2VEPA

Crystal structure of the full length bifunctional enzyme pria
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title The Structure/Function Relationship of a Dual Substrate (Betaalpha)(8)-Isomerase
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 86
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vepA00
4JTFA 1EWEA 5G1TA 4S1FA 4TR9A 3EX2A 3W7RA 4BFAA 4N9EA 4NUWA 4X3ZA 3TC6A 2PCQA 4TX9A 1TV5A 5DY2A 1IIHA 1SZEA 4O17A 1SW0A 3Q37A 4NXKA 3MP3A 4ADTA 3W7LA 2E5DA 2V2HA 3UWQA 4IXXA 1XBXA 2E6DA 4YWIA 5H2ZA 1Q6LA 3TXVA 2H3BA 2CLHA 2CZFA 2ZYFA 4EVZA 5LNSA 1OX5A 3JS3A 3ABOA 2E1DA 4O1CA 3T55A 3MI3A 3YPIA 2PC4A 1K03A 1IXOA 5GVJA 3MBDA 3O6YX 3FA5A 4ICNA 4AAJA 3P74A 2FQIA 1K7EA 5MHBA 3B06A 7TIMA 4MZ1A 3NQ8A 6TIMA 3KAOA 1D3GA 4QJ1A 5ABTA 3GDRA 5F2LA 2ZCGA 3WK0A 4O52A 3G0XA 1W37A 3VCRA 4JX4A 1Q6RA 3CIXA 3GYEA 3W83A 4AVFA 3TK7A 3FYOA 3O06A 5AHFA 1OJXA 1PHQA 1W0MA 1RQEA 3DHFA 3SGZA 4LW7A 3W88A 1SO6A 3F1QA 3TNOA 2Z2UA 3NL3A 1PCWA 4AF0B 1S3HA 4NNBA 2PRMA 3SR7A 2NV1A 2YPIA 3GIYA 1AL7A 4HNUA 5I3JA 1LP6A 1U5JA 1QO5A 5K4XA 2VEMA 2JKEA 4MPQA 3S5YA 5LNRA 1FBAA 1WAUA 1I2QA 5F4WA 3WJYA 4YCPA 3FFSA 5DLCA 3BLFA 1H61A 3LCHA 3UD6A 3P62A 1UBSA 4O53A 3THQA 5SWUA 4CQ9A 3I7RA 3P60A 3NQVA 3NZRA 1TPFA 4JY9A 4NJKA 3TW7A 5TQLA 2Y61A 4UMBA 3M6YA 3NDOA 4H6KA 3C3NA 4GUFA 1T96A 2QCLA 4K36A 2NUYA 1GVSA 1JCMP 3G1DA 4O4VA 3LTSA 3L5AA 2B7NA 1TPEA 3LHUA 4ZZ9A 3TIMA 1NAL1 3HG3A 3GK0A 1G4TA 2WSRA 5BMXA 3C8FA 3PG8A 3MYOA 5FESA 3UWZA 3G1XA 5FEWA 4UTTC 4A2RA 1TCDA 1TRIA 1RR2A 3CIWA 3L2IA 3N2XA 1KLYA 3M5ZA 4HPJA 1O94A 2E6YA 2Z6JA 1WA3A 1KM0A 2W0UA 3RNDA 3W2JA 4RJEA 1F05A 2VFIA 2ZQ0A 3LI1A 3LHTA 4E38A 1PE1A 3UQNA 1PL9A 1ME9A 2ZRZA 3QYQA 3M7WA 5EKYA 3W1TA 3W7MA 3I68A 1YTEA 1TIMA 2ZRXA 1TSIA 1ME7A 5BMWA 1H7OA 3FKRA 3UWUA 2A5HA 4MLJA 5LZLA 3S9YA 3W72A 3SI9A 1QR7A 3I7SA 1X1ZA 4HIBA 4QNEA 5FF2A 3MMTA 4GFSA 3B4UA 1SZGA 5A8GA 1TV8A 4JTEA 4GWEA 2CLLA 3LCXA 1N55A 1LOLA 4DPPA 1VCFA 1TTQA 4UTJA 2RH9A 5C54A 1EUAA 5EPDA 4BI7A 3CU2A 4UFJA 3IVTA 4O8RA 3O07A 3DHDA 4FNRA 3KVJA 1NF0A 2VOMA 1Q6OA 1D9EA 3VFLA 3U6WA 2X1SA 1O95A 3KX6A 3QPYA 3TA6A 2ATSA 3W6YA 4HPXA 1MEWA 3R8RA 1FCBA 3QW4B 3IV3A 3W85A 4A22A 1FWWA 1JCLA 4NJIA 3W2UA 1I4NA 2DJLA 2H90A 4H3DA 3L68A 2QDGA 3M47A 4NX0A 1RQBA 4JTUA 3TE9A 5U4NA 1C29A 4NZFA 4POCA 1NF7A 2KZHA 4WY0A 1X6UA 3NVTA 4N6FA 4PL2A 4QM1A 2V0TA 3WJSA 1A50A 1XUUA 5KZEA 3TV8A 3MJYA 4O0KA 1K02A 4RV8A 3M5YA 4NZJA 4Y8FA 2VEPA 4QISA 2GJNA 2J88A 1TREA 5HJLA 3KRUA 3GLCA 5K9DA 4JXCA 1SW7A 4M6PA 1TPH1 4OBTA 2JGQA 4IWWA 5G5IA 4CCDA 1AL8A 2WNZA 4UTIA 3RFAA 4JICA 3ZS4A 3W1XA 2FPTA 3PWAA 3UZ5A 1OF6A 3G1HA 4O16A 3DXIA 5D33A 4O13A 3OIXA 5CZJA 1T99A 4HT3A 2CW6A 1Q3NA 5I3HA 2A7RA 2NXIA 4N9CA 4FX6M 3MUXA 3OG3A 2BSLA 3TQ0A 4AWSA 3EXSA 2ZFAA 3G8EA 1OYBA 1FCVA 2VELA 1ADOA 4LV4A 2XN1A 3NQ6A 3Q2DA 5CZSA 1JRBA 2VFHA 3UXDA 2QJGA 4IMDA 4PEKA 2ISVA 1JCJA 3B8DA 3TX9A 1EIXA 5F1UA 2GQAA 4I7WA 1TPB1 1IIGA 3DZ1A 2QEZA 5CZTA 1YDNA 1F2JA 4O19A 3NL6A 3T78A 4RX0A 4FHAA 3BGJA 2VEIA 1VYRA 5FEPA 4R33A 1XXXA 1C8VA 3LRKA 1YXYA 5HWMA 3LGEA 1GWJA 4DF1A 3ZR4A 5I3KA 1VHCA 2HSAA 3TJLA 1IGSA 1F5ZA 5F2GA 4QNWA 4YL2A 3PBUA 2B7QA 1HFBA 2RHGA 3P84A 4MYXA 1XM3A 3L66A 3DFSA 4JR5A 1FUYA 4EOUA 2B7PA 4Q33A 3SSJA 1AW5A 3W76A 5HNRA 1B57A 1R2RA 3HG4A 3W87A 4ML9A 3W7EA 5F4SA 1YPFA 4WZHA 3DU0A 2FB3A 1PV8A 1VYSX 2VENA 3DKJA 5FI8A 3TSMA 4XQ6A 3STEA 2GVGA 2O7SA 4PFMA 3W1PA 3Q58A 2C1HA 4MZYA 4M19A 4RZ5A 4R34A 2ISSA 3INPA 3NL2A 4AHQA 1NVMA 3W86A 3U8GA 2YXGA 4LC8A 1F6PA 4UTLA 1HUVA 4UTUA 2TSYA 5I3FA 3L5MA 5HUPA 5KTLA 2PURA 4KWWA 2FFCA 3LDVA 2DZTA 2YW3A 1GVFA 1EX5A 1L6WA 4IOTA 1XI3A 3NR0A 3GVGA 2BZNA 4W9TA 4LS1A 3P61A 4JYFA 3AJXA 4DF2A 2Q8LA 1PCKA 3V1PA 1RZMA 3H54A 1RVGA 3NZ1A 3C56A 1H60A 3WJWA 4AXKA 2EAWA 5E0KA 2ZZ4A 3IIXA 4WD0A 4O18A 1DQWA 3N19B 3DKLA 2X1UA 3W75A 2V5LA 4JTJA 1BTMA 3BGGA 3HJZA 6ALDA 1B4EA 4ORIA 5EMUA 3TFCA 1RD5A 3S42A 4UTTA 3NNTA 5D2TA 2AQWA 3UY8A 2TMDA 4U4MA 1I45A 4P61A 1J2WA 3LBMA 2R14A 4Z0JA 3W1RA 1EWDA 1IXQA 4Q4KA 4FNUA 2V2DA 2ZRWA 1FWNA 3CC1A 2QKFA 1KM3A 2ABBA 1KTNA 3LRLA 5K7JA 1O4UA 3W7JA 3FJ6A 1S5TA 3LCFA 3W1QA 1YPIA 1K7FA 4MYAA 4WQ6A 3ZFHA 1W8SA 1LBMA 3W1LA 4LRTA 2X1RA 2VXNA 4RKAA 3P81A 4JD4A 2I9EA 3S1WA 4KFPA 1EB3A 4JTTA 2CLEA 1QOPA 1OFDA 5D38A 4LNYA 2FDSA 5A5WA 1KV8A 4RXGA 2FLIA 1Y0EA 5AC8A 3GDMA 4GBUA 4JIPA 3MWAA 3BV4A 1KM6A 5LKYA 1KFCA 3BK0A 3IGUA 3BVJA 3S8HA 1O5KA 1E51A 2TRSA 3PUEA 5HMSA 1VLWA 5TIMA 3CT7A 1G69A 5CPOA 3TAOA 4Z1AA 3VI2A 4OU1A 4LVAA 3MP5A 4BI5A 3GKAA 1ICSA 1SQ7A 1LRTA 1DHPA 1P0NA 2ZZ1A 3G18A 5DBTA 3W7CA 3QMRA 1KM5A 3EWWA 5EY5A 1QMLA 3TJXA 5CGQA 3QMSA 2CLKA 3NYZA 3PC0A 5TBOA 2JKAA 3N73A 3E02A 5BNKA 3OHIA 4ZQMA 4XKYB 4XWUA 2ZRYA 3S1XA 4K7YA 4Y90A 2OX1A 2FJKA 5KINA 4EIVA 5D09A 3MO7A 3TCEA 5D2WA 3NOEA 1ICPA 1WXJA 2R94A 4ZQOA 2CZDA 5HWJA 4N6EA 1DL3A 4ZMGA 2D73A 3L21A 1LDCA 1LOSA 4AB4A 1TQJA 1GPWA 2Y88A 4Z0SA 4Z1DA 4K6AA 3JR2A 2ZZ3A 4NU7A 2RDUA 2QJIA 3LB0A 4AWUA 3CEPA 4ZL1A 4BR1A 3T40A 1KW1A 1JCNA 2YSWA 3C52A 1MZHA 2J9ZA 4UTWC 2ZA2A 2V9DA 2CWNA 3NPVA 1K8XA 3HMJG 4NVTA 4OE7A 5CPNA 5EL1A 1OK4A 3A23A 5DCEA 2GVLA 4I9AA 4PH6A 5D32A 3W2KA 2G96A 4DO5A 4PODA 4RZ4A 3GXPA 3G1YA 3PR2A 4K38A 4M7TA 4FIQA 1R2SA 3W2LA 1XCFA 2H8ZA 4ZQCA 3F4NA 1MO0A 1KBJA 1SPQA 2Y7GA 3GDLA 1TPUA 1XC4A 5AYXA 2A4AA 4JTSA 1QAPA 3W07A 3NQFA 1OFBA 1JVNA 3KFTA 2QDHA 1KTBA 4HKPA 1ZCOA 4YLWA 4UCGA 4GRSA 2Z6IA 3TMQA 4TO8A 5BOOA 3G1AA 1GOXA 1PS9A 2CZEA 1VLIA 1SSDA 1H7WA 1L9WA 1AG1O 1TTIA 3O15A 3GZ3A 3MHGA 2Y70A 2I1OA 1L6YA 5E93A 1JCXA 1TPWA 4QSHA 2QR6A 1FDYA 4RK8A 4HSOA 4NJHA 3STGA 4BF9A 2V8ZA 3FJLA 3HGJA 4XKYA 3EX1A 5LNWA 4O1DA 4LRSA 4UFMA 4XTDA 5C6MA 3NQCA 3KVKA 4UR7A 4H4IA 3M16A 1WYIA 3CWNA 3BLEA 1GEQA 1OYCA 3QPZA 4X22A 1P0KA 1VHNA 2VFDA 3W1NA 4O15A 1T8XA 2P1FA 1VJIA 1JULA 1SSGA 2OT1A 1I2OA 3EX6A 1WBJA 3FKKA 1JCYA 1NSJA 3DGRA 1QCWA 1L6SA 3LM7A 3IVUA 3TQVA 5FF7A 3NQEA 5AYYA 2VFGA 5KZMA 1QDSA 4IUOA 3G0SA 3TW6A 4E2BA 1W5MA 3MBFA 2QCMA 4M6VA 4S2CA 1KM2A 3ZWTA 4GUJA 3P8IA 4LUJA 3E9AA 3SY5A 1ZFJA 1KLZA 3K30A 3LRMA 3T44A 4EF9A 3LCGA 5CPMA 3HPZA 4PC8A 2VFFA 4QITA 3RLVA 4IMCA 4CNOA 4DBEA 3L65A 3N2MA 3IIOA 3HOJA 3R89A 3GXNA 3L67A 5LSMA 2NWSA 3DI1A 1BWKA 2VFEA 1W3NA 2NX1A 3QFEA 2WNQA 1EEPA 2QJHA 3W7IA 4CQAA 3TSBA 1TV7A 2YZRA 3HF3A 3TKFA 4AF0A 3L9CA 1M6JA 1GG0A 3FIGA 4KWVA 1SO4A 8TIMA 3CWOX 1DQXA 4I7VA 1ZALA 2JK2A 1X1OA 3IGSA 3IEBA 4C1KA 1EUNA 4NQ1A 3NPWA 4EWND 2J9XA 1ZAIA 5IBXA 1GG1A 3A24A 3PAJA 3W7OA 1P1XA 3W71A 3S5NA 1I2PA 4JTGA 1F6KA 1LLZA 2O7QA 3T7VA 3SW6A 4CQ8A 1GVRA 4ZQNA 4GUHA 1MXSA 4JTHA 2DZSA 3HQ1A 2ZDRA 1Z42A 4XUGA 2XFWA 1OK6A 3G8RA 3B05A 3SIZA 5AHLA 1K7XA 1VS1A 4S2BA 2PRLA 5K2ZA 1YXDA 4IMGA 1K8YA 5D05A 5T26A 4FF7A 3RF9A 1GJPA 3U2OA 4OQVA 4WXYA 3TAKA 1I2NA 3LLFA 1I8JA 3UPWA 4IPJA 1ZY9A 2YYUA 1LZOA 3EXRA 1QPRA 4LVFA 3LI0A 1XDLA 3QZEA 2FB2A 1HL2A 3CM4A 1JRCA 3W70A 3G3MA 1G4PA 4K8EA 3TC7A 3UPBA 3KVMA 3UWVA 2Q3OA 4IMEA 3BW4A 4UXDA 1J5TA 5KITA 2J27A 2JBMA 3LHWA 5AHMA 4ALDA 4KKXA 4O4WA 1K3UA 1X8FA 4GUGA 2C16A 1FY6A 3TR2A 1FQ0A 3UY7A 1QFEA 4L4MA 2TPSA 5HR6A 4O28A 4MIMA 2YGYA 1DV7A 1ME8A 4HNNA 3UWWA 2YR1A 1TRDA 3CLMA 4Y96A 1F7BA 1SFJA 1F76A 2C19A 2PE4A 3C2EA 3EX4A 3IVSA 1F74A 2HS6A 2A2IA 5D37A 4DO6A 2WSQA 1H7RA 3O05A 2GQ8A 1ZJIA 4UTWA 4A29A 4C1LA 4MJMA 4M5PA 4MOZA 3W7DA 3M9YA 2PRHA 4AEOA 4ADUA 1THFD 3QQ1A 3MW7A 2A21A 5K4ZA 1Z41A 4DELA 2YYTA 4LVDA 3TH6A 4BI6A 3MI2A 4A2SA 1AK5A 1ALDA 2C18A 2DZWA 1A5CA 1T0OA 1MSSA 4UC5A 5AN7A 1LBFA 1GTHA 4CLMA 2QUVA 5DCDA 3WJZA 3L0NA 5AHNA 1TPDA 5E1QA 5H91A 2DJXA 2WNNA 3ATZA 2OCZA 3QM3A 3NQDA 2YFOA 2E09A 4JX6A 3DFQA 2RKXA 2V5BA 4I7UA 4LWWA 1H5YA 2ISWA 2V2CA 1H1ZA 1GYNA 1Q45A 3PBWA 3HIJA 2EGZA 2C0AA 3OA3A 3BPWA 1W3IA 2R8WA 3G24A 1B3OA 3N14A 4NJGA 4NXSA 3R2GA 1W31A 1OFEA 1QNVA 3ABSA 5D2VA 2J9YA 3MHUA 3P8JA 1OFRA 2GPTA 4K7VA 4LOCA 3W23A 3NL5A 3W2NA 3F03K 4N4QA 3THAA 5DN1A 3O1NA 5FEXA 2E77A 4AHOA 4O1AA 4CCCA 1G7UA 2C14A 3CEUA 1LCOA 2QCDB 3LTYA 3G1SA 1CI1A 3H55A 4MFEA 2A6LA 4JN6A 3A21A 3KXQA 3G3DA 3G1FA 2WV8A 1B4KA 3LCLA 1WV2A 3GDKA 1EA0A 4FX8A 1PIIA 1KA9F 3O6DA 5AB3A 1VCGA 2A85A 2I14A 2YW4A 3BG3A 2B7OA 4WUIA 3USBA 2A1YA 5AFDA 2WKJA 5CKSA 4IX0A 2P0OA 4FNPA 2FPYA 3PB2A 3ANYA 4GXMA 1UCWA 4N2YA 3SJ3A 2BXVA 2WQPA 3QJAA 3LHYA 1FXQA 1XBVA 1G6CA 5F1VA 3W74A 4O50A 2IQTA 1LORA 1TPVA 2GOUA 3GDTA 4RLIA 3BG9A 5D02A 3C6CA 3W7QA 4UNKA 4K37A 3IGXA 1G7VA 1EPXA 2ATMA 1YTDA 3KRZA 1LLWA 3MHFA 2LLEA 1H62A 5DELA 1W54A 2OJPA 1KFEA 1QOQA 3C0JA 2WSYA 2X2GA 4XZ9A 2DZUA 1LOQA 1O5XA 3O16A 1LRQA 5K9XA 1ZENA 3S1UA 1WDWA 4TIMA 5FF0A 1JJKA 4IGHA 4MVAA 3LLDA 2DU2A 4PTNA 3A5VA 3VE9A 1LTDA 2NV2A 5D30A 1L2UA 2FPVA 2X1TA 5IBXC 3LXBA 1FDJA 2XN0A 1OFPA 1ICQA 1N7KA 3E0IA 3RK8A 4ADSA 4HN4A 4UIOA 2RDWA 2TYSA 3LXAA 1KTCA 2ZA1A 4RR4A 3W84A 3LV5A 3M41A 1A5BA 3RLUA 5C2XA 4JTIA 3BLIA 2GJLA 3FS2A 3GR7A 1ZAHA 1A53A 1P4CA 4FIRA 4O1BA 3LCIA 4MZ8A 2YDAA 4O14A 4OHQA 1KFKA 4JDYA 3P67A 1H1YA 2DZXA 3KRSA 3W7NA 2QCEA 2NUXA 3MP4A 1YDVA 3GB6A 4JTKA 5I3IA 5K3VA 3NAVA 4UMAA 2E68A 1AW2A 3NM1A 3CB8A 3O8AA 3EKZA 2B4GA 2DP3A 4JNMA 4FEZA 2ZZ2A 1DKWA 3M5VA 1SO5A 3UNDA 3L0KA 3C61A 1RQHA 2Y85A 3LX9A 4AMAA 5LNVA 4JDBA 4KFNA 1LROA 2ZRVA 2CLIA 4Z1CA 3LOTA 4U28A 2CLOA 1H63A 2DZPA 1KV5A 1SU5A 3W7HA 4FNSA 4PCFA 3DFPA 3PVFA 1AW1A 3G22A 4E2DA 1HTIA 4QQ3A 4EF8A 3EKLA 4MY9A 4ONVA 1SFLA 5G1YA 2B0MA 1M5WA 2NX3A 1LBLA 1OF8A 3P5ZA 4MY8A 5CG7A 2V30A 3L5LA 4NNAA 3N9SA 4UR8A 3HPSA 1SZNA 3QW3A 2ABAA 1UJPA 4IPIA 3IIZA 1TJPA 1DORA 1WQ5A 1XBZA 3NQ2A 4HNTA 3AO0A 1SZFA 5AC7A 1SO3A 4XBSA 3KOFA 2X16A 1VR6A 3DENA 4B5NA 1OX4B 4IX2A 1WOBA 3NQAA 5LHFA 2FTPA 2EHHA 2W6RA 4HSNA 1QPQA 4DXVA 3MI6A 4GC4A 3MYPA 4JS3A 4UTMA 3LCWA 2X30A 1VZWA 2F7FA 4YMZA 1Z48A 1VPXA 2G95A 1UASA 5D2YA 1U83A 3CHVA 1A5SA 3UXAA 4ZQRA 1W56A 2C6QA 3P80A 2DZVA 4UFLA 1H51A 1XKYA 3SZ8A 5J5DA 2NXGA 3NQ7A 4TMBA 3GR8A 2A7NA 1GTEA 1P5BA 3EWZA 3S1VA 2Q3RA 2J6XA 4M7SA 3BO9A 1KM1A 3HG5A 3SFKA 1WBHA 1EP3A 3BW3A 3TSDA 1OFAA 2AAMA 1TB3A 2VC6A 1ZAJA 4LVBA 2C15A 4N9BA 1J4EA 4O12A 3WK3A 5LGZA 2OMAA 3GNNA 5F4XA 3N34A 4IXHA 3TDFA 3QC3A 5F2IA 1N8FA 3C2RA 4RXFA 1LYXA 4XBKA 3C4UA 2QCCA 4O57A 3E96A 4JY8A 2V82A 1CX9A 1QWGA 4LUIA 3FLUA 5AC6A 1OFOA 1EP1A 3HGOA 2BWGA 4TU1A 5CZ0A 1VQTA 1DOSA 4LVGA 4FB7A 4E0CA 1YYAA 3N3MA 3WFAA 4LS0A 1AMKA 3R13A 3PSWA 1VGAA 2WPBA 4HNVA 5HUOA 3W1AA 4GJ1A 2P10A 4DF0A 4PL1A 4UNLA 4DEFA 1SR9A 4TMCA 3QH2A 5KZDA 3E12A 4UMCA 1BKSA 5K9CA 2Z1BA 2Y7FA 2A6NA 1R46A 1FCUA 4GNJA 2OT0A 1S5WA 2HMCA 4QIUA 2ZZ7A 2C13A 3PUDA 2YX0A 1R2TA 4Y6GA 4CNPA 2BTMA 5L6UA 1TO3A 3H53A 4Q32A 4ZQPA 3LERA 4AHPA 4MY1A 3HGSA 3EEGA 5C55A 5AOUA 3C2FA 3N9RA 4LT9A 4WY0B 1GZGA 5LGXA 4PA8A 1W1ZA 1KBIA 5G2WA 1OX4A 4MLRA 4DQWA 5J5RA 2EF9A 2V81A 4GUIA 3EWYA 1S5VA 4N9DA 2Y7DA 3IIPA 2WOQA 1SW3A 3CTLA 3E49A 3M1ZA 3VNDA 1SUXA 2QUUA 3TROA 1O60A 4DPQA 4UFIA 2CLMA 3ZWSA 1M7PA 5G4EA 4UFKA 1FDZA 4JYDA 3QEZA 4YCOA 3IRDA 2E6FA 5D04C 3TXZA 4WX2A 3M5XA 4K39A 5DCBA 3BG5A 3C2OA 1WOAA 4DBDA 3QSRA 3TU9A 2Y62A 4AWTA 2WO5A 3W2MA 1TPC1 1FWRA 4D2JA 2ZRUA 4NX5A 3GAKA 1KM4A 3TUUA 3DAQA 1TTJA 3FEMA 2E6AA 1XBYA 3GXTA 4FO4A 3EWUA 3FOKA 3S6DA 1QPNA 1YTKA 3O63A 3TMLA 2W79A 2QAPA 3P5YA 3KHJA 3UYCA 3DI0A 2XN2A 3VE7A 5EBUA 1MEIA 3NGJA 3P7YA 1UB3A 1M7OA 1H7PA 4R53A 1Q6QA 2C3ZA 4GE8A 1JQXA 1JUBA 4BWLC 1OHLA 3EX3A 3R12A 2EKCA 1H50A 5CSSA 1DVJA 4Z08A 4IQLA 1YXCA 3CQ0A 2Q8ZA 4JEQA 5L9FA 1TTPA 1JR1A 1HO4A 5D2XA 5HULA 1MEHA 1QO2A 4M6QA 1YLVA 3HPXA 3LBCA 4WJEA 2QCGA 5IM51 1GVOA 4KFOA 2Y63A 1ML1A 3GX9A 1FWSA 2E5BA 4WXZA 2Z0IA 3M43A 2CU0A 1OX6A 2QUTA 5HQEA 3OBKA 5AHIA 5LNUA 2GQ9A 1TJRA 4N02A 3UZJA 4FNTA 1VCVA 1W5PA 2CFFA 2E5CA 3QSTA 1VYPX 1NEYA 1BWLA 3LHZA 4NJJA 4LY8A 2NXHA 2H6RA 4FXRA 3SECA 1F73A 3ABQA 1OYAA 1I2RA 2VEKA 4FX7A 5DXYA 1ZHAA 3F4WA 1V7YA 2JKPA 3WJXA 3W7GA 2JGYA 1A5AA 3W7KA 1DJNA 2DORA 3B0UX 3HGRA 3CPRA 3I7QA 4ORMA 1FWTA 1UUMA 3NXFA 2NLIA 1VC4A 3ELFA 4O10A 3O6CA 3S5ZA 1OFQA 3DFNA 3HBLA 4OT7A 1H7XA 3QMTA 3W9ZA 3HO8A 5F2MA 3LV6A 3PULA 3GAYA 1IXPA 4O0ZA 3VKJA 3NO5A 1GQNA 1PVNA 4J9JA 1KFJA 2F84A 1R30A 3P82A 4MFDA 1TQXA 4OV9A 4LU0A 2R91A 2NUWA 3L0GA 2CZ5A 1X7FA 2RFGA 4IMFA 3FYPA 5AHEA 5I3GA 1KFLA 1W5QA 3PG9A 3DH7A 5G2HA 4CCEA 4FXSA 1XDMA 3W7PA 3UWYA 1XFBA 4DO4A 1W3TA 4XTIA 4IJBA 1W5OA 4O54A 2HS8A 4MKNA 2CLFA 2QCNA 4Z1BA 3G0UA 1BEUA 3W22A 2QAFA 1GYLA 3W73A 3V75A 4A3UA 2QCFA 4FNQA 4JIQA 1LRNA 1KFBA 2ALDA 4OWGA 3OEXA 3OVRA 1CW2A 1TMHA 3EXTA 3QF0A 3PBVA 1UUOA 3PB0A 2YCEA 2ZZ6A 4R7JA 2HTMA 1C9DA 3HG2A 3PBYA 1GT8A 1IF2A 3TQKA 3RMJA 3S5OA 4LS2A 5CSRA 3NPUA 3GKFA 3R5EA 4G1KA 3C2VA 4JGDA 5HINA 1OABA 1DBTA 3NM3A 2NX9A 3NQGA 1B9BA 1YDOA 2J24A 3DFTA 4QAIA 5DY3A 3PUOA 4OGZA 2ZTKA 5CPLA 4K8HA 5FF3A 2GVJA 3NPXA 4LC6A 3M0ZA 4AH7A 3T4CA 4L4LA 2G97A 3WK1A 1IXNA 3HB9A 2H8XA 5G4WA 2BLEA 3LHVA 3ATYA 4X9SA 3BW2A 2G5WA 3PY2A 3A5FA 2QF7A 1H7NA 2EPHA 4OV4A 4HHPA 1NFBA 4P2VA 5FF4A 1G4EA 2OZ0A 4WOQA 5EYWA 1EP2A 1FXPA 3EWBX 5C5YA 1PHWA 1YADA 2GUUA 2H3DA 4UFHA 2ZZ5A 4YXGA 1GVQA 1ZNNA 2YFNA 5FEZA 2RDTA 1XUZA 4RCXA 1VRDA 1VH7A 4MUZA 3SGUA 3PM6A 3EWXA 4BK9A 2A0NA 4UUIA 2UV8G 3LXCA 5HWNA 3RU6A 4RZ6A 3I65A 3LTPA 1R47A 2A7PA 3EB2A 2ZTJA 3I6RA 2NZLA 2NWRA 2Y89A 1DJQA 4LTSA 5KMYA 5U7SA 3W1UA 4X2RA 2ZBTA 5KSWA 1XL9A 3STFA 4MJZA 3D0CA 4UTKA 2AGKA 3NA8A 1QPOA 3M44A 3NG3A 1RV8A 3NEVA 3STCA 1K8ZA 3PSVA 4NNCA 4LV9A 1RPXA 5G2IA 1G4SA 1JUEA 3NQMA 1V5XA 4JTLA 3GNDA 1W5NA 3G1VA 1HO1A 4NT0A 4WY0F 2FIQA 3TFXA 5AYZA 2Y7EA 2QCDA 1LM1A 4CNNA 1G67A 3OVQA 4ZVJA 4BWLA 5DXXA 2VKZG 3KVLA 4N4PA 2ZA3A 3PF3A 2Y6ZA 3W1MA 2BX7A 1JUKA 3QRHA 3B0VC 4WOZA 3S0CA 5D03A 3B03A 1JQVA 3JRKA 5EA9A 1OVDA 1FCQA 3B0PA 4Y9AA 4JYEA 3A9IA 4O11A 1Z44A 5HR7A 1WX0A 3Q94A 5BW6A 2QCHA 3BARA 1D3HA 3ABRA 5DBUA 1HG3A 1FX6A 3PS7A 3B04A 3A22A 3DBPA 2WJZA 3DFOA 3QQ0A 5LHEA 3W3OA 3WK2A 5BRBA 4A21A 4JX5A 3OVPA 1TYGA 1ONRA 4UTHA 1OG0A 3IIVA
chains in the Genus database with same CATH superfamily
3WLTA 3WH5A 1ZL1A 5G1TA 1W9DM 3AS1A 3W7RA 4I6KA 4N9EA 1FWIC 4OECA 2PCQA 4TX9A 1TV5A 2BG5A 3S3GA 1IIHA 1SW0A 2DT2A 4JQ1A 1W2VA 1VRXA 1XLCA 2E6DA 2Y1HA 4N7QA 2WAGA 2CLHA 4H9MA 4GQGA 4EVZA 5LNSA 5LIWX 5E6ZA 3ABOA 4F79A 5REQB 3L2LA 3T55A 3MI3A 3HJEA 2PC4A 3QR3A 3R8HA 4F3HA 3EA3A 3MBDA 3FA5A 4ICNA 2FQIA 1T41A 3B06A 7TIMA 4JBRA 6TIMA 1D3GA 2UWFA 3O0KA 1EJTC 3UPMA 1W37A 1US0A 3IARA 4B5SA 3WD3A 2F9RA 3QBUA 2WC3A 4R7OA 4FA3A 5AHFA 4IG2B 1Y5VA 1PHQA 1G5AA 3DHFA 4C91A 4DM1A 3VX0A 2Z2UA 3U4FA 4AF0B 1S3HA 1K6WA 2ZUTA 5T9CE 3SR7A 2NV1A 2PDJA 4GG9A 4KF1A 4TUFA 1AL7A 1H3GA 4HNUA 4GJJA 1LP6A 1U5JA 1QO5A 2GSEA 4MPQA 4JIRA 3S5YA 1AZ2A 2CITA 5FJUA 1HL8A 1FBAA 3SM0A 5F4WA 4YCPA 1Q85A 1JCTA 3LCHA 5BRPA 7REQA 5FJRA 4M81A 2QMKA 5SWUA 2KAUC 1U2YA 3IANA 4NJKA 4WLCA 5AZ1A 1LWHA 4H6KA 2QCLA 1TR1A 4B91A 4PMOA 3NO1A 3LTSA 4GPNA 8XIMA 4ZXOA 3LHUA 3PAOA 1J0IA 1NAL1 5PTDA 3BSMA 3HG3A 2X42A 1G4TA 1E0XA 4GIEA 3SB0A 3UWZA 3LEPA 4QLJA 1J0JA 3WBWA 3AFBA 4UTTC 3L4ZA 1TCDA 1RR2A 4YYCA 1KLYA 3NWRA 1AQHA 1UR4A 4Q8NA 3RNDA 3W2JA 2ZQ0A 1BRLA 1R86A 4J2PA 2NVCA 2VTFA 5H8MA 2ZRZA 3AMLA 3ZVIA 4WDTA 3W7MA 2WZHA 1TSIA 3UWUA 4MNKA 1U5HA 4NAFA 3W72A 3VKAA 2XHYA 2REQA 3FXGA 3MMTA 1CXLA 4EPDC 1MDLA 1TV8A 4JTEA 1J0ZA 4R85A 4FLQA 3SAZA 3SQSA 4KS0A 2CLLA 1XGEA 4I6VA 1VFFA 1VCFA 1TTQA 3M64A 4UTJA 1U5VA 1JIBA 2QPSA 1EUAA 2Z7KA 4FNRA 1NF0A 1D9EA 4NSBA 4Q8WA 4W7WA 3E5BA 3UR8A 3CZEA 4ZSTA 4GHRA 5HQLA 2XVKA 2WMJA 4ICCX 3QPYA 4HPXA 1MEWA 2WHJA 3KS5A 3BAIA 1JZ7A 4A22A 4FOUA 1FWWA 3WNLA 2P5NA 4WJXA 3TOPA 3L68A 2ZICA 4GO9A 5CPTA 4HA4A 3M47A 4C6QA 1RQBA 1YDYA 4KETA 1S3TC 3PZQA 4PBFA 1HVXA 2KZHA 3WJSA 4ES4A 5M03A 1W91A 5CPQA 5HJLA 3KRUA 4S23A 4DRSA 4L6OA 5GNYA 1BVNP 1UUQA 3KL5A 4EP8C 4XV0A 3MANA 5HXMA 3E0WA 4PTVA 4IWWA 1AL8A 1CZ1A 1MW3A 2OOFA 4UTIA 3W1XA 3T2QA 3PWAA 3UZXA 3DXIA 5CZJA 4F0LA 3WNKA 3IJQA 4B2DD 2BSLA 3TQ0A 3VIGA 1A4MA 3BURA 2WCGA 4PRRA 3VC5A 4MG4A 3UXDA 4CU6A 4P8UA 4J5NA 4JZ5A 2ISVA 3TX9A 1EIXA 2GQAA 1TX0A 4BA0A 1G01A 4I7WA 4YTUA 4D6JA 2BHUA 4QJ3B 3SADA 4O19A 1KRMA 3H8AA 1D7KA 4WDUA 3BGJA 3MS8A 1VYRA 2MANA 4MB5A 1YE6A 3LRKA 3GC5A 2GJXA 3MB9A 3LGEA 1GWJA 4BJHA 3SJNA 4DUOA 2YKKA 5I3KA 1RBAA 2Z1VA 1SJAA 2CYGA 3LGDA 4QNWA 3AUOA 3ZLHA 3NZPA 2B7QA 1HFBA 3L66A 3DFSA 1FUYA 3B40A 3KBVA 4EOUA 3NQBA 3CAKA 3W76A 3B9EA 4YU1A 1QI5A 3VNZA 4KRUA 3HG4A 3W87A 3Q67A 4EE9A 2FVKA 4H1ZA 1WAWA 1JPMA 1GVIA 3BAXA 2WWDA 4PUEA 3DU0A 2FB3A 1LUCA 4GVFA 2WBGA 5FI8A 2J7FA 4FPSA 4XQ6A 4A3RA 4ERGA 4PFMA 4MZYA 1PZ1A 2PDXA 1Q8JA 4GOAA 1ZRQA 2V3FA 3INPA 4NZ5A 2VRJA 1GVEA 3U8GA 1RVKA 3T0CA 4BF5A 7ENLA 4UTLA 3LU2A 2PURA 4KWWA 3H70A 3KP0A 2I9UA 2E28A 3WUGA 4IOTA 1ITXA 2DIEA 2DIJA 5MKGA 3RR4A 4W9TA 4Z2IA 4HCDA 3P61A 1P0DA 2C71A 4DF2A 1RZMA 3H54A 3NZ1A 1SGJA 3SQMA 4LAKA 2D0HA 2MNRA 2ZZ4A 3C0LA 1DQWA 1LWIA 3DKLA 2X1UA 4BEQA 2GJRA 3TN6A 3BGGA 4ACZB 2VEGA 4ORIA 1QNRA 2XIMA 4LYRA 4UTTA 4IQJA 1TCMA 3NNTA 4Q4SA 2TMDA 1EZWA 4WSKA 2JEPA 1IXQA 5MF5A 4I8YA 4FNUA 3U0HA 2FVMA 3AWNA 2HNHA 1KM3A 2CBJA 3B9OA 3R6IA 3W7JA 3UF9A 1S5TA 3LCFA 1UD6A 3FDKA 3KL0A 1MWOA 3W4RA 1IT0A 1YW1A 4LQ1A 2VXNA 4XUYA 5A6SA 4KFPA 1OFDA 5D38A 4LNYA 2WHLA 2V69A 3N6JA 3PFRA 5A5WA 1DHKA 1PX4A 2D1ZA 3ZLGA 4GBUA 3MWAA 1KM6A 5LKYA 1KFCA 5A6KA 3BK0A 5LIYX 2ZVIA 2TRSA 3PUEA 3B9AA 1G69A 5IDIA 4PMRA 1US2A 3VI2A 4GA8A 3ALGA 1SQ7A 1UOZA 2VQTA 1E15A 5GNZA 3ERPA 4L6DA 4REQA 1KM5A 3EWWA 2PU1A 5CGQA 3G1RA 2O9OA 3II1A 4N0RA 1NJJA 1RY0A 1US3A 1TE1A 3OHIA 4GY0A 1MZRA 3GU1A 4ZQMA 1PYMA 2ZRYA 2FZDA 2YB1A 3S1XA 2RJGA 3AUJA 3ZXWA 3OZYA 4Q6JA 4ZQOA 2D20A 4W8BA 5DX7A 1DL3A 1EGZA 4ZMGA 3L21A 1WDRA 4PCPA 3RPTA 3NUKA 3AIEA 1TQJA 2Y88A 4NZ1A 3TN5A 1JPKA 1OEPA 2V3GA 1XYAA 4HSHA 3BANA 4IL0A 2VHLA 4HPGA 2J77A 1KW1A 1XIIA 1JCNA 3C52A 1BAGA 5J04A 2V9DA 3BJTA 2D24A 4URIA 4XSLA 3EYPA 1XJBA 3TWBA 1OK4A 4QXIA 5AC5A 1H4PA 3TYCA 3JUGA 4JHOA 3BLDA 4UNIA 2G96A 4DO5A 1AD1A 4HGXA 4RZ4A 4RNIA 4H9UA 5I06A 4DN1A 3G1YA 3NURA 4M29A 3GY1A 1AUSL 1ZP4A 3UNTA 1QU4A 3SUVA 1SPQA 3GDLA 1QAPA 1OZQA 3H2OA 3KFTA 2ACQA 2OKOA 5BOEA 3DIPA 1ZCOA 3SSZA 7XIMA 2J62A 3GVVA 5BOOA 2YBUA 3G1AA 2OLSA 1E1FA 1GOXA 2CZEA 4AIEA 1SSDA 3R0KA 1GOWA 3JZUA 4W4QA 1ZP3A 4ZA0A 3MHGA 1V6VA 1EJRC 1OIMA 4MDOA 1L6YA 1VKFA 4QSHA 4RK8A 3M0JA 4U2YA 4HSOA 3STGA 3GG8A 1KR1A 1RH9A 3HGJA 4IP4A 9CGTA 4O1DA 3IJ7A 3ITVA 1B9ZA 4GIAA 1C91A 3U9IA 4BCEA 4YTQA 2F8QA 2CESA 1WYIA 4P7OA 1D2KA 4X22A 2WVTA 4CKQA 3UW6A 4XBJA 1VJIA 1JULA 1EJUC 4GYJA 2YXXA 1I2OA 1NSJA 1XP3A 1F3TA 3LM7A 5DT5A 3IJIA 3TW6A 4A35A 3SUUA 1CT5A 1VIZA 3LBOA 4M80A 1UWRA 4UZSA 3WLSA 3K30A 1A5NC 3LRMA 3LCGA 2OSXA 3CYVA 3BL3A 4QITA 3T0BA 4IMCA 4XIMA 3IIOA 4MWAD 3R89A 5LSMA 1ZSXA 3DI1A 4JTAA 3W6MA 3MSRA 3BMXA 1C8YA 4L9YA 3QFEA 1EXBA 3WEOA 2F61A 3VYLA 1E0WA 4TTUA 3TKFA 3USZA 1KKRA 2DW7A 3UCDA 2CWXA 8TIMA 4PMDA 4Z2GA 4IT1A 5M1TA 3SIMA 4AFYA 2NW0A 1F61A 2WWCA 4YVXA 4NQ1A 1GONA 1PTAA 3E0LA 1QI2A 2D22A 3NPWA 2PDUA 3A4JA 4IPPA 5IBXA 2EXOA 1GG1A 2X09A 3A24A 3PAJA 3VC6A 4OBSA 3UGRA 3S5NA 4JTGA 1F6KA 3T7VA 4IIHA 1H2JA 1VP5A 1CGVA 2BOGX 4C90A 4UQ9A 3G8RA 1K7XA 4J7RA 1EHNA 2PWVA 4KPLA 3B97A 5D9PA 5EFFA 4W8LA 5K2ZA 1TV4A 3MO4A 4IMGA 1K8YA 5D05A 2FGZA 4M0XA 2EQDA 3LLFA 1JPHA 5EGRA 4IPJA 3W6LA 1DXEA 2YYUA 4CNSA 3EXRA 4LVFA 1CECA 3FAXA 1XDLA 3LI0A 1HL2A 1UQYA 3AIWA 1POKA 1R85A 4NZ3A 4ZB0A 3ITGA 4O1FA 4E8DA 4WDXA 3GE7A 1R9ZA 4F8XA 4DI8A 4R5EA 4HK7A 2J27A 4XZMX 5AHMA 1GYMA 4O4WA 1L8PA 1K3UA 3M0MA 2BGQA 3MUAA 3ONCA 4GUGA 4FS9A 4PMZA 3TR2A 2QYGA 5JUVA 1AZ1A 3B0YA 1CLKA 3WIJA 4DJDA 4CEUC 2TPSA 4GGHA 1Q6GA 3BTNA 1DV7A 2BFGA 3UWWA 3MPGA 4G7EB 3AU6A 1P6WA 3H2FA 1EJXC 1SFJA 4JL2A 4DUXA 3ARQA 3C2EA 1DJIA 3XIMA 1V79A 3VOIA 3WDJA 4WF7A 1Q66A 2AKMA 3S2JA 1E6PA 2POZA 1A3WA 5DRIA 5DMLA 3BZGA 1TWZA 3M9YA 3QN3A 4ADUA 3B8UA 3DOPA 3MW7A 2A21A 4BI6A 3TH6A 1AK5A 1A5CA 2A3CA 3FGCA 5JQ9A 2QUVA 2DH2A 4GX9A 1T7LA 5FJOA 5H91A 2WNNA 1BQCA 3ATZA 3CH9A 1UWIA 5GJPA 4JX6A 4HMNA 4RL3A 1H1ZA 1Q45A 1E6ZA 4PBEA 1W3IA 3G24A 3M0IA 4NXSA 5I23A 1VPYA 1W31A 2BASA 3VTRA 1GKRA 2J9YA 3WD4A 3ID7A 3W2NA 1OC6A 1TZ7A 5DN1A 5FEXA 3SQLA 1NP2A 1G7UA 2C14A 4JEJA 4PUWA 2O4QA 3H55A 1V3JA 2CHOA 3ITCA 3G3DA 3DBNA 1WV2A 3DDMA 4V15A 4DO7A 4FX8A 3KTSA 1PIIA 1KA9F 5AB3A 1LF1A 2B7OA 1QHOA 4PMXA 1JD9A 4I90A 3PB2A 2Z7GA 4GXMA 4N2YA 3SJ3A 3E0FA 5A8NA 3QJAA 5BWFA 1FXQA 2Y8UA 3OP2A 3WQVA 3UBPC 2AL1A 3W74A 3CHCA 2OGJA 2IQTA 1LORA 1UH2A 4C6MA 4J3XA 4K37A 3CQHA 1A0EA 4QG9A 1UR8A 3PFMA 1NELA 5DELA 4PZVA 2FHBA 4AVNA 1W54A 3WH9A 3R0UA 1KFEA 1J9YA 2WSYA 3K2GA 1ISZA 3GU9A 1LRQA 1FA2A 1EIBA 5K9XA 4ZTXA 2PEVA 4TVDA 1KBLA 1ZENA 4GCXA 3S1UA 1WDWA 2J7CA 5FF0A 4P5UA 2DU2A 3DYOA 1H09A 3A5VA 2XH7A 1QXLA 5D30A 4FR6A 2X1TA 3UERA 1ZJAA 1QATA 1TELA 1ICQA 3VK5A 1YHTA 1Z89A 3ZJ7A 3H4WA 5AYIA 2ZX9A 4N42A 4RR4A 4PCNA 2GJLA 1ZAHA 1A53A 1K70A 1BXNA 1E70M 3LCIA 4OHQA 1DWAM 4QS6A 2AL2B 3KRSA 1PEZA 4RNHA 1E9YB 2J7DA 3WEZA 4EPKA 2PC8A 4HJFA 3EAUA 4JTKA 5JBEA 4FOJA 4OTKA 2JF7A 3NAVA 1HF6A 1I9CB 3GFXA 2G3JA 3EKZA 4Y8EA 2DP3A 1YBQB 2DSVA 1N2VA 3B4YA 1SO5A 3C61A 5IFPA 1RQHA 4CGTA 2RDXA 1E0UA 3C8NA 4KFNA 3HV9A 4CU8A 4Z1CA 1XIJA 1CB7B 3IAQA 1B30A 2F6KA 2PTYA 2PWGA 1S46A 5CAHA 4ONVA 2IKGA 1M5WA 2NX3A 3UG8A 3VMNA 2DT3A 3P5ZA 3L5LA 3QW3A 3QKZA 5I77A 2VDGA 5AC7A 4CQBA 4H9TA 4ZO9A 2ACSA 1OX4B 4IX2A 2HV5A 5KZ6A 1XF0A 4DAFA 1QPQA 3VIJA 3ZT7A 1BYCA 4JS3A 1VZWA 4LB4A 1UASA 4PB3A 4JFVA 1W56A 4OVXA 1YPXA 3WDIA 1H51A 1XKYA 4DHGA 4DY1A 1TA3A 4OUIA 2P0IA 4F9DA 1P5BA 3KLLA 3H7RA 5A2AA 2J6XA 3WQEA 2J7BA 1TB3A 4TOQA 2C15A 3SCRA 2VX5A 4B3LA 4IXHA 5F2IA 3UGVA 1N8FA 4ZOEA 4RXFA 3O2LA 1K1DA 1LYXA 3N2TA 3QY7A 3T08A 4O57A 4Q6XA 4XZHA 3E96A 2ASHA 2WJDA 1QWGA 3GM8A 1BKHA 3N9KA 1M65A 2BY2A 4LVGA 4E0CA 1BYDA 1YYAA 3R13A 4PL1A 1FHDA 2CNCA 2P3ZA 5HATA 4IM4A 1DJXA 4UMCA 1BKSA 5K9CA 2Y7FA 3TLLA 1UKSA 1FCUA 4GNJA 2OT0A 1S5WA 1OCBA 1JYXA 2F6UA 3GSMA 3CUIA 3CB3A 2OSWA 4AIBA 4Y6GA 2E1WA 4CNPA 3WDPP 3H53A 1GVYA 2NT1A 3LERA 1S2CA 3O0FA 2WJEA 1VJZA 3N9RA 4WKHA 1EQPA 2X7VA 2EG8A 2CBVA 5LIKX 3KOWA 2V81A 2Q8XA 2EO7A 4BQ2A 1PBGA 3M1ZA 4AXNA 2EPOA 3TROA 1O60A 1F9CA 4XAYA 4UFIA 3ZWSA 1FDZA 4JYDA 3C0SA 3QEZA 4V27A 5TNVA 3WQOA 4OIFA 1GZJA 7CGTA 1RCOB 1UG6A 2DUAA 1PKLA 4H00A 4DBDA 3PZGA 2Y62A 2D2OA 5LA0A 1TPC1 1XQLA 4NX5A 2HJPA 2GL5A 1KM4A 3E0VA 3U57A 2ZVRA 2PDQA 1XBYA 3EWUA 2C79A 3FOKA 3VUPA 1YTKA 2JE8A 2W79A 5FSDC 1KCLA 1HKWA 1Y5XA 5EBUA 1MEIA 1R38A 1M7OA 5GJMA 3WF0A 3UEQA 1QHPA 4GE8A 1Q6QA 1Z32X 2O9PA 3MY9A 2Z1WA 3AIUA 1ZLPA 3R12A 3HQPA 2EKCA 1RJRA 1W8GA 3IJ8A 3WX7A 3EMQA 1YXCA 4GNKB 1EDQA 1MEHA 1QO2A 5I07A 1AMYA 1X98A 2PLCA 4FLOA 2QCGA 1W1B1 4G5DA 2VCAA 2Y63A 1UH4A 3CAWA 1I1WA 1ML1A 5FL0A 4M51A 2E5BA 2VM8A 1A0DA 2Z0IA 1V4YA 3M43A 2G37A 5AHIA 3ABZA 2VR5A 4N02A 4FNTA 3SRHA 4GABA 2UBPC 2PS2A 3WNOA 4CNTA 4NJJA 1TIWA 2QVNA 2H6RA 4PR4A 5T8GA 3FVDA 1OYAA 1B3ZA 5CSYA 4FX7A 2WZIA 2E40A 4IFKB 1V7YA 3KHDA 5ABFA 2JKPA 3WJXA 3W7KA 2DORA 1V93A 9XIAA 2EJ1A 3B0UX 3T4WA 4ORMA 5C9UA 4LUSB 3SN0A 2HPIA 1S38A 4L1WA 4O10A 2AMXA 2W92A 1B3XA 1IWPA 1HXJA 2I56A 4Y9PA 2FGBA 3GG1A 3QMTA 2X1IA 3LENA 4US5D 5EMYA 2VGBA 5F2MA 4GIYA 4DWSD 2EJAA 4IUGA 4X0VA 1GQNA 3MSDA 1RCQA 1R30A 4F2BA 3M6DA 3N6QA 3V0UA 2F6XA 1CXKA 4FF5A 2R91A 4XIAA 3L0GA 2CZ5A 2RFGA 3FYPA 5I3GA 1H5VA 3UJFA 1W5QA 2V68A 3C5QA 5G2HA 4FXSA 1XDMA 4PTWA 3W7PA 1NDYA 1ESWA 5GPRA 2DVUA 3UWYA 1MXDA 3I3EA 3NYDA 3D47A 4XTIA 4IJBA 3WLPA 3G0UA 3E6EA 1KCXA 3RXZA 2X0YA 4L1GA 1SJDA 4A3UA 5HQMA 4JIQA 4A8RA 3T09A 1HNYA 2DVTA 3GTNA 5FSEC 3OEXA 1Z8AA 3OVRA 2ONEA 2A3BA 4H01A 2PLJA 2DZBA 1D8WA 2YCEA 2ZZ6A 2BVDA 4PMVA 1O7AA 3REQB 4XG1A 1IF2A 3KWSA 4QDMA 1CGXA 3S5OA 3CGTA 1U1UA 1RBOB 3R5EA 4Q8PA 4G1KA 3C2VA 3VOGA 4KIEA 3R94A 4EAYA 3PN8A 3ENLA 2X7WA 4QCEA 1YDOA 1E6NA 3DFTA 3QLDA 1F8IA 3H2NA 4HMDA 4A6GA 3PUOA 3ITXA 2ZTKA 2UY2A 1OQFA 2YCJA 1RD6A 3H4GA 3GW0A 3H2MA 4AH7A 3T4CA 1T6MA 3RUBL 1BQGA 4L4LA 2G97A 3DYPA 1OWQA 1IXNA 4AZBA 3ZM8A 3VDHA 2H8XA 5G4WA 3LHVA 2QF7A 1H7NA 4ZENA 1NFBA 4TVCA 2PDYA 4V1YA 1IE7C 1EHAA 2OZ0A 5EYWA 1Q63A 2OYKA 3MUCA 3N17A 2D69A 2ZZ5A 3T6CA 5FEZA 2BS9A 2RDTA 5CSUA 3A3WA 2J7EA 4ENLA 4BK9A 3BV7A 4GX8A 2UV8G 3P0XA 3TNBA 2A7PA 1ENUA 5EMLA 4B5WA 3ZSSA 2Z1KA 1NY1A 3AS3A 4MJZA 5BXSA 3CPUA 4KGJA 1F4AA 2ZX6A 3AOFA 5CG0A 1YNPA 1QPOA 4ZOAA 1K8ZA 3PSVA 3M7SA 4AZ5A 3BJSA 4HU3A 4LV9A 5HANA 3PUGA 5G2IA 3NQMA 1UR9A 1V5XA 2WZMA 4D6CA 3C86A 4PGLA 3M0HA 1HO1A 3PZMA 4L64A 1J6PA 4GO8A 3W28A 1JI2A 3NGFA 4XZBA 3WLNA 1G67A 5DXXA 2XH2A 2ZA3A 1RUSA 2Y6ZA 3W1MA 4EKJA 4E2OA 2VR2A 3KS6A 1IWAA 4L4OA 3JRKA 4H6RA 1RLDA 5IOBA 1OVDA 4LAOA 2GWGA 3B0PA 2QVHA 4JYEA 1UOKA 5A1AA 3MT1A 5BW6A 4H9VA 1F3EA 1D3HA 1PPIA 1I1XA 2GDQA 1IEIA 3B04A 3R79A 3LGGA 4AISA 2XG9A 2R82A 4ERAA 1ZBCA 3AIBA 1AJZA 3OVPA 1OG0A 3IIVA 4M82A 4YN5A 2G3NA 3W24A 1FVPA 2XIOA 4NUWA 3TC6A 4RDZA 4CQCA 1UZ4A 4QDWA 3Q37A 2DT0A 3N4EA 3MP3A 4ADTA 1JAKA 4ROQA 2XJ7A 2R1LA 3W7LA 3VFCA 1MQQA 2E5DA 2V2HA 3UWQA 4AYSA 4IXXA 2VCCA 5H2ZA 3QV7A 2H3BA 5IFTA 2QJMA 4H83A 4C6OA 3LA4A 2W67A 2VX7A 2DZAA 3JS3A 2OWCA 4O1CA 4JHMA 5I7GA 3SCPA 4Q8UA 5GVJA 3AIQA 4AZCB 2GGHA 3U2ZA 3DC0A 1MXGA 1ZTVA 4BZYA 5A6BA 4C6PA 5F2LA 4IGNA 3VCRA 3EKGA 4H6QA 3ARTA 1Q6RA 1OIFA 3CIXA 3GYEA 2V5DA 3VCCA 3W83A 3O06A 1O6IA 2P88A 4NF7A 4F4RA 3SGZA 3W88A 3QFWA 3NL3A 5HNTA 4XAGA 4NNBA 4HK5A 3CV7A 2PRMA 2BOEX 4HQVA 3RLHA 3L12A 3VGDA 5ECVA 3V4BA 2JKEA 3GIQA 3VIKA 1UD8A 4B90A 1OG6A 1I2QA 1GKQA 5A6LA 2QXWA 2O92A 1H61A 1TZZA 3QGVA 1TJ0A 3P62A 5I03A 2XTKA 2VCBA 3I7RA 4Q3MA 1DXFA 3NQVA 3NZRA 1XYLA 3VA8A 3VU2A 3ZIZA 4M3PA 2Y61A 4UMBA 3M6YA 3C3NA 3TTOA 2BB0A 2NUYA 3MQTA 1TE6A 2B7NA 1UKPA 4ZZ9A 5A94A 3HA1A 3EBVA 2YLLA 3MYOA 4S3DA 3G1XA 1KQZA 2H9AA 1UZDA 4C6LA 2QPXA 1TRIA 3RO6A 1MQRA 1UJQA 1ONXA 4B5TA 1FHLA 4KT2A 3APGA 3LI1A 3UQNA 2YA0A 3XINA 3GUGA 1AD4A 3SCVA 4H6EA 3CT2A 2ZRXA 4M24A 4D71A 2CKRA 3T0DA 1H7OA 4DIAA 4XVEA 2A5HA 4MLJA 5LZLA 5A6JA 1X1ZA 4HIBA 1XSJA 1ITUA 1UA7A 3B4UA 4P7NA 3GXIA 4P7RA 4C6EA 3LCXA 1N55A 3PTMA 2CC0A 5XIAA 1Z9AA 2RH9A 2PMQA 4BI7A 3CU2A 4UFJA 3DHDA 2IPJA 3VFLA 2ZXDA 3U6WA 3FJ4A 2GJXB 3ORWA 3TA6A 1Y8BA 2IW0A 1V0KA 1G94A 1UH3A 3UXKA 2CCRA 3GVWA 2DUXA 4TX8A 3W2UA 2Z27A 3UVAA 4H3DA 3WUEA 5BOFA 5DEZA 4RUBA 2WNWA 4XD6A 1C29A 4B9ZA 7A3HA 4WY0A 4N6FA 4PL2A 2PP1A 4IIDA 1AVAA 4PUDA 1A50A 5KZEA 3M5YA 4NZJA 4GZEA 2J88A 1TREA 2PTWA 3CQIA 1XYBA 1SW7A 2X05A 4IH3A 4MF4A 1TPH1 1E9LA 2X0HA 3LUTA 3EMZA 3O3RA 4CCDA 2WYSA 3WLMA 4YHGA 3DERA 1AFSA 1UWUA 2VWSA 4JICA 2ZUMA 3ZS4A 2FPTA 3UZ5A 5A6BD 2Y24A 3I10A 5HA7A 1CLVA 3G1HA 3OIXA 3CV6A 3FXYA 3H7VA 2CW6A 1Q3NA 5I3HA 2NXIA 4FX6M 5C9ZA 4PBGA 2ZFAA 2WLZA 2VELA 4LV4A 3NQ6A 4HYRA 2Y5SA 3B3DA 4IPNB 1IEQA 4JNYA 3GXMA 1P7TB 2A3EA 5F1UA 1SVDA 4GIRA 2P50A 4DUVA 5KEZA 1GQIA 2V67A 1F2JA 1DPMA 4S3CA 2DGAA 4EXQA 4FHAA 1DWFM 5FEPA 4ATWA 1DWHM 2XYLA 1XXXA 4FOKA 1XIGA 2PDFA 2XWEA 5HWMA 3B0XA 3IK2A 5EB8A 4S3GA 1IGSA 3PANA 4KWUA 3CZ8A 2VURA 4YL2A 2V63A 3DUGA 5DMMA 3F5JA 2VRKA 2V5KA 4JR5A 4P8VA 3EA2A 1RCXB 2B7PA 4Q33A 4X63A 1BGGA 3CL7A 5HNRA 1B57A 1R2RA 3D3AA 2FZNA 4XD4A 4D1JA 3ONBA 5F4SA 3PP7A 3W7EA 1P43A 2EG6A 1UPPA 2XH0A 1PV8A 1VYSX 1GOKA 2VENA 3DKJA 4D1IA 3E2SA 4CVWA 3STEA 2HXUA 4TQTA 2PD9A 4MWAB 1EC7A 2UY4A 3VIHA 2FFCA 2UY5A 2PTZA 3LDVA 3DCPA 1BFNA 3SCQA 1OGBA 5BYWA 1EX5A 1KWGA 5H1WA 1F8MA 3NR0A 2HE8A 3GVGA 2BZNA 3SRFA 3R4IA 2G50A 4H9XA 3H12A 4JYFA 3WLIA 1Q6DA 5BZAA 1RVGA 4IIFA 4QRNA 4BHYA 3SURA 1L6GA 3RX3A 2XVPA 2EAWA 4O1EA 4LEQA 3AMCA 2VZVA 1S39A 1IEXA 3LZ5A 3WKZA 3RO8A 3CHDA 4FALA 4JTJA 4U3CA 4S38A 4AD3A 3HJZA 1REQB 4DZHA 4KQNA 4RE2A 3KDNA 1LG1A 4JQ4A 4RE4A 4EPBC 5C8BB 3UY8A 4NI3A 4MPKA 1ZBVA 4Q4PA 2J25A 2OSYA 4F2TA 3L4VA 3WQFA 1R3RA 3VX1A 4AZHA 3MSGA 2YCLA 3WMBA 3CO8A 1DWIM 2OLAA 3ZZ1A 2QKFA 1JEZA 2BODX 3KZPA 1XGDA 3KBSA 1O4UA 3R10A 3NSMA 3ARRA 1CBGA 4YTRA 3W1QA 1QK2A 1YPIA 2D2GA 4MYAA 4WQ6A 3ZFHA 1W8SA 2ODOA 3W1LA 4LRTA 1R3WA 2X1RA 2WBKA 4RKAA 1XLEA 2X41A 1UC4A 3MKVA 3ZQ9A 1EYWA 4JTTA 4XAFA 3EOOA 1X97A 1QHZA 1DIOA 4WGHA 4QLKA 4WK9A 5AC8A 3BV4A 2D2JA 4JTQA 1J96A 4Y9OA 2IXUA 2GGGA 3WG6A 3U7BA 4P7LA 2I17A 3POHA 2W63A 4UQBA 4GCAA 1FH9A 3MP5A 4BI5A 3CTTA 1ICSA 3AIVA 1DHPA 2ZZ1A 3G18A 5DBTA 3W7CA 2CXGA 3OB8A 3WLRA 5JMUA 3B9DA 3FSUA 4DZ5A 2VGIA 3VNIA 2JKAA 3T07A 3E02A 3CV1A 3QV9A 4YTSA 3R7MA 3UZWA 1I6NA 5DT7A 5BWAA 2ACUA 3MO7A 4I8DA 5A8MA 3W38A 2O56A 1WXJA 1V8EA 3HU7A 4Y7EA 2D73A 4XO7A 2QT3A 3BAJA 5M2FX 4K6AA 4JCMA 2WJFA 3TVAA 1XPYA 3AXKA 2XINA 2VP8A 1NARA 5FACA 1FKWA 3VNKA 3NPVA 3NCOA 3P0WA 3BAWA 4BF7A 1FWHC 5CPNA 2GGIA 3TOYA 2PWHA 1JPIA 5D32A 4C6JA 4I9MA 1KRBC 3GXPA 2HWGA 3QHNA 4HA0A 1TUFA 2PZ0A 3KLKA 4BEUA 1R2SA 3W2LA 4ZCWA 4UOJA 5DO8A 4IMAA 1GQKA 3GFZA 1KRCC 2Y7GA 3CL8A 2EPKX 1C7SA 2A4AA 4JTSA 3W07A 4Q7IA 1JZ3A 3K4AA 1NU5A 1OFBA 1JVNA 1UR1A 4HCLA 4MNLA 3PNZA 3FAWA 2YLAA 1KTBA 2PGEA 4UCGA 4GRSA 2Z6IA 2D3LA 1LG2A 2WVVA 1HJQA 1OT2A 3R25A 1VLIA 1H7WA 1L9WA 4YWSA 3O15A 1TTIA 2Z25A 3N2CA 1I0DA 5E93A 1JCXA 2QR6A 1UHVA 1EH9A 3RX2A 2V8ZA 1QRQA 2GK1A 5EMJA 3OOQA 3ZR5A 1VFLA 3EX1A 4AIUA 5LNWA 4C65A 4LRSA 4PCTA 1RK5A 4FLRA 3GBDA 1EA9C 5C6MA 3KVKA 3QZAA 1J6OA 3DFHA 4ML4A 2V5CA 1IYXA 3BLEA 1GEQA 3AXIA 1T8XA 2X8RA 3MMDA 1JCYA 3WQPA 4LAMA 4D6FA 3IVUA 2INEA 4G2DA 4KERA 2VFGA 1QDSA 3ES8A 1J0KA 1BXBA 4M6VA 2VGGA 1ONEA 3IPWA 3GYCA 3WQCA 1XYFA 3P8IA 3SY5A 4LCSA 1ZFJA 1N82A 5REQA 4J3UA 4FSAA 4PC8A 2Q02A 3W82A 2YL5A 5HMFA 4ATDA 2VFFA 1E71M 3TN4A 4HU8A 3SRKA 2CEQA 3BE7A 2W91A 3GXNA 3L67A 4GJIA 3IJLA 3CASA 2XZ7A 3FVMA 1BWKA 3HPFA 3AYVA 3VKCA 3FK4A 1KD0A 1SR0A 2NX1A 3N1AA 2WNQA 1W32A 4CQAA 4GMEA 1TV7A 1B54A 3ARXA 3HF3A 4AF0A 3GG7A 3RCMA 1LQAA 3FIGA 3CWOX 2ZUNA 1DQXA 1QI4A 4I7VA 3FJNA 5C2CA 4KIRA 3G6LA 5H8PA 1WXZA 3IGSA 1JNEA 2IKHA 4JPGA 1A5KC 4C1KA 1KXVA 2E9BA 1TJ1A 1HJSA 3M0VA 2FZ9A 3H2AA 1WPCA 1SYTA 3SW6A 2OYMA 4ZQNA 4JTCA 1MXSA 4JTHA 3S2CA 3URQA 3HMCA 3HQ1A 2VO5A 1Z42A 4XUGA 3RCNA 2XFWA 1OK6A 4GK8A 3B05A 5AHLA 1VS1A 5G4HC 1V51A 4RW3A 1V3IA 3I3BA 4V33A 3AIRA 5T26A 1M3UA 3WF4A 4LEFA 3U2OA 1QBBA 4WXYA 1I2NA 1I8JA 1POJA 3UXLA 2E8ZA 1DTNA 2C8NA 1P1MA 1HJVA 1U22A 2FB2A 3QZEA 1XYMA 4D9PA 2FZ8A 3SY1A 3DESA 3G3MA 1I0BA 1QW7A 4KCTA 4W93A 3TC7A 3RYSA 1SJCA 2Q3OA 3TTYA 2UY3A 3BW4A 1J5TA 2OTDA 4PUMA 3B8VA 1X8FA 5FIPA 2OZTA 2GUYA 3GHTA 4R7WA 1FQ0A 4MIMA 2F2KA 2YGYA 1ME8A 5IHRA 1TRDA 4K8GA 4Y96A 1F7BA 1F76A 2C19A 4CD8A 4IICA 3OVGA 3IVSA 1WCGA 3D46A 3T42A 1EO7A 5D37A 6CGTA 3M0LA 2XIJA 1R3YA 2WSQA 2Z24A 4C60A 3GH5A 3A12A 3VKKA 1AJ0A 7PTDA 2XIIA 3OQ8A 1XLJA 4MJMA 4MOZA 2PRHA 1PIFA 1THFD 2XGBA 5TD4A 1Z41A 4DELA 1KQYA 3MI2A 5I6SA 3CUJA 1ALDA 2C18A 1HGYA 1T0OA 1ZPTA 3FEQA 4UC5A 4V1XA 3ITLA 4CLMA 5DCDA 1FWBC 1TPDA 4C6KA 5E1QA 2QIIA 5FAJA 2YFOA 2E09A 3DFQA 1JZ8A 2V5BA 4LWWA 4F0HA 1H5YA 3WBEA 2VGFA 5CEWA 4KESA 4ZO7A 1TMLA 4WKFA 4AZGA 3PBWA 2VOTA 3WH6A 3GD6A 2EGZA 4F0RA 1FFRA 3BPWA 1X38A 2R8WA 3N14A 1AJ2A 4NJGA 1QUMA 1OBAA 4AZ6A 2WPGA 4ZBCA 5B80A 3NZGA 4RPPA 1QNVA 1Z6KA 1OFRA 1XLHA 2GPTA 5BROA 4S3JA 1BHGA 4K7VA 1K6AA 4JNZA 4CCCA 3V0TA 2XUCA 2QCDB 1CI1A 4X61A 4GISA 4JN6A 4D8ZA 2WM1A 2WV8A 4IF2A 1FTXA 3GDKA 1CEOA 1PJ9A 3O6DA 3KTCA 2I14A 3BG3A 3CQJA 3K1DA 4WUIA 4GQBA 2A1YA 5AFDA 2WKJA 5CKSA 4FNPA 3ANYA 1UCWA 2BXVA 1KGUA 1G6CA 1VBGA 5F1VA 1S2WA 4O50A 2QJJA 2GGJA 2GOUA 2VX4A 3BG9A 3KZSA 4GI4A 1ISXA 3DX5A 4GI8A 6TAAA 1NFPA 1WDQA 5EMMA 4HOXA 1A5MC 1EPXA 3KRZA 1LLWA 1C92A 1L0PA 5CLTA 2OJPA 1QOQA 2CLPA 5A2BA 5HPCA 1LOQA 4J35A 1O5XA 1ZJHA 3O16A 1QJWA 2HNEA 3UYIA 1BWVA 2PDLA 1JZ2A 3V0SA 1QNOA 3VE9A 4XZLX 4Z2JA 4GXWA 4QE4A 3P93A 1W2PA 1X6LA 1X8CA 3WLHA 4RZBA 2P3EA 4IPLA 3UG3A 4GVIA 3RK8A 4ADSA 3LXAA 2ZA1A 4TVUA 3W84A 4CD4A 3KEHA 3LV5A 4B4FA 1A5BA 3RLUA 1J11A 2GQ3A 1MFVA 3AXHA 3L4XA 4O1BA 1HJUA 1V3HA 4F0MA 1QW8A 1TA3B 1KFKA 4DM2A 2DZXA 3W7NA 1O5RA 2NUXA 3MWCA 1YDVA 1PUDA 4NASA 2J79A 5I3IA 5I24A 3AZRA 4MMWA 4UMAA 3NM1A 2BVWA 3CB8A 3QOKA 3O8AA 3SRDA 3WLOA 1GOIA 4IZGA 2W4XA 3F5KA 5DMNA 3SDOA 1XSKA 3UNDA 3IUHA 2Y85A 5LNVA 3GO2A 2WCAA 3VOJA 1LROA 4AD4A 2CLIA 3TWAA 4U28A 1AODA 3IWPA 2VZSA 3W7HA 1JXKA 2HQAA 3S2NA 3DFPA 3PVFA 4ACZA 2A3LA 1Q6FA 4QQ3A 4EF8A 4YPJA 3A4AA 4M6UA 4MY9A 1NDWA 5G1YA 1EXPA 4G6CA 4JHZA 1LBLA 1OF8A 4G1NA 2EPLX 4NNAA 2INFA 4C1NB 2D0FA 4UR8A 3PZIA 2DSZA 4RDYA 4RNJA 4PUKA 1HJXA 3SCSA 1G1YA 1XBZA 3GTHA 2PDWA 1V0MA 1DTUA 1GHSA 2FTPA 6XIAA 3MI6A 3NFUA 4UTMA 4WKAA 1ZBKA 4YMZA 3DG3A 3BSHA 4MNMA 3UG4A 3WENA 2G95A 5D2YA 2VL4A 4DJEA 1A5SA 3R1ZA 1JDCA 1M7JA 2C6QA 4JIHA 2J8GA 2X40A 1JI1A 6REQB 1A3HA 4LX4A 2BBFA 4FXJA 3VNJA 3ARSA 3EDDA 2Q3RA 3HG5A 3O7UA 3TSDA 1EP3A 3BW3A 4AC7C 4LVBA 1R87A 2BGSA 3GNNA 4M56A 5CH9A 3GVQA 3C4UA 1JDEA 3UFYA 1C90A 3B8IA 4QSFA 4ATLA 2DUZA 1SZRA 4LUIA 3UA4A 4TU1A 2BWGA 1VQTA 5LIUX 1EQCA 3KOYA 3N3MA 2QUNA 3D5HA 1AMKA 3PSWA 1VGAA 4HNVA 5HUOA 3APTA 4GJ1A 2P10A 3NSXA 1ZCCA 2Y2WA 4UNLA 4DEFA 4TMCA 3QH2A 4E5TA 3E12A 1XV8A 3GZAA 3MTWA 4NY2A 4A8NA 3WQDA 2C13A 3AALA 4CD5A 3PUDA 2IMRA 3SO7A 2BTMA 1NDZA 4G9PA 3NDYA 3F4VA 6A3HA 3W25A 3WDRA 4ZQPA 3HM7A 4MY1A 3HGSA 3AHZA 5C55A 1XIMA 3ISIX 4LT9A 5D9NA 1CENA 1RJQA 2RGMA 1GZGA 1W1ZA 5LA1A 2VDIA 4L5ZA 1ZS2A 1O1HA 4CU7A 3EWYA 1S5VA 4N9DA 2Y7DA 5JU6A 3CTLA 4H2CA 2D2HA 3OZOA 2I7GA 1SUXA 1UZHA 4AEFA 2IS7A 2OQYA 4LGXA 1LQ2A 4UFKA 4NRSA 3LS9A 5JXQA 1ZU8A 5D04C 4X2PA 3TXZA 4WX2A 5CQ1A 1WZLA 3C2OA 3KL3A 3FCPA 4U31A 3DHPA 4Q7NA 3SN1A 1KBKA 3MMUA 5E9AA 2WO5A 2AAAA 5FD0A 2XSXA 3VVGA 1FWRA 3L4UA 2ZRUA 4F0SA 2HXTA 5EBAA 4PYSA 4FO4A 3QYSA 4J3ZA 4UCFA 1DWJM 1JL8A 1QPNA 3FHAA 2XISA 3PWIA 3TMLA 1Q2SA 3GXFA 2QAPA 4E4FA 3P5YA 3KHJA 3VE7A 4AC1X 3NGJA 3P7YA 2B31A 4HB7A 1H7PA 2ON3A 3EPNA 4Q8QA 1FWDC 1XIFA 3A3HA 1OHLA 2FGLA 2XVLA 1H50A 2GOKA 2CETA 3OHMB 3UJEA 4Z08A 4HZ6A 4IQLA 4BQ3A 5FL1A 4GYPC 2Q8ZA 1JR1A 4JQ2A 3CO4A 3GW3A 5D2XA 5HULA 3S4TA 1MQPA 5AZ0A 4MHBA 3IS4A 4JFSA 3EDJA 4WJEA 1GVOA 4KFOA 4ZE5A 3RR1A 4CD7A 1MW2A 2IQ0A 3CMJA 3AYTA 3GX9A 3WLLA 2IXVA 5FA5A 1OADA 4V28A 2CU0A 3QVQA 1CCWB 2GQ9A 1TJRA 1XLGA 4PMYA 3UZJA 4AW7A 3GDBA 2E5CA 3QSTA 1EL3A 1NEYA 4LXFA 3LPFA 5HDRA 3H24A 4XD5A 4GVHA 3Q45A 3SECA 4AY1A 4FK9A 4H04A 3QTPA 1AQFA 4W7VA 1L8NA 1OSEA 2FZMA 2YBVA 4DJED 1FWAC 1ZHAA 2ZE0A 4XAZA 1TUXA 3W7GA 2HEJA 2JGYA 3HFYA 1DJNA 2VMFA 2ZADA 3I7QA 3WQ5A 2HVOA 1FWTA 1NWSA 4O8AA 4ASTA 2NLIA 1XSIA 3ELFA 3S5ZA 1EDGA 1MVYA 4GI6A 3DFNA 3HBLA 4C6NA 1XFCA 1H7XA 5JVLA 3A64A 1SFSA 3GUWA 3VCNA 2QQ6A 3PNUA 5DANA 4Y9MA 5A6AA 2FKPA 4S3BA 1YNQA 1P0BA 3WMLA 1EF3A 4C7DA 4J9JA 3P82A 1KXQA 3RM4A 4DJFC 2A79A 1RAKA 4OBRA 4OV9A 2NUWA 1X7FA 4ZODA 2EKGA 1KFLA 3ITOA 2IUZA 4QHRA 1JXJA 4PSPA 2GSJA 3A6OA 3WZ0E 2HROA 1W5OA 4ZO6A 2HDJA 2HS8A 1CIUA 3ALFA 3W27A 4U3AA 4ZE4A 1M04A 1P6BA 2J4GA 1JZ6A 2QAFA 2PDPA 3UZZA 2QCFA 1JGMA 1LRNA 2ZC1A 4C6CA 3Q4DA 1K4HA 3EXTA 2XZ9A 3GWQA 3I3DA 4FP1A 1FWFC 4MNJA 3AXMA 4XB3A 4R7JA 5DRCA 3UR2A 1C9DA 3HG2A 1RPKA 3AYSA 3PBYA 1QK0A 3TQKA 4L65A 3RRAA 3GKFA 2ESCA 1CXFA 2HVMA 1MI3A 1T40A 1DBTA 2NX9A 3NJ3A 5DY3A 2VZUA 2FYMA 1F3XA 3K8KA 3N12A 3TLQA 2WSPA 3NPXA 2Q09A 3TZNA 1XRTA 3PHAA 2QUMA 2O4MA 4G7EA 1XW8A 3CLWA 1PO9A 3WH7A 1VFHA 5GQBA 1CGYA 1WZMA 5CGMA 5D9OA 4PFHA 3WELA 3UG5A 2PTDA 3WQWA 5FF4A 3TP4A 3NSNA 1EGMA 1EP2A 1FXPA 1TMQA 5C5YA 2TAAA 4IIGA 2H3DA 3UVIA 1GVQA 1JZ5A 1ZNNA 4RCXA 3EEZA 2WMIB 1VH7A 4MUZA 1G9HA 1LL7A 3ZMRA 4HVXA 2A0NA 4LCRA 3GC2A 4RZ6A 3LTPA 1TWDA 3N2BA 1U1JA 3I6RA 5D4YA 1QW9A 2VT0A 2NWRA 5KMYA 4S3EA 5AKQA 3W1UA 3STFA 4H7ZA 3WSUA 3D0CA 1UROA 2VJXA 4QCFA 2A3HA 3R11A 2J74A 1RV8A 3NEVA 3WQ6A 1G4SA 3ZSTA 2OU4A 3WF3A 1FKXA 3F2CA 1W5NA 3UA3A 4B5UA 2FIQA 3TFXA 2NSXA 3H2EA 4NIRA 1X7IA 4HCHA 2FFIA 4GC3A 4UWMA 3KVLA 3U7VA 4N4PA 4EXBA 4GYPA 1FWGC 4PMJA 4CN1A 1EJ7L 2PFHA 4BQ5A 2BX7A 3QRHA 5CXPA 4Q22A 1NQKA 4WOZA 4HMCA 3H4XA 3RRXA 3B03A 1EYEA 4DBUA 1K77A 4FLSA 3UETA 1JGIA 1E43A 1UW9A 4XK2A 2FZBA 3A9IA 4QS5A 3RHGA 1C9WA 4O11A 1Z44A 1VFMA 3Q94A 3T05A 1VBHA 3PZVA 1TWIA 2C1GA 3ABRA 5DBUA 3RJXA 1FX6A 4NP7A 2VI0A 2F2HA 2ZUUA 1XWYA 1MUWA 3W3OA 3GHRA 1W9UA 4S39A 5BRBA 5CC6A 4JX5A 1QNSA 3ZYZA 1TYGA 4UTHA 2YIHA 1IEVA 4LJ3A 4JTFA 2WHKA 4IGSA 2VVSA 1E0VA 4IFOA 4TR9A 3EX2A 4BFAA 4X3ZA 1PX8A 4A8IA 1SZEA 4O17A 1P6CA 3OQEA 3IUDA 4NXKA 2WVSA 4YWIA 1E4NA 4EPEC 3ECQA 3N2OA 1YQ2A 3MUY1 2H9AB 2CZFA 3WLQA 1HN1A 4IIEA 1OX5A 5A2CA 2E1DA 3WO8A 1CGWA 2V38A 3YPIA 1K03A 3H6OA 1IXOA 3IJ6A 5A95A 4AAJA 3P74A 2AL2A 1B3YA 1K7EA 4UBPC 1UYQA 2J7HA 4DJFA 4MZ1A 3T8LA 3NQ8A 1GOQA 3IACA 4QJ1A 5ABTA 3GDRA 1Z3NA 3LSBA 3V1HA 3UZYA 2Z4GA 2PDIA 5FAGA 3W29A 3TK7A 1OC7A 1YBQA 1W0MA 1RQEA 3OGVA 4OFCA 2XH4A 4MSSA 2RAGA 4H8HA 3TNOA 4UZUA 1TZ9A 3QHOA 2Y8VA 1CB2A 3O6AA 1PX3A 1ADSA 3HPAA 3W26A 4ZGYA 3M0YA 3AXXA 2IPGA 3GIYA 1MNZA 3OZPA 1XQKA 5K4XA 1JZ4A 2CHRA 5LNRA 4NI8A 1DQUA 3WEMA 1WAUA 3WJYA 3FFSA 5DLCA 3BLFA 3UD6A 1UBSA 4O53A 3THQA 1MRAA 4IQEA 1XKJA 1KNWA 3P60A 4F2UA 1TPFA 1UIOA 3NTYA 1GHRA 1PXGA 2VQUA 3NDOA 4L7ZA 4PN2A 3EOSA 4K36A 1GVSA 4O4VA 5C9WA 1UD2A 4UB9A 1RJPA 3KCOA 1TPEA 3HQOA 4L9ZA 4UQAA 2WSRA 5BMXA 4RDVA 3LK6A 5FESA 1F3WA 3D3FA 5CC3A 3AQUA 1XX1A 4RE3A 1NQ6A 3VDGA 2W9MA 3L2IA 3N2XA 5HMEA 3M5ZA 3UJ2A 2E6YA 2Z6JA 1KM0A 2W0UA 1R3QA 1F05A 2VFIA 3EB3A 4E38A 4E8CA 1ME9A 3QYQA 4DBWA 4XZNX 3M7WA 4LY4A 1TIMA 3KCLA 1ME7A 4AZIA 3S9YA 3SI9A 3I7SA 1GORA 3S9ZA 1SZGA 3F2DA 1Q2RA 2QGHA 3VD4A 4GWEA 2Z26A 2J47A 3F7JA 4MJ2A 1LOLA 1J01A 1S5NA 5C54A 3THDA 8A3HA 5EPDA 2J8FA 1BF2A 4LH8A 5JBFA 1EO5A 2NQ5A 2XIQA 1Q6OA 3EMCA 3RN6A 2FJUB 4D6HA 3U5YA 3ITYA 2ATSA 3W6YA 4AY7A 1PKNA 1OZMA 4MAZA 4HD5A 3R8RA 1Q6CA 3QW4B 4NJIA 2H90A 2QDGA 3WL1A 4AUBA 4GI9A 4NX0A 3VILA 2YJQA 3S6OA 4CD6A 3VGBA 5U4NA 4ZB2A 5T9BG 5A8PA 4POCA 3W01A 1BYBA 3NVTA 3SFWA 2OFJA 4QM1A 3TN3A 1H41A 3TV8A 2XPKA 3MJYA 4HNOA 4O0KA 2RJHA 1K02A 3E1F1 1XCWA 4HU4A 2VEPA 2GJNA 3TTQA 1JFXA 2JQXA 2ZXBA 3AC0A 3GLCA 5K9DA 4W8AA 3LY0A 3E3HA 3IJDA 3QLLA 2JGQA 1K9FA 2HE5A 1RY8A 5G5IA 3JVAA 2WNZA 2E7FA 1HIZA 3SN4A 3RFAA 2QHAA 4R9OA 1OF6A 4JCLA 2NLYA 2GLKA 4HT3A 4JAWA 3WN6A 2A7RA 3SUSA 4N9CA 1J5SA 3MUXA 3OG3A 2UZ9A 2G3IA 3EXSA 1OYBA 3UR5A 1FCVA 1E3ZA 3GNOA 3S2MA 9XIMA 4D6IA 1ADOA 3Q2DA 2JIEA 5CZSA 1E6SM 1JRBA 1E72M 2VFHA 1ISVA 4PEKA 1UQZA 4HHLA 4HMEA 4KCWA 1XH0A 1IIGA 5DFAA 3BLLA 1IV8A 2HBVA 4PUNA 1YDNA 2QJNA 4R88A 2YDSA 3T78A 4RX0A 2VEIA 4KH2A 3GR4A 4JFTA 4Q8TA 4R33A 1C8VA 4LYKA 2ZOXA 1YXYA 4DF1A 2WMGA 2HSAA 3TJLA 3S83A 4HZMA 1F5ZA 2RHGA 3P84A 4MYXA 2PDMA 1XM3A 2PWDA 1YE4A 3S47A 4A4AA 4Q7BA 3SSJA 5HBFA 3VD7A 1QT1A 1AW5A 2WKGA 2VUYA 1R5YA 4H7VA 4ML9A 2P76A 3VKBA 1YPFA 4OJYA 5C2GA 4HNCA 3KUMA 4DZIA 3TSMA 1A3XA 2GVGA 4K68A 3GXDA 3Q58A 1ELSA 3R43A 4IFKA 4R34A 2ISSA 3NL2A 3P14A 1NVMA 5ABEA 4QR6A 3STPA 2PF8A 2YXGA 1F6PA 4B3KA 1RHCA 1TWSA 4LUSA 2TSYA 4KBXA 1BG4A 3CH0A 2DZTA 2YW3A 2R1MA 5T91A 1XI3A 3I6EA 3MKKA 1V3LA 3GFYA 4LS1A 4NRRA 1XLBA 2I16A 2GVEA 2Q8LA 3GTFA 3VGGA 3RPDA 4EANA 3V16A 3PBGA 3C56A 1H60A 1PKMA 3E5PA 2Y0FA 3WD1A 4WD0A 4O18A 1J12A 4IIBA 3N19B 2BY3A 3W75A 2C7FA 2V5LA 3CIVA 4MADA 1E56A 4KW2A 1VEPA 1B4EA 1HT6A 1LT8A 1E6XM 3TFCA 2PUZA 4WRHA 3IK4A 3S42A 3TCSA 1UKOA 4HPNA 5D8WA 2AQWA 1GUVA 4IFRA 1I45A 4P61A 1J2WA 2DEPA 2R14A 4Z0JA 3VIMA 3PPCA 3W1RA 2OLHA 1R3SA 3THUA 4RE0A 1FWNA 1XH2A 1KTNA 1RALA 1E5JA 4ZO8A 3FJ6A 1DP0A 1LBMA 2Q6ZA 3REQA 2GZXA 3QGAC 3RPMA 2IKJA 3VDBA 2CLEA 1XLLA 1KV8A 4RXGA 2FLIA 3GDMA 1OB0A 3MV11 4W87A 1DJHA 3BLPX 4B5XA 3BVJA 3S8HA 1O5KA 1FRBA 1VLWA 1ODUA 3U5UA 5TIMA 3CT7A 5CPOA 4MJ4A 3UT0A 4Z1AA 4MB4A 4OU1A 1OD8A 2WVVB 4GBDA 3PPFA 1HKJA 2GVYA 3IV8A 4QEHA 4DJDD 4D8AA 3QMRA 1E1CA 1CWYA 3PBMA 1QMLA 1VFOA 3TJXA 1TG7A 5AYBA 2CLKA 3PC0A 3N73A 4XZIA 1UMLA 4XWUA 2BHYA 1B2YA 2PDBA 2OX1A 1WKDA 1LL4A 5KINA 1UR3M 5D09A 1HJWA 4HHHA 3D6NA 3NOEA 3T0AA 1ICPA 2R94A 3W81A 2CZDA 4LAZA 3DG6A 3VDAA 3RJYA 4AB4A 4Z0SA 1EBGA 3UXIA 2ZZ3A 1MRQA 2QJIA 4BR1A 5I0DA 1SM9A 3LD5A 3T40A 3KRBA 2VD9A 3A4XA 2CWNA 1K8XA 1W9VA 2PGWA 3VUSA 3HMJG 4YJ5A 1EC8A 4L61A 2HISA 5EL1A 3A23A 2GVLA 4QEEA 5CBJA 4PH6A 2PF0A 1W1YA 3PZTA 3EOLA 1KGWA 2OZ8A 3PR2A 1H0IA 4M7TA 2XFYA 4KCVA 3RX4A 4FIQA 1BGAA 4Z1YA 1E73M 4MDPA 4ZQCA 1WUEA 3F4NA 1S2UA 1MO0A 1E55A 1GCYA 1XC4A 4LUTB 3BH4A 1S2VA 2QNEA 4B2DA 3V5CA 2OEKA 4HYVA 4Q8VA 1JNDA 3GNPA 3MSYA 4YLWA 3TMQA 2FMNA 1K8CA 3ZR6A 4J3SA 4ZXLA 1JYNA 1AG1O 1GPFA 2E9LA 2I1OA 5C9XA 3A3XA 1EJWC 1IZCA 4NJHA 2WXDM 3EDFA 4BF9A 3FV9A 3K8LA 2Y4SA 4XKYA 2WK2A 4UFMA 3BQ6A 1AH3A 3NDZA 1ADDA 3PPGA 4H2HA 2YA1A 1KB3A 1P0KA 4HHMA 4O15A 2P1FA 4MWAE 3BICA 3GTIA 4UQEA 1GZ1A 2OT1A 2NVDA 3FKKA 1WBJA 1XHGA 5E09A 3TQVA 3DHUA 3OYZA 4IP7A 5AYYA 5KZMA 4IUOA 3TYBA 3G0SA 4E2BA 1W5MA 1XLKA 3WNNA 3MBFA 1LL6A 2QCMA 4S2CA 4GUJA 4R3UA 4LUJA 1XS2A 5FKYA 1S1PA 1M03A 2R1NA 1KLZA 1R7AA 2ZIDA 4AMCA 1IT7A 3HPZA 4AZCA 3H26A 4CNOA 1Q6EA 4DBEA 2WMFA 2OO0A 1KCKA 3OBEA 5TF0A 3WFLA 1CNVA 4QAWA 3F5LA 4RV3A 3QHMA 4KGLA 2OXNA 1W3NA 2INZA 4JKLA 3GH7A 4RPQA 4C7GA 2QJHA 4U33A 3W7IA 2XSBA 3ES7A 3IRSA 4L4PA 3DGBA 3WD2A 3B9NA 1VENA 2G3FA 1M6JA 1TV2A 4KWVA 4MWAC 2R1KA 4LFYA 2GWNA 4DYEA 4RDWA 1C8QA 1ZALA 2JK2A 1A0CA 3IEBA 1EUNA 2J9XA 2XSAA 4C6IA 3W7OA 4HPHA 3A9BA <