2ZX8A

Alpha-l-fucosidase complexed with inhibitor, f10-2c-o
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
441
structure length
441
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 163
structure length 441
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zx8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zx8A01
2NT0A 4DO4A 3L4WA 3SUVA 4AZGA 1GW1A 3A24A 2CERA 1H5VA 3LPPA 4GO9A 1B3WA 4JFUA 2X0HA 2E8YA 2NW0A 4CD8A 2CHNA 5I6SA 1LQ0A 5IXEA 3VINA 2DSUA 3VIGA 3DDGA 4BQ4A 2DT2A 9CGTA 1EQCA 4MB1A 2JIEA 2E3ZA 1MFVA 1B3YA 4CGTA 3VIFA 4YN5A 2D3NA 2D0HA 2WVUA 3CZJA 2WVTA 3NSXA 2WHLA 1HL9A 4U31A 3LMYA 3N11A 3D4ZA 2YLAA 5D9PA 4OOUA 3S2CA 3WDHA 2ZX9A 1J18A 2G8ZA 5E6ZA 1HT6A 3II1A 3OLDA 4MJ2A 2YA1A 3FHAA 4JKMA 3T2QA 4J27A 2BV9A 2FYVA 1W2PA 3LRLA 1CXEA 3L2LA 2FDMA 3W29A 2EBNA 2WMHA 4M82A 1UUQA 4PCSA 1ZBCA 4W84A 3L4TA 4H8UA 1PPIA 4V28A 2F18A 1BVZA 1E4NA 3AHYA 4URIA 1KBBA 4KRTA 3DX4A 3W28A 5CXPA 2GJXB 3VMOA 4RE2A 4ZEPA 1CTNA 2DT0A 4NRRA 3BVXA 1UD6A 2WHJA 3CZKA 1G94A 1H2JA 2F8QA 1DWGM 2WHMA 4OBRA 3OG2A 3BAXA 5ABGA 1EOMA 4JKLA 3ZSSA 3SURA 3VOCA 4AZCB 1Q6CA 3PBGA 4QLLA 1ZBVA 4MDPA 1JXKA 1XH2A 1PX8A 2WPGA 3QOMA 4HPGA 4WKAA 3BUQA 2OW7A 2F1AA 2EACA 1HX0A 1B3VA 1JG9A 3NYDA 4JFWA 3ZJKA 4PMXA 1W2VA 4LXFA 5BXTA 3I3DA 2VZOA 4ZXOA 4MAVA 5A94A 2X2IA 2YIHA 2VTFA 1VEPA 3AS1A 2UY2A 3ZR6A 2A3AA 2FHCA 2CETA 4M80A 1KBKA 2YBTA 4YHEA 1ISWA 4E8CA 5E6YA 2WC3A 2ZXAA 1J0JA 1SR0A 3M46A 1WDSA 1DTUA 1CXLA 1B30A 2BS9A 1ZL1A 5A6AA 1RP9A 3RPMA 3OGSA 3VDCA 5A6BA 3GZAA 1E70M 3EJPA 4ML4A 1UWSA 3PZOA 1Q4NX 4PMZA 1MW1A 4AD0A 1NP2A 2C0HA 4UFIA 1JF5A 2FHFA 1GNXA 1QOXA 3M07A 3GH7A 4JAWA 3DX2A 4WKHA 1KXHA 1GJUA 2WCGA 1TVPA 4HMDA 4PRWA 2JE8A 2ZUVA 2WC4A 3AHTA 1BGAA 1E6QM 1Q6EA 3WF1A 1UZ4A 1D7FA 3DX3A 3J7HA 3TTOA 3TP4A 1KR0A 4UOZA 1ZBKA 3A22A 3UCQA 2PF0A 3AXIA 3KL3A 5M5DA 4Z2GA 1QNPA 2VRQA 4QAWA 2J8FA 1VJZA 3AMDA 1QI2A 3N17A 1GORA 1J01A 2ZUTA 3N04A 3T2PA 3AOFA 2ZUSA 3N12A 1EDTA 5D8WA 2RGLA 1VBRA 3WY2A 3N18A 3HG4A 4W85A 3AROA 2D0GA 1PIFA 4UQAA 2UY5A 1ZJBA 2YFOA 3CH9A 3WQ5A 2J7HA 1UD8A 3F4VA 1R75A 3W6LA 3DX0A 1L8NA 3K4DA 2QMKA 1R85A 1ODUA 2A3BA 1JZ4A 2WSPA 2QHAA 3U5UA 2ZXBA 3ZR5A 1FHLA 1VAHA 4B3KA 3UG3A 2OYLA 1OT2A 2BVDA 4D6JA 4BQ2A 3H53A 1Q6FA 3BLBA 3ARUA 4OJYA 3WNLA 3WL0A 2Y2WA 3AMLA 1HN1A 2DSWA 4FNQA 1MQRA 1ISZA 5CPTA 4CU6A 1K9EA 5JIPA 3EYPA 1R34A 1UWUA 1KXTA 3W26A 5M17A 1MW3A 4Z2HA 2ZWYA 3IJ8A 2CBUA 1UOKA 4PMQA 4GI8A 1CDGA 4AMCA 1A3HA 3CZ8A 4AXNA 1WDPA 2W61A 3PZIA 3BUIA 5E0FA 1JNDA 4ACYA 3BAWA 5A95A 1OD8A 1OM0A 5A8OA 2XWDA 3PTQA 4PMOA 1ITCA 3PZGA 2D1ZA 2J8GA 2VMFA 4LQ1A 1GUVA 5GQBA 1C7TA 4NX0A 2D24A 1FFQA 2X0YA 4ATLA 3K8MA 3ARRA 1KWKA 2DSZA 1PAMA 4V27A 3VX1A 2MANA 3OLEA 3SCSA 4AEEA 2OYMA 1PIGA 2D20A 3A4AA 4B9YA 2D0FA 5IHSA 1DHKA 2XG9A 3W25A 1GOWA 4PTXA 4DM2A 1V6UA 3CUFA 4BQ3A 4FLQA 3W27A 3WN6A 3AXXA 4F8XA 4TOQA 5CZKA 2QV4A 2EAEA 1ISYA 3EBVA 3GH4A 3DX1A 4OKDA 1R86A 3AHVA 4GQQA 3GTNA 5EBAA 4NZFA 4LYQA 1WP6A 1V0NA 5ABEA 2WZEA 4J3UA 1ESWA 3THCA 5C70A 1PBGA 2QMJA 3TOPA 4FNUA 3DYOA 4Z2LA 3CZNA 1MXDA 2BY1A 3AS0A 2CEQA 3VILA 3WNNA 2ZIDA 1YQ2A 2HVMA 3OGRA 2VVSA 3W81A 3ZMRA 2HISA 1RD6A 1V02A 4HZ7A 2DDXA 2J75A 1UR2A 1UD2A 4XZBA 4TVUA 3WDJA 4AIOA 3KLKA 5CSYA 3SUTA 5DFAA 1GOMA 5GPRA 1BG9A 4GPNA 1EIBA 3VGEA 3D4YA 4JHZA 4CU8A 2DQXA 3ALFA 1XC6A 3QHOA 3WH7A 4X0NA 1M04A 2BXZA 1WAWA 4Z2IA 5DF0A 2ZXDA 2J7BA 2VOTA 3KL5A 3HMCA 4F79A 4DWSC 3A47A 4FNRA 2XSAA 1W9PA 1JF6A 3VKKA 1V02E 3PZTA 4UZSA 3B9AA 1HVXA 4MB4A 1FHDA 3UESA 2XWEA 4F66A 4CD6A 5CQ1A 4HPHA 1NARA 2X8RA 1CXFA 2AAAA 4UZUA 1HVQA 4AMWA 2PWFA 3GXNA 4H04A 3SIMA 2VL4A 8A3HA 3AZSA 1QWNA 5I23A 1HKJA 3BCDA 4NXSA 3F5JA 2XN2A 5KEZA 2PI6A 3AI0A 1ZB5A 3W53A 4F9DA 5E0CA 4LX4A 2WXDM 2J62A 4CCCA 4AD2A 3A4XA 4FK9A 3VD4A 1HXKA 1EHAA 2XVNA 4C7GA 4CVWA 3VO0A 3I3EA 2JF7A 1QNRA 1W1VA 4B15A 1LLOA 2WK2A 3DYPA 3NSNA 3BLKA 2YL5A 3VIJA 3FN9A 2OYKA 1TQWA 1E4IA 3ZT6A 1O6IA 3ZIZA 4RE3A 1CGVA 3LXAA 3WMSA 2WZHA 3I3BA 1CYGA 1QHPA 2CYGA 2PC8A 1DP0A 1BFNA 1V0KA 1GQIA 1R47A 1E5NA 1TUXA 5CSUA 3AYSA 1IZJA 3CO4A 1QI0A 1XHGA 4HA4A 1GVIA 5IFTA 1J0ZA 2V5CA 4IPLA 1T0OA 4PTMA 1EO7A 4J3XA 2JEPA 1J0YA 1XSKA 2W5FA 4HTYA 3T2OA 1HJWA 3L4UA 1TE1A 4XB3A 4DWSD 4H8HA 1M01A 1C93A 4HMEA 4C7DA 4W7UA 3T09A 4ACZB 3W6MA 2ZX8A 2WAGA 5IFPA 1JAEA 1NP0A 3AZTA 2XFYA 3POHA 1W9XA 1US3A 3AXHA 5AC5A 4JCMA 2W91A 3GBDA 1E6XM 2J78A 1W9VA 2WVVB 2FE0A 1E71M 1GQJA 4BA0A 1KR1A 1US2A 1E6PA 3B9EA 3H54A 3ARTA 1B0IA 1UH3A 2GJPA 1MVYA 2VZTA 4D1IA 3CBWA 1HJSA 2WLZA 2VNCA 6TAAA 2DT3A 2E9MA 2G3MA 2FGZA 4DUXA 5FD0A 3VD9A 2BFGA 3WEOA 3QHNA 3VM7A 3NCOA 2EQDA 2GJXA 2BNJA 2IUZA 3POCA 1UH2A 4W8LA 1CBGA 1CENA 7TAAA 2VR5A 2A3CA 3BCFA 3VGFA 1CGYA 4XV0A 1J9YA 4AIUA 4CKQA 2XVPA 3W4RA 4WLCA 5F7UA 4W88A 1E6NA 4AZCA 3BAKA 4FNTA 1GQLA 4D6EA 1E72M 4KWUA 4M8UA 3WY4A 2E40A 2VI0A 1IT0A 3WNKA 3TONA 1E3ZA 1UWQA 4KRUA 2DSVA 2WKGA 1W91A 1RH9A 2OSYA 2ZX5A 1HJUA 1LG1A 1I75A 3WUFA 1GOIA 4UTFA 1PX4A 2PWHA 3FHQA 2CPUA 1QW8A 4AYGA 3GXDA 3VTRA 2XTKA 5LA2A 2QF8A 1JDCA 4MAZA 3IGUA 5A3HA 2WW5A 2YFNA 3GXPA 3VSVA 3CHCA 2Y4SA 4NRSA 4R27A 3CZGA 3RM4A 1NWUA 1D2KA 3ZT5A 1JAKA 4OIFA 1W3HA 3AIVA 1E1EA 4CVUA 1FFRA 4J3SA 3T08A 1LF1A 3VGDA 3K8LA 3BUBA 1R7OA 1UWIA 3M7SA 2DH3A 2GSJA 3A23A 3SCNA 4CU7A 1BAGA 1IV8A 2QLYA 3WF4A 4PMUA 3WMBA 3KEHA 5E70A 4FNSA 4N0RA 5ABFB 1SYTA 3AHXA 2XN0A 3ZJ6A 4WJXA 2Y5EA 3ALGA 2VUYA 4RE4A 4BS0A 2J77A 4UQEA 4M29A 4B3LA 3SUWA 4W8BA 1CPUA 4W7VA 1S46A 2JALA 4GINA 5GNXA 4Q22A 4XUYA 1CGXA 1PEZA 2QPSA 3WUEA 2WWCA 3WD3A 1UKOA 3G6LA 4PMDA 1Q6GA 2C8NA 1G9HA 3N13A 4ZFMA 1ITXA 5LYRA 2J7DA 5KZ6A 2W92A 1MW2A 1KQYA 5BROA 3GH5A 1IZKA 2CXGA 3ARYA 4AZHA 3GXTA 3EMZA 4DM1A 3S5ZA 2EADA 1J0KA 1L0PA 2XUCA 3MUIA 1JYNA 3VIIA 3W24A 1E6RA 3K4AA 4MTVA 4W89A 1MW0A 3NDZA 1B31A 5D9OA 4D6IA 4Q7NA 4TX8A 1C92A 5ECUA 4XX6A 1JNEA 3MI6A 3MV11 5BXSA 3SCPA 1CGUA 3PHAA 3PTMA 3SUUA 1NWRA 4W87A 3TTQA 4GZJA 2DEPA 3IANA 3AIQA 1EH9A 1NM9A 1UR8A 1AQMA 2RGMA 2FGLA 3AYRA 2GFTA 4QCEA 1UKTA 1E9LA 1KGWA 4M56A 4JFVA 4U2YA 1H4PA 4PCTA 4FLRA 1JZ7A 4S3KA 3VM5A 2O9RA 3ARXA 1BQCA 1HKIA 3GXIA 2CKSA 4QLJA 4CUCA 5CLTA 4U3CA 4K68A 3A4WA 3MMUA 3LPOA 2VX6A 2Z1KA 1G0CA 4WF7A 5AC4A 1LJYA 1BHGA 1EOKA 4P7RA 2BXYA 1V3KA 2ZXQA 2B31A 3VVGA 4WK9A 2X2YA 1CXKA 1KTCA 4DO6A 1E15A 1CGWA 3AFBA 3KL0A 3L4ZA 2Z1SA 3K8KA 2XVKA 2VZUA 2F1BA 1UQZA 4H41A 4U3AA 4ZE4A 1HL8A 3WL1A 4AIEA 2V3GA 7A3HA 3T0DA 1QBBA 4PUEA 1VFFA 1GHRA 1JYXA 1OIFA 3F5LA 4JFSA 4W5UA 3TTYA 3WIJA 2ALWA 2WMKA 3MUZ1 2F7QA 4H8VA 3AMGA 1EDQA 1MFUA 2VVNA 3MSDA 2VX5A 5D4YA 3BXWA 4E4PA 4UFKA 3PZNA 5JUVA 3QGVA 1CLVA 2UWFA 1OINA 1AQ0A 2CITA 1CECA 2GJRA 1XGZA 3MU7A 1OCQA 3GXFA 5EFFA 5CGMA 3PZUA 3WF2A 3O2LA 1UD3A 1RP8A 2XSBA 1R8LA 4ZE5A 1UR4A 1XH0A 1B1YA 3VGHA 4Z2JA 3NIYA 2WBGA 2DGAA 5ABHA 3UR8A 1G5AA 1TA3B 4CD7A 1V08A 3AQUA 1EGZA 5DMYA 5HOSA 4ATWA 3HG2A 3VSUA 1E55A 2XHYA 4R5EA 1LG2A 1VIWA 3EJQA 5M03A 1MXGA 3HG5A 3CHEA 4F9JA 1H0IA 1UR0A 4E8DA 1CNVA 1XSJA 1ODZA 2QPUA 1CZ1A 4HMCA 3NDYA 5CPSA 1CGTA 2V3FA 3PZVA 5D9NA 2WKLA 5IDIA 2J7FA 2DH2A 2GK1B 3EDJA 3T0AA 5A8NA 1D3CA 3OLGA 4HOZA 1PX3A 4YPJA 2GDVA 4X0VA 5CJ5A 3DHUA 4HU8A 4W7WA 2VO5A 1OBAA 1E3XA 3W38A 1Q6DA 1QPKA 1V0LA 3GNRA 3VGGA 3GYCA 4AZ7A 1SZNA 1H0GA 1VRXA 1J0HA 5JBFA 1WZAA 3RMEA 4HP5A 4A4AA 2WBKA 3ZM8A 1TG7A 1FA2A 2BVTA 4NZCA 1C8XA 5C71A 2EPOA 3PZMA 1UA7A 2W67A 1NOWA 1DWJM 5LA0A 3BH4A 1WCGA 4WSKA 4A3YA 4M81A 3HU7A 3LRMA 4D71A 1WO2A 1C3FA 1V6VA 3SCTA 2V38A 2UY4A 1KB3A 1C90A 4JIEA 3W82A 1V03A 1BYBA 4OUEA 4BCEA 4V2XA 4D6CA 2EPNA 3WBEA 1HJVA 3VNYA 1BVNP 3TTSA 4EAMA 5A6SA 4QDMA 1JYWA 1GONA 3CUGA 2D22A 1V6XA 4PBGA 5I79A 5A2BA 2WYSA 4DO5A 3CMGA 4MB3A 3VIKA 3GNPA 1VBUA 1GPFA 4H2CA 2A3EA 3WNMA 4L4OA 1TQSA 1QNOA 5D8ZA 2WMFA 1TFVA 1QNSA 3CZLA 3GXMA 4FMVA 4PTVA 5BXPA 2VR4A 1DWFM 2G3JA 4DWSB 1JXJA 1UKPA 2PBGA 5TD4A 2G41A 3AS2A 5M3WA 2VRJA 5A8QA 1JZ5A 1OWQA 2J79A 4IISA 5JBDA 4J28A 4ACZA 3W0KA 1K9FA 3L2MA 1JZ6A 2YL8A 5I24A 4AD1A 4JL1A 1OSEA 3SCOA 2WMIB 3DHPA 1F4HA 1CIUA 1ISVA 4PMRA 1E0XA 1HJQA 3WSUA 1E5JA 5A6BD 4J3VA 1XYFA 3WY3A 3CHFA 2WVVA 3FY1A 3DC0A 3WDRA 3JUGA 1E4LA 6CGTA 1BYAA 2VQTA 3LPGA 2OW6A 1HTYA 5A6KA 3A5VA 3BMVA 1E0VA 3B8SA 4D6FA 3TV8A 1JL8A 5BYWA 4EK7A 4D6GA 4D6HA 1V3MA 2FH6A 2YDSA 3WENA 1JZ8A 1OGBA 8CGTA 1W9UA 3UERA 2VQUA 5BRQA 4PN2A 3CZEA 2AMGA 4UOQA 4QCFA 3RIKA 4WIWA 3VDAA 5A6JA 3RM9A 4L4PA 3WEMA 1O7DC 2X09A 3EMCA 4JFTA 3MMWA 4AZBA 1F4AA 3A21A 3ZO9A 3EMQA 3WKZA 1JIBA 5A2AA 1FH8A 5E09A 2TAAA 2F61A 3RDKA 1JFXA 3DDFA 4TVCA 1QI3A 2E9LA 4AZ5A 3S5YA 4TUFA 3N1AA 2ZWZA 3N15A 2EO7A 2DIEA 1QWUA 4CD4A 2PB1A 5LA1A 1WDRA 1NWSA 4CN4A 5A6MA 3CGTA 3WDQA 3VDBA 1ZU8A 2WWDA 3VDHA 3GDBA 4LYRA 5CLWA 2O9PA 4P8WA 4JHOA 3PZ9A 1ZBWA 3LXBA 2F7PA 3VMNA 1K9TA 2XJ7A 4MNKA 2YOCA 1XCXA 2YLLA 3CUIA 1NQ6A 3A6OA 3AICA 2PWEA 4P7OA 3G6MA 4MDOA 4D72A 5BRPA 3EJSA 2F2HA 1JD7A 1TQTA 3EDEA 3HZ3A 2EEXA 4E2OA 3SUSA 3VIPA 1GQKA 2X2HA 2V3DA 5A8PA 3VIOA 2EXOA 3VD5A 3AIEA 3WFZA 1J10A 2BVYA 3VNZA 5BXRA 1WNOA 3UR7A 3OLIA 5BCAA 2XYLA 2DT1A 1HP5A 5ABFA 3IJ7A 4EE9A 4OZOA 3SCQA 7CGTA 1LWJA 1R7AA 1PS3A 2J7GA 3WUGA 1W3JA 1QNQA 3LRKA 3UETA 2O9OA 3U57A 1B9ZA 4GI9A 1BPLB 2F7OA 3L4VA 3PZQA 4AW7A 4C7FA 1GOQA 1UWTA 2BHUA 2OSWA 3AHZA 5I3DA 1K6AA 4BF7A 4UQCA 4LYPA 4M24A 3HG3A 2W4XA 5AYBA 3OBAA 3FAWA 3KZSA 1VEOA 3AISA 1SMDA 2Y8VA 2BY2A 4HU0A 3OZOA 1V3LA 4IPNB 3S6TA 1VEMA 2YA2A 4UFMA 3M6DA 2VCBA 1FP8A 2J47A 1NOUA 4JCLA 1TCMA 3WQ4A 1OT1A 4ZXLA 4GZEA 5E1QA 2O92A 2VC9A 1FP9A 3NJ3A 1B2YA 1E56A 2WMJA 3MV01 2BY0A 3BAYA 4TTGA 4CD5A 3CHDA 1KWGA 4HA1A 1KXVA 1QI5A 1LL7A 1UR9A 3DYMA 4AWEA 1UG6A 1JZ3A 1NWTA 3WQ8A 3WMCA 1E73M 1LWHA 1LL4A 3GM8A 3CLWA 3BGAA 3VD3A 1MYRA 2C7FA 2WHKA 4PEEA 3H55A 3CTTA 1W1YA 3ZQ9A 1WZLA 1ECEA 1XRVA 3WNPA 1JDAA 2EABA 2WM0A 4FNPA 1Y7VA 4D6DA 2Y8KA 5C8BB 2X2JA 4TVDA 4MNMA 2O9TA 4B9ZA 3CMJA 2YJQA 4P7QA 3ZSTA 3WH8A 5DT7A 3RM8A 1XYZA 4FF5A 3F5KA 1BYCA 1P6WA 5FL0A 3WF3A 3UEQA 4W86A 1GJWA 2XM1A 4UFHA 4GO8A 2OWWA 1WKYA 3ZJ7A 1X6LA 4HOWA 1OGSA 3UG4A 4PYSA 4KGJA 4Z2KA 5CGTA 4YHGA 1H1NA 1R33A 4OOZA 2WB5A 4P7LA 2D2OA 2NT1A 2WC7A 1MQQA 3BVTA 2CHOA 3L4XA 2WZIA 3ARVA 2G4FA 1UKSA 1DWIM 4JL2A 1X1NA 3OIHA 3WNOA 3HJEA 1FH7A 3OA5A 2X1IA 1U30A 4J3TA 4QFUA 5E9AA 2BY3A 4M1RA 2AOSA 5CPQA 5A69A 4OBSA 2GUYA 2VT0A 3MMDA 2CBIA 3MUY1 3U5YA 1QX1A 2G3IA 3WEZA 3MO4A 1PJ9A 3U7VA 5FIPA 1QW9A 1VB9A 3U7BA 1EXPA 2ESCA 4JKKA 1VJSA 3K46A 2EPLX 2V5DA 5FCZA 2ZX6A 2NSXA 2FH8A 2PWDA 1DWHM 4J7RA 4QLKA 2OLHA 4W93A 5GNYA 2WNWA 2E9BA 1UHVA 1XV8A 2CNCA 1VFOA 4IM4A 1TA3A 3FXYA 5FOOA 1E0WA 3WD4A 2DIJA 3BLPX 4ZENA 3MANA 1C8YA 2D73A 3GNOA 3BUDA 1NH6A 2CESA 3IAQA 1ZJAA 3L4YA 1BYDA 2XVLA 1AQHA 1BGGA 2J74A 2XGBA 1UASA 3RO8A 3ARPA 1QI4A 2E8ZA 1R87A 2JIWA 4TX6A 5HDRA 1UZ1A 1B3ZA 1W9DM 2A3HA 2FHBA 2GK1A 4S3JA 1UD5A 4AD4A 1BTCA 4D1JA 2VX7A 1H09A 4PTWA 4NZJA 1CLXA 1H49A 1XD1A 5FKYA 4WSJA 4P7NA 4NI3A 3AIRA 3BC9A 1MWOA 1UA3A 2IXVA 1J12A 5I2UA 3D51A 1VF8A 2G3NA 1DEDA 3SCWA 3WQWA 1JDDA 1W9BM 3ZT7A 3LPFA 1MQPA 2XN1A 3EDKA 3BSGA 1EDGA 4UR9A 3NUKA 1QHOA 3VSTA 5DEZA 6A3HA 3WD0A 3W37A 2VURA 1DWAM 1G01A 3ZOAA 1WZKA 2ZUWA 3O9NA 4TTUA 2XIIA 4J3WA 1O7AA 1TQUA 2BHYA 4KH2A 4FLSA 5EFDA 1W3KA 1UR1A 3WDPP 4NF7A 3TA9A 1E6ZA 1KTBA 4GIAA 1HF6A 3DECA 2EPMX 2V3EA 1E40A 1XCWA 3WDIA 3LX9A 3MKKA 4GZIA 4UOJA 1PZ2A 1H11A 2J7CA 1A47A 2E0PA 4UCFA 1UH4A 1WDQA 1QHZA 1JGIA 1HXJA 4UFLA 3MUAA 3AZRA 1K9DA 1N82A 4UNIA 3QOKA 1ZS2A 4MADA 2J4GA 4TXEA 3ARZA 4DWSA 3WH9A 4A3HA 1H3GA 2ZE0A 5I5RA 3O6AA 1OIMA 1CXHA 2Q8XA 1AMYA 1V3IA 4HZ6A 4FLOA 3KE0A 3SCRA 3VMPA 2F7RA 4AMXA 2XFFA 2WCSA 1J0IA 2WMIA 2YL6A 4H7VA 4GI6A 2PWGA 4XZWA 1M03A 1HP4A 2VZVA 3AS3A 2VCAA 3CUJA 2ZX7A 4N42A 2ZUUA 2VX4A 4U5KA 2ZICA 2XPKA 2W63A 4PMNA 2XIBA 4P8UA 3APGA 5DO8A 4OGZA 3RJYA 3FW6A 1UKQA 2J25A 2WLYA 1E1FA 3GBEA 4PSRA 4U2ZA 1BG4A 2YDQA 1Z32X 3CC1A 3CZSA 3PTKA 5A2CA 4GXPA 5DT5A 1KGXA 1C8QA 5CG0A 2VZSA 3CUHA 2ZUNA 1HWWA 3WF0A 3D52A 1W32A 4U5IA 5GNZA 3OZPA 3VGBA 2OWCA 3IAPA 4W8AA 1GHSA 1UQYA 2EPKX 2IGTA 1KGUA 4MPKA 4EKJA 1BF2A 3WELA 3ARQA 3RJXA 4KGLA 1V6YA 1NOFA 3PN8A 2OWXA 1V6WA 3BMWA 2JEQA 2CBJA 4AD3A 1W3LA 3IJ9A 3MS8A 4HOXA 1SFSA 2VJXA 2XVGA 1KQZA 1GCYA 3BAIA 1G1YA 2YA0A 1EHNA 2CIPA 3THDA 1U33A 4AEFA 4AD5A 3KWXA 3RCNA 1UWRA 1XD0A 2VCCA 1KCLA 1WPCA 1I1XA 2UY3A 3SEPA 2W66A 2D23A 4CN1A 4CN6A 4MB5A 3BUPA 1JZ2A 4MNLA 3LXCA 4KMQA 2EJ1A 1M53A 5I0DA 3BAJA 5A1AA 1J11A 3UG5A 4W5ZA 5JBEA 1EQPA 3ECQA 3OB8A 1AVAA 4HA3A 1TVNA 3SCUA 5HPCA 2WSKA 3EDDA 2IXUA 3D50A 2XM2A 5BWFA 5HNNA 2CKRA 2DSKA 4DUWA 3VD7A 5AY7A 2YKKA 1YHTA 1HNYA 3K1DA 3EJUA 5HPOA 4AZIA 2GVYA 3BVVA 3D3AA 4MJ4A 3ZJ8A 3D5HA 4EANA 3WBAA 2WMGA 3EDFA 1FH9A 3CPUA 1E43A 3AIWA 3IK2A 2YBUA 3VU2A 1ISXA 1CEOA 1OGGA 4P8XA 3NSMA 3QHMA 1KXQA 3MSGA 4AY1A 3HN3A 2PBOA 1TR1A 3WQ6A 3KLLA 1LL6A 1WB0A 1KFWA 4RL3A 1JYVA 1XH1A 1VENA 4Y7EA 2X05A 1FOBA 1TMQA 3FNDA 3WQVA 4PMVA 3WH6A 2ZUMA 2JFEX 1C7SA 1V3HA 1QBAA 2YDRA 2Y24A 1GOKA 1CWYA 3ARWA 4AYSA 1HJXA 4JZ5A 5EB8A 1X6NA 4X9YA 4GQRA 1GOOA 3WH5A 5IHRA 5JIWA 1H41A 3AJ7A 4HZ8A 1R46A 1JI1A 3OGVA 3WUBA 3SCVA 4DUVA 4LGXA 1CXIA 1KCKA 5A8MA 3VPLA 1TZ7A 4CCDA 5AYIA 3WD1A 2WCAA 1U2YA 3FAXA 3WY1A 1I1WA 3QR3A 1WZMA 1JFHA 1QVBA 4BQ5A 2D3LA 2XFRA 1B90A 1HKMA 1SMAA 2CCRA 1V3JA 1TQVA 1UD4A 4BZYA 1V0MA 4P8VA 4PUDA 3N9KA 1JD9A 4WKFA 1JI2A 2VRKA 5A6LA 3AMCA 1EA9C 5FL1A 1VFMA 4U33A 3VIHA 1HKKA 3B9DA 4QP0A 3AMKA 3BVWA 1M7XA 4UQDA 3CIVA 4AZ6A 3RILA 1HIZA 2W62A 1C91A 3VX0A 3VUPA 4NXKA 4IUGA 1E6SM 4UQBA 1GVYA 4AISA 1WE5A 2YL9A 3BSHA 3WFLA 1PZ3A 4PSPA 1E4MM 1EO5A 4AC1X 2OSXA 3VIMA 1W1TA 4PMYA 3CV5A 2DPEA 2CBVA 2E4TA 3A3HA 1B3XA 4MNJA 4UQ9A 3WD2A 4NSBA 3EJRA 4CCEA 3BVUA 5EMYA 3ARSA 3E1F1 1OB0A 1VFUA 2BHZA 1OD0A 2GDUA 1W1PA 2J7EA 5HXMA 1UYQA 5HBFA 4UFJA 1XSIA 4LPCA 4B16A 3EJTA 5D9MA 2ZOXA 2JF6A 2WANA 2WVSA 2XGIA 4ATDA 1BLIA 3AIUA 5I77A 1BSIA 1GZJA 3AIBA 5I78A 4GKLA 3T0BA 1RPKA
chains in the Genus database with same CATH superfamily
2XX1A 1G87A 2P49B 3P77B 1KTNA 1LQ0A 4F8NA 3GUWA 4UT6H 5G4HC 3H9YA 3DDMA 3LHYA 3TSMA 1HWGB 4Z7VA 5TQ0L 3G6JA 3S5LA 3RB7A 3WL9A 3SE8L 2HKHH 3QXTA 5IVXA 1N55A 2A77L 4L4LA 1TYEB 3MLWH 4PJBB 2NWRA 5DYOA 4BK9A 4X9IA 3SSZA 4LC8A 2HS8A 3L67A 4GZ7A 5IOBA 1AGEB 4WNQA 3ZL4L 4JRXD 4EZKA 3OJDB 3NQFA 3NOEA 1Z44A 3D7PA 4Z7VE 1PPIA 1XEDA 4ZZ9A 1KBBA 5LBGA 5FF6A 4KK6C 2OJPA 4PM1A 5CXPA 3WUWA 1XDLA 5IVXE 1WQ5A 2DT0A 1Q6RA 3P5ZA 3BVXA 4AXKA 1A1OB 2J8UF 1L0QA 5C9ZA 3WJLA 3SBPA 4XTDA 1G0YR 3M8OH 1UZHA 3QNYA 2GWNA 5C0ND 1ZGDA 1R2TA 4HK0B 2P5EA 4FLHA 1AUSL 3CH1B 4YDIL 1ILUA 1T7VA 3RJOA 3GZQA 3ATYA 1N2RA 4Y5YA 2CETA 1CG9B 5BMWA 5JHAA 2GBTA 1ISWA 3EX3A 3P69A 4MD0B 4KU1A 1YNTA 1ZIAA 4UILL 3RIAF 4B5NA 3UBXA 3QXAA 1E70M 2BSED 1NLBH 3AAMA 3ZL2A 3BPOB 2P5EE 5E8EB 2QL1A 3BW2A 1UZ4A 2MMXA 3GC3A 1A14L 3RWEB 3I75B 1UMYA 3X12B 2WYIA 2P50A 4KO9A 1Q9OB 4PP2A 2V9RA 5BOZG 2XKNA 5JPNA 3AOFA 3HBZA 5L9DL 2J88H 2A3LA 4XOEA 3QQ4B 5I8OH 5FDWB 3ZVHA 3CIQA 4JFQA 5EY5A 4IOIB 3KRZA 1U95B 2VUKA 3STZB 4ERGA 4B3KA 1YLVA 5SWSD 5H35B 4PB0H 3KVMA 5I0VA 2VN4A 3LLFA 4NUQA 3K6SB 4C1KA 3I6GA 3GE7A 4DTGH 5I02A 2I07B 3NXFA 1BP3B 5JW4M 3KBSA 5M17A 2ZWYA 3TYFB 1NGPH 5BQ7A 3O2VH 1I31A 3GEFA 4UINL 4NYYA 4FFYH 1HC1A 7PTDA 2AJZA 5C2XA 1OD8A 2E25A 1BBDH 1I7UB 3FRPG 2J8GA 3GHEL 3P80A 5GQBA 1C7TA 4PTTB 1Z3NA 3KVQA 4HKBA 3ROOA 4KFNA 1MFCL 4UU9B 2WZPD 4XVUC 4DM2A 4LOEA 1TELA 1DVFD 3QWQB 4CBZA 4JJ5A 5T3ZE 3COTA 5T1KB 4MJID 2GQ9A 3GSOA 3RY5A 4R2GD 4IMLA 1CLZL 3N1PC 5D7LB 4KO5A 5JVLA 1BVWA 3O2WL 3P9MB 3WDJA 2OYPA 3MACH 4JFDA 1UEMA 1FWCC 1A3RH 4RA0C 4JY9A 3B7SA 3NPZB 2PO6A 2FYYB 4FNRA 2ZADA 3RPTA 3PFQA 3I85A 5L4FA 2CIKA 1LRTA 2HFGL 3SRDA 2GGIA 4JHBA 4N2HA 4XKYA 2PWFA 4WK4B 3ZTJG 1KTRL 1SMOA 4OZHB 2EDHA 4OB5H 3R6IA 4FQ2L 3IT8D 3EAKA 5K5YA 3QWRD 2CJTA 4FJ6A 2YBRB 5FV2A 4BSVA 4KI5C 5EC2A 1PUDA 4DEFA 2OYKA 2VEMA 5GRVK 3JV5A 5L2JA 4Z3IA 4TSAL 1VYPX 3NA8A 2OQJB 3T05A 2OJZH 4GYFA 1UB3A 1Q94B 5EIQA 3CFBA 2EDKA 2OMVB 1FWDC 4ONHB 2W91A 3ARGA 5KYXB 4PGLA 3OGCB 2VRAA 4WFEE 1FJ1B 4XC1H 4XNUL 1VFAB 1M4KA 4G7YH 1W3IA 1MHCA 5HGHA 1BMZA 4D1IA 5SWUA 3HAEA 1TLMA 3E49A 2A79A 5I07A 1NA8A 5J7CC 4YDNA 1BOYA 5GGVH 5D6CA 5IFJB 4DWHA 3V0DA 5DUMH 1CGYA 1TWSA 3KCPA 4H20L 3B1TA 1LEIA 4WLCA 1FORH 5J6GA 2IKGA 2NQJA 2BP5M 4KWUA 5FSEC 4P23C 5J3HC 3WY4A 5F0JB 1FZJB 3ESNA 3L3OA 4OCNC 1YNKH 1IT0A 3ZYOA 1ICQA 4YR6B 3MP4A 3T2LA 1EJ8A 4AM0Q 4A1RA 5MI0C 3LEVL 3FHQA 2V2WA 1ZAIA 3HI5H 5IMLB 3HJ0A 3I7QA 4NUJA 4NQDA 1TQBB 3GXPA 4BIKA 3MA9H 5TPWH 2B7PA 4OIFA 5BOOA 4ELMF 2FPTA 1ZIBA 1FHUA 2DORA 2QPDB 1XLIA 3WG6A 1H15B 1WH0A 4KPHL 1GKOA 1KFBA 5F9OL 3RX8A 3SKUD 1IQ8A 3I50L 4WJXA 5H8DA 4BS0A 1ES0A 4IBTA 3SYAA 4AXWA 1P0SE 4GINA 4NQDE 1SZGA 3CJJA 1WBZB 2WWCA 3O6YX 1BA9A 3G5ZB 4KXZH 5F44A 4XNQA 4NU7A 3QIBA 4JFPB 4UTAA 2DJUA 4OLYH 4YE0A 2EADA 3MUIA 1TO3A 2YZRA 1OCRB 3VIIA 5K9KB 1FTXA 2WN3A 4JEQA 4E6MA 4GIOA 3JR2A 1G9EA 4NC1E 3INOA 4H8QA 5CPMA 3TYAA 1OAKH 1YJDH 2G5BA 1I8IB 5GZNC 4ZO8A 4LP5A 2V67A 3PHAA 3PTMA 1IBHA 4WDWA 4W87A 1R3JB 1TMCB 5LXGH 3GB7A 1NM9A 2FGLA 4JTIA 4QCEA 1K2DB 1O9VA 5D7JB 3GWQA 3L0KA 5FF7A 1M7IB 3ULUD 2GCYB 4MWAD 4AY0A 4X4ZA 5U4NA 1P84K 1G7IA 3K71A 4ZUSB 4J4PC 3VXMA 5TDPB 4K68A 2OMYA 3LPOA 3ZWTA 1XGUB 1BXVA 3U6XA 5F4WA 2PD5A 7REQB 1RIVL 3HN5A 3P2DA 1ENUA 1M3UA 3QQXA 4JDTH 1I82A 1NAKH 3N40P 3TO4C 4BXVA 5JA8B 4QS5A 4PJDF 4ANVA 1TWDA 3DUHA 9PCYA 3PDOB 1HHKA 5EA0L 3NZGA 2A9MH 3VXME 4PL2A 1UZ8B 2RIKA 4UR7A 5F1IB 1U8CB 5HA7A 3L8QA 5HHOB 4HCRA 3ZKMD 4GQBA 4MASA 2HE8A 2VITB 3UO1L 4MZ3A 2NX5B 4S3FA 1XGZA 2R7EA 4GG8A 3G5EA 2CW6A 2FVMA 3PZUA 3KXQA 4F0MA 2GTZB 5DX7A 3DJ9A 3W6YA 1IAIL 5AVSB 2WBGA 1NDYA 2OELA 3UR8A 4A7TA 5MERA 4CD7A 1E5UI 5D2LA 2JXMA 4NRXA 1LG2A 2VE6A 3VFMA 3D8MA 1UCBH 1F11A 3ABGA 2E7FA 2DVTA 1CZ1A 15C8L 2DU2A 5D9NA 4OV9A 3TJEH 5AVWB 1L9TA 5CC3A 5CJ5A 1NCTA 2X4RA 4ZUVA 2YBGA 4JX0A 4KFMA 1XBZA 1SZNA 3EHBC 4HJFA 1WZAA 4HP5A 4IMAA 3BKCH 2WP3T 1MRCL 1FA2A 2XTLA 5D2LE 4GY0A 5T1MB 3X3GL 1Z42A 4GY1A 4LB4A 3TYDA 3MSYA 4ZYKA 1PCSA 5GGTL 5C9JA 5CCKL 2H2PC 3QUZC 4GBXD 3ZE0F 3ZDYB 4RESB 4OUEA 1MI5D 1X5XA 1OTTC 3NG3A 3TTSA 5A6SA 5EIIB 4J35A 1MCDA 3O3DB 1MJ7L 1GONA 1WS7A 1ZMYA 4XO4A 4AGOA 2L04A 3D85A 3WO8A 1CB2A 5AKVA 3ZPDA 1HCFX 4ALDA 3VFTB 2VDOH 3NQ7A 1K4DB 1HKFA 3BXNB 5GGUA 2PBGA 4ZQRA 2ESVA 5DTFA 3T65B 3D05A 4H44C 1KTLA 1N12A 5F6IC 1R4XA 1OSEA 1ZHKB 5C09B 4L5FL 3WSUA 1H0DA 2BODX 3UBPC 6CGTA 1BYAA 4GFXA 2MCAA 4LVDA 4TTDC 4Z5RA 4Z7QE 5IEHA 2F68X 3UERA 3LV3A 2ESVE 1EUAA 5DI8B 4AVKA 5I19L 2ZCLH 1RMFH 3S2MA 2C3VB 4XRCA 3UIYA 5IHZA 4B6ZA 1QASA 3LOWA 2X09A 4WV1A 1V8HA 4C6JA 3IKCB 5E09A 1OGAB 1UOVA 3TF7C 2JKLA 1DQWA 2V5LA 4QBXA 1MCSA 4BKLA 4QRQB 5IESH 1CZ8L 2HP4A 5J1AB 2EO7A 2WLKA 3MOBL 4YBQD 3VDBA 3ZKXC 2Q76B 2EUXA 3MJWA 4PQXA 3RDTA 3OHIA 4Q58C 1AOZA 1OM3H 1JZJA 2YLLA 4IMCA 5BOJA 3KYNB 4PGJA 1BQLH 3O6KL 3IE4A 4HC1H 1QWGA 1B54A 5H8MA 2FZBA 4OQTH 1TVLA 3VIOA 1P0NA 4NZTH 5C0FA 3BANA 4FL4B 4QYOB 4EE9A 3SCQA 1LWJA 5HNTA 1W3JA 4KETA 1AG0A 1FZOA 3A3XA 2O9OA 4O1BA 3KTCA 2AK1L 4FS9A 2FT8A 3GFZA 1Z9PA 5JW5A 4ESKA 1E4KC 2CJ3A 4JZJA 3EGDB 4N8CH 4N6RA 1CE6B 4AT6B 1W8OA 3QR2A 3IIPA 4EDXB 1T2JA 1HOEA 3GHBL 4IJ3C 4BI7A 4H9UA 2BY2A 3PUUA 1KRBC 3OZOA 2UY6B 1IC0A 1LDPH 1C1EL 4R96B 5I09A 3CCHA 4YK4B 4UTKA 1JZEA 3TSDA 1XBRA 4R4FL 4P0DA 3LKQA 4R4ND 3HB3B 2BSBA 1AKPA 1OOAA 4KQ3L 2VWSA 2Y85A 1KWGA 1BQHG 3FKRA 1NWTA 2OKMA 4NJ9H 1LWHA 2YX0A 3GM8A 2G3ZA 4OF7A 3TU9A 5F2FA 5DXYA 3UTOA 1NBZA 5E2UH 2WM0A 3ZHDA 3FCTB 5AW4B 2CMRL 4DB7A 1S7TB 3HC0B 4ZMQA 1KCUH 3O4OB 3WH8A 3RM8A 2R29A 2VIRB 1AE6H 4ZQNA 2BP8A 3F5KA 4W86A 1GJWA 2VLJB 4UFHA 2PLMA 3PJXA 3ZJ7A 3VFSB 4PZVA 3CVHB 3P73A 1FH5H 4YHGA 1H1NA 3SN1A 4XSLA 2GTQA 3BDBA 5F21B 3NQ2A 4YVVA 2Q86B 3CMOL 4JTHA 4J3TA 3C52A 4C6FA 2MPAL 3F6IA 5JIDA 4YN3A 4V2CB 3EF4A 1I1CA 4KK5D 4AQLA 1PG7L 1P7TB 3VG0H 3U7BA 3F7KA 4JKKA 4HK3J 4K9EH 3WMLA 4JY5L 3H2AA 5B1JA 5I1IL 3SBWC 1LK3L 3BLPX 4NC2B 1V77A 5J9PA 3FV9A 3F5WB 2DWDA 3GPEA 2XGBA 5C7HA 3ARPA 1AP2A 3E74A 2EDLA 1B3ZA 3ZYJA 2PTXA 5HMEA 1M6OB 5HPMB 3ZTEA 1TENA 4L8DA 4R26H 4EN3D 1EJVC 3LI0A 5AHFA 5FKYA 1YUHB 4MMZC 2NLJA 3JVAA 3TXAA 5BRZB 3BC9A 5E8PB 3D51A 2J3SA 5KYWA 4HS6A 4X9GA 3ASNB 2XN1A 3SDXB 3MY9A 1T1XB 2VDQL 2ZCGA 3TYCA 1IQWL 6A3HA 1KCXA 2DQEH 3K6IA 3Q9PA 4G1KA 4R90H 1TTFA 4KF1A 3CQHA 5KSUA 4A8NA 2QVFB 1BEXA 4DCQB 4NQUA 4FX8A 1MFBH 3MKKA 2DD8L 2Y25A 4PRHD 4UFLA 3ZL1A 2XXCB 5T9BG 3GKZA 5EDSA 1N82A 3FK3A 4Z77B 1U21A 4WO0A 4A3HA 2JELL 3NIFB 5DA4A 3U6RA 4KKLC 3K0WA 1GOGA 4WZ9A 4XZWA 1I53A 4FQPA 1X5GA 1FLRH 1OTUC 3OVQA 1XIDA 2P7TB 2ZICA 2BSRB 3V6FB 2NQHA 1QBLH 4PLOB 4D2NA 2F58L 3LY6A 5KSBA 4HWZB 4J6IA 4A2GA 4UTBH 1KDJA 4NNCA 4F7CA 4KK9D 1P7BA 3KHQA 4JQ3A 4OZGA 4R8WL 1R6WA 1SBBA 3RJXA 3U0TA 1Z1WA 3RB5A 4K71B 4JB9H 2IEPA 3P3BA 2BO0A 2C13A 5KSBE 4GUQA 5DQJB 3LQZA 2CIPA 3THDA 1IXQA 3PHOA 5J11B 5IF0B 1J5CA 3MV7D 5E4EB 4C8XA 4NLHA 2EZ0D 4OZGE 2FBOJ 2NMSA 4XC3H 1TITA 3SO7A 3TZNA 3AXLA 4PMFA 2QHLA 3TLLA 3B9NA 3ECQA 1ASPA 4HA3A 3DRQA 3LOTA 4OI7A 2E9IA 3HC3L 3D9AL 4G11A 1AKJA 1L7TH 1C5CL 1OCWH 2OJEB 2YKKA 1NBQA 4WU7B 2DFAA 4MNHB 2P8PA 3ZJ8A 3IJYB 4WU5A 5I26A 5FI8A 5FAAA 4WGKA 2L0DA 3JVGC 1KYDA 4LLMB 2IMMA 5A2IH 4X0KB 2Y88A 4JHAL 4KZ0A 2XLLA 3T8VA 4PVBA 4YPGB 3W2DL 2Z34A 3VYOA 4TRPH 3IU3A 4CBPA 1KFWA 4DJMA 3R8QA 4Y8AA 3KPNB 3W02A 3LERA 1DQKA 2AQOA 1CWYA 2ZP9A 4MD4A 2CWXA 3K4WA 5IVZA 4ZAKD 3WUBA 1N59A 1PFOA 1TZ7A 1KMGA 3ITLA 3WXWL 1R9YA 1JFHA 2OOFA 4BQ5A 4JFYA 2GY7B 2Y07H 4ZUUA 4MXWH 5AYZA 4KO6A 2E74C 2H3DA 4WWPA 1OK0A 4M7ZC 5I6XB 3OWRA 4H0LC 4KRLB 4H4NA 4V11A 4IIEA 3CIVA 4BH7A 3QORA 4EXPX 3V8OA 4IUGA 1K8IB 2NQ5A 4RV8A 2GUUA 1T0MB 1YEHH 1EO5A 2E4TA 1E9IA 1IFHL 3EXLA 1NCDL 3MGTB 4BBWA 1NZRA 3KPQB 3MVSA 3JTSA 2ANUA 2YSTA 3VGAB 4UTTC 1W6WA 1VHPA 2GYIA 1KFAL 2JF6A 1BLIA 5HGBB 3OKNB 3BZ4B 3EWCA 4DO4A 4S38A 5IBTL 5GGSB 4N7QA 3N06B 3Q5YA 4LVHC 2ZJSL 4JG0H 3K2IA 3S3BB 4QHUA 4G8GB 2B0MA 3MUCA 4P5UA 3S9IA 4J2PA 3LH8A 1G9ML 4KWOA 1J1PL 3NACL 1VQTA 5E6ZA 4RFNB 4M6PA 2GSIA 4HFWA 4H8WL 5CIPH 1A64A 3QQ3B 1IBZA 3QDHA 3BESR 3GIZH 4XNBA 3ZE1E 4ZW3A 1QUNB 3NSYA 5C2BH 4RAVA 2MTPA 5CBJA 4QRPB 3EYSL 2A73B 3UYRL 2ICEC 5DANA 2FB2A 3D39D 2BRRH 4IOTA 5IHUL 4KIRA 3KGSA 3SRKA 3H70A 1Q6OA 1FNEB 1P5VA 2FRGP 2Q01A 5DCEA 2H45A 2WNXA 3Q4DA 4F3FA 5IFHL 1R6VA 3UGEA 3QOMA 2Z4QB 1OALA 3OIXA 4JZOA 3NJHA 1MH5A 2A6DB 3ESUF 5GSRA 4GH7B 5DJXB 4HKJA 2WBJD 2EE0A 3ZKMC 4S1RL 3BKYH 4MY1A 1OK8A 4LIQH 3UYOD 4X98A 1OX4B 4N0YH 1BTMA 3PBVA 1IT9H 1QWHA 4MMYA 3IXAB 3UZZA 4KK6D 3APDA 2WCGA 5TFSL 2YMOA 1E6QM 2A1YA 2E7LC 1P2CB 4ZFZB 2RH0A 4PLKD 1GZPA 1MEHA 2WLJA 2J8FA 3VTAA 1GORA 3N0AA 3JYCA 1SQ2N 2RFGA 4MXQC 1DZBA 1IXPA 1RUAH 1A25A 2HN7B 2RGLA 4L9YA 4LUTB 4HNCA 1CDBA 3AROA 2AQRA 2R4RH 1AHMA 2ZWSA 2EKSB 2AW2A 3BSZH 1TPVA 5TBOA 4S2SA 1Q7MA 3PFUA 1HCYA 5AZ1A 2A74A 1I1YB 2DQJL 4XMKH 3ZR5A 3LD8B 5AOKA 5D4HA 3IETA 1N5AB 2Y2WA 3QXVA 1KACB 1MF2L 3FYEB 5GXBB 1UWUA 2DKSA 3WAJA 4JM0A 3HNSL 3BZFB 5C08A 2AI0H 1WDPA 4B3VA 2YW3A 3PZIA 5EF2A 3BUIA 1NLDL 3M9YA 3RCMA 4D8PA 1S78C 3P74A 3PTQA 4HSCX 4QLRA 2H4EA 4XXCA 3MZ2A 3QUKB 1EZLA 5DRXB 1M71B 5I30H 2A83A 4PY7A 4BSWA 4S0SD 2DSZA 1OY0A 3SCSA 1S7SA 3PAYA 5C08E 3DFPA 4XZUA 1KIUB 4Y16B 3VE7A 3VXSA 4PJHF 5EWIL 1R86A 3DTXB 1E9QB 2A5HA 5I66B 4MMXC 3CDYA 3IIXA 1CIDA 4L4MA 4UB0H 4CQAA 4A2DA 5MENB 1AXTL 2FQFA 1A5CA 5CN3A 3S3JA 4PJFA 1O4UA 4KRNA 2HISA 4YOKA 1K7FA 3QZLA 1WA2X 4GXFA 4L1GA 5EOTB 3CVHL 4K3GA 3DUUA 1ZPUA 1GOMA 3N2TA 3VXSE 1NKGA 3E96A 1LWIA 2J2ZA 3BFOA 1KCRL 4MAYC 1XWYA 4YBQC 1XDMA 4AYFA 2FIKB 4PJFE 1AQKL 1GVQA 2J8UB 4QJ4B 1UWAA 3E2SA 4TR9A 1WUZA 1Y07A 4MB4A 4MJ5B 5CQ1A 4XVUD 1NC4D 1DN0A 4WFGE 5AYXA 2ACRA 4F9LC 3SJVB 4J5VA 3HPXA 1HKJA 4NNXA 4NXSA 1U4FA 2CK2A 4L3CB 3W53A 4MZ1A 1KM0A 4LYKA 4A3RA 3VO0A 3INUH 1M2VB 5BV7C 3KOYA 2EIZA 2EDOA 4C4UA 1EANA 4ZTOH 4Z8FL 1I4FB 1LP9A 3O6LL 4KY1L 1U8NA 2F54A 3L3GA 1Z9OA 1IILE 3V18A 5LDUA 2XXMB 5FEZA 2W5FA 3MNZA 4CC4A 1EEUA 4C7DA 1Z3RA 4HWBH 1RL1A 3FYYA 1WS8A 3B4YA 5EOQL 5DEJA 4ABQA 1B2WH 3IDXL 1H8NA 5IG7B 1BSLA 4MX7A 1LP9E 1E71M 3W2UA 3BN3B 2F54E 1FHGA 4GW4B 1OHQA 2PLKA 4NJIA 2DT3A 2VUNA 5CEXA 4NAFB 1FL3B 3LCFA 2BH0A 4DUXA 4F0HA 3VXPA 2GJXA 3SKJL 1Q65A 5I1HL 2ALAA 2WXRA 1U93B 5F7UA 1SJVA 3W86A 2J5WA 4YJ5A 5IROC 1CK0L 1ZDSA 1E72M 4PJ8B 4S3DA 4BELD 4XAGA 4PJEA 2OR9L 1CFSB 1G7QB 2WLNA 4JFFA 5IB1A 5DJDB 2RCSH 4FXFA 3G9VA 3E6HB 1S5TA 4XPHL 1I75A 4DGWC 2WTPA 3U0PB 4PV9B 2XA3A 1QW8A 5D71H 4LS2A 3R8RA 1DJGA 1JDCA 2FQIA 2DUZA 2E27L 1IGIH 1MFEL 5EMMA 4PGCB 1CUOA 3KPOB 1R3QA 1E1EA 4KK5C 3NOIA 3CTLA 3K8LA 4PJEE 2WWMD 4JFFE 4DN3H 3ELAT 1RZKL 1YEFL 5TE6L 2D7QA 1JN6A 2D69A 1E50A 3ORJA 3G2GA 1ID5I 2GGEA 1HXYB 3QC5X 5F89B 3FO9B 4NBXB 2YOAA 2R23B 4XVDA 4UQEA 4M5YL 2GJLA 4B3LA 2IPFA 3PJSA 1CBVL 5LUMA 4Y9EA 4P23D 5AOZA 1J5OH 5D6DA 5E1AA 1CLCA 3VNMA 4OF3A 1F8TL 2W92A 4DVOA 1D6EA 3ILDA 2RDWA 1QO3B 4AZHA 4D9LH 4OUUB 2OO6A 4OIIL 1J0KA 5HYFA 4PB3A 4ZPVB 1K3UA 1MW0A 3DOSA 3NM1A 2K9FB 3M17A 5FFLA 4GYKA 1J05B 4RCXA 2M8XA 1TZ8A 5DHYB 2O5NA 3H2WA 4KESA 4WOQA 3ABLB 3LSBA 3B34A 4N22A 1HHGA 4FZEL 5K4ZA 2PDUA 3BD3A 1J79A 4JM2F 4HJGA 4KEZA 4HZLA 3RFAA 4ELKA 2CNYA 4JDZB 2XWTB 1NFPA 4X4MA 1M9WA 1H4PA 4PCTA 4DZIA 5EF3A 2P53A 5ICZA 3SDAB 4DFHA 2QVKA 3G04A 4F40A 3BRFA 4AL8L 1EOKA 3PWJA 4IPJA 2WO5A 1NOAA 5L8LB 1LD9B 4Y5VB 1I8UA 2XTJC 3SZ8A 4K1GA 4XCYA 1PV8A 2GABA 4X4ME 4O50A 4ZUTA 3NK3A 4FF7A 1GHRA 4AX6A 4QCIA 5DGQA 4K73A 1JRHH 1RJQA 1K77A 1KLYA 3KCOA 5GZND 2WMKA 1IWAA 4OZIA 1PWMA 1GS7A 2FTAA 4UFKA 1CLVA 2PF6A 1FN4B 1OINA 2IDTA 2YD3A 2NV2A 5DXWA 1DBBH 3MBXL 4QF1A 4J4PD 2FECI 1G7LB 3VQ2C 4LEQA 3GF8A 2OZNA 4WWKB 1CD1A 5LBSH 1TETH 1AS7A 1G5AA 3GPSA 4F15C 5TH2B 2FJUB 3B3DA 3D0LA 1MXGA 4NQCB 2IH1B 4AENB 1ODZA 4HMCA 3NDYA 4RAHA 1XPYA 1JPKA 3AY4C 3TO4D 2EZ0C 2MCMA 5E5RB 1E6JL 4HOZA 3YPIA 1CDUA 3B4UA 4W7WA 4P57A 4G2DA 3W9EB 4H7ZA 4AZ7A 1BWMA 5CC7A 4A4AA 1NDGB 3JWDH 4BGDA 2EPOA 3NDYE 3LZOA 5HDBE 5FYKD 1T22A 4WSKA 3OQ3B 4HUNB 3LRMA 5DEFA 1EAQA 2GB2A 1C3FA 4X9FA 1KB3A 1FFNB 4MUZA 2BCKB 1A6AB 1E8WA 5C9WA 4JO8A 1SW0A 4MBRA 4KDTC 2Q2LA 3H3PH 3N50A 4ELMB 5I5MA 4G6KH 4WUKH 5DT1H 4H8WC 2WMFA 3P0YL 4MQ7A 4LS0A 3V95A 3U1SL 2VCOA 3S97C 1PS9A 5D2NA 3P2BA 3Q8AA 2PRHA 1JPSH 4ZAKC 5F97E 3EHBD 4MJ6A 2WMIB 4PMRA 1E0XA 4PG9A 1EFXB 3ZKND 2DIAA 5EU3B 2PZNA 4FQQB 4WK2B 3GC5A 5LNDA 1RLCL 5D2WA 4ZNEA 4ZW5A 3QW9A 4N0FB 3TC9A 3H42L 2H2PD 4PN6A 3UJIL 1Z6KA 3QUZD 1F4WH 5D2NE 1KN2L 4E5XG 4G43A 1OTTD 5FJUA 1NQKA 5B3JE 3B97A 4TVPL 4U1LA 2I9LA 1XAUA 3MBEB 4X6EB 1NUGA 2Z25A 5K59E 1GH7A 3U4EA 1SJCA 4XN8A 4ZNEE 5C0DB 1UJTA 3QG7L 1NSNH 3GRWH 3LHWA 4X8CA 2FZ3B 3CGTA 1OAYL 4JHOA 2UUDH 5C0CB 1QEWA 1QUMA 4G9DB 3B7RL 1P5UB 3EJSA 2EDWA 1MLBA 5IB4B 3KLAB 4PJDB 3LHTA 2EXOA 2P24A 1MRFH 5DR5H 4DIAA 1J10A 2X5PA 1IR1A 1JVKA 2VR6A 1B4EA 3A9IA 2YXWA 3V0WL 4JX6A 2J7GA 4DKDC 1LUCA 4YIWA 1MHPH 4GI9A 3L4VA 4OCMC 3GSRA 5DS8A 5C6TH 1RAMA 3DU0A 3DVNA 3SE4C 3LNIA 1SZFA 4TNWF 2W4XA 3GI9H 1GGTA 5BUPA 5F2LA 1R5IB 4IPNB 3NO1A 4U6HB 3IXTB 1EMTL 1S2TA 3QMTA 1WC7A 5FJOA 1XFCA 1I8MA 1T2XA 4HBQA 1YMMB 4FABH 3V4VA 2B1AH 4DUOA 3A6BH 2FB4L 2RALA 2O6EA 3H4WA 4YQXL 1KXVA 1QPRA 4KTEH 3FT3A 5E94B 3VD0A 5GRVL 3L12A 4WDIB 2PU0A 3NJVA 3CLFL 3KYOA 2WBJC 4AEHL 3DPDA 2P80A 1JZGA 3GI8H 3DX6A 4MA1B 43CAB 2YJQA 4GAJL 3VA8A 4ZMZA 2O7SA 1J2WA 3ZE0B 4RZ4A 2R2HA 3X13B 1BYCA 1DLFH 3G6JE 3FU8A 4I0PA 2OWWA 4YIQB 4EI6A 2ICWB 1OARL 4LAUA 4OU1A 3VW3H 4I7WA 5ABTA 1IL1A 2FGWH 3U3HA 1N19A 4LSPL 1LLZA 2YPLA 3L4XA 5JOPE 5I76B 3LIZL 4MNQA 2QGBA 3MCNA 3DOPA 1DSFH 2QBWA 4JPIA 3HJEA 4V33A 2G60L 3PANA 4R4BA 1N2VA 4PLKC 4QFUA 1ONWA 1SLWA 1HAWA 3BQ6A 3GVVA 1XG4A 2AANA 4IX2A 4C57C 3MUY1 3MFFB 1HL5A 4EDWH 3CL8A 3GO2A 3ZK0A 4IP7A 3WJYA 2QF7A 3P0VL 1JP5A 3GMNB 1OW0C 1Q72H 1IKNC 1F3JB 2R0KL 2PW1A 5HHXL 2YPLE 4XOAA 4JG9A 3GWJA 3UPCA 4YHPA 2IH3A 3STEA 2BINA 2GSEA 2A6JB 1NCIA 2AERT 1UOLA 1XGTA 3TN3A 5HHVH 4ML9A 2FHBA 4Z7UA 2E7HA 4ZX6A 5L2KA 3KP0A 2DW6A 3IDMA 3DCPA 4FEZA 1TTAA 4P7NA 2J43A 4C59B 3T4YB 2Z8SA 4ZCWA 3WN5A 3EWDA 4ZO7A 3ERXA 1G01A 3PWVB 4Z7UE 4TTUA 3HA1A 1TQUA 1F02I 4L2LA 3TBWB 1QATA 5L2KE 1FWWA 5EA9A 1IAMA 4NX5A 1YEGH 4X6BA 4QDWA 1MVUA 2YMXL 3WDIA 1PZ2A 2X88A 2PCXA 1R19A 1L5GB 5I8CA 1LE5B 4QLWA 4YHIB 1VCVA 3HNTH 2DAVA 1PSKL 3M47A 1ALDA 1JJUA 4XAPA 3KE0A 4ERSL 4W70A 4R0LC 3MLVL 1ONQB 5AW8B 4EIZC 3UT0A 1ZTXH 3FT0A 5B8CA 3F4DA 2BOGX 3GMPA 1EEPA 3TOYA 1F6KA 1H5BB 4I48B 2I26N 2BNQD 1BG4A 2IALA 3KWWB 2EVHA 2VDPB 3PULA 4ZW8A 3HMWL 4F2MA 5SX4H 1DQLH 5DVPA 4UMCA 4YHKL 4NKIL 5KS9F 3U30C 3QRLA 2Y62A 2R9RA 3T6XA 2ZSWA 5IREA 2XXGA 2DYSB 4KO7A 2CBJA 2ICCA 1AQFA 1HO4A 3HQPA 5JQHC 7ENLA 1LWRA 5CJOH 2ISWA 5FJRA 3DURA 3LH2L 2Y5TA 4OZFA 5C9KA 1OF2A 2XETA 2FIRT 4KKLD 4F2ME 4O4YH 3HPSA 3PCYA 1OAQH 3WE6B 1Z9NA 3LXCA 4FF9A 3LH9A 4GSUA 1UR3M 3EUUA 5AZUA 5M2FX 1F58H 1OTUD 3CT7A 3S1UA 3QDJA 2I32A 3OKKA 5FCSH 4WEMB 2HTLD 5HPOA 4AZIA 2KHAA 2AXGB 2RQEA 4KDWA 2KBGA 1Y6NR 4U1JB 3OSVA 4I3SH 3MSGA 1X5YA 2W94A 3D3VD 3FONA 3QDJE 4PWFA 2ETWA 3B7UX 3ID7A 5EPDA 4Y4HB 4JFDE 3LHPH 4ADIA 4P46B 3FNDA 3R0KA 5AW9B 4H0HB 2ERJC 3V3WA 1MRAA 1KT2B 5DELA 2EHHA 4G80B 2NUTB 3MCKB 4RMSA 2YGNA 1M7DA 1F8MA 3BOVA 3VUSA 4NOBA 3HO8A 5FW7A 2XQYA 1GEQA 2WWKO 4JIRA 1NCCH 1AJ2A 4FXJA 1AFSA 1A1MB 3VPLA 3WS6A 3THMH 5G2HA 3FAXA 1O68A 4HFUH 3WK1A 4PRDA 4UM9D 3IFOB 4ADJA 1SMAA 3ME0A 3O2DH 1OZTG 1N5YL 3UZEA 3B2VH 4HUMB 5FL1A 3CH0A 4QTHA 4HW6A 3IRDA 3UGUA 5CHNB 1OHLA 1UM4H 2YXOA 3RWDA 5D2TA 3CFMA 2HK1A 1U8JB 1KGCE 4NHCH 5FA3A 2RAGA 3MUJA 4KPLA 1A9VA 4POCA 2NW2B 4WUUB 1JERA 4IJRA 4AGPA 1KJ2H 2A6IA 4PJ5B 1W1TA 3AITA 3VNKA 4G2AA 3U7YH 2WD0A 5BOEA 2WWMC 4CNIB 4XNZB 5HSFA 4M3KB 3EA1A 4PMJA 1UYQA 4RISH 1IAKB 4Q6IA 3RMJA 4TPRL 4YVXA 2ZOXA 1P6AB 4HN8A 2WANA 1JTPA 5KVDE 1VFHA 5I78A 4OLXH 1EDHA 1TX2A 3RRAA 1NFIA 3SUVA 4YDMA 2WXNA 3EFOA 3B0YA 4UTJA 2BDQA 3O6FA 5IXEA 3Q0HA 1HEZA 1AO7B 4QROA 2OA9A 4S1QH 4PB4A 2E6AA 5D9SA 3W00A 3S6CA 5I75C 1JMXA 3AU6A 2ED7A 3LNFA 3MLSH 2VC2L 4Z1PA 2WHLA 4U31A 2PFHA 3RIAK 3S96B 3QUGA 1V7MH 2ENYA 2JH2A 1QLEB 2ZXEB 4A66A 3QEHB 3WG7B 1ADQH 3R0MA 4Q0XH 2ZKYA 3AQYA 3U9WA 5J6HB 3C6LB 5DMIL 2XPZA 5HJ3A 3ZO0A 1OSPH 3NJIA 3KJ6H 5K9OA 1QSZA 2IWEA 4AZ8B 1XF1A 3H7VA 4P2OB 1PCXA 3QQ0A 3QNZA 1JK9A 1EOMA 4XPGH 4KDVA 2Y7QB 3IRPX 5F9DC 4AZCB 1TJGH 1XH2A 5GJTL 1T1ZB 1PKOA 5FKPB 3MYPA 5FEWA 4PBXA 4MAVA 3DGGB 4GAYA 4EO5A 5FYKU 2A3AA 3IDIA 1ZRQA 3QO1A 2WMPA 4WXZA 4Q9RL 1T0PB 4F7TA 2ARWA 4XAYA 1F9CA 1CXLA 2DTSA 4QY8B 1U8OA 4Q4RA 2BVPA 4I2XA 3BQUA 5BS0D 3GZAA 1RIHH 3H4HA 1Q4NX 4AD0A 4JGJA 3GH7A 4GS7B 4JAWA 2R2EA 1GJUA 3IVUA 3DETC 1B4JH 1TFPA 1UT2A 4KKZA 3O05A 5D09A 1HQ4B 4UTWC 5DD3L 2BSSB 3KYKH 2LW3A 4UOZA 3OB0K 4HUXB 4Q8BA 3A22A 3UCQA 3F7YA 3UR5A 2VRQA 1CE1H 1V5JA 4HAKA 2OK0H 4I2XE 5DK0B 3STLA 3SDOA 3MLTB 5JW3L 1CL7I 5EU6D 5EIIG 5GRZA 4FFZH 1SYVB 1W0VA 4RNJA 2CGRH 1FWNA 4TLKA 1I2NA 2OMXA 2V68A 3DI1A 3CWHA 4JVWA 5LQBH 3M43A 3TV3H 1UD8A 1QOQA 4Y2OB 2PWUA 2QMKA 3EOTL 1IRAY 4FA8A 4OFPA 1TZHA 4AIZB 3U5UA 4UIMB 1Q6FA 3ARUA 3QHTC 3WNLA 2ASHA 4BZ2A 2WO3B 2X41A 3CHQA 1HQRA 5J13B 1WA0X 4YL2A 4QRRD 4Z2HA 2P0OA 3ZMEA 4XVSH 2W27A 5FACA 5PTDA 3AB0B 2FWLB 4BZ1H 2XWDA 4PJCF 2P5NA 1ITCA 4ZNCD 1UCTA 4MXQD 3OKMA 5C0IA 2R8SH 3QAQA 4RZ6A 1FFQA 5DHXB 1RUKL 3UU0A 3ZKNC 3P4LA 1YDPA 3OLEA 1T89A 2Q3XA 1U8PA 4JFEA 5L6YL 1HEHC 4C54A 1EAPA 1JXDA 3SDDA 3WN6A 3SGJC 5FO7B 1OB1B 4XCFH 3MX0B 1B88A 5EUKA 5EO1A 2HTKC 4PWKA 2WZEA 4EEEA 2V82A 2Y0SA 3Q6GL 4Z2LA 4Q4IA 2BY1A 2YEZA 3VILA 1YQ2A 3ZMRA 1R5VB 1S2CA 3GD6A 4ZS7L 4CVZB 4JFEE 4AQ1A 3ZJAA 5I3IA 2BSTA 1J8RA 1S78D 3GSNH 5HVGB 3S98A 1QNZL 1CB4A 3AREB 2J7BA 5DJYA 4F79A 4HXBH 2J66A 1RH8A 1GZ1A 4OD2B 5GJSH 1FHDA 3C5JB 3HZMA 5JUEL 1U5HA 3UTPE 3FO0L 2VMJA 3AWNA 3I65A 4YHOL 2J6VA 1ZB5A 2HEJA 2WXDM 2KLTA 4AQAB 4F57H 3WIIH 3BKJH 3N19B 4N87A 2B4CL 3VIJA 3M0HA 1I2RA 1BXNA 4C6EA 1EXHA 1V0KA 1GQIA 3ISWA 1P4IH 1CW2A 4RXFA 4MAYD 4LGPB 3DIFB 3IFPB 5BWAA 1GK8A 4P5MB 4XB3A 4HKXA 3CV1A 2RFXA 3CUPA 4RMVA 3T09A 4IBSA 1XLHA 3DG6A 3AXHA 4X5QA 3FQTA 3WGUB 4ZQMA 3H7BB 3WHXB 2VJ8A 2Z35B 3EH3B 5CS7A 1JDEA 3Q48A 4ICWA 3MRGB 1MFDH 1MVYA 4KWVA 2WLZA 6TAAA 5IW6A 1BWVA 5G4NA 3PAJA 3OM3B 3ABMB 2BOLA 1YRKA 1QSFD 2HRPL 3WQCA 4W8LA 4P59L 4GMTH 1IEBB 5I1AA 3OHXC 4MHBA 1B0RA 1HHIB 1Y65A 2AK4D 3F2BA 2X16A 3HFFA 4B7IA 4ZFFA 3I6KA 1QK0A 1OAUL 3ZDZF 4MSWB 1BF6A 4KRZA 2PTWA 1TMHA 4LEBA 4RGNB 3FYOA 5MHSD 3NTYA 2PWHA 1M7JA 5J6SA 4WKZA 1T7XA 3UR2A 3DENA 4PJ6A 4MCYB 4RGMB 4S23A 3QUMH 1V8EA 3MFGB 2R1NA 4BKNA 3T08A 3E2QA 4ZB2A 2VXSH 3QUYC 3V0JA 3SCNA 2W1NA 4B92A 4FZ8L 1POKA 4QR6A 2OMBA 3TYGL 4F8PA 2KZBA 1DR9A 4JQ1A 3UTSA 1VESA 2Y5EA 2EVJA 4HYTB 4M29A 3Q3GA 4PJHB 5IROD 1H61A 2J7DA 3ABXA 2H3NA 2CHRA 3IS0X 3UPWA 3SY5A 4WDUA 2V17H 5IZ7A 3EMZA 1Q7QA 1FO0B 1U91B 3K4AA 4MTVA 3UTSE 3C5ZD 3FUFA 4XX6A 1DYZA 5LAXB 3MI6A 3MV11 2JKIS 3I2CH 4Y89A 3LEXA 1T21A 5IGXH 3AIQA 1ZCRA 4L8SC 3PP4H 1FYTB 3RGVB 3Q6FB 5HQMA 4U2YA 1YEDB 4WW2F 4FFTA 1MAKA 4ERIA 1W1IE 5CZRA 4WF7A 5AC4A 4NGHH 5HI4C 2BXYA 5HBBA 3CBRA 1CS6A 3QWNA 4P4KB 3SO3B 3SPIA 2Y7MA 4ZZKA 3WS3A 4GKZB 4NI6A 3RHGA 1P1MA 4N9CA 3QYQA 4GKSB 2UZXA 3WQGA 3BAEH 4LV4A 2VM4A 3QM3A 5AW2B 4D0DB 2NNFA 2EJAA 3D6GA 3QXDB 4UTMA 5K39B 3IFLH 4GUGA 4OUIA 4PFEA 1KSRA 2GDQA 3ZDXF 3AMGA 1PTDA 3X1GA 1TZAA 1GG1A 3GW0A 3BL3A 1A7RH 1Q4WA 4FHJA 4JFZL 3KX6A 3G5XA 5DUBB 1N64H 4OLWH 3WO4B 3MJ7A 1PCKA 2X1UA 3M5VA 3QHFH 3ARDC 4Q7DA 2DYRB 5ABHA 3LN3A 2O6FA 3ULVL 3V0TA 1IEAA 4H2AA 4G5ZH 3V4PH 3OVGA 4ATWA 2AMXA 1LL1A 4WQOA 2XTJD 5DURD 1GJIA 5AALA 4DVBA 3LA4A 5FO8B 4S3GA 3PZVA 2WKLA 3T44A 5IDIA 3FMGL 1SVDA 1G9NH 4X5XB 3WKYA 4PRID 4HU8A 3TDFA 4PLNC 4U7KA 3ZTCC 1TJHH 4DN1A 3FSZA 1Q9WA 3CHOA 4FXKA 2WBKA 2BVTA 4JM4L 4F80A 2VLKB 4HJSA 1XGQB 4JFXA 1OY3B 2CPCA 5GVJA 2HTLC 1X5MA 5DJCA 5I73C 5K9JL 2UVEA 4FP8L 4UBDD 5A8GA 4XX1E 3GHTA 1NBVL 4H0IA 2J20A 2WQPA 1DE5A 1JRBA 5TQ2L 4GMSL 4YLQT 3SB0A 1K5NB 2CHDA 1H7NA 4DO5A 4XMTA 5ICYA 3GBNH 4L4OA 3GRGA 1YDNA 4PIRF 1FWGC 1DIOA 2JGYA 1TFVA 3M0ZA 5I1DA 4LB3A 2XHNA 2F5BL 2G41A 1UXSA 1OWQA 4QHKI 5JBDA 4D0CA 5IBXA 4RQQA 2QUVA 2DMGA 1HINH 1HJQA 3ZXAC 4H25A 2XG5B 2JKRM 4HK3N 2VGLM 5JDSB 2LTQB 1E4LA 2VQTA 3D69A 2J8TA 2ALDA 3VE0A 3NQ8A 3TV8A 5BYWA 4D6HA 4ZQKA 3FT2A 3E3QC 4XXWC 2O5ZL 2AMGA 4XN9A 2IDCA 1EZUA 1V05A 3DXAA 2EXYC 2LHAA 5DK2A 1RJZA 4YSTA 2XCMC 3WLPA 4JM2B 5D1XC 2QAFA 1A4JB 2GUOA 25C8L 4TUFA 3N1AA 4PJ9A 3NJGA 3PHQB 3PL6A 3CUXA 5CWSA 2P28B 3S4SG 3DXAE 2PTYA 4W1TA 1RJYA 1BFVL 3L5LA 3U4BL 2B9AA 3TL5A 3GC4A 2B5IB 3I4EA 1CYXA 1E6OH 3RN6A 5EO0A 3VAVA 5A8PA 1HSBB 4ZSUA 1L0XA 5BXRA 1RVFL 1WNOA 3PDGA 4XZMX 2I1OA 3WAKA 2YPVA 3O45B 2VEIA 4QNPF 2HPIA 3QV9A 4Q6YA 3FTVA 3OYXA 4MA3A 4Z3GA 1IT7A 1UB6A 4XHQA 4YHYC 4NFDA 3JRKA 4NPJA 4Z0XA 2ACSA 5C0GA 4E9WA 5I3DA 1K6AA 2BMKB 4LYPA 1RV6X 2GJ6B 4Z7NE 5CPNA 3KFTA 1OZUA 2MNWA 4FE9A 3IVTA 2UV8G 1X3DA 3FAWA 1SMDA 4Y9BA 1EP2A 3C08L 5KUKA 4UMGA 2EH8H 3REWB 1TNMA 3VWKA 3BV4A 2KZKA 1JPDX 2BWGA 1NOUA 5AZ2H 1TCMA 3RWCB 1QLRA 1R3HB 1TJPA 1FP9A 4GKTA 5ECJE 4JAMB 3KS0J 4IKJA 3KCJA 1QFEA 2ZYFA 3DYMA 1TB3A 1DJYA 4J3OC 4LLWA 3GAYA 4JX5A 1JHKL 2BVUA 3KHDA 4IBYA 4M61B 3G0UA 2JCCF 3S4SB 3TGXA 5C0JB 4D6DA 1N9PA 4C6PA 2EP6A 4J4KA 4JLRB 4RZBA 2V2CA 3D2UB 3FQRB 3IRZA 3KD4A 1JR1A 3NCXA 3W7LA 2WZ5A 3PQYD 1WJ3A 5MP6H 4K23H 4UTAH 3BLEA 4ZTXA 2BFVL 4JFOB 4OOZA 4XVJL 3JWNE 2BNUA 3QPXL 3AG3B 2H8XA 1T6WA 3CX2A 5BPPA 4YTSA 4LFHG 3K74B 1I9IL 4X7TB 3WNOA 3BDYL 4LSTH 5KJRL 1DQDL 4M1RA 3QEGL 4EOUA 2EPHA 3WK0A 5DLLA 2D4DA 5J5EA 1XP3A 3W74A 5FIPA 3BLDA 3UPBA 1VB9A 2ESCA 5FA4A 1T5XB 3IS4A 3QJHB 2RJGA 4F20A 4PJXA 2R91A 3U4FA 3FXYA 2WJDA 5FOOA 1U5JA 1E0WA 4PP1C 2KAUC 3MANA 2D73A 2AEIT 2OEMA 3H0TA 1NC2D 4I9WD 4MGGA 2ADIA 1AQHA 1BGGA 5I8EB 3E8UH 1EPXA 1R87A 1N3NB 3O6DA 4U1IA 5CIPB 5CP7A 4OFQA 2R56L 4PJXE 4XXDB 4OCYL 1JK8A 5I2UA 5LG1A 3SCWA 3WQWA 2FT6A 5JLZA 3RNQB 3AT0A 5DMKA 4WRHA 3E0FA 3VSTA 3J27A 1NCWH 3Q01A 3RL2A 4MOZA 4GYPC 5DHDA 5EKYA 3PWUA 3HI6L 1BMGA 2BSCA 5JO5A 4NF7A 4ALAH 2LVCA 4NYUA 4BF5A 3CN4A 4F0LA 4W6XB 4IBZA 1XCWA 1RSFA 1AGCB 3UF9A 3VOIA 3HBPA 1JE6A 5DY3A 2YXMA 4UNIA 3QOKA 3WLKX 2A2IA 4ELDA 1SJMA 4HA0A 4IL2A 4UR8A 1CXHA 4M6OL 3K7UA 1N7KA 4XMXA 1W6TA 1E4WL 3TAKA 3NA9H 2MCPH 1PZDA 4HDIA 3O15A 4H7VA 2ISSA 3N6YA 2VZVA 3CFKA 3AS3A 2DBLL 1T8QA 3I6EA 4Y7OC 1Q45A 4UV7H 1E1FA 1ACYL 2PR9A 4P9MH 2QHRH 2G2NA 3LTVA 3CC1A 3N3MA 2Q87A 1W32A 5ANMB 4N8VG 1K6QH 4M1DH 2IGTA 1Z2KA 1PTGA 3T1WA 35C8L 1NOFA 2L3BA 3PN8A 1V6WA 2PD9A 1R3IH 4AD3A 3G5WA 5H2ZA 2E5EA 1SFSA 4HNLA 4EE2A 3A4JA 3PJNA 2ATPA 1O5RA 4K8EA 2YA0A 1TEFA 2WZTA 5FWQA 4JQIA 3VD1A 1LT8A 2G95A 4EBQH 4FXGA 3PY9A 3PPSA 4C56B 5I6LA 5FHBH 5KBDA 3HG1B 3F64A 1XF2A 3NZQA 1XSOA 1W72B 1E42A 4UNUA 2IQAA 5HNNA 2DSKA 1FO0L 4R7DA 2PMQA 4PJAA 2B7QA 3BVVA 3V7AG 4KCUA 1WKDA 3VRJA 1SFDA 4LSVL 2YS4A 3SYPA 3R8HA 1OGGA 3H2MA 3JVFC 4KMLB 4KRPD 1KM3A 1QR1A 3T77A 1I9EA 3NFSH 5B38G 4PD4K 1FOBA 1F05A 5CZXC 4I7VA 4PJAE 3CXHJ 3HIZA 3FOLA 4AYSA 4N8VB 2ITDB 2F9BT 2W0FB 1WTGT 3F2DA 1UA6H 3DMMA 3CVCA 4GNKB 2PSNA 4OLZH 3RU8L 1BIIA 2FX9H 1U2YA 1I9RL 1B3JA 3VH8A 1NDZA 1W8SA 1KGJA 4XP5H 1H60A 2FLIA 4B4FA 3BUVA 1P4BH 1T04B 1XIIA 1I1FB 5EEYA 3NIDF 5GS0L 3CC5A 1Q8AA 1M7XA 4IBWA 3LN9A 4ONFH 5CJXC 4BFEA 1LORA 4PTUA 3MUGB 1E4MM 3KDNA 1A53A 4PMYA 2ZZ6A 1E4XH 4MNJA 1B3XA 1QPNA 4XBPB 4ZFGL 1BGXL 1OD0A 4ROQA 2J7EA 1GKQA 4NQSA 1GYMA 4YYFA 4IRZH 3RZCA 4DPBX 2PCFB 5K1VA 2Z29A 1WBJA 3RDJA 2G5UA 3C09B 3ULVC 1U3JA 5E9DA 3CWGA 4PRNB 4U1HB 4G3YL 4B0MB 2BNRD 5B38B 4ODSL 3U7WH 4UQ2B 5DHVH 3MLRL 2J1YA 2D7TH 2X1XR 2PGRA 4BQ4A 3V5DA 4L9LB 4DKEH 4HU3A 1HH9B 2GY5A 1I3GL 5DEGB 2VMCA 5BJTA 2AJVL 2WWOA 4LOVA 1MHEB 3C5ZC 1SY6L 2WVTA 1EXUA 1X5AA 1FIEA 4R7NB 5E9DE 3ISIX 1HT6A 3BP7B 5CEZE 4R3UA 2YGOA 2GVLA 3BARA 5DFTA 2R29H 2G50A 4OQVA 5KS9B 1TQBC 4W84A 4LY4A 5LHDA 1IE7C 2IPTH 2Y89A 3W28A 5AYUL 2Q8AH 5IB3B 1H9DA 3MXWH 4EZMA 4LASL 3ZR4A 5DC2A 3TFXA 2MIZA 1F76A 5AYTA 3LKRB 4NRYB 1H8OA 3EUDA 3S37X 4QHMA 1A3WA 1SM9A 5A94A 3AS1A 3UJEA 5H2BB 4I18A 2Z31B 4M48H 2YD1A 3BWUC 1F00I 5CBEA 3RNKB 1F7BA 3S3SA 5E7BA 3WLQA 4GBDA 4FKEA 5DMNA 2BOFX 3G5VB 2XWXA 4O5LL 4ONGL 1TJIL 2R0WL 5FAJA 3S8HA 1AMXA 4UNVA 3APCA 3DX2A 1WK0A 4MKVA 2G0LA 4KJWD 5JR1H 1TVPA 5FO9B 5D7JC 1LHZA 4WI9A 1BRLA 1MIMH 2QJNA 2WC4A 2HFEA 3GMQA 4WUIA 4WEVX 4MWFB 1ZBKA 3WJMB 2VR2A 3PY2A 2QELA 1OSZB 3FQUB 4GRSA 5D1QA 4MFDA 3QZ6A 5C0EB 3L9CA 3RWFA 1OFOA 3AMDA 1E9ZB 3TVMB 2V37A 2H6PA 1Q9LA 2P8LA 4YHNA 3RL1A 1EVTC 3BZEB 4AH2A 3SHSA 3QDMA 4GRLA 3N12A 3HG4A 2D0GA 3MHGA 3QZNA 4YUEL 4M6NL 3IDJA 1F4XL 1PXGA 3C60A 3LS9A 2JI3A 1H7PA 3F4VA 1R75A 3TCLB 4DT2A 1NGQL 4N24A 5D1QE 1PLGL 4UBDC 4D6JA 1OD9A 5HDLA 3H53A 4RRPA 3OPSA 3VAEA 1DQVA 3QDME 3DETD 4I90A 3KBEA 4E4UA 4DW2H 1GVEA 4LCYA 2IFFH 4OZIE 3IJ8A 2CBUA 3V5HB 2P3ZA 3FTSA 2G30A 3CZ8A 4AITA 5I1JL 4ES9A 4JFHE 2V2TA 3WFBH 4WHTA 4OCSH 3H12A 1T0NA 3QLLA 3RPDA 2VMFA 3TBSB 1TTCA 2DZAA 3ARRA 2OO0A 2CR3A 2MANA 4QHLA 1U8LA 2XWBA 2DQIL 1DANU 1R9XA 1J9SA 3M1BA 1U3ZA 4ORGA 3SGEH 5I74B 3AT9A 1ORSB 3KBVA 5C70A 1FNGA 3D4GA 1H8SA 2Q10A 4YGVB 3RFZA 2X6UA 1G9MC 5EN3A 4HZ7A 4Y9MA 4NB7A 1FDJA 1EWEA 2MNUA 3OR6A 4XZBA 1A6UH 1I7TA 3NIGF 3HE7D 1IAOB 3VZXA 2DKUA 4L3AA 1XX9C 1EIBA 1UGNA 4JDEB 2JVUA 2VHLA 2G4JA 3TT3L 1IQDA 4F7PB 3TKFA 3HZYB 1K85A 5H37A 3HMCA 3MJ8B 4WJG3 4BK5C 3WE1A 1BW8A 3BIKA 3DK0A 4DXVA 1FNAA 3FQXB 1EFZA 4AQ8A 2X0VA 4NKDB 2XN9B 4Y8FA 3W1TA 1NARA 2PDNA 1HVQA 3SIMA 4WEUD 3Q67A 1QWNA 1Q90A 1SVBA 2HTKD 5DC4B 1BJ1J 3ECBB 4OU3A 4KX9A 3DNKA 1AQDA 4KQNA 2SFPA 3N2XA 4JXCA 4LCUA 5D1ZD 2PPGA 4CW1B 3QFEA 4HJWA 2FX8H 4B2DA 4WY0F 2WK2A 2PPDA 5JZ7C 1Z5HA 2QPEB 3CV2A 1RZGA 5FYJL 4K3JH 1R24B 5TJWK 4BE5A 3SKOB 2Q2EB 2X9WA 3L5IA 3KJ4B 3FB7A 1OYAA 3QV6A 1TUXA 1IZJA 3ALWA 4CGUB 1YSOA 2VISB 4HA4A 1XGYH 2BS71 5GRJH 4FHBD 3OKDA 3THUA 3HHMA 5LHEA 5E6IA 4TUKL 1EX1A 4BFIA 2XFGB 1IGYB 4EPSA 1EAJA 2WVVB 3BSMA 4PS4H 4J1UA 2Q71A 2J24A 1GQJA 3NL5A 4E38A 3WJWA 4XAKE 1HJSA 3DKLA 1XGDA 1DXEA 1LEGA 4CCZA 3T0EB 5D4IA 4TUJA 4OJCA 3FNKA 2XH2A 3EZ4A 1KM5A 3R25A 3VXNB 3QDGD 4OD1L 4X7CC 2WNZA 3M44A 3BCFA 2WPBA 1S9XA 4GUJA 3X11A 5C7XL 4RLIA 2XVPA 1D9KA 3S35X 3BAKA 3HGOA 5DN1A 5TE4H 3MRDB 1IM3B 4LSUH 1W91A 1KNOB 1PKMA 1LBMA 1KKRA 4G7EA 1VPOH 4WY7L 2HJKB 4BHYA 3L2NA 2A9CA 1A5BA 1JPHA 5J12C 1D3HA 2ZRYA 4DETA 4PJCB 2I5YL 1TJMA 4LLYA 3ZTNL 4YK4C 2QSQA 3FUJA 1KIQA 5HTSA 1H6EA 3TPKA 1V7NH 1Y5VA 5FECB 3NAAL 1WG3A 4BEIA 3IGAB 5T1LD 3AG4B 1BVOA 1VS1A 1XINA 1BIHA 5JNYB 1WXJA 4AWJC 4LCCA 1AH4A 1S7XA 3AHXA 4PRAB 3LNDA 4JPKH 4CNNA 1GQNA 3W01A 4DEPB 4MD5A 2CLLA 2QPSA 4LAQL 5ESQB 1AACA 3SE3A 4XAZA 3EGJA 4N3TA 4PWIA 1C5DB 5HMFA 3ZWSA 2KPWA 4CQ8A 1J8VA 2VLRA 3HUJF 3OSKA 2APXA 1M9HA 4R53A 3LBMA 3PFMA 2H32B 1W72L 1FL6B 4XAWL 3TQKA 3W88A 2J9YA 3CSYA 2A38A 1C92A 1SBSH 1CI5A 3E02A 4WENB 1A5LC 1SEBB 4GZJA 4I8DA 3QUYD 3H9HB 1ET7A 5F9WB 3QIWA 3BLLA 1OWRM 4XMVA 3KP1A 1FDYA 2VLRE 1S38A 5FO2A 2OX5A 3GSMA 4PUBL 4AV5A 4MNQE 5BVPH 4YC2B 1N0LB 2O6DA 3FB8A 3EZ8A 3A4WA 4FNLL 2FWOA 4UDUB 3LS5H 5GS3A 1J8HA 3WFEH 2R1XB