4JTAA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
molecule keywords Voltage-gated potassium channel subunit beta-2
total genus 121
structure length 326
sequence length 326
chains with identical sequence P
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtaA00
4FZIA 4GA8A 1C9WA 2NVDA 2C91A 4PMJA 2PDJA 3S3GA 3WBYA 1M9HA 3R94A 4XZIA 2PF8A 2IPGA 1XF0A 2IPJA 4OTKA 1PZ0A 3V36A 2HV5A 3C3UA 2BGSA 2PFHA 2DUZA 5AZ0A 1AH4A 5JH1A 2FZBA 3UZZA 3UGRA 2F2KA 4PUWA 1ZSXA 1ADSA 3F7JA 4AUBA 1VBJA 1QWKA 4WDTA 3V0UA 2PD9A 3Q67A 3N2TA 2IQDA 3CMFA 2AGTA 2IQ0A 2FVLA 4Q7BA 1X98A 2PDCA 4Q3MA 4JIIX 4GIEA 1PYFA 2BP1A 2DUXA 4XVEA 2PDGA 4EXBA 3M4HA 3G5EA 1MI3A 2F38A 3COTA 2HVOA 3V0SA 1XGDA 4I5XA 2FGBA 3EAUA 2IKGA 3KRBA 4LAUA 3ERPA 4IJCA 3N6QA 3R6IA 3M0IA 3R7MA 3V0TA 3CAQA 3QKZA 2NVCA 4DBWA 2ALRA 4ASTA 1OG6A 4JIHA 4XK2A 3DOPA 1JEZA 1HQTA 2QXWA 3V35A 3O3RA 2BGQA 3LN3A 1Z9AA 2WZTA 3BV7A 1X97A 3EB3A 1PZ1A 4FALA 3UZXA 4JTQA 1S1RA 3LZ5A 4PUUA 3G1RA 2PDIA 3GHUA 3UP8A 2I17A 2PD5A 3GUGA 3CV6A 3WG6A 2PDXA 4GQGA 3ONCA 3R58A 2INEA 4G5DA 2IKJA 5LIUX 3ONBA 4HMNA 4LB4A 3GHSA 4LB3A 1Z3NA 4QR6A 4GACA 2ACQA 1Q13A 2ACUA 4XZHA 3R43A 3WBXA 3EB4A 2WZMA 4JQ1A 3T42A 4YU1A 3LZ3A 4PRRA 4QXIA 2P5NA 5M2FX 2R9RA 1LWIA 3WCZA 2PDFA 4XO6A 4ICCX 1ZGDA 4XVDA 2ACSA 5LIWX 1MZRA 1X96A 3NTYA 1AH0A 1US0A 2FZDA 3DN5A 4DBUA 3UWEA 1YE6A 3M64A 4JTDA 5C7HA 2DV0A 4JTCA 1UR3M 4YVPA 3LQGA 5HNTA 1GVEA 5JH2A 3CASA 1QRQA 1RY8A 2HE8A 3UZYA 3LNMA 1Q5MA 1A80A 4F40A 1AFSA 4YVVA 1T40A 4FA3A 4L1WA 4GQ0A 2CLPA 1R38A 1T41A 3LBOA 3BUVA 1RY0A 4JQ4A 4R9OA 2I16A 1HW6A 3VXGA 4IJRA 4XZNX 2PDNA 3H4GA 2HE5A 3CAVA 4FAMA 4LBRA 1J96A 4WDWA 3H7RA 4YS1A 1PWLA 3RX2A 1VP5A 3FJNA 4XZMX 3LEPA 1EF3A 3GHRA 4WDUA 4XAPA 1MRQA 4ZFCA 2ISFA 3CV7A 3D3FA 2PDQA 1AZ1A 1IEIA 4JQ2A 2PZNA 2FZ9A 2FZ8A 3O0KA 2ACRA 4WDXA 4LBSA 3BURA 1LQAA 2PDHA 4XO7A 4JQ3A 1ZQ5A 1PWMA 4JQAA 4XZLX 2PDBA 1S2CA 2PDLA 1AH3A 2PDMA 4LAZA 2HDJA 2PDKA 3LENA 4HBKA 4GCAA 3UFYA 3BCJA 2J8TA 4JIRA 3LQLA 2HVNA 2INZA 1EL3A 5HNUA 3RX4A 2IKHA 2IPWA 4JTAA 3GHTA 5LIXX 5KETA 1K8CA 1ZUAX 4QX4A 2PDPA 1Z8AA 4WRHA 3UZWA 1Z89A 3FX4A 3P2VA 3LUTA 3WBWA 2IPFA 1EXBA 1XJBA 4H8NA 5AZ1A 2PDWA 4H7CA 3MB9A 5DANA 4PR4A 1EKOA 2PDYA 1RALA 2HEJA 3RX3A 3B3DA 4JTRA 4WEVX 3UYIA 2PDUA 5LIYX 4DZ5A 4EXAA 1AZ2A 2IKIA 4IGSA 3U2CA 4DBSA 1IHIA 1YNQA 4WGHA 3H7UA 3R8GA 1SM9A 4MHBA 1YE4A 2VDGA 3UG8A 3LD5A 4NKCA 4GABA 4YVXA 4PRTA 3Q65A 4RPQA 3MC5A 5HA7A 2IS7A 1YNPA 1FRBA 5LIKX 4L1XA 3R8HA 1S2AA 1S1PA 2R24A 2A79A 4QBXA 2PEVA
chains in the Genus database with same CATH superfamily
2E5BA 4J28A 4DJED 4C6IA 3KOYA 2UY2A 4W9TA 3LPPA 3PAOA 1ZBCA 3CGTA 1SR0A 4EPEC 2FTPA 2B7NA 3TYZA 1OK4A 1ONXA 2WHJA 3DHFA 5IRPA 3S5SA 5I77A 3UWZA 2ABBA 3LNPA 3FVMA 3NOYA 1PS9A 2J9YA 4L1GA 3C3UA 2BGSA 5AKQA 2R1KA 3W07A 3GAYA 4NASA 3ITOA 3SUUA 3M0HA 3PBYA 1KWKA 4YL2A 4AZ7A 1ZSXA 1FWSA 3P80A 4UZUA 3EWWA 5JUVA 2QAPA 3V75A 4AHOA 4W5UA 1ME9A 2ZZ1A 3PUEA 1GOXA 5CPOA 5A6BD 3C4UA 1FWWA 1WO2A 3KL3A 1UR8A 4MWAD 2V5JA 2DJXA 4RZBA 2XWEA 2VC5A 3GC5A 2XFRA 1CGTA 3MTWA 4I5XA 4AWTA 4DAIA 2PU0A 4M6VA 4BQ3A 5CBBA 1CPUA 3SJNA 5XIMA 4KBXA 4B16A 3G6MA 4I8YA 5A8GA 1E4MM 1GVRA 1JPKA 1H7OA 3NM1A 2NVCA 1KLYA 2GWGA 4K1WA 3LB0A 3UERA 3CZKA 2QJGA 1TE6A 5EBUA 3KTSA 1E0XA 1HVXA 3PJWA 3HGJA 4Q8NA 1TB3A 2ICSA 1H62A 1Z9AA 3GU9A 1US2A 4LH8A 3DX5A 1I4NA 4WKAA 3GNPA 3IJIA 4LT9A 3T81A 1NDZA 1QWGA 3BZJA 4ZQCA 5D4YA 4CQCA 1ZTVA 2ADAA 3DH7A 3W7IA 1Q4WA 1RBLA 4FX8A 4XWUA 2C79A 3UU0A 1FHUA 4DAFA 3CPRA 3BW4A 3LS9A 4HMNA 2J66A 3WUGA 4QR6A 1HKJA 1TWIA 1GHSA 2QPSA 1A0EA 2V5BA 3PB0A 1EYEA 1H4PA 3MYOA 3ENLA 2WZMA 1W8GA 4GBDA 4KGLA 3T08A 3VOJA 2VO5A 3MS8A 3GE7A 4CQBA 1NFPA 3ARUA 2WM1A 2VKZG 3FS2A 4KFOA 5FF7A 4PCPA 5IFTA 4CEUC 4DJFA 3E49A 1V3HA 4XO6A 3TUUA 3QR0A 3VKBA 1LL6A 1ODZA 4AZIA 1VZWA 4FO4A 7REQA 1P6BA 2HWGA 2QF7A 2QMJA 2NWSA 2FZMA 3PBVA 2UBPC 1AL7A 3QHOA 3IV3A 5EMYA 1GOOA 4JEJA 4B4FA 1EHNA 5H8MA 1XYCA 4ATDA 1PBGA 3BARA 2V3FA 5CPNA 3VVGA 1VFMA 3B8SA 3AWOA 1E1CA 4JX6A 1LLOA 4UBPC 4P7RA 2ONEA 2C18A 1K3UA 1C8XA 2OX1A 3ABXA 3O6AA 3B8IA 3QV6A 1CTNA 5MKGB 3QFEA 2ZADA 4A3RA 1LBLA 3ISIX 3AFBA 3L4XA 3ANVA 5M17A 1M68A 2VZOA 1UBSA 1EC7A 3BUVA 4KWUA 2X1TA 3OHIA 3NQ6A 4JBRA 4UNIA 3U2OA 1HW6A 1HXJA 2KX9A 3RR1A 3GSMA 2HE5A 4K6AA 3DG6A 3B9DA 3VNKA 3CL7A 4DLFA 4B5TA 4WDWA 1R7OA 1Y5VA 4EF9A 3KOFA 2G3FA 3NQDA 1S46A 1GUVA 1N2VA 2Z2UA 2D22A 4JTEA 3NURA 1NFGA 3DERA 2Y5SA 1H11A 4MDOA 2ZUSA 3WF1A 1W9XA 4JTGA 3W87A 3BZGA 4J3VA 3HTWA 4WDXA 3DEQA 4TV6A 2BY2A 3CMGA 4YLWA 5C71A 1O1HA 4BZYA 2CBJA 1E9IA 4GOAA 4YHEA 3W2MA 4HPHA 1FWDC 5DX7A 1OBAA 4GFSA 3CAKA 3RAOA 3V3WA 1Q63A 2XIJA 2RDUA 4AMCA 3MHUA 1NJJA 4MNKA 4ACYA 2D0GA 1C92A 2ZTJA 2VHLA 4IP5A 3MSYA 3VCRA 4RE4A 1UA3A 4Y9PA 1XH1A 1JZ7A 1JIBA 1NF0A 1NP2A 5FJPA 4QX4A 4H01A 5HJLA 4E2VA 4U2YA 3GUWA 3GZAA 2JEQA 2UY3A 4LQ1A 3U6WA 1SFJA 4RE2A 1Z89A 4FSAA 8TIMA 2WNNA 3M0YA 1XIBA 3U3HA 3GM8A 1XICA 3GZ3A 4IMCA 2QHAA 3P5YA 1UP2A 3DYMA 3LDVA 2X7VA 4E2BA 1S2VA 1NDVA 2F7FA 4W84A 3STCA 3R10A 3CH9A 1RCXB 1ZAJA 2G97A 1E6ZA 3PPHA 4ZSUA 3NQEA 4M0XA 4XZ9A 6ALDA 1E6QM 3AS2A 5B80A 3RM9A 2QDDA 3MMDA 3OHMB 4HPGA 1OM0A 3WLHA 3P3BA 2H90A 3SGZA 3DC0A 3BVJA 2Q09A 3VKCA 4C7DA 4MWAB 2E09A 2DZSA 1XSJA 3WH5A 4GH3A 2D69A 1XBYA 3WQGA 1R0MA 5EPDA 3U7BA 3MHGA 4DZHA 4GKTA 5I03A 4PFHA 3FA4A 1JCJA 5C8BB 3VIJA 3RR4A 4UTTA 4GA8A 1S5NA 1SO6A 1QHZA 4RK8A 1VHCA 3RRAA 4MB3A 3WH9A 1I2NA 3GB6A 3L66A 1US3A 3SFWA 4LRTA 5D8ZA 4O1BA 1J11A 2EHHA 1ICPA 4XZIA 2I9EA 1ONWA 4FNQA 4IOTA 4DY1A 4O0ZA 3CC1A 2DT3A 2HV5A 1MEIA 3ITGA 1YPIA 3T4WA 2D2OA 1JL8A 2A85A 4R5EA 1EP2A 4PUWA 3OPSA 1TZ7A 2PA6A 5A6JA 3KRUA 2Z7KA 3OIXA 3SY5A 2Z1WA 1GVFA 2PS2A 1V0MA 2Y7GA 4IIDA 4RNFA 1PYFA 3CM4A 1AMKA 2DDXA 4IQDA 2OXNA 1BKSA 1K6AA 2VGFA 1E51A 3H2FA 4CKQA 4EXBA 2FFIA 2J74A 5H1WA 1TR1A 1KM3A 3HPXA 4QEHA 2QGHA 1YRRA 3V0SA 3TYUA 5CZKA 1DHPA 1H1ZA 5TIMA 3DYOA 1G4SA 3LMYA 3W27A 4C6PA 3G3DA 3M0IA 1J0IA 3R7MA 3W73A 1A5NC 2W61A 2OKOA 3QKZA 1E6SM 5BMXA 3A9IA 4V2XA 1MQPA 1KGUA 1XLHA 1OG6A 5T9BG 3DFSA 4Y9MA 5KEZA 2ZICA 1M7OA 3GFZA 4UTMA 4J3SA 1LZOA 4O1DA 2F2HA 4ZOEA 4YN5A 5AHNA 4ZODA 1QCWA 3BO9A 1IE7C 3UWYA 1Q6QA 1HP5A 4N4PA 2P76A 3N11A 1C8QA 2XSXA 3AXIA 2WC4A 2I17A 1OZMA 3M6DA 3UVIA 2PDXA 3NO5A 1XWYA 2D20A 2IKJA 4M80A 2XIOA 2GGJA 3A12A 2JE8A 3QMRA 1A49A 3CLWA 3EMQA 2PC4A 4X60A 3II1A 5EMLA 4PTWA 1EC9A 5B7YA 2G3NA 3ALFA 3KX6A 3S6DA 4B4HA 2G8ZA 4NZ1A 1BF6A 5FEZA 4PRRA 2XTKA 5LYRA 5REQB 1XRSA 2J77A 2V2DA 1DQWA 3W00A 6PTDA 1B4EA 2JGYA 4XVDA 1JFHA 2Y5EA 4E5TA 2DVXA 1WDQA 1ZAHA 3WSUA 3CL8A 4DBUA 3CQHA 3PTMA 1DVJA 1MZHA 2DT1A 1GVQA 4HNCA 1OX4A 3C8FA 4HCHA 1AD1A 2GLKA 4NILA 3KCLA 2VZVA 3B04A 3CHCA 4JN7A 1DKWA 2RJHA 2EPOA 4BI5A 3P5ZA 1IZKA 4PMOA 1A80A 8RUCA 2V2CA 3GDKA 1BYBA 2G96A 1M7XA 4IPLA 3CWHA 2OWCA 7REQB 4JFWA 4RZ4A 3L23A 1Q6GA 4IL2A 1SO4A 5LA1A 2NSOA 2VEIA 2A5HA 4TQTA 2TPSA 3BAWA 4EAYA 1EXPA 1CGWA 3HMCA 3GDTA 3LCWA 4TX8A 3CNYA 1QO5A 4CNNA 3DENA 4NAEA 2ZRZA 3LU2A 4UC5A 3M0LA 3F2DA 4FAMA 2ZUUA 3W74A 4FEZA 1TUFA 4AIUA 1IXNA 4GISA 5A69A 4LAMA 1XFCA 3FNDA 1TUXA 3RX2A 3RMEA 3BLDA 1G94A 5E9XA 1HFBA 1MW3A 3AIQA 3T0BA 2CETA 2YL9A 1BQGA 4V15A 1UC4A 4US6A 2WSKA 1AMYA 4Z2JA 1KFCA 1NM9A 3KVMA 3U2EA 4UIOA 5FD0A 5JMUA 3W23A 1C9DA 5D32A 3BWWA 2R6OA 4UR7A 3O1NA 2YCLB 2F8QA 1OFDA 4QS6A 4MLJA 3P0WA 5LKYA 4KT2A 1EC8A 1QUMA 3WO8A 2PLMA 3PTKA 1TPVA 3ZR4A 4JHMA 4HN8A 1I75A 1U33A 3CEPA 3AALA 4RW5A 1I2PA 3W70A 4CD8A 2XN0A 1FBAA 2J8TA 1ZJBA 3OQ8A 4K7YA 4C6JA 3HG5A 1L9WA 3KHDA 3KE0A 3TZFA 4OHQA 1C90A 3THCA 4HTYA 2FMOA 2IKHA 4MY1A 3WQ8A 2IPWA 3CBWA 1NY1A 3Q94A 1UQYA 4UFHA 3GG8A 5LIXX 3P84A 1VCVA 1FWRA 1XLBA 7ENLA 3FY1A 3CTTA 4WXZA 3VIOA 3AISA 3P7YA 4LX4A 4CNPA 2XVKA 3ZWSA 4MJ2A 1J93A 1XLLA 1RVKA 3NDYA 4F4RA 4PR4A 5HATA 3WQWA 4AX7A 4FF7A 2YCIX 4S3KA 2VVNA 3AICA 2VRJA 3HFYA 1IIGA 4TO8A 4CU8A 3H4WA 1WOBA 2HISA 3AS0A 2V81A 1GJUA 3URBA 4M29A 1ZJHA 2Y6ZA 2CYGA 3AMLA 3BTNA 1A5BA 4AD2A 1TQJA 1MW2A 2Q8ZA 3SEPA 1UMYA 3PNZA 5F4WA 1K8YA 2OZ0A 4PTDA 3HGSA 4Z2IA 2OLHA 4D6DA 3M0KA 3C5QA 1EJXC 3POHA 4IFRA 5DQPA 4JY9A 1VQTA 2J88A 3SY8A 3DHPA 4Z17A 4IH3A 5HPOA 4YTUA 2HPMA 2ALDA 2WLYA 3IJ7A 4BF9A 2YDSA 2C0HA 3AIVA 3TEVA 3AHVA 3KDNA 3R89A 3S1UA 1RQEA 2E25A 3UR5A 1PKMA 2D2HA 5CPSA 4RE0A 5D2YA 2PSNA 2ZRVA 4MUPA 2JKEA 1FHDA 2VWSA 4HA3A 3SW6A 3DKLA 2CLIA 3FDGA 4XAGA 2C7FA 2DH2A 3N19B 4MNMA 5D2WA 2I5IA 3OLIA 3LBCA 4PN2A 3VDCA 3SB0A 4H9UA 3WL0A 3STFA 5I3HA 4B5VA 2XJ7A 3W83A 5G2HA 1RJRA 1LF1A 2PP0A 3QLDA 3I7SA 1FWTA 1XI3A 4GUIA 3NA8A 3C2VA 1TFVA 1QWKA 4ZSTA 5U4NA 3AXHA 4QROA 4KERA 4UZSA 3OGVA 3F2BA 3QYQA 4FF5A 1QW9A 4LALA 2O9PA 4H7ZA 5LA0A 3CK5A 3W86A 4HSOA 4ZMGA 3H70A 3VNDA 4REQA 4GUFA 3R25A 1XRVA 2HSAA 1E0VA 1MDLA 3URAA 3S1XA 3EAUA 3VGGA 4LV4A 3H2NA 4DQWA 3CQKA 4X0NA 4IMDA 5D04C 3RIKA 1OFBA 5BRBA 3IJ6A 4TVDA 3V18A 2X2YA 1J79A 2Z29A 4BQ4A 1Q65A 3CXOA 3CWNA 3LSBA 3OB8A 4AXNA 1OGSA 5I3KA 4UTFA 3EXSA 1PDYA 2BGQA 2ZXDA 2A7RA 5DF0A 1Z69A 4QE1A 3VILA 4EWJA 3VO0A 3UZXA 4FNTA 3T78A 4ADUA 4W8AA 4IG2B 4JYDA 3GHUA 1TPUA 2BTMA 3GNDA 4Q32A 1NQKA 4DJFD 4P7LA 2EF9A 3HPFA 3W2LA 4G5DA 3LHVA 4WVXA 5A3HA 4UCFA 2OZTA 4KWVA 3EB4A 4XKMA 3VFLA 1O60A 2DSKA 3H26A 5CGQA 1GOQA 3LCHA 3W7DA 2R9RA 3FLUA 1W5QA 3UEQA 5HAOA 4LCSA 3W2NA 3TNBA 3UGVA 3AUJA 3S2NA 2WVSA 4JHZA 1UD3A 6TAAA 2A1YA 1N8FA 1AH0A 2Z1XA 2FZDA 3G1XA 4JTKA 3N12A 1H3GA 4NJHA 4P8VA 3LI1A 3WLRA 1MRAA 4B5NA 5EFDA 3EDJA 1GVEA 4CD6A 1SMAA 3SCPA 4MG4A 2D3LA 4UOQA 2ZRWA 1Z6KA 3CUJA 2MANA 4L1WA 3BGGA 4JNYA 4B5SA 5I09A 2E77A 3NPUA 1R2TA 4JCMA 1JZ2A 3MP5A 3OBKA 3F5LA 1Z44A 1V3KA 3IJ8A 2FVKA 3SRFA 2ZOXA 2XSAA 4HU8A 4KF1A 4IPNB 1HF6A 1TV8A 2VOMA 4B2DA 7CGTA 1P6WA 4YTQA 1W17A 4DF2A 3VNLA 5FL0A 4X61A 1CBGA 1WDSA 1KBLA 3RCYA 1KM1A 4WDUA 4XAPA 5ABTA 1EJSC 3L2MA 3AZSA 1DWIM 1JQVA 3WQVA 1HKVA 2NQ9A 4RJEA 3T6CA 4FS9A 3USBA 1SUXA 2QUVA 3LPOA 1MQQA 5DELA 1F6KA 1VS1A 4UTLA 5EMKA 4DUOA 3H2MA 3WQOA 2QJMA 4XTIA 3L12A 1NFBA 3BCFA 3FYYA 5CPMA 3MUZ1 2FPVA 1AG1O 2QJJA 5CAHA 2YLLA 1J18A 2ZUNA 1K8CA 1F3EA 4Q4RA 2NXIA 1KQZA 4Q6JA 1GCYA 2EPHA 2CHRA 4UR8A 4A3YA 2ZIDA 1SSDA 3VIKA 3NXFA 2HEJA 3OO2A 1VYSX 1VFOA 1FP8A 3S1WA 4C5ZA 2DGAA 2BWGA 1JAKA 4IGSA 4NXKA 4K2SA 1XS2A 3PY2A 4MUZA 4FP1A 1BXCA 1XSIA 4X63A 1RPKA 2ZDRA 3PP7A 3PZMA 2DSUA 3GR7A 3U8GA 2NUWA 1UIOA 3W84A 1KM0A 4IXHA 2ZZ6A 4MHBA 2CXEA 1E0WA 2G5WA 2HVMA 1YDNA 1X1NA 1G1YA 4GABA 4R9XA 3TC7A 2IS7A 5BWAA 2GFTA 2GL5A 1BYAA 3W7CA 1HTIA 1ZBKA 3E5BA 1QDSA 1OINA 2XUCA 4I6KA 4YWSA 3WF2A 1IR1A 3PBWA 2V5KA 2FHBA 4MJMA 3ZR6A 4J3ZA 3PNUA 1FCUA 3LSCA 4JN6A 4AQLA 2F6XA 3MI6A 1W56A 2OVLA 2Y0FA 4US5A 1TJRA 4PMJA 3GIQA 1VF8A 3GYCA 3NYZA 2YW3A 4RCXA 1GVIA 1E70M 1KRBC 2C71A 5IBXA 4GINA 3HN3A 1KBBA 1ME7A 1D3GA 3VC6A 1UA7A 1Q6DA 3HMJG 2B7QA 1JCTA 3VC5A 3OODA 3AHXA 2C3ZA 1VBJA 3IUIA 4OOUA 1XD1A 4L9XA 4DWSA 4ZQRA 4ZO6A 5A8PA 4PUEA 2ZYFA 3W4RA 1F6PA 2D24A 4AHPA 1S2TA 3TC3A 1SZRA 3GFXA 1WNOA 3JRKA 1GNXA 2J24A 1TTJA 4MGGA 2Z2BA 3BJFA 1XQLA 4E2DA 1HKWA 4DUVA 5JBEA 3WQCA 3VKDA 5ABFB 4GK8A 2WCGA 3NPVA 4IGMA 4J5NA 3NZRA 2ZXQA 1PJ9A 5CSYA 1EO7A 3GH5A 1C29A 2PGFA 2QDHA 3W7RA 3NDOA 5KZ6A 1S5MA 1PCWA 2Y8UA 2R1PA 1OGGA 2VD9A 4DBWA 1SQ7A 4I7WA 4BCEA 3AAMA 1F07A 3HGOA 3C2RA 1DXEA 4I7UA 5IM51 1RQBA 4KWSA 3CO8A 3NNTA 3MI3A 2WXDM 1W54A 3N15A 3K8MA 4H6QA 4JL1A 4XKYA 2WWCA 3KFTA 3ARRA 4KCTA 1Q6LA 3S83A 1HJSA 4GYJA 4HNUA 2Y24A 3J7HA 2YZ5A 1E6NA 3WG6A 2YXXA 1DXIA 4WLCA 3OGRA 2WYSA 2G3MA 1DBTA 4AY1A 1HNYA 2CZ5A 3HV8A 4XZHA 3ZYZA 1QI3A 3R43A 2PUZA 4N4QA 2D2GA 1GVYA 1V6UA 3RYSA 3LZ3A 2RAGA 3LXAA 5DN1A 2A3EA 3VDGA 1DTUA 2GJNA 3B4YA 4DO4A 3W71A 1I1XA 1JPIA 4Z2LA 5C9RA 1O5XA 4C6DA 2P0OA 3BSMA 4W87A 3WF3A 4GZ7A 5EMUA 4D8AA 4K39A 3W53A 1M5WA 3B9AA 3DN5A 1P0EA 2ZZ4A 3QPEA 3ZO9A 1W8SA 1M04A 3VOFA 4IFKB 2WMKA 2OO6A 4BF5A 4NJJA 3PFRA 2O0TA 4AYGA 2QCFA 3MP3A 4JX5A 4JXCA 4ADSA 3NSXA 3S1GA 1K02A 3E38A 3BG5A 4Q4KA 3W29A 1KXQA 1TZZA 3THDA 3FSUA 1OWQA 2YOCA 3SQMA 2DJLA 1BTCA 3BANA 2WVVB 1WDPA 3APGA 4ERAA 1RD6A 4YXGA 2VX7A 1FX6A 1H49A 3K8LA 3EA1A 4PL1A 4DZIA 3ARXA 3NQAA 4IJBA 5GJNA 3UY8A 3ARSA 3N2MA 5CPQA 5HQEA 4DELA 2CWXA 4CGTA 3FHQA 1FFQA 1XM3A 5FCZA 2GQ3A 3DESA 3WD3A 4U3CA 4H9YA 4HP5A 5EKYA 5K4ZA 3WY1A 5BROA 1XLJA 2VCBA 3SDOA 4XZMX 5HULA 1GOMA 5I06A 2NWRA 3SCOA 2A3CA 2OOFA 3WN6A 3GNXA 3CHEA 4RDVA 3RO8A 4QG6A 4PBEA 3CV7A 2A6NA 2FMNA 3IIOA 1WXJA 3RNDA 3LXCA 1A3XA 5HUOA 1V03A 1XIEA 1MSSA 3UXDA 1RK5A 2PBGA 3WX7A 1UWAA 1MEHA 3KM8A 3QR1A 3SIZA 2BGNE 3FCPA 5T26A 3QFWA 4D6HA 1F76A 3TCEA 3HQOA 3W81A 1WA3A 1CLKA 1EA9C 2J7HA 3KCJA 4JIRA 3S6TA 3SRHA 3VNZA 2PWDA 2INZA 1GGOA 3W1PA 3TKFA 3TQPA 1AL8A 4IF2A 1A5SA 4CLMA 1UQZA 2WNQA 2JGQA 1KRCC 1E1EA 2R1MA 4FX6M 1DWJM 3FGCA 3HPAA 1SU5A 1GPWA 5I7GA 3GK0A 4LY8A 5DO8A 3UZWA 3FX4A 3IK2A 4GI4A 1BSIA 2AL2B 1QBAA 3R13A 1LUCB 3WBWA 5I0DA 5EU9A 4ZGYA 3MDWA 5AZ1A 4MKNA 1KD0A 1D8CA 5DANA 1EGVA 1B4KA 3ID7A 2OZ3A 4IMAA 4YJ5A 5KZMA 1AZ2A 1L6WA 3VYLA 1A5AA 1UP0A 2A6LA 1FWIC 3S9YA 1KFEA 4QIUA 4H9ZA 2BOFX 2CKRA 1UWRA 1JI2A 4WGHA 3DFNA 1CENA 3NO1A 2QEZA 1BRLA 3F4NA 4UTJA 4QRNA 1Z42A 3R4IA 3R8GA 1SM9A 5I23A 1JCYA 3OLGA 2HRWA 5TQLA 4UFMA 3KW3A 3NQCA 1SFLA 4RDYA 2WZIA 4IX0A 1CI1A 2VEFA 3B06A 3DKJA 4Y7EA 1PHQA 2EPLX 3GTIA 3UPBA 1LWJA 1H63A 3RJYA 1YYAA 4AWSA 3TYDA 2A79A 5LNVA 2GUUA 1OIMA 3L4UA 1E5NA 2QUMA 4W89A 3RG6A 3M0XA 3FW6A 1GK8A 2VRKA 3LM7A 4MLRA 3HJZA 1O66A 3A9BA 2WHLA 3FHAA 5A1AA 1TZ9A 3QQWA 1RD5A 4JTIA 4BQ5A 2XHYA 1V79A 3S0CA 4D6JA 4QJ4B 2DUZA 3WNMA 3ARQA 4NNCA 1MNSA 1BVNP 4A3HA 1ML1A 3UW6A 4ZENA 4PZVA 2EGZA 3B8UA 3CU2A 2EQDA 4CD7A 1XLGA 2IQDA 1TKKA 3PAJA 4D6FA 1LJYA 5AC8A 5CEWA 1E9LA 1E3XA 4UMCA 1DQXA 2GVEA 2J6VA 4ZB2A 2BP1A 4HNVA 2PRLA 3BLIA 5D9OA 4DM2A 3GVWA 2PLCA 5FEWA 3EOEA 2PGWA 4XBJA 2PDGA 2QJIA 5FF0A 4XV0A 1KW1A 2CBUA 3E12A 1CGUA 1TWWA 1J0YA 1F9CA 2QLYA 5DCEA 1CDGA 2A4AA 1EGMA 2WHMA 3W1QA 2C15A 1HKIA 2GJXA 3QTGA 3NZQA 3EWUA 3VNMA 1S3HA 1X1OA 3QHNA 3LXBA 2VWTA 1KNWA 1LCOA 3H22A 5G5IA 1XPYA 5AOUA 1W1PA 2RGMA 3KAOA 4JIHA 2POZA 4Q8QA 4S3DA 1FHVA 1VD6A 3G8RA 1UR9A 2WSPA 3LHWA 2YCLA 3AHYA 1X97A 1VLIA 3NOEA 2Z4GA 3AHTA 4UTIA 1PIIA 2CLOA 3TJ4A 1OVDA 3GVGA 2W0UA 1REQA 1UR0A 1YW1A 1ICQA 1Z3NA 4C6BA 5CH9A 4Z08A 4CNUA 4QAWA 1HL2A 3C2FA 3T42A 4HA4A 1KRAC 3SFKA 3K4AA 1XISA 3GXMA 5G2IA 3QSRA 1H7RA 1KC7A 1VYPX 4P61A 5M2FX 3M9YA 1K7FA 3RLHA 3GFYA 4JIEA 1OFEA 1XYAA 1EYWA 3CQJA 2OT0A 1IEVA 3VOIA 1X96A 1SZNA 1YKWA 3HM7A 1KBKA 4OV4A 1HJWA 4L9ZA 3LBMA 3GVRA 5HJYA 1JPHA 2D0FA 2FJUB 2XVLA 4POCA 5C7HA 4Z1YA 1YNYA 4LJ3A 1ISYA 3U7VA 4OGZA 2PI6A 3BLOA 4IMGA 3L4YA 3LCLA 4GD0A 4H6KA 1LL7A 1E73M 1SO3A 2CLKA 4F9JA 1MO0A 4FA3A 4O53A 4DYJA 1WZAA 4FNRA 3IIVA 4CUCA 2BHYA 2DVUA 3T0AA 1LBMA 2X1RA 4D6IA 2XVPA 4S3JA 1HVQA 4R27A 1RY0A 4DI9A 3FV9A 5I78A 5A8OA 2I16A 3CV2A 1GW9A 1FXQA 1F3XA 4MWAE 4H9MA 4N6EA 4PUKA 2I14A 1W3HA 2L5HA 4H9VA 2PDNA 1DOSA 2Q8XA 2FHCA 3CAVA 1KBIA 2PWEA 2B4GA 4DO6A 5BCAA 1VBGA 2Z26A 3PWIA 2HS8A 1XLMA 4ORMA 3FA5A 3IGSA 3U4FA 1IWPA 1VP5A 3NDZA 3NQ8A 1HN1A 3LEPA 1CXIA 4I6VA 1R47A 1TRDA 3P82A 1RV8A 5KMYA 1UWIA 4ZFCA 4ZB5A 5HXMA 1S2UA 3SM0A 4E3TA 1W31A 1EPVA 1LL4A 1W5NA 4EOUA 3GVQA 3DFYA 4GUGA 1BWVA 4AG0A 5HUPA 1XYLA 4JNZA 2YXOA 2XH7A 1B3XA 1GYLA 1QPKA 4PEKA 5I00A 2BB0A 2JFEX 2QIIA 4RDWA 1JFXA 1QI5A 1FWCC 4NNAA 2Q3OA 4L4OA 4EWND 1GT8A 1F61A 3FEMA 3QKEA 4GCAA 4Q4QA 1UZDA 3MQTA 3O63A 1WKEA 4QCFA 7ODCA 2PWUA 2WQPA 3V4BA 2E8YA 1Y5WA 4PSPA 3MMUA 4JTAA 2VZSA 2PODA 3L5AA 4NZ5A 4FLOA 1ZJIA 1BD0A 3IS4A 4E3VA 3PFMA 4R85A 1Z8AA 3MPGA 1HZYA 1DJGA 1CGVA 1J6PA 1KCKA 3PSWA 3P2VA 3ZZ1A 1XH0A 3M07A 2VDHA 4GO9A 4DBDA 3IUDA 2FYMA 3HZ3A 3ZWTA 2P3ZA 1M03A 1WBHA 4Q4MA 4P7QA 4QGCA 2VI0A 4R34A 5JQ9A 1U5JA 4UTUA 5ABGA 5CPLA 4R33A 1YNQA 1OZQA 2PMQA 1UR1A 1UD8A 4WKHA 3W75A 3PG9A 4AD1A 1FWFC 3M5VA 3NZPA 3H54A 2XISA 3RM8A 2JKAA 4HZ7A 3VU2A 3WMBA 3RJXA 5MKGA 4KWWA 1TELA 3A21A 4O16A 1FRBA 4LVBA 4M7SA 4ICNA 2D73A 2QS8A 1S2AA 4FXJA 3VOCA 3AMCA 2I57A 3NEHA 4WY0A 3CV1A 3GTNA 2D3NA 5K7JA 4QM1A 4C6CA 1OG0A 4DXKA 1NWTA 3KBSA 5A6KA 5DT5A 2PGEA 3PHAA 4LPCA 2AGKA 3TLQA 1GQLA 3TP4A 2DZWA 5IDIA 3W7KA 3SUTA 3QMTA 3MZNA 2ZZ3A 1JAEA 2QT3A 2IPGA 4H7VA 1JUBA 3C61A 3P14A 5EYWA 3W6MA 3GXPA 4LUSB 3VDHA 1Q4NX 3NVDA 2PFHA 4AB4A 2PURA 1W9DM 3OW1A 3VABA 3OYXA 2FZBA 2WMIA 2GDQA 3EOOA 3ZLGA 5FI8A 5HINA 4K37A 3L67A 4M81A 4Z2KA 1KXHA 3ANYA 3SO7A 4JFUA 3VKJA 1GQIA 1QXLA 2ZE0A 2R14A 2OU4A 2FVLA 1W91A 5HWNA 4M6PA 2O7SA 4PCTA 5AYXA 3N73A 3P74A 3LX9A 1B9ZA 3EPNA 4XTDA 3W7QA 3U9IA 2X05A 4PCNA 2HJPA 2POTA 2BMBA 2OQHA 1E4IA 4LANA 2GVJA 3A4WA 4HMEA 3R2GA 1I8JA 4B91A 3VE9A 1JDCA 3DU0A 4Q8WA 1PX3A 1WP6A 4HVXA 3CAQA 2B7PA 1OFPA 3JW7A 2GGHA 2ALRA 3BMWA 3AYTA 1IEXA 4QE4A 3WLMA 3OVQA 4XAYA 3W7JA 4WJEA 3MW7A 5DMLA 2QCHA 3MUXA 1DJHA 4HA1A 1OCBA 4CU7A 2OOGA 2YR1A 2HPIA 1XLAA 1YTKA 5CC5A 4HNOA 4U3AA 1KB3A 5JBFA 3PZTA 4FPSA 1RCQA 3USZA 3E9AA 4GHRA 3UP8A 3BPWA 3IVTA 3WNLA 1W3LA 4FIQA 4YIWA 1RK6A 4IUOA 2ZDSA 4JR5A 1TPB1 2OG9A 1TJ0A 4PMUA 3ONBA 4HQVA 1W3IA 3NL3A 3VX1A 1MUWA 2ACUA 3O7UA 3PJTA 4AX6A 5CGMA 3A3WA 3HG3A 1CXLA 1PB0A 5A2CA 2P8CA 2HNHA 1GJPA 4P8UA 4QXIA 5A8NA 4G8TA 1B3ZA 5PTDA 4FHAA 3L2LA 3N17A 5D09A 3O6YX 3E74A 1K8XA 1LOLA 1P43A 1QNVA 4EPBC 1GKRA 3OIHA 5DBUA 5A6TC 1F8IA 1BYCA 1KFBA 1WAWA 2ZKMX 9XIAA 3NTYA 1TQXA 1UD6A 3URQA 4MPKA 1KM4A 1QVBA 1PYMA 1CB7B 4CQ9A 3UWEA 1B9BA 2PE4A 4H00A 3QY8A 5LSMA 4JTDA 3CMJA 3NCOA 1PPIA 3W1AA 3F4VA 5CJNA 1DXFA 4J3XA 5FJIA 1FH7A 1DJNA 3FYOA 1XIJA 5DXXA 4ILSA 4KESA 3MWCA 1F8MA 2OWXA 4DM1A 3T0DA 1HJUA 1AFSA 5F2LA 3PTQA 5G1MA 5ECVA 1HP4A 1NOFA 3B8VA 3RFAA 2TSYA 4OJYA 3LBOA 1WB0A 4N9BA 3HURA 2RHGA 2X40A 1BWKA 3AMKA 1XGZA 3WJXA 3L0NA 4PMRA 3DG3A 3N18A 1Z32X 2Y8KA 1TV2A 1FTXA 3SCUA 3TTEA 4LBRA 4JEQA 2V3EA 1QTWA 3EX4A 1EWDA 3QHMA 4YMZA 3WF0A 4GIYA 3GY1A 5K9CA 4N42A 1EF3A 4TUFA 4N9EA 3ZR5A 5ABEA 3GG0A 2VGBA 3I6EA 1B54A 4I9JA 4PCFA 1JRBA 3WJYA 2GSEA 4W93A 1AZ1A 2VGGA 1VHNA 2G3JA 3F1QA 1W0MA 1J0HA 3O0KA 1BLIA 3DFHA 1VRDA 4LBSA 2OZ8A 1C8VA 3BURA 1LQAA 4Q8VA 1SR9A 2PGRA 3AHZA 4JTHA 4EX4A 4FB7A 4XO7A 1JYNA 1ZQ5A 1A0DA 4GC3A 4JQAA 3MYPA 2VRQA 4UQ9A 4DHGA 1OFRA 5AC6A 1UKQA 3FOKA 1OIFA 2Y5JA 3K1DA 4XB3A 2F84A 3KHJA 3MJMA 1QK0A 4TR9A 3EPOA 4OT7A 5BU9A 2DSVA 2YSWA 4RZ6A 3B9OA 3BLKA 3ZLHA 1GG1A 1O4UA 4KWOA 5L6UA 3EEGA 1OT1A 3RX4A 1F7BA 3SCVA 3DZ1A 4JY8A 2OT1A 3JUGA 2EKGA 1KRMA 1SJBA 3E0FA 4ZTXA 3V7PA 2FH8A 3PB2A 3WFZA 4HHLA 1BVWA 1EH9A 1MW0A 3LUTA 1UKSA 2VUYA 3GBDA 2YX0A 4DF0A 1Q3NA 2RFGA 2XGZA 1UWUA 1PVNA 3WH7A 3G18A 3SCTA 4NQ1A 7A3HA 1X6LA 4PUJA 9CGTA 3RX3A 1Q7MA 2WVTA 2I7GA 1F2JA 1H5VA 3TXVA 5AHEA 5M1TA 3VOHA 3K8KA 1BKHA 4RL3A 3WENA 3W85A 4U2ZA 3VMOA 3C86A 4LUJA 1U1JA 1NOUA 2XM1A 1OD0A 4KS0A 2OSWA 3BAIA 4FMVA 3GTHA 1OF6A 4LFYA 3LG3A 3S2JA 2XIMA 2ESCA 4J3WA 1OSEA 2VZTA 2OPJA 4Q22A 4PRTA 3WELA 3LGEA 5K2ZA 1RBAA 5KZDA 5IOBA 3QPYA 1CXKA 2IXUA 2GK1A 2YDQA 3EOLA 3N2XA 3NGFA 2WC7A 1S5VA 3TOYA 1S1PA 3W6LA 1YBQB 2HBVA 1H0IA 4LVDA 4JTSA 1XX1A 4XZBA 3N1AA 3PTDA 4O0KA 3WUEA 4G2DA 3CB8A 3OA5A 1DJQA 2E9BA 4GI9A 3TU9A 4Y9OA 2Z1BA 2OSXA 3GU1A 5E70A 2J9XA 2PDJA 3S3GA 2J75A 1CW2A 3WLPA 2V30A 3R94A 5C6MA 2O9TA 4GYKA 4H9XA 3OZMA 3QYSA 2YGYA 3SURA 1NDWA 3TCSA 4IQLA 3ABQA 3W01A 4O18A 2Y70A 6CGTA 4OTKA 3VD4A 4B90A 4IM4A 4D6EA 1EDGA 3S2LA 3I10A 1GORA 3A23A 2F2KA 4GMEA 3Q2DA 4WDTA 4V1YA 2HROA 1EJUC 1WKDA 1FWHC 2WVVA 4Q7BA 1A5CA 7XIMA 2NLYA 4X3ZA 4ZVJA 1IWBA 4L6HA 4E4UA 4GIEA 4XG1A 1S3TC 4DVOA 5CCZA 3WFAA 2G4FA 4E6MA 4GVGA 3G1DA 4UQAA 4S3FA 4ML9A 2WJEA 1EUNA 1O6IA 3SZ8A 4YPJA 3O6DA 2PBOA 2FGBA 1E4NA 5K4XA 1CXEA 4QSFA 4LAUA 3WQDA 5C70A 2JBMA 1FCBA 3SQLA 1BF2A 2CW6A 1H7NA 4O1CA 2QCLA 3A4AA 3ZOAA 3V0TA 1K70A 4FLSA 5EL1A 2ISVA 1RH9A 3B8TA 4HNTA 2AL1A 2I1OA 5I3DA 4C65A 1HQTA 3ATYA 2QUNA 4RZ5A 3T05A 4G56A 5J04A 4LRSA 3S47A 5FEXA 1E9ZB 3ME3A 1UPMB 2WZTA 5A2BA 3EB3A 1SZGA 2H9AB 1W1B1 2FDMA 2WJDA 4F2TA 3A5FA 3BW3A 1EF2A 4PB5A 1S1RA 2ZFAA 4BKNA 4GE8A 3F5JA 2CCRA 2W79A 3OQEA 4ACZB 1OADA 1ENUA 2OYMA 4LVAA 4F0MA 3ONCA 3GAKA 3OTRA 3W7NA 1IWAA 3GHSA 3I65A 3CZJA 2YZRA 4F0KA 5CBIA 3TROA 1XW8A 1EUAA 3LCIA 4NU7A 2H3BA 4GVIA 3T40A 1ODUA 2V6AA 4DYEA 1N55A 1QT1A 3KVJA 2DQXA 1XC6A 3QN3A 4E38A 4E4PA 2ZC1A 5ABFA 4AEEA 1Q45A 2EBNA 3TZNA 4DJDA 2ZRXA 1EPXA 4JPGA 3B4UA 2PAJA 2VL4A 2P53A 4ICCX 1ZGDA 3M43A 1FH9A 3BAYA 1EDTA 3OLDA 5A6SA 2AAMA 4OU1A 1X6NA 4NXSA 3BAJA 5BYWA 4TX9A 1JZ6A 5TAOA 3E2SA 1R6WA 3UXLA 1FHLA 2Q6ZA 1RXOB 2V67A 4LYKA 3PM6A 1YDOA 2YFNA 1BRLB 2PCEA 3LNMA 2QUUA 3W6YA 3VNYA 2KAUC 4RX0A 2X0SA 5LNSA 3VIFA 1LUCA 4RKAA 1N8WA 1LLZA 1UKTA 2P3EA 3VGBA 3LTSA 2B0MA 1UBPC 3SI9A 4DZAA 1L0PA 1K9FA 4F3HA 3I7QA 1UP3A 5E6YA 3M0MA 1PIFA 1QNSA 2ZQ0A 3KLLA 2FPYA 3ES7A 3KBJA 3WJSA 2DZPA 1NU5A 1JCMP 4WCJA 1ZJAA 1J6OA 1JDFA 3PVFA 3GDRA 1UH3A 2PTYA 1TREA 2VURA 4IPJA 2XG9A 3G22A 2AQOA 3VKKA 4ECLA 4MTVA 5D2VA 4CQDA 4BEQA 2DSWA 4H83A 3OG3A 1MEWA 3QW3A 1EBHA 4UOJA 4LS1A 3ALGA 3BG9A 3R12A 2WNWA 5FA5A 1M41A 2PDQA 3ZJ7A 3MSRA 3CHFA 4A2RA 1RUSA 1D9EA 1DORA 1UD5A 3WLOA 1DQUA 3VE7A 2G4JA 1E1CB 3TTYA 3M5XA 1GW1A 3W7EA 1EJTC 1XKYA 3I3BA 1XUZA 1W2PA 2XPKA 5H8UA 4X0VA 1UZ4A 4IX2A 1K9TA 3EPMA 4Y96A 4HK5A 8XIMA 3IARA 4PMYA 4QTGA 4ALDA 3U0HA 2YLAA 3WNOA 2J27A 1RP8A 2QJNA 2YJQA 1M53A 1ZBWA 1TWZA 4O19A 1K7XA 5HMSA 4D1IA 3ITVA 5BRQA 3KDOA 1I0DA 1OD8A 1GYMA 4NIRA 2IW0A 3KVKA 3HV9A 3KEHA 1Q6RA 3TONA 3FKKA 4Z1BA 3M0JA 3C52A 3S5ZA 3UWQA 4JTLA 3EWCA 3FJ6A 3KP0A 2J7GA 5AHMA 4AZHA 1RVGA 3BLPX 4AH7A 3WEZA 7TAAA 4WEVX 1PIGA 3QY7A 2AMGA 4HHMA 3UZ5A 1PCKA 5I3IA 3WLNA 1GQJA 2PLJA 3U4AA 1QW8A 2ZWZA 2D2JA 3GNRA 4A35A 2QPXA 3H8AA 4AMAA 4HCLA 2G37A 3NUKA 3INPA 4F66A 3SCWA 1RA5A 5DCDA 1QO2A 3LD5A 1KV8A 4M8UA 3L5MA 5LIKX 1XRTA 1DPMA 1TSIA 1W3JA 1UH2A 3WQ5A 1V3JA 3L4VA 3TMQA 2WNZA 3P6LA 1V3LA 5G4WA 3LGGA 2WKLA 2X1IA 3PJXA 3ELFA 3FJLA 1KCLA 4FZIA 2W67A 1XYZA 3EDKA 4U28A 5CKSA 3XIMA 3N13A 2X16A 4GZIA 1HKMA 5I3JA 2ODOA 1W1IE 4EP8C 1VEMA 3VUSA 5F2GA 3T8LA 1B0IA 1GVSA 4H8HA 2HS6A 4NL1A 1FXPA 3NQVA 1REQB 2V82A 4LS0A 1GEHA 3KP1A 1KKRA 1L6FA 1F3WA 1UR2A 3W7LA 1OF8A 1EP1A 3NO3A 1TWSA 1QNQA 3MMWA 1JI1A 2E5CA 4BI6A 5BXPA 3E0IA 1NP0A 2XH4A 1LG1A 3N2TA 2WWDA 1GPFA 2PWVA 1SO5A 2BVDA 4V27A 4NYYA 3RUBL 1POJA 4M3PA 3PWAA 2YBUA 3L4WA 3ARWA 3WK3A 4LUTB 1OX4B 4MOZA 2Y85A 5E93A 2NSXA 1J01A 5FKYA 4A3UA 4PUDA 4RXGA 2UV8G 3UCQA 5E9AA 2Z1KA 3WQFA 2HVOA 1CXHA 2RGLA 3C0SA 1DL3A 1ITUA 4KRTA 3VOGA 2VDIA 3S8HA 2IKGA 1B5TA 4Q8PA 3LV5A 2QR6A 2ZX8A 2FJKA 3AQUA 2RUSA 3R6IA 2XFWA 2YL5A 4HCDA 3IJDA 1V6XA 3KLKA 3JS3A 4KCVA 2VVSA 2QXWA 3MUAA 3ABSA 1KFLA 5MHBA 4NI8A 1UWTA 2CBVA 2X1SA 1X6UA 3IANA 3PULA 4DBEA 1FY6A 3LRKA 3WEMA 5FESA 5E09A 3N3TA 5FIPA 1RSCA 2JQXA 2JIEA 1HJVA 4NG3A 4JD4A 1ZZMA 4HZ6A 4UQCA 1Q8JA 3TTSA 2PDIA 3THQA 4DJDD 4G7EA 4XBKA 2CERA 1PO9A 4QJ3B 1FDZA 4PMXA 3ANUA 4H9TA 1B30A 5FJRA 4DWSC 2OSYA 1KM2A 3OBAA 1QI0A 5K9XA 2O56A 2W66A 3RCMA 3C2YA 1F3TA 3UCDA 2EPMX 3DCPA 2WO5A 3PR2A 5A6BA 2C13A 4ZE4A 4MJ4A 3L2IA 4ADTA 3O07A 1RBOB 1UUQA 3PZOA 2V3DA 3OEXA 3STGA 4ENLA 3UVAA 4HOXA 4EAMA 1AODA 2IUZA 2NX9A 5HMEA 3ZSSA 3L9CA 1ZENA 3CIVA 4O15A 1C7TA 3WNPA 1VEOA 2QVNA 3IRDA 1W5PA 1EFZA 3SUVA 4ES4A 5FL1A 1US0A 4GI6A 3EEZA 1KKOA 3SRDA 3M64A 2NQ5A 1GZ1A 4MKSA 1ZCCA 1WXZA 3CLMA 1UKOA 1KO0A 3JZEA 1JQXA 3LQGA 4LTSA 2JIWA 4IQEA 4WUIA 4FNPA 4H8VA 1UZHA 2ZA3A 5JH2A 3VNJA 1R85A 4NAEB 1Q5MA 2QIWA 2EG7A 2OR2A 4PYSA 1SJAA 2ZWYA 3KBMA 5BRPA 4LVFA 3W2JA 4XAFA 5H8PA 4M1RA 3L65A 4D8LA 4MY9A 1PTGA 1SPQA 2CITA 1XRFA 4EE9A 1WV2A 4CQ8A 4JX4A 3A22A 2HXTA 1X1ZA 4B9ZA 4A8IA 1P6CA 1XLKA 4XUYA 1SMDA 1TIWA 4KRZA 4DJDC 4XD3A 4PRWA 4EANA 1K4HA 4N02A 5A2AA 2OQYA 5D02A 4JYEA 2VFFA 5DMYA 1X8FA 4I9TA 1J96A 4HTBA 3B8WA 1XLIA 3GR8A 4AEFA 4RDZA 4DEFA 2OLSA 3O15A 3GHRA 1Y5XA 3T2QA 1AW5A 2AL2A 2C1GA 1IQ8A 3VZYA 5TD4A 2P50A 1K1DA 4M24A 2VUNA 5BXTA 3E96A 3FN9A 3SUSA 3VM7A 3P0XA 4L65A 2I5GA 3RLVA 3K1GA 4F0RA 2EPNA 2Z25A 2JEPA 4JQ3A 3NL2A 2PZ0A 4O4WA 4HNLA 3GDLA 2E6DA 4Q8MA 4D9PA 2QUTA 2YBTA 2HDJA 4JOMA 4I3GA 3FDKA 1V6YA 3HA1A 3LQLA 3WQEA 3OVGA 1VGAA 4P2VA 4ONVA 5DMNA 4V28A 2NQHA 4HHPA 3RPDA 3TNOA 1QR7A 3H21A 4C6NA 1POKA 4JTUA 1WKYA 4F9DA 1OHLA 1NOWA 3IVSA 3CT2A 3IACA 4AVFA 2ZBTA 2IXVA 4PUMA 2VENA 4XIMA 5H91A 1G0CA 3SCQA 1WDDA 1VR6A 3ABRA 4DN1A 1V4YA 2VGIA 2PDUA 4AZBA 4ZTYA 1VLWA 3RU8X 2R82A 3L4ZA 3EWZA 3E2QA 3WKZA 3AYSA 3VZXA 2ZC8A 3MMTA 3OU8A 3M6YA 4YTTA 8A3HA 1JD7A 4ZXLA 1LROA 4GPNA 1F6YA 2R91A 3W1LA 4IUGA 1XP3A 3UG8A 2OTDA 3CTLA 5K9DA 2PWFA 3A47A 1GOWA 4FR6A 4JTTA 1YNPA 4CU6A 3VGEA 1RR2A 4U31A 4YCPA 9XIMA 3SN1A 1T99A 4RPPA 1N8IA 2YCJA 3GR4A 1N82A 1HX0A 1DEDA 4QBXA 3MKVA 1KFWA 1XSKA 3WD4A 4G6CA 3TWAA 1RZMA 1SSGA 3DFPA 2NVDA 2WVUA 1I45A 3VKAA 3VZZA 4PULA 1G6CA 1TV7A 3VMNA 2VX6A 4BI7A 4NYUA 2BBFA 3SCSA 1G67A 2X8RA 3LCXA 4KEMA 4OFCA 2G50A 3TYCA 4Q4PA 4NJKA 1IV8A 2ZA2A 1PZ0A 4QLJA 1HL9A 1W1ZA 3LGDA 3DHUA 2A3HA 1FKWA 3CUFA 3HQ1A 3GYEA 2E0PA 4HPXA 4WXYA 4AF0B 2XSBA 4S1FA 4WHBA 1VBHA 2PD9A 3EMCA 5E1QA 1JXKA 1Z7AA 2G0WA 2ZX7A 5LGXA 5CG7A 4JIIX 4A6GA 1XIDA 4EF8A 4NX0A 2REQB 1KLZA 1IR2A 4QQUA 4QE5A 3QM3A 1FKXA 1LRTA 4XVEA 2DW7A 1E72M 4J3UA 4PB4A 1TYGA 1M7PA 4AIOA 5I02A 3OVRA 4OBTA 3C0LA 4RNHA 3HG4A 2X41A 1MYRA 3LHUA 3UT0A 3VPLA 1WZKA 4ZQMA 1GG0A 1EJVC 3W7HA 1NSJA 4JICA 3VGHA 9RUBA 3KVLA 4KCWA 2NX1A 1FCVA 3BW2A 1OC7A 1XR2A 2VFDA 1L6GA 4BK9A 3E5PA 1CIUA 3DOPA 4F48A 1JEZA 2DH3A 5D8WA 4D8ZA 3AIRA 4C5YA 4A8NA 1Y0EA 4XQ6A 4HK7A 3H12A 2DP3A 2CWNA 1LLWA 1PZ1A 1XLDA 4ZOCA 3C0QA 2XYLA 1TV3A 3TN5A 1ME8A 2YYTA 4GLEA 5JXQA 2D1ZA 3GWQA 1ITXA 3WFLA 1DIEA 1LOQA 1VPXA 5DRIA 3EBVA 2EAWA 5C54A 3R58A 4G1NA 3ECQA 1E43A 1UROA 4IXXA 4C6MA 3W7PA 3V1HA 1Q13A 1OCJA 1H09A 1ZP4A 3I6TA 2J79A 3C56A 2INFA 1DE6A 1VCGA 2YPIA 1ISVA 3H2AA 3B0XA 1H7XA 1T5AA 2GSJA 5EMJA 1GJWA 5HMDA 3BDKA 2QV5A 1D7KA 1BXNA 2VEPA 4CVUA 2Z6JA 4V33A 1X7IA 3CIXA 1AQ0A 3MJYA 4WOZA 2D23A 4H19A 1V0KA 3IPWA 3UPWA 4FXSA 3RU6A 4L61A 1P0KA 3L7RA 2PLKA 4S3AA 2OGJA 5FJUA 1AJ2A 1YE6A 3UNDA 3UF9A 3QGVA 3OLEA 3ZXWA 1BGAA 3DGRA 3W1TA 1B1YA 2EO7A 2OFJA 2YDAA 3KWXA 4DF1A 2CESA 2ZRUA 2RKXA 3GLCA 3M5YA 3S2CA 2WHKA 1CT5A 1KBJA 3AJXA 3UR7A 1K03A 5FACA 2BOEX 5M5DA 4GQ0A 1FQ0A 3ZJKA 1WKFA 3KWSA 2Y88A 2X0YA 3T4CA 3CEUA 2GK1B 4A29A 4KEVA 2QAFA 2E9LA 1UYQA 4INFA 1F4HA 1CX9A 4IJRA 4GQBA 1H0GA 4ROPA 2NUYA 1AJ0A 1G4PA 1QOPA 3VD9A 5I79A 3EB2A 1S38A 4CVWA 3TWBA 2GGEA 4GYFA 2NQZA 3H7RA 5AC4A 1T8QA 3FJ4A 1WX0A 3STPA 3RPTA 1U1HA 2YFOA 3DI1A 5A94A 4KRUA 3S6OA 4J4KA 4BWLC 4O8RA 3CYJA 4FIRA 1UH4A 1IEIA 4PL2A 2FZ9A 5I3FA 2ACRA 3PZIA 4YCOA 3OP2A 3BICA 4NJGA 1L6SA 4ZXOA 2DIKA 4GIAA 3WH6A 1KM5A 3PJUA 5IHSA 3CH0A 2BXYA 2PDLA 1ZY9A 2RH9A 4BWLA 4L6DA 1LTDA 1EGZA 1X7FA 4N6FA 4MNJA 3GBEA 4HBKA 1MNZA 1CEOA 3PC0A 4QAIA 1HUVA 3L0KA 3RM4A 2VTFA 1YQ2A 5LHEA 2NX3A 4HHHA 1ECEA 1W3KA 3PBMA 1JZ3A 2P88A 5HNUA 3WJWA 4ROQA 3RMJA 3WF4A 2WC3A 4LF2A 2NV9A 1AQHA 4CNOA 3AS3A 2PDPA 3PANA 1Q6EA 1XD0A 2IPFA 1XJBA 5HDRA 4Q33A 2UY5A 2BASA 4RW3A 4R88A 4LAKA 2PWGA 3QRHA 4NVTA 2AKZA 3AOFA 1BEUA 3CUXA 1IGSA 4JTRA 1JZ5A 1TVNA 4UOZA 2GYIA 2GQAA 4DNHA 3BOLA 2RDTA 1GQNA 3DFOA 5FOOA 3QBUA 1TTPA 1UKPA 3DG7A 5RUBA 4V1XA 1L2QA 2V0TA 4LEFA 1SZFA 2FKPA 1H41A 3S4TA 2F61A 3BJSA 4EACA 1YE4A 1XLFA 2ABAA 3WH8A 3MVTA 4MZYA 4FI4A 4JTFA 5LA2A 2CZEA 3ARVA 5HA7A 5HQLA 1LQ0A 3GXTA 2IQTA 1XINA 3U2ZA 3G6LA 5CZSA 4B2DD 3M16A 3S46A 4AY7A 3AMGA 3DYPA 1EB3A 4XZWA 5D2XA 4Q8TA 1ECQA 3PPCA 1UWQA 1XIIA 3F2CA 2VFHA 3W88A 1UWSA 3KL5A 1M3UA 3TFXA 3ARZA 3S9ZA 4KW2A 1OJXA 2JF6A 3LCGA 1BAGA 1C8YA 1XDLA 2WSQA 1J0ZA 3EDFA 1UASA 1FA2A 4G7EB 3PN8A 5A95A 3R0KA 2E3ZA 3L4TA 1M9HA 3A13A 4MB4A 4RXFA 1TVLA 1C93A 3LPGA 3W9ZA 2PF8A 3TC6A 1XF0A 1VIWA 4HPNA 2YKKA 3V36A 2W6RA 2GOKA 4U4MA 1V5XA 5E0CA 1ZU8A 2QCDB 3UGRA 1NWUA 4PODA 1M1BA 4ZO9A 5HK4A 3IGUA 1IZJA 4W85A 3IVUA 2P0IA 1U2YA 4H2CA 2WBKA 3UJSA 2PDCA 5CSUA 3AZRA 5C9XA 1Y8BA 2GWNA 2B31A 3K30A 3WMSA 1DWGM 1QPQA 3AXMA 3I6RA 5D9MA 2QMKA 5HR6A 3B8DA 5HANA 3CUGA 2CIPA 2Z1SA 3WDHA 2FQIA 5AVHA 4HZ8A 2H3DA 2V5CA 3GO2A 3MANA 1W2VA 1K4GA 3A64A 1KGWA 4ZFMA 1QFEA 3CWOX 4MSSA 1D3HA 1RJPA 2I9UA 2EG6A 4A05A 6REQB 2W9MA 3H2OA 4Z0SA 1V77A 1PXGA 3TAKA 4MAZA 2W92A 3KS5A 1QASA 3WQPA 3G0UA 3WBEA 3V16A 4UQDA 1RP9A 4QLLA 2H8ZA 4DB7A 2TODA 4MF4A 1PTAA 5C55A 3R0UA 4FNSA 3ZT6A 5T8GA 1DJWA 1GVOA 3D5HA 3G1AA 4PGLA 3LZ5A 3G1RA 4Y90A 1YXDA 2E6FA 4WIWA 3AYRA 2B81A 2JKPA 3WLLA 1R3YA 2FTYA 3G1SA 1W5OA 4HD5A 1GOKA 3EWYA 5F1VA 2GQ9A 3JZUA 4LUTA 4CQAA 1UD2A 4B15A 4PFMA 1CLVA 2WMJA 4YU1A 2BSLA 1S39A 3QSTA 1MW1A 2QYGA 3I68A 2CPUA 2V69A 1B3WA 5A6MA 5DMMA 3B05A 3RXZA 2E7FA 4HKPA 4GVHA 3PZNA 4UWMA 3LM3A 1EEPA 5C0QA 4C1NB 5I6SA 3ZJ8A 3LLXA 3ES8A 3REQB 3KRSA 1XPGA 4JGDA 2J25A 1KR0A 2DV0A 4J1OA 5E5CA 2GJPA 1U83A 3IJ9A 3SRKA 2E1DA 4DWSD 1V3MA 4F40A 5D05A 4FOUA 3AIBA 1T40A 3WNKA 1WPCA 4RUBA 3IGHX 3IK4A 4LNYA 3MCOA 1Q6CA 3KUMA 3I3DA 2GPTA 2DZVA 1TPWA 1A5MC 2REQA 4I5RA 4QNEA 1GTEA 3GNNA 4HIBA 1A4MA 3QF0A 4KETA 1BHGA 4ORIA 1BG4A 4WGXA 3HJEA 1JCXA 1EA0A 3C3NA 1JZ8A 3H4GA 2VCCA 2FB2A 3MUY1 1QJWA 1KXVA 4CN6A 4GH1A 2QKFA 2OQLA 4ICMA 4FOJA 1EZWA 4IIHA 3O05A 4XKYB 3V5CA 2W27A 2YCKX 3ICJA 4L6OA 3WLKX 1ZL1A 2XZ7A 3EA3A 4LS2A 1NEYA 2VJXA 3ZSTA 4F0HA 3O2LA 3WL1A 2CHNA 2ZA1A 1GHRA 2PRMA 2YW4A 3D3FA 1JD9A 2PZNA 3BCDA 3RO6A 1BYDA 3OOQA 2PDHA 3WJZA 3FXGA 2ANUA 1ZAIA 3VDBA 3RPMA 4IP7A 4QJ5B 2Y7DA 1R3WA 4NZCA 4JS3A 1GWJA 1JVNA 2Q02A 3ARPA 3I3EA 3LRMA 3IAQA 1PEZA 4YTRA 4J40A 2FFCA 1ISZA 3QEZA 5C5YA 1LM1A 3SGGA 2WMGA 3GHTA 3PZUA 3EX6A 4O52A 2QDEA 1TJ2A 3ZMRA 5KETA 4CNTA 3IEBA 4H6RA 4PB3A 2VEKA 1L6YA 8XIAA 7TIMA 4G1KA 4L9YA 4H2HA 3CQIA 5E0KA 2OJPA 3UWVA 4KFNA 5D38A 2VEMA 4OUIA 2R94A 3EA2A 1T8XA 4YHGA 1YDVA 4R7JA 4HT3A 2PDYA 1HGWA 3TLLA 2FPTA 1TCMA 3RK8A 4MZ1A 5LIYX 7PTDA 3P67A 2BG5A 3EX3A 1GZJA 1W3NA 3RF9A 8CGTA 4RR4A 1LOSA 5LXEA 3NM3A 1EIBA 4AZCB 3BGJA 2G95A 2GDVA 1HJXA 3AXKA 1SW3A 1OQFA 3MP4A 1XBVA 1TJPA 3K4WA 1NTHA 4O57A 4DWSB 3P61A 2Q01A 4TU1A 4EPDC 4S2BA 4LYPA 4W7VA 2RDWA 3Q37A 3G1YA 1L8NA 4HYWA 2BX7A 2ZX9A 4FLRA 1MXGA 1E0TA 2R24A 4RNIA 4KMQA 1YLVA 1QPNA 1ITQA 4HYVA 4L4PA 3DDMA 4LAOA 2RDXA 2C0AA 2W91A 1WCGA 3QQ1A 2WB5A 5CPTA 2J7BA 3QV8A 3HBLA 2HK0A 3G77A 3SCNA 3GVVA 3LOTA 3PUGA 5AYYA 3MKKA 5TF0A 5FSDC 3TTQA 2IPJA 4LF1A 3VM5A 5AHIA 1PV8A 1OYCA 2YCEA 3UYCA 2OWWA 2GVYA 1CCWB 3UZZA 3F7JA 4IFOA 4GZJA 2A0NA 3AXXA 1GOIA 2AGTA 4HN4A 4DUXA 2IQ0A 1KR1A 1RAKA 2BXZA 1SJCA 1JNEA 2BNJA 3GX9A 1UOKA 1R3SA 3M7WA 4HPJA 1E9YB 4NZFA 3P93A 4M6UA 2Y89A 4OWGA 2VXNA 2W63A 2A2IA 1CWYA 3COTA 2Z6IA 2GQ8A 3MY9A 2XN1A 2BZNA 3PBGA 1XGDA 1WQ5A 3KRBA 3WD0A 2VFGA 4HMCA 3V5FA 2HZGA 3ERPA 4K38A 4MKVA 2YB4A 6XIAA 4MNLA 2XGBA 1MDRA 3OBEA 1R9XA 4ASTA 4JFTA 2CKSA 4XK2A 2XWDA 5D9NA 3HPSA 1P7TA 3MHFA 3O3RA 1I0BA 4HB7A 4LCQA 1B90A 3VUPA 4P7OA 3MT1A 3W0KA 5H2ZA 4LNCA 3MBDA 4MB5A 5CZTA 1QW7A 3A3HA 1JZ4A 4UB9A 4GY7A 3IAPA 1XBXA 1XGEA 3UNTA 2CHOA 3QGKC 4C6QA 4JTQA 4GKLA 3HPZA 6REQA 1E0UA 3NSNA 3GDMA 1Q7ZA 1P0DA 2YIHA 3QPZA 4S3EA 5LIUX 4LB4A 1J10A 3RITA 5CG0A 3LV6A 3SCRA 1LYXA 3GDBA 1YTEA 3SECA 3QW4B 3WBXA 4S23A 4W5ZA 4G9PA 4MFDA 1EO5A 3BC9A 4MAVA 2NXGA 3W7MA 4DJEA 3LHYA 5I5RA 1LWIA 2ZTKA 4MYXA 1NH6A 6TIMA 3UG3A 4EK7A 3AI0A 5J5DA 3BMVA 3PBUA 4A8RA 1TPEA 3VIGA 2ACSA 3ITTA 4UQEA 2XIBA 1S2WA 3GU2A 1DV7A 1WZMA 3DFQA 4P8XA 1E3ZA 5AFDA 3T2OA 2PTWA 1B31A 4IIEA 3EX1A 4YVPA 1SJDA 3AZTA 3BAXA 4TTUA 3VI2A 1PUDA 2ISDA 2Z2AA 4IPPA 3LTYA 2AOSA 1QNPA 2Z0IA 3OZPA 3RLGA 1XIMA 1OYAA 3N4EA 3E0LA 4WR3A 4E8DA 3QZEA 5CLTA 4AD3A 1QAPA 1QMLA 3AWNA 1JULA 4JTJA 3QZAA 1Q2SA 3TR9A 1DHKA 4JQ4A 5CC6A 3AU6A 3TN3A 4N7QA 2VX5A 2VC6A 1SW7A 2NQLA 3G2GA 3L0GA 3P62A 4XZNX 3LYEA 1XLEA 3ITYA 3NVTA 4UXDA 4RV8A 1HT6A 4M82A 3DUGA 1E15A 4UNKA 2A3LA 1YXYA 1FDYA 3KZPA 3MKCA 3VCNA 3L21A 1L8PA 4H8UA 1J12A 2DT0A 1LRNA 4C60A 4BF7A 1ZP3A 4GWEA 1TRIA 2WZEA 5G4HC 3GQYA 4JNMA 3SIMA 3BGAA 4K7VA 3RHGA 2GVGA 3SBFA 1PX4A 1FUYA 1QHOA 1TPC1 3NQFA 1UJQA 5DCBA 4C7FA 1Q8AA 1P1MA 5ECUA 3SN0A 4O54A 2O9OA 1VIZA 4A8LA 3NPXA 4JDYA 1WDRA 3ABZA 2X09A 4H3DA 3WZ0E 1O5RA 3TW7A 4GBUA 3S5OA 1O5QA 3GS6A 3NEVA 4KEUA 2JF7A 3EZ4A 3EKGA 4ATLA 1FH8A 1W1A1 1OCNA 2E1WA 4Y9NA 4WJXA 2OELA 4BEUA 4NP7A 4IQJA 3ZQ9A 4HOZA 2I5QA 2EXOA 1UB3A 3OZOA 1A4LA 2BS9A 4DUWA 4MVAA 1TIMA 3B0PA 3C8NA 3LTPA 2XU2A 2WCSA 3MO7A 3P8JA 4R53A 2WSYA 4B3LA 1JNDA 4AF0A 3D0CA 1I6NA 3LHTA 4LW7A 4JKKA 3RN6A 1TE1A 1J2WA 1R3VA 3N4FA 3QQ0A 1EXBA 4AZGA 4DI8A 1VFSA 1NARA 1NELA 4M1BA 1AUSL 4H7CA 3F4CA 5CGTA 1H60A 4GQRA 1MWOA 3GD6A 2F9RA 3QVQA 1HG3A 3MCMA 3TN6A 3S2MA 3B0YA 3UYIA 3T07A 3AUOA 1FWNA 5D9PA 1GKQA 3H24A 3OJGA 2X2GA 4YWIA 2BV9A 4HSHA 1OK6A 3BXWA 1BPLB 3MBFA 2X42A 3CJPA 3QGAC 1VBUA 2EG8A 1QOQA 4AYSA 1Q6FA 1MFUA 5HQMA 4M19A 4YVXA 1OEPA 4PBGA 4DNMA 3CUHA 2BLEA 1A5OC 4LUIA 4Y6GA 1W1TA 3HG2A 1B3OA 4DJEC 4UTTC 3UR8A 4M7TA 3R8HA 1OT2A 3JVAA 5BWFA 1D2KA 1FVPA 1WDWA 4L4LA 2ZZ7A 1J0KA 4TMCA 2OGYA 5D33A 3YPIA 4JFSA 3CL6A 3W25A 1VENA 2PCQA 1JGMA 3NG3A 3GH7A 4E2OA 4X2PA 5KTLA 4BJHA 3B9NA 2OKTA 5F4XA 3EWDA 3MSGA 1W9VA 5C2CA 3PZ9A 4O11A 4TTGA 2NT0A 4Y2WA 5DBTA 4Z2HA 4N9CA 1GEQA 1MXSA 3TVAA 5HWJA 1U30A 1X38A 3KBWA 4P7NA 4US5D 3TXZA 4MWAC 1VAHA 3W1RA 1RQHA 3EYPA 3PZQA 3Q45A 4GX8A 1SVDA 1VBRA 3PWGA 5EBAA 2XVNA 3DAQA 4UQBA 2HTMA 2DUXA 4LGXA 3W7GA 5G2WA 2ZXAA 4AIEA 1DE5A 1XDJA 2DIEA 4K3ZA 4M6QA 4W8LA 3S1VA 2VQTA 1WAUA 2GDUA 4D72A 1VEPA 4NT0A 4Y8EA 1O95A 1E5JA 1G4TA 3KBNA 4Y8FA 3UETA 4TX6A 1TCDA 3KTCA 4WD0A 1IXOA 1HO1A 2NXHA 1OX5A 4PMQA 4GNVA 4PH6A 3VINA 1IEQA 2WANA 1BG9A 2W3ZA 5J5RA 1E6PA 4LBUA 2PC8A 4YNGA 4HJFA 5LHFA 1EX5A 3W82A 3HU7A 5CLWA 1FWAC 3ZVHA 5GNYA 4LUSA 4DO7A 1UC5A 2QCGA 4KPLA 1TVPA 1YPFA 1H7WA 5HR7A 4NHVA 3H4XA 2WMHA 5CSRA 3M1ZA 4O8AA 4PUUA 4AC7C 3N6HA 3BG3A 3PUDA 1K9EA 3GUGA 4ZOAA 5DFAA 4YYFA 3CV6A 3SN4A 1Z48A 2NQJA 3PSVA 1M01A 1G5AA 4YYCA 3SUWA 4UUIA 1VH7A 4GACA 3IJQA 1CYGA 3REQA 1TTIA 4JQ1A 1IEWA 5FAGA 3UBPC 3CT7A 1GKPA 1GTHA 2C19A 4TVUA 2VYOA 4AD4A 3WCZA 1ISWA 4AFYA 2CFFA 1QHPA 3DXIA 5HOSA 1JDDA 3UXKA 3POCA 4RNJA 1UJPA 1CXFA 1PKYA 3PPFA 3GKFA 2ASHA 1R2RA 2YB1A 4BR1A 2WMFA 2OYLA 4F2UA 2QULA 1XG4A 1UR3M 3M47A 3CUZA 1IZCA 1FWJC 1LT8A 2XM2A 5DRCA 2P8BA 1G69A 1RY8A 2QVHA 3E3HA 4HK6A 2HE8A 1L2UA 1PX8A 1V8EA 5A6LA 3ITXA 3EMZA 1THFD 2GZXA 4CCZA 3E1F1 1I60A 3F03K 1MFVA 4ATWA 1JUEA 3NPWA 2J7DA 4R9OA 5G1TA 4AY8A 4RE3A 4GJJA 3EOSA 3FYPA 1SFSA 3SSZA 1VRXA 1XUUA 3T9PA 2HQAA 1TR9A 1NDYA 5B7ZA 3GIYA 4O4VA 1TA3B 3T1GA 4YS1A 1X8CA 2DIJA 3FJNA 2GUYA 1F5ZA 3TOPA 1ONEA 3BAKA 3NYDA 2GJLA 1A5LC 1OX6A 3JU2A 4WOQA 4KGJA 2NV1A 3FFSA 3N9RA 3NQGA 2DZAA 5BU6A 4AIBA 3AC0A 5HMFA 4JAWA 4NZ3A 4ERGA 4QP0A 3THUA 1FDJA 1U5HA 2FZ8A 2WM0A 5AYIA 3IIPA 3S5YA 3WK0A 4Q8OA 3VDAA 1IT0A 4ML4A 1P48A 5AVNA 4HNNA 4QG8A 4F0LA 3W37A 1D3CA 2W5FA 1DJYA 1WBJA 4FNUA 4BS0A 4CCEA 4QSHA 2Y7EA 2WK2A 4O14A 1AH3A 3S5NA 4LAZA 3WD2A 4QISA 4IWWA 3VIHA 4CEXC 2YA0A 2PDKA 3V1PA 2WJFA 3TV8A 2A3AA 3BJTA 3P8IA 2HVNA 1PDZA 1EHAA 2CXGA 1EL3A 4MWAA 1XQKA 5F4SA 4AZ5A 4GNKB 4UFIA 1E6XM 1M65A 3O0FA 4IIBA 3WBAA 2Y7FA 2J7EA 1I2QA 1A5KC 1JCNA 1DIOA 3LPFA 2R8WA 3WLJA 4PTXA 3MZ2A 3NIYA 4DLMA 1YXCA 4XISA 3FXYA 3CO4A 3UJ2A 3LLFA 3EGJA 1IXQA 4IIFA 5E6ZA 4I9AA 5IXEA 4WX2A 3PZVA 3TJLA 4JFVA 3NR0A 2ATMA 3TSDA 3B97A 5G1YA 5C2XA 3H53A 4BQ2A 2V3GA 3UXAA 1PSCA 1V0NA 4IMFA 5GNZA 1V7YA 2MNRA 4JHOA 4PSRA 1HL8A 1OGBA 3GNOA 3CQ0A 2QCEA 4UTKA 4EXAA 1O94A 2BHUA 1IHIA 3SQSA 4TXEA 4NZ4A 1S5WA 3UJFA 4WSHA 2DZTA 3N2BA 2WMIB 2HXUA 1IXPA 5KZEA 1V3IA 4LOCA 1GONA 4UTWA 5I2UA 1H61A 2DY3A 5FF4A 3N2CA 4NY2A 4GUJA 4H4IA 4ZEPA 3GG1A 2QCMA 4L1XA 1T0OA 1JYVA 4KFPA 1G01A 2BVWA 4PC8A 1B3VA 1FWEC 3MDUA 1XCWA 1H7PA 4ZCWA 1JF5A 4QLKA 2ZVRA 4ZB0A 3DFTA 5FJOA 3M7SA 3NQ7A 3TK7A 3VTRA 4NF7A 2XFYA 1P0NA 4AHQA 2OODA 5I07A 1J5SA 1W9BM 1AD4A 5C9WA 3BSHA 2E4TA 3AJ7A 3W26A 1AVAA 1QK2A 1W5MA 3K46A 1UHVA 5CZJA 4XIAA 3H55A 2EJ1A 3LA4A 1YHTA 1JJKA 1K8ZA 2LLEA 3W1XA 2C16A 1XKJA 5BMWA 2VNCA 5REQA 4XX6A 4HU0A 2R1LA 4OECA 5ENLA 3GW3A 5A5WA 2GUBA 4Z42C 3GKAA 4JN8A 3UR2A 5BXRA 1D8WA 4DXVA 4PMZA 3M44A 3WDPP 1VFLA 3CIWA 2CC0A 1BQCA 1DIKA 1KXTA 1VCFA 1ZS2A 2VR4A 4QG9A 4ZQPA 5KSWA 2VEGA 2CLEA 4FXFA 2CLHA 4TVCA 1W1YA 4B5WA 3WK1A 3E0WA 4OBRA 5EFFA 3TX9A 4JYFA 2PPGA 3PS7A 3OZYA 2VMFA 2EEXA 1AQMA 5BOFA 3E2RA 3TQVA 3N6QA 3CUIA 5FJTA 1X39A 4GZEA 2ISSA 3BL3A 5U7SA 3QTPA 3E02A 1KTNA 3AMDA 4GC4A 3VD7A 4N2YA 1UW9A 3QOMA 1Q2RA 2V2HA 1V6VA 2Y2WA 3EWBX 4MFEA 4U5IA 5K3VA 1XBZA 4UMAA 5L9FA 4PBFA 3KS6A 2D0HA 3QMSA 4GI8A 4N9DA 5IBXC 2DVTA 4NAFB 2PU1A 4J35A 2VOTA 3W2KA 5A6AA 2PB1A 4XBSA 2EJAA 2CEQA 5HNNA 4GQGA 3TDFA 1F4AA 4GQQA 3LK6A 1MXDA 3M0ZA 1IGWA 1ISXA 4R3UA 4H04A 1KTBA 3OVPA 5FSEC 2C14A 1FCQA 2E6AA 1ZBVA 3M41A 4MJZA 4LUYA 1QBBA 5A8QA 1B3YA 4QITA 3TQ0A 2NW0A 4MM1A 1HIZA 1XDMA 4O1EA 4Q8UA 3ZIZA 4PA8A 3H7VA 1V02E 5AHLA 2DZXA 2GJRA 4DWDA 3B0UX 2SFPA 4LEQA 1MZRA 4O28A 4K1GA 2YL8A 5EMMA 4MY8A 1LT7A 1K6WA 3PK7A 2DQWA 5SWUA 3N9SA 3VIIA 4DJFC 3WD1A 2XN2A 3RDKA 1NWRA 2P1FA 4O13A 4PTMA 1WUEA 4JDBA 5HNTA 1CGXA 1HJQA 2Z28A 3CASA 4B5XA 1VFFA 4L7ZA 3UWWA 4QFUA 3BH4A 2V5DA 2VCAA 3O8AA 2FVMA 2MUCA 1F73A 3P60A 3WDIA 2V63A 1BGGA 5M03A 2AQWA 5I3GA 1EJRC 4BFAA 3MSDA 2NLIA 4ZQNA 3B9EA 1VPYA 2Y8VA 1MMFA 3UJRA 3IV8A 1SGJA 1ZHAA 5J8LA 1A53A 3EDEA 1UG6A 3HB9A 2AQVA 3LERA 4OE7A 4RV3A 4AWEA 4L4MA 1ZLPA 4NRRA 4BY3A 4GXWA 5E0FA 6A3HA 3W1UA 3W22A 3NSMA 2ATSA 5XINA 4L5ZA 1ESWA 5FJJA 2QCCA 2A3BA 1PWLA 3WMCA 1O7AA 2BVTA 2TRSA 3HQPA 3BOFA 1A47A 2BY3A 1P1XA 4GY0A 5LNUA 5MF5A 1KTCA 5AB3A 4C1NA 4MB1A 5AY7A 4PTVA 4LCRA 2O92A 2XIQA 1EP3A 4GRSA 4IICA 2Q3RA 3ZVIA 3C6CA 1XV8A 3QV9A 2DZUA 3FSTA 4UNLA 4XD5A 1OCQA 4GG9A 3URNA 3TN4A 2BXVA 4XSLA 3CYVA 4HA0A 3WNNA 3AIWA 5F2IA 2FDSA 4HOWA 2NT1A 1BSLA 3BK0A 3EXTA 3HQNA 3VIMA 2CZVA 4GUHA 2E67A 3VK5A 1RLCL 2WQDA 4HU3A 1QU4A 3TE9A 3FAXA 4D6CA 4B3KA 4F8XA 1YDYA 2ZX6A 1XFBA 3NQMA 4J2MA 5F2MA 3EOUA 3O06A 5DT7A 1XYMA 3C0JA 1EZ2A 4WRHA 3A3XA 4LSBA 4AZCA 3ZLFA 3M5ZA 1ZCOA 5GJPA 2OX4A 2Y61A 5KINA 4WSKA 1TO3A 1EQCA 2PWHA 4AW7A 3T7VA 4AVOA 4ZBCA 4JL2A 2BDQA 3CB3A 1EOKA 4PE8A 3UD6A 1A3HA 4QEEA 1OC6A 2PTZA 2V9DA 1R46A 2DORA 3TA6A 3CAWA 4XD6A 3ORWA 3RRXA 3ZT5A 3U2CA 1KFJA 3CZGA 2WPBA 4FK9A 3KL0A 4Z0JA 3AYVA 4WQ6A 2DUAA 1F74A 2H8XA 4GCXA 5LNWA 4NSBA 4AD5A 3ZM8A 3W02A 3MV11 3TQKA 2PP3A 1E40A 3E2VA 4NKCA 3MUCA 4RPQA 4A3QA 3QR3A 3UXIA 3AIEA 5G4EA 2ZUVA 4D6GA 3O6CA 2OLAA 2J62A 4WY0F 4C7GA 2H6RA 4BHYA 2Q8LA 2ZZ5A 3NQBA 4GJIA 1XHGA 1TA3A 1K77A 5CBJA 1W37A 1AW2A 4JIPA 1V6WA 3DHDA 1K7EA 3WLSA 3IWPA 3TYAA 4JKLA 4J3TA 1EDQA 1EJWC 1DIDA 3MVIA 3XISA 1FWBC 4RLIA 1NF7A 4W4QA 1W3TA 3A4JA 1AH4A 3QJAA 1XL9A 5HNRA 1UZ1A 3BV4A 3UG4A 3TFCA 1XIHA 3RLUA 1LDCA 5CAKA 1QOXA 3ABOA 5M3WA 3IJLA 3V0UA 4B3ZA 4L56A 2WAGA 1FFRA 3BMXA 4HMDA 4IMEA 3AIUA 1X98A 4Q3MA 4I90A 4C6LA 1I2OA 4CD5A 2FGLA 3F4WA 5BZAA 4OZOA 1I2RA 2BOGX 1XC4A 4EIVA 4PMVA 2YL6A 1J2BA 1JPMA 2ZUWA 2VELA 3GXFA 3K5XA 3TTOA 5AYBA 2TAAA 2Z24A 3P81A 1AJZA 3R8RA 5TNVA 4F0SA 4NNBA 2FTWA 3ATZA 3VNIA 4K36A 2NVAA 4QDWA 3BLEA 2DSZA 1R3RA 2CLFA 4AVNA 1T7LA 3OYZA 1QNOA 1OYBA 4C91A 2J7CA 4AWUA 4MPQA 1MUMA 3LN3A 3G24A 3TIMA 4FALA 3TJXA 3NZ1A 1JGIA 4W7WA 3H2EA 1OFOA 1UIPA 2CZFA 5AN7A 3UA3A 4H1ZA 3EX2A 1AK5A 2X7WA 4DPPA 1A3WA 3CPGA 4QCEA 1JPDX 3NL6A 4LB3A 1OABA 3VGDA 1PHWA 2F6KA 2E28A 1PZ3A 3RGTA 4KKXA 3QLLA 4ZO8A 5DY3A 2NV2A 1EBGA 1LBFA 2GOUA 1TPH1 4N0RA 4WF7A 4FX7A 3ARYA 1DYSA 1V08A 2P5NA 3CZLA 4ZE5A 3HO8A 2OEKA 1MVYA 3UY7A 1Y7VA 2PDFA 1TX0A 3QY6A 1EOMA 1TX2A 2ISWA 3G0SA 3ITLA 2QGYA 1QPRA 3BLFA 3NL5A 2PP1A 1VC4A 4A2SA 4UFLA 2CU0A 1S5TA 2Y63A 2J7FA 1BVZA 1YEYA 3NXLA 4JTCA 1P4CA 2J47A 4D1JA 4CNSA 4O1FA 1OFQA 4O12A 1NWSA 4Q7IA 1HKKA 1WOAA 3UZYA 2VFIA 3TYEA 1ADOA 1UUOA 4ACZA 3WUBA 3BSGA 2DFAA 2ZUTA 1Q7QA 1ICSA 3NFUA 1TV4A 3F5KA 4AD0A 1ZNNA 4GX9A 5C2GA 1C3FA 1T41A 3EWXA 2E6YA 2C8NA 2IMRA 1V93A 2I56A 3D46A 1U22A 4S3BA 5XIAA 1XG3A 1H2JA 5H6HA 3GH4A 4IPIA 1K9DA 4QDPA 5GJMA 1CB2A 3G1HA 3D6NA 1IF2A 3NGJA 1R87A 1PE1A 1VFTA 5D2TA 5JIWA 3WQ6A 4B9YA 1G7UA 1ONRA 3K13A 3TSMA 3KOWA 4CN1A 4IISA 2O9RA 1JYWA 3T2PA 2PTDA 3T0CA 4GYPA 3MI2A 1YX1A 1R30A 1H5YA 5C7VA 1LQ2A 2HNEA 2X30A 2ISFA 1O68A 4ZO7A 1JDEA 5AYZA 2YXGA 3GW0A 3S9IA 2BVYA 3TR2A 4QDMA 3D47A 2OMAA 4NJIA 5CQ1A 4PTNA 5AC7A 3N14A 4O10A 1VYRA 4MYAA 4TOQA 2CLLA 2OEJA 3N6JA 3WMLA 3ITCA 1RCOB 1NIUA 4J9JA 3UJEA 1E55A 4QS5A 4H6EA 2XIIA 1WUFA 3WIJA 4E0CA 3LENA 1GZGA 4NI3A 1HGYA 3BCJA 2O7QA 4P8WA 1CGYA 5CJ5A 2Z00A 3TJIA 3UPMA 3DGBA 3FVDA 4HJWA 5DY2A 2G41A 3I7RA 1RLDA 4KQNA 1VB9A 5JBDA 2JALA 4J27A 2CZDA 3AROA 3G8EA 3MCNA 3A24A 1BTMA 2FB3A 2FLIA 2V38A 2Y4SA 4KCUA 4K8EA 1GQKA 1M7JA 3C2OA 3R5EA 2VC9A 1O1ZA 3MB9A 4IZGA 1T96A 2DU2A 4MDPA 3UQNA 4QJ1A 3N34A 3FK4A 5CSSA 4AAJA 2YBVA 3B3DA 3UA4A 1V02A 3TAOA 1R8LA 2Z1VA 1DP0A 1KWGA 3STEA 4M5PA 2QPUA 4DZ5A 3A6OA 1XYFA 2IKIA 4U33A 1J9YA 4Q4OA 1UCWA 2VR5A 1R9YA 4Z1CA 1QI4A 1KA9F 5BNKA 2J4GA 2WPGA 4DO5A 3OGSA 1PAMA 3CPUA 3H7UA 1RJQA 1V6TA 5C9UA 2ZRYA 3L68A 5FF3A 2BY0A