1HO1A

Crystal structure of pyridoxine 5'-phosphate synthase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
242
structure length
235
Chain Sequence
b'AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE 5'-PHOSPHATE SYNTHASE
publication title Structural basis for the function of pyridoxine 5'-phosphate synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 93
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ho1A00
2CZFA 2YR1A 1SW7A 3LCHA 3CIXA 2YFNA 3LCLA 5IM51 3NXFA 1B4KA 3GNDA 3N2MA 3HIJA 4NJHA 3R89A 5AHMA 4MY8A 3ABOA 4L4MA 1I2PA 4EF9A 4YLWA 2B7QA 4FHAA 3L67A 4TIMA 1G7UA 2WOQA 3M0ZA 1T0OA 3IRDA 3BV4A 4GUIA 3OIXA 2DZWA 4PTNA 4UTUA 3NA8A 4CLMA 1KLYA 2TRSA 1TMHA 3VI2A 2V30A 2QR6A 1QO2A 4NX0A 2A7NA 5F2GA 1S5TA 1QFEA 1VJIA 3TFXA 3IV3A 3FEMA 4UTJA 4TMBA 2F84A 4BR1A 1C9DA 1EUAA 2QUUA 3UXDA 3GYEA 4UTWA 3HG4A 2XFWA 1GVQA 3F1QA 4AWTA 3W2MA 5G4EA 2WQPA 2VENA 3L5MA 1VYPX 2A7PA 3GXTA 4ONVA 1W1ZA 1ZHAA 4PL1A 3FLUA 4JN6A 2V2CA 3SFKA 1OABA 1Q6OA 1TPUA 2A5HA 4JIPA 1MZHA 3QJAA 5A5WA 5HJLA 2ZRZA 1TPEA 1H7OA 3DHDA 4GJ1A 3NO5A 1D9EA 2X2GA 4O17A 3TSMA 3LRKA 4MYXA 5I3IA 1UUMA 2RDUA 1H50A 5I3GA 4UR7A 4KFPA 1IGSA 3DAQA 2J24A 3MI3A 1LBMA 4QSHA 5HUPA 4WX2A 2HS8A 3C4UA 5A8GA 4QJ1A 3IEBA 4GXMA 4O4WA 4PFMA 1H7WA 1XBVA 1P0NA 3NQ7A 1MEHA 3M47A 3MJYA 3PUDA 1EEPA 2J9ZA 3DFNA 3O8AA 3VE7A 3DENA 3HGOA 4ORMA 1XL9A 3IGXA 3NGJA 5HWJA 3MHFA 3PUEA 3QQ1A 3QM3A 1IXNA 1QAPA 1IIHA 3EX2A 2OT1A 1P1XA 2FB2A 4POCA 1MXSA 3KRUA 3C8FA 2Q8LA 3N73A 5L6UA 3LCWA 2ZRVA 3BLFA 2GUUA 3IIXA 4A21A 1DL3A 2WNZA 3N14A 3T78A 3NQVA 3OBKA 4ORIA 1NAL1 3TR2A 3UWVA 3P74A 3HG3A 3W75A 2Z2UA 2A6LA 4UMCA 3S1XA 1PL9A 4NNBA 1A5BA 3GZ3A 3LTSA 1R30A 2BLEA 3M5XA 1FBAA 1TPVA 3T44A 1SO6A 3W70A 3LXCA 3G8RA 4X2RA 2E6AA 1WBJA 2E77A 3O07A 3W7PA 1OJXA 3TC6A 3W7NA 5C5YA 3W3OA 3EWUA 4UTKA 1U5JA 3B0PA 4P61A 3LOTA 5CPNA 2P10A 1K8XA 4MZ1A 4ZQCA 3PVFA 3RNDA 1R46A 1H51A 3M43A 4DO4A 2Y7GA 1XI3A 4DQWA 1ICQA 4HNNA 4CQ8A 3PULA 2CZEA 1SFLA 4IMEA 5IBXA 2ZCGA 4CCDA 3QSTA 4GBUA 5AC8A 4BI6A 2FB3A 5D2VA 3L5LA 2HS6A 5I3KA 3IIZA 3W7KA 2FPYA 2Q3RA 1PCWA 4OT7A 1DJQA 3TK7A 2OT0A 3DH7A 4RJEA 1GYNA 5AFDA 1IXQA 4BFAA 1FWRA 4E38A 1DQWA 1RZMA 1DKWA 3EKLA 2ZRXA 3NAVA 1X6UA 2YCEA 1ZAJA 1H61A 1CX9A 1OFQA 1HUVA 3CEUA 1SZFA 1QMLA 3NQFA 4UNLA 3W2JA 6TIMA 2ZA2A 4JR5A 3CPRA 1O95A 2NUXA 4CQAA 1N7KA 2I14A 2QCDB 3GDRA 1F73A 1BKSA 1DBTA 3FKKA 4NNAA 2ABAA 3G1XA 3T40A 3FS2A 3W7LA 4O15A 3O6DA 1K7FA 3ABSA 2ISVA 3HPSA 2ZTJA 4N6FA 2I1OA 2RHGA 2PRHA 2JGQA 1OVDA 4IX2A 1KM3A 4QQ3A 5K9DA 1KTCA 5DBUA 1EA0A 3LBCA 4ADTA 1AW5A 4Q32A 1H5YA 1LORA 2ZYFA 5F2MA 4PC8A 2YSWA 1GTHA 5D04C 1H1YA 3C2VA 3FOKA 1QCWA 3MP5A 5CZJA 1H63A 1LRTA 4RV8A 1NF0A 3UZJA 3UY8A 2V0TA 3TNOA 1X1ZA 1VCVA 2J9YA 2RH9A 2WSQA 2NLIA 3GAYA 3TU9A 3WFAA 1MEWA 1OX5A 3SECA 2QF7A 4D2JA 5G4WA 3MBDA 5IBXC 2TMDA 2QJGA 5DCDA 4HHPA 4IOTA 4FNTA 5AHLA 1B4EA 1FXPA 3EWXA 1O5KA 5AC6A 1B9BA 1UASA 3MMTA 4QNWA 1LLWA 1YXDA 2NX3A 3G3MA 2DZUA 1EPXA 3LV6A 1X7FA 4RXFA 3DGRA 2FDSA 3S1VA 4J9JA 4UIOA 4ALDA 1TPC1 4OV4A 2J27A 2QKFA 1O60A 3TQVA 2NUWA 1Q6LA 4ZQOA 2A4AA 2YW4A 4XQ6A 4XTIA 4CNNA 1M7OA 3HG5A 4R7JA 1VR6A 1A5CA 1VCGA 1L9WA 4OE7A 2VXNA 4MFEA 3W1LA 4JX5A 4IQLA 4RKAA 3BLEA 3G0UA 4NUWA 1E51A 4IMDA 3DFOA 4BF9A 4LVGA 4K39A 1W0MA 1KV5A 3S5OA 4JX4A 3A9IA 4MZ8A 1TSIA 4O4VA 4UFIA 2GJNA 4EVZA 3MO7A 3HQ1A 3PBUA 1T8XA 3LGEA 1LTDA 1I2QA 1U83A 3U8GA 2BTMA 2CFFA 5G5IA 2A7RA 2R91A 4LVDA 5CPMA 3M5YA 2OZ0A 1T99A 4I7VA 4HNUA 4MLJA 3UWWA 1X1OA 5AYZA 2ISWA 2Z1BA 5BOOA 3KRSA 1XCFA 5DCBA 3L21A 5LHFA 2CZ5A 1XM3A 1LRQA 2QCFA 3L9CA 1F6KA 2C19A 3S8HA 1RQHA 2JKEA 2QCDA 4Z08A 5MHBA 1UUOA 4O19A 2E5DA 3W1AA 3KAOA 4KWWA 1VLWA 1JRCA 1SZGA 1GQNA 1FDYA 4MKNA 3SW6A 3STFA 4FIRA 1JUEA 2XN1A 1ZJIA 3LHUA 4OBTA 3K30A 3G0SA 3PSWA 3W83A 1EP3A 1Y0EA 2OJPA 4RCXA 3ZWTA 4AXKA 1WBHA 5K4ZA 3OEXA 3LDVA 1TREA 4FNQA 2RDTA 4I7WA 1WOBA 1CI1A 3G1FA 4NJGA 2ZZ4A 4UMBA 3THAA 4AF0B 2PC4A 3D0CA 2G97A 3W7GA 2TYSA 3ATZA 3W7OA 1K3UA 2QDGA 2X1TA 2VFFA 1F76A 4O50A 4QIUA 3W7QA 4GC4A 3G24A 4O12A 1YDVA 2QEZA 5HWNA 5EY5A 2CZDA 2YDAA 4I7UA 1DVJA 2W0UA 1S5WA 4JTSA 4CQ9A 1LBLA 4OHQA 3NPUA 1QNVA 1RV8A 4JICA 3THQA 4NJKA 1ZNNA 1OFRA 4O0ZA 4ZVJA 3LCGA 1V5XA 5G1TA 3P67A 3CTLA 5SWUA 3BGGA 2H6RA 2NX9A 1VRDA 3EWWA 1KM0A 2GPTA 2J6XA 1TPWA 2E1DA 3NZ1A 4WJEA 1P5BA 4UTLA 2B7PA 4C1KA 5G2HA 3FIGA 4U28A 2W6RA 3C52A 3IVUA 1GVOA 4LC8A 1PIIA 2ABBA 1A5SA 4K8HA 3C56A 3STGA 4MLRA 2ZZ1A 4JIQA 1VCFA 2QAFA 3DI0A 1XFBA 3E02A 1W3TA 1K8ZA 4K8EA 2FJKA 4DO5A 4HNTA 3S42A 3HPZA 1P4CA 3L0GA 3PBWA 1KFCA 5LHEA 4W9TA 1VZWA 2JKPA 5DY2A 2Z6IA 1SO5A 3S5NA 4YXGA 3DU0A 1W5NA 1KM6A 2YGYA 3LCFA 3V75A 3WJXA 3GLCA 1DQXA 1DHPA 3M5ZA 4K37A 3INPA 1IF2A 1ICPA 2GJLA 2VOMA 5U7SA 4DEFA 3STEA 1RQEA 5DN1A 3A5VA 3G1VA 4IMFA 2ZRUA 1JCJA 3C2EA 1FUYA 1OFEA 2CLEA 3W71A 1TIMA 1OF8A 1O94A 4N02A 5C55A 3GXNA 5D2XA 3JS3A 3GDTA 3ZFHA 3NQEA 3B0VC 4E0CA 2ZZ3A 5H2ZA 4Z1CA 5G1YA 3JRKA 4GNJA 4KFOA 3N3MA 5AB3A 5D2YA 3GX9A 3W23A 1DOSA 2AAMA 3BW4A 1H62A 2Q8ZA 1VHCA 5HUOA 5FF2A 3U6WA 1PHQA 3SR7A 5F4WA 3TX9A 3HB9A 3LHTA 3N2XA 4YCOA 3W7EA 2YZRA 4O13A 3BG3A 4AF0A 3T4CA 4OQVA 4OWGA 5KZEA 2A1YA 2V81A 5LZLA 5HINA 1BWKA 4O8RA 3UZ5A 3LRLA 1KM5A 4Z1BA 3HO8A 3KFTA 4Q4KA 1BEUA 2G5WA 3W2NA 1SO4A 4K7YA 2DORA 1TTQA 4O28A 5CZSA 3MHUA 3TMLA 3TE9A 4JTIA 4ML9A 3NQCA 1G4TA 4S1FA 2CU0A 1ZFJA 3L2IA 4YWIA 5LGZA 3FJ6A 4M19A 3TJXA 2NXGA 3G1AA 2Y7FA 1CW2A 4DELA 4Y9AA 1VYSX 1H7NA 3NR0A 3R8RA 2E6YA 3M5VA 5KSWA 1W5MA 4NVTA 1Z41A 2WV8A 3C3NA 1SQ7A 5F2LA 1TCDA 1W5PA 4ZMGA 1F6PA 5D32A 2RFGA 1FWNA 4DO6A 2WNQA 5C54A 4FNPA 1N8FA 1LOSA 2QCGA 1XDMA 3C61A 1I45A 1GJPA 2VELA 3N9RA 4M5PA 5HWMA 3M7WA 2H3BA 5KTLA 2YXGA 1H7PA 1UB3A 1WQ5A 3IIPA 2H90A 3LCXA 4ZQNA 4LRTA 1SO3A 1YLVA 2QCLA 4JY9A 4JX6A 5HR6A 3TH6A 3KXQA 2WJZA 3WJWA 3PM6A 1XUUA 4MOZA 3PUOA 2R94A 2FLIA 3CC1A 1W5OA 3TAOA 1W5QA 5CGQA 1W54A 1RD5A 3GAKA 3Q94A 4GUFA 5D38A 3L68A 4UXDA 4UTTA 2FQIA 3TSBA 4DBEA 5FF3A 3OA3A 5FEWA 3E9AA 3EXSA 1F2JA 4LT9A 4JXCA 2FIQA 3PBYA 4A2SA 5U4NA 3W7HA 1DORA 1OK4A 1NF7A 4JGDA 2C3ZA 4GUJA 3T55A 3CQ0A 4FO4A 1SZNA 3CWOX 1R47A 3R2GA 2W79A 2DZTA 1PCKA 1R2TA 1FX6A 3MW7A 3NQ2A 4YL2A 1QOPA 5HULA 3STCA 2A85A 3OHIA 1EUNA 4PH6A 1Z44A 3MP3A 4GUGA 1JJKA 4UTWC 2OMAA 3L0KA 1JUKA 4X9SA 2C6QA 5LGXA 5AHIA 1YTDA 1ADOA 4RZ6A 5T26A 3PG9A 3P84A 4OGZA 3ATYA 3KOFA 4HSNA 2A6NA 1G69A 1PV8A 1PHWA 1G6CA 2V2DA 4NXKA 1JCMP 4A3UA 2ZDRA 3GK0A 1LROA 5KZDA 5HNRA 5J5RA 1TV8A 3LRMA 4AB4A 1KV8A 4M6VA 4LVBA 5D2TA 3OVRA 3RLUA 3M1ZA 1GPWA 5DCEA 2VEKA 1KFLA 3M44A 1VS1A 3A24A 3CEPA 3P8JA 4JTKA 1F7BA 2NWRA 4O52A 4CNOA 5D02A 3P60A 4LWWA 4UMAA 2B0MA 4ADUA 1OYCA 3VFLA 2GVGA 3W7JA 3W1XA 4IUOA 2NX1A 3WJSA 5GVJA 1ZY9A 4DPPA 1LP6A 1UCWA 3ZR4A 1G4SA 4Z0SA 5EBUA 3TROA 3W74A 2WPBA 4UTTC 3E96A 2FFCA 4IJBA 3ABRA 3LB0A 4YCPA 1WOAA 1G7VA 2TSYA 3F03K 2BXVA 4FNRA 2JGYA 2C1HA 4UFJA 4N9EA 4LC6A 4JTHA 2EPHA 3KHJA 3O05A 5TBOA 1WDWA 4N4QA 3QC3A 2ISSA 2ZA1A 1AW1A 1D3GA 1JQXA 3SIZA 2KZHA 4R34A 3TC7A 1FCBA 3H54A 1NFBA 3WJZA 1NSJA 1L6WA 1VLIA 4GE8A 5CZ0A 3OVPA 3C0JA 3B06A 3CLMA 8TIMA 1I2OA 4UNKA 1FQ0A 4NJJA 4NXSA 3TCEA 2C16A 2YPIA 3NL3A 1W37A 3TXVA 1G67A 4CCCA 1F5ZA 4ICNA 2EAWA 1D3HA 5D2WA 3NM1A 2GQ8A 2ZZ7A 2EHHA 3W22A 5ABTA 1LRNA 5LNRA 3I65A 4RZ5A 3DFTA 3FYOA 3NM3A 4UTHA 1TQXA 2OCZA 5F4XA 2J88A 3NQ6A 4JYDA 1QO5A 1XC4A 3L66A 3PBVA 3DFPA 4NQ1A 4LUJA 3W7RA 4BI7A 4EOUA 1AL8A 3TAKA 3NQAA 1YXCA 4XWUA 1FCQA 1GOXA 2OX1A 2YYUA 4O54A 1KA9F 2Y89A 3N9SA 3UNDA 4OV9A 4O11A 3GDKA 5D03A 4A29A 2BSLA 2ZRYA 1H7RA 3SI9A 1OFPA 1FCUA 3MP4A 5I3HA 4TMCA 1WX0A 4MFDA 2WKJA 2F7FA 4CNPA 5FEPA 6ALDA 2P0OA 1ZENA 3E12A 4WUIA 1GT8A 1PVNA 3P8IA 3W73A 4MJMA 3QEZA 1QR7A 4K6AA 1O5XA 4N9BA 3UWYA 4JEQA 3A5FA 3I68A 1H1ZA 3MYPA 5FF4A 3NEVA 4WD0A 3LXAA 1OYAA 3NOEA 3NL5A 3LM7A 3GVGA 3VCRA 1TV7A 3EEGA 4BK9A 1QPNA 3LHYA 2Y88A 4HSOA 2WNNA 4PODA 1A50A 5DY3A 2HSAA 1JCNA 1VC4A 4FEZA 2ATMA 3GKAA 4AHOA 2DZPA 3LTPA 3MI2A 4ZQPA 1WV2A 3S1UA 3G8EA 3UYCA 4RK8A 4IPIA 3S0CA 4Z1DA 3NYZA 2VC6A 2X16A 3W7CA 4OU1A 5E0KA 4K36A 5EPDA 5CSRA 3JR2A 1TO3A 3EX6A 3UY7A 1LOLA 2UV8G 4WOQA 4AWUA 1Q3NA 4JD4A 1QOQA 4KKXA 1OFDA 5CPLA 4UCGA 1OX4B 4K7VA 5LNSA 3GIYA 4ZQRA 2ZA3A 4NJIA 1TTJA 4RR4A 2ZZ6A 2X30A 4HKPA 4LVFA 3P61A 3ZS4A 3IGSA 1VYRA 3BG5A 2DJXA 3LTYA 1I2RA 3QMTA 2YFOA 1B57A 1K7EA 4LS1A 2YYTA 3B0UX 4BI5A 4R33A 4FX8A 2TPSA 3EWZA 5EA9A 1GVFA 1KM1A 1KM4A 2ATSA 5L9FA 4DF2A 3ANYA 3BPWA 1OHLA 4LTSA 5LSMA 1NEYA 1XBXA 2QUVA 4AHPA 4NX5A 3GR7A 4M7SA 5F1UA 4RLIA 2AGKA 3TSDA 3U2OA 3UXAA 5K4XA 5DBTA 5E1QA 1RPXA 1VPXA 2JBMA 5AHNA 4UFLA 5BMWA 5C2XA 3NVTA 4GRSA 4MIMA 4ZL1A 1TPB1 2B7NA 2Z6JA 4MVAA 4PA8A 4N6EA 4GWEA 4JY8A 4TO8A 5D05A 5DXYA 1THFD 5AHFA 3P80A 5C6MA 3SGZA 2EGZA 1TRDA 3PWAA 1L6YA 1W8SA 1BTMA 5AYXA 5I3JA 4N4PA 4Z0JA 1DJNA 3PS7A 1ME7A 2QAPA 3NG3A 3P5YA 1P0KA 3O06A 4LOCA 1OX6A 3N34A 3B03A 1YPIA 4BWLA 4N9DA 2B4GA 4CCEA 4MJZA 2HTMA 2G95A 1KFJA 3WK3A 2V2HA 1OG0A 1KM2A 3FA5A 3FYPA 4H6KA 4JYFA 4LNYA 2NV1A 2Y61A 1KFEA 2DZSA 5D33A 5F4SA 4FNSA 3QSRA 5F2IA 1R2RA 3W1NA 4JDBA 1QPQA 2RKXA 3P5ZA 3EXRA 4KFNA 1K03A 2GOUA 3W72A 1VQTA 1SW0A 2ZBTA 5D30A 3HG2A 4XKYB 1ALDA 1TV5A 3SJ3A 5BW6A 3TUUA 2RDWA 3RMJA 3LLDA 2Y7DA 4EWND 2A21A 3RU6A 2FPTA 3QW3A 1KFBA 4JDYA 2HMCA 7TIMA 3V1PA 4XBKA 3BARA 1EB3A 2NUYA 4XBSA 3LV5A 3SY5A 4MZYA 3CT7A 5BNKA 2V82A 3WJYA 3FKRA 3QQ0A 1TPFA 2VFDA 2ZRWA 1H60A 4LS2A 1OX4A 4FX6M 2VKZG 3TQ0A 1DV7A 5K9XA 5AYYA 3C6CA 3W86A 1PS9A 3HBLA 1TB3A 1SSDA 5FESA 1FXQA 2E09A 3BO9A 1GEQA 2VEIA 5G2IA 1ZCOA 3NQDA 2VFIA 3Q58A 1H7XA 3SGUA 5FF7A 4NT0A 4WZHA 1J4EA 3HGRA 1NVMA 4PL2A 4RX0A 2GQ9A 4K38A 3HMJG 2XN2A 3MHGA 4S2BA 3W9ZA 1ZAIA 4AMAA 4DF0A 1WAUA 5K7JA 1T96A 3LI0A 3QFEA 1TPH1 3EXTA 3EKZA 2JKAA 1TRIA 3O6CA 2I9EA 4QNEA 2LLEA 4RZ4A 1W3IA 3W7DA 1PE1A 3TW7A 5CG7A 4DF1A 1JVNA 3P81A 2VEPA 3GDLA 2PURA 2CLKA 4O16A 1ME9A 1HFBA 3GNNA 4QISA 3S9YA 3GDMA 1LM1A 4JTGA 4BWLC 3AO0A 3F4NA 4AAJA 1GYLA 3B8DA 4NZFA 4QITA 3NPVA 2WSRA 2QCHA 4O1DA 1XKYA 3BW3A 1LDCA 1C29A 3TJLA 1G4EA 3AJXA 3QRHA 5AHEA 2ZTKA 3PF3A 5K2ZA 1FDZA 4H4IA 3QYQA 4DPQA 4WQ6A 4C1LA 3LHWA 3M9YA 3G1YA 2C18A 3CWNA 3VKJA 3UPBA 2QCMA 1TPDA 2DP3A 1JQVA 1TQJA 4FX7A 2CW6A 3DHFA 2D73A 1F05A 1LOQA 3SZ8A 2QCNA 2ZZ5A 4O57A 5EKYA 3IGUA 3DKJA 5DLCA 3LERA 4IXHA 3HGJA 3G22A 4N2YA 4LW7A 3S5ZA 3W1MA 4HPXA 2NWSA 3O15A 2Y6ZA 4Y96A 3QH2A 2ALDA 4XKYA 4X3ZA 4ZZ9A 3TFCA 3A21A 4UTIA 1SZEA 1KTNA 4X22A 1C8VA 5HR7A 3M6YA 1F74A 1W56A 2O7SA 3W1TA 3G1SA 2Z0IA 3NNTA 4MY9A 1M6JA 1VHNA 1TYGA 3A23A 4JTFA 2BX7A 3GB6A 2Y70A 3SSJA 1R2SA 3W85A 4O1CA 3PB2A 1TTPA 1EWEA 2VFGA 4WOZA 4TU1A 4Y90A 3UWZA 1A5AA 4A2RA 3W84A 3Q37A 3W2UA 3L65A 4XUGA 4LVAA 5LNWA 4UFHA 1EP2A 2V5LA 4R53A 4LV9A 2P1FA 2A0NA 4DXVA 3G1DA 3HPXA 1AW2A 3I7QA 4NZJA 3C2RA 3L5AA 5TQLA 4O14A 3WK1A 3PSVA 1LBFA 2FTPA 5FF0A 4JYEA 1W31A 3KVLA 1B3OA 5J5DA 3QF0A 2DZVA 3S1WA 1XDLA 1FDJA 4Q33A 4FIQA 5K3VA 4UTMA 3HJZA 3E0IA 5BMXA 3MUXA 5D37A 1ZALA 1GVSA 1S3HA 3KRZA 4HT3A 1QDSA 3DZ1A 4MY1A 2X1RA 3MBFA 3NDOA 3BW2A 3W1PA 3W87A 2VEMA 1BWLA 1RVGA 2R8WA 1A53A 4E2DA 4AVFA 3IIOA 3GR8A 3RLVA 4MYAA 5EMUA 1HG3A 4O18A 2ZFAA 4O1BA 3RK8A 2R14A 4P2VA 3T7VA 1HO4A 1Z48A 3EB2A 1KBJA 3TV8A 3NQMA 3TA6A 5CSSA 2YW3A 2BWGA 4ADSA 3CIWA 3CB8A 3EX4A 4UUIA 3C2OA 4QAIA 1MO0A 2CLLA 1V7YA 2J9XA 3S6DA 2V5BA 3P62A 3PY2A 2EKCA 1QWGA 1SUXA 5FEXA 1EX5A 4WXYA 1GZGA 4TX9A 1SR9A 3CM4A 1XUZA 2E5BA 4PEKA 1GG1A 4O1AA 5AOUA 3VNDA 4M6PA 1HL2A 3O16A 1AL7A 4MUZA 4EF8A 1YTKA 1OF6A 3UWQA 1I2NA 3DBPA 1FWSA 1OFBA 4H3DA 1ICSA 4JTUA 3UWUA 3CU2A 5G2WA 3LBMA 4LV4A 4GFSA 4Y6GA 1EWDA 3KX6A 3W1QA 4JTEA 2DJLA 3LHZA 1JULA 3W07A 5F1VA 2WO5A 1WYIA 5FEZA 3A22A 2ZQ0A 4UR8A 1TJRA 4ZQMA 3DKLA 3N19B 4HN4A 2E5CA 3F4WA 2XN0A 3QW4B 4FB7A 4PCFA 4LU0A 3P82A 2GVJA 4JTTA 5HMSA 5D09A 2PRLA 4RXGA 1UJPA 3W6YA 3H53A 2CLOA 1M7PA 1RR2A 2X1UA 2C15A 4XTDA 4DBDA 3GKFA 1ZAHA 4N9CA 1YYAA 3EX3A 3LX9A 5AC7A 1K7XA 4IPJA 1SW3A 3W7IA 1SPQA 1XBYA 3R12A 2DZXA 1OFAA 1O4UA 3EWBX 1GVRA 1ONRA 3NL2A 1EP1A 2NZLA 2QUTA 1J2WA 5E93A 3VE9A 2A2IA 4NNCA 4A22A 4E2BA 1OFOA 1SU5A 2PCQA 2Y85A 3RFAA 1K8YA 3LI1A 5KZMA 4JTLA 4LUIA 5H91A 3KVJA 3LLFA 3TQKA 2C14A 3TW6A 3Q2DA 3TXZA 2CWNA 2QCCA 3OG3A 1IXPA 5I3FA 4WY0F 1FY6A 1Z42A 2C0AA 2H8ZA 1W3NA 2VFHA 1SFJA 1G4PA 3QPYA 1YADA 4M7TA 5CZTA 1KTBA 3CHVA 3BLIA 3HGSA 4LRSA 1VGAA 4IMGA 4HIBA 3USBA 1N55A 1K02A 3MWAA 3QZEA 3PG8A 3W1RA 4O10A 2NXIA 3TMQA 1WA3A 3NQ8A 1AG1O 1L2UA 3RF9A 2CLMA 1S5VA 2B7OA 2E6DA 1I8JA 4S2CA 2QDHA 3M16A 3LXBA 3I6RA 3E49A 5BRBA 1JRBA 1OK6A 4KWVA 3IVTA 1YDNA 5EYWA 1UBSA 4NU7A 1IXOA 3YPIA 3M41A 4LS0A 5DELA 4HPJA 1ML1A 2YX0A 3O6YX 2WSYA 3UD6A 3WK2A 2PRMA 2H3DA 5KINA 3R5EA 3H55A 1SSGA 3QMRA 2X1SA 4WY0B 4UC5A 4L4LA 3NPXA 1GWJA 3G0XA 2H8XA 2C13A 3W2KA 2EF9A 3NZRA 4YMZA 3C2FA 1M5WA 3R13A 4AH7A 2CLIA 3BVJA 2JK2A 3PB0A 3O1NA 4EIVA 4FNUA 2Y63A 3W1UA 1AMKA 4TR9A 1KFKA 3QMSA 4WXZA 3B04A 4M6QA 2Y62A 3DXIA 1KW1A 1LCOA 1QPRA 3NQGA 4LY8A 3TIMA 1YPFA 1EIXA 3DFQA 1YDOA 5AN7A 1FWWA 3W88A 3W2LA 4U4MA 4JTJA 3BGJA 1LYXA 4I9AA 4IXXA 5DXXA 4B5NA 1AK5A 3OVQA 3DFSA 1GTEA 3P7YA 1JCLA 5CPOA 2E68A 5LKYA 5FI8A 3IVSA 1IIGA 1KBIA 3KVMA 4UFKA 3L0NA 4AWSA 3MYOA 3PC0A 4IX0A 3IIVA 1OYBA 2O7QA 3UPWA 4O53A 4IWWA 1X8FA 4IMCA 4FXSA 3B4UA 1HTIA 2GQAA 3GXPA 5HQEA 1L6SA 3HOJA 2E6FA 2Q3OA 1JCXA 4Z1AA 4JS3A 1FCVA 2BZNA 4JNMA 2V8ZA 2AQWA 2PE4A 5TIMA 2VFEA 3TDFA 1LLZA 4Y8FA 2CLFA 1KLZA 4UFMA 1QPOA 3I7RA 2QJIA 4FF7A 3PAJA 1MEIA 5LNUA 1FWTA 3NL6A 3ZWSA 3B05A 5LNVA 1J5TA 3DI1A 3MI6A 5K9CA 1XBZA 2V9DA 1MSSA 1YXYA 3BK0A 5KMYA 4GUHA 1WXJA 1YTEA 1XXXA 2NV2A 3HF3A 3QPZA 1TTIA 2CLHA 2DU2A 4O0KA 5EL1A 3O63A 4HNVA 3KVKA 3G3DA 3W76A 3LHVA 2QJHA 1HO1A 3G1HA 3S5YA 2Y7EA 1VH7A 1Q6RA 4MPQA 1Q6QA 4G1KA 1I4NA 3TKFA 2ZZ2A 5KITA 3FFSA 4WY0A 1TJPA 3PR2A 1LZOA 5CKSA 2G96A 1JUBA 4QM1A 3UQNA 4XZ9A 2QCEA 1Q45A 4IGHA 4AHQA 3EWYA 3G18A 3FJLA 2IQTA 2NXHA 3ABQA 3W7MA 1GG0A 2FPVA 1ME8A 2GVLA 3WK0A 3NPWA 1RQBA 3I7SA 4AEOA 3EX1A 3LCIA 1JR1A 1JCYA 3ELFA 4FXRA 3BG9A
chains in the Genus database with same CATH superfamily
5FAJA 4MB3A 1QI4A 1W1VA 3CIXA 1Z89A 3LCLA 3ZVIA 3WF4A 2DIEA 1I75A 5JBEA 1VKFA 4PCPA 3WN6A 3MWCA 1OZQA 3HIJA 4NJHA 2OLSA 1BYCA 5AHMA 4L4MA 1K4GA 1I2PA 2DUXA 3VIKA 3MS8A 4H2HA 2Y1HA 3L67A 1W1A1 2IPJA 3PWGA 2W92A 3LQGA 4XIAA 3BJTA 3KRBA 3IRDA 3N2CA 2INEA 2PCEA 5DANA 4AZGA 3VI2A 2V30A 1QO2A 2DSWA 4L1GA 3VGGA 4WJXA 1QFEA 3IV3A 3FEMA 3OU8A 5EMLA 2IKGA 1YE4A 4UTWA 1C7TA 3N12A 2XFWA 3F1QA 4AWTA 3KS5A 4IF2A 3PTDA 2FTYA 2PDGA 1RPKA 3RYSA 5FJUA 1VYPX 5BXSA 3GXTA 4PBGA 4ONVA 1QI3A 2V2CA 1MW0A 3CASA 3SFKA 4QX4A 1A0CA 1TPUA 3QY8A 3QPEA 1R3QA 3RG6A 3WD0A 2I16A 1TPEA 4N7QA 3QY6A 3NURA 3GWQA 2X2GA 2C1GA 4O17A 3TSMA 2GL5A 3OZMA 3LRKA 5DEZA 4MUPA 3UXIA 1H50A 5I3GA 1F8MA 4XZLX 4KFPA 1IGSA 5AVNA 2JIEA 1NDZA 2J24A 4RL3A 5HUPA 4WX2A 2HS8A 5C9RA 3RDKA 3WCZA 4PFMA 1H7WA 3BGAA 2Z1SA 1X39A 2D0HA 4A3HA 4YJ5A 3PUDA 1LQ2A 1CGYA 3DFNA 3BSHA 3O8AA 3JU2A 3VE7A 2GJRA 1KC7A 1H0IA 1OADA 3GFZA 3IGXA 5HWJA 2WAGA 5JH2A 3SCQA 2REQA 4S3CA 3UPMA 4CGTA 3OBAA 2XG9A 2JF7A 5DMYA 4NKCA 1HVQA 2ZC8A 2FB2A 1TWIA 3CTTA 1MXSA 2Q8LA 4E2VA 1HKIA 3N6QA 4WDUA 1QNSA 2ZRVA 2GUUA 3IIXA 3AUJA 3CZGA 3OBKA 3TR2A 2VR4A 5HMFA 1UH4A 2QT3A 3HG3A 4UMCA 3S1XA 4AW7A 3DGBA 1JYVA 4PTVA 2QJMA 1FBAA 1TPVA 3W70A 4RNIA 2XHYA 4IJCA 1OJXA 1H2JA 3ZVHA 1W9VA 4KERA 5C5YA 1QW8A 4UTKA 4B5WA 3WQ8A 2P10A 1K8XA 1JDCA 4GY0A 1DIKA 3RNDA 1ZBKA 2BFGA 1GEHA 4DO4A 1XI3A 4HTBA 3G5EA 1SFLA 3H22A 3QSTA 1LT8A 4IQEA 4JNZA 3QHMA 4BI6A 2XFFA 1DJHA 2Q3RA 4QRNA 1PCWA 3AICA 3TK7A 3DH7A 5HPOA 4AZCB 4HCLA 4GBDA 3T0CA 2BG5A 2HNHA 4EPBC 1FWRA 7PTDA 1XC6A 1DKWA 4B5SA 4XO7A 4AVOA 1ZAJA 3EYPA 4I8DA 1E4MM 1CX9A 1HUVA 3CEUA 1SZFA 3W2JA 3NQFA 3UA4A 1O1ZA 1YRRA 4CQAA 1W2PA 2PDLA 2PSNA 1TR9A 1R3TA 5FCZA 3VO0A 1ZPTA 4NNAA 3BANA 3T40A 3PTQA 1XGZA 2FDMA 4GXWA 2XJ7A 3AXMA 3KBMA 1TKKA 1GKRA 2I1OA 1PZ0A 3AHVA 3WZ0E 2X0HA 3FXGA 5K9DA 1H5YA 3GNPA 1H1YA 4H8UA 3IJQA 1JF5A 1X7IA 3U0HA 2E28A 4DWSC 5CZJA 3EA3A 1LRTA 4H7CA 3RM4A 3SUUA 4B2DA 4AMCA 1XSJA 2EQDA 1B0IA 5CSUA 1EEXA 6REQB 1RY0A 3C0SA 2NLIA 1E0VA 4HHMA 3WFAA 1OX5A 3QZAA 4FZIA 1OC6A 1PYFA 4PTDA 3SO7A 2TMDA 1XYMA 3L12A 4FNTA 4AC7C 1P1MA 1FXPA 3EWXA 2WLYA 3CQKA 3VD5A 5C2GA 1OIMA 2EPOA 1X7FA 3S1VA 3TTQA 4TVUA 4FP1A 3UETA 2VP8A 5CPQA 1MXGA 4GFIA 1FWEC 1M7OA 3UXLA 4R7JA 1VR6A 4HMDA 1CGUA 1VCGA 4KGJA 1HT6A 1W91A 1P7TB 3A4XA 3QKEA 3W1LA 1QNOA 1A49A 5XIAA 3G0UA 1E51A 4BF9A 4K39A 3QQWA 4BZYA 4KMQA 9CGTA 4MZ8A 4UFIA 3P93A 4OBRA 3MO7A 2ZUWA 2GGHA 2EEXA 1U83A 2OSXA 2BTMA 1Y8BA 1QBBA 4AIOA 5CPMA 1ZBWA 2IQ0A 1MQQA 3B8SA 1E9YB 3VOFA 2BHUA 1DJWA 1X98A 5M03A 1J10A 2CZ5A 1FWCC 3CH9A 2C19A 3RITA 3V5OA 2EBNA 3TJIA 3W01A 3QYSA 4O19A 2FH6A 3VPLA 4O1EA 4KWWA 2GGGA 3KCOA 1JRCA 3ITVA 1E5JA 1Q8JA 4M6UA 2VX4A 2XN1A 5LA0A 4OBTA 4YTTA 4L64A 3WF3A 1R0MA 4GGHA 1EP3A 1HKKA 1IHIA 4RCXA 4J40A 3OEXA 3LDVA 1GOMA 3K46A 2RDTA 2DT0A 4UMBA 3CB3A 3D0CA 4GH3A 3W7GA 2TYSA 3BJFA 3FGCB 2BY2A 3W7OA 1P6WA 1J0ZA 3BL3A 2CETA 2YXXA 2VFFA 3IJ6A 4GQGA 2PWHA 4O50A 4QIUA 3W7QA 4GC4A 2OWCA 1KBKA 3OG2A 3VX1A 2ZC1A 1AUSL 3AYVA 4PE8A 2WMKA 3THQA 4AZHA 1ZNNA 4O0ZA 3VKDA 1TG7A 2BXYA 3PN8A 5SWUA 2H6RA 4PMUA 4GX9A 4HZ6A 2I56A 2XM2A 4J5NA 2R82A 2Z1VA 1TPWA 3NZ1A 4WJEA 3DBNA 1AQMA 5G1MA 4AYGA 1U1UA 3GH4A 4WGXA 1PX3A 5I00A 3GC5A 4GINA 1RLDA 1Y7VA 3STGA 2ZZ1A 5DX7A 3PPGA 8RUCA 4U10A 4K8EA 4DO5A 2FYMA 4E4PA 5BCAA 4MSSA 3HPZA 1POKA 1PAMA 4GACA 3SN0A 5LHEA 2JKPA 5CSYA 2JFEX 4YXGA 4CKQA 3PZQA 3LCFA 5EGRA 4S3AA 3OZPA 3WJXA 3AAMA 3GE7A 1DQXA 4K37A 1BVNP 3INPA 1ICPA 4DO7A 5JU6A 3VNLA 4ATWA 3G1VA 3VMNA 4DJEA 2ZRUA 2CLEA 1V4YA 5A2AA 1TIMA 3EMQA 1O94A 1J8VA 3GXNA 3GDTA 3U7BA 3ZFHA 1XD1A 4GVFA 4XO6A 4H00A 4KFOA 3B3DA 3E0VA 4HK7A 4FOKA 1XIFA 1H62A 1CB7B 4C65A 3ARWA 3TX9A 1VPYA 4RPPA 3WBAA 3QC0A 4L7ZA 4AF0A 1DWHM 5LZLA 1BWKA 3KWSA 4O8RA 2BHZA 2VI0A 4Z1BA 4Q4KA 3SCUA 3IUIA 1BEUA 2G5WA 3W2NA 1SO4A 1I6NA 1PX4A 4ACYA 4O28A 3MHUA 1DTUA 4JTIA 1PSCA 2A3CA 1TJ0A 1M9HA 1ZFJA 3L2IA 1TVPA 3QV6A 3TJXA 4DELA 1VYSX 1AA1B 4NVTA 4PUMA 2XM1A 3GU2A 5F2LA 1TCDA 1W5PA 3PJTA 2RFGA 3DFYA 2KAUC 2VUNA 4GGBA 1DWIM 2ZKMX 3LN3A 4TOQA 1XDMA 3UERA 2BOEX 1VFLA 1I45A 5HNUA 3M7WA 4M81A 1EIBA 4OZOA 1WQ5A 3LCXA 3RHGA 4EANA 4J28A 3BAKA 3KBVA 3VDAA 6ENLA 3NUKA 3WJWA 3PM6A 1XUUA 4JTCA 1CXHA 3F2DA 1GK8A 1KXVA 1YMYA 2OEKA 2Y0FA 2CIPA 1W5QA 5CGQA 1W54A 2WJFA 3GAKA 1HN1A 3BOFA 5FJJA 4UXDA 1HL9A 4H7ZA 4UTTA 3TOPA 4HA4A 1PO9A 3E9AA 5FEWA 3E38A 3WQPA 4JXCA 3R11A 2FIQA 3PBYA 4DLMA 3QV7A 1OK4A 4JGDA 4FO4A 1Y65A 4JHZA 1SZNA 3TWBA 2WHJA 5C9XA 1KRBC 2IQDA 2VOTA 1MVYA 3STCA 4GQBA 4MB4A 2DVTA 1XYLA 5EU9A 2OMAA 3L0KA 1F3TA 1JUKA 2C6QA 3WH5A 3ZXWA 1C8QA 3FW6A 1ADOA 4F2TA 3BZGA 3E6EA 2GQ3A 4HSNA 1PHWA 2V2DA 1PIGA 3GK0A 3AWNA 2OEMA 4XAFA 1ONWA 1JXJA 4RDVA 3EBVA 1TV8A 3VMPA 4AB4A 5BU9A 3N17A 3RLUA 2PGRA 2VEKA 1JI1A 2W62A 8A3HA 5CC6A 1KQYA 1NQKA 1JPIA 4LYQA 3AZTA 3P60A 2BDQA 4H7VA 4H6RA 2B0MA 5H8MA 1E71M 2OGJA 2GWGA 4IHCA 3QOMA 4URIA 4HK6A 2DQWA 5AY7A 2WJDA 4HTYA 4LALA 4F2UA 1T5AA 3W7JA 3K13A 4EAMA 4DPPA 1LP6A 1UCWA 2ZUVA 3ZR4A 2O56A 1KBBA 5AZ1A 3KZPA 4Z0SA 5EBUA 4M8UA 3TROA 3M0XA 2FFCA 3ABRA 3LB0A 4ZCWA 3PZ9A 1ISYA 4FNRA 1KNWA 3CYJA 1E72M 4TQTA 1WDWA 4FOUA 1XYBA 1MW1A 2ISSA 2ZA1A 2J66A 2O92A 1HKMA 1FCBA 1PPIA 4CQBA 3RAOA 3C0JA 4HN8A 3B06A 3CLMA 1I2OA 2E67A 2VCAA 2GLKA 2C16A 2YPIA 1W37A 4Z2HA 1G67A 2ZZ7A 1T7LA 3WLNA 4HU3A 4Z42C 3U57A 1AQHA 4PUJA 1BVWA 5A6BD 4RZ5A 5LNRA 3DFTA 1JYWA 3CL7A 2QF8A 2WMJA 3NQ6A 4JYDA 1FP9A 4MWAE 1OT1A 4NQ1A 4H9YA 2WWCA 4LUJA 3W7RA 4J7RA 4HQVA 2PTZA 3TAKA 3N2BA 1FCQA 2OX1A 3CZ8A 4O54A 3MV01 1JNDA 2Y89A 4OV9A 4O11A 3GDKA 2W3ZA 2YDRA 2BSLA 2ZRYA 3ES8A 1H7RA 3E2VA 4NAEB 1FCUA 4TMCA 2C7FA 1WX0A 2F7FA 4UNIA 3AIQA 5FEPA 1JF6A 3IJDA 1UMLA 4W8AA 2P0OA 4WUIA 3E12A 3BAYA 1PVNA 4HPGA 3P8IA 3W73A 7REQB 4AQLA 2Z7GA 3QEZA 3VGBA 2G3NA 4WR3A 3A5FA 3I68A 5FF4A 3MCOA 4FPSA 1E0XA 4GZIA 5GQBA 3LXAA 3GVGA 1QPNA 1EO7A 1E3ZA 1ISVA 3LMYA 3UG4A 1E43A 5DY3A 1M01A 5LYRA 4HHLA 4W88A 2OYLA 4WGHA 1U22A 2VHLA 3AMGA 4BEUA 1ZU8A 4AXNA 1XHGA 5T9BG 3AZSA 3F5LA 2R1PA 2VC6A 5EPDA 4XZBA 4IP7A 1XX1A 4HOXA 4TUFA 2D20A 4OUEA 3CUJA 2UV8G 1QBAA 1ZB5A 1Q3NA 4BS0A 4KKXA 1OFDA 3R1ZA 5CPLA 1TZZA 2E9BA 5LNSA 1WKFA 2GWNA 4R7WA 2ZA3A 1TTJA 1JDAA 2PTWA 3ZS4A 2PDXA 3WLIA 2TAAA 3BG5A 3VGDA 2DJXA 1PTDA 3T2OA 3WQEA 2YFOA 1B57A 2XIOA 1H3GA 1T41A 1GUVA 4Z2GA 3FCPA 4QP0A 5EA9A 1GVFA 2ATSA 1TZ7A 2B31A 4XVEA 3SN1A 1OHLA 2PWEA 4AHPA 3GR7A 2PP3A 3KWXA 3TYAA 2MUCA 1JIBA 3PJUA 1GVEA 5E1QA 2IMRA 3E2SA 3WLHA 1VPXA 3NSXA 4DAFA 4H6EA 5C2XA 3NVTA 3L4WA 4O1FA 4TO8A 3UCDA 2DUZA 3OZYA 4H9UA 5AHFA 4RE4A 3LGGA 3EWCA 4JQ2A 1TRDA 3PWAA 1BYBA 4D6IA 4B15A 4Z0JA 1DJNA 1ONXA 3PS7A 3NG3A 2WM0A 1UC4A 2A3BA 2WYSA 1JDDA 4MNMA 3EDJA 3ARTA 1ZTVA 2HV5A 4MJZA 3HN3A 3FVMA 1KFJA 3BLDA 3TYBA 2V2HA 5CBJA 2PLCA 3QGKC 4Y9MA 1SJDA 4JYFA 2CKSA 1LJYA 4AEFA 3OP2A 2DZSA 1E4IA 3BJSA 5F2IA 4JTDA 3H4GA 1QPQA 1QATA 1K03A 4QG6A 1IEWA 2ZBTA 3RPMA 4R27A 3SJ3A 3HPAA 5BW6A 2RDWA 3DG3A 3GFYA 2HK1A 2A21A 4J3SA 3ALFA 3QW3A 1UR8A 4FF5A 1ECQA 2HMCA 3CV6A 1HP4A 2NUYA 2RGLA 5GNXA 3WELA 4XZHA 3CT7A 5BNKA 5C8BB 2V82A 4IM4A 5EFFA 3N11A 4LS2A 4XVDA 1DV7A 4H6QA 2Q71A 3W86A 1PS9A 3HBLA 1SSDA 5FESA 1FXQA 1DWAM 2WZIA 2VEIA 2HDJA 2V5KA 2IPGA 1E1CB 3Q58A 2VFIA 1H7XA 1V3HA 2ZWZA 3NZGA 4K38A 2XSAA 2XN2A 4S2BA 1W3HA 3O0KA 1WDSA 3BLPX 4X61A 4AMAA 3HV9A 2D23A 3R0KA 3IAPA 4LYKA 1TRIA 3O6CA 4RZ4A 1W3IA 1ITCA 4H9TA 4J3TA 4Z1YA 1PE1A 2WW5A 4DF1A 2VEPA 3GDLA 4DWSB 1P6BA 7ENLA 1HFBA 3GNNA 5H8UA 4BWLC 2AMGA 1TVLA 2J74A 1JGIA 1UKOA 5I09A 3K1DA 3VIPA 3GNXA 4US5D 1UBPC 2VR2A 3UT0A 1W1TA 3IARA 4DNMA 4KT2A 4EXAA 3AJXA 5AHEA 3IGHX 2D3LA 4WQ6A 3T2PA 5XINA 1GQLA 2WLZA 3JUGA 3KS6A 4JPGA 1EDTA 2ONEA 1TA3B 3M9YA 3G1YA 2AKZA 3CWNA 4JQ3A 3GR4A 3UPBA 2DP3A 2GYIA 4Y9PA 5JQ9A 2YJQA 2PF0A 4ECLA 2D73A 3MCMA 3SZ8A 4NYUA 1JZ6A 3OTRA 3IGUA 3DKJA 3LERA 4REQB 4IGNA 2AL1A 5AC5A 1SZRA 1OGSA 5TAOA 3W1MA 3N15A 4TVDA 2ALDA 3N29A 3TFCA 1PIFA 3A21A 1Q4NX 4UTIA 3VUSA 1O12A 4GCXA 3WD2A 3B8VA 5HR7A 3HTWA 4ZOEA 3N25A 1EL3A 1F74A 2O7SA 3W1TA 4C6MA 1JZ2A 4ZO9A 1IT0A 4JTFA 5M2FX 2E40A 4O1CA 4FR1A 5BWFA 4XAGA 1TV4A 2R9RA 4WOZA 4L56A 3N9KA 3SRHA 4YIWA 3W84A 1V7AA 3Q37A 4IIEA 3L65A 2V38A 4LV9A 2P1FA 1SFSA 4LF1A 2OWWA 3IPWA 3HQNA 3UJSA 4IICA 3L5AA 5TQLA 3O9NA 2FTPA 1US2A 4JIRA 4WJ8A 3WH8A 1FDJA 4FIQA 4IIBA 3HJZA 5BMXA 2HWGA 2J79A 4Q8PA 4H8VA 3KRZA 3DZ1A 2X1RA 1U1JA 3LENA 4K8GA 3RO8A 1RVGA 5IOBA 3IIOA 4MWAA 4O1BA 3RK8A 4GKTA 4P2VA 1HO4A 1W3LA 3EB2A 1F8IA 4DJED 1YBQA 3NQMA 3AROA 2YW3A 3FEQA 3H4WA 1B2YA 5A8OA 4OFCA 3EX4A 3C2OA 5FL0A 3H2CA 3S2NA 4ZSUA 2CLLA 3NGFA 3PY2A 4AD5A 1Q2RA 1W1IE 3FV9A 1EX5A 1YNQA 3CM4A 3ZIZA 1M04A 4O1AA 2PDMA 1AJ0A 2AMXA 3GD6A 4D71A 2QMKA 1HL2A 3O16A 2DSZA 3SIMA 4MUZA 5FL1A 3UWQA 1OF6A 1KO0A 1XLLA 1I2NA 3R43A 1OFBA 5JH1A 4JTUA 2BXZA 3CU2A 1UWIA 1TVNA 4LV4A 3R8GA 5A6KA 3CV1A 2J7GA 1VENA 3BICA 2DJLA 1UP3A 1JULA 2WQDA 1WYIA 4UR8A 1TJRA 1Q7QA 4W87A 4LX4A 1JPDX 3MV11 3ITGA 5EMJA 3GC4A 4JTTA 3W6YA 1V02E 3FJ4A 4PMZA 3W02A 3DC8A 2GDQA 2UY2A 4Q8QA 2C15A 5I78A 3SUVA 5C9WA 3GKFA 3ARXA 4N9CA 3S6OA 1TV3A 4KPLA 1K7XA 1PWMA 4JKKA 4NIRA 3S9ZA 3R12A 4JOMA 2F8QA 1O4UA 3EWBX 3CK5A 1QPKA 1HKWA 2VX7A 3LPPA 1J2WA 1QW7A 2A2IA 4NNCA 1SU5A 3RFAA 3WLLA 3LI1A 4F3HA 1VAHA 2C14A 2QIIA 2ZX7A 3Q2DA 1Z32X 4ML4A 5CZKA 4I5UA 4W7VA 2CWNA 2QCCA 2NQJA 3QLLA 4LYRA 4KESA 2ZXDA 4GYFA 2VFHA 8XIAA 1G4PA 4M7TA 5CZTA 3K1GA 4PGLA 3CHVA 4NY2A 4KRTA 3VD4A 1AJ2A 3W81A 4IMGA 3WFLA 2OQYA 2J7BA 3MWAA 1K02A 3QZEA 3PG8A 3W1RA 4O10A 2NXIA 3TMQA 3RF9A 2WZEA 4KCUA 5AZ0A 3BUVA 4H01A 3VNJA 2E6DA 1I8JA 2QDHA 2GJPA 3D5HA 2XGBA 1LL6A 4GZ7A 4X0VA 3MO4A 5EYWA 1XCWA 4WHBA 1UA7A 4LS0A 5DELA 2WKGA 2PRMA 1J0JA 3VUPA 2X1SA 4BQ2A 4HMCA 2H8XA 4YMZA 4AG0A 1FWIC 4J2MA 4KS0A 3O1NA 1JAEA 4A8LA 2H9AA 2XH7A 3C3UA 2INZA 4M6QA 4DB7A 2C0HA 4E4FA 1YPFA 4OECA 3AXXA 1PUDA 3AI0A 3UZWA 1YDOA 5AN7A 1FWWA 4C60A 2G41A 4JTJA 1OZMA 4IIHA 1PX8A 3ECQA 3DHUA 1E55A 4WDXA 1DE5A 3VD9A 4BA0A 1GTEA 2BGQA 3PNZA 1XINA 1JCLA 2E68A 3QFWA 5FI8A 4GVHA 4LAOA 3KVMA 4UFKA 4AWSA 3SUWA 1E9ZB 2GSEA 3IIVA 4XG1A 2FKPA 3F5JA 3TZNA 1QHPA 1M3UA 4YHGA 2FGLA 1LT7A 4O53A 4NAEA 1BQCA 2P3ZA 3B4UA 4Q4MA 1HTIA 3RM8A 2I7GA 3GXPA 4DYJA 3UG5A 2Z2AA 3S2LA 3L4ZA 3E2RA 4NAFB 1V6VA 3UYIA 3TDFA 3W26A 3QV8A 5T91A 1KLZA 4G2DA 1QPOA 3ITYA 2CLPA 3ARRA 4FF7A 1TWSA 3NDYA 1HP5A 3ZJ7A 1L2QA 5HXMA 5LNVA 3S46A 4B4FA 2PA6A 3MI6A 1UWAA 1SJAA 1MSSA 3BK0A 2G3IA 2J7DA 3UG3A 4AD3A 1WXJA 4Q4RA 2YDQA 5CEWA 2NV2A 3HF3A 5CBBA 2FZMA 4HNVA 2C71A 3G3DA 3ZSTA 2CXEA 4KRUA 4D6DA 5HNNA 1HO1A 1J01A 3OYXA 3QR3A 1Q6RA 2OO0A 4G1KA 3M0KA 4K68A 4I6KA 4QGCA 1Q4WA 2G96A 1UH3A 4MG4A 1ONEA 1UKQA 3B0XA 3WQDA 2QCEA 1Q45A 3B9AA 4IGHA 3PZVA 1S2WA 1UWTA 2IQTA 2NXHA 4EE9A 3W7MA 4W8BA 1GG0A 2FPVA 4FMVA 4J1OA 1Q66A 3NPWA 3WUEA 1RQBA 2PD9A 3I7SA 4C6CA 4I9MA 3UXKA 3U9IA 3ZJ6A 3FX4A 4W93A 4FXRA 5DMLA 2OYKA 3LCHA 2PWDA 4QSFA 5IM51 2D0FA 1JFHA 4WSKA 3NXFA 1UR4A 1B4KA 4C6DA 4M56A 3ABOA 5G4HC 2DGAA 4EF9A 4YLWA 2B7QA 4TIMA 1Z69A 1G7UA 5A8QA 4D6JA 3M0ZA 1T0OA 4GUIA 3B9OA 3NA8A 4CLMA 4UTUA 4ASTA 4PCNA 1ADSA 4XZIA 5FIPA 3ABXA 1VJIA 2CWXA 3ID7A 4G6CA 4PSRA 1XH0A 2AQOA 1X1NA 1EUAA 3IJ9A 3UXDA 3GYEA 4P8UA 1GVYA 3GG7A 3T0TA 4UOJA 3WLTA 1GVQA 3K4DA 4AZ5A 1JCTA 4P5UA 3L5MA 4AX6A 3M4HA 3NWRA 2A7PA 1W1ZA 1ZHAA 4PL1A 1OCJA 2BVWA 1BLIA 2A5HA 1MFVA 3QJAA 5A5WA 1C91A 1FHUA 5I6SA 2VGBA 2ZRZA 2ZICA 4YTQA 1H7OA 1W9PA 3V5CA 1Q6EA 3K8LA 1KR1A 3MMWA 4KCVA 4MYXA 2CERA 1VBHA 2Z4GA 3KTXA 4U5KA 2O0TA 2QQ6A 2O9TA 4QJ1A 3QXBA 3IEBA 4GXMA 4QEEA 1P0NA 1LQAA 3NQ7A 3M47A 4ZXOA 1EEPA 1TMLA 2J9ZA 4K1WA 3THCA 4NG3A 4B9YA 1GYMA 4HMEA 2Z1XA 4ORMA 3ME3A 4GG9A 4JIHA 4M3PA 3TWAA 4FI4A 1TFVA 1QAPA 2X0SA 3KRUA 3C8FA 1L6FA 1FTXA 3N73A 2YBUA 5L6UA 1TV2A 2F6XA 1CGWA 4A21A 1DJYA 4JHMA 1UQYA 2WNZA 3CIVA 1NAL1 5I2UA 3WD4A 4ACZB 2EPMX 1X97A 3WLPA 5BRQA 4JTAA 3AMKA 4I5RA 3LLXA 2RJGA 3T0BA 1A5BA 3LTSA 1R30A 4DUOA 1NELA 4QQUA 3L4YA 3T44A 3N6HA 4PZVA 3LXCA 5IFTA 3GG1A 3O07A 1V02A 3QLDA 1D3CA 2XVNA 2XWEA 3GTIA 1KXHA 3W7NA 2ZIDA 1E6SM 3ORWA 1P0EA 3LOTA 3CMGA 2YA1A 1R46A 1H51A 3M43A 3MDWA 2Y7GA 4PMQA 1ICQA 2OSWA 4CQ8A 4CCDA 3WDHA 1D8WA 5D2VA 2HS6A 1HJSA 1HJVA 1A5LC 2HXTA 4RNFA 5ECVA 4U31A 1DJQA 1UJQA 2OT0A 1WO2A 3PBGA 2X8RA 5AECA 2BGSA 1KCKA 3S9IA 3FJNA 1UR3M 3C5QA 1E9IA 4EXQA 3UFYA 1DQWA 1RZMA 3EKLA 1RLCL 5CLWA 1H61A 1VBJA 2FZ8A 2F38A 4LYPA 2WCAA 2ZA2A 4AZIA 1O95A 5EMMA 2I14A 1F3WA 1E3XA 3LBOA 3I4EA 3OLIA 3VIFA 1FWGC 3MSDA 3WQCA 1SR0A 3H26A 3KLLA 4O15A 3O6DA 2ISVA 3CJPA 3HPSA 5HATA 2WC4A 4N6FA 4S38A 2RHGA 3A3WA 3M7SA 4IX2A 4CD6A 2Q02A 1KTCA 4DX3A 1EA0A 3GG0A 3LBCA 4ADTA 3BH4A 2X2YA 4JKMA 5A3HA 4Q32A 1LORA 1NOUA 2CHOA 2R24A 4PC8A 1GTHA 3C2VA 2QPUA 1GHSA 1XIJA 3FOKA 3UZJA 3UY8A 3VIHA 1VCVA 3EA1A 2RH9A 2X09A 2WSQA 4P7NA 3GAYA 2DT1A 1J6OA 3MA8A 5A8PA 3DUGA 3VNIA 2ASHA 4D2JA 5IBXC 1Z8AA 3ABZA 5DCDA 1DIOA 4IOTA 2EKGA 4PRRA 4V1XA 1B9BA 1MYRA 1UASA 1RXOB 4A8RA 1LLWA 3CUFA 1RY8A 4RXFA 2FDSA 3A64A 4J9JA 3PFRA 1ZBVA 1M03A 4OV4A 4L6HA 2J27A 1O60A 1UYQA 5JVLA 3TQVA 1Q6LA 3BTNA 4H04A 1UA3A 2A4AA 4XQ6A 2VX6A 4UOQA 3VZYA 1E6QM 3HG5A 1A5CA 1K1DA 4OE7A 4A6GA 3L4UA 4IQLA 4RKAA 1E1FA 3BLEA 1NWTA 4NUWA 4IMDA 3DFOA 3RUBL 1B1YA 1UIOA 4LVGA 3F2BA 7ODCA 2VC7A 3S5OA 2P3EA 2ZUSA 2Z26A 2GK1A 3A9BA 4JQAA 1T8XA 2B81A 4AY1A 4AIEA 3CZLA 3EOOA 2HPIA 1EOMA 4V1YA 3M5YA 2OZ0A 3PJXA 4I7VA 1LUCB 3G6LA 1B3ZA 1DJIA 2ISWA 2PD5A 4HZMA 1XRFA 1XCFA 5DCBA 5C70A 4RE0A 3ARQA 2QCFA 3RLGA 2EXOA 3TTOA 3DDMA 3AZRA 1BSIA 3S8HA 2QCDA 2JKEA 4Z08A 4IL0A 3GXMA 3M46A 1UUOA 2ACRA 1XLCA 2F6KA 3W1AA 2HBVA 2YOCA 3KAOA 5GNYA 4YS1A 3WMCA 2Y24A 4EPDC 3QY7A 4WSJA 2V63A 3WBEA 1JUEA 1ZJIA 2GUYA 2CHNA 3CV7A 1QJWA 1Y0EA 1U5VA 1W17A 3N3TA 2IKJA 5BU6A 1WOBA 3OVGA 3G1FA 2ZZ4A 2G97A 1OM0A 3CUHA 3C2YA 4MDOA 4GI6A 1CYGA 1F3EA 2X1TA 3USZA 1F76A 1JL8A 3NO3A 4X63A 4C6NA 1TE6A 3QBUA 3BCFA 4G7EB 5H1WA 1R9YA 1S5WA 4JTSA 3IJ7A 4CQ9A 6CGTA 3CMFA 3NPUA 1QNVA 4JICA 4G9PA 4NJKA 4ZVJA 1V79A 3LCGA 1RBAA 1XISA 4LAMA 5G1TA 3U4FA 4K2SA 1IYXA 1VRDA 3BSGA 4HK5A 4JZ5A 2YL9A 2E1DA 1P5BA 3T0AA 1BKHA 2ZUUA 4C1KA 3B9EA 1CGXA 2W6RA 3C52A 4F2BA 1GVOA 1JD7A 4K8HA 5T9CE 1D7KA 4LBRA 2QPXA 1EJRC 4IFKA 3TYEA 3EPNA 2FJKA 1J96A 2EG8A 1FFQA 4HNTA 3S42A 1P4CA 1KFCA 1N2VA 2Z6IA 1SO5A 1V6XA 2PZNA 1W5NA 3DU0A 1KM6A 1XLMA 4J2PA 1BVZA 3AIVA 4MF4A 5D9MA 3V75A 1PKMA 3ITCA 3M5ZA 2YIHA 1IF2A 2GJLA 2VRJA 4DEFA 1I9CB 1I0DA 6XIAA 1XKJA 1KR0A 2J77A 4N02A 1J0KA 2OB3A 4C1NA 5D2XA 3JS3A 3PZGA 5FD0A 3NQEA 1N8WA 3BMXA 5DMNA 2OZ3A 2Y5JA 1YPXA 5G1YA 3RRAA 3LS9A 3GX9A 3Q65A 3W23A 4C6BA 2UWFA 2C91A 3DYOA 3ZM8A 5FF2A 1PHQA 1OINA 2DVUA 1O7AA 3S1GA 1JNEA 4YCOA 2A3AA 2WZHA 3BG3A 2QUNA 4JCMA 2V81A 3P2VA 3WLRA 3UZ5A 1QOXA 2VDIA 3HO8A 4DZAA 2QGHA 4ZGYA 1KGWA 3TMLA 3TE9A 1G9HA 1R3VA 4E8DA 4JBRA 2J47A 3CUIA 5A94A 2CBIA 5LGZA 3FJ6A 4M19A 1BF6A 1XIEA 2DFAA 3G1AA 2Y7FA 4DI8A 4NASA 4Y9AA 4YPJA 3NR0A 3M5VA 1L8NA 1SQ7A 2FFIA 4ZMGA 1IQ8A 3SJNA 3SQSA 3ZLFA 2WNQA 2AL2A 5C54A 1IZJA 3AJ7A 4A3QA 1LOSA 3LK6A 2QCGA 3S83A 2PUZA 4S39A 1VD6A 3SCNA 2G50A 2V3GA 1BWVA 4M5PA 1GORA 2H3BA 2QPSA 4NZCA 2AGTA 3QHOA 3O3RA 1WDDA 2J7HA 1SO3A 3ANVA 1CPUA 2QCLA 3M0LA 4JX6A 3ZLHA 4U2ZA 4ERAA 4MOZA 3PUOA 1P0DA 2IXUA 2PGWA 2XVKA 4D8LA 3MY9A 2V69A 1W9XA 4GI8A 3HV8A 4XAZA 4QEHA 1HJUA 4I8YA 5A8MA 5C0QA 4DBEA 1EJSC 2BASA 4JFWA 4LT9A 5U4NA 4HCHA 1DORA 1X6LA 2C3ZA 4ZE5A 3CQ0A 2UZ9A 3NIYA 5FOOA 3CWOX 4CVWA 2DZTA 1R2TA 3MW7A 1XF0A 5HULA 2VGIA 2V6AA 5FJTA 3ZOAA 4CN6A 4YNGA 3OHIA 1EUNA 1Z44A 3MP3A 1JJKA 4UTWC 4BKNA 3TCSA 1UKSA 4UZUA 5LGXA 1QUMA 4LUTB 3UEQA 3VNKA 4RZ6A 5T26A 3VIJA 1GOKA 3ATYA 3KOFA 1G69A 4LBSA 1EGMA 1G6CA 4NXKA 4A3UA 2ZDRA 1ZP4A 5KZDA 4Q8OA 1LG2A 3TQPA 1XV8A 4QFUA 4HP5A 3G1RA 3LRMA 1KV8A 1NP2A 5D2TA 1KGUA 3OVRA 3M1ZA 3AIUA 1KFLA 3EDKA 5D9NA 1VS1A 2JE8A 2J7FA 1R8LA 2WMIA 2NWRA 2YL8A 4CNOA 5D02A 3WG6A 3CZKA 1A4MA 1Q6DA 1O1HA 1OCBA 4ADUA 2HBXA 3M0YA 2WKLA 2GVGA 3S6TA 4IUOA 1UOKA 3CH0A 1ZY9A 5HANA 1REQB 3AS3A 5J04A 3U2EA 5CPTA 2J7CA 2GGIA 3HA1A 1G4SA 2WPBA 2VD9A 1T8QA 3A3HA 1QI0A 3E96A 4WCJA 2WHMA 2OG9A 1EXPA 3F03K 2ON3A 1ECEA 4XISA 4UQ9A 4U5IA 2P53A 4CUCA 3HPFA 2C1HA 4LC6A 1E4NA 2EPHA 3KHJA 4X60A 2WVVB 3B97A 2V5JA 3P14A 3PZNA 3BSMA 1VFSA 4R34A 1EZWA 3H54A 1NFBA 1NSJA 2OKOA 1L6WA 4GE8A 2XGIA 1MUWA 5CZ0A 8TIMA 1MQPA 1W2VA 4F0SA 1S1PA 4UNKA 3TCEA 2J8GA 4XZWA 4HU8A 2NW0A 3TXVA 4ICNA 2EAWA 1D3HA 5LIWX 3IUHA 1RCXB 1XQKA 1QK0A 2V3EA 4PCTA 1LRNA 1RUSA 3I65A 3SCPA 1Q63A 3NM3A 1TQXA 5F4XA 4IG2B 2VDGA 3L66A 4P7QA 3PBVA 4W8LA 1FRBA 1FP8A 4HYVA 4GKLA 4EOUA 1UD6A 1AL8A 1Z9AA 1GOXA 2YYUA 3AHXA 1TE1A 3N9SA 5D03A 4GI4A 4A29A 1KRMA 3AMLA 1OFPA 3MP4A 4ATLA 3KCJA 2CESA 2ACQA 3T4WA 1XYZA 1LL7A 1E0TA 4N42A 1RHCA 4MKSA 1B3XA 3MKKA 1UUQA 1QR7A 2VL4A 4JEQA 4ZEPA 4HCDA 3AISA 3MYPA 2R1MA 4CEXC 2CBUA 1W32A 3VTRA 3LM7A 1OGGA 1J0HA 2R1LA 1TV7A 4BK9A 4HSOA 1XYFA 4QG9A 3PK7A 3KBWA 1E9LA 1A50A 3LZ3A 4E2OA 5FSDC 1SYTA 2HSAA 3VU2A 1JCNA 4AHOA 2ATMA 2DZPA 4ZQPA 2Y5SA 4D8AA 4EX4A 3UJ2A 1D8CA 3G8EA 1LWIA 3NYZA 2XH2A 3W7CA 4G5DA 3ZLGA 2V5DA 4OU1A 4K36A 5CSRA 3PP7A 2WHKA 4LPCA 1EF3A 2YA2A 1M53A 1WKYA 4C6EA 4AWUA 4DWSD 3RCNA 4QCFA 3FK4A 2W91A 4JD4A 4OUIA 4C5ZA 3VC5A 1OX4B 5LA2A 3SUSA 4ZQRA 1TJ2A 4JAWA 1CXFA 2YYTA 2GJXB 2NVCA 3WEMA 4OBSA 1V6UA 3EWZA 3S5SA 5B7YA 2VRQA 5HDRA 3K8MA 3ANYA 3UJFA 2PDUA 3ISIX 3WDRA 4LTSA 1NEYA 4NX5A 5F1UA 4RLIA 2AGKA 2ZX5A 3U2OA 4GI9A 1A0EA 1HQTA 1RH9A 5K4XA 4V27A 1RPXA 5AHNA 3NVDA 4GRSA 4MIMA 1JZ3A 4N6EA 4JY8A 3ZZ1A 3O7UA 5D05A 4HVXA 4S3FA 5C6MA 2EGZA 3LPOA 2VZOA 5I07A 1ZRQA 4MNKA 1XIHA 2OYMA 3GH5A 3DIPA 3KOXA 3N34A 3B0YA 1YPIA 4BWLA 2B4GA 4KWSA 1CDGA 2PF8A 3N04A 3WK3A 4B91A 3GSMA 3OBEA 4P7RA 4FXFA 2Q09A 5FSEC 2Y61A 1KFEA 3H2FA 2I5QA 4MNLA 2DDXA 2INFA 3B8TA 3W1NA 2Z1KA 2YB4A 1A3WA 2GOUA 2DV0A 3TLQA 1XRTA 5D30A 3HG2A 1V3IA 1ALDA 1VEOA 5MKGB 3UBPC 1WZLA 3PPHA 3RU6A 1M68A 2FPTA 1CLXA 1KFBA 3H21A 4JDYA 2VEFA 4MNJA 1RAKA 3VA8A 1ISZA 1EB3A 4YVPA 3LV5A 3SY5A 4GCAA 4H19A 3WJYA 1EGZA 2VFDA 1X96A 2BNJA 4IP4A 2ZWYA 5K9XA 4NSBA 1JDEA 4JQ1A 3V16A 1TB3A 1E6NA 4MMWA 1U2YA 4HSHA 1WDRA 3HM7A 3MUAA 1O5RA 4WZHA 3HGRA 1NVMA 3KL0A 4RX0A 5ECUA 2P8CA 3HQPA 2C79A 2AAAA 2HNEA 2NQ9A 2O55A 1ZAIA 4GJIA 5K7JA 2ZOXA 3WEZA 1T96A 3LI0A 3QFEA 2VZVA 5JIPA 3EXTA 3EKZA 2ZUNA 3GTNA 4XK2A 2W27A 1EQCA 4GIYA 2LLEA 3W7DA 2FZ9A 5CG7A 1PB0A 1UIPA 5I5RA 3W0KA 3RN6A 4D6FA 4O16A 1ME9A 4H41A 4MTVA 4JTGA 3AO0A 1W3KA 3CYVA 2QW5A 4QITA 4WRHA 3MT1A 4O1DA 3EMZA 1FHLA 2FHCA 1F3XA 1LDCA 1C29A 3MSYA 3OA5A 1PTAA 3QRHA 4PRWA 3MSGA 5TF0A 3PF3A 3I4KA 1V3KA 3TONA 3QYQA 4C1LA 1IV8A 5A6BA 4A8NA 4V28A 1BRLA 4TXEA 3QN3A 2PBOA 3N13A 3ZT5A 2PWUA 3VKJA 2QCMA 1JQVA 1TQJA 3JZUA 2ISDA 1C90A 1F05A 4HOZA 2QCNA 4O57A 4LJ3A 2Y2WA 2DH2A 4IXHA 3HGJA 3SFWA 4IISA 3S5ZA 1NU5A 4HPXA 2NWSA 3O15A 2Y6ZA 3TW9A 4XKYA 3QGVA 2VQTA 2FZNA 3LQLA 1EF2A 1KTNA 1C8VA 4TX6A 4YTRA 1HL8A 3NNTA 3U2ZA 3A23A 3WD3A 1CB2A 2DSKA 3W85A 1OC5A 1EWEA 3R4IA 4TU1A 4F79A 3CO4A 3SCOA 1A5AA 4A2RA 2P88A 3W2UA 1R5YA 4LVAA 2VC9A 2DPEA 4PFHA 1EP2A 2XVPA 1FWJC 1H09A 3T07A 1B3VA 1FA2A 3UCQA 4DXVA 3G1DA 4C6IA 1BYAA 4LH8A 4RW3A 4NZJA 4Q22A 3WK1A 3TTYA 2OLHA 1P48A 5FF0A 3VVGA 1W31A 1B3OA 1CENA 1Q7ZA 5J5DA 3QF0A 2DZVA 1UD8A 4Q33A 5K3VA 3E0IA 1CTNA 4MY1A 1WDPA 2J8FA 4M51A 3BW2A 1E15A 2OR2A 2WC3A 1BWLA 1DPMA 4FOJA 4AVFA 1JG9A 3V0TA 1YX1A 3RLVA 3R0UA 4MYAA 3VOHA 3UR7A 1S5NA 3CPGA 1KBJA 3TV8A 3TA6A 5CSSA 2BWGA 4ADSA 4CQDA 4UUIA 3W53A 4QAIA 3DEQA 2VD8A 5ABHA 3M0MA 3E2QA 3S6DA 4QE1A 4IMAA 4KWUA 1QWGA 3P0WA 1SUXA 4XAPA 5FEXA 5JBFA 5E9AA 1H1NA 4WXYA 3T09A 4TX9A 3B8WA 2R1KA 5KETA 5CJ5A 4S3GA 2WMHA 3WUBA 4M6PA 4GNKB 1HKJA 2G0WA 1J2BA 1YTKA 3IJIA 2Z27A 3LSCA 3NQBA 2NSXA 4Y7EA 4FXJA 1ICSA 3UWUA 5G2WA 2CPUA 3BCDA 4GFSA 1EWDA 2OXNA 4YYFA 3W1QA 4IJRA 3VDCA 3LHZA 4L9ZA 3ES7A 2FH8A 1XIMA 2XPKA 2Y8UA 3MVTA 4AU0A 2W66A 1L8PA 4YWSA 4HB7A 2ZQ0A 2NSOA 3H7UA 3DKLA 3I6TA 3R79A 1ZJBA 4KIEA 1I1XA 4FB7A 4B5VA 2XUCA 3MDUA 1CZ1A 4F48A 3P82A 1MNSA 5D09A 1UJPA 3TEVA 5A95A 1DWJM 2XINA 5I06A 4DXKA 1MRAA 2ZE0A 3OGRA 1UD5A 5EB8A 3LX9A 5AC7A 1L0PA 4PUDA 3UF9A 1SW3A 1HNYA 1XLDA 1XBYA 2DZXA 5HA7A 3VGEA 3VE9A 3H24A 1OFOA 2PCQA 3GHTA 3E3HA 2HJPA 3N4EA 4XD6A 2BVYA 4HD5A 1JZ8A 3TQKA 3VIOA 3TW6A 1EPVA 3K4AA 2CC0A 3KBSA 3NZQA 1IXPA 4LUSB 4Q8TA 2DH3A 2KX9A 3GIPA 2UBPC 1W3NA 3FSTA 1SFJA 5M1TA 1UOZA 3LU2A 3VOJA 4GQ0A 1KTBA 3FYYA 2XSBA 4XZMX 3HGSA 3F2CA 4O8AA 4DYEA 4LRSA 1VGAA 2PDNA 1G94A 4H2CA 1WA3A 4WF7A 3GW0A 4RUBA 1L2UA 3T05A 1S5VA 3M6DA 4XD4A 4U3CA 4EP8C 2G4JA 3LXBA 1O6IA 1U5HA 3VK5A 1JRBA 4KWVA 3ZMRA 4U33A 2GVEA 3GTHA 1LF1A 2PDCA 4NU7A 3UW6A 3KW3A 4HPJA 1ML1A 3O6YX 1XLBA 3D3AA 2WSYA 1KCZA 2H3DA 2PDKA 5KINA 1GJUA 3R5EA 3H55A 1U30A 1SSGA 2YCIX 4DJDD 3CO8A 3APTA 2YCLB 4WY0B 3SN4A 3MU7A 3EDEA 5TNVA 4L4LA 1EBHA 3NPXA 1GWJA 4XV0A 1MW2A 3C2FA 2AQVA 3VNYA 4AH7A 5LXXA 3I3DA 4EIVA 3LUTA 4C7FA 2Y63A 3AU2A 1AMKA 5CPSA 1KFKA 3O0FA 4US5A 3EAUA 2Y62A 3W25A 3DXIA 5FJIA 3WF1A 1QPRA 3NQGA 1O68A 3ITTA 4LY8A 3TIMA 2DIKA 5ENLA 3CNYA 3WIJA 3M0HA 3W2LA 4IXXA 3URAA 5I24A 3CMJA 3DFSA 3P7YA 1US0A 5CPOA 5LKYA 1UD2A 3REQA 3IVSA 4W86A 1RCQA 1KBIA 2OX4A 3NXLA 5CAHA 3W38A 1H11A 1S39A 3L0NA 5C2CA 1GHRA 3PJWA 3SSZA 4IX0A 2XIQA 1OYBA 3C86A 2O7QA 2YLAA 4TV5A 1JEZA 2HZGA 3UR2A 2E6FA 2Q3OA 4PR4A 4K3ZA 4WKAA 4XKMA 2BZNA 1XWYA 2OEJA 3BOXA 2V8ZA 2AQWA 3FA4A 5HPCA 2VFEA 4D72A 4Y8FA 1ZBCA 2IKHA 1M1BA 4C7DA 1K70A 1EBGA 1XSIA 5LNUA 4V15A 3ZWSA 3AOFA 4J27A 3B05A 1VFHA 1US3A 2PWFA 1J5TA 4PMYA 2R6OA 1RP8A 1ITUA 2CNCA 3GVRA 4GUHA 3WLQA 3GHRA 1XXXA 1YEYA 4B3ZA 1ZCCA 1H41A 1TTIA 2CLHA 2WNWA 2Y8KA 5A2CA 4S23A 4ZTXA 4O0KA 4UTFA 3KVKA 2QIWA 2YLLA 3EDFA 4E8GA 5FJPA 4LGXA 4CN1A 4DZ5A 1X38A 4YVXA 5JBDA 3GHSA 1RD6A 2Y7EA 1VH7A 4HHHA 4LNCA 5REQA 1Q6QA 2I9UA 3TKFA 2ZZ2A 3OLGA 3PWIA 1GPFA 4PRTA 4P8VA 3VKKA 3UZXA 3WQWA 3PR2A 1LZOA 4RNJA 5CKSA 3UQNA 4JHOA 5B80A 4AHQA 2REQB 1FWHC 4UQBA 3ABQA 1HKVA 2HROA 2NT1A 3EA2A 3O6AA 3CAVA 4BF5A 4Z2KA 3WDQA 4G1NA 5LIKX 1MFUA 4LCQA 1JCYA 4DM2A 3CHCA 3ELFA 1GOQA 4US6A 2CZFA 1V3JA 2YR1A 1A4LA 3EOEA 2YFNA 3CS2A 2VZSA 2ZVIA 3MUY1 1R3SA 3GUGA 1HJWA 1EHAA 2GOKA 3N2MA 3Q4DA 4MY8A 3N6JA 4FHAA 4C6PA 1UPMB 4F9DA 4XZNX 4R85A 3BV4A 3EB3A 3ZVHB 2C8NA 4PTNA 4Y2WA 3TR9A 3GS6A 4GVGA 4O0QA 5ABFA 2QR6A 2QS8A 1UH2A 4NX0A 2A7NA 1RCOB 1B9ZA 5F2GA 3TFXA 2D2OA 3VCNA 2ODOA 4R5EA 5M17A 4BR1A 2JEQA 2QUUA 1JAKA 1Q6FA 2EG6A 2WK2A 4LB3A 2ZADA 2VCBA 2WQPA 2VENA 3CQHA 4B3LA 1Y5XA 1P6CA 5FACA 4JN6A 3B8UA 3VOCA 2FMOA 1OABA 4NZ4A 4JIPA 4DYKA 1HJQA 3MANA 4W5ZA 4Q6XA 1D2KA 4QG8A 3NJ3A 1D9EA 3U5YA 1UUMA 2RDUA 4UR7A 1V8EA 3V18A 4QSHA 5M3WA 2HCVA 5A8GA 1NARA 3GDBA 1XBVA 3BAJA 4RDZA 1MEHA 4R3UA 2IS7A 1WE5A 5IHRA 3CQIA 3DENA 3HGOA 1W1YA 3NGJA 1V6WA 1EC8A 3QQ1A 4GABA 1IXNA 5I77A 3EX2A 1IIHA 2OT1A 3EPMA 1NDYA 1V0KA 1QHOA 2PDHA 3LCWA 3CGTA 1YNPA 4ORIA 5E0CA 3P74A 2Z2UA 2A6LA 5GJNA 2EJAA 1W8GA 3A6OA 1EJTC 1PL9A 4NNBA 3GZ3A 3H70A 3R0DA 3V5FA 3GU9A 2BLEA 4LXFA 1R9XA 2E77A 1WBJA 2GGEA 4C6OA 2P5NA 1CT5A 1XPYA 3EWUA 1U5JA 3B0PA 4AEEA 5CPNA 4MZ1A 4ZQCA 3BCJA 1IZCA 2OGYA 3GBDA 2CZEA 5IBXA 1OWQA 2ZCGA 1TELA 4GBUA 5AC8A 2FB3A 3L5LA 5I3KA 3W7KA 3S47A 1VFMA 4OT7A 1QVBA 3W4RA 4RJEA 2OKTA 2CKRA 1GYNA 3MJMA 2BBFA 5AFDA 1IXQA 5I03A 1E0WA 4GIRA 4OOZA 3NYDA 2ZRXA 3NAVA 3KZSA 4IPNB 3EDDA 4C90A 1QMLA 3N4AA 3N2TA 4LBUA 2WMFA 4JR5A 3CPRA 2GSHA 4OJYA 2NUXA 1ENUA 1IEXA 3GDRA 3DC0A 1F73A 1DBTA 1E1EA 3EWDA 1SVDA 2ABAA 3W24A 2WC7A 1K7FA 3ABSA 1FWAC 2PRHA 1OVDA 1JZ7A 4ZOAA 2J62A 2ADAA 1GGOA 2VTFA 3WLMA 3II1A 1SFTA 2GZXA 1LL4A 1AW5A 1CIUA 2ZYFA 5F2MA 1A0DA 2YSWA 3XISA 3T2QA 4PB4A 4DJDC 3WQ4A 4J35A 5CAKA 4QHRA 3UU0A 1FVPA 3MP5A 1H63A 1NF0A 1Q2SA 3COTA 3TNOA 3SAZA 3M64A 4I6VA 1X1ZA 2J9YA 4UB9A 3MCNA 1MEWA 3O2LA 4F66A 1MDRA 1QT1A 4CU7A 2QF7A 1W1B1 5G4WA 3MBDA 2Q6ZA 4HHPA 2ZX9A 5AHLA 3EPOA 5AC6A 3MMTA 4QNWA 1XLHA 2NX3A 3G3MA 5HBFA 2DZUA 3FAWA 4V33A 1J5SA 2Z25A 5EBAA 3DGRA 4ES4A 2WSPA 4ALDA 5AVHA 4ROQA 1TPC1 2QKFA 1R3RA 1R6WA 4H1ZA 1VJZA 4ZQOA 4MGGA 4CNNA 4F40A 3V4BA 3WEOA 4YHEA 4HJWA 1L9WA 4MFEA 1J12A 1WXZA 4JX5A 2Z7KA 5FJOA 3EOSA 3M0JA 1W0MA 3AS2A 1KV5A 1WAWA 1H4PA 4JX4A 3A9IA 3N18A 4O4VA 1F4HA 4EVZA 3PBUA 3LGEA 3WQOA 1HZYA 3WF2A 1LTDA 1YW1A 4HJFA 3WDJA 1I2QA 3U8GA 5E6YA 4AZCA 5G5IA 2R91A 4LVDA 1TWWA 1T99A 4GZEA 3RR1A 3AFBA 1KRAC 4MLJA 2CXGA 2PDPA 1S3TC 3D46A 5BOOA 1VBGA 2OODA 4C6KA 4KGLA 3DG6A 1TZ9A 3L9CA 1QTWA 3UR5A 2BY1A 1WZMA 5MHBA 3L23A 2E5DA 1GQJA 4OTKA 3KBNA 4RPQA 2OSYA 3ARPA 3TLLA 2ESCA 3WNOA 4BEQA 3IAQA 1XFCA 3UG8A 3SW6A 5B7ZA 2A3EA 3LHUA 3POHA 3GVQA 3K30A 2YDSA 2VGFA 3T8LA 1E73M 2OTDA 3W83A 4QS5A 2ALRA 4U2YA 1XR2A 5LIXX 2OJPA 4AXKA 1WBHA 4IFOA 3UA3A 4ZENA 3H7VA 2BVDA 5PTDA 1CI1A 3L7RA 4AF0B 4PBFA 4IFRA 3WDPP 3ARYA 1RA0A 3IJLA 1IE7C 2QDGA 6REQA 3VD7A 2EPLX 2ZVRA 1TCMA 3AU6A 4RZBA 4MKVA 4PMDA 3G24A 1YDVA 2BOFX 2QEZA 2W5FA 5HWNA 2CZDA 2QMJA 3WL1A 1DVJA 2W0UA 3DCPA 2WCGA 1LBLA 4OHQA 1RV8A 4D6CA 1XYAA 4PN2A 1OFRA 3R25A 1GW1A 5BWAA 5H6HA 4J3VA 4Q6JA 3CTLA 2O9PA 4GYPC 3EWWA 1KM0A 3VKBA 3MQTA 1SJCA 3SCRA 4UTLA 2B7PA 4GIAA 3VOGA 5G2HA 1K9TA 4U28A 4GY1A 1DEDA 3IVUA 1P7TA 2CBJA 5E5CA 1PIIA 2ABBA 1A5SA 1S38A 2FTWA 1HJXA 4MLRA 1YDYA 3DI0A 3JZEA 3E02A 5H8PA 1FKWA 4DJFD 2MANA 1UKPA 3L4TA 3F5KA 3L0GA 2PWGA 4W9TA 1OY0A 3MC5A 3GHUA 2YGYA 1GNXA 4LFYA 4H9MA 1UZDA 3VIGA 2EJ1A 3GLCA 1DHPA 2VOMA 1WZAA 3ZR6A 1RQEA 3A5VA 1JCJA 1DWGM 3C2EA 1FUYA 4LB4A 2X41A 1OF8A 2V68A 3BMWA 4KBXA 5C55A 3P6LA 3B0VC 2ZZ3A 3OZOA 3GVWA 1ZZMA 2WBKA 3STPA 5H2ZA 3FHQA 1XS2A 3JRKA 4GNJA 4YU1A 4NI3A 1DE6A 2BB0A 2QV5A 4R88A 5AYIA 1HGYA 3U6WA 1OT2A 3SR7A 5F4WA 3WLKX 4NF7A 1CXLA 4J3ZA 3N2XA 1AD1A 3NO1A 3BAWA 2YZRA 4O13A 3QGAC 5DRCA 3ZT6A 3T4CA 4OQVA 4C6LA 5KZEA 1JGMA 2A1YA 5HINA 3FGCA 3LRLA 1KM5A 3KFTA 3W6LA 3AIWA 1VRXA 4K7YA 1NWUA 5CZSA 4LEQA 5IXEA 4CVUA 4CD7A 1F9CA 5MF5A 1CCWB 3NQCA 1G4TA 5FAGA 4S3JA 4WK9A 1TX2A 1Y5VA 2NXGA 1EC7A 3W27A 1RJQA 1CW2A 1NP0A 5KSWA 1H7NA 4TX8A 4Q7IA 3E0LA 5D32A 1FWNA 3RCYA 5IHSA 5D9PA 1XYCA 3ERPA 3U48A 3GVVA 5HQMA 5GNZA 2PU1A 4L9XA 1PZ3A 3SUTA 3SQLA 3C61A 1TIWA 1NM9A 1A80A 2R1NA 4CNUA 2YXGA 1UB3A 3WQFA 2H90A 1XD0A 2NLYA 1GOWA 4Y9OA 1YLVA 4B16A 3JVAA 4JY9A 3CLWA 4AD0A 4AZBA 5HR6A 4JN8A 4FSAA 3KXQA 2WJZA 1DXFA 1X8CA 2HXUA 2ZE3A 2Z28A 3S3GA 3UCCA 2R94A 5E6ZA 5E09A 4A05A 2FLIA 1W5OA 3TAOA 4HYWA 1EQPA 3Q94A 1BGGA 3L68A 2PWVA 1Q85A 5DO8A 1PTGA 4ZFMA 4AZ6A 1B54A 3U7VA 3H8AA 4I5XA 2OZ8A 1XLFA 3URBA 3WKZA 1R3WA 3OA3A 4ZODA 5I79A 3R58A 4N0RA 1NIUA 3W7HA 1PWLA 2CHRA 2NV9A 4CNTA 2DUAA 3KE0A 4QJ3B 1UWRA 2OLAA 4KEVA 3R2GA 3ZR5A 4GMEA 2XH4A 3NQ2A 2E8ZA 2A85A 2HISA 5AYBA 4PH6A 2VGGA 5FKYA 5D8WA 3DFHA 2GUBA 2WCSA 4NYYA 4X9SA 5AC4A 2A79A 1V03A 1ESWA 1YTDA 1BXCA 3IUDA 3PG9A 2X42A 3P84A 2ZUTA 3U3HA 3KDOA 4HNLA 3ZYZA 4H9XA 1XSKA 1TUXA 2GDUA 1EYEA 5LIYX 1LROA 1UHVA 4BQ5A 1Z6KA 1KWGA 1GQIA 4W84A 2QULA 2VMFA 1GPWA 5DCEA 4QBXA 4P8WA 4CU6A 2OOFA 4B5UA 3CEPA 1FH7A 5DRIA 4JTKA 1F7BA 3URNA 4LWWA