1HO1A

Crystal structure of pyridoxine 5'-phosphate synthase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords PYRIDOXINE 5'-PHOSPHATE SYNTHASE
publication title Structural basis for the function of pyridoxine 5'-phosphate synthase.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ho1A00
3W1NA 5LSMA 3NEVA 3CU2A 4QIUA 2EHHA 4BI7A 3P67A 1SZEA 5AFDA 3S0CA 1UB3A 4CCEA 1VS1A 1I2RA 4M7TA 4NT0A 4Q4KA 3SFKA 2V2HA 3DZ1A 4UTWC 4QNWA 1DJNA 3NXFA 1ME7A 2V81A 3QM3A 3EX2A 3BK0A 4MZ8A 1KBJA 2Y6ZA 4LRTA 1JRCA 2B7PA 4TO8A 1XDMA 4WZHA 3S8HA 2A6NA 3DFQA 4AH7A 2UV8G 1OJXA 4WOZA 1KW1A 3OHIA 1JQXA 3W2UA 3QQ1A 4ZQPA 2RDTA 3HQ1A 5DELA 2EGZA 1SQ7A 3BW4A 3OVRA 4YLWA 5G4EA 4LS1A 4EOUA 2CLHA 4FXSA 3RK8A 2VEIA 4EIVA 1ALDA 3O06A 4NX0A 4O1CA 1TPWA 2TYSA 3WFAA 4O1BA 3U2OA 1BWLA 4MLJA 3DKJA 5DBTA 5HWNA 1N7KA 1A50A 1FWNA 3FKKA 4WY0A 1LROA 1KFBA 1O5XA 3P82A 3BPWA 3N14A 3NQEA 4MY8A 2G5WA 4WXYA 3LRMA 2ALDA 3MP3A 3TXVA 3IIOA 4FX7A 1XUZA 1RQHA 4H3DA 3AO0A 4LV4A 5L6UA 5CG7A 3R12A 3OG3A 2J88A 1RQEA 3O6DA 4N9BA 4UIOA 3GDMA 3G1HA 5F4XA 3S1UA 4O28A 4C1KA 4AXKA 4CCCA 5K9DA 4MY9A 3WK3A 3I7SA 3W2KA 2VXNA 1WYIA 1JCYA 3BG3A 4HNUA 3C8FA 3M5VA 1OX5A 2Y7GA 2ZRYA 3BW3A 4UFKA 2V82A 2QJHA 3N9SA 1FUYA 2J9XA 4HSNA 1SPQA 3R8RA 3GDKA 2I14A 3QSRA 2VELA 3G18A 3CWOX 5H2ZA 1H7WA 1U83A 2FPYA 2C1HA 3G1YA 3TV8A 4R33A 4H4IA 3NL6A 4O14A 3MI6A 3G0UA 1Q6QA 1YXDA 3L5AA 1UCWA 1P1XA 1I4NA 2WNQA 4Z1BA 1TV7A 1N55A 2WJZA 4IMFA 1AL8A 4ALDA 3DKLA 3UPBA 2J9YA 3W70A 1U5JA 3PUOA 4CNNA 1F73A 3A9IA 3EWXA 4W9TA 4GXMA 1F5ZA 3DFSA 4AHOA 2QDGA 1TIMA 2OMAA 4RCXA 4DF2A 1EUAA 3NQDA 1SO3A 2J6XA 2NV2A 3T7VA 1LYXA 4JXCA 1QO5A 1W5PA 3UNDA 3W75A 3W7QA 5KITA 2NXIA 2GPTA 3HO8A 5H91A 1X7FA 1KTBA 3TAKA 2QUVA 4O53A 1YXYA 3UZ5A 2C16A 2JGQA 1XDLA 1GEQA 4O4VA 3QEZA 4NU7A 4RKAA 1W3NA 5F2MA 4AAJA 3VCRA 1GTHA 4OHQA 3TU9A 3TNOA 4IX2A 4IPJA 3W87A 4NNCA 2CLIA 1TRDA 2DZVA 3W7HA 3UQNA 4NQ1A 4I9AA 4NVTA 4FF7A 4MJZA 4NZFA 3HPZA 3UWWA 2XN1A 4RXGA 1JCLA 2QF7A 3LTYA 3THAA 2QCCA 1Q45A 4QISA 1GPWA 1V5XA 2XN2A 3NGJA 2ISSA 2ZBTA 2ZRXA 2ZCGA 3LHZA 4TU1A 5LNWA 2O7SA 1R30A 3SSJA 3FLUA 3TQ0A 4LNYA 3TC7A 3FYPA 2Z2UA 4FHAA 2QUTA 4EVZA 1ME8A 2OCZA 2ZQ0A 3S6DA 1EEPA 1VCGA 2JKPA 3MMTA 2Y61A 3YPIA 2ISWA 4FNQA 5K4XA 2H8ZA 2EPHA 1G4SA 3UD6A 1M7OA 4LW7A 5DBUA 3PBVA 3PY2A 5AB3A 3TAOA 3LRKA 4N4PA 4Y6GA 4MLRA 3KFTA 5EKYA 6ALDA 5DY3A 3ELFA 5AHNA 3SW6A 2AQWA 3HGOA 1X1OA 2B0MA 1SFJA 4JIPA 4QM1A 1H7XA 1IGSA 3GKAA 4ZMGA 3PVFA 5U4NA 5FESA 3O6CA 3Q2DA 5BNKA 1OVDA 4HIBA 3IRDA 1ZALA 3GIYA 1TYGA 3W1XA 3W1RA 3EWWA 2CW6A 2RH9A 4UTKA 3NPWA 5EL1A 4O8RA 2HS6A 4GUFA 1OF8A 4O13A 3NPVA 4O16A 1Y0EA 1VYRA 2CU0A 3OVPA 3E49A 4OT7A 1VYSX 3FJLA 4S2CA 1K03A 3SY5A 3TK7A 4ADTA 5CPMA 1LRNA 3M5ZA 3BG9A 3ZFHA 3M9YA 3NQ6A 1L6SA 4M6QA 3W22A 5BMXA 3LERA 3C2EA 4UMCA 5K3VA 4JD4A 1KM3A 5BW6A 2NUYA 4N9CA 3IGXA 3ZR4A 3CC1A 2BLEA 1AW1A 3IIXA 3G3DA 2QCMA 3G0XA 3MP5A 3CWNA 3NL2A 1ZNNA 1GVQA 2BWGA 3UPWA 1LOQA 1HO1A 1I2PA 2YGYA 2OT0A 1EPXA 1MEWA 5C6MA 3W72A 4IMGA 4YL2A 4RV8A 1TPEA 3RF9A 3T55A 3W7JA 1ZENA 1EP1A 2GJNA 3H53A 3W88A 3CQ0A 4GE8A 3M1ZA 4WX2A 3L9CA 3QPZA 3N3MA 1TMHA 4RZ4A 3E02A 3KVLA 4MYAA 3QW4B 4XUGA 2W6RA 3CT7A 2BTMA 2J27A 4LRSA 1JJKA 1OFAA 1O94A 1TPFA 1H62A 4O12A 1E51A 3LXAA 4A29A 1EP3A 4O52A 4UNLA 5FEZA 3L0NA 5LZLA 4DPPA 1W5OA 1XXXA 3I68A 4BR1A 4NX5A 5F2GA 5CSRA 1LTDA 4PA8A 4NJHA 2QR6A 4JR5A 1G4PA 3PF3A 2CZEA 4HN4A 2C14A 2PRMA 4C1LA 2GVJA 1OYAA 1OF6A 1FWRA 2DZPA 2DZUA 3KRUA 3Q94A 2NXHA 4Z1AA 5AHLA 1K8YA 3FKRA 1I8JA 2B7OA 3W7EA 3G8RA 1XBVA 4M5PA 1TTIA 4RZ5A 3VNDA 4ADSA 3UY7A 1F05A 1SSDA 2LLEA 1PV8A 4R7JA 4JTSA 1P0KA 1LZOA 2DZSA 2V30A 5AHEA 4K38A 3IGUA 5BRBA 1BKSA 3LCIA 1VC4A 3QQ0A 3CEPA 3W3OA 3WJSA 5FEWA 2TRSA 4QITA 1CX9A 2J9ZA 3S1VA 1Q6RA 3E9AA 1V7YA 3LHYA 3GR8A 5AYYA 1TPDA 1SW7A 3HGRA 3INPA 4MVAA 4RR4A 1MO0A 3HPSA 3SGUA 3DFOA 3P84A 1S5TA 4IPIA 4UCGA 1OFQA 1RVGA 1XUUA 1QPNA 2CLOA 3PM6A 5HMSA 3PG8A 2Y70A 3LV6A 3W7DA 4U4MA 1SZNA 3G22A 3E0IA 4ZL1A 4TIMA 3G3MA 3VI2A 4FX6M 2E68A 2C13A 3CIWA 5I3GA 3P80A 4JTKA 4BWLC 1B4KA 4ZVJA 2F7FA 5K7JA 3DFPA 3JRKA 1G6CA 3LRLA 4PFMA 3HPXA 2V8ZA 3LB0A 4FNTA 5K4ZA 3W7NA 1FCVA 4UFJA 1LBLA 4A2RA 3E12A 3EWZA 2C0AA 3KRZA 3MJYA 1O4UA 1TREA 2PCQA 4DEFA 1G4TA 1R2SA 4JTIA 4FIRA 2JGYA 5DCEA 4OV9A 5J5DA 3TSMA 2VFEA 4TMCA 2ATSA 1QDSA 3FA5A 5CKSA 2GQ9A 2A85A 1AL7A 1HO4A 2G95A 4LY8A 1OHLA 2WKJA 3PB2A 4JX6A 3CTLA 4O57A 1C9DA 3A21A 5DXXA 5AYZA 1QR7A 4ICNA 4K37A 4MKNA 1EWDA 2TSYA 5HR6A 1T99A 1B3OA 4BF9A 3I7RA 1CI1A 1K7FA 3KRSA 1HTIA 4NJJA 1GYNA 3FOKA 4Y96A 5LNRA 3MYPA 3PBWA 2X2GA 4IMCA 1GG0A 1VLIA 2YCEA 5F4WA 1DHPA 2HTMA 1GQNA 3KVJA 5G2WA 4XBSA 3NR0A 2A7PA 1K02A 1ONRA 2X1SA 3S5NA 1LCOA 2V5LA 4X2RA 2DZWA 5AC7A 3TQKA 3LBMA 5F1UA 1X8FA 3NAVA 1JUKA 2VFIA 4XBKA 3N2MA 5I3HA 1JCXA 1AW2A 4IX0A 2VFGA 2Y89A 3W1PA 2YDAA 3NOEA 4JTTA 1LP6A 2NZLA 1UBSA 2ZZ6A 3N73A 2QJGA 3WJWA 4KKXA 4D2JA 1L6YA 1W8SA 5G2IA 3BLEA 2X30A 5AN7A 4GNJA 4GUGA 3TFXA 3L0GA 4GBUA 5KSWA 2DJLA 1H60A 1GWJA 3SZ8A 3MW7A 2Q3OA 3EX6A 4O15A 1XKYA 4FIQA 4UR8A 3HMJG 4AWTA 3P5ZA 1T0OA 2ZDRA 1JVNA 3W7OA 1VRDA 3LM7A 2NX9A 1RZMA 3PS7A 4OV4A 5LGZA 4AWUA 3GR7A 2C3ZA 3NQFA 2I1OA 3O15A 3C6CA 1JUEA 3S5ZA 5HQEA 1A5BA 2Z1BA 7TIMA 4UTUA 2NUWA 1F74A 3ABRA 2DJXA 3PBUA 4LC8A 2A1YA 1TSIA 2CWNA 2ZZ5A 2P0OA 2YX0A 1C8VA 1ADOA 4I7UA 3I65A 1QFEA 3NPUA 4HPXA 1PL9A 3W7LA 1QO2A 1FCUA 3EKLA 1B9BA 4LWWA 1B4EA 1I2NA 3OIXA 1WX0A 4L4MA 4OE7A 1SR9A 3LHVA 3V1PA 1YDNA 1SZGA 4PH6A 1ZHAA 4OWGA 4B5NA 3IIZA 1KLYA 1BTMA 5D2XA 4GUIA 4CQ9A 3K30A 1LORA 3EX4A 4NXSA 1PVNA 5I3IA 3G1VA 4WQ6A 5CZ0A 4IQLA 5A5WA 4UTTA 1DBTA 3G24A 2EAWA 3NVTA 4FNPA 1BEUA 3TMLA 3EKZA 3UWYA 1FQ0A 4UTHA 4ML9A 2WNNA 4FEZA 1EB3A 3STGA 3UWZA 3W83A 3RNDA 1HFBA 1G69A 4MIMA 1J4EA 5D02A 4JTHA 3B06A 3NQCA 1IXPA 3P81A 4UNKA 2QAFA 1TJPA 5AHIA 4I7VA 4JTJA 1SO6A 1ML1A 4JYFA 3P62A 3SECA 3IV3A 3PBYA 5D05A 3LBCA 3PUDA 1OABA 3O6YX 4A21A 3RLUA 2BXVA 4PEKA 1WQ5A 1OX6A 5EA9A 1T8XA 4LU0A 1FY6A 3W1MA 3WK2A 4JGDA 1GJPA 3UXAA 3P8IA 3SJ3A 1D3HA 5HJLA 2YYUA 4DO4A 4E2DA 1KFJA 3FYOA 1QMLA 1YTKA 3EXRA 1DQWA 1TV5A 4BWLA 3TSDA 5HUOA 4G1KA 2WV8A 1OK6A 4XTIA 3AJXA 3NQMA 4K7VA 3IVTA 1JULA 3NDOA 4RX0A 5FEPA 3T78A 1J2WA 3NNTA 3DU0A 1G4EA 5ABTA 2FB3A 2ZRZA 2ZZ3A 1LBFA 4O17A 2YFNA 2CLFA 1A5SA 4QQ3A 4WOQA 3W1AA 4KFOA 1F76A 1SW0A 3GXPA 4Q33A 3IIVA 1W5MA 2WSQA 4UFHA 1YPFA 3W6YA 3L2IA 4CCDA 1W1ZA 3TMQA 2C18A 3I7QA 1VCFA 2WSRA 4UTJA 4MZ1A 3BG5A 2E5CA 4NJKA 2ZRUA 3B03A 4ZZ9A 2V2DA 3RLVA 2X1UA 3TJLA 2R14A 2PC4A 4MZYA 4HSOA 1KM5A 5E93A 3LLFA 3O07A 2VC6A 3GVGA 4LT9A 4X9SA 4M6VA 5DN1A 1BWKA 1QPOA 1IXQA 5TQLA 4J9JA 1L6WA 4A2SA 1UUMA 2YZRA 1NAL1 4A22A 3P8JA 3GXTA 1S5VA 3L67A 3QPYA 2FTPA 2OJPA 4K8EA 4Z1DA 2A7RA 5DCBA 1PHWA 5D33A 3ABOA 3KXQA 1OFOA 5KZEA 2XFWA 2QEZA 2HS8A 3CLMA 4CNOA 3CIXA 4WUIA 1CW2A 4Z1CA 3B04A 3THQA 4FNSA 2F84A 1HG3A 1D9EA 4JYEA 3JR2A 3IVSA 3MI2A 1A5CA 4JTUA 4UFIA 1O5KA 2RDUA 2O7QA 2V2CA 3DGRA 4POCA 3DHDA 4DF0A 1O60A 4AVFA 2E6DA 1H50A 4AEOA 5F2IA 1SSGA 3R2GA 1LRQA 2FLIA 5FF7A 3W84A 5GVJA 4BK9A 4FNUA 4KFNA 1WAUA 2PURA 2KZHA 4NNBA 1TB3A 3LCWA 5F4SA 5LHFA 3F1QA 4QJ1A 4UTWA 4N4QA 3UZJA 3GNNA 4WJEA 3Q37A 4IUOA 3GNDA 3LCLA 1W5QA 5TIMA 5IBXC 1JRBA 3QMSA 1ICQA 3OBKA 3W2NA 2QKFA 2YFOA 3LCXA 1RQBA 3P61A 3S5YA 5KTLA 4GRSA 1RR2A 4Y8FA 1EA0A 1DVJA 2V9DA 1I45A 2Z6IA 3A5VA 3W9ZA 1VJIA 2GVGA 1KM1A 2VFDA 1PIIA 3PUEA 3W1TA 4BFAA 4K7YA 1NSJA 5DY2A 2QUUA 5TBOA 2B7NA 1YTEA 2BX7A 2QDHA 3S5OA 3S1XA 3A24A 4RXFA 3R5EA 3MI3A 4HNTA 2TMDA 3L0KA 1R46A 1YPIA 1VCVA 3D0CA 3NQ7A 1W37A 3TC6A 3L5MA 1IIGA 3W23A 4E0CA 3WJYA 4N6FA 3G1DA 4M19A 5KZDA 2CLEA 3NQGA 4IJBA 1L2UA 1TQJA 3UWVA 3CB8A 4ORMA 3QZEA 2DORA 3C0JA 3MHFA 6TIMA 4JTGA 5EBUA 4NJGA 2X1TA 3E96A 5CPOA 3W7RA 5D2VA 3HGSA 1RPXA 1M5WA 2W0UA 2VKZG 3N34A 2P1FA 5D38A 3KX6A 1GZGA 4LVGA 3V75A 3LHUA 2PRLA 1AG1O 8TIMA 5LHEA 1W3TA 5FEXA 4AF0B 4JX5A 1JCJA 3FFSA 2VEPA 5T26A 3PB0A 4JYDA 1X6UA 5AC6A 1O95A 1VHCA 2R91A 2PE4A 4R34A 4NJIA 4MUZA 2OT1A 4JICA 1L9WA 1FWTA 1LOLA 2H90A 3LHTA 5AHFA 4NNAA 1FXPA 2B4GA 3W2JA 4M6PA 4AWSA 4JDBA 2FIQA 3A22A 3QMTA 1DOSA 3L21A 3W1UA 4UFMA 3P5YA 2VEMA 3R13A 4XTDA 5HNRA 4CNPA 2EKCA 4S2BA 1IF2A 1GVRA 3L5LA 2Y63A 5SWUA 5EMUA 5HR7A 4TMBA 2ZRWA 4JTEA 2Q8ZA 3IGSA 4O0KA 1FWSA 1DJQA 3NO5A 2W79A 3C52A 1JR1A 1VR6A 3PWAA 3C4UA 1JCNA 1H5YA 5BMWA 1QWGA 1TTPA 3GAYA 2NWRA 4N6EA 1ZAHA 1VPXA 3F4WA 4FO4A 4LVAA 3W85A 5E1QA 1GG1A 2GQ8A 2GQAA 4N02A 5LNSA 3KVMA 4DELA 1A53A 3TW7A 2H3BA 3P60A 1ZAJA 4LVFA 1XCFA 3W7PA 2YYTA 3L68A 5K9CA 1HL2A 4GFSA 4LS2A 1DQXA 3C2OA 2QCEA 1KFEA 3NQ8A 3T4CA 2Z6JA 3TSBA 3QRHA 4EF8A 5J5RA 5G1TA 3LX9A 2E77A 3C61A 1T96A 4R53A 1M7PA 3SR7A 2CFFA 2NX3A 3WK0A 1QAPA 3M47A 3WJZA 1AMKA 4JTFA 1G7VA 4YCPA 2YW3A 1K8XA 1QPQA 2A21A 4DPQA 1NFBA 2RDWA 4P61A 2VENA 3GKFA 3DI0A 3STCA 3L66A 3GDRA 4PL1A 3MHUA 4JN6A 1SZFA 2ZZ1A 2ZTJA 3BW2A 4O18A 1G67A 2ABBA 3UYCA 1FDZA 4QSHA 4KFPA 3VKJA 3UWUA 1YDVA 1KA9F 5I3FA 3TFCA 3LHWA 3LXCA 1TPUA 1TCDA 1UJPA 4GJ1A 5DLCA 1XL9A 1FXQA 4N9DA 1KM4A 2WSYA 1GOXA 3C56A 3LI0A 5AC8A 2CZDA 2A2IA 1UASA 2B7QA 5CGQA 1KTCA 4N2YA 4IXXA 1LDCA 3IVUA 5FF0A 3MBDA 4JTLA 3IIPA 4AB4A 1EIXA 5AYXA 3M0ZA 5G2HA 3TA6A 2ZFAA 2G96A 4DO5A 4HHPA 1GVOA 3DI1A 2X1RA 4Z08A 4WY0F 2A7NA 2E5BA 1H7RA 3HOJA 3ZWSA 5IBXA 3GXNA 3QW3A 2V0TA 4AHPA 2QAPA 1H7PA 4OBTA 3W7MA 2AGKA 3NPXA 1X1ZA 1KV8A 1NF0A 3PSWA 2JKAA 1OYCA 3BV4A 1KLZA 3BO9A 2YSWA 1I2OA 3PG9A 3LCHA 3W7IA 3MHGA 3EX1A 3MBFA 5I3JA 3DFTA 3S1WA 5HWMA 4MFDA 2ZA2A 3NZ1A 3P74A 5G1YA 1Q6OA 3CHVA 3TXZA 4ZQOA 3DFNA 3M41A 4JY8A 3NZRA 5CPLA 1H1YA 1W0MA 5FF4A 4UMAA 3SI9A 2XN0A 3TIMA 4MYXA 3TROA 3LTPA 3DBPA 4RJEA 1YDOA 4OQVA 1H63A 3WK1A 1XBXA 4ORIA 4RZ6A 3OEXA 1TJRA 5CPNA 4IWWA 3R89A 5KINA 3UWQA 2AAMA 1VLWA 3FEMA 3G1FA 3BGGA 3G1SA 2I9EA 4BI6A 2JK2A 2GVLA 3GDTA 1YLVA 2R8WA 1GYLA 4WY0B 1YYAA 4EF9A 3W7GA 3TKFA 5HINA 2WOQA 2ZZ4A 3EX3A 3W71A 4O19A 3NL3A 3HG4A 3C3NA 1LOSA 3BLIA 5D04C 3ZWTA 4TR9A 2WNZA 1QCWA 4UTIA 3TQVA 4ONVA 3W86A 1P5BA 1W5NA 4MOZA 4YCOA 1Q3NA 5CZJA 3USBA 1OYBA 1H1ZA 2C6QA 3OVQA 1EWEA 1EP2A 2WPBA 3LI1A 1SFLA 3H54A 1R47A 3TDFA 1GVFA 3M6YA 3GZ3A 3HJZA 4LC6A 4X3ZA 3A23A 4MY1A 4PCFA 1XFBA 4YXGA 4JY9A 3STEA 5FF3A 4DQWA 1K7XA 3M16A 1PCWA 1PHQA 2VFFA 2E09A 3TUUA 2ISVA 1P4CA 4Y9AA 4LS0A 4QAIA 3O1NA 2ZA1A 1WDWA 3SIZA 4JEQA 2NXGA 1KM2A 3C2FA 3HBLA 1OFDA 2FFCA 4UFLA 3M43A 3QFEA 5U7SA 1OX4B 4M7SA 4XZ9A 2E6FA 2Y7EA 5D2TA 1F6KA 3PR2A 1FCBA 2FDSA 2CZ5A 3NG3A 1SUXA 3W2LA 4ZQCA 1WOAA 2RHGA 2ZZ7A 2Q8LA 3W2MA 1SU5A 1OFRA 1F7BA 3DAQA 4HKPA 2A0NA 1NF7A 3ATZA 4EWND 2E1DA 2QCHA 3VE9A 3NQAA 3GX9A 3N9RA 5HWJA 3GB6A 1VGAA 1LLZA 3EWBX 1MEIA 2V5BA 5FI8A 2CZFA 2DP3A 3MWAA 3L65A 1PE1A 1IXOA 2RKXA 1NVMA 1MEHA 2E6YA 2Y7FA 2IQTA 1TPC1 3HIJA 1TRIA 5C2XA 5FF2A 4I7WA 3LCFA 1P0NA 2J24A 4JS3A 4GUJA 1F6PA 5LGXA 3Q58A 5MHBA 3HG3A 3EXTA 4JIQA 1B57A 3VFLA 2Y88A 2OX1A 1Q6LA 3W74A 1OX4A 3ANYA 3GDLA 3S9YA 1ZAIA 1H7OA 3RMJA 3LDVA 5D2WA 3SGZA 3TJXA 1Z41A 5C5YA 1QOPA 4PC8A 1FBAA 1FX6A 2GOUA 1NEYA 1OFBA 1TTQA 3LTSA 3UY8A 4K39A 5EY5A 3GK0A 3U6WA 1S3HA 1KM0A 2BZNA 4MJMA 2FQIA 3KVKA 3CEUA 3QF0A 3ATYA 1H51A 3BGJA 2YXGA 2VFHA 4WXZA 5D30A 5IM51 4IMDA 2ZTKA 4RK8A 5F2LA 4DBDA 1UUOA 1J5TA 3TX9A 5CZTA 4RLIA 1GTEA 4N9EA 1I2QA 3O16A 2NUXA 4Y90A 1WOBA 5D37A 1N8FA 2JBMA 1RV8A 4LUIA 3HGJA 5LNUA 4UUIA 2CLLA 4HNNA 4O50A 2E6AA 3PC0A 3FJ6A 1LLWA 5LNVA 3T44A 1OG0A 1MZHA 1W31A 5K9XA 5HULA 4NUWA 1C29A 1S5WA 1WV2A 2DZXA 4NXKA 1LRTA 4AMAA 3G8EA 3GYEA 2X16A 4JDYA 4XKYB 3U8GA 1VHNA 4WD0A 4Z0SA 1ME9A 3MYOA 1LBMA 3LV5A 4LUJA 1XM3A 3BLFA 4ZQNA 1Z48A 1XC4A 3T40A 3QH2A 1ZY9A 3NYZA 3BVJA 1MXSA 3O8AA 1XBZA 2A5HA 2D73A 3N19B 1PS9A 1WXJA 3M5XA 2QCNA 2Y85A 2H8XA 4LVBA 3G1AA 3HB9A 1K7EA 4HNVA 3M44A 3NL5A 1KBIA 3LXBA 4BI5A 3NQVA 4UC5A 3G1XA 5G4WA 5AOUA 4OGZA 1JCMP 3PSVA 3CM4A 2Y62A 1QNVA 1WBHA 1H7NA 3TW6A 2TPSA 4X22A 3W76A 4DF1A 1R2RA 1AW5A 1HUVA 4GUHA 3STFA 4IXHA 3FIGA 3H55A 3I6RA 4CQAA 5LKYA 1ICSA 5DXYA 2NX1A 1QPRA 2ATMA 5HUPA 2FPVA 4XKYA 4IMEA 3TR2A 4K8HA 2YW4A 4FNRA 4LVDA 1K8ZA 5CZSA 4E2BA 4O0ZA 3W7CA 3EXSA 1AK5A 4ZQRA 4JNMA 3DENA 1W3IA 3KOFA 1FCQA 2DU2A 1KFLA 2GJLA 1WBJA 1GVSA 4NZJA 1WA3A 5BOOA 1GT8A 2RFGA 5AHMA 1TQXA 2H6RA 3DXIA 4FXRA 3PAJA 3W07A 4LTSA 4O11A 5D03A 3QC3A 4UXDA 3QJAA 3B0UX 3EEGA 1EX5A 1KFCA 1Z42A 1F2JA 5D09A 3UXDA 2A4AA 4HT3A 3C2RA 1JUBA 1VYPX 1EUNA 3NA8A 2QJIA 2EF9A 5CSSA 2YR1A 4PL2A 2R94A 1TTJA 1YTDA 3P7YA 2CLMA 3C2VA 3B0VC 4P2VA 4YMZA 3RFAA 3S42A 3CPRA 1ZJIA 3F03K 5C54A 3OA3A 1KFKA 1XI3A 4H6KA 3NQ2A 2C19A 3DH7A 2C15A 3HG2A 4O1DA 2ZA3A 4LV9A 1W56A 3TH6A 3W1QA 4E38A 3NM1A 1XBYA 4UTTC 1IIHA 2ABAA 2FB2A 3WJXA 3TCEA 4AF0A 4U28A 3A5FA 4KWVA 4AHQA 1FDJA 2P10A 3KHJA 5A8GA 3LLDA 4Z0JA 3TE9A 3GAKA 1LM1A 4K36A 1YXCA 2OZ0A 2QCFA 2YPIA 4KWWA 4JX4A 3RU6A 2QCDB 2NWSA 4CLMA 3VE7A 3KAOA 1SO5A 1KTNA 3B4UA 4L4LA 3EB2A 2G97A 1OK4A 5D32A 1QOQA 3M7WA 4ADUA 2QCLA 3IEBA 2NV1A 1DV7A 2Q3RA 2QCGA 3G0SA 4TX9A 2JKEA 4OU1A 1G7UA 2VEKA 2Y7DA 1IXNA 2HSAA 1SO4A 3MUXA 4Q32A 4FB7A 2NLIA 4S1FA 4HPJA 3LGEA 2ZZ2A 2WO5A 4UTMA 3QSTA 4O10A 2Z0IA 1MSSA 3NM3A 3QMRA 3EWYA 1Z44A 3B0PA 3LOTA 5KMYA 1DKWA 5DCDA 4XWUA 1VH7A 4K6AA 1KM6A 4GWEA 3W7KA 3MO7A 3EWUA 5D2YA 4ZQMA 4GC4A 1YADA 3JS3A 2GUUA 3PULA 1KV5A 1VZWA 2DZTA 2QCDA 3ABSA 2HMCA 2CLKA 3BARA 2FJKA 1THFD 1H61A 4O4WA 1FDYA 3M5YA 1ZCOA 1TPB1 5L9FA 3W73A 4O54A 5KZMA 3DHFA 2H3DA 4DO6A 1DORA 1ICPA 2BSLA 5C55A 4PTNA 1RD5A 4LOCA 5E0KA 1TPH1 1K3UA 4UR7A 2E5DA 3LCGA 1FWWA 5G5IA 4DXVA 4A3UA 1VQTA 2ZYFA 1D3GA 3N2XA 1R2TA 4IGHA 4MFEA 3ZS4A 4PODA 1W54A 2ZRVA 1OFPA 1ZFJA 2A6LA 1SW3A 2VOMA 2WQPA 1TPVA 1M6JA 4UTLA 3B05A 5EYWA 1JQVA 1A5AA 3O63A 3B8DA 4XQ6A 3ABQA 3FS2A 3HG5A 4UMBA 3QYQA 3HF3A 5K2ZA 3GLCA 5EPDA 5I3KA 3MP4A 1DL3A 1TO3A 2PRHA 4YWIA 4MPQA 1OFEA 5F1VA 4QNEA 2FPTA 4CQ8A 3F4NA 4IOTA 4O1AA 4DBEA 3W1LA 3O05A 4FX8A 1TV8A 1PCKA
chains in the Genus database with same CATH superfamily
5LSMA 2EG7A 3WBWA 1V51A 3P67A 1SZEA 3S0CA 2PS2A 3UBPC 1VS1A 3UPMA 2D2JA 4M7TA 4LYPA 1NQKA 3SDOA 1C8YA 1J12A 3SFKA 2V2HA 3DZ1A 1DJNA 3NXFA 3AXMA 1GKRA 4H1ZA 1O1HA 4YTSA 4TO8A 3WQ5A 2FH6A 1VJZA 4XSMA 3S8HA 4RL3A 5CG0A 1O66A 2UV8G 5BOFA 4WOZA 4E2OA 5CAHA 3CV1A 5TAOA 1QW9A 4LEQA 4AY1A 1GKQA 3HQ1A 2EGZA 1SQ7A 1ONXA 4GYJA 4FF5A 5G4EA 4FXSA 1ALDA 2J62A 4NX0A 1TPWA 3CYVA 2TYSA 4O1BA 3H2CA 3WUBA 1BWLA 3NXLA 3FHQA 4RW3A 3GH4A 1GHRA 4MADA 1KKRA 1N7KA 1TCMA 3FKKA 3QHMA 3P82A 1I1WA 3N29A 3SCWA 3TXVA 1F3TA 3UU0A 4H3DA 5CG7A 5L6UA 2J88A 1RQEA 4AU0A 2XH2A 2CC0A 4C1KA 2XFRA 3NOYA 3EB3A 4W7VA 3F2BA 4MY9A 3WK3A 3I7SA 2VXNA 2I5GA 1CLKA 1JCYA 4HNUA 2AL1A 2Y7GA 3I4KA 3QY7A 3FGCB 2V82A 5ECVA 2WVTA 2J9XA 3QGAC 2W61A 3G18A 2HZGA 1I1XA 1UC4A 1UZDA 1H7WA 1U83A 2C1HA 4IJCA 3TV8A 5EMMA 1GVEA 4R33A 3RU8X 3WLKX 1YXDA 1UCWA 3L12A 1IR1A 3WYZA 1C9WA 3I10A 1TV7A 3H4XA 1N55A 1OT1A 4UZUA 4W85A 3UPBA 3GXFA 4C6CA 3ZJ8A 4ML4A 1S46A 3W70A 3PUOA 4PB3A 3GVVA 1WDQA 4CNNA 3A9IA 4CVWA 3EWXA 3VD9A 2QDGA 3WQ8A 3ZLGA 4MWAE 4TVDA 1YDYA 1SO3A 4IIFA 3CAWA 1FHVA 1LYXA 2P3ZA 1CXIA 2VI0A 4MDPA 4YTUA 1SM9A 1R86A 1X7FA 4JQAA 2QUVA 4O53A 1TWDA 1YXYA 3UZ5A 3GBEA 4MNMA 1GEQA 4DM1A 4NU7A 3KOWA 1B90A 1W3NA 4CN4A 4AAJA 1UMLA 5CEWA 3GIPA 1SJCA 1E9IA 2PA6A 2F9RA 1JDDA 4H6EA 1HKVA 3TNOA 4IX2A 5IOBA 1B2YA 3NVDA 4GZ7A 3GU9A 4NQ1A 2HEJA 4C91A 2QYGA 1MQRA 4AY8A 4AZBA 3P2VA 1Q45A 4QISA 2XN2A 2ZRXA 3WLSA 4F0RA 4S3JA 5DMMA 3IUIA 5LNWA 2MANA 2I7GA 2V3EA 4WDXA 3FYPA 4EVZA 3PBGA 2A3BA 1SFTA 2JKPA 2BHUA 3VINA 2Y61A 4US6A 2XU2A 1MQQA 3EZ4A 1J18A 4LW7A 1QI2A 3VIJA 3OW1A 1BKHA 3GC4A 2CZVA 3AS3A 1ZUAX 5EKYA 2AQWA 4OECA 2Z7GA 2C71A 4H6RA 3HGOA 1PZ0A 1SFJA 3AISA 5M03A 3QHOA 4AMCA 1RVKA 3EPMA 3ITYA 3O6CA 2BV9A 1OVDA 3IRDA 1AZ2A 4D6FA 3GIYA 1TYGA 3LPGA 5T9BG 3W1RA 1BLIA 1HKKA 2CW6A 2VNCA 1UWSA 4LUSA 3HA1A 5A1AA 3QGVA 2HS6A 2Z2BA 1VYRA 3HQNA 2CU0A 3PZ9A 1NDYA 2VZUA 3E49A 3TONA 1VYSX 4S38A 1K03A 4ZB0A 5CPMA 4C6BA 2UWFA 3M9YA 4AD2A 7REQB 1S2AA 2NQZA 1MWOA 1S39A 4UMCA 5K3VA 1KM3A 3UJFA 2FFIA 2J8FA 1QU4A 5DEZA 3VIKA 1ZBCA 1EF2A 3ZR4A 4DZHA 1M68A 4Z42C 4X9YA 3W02A 3G3DA 3UEQA 3GU2A 1TMQA 2BWGA 2W91A 2JEQA 1AJ0A 4BQ3A 1EPXA 5KETA 3W72A 4IMGA 3MCNA 4YL2A 3PK7A 5C2GA 5MKGB 2QMKA 1OEPA 1EP1A 2GJNA 3ISIX 3W88A 4B5UA 5C0QA 4K1WA 3N15A 4GPNA 3CQ0A 5DMYA 4F0LA 4GE8A 3M1ZA 3VM7A 1RHCA 3L9CA 1WXZA 3H7UA 4RZ4A 3KVLA 3QW4B 1XLMA 2W6RA 2I17A 1OFAA 3WN6A 4BKNA 2PD5A 4PMDA 4TQTA 5A8PA 3S47A 3VZZA 3LUTA 4O12A 1M7JA 1E51A 1CBGA 4UNLA 1TX0A 1X96A 4H8VA 4JIIX 1EX1A 4S23A 1SYTA 1LTDA 4PA8A 1AQMA 1NU5A 2O92A 5H8UA 4PMOA 1KNWA 4NJHA 2QR6A 2ZE3A 2ODOA 3HFYA 3E1F1 4PBFA 2VURA 1IEQA 4HN4A 2PRMA 4IP4A 1OF6A 3IAPA 1IGWA 3KRUA 4Z1AA 1HJVA 2VVNA 3K8MA 5AHLA 2C79A 3W7EA 3G8RA 4RZ5A 4ADSA 3VNDA 1EDGA 4R7JA 1V3MA 4K38A 3GTFA 1EHAA 3PPCA 3PHAA 1QW7A 2J9ZA 1Q6RA 2ZADA 1YBQA 3LHYA 4CQDA 3CO4A 5AYYA 1ITCA 2W9MA 1CGWA 1CB7B 4MVAA 3IWPA 4QJ4B 4AZCB 1KGUA 1MO0A 2O55A 4IPIA 4UCGA 1OFQA 3P14A 1XUUA 1QPNA 1XPGA 3PM6A 5HMSA 2Y70A 4QHRA 2BP1A 2EBNA 4MNLA 4ZL1A 2VWTA 2VX6A 4FX6M 1EZWA 3S6OA 2WKGA 1ZS2A 1EJUC 1LUCA 1AFSA 4PUMA 2Q01A 5K7JA 3H23A 4PUWA 1JZ7A 3JRKA 2B31A 2UY4A 1QASA 5K4ZA 2PU0A 3LNPA 4A2RA 3EWZA 3KRZA 2F38A 2YJQA 4JTIA 2JGYA 4NAFB 4OV9A 5J5DA 2Z29A 1BXNA 2POTA 1E5JA 2ATSA 1QDSA 4JN7A 4GMEA 5I78A 5I06A 2GQ9A 2A85A 1JF6A 1HO4A 4FR6A 2WKJA 2YZ5A 3JVAA 4B9YA 4J40A 5DXXA 1KKOA 4GCAA 1QR7A 4ICNA 3B9NA 1B3OA 2XIBA 1CI1A 3L4ZA 4D71A 1POKA 1JAEA 1GYNA 3QHNA 3SCRA 3PBWA 3GRIA 4IMCA 1NJJA 4R3UA 3ES7A 2YCEA 5G2WA 1H49A 2A7PA 1XLKA 4TX6A 1RH9A 3ICJA 1ONRA 2X1SA 2V5LA 4R5EA 4U3CA 3LBMA 3NAVA 1JUKA 2HK1A 5I3HA 1AW2A 1W8GA 3W1PA 4JTTA 5I09A 2R1NA 1UBSA 2ZZ6A 1XYZA 3B4YA 3CIVA 4D2JA 2ZWYA 2X30A 3CUXA 1XIFA 3MC5A 3CHDA 2VUNA 1TA3B 3BXWA 4HCDA 4B5XA 4DWSC 1IV8A 1GWJA 3AQUA 1A5NC 2QMJA 3MW7A 4XAGA 2Q3OA 4H8HA 4O15A 1XKYA 3GSMA 3HMJG 5H8PA 3VMPA 4WJXA 1YNQA 1JVNA 3MUY1 3S3GA 3UG5A 2OXNA 2ZX9A 3ENLA 1S2WA 3NQFA 3WO8A 3C6CA 3II1A 1HJQA 3S5ZA 3O6AA 7TIMA 1DEDA 2Z28A 4LBRA 4A6GA 4ZB2A 1ZZMA 3TYDA 2PTXA 3HPFA 2A1YA 1TSIA 4QJ5B 2CWNA 2YCLA 1C8VA 3CQJA 4I7UA 4F3HA 2HXUA 4ROQA 1G94A 1YQ2A 1DQUA 1QO2A 2J7EA 1B9BA 4F9DA 4GIRA 3OIXA 2WVVB 2ZXQA 3OO2A 4L4MA 1SR9A 4DJFD 1SZGA 1BTMA 2XH7A 5D2XA 4GUIA 1HIZA 3ANUA 4FOKA 3EX4A 4NXSA 4DHGA 3BAJA 4WQ6A 5CZ0A 2W27A 2XM1A 2CHOA 3EDEA 5A5WA 3WBAA 3NVTA 4ILSA 4UTHA 4ML9A 2WNNA 3STGA 3UWZA 4MIMA 1KCKA 5D02A 4AIEA 2Q8XA 3PTDA 5AC5A 1IXPA 1GONA 2C1GA 4HZ6A 2QAFA 4JYFA 1ML1A 2D69A 4OVXA 1XLJA 4BQ4A 4QG9A 1OABA 3RLUA 4B15A 3QC0A 1MXGA 1XSIA 1ITQA 1OD8A 1D3HA 1UKTA 4JFUA 4PN2A 2WMHA 1JNEA 1NOWA 1Q7ZA 3RPTA 3BICA 3WF3A 5DO8A 1KFJA 3FYOA 1QMLA 1YTKA 3EXRA 3AJ7A 1MUMA 3T6CA 5HUOA 4UWMA 2GWGA 2C0HA 3AJXA 1P6WA 1JULA 1OM0A 5IRPA 4HA1A 3NDOA 3SM0A 1EJTC 5FEPA 2GJPA 1J2WA 2DSKA 2J47A 4ES4A 1OC6A 1EHNA 2ZZ3A 5BXSA 3CTTA 3RR4A 1EL3A 3BJSA 4XSLA 4XUYA 5EMKA 4Q33A 3IIVA 1V3IA 3UT0A 1XRTA 3L2IA 4QDWA 4CCDA 3TMQA 4MZ1A 5CBBA 3ALFA 3IJ9A 3M6DA 3M0VA 1MW0A 3KWSA 4DWSB 3RLVA 2R14A 2PC4A 1UR2A 5D4YA 3O07A 4TVCA 3VO0A 3ARZA 3GYCA 3GVGA 4LT9A 4WLCA 3VDCA 1DE6A 4CGTA 2WMKA 4A2SA 1P1MA 2YZRA 1NAL1 4GD0A 4KCTA 3RG6A 4K8EA 4Z1DA 1K9EA 3ABOA 2PDGA 4P7RA 4H8NA 3F7JA 4E4PA 4MTVA 2EKGA 4Z1CA 3LU2A 4FNSA 1QVBA 1XLAA 1FWBC 4JYEA 1O1ZA 2B81A 3IV8A 3IVSA 1ZQ5A 4POCA 4X0VA 2OQYA 1KBKA 3U5YA 4JQ3A 4OIFA 1HJUA 1K4GA 2PURA 3LCWA 2OEJA 4HB7A 3GNNA 3B97A 4AUBA 1JRBA 3VD5A 1XH2A 5ABGA 2EG8A 2ACSA 1X6LA 2REQA 3NUKA 1HP4A 3MUIA 5EMJA 5J8LA 3OZPA 1VKFA 4C7DA 4I90A 3R94A 4H9TA 3GWQA 5DY2A 2XIIA 4JTCA 3VOFA 1AH4A 3QYSA 3MI3A 1IEWA 3R0UA 4HNTA 1R46A 1YPIA 5A6AA 1VCVA 3UJ2A 4FOJA 1W37A 4GO9A 1Q2SA 1IIGA 5CSYA 3W23A 4AD3A 2HBVA 5GPRA 2FMNA 4N6FA 3G1DA 4M19A 2VYOA 3P6LA 4R9OA 1HX0A 3U3HA 3CB8A 1ZCCA 2DT3A 3MHFA 6PTDA 4GIAA 1UHVA 3E96A 3BE7A 5M1TA 5D2VA 4FSAA 3N34A 2P1FA 4LVGA 5HJXA 5FEXA 1XYMA 4JX5A 1NDWA 4HN8A 1JCJA 4ZFMA 2V67A 3PB0A 4JYDA 1X6UA 3AMGA 4MUPA 1OGBA 1FKWA 4UQ9A 2B4GA 3TOPA 4JDBA 2WWCA 1UKQA 3TJ4A 3QMTA 3W1UA 3L21A 4H83A 1Z9AA 2OR2A 5HNRA 4H7ZA 4CNPA 2EKCA 3URQA 2V69A 3WY1A 3ZT7A 1XLLA 2ASHA 4CCZA 6XIAA 4JTEA 4UB9A 3CT2A 5MKGA 4K1GA 1JR1A 4KRUA 4PZVA 2OOFA 3N2BA 1TTPA 3GAYA 1ZAHA 4LVAA 3KHDA 2PLKA 3W85A 1GG1A 2GQAA 2Q71A 3TN3A 4N02A 4JKMA 5JU6A 3ZVHB 3TW7A 3P60A 4HD5A 2DFAA 2HK0A 4UBPC 3ZR5A 3L68A 5A8QA 3POHA 1HL2A 4GFSA 4LS2A 4ZSUA 3ABXA 4BCEA 1KFEA 1WDSA 3NO1A 3T4CA 1FWHC 3QRHA 4R85A 1KBLA 1U33A 1V77A 5G1TA 3LX9A 4R53A 1T96A 2PWHA 1M7PA 2CFFA 1VP5A 3WK0A 3KL3A 1PX4A 2YCIX 4HCHA 1B3XA 3WJZA 3CGTA 4UQAA 1G01A 3VOHA 2O56A 3AFBA 4IISA 3GKFA 1C91A 4RE2A 1O68A 5FD0A 2QGHA 2QLYA 3DHPA 1SJAA 4O18A 3EMQA 1JPMA 1XFCA 3QGKC 3UYCA 4I6KA 3UWUA 1YDVA 1DWGM 1E9YB 3GC5A 3KE0A 3QV6A 1V3HA 4YU1A 1A4MA 1R3VA 5A6TC 3A3WA 4KERA 1JPKA 1RY8A 5DLCA 2WJDA 4M56A 1GOXA 3C56A 3LI0A 9XIMA 4DBWA 1L0PA 2O9OA 5CGQA 1KTCA 3V7PA 1LDCA 4AX6A 1ITXA 3U7BA 2QPSA 1TKKA 3CHEA 3M0ZA 1HVXA 5FL0A 4HPHA 3A3HA 2X1RA 4WSKA 4WY0F 2MUCA 4PMVA 3AHTA 1TE1A 5IBXA 3GXNA 3QW3A 1OCNA 1QNOA 2V0TA 2CLPA 1XHGA 1OWQA 3TTEA 1A5MC 3AIUA 1KLZA 2PTYA 4H9VA 1I2OA 1MFUA 1VRXA 2GFTA 3S1WA 4GZEA 4NAFA 3CHVA 4ZQOA 4PYSA 3DFNA 3NZRA 2DW6A 1UZ4A 4UMAA 1PTDA 5A6BD 5D9PA 1YIXA 3H7VA 2FZNA 1XYLA 3LTPA 4RJEA 1YDOA 3OYZA 2BOEX 2ZX6A 1XBXA 1VF8A 3N2TA 4OFCA 4IWWA 2RGMA 1JCTA 1R3TA 5FJRA 3UWQA 3BGGA 4G9PA 2P53A 2I9EA 3RHGA 5FIPA 4WY0B 3TKFA 3WQDA 2PLMA 1RJRA 3KLLA 3DYPA 1UR0A 1A5OC 1L2QA 1MW2A 3CUHA 3HURA 3ARYA 4XZNX 3C0SA 1A80A 2BDQA 4L56A 4UTIA 3TQVA 1XW8A 3VKCA 1W5NA 4IIBA 4XV0A 5ENLA 1HL8A 4JFTA 2QNEA 1TZ7A 5CZJA 1OYBA 4ROPA 1GVIA 1EWEA 2X1IA 4KGJA 4XVDA 3LI1A 3H54A 5LIUX 3BAWA 3M6YA 1BYCA 2HXTA 4IGNA 4JIEA 1Q63A 4LC6A 4X3ZA 1DJIA 4Q3MA 5FAJA 4GQGA 2FHBA 4GQRA 1Q5MA 1YMYA 4LGXA 1Z6KA 3STEA 1TE6A 1K7XA 4NF7A 1PCWA 1S1RA 3B40A 1P4CA 4LS0A 2NSOA 1M65A 1W1PA 3R0KA 3QR0A 2DSUA 1OC7A 1KM2A 3HBLA 3AHVA 5HANA 6XIMA 1OX4B 4M7SA 4QCEA 4ACZB 1B3YA 2E6FA 1FOBA 1FCBA 3B9DA 2D24A 1XICA 3FSUA 3W2LA 4Z2GA 2WVVA 4HKPA 2A0NA 1NF7A 3QXBA 3ATZA 4G56A 1VIZA 1DJZA 4GVHA 4HTBA 1FH9A 1LLZA 3EWBX 1XIBA 2HBXA 3CZGA 1AD4A 1R9XA 1E73M 3UGVA 3SUUA 4EPBC 1CGYA 1L6GA 4Q4MA 3BAXA 5EGRA 2E6YA 1WO2A 1XP3A 2OGJA 5FF2A 2PI6A 4I7WA 2AL2B 2J24A 3KTXA 1F6PA 3GC2A 1R8LA 3EXTA 5AYBA 4A3RA 3B0YA 5HQMA 3JUGA 2NQJA 4D6EA 3EPOA 1ZAIA 3CQKA 2ZUNA 1EZ2A 4I5UA 2DT1A 3TJXA 5C5YA 4M0XA 4TUFA 1FX6A 2GOUA 1NEYA 3GTNA 3N18A 3R11A 3RCMA 3LTSA 3E3HA 5ABFB 3PWGA 2EXOA 1RA5A 3S9ZA 3BDKA 3T2PA 3U6WA 1TR9A 5M2FX 3V36A 3ATYA 1ZGDA 4HPGA 4IZGA 1J2BA 4IMDA 4M51A 4DBDA 4WKHA 4RDZA 3TX9A 3F2DA 4C1NA 3B8IA 3FX4A 3WQFA 1E6SM 3O16A 5BWAA 5D37A 4QRNA 5LNUA 2CLLA 3TC3A 2GWNA 1QATA 1LLWA 3WMSA 1OG0A 3WLHA 2DVTA 4NUWA 4NXKA 4AMAA 3AU2A 3G8EA 1B0IA 2PDUA 2I5IA 3PZIA 1CXLA 4DBSA 3SUWA 1LWHA 2IKJA 4WD0A 4AZ5A 1Q8AA 3MYOA 4LUJA 1XM3A 4ZQNA 1TWSA 4KRTA 3QV7A 3UCDA 1E4LA 3KDNA 1XC4A 3QH2A 3NYZA 4B4HA 1IZCA 3N19B 2JALA 1FH8A 1WXJA 1DJHA 3GVQA 1X6NA 3AU6A 3FHAA 1NARA 3G1AA 1K7EA 4W8AA 3NL5A 4BI5A 3ARRA 3TA9A 3G1XA 3V0SA 4LX4A 3DN5A 4MWAC 4ASTA 3PSVA 4V27A 3IPWA 1E6RA 2OZTA 2Y62A 5CJ5A 3TW6A 2TPSA 3NEHA 4X22A 3WUFA 3SAZA 3TR9A 1R2RA 2CITA 4WVXA 1HUVA 4GUHA 2AGTA 2OOGA 2FGBA 1GYMA 1EO7A 1JDFA 5HMEA 2YL5A 1WZLA 2DIKA 2UBPC 2YBVA 3W26A 2ZUTA 1GK8A 4QE1A 3RM8A 1AK5A 3MT1A 3T2QA 1W3IA 4M24A 1FCQA 2DU2A 1KFLA 1BYBA 3WDRA 4HJWA 5BOOA 2RFGA 2XVPA 1MNSA 3FNDA 4DLFA 5AHMA 2V63A 3T05A 3V35A 1DYSA 3BAYA 4CN1A 1KC7A 1B3ZA 4TVUA 4EAMA 3UXDA 2A4AA 1J0YA 1XH1A 3C2RA 3BLLA 3F5JA 1JUBA 4HOXA 1JDCA 2FMOA 2QJIA 2VGFA 3URNA 5CSSA 4RDYA 5IHSA 1EC7A 3ZT6A 2VDHA 2CLMA 4UOQA 4PCPA 1ZJIA 2HCVA 4B2DA 4DBUA 1W1IE 3GHSA 4E8CA 5C9WA 3G5EA 2E9MA 4O1DA 1O6IA 3DG7A 1W56A 3SSZA 1SR0A 1REQA 4UTTC 2FB2A 4GJJA 2VGGA 3A5FA 5BZAA 3OPSA 2P10A 3KHJA 5A8GA 1NOUA 1KWGA 5CC7A 4K36A 4KWWA 3H2FA 4YIWA 4LB3A 3D3AA 4JX4A 3RU6A 4CLMA 1SO5A 1KTNA 1V02E 4LYRA 1Q8JA 3U48A 1CENA 2G97A 5D32A 1QOQA 1E0UA 1V79A 1A4LA 2QVHA 4FLOA 3BLOA 3M7WA 2ACQA 3CWHA 5E9XA 4WKAA 5LIYX 2QCGA 1DXIA 4TX9A 4HGXA 1OCJA 5BRPA 4IJRA 5I77A 3LG3A 3MUCA 3CMJA 1RK6A 4YN5A 2ZZ2A 1AD1A 4XD3A 4MWAB 4HP5A 1Q6DA 3WDQA 4M29A 1GGOA 4DN1A 3QMRA 1B54A 1XS2A 3EWYA 5KMYA 4LANA 4MPKA 4Y9PA 4GWEA 3W7KA 1JYXA 3EWUA 2GUUA 1IWBA 3PULA 1KV5A 4KEUA 2DSZA 4D9PA 2PSNA 2DZTA 1HVQA 2HMCA 1FFRA 3BARA 1THFD 2DH3A 5HDRA 1N8WA 1R85A 4DZAA 3W73A 4O54A 3RN6A 5A6LA 1DORA 2BSLA 5C55A 4LAOA 4PTNA 1RD5A 3BCDA 1K3UA 4XX6A 4W5ZA 1R0MA 2ZYFA 3DESA 4IGHA 4M1BA 1GW1A 1W54A 3OQEA 2WQPA 1RBOB 2VOMA 1TPVA 2XWEA 4L6HA 1M6JA 2WZIA 2ZVIA 4UTLA 1XH0A 2FZBA 4GXWA 1VBJA 3B8DA 3PNUA 2ZX5A 2WLZA 4UMBA 3HG5A 2FVKA 3KOXA 2QZRA 3VMOA 3HF3A 1UH3A 3GXDA 3SRFA 7XIMA 1DL3A 1TO3A 4MPQA 3WCZA 1PKLA 3SCVA 1V4YA 4O1AA 4C6OA 3W1NA 4Q4RA 1PBGA 1FWFC 4QIUA 2EHHA 5C9UA 2BY3A 4CCEA 1EJXC 1Q7MA 3BAIA 1EBGA 2OEKA 3ZZ1A 1A5LC 2PF0A 4FOUA 3R58A 1K8CA 1ODZA 5C7HA 3SQSA 1ITUA 5EMLA 4UTWC 4IQDA 3D5HA 3IJIA 4X63A 3QV8A 4AG0A 2V81A 3CS2A 4JNZA 3EX2A 1CLVA 4MZ8A 1ADDA 2XWDA 2Y6ZA 3V4BA 4LRTA 1JRCA 3QZAA 1FRBA 3D6NA 2A6NA 4G6CA 1CNVA 3W01A 3COTA 1E43A 3OHIA 4GC3A 4H19A 3QQ1A 3XINA 2UZ9A 5DELA 5MF5A 4JFWA 1C3FA 3TCSA 4LS1A 3KUMA 4EOUA 4B16A 3RK8A 2VEIA 4EIVA 3NYDA 3WFAA 1WKFA 5C71A 3DKJA 1RALA 1A50A 3CV7A 4WY0A 1LROA 1KFBA 1UWUA 2D0FA 2X40A 3NQEA 4MY8A 2G5WA 5XIAA 4WSJA 5JXQA 1V3LA 4LV4A 1R9ZA 1S2CA 1CZ1A 4QTGA 4O1FA 3RUBL 3GIQA 1T40A 4CCCA 4CNTA 1H3GA 3SUTA 5ABHA 4IG2B 3BG3A 3M5VA 2MNRA 4F2UA 1R5YA 2ZRYA 3PP7A 4AIOA 3ANVA 3TTYA 2WB5A 3N9SA 1FUYA 2WXDM 1SPQA 2GZXA 2OFJA 3M0YA 3O2LA 3CWOX 5H2ZA 3VNIA 2FPYA 3H26A 1VD6A 3NL6A 3W4RA 1Y5VA 2PDCA 1K1DA 1UMYA 3DKLA 3T42A 2NVAA 1XIGA 4IQEA 3HZ3A 3ARPA 3O3RA 4KCVA 1F73A 3R1ZA 4W9TA 2WSKA 1F5ZA 1QI0A 5LIKX 2A3AA 3CZKA 3UGRA 5DRIA 2OMAA 3EOOA 1EUAA 3NQDA 4WF7A 4CQCA 2NV2A 4ECLA 4W89A 1UQYA 1QO5A 5KITA 1PDZA 3A4JA 3T4WA 1EGMA 3APYA 3SN1A 1UYQA 5ECUA 4XAFA 4ACYA 4PUUA 1KXVA 3CUGA 4V1YA 2C16A 3QEZA 3CQHA 4RKAA 4GVIA 1GTHA 2E9BA 4LBUA 3IACA 1EH9A 4IPJA 3R4IA 3ARUA 4IPLA 3W87A 3V5FA 3V0UA 2CBUA 1TRDA 3UQNA 4D6HA 3HPZA 3UWWA 7TAAA 3VD4A 4RXGA 2QF7A 2G3MA 1JIBA 3H2MA 1V5XA 1OGGA 4MNJA 3LA4A 1W6TA 4DY1A 2GSJA 2O7SA 1R30A 4MM1A 3SBFA 5ABEA 1UKSA 3FLUA 3TQ0A 4LNYA 3TC7A 1OG6A 2Z2UA 4FHAA 3VTRA 5M3WA 1ME8A 2OCZA 2ZQ0A 3KL5A 4E4FA 2OYLA 2VGIA 1F3XA 2ISWA 5K4XA 4OOUA 1M7OA 3THUA 4JHMA 1WZKA 4AC1X 5DBUA 2XVKA 1BF6A 3LRKA 6ALDA 1YPXA 2Y2WA 4KBXA 1LL4A 2XZ9A 1X1OA 4L80A 4JIPA 3ME3A 2X2YA 1UC5A 2OLHA 2EG6A 2V6AA 2V5CA 5JIPA 4ZMGA 3PVFA 2X7WA 3OZOA 5U4NA 4IP5A 3WMLA 1RBLA 7ODCA 3R8GA 2ZUWA 1VFFA 3H4WA 4HIBA 1E0TA 5D8ZA 4A4AA 1ZALA 3AIWA 3WBYA 1U1JA 2ZIDA 1KRAC 1KQYA 3B9EA 1NP2A 3NCOA 3RJXA 3MWCA 1W17A 3E0WA 4W93A 3OVPA 1LJYA 4OT7A 3AWNA 1Y7VA 3AOFA 3TK7A 4NRRA 3M5ZA 3BG9A 4W87A 5JBDA 1Q6EA 4EPDC 1L6SA 4M6QA 4BEUA 4JD4A 3AYTA 1UR4A 3VNJA 4HYWA 2NUYA 4MF4A 4N9CA 3IGXA 1LG1A 4S3CA 2XIJA 3W81A 3T0TA 2HPMA 2Z1WA 2BLEA 1AW1A 1ZNNA 1X7IA 3WFLA 4L65A 3CH0A 1LOQA 3CHFA 3DYOA 2YB4A 2YGYA 4GXPA 5C6MA 1X38A 3N2CA 1TPEA 5CBJA 5I24A 3T55A 3QV9A 3W7JA 1JG9A 1ZENA 3KBWA 3LS9A 3MCOA 4S3KA 4XKMA 1EC9A 2AQOA 3VNLA 5I3DA 4IIEA 1EOKA 4E2VA 1Q6GA 3QPZA 3N3MA 1TMHA 3E02A 2PP3A 3AIBA 2BTMA 2J27A 4HJFA 4Y9MA 4DAIA 3H4GA 1TPFA 4B5SA 1H62A 3CJPA 5EBAA 3LXAA 3IJ6A 4JPGA 1EP3A 2VDIA 4O52A 2DQXA 4WEVX 5FEZA 5LZLA 5A6JA 4DPPA 3N2OA 1Y5XA 5CSRA 1GQJA 3N11A 1TZ9A 4JR5A 1SFSA 1EJRC 1VEPA 1BRLA 2PDNA 2C14A 4C1LA 3LNMA 2G3JA 2GOKA 4J3TA 1ZL1A 2NXHA 3OLDA 3FKRA 1I8JA 1TTIA 4PRWA 4QLKA 3UY7A 1F05A 3VNMA 3ZM8A 1FWIC 1LZOA 1R3YA 3IGUA 4P8UA 3LCIA 1VC4A 3UW6A 2WW5A 4UR9A 1KRMA 3WJSA 2VR4A 2TRSA 1CX9A 5GNYA 1RA0A 2JIWA 1V7YA 3WF2A 4W7WA 3GR8A 4WRHA 1SW7A 3HGRA 3DUGA 4GVFA 4IH3A 3SCSA 4C60A 5A2CA 4G7EA 2GJRA 1FWJC 3SGUA 1OIFA 1S5TA 1U1HA 4A3YA 1RVGA 4BQ5A 3U57A 3PG8A 2F6KA 3W7DA 1P7TB 2ZE0A 3E0IA 4CQBA 1OZMA 2E68A 2Y5SA 2C13A 2OWXA 5FJUA 4BWLC 4ZVJA 4FLQA 3DFPA 5CXPA 4LAMA 3HPXA 3K5XA 5HK4A 4A05A 3E12A 2W4XA 1H1NA 3MJYA 1UPMB 2R1KA 4J7RA 5GJMA 4F2TA 3TSMA 3W27A 7A3HA 2NQLA 3M0KA 4JAWA 3VOIA 3D3FA 3UERA 4TMCA 3FA5A 5CKSA 1A49A 1AL7A 4FALA 4LY8A 1OHLA 3CTLA 4O0QA 5AYZA 3EA1A 3E2RA 1EWDA 4DYKA 3MUAA 2E40A 1R3WA 3QKEA 3KRSA 4NJJA 1WCGA 1OCBA 4C6LA 4Y96A 4X0NA 1ZJHA 4C6NA 3MYPA 3NJ3A 4FMVA 4H41A 2X2GA 4F9JA 3QVQA 4W86A 3UJSA 2GVEA 1G1YA 1H0GA 1BAGA 4B90A 4FS9A 1CT5A 3UXIA 1GQNA 3NR0A 1UR8A 1K02A 4MWAA 1LCOA 4X2RA 1HNYA 5AC7A 3AIEA 3TQKA 2WM1A 4P8VA 4HMDA 1X8FA 2V3GA 4IX0A 4LY4A 3T81A 2Y89A 2YDAA 3NOEA 2ZUVA 3W24A 2IW0A 4IPNB 3ITTA 3N73A 3WJWA 3N6QA 3LQLA 4KKXA 2XFFA 5G2IA 1UD2A 3BLEA 4MJ4A 4JTQA 3LPFA 4GNJA 4GUGA 4EXAA 3WLOA 2XSXA 3WH6A 1JGIA 4GBUA 4GGBA 4N7QA 1H60A 4WSHA 3U2CA 4EX4A 3IJDA 3SZ8A 3TYZA 2EJAA 4FIQA 9CGTA 3PZQA 1T0OA 1XLHA 1VRDA 3PS7A 1RZMA 2OPJA 4M8UA 4AWUA 3KP1A 3TYCA 2CHNA 1IR2A 1TVLA 3ONCA 1K70A 2I1OA 4IP7A 1DXEA 4MNKA 4GY7A 2Z1BA 2WMFA 4KQNA 4Q22A 2NUWA 5FJTA 2YBUA 4JQ2A 4PR4A 1H09A 3PBUA 4GIEA 3DFYA 1V6XA 2YX0A 3THDA 3W82A 1QFEA 3ITVA 3NPUA 2XH4A 3W7LA 1FCUA 3NSNA 2Y1HA 4AW7A 2OB3A 1I2NA 3E0VA 3W28A 1XV8A 1UWRA 1MXDA 6A3HA 3L4VA 4PE8A 4OE7A 1BPLB 4GNVA 1YDNA 4PH6A 1HJWA 2A3HA 2Y8KA 2Z2AA 2PMQA 4IFRA 3IIZA 5E09A 2R1LA 4CQ9A 3K30A 4NI8A 1ZJBA 3MTWA 1A5KC 3VCCA 1PVNA 5I3IA 4HZ8A 4IQLA 2P5NA 4UTTA 1DBTA 3G24A 1ISYA 4DJFC 3TMLA 3EKZA 3UWYA 1FQ0A 2JF7A 4IIDA 4FEZA 3W83A 1EB3A 4JKKA 3RNDA 4JCLA 1HFBA 3FN9A 1VFUA 4JTHA 3QLLA 1PSCA 2ZX8A 4S3AA 4UNKA 2J7CA 3AXKA 4I7VA 1HZYA 4GGHA 4JTJA 1YNPA 4IGMA 5AECA 2DT2A 3DOPA 3GXMA 3IV3A 3O6YX 4A21A 3EDJA 2BOGX 1DWFM 3M4HA 1I60A 3QBUA 4LU0A 5IFTA 4JGDA 4LUTB 1PDYA 3CBWA 1YKWA 4D8ZA 3P8IA 3I3EA 5HJLA 2YYUA 1ISWA 4DO4A 4E2DA 3MSRA 3DCPA 1KB3A 1JZ8A 2UY3A 3CYJA 3KTCA 3HV8A 1PAMA 4NI3A 1TV5A 3ITGA 3G2GA 5AZ1A 2YLAA 1P6CA 8XIMA 3WQCA 4K7VA 2INZA 3PTQA 3CUZA 1VFHA 5ABTA 2ZRZA 3GFXA 3JZUA 4NYYA 4O17A 3DECA 4L5ZA 2YFNA 2CLFA 3USZA 3AS1A 4IG2A 2BGQA 3W1AA 4NZ1A 1MMFA 1J01A 3E74A 1W5MA 3N9KA 3DFHA 4UFHA 3W29A 3URBA 3T07A 5DF0A 4UTJA 2FVMA 2AKZA 3HQPA 4D8AA 4ZFCA 2OG9A 3A4XA 2V2DA 3AWOA 3MCMA 4MZYA 4W7UA 5E93A 3LLFA 3MS8A 2GSEA 1XISA 1DJGA 1IWAA 4M6VA 2VOTA 1QPOA 1L6WA 4A3QA 3HPAA 4A22A 3GXTA 1KGXA 3AUOA 1P48A 3L67A 2Q09A 3W37A 1A3WA 1R9YA 3BQ6A 2NLYA 1PHWA 5D33A 3RIKA 3W00A 3KXQA 3ARXA 3ZR6A 2QEZA 3CLMA 4K2SA 3CIXA 3THQA 1CXFA 1JZ6A 2RJHA 3CUFA 2F84A 1HG3A 3ZQ9A 1UWTA 2BHZA 3QN3A 3I6EA 1A5CA 4ERAA 5HXMA 1BQCA 1O60A 4AEOA 3JZEA 1SSGA 3R2GA 1LRQA 3CQIA 2WSPA 1U2YA 4KFNA 2G0WA 1HL9A 2QV5A 4QJ3B 2KZHA 3PNZA 1TB3A 2WAGA 1R7OA 5F4SA 1O7AA 5EFFA 2XJ7A 3F1QA 4QJ1A 4GCXA 4UTWA 3F5KA 3UZJA 1V93A 3GNDA 1W5QA 3QMSA 4QDMA 3LCXA 1UW9A 1RQBA 3P61A 1IT0A 3BSHA 4ZENA 4LAZA 4Y8FA 3H24A 2WC3A 2Z6IA 4HNCA 4GKLA 4DB7A 3W9ZA 1VJIA 4Q8WA 1H4PA 2VFDA 3OGSA 3PUEA 4IFOA 3W1TA 3EDDA 4BFAA 4UCFA 1WUEA 2QUUA 1YTEA 4GYPA 1HKIA 2A3LA 1OZQA 3IANA 3L0KA 1F4HA 1XG4A 4LB4A 1ODUA 3UCQA 1LL6A 3P3BA 5B80A 4ZXLA 4Y9NA 3DX5A 1WDDA 3DG3A 5CLTA 1V3JA 1QNPA 4IJBA 3C0QA 3UWVA 1UKOA 1BGGA 4GQBA 3VVGA 3UETA 2YIHA 6TIMA 5EBUA 1W9DM 2X1TA 5CPOA 3E2VA 1WDPA 3PN8A 4H8UA 1EXBA 3LMZA 5D38A 4C6KA 5JQ9A 1GZGA 1AG1O 1RUSA 8TIMA 2CBVA 1JXJA 4AF0B 3M0XA 5FCZA 1MUWA 4D1IA 5T26A 3WDIA 5CPQA 1VHCA 2R91A 4R34A 4NJIA 4MUZA 4D72A 2OT1A 1L9WA 5AHFA 2PCEA 1FXPA 3F5LA 3W2JA 4E5TA 4M6PA 3GG0A 4HHMA 2TAAA 2FIQA 4H01A 3A22A 4CVUA 4KH2A 4UFMA 3VM5A 2QJMA 2VWSA 4F0KA 2OLAA 4XTDA 4REQB 2VRQA 3QR3A 1QBAA 1V6WA 3UA3A 2D0GA 4NHVA 2Y63A 1TUFA 2ZRWA 2J7BA 2Q8ZA 4MAZA 1FWSA 1V6TA 1DJQA 3NO5A 2W79A 3SB0A 4MJ2A 1N82A 1VR6A 4I6VA 4N6EA 1JPDX 1UZ1A 1E4IA 5E1QA 3GG8A 5A6SA 4L9YA 5CPTA 4HU0A 1ZAJA 1XCFA 1UA3A 5GNXA 1JZ3A 2YYTA 5K9CA 2WHJA 3TJIA 3OLEA 1PB0A 1XGEA 3C2OA 2QCEA 4HNLA 2IQ0A 2Z6JA 4EF8A 3C61A 1ZB5A 3SR7A 3KOZA 2PF8A 3CPGA 1E1EA 1G7VA 4ZOCA 4YCPA 1HKJA 1QPQA 3RILA 3WL0A 2R24A 1EBHA 3NWRA 2CYGA 1NFBA 4P61A 1FWGC 3GDRA 4JN6A 3K1GA 1G67A 1UJQA 4LF1A 1FDZA 1KR1A 4QSHA 3WKZA 4GKTA 4KFPA 4W84A 3K8KA 3LHWA 3UA4A 5DMLA 4IL0A 1TPUA 1TCDA 3H12A 5LA1A 4BJHA 5AC8A 4JKLA 2CZDA 3OODA 1UASA 4ICCX 3WLMA 4N2YA 4Q4OA 1U1UA 4IXXA 5FF0A 3MBDA 1HT6A 3IIPA 4AB4A 1EIXA 4GI8A 5AYXA 4KPLA 1BD0A 4UZSA 4J5NA 2ONEA 2RDXA 3W25A 4HHPA 1GVOA 3AIVA 2AMGA 5BU6A 1KRCC 4I3GA 3IJLA 1J8VA 5XIMA 4FR1A 4AHPA 2QAPA 3R25A 3W7MA 2AGKA 1KV8A 1ONEA 3PSWA 3PG9A 3RLHA 3MHGA 2BMBA 4PB4A 5I3JA 1F61A 1XWYA 3AICA 4KT2A 1XG3A 3B8VA 2VD9A 2ZA2A 3P74A 5G1YA 4S3FA 2KAUC 5I03A 3TOYA 4JY8A 1ZLPA 3LEPA 4XB3A 2HROA 1W0MA 1XRFA 2FTWA 3WBXA 5J04A 1QI3A 3L4UA 2ACRA 3TIMA 1WKDA 2DZAA 4MYXA 3UZWA 3QR1A 3MUZ1 3WK1A 5BWFA 3QLDA 3OLGA 1TJRA 5CPNA 3CK5A 4XO6A 3H2AA 4PMZA 5KINA 3GTIA 3MSYA 3G1SA 1VFTA 3L23A 4XO7A 2R8WA 2ZUSA 1YYAA 5DMNA 1A5UA 4NSBA 3ALGA 3W71A 4O19A 1TWWA 1J0IA 3HG4A 1NTHA 3SEPA 2WMIB 4H9UA 4LBSA 1LOSA 1Q2RA 4J3VA 3K1DA 3TYUA 1KXHA 3WMBA 5KZ6A 1TWZA 3BCFA 3UNTA 2C8NA 3VFCA 3GH5A 1VPQA 3FXYA 1H1ZA 3Q45A 4HZ7A 4QG8A 2CHRA 1SFLA 2FGLA 1J9YA 2UY5A 2ISFA 3GZ3A 5I6SA 4HQVA 5HMFA 2PGRA 3A23A 4PCFA 4XZMX 2IKIA 2G50A 1V0MA 3LZ5A 4JN8A 3PJXA 3WD0A 3U4AA 3BMWA 3PBMA 3CH9A 1PHQA 5CPSA 2ISVA 3NZPA 3O1NA 4XVEA 3C5QA 4E8DA 4JEQA 2NXGA 1QK2A 3TNBA 2GK1A 2Y7EA 4C6EA 5D2TA 5DANA 2HNEA 1TJ1A 5FAGA 3NG3A 2VCCA 1SUXA 1R38A 2RHGA 2Q8LA 1S2UA 3WEOA 3TTOA 4CU8A 4K3ZA 4Z2IA 3DAQA 4MG4A 2PBGA 1IT8A 3VAVA 2WMJA 1U5VA 3VE9A 4RE3A 4NY2A 5HWJA 3GB6A 2EPMX 1MEIA 2JIEA 3ERPA 3VMNA 3G6LA 4I9TA 3IJ7A 1BGAA 1SGJA 3L65A 4DUWA 4HBKA 3AIQA 1NVMA 2QDEA 2PLCA 3GU1A 5AY7A 3PTMA 2Y7FA 2IQTA 1BWVA 4JTRA 1PWLA 4ZO9A 4XG1A 1W9PA 3WD1A 4J35A 4GUJA 5LGXA 3HG3A 1B57A 2OX1A 4R7OA 3ANYA 1UP2A 3GDLA 5D9OA 3KW3A 3FXGA 1H7OA 2I16A 4CEUC 3LDVA 5D2WA 4ZOEA 2QULA 3JW7A 4PCTA 3RX3A 1Z41A 1FBAA 3CAQA 2ISDA 5A6MA 1TTQA 4LUTA 3N3TA 4ATLA 2Z1KA 5EY5A 1NP0A 4D6CA 3TZNA 1RBAA 1S3HA 1KM0A 2BZNA 4D6IA 4MJMA 3AZTA 2FJUB 3PZTA 3CEUA 3A12A 2YXGA 2VFHA 1WKEA 1AJZA 5F2LA 3WEZA 1PIGA 2X09A 1UUOA 3CB3A 1I2QA 5E5CA 4Y90A 1QNRA 1L6FA 1EQCA 1RV8A 3EPNA 4B5WA 3QY8A 4UUIA 4HNNA 4O50A 3PC0A 1AVAA 1W31A 5K9XA 5HULA 3L4TA 5BU9A 4XKYB 2X0HA 2EPOA 3U8GA 4D6DA 3AIRA 4YNGA 1VHNA 3A13A 1JF5A 2XISA 1VAHA 4LSBA 2HWGA 3N25A 3LV5A 1V0NA 2VZTA 1Z48A 1TVPA 3T40A 2EJ1A 4CUCA 3BVJA 1MXSA 3O8AA 3OG2A 1XGZA 3QZ6A 5HPOA 1PS9A 2QCNA 4P7QA 4W8LA 4S3GA 1C90A 1GZJA 3GFYA 3T0AA 3VD3A 4HNVA 2WLYA 4BF7A 3NTYA 4WGHA 2R6OA 3NQVA 3VIGA 1GQIA 4RNHA 3SCNA 1VENA 4OGZA 1E55A 1VBHA 3I6TA 4JCMA 4NL1A 3CM4A 2IQDA 1QNVA 1WBHA 1H7NA 3W76A 4D6JA 3IJQA 3KCLA 3FIGA 3W6MA 4CQAA 5JH1A 3B8TA 5LKYA 2NVDA 1ICSA 3M07A 2NX1A 2ATMA 1RXOB 3TR2A 4FNRA 3ZOAA 9RUBA 1WKYA 5CZSA 4E2BA 3GTXA 1QHOA 4GNKB 3FVDA 4DJFA 5HJYA 3U5UA 3G77A 1TMLA 2ZC1A 4P8XA 2GJLA 1B31A 1K77A 1WA3A 2Y8VA 3SCOA 3FCPA 3VZXA 3D46A 4CNUA 3Q67A 1TQXA 3GW3A 1A0CA 3W07A 4S3BA 4QBXA 3UXLA 1W1B1 4AEFA 3IK4A 4O11A 4ZO7A 3QC3A 2CBJA 4UXDA 1BQGA 2XSAA 4BEQA 2Y24A 1EX5A 1KFCA 5EMYA 3WMCA 3EDKA 1WZMA 4HT3A 4G1NA 4QS5A 2PZNA 1HXJA 4AYGA 5FSEC 1PYMA 4L4OA 4XZWA 2YR1A 3ITCA 1GOKA 4PL2A 1PKMA 1TTJA 3P7YA 3V18A 4EP8C 3AMCA 3C2VA 4KGLA 3B0VC 4JL1A 3RFAA 3S42A 3UR2A 3ECQA 3OA3A 1XI3A 4H6KA 4U2YA 3NQ2A 3DH7A 2C15A 3W6LA 3IK2A 1KXQA 3EAUA 3SRDA 1UH2A 4NZ5A 3TCEA 2HJPA 4AF0A 2R82A 1E4NA 5CSUA 4AHQA 3AXIA 1S3TC 4EACA 1W32A 5I0DA 3TE9A 2W67A 2ON3A 3VOGA 1LM1A 1I6NA 1YXCA 2OYKA 3BANA 1C92A 2QCDB 2NWSA 3OGRA 3MSGA 2VM8A 3F4VA 5E9AA 4WGXA 1E1CB 2OSWA 1J96A 4REQA 2PDYA 4ADUA 2QCLA 2NV1A 1DV7A 3ZLFA 1F07A 2BGNE 4TV6A 1AUSL 5RUBA 4HSHA 2JKEA 4DX3A 4RDVA 4DYJA 2HSAA 4Q32A 1E3XA 7PTDA 1J93A 2WO5A 2A3EA 3PJWA 3QSTA 2JF6A 1EA9C 2Z0IA 5FOOA 2YA2A 3ARQA 3LOTA 1EPVA 3B0PA 3KLKA 4HK5A 4O8AA 4XWUA 1VH7A 1KM6A 1Q13A 4P7LA 4PBGA 3BC9A 1OBAA 4Q6XA 3BMXA 3AMKA 1TR1A 2FGZA 3ABSA 3UJRA 1ZCOA 3T0CA 1VEOA 3EA3A 1TPB1 5L9FA 2XH0A 3BSGA 5KZMA 1RP9A 4DO6A 4RNFA 2NW0A 5E0KA 4LOCA 3WNPA 4HU3A 1MZRA 4UR7A 4AYSA 2E8ZA 4A3UA 2DDXA 1D3GA 3N2XA 3ZS4A 1QOXA 5CC6A 4DLMA 2PDLA 3PZGA 4HA3A 1Z7AA 4HK7A 3B05A 5EYWA 3BQ5A 3VABA 4XQ6A 3ITLA 1PX3A 3N12A 4OZOA 3OBEA 3B8SA 5K2ZA 2OODA 3M46A 4Y2WA 4IFKB 2PRHA 4PB5A 2FPTA 1EYWA 4US5A 3F4NA 3TN4A 1EOMA 4IOTA 4DBEA 4FX8A 3O0FA 1OC5A 3DEQA 3CL6A 3K4WA 4BI7A 3ARVA 1JYWA 1ZBVA 4AD4A 3J7HA 1UB3A 1YRRA 1I2RA 3RXZA 1GCYA 3L2MA 4Q4KA 4RE4A 1UD8A 5C8BB 1SMAA 3FSTA 2Z4GA 3XIMA 4NKCA 3BK0A 1KBJA 4PMUA 4HOZA 1E0XA 3ZJ6A 3VC6A 2VDGA 5C9RA 1OJXA 3VDAA 4GY1A 1L8NA 1XQKA 1JQXA 3W2UA 3AROA 1Z32X 2GDVA 2RDTA 3BW4A 3OVRA 4YLWA 4Q8QA 2Y4SA 8A3HA 2IPGA 2XYLA 1PYFA 1T8QA 1ZSXA 4MLJA 5DBTA 1FWNA 1O5XA 2OKOA 1EYEA 3BPWA 1Q6FA 4B4FA 3N14A 4WXYA 2ALDA 3MP3A 1YE4A 1RQHA 2XINA 4G7FA 4XZLX 2G37A 3OG3A 3R12A 3O6DA 4UIOA 1WP6A 3GDMA 3RAOA 5F4XA 1QUMA 4AXKA 3R8HA 3EDFA 5K9DA 3W2KA 3A64A 1G5AA 2G3IA 3ZLHA 1DWIM 1W3LA 3QTGA 1E1FA 3REQB 3ARTA 2ALRA 2ZKMX 3QSRA 1WPCA 4D1JA 1W91A 3G1YA 3V0TA 1AZ1A 4O14A 2ZDSA 4QCFA 3L5AA 1P1XA 2D2OA 4Q4SA 3MZNA 1U5HA 2J9YA 4OKDA 3AUJA 3LLXA 1OB0A 1XIDA 1WE5A 4AHOA 1IT7A 2J13A 1TIMA 4AY7A 1XLCA 3XISA 2J6XA 3WLRA 2FZDA 3VIFA 3T7VA 2E0PA 2PLJA 1X39A 2GPTA 5H91A 3LMYA 3WQ6A 2JGQA 1QTWA 1XDLA 4O4VA 3VGGA 3FGCA 5BCAA 3BTNA 4GK8A 5F2MA 3VCRA 4OHQA 4GA8A 2WCAA 1J10A 4H7VA 1VBGA 2CLIA 2VZVA 3OLIA 3VGFA 3W7HA 3UCCA 4I9AA 1E71M 2BFGA 4FF7A 4OUEA 4NZFA 2PPGA 3OIHA 1JCLA 1R87A 3ITXA 2DSVA 3LTYA 1QJWA 3GNRA 1GPWA 4V2XA 4MB4A 4LUSB 3KWXA 1DJYA 2ZCGA 3GH7A 4TU1A 1LT7A 2OEMA 1U22A 1JL8A 1RAKA 4CU7A 2WVSA 4J3XA 1EEPA 1VCGA 3SJNA 2EPHA 1G4SA 3UD6A 4F48A 2YDQA 2FYMA 5E0FA 3PY2A 3TAOA 4MLRA 5DFAA 1MI3A 3MKCA 1KXTA 1V02A 5A6BA 1H7XA 1IGSA 3GKAA 3VD7A 4GH3A 1SMDA 1W1A1 4KIEA 4XD5A 3CHCA 4H2HA 2GGHA 5FESA 4A8NA 5BNKA 2QGYA 4DJED 4AD5A 1UWIA 2YA1A 3EWWA 2RH9A 3LN3A 4UTKA 1NOFA 1OF8A 3S83A 1Y0EA 1GJWA 3KBJA 3UJEA 3QTPA 3WLIA 1T5AA 3Q65A 3FJLA 2J66A 3SY5A 4ADTA 9XIAA 3EOLA 3NO3A 1TZZA 2HQAA 3NDYA 5C9XA 2GLKA 3OU8A 4AXNA 2D3LA 3NQ6A 1ONWA 4U5IA 3W22A 3E38A 2PP1A 3LERA 3C2EA 1CYGA 3IUHA 3U7VA 5BW6A 4ZA0A 3GNXA 4CD4A 1S1PA 2XGZA 3MANA 2WQDA 4B92A 2QPXA 4UNIA 4ZTXA 2Z27A 3CWNA 3UPWA 1PZ3A 1HO1A 1I2PA 3DG6A 2OT0A 4ERIA 3EBVA 1MEWA 4PTWA 1XYAA 2VRJA 1AJ2A 2J6VA 1CLXA 3ABZA 4LYKA 2V3FA 2VT0A 4FXFA 4XUGA 5I02A 1XINA 4ZODA 4HHLA 1O94A 2VX5A 7REQA 1CTNA 3I68A 4NX5A 5F2GA 1EKOA 1E6PA 5G1MA 3WEMA 1YEYA 1UG6A 1UIPA 3OOQA 4GI9A 4YTQA 3PF3A 3EYPA 2GVYA 2CZEA 1OYAA 3PZNA 1LUCB 3QKZA 1M41A 5TF0A 1GJUA 2DH2A 2VVSA 1TWIA 1OINA 4M5PA 2CETA 2DPEA 1SJBA 2LLEA 4R9XA 1PV8A 1P0KA 2V30A 5AHEA 5BRBA 1PTGA 3QQ0A 1W3JA 1K9TA 5FEWA 3GNOA 4QITA 3A4WA 8RUCA 4XAPA 3B8UA 3INPA 4RR4A 1IZJA 3HPSA 2YOCA 3DFOA 1JAKA 3WQPA 2XHYA 2V3DA 5CGMA 1ZPTA 1HN1A 4U4MA 1SZNA 3G22A 4TIMA 3G3MA 3VI2A 3ARWA 1EO5A 3CIWA 4PBEA 5I3GA 3P80A 5FJIA 4I5XA 3AS2A 4JTKA 3HM7A 6REQB 1JXKA 1G6CA 2J79A 4PFMA 1BTCA 3LB0A 4FNTA 4UFJA 4OBRA 2C0AA 2XIQA 2PCQA 4DEFA 3OJGA 1G9HA 1VEMA 4FIRA 4RPPA 1CWYA 4ZSTA 3UR8A 1XYCA 2YCJA 3ORWA 3BAKA 4P8WA 3UVAA 4Y9OA 1M3UA 3MA8A 3PB2A 4JX6A 4O57A 4J3UA 3FEQA 3K4DA 4AZCA 4K37A 4MKNA 2TSYA 5HR6A 1T99A 3EOEA 3I7RA 3NZQA 1HTIA 1CGUA 1X8CA 3FOKA 1CB2A 5T9CE 3E2QA 4EK7A 1GG0A 2QDDA 1EF3A 3R79A 1M03A 1UR1A 2NQ9A 5D9MA 4PMQA 1A47A 5F4WA 4Q7IA 3R0DA 1AA1B 2E1WA 4KESA 1DHPA 2HTMA 3KVJA 2XGIA 1MRAA 4XBSA 1H41A 1BXCA 2W66A 4C5ZA 1DIKA 3QQWA 5F1UA 4XBKA 1TX2A 3N2MA 2YCLB 5BXRA 2WK2A 1ZJAA 2VFGA 3GHRA 1XIMA 1B3VA 3TEVA 4LUYA 4EWJA 3F2CA 2QJGA 2X8RA 4FK9A 1L6YA 1W8SA 3KS5A 4XISA 5AN7A 3GXIA 3TFXA 3G6MA 3N4AA 2BNJA 3DBNA 1PZ2A 5KSWA 2DJLA 1WXYA 3EX6A 1UWQA 4UR8A 1LLOA 4AWTA 2VMFA 1DJXA 3W7OA 3LM7A 1NWSA 1BYDA 3SY8A 2PGFA 3GR7A 2OWWA 2C3ZA 1M04A 4OTKA 2WJFA 1JUEA 3A4AA 1Q7QA 4UTUA 4DUOA 1WAWA 4QSFA 2CESA 5A94A 1XYBA 5CJMA 2DIJA 4LC8A 2P0OA 4IFKA 2PWEA 1ADOA 2YL9A 1UP3A 3I65A 4B91A 1PL9A 2OTDA 3EKLA 2EPKX 3VOJA 1WX0A 1PUDA 1E5NA 3V1PA 5HMDA 1MYRA 4L1GA 1ZHAA 1K9DA 1TA3A 4KWOA 4OWGA 4ZB5A 4B5NA 2RJGA 3E5PA 2Z26A 1LORA 2XVGA 3WX7A 1PO9A 3G1VA 3PTKA 1QNQA 2EAWA 2PWGA 2J7FA 1BEUA 1NIUA 1IEIA 1IWPA 4H2CA 1G69A 1JI2A 4HMNA 1XIJA 3NQCA 3LPPA 1LQ2A 3H6OA 3P81A 2PDFA 1JFXA 4RZBA 5AHIA 1SO6A 4C6PA 3B3DA 5CAKA 3SECA 1US3A 5D05A 2INFA 5HA7A 3LBCA 3PUDA 3VDBA 3WNLA 2BXVA 1WQ5A 1OX6A 5EA9A 1T8XA 1EDTA 5CJNA 3W1MA 2GDUA 3WLPA 4J3ZA 3SJ3A 1JYVA 1U30A 1E4MM 3CLWA 4PMYA 3PZUA 5I00A 3TSDA 2WV8A 3NQMA 3N6HA 2P0IA 2VX7A 3MU7A 2DVUA 3AZSA 3SURA 3SN4A 2JQXA 3NNTA 1AODA 1G4EA 1DWHM 5BXTA 3APTA 1LBFA 3F4CA 1A5SA 4QQ3A 4WOQA 2IUZA 1F76A 3GXPA 3K2GA 2WSQA 2ZX7A 3REQA 4YHGA 1PX8A 2PP0A 2ACUA 1TV3A 3APGA 2IPJA 4NJKA 3KBNA 3B03A 4ZZ9A 4MGGA 2WC7A 2X1UA 2OWCA 1GUVA 3HU7A 1XRSA 3SO7A 4HSOA 2XG9A 4RNJA 2IPWA 1DHKA 3BUVA 1XD1A 3TN6A 5DN1A 4HK6A 1IXQA 4J9JA 4HZMA 3WDPP 3P8JA 2PD9A 1S5VA 4EPEC 2REQB 3CXOA 3SN0A 1GQLA 3QPYA 2FTPA 2DY3A 1S2TA 2A7RA 4AISA 3BL3A 1W2VA 4H7CA 1OFOA 2GL5A 3GY1A 1E0VA 1PKYA 2HS8A 3FK4A 4WUIA 1CW2A 2YXOA 3MSDA 2GSHA 2WANA 3MI2A 2R9RA 2A79A 4JTUA 4ENLA 4YJ5A 3WUGA 1O5KA 2V2CA 3WELA 4AVFA 2E6DA 2W63A 2WCSA 1T6MA 2G8ZA 3EWCA 2QHAA 2FLIA 3W84A 5GVJA 2X05A 4FNUA 5IDIA 4B3ZA 3GUGA 4XZIA