3TDFA 4M03A 2W38A 3DAQA 2OQJA