4JTAA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 121
structure length 326
sequence length 326
chains with identical sequence P
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtaA00
1VP5A 2IQ0A 4I5XA 5HA7A 1UR3M 2FZ9A 1ZQ5A 2FZ8A 2IKGA 2INEA 2PZNA 2NVCA 4GCAA 4JIIX 1Z3NA 4AUBA 2P5NA 2I17A 1R38A 2PD5A 2HV5A 1MZRA 1PZ0A 4XZMX 4L1XA 1AZ1A 2BGSA 4G5DA 2C91A 3Q67A 2FZDA 1Z8AA 2PDGA 4FALA 5LIWX 4PRTA 1YE4A 3H4GA 3UZXA 1RY8A 1AH3A 3M64A 1MRQA 4ICCX 3R94A 3MC5A 3F7JA 2ACQA 3QKZA 2IPGA 3ERPA 2ALRA 1GVEA 4GQ0A 2PDCA 3UP8A 4FZIA 3LUTA 4JIRA 1RALA 1EF3A 4JQ4A 2R9RA 5AZ1A 5AZ0A 3V0UA 3ONCA 4XZHA 4DBWA 3N2TA 3V0TA 1LQAA 3Q65A 1XGDA 1ZUAX 3R8HA 3WBXA 3MB9A 2ACUA 4Q7BA 1T40A 2PDQA 2HDJA 4IGSA 1JEZA 4JQ1A 3GHTA 1AFSA 2ISFA 4QR6A 3EAUA 3CV7A 2DV0A 4YVPA 5DANA 2PDLA 4XK2A 1AH4A 4GQGA 3R58A 4JQ3A 1LWIA 3R6IA 3V0SA 3T42A 2IPFA 2WZMA 4LB3A 2HVNA 3B3DA 2HVOA 2PDKA 4XZNX 2A79A 1AZ2A 3R8GA 4PUUA 4DBUA 1T41A 4XZLX 1J96A 3R43A 1PYFA 3LQLA 1YNPA 2IPJA 2BGQA 3G5EA 3DOPA 2DUXA 3UZZA 5KETA 3LENA 1Z9AA 2FVLA 4WGHA 4PRRA 4IJRA 1Q13A 1Z89A 4R9OA 3UWEA 3LQGA 3RX4A 3CV6A 1X98A 4YU1A 2WZTA 4WDTA 2QXWA 3CAVA 2PDMA 3COTA 1C9WA 1EKOA 5LIXX 2J8TA 1K8CA 1ZSXA 3VXGA 2F38A 2FGBA 3UFYA 2FZBA 4JTCA 3LD5A 4DZ5A 3RX2A 4JTQA 2PDYA 1S2AA 3CMFA 4Q3MA 4JTDA 2HE8A 4JQ2A 3KRBA 5JH2A 2PEVA 1ADSA 4F40A 1IHIA 1US0A 5LIUX 4L1WA 2PFHA 1A80A 4XO7A 1SM9A 1S1PA 4HMNA 2HE5A 1X97A 3BURA 4LBSA 1HQTA 2NVDA 3M0IA 2PDJA 3LZ5A 5HNUA 5LIKX 2PDFA 3UG8A 2IS7A 4WDUA 2VDGA 4LB4A 4QBXA 3V35A 3BCJA 3WBWA 4FAMA 4YVVA 2IKHA 1AH0A 3CASA 1ZGDA 2F2KA 4GIEA 5JH1A 4IJCA 3UGRA 4XO6A 3LZ3A 4MHBA 5M2FX 4ASTA 3P2VA 1XJBA 4RPQA 1YNQA 4LBRA 4XVDA 3EB3A 1VBJA 1FRBA 1QWKA 3R7MA 2BP1A 1XF0A 2INZA 3FJNA 4FA3A 4WDXA 4GACA 4DBSA 1EL3A 4QXIA 3BV7A 1EXBA 2ACRA 4OTKA 3GUGA 1Q5MA 4YS1A 2PDWA 4PUWA 2ACSA 4LAZA 2PDHA 2I16A 4JIHA 2PDIA 3LN3A 3UZWA 2PDUA 1PZ1A 3N6QA 4ZFCA 1YE6A 5C7HA 3UYIA 2CLPA 3UZYA 4JTRA 2PD9A 4PR4A 4XAPA 3DN5A 2IQDA 3GHUA 4LAUA 3LEPA 4H7CA 4HBKA 2IPWA 1RY0A 5LIYX 1S1RA 3LBOA 3RX3A 1PWMA 3LNMA 4JTAA 4XZIA 2DUZA 3GHSA 3S3GA 4WDWA 4GA8A 3WG6A 3G1RA 2PDNA 1IEIA 4QX4A 3H7UA 2IKJA 3M4HA 3WBYA 4WRHA 3ONBA 1X96A 1HW6A 1PWLA 4H8NA 4XVEA 2PDXA 4EXAA 1MI3A 3NTYA 2HEJA 3H7RA 1M9HA 3O0KA 2IKIA 3C3UA 2PF8A 3CAQA 3U2CA 5HNTA 2AGTA 4WEVX 2PDPA 4EXBA 3WCZA 3D3FA 4YVXA 2R24A 3V36A 1S2CA 3GHRA 3O3RA 3BUVA 1QRQA 1OG6A 4NKCA 4PMJA 3EB4A 2PDBA 4JQAA 3FX4A 4GABA
chains in the Genus database with same CATH superfamily
3NZ1A 3F4VA 3STFA 3M44A 1BWKA 4RE2A 2DT1A 4J3XA 1N2VA 2EBNA 5EMMA 1GQLA 2PZNA 3PZMA 4ZE5A 3LLFA 4H6QA 4IIDA 1N7KA 1FA2A 4UWMA 2Z24A 4AEEA 3SY8A 1SJDA 1X7FA 1W6TA 1I1WA 4EKJA 1E6RA 3HPAA 4LF1A 1KR1A 2WZHA 4BF9A 3LRMA 4IXHA 3NQ2A 4J35A 2ALRA 2P0OA 1N8WA 3TOYA 3UVIA 2VWSA 3QQ0A 2J27A 2J74A 4FZIA 2XN1A 1XSIA 5EMLA 4KFOA 1EF3A 5CBBA 1Y7VA 2VGGA 3JZUA 1LOSA 4Q7NA 2D20A 5D09A 4J27A 1XS2A 2C79A 3VIIA 1T96A 2ACUA 2VCBA 3TEVA 1A49A 4V27A 1CB7B 1TFVA 2A0NA 3NPUA 3NXFA 2D69A 1ZU8A 5CH9A 4H6EA 3QVQA 1ZBWA 1OFPA 1MUMA 4IHCA 4WKHA 3QW4B 3O16A 1US2A 5HMDA 3WX7A 1FWGC 3TN5A 2PMQA 3WMSA 2V2HA 1E0UA 3U4AA 3OLIA 3N2MA 4H9TA 4LCQA 2HVOA 1FOBA 1S38A 2HS8A 4C6JA 2ZKMX 5AYYA 3M0JA 1OX6A 1A47A 1O5QA 1FWBC 5IBXC 2BHZA 3FA3A 3TU9A 3TQKA 4UFLA 3BE7A 4JNYA 4X2RA 4NZFA 3F5JA 1BG9A 5IRPA 4H7ZA 1W3HA 4YL2A 2ZX6A 4XKYB 3NQAA 4F0LA 2ZOXA 4OUEA 4NILA 1JNEA 5FEPA 1PUDA 4D8ZA 3N14A 3KP0A 3S46A 3O6CA 4H04A 3W9ZA 3HGRA 3DFHA 4LNCA 3STCA 1S2WA 1Z89A 4HZ7A 4GNJA 1WQ5A 1LJYA 1GG1A 3FDKA 3R1ZA 3TQVA 5A8GA 3CB3A 1OBAA 3VOIA 3ITTA 2HRWA 1B3VA 1GOKA 4LVBA 1W1ZA 1WA3A 3IUIA 1GORA 2Z2UA 4PTMA 2F9RA 4JTCA 4AW7A 2CZEA 4XTDA 2QAPA 3H12A 3QLDA 3CMFA 1F6PA 4TX6A 4K3ZA 1LUCA 1A3WA 1VJSA 2CLLA 3N29A 1MO0A 4HNTA 2PFHA 1NH6A 2HSAA 4JXCA 1S1PA 4S3DA 2OJPA 3TA6A 1I9CB 1CGVA 1HQTA 1XHGA 5FIPA 1G7VA 4HTYA 1W9PA 4QBXA 3HJEA 3KXQA 3UR7A 4GBDA 1PSCA 4JYFA 1JYXA 2WJDA 3WMCA 3Q94A 4ZO9A 2I57A 3S6OA 3M07A 3OZMA 1AH0A 3PTQA 3CHVA 2JIEA 2EPOA 3EOUA 3MP5A 2D24A 4JIQA 4DLMA 4GIEA 2J62A 3SIZA 3KLKA 4MDOA 1TPB1 1E0TA 1K3UA 3XIMA 1R5YA 2CHOA 4IPIA 2YR1A 3IIVA 1JQVA 4Q4SA 5EGRA 4QAIA 2I56A 4PUNA 3TONA 5AFDA 4JL2A 1FRBA 1NSJA 2QKFA 4S3GA 4GWEA 3R7MA 3VK5A 1WBJA 3TA9A 4UTIA 4HA1A 5JMUA 3SRDA 2VKZG 4M7TA 3LGDA 3W7GA 4NVTA 5CPSA 2QCHA 2ZICA 1V0LA 2IMRA 5DXYA 3FYOA 1FH8A 3GW0A 4G2DA 4PCPA 2QPSA 3WDPP 2E5DA 3WK0A 3QRHA 4QCFA 4UMCA 4YS1A 2YLAA 1QTWA 3RPTA 3GDBA 2ACSA 2YSWA 3KL5A 3SAZA 3LK6A 2XFYA 3H54A 1ZAIA 1M6JA 1ZBCA 1W2VA 5I3FA 3WNKA 1C91A 5LXXA 4GGHA 1LBLA 4GUHA 1BYDA 3BOFA 2WYSA 1JYWA 3PWGA 3MJMA 1E1FA 3SY1A 4Q7IA 3AS3A 4TOQA 3SJ3A 3UJEA 3AIBA 1IYXA 1IT0A 1H09A 1U30A 4Y9NA 2IKJA 4BQ3A 4YHGA 1UZHA 4IP7A 3UD6A 1OFBA 3TXVA 5KZ6A 1DIOA 5L6UA 4U5KA 3GXPA 5FACA 1P6BA 3GU2A 4R5EA 1XPGA 4AVFA 2PPGA 3ITXA 3FA4A 3F5LA 4Q8OA 4C60A 4G8TA 1M9HA 3AZRA 3BO9A 1ZLPA 1RBAA 3T2OA 3CXOA 4IGNA 4PB3A 4P7RA 3I7RA 1IXPA 2ZXDA 1TVNA 1POJA 2D3LA 5G1TA 3SCQA 3BLPX 5A6KA 3CYVA 3FX4A 5AHFA 3BH4A 1JYVA 2PRMA 1J6PA 1V4YA 1KRBC 1QWGA 3K1DA 3UZ5A 5CG7A 4GCAA 5FF4A 2X1UA 1JDCA 1ZBKA 4GZ7A 3AMKA 3H70A 2W67A 1PIIA 3EX2A 1CW2A 3ITVA 3TTSA 4E2BA 4CNUA 4MFEA 3QQWA 3PBGA 3UZXA 1JZ8A 3ATZA 3TTOA 3B8DA 2BWGA 2OFJA 4Y8EA 1E6SM 1MNSA 1WE5A 3VM5A 1PZ3A 1U5JA 1OINA 4U28A 1MFUA 1RV8A 2IW0A 3TC3A 3UG4A 4RNJA 1HIZA 1KM6A 1I75A 2ZVRA 2PGWA 3MTWA 1U5HA 4AZGA 1E72M 2QPUA 2E6FA 2ZDSA 4F0MA 1SMAA 4QDWA 1T40A 4GD0A 2D2GA 3RLGA 3PJXA 2VL4A 1ME9A 2OXNA 4LS1A 4DJDC 1XLIA 1CEOA 2VC6A 2XYLA 4S3JA 1R3YA 4S3KA 3DC8A 1CLVA 2VEMA 1GQIA 1PS9A 2EPMX 2Z1WA 3HU7A 1OGBA 4FOJA 2VFGA 2CEQA 1DJHA 4XK2A 3RPDA 3BK0A 2Q8ZA 3NO3A 3M1ZA 1LWIA 3PUDA 1HP5A 4V28A 2G3IA 2QCLA 4AAJA 1SO4A 2OG9A 1UR8A 4LB3A 2HVNA 3ABRA 1OF8A 1I1XA 4CNOA 3W85A 2YDRA 1AZ2A 4KKXA 1NWRA 1KA9F 1WBHA 4GFIA 3POHA 1G9HA 3S2JA 3DG6A 3GVGA 4AEOA 4L56A 1Q4WA 5CGTA 3L66A 2ZZ1A 1KM2A 3UF9A 2QUUA 3C0LA 2DJLA 4IFKA 4WZHA 1KFCA 1LRTA 2CFFA 3SB0A 1XSKA 5FF2A 1UUOA 3QYQA 2GGGA 1XIMA 3M6YA 4NL1A 2DVXA 4PMRA 6TIMA 4MKVA 4OECA 1VFLA 4A8LA 1X98A 1UQZA 2Q71A 4HNUA 4EX4A 1TMLA 1PPIA 2EGZA 3CWNA 4GXMA 3CT2A 3N34A 3VXGA 2A2IA 4IFOA 2XVNA 3PZOA 4O8AA 2WPBA 2A7PA 2QGHA 4Z1DA 3GAYA 4S23A 4AZCB 4O17A 1EF2A 3MP3A 4Q3MA 1XGEA 1H4PA 4MUPA 1IHIA 3DESA 4L1WA 2RDTA 4UQDA 1LG1A 3UWQA 5C9ZA 2BODX 3DHPA 3O0FA 2QDDA 4ACZB 3ABSA 3AZTA 2VDGA 5JUVA 1Q65A 5LSMA 1ISXA 2P3EA 4TIMA 1GOQA 3OZPA 4Y90A 3WMLA 4P8UA 3NZQA 3S4TA 1H41A 3LPGA 2P88A 1CIUA 1ENUA 1KTCA 5J04A 2OX4A 3BANA 1GJUA 3KCLA 4I7UA 2GYIA 1UROA 1G5AA 2X1RA 1B4KA 1V3HA 2A3LA 1K7FA 1HGYA 5M2FX 3ZJKA 4LBRA 2Z27A 4YTRA 5BZAA 3S5ZA 4P7NA 5FD0A 4S3BA 1XRSA 2Q02A 1EBHA 4ZE4A 2Y62A 2WVVA 3QR0A 1ODZA 5REQB 4CQ8A 1P43A 1O1HA 1JDAA 1NFBA 3AIUA 3KZPA 3NO5A 5KTLA 1XD0A 4XZWA 2EPKX 5A2AA 4BJHA 2QJHA 3JS3A 2PTZA 3L4TA 4QTGA 2W92A 1SO6A 3IIOA 3KTCA 1JYNA 3I7SA 4D1IA 3R8RA 3T6CA 3VGGA 4FLSA 5HK4A 1JI1A 3FSUA 3NQMA 3P74A 2PDIA 3UZWA 3K4DA 1R86A 3AIWA 2JK2A 4HJWA 1J0HA 3ORWA 1E15A 1DQUA 4IP4A 4DM1A 5KMYA 3VOHA 3V5FA 1XUUA 1QNVA 5EB8A 3R4IA 3VOJA 1I0BA 3CB8A 3R13A 2IXUA 2QUVA 1H1ZA 1WKDA 3HMCA 2O9PA 3GLCA 3VNLA 1OFAA 2WC4A 1XD1A 1EHAA 1BKHA 4IMEA 1Z6KA 3QR1A 3LNMA 1CXLA 2QYGA 1TX2A 3ARXA 2Y2WA 4MMWA 2NV9A 5CEWA 2VR5A 2P76A 3UXAA 3W7MA 4QX4A 2WKGA 4HSOA 4GRSA 3H2OA 1B31A 1VEMA 1X8FA 1OK6A 2GVLA 2GK1B 3NPVA 4DUOA 3A21A 1Q2RA 4I9MA 3AUOA 2V3EA 2PLKA 3AAMA 5TAOA 3PFMA 2FMOA 1A3HA 3CAQA 3VKAA 3M0ZA 1YEYA 4WXYA 3MKVA 4IG2B 2YW3A 4ALDA 3OGVA 4DO6A 1VFMA 2VHLA 3K2GA 3FEMA 3L5AA 5LZLA 4YVXA 1VBHA 1J2WA 1SFSA 3RJYA 1O66A 1OYAA 4AY8A 1MXGA 4ZOCA 2XZ9A 2R94A 3W87A 1M7XA 1EJRC 1ZQ5A 1G4TA 1PDYA 2OGJA 4E38A 4HSHA 4QLKA 4AWUA 2ZA1A 2WMJA 1QK2A 1Z3NA 1OHLA 3S5SA 1GTEA 2RJHA 2FHFA 3GR7A 4IMGA 4C5YA 5H8UA 3A13A 3QC0A 2YCJA 3BWWA 2WMHA 1AZ1A 1VYSX 4G5DA 5IHRA 5MHBA 2FZDA 2O92A 3FFSA 5HBFA 4FALA 3P60A 3SEPA 4C1LA 2X09A 4S3EA 1ONEA 1RY8A 1R3VA 4CCDA 1THFD 3R94A 3R79A 3GG7A 1V02E 4WCJA 1Z42A 2F2HA 1KBJA 4MTVA 1QK0A 2BHYA 2YIHA 1XBZA 4EWJA 1UWTA 3UP8A 1E6XM 4PMNA 5LA0A 3NPWA 4JIRA 1JRBA 1R9XA 1UD4A 4U5IA 3CEUA 2NUXA 1YLVA 1I2OA 2G5WA 3HM7A 5A6AA 2TMDA 1A5OC 2VURA 5M3WA 1YBQB 3SSJA 3IWPA 1W1TA 2J4GA 2QCNA 3SCUA 4MKSA 1AFSA 5K2ZA 3DZ1A 2V3DA 2YA1A 3LPPA 1BWVA 3G1YA 1YTKA 3EWBX 4OV4A 2ZTJA 1R3QA 3GXNA 4LVAA 3NO1A 3FJLA 3A3WA 3NOYA 2EEXA 3NCOA 1A0EA 3NJ3A 3AO0A 4Q33A 3KRUA 4JNMA 5GQBA 4BF7A 1EYEA 3N2OA 4L5ZA 1C7SA 2QEZA 3ZJ7A 1XYAA 2KX9A 4H01A 2OU4A 2VZUA 4IMFA 4KWUA 2VFFA 4YN5A 2X42A 3BCDA 1H5YA 4I6KA 4WR3A 5LNWA 4RUBA 2ZX5A 3G1FA 1J96A 1ZS2A 1PYFA 1P0EA 3KWXA 2VFHA 4MVAA 1MXSA 1VQTA 3G5EA 4NXSA 2DUXA 1W1IE 4FOUA 1AW1A 2G50A 4NASA 1OX5A 5D9OA 3S9YA 4B91A 5PTDA 1Z9AA 1RCXB 4IPNB 4LYPA 3OQ8A 4AIUA 4Q4QA 3HQNA 3KL0A 4HT3A 2OB3A 2BB0A 3LV6A 2YDQA 3AWOA 3EDJA 2YPIA 4G9PA 1GHSA 2YYTA 4WDTA 4YTSA 3LLDA 5A8OA 3CAVA 1UWAA 3DFNA 1UKOA 3KHDA 5AECA 4IMDA 3PPCA 3GIYA 2E9MA 5HQMA 1VHCA 4S3FA 3PP7A 1MW1A 3WK1A 2PF0A 4UUIA 4W4QA 4IISA 4DJFD 2V67A 5JH2A 1V0KA 2P3ZA 3WZ0E 1UJPA 1GVIA 4HGXA 4XAZA 1XIDA 3WLIA 1WO2A 3AFBA 3M47A 2D3NA 3AHVA 4AX6A 2AOSA 2Y1HA 3ZLGA 5JVLA 4E2DA 1JVNA 2AMXA 5LIKX 1V6VA 1IZKA 1WYIA 1XDMA 2X0YA 2ZE3A 2RHGA 1TWWA 3RO8A 3F2DA 1TWSA 1XYFA 4LY4A 4QLLA 4A8IA 3AJ7A 4FAMA 1YNYA 1LDCA 4CD4A 3E0VA 3W1UA 2C0AA 2AQOA 3BAKA 5CPMA 1S2VA 1KKRA 3VI2A 4O13A 2VT0A 4DYKA 1Y5VA 3W7DA 1S2TA 3SGUA 4LOCA 1B4EA 3VUSA 3I68A 3BICA 1Q66A 1XDLA 2XSBA 1NAL1 1HJWA 1NELA 5C70A 5AYIA 4B3ZA 5A6JA 2ONEA 3TSBA 4ADTA 1GZ1A 5FAJA 2CZDA 1CCWB 3B03A 2J7DA 4JN8A 1EGZA 3REQA 1H7NA 5U7SA 4IXXA 2RDXA 4GVFA 5JIPA 2DH2A 4PMQA 3UR5A 3TYAA 3D6NA 5I79A 4FLOA 4X0NA 5KZDA 3MPGA 2Y4SA 3ARSA 3VPLA 1ITCA 1TV4A 1P1MA 2W62A 1GZGA 4XQ6A 2YW4A 4LAZA 3PULA 4H00A 3WQGA 2UZ9A 2G4JA 3LN3A 5JU6A 3ICJA 3NWRA 4WSHA 5HINA 4KF1A 1WNOA 4JFVA 1UBPC 3C61A 4FXFA 4LSBA 3QOMA 2PGRA 2YZRA 3M0MA 2GPTA 4ZQRA 4JFWA 2OTDA 3DERA 3SCRA 1GQKA 2UY2A 3CM4A 3W86A 2C15A 3D5HA 4OU1A 4ERIA 3NZRA 1M53A 4QP0A 1A0DA 1RQBA 3FK4A 3PAJA 1I0DA 1OC7A 4MY9A 8RUCA 4GA8A 4ZODA 2Q3OA 2QCFA 4POCA 4NIRA 2EG6A 1F4AA 3TH6A 1ECEA 1JPDX 3FEQA 3H7UA 4AD1A 3MUCA 5A8NA 1PDZA 2D0HA 1GGOA 3MHGA 1Q6RA 3EWUA 1PWLA 3GDLA 3GD6A 3N17A 4TVCA 5IOBA 4N02A 1DTNA 1FDZA 1NQKA 2XZ7A 5GJNA 2DIJA 2Q01A 2GDUA 4JEJA 3PJTA 3K4WA 3C56A 3BGAA 4K8HA 3LS9A 4DLFA 2NXIA 2YCLB 3GBEA 3F5KA 5IXEA 1ELSA 5I07A 3QH2A 1JDFA 3W22A 1JL8A 1G01A 1J0JA 1DBTA 4UFIA 2J47A 1LOLA 3O8AA 1EEPA 3GU9A 5F2IA 2PP1A 4Z2GA 3KOZA 5I78A 3O05A 4GABA 1NFGA 5FL1A 4LVFA 1WDWA 3B8IA 2PU1A 1KCZA 5DFAA 1BSLA 1XH1A 3GW3A 4PTNA 5C9XA 4OIFA 4W85A 4GGBA 3CHDA 1QPKA 1JAEA 1KV5A 1TE1A 3BVJA 5LHFA 1TJ0A 3LCXA 3AIRA 3U2EA 1TPUA 3VNZA 3NM1A 3GIQA 4DBEA 3KS5A 3P80A 5LGXA 5DY3A 1IWPA 3IUHA 4WJEA 2W63A 5HMSA 3UW6A 3TV8A 3NQGA 1ZCOA 4RX0A 5D32A 2OQYA 3BJFA 5D2TA 6REQA 3QJAA 2J9ZA 3CMJA 3V0UA 1F6YA 1RK5A 4DJEC 5C71A 3GKFA 3SQSA 4ICMA 3MA8A 5FJUA 2PDQA 5AC4A 4B92A 3NXLA 1H49A 1K8XA 2DSWA 2PODA 4ORIA 3C3NA 1IEVA 3NEVA 2DZXA 4PUDA 2UY3A 4Q6JA 3MZNA 3MU7A 2PDLA 1FCVA 1MYRA 2VX6A 4JL1A 4MWAB 1PKYA 1XSJA 3H2FA 2WLZA 3DKLA 3UY8A 2XPKA 3GTHA 2OQLA 1I45A 1U1HA 1YXCA 3B8VA 4W5UA 1F8MA 1KXTA 3DFTA 4FB7A 1JDDA 3NGFA 3N12A 3ME3A 3MBDA 3OGRA 3CL7A 1HO1A 4UQCA 5HUPA 3LX9A 4BQ5A 5AY7A 4XZLX 2QLYA 1EP1A 4A05A 2GVJA 4TVUA 4IPLA 3M16A 4DWSB 1OK4A 3T05A 1E55A 4WSKA 4AQLA 3UZZA 5C0QA 3DKJA 4PTDA 3W1RA 3OO2A 4PRWA 4J2MA 1R3WA 5FSEC 1QCWA 2HBVA 3LERA 4B5SA 2O56A 1BAGA 5A5WA 1OIFA 2PC4A 4KGJA 5DMMA 2YBVA 3OB8A 1XW8A 4S2CA 4H4IA 1G0CA 4GIYA 4GNVA 3KDOA 2PDMA 5L9FA 4K36A 1JCXA 3INPA 2CZVA 1K8CA 2VGBA 2VNCA 3S2NA 2EKCA 4GO8A 5I09A 3KL3A 5HPOA 4Q8NA 4E2VA 1W3JA 1T7LA 3L5MA 1WAUA 1WB0A 3T0BA 1H50A 4KWVA 4CD6A 2QJGA 4PUJA 2ZTKA 1PKNA 3CZ8A 3U9IA 1O5KA 3CBWA 2ZRYA 1W3NA 2HE8A 3DXIA 4JQ2A 3M5VA 3PG8A 3C2FA 2ZRXA 5LIUX 4OT7A 1SM9A 3WDJA 2BY2A 4JTJA 5DMNA 2HE5A 1X97A 4K1WA 3P93A 5DO8A 2R1MA 4AZ7A 3H24A 2O9RA 3M0IA 1OIMA 3GVRA 1GYNA 1L8PA 3W02A 2HMCA 1AL8A 4IUOA 4L9XA 3P5ZA 4W93A 3V35A 3EOOA 3GC5A 2FHBA 3W88A 1W31A 1WDRA 4Q4OA 3IIPA 1PYMA 3W01A 1WXJA 2H3BA 3THDA 2WMFA 1E6NA 1TCDA 3WNNA 5JIWA 2RH9A 3RCYA 5C2GA 4AG0A 2D23A 3L4ZA 1C7TA 5A6TC 1I60A 3DEQA 1XJBA 2XGZA 2DUAA 5LNSA 4WIWA 4WLCA 5XINA 4ML4A 1V77A 2VFIA 3RPMA 1YX1A 1C29A 1KCXA 2ZC1A 1EOKA 1PBGA 4TUFA 4W8BA 3LPFA 3WN6A 3CTTA 1JFHA 3SCSA 5I02A 5BWFA 4OJYA 1DIDA 1KXHA 3ZYZA 4O15A 2ACRA 1G67A 2DFAA 3UJSA 3VNKA 2GVEA 5HWMA 5IFTA 3BG3A 4UFMA 4LC6A 2PTDA 2PDUA 2WJZA 4FMVA 2ABAA 4NAEA 4N4PA 4ZFCA 1YE6A 5HR7A 4GI6A 2H9AA 3UZYA 5CGMA 5E1QA 2Z00A 3QYSA 1G6CA 2DIKA 3LB0A 3TQ0A 3NQVA 5C7VA 1Q63A 4NZJA 5HQLA 1E40A 1PCWA 3KS6A 3VGBA 1XYMA 3OHIA 2XIQA 2J7CA 3RCNA 1JDEA 4ATWA 3NDOA 5BMWA 3DECA 3TX9A 4IF2A 4TTGA 3W7OA 1RUSA 4FXJA 1P1XA 2YCEA 4Z0SA 3UJ2A 4WD0A 2A7RA 3W2UA 3LRKA 1YMYA 3BGGA 3WLPA 4JTGA 3K8LA 1YYAA 3KRSA 4N7QA 1G94A 1EJVC 4UC5A 4KBXA 1CLXA 5KITA 3UJRA 1ALDA 3ITYA 5AHLA 3NM3A 5FJOA 4F9DA 1AW2A 1TQXA 3O06A 1FHDA 4B90A 1TV5A 3LGGA 3W07A 3FVMA 1J11A 2FTPA 4CN6A 3N73A 1K7EA 2PF8A 4GX9A 2Z2AA 1EZWA 4P7OA 4R85A 2FJKA 4WEVX 1DWIM 3NUKA 1TTQA 2VI0A 3W0KA 4HCLA 5D8ZA 3N6JA 3ZIZA 1XXXA 3K8MA 4NZCA 3I6TA 1J6OA 3V1HA 5CZSA 4PSPA 1W9DM 5H2ZA 2F8QA 3OYZA 4ZB2A 4CD8A 2VEPA 1NWTA 2FZ9A 3ISIX 3MS8A 4DJEA 4JTFA 3UXIA 4AZHA 1FWEC 2P5NA 4AHQA 2HK1A 2JE8A 2QCGA 1RAKA 2HV5A 3ITOA 3W83A 2VOTA 4LUSB 1R7AA 1Z8AA 4RL3A 3OVPA 2E8ZA 4FIQA 3QPYA 1YE4A 3AS1A 4R7JA 1H3GA 1UWRA 5D2VA 3BQ5A 4DX3A 3RHGA 2Z6JA 3ZR4A 1HFBA 3LCIA 4X63A 2NLYA 2FGZA 1GVEA 2YFOA 3PPHA 4MADA 4FNPA 1SZGA 2G41A 4BI7A 4EPDC 5D02A 1ZB5A 3GY1A 4CEUC 1W9XA 3C2OA 3CUZA 1G4SA 4UTHA 2F61A 5CLTA 4GH3A 5AYXA 3I3DA 1OD8A 3FV9A 2XGBA 1X1NA 2VXNA 4XD6A 3EWWA 2PB1A 4ROQA 4CCZA 5AC8A 2V5DA 4QS5A 3Q4DA 3OBAA 4LGXA 4TXEA 4NI8A 4GHRA 3N9RA 2Y63A 3QMRA 1RCOB 2ISFA 1EQPA 1ICSA 1V6UA 3SECA 2DV0A 3W7LA 4C1NA 4YVPA 2CWXA 5HQEA 1D3HA 3FXGA 4B5XA 3LTSA 2PWUA 3WFLA 3NFUA 1C90A 1VC4A 3V5OA 4W7WA 2FGLA 4H8UA 2O7SA 4Z17A 3EX6A 1O7AA 2PDKA 1I2RA 2PRHA 2A79A 4QE4A 1EO7A 3VIPA 3CMGA 1EYWA 1ECQA 1IV8A 1PXGA 3AMDA 3UQNA 1GOWA 3LV5A 2XVKA 5EA9A 3QPEA 1E1CB 2ZX8A 4Z2HA 4MB4A 3VX1A 2BFGA 2W91A 2V81A 4W7UA 3FGCA 3E0LA 2J79A 2QUMA 1L0PA 4ZOAA 4C7DA 2NV2A 2O4MA 1UR4A 2XISA 3NGJA 1Z7AA 2B0MA 4M3PA 1QI3A 1CXEA 3VVGA 4AF0B 4TQTA 5FESA 3TN4A 1E73M 2C6QA 5EBAA 2OSYA 1F7BA 1FFRA 4DXVA 4NG3A 3SDOA 5HXMA 3N4FA 3R0UA 1H11A 2OWCA 1X1ZA 1OQFA 2ZCGA 1VRXA 2YL5A 2J8TA 3PTMA 4LXFA 4NJIA 3AMCA 3FVDA 3BLLA 3G8RA 4EXQA 3RR4A 4Z2LA 2CCRA 4PL2A 1GYLA 2WCAA 1TMQA 1W9UA 2EQDA 4LFYA 3IACA 4X22A 4HP5A 4JTQA 3ARUA 5F1VA 1P7TA 4BWLC 5BU9A 3PAOA 3L7RA 2Y6ZA 4DWDA 1RJPA 5FJJA 3GM8A 1GZJA 4DF0A 3DAQA 4O19A 4B4HA 2W9MA 1AUSL 4LUJA 5HNUA 2E1WA 2QT3A 3TIMA 2GJNA 2PDFA 4N42A 4LB4A 4L4PA 1OB0A 1EIBA 2BS9A 2HNHA 5FF3A 1H0IA 3TZFA 4J3SA 3G0XA 4DF1A 2C13A 4ZBCA 3CASA 2OKOA 1J18A 5K9DA 3AUJA 3D47A 4A22A 5ABFA 1TWIA 3LM7A 3TW9A 3UGRA 5CBJA 1IT8A 1WOBA 3BC9A 4X9SA 4R53A 4H1ZA 4CQDA 2PWHA 3THUA 1GEHA 2J77A 1TPH1 3P2VA 5E09A 3ZO9A 2BY3A 4CD7A 4Z1BA 1LRQA 1VRDA 4TX8A 2PP3A 3C2YA 4KRZA 3PSWA 3T78A 4NI3A 2OEJA 3HB9A 4RW5A 3EMCA 7ENLA 2W3ZA 1D7KA 5M5DA 1Q6CA 1B30A 3BLIA 4O8RA 3A6OA 4CQ9A 3B9NA 5F4SA 1JCYA 3RLHA 3R89A 3AYTA 1LORA 4DIAA 1LLOA 3CT7A 1TJ2A 3O6YX 3UR8A 1WCGA 4PMOA 3EOEA 4DYJA 3RK8A 1GONA 2X40A 4RDZA 2WMKA 4Z1YA 1TG7A 3AALA 4NSBA 4LAUA 2TODA 3CUJA 4HBKA 2B7OA 4AVNA 4MWAD 4AYGA 3M0XA 3QC3A 3W82A 5AN7A 2G0WA 1S1RA 4LEQA 4C6LA 3W7QA 1M01A 1LT7A 3AXHA 1JPHA 3EDEA 4OUIA 3EPNA 4JGDA 2SFPA 3NG3A 1DE6A 6CGTA 4QJ1A 2HXUA 3WBYA 1IF2A 2INFA 3FKKA 1UCWA 3I6EA 4DWSD 1X96A 1IQ8A 3BL3A 1OCQA 3OVRA 1HW6A 1UP3A 5FAGA 5CZTA 2V0TA 5U4NA 1KFWA 4M6PA 2GSHA 2DZTA 1NM9A 3AXKA 3L12A 1XR2A 1SW3A 4CUCA 1TRIA 2EJ1A 3WLSA 1C8VA 6XIAA 3PTDA 3KVJA 2YDSA 2OLAA 4ZVJA 1P48A 1SW0A 1W9VA 4XSLA 1ZZMA 1ONXA 5FL0A 1W1A1 1X7IA 2X1SA 1UZDA 4U3CA 2HK0A 4NKCA 3VDHA 2WO5A 1REQA 2H8XA 2PC8A 2ASHA 1Q6LA 2IQ0A 3CZKA 4M5PA 4W8AA 4UQ9A 3TWBA 4DF2A 3DFOA 4PMZA 2AL2A 2DORA 4U3AA 4TTUA 1B90A 8A3HA 1NJJA 1JCNA 4MJZA 4GYJA 1LQ2A 1R38A 5JBFA 1RLCL 5HUOA 3CGTA 5BXPA 1AA1B 3QZEA 1KFBA 4UTFA 2QZRA 2DH3A 1E9LA 1UJQA 3IUDA 4GQQA 5CZKA 5LIWX 1J12A 3KBWA 3KLLA 4QEHA 4A3UA 4CCEA 1ISYA 4CNSA 1R2RA 4MGGA 3CZJA 1UASA 4D6JA 1IZCA 3QKZA 5TD4A 1EDGA 2WQPA 3EBVA 2W27A 1QW8A 1B3XA 2QDEA 3WF1A 1RJQA 4FEZA 3KZSA 4R7OA 1JD7A 2NUYA 1GUVA 1OT1A 1X6UA 3GFZA 1UPPA 3E5PA 1PX8A 4QSHA 5CSYA 2WSQA 1PVNA 4HCHA 4DBWA 3CHEA 1LQAA 3Q65A 2CHNA 4LUIA 5DF0A 1ISZA 1R3TA 4JN6A 5FSDC 3WL0A 1XLHA 1GOMA 3OOQA 3A4WA 3KBJA 4ML9A 3GE7A 4P8WA 4V1YA 5CBIA 2QMKA 4LV9A 2I14A 2HISA 2WMIB 2X41A 3KE0A 1N55A 4JQ1A 1RPKA 5ABEA 3WQCA 3EAUA 3PTKA 1YTEA 2CZFA 4UNIA 1V3LA 4AMCA 4H2HA 1F3XA 3RGTA 2FPVA 1GCYA 2PCEA 1LTDA 4IL2A 1EPVA 4N6EA 1IGSA 2GJLA 1V79A 5SWUA 3VKCA 2PE4A 3R8GA 3PK7A 5RUBA 4U4MA 2JEPA 4FNRA 4RK8A 1F05A 2BY0A 1H5VA 4RE0A 3W76A 3TFXA 1P6CA 2V5CA 2A3HA 5HANA 3UNTA 1POKA 6ENLA 3DOPA 3L67A 2NSOA 4G7EA 1OEPA 3WBEA 2WSKA 3OZYA 3HQPA 1XKJA 1VFUA 3QBUA 1TVLA 3P61A 4PRRA 3S47A 3V3WA 1Q13A 3VC5A 3LQGA 1X1OA 1Z69A 4D71A 1NFPA 4ATDA 5BXRA 4KT2A 2WOQA 3CIWA 4NY2A 1W8GA 2O4QA 4XD4A 4K68A 4BQ4A 1G4EA 3WSUA 5HDRA 3APGA 3ELFA 4H6RA 3W1PA 1FWIC 4J3WA 3A23A 4KGLA 1QOPA 2PDYA 2V5JA 3STEA 3AS2A 4ZO8A 1EA0A 1ZPTA 3OBEA 3H2NA 4PSRA 1V0NA 2UY4A 1H2JA 3OIXA 2YZ5A 1CGUA 3FHAA 3LZ5A 3N4EA 4J2PA 1PIGA 3ITGA 3TYDA 3G24A 4GBUA 1EA9C 4PBGA 4Q22A 4DY1A 1K4HA 4RXFA 3TJXA 5FF7A 2VM8A 1AMYA 3BXWA 2XTKA 3I4KA 3IJ8A 2Y8UA 4WY0A 4J9JA 1JIBA 2V5BA 1ZGDA 4TMCA 3TYCA 4IMCA 3E0FA 4I7VA 3AZSA 5JH1A 4IH3A 5FEWA 4JX6A 3HQOA 5BYWA 1W5MA 1AD1A 2R1NA 1W1B1 3E74A 4DZAA 3TTQA 4GXPA 3AIQA 3W1LA 4HHMA 4KEMA 2REQA 4Z2JA 1SZRA 3CPRA 4IFRA 1QT1A 5J5RA 4MY1A 1A5NC 4B2DD 4NF7A 3ZVIA 2QUNA 3TCSA 1HKWA 1QWKA 4NRRA 1XF0A 4GJIA 1NDZA 1MDLA 2WVUA 4H6KA 3M0HA 1HX0A 1F61A 3GNRA 1V3KA 1LLZA 2FLIA 4NZ3A 4WVXA 3GG0A 3ZJ8A 1FBAA 3KCOA 3WQOA 2WWDA 2OZ0A 1B54A 1WV2A 2Y88A 3TW6A 4RV8A 1RA0A 3EYPA 1KNWA 4D72A 3UYIA 4DBDA 3OZOA 3RITA 4Z42C 1WZAA 2PD9A 3WH5A 1TV8A 3VIFA 4QQUA 1CLKA 1RR2A 3TE9A 2WNNA 1HL2A 2D2JA 1XI3A 3MKKA 3TVAA 4C6NA 1TKKA 3PBVA 4IFKB 3QEZA 3M46A 4L80A 3LBOA 1CYGA 3SUUA 2OX1A 1M65A 3S3GA 3LTPA 3RFAA 4H9UA 4J3ZA 4PBFA 1LG2A 3AYSA 5BXSA 3ABOA 4OBRA 5BNKA 6PTDA 2B7NA 1HZYA 2ZUNA 3AC0A 2QQ6A 1T0OA 1PTGA 4V33A 4OBSA 4AWSA 2RGMA 2PS2A 3RCMA 4UQEA 4HZ6A 3ES8A 1QPQA 3H4WA 3NQFA 2YL9A 4YIWA 1F73A 4Q6XA 1IEWA 2G3JA 4B15A 3C86A 3EX3A 3AWNA 4NZ4A 3F4WA 2CLMA 3VZYA 1DORA 4Y9OA 2R1LA 4QLJA 3P8JA 3II1A 2PWGA 4I3GA 2ZC8A 7TAAA 5CC5A 3SUTA 3G3MA 4UQAA 3AS0A 1TR9A 1VP5A 4I5XA 4HYWA 5HA7A 2ZRWA 1JPKA 4W86A 4S38A 1UZ1A 2IKGA 4GX8A 4JIIX 1KM0A 3GVQA 4URIA 3OPSA 3P0WA 2Z26A 1YADA 4XIAA 3DDMA 1N8FA 3LHUA 4IIHA 1LOQA 3VGFA 3DC0A 2PA6A 3ZOAA 3MSRA 2G37A 2PWDA 1EJ7L 4L1XA 3M0VA 1SSDA 2Y7FA 4HCDA 2PDGA 3CQJA 4CN1A 1XCFA 3H4GA 4N9CA 1Q8AA 2JF7A 3NIYA 3VKKA 3W00A 3P5YA 1TA3A 1NOUA 5CPQA 3VNYA 2QR6A 1ITXA 2WVVB 4E4FA 2FKPA 4KCUA 2P53A 5AZ1A 2WHKA 4WX2A 4MAZA 2CWNA 2Z1XA 3WIJA 3N2TA 2CITA 2HNEA 3RLUA 2F6XA 2GGHA 1XIGA 2C18A 4HPJA 4Q7BA 4QROA 1L6YA 1HKIA 3B4YA 1R30A 3EEZA 3IS4A 1W91A 2BXYA 3WLNA 3PZ9A 4GQRA 1FWWA 1H51A 1QU4A 4HIBA 3TLLA 4MNJA 2XH0A 3W1AA 4I5UA 1H63A 3DHUA 1XL9A 2OO0A 3EOLA 3AYRA 4KWWA 3GK0A 4FO4A 3I7QA 1XLCA 1DPMA 4GY7A 1OY0A 4KH2A 3B3DA 3T4WA 1ITQA 2ZIDA 1WXYA 1MEHA 3LYEA 4HMDA 1H62A 4JZ5A 3RMEA 4TMBA 5JBEA 3B9DA 3TJ4A 2I7GA 3MO7A 1Q6OA 4R34A 4LY8A 1NF0A 4LQ1A 1XX1A 1VKFA 2OGYA 5E93A 3MCOA 4Q32A 3L23A 3WLTA 4JNZA 3E0WA 5G2HA 2WWCA 4C6CA 2GGIA 3IRDA 5LA2A 4AWEA 4GI8A 3TSDA 1KM4A 1O94A 2CU0A 3WMBA 5CZ0A 4ZTYA 1V5XA 1E1EA 4FNSA 4Q8WA 1VPQA 2R14A 3OLDA 4EE9A 3NA8A 2ZE0A 3RX4A 2VEIA 3B9AA 2OLHA 1Q6GA 1KRAC 1DV7A 4GY1A 2G3NA 1VBUA 3O2LA 1R3RA 3LSBA 1YPIA 7REQA 4EAMA 2OQHA 1CZ1A 4HSNA 2FZBA 3APYA 1YQ2A 3MSYA 2MANA 4DZ5A 1RD6A 4GZJA 3GYEA 1S2AA 1GVYA 4GY0A 4HNCA 1ZRQA 3KRBA 2PEVA 1UR2A 2OYKA 3UVAA 3ZZ1A 2GJRA 1BKSA 4W89A 4Z1CA 3TTYA 1V6XA 4LBSA 2A6LA 1TPEA 2X30A 4A2SA 2ABBA 4MG4A 3GR8A 4H3DA 2VC5A 3UG8A 4DO5A 1FCQA 1Y5WA 4FP1A 3CWHA 1XM3A 3UA4A 4EWND 2Q3RA 4O1EA 4LANA 1Q3NA 2RFGA 4JTIA 2WKLA 2X05A 3PANA 4JR5A 1W0MA 1W5NA 4GVHA 3SCPA 4YYCA 2TYSA 4Q4MA 3BMVA 2I5QA 3TUUA 3WF3A 2CERA 4PFHA 3NSNA 4M6UA 1VBRA 1DVJA 4IJCA 1TVPA 3XINA 1XV8A 3B0YA 5A6BD 4MIMA 2V2DA 4XO6A 3W70A 4ZO6A 4AFYA 4O57A 1H7PA 1XRVA 1GW1A 4M82A 2Z28A 3EB3A 1YKWA 4LUYA 2QIIA 3CH9A 2Y8KA 3VGEA 4GINA 3BSHA 4A8RA 1KXVA 2BP1A 3S2MA 1NQ6A 1PTAA 3UWVA 4IGHA 2WZIA 1ZP3A 3LCHA 4DBSA 3M0KA 4MLJA 1W5PA 1XLGA 3WNPA 5BMXA 1DIKA 1D2KA 1ZAJA 3TFCA 1LL7A 4DELA 2YB1A 3GUGA 2O9TA 5CSSA 2POTA 2XDFA 4ZXLA 2JIWA 2AMGA 1PZ1A 4NJKA 3WH9A 4DPQA 4XAFA 4DI9A 1FHLA 3PJWA 1K7XA 5C7HA 5DY2A 4B3LA 3DBNA 3G3DA 3W1MA 1JG9A 2J7BA 4M6VA 3LEPA 1GVQA 3CHCA 2CKSA 1Y5XA 3NQDA 3BARA 4O52A 3VTRA 2DZBA 1QO2A 1TTJA 1AVAA 4A2RA 4S3AA 3THCA 4O1AA 1LRNA 3W7CA 2Y5JA 3EWDA 1UMLA 2BZNA 3V7PA 3BW4A 2OO6A 3OP2A 4US6A 4H7VA 5I3KA 1MNZA 2E25A 1F74A 4XUGA 3KOYA 1S46A 1JZ4A 5I3GA 1KCKA 5FJTA 3M0YA 1A0CA 1K8ZA 5H91A 3BDKA 3LCLA 2FMNA 5BCAA 4JICA 2Y5EA 4W9TA 4NT0A 3HGJA 3QY8A 2ZA2A 4O28A 3N4AA 4OHQA 3SRKA 2Y7DA 3WELA 4QISA 1BVWA 3E2SA 4HU0A 4MNKA 1SZEA 1R46A 4W7VA 3TC7A 3T2QA 4ENLA 2BG5A 3GNPA 1OG6A 2QCMA 2V8ZA 3F03K 2E6AA 1Q6DA 2NXGA 3BOXA 4LALA 3QV9A 2WB5A 3A4XA 3MJYA 4DEFA 8TIMA 3VCCA 3SCTA 1BRLB 2X7WA 1JUKA 2VENA 3G1SA 1UIOA 1SJBA 4QRNA 3NQ8A 3KVLA 1FQ0A 4M81A 2Z2BA 3TJLA 2C71A 5FKYA 1TJ1A 4AEFA 4QM1A 5D9PA 3UETA 2VC7A 3BMWA 1ZJHA 5DCDA 1FKWA 3CLWA 2G97A 1JUBA 2YXOA 2CBUA 4QAWA 1KBLA 2ALDA 5DRIA 3H4XA 4OBTA 3YPIA 2D73A 3E12A 3WFAA 3REQB 4CQBA 1EB3A 1FWDC 4GIAA 1J4EA 4WJ8A 4FX8A 3G0SA 4UB9A 3N15A 1ZUAX 4JCLA 1V7AA 3IK2A 5F4XA 4ATLA 4ZQPA 1JCTA 1O68A 1VD6A 1XLAA 2ZRUA 3WBXA 3K4AA 2GSJA 4RZ5A 3EX1A 3AIVA 3WLRA 3CL8A 4F2BA 3G8EA 1LQ0A 3ARVA 3AICA 3GTIA 1DXEA 4BS0A 2X16A 5HMEA 3E9AA 2GSEA 4X3ZA 2PTXA 4P2VA 3LPOA 5J8LA 2PZ0A 3SURA 3VMOA 1HJUA 5DBUA 2IPFA 4L9ZA 3UPBA 1DWGM 1MWOA 1VBGA 4AD4A 1DP0A 4YTQA 4ES4A 2ZX7A 3L0NA 4FLRA 1EQCA 3U7VA 3KVMA 4F0RA 1QNPA 4W84A 4MNLA 3WLKX 1OX4A 2CXEA 1DHKA 1ZAHA 2DVUA 1KV8A 3B8SA 3QOKA 5AHMA 3MI3A 4UOJA 2ZZ4A 4F66A 2E67A 3CUIA 3T2PA 4ERAA 4GC4A 3W4RA 3W72A 3H7VA 3DFPA 1N82A 1C8YA 4UTMA 5BOEA 2ATSA 3MBFA 1RVGA 3P3BA 1LT8A 4FNUA 1MZHA 4IIBA 4MZ1A 3R11A 5KETA 3LENA 3PZVA 2GOUA 4XAYA 3M5ZA 1TELA 1UHVA 4HNOA 1LYXA 1Z32X 3GXFA 4PCFA 1I8JA 4ZL1A 6A3HA 2QXWA 1LBMA 1W5QA 3COTA 3NAVA 4LAMA 4CU7A 2HXTA 4M1BA 1YPFA 2J7GA 2J8GA 2WM0A 5GNYA 1RA5A 4E8GA 4ADUA 1XLEA 1PV8A 4S1FA 2VRKA 3S1UA 4A29A 4CVUA 4W87A 2YFNA 3SM0A 4Y96A 3I65A 2WJFA 1S5TA 4S2BA 1EFZA 1BYCA 3UA3A 1L2QA 5TBOA 4E0CA 3USBA 2A3EA 3AU2A 3ZJ6A 3BSGA 3WDQA 4C6KA 3RO6A 3VMPA 3M7SA 1A80A 3S6DA 3OLGA 4IPJA 5AHIA 2FTYA 3I10A 2CBJA 1XFCA 3UWWA 2ZXQA 3WFZA 4DAFA 2VWTA 2XM2A 4PE8A 1SJCA 3GTXA 5H8PA 1P6WA 1UR1A 2WJEA 3SR7A 4XV0A 1FX6A 1L8NA 3E5BA 3NOEA 3FA5A 3WBWA 5DCEA 3WLLA 3TQPA 4EPKA 2XIIA 1WX0A 1QVBA 1GJPA 1T8QA 3EDDA 3N9KA 3T7VA 4JIEA 1XYBA 1E0XA 1P4CA 4F0KA 1ZBVA 2Q09A 5CC3A 3PBYA 5D05A 3FAXA 5F2GA 6REQB 5HWNA 4K37A 4UR9A 3WO8A 1PL9A 4TU1A 3SUVA 3WY1A 1O95A 3I3EA 5F4WA 1EC8A 4RPQA 2HPMA 3BLDA 3N13A 3GKAA 4WHBA 4KETA 1V3JA 1VBJA 4CQCA 3C2RA 4O0QA 4HU8A 3SADA 1C3FA 4Q8MA 1VFFA 4CNPA 2VCCA 2DZAA 1DWAM 3SFWA 4JS3A 4Z2KA 3FYPA 3SN0A 3CK5A 4JTEA 1UH4A 4BZYA 3W7PA 3KAOA 2V6AA 3W7EA 1SFLA 1KB3A 3F4CA 1BLIA 4PUWA 2W5FA 2I16A 3AMGA 4JIHA 1JGMA 4OQVA 2EPNA 5K7JA 1HL8A 3ARWA 1J0ZA 3VABA 3USZA 3E1F1 1VPYA 4O11A 1HG3A 3P82A 3QZAA 3DFQA 4H2CA 3DN5A 2IQDA 3RG6A 2YLLA 5MKGB 3PHAA 5FOOA 3W1NA 2J78A 4R3UA 1BXNA 3NYZA 3F4DA 4WJXA 4RZBA 4XZIA 4QJ5B 3CPGA 3GHSA 3G1XA 5H6HA 3O6AA 3EMQA 3S8HA 1G7UA 3NDZA 4WQ6A 2XFRA 1EOMA 3EKGA 3P0XA 3NL2A 4RZ6A 4F3HA 4JYEA 2VVSA 3G22A 1WOAA 3ZS4A 3C52A 4O1DA 1WDPA 3IRSA 4ZR8A 3WJYA 1TIMA 2X2GA 3E3HA 4PB4A 4JTTA 2E5CA 2WSYA 1SSGA 1SO5A 1CGTA 4R9XA 4MWAE 4KEZA 4B3KA 3B8UA 1SR0A 3AXIA 1NWSA 4E5TA 2CBIA 3GS6A 3MUAA 1LWHA 2BDQA 5ECUA 3C3UA 1U1JA 4J3VA 1E4MM 4LF2A 4UMBA 5FI8A 3S9IA 1XISA 2Z7GA 4M51A 1QR7A 4KQNA 1J9YA 1ZY9A 3LGEA 2R91A 3UBPC 1XG4A 4NNBA 1SVDA 2GGJA 1GKQA 1XRFA 5A94A 2CESA 1VCGA 1QO5A 4AD2A 1P0BA 1ZJIA 2NT1A 4MPKA 4CU8A 3MYPA 2WCSA 4LCRA 2RDUA 1UH2A 4PMJA 1GPWA 3WDHA 1EWEA 2PDBA 1GTHA 1OCNA 4O0ZA 2TSYA 4MPQA 1XLDA 1DXFA 2QIWA 1TZ9A 4EIVA 1ITUA 5J5DA 3CWOX 3NNTA 2FZ8A 4HU4A 3HFYA 5A3HA 3HPSA 3RNDA 2Z25A 3T0AA 4ZOBA 3QF0A 2Z4GA 2WQDA 1FCBA 4GFSA 4HA4A 2WC7A 4LC8A 1HVQA 2DGAA 4ZTXA 5CJMA 1JCLA 3VC6A 3L4UA 1DJGA 3LMZA 1BTCA 3FHQA 4DJDD 2Y0FA 1ODUA 3M64A 3MC5A 2FHCA 3RXZA 1HXJA 3E2RA 1ZFJA 2A3CA 2Y7GA 4E4UA 1OWQA 4KW2A 4GQ0A 3HV8A 2DY3A 3JW7A 4AYSA 3BV4A 3QN3A 4J28A 3S83A 4Q4PA 3M43A 5DX7A 4BR1A 4XZHA 4L61A 1UKTA 3N11A 1OCBA 3MI2A 1G69A 1I2PA 4CCCA 1UKPA 5C2XA 5G2WA 1QI5A 1TMHA 3ARQA 2FB3A 4IJBA 2HCVA 4L4OA 3V4BA 4HMCA 5G1MA 1Q7ZA 2PBOA 3WQFA 4G7FA 3H53A 1OABA 4GYFA 4NAEB 2PU0A 5DRCA 3BQ6A 2J6VA 3K30A 3LBCA 2AKZA 3U4FA 2H9AB 2GGEA 2J25A 4DVOA 1FDJA 2OEKA 2PP0A 1Q7QA 3WJSA 1J79A 4A3HA 3S1GA 4HK6A 4K2SA 3OHMB 2WZMA 3LSCA 2J88A 3EWCA 2GQ9A 5HMFA 3KEHA 3BW3A 2Y85A 4GJ1A 2WW5A 1L2UA 3W24A 3EDFA 1XLMA 4QE1A 4PUUA 4ONVA 1W2PA 5K4XA 4CVWA 3GX9A 2QW5A 3G2GA 3FJ4A 1BVNP 1IR2A 4AU0A 2E9BA 4O1FA 1K9EA 3B97A 3LRLA 2YYUA 4OE7A 2Z6IA 5CCZA 2NUWA 5I23A 5BRPA 1J0YA 2CNCA 4QGCA 2Q8LA 4HU3A 1XIEA 4B5NA 4ZEPA 1MUWA 1VLIA 4ZQMA 2AQVA 4R9OA 3VE9A 1VR6A 2QGYA 2W66A 2X0SA 3IJIA 2NQHA 1DJYA 3CHFA 2W6RA 5CQ1A 2ZUMA 4UBPC 1M7OA 2JQXA 1YDVA 3KFTA 3K5XA 1HKJA 1H0GA 4QQ3A 3EKLA 2FGBA 4HTBA 3WJXA 2D2OA 5D04C 1KTBA 4QDPA 1PTDA 4PBEA 3GRIA 1UWSA 3ANVA 4IP5A 4IPPA 2NX3A 4K39A 2PSNA 3IVTA 4MJ4A 2GFTA 4K6AA 3PBMA 5EMKA 3CQ0A 3MUZ1 3QHOA 3MDWA 1R3SA 3A5VA 4HMNA 4PUMA 3NSMA 1KLZA 3IARA 1BQCA 5A2CA 4Y9PA 4QJ3B 1M5WA 3KBVA 5CPTA 2DZVA 1E70M 3ARZA 1V51A 1V93A 1QATA 2BASA 3RF9A 3GIPA 1PHQA 3W73A 3UCQA 3KDNA 2FVMA 1EJWC 3GH5A 2V82A 2B81A 3T0TA 2F2KA 1EX5A 2ZZ2A 2ZFAA 3HGOA 3NL5A 1KGUA 5I3IA 1KQZA 4JTUA 3OQEA 2QF8A 3PZUA 3BTNA 1JAKA 1D8WA 1AQMA 1AD4A 5JBDA 5BXTA 3AXMA 2AKMA 4XUYA 3SW6A 3BJTA 4EF8A 3SBFA 4ZXOA 4GZEA 1EJXC 2R6OA 3R0DA 1CBGA 2HROA 4REQA 2V69A 3E49A 1SQ7A 5F2LA 4JDBA 1OFRA 1AODA 4JTSA 4MKNA 3MV01 7TIMA 3GR4A 3O1NA 4GACA 4MYAA 4C1NB 4LUTA 3BJSA 1S5WA 3RUBL 3S9ZA 2QCDA 2OT0A 4OTKA 3VM7A 1BHGA 1XG3A 2DVTA 3TROA 1IEQA 3B0PA 1FWSA 5CJNA 1JNDA 3N6QA 4PEEA 2F6UA 4JTRA 3R2GA 4F4RA 3RMJA 1W1PA 3MZ2A 4G6CA 1XBYA 3URQA 1JZ2A 2VC9A 4AISA 1JF6A 1ICQA 4QCEA 2IUZA 1FP8A 1HNYA 4DO7A 4LRTA 3DI1A 3FGCB 2Z0IA 1RY0A 3S1XA 2OSXA 3ZVHB 3VKJA 4BK9A 3OEXA 4PTWA 4AD0A 5EL1A 5IDZA 1HVXA 1EO5A 2ZDRA 3SRFA 4WDWA 1Q6EA 4CNNA 3N04A 2JBMA 3L2MA 4H9YA 1G1YA 3K8KA 4Q4KA 2ZWZA 4UFJA 3MHFA 4X9YA 3M4HA 1Q7MA 4FPSA 5AOUA 1HKKA 3CTLA 1K9FA 3KOWA 3WUBA 3O7UA 4OV9A 4KCWA 2NV1A 5G1YA 5AHEA 3ZMRA 5I7GA 4DB7A 3ZT6A 2EG7A 1SZFA 2XIBA 3ZWSA 4ZA0A 1BEUA 3FLUA 1YIXA 4C5ZA 5I00A 4B2DA 3W2NA 4GC3A 8CGTA 1P7TB 4EXBA 5XIAA 2V5KA 1GWJA 2FH8A 2C1GA 1D7FA 3PPGA 3IAQA 3EB4A 1V02A 5KINA 2XVGA 5BROA 3CNYA 5A8PA 5H8MA 2A21A 5DQPA 1E9IA 3LMYA 2Z29A 2J24A 4HK5A 1RLDA 2PLJA 3S42A 4B9YA 4RCXA 3N2BA 2INEA 5C9RA 1B9BA 3LCWA 3ABQA 1VJZA 3E96A 4PZVA 3KHJA 4M19A 3CU2A 1F2JA 2E4TA 3LHZA 3LA4A 2EF9A 1ONRA 1BXBA 1WZMA 4I8DA 3W26A 4XD3A 1PZ0A 4MB3A 4XZMX 2I5IA 5ABFB 1TYGA 2GJXA 4FF7A 4FF5A 3IVUA 1NTHA 2WNZA 2NX9A 2WMGA 1WKYA 3M0LA 3FYYA 8XIMA 1NOFA 2V2CA 4J4KA 5B7YA 4NX0A 4JY9A 4YWSA 2GWGA 3WEZA 1C8QA 3ANUA 2DU2A 1BG4A 4AB4A 2DW7A 1K77A 5AVHA 3QHNA 4JQ4A 4A6GA 2Z7KA 2YGYA 1VFHA 3ONCA 2BY1A 1KM1A 1EP3A 3A4AA 1XWYA 1OADA 3R8HA 2KAUC 5C2CA 2ZZ7A 1GOXA 4PTXA 1X6LA 4RW3A 3HZ3A 2YJQA 2QAFA 3HURA 4GISA 4N6FA 2BXZA 4GUFA 3VD3A 2DSKA 1FHUA 4UFKA 3RYSA 3BW2A 5D9MA 3SGZA 1QOQA 4DI8A 1F3TA 5BOFA 2VR2A 4PEKA 1YDYA 1P0DA 3W81A 4QHRA 5D37A 3L4WA 3V0SA 2GVYA 4WOQA 1AMKA 3OBKA 3WLMA 2ZRVA 4KERA 3LNPA 3RIKA 4QE5A 4O12A 5M1TA 2VEFA 1QNRA 3H23A 4EACA 4QNEA 2V68A 5C6MA 3V18A 3PUGA 4O1BA 4S39A 1OC6A 4LYRA 4PYSA 3PM6A 3LXCA 1VIWA 3QGAC 1IIHA 1GHRA 2JKPA 3BLEA 4GG9A 3EWZA 3C8FA 1PEZA 3RN6A 2P50A 1KFLA 4H83A 1XC4A 3C8NA 4ILSA 2ZUVA 1OM0A 4UNLA 1VH7A 3SQMA 1D8CA 3WNLA 4K7YA 3NQ6A 1OYBA 1F9CA 4FXSA 1UP2A 1L6FA 1YDOA 4L6DA 2NWSA 1RH9A 4M29A 1GPFA 1MQRA 3A3HA 1D3GA 4GKTA 3NQBA 2J7EA 3EA3A 3C0SA 3IAPA 1JF5A 2FTWA 1TPWA 2Z1VA 2EHHA 3RM4A 4HPHA 4D8AA 1E9ZB 3NYDA 5FEZA 1DYSA 3RR1A 5G4WA 1AQ0A 3HPFA 1REQB 2R8WA 3H21A 4C6DA 3B0XA 3A4JA 4HZMA 4FXRA 4B5WA 2FFCA 4LEFA 2AL2B 3SI9A 5I03A 3WQ8A 1FKXA 3GYCA 3UT0A 3CV2A 3FCPA 2BVYA 1AK5A 3L4VA 3OVGA 4M7SA 1FTXA 2B7PA 3GC2A 2HJPA 2PWEA 1MEIA 3CV1A 4DHGA 1TPVA 1OGSA 3BCJA 3OGSA 4UZUA 4AIEA 4HOXA 3BMXA 3KW3A 2NZLA 4D6FA 4L7ZA 3G1DA 4MDPA 4JFTA 2E1DA 3WLQA 3IGUA 1I2QA 1ZJAA 4GUIA 3TOPA 2CLEA 2QHAA 2OOGA 3GXDA 3J7HA 2G95A 3HFTA 3W74A 1SGJA 2YOCA 4MAVA 4MYXA 2ISDA 4JHZA 1OVDA 3CZEA 1BF2A 1CT5A 3OU8A 3VGDA 3DYMA 4FA3A 3C2VA 2X1IA 4UR7A 4NHVA 4AXNA 4PCTA 3QHMA 3GH7A 2QMJA 5T9CE 1EL3A 4X2PA 4QXIA 2O55A 4DXXA 3BV7A 1EXBA 1QAPA 1P5BA 3UWZA 1UR9A 1XRTA 1UWIA 2PURA 3QTPA 3URBA 2CZ5A 1FDYA 9CGTA 3QLLA 3RRAA 2QVNA 3PZTA 3DI0A 5ECVA 1ONWA 4GQBA 4ECLA 4C6BA 1EJTC 1U83A 1RJRA 4KCTA 1EGMA 2UWFA 3TP4A 3K1GA 1UUMA 2CKRA 2VEKA 2O7QA 3IGSA 2ZXBA 3S0CA 4JBRA 5GNXA 2ZUTA 1QBBA 4FNTA 3TC6A 3SO7A 3E02A 2JGQA 4MFDA 4PR4A 4IL0A 5E9XA 3CUXA 3A12A 4CLMA 4PUEA 3BAXA 2NLIA 4U31A 3QZ6A 4GYPC 3GXIA 4IT1A 4O10A 3T1GA 3BGJA 1KR0A 3EWXA 4G7EB 1DJWA 4UTWC 2ISSA 3G18A 4JTHA 4LS0A 1BQGA 3OLEA 5E70A 5D4YA 1OFOA 4US5A 1Q2SA 7CGTA 2DEPA 2RJGA 3DFYA 3DGRA 1BSIA 2MUCA 4IX0A 2WNQA 4M8UA 1V6WA 1YDNA 2H8ZA 3N19B 3P14A 1V08A 2A5HA 2E3ZA 5A6BA 2VUYA 3GDKA 3AXXA 4C91A 1FUYA 1UKQA 1YHTA 1R47A 2NQLA 4R33A 2ZZ3A 4K1GA 2F6KA 1RBLA 1EJSC 5BW6A 3U2CA 2P0IA 1QW9A 2AGTA 3ZQ9A 3PWIA 2CYGA 5A6SA 1MEWA 2DT0A 4RDYA 4F9JA 4NX5A 1OYCA 1KWGA 1LL6A 5DN1A 3VUPA 1KBBA 2FH6A 3W7NA 5CAHA 2J9YA 4PCSA 4BF5A 5AC5A 3MMDA 1TX0A 3NQ7A 1B3ZA 4RXGA 3W1QA 3IVSA 4ZMGA 4C6EA 1W1YA 4GIRA 4LW7A 4WY0B 2J13A 1O5RA 1TSIA 2WMIA 4DJED 3WL1A 2VMFA 2VZTA 2BVDA 3N2XA 3TTEA 2J6XA 3CQHA 1IWBA 1RK6A 3FXYA 3NL3A 3VD4A 1TJRA 3UYCA 4D6IA 1F76A 1BGGA 1M04A 2REQB 1DJNA 3GFYA 2ACQA 3RU8X 3VA8A 2VD9A 3HQ1A 2E7FA 4FX6M 3U6WA 3T81A 1LROA 1QHZA 3A9BA 3DFSA 5DLCA 1AJ0A 4TVDA 4EF9A 5AKQA 2RAGA 4M0XA 1FWAC 1J10A 1XGDA 2WSRA 4LRSA 4AZ5A 1E5NA 4O4WA 1WUEA 5CAKA 3ATYA 2HDJA 2PWVA 3QGVA 4RJEA 2WC3A 2P1FA 2ZZ5A 2WLYA 5EMYA 3L9CA 3AHYA 1CDGA 4PGLA 4HD5A 1F4HA 1S5VA 4GCXA 3Q2DA 4ZQNA 3CH0A 2DZSA 4PH6A 1TZZA 1AH4A 2VD8A 2G3MA 4CQAA 3V5CA 3JU2A 3GVVA 1OGGA 1KBIA 3ARRA 4YCOA 4JFUA 3TYEA 4C1KA 3N9SA 3I3BA 3POCA 1KFJA 3UWUA 1O4UA 1UD5A 3S5NA 1EJUC 2J66A 3KRZA 3HV9A 4FX7A 1NVMA 5CG0A 4JOMA 1RP9A 4E3VA 1UC4A 2CHRA 4LV4A 1JXJA 2XH4A 4AIBA 3DHFA 1FH9A 3QMSA 2WV8A 4AH7A 2FFIA 1YNPA 3LQLA 3NZPA 1W54A 4RR4A 2WVSA 3EDKA 1DJQA 2HQAA 3SIMA 5CPOA 2BOFX 2JF6A 3TAKA 3B0UX 1UPMB 3M5YA 3CUHA 1SR9A 3OG2A 3PN8A 3ZLFA 4ERGA 2XUCA 4PFMA 5FJPA 4Q8TA 2ZQ0A 1GT8A 3LHWA 3W38A 4PMYA 4GK8A 1S5MA 3L2LA 1EKOA 5C5YA 5LIXX 3IJQA 1ZSXA 3VYLA 4GOAA 1JJKA 1TRDA 5G4EA 1C8XA 1HL9A 1TTPA 3U2ZA 2A4AA 4EPEC 5AC7A 3LD5A 1R8LA 3VCRA 3GG1A 4QEEA 4IZGA 3KTXA 3UZJA 1QI2A 4PMUA 4PN2A 1WZKA 4V2XA 2XWEA 5IBXA 2ESCA 2CPUA 3T08A 1EX1A 4MZ8A 1FCUA 1TPDA 1EC7A 1UH3A 1NDYA 3BURA 1H7XA 4A8NA 2O0TA 3WUGA 4CU6A 2PDJA 4S3CA 5A2BA 2EG8A 4F48A 2IS7A 3B06A 4Z1AA 5K9XA 5TIMA 4FR1A 3U0HA 3O15A 4P7QA 4LYKA 4HN4A 4GVIA 5FEXA 2IKHA 1TA3B 1UD3A 4XZBA 3V16A 1TV2A 1J5TA 2A7NA 3BG9A 4PL1A 1V6TA 1DL3A 1XC6A 2I9UA 1K70A 3CIXA 1NY1A 4HNLA 1XIIA 2F7FA 5D03A 2E8YA 3FIGA 4D2JA 3ZFHA 3KBNA 3W84A 1QBAA 5CJ5A 3HBLA 5ABHA 3L65A 3FJNA 4GYPA 4L65A 5HNRA 1VZWA 4MOZA 2B4GA 3W71A 4HYVA 4UTWA 3TR9A 2GOKA 4MLRA 4QIUA 2RUSA 1DJIA 3LU2A 3DYPA 5D30A 3C2EA 1EUNA 5G5IA 4UTUA 2PLCA 3HJZA 2J7FA 4U33A 1B57A 1ZP4A 1K4GA 3VIHA 4IQDA 3UNDA 4KFNA 3TR2A 3L4YA 4JTLA 3TYZA 3G1HA 3CO8A 3LLXA 7XIMA 3IJ9A 4DUXA 3E2VA 3GHUA 4JTKA 1XCWA 1UUQA 2OZ3A 1UMYA 3N25A 3P67A 1QMLA 1VCVA 2QV5A 3ID7A 5A8MA 3WUFA 1ZTVA 4D1JA 1MVYA 5D38A 2BX7A 2I5GA 2ZVIA 2GUUA 1UBSA 2B7QA 2YCKX 1HN1A 4BY3A 4D6HA 3I4EA 4ZB0A 3WJZA 2GLKA 4O0KA 2CW6A 2DZUA 5HR6A 2BLEA 1B0IA 1XIFA 1PAMA 1VAHA 1E6QM 2XSAA 3TK7A 3PB2A 4M1RA 3E6EA 4N9BA 3TMLA 3GDTA 5B7ZA 3VX0A 3ONBA 4OOZA 4IOTA 4KWOA 4LJ3A 5EU9A 4LYQA 4H8NA 3RRXA 4NAFA 2YL8A 3AROA 7REQB 3MT1A 3W2KA 3GDRA 2WBGA 2QJJA 4AIOA 4JY8A 1FY6A 3IGHX 2IKIA 2QCCA 4QITA 5AYZA 3M5XA 3G77A 1K8YA 4C6IA 5HNTA 3N1AA 2OWWA 2WZEA 3DGBA 3IIXA 2VQTA 1UW9A 3UG3A 3VDAA 1FXQA 4ZSTA 3O3RA 4HYRA 3EKZA 3PUOA 3VNIA 1JD9A 1L6GA 3V1PA 3CAKA 4F0SA 3MUIA 3NZGA 1QI0A 2CIPA 3VILA 4WUIA 1X8CA 2J8FA 5GJPA 3GB6A 1BXCA 4L64A 3CYJA 4HZ8A 2X1TA 3HF3A 1RZMA 4UCGA 3MVTA 4IWWA 4BEUA 1VGAA 4HVXA 3W3OA 3ZSTA 1TCMA 1U1UA 3DU0A 3E38A 1FFQA 3PUEA 3VZZA 2BGSA 1KQYA 5E0FA 2POZA 1E6ZA 3KX6A 4LU0A 1ML1A 1PO9A 5E0CA 3THAA 4UFHA 4K8EA 4Q8QA 2DT2A 3W7RA 2ZUUA 1XYCA 4JYDA 4KWSA 1EEXA 2YA2A 4PULA 4JAWA 5D9NA 2W79A 2C16A 1V8EA 3VCNA 1DQWA 4U10A 1NWUA 4OVXA 4DYEA 4PTVA 1R2TA 3KVKA 3WH7A 2V38A 3CQKA 4HOWA 4W8LA 2H3DA 4FS9A 2YB4A 3QSRA 3G6LA 3RILA 2X0HA 1A5SA 2G96A 4INFA 2FPTA 4QR6A 4B4FA 1E6PA 3WKZA 2ZRZA 9RUBA 2EO7A 4GKLA 5DELA 5AHNA 1U2YA 2Y24A 3THQA 4KIRA 4Z08A 3BAYA 4UMAA 1AW5A 1KM3A 2BGNE 3R6IA 3NURA 4F2UA 2UY5A 2BOEX 3PBWA 3LXAA 1GK8A 1XBVA 5DMLA 1R0MA 2GZXA 3W53A 4QJ4B 4X60A 2ZZ6A 1I2NA 3N3TA 1NOWA 3WDRA 4QG9A 1T41A 4NZ1A 3TKFA 5IDIA 3SN4A 3CAWA 4ZGYA 3R43A 4KIEA 3OIHA 1GNXA 2HPIA 1ADOA 1KGWA 4E6MA 1LM1A 5D2XA 1UD8A 3NQEA 1V3MA 2C8NA 1L6SA 3SQLA 2ISVA 1NU5A 4WGHA 4LX4A 1A5LC 4DJDA 3OG3A 4O1CA 5DCBA 3H55A 5I2UA 3LI0A 4BI6A 3CV6A 4D6DA 1E5JA 4AY7A 2RDWA 2NSXA 4MM1A 2WZTA 3DIPA 2GUYA 3VIMA 3VU2A 1UWQA 5GVJA 2WHMA 2C0HA 5T8GA 3MP4A 1KKOA 3B4UA 3TLQA 1MW3A 3A47A 3UCDA 2A1YA 1M68A 4DUWA 3N6HA 4X0VA 1J01A 4DUVA 4JTDA 1DJXA 3PG9A 1ADSA 1KWKA 2ZUWA 1US0A 4G1NA 2PI6A 2NVAA 4JKMA 3SJNA 2ZYFA 2NVDA 1TPFA 3M6DA 3Q45A 5EFFA 3IANA 4GLEA 3LHVA 3STGA 1ZJBA 3WQ5A 2ODOA 1WZLA 3ZR6A 1S3TC 3W6YA 2DDXA 3MQTA 4DAIA 2V30A 4AC7C 4GI4A 1CX9A 4ZSUA 3MW7A 3OA3A 1MXDA 4CN4A 4E2OA 2O9OA 1E9YB 4DXKA 3UJFA 2C1IA 4DJFC 1Z41A 3PNZA 3AQUA 1BVZA 3SZ8A 2FQIA 1KM5A 4PODA 1XPYA 1TV7A 1LUCB 3GXTA 1YNQA 1OFQA 4L9YA 3U7BA 4DPPA 1US3A 4NXKA 1RPXA 3AHTA 2NQ9A 1XIBA 3HPZA 1O5XA 2FPYA 4IQJA 3OVQA 3GG8A 5CGQA 3RM9A 2D2HA 3H26A 2DJXA 1O1ZA 1FWTA 1ZENA 1RQHA 3NVDA 5D8WA 3NPXA 2VYOA 1GYMA 1FWCC 1E4IA 2BHUA 2C1HA 3W1TA 3M41A 2PDHA 2GQ8A 3FNDA 3MCMA 5CKSA 1S2UA 5CSRA 5F7UA 2RKXA 4DM2A 4O53A 4UXDA 1KC7A 9XIAA 2CLPA 1OX4B 4UR8A 1UIPA 5JXQA 4L6HA 3AHXA 1CXKA 2AAMA 3O6DA 2X8RA 2XGIA 2VX7A 1T8XA 1W3IA 3C0QA 3GDMA 4H7CA 1MQQA 3N2CA 4GVGA 1RD5A 4GJJA 4HHHA 1WKFA 4RDWA 4AZ6A 1FHVA 3U2OA 4G56A 2HZGA 5KSWA 3GH4A 4JTAA 1HP4A 2GJPA 3UXDA 2XG9A 1MDRA 1IGWA 5DEZA 3T07A 3SCWA 4J7RA 3WG6A 5AC6A 1J0KA 1SFJA 4XB3A 1MFVA 1IEIA 1H1NA 2ZBTA 4H9VA 4I8YA 2YBUA 1BRLA 4YPJA 1K9TA 4XKYA 4HQVA 1I6NA 1E51A 1W3LA 1TJPA 1UA3A 4JEQA 3SRHA 2CLHA 1VPXA 4RE4A 2GL5A 4AC1X 2VJXA 2UV8G 4JD4A 1QPNA 4XAGA 1FH7A 4IGMA 2Y70A 1CTNA 4FNQA 1W32A 4RNIA 2DQWA 3OW1A 4PMVA 1CGXA 3FY1A 5HNNA 2W4XA 3EZ4A 4V15A 1FWNA 3EA1A 3UWYA 1LLWA 3UU0A 4D6CA 3IV8A 3WD1A 3BUVA 5I24A 3N18A 3G1AA 3QPZA 4MF4A 1OFDA 2QJNA 1MSSA 4PA8A 1R7OA 4AD3A 1UR3M 1T5AA 4LWWA 1HF6A 1DE5A 2OMAA 4Y6GA 4WOZA 2VFDA 2NVCA 3HA1A 4O4VA 3VO0A 2XSXA 2GDVA 1U22A 1U5VA 2ZUSA 4AUBA 3RM8A 3RLVA 5KEZA 3C0JA 1NDWA 1EXPA 3ABXA 3CL6A 4FLQA 3GTFA 1ZHAA 3EGJA 4E4PA 1JZ3A 3D0CA 3CO4A 3VD7A 3HO8A 3W1XA 1JXKA 2C91A 2OWXA 5A95A 3WH8A 4PRTA 1DWHM 1DTUA 3ALGA 4KRTA 4C6OA 3ALFA 3S5YA 1AH3A 3VOFA 1D3CA 4DNMA 4ICCX 4XBSA 3ZWTA 3STPA 4YHEA 1QNQA 2IPGA 3GNOA 3GZ3A 3CLMA 1E0WA 2JFEX 1YPXA 5EMJA 4L6OA 1R9YA 1BGAA 3CS2A 3T8LA 3LUTA 4U2YA 1HKVA 1YXDA 3L21A 3TNOA 1V3IA 3JUGA 3TZNA 4XKMA 2XHYA 3ARPA 4OWGA 3CIVA 4H9XA 1NDVA 1ZCCA 3TWAA 2BMBA 2CLIA 3S1VA 4RLIA 1GVSA 2QCEA 1UR0A 3S2CA 1JEZA 1CWYA 1EGVA 1YXYA 2XVLA 3IIZA 1EBGA 4WK9A 6TAAA 4QSFA 2W61A 4NJJA 4NZ5A 4R27A 5GPRA 5DANA 4TR9A 4AY1A 1HT6A 5C8BB 1I4NA 4HJFA 1UD2A 4GYKA 3R58A 3URAA 4PUKA 4GXWA 2DP3A 2I1OA 3PPFA 3ENLA 3ITLA 2LLEA 3QV8A 5E0KA 4IIFA 3B04A 3ANYA 1U33A 4C6MA 1M03A 4XZNX 4UOQA 2A3AA 1DEDA 3WK2A 7PTDA 3EMZA 1UOZA 3R5EA 4J40A 2QJMA 4GUJA 1AG1O 4WY0F 3S5OA 3KM8A 3T09A 3P84A 3MSGA 4NUWA 3QFWA 4QNWA 6XIMA 2WM1A 2BOGX 2DPEA 2NXHA 1JZ6A 1E0VA 1X6NA 4JDYA 3VE7A 2CBVA 3PJUA 3CPUA 1E71M 1JPMA 1IT7A 1E56A 4NNCA 4XBKA 4IJRA 3UWEA 1RXOB 3HIJA 3GC4A 3L68A 4D6GA 3SCOA 2BVWA 2E0PA 5CC7A 1OG0A 3PS7A 4AD5A 4RV3A 1PKLA 3PSVA 4AMAA 3HG2A 4DZHA 3UFYA 1DQXA 3D46A 1RSCA 2DSUA 3VIJA 4DJFA 4EK7A 4I6VA 4CEXC 1GKRA 3E2QA 3UEQA 3TCEA 1L6WA 3W6MA 1IR1A 3TNBA 4K38A 4QDMA 4AXKA 3LDVA 4J3UA 3PNUA 1SU5A 2Y89A 2JKEA 3UESA 1V7YA 2ON3A 4N0RA 2X7VA 4A3RA 4YYFA 4O16A 1A5MC 3WNOA 3UPWA 4PMDA 2FVKA 1J2BA 1KBKA 2XN2A 4MB1A 4RNFA 2FYMA 3VIGA 5LA1A 1F6KA 4AZIA 1OSEA 1K6AA 2NWRA 4XG1A 4MB5A 2PWFA 1FWRA 4H8VA 2BVTA 3ARYA 4M24A 1FWFC 1UKSA 4YNGA 4Y9AA 3LZ3A 5FF0A 3S6TA 3WQWA 3UXLA 4NYYA 4C90A 4MHBA 3BLKA 3VAVA 1S39A 3GNNA 3A22A 2E6DA 3VOCA 1W8SA 5MKGA 1S3HA 2QNEA 3DHDA 1XIJA 3K46A 1EZ2A 1XP3A 4HHLA 1MW0A 3D3AA 3MUXA 5D33A 5CPLA 1A3XA 1E3XA 4H9ZA 1KTNA 4NJGA 1RQEA 1XLJA 3VNJA 2ZWYA 4MSSA 3RJXA 1QUMA 1L9WA 5T91A 4C7GA 2OR2A 3PF3A 4GI9A 3W29A 1RVKA 1CNVA 1CXHA 3FAWA 2XM1A 3WYZA 1EHNA 4HPNA 1Q5MA 1GQJA 2WBKA 4JN7A 2GUBA 1XLLA 3KCJA 4FHAA 2EAWA 3SCNA 2Z1SA 2EXOA 3FN9A 4FIRA 1OJXA 1HJSA 5C9WA 5TQLA 5A69A 1JCMP 1D9EA 1KGXA 4FK9A 4XAPA 4AHPA 1A50A 4EAYA 3DH7A 4LVGA 2NQ5A 3QY7A 4KPLA 4OZOA 2WK2A 2IPWA 2VX5A 4LPCA 1A5UA 4HMEA 1UA7A 1WDSA 1IXOA 2H90A 1CI1A 4JIPA 1PHWA 4J3TA 4IM4A 2ATMA 3QSTA 4IICA 1ZL1A 5XIMA 5CSUA 1NP2A 4GUGA 2OSWA 3QR3A 4ZO7A 4MUZA 1IXNA 4JHOA 3BSMA 3VKDA 5I3DA 1EDTA 4LH8A 1MI3A 3CZLA 2HEJA 1RP8A 2DZWA 1KRMA 3QKEA 5AB3A 2J75A 1ISVA 2A85A 3EX4A 3G6MA 4W88A 3JR2A 4IIGA 2WNWA 3S2LA 3NQCA 2IQTA 5H1WA 1DOSA 3AMLA 2B31A 3UY7A 1NP0A 2WSPA 4IMAA 3MMUA 3D3FA 3LCFA 3V36A 3VIKA 2DQXA 1T6MA 3WQ4A 4OFCA 4JQAA 4AZCA 1CENA 5A6MA 3W7HA 2XIOA 1W56A 3TXZA 4L1GA 4H8HA 4P61A 3EOSA 3GQYA 1GJWA 2WANA 1P0NA 3HTWA 3BAIA 2XFFA 4ACYA 4ACZA 3T55A 3TAOA 2JALA 1A53A 1A4LA 1EIXA 1W5OA 2IXVA 4P8VA 2QF7A 5HAOA 3IJ7A 5I3JA 3KTSA 1M7PA 3KOXA 2OEMA 4A21A 5AYBA 3ERPA 3QV7A 3AISA 1TO3A 3T8QA 1E3ZA 4REQB 1W9BM 1C93A 3LTYA 1DXIA 3T0DA 1RALA 4UNKA 1WPCA 5I06A 4YXGA 2PCQA 3V0TA 2VELA 2QJIA 4LUTB 3MANA 4ZOEA 3H2CA 2QCDB 3EWYA 4R7WA 1XH2A 4A3YA 3MYOA 2EPLX 3EXTA 5REQA 1X39A 4UOZA 1H61A 1OC5A 1M1BA 4ZQOA 3EPMA 4JKKA 1TB3A 3JZEA 3LHTA 3BAJA 2RGLA 4BI5A 3FDGA 1PB0A 3ZLHA 9XIMA 2C14A 3GSMA 1A4MA 4Q8UA 4J1OA 3VD5A 2XWDA 2BNJA 4D9PA 1LWJA 3BOLA 3GWQA 1W17A 2HBXA 2VDIA 3ZT5A 2L5HA 3TN3A 3QV6A 3SCVA 1HKMA 4LCSA 3DUGA 2QS8A 4KFPA 1JZ7A 2YCIX 5IM51 1V0MA 1LZOA 7ODCA 1W1VA 3T0CA 1XKYA 4UTKA 2YX0A 3VFCA 2QDHA 4MJMA 4FI4A 4HK7A 1GQNA 4MJ2A 5C9UA 3BLOA 2VP8A 1YTDA 3XISA 2W0UA 5HJLA 4I9TA 4AX7A 3GFXA 1NF7A 2VRQA 2OPJA 4G1KA 1O12A 1KD0A 4ICNA 1UB3A 2DT3A 1KCLA 2XH2A 3HG5A 4IQLA 5EBUA 4LAKA 1AJ2A 4HA0A 5TF0A 1F3WA 3UPMA 1C9WA 3WQVA 3GTNA 3VZXA 3GBDA 2FB2A 2E5BA 4R88A 1B3YA 2Y5SA 2E28A 2D22A 2GK1A 1FWHC 4LBUA 3WD0A 4B16A 4NU7A 3QXBA 3WD2A 3SGGA 1PX3A 3MI6A 3WF4A 3B05A 4DN1A 3H6OA 1ESWA 3WEOA 4IG2A 3LHYA 4OKDA 1A5AA 1G4PA 3SUWA 1VEPA 3R25A 4F40A 5K3VA 3W6LA 2YXXA 2OCZA 2V63A 2WPGA 5G2IA 2P8BA 4E3TA 1W37A 4WXZA 1TE6A 1QJWA 3PY2A 3H2MA 1F8IA 1QHPA 1XFBA 3KWSA 4P7LA 2GJXB 4WDUA 8XIAA 2XJ7A 1KFEA 1OFEA 3M7WA 4C65A 4YTUA 1SFTA 4J5NA 3ZT7A 1VFTA 3P7YA 3UR2A 4EP8C 2AQWA 5GJMA 3NR0A 4D6EA 1HJXA 3U5YA 1R6WA 1J5SA 4BCEA 1JR1A 2XIJA 4UQBA 3R12A 5EMUA 1Q4NX 3TSMA 4U2ZA 3BPWA 5HJXA 2XVPA 2PLMA 2YL6A 4UTLA 4ASTA 3ECQA 4Y8FA 1UYQA 1QASA 1V03A 3ITCA 3ZVHA 1F5ZA 3VD9A 2WKJA 4WDXA 3S1WA 1OD0A 4M56A 2FDMA 5KZMA 1EUAA 2XU2A 2VUNA 4Y9MA 5K9CA 1KXQA 1DHPA 1A5CA 2XH7A 3PZIA 1UP0A 1VLWA 3EPOA 4WGXA 1EWDA 2PTWA 1BFNA 4HPGA 1Z44A 4YTTA 1B9ZA 1PZ2A 1J8VA 1IEXA 3T40A 4N4QA 1YBQA 2CLFA 1KLYA 4UIOA 3MSDA 2X2YA 3QY6A 1X38A 3TW7A 1Z48A 3OYXA 1RBOB 1Q45A 1XQKA 5E9AA 1O6IA 2V9DA 5BRBA 1JFXA 4O50A 4BEQA 5EY5A 1UZ4A 2Y8VA 4BHYA 2CXGA 4XBJA 3ZXWA 5LNUA 5HOSA 3P6LA 1XLBA 5A1AA 3WD3A 4BQ2A 3Q37A 1OT2A 3MO4A 4MZYA 5T9BG 1LBFA 2P8CA 4YLWA 2AGKA 1PE1A 1BWLA 4HA3A 4XZ9A 4ZCWA 3WDIA 3G1RA 3ARTA 1JRCA 2WAGA 4RE3A 2ANUA 2NQJA 2YBTA 2DSVA 2V3FA 1UQYA 3U8GA 1HJQA 3KBSA 5D2WA 3U5UA 3WLJA 3B9EA 3PZQA 4WSJA 1LF1A 1TIWA 3B40A 3GAKA 2ZADA 3PBUA 2QPXA 1K03A 3W25A 3RU6A 4MWAC 2BSLA 4C7FA 4JKLA 2GVGA 3BZGA 3A24A 3F1QA 2XN0A 1EC9A 4PC8A 3WENA 1DWFM 4DZIA 1WDDA 3KOFA 3WCZA 1EP2A 2Q8XA 3SUSA 4ZQCA 5CC6A 3HMJG 1TV3A 3W2LA 5LNRA 2Z1KA 1TZ7A 3U3HA 2R24A 4HNNA 2VZVA 1XQLA 3U48A 1QRQA 1XCXA 4Y7EA 4UCFA 4XWUA 1ADDA 1FVPA 1J93A 4F79A 3GNXA 3AHZA 3HN3A 4BA0A 1DIEA 3TYUA 3LG3A 4DWSC 1XLFA <