1HO1A

Crystal structure of pyridoxine 5'-phosphate synthase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the function of pyridoxine 5'-phosphate synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords PYRIDOXINE 5'-PHOSPHATE SYNTHASE
total genus 93
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ho1A00
1LCOA 3LCLA 1AL7A 1FWWA 2ABAA 3BG3A 4LV9A 1DV7A 3LTYA 1FQ0A 4K7VA 1MEHA 3QMTA 3MYPA 1TPWA 2E6DA 4O0ZA 5FEZA 3TX9A 4RZ6A 3EEGA 1LOQA 3G3MA 4UMCA 2CZFA 4AEOA 2G96A 3NQ6A 4DPPA 3Q37A 1M7PA 4JTEA 4MZ8A 3G1VA 1JCYA 4XKYB 2Y7GA 4S1FA 4CCEA 1JCNA 5AHEA 2C19A 3PBUA 3PG8A 3ABQA 1M7OA 1LBFA 5HUOA 3CU2A 3NR0A 3EX6A 3LERA 6TIMA 3KXQA 4Y96A 3OIXA 3W7CA 1JCLA 3PM6A 5KSWA 3M0ZA 2YW4A 1K8XA 3KVMA 2ZDRA 3H55A 2JKPA 2GVLA 3W6YA 2B7NA 3GNDA 4O10A 3W2UA 2Y7FA 3CC1A 2JKAA 3UY8A 2VC6A 2GJLA 2H3BA 1RZMA 1QO5A 2ZRVA 1ZAJA 3NQ7A 3N3MA 4R34A 5E0KA 2E5BA 3N2MA 3NA8A 3TV8A 2HS6A 1C8VA 4UTTC 1K7XA 1KM6A 3A23A 3E0IA 2Y6ZA 3QMRA 4JDYA 2DZVA 4UTKA 4EF8A 1KFLA 5F1UA 1QPQA 3MI6A 4JTHA 4Y90A 2XN2A 5HR7A 4GNJA 3BW3A 4EVZA 1YPFA 2YCEA 3EX2A 4MY1A 2CW6A 1OFDA 4RZ5A 1D3HA 1VC4A 5HINA 4AAJA 1VYRA 1VR6A 2J88A 1IIHA 1EX5A 2QCFA 3DH7A 2Y63A 4MJZA 3B05A 1J4EA 3C0JA 4YCPA 3VI2A 4JTLA 5FI8A 5AC7A 4WQ6A 1AW5A 3OG3A 4HPJA 3NQCA 3GAKA 2CLFA 4OHQA 1RVGA 1TYGA 3WK1A 1KW1A 4IOTA 3TCEA 4MFEA 2A5HA 1LZOA 5G4WA 5F4XA 4LUJA 3MMTA 1LBLA 5C5YA 2LLEA 3TFCA 1OF6A 3S1VA 5CSSA 1HO4A 1KM1A 3VCRA 1UBSA 3NPXA 4XKYA 1SZNA 1BTMA 1F6KA 1KM4A 2DJLA 1LDCA 3ABOA 1FCQA 4N6EA 4K38A 3W2JA 3CWOX 2Y89A 4Z1CA 3SGZA 5K4ZA 1F73A 5KTLA 5D2XA 3PG9A 3P5ZA 3WK2A 4MLRA 3L5AA 3GXNA 5KMYA 4HN4A 3P8IA 1GVRA 4GFSA 4ZQCA 1ZAHA 2QCDA 2QCHA 4XZ9A 1BWKA 1Q6QA 4GUGA 2I1OA 5F1VA 4KFNA 3D0CA 2RHGA 2CFFA 4HSNA 1EP2A 3ZWTA 2YZRA 3KRSA 5D30A 4LVBA 5K3VA 4DXVA 2TSYA 3FA5A 2A7RA 1OK6A 3MI3A 3GKAA 1G4PA 1PE1A 3T7VA 4O0KA 4JY9A 1RQHA 4UNLA 3TSBA 5TIMA 4MUZA 1VYSX 3P62A 4O18A 3UD6A 5FF3A 4DO6A 3DZ1A 4DEFA 4CQ8A 3PUOA 3EKZA 3A9IA 1WA3A 1TMHA 3DFPA 2W79A 1JRBA 4RJEA 1TSIA 3DI1A 4M6QA 1GYLA 5KINA 3C4UA 4RZ4A 2HSAA 3PSWA 1SW0A 4UTUA 1DOSA 1VS1A 1VH7A 4K6AA 4GUFA 2W6RA 4QJ1A 4JYEA 2FQIA 1ZAIA 1YYAA 1KFEA 1TO3A 1MXSA 3HGJA 1I2QA 4ORMA 1GVFA 3R8RA 3W1XA 1DORA 1W0MA 2A6LA 6ALDA 3A5FA 1W5OA 3FLUA 3U8GA 5ABTA 3T4CA 1QR7A 2R91A 3C52A 4EWND 2R94A 2WKJA 4JTFA 1UJPA 1UB3A 7TIMA 3PBWA 3BK0A 5F2IA 1X1OA 3MHGA 1SSDA 3M5YA 4Z0SA 4DBDA 2PURA 1DKWA 3S5YA 2FFCA 3KAOA 2GQ9A 3R89A 1TJRA 3W1TA 3UZJA 3BV4A 4IPJA 1YTDA 1BEUA 3LX9A 4MLJA 3A21A 1TPC1 3QRHA 2I9EA 1VCFA 2E09A 3W1NA 3HG4A 4CLMA 3SW6A 4O4WA 1JCMP 3C8FA 3L68A 3PAJA 3LLFA 3W84A 5BOOA 5BMXA 3P81A 3GDLA 1GWJA 2YW3A 4LVGA 3NQAA 3KX6A 4JXCA 1SO5A 3G24A 2ZA3A 4IUOA 3EWXA 2VXNA 4GXMA 2V0TA 3NO5A 3O05A 4O52A 4BWLC 2GUUA 5EBUA 3O1NA 5AHNA 1R30A 2YXGA 5AB3A 2VFHA 3NZ1A 2OZ0A 3B0UX 1ME9A 1W3NA 2CLKA 4XTIA 1YPIA 3W74A 5HUPA 1KBJA 3L21A 4RR4A 4N9CA 1OK4A 1OYBA 1H5YA 1H1ZA 4ONVA 1GOXA 1XDMA 4ZL1A 4TMCA 1TIMA 3W9ZA 2C3ZA 3P82A 3W72A 2DJXA 5D2TA 2FPVA 3IIVA 3GLCA 4CNOA 1X1ZA 2ZZ4A 3E49A 4UFHA 5D2YA 3GAYA 3MJYA 1Z42A 3PB0A 1I2NA 1TPVA 3STCA 1XC4A 5CPNA 4AMAA 3LXAA 3NL3A 5D05A 5BNKA 4HNTA 4OU1A 3UNDA 4JGDA 4AHOA 3UXDA 4QAIA 2YYUA 4CNNA 4B5NA 3DXIA 5F4WA 4PL1A 1FCUA 4HT3A 4X22A 5LNUA 3SIZA 3TW6A 5AFDA 4PEKA 1LORA 3E02A 4IX2A 2ZA2A 3TIMA 1H7WA 1K7EA 4S2BA 1RV8A 5HMSA 1KV8A 3NOEA 1YDNA 1NSJA 4HKPA 3LI0A 5D2VA 2QCCA 4OT7A 1W1ZA 4ZZ9A 2E6FA 1V7YA 2E6YA 3IIZA 2V2CA 1SZEA 2Y7DA 4JTSA 3C2FA 5HNRA 3LDVA 1L9WA 2OJPA 3G1SA 1VJIA 4LTSA 4GWEA 4M7TA 3CHVA 3BO9A 4AHQA 1ZFJA 3P60A 3W7HA 5I3FA 3C3NA 3DGRA 3P8JA 4FNQA 1TV5A 3W1RA 1EP3A 2WNNA 2F7FA 3QW4B 1G67A 5I3IA 4N4QA 1RR2A 1VHNA 3USBA 2QCDB 4NUWA 5CKSA 2H3DA 3CB8A 1ZHAA 4OBTA 4LVAA 3P80A 2H6RA 2AAMA 4UTLA 4UUIA 3EX3A 4HHPA 3KRZA 3MYOA 2TYSA 1W56A 3TH6A 3W1MA 1FBAA 1EP1A 1TB3A 2FB3A 3QSTA 3GKFA 4JX5A 1GPWA 1ZY9A 2A21A 4GJ1A 4LS2A 4WOZA 4O13A 3F4WA 2ZRUA 1THFD 4XUGA 4UR8A 1S5TA 2FDSA 5HULA 4H4IA 4JTJA 2A6NA 2V5LA 1GTHA 3P84A 1T8XA 2YFOA 3ELFA 4FF7A 3W87A 5G1TA 4ML9A 5BMWA 1VYPX 4UTWA 2Z2UA 3WJXA 4OV4A 2J9XA 1SU5A 2UV8G 1HL2A 1IF2A 1YXYA 1XL9A 2Z0IA 2NZLA 4TR9A 3L66A 2QCNA 2QDHA 3HPXA 3MHFA 3ABRA 3EWUA 2Z6JA 5BW6A 2Y85A 3HB9A 1L6YA 2A7NA 1WQ5A 1MEIA 1DJNA 2TMDA 1BWLA 4I7WA 3UWQA 5GVJA 3EKLA 3IGXA 3UWUA 3TUUA 1G6CA 1AMKA 1SO6A 4K8EA 4YL2A 4KWVA 1O60A 4O1BA 5LGZA 2G97A 3GXPA 5KZDA 2GQAA 5LHEA 1C9DA 3RU6A 3PS7A 1H7PA 4IQLA 1UASA 1K3UA 3M5ZA 3TC7A 3SGUA 3DHFA 1LM1A 3SECA 2VFGA 1XXXA 4HSOA 2FB2A 5L6UA 3OEXA 2WV8A 1GJPA 3OVRA 3Q58A 2JBMA 5C55A 1Q6RA 3W2NA 3GK0A 3O16A 4TX9A 3PUEA 2CLOA 3QPYA 2ZRYA 3HOJA 4UR7A 1W54A 1JUEA 3TU9A 1LBMA 4WJEA 2ZZ5A 1JULA 4ADTA 2BLEA 1W5NA 2Z6IA 1LP6A 3QYQA 3DBPA 5DELA 3R5EA 5F2MA 4MZYA 1G69A 1KFKA 1NEYA 5J5RA 2NWRA 3GXTA 4EIVA 2V2DA 1TTJA 1WYIA 4LWWA 4CQ9A 5D2WA 2A4AA 1KTCA 4QIUA 4FIRA 5G5IA 2NUWA 3NQVA 1ICPA 3W7QA 1B57A 1LTDA 2W0UA 2B7QA 5KITA 1OG0A 2J6XA 5CZSA 3IRDA 1OFBA 1H60A 4AF0B 4IWWA 2E1DA 1KTBA 3BLEA 3H53A 3PSVA 4BWLA 3NQ8A 2QJIA 4TIMA 2E6AA 3TAKA 1XFBA 4NX5A 3T44A 1H51A 3BW2A 5CGQA 4IXXA 2QR6A 3EWYA 3PWAA 1Z41A 3I7SA 2ALDA 1LYXA 1WDWA 4UXDA 2P0OA 2DZXA 4LVDA 4M7SA 3W23A 1A5BA 3NL5A 1K8ZA 1FXPA 3QZEA 4NXSA 1Q6LA 4I9AA 4LY8A 1TJPA 2VELA 3NQFA 1OFOA 3SJ3A 4PA8A 1FCVA 1A5SA 2QUVA 1W31A 4AF0A 3KVKA 4UTJA 4Q4KA 1Z48A 3VNDA 2DU2A 2EHHA 2P10A 3W75A 2YPIA 4WUIA 4WY0B 3UWWA 5J5DA 3HQ1A 3DU0A 3I65A 3NEVA 4NNAA 3ZFHA 5U7SA 2JGQA 4N02A 1UUMA 2G5WA 4NVTA 3W71A 4IPIA 2Q8LA 2ZTKA 1S5VA 1AL8A 2NLIA 5U4NA 3R13A 4FNSA 3SZ8A 4UNKA 1EEPA 1TV8A 1EIXA 5DXYA 3CIXA 4A3UA 1CW2A 4M6PA 3PBVA 2ZZ3A 3P7YA 5EA9A 5FF4A 5LKYA 2BZNA 2Y7EA 1AK5A 1P5BA 2QDGA 4FHAA 4GC4A 3QF0A 3LCWA 3TAOA 1ADOA 2C15A 1VCVA 4UFIA 5AC6A 1ICSA 4NNCA 1X8FA 2Z1BA 3T78A 1SSGA 4WY0A 4P2VA 2V2HA 5DY2A 3FS2A 3SI9A 3QMSA 1TPEA 1XBZA 1X6UA 1YXCA 3MI2A 3TKFA 3TNOA 3HPSA 3TJLA 3EWBX 3CT7A 3GDKA 4X9SA 2Y61A 1YTKA 4MIMA 3GZ3A 3F4NA 1W3IA 3KFTA 1KM5A 5HWNA 1FWRA 3CPRA 4QQ3A 2VEMA 3PBYA 3K30A 4Z08A 3TW7A 3CQ0A 1ZALA 3LCFA 4ORIA 4Y6GA 4DBEA 5LNWA 3UXAA 3MP4A 3LTSA 4O16A 1DHPA 3G8EA 1WOBA 4E0CA 1WV2A 1CX9A 3RMJA 1HFBA 3DFNA 1H7OA 4HIBA 4MYXA 2VFIA 2C14A 2WSRA 1ONRA 1FXQA 2YFNA 1EUNA 3TJXA 3FKRA 3W7LA 4MPQA 1FWTA 2B7OA 3S6DA 2IQTA 3M1ZA 1EB3A 3Q2DA 2DP3A 4O1AA 3O6YX 1KA9F 2ZTJA 1G4SA 2ZRZA 3GDRA 4NZJA 3EWWA 3HGOA 5AYYA 2FTPA 4GUJA 2NXHA 3DENA 5CZJA 4UTHA 4LU0A 5FF7A 3G0UA 4KKXA 4XBSA 1AW2A 1DQWA 2ISSA 1TPDA 1M5WA 3PULA 1W5PA 1YADA 1A5AA 1D3GA 5IM51 1YLVA 2CWNA 5AHLA 2BX7A 1QWGA 2G95A 4UFKA 3A5VA 5G2WA 4CCCA 5AN7A 1I2OA 4LS0A 5HR6A 5DN1A 3G1AA 1QPRA 2YGYA 3THQA 1DVJA 4NX0A 2WJZA 3PC0A 1RPXA 1FDZA 3TR2A 2J9YA 4AB4A 5DCBA 3L0KA 3LHVA 1KV5A 3RFAA 2A0NA 1QAPA 3LRMA 1H7NA 5C54A 1JUBA 2A85A 5A8GA 3M6YA 3SFKA 4CQAA 5D02A 5MHBA 1N7KA 3IGUA 1TQJA 2ZA1A 2ATMA 5EMUA 4GBUA 4DELA 1PHWA 3MP3A 5H91A 4ZQRA 2FIQA 4WY0F 1I2PA 2QJGA 3QM3A 1TRIA 1KLZA 2XN1A 3PUDA 4POCA 3DFTA 4O53A 3B06A 4X2RA 2F84A 1ML1A 4X3ZA 2O7QA 1KLYA 4IGHA 1G4EA 1XI3A 2JK2A 4MZ1A 3NL6A 3VE7A 1F76A 1O5XA 2PE4A 4JNMA 2GJNA 2RKXA 1U83A 5A5WA 3IIOA 2BWGA 1H7RA 4FXRA 1AG1O 1LOLA 1WAUA 4MJMA 4UTMA 1EWDA 3EX1A 1ZNNA 2HMCA 2NX9A 4A2RA 4FNTA 5EYWA 3C2VA 4UMBA 1TPFA 3BARA 2NV1A 1OFQA 2PCQA 3I7QA 1P0NA 1PL9A 3NM3A 1FWNA 3B8DA 2Y70A 3FJLA 4FNRA 2TPSA 4P61A 4IMGA 3W1LA 3OA3A 3LXBA 3MBDA 2GPTA 4FIQA 4NT0A 3S1WA 3HG5A 1Q6OA 3HJZA 1F74A 3DKLA 3KRUA 3W70A 1A53A 4OV9A 2A2IA 1KFBA 4C1LA 3QH2A 1GQNA 1F05A 2H8ZA 3V75A 1YTEA 4M6VA 3G0SA 1PCWA 2X1UA 3ATZA 4O12A 5F2GA 5D09A 5IBXC 2QF7A 4BF9A 3CLMA 2BTMA 1NFBA 3TSDA 4U28A 1GTEA 4IMCA 3M9YA 4MYAA 1QFEA 2X16A 3WJWA 2VEPA 2Y88A 3LM7A 5LZLA 1JVNA 1MO0A 3CWNA 2V5BA 4QM1A 5D33A 3BG5A 2ZRXA 4MVAA 3N14A 3PVFA 4N9BA 4UTIA 3HG2A 4UMAA 3HGSA 4AWUA 1QMLA 2OX1A 3BLFA 5F2LA 4JDBA 4LUIA 3P61A 2EPHA 1P4CA 4AWTA 1F7BA 3FJ6A 1ZJIA 1I45A 4HNVA 5I3HA 3G0XA 4N2YA 3LV5A 2ZZ1A 4RXGA 4Z1BA 3W2MA 1SW7A 1T96A 2O7SA 2QEZA 1OF8A 3M41A 3F1QA 2WNQA 5LSMA 3BGJA 3L2IA 4JD4A 3M5VA 1XM3A 1L6SA 4G1KA 1KBIA 2ABBA 2Q3RA 3TQVA 1PVNA 4K39A 4AVFA 3TDFA 1IXPA 1OVDA 1QDSA 1ZENA 4JIQA 3W7RA 1J2WA 3SSJA 1S5WA 2FJKA 3BVJA 4LC6A 4O4VA 3LXCA 4JICA 4L4LA 2V81A 3W1AA 5LGXA 3W3OA 1ICQA 3P74A 1XKYA 4E38A 1G7VA 2QKFA 3W7KA 2J9ZA 1R47A 1ME7A 3B0PA 3EWZA 4R33A 4BI6A 3A22A 2X2GA 1IIGA 3N19B 3TMLA 1PS9A 3O6CA 3JR2A 1OFRA 3NPWA 3G1DA 1O95A 4ZQNA 3UWVA 4FO4A 1QOQA 3NQEA 3M43A 4U4MA 5D32A 3H54A 1SZFA 3MO7A 3KVLA 3O8AA 3W2LA 4JX4A 1SPQA 3VKJA 4XBKA 4O19A 4A22A 8TIMA 3W7NA 3LHYA 4D2JA 4H3DA 1JJKA 3NNTA 1GVQA 4O57A 1TTPA 2QCEA 4Q33A 1LROA 4IXHA 3S8HA 3THAA 3IVTA 3P67A 4RK8A 4O11A 1RQEA 3NM1A 4EOUA 5K7JA 3N9RA 1SFJA 2BXVA 1XUZA 1WBJA 2DZUA 1MZHA 1OX5A 1NF0A 1EWEA 4WOQA 3AO0A 3QJAA 3NL2A 4Z1DA 2DZPA 1VRDA 4LW7A 3LBMA 4LC8A 4O15A 4MY9A 3ZWSA 1FUYA 2P1FA 3W86A 2B4GA 4JX6A 4DF2A 1P1XA 3IIPA 4FX8A 5FEXA 4FEZA 2CZ5A 4WX2A 2XFWA 2XN0A 3GR7A 3TSMA 2NUXA 1FCBA 3GVGA 2VFEA 1R2RA 1JCXA 3Q94A 2WSYA 3W1UA 1W37A 4PTNA 5CZTA 3TQKA 3RNDA 3G3DA 3W7GA 3PF3A 1ME8A 2C18A 1JRCA 2V9DA 5K9DA 1PIIA 3OBKA 4RV8A 4O54A 3TFXA 2A7PA 4JYFA 1QPOA 1R2SA 1SUXA 3M44A 5CPOA 3HO8A 3GR8A 4JTUA 3EXTA 3RLUA 3WJSA 4O14A 3C2RA 1IXNA 2C13A 5E1QA 2C1HA 3BLIA 5DLCA 4LV4A 4YLWA 4NJKA 2EF9A 3HGRA 3ZS4A 4FNUA 1RD5A 1WBHA 5FEWA 2PRLA 3HF3A 3VE9A 3I7RA 2A1YA 2ZRWA 4WXZA 3WFAA 3TROA 4A2SA 1HG3A 2B0MA 2V82A 4UFJA 1EUAA 1QCWA 4ICNA 1LOSA 4ZQMA 3C56A 5DXXA 3IVSA 3LHZA 4O28A 3NAVA 3OVQA 1FDJA 1I4NA 5E93A 3LV6A 1OX4A 3E9AA 4LNYA 4JY8A 2CLIA 5KZEA 3MHUA 3LHTA 3STFA 4N6FA 1PCKA 4BFAA 3FIGA 4CCDA 4PFMA 1GEQA 4O17A 4GE8A 4PC8A 3O07A 4WZHA 1JR1A 4H6KA 1IGSA 3IIXA 1W5QA 1XUUA 2RFGA 3UPWA 4N4PA 4YCOA 3W83A 3G8RA 4LRTA 2RDWA 3KHJA 4FXSA 1L2UA 3TXVA 4JN6A 4FX7A 2FPYA 2QUUA 3UZ5A 3SR7A 4DF0A 2AGKA 4Y9AA 3ATYA 4OQVA 1DL3A 1SO4A 2WO5A 3QC3A 2ZBTA 3KOFA 4K37A 4KFPA 3NZRA 4TO8A 5CSRA 3W73A 5CG7A 1A50A 1W3TA 1NVMA 2ISWA 1R46A 3RK8A 3FYPA 4EF9A 2DZWA 3QQ0A 1G7UA 4OGZA 1Z44A 4A21A 4S2CA 3HG3A 3CIWA 5K9XA 2WSQA 4C1KA 3L5MA 5L9FA 1KM3A 1VQTA 5G2HA 3W7EA 1QPNA 1SZGA 2ZYFA 4LOCA 1TV7A 3DAQA 1Q3NA 1MSSA 3E96A 3DKJA 1DJQA 3IV3A 4BR1A 3QW3A 2J24A 2AQWA 2NV2A 3WK0A 1EA0A 2YYTA 3S1XA 2QCLA 1OYCA 3LHUA 2ZQ0A 3SY5A 3TA6A 2GVJA 3HBLA 3LCIA 2X1RA 3LI1A 3O6DA 2Q3OA 2WOQA 2GVGA 4XQ6A 1I2RA 3W7MA 1QNVA 2CLEA 1GZGA 3CEPA 4DF1A 1HTIA 4N9EA 4DO4A 3L5LA 2OT1A 5D04C 1H62A 5IBXA 3DHDA 3LB0A 4K36A 5AHIA 1FWSA 2X30A 4HNNA 3W07A 1JQXA 1PV8A 4L4MA 2D73A 2EGZA 3CEUA 4RLIA 4ZQPA 4JS3A 4JTGA 1GT8A 1N55A 2BSLA 3NDOA 4UCGA 3FYOA 2GQ8A 4IJBA 4WD0A 3KVJA 3DFSA 3DI0A 2QAFA 3ANYA 4LVFA 2QUTA 2Q8ZA 3IEBA 2DORA 3S42A 1K03A 1IXQA 2C0AA 2NX3A 1NAL1 1XBYA 1TTIA 4JTTA 1S3HA 4O1CA 3W7PA 4ADSA 2NXGA 5CZ0A 3TK7A 1YDOA 1J5TA 5DY3A 2NXIA 3O15A 2JKEA 1XBXA 3NQMA 2RH9A 3C2EA 5LNRA 3M7WA 4RXFA 1SR9A 1KM2A 3NXFA 1SO3A 1Y0EA 1X7FA 4NNBA 4I7UA 4JYDA 2OCZA 1DQXA 1TPH1 3W2KA 4WXYA 3GX9A 3N34A 3WJZA 5DCDA 4GRSA 3JRKA 1W8SA 4YWIA 3NQ2A 3HIJA 4ZQOA 5KZMA 3QEZA 3TQ0A 3V1PA 1UCWA 2GOUA 1T0OA 2E77A 2DZTA 1TQXA 4M5PA 3S5ZA 1U5JA 3RLVA 4PODA 4NZFA 4ADUA 1Q45A 4HNUA 1VHCA 2YSWA 3QFEA 1TREA 2RDTA 4NJIA 1TCDA 4IX0A 1NF7A 4O1DA 4Y8FA 3C6CA 3R2GA 2Y62A 1OJXA 4RX0A 5T26A 3S1UA 1P0KA 4K8HA 1OFPA 4NQ1A 3L65A 3M47A 4KFOA 5TBOA 3G18A 2RDUA 3LOTA 3UQNA 3NGJA 1GYNA 2QAPA 1OYAA 1B9BA 4MFDA 3W7OA 1H61A 2VFDA 2H8XA 4O8RA 4E2DA 5CPLA 4FX6M 4TMBA 3LRLA 3W22A 4ZMGA 3TMQA 3L67A 2WPBA 4CNPA 1TTQA 3DFOA 5HWJA 1DBTA 3TXZA 1LRQA 3CTLA 3IVUA 3E12A 2YDAA 2TRSA 3LGEA 5K4XA 3BG9A 3GNNA 3UWZA 4Z0JA 1KTNA 1QOPA 5BRBA 4E2BA 3U2OA 4BI5A 3M16A 1FX6A 4QITA 4DQWA 4R7JA 2KZHA 5EPDA 4QSHA 3NYZA 4JTKA 5C2XA 3W1PA 3LHWA 4N9DA 5F4SA 2ZZ7A 2B7PA 4UTWC 1O5KA 1OFEA 1ZCOA 1C29A 3N2XA 1VCGA 2R8WA 2VKZG 3W7JA 2PRMA 4LRSA 3B0VC 2FLIA 1JCJA 3ZR4A 1B4EA 4I7VA 4FNPA 4TU1A 3OVPA 4MY8A 3LLDA 2WNZA 1H1YA 2ISVA 5CPMA 2VEKA 4Q32A 3W76A 3EX4A 1OX6A 3L0NA 2E68A 3CM4A 4NJGA 2C6QA 1BKSA 4GUHA 2QJHA 3RF9A 4MOZA 2OT0A 4IMDA 3AJXA 5LHFA 5EL1A 3GDMA 3TE9A 3STEA 3LTPA 1XBVA 5G4EA 5AHFA 3FKKA 4Z1AA 1M6JA 2CLHA 3MBFA 1IXOA 5H2ZA 2ATSA 1A5CA 3QQ1A 3W7DA 4XWUA 4OWGA 3LRKA 3HMJG 2E5CA 4J9JA 4UFLA 1H50A 2QCMA 3W85A 1UUOA 3MWAA 3QSRA 1OX4B 4MKNA 5G1YA 3UWYA 1GVSA 1XCFA 2JGYA 4NJJA 2VEIA 3LBCA 4PH6A 1F6PA 3G1XA 3O63A 3F03K 4LS1A 1R2TA 2VOMA 4LT9A 4PCFA 4ZVJA 2V8ZA 2CZDA 1WXJA 2PRHA 1K02A 3GYEA 3G1FA 1AW1A 3I6RA 5C6MA 5AYXA 3B04A 5AOUA 2DZSA 4RKAA 4YMZA 1MEWA 3EB2A 3WK3A 4A29A 5K9CA 3ABSA 2PC4A 2VENA 2H90A 1B4KA 4OE7A 1OFAA 1GVOA 3HPZA 3STGA 3NPUA 1F2JA 2VFFA 1KFJA 4UIOA 4QNEA 3S5OA 1TRDA 4FB7A 3NQDA 1ALDA 5DBUA 1OABA 3C61A 3MUXA 1K7FA 4JR5A 1G4TA 1LLWA 1XDLA 5LNVA 3MP5A 3P5YA 5FESA 4O50A 3EXSA 3NPVA 1LLZA 2I14A 4NJHA 4AXKA 5AYZA 3VFLA 3A24A 2ZCGA 3FOKA 2YX0A 3FFSA 1V5XA 2OMAA 4AH7A 1GG0A 3JS3A 3GB6A 3LCGA 3G22A 4JEQA 2NUYA 5AHMA 1PHQA 1JUKA 3BPWA 5HQEA 5I3GA 3FEMA 3B4UA 1N8FA 4UFMA 2ZFAA 3W7IA 3S9YA 1LRTA 4K7YA 1LRNA 4BI7A 5FF0A 4RCXA 1K8YA 1KM0A 4GUIA 1VLIA 2QCGA 5D37A 1TPB1 5I3JA 1F5ZA 4KWWA 4UC5A 3GDTA 3BGGA 1JQVA 3T40A 5AC8A 5DCEA 1WOAA 1I8JA 5D03A 4QISA 3S0CA 1SW3A 3C2OA 2NX1A 3UPBA 2ZZ2A 1OHLA 3NQGA 1VGAA 3YPIA 4JTIA 3EXRA 5D38A 3INPA 2X1SA 3LCXA 4PL2A 5SWUA 1TPUA 2R14A 2J27A 1RQBA 2YR1A 4R53A 3NVTA 5TQLA 3IGSA 3TC6A 2NWSA 3L9CA 1FDYA 1O94A 5HJLA 1B3OA 2V30A 4M19A 3R12A 1EPXA 2EAWA 5FF2A 3W88A 2ZZ6A 3M5XA 3DFQA 3UY7A 1YXDA 1QO2A 3T55A 4DPQA 1HUVA 1CI1A 1W5MA 4IMEA 4YXGA 4QNWA 2X1TA 4AHPA 3BW4A 2CLLA 1SFLA 3B03A 5EKYA 3OHIA 3UYCA 3N9SA 3NG3A 4JIPA 3W1QA 1L6WA 3I68A 3QPZA 1SQ7A 3N73A 1D9EA 3PY2A 2HTMA 2HS8A 1E51A 2C16A 1VZWA 2EKCA 5G2IA 4BK9A 5EY5A 5DBTA 3U6WA 4HPXA 1FY6A 4ALDA 3PR2A 3LCHA 2CZEA 3PB2A 3G1YA 1HO1A 3O06A 3MW7A 1O4UA 2WQPA 3G1HA 3S5NA 1WX0A 4UTTA 4NU7A 5LNSA 1GG1A 4NXKA 3GIYA 1H63A 5HWMA 4AWSA 1VPXA 2CLMA 4DO5A 4W9TA 1KFCA 2E5DA 5FEPA 4XTDA 1YDVA 1H7XA 3WJYA 4IMFA 1T99A 3L0GA 1VLWA 5I3KA 5K2ZA 2FPTA 2CU0A
chains in the Genus database with same CATH superfamily
2EBNA 1AL7A 1BVZA 1FWWA 1Z3NA 1TE6A 3LTYA 1FQ0A 1V7AA 1DYSA 3HV9A 3KL3A 4O0ZA 5FEZA 2YLAA 5E5CA 3T07A 2YA0A 2AKZA 1LOQA 3G3MA 2CZFA 4MDOA 7REQA 3Q37A 1M7PA 4AISA 1JCYA 4XKYB 1TVLA 2Y7GA 3ALFA 1JCNA 3VK5A 2C19A 3PBUA 4JFTA 1M7OA 1NWTA 1P6WA 3N15A 1WKDA 4B16A 1JZ5A 3UJ2A 4Y96A 3W7CA 1ODUA 1W9DM 3FN9A 2FHBA 1K8XA 3BAXA 2JKPA 2B7NA 4O10A 3W2UA 3CUGA 3UY8A 4GXWA 2VC6A 3H2MA 1HVXA 3V5CA 4IF2A 1RZMA 2E5BA 2VHLA 3GBEA 2HS6A 1C8VA 1KM6A 3A23A 4EF8A 1KFLA 3RLGA 1QPQA 4Y90A 1TA3B 1OINA 2VRKA 4M24A 1K6WA 3BW3A 3AXKA 3PFMA 2I5IA 4RZ5A 1VC4A 4GI9A 2A3EA 3D6NA 4TTGA 3AMLA 3DH7A 1VR6A 1EX5A 2ANUA 4EE9A 1QNOA 4QBXA 2Y24A 2NQ5A 4A8IA 4GBDA 3C0JA 4LB3A 3OW1A 3TZNA 4IQDA 2BNJA 4WLCA 1R85A 4WQ6A 4G5DA 1AW5A 1W6TA 4HHHA 4HPJA 3PZGA 3WLSA 4Z2KA 2HPIA 3TCEA 2A5HA 3B9OA 1VJSA 5F4XA 3BJSA 4H2CA 2ZWZA 5DEZA 1TV4A 2YKKA 1A4MA 2LLEA 3KUMA 4U10A 3WNLA 5JVLA 1OF6A 5IHRA 1WXYA 4L61A 1F6KA 2E7FA 4JHZA 3VO0A 2Y89A 3SGZA 1F73A 1A5OC 3W53A 2PTXA 3GXNA 1DIOA 5KMYA 1GVRA 6CGTA 1OIFA 4XZ9A 2L5HA 2I1OA 3D0CA 2R6OA 3ZWTA 1Q6EA 2ZUVA 3KHDA 2VD9A 4B3LA 3CHDA 4Q8QA 3MI3A 3SQMA 1MNZA 1G4PA 1PE1A 1HP4A 1CXIA 1GOQA 1JEZA 1RQHA 4IIEA 1XG3A 1T5AA 4UNLA 2ZUMA 4MUZA 5CC5A 1FH9A 3TYAA 3EMZA 3P62A 1V0KA 3RO6A 3SB0A 1F8MA 1A5UA 3WNNA 1BD0A 5BRQA 4DO6A 2DQXA 3RO8A 1FP8A 4RE2A 4NY2A 4WHBA 4OBSA 4C6FA 1Z6KA 3V18A 3DFPA 1BXBA 1IZJA 1TSIA 4DJFC 2DVTA 4M6QA 5KINA 3FHAA 4JCLA 4RZ4A 1KXHA 3GHUA 3VGFA 1TUXA 1AQFA 5DX7A 1JI1A 1SW0A 1ZBVA 3C0QA 1VJZA 4QJ1A 3UG5A 4QHRA 4BQ3A 1WCGA 1PKNA 1XLCA 4R3UA 4KEMA 2GGJA 2HK1A 2VGIA 2Y1HA 3WQ6A 3OA5A 3H8AA 1XRFA 1EQCA 3A5FA 1W5OA 4W7WA 5ABTA 3FK4A 3N9KA 1XLDA 4HCDA 1GQIA 4EWND 3U7BA 2QHAA 5ECVA 5BCAA 1UB3A 1B2YA 3KBMA 2YXOA 4R9XA 5HNNA 5E0CA 3KAOA 3WD1A 3QR3A 1MDLA 2YCIX 3DUGA 2OWCA 3V0SA 4IPJA 1TVPA 4H41A 3LX9A 2PD5A 4HZ7A 4MLJA 2ZADA 3A21A 3QRHA 3VTRA 3E38A 3CQJA 4QCEA 2E09A 1RJPA 2VZVA 4PCPA 1K8CA 3BOLA 4NHVA 4O4WA 1JCMP 3W84A 3LLFA 5AVNA 2ZVIA 3P81A 3TYUA 3H23A 2YW3A 5A6KA 3AS0A 1SO5A 2ZA3A 4IUOA 1MQRA 1FWBC 4GXMA 1XG4A 1EJSC 3NO5A 4O52A 2IQ0A 2WBGA 3PZVA 1XYFA 4ZB5A 3CMFA 2NT0A 4D8LA 1CB7B 5I02A 4DJEC 4LEQA 4Q6XA 2CHNA 4L1GA 4Z42C 2R24A 1R3QA 3PZ9A 1UWAA 3NSMA 2CPUA 1TIMA 5FAGA 2C3ZA 1BSLA 2DJXA 5D2TA 1OGGA 3IIVA 4CNOA 3GC4A 4F2TA 2IPJA 1H5VA 3AU6A 5D2YA 1K4GA 3GFXA 4TOQA 3RCNA 4AMAA 3NL3A 3L2MA 1W1TA 1EGZA 5BNKA 4OU1A 1F3TA 3UNDA 4QAIA 2G3NA 4AX6A 2BY0A 3DXIA 4B5NA 2W9MA 3VIOA 4OFCA 3TW6A 1UD6A 4PEKA 3AFBA 3TIMA 4WSHA 1PSCA 2VZOA 3WQEA 4QDMA 1YDNA 4CUCA 1KXVA 1QHOA 3LI0A 4W86A 3KCJA 2E6FA 1CWYA 1V7YA 4BEQA 1XRSA 1SZEA 3QBUA 2Y7DA 4QAWA 4JTSA 3OYXA 3C2FA 5HNRA 3LDVA 3QOMA 3G1SA 1S46A 4RL3A 4OOZA 3PZOA 4M7TA 3CHVA 4C6NA 3P60A 3CH0A 3GH4A 4XUYA 4L9XA 5I3FA 1NP2A 4HK6A 3BAYA 2VCAA 3C3NA 4F66A 2YBUA 4FNQA 3W1RA 1PYFA 5I7GA 3WH7A 2F7FA 3QW4B 3U7VA 4FOJA 2X42A 5HA7A 1RBOB 5FCZA 1JDDA 3P80A 4Q8PA 1NQ6A 3KRZA 2TYSA 1W56A 1L6GA 3W1MA 5HATA 3GKFA 1ZY9A 4YPJA 4LS2A 2F38A 4GY1A 1JZ4A 3PTMA 1BXNA 4PBFA 3CHEA 1A5LC 4CD4A 4U2YA 2ZXQA 4JTJA 2A6NA 4D6IA 3P84A 1WKEA 1T8XA 3ELFA 3W87A 4ZO6A 2GK1B 3KCOA 4CNSA 1VYPX 3ARYA 3LSCA 3BL3A 1IF2A 2GUYA 3HV8A 4F9JA 2NZLA 4TR9A 3L66A 1BSIA 3ABRA 1FWJC 1CB2A 4S23A 5BW6A 3C8NA 1E9ZB 3K4DA 4DJFD 4PUJA 2QVHA 3UWQA 4X9YA 4GABA 4HB7A 4YL2A 3L4VA 4KWVA 2I57A 5DMMA 1FHUA 3W00A 2GQAA 5LHEA 2WHKA 4IHCA 2NLYA 5BXSA 5CEWA 4NYYA 3WBEA 2Z1WA 3EYPA 1K3UA 3MSRA 3TC7A 3SGUA 2YCJA 3SIMA 4H9TA 4PFHA 4JHOA 2QDDA 3H6OA 1BTCA 2PLKA 3CZEA 3BSMA 3Q58A 2Z24A 1AZ1A 3CNYA 5A8MA 1Q6RA 1MQPA 3AWOA 4HU0A 4S3DA 1LL6A 1NFPA 2ZRYA 2XH4A 4R9OA 3HOJA 1WKYA 3TU9A 4FSAA 3R8GA 4CEUC 1JULA 2Z6IA 1W5NA 3QYQA 1A80A 2XIIA 3FDKA 3QR1A 2F6UA 3O7UA 2NWRA 4EIVA 1TTJA 1V0LA 2WVSA 5H1WA 4P5UA 1EJXC 1POKA 4L1WA 1OT1A 1KTCA 1GNXA 2E4TA 2P8CA 2R1KA 1UP0A 4W89A 1HKKA 5DT7A 1ICPA 1WUFA 4HSHA 1OG0A 2PP3A 2J78A 1Q13A 4IWWA 4FOUA 5HBFA 3BLEA 3PSVA 4BWLA 4MJ2A 3BW2A 5CGQA 4IXXA 1BRLA 3PWAA 3TOPA 1LYXA 1OGSA 4U33A 3S2LA 3AOFA 2P0OA 4AIUA 1JZ3A 3T8QA 3NL5A 1V3MA 1K8ZA 1FXPA 4I9AA 1Q6GA 4LY8A 1XLGA 2PTYA 2VELA 4C1NA 1OG6A 4HYWA 1S2TA 3AZRA 3AIEA 1W31A 3RM8A 4UTJA 4Q4KA 2QULA 3VNDA 3E0WA 4H6RA 2PU0A 1FTXA 4GIYA 3LGGA 4QROA 5J5DA 3DU0A 4FP1A 3VIIA 4NNAA 1PKYA 2JGQA 2O9OA 1KRBC 3LYEA 1UUMA 4I9TA 3MCNA 1XPGA 2Q8LA 1M03A 1CPUA 1AL8A 4HMNA 1IEQA 3IUIA 5U4NA 3RG6A 2IS7A 4FNSA 1TV8A 4G9PA 1JDEA 1L0PA 1CW2A 3NUKA 3WQFA 4ECLA 1LL7A 1XYZA 4HU3A 1QI3A 3H2OA 3N04A 4B91A 4GC4A 3EA3A 4B4FA 1UMLA 1ADOA 1EA9C 1KCLA 2C15A 3D47A 2PTWA 1QBBA 4ENLA 4NNCA 1X8FA 1SSGA 4WY0A 5CJ5A 2VGGA 5DY2A 1C9WA 3FS2A 3WCZA 1XBZA 1MXGA 3HPSA 3TJLA 1U2YA 3GDKA 2PDFA 1YTKA 3UR2A 3ABXA 3KFTA 5T91A 4BF7A 3NXLA 3TW7A 4Y6GA 3EA1A 3UXAA 1UZDA 4O16A 4Q8UA 1HFBA 2OLAA 2DW6A 4FMVA 2IXVA 2C14A 2WSRA 3TJXA 3FKRA 3JUGA 2I9UA 1XV8A 5XIMA 4O1AA 5H6HA 2GVYA 2WBKA 2ZTJA 1YE4A 3GDRA 4NZJA 3EWWA 1PX3A 3J7HA 3HGOA 3AYVA 4Q4QA 5JIPA 1AJ2A 3C86A 3A6OA 4L9ZA 1M5WA 1OADA 3PULA 1W5PA 1IT8A 2D24A 3MSGA 3W01A 1JZ6A 1YADA 1YLVA 3H21A 1Z32X 5D9OA 2G95A 4G8TA 2QUNA 4H8HA 3T08A 1I2OA 5HR6A 3IJ9A 4R85A 2YGYA 3THQA 2FVKA 2NT1A 4LPCA 2WJZA 3UERA 1UH2A 2HVMA 4OVXA 1RPXA 1NU5A 3TR2A 1HZYA 2QGHA 4AB4A 2VC7A 3AXMA 3FX4A 9XIAA 1H3GA 5H8UA 2X40A 2A85A 1RBLA 2YLLA 3Q65A 4RNHA 2PWEA 2Z00A 2O0TA 5EU9A 5H91A 1NDWA 4POCA 1JPKA 2PDMA 4M80A 4IGHA 2YBTA 1XI3A 2HVNA 4GGHA 3P0WA 3AMGA 1EBHA 1R3YA 2UY5A 2Z1XA 2RKXA 1MXDA 2P0IA 4KPLA 2FMNA 1AG1O 1W1A1 4AZ6A 3VDGA 1PBGA 4A2RA 3WLPA 3C2VA 4UMBA 1Q7MA 4D1IA 3SRFA 1OFQA 2KAUC 5EGRA 3I7QA 2Y70A 1R9ZA 4P61A 5AVHA 4IMGA 3GC2A 2GPTA 1RUSA 3EOLA 3BANA 1ZRQA 3QZAA 3OQEA 1AH4A 3LBOA 2CXEA 3KRUA 3NZPA 2A2IA 4QDPA 3QH2A 2WM0A 3T0DA 1JPHA 3UXKA 1YTEA 4M51A 3VC5A 3ATZA 4O12A 4WR3A 5F2GA 4DZ5A 5D09A 1YNQA 3CLMA 3OBEA 1U5VA 5C9XA 4AG0A 3QQWA 4MYAA 1QFEA 4KWOA 5CJMA 6REQA 2PC8A 3LM7A 5LZLA 1JVNA 4LB4A 5BU6A 1MO0A 3B9NA 1EJRC 3CWNA 4QM1A 3WO8A 3BG5A 1ITXA 3PVFA 3HG2A 1AVAA 2Y2WA 2OX1A 3BLFA 3AZTA 2BVTA 4Q3MA 3VOFA 4LUIA 3P61A 1S2WA 3TNBA 4KWUA 4AWTA 3FJ6A 4HJWA 3VOGA 2XGIA 1DE5A 1NFGA 1E3ZA 6REQB 5FL0A 4MSSA 3LV5A 4KGJA 3CASA 3M41A 3PTKA 4WSKA 4JD4A 1XM3A 2UY4A 4G1KA 5HJXA 2Q3RA 4DUXA 3L23A 4C6LA 3TDFA 1ZENA 4JIQA 2W92A 4PR4A 7A3HA 2V6AA 4MAZA 3OO2A 1PKLA 4L4LA 2V81A 5LGXA 2C1GA 4AIEA 1ICQA 3P74A 2QKFA 3S6OA 1BYCA 2W5FA 5GNXA 4LUSA 3W7KA 4R33A 1D8WA 4GZIA 5HQMA 2FZDA 2X2GA 3N19B 3M0YA 1RALA 3N6QA 4MWAC 3JR2A 4S39A 3WLOA 3R94A 4HMEA 3E2QA 1UW9A 5D32A 4XZBA 6PTDA 2IW0A 1HJUA 3O8AA 3WNPA 4GI8A 1POJA 3RMEA 1SPQA 3VKJA 3WF3A 4XBKA 1L8NA 3LHYA 4D2JA 1DJWA 2UY2A 1QI4A 3E0FA 3KL0A 4ZSUA 4ZENA 3WQWA 4O0QA 5C70A 3S8HA 1XQKA 4RK8A 1ZLPA 1BVWA 5HAOA 3AMKA 1WE5A 1Q4WA 1XUZA 1EWEA 1XLHA 1O1HA 3AO0A 1KFWA 5JH2A 4PTMA 3H7RA 5AZ0A 1VRDA 3XINA 1LG1A 4Z1YA 3VNZA 3ZWSA 4PCSA 1V0NA 3KWSA 2W61A 1N82A 4JX6A 3I3EA 1M53A 5FEXA 4GQQA 4XZWA 3G2GA 5EMJA 1JCXA 3MZ2A 3HFTA 4PTNA 5CZTA 4EKJA 1FHLA 2Z1VA 1W1VA 1ME8A 2C18A 2INZA 5AYIA 2VQTA 1PIIA 4RV8A 3WX7A 2YL5A 2FZBA 3M44A 3T81A 5CPOA 5IFTA 1PIGA 3VIFA 4GIAA 1PYMA 2WZEA 4AZGA 3RLUA 4J3ZA 3C2RA 2C13A 2C1HA 2J66A 4H9UA 1WZMA 4NJKA 3HGRA 4D6CA 3DFYA 1RD5A 4LALA 1UOZA 4S38A 1XLBA 1JI2A 1DTNA 4WXZA 3CQHA 4UZUA 4L64A 4UFJA 1EUAA 3RX3A 1QCWA 2MNRA 3AJ7A 4Q7IA 2ODOA 5DXXA 3IVSA 3P93A 3LZ3A 4O28A 4JFUA 2OYKA 1I4NA 1ZL1A 1C8XA 3OOQA 5KZEA 3CWHA 3B9DA 2E9LA 3IGHX 4PFMA 2O9RA 1JXJA 2UZ9A 3S9ZA 4LAUA 1OCJA 2BVWA 3W26A 2J6VA 4WZHA 3IIXA 1XUUA 2GWNA 3W83A 3G8RA 3TXVA 2AL1A 3G6LA 4FX7A 4UB9A 4QJ4B 1DJZA 3FJ4A 1W8GA 2ZX8A 5LA0A 1DL3A 1SO4A 3UJEA 3KOFA 3VM7A 2WJDA 3FYPA 4HQVA 2DZWA 2VC9A 4ACZA 1ODZA 4C1NB 1UR1A 3HG3A 1E9LA 2WVVA 2O4MA 3SURA 2ZC8A 4C1KA 3TCSA 3LQGA 1ONWA 5L9FA 1KM3A 1VQTA 5G2HA 1SZGA 3ARUA 1SJBA 3DAQA 3T6CA 4AYSA 2TAAA 3E96A 3IV3A 3M0KA 1UZ4A 4S3AA 4MWAD 3RRAA 3QW3A 4HOWA 2NV2A 3VMPA 1EA0A 1XSKA 1OYCA 3O6AA 2ZQ0A 3SY5A 3APYA 4CVUA 2X1RA 4J5NA 3LI1A 1KC7A 2ICSA 4XQ6A 3W7MA 3VA8A 2VYOA 1OQFA 4BQ5A 4N9EA 4QG9A 3L5LA 3N3TA 1J6OA 1JD7A 2P53A 1YX1A 2WSKA 5AHIA 3W07A 4NI8A 1DJHA 1JQXA 2D73A 3GTFA 3CEUA 2DZBA 2JALA 3C5QA 1N55A 3NDOA 1UQYA 3EPOA 4DLMA 1G94A 4E8CA 3KVJA 3DI0A 2QAFA 4LVFA 4B2DD 5I23A 4MKSA 1IXQA 3CV2A 1XBYA 4JTTA 3F2BA 5JQ9A 4HPGA 3TK7A 4DZHA 3OB8A 1VBUA 2RH9A 2G3JA 3L12A 1X7FA 2QV5A 5CC7A 2YL9A 2OCZA 4RNJA 2BS9A 3W2KA 1S2CA 5DCDA 1W8SA 1EGMA 4GA8A 1N2VA 2PCEA 4NILA 1UCWA 3K5XA 3PPHA 4F8XA 1E1FA 4ZB0A 3WBWA 4HNUA 1VHCA 4Z2LA 3GS6A 4FLRA 4O1DA 4Y8FA 3S5SA 3DG3A 2WZTA 3CAVA 4GY0A 5EMYA 1P0BA 3L65A 2RDUA 3NOYA 2QAPA 3TYZA 3QYSA 2PI6A 1OYAA 4TX6A 1B9BA 3UPMA 3W7OA 4DM2A 4IT1A 4O8RA 3MQTA 1CXFA 1LT7A 4F0MA 3TMQA 3MC5A 5CLTA 4EXQA 4YU1A 2OSWA 1W1PA 5CPTA 3TXZA 2Z28A 2ASHA 2QLYA 5K4XA 3CMGA 3BG9A 4Z0JA 2DEPA 1P6CA 1RJRA 4PTVA 3U2OA 4BI5A 1B31A 4RPPA 4R7JA 4QSHA 3ZLHA 3VNLA 4DBWA 3W1PA 4ZOBA 3LHWA 4N9DA 5F4SA 3WH8A 4UTWC 3HN3A 3QFWA 3SN1A 1C29A 4AZBA 3N2XA 4PMZA 5I07A 1E4MM 4NRRA 4TU1A 3TYEA 3OVPA 3EEZA 1RD6A 3UT0A 4X63A 3FGCB 1W1B1 1ZZMA 4PYSA 3W76A 1UHVA 2E68A 2P3EA 4MNJA 4GPNA 4P8XA 1NOUA 1BKSA 4LCQA 5CAKA 1JNEA 2W3ZA 4PCTA 4IMDA 4DX3A 2A3AA 1GJUA 3AJXA 3TE9A 3IS4A 7ODCA 4H9XA 1UD4A 1E56A 3O9NA 4A8LA 2VZUA 4Z1AA 1SVDA 1A5CA 3QQ1A 1EC8A 3CT2A 3LRKA 3HMJG 4NAEB 4UFLA 1I9CB 4E3TA 3MWAA 1OX4B 3FSUA 3MZNA 5I00A 1UPPA 2Y5JA 1E1CA 1OGBA 2PPGA 3ZJKA 2QDEA 1F6PA 5CBBA 3QR0A 3G1XA 1NELA 3IK4A 1J0IA 2VOMA 4YTRA 1A5NC 1K02A 5AYXA 3OVGA 4M56A 1IEIA 3V5OA 3OTRA 3WK3A 4Y7EA 1H41A 5KETA 4GOAA 3WLLA 3ABSA 2H90A 2GDVA 2EJAA 3U3HA 3VKKA 5LYRA 3GIQA 3LUTA 2WANA 3NPUA 3UCQA 1YNPA 2FVMA 3AUOA 4D72A 3BSGA 4UQBA 1PAMA 1UH4A 3NQDA 1ALDA 1X97A 2E8ZA 3AISA 1K7FA 4JZ5A 3MU7A 1G4TA 4ZOEA 2Z4GA 4GH3A 5FESA 4O50A 2BB0A 4NJHA 4AXKA 5AYZA 3VFLA 1QW7A 3A24A 4XAYA 2D3LA 2OMAA 2HCVA 3THUA 1GG0A 4JEQA 3GTNA 2WZHA 2YXXA 1PHQA 3THCA 1TX0A 3CUJA 5A69A 2VWTA 3K8MA 1CCWB 3PJXA 4CNUA 2ONEA 5DMLA 3ZO9A 1UKOA 4BI7A 4UQAA 1KM0A 1IEWA 1BYDA 5DF0A 3GDTA 3BGGA 1EZ2A 2FZ8A 5DCEA 3LU2A 1M3UA 1WOAA 3C2OA 2GLKA 4QXIA 1ONEA 2D23A 1VEOA 3RLHA 3KP0A 3YPIA 4JTIA 3EXRA 5D38A 4H9VA 1P43A 2X1SA 3LCXA 1KCKA 5LXXA 2PDNA 2YR1A 4AQLA 4HOZA 3BMXA 3GH5A 4FALA 2NWSA 5HJLA 3FXGA 2V30A 4A6GA 3R12A 1JXKA 1JGMA 2EAWA 4BJHA 3M5XA 1XIJA 2EKGA 2DUZA 3EBVA 3T55A 4IMEA 4HZMA 3OHIA 3I68A 2WPGA 5M1TA 2HTMA 1DQUA 1C91A 2C16A 3BJFA 4ZBCA 5DBTA 3R58A 4HPXA 3BAWA 4GCXA 3L2LA 4LAZA 3FYYA 3O06A 5BRPA 2WQPA 3AU2A 5A8PA 4UTTA 4NXKA 4F0HA 4AWSA 1DWIM 4DO5A 4W8BA 2XSBA 1KFCA 2E5DA 4UQDA 3WJYA 1T99A 3TN3A 1KXTA 1S2UA 1HL9A 4G6CA 2PWHA 2EG8A 1HKWA 3LCLA 3MB9A 3BG3A 3LS9A 1PTGA 3QGAC 1QBAA 4HJFA 1MEHA 3QMTA 3MYPA 1TPWA 2E6DA 3T0BA 2O56A 4MGGA 4ZCWA 3BICA 3KL5A 4AEFA 4JTEA 4MZ8A 4GYKA 4I6KA 3KOYA 3LG3A 3AROA 2I16A 1OZQA 1DWFM 1LBFA 4UQCA 3BH4A 4JKKA 3CU2A 4A3HA 4ZEPA 1L6FA 2OFJA 4Q8OA 4QX4A 1O7AA 3M0ZA 4H8UA 2E9BA 4DUVA 2ZDRA 4EPEC 3W6YA 1RPKA 4GZJA 2WC3A 4NG3A 4Z2HA 2W91A 2Y7FA 2JKAA 1W1IE 1NWSA 4W5ZA 2YCLA 3KEHA 2GJLA 2ZRVA 3N3MA 4R34A 4AU0A 4C90A 3N2MA 3EOUA 2Y6ZA 1UJQA 3MI6A 5JH1A 3EGJA 4BZYA 5HR7A 2ZOXA 1YPFA 4MB1A 4C6IA 3AIBA 1IQ8A 4MY1A 2J74A 1KD0A 1A49A 1OFDA 2VDIA 1UOKA 1HJQA 2VVNA 3AYTA 2QCFA 3N6JA 3OU8A 2O9TA 3MPGA 1NWUA 4QLKA 1M65A 3W27A 2WJFA 3GWQA 1QNSA 5TF0A 3VI2A 5C9ZA 3II1A 3QV8A 3WQDA 3UJSA 2DSWA 2CLFA 2Y5EA 4OHQA 1RVGA 3WK1A 3DCPA 3WNMA 1ISVA 5G4WA 3FA4A 3SY1A 4L6HA 4LUJA 1E0WA 2CLPA 4NAEA 1QT1A 3MMTA 1LBLA 4B2DA 5C5YA 1P0EA 1J11A 5FJTA 1IE7C 3TFCA 3S1VA 5H8PA 1GONA 5FACA 1UBSA 1SZNA 2ZXBA 1KM4A 2Y8UA 4J2MA 1JZ8A 1UA7A 3CWOX 3OZPA 1U1JA 4U5KA 3PG9A 4H8VA 3P5ZA 3PZUA 4MLRA 3WK2A 2BXYA 4GHRA 1KGXA 4GG9A 1XH2A 2PWFA 1BYBA 1BWKA 3UBPC 3ZZ1A 4LBUA 5IHSA 4PSRA 5F1VA 4NASA 4QTGA 2AQOA 2OOGA 4DXVA 1GCYA 2FGLA 2TSYA 4MWAB 3AMDA 4WDXA 1OK6A 3T7VA 1GYMA 4C91A 2OQLA 4S3EA 3TSBA 4C7GA 4GC3A 2IPGA 2VCCA 3VD3A 3UD6A 3DZ1A 4DEFA 1V6VA 3A9IA 4C6KA 1TR1A 1WXZA 4GFIA 4RJEA 3SUWA 4L65A 1QWKA 2POZA 3MUCA 4GUFA 2FQIA 4OOUA 1OSEA 2VX4A 3WMCA 4DJFA 4B5UA 1ELSA 1UG6A 4GXPA 1DHKA 3GYCA 7CGTA 3HGJA 1XIEA 3R8RA 3W1XA 1DORA 4TXEA 3BE7A 6ALDA 1JYWA 3FLUA 3EPMA 1O6IA 2ZICA 3T4CA 3OPSA 3ZXWA 2WMHA 2R94A 4D6HA 2QQ6A 1P7TA 4PUMA 1Y5VA 5F2IA 1X1OA 3RGTA 3VMNA 1CGTA 1SSDA 4DBDA 2CETA 1Z89A 3R89A 4IFKA 4OIFA 1H4PA 3ME3A 1J01A 2YBVA 4JOMA 4TV5A 3BOFA 2V67A 2I9EA 1VCFA 4J3TA 3HG4A 5J04A 2OELA 4HCHA 1B9ZA 2CC0A 5BMXA 4OJYA 2P88A 1GEHA 1C8QA 4JXCA 3B8SA 3G24A 3BAKA 3ONBA 3MVTA 2VXNA 3DHUA 3O05A 4BWLC 2GUUA 3WQGA 2QT3A 4PBGA 5AB3A 2GK1A 4IPLA 2CLKA 2JEQA 1X7IA 5GNZA 1KBJA 3L21A 4DIAA 2DY3A 4JKMA 2J7DA 2XH0A 3GTXA 1GGOA 3KS6A 3ZVIA 1A3HA 4TMCA 4H9ZA 1M01A 3GLCA 1CDGA 1X1ZA 2ZZ4A 2C8NA 3GAYA 1E0TA 1Z42A 5LIXX 4DWSB 3NEHA 5HMEA 1I2NA 1EEXA 3RCYA 3STCA 2VZTA 1XC4A 1VFLA 3FVDA 4HNTA 4JTAA 3S46A 1K9DA 2HDJA 1Q65A 2YYUA 2NQ9A 4CNNA 1R87A 5F4WA 1DJGA 4PL1A 3LMYA 1FCUA 2XM1A 3W37A 3LEPA 4XZLX 4X22A 5AFDA 4MJ4A 1DEDA 1PB0A 2ZA2A 1K7EA 4AIOA 1I60A 4RNFA 3CH9A 1NSJA 3L4WA 4UR9A 3ECQA 3MT1A 3WUGA 4OT7A 1W1ZA 3RN6A 3KS5A 1KWGA 2WYSA 3IIZA 1XPYA 1VENA 5A95A 1L9WA 4IQJA 5DMYA 3TA9A 3UA3A 1GJWA 1FH7A 1F07A 3QHNA 6TAAA 4AHQA 1ZFJA 1VP5A 3W7HA 2YIHA 2HISA 1TG7A 3AXHA 1TV5A 1EP3A 2OYLA 4NUWA 5CKSA 3UG8A 2XISA 5A3HA 4UTLA 1OEPA 1E6ZA 1H11A 2JF6A 3EX3A 4JL1A 2FVLA 3DBNA 3VFCA 1FBAA 2FB3A 3QSTA 5DO8A 2A21A 4HA1A 3B8WA 4O13A 3BCDA 2ZRUA 4XUGA 5CC3A 1J0ZA 1SFSA 3H22A 1AUSL 4XV0A 5HULA 4ILSA 4KS0A 2V5LA 3URAA 5A2CA 4INFA 4Z2IA 9RUBA 4GKTA 5G1TA 4ML9A 5BMWA 3UXLA 3R7MA 3OGSA 2J9XA 3VC6A 1MFVA 2UV8G 4B9ZA 1HL2A 1YXYA 3ZMRA 3U48A 4NL1A 4HTBA 2QDHA 3HPXA 2Y85A 1L6YA 2Q09A 1MEIA 1ENUA 1UKQA 1CGYA 1U33A 3SAZA 3UWUA 1TKKA 3NJ3A 3TUUA 1G6CA 4O1FA 1AMKA 1SO6A 7REQB 4K2SA 5LGZA 2G97A 5KZDA 5F7UA 3KCLA 3QHMA 1C9DA 2FZMA 3RX2A 4PMVA 2EO7A 3JU2A 3BTNA 3CK5A 4IQLA 1UASA 3M5ZA 3DHFA 3SECA 4U3AA 3GG8A 2WMKA 5L6UA 4GQBA 2ZXAA 1QTWA 3CAKA 3H2AA 1IT0A 3WMLA 2Q71A 4HP5A 1GORA 1J2BA 4DO7A 3W2NA 3O16A 3PUEA 2CLOA 3QPYA 1CTNA 2PA6A 1CXEA 2YB1A 5ABHA 3KTSA 4UR7A 4S3JA 4US5A 4ADTA 2OO6A 2BLEA 2YOCA 1PWLA 3DBPA 1LT8A 2I5GA 5DELA 3R5EA 5F2MA 4YTQA 1G69A 1KFKA 5J5RA 3PZNA 1O5QA 3GXTA 2V2DA 1GW1A 2CHOA 6XIMA 5D2WA 3S1GA 2A4AA 3RHGA 4QIUA 2PDIA 3N12A 5M5DA 1XR2A 4XZNX 5G5IA 2XVKA 4DY1A 5EMMA 4WDUA 5I5RA 1MZRA 4HYVA 3BGAA 1B57A 2W0UA 2B7QA 4E8DA 5CZSA 3KZPA 1OFBA 5MKGB 4GNKB 2E1DA 1KTBA 2VGBA 4EK7A 3HFYA 4V2XA 2OZ3A 4IZGA 1OC7A 2I5QA 4QSFA 3NQ8A 1O66A 4TIMA 3OGVA 4G56A 3CZ8A 4ZR8A 1H51A 2CESA 3GXDA 4F0LA 1E71M 1EC9A 1XSIA 2JFEX 4H6QA 4DJDC 1AFSA 4QE5A 2FTYA 3EWYA 1AD4A 1E4LA 4JTRA 1SM9A 1F3WA 3A4WA 3I7SA 4NZCA 4UXDA 4BY3A 3SN0A 4HPNA 1D3CA 4LY4A 3MV01 4JQAA 3BLOA 2OZTA 4BQ4A 1A5BA 4N42A 3QZEA 5IFPA 1T40A 1AQMA 1OFOA 3SJ3A 4PA8A 1MI3A 1A5SA 1K77A 4AF0A 4QQUA 5E70A 2J7GA 2FYMA 2DUAA 2EHHA 2P10A 4WY0B 1TIWA 3MCMA 3I65A 3LGDA 3ZFHA 5JU6A 4GJJA 1EO7A 5GQBA 4J3WA 2HXUA 1WKFA 2NLIA 1BQCA 4C6OA 5ENLA 3UNTA 3R13A 3SZ8A 4UNKA 1EEPA 5FL1A 2Y8VA 3FEQA 1M68A 1UUQA 2ZZ3A 1IZCA 3WFZA 3P7YA 5EA9A 1YNYA 5FF4A 4AVNA 2BZNA 5I3DA 3GRIA 2V5KA 2BVYA 2INEA 3CAWA 3EMCA 3LCWA 3TAOA 2WMGA 4W7UA 3OJGA 3T2OA 1VCVA 1PDYA 2Z1BA 4JTCA 1PUDA 1Q6DA 3GNPA 2OODA 4FR1A 3SI9A 3KBJA 1V02E 3CUXA 3TNOA 3QKZA 2ON3A 4X9SA 4AY7A 2Y61A 1KCZA 4DVOA 3K4WA 2Y0FA 3F4NA 3UU0A 4Q8TA 2HQAA 4CD8A 4J7RA 2RAGA 4H7VA 4CU8A 3CQ0A 4UTFA 4ORIA 3TEVA 4B5SA 3FCPA 1NDVA 2VOTA 1VD6A 2INFA 3G8EA 2Z27A 1UR3M 2PTDA 3RMJA 3NWRA 1QNRA 1QXLA 1F4HA 4MYXA 1ONRA 2YFNA 3WQ8A 3W7LA 4S3FA 1XYCA 1PZ3A 3S6DA 2IQTA 3A12A 3KBWA 1YKWA 4JIRA 1RH9A 4U3CA 3PZIA 4PMQA 2ZRZA 3GR4A 2FTPA 3RRXA 4GUJA 2J25A 3WDHA 4D9PA 2VNCA 5FF7A 2Q01A 3G0UA 3S2MA 4XBSA 1TWWA 2QV4A 1TPDA 2P8BA 3VOJA 3VZXA 4HZ8A 4BKNA 2BX7A 1TWIA 1QWGA 5GJNA 3VGDA 4UFKA 2BP1A 5AN7A 5D8ZA 3S6TA 1GOOA 1QPRA 5JMUA 4EXBA 4MAVA 5FAJA 4DUWA 4YNGA 1V6XA 3PTDA 4JFSA 4KEUA 5CG0A 3PPGA 1IYXA 3LHVA 3RFAA 3SCPA 1UH3A 1W3JA 1ISWA 4JKLA 3LRMA 1H7NA 5FJIA 1XLIA 2PDYA 3B8UA 1RSCA 5BXTA 4CQAA 3WH6A 3UYIA 5D02A 5MHBA 1TQJA 1K6AA 2ZA1A 1B30A 4H83A 4DELA 1PHWA 3MP3A 3CMJA 3KLLA 2BDQA 1TRIA 4I5XA 2XN1A 3PUDA 4MM1A 4X2RA 1KBKA 2OZ8A 1ML1A 4X3ZA 5A6AA 2J77A 2O7QA 1KLYA 4M29A 3K46A 3AHVA 4RDZA 4MZ1A 3NL6A 1O5XA 2PE4A 1V77A 2AMXA 4RDVA 2GJNA 3PZTA 4IISA 4LYKA 1F9CA 5A5WA 4FZIA 3IIOA 4FXRA 1UD5A 1WAUA 4MJMA 4O8AA 2HMCA 2G3IA 3B9EA 3EA2A 1TPFA 1EDTA 2NV1A 3WDQA 2PCQA 3FGCA 4YHGA 4IP7A 2WC7A 3FJLA 1ITUA 1MUMA 2TPSA 3N1AA 3OA3A 3STPA 3AUJA 3LXBA 5A6TC 5DMNA 2XWEA 4FIQA 1RLCL 1W9VA 3HG5A 2RDXA 2VX5A 3RCMA 4K1WA 4AXNA 4NKCA 1KFBA 4C1LA 1GQNA 1F05A 2PF8A 3C2YA 4F0SA 1QUMA 4M6VA 2X1UA 1I0DA 4MUPA 4OUIA 3PPFA 5IBXC 2QF7A 2V5JA 3C0SA 4AX7A 2W63A 3QY7A 4U28A 4JQ2A 3TSDA 4ML4A 1LQ2A 1GTEA 3VNKA 3M9YA 3ARVA 2X16A 3WJWA 1B90A 2G8ZA 1D2KA 1EF3A 5IXEA 1W3KA 5RUBA 4CD6A 4MVAA 3N14A 4UTIA 4AWUA 1QMLA 3V3WA 3F4VA 4EPBC 2EG6A 5A8OA 1MW3A 1DIDA 3S4TA 2EPHA 1P4CA 1F6YA 4NSBA 1BGGA 2J7EA 1K9FA 4GZ7A 4W8AA 4ACZB 4N2YA 2XM2A 2ZZ1A 2DSZA 2F6XA 2O7SA 2YDSA 3ITGA 2WKGA 3F1QA 2I7GA 5LSMA 1ECEA 3M5VA 1L6SA 1KBIA 5FJPA 2CITA 3TQVA 4AVFA 1OVDA 4DM1A 4RV3A 3MWCA 3W7RA 1J2WA 2WW5A 3BVJA 4RDYA 1QATA 4O4VA 2BOEX 2W27A 3W1AA 4E38A 3DEQA 1G7VA 2IKHA 4DNMA 3T4WA 2J47A 4BI6A 3WLHA 3A22A 3TMLA 1GPFA 3A4XA 4E4PA 3O6CA 4QDWA 2BFGA 3NPWA 3SUTA 3EWCA 1ISYA 1O95A 3ICJA 4HPHA 3HQNA 3CUHA 4DWSA 4U4MA 3DESA 3SSZA 1BAGA 2F2KA 3MO7A 1XLJA 1ZU8A 4O19A 4A22A 3GD6A 3W7NA 1US2A 3XIMA 2QNEA 3WLIA 4H3DA 3W29A 2PWDA 2GSEA 3RR4A 4O57A 4Q33A 1LROA 4ICCX 3VNIA 1ITQA 4O11A 3OZMA 3NM1A 4WSJA 5K7JA 3N9RA 2V3DA 1WBJA 2DZUA 4C65A 3LLXA 3WZ0E 1T41A 4WOQA 1HJVA 4WKAA 1WZKA 4LW7A 4GYPC 4LC8A 2FMOA 3PANA 4KT2A 4FEZA 3SCRA 4WX2A 2XN0A 3B8TA 3TSMA 1O1ZA 2VFEA 1R2RA 2DVUA 1EPVA 4DWDA 3Q94A 4JL2A 2QIWA 2WNWA 4A4AA 2IXUA 1W37A 1N8IA 1UA3A 1IWPA 1IWAA 2QYGA 4F9DA 1JRCA 1TMLA 2V9DA 3TWBA 4I8YA 3TFXA 3ISIX 1QPOA 1R2SA 1SJCA 4V15A 2J7BA 4GNVA 3EDFA 3WJSA 1E43A 1SGJA 5EB8A 4OKDA 1REQA 2PWVA 5C8BB 2PRLA 3FAXA 4K68A 3VE9A 1W2PA 3CUIA 1O68A 4FPSA 2XTKA 1JNDA 3E0VA 4LAMA 4ZQMA 1RY0A 4HHMA 3LHZA 4RZBA 3FNDA 3RITA 3L4ZA 2J4GA 3OVQA 4LBRA 1FDJA 3LV6A 1OX4A 3WD4A 3UF9A 3QLDA 2XZ9A 3BCFA 4K8GA 4N6FA 1PPIA 5MKGA 2OQHA 4MNKA 1WB0A 3KBVA 5CQ1A 2OPJA 4R7OA 2D20A 1JR1A 1IGSA 3IK2A 2VJXA 3CO4A 5JXQA 2FH6A 1Z69A 4JN6A 3MTWA 3UZ5A 1TWZA 4DF0A 4PULA 3VD4A 3TWAA 3JZUA 4Y9AA 4S3CA 1CGUA 1JAEA 2ZBTA 4AEEA 1GQKA 4K37A 2PDLA 3W73A 4M8UA 5CG7A 1A50A 2DH3A 2ISWA 1EDGA 2GQ3A 4EF9A 1HL8A 1V6YA 2J75A 4OGZA 2D2GA 4S2CA 2GGEA 4S3KA 4I6VA 3W7EA 2JIWA 1TV7A 2FJUB 1Q3NA 2VM8A 1TMQA 3DKJA 1SZRA 2OEJA 1R3TA 6ENLA 2E1WA 4TX8A 3DGBA 4J27A 3TQPA 4ZODA 3S1XA 1VKFA 3VINA 3I3DA 3AMCA 2GVJA 1CGXA 4GYPA 1MVYA 2Q3OA 2WOQA 2VR5A 1SMDA 3SRHA 2WLZA 2YZ5A 1GZGA 7PTDA 4XZHA 1HTIA 1WZAA 5E9AA 3CUFA 5D04C 4J40A 5IBXA 2VQUA 3CPGA 4K36A 3ARZA 1E0XA 1QRQA 4DBSA 2HNEA 4ZQPA 3R11A 4JTGA 5M03A 4IICA 2GQ8A 4IMAA 2F9RA 4WD0A 3DFSA 4DI9A 4L7ZA 2Q8ZA 3IEBA 2DORA 1XKJA 2DUXA 2NSXA 1NAL1 1VFOA 3TJ4A 1EZWA 4XAPA 2NXIA 1S2AA 2JKEA 3NQMA 4HZ6A 3KRBA 3M7WA 1SO3A 3S3GA 3H7VA 1I0BA 4QLJA 1DQXA 1TPH1 2WSPA 4Y9MA 2O4QA 1X38A 4YTTA 4GRSA 1P1MA 1QK2A 3NQ2A 4L6DA 1FRBA 1UD2A 1OT2A 4ZQOA 2EJ1A 5KZMA 3A3HA 1WO2A 1AA1B 4V27A 3VABA 1U5JA 4ADUA 1P6BA 1TREA 3HQOA 3WEOA 1E0UA 1XLMA 4IX0A 3TYDA 4KF1A 3LPOA 3C6CA 1FWGC 1OJXA 2Y62A 3F5KA 1KWKA 3WMBA 3SJNA 3M47A 4KFOA 2D3NA 3MUZ1 2VRQA 1Y5WA 3NGJA 2BOFX 3JW7A 2D69A 1KRCC 5A6JA 2YJQA 3WH9A 1CGVA 1E5JA 3ARQA 4E2DA 3BC9A 5D9NA 4FX6M 3V0UA 3L67A 3QV6A 3N4EA 2WPBA 4J3SA 3MUIA 4PUKA 5ECUA 5HWJA 1UR4A 2XG9A 2PF0A 1WP6A 2TRSA 1E72M 3LGEA 5CPQA 2REQB 1X39A 7ENLA 2XINA 2PTZA 1QOPA 4E2BA 3LPPA 2GOKA 3BJTA 1MNSA 3ZIZA 4AZ7A 4DB7A 5C2XA 3CS2A 3D3AA 3UZYA 2WCSA 2FHCA 2J13A 4RE0A 1PO9A 3W7JA 4LRSA 4I7VA 4CU6A 5M3WA 3TYCA 4MY8A 3LLDA 8A3HA 5XINA 1O5RA 2RUSA 3UCCA 1KRMA 3OODA 3MY9A 3ZJ6A 4H2HA 3EX4A 3E2SA 3FJNA 4Q4OA 3WDJA 1QHZA 2Y5SA 4GUHA 4QRNA 3UWEA 2ZIDA 3S83A 1XBVA 2PZNA 4MPKA 1Z8AA 1XW8A 2O9PA 2ATSA 4PTXA 5H2ZA 1XCWA 3W7DA 5B7ZA 3W25A 1H50A 3HU7A 4D71A 4MKNA 2CIPA 3UWYA 1ZPTA 1EHAA 1UYQA 3AICA 3UXIA 4ZO8A 1BXCA 1VFFA 1BRLB 1QHPA 1WDPA 4OTKA 3F03K 4LS1A 1S39A 3KLKA 4XVEA 2XIJA 4EACA 3IJ8A 1R9YA 2V8ZA 3GYEA 4R27A 4WJXA 3B04A 4KIRA 2JIEA 1RA0A 4L80A 4RKAA 4YMZA 4FS9A 4Y9NA 5I2UA 4LUTA 4OE7A 1OFAA 1J8VA 3HPZA 1J10A 4P7RA 1MRQA 4YHEA 3H7UA 2WCAA 5J8LA 4UIOA 1C90A 1XLFA 3SFWA 1TRDA 4FB7A 2PGFA 5DBUA 3MUXA 1XGEA 4JR5A 2WVTA 2X8RA 5D9MA 1LLWA 2UY3A 1HF6A 1NY1A 4C6MA 3GVQA 2PEVA 3W0KA 3VIJA 1IT7A 1E55A 2YX0A 3FOKA 3OLEA 3Q4DA 3SEPA 5HXMA 1R38A 2PWUA 3GTHA 4AD3A 5C9WA 1QI5A 1VBHA 3BPWA 5FJRA 1JFHA 5I3GA 4JIEA 5D4YA 3CZLA 1LRNA 3MDWA 1IV8A 5HK4A 2BBFA 1VLIA 5D37A 5I3JA 4YN5A 1F5ZA 4UC5A 4W88A 5CBJA 1JQVA 3CQKA 3N13A 1AJZA 2PDUA 4NZ1A 4WGXA 1OC5A 3W82A 1XLKA 5E0FA 2NQLA 1LWJA 1F3EA 4PL2A 4KBXA 4W4QA 1TPUA 1CLVA 4R53A 1NARA 2W66A 5GJPA 3TC6A 4F0KA 3SUVA 4GQ0A 4M19A 1EPXA 3CZKA 2WVUA 3R0KA 3DFQA 1QO2A 3BLLA 1CI1A 3FVMA 4M82A 2H9AA 4YVVA 3RYSA 1UD3A 4QNWA 4AHPA 1DWJM 2CLLA 3PJWA 2XVPA 3B03A 5EKYA 3UYCA 4QP0A 2MANA 1L6WA 3QPZA 1SQ7A 1ADDA 3SBFA 1E51A 4JAWA 4BK9A 5EY5A 2WWCA 4D6EA 3PR2A 3LCHA 2QZRA 3PB2A 1KR1A 1WX0A 2OWXA 4XISA 1H63A 2V3FA 4I90A 4Y9OA 1M9HA 4W9TA 3NTYA 1H7XA 1A0CA 4M0XA 5CSUA 5I3KA 5K2ZA 2CU0A 1LCOA 2E0PA 3TTEA 1Y5XA 1XH1A 3GW3A 3TN6A 3KDOA 4F48A 4XIMA 4RZ6A 1UKTA 1VB9A 3EEGA 1T6MA 3MKCA 4UMCA 5I0DA 1DIEA 2G96A 3NQ6A 1OD8A 4HMDA 1VRXA 3G1VA 2HXTA 4S1FA 4CCEA 3RPMA 4L1XA 5BOEA 1Z9AA 3QTGA 3ABQA 3R0UA 5HUOA 3UCDA 3F2DA 3EX6A 3LERA 6TIMA 5HMFA 3KXQA 2D2OA 9CGTA 3OIXA 3H2FA 3PM6A 4ZTYA 2YW4A 5BU9A 4US5D 5FKYA 3H55A 5JIWA 2GVLA 2VR4A 1RP9A 3T2QA 3V16A 1BF6A 2ACQA 2FZ9A 1QO5A 5E0KA 3MO4A 3TLLA 4CVWA 1K7XA 3VOHA 2XYLA 3QMRA 4UTKA 1FFRA 3U9IA 5F1UA 5A6LA 3AWNA 4XG1A 7TAAA 4B5TA 1Q63A 2YCEA 3ITXA 3UJRA 5DRCA 1FH8A 1D3HA 3A3XA 2A3HA 5AC5A 1J18A 1VYRA 2J88A 2QW5A 3PUGA 3W6LA 4BS0A 5CLWA 4MJZA 3BQ6A 3B05A 1T7LA 3QN3A 4YCPA 3NCOA 1IEVA 3EKGA 4JTLA 1PTAA 4AUBA 3OG3A 1XINA 3NQCA 1QNPA 3GAKA 1XHGA 4F2BA 1BLIA 1XRVA 1TYGA 3OG2A 2IMRA 2ZUNA 1KW1A 1EOMA 1A4LA 4IOTA 4E4FA 4MFEA 1LZOA 2AL2A 4LAOA 2WMIB 1CZ1A 3FSTA 4PN2A 3L4UA 3N25A 3ZR5A 3SRKA 4GO9A 3TONA 1B1YA 5CSSA 4Q4PA 3NPXA 4JPGA 4HOXA 2POTA 3WLTA 3FDGA 1XDJA 2DJLA 3ABOA 1LDCA 3DERA 3WF0A 4K38A 3T0TA 3TC3A 5KTLA 3ZJ8A 1B5TA 4HN4A 5BWFA 3VD7A 1TV2A 4GFSA 4GVGA 4ZQCA 3N11A 1ZAHA 2QCDA 2QCHA 1VF8A 3WLNA 5PTDA 4ZO9A 3K2GA 4KRTA 3QTPA 2Z7KA 1S38A 3UR8A 3KRSA 3SCSA 3VD5A 3GIPA 5K3VA 3VXGA 3WF4A 4CQCA 3BUVA 1WDSA 3FA5A 1K9TA 1ZBWA 1XIHA 1CXHA 3GKAA 2DSVA 3VILA 4O0KA 3KW3A 5JBEA 3ES8A 1FFQA 5TIMA 4PRWA 4LJ3A 3T2PA 4O18A 1JG9A 4J2PA 4JBRA 4LSBA 1TUFA 3CL8A 4CQ8A 4GZEA 4US6A 2NV9A 3PUOA 3EKZA 1JDCA 3A9BA 4LGXA 1DWHM 1WA3A 1TMHA 1JRBA 5IOBA 3DI1A 1DWAM 3C4UA 2HSAA 3PSWA 1FHDA 4UTUA 1DOSA 1VS1A 1VH7A 4K6AA 1J93A 2W6RA 4JYEA 1JZ2A 4UOZA 2X7VA 1YYAA 1XIDA 1KFEA 3OZOA 1TO3A 3V1HA 3AXIA 1MXSA 2VX6A 4C6PA 1W0MA 4Q8NA 3U8GA 2QXWA 3VNJA 1QR7A 2R91A 3WQPA 3C52A 3H26A 2QPSA 3LPFA 1YBQA 3B4YA 3KTXA 3ZT6A 1BVNP 4R88A 1TA3A 3QLLA 2WWDA 1EXPA 3MHGA 3M0MA 2GJRA 1TJ0A 2PURA 1BWVA 2P3ZA 1DKWA 3ANVA 3VUPA 2AKMA 1OD0A 2FGBA 4QGCA 4HVXA 3PP7A 4S3BA 1VBJA 3B8VA 1W17A 4CEXC 4C60A 3M0VA 1P7TB 2X09A 3WEMA 1ZQ5A 4HBKA 1UKSA 4K1GA 4CLMA 3AS3A 1K9EA 1UWQA 3C8FA 3PAJA 3L68A 2C71A 4CNTA 5BOOA 3GDLA 1GWJA 2W4XA 3NQAA 4Y2WA 3TTQA 3EWXA 4GX8A 4GQGA 1TZZA 5EBUA 3DX5A 3UZZA 4MB5A 5AHNA 1R30A 2YXGA 1V3LA 2OZ0A 3IAPA 1W3NA 4IP4A 4XTIA 1YPIA 3W74A 4QJ3B 2Z2AA 1JFXA 2OX4A 1XICA 1OK4A 4ZXLA 1OYBA 1HN1A 3MMUA 3UW6A 1H1ZA 4ONVA 1UIOA 2R82A 1XDMA 5C0QA 3D46A 4RE4A 4ZL1A 3H4WA 3W9ZA 3P82A 1XD1A 5D9PA 2FPVA 3VDCA 3R6IA 2VUYA 1V4YA 4GI6A 3KBNA 4UFHA 3GE7A 3U5UA 3MJYA 4AC1X 4FLOA 5LXEA 5KZ6A 1D7KA 2PGWA 4UWMA 4IH3A 4UZSA 3SUSA 3P3BA 2EPOA 3ARPA 4KRUA 4JGDA 5EMKA 3UXDA 3I10A 3VNMA 1WAWA 1Y65A 3IRSA 4LCSA 2FDMA 1Q8AA 4XD6A 2QMKA 3E02A 4IX2A 1E4IA 1H7WA 4S2BA 4P8VA 3NOEA 2ACRA 5HNTA 4HKPA 4ZZ9A 3WBAA 2E6YA 5A2BA 3ANUA 2HJPA 3PN8A 4BF5A 3VGBA 3GW0A 1ECQA 3BV7A 2YDRA 2CWXA 4GWEA 3BO9A 1EF2A 1NWRA 4G7FA 2GDUA 2WNNA 3VCCA 1SJDA 1G67A 1LG2A 4N4QA 3JVAA 5BXPA 5I3IA 1VHNA 3USBA 2QCDB 4CN4A 2H3DA 3CB8A 4CU7A 1ZHAA 3GXMA 4L6OA 4OBTA 4DBUA 1S3TC 1S5NA 1T8QA 2H6RA 1QJWA 2D0HA 4HHPA 3MYOA 3TH6A 2HEJA 1TB3A 3PJTA 4L4PA 1LQAA 4GJ1A 3F4WA 1NOFA 2QPUA 3N18A 5DT5A 1YRRA 2FDSA 2DT1A 4H4IA 3ZYZA 5EMLA 3T09A 1XWYA 1DP0A 1JPDX 3EOOA 2ZX6A 1QI2A 4WDTA 2YFOA 2XVGA 4FF7A 4UTWA 2Z2UA 4OV4A 4WGHA 1XL9A 2Z0IA 1E0VA 2VEGA 3MHFA 2Z6JA 4Q4MA 3HB9A 2A7NA 1WQ5A 3HMCA 4L56A 4C5YA 4IIBA 1BWLA 4I7WA 1J5SA 2JEPA 3U57A 3IGXA 4RW5A 4W5UA 1R86A 2NVDA 4K8EA 1NDYA 2F8QA 4MB4A 3PAOA 4JIHA 1KBBA 5CPSA 1C7SA 4KWSA 3EDDA 3WQ4A 2VP8A 2OB3A 1LM1A 3N29A 3UVIA 3VOIA 5CAHA 3OEXA 2WV8A 3P2VA 1GJPA 3OVRA 4J4KA 2JBMA 5JBDA 2WHLA 1G9HA 3GK0A 1ZJHA 4TX9A 3UG4A 2QGYA 2ISDA 4GI4A 1W54A 1B3ZA 4MDPA 1OIMA 4NF7A 3NGFA 3KTCA 4PGLA 1R7OA 4MZYA 1NEYA 3WL0A 4D6GA 3ARSA 3WQCA 1E73M 1WYIA 4GCAA 3A13A 4KCTA 2D22A 4H7ZA 3QC0A 2NUWA 1UWRA 3MUAA 3W7QA 1LTDA 2A3LA 1HX0A 3M0IA 3I6EA 3WD0A 2NQZA 3QY8A 4W93A 4AF0B 4LXFA 4ZGYA 2XVNA 3CO8A 2VL4A 2EPLX 5LA2A 2GFTA 1J0JA 1W3HA 4MWAE 2OR2A 2OQYA 1XFBA 1IEXA 2BODX 3T44A 1I1WA 2QR6A 4PBEA 3VUSA 1Z41A 4MWAA 1WDWA 1RK5A 3F4DA 1GOIA 2DZXA 1QK0A 3W23A 4M7SA 3GVRA 3B0XA 4NXSA 1Q6LA 3CHCA 1FOBA 1TJPA 3O0FA 1BFNA 3ORWA 1FCVA 3APTA 3K1DA 2FGZA 3H2CA 1Z48A 2DU2A 4WJ8A 4IJCA 2YPIA 4WUIA 3UWWA 1A5MC 4DWSD 1Y8BA 4JTQA 2BGSA 5U7SA 2X2YA 1E3XA 4NVTA 3W71A 4PTWA 4ZA0A 4IPIA 1V6WA 1S5VA 2XGZA 3KBSA 3MV11 4GACA 1S1PA 2XSXA 4A3YA 4HU8A 5DXYA 4A3UA 4M6PA 3MANA 3SCQA 5TAOA 4IFOA 4JQ4A 2HNHA 3BSHA 1DXFA 2Y7EA 1GQLA 1CXLA 1AK5A 4W84A 1MMFA 2BHYA 5T9CE 5MF5A 1RHCA 1VBRA 2AMGA 3ZVHA 5AC6A 4RPQA 3T78A 4P2VA 3CL6A 1ESWA 3CXOA 3RM4A 1GQJA 3QMSA 1X6UA 3MI2A 3WG6A 3TKFA 3K4AA 3CT7A 4EX4A 3GZ3A 1W3IA 1SR0A 2Z1SA 3G5EA 1KM5A 2GUBA 4DJED 4DJEA 1FWRA 4QQ3A 2VEMA 3PBYA 1HJXA 5LNWA 3V36A 4QJ5B 3LCFA 4W85A 3LTSA 4F79A 4KCWA 3GH7A 4QS5A 1WOBA 4BQ2A 1WV2A 1R9XA 3DFNA 2Y8KA 4HIBA 1EUNA 4IGSA 3VZZA 3M1ZA 3Q2DA 4R5EA 1KA9F 4IM4A 4MB3A 4PMXA 5AYYA 3D3FA 2NXHA 3WL1A 1LL4A 4UTHA 3E3HA 4KKXA 2BXZA 3VM5A 4FXJA 4DZIA 2XGBA 3WBYA 4JFVA 4NRSA 1A5AA 3UETA 5IM51 2CWNA 4N0RA 2J79A 3MA8A 5HNUA 1PX8A 2V38A 3T1GA 2XH7A 3A5VA 4CCCA 1VFTA 4PB5A 3K8LA 5DN1A 5CC6A 2BHZA 1DVJA 4NX0A 3PC0A 4JTDA 3MDUA 4C7DA 1X6LA 1EJUC 2DT3A 1E6SM 4DAIA 1KV5A 4GYFA 3MJMA 4AIBA 4W7VA 1QAPA 2PDWA 1QU4A 3HQPA 3SQSA 2IPFA 3E74A 4KERA 4UOJA 5C54A 1E40A 3REQB 4TVUA 4PMYA 1Q8JA 2DW7A 3L4YA 1IZKA 3IGUA 4PUEA 2ATMA 3OLGA 4GBUA 4X2PA 1H1NA 1GOWA 3WBXA 4ZQRA 4Y8EA 2FIQA 4PMNA 1HJWA 2QJGA 3QM3A 3S2CA 3HPFA 3THDA 2VT0A 1DPMA 1JF6A 3OLDA 1V6TA 1G4EA 1EC7A 2JK2A 2WMFA 3UGRA 3VE7A 1K70A 4L9YA 3VDHA 4V33A 2BWGA 1XYAA 2VC5A 4KGLA 4UTMA 1EWDA 1FA2A 4I5RA 5CCZA 4FNTA 5EYWA 1ZBKA 3FW6A 1M04A 5BROA 3GNXA 3I4EA 1W9BM 2GYIA 2XDFA 1V3KA 3B8DA 4FNRA 4I9JA 2WVVB 2VTFA 3W1LA 1Y7VA 2GGIA 4I5UA 4NT0A 3IV8A 3WFLA 1FWIC 1Q6OA 3COTA 5FSEC 3TTOA <