1HO1A

Crystal structure of pyridoxine 5'-phosphate synthase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the function of pyridoxine 5'-phosphate synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords PYRIDOXINE 5'-PHOSPHATE SYNTHASE
total genus 93
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ho1A00
3PSWA 4OV4A 2NUWA 4K36A 5KITA 3N14A 5G2HA 1FCUA 2WV8A 4Q33A 1KM4A 3W85A 3PY2A 3NQ2A 4LS0A 3W72A 4J9JA 2QUVA 3UNDA 2EKCA 3W2NA 2X30A 1MZHA 3L68A 2H90A 2BLEA 4Q32A 4MZ1A 4RLIA 3LTYA 4CNNA 3PBYA 3LHZA 4LWWA 3PG8A 1FCBA 3NZ1A 2CZ5A 5LHEA 1EUNA 3LTPA 3EXTA 1XBZA 3C52A 4POCA 4ZL1A 3TMLA 4UFLA 2GVJA 1XM3A 5DXXA 5I3GA 8TIMA 3UWWA 2E77A 4N6EA 1RZMA 1JJKA 2B7QA 3UWUA 2CZDA 3EKLA 2V0TA 2E5CA 3EKZA 2Z2UA 3W7QA 5D05A 2YSWA 3MHGA 1TJPA 4WXYA 5AHEA 5LSMA 3PBVA 1PHWA 3LHWA 4IWWA 5F4XA 4EWND 4TMBA 1WYIA 4RZ5A 3EEGA 4UTUA 1XBYA 1W3NA 4RJEA 2C15A 1GVFA 4JX5A 3S0CA 4HSNA 2TRSA 3M41A 1MEWA 3I68A 1H61A 3W1AA 1DOSA 3FKKA 5AHMA 3EWWA 1HO1A 3ZS4A 4IMEA 4NXKA 4Y90A 2J9YA 3A24A 3STEA 1KTCA 3NAVA 5H2ZA 2O7QA 4GWEA 3W1UA 3HBLA 4O28A 3W7HA 3P5ZA 4LNYA 3HMJG 1SUXA 4O0ZA 3M5YA 2UV8G 5DELA 3IIZA 3W2JA 4O1DA 3W86A 4P2VA 4N9DA 1P5BA 3NVTA 1LCOA 3E96A 4DF2A 1O5XA 4JTLA 1GVRA 1UJPA 1UB3A 2OT0A 4BFAA 4MUZA 4YCOA 5I3IA 1KV8A 1N7KA 4KWWA 5DCBA 1YTEA 1YXDA 2Z6IA 5CPNA 4DBEA 2YPIA 1LORA 4E0CA 5AC8A 3PF3A 3N73A 3TW7A 2Q3OA 2VELA 3E9AA 2VOMA 1PIIA 5CSSA 4E38A 2P1FA 4Z1DA 4O10A 2HS6A 5LNVA 2H3BA 1DBTA 5C6MA 1YPFA 4Y9AA 3TJXA 3EWXA 3MJYA 4RZ6A 3TIMA 3GR7A 2PCQA 3L5AA 4JTSA 1TPB1 4ONVA 4IX0A 5FF3A 4RKAA 4OBTA 5HNRA 3CEUA 4PCFA 1VCVA 2VFEA 1OX5A 3A9IA 1K8YA 3GXPA 1XBVA 2Y88A 4RCXA 2QCDA 2KZHA 1DL3A 4FX8A 4GE8A 1SO5A 1VRDA 4I7VA 1A53A 4O16A 4AF0A 4O19A 3NDOA 4LC6A 1KM1A 4LUJA 3LCXA 4S2CA 2O7SA 4O57A 1HUVA 1I2QA 2ZRVA 3QJAA 2Z0IA 3W1TA 3O6DA 3H55A 3LBCA 3L0GA 3TFCA 1VHCA 5HINA 2G95A 2FB3A 1JCJA 1ADOA 4X9SA 2QAFA 3NZRA 1KFLA 2FQIA 2W79A 1W5QA 4U4MA 2NLIA 3TAOA 3E12A 2QCDB 3MYOA 1G69A 3RK8A 1JCNA 2A85A 2NWSA 3DFQA 2J24A 5LHFA 3QMRA 3IRDA 3NPUA 2OX1A 3MMTA 4NNCA 2ZTKA 1KFBA 3GX9A 3V75A 4ZQOA 2ABBA 5AHNA 5DLCA 1I2OA 1WX0A 3U8GA 3UXDA 4AH7A 3C6CA 3KRUA 2QJIA 1FQ0A 1P4CA 3IGUA 3THAA 2A7RA 3L0NA 4LVFA 1OX6A 4XKYA 4MOZA 4NJKA 3W87A 4FNPA 1A5BA 3MHFA 2YX0A 3M47A 3EB2A 4LVGA 3IGXA 2AQWA 2Z6JA 3CT7A 3VCRA 3EX1A 4NJHA 2R91A 3GAYA 3QZEA 2C3ZA 5BRBA 3LRMA 1H51A 4HT3A 3L2IA 2GJLA 3MP3A 3SFKA 2PURA 3EXSA 2ZRXA 5C2XA 1H62A 1V7YA 6TIMA 3E0IA 1R47A 4S2BA 3TQ0A 1MO0A 3BGJA 3KRZA 3SJ3A 3FA5A 4ZQCA 4LV9A 5E1QA 4K39A 5IBXC 5L6UA 5FEXA 1WOBA 2Y7EA 5MHBA 5KZEA 3LDVA 4MJMA 5FEWA 5LZLA 3ABQA 1VQTA 3KFTA 2FPYA 2FPTA 2PRMA 2V8ZA 1H63A 1QOQA 1W3TA 4HN4A 3DZ1A 2X2GA 4LV4A 3P62A 2DP3A 3L65A 3NL3A 3P7YA 1TCDA 1K7EA 4JTEA 4N02A 4LRTA 3LOTA 1TTIA 3GYEA 3TXZA 1QPQA 1DORA 4B5NA 3M7WA 1X1ZA 2QJHA 1KM0A 3B04A 1S5TA 5C5YA 4GC4A 1LBMA 1GQNA 4IPJA 1TPC1 4JY9A 2ZZ4A 2X1RA 2RDUA 3TSMA 1TPUA 5E0KA 1GTEA 3PG9A 4FIRA 4UFHA 2ZZ6A 3NNTA 3P61A 1KFKA 3NPVA 4PL1A 2WSQA 4CNPA 4NJGA 3KRSA 2DZTA 3GZ3A 1TREA 3I7SA 1ICQA 4LY8A 3C4UA 1QO2A 3IVTA 1D3GA 1QAPA 2H6RA 3CTLA 3S5ZA 1SZGA 3FLUA 1I2PA 3W7PA 5DBUA 4MY1A 3QSTA 3G1DA 1TPFA 4XWUA 1O95A 1AG1O 2J9ZA 3P8IA 3ATYA 3NL2A 1GOXA 4QSHA 5HUPA 3UPBA 1QPRA 1G4SA 3CHVA 5G2WA 4PODA 3NQ7A 5I3HA 3S6DA 4JD4A 3WK3A 2VEPA 4PL2A 4NXSA 3G8RA 3WJSA 2Q8ZA 2WNNA 5D30A 5FEZA 1YTKA 2TYSA 3L66A 1G6CA 2J9XA 1A5SA 1SQ7A 1LBFA 5G5IA 5CGQA 2VC6A 2A6NA 5IM51 3TQVA 2Y7DA 4LUIA 3W7CA 1UASA 2DJXA 3UZJA 3W1MA 1WQ5A 3NR0A 2PE4A 2R8WA 4NU7A 2F84A 2YDAA 5EPDA 4UFKA 4AAJA 1EWDA 2ABAA 3PUEA 2ZRZA 2Y62A 4MYAA 1KFCA 4CQAA 4JEQA 5D2WA 3MW7A 4GUIA 1W0MA 2C19A 3HPZA 1MXSA 3GR8A 3N9RA 4NUWA 4OU1A 1TO3A 3G3DA 3HG5A 3FS2A 2YGYA 4YLWA 4HHPA 2G5WA 5AHFA 1IIHA 2FFCA 2GPTA 4BI7A 1FDYA 3RMJA 3W1PA 1C8VA 2ZZ3A 1FXQA 4Z0SA 4K38A 2J27A 1E51A 4GNJA 3BG3A 1T96A 3CM4A 1IF2A 1OYBA 2VFDA 2E1DA 1X7FA 3EX3A 3STCA 3LCFA 3W22A 2ZYFA 4WY0A 4Z1AA 3QH2A 1KM5A 1M7PA 1NF0A 3B05A 4FNTA 2JGQA 3EX6A 1O5KA 1EA0A 2QCCA 1QPNA 3MO7A 4NNBA 5CPOA 5FF2A 3GXTA 4TU1A 3OHIA 3USBA 1IXQA 1O4UA 1XDMA 1T8XA 4DPQA 3P67A 1B4EA 5AYZA 5AOUA 1AK5A 1G4TA 1Z48A 3ABRA 1RD5A 3HIJA 2Q8LA 5AHLA 3NQMA 2BSLA 2C13A 3B0PA 3MI3A 4ML9A 3SZ8A 3BW4A 4JGDA 2Y89A 1YDOA 4X2RA 3W70A 5I3FA 1JRCA 3FEMA 4FF7A 1F05A 3N2MA 3LCHA 1MEIA 4DXVA 5FI8A 1P1XA 4KWVA 1JR1A 5AYXA 3N19B 3A23A 5F1UA 3VNDA 5K3VA 1THFD 5EYWA 1CI1A 3DKLA 3HJZA 3T55A 1PL9A 4NQ1A 4RZ4A 4UTHA 4QAIA 3PVFA 4AF0B 4JYDA 1B4KA 5F2IA 4IJBA 3DKJA 4DO4A 1QWGA 1EP1A 3H53A 3JR2A 4NJJA 2DU2A 3TDFA 3G8EA 2WJZA 2DZUA 2V2CA 3OVRA 4O13A 4NZFA 1W31A 1W54A 4NJIA 4DO5A 4O4VA 3FIGA 2YXGA 1GT8A 1K3UA 1YXCA 1OF8A 1F76A 4XTDA 5CZSA 4KKXA 3W2KA 3NL6A 4JTJA 1SO4A 1FWSA 1TRIA 1XC4A 2W0UA 4CQ8A 1ZAIA 4UIOA 1KM6A 3P5YA 4LC8A 5DN1A 4UFIA 1WOAA 3QPYA 3BVJA 3W7EA 5KZMA 3O15A 3HGSA 3LGEA 3M16A 5GVJA 3NL5A 5C54A 2Y70A 1ZJIA 4FNQA 3W23A 3LHUA 3QC3A 4DF0A 3O05A 1DV7A 4HNNA 4UMBA 1PCKA 4AMAA 4H3DA 1AMKA 4JTIA 3IIPA 3FJ6A 4NZJA 5D04C 1KFEA 5H91A 1MEHA 3TR2A 2IQTA 1OYAA 2DZWA 1LRQA 1KM3A 1VPXA 4DBDA 1UBSA 4IMFA 5D33A 4LU0A 1TV8A 4O4WA 2CW6A 2J6XA 2OCZA 3VFLA 1VYPX 2QUTA 4WQ6A 3LTSA 1F5ZA 5KTLA 3DFOA 2A21A 2V81A 4PC8A 3DBPA 5HR6A 4BR1A 2JBMA 2VEKA 4LRSA 4CNOA 4DQWA 3DXIA 3ANYA 5DBTA 1OFDA 3KVLA 4CQ9A 3WJYA 4AHQA 1Y0EA 1EB3A 2FJKA 4A21A 5LGZA 2ZA2A 3NXFA 1I4NA 2ZTJA 4PEKA 3TFXA 1TPEA 4DO6A 2OJPA 5D32A 5FF7A 3D0CA 1JUKA 3ZFHA 1GG0A 2QCMA 3G18A 3S1WA 3LLFA 5KSWA 4A2RA 1G7UA 4O1AA 3UY8A 4MZ8A 1HTIA 3F4NA 1JRBA 2E6YA 5A5WA 3QMSA 3GB6A 3E02A 2EAWA 1FDJA 3AJXA 4IXXA 3U6WA 3CC1A 5HMSA 5K9XA 4JTGA 1XFBA 1ZAJA 3MBFA 2CU0A 3WK2A 1KLYA 2VFFA 2XN0A 4FX6M 4JTUA 1QMLA 3L9CA 1H7RA 2ISSA 1H1ZA 5TQLA 3GK0A 4EVZA 3NQAA 1F7BA 4UNKA 4UCGA 3W84A 1XI3A 2VENA 1EP2A 1AL7A 4MZYA 1QFEA 2Z1BA 4TR9A 5D2XA 2GQ8A 4FB7A 3FOKA 4AWTA 4XTIA 4XZ9A 2Y7FA 2FB2A 3LM7A 3RU6A 3P81A 4JX6A 3HGOA 1L6SA 2VXNA 2OT1A 1OVDA 1QOPA 5AN7A 1PV8A 5D03A 2Y61A 1H7XA 1IIGA 3BO9A 2H3DA 1VCGA 3C0JA 3G0UA 5E93A 1LM1A 1NAL1 3S5NA 5HQEA 3W7GA 3O6CA 2DZSA 1I45A 3R12A 3F1QA 4WY0F 3MWAA 1GVQA 4UFJA 5IBXA 1ZAHA 4O12A 1XBXA 5D2TA 3WJZA 3NQFA 1H5YA 5KZDA 4O0KA 2FLIA 3B03A 4ZQMA 1WA3A 3PR2A 2NUXA 2A7PA 3A5FA 1PCWA 1YLVA 1NFBA 4IGHA 1TPWA 2QCEA 2I14A 1TB3A 4JICA 1RQEA 4LTSA 1W5PA 4JTTA 4QITA 5LGXA 2A0NA 1Z41A 5D37A 3BGGA 3NG3A 4ZQPA 3CLMA 3N2XA 4UTWA 1L6YA 3M44A 4OE7A 1GJPA 2A4AA 2GUUA 3B06A 3BPWA 2B0MA 1YDNA 3TXVA 1FBAA 4HPXA 5HWJA 1I2NA 3PULA 4EF8A 1Q45A 4UTLA 3G1HA 4WUIA 3M5XA 2V5LA 2JKAA 5G1YA 1RV8A 4JR5A 4MYXA 3QF0A 4MVAA 3G24A 2HTMA 4FIQA 4R34A 2E6AA 2AAMA 3EWUA 3DHDA 1FWWA 5HWNA 2ZFAA 4LVAA 4JTHA 4LW7A 3TCEA 1TIMA 5G2IA 1LBLA 3W7IA 2Y63A 2V5BA 4LOCA 3LCIA 2RFGA 1F74A 2ZRUA 2ALDA 2WSYA 3AO0A 1IXPA 4O11A 1LROA 5I3JA 1Z42A 4WOQA 4AWUA 3TW6A 3BV4A 3OVQA 1H1YA 1VHNA 3LBMA 3HGJA 5DY2A 3PS7A 2ZRWA 4R53A 1IGSA 1ZALA 3W1RA 3O07A 1ZHAA 4JYFA 4FXSA 4NNAA 3SGZA 2TSYA 3DGRA 4MFEA 5EY5A 3S1VA 1YADA 2X1UA 2QJGA 3M9YA 3MI2A 1BKSA 4JIPA 3PM6A 3ABSA 3RF9A 4H4IA 4DF1A 3CQ0A 3CB8A 4OHQA 3S1UA 1TPVA 4A22A 5CZJA 1OFRA 3G1AA 3BG5A 2JGYA 4OT7A 2A1YA 1LDCA 2CLLA 1OFAA 3NM3A 4N4PA 2NXHA 1DQWA 5BNKA 3P80A 2JKEA 3SECA 2ZA1A 1QPOA 3S9YA 1GTHA 1VJIA 2HMCA 5LNUA 5G1TA 3HPXA 3BW3A 3TKFA 3THQA 4ZMGA 5DCDA 5K2ZA 2DJLA 5FF4A 1TQXA 1VR6A 5EL1A 3W1NA 1QCWA 4UMCA 4TX9A 2QCFA 4JXCA 3W88A 4UFMA 3DAQA 3IIXA 3B4UA 5LNWA 2WNZA 3TK7A 3EWZA 1H60A 4ICNA 2YW3A 1BTMA 3DFSA 4LS2A 2ZBTA 3SW6A 3LHTA 4PFMA 3UQNA 4CLMA 5HR7A 1ICSA 1OJXA 3W83A 4UMAA 2FIQA 4LVDA 1FXPA 1DHPA 3LX9A 4Z1BA 3WJWA 5CZTA 1F73A 4NT0A 1SPQA 5AHIA 2ZRYA 1TRDA 1GG1A 5CSRA 4QNWA 3U2OA 1DKWA 4UTMA 5AC6A 4ZQNA 2I1OA 1ZCOA 3HO8A 2DZXA 3LV6A 4JYEA 4MLRA 1F6KA 4M6QA 1IXOA 3GVGA 2OMAA 4M7SA 3LI0A 4A2SA 3TMQA 1TTPA 2FDSA 5D2VA 3DHFA 3C8FA 4GUFA 4YWIA 2TPSA 1Q3NA 3IVUA 3DFTA 5F4WA 1WAUA 3NM1A 4YL2A 4X22A 1DVJA 3KVKA 2BZNA 3P74A 3O8AA 1P0KA 4MJZA 3G1VA 5SWUA 4JTKA 5CPLA 1YYAA 5TBOA 5D2YA 3Q94A 1KTNA 5K9CA 3M5VA 4WXZA 4MIMA 4EF9A 2C6QA 3NQGA 1OFEA 1OK6A 3PB0A 4R33A 2WSRA 3KXQA 2JKPA 1I2RA 3UXAA 1GYNA 2V9DA 2YCEA 4GXMA 4WD0A 2X1SA 3O16A 5A8GA 4JS3A 4PH6A 4KFPA 3RLVA 4ADSA 2G97A 1G67A 2P10A 3VE9A 4DEFA 2C14A 1Q6LA 3LHYA 1ML1A 4GRSA 1H7OA 4YCPA 1W37A 3BW2A 1CW2A 1GVOA 1EEPA 4M6PA 3VE7A 1FWTA 4GUGA 4JTFA 3C2RA 3INPA 3O1NA 1TYGA 3QM3A 3GDKA 4OGZA 3TH6A 1SZEA 3N9SA 5I3KA 3NEVA 2C16A 1U83A 4ZQRA 2QKFA 1JULA 5AFDA 3NQCA 2CZFA 1ALDA 2ATMA 1VCFA 4RX0A 1H7NA 2QCLA 1VLWA 4K8HA 3TUUA 1LZOA 5AC7A 1AL8A 1EIXA 3R13A 2VFHA 1S5WA 4UNLA 3CWOX 3LB0A 3TNOA 2QR6A 3STGA 1I8JA 2NXGA 3FYPA 1S3HA 1XDLA 1O94A 1RR2A 3NQ6A 4IX2A 4JX4A 4K6AA 3L21A 1QR7A 1JCXA 2Q3RA 3O6YX 3I65A 1W8SA 2BWGA 2VFGA 2XFWA 2E68A 3MP4A 4FEZA 1VYSX 1K03A 1XUUA 3QW3A 1SO3A 1PE1A 2NWRA 4NX0A 3ABOA 3TC6A 4UXDA 3TSBA 3M6YA 1RQBA 4LVBA 1KLZA 3T44A 5LNSA 4QQ3A 3S5YA 3P84A 5FF0A 1U5JA 1V5XA 4M6VA 1KBIA 1ZFJA 4QIUA 4O8RA 4IOTA 3MP5A 3R2GA 2CLFA 1NSJA 3HF3A 4I9AA 3LCGA 3KX6A 3V1PA 3W1XA 4MKNA 4AWSA 2CLIA 4FX7A 2GJNA 2E6DA 4D2JA 3RFAA 2WQPA 4JNMA 1FUYA 3QW4B 2V30A 3M1ZA 3GXNA 2VFIA 1SZFA 1HG3A 3DU0A 5J5DA 4UC5A 3GLCA 2YYUA 3B0VC 1G4PA 1OX4A 1GYLA 3OA3A 3OVPA 3RLUA 1F6PA 2VKZG 4GJ1A 2PRHA 2DZVA 2ATSA 5AYYA 5BW6A 1SSGA 3EWBX 1KFJA 3Q2DA 4XUGA 4DPPA 3G1SA 2Y7GA 1OG0A 4UTKA 3L67A 4K8EA 1EP3A 3TROA 5J5RA 4E2DA 1M5WA 2H8XA 3SY5A 4IUOA 4TIMA 1JUBA 3PWAA 1WXJA 2QEZA 3SI9A 1OABA 4O54A 4Y8FA 5FESA 3UWVA 3JRKA 2YFOA 4L4LA 3ZWTA 4DELA 1B57A 1W1ZA 1TQJA 3OBKA 3LHVA 3Q58A 3S8HA 3LCLA 1J5TA 2DORA 1TMHA 4FNUA 1K7XA 3GAKA 3C2VA 1VZWA 2HSAA 3ATZA 5EKYA 3G1XA 1HFBA 2V2HA 3W7OA 4PA8A 3NOEA 3TA6A 3W2MA 2DZPA 3PUDA 3NGJA 4UR7A 3M43A 3L5LA 3R89A 3P60A 1ZENA 2NZLA 5DXYA 4N9BA 3K30A 1EPXA 3IIVA 2QCNA 1OFPA 4BWLA 2YYTA 1TV7A 1A5CA 2FPVA 3QSRA 1DJNA 1O60A 2GVLA 3R5EA 5CPMA 3NA8A 3W1LA 2ISWA 1OFOA 1WDWA 3M0ZA 2EF9A 1YTDA 1CX9A 5HULA 3LV5A 1OFBA 2QDHA 3QQ1A 3G3MA 2CLKA 1PVNA 4Z0JA 1WV2A 3N3MA 4XQ6A 4PTNA 2J88A 3QPZA 1FCQA 1SW3A 3W76A 3QMTA 3MYPA 2GOUA 3DENA 1A50A 3O63A 3W6YA 3GDLA 4XKYB 1VLIA 4MY8A 3PBUA 1D9EA 1GVSA 4RXGA 4NVTA 4ORMA 1XL9A 4ZVJA 2GQ9A 4EIVA 1QO5A 3HG4A 1UUOA 5BOOA 1KTBA 3SR7A 1LOSA 4IMGA 1IXNA 2NUYA 1GWJA 4LT9A 5HUOA 3LI1A 4YMZA 3PC0A 5KMYA 3NO5A 5KINA 2CLHA 1KW1A 1X6UA 3PUOA 1G7VA 2YZRA 3N34A 3C2FA 1PS9A 4A3UA 3OG3A 5K7JA 1W5NA 1LLZA 1JUEA 1C29A 3WK1A 3GDMA 4CCCA 4RK8A 3E49A 3S42A 4YXGA 2A7NA 5EA9A 3T78A 3G1FA 1L6WA 1B3OA 2HS8A 3PB2A 2E5DA 1BWLA 1TPH1 2RDWA 1YDVA 2EPHA 3SSJA 3KHJA 3JS3A 4UTTA 3UD6A 3GDRA 1D3HA 1QDSA 3FJLA 4O17A 3UWYA 4S1FA 3M5ZA 4M5PA 1Q6RA 2GQAA 3W1QA 1L9WA 4L4MA 4A29A 2ZCGA 3C2OA 3W7RA 3R8RA 3UWQA 1DQXA 1VC4A 2WO5A 5C55A 3HOJA 1L2UA 2P0OA 3TV8A 1ME9A 2C1HA 3ELFA 5LNRA 1W5MA 2QCGA 3EWYA 3F4WA 1G4EA 3SGUA 3WFAA 4TO8A 3HB9A 4OV9A 4WX2A 3LCWA 5DCEA 3UZ5A 1OK4A 1RVGA 3FKRA 4UUIA 1ONRA 3VKJA 3W7KA 2PC4A 3W2LA 1H50A 4Z08A 4IXHA 4AXKA 4N6FA 1OFQA 1KV5A 1FWRA 4CCEA 1R30A 3W7DA 5CZ0A 3TU9A 2EHHA 3BARA 6ALDA 4N4QA 1HO4A 2AGKA 2GVGA 4RXFA 4BI6A 4JN6A 1RQHA 1K8XA 3TX9A 1VGAA 1SZNA 3F03K 1BWKA 2NV2A 3RNDA 4HPJA 1AW5A 2CZEA 1N55A 2BTMA 2QUUA 3I6RA 4K37A 4WJEA 3L5MA 5G4EA 1PHQA 3MBDA 2QCHA 2ZZ1A 4QNEA 1SU5A 3LXCA 3Q37A 1YXYA 2A2IA 3UWZA 4TMCA 3DFNA 1ME7A 1R2SA 3QFEA 2VEIA 3MI6A 2RDTA 4QJ1A 3HG2A 1LRNA 2B7OA 5T26A 3NPWA 1C9DA 2NX3A 2I9EA 1GPWA 3IIOA 2WNQA 4NX5A 1NEYA 4P61A 4UTTC 3W7MA 4KFOA 4EOUA 1F2JA 2TMDA 1ICPA 1LOQA 4Y96A 2FTPA 1M7OA 1TPDA 3LXBA 2R14A 1LLWA 4ADUA 1OF6A 4M19A 4AHOA 2NX9A 4QM1A 2CLEA 3BLIA 3PAJA 1W3IA 3C2EA 4O52A 1EWEA 3W73A 4WY0B 5K4ZA 1B9BA 1FDZA 4IMCA 4WZHA 1LYXA 1K02A 1JCLA 2WOQA 7TIMA 4KFNA 3GNDA 4ALDA 4M7TA 3P8JA 4FXRA 4G1KA 2G96A 3IV3A 3UY7A 5L9FA 1VS1A 3STFA 1ZY9A 3BLEA 1LTDA 2V82A 4K7VA 3NQDA 5G4WA 2CLMA 2RHGA 3MUXA 1EX5A 1TTJA 5ABTA 3NYZA 1TSIA 1W56A 4FNRA 2WPBA 2VEMA 3TQKA 3NQ8A 1EUAA 1FY6A 2QAPA 2YR1A 1AW1A 1Q6OA 3CPRA 4K7YA 3KAOA 4QISA 2B4GA 3MHUA 1UCWA 1OYCA 4N2YA 1NF7A 2C18A 3W07A 3L0KA 1SFJA 2PRLA 2YFNA 2Y6ZA 5CKSA 5BMWA 2YW4A 3OEXA 3HGRA 4OWGA 1T99A 2X16A 1FX6A 3CIXA 5F2MA 3LXAA 3EX2A 4C1LA 4HSOA 5F1VA 2RH9A 1GZGA 1JQXA 1R2RA 3QYQA 4HNTA 3KVMA 3SIZA 3LRKA 4MFDA 2C0AA 2NX1A 1TTQA 2RKXA 4GUJA 1DJQA 2W6RA 1XKYA 1X8FA 3EXRA 1SR9A 2A6LA 4H6KA 3T4CA 5CG7A 3VI2A 1UUMA 4HNVA 3H54A 3DH7A 3EX4A 2EGZA 1LP6A 2XN2A 4AEOA 3TE9A 1KBJA 2ZA3A 5HJLA 4JDYA 4O1BA 3T40A 3G0XA 2QF7A 3HG3A 4O14A 2QDGA 5U4NA 2B7PA 4UTJA 1A5AA 1VYRA 4ORIA 4UTWC 1K7FA 1TJRA 2ISVA 1LOLA 2NV1A 3GKAA 1M6JA 4OQVA 3PBWA 4AVFA 2E09A 1N8FA 3GKFA 3W7JA 3QEZA 1KM2A 4BF9A 1T0OA 3W9ZA 3CEPA 1VH7A 2B7NA 4ZZ9A 4ADTA 3IEBA 2ZDRA 4IPIA 3LLDA 2R94A 4FO4A 3W2UA 3PSVA 2LLEA 1OX4B 4MY9A 3TAKA 3W74A 3B8DA 3ZR4A 5F4SA 1JCYA 2F7FA 2X1TA 3I7QA 2H8ZA 3W7LA 1H7PA 1J2WA 1ME8A 3A5VA 3P82A 4O1CA 4FHAA 2E5BA 3LERA 4JIQA 4JDBA 3DI1A 4BK9A 4UR8A 3FYOA 3BK0A 1SFLA 4HKPA 1R46A 5D02A 3LRLA 2A5HA 4N9EA 1WBJA 1XXXA 4LS1A 4N9CA 4X3ZA 4I7WA 3KOFA 3WJXA 3G0SA 3CWNA 3W3OA 3S5OA 3GIYA 4CCDA 3NQEA 1JCMP 3KVJA 1K8ZA 3FFSA 1SW0A 1P0NA 4IMDA 1ZNNA 5DY3A 3DI0A 1FCVA 2CLOA 5K9DA 4MLJA 4UTIA 4IQLA 1WBHA 1Z44A 3TJLA 3UYCA 4FNSA 4AB4A 3I7RA 3DFPA 4W9TA 5F2LA 3W7NA 1Q6QA 2JK2A 3CU2A 4R7JA 4O53A 2ZQ0A 3YPIA 5BMXA 2CWNA 3BLFA 1OHLA 4MPQA 3UPWA 3T7VA 5D38A 1YPIA 4I7UA 3A21A 3GNNA 4BWLC 3NPXA 1LRTA 3GDTA 5AB3A 1SW7A 1KA9F 2BX7A 3ZWSA 3IVSA 3C56A 5K4XA 2WKJA 2OZ0A 2D73A 1MSSA 1SSDA 4WOZA 4AHPA 1H7WA 3QQ0A 1FWNA 4BI5A 1RPXA 3HPSA 1J4EA 1NVMA 3NQVA 1BEUA 5EBUA 4XBKA 3C61A 5F2GA 5FEPA 2ZZ2A 4Q4KA 3W75A 3QRHA 2XN1A 5D09A 3WK0A 1JVNA 4U28A 1AW2A 1JQVA 4C1KA 1TV5A 4XBSA 3TSDA 4E2BA 1XUZA 5HWMA 2Y85A 1W5OA 1SO6A 5U7SA 4Z1CA 4RR4A 3IGSA 2E6FA 4HNUA 5LKYA 2BXVA 3CIWA 3A22A 3G1YA 1HL2A 3OIXA 2ZZ7A 4GBUA 4RV8A 1S5VA 1R2TA 3S1XA 3BG9A 2NXIA 1XCFA 4O18A 4GFSA 4HIBA 3B0UX 4GUHA 3HQ1A 1X1OA 4O50A 2CFFA 2V2DA 5EMUA 3C3NA 4Y6GA 4JY8A 3W71A 4O15A 1GEQA 3G22A 3O06A 1QNVA 5TIMA 3TC7A 2ZZ5A
chains in the Genus database with same CATH superfamily
3PSWA 4OV4A 3WLMA 4YTSA 3UGVA 1V0LA 5KITA 1FCUA 4J9JA 1FWCC 1LQAA 3A3WA 3LG3A 2H90A 4L4OA 4JHZA 4Q32A 1XP3A 1H0GA 1IR1A 3MCOA 4RLIA 5E0FA 1MI3A 1HKMA 2AL1A 1BFNA 4CNNA 1TJ1A 4GZEA 3LHZA 3MCMA 3AAMA 4ICCX 2WZIA 4X0VA 1EUNA 4IGNA 2FTYA 3EXTA 4ZL1A 1R9YA 1XM3A 4S23A 1PWLA 8TIMA 1J0HA 3UWWA 4QTGA 4ZO8A 1JJKA 1QASA 2B7QA 3MKCA 2P88A 2YSWA 3GWQA 3M64A 2Z00A 3II1A 5I24A 1TJPA 5LSMA 2WAGA 1V77A 5G4HC 2OZ8A 4EWND 5M17A 1DWIM 2GVYA 2DFAA 4RJEA 3W6MA 2C15A 2OKTA 3ZT7A 3TJ4A 1P1MA 3ZJKA 3AXKA 5EMLA 3M0VA 3M41A 1P6BA 3QV8A 4D9PA 4D6CA 2OKOA 3EWDA 3WLKX 3VC6A 4MDOA 1FWHC 1XHGA 1J0ZA 1Q13A 1LT8A 3U7VA 3M0IA 4NXKA 4Q3MA 3R8HA 3RJYA 1JFXA 1XV8A 5H2ZA 1UZ1A 2E67A 4GWEA 4MJ4A 3W1UA 3HBLA 5FA5A 1AH4A 4LNYA 5DF0A 1SUXA 3M5YA 4QE4A 4US5D 3WNKA 2EPLX 4O1DA 1K4HA 1WP6A 3HN3A 3ARWA 4TOQA 2XH4A 4HYVA 4J3UA 3CZJA 4D1JA 1O5XA 1HJUA 1A4LA 2BXYA 4GNVA 2OWXA 3ARXA 4JIHA 2ZVRA 4LBRA 4DBEA 1LORA 3WDQA 4E0CA 2H9AA 1EF2A 4WF7A 3N73A 3RG6A 4HSHA 2Q3OA 3A47A 2VOMA 4AVNA 4Z1DA 4O10A 3IARA 5C6MA 3K4DA 3TIMA 1W9PA 3L5AA 4GKTA 5AECA 3WNOA 3WBAA 2ZC8A 1PDZA 2XFRA 1JF5A 4RKAA 4LAUA 5HNRA 4QS5A 1VCVA 4HA4A 1OX5A 4PRTA 4QQUA 3A9IA 1K8YA 1GORA 5FD0A 1XBVA 4XAFA 2QCDA 1W3JA 4I7VA 4AZHA 4O19A 3NDOA 4LC6A 1I9CB 2XSXA 4S2CA 3M0JA 1PZ2A 3ARZA 2VGGA 5TAOA 2ZRVA 2FVKA 2J25A 3U0HA 4JQ4A 2GZXA 3ZJ7A 5HINA 1XIIA 4MUPA 2I5IA 2FB3A 4GI4A 1XYFA 3FAWA 4ROQA 4X9SA 2W79A 2Q8XA 3VA8A 4HA1A 2NLIA 3LLXA 1UZDA 4D8AA 4TV6A 1HP4A 3LYEA 1B9ZA 4ZOCA 5FJTA 4QLLA 3WD3A 2WC4A 3DFQA 3CH0A 1GJWA 4W87A 4MPKA 4FLQA 4IPLA 2ZTKA 3GX9A 4ZQOA 5DLCA 1REQB 4JBRA 1I2OA 3ARTA 3TOYA 1FQ0A 5HNNA 5EBAA 1OGBA 3IUHA 4XKYA 3CO8A 2DUZA 3W87A 1A5BA 1UP2A 1XIJA 1X39A 3M47A 2HBVA 2AQWA 2D2OA 4XZIA 4NJHA 4AYGA 3ZJ8A 2MNRA 3TLLA 2V38A 3MP3A 2PURA 5A8MA 3RCMA 4YYFA 1XR2A 2OQHA 1H62A 4KS0A 2D3NA 3E0IA 3TQ0A 3FA5A 4FXJA 2HISA 3RRXA 2JF6A 5L6UA 5MHBA 1Q5MA 3SM0A 5LZLA 3N6QA 3ABQA 1A5NC 4RDVA 3V0SA 4LXFA 1KQZA 2BNJA 2X2GA 1UROA 4LV4A 2DP3A 2OEKA 3CZLA 1K7EA 4LRTA 3TXZA 4B5NA 1KM0A 1CXIA 2WCAA 1S5TA 4GC4A 1TPC1 4IPJA 1CECA 2AOSA 3IK4A 2QULA 4U5IA 2X1RA 4CVWA 2CYGA 2F6UA 5E0KA 2A3HA 4FIRA 1SJBA 4RE2A 1XYCA 2C7FA 3NNTA 3NPVA 4AZ5A 5C71A 1Z69A 3ARSA 1C8XA 1TREA 3GZ3A 1ICQA 1QT1A 1OIMA 3WLOA 3C4UA 1QO2A 1WDQA 2QF8A 4GMEA 1VENA 3M0KA 1EL3A 1SZGA 3QHMA 4L1GA 3DCPA 1TWSA 3W7PA 4FPSA 1C90A 2FYMA 1TPFA 3P8IA 5CCZA 1GOXA 2EJAA 4BHYA 5G2WA 3PTMA 1EGMA 3S6DA 5T9BG 2VEPA 3H22A 4Q7IA 3WJSA 4DVOA 4RE0A 4XZHA 3S2CA 5I00A 1G6CA 2J9XA 3G1RA 2XVGA 3U48A 4F66A 2AAAA 2A6NA 4XZBA 2Q02A 4LUIA 4XZLX 3W7CA 5HPCA 3UZJA 5T91A 1WQ5A 3NR0A 3CXOA 3W02A 2YDAA 1ZBKA 4JQ2A 5EPDA 5HMDA 4UFKA 1EWDA 3IAQA 2ABAA 3CAKA 3K4WA 1IV8A 1KFCA 4CQAA 1UR4A 3MW7A 1W0MA 4PRWA 3TP4A 2EEXA 3KOZA 3VMOA 1KBKA 3VZYA 3GR8A 4H6RA 2QUMA 4GA8A 4HU0A 3G3DA 3STPA 4HHPA 3GE7A 1BXCA 1RY8A 3EA3A 4O1EA 3UJ2A 1IIHA 2FFCA 1ODZA 4H7ZA 3WH6A 1FDYA 3RMJA 3S3GA 1NWRA 2NT0A 1FXQA 3ALGA 4YU1A 9RUBA 5IDIA 2BODX 3N2OA 2CCRA 1OZQA 2VQUA 3STCA 3W22A 1F4HA 2ZYFA 4WY0A 4REQB 4GISA 4B5TA 3W28A 3AXHA 1NF0A 3MO7A 1QPNA 4NNBA 5CPOA 3HMCA 4H8UA 5ECVA 3OHIA 1PZ0A 3LY0A 5AOUA 4J27A 3UCCA 1Q66A 4XSMA 2ZOXA 3NQMA 4CQBA 2HPIA 3IV8A 3N2BA 3MI3A 4PCTA 4ML9A 1RJPA 3BW4A 2Y89A 1UWSA 3UJRA 4B5SA 3OZOA 2YZ5A 3ZLFA 1LWJA 1L6GA 2ZICA 1JR1A 1R7OA 3P93A 5AYXA 4XKMA 4AIUA 5K3VA 1E6SM 5EYWA 1FH7A 3T55A 4EXBA 1E40A 4NQ1A 1DQUA 5D9MA 3GNRA 5A6BA 3RX3A 4NI8A 4ZE4A 1B1YA 1B4KA 4FS9A 2GSHA 2P50A 2IPFA 4LB3A 2VM8A 4DO4A 3RIKA 1A5UA 3H53A 2DU2A 1TVNA 4IFRA 2DZUA 1X7IA 4O13A 2DIKA 1DIEA 2UY5A 4NJIA 3V35A 3PZTA 4O4VA 3FIGA 4W7UA 2NQZA 1YXCA 1XSKA 3B8UA 5CZSA 3I6EA 4KKXA 3W2KA 3KE0A 3NL6A 4JTJA 4NAFB 3GS6A 1DPMA 3SUTA 4CQ8A 1JD7A 3P5YA 4F3HA 4QJ5B 3ZOAA 5KZMA 2VC9A 1ELSA 4E6MA 4FNQA 3M0HA 3QC3A 2YL6A 3O05A 4IJRA 5EGRA 2D2GA 1JEZA 2YBTA 4NZ3A 3ZQ9A 3FJ6A 3WLRA 1UWIA 3ARQA 3KCLA 4NL1A 1KFEA 1MEHA 2IQTA 3W0KA 2E9LA 1HJWA 1LUCA 5BU9A 4GCAA 4F40A 2OCZA 2J79A 4H00A 5M2FX 1OD0A 4AD5A 3VYLA 4WQ6A 4G7EB 1EKOA 1XYZA 3B9EA 3RN6A 4IGSA 5MKGA 2DPEA 2A3CA 4A3QA 1DE5A 3APTA 3OIHA 2VEKA 2GFTA 5HJYA 5DRIA 3VOJA 2R9RA 4JTRA 4A21A 3WF4A 2R1PA 3DX5A 1UZ4A 1I4NA 4B9ZA 3PJUA 3T07A 1A0DA 2VRJA 2DH2A 3OZYA 4ICMA 2OJPA 1JUKA 2J7CA 3LGGA 5XIMA 5AVNA 4BCEA 1S2WA 3QTPA 1HTIA 2VX6A 1UR0A 2O9TA 5KETA 1QBAA 1EJ7L 3S2NA 4LALA 3AJXA 1XS2A 1UYQA 3LA4A 4RZBA 1ZAJA 3OOQA 3WK2A 4DX3A 1V3KA 4JTUA 3FXGA 1H7RA 3OB8A 5TQLA 3GK0A 1VKFA 1F7BA 2PWGA 3KHDA 3TZNA 1V79A 3VDCA 4MZYA 1QFEA 2Z1BA 1HJXA 4QCFA 4FB7A 3RU6A 3CMFA 1EJRC 3WYZA 4N7QA 1L6SA 3A12A 9XIAA 3BO9A 2Y61A 1IIGA 3A4AA 1TMQA 2J7GA 2V3GA 1VCGA 3H7RA 1BVZA 4CQCA 2FHBA 2DZAA 3AXMA 1B0IA 1AH0A 3UA3A 5BWAA 3F1QA 5M1TA 4WY0F 4O0QA 4M24A 1MNZA 2HJPA 3ALFA 1XBXA 1H5YA 2PLCA 3WEOA 1XLHA 4PMJA 1CZ1A 3CS2A 3CUXA 1Y65A 1OADA 2RAGA 3CQIA 3T0DA 4JICA 1J0YA 3F5KA 4JFVA 1RQEA 2VRKA 4HVXA 1H3GA 4LYKA 2HXUA 4JTAA 3RCYA 4AY7A 5D37A 2XVLA 3N2XA 3AWNA 2BOFX 4UTWA 4HQVA 2ZC1A 1KC7A 3WEZA 4US6A 3TXVA 1E6XM 2BDQA 1VBJA 4C6MA 4FK9A 5HWJA 1DJWA 2AQVA 1M68A 1E1CB 4WUIA 1YBQA 3UZYA 2V5LA 5G1YA 4BQ2A 1FWFC 1YW1A 3PFRA 3FN9A 2NQHA 4FIQA 4GH1A 3CV2A 1KBLA 5HWNA 3JW7A 3TCEA 4P7RA 1EFZA 3GNXA 3J7HA 2V5BA 2PP3A 1JAKA 1JFHA 4YTRA 4JL2A 2ISFA 1IXPA 4YVVA 4O11A 1LROA 4AWUA 3AMCA 5G1MA 2DQWA 5C2CA 3AHTA 4CD4A 1UR1A 4B92A 5D9PA 4R53A 4OTKA 1ZALA 2DT1A 2NQ5A 3PHAA 4MFEA 1HJQA 1YADA 4Q6JA 2X1UA 2QJGA 1FWGC 3RF9A 4H4IA 3REQB 1TJ0A 5CZJA 2ONEA 3G1AA 3BG5A 3KWSA 3R10A 1M7JA 2A1YA 1UPMB 1LDCA 1OFAA 3WQEA 4FOKA 4J28A 4JIIX 4ECLA 3M0YA 3TW9A 4NAEB 5BNKA 3SGGA 3WNNA 4KEVA 3SECA 2ZA1A 4GIRA 4E4FA 3DC8A 5LNUA 3V3WA 3BMXA 3TKFA 3I10A 3FVMA 3THQA 4ZMGA 5AC4A 5K2ZA 5FF4A 1TQXA 2OXNA 1VR6A 5EL1A 5GJPA 1LLOA 3W1NA 1EO5A 4MNKA 2QCFA 3EB3A 1PDYA 1XIMA 3EWZA 3W4RA 3DFSA 4LS2A 1FH9A 1WUFA 1IZKA 3W82A 1OJXA 3W83A 3ES7A 4LVDA 3K4AA 1DHPA 4LCQA 3LX9A 1A47A 4Z1BA 3LPGA 4NT0A 4NIRA 1Q6FA 1PZ1A 2VGIA 3QY6A 3T2OA 1GG1A 1BSIA 4QNWA 2FTWA 4KERA 4ZQNA 1IT8A 2DZXA 3P14A 4MLRA 4F8XA 3A4WA 2D23A 1NELA 4M7SA 4R3UA 3LI0A 6REQA 3TMQA 3BOXA 2CXGA 3DHFA 4IH3A 4R5EA 3F2CA 2DSUA 1MW0A 4H19A 3B0YA 4GZJA 3KVKA 3E0LA 2QT3A 3MV01 3PNUA 3ITTA 3O8AA 3GTXA 1P0KA 4MJZA 1R85A 5CPLA 3PTKA 3V36A 1YNYA 3UP8A 3Q94A 1FWIC 3DEQA 2AL2A 4AC1X 3LN3A 5AYBA 4MIMA 1Q2RA 3NQGA 3EAUA 1OK6A 4NYYA 1M7XA 7TAAA 1LL6A 3UXAA 3PANA 9XIMA 4Q8NA 3O16A 4JS3A 4ADSA 4KFPA 2RGLA 3VE9A 2D0HA 2OR2A 1W37A 2QYGA 1GVOA 1EEPA 2YDQA 1K4GA 3IUIA 4ZOAA 1FWTA 4GYPA 1TYGA 2VR2A 3EOOA 3GDKA 1FFRA 4YPJA 5BYWA 1B3VA 3QLLA 1R3YA 3V5CA 2ZE3A 3IS4A 4AU0A 1HF6A 3EDEA 4EX4A 2OQYA 3NEVA 3E3HA 3PZIA 1QNOA 3TN3A 2C16A 4PB5A 4ZQRA 3N4EA 2QKFA 4DBSA 3NQCA 1ALDA 2V63A 2X42A 2QCLA 5ENLA 1V8EA 1W6TA 4KWOA 4LCRA 3HQOA 1X1NA 1CB2A 4LH8A 5DMMA 1RCOB 2ACUA 1S3HA 3GVQA 2VWSA 1E55A 2GLKA 4IX2A 1GCYA 1QR7A 1JCXA 2G41A 2VCCA 2BWGA 2VFGA 1CXEA 3NIYA 4REQA 3TTQA 3MP4A 2PWHA 3E0WA 3GXFA 5JH2A 3QW3A 4Q6XA 1UD2A 2P3EA 4NX0A 2XIBA 3HU7A 2WHKA 3ABOA 3TONA 5AZ0A 3BGAA 5A6LA 1KGUA 2C91A 4QQ3A 4ZB5A 1U5JA 3NSXA 3EKGA 4Y7EA 1ZFJA 4HZ8A 4XO6A 4IOTA 3WO8A 1BG9A 5AYIA 3NDYA 4I9AA 1M1BA 2TAAA 3LCGA 3ZXWA 4W93A 3M7SA 5FJRA 2CLIA 3QZAA 4JNMA 3H2FA 3VCNA 3AZTA 3FX4A 1GKRA 4N42A 1Q4NX 3M1ZA 4MTVA 2VFIA 4DZHA 3DU0A 2QPSA 4HMEA 4UC5A 3PZ9A 5CAKA 1GYLA 2QLYA 4GIYA 3IACA 3SCUA 5BW6A 3Q2DA 2BGQA 3RX2A 1X97A 4DPPA 4CN6A 2Z28A 2NSXA 1M5WA 1VP5A 4UQ9A 1NH6A 1WXJA 1IEVA 6A3HA 1T6MA 5FESA 4M3PA 3JRKA 3RM9A 5H1WA 2YFOA 4DELA 3N25A 3AS0A 3UZZA 2VDHA 1O1HA 5GPRA 1WKYA 3QFWA 3TJIA 3TOPA 2G4FA 2Y2WA 3TYDA 3W7OA 1HFBA 3AYSA 3BCFA 5I23A 1GONA 3W38A 2DZPA 4UQEA 3NGJA 4N9BA 3NYDA 3K30A 2QCNA 4KWSA 1OFPA 4BWLA 2YYTA 1A5CA 3A3HA 4F2UA 5A8OA 3R5EA 4MM1A 4MKVA 1EDGA 3M0ZA 2GYIA 2IMRA 3JZEA 3OG2A 1WZKA 3GNOA 4BY3A 1TR1A 3G3MA 1PVNA 1EJUC 3URAA 1WV2A 1EC7A 3GC4A 1XLKA 3QPZA 3WQFA 1XRFA 1A50A 3QXBA 1UKQA 3GDLA 3TTSA 2VT0A 4XKYB 2E9BA 5PTDA 3FCPA 5A6AA 4W89A 1D9EA 4PRRA 4HU3A 3HG4A 3SR7A 3GHRA 2G4JA 1IXNA 1GWJA 4LT9A 5JBDA 2WK2A 5REQB 1X6UA 1ISVA 1G7VA 3N34A 4XIAA 4RDWA 5K7JA 1XLEA 3QKEA 3T2PA 3GDMA 4RK8A 5FKYA 4YXGA 2VZVA 1US3A 2BS9A 2OSYA 3GVVA 1GHSA 2E5DA 3TZFA 4AISA 3BAWA 1E56A 1PB0A 3ITGA 1JZ5A 4PSRA 2HNEA 4GC3A 2YCJA 4UTTA 3UD6A 1GYMA 3GDRA 1MVYA 3F7JA 3WBWA 3UWYA 1H11A 5I6SA 4PTVA 4AD2A 2GJXA 3KRBA 4C6NA 3W1QA 3WQVA 1DQXA 4NRSA 2WO5A 1L2UA 5HMFA 2P0OA 1ME9A 1UZHA 4C6CA 4HBKA 3BZGA 3EWYA 2IKHA 2Y4SA 2O4MA 1G4EA 2X41A 3HB9A 4OV9A 3LCWA 5DCEA 1OZMA 1NWTA 3UZ5A 3OLEA 1RVGA 4GIAA 4WK9A 1A5MC 4OZOA 3ZIZA 4EXAA 4N6FA 2YLLA 3H21A 1Z89A 1KV5A 3RPTA 4IGMA 3VD3A 3TU9A 1FFQA 3AQUA 1HO4A 3B9DA 2AGKA 2GVGA 4ZOEA 3TX9A 3O9NA 3UR2A 3F03K 3OGVA 3WLLA 3V16A 6ENLA 3RNDA 1MW1A 2BTMA 2QUUA 3I6RA 4K37A 3WLTA 4WJEA 3L5MA 5BRPA 3MBDA 1W1VA 1SU5A 3Q37A 1RH9A 3AS2A 1Y8BA 3UWZA 4D6IA 4IG2A 1S38A 3UBPC 1ME7A 3MI6A 2RDTA 3DGBA 4QJ1A 3HG2A 1LRNA 3NEHA 4HK5A 1C9DA 2NX3A 2I9EA 4HB7A 3IIOA 3BAKA 4NX5A 4WLCA 4FI4A 2Q09A 3W7MA 2PFHA 1F2JA 4Q8TA 5HBFA 4S3GA 1P0BA 1M7OA 4Q8WA 2R14A 3ITLA 4M19A 5CBBA 4MSSA 2VC7A 2CLEA 3PAJA 2OLAA 4WY0B 4ACYA 1B9BA 5CPQA 1AJ0A 1W9UA 5GJMA 4H1ZA 1K02A 1SMDA 2REQB 4XD3A 4KFNA 3GNDA 4M7TA 3ISIX 4HOZA 4G1KA 2G96A 2W91A 4BZYA 3CUJA 3WQ4A 1ZY9A 1AUSL 1LTDA 1Y5XA 2REQA 2GVEA 2QXWA 4ZO6A 1QHZA 3FV9A 5GJNA 3WMLA 2G3IA 3NZQA 3TQKA 5A6BD 1Y5VA 2O9OA 1Q6OA 2W62A 3CPRA 1AODA 3KAOA 2WW5A 4L61A 4MB5A 4LYPA 2ZUUA 2BMBA 3KCOA 3BLOA 1UCWA 4RE4A 1NF7A 2C18A 2P8BA 2WC7A 2YFNA 2Y6ZA 2YW4A 4LYQA 4QLJA 3SCOA 3W6LA 1OQFA 2O9RA 3CZEA 1FX6A 4PBGA 3WG6A 5F2MA 4UR9A 1R2RA 3QYQA 4HNTA 1BVWA 4I3GA 3LRKA 2C0AA 2RKXA 2GQ3A 2YXOA 1UD8A 3EXRA 4DNMA 2A6LA 1VB9A 5CG7A 3CHDA 3VI2A 1UUMA 4HNVA 1E0WA 4XV0A 2PP1A 3VUPA 3PWGA 4LEFA 3VIFA 1MDRA 1LP6A 4EACA 5I0DA 1RD6A 3TE9A 1FVPA 4JDYA 4EKJA 2XPKA 5U4NA 4UTJA 1VYRA 3VILA 3FHQA 3GKAA 2NV1A 3VIIA 2VI0A 4OQVA 3C8NA 3TYBA 1F8IA 1PIFA 4QRNA 5LXEA 6CGTA 5IXEA 1FH8A 3NDZA 4KCTA 4ZZ9A 2YA0A 3I4KA 2VRQA 3IEBA 2ZDRA 1HKVA 3OZMA 4ZODA 4LY4A 4YNGA 4S38A 4MY9A 3TAKA 4E4UA 3W74A 1GQJA 1QNPA 1AD1A 1ME8A 2WVVA 5ABGA 4JIQA 1P7TB 3DI1A 4BK9A 2PDKA 2WVVB 1R46A 4E3VA 1JYVA 2A5HA 4X3ZA 3V5FA 3G0SA 4W86A 2OOFA 2I56A 4HA3A 3HV9A 3KVJA 1UH2A 3GTFA 2R1MA 4MB4A 3R25A 1NP0A 1FCVA 2V67A 4NAFA 1NDWA 4WDUA 3DIPA 4FLOA 2E8ZA 4XK2A 3WQGA 4Y9OA 5H8PA 4PULA 3L4VA 3W7NA 1VIWA 3RITA 1T5AA 2XG9A 4HHLA 3ZMRA 1HKIA 3CU2A 4O53A 3I4EA 1EHAA 4QR6A 4IP7A 2X1IA 1ZTVA 2CWNA 1JCTA 3BLFA 3AIRA 1OHLA 3N6HA 1EYEA 3G77A 3AIEA 4GQQA 4DXXA 4HZMA 5AB3A 3IRSA 1LRTA 1H09A 1KA9F 1DJXA 4GCXA 4CQDA 3WH5A 2WHJA 3VIHA 1NVMA 1HN1A 4I8YA 1E1EA 1PBGA 4XBKA 3AS1A 3WH7A 3QRHA 3KLLA 3F4DA 1JDDA 4CNSA 1JVNA 4TUFA 2J77A 1TV5A 4XBSA 3TSDA 1XUZA 3CH9A 3P3BA 3LSCA 1W5OA 5BXRA 1Q8AA 1XYLA 1R6WA 4QAWA 3IGSA 1OM0A 1UD6A 3A22A 3G1YA 4DUVA 2ZZ7A 4PMYA 3UFYA 1NY1A 3V5OA 2DV0A 3BH4A 4YJ5A 2BVYA 4YYCA 1CPUA 4A4AA 3CQJA 4FOJA 3KBNA 1ZJAA 4JN8A 5MF5A 4I5UA 1YX1A 5EMUA 4Y6GA 4JY8A 3QGKC 4R9OA 3O06A 4ZXLA 2QIWA 3CGTA 3W72A 3GUGA 2EKCA 2X30A 3OLIA 4M0XA 1MZHA 1YPXA 2XUCA 3L68A 1AMYA 3WDRA 2ZUNA 4MZ1A 1NOUA 1Q7ZA 3ZSSA 3PBYA 3NZ1A 3SCRA 5D9OA 1R3VA 3ZO9A 4GD0A 8A3HA 1B54A 3SY1A 3LPFA 3UWUA 3EKLA 2V0TA 3EKZA 3W7QA 3VIGA 4B2DA 4RDYA 3G5EA 2VOTA 3PBVA 4DZAA 2WZTA 5HPOA 3LHWA 4IWWA 1WYIA 4RZ5A 3GD6A 3EEGA 2WM1A 3W26A 4UTUA 4XISA 1KCXA 3WLIA 2P3ZA 1K9EA 3GC2A 4JX5A 3OGRA 1J79A 1MEWA 4QCEA 1IZJA 3I68A 1R3QA 1XSIA 3WLJA 3ZSTA 1IQ8A 3W1AA 5DRCA 4DYKA 2QZRA 3GY1A 3R1ZA 1HO1A 4DAIA 4RPQA 2PUZA 3GG1A 3VGFA 4Y90A 2J9YA 4PFHA 5CC6A 3UZXA 4B3ZA 2W92A 3WMSA 1CWYA 3W81A 1WUEA 2RJGA 3W7HA 1XLLA 2UV8G 5DELA 3K8KA 3AYVA 5CEWA 4DWSD 3QVQA 3UESA 1LCOA 1KWGA 1U1HA 4JTLA 3ANUA 1UJPA 2WLZA 4Z2HA 2OT0A 3FJ4A 4YCOA 4DJFD 5I3IA 4XD6A 1N7KA 4DI8A 2OYMA 2W27A 4AXNA 1UD4A 2R82A 3G6MA 1UR9A 4S3BA 3VM5A 2VELA 2UY4A 3QR3A 3ZLGA 3KBMA 1HL9A 3ERPA 2NSOA 1DIKA 1CXLA 4XBJA 2HS6A 5LNVA 2H3BA 1YPFA 2WKLA 1K1DA 4W88A 4G8TA 1VFSA 1SVDA 4BQ3A 3NUKA 3MKVA 3GR7A 2F2KA 3VIOA 4IX0A 3OPSA 5LIWX 3VINA 4DJDA 1TA3A 5HANA 4PCFA 3W24A 1ZLPA 2VFEA 4NF7A 3ONBA 1UR8A 4C6PA 2Z7GA 5I06A 2A79A 1O66A 1UKSA 5FJJA 3R6IA 2KZHA 1G1YA 4GE8A 1JZ7A 4XX6A 4O16A 4AF0A 4P8UA 1PWMA 4JIEA 4KRTA 3R94A 1FWDC 1I2QA 1I1WA 3QJAA 3CYJA 2Z0IA 3WD1A 3LBCA 2VZTA 4GQBA 1LWHA 4DM1A 4WGXA 1ADOA 3GTHA 3E2VA 2QAFA 2RDXA 3S2JA 1KFLA 4W5UA 4U4MA 5E6YA 3TAOA 3E12A 3HA1A 3P0WA 4JFWA 1JCNA 4U31A 4EXQA 3AYTA 1V02A 2DVXA 1ODUA 3GTNA 3QY8A 4NP7A 2J62A 1Q6DA 3ZLHA 5AHNA 1R86A 4GOAA 3A64A 1WX0A 3XINA 3UXDA 1QW9A 3KRUA 1P4CA 3IGUA 3THAA 4Y2WA 2D69A 2ZIDA 4R88A 4HCLA 4KIRA 4NJKA 3TN6A 1S1RA 3MHFA 5JIWA 2YX0A 1QI3A 3WENA 4IL2A 2VZSA 1G94A 3IGXA 3VCRA 2R91A 5E9XA 3PZNA 2GJLA 3TWBA 3T4WA 3TYUA 3GBEA 4WVXA 2Z4GA 3IPWA 3UR8A 3WQCA 2NQ9A 3KRZA 3SJ3A 4QEEA 1FP8A 4ZQCA 4LV9A 1KXQA 4FF5A 1GOOA 1WOBA 2Y7EA 3LDVA 5FEWA 3R79A 2OOGA 2D20A 1VQTA 3HJEA 4HYRA 3KW3A 2F9RA 2WCSA 4EE9A 1TVPA 1WXZA 2PRMA 1H63A 2J7BA 3DG7A 1LL4A 4L1XA 2XGZA 5I2UA 1M01A 3GFYA 2YXXA 2VX7A 2E9MA 2GSJA 3LOTA 3M7WA 3B9NA 5CJ5A 2A3LA 2PGEA 1UWAA 1JAEA 4PCSA 2ZZ4A 4I5RA 3RMEA 4QS6A 3GHUA 3U5YA 3OVGA 1GTEA 3WELA 3GVRA 3L4TA 4PMNA 4QG8A 3L2LA 2WSQA 1NQKA 3GXDA 1VBRA 3AUJA 3T0AA 1TX0A 3U57A 4JKKA 3D5HA 3TTYA 3BUVA 5C7HA 5AC5A 2H6RA 3VKKA 4PMQA 5DBUA 3EYPA 3BOFA 3QSTA 4Z2IA 4XWUA 1O95A 5EMKA 2J9ZA 3TYCA 1WNOA 2PI6A 2XIIA 4QSHA 5HUPA 4KIEA 1G4SA 1C8QA 2PF8A 4NXSA 2ZUVA 3G8RA 4XAZA 4C6BA 2Q8ZA 2L5HA 1PX4A 4MG4A 2J4GA 3L66A 2DT2A 1E4IA 2WVUA 1A5SA 1LBFA 3KDOA 1XGZA 3EB4A 5IM51 4HMDA 1U5VA 4DUXA 1UASA 1JI2A 3FDGA 1VEMA 2PE4A 4NU7A 2A3AA 2F84A 4BEQA 1Q7MA 3BSMA 4W4QA 1W1IE 3OBAA 3BQ5A 1ONWA 3H2NA 3N3TA 4L80A 4GUIA 4W8BA 1H49A 2C19A 1IGWA 2OZ3A 1E0UA 1GHRA 3RR4A 3B9AA 4NUWA 4TVCA 1TE6A 1UW9A 5FIPA 5IHRA 3AIBA 3FS2A 4B5VA 2YGYA 3GHTA 2QMKA 1XCWA 3TA9A 2PLMA 4BI7A 1EBHA 1JPHA 4JEJA 2I16A 5CPTA 5HDRA 3VKCA 3GU1A 3PK7A 2J27A 1U5HA 1IF2A 1OYBA 1WO2A 1E4NA 3B0XA 4PE8A 3LCFA 2DIJA 1VAHA 2CBVA 2E0PA 1TWIA 5HNTA 1EA0A 3BQ6A 4KGLA 5AVHA 3XIMA 1IXQA 1O4UA 1RA0A 1B4EA 3SRHA 5CSUA 1Z48A 3PZUA 3BTNA 1RY0A 2OFJA 5ABHA 2BSLA 3QGVA 4ILSA 1QRQA 2CXEA 3SZ8A 1W17A 3U5UA 5A8NA 3W70A 4KRUA 5I3FA 3TEVA 4LF2A 3N2MA 4XUYA 1P43A 1MEIA 5A8PA 4FLRA 3N18A 2X09A 3SADA 2YCLB 1SJAA 1RSCA 5F1UA 1THFD 1D8CA 1CI1A 2MANA 3GQYA 2POTA 3HJZA 3MO4A 1GK8A 1PL9A 5C70A 4PEEA 3S2LA 4EK7A 3SIMA 3M07A 4AF0B 3WQ5A 4FOUA 2ON3A 1EP1A 2UY2A 3U2EA 5E6ZA 4HMNA 1XRTA 4RV3A 3G8EA 1ZL1A 1I75A 4V2XA 1Y5WA 3AIUA 2V2CA 3OVRA 5E0CA 3BCDA 4NZFA 5C9UA 1W31A 1W54A 4DO5A 4AEEA 2AKZA 2PBOA 2YXGA 5JIPA 2WHMA 4DWSA 2BBFA 5GQBA 3QZ6A 4B15A 1OF8A 1F76A 3MMDA 4XTDA 2NQLA 2HVMA 2D2JA 1FWSA 1TRIA 3HTWA 1ZAIA 4UIOA 1H4PA 2YCKX 4J5NA 1KM6A 3LEPA 1XSJA 4LC8A 5DN1A 2OTDA 3KTCA 5TNVA 1BXBA 3BVJA 3O15A 3HGSA 4DM2A 3LGEA 3M16A 1FHUA 1V3MA 4PMVA 2QUNA 1M9HA 2EXOA 5I02A 3UCDA 1ITQA 5JU6A 2QPXA 4M8UA 4MNLA 1PCKA 4LBSA 5RUBA 1AMKA 1BQCA 3F5JA 4AZ6A 1TWDA 2Z29A 3AJ7A 4MAVA 4GACA 4LUYA 3VOCA 5D04C 3PWIA 3TR2A 2DZWA 1XLFA 1ISYA 1VPXA 1UBSA 5H6HA 3H23A 1XJBA 4LU0A 1W8GA 4B90A 5JBEA 4GY1A 4QE5A 3V18A 2BY0A 2HZGA 3FA3A 2O9PA 3VFLA 2QUTA 2VDIA 4GQGA 4MWAE 1MQPA 1EPVA 3WSUA 2A21A 3E1F1 2V81A 4PC8A 4IICA 2JBMA 5D9NA 1D7FA 2FFIA 3SCWA 2X05A 3ANYA 4AG0A 5LGZA 2ZA2A 5CH9A 1XIDA 4G9PA 3M6DA 3TFXA 3FY1A 4ZFMA 4AD0A 5D32A 5FF7A 3D0CA 4FAMA 3ZFHA 1GG0A 3R58A 3S1WA 5KSWA 4A2RA 4ZXOA 4H8HA 5FJOA 5A5WA 1AA1B 1JPKA 3QMSA 3SN0A 1S3TC 3GB6A 3MMUA 3GW0A 2EAWA 1FDJA 3U6WA 1VFMA 3AALA 3AS3A 3CC1A 4JFUA 1GVYA 1VJZA 5K9XA 4JTGA 1XFBA 2VTFA 4AEFA 1GZ1A 1MW2A 3ARPA 1DTNA 3L9CA 2NW0A 3WUFA 4AZGA 2VENA 3OP2A 1EP2A 2VR5A 5D2XA 3H2OA 4XTIA 2FB2A 1TR9A 3LM7A 1CIUA 3AIWA 4JHOA 3DESA 2E7FA 3P81A 1OVDA 3RCNA 5FCZA 5AN7A 1PV8A 5D03A 4D8ZA 2DVTA 3C0JA 1ESWA 5E93A 1NAL1 3S2MA 2GK1A 2VWTA 4XAGA 4C60A 5HQEA 1CEOA 3PJXA 1I45A 3OGSA 4C6KA 3KBVA 1ZAHA 2NVCA 2WMGA 5D2TA 3WJZA 3NQFA 3MUY1 1XIFA 1KGWA 2OGYA 2PDUA 1TV3A 1U1JA 3WBYA 1NFBA 4IGHA 1TB3A 4G56A 1IEWA 3DUGA 2YLAA 4JTTA 2PBGA 1VEOA 4AY1A 1BVNP 1RPKA 2A0NA 4MHBA 4CN4A 3CV6A 3BGGA 3U2CA 3KM8A 4X9YA 1DWJM 5I3DA 2V3DA 4HD5A 3RU8X 3NFUA 1EIBA 4Z2KA 1KFWA 3APYA 3NO3A 1YDNA 3PZGA 3T0TA 1FBAA 4CCZA 3PULA 1Q45A 1E5JA 1D8WA 4UTFA 3G1HA 2PWUA 3TVAA 4F2BA 4H7VA 3VNJA 4J3TA 4MYXA 2X8RA 4MVAA 3VDAA 2VUNA 3VMPA 2P5NA 3EWUA 1O68A 3CHEA 3G6LA 1TIMA 1NFPA 2WB5A 1LBLA 2AL2B 2CBJA 3W7IA 1Q85A 2Y63A 1B31A 1K9FA 3WX7A 3QC0A 4BS0A 3DDMA 2ALDA 1RJQA 2WSYA 3AO0A 1OCBA 2XWDA 1AZ1A 3TW6A 4B5UA 3N29A 2W9MA 4KESA 1Q2SA 2WJFA 4I8DA 2UY3A 4F0RA 3SUWA 5DY2A 1KGXA 4FXSA 3SGZA 2PDPA 2WWCA 3S1VA 1GEHA 5D4YA 4HCDA 2CHNA 3WQPA 4CU6A 4DF1A 1DWFM 1E0TA 4OHQA 4A22A 3D6NA 1T7LA 1YNPA 3UERA 5HMEA 3IWPA 4RW3A 2VO5A 2JGYA 4XZMX 3IJ7A 2BHYA 1MZRA 4OECA 4OT7A 2CLLA 1NDZA 3FGCA 1L0PA 3P80A 3A6OA 2EQDA 3VX1A 1QPOA 3BAXA 3FHAA 3GFZA 3NURA 5HXMA 4H01A 5EFDA 2HK0A 4RE3A 1ZSXA 3VNIA 1EGVA 1QCWA 1DHKA 3W88A 3SRDA 2PDBA 5JQ9A 4YHEA 3AIQA 4J3VA 3DAQA 1RLCL 3B4UA 2HE8A 2IQ0A 1CCWB 3VABA 3LSBA 1Y7VA 1H60A 4ICNA 5DT5A 4HOWA 4WSKA 3MSYA 3R11A 4LBUA 2ZBTA 1YNQA 1O5QA 3IK2A 3LHTA 4PFMA 3UQNA 4CLMA 5HR7A 4UMAA 1JZ2A 1F73A 1SPQA 4R9XA 5CSRA 3U2OA 1DKWA 4UTMA 1XC6A 4UB9A 3HO8A 1F6KA 2YKKA 3CO4A 1BQGA 2OMAA 4GI9A 4Y9MA 4A2SA 3LPPA 2FDSA 3E2RA 5D2VA 3U4AA 2JQXA 2DSVA 3FK4A 3IVUA 4F0SA 1F61A 5F4WA 2J6VA 1B2YA 4X22A 3BLPX 1YBQB 3ECQA 1Q6EA 3UG4A 1MUMA 3G1VA 1EBGA 1X6NA 3A4JA 3UZWA 4PMZA 1UWQA 4R7OA 4QX4A 5BZAA 3PAOA 1EC9A 3M5VA 5K9CA 2C6QA 4NRRA 5CSYA 1K9TA 3PJWA 3PB0A 2WSRA 3KXQA 3CL8A 1I2RA 1JDAA 1GYNA 2X1SA 4PH6A 1OD8A 2Z2BA 4DEFA 2C14A 3S5SA 3LHYA 1ML1A 4GRSA 3BW2A 1CW2A 3EA1A 2V3FA 4GUGA 3INPA 3O7UA 4OGZA 3TH6A 4S3FA 3N9SA 2VZUA 5I3KA 2YB1A 1V0MA 5AFDA 2ATMA 2XVPA 1VCFA 1UMYA 1RCQA 1LZOA 4HA0A 3WBEA 1XYAA 1AL8A 4UNLA 4DLMA 3TNOA 3STGA 1I8JA 1XDLA 1O94A 3HQNA 1RR2A 2R24A 1E43A 1K70A 1TZZA 3I65A 2XFWA 2OYLA 2PSNA 1QI5A 2E68A 4F79A 4FEZA 1SGJA 2PLJA 1J6OA 1OG6A 1XUUA 1PE1A 2PEVA 4GVFA 4Z17A 2E3ZA 2DUAA 1J6PA 3TSBA 1KB3A 1BWVA 1UOKA 2EG6A 3T44A 4F9DA 1PTAA 4M6VA 1XLGA 1XF0A 1KQYA 4O8RA 3MZNA 5DQPA 2C1GA 3R2GA 3TCSA 4PTDA 1MXGA 2WZEA 3CZKA 1NSJA 3HF3A 4MAZA 3AHYA 4P7NA 1P6WA 2J8TA 4D2JA 3P0XA 3RFAA 2HCVA 2OZTA 1XKJA 4NHVA 4F0LA 1HG3A 1BAGA 5J5DA 3GLCA 1PAMA 1W9VA 1G4PA 1R9XA 3E2QA 1RP9A 1M04A 1F3EA 1VFHA 3UU0A 2QIIA 2PRHA 2DZVA 3FGCB 4WJXA 3URNA 3EWBX 2VX5A 2PWEA 1TVLA 1W2VA 2Y7GA 4LAZA 3EBVA 4K8EA 1W3KA 4J7RA 3TROA 3MTWA 4PMXA 5H8UA 1QHPA 1JUBA 3ZVHA 2YCLA 3PWAA 1R3WA 1R3SA 4O54A 1NP2A 4DBUA 3TYAA 2PDFA 4CD7A 2ACSA 2EG8A 1CBGA 1RBLA 1UG6A 1G5AA 5DMNA 3OBKA 3A4XA 3S8HA 5A6KA 3LCLA 1RA5A 3CT2A 2DORA 3UPMA 3MPGA 3GAKA 1VZWA 2XM2A 3NTYA 3ATZA 2FH8A 1DJZA 5GNXA 1PTGA 1VBHA 2CKSA 4OVXA 4B91A 5ABEA 3PUDA 2VR4A 3L5LA 2NZLA 5DXYA 3IJ6A 4RL3A 2ZKMX 3MCNA 4GYKA 3OZPA 3OQ8A 1TV7A 4ZSUA 4K3ZA 2ADAA 3NA8A 3RJXA 1IZCA 3WIJA 4LGXA 2X7WA 3B4YA 3SSZA 1CX9A 3LV5A 5BROA 4HNLA 1HT6A 3CUFA 4AFYA 1PKMA 4M29A 1SW3A 5FSEC 1AD4A 3VDBA 3O63A 3LM3A 1VLIA 4MY8A 4RXGA 4NVTA 3KDNA 3NQBA 1Q7QA 3LU2A 1QO5A 1R7AA 5BOOA 1LOSA 3WF3A 2ZWYA 3CWHA 5HUOA 3LI1A 4Q22A 4YMZA 4NKCA 1NWUA 1JYWA 1PPIA 1PS9A 4IFKA 2A3EA 5M3WA 1SM9A 3D46A 1XLMA 1XPYA 3POHA 1LLZA 1FWAC 3WK1A 4CCCA 1RUSA 3E49A 3URBA 2GOKA 3S42A 1HX0A 5EA9A 3L4YA 4UZSA 1L6WA 5FSDC 3AMDA 4IQEA 4C7FA 3MKKA 1BWLA 3O3RA 4MF4A 3TN5A 2HPMA 3LENA 4Q8MA 1YDVA 3G2GA 3SSJA 3VAVA 5GNZA 4K1WA 3PPCA 1QDSA 4O17A 4S1FA 1Q8JA 3EDDA 1Q6RA 3PUGA 1L9WA 3GNPA 3W7RA 3MU7A 1JF6A 3HOJA 3WQWA 1QNSA 3SQSA 4ZO7A 3TV8A 4ZBCA 4CVUA 4RNIA 3CQKA 4BEUA 3ELFA 1XW8A 3IJ8A 5LNRA 3D3FA 1QBBA 4KRZA 3KUMA 2OEMA 1HKJA 3I3DA 1H1NA 3B9OA 3FKRA 1TUFA 1SJDA 2X0YA 2PC4A 4MB3A 3W2LA 4NI3A 3GTIA 4Z08A 2PTDA 4IXHA 4AXKA 2BG5A 2QQ6A 3CYVA 1XIBA 1FWRA 5CZ0A 2EHHA 3OHMB 4C6LA 2HVNA 4N4QA 4QBXA 5FOOA 2JF7A 4OUEA 3WQDA 4BI6A 4DJFC 1RQHA 3L4UA 1ZS2A 4PMOA 1QVBA 5LIYX 3KTSA 3KLKA 3R0DA 3QGAC 1FWJC 1KD0A 1S39A 1O7AA 1PHQA 4NZ5A 3MDUA 5BXPA 3LXCA 1UH4A 1EA9C 1ZQ5A 4TMCA 2HV5A 1EO7A 3WY1A 3WFLA 1R2SA 3V0UA 1V3HA 2GK1B 4AMCA 1UIPA 2B7OA 2PS2A 3NPWA 2O92A 3Q65A 1NEYA 4P61A 2PLKA 4UWMA 4EOUA 1Z7AA 3WNLA 4RNJA 1U2YA 1TPDA 1ZP3A 4QM1A 2C8NA 4XAYA 3C2EA 2DGAA 1D2KA 1Q65A 3W73A 4H9MA 1F8MA 1FDZA 1TA3B 4IMCA 3MUCA 1X38A 3LMZA 2OWWA 2WOQA 4C1NB 4MWAB 4ALDA 3P8JA 4WDWA 3CUIA 3UY7A 3STFA 5REQA 5BU6A 1ZBVA 2GWNA 1W1B1 3NQDA 5G4WA 3MUXA 1EX5A 3RYSA 4C6FA 1XQKA 1E3XA 1MQQA 1W56A 4PR4A 4TXEA 4L56A 4FNRA 1JYNA 1CXHA 3PNZA 2F6KA 4PUKA 4HJWA 1QHOA 2QAPA 2FGZA 1J96A 4K7YA 5B80A 1B3ZA 2G50A 3MHUA 4MWAA 4N2YA 2PGWA 5CKSA 2PRLA 1FTXA 4GZ7A 1X6LA 3VNKA 2EG7A 3AZRA 3CIXA 1QTWA 2HE5A 3EX2A 1GGOA 2WXDM 3F2BA 3SIZA 4GXPA 4DI9A 2PZ0A 2NX1A 1TTQA 1J0IA 1DJQA 1XKYA 3QHNA 3WKZA 5ECUA 4PTWA 1SR9A 3AHZA 5CG0A 2WZHA 2I7GA 2DQXA 2GGHA 1CYGA 1E6QM 1JPIA 3CB3A 4F2TA 4AQLA 1CTNA 2YB4A 2IKGA 3W29A 2EPMX 4O1BA 1IWAA 1AJZA 3BDKA 4H2CA 2QF7A 4O14A 8CGTA 2B7PA 3N17A 1A5AA 4E2OA 2CZVA 2D2HA 2ZUWA 1D3CA 1K7FA 3WQOA 1TJRA 4JL1A 2E1WA 2P76A 2POZA 3E38A 2AMXA 5CQ1A 3W7JA 3QEZA 2XIJA 4BF9A 3CEPA 4L9XA 4AIBA 3QHOA 3WD4A 4RUBA 3LLDA 1CGYA 4FO4A 4IPIA 4PUNA 3W2UA 2LLEA 4ATLA 1OX4B 5A6JA 1JCYA 2F7FA 3I7QA 3W7LA 4C91A 1UQYA 3GRIA 1T8QA 4O1FA 1TG7A 2VD8A 4WHBA 3T8QA 4MKSA 1UUQA 5C8BB 4H41A 3FYOA 3COTA 1JZ4A 5I79A 3KOFA 3CWNA 3S5OA 3GIYA 4PB3A 4XZNX 3NCOA 4HTYA 1HVXA 3QY7A 4JQAA 3FFSA 1V6UA 5TF0A 1C7SA 4IMDA 1EQCA 5DY3A 3DI0A 1S5MA 2CLOA 4PB4A 1OIFA 4MLJA 4UTIA 5B7YA 3UYCA 1S2AA 3DFPA 4UZUA 1Q6QA 4UQDA 3K1DA 5C7VA 5JVLA 2ZQ0A 3YPIA 4LYRA 3T7VA 5D38A 4HP5A 1P48A 1YPIA 3A21A 3GNNA 4BWLC 2BX7A 3C56A 1MSSA 1EC8A 4AHPA 1Q4WA 3FDKA 3QQ0A 4BI5A 3HPSA 3NQVA 4C7GA 3WMBA 5EBUA 4CUCA 2ZZ2A 4Q4KA 4UNIA 4QFUA 5BOEA 3WCZA 4H9ZA 1RVKA 4IFKB 3GG7A 3VZXA 1AW2A 4D6GA 2Z25A 3U9IA 3S9ZA 3BC9A 4E8CA 2YA2A 2Y0FA 4GZIA 5CGTA 3PBMA 1SO6A 4HU4A 5U7SA 4J1OA 1NDVA 2XFFA 4RR4A 4IZGA 4DYJA 5LKYA 4GJJA 3DYPA 4F0KA 5CC7A 4JNZA 2PF0A 4GBUA 4PCNA 4RV8A 3JUGA 1M53A 4QJ4B 1R2TA 3HZ3A 3VKDA 3BG9A 3PJTA 2NXIA 4HZ6A 1XCFA 4KMQA 1PX8A 1SJCA 1V6XA 1M3UA 4HIBA 3B0UX 2QVHA 1X1OA 4EAMA 4O50A 2CFFA 1WZLA 1EH9A 2C79A 5HOSA 2VVNA 4AD4A 1X98A 4CU8A 2J8FA 4NYUA 3QTGA 1GEQA 4AZ7A 2Q01A 3CZGA 2YDRA 3E74A 3EOSA 1E71M 4JFSA 2RGMA 2DSWA 2ZZ5A 4CD8A 3CUHA 4K36A 3N14A 3LNMA 4S3EA 3W85A 3PY2A 1FWEC 4HTBA 2QUVA 4K2SA 2OG9A 4D6DA 4QLKA 3VNZA 2BLEA 1IHIA 3GXIA 3L23A 3PG8A 2CZ5A 3LTPA 1HJVA 1XBZA 1K9DA 3C52A 4POCA 3U3HA 3TMLA 4OBSA 1XISA 5I3GA 3T08A 2CHRA 4N6EA 1RZMA 4AIEA 4RNHA 2XU2A 1UKOA 3IJ9A 2CZDA 2I9UA 3AOFA 3WF0A 5DMYA 4X63A 1YQ2A 4J2MA 5D05A 4HHMA 2BXZA 1RK5A 1JDCA 1U33A 4PUEA 2VQTA 3N2TA 5F4XA 4G7FA 1S1PA 4OBRA 3BURA 2PD9A 3SEPA 3V4BA 1OGGA 1GVFA 5FL0A 4DJDC 4E4PA 3S0CA 4HSNA 3U4FA 4TVUA 1ZBCA 4X60A 5E9AA 3UETA 5AHMA 1LL7A 3EWWA 1YKWA 3EDKA 3D47A 5C9WA 4IMEA 1V7AA 3WD0A 2O7QA 3SCTA 1BD0A 1TZ9A 1DJHA 4JTCA 3P5ZA 3VOGA 4O0ZA 5B7ZA 4IT1A 5XINA 3IIZA 3TLQA 1EGZA 5CC5A 2O56A 1J93A 1H41A 3NVTA 3E96A 4DF2A 4IIFA 2VD9A 1HL8A 1XLDA 3LZ5A 1GVRA 1YEYA 4BFAA 3RO8A 2DT0A 3BLLA 1AH3A 4H8VA 3NGFA 1EHNA 4TQTA 3THCA 4Z2LA 4IPPA 5DCBA 1YXDA 4GX8A 1UHVA 2Z6IA 4ZTXA 5CPNA 2YPIA 3DFYA 2WANA 5LA1A 2DY3A 3R4IA 5CSSA 4K1GA 2Z26A 2P1FA 4H83A 1SFSA 2WVSA 1IWBA 3TJXA 3ONCA 3MJYA 2J7DA 4JTSA 4X2PA 1TPB1 1TELA 1OT2A 3WUEA 4GABA 4IPNB 2WYSA 2ZVIA 5FF3A 3WN6A 3QV9A 3WMCA 4YTUA 3RGTA 1V3LA 4U3CA 4ZGYA 3GXPA 1E4LA 1IWPA 4TTUA 2VYOA 1JL8A 2HEJA 1XRSA 4R85A 3PZVA 1M41A 4FX8A 2OLSA 3F2DA 2Z1WA 1CGWA 5KZ6A 1W3HA 3TYEA 4LUJA 1YE4A 3LCXA 5A6SA 3GH5A 4HMCA 1AQHA 1B30A 4A8RA 1UOZA 3O6DA 4QDPA 5JMUA 3L0GA 3TFCA 3CBWA 4AIOA 3H6OA 4CEUC 4DXKA 4LF1A 4ZB0A 3NZRA 2XFYA 2EO7A 3BV7A 3MYOA 1CDGA 2F61A 4WKFA 4C65A 3T8LA 2NWSA 2XH7A 4LQ1A 2J24A 5LHFA 3QMRA 3IRDA 2JALA 2OX1A 3MMTA 4NNCA 2ASHA 1KFBA 3V75A 2Z2AA 4MADA 4MWAC 3DG3A 3TTOA 4XZWA 1OB0A 3U8GA 3C6CA 2QJIA 4ENLA 4L65A 3VUSA 2A7RA 3L0NA 3KOWA 1XH0A 1J9YA 1OX6A 4LVFA 1HGYA 4EP8C 4GBDA 1POJA 4KCUA 1KBBA 1QXLA 4B4HA 3GAYA 3QZEA 2C3ZA 1PKNA 4U5KA 5BRBA 1H51A 3L2IA 1XQLA 5I7GA 3VIKA 3EXSA 5C2XA 1V7YA 3GH7A 6TIMA 3SUSA 1R47A 4S2BA 1T41A 1XINA 3BGJA 1CNVA 4D6EA 4BKNA 5AZ1A 2OVLA 3H2MA 4K39A 4IIHA 1VEPA 1WE5A 1W9XA 2YA1A 5FEXA 3VKAA 5KZEA 4MJMA 3MJMA 5IFTA 4CGTA 3CUGA 1PEZA 3BICA 2CESA 3KFTA 2FPYA 1P6CA 4GLEA 1QOQA 2PD5A 2PCEA 4HN4A 3DZ1A 2W3ZA 3UCQA 3EDFA 3PPFA 3NL3A 4UOZA 3P7YA 1CENA 1R0MA 2YCIX 1QPQA 2QJHA 5C5YA 1LBMA 1GQNA 4JY9A 3M0XA 2J74A 4FR6A 4KW2A 3TSMA 2JE8A 1TPUA 3PG9A 4UFHA 2ZZ6A 1E9IA 2Y8VA 3EMZA 2XSAA 1E1CA 3VO0A 4PL1A 2G3NA 4HHHA 2BOEX 3KRSA 2DZTA 4HPGA 4NJGA 3RLGA 4P5UA 1OGSA 4LY8A 4XD4A 3CTLA 3S5ZA 3K13A 3OQEA 2PZNA 1I2PA 1MXDA 1AG1O 4XB3A 1IEXA 3NL2A 2VCBA 2FVLA 3IANA 3UPBA 3NVDA 1A3HA 3CHVA 3NQ7A 3WK3A 4PL2A 1DWAM 3QPEA 2WNNA 5D30A 5FEZA 3AHVA 5G5IA 3GZAA 4DY1A 5CGQA 2VC6A 4QGCA 3H24A 3TQVA 1O12A 1P0EA 2DJXA 1AQFA 3W1MA 5CPSA 3NOYA 3ICJA 4AAJA 1XFCA 4DN1A 3NJ3A 1WDSA 3PUEA 6XIMA 2XIMA 1W1PA 2Y62A 2ZRZA 2GUYA 2PWFA 3U7BA 1XCXA 4A3RA 3HPZA 3GH4A 4HU8A 1E9YB 4UBPC 1MXSA 3N9RA 3MSDA 4OU1A 5C9XA 3GC5A 1A4MA 1E1FA 1ZBWA 4LAKA 4YLWA 4JCMA 5AHFA 2GPTA 1LJYA 1C8VA 2ZZ3A 3B3DA 4F4RA 4K38A 1E51A 4GNJA 1T96A 2VFDA 1MUWA 1GOKA 2FGLA 3AC0A 1X7FA 3EX3A 1IT7A 1S2UA 4RDZA 4Z1AA 4DJEC 1KM5A 1M7PA 4UQBA 2WBKA 2JGQA 3EX6A 1GKQA 4ACZB 3ZM8A 2SFPA 3NXLA 4IP4A 2QNEA 1UP3A 3MWCA 4TU1A 3USBA 1XDMA 1T8XA 4DPQA 3P67A 5AYZA 3FNDA 1G4TA 1VF8A 5A3HA 3ABRA 1SMAA 3AXIA 3HIJA 3GYCA 1XICA 1L8NA 5AHLA 4GG9A 3AU2A 2C13A 3B0PA 2OB3A 2XH0A 3CMGA 4X2RA 1UR2A 2PWDA 2QGHA 1JRCA 4QSFA 3MUIA 3FEMA 1B3YA 1DP0A 4FF7A 2PTZA 1NM9A 4DXVA 3S9IA 1P1XA 4J2PA 3NWRA 1XX1A 3A23A 3VNDA 1HKKA 4H9UA 2OELA 3FSUA 3U2ZA 3CAWA 4GYPC 4RZ4A 2EPOA 4GJIA 4GXWA 4QAIA 2XM1A 4I5XA 3BCJA 4JYDA 4MWAD 5HAOA 4E8GA 3JVAA 5F2IA 3SY8A 3DKJA 1QWGA 4ZCWA 1XG4A 3VK5A 2WJZA 3UW6A 3B8TA 2GWGA 3KS6A 1ZJBA 1BYCA 1CLXA 4B3KA 1GT8A 4CD5A 4NY2A 5HJXA 3AMKA 1JDFA 3MUAA 2PAJA 5BRQA 1SO4A 4PMRA 4C6DA 4PGLA 3LZ3A 4C6JA 1WOAA 3QPYA 3VIMA 3W7EA 3KWXA 4UCFA 3UF9A 4D6JA 3NL5A 3ZR6A 1G0CA 2WM0A 3LHUA 1DV7A 3QN3A 2IW0A 4AMAA 3H8AA 3PN8A 2ZX6A 1FWBC 3WDPP 4G2DA 3VVGA 5H91A 3CV1A 1OYAA 1LRQA 5EFFA 4BQ5A 4DBDA 2WLYA 4IMFA 5D33A 4RW5A 1TV8A 2CBIA 2J6XA 4LJ3A 1VYPX 2PDWA 4GO8A 2VL4A 3LTSA 1F5ZA 1E6RA 9CGTA 3DFOA 3MA8A 3EA2A 4AW7A 1QPKA 1LQ2A 3ITYA 4CD6A 5HR6A 4BR1A 4S39A 4Q4RA 2J75A 1KRBC 5CC3A 5DBTA 1OFDA 3KVLA 1UIOA 1WCGA 1EB3A 5H8MA 1UJQA 2VURA 4RNFA 4MNMA 1HQTA 1L6FA 3G18A 2G8ZA 1G7UA 4M51A 4MZ8A 2V68A 3F4NA 1QUMA 5CAHA 1JRBA 2CNCA 5JUVA 2E6YA 4V15A 4JKMA 3KCJA 3E02A 2FH6A 4JIRA 4Q8UA 3QOKA 2PU1A 2XN0A 3ID7A 2ACRA 1QMLA 2ISSA 4UNKA 1GQKA 5A8QA 1NOFA 2WZMA 3AMLA 2PDNA 1AL7A 2WPGA 4RPPA 2D3LA 3DC0A 2D22A 4JX6A 3HGOA 1DXFA 1XDJA 4W8AA 2VXNA 2OT1A 1KR0A 1QOPA 5BOFA 1H7XA 5F7UA 2EPNA 2CC0A 5DFAA 3WNPA 1XIEA 3W7GA 1OINA 3O6CA 2DZSA 4DYEA 4EANA 2DUXA 3R12A 4C1NA 3MMWA 1GVQA 4UFJA 4TTGA 3RDKA 4O12A 5KZDA 4AD3A 8XIAA 4ZQMA 1WA3A 4Z1YA 3KBWA 3WEMA 3QBUA 3A5FA 1Z8AA 1H2JA 1PCWA 1YLVA 1D7KA 1TPWA 1JZ6A 3R8GA 1QOXA 4PBEA 5JBFA <