1HO1A

Crystal structure of pyridoxine 5'-phosphate synthase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
242
structure length
235
Chain Sequence
b'AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRIDOXINE 5'-PHOSPHATE SYNTHASE
molecule tags Biosynthetic protein
source organism Escherichia coli
publication title Structural basis for the function of pyridoxine 5'-phosphate synthase.
pubmed doi rcsb
total genus 93
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ho1A00
4A3UA 1SO6A 1NAL1 4CCCA 1FXQA 3P84A 2G95A 3RF9A 1WQ5A 5D09A 5D37A 4UTUA 2ZA1A 3P67A 4TO8A 4CCEA 4B5NA 5T26A 3WFAA 4ADSA 2X2GA 3TKFA 4FXRA 2RDUA 5AHNA 2NXGA 1BWLA 3W74A 4GBUA 5IBXC 1HO1A 3QFEA 2DJLA 4WD0A 1G67A 5D38A 1XL9A 4YCPA 1FWRA 1X8FA 2Y61A 5BMWA 2VKZG 2E1DA 3LB0A 4YCOA 4WY0F 5TBOA 3A21A 3LCIA 1W5OA 1X7FA 5I3JA 1GVRA 3QSRA 4PTNA 5AHEA 3B04A 2QCDA 3NQMA 1YDOA 3PWAA 1WXJA 1FWWA 1OFQA 2HS6A 2TYSA 3MBDA 1O5KA 4MIMA 4MFEA 2BXVA 5CZSA 1QCWA 4O11A 3U8GA 1YXYA 5CZJA 5EA9A 1C9DA 3O16A 3QPZA 5K4ZA 3RU6A 2ZYFA 3QSTA 3CHVA 3M47A 3L2IA 1LOQA 5CPNA 1QDSA 1JCXA 2E5BA 4L4MA 1I45A 4TMCA 5HR7A 1DQWA 1N7KA 1RD5A 4K8HA 1L6YA 3HB9A 1CX9A 3TC7A 2YYUA 3G1HA 3W3OA 1P0KA 1XFBA 3NR0A 5CG7A 4ZQNA 3N9SA 4HNUA 5CZTA 3DBPA 1F05A 5A5WA 2TSYA 3I7SA 3KVMA 3NYZA 4K39A 1KM1A 1ZNNA 4O0ZA 1TTJA 3HG4A 3NQ6A 1ZAHA 3W23A 3ELFA 3TX9A 3UY7A 1YDNA 2WPBA 3E02A 2VFGA 2HTMA 4ZQMA 3BG3A 1TCDA 4LRTA 5DLCA 4GJ1A 5FI8A 2GVLA 1JUEA 3I7RA 3ZR4A 4FXSA 1AG1O 3G1FA 2CLKA 4FX6M 1X1OA 4FNUA 1Z44A 2EGZA 4OV4A 1ZENA 3DH7A 5K4XA 3ZS4A 1SZEA 1W3NA 3PM6A 5F1VA 4OWGA 4M6VA 3NM1A 5LNSA 3ABQA 3DFNA 5F1UA 1W31A 3E49A 5FF0A 1GQNA 2NXIA 5AHFA 3HIJA 1XDLA 3GXTA 1XDMA 3HGRA 1VCFA 3H53A 3NXFA 4EVZA 4N02A 1OFRA 4UFIA 1PHQA 2Q3RA 2GQ8A 4PL1A 5HQEA 3TAOA 1P4CA 1SQ7A 3I7QA 2R91A 4O17A 4FEZA 4R34A 5F4WA 5LGXA 3F4NA 5AB3A 3DFOA 4PC8A 2DJXA 4FX8A 3O15A 4IXHA 4ZVJA 1KM3A 1M7OA 3W7JA 3PBWA 4LT9A 2YPIA 2I9EA 3O6DA 2CLLA 4XQ6A 3BGJA 1J4EA 3NEVA 2TRSA 3TCEA 3DFTA 1NSJA 3CWOX 4HPXA 1PL9A 2E6YA 3CLMA 4ZQOA 2BLEA 1JULA 3IIXA 3WJXA 2ALDA 1TTPA 3W2LA 1KV5A 2P10A 3TXZA 4QM1A 1BWKA 1SR9A 1ZAJA 4Z1AA 1H61A 4KFPA 3PSWA 3M0ZA 2ABBA 3MI3A 3IGXA 3DHDA 3MJYA 5HULA 1JCLA 3LCWA 5AN7A 4J9JA 1ZFJA 1ME7A 2C19A 3L21A 8TIMA 4MLJA 1EA0A 3IVSA 1DV7A 3QEZA 3RLUA 1R46A 5G4EA 1ICQA 2QR6A 3FA5A 2Y85A 4A29A 1Q6LA 4HKPA 3GB6A 1CI1A 3HQ1A 3BG5A 3BLEA 4FNQA 1DQXA 1F74A 3MHGA 1W56A 2Y63A 3S5OA 3SY5A 3M5YA 5BRBA 4MUZA 3W88A 1R47A 1WX0A 1QMLA 2VEIA 1P5BA 3GKAA 2ZRUA 4UFJA 2YDAA 3NGJA 3T55A 1LZOA 3R2GA 5I3GA 3QYQA 3CU2A 3LHZA 5DBTA 4K37A 4JYEA 3BW4A 3LCLA 1SFLA 3B4UA 3MHFA 2CWNA 4X22A 2C14A 2GJNA 3QZEA 4UR8A 3BK0A 1YTDA 4X3ZA 4NQ1A 1I4NA 5J5DA 4MZ8A 3KHJA 1JCJA 2H8ZA 4D2JA 3GK0A 4M7TA 1EP3A 5C6MA 3LERA 1W1ZA 2VELA 3SZ8A 4Q33A 2HS8A 3W1MA 2A85A 1G7VA 5FEPA 1N8FA 1H7WA 3VE7A 1MSSA 3MP4A 4BWLC 2B7PA 4X2RA 4Y96A 2V9DA 4O53A 3LV6A 2A7RA 3UZJA 3IGSA 1H1YA 1TIMA 3WJSA 1MO0A 2ZFAA 4EWND 2HSAA 3KRSA 2WKJA 1A5SA 3IIPA 4LOCA 3TSDA 1TTQA 1VGAA 1PV8A 2J88A 3PB0A 1FWNA 2WSRA 1X1ZA 4RZ6A 1SUXA 4Z08A 2E68A 2QUVA 2VEPA 1VH7A 3EWWA 3VI2A 4FIRA 5AHIA 4JN6A 3WJWA 4ALDA 1XBYA 3PUOA 4YWIA 5U7SA 4AMAA 2A5HA 3FLUA 5DXYA 5DN1A 1SZGA 2ZDRA 4MJZA 3RFAA 2Y7GA 3TNOA 4CLMA 5C55A 1ML1A 4OT7A 5IM51 1PS9A 1LRTA 3M9YA 4IMCA 1GEQA 1MEIA 1VYSX 4KFNA 3GDTA 3STFA 4AHPA 4NJKA 1G4EA 5HWJA 5I3FA 6ALDA 1JR1A 4HT3A 3L9CA 3LXAA 3LHTA 4LTSA 3EWXA 1HO4A 3W2NA 2ZBTA 1UASA 4W9TA 5KSWA 3LI0A 4X9SA 4O54A 1LDCA 2AGKA 5CPLA 3EX1A 1H50A 1OFDA 5D33A 4K8EA 1W54A 3TROA 1VLWA 5LZLA 3GR8A 4RXGA 3KX6A 3W1UA 2CLIA 3L0NA 4QQ3A 4NVTA 3VCRA 3A24A 2QUTA 5CKSA 3DGRA 2E6AA 3HGOA 1W8SA 4RX0A 2X30A 4UFLA 2YXGA 4JY8A 4HHPA 4M19A 4KKXA 3GX9A 1KTCA 1CW2A 4O14A 4UC5A 4XBKA 3UXAA 5G1TA 1FCQA 4A22A 3SGUA 3BGGA 2DZUA 2Y89A 3T40A 5HR6A 1W37A 2GPTA 1JJKA 5IBXA 1GVQA 3MBFA 4GE8A 2GQAA 2YFOA 3KVJA 1B3OA 3A9IA 3N9RA 2QCCA 3W76A 1VYPX 2FB3A 5EBUA 1XBXA 4DO4A 3LCXA 4LC8A 3FKRA 4GWEA 3ZWTA 1LOSA 1NFBA 4LVBA 1IXOA 1TSIA 2XN1A 3A22A 2FTPA 3O6CA 2RDTA 1IIHA 2DP3A 1JVNA 4IX0A 1S3HA 3C0JA 4O50A 5AHLA 3W85A 5KTLA 3R5EA 2GVJA 1F6KA 1R2RA 3C8FA 4WZHA 2CW6A 2CU0A 4O1BA 1HL2A 3TQ0A 1O60A 1T8XA 3HGSA 1EEPA 1W5PA 3LHVA 3QMTA 3B8DA 4JTJA 2WOQA 3M5VA 5G2HA 2A2IA 1K7XA 1X6UA 4FHAA 1WAUA 1LYXA 3NAVA 2PC4A 4RKAA 1D9EA 3EB2A 3DKLA 4ML9A 3STCA 5FF4A 5FF2A 1LCOA 3W7PA 2Q8LA 3P62A 1SSGA 3MI2A 3R89A 3GDLA 1SW7A 4IXXA 4RXFA 3OVPA 1ALDA 3PBUA 1IXQA 3O06A 1G6CA 2B7NA 4JTLA 1VC4A 3V1PA 4XKYA 3NQ7A 5G5IA 3DFQA 1PVNA 3NPVA 4NXSA 2YZRA 3S1XA 4JXCA 1Q45A 2GQ9A 3G24A 2YW4A 4OBTA 3DXIA 4C1LA 2Z1BA 4MVAA 3TQKA 1LORA 2LLEA 4WXYA 1LP6A 2EAWA 3PS7A 4UFKA 2VENA 1WOAA 2AAMA 5K9CA 2QF7A 4NXKA 3W1TA 5C5YA 2YX0A 3LRKA 3OVQA 4I7UA 4JTKA 1FCUA 4IMGA 1IXNA 3MWAA 4H3DA 3TFXA 3WJZA 1K03A 1DHPA 1YLVA 4N4PA 4YLWA 3IIVA 1W3IA 4XKYB 1ZAIA 2BWGA 3W7EA 1GVFA 1KTNA 2A0NA 3THAA 3HPSA 1TJRA 2FJKA 2ZA2A 4G1KA 1GZGA 1D3GA 3IVUA 3HF3A 4P2VA 3IV3A 2NLIA 2CZEA 1EP1A 1GG0A 4CNNA 2OX1A 1J5TA 2J9YA 5HUPA 1GVOA 2NX3A 3P60A 4UMCA 1AL7A 4NX5A 4Q32A 3N2MA 1YYAA 3TIMA 1BKSA 1OX5A 3PR2A 5BNKA 1YTEA 1L9WA 5E1QA 1EPXA 2FDSA 3MMTA 1TPUA 4JNMA 1Y0EA 5LKYA 2ATSA 5K9XA 4R7JA 1F2JA 1UUOA 5LHFA 3V75A 3TMQA 1JUKA 3I6RA 3W1PA 1H7OA 4UXDA 3TJLA 1L6WA 4CQ9A 4Y8FA 1OX4A 5HUOA 2OT1A 1GJPA 3CPRA 3GNNA 3P5ZA 1U5JA 1GYLA 3G1AA 3W70A 3THQA 2PRHA 5D02A 3HMJG 4DPQA 3FOKA 3EX6A 2VFIA 1KBIA 1OX6A 3BW2A 3A5VA 4EIVA 3NL2A 3LX9A 4O1DA 1S5VA 3QMSA 4LS1A 3W87A 3LV5A 4MZ1A 4IX2A 2X1UA 2VEKA 4MYAA 4S2BA 2EF9A 2QCLA 2V2CA 4QSHA 2ZZ7A 3KFTA 3OBKA 3BLFA 4I7WA 1HFBA 4XZ9A 4IOTA 4NNAA 5CPMA 2V8ZA 1VHCA 2V30A 3B05A 3W75A 3VE9A 1Q6RA 3NM3A 3PUEA 3L0KA 2NWSA 5E93A 2UV8G 4JGDA 5DXXA 3WK3A 4IJBA 4UNKA 3OA3A 2AQWA 4K7YA 3W22A 3CTLA 3UXDA 4DO6A 3G1XA 4QNWA 5K7JA 3W71A 4JX5A 3PVFA 4PCFA 3S5NA 2QAFA 2C16A 3C2FA 1YDVA 1SO3A 3LRLA 4K36A 4JTTA 2RH9A 1TPB1 3JR2A 3NDOA 4GFSA 3S42A 1OABA 4LV9A 3TW6A 3MUXA 2W6RA 1T99A 5H91A 2KZHA 1H7NA 1TQXA 1P0NA 4HIBA 2J6XA 4O4WA 4NUWA 4ICNA 1VCGA 5EY5A 1M7PA 2CLHA 4UTTA 3F4WA 2EHHA 3C2VA 3M43A 2FIQA 4O28A 1TB3A 4FNRA 3NQ8A 2JGQA 3C2RA 2QCEA 1EX5A 1EUAA 5BMXA 2Z6JA 3WK0A 7TIMA 1MEWA 3DFSA 1SZNA 2ZQ0A 4MY1A 2BSLA 1ADOA 3M6YA 4YXGA 4QISA 1YXCA 3CM4A 3TU9A 3UWUA 5HWNA 2EPHA 2XFWA 3G8RA 1UUMA 3UWWA 1I2PA 1FY6A 2YCEA 4IMFA 4NJHA 5LNRA 1ME9A 2QCDB 4O1AA 2QEZA 3TR2A 1R30A 2VFEA 1R2TA 3TH6A 3TSMA 4JR5A 3LXCA 5AYYA 2VEMA 5DBUA 1KM4A 4GXMA 2RKXA 3FJLA 3IGUA 4ORMA 4LY8A 3LTSA 1GVSA 1SSDA 4DPPA 2JKAA 2H3BA 1K8ZA 3RK8A 3SGZA 4BFAA 3FYOA 2RHGA 1F76A 2YGYA 2ZZ6A 4NX0A 3UNDA 1FDYA 1FCBA 1KFCA 4CNPA 1QO2A 1YTKA 4RCXA 4UMAA 4DELA 3UWZA 5BW6A 2DU2A 5D30A 3SI9A 2ZTKA 3L66A 4UNLA 2QUUA 2XN0A 3FFSA 1ZCOA 4BI6A 4JYDA 3BVJA 1VS1A 1LRNA 3PG8A 3HOJA 2B0MA 1QPRA 3W7LA 5AYZA 1FXPA 1B57A 2BTMA 3W7OA 4Y90A 3W7HA 4AWUA 4O0KA 2DORA 1LLWA 2TPSA 2QCGA 3EWUA 4OU1A 4E38A 3M7WA 3R13A 1ZHAA 3E0IA 4ZZ9A 4AXKA 5L6UA 4RLIA 4BR1A 2FLIA 5D2VA 1DJNA 4LC6A 3OVRA 4RZ4A 4N9BA 3LHYA 1PHWA 4JTIA 2F7FA 4DBEA 4MOZA 5G2IA 4QJ1A 3DKJA 1KLYA 1OYCA 3S1UA 2VOMA 4BI7A 2H3DA 5D05A 5G4WA 2CLOA 4IWWA 1KFKA 3B0PA 4JDYA 2QCNA 3CC1A 4MYXA 1EB3A 4A2SA 2E77A 3UY8A 3G1DA 1VCVA 1BEUA 3O63A 2WNZA 4RV8A 3PAJA 1V5XA 4JTSA 1TYGA 1MXSA 2RFGA 4FF7A 3DZ1A 3CWNA 3CT7A 4AB4A 3W1QA 2ZRZA 1B9BA 1Q6OA 5F4SA 3FJ6A 1UB3A 2D73A 3G0XA 4JD4A 1YADA 2A21A 3GKFA 1XC4A 3LHWA 3W7RA 4AEOA 2I1OA 1RQBA 3F1QA 5I3KA 1GYNA 3U6WA 2WQPA 3LI1A 3N73A 5ABTA 5C54A 3GXNA 3KVLA 2NV2A 3G8EA 4N2YA 4MLRA 1OF6A 3IEBA 1F7BA 1RV8A 1KM6A 1LRQA 5HMSA 4LVGA 3SJ3A 1H51A 1O5XA 2BZNA 1P1XA 2FPVA 1M6JA 1DKWA 5TQLA 3GR7A 5CGQA 3PF3A 3S5ZA 3LCHA 4LS0A 3VNDA 1GOXA 5L9FA 4N6FA 1VQTA 1DJQA 4U4MA 3L5MA 3GDMA 3FS2A 1TPFA 2FB2A 4NJJA 1T0OA 2NUXA 1TV5A 2CLFA 4CNOA 3W84A 1WDWA 5D2XA 3Q2DA 3EKLA 1GG1A 5HINA 2G96A 2OZ0A 2Z2UA 3WK2A 2X1TA 2DZSA 2A7NA 3S1VA 6TIMA 3O6YX 1XUZA 3W2UA 4LVAA 3EEGA 2PRMA 4K7VA 1WBHA 2C18A 5AFDA 2V5LA 5CPOA 1KFBA 3W7DA 4JYFA 3N3MA 3C61A 4LU0A 3NOEA 4M7SA 4O15A 4TIMA 1ICPA 3NPXA 3S8HA 1WYIA 4NT0A 3W1AA 2ZZ2A 1SW0A 1FX6A 4GUIA 1UJPA 3VKJA 2F84A 2DZVA 1OX4B 4LRSA 3DHFA 3W2JA 4EF8A 4BK9A 5DCEA 1OF8A 1S5TA 1EUNA 1HTIA 4NZFA 1OK4A 2ZA3A 3G3MA 4LUJA 5D2WA 4MPQA 3NQGA 5G2WA 5LSMA 3DFPA 4BI5A 3Q37A 3E12A 4JIQA 4ADUA 2QAPA 2Y88A 2C6QA 2Y70A 1RR2A 3G1VA 4RK8A 3MYOA 1XBZA 2NUYA 2QJHA 3EXSA 4LWWA 4RZ5A 4KFOA 2H90A 1XBVA 4FX7A 1LLZA 4UTKA 3NVTA 1GTHA 2YSWA 4UUIA 1ZY9A 5FEXA 3LCGA 1I8JA 4IPJA 2WV8A 3G22A 5BOOA 3TQVA 3NQAA 4WXZA 2QCFA 3NNTA 2X16A 1OFBA 3W2KA 4DF1A 2PE4A 3GNDA 3JS3A 3KXQA 4NJGA 3USBA 1FUYA 3LBMA 3PUDA 3W1RA 2DZTA 2Y7FA 1HG3A 2FQIA 1NVMA 4PA8A 2OT0A 1YPIA 4IMDA 5F2GA 4PL2A 1RPXA 4A2RA 1VRDA 1EP2A 3LM7A 4WX2A 2V5BA 2R8WA 2ZZ4A 1JRCA 3S5YA 4NJIA 2V82A 4OQVA 2V81A 3UQNA 4Z1BA 3TE9A 4E2BA 1A50A 2G5WA 3O1NA 1NF7A 2JK2A 3UWVA 1XKYA 4Z1DA 4JTGA 2DZXA 4JY9A 2Y7EA 3TAKA 3B03A 3W83A 1DL3A 4Z1CA 1J2WA 1TPEA 4I9AA 3NG3A 3ABSA 1I2QA 4O1CA 3IRDA 4LS2A 4FO4A 4UIOA 3MYPA 1SO5A 3SR7A 4K6AA 3Q94A 5KZEA 3H55A 4N9EA 4O57A 1MZHA 2JGYA 1KBJA 3C4UA 4PH6A 4ZQPA 3RNDA 3LBCA 4JTHA 3NQFA 3L68A 4UTTC 5I3IA 4GUFA 1WOBA 3QW4B 3NQVA 3LTYA 3L65A 3M5XA 4WY0A 4MJMA 4L4LA 3HG5A 3CEUA 5KZMA 5LNVA 3OG3A 3QQ0A 3W7QA 5EL1A 4HPJA 1H63A 1KTBA 4PEKA 3OHIA 5EMUA 3L67A 1DBTA 3NZRA 5LHEA 3S9YA 2NXHA 3IIZA 4GNJA 3S1WA 3PBYA 3UYCA 4POCA 2GUUA 3LTPA 4UFHA 3FIGA 5LNUA 3IVTA 3LLDA 5DY2A 3HPZA 1TQJA 1OFAA 2CZDA 3EXTA 2WNNA 4WY0B 3PULA 3QJAA 5FEZA 1TPDA 4BWLA 5D2TA 2FPYA 3WK1A 1LBMA 1W5QA 4ONVA 3JRKA 1S5WA 3CQ0A 3HG2A 3E9AA 4JIPA 4JICA 4H4IA 2CFFA 1DVJA 3EXRA 2B7OA 3EX2A 3W7IA 1RZMA 2NV1A 2B7QA 1A53A 3R12A 4UTIA 1TREA 4PFMA 4KWVA 3C56A 3DAQA 4Q4KA 3N34A 1FDJA 1KV8A 4N9DA 4LW7A 4GUHA 3NL3A 3I65A 3HBLA 5SWUA 4Z0JA 2Y62A 2ZRXA 1AW5A 4R53A 4NU7A 5J5RA 3T7VA 3GYEA 1AMKA 4JDBA 4JTEA 3MP3A 1W3TA 3SSJA 4DO5A 1H5YA 4O18A 2ISWA 2WNQA 2IQTA 1T96A 1TMHA 2WSQA 3UPBA 3ANYA 1KFJA 1O95A 2WJZA 5U4NA 3TC6A 5G1YA 4I7VA 4M6QA 3O05A 4Y9AA 3CIXA 2A6LA 3O07A 5F2LA 3HJZA 1AK5A 1OYAA 5CSSA 3DENA 1OHLA 4TU1A 3CEPA 1SFJA 1QAPA 4TMBA 4NZJA 3S6DA 1K02A 2CZ5A 5GVJA 4E2DA 5F2IA 2C13A 2YYTA 3W9ZA 2VC6A 4AF0B 3P5YA 5FF3A 4JS3A 4N9CA 3A5FA 3NO5A 1QPQA 1ZJIA 4S2CA 2QDGA 3UWQA 3PSVA 2E5CA 4XTDA 1TJPA 1PCWA 4UMBA 1LBLA 3A23A 1QPNA 5K3VA 4IPIA 2E6DA 1WBJA 1QNVA 3UZ5A 4UCGA 3U2OA 3SFKA 1AL8A 3FEMA 3STEA 1B4EA 4NNCA 3GDRA 3QRHA 4IGHA 1K3UA 2EKCA 4UR7A 4O13A 3YPIA 3LCFA 4O10A 4ADTA 3NQ2A 1QFEA 3G0UA 1JQVA 4IMEA 5EYWA 1H7XA 1IXPA 4OE7A 1HUVA 1H1ZA 4H6KA 1Z42A 1I2NA 4DQWA 1O4UA 1C29A 4S1FA 3W2MA 4ZMGA 5AOUA 1AW1A 1OG0A 5DELA 5D04C 3QM3A 2DZWA 1G4SA 1G4TA 3GDKA 2A7PA 2GJLA 3GAKA 1Q3NA 3TA6A 4RJEA 4OV9A 3OIXA 3TV8A 2R94A 4LVFA 4MZYA 4UTJA 4UTWC 1NF0A 2ZTJA 4QNEA 3B06A 3ABRA 4DBDA 1FQ0A 3N2XA 4NNBA 4XUGA 1KM0A 1W0MA 1KFLA 3B0UX 2ISSA 2QDHA 3PBVA 4WJEA 3KRZA 4M6PA 2NZLA 5CZ0A 4O16A 2Z0IA 4HNTA 1QWGA 5FF7A 2J9XA 4QIUA 2NWRA 3UWYA 5AYXA 3L5AA 4JEQA 3W1XA 3W7CA 4O8RA 2ZRWA 2H8XA 4ZQCA 1EIXA 3RMJA 3W7MA 1FCVA 2RDWA 1TV8A 5K9DA 4MY8A 4UFMA 5D2YA 2I14A 2A4AA 4CCDA 4CQAA 3R8RA 3STGA 3MI6A 4N6EA 1KA9F 1RVGA 2VXNA 3G1YA 2C0AA 1KFEA 3QC3A 3GXPA 4MFDA 1QO5A 1XUUA 1GT8A 2YFNA 3ZWSA 3C6CA 2HMCA 2C1HA 1XXXA 1F73A 4JTFA 3L0GA 4IQLA 4JTUA 5C2XA 2JKPA 1OVDA 3LOTA 1D3HA 5AC8A 1KLZA 4GUGA 2A1YA 1OFPA 2CLMA 3H54A 3G0SA 3BPWA 1VZWA 4DF0A 3NPWA 4JX4A 2FPTA 5H2ZA 3BV4A 2ZRVA 1XM3A 1JCMP 2CZFA 3B0VC 3ATZA 3TUUA 3RLVA 1DOSA 4LUIA 3TDFA 4O52A 3W7GA 1PIIA 4OHQA 3QPYA 3MW7A 1LOLA 3AO0A 1GWJA 4O19A 1WV2A 1E51A 1NEYA 4O12A 2V0TA 2E09A 3DI1A 1OK6A 2YW3A 4FB7A 1LTDA 1K8YA 3EKZA 5D03A 3VFLA 2J9ZA 2Y6ZA 3T78A 4AHOA 2QJIA 2X1RA 2Y7DA 3Q58A 3BW3A 2QKFA 3PY2A 1H7RA 4MKNA 4EF9A 4R33A 1G69A 2ZZ1A 3OEXA 2OJPA 1YXDA 3LDVA 1BTMA 3M16A 2W0UA 3SECA 1GPWA 3HGJA 3HPXA 4PODA 3ZFHA 4A21A 1AW2A 3KAOA 3QH2A 3N14A 1TO3A 5TIMA 4HN4A 3PC0A 1OJXA 4RR4A 1H60A 3P80A 4ORIA 1LROA 3IIOA 3PB2A 3DU0A 1G4PA 1FWTA 1Z41A 1OFOA 1TV7A 4Z0SA 1H62A 1TTIA 1KW1A 3LRMA 1RQEA 1LM1A 3BO9A 2O7SA 3F03K 2ZZ3A 3C52A 1SZFA 5D32A 1SU5A 1FWSA 2GOUA 3KRUA 3W7NA 2XN2A 4QAIA 4DF2A 1QR7A 5KZDA 3HO8A 4FNSA 4OGZA 1THFD 2PURA 4UTLA 3BG9A 4AHQA 5AC7A 3QMRA 4E0CA 3WJYA 1GTEA 1N55A 2R14A 1H7PA 4Y6GA 4FNPA 3M5ZA 4TX9A 4EOUA 3G18A 3ABOA 3QW3A 5A8GA 3C2EA 3AJXA 2VFDA 1XCFA 3W72A 2JBMA 3TSBA 4GUJA 3N19B 3KVKA 1UBSA 3W1LA 3UPWA 5EKYA 5F4XA 2NUWA 3NA8A 3M41A 4XTIA 4DEFA 3MO7A 2NX1A 1L2UA 1R2SA 4YMZA 1RQHA 1SPQA 3TXVA 4AWSA 4UTWA 3M44A 1C8VA 1U83A 2O7QA 3NL5A 4HNVA 2E5DA 3GIYA 2QJGA 3MHUA 3W6YA 1PCKA 2Q8ZA 3P7YA 3TFCA 4ZQRA 1TRIA 1OYBA 1A5CA 3G1SA 4M5PA 3C2OA 1VPXA 3GAYA 1A5AA 3K30A 5DY3A 3BARA 3UD6A 2JKEA 2PRLA 1W5NA 2VFHA 4YL2A 1V7YA 1F5ZA 4ZL1A 1F6PA 3BLIA 5KINA 1I2OA 3CB8A 5FESA 3P81A 3TJXA 1ZALA 1EWDA 1W5MA 2FFCA 3E96A 3EX3A 1DORA 4LVDA 2Z6IA 4C1KA 2WO5A 3INPA 3NPUA 3C3NA 3KOFA 1IF2A 3NQEA 2OCZA 3P74A 1VR6A 3PG9A 3L5LA 3T44A 1K8XA 4FNTA 3LLFA 4AWTA 4LNYA 2YR1A 2TMDA 3LXBA 1YPFA 4AF0A 4WQ6A 1VHNA 1TPVA 2H6RA 3T4CA 3TK7A 1KM5A 1ICSA 1ME8A 4GC4A 1MEHA 2CLEA 3LHUA 3FKKA 2ABAA 4HNNA 4LV4A 4XBSA 3P8JA 1VYRA 1SO4A 2ATMA 1ONRA 4TR9A 1TPWA 2G97A 2BX7A 4IUOA 2ZCGA 1JQXA 2V2HA 4QITA 1TRDA 1K7EA 1K7FA 4JX6A 3NL6A 5LGZA 3ATYA 4DXVA 4WUIA 5HNRA 1Z48A 1TPH1 1EWEA 2W79A 2J24A 4CQ8A 2ZZ5A 2NX9A 3D0CA 4HSNA 5HJLA 2VFFA 2J27A 4UTHA 2V2DA 4WOQA 4FIQA 1JUBA 4KWWA 2QCMA 1B4KA 5F2MA 5KMYA 5FEWA 3O8AA 3W73A 3LGEA 1JRBA 3S0CA 3EWYA 3QF0A 4AH7A 3G3DA 3TMLA 3P8IA 2C15A 5KITA 4K38A 5DCBA 3MP5A 2E6FA 5HWMA 1KM2A 1A5BA 5AC6A 2B4GA 3P82A 1VJIA 5K2ZA 2Q3OA 5EPDA 5CSRA 1UCWA 3EWZA 3M1ZA 3DI0A 3QQ1A 4AVFA 2ISVA 1JCYA 2WSYA 3NQCA 1G7UA 3W07A 1WA3A 4XWUA 1QPOA 1LBFA 4HSOA 3W1NA 4N4QA 3EX4A 4GRSA 1VLIA 1L6SA 1TPC1 2PCQA 2OMAA 5LNWA 5I3HA 2GVGA 3I68A 3GLCA 1M5WA 4P61A 1PE1A 1OFEA 3CIWA 4AAJA 5E0KA 5MHBA 3SIZA 2QCHA 3FYPA 2DZPA 1FBAA 4BF9A 4U28A 1SW3A 4WOZA 2C3ZA 2ZRYA 3GZ3A 5AHMA 3W86A 4MY9A 1JCNA 3W7KA 3P61A 3SW6A 1IIGA 2P1FA 3NZ1A 3TW7A 1I2RA 2A6NA 3GVGA 1QOPA 3NQDA 5DCDA 2P0OA 2X1SA 4UTMA 1QOQA 3EWBX 4O4VA 1O94A 3HG3A 1Q6QA 1XI3A 1FDZA 1IGSA
chains in the Genus database with same CATH superfamily
3ICJA 4CCCA 1FXQA 3P84A 4R85A 3AS3A 3RF9A 4CEUC 1JDCA 5HA7A 1G0CA 3KL5A 1MZRA 4TO8A 4B5NA 1F3WA 3PZMA 3SUVA 4DYJA 1WZAA 1C92A 4TOQA 3W74A 5ECUA 5IBXC 1FWGC 2J4GA 5BWAA 4R9OA 1G67A 3GFYA 1XL9A 1RD6A 4YCPA 4U10A 2WZMA 2Y61A 2E1DA 3LB0A 4YCOA 4D6JA 1ISVA 3QTPA 4R7OA 4HNCA 3LCIA 4R88A 5I3JA 1K6WA 4GOAA 1V6XA 4OIFA 2AL2B 3NQMA 3U9IA 3CHEA 1O5KA 4MIMA 3VNJA 1GPFA 4CVWA 2BVYA 1B3ZA 1ZBKA 3U8GA 1DWAM 1VFUA 1C9DA 3PPHA 4KETA 5K4ZA 3RU6A 2KAUC 3GZAA 3QSTA 4US5D 4UR9A 1L8PA 3HQOA 1PZ1A 1M53A 1QRQA 3WMBA 4RE0A 3BAYA 1I45A 2R1MA 2QV5A 1O6IA 1RD5A 2P53A 2ZVIA 3WFLA 4IL0A 3UJSA 3WX7A 1VFFA 2PLMA 4GI9A 3W3OA 5CG7A 4Q8WA 4HNUA 1HN1A 3GWQA 2ZDSA 1J0KA 1KM1A 1ZNNA 4O0ZA 3GBEA 1ZAHA 2WPBA 4IIEA 1NJJA 3HURA 3BAWA 3E02A 2VFGA 1HQTA 3UXKA 4ZQMA 4HPHA 1TCDA 2V3DA 1HX0A 1MNZA 4LAMA 1JUEA 1V79A 5FJOA 4B5UA 2CEQA 3ORWA 4ZA0A 4ZO6A 3VAVA 1X1OA 1UKOA 1P0BA 1Z44A 4OV4A 5K4XA 3PZNA 3ARUA 3M0JA 3NM1A 1WE5A 1MUWA 3F4DA 2J7HA 3H53A 1KXHA 2DH3A 4AW7A 3U57A 1OADA 1OFRA 5A8OA 2FH6A 2YCLB 2GQ8A 3RO8A 2D23A 2WCGA 4B2DD 2A3HA 1XIHA 1SQ7A 4IIDA 5GNYA 3H4GA 5F4WA 3O15A 4IXHA 3VUPA 3VMOA 2PD9A 2D2OA 1TR9A 4O1EA 3NEVA 4GCXA 3TCEA 1DJHA 1EF2A 3XIMA 1PL9A 2DV0A 3IIXA 5A6LA 5AYBA 2ALDA 5CJNA 1UOKA 4XV0A 4QM1A 4F0RA 4H1ZA 2I56A 3NSMA 3MJYA 4H7ZA 1JCLA 1JYNA 5FL0A 4J9JA 2C19A 4HYWA 1EA0A 4F9JA 1W17A 3P0WA 5CPSA 1R46A 4HK7A 1EJTC 4I9JA 5G4EA 2P3EA 5HNTA 4HKPA 3GB6A 3BG5A 4DX3A 1F74A 1XJBA 1W1B1 2DIJA 3L2MA 3CL8A 1Q4NX 5BRBA 4I9MA 1ZGDA 3DOPA 1WX0A 1QMLA 4HHLA 5I2UA 1HW6A 3NGJA 3WBAA 3LHZA 5DBTA 4K37A 3CPGA 2HISA 3E0FA 2QT3A 4LSBA 1A5UA 2CWNA 2BODX 4X3ZA 3W6MA 4MKSA 1I4NA 1R9YA 4PMRA 3ZT7A 3ZJ8A 3QPEA 1V51A 5CLTA 3PZ9A 4D2JA 3N15A 2WJEA 3KM8A 1J8VA 1W1ZA 3FDKA 5JBDA 3E5PA 1BQCA 3VCNA 1XLCA 3NXLA 2V38A 1TIWA 1MSSA 4D6IA 4BWLC 2B7PA 1UC5A 4Y96A 4EPDC 5I03A 5J04A 4HA1A 3IGSA 3UG4A 2XU2A 4J27A 4PUMA 3MDUA 1EBGA 4EWND 1FHUA 4MMWA 1X1ZA 4IJCA 4RZ6A 2ZE0A 4U5KA 4Z08A 2QUVA 2VEPA 2AL2A 2OEKA 4FIRA 3VD4A 3RIKA 3AYRA 1XBYA 3PUOA 4PMXA 4YWIA 5U7SA 3FLUA 2RJGA 2G3MA 3CZKA 2C71A 1R3WA 3C2YA 4CLMA 4OT7A 4IMCA 3T8QA 3STFA 4AHPA 4IF2A 4X0NA 3RJXA 6ALDA 3HPAA 3CMFA 3LXAA 1QHOA 1V6VA 3EWXA 1WKYA 2PWGA 1TWZA 3CK5A 3W2NA 3CNYA 1UP3A 3KBJA 1HJVA 3A4XA 1F6YA 3SUSA 5CPLA 1XIIA 2BP1A 1KCKA 4K8EA 3TROA 5LZLA 1V6TA 3QVQA 2QUTA 4W88A 4JZ5A 2E6AA 3UG5A 5C7HA 1QVBA 1W8SA 4IISA 4YTTA 2ACQA 5C71A 1CW2A 4O14A 3GS6A 4UC5A 3UXAA 2WANA 5G1TA 1FCQA 3F5JA 4A22A 1M7JA 4LF2A 3T40A 2GPTA 4D8ZA 1H0IA 4GE8A 4L9XA 2RGMA 2QCCA 3KBSA 2FB3A 3MTWA 4DO4A 3LCXA 5DEZA 2J7EA 3ZWTA 5JUVA 3GE7A 3H2MA 4L61A 3DYOA 3E1F1 1JVNA 4O50A 1H0GA 2WZHA 3HJEA 5LIUX 3R5EA 1CNVA 1VPYA 1UMYA 3QV6A 3DFHA 4DUXA 4NF7A 1BKHA 2JIWA 3B8WA 3C8FA 3KRBA 3RAOA 2CU0A 4JQAA 3BAIA 3PZTA 2CIPA 1W5PA 1EDTA 4MWAA 3MVIA 4J2PA 1UPPA 3B8DA 4JTJA 3S9IA 5G4HC 1K7XA 2Z1SA 3WD1A 2XH0A 1D9EA 1XYFA 3NZPA 1CGTA 3STCA 5DO8A 5FF4A 3WLJA 2Q8LA 5I78A 4HZ6A 3GXFA 3WLLA 3MSYA 4IXXA 4RXFA 3OVPA 3AALA 1ALDA 4JL1A 3G2GA 2B7NA 1VC4A 4XKYA 3NQ7A 5G5IA 1XRTA 3QGVA 3G24A 2QMJA 2YW4A 4OBTA 2Z1BA 5HQMA 4XIMA 4KW2A 3ZJKA 2LLEA 4WXYA 1LP6A 1MI3A 3CUHA 3AYSA 2ZC1A 2EAWA 2PA6A 2VENA 2AAMA 2QF7A 4NXKA 1EC9A 3W1TA 4WKAA 2YX0A 3OVQA 3T9PA 4I7UA 4IMGA 5BXTA 3D47A 3TFXA 1K03A 2XIJA 4H9VA 1YLVA 4N4PA 3AIRA 3IIVA 1ZAIA 3B8VA 2WZIA 4MPKA 1ONEA 3VVGA 1TJRA 4H9ZA 2CETA 2PDUA 1YEYA 1E40A 1NH6A 3IV3A 4AZ6A 4GLEA 3N12A 2NLIA 3RG6A 3VZYA 1ITQA 2OX1A 4H19A 3LEPA 3GFZA 1J5TA 2J9YA 5HUPA 5A6BD 1GVOA 1JD7A 4UMCA 3GO2A 4NX5A 3WF1A 4MTVA 5JIPA 3HV8A 1KXVA 3PR2A 1YTEA 3MMTA 1VRXA 1TPUA 2CPUA 4JNMA 1U1UA 1O12A 5PTDA 3UR7A 2ATSA 4L6OA 2QXWA 3BOFA 2Y4SA 2GUYA 5LHFA 2OLHA 4L80A 1KBBA 4WF7A 4C6CA 2PBOA 3CAKA 3I6RA 4CQ9A 1GJPA 1U5JA 2VRQA 1BYAA 3P14A 3RX2A 3THQA 2PRHA 3FOKA 3EX6A 5CBBA 1F4HA 3NL2A 3CHFA 4RNJA 2FVMA 4IX2A 3LGDA 1VFOA 2PGWA 2EF9A 4QSHA 3KFTA 3BLFA 2FFIA 3B8TA 1HFBA 2XVNA 3H2CA 4NNAA 1JNDA 3CUGA 2EPMX 2V30A 3PUEA 3L0KA 2VZTA 3VOIA 2DSKA 3THUA 4NZ1A 4AZ7A 5DXXA 1E9IA 3BQ5A 1V93A 1ZU8A 3W22A 3S46A 1HP4A 3H70A 3G1XA 2ZX7A 4GI4A 2QULA 2G0WA 3GXDA 2WHMA 2QAFA 2C16A 3LGGA 3ME3A 3LRLA 3VIHA 1JCTA 4JTTA 1ADDA 1M1BA 2X05A 3TW6A 1DYSA 1VPQA 4BQ5A 1V0LA 4DYKA 2P88A 5DRCA 4QG9A 4BQ4A 4NUWA 3S9ZA 4PBFA 3BMVA 4PB4A 3WQWA 3C2VA 4OKDA 5A6KA 1TB3A 4MJ4A 4FNRA 9XIMA 2GSJA 3N13A 1EX5A 2E8ZA 1EUAA 4S23A 1TVPA 7XIMA 7TIMA 1MEWA 2ZQ0A 3WLPA 4D6HA 2REQB 3LNMA 3UWUA 3KDOA 3TWAA 5FAJA 3QFWA 3A4JA 4LBUA 4CNTA 1QBBA 3FW6A 2XVLA 4IMFA 4Z2HA 5LNRA 2AQOA 1QU4A 4O1AA 5IHRA 4PTVA 1JDEA 2VFEA 2OG9A 2ACRA 1WP6A 5AYYA 5ABGA 2VEMA 2D3LA 5DBUA 4CD6A 1OIMA 3HPFA 3IGUA 4H2HA 3I4EA 3VX0A 5I09A 3LTSA 3BH4A 2JKAA 3E38A 1K8ZA 3RK8A 4BEQA 1F76A 4NX0A 3UNDA 4HOXA 1FCBA 4CNPA 5RUBA 4J3WA 2WSKA 4D6CA 1E6NA 2YCKX 3SI9A 2NQ9A 3FFSA 4JYDA 3BVJA 4DI9A 2OWXA 3GU9A 4OJYA 1J0JA 1NU5A 3HOJA 2BTMA 1JXKA 3W7HA 4IH3A 1KR0A 3CWHA 1LLWA 4IGSA 1JI1A 3OU8A 1QNRA 4AY7A 3E0IA 2J62A 5L6UA 4L1XA 2FLIA 1ZRQA 4RZ4A 1F9CA 3LHYA 3RRAA 2A3AA 2F7FA 1M68A 3EMCA 3S1UA 2VOMA 3MMUA 4F79A 5G4WA 1KFKA 1EOKA 3WDHA 1I60A 4JDYA 1NDWA 1V6YA 4MYXA 4P8VA 1BYCA 1DIEA 3RCYA 4JBRA 2VNCA 3G1DA 2F6UA 3UXLA 2GJRA 1ZB5A 3LQGA 4WJ8A 2IQDA 1Q7ZA 1BHGA 4Q7NA 2WNZA 4HMDA 5CJ5A 1GZJA 4JTSA 5MF5A 3VD7A 3QV9A 4YWSA 1WB0A 2ZRZA 1UB3A 4GY7A 3AC0A 3NDZA 4LYPA 4C6QA 3LHWA 4BKNA 1OC5A 2RGLA 3QGKC 1RQBA 3F1QA 3R25A 4XAPA 3T1GA 4CD4A 1SJCA 3I6EA 3U6WA 2WQPA 1E9ZB 2ZADA 2ANUA 3GXNA 2XISA 1AZ1A 4MLRA 1OF6A 2PD5A 2OEJA 2R82A 1KM6A 4HZMA 4JKLA 3SJ3A 3CT2A 5T9CE 1CB2A 3IANA 2BZNA 4LQ1A 3LBOA 1ADSA 2WAGA 3SEPA 4E4PA 3M7SA 1FRBA 1HJUA 3FGCB 5TQLA 3WLTA 4AU0A 4Z2JA 3M07A 1DJXA 3FSUA 2VRJA 5A95A 4WSHA 4LS0A 3VNDA 1GOXA 3CLWA 5L9FA 2YCIX 4N6FA 1VQTA 1DJQA 1SM9A 1TPFA 3WQ6A 4YHEA 3ZIZA 3WNPA 3V18A 1CXLA 4EPEC 1P0DA 1R85A 5D2XA 3UA3A 5HINA 2IPGA 4HA3A 3S1VA 5D9MA 2OYLA 1SFSA 1RH9A 1XUZA 3IJLA 4LVAA 3EEGA 5HPCA 3UVIA 1MXDA 1QI0A 1WBHA 4PUKA 4TIMA 3NOEA 4M7SA 4O15A 1A5KC 3NPXA 3MT1A 1WYIA 3KHDA 2ZZ2A 4LRSA 1WXYA 3W2JA 1V7AA 1EHAA 3VDGA 4BK9A 2ZVRA 3SCOA 4NZFA 1OK4A 2ZA3A 5D2WA 3NQGA 1VEMA 4QP0A 4BI5A 4JIQA 3IV8A 1EYWA 2QAPA 2FGZA 2C6QA 1RR2A 3LPPA 3G1VA 4LX4A 1WO2A 2NUYA 4LWWA 3K1GA 3POCA 4UTKA 4YTSA 1UYQA 1GTHA 3R43A 1LQAA 1I8JA 1H1NA 4PFHA 2QUNA 3EDEA 2CERA 3GTIA 3IJ9A 2EO7A 2WV8A 3G22A 3TQVA 3NQAA 2QCFA 3CYVA 2X16A 4H41A 3W2KA 5IRPA 2HV5A 4NJGA 3USBA 1YPXA 3PUDA 1O1ZA 4JIRA 4DBWA 1P43A 1HG3A 1FWAC 2PWHA 4PA8A 2VEGA 4F8XA 4F66A 1XIFA 5HAOA 2A79A 5C9UA 4PL2A 4AVNA 3CHCA 1BG4A 4CD8A 4WX2A 2OWWA 4W8BA 4J3SA 4I9TA 3S5YA 4NJIA 2C79A 4OQVA 1ZBCA 5XIAA 4XD3A 1A50A 2G5WA 5HMEA 2JK2A 1JDDA 2EPNA 3TA9A 4DHGA 3VGFA 3BSHA 1MFVA 4QLJA 4Z1CA 4L7ZA 1TPEA 3GUWA 3NG3A 3ABSA 3IRDA 4UIOA 1VJSA 3WH8A 4GCAA 4K6AA 2XM2A 4N9EA 1MZHA 1KBJA 3C4UA 3EDDA 4ZQPA 3RNDA 2PPGA 3GU1A 3NQFA 3L68A 2YL6A 5I3IA 1KXQA 4GI6A 4H9TA 4CQBA 1Q85A 3L4XA 3O9NA 1HGYA 3OHMB 3T0TA 4E3VA 3QQ0A 3W7QA 3L67A 2JALA 5D8WA 1E0UA 2J47A 4MNJA 2NXHA 3IIZA 3ITLA 3PBYA 4HTYA 3NOYA 3QGAC 5CC7A 1NFGA 9RUBA 4BF5A 5JH1A 2KX9A 1Q13A 2YXXA 3REQB 3PULA 1W5QA 1WCGA 1X38A 5BWFA 3CQ0A 3F2BA 1W3KA 3N6QA 2F9RA 1T41A 2B7OA 1QHZA 2B7QA 1TREA 4PFMA 4JTAA 1UP0A 4KT2A 2O9RA 4N9DA 3AUJA 1UWQA 3WQOA 1WKDA 4G5DA 3UR8A 2Y62A 1BYBA 2DSVA 2J25A 3SB0A 2FMOA 2Q01A 2OKTA 3MP3A 3SSJA 1H5YA 3HM7A 3LMYA 3C86A 3FGCA 2WNQA 2IQTA 1W9XA 2DSWA 1TMHA 3QKZA 4C6OA 2WSQA 2V3GA 1O95A 5U4NA 4Y8EA 5E6ZA 1TA3B 3O05A 3OLDA 1TVNA 1UZHA 4LB4A 2WKGA 3CBWA 1V6WA 3O07A 1A0DA 1OYAA 3CUFA 4IIBA 5CBIA 3NGFA 4TU1A 4TMBA 2VUNA 1CLKA 3IGHX 4TQTA 1K02A 3KW3A 5XIMA 3RGTA 3NJ3A 2YYTA 1KGXA 3RM4A 3P5YA 5FF3A 4JS3A 1EEXA 3C8NA 4PB5A 3UWQA 3WUFA 3BUVA 1XHGA 2E5CA 1TJPA 1UD8A 2BXYA 4UMBA 1W3LA 1K1DA 5K3VA 4IPIA 1PX4A 2E6DA 3RM8A 4UCGA 3STEA 1OGSA 2JIEA 2EKCA 2PWFA 4O13A 2BFGA 5HQLA 3WEZA 1QUMA 5DQPA 4QQUA 1NIUA 4LAZA 4DB7A 5EYWA 1IXPA 1E0VA 4NP7A 4H6KA 2Q6ZA 5CG0A 4MM1A 2XM1A 4S1FA 2XG9A 3ALFA 5AOUA 3UR2A 1S3TC 3IAPA 4RDWA 1VEOA 3GDKA 2A7PA 3WKZA 3TA6A 2I9UA 3AIBA 4R5EA 3TV8A 5DMYA 1EO5A 5HANA 4UTWC 3EA3A 4DJEA 3T09A 3ABRA 4DBDA 3N2XA 4XUGA 3L4ZA 4QLLA 2YA0A 1C3FA 3E5BA 3WD3A 4GIEA 3AIUA 2QDHA 4AD1A 3SCSA 1M01A 4EAYA 1FWDC 1QWGA 5FF7A 4I5RA 4P7NA 2EG8A 3W53A 4LAKA 5JBFA 5AYXA 3FXYA 2P5NA 1EXPA 3SN4A 3GHTA 2VDHA 1TX0A 4EWJA 2BHYA 2W27A 2GWNA 4ZQCA 1EIXA 2RDWA 2Q8XA 4MY8A 2I14A 2A4AA 4CCDA 3R8RA 3STGA 2PDKA 4YTQA 2VXNA 1FWJC 3OGRA 3QC3A 4Q4QA 1QO5A 1RBAA 3ZWSA 2HMCA 1E4NA 3T81A 5M1TA 1DJZA 1J0IA 4JTUA 4XD5A 1GW9A 1KLZA 1IHIA 1E73M 5A2BA 3AYTA 4TX6A 1XM3A 1QASA 2DZBA 4JQ2A 3ZMRA 5BCAA 1EHNA 1UZ4A 2CZFA 3ATZA 3TUUA 3EOSA 1DOSA 1PIIA 4OHQA 4J1OA 4X9YA 1LOLA 4O19A 1WV2A 3AAMA 2HNHA 1NEYA 4FB7A 2DT1A 3BZGA 1Q4WA 4B4HA 1GVIA 1WXZA 1DWGM 3E2QA 2QJIA 3KL3A 3BW3A 3PY2A 1VIWA 1EPVA 1Q65A 3LDVA 2R24A 3MV11 4GA8A 3VKBA 4A21A 4CU8A 1UPMB 5CSYA 3VKAA 3N14A 1TO3A 3CMJA 3BSGA 1GQKA 1MW3A 1H60A 3GTHA 3IIOA 3DU0A 4A3QA 1FHDA 4ZOAA 5E9AA 1OFOA 1FWBC 1TTIA 5C0QA 1RQEA 1LM1A 3BO9A 2ZZ3A 3W7NA 1UR4A 2PZ0A 4AZGA 5KZDA 3GH7A 1THFD 2PURA 3GXMA 3ANUA 3BJTA 1YKWA 1GTEA 1CXEA 4Y6GA 1JI2A 3BJSA 4EOUA 1H4PA 1K9DA 1E43A 4RZBA 3QW3A 3A4AA 3C2EA 4UQ9A 2VFDA 2AMXA 2MANA 4IGNA 3VTRA 1EH9A 3W72A 4JIIX 4O8AA 3RUBL 3UPWA 5EKYA 3M41A 4ROQA 3SCVA 4XBJA 4CD5A 1R2SA 4YMZA 1Q2SA 1RQHA 1SPQA 2VQTA 3GU2A 2Q02A 2VCBA 3M44A 3NL5A 2E5DA 4L9YA 4AEFA 5I06A 3W6YA 4ZQRA 1IWAA 3H2EA 1X39A 1A5CA 1ZLPA 3G1SA 3WH5A 1A5AA 2OWCA 1KGUA 5DY3A 3PPCA 5LA0A 4ZENA 2JKEA 2PRLA 3O0KA 1W5NA 4YL2A 3UNTA 3UBPC 3SQLA 4E2OA 4ZL1A 1IGWA 4LUYA 4QSFA 5KINA 4GJJA 1I2OA 3EPMA 4JTRA 1N82A 3P81A 1ZALA 1W3JA 3OGVA 1E3XA 2WO5A 3NPUA 2ZKMX 1R3TA 1PDZA 5KETA 2PF8A 3R6IA 2XPKA 3AU2A 3AQUA 4GINA 1K77A 4JFVA 1AQMA 3POHA 3L12A 1PKMA 4WQ6A 1XRFA 2H6RA 1ME8A 1XGZA 1OM0A 1KKOA 3KUMA 1MEHA 2CLEA 3MCNA 4XBSA 4GD0A 1TPWA 2G97A 4MKVA 4DJED 3CV2A 1JQXA 3VD9A 3VUSA 1KR1A 1K7EA 1F07A 2PTDA 3NL6A 4DXVA 4WUIA 4NASA 1KD0A 2JF6A 3VNKA 3SIMA 2P3ZA 4TV6A 1E15A 4W85A 2W79A 5ABHA 1LG2A 2J24A 1MWOA 4W89A 4UTHA 2DT3A 2O4MA 3URBA 2FH8A 4ERIA 2QZRA 4KWWA 2QCMA 3WLSA 8RUCA 4QRNA 2Y5SA 3O8AA 1FH7A 3WLHA 3EWYA 3KBNA 3QF0A 4GKLA 4KRUA 2G3JA 5DCBA 3TLQA 3MP5A 2OXNA 3EDJA 3FY1A 5FJTA 1H2JA 3GSMA 5AC6A 5K2ZA 3UG3A 3CXOA 1UCWA 3QQ1A 2ISVA 1VKFA 1V77A 4XSMA 1WA3A 4XWUA 1VJZA 2YA2A 4E8GA 1BRLA 4Y7EA 2G3FA 2PCQA 5LNWA 5T9BG 3GW0A 3KTCA 2IKGA 1DE5A 3CIWA 3PZUA 4AAJA 4XZIA 2XSBA 4GNVA 1TJ1A 2QCHA 2QNEA 3W81A 4AFYA 2QJNA 1SW3A 4GIYA 3R58A 1YBQA 4MY9A 3P61A 3AUOA 2P1FA 1PKYA 2A6NA 2VEFA 4DUOA 3IJ8A 1O94A 3TTEA 1XI3A 2WYSA 2BOGX 5HBFA 4AY8A 3GR4A 1WQ5A 4Q8NA 4TVUA 5D37A 2D2HA 3ARQA 4GISA 3P67A 1C7SA 1A5LC 3WFAA 4HYRA 4ADSA 3TKFA 3EWCA 2XFRA 3UF9A 4LEFA 5ABEA 2NXGA 4QAWA 1BWLA 1S39A 3FYYA 1XLFA 3H2NA 2AKZA 2D69A 4GBUA 4HQVA 2DSZA 1HO1A 1GOOA 2P8BA 3NYDA 4C6KA 2AAAA 4N0RA 3OGSA 1FWRA 3DN5A 4MB1A 3W0KA 4XVDA 2VVSA 4KPLA 2FGBA 1W5OA 1X7FA 4U3AA 1NQ6A 1YDOA 3PWAA 1WXJA 1FWWA 1S2UA 3AIQA 3MBDA 4Q4SA 2BXVA 5CZSA 4H9UA 4IIFA 3CZ8A 2INZA 5EA9A 3IUHA 2XGZA 3WH9A 2ZYFA 4W86A 3L23A 4RNFA 3CHVA 5DRIA 4GO9A 4MDPA 4L64A 1P6WA 3ZR6A 1JCXA 1E0WA 2E5BA 1K4GA 1E5NA 2ASHA 4K8HA 3TC7A 1CX9A 2YYUA 3AHVA 3NR0A 1NOWA 1W2PA 1FWFC 1POJA 4S38A 1EKOA 3DBPA 4DJDD 4V1XA 4PUWA 1F05A 2TSYA 5AVHA 4ZO8A 3NYZA 2BASA 4CN4A 3GNRA 4H8UA 3W23A 1KXTA 1B3VA 1ISYA 4E8CA 1HIZA 3T0DA 3ARWA 3ARSA 5FI8A 4PCSA 5DLCA 4JN7A 4NIRA 3PTMA 3I7RA 3QLDA 1AG1O 2VR5A 4FX6M 3BC9A 1NP0A 3SCUA 2EGZA 2XH4A 2XJ7A 1XG4A 3ZQ9A 1SZEA 1W3NA 3PM6A 4M6VA 2ICSA 4S3BA 1W31A 1EL3A 3VOFA 5AHFA 2V6AA 3GXTA 1XDMA 2C1IA 1U30A 3N9KA 1PHQA 4PTMA 3GG7A 2Q3RA 3GG1A 3MDWA 1JPHA 1LUCB 1LT8A 3I7QA 3VC6A 2R91A 2PSNA 2FHBA 1UZDA 2DJXA 2VQUA 4ZVJA 2X2YA 3W7JA 1OGBA 3PBWA 1VFLA 1J4EA 3KCLA 2CZVA 4GC3A 1E1CA 2E6YA 3PUGA 3CLMA 4CN1A 1XIMA 4KEMA 1UQZA 2WB5A 2WJDA 3WJXA 1P6CA 3QZ6A 3H2FA 4A05A 1QNSA 1BWKA 3IJIA 1ZAJA 3OZPA 1R3VA 2D20A 3N6HA 3IGXA 2F2HA 3DHDA 3ECQA 5EU9A 4GZJA 1HJXA 5HULA 3QXBA 4V33A 5AN7A 1BQGA 3BANA 3L21A 8TIMA 4C6NA 3AOFA 3QEZA 2EBNA 1ICQA 1W9UA 4AG0A 4A29A 2Y85A 4LCSA 2ZX6A 1CI1A 3BLEA 1UC4A 5CCZA 5IDZA 4WR3A 3M5YA 1K9EA 3W88A 3SCPA 2VEIA 3SBFA 4ZXOA 2YDAA 1BXCA 3R4IA 4ATWA 4OBRA 3VNLA 2JE8A 3TYBA 3WDRA 1E4MM 1CXKA 4PCNA 1N2VA 4HHMA 5C9RA 4J5NA 2RDXA 2OOFA 2GJNA 2J78A 3QZEA 5J5DA 4MZ8A 3PPFA 2WKLA 5C6MA 1PDYA 2IKHA 1O68A 1LT7A 4U5IA 3TYUA 1S2CA 2HS8A 3W1MA 5FEPA 4OFCA 1N8FA 4RE4A 1HL8A 1BSLA 1H7WA 1OT2A 3BLOA 4L56A 3ARZA 1Z7AA 1QNPA 4XAYA 4X2RA 1ZP3A 1BRLB 1H1YA 5JQ9A 1TIMA 3M0KA 3AZTA 1JD9A 1MO0A 3FX4A 2ZFAA 3UZYA 1L2QA 3KRSA 2PTXA 1A5SA 4LOCA 3W00A 1T7LA 1UOZA 2P8CA 1TTQA 1MW2A 1JZ5A 4YVXA 1OCQA 2WSRA 4I8YA 5CBJA 4UZUA 1TV4A 2E68A 1VH7A 3GD6A 1FWHC 3WJWA 4IP5A 4UB9A 5DN1A 5DXYA 3GNOA 1HXJA 3HU7A 1SZGA 1F4AA 3GTXA 2HCVA 1MEIA 1VYSX 4Z42C 5CGMA 4JIHA 4XX6A 4C1NB 4IIGA 5HWJA 1OD0A 2VWSA 4G7FA 4HT3A 4HA4A 4LH8A 3BL3A 2HXTA 4DJDA 1XLKA 2FHFA 1UASA 4W9TA 1YNPA 2I57A 1NWRA 3PJXA 3B40A 1LDCA 1HKMA 4QE5A 1XLGA 4WGXA 4G7EB 2J66A 1VLWA 1Q2RA 2ZICA 2GJPA 4B3LA 5HK4A 4KCTA 2GK1A 3DGRA 2NV9A 1ZL1A 3WQ8A 3HGOA 4NAEB 1GQLA 2YXGA 2ON3A 1TZ7A 4QXIA 3VFCA 1YHTA 3GX9A 2Z7GA 4XAGA 2W91A 1B54A 3P6LA 2DZUA 5HR6A 1W37A 5IBXA 3GHSA 3MBFA 4XZWA 1ZCCA 3KVJA 4Q7BA 4QDPA 3VIIA 1UH3A 4FP1A 3A9IA 4LF1A 3W76A 4BA0A 2V67A 1S5MA 1Z6KA 3DG7A 4A3RA 4GWEA 4MG4A 1Q6DA 3TYZA 1IXOA 1TSIA 5BOEA 4DXXA 3O6CA 3W29A 2W3ZA 3AXXA 4HGXA 4G9PA 2VX6A 1U1HA 1XLHA 1BVNP 1G9HA 1R2RA 2I16A 2QHAA 4INFA 4O1BA 1HL2A 3BLLA 2EPLX 3IJ6A 4Q4MA 1EEPA 1RCOB 3WQGA 2XDFA 3ZOAA 3LHVA 3QMTA 1NFPA 4LUSB 2DZAA 1Q7QA 3M5VA 2A2IA 4PEEA 3ZVHB 3M4HA 1X6UA 3CTTA 3KEHA 3NAVA 7ENLA 3H26A 3EB2A 1VB9A 3DKLA 4JKMA 1LCOA 1DXIA 3W7PA 4US6A 3OJGA 4GQRA 1ZP4A 3Q67A 1ODUA 1SW7A 5XINA 3O06A 5IFTA 2YKKA 3MB9A 5A3HA 1MYRA 2TODA 3CPUA 1JGIA 1PVNA 3N4EA 3NPVA 4GY0A 2GQ9A 3U2CA 4C1LA 3WUBA 2GDUA 2XZ9A 3WD0A 5F7UA 2BDQA 1E6SM 1WOAA 1V8EA 5K9CA 5HJXA 5C5YA 3LRKA 2MUCA 3NWRA 2ZOXA 1FCUA 1IXNA 1JPMA 3BZJA 4ZO9A 1JF5A 3VMPA 4GYKA 1Y65A 3OPSA 1CXIA 3R79A 4FMVA 4XKYB 1GVFA 3KE0A 5GPRA 4GZIA 3A13A 3DESA 2A0NA 4C6LA 3HPSA 3ARRA 2CBJA 2IXVA 5A1AA 4FLRA 3VX1A 3UZZA 2FJKA 2ADAA 1D3GA 4B5VA 3HF3A 3F4CA 2CBIA 4S3GA 2CZEA 4CNNA 2D22A 2DIEA 3GBDA 4B16A 3A3HA 2NX3A 2WM1A 1ZJHA 3UJ2A 1B31A 2VD8A 3TIMA 1OX5A 5BNKA 5E1QA 3R0DA 3NQBA 1Y0EA 5LKYA 2YIHA 1XC6A 4L4PA 3E74A 3N18A 2JF7A 3V75A 2NVCA 2XFYA 2PP1A 1Q63A 4H83A 3W1PA 1FHLA 1NDYA 4UXDA 2R1PA 3SRKA 3CV7A 5HUOA 3SSZA 3P5ZA 4MB5A 1R0MA 4AIEA 5I23A 3W6LA 5D02A 3UGVA 1KBKA 1KBIA 1OX6A 3BW2A 2UY2A 1K8CA 2ZX8A 1OY0A 3CZLA 3W87A 4MZ1A 5CAKA 1GKPA 4I6KA 2VEKA 5FJIA 3GXIA 5C2CA 2DUAA 3K4AA 3DG3A 4I7WA 1LQ2A 2CKSA 2V8ZA 1GJWA 1NQKA 1Q6RA 3NM3A 4XD4A 3UETA 3DBNA 3KTXA 4CVUA 4LPCA 3QZAA 2OLSA 3SUTA 4C1NA 3OA3A 3SCNA 2AQWA 1KRCC 3UXDA 2PF0A 2G3NA 2HROA 1HGWA 5K7JA 3SN0A 2PDYA 3S5NA 2EPKX 1XIEA 1T8QA 1V0KA 1QI2A 3PZOA 3S42A 3MUXA 1BSIA 3S2LA 2PAJA 2KZHA 5A6SA 1DXFA 3ABZA 1TQXA 4O4WA 4G7EA 2CLHA 4UTTA 2DW7A 1BPLB 2CKRA 3M43A 3DEQA 4MWAD 3UZWA 1JGMA 3C2RA 2QCEA 2A3LA 2Z6JA 3UT0A 4Z1YA 2OZ3A 2HE8A 4B3ZA 3F2CA 1SZNA 3O7UA 1ADOA 2PU1A 1YXCA 5HWNA 3CGTA 2NSXA 3GY1A 3OW1A 3UWWA 1I2PA 5D9OA 1RJQA 3PZVA 3CO4A 3UERA 4NJHA 1EC8A 3H2OA 3CMGA 3TR2A 2QF8A 1Z32X 3MSGA 4PTWA 2RKXA 1ISWA 1PZ3A 2VI0A 3LYEA 4JFSA 4LY8A 4QEHA 3N4FA 2H3BA 3SGZA 2YGYA 4GO8A 1JL8A 2BHUA 1YTKA 3GHUA 4NAEA 2DU2A 5D30A 2ZTKA 3L66A 4I6VA 4DJFA 1V3HA 4LB3A 1E9YB 1LRNA 2G3IA 1PTDA 5AYZA 4IICA 5CAHA 1B57A 1CGXA 3W7OA 2HK1A 3KBWA 4O0KA 3ZYZA 3VGGA 4MAVA 1GOIA 2QCGA 3EWUA 4LANA 4R27A 2FYMA 1BGGA 4E38A 3M7WA 1W9DM 3R13A 4AXKA 1ZBWA 4BR1A 3LQLA 4HZ8A 1DJNA 1OBAA 1PHWA 4DBEA 4MOZA 1GCYA 2X1IA 4QJ1A 1JYXA 1OYCA 1JF6A 4XD6A 4BI7A 4WK9A 1SMAA 2CLOA 3H4WA 4U33A 2HQAA 2QCNA 2PZNA 2YDRA 2DQXA 3VIGA 2E77A 2BGNE 3DHPA 4UBPC 4G6CA 3T2OA 4PE8A 1VCVA 4CUCA 3O63A 1S2TA 1S2WA 4CGTA 4Q22A 1F3XA 1M03A 1MXSA 4FF7A 2YCLA 3DZ1A 3CWNA 4AB4A 1PIGA 1HKVA 3A9BA 4Y9NA 3P0XA 3ZM8A 1W9BM 3ZJ6A 1Q6OA 3GG0A 5D4YA 2F38A 3EOEA 1XLLA 4JD4A 3TNBA 1XLMA 2A21A 4FOUA 3S3GA 1WDSA 1MQPA 1B9ZA 3KVLA 2NV2A 4N2YA 3WQEA 1XDJA 2X41A 4IMAA 2J13A 1JDAA 4TTGA 4IJRA 4LVGA 5I0DA 1YIXA 4DWDA 1ESWA 1KO0A 3APTA 1P1XA 5I5RA 2FPVA 1M6JA 1A5MC 3E3HA 1DKWA 3BDKA 1A3XA 3GR7A 1QNQA 4AD4A 1JZ3A 3V36A 3PF3A 4D71A 1JZ2A 4AC7C 1PPIA 3VOCA 4H7CA 3LCHA 1TWIA 1TUFA 3AS1A 1GORA 5EFFA 1IEXA 1R3RA 2ZUWA 3ARYA 2A3EA 4NJJA 2NUXA 1F3EA 2IKIA 4HJFA 4P8WA 3EKLA 1GG1A 3DGBA 3FJ4A 4F3HA 3WCZA 1BWVA 2Z2UA 3WK2A 2X1TA 4IFOA 2DZSA 2A7NA 2Y2WA 2G50A 1YMYA 7REQB 5BU6A 3G1RA 1HVQA 3O2LA 5CPOA 4DBSA 1V08A 1UKQA 3N3MA 3C61A 3WQFA 1DWIM 1XP3A 2PGEA 1PZ2A 1NWSA 4NT0A 1QTWA 2F84A 4C6JA 1XQLA 1OX4B 3RITA 2DVTA 4U3CA 2EPOA 2IS7A 3DHFA 3QC0A 5CPQA 4ZO7A 3U5YA 2PI6A 1S1RA 5EMKA 5C9XA 4PULA 5DCEA 3ITGA 3VXGA 1OF8A 2QVNA 1S5TA 1EUNA 2E4TA 5LA2A 4BHYA 3HFTA 3RX4A 4B2DA 3FAWA 3Q4DA 5DANA 4PMYA 4A4AA 1QPKA 2VWTA 1GOQA 4RK8A 1E9LA 1TG7A 4AX7A 4RZ5A 1XBVA 1LLZA 3NVTA 2YSWA 1SYTA 1KCZA 1F3TA 2PDGA 3LCGA 2E8YA 3R1ZA 4IPJA 3BAKA 3WDJA 5AECA 4UOZA 1C91A 4BCEA 1BFNA 1OT1A 4JHZA 2Y5JA 3AHYA 3H23A 2NT0A 4DI8A 3AJ7A 4DF1A 3JS3A 2D2GA 4H9XA 4K3ZA 2XGBA 3W1RA 1W1IE 4UQDA 5BZAA 4AISA 1W1TA 1WZLA 2VC7A 4ERGA 4HOZA 3UFYA 4Y9PA 4A2RA 3T08A 2YDQA 4DJDC 2R8WA 3BMWA 1J79A 3AWNA 4K1GA 1JRCA 4K8GA 4AD0A 3RR4A 3TE9A 3G77A 4KRZA 3O1NA 1NF7A 4JPGA 3TAKA 2VR2A 4MADA 4G8TA 1I9CB 4LS2A 3SGGA 2J75A 1TJ0A 1YNYA 1BTCA 3HMCA 3DX5A 3MYPA 3SR7A 1IV8A 4XB3A 1AQHA 4KCVA 4O57A 1A0CA 2JGYA 4PH6A 3OQ8A 3LBCA 4JTHA 4UTTC 4IPNB 5LIKX 5C7VA 3QW4B 3NQVA 3LTYA 4WY0A 4US5A 4BS0A 2VGBA 4L4LA 3HG5A 3CEUA 3OG3A 1DTUA 2AQVA 4PEKA 1KTBA 3OHIA 1EZ2A 1O5RA 2ZUNA 4ZSTA 3NZRA 2PLJA 2ZUSA 4GNJA 1VBHA 2YL5A 3UYCA 4POCA 2FDMA 2ZUMA 3PNZA 4UFHA 5A2AA 3LLDA 1EJSC 4B91A 2EJ1A 1DWHM 5FEZA 2YBTA 5D2TA 5E0CA 4ONVA 2VZSA 2Z1WA 2UZ9A 4DZHA 5FJPA 1Q6GA 2E9BA 4GPNA 4PYSA 4OOZA 1DVJA 3D3FA 3EX2A 3W7IA 1WDPA 5FACA 1F61A 3LZ3A 4CU7A 1I6NA 1AVAA 4GUHA 3NL3A 3HBLA 1P48A 4R53A 4NU7A 5J5RA 2GL5A 3ARTA 3T7VA 1AMKA 2W61A 3SCTA 4DO5A 2CITA 3OZYA 3KZPA 4JN8A 2ISWA 4M51A 1T96A 2DFAA 3UPBA 3ANYA 3EMQA 1C8YA 3TC6A 2VGGA 1I1WA 4I7VA 3OLGA 3ZZ1A 4Y9AA 2ONEA 3CIXA 2HNEA 1BYDA 3IARA 3NDYA 5DFAA 5DF0A 3HJZA 5AYIA 1AK5A 1WUFA 3HN3A 4NZJA 4F2UA 3OLIA 3JVAA 3VOGA 3V4BA 4AVOA 1W9PA 3S6DA 3VKCA 1M41A 1U1JA 2C13A 3W9ZA 4C5YA 2QYGA 2VGFA 3S5SA 1EX1A 4N9CA 3NO5A 5H8UA 1CDGA 3AHTA 4NY2A 4XTDA 4AWEA 1SVDA 1QPNA 1R3QA 1WBJA 1QNVA 3UZ5A 3SFKA 3TZFA 1AL8A 2Y24A 3FEMA 1G01A 2E7FA 4IGHA 3YPIA 4UR7A 3TVAA 3HA1A 1JQVA 4IMEA 3CV1A 4OE7A 3RU8X 3E2VA 3KWXA 1AH0A 2C91A 1OG0A 5D04C 1UZ1A 2DZWA 2PWVA 1TCMA 3V0UA 2VZOA 1FA2A 4ROPA 3GVWA 1MFUA 3EOOA 4OV9A 4LVFA 1CXHA 5LYRA 1XPYA 2ZTJA 3VGBA 2EG6A 3EPNA 4MB4A 4NNBA 3FEQA 3AFBA 1W0MA 3CQKA 1KFLA 4WRHA 2ISSA 3GHRA 3H2AA 4RNIA 1CGYA 1WZMA 1MW0A 4O16A 2X42A 4HCLA 4QIUA 3DECA 5EGRA 1J5SA 4JEQA 3RMEA 1ITUA 3IUIA 2ISDA 3W7MA 1FCVA 5CGTA 1TV8A 1V6UA 1HZYA 1UH4A 4N6EA 1KA9F 1OCBA 3AISA 3G1YA 4MDOA 3WL0A 1K9FA 1KFEA 3W01A 1XUUA 2Z27A 3BXWA 2HWGA 4TTUA 4F9DA 1XXXA 3LSBA 4J2MA 2VCAA 3SCWA 3T05A 3L0GA 2XSXA 1BXBA 3FVMA 4GACA 4QG8A 1CECA 3NVDA 2CLMA 3N17A 1JFXA 3AS2A 3QR0A 3STPA 1DTNA 4DF0A 1SGJA 4OTKA 3CB3A 4JCMA 4KGLA 1KGWA 2Q71A 2VX5A 1JCMP 4QJ4B 5M3WA 1UKPA 3RLVA 4LUIA 3W7GA 3QPYA 3DI1A 1NOFA 3D5HA 5D03A 3VFLA 2WWDA 3WLNA 4AHOA 3M0IA 2Y7DA 3Q58A 1CCWB 2QKFA 3U4FA 4C7DA 3UCQA 2WBKA 4R33A 4Q4OA 3IACA 2ZZ1A 3OEXA 1UIOA 2OJPA 1YXDA 3M16A 3LLXA 3HGJA 4KEUA 3BQ6A 3ZFHA 3OB8A 3QV7A 1OB0A 2FZNA 5GNZA 3KAOA 3QH2A 4AIBA 5MKGB 1JPDX 4DJFC 2B31A 3AHXA 1XD0A 3PC0A 1OJXA 5H8MA 1FWEC 1C93A 1RUSA 4RR4A 3P80A 4PCPA 4W84A 1LROA 2VGIA 1QI4A 2P0IA 3PB2A 3AROA 3BICA 3VINA 2RUSA 1Z41A 3NCOA 3CQHA 4RV3A 3KLKA 4EXBA 4HTBA 1EJWC 3LRMA 3OYZA 3F03K 2O7SA 2GOUA 3KRUA 3S1GA 4J7RA 1KQYA 3WENA 4Z17A 5DX7A 3W4RA 2XN2A 4ZCWA 1B1YA 4DF2A 1QR7A 3NO1A 3HO8A 1QW7A 4UTLA 3RJYA 4IFRA 3SRHA 3VZZA 2YDSA 3QMRA 1JAEA 3DC0A 1TE6A 4LAUA 2Z29A 2WCAA 1EFZA 4GYJA 4NHVA 3U3HA 4FF5A 4Q8TA 1H7PA 4FNPA 4GJIA 1MDLA 4J3XA 3AZSA 4TX9A 2A3BA 1EGZA 3ABOA 2AL1A 3URQA 5TNVA 2GOKA 4PMOA 1K4HA 2JBMA 3PFMA 3UJRA 2F6KA 4B9ZA 5F4XA 1VFHA 2WJFA 2JEPA 4DEFA 3M0XA 3WF4A 1L2UA 3I3DA 1B0IA 5BROA 3TCSA 3MKKA 4EXQA 1U83A 4WJXA 3P2VA 1OQFA 1YQ2A 2XVPA 4YPJA 3LU2A 4DWSD 3P7YA 2O56A 6A3HA 3TFCA 1TRIA 4M5PA 3TJ4A 1YDYA 3UD6A 1F5ZA 1R38A 5EMYA 1F6PA 1KWKA 5FESA 5A69A 3TJXA 1EWDA 3GNXA 3E96A 2BOEX 3OIHA 4IT1A 1DORA 2Z6IA 3INPA 4AEEA 1J12A 2O92A 3NQEA 1FFRA 4YVPA 2OCZA 1VR6A 1KRMA 3PZQA 2DUZA 4FNTA 3CUZA 3LLFA 4AWTA 4W7VA 4LNYA 2O4QA 4RNHA 1A0EA 1HKWA 3CUJA 3ZT5A 3T4CA 1KM5A 4GC4A 1GVYA 1XGDA 3LHUA 1R7OA 4HNNA 3V1HA 4LV4A 3W24A 1SO4A 3B9OA 2ATMA 1VIZA 1PO9A 2GDQA 3LS9A 1CIUA 2ZWZA 3PTKA 4KRTA 3OVGA 1UMLA 3WL1A 4ZGYA 4IUOA 4L1WA 3DCPA 5AC4A 5H1WA 1K7FA 4EPBC 3B8IA 2QMKA 2HXUA 1AQFA 2J7DA 1EWEA 3W02A 2C0HA 2W67A 2BOFX 1C8XA 2PEVA 4C6PA 3RRXA 2UWFA 2ZZ5A 3RPDA 4CQ8A 3D0CA 4EXAA 2VFFA 2J27A 3ZLHA 4WOQA 1Q7MA 1QK2A 4DN1A 1UG6A 5KMYA 2GJXA 4L6DA 4C6DA 5A6TC 3IPWA 4DRSA 2XVKA 2YLAA 3CQJA 5FJRA 1B5TA 4QFUA 1DJGA 5HWMA 3EBVA 3GQYA 4HSHA 1A5BA 2B4GA 3P82A 4DO7A 5EPDA 3V5FA 4Q8VA 3KL0A 3W07A 4FXJA 1QNOA 2Z1XA 1QWKA 3W1NA 4N4QA 4HU8A 3EX4A 2FTWA 2Y8VA 1XG3A 3OOQA 1AMYA 2OMAA 1D2KA 2GVGA 3I68A 1OIFA 2BY3A 4W93A 3GLCA 3E6EA 5E0KA 3SIZA 4EKJA 3GC4A 3FYPA 1FBAA 4RUBA 4XZMX 2PTZA 4I90A 2WBGA 2DW6A 4AZHA 2WVSA 1R87A 3W7KA 1NM9A 5E0FA 2FZMA 3NQDA 2X1SA 4UTMA 2ZE3A 3ITXA 2ZX9A 1Q6QA 2YBUA 4A3UA 1NAL1 2EQDA 2XHYA 5FKYA 2ZA1A 4CCEA 5T26A 4C5ZA 4IUGA 4FXRA 4LY4A 2RDUA 3ZJ7A 5AHNA 5HNNA 1WAWA 3WNNA 4WD0A 4EX4A 3JUGA 3ZVIA 1X8FA 1V03A 3VIPA 5TBOA 5LIYX 4LYQA 4GK8A 1LLOA 3QY7A 1GVRA 2XIOA 3FA4A 3PPGA 4GGBA 5AHEA 4GI8A 3B04A 2QCDA 3F4VA 1OFQA 2TYSA 2W5FA 3PBMA 2RJHA 4O11A 4CEXC 2CWXA 4NI3A 4WCJA 3O16A 1HKIA 3IAQA 5C8BB 1V3JA 2CLPA 1SJBA 4QS5A 1JYVA 5MKGA 1FWCC 1VF8A 4H8NA 1LF1A 3K5XA 4A3HA 1A4LA 3M47A 4QEEA 3L2IA 2W62A 1QDSA 2Z4GA 5HR7A 1DQWA 2DVXA 7CGTA 1BLIA 3VM7A 4C6FA 4AIOA 2Y8KA 4M82A 4ZQNA 2CHNA 5LA1A 3N9SA 4AC1X 3PJUA 2HEJA 2J7BA 3NFUA 1MMFA 1UR9A 2IQ0A 4D9PA 3GDBA 3HG4A 1M65A 4EANA 2AGTA 4PMJA 2ODOA 5BRQA 2NQJA 3ZVHA 3GTFA 3BG3A 4NG3A 4GJ1A 2FZ9A 2GVLA 2V5DA 3WG6A 3ZR4A 1US0A 2GQ3A 1F8IA 4FNUA 3WLIA 4HPNA 3R94A 3ZS4A 4IGMA 2ZXQA 4OWGA 2A3CA 2X0HA 4TVDA 5IXEA 3VA8A 4DWSB 5FF0A 3NO3A 1GQNA 1WKFA 3HIJA 1XDLA 3HGRA 4GFIA 1VCFA 4ZE5A 3FN9A 3NXFA 4Z2KA 2ESCA 3ZLFA 2POTA 4EVZA 4FLSA 4N02A 1W9VA 4PL1A 5HQEA 1U5HA 2J79A 4HVXA 4G1NA 1VBRA 2FZBA 3GC5A 5LGXA 5AB3A 3DFOA 4PC8A 4CNSA 4L6HA 2L5HA 3EB4A 3RLHA 1KM3A 1M7OA 4LT9A 2WHJA 2YPIA 2NVAA 3O6DA 1ENUA 1MVYA 5DMMA 5FL1A 2TRSA 2WLYA 4HPXA 1NSJA 3CWOX 3QTGA 4ZQOA 5LIWX 1JULA 2E67A 3BE7A 1TTPA 4AZ5A 3W2LA 4HNLA 1AD1A 2P10A 3CV6A 3TXZA 3UW6A 4Z1AA 3W26A 1H61A 3PSWA 3WF0A 1BF2A 1V3MA 4JTCA 2VL4A 4WEVX 5M03A 1AJZA 3WF2A 3RLUA 3N3TA 3COTA 3AHZA 4TUFA 3TTOA 1L0PA 2OVLA 2QR6A 3FA5A 1Q6LA 5AVNA 3QBUA 3WMSA 3IJDA 1UP2A 1DQXA 3UR5A 4D72A 5LXEA 3MHGA 1GKQA 3SY5A 4MUZA 5CZKA 1R47A 2RAGA 1P5BA 3GKAA 3DYPA 3T0AA 4YYFA 3MMWA 3T55A 1LZOA 3QYQA 3CU2A 1VFSA 3VNZA 1EOMA 2Z1KA 4JYEA 3BW4A 1H5VA 3LCLA 3BV7A 5BXSA 3VM5A 1CEOA 3MHFA 2WMGA 3SADA 4X22A 2C14A 2QDEA 4URIA 3KBMA 3WQPA 1JCJA 4M7TA 1E4IA 1BG9A 1EGMA 3MUY1 5AZ1A 2A85A 1W1YA 3N1AA 1GONA 3VE7A 3EOLA 3MP4A 2UBPC 5A6AA 1CXFA 4KH2A 3OODA 2NQ5A 4O53A 2GYIA 3GVVA 3LV6A 4XO7A 2A7RA 3EYPA 2WMJA 1WUEA 2NT1A 1NARA 4Z2IA 4E2VA 3M0VA 3VCCA 4QGCA 1ONXA 5C9ZA 2HSAA 4GYPA 3IIPA 3IS4A 5EB8A 3EGJA 3LPOA 3N11A 3AIVA 3WF3A 1BGAA 1SUXA 1BF6A 3QY6A 1YX1A 3EWWA 3VI2A 4AZBA 4AMAA 3D46A 2ZDRA 3RFAA 3VKKA 2Y7GA 3TNOA 4ACYA 1ML1A 5HOSA 1D8CA 1LRTA 3GDTA 4NJKA 1IEIA 5I3FA 1RXOB 2DUXA 1JR1A 3L9CA 3V35A 4EE9A 4QX4A 5I79A 3CH0A 3APGA 1HO4A 2ZBTA 2YA1A 4D8AA 4JL2A 4PUNA 4X9SA 2BGSA 1XH1A 2YJQA 4O54A 1M7XA 2AGKA 4GHRA 4ZXLA 1H50A 5D33A 3BOLA 1G5AA 3GR8A 4ICCX 3KX6A 1GK8A 3W1UA 2CLIA 4PBEA 3VCRA 4NVTA 4DAIA 1EJVC 2NW0A 5CKSA 2FMNA 1UUQA 4IFKA 4RX0A 1AZ2A 2X30A 4UNIA 4HHPA 4M19A 4KKXA 6PTDA 4B5WA 2OO6A 1KTCA 4XBKA 2ZIDA 1RY8A 1XR2A 3SGUA 2WC4A 3BGGA 4DWSC 1JJKA 5T8GA 3IK2A 4F0SA 2YFOA 1B3OA 2PDNA 2PDWA 2O55A 5C2GA 1XICA 4XAFA 1XF0A 3T0CA 1VYPX 4F0LA 3I4KA 1J01A 1O5QA 4QJ3B 3FKRA 4LVBA 1NFBA 1KQZA 2XN1A 2FTPA 3SCRA 2DP3A 4Q4RA 4DNMA 1S3HA 3W37A 3L4VA 1RBOB 2DSUA 1KC7A 2GVJA 1F6KA 4ML4A 1LUCA 2WWCA 3TQPA 1HNYA 3VD5A 2YB1A 3TQ0A 3WBEA 4F0KA 3GH5A 1Q8AA 1XPGA 1REQA 1X7IA 2WOQA 2PDPA 3LZ5A 4DM1A 5G2HA 3QHNA 3V16A 3MSRA 4FHAA 1WAUA 4W8AA 1MNSA 4ZR8A 1LYXA 3F7JA 4KCUA 2PC4A 4RKAA 4ML9A 2J6VA 4ACZA 5FF2A 2XVGA 3P62A 3AYVA 1SSGA 3FHAA 1A5NC 3UYIA 3MI2A 3R89A 3GDLA 1XINA 3PBUA 4OZOA 1G6CA 4B3KA 4XZLX 4JTLA 4R9XA 2EJAA 3HQPA 4D6FA 5JVLA 3I10A 1TMQA 2YZRA 1Q45A 3M0YA 4CN6A 4YTRA 1B2YA 2YOCA 4UOJA 4M1RA 1NELA 3LK6A 3AMDA 3CAQA 2VUYA 4UFKA 1ISXA 4KMQA 2NQHA 4HU4A 3URNA 4UZSA 4H3DA 3WJZA 1DHPA 3KOZA 1V02A 4RPQA 2BWGA 3W7EA 5EMMA 3RPTA 4V27A 1US3A 3AZRA 1DQUA 4QDWA 5CC5A 3ID7A 2ZA2A 4G1KA 3ABXA 4P2VA 3EEZA 5JIWA 3CH9A 3PTDA 1R7AA 2H9AA 2HZGA 3B8UA 2YBVA 3TC3A 1AODA 3B0XA 4W8LA 5FSDC 3KDNA 4CD7A 1YYAA 2ZXBA 3LN3A 1BAGA 2Z2BA 1DP0A 1L9WA 3ES8A 3UWEA 3QLLA 4LEQA 1HVXA 4LBSA 1F2JA 4HCHA 1KKRA 1Q5MA 4HU0A 2CBUA 4XUYA 1JUKA 1TMLA 2PUZA 4Y8FA 1OX4A 2INFA 2OT1A 5ECVA 3GNNA 6CGTA 1GYLA 2Y0FA 3G1AA 3W70A 1J18A 3HMJG 4IG2A 2NVDA 4DPQA 3VIJA 2CXEA 2JFEX 5FIPA 3LX9A 1GW1A 4AXNA 4UQBA 1WPCA 4PMZA 5E09A 1PB0A 3QYSA 4MYAA 2QCLA 2V2CA 4M81A 3S6TA 2VC5A 3B4YA 4XZ9A 4PUUA 1GOKA 3B05A 3H7UA 3KZSA 3VE9A 3SUWA 1GUVA 2OX4A 2QJJA 5E93A 3LPFA 3KOXA 1Q6CA 4GX8A 4IJBA 4UNKA 1TVLA 2GDVA 4K7YA 3CTLA 3TEVA 2GLKA 3K8LA 4ILSA 4JX5A 1CGUA 2VT0A 3NZGA 3TZNA 4B4FA 2Z00A 1EJXC 4OVXA 3GFXA 4H8HA 3JR2A 1AH3A 1DJWA 3NDOA 4GFSA 1QOXA 3LY0A 2W6RA 5H91A 4HK5A 4M1BA 1H7NA 3EA1A 1EDGA 4AYGA 5EY5A 4PB3A 1M7PA 3F4WA 2GK1B 2EHHA 2FVLA 3TR9A 3BCFA 2C1GA 2P76A 2QS8A 5D8ZA 3NURA 1IEVA 4AMCA 1PTAA 1NWUA 3GVQA 5BMXA 3WK0A 1JIBA 3DFSA 3B97A 2BSLA 3M6YA 4YXGA 3CM4A 3UJEA 4U2ZA 3SJNA 2WW5A 2BY0A 4A35A 5HXMA 3S83A 4MUPA 1FY6A 1ZZMA 3DHUA 4S3CA 2PWEA 4M3PA 4P7RA 2O0TA 3G6LA 1R2TA 3TH6A 5HMFA 5TF0A 3MA8A 3AS0A 3M0MA 4QLKA 1KM4A 3H12A 4WSKA 4AZCA 4GXMA 3H24A 4Q8PA 5B7YA 3OZMA 3VO0A 2WMIA 1FHVA 4DPPA 1DWJM 3FYOA 2RHGA 4IQDA 1KFWA 2XIQA 3AMKA 1FDYA 9CGTA 5G1MA 1XH0A 4RCXA 2W92A 1VEPA 4IP7A 5I3DA 3UWZA 3AU6A 2FZDA 3OP2A 3PFRA 2OOGA 1RVKA 1DEDA 2QUUA 3SO7A 2OELA 8XIMA 1VS1A 4PMVA 4RL3A 2B81A 1QPRA 2E3ZA 3W7LA 1FXPA 2V5KA 3BOXA 2PCEA 4Y90A 4WSJA 2DORA 3BLDA 1S2AA 4OU1A 2PDQA 1HT6A 4ZZ9A 2VHLA 5GJMA 5D2VA 4ZODA 2XYLA 3KS5A 2TAAA 1Y7VA 3THDA 3OVRA 1I0BA 4N9BA 4JTIA 4HMEA 1SR0A 5I7GA 3DKJA 1MQQA 1KLYA 2H3DA 4WIWA 2BS9A 1JZ6A 4GQQA 1YE4A 3B0PA 3U7BA 1UKTA 5REQA 1CLXA 2DQWA 2GUBA 2V5CA 1Z8AA 3H7VA 4X63A 2OZ8A 3DIPA 1QATA 1BEUA 4MHBA 4J3TA 1PAMA 1TYGA 4Q6JA 1AUSL 3CT7A 1UROA 1NWTA 1B9BA 3MV01 5F4SA 2D73A 3V5CA 1IT0A 3U48A 1YADA 2PDMA 1E6ZA 7A3HA 3K8MA 3KTSA 4AEOA 2I1OA