1HO1A

Crystal structure of pyridoxine 5'-phosphate synthase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE 5'-PHOSPHATE SYNTHASE
publication title Structural basis for the function of pyridoxine 5'-phosphate synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 93
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ho1A00
3HG2A 1IIGA 1TB3A 2E5DA 4A2SA 3RNDA 1ONRA 3QPZA 4FHAA 1O5KA 4UNLA 2QCDB 4Y8FA 1P4CA 4GNJA 3QJAA 4Y9AA 1DORA 1YDVA 3O07A 1OYBA 2ZA2A 1TO3A 3OBKA 4DEFA 1DKWA 1K7XA 2ZA1A 3E96A 3UXDA 4QIUA 1GTHA 3BGGA 3N14A 4IMCA 3G1SA 2VFHA 2J9YA 1VHCA 1ZAHA 2VFDA 3W7HA 4RJEA 1I8JA 2XFWA 2QF7A 2B4GA 1WYIA 3FIGA 3G1DA 4LOCA 4PFMA 1LRTA 3UQNA 4N9BA 1CW2A 1C29A 4WOZA 3W7GA 3O16A 5D09A 4NJGA 4NJHA 5DCEA 2E77A 3KOFA 3QPYA 3PAJA 2H3DA 4L4LA 3THQA 1VS1A 1GYNA 4LV4A 3TH6A 4JTEA 1W3IA 3C2RA 1N8FA 2RFGA 2ISSA 1GEQA 2FFCA 4YXGA 2WSYA 3NDOA 4JTJA 1XM3A 4MZYA 4MKNA 3N34A 5GVJA 4QNEA 3GNNA 1QPOA 1EA0A 1RPXA 3W7JA 1G7VA 5F2LA 3P5YA 1S5VA 5AHFA 1OX5A 2CW6A 2ZZ3A 3G3DA 3ZWTA 1TRDA 5FF3A 3PR2A 4R7JA 3UPWA 2H90A 4LS1A 4XTIA 2DZTA 1GVOA 3QEZA 4GUGA 4NNCA 4UTWC 4XWUA 3W7NA 3PBYA 4KKXA 4ZQMA 4LT9A 4LUIA 2Y7GA 4MFEA 1XBZA 3QSRA 4C1LA 2GVJA 2E6YA 2X1SA 4TMBA 1IXPA 1VCGA 3N2XA 2O7SA 5HUOA 3W07A 3CIWA 3WK1A 3NQEA 1K7EA 4OV9A 2XN0A 1HTIA 1OK6A 5FI8A 4MJZA 1O95A 1EEPA 3LTPA 3HMJG 2ALDA 3NQ6A 1KLYA 4IWWA 1M6JA 3N73A 3W1TA 3SFKA 4WZHA 1Z42A 2DZVA 3TIMA 4AVFA 2FPYA 3STCA 3W7PA 2X2GA 4AHPA 5E1QA 4Z0SA 4JYDA 3W7EA 5KZMA 3FJLA 3O1NA 4FB7A 3G1HA 3W1PA 3IVTA 2FTPA 3E49A 1M5WA 4UNKA 5D33A 4JTIA 4JEQA 5AYZA 3EX1A 4RV8A 1XI3A 5D32A 1MEHA 5FEWA 3C2FA 1VLIA 1XKYA 1FCVA 3W87A 1SR9A 1X8FA 1J2WA 1FCQA 5LNWA 2J24A 2X16A 1R2RA 4RR4A 3W7IA 3CLMA 1GG1A 4UUIA 1ZALA 3HGRA 5AC6A 4OT7A 2P10A 2C1HA 3I68A 4CCDA 1B4EA 4IXHA 4DPPA 3UY8A 2IQTA 3IV3A 1WBJA 1H61A 3NL2A 4UMAA 5K9XA 1AW5A 3R13A 1DJNA 1TV5A 3PB0A 4WY0B 3EX2A 2VEIA 2FDSA 2QCHA 3W7OA 1X1ZA 4OU1A 3MBDA 3NL3A 1GVFA 4FNUA 4N02A 5F4WA 2QUVA 3VI2A 5KINA 3GXTA 3IGSA 2NXIA 5G5IA 2QJIA 1QMLA 5FF7A 3C61A 3TROA 4ZZ9A 1H51A 2CZEA 4AMAA 2V5LA 5K2ZA 2E5BA 2ZTJA 3W22A 4MJMA 4FF7A 1VYPX 2X1RA 1SZGA 3STFA 2QJGA 3M47A 4E2DA 2YXGA 3P82A 3GDKA 3LCIA 3B8DA 2HMCA 3W6YA 4CNOA 2Z0IA 4PTNA 2A6NA 1L6WA 4GFSA 4JYFA 3KVKA 3V75A 4M6PA 5D02A 3LHVA 2QKFA 4K7YA 3TQ0A 1LOLA 1JUEA 1LYXA 3PSWA 3M6YA 3IGUA 5A5WA 1KM6A 3MW7A 3I7QA 3GAKA 3LRLA 1B57A 2WSRA 2FIQA 1W5PA 3QW3A 4IGHA 2QCLA 3N19B 4PL2A 4K36A 1FY6A 3ABSA 1H1YA 1LORA 3MWAA 5C2XA 3EWBX 5AYXA 1JR1A 3GDTA 4K38A 5FEXA 2WJZA 4K7VA 3LTYA 2OMAA 1VGAA 1AW2A 2OT0A 3K30A 3LCGA 2ZZ6A 1GYLA 5BW6A 4LS0A 3UWYA 4UTTA 5CPLA 4TMCA 2TRSA 4RCXA 5DBUA 4DF2A 4TU1A 3FFSA 4WOQA 2B7PA 1TPC1 3CQ0A 3CIXA 4M6QA 1VQTA 3DFSA 3PBWA 3W23A 2RKXA 1DQWA 1TTJA 1WQ5A 2CFFA 3HO8A 3GX9A 1SFLA 5C54A 4RZ6A 2NX3A 3PSVA 4BI5A 4DELA 5DY2A 5K4XA 1JCXA 2X30A 1OYCA 4JTUA 3IIPA 1H1ZA 3KRSA 3MYOA 4R33A 4Z1CA 2Y63A 3SZ8A 1YYAA 3LB0A 1OFPA 2H3BA 1SQ7A 3TX9A 1Q3NA 3C2VA 5D38A 3B05A 3A5FA 3BLFA 4O57A 3BG3A 5C6MA 3EB2A 2FPTA 3DFNA 3TE9A 1QFEA 4WD0A 2ISWA 1DVJA 5AB3A 3G1VA 2CLLA 1SSGA 1PIIA 1JCNA 1KFLA 4NJIA 3B0VC 3PM6A 3NQ2A 1P0KA 1SW3A 3LV5A 4JNMA 5D30A 3RK8A 3U8GA 4RZ4A 4EVZA 3PG8A 3UZ5A 2F84A 2ZRWA 1SUXA 3DI0A 5D2YA 5LNVA 1SFJA 2TYSA 2FJKA 3LHUA 5D2XA 3TA6A 3T78A 1MEIA 2G97A 1A5CA 1ZNNA 4AF0B 1KV5A 3A21A 4X22A 3NM3A 1H50A 1EP3A 5HUPA 5F1VA 1I2QA 2OX1A 1CI1A 1RVGA 4RX0A 3NPXA 1CX9A 2Y85A 3MHFA 3U6WA 1LM1A 3M5XA 4NNAA 1BTMA 1H7OA 4KFNA 1XL9A 3EXRA 3CPRA 2YDAA 3T4CA 1OX6A 4S2BA 4O53A 3PG9A 4XKYB 2QCNA 4M7SA 1RV8A 4YCPA 3BGJA 1JCMP 5D2TA 1FWRA 2EAWA 4M19A 3QZEA 4DF0A 2A1YA 2FLIA 2WPBA 2PRLA 3NL6A 4LVBA 3L5LA 5HMSA 1ZFJA 4JIQA 4LS2A 3L5MA 2J9XA 4NT0A 1WOBA 1W1ZA 3B03A 3ABRA 3TC6A 3M5ZA 4JY8A 2QJHA 4IQLA 3P67A 6ALDA 5G2HA 4DPQA 2JGYA 4Z1DA 3KVJA 1SU5A 5C5YA 5EPDA 3PUDA 1LZOA 1UUMA 3R5EA 3LXBA 1KM2A 4IMEA 4UFKA 5CPNA 3LRMA 1AL8A 1EB3A 3WJZA 2V81A 1NF7A 2NXHA 3SW6A 4HNVA 3BLIA 3TMLA 3EWWA 3TKFA 4AH7A 4TIMA 3O05A 1W54A 4FXRA 3O6CA 1JQVA 3CEPA 3DHDA 3V1PA 2NWSA 2E5CA 1LRQA 3HOJA 3A22A 2V9DA 4ZQCA 2ATMA 2NUYA 1WV2A 4DQWA 3S5NA 4ORMA 4DBEA 1ALDA 4AEOA 4JD4A 5AYYA 3WK2A 4JDYA 3HG3A 1OX4B 1QAPA 3WJWA 1W3NA 3HF3A 2QUUA 1KBJA 2EF9A 1B3OA 3DH7A 2DJLA 1SSDA 3BG5A 3CEUA 3FKRA 1KM1A 1YADA 4K39A 1G4PA 1KM0A 3S5YA 1W56A 5CG7A 5LNSA 3LLFA 2QCFA 3D0CA 1DQXA 4NXSA 2GJNA 2ZQ0A 3P5ZA 3P80A 4KFPA 3QC3A 2TMDA 4R34A 4U28A 3LHWA 3NA8A 2Y70A 2CZFA 3T40A 4NZJA 3PWAA 3JRKA 3DFPA 3S1UA 3EX3A 3ZWSA 3QM3A 4O54A 1TQXA 4GWEA 4O1DA 4IX2A 1RR2A 3GKFA 3TC7A 5DLCA 2PRHA 1SZFA 3M41A 1VYSX 2W6RA 2ZZ4A 4PC8A 3MUXA 2I14A 3MP4A 1F7BA 3G22A 1FWNA 3ABOA 3G8EA 4DO6A 4CNNA 1I45A 4UFHA 3UYCA 3VFLA 5AC7A 3NQVA 1W3TA 4RZ5A 5HWNA 5BMWA 3OHIA 4IOTA 4P61A 1K8XA 2YW3A 2ZZ5A 4UFIA 3IIOA 1JRCA 3GR7A 3VNDA 3PUOA 4HPJA 2DP3A 3GZ3A 1FQ0A 3S5OA 3W88A 4GJ1A 3W75A 2JKEA 3W76A 3DAQA 5L6UA 3UWZA 3ELFA 1L9WA 2WOQA 4MUZA 1T0OA 3BG9A 3MJYA 3W1XA 3OIXA 1EUNA 4IJBA 1TPDA 4PH6A 3UNDA 5TIMA 5KZDA 2A4AA 2ZRZA 4O4VA 4GC4A 3F4NA 1VZWA 1VRDA 2CLKA 3M5VA 1XCFA 3L21A 4RK8A 5EKYA 2YFNA 3I6RA 3TW7A 5TQLA 4UTIA 2G96A 2FB3A 4MVAA 3QRHA 2B0MA 5K9CA 1V7YA 4W9TA 3GB6A 1LCOA 4UTTC 2B7OA 2J9ZA 3R8RA 1X7FA 1D3GA 1DL3A 4AWUA 1A5SA 3MI2A 3W2KA 3Q37A 3I7SA 1WXJA 2Y61A 2VFGA 2ZZ7A 5HWMA 1QCWA 1LLZA 2EHHA 4OWGA 4WY0F 5E0KA 2C13A 5EL1A 1Z44A 4UFLA 3JS3A 1RQBA 1B9BA 2AAMA 3QQ0A 3EWYA 1SZNA 2YW4A 3LX9A 3EWUA 1XXXA 1ZHAA 1F74A 2A7NA 2J6XA 2ABAA 3DXIA 2WKJA 4Y6GA 3PVFA 3BW2A 3QFEA 1DBTA 5HWJA 2YR1A 1O60A 3M5YA 1OABA 3WJSA 3G8RA 1VH7A 2HSAA 4UFJA 1TPB1 3S5ZA 1VC4A 2J88A 4ZQOA 5CSRA 4O0KA 5FESA 4QM1A 2YSWA 4K8EA 5SWUA 1RQEA 1QOQA 3B06A 3LLDA 1J4EA 3W1AA 3NR0A 5EY5A 4JX5A 3UWQA 5K4ZA 5LHFA 2E68A 4TR9A 1KFEA 2VFIA 1FCBA 1KFKA 3NQGA 4GBUA 3RLUA 1JRBA 1H7PA 3W72A 1Q6RA 3P62A 5I3HA 4BI7A 2ZDRA 3R2GA 1R2SA 2VENA 3NQFA 3TFXA 4N6FA 2AGKA 1OFRA 3M1ZA 4GE8A 4NU7A 1LBFA 1GZGA 4O11A 4BR1A 2ZRVA 2CU0A 3MI6A 4IMGA 5F2IA 2ABBA 4Q32A 3W7MA 3P8JA 1TPEA 2JBMA 2B7QA 2BX7A 3EWZA 3LCHA 4K6AA 1QNVA 3MP5A 4EF9A 4OGZA 1VHNA 1RZMA 3C2EA 1QDSA 1A5AA 3W71A 3IVSA 3INPA 3KHJA 4MYAA 2YX0A 4J9JA 1XFBA 2XN2A 3G3MA 4UR7A 5F4SA 3C3NA 5CZSA 1G4SA 1FUYA 1PS9A 4GUIA 2VFEA 5IBXA 1H7NA 2Z6IA 3W1LA 1OFOA 1YPIA 1KFJA 4QAIA 2Y62A 3GDRA 4O28A 5DN1A 2UV8G 2D73A 2PC4A 4O4WA 1SO6A 3BVJA 3T7VA 4YL2A 1LRNA 5KMYA 5K3VA 2NLIA 2E6DA 5K9DA 4EF8A 3NVTA 5AFDA 4UMCA 1XDLA 4QITA 5HR6A 1BWKA 4X3ZA 3W1UA 3NM1A 2LLEA 2QAPA 1GTEA 3W7DA 3MBFA 3L9CA 3GIYA 3W86A 1QO2A 1JQXA 1GOXA 1LLWA 3TDFA 2QCMA 1WDWA 2VXNA 3TAOA 5KTLA 4MZ1A 4JTLA 2PRMA 4E38A 1OFBA 5G4WA 4NVTA 3A5VA 1KBIA 1KFCA 3BW4A 1EPXA 2WSQA 4K37A 1GJPA 2H6RA 5TBOA 3RU6A 1HL2A 3P8IA 3CWOX 2WV8A 1S5WA 3W2JA 2A2IA 4LW7A 5CSSA 3TR2A 4NXKA 1A53A 4JTTA 2EKCA 3L67A 1FWTA 1YTKA 4EIVA 4AAJA 1QOPA 2WNZA 3QYQA 2C18A 1ME7A 2NUXA 2C15A 3PB2A 4UCGA 4O12A 1SPQA 3BV4A 3HBLA 5LGXA 2A7PA 5AC8A 3H53A 2DORA 5D03A 3QMTA 4A3UA 3NNTA 1H63A 3W3OA 4H3DA 4CQ9A 2VEMA 3G18A 1XDMA 4ML9A 3W7KA 2VOMA 5G4EA 2Y7EA 3DKLA 3DFQA 3HB9A 5DELA 2HS6A 2NWRA 2V30A 1OF8A 3EXSA 3LXCA 1OF6A 1JVNA 5K7JA 2JKPA 3NXFA 2ZRYA 5AHLA 3P81A 2QCEA 4PEKA 1NAL1 3OEXA 5AN7A 1ADOA 4UMBA 3G1FA 3WJXA 4YCOA 3SY5A 5HQEA 1IXNA 3PULA 4M5PA 1D9EA 1UB3A 4X2RA 3VCRA 3EWXA 2J27A 1OYAA 4AXKA 3TJXA 3KXQA 3WJYA 5C55A 1ICPA 1K8ZA 1TJRA 1H7RA 4XBKA 3GK0A 3LERA 2QCGA 1TPFA 1GVSA 4QQ3A 3EX6A 1RD5A 4S2CA 1TTIA 3W2LA 1I2NA 1FXPA 4X9SA 3SGUA 1H62A 3LM7A 1GWJA 1UUOA 3S1WA 1TJPA 2OJPA 4A21A 2NX1A 3W9ZA 1XUZA 5H91A 3PBVA 3OVRA 4WXYA 1AL7A 2YZRA 4HIBA 4PCFA 3EXTA 3VE9A 4N2YA 3MHGA 5F1UA 1F5ZA 1W31A 3N9SA 4AWTA 4QISA 4O1BA 1XBVA 1P1XA 4IUOA 1K02A 4POCA 5G1TA 2QDGA 3OG3A 4OBTA 1OVDA 3W2UA 3W7QA 3W1NA 3UD6A 3S0CA 4JTGA 5LZLA 1RQHA 4JTKA 4A22A 4O17A 3HGSA 4TX9A 3L65A 3Q2DA 1ZCOA 4XQ6A 1LTDA 3GNDA 1JJKA 1OK4A 5FEZA 4MOZA 5FF4A 1VJIA 5CPMA 4FX6M 3GAYA 4FEZA 4JR5A 1R2TA 4IPIA 3KVMA 3NOEA 3G24A 4NX5A 3S1VA 4HPXA 1MEWA 3B0UX 4CCEA 1VR6A 3U2OA 1ML1A 3MHUA 3TU9A 4NJKA 4XZ9A 4XTDA 1X6UA 3TQVA 1YTEA 5IM51 1PL9A 1EP2A 5J5DA 3ANYA 2GPTA 3ZFHA 2DZWA 2X1TA 1K7FA 4IXXA 4O13A 1XC4A 1L6YA 3TMQA 1PHQA 3NZ1A 5F2GA 5FEPA 1FX6A 1SW0A 3HPXA 5EBUA 4OQVA 2ZRXA 2R91A 3I7RA 3CB8A 2Y89A 1M7OA 3MI3A 2RH9A 1R46A 1P5BA 1G7UA 5ABTA 4UXDA 1PE1A 2P1FA 5AHMA 2CZDA 3OVQA 2NV2A 1GVQA 2YCEA 1QO5A 3PY2A 2EPHA 4BI6A 1YPFA 1BEUA 3QMSA 1WAUA 1IXOA 5BMXA 4GXMA 3ZR4A 4LTSA 2GOUA 1KM3A 1TRIA 3GDLA 3NZRA 2R8WA 1IXQA 4O50A 3TW6A 5BNKA 1F2JA 3HGJA 1EWDA 3L0NA 4CQAA 1TIMA 3EKLA 3BW3A 5IBXC 2GVLA 4RKAA 2P0OA 4M7TA 3RFAA 4MIMA 3M44A 1H7WA 3GKAA 3M7WA 4JX4A 1F76A 2QR6A 3L0GA 1ZAJA 1W8SA 3W2NA 3BLEA 3QW4B 3W2MA 1O94A 1TSIA 4FIRA 4JDBA 1EIXA 3NEVA 3RF9A 5CGQA 1VCVA 5H2ZA 1SW7A 4FO4A 2VC6A 5LKYA 4K8HA 4BFAA 1OFEA 4FX7A 3TSDA 2DU2A 4XUGA 4IPJA 3KAOA 3TUUA 3G1XA 3L2IA 3NQAA 3FLUA 5D04C 4ADSA 2ZZ2A 3R12A 3AJXA 2KZHA 1FDYA 3DFOA 4AB4A 4LVFA 2RHGA 5HR7A 3QH2A 3DGRA 1HG3A 3FKKA 4GRSA 1YLVA 5KSWA 5CZJA 4KWVA 5A8GA 2AQWA 4R53A 1ME9A 5I3KA 1Z41A 1THFD 3O63A 4YMZA 4ALDA 4Y90A 1NVMA 3FA5A 5J5RA 4O1AA 1QPRA 3CHVA 5CPOA 3G0XA 3PC0A 3DFTA 1HO1A 1LROA 3LOTA 3HPSA 1V5XA 4CLMA 4FXSA 1KFBA 3CTLA 3UWWA 2JKAA 4PL1A 5T26A 1F73A 1KM4A 1DOSA 5KITA 2F7FA 4MZ8A 1G4TA 3M16A 3W1QA 5LHEA 1Q6OA 5FF0A 3M9YA 3MMTA 1NEYA 1XUUA 3TK7A 2GJLA 1KV8A 4MPQA 3ZS4A 2Z1BA 3SGZA 4G1KA 4DO5A 3T55A 1XBYA 3LGEA 3O06A 1MZHA 5DCBA 4LVGA 1GQNA 3H54A 3NAVA 2V2DA 1JUKA 6TIMA 4RLIA 3IGXA 1VCFA 1QPNA 1H60A 7TIMA 1FCUA 1AK5A 1IF2A 2ZBTA 1GVRA 2Q3RA 3T44A 2OCZA 3WK3A 1K8YA 4TO8A 2Z2UA 1D3HA 3O8AA 1TMHA 4WJEA 2NXGA 4MY1A 4DXVA 1LOQA 3AO0A 3M43A 3NL5A 4JGDA 3TV8A 3HG5A 4KFOA 5AOUA 2ZTKA 4C1KA 2OT1A 2Y7DA 5U4NA 3TAKA 1N7KA 3CWNA 3A24A 2BLEA 2ZCGA 3LRKA 4MY8A 3HG4A 4NQ1A 1DV7A 1IGSA 1F6PA 2Y88A 1T96A 3KVLA 3NQDA 3GYEA 4NZFA 3DKJA 2FPVA 3P60A 1LP6A 1R30A 3FYPA 4MYXA 3O6DA 1TV8A 1Y0EA 2V8ZA 4HNNA 3C0JA 3LV6A 4IX0A 5CKSA 3H55A 3EKZA 1EX5A 1BWLA 2R14A 4Z1BA 3L66A 2Z6JA 4JICA 3O15A 1GG0A 4LWWA 1XBXA 1O4UA 4NJJA 1HO4A 5DXXA 3LDVA 4LUJA 3W7CA 3DI1A 4N9CA 3FYOA 1YXCA 2G5WA 4HSOA 3NG3A 4E2BA 3GLCA 1MXSA 5CZTA 3UZJA 5I3IA 1UCWA 2YPIA 4JYEA 1OG0A 3IVUA 3YPIA 5KZEA 2DJXA 3KX6A 3F1QA 1I4NA 2Q3OA 4I9AA 3KRZA 2C6QA 5G2IA 4JTFA 1Q45A 5CZ0A 3IRDA 2A85A 2NZLA 3NQMA 3R89A 2PCQA 2QDHA 1IIHA 1Z48A 3JR2A 5U7SA 4XBSA 2YGYA 1PCWA 3P7YA 4N4PA 4Z0JA 4LVDA 2Q8ZA 3SSJA 3IIVA 4WY0A 1W37A 1A5BA 1FBAA 4BK9A 3USBA 5AHEA 3TSBA 1F6KA 4ZQNA 1DJQA 4Q4KA 4P2VA 3PF3A 2TSYA 3OA3A 4BWLA 2GQ9A 4O10A 1GT8A 1C9DA 1YTDA 4Z08A 1L2UA 2WQPA 4JTSA 4DO4A 5D2VA 3LXAA 4LU0A 1T99A 5FF2A 1E51A 3LCXA 1KM5A 2VKZG 2PE4A 4WQ6A 3RLVA 2E09A 2H8XA 5DCDA 3GXNA 4UTHA 3F4WA 3STEA 5D37A 4JS3A 3DU0A 2ZA3A 4FNTA 4LV9A 3N3MA 3C8FA 3C52A 4O52A 3LBMA 2HS8A 2R94A 5L9FA 3W84A 1G6CA 3LBCA 2B7NA 1YXYA 2Q8LA 3L68A 4YWIA 2GVGA 2Y7FA 3QSTA 2ZRUA 4UIOA 4FNRA 4ZL1A 2TPSA 1FDJA 4O19A 3P74A 1TPVA 4O18A 4KWWA 1SZEA 1ZJIA 3P61A 5BOOA 1TREA 3VE7A 4YLWA 5LNUA 1KW1A 3DZ1A 3N2MA 2GQ8A 2CLIA 3WK0A 1G69A 2OZ0A 5AHNA 4RXGA 2GUUA 4LC8A 3THAA 3RMJA 3W7RA 4I7WA 4LVAA 3W1MA 5D2WA 5F4XA 1HFBA 1TTPA 1GPWA 4U4MA 4ORIA 1UJPA 5G2WA 1H5YA 3NPVA 1EWEA 3IEBA 2RDWA 1TTQA 1JULA 1Q6QA 4JTHA 2W0UA 3MYPA 5DXYA 1Q6LA 1NFBA 1UASA 2C0AA 3QMRA 3TXZA 1OFDA 4BF9A 1P0NA 3ATYA 2RDTA 2VFFA 5D05A 5I3FA 4AHOA 4FNPA 3G1AA 4LY8A 3L5AA 4H6KA 1PV8A 3HPZA 3DHFA 2ZYFA 3Q58A 3SR7A 1R47A 4N9DA 3LCFA 3TQKA 1FWWA 2NX9A 3NPWA 3W7LA 1I2OA 3VKJA 3WFAA 1OFQA 1KA9F 8TIMA 3G0UA 1TPH1 4E0CA 1FWSA 2X1UA 4UTMA 1NSJA 1ICSA 1AW1A 3GXPA 4WX2A 5HINA 3G1YA 2CWNA 2BZNA 4NX0A 4M6VA 3EEGA 4N4QA 2NUWA 1ICQA 4IMDA 2VEPA 2V2CA 3SIZA 5I3GA 2E1DA 1U5JA 4GUHA 3SECA 3W74A 4CNPA 4I7VA 4WXZA 1S5TA 3HIJA 1H7XA 1U83A 3E02A 1M7PA 3LHTA 1ME8A 3UXAA 1KLZA 4JN6A 2CLFA 3C6CA 1KTCA 2FB2A 3GVGA 4MLRA 1ZY9A 2ISVA 3LHYA 4HHPA 3GR8A 5HJLA 3TSMA 3CT7A 4AF0A 4B5NA 1C8VA 5G1YA 3TNOA 4N9EA 5AHIA 4UFMA 4CCCA 1QR7A 3UWVA 1TPWA 1O5XA 3NPUA 4WUIA 4JIPA 1ZAIA 4NNBA 2DZPA 4ZMGA 3SJ3A 4HN4A 2A5HA 4QJ1A 1PHWA 3TCEA 3LHZA 2QAFA 3TXVA 3HJZA 1SO4A 3KRUA 4FX8A 4HNTA 4O0ZA 3LCLA 4XKYA 4ADTA 3HQ1A 5BRBA 1KTNA 3UWUA 1W5NA 2C16A 3MP3A 3IIZA 4IMFA 3S1XA 3EX4A 1TV7A 3W1RA 2CZ5A 4O14A 4UTWA 3SI9A 3B0PA 4MFDA 3FS2A 4RXFA 2A0NA 2CLMA 2ZFAA 4UR8A 3TJLA 4A29A 2V5BA 1I2PA 3G0SA 5E93A 3NYZA 1NF0A 3CU2A 1AMKA 4DF1A 2VEKA 4MLJA 1JCYA 4DBDA 4PODA 2BSLA 5EMUA 2WNQA 3B04A 4EWND 1MSSA 2CLEA 3NQ8A 2A6LA 1VPXA 1WBHA 1ZENA 1SO5A 2GQAA 4JX6A 4CQ8A 4ZVJA 2A7RA 2JK2A 1PCKA 4S1FA 1TPUA 1YDOA 3LTSA 3W73A 4NUWA 2YYUA 1LDCA 3I65A 3W85A 1OX4A 3S9YA 5MHBA 1W5MA 4JY9A 4Q33A 3O6YX 4UC5A 3NQCA 2A21A 4A2RA 3GDMA 2PURA 1J5TA 2YYTA 2WO5A 1EUAA 3P84A 4UTKA 2HTMA 3IIXA 3DENA 4LC6A 1OFAA 3NGJA 2CLHA 2G95A 3NQ7A 2V82A 2W79A 1T8XA 4I7UA 1YDNA 1TQJA 3KFTA 3F03K 4ICNA 4O16A 4GUJA 2E6AA 4UTJA 4OHQA 3ABQA 3N9RA 2WNNA 2Y6ZA 2NV1A 4LNYA 3C56A 1OHLA 5EA9A 3BK0A 3TFCA 3S6DA 4BWLC 1MO0A 3BPWA 2FQIA 3A9IA 1X1OA 3BO9A 5F2MA 4Y96A 1G4EA 2CLOA 2DZUA 2QEZA 4O8RA 1W5OA 4JXCA 4OV4A 2RDUA 4HSNA 1WOAA 5LSMA 1FDZA 4HT3A 3FEMA 1UBSA 3E0IA 1LBLA 3LCWA 3C2OA 3PBUA 5HNRA 4QNWA 2C19A 4UTLA 5DY3A 1N55A 4N6EA 4ADUA 4FNSA 3B4UA 2I1OA 2DZSA 2XN1A 2QCCA 3CC1A 1G67A 3FJ6A 4O1CA 1L6SA 2BWGA 5I3JA 2DZXA 1QWGA 2V0TA 2VELA 1OJXA 3M0ZA 3UPBA 1AG1O 1B4KA 1TCDA 4ZQPA 1WA3A 3W70A 5EYWA 1KTBA 2I9EA 4AHQA 2QUTA 5HULA 3E12A 4HNUA 1YXDA 2V2HA 1FXQA 3LI1A 5DBTA 3S8HA 1K03A 1VLWA 4FNQA 3STGA 2E6FA 4HKPA 2QCDA 3CM4A 1W0MA 4ZQRA 4LRSA 2C14A 4FIQA 3HGOA 2BTMA 1A50A 3W83A 5LGZA 1F05A 2BXVA 1K3UA 3L0KA 3A23A 1PVNA 3Q94A 3OVPA 2YFOA 3PS7A 2H8ZA 1QPQA 3S42A 2EGZA 3FOKA 1HUVA 1JUBA 3DBPA 2JGQA 4EOUA 1BKSA 4GUFA 1VYRA 1DHPA 4OE7A 3MO7A 2ZZ1A 2O7QA 1JCLA 3BARA 4PA8A 3NO5A 3UY7A 1WX0A 1TYGA 4D2JA 1SO3A 5LNRA 3C4UA 4LRTA 4ONVA 1JCJA 3QQ1A 2C3ZA 2ATSA 4O15A 1LOSA 4H4IA 4QSHA 4AWSA 3LI0A 1W5QA 4MY9A 4Z1AA 3PUEA 1S3HA 3E9AA 1I2RA 3QF0A 4L4MA 1EP1A 3ATZA 1LBMA 4UTUA
chains in the Genus database with same CATH superfamily
2PPGA 1IIGA 2E5DA 1PO9A 4UNLA 1P4CA 4Y9AA 1HVXA 1XV8A 3QV6A 2ZA2A 3OBKA 3SUSA 1J9YA 1BQGA 3THUA 3E96A 3N2TA 4ZSTA 5IRPA 3BGGA 4D8AA 1UC5A 3WLJA 3GR4A 1LG2A 4OBSA 3W6LA 4R5EA 3W7HA 2XFWA 3N13A 1LRTA 3K2GA 4WOZA 6XIMA 3W7GA 3FHQA 1XLAA 4NJHA 3KOFA 1BAGA 2O56A 2H3DA 5FL0A 2NQZA 4L4LA 3THQA 1VS1A 3CZLA 2CITA 3N9KA 1MW1A 1N8FA 2ISSA 4YXGA 2FFCA 1VFOA 2XPKA 4REQB 1LUCB 4HU0A 1QPOA 1GCYA 4GYFA 2P53A 1RPXA 2VR5A 3OGRA 1OC7A 5AHFA 5B7ZA 3ID7A 1NDZA 2BGNE 2WCSA 2J8GA 2IW0A 1RUSA 3PR2A 4R7JA 3UPWA 2DZTA 1YE4A 4LBRA 1GVOA 3QEZA 2OKOA 4GUGA 3AZSA 2VYOA 4UTWC 1W3KA 4XWUA 3W7NA 2YBUA 2BY3A 2PDNA 4LUIA 2GVJA 4TMBA 1BXNA 4ILSA 3QTGA 1VCGA 1BTCA 3W07A 1AQHA 4O0QA 3VGFA 3WMSA 3CV7A 1P0EA 4LCQA 1W3LA 4OV9A 2XN0A 2I5QA 3TTQA 2HPMA 2ALDA 3CNYA 3RRAA 4P7NA 1EXBA 4PUMA 4L6OA 2FPYA 1SFTA 1WDDA 3QHOA 1KCKA 5E1QA 4JYDA 4L1GA 3WNOA 3UZZA 3GU1A 4DIAA 3QOMA 2P8CA 1M5WA 3PJTA 3M0KA 4Q8MA 8A3HA 5KEZA 5T9BG 1NDYA 3C2FA 1BYAA 1D7FA 1XKYA 1SR9A 1L8PA 1IR1A 2VJXA 1J2WA 2YXXA 4LYPA 2J24A 4XBJA 1R2RA 4RR4A 3CLMA 4JZ5A 5AC6A 2P10A 2OZ8A 3THDA 1OADA 2OQHA 2XIBA 4C6FA 3IV3A 1WBJA 1H61A 1B30A 2OG9A 3AI0A 1CLKA 4GYPC 4AC1X 5BWAA 3R13A 1IZCA 2ZWYA 1DJNA 2VEIA 2FDSA 1V8EA 2OGJA 1X1ZA 4OU1A 3MBDA 4JL1A 1GVFA 3BCFA 3KOYA 2QUVA 3SADA 5G5IA 3GUWA 3BJTA 2X09A 3M0JA 4RPPA 5JH2A 3GVRA 4AMAA 2WHLA 2YL9A 5A2AA 3W22A 4HTBA 1QW7A 2PWGA 4WJXA 1SZGA 2ZC1A 3STFA 3KCJA 4JEJA 4MNJA 3W6YA 3PPGA 3DEQA 4YVXA 3LHVA 4CD4A 4XO7A 5DF0A 3ZO9A 3ANVA 1LOLA 1LYXA 3M6YA 5A5WA 3VZYA 3MW7A 1B57A 3WBAA 4UQAA 1KFWA 1FOBA 1W5PA 5DMMA 3N3TA 4HJFA 4AFYA 3LNPA 2ACRA 1XR2A 1VJZA 4ZFCA 5H8MA 1B5TA 2JIEA 4K36A 3ABSA 4E5TA 5IOBA 2GLKA 1UG6A 4HPHA 1OIFA 1JR1A 1JZ2A 2WJZA 1ISWA 1R9XA 4Z2LA 2OMAA 3K30A 2IPWA 3LCGA 2ZZ6A 5BW6A 1VP5A 3NGFA 2PP0A 1UWTA 4TMCA 1FWHC 3ITYA 2TRSA 5DBUA 2J8TA 4TU1A 3FFSA 4QE5A 1M9HA 3ARTA 5G4HC 4QX4A 4AVNA 2GL5A 1WQ5A 4Q7BA 3CHEA 3UG8A 4J3XA 1EOMA 4I9TA 1B31A 4Z1CA 2Y63A 4EACA 4LX4A 5GNXA 4C6JA 3EB3A 1Q3NA 3C2VA 2J62A 2HK1A 4DN1A 4H9VA 1EGZA 3DFNA 4WD0A 2ISWA 5AECA 1DVJA 5M03A 1CTNA 3COTA 3CS2A 3Q65A 2SFPA 4G9PA 3NQ2A 1SW3A 3RK8A 5I78A 1Y65A 3WQPA 1TA3A 2ZRWA 4LAUA 1SFJA 2TYSA 3LHUA 3EA1A 4YU1A 1FHDA 2DSZA 4D8ZA 2ZXAA 2ZDSA 3WBWA 4AF0B 4A3YA 4MKSA 1E6PA 3EDDA 1MFVA 3MSGA 3EAUA 1KRBC 5F1VA 1RP8A 3SAZA 5FIPA 3D47A 3QHMA 3U6WA 4NNAA 3VNLA 1BTMA 2AL2A 4MUPA 1XL9A 3EXRA 3GE7A 3KS6A 3ZYZA 4XZLX 4C7FA 1VENA 4M7SA 1RV8A 1SZRA 2PWUA 4DF0A 1O1ZA 3CJPA 1E4LA 2ZX5A 4D6FA 4W85A 2ZX9A 1EO5A 2YL8A 1WOBA 4S23A 4RDVA 3TC6A 4JY8A 2QJHA 3P67A 1V0NA 4UQCA 5G2HA 2JGYA 4Z1DA 6ALDA 1SU5A 1MDLA 5EPDA 3R5EA 4UFKA 4QJ5B 2Q01A 1AL8A 4CQCA 4RW3A 1PZ1A 1NF7A 2Z2BA 2NXHA 3AFBA 3PZUA 3SW6A 4HNVA 7ENLA 3KCLA 3EWWA 4TIMA 1WO2A 3RR4A 3VIJA 4P8UA 4F2BA 5GNZA 3CEPA 3DHDA 3HOJA 1V77A 1RPKA 1WV2A 4DBEA 4AEOA 3T07A 3TWBA 3WK2A 5A2CA 4URIA 2HZGA 3WJWA 1H3GA 3ENLA 3NJ3A 3SN1A 1E6ZA 4OUIA 3O0FA 4GI8A 1SSDA 2Z4GA 2W62A 3WD0A 4K39A 1KM0A 5CCZA 1W56A 3MSRA 4OFCA 2ZQ0A 3P5ZA 3QC3A 4YPJA 4U28A 4HNLA 3EX3A 1DIOA 3QM3A 2WVUA 3GG0A 3KTCA 4NAFB 4IX2A 2FZ9A 1RR2A 3GKFA 3WLKX 5C9XA 1SZFA 1GHRA 3T0DA 1VYSX 1MYRA 2YA2A 4GVIA 3LSCA 1F7BA 1PBGA 3LS9A 4CNNA 3SCPA 3NQVA 4RZ5A 1NDWA 4DBUA 3VCNA 3WLIA 3GH7A 3IARA 4GFIA 3APTA 1GOWA 3VZXA 1JDFA 4QE4A 3GR7A 3N4AA 3VNDA 1JI1A 4JQ3A 3PTQA 3S5OA 1TUFA 5CJ5A 4LCRA 4GG9A 2QF8A 3VNMA 3JZEA 2P0IA 2RUSA 4MUZA 3D5HA 4HYWA 4INFA 4ZXLA 2B81A 2VEFA 5CBJA 1ZBCA 4PMNA 3OIXA 4IJBA 4PH6A 2QVNA 3QPEA 3DHPA 4EAYA 1A3WA 4D6DA 4FF5A 1VRDA 3KE0A 3M5VA 1FKXA 4J3ZA 5TQLA 1PXGA 1ZJAA 2PBGA 2FB3A 1TWIA 4RNFA 1KBLA 1F9CA 1XG4A 1MWOA 2W67A 4BF7A 2J9ZA 1XGZA 1TX0A 1Q8AA 3WBYA 4IL0A 1DL3A 1A5SA 3MI2A 3R1ZA 4OWGA 3FV9A 2VC9A 1K70A 1XLEA 4TUFA 3ZR5A 1B9BA 3QQ0A 2E0PA 3EWYA 1SZNA 4MMWA 4A8RA 1XXXA 4H9MA 1JDCA 5EFDA 1NP2A 1ZRQA 2VDGA 1F74A 4GY7A 3O2LA 3SY1A 1XH1A 2WKJA 2GK1B 4Y9OA 1XLLA 3SCRA 4Y6GA 3PVFA 3PWIA 2QDEA 4YTTA 1E1EA 3C0SA 3M5YA 4HBKA 3G8RA 1VH7A 1PWMA 5FCZA 1HJUA 3HJEA 4ZQOA 4I8DA 1GZ1A 1ENUA 5BXSA 4K8EA 4QG8A 2BVYA 2E9LA 3ZVHA 4CEUC 1R38A 3WYZA 2VZVA 3L4TA 4JX5A 3LENA 1KFEA 5A6LA 2VFIA 1FCBA 3NQGA 5BZAA 1LF1A 1JF5A 1M3UA 4N6FA 2DV0A 2DT2A 1XH0A 4DJDA 4GE8A 4O1FA 4NU7A 3AIWA 1UZ4A 3T0AA 1B3XA 1ONXA 3MI6A 1TIWA 4I8YA 2ABBA 3WH9A 3QKZA 1TPEA 1S2AA 3F4CA 2BX7A 3AS1A 4FLRA 3NTYA 3LCHA 4GCXA 3ITGA 6TAAA 2VI0A 4C91A 4YVPA 4GKLA 1M65A 4JQ4A 1ODUA 2GWNA 4Y8EA 1EBGA 4J9JA 1XFBA 1YQ2A 4KPLA 3GD6A 1SR0A 1J0IA 4P7OA 3G3MA 4UOQA 2I57A 3QN3A 4OUEA 1N8WA 1UH4A 1G4SA 3U9IA 4W5UA 3D3AA 4LCSA 1H7NA 3VIGA 1OFOA 2D0GA 3MUZ1 1SJBA 2Y62A 4O28A 3DUGA 3T7VA 1N2VA 3T2OA 5KMYA 3EPMA 1AH4A 5K9DA 2FVMA 1E9YB 3CB3A 1XDLA 5DMLA 2FTWA 3HQOA 4KF1A 1AJ0A 1IEXA 2ZUUA 2P8BA 1BWKA 2LLEA 2PD9A 2CIPA 1OG6A 4KCWA 1EA9C 1WZMA 2OEJA 5HMEA 4QR6A 5EU9A 1GKPA 1QO2A 3IJ8A 4A8NA 1EHAA 3A64A 2PRMA 1OFBA 5HATA 5G4WA 4U5KA 5FSEC 1KFCA 3BW4A 1QNQA 3THCA 5JBFA 3LN3A 2X05A 5E0CA 2WV8A 2HVNA 3R7MA 1S5WA 2A2IA 4LW7A 5CSSA 2D0FA 2MUCA 3SCQA 2C8NA 2ZX8A 4YTQA 5M1TA 4AAJA 1SVDA 5A94A 5A2BA 4XZMX 2C15A 3UESA 4ACZA 4O12A 1X8CA 3BV4A 3P14A 1B54A 4WDTA 5AC8A 1VFTA 2XIQA 2DORA 5D03A 3QMTA 3LK6A 1XWYA 3PTKA 1Q6GA 3NNTA 3EYPA 4IT1A 3W3OA 3ARSA 4JNYA 2VEMA 2W91A 4ML9A 3C86A 2VOMA 2X7VA 5G4EA 3VNYA 3MUAA 1VBHA 3DFQA 2AAAA 5CBIA 2OU4A 5CQ1A 1XIHA 4R9OA 4PMRA 3QQWA 2JKPA 1QVBA 1IR2A 1VFUA 5AHLA 2QCEA 1E70M 1H11A 4C6QA 4DYEA 5PTDA 3G1FA 5HQEA 1IXNA 3PTDA 3U4FA 1UB3A 3ARXA 1PX8A 3MTWA 5E6YA 2FH8A 4AXKA 1E9LA 4G8TA 1ICPA 3WNKA 1TJRA 1H7RA 4XBKA 1TCMA 3FN9A 1UWIA 4GIAA 1RD5A 4S2CA 3ZVIA 3SO7A 3N6JA 3U5UA 1EEXA 4QLKA 4X9SA 2YCJA 2QULA 4AWEA 3ZJ8A 3P6LA 3FYYA 5DEZA 2FH6A 3W9ZA 1CXFA 1XUZA 2IPFA 5TNVA 3R43A 2BY2A 1F5ZA 2XISA 1W31A 2Z24A 3CUIA 5C9WA 3P0XA 3WEOA 4AIBA 4GHRA 1PDZA 1ITQA 3CIVA 5EMJA 4F40A 2QDGA 2R9RA 1UC4A 4FALA 4J3VA 5LZLA 5FJRA 5H8PA 3GM8A 3Q2DA 4XQ6A 1LTDA 1ZU8A 3CAVA 1VJIA 4FX6M 2ZUNA 3GAYA 3WUFA 1Y7VA 2I5IA 4FEZA 1EJTC 4I5RA 4PMVA 4AU0A 2VNCA 3CYVA 3TU9A 5CSYA 4XZ9A 4Q8TA 4XTDA 1X6UA 3TQVA 1YTEA 2Z29A 1DTNA 1EP2A 5BROA 1R5YA 2PU0A 2DZWA 2X1TA 3K5XA 4DJDD 4IXXA 1AMYA 1JPMA 3WLTA 3NZ1A 5FEPA 1FX6A 3HPXA 4OQVA 1XLJA 1MNSA 2UZ9A 3U2EA 3E0LA 3CV1A 1TVPA 1Q7MA 1R46A 1P5BA 4M1RA 2P1FA 2Q6ZA 4P8XA 5AHMA 3QR3A 4P7RA 5A1AA 4YS1A 1W91A 3WQDA 4B91A 1B3YA 2GVYA 5BMXA 4GXMA 1YNPA 2GOUA 1TRIA 4NAEA 4ZOEA 3U57A 1FH8A 5E5CA 2QUNA 2WMIA 1XG3A 4EXBA 4O50A 1NP0A 5E9AA 4PEEA 2E8ZA 4CQAA 4ZTYA 3SCSA 3I4EA 3EKLA 3BW3A 2O9RA 5CC7A 3GC2A 1DJZA 1G0CA 2G4FA 4A3RA 2C7FA 2Y8VA 4LAOA 1KO0A 4DAIA 3T9PA 3JUGA 3GKAA 4JX4A 4A3HA 2QR6A 4Z2IA 4L9ZA 1JI2A 2PDLA 1O94A 1TSIA 1H4PA 4JDBA 4OJYA 3RF9A 5CGQA 4A35A 5H2ZA 4FO4A 3ARUA 2VC6A 4K8HA 1KCZA 3PNZA 2DU2A 3EMZA 4XUGA 3WMCA 4LBUA 2GFTA 2JE8A 2X0YA 3K13A 3NQAA 3CQIA 2VRJA 4ADSA 3W4RA 3R12A 2KZHA 3DFOA 4LVFA 4DZHA 3KBVA 4XX6A 2PUZA 3QH2A 1UA3A 1HG3A 3BSGA 4F9DA 3GFZA 3FKKA 1TZ7A 5CZJA 4NAEB 4KWVA 4J4KA 2AQWA 5CC6A 1MQQA 3VGGA 3M0HA 5I3KA 1CWYA 4E4PA 3NWRA 2CCRA 4LFYA 3ZLFA 4YMZA 3AZTA 1IYXA 5J5RA 2ADAA 4NZ3A 4UQEA 5CPOA 3KLKA 1FH7A 4W89A 1HO1A 1LROA 5BOFA 3A4XA 1XF0A 1HKWA 4QQUA 3IANA 4EAMA 4PL1A 2DVTA 3OPSA 3ZMRA 1DOSA 5KITA 4DWSA 4I90A 2CNCA 4J7RA 1G4TA 3M16A 3LLXA 3MMTA 1L0PA 1S38A 1KXHA 4G1KA 1WNOA 3T55A 3WQGA 1JAKA 1FWJC 1GQNA 3NAVA 3C5QA 2V2DA 1HF6A 1JUKA 6TIMA 1QUMA 1BF6A 4RW5A 4IGSA 4W93A 7TIMA 2DIEA 3GFXA 4UQBA 4DJFA 5BXRA 4DZIA 1TMHA 2NXGA 1DJIA 4Q6JA 3M43A 4DM1A 2D0HA 2Z7GA 3NDYA 4JGDA 3TV8A 2DSWA 1HXJA 3HG5A 3KUMA 5AOUA 3APYA 1PTGA 4V27A 1N7KA 3A24A 2BLEA 4MY8A 3HG4A 1DV7A 2PGFA 4BZYA 1BYBA 2VDHA 2WLZA 6REQA 4NZFA 4L4PA 2OSWA 2IUZA 3DKJA 5TAOA 4GIYA 1Q63A 1ZUAX 4B5SA 4ZO8A 3BLDA 3IAPA 3O15A 4LWWA 1O4UA 4TX8A 2A79A 2PI6A 5HXMA 3AXMA 3LDVA 3W02A 1I1WA 1PTDA 4EE9A 1B3ZA 2ZUTA 3NG3A 2YPIA 4LANA 4JHOA 4K1GA 4JYEA 4J3SA 1EF3A 5CC5A 2Q3OA 2XGIA 4FOKA 4QEHA 2W4XA 1VFMA 2PTWA 3L4VA 2PCQA 2QDHA 3C0LA 2YGYA 3WF2A 2Q8ZA 3HN3A 4MNKA 3SSJA 3IIVA 1F8MA 4WY0A 1A3XA 1A5BA 2ZUSA 1FBAA 3AMDA 3USBA 6REQB 5D9OA 1F6KA 3TTSA 4Q4KA 4P2VA 2PDJA 3MDUA 3MV01 5BWFA 1OGGA 4JTSA 1WKEA 2WJEA 4H2CA 1E51A 2R1PA 1KM5A 3AYRA 2VKZG 5D9MA 2YXOA 2H8XA 5DCDA 4XIAA 1T8QA 4G56A 2WSPA 4JS3A 4TX6A 1JF6A 4LV9A 3QR1A 4KIRA 5L9FA 2HS8A 3W84A 4CKQA 5HANA 1NFGA 4X0NA 4ENLA 5MKGB 3VFCA 2GJPA 4C60A 4JQAA 1EGVA 1OY0A 5XINA 4NIRA 2X0HA 1BG9A 1EJUC 3HA1A 3OYXA 1FDJA 1TPVA 1ZJIA 5BOOA 4B9ZA 3UYIA 3R94A 4ECLA 4YLWA 3DZ1A 3N2MA 1GORA 3VILA 1XIDA 5D2WA 2OOFA 1XD0A 3E5PA 4ZOBA 1UJQA 1E4NA 4C6EA 1UJPA 1X98A 1H5YA 4JPGA 3NPVA 1H5VA 2WC7A 2UY2A 3IEBA 1JULA 4JTHA 3ZT7A 5DXYA 2VR2A 1DWHM 4BF9A 3MJMA 2VFFA 4GNKB 3RILA 3UJEA 4AHOA 5DANA 3KEHA 2J4GA 4H6KA 1PV8A 3Q58A 5T8GA 3SR7A 3PJXA 2J78A 3W7LA 5FAJA 2J77A 1KA9F 3PBMA 3K8LA 3G0UA 4XAGA 3WQ5A 4UTMA 3S1GA 1JD7A 3S3GA 2YZ5A 1TE6A 2CWNA 3PPFA 3ARZA 4QLJA 4M6VA 1QHOA 3OZPA 4IMDA 2VEPA 3URAA 1JDEA 1WDPA 3HQNA 3NIYA 5REQB 5I3DA 4GUHA 3B9AA 3A3XA 4ZO7A 1P7TA 4WXZA 3R58A 1M7PA 1JEZA 4IQDA 4DWSC 5DT7A 3UXAA 1KLZA 3ONCA 3C6CA 1KTCA 2FB2A 1HP4A 4ZO9A 4IJCA 4MLRA 1ZY9A 2Z7KA 3RO8A 4UB9A 3LHYA 4QE1A 4DNHA 3GYCA 4ZODA 1OGSA 4S3EA 2PWVA 3M7SA 1C8QA 3TNOA 3LD5A 4DJFD 5DRIA 3LY0A 1QI5A 4CCCA 3VD9A 5LIYX 1QR7A 2CLPA 3UWVA 3VA8A 2EO7A 1ZAIA 3NSXA 1G5AA 5IXEA 4ZMGA 4DY1A 4HN4A 2A5HA 2VD8A 5BXPA 4RNIA 4DUWA 1PHWA 3TCEA 1SMDA 2WK2A 3LHZA 4KCTA 2QAFA 4W87A 3KRUA 3TA9A 3LCLA 1E6XM 3HQ1A 4LEQA 5BRBA 1KTNA 2DY3A 4I9MA 3XINA 3UWEA 2GUBA 1W9BM 2QJMA 3R8GA 2CZ5A 3FX4A 3BOXA 4UR8A 4MNLA 3DDMA 2X40A 3L4XA 4BF5A 3G6MA 1V6YA 4DF1A 2DZAA 4AYSA 1XSJA 4L56A 2PF8A 1EYWA 4NRRA 1OBAA 5EMUA 3B04A 3T4WA 3A3WA 3ZXWA 4MB3A 2A6LA 1ZENA 3VKBA 5C71A 1TPUA 3EMCA 1YDOA 3LTSA 3W73A 1NOUA 4AEFA 4EXAA 1LDCA 3I65A 1ADDA 4H9YA 3U3HA 4N7QA 2DUXA 3S9YA 3WD1A 3ABXA 3MB9A 3SQSA 1CGWA 4Q33A 3O6YX 5BOEA 2A21A 1CGYA 5FAGA 3KW3A 1F4HA 4CCZA 4UNIA 3P84A 4C6DA 4LC6A 2WHJA 3NGJA 4S3GA 3AU2A 1Z9AA 2GJXB 3WNPA 1AZ1A 1YDNA 3CH9A 3KFTA 3A12A 2E25A 1CB2A 3ABQA 3VKCA 1UKTA 3C56A 1OHLA 2HJPA 3S6DA 2FQIA 3OLGA 4NG3A 3A9IA 4PB3A 1ADSA 1X1OA 5F2MA 4BQ2A 4U2ZA 4ZGYA 2QEZA 2YCLA 4JXCA 2RGMA 4HSNA 4IP5A 1XLIA 1UKSA 3W00A 1Q7QA 4HT3A 1FDZA 2PTXA 1UBSA 3N6QA 1BF2A 4GZIA 2J7CA 1PZ3A 1XRVA 3FHAA 5DY3A 4GI4A 4XVEA 4ADUA 4Q8WA 2I1OA 2XJ7A 4WKFA 2J47A 4JNZA 1G67A 2L5HA 3GVWA 2CHOA 1A5MC 2HCVA 3VNIA 3UPBA 1X39A 1WA3A 2NVAA 4FAMA 5CZKA 1W9XA 2PU1A 5DT5A 4CQDA 3GTNA 4HNUA 5C9ZA 4BEUA 3H70A 3BMXA 2V2HA 5DMYA 1FXQA 5DBTA 3OJGA 1DYSA 3RO6A 3GHUA 2YA0A 4Q4RA 2QCDA 3CM4A 3WNNA 1R0MA 4FIQA 1EPVA 3SUTA 2BTMA 2Y1HA 1K3UA 1A0EA 3A23A 3Q94A 1TVLA 2YFOA 2H8ZA 1VEOA 2J7HA 2EGZA 3V3WA 5B7YA 3CZEA 4B16A 3D3FA 3E0WA 3ZSTA 1REQA 4OE7A 1NU5A 2ZZ1A 2V3GA 4PCNA 3BARA 3H23A 3NO5A 4DX3A 2PTYA 1FH9A 3TEVA 3C4UA 4LRTA 5C7HA 1JCJA 3EPOA 4O15A 4QSHA 3WL1A 1Z32X 3VABA 4XZIA 3PUEA 1S3HA 3E9AA 3QF0A 3WEMA 3ATZA 1TE1A 5CLWA 4ATDA 1A3HA 3ARYA 2OO6A 3RNDA 1ONRA 3O9NA 2ZXDA 1O5KA 4H7VA 2QCDB 5FJPA 4B5TA 4Y8FA 3QJAA 1YDVA 4FOUA 1OYBA 4ZB0A 1OWQA 3UXDA 4IJRA 2CYGA 1GTHA 3N14A 2PDGA 2VFHA 1RBOB 1VHCA 1ZAHA 5GPRA 5AC4A 2XUCA 2ZVRA 2EKGA 4RJEA 1I8JA 3IAQA 2B4GA 3G1DA 1YW1A 4OTKA 4N9BA 9CGTA 4M24A 5D09A 3K8MA 1UKQA 1J2BA 2VWTA 2BNJA 1E73M 4YHGA 2GJRA 2VC5A 1W3IA 4IF2A 4AX6A 1P6WA 2RFGA 3DCPA 4M1BA 1W9DM 2OGYA 2WSYA 1R85A 3VD4A 3NDOA 4MKNA 3N34A 3SUWA 5GVJA 3SSZA 1G7VA 5F2LA 3FJ4A 2CW6A 3E74A 4B15A 3ZWTA 1TRDA 1V03A 2OPJA 1NWUA 4WSKA 2CEQA 2QMKA 3G1RA 3PNUA 2REQA 1EC8A 4NNCA 1J11A 3OODA 2NVDA 3PBYA 4KKXA 1QW8A 5LIXX 3SEPA 1XBZA 3EWDA 4JFVA 1IXPA 5ENLA 4IQEA 1R3YA 1KCLA 4PB4A 5HUOA 4LB3A 4HP5A 3RN6A 3TYCA 1R3WA 2FYMA 2INZA 3WK1A 4IISA 3NQEA 2Z1KA 3SN0A 2PDYA 4LF1A 4U3CA 2PA6A 1HKVA 4MJZA 1LG1A 4GH1A 3LTPA 1Q4NX 1ODZA 3HMJG 2ESCA 3VTRA 1HNYA 4PTWA 1M6JA 3BXWA 4PBFA 2WYSA 2DZVA 4LUSA 3UNTA 2WSKA 2G3IA 3C2YA 1EXPA 4AHPA 4CN6A 4Z0SA 4JTAA 1QNPA 1EQPA 4CQBA 4UOZA 2Y4SA 3E49A 4DUXA 4JEQA 5AYZA 3KHDA 4ZB5A 1MEHA 4DJED 3AWOA 5FEWA 1VLIA 1VFSA 3WH7A 1FCVA 2NSXA 3H22A 1XHGA 2HDJA 5LNWA 3DHUA 1Q65A 1VEMA 1BHGA 1GG1A 2DQXA 4UUIA 3CO4A 1ZALA 1KC7A 1V6XA 4YYCA 1Y5XA 3LGGA 1FHLA 4IXHA 5CEWA 1UR1A 4UOJA 1JZ3A 3NL2A 4UMAA 3LSBA 2Z27A 1TV5A 3PB0A 3BTNA 2DH3A 2QCHA 3GTFA 4A3QA 2QHAA 2XIMA 4FNUA 3C8NA 5F4WA 3VI2A 2R82A 3IGSA 3N17A 1EBHA 3UT0A 1ITUA 1QMLA 3C61A 3TROA 1ONWA 4ZZ9A 1H51A 4AD0A 2ACSA 1EX1A 3AMLA 3U7BA 1Q2RA 2X8RA 2FHBA 5K2ZA 1O1HA 1B1YA 2ZTJA 4MJMA 1OCNA 3M47A 4PE8A 4E8DA 1GGOA 3GDKA 4JIHA 4CNOA 2Z0IA 4PTNA 3ALFA 1W1A1 1W32A 1L6WA 4JYFA 3V75A 4M6PA 5D02A 2QKFA 4K7YA 2HE8A 3BQ6A 1MW0A 5A6BA 1KM6A 4RE2A 3DG7A 1G1YA 3TYBA 3WL0A 3GAKA 3LRLA 4L1XA 3PUGA 1ZGDA 3I3BA 3B97A 3PZVA 4YJ5A 3V7PA 4FMVA 3N19B 1XC6A 3ZQ9A 1QNSA 1Q8JA 2W27A 1LORA 3S2LA 1SYTA 3EWBX 2XH7A 3UXLA 5AYXA 3DGBA 5FEXA 2F2KA 2CKSA 1I0BA 1AW2A 4M0XA 1VB9A 2ZVIA 1A5UA 3AHXA 4LS0A 3UWYA 4HD5A 5TD4A 4B2DD 5CPLA 4RCXA 1OINA 4Q7NA 4FP1A 1V3LA 2B7PA 2NLYA 1TPC1 3CIXA 1S39A 4M6QA 1VQTA 3DFSA 3PBWA 3W23A 2PZ0A 3VVGA 1TTJA 3UJFA 4IICA 3STPA 3HV9A 2NX3A 2ZKMX 1XYCA 2X30A 1OYCA 3IIPA 1C91A 2I5GA 1BRLB 2Y5JA 1SQ7A 4V15A 2WZMA 3QV7A 5D38A 3H2FA 4XZBA 1L2QA 3WQFA 1DJWA 2E9BA 3VK5A 3NO1A 3TE9A 1QFEA 3OU8A 4Q3MA 5I5RA 2IS7A 3AC0A 3LA4A 1PIIA 4BQ4A 3PM6A 5D30A 1UWAA 3LV5A 5ECVA 4RZ4A 3LGDA 4EVZA 2FJKA 1PIFA 2F2HA 3B9EA 4M80A 3VD3A 4K2SA 1ZNNA 3S2CA 1E71M 3SBFA 2VL4A 4NYUA 4MB1A 5HUPA 3QY7A 1I2QA 2D2GA 2NT1A 1BSLA 3WLOA 1CI1A 3NURA 4JTQA 3GHTA 4XK2A 4I3GA 4ERAA 1QHPA 2PZNA 4W84A 3VIKA 1YDYA 3T4CA 4Y9PA 1DJYA 2WAGA 4S2BA 4O53A 1Y5VA 3VM7A 4XKYB 1C9WA 4B3LA 2VZTA 2TODA 2YDQA 1DTUA 2A1YA 1GKRA 2WPBA 3PK7A 4LVBA 3L5LA 4LS2A 4JTCA 1BD0A 4E3VA 4NT0A 4IFKA 1R7OA 3VNJA 3TN5A 1E56A 1VJSA 3DECA 3KVJA 4AZGA 4GMEA 5C5YA 3RG6A 3PUDA 3VIPA 4IMEA 3AYSA 2V81A 2NQJA 3WFZA 3IRSA 3VDAA 3BLIA 3TMLA 3TKFA 3ARWA 3O05A 5A3HA 1XQKA 4FXRA 3LUTA 3O6CA 1JQVA 1B3VA 2G3NA 1OT1A 2V9DA 2ATMA 4JN8A 3MKCA 4ORMA 5AYYA 1QI0A 3H24A 4JDYA 4UTFA 5C0QA 2HEJA 1QAPA 1V02E 1W3NA 3HF3A 4I9JA 2BBFA 1V6VA 2QUUA 3EDFA 2EF9A 2DT0A 3TJIA 1B3OA 1L6FA 3N4FA 1LQAA 4PCSA 3REQA 3BG5A 4PBGA 4PUDA 4CD6A 4C1NA 2HBVA 3KDOA 1QASA 2WJDA 3U2ZA 3MMDA 2QCFA 1EL3A 1BGAA 3CGTA 2FJUB 3R79A 1NJJA 1HKKA 3CAQA 1R3SA 3NA8A 2Y70A 3PWAA 2FHCA 3DFPA 2R1MA 1TQXA 4O1DA 1YPXA 4AIOA 4JKLA 3MCOA 1I0DA 4HCLA 5DLCA 4JIEA 5HMFA 1WB0A 1KGWA 4W8AA 2V5DA 4ZSUA 3ABOA 3G8EA 4F3HA 4UFHA 3V18A 3UYCA 3N2CA 4M8UA 2PDXA 3OHIA 4B5UA 3WUBA 4P61A 1OZMA 4AZCA 3WO8A 3AMKA 2J66A 3REQB 2VWSA 3GZ3A 1FQ0A 3W88A 2CESA 3L23A 6ENLA 2JKEA 4BHYA 3ELFA 3B9OA 2WOQA 7XIMA 3L4WA 1EUNA 5KZDA 3TVAA 2ZRZA 4O4VA 3UG3A 1XCFA 5EKYA 2YFNA 4R7WA 2ZC8A 1PYMA 2G96A 5G1MA 3F7JA 3QRHA 1WDQA 5K9CA 4W9TA 3PWGA 1LCOA 1X7FA 1D3GA 4AWUA 2VFGA 4C65A 5HWMA 4ZO6A 1QCWA 1LLZA 2EHHA 3WEZA 5HNTA 2C13A 1AQ0A 2Y24A 4J40A 1Z44A 4NZCA 3OBAA 3CPGA 3K4WA 3E5BA 4YWSA 2C91A 1J79A 1ZHAA 4GJJA 2A7NA 2J6XA 2ABAA 2VHLA 4AZ6A 4DO7A 2FVLA 3DXIA 3KOZA 4P8WA 3BW2A 5JVLA 3MWCA 1GONA 5KETA 3RAOA 3WJSA 1QHZA 4HB7A 3S5ZA 4U10A 3VUSA 1VC4A 2J88A 4AZ7A 3RM8A 5IDIA 5FESA 1XX1A 1Q66A 3H7UA 3B06A 1EDQA 4YYFA 1GOQA 4XAFA 3LZ3A 4JCMA 3NR0A 3KL0A 3UWQA 2WKLA 5K4ZA 4TR9A 3LNMA 1JRBA 3W72A 1Q6RA 1J0KA 3P62A 4MWAA 2ZDRA 1R2SA 2VENA 1XJBA 3IACA 2PDFA 3UXKA 4IFOA 1OFRA 3M1ZA 1W1VA 1OD8A 1GZGA 4G7EA 4BA0A 5F2IA 2V69A 4Q32A 3P8JA 2B7QA 4ROQA 4AZHA 4GCAA 3EWZA 3S2JA 1WDRA 3WUGA 3QVQA 1JZ4A 4AIUA 2X2YA 1AD1A 3OLDA 1VHNA 4XKMA 2FGBA 4Z17A 2VURA 1W9VA 2VC7A 3W71A 1U1UA 3HFTA 2NSOA 3IVSA 3INPA 4R3UA 3SQLA 2G3FA 4DAFA 1BKHA 3WDHA 2YX0A 1UZDA 3QGVA 1RSCA 3ARPA 3E0FA 4HMEA 3QTPA 1P1MA 4KT2A 5F4SA 3C3NA 1PS9A 1TG7A 4GUIA 2YLLA 4MKVA 5AYIA 3TWAA 4H8VA 1KFJA 4QAIA 3GDRA 5DN1A 4O4WA 3NOYA 4XUYA 3V36A 5K3VA 2NLIA 4XB3A 3IS4A 1QK2A 4MDOA 5AFDA 3GW0A 4C90A 4QITA 3H26A 5HR6A 4X3ZA 1A47A 3NM1A 4JOMA 3H2EA 2BV9A 3L9CA 1AZ2A 2ZWZA 3W86A 1GHSA 1UZHA 2NT0A 2NQ9A 1GOXA 1UD3A 2QCMA 3KS5A 2XM2A 5FKYA 4PSRA 3PAOA 1V51A 4E38A 4NVTA 4IPLA 1S2VA 1ITCA 1MI3A 2WSQA 1GJPA 2H6RA 5TBOA 5C9UA 3P8IA 1EJSC 3W2JA 2V38A 3M0IA 1JAEA 3RCNA 4WKAA 1A53A 1J93A 2VVSA 2EKCA 3L67A 1PKMA 4EIVA 1MUWA 1QOPA 2VZUA 1ME7A 4H8UA 2EJ1A 4P8VA 3I4KA 1SPQA 5LGXA 2A7PA 4GC3A 4XSMA 4D1JA 1NY1A 3NVDA 4US6A 4E4UA 3G18A 1XDMA 3W7KA 1MUCA 2Y7EA 3NZPA 1H41A 4H41A 3DKLA 5DELA 2OR2A 1HL8A 2D3LA 1XDJA 4NZ4A 4QDPA 1JVNA 2HRWA 4Q22A 4EPKA 1HJVA 3VIOA 1MW2A 2DFAA 3P81A 3T8LA 2V3FA 5I7GA 3EGJA 3OEXA 2HK0A 1EZ2A 3VAVA 1XH2A 2DEPA 2G3MA 1JYWA 2DT1A 1D9EA 2XIJA 1T6MA 3TJXA 2JQXA 3IK2A 1JZ5A 2PS2A 1YBQB 1K8ZA 2AMGA 3LERA 1A5LC 2IMRA 4HYRA 3GC5A 3W2LA 2ACUA 1TZZA 1E4MM 2MNRA 3PZIA 2ZICA 2NX1A 1NOWA 4HSHA 4WXYA 4M6UA 1GJWA 4HIBA 3A3HA 4PCFA 3MHGA 5F1UA 3CUZA 3GXIA 2POTA 3RR1A 4QISA 4O1BA 2F9RA 3RRXA 2QNEA 4XG1A 4IUOA 1ITXA 4OBTA 1OVDA 1V3MA 3UD6A 3W1NA 1QWKA 2PLKA 4JTGA 3S0CA 2FZMA 4B5WA 3PHAA 2BASA 3V16A 3HGSA 3L65A 3BCDA 3GNDA 3I6EA 3VKAA 4JTRA 4JR5A 3SRKA 2PDQA 3KVMA 4NX5A 4W86A 1VR6A 1DHKA 3MHUA 1RJRA 4NJKA 1VIZA 3RM4A 1US2A 4JKKA 1CGVA 4KGJA 1KR1A 3ZFHA 4MHBA 4O13A 4CGTA 1XC4A 1O7AA 5DRCA 1PHQA 3PZNA 5F2GA 3BJFA 2P3ZA 5EBUA 2ZRXA 1DEDA 2R91A 4MWAC 3S6OA 1L8NA 1KGUA 1UIPA 1Z8AA 3UZWA 1G7UA 1BXCA 3DX5A 3WDPP 4OVXA 3OVQA 1AQFA 3B0YA 4GOAA 1QNOA 4W8BA 2EPHA 1YRRA 5JMUA 1EF2A 2BGQA 1BEUA 4AZBA 1UD8A 1W8GA 1W1TA 1ZLPA 2QGHA 3AOFA 2C79A 1ZBVA 4LTSA 3PZMA 1HZYA 1O5RA 3GDLA 2R8WA 3R0UA 1GUVA 2Q71A 1TV2A 4FLOA 3TW6A 5AVHA 2VOTA 3HGJA 1EWDA 3FA3A 2VR4A 3GNXA 9XIMA 5I23A 1E1CB 3EOLA 2CXGA 2P0OA 1GEHA 4FOJA 4MIMA 3M44A 3WIJA 3M7WA 2WBGA 1AUSL 2WJFA 3D46A 1VBGA 1Y8BA 4LJ3A 1IEWA 2G3JA 5LKYA 4KEVA 4BFAA 3FDGA 5BRPA 1OFEA 4FX7A 4HA1A 4HZ7A 1DWIM 3G1XA 1JIBA 2CBUA 3FLUA 1XISA 1FDYA 4AB4A 5DO8A 2O4QA 3N4EA 3OIHA 4PMOA 3FGCA 2QYGA 4QROA 1MW3A 5KSWA 2Y5SA 4IPNB 3KBNA 4QLLA 5A8GA 4IL2A 4R53A 3GH5A 2UY4A 3VM5A 4AY1A 3VOJA 2WZHA 1K6AA 3GU2A 5CC3A 1RK5A 1GQLA 4ALDA 3FA5A 3CHVA 3G77A 4HOXA 2QS8A 4QHRA 3DFTA 4B4FA 3V4BA 5XIAA 1HP5A 3UWWA 3PFRA 3AISA 5T26A 3BAXA 3MT1A 4REQA 1LUCA 4U2YA 1C7TA 1E40A 4IGNA 1PKNA 4M29A 3DYPA 1KV8A 1P0BA 4MPQA 4MB5A 3ZS4A 2Z1BA 2D2JA 2VQTA 1XBYA 3FGCB 4KEUA 5AY7A 4M51A 3SCNA 3CV2A 1I9CB 4F0LA 4PMJA 1Z6KA 1I75A 3CZ8A 3HURA 4RLIA 2BFGA 1QPNA 1H60A 3FSTA 4MADA 2QIWA 1FCUA 1IF2A 2Q3RA 1S2WA 4UCFA 5GNYA 1CNVA 3T0TA 1WPCA 2JFEX 4BCEA 1BPLB 3UJ2A 1D3HA 3WG6A 3VGEA 3GIQA 1W1B1 4DXVA 1KRMA 4GINA 4IG2B 3U7VA 4S3KA 3UA3A 4KWSA 3KWSA 2OT1A 3TAKA 1W17A 1M1BA 3V0TA 4NQ1A 4KEZA 3ECQA 3T42A 2Y88A 3HQPA 3KVLA 3OYZA 4AZ5A 4V28A 2BOGX 7A3HA 3DC8A 2XG9A 2BVTA 3VMOA 4OIFA 3O6DA 2V8ZA 4IX0A 3C0JA 3H55A 4AISA 4CU8A 2R14A 4Z1BA 1E6NA 4OOZA 1E55A 1XBXA 3ARVA 3FNDA 4FI4A 4CVUA 1HO4A 3OOQA 1ZB5A 3DBNA 4N9CA 4UR9A 5HMDA 3FYOA 1YXCA 4HSOA 4CU7A 1W1PA 2XWEA 4YTRA 2C71A 4E2BA 1TJ2A 3UZJA 1UCWA 4LBSA 2PGWA 3WD2A 3XIMA 4CEXC 4A05A 3CLWA 5I24A 1LL4A 1V3KA 5CLTA 4C6KA 2P3EA 2ON3A 2C6QA 5G2IA 5A6AA 1Q45A 4U5IA 3E2QA 4ZA0A 3UP8A 3IRDA 2A85A 3NEHA 1IIHA 4XBSA 4Z0JA 4LVDA 3DC0A 4GIRA 3ME3A 4BK9A 3LEPA 1CT5A 1DJQA 4E4FA 3W0KA 3OA3A 1R9YA 3ZJ6A 1GT8A 1C9DA 1YTDA 3MO4A 3TTYA 4Z08A 2WQPA 3B40A 1EQCA 1F61A 2BHUA 3LXAA 3DIPA 2PDKA 3U5YA 1T99A 5AYBA 1K9EA 3LCXA 4F4RA 5ABGA 4DVOA 2WVVB 2PE4A 3M0YA 3KP1A 4GYJA 2E09A 3B8SA 1IEIA 3GXNA 3TNBA 3F4WA 3TC3A 5D37A 2DH2A 4QJ4B 4HU8A 3LBMA 1G6CA 2B7NA 4RDZA 1FWIC 3JW7A 1IZJA 3L68A 3QSTA 2XFFA 4JFUA 1FWDC 2TPSA 4I6VA 3GNOA 2D2OA 4O19A 1MNZA 3P74A 4O18A 4KWWA 3UGRA 3P61A 2BODX 4RXGA 2AOSA 3THAA 2CETA 5LYRA 3W82A 1G94A 3WQ6A 2WHMA 4NHVA 1UMYA 1XLFA 1SGJA 2J6VA 1ZJBA 3VD7A 3VDBA 4QJ3B 4HMNA 1EWEA 2P5NA 2GVEA 1Q6QA 4BS0A 4MJ4A 1Z89A 3CZKA 5IHSA 1Q6LA 4JN7A 2C0AA 3TXZA 4GO9A 1P0NA 1HKIA 3ATYA 4TV6A 2X42A 5D05A 4GQRA 2WPGA 3IWPA 3AIUA 1JL8A 4WDWA 3BAWA 1H1NA 3DHFA 3LQGA 4N9DA 3TQKA 1FWWA 5I79A 4EKJA 3WFAA 1D8WA 1UH3A 3I3EA 2EG8A 3B0XA 3EA2A 3T6CA 1WZAA 4E0CA 1FWSA 2X1UA 1NSJA 1ICSA 1CYGA 5CAHA 3WQOA 4GH3A 3WD3A 3VU2A 3EEGA 3TR9A 2NUWA 2OYLA 5C2CA 1K77A 1EJ7L 3SIZA 1XPGA 1WE5A 1GOMA 4IH3A 1FFRA 4GZJA 4PUNA 4CNPA 4I7VA 3HM7A 4MJ2A 3BSMA 1H7XA 4UBPC 4EK7A 3E02A 1YMYA 4OECA 1ME8A 2ISDA 3CZJA 5HA7A 4S3CA 5C9RA 1UPMB 1US0A 3CV6A 4HHPA 3GR8A 4PUUA 5C7VA 4AF0A 4J3UA 2WC4A 4N9EA 1R9ZA 3GVVA 3PZQA 4A8LA 3DOPA 3MVTA 3AMCA 1XRTA 2D22A 4EPEC 2F6XA 4NNBA 1KWKA 2ZE0A 1MXGA 2JIWA 4K8GA 4PUWA 1XYZA 4HNTA 2NQHA 3V1HA 1JGIA 1X1NA 1IE7C 1W5NA 2O55A 3IIZA 2PSNA 3GWQA 4AVOA 4LH8A 5DQPA 3EX4A 5CXPA 4S3AA 3W1RA 4G2DA 2OYMA 2IXVA 1FHVA 1JDDA 3B0PA 3TJLA 2VCCA 1AJ2A 4E3TA 5E93A 4LYQA 1TVNA 3F2DA 1NF0A 3CU2A 3WDJA 3P3BA 1FWCC 4HYVA 1LL7A 2VEKA 1UA7A 5FL1A 1JCYA 1S1PA 4GACA 4PODA 2G37A 3PFMA 1ECEA 2WNQA 1D3CA 1MSSA 2PDBA 2CLEA 4D6CA 1CLVA 3GG8A 4GVGA 4CQ8A 1A5NC 2BXYA 2JK2A 4S1FA 1N82A 3AUOA 3OZYA 1JCTA 4B3ZA 4H6RA 2XIOA 3W85A 1GVYA 2IXUA 3BAJA 5MHBA 5EMKA 1W5MA 2FDMA 1WXYA 4UC5A 4TTUA 2XSBA 4A2RA 3GDMA 1D7KA 1J5TA 3BDKA 4P5UA 1U30A 1S5NA 2JEQA 3JU2A 3OQEA 4XO6A 3UJSA 2W5FA 1T8XA 2OQYA 1KRCC 1HN1A 3VOFA 2WNNA 3ZLHA 5CGTA 3E3HA 3FVMA 4W4QA 3WF3A 3TFCA 3WF1A 3OTRA 1MZRA 3B9DA 3KL3A 4L80A 1MO0A 2O9TA 1OGBA 2CKRA 2QDDA 4Y96A 5M17A 1G4EA 3IPWA 2W3ZA 1BVZA 4NAFA 4PFHA 4WK9A 1DE5A 1WOAA 3RYSA 2Y5EA 1LBLA 4C6LA 3C2OA 3PBUA 4QNWA 3CBWA 2DW6A 1W1IE 1XYBA 4N6EA 4PBEA 2DZSA 4QBXA 2XN1A 2QCCA 1L6SA 4KW2A 2DZXA 4QG9A 3WZ0E 3M0ZA 3W70A 5EYWA 2YCKX 1M53A 1UP0A 4AHQA 1C8YA 1PEZA 3RHGA 1XLHA 1XIIA 1IT7A 1O5QA 3S8HA 1VLWA 4WEVX 2PWFA 3STGA 3GSMA 2VX5A 2C14A 1WDSA 4DLFA 4R88A 3HGOA 3WELA 1A50A 4IIFA 5C8BB 3OLIA 5JIWA 1UR9A 1NOFA 5I07A 3ARRA 3L0KA 4JIRA 1K6WA 4EXQA 3OVPA 2NW0A 1QPQA 3QGKC 1J12A 5D9PA 5HNNA 5A6KA 4DRSA 2XSXA 4F0KA 1JUBA 3DBPA 1PX4A 4GUFA 3AIEA 1DHPA 3MO7A 2O7QA 1F3XA 2IQ0A 4IMAA 3IUHA 3UY7A 1WX0A 1TYGA 3BE7A 3VMNA 3ZJKA 5FA5A 3VCCA 1NQKA 4PSPA 2OVLA 2Q8XA 1LOSA 4H4IA 1X7IA 2WWDA 3H2MA 1W5QA 1JD9A 4GI6A 2PWEA 4L4MA 3BSHA 3WUEA 1J6OA 2GK1A 3UCCA 2QMJA 5CGMA 1TB3A 3VXGA 4A2SA 4EANA 3QPZA 2GGIA 4GNJA 1TV3A 1UKPA 1M41A 4O1EA 1EYEA 1DORA 3M46A 2VGFA 4GQ0A 2ZA1A 5LA1A 1J0JA 3M4HA 1V93A 1BYDA 4QIUA 3F2BA 4M56A 2J9YA 4X2PA 1QOXA 3FIGA 3EBVA 7REQA 4PFMA 4DBWA 3AYVA 3W38A 4ERIA 3WH8A 5AKQA 4WDXA 4NJGA 7CGTA 5EFFA 3PPCA 5DCEA 2WMJA 2E77A 3CYJA 1PX3A 1PWLA 1U33A 4B90A 3AHYA 5D4YA 5T9CE 4PB5A 5CBBA 3TH6A 4JTEA 3NQBA 1P6CA 3GIPA 3QOKA 5FJJA 4CD5A 4JTJA 4MZYA 1IT8A 4PCPA 2CC0A 1EA0A 2VP8A 3VMPA 4H83A 4DWDA 1S5VA 3H2AA 2AL1A 2ZZ3A 3S83A 4F79A 4GQQA 3B3DA 3G3DA 3LU2A 3GC4A 5FF3A 2H90A 4XTIA 3SN4A 1XYLA 1J18A 2BHZA 1PKYA 3K4DA 4PMQA 4DLMA 1TJ0A 1DJHA 4ZQMA 4LT9A 2Y7GA 1Q4WA 1H0IA 1J6PA 3CTTA 4J2MA 4A6GA 7REQB 1IQ8A 1P6BA 3N2XA 2O7SA 3DG6A 3GY1A 1C90A 1K7EA 4WF7A 1HTIA 4GX9A 3USZA 2ANUA 1GQJA 3NQ6A 1KLYA 1JYXA 2HXTA 3AS2A 2E9MA 4CNUA 5I02A 2XFYA 1XLMA 3TIMA 1UROA 3R6IA 3VO0A 3STCA 2VX6A 2QJNA 3CUGA 2GDVA 4HCDA 3FJLA 3O1NA 4FB7A 5LIKX 4ZXOA 4F9JA 4H9ZA 3W1PA 2ISFA 2FTPA 2YA1A 2CBJA 4V1YA 1RCOB 1A4LA 1E9ZB 4W7VA 3AALA 4G1NA 1XI3A 2WZEA 1V79A 1QTWA 4QXIA 4R85A 3BAKA 2OWCA 1X8FA 2VX4A 4WHBA 1RALA 4LYRA 2X16A 4GZ7A 4JIIX 3MV11 1CEOA 4KRZA 4D6HA 3HGRA 1FA2A 2C1HA 1SFSA 3RLGA 3I68A 1S5MA 2ZE3A 4DPPA 3UY8A 2D2HA 1Y5WA 2BY1A 1RXOB 4PCTA 4QDMA 5K9XA 1AW5A 1KKRA 3BURA 4J28A 1UW9A 3W7OA 4M3PA 1EIBA 3KRBA 2QJIA 4DYJA 3TTEA 2OEKA 3ALGA 3H4WA 2VRKA 2ZIDA 2Z00A 1YNYA 3VOIA 8RUCA 2V67A 1WUFA 2E5BA 4ZOCA 1VYPX 2X1RA 1K1DA 2XFRA 5I6SA 4YTUA 1GOKA 2QJGA 4E2DA 2YXGA 3G6LA 5H6HA 2YJQA 4N0RA 2HMCA 2VGGA 3K8KA 2DIJA 2PTDA 1QATA 3KVKA 2RGLA 2NV9A 3TQ0A 3VD5A 2XIIA 1XLGA 3AIVA 3MU7A 3U0HA 1IEQA 4QSFA 4XD4A 1GZJA 2FVKA 3WLLA 4Z2HA 3GNRA 3BGAA 2WSRA 5HJYA 1B2YA 3O3RA 1J8VA 1K8CA 2QCLA 3N1AA 1I60A 4QP0A 3VYLA 3DYOA 4PMDA 4PL2A 2JALA 1FY6A 2CHRA 1H1YA 2AKZA 3MWAA 3MSDA 2A3EA 4K38A 4JFWA 4PTVA 3VGDA 3KOXA 4K7VA 2JF6A 3LTYA 5HAOA 3UJRA 2V3EA 1GYLA 4OZOA 4UTTA 1RVKA 2GYIA 1M03A 2BB0A 3EMQA 3QHNA 4QAWA 2XDFA 2D24A 2RKXA 1DQWA 4ZBCA 4HZ8A 3MUY1 4US5D 5JQ9A 3HO8A 3GX9A 5JUVA 2X7WA 4AD1A 2E1WA 3PSVA 4L64A 4IUGA 4XAPA 3CMJA 4DELA 5DY2A 2CWXA 1JCXA 4DUOA 4MDPA 5LA0A 1H1ZA 3SY8A 3AHVA 1JYVA 3SZ8A 1YYAA 3LB0A 1OFPA 3W27A 5I2UA 3B05A 3BLFA 5EGRA 2A3HA 3RCYA 1UP2A 3EB2A 4MB4A 3G5EA 2FPTA 3PZOA 2BOEX 4C6BA 4TXEA 1TR9A 2CLLA 3SUUA 4NJIA 1DWFM 3A47A 3B0VC 1P0KA 4AD5A 1C7SA 2XU2A 2F84A 1SUXA 5LNVA 1HL9A 3FK4A 1RBAA 1SJCA 3VX0A 1YHTA 1A5CA 1HW6A 4X22A 1TKKA 2VDIA 1GQKA 3NM3A 4DXXA 1CXKA 2PB1A 3WLQA 3UR7A 2WC3A 2OX1A 4RX0A 1V0MA 3NPXA 3RU8X 1RCQA 7PTDA 1CB7B 3MHFA 5HQLA 1LM1A 1JXJA 4KFNA 3KOWA 3CPRA 4RNJA 1OX6A 3AZRA 4HGXA 5FSDC 3W26A 3PG9A 2QCNA 3PBGA 1XIMA 1D2KA 3BGJA 5D2TA 3CL7A 4GKTA 2EAWA 1NQ6A 3QZEA 4NI8A 4YNGA 1ZP4A 2A3AA 1C92A 3GXDA 1UP3A 3CPUA 1ZFJA 3EOOA 4CD8A 4DJDC 3L5MA 4S3DA 1W1ZA 3AIBA 3FW6A 2YCIX 3GDBA 3M5ZA 2PD5A 1DP0A 1RY0A 2DQWA 1LZOA 1UQZA 1UUMA 4QGCA 5CPNA 4U31A 3LRMA 2ZX6A 3OO2A 5M3WA 1EB3A 4S3FA 2OXNA 1U5VA 1R87A 4GYPA 1W54A 3IUIA 3AYTA 5BCAA 2E5CA 1LRQA 2DW7A 3A22A 5A6MA 3BMVA 4DQWA 1V3IA 1ALDA 1F6YA 3HU7A 1EJVC 3JVAA 1V3HA 3HG3A 3BAYA 1XIGA 3BAIA 1OX4B 2G50A 4KS0A 1KBJA 2OEMA 5BYWA 4QCFA 1GW9A 2DJLA 1IWBA 3CEUA 3FKRA 1YIXA 2I9UA 4L4OA 3EKGA 2OLSA 3SDOA 4Q4PA 3D0CA 2PGEA 1MFUA 2OELA 3P80A 4AD2A 2X41A 1ZPTA 2VUNA 4R34A 3LHWA 3KZSA 3OVGA 2CZFA 2Z2AA 4KWUA 1OM0A 2J7EA 3T40A 3PJUA 1V0KA 3JRKA 3S1UA 5JBDA 6A3HA 2IPJA 4O54A 3Q4DA 1RLDA 4YTSA 3WBEA 4HZMA 4WVXA 1Z69A 2PRHA 3TLLA 1AH3A 2W6RA 2ZZ4A 3MUXA 1V6TA 3MP4A 4DI8A 3URBA 3G22A 5LXEA 2ZOXA 1VBUA 3BLLA 1PKLA 4JQ1A 5BMWA 4CNTA 2A3BA 2EJAA 1XYFA 2ZZ5A 4H1ZA 4UFIA 3IIOA 1JRCA 2C1IA 3PUOA 4YIWA 4HPJA 2YOCA 3NUKA 2DP3A 4I6KA 4FSAA 4GJ1A 3W75A 4ZENA 2NVCA 3DAQA 5L6UA 3UWZA 1L9WA 3WLHA 1T0OA 2XSAA 3BG9A 3MJYA 3ISIX 1MDRA 4ERGA 3W1XA 3POHA 1TFVA 3WLMA 1HVQA 1TPDA 3UNDA 5TIMA 1AQMA 2A4AA 8XIMA 2PGRA 3RM9A 2XVLA 3CUXA 4GY1A 4UTIA 1S2UA 4Q8PA 3T1GA 1UD2A 1J0ZA 3NYDA 4UZUA 3GB6A 5RUBA 4UTTC 2B7OA 1YKWA 1R86A 3CH0A 3R8RA 2HE5A 3OZMA 3XISA 1XP3A 3W2KA 3Q37A 3I7SA 4RDYA 1WXJA 2Y61A 4GXWA 4GLEA 9RUBA 2I17A 4WY0F 4LUTA 4PRTA 2BP1A 5EL1A 2HXUA 3L4YA 4UFLA 1RQBA 2GSJA 2AAMA 2A3CA 4KBXA 2WLYA 3EWUA 1O66A 2OWWA 1EDTA 3DERA 3H7RA 3QFEA 2F6KA 5HWJA 4IIHA 4C6IA 2GGEA 1TPB1 5CSRA 4O0KA 2DUZA 5E09A 2YSWA 4KESA 1Q6FA 1RQEA 1QOQA 1V7AA 3LLDA 3B8IA 3BANA 9XIAA 3WLRA 4AMCA 2PWDA 3ZM8A 1NTHA 3EPNA 4J2PA 3PPHA 1UBPC 2OSYA 4GBUA 3RLUA 4CUCA 5I3HA 1W3JA 3NQFA 5CJMA 1KGXA 4LUTB 2AGKA 3WQWA 3CZGA 3IJLA 2B31A 2ONEA 3IJQA 4O11A 5MKGA 3RPTA 4BR1A 4GY0A 2GGJA 4D6IA 4IMGA 3CHDA 5A6SA 5EMLA 2JBMA 4K6AA 1A4MA 3UGVA 4EF9A 4OGZA 1XLKA 1RZMA 1M68A 1A5AA 1ESWA 3KHJA 4MYAA 1LT8A 5CG0A 3BWWA 4J1OA 3VIHA 2XN2A 2BMBA 1B3WA 3ICJA 2KX9A 2J7GA 4ML4A 5LA2A 5CZSA 4D1IA 4OKDA 2Y0FA 4H9TA 5IBXA 3GQYA 2EPMX 1YPIA 4B92A 4R7OA 1E6SM 2UV8G 3TYUA 4L5ZA 3BVJA 2JEPA 4HA3A 4YL2A 2EPNA 1LRNA 4X0VA 1NWTA 2E6DA 4EF8A 2V3DA 1PSCA 4MAZA 1VAHA 4H00A 3BZGA 3W7DA 3CO8A 1VRXA 3ARQA 3L2LA 1QXLA 5FOOA 1O12A 4HU3A 1LLWA 3TDFA 1U1HA 1E6RA 5KTLA 4MZ1A 4S38A 4JTLA 3WN6A 3WMLA 3A5VA 7TAAA 1RAKA 1EJXC 1BLIA 1EPXA 1QW9A 2VMFA 4K37A 5REQA 3I3DA