4JTAA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 121
structure length 326
sequence length 326
chains with identical sequence P
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtaA00
2ISFA 4PRRA 1MRQA 4IJCA 3COTA 2BGQA 3V0UA 3O0KA 3BCJA 2ACRA 2PEVA 3KRBA 1LWIA 1S1PA 2HV5A 3G5EA 1US0A 1Z9AA 3U2CA 1RALA 1EL3A 2PFHA 3UYIA 3MC5A 4LB4A 2FGBA 5JH2A 2PDBA 2WZTA 4GIEA 3V0SA 1M9HA 2CLPA 1T41A 3B3DA 1AZ2A 3UP8A 3ERPA 4HBKA 3UFYA 3LQLA 2PDLA 1FRBA 4XO6A 3M64A 4XVDA 3DOPA 4PUWA 2PDIA 2IKGA 2IS7A 4RPQA 2C91A 1ADSA 5HNTA 4ASTA 3H7RA 3C3UA 3S3GA 1S2AA 1ZSXA 2AGTA 4JIHA 1A80A 4PR4A 3RX4A 2IPJA 4JQ2A 3Q65A 5AZ1A 3ONCA 4IGSA 4IJRA 4Q3MA 3LBOA 4WDWA 4GA8A 3H7UA 1T40A 3UZXA 4GABA 4XK2A 4DBSA 1AFSA 2FZ8A 4G5DA 1PWMA 2F38A 4GQ0A 4QBXA 3R8GA 3LEPA 1YNPA 1YNQA 3WBYA 1XGDA 4FZIA 1Z8AA 2IPWA 3WBWA 4LAZA 2IKJA 4XZMX 4LBRA 3G1RA 1S2CA 1X98A 1GVEA 3GHSA 2FZ9A 4L1XA 3WCZA 3ONBA 3R94A 2PDCA 3LZ3A 2INEA 1YE6A 2PDYA 5LIYX 1AH3A 2BP1A 3V36A 2IKHA 3R6IA 1YE4A 2J8TA 5AZ0A 4OTKA 3LENA 2PDJA 5LIUX 4JQ4A 4YVPA 2PDNA 1HQTA 1RY0A 4WGHA 2FZBA 1ZQ5A 2HE5A 2ACSA 5LIXX 4JIRA 4F40A 3V0TA 2HE8A 4YS1A 1Q13A 1JEZA 4Q7BA 4H7CA 3LQGA 1Z3NA 2DV0A 3M0IA 1PZ1A 2VDGA 3RX3A 3DN5A 3UZYA 4XAPA 3LZ5A 3O3RA 4I5XA 1J96A 1MI3A 3LN3A 1IEIA 3GHRA 2PDHA 1X96A 4WRHA 2PDUA 4QR6A 3EAUA 4LAUA 2I17A 2R24A 2IPGA 4DZ5A 4MHBA 2PDGA 4ICCX 5LIKX 3LNMA 4LBSA 5LIWX 3UZZA 4JQAA 1HW6A 4XZNX 1EKOA 2WZMA 1SM9A 3R58A 3CV6A 4WDXA 4FAMA 4WDUA 1IHIA 5JH1A 4JIIX 5HA7A 2PDPA 3VXGA 5HNUA 1MZRA 1Z89A 2HVOA 1Q5MA 2IPFA 2R9RA 4JTCA 4H8NA 1OG6A 1ZUAX 1XJBA 4XVEA 4YVVA 2IQ0A 2PDFA 2INZA 2I16A 3H4GA 2DUZA 4R9OA 1EF3A 3BV7A 2HEJA 2PDKA 1QRQA 1S1RA 4FALA 3EB3A 4NKCA 2F2KA 1ZGDA 4AUBA 2BGSA 4PMJA 4JTAA 4LB3A 3WG6A 4XZLX 3LUTA 1QWKA 3GUGA 4FA3A 3BURA 2FVLA 4EXBA 2ALRA 4YVXA 3CAVA 1X97A 3N6QA 4PRTA 3GHTA 3R8HA 1PZ0A 4QX4A 1PYFA 1R38A 4JQ3A 2NVDA 1UR3M 3UGRA 2PD5A 4JTQA 4JTDA 3CAQA 4DBWA 4HMNA 1AH0A 2IKIA 3QKZA 1AH4A 4WDTA 2PZNA 3GHUA 2NVCA 1RY8A 3LD5A 5M2FX 3FJNA 4JTRA 4GQGA 2PDQA 4WEVX 4ZFCA 1LQAA 4QXIA 2PDWA 3CASA 3CV7A 3WBXA 3F7JA 4PUUA 3FX4A 3P2VA 4GCAA 4GACA 2HVNA 3NTYA 2PDMA 4JQ1A 3D3FA 3V35A 3UWEA 3N2TA 2A79A 2ACUA 1AZ1A 1PWLA 3M4HA 3BUVA 4XZHA 3T42A 2PD9A 4YU1A 2ACQA 2PDXA 2PF8A 1XF0A 3UG8A 2QXWA 3EB4A 2P5NA 3R43A 2HDJA 3R7MA 2DUXA 2FZDA 3MB9A 2IQDA 3RX2A 5KETA 1K8CA 4XZIA 1VBJA 1VP5A 1EXBA 4DBUA 4XO7A 4L1WA 4EXAA 5C7HA 3UZWA 5DANA 3Q67A 3CMFA 1C9WA
chains in the Genus database with same CATH superfamily
3TOPA 4GHRA 4JTSA 1TWWA 3ABZA 3SCWA 4ZO7A 3DX5A 2GFTA 4D72A 2PPGA 4J2MA 4MZYA 3LPOA 5B7ZA 1A5SA 2O9OA 2WZIA 4ECLA 3MCOA 1CZ1A 1EL3A 4H9VA 3MHFA 4R85A 1QHZA 1EJ7L 2FJKA 2I57A 3NUKA 4E4PA 1E55A 3U6WA 1E3XA 5FJPA 4ATWA 2X1IA 2DZSA 5C5YA 2BDQA 2OX4A 3LHZA 4NZJA 4P2VA 3CEUA 3A21A 1KV5A 4C6NA 1CXIA 4MSSA 1AZ2A 2WZHA 5BROA 1PX4A 4P7NA 3W07A 3CIWA 4GZ7A 3W7DA 4G9PA 4IFRA 4IF2A 5A2BA 3CU2A 2HXTA 3B0XA 3SCOA 2X09A 4RPQA 2QDHA 1O1ZA 1TMLA 3AALA 2J7CA 3GK0A 3WQ6A 1UMYA 3ZJ6A 4ZQRA 2WC7A 3CO8A 2YLLA 3PWAA 3DGBA 1P4CA 4H01A 4YCPA 2B7QA 1XIMA 1TRIA 1SW3A 2NX9A 2CHNA 2CZDA 3RX4A 2Z1KA 4ILSA 3GVWA 1FY6A 5AZ1A 4HK6A 4O1DA 5HNRA 1LT7A 5A8PA 4TVDA 3VNJA 3N12A 5BXTA 3G1FA 4WOZA 1JPKA 1M1BA 4UOZA 2O0TA 2ATMA 2H9AB 4G5DA 1TE6A 5CGQA 1PWMA 3Q4DA 4OUEA 4Q8WA 3WLSA 3GFZA 3KOYA 2VM8A 1RZMA 3LEPA 3H2CA 3NO1A 4MDPA 3HQ1A 1O5RA 1XGDA 4Q8UA 2FH8A 4JTJA 2DZBA 4IQJA 4DJFD 3AIUA 3LLFA 3S9ZA 3KEHA 3QOMA 4HP5A 1MW1A 4DB7A 3C2YA 3DI1A 3DESA 4I6KA 1NELA 1H7OA 2INEA 3TN3A 1IEVA 3V36A 2QDEA 1WPCA 3P0WA 5MF5A 1E15A 3GNRA 1LCOA 2FQIA 4I5RA 3PBGA 1Q45A 2ODOA 1R3SA 4U3AA 3URAA 3N9RA 2A21A 5A5WA 2PAJA 3TC3A 5B7YA 4H7CA 2QJJA 2AQWA 4GVFA 2X2YA 3SO7A 1XL9A 1U5JA 1TUFA 1P5BA 1OF6A 3H12A 4IJBA 1E6RA 4GJJA 1P0KA 1R6WA 3RX3A 5CC5A 2W9MA 4OHQA 1XYAA 3W1XA 2BASA 2PWHA 1YQ2A 1GHRA 3L4UA 4IP5A 3S6DA 3M7WA 1Z41A 4CCDA 4O1EA 5J8LA 1J8VA 3MQTA 3DZ1A 3CT7A 3DU0A 4KWOA 2PDGA 4ICCX 3WD2A 4CD5A 4XIMA 1O7AA 4C1KA 3MUXA 5LIWX 1PO9A 1RCXB 1KRBC 1BXBA 1TKKA 1WUFA 4L6DA 3SCPA 3GDMA 3KWXA 4MY1A 5ABEA 5IFTA 2JKAA 2V8ZA 3RXZA 4OT7A 4ML9A 4CQ9A 1XPGA 8RUCA 1PZ3A 1Q6QA 2ZWZA 1XUZA 5H6HA 4ACZB 4PL1A 5G1MA 4CVWA 3GNXA 5FAGA 5I78A 1KM3A 2FHBA 3UY8A 5A2AA 4C7DA 5EMMA 4AVOA 4KEZA 4MWAA 5PTDA 1OD8A 3R8RA 3QHNA 4CNNA 4HPHA 2G5WA 2OWWA 1R85A 1TG7A 1KWGA 4XVEA 4YVVA 4BZYA 3KRZA 4DPQA 3WX7A 1W1YA 1KM2A 4U2ZA 2YB4A 3SFKA 3KS5A 4GCXA 3BAWA 2UY3A 3O06A 3WG6A 2DSKA 1UBSA 3GG7A 3LHUA 5T9CE 4MDOA 4M6QA 1ZP3A 3LM3A 3W29A 4H4IA 1WUEA 4RLIA 2F9RA 1YPIA 1MQRA 2YXXA 1A5UA 4PTVA 3ANUA 1HXJA 3IARA 1H41A 3GTHA 3OOQA 1JXKA 3QC3A 3LXBA 1EXPA 1RR2A 5DBUA 1G67A 1HJXA 2C6QA 1X6NA 4EXQA 2DT1A 2E28A 2G8ZA 3NQ2A 4HU0A 2C14A 1JPIA 4G56A 3UY7A 2HBVA 4WCJA 1R30A 2DZAA 3K4DA 2GUYA 3VE7A 5CGMA 4KEVA 2LLEA 3UJSA 3TZFA 2AMXA 4DO7A 1K9EA 3CQKA 3L4XA 3V7PA 3S83A 1MNSA 1TB3A 4QCEA 4A22A 2JGYA 3SB0A 3PBWA 2P1FA 4A8NA 3F7JA 4UFJA 3FX4A 4PUEA 1KB3A 1F5ZA 1MUWA 4C6EA 3WDJA 1H50A 2V3FA 4LYQA 1J2WA 3LERA 3W2NA 3LSBA 3UWEA 5KTLA 2PTZA 2QAFA 3NPWA 3A6OA 1A53A 1B4KA 1GUVA 3OQEA 3UT0A 4Q7IA 3WBAA 4JD4A 2R91A 3BJSA 3VABA 3B9NA 1Z7AA 3CTLA 3THUA 3VNDA 2TODA 2VZUA 1Q7MA 4LVGA 2QEZA 2Z26A 2HDJA 3CT2A 2OCZA 1S5TA 1K70A 3AWOA 2DPEA 5GJMA 1K8CA 4X22A 4NJKA 2NWSA 1FFQA 5D2TA 1HFBA 3C2OA 4RE2A 3TSMA 1S46A 2ZXQA 2OYMA 3S47A 5FACA 4C5YA 3A3HA 3Q45A 4PCFA 3TXZA 3SY5A 2OGJA 1DXIA 1RCOB 4C91A 4IMGA 2XVKA 3U2CA 1G5AA 4AZ7A 2FZNA 4LUIA 4CCCA 1WP6A 4V33A 1GJWA 1TV2A 3FVDA 1VJSA 4XIAA 3GXMA 3P62A 4KFNA 4EANA 5XINA 1VEMA 2WVVB 4MZ8A 3QGAC 2V2DA 1AG1O 3K30A 3IGSA 1UD8A 3MSDA 4DWSA 2D0HA 3GU1A 4D6EA 3II1A 3UFYA 3BK0A 3IACA 5HWNA 4Z2IA 4J3SA 2A85A 4AWTA 3QY6A 3BMXA 3STEA 3OG3A 3DC8A 3BSMA 2XSXA 4HNOA 3PR2A 2DSVA 1ITCA 4RZBA 4DO5A 4K7YA 4RDZA 1A5KC 2VC7A 3ITTA 1YBQA 1DVJA 4JTLA 5EMYA 5BWFA 3QW4B 1F74A 3CGTA 5F2MA 4ZA0A 4NUWA 4AXKA 1D8WA 2J79A 4QQUA 1V77A 4LBUA 5U4NA 1J0HA 4WKHA 2GGIA 1C9DA 4ZODA 3OHMB 1MSSA 3W7OA 4EAMA 3GIYA 1A4MA 3VFCA 1GZ1A 3U7VA 3IS4A 4O1BA 4EIVA 3GVQA 3O1NA 5LXEA 1TCMA 1OX4A 2AL2A 2XDFA 3DFSA 3DKLA 3H22A 4GNVA 1XIGA 3SM0A 1VBUA 3BWWA 1FWDC 2BOEX 3B9AA 3ZSSA 3U7BA 1E4NA 3O9NA 2EBNA 3GHSA 3GD6A 1UBPC 4DJDD 1WZAA 1EOMA 2QR6A 3SR7A 1C7SA 1K3UA 3ZMRA 1YE6A 3WEOA 3TFXA 2J7BA 1DXEA 3W7KA 1A5LC 5K7JA 4OTKA 2WHLA 3OHIA 4AAJA 3NFUA 3EOLA 1Q8AA 5HATA 3GSMA 4OZOA 3WJSA 1UQYA 1JVNA 2XVPA 1V7AA 1NM9A 1IIHA 3GDLA 1SSDA 1QK0A 3TWAA 3W84A 4PEEA 1ZY9A 3WH6A 4KCVA 1XLKA 2GPTA 1QAPA 3F4WA 2ZZ6A 1XS2A 4DM1A 3SURA 2XTKA 5C70A 1LRTA 3AS0A 4IPPA 1B3XA 4NQ1A 4PUMA 2E7FA 4MWAC 1J96A 1RK6A 3NQDA 4REQB 3AYVA 1VENA 4NHVA 1DQWA 3GFXA 1VQTA 1WDWA 1VFFA 4Z2HA 2C79A 3I7RA 4XTIA 3WDIA 1RPKA 5C71A 1K77A 3WNPA 2XWEA 2HBXA 3SQLA 2EPKX 4QAIA 1UWTA 3TA6A 3LCGA 1JULA 3KTSA 4Z0SA 3EXTA 3ZVHB 2FLIA 3G0XA 4JNYA 3VC6A 4PB3A 3I3BA 3SN4A 3U2ZA 5C0QA 2E67A 1CGVA 1DPMA 3DHUA 3IJ8A 5I3KA 2ZICA 2NV2A 2DY3A 1RD5A 2WKLA 3KBNA 1IGSA 4IFOA 5F7UA 1RLCL 5JH1A 4JIIX 3IVTA 3VXGA 5I09A 4DVOA 3WF1A 5I0DA 3NZRA 4AHQA 3FDKA 3GW3A 3NSMA 1OT2A 2VFDA 3MMDA 1J0JA 2J24A 4URIA 3N11A 3N2OA 4O12A 4WK9A 2CBJA 4M81A 4CU7A 2VI0A 4W93A 4WVXA 3B8SA 2UY2A 3TH6A 1F3WA 4Z1YA 3TU9A 2OO0A 3UZJA 1KGWA 1W5QA 1OCQA 3NXLA 3TLLA 3LUTA 2WYSA 3FXGA 1CX9A 2O4MA 1P0DA 1TV7A 3ITXA 2I56A 4HTYA 3A24A 1JFHA 3KS6A 4AG0A 2Z2UA 2OGYA 3CHCA 2Y5JA 5A6LA 1K6AA 3TR9A 2O4QA 2PURA 2VGFA 2VD9A 4HMNA 4IUOA 4CD6A 3LRKA 7PTDA 1NAL1 4L61A 3VIJA 4HOZA 4FK9A 3WNNA 4MG4A 4HYRA 2BWGA 1XISA 3GU2A 5GNZA 3C2VA 5LGZA 3OLGA 5BYWA 1XDLA 1VC4A 4BI5A 1ESWA 4CEXC 1KW1A 3T8LA 5FF0A 1WZMA 1XQKA 1KCXA 3PNZA 1XBYA 3XISA 3K4WA 3NDYA 4UB9A 3O07A 3LBMA 1UH2A 4QIUA 3RPDA 4GI6A 4UCFA 3AXXA 1UHVA 3UG4A 1PX3A 4O19A 3S5SA 4YYFA 1L9WA 1IZCA 1UD3A 1R3TA 4C1NB 1U22A 3LV5A 3UVIA 2WNQA 5HANA 3OVPA 1TTPA 4RX0A 1H61A 4XD4A 3EX2A 3I6RA 4FS9A 1SGJA 5CZSA 3W4RA 1HGYA 1KTNA 4O0KA 3MTWA 4WQ6A 1W37A 3UF9A 5C2GA 1SR9A 1XIFA 2ZUNA 4H8UA 3NQ6A 4FPSA 1SSGA 2E77A 4AZBA 4PMXA 1YDVA 3EDDA 4UQBA 1SJBA 4UTIA 3TNBA 2E68A 1V93A 5I24A 1ISZA 1H4PA 3L68A 3L23A 1P1XA 1VFUA 4BEQA 3JS3A 2XISA 3CQIA 1Z9AA 4MY8A 4D6CA 5G4WA 3B0UX 3HJEA 3U3HA 2DIJA 4D6DA 1XIBA 1H7XA 3ZZ1A 4IHCA 3I6TA 4GXWA 2YFNA 3QFWA 1TV5A 1P48A 2BVWA 1UP3A 5EMLA 4MJZA 4CD4A 3O05A 3MUCA 3EPOA 1DYSA 5E1QA 4FNUA 3G3DA 4HMCA 2XFYA 1F6KA 4PTNA 3HPFA 4LUYA 2YBTA 2QUVA 4KRUA 2HNEA 1Q66A 4N9BA 3WLOA 1GOQA 3SCQA 3VINA 2Z4GA 1OM0A 2WHKA 3I6EA 1E0VA 4UR8A 4WY0B 2IKGA 4XTDA 1S3TC 2IS7A 4ZOEA 1FXQA 4S3EA 3A4XA 4DZIA 2EO7A 1ITUA 1EGZA 1M5WA 2Z6JA 1UD5A 1GW1A 3OA5A 2CZVA 3HQNA 5A69A 3WLHA 1H5VA 1THFD 1UR9A 2YOCA 2ZRZA 3R0UA 3T40A 2EG8A 4UFKA 2I9UA 1VLIA 3HB9A 2WSPA 1SW7A 4IISA 4ZFMA 4ZQCA 5HMEA 1R86A 1LLOA 2FZ8A 3RJXA 1AMYA 3PBUA 2VL4A 4HNNA 1RQHA 4LUJA 3HMCA 2PWVA 3NJ3A 4N7QA 2DZXA 4JL2A 1PIGA 5AHLA 3MUAA 5JXQA 1XQLA 1RSCA 3GH5A 3ARVA 4HHMA 2ZIDA 4D1IA 4HHHA 2FZ9A 4LS1A 2QF8A 4DIAA 5EFDA 1VFOA 2D22A 2DT2A 1LL4A 3DERA 1NEYA 1XH0A 3R25A 1BAGA 2XIOA 3KAOA 2O9RA 4AWEA 2J8TA 4OQVA 5EPDA 3GNNA 2CESA 1E1CB 2G3JA 1TWDA 2PDNA 3BXWA 1MFVA 1XLJA 3ES8A 2QJMA 3SGUA 1UOZA 1B30A 3ARQA 3UR8A 5AHFA 1XBXA 1XYZA 5CSYA 1QO5A 3AXHA 1U2YA 4OFCA 1V3HA 2HCVA 3VILA 2C1IA 3TX9A 1VBRA 1Y0EA 2P0IA 3UJRA 4AC7C 5KEZA 2AAAA 3ZM8A 4C5ZA 3F2BA 4XSMA 2GQ8A 7REQB 1JDDA 4DYKA 1S5WA 5GQBA 4UBPC 3OG2A 4XSLA 1CTNA 3B04A 4A8IA 3WLRA 3NG3A 4MNLA 1VGAA 3ZYZA 2PGEA 3IVUA 4LGXA 4TOQA 3P7YA 4RDWA 1UKPA 4EX4A 3WJZA 4LY4A 4DO6A 3TYBA 2D2JA 2WLYA 4JIQA 4QS5A 3CV6A 2CCRA 4TX9A 5E6ZA 3WUFA 5A6KA 6XIAA 4QCFA 2H3BA 1NIUA 2QZRA 1OQFA 2F6XA 1UWQA 3NM3A 4JTCA 1EEXA 4V27A 3B9EA 3VK5A 3MYOA 4U33A 3HZ3A 3BLEA 3BSGA 1ZJIA 5ABGA 3V5OA 4MYAA 2CWNA 1A0CA 3PZVA 3BICA 3WMSA 3CIXA 2W61A 4D8LA 1UP2A 4J28A 4ZE4A 4R3UA 5HR7A 2F2KA 1KXTA 4PMJA 2YCEA 4LB3A 4PYSA 3UWUA 5IDIA 2XM2A 1KBKA 4EXBA 1DP0A 1GGOA 3CAVA 4BS0A 3NQBA 1G7UA 1YW1A 3CZGA 4TU1A 4AY7A 1NARA 4NI8A 3PM6A 4EWJA 4M5PA 1E6QM 4OV9A 4ZQNA 1HIZA 5D33A 2NQLA 5JBDA 5A2CA 4NP7A 2EAWA 4BF5A 3MI2A 2OWCA 4CQCA 1LBLA 2ZUMA 4PMVA 3PZQA 5E70A 1PCWA 1HVXA 3VGBA 3MP4A 4D8AA 4UUIA 2JKPA 4EACA 3M43A 3LPGA 4OV4A 3BAKA 2PZNA 3O6DA 1JIBA 1A4LA 4GFSA 3QEZA 4F0LA 3A4JA 1QOXA 3UR5A 1PV8A 1I45A 1W8GA 1BF6A 3NAVA 3FJ4A 4YTTA 2V3EA 1NOFA 4E5TA 4GO9A 4HNLA 3FS2A 4P8WA 4RPPA 2VGBA 2C16A 4P61A 3PY2A 2VC9A 1BHGA 1KRAC 3I4EA 3QGKC 2PDMA 1RHCA 3VGDA 1J0KA 1FDYA 1O5QA 3AXIA 5H2ZA 2VKZG 4W9TA 3P8JA 3EDKA 4WX2A 3BUVA 5AVHA 1E0WA 3CYJA 4MADA 1ZS2A 2PF8A 2OX1A 1NWRA 1KO0A 3RPMA 2HJPA 1J6OA 1ZU8A 2V2CA 3R43A 4KS0A 3IUHA 4WJ8A 4S3JA 3RRAA 2WQDA 3R7MA 1W5OA 2PWEA 3ZOAA 1BWLA 1J5SA 1W5PA 4AD4A 5KETA 3UETA 1ECEA 1LF1A 1CT5A 2HPIA 4XZIA 2J9XA 1CGTA 3FOKA 3WQWA 3QVQA 1R3VA 4GOAA 2NVAA 5E09A 4JCLA 4Z1CA 2GJXB 1C9WA 1YTKA 1Y5XA 2W27A 3HG5A 1K02A 2VJXA 3S6TA 3TV8A 5EU9A 1JDAA 5CLTA 1LWIA 3NO3A 2GK1B 3TN5A 2BY0A 1FWHC 2VURA 3VIMA 4C6QA 1TPWA 4Z08A 2BXVA 3SIMA 3GC5A 1S2TA 5JH2A 3KL5A 2ZX8A 4A35A 4Z2KA 3BSHA 1I4NA 4UMCA 3CHVA 3I4KA 1R3YA 4V2XA 4EAYA 3UP8A 3ERPA 5EB8A 3TFCA 1LL6A 3EX6A 1EA9C 2OEKA 3SSZA 1KFWA 3SUSA 3W88A 3IJDA 4WD0A 4RW5A 3OGSA 3V16A 4ACZA 1TMHA 1V08A 1HP4A 1GVIA 4RUBA 2FDMA 3G18A 1DL3A 3W6YA 1EP1A 4AFYA 3RHGA 2R1KA 1VF8A 3VA8A 7ENLA 1CENA 2NSOA 4LRTA 4DXVA 4DJED 3C3UA 4UWMA 2D2OA 3H70A 3PUOA 1W1ZA 1XLGA 5HBFA 1GZGA 4JTHA 3TOYA 3BARA 4QDPA 2A4AA 1FWSA 4CNTA 1B31A 4P8UA 1KFJA 4ICMA 5K4XA 1BRLA 5LZLA 3JR2A 2GYIA 3CZLA 3OZOA 1B3WA 2XU2A 1AFSA 3KZPA 2FTWA 5H91A 4GQ0A 1FHDA 3MKVA 2PU0A 4RNHA 4HA3A 1KD0A 3OBEA 3VIGA 4C60A 2TYSA 1BYBA 3ARPA 5T9BG 3WBWA 4N42A 2R82A 3V18A 4MB1A 3VKCA 4DUVA 1IT7A 2E9BA 1XYLA 1UQZA 3LZ3A 4PCNA 4ATDA 3NQGA 1DWGM 3FA3A 1J4EA 2R1MA 4J3TA 3V4BA 2YL6A 3CV2A 4FLRA 4HZ8A 1HJVA 4FX7A 3D6NA 2GGJA 4M24A 3PTMA 3K4AA 5EMJA 1JCJA 3A47A 1MXDA 2EG6A 5LIUX 3RO6A 4UQEA 1ZQ5A 1LUCB 4JIRA 4F40A 4J3VA 4XBSA 2XVNA 2ZC1A 4MY9A 1P7TB 4YS1A 2WM1A 2O56A 2GGHA 4N4QA 4GY7A 2X0HA 2CEQA 4UTMA 5EGRA 3L0GA 4AX6A 2VEIA 1KKOA 4NRRA 4A4AA 1F6YA 4S38A 2A3LA 4XAPA 1ZCCA 4Z0JA 3HG4A 3DHFA 4XUGA 1AD1A 2VGGA 4L4OA 3ARXA 1XUUA 4L4PA 1JZ4A 3GE7A 1ZALA 3FK4A 3M16A 2PUZA 4AZCB 4R7JA 1X96A 4RCXA 1EJTC 3U5UA 1GG0A 3GYCA 3WL0A 2IPGA 1IT0A 5FEWA 1TWIA 1V0LA 1HTIA 3POCA 4TTGA 3UZZA 1UIOA 1J11A 3ARRA 3NQCA 4R7WA 4MB4A 3QKEA 2NV9A 3AMGA 5F4XA 4S3CA 1EYWA 4BQ3A 2O55A 3DFYA 5JU6A 1E3ZA 4AD1A 5CBJA 3OB8A 4HGXA 4LTSA 1OK4A 4BJHA 4MMWA 4W5UA 3ECQA 2Z1WA 3KCLA 3TJ4A 3F4CA 4M29A 4E3TA 4L9YA 3VFLA 4IMFA 1AD4A 1DORA 4JFTA 2WC4A 2YDSA 1J18A 3M0VA 6REQB 3DC0A 3GIPA 1CGXA 1TX0A 3E0FA 4IQDA 5HQEA 2OYLA 4R9OA 4MAVA 4GD0A 2PWDA 1IE7C 3VYLA 3KW3A 3UU0A 4KF1A 4F66A 5CQ1A 1QI5A 2GJRA 3W2UA 1O68A 1A0EA 1BTCA 1B5TA 1TWSA 3CPGA 4WR3A 3OODA 1EJWC 1NDWA 3EYPA 1PBGA 2J62A 2QCFA 1VD6A 1LLZA 4KEMA 4O8RA 1WOAA 4NILA 2Z2AA 5DELA 3GH4A 3WDHA 4ZZ9A 1W9XA 3CQJA 1G7VA 1LG1A 3P5YA 4DBWA 1U83A 2R1PA 4B2DA 3U0HA 5BOOA 1JXJA 2NT1A 4PMDA 4CCZA 4JOMA 4LANA 2ZUSA 4S1FA 5CPTA 3DFNA 1LWHA 4PCPA 3WLJA 1KGXA 3TCEA 3TN6A 2Y24A 4GX8A 5J5DA 2REQB 2H8ZA 1X6UA 3STPA 7TIMA 3IGHX 4YNGA 1UZDA 1SW0A 4DAFA 2V5BA 3M47A 3QOKA 1Q2RA 3G8RA 2ZRVA 1DQXA 4ZOAA 1J2BA 3S0CA 2W4XA 2BXYA 4RKAA 5BNKA 4H83A 3HGRA 3BJTA 3PUGA 4DM2A 4GC4A 1HP5A 4W7WA 2DU2A 1SR0A 1ONXA 2V5JA 1MUMA 2F6UA 4HHLA 3C6CA 3W70A 5D30A 4KESA 3W85A 3KL3A 3UPBA 2NUYA 4XD3A 4LCRA 2FVMA 3V1HA 5CPOA 3E0IA 3N1AA 4GZJA 3TAKA 3BOXA 2Q6ZA 3SECA 3APYA 3LV6A 2GQ3A 5C7HA 3TJXA 1SFJA 4EWND 4O54A 1MRQA 1GOKA 4J2PA 4J3WA 3QY8A 2ZXBA 2WMGA 4MTVA 4I9JA 3SZ8A 4H9XA 4AZGA 2YW4A 1K4GA 4NZ3A 4REQA 2QPXA 2XIQA 4W7VA 4NX5A 4GYJA 4LALA 4INFA 3TW9A 4G1KA 3U4FA 2Q8ZA 1BD0A 4QM1A 1RALA 1JCMP 2GZXA 1OF8A 2QGYA 3KVKA 3F2CA 3EKGA 1CW2A 1VH7A 1UJPA 3USZA 4XKYB 1PE1A 1GCYA 2WOQA 4X2RA 2ZQ0A 1PKYA 4W8AA 3V0SA 3TIMA 4F0KA 3CZ8A 3EKZA 4Y6GA 1SZFA 4Y2WA 4XB3A 5MKGA 3LTSA 4OECA 1GVFA 1L6YA 1LJYA 3N2MA 5BXRA 4Z1AA 3GR8A 1SJAA 3R2GA 4EK7A 1OEPA 3CL6A 4MYXA 1W1VA 5JBEA 1E0TA 1WA3A 4MPQA 4HU8A 3OVQA 4IPNB 3STFA 3PPFA 4KETA 1ADSA 4CD8A 5CCZA 4AZIA 2XN1A 2V5LA 1BSLA 2B31A 4A21A 1XGZA 1D3HA 4GG9A 3SGZA 2OJPA 1BG9A 3IV3A 1H0GA 2HQAA 3B9OA 3T0CA 2I5GA 2IPJA 3UXLA 4AIEA 4ATLA 4PMYA 5LGXA 3QY7A 3TTYA 5FSEC 3RM4A 1RD6A 1I1XA 1QWGA 3WY1A 2PE4A 2FFCA 3T1GA 2X0SA 4XD5A 4MJ2A 1ZRQA 4ZOBA 1G01A 3T4WA 4L6OA 2WWDA 3O16A 3WNOA 1WZKA 3WF2A 2PSNA 4YIWA 4GYPA 1QT1A 4KH2A 4LAZA 4S3KA 3W7HA 4GBUA 4XZMX 4H9YA 3ZQ9A 4LX4A 3WF0A 1QHPA 1I2QA 3GM8A 3K1DA 8A3HA 4DXKA 5A6BD 3VI2A 5HMSA 1UR4A 4V28A 4OKDA 1AW5A 2BFGA 2ZTKA 4ZQMA 4CVUA 4LS2A 1SZNA 2JE8A 3G0SA 4PBFA 2POTA 4ZQOA 4MKVA 3VUSA 1K8YA 1LL7A 3LU2A 4E4FA 3L7RA 5XIMA 1KM1A 3BOLA 5J04A 2FZBA 5FESA 1YLVA 2NWRA 1TTQA 1DBTA 4PFHA 1JNEA 2P3EA 1JEZA 4AHOA 1TZZA 3NDZA 2BTMA 4RZ4A 1XYMA 3IV8A 4Q33A 2ZRXA 4AD2A 1LG2A 4JHOA 3NZGA 3MO4A 1UWRA 4J3XA 2Y6ZA 4HA0A 2EPOA 2XH4A 1E70M 2OT1A 5CPLA 2JEQA 3KL0A 2Z1SA 1GQKA 1ZP4A 5AC6A 3U48A 4D6HA 3F1QA 1N82A 1NF0A 1VFMA 4OBTA 3SCTA 3UWWA 2NSXA 4O16A 4QLLA 3LNMA 2ZE3A 5HNNA 3T0TA 4KKXA 3HPAA 3RAOA 4K39A 1NFBA 5IOBA 1VEOA 3V5FA 4M6UA 4JYDA 1BFNA 1RCQA 2V63A 2PGWA 2VX6A 4WDUA 2DUAA 4UTFA 1RP9A 2KX9A 1MO0A 1CXKA 2VFEA 4Z2LA 2B81A 5A6JA 4BI7A 1WDDA 2PDPA 2Z25A 4IM4A 2CHOA 5HNUA 3CO4A 3QV9A 1UWIA 4H6EA 4E38A 3S2NA 1PZ2A 2FGLA 2JF7A 3VMPA 4H8NA 3EWYA 2YXGA 4N6FA 1BGGA 2XIMA 2ON3A 1EPVA 3IAQA 3L65A 2DUZA 3OA3A 3QV6A 5FEXA 3WYZA 2GWGA 2XH0A 5D4YA 4C6PA 4I7VA 3CXOA 3OTRA 4NKCA 5DF0A 4MLRA 2VEPA 1HL2A 3L2MA 4YPJA 4HVXA 2G3MA 1EC7A 4L6HA 3UWYA 2QDGA 3VOJA 3CLWA 1EJVC 4WY0A 2B0MA 3VAVA 3E0WA 4YN5A 4DPPA 4FXSA 3VIKA 4AYSA 1Q6EA 3C2FA 4N6EA 2J7DA 2DZTA 4W4QA 3ORWA 3W7LA 1ZBCA 3PBYA 4B15A 3JZUA 4GLEA 4KCUA 5DX7A 3FIGA 1V02E 3LY0A 2NQ9A 1FTXA 2WM0A 1V3KA 3GRIA 4JXCA 1EJUC 2D73A 3CMGA 2FJUB 5I3DA 1NVMA 5DCEA 3S42A 1JYWA 4OUIA 5FCZA 4PODA 3KBVA 5CGTA 7XIMA 2BHUA 3PJUA 1AK5A 2QCNA 1O5KA 1VJZA 3PULA 5AB3A 2E5DA 1QOPA 4P7OA 1FX6A 4ZMGA 3L4ZA 2I5IA 3GTNA 4JX5A 4H2HA 4RE3A 3ALFA 4W89A 3TSDA 3PB0A 1POJA 4LUTB 2DVTA 3VU2A 1GVYA 2AKZA 3PVFA 4FXRA 1FKWA 1ICPA 1ZAIA 2YKKA 4LUSA 4XZHA 3G77A 4XISA 3PAOA 4B3LA 1AQHA 1E1CA 3AZTA 1X38A 2DP3A 2RJGA 3IJLA 4LWWA 4NXKA 3RRXA 1WKYA 4IX0A 1RXOB 5D05A 3S6OA 3A12A 3QGVA 3PWGA 4PEKA 5IHRA 3MMUA 4H8VA 4LYRA 1X8FA 3C2RA 3QR0A 4DZAA 3AMKA 3RX2A 3N25A 3PANA 1S2UA 4Y7EA 1JRBA 2YYUA 3CAWA 1D3GA 1LDCA 1VP5A 1EXBA 3KUMA 5LA1A 2FGZA 3IJ7A 4DNMA 3AZSA 2FTYA 1AW2A 3GXIA 3PZGA 1XCWA 4OE7A 5KITA 3TSBA 3O0KA 3ZJ7A 1RA5A 3AC0A 2GVJA 1S1PA 2YR1A 4Z1DA 1US0A 2OPJA 3ITYA 1OX6A 1I1WA 7REQA 3W74A 1KQZA 2FKPA 3KLLA 4AMAA 2UV8G 3AHZA 1VYRA 4CEUC 1F61A 6TAAA 1EDGA 4UQAA 2A3CA 3EOEA 5D03A 2PZ0A 4I90A 3TYEA 4J1OA 4Q8MA 4JAWA 1X1NA 1UPMB 3WENA 3G0UA 3LLXA 3VPLA 1C93A 4D6JA 4GNKB 2E6YA 4DUOA 1IWAA 1F3TA 3BLIA 4GYPC 1FWRA 4US5A 3WDPP 1OINA 3UCDA 4UC5A 4LYPA 3EX3A 1QPNA 1K6WA 4IPJA 4BCEA 2VNCA 1AODA 1KLZA 1WKFA 1E73M 3AJ7A 1MMFA 3CHFA 4POCA 1FWAC 3M0ZA 5K9DA 1NH6A 3PTQA 4UQCA 1VB9A 3E2RA 2DH3A 2WMKA 3VDHA 2XGIA 3MV01 4CQBA 1EDQA 1WNOA 4S3FA 4IGSA 4LC8A 2CETA 3WLTA 1Z32X 1QW9A 2C8NA 3LBOA 3N2BA 1WXZA 1K9FA 1XYCA 3W7NA 4XK2A 4FLSA 1H1NA 4IMCA 1GTHA 3DKJA 4LVDA 1EFZA 4HKPA 5TBOA 4GRSA 3FAWA 1YNQA 4A3RA 5I7GA 3CQ0A 3A64A 3KOWA 5KZDA 4M0XA 4CQAA 2IKJA 2W91A 4RE4A 1YBQB 1P0EA 3M5YA 1GVEA 2VQTA 3JW7A 2QJHA 4FIQA 3NVDA 3UGVA 3LYEA 3O15A 3E5BA 4RDVA 3SUTA 1IEQA 4MM1A 3VCNA 3OIHA 4AF0A 2ZUWA 4HN8A 4QNWA 4ERGA 1H60A 1EJSC 1R3QA 3R6IA 3BCFA 4TXEA 2Z2BA 1X1ZA 4FR6A 1R8LA 1J10A 2EKGA 1RY0A 4GMEA 4F4RA 1CPUA 5LIXX 1YRRA 1OX4B 1ISXA 1W1TA 2EJAA 3RPTA 3WKZA 2WSKA 3LQGA 2E4TA 1PS9A 3BLDA 1OC5A 4HN4A 2HS6A 4W85A 3PPGA 2DV0A 4MOZA 1L2QA 3CPRA 5M17A 4B3KA 4M6PA 4G2DA 3MCMA 1IEXA 4IX2A 3A5FA 5TNVA 4UFHA 1D9EA 1WZLA 4WSJA 1XR2A 2CZFA 3VOHA 2Z7GA 7A3HA 2XVGA 5HAOA 4YL2A 2Q09A 1HUVA 1P0NA 4GO8A 2Y61A 1M3UA 2IMRA 5ENLA 1E5NA 2I17A 1FHVA 2ZRYA 3G1SA 1ODUA 1E0XA 3HPXA 4BWLA 3WF3A 4HK5A 3C0SA 1JI2A 4R27A 2D23A 3ZT7A 2GSEA 1E5JA 3NOYA 1F4HA 1XKJA 4UCGA 1FWWA 3LXAA 1KBBA 2JIWA 3IIVA 3L2LA 1FWBC 5G2WA 3QMRA 3SCRA 1L6GA 4EOUA 3CWHA 8XIAA 1JPDX 1F3XA 2GK1A 1G1YA 1MZRA 3KBSA 4HNCA 3AMDA 3FXYA 5D09A 2ZUTA 3W1UA 4AZ6A 3MANA 1FDZA 4F0SA 1VZWA 6A3HA 4D71A 1GOIA 1W1PA 2WJZA 2HPMA 3ABSA 2INZA 2I16A 3S9YA 2XFRA 2A2IA 2V3DA 3SSJA 4TQTA 5D37A 3M41A 3PNUA 2J74A 3JVAA 2WMFA 1T0OA 5K3VA 1SJCA 1PIIA 3QZ6A 4PN2A 1JI1A 1GOMA 3CM4A 1XLCA 3L4YA 1QXLA 2Z28A 3FSTA 4O4WA 2FTPA 2QVHA 3BGJA 4XAYA 1S38A 2J88A 4AIUA 1E43A 1BKHA 5CPMA 1R3RA 4Y8EA 1UWAA 1AUSL 3N6QA 2W5FA 2PLKA 3UD6A 4V1XA 1Q4NX 2WNWA 1A5CA 3OLEA 2ZZ3A 2GVEA 3VC5A 1R38A 3BO9A 3IVSA 4JTQA 3RNDA 4PMRA 4Z42C 3UR7A 1XP3A 3IJIA 1J6PA 4CU8A 4QJ5B 1XINA 3NQMA 3QKZA 5HMDA 1XC4A 1AMKA 3MZNA 1QUMA 1Y5WA 1KBJA 4HOWA 2ZXDA 2OWXA 2XG9A 4MWAD 1SYTA 3GU9A 3ID7A 1IZJA 1OFEA 1V3JA 4JTRA 4KMQA 3AS1A 1MXSA 4IMDA 5A8MA 4GVHA 1S5MA 1VYSX 4W8LA 5I03A 5M5DA 1KFBA 1GZJA 3RK8A 3GNPA 4KWWA 4GACA 2X8RA 3GTFA 1L0PA 3NPVA 3USBA 2JQXA 2QDDA 3GH7A 3AICA 2UY5A 1N55A 2CNCA 4EPDC 5HPCA 2ZVIA 3BAIA 3KTXA 3W53A 3QQ1A 1JPHA 1B9ZA 4C90A 4GQBA 1UOKA 1PL9A 4HQVA 2BY3A 3EB4A 1CI1A 4F0MA 3QFEA 3AYTA 2VP8A 4H9MA 1GYNA 1RV8A 3SCUA 3T2QA 3CZKA 1A3HA 1UH3A 3GTXA 3KM8A 1E6PA 3WD1A 1T96A 1E51A 2Y7FA 3UJEA 2EPLX 3RF9A 3MO7A 4O1CA 4A2SA 4A29A 2VWSA 3EWCA 3FSUA 5A8QA 3T2PA 5ECUA 1ZZMA 1BEUA 1IXPA 1PPIA 3ZFHA 5CZ0A 3FKRA 4R5EA 4RZ5A 1E1FA 3PBVA 2GDQA 4O14A 4JY8A 4PH6A 1T41A 4RZ6A 4PE8A 1RBAA 3U9IA 4DELA 3WQOA 1ISVA 3GQYA 2HTMA 3BC9A 1O5XA 3FHQA 3DBPA 4S3BA 4JS3A 4L80A 3D0CA 3TCSA 2SFPA 1TV8A 3QQWA 3PSWA 2FPVA 4I7WA 4O53A 1AVAA 1TVPA 3FY1A 3M5XA 2OLSA 1GWJA 3W27A 3WJXA 3U5YA 5A6SA 1ADDA 3QYSA 1MUCA 5HNTA 3DG3A 3GYEA 2RKXA 4OJYA 5I77A 2NV1A 4Q6XA 3UW6A 3TDFA 1R7AA 2A3BA 5CJNA 2VEMA 4QJ1A 2VQUA 3WK2A 2PTDA 5LNUA 2VX4A 2NW0A 2A7PA 1MFUA 1VBHA 2E8YA 3TAOA 2YBVA 2AOSA 4E2DA 2KAUC 3MMWA 3O7UA 4NXSA 5EL1A 4OBRA 3OPSA 3NIYA 5HWJA 2A5HA 3FA4A 4B9YA 5D2WA 1G0CA 1XLAA 4J7RA 3MI3A 3ANYA 4LH8A 1LOLA 4TVUA 3TW6A 3PFRA 1M41A 2NX1A 3TKFA 4DJDC 4IFKB 4DWSD 4RNFA 1MZHA 1Z8AA 3KWSA 4OGZA 2Q02A 2VC6A 1H62A 3N34A 4X2PA 5F2GA 4RL3A 4TV5A 1OYBA 5D8ZA 3GW0A 4WGXA 2J25A 1FWNA 2PA6A 3BH4A 3TJLA 4E2BA 1PHQA 1CLKA 2CLHA 1ZBVA 2OR2A 5JVLA 3AS3A 1QO2A 1ME9A 4IQEA 3GXNA 1V0NA 1EO7A 2FB3A 2V0TA 3GXPA 3FV9A 3TYCA 2NQJA 5AY7A 2WCAA 3AI0A 4MLJA 4P8VA 4Q7BA 3VCCA 4IG2A 2ZZ5A 4KGJA 1NWSA 3SRKA 2YXOA 3EEGA 4X3ZA 4ES4A 2ICSA 4K8GA 1K1DA 4GNJA 4WIWA 1YYAA 1I75A 3EWZA 4ORMA 4AWSA 3WQ4A 2QT3A 3LN3A 3THQA 2TSYA 3B4YA 5I3JA 4D9PA 1JDFA 2I14A 2PDUA 3N9KA 3MUY1 3UR2A 1FH9A 3WSUA 3VMOA 3VE9A 1TZ9A 3TVAA 1W8SA 2VDHA 1TSIA 4G1NA 2ZUUA 1D7KA 4O0ZA 3NPXA 1KM0A 1TPC1 3SCVA 1G4EA 1DJHA 1O94A 3RMEA 3LCXA 1VS1A 3WL1A 5HA7A 3LGGA 1HX0A 2ISWA 3AIVA 1QJWA 3C3NA 3AHXA 3UWZA 4JN6A 2UBPC 4MZ1A 3BAYA 1VIZA 1IT8A 1IGWA 3VGHA 4H04A 3PTDA 4ALDA 5DCBA 1U30A 3TQ0A 3TUUA 3HJZA 2EGZA 3FYPA 5AHIA 3A23A 2JF6A 1VCVA 1A5MC 3E38A 1XH2A 3W6LA 1VFLA 1RQEA 3W7CA 2GOKA 2Z24A 1A5NC 4XKMA 3LTYA 1M04A 2DQWA 1ZPTA 4DN1A 4FA3A 3FGCA 3N2XA 1JUKA 3M7SA 2VFFA 1OCNA 2VC5A 4FX6M 3N15A 3C0QA 4FNTA 3WLNA 3MKCA 1DOSA 3DHDA 1UZHA 5LA0A 3E9AA 4ZR8A 1MYRA 3S5OA 3V1PA 1R2TA 3J7HA 3NVTA 1FA2A 2NUWA 2DEPA 4AYGA 1K7EA 4WUIA 3ZJ8A 1DE5A 5E9AA 3PZIA 3WH5A 2PODA 1V3IA 1KFKA 1VR6A 2X7VA 4WDTA 3LXCA 3FLUA 2BB0A 2FMOA 2W67A 2J77A 3PB2A 1JCYA 1JYNA 1BTMA 1C90A 1DIOA 5FEPA 1CWYA 2XFFA 4HHPA 1C8VA 4LVAA 1GVQA 2WPBA 4Q8TA 2AQVA 1W3NA 1V3MA 4ORIA 4QLKA 3ABRA 2J47A 2ZOXA 4PZVA 4Q8QA 2QJIA 3CH9A 1Z6KA 2P8BA 4QG9A 1B0IA 1REQB 2I1OA 3G22A 3MKKA 4M56A 1FWIC 4U5IA 4DXXA 1MVYA 2VR4A 1N8WA 4IP4A 3KHDA 2QULA 4RV8A 4V1YA 3VNMA 4XWUA 3VMNA 3VKKA 1UKTA 1ZBWA 5CC3A 3UWQA 2PDXA 3ZR5A 1XF0A 2E5BA 5CXPA 4ACYA 2J8FA 2D20A 2VVSA 3W2LA 4L5ZA 4PGLA 4DEFA 3LDVA 2GDVA 3BMVA 4WJEA 1XYBA 1D2KA 1W9VA 4JHMA 2X0YA 2BVDA 3N18A 4GX9A 1UROA 1H1ZA 3V0UA 4PBGA 2YYTA 2AQOA 1EH9A 4H1ZA 2VYOA 1TA3A 4DLFA 2V5CA 3E1F1 5FEZA 3UYIA 1M01A 2FGBA 4NSBA 4C7FA 4FOKA 2VVNA 3T55A 5BRBA 1R46A 3THDA 1QNOA 4UFLA 3S4TA 2PLCA 3NWRA 1EZWA 4QNEA 1TE1A 3T4CA 3ARSA 3L66A 4E3VA 2GUUA 3PZTA 4H9UA 2QV5A 4IIDA 1QBAA 3E12A 1HGWA 1OIMA 2OVLA 3G1VA 4FNQA 1DXFA 1JPMA 1V8EA 4J3UA 2AAMA 4F48A 3I7QA 1W31A 3R13A 1LM1A 4K37A 5DCDA 1ICQA 2NXIA 4IL0A 3S1UA 2V5DA 4UNLA 4B92A 4CN6A 4M1BA 2ZWYA 5E0FA 1ICSA 3SUUA 5LYRA 1R2SA 1ISYA 4M80A 3N9SA 3S3GA 4RV3A 5A1AA 4CN1A 1DIKA 4JEQA 2PB1A 2XJ7A 1XICA 3ZWSA 4FO4A 1LRQA 1XIJA 3ONCA 3W7PA 3URQA 2EHHA 3W72A 3O2LA 3RIKA 3A9IA 1E56A 2E6AA 3N4EA 3NOEA 4MFEA 4GABA 3RR1A 3SW6A 4OU1A 3QR1A 1Z44A 3L67A 4QBXA 1TPUA 1Z42A 3R8GA 1KR1A 4U2YA 1UA7A 3CPUA 1OX5A 3NGJA 4BF7A 1S2CA 4ZL1A 3VDBA 5FL0A 3WCZA 4PTWA 4UNKA 1QNVA 1KBIA 1P6WA 3FNDA 3LGDA 1V02A 4PMZA 1VKFA 1JR1A 2R14A 2P10A 1B54A 1BRLB 1K4HA 4JKMA 1XYFA 5C2CA 5LSMA 5CG0A 4KIEA 3M5ZA 1R3WA 2YB1A 3I7SA 2VRQA 4Y9NA 4QAWA 1V6YA 4DF0A 1MDRA 1VJIA 3W37A 3SADA 4LW7A 4UR9A 3DHPA 2W3ZA 1RVKA 2EXOA 1GHSA 1H09A 1FHLA 1UG6A 3WMLA 4QJ3B 3WH8A 3PPHA 4LUTA 4ZXOA 2XUCA 3O6AA 3QR3A 4GZIA 2OEMA 3O3RA 3CUXA 1PAMA 5AC7A 1F76A 1GOXA 4E8GA 3LBCA 2QS8A 1BKSA 1MI3A 1UUQA 3SFWA 2YA0A 3WUGA 4AWUA 2OZ3A 1H63A 1W3JA 1WCGA 3WLMA 5LIKX 4IP7A 5AFDA 3P82A 4M1RA 3BW4A 4JQAA 3TEVA 3F4NA 3VNZA 1XBVA 3AMLA 4QTGA 1M03A 1YHTA 4YCOA 2VEFA 3T0BA 1UMLA 1TTJA 1GJPA 4JX6A 1J9YA 2DW6A 3HG3A 1G4SA 2A3AA 4IPIA 1TPEA 1W2PA 5HK4A 4GXMA 4B3ZA 4L56A 2F61A 1AL7A 2YCIX 3EDEA 3VIHA 1KGUA 1NU5A 3W7MA 2Y0FA 2YA1A 3WO8A 3M0HA 4JZ5A 5C55A 3LCIA 4JTUA 1EEPA 4HK7A 3K8MA 3CQHA 1S1RA 3UA3A 2CBIA 3CNYA 3GXTA 5C6MA 4DYJA 2BGSA 3WLKX 1BXNA 3N3MA 1B2YA 4PMNA 4B4HA 2HISA 1UCWA 4EF9A 4HNTA 3KVLA 3PZNA 3UG3A 3VM7A 2RFGA 1KCZA 3F4VA 3VOCA 4QJ4B 1C8YA 4PRTA 4O28A 3DFTA 3NCOA 1O60A 2WKGA 1YNYA 3SUWA 3NQVA 3SDOA 1FWGC 4JQ3A 2P0OA 4S2CA 4W84A 1NWUA 2A7RA 3VZXA 2ASHA 1M7JA 2OKTA 3ZLHA 3ZR4A 3MS8A 2B7OA 1X7IA 2CZ5A 4C6KA 2IUZA 1BQGA 3GHUA 4NYYA 3E3HA 1XRTA 3WLIA 3F03K 1OADA 5G5IA 4KCTA 4XAFA 2QPSA 4DAIA 3FEMA 4BK9A 2CLOA 2WHMA 2P88A 3UXAA 2RHGA 4PUUA 4ADTA 1XFBA 3NNTA 1XSIA 1K7XA 4LC6A 1VIWA 4N0RA 1GTEA 3D3FA 4BKNA 3VM5A 1EJRC 2CZEA 3MV11 3TROA 3OU8A 1R87A 1NDVA 1G94A 4Q22A 1KRMA 4E6MA 4K7VA 4DBDA 1B9BA 4GK8A 1KC7A 2WNZA 1DJQA 4HD5A 1EWEA 2QCLA 3NSXA 4XBKA 4UNIA 1JJKA 3UQNA 2GOUA 3CB3A 3AQUA 5C9UA 1JDEA 4Y9PA 1HO4A 2WW5A 2J4GA 1GKRA 3EWUA 1TPH1 1VBJA 2YW3A 3KCJA 3BLFA 1A3XA 2YZ5A 4S39A 4EXAA 4LNCA 3P81A 1MQPA 4UZSA 2Y8UA 1DE6A 1BVWA 2PWFA 2GDUA 4ROQA 1TREA 2XFWA 4DF2A 1EX5A 2QCEA 2HV5A 4QFUA 3G5EA 1TTIA 3RM8A 3ARWA 3OYZA 3NA8A 3MJYA 4GI8A 3A3WA 1US3A 3IIPA 1VRXA 2VX5A 4WLCA 1ENUA 4N2YA 1A49A 3W71A 3R11A 5CSUA 1F8IA 4JYFA 1XLEA 1YPXA 1UZ1A 4ZTXA 4GIEA 1ZNNA 2JBMA 4ZQPA 2RDTA 4FF5A 5F4SA 4J4KA 4X60A 4KPLA 1AW1A 1Z69A 3S2MA 2ZRUA 5L6UA 2AGKA 3SCSA 1Y65A 4JEJA 2E1DA 1OFQA 1TJ1A 2Y7GA 3ITVA 1LYXA 1QATA 2DZUA 3LOTA 3QPYA 3TYZA 3LPPA 3G1AA 4PMQA 2CBUA 1E71M 3UWVA 2WJFA 2PDIA 1SUXA 4DF1A 3TLQA 2OSXA 5IBXA 5REQA 1PEZA 3ZXWA 2VEKA 1IXNA 4J40A 3BVJA 1JQXA 5CAKA 3GZAA 3W2MA 4LFYA 4O17A 1QK2A 2ZA1A 4EE9A 1ZSXA 5DMLA 1DJIA 4EVZA 2Z27A 3T9PA 2NZLA 4HMEA 3BQ6A 5DT5A 1P6BA 3EGJA 1LQ2A 2XZ7A 3HQOA 5BOFA 5MKGB 2H6RA 1JCNA 3HU7A 4GQQA 3GBDA 2BVYA 4X0NA 2PWGA 4LNYA 2CYGA 1Q8JA 5D9MA 4DX3A 1K7FA 2DZPA 2PLMA 1LOQA 2RUSA 1KXQA 3QV7A 1I9CB 1QI2A 1RUSA 5EA9A 4I5UA 3MZ2A 3VX1A 1XRSA 2CLKA 1Q6DA 5ABHA 1FOBA 1GKQA 3RG6A 3WBYA 4WZHA 1O12A 1T5AA 3G24A 3W28A 1DTUA 2D2GA 2XZ9A 4FXJA 3F2DA 4JTEA 4C6BA 3TC7A 3TWBA 4OOZA 1JZ3A 2PDYA 4JICA 4NU7A 1RPXA 1DJYA 4W86A 2UWFA 2WQPA 5AZ0A 1OABA 4NI3A 4PMOA 4JQ4A 1HQTA 4GJ1A 3W25A 1XLHA 1QI3A 3M6YA 2YZRA 2WNNA 3HV8A 3LK6A 3PZ9A 4F8XA 4QLJA 3L4WA 3PTKA 1KTCA 3E49A 4MVAA 2E6DA 1H7PA 1WDSA 4Z17A 3L0NA 2GLKA 3CTTA 3LZ5A 3B05A 3ABQA 4I5XA 1FFRA 4W7UA 5A6BA 1ZCOA 4ZEPA 1W2VA 3UXKA 3AU6A 4AHPA 4PULA 1WAWA 3LHVA 2CKSA 5C2XA 3K13A 4E8CA 2QPUA 3AUOA 3HGOA 4HZ7A 3GVGA 1CXHA 3H2FA 2R1NA 1V6VA 3MBFA 5TD4A 1E6SM 1HW6A 1YDNA 2ZZ4A 2WMJA 3EWBX 3OGVA 3W1NA 3R58A 4DRSA 1FWCC 2FDSA 4GINA 4B16A 1OD0A 3QM3A 3VD4A 3VO0A 1WO2A 1HKIA 2V69A 3TONA 1TWZA 2ABBA 2C7FA 2E9LA 3SN0A 3TZNA 2OOGA 2VTFA 3APGA 3H21A 1CGUA 5DO8A 3UJFA 1MWOA 2VXNA 4IMEA 1MW2A 1QR7A 4FI4A 1GORA 4Q4OA 4AY1A 4GGHA 1SMDA 1LRNA 5CKSA 5D2VA 4LAOA 1LLWA 1EF3A 1NP0A 1UD2A 4B5XA 3K2GA 4UTUA 4M6VA 3W22A 3RDKA 4FALA 3W1LA 4KIRA 2CLLA 2AL1A 1CEOA 4DYEA 1OFBA 4JTAA 1VBGA 5I00A 3C0LA 3GUGA 4LYKA 5CBBA 1S2VA 2IXUA 3NO5A 3E0LA 3IGUA 2HWGA 5HOSA 3TTEA 1FUYA 1WQ5A 4X9SA 4QX4A 3OBKA 1TVLA 3R5EA 3LGEA 4O57A 1ZAHA 3B8DA 1ALDA 5I23A 1EBGA 4AEOA 4O0QA 3HN3A 3AISA 4KFPA 1XM3A 3LI1A 4HSOA 2VENA 5C9XA 4FNPA 5I07A 3FJNA 4GQGA 1GW9A 1MQQA 2OODA 2ADAA 2O92A 2Y7EA 3E2QA 3BLOA 4IFKA 2BSLA 5BOEA 3EB2A 4FR1A 4BQ2A 2BBFA 2YLAA 1HL8A 2GQ9A 4B9ZA 3STCA 1IXOA 3SAZA 1E40A 1GJUA 3GLCA 3IPWA 3XINA 3WMBA 2E1WA 3CYVA 4GUGA 5CC7A 1CXFA 4AD0A 3NGFA 3PC0A 2BOFX 4HSHA 4H2CA 3QYQA 1GPWA 3LHTA 4YU1A 3K46A 4O15A 4C7GA 1K8XA 2P5NA 3P61A 5H8MA 4Q7NA 1Z48A 2V30A 4J9JA 2FZDA 3KX6A 1FDJA 4B5UA 2IQDA 3VOIA 3ZJKA 4B2DD 3H24A 3Q58A 1POKA 3W81A 4CCEA 5C54A 2E9MA 1ZJAA 3T7VA 3TTOA 4DHGA 2WPGA 5DT7A 1OC7A 4WKFA 3M1ZA 4AEFA 3GAKA 3E02A 2NQZA 4NT0A 5IBXC 2VMFA 3OJGA 3RMJA 2VZSA 1KM4A 3DYPA 4M7SA 1XCFA 1EUNA 3P0XA 2ZA2A 3DFHA 1JF6A 2QIWA 3VDCA 1FP8A 3H6OA 1QASA 1W9BM 4YTSA 4LUSB 1UPPA 3E0VA 1DWIM 4JY9A 1W5NA 5CSRA 2X7WA 2WO5A 3L5LA 2JIEA 5EBUA 3S8HA 3B8TA 4Q4QA 4RNIA 2QHAA 2XINA 5F2LA 4NAEB 5D9OA 1HNYA 2UY4A 3R0DA 5E93A 2ZUVA 3AZRA 4Q4SA 4HCHA 4Q32A 3VTRA 1V51A 2MUCA 4AZHA 3VIPA 4C6MA 5GNYA 1OHLA 4NJJA 4FNSA 3RILA 4RXGA 3C52A 5HWMA 1WXYA 4AB4A 3FCPA 2OQLA 1EPXA 1KKRA 2WAGA 1OWQA 5D8WA 4KBXA 4OOUA 1VHCA 2ZX6A 1RP8A 4U31A 2O7QA 4EF8A 3RLVA 4LVBA 3CUFA 1WB0A 4PR4A 1ISWA 2WWCA 5I2UA 1N8IA 2WMIA 3LCLA 1BLIA 3B0YA 4JQ2A 2EPHA 4O1AA 9XIMA 1JZ8A 2J6VA 1YDYA 3H7UA 5DRCA 4Q6JA 1YPFA 3OVGA 2QUMA 4I9MA 3LCHA 3G8EA 2RGLA 1MEWA 3RCNA 3EWWA 4DLMA 4E8DA 3S9IA 3BQ5A 1SMAA 5BU6A 3T08A 4M82A 4O8AA 2OT0A 1M7OA 2FZMA 3EZ4A 4AVFA 4OWGA 1J0YA 2JEPA 4MB3A 5HUOA 1TO3A 1V6WA 2WC3A 5M1TA 4IZGA 3MA8A 2BV9A 4N9CA 3H4XA 2VR2A 4LBRA 1ONRA 5FJRA 3VUPA 1X98A 1J12A 4I9TA 5JIWA 2OQHA 1AH3A 1XDJA 5T91A 2VRKA 2Q3RA 3GO2A 4HT3A 4L4MA 1UC4A 3NL2A 2C71A 1XG3A 1XLMA 3D5HA 2HE5A 2RGMA 3SQSA 4AX7A 1Q4WA 4J35A 1EP3A 3W87A 1FCBA 3ZSTA 3ABXA 4PSRA 1VFSA 4UTTA 3E74A 2X30A 2YBUA 1Z3NA 3O0FA 2QGHA 4DI9A 1V3LA 3DFQA 1XI3A 3VD7A 4AW7A 3SJ3A 1REQA 3BW3A 3CHDA 1I0BA 1VCGA 1B1YA 4GZEA 3BLKA 1IF2A 4AF0B 5LA2A 3GHRA 2J13A 4MJ4A 2PDHA 1MDLA 1ONWA 4WRHA 1J79A 3UJ2A 4S3DA 1EBHA 1HJUA 4QR6A 3TTSA 1QHOA 2R24A 4MHBA 4KWSA 4H19A 5DXXA 4ERAA 5AKQA 1AJZA 5GVJA 4E4UA 4Y90A 3ARUA 3GIQA 4W87A 4KGLA 2FVKA 1KWKA 4K38A 2BG5A 4Z2JA 5GJPA 1EKOA 4D6GA 3TQVA 4HJFA 2WZMA 2BY2A 3SUVA 1AJ2A 1I2PA 1J01A 2Y89A 1FH7A 3QMSA 4O50A 4QITA 3CMJA 4JFSA 1HJWA 3P3BA 1IQ8A 2J9YA 1X7FA 5FI8A 3CB8A 4B5SA 6TIMA 4B5NA 1DWHM 2VO5A 1ML1A 1XRFA 3STGA 3REQA 3TMQA 3VD3A 3NL3A 1ONEA 5AOUA 3LRMA 4CNUA 1OG6A 4LV4A 5AVNA 1QVBA 3AHYA 2PDFA 5F4WA 2CLFA 2CWXA 5LNWA 3WK0A 4UFIA 1PCKA 3B4UA 5C9WA 1NFPA 3T07A 2YPIA 1IV8A 1PYMA 3BANA 3P6LA 4RNJA 1C92A 4XZLX 1HN1A 5ABFB 5D02A 1SVDA 3IANA 2V2HA 5TF0A 1EIXA 2D0FA 1XLBA 3GHTA 2PF0A 3I10A 1MEHA 1R9YA 2G0WA 2BGNE 3RITA 1UR1A 2ABAA 2PD5A 4JTDA 4G8TA 1AQMA 1LZOA 3EXSA 3CS2A 3EXRA 4JFUA 1W3IA 1S39A 1IIGA 5KINA 1QI4A 1FXPA 4PTMA 2A1YA 3LG3A 2NVCA 3PHAA 4GBDA 4CQDA 3GAYA 4JIPA 4LU0A 1V4YA 4TVCA 1YXYA 4JFVA 1D7FA 3CUJA 3A5VA 1LQAA 2PDWA 5CZTA 2VZTA 2XSAA 4NNAA 2YX0A 1UIPA 4EP8C 4ZXLA 2TAAA 4LF2A 4E2OA 3MDUA 1CLXA 3S5YA 6PTDA 4KWVA 4Q4MA 2G3IA 1V03A 3KVMA 3V35A 3APTA 4NJIA 5A6TC 2BHZA 4M8UA 3ZLFA 5LNRA 4P7QA 2R1LA 3EOOA 3M4HA 2MNRA 4QHRA 4MIMA 2BNJA 2PD9A 3OGRA 4ZB0A 3ENLA 1FCUA 1ZL1A 6ALDA 4JR5A 5AC4A 4LXFA 3MWCA 3MP5A 3O6CA 1H7NA 3NXFA 1EC8A 3UEQA 2ZDRA 1W6TA 4AMCA 4XO7A 2WVTA 4HIBA 4L1WA 4KEUA 1E9YB 1WXJA 2PWUA 3AIQA 3GC2A 2OSWA 4ZO9A 4YMZA 1OG0A 1I2RA 1PX8A 5TIMA 3MU7A 4XAZA 4YHGA 3BCJA 3MWAA 1Q6GA 3B06A 1I8JA 3LRLA 3PUEA 2L5HA 2P50A 2WB5A 1AA1B 4G7EA 4C1LA 3HIJA 4I8DA 1D8CA 4TV6A 2VGIA 4J27A 2PRMA 3U2OA 3AMCA 3S1WA 1NDYA 1TQXA 5AYYA 1NDZA 4ZB5A 2ISVA 2QMKA 2VRJA 2X1SA 2BOGX 3B97A 3AYSA 1JYVA 1L6SA 1EGVA 1AJ0A 3LQLA 1ME7A 5HULA 4O52A 3GVVA 1AL8A 3G1XA 1LQ0A 4PTDA 3DOPA 1TIMA 3CUIA 3RLHA 3IJ6A 4PUWA 4UQ9A 3QHOA 2Q8XA 4QRNA 4JBRA 4FLQA 2XHYA 1KTBA 3MVIA 1QNQA 3HM7A 1CYGA 2X05A 1GOWA 3R12A 2ZE0A 4L1GA 4DNHA 1MEIA 3TNOA 2VZVA 1A80A 3VGGA 4GGBA 5DMNA 4C6FA 1YTDA 3UG5A 5FF2A 4UTKA 4IQLA 1BYCA 1PVNA 1WDRA 4ZOCA 3N19B 1EC9A 3K8KA 4PC8A 1JD9A 2GJPA 2CITA 3MHGA 4W5ZA 3I3EA 4NAFA 2YL8A 4HSNA 3W1MA 5CPSA 4OBSA 4UTTC 2F38A 2GVGA 4XUYA 3RGTA 3BG5A 4LY8A 3N3TA 1OCJA 4O13A 4LRSA 1YNPA 4IPLA 1ZAJA 3O6YX 1WYIA 4NIRA 4HNVA 9CGTA 3GKAA 3FFSA 5IM51 3CWNA 3QC0A 4CGTA 3EKLA 4WY0F 3MCNA 2YCJA 2DJLA 2V38A 1QMLA 1JGMA 2Y2WA 4US5D 5LIYX 1M7XA 4N9DA 3T81A 4TMCA 2FFIA 4XAGA 1YE4A 3WH7A 3ZVIA 4M19A 1C91A 3FAXA 3OYXA 4UR7A 1XFCA 2QNEA 1WV2A 2PP3A 4WGHA 2ACSA 1GQNA 3R4IA 3M44A 3JZEA 4KW2A 2ZADA 1Q13A 4LAKA 1IWPA 2YSWA 3LI0A 4U4MA 4KT2A 4UTLA 1QW8A 3C56A 3M0IA 1WAUA 4PCSA 3UNTA 1PZ1A 3V3WA 2FYMA 2VDGA 3UZYA 1J0ZA 3VNLA 1QCWA 3DG6A 3IIXA 1DKWA 1TJPA 5BRQA 3VD5A 2HNHA 1KCLA 2ZRWA 3RLGA 3EA3A 4JKLA 1LTDA 1UUMA 4J3ZA 4LSBA 3W1TA 4DZ5A 1YEYA 3IEBA 1C29A 4GXPA 4N9EA 2V6AA 4DI8A 2R6OA 4IG2B 4XZNX 1Q2SA 3N2CA 1XLIA 2GGGA 5AYBA 5J5RA 1F4AA 4Y9OA 1GQJA 3CL8A 1DWFM 4FAMA 3S1GA 5LNVA 1NTHA 3W9ZA 1CDGA 3GX9A 1NQ6A 2E09A 1EGMA 4D6FA 3U4AA 1V0KA 4LVFA 5KMYA 5FOOA 2X41A 1Y7VA 2ZZ2A 1JFXA 2A6LA 2WSYA 2Y62A 3QLLA 4GUHA 3OLDA 3TYAA 1QPRA 4NX0A 2RDUA 2YFOA 4AQLA 4GQRA 2VFIA 3ZT6A 4XBJA 3RM9A 4QE5A 1QOQA 3TXVA 1YTEA 1QNPA 2HEJA 2E3ZA 1XV8A 4RW3A 3MSGA 4AUBA 4CUCA 3DI0A 5HJLA 3WFZA 3OVRA 1BSIA 4WHBA 4QSHA 2QCHA 4HCDA 1LROA 5LNSA 2W62A 3KP0A 3V5CA 1DJNA 4AC1X 3TYDA 2GVLA 1HO1A 1TUXA 4JFWA 1TCDA 1QI0A 2CC0A 3P80A 3R8HA 2RDXA 2YCKX 5I79A 3CUZA 1TJ2A 2XN0A 1I60A 5KZEA 1C8XA 3VX0A 4Q4RA 5CH9A 3VNKA 5IXEA 3M9YA 4CNSA 2WBKA 4HNUA 1HZYA 1V0MA 3LPFA 5CLWA 3KZSA 2I7GA 1F3EA 1KFEA 3PFMA 2P76A 1CGYA 1FWJC 3BZJA 3FGCB 4IT1A 2EG7A 2Y88A 4ADUA 4Y8FA 3ZWTA 3VGFA 2PI6A 3CV7A 1G69A 1HVQA 1PTDA 2GJNA 2C0AA 4H6RA 4EPKA 3H26A 2GQAA 1UZ4A 2X1UA 5CG7A 2Z0IA 4HPJA 2CPUA 3HFYA 3LS9A 1ZBKA 5AYIA 3CWOX 3ITGA 2PP0A 5D38A 1OGBA 3CZJA 3DUGA 1NP2A 1EYEA 3CV1A 3SRDA 4EPBC 2V68A 3G2GA 1M68A 3WFAA 3KOFA 4PUKA 2BLEA 1KLYA 3EA2A 4IMAA 2ZXAA 4CNPA 3N6JA 2J78A 5FJJA 4IIHA 3THAA 1PXGA 3DAQA 1BG4A 3SRHA 1RJQA 1CIUA 2QW5A 2VUNA 3H7VA 4H7VA 5DLCA 3HURA 4HPNA 4NF7A 4DBEA 3GDBA 5EKYA 3GZ3A 3CMFA 3L2IA 4L9ZA 4IJCA 3VNIA 4YYCA 2BGQA 3H2MA 1E4LA 3NDOA 4X0VA 1XPYA 3EX4A 3UPWA 1PTAA 3FVMA 2PCEA 5BRPA 1G6CA 4A3QA 1XIEA 1TPVA 1I2NA 3JUGA 4DZHA 2WXDM 1F2JA 5I3FA 3H2AA 4ZBCA 1BXCA 5K2ZA 3IWPA 2PDBA 1G9HA 1JF5A 1DWJM 4K6AA 3S1VA 3ZO9A 2OZ8A 1KM5A 3KBMA 3WD3A 1M9HA 4GYKA 3BPWA 1H11A 5DY2A 5KSWA 2ZC8A 3PAJA 1UKQA 3BLLA 4WSKA 4PUDA 1JUEA 2OSYA 1OC6A 4DJFA 3SEPA 2DZVA 3B0PA 1KQYA 1IR1A 4QEHA 4GKLA 1OFAA 2I9EA 2VR5A 3M64A 4GYFA 1RH9A 3H54A 3BG9A 1TA3B 1WE5A 5ABTA 1XKYA 3VZYA 3WQ5A 3I65A 4Z1BA 4S2BA 3B8UA 4K68A 3B8IA 3W75A 3WFLA 1TFVA 5G4EA 3W83A 4J5NA 3IK2A 3GKFA 2FMNA 2G97A 4FB7A 3C0JA 3FA5A 4L7ZA 1PIFA 2XIJA 3KCOA 3WZ0E 1JYXA 2X1TA 1YXDA 3IJQA 3EDJA 3VOFA 1TPFA 4DWSC 1HKMA 3HQPA 4L4LA 4C6DA 1QPQA 1DJWA 1VEPA 2JFEX 1EB3A 3UNDA 5DQPA 1BVNP 5HR6A 3N6HA 5D2YA 3ONBA 1SO4A 3W23A 3WJWA 1U5HA 4S3AA 3HPSA 3BZGA 4O4VA 3MYPA 4LF1A 4YTUA 1Q3NA 4FEZA 4F2TA 1KFCA 5BXSA 4AZ5A 3LENA 3KE0A 5BMXA 1KM6A 3QMTA 3W7GA 4IOTA 4YTQA 2CHRA 4GISA 2F8QA 4XZWA 2PRLA 1TIWA 3RU8X 1P6CA 5G1YA 3CIVA 1IZKA 2QCDB 1W54A 4AIBA 3LHWA 3MUIA 4NY2A 2GJLA 3HV9A 5GJNA 3YPIA 3FN9A 1QNRA 4RDYA 2XH7A 2ZCGA 1D3CA 1E0UA 1W3HA 5E5CA 2FIQA 1B3YA 3H53A 4M3PA 1OJXA 4U10A 4F2BA 5FJTA 3E6EA 4LQ1A 4MGGA 4I6VA 4AEEA 3L4TA 2NQ5A 4B90A 3L0KA 2CBVA 1BQCA 3JRKA 3W38A 1A5BA 5T26A 4MAZA 3DH7A 2IQTA 1R47A 3N4AA 3PG8A 1C8QA 3QJAA 3VDAA 1J0IA 3EMQA 1NOUA 3EPMA 1LBFA 4AH7A 3NURA 3OIXA 1UW9A 3ICJA 3G3MA 2D3NA 2C1GA 3P5ZA 5I02A 2HVOA 3B8VA 3K8LA 2DDXA 1OZQA 2IPFA 4TX6A 3XIMA 2R9RA 4Y96A 1XLLA 2CXEA 3L5MA 1ZUAX 2G3NA 3AYRA 2IQ0A 5ECVA 4O1FA 2GSJA 3RR4A 3DG7A 1TJ0A 3W02A 3DGRA 3WMCA 1FVPA 1UWUA 3DECA 2O7SA 3WIJA 1Q65A 2PRHA 1EJXC 4NAEA 2W79A 2E8ZA 2W63A 3B03A 4R9XA 4JNMA 4QG8A 5FKYA 1KBLA 2W66A 4ADSA 4QDMA 3WH9A 3BURA 2VHLA 1PDZA 3AAMA 3IRDA 2ALRA 2DZWA 2VELA 4YVXA 4Y9AA 2OELA 4UXDA 1A5OC 1EOKA 1V6UA 1E9IA 1H5YA 4NVTA 3EMCA 1RK5A 4UTJA 1PZ0A 1E6NA 2FHCA 1KXHA 1OFPA 2OU4A 1LT8A 5BU9A 1UR3M 4Q4KA 3KXQA 1QPKA 2C19A 2OZTA 3D46A 2TRSA 2G96A 1X6LA 4XV0A 1AH0A 1I2OA 2IKIA 1B90A 4LJ3A 2OOFA 1IR2A 1PTGA 4BQ4A 3TQKA 2J7GA 4TTUA 5FL1A 3GY1A 2QYGA 3T09A 3HOJA 2X1RA 1W3LA 1E6ZA 1SZRA 4F0RA 1SFSA 1EWDA 3W2KA 1BYDA 1B3OA 1A3WA 2YJQA 2WHJA 4PB4A 4UOQA 3PP7A 3C8NA 1UYQA 1UR0A 2QV4A 3WBXA 1UR8A 3PG9A 5I06A 1BF2A 5D32A 4XX6A 4US6A 5DFAA 4WOQA 5EMKA 1KA9F 3W1QA 1JZ6A 2PU1A 1VCFA 3ARYA 5AN7A 2OYKA 3TA9A 2NUXA 5G2IA 5BCAA 4WXYA 2B7PA 4KQNA 3N2TA 4P8XA 2ATSA 1PWLA 5K4ZA 3CHEA 4GKTA 3T42A 4N4PA 3GFYA 4WSHA 4JNZA 1CGWA 1R0MA 2QXWA 1H51A 3AIEA 3NEHA 1MW0A 1RA0A 2DT0A 1U1HA 3GTIA 2D24A 3CBWA 3HPZA 3DBNA 4AXNA 1SPQA 4H41A 4DJFC 5FF4A 2RAGA 1C7TA 2R94A 4HOXA 4DBUA 2ZX9A 1JZ2A 3MVTA 1O1HA 1T99A 3LHYA 5DANA 2ISFA 2QJGA 3CZEA 3I68A 3KDNA 5HJYA 5FAJA 3W24A 3ITCA 1H2JA 1IEWA 1WKDA 3S46A 3KRBA 1PKLA 4IWWA 3AXMA 3AO0A 4BQ5A 2OMAA 1F8MA 3CEPA 2DVUA 5KZMA 4M51A 3VD9A 4WJXA 3MC5A 1K9TA 4HPGA 3QXBA 3AWNA 1DJXA 3THCA 4UTWA 3HO8A 2DJXA 4GI9A 2E0PA 4QEEA 4PSPA 3PWIA 3BGAA 4H9TA 1O95A 4C65A 3UVAA 4PFMA 1UR2A 4JN8A 3EEZA 3O63A 1ODZA 3N17A 3F5KA 2CLEA 3WQ8A 4JTKA 1U33A 4R53A 1ZB5A 2C3ZA 4DJDA 2H9AA 1IYXA 4DQWA 2OTDA 3AIWA 3TYUA 3KDOA 1CB2A 4V15A 2RH9A 4P5UA 3PK7A 4MNMA 1LORA 1OYCA 3RYSA 1JAKA 4P7RA 1F07A 5F1VA 3L21A 2Z29A 1KCKA 4UFMA 4CU6A 4UZUA 2OEJA 4PBEA 3MBDA 2B7NA 4X9YA 1CB7B 1I6NA 1UUOA 4AU0A 2J7HA 4JTIA 3W26A 2WVSA 3FW6A 3W7IA 4GA8A 1RVGA 3UBPC 3WEZA 5ABFA 3GB6A 2VT0A 3ELFA 1T8XA 1JAEA 5T8GA 1WDQA 1RBLA 1Q6RA 5REQB 2YDQA 1OGGA 3OZPA 4G6CA 2FH6A 3Q94A 3RCMA 1ZENA 2X2GA 4FOUA 3DIPA 3WQEA 4ONVA 1EHAA 3LCWA 2GGEA 3DXIA 2XGZA 2CIPA 4BEUA 3RUBL 3MSYA 3T0DA 1GVRA 2CXGA 5JMUA 5GNXA 3OLIA 3KRSA 2BP1A 2PGRA 3W1AA 2JK2A 1TV4A 3BGGA 4FOJA 4IL2A 3NZPA 4JYEA 2BX7A 2DT3A 2DIEA 5CZKA 3WBEA 1CCWB 2PDJA 2DIKA 2RDWA 4F9JA 5KZ6A 1ECQA 2W0UA 3R10A 2VZOA 2ESCA 4A3YA 4DWDA 1FWEC 3QLDA 3GS6A 1QTWA 4BY3A 1S3HA 3TR2A 1F9CA 1OGSA 4JL1A 4MKNA 3E2VA 3DN5A 5AHNA 2XM1A 4HYVA 3BW2A 4YWSA 1DQUA 2MANA 4Q8NA 3UERA 1GEHA 2VFGA 4NZ5A 1UWSA 4ZTYA 1T7LA 1IEIA 3WN6A 5B80A 3OBAA 1GVSA 3W82A 3EAUA 3LX9A 5XIAA 2CU0A 4IXXA 3CLMA 1EF2A 3CH0A 3EDFA 2WLZA 3H23A 5A8OA 1SO3A 4FX8A 3HMJG 2QCMA 4LEQA 3SY1A 2PTXA 4BR1A 2CERA 5IDZA 1V6TA 2HVMA 4K36A 1XDMA 5EY5A 5CBIA 3QZAA 1XLFA 4XZ9A 1NSJA 3N04A 3WQFA 2WBGA 4HJWA 1W1IE 3VDGA 1SZGA 1UA3A 4K8EA 2JGQA 1GVOA 3SIZA 5A6AA 2BXZA 4MUZA 4TMBA 1XJBA 1XSKA 1L6WA 3NR0A 3H55A 2VUYA 1MRAA 2QMJA 3WDRA 5G1TA 3N4FA 4JDYA 2G50A 3EPNA 2KZHA 4D1JA 1FWTA 4MUPA 4X63A 1XW8A 3PZOA 2W92A 2AKMA 2QQ6A 4LAMA 1QWKA 1UD4A 5RUBA 1VPYA 2D1ZA 2PS2A 2J7EA 2FVLA 4AVNA 5IFPA 1HJQA 3QPZA 1KXVA 1UP0A 1HKJA 4XQ6A 3IIZA 2YCLB 4BHYA 4LEFA 3C5QA 1X97A 2J75A 3P14A 4DO4A 3PN8A 3PJXA 2PGFA 4IUGA 1NY1A 4GWEA 3VKDA 1BGAA 1FCVA 3WDQA 3D3AA 2NVDA 3WK3A 3A3XA 4Y9MA 3VGEA 5D2XA 4ZSUA 5DBTA 1OCBA 4BA0A 3CAQA 2J6XA 4ZE5A 4FF7A 3W7JA 1JCXA 1R7OA 2J66A 3HF3A 1PHWA 3HTWA 1RY8A 1GYLA 2V67A 4JIEA 5U7SA 4AD3A 3T78A 1BWKA 1YIXA 4QSFA 4WXZA 1GKPA 4ZFCA 4ML4A 4PCTA 1HG3A 4LS0A 3WD0A 4R34A 4LV9A 4UMBA 4NJGA 3RLUA 3SGGA 4QE1A 3NTYA 3NQFA 2X40A 3PF3A 1QBBA 4K1WA 4Q4PA 4RJEA 1HKWA 5EMUA 3WEMA 1XD0A 3ZR6A 1KR0A 4C6CA 2VCCA 3QF0A 1Q6FA 5HMFA 4NJHA 3W1RA 4UTWC 3WLPA 3BMWA 4YLWA 3M07A 3PJWA 3EOSA 1UD6A 3B0VC 2WVVA 1W1B1 5IRPA 2PLJA 4IXHA 3UESA 5BWAA 3MB9A 5DXYA 3M0YA 1W9DM 2BHYA 1S5NA 2NLYA 1ZHAA 3R89A 1PDYA 5F1UA 5H1WA 2A7NA 2GWNA 2XYLA 2D0GA 1W0MA 3G1YA 4RE0A 2ACRA 2VOTA 3EX1A 5DY3A 3EA1A 2HZGA 5FF3A 3BJFA 3PPCA 5AC8A 1HF6A 4YHEA 3M6DA 1R9ZA 1V5XA 4ZO6A 1DJGA 5EBAA 2HROA 1IXQA 2WZTA 4BF9A 4A8RA 3AIRA 3MW7A 5A3HA 4JDBA 4OIFA 1R5YA 3LA4A 1OVDA 3SN1A 4GH3A 4JKKA 3HGJA 3QH2A 3B3DA 1ITXA 1ELSA 4FP1A 5CSSA 1FWFC 3IAPA 3M0MA 1ZLPA 3MHUA 4GC3A 1F05A 1T6MA 2OO6A 1EQCA 1F6PA 5H8UA 3ES7A 5AYXA 1JNDA 4LCQA 4JGDA 3S2CA 4JTTA 4XVDA 5A94A 4ZO8A 1OFOA 5AHEA 4DUXA 2QUUA 4H00A 4KRZA 1G4TA 4ENLA 2Q71A 3U2EA 2C91A 1LOSA 4A3HA 1NF7A 3I3DA 3PZMA 4GI4A 4HYWA 1OYAA 4NL1A 3WQPA 3CJPA 4KCWA 4XZBA 2WJEA 4GIRA 4NNCA 2J8GA 4H7ZA 1SZEA 3G6MA 3NL6A 3W1PA 1F7BA 7TAAA 4IJRA 4UQDA 3S2LA 3A4AA 3E96A 3PSVA 2QVNA 1PUDA 4ZCWA 1A0DA 1FP9A 1KFLA 1ADOA 3BLPX 4GE8A 4O11A 5TQLA 1OFRA 3VIOA 3KRUA 1H7RA 4C6IA 2F2HA 2Y8KA 5FF7A 1VPXA 4FZIA 1W9PA 1XIDA 2HXUA 4C6LA 2QIIA 1FCQA 2ZDSA 3QZEA 3OP2A 5I6SA 4L9XA 4ZGYA 2D69A 5FJUA 4PRWA 3IUIA 1VLWA 1QU4A 2CLIA 4BI6A 2WMIB 1OY0A 3NSNA 1E72M 2QUTA 3NQ7A 3AOFA 4W88A 1TX2A 3T44A 2PC8A 1DHKA 3M0XA 3NQ8A 3R79A 1TV3A 3BE7A 2Y4SA 3V0TA 2H3DA 2HE8A 4TR9A 3POHA 1OSEA 2F7FA 3ME3A 4JHZA 3ZVHA 3L12A 1KNWA 2XVLA 5HJXA 4H8HA 2ANUA 4I3GA 3UXDA 1E4MM 3F4DA 4K8HA 1VFHA 3C4UA 4CD7A 1SU5A 1CNVA 2FB2A 4ZENA 1CXEA 4GJIA 2XWDA 2CW6A 3H2OA 2XIBA 1NFGA 4GY1A 2P8CA 4HZ6A 4IIGA 4LAUA 1DHPA 1SFTA 3QSTA 1TMQA 4E2VA 3AXKA 4HZMA 2YIHA 4LBSA 1S2WA 3IRSA 3GR7A 4MFDA 5C7VA 5HQLA 1J5TA 1YADA 3GUWA 1JCLA 4GPNA 4L64A 1EZ2A 1ITQA 5CPNA 3W76A 3LSCA 2Z6IA 5HPOA 1EX1A 4IGHA 3ZLGA 1HT6A 1Z89A 5M03A 1C3FA 3W7QA 4U5KA 5C8BB 4FLOA 2CFFA 5AYZA 1HL9A 3A4WA 3GVRA 3SCNA 1A50A 3NZ1A 4U3CA 3FJ6A 3ANVA 3H4GA 3SY8A 2C13A 3GNDA 2ONEA 4TUFA 4IICA 4LPCA 2ISSA 3N14A 3BV7A 2F84A 2PDKA 2PBGA 3NQEA 1SO5A 4ROPA 4K3ZA 3WLQA 2V5KA 5FA5A 3F5JA 3RCYA 3ZIZA 2HMCA 1TJRA 1L8PA 3V75A 3MMTA 3W86A 2TPSA 3ATZA 2BZNA 3REQB 1PYFA 4GUFA 4JN7A 1CXLA 2I5QA 2O9PA 3SI9A 5H8PA 3K1GA 3W7RA 3N13A 2H90A 4DUWA 4C1NA 1JL8A 2ZZ7A 1GG1A 2G4FA 3C8FA 4YJ5A 1O4UA 2A3HA 4MNJA 1XSJA 3MY9A 3MPGA 4HA1A 1UJQA 1V7YA 4B5WA 5G4HC 4B4FA 4HB7A 5BMWA 2Y5EA 2ZA3A 5HQMA 4QXIA 1YKWA 1X39A 3QBUA 2YDRA 3FYYA 3G1HA 2BMBA 1E9ZB 2ZKMX 3H4WA 1XRVA 1L8NA 1E6XM 4A3UA 3BV4A 4NG3A 2DSUA 1YX1A 3H2EA 1QFEA 2EEXA 4GVGA 2A79A 1OBAA 2ACUA 3M0JA 3MI6A 2Z1XA 3C2EA 3KBWA 2XIIA 1JZ7A 4ZVJA 4C6JA 3RO8A 2J9ZA 2A6NA 4BFAA 3ALGA 3IUDA 1K8ZA 2DUXA 3EWXA 2NQHA 4PMUA 3W00A 3AIBA 3KLKA 1JZ5A 2QKFA 2QCDA 4XG1A 4GY0A 3WLLA 3IJ9A 2IW0A 4DJEA 4QGCA 3Q67A 2GUBA 3FDGA 1QNSA 4Z2GA 3K5XA 2PC4A 3ZS4A 1OB0A 3WUEA 3SQMA 4MWAE 1TPB1 2ZBTA 1DIDA 1ME8A 1IWBA 3DFOA 4MWAB 3KBJA 1JDCA 3GG8A 1TELA 4LB4A 2OLAA 5EFFA 1VHNA 2PBOA 2C18A 3MUZ1 2OZ0A 3CUGA 5I3IA 1GQIA 4UOJA 1PKNA 1T8QA 1GK8A 4CLMA 6XIMA 3A9BA 1BWVA 1ZJBA 1K03A 1FHUA 2DH2A 3H2NA 1FRBA 1TZ7A 4XO6A 4KRTA 1MXGA 4IH3A 3LB0A 3QPEA 4RR4A 5JBFA 4UIOA 4R88A 2VFHA 3CAKA 3TE9A 4F3HA 5DRIA 4I7UA