2ZX8A

Alpha-l-fucosidase complexed with inhibitor, f10-2c-o
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
441
structure length
441
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 163
structure length 441
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx8A01
2F18A 2DH2A 3W53A 5CGTA 3WMCA 1XCXA 1OM0A 1GVIA 3OIHA 4TXEA 1FFQA 1ZBVA 5GPRA 5A8PA 3WY1A 5LYRA 4TTUA 3WF1A 5M03A 5KZ6A 4UNIA 1WO2A 1CDGA 3HG5A 3SCVA 3CO4A 2E0PA 3D4YA 3SCRA 4D6HA 5A6JA 2WKLA 3ZMRA 1QBAA 2CESA 1R86A 3AIQA 1VFOA 1Q4NX 1PBGA 3GXDA 3A4XA 4C7GA 1VEPA 2X8RA 2WSKA 3PZNA 4KRUA 3AIUA 1JDCA 4E8DA 4M82A 3VIMA 3CZNA 4QAWA 3AZSA 1KXTA 5D9OA 4H8HA 4OBSA 4PMQA 3BAIA 3M6DA 4QP0A 3A3HA 3BVUA 3EMZA 4BS0A 3L4VA 4XUYA 4D6CA 4BF7A 4P8XA 3A6OA 3VNZA 4Y7EA 3OLDA 1TMQA 3VMPA 3AIBA 5CSYA 3VIGA 4GQRA 3U7BA 4W84A 5IXEA 1JDDA 3AOFA 1W2VA 3K4DA 2NT0A 3EJUA 3MI6A 1UR2A 5M5DA 4WKFA 2J25A 1W3KA 1U2YA 4OIFA 3ALGA 1W9VA 2HISA 4B16A 1GPFA 2WVSA 3OGVA 3ZJ6A 1GOMA 5E9AA 4WK9A 3WUFA 4CD6A 2DSKA 1V0NA 4W89A 3W29A 1QI3A 1JYXA 5LA1A 1CXHA 4KRTA 3A23A 1JFXA 3WQ5A 5C71A 4D6FA 3VNYA 1V0KA 4PCSA 2GDUA 3VD7A 3AMLA 3WH5A 3VPLA 1JGIA 4D6IA 2E9BA 1RP8A 3HG2A 4J28A 3MUY1 1HP4A 1UWIA 3VGHA 1E5JA 2EABA 1EHNA 3N13A 2ZICA 3VIJA 4AD3A 3WMBA 4AZHA 4HA4A 5CQ1A 5DFAA 1KXQA 3CUHA 3THDA 3BAKA 5I79A 1DWFM 1TVPA 4ZFMA 1OINA 2FHCA 2Y4SA 1J11A 1MVYA 4PMVA 3SUTA 3DX4A 3WEOA 2V3FA 5M3WA 3RM9A 4BQ5A 2G41A 2ZWYA 2UY2A 4GQQA 3CHFA 1KCKA 4IPNB 1Z32X 3MO4A 3CUGA 1MW1A 5CZKA 1HT6A 2WHLA 3OLIA 4ATWA 3TTYA 5BWFA 3VSVA 1BYAA 2VVNA 3KWXA 3ZO9A 3WL1A 2DIJA 1JZ3A 4U33A 1DEDA 2PBGA 2UY5A 3W82A 2WMKA 1V3MA 3I3DA 2CEQA 3SCSA 5EFDA 4Z2GA 4YHGA 2VNCA 1JAKA 4J3TA 3WD0A 4JIEA 1GQJA 1E56A 3EJQA 1UG6A 4IPLA 2XFRA 1CXLA 4AW7A 3OLGA 1X6NA 2WZEA 1A3HA 3H55A 4GI6A 2VTFA 3OZOA 2GSJA 4HA1A 3ZQ9A 5DO8A 2WMIB 4NSBA 1B2YA 1KXHA 1EA9C 4HPGA 1WAWA 5GQBA 3WENA 2F8QA 3EDEA 4F9DA 4QFUA 4D1JA 1U33A 3UG3A 3AYSA 1VENA 2X09A 1JFHA 3SCNA 1DWHM 2WHJA 5DT5A 4Z2HA 4DM2A 1G0CA 2XWDA 3ZJ8A 1WDQA 2VL4A 3ZOAA 4CVWA 4JL1A 1V08A 2XFYA 5D9PA 1J0JA 1SMAA 1PJ9A 4IUGA 2B31A 2YL9A 1FP9A 3DECA 3S2CA 2EPOA 2C7FA 1KGWA 3ZJKA 4KMQA 3W28A 3F4VA 1JNDA 4PMZA 5ABFA 3SIMA 1VBUA 2F7OA 3ARVA 4KH2A 3J7HA 2VURA 1UD5A 3PZTA 2ZX7A 1HJVA 1QNRA 1LJYA 2AMGA 3GH7A 1E9LA 4PMXA 6A3HA 3S5YA 3VIIA 4AIOA 1HVQA 1OB0A 1CXIA 3VIHA 1N82A 1NWRA 3WNNA 3VM7A 3SEPA 1DWGM 4UFKA 4PMUA 3RMEA 1UWUA 4JL2A 4JFUA 4HOWA 1FA2A 4MB4A 4W8LA 4LXFA 4W5ZA 1IV8A 5D4YA 3ZT7A 1FOBA 3AMCA 3BMWA 1UHVA 4AY1A 4DWSC 5GNXA 2J4GA 4CKQA 4B15A 1DWJM 4H2CA 2W61A 3UG4A 1GNXA 1UQZA 1QBBA 2QPUA 4ZENA 5FL1A 4L4OA 3PZMA 2JFEX 1JF6A 1BTCA 5JBFA 3A4WA 2D0HA 1C91A 5E70A 4AZCA 2VZUA 1UR0A 3CHDA 4A4AA 1GVYA 3AFBA 2EPLX 3LPPA 1EIBA 1HKIA 2QLYA 5E6ZA 3WQVA 1ODUA 1UKSA 4OZOA 3KL5A 4MAZA 3ARQA 1GOQA 3VILA 2BY3A 3WUBA 1UZ4A 5D8WA 2YA2A 1QWNA 3ARTA 4BQ3A 2WVTA 1JXJA 2OSWA 1VFMA 5EB8A 3K4AA 2IGTA 2O9RA 1NOWA 1MW0A 3LPOA 2D20A 3WUGA 3CZKA 4QCFA 4BQ4A 1LL7A 1UH2A 2W5FA 1E4NA 3B9EA 2F61A 1F4AA 2VC9A 4HMCA 1QHZA 3W6MA 5A6BD 3L2MA 3AIWA 2VQTA 4MNMA 3VIFA 4PTWA 4OGZA 5ABEA 2CITA 1JAEA 2EPMX 4P8WA 2GJXA 1CGVA 3VGFA 2YIHA 3ZSTA 4MB3A 5I77A 5CPSA 2X2IA 2QMKA 1KXVA 3GTNA 1OGSA 1XH2A 1ZBKA 1UA7A 4D6JA 5E0FA 3QHMA 5BRPA 1H41A 4H41A 2E4TA 1XV8A 3KLKA 4UQCA 1WP6A 3RJYA 3SUSA 1XCWA 4J3SA 3DX0A 2G3IA 3DC0A 1CGXA 1ISWA 3K46A 3N12A 3EJRA 3MUIA 3VDBA 4MADA 4R5EA 1EOKA 1IT0A 4PMNA 2ZX5A 2GUYA 2J7GA 5E1QA 3POHA 5DMYA 5I3DA 3CLWA 1QI2A 2X05A 1VIWA 3T09A 2W66A 4TTGA 1C3FA 2DSZA 2J7CA 1XH0A 3B8SA 1EH9A 5A6BA 3BC9A 3GNRA 1CNVA 1TR1A 2ZUSA 2Y5EA 1YHTA 3GXFA 3CIVA 1LWJA 1G9HA 2GK1A 1ISVA 5TD4A 3W6LA 2ZUTA 1W1YA 4ZE5A 1H4PA 1WKYA 1E55A 1LG1A 1GONA 1KFWA 3D3AA 3BSGA 4AZ5A 3FAXA 1E6SM 2ZUNA 1XGZA 2OSXA 2IXUA 3VUPA 3GXPA 2VUYA 1LL4A 3MMDA 2ZOXA 1E6PA 1KR1A 4GO8A 3WY2A 5FOOA 1ZJAA 3FW6A 2F1AA 5DF0A 1VEOA 3WQ8A 2QHAA 3EJTA 3WNOA 1JZ4A 3CTTA 2JIEA 1AQHA 2G4FA 2V5DA 3WFZA 5CSUA 3LPGA 1W32A 1W1PA 1R47A 1XRVA 3PN8A 1BQCA 3T0DA 4D6GA 3AS1A 4E4PA 4OOUA 5IFTA 4UQBA 1W1VA 2D73A 3MKKA 1VBRA 3BUIA 1JZ2A 2NT1A 4N0RA 2PWHA 2ZXBA 4J27A 4GKLA 1TVNA 2YLAA 3AHYA 5A3HA 1Q6FA 4HU0A 1E4MM 4UQAA 2G3JA 1NWUA 4TOQA 3HG4A 4AD5A 2WKGA 1OSEA 2WC7A 4J3UA 3QHOA 2E3ZA 5A6AA 1DTUA 2YDQA 1ZU8A 2DSWA 1F4HA 2JE8A 3IJ7A 4EANA 3AS3A 3OB8A 2XG9A 1BF2A 3SURA 1GORA 1RH9A 3GM8A 1B3ZA 3KZSA 4M81A 3ARZA 3QOKA 1MXDA 3ZT6A 2VR4A 1EO7A 2PWGA 4CUCA 3DDGA 2WZHA 2X2JA 3QHNA 3N18A 2J8GA 3KL3A 4UQ9A 1J0KA 3WH6A 3T0AA 1C8XA 1FHLA 1MW2A 4X0NA 1UR4A 2WHMA 3OBAA 4QLJA 1C8QA 1ISYA 4GPNA 1H09A 1FHDA 4PMDA 7TAAA 1S46A 3BAXA 3WQ4A 1K9EA 4JFSA 1QVBA 2Z1SA 1B30A 4UFJA 3MU7A 4XX6A 1V3HA 1HJQA 4DUWA 3KLLA 3VGEA 4UFLA 1HJSA 2XVGA 4OOZA 2JEQA 2F7PA 3VKKA 1EQCA 3OZPA 3D50A 3MSGA 4CD5A 3CMGA 2BFGA 1V3JA 2DEPA 4CD4A 1HJXA 2XSAA 4X0VA 5DT7A 2ZUVA 2JIWA 1NOUA 2VCCA 1G01A 1V6YA 1ISXA 3AMGA 2CHNA 3WNKA 3AS0A 2RGMA 4LYPA 2J7EA 2VZOA 2E9LA 2EBNA 2QMJA 3ZJ7A 4JFWA 5JUVA 2PWEA 4D6EA 4LX4A 2Y24A 1GW1A 1HXJA 1GJUA 3WNMA 1J18A 3SUWA 1YQ2A 5ABHA 2ZXDA 2YDSA 1JL8A 1E73M 3KL0A 1JF5A 1VJSA 3NUKA 4W88A 2GJRA 3DX2A 3PZOA 3VIKA 4DO4A 3LXCA 2EPKX 1JYWA 2BY1A 1CEOA 4FNTA 3WD1A 1M03A 3N11A 3O9NA 3GXNA 3VU2A 1OD0A 1E6RA 2AAAA 3WL0A 5BXTA 2YBUA 3GBEA 5KEZA 1E0VA 3I3EA 2D24A 2VMFA 1RPKA 4J3WA 2YJQA 1K9FA 2EXOA 1BYDA 1XHGA 2E8YA 2EQDA 3VGBA 1RP9A 1PX3A 1C8YA 4XV0A 2XTKA 4WLCA 2VQUA 1UD6A 3HG3A 4OJYA 3LRKA 1PZ2A 3AXHA 1V6XA 4U5IA 4Z2KA 1PIFA 1CECA 1KGUA 2V5CA 1UA3A 1E1EA 3BVXA 5IFPA 1V02E 1GCYA 2WMHA 4NRSA 3W37A 1UWSA 2D22A 3U5YA 4D1IA 1E6ZA 5BXRA 1X1NA 4XB3A 5I78A 1ESWA 2XM1A 5FCZA 2WC4A 1KTCA 1KWGA 2CBJA 2WSPA 1UZ1A 4FK9A 2PB1A 4FNUA 1L0PA 1V3LA 3DHPA 2OW6A 2ESCA 5FL0A 1JZ6A 4MB5A 1I75A 1E71M 1T0OA 4A3HA 3SCTA 3ZT5A 3CUIA 1Q6CA 3IAPA 4C7DA 3VSTA 1VFFA 3M46A 5HOSA 1CTNA 1W9BM 2VRQA 4CU7A 4OBRA 1WE5A 3CC1A 3HJEA 4CGTA 3AIRA 4NI3A 5EBAA 2OW7A 3ZR5A 3S6TA 4E2OA 2CBUA 2OWWA 2Y8KA 4MDPA 2JEPA 1J0HA 5F7UA 3AMDA 5D9NA 4JFTA 1E40A 1R85A 1G5AA 1CENA 5D8ZA 1JYVA 2VVSA 2VT0A 2X1IA 3BUBA 3AXXA 1KBBA 1GOIA 4H7VA 2X0HA 5A69A 1GQKA 3L4TA 1EGZA 4AMXA 4U3CA 2J74A 1B90A 4HMDA 2CXGA 3RPMA 3TV8A 3TONA 1HKKA 4PRWA 2D2OA 4KGJA 3TTOA 3BAWA 2BHZA 1W2PA 4QDMA 1KQYA 4TX6A 1CPUA 3WDJA 4Z2JA 2ZX8A 1E6QM 3HMCA 3DYMA 1W9XA 1UWRA 1IZJA 4HZ8A 1UKPA 1MXGA 5BYWA 2J62A 2DIEA 2CBIA 2CCRA 1MFVA 3GH4A 3CZEA 3L4XA 1WCGA 4PSPA 1MW3A 3ARWA 1JI2A 5A2CA 3WDHA 5I5RA 1E3XA 2E8ZA 5FIPA 1WZLA 3U7VA 1LG2A 1UH4A 1WB0A 4EAMA 1BYCA 3AQUA 3FHQA 1TCMA 2FGZA 1VB9A 1E70M 2VZSA 2BY0A 2BXZA 3A5VA 3GXIA 3ARRA 3WEZA 3OA5A 5A8NA 1E15A 1H0GA 3WH9A 4KGLA 3DX3A 5FD0A 3BLPX 4OUEA 3GXMA 1XSIA 2QPSA 3L2LA 1X6LA 5IHSA 3ZR6A 2YL5A 4QLLA 1W1TA 1W9PA 3MANA 3VD5A 1AMYA 3DHUA 1W3LA 3VIPA 2YA1A 1HIZA 3EBVA 1XYFA 1UD8A 3PZ9A 6CGTA 2C0HA 1SZNA 3BH4A 1WZMA 3DDFA 4MJ4A 2BV9A 5M17A 4DUXA 4S3JA 2XGBA 4B9YA 3AICA 1VAHA 2NW0A 1B1YA 4AISA 3N17A 3BCDA 4MNJA 3GH5A 3MMWA 2J47A 4CD8A 4UZUA 3N15A 1CGTA 4U5KA 3BGAA 1QW9A 4W87A 2OYMA 3N9KA 2WMIA 2FGLA 4YN5A 4PN2A 5ABGA 2ZIDA 3BVWA 2YOCA 3LMYA 4MPKA 4FLQA 3VGGA 1E1FA 3G6LA 4E8CA 3AJ7A 1KB3A 4AZ7A 3AHXA 1SR0A 4W7WA 3RO8A 4PBGA 4H8UA 2WBKA 3VMOA 5D9MA 1C93A 3CUJA 2QF8A 3F5KA 4ATLA 1TUXA 3LRLA 2WBGA 1R34A 1BFNA 1PPIA 3AZRA 4PUDA 3ARUA 1W9UA 1UWTA 1KTBA 4M29A 5HXMA 4KWUA 1EDQA 4LQ1A 3OGRA 2EADA 4DWSB 4OKDA 2WYSA 3II1A 3U57A 4GZJA 5E09A 2XWEA 3CMJA 1OWQA 3I3BA 4CU6A 3CHEA 2O92A 2PF0A 1B3YA 1VF8A 1R8LA 2PWDA 2YFOA 3CGTA 4A3YA 4ACZB 3PTMA 1E4IA 4P7LA 3LX9A 1M01A 3EJSA 1HVXA 4FMVA 3EDKA 3HN3A 3WN6A 1JNEA 1CGWA 5A94A 3ALFA 2XN2A 3IJ9A 3NDZA 1I1XA 3MV01 3PZUA 3RM4A 3OLEA 1NARA 2Q8XA 1E3ZA 4DWSD 1E6NA 4QCEA 1UKQA 3NYDA 1JI1A 2WNWA 1NWSA 4U31A 1V6WA 4W8BA 3VM5A 1D7FA 4AD0A 4WF7A 3TA9A 1I1WA 2VJXA 1R7AA 4FNPA 1UD3A 3BMVA 4CU8A 3TTQA 3LXAA 2W92A 5I2UA 2GVYA 2V3GA 4JCLA 3WDIA 1MQPA 2VZTA 1L8NA 4AD2A 1UOKA 3AHVA 2WW5A 4ML4A 2CPUA 1TA3B 4AWEA 2WCGA 4TVCA 3VD4A 1OT1A 3WY4A 4FLRA 1GUVA 5LA0A 2ZXQA 3D5HA 3POCA 4DO5A 2QV4A 3CZJA 4NXKA 1H0IA 3UERA 3ECQA 3AI0A 3FXYA 3SUUA 1XH1A 3UR7A 2XVLA 2YLLA 2A3CA 3K8KA 2JF6A 4HOZA 2OWXA 4DWSA 1J0ZA 8CGTA 2WM0A 5BCAA 2D23A 4V28A 3MMUA 4AIUA 3CHCA 3T08A 1C92A 1PEZA 3BLBA 2OYKA 2AOSA 3A47A 1ZS2A 4AD1A 2BNJA 2VX6A 1BVZA 4JKLA 2OWCA 2IUZA 7CGTA 1QNQA 1A47A 1J9YA 4HP5A 1NWTA 2WVVB 4CVUA 3BCFA 4UCFA 3TP4A 4P8VA 5C8BB 2D1ZA 2WB5A 1MQQA 4ZEPA 3AISA 1W3JA 4JHOA 2VZVA 3BUQA 3T2OA 2DSVA 2WHKA 2BHYA 3BVTA 3KEHA 4L4PA 2VX5A 1UR8A 3A21A 4WIWA 3CH9A 4Z2LA 2FH8A 4GXPA 2A3AA 2EEXA 4K68A 2O9TA 3CBWA 3EMCA 2WMFA 1KCLA 3B9AA 2FHBA 3SUVA 4U2ZA 2DT1A 1M7XA 2W67A 2DH3A 2CKSA 4NX0A 4RE4A 4AZ6A 2J7HA 1CLXA 3DYPA 4UOJA 3QGVA 5A6KA 1SMDA 3AXIA 1OCQA 4HMEA 5A8MA 1BG9A 4HOXA 3FAWA 5BRQA 5I24A 4IISA 1ZJBA 5C70A 3WIJA 4RL3A 3LXBA 3WFLA 1VFUA 3WDPP 8A3HA 5A6SA 1EQPA 5I6SA 3SCOA 4MNKA 4DO6A 3BVVA 2WWCA 3RIKA 3IGUA 4WJXA 2VX4A 2J7FA 3S5ZA 1Q6DA 1C90A 3ZM8A 3VMNA 2G8ZA 1TG7A 3VIOA 2D3NA 2WWDA 1US2A 3WH8A 4CCDA 2PWFA 1Q6EA 2UY3A 1BLIA 2VI0A 5IHRA 2DQXA 1E43A 1UUQA 2ZUMA 3THCA 2EACA 1VJZA 4PMOA 1V02A 2Z1KA 3PZIA 2W91A 4MDOA 2WZIA 3WSUA 4LPCA 1QWUA 2F7QA 4BQ2A 2WK2A 3PTQA 2GJPA 3W25A 1MWOA 2DT3A 5AY7A 1HX0A 1LWHA 3W81A 3UETA 1HNYA 4MNLA 4B3LA 4URIA 4H8VA 4AEFA 4P8UA 3VOCA 5JBDA 2YL6A 3AIVA 1KR0A 4FNQA 1KWKA 4JZ5A 3L4YA 3DYOA 1PIGA 2BY2A 3WF3A 1LLOA 1WPCA 1FFRA 1CXKA 2HVMA 4JHZA 4JAWA 4WSKA 4D71A 1J12A 4W85A 5ECUA 2J8FA 3AYRA 1E0XA 4V2XA 1E5NA 3BSHA 3IJ8A 1CZ1A 1O6IA 2VR5A 3PHAA 5IDIA 2ALWA 1QNSA 3RDKA 5DEZA 2CNCA 2VCBA 2FDMA 1R75A 1JYNA 3D4ZA 3ARSA 1CIUA 2F1BA 3VO0A 1B31A 3VVGA 3WQ6A 2WMGA 2DSUA 4D6DA 1WZKA 1R46A 1DWAM 1W91A 3SCUA 1OIMA 2OSYA 3IAQA 3IANA 4ATDA 4QLKA 4J3VA 4PMYA 3UESA 2YBTA 1P6WA 3MV11 1V6UA 4MB1A 4M56A 3A24A 3AROA 1UASA 1H1NA 2XIIA 5A2BA 4J3XA 2VRJA 3WUEA 1TQVA 1KBKA 2J7DA 2WAGA 4M8UA 1BSIA 1B9ZA 3EDJA 2XJ7A 1W3HA 3WBAA 3AHTA 1JDAA 3BUDA 4AXNA 5CPQA 3W27A 4GZEA 1EXPA 3QOMA 2TAAA 4CCCA 2ZX6A 2C8NA 3H53A 2XPKA 2XGIA 4XZWA 2G3MA 3OG2A 2UWFA 1GOWA 4MAVA 4Q7NA 1M04A 1G1YA 1HWWA 4AZIA 3WD4A 2BXYA 1D2KA 4TX8A 1HL9A 1JD9A 2NSXA 1QX1A 6TAAA 4PMRA 5CJ5A 2YDRA 1WNOA 4R27A 1JZ5A 2XN0A 4FNRA 2A3BA 1C7SA 3U5UA 4W7UA 2OLHA 3LPFA 5BXPA 4EKJA 2MANA 5CLWA 2G3NA 3WY3A 3NJ3A 1IZKA 1B3XA 1QHPA 4P7OA 1UH3A 1BVNP 4PTVA 3GBDA 4LYRA 1WDPA 3NIYA 3W26A 1CWYA 1V03A 4ACYA 4LGXA 1QHOA 2E40A 1CLVA 3ARPA 2XFFA 4LYQA 1XYZA 3BXWA 2WANA 1G94A 4CD7A 2JALA 1GOKA 4W5UA 5EMYA 1AVAA 3WF4A 4CCEA 1CXEA 1DP0A 2FH6A 4D72A 1LL6A 3AIEA 4P7RA 4PTMA 1R7OA 2XVKA 5ABFB 1GQLA 3PZGA 3GYCA 1TQUA 3WEMA 5JIWA 1MYRA 1TZ7A 1H3GA 2ZE0A 3WF0A 1DWIM 2X2HA 1ECEA 1E72M 2E9MA 3H54A 3K1DA 1PS3A 3PBGA 3D52A 3EMQA 3CUFA 3T0BA 2XVPA 1TQWA 1XSJA 5AYIA 1TQSA 3M7SA 1ISZA 3RJXA 1GHRA 1QI0A 4PYSA 3RCNA 2X0YA 1LQ0A 4BA0A 1HF6A 5A1AA 3BUPA 4EK7A 4RE3A 1BHGA 5HDRA 2WMJA 1K9DA 1GOOA 4UFIA 3RILA 2XUCA 2CHOA 1W9DM 3GXTA 3UEQA 4AYSA 4HU8A 1US3A 1XC6A 2DDXA 4AC1X 5I0DA 1XSKA 2V38A 3WDRA 1FH9A 1JZ8A 3JUGA 2V3EA 1V0LA 2XN1A 4AZCB 1J10A 5BXSA 1AQ0A 2BVYA 2ZWZA 2VRKA 3M07A 4UQEA 1EDGA 3VTRA 4J7RA 3GNPA 4FF5A 1E6XM 2WLYA 3SCQA 2W4XA 4GO9A 3EDFA 2DT2A 4EE9A 3EYPA 2O9PA 4TVDA 1K9TA 2EJ1A 3MUAA 2X2YA 1KQZA 3WBEA 4GIAA 3VDCA 4M80A 3MUZ1 3T2PA 4FLOA 2W63A 1MQRA 2Y8VA 1EO5A 1OGGA 1BAGA 3O6AA 4CN6A 4HA3A 1JG9A 4JCMA 4DM1A 1SYTA 4F8XA 1LF1A 2BS9A 4AMWA 3HZ3A 3W38A 3VSUA 3WD3A 1VRXA 4W8AA 3L4ZA 1GQIA 5HNNA 3QR3A 5CG0A 4P7QA 3NSNA 1XD1A 2EPNA 3NDYA 4IM4A 1EDTA 1QI4A 1CXFA 3WMSA 2DPEA 2YL8A 1PAMA 1CBGA 1ITXA 3AZTA 1PX8A 1V6VA 1NP2A 2GJXB 1ZBWA 3MS8A 5CGMA 2CBVA 2ZUUA 2J75A 2WC3A 2YKKA 2JF7A 4Q22A 5FKYA 5CLTA 2VCAA 3PZQA 3KE0A 1JZ7A 1J0IA 3TOPA 5CXPA 1HJUA 1JIBA 3SCWA 4YPJA 4W7VA 1ITCA 1OGBA 2PC8A 4HZ6A 4FNSA 3CZ8A 2XHYA 5EFFA 3WKZA 1PX4A 1E0WA 2D0FA 1SFSA 1V0MA 2F2HA 1BPLB 3VGDA 3FN9A 4UOQA 5LA2A 1JD7A 2OYLA 4W93A 2WXDM 3EDDA 3VD3A 4NZFA 1B3VA 4XZBA 2EAEA 3VDAA 4N42A 3GNOA 2CETA 3VINA 1PZ3A 5CPTA 4ZXLA 1QPKA 4AEEA 1WDSA 2ZX9A 3APGA 2GK1B 2J79A 4AZBA 1JXKA 3BAJA 1QNOA 1CGYA 2FE0A 1RD6A 2V3DA 4FLSA 1HJWA 4MTVA 1HXKA 3VX0A 2UY4A 2A3EA 1AQMA 1UKOA 3ZIZA 1BGGA 4GI9A 1V3IA 1HP5A 7A3HA 2WCSA 1H2JA 2IXVA 4JFVA 4JKMA 3IK2A 2FHFA 3GZAA 1H49A 4F66A 4HPHA 4P7NA 4H04A 2XM2A 3ARXA 3EJPA 4PTXA 1OIFA 1GJWA 1GHSA 4ZE4A 4U3AA 3G6MA 3O2LA 3FY1A 1UD4A 5BROA 2XVNA 5AC5A 9CGTA 2DT0A 2EO7A 1QW8A 1KGXA 4AD4A 2VO5A 2CIPA 4NZCA 1HKJA 5A6LA 2XYLA 3HU7A 2WLZA 1QOXA 1ODZA 2J78A 2W62A 4JKKA 3K8MA 4V27A 4DUVA 5A8QA 3B9DA 1QI5A 4U2YA 3UR8A 5GNYA 1OT2A 4AZGA 5A2AA 2WPGA 2YA0A 5HPOA 4UFHA 4AIEA 2PI6A 4NRRA 1TQTA 3VD9A 4UFMA 2F7RA 1V3KA 3CZSA 4HZ7A 3T2QA 3ZSSA 4F79A 2BHUA 2FYVA 2YFNA 2XSBA 5AYBA 3WD2A 4F9JA 1UR1A 4HTYA 1NM9A 3PTKA 3WF2A 3D51A 4GINA 5JIPA 3CPUA 3MSDA 3W0KA 2XIBA 4PCTA 2CKRA 3F5LA 1OD8A 1NQ6A 1EOMA 2BVDA 1UKTA 3UG5A 1BYBA 5HBFA 3GDBA 4BCEA 4AMCA 3BLKA 2WCAA 5HPCA 1GZJA 1UYQA 4S3KA 1VEMA 1ZB5A 3WELA 5E6YA 4UQDA 4UR9A 4ACZA 1UR9A 5AC4A 1Y7VA 3NSMA 4GI8A 4UZSA 1BGAA 1HTYA 3WNPA 3UCQA 2J7BA 4Z2IA 2ZUWA 3WQWA 4PUEA 4BZYA 1UD2A 2CYGA 4ZXOA 3FNDA 1FH8A 4WSJA 4NXSA 4M24A 4UOZA 4M1RA 1CYGA 1D3CA 3WDQA 1UQYA 2RGLA 4C7FA 1J01A 4MJ2A 4CN4A 5A95A 1R87A 1EHAA 3PZVA 3CV5A 2GFTA 3AMKA 3F5JA 1ZBCA 1U30A 1DHKA 1TFVA 4W86A 4NZJA 4GZIA 4WKHA 5GNZA 2GDVA 3NSXA 3N1AA 1TE1A 4B9ZA 1WZAA 1BG4A 1HL8A 1NH6A 1XD0A 3VDHA 3TTSA 1B3WA 1H5VA 1E4LA 1TA3A 4AYGA 2CERA 4PEEA 3RM8A 5A6MA 3ARYA 5JBEA 1WDRA 2J77A 1QNPA 2PBOA 3K8LA 3E1F1 4TVUA 5A8OA 3CZGA 3W24A 1MFUA 2ZXAA 2VOTA 1O7AA 1B0IA 4CN1A 3N04A 2O9OA 3WH7A 3NCOA 2VX7A 1OBAA 4X9YA 5I23A 3AHZA 1H11A 4RE2A 2D0GA 4PSRA 4UTFA 1FH7A 3A22A 4B3KA 1NP0A 3L4WA 2DGAA 1M53A 4TUFA 1FP8A 1ZL1A 1HN1A 1O7DC 2BVTA 2WVVA 1R33A 3OGSA 1HKMA 2WVUA 3WNLA 3A4AA 3L4UA 2A3HA 3AS2A 3VX1A 3LRMA 1C7TA 1K6AA 3W4RA 1NOFA 4WKAA 3FHAA 4NF7A 3CZLA 3DX1A 1CGUA 1J0YA 1UWQA 3SCPA 2Y2WA 1Q6GA 4YHEA 2D3LA 5E0CA 3BAYA
chains in the Genus database with same CATH superfamily
2QVIA 3PR2A 2CO3A 3TMQA 2VCOA 5T5FL 4EDXB 4LLAA 1ALDA 4QDWA 4E9VA 4LEXH 4K1GA 1DBBL 5H2BB 4A7UA 3TCXA 3OBKA 4GIYA 5M03A 5D71H 5KZ6A 1DVFA 1QZNA 4HUMB 4ISVA 4TVPE 1JPSH 2V2TB 3S6DA 2CR3A 1ZT4A 1S5TA 5A6JA 2JMRA 3P4LA 3B43A 4Z5RA 2C19A 3ZVHB 3OG6B 5JHDD 3GXDA 2A6NA 4WXZA 4M82A 4BHUI 3FU7B 3V9FA 1UB3A 3P81A 5D9OA 2FDBP 5SX5H 4CA4A 1SUHA 5IFJA 2WQXA 1A6VL 4NUJB 4DYEA 2ZP8A 1A25A 4I3RH 1FFOB 1W0WA 4FQXD 4WGVB 1CLOH 1TPXB 5HYEA 3QEQB 5LGJA 4C60A 1PO9A 2R2EB 4GRLC 2ZDRA 3EYVB 4N20A 4G8IB 1FWXA 3Q2VA 4JFEB 1A7RH 3BLOA 4X6EA 3CFUA 3ME0A 1ECYA 3O8XC 2IH9A 2QCDB 3CCHA 4I0PC 4AH2B 4U6HB 4QRTA 3NIGE 4Z7UA 3MRMA 3LY0A 3DX4A 1GC1C 3UF9A 1NAKH 1AODA 3PPCA 3RM9A 1PFCA 2DFAA 4BQ5A 1U6AH 3ZYJA 1IAIH 1LLWA 4YHLH 4JM2A 4MKTA 2GCYA 3HE7D 3GLZA 4Z7QE 2DU2A 2AQ3A 4HIPA 3NPUA 5L0QC 5LG6A 3P9MB 3BX7C 4LLDA 4Y2DC 1F76A 3O41A 3I3DA 1V3MA 4HV8B 4XZHA 3FGCA 4AB4A 3QIBC 3BOFA 4WO4B 1CX9A 4EOWH 3BUVA 1J9CT 5JA9A 2YMXH 4YHYC 2OMVA 4L9YA 3EDEA 1ZXQA 5KG9B 1VENA 1S3TC 2VXTL 1YG9A 4GSQA 2FR4B 4Z2HA 2Z31B 4DM2A 1ZT1A 2VDQL 3PJLA 5F7DA 3P69A 1FL5B 3MO7A 4G6AD 2HKHH 4Z7UE 3VFLA 1BBDH 5LVEA 2NVDA 5HNTA 2C7FA 1O1ZA 2HZGA 3QO0B 1S38A 3WLKX 1IBBA 3CFNA 3V52L 1T03L 4AZ8A 1HJVA 3ZVIA 4W1TA 1LE5B 1IC0A 1VZWA 1OB0A 4A6YL 4UFKA 2VR9A 1MVFA 1MCCA 3ZN6A 1BEXA 1J1OL 3GD1C 4GUHA 2YB1A 3OZLA 3LQZB 4ZENA 3W7OA 2VL5B 4GKZB 1S5WA 2I7OA 4FG2A 2FWLB 2WQPA 2G0WA 5D2LF 2OMZA 2NY6D 4X0KA 3UTOA 1ZUAX 2FQIA 2ARWA 4E2DA 1H7WA 1E27B 1UZ4A 4NPYB 1F1DA 1JWUA 1JXJA 4ZB5A 4BZ2L 3CK5A 4GUPA 4ZXBB 4HYTB 5BMFH 4IH3A 2D20A 1LNUB 1G87A 5FEXA 5FUZL 3WIIH 2R29A 5EMJA 2ZXCA 5B1JC 4F80A 4NGHH 2BSRA 4X6FB 4P8WA 3ABGA 2VELA 4PJXB 2GJ6A 3IXAB 4MYAA 3D39A 2W60B 1ZANH 2C5DC 5KSVB 1TV8A 1XCQB 3ECBA 1EFZA 3DC0A 3DHMA 3VWJD 2XWXA 3BKCH 3WO8A 3QM3A 1MI5B 4R0LB 1AO7D 2WXKA 2NNAB 3EO9H 4TTGA 3I50L 2J7CA 3CX5K 4BKLB 3SFKA 4HISA 4DIAA 2F8VA 4XXCC 4D3CL 5IK3A 1I7UA 1YEIH 2IG2H 4P23C 1P4BH 1P53A 1LG1A 3CO8A 4FP8L 3FT0A 2IXUA 2JJWA 3SAZA 2J6EH 1TKWA 3C5JB 3O6FB 1SO6A 3Q1SL 3OXSA 2GGJA 2NV9A 1HSAA 2QHAA 4JZNA 3NAAH 3K81A 2V7NB 1XLLA 1I7ZB 4NQCD 1HO1A 5IB3A 3MKKA 2D73A 4PJ9D 4PRRA 2GJ6E 2YQGA 4JFHE 4W9FC 4P04A 1UVQB 1UC5A 4FFZA 1F8IA 3SHSA 3IJEB 4GCAA 4XVSH 3N9GH 5J7CC 1E4MM 3OKNA 5L6YL 1BF2A 5KSAC 1IEQA 3BSZA 5AEAA 3L0GA 3APFA 2XWRA 4NN5B 1V6TA 1TVBB 3EO1B 3VXMA 1WDDA 3H8AA 2A9MH 5IHHA 3TEXA 5I3HA 2QS8A 3A13A 1FF5A 3RWIB 4IQLA 2X89D 3OAUL 4L8BA 2WHMA 3FUMA 2CK0H 4Y5YB 5H8PA 4OD2A 2QLVB 4B2DD 3BAXA 2CJUH 1HHGB 1J5OL 1B2WL 2V2XB 4JY4A 1KPRA 2E56A 2CLMA 2DJUA 4JFSA 1UP2A 3ERXA 4XX6A 5C0JA 1GS7A 3LD8B 3WUWB 3A67L 1B5TA 2NUYA 4DXVA 1EQCA 3S46A 1SOQA 2CRIA 3L3DA 2IANB 5J9PB 3HG0A 5JR1H 1O5KA 4AJWA 3ROLB 3WNKA 2NVCA 4AM0B 3MRIB 5JPNC 4OI7A 2J7EA 1A9BB 4R8WL 1NC4B 1R4XA 3OP2A 3GRWA 1XPGA 4NNPH 3ZTNH 1IBGL 4LW7A 2TMDA 5L88L 4PRNA 4RW5A 3L9RB 3LXCA 3WTWA 4HGWB 4KOBA 2EPKX 3LKQA 1ASOA 2R0ZH 5DHMC 2WM1A 3LZOA 1J5SA 2YPLA 2F54D 2D24A 2CHWA 3RUGA 2PLJA 3VAEA 4LS0A 4JRYD 4PY7B 3I2CL 5JNYB 1V6XA 4AXWA 3U0PA 2CKBA 2VSMB 1XIWD 2Q86B 1QBMH 2MCMA 3L5WA 2AJYL 5DHDA 2D22A 4LHJB 2OB3A 3GTHA 5REQA 2PPEA 2NLJB 2A7RA 1U8LB 4IW4C 4PCNA 3MRKA 5FGCE 4DP1X 1JNHA 1I8MB 1XLGA 1T0OA 4W6YB 3E2HB 1Q6CA 2ZKXA 2DN7A 4TF4A 2XPYA 4F7CB 4LVOB 4AX3A 4IQJA 1SZEA 4PLJD 4CGTA 3Q5TA 2V5LA 3RU6A 4JZOA 2E7FA 1E67A 2QJDA 3LS5H 3KVDD 2GGIA 3FS2A 1AD0B 4MDPA 4MZIA 3T3PE 5HHOA 1OP4A 3ZYOA 1JUFA 3MJ9H 3WJWA 1YNYA 2YPLE 1TTQA 5MKGA 2BVOB 1XXXA 2NX5A 3GHBL 3EOTL 3UIZA 4IG2A 2GTWA 5E8PB 1YUKB 1AZBA 4AU0A 4AMAA 3U36B 3K71A 3AW5A 3RPMA 3WK0A 3PDDA 3H2CA 2WQRA 2JIXB 3N2CA 5L2JA 2PDGA 3QW3A 3HIZA 1OAUH 1I3VA 3ULVD 5BOOA 4H00A 4FIRA 4LLWB 5KVFH 1I60A 5E1HB 1OAQH 2YUVA 2LLLA 4JFYA 2IH3A 4DX3A 4UT7H 4L7ZA 2IPJA 4PS3A 3QUMH 3E6FA 3DOHA 4TKWA 3MBXL 2J5WA 1Z9NA 4LVGA 1F56A 5HHQB 2Y2TA 1VPQA 2WJ5A 3WHE0 1BRLB 5A8NA 1T3FA 1H0GA 3WH9A 3DXIA 4JDZB 5IHZA 2YAOA 4KNSA 4YC2C 3L2LA 2FX7L 4AQ8A 4ZX6A 1XB6A 4DZBA 5T8GA 2W0FB 1WICA 3CN4A 5FGBA 5H35B 3I6RA 5DANA 3GDRA 5D7SH 4C6DA 4L3FA 1SZNA 4FE9A 4NT6B 3RX5A 2JKWA 1E4WL 2NW0A 3NFUA 2OKMA 3UROR 4PG2A 1A4CA 2KZWA 5KYWB 2YOCA 3B5GA 3E0WA 1EF3A 3G6LA 1WBYA 3H9SB 1EHKB 4OI9A 4APXB 3ULVH 4PRPD 3IDNA 3VMOA 1P5UA 3V6FA 1OSZA 1BFSA 3T04D 2GLKA 3KPSE 3F5KA 1IFGA 1E5BA 4JM4H 2VENA 2GQAA 1I8JA 4K3DL 1M41A 4TNVF 3QS3A 4Q7BA 2QQLL 7PTDA 2OMXB 5GGSA 2ZKYA 4PGBA 5C54A 3MV9D 3WK2A 4KQ0A 3RY6C 4IEFB 5BVPH 3D18A 3AWNA 3KOYA 5BRZE 6TIMA 1EXUA 4RIRA 3VRJA 2E9IA 3XISA 1JNEA 4AGPA 1U8KA 3IJ9A 3WLJA 3W7EA 2DTMH 4TUJA 3VVWA 1GJPA 3U3HA 2VFIA 3VM5A 4AD0A 4R4BA 1D2PA 4JPSA 3PAUA 5D1ZD 1XLKA 5E94B 2CPUA 2OT1A 3AAZB 4JE4B 4YHPB 2C71A 4RRPG 1KBPA 2Y5SA 3QMSA 4QYAA 3TW9A 3TUUA 1YJDC 1CFTA 4R2GD 5CC6A 4O02B 4FFYH 4LU5L 4NQVA 32C2B 1YDPB 4GAFB 2CLHA 5DN1A 3RIFF 3QB7C 2YXOA 1U21A 4YSEA 2VH5L 3A5FA 1WUEA 3JS3A 1WOAA 2HLAA 5KYNA 2D1ZA 2WB5A 1JV5A 1W3JA 5L8LB 2VZVA 1O9ZA 2B1OA 4Q6XA 1ICTA 1EBAA 3MVSA 5IHUL 5C86A 2VX5A 5L2KB 5HHNB 1T5WB 2ZUQB 4OFVA 3CH9A 5GJNA 4P8QA 2X9YA 4Z17A 2FB4H 3SUVA 2C18A 2ZDSA 5EH1A 3W7KA 4HYRA 3TZVD 4KBXA 5L8KB 3BTNA 2P8MB 2IH1B 4WSGA 3A4EA 3ATBA 5ALBL 1BFTA 1OCQA 4BCZA 3CVBA 2Z0BA 2LFGA 1F7BA 2R0WL 1S78D 4RZ6A 4JAMA 3RIKA 2PRHA 4WJXA 3VACA 5KJRL 1SZFA 4NNYB 1G67A 4QCIA 2RFXA 2AJXL 1TKKA 2HFTA 1FFNB 1US2A 1RZJC 5CJXA 1BLIA 2Z91B 3WYZA 4XP6L 1ZIBA 1ZY9A 3PZIA 4DLFA 1JUEA 3X1FA 3SCMB 1J4EA 3NZQA 4NG3A 2A6IA 2VR8A 4XD5A 1LWHA 4HIXL 2UZ9A 1HNYA 3Q5OA 3RI5K 3X2QB 4IGHA 5JBDA 2EC9T 4MCZB 2YL6A 4P0DA 5FKPA 1TTIA 4PGEB 1H8SA 1UMYA 4EVNB 4WFHE 1BQGA 1S7QA 3M1OA 1W8EA 1X7TA 4MMZA 3UWVA 1J12A 1GS8A 4UB9A 3FCTB 3AYRA 4ZGYA 4KQ4H 3HFML 4G2AA 4WWKB 4LNCA 3RDKA 1TPXC 2CNCA 3B7UX 3INPA 5SWQB 4XBSA 2VR3A 2YD0A 4YDJB 3PJTA 5ECGA 4FKHA 4O2FA 3VXPA 1JPFA 3LCIA 3OZ9L 3RFZA 4W6XB 2OJZL 2J71A 1TQVA 4TSAL 4BR1A 1VHPA 4OFPA 5C9KA 2WAGA 4N2MA 2XJ7A 3KBNA 1W3HA 2QQKH 1EXPA 2TAAA 4OH2A 1MPAL 3O45A 1GOWA 3SKOA 1ONEA 4P9ML 4XRCB 1XMWA 3C08H 2WNNA 3X3FH 5I6OA 3QKZA 2WXPA 2V2WA 3F7VA 1NMCB 4W7UA 1ZRUA 4JFXA 5GZNA 2G30A 2X3BA 3C6SB 1K4HA 5EEUA 4HNLA 4HCHA 4FQQB 3U4EB 4FJ6A 4E41A 3W76A 2XFFA 4WO4C 3U7WH 3D0LB 1I85C 4NLAA 3AIEA 4PTMA 4M0XA 4ZNCD 3BI9X 2UXFA 3FB5A 2Z31C 4LAKA 3CB8A 1MZYA 3CG8A 2ZRVA 2R7EB 4GRWF 4UUJB 4PRID 5EBUA 3RAOA 1ICSA 2WXGA 3HNSL 5T8IA 2B59A 3DGGB 1KJ2H 1S5IH 4QRQA 4B5TA 2Y3AA 4RE3A 3QPKA 1G6RB 5HDRA 3VXQA 2RCSH 5TDOB 1K8DA 2X1XR 1US3A 1XC6A 4HKPA 2CD0A 1VPXA 1XSKA 1JR1A 3FOLB 3L9YA 3P73B 4JRXB 1DJHA 4F33B 3ZLFA 4ZNEE 5C09A 3JXAA 4LVNB 1AHKA 2OEJA 2YBGA 1AQ0A 1E50A 4X8JB 3RU8L 3KHJA 3OAYK 3QO1A 2VRKA 3T8MA 4J7RA 2C9UA 2YCLA 4NM8L 3NFSL 3H7BA 1W5NA 4LOUD 4GRLA 4AUYA 2EE9A 1AFSA 3CV6A 3R8HA 1EEZA 3QPXH 5MP6H 4R26L 5IREA 3VSUA 1VRXA 5F88B 2YWZA 1U58B 1T2JA 3C5ZB 2OR9H 1BX2A 4K8GA 2OMNA 2ADIA 4Z7IA 2J9XA 2R0LL 3EWXA 3MS8A 5KANG 2CBVA 3EWYA 1PY0A 3WBDA 4QNPE 4ZXBC 5IMOA 1J0IA 2YD2A 3AXLB 1AQKL 4X6BA 5AOIA 2XHYA 1AI1L 1WZ1H 3PFQA 3ZE2F 4Y2DA 2FEDD 1RHHA 3EUUA 3HHRB 3IFOA 5C09E 1MQKL 4NZFA 1OZTG 4C5YA 1BFOA 5IF0B 1LRNA 1N9PA 1SBSL 3QIBA 3LCYA 2LFEA 5JDSB 1MO0A 4WDWA 1EFXB 2OA9A 3V75A 1BREA 1HXKA 2P3YA 4R0LC 4CSPA 5CZXC 2E68A 1ET5A 4ZUWA 4GBUA 1L9WA 2XN9A 4I7UA 5CPOA 5ICYB 4M1GH 4YJ5A 2K0RA 1H0DB 5J1AA 1OHLA 5BWAA 1NIAA 4ALAH 1P7QD 5IWLA 4WY7L 3A6BH 3LKRB 3SE3C 4RPQA 1SRDA 4MM1A 2DZBA 4J2MA 5FEZA 4PJBE 5GNYA 2WYIA 3P9LB 3RX4A 3O6FC 4CMMA 4AZGA 1RIUH 1IBHA 4HK0A 2VFHA 2WBJB 3BDXA 2VLRD 4OD3L 3P4NB 2BINA 3MGOA 1MCLA 3MV8A 4NWUH 2ODIA 3QRBA 4LFHG 1NGZB 4DGYL 4MAUH 2EDXA 3VFNA 3TM6A 1VRSA 4K1WA 1XINA 5FF0A 2OMYB 4ANVA 4MXQD 3M0YA 3TBVA 3UCQA 3RG6A 1TYGA 2HTLC 2CYGA 4NN5C 3FNDA 4PJEA 4O18A 2DM3A 4M1RA 4B60A 1H7NA 1EXGA 2XN9E 1KV7A 3TT3L 4I5UA 5EWIL 4JFOA 1TCDA 2W9EH 1PTGA 4Y5YC 2GFTA 3HPFA 3NSCA 1RJLB 1YN7B 1DQMH 5KYYA 3LNPA 2VGLM 2H6OA 3V5DB 4HZ1A 1E4LA 4GXFA 5B1JA 3LD8C 3W2MA 4HUWB 1QNPA 3CPLA 4Z9KB 2EIDA 5F9DC 2VDLL 5GZOC 2BSTA 2MQ0A 3O11B 4I2XE 2AMUA 4YXGA 1S39A 4CNPA 5DK2A 3BV4A 3LQAH 4OCWH 1RK7A 1NP0A 1M53A 2CDGA 4XGZB 4KK5C 4CC1A 2BC4A 3ARFB 4ZS7H 4G80B 1E0UA 1TIUA 5D9SA 5IVXA 2WVVA 1HKMA 2G60L 1K8CA 3WNLA 2J1XA 3BESR 4PJCF 1C7TA 2W1NA 4XBPB 3G1HA 1UTDA 4PJEE 1Q6GA 3OF6A 4NNBA 9PCYA 3N0AA 1TIWA 4XXCA 2DI8A 4AJ0A 5HJBA 4ECNA 4P23A 4DP0X 4LLMB 2WZPD 2P5WA 4WHTA 3FB8A 1DN2A 4RPPA 2GPTA 5LYRA 5E8EB 1JWMB 3WF1A 4UNIA 3BRDA 2I27N 3EOAB 4RZ5A 4MKSA 3RVUD 4MD0A 4F58L 4X3ZA 2RACA 4LPVA 4LSBA 5EBWB 2HNHA 4Q8WA 1QBAA 3GIZH 1QSFB 5LBSL 2QEZA 3U1SL 1GL4B 4JJOA 3P0VL 2E27H 2TSBA 3B06A 5EF1A 2NXZD 1M9HA 5KTEL 5FKAA 5DEJA 3T42A 1NIDA 5KYUB 1C08A 4KPHH 2ID5A 5HYIA 4M6QA 3BVUA 5KSAA 2BWDA 5BOFA 3E2HC 3O06A 4X8GA 3K91A 4LVOC 4KZ0A 4ZS6D 2BVQA 5HHPB 3FYIB 1W16A 3FVDA 3W23A 3UAAA 4HSAC 4PW3A 4PBXA 1RZKC 2A0LD 1FZMB 5CILH 2DSKA 4NWTH 1QSZA 2D8KA 4Z08A 5KS9B 3RVVD 5IW1B 2GDUA 3OO2A 3S8GB 2NV2A 3MUY1 3GSUB 2LVCA 3UJRA 4IOFC 4FA8A 5C3IA 2WJ7A 2QVKA 4Z7VA 3C8DA 4ZFMA 2PZ0A 2PTTB 4WUUA 2RBLA 4HCIA 2GGGA 4XBGB 4TRPL 2V3FA 5M3WA 5E99H 2ZWYA 1E9PB 5I17A 4P2QE 5JPNA 4TPRL 2TPSA 3MO4A 3VOJA 4DEPB 2ICWA 2UWEE 2WHLA 3ZKNC 1F2JA 3ROOB 4JZJB 1ZPTA 1EL3A 1A6TA 4OKVB 3W9EB 2ZRZA 1BKSA 4OIIH 5IVZA 5ACMA 5DJAB 3X14B 1KENL 4YDMA 2QIWA 3WUWG 3WD0A 3O3AB 3MNZB 5CJQH 2XY1A 2WLLA 1KTLB 1KD0A 4HA1A 2I5IA 1WAWA 4MJ6A 3UTSB 3H1ZA 2AQSA 2OSLA 5I1GL 2WGNB 1DE4A 2WHJA 1FNFA 3O05A 3G8RA 1WEJH 1OJXA 2REQB 3CDZA 1OAXH 4YSTA 4P2RB 5D9PA 2GHZA 4IUGA 2VDNH 4WUUE 3QUZB 2BP8B 4QY8B 5GHWL 1DBAH 2ZE3A 1A5FH 3OPZL 1J2BA 4O51A 3S34H 1LO4L 2F7OA 4IBUA 3P40A 4YHYB 2FPYA 2Y0SA 3TC3A 3W07A 4XO9A 1TLKA 3WV0A 5C9JA 3VIHA 4FL4B 2PWVA 3MLTB 5H94B 5HMSA 1ZCCA 4YSRA 3WLIA 5FDYA 4RBPH 4ORGA 3ZR4A 5DMGC 1ONWA 1IKNC 4TQIA 5LIYX 5HYJE 1VD6A 4HJJL 3T2LA 1C91A 4AZCA 3CHDA 4NUPA 3MJ7B 5ACZB 4UT9L 1EGJA 4MDIA 1UKSA 3UPBA 2X70B 4JPVL 1RZ8A 4BQ3A 2E9WA 1L7TL 4KJYB 3SR7A 5J6SA 5CM1A 3CZKA 3KWVA 5LGHL 1LL7A 5D5ME 4A2MA 5LCVH 4HMCA 4R5TA 3AIWA 4ONFL 4WWPA 1FVEB 1F8TL 4OGZA 1JAEA 1M1XB 1HL4A 4ETQB 5H2ZA 1OSPL 1WFNA 3RMJA 3G08B 3TC6A 3ZSTA 4TM9A 1RUQL 4HQQH 1B4LA 4GQPH 1ZBKA 1AGEA 1J8HE 2E4TA 1WP6A 1FZKA 4K0OA 4YDKH 2ETWA 2GYIA 1ZE3C 1UFGA 3HA0A 3TO4D 3FYOA 3ZDXB 1SXCA 4ZUVB 5A6BA 3GI8L 2Y5EA 3IGLA 5AKRA 2GK1A 3MY9A 3VFUA 4LSTL 2MSPA 2CHXA 4F20A 1TLMA 2VDQB 3BFWA 2ZUQC 1E6SM 1JZIA 3TQPA 2YBVA 1BM7A 3SOTA 3V0FA 3E74A 3N3EA 3OMIB 3NIFB 3W75A 1H1YA 3WY2A 3CC5A 4MVBC 1I7RA 5GGRA 3S3DB 4IHOA 4APQB 4G9DB 1A0QH 1OX4A 1NCHA 3DVNA 2YPVL 4D6GA 3QUKB 2Q6WA 4OOUA 4WGWB 2VAJA 3MOBH 2H7WA 5DS2A 1OG0A 4HCGA 3IKKA 3VFTB 4AYFA 5A3HA 4F91B 1IGWA 2Q3XA 2E3ZA 2BOLA 2DWSA 3O2DL 1QD0A 4NNAA 4QXGL 3MJ6A 3RVTC 4HCFA 4FADA 2W38A 2BWIA 1MXDA 3WJMA 4WEBH 3ZT6A 3SCMC 1IL1B 2X6UA 3EX2A 3LMJL 2GJJA 1LUCB 5FUOL 1WUFA 2DYSB 2X1QA 5IB1B 1FTXA 1M05A 1OYBA 3AG3B 3DEQA 3ATAA 3E3QE 4WY0A 2K7PA 2P10A 1WUZA 2Y5JA 1Z6JT 3UTPE 2R83A 4DN1A 1I8AA 4WWKC 3TXZA 4CD4A 1H3VA 1HC1A 2BNRE 1MEIA 5MEOA 2CHNA 3CFBB 3OGCA 4YVVA 3FUDA 1IC1A 3B3DA 3ZYIA 3UC2A 1Q13A 4CSTA 1W5QA 2JQZA 4DP5X 1YEHH 4EO5A 1GW1A 2CWRA 4G6MH 3MLYH 4WKZB 1NBYA 3G0UA 3M5XA 3PZOA 3GZ3A 3WLRA 1IIIA 3MACL 2FVLA 3IYLW 4P9HH 1RXOB 3PVFA 1XGDA 3VU2A 4M03A 2KLTA 2Q8AL 4BSVA 3CSYB 4XKMA 4YBQC 4M3JA 1NMCC 3DXAB 5FW8A 2YCJA 5IR1A 5HDBE 5FO8A 1CE1H 5SWZE 3REVB 3AXHA 1EQWA 5I6LA 2HT4C 4PJ8C 4Q2ZB 5AW0B 3HW7A 4EDXA 2WYZA 2I26N 1E1EA 5IFPA 2G95A 1GCYA 4LSQL 2CWXA 4KY1L 2L7QA 5H2BA 4JKPH 1UJPA 2QKIB 1K3UA 2UX6A 4NJGA 4IICA 5D2XA 1XTMA 3SCTA 5IMLB 3HB9A 3QHTC 3M46A 3MTRA 1C5BH 1VESA 2VRQA 5AC8A 4FQLH 1CE6B 3HI1A 4R9OA 4JUSA 2MPAL 4WD0A 4E2OA 4YNYB 3WLNA 3FU7A 5I1AA 2QHRL 4ODHL 3VUAA 2E6YA 9XIAA 1NMAL 2IGLA 5B8CB 2MH4A 1G5AA 3EPMA 3PG2A 1QTYT 4NRYB 4NUJA 3UAJD 1L8PA 4Q89A 5IQOA 3WTVA 3S42A 2A3LA 4K8HA 2X0HA 1FFOA 4LVNC 8TIMA 1DCLA 3K6DA 5ELIA 4PGDB 3QEQA 1X7QB 3QZWB 2R2EA 1UKPA 3UZYA 3OL2A 3EYVA 4URTB 4G8IA 3GH4A 4DPAX 4XMZA 1QFWH 4PTUB 4JFEA 3IFNH 1L9SA 3R1ZA 3C5ZC 4LB8A 1UH4A 4DPQA 2QCDA 3AWGA 3DK0A 4AH2A 2ATAA 4GD0A 1JPEA 4U6HA 3EOYG 1IILE 1SOKA 4ZTOL 3F4NA 5KN5B 1KXVC 2QVNA 4IIFA 2ZQKA 3MTWA 3S2JA 4AUJA 3QDJB 4M4PA 1FZOB 1I9JL 4CQDA 1AMYA 3DHUA 3OJDA 4XP9L 1RQHA 2A5HA 1XYFA 3IETB 4E9WA 2O30A 2VLKD 5F3BA 4CNNA 2WWNA 1WDWA 4HV8A 4HGMA 3QEQE 4WO4A 1Q0YH 1OZUA 1CLYL 3BGGA 1QW9A 1I85A 3TJ4A 5I76B 3F6IA 2G3XA 3FT3B 5KG9A 1IE5A 1E1FA 3AHXA 2O6FA 2FR4A 2Z31A 2Y7LA 1C93A 5BU9A 5BMXA 1CFMA 1X9LA 5EA0H 5I0XA 3ZHDA 1FL5A 5FJIA 1TUXA 3LRLA 1BFNA 1CB2A 1P2CB 3ARUA 5FV2A 4NIKB 4YL2A 3QO0A 4OKDA 4OQTA 1A5OC 2QCLA 4OLZL 3SPCA 1LE5A 2WBJC 1UADC 2DP3A 1NCCL 4YHIB 1AJ7L 1OCWL 1E6JL 4AC2A 4YXLL 3BKML 3NDZA 1DBMH 3OLEA 2CGZA 4AVHA 1E6NA 3WFAA 1OALA 2XX1A 3W83A 2NXYC 4L3EB 1RKRA 2VL5A 4GKZA 3MHZA 1XRFA 3SQSA 2PR4L 3M1ZA 1V10A 3RVXD 4ERIA 2VC2B 3KPRB 2HUEA 4AWEA 4ODTL 1E27A 4JG0H 4NPYA 1XIDA 5DUJA 3POCA 4TVSa 5FUCE 3FH8A 2DQTH 3MCG1 4LAUA 5I1IH 1PYWB 4PMJA 1LNUA 4A7GF 3K1KC 3QZBA 5TAOA 2WO4A 3KNBB 5BOPA 1MCOH 4FI7A 4JKLA 3RHWK 1YNPA 4M7JH 4X6FA 4P8VA 4B5ZA 4C56B 1XF0A 3FIGA 3IXAA 2ZSVA 2EXYD 2W60A 1JSYA 5KSVA 3NDZE 5DUPL 2E7BA 5T3ZL 4DI8A 3LI1A 1XCQA 3QARA 1V8EA 2I07B 2BPBA 5DD1H 3ARFC 1MI5A 4R0LA 4YDLB 5INDB 1AY1H 1HH6B 1OAZH 2NNAA 2DT1A 3N0PB 1LK2B 1OGAE 4BKLA 3ESUF 1CLXA 4FG4A 5I24A 1NL0L 1JGVL 1HIML 1CDUA 3SE3A 3WDPP 5I6SA 2WWCA 3C5JA 4IJ3B 2CC0A 3KDOA 5KOVC 3T0EB 3PBMA 1X4YA 3G1XA 1EDHA 2XNAB 3EOBB 4H1ZA 4ZW8A 3WH8A 2EH7L 2UY3A 5FJRA 4GJ1A 1TR7A 3PJSB 1I7ZA 4WWOA 3LBCA 1V02A 1RJQA 1G9NL 1KIUB 4XNXL 1CGSH 2FYYB 1UVQA 1LP9E 4QHMB 3IJEA 5CJMA 2XI9A 3LDBB 4F8QA 4LKXB 4AEFA 1F1AA 2XFGB 4XR8C 3B8IA 3UPWA 2BP1A 3V0UA 5D6DC 4PLKD 2BY2A 1TVBA 4Y2NA 3EO1A 1T96A 3BANA 4D71A 4ICXA 1RUPH 2PNDA 1UENA 2J8FA 3IJ8A 3PWUA 3FJ6A 4Y5YA 5KVGE 4Z0BH 1GK8A 2ZNXA 5HK4A 1HHGA 4P4KA 3M8OL 1SZRA 2V2XA 3B0VC 4D94A 3GAYA 4XNAA 2ZXWB 1TUPA 4MB1A 3WUWA 4ADJA 2PDJA 4GY7A 3GAKA 2PDYA 4UTBH 2VXSL 2X40A 3KLSA 2IANA 5J9PA 4AYBA 3AHTA 1QDSA 4AXNA 1MCPL 2P76A 3QOMA 3NQBA 1TFHA 4LIQE 5JA8B 4AM0A 3MRIA 4JTDA 1FGVH 1HWWA 4AZIA 1UROA 1A9BA 2KYIA 1NC4A 5B1CA 4DEPC 4IKIA 3WFCL 2B4CH 2EEAA 1UT2A 5BXPA 5DJDB 2PDMA 3I9GL 2LAGB 3WY3A 5GSRB 4JZJC 4AMKL 3INUH 4P7OA 2HPTA 1NC2D 3L9RA 4MMXB 4HGWA 2EO9A 1JHTB 1QHOA 2OMUB 5E8OA 4C4KO 1OG6A 1N64H 3HRPA 1QTWA 3BE1L 4PS4H 4ZPTB 1GH7A 1ZEAL 2H3XC 4PY7A 4NASA 1DP0A 2OR7A 4KI5E 3O6ML 2JWYA 5JNYA 4JMXA 1ZAGA 5FSEC 5AAMC 2Q86A 2PDXA 3D52A 2IANE 1QW7A 3M7SA 4DOHB 2HE5A 1QHQA 1YNKH 1GHRA 4BFBD 3QUZC 3IMSA 2JELH 3R7QA 1M3IA 5LZLA 2NLJA 4QTIH 4WFFD 1U8LA 4YHZH 2UVEA 1I8MA 4A37A 4HU8A 1KTKE 2J55A 1J96A 1CT8A 2Y6SC 1A4LA 4F7CA 3JUGA 1V0LA 1PD6A 4FL4C 5DD3L 3TJHC 5AFAA 5T33L 1EDGA 4QHKI 4QT5B 1R0AH 1XIHA 4JRFA 3IMRA 3M41A 3CNYA 1RLDA 4EAEA 4EIUA 5DZJA 1J2WA 1E4XI 2BVOA 4P49A 1H60A 3SZ6A 5E8PA 2PW2B 3LEVL 2NYYC 5L4MA 1WHPA 3B8TA 4LPUA 3GSRB 3U36A 1X98A 2HK1A 5EF0A 1TTCA 2ENJA 5L4JA 3E9TA 2JIXA 4DBEA 4IM4A 3UZEC 4KZEH 3G1SA 2HZHA 1ZBWA 3NGJA 5G5DB 4XMLH 4LLWA 3L2NA 1PLBA 1FXQA 3B8UA 3F4DA 3H4FA 5I8CB 4XB7A 3L2IA 4FQJH 1IO4C 1KKRA 1TZGH 4I1RA 4J9JA 2XUWA 1SJVA 2R4RH 4H9ZA 4LOFA 5IBXA 4XMXA 4Y16D 4RZKA 5SX4I 5IROD 1BRLA 1F4YL 3V0WH 3RX8A 3I6GB 4KEUA 4FABH 4JDZA 3MSRA 1INDH 1RLWA 1UWEL 3JVAA 4KT2A 3G3LA 1QNOA 4FXSA 2PXYB 3OR7A 1SJXA 5H35A 1P4CA 4OFQA 2DKMA 3GVVA 5FB8B 3GZAA 2Z8SA 4NT6A 5A3IC 4NKIL 4ONGH 1GHSA 1XC4A 5L7XL 3QJZA 2D31B 3W7DA 1QWGA 2YHGA 2X4UB 4Q8PA 3KJ4B 4YWIA 1RBAA 5KYWA 3QR1A 4BFNA 3D6NA 5ICXB 3OEXA 4H1LA 2FK9A 2YRBA 4PBEA 1NOLA 4UTLA 2HT3D 3H9SA 2ENQA 3ZTCC 4APXA 4D0BB 5HPOA 1TJGL 4UFHA 1PMYA 5BOEA 4JXCA 4APQC 2NCEA 4PP1C 3IJHB 1PXGA 5HDQH 1TPWA 2OMXA 1FYTB 4B27A 1D3HA 2XIBA 3VNJA 1OD8A 5DMIH 3SY0B 1UT1A 5HBFA 1PG7X 3NZ8B 1IKNA 4XCNB 4IEFA 3U2JA 3WELA 4JTUA 1KFLA 4NHVA 3KBEA 1RPXA 2Z7GA 4M24A 1V7NH 4LYKA 1X7SA 1MJUH 1KC7A 4L1SA 4Z23A 1JRHH 1F3TA 2XRAL 1ETB1 4C7FA 1ONXA 4PWJA 1FNLA 4E4UA 3H7LA 3D39E 1YPZB 4KWVA 3N50A 3OKEB 4DZ8B 5E94A 1EAOA 5EU5B 3AAZA 4OLWH 4YHPA 2XBDA 1MFUA 4GMEA 3N04A 5EMMA 3QEGL 1CZ8L 5AL0A 4O02A 5M2FX 5CD3B 2WTOA 32C2A 2QSCL 2XZ9A 1GGIH 2CLLA 1GZGA 1A7NL 1K8IB 1Y1UA 3KRZA 2LLEA 4US5D 5IMKB 4OV4A 4MFHA 4E9RA 2P46B 3T0XA 3ZRCC 5E2WL 4WQ6A 4YZFE 4XPFH 2C4FT 4NF7A 3QN3A 3QFDB 1JTTA 2YPKB 5ISZD 2NSMA 1KM5A 4AXKA 5HHNA 1SFHA 1T5WA 2G2NA 1GVIA 4NRZB 3CL6A 3BHBB 2CBMA 1GOGA 2V67A 1IBFA 3D25B 3M17B 3QDGB 1W1IE 5DJ6B 4XMKL 2IBZY 4C4UA 2P8MA 3NZHL 2R1WB 2EH8L 3H2NA 4OF7A 3BPWA 3GHEH 2P8PB 1NKGA 4XO3A 1HJCA 4OCXH 4OUUB 4KC3B 3VXME 4M02A 3U2SB 2WW8A 4G1EB 2CK2A 4HPJA 4NNYA 2QKIC 3LSBA 3IM1A 3M7FB 1G7LB 2QCCA 3PB2A 1FFNA 1AW5A 2VISB 3ENEA 1KYAA 4BS0A 2Z91A 4DELA 5IDZA 4XN9A 3W9ZA 5DFTA 2HT2D 5CSYA 3SCMA 4EQ3A 2QFRA 2Y7OA 4XBEL 2A9AA 3THQA 5CEZE 4W9JC 2BFVH 4MCZA 3LSCA 2QGHA 1U3HA 5KBMA 5B8CC 2P8BA 3HUJB 4H8QA 4W89A 4JG1H 3BPOB 4PGEA 3OJVC 4EVNA 1AJ2A 2BASA 4KX8A 3RWDB 2DIBA 5XINA 3AMLA 5MERB 3IJ6A 4TMPA 3FCTA 2AL1A 4JNYA 4O2CB 4WWKA 1WKEA 4QOKB 1YY8B 3RN6A 4KWSA 3GG0A 2PYFB 3IJYB 4YDJA 3BGFC 3AALA 2VDLB 2R69L 3QZMA 3NCWA 3ESOA 5CZKA 5AW2B 4G9FB 3QXUA 3GPSA 1WIUA 3BLEA 3RUGE 4AK2A 3TL5A 5T1KD 2FMNA 3OLIA 1E6OL 5J8OA 1EGMA 3ZO9A 4D9LL 3MSPA 3DARA 3LENA 2PD5A 1S7UB 4AW7A 4F57L 3CFEA 3HE6A 3ORWA 5CR8A 3SPHA 3GYEA 3FQNB 3QJOA 2DUZA 5FYLE 3C6SA 5I15L 1MHPH 4FQQA 3U2OA 3U4EA 2I5YL 3ZOAA 4CVWA 3DZ1A 3BQVA 3D0LA 1SJHB 2AJVL 4RCAA 4J12A 5CJOH 5JQ6H 3S2CA 2VWTA 3RITA 1JZGA 4F1SA 5F7KC 5HHOE 4HSCX 2AMGA 4RLDA 6A3HA 2NX5E 4UUJA 2O6EA 2GSEA 2HKFH 2AQTA 5IQLA 1NWRA 1ACZA 2EG8A 3GG8A 2PCEA 1IGML 4JFUA 4W5ZA 3KDMB 4F8TA 3QPEA 1G6RA 5D4IA 5GNXA 2IOOA 4CKQA 2W65B 2J4GA 2A9NL 5TPWH 3UXAA 1F07A 5TDOA 4UMAA 1QBBA 3FA4A 3IS1X 3FOLA 1BTCA 3A4WA 3P73A 4JRXA 2D0HA 4F33A 4MJZA 4P3WA 2Q0ZX 2FGBA 4UTHA 1BQ5A 1UM6H 2PKDA 1OAYH 5E8DH 5CEYB 4X8JA 2QLYA 5E6ZA 1PVNA 8RUCA 3KL5A 5KOMC 4MHBA 3VILA 2BY3A 4M7ZB 3RCMA 1IAIM 3HF3A 3W2LA 2OSWA 5G1YA 4O14A 5AB9A 1JXGA 1A1MB 4N28A 5D7KE 2BNQB 3B9EA 1FNGB 2P1YA 5TTRA 1NJJA 1DANU 5F88A 1F4AA 1U58A 3C5ZA 2VQTA 3VIFA 2R1MA 4KKZA 5B80A 4F27A 3VGFA 3T07A 1EEQA 1XBZA 2VR6A 3LKSB 4QGCA 2X2IA 1KXVA 2DBLH 3MUCA 4S3EA 4XWOD 4PC8A 5BRPA 1XV8A 1QSED 4UQCA 1EP2A 3AXLA 4ODVH 1SN2A 2Q8BH 2OU4A 3N12A 4PRDA 5D8JL 4OJDH 3QZWG 4PMNA 3TLRA 1EH9A 3U0HA 5IF0A 1SGJA 4MIMA 4QNEA 5E6RB 3R8BB 5JDSA 1W1YA 4QR6A 1EFXA 3DRTA 1GONA 3JR2A 1ZVHA 3X11B 4YDLC 1X1OA 3QR2A 5AYYA 3RWFB 2X3CA 3B1UA 5HHMB 5JVLA 5FAAA 2AZUA 4ZMLA 2FQFA 5DURD 3FW6A 1EO8H 1GYAA 4RW3A 5ICYA 3LPGA 3I6KA 3KYKH 1O60A 4A68A 4JR9L 3RRXA 2FT8A 1H0DA 3C3UA 3PABB 4N2YA 4KFNA 4FI8A 3LKRA 2W0UA 5BPPA 2PWHA 4IJ3C 3P9LA 5KSUA 2G3JA 4EBQH 3T0EC 2WKGA 1PTZA 1LO0L 2WBJA 5FDWB 1P6BA 1WXZA 3P4NA 3QG7H 2XWJB 5I19L 4E8GA 1WCQA 2CDFB 1NGZA 4XAGA 1PD0A 4IBWA 2J8GA 5DVMA 3MA9L 3T0AA 1GAFH 3LDBC 5DO2D 3OVQA 1MFBH 2OMYA 3TPKA 3KLLA 4RDVA 4OY9A 3TH2T 3UD6A 2HFGH 2EDTA 5DI8B 3MSGA 4JRWA 2Y1AA 3ZTJH 5DT7A 2KPNA 3IV3A 4FOKA 3R25A 3WTSA 2EKGA 1V6YA 1RJLA 1YN7A 1S2TA 3AMGA 3ULVF 5T5NF 3E2VA 1H7XA 4LSPL 1IGFH 1AGFB 1IM9D 2E9LA 5IY5B 4MZYA 4HUWA 3D9AH 3ZPDA 1DQVA 4NCDA 3BZGA 1OD7A 2YSWA 4KV5F 3O11A 2DM7A 3NUKA 1HZLA 4Q9QL 3B9KC 4LCIH 3TWYA 1JMZA 2BSSB 4DO4A 4KCVA 5L4FA 5C9XA 2N1KA 2VYOA 3KOFA 4OM0L 3IGHX 1LBFA 4XGZA 4WJ8A 3S5LG 3ARFA 2X2GA 4G80A 4WI3A 3T5WA 3KXFB 1NBVH 3CV1A 4JFFD 4XBPA 3BIBX 1XHGA 4Z42C 1OHZA 2FWOB 3UEZA 5J6GB 1C8YA 1KACB 1UD6A 4MMXC 3LRKA 5I1CL 3VCRA 3HCVB 4LLMA 4S39A 2I17A 4U6VH 2GSHA 5FWRA 3ZDZF 3B9OA 1UWSA 2TYSA 1X1NA 5AVWB 1OEZW 5E8EA 1UPPA 2HV5A 1J1PH 4LCWA 3EOAA 2XOTA 3DO4A 5ESVA 4UM9D 1ZNNA 3ZT5A 1EAQA 1AQDB 5E08H 4ENED 2CNZA 2LLGA 5EBWA 1N6QL 1QSFA 2X88A 4OBRA 2DW7A 1J7VR 1A6WL 5KSBB 1ZLWH 5CJ8A 5KYUA 4HFWB 4PJ8B 1Q5MA 1J0HA 2OTWB 3AMDA 1ETZB 3U9PL 3CXHK 5D6DA 1A6UL 4P5RA 1QZ1A 5E00B 1WAPA 3V6OC 1S7VA 4DKTA 4GKTA 5EULV 5HHPA 2VXUL 1SUXA 1XAUA 2BHZA 1KQYA 1BMWA 1FZMA 5KZCD 4R4FH 1JCJA 2DIEA 4IRZH 3W1MA 5IW1A 1V77A 1NEUA 4GHRA 4U0RB 4H4IA 4LCWE 1MW3A 1POKA 3GSUA 5I5RA 2E8ZA 3B8VA 1VGKB 3F2CA 4EAMA 1EVUA 4J2XA 1QRKA 4LGSB 2LAAA 3CH1B 3A5VA 4XBGA 2YD5A 1E9PA 3BWSA 1A3QA 4E41E 3FCPA 3W86A 5GS0D 4QLLA 1K72A 1W9PA 1FAKT 4JZJA 4OKVA 3W9EA 4RJEA 2DZTA 2Q76B 4N2LA 4Y2LA 5DJAA 3LU2A 3X14A 3ZU8A 3O8XA 4DN3L 1LOQA 1GTHA 4I0PA 4AISA 3O3AA 2W80C 3MNZA 1YYML 3BGAA 2PXYC 5ABGA 1F11B 3UTSA 2P5PA 2O72A 1LO3H 2NWRA 2EUZA 5GGVY 1ZCRA 2VKXA 5AG9A 2REQA 4OHQA 1BJ8A 5AAMA 4AE0A 3MRHB 4P2RA 4I4WB 3KMDA 3QUZA 3KJ4C 4F0MA 5D38A 2BK8A 2BP8A 4I1NB 4LQ1A 2HRWA 3ES8A 4AVFA 2XWEA 4HBKA 2Z2BA 2B14A 2OXNA 2GZXA 1YUHB 3TA4D 4F2UA 3GNMH 2PWDA 3CGTA 5GS0H 3NVDA 5H94A 3QUYD 1JGEB 1DTNA 4QRFA 1O5XA 3SI9A 1YZZA 2O4MA 2ZKHH 2JGQA 1G7JA 1F18A 4DRSA 1P4UA 3QUGA 2W9MA 2EUVA 1R7AA 4CU8A 1TJIL 5ACZA 4NAEB 4Q3MA 2WW5A 2YLKA 5GRXG 1AW2A 3UZEA 2X70A 3VD4A 4AG4L 3C56A 3CAWA 3MC0A 1WFOA 4GC4A 4JDTH 4XNBA 2Q01A 4KJYA 5D96B 5DY2A 3X1NA 4QHKJ 4KXAA 5DMKB 4RNIA 1Z3GH 1QBLH 2F84A 4UYPA 4BHYA 4HDIB 1ZCOA 3IGAB 5LDSA 4KKAD 3A47A 2NXYB 2IUZA 2Z00A 1FVEA 3ZL1A 5K9CA 3S3JA 4XAZA 2FBRA 1M1XA 4UCFA 4WHYH 4ETQA 4IU3B 4QRPB 3G08A 3GSNL 1AXSB 5EV7A 3DESA 1Z66A 1IC5L 2Q3OA 3CT7A 2YD9A 3PY9A 4Y4HD 1WK0A 4Q32A 3C6LD 4K68A 1GKQA 2GSGB 1QOQA 2Z64C 3NCJH 4ZUVA 3PQYB 2V17H 1AIZA 3CMOL 1IWAA 4NQED 5HANA 4S1QL 1F8MA 1H15B 2J7HA 3KPQB 3BKYH 5DLMH 4UOJA 5IFHL 5A6KA 4LAJH 1E1CB 3MV8E 3Q5YA 5BRQA 4FX6M 2AAVA 4BFAA 3IKCB 2RJGA 3SYAA 3NCMA 4APQA 4BWTA 2PWFA 4G9DA 5FO7B 4X80H 4MJIB 3D0AA 2BCKB 3LH9A 4MDOA 3QUKA 4W4QA 1QWUA 3RNDA 1UOVA 2O5YL 3CNKA 4HWBH 3VFTA 2HXUA 5AY7A 5FWQA 5J6HB 1XPYA 1AKJD 2PDUA 3O9WB 4IMDA 3PP7A 3AIVA 1UURA 5B22A 3L4YA 4WW2B 1V7AA 2IQ9L 1S1RA 4C54A 3UBPC 4OCRL 4WOZA 5C0AD 1O9WA 3SY6A 1RZFL 1LQSR 3FCGA 1CZ1A 3D33A 1LUCA 4A2RA 2XTJB 4IQHA 4XOBA 1BSLA 3VO0A 5IB1A 3FXIC 2WMGA 3VFSB 3WXWL 3PP4H 1R46A 3BPOC 4BZ2A 4ATDA 1C9DA 4LUJA 3LZLA 4XN4A 1OL0A 3W88A 1RY7B 3KWWB 1FORL 3VYPA 4L4TB 1WYJA 5IVXE 5GRUH 1BAFH 3B4YA 3GHPA 2OEMA 3H53A 3CFBA 4Q7NA 4XZIA 1ZLUH 3ONCA 4O9HH 1H8NA 2DEYX 3Q43A 2P5WE 4N0UB 5LNGA 4WKZA 5LKNA 4NN6B 3K13A 4PB9L 5CLWA 1IZKA 1XIEA 3IUIA 4IMFA 2FATH 2ATMA 4N8VG 1IHIA 1NDYA 4UDTB 1V03A 1CLVA 4ERSH 3F64A 1ZGLB 5E5CA 5AW9B 2YD1A 3CSYA 5JMUA 3QQNA 2EE6A 1IE7C 5GRJL 4ZQKB 3LS4H 4GAGL 3DXAA 3FRPG 1KSRA 2YUZA 3PHOB 3M0JA 4LRNH 3E38A 4ODSH 1TV7A 4TSCH 5CN2A 3L21A 3PZGA 4J40A 1H3GA 3ZLHA 3QXDB 1WT5C 5KZEA 1JXDA 5DEFB 3N85H 1QSVA 3OHXB 3UBXI 2GJZA 1DBKH 1KCVL 1RFDL 5A1AA 3RKDC 1RI8A 2LVEA 2XZQL 2QKIA 2V5SA 1YLVA 1HYSD 1RSCA 1U8QB 4HUVB 1Z48A 4NCC1 3GFYA 4PJAB 1ZTXL 4FZ8L 4ZOBA 5I0DA 3A3YB 3LB6D 3MR9B 2TSYA 1KBWA 4JIIX 4GYFA 2XN1A 3N9RA 5AHNA 5BXSA 3BP4B 1CE6A 3LCLA 1I8IA 4I8DA 3FDWA 1I1RA 2V5MA 1K6QL 1ITUA 4RFOH 2W4XA 2DT2A 4EE9A 2NNCA 5B8CA 2X2YA 4Z7VE 3GIYA 3NQCA 4NRYA 2Y8VA 1KIQB 4HD5A 2KX9A 4HA3A 3TS8A 4MX7B 1SYTA 1FSKB 4PGDA 4M7ZC 1X7QA 4JY6A 4M1DH 4YJZL 1AZNA 1IBZA 1MRCL 1X5ZA 4UB0H 1JZ7A 1BOGB 2C16A 1IXPA 4RRPA 3WLSA 2MCAA 1I2PA 3JZ7A 4GXVL 1SW7A 5EOQL 1PFOA 2OYLA 5FCSH 4HIHB 4LSDA 3T8QA 4XZBA 5KN5A 3L5MA 5E9DB 1PZ3A 3N55A 1JPTL 4ZXLA 4U6XB 3SJVD 4RGND 4NZRL 3QDJA 2QVMA 1FZOA 2XBZA 2WYHA 3W72A 2FBJH 2VD9A 3QZPA 3O81A 3H42L 3HMXA 3IETA 1P1ZB 1TJHH 3ZL4L 1W54A 4Z78B 3IMBA 4NS0A 3LH2L 2OXHB 3GMLB 1UD4A 4FQPA 5LNEA 3KBVA 3B2VH 9CGTA 3EXTA 1KGXA 2CIPA 5I76A 3FT3A 1HKJA 3C5XA 2J78A 2W62A 1IFHH 1L9RA 1F42A 3Q6GL 1FQ0A 5I18L 4GMSL 5JXEC 2YD8A 1U8NB 5CGQA 5F9OL 3FZUD 2WQSA 1P2CA 1EBHA 1NBCA 5C9UA 2DQEH 3NTYA 4ZMAT 1I8LC 2ZZ2A 2ODOA 4LOEA 1J9SA 5HPCA 3RGBA 3Q44A 1Y7VA 4TLKA 4YHIA 1F3DJ 3B0UX 2B1HL 4G6JL 5FJUA 4EZLA 2QQNH 1XXFC 2W9LA 2C14A 1D3CA 3WDQA 5LLIC 5HWJA 2Y07L 4J3OD 1CG9B 1S2CA 3UT0A 4MJ2A 4OSUH 3STBA 1KJVB 4Q74A 2VXQA 4L3EA 3QORB 2D9QB 4WI0B 4A6YB 4IIZA 4PJHB 3N1AA 2NWSA 3QW4B 1DLFH 3KPRA 3RY6A 1SFJA 4NPKA 5MI0B 4M4RB 3NQGA 1MCFA 4JN7A 2PF6A 4CC0A 1SLUA 1UM4H 3UPAA 3TCEA 4FG6D 4XT1C 3MLRH 3WH7A 4DY1A 1PYWA 1JHLH 4UTFA 5K4ZA 1U3NA 4S1RL 1QAPA 3L4WA 1ZL1A 1IR1A 4XBMA 1O7DC 3WLWC 4QXTB 4C56A 2A3HA 3LRMA 2QELA 1EKOA 4K5LA 4XAKE 1OFEA 5D32A 4JHVA 4HJGB 1KEML 3C0SA 3G5XB 3UWZA 2I07A 4FQ1H 2KH2B 3PWPA 3KYAA 4WI6A 4UT6L 4P3DB 2XJLA 4J3OH 5INDA 2B15A 2XWTB 2PUZA 4A3RA 1HH6A 4DVRL 3COTA 4S3GA 3Q67A 2NXIA 5TIMA 1LK2A 3UO1H 3EKGA 2Y89A 5EEXA 1Q4NX 1CDIA 2IBZX 3GHSA 4XZUB 4I89A 2XDHA 5EF2A 2DQIL 3THMH 4ES4A 4ZODA 1SDYA 2X10A 3BP5B 3T0EA 2ZQ0A 4YSQA 5FCUH 2XNAA 3UTZB 1DEEB 1N70A 1QU4A 3WJXA 3ULUD 4BF7A 1N12A 1CDJA 4NJ9L 4Y7EA 4RA3A 2E1DA 4B0MM 1TMQA 1JUBA 1KIUA 1JQVA 3SYPA 4S0HA 4QHNB 2FYYA 3EWWA 3U9IA 4QHMA 1F58L 4S1DD 2Z8VC 4OIFA 4LKXA 4ZG1A 5IQ7H 1GOMA 3PWPE 2FJHB 3W29A 2JFCA 5LA1A 1CXHA 4QAMB 4PCSA 1CI1A 2PTDA 3DGCR 4EUPH 5KJ7E 1RP8A 2YUXA 2V2TA 4MS8C 4WEEA 2RJHA 3L67A 2D3JA 1S3KH 1JDEA 3CLFL 3WMBA 5AALA 3GVRA 2ED6A 1DWFM 3LYRA 3ZVHA 1OINA 4HPOH 2Y4SA 3R4RA 4BQ6A 4TU1A 4R4NC 1YPFA 3CHFA 3BJTA 1KCKA 4IPNB 1Z32X 3T0EE 4U0RC 3LEXB 3KPLB 1XGRB 2AMXA 3G6AB 3SDCD 3P54A 4AGLA 5JZ7D 1NMBL 1BVKB 3V2AR 3JSSA 2OODA 2WMKA 1T7WA 4IGBB 2QHLA 2ISWA 3K6SB 4NKCA 3BT2L 2UZYB 3J27A 3OU8A 3BGFB 4Z6AT 4GI6A 2ED7A 2GSJA 5K9JH 5DJDA 3D4CA 5GSRA 1ZV5A 4MMXA 3IPEA 1JHTA 3IDXL 2OMUA 2VL4A 1IE4A 2GW5A 1FNEB 1QOKA 2I16A 4ZPTA 1AR1B 4DZHA 2V5JA 2EPOA 3ZKQD 4XE0A 2NTSP 5A43C 3UA3A 3VI3F 2P0OA 4AG0A 3S5YA 3U2CA 5AAPA 1KCXA 1AHMA 3P9MA 3WNNA 1MFMA 1DWGM 5CBBA 5K9DA 5LJYH 3OIXA 5TQ0H 3PXLA 1RIVH 4XP4L 5L9FA 1UYWH 4YHOH 1XG3A 2DQ6A 3BMWA 4I7VA 2XV3A 5HHVL 2MPVA 5FS5A 3UG4A 3TIDB 1QJWA 3V6OA 3QQ9D 4ZFOL 1FWRA 4JFEE 1RUAL 4N5ED 1DE6A 3ECUA 4QT5A 4XTRC 2B2XL 4KKCC 4LV4A 4AHOA 4LCSA 4LCQA 4WEVX 2W8CA 1QR7A 3TJXA 5IEHB 1YEFH 1NOWA 4Y8DC 4BQ4A 5F0JB 4HWEL 3GSRA 3FB6B 5DEGB 4DWHA 4RMQA 5IVNA 3BZ5A 4PTWA 4IOSA 2WBWB 2R8SL 1CQKA 2NMSA 3CHOA 2X4PB 3P82A 5G5DA 2Y5TB 4I0KA 3NR0A 5D96C 4QG8A 4BGLA 1OY3B 1TYRA 2G9KA 4H41A 2WXFA 5I8CA 1R5VB 1KBIA 2CGRL 4MY9A 3LQZA 2DOCA 4JO5A 1ISWA 3QY8A 2PDHA 4R5EA 1NFDB 3PPEA 4NZ5A 3O6LL 3S2NA 2JLPA 2CRZA 3V6OE 1TE6A 5DWUL 2CUIA 5ALCH 2DZWA 3IV8A 3H26A 1TR1A 1N18A 3T78A 1LWJA 5A2FA 3S5LB 5T1LB 4R5VA 2PXYA 3KWTA 1FE8H 2ZUNA 2OSXA 5F7BA 4ZXBA 1GS6X 5E6IB 4RV8A 4M6OL 5FB8A 3NTCL 4JDVB 3MZ2A 2IKJA 3E6HB 3H4XA 5FX3A 1R6VA 5FOOA 3HZVB 1AH4A 3S47A 2F1AA 5DF0A 3WQ8A 2D31A 3EJTA 3K4WA 4PM1A 1U3ZA 3RYSA 5E23A 2X4UA 2MNWA 2ZAIA 4BE6A 1BQCA 3TYGH 2J88L 4PJXA 4UQBA 4HIEB 5ICXA 2IMMA 3L0NA 3ETTA 3G6JB 3HPXA 3P8JA 3AHYA 1KGJA 4YIQB 1OSEA 1TXKA 3EBIA 3VI4B 2DL9A 2B7NA 3VQMA 1AMKA 1FYTA 2BOBB 3EH3B 2O55A 2V6AA 3SY0A 3JQOB 4A2FA 2FSEB 4CRPA 4XCNA 3WKPA 4U1IB 4F7TB 5C9WA 1L6ZA 1RURL 3O9WC 1HW6A 4M48H 3M47A 4LEQA 4NAMA 4WW2C 3O6FA 1T1WB 3EHBD 1OP3H 4OOZA 4JOMA 3TV3L 2V7NA 1DORA 4AWUA 3D50A 2XTJC 3UGVA 2OL3H 3VTMA 1JNNL 3C09B 2XSAA 4X0VA 2W27A 3RDTB 4PJXE 2XG4B 2JSFA 3QC5X 4HNNA 1ISXA 2VDML 1B0GB 1YPZA 3QG6B 1U5VA 5D7JB 1C5CL 3NM1A 4DZ8A 4OF3A 15C8H 5EU5A 1W2KT 1IAII 2O6DA 3ITOA 4MKMA 1WAUA 2UXTA 1Z89A 3CHXA 1MI5E 3FO0H 3KL0A 1FWNA 1UZGA 1VJSA 3KS0J 5CD3A 5LIKX 4LMQI 3RWIA 4LDCA 5I0WA 1K8IA 1TTGA 3WJJC 4BQCA 1XGQB 3FFCB 4S38A 5IMKA 3BN9C 3CUPB 3MLWL 4WUKL 4NN6C 3VG9B 3STGA 1K9FA 4KCWA 1BYDA 5AOUA 1B9BA