2ZX8A

Alpha-l-fucosidase complexed with inhibitor, f10-2c-o
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
441
structure length
441
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 163
structure length 441
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx8A01
3AYRA 3F5KA 1C8QA 4JIEA 2WPGA 2F8QA 3N1AA 4TXEA 2XIBA 3UERA 1M53A 2Y5EA 1J01A 3PZTA 1RP8A 5TD4A 1Q6DA 3VIGA 3CIVA 2E9BA 4MJ2A 2XVGA 3M6DA 3WKZA 3WEZA 1QNOA 1JYWA 1KGWA 3WENA 4W88A 1GPFA 1V02E 5DFAA 5A6SA 4CN1A 3EDFA 3SCPA 2OSXA 1HP4A 1EO7A 1PIFA 4N42A 4PMZA 2VVNA 2VMFA 3WDJA 1JAEA 5M5DA 3T0BA 1E3ZA 3D4YA 2E9MA 3WELA 1US3A 1SMAA 2WLZA 2ZXBA 3WF0A 2ESCA 1B3YA 4UQDA 4ACZA 4KGLA 1R7OA 1NOWA 4D71A 3PZ9A 1G9HA 2DGAA 2ZWZA 1W32A 3LPGA 5E1QA 4EKJA 3D4ZA 1E6RA 4EK7A 3EJQA 4TVUA 4PSPA 4P7RA 3WBEA 3ZQ9A 1PBGA 3AIVA 2CETA 2WBGA 1XGZA 2WZEA 4UZSA 1UR4A 3F5LA 1S46A 1KR1A 1XHGA 1K9FA 4AYGA 1BVZA 1JI1A 3EJPA 1WZMA 4UFJA 4UFMA 1UA7A 2W62A 4OIFA 7A3HA 1XCWA 1TR1A 3ARQA 1W1VA 5HOSA 2XJ7A 4GXPA 5EB8A 1CEOA 1AQMA 1UH2A 3FW6A 2WBKA 1E1FA 2X1IA 2OYMA 1ZBVA 4GI8A 2D0FA 3VD5A 1JZ8A 1JNEA 3VILA 1I1WA 1R33A 5D9OA 3EDDA 1XYFA 3TTQA 2YA0A 2XFFA 3VX1A 3LPPA 1GVYA 3U5UA 4EAMA 1FHLA 4HZ8A 2BHYA 2YBTA 3SUUA 3K4AA 4GIAA 3PZMA 2A3EA 4X0VA 3SCVA 4FLOA 2QPUA 2XWDA 3RM8A 3W25A 5M03A 1QI3A 1TUXA 1OIMA 2FH6A 4MB1A 1F4HA 3F5JA 3MSGA 1CWYA 4H41A 1E15A 4PMOA 1CGTA 3A47A 3BMWA 1QI2A 3IK2A 2J8GA 2ZX8A 5BXPA 4URIA 4AD5A 2DH3A 1VFUA 1E73M 1J18A 4CN6A 4AW7A 1JZ2A 2GK1B 3CV5A 2VR5A 1U2YA 2J7EA 3MUAA 1GUVA 1H3GA 5KZ6A 4Q7NA 3VDAA 3A4XA 1X6NA 1Q6FA 1E3XA 3W28A 4DWSB 3VGHA 2J77A 2WKGA 1PX4A 2VZSA 3DYMA 3VD9A 3S2CA 1DWJM 1OINA 3VGEA 1CLVA 1G0CA 1QNSA 2HVMA 3DECA 4AD1A 1WDRA 2E8YA 3W4RA 2EACA 5HNNA 5BXRA 3MV11 2GJRA 3OG2A 1O7DC 1GONA 3A6OA 1CPUA 3VIKA 5I6SA 3WUGA 1MXGA 9CGTA 4BQ3A 3ZO9A 1VEMA 4QFUA 3AFBA 4ZE5A 1HN1A 1I75A 1HKJA 3VKKA 1LG2A 1JL8A 4PCSA 1QOXA 3IANA 4LGXA 1XSKA 4QAWA 2DQXA 4JFSA 4A3YA 4F79A 3BAJA 5ABFB 3DHPA 3UCQA 5AY7A 5BWFA 1JYVA 1KGUA 1W3JA 2AMGA 3WD1A 1UKPA 1UR9A 4GZIA 3PZUA 2UY3A 2F61A 2F2HA 3AI0A 3PZOA 3SUTA 3L4WA 4OGZA 3W6MA 5IXEA 1V08A 5D9PA 3WH8A 4JCMA 4Z2GA 3E1F1 2GJPA 3KL0A 5JIPA 4AXNA 1DWFM 2BXYA 2XN1A 3GXTA 3ZR6A 1TVPA 3SCUA 4MNMA 1CIUA 1WNOA 1HJUA 1NQ6A 1PS3A 2ZUVA 3VD4A 3RPMA 3LRKA 1XH1A 3SCTA 4LQ1A 4Q22A 1MWOA 3W27A 2WW5A 2CBJA 1B0IA 2HISA 4D6EA 1JYNA 5E6YA 2PB1A 5A6AA 1HJXA 2DT2A 1B30A 3CHDA 4GPNA 3WN6A 3CLWA 1B3VA 4P7OA 3LXCA 4CVUA 1NM9A 1E1EA 4CU7A 1AQHA 1JIBA 2YIHA 3DX3A 4WK9A 4AIEA 3VIPA 2XIIA 4CD4A 3AYSA 4KH2A 2W67A 2WHLA 3VGFA 2ZXQA 2D73A 4AD0A 1V3KA 3SCSA 5BRPA 4W7WA 3CUJA 3SUVA 4AZBA 3WDHA 1UHVA 1GNXA 4DWSD 1TQTA 4AEFA 1T0OA 5A2BA 1QNPA 2FGLA 1PX8A 4D1JA 5E6ZA 2CBUA 1OWQA 3LXBA 1C7SA 1WE5A 4RE4A 2XGBA 2X09A 3O9NA 1WZLA 3AISA 4ZXOA 1W3LA 1EH9A 1HT6A 3DX0A 1TFVA 2CBIA 3A24A 3CBWA 2VQUA 2WSKA 4PMNA 3B9AA 4E4PA 4H8VA 2FGZA 1UD2A 2YKKA 1BQCA 4E2OA 3CZGA 2BS9A 4IPLA 5I5RA 1OBAA 1NWRA 3OB8A 4J3SA 2EJ1A 2EPNA 3WQVA 2DSUA 1OM0A 4HOWA 3BXWA 3WF3A 2YLLA 3GNRA 5CGMA 4ZEPA 1MW2A 2J79A 1EHAA 4PUDA 3IAQA 4D6JA 4Z2HA 4Z2JA 1DEDA 1J0JA 4FF5A 1GORA 4UTFA 3WDPP 2Z1KA 5FKYA 2VZTA 4KGJA 4CD8A 3QHNA 3AS3A 2MANA 4D6CA 2PWGA 3BLKA 3AZRA 3WY1A 3A22A 1WKYA 5I3DA 4XUYA 1UQYA 3N9KA 1Q6EA 1IZJA 2D1ZA 1KWKA 2O92A 4P7NA 3AJ7A 4QCEA 3U7BA 1H5VA 2YBUA 4JL1A 2V3FA 3WY4A 1C91A 2X2HA 3GZAA 4TX6A 2WCGA 2IXUA 3BVVA 1GW1A 1XRVA 1HL8A 1ZB5A 3OGVA 2CPUA 3NSXA 3H55A 3WH7A 1U30A 4F9JA 5ABFA 1M03A 1JDDA 4HPGA 2JF7A 3VIIA 3UG5A 1KGXA 4JZ5A 4S3JA 3T2OA 1G01A 2ZUMA 3RDKA 2DSKA 3J7HA 4GI9A 1J0KA 3ARPA 4NRSA 3NDYA 1UA3A 2VC9A 3AZTA 1LWJA 1K9EA 4D6HA 2YDQA 4M8UA 3MV01 3VX0A 6A3HA 4J28A 5BROA 3FNDA 2C8NA 2DT1A 2C7FA 1Y7VA 2D24A 4FLQA 1G5AA 1SYTA 1HL9A 1U33A 3VUPA 2ZX7A 1TQSA 2E8ZA 3ARSA 1TQUA 1DWHM 4ATDA 3GXFA 1MQPA 2CEQA 1SZNA 4AZHA 1XV8A 3N11A 4PMUA 2WHJA 3ZJKA 2J7FA 3H54A 2PF0A 3GH4A 1ITXA 6TAAA 2OW6A 1KWGA 2WMHA 4FMVA 5EFFA 1CDGA 1W3HA 2BFGA 2WCAA 3AIQA 1WZAA 3AIBA 7CGTA 3I3EA 1QWNA 2EO7A 3N04A 3WD3A 3CPUA 3G6LA 4LPCA 5CPQA 3THDA 1LG1A 3OZOA 1RPKA 3IAPA 5CJ5A 4DWSC 3AHTA 5D9MA 3RMEA 5A94A 5JBFA 2Y4SA 1TZ7A 2VRKA 3WMBA 2YLAA 1V03A 1BGAA 1JG9A 1OT2A 4HOZA 2ZE0A 5CSUA 1XD0A 1QVBA 2VNCA 3WF2A 1SR0A 3WMSA 4PN2A 2FHFA 2CHNA 4P8VA 2OYKA 3WQ4A 4UFKA 5IFPA 2PWFA 2B31A 2XM1A 2WWCA 3BVXA 2WANA 1NWTA 3KZSA 3MMDA 3GBEA 4YHEA 4D1IA 1UWIA 3M46A 3WSUA 1GCYA 3OBAA 1QHZA 2PBOA 4A4AA 4J3XA 2ZICA 4W8BA 1FH8A 5JUVA 4GI6A 1WAWA 3BAKA 3O6AA 2VUYA 1EDQA 2DDXA 1BF2A 1CXFA 1KTBA 5CSYA 2NT0A 4KMQA 1PEZA 1UR0A 3SCQA 4HPHA 1CGXA 2WZIA 4M81A 2CITA 5CPTA 1E6PA 5D9NA 5C70A 4AIOA 2W4XA 3BVUA 3GNOA 5JBEA 4WLCA 1VEOA 4CD7A 1XH0A 3D50A 1QNRA 1E43A 3EBVA 3PBGA 2WVUA 4TUFA 4AD3A 4D72A 1HIZA 2ZOXA 2JIEA 1JZ7A 3CUHA 1W1YA 4WSKA 1B3WA 1CGVA 2OW7A 1LWHA 2X0YA 4JFWA 3WY3A 3ARYA 3SUWA 3CZLA 1LF1A 3AOFA 2J8FA 2J74A 5AYIA 2CXGA 1QI5A 5E70A 1GOWA 4MB5A 5GNZA 4WF7A 3CO4A 1CGWA 1FOBA 1RP9A 3L2LA 2VCCA 2UY2A 4UQ9A 1CNVA 1MQQA 2E0PA 1VF8A 3VVGA 2W66A 4C7FA 4L4OA 2CKSA 3ZSSA 2ZXDA 4M24A 4PMYA 5C71A 1R87A 3T2PA 1L8NA 4PBGA 1Z32X 2Z1SA 1FFQA 3TTOA 4D6FA 2VRQA 3QHMA 4ZXLA 3WQ8A 2Y24A 1EHNA 1E4LA 1H49A 1NH6A 2G41A 1V6UA 4J27A 5EMYA 1CXIA 1OGSA 2J7DA 4UNIA 4W8LA 2J25A 4B9YA 4U2YA 3AHXA 3CMGA 4HU0A 1FP8A 4OOZA 1V0NA 3D5HA 3BH4A 5FIPA 1X1NA 1CENA 4E8DA 3L4UA 3SEPA 3POHA 5DMYA 2BHZA 2WVSA 1GQKA 3AMDA 4QLJA 2WVVA 3ZT5A 1ECEA 4AD4A 4OKDA 2XGIA 3KLKA 3AZSA 4H8UA 2WNWA 4YPJA 3PZNA 3HZ3A 4DUXA 2VCBA 4XX6A 2BNJA 2WMGA 4BS0A 3AXHA 4YHGA 1NWSA 1DP0A 3RM9A 3SCOA 1JNDA 3LPFA 4OUEA 5LYRA 2CKRA 1B3XA 4LXFA 3CZEA 5I0DA 5ABHA 4XZBA 5A6MA 4CD6A 2QHAA 3AMGA 1J11A 4UOJA 3AMKA 1YQ2A 2FDMA 4PYSA 4UCFA 2BY1A 4J3UA 2WVTA 3QGVA 2BXZA 1AMYA 1CXLA 4AYSA 3WEOA 1GVIA 4NI3A 1B2YA 2XVKA 3II1A 1R75A 4GO9A 3L4ZA 4YN5A 1H11A 2A3HA 3AIWA 4W86A 4P7QA 4BQ5A 4RE2A 4DO6A 2CESA 3LPOA 3TTSA 5ABEA 1R47A 4J7RA 2RGMA 3W82A 3JUGA 3WEMA 3VM5A 1HJVA 2V5DA 1W9XA 2QF8A 4DO5A 1E6NA 1B3ZA 2XG9A 4B16A 4U31A 3VNYA 1LL6A 1CXKA 2YL6A 1TQWA 3UEQA 5A6BD 3D52A 4JFVA 3AS0A 5DO8A 3HMCA 1EA9C 1E6QM 1BAGA 3MMUA 2XN2A 1BYBA 4ZE4A 3VM7A 1KCKA 4DUWA 1HWWA 3GXMA 1K6AA 3FHAA 1RH9A 1XC6A 5DT5A 4XV0A 1OD8A 3WUFA 3WY2A 1UZ1A 2DIJA 4C7DA 2WXDM 1VFFA 1GOKA 2E4TA 4H7VA 1EOKA 2WWDA 1WPCA 4S3KA 4AZ7A 4D6IA 1J0YA 2C0HA 3OLGA 2X0HA 4MDPA 2YA2A 1D3CA 2WMIB 2X2IA 1GQJA 3KEHA 4PCTA 2FE0A 4U33A 2D20A 4GKLA 5IHRA 2E9LA 3ZSTA 3K8KA 3WDQA 2ZUTA 1ISXA 1EXPA 4MNLA 3GXIA 3KWXA 1QHOA 4B9ZA 3PZIA 1Q6GA 3RM4A 4MPKA 1NARA 1BLIA 4ZFMA 3EJRA 3TP4A 3GDBA 2D2OA 1JF6A 3U57A 1KXHA 1UWSA 4PUEA 1H4PA 1MW1A 1W1TA 2WHMA 3S5YA 3VIMA 2EXOA 1EQPA 1BPLB 2FHCA 1XYZA 4DM1A 4LYQA 4OOUA 3MO4A 4ZENA 4CN4A 3A4AA 2D0HA 4U3AA 3WNPA 3KLLA 5A2CA 2GUYA 2A3CA 2VO5A 4UQCA 2W5FA 4XB3A 4UR9A 1GJUA 3A5VA 4PEEA 2ZX9A 1EOMA 1JAKA 3VDCA 2WB5A 5D8WA 1TG7A 2UY4A 4NX0A 5CGTA 5IDIA 1UYQA 2VX7A 2EAEA 5F7UA 1RD6A 4AEEA 1HJQA 5AC5A 2TAAA 3QR3A 1JF5A 4HA4A 1AVAA 3NUKA 4BA0A 2GSJA 1HP5A 4UOQA 3MKKA 2OWWA 2ALWA 3MI6A 3VDBA 1MVYA 4NZFA 4AY1A 1L0PA 1PZ3A 2OSYA 2YDSA 3SCRA 4GQRA 3N12A 1FHDA 2CERA 3L4TA 1JDAA 3GBDA 4TTUA 3AQUA 3WDRA 3BUIA 4M1RA 1B9ZA 1ZU8A 2W91A 1WB0A 4CKQA 2GVYA 5A69A 2F7QA 1VFMA 1TMQA 1UH3A 3NSNA 1JFHA 2ZUNA 8A3HA 4FNUA 3OA5A 1UKSA 2ZWYA 2GK1A 4GQQA 4UFLA 4AMCA 2G3IA 2PWDA 2PI6A 1V3HA 3WIJA 3WH6A 1QNQA 1WZKA 1US2A 3I3BA 1TA3B 1DWIM 1J0HA 5A8OA 3K8MA 3LRLA 5LA1A 3W0KA 4DWSA 4B3KA 3AROA 2J7GA 3DX2A 1VJZA 1AQ0A 4FNQA 1G94A 2DH2A 3WQWA 2WC7A 5FCZA 2XN0A 2WAGA 2DPEA 2G3NA 4AZCB 1OSEA 2AAAA 2PWEA 3W37A 5A6JA 2QLYA 2XFYA 1WO2A 2WMFA 4AZ6A 4P8XA 2V38A 1OB0A 4WKFA 3CC1A 2WSPA 3B9DA 1R46A 2FH8A 3A21A 2XSBA 4BF7A 5I2UA 3DX1A 3B9EA 1UUQA 2OSWA 1E55A 1QW9A 2XVLA 3IJ8A 1CZ1A 2G3MA 1ZS2A 3L4XA 3ARUA 1BHGA 4W93A 3VNZA 5CXPA 2GDUA 3GNPA 3BCFA 3IJ9A 1XH2A 3BGAA 1PZ2A 3WNLA 4Z2KA 1VBUA 1W9UA 5E0CA 4V2XA 4CVWA 1R8LA 3RO8A 1DWGM 4W8AA 1UD4A 3AMCA 2G4FA 3EMCA 2DSZA 4ML4A 5I77A 2QV4A 2OYLA 1C8YA 2WMIA 4W89A 5A1AA 1R34A 3BAYA 3OLDA 4D6DA 1ISYA 4PRWA 3BLPX 4GZEA 2GJXB 1IV8A 2J7BA 3D3AA 4JFUA 1P6WA 3SURA 3MUZ1 1CECA 1V6XA 3UESA 3NYDA 1GZJA 1W1PA 3UG4A 5LA2A 1MFVA 2DT0A 2Q8XA 3TA9A 4ACZB 4Z2LA 2J47A 3NSMA 1ZBCA 2CCRA 3VD7A 2VVSA 3EYPA 3AS1A 1HKKA 3UG3A 2WYSA 1UOKA 3U5YA 3BVTA 3EDEA 2VQTA 1FFRA 4AWEA 1C92A 2YL9A 4QLLA 3OLIA 2DT3A 5DT7A 4WJXA 1E71M 3APGA 2BV9A 2RGLA 4OJYA 2W92A 2F7OA 3CZJA 1GQLA 3CZ8A 2VOTA 3S6TA 8CGTA 3PTMA 3GM8A 1E9LA 3BAIA 5E9AA 4PMVA 3WL1A 3VIJA 1EIBA 1QI4A 3ECQA 3SCNA 1FP9A 5CZKA 4M56A 4W5UA 3ARVA 3WQ6A 5BYWA 2W63A 3A4WA 5C8BB 4B15A 2F18A 1VEPA 2V5CA 3ZJ8A 1W2PA 1HNYA 4WSJA 1HKMA 1UWRA 2VZVA 1UD6A 4JCLA 1JD9A 3WF1A 4F9DA 2WK2A 1CYGA 2JIWA 3WH9A 5AC4A 2DSVA 1QBAA 2VX5A 1FH7A 4EANA 1E0WA 3TTYA 2JFEX 3EJUA 3MSDA 1TVNA 2J4GA 3I3DA 5M17A 1FA2A 1EDTA 1M01A 1D2KA 2J75A 1VAHA 2X8RA 2XWEA 2DIEA 4AZCA 2QMKA 4Z2IA 2V3GA 2O9OA 1EGZA 1R7AA 4M80A 3VD3A 5E09A 1V3JA 2QPSA 2XTKA 3ALFA 4N0RA 4PTWA 2VR4A 1W91A 3CZSA 1GOOA 3HG4A 3CUIA 2BY3A 4IM4A 6CGTA 3SCWA 4W5ZA 5A6LA 1E5JA 3GTNA 3RIKA 4U2ZA 2NW0A 2D22A 1G1YA 4DO4A 2JE8A 1PJ9A 4W84A 1V0MA 2IGTA 2QMJA 1JD7A 4MNKA 3UR8A 3BSGA 2A3BA 1C93A 2GFTA 3WD4A 4TTGA 1BSIA 1E0VA 4HU8A 2O9RA 3ZOAA 3N18A 1NOFA 1UQZA 1HXKA 1H41A 3CMJA 2WM0A 3MU7A 1GOQA 3IJ7A 4KRUA 1MXDA 2E3ZA 3WL0A 1LQ0A 1UD8A 1W3KA 3HG3A 2D0GA 2WZHA 2GJXA 2W61A 1KB3A 2XSAA 1NOUA 2ZUWA 4OBRA 3OGRA 3ZT6A 3DDGA 2EEXA 5E0FA 2YOCA 1E6SM 4M29A 4CU6A 2EPOA 3WUBA 2JEQA 4HMDA 4QCFA 3AHZA 3WQ5A 1OCQA 1QPKA 1IT0A 3PZVA 3CHCA 5CLTA 1HJSA 1E6ZA 2F1BA 2X2JA 2BVDA 1TE1A 3MMWA 1E4NA 4CD5A 4NXKA 2F1AA 2VX4A 2XHYA 3EMQA 3ALGA 4CGTA 4HZ6A 2YFOA 1KTCA 3PTKA 2VL4A 1Q6CA 3IGUA 3TONA 1UASA 1PX3A 3MANA 3VGDA 4UQEA 3PN8A 3K4DA 2VJXA 1KFWA 1C8XA 3VGBA 3PZGA 1MW0A 4FNSA 3T08A 3THCA 1KXVA 3OGSA 3GXDA 3F4VA 3GXPA 2E40A 1CTNA 5A3HA 1HTYA 3CH9A 2XM2A 3RCNA 3ZIZA 3M7SA 4W7UA 1CXHA 5HXMA 1MQRA 1H0IA 2AOSA 2J78A 3VOCA 4V28A 1HVXA 2OLHA 4TOQA 1MFUA 1J9YA 1HX0A 2WHKA 5FL0A 3AMLA 3WUEA 2V3DA 4MDOA 1C3FA 2F7RA 1ZJAA 3WNMA 4J3TA 2J62A 4KWUA 2NSXA 3WFLA 1JI2A 2JALA 3RILA 1E56A 2OWXA 2WLYA 1UZ4A 3FAXA 3ARZA 5CLWA 3UR7A 1JXKA 4CCEA 4AISA 1XCXA 3SUSA 1H2JA 2XUCA 3HG2A 2VZOA 3BCDA 4TVDA 4H04A 2PC8A 4HOXA 1JXJA 1UWTA 1V02A 1PIGA 1W9PA 4CU8A 1YHTA 1O7AA 2CHOA 1KBBA 4HZ7A 4IISA 1EDGA 2BY0A 2WCSA 2BY2A 4H2CA 3ARWA 4MB4A 3VPLA 3G6MA 2CNCA 1N82A 2VURA 3L4VA 3D51A 4HMCA 3CHFA 4TVCA 1ISVA 3CZNA 1CBGA 3DDFA 4CUCA 1E70M 1JGIA 1BTCA 3WD0A 3AIUA 4Y7EA 3RJXA 2WC3A 2CIPA 4NRRA 1UG6A 1HF6A 4ACYA 5A6KA 4FNTA 1BGGA 5GQBA 4MAVA 2O9TA 5CQ1A 4AZGA 4IPNB 3WD2A 1UKQA 3TOPA 2XVPA 3N17A 2YA1A 1MYRA 1DHKA 1ZL1A 3WF4A 1BG9A 1TCMA 1KCLA 4NF7A 1ISWA 4DM2A 3W29A 2Y8VA 4JL2A 4PSRA 2GDVA 4LX4A 1J0ZA 2XFRA 3QOMA 4PTMA 2VX6A 3UETA 3HG5A 1NP2A 2NT1A 5BCAA 3N13A 5A6BA 3KL3A 5HPOA 1UWQA 4KRTA 5A8QA 1VB9A 3POCA 5GNXA 1H09A 4HP5A 3AHYA 4OBSA 1KXQA 1BYCA 4NSBA 3W6LA 3LRMA 2FYVA 4LYRA 3CUGA 3CUFA 1ITCA 3FXYA 1WP6A 4PMXA 5A8PA 2CYGA 4FNPA 4C7GA 1PAMA 3O2LA 3HU7A 5D8ZA 5ABGA 3ZM8A 1DTUA 1GHSA 1WDQA 3MS8A 4L4PA 3VMNA 4NZJA 4HTYA 1H1NA 4P8WA 3AHVA 2ZUSA 3N15A 2ZXAA 4D6GA 1JZ3A 5DEZA 4M82A 2A3AA 1I1XA 1V0LA 4GO8A 5EFDA 2BHUA 3LXAA 3PTQA 5JBDA 3AXXA 4IUGA 1B31A 4U5KA 4WKAA 3LMYA 1V6WA 3BSHA 2YL5A 1HKIA 5HPCA 3W81A 4NXSA 1ODZA 2VCAA 1CLXA 4PMRA 1C7TA 1BG4A 2UWFA 1ISZA 1V0KA 1J12A 3AS2A 3AIEA 3PZQA 5IFTA 4R5EA 2JEPA 1NWUA 3CTTA 4HA3A 1EO5A 3DX4A 4FNRA 3GH5A 5ECUA 5IHSA 4HA1A 4LYPA 4JKLA 4AMXA 3DC0A 1GOMA 2EPLX 3OZPA 3GH7A 1VRXA 4ATWA 3FN9A 1W9DM 4U5IA 4XZWA 3FY1A 3OIHA 5A2AA 1VFOA 3ZR5A 3SIMA 5GNYA 3VGGA 4H8HA 1E40A 5BRQA 4AMWA 5DF0A 1WDSA 3DHUA 1UH4A 1KR0A 2CBVA 2XPKA 4RL3A 1A47A 3EJSA 3WFZA 2Y2WA 3H53A 1QW8A 4TX8A 4JKMA 5I24A 2ZX5A 1TQVA 3ZJ6A 3VINA 1QBBA 1XSIA 4JHOA 3NIYA 1ZBWA 1B1YA 4P8UA 5BXTA 1V3IA 1SMDA 4R27A 2EPKX 5FL1A 4WKHA 1M04A 1BFNA 4J3WA 3T09A 3QOKA 1H0GA 2XVNA 4CCCA 2BVTA 2PBGA 1UWUA 4MTVA 2VI0A 1JFXA 4MJ4A 5CG0A 2PWHA 1KQYA 1ZJBA 4X9YA 2J7CA 4UFIA 5I79A 3K8LA 1K9DA 3VO0A 1E6XM 3CHEA 1CGYA 1KQZA 4J3VA 3WH5A 1E72M 4RE3A 2G3JA 5FOOA 1LL4A 5M3WA 1UR1A 3BUQA 1F4AA 1GOIA 3RJYA 2V3EA 1UKOA 3W24A 1QWUA 4QP0A 1VENA 1V3MA 1UR2A 3VSVA 4BZYA 4AD2A 3WDIA 1O6IA 1E4IA 2F7PA 1DWAM 1M7XA 5I23A 1CGUA 1VIWA 5KEZA 3EJTA 1VJSA 1W2VA 1HVQA 5HBFA 1V6YA 3OLEA 1E4MM 2O9PA 2WMJA 5FD0A 5AYBA 1IZKA 4NZCA 1K9TA 3L2MA 3NJ3A 4EE9A 5A95A 2XYLA 4JAWA 2YFNA 1E5NA 2D3LA 2YJQA 3WNKA 1BVNP 2EADA 2WC4A 3BC9A 4FLSA 1CXEA 1A3HA 1OIFA 4W87A 3EDKA 5D4YA 4V27A 3VMOA 3GYCA 4W85A 4AC1X 1XSJA 4MNJA 1KXTA 3VIHA 1JZ5A 4FLRA 2G8ZA 1B90A 4JHZA 3BLBA 3FAWA 1QX1A 1V3LA 4BQ4A 1LLOA 4UFHA 1J0IA 1Q4NX 3AICA 1JZ4A 4A3HA 3BAWA 3WNOA 3A3HA 4F66A 1GHRA 2ZUUA 3LX9A 1X6LA 4JKKA 1PPIA 2VRJA 2YDRA 1EQCA 2OWCA 1LJYA 4B3LA 1R85A 2IXVA 4UQAA 3BUDA 4X0NA 1R86A 3T0DA 4U3CA 1UD3A 2VTFA 3ARXA 1WCGA 4PMQA 1BYDA 4GZJA 5EBAA 3GXNA 2WMKA 4AZ5A 4BCEA 3DYPA 3MUIA 1KBKA 3T0AA 2WVVB 3W26A 3W53A 1UD5A 4WIWA 1QHPA 5GPRA 3BAXA 2J7HA 2IUZA 1SFSA 4PTXA 2EABA 1OD0A 3S5ZA 4OZOA 3VU2A 3VSUA 4FK9A 3K46A 4ATLA 1GJWA 4JFTA 4P7LA 4GINA 5BXSA 4CCDA 4QLKA 3WMCA 3WNNA 3U7VA 3ZMRA 4HMEA 1GQIA 2DSWA 2ZIDA 1JYXA 3ZJ7A 2X2YA 4MB3A 3WBAA 3TV8A 2WKLA 4DUVA 3K1DA 3T2QA 5LA0A 2UY5A 1W9VA 3DYOA 3KE0A 3QHOA 1C90A 2VZUA 2EBNA 2FHBA 1UKTA 3VIFA 3VIOA 1ZBKA 3BUBA 2DEPA 2Y8KA 3B8SA 3NCOA 1WDPA 5JIWA 3CGTA 2X05A 4QDMA 1D7FA 1TA3A 3A23A 3CZKA 2D23A 2EPMX 3L4YA 3PHAA 3EDJA 3KL5A 1XD1A 1HXJA 3VDHA 2VT0A 3M07A 3BUPA 1ESWA 3ARRA 4F8XA 1OGBA 4UQBA 3BVWA 1HJWA 1JDCA 4UZUA 1J10A 2BVYA 4AIUA 5A8NA 5A8MA 3VMPA 1OT1A 3FHQA 1BYAA 4BQ2A 4MAZA 1NP0A 1OGGA 1V6VA 2JF6A 4K68A 4W7VA 2EQDA 5I78A 3ARTA 3EMZA 1JZ6A 3AXIA 4MADA 5CPSA 1ODUA 1MW3A 4UOZA 3W38A 1W9BM 3BMVA 1VBRA 3VSTA 1LL7A 2YL8A 3HN3A 1FH9A 3HJEA 4PTVA 1E0XA 2ZX6A 2D3NA 5HDRA 3VTRA 3ZT7A 3NDZA 7TAAA 4E8CA 1UR8A 3AIRA 4AZIA 3MUY1 1QI0A 4PMDA
chains in the Genus database with same CATH superfamily
1J1OH 4EQ2A 3QEGL 3CWOX 4P8QA 4LBUA 4XP6L 3I50H 2H3KA 1JYWA 3GC4A 1E4XI 2G2RB 5F7DB 1GPFA 5GIRB 3QDGD 4Y9CA 4ZDHA 2W27A 1AO7A 4FOUA 1LP9A 1I8LA 1KT2B 3TJEL 2KZKA 4KROC 3G3LA 3UL4A 2A7BA 3ZE1E 2I7GA 1A2YA 4D0BB 2DEYX 3R1GL 4FG0A 1V7MH 1NBVL 2ICEC 4PRPE 4PJDE 1D9KC 3KWWA 2EVGA 2PTXA 3QDMD 5I30H 4HIJB 1TR1A 3T4AC 4LOUD 4AWUA 2B8OT 5EB8A 4PUUA 2X4RA 1PVNA 5F7LB 1JNEA 4C6KA 3U0TA 3Q2NA 4WTZG 3FQWA 2QZ5A 5ESVB 2XTJD 3U5UA 5E8DH 1Q72L 3PQYE 3GUTA 1TVHB 4KMTH 2ZCHH 1ELSA 1W8OA 3S97C 1GKEA 2QPUA 4AIZA 3MA9H 5M03A 1P9MA 2ZZ3A 4WJ8A 3MRKB 4Q4IA 1KJ3H 1D7CA 4HC1L 4AW7A 3MRBA 3S9IA 5AYQA 2J2ZA 1U8MA 4U1SB 3SB3A 4R90L 5FDWA 2R8SH 4AFYA 3EYOA 3VD9A 3OKEA 4NJIA 3LUTA 1DE5A 4MLRA 1SEQL 1YEGH 4PCPA 1GYNA 2VIRB 1X5AA 3NSCA 3SQMA 5FFLA 4GBUA 4V1XA 3BISA 3UIZA 3G5WA 4G72B 4L2LA 4LCUA 5I6SA 1UUOA 2FTWA 1J79A 1GL4B 4E0RA 1MHEB 4PCSA 1QOXA 2MCPH 3MT1A 4G6AD 1P0KA 3IJIA 3MA7A 4O15A 3I84A 4IP7A 1QOQA 5JOFA 3MRCA 5CAHA 2GABA 2TSBA 2A6KB 1COBA 2UY3A 3C6SB 3SUTA 4S1SL 5D9PA 1URZA 5JIPA 4FXGC 2J72A 4AWJC 5DTFA 3RCMA 2V2XA 3RPMA 1AH1A 2G0LA 4GB9A 4K9EH 3RWJA 3GR7A 2Z2AA 3OMNB 5E6YA 1TJGH 1F18A 3PPEA 1JGUH 1DIEA 3GBLA 2A7NA 4WY0B 3OXRA 3ZHNA 5I16B 4HWZB 4R6UA 3TR2A 2LU4A 4RBPK 1BYPA 1V3KA 2DUAA 5CP3A 2QUNA 4OGAD 5IVOA 1XLJA 4CVZA 3ABGA 1DQQB 1A14L 1IKOP 4HYVA 1WZLA 1H0DB 1YPZA 1WC7B 3DX0A 2X6UA 2VQUA 4JXCA 1NGZB 3B9AA 4IBVA 4WUKL 2I69A 3S36H 3TWAA 1ZA6B 2J8HA 3IS1X 2YR3A 4ISVA 2HFFA 1XIFA 4REQA 1GG1A 1X5GA 2EVJA 5CPLA 5CEZL 3QZLA 4HJUA 3EKZA 5TQ0H 2P26A 5SX4H 4BKNA 1VADA 4KVNH 4TVPH 3TU6A 1QW7A 1J1XL 5FKYA 5FW7A 1KTDA 4CD8A 4CADA 4X6EB 5CM1A 2ZF9A 2VDLH 4Y8EA 5I1CL 3GEWB 4UWQB 3UJTH 1HZKA 2PWVA 1W5QA 2HMCA 5DY2A 1N5AA 3P82A 4CW1A 3KCPB 4MA3A 3VAVA 1QSVA 1HL8A 3OGVA 3FOMB 1K8IA 3H12A 1LNUB 4DN1A 4HJGB 3BUVA 2HLAA 2TRYA 5ICZB 4JZ5A 4S3JA 4AQ1C 3BAEL 1ZALA 4RJEA 4Y2DD 3BZFB 1LWJA 4TMBA 3RZCD 1SGJA 2R56H 3KR3L 2XQBL 4N9DA 2C8NA 5HULA 2IXQA 2KS0A 4YHMH 2NYZA 3KS0H 3VOFA 4QRNA 4NQCE 2NX3A 4BFEA 1AJ2A 1EPVA 4FKKA 5ACZB 2CEQA 2DYPA 3D85A 1XV8A 2AK4E 4IS6A 4X7TA 4YX2H 3CFKB 1RZJH 5EU6A 4K3EH 3BG3A 2IF7A 1CDGA 5F2LA 3LMJH 3VOIA 2EO7A 2Z35B 5HWMA 2XH2A 3AXLB 1V10A 5E9DE 1ZVSA 5BW7A 1PTDA 1PZ5B 3BT2L 2JGYA 3W01A 3IUHA 3MGAA 1A7BA 4L1XA 3PPGA 1OT2A 4IW4C 1IGIL 3ELAT 3WMSA 4EPEC 2WB1A 3K72B 1QFWL 1ED3B 2PWFA 2WWCA 4I2XE 4NX5A 3MMDA 3G6AA 5MERB 1BWMA 4JY4A 4X80H 2KLTA 3BN9C 5LGJA 3GDRA 3T4CA 2YEZA 3CJPA 4Q32A 3S34H 1MCPL 2PPAA 3TBYA 4J2QA 1CTOA 4B53A 1RIHL 1URLA 5HDOA 2MHAA 4KMQA 4G1KA 1E9PB 1S5WA 2Y1VA 2NY3B 1GGOA 3RX3A 3F5WB 1MHCA 1J4EA 1VEOA 2QGYA 1GOGA 1V5XA 3QNYA 5HHOE 5I5MA 1RZMA 1HIZA 4DJFA 5D7KE 1HINL 2XTSA 1B3WA 4JQ2A 1T2QL 1SW3A 3CZUB 3KHOA 4HSOA 1VACB 2WAQA 5GGRB 4WF7A 4KEUA 5SWZE 1RP9A 3L2LA 1XL6A 1DQTA 2UY2A 4LF2A 2I9LA 5AZ2L 1ASQA 1RHHA 1R1CA 3LSBA 1RZ8B 2CKSA 1OF2B 4QYOA 1ZRQA 5F4SA 3EO1B 2X89D 1BFSA 3R25A 4BKLB 4H0IA 3KCJA 2Z31C 5ESAA 4Q52A 4JDBA 4I7ZC 4KZDL 3V4VH 3S5LB 3DETC 4G9DA 3EEZA 3EWUA 1J7VR 2WXHA 3ZT5A 4UTTC 4QTIH 3ASWA 4A7TA 4ZMWA 1E5YA 4JO2L 4LEBA 4IHBA 3VVWA 3WKML 4MJ5A 2Q8AH 3ET9F 1J96A 4HFUH 3AMGA 4ZPTA 4G83A 5F7YC 1KYOK 1IFHL 3F7JA 3NPSB 4U1MA 3AMKA 4ZQRA 5C0RL 2OEJA 4U6TA 1ILSA 4XC3L 3MLPA 3WK1A 4RA0C 4U7MA 4NI3A 1B2YA 3SW6A 4TYUA 3ZL4H 3E12A 4JJHA 3AW5A 3Q05A 2AZAA 4LCIL 3ZXAC 3Q1SL 4BSWB 1R47A 4LP8A 1KFKA 1P7TB 4DO5A 1UCBL 4CSSA 3A67L 1T4KA 3VI3B 3PFUA 3QJOA 2CC0A 4PCFA 4TO8A 3MRRA 1VPYA 6ENLA 1X97A 1OCCB 4NWTH 1JHKL 4ZE4A 3QTPA 1KCKA 2ZYSA 4YHIB 2Z7GA 3HI5L 3TBSA 3GXMA 4RWYL 4MY9A 5AB2A 3M17A 3GY1A 4YXLL 3ZYZA 3N42B 1VZWA 2J1XA 2PXYB 2Q2EB 1SHXA 1EWHA 2OCZA 1QPXA 3OLGA 1DQDH 1BMWA 4Y4KB 1RA0A 2W0LA 4H13C 2DQHL 4WDTA 2D20A 5IG7B 3PS6A 4E9RA 4UTWA 1AZCA 4H83A 4B9ZA 4L3CB 1WAEA 2ZKHL 4NAMA 3TP4A 4GW5B 1P4UA 5GRUH 1YNQA 3VNJA 3HS8A 4CLMA 3IVSA 5J4MA 3KBEA 4Z7OE 1HJBC 1A80A 3PFQA 4NLAA 1HKFA 4R3SB 1Y1DA 4R2GB 5T1LB 1OLZA 3REWB 2VDGA 4MWAA 3MRQB 4F7TA 5IESL 5IEKA 1VBHA 3QIWA 3MRDA 5FF3A 4I89A 4NX0A 4NG3A 4PTTA 1VKFA 5GJTL 2VDHA 4QWWC 2OVLA 2TAAA 3TVMD 2SEBB 4JEJA 2W9LA 5GGVH 2OWWA 1ZLEA 4F2UA 1LROA 1FHDA 4YSEA 4OJCA 3I7RA 1IGFL 4OSUL 4L0PB 3BSMA 1ZU8A 2W91A 1RKRA 1GGCH 3B3BA 2P0OA 1T5XA 3L3OC 2ZWYA 1G7JA 4GQQA 1V3HA 4PJ5B 1CBJA 4NCC2 4F2ME 5JPMB 2EXSA 2YUXA 2J44A 3F6IA 1F7BA 4DN3L 3FN3A 3HOJA 1ZRUA 4W9ZA 5D7SL 3O0FA 1WA0X 3FU7B 3QC3A 4FI4A 3GIVB 1A7RL 4HMNA 3IMBA 2J3SA 3NQAA 4LTSA 2XSBA 4PWIA 4P46C 1RK0A 1GC1H 5D1QB 1JGMA 3OG3A 2H1LM 3K5RA 4Y9PA 1CZ1A 1BHGA 1UM5H 2AQSA 3TDFA 5AN7A 1Q9OB 1MPAH 3CFEA 4N4PA 4CMHB 3BCFA 3IJ9A 2O4EA 2OX5B 3WNLA 1WX0A 2G4FA 5EPMA 3KP1A 2H90A 4FULA 5T3XH 2CO6A 1XGEA 4Z6AT 5A1AA 1JJKA 3BLPX 1JPMA 2DZEA 4NYUA 2K8QA 4WWKB 1V6XA 5DHVH 1WIUA 3D4CA 2O4QA 2RAGA 3HNSL 3UG4A 4OM1L 3KDNA 3S36X 3TA9A 4IRSA 4ACZB 1FPTL 2FBJH 1NJ9A 4PVMA 2IBGA 1L7IH 2R15A 3CVBA 5CMAB 4JN6A 3BVTA 3EOBB 3B0YA 3MWAA 4BDVA 2PLJA 4DF2A 1DJXA 2VN6A 1Z7JA 1G7MA 4LFYA 1ETZB 2H6OA 3B0PA 2VOTA 4Y4HA 4C1NA 3UH8A 3G08B 4ZUWB 1E7UA 2X88A 1O7DE 3ZWTA 5L2KD 1LOQA 3ARDB 3GQYA 4YLQT 3BARA 3BDBA 5GSVA 4A22A 1VHNA 1EJRC 4LPTA 3QZWA 3CK0H 4IBTA 2EH7H 3K5XA 4PJEE 3CDZB 3N43B 4OB5L 1A3LL 2Y7QB 2H2PC 5A6TC 4RIRB 2VX5A 5IM7B 2JTYA 3PHQB 3PWPB 4S3BA 4FHKA 3QY6A 3VAEA 3MJWA 4N5EC 1F11A 2VM4A 2CRYA 3VD3A 1DQIA 5E09A 2IG2L 1V3JA 4XNXL 1AO7D 4D0DA 1OPGH 1A64A 4PG2A 3HG4A 1ORSA 3UJIH 3TN0D 5A6LA 3ZZQA 5JXQA 2YZ8A 2NDGA 1TPB1 1XYBA 2NW0A 2PZNA 2JE8A 4AZ8B 1PJ9A 2HVJB 1V0MA 3UZQB 4KX8A 3QYMA 1L6ZA 2CDEB 4AG0A 2GFTA 4V1YA 3BOVA 2WZ5A 1G4MA 4YO0B 1KV8A 4GRWE 4P9HL 2GVGA 2FR4A 3N18A 3MUJA 3CMJA 4HJJL 4LAQH 5E2UH 3GWJA 5I8EA 3BFOA 3SGJC 2GJXA 3EWWA 3NP4A 4APQC 2GGEA 4KO9A 2XBZA 2FO4B 3VGAC 3O4OB 5TF1H 1TJHH 4JM2C 1QPQA 4IIFA 2QVFB 2JJTC 1B4LA 3ZDXF 1QNZH 2F1AA 2XHYA 4CGTA 2XIMA 5F88B 5LQBH 1UASA 1AG0A 2VXTL 2MQ0A 1DZBA 2WNNA 3KXFA 3GLEA 2VJXA 3LSOB 4V1DA 2P3ZA 4PLJC 1QT1A 3DOIA 1MY5A 3OKMB 3KDPB 3MJ9A 3LCLA 3M7SA 2BBFA 5CCKH 3ARGC 1I8IA 2O56A 2R8WA 1XGYL 1KOAA 4WU7A 4OQTH 1XXDC 3QQ0A 4LSDA 4JAMB 3PV6A 4XO9A 1E56A 4NRYB 4H7CA 3QVAA 4IGMA 1U5VA 5E23A 4AISA 4GXMA 2VZOA 4ZRGA 3BCDA 3GVRA 1ZPTA 3CHSA 1UWTA 4Y1AB 3GTVA 4HK3J 3B2XA 4AMAA 4DZ5A 2WOYA 4NUMA 2AJZB 1NBQA 1R5WA 1QBLH 2AHIA 5DMLA 1TMCB 2CDFA 2NX5A 4NT6A 1Q9LB 2GEEA 4MKNA 5DJYB 1U95A 4UTUA 3AUVA 1A7QL 2BSCA 4CUCA 1WZ1H 3CH0A 2DMGA 3QCUH 4Y7EA 4IBYA 3KVJA 4UDUA 4AX6A 1JUFB 4IPNB 1AK5A 3N17A 1TWWA 3QW4B 2ZNXA 4KAQL 5I07A 1PD6A 1I8AA 1XLAA 3MRMB 4BWWA 4D2JA 1S2AA 4O52A 1S2CA 1YMME 1BYCA 2FYVA 3D0AA 4Y7OC 1PYWA 2X53A 1RV6X 3MRIA 3CDFA 5KJ4A 4MXWL 4UT6H 4F15B 5I19H 1X3DA 3W1AA 4N4YB 2QT3A 4JFQA 4GO8A 4PV8A 4Y7MA 5G4MA 2JF1A 4ES8A 5KS9E 4PBXA 3AXXA 5DC4B 4PRNA 4E8GA 3M0XA 3QORC 5JIQA 1MKFA 1HKIA 1RZKC 2ESVE 2HTLD 4I3RL 1MAMH 3Q13A 3M1CA 2BLFA 3OGCB 1U8QA 3U4AA 2LAGB 4MPQA 2QCDB 3W2UA 3V0WL 1LBMA 3U25A 4FQHA 1QA9A 2EC8A 4HGWB 1S7WA 2HMID 3COOA 1BVWA 3R0MA 1E40A 4Z3GA 1OAZH 3QZBA 3GI8L 1O6SB 2GIYA 1TQCC 1XHHA 3TUUA 1XMEB 1Q9WA 1NQKA 2ZX5A 3F7LA 4K3JL 3S35L 2DQTL 3G1FA 1X4YA 3BXNA 1H60A 1G1KA 4NI6A 4JTQA 3HO8A 2CHZA 5C08A 3O05A 5F9DC 5FGBC 3PV7A 1U2CA 4FI7A 1SFLA 1KQYA 5I79A 4TQTA 1Q0YH 2EXWC 3FQRA 3GGWA 2CIKB 1E6XM 4FXKA 1KQZA 5L9DL 1BGXH 4HCDA 3BO8A 1M71B 4NQXB 2LVCA 3V4LA 4BCYA 1YEFL 2APBA 4LRNH 2VXQH 2XV2A 4LVAA 3QJHB 2CLIA 4NM8L 4ENEC 4OLWH 2NZ9D 3VFWB 4HUVA 4L4VD 1TO5A 1VJSA 2DYPD 2YN5A 3D85D 3ZTDC 2BMBA 3MODH 4JQ3A 1Q5MA 2G4EA 5EU6D 5JVLA 3BC9A 4FLSA 3VMOA 3ZVHA 4W85A 2BNUB 2WP3T 1RZGB 1HAUA 2PGFA 4M6OL 4L9XA 5G2WA 5JHDD 4RESB 2N01B 5EOTB 3C09B 1KO0A 1GYMA 3HR5B 3GTTA 4FFTA 5JQIB 3H56A 4JKKA 1IF2A 1SXSA 1EQCA 2OWCA 1LJYA 3HNVH 1XS2A 3K0WA 1GSKA 1VLWA 3N19B 2WVVB 4QRAA 3VXPA 3OZ9L 4XPBH 2WY3B 2PP1A 2J7HA 4DB7A 4GXVL 5IFHL 2OQJB 3DV6A 3K46A 5HR7A 2ISDA 3KLSA 2WYZA 4KTEH 3PWLB 4RAUA 5DT1L 2NMSA 2NUXA 1I1AB 2AL2B 1ZEAL 5D7JC 1CC3A 1JWSA 2R0ZH 4IG2A 3F8UB 4DJFD 3BUBA 1HQRA 3B8SA 3WLKX 4XNQB 2E47A 4HG4J 3AT9A 1ZAGA 1IEIA 4Z1DA 1GMEA 1H6EA 3IIZA 4N9GB 2WBXA 3DOPA 1U8NA 3B8WA 2AEPH 3WBDA 3BVWA 2YUZA 3ML8A 1UXSA 2HVNA 3ITVA 1BXXA 2WV3A 2WXJA 4FEMA 3EMZA 3OKDB 1JZ6A 1RBAA 4E5XB 1G6RL 2ZG3A 1ODUA 1XFBA 1U8OA 4A2EA 1SOSA 2EDRA 4Q6YA 5LNWA 5L88H 4DYEA 2ZX6A 3ZKXB 4MZ1A 3ZT7A 4LHQB 4UXDA 2J4WL 2ATMA 3P84A 3SN4A 4PRDA 2WPGA 1WF5A 3UERA 1HXYB 2JFCA 4I9JA 1N0LA 3WEZA 1AMXA 2O61B 3PWUB 4PUNA 5K39B 2UXVA 1V02E 1KYDA 1PIFA 1S3RA 2BM3A 3AUWB 1JAEA 5T1DH 3CH8A 3LEYH 5T5FH 1I8KB 3WF0A 1C08A 2EH8H 5SWSA 2IPTL 1K6WA 3UADA 1MWAA 4EK7A 5JA8B 4R26H 3LH2L 5C9KA 2IQAB 5HHQA 2FIKB 3P4OB 5KUKA 2OQHA 3X14B 1BVZA 1OFAA 3VCLA 1UMLA 4J35A 3E6FB 5H6HA 2DDQL 1T2JA 4M1CD 3ITCA 5LKYA 4NNYB 3U0PA 1R33A 1AR2A 4D9RE 3GZPA 1CFMA 3ILPB 4PJFB 1Z44A 1FHLA 5FO9A 2ZZ1A 4XNUL 4R7DB 3PZMA 3TM6A 3NCBB 3ANUA 3OU8A 3W57A 3TBTB 2EKSB 2VEPA 3BMWA 2BPBA 5AOIA 5GXBB 4URIA 5DBTA 2XX1A 3QV6A 1QACA 3Q8FA 2OZ3A 1KZYA 3LKRB 5BW6A 1WYJA 2QIIA 1KJ2A 1X5KA 3OR7A 4IMDA 4YSDA 5C7XL 5G4NA 2WM1A 3LERA 3VFPA 3TYCA 1MVUB 2EACA 1OCNA 3D9AL 3WN5C 4FAAB 4FHBD 1GONA 3WK2A 3AFBA 5IJKC 4YNYA 1WFJA 3B8UA 4FZ8L 2VCOA 2Y23A 3IM1A 4TQIA 3BAJA 3RX2A 4AL8H 4MNQB 3DTDA 1YJDH 5A16A 3L13A 4EIBA 2PGRA 4MWAD 5E51A 1YECL 4PJ7E 3TYGL 1O5XA 3QIWD 3L4WA 4MAYB 1DJSA 4HYTB 1V4YA 3SHSA 3HMWH 4Y4FA 4IJRA 4XO7A 2PTDA 2XDHA 5D7LE 4PD4K 3D39B 3KRUA 4B97A 3EOAA 4M7TA 4UMSA 5IT2L 2FGWL 4OUUA 4QHMA 3SPVB 5TTRA 3N2MA 3P4NA 3BGFB 4TUUA 3GZQA 1NBYB 4X6CF 4HLEA 1EANA 3DHFA 3GG1A 1IX2A 5IFAL 2NY1B 8FABB 5IQ9B 4LEQA 1JNNL 4PJ9B 4JFPB 1ACXA 1PU0A 2DQJL 1FGVH 3O0RH 4MXQC 4LAUA 1U8LA 2ZOKA 3A24A 1TPEA 5DK2B 2GTWB 4M9OA 2GFBB 4QRQA 3U8GA 3CJJA 4ELMF 2MOGA 4AV0A 3MRGA 4NLHA 4U7SA 1QASA 2IPWA 1AZVA 4G8FA 4XX1G 1SZGA 4K38A 4M4PA 3C2EA 1Z9MA 4BQ8A 3QHNA 2HFTA 2FVLA 3BZEA 4UTLA 2B59A 3TFKD 1M65A 2PWGA 3SGEH 1L7TH 3W7QA 3RJQB 1MJUH 4NILA 2BCKA 3QQ3A 1N0XL 5FJOA 3AJ7A 3NVDA 1TJIL 2VDLB 1OF8A 1YQVL 2H32A 1BVKB 4F7CA 3WY4A 3CAWA 3GZAA 5DCDA 2LU5A 4IRSD 3VFNA 2ZJSH 1KG0B 2Y63A 2XH7A 4XI5D 3HVNA 1EP2A 1JDDA 5C0JA 1WWAX 4HPGA 3VIIA 2EP6A 5MHSE 4GIYA 1KCWA 3PBUA 3V4PL 3ZQXA 3RWDA 3CBJB 3SDXB 4KY1L 1BD0A 3ZKND 4OVXA 1QQDB 3RX7A 2VC9A 2D9CA 5ADOH 5C0CE 3MV01 4Y4HD 4BK5C 1KFEA 1Y7VA 4J3OD 4RGNC 5D2NC 3L5AA 4WW2C 1JXGA 5IR1A 3VFVB 1DWHM 3CQPA 1A0EA 1UVQA 4TMPA 3WLRA 3THMH 2HWZH 5CCZA 1P43A 4YC2B 4NKIL 3H54A 4PJGE 2ISSA 1ITXA 1QR7A 3HI1A 2BFGA 2XA8L 4FFZL 1FHUA 1S5IL 5B3JF 4L4TB 5BZWB 4MOZA 4DWSC 1MUMA 4W9CC 1I2NA 2Y07L 4ORGA 3LQMA 3HBQA 2VRKA 1VFAB 3C5SA 3E6HB 2EDXA 3CCHA 3DX8B 3WF2A 1LRNA 2J8UF 3VXMB 3JTTB 4NRXA 3NABL 1NANI 3H9SA 3GMPB 3R10A 4HJ0C 4NHCL 5DHEA 2NQJA 4TQHA 3FA3A 1NCWL 3Q2DA 3PHOA 4R0LA 3DTXA 1GCYA 1SDYA 1LM1A 3PWAA 4ETYA 4NQDA 2L7QA 1OP3H 3NQBA 4Z7QB 1NY1A 3IIXA 4O13A 2WPBA 2V37A 1RZIB 5E4EB 3DBXB 3G04A 1OGAB 1U8IB 4LBEB 3V7PA 3EBVA 3S47A 3PNWB 3LCFA 2OZ4L 2NNCA 4IRJA 2OW7A 2C26A 1JWMA 4JFWA 2BJML 4M6NH 2CR6A 5GS0C 2BMKA 1ZY9A 1RV8A 4ZFFB 4GHRA 4I9MA 3KRSA 3FB8A 4FMKA 1M1XA 4O57A 3D0VB 3RUBL 2L7UA 4DXVA 1U0QA 3MP4A 3NG5A 2CBQA 4K3DH 2E75C 5J7CC 5I66B 3F2BA 4LP5A 3KXFD 1L8NA 3T71A 4V1DD 5IB5A 3DNKA 4U6YB 2P10A 3DXIA 5JO5A 2FVMA 4E5XG 1E4LA 4C65A 1A1NA 5I76B 2G41A 5F1OB 1TV7A 3UIYA 4OOZA 1HKLH 5FK9A 3W23A 1CENA 1DVXA 3CPGA 3V4VB 2XUWA 2X4UB 4Z7IA 2W07A 3ZDYB 1W54A 4R4BA 2DORA 2B20A 2MNJB 3AJXA 3AXHA 3CSYA 4FFWD 2BRQA 3A12A 1JNDA 2Z6IA 3KTXA 2IMRA 1BX2A 3BE7A 4NO2A 1FWNA 1UPMB 3UJJH 1DVTA 1IM9A 3ZE0E 2NX5D 1OE3A 4TTDC 2IPKA 3IDNA 1A6TA 4PMEA 3TO4B 1L0XA 4YUEH 2CKBH 1CD8A 2CHDA 3S37H 3L4ZA 4ZSOB 4O8RA 3ABSA 2EEDA 4XCYB 1JFQH 5CC7A 2B7OA 3JUGA 3B7RL 2BOCA 1F2JA 2ADYA 1VIZA 3MJ8B 4HFWA 4LCVA 3BSZA 1EA9C 1VCGA 4O2FB 3KYNA 4N2CA 1PB0A 1RH9A 2NXHA 3L12A 3AVEA 4EUPA 2BW4A 4C7DA 5FA3A 4WV1B 4L5ZA 2OEKA 4OECA 4N28A 1F5ZA 1ZIBA 4JPQA 4P2QD 5IRPA 1CF8L 5JZ7C 4FG6C 3LCHA 1RUAL 1GQJA 5DFTA 2R69L 2FE0A 1Q9KB 4WNQB 2ZUTA 3SE4C 4C83B 5E1AB 4XUGA 1BJ1J 1WFMA 2YMXL 4CC0A 5EIQA 3UNDA 4CDHA 2VFGA 1X8CA 2JCCF 2XT1B 1VGKB 4AUUA 2HT2D 1MJJB 1XYZA 4OF0A 2KDGA 4L9LC 1YEKH 3WS6A 5CFAA 4U3AA 1SXBA 5CAYB 2EKGA 2W5FA 3FH8A 1XQKA 4PBFA 2H3NB 3KLHC 5K9QG 2NQLA 3TEYA 3VDCA 1A6WL 1YE4A 2VN5A 1C5DA 3VTMA 4OLEA 2MUCA 5ABZA 1AY1L 5C08D 3MKKA 3N73A 2ALWA 4DW2L 1PZ3A 2PURA 1BM3L 3NCFB 1S3HA 2VLKB 3WDRA 1HC1A 4HPXA 5C8JA 3CBRA 1FWCC 1VFMA 2RACA 3SDAA 3LKQA 2JB5L 1YTKA 3B2MA 3IMVA 2C71A 5B1BB 4MMXA 1BQ5A 3OVUB 1LLZA 1JV5B 1GPWA 1WKEA 3EZ4A 3AROA 3JYCA 3GRWH 1UQSB 1MN4A 1KC5L 1NOAA 2XN0A 3KPNB 2XI9A 4MY1A 4Y9NA 4KF1A 1M7OA 5D1XA 4WKFA 2N4IA 3CC1A 1R46A 1WUFA 3U4EA 4IJ3C 1R3YA 2UYLB 1MSSA 3STLA 5C7VA 3IJ8A 3ARUA 4PVBA 4AWTA 2WBWB 3FJTA 3ASOB 4AIXA 3JYBA 1Q63A 3GNPA 1N8OE 5D5MF 4QMEA 1I9IL 4LPXA 4P48A 4RNHA 1W8GA 1W9UA 1UD4A 3SKMA 4O50A 4N9BA 3WFDH 3D3VA 5E8NA 3SGUA 4B9FA 4HNTA 2OTWB 1N70A 5EH1A 3C5ZA 3BLFA 2AJVL 2CJSA 1P6WA 4Z95L 1EZWA 3UESA 1MNUH 2CHXA 1VC4A 5A8GA 4K3GA 4ZFOL 4GFIA 1AIFA 4ONHB 4ODHL 5DHVB 2HCVA 5MEPA 3ZBMA 2PAJA 4PYHA 3UG3A 4JFZL 2WINB 2R1YA 3UO8B 2AP2A 1FXPA 1LMIA 4QXTB 1CE1H 2YPVA 4H8WC 4MGGA 1X5JA 1THCA 3CZJA 5FEWA 3T5WA 5I0YA 4GBXC 3UF9A 1REQA 3RQ3A 4XGZB 3JVGA 1KD0A 3I6GB 2AV1A 3O3EB 5ERWB 3FFSA 3NCXA 1XMWA 1EXBA 1XI3A 3O6CA 2BNRA 5EOQL 4F33A 4TF4A 2H7WA 4KERA 2WWKO 2CLFA 3JRKA 1RUQL 3H42L 1FE8L 1R3JA 1AKPA 4BY3A 1CYGA 3M0MA 4ML9A 3DI2B 1QBAA 4JDEA 1FJ1B 5CF3A 3RXZA 1WAAE 3X1NA 1P5UA 5JYMA 1TZAA 5J11C 4RZ5A 3V0VB 2DWSA 3R1ZA 4FA8A 2AQ1A 3KGUA 1YTDA 3ULVH 2D03H 2J75A 4YHKL 3RY6C 1UJ3C 2O9OA 4PZVA 2MPAH 4LWWA 1WTLA 6CGTA 3HNTH 4YQXH 5SWSD 5JQHC 3SO3B 1PY0A 1ZAIA 4LLWA 2WW8A 1FZJB 3TEWA 1UXMA 3V6ZA 4HUWB 2A77H 4Y5XC 4N24A 2FEJA 4B3VA 4LCCA 2IGTA 4IZGA 2P8LB 2FBRA 3BSGA 1JGEB 1O6TA 4APXA 2APTA 5K9DA 3X12A 1GOQA 1HCZA 4C6DA 5MENB 1WHPA 2OJEB 1MJ7H 5C0ND 4YHNB 1GY1A 3WL0A 1RUML 1RVKA 2NYYD 4H1ZA 1NCGA 1HHHB 2XSAA 4M5YH 1XDMA 1H7PA 4M29A 1WD8A 3BDYL 3JVFC 3N2BA 3QT2A 2BNQE 1QPKA 1OD9A 2EC9U 4XBGB 3L7EA 2F1BA 2X2JA 3LTVA 3ONBA 4S23A 3VXGA 3DIFA 5D6DA 3NTYA 1JRHH 1SO4A 5TQLA 5LIXX 4GOAA 3GMMA 3MKCA 3QJUB 1TQXA 4KK9D 4EVNA 1E7VA 3TJHC 4OY9A 3NBNA 3VI4B 3T08A 5F89B 1CTNA 1HTYA 1K4CB 1ZAJA 5EO1B 1TV2A 1CXHA 5LO7A 5HXMA 4WTQA 4V28A 4Z1AA 1MFUA 2FECL 3S4TA 3FT3A 2ATPA 5IMOA 4QRFA 3SSJA 1EF2A 5A2JH 1A65A 2H2SC 3U7YL 3IJHB 2PABA 3H22A 1CS6A 1O1HA 4F7MA 4DJDA 4XP4H 3WJYA 5CSSA 2BRRL 4Y88A 2J8OA 3KBSA 3KPQA 4K6AA 4NOFA 3PJXA 3MRPB 1O7AA 2BY0A 4GAAA 4I48B 5DJ2B 1HH9B 1KFBA 3IDMA 3LZOA 4LVOC 4Y4FD 1T03H 4L4JA 4YL2A 2XDFA 1KB5L 4KVPA 2EYTB 1W3IA 4ZPVB 2AI0H 2ITDA 2QCNA 5AW6B 4ZFQA 3GMRB 2AJUH 3LD8C 2FZ3B 4FNTA 4N0UA 4FKHA 1TWZA 1R3QA 3TOPA 2O5XH 3DROA 3MLWH 5ILTL 3I6KA 3BD5A 4WU5A 1UZ8A 1X7FA 1GYCA 3CU1A 1NP2A 3N13A 3LI1A 1IAIL 5DVMA 3POCA 4EI5C 4IK7A 1CD1B 4U1NB 1ITCA 3AO0A 1J9RA 4PMXA 1EZLA 4JZNB 3IDXL 3AITA 3CX5J 3ZM8A 1GHSA 5J5EA 5HMDA 5FOBA 3HS0A 4HPOH 2DQUL 4RISL 2ZYIA 2VDKL 3R4IA 3DKHA 1FVCB 3BZ4B 3P8IA 1S7RA 4XVSL 1OW0C 1KPUB 1K03A 4XO6A 2D9QB 2FYYA 3CT7A 3ULUH 2BP8B 3K13A 2IANE 3WJXA 2ZXEB 4R5EA 3II3A 4LBRA 5FHAH 1LM8V 4LYPA 2QR0A 5E94B 1GOMA 1Q8JA 3GH7A 3UP8A 3VFSA 3CUXA 5MF5A 1NAKL 4PRIE 3HC3H 5GNYA 2ZRYA 1R6VA 4ZNCD 2QGHA 1GGUA 4QNPE 1GK8A 1WBZB 2QCCA 2R9HD 2AXHA 4R7NA 1QBMH 4TX8A 5LHEA 5CGYC 3I4EA 1OAKL 1QZ1A 3RVTD 5ALCL 4BR1A 3QUMH 4FADA 3EIFA 2BVWA 3RB5A 5J9PB 2DMKA 2G4GA 4CILA 1XH3B 4QHUA 2DWEB 4MTVA 3DJ9A 3OPUA 3JV6A 3K2UH 2QVHA 3C5XA 4HBQA 3CHEA 3EX1A 2A0LC 1FF5A 5FOOA 1JPTH 2V3EA 4FOMA 1RIUL 3TYFB 4ONFH 3B5HA 3DVFA 5F7EH 3QXBA 3BLIA 2W9DH 2BS8A 2FDBP 5I23A 3NRFA 4NKMA 2CLLA 5F0MB 2VLRE 1ZA3A 3OLEA 1V7YA 1M7IA 4XN1A 4NO0B 1TCRA 1NDTA 5HI5C 2BS71 5DFWH 1FNGB 2JNZA 2XZ7A 3TJ4A 1EJOH 1UB6A 2YK1L 1PKOA 5T26A 1LO4H 3FAWA 2GITA 4BQ4A 3LKSA 1LLOA 4N8UA 2GSMB 1DQLH 4UUJB 4KWOA 2CHWA 1GHRA 4UM9B 4GG6B 4OLVH 3WHXB 3P54A 3WJMB 1WCGA 1BYDA 1OGTB 2D7QA 3CHRA 4EX4A 1KBKA 3VFGL 1XIWB 2QNEA 3W26A 3W53A 4YHLH 3U30C 3OHXB 2HPTA 3WU1A 1L9RA 4XP1L 5CBJA 2EABA 3FQXB 4NQDD 1GJWA 1UP2A 4CCDA 2GYSA 3TL5A 3ZJ7A 4JRXB 1NKOA 3T2QA 5LA0A 3ECBB 3WLNA 2C5DC 1PWMA 3GC5A 1D7BA 2DZPA 3RMJA 3WD5L 1CVRA 3Q8EA 1N8FA 4I9TA 4P23C 1H7OA 1XBRA 2ARJA 2I9EA 5CEYB 2X05A 1AGEB 1QYGH 4IRJD 3X11A 1D7FA 1F45A 4LSSH 2HG5B 2YXXA 4XO4A 1T0MB 3PXLA 4BD4A 2OXGA 1PG7L 1ESWA 2PO6B 4WRHA 2XY2A 1J10A 2BVYA 1XEDA 3VMPA 1OGGA 2JF6A 5IBXA 4W7VA 1KLZA 3U9PH 2F8IA 2R1PA 3KPLB 4IICA 3LCYA 4N2YA 3UOAB 4FFYA 1THFD 4WOZA 3M6YA 4FQXC 5H8MA 1YNKL 1O94A 4ZO6A 5DMNA 1TTBA 5JXED 1AA1B 2DQGH 5B39B 3B9VA 5EKYA 1YDOA 2PD9A 4BFOA 3PZTA 1RP8A 4JO4H 3L95B 3EKGA 3UFIA 1KGWA 1OCJA 1IIIA 1THAA 5KZCD 2XY1A 4XMUA 4RFOL 4CNTA 4AQ8A 3MOQA 2X6CA 3F7QA 5HD8C 5IB4B 1F8MA 1QLEH 3N14A 4C6EA 5K9OA 3H3PL 5LCVH 4JBSA 3IJLA 3H7BA 3WUWA 1BWVA 5JDSA 3E8UL 1IM9D 4GG8A 3D4ZA 1E6RA 4TQEL 4M61B 1DVQA 3ZQ9A 2WBGA 1XGZA 3VCRA 2CR0A 5KYXB 1SO5A 1KFAH 2EIMB 1K4DB 5EZOL 3EJPA 1DSFH 1UA7A 2DJSA 4JQAA 1A4JB 1LE5B 5ECJE 2OYMA 5IQLA 5CJOL 5T1MB 4GI8A 2YRPA 5DRZB 3UGXA 4WFEE 1E0OB 3HKZA 5D4IA 1MCIA 3DBNA 4O2CB 1GVYA 4QCIA 4HZ8A 5TAOA 1AI1L 3V79C 1AR1C 2FNWA 3SCVA 3WLLA 5F6IC 1H3VA 4JFXA 3DGGB 3MX0B 2Y62A 2DH3A 2WD0A 3EYUL 5BZDA 3SO7A 4HCRH 3ZWSA 1IT9H 1Z7AA 2I9TB 5DDHB 1Q90A 4ZAKB 1X6NA 4B9JA 3CEPA 2J77A 1HOCB 4NQTA 3E2VA 4XXWC 3S5NA 3RO6A 2VEMA 3K1KC 2VAJA 4GQZA 3EBAA 1NFIA 4OFKA 3SJVB 3BT0A 2E8YA 3FFDA 3W2DL 1A4KB 3PAJA 3M1BA 3CQFA 3KG5A 4OCRH 3HAEG 3DX7B 4A37A 5GZOA 4F8QA 4M8RA 4PUKA 4O5LH 4X61A 4BYHA 4S2BA 1LG2A 4UV7H 2DQXA 4JFSA 1XGRA 3HMXL 5EO0B 1U2HA 1U1JA 6FABH 1BOYA 4PUMA 1S5MA 3GSNL 4X6CA 4GZIA 1B0GB 3D34A 2MOVA 4WOQA 5GRXG 1FG9C 4K94H 4OGZA 3ZE1F 3OZMA 1T04A 4RPQA 1DJHA 3KPSD 4PJDF 2OCFD 3AACA 1WNOA 5J6HB 2ZUVA 3BH9B 4IRZL 2BSEA 4F1SA 3W7IA 1XH1A 2Z1VA 4K2SA 3A4JA 1MWOA 1TEGA 4HS3A 3JTSB 3ME0A 4MKMA 4QUOA 3RVWD 2PDIA 2R29L 3FCTA 4FQIL 5PAZA 2ENQA 4QRSA 4ZD3L 3D2UB 1P7HL 1JIBA 3WAJA 3SDAD 3O63A 1F4WH 1RSYA 1FWJC 2WHLA 4WGVB 2FZNA 1TVBB 3RKPA 3WDHA 4ELMA 2ZP8A 1UOVA 2B7NA 2GSGB 5C0FA 2X0WA 3H6OA 1WE5A 4RE4A 4C60A 3AUJA 4M1DL 2CWNA 4MZ2A 3UWEA 2XWBB 4ILSA 1HT6A 5D1XD 5I1HH 5LXEA 2FGZA 3VVVA 4PWJA 1T8XA 3CASA 5C0IB 2EJ1A 1IXPA 4WEEA 4IT1A 4HN4A 4QS6A 1MW2A 3FTVA 3RPBA 3MLSH 2YBVA 2AZUA 5LGXA 3IAQA 1TETH 3GMOA 4GO6B 2P5PA 2F74A 1I0BA 4YTRA 2Z7KA 3NPZB 2HN7A 5EU7E 1Z9AA 1IZJA 3C5ZD 4OAWA 1KLGB 1UADC 2FWOB 4XXDA 4KKXA 2V7HA 2OI9C 4I77L 4KVCH 3QRLA 2BC4A 4PR4A 1MFNA 2VW6A 3F2DA 2AV7B 5IQOA 5AW4B 2FLRT 4LB8A 2AEOA 4KPLA 1C12A 5BS0B 1WQVT 3DMMB 4GAYA 2PDYA 4PGBA 3BEWB 1M03A 2EVIA 1NCAL 3O3AB 5JLZB 1Q45A 1KGXA 4HCGA 5E6UB 3T2NH 4YDKL 4N8CL 2VAAB 4IKJA 3TNMA 3CUPA 1IE7C 3S0PA 4B60A 4L56A 2DKSA 3B3IA 4C4UA 4Z5RB 5XIAA 3M0LA 4U1HA 1WUNT 2CH8A 3DXAA 3PUOA 1MHHA 4X22A 5KWYC 3S3PA 4GMTL 2ALRA 1SBSL 3ISYA 5DMKB 2D31B 2BNRD 4B5SA 5AW1B 2J8UA 1L2UA 2D2JA 2J7FA 4HB7A 4X6FA 2OMWA 4L0YA 1T66D 2VLJE 3TKFA 2K9FB 4EPKA 2WCAA 4HWEL 2WCPA 2QSVA 1OOWA 1QWNA 3L6FB 1IEWA 1LG1A 4A55A 2X40A 3N85H 5IB3B 4AGLA 4Y8DC 3B6SB 4GFSA 3RMEA 3UZWA 3V52L 4XCNA 4HOZA 1L8PA 3N2JA 3BWUF 2Q87A 4G5AA 3QO1B 1LK2A 2FBOJ 5T9CE 2NNFA 2OYKA 1CDBA 1FIEA 4OLZL 5AAMA 1H50A 2CLKA 3DJTA 5FECA 2JCWA 4PBDA 1UWIA 2DM3A 1ETA1 4DELA 2PBOA 2GVEA 2DMBA 4A4AA 3II2A 2OMYA 4JM0A 5IWLC 5HI3C 1J9TA 2DDXA 2NT0A 4HHAA 1IEQA 3SCQA 1CGXA 4O02L 5D9NA 3MRJB 1KPRA 3TBWA 5EA0L 4F57L 1JZ7A 1F5WA 3S3JA 4UT7H 2YZ1A 1LWHA 1NA8A 3LEXB 1EEUA 4EXKA 3M8OH 2IKJA 3QI9A 1YNLL 2VB5A 1GOWA 4EPSA 2SFPA 4R7OA 1MEXH 4NVTA 3D25B 3FB7A 1BBDL 4EPBC 2C9VA 3GTHA 3W87A 2UZYA 4N6EA 3GWQA 4XD4A 4KI5F 4M24A 4PMYA 5I6NA 3RX9A 2WLLA 4KW2A 2K3HA 3GSXB 2JKSA 1FNSH 4UNIA 2YC1B 1D5ZA 3D5HA 3RI5F 3FUDA 4E8DA 1S7TB 1JUKA 2C7UA 2J7LA 2G37A 2J6EL 4MYWB 4QLJA 5B39G 4FQ1L 1OARH 1IXNA 3HZ3A 3MHZA 2ADIA 4DJDD 1SN0A 1P0BA 5BU9A 4XWUA 4RRPG 3WLHA 4E38A 1KYUA 4JS3A 3AGWA 3HAEH 4KKBD 1DLHB 4XPAL 4ABUA 5FWRA 3RP1A 4UCFA 5E5MB 3O8XC 4I6VA 5IM51 1YKWA 2A99A 4NC0B 1J8HA 1GVIA 3E2SA 4A8RA 2CKBB 3MJ7B 2A6DB 2A3HA 3VFOB 3I6EA 2X4OB 3QHZL 1T6WA 1B0RB 3LNDA 1B3ZA 1CXKA 1A6UL 1BAGA 2FK9A 1MREL 3NJKA 4YSTA 4DTGL 3CN4A 2YD4A 4P5KB 3C3UA 2Y72A 2GBAA 2QELA 1GOKA 2JCCA 1MNNA 3GFUA 4KO7A 4FQQB 3MRHA 3FBQA 5DY3A 2YA2A 3ZX1A 1R5IA 2WBJA 5C07B 1F00I 3ARFB 2G30A 4S1DD 3KOYA 2IH1B 1T6VN 4LLUA 4XN8A 1Q6LA 1I2PA 5CU9A 3UGUA 4PTUB 3P0VL 3W1ZA 3WBYA 3E7JA 2GIMA 1XTLA 3NL6A 5BMWA 4XAPA 3M16A 2F54A 1A6VH 5C2BL 5B4MD 1BZ7B 2Z93A 4Q4KA 1KCSL 3QUXB 5KVMC 2JWYA 4JFEE 2AS5M 3F83A 5AHLA 5L7XH 5A2CA 1MFAL 4DNMA 5TH2A 5I73B 3BG5A 2VLMD 5JHMA 4MQ7B 1SJEA 4MDIB 5E8EA 4HUUA 4LNCA 2PYEA 1M6OB 5D8WA 5JIDA 1B2WH 1Z9OA 4BH7B 4ZMGA 3P7YA 1MUWA 3QR3A 2VISA 3QRHA 1JF5A 2DF3A 1QRQA 5TDPA 2JQZA 5DU7A 3MI6A 3VDBA 2CM5A 2ZVRA 2OSYA 2YDSA 3PGFH 2Z8RA 1DVFB 4LVNC 3UPMA 4X6DF 1G4TA 2Q10A 3BUIA 1MRCH 4GLRH 3MV9E 3E2QA 2AQRA 2PS2A 2PW1B 3QE5A 4NSKA 3VXSB 2CALA 1X7QB 3WFEL 3SCMB 3WH6A 1P7BA 4LMQI 1TA3B 5FLVA 2QTEA 4ZYKA 1XLIA 4ES4A 3FDGA 5LA1A 1HFUA 4LPUA 5D5MA 5CJQH 3GHSA 1AQ0A 3QIUA 4PRHE 1TYJA 5E8PB 2DPEA 4L29A 3GHTA 3UTZB 1AOZA 3W37A 2QLYA 2WMFA 3LBOA 4P8XA 2FH8A 2F5AH 1C1EH 3K71B 5EC1A 4RMQA 2ACRA 1OCWH 1W5NA 4WWID 4JHWH 4A05A 3TSBA 5BV7H 4QRPE 2LU3A 1KGCE 4W93A 4OZ4A 1XF4B 2GDUA 1FGNH 1AD0B 3L3HB 2EIZA 5SWQA 3V1HA 3NIDE 4JQXA 4Z2KA 5FESA 5A5WA 2DSZA 3EOLA 3GI9H 3IEAA 3AAZB 1GZGA 1KCZA 4QHRA 4DP4X 4Z7OF 1ISYA 3BEVB 2NOYA 3NJFA 2YSSB 3B7YA 3FUIA 4MNGA 4XQ6A 4A67A 1NFBA 4KCVA 3SBWC 1W1PA 3L0NA 3KRZA 4B50A 1KZQA 3IBEA 5I0XA 4MVBD 1Z2KA 3M7OA 3G77A 2FJUB 4F2FA 4I18C 2QGCA 1XRFA 4RNJA 3NN8A 3BW9A 2MQ3A 1EXUA 1FZKB 1MCDA 1CI3M 4XZ9A 1KCRH 4E41B 2OTDA 1UJTA 3IIPA 4OZFH 4ZTYA 3G1YA 1D3GA 5GRYA 3SY0B 4U1GC 3S6TA 5J04A 1CYWA 2IPGA 4PMVA 3VSQA 3DI1A 5FA5A 1QTPA 1OK0A 4W4NA 2C1PB 4E68A 3UA4A 1CX9A 5EOCL 1FWWA 3MBEA 5INDB 2FO8A 2F18A 1MIML 2W81C 5B1JC 2NZ1A 4B5WA 1MRQA 2E7MA 4C6LA 2NY5H 2P1YA 1TV4A 1LO0L 1RCYA 2XIDA 1BM7A 5TE4L 4F8TA 1OP3K 3L68A 3VFRA 3TSMA 4EANA 4HA0A 3L5LA 2YZRA 4PP1D 3UO1H 2J6XA 3P0GB 2XFWA 5KBPA 3HE7A 4AZCA 2Z9TA 3SDYL 3FDKA 1FCVA 2J66A 2O6PA 1W91A 3CUIA 4KJYA 2BY3A 4QOKE 1K7FA 4GNJA 1WA3A 3SCWA 1VFTA 2B4CL 3UTSE 3B34A 1T80A 2HJKA 2MTAA 3MSYA 1ZJIA 2JKWA 2R1XB 3MV7A 1NC4B 3R43A 5E6IB 4DK5A 3VC5A 2QMJA 4G7VH 3L9YA 3CUZA 1SJHA 4WEBH 1FVEB 4ZVJA 1V8EA 4EPDC 4OZGB 1P5VA 4MJMA 2K7QA 3V0AC 3IJ7A 1HILB 1Y18B 3KRBA 3CPLB 1TLMA 1MLBB 3ZT6A 3W88A 2GGHA 4ZW8A 1OHQA 1GTEA 3WUBA 3NEEA 2BG5A 4KJWC 4LCYB 1OCQA 3KJ6L 3ZVIA 2DQCH 1U3ZA 1BIIB 3LZ5A 1FNFA 3IETB 1H6UA 3JWDL 4NGHH 1GCFA 4YWGL 4NKOB 5A3IC 5D1ZC 3ZDWA 1E28A 5KYUB 2V2TA 1KEGH 1NSNL 2HSIA 4OIIH 5BWAA 1DEEB 4KQ3L 4GKSB 3LHVA 4Y8FA 3FTWA 2MWCA 3LEVH 4HK7A 4JO3H 3UR2A 4PJEF 2XM2A 1ZAHA 3STEA 1HVXA 2X0SA 3ORJA 4N2OA 1J9YA 4Q9RH 4U0QB 3FEQA 4PN6A 4J1OA 4JUTA 3E38A 2V3DA 2MKLC 4GS7B 5GZOD 2VWSA 3NGBB 2J71A 5F0LB 4PV1C 4LSBA 3GSOB 2XUCA 3HG2A 2WNZA 2ZSWA 3PP4L 1X7SA 2DQFB 2FX7H 1PIGA 3OR6A 5TBOA 2DW5A 3TA3A 4EP8C 3KYKL 2WCSA 2VXVH 4H2CA 4DVRH 3G6MA 4HMCA 5ITBH 3U9UA 2R2BB 3CFBB 1CL7L 2Y06L 4OI9A 4AIBA 5EFIA 2BSED 4MNHB 4AT6A 2KZ1B 4OV6F 4EN3A 5G5DA 3VD1A 3HZMA 4N25A 1B54A 4KV5F 1UZHA 1CICB 1OCRB 4IFKA 3KL3A 4KRTA 2VUKA 3EGSB 2ZKMX 4NSBA 2PP9A 4K8RC 3GR8A 3ALWA 4N0FA 3S7GA 4Q6KA 3KPMB 5IKCB 4IGBA 1X98A 1WDQA 4PHXA 1D5RA 2WSQA 5IOPB 2V2WB 2JH2A 5MI0B 1E9OB 1Q94A 5CBEB 3MLTB 5DD0H 1ZWIB 4ZB2A 1JE6A 3BWAA 4KJPC 4PJIF 5EF2A 1GPOH 3N34A 1QFOA 1C7TA 5CEXB 3SE9H 1V0KA 1EC7A 3CTTA 1SVCP 4MCNA 4RZCB 1LTXA 2EPLX 3EYFA 3FY1A 3O2DL 2XOTA 3WYZA 1UURA 1WDSA 1E4XH 2CBVA 3ABOA 3LLFA 4XKMA 2ZWKA 4P5RA 2ORBL 3AU6A 1TQVA 3ZJ6A 4YEEA 1UOLA 5AC8A 3M7WA 3T7VA 2K1MA 4WKHA 3DX9B 1UPPA 4EZMA 3PJSA 1MFCL 4I7UA 3QUMB 5K69A 4Q4MA 5LBVA 2VE6A 4DERA 3L5JA 1TXKA 3CFCH 4DBWA 4Q97A 1E72M 5KSVB 4FXTA 1V6TA 1OC5A 3KPOB 4R7WA 3DX6A 1NGQL 2IKGA 4E0CA 2IGLA 3JXAA 3RPKA 1P4BL 2GIXA 3GXUB 1RHCA 5EMJA 3DXAD 1O12A 1O6IA 3NACL 1TZIB 4KKLC 5AOMA 3C60B 1IGJA 3W0WA 5KVDE 5HBFA 5LGKA 5GS1B 3HHSB 4DP9X 5ADPL 2R94A 4ORZC 4FO4A 4ICXA 1IT8A 1JN6A 2IBZY 3OKLA 1SQ2N 1TR9A 3Q9QA 3NPXA 4JY5H 5LJYH 2FX8H 3L5XL 1J6PA 5KS9F 5G2HA 2UBPC 3BAWA 4XMTA 4F66A 1PPIA 3TASA 3P74A 1AH4A 2V7NA 4P5SA 1IIKA 4X0NA 1T2XA 4GIPD 1A7NL 2XWRA 4HOMA 4AZ5A 1AL7A 5K9KB 5DRIA 3CFIC 3B9KA 5TDOA 3T3PE 3OZLA 1GYLA 4PL2A 1HZHL 4GP5B 3SOBH 4MMZB 1UMYA 1ZT4A 2R6OA 4FA3A 3FSAA 4ATLA 1GGIL 2FFCA 4XO3A 3GBNH 3QJTB 3GDLA 4G9FA 4HK6A 3APDA 4RRPM 4X4XA 2VOMA 3HLAA 3VXRA 3JWNC 1AHKA 2Z1XA 2GJ6E 4MX7B 1KFCA 1J5SA 1WDPA 4UILL 4KK8C 3G2GA 4N3UA 5DQDH 3AB0B 2EPMX 3WG6A 2ENSA 4WDXA 4PJBB 3ZYIA 3NZ8B 3QI9D 3RX5A 3QSTA 5FM8A 4KZEH 1Q1JL 5IGXL 3QXAB 3QQDA 3ETSA 5KBMA 3W72A 4OZHE 5LHDA 3IWUA 4CQAA 4WHTB 3VQMA 1MW3A 4LZKA 4KNQA 3CSBA 2ZPKH 4I5BB 2DM4A 2PYFA 5KBLA 5E93A 2J6WA 4FTVA 1LILA 3AIRA 1TYRA 2MTPA 4JQIL 5C9XA 8RUCA 4CAGA 5F3HA 2KKQA 1VFBB 3EF7A 2K7PA 2Z4GA 3QFDB 2XPGB 2G5RA 2AGTA 3FOLA 4YIQA 1CLZL 3MN8A 4GA8A 1US3A 5I15L 1F3WA 3REQB 1UW9A 1JHTB 2JELH 1QLEB 1NUGA 3QJFA 4PQXA 3MYPA 3LDBB 2H4EA 1XW8A 4LKXB 2I7SA 4ADTA 5I8KL 3IPBA 5EU4A 3HN8A 1J8HD 5FOJA 4AYGA 4HIEB 4AM0Q 4YSAA 4UFMA 1KRCC 5CP3H 2C16A 1MIEH 1B4EA 2DLTA 1OSZB 1G6RA 5K4XA 1A3RL 4O4WA 1TWIA 3NCEB 5JUEL 2YA0A 3VX1A 2Y88A 1CURA 2L3BA 3DSFH 4D8LA 4GIAA 3UC2A 3IRPX 3BMXA 5DD1L 1QI3A 4AY7A 5E7BA 5ALBH 2ZX8A 1LQAA 5HVFB 2OT1A 3CIXA 5EU5A 4JTTA 5DMMA 3NIFE 4N2BA 2WKGA 5DC9B 3VXNB 2V30A 2WBJD 1EB3A 1FAIH 4ODSL 1OINA 1YAIA 1T5WA 1AW1A 2ADFL 1R3HB 5G4WA 4CRPA 2ZUQB 5AOZA 5HGAA 3KHQA 4PRPA 1XO8A 4PJDA 2D7TH 4WI8A 5ISZB 9CGTA 3AADB 5D72L 4F8OA 1HKJA 1YYMH 1CZ8H 5I1IH 1W3JA 1AQKH 3WD1A 4Y16B 1H5BB 4JG0H 3W11D 3HVDA 2YQBA 2PYED 3LIZL 3WH8A 4EACA 3PQYA 3EFFA 3S3SA 2XFXB 4UANA 4BGLA 3LRSA 5D70L 1EHLH 1N2VA 3PY9A 4JPIB 2VM8A 4P2OC 2JIXB 3E2HB 1X9UA 4PUBH 4KKAD 4D6EA 3W9DB 1BQRA 5LAXA 5EMUA 5CWSA 3KS5A 2X4SA 4X99B 4DI8A 4C56A 1XR9A 4XVTL 1KM5A 1KN2H 5BZXA 2D73A 1ZZMA 2DLIA 4GD0A 3FX4A 3SECA 4IIQA 1GNXA 3ANVA 4H88L 4AEFA 5A2BA 3G1VA 1GKPA 1PX8A 5E6ZA 3QIUD 1TJ0A 1L6PA 1SOKA 5DZ9A 3KLAB 4IXXA 3V7MA 1A3WA 2X09A 5AEAA 2OXNA 1WAUA 3P9LB 2YPKB 1GS6X 3RWIB 1DUYA 1USQA 1Z5HA 1W1ZA 3FTXA 2BSDA 2GGIA 2VGBA 1OK8A 1FLRL 4HOWA 4S1QL 1YYLL 4HKJA 3RA7H 4ADJA 3U7AA 1L9PA 4ALAH 3BKML 2R1WA 3WDPP 4KGJA 2VFFA 3A22A 3PB0A 4LAJH 3AM8C 2LW3A 5FF0A 3O41B 2IDFA 2CLMA 3U7BA 5EZLA 2YWZA 4JL1A 3UTTA 2GY5A 4N3TA 5K59F 2F53B 5DRNA 2HPMA 1T89C 2M1KA 1ZB5A 2NUTA 1IGSA 1RPQA 1EZSA 1YEHL 4NJJA 3TMLA 1IBYA 2JF7A 3GSUB 4FABH 3NSDA 1JCKA 3B8IA 4QG8A 2RUSA 1HE8A 3AY4C 2PRLA 3FNKA 1I0DA 3WLQA 3TZVB 4WCJA 1WCBA 4XTRD 1IBBA 1KCVL 2EUVA 3RLSA 2RFGA 1FKXA 1YLBB 3EB3A 3W1XA 2GK0A 1SO3A 2ZX7A 2C4FT 4P4RA 4PR5A 7ODCA 2OODA 4PAZA 3C5QA 3MBED 3GJEA 2J1YA 1LEKB 4ZBCA 2FPTA 2UVEA 3GU9A 5F97E 1KWGA 3QDGB 4TNWK 5EFFA 2DJXA 5EORH 4XX5A 4DZBA 3D47A 3THDA 2FFIA 3CIAA 4KUZL 2ACSA 2A1WL 2VDPL 4YK4B 4WW1A 3CC5A 1XR8B 2ZQ0A 4N0YH 3HE7D 4Z7UF 4KRNA 2JKNA 5ANMB 1GGTA 1SBBA 3K6IA 1UA6H 5F7FA 2HJLB 4LKCB 3QDMB 1UM6L 1N6QL 4ERGA 3ABXA 4DPAX 3GBEA 4OD2B 3BJTA 4WGKA 3MV7D 2V8LA 4MD0A 3UGEA 2TYSA 4TNEA 1TT6A 4DPBX 4JIRA 4IGHA 1KTLA 2DAVA 4DZ8B 4BI7A 1PEZA 1ZK5A 3X1GA 4U6XA 2Z0UA 1E6PA