2VEPA

Crystal structure of the full length bifunctional enzyme pria
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
b'MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title The Structure/Function Relationship of a Dual Substrate (Betaalpha)(8)-Isomerase
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
total genus 86
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vepA00
4EF8A 1KFCA 1OX6A 2ISWA 2JBMA 3ZFHA 1X6UA 4RJEA 1SUXA 2VEMA 3UY7A 3P5ZA 5BNKA 2CW6A 4UFIA 4WY0A 4PC8A 4JTGA 3HPSA 1DBTA 2FLIA 2VFDA 1HO4A 1UUOA 3I7QA 1THFD 2E09A 1ICPA 3KVKA 4I7WA 1GG0A 5D05A 4BR1A 4AWSA 5AOUA 1CX9A 5I3IA 1H7PA 2QCGA 3NQCA 5BMXA 2J88A 5T26A 2YW4A 3C61A 4EVZA 1PIIA 5LSMA 1ZCOA 1IIHA 4N9DA 1W56A 4MZ8A 4O19A 3SW6A 4C1LA 4GRSA 1IXPA 3G0SA 4OT7A 3LHTA 3TV8A 3UXAA 4LVAA 4ICNA 3LBMA 3G18A 3EX2A 4DO6A 4A21A 4QISA 3NPUA 4R53A 5FEZA 4AF0B 2Y63A 4XBKA 2X1RA 1KTBA 3TNOA 4MJMA 4DF1A 2H6RA 3C2EA 2A5HA 1KFEA 3M5XA 4O10A 3W85A 3MBDA 3TKFA 5D04C 3SFKA 4Y90A 2FB2A 2V5LA 1W5MA 3LGEA 4NNCA 3PBUA 4O1CA 2DZVA 2NUYA 4UTLA 3W23A 3C3NA 1GZGA 1SU5A 1XC4A 4XTDA 4Z0JA 4O14A 4H3DA 3IGSA 1R30A 3WK0A 3GAKA 5EYWA 3CPRA 1X7FA 4UTTC 2GJNA 3N19B 4LS1A 1NVMA 2ZRVA 3DFPA 1KM6A 3BW3A 5CZSA 4FIQA 2V81A 2BWGA 4IMGA 1KFBA 4TU1A 2ZRYA 3G22A 1VYRA 3W2NA 1H63A 1FQ0A 3NG3A 3UXDA 4AWTA 3TROA 2JGQA 2P1FA 2CZFA 1ZENA 4HNVA 4CQAA 5FEXA 2OT1A 3GXTA 2Y7EA 3QZEA 4XWUA 1I45A 1O94A 3PC0A 1DVJA 5TIMA 2GVGA 2VEKA 3LRKA 1D3GA 1GVSA 1DV7A 2KZHA 2QJIA 3EKLA 3S5NA 2DZWA 3NQ2A 2YFOA 3CIXA 2GOUA 4NX5A 2Z0IA 1H60A 4O4WA 3CEPA 3GKFA 1C8VA 2Y70A 4UTWA 2R94A 2ZDRA 4CLMA 4UUIA 4JEQA 5FEPA 4FXRA 1G69A 5CZ0A 3DHFA 3EX1A 1NAL1 4EOUA 1FWWA 3NL6A 3S5YA 2CLIA 3GYEA 4NXKA 3DHDA 3EWZA 1J5TA 4BWLA 3E12A 3KVJA 1JUBA 3B06A 3NPWA 1GYNA 3SI9A 3O06A 1LBFA 3TU9A 3SECA 4MUZA 5K9CA 1XI3A 1OK6A 1XFBA 4A2SA 5K2ZA 3TMQA 1JCYA 1XBXA 1G6CA 3LRLA 3EX6A 4A2RA 2PRMA 4Q32A 1FBAA 3GKAA 3PG8A 2TPSA 2QF7A 4JTIA 4RK8A 2ZRXA 3DBPA 3LI1A 2NX1A 3A22A 1TTPA 3DXIA 4UC5A 1JUEA 3PBYA 1TREA 4KFPA 1DKWA 3M47A 4UR7A 5A5WA 2NX9A 4BFAA 2V30A 4JYEA 3QRHA 4CQ8A 2C1HA 5F1UA 1K3UA 1IXNA 5EPDA 1O4UA 1G4SA 3LHUA 3OEXA 1DHPA 1FCQA 3QSTA 4PFMA 5KZMA 3UWWA 1DJQA 1RR2A 2E5DA 1JCMP 3NQMA 1L2UA 1VHNA 1GYLA 2WNZA 4AHOA 3M5YA 1H5YA 1SZEA 3WK2A 1PHQA 3NQGA 4LU0A 3G8EA 2OX1A 2YW3A 1HTIA 3BK0A 1VPXA 4FHAA 2V0TA 5AFDA 2UV8G 2Y89A 3OHIA 5AN7A 5L9FA 1OABA 1W0MA 4UTJA 4Q33A 1AW1A 1YXCA 1RVGA 1OK4A 1ZAIA 1Z48A 3NM1A 3C52A 3QMRA 4IJBA 4LVDA 1W1ZA 4DF2A 3KX6A 2VFFA 1RQHA 3DU0A 4X2RA 3NL3A 3EEGA 3R5EA 3DKJA 1U5JA 2RDUA 3TFXA 5HUPA 3W2KA 1FCBA 1YYAA 5D2YA 1W5OA 1YXYA 3U6WA 1H7NA 3MI2A 1ML1A 2J6XA 4NJKA 3EX3A 4HHPA 1ME8A 3TR2A 3UPBA 1H50A 5HUOA 3IRDA 1YXDA 3NQDA 4MJZA 4CCDA 4WUIA 4LY8A 2H8ZA 2CLEA 3O6YX 4UCGA 4EIVA 2YSWA 3W87A 3NZRA 4PODA 1DJNA 4U4MA 4JTLA 3TW6A 3F1QA 3TX9A 4IMEA 3P60A 3KRSA 1H61A 5F4XA 5F4WA 3MHUA 3F4WA 1YPFA 3L9CA 4TX9A 3BLFA 2VENA 4NJJA 4ZQNA 1WX0A 3W76A 1HUVA 2EPHA 3W7IA 1YTKA 3CWOX 1EA0A 3BG9A 4JXCA 3IVTA 5E93A 2QJGA 2VFEA 2QUTA 3T4CA 1GQNA 5F2GA 3W1TA 2EF9A 4R7JA 3W1XA 1TCDA 1K7EA 3NVTA 1LRTA 5D32A 5LKYA 1EPXA 1ZHAA 4NNBA 3T44A 4JY8A 3RF9A 1GTHA 3R13A 4UTHA 2ZZ4A 3QMTA 2HS6A 2WO5A 1OFEA 2NXHA 4K6AA 4A22A 4JIQA 3FOKA 3Q94A 1WBHA 2I1OA 2G97A 3H53A 1XBVA 5F2LA 3IVSA 1VS1A 2ZBTA 5CPNA 3L5LA 4BK9A 3KHJA 3AO0A 3W7HA 4FNTA 1GEQA 1OX4B 4PCFA 1X1ZA 3B4UA 2FQIA 1Q6QA 5BRBA 4JTFA 2B7PA 4M6PA 1FX6A 1S5VA 5G4EA 3TJXA 4X22A 1I2NA 3RLVA 2A1YA 1JRBA 4ZVJA 5K9XA 3NL5A 1NSJA 3G3MA 3EWBX 4NT0A 3O63A 1Z44A 3GDLA 3IEBA 4ZMGA 5BMWA 3TXVA 4FX8A 2OCZA 3L65A 2E6DA 3G1XA 4HPJA 1EP1A 5HMSA 4ZL1A 3NQFA 3PAJA 3L5MA 4FNQA 1TPB1 1QNVA 3DH7A 3B03A 3DAQA 2PURA 5C2XA 1YDVA 3VKJA 1SW0A 1VYSX 2YYTA 1ZJIA 3CU2A 2FPVA 2DZUA 4HN4A 3HJZA 1FDZA 2J9XA 4RXFA 5G2IA 5DCDA 1P0KA 1YTEA 3F03K 1TPFA 1KBJA 4YCPA 3W1LA 4MYXA 1CW2A 4ZQPA 4IMCA 3PY2A 1KV8A 1EP2A 3FLUA 4LNYA 2YCEA 4RCXA 3CEUA 4BI6A 1PL9A 3KXQA 3NQEA 4WOZA 5KITA 2LLEA 3E96A 5HWMA 4ONVA 2P10A 1D9EA 2V82A 3B04A 4M5PA 3ABOA 5MHBA 1BKSA 1AW2A 3NPVA 3TQKA 3HIJA 4P61A 3S9YA 4QNEA 3SJ3A 5FF3A 3P8IA 5LGXA 1MSSA 4ALDA 2HTMA 1UASA 3IIXA 1ONRA 3A9IA 1FDYA 2TSYA 1TPH1 4PH6A 2YZRA 3TQ0A 1JCJA 3M16A 2ZA3A 5I3FA 1VR6A 1T96A 4I7UA 1IXQA 4UIOA 2ABAA 1KBIA 2NUWA 5FF7A 1IIGA 4Z08A 3W22A 1QOQA 3ZR4A 3W72A 1FXQA 2GQAA 3FJLA 2A7NA 4DEFA 3W9ZA 4LV4A 1KFJA 2J27A 2V2DA 4MKNA 3B0VC 5G2WA 3L68A 2WV8A 4IX0A 3DI0A 2AGKA 1R47A 3V1PA 5D02A 3SR7A 5KSWA 1UJPA 1TPWA 3KAOA 4RLIA 4UR8A 1P4CA 2WQPA 1KM4A 4O15A 3TDFA 1XDMA 3MHGA 3LTSA 1RQEA 3OVQA 5AHIA 4LC8A 5HNRA 4HNUA 4I7VA 3QQ0A 4QNWA 1Q6OA 5DCBA 4WX2A 3MUXA 1B57A 2C3ZA 3W84A 3UNDA 3I7SA 3IGUA 3BPWA 3FKRA 2J9ZA 3LCGA 2YGYA 3L0NA 2YFNA 4ZQRA 3QPYA 2EHHA 3QH2A 5LZLA 4PL1A 5CSSA 1MEWA 3LHWA 5CZTA 5DXXA 3QJAA 1O5KA 4LUJA 4GNJA 4DPQA 5K4ZA 3S42A 3MYOA 2H3DA 5D2VA 3CC1A 5D03A 1SO5A 4WY0B 3HB9A 2WSYA 3STCA 1P1XA 1UUMA 4BI5A 5AC7A 3GDMA 4FNPA 4RZ6A 4UTWC 3S0CA 3BGJA 1M6JA 3CLMA 2Y88A 4JX4A 4IMDA 1VCGA 1WDWA 3W73A 3PG9A 2WNNA 3ATYA 3BLEA 4N9BA 4O11A 3LERA 4AWUA 1Q45A 2BLEA 3DENA 1O95A 3M5VA 5CKSA 3QW3A 3C2VA 2CWNA 1B4EA 1FCVA 4AVFA 3HGRA 1SO6A 4O12A 3HG3A 2ZZ6A 3LCXA 1TQJA 4FB7A 1JCLA 3QM3A 3UPWA 3HF3A 6ALDA 3M43A 2Y7GA 2DJLA 1NF7A 2VOMA 3O16A 1VHCA 2TYSA 1ICSA 1EWEA 4O50A 2D73A 3RU6A 4O13A 1SZNA 5DN1A 2OZ0A 3STGA 2A85A 3L0GA 5AHFA 1KTNA 3BW4A 1SZGA 1GVOA 4WJEA 2AAMA 3GDTA 4JN6A 3N2MA 1IF2A 1L9WA 4GUIA 4O8RA 3FS2A 4UFLA 3N2XA 3I7RA 3WJSA 3NL2A 2H3BA 1Q3NA 4DF0A 5KMYA 4O4VA 2ISSA 3ANYA 4M6QA 2OMAA 4N4QA 5EA9A 4FXSA 2R14A 2W6RA 4ZQOA 5F1VA 3VNDA 4C1KA 2E77A 2QDGA 5AHEA 5K3VA 1F2JA 3A5FA 4GC4A 3W7LA 4QQ3A 1QOPA 1WAUA 1I2PA 4GUFA 4NX0A 4JGDA 4ADUA 1QAPA 2EAWA 1C29A 1H62A 3DFTA 3LX9A 4JD4A 5D37A 2GQ9A 2Z2UA 2QCDA 4M19A 1LRQA 5GVJA 2YXGA 3W07A 5EY5A 1GVQA 3MHFA 4MIMA 3Q58A 3DI1A 2NV1A 4IOTA 2DORA 2NWSA 4PA8A 1H7OA 3CM4A 3CHVA 1LP6A 3LM7A 1NF0A 2X30A 1KV5A 4J9JA 3UWYA 4EWND 4UMBA 3M7WA 1AL7A 4XUGA 3MMTA 1SW3A 1W5NA 3GAYA 4HNTA 1QPRA 4YL2A 3INPA 4Y6GA 2Y7DA 1C9DA 4A29A 3L21A 3NQ8A 3W7EA 5AC6A 1G7UA 3ABQA 3W7MA 2FTPA 5CGQA 5KZDA 3PBVA 5AHMA 5U7SA 3NGJA 1TPDA 5IM51 3NR0A 2QCEA 1R46A 4LOCA 1F76A 3UWQA 1OFPA 4A3UA 1SPQA 5G1YA 1OFQA 3THAA 2QAPA 4LS2A 4O16A 3GZ3A 3M44A 4JR5A 1KM3A 3GDRA 4JYDA 3NNTA 4GE8A 1MXSA 4GXMA 4FNUA 4UFMA 3GR7A 5IBXA 3B0UX 4S1FA 3C56A 2VFIA 1TPUA 2FB3A 5J5RA 3Q37A 4O57A 1T0OA 3I6RA 3TC7A 4ZQCA 5HWJA 4LC6A 4UTUA 1ADOA 2TMDA 4XKYA 3DFSA 4MLRA 3W3OA 3LHVA 3BV4A 3W7OA 1QPOA 2O7QA 1KA9F 4ZQMA 4H4IA 1I2OA 4X3ZA 4Z1CA 2ZZ7A 3MYPA 4K8HA 1TV5A 5I3JA 2QR6A 1QCWA 2C6QA 5D33A 2V5BA 4ADSA 3P61A 4GBUA 1YDOA 2EGZA 1F74A 4LT9A 1X1OA 4BF9A 1GVRA 4N2YA 4K37A 1TSIA 2FIQA 1Z41A 1GT8A 3QQ1A 4UTKA 1XBYA 4K7VA 4AAJA 4NU7A 3W1QA 1P5BA 1FY6A 2Y85A 4AB4A 3EWUA 4XZ9A 2JKPA 4YMZA 5C54A 5I3GA 3W2LA 3M1ZA 2RHGA 1H1YA 4GFSA 5DLCA 2CLMA 4L4MA 1VYPX 3GNDA 1K7FA 2FDSA 2W0UA 5LNWA 2NX3A 2EKCA 1TV7A 3E02A 4K7YA 4IPJA 1FWNA 2X1SA 1M5WA 4MYAA 4ZZ9A 2Z6IA 2VELA 3LDVA 4O1AA 4DBEA 2DZPA 1VH7A 3BG3A 2PC4A 4ORMA 3PUDA 4XQ6A 5LHFA 1KM0A 4WOQA 1DORA 1OYBA 5TQLA 4FEZA 4O17A 1DOSA 2ZZ2A 1GOXA 4UNKA 1TTQA 3C2RA 1I8JA 1LZOA 1EUNA 1VCVA 1AL8A 1RV8A 2ALDA 1PVNA 1OF8A 1YDNA 3FJ6A 1LM1A 2NUXA 3IGXA 3MP5A 4LRTA 3UD6A 2ZRUA 1QWGA 3NQ7A 2A0NA 1FDJA 1JCXA 3DGRA 1CI1A 4O1DA 1EWDA 4MY1A 1IXOA 1W5PA 2A21A 4FIRA 1RD5A 4LW7A 4JTSA 3K30A 1OFAA 4OGZA 1KW1A 3O05A 3DFQA 3ELFA 1SQ7A 3TE9A 1JR1A 4N4PA 3T7VA 2X1UA 3TMLA 1SSGA 3NM3A 2HSAA 3PB2A 4N6FA 5D2WA 3R89A 3B0PA 2G5WA 1TJPA 4YLWA 3SZ8A 2H8XA 2W79A 3W7GA 5AHLA 4IQLA 1H7RA 3MP4A 3TXZA 2YPIA 3P74A 4NQ1A 4D2JA 1XUUA 5DY2A 1EEPA 2YR1A 1RZMA 4HT3A 1PCWA 4M7SA 2ZFAA 3W7RA 4IWWA 3W6YA 3GXPA 1GPWA 3KRZA 6TIMA 2B4GA 3BO9A 5FI8A 1OVDA 2GJLA 2C16A 3W7KA 1V5XA 2BZNA 2CLOA 1PCKA 1TPVA 1BWKA 5AYYA 1YPIA 2DZXA 5D2XA 5C5YA 2WKJA 3LB0A 3O6DA 1RQBA 1Y0EA 2CFFA 4MLJA 2HMCA 2QCFA 3G1FA 3G0XA 3EXSA 2DJXA 3A5VA 4AEOA 1VCFA 1JULA 1QO2A 1W3TA 4JX6A 1TMHA 1LYXA 3D0CA 3O1NA 1OFBA 3IIPA 4AH7A 4FX6M 2VKZG 4Z1DA 3S5OA 1AG1O 3SSJA 2H90A 5I3HA 4Y8FA 2ZRWA 3VCRA 2WSRA 1FWRA 4DO5A 1WOAA 3G1AA 3OIXA 4AMAA 5LNRA 5HQEA 2WSQA 1PV8A 5DBTA 4FX7A 4OHQA 3RMJA 3W88A 1OYCA 1ICQA 3W7DA 1ZY9A 4W9TA 3BLIA 2NV2A 2WNQA 1TB3A 1E51A 3EWYA 1SZFA 4K38A 1L6YA 3HQ1A 2ZA2A 3GK0A 3W1MA 2NXIA 1LORA 3EWXA 3PB0A 3W1RA 1KLYA 5F4SA 3G24A 1X8FA 1EX5A 5LNSA 1ME9A 3P8JA 1G4TA 3LOTA 3LXCA 4S2BA 1KLZA 2C13A 3TSDA 4OE7A 3BGGA 1F5ZA 5L6UA 3LXBA 2E5CA 5DXYA 1NEYA 3T40A 4Z0SA 2A2IA 1XXXA 3N3MA 3P81A 4CCEA 1QO5A 3BARA 4KFNA 4MY8A 1T8XA 3O07A 1TYGA 3PULA 3CQ0A 4FO4A 4UFJA 5G1TA 3JR2A 3MI3A 4UFHA 2JKEA 3EWWA 4HSOA 3FFSA 3QYQA 2E1DA 3S8HA 2FPTA 1K8XA 4TMBA 2R8WA 3Q2DA 3HPXA 5DY3A 1A5CA 4CNNA 2DZTA 4MFEA 5BW6A 1TTIA 3R8RA 3LI0A 4NVTA 3U8GA 2VEIA 3CT7A 2E5BA 2NXGA 4OBTA 3CB8A 3P82A 3CIWA 3ABSA 1VC4A 3RFAA 2X1TA 3M41A 5DBUA 1QR7A 2ISVA 5D09A 3MWAA 3W2JA 1A50A 1EP3A 5FF2A 3TW7A 1OX5A 4LVFA 2Z6JA 5H2ZA 5LGZA 2BXVA 3LTYA 3RNDA 1M7OA 1OFDA 1TRIA 2J9YA 3R12A 3KFTA 3W2UA 5HR7A 1WV2A 1ZFJA 5C55A 3LCLA 2QKFA 3GX9A 3KRUA 2E6AA 1FUYA 1TPEA 5EKYA 3G1HA 3LCHA 1XCFA 4NNAA 3BW2A 3GLCA 1LLZA 4JDYA 1OFRA 4DO4A 2VFHA 4M7TA 2XN1A 3RK8A 3FA5A 1KM1A 2GQ8A 3L5AA 1JRCA 1H51A 4GUHA 3G0UA 1QPQA 3GXNA 4JS3A 1YLVA 3P84A 3CWNA 4OWGA 3W7NA 2QDHA 3W86A 4MVAA 4M6VA 4AF0A 3EKZA 3JRKA 4OV4A 1WYIA 2XN2A 4BWLC 1JCNA 3FKKA 3VFLA 2QJHA 4HPXA 1BWLA 2C14A 2WJZA 2E68A 3VI2A 1A53A 3U2OA 5AB3A 4KWVA 4LWWA 1G4PA 5AC8A 1SFJA 3TQVA 1B3OA 3ATZA 1W8SA 2NZLA 3F4NA 1XKYA 3W1UA 2IQTA 3C0JA 4JTUA 4U28A 5HULA 3W2MA 1GVFA 1U83A 4DXVA 1LBLA 4KWWA 4LS0A 3JS3A 1HL2A 3LCFA 2YYUA 3LLDA 5IBXC 3TK7A 2J24A 4N9CA 1KM2A 4MZ1A 2QEZA 5LNVA 2JGYA 3G1YA 2JKAA 3N9SA 2XFWA 3ZWTA 4UMAA 1VLIA 3E0IA 1MZHA 1TRDA 5I3KA 3GDKA 1Q6RA 4WXZA 4MOZA 4EF9A 4O28A 4TIMA 1TJRA 3W1NA 1VQTA 3B05A 4YCOA 5LNUA 2Y6ZA 1SW7A 5EL1A 1JVNA 2DZSA 3C2OA 3A21A 3WK3A 4Q4KA 1LTDA 4YXGA 3SGUA 2QCCA 4Z1AA 1K8YA 1F7BA 2AQWA 3W1AA 5K9DA 3NEVA 1OG0A 2Y7FA 4GWEA 1HO1A 1GJPA 2ATMA 2GUUA 3UYCA 3AJXA 1XM3A 3NDOA 4JTHA 4IGHA 3IIOA 4AXKA 4GUGA 4IXXA 5D30A 3QC3A 2WPBA 5D2TA 2A7PA 1VZWA 1A5AA 1K02A 4JICA 5FESA 3B8DA 1P0NA 3LBCA 2QCDB 4JIPA 4QJ1A 1N7KA 1UB3A 3HG4A 4H6KA 5U4NA 2B7OA 4RXGA 3G8RA 3W1PA 8TIMA 1EB3A 1SR9A 3MI6A 3H54A 4N9EA 1H7WA 5ABTA 4TR9A 1KTCA 4B5NA 3USBA 4PEKA 1LBMA 3C6CA 3WJYA 1YTDA 2RDWA 1MO0A 2VEPA 1PS9A 4GUJA 1OJXA 3O15A 1W37A 3N14A 3PM6A 3EB2A 3NQVA 3O6CA 4O53A 3WJZA 4JTJA 2CZDA 1GTEA 4RKAA 3TCEA 1LOSA 2CLKA 3BVJA 2ZQ0A 1F73A 3SY5A 4TO8A 4UMCA 4UTIA 2TRSA 1KFLA 1JQXA 1L6SA 4K39A 4LTSA 1D3HA 5FF0A 3VE9A 1FWTA 1DL3A 3MJYA 4QITA 3UY8A 3FYOA 4OQVA 1A5BA 2F7FA 1HG3A 2X16A 1YADA 2C19A 5HJLA 4S2CA 3T55A 4OU1A 5TBOA 1FCUA 1RPXA 1GG1A 3EXRA 1AW5A 1LRNA 1JUKA 1WBJA 3V75A 4OV9A 1OYAA 4K36A 3G1VA 4JNMA 4O18A 3G1DA 2JK2A 3TUUA 2DP3A 2R91A 4UTMA 1KM5A 3PF3A 1B9BA 1W54A 1OFOA 5E0KA 2ZTJA 4O52A 3TIMA 5H91A 1M7PA 4O0ZA 4R34A 3KOFA 4UTTA 1XBZA 2A6NA 1O5XA 3TA6A 4WD0A 2VC6A 3OG3A 3VE7A 1SO3A 3HOJA 3OBKA 4XKYB 3STEA 4PTNA 4QAIA 2G96A 3BG5A 4NJIA 4CQ9A 3W71A 3N73A 1TPC1 1ZAHA 2YDAA 1XUZA 4JX5A 1G7VA 1PHWA 3S1XA 3UWZA 4O0KA 1TTJA 3W74A 5G5IA 4CNPA 4Y9AA 3PR2A 2V9DA 3HMJG 2QCHA 1LOQA 2ATSA 4TMCA 3ZS4A 4X9SA 3P62A 1EUAA 3LV5A 4XTIA 3S1VA 4AHQA 3IVUA 1S5WA 3HGJA 3TC6A 1AK5A 1OHLA 3S5ZA 1ZALA 2GVJA 1T99A 2O7SA 7TIMA 3W70A 3NAVA 2E6YA 5CPMA 3NO5A 1NFBA 3SIZA 3FIGA 1FWSA 4R33A 2I9EA 3NA8A 3TSBA 1S3HA 2GVLA 5CSRA 1W3NA 3S6DA 4LVBA 1I2QA 3NQ6A 1L6WA 3UQNA 1V7YA 3GB6A 1DQWA 3IV3A 1W31A 2QUUA 3QEZA 1BTMA 3N34A 2OT0A 4MZYA 2V2CA 1VLWA 1Q6LA 3UWVA 3MO7A 3QF0A 1H7XA 3PSWA 3DKLA 2YX0A 3KVLA 2C15A 3L0KA 1G4EA 4UFKA 3OVRA 3HGSA 3M9YA 2NLIA 1HFBA 4WY0F 1W5QA 4MY9A 1SFLA 1QMLA 1TO3A 2QCLA 3PUOA 1TIMA 3W7CA 2B7QA 3PUEA 3A23A 2ABBA 2P0OA 3I68A 3STFA 3LHYA 3THQA 3ABRA 3LXAA 4G1KA 4WQ6A 2A7RA 2CZEA 3TAOA 2QCMA 2CLLA 4JY9A 5K7JA 5LHEA 2C0AA 1MEHA 4QSHA 1QFEA 1WOBA 2RKXA 5AHNA 2C18A 4E2DA 2PE4A 4NZJA 1VJIA 3HG2A 3R2GA 3DFNA 4PL2A 2ZZ3A 1O60A 2Q8ZA 5HWNA 1QDSA 4ADTA 4IX2A 3LCWA 3UZJA 3W83A 4DQWA 1AMKA 3E9AA 3HG5A 5DCEA 1UCWA 5E1QA 5AYZA 1VGAA 3YPIA 3G3DA 5KTLA 1R2SA 1MEIA 3IIVA 1OX4A 2Z1BA 1SSDA 4FNSA 4UNLA 4HSNA 3NPXA 2V2HA 3S1WA 2FJKA 1LROA 2B0MA 4JTTA 2QAFA 2ZZ5A 5G2HA 4ML9A 4RZ4A 5F2IA 3NZ1A 3W7JA 4JTKA 3LV6A 3MP3A 2CZ5A 5CPLA 5CZJA 3H55A 3PS7A 3T78A 1K7XA 2ZRZA 4DPPA 2DU2A 3L66A 4MPQA 3PBWA 1QPNA 2Y62A 3HO8A 2VFGA 4QM1A 3MW7A 4FF7A 4LRSA 2A6LA 3KVMA 4JYFA 2V8ZA 2Q3RA 4N6EA 4DBDA 3QPZA 1I2RA 1WQ5A 5DELA 2RH9A 4CCCA 1A5SA 1H1ZA 3HPZA 2VXNA 3EXTA 4E2BA 3PVFA 1VRDA 3G1SA 4IUOA 1WXJA 1I4NA 1JQVA 3NXFA 4LVGA 1S5TA 1XL9A 3NOEA 2FFCA 4KFOA 3L67A 2OJPA 1GWJA 3GVGA 2F84A 5J5DA 2WOQA 3W7QA 1J4EA 5HINA 3C8FA 4Y96A 4RX0A 1TQXA 4E0CA 2ZA1A 3M6YA 2Y61A 4L4LA 5CG7A 4MFDA 2I14A 1TV8A 3LHZA 4IMFA 4HNNA 1K03A 5G4WA 3W75A 2HS8A 4NJHA 4CNOA 4HIBA 1OF6A 4P2VA 4IXHA 4ORIA 3GNNA 3PSVA 3P5YA 3N9RA 2PCQA 4NJGA 5HR6A 4QIUA 5FF4A 5F2MA 4YWIA 1WA3A 5C6MA 5CPOA 4LV9A 3SGZA 2PRHA 4WXYA 3CTLA 4HKPA 3MBFA 1N55A 2CU0A 3WK1A 5BOOA 4UXDA 1F6PA 1XDLA 4NUWA 4O1BA 1LOLA 2QCNA 3TAKA 2BSLA 2CLHA 3UWUA 2ZCGA 4E38A 2RDTA 2NWRA 3S1UA 2G95A 3QMSA 4FNRA 4GJ1A 1ZAJA 2ZZ1A 5EMUA 3WFAA 3M0ZA 2RFGA 4AHPA 1UBSA 1ME7A 4JDBA 4BI7A 3A24A 2ZTKA 3RLUA 4NXSA 1PE1A 3LTPA 1J2WA 3NYZA 2CLFA 2FPYA 3P67A 4LUIA 5EBUA 1SO4A 3GR8A 4JTEA 2A4AA 4RR4A 3QSRA 2X2GA 1F6KA 4RV8A 4Z1BA 3WJWA 3GIYA 1DQXA 1G67A 1LLWA 3QW4B 5AYXA 1Z42A 3TFCA 4DELA 3ZWSA 1IGSA 2Q8LA 4O54A 1ZNNA 3TH6A 1LDCA 4K8EA 1B4KA 3FEMA 3PWAA 4RZ5A 1R2RA 2BX7A 3OA3A 3LLFA 1LCOA 3QFEA 5FEWA 2ZYFA 2E6FA 1KFKA 3EX4A 1JJKA 2BTMA 5SWUA 2QUVA 2PRLA 3L2IA 5K4XA 3DZ1A 3W7PA 1N8FA 1EIXA 3O8AA 4KKXA 3LCIA 3FYPA 4XBSA 5KINA 2GPTA 3M5ZA 4WZHA 3P80A 3WJXA 5KZEA 3OVPA 3TJLA 2XN0A 4I9AA 3P7YA 3NQAA 1BEUA 3I65A 4POCA 5D38A 5A8GA 3TSMA 4IPIA 4N02A 1F05A 3HBLA 3C2FA 2Q3OA 4NZFA 1K8ZA 3C4UA 2B7NA 3HGOA 3IIZA 1W3IA 3UZ5A 3DFOA 3E49A 1FXPA 3LRMA 1ALDA 1R2TA
chains in the Genus database with same CATH superfamily
2ISWA 1SUXA 2VEMA 3UY7A 5BNKA 1SFSA 2CW6A 5FSEC 1QK2A 2VFDA 1UUOA 3WNMA 3I7QA 3L23A 3VAVA 4I7WA 4MDPA 4FK9A 5DEZA 4J7RA 1O5RA 3RX2A 2CC0A 4AWSA 3EPNA 3QGVA 5I3IA 4JIHA 3QR1A 2YL9A 5BMXA 2J88A 5T26A 2YW4A 2G3NA 4XUYA 1PIIA 5LSMA 2Z2AA 1IIHA 1W56A 1F8MA 2WSPA 3G18A 2WLZA 4QISA 3H4WA 3WH6A 3RLGA 4AF0B 2Y63A 3UG3A 2OU4A 4RL3A 5BOEA 4US5A 2W91A 3PFMA 2J7BA 4FMVA 4KMQA 3AHXA 1XGDA 3W85A 3TKFA 5D04C 3SFKA 1O1ZA 4ZO6A 4NNCA 4LUSB 1BKHA 1E3ZA 3ITCA 3PBUA 4GJJA 4GQQA 2NUYA 2PI6A 4OKDA 2D0FA 4UTLA 4PR4A 3C3NA 1DJHA 1SU5A 1MW1A 2YDRA 4XTDA 3ARTA 1MUWA 3BANA 4IFKB 3HURA 1GOQA 4G2DA 3GAKA 1XLIA 4Z42C 2PU1A 5FCZA 4UTTC 1QHOA 4LS1A 1NVMA 2ZRVA 2V63A 1KM6A 3BW3A 5A2BA 4E2OA 2BWGA 3EMQA 2ZRYA 4DJED 2BGNE 1W9PA 3TROA 1VBHA 2P1FA 1ZENA 4CQAA 5FEXA 4XWUA 1JL8A 3PAOA 4RNIA 1BG4A 4PUWA 1GW1A 2IQDA 2IS7A 1DV7A 1S38A 3VDCA 2DZWA 2EPOA 1E6SM 4B90A 4NX5A 2Z0IA 1H60A 1D7KA 4DM1A 3GKFA 1B3WA 2Y70A 2R94A 1WKDA 1DP0A 4DJDD 4FXRA 2UY5A 1FOBA 3P93A 3GYEA 4HOXA 2DZAA 1JDCA 3B8SA 3Q45A 1J5TA 2HCVA 3NSMA 4GIAA 3MU7A 2J25A 2VDGA 3V5OA 1EJ7L 3TMQA 3SCNA 3RRAA 2NT1A 4A2RA 2PRMA 3PJUA 3GKAA 3GNXA 1B0IA 3TP4A 3OZYA 3ABXA 1PTGA 3DBPA 1CGVA 1WPCA 2J75A 3T2OA 4UC5A 2JEPA 3BAXA 1TREA 2REQA 1QNPA 1YBQB 3BH4A 4HJWA 2PDJA 2V30A 2YLAA 3QRHA 2C1HA 5F1UA 1K3UA 1LUCA 1O4UA 5I78A 2Y4SA 1KRMA 3LHUA 5MKGA 4PFMA 3QSTA 1RR2A 2E5DA 3NQMA 3WLPA 1U5VA 4AHOA 1XISA 2WB5A 3ITLA 2QMKA 3MMUA 4LU0A 2VEFA 3FAWA 1M9HA 2TAAA 4ZR8A 1HTIA 1VPXA 1RD6A 2Z1SA 3GVWA 4K8GA 2V0TA 4Q8VA 1QHZA 1UH3A 2YCIX 4UTJA 1AW1A 1YXCA 3WLSA 1RALA 1OK4A 1Z48A 3NM1A 1W1ZA 3DU0A 3NYDA 1YIXA 1RA5A 4UQDA 1ZGDA 1E1CA 4GZ7A 1E5JA 3RN6A 5D9OA 3W2KA 1UP3A 2IKJA 4IIHA 4TTGA 1H7NA 2J7EA 3O6AA 3MO4A 4AIEA 1WE5A 4YWSA 3GSMA 1HL8A 2OFJA 4WRHA 4HHPA 1ME8A 1QBBA 3UZZA 3ES7A 3SN4A 1H50A 4LALA 5HUOA 1YXDA 3MV01 4MJZA 4CCDA 2H8ZA 4ROPA 3C3UA 4MJ4A 3R0KA 3W87A 4QE1A 1O12A 5JQ9A 4B2DD 4GH3A 3NCOA 2BOGX 3AIVA 1H61A 1ZQ5A 1EDGA 1JDEA 3F4WA 2IXUA 4JFTA 1DTNA 4B5TA 4Q8PA 4ZXOA 2VZUA 3CWOX 1U1HA 5E9AA 4JXCA 1XD1A 4YVPA 2BY0A 4I90A 2QJGA 5FIPA 1R3RA 2QUTA 3GRIA 4CQBA 3EDFA 1HZYA 3SGGA 5HMDA 4NZCA 1CB2A 1TCDA 4D8LA 3POCA 3E0VA 5LKYA 1EPXA 1ZHAA 2PDKA 3T44A 2VCBA 1GTHA 3VPLA 4XZNX 4DI9A 3IK2A 3MC5A 4JIQA 3Q94A 3R1ZA 1XIGA 1VS1A 5F7UA 3KHJA 2OGJA 3V36A 2CITA 1OC7A 3CK5A 3AS0A 4M1RA 2FQIA 3BOLA 4ZB5A 5BRBA 2DZBA 4M6PA 3WMLA 3QHNA 3C86A 1XLAA 1JRBA 5K9XA 4E5TA 3NL5A 3EWBX 5MF5A 1NFPA 5BMWA 3K8MA 3TXVA 2Z29A 4DZ5A 5G1MA 5C9WA 2HNHA 4HPJA 3L5MA 1TPB1 2GDUA 3ITOA 1QNVA 3DH7A 5C2XA 3VKJA 3I10A 2YYTA 3TN3A 1Z89A 4XAGA 2DZUA 4GXPA 3MS8A 3MDUA 3VYLA 2J9XA 3IJIA 4XB3A 1KCZA 3WQ5A 3GBEA 1ODUA 2HRWA 1YTEA 2DDXA 4YCPA 3R79A 1JIBA 2VR4A 1JAEA 3COTA 4ZSUA 4P8XA 4R3UA 1EP2A 3GVVA 3VNMA 4BI6A 1A3WA 2JALA 3KXQA 1VEOA 2LLEA 3NWRA 1XIJA 3ABOA 1BKSA 4GVFA 3RDKA 3HIJA 4G6CA 3SJ3A 3AMGA 3P8IA 4ALDA 2HTMA 1J5SA 3IIXA 1RLDA 3RX4A 1B54A 4NY2A 2PCEA 1NFGA 3WQ4A 1FDYA 2DUAA 3VD4A 4D1JA 1Q5MA 4J3UA 1XINA 4GKTA 4X0VA 1QTWA 5H8MA 4QSFA 1RY0A 1VR6A 3MSDA 4XO7A 4I7UA 8A3HA 3VGBA 2NUWA 5FF7A 2DT1A 2A3HA 3W22A 3ARWA 1QOQA 3VZXA 3FJLA 2A7NA 2GSHA 3EGJA 4YYFA 7REQA 1XP3A 2GFTA 3B9NA 1TIWA 3B0VC 1FHLA 5G2WA 4IX0A 2AL2A 2AGKA 1R47A 5DMLA 5D02A 2GZXA 2FZBA 2PEVA 5FJTA 3KAOA 4WSJA 1MUCA 1Q8JA 3TDFA 1RQEA 1EDQA 5AHIA 4LC8A 4H2CA 1C93A 3ITXA 4HNUA 4QNWA 1RCXB 4DIAA 1RA0A 3MUXA 2BDQA 2Y0FA 5DX7A 5BYWA 3KBJA 4RDWA 2YCLB 2VX4A 2DGAA 2ACUA 3CZEA 3B0XA 1U1UA 2P88A 2BB0A 3AU2A 3IAQA 2EHHA 3QH2A 4GI8A 1XS2A 3AALA 5CSSA 4U5KA 2J79A 5DXXA 1ZP3A 5CZTA 3VM7A 4ZO8A 1PDYA 4PTDA 3LLXA 3HPFA 4LUJA 2J62A 4WKFA 4GNJA 3FA4A 5D03A 1QNQA 4PTVA 4H00A 2VX5A 4F0RA 3OZMA 4FNPA 1S5NA 1E73M 3R11A 1Q63A 4N9BA 3AYVA 4AWUA 2FZMA 1Q45A 2BLEA 1DXFA 4W8LA 1IEWA 3VIKA 3AIWA 1SO6A 1TZZA 2FHBA 4O12A 3PZ9A 4ILSA 4AD1A 3LCXA 1JCLA 1ECQA 2VWSA 3BE7A 4UOQA 3M43A 1KRBC 4GYPA 1JPDX 2Y7GA 2DJLA 1NF7A 4H19A 4KWSA 2BOEX 2D73A 1SZNA 5DN1A 3BW4A 4GGBA 3G2GA 2FTYA 4WJEA 5AVHA 4JN6A 3FS2A 4XAZA 5CAKA 3UR8A 4IQEA 2PPGA 2GJRA 4DF0A 4O4VA 4OFCA 3L4UA 3AS1A 1ZP4A 4N4QA 3ARZA 4FXSA 4UOJA 2R14A 4ZQOA 1BXCA 8XIAA 3VNDA 3KWXA 2E77A 1F2JA 1E71M 3XINA 4GUFA 3LZ3A 4L4OA 5TD4A 3UZYA 1I0DA 4JD4A 2Z2UA 2QCDA 1VFLA 3VOIA 4WR3A 3EOUA 3IARA 1GVQA 2OPJA 3H7VA 4MIMA 4C6KA 2NQZA 5XIAA 1FA2A 3D47A 3DI1A 2NV1A 1NWUA 4LCQA 1H7OA 2MANA 4A8NA 4DUVA 3CM4A 3CHVA 1AH4A 2X30A 1S5MA 5I02A 1KV5A 3VIGA 3UWYA 1W8GA 5BRPA 2OGYA 4UMBA 2X41A 3OZOA 2Y5JA 4MAVA 2G37A 5IDIA 1VFSA 1I1XA 3GAYA 4AY8A 3INPA 4AQLA 1K6WA 1HJWA 4LCRA 2Y7DA 4I6VA 1UD2A 1UZDA 2GWGA 3CAKA 3W7EA 1C9WA 2EG6A 3ABQA 3W7MA 3CV6A 5CBJA 5KZDA 2Q6ZA 3RM8A 3NSNA 5U7SA 1J93A 4W5UA 4KWOA 2QCEA 4GH1A 1A5OC 4XZMX 2E25A 5I23A 3CUXA 4Q6JA 2Z1KA 3ZSTA 3GXIA 2OX4A 3UESA 4JOMA 4QS6A 1KM3A 5C7VA 2ZXDA 4DUOA 4GXMA 1IT8A 3B0UX 1W1VA 2VFIA 1TPUA 1FP9A 4JNZA 5A2CA 2V5CA 2VEGA 4HA0A 4DWSD 2R1NA 4UTUA 3FDKA 1ADOA 4XKYA 3RGTA 3W3OA 1XH2A 3WD0A 3BV4A 1H1NA 3W7OA 5KEZA 2O7QA 3TN5A 1I2OA 4X3ZA 4Z1CA 3NVDA 2PZNA 3RMEA 5I3JA 1QCWA 4X60A 1E9YB 3CV2A 5D33A 4ADSA 3P61A 3OGVA 2WCAA 3V35A 3GNRA 1YDOA 3WQ6A 1J6OA 2REQB 4BF9A 2R1MA 4MWAE 2VRKA 2G0WA 4K37A 4M0XA 1LUCB 1XBYA 1SFTA 5XINA 5C54A 4Y9NA 2JKPA 3BMWA 2DV0A 3M1ZA 2VNCA 4P7OA 6CGTA 2DSKA 1PZ1A 4DHGA 1RBOB 3SO7A 3APTA 3WUBA 5T9CE 2EPLX 4FAMA 4LF1A 4HN8A 3ITYA 2PC4A 2XWEA 1DXIA 4ORMA 1ITCA 1OYBA 2HZGA 1QBAA 2O56A 4UNKA 3BJFA 1TTQA 1VIWA 1E1CB 4DB7A 2BVDA 4B16A 1WDRA 1XKJA 3ARYA 1AL8A 1V03A 2ALDA 4AD0A 3F7JA 5BU6A 1PVNA 3UG5A 1YDNA 2NQ9A 2VX6A 4PBGA 2XFFA 1X1NA 3MP5A 1Q7ZA 4O1DA 3DGRA 1CI1A 2VX7A 1UZHA 4US5D 2CNCA 3WSUA 3K30A 1OFAA 4JCLA 4MSSA 3VFCA 3O05A 1RXOB 1OIFA 1YEYA 4A3QA 1SQ7A 1GOIA 1BQGA 4FZIA 1LT8A 2XJ7A 2P3EA 3IAPA 1SSGA 4HCHA 3PB2A 3G6MA 2GVEA 3EDKA 4YLWA 5AHLA 1G94A 1UIPA 5GPRA 1EL3A 5E5CA 1VIZA 1POJA 2WZMA 2XVLA 1GONA 1RZMA 1PCWA 3LENA 3W7RA 3KBWA 2ZOXA 1WZKA 1NELA 1GPWA 1DWAM 1RK6A 3F5KA 6TIMA 4U3AA 5BXPA 5FI8A 2OYLA 2O9TA 2PWUA 1PCKA 1QW9A 1NM9A 2DZXA 1PPIA 2WKJA 2XHYA 3LB0A 2QF8A 2PA6A 1E9ZB 1RQBA 1Y0EA 2CFFA 3SUUA 4XK2A 3G1FA 3R0UA 2X09A 1A5UA 3H2NA 1EX1A 1JULA 1PKNA 2CKRA 1BLIA 1O5QA 3U48A 3UG8A 1OFBA 3F4CA 1UWUA 4Q4PA 3MKCA 3CV7A 4FX6M 2QXWA 4Z1DA 3T0CA 4LUYA 5IFPA 2J66A 4Y9OA 2C7FA 3SSJA 3PJXA 2WSRA 1FWRA 1FVPA 4DO5A 1AODA 4IIBA 3OIXA 1J01A 4AMAA 3TCSA 3GH4A 1PV8A 1LQ0A 4FX7A 3RMJA 3W88A 2Q8XA 2VDIA 1ZY9A 4NZ1A 4HA3A 4NG3A 3F2CA 4UQAA 1K4HA 3ITGA 3UF9A 3EWYA 4M81A 5FL0A 3ZJ7A 3WNPA 2CETA 3HQ1A 1RP8A 5DMNA 1OD0A 2NXIA 3EWXA 2CHNA 1KKRA 3VOHA 2VP8A 3W81A 1GKPA 3G24A 3K1DA 2INEA 1EX5A 5LNSA 4RNJA 3AMDA 4S2BA 1BYDA 3LOTA 1JD7A 1R3SA 1DWHM 3K4WA 2O9PA 3LXBA 2E5CA 5DXYA 2BHZA 4ZB2A 2A2IA 4TVCA 5I24A 3P81A 3B3DA 3O07A 3CQ0A 3T42A 3JR2A 3EWWA 4HSOA 2E1DA 1K8XA 3LGDA 2NT0A 2D24A 4CNNA 1GOWA 2FVLA 3UEQA 1TTIA 2WKLA 2DT3A 4W87A 4P8WA 1XLGA 1K9EA 3CB8A 2UZ9A 1E0TA 3ABSA 3VOCA 3FVMA 4M3PA 2HPIA 2X1TA 1K8CA 5DBUA 3W29A 7REQB 4CD4A 5IHRA 3RM4A 1EP3A 5FF2A 3LZ5A 2WZTA 4E4FA 2DW6A 2Z6JA 3ZJ8A 1TZ9A 3SQMA 4RV3A 1OT1A 1ODZA 2QDEA 4L80A 3MKKA 3QKZA 4HTBA 2XIOA 2J9YA 1QJWA 4B5XA 2C1IA 1AQMA 2OVLA 1CBGA 3KRUA 3ABZA 2E6AA 1TPEA 2D20A 5EKYA 3G1HA 2OEKA 1XCFA 1UPPA 4LXFA 4W89A 3VNYA 4DO4A 4D6HA 3RK8A 3RO8A 2E9MA 4H01A 1KFWA 4Q8WA 1H51A 4A3RA 1B5TA 1KQZA 1QPQA 4JS3A 2ZXBA 4GBDA 3P84A 3VC6A 3CWNA 3W7NA 3AMLA 3W86A 3W37A 3EKZA 4QX4A 1Q66A 4OV4A 3CUHA 1JCNA 3FKKA 2QIIA 3GW3A 2QJHA 5DF0A 4YS1A 2VC5A 4HPXA 1BWLA 1E6ZA 2WJZA 4Q4MA 3KCOA 3VI2A 4G8TA 2FH6A 3SJNA 3U2OA 4ES4A 7PTDA 1ZJHA 5T8GA 5AC8A 4LEQA 3ATZA 1R6WA 1Q7QA 1Q4WA 3W1UA 5A6AA 4V1XA 4JTUA 4F8XA 1E9LA 1G0CA 1LBLA 4L6OA 3RRXA 2ISFA 5FD0A 2YYUA 3KM8A 4W84A 2WC3A 5GNXA 3LLDA 3OG2A 1CB7B 1R7OA 2J24A 3IUIA 3VUSA 2GDVA 3N04A 4JQ3A 1MZRA 2JKAA 4IP4A 3W6MA 4M6UA 4IJCA 2ZUSA 1MZHA 1WUEA 3GDKA 4TIMA 1TJRA 1SVDA 3TR9A 3UR2A 3UR7A 1PZ2A 3B05A 5LNUA 4JTCA 5EL1A 4S23A 2DZSA 1DJWA 3R6IA 9RUBA 4MNKA 4HMNA 1F7BA 3E5PA 3Q65A 1HO1A 4WLCA 1CGTA 2GUUA 4I6KA 3UYCA 3WD2A 2O55A 1IEIA 4JTHA 1J0IA 5FJUA 1E40A 4GUGA 4IXXA 7A3HA 5I6SA 5D30A 5C70A 3QC3A 1UC5A 1A5AA 3AI0A 3NOYA 3PBMA 4JIRA 2QCDB 4JIPA 3UVAA 1UB3A 2PLMA 2B7OA 4RXGA 8TIMA 1BWVA 3VKDA 3W27A 3MI6A 1KRAC 2VRJA 3N6JA 1TCMA 4H1ZA 1GJUA 4B9YA 4F9JA 5ABTA 1S2CA 1HW6A 4B5NA 4I5XA 3NEHA 4ROQA 2F61A 1PJ9A 1NP0A 1PS9A 2VEPA 3QPEA 1IYXA 2QJJA 3N14A 2O4QA 3NQVA 3O6CA 1TE6A 1OQFA 3WJZA 1EYEA 4JTJA 3TCEA 1J9YA 2GJXB 5E6YA 3BVJA 2ZQ0A 2QYGA 3KHDA 4TO8A 4UTIA 3Q67A 2OEJA 3SRHA 4F0MA 4QFUA 1F9CA 5FF0A 2PDYA 1FWTA 1N82A 4XVDA 4GCXA 4QITA 4CKQA 3DEQA 2F7FA 3B9EA 1J6PA 3OYXA 1YADA 4IMAA 1GKRA 1LRNA 1WBJA 3FAXA 1HKKA 4K36A 4JNMA 1POKA 3QVQA 3CBWA 1V6YA 1Y5XA 3PTMA 1KM5A 3PF3A 1B9BA 5CGTA 1OFOA 5E0KA 1FWCC 3OTRA 5H91A 4O0ZA 4CD5A 2A6NA 3TA6A 1O5XA 2XG9A 4WD0A 3ERPA 3ZIZA 4RE2A 1MW0A 2BXZA 3OBKA 4XKYB 2Z25A 2G96A 3BG5A 3W71A 3N73A 1OGSA 3TZNA 1TPC1 3W0KA 2YDAA 5LIYX 4D8ZA 3EB3A 1G9HA 1TTJA 3WLQA 3PR2A 2V9DA 3JUGA 1I60A 4I9JA 4A35A 3FY1A 4QGCA 3E0WA 4XTIA 2F6XA 3S1VA 4AHQA 1S5WA 2DQWA 1KBLA 3IGHX 4QDPA 1HX0A 1DPMA 4RNHA 3W70A 3NAVA 2DT2A 2W9MA 3A9BA 1NY1A 1QASA 3NO5A 1OCQA 4E6MA 3B8WA 4N0RA 1CDGA 2XH0A 4R33A 4AZ7A 4L6DA 3NA8A 3TSBA 1HL9A 1S3HA 2PDBA 1QVBA 1AJ0A 4MMWA 2DFAA 5B7YA 1SGJA 3V1HA 4UZUA 4CUCA 3WEZA 3NQ6A 1L6WA 3UQNA 1V7YA 3L4TA 1FRBA 3NJ3A 1FKXA 3IV3A 1YNQA 2QUUA 3QEZA 3BAYA 1R3QA 3MCMA 2OT0A 1VLWA 1F6YA 3R0DA 3HGSA 3I3DA 1K6AA 3E2QA 4WY0F 4IH3A 4MY9A 1SFLA 4XISA 3BCFA 1Y5WA 1GOMA 1W9VA 2QCLA 3PUOA 1TIMA 2BG5A 5BZAA 3PUEA 1N8WA 3H21A 3I68A 4WDTA 3QGKC 3ABRA 3B8VA 5CSUA 1W9UA 4Z2HA 4W85A 4JY9A 5K7JA 4DXKA 1MEHA 5HBFA 2RKXA 3DOPA 3WF4A 3VNIA 5A6KA 3SCRA 2O4MA 1XYLA 4PL2A 3BLPX 3BSGA 1O60A 2XSXA 1OCNA 1P7TA 2Q8ZA 1B3VA 4FA3A 3BOXA 4QCFA 1AMKA 1V51A 4XX6A 3JZUA 1S39A 5AYZA 4ZSTA 1R2SA 1MEIA 2IPWA 1PKLA 2V2HA 1MI3A 3S1WA 4ERAA 3B4YA 2OEMA 4ML9A 3LMYA 5F2IA 3IJ8A 3PK7A 4HHLA 3W7JA 3LV6A 4N7QA 2CZ5A 2HPMA 3VIMA 3T78A 3BTNA 4C7DA 1XWYA 2GGIA 4MPQA 3LBOA 2YA0A 4QM1A 4LRSA 3KVMA 4JYFA 2V8ZA 1W3HA 1V3KA 1ESWA 2OKOA 2VRQA 1A80A 4CCCA 1QNSA 1VRDA 1CLXA 4IUOA 4EX4A 1D8CA 3PZGA 1S5TA 1XL9A 4KFOA 2OJPA 5J5DA 2WOQA 3K8LA 3C8FA 4Y96A 4RX0A 1TQXA 3VTRA 3VABA 3U2ZA 4UWMA 5IFTA 4MFDA 3W75A 4NJHA 4M24A 4CNOA 4NI8A 1EFZA 2PCQA 3NDZA 5C6MA 4LV9A 7ODCA 2PRHA 4D9PA 3CTLA 3M0IA 3MBFA 2FTWA 4JIIX 3VGGA 3SURA 4O1BA 1WP6A 3KOYA 2BSLA 4IIEA 1XLLA 3E0FA 2WWDA 1TR9A 4JDBA 2ZC8A 1KKOA 1MUMA 2ZTKA 3RR1A 4TUFA 4NXSA 3O3RA 4OBSA 3GHTA 4CNUA 1J2WA 4HQVA 1DTUA 4LUIA 2A4AA 1DEDA 4L9ZA 3QY6A 4EAYA 1UH4A 2XH2A 1KCKA 1G67A 3QW4B 1LLWA 1E43A 5AYXA 5B7ZA 3FEMA 5BXTA 4RZ5A 4GNKB 4Z17A 2VYOA 1MW3A 4HZMA 3QFEA 3H2OA 4IGSA 2BTMA 3L2IA 4DNHA 4HD5A 1M65A 3ZZ1A 1VFUA 4KKXA 2OODA 1GOOA 3CUZA 3PZOA 3DG3A 1DE6A 1NJJA 3WF2A 3P7YA 3NQAA 3TSMA 3I65A 3WQDA 2XGZA 1ZJBA 3C2FA 1K8ZA 1FWBC 3C4UA 3DYMA 2FZNA 2BGSA 3IJ7A 3IIZA 3DFOA 3E49A 4JQAA 2VURA 4PEEA 4C6MA 3LRMA 4AVNA 3TYDA 4DO6A 4DX3A 1KFCA 4W4QA 1X6UA 3WDPP 3ZJKA 2YB1A 5FKYA 1DBTA 1XICA 4B3LA 1BGAA 1ICPA 3M0LA 3U2CA 1O1HA 4BF5A 5A8QA 1CX9A 2AKZA 1YKWA 1H7PA 1XIHA 3B8TA 3NQCA 3GG1A 3C61A 1ZCOA 1P43A 3P3BA 4O19A 4J27A 2OXNA 1JI1A 4GRSA 4DO7A 1IXPA 3LHTA 3TV8A 3UXAA 4LVAA 4ICNA 2NQ5A 3S83A 4DYKA 5JBFA 4E8GA 5JBEA 1CXKA 1MDRA 5CLTA 1CGUA 1EBHA 1GCYA 2A3BA 1A0DA 1KTBA 4DF1A 4MJMA 2H6RA 2A5HA 3M5XA 1LQAA 1ZSXA 2JF6A 4XZWA 4Y90A 2R1LA 3QZ6A 3ZMRA 2FB2A 2V5LA 1W5MA 1ZLPA 2OB3A 3QTPA 3WELA 4QR6A 1Y65A 3AYTA 1Z7AA 4Z2LA 1GZGA 4GQGA 1XCWA 2XIQA 5A6LA 3QY8A 5M03A 1R30A 4ZFCA 5EYWA 4Z2IA 4GI4A 3T9PA 1FP8A 3CPRA 3UA4A 3N19B 3BMVA 4OECA 4NIRA 1PXGA 1ZZMA 5DFAA 3WUFA 4DXXA 4EACA 4FIQA 3N2BA 2V81A 1ZRQA 1KFBA 3WLHA 1VFMA 5HPOA 3SQSA 1H63A 2VGFA 3RO6A 2PSNA 1XV8A 3QHOA 2JGQA 2NQJA 4PSRA 3U5YA 4QG8A 1EH9A 3RPDA 1V8EA 1I45A 3RCNA 3VNJA 2J7CA 1L6FA 5E9XA 1ZBCA 1V3HA 3PC0A 2X7WA 4GA8A 1VBJA 5TIMA 3LRKA 1I9CB 1GVSA 1XYZA 2BHYA 3S2CA 4BQ4A 3EKLA 1RJRA 3NQ2A 5I07A 5D9PA 2GOUA 1EJUC 4BKNA 2PD5A 1BXBA 4C6IA 2NV9A 1A0EA 2B81A 4CLMA 4FLSA 3EX1A 4HVXA 2E7FA 3EWCA 2EO7A 7TAAA 4NXKA 3WQFA 2IKIA 2Z1VA 4AIBA 1EJTC 1JUBA 3B06A 3NPWA 2WC7A 1WKFA 1X8CA 1VEPA 3AMKA 2PC8A 1UWRA 1ZB5A 2IKHA 4PB4A 2W3ZA 4MUZA 4IZGA 4JQ4A 4A2SA 1JCYA 1G6CA 3ZM8A 2YBVA 1J0ZA 1BXNA 3NURA 5HATA 4AG0A 2TPSA 2QF7A 3AUJA 4QG9A 5HANA 3V7PA 2NVCA 1XYBA 1PTDA 3LI1A 1H4PA 4UQBA 5T91A 4WSKA 1W1A1 2WVSA 3OO2A 3PANA 4N42A 1JNDA 3A13A 3B9AA 4JYEA 1IXNA 4MNLA 5EPDA 4RUBA 3S1GA 3UXKA 3OEXA 1FCQA 3GW0A 1DJQA 3FGCA 1QU4A 4WDUA 3M5YA 1XLJA 3NQGA 3AROA 5HDRA 2WYSA 3G8EA 4YTRA 4ZCWA 4H9VA 1CYGA 4Y7EA 3LA4A 4PN2A 5AFDA 1UR3M 1NWSA 1OABA 4LYQA 1W0MA 3GNPA 4CCZA 1VB9A 1W1IE 4MUPA 4BQ2A 5CJNA 2YA2A 4OTKA 1EJVC 3ZQ9A 3QMRA 1XLDA 4IJBA 4DF2A 4ENLA 2VFFA 5DANA 4FI4A 4G56A 4GPNA 3HFTA 2XU2A 4CN1A 3DKJA 1U5JA 2XIJA 1BQCA 1FCBA 1YYAA 4ZBCA 3STPA 1XQLA 3VCNA 3MANA 4NJKA 3EX3A 4HP5A 3BWWA 1RBAA 3MVIA 3UPBA 3SCOA 3IRDA 4HK7A 4IGNA 5JUVA 3UXIA 4LY8A 3WYZA 4EIVA 2YSWA 1JYNA 5CJMA 5REQA 4U4MA 2CLPA 4GLEA 4GYKA 5F4WA 1JZ8A 4CU6A 1WX0A 4QHRA 5G4HC 3W76A 2EPHA 5A94A 3RG6A 1X7IA 3BC9A 1FFRA 3BG9A 3IVTA 4O1FA 3T1GA 3WLIA 1IZCA 4F9DA 1GW9A 3T4CA 5DO8A 3A6OA 1ISWA 4YPJA 2XVKA 3PPGA 2YLLA 4HYVA 5CC5A 5IRPA 4RW5A 4NNBA 2P50A 4JY8A 3RF9A 2ZUMA 5LIKX 3KBNA 4S3CA 2HS6A 3ZVHA 1OFEA 4K6AA 3FOKA 2QW5A 2NSOA 3W25A 4XZIA 2GL5A 4QLLA 1XIFA 3L5LA 3TWAA 4RE0A 3FDGA 4FNTA 4MTVA 2WZIA 4M29A 2DQXA 1MNSA 4S3FA 1X1ZA 4NRRA 4JTFA 1FX6A 4HU4A 2V5JA 1HP5A 3RLVA 4D6IA 1ZU8A 3VDBA 4ZE4A 2A1YA 5CPSA 5FOOA 2ZUVA 4R9OA 4U2ZA 3GDLA 1EXPA 3HFYA 1FWJC 2F6UA 1XLBA 3DBNA 1TUXA 1TMQA 3IJDA 2WVTA 5J04A 3WLMA 1HKIA 1G01A 4ZL1A 4FNQA 5H1WA 1SR0A 4XZHA 1TWSA 3B03A 2X0SA 1QATA 3BICA 5CAHA 3UPMA 1SW0A 1VYSX 2QZRA 5GNZA 1ZJIA 2J7DA 2ZXQA 5HQLA 3WD4A 4FF5A 1BSLA 3IJ9A 4RXFA 1P0KA 4NASA 1H11A 1TPFA 1KBJA 1PYMA 4XO6A 4F79A 1G5AA 3WN6A 4JCMA 4XD3A 4AUBA 4QE5A 4Q4RA 4AWEA 4IMCA 3FLUA 2QMJA 2AQOA 4LNYA 3MA8A 3NTYA 2PTXA 2V82A 4KRUA 2WQDA 4M5PA 3M0HA 1AW2A 1BVNP 2DSVA 3WQ8A 1GEHA 1U22A 3LPOA 4AZBA 5LGXA 1XFCA 2XTKA 1E70M 1L6GA 4GK8A 1KCLA 2GGJA 3A9IA 2TSYA 4PH6A 2YZRA 4P8UA 3L2LA 2PDNA 2PTYA 1T96A 2F9RA 1TFVA 4UIOA 4H41A 1KBIA 2VQTA 1V3MA 4Z08A 4GXWA 3N1AA 1MQQA 3W72A 2JF7A 2ZE3A 3W9ZA 3NDYA 1FWAC 2WC4A 1PIGA 1W1B1 1Q6FA 2VL4A 3K1GA 5D9MA 4KH2A 3DI0A 2PTZA 2QPSA 4PMVA 4RLIA 4UR8A 1P4CA 3GR4A 4XD6A 1HJSA 1X6NA 1C91A 4GVIA 3OVQA 5HNRA 4I7VA 3QQ0A 2VTFA 1AD4A 4WX2A 3VMNA 1B57A 3W84A 1J10A 2CEQA 1XPYA 3N2OA 3H23A 2J9ZA 2YGYA 2QULA 8XIMA 1NARA 4FSAA 4GVHA 5D9NA 3SCWA 4FS9A 5D2VA 1UR8A 2GSJA 2YL5A 1SO5A 3CQHA 1UUMA 4BI5A 7XIMA 3GDMA 3PTDA 3CLMA 3CO4A 2Y88A 4JX4A 1VCGA 3UETA 3I6TA 3BXWA 3BLEA 2WMHA 3KTXA 3LERA 3DENA 3FV9A 4L56A 5CKSA 3M0MA 1LWJA 1FCVA 4AVFA 3HGRA 1A0CA 1KGWA 2J7GA 3UPWA 3HF3A 5C71A 1D3CA 1NDVA 4NZ4A 4FLQA 2VOMA 2ZWZA 3GTHA 3TJIA 3KZPA 1ICSA 4O50A 1UKSA 3CH0A 3STGA 5BCAA 3ANVA 1KTNA 3T08A 3BCDA 4KS0A 1Y7VA 1Z6KA 1YW1A 2AAMA 2PDMA 3N2MA 1IF2A 3WJSA 3I7RA 4JL1A 1EBGA 4JKLA 2H3BA 2JFEX 2QS8A 8RUCA 3ANYA 1E6NA 1UKTA 2OMAA 3OLEA 4W8AA 2ZUNA 3FHAA 5K3VA 4K1GA 3S6OA 3IK4A 4CGTA 3W7LA 3IACA 3BQ6A 4NX0A 3LNPA 1QAPA 5C2CA 1C29A 4X2PA 5D37A 3WQGA 2GQ9A 4M19A 5GVJA 1JGMA 1YPXA 4LX4A 3VNKA 1ZBKA 1EO5A 3Q58A 4DVOA 2FGBA 2WXDM 4IOTA 2DORA 2GK1A 4PA8A 3ALGA 1WKYA 3VD7A 3KE0A 3LM7A 3WLNA 1FFQA 3SM0A 1EC7A 3M7WA 1RVKA 3HA1A 1AL7A 1H2JA 5HK4A 4XUGA 4B9ZA 1SW3A 1W5NA 4FXFA 4IQDA 1QPRA 4ZGYA 4YL2A 1HGWA 4Y6GA 1RK5A 1C9DA 3NQ8A 1G7UA 3TOPA 1WDQA 1G1YA 3GYCA 1UR4A 3NGJA 4PSPA 3URQA 3U7BA 4GQBA 2I57A 1HF6A 1QUMA 1NOFA 4CD6A 1RJQA 4YHEA 3FXYA 3KP1A 4NRSA 5G1YA 3THAA 3VA8A 2QAPA 4LS2A 4O16A 5CH9A 1CXLA 3GZ3A 3M44A 3EDEA 2EG7A 3NNTA 2OZ3A 1SZRA 2OLSA 1UZ1A 2IW0A 3GVQA 5J5RA 1EEXA 3Q37A 3M7SA 1UMLA 1SYTA 1T0OA 3WLJA 4LC6A 5CPQA 2WZHA 4Q3MA 1MNZA 2PWFA 1JNEA 1YBQA 3DFSA 4MLRA 2IKGA 3NFUA 1QNOA 1KA9F 1ONEA 4H4IA 4DZHA 3W00A 4H9MA 4K8HA 1TV5A 5CJ5A 4NZ5A 2X7VA 1X6LA 3DHUA 1XLFA 3NZPA 1DWJM 4LT9A 1AD1A 3A4AA 2PODA 1IR2A 3TJ4A 1GT8A 3VC5A 4NU7A 2VD8A 2FH8A 2XVPA 2Y85A 3EWUA 4YMZA 1BHGA 2RHGA 3TN6A 4WGHA 4DWDA 3C0LA 4L4MA 1VYPX 4AEFA 4GIEA 1BG9A 1EKOA 4FR6A 3ZVIA 6PTDA 2BFGA 1BD0A 3UJ2A 3S2JA 3NGFA 1FWNA 3EEZA 1DWIM 4NI3A 2BNJA 2VELA 3LDVA 4ZODA 2QVNA 1UOKA 2DZPA 4BEUA 4XQ6A 5LHFA 2VWTA 3AXHA 4H8VA 1YE6A 4URIA 1BSIA 4MB3A 1DOSA 5TF0A 2ZZ2A 4K3ZA 4LGXA 3BQ5A 4LPCA 1P1MA 5FSDC 1EUNA 5A8NA 1VCVA 3N2TA 1RV8A 2TODA 3GNOA 3WBAA 3FJ6A 1K70A 4GG9A 3XIMA 3UZXA 3UD6A 2ZRUA 1FDJA 3A3XA 4TOQA 1EJXC 4EE9A 1RD5A 1TV3A 4JTSA 1C3FA 3IUHA 1CLVA 1NIUA 4D6EA 2NQHA 1KW1A 5D4YA 5REQB 3TE9A 4N4PA 2YDSA 3AOFA 4N6FA 1E0UA 2JQXA 3B0PA 3WNKA 2G5WA 1TJPA 3BMXA 1MW2A 4IQLA 1H7RA 3P74A 1FWGC 4PMDA 4MADA 1ZUAX 3PZTA 1XUUA 5DY2A 3PTQA 3N12A 3CHFA 2YR1A 1V08A 2ZFAA 3OW1A 4C6NA 2P8CA 4LYRA 4RE4A 4ACZA 2C79A 1RP9A 2X42A 3M0YA 3KRZA 1B3YA 1EHNA 3BO9A 1CENA 2GJLA 2C16A 3W7KA 3ZVHB 3CYVA 2GDQA 4C7FA 3U57A 2CLOA 3V5FA 1JYXA 3G77A 3IWPA 1QOXA 1AQ0A 1MFUA 4BHYA 5CBBA 5A6JA 3EPMA 3QV7A 3ZLGA 5E09A 4DZAA 4TVDA 1PWMA 4INFA 4MLJA 2HMCA 2QCFA 3G0XA 2DJXA 1VCFA 1QPKA 4KERA 4MM1A 2V6AA 5RUBA 1WZLA 4MWAC 2VKZG 3WEMA 4MPKA 4EPBC 1AG1O 1KWKA 3KUMA 2H90A 1XDJA 1UR1A 1YNPA 1VRXA 3V4BA 1WOAA 4KGLA 3G1AA 4W7WA 5HQEA 1W1YA 4MDOA 1DXEA 4OHQA 2HK0A 1ICQA 1VFOA 2RJHA 3W7DA 1QNRA 3UJEA 3BLIA 4ZENA 3DHPA 3TYEA 4AX6A 2BY1A 3BJTA 4DUWA 1SZFA 4K38A 2ZA2A 3GK0A 4U10A 1LORA 1RPKA 3PB0A 4JKKA 3W1RA 3VKCA 3WUGA 5ABHA 6XIAA 1G4TA 4LAKA 3WD3A 4F0HA 1KLZA 3TSDA 3BGGA 4IG2A 1F5ZA 1P6WA 5A3HA 3BUVA 1FH9A 2FHFA 1NEYA 4H6QA 1UR2A 4KFNA 3WBEA 4GYPC 5A8MA 3CZJA 1TYGA 2W92A 4FO4A 4UFJA 3MDWA 2J78A 4JNYA 2FPTA 2C1GA 4TMBA 2R8WA 2YOCA 4DY1A 3CUFA 3C5QA 1A5CA 2DZTA 4MFEA 1JPMA 4ZTYA 2G3FA 3R8RA 3LI0A 4L61A 2WMKA 2Z27A 1CXIA 3ZLHA 2D0HA 4D8AA 1WNOA 3MV11 2BV9A 3WD1A 3M41A 3SN0A 3ES8A 1R9XA 3W2JA 4B5UA 3WH9A 3TW7A 1OX5A 3ZR6A 3H6OA 4JHZA 2UY4A 3DIPA 4FALA 3P2VA 1Z9AA 2ZKMX 1TRIA 1XD0A 3R12A 3KFTA 3BDKA 1WKEA 4AW7A 1TVLA 5HR7A 5AC4A 2P76A 1P6CA 3BLOA 5C55A 1NH6A 3LCLA 4H7VA 3GX9A 1FUYA 6TAAA 3BW2A 3GLCA 1EOKA 2XDFA 1OFRA 4CNSA 2XN1A 1O6IA 1EF2A 4IP7A 3FA5A 3ID7A 1DE5A 1IZJA 2FZ8A 2ZX7A 4CQCA 3S4TA 1B9ZA 4GUHA 3AWNA 3ICJA 2A3LA 2PB1A 3G0UA 3GXNA 4ASTA 1OY0A 3ARSA 4OWGA 1AZ1A 2QDHA 1CNVA 3DFHA 2Z1XA 3FK4A 1BVZA 3TYCA 3JRKA 4H8HA 4FPSA 3PHAA 1EJRC 1JF6A 5AB3A 4KWVA 4OUIA 3TQVA 3G6LA 1XKYA 2WWCA 1UPMB 1E4NA 3GU1A 1MRQA 3LSCA 3VMOA 3FW6A 3GH5A 4H04A 3I4EA 3W2MA 1GVFA 1RSCA 1XSJA 1U83A 4HU3A 4PMYA 1B3XA 4KWWA 3JS3A 3LCFA 3AAMA 4DRSA 3ARVA 3TK7A 1GHSA 3NXLA 5LNVA 2WJEA 2YBUA 3HQOA 2ESCA 3ZWTA 4XKMA 1ZBVA 4YVVA 1UHVA 4P7NA 3WDIA 1VLIA 1PKYA 3QY7A 5I3KA 2DY3A 5DRCA 4LANA 1U33A 4W86A 3W1NA 1UR0A 3NSXA 1V0MA 1VQTA 3ORWA 4AIUA 1SW7A 4P8VA 1JVNA 3C2OA 3A21A 2ZVIA 2FGZA 1H09A 5B80A 3SCQA 1VAHA 4Z1AA 2Z26A 4R88A 5K9DA 4IFRA 4B4HA 1GJPA 3N4FA 2ATMA 3AZTA 3AJXA 2PLJA 1GQJA 2VO5A 1L0PA 4E4UA 3BSHA 4RDVA 2FVKA 1AJ2A 2A7PA 1VZWA 1ONXA 1RLCL 4JICA 3S2NA 5AYIA 3VK5A 4KEMA 1AVAA 1N7KA 3JZEA 5HMFA 3W1PA 2GSEA 1V79A 1EB3A 4V1YA 3RPMA 2EPKX 3H54A 4N9EA 1O66A 4P5UA 5AKQA 1H7WA 2GK1B 3PP7A 1KTCA 1JDFA 2OO0A 3VX0A 4HNLA 3VGDA 2VZSA 1YTDA 4GUJA 1OJXA 3O15A 2WMJA 2E8ZA 3PM6A 3AQUA 2Y8KA 3R7MA 2E40A 4OVXA 2Z2BA 1GTEA 4RKAA 4GCAA 4KQNA 1LOSA 5I2UA 2CLKA 5I7GA 1OIMA 2I9UA 3Q4DA 1XYCA 2JIWA 4QEHA 1L6SA 1R3YA 2PZ0A 1CIUA 4K39A 2P8BA 3H8AA 1TMLA 3ONCA 3WDRA 2GJPA 1DL3A 3FYOA 4NZ3A 3H7UA 4OQVA 4JZ5A 2ON3A 4IICA 2X16A 3EMCA 3T55A 4OU1A 5HAOA 4L1XA 4PYSA 4H6EA 3OODA 2DPEA 3FN9A 3WKZA 1JUKA 3V75A 1OYAA 3SQLA 2ACQA 2V69A 1TVPA 4O18A 2CZVA 3ME3A 4J4KA 2V68A 1LJYA 3MKVA 1EF3A 1M7PA 1V6TA 1UWSA 2VC6A 2BVWA 2HVNA 3HOJA 4KIEA 2D3LA 3T0BA 1WDSA 4CQ9A 4Q6XA 2J7HA 3S1XA 3UWZA 1LLOA 5LYRA 4BS0A 4ZOBA 5G5IA 1BYBA 1HKWA 2OQLA 4GIRA 2QCHA 1V6WA 1LOQA 3SUSA 3CL8A 1C8XA 4X9SA 4AMCA 1NTHA 1VFFA 3IVUA 3HGJA 2VZVA 2I5QA 1EOMA 1OHLA 4PUDA 4S3AA 2HXTA 4IL0A 2GVJA 2Y24A 5DMMA 4L65A 1KR1A 3OBAA 2JIEA 2X2YA 5FJJA 1GJWA 4I9MA 1FWSA 5A6BD 4MNJA 5HNTA 1XH0A 4R7WA 3G1RA 1PB0A 2GVLA 4HMEA 4HZ7A 3S6DA 1OM0A 2HQAA 4GZEA 1P0DA 1S2UA 4J3WA 4W7UA 4CVWA 4F4RA 3JU2A 4Q4SA 3EZ4A 3UBPC 1XG4A 3DGBA 2FDMA 1W31A 4GMEA 4PMXA 3WG6A 3B9DA 2EBNA 4OJYA 1FWDC 1Q6LA 3KLKA 3MO7A 1OZMA 1BPLB 2CERA 3QF0A 1R7AA 1DWFM 4H9TA 4UFKA 4B91A 1W5QA 2D22A 3EOOA 1XLEA 5A95A 2AAAA 3BV7A 1V3JA 3A23A 3VIFA 5FJRA 3LXAA 4E3VA 1E55A 2CZEA 3LPPA 3TAOA 2QCMA 2JEQA 2WPGA 3FSUA 4AY1A 1WCGA 2OLAA 1XIDA 4RNFA 5LHEA 1UIOA 2C0AA 1QFEA 1WOBA 3CMFA 1Z32X 5AHNA 2PE4A 3W6LA 3I3BA 4NZJA 4ZE5A 9XIMA 1SMDA 3GHRA 3HG2A 1X39A 3MWCA 4DQWA 2J13A 2Y8UA 4MGGA 5E1QA 1VGAA 3YPIA 5E0CA 5KTLA 1SM9A 2Z1BA 1M7JA 3VNZA 4P7QA 3GU2A 4JFWA 4A8RA 4H6RA 1LROA 1MDLA 4MHBA 4HYWA 2BY3A 1C7TA 2G3MA 3TYAA 1TUFA 4ACZB 4HHMA 3NZ1A 4JTKA 3T07A 5CPLA 4S38A 5CZJA 3PS7A 2ZRZA 3UG4A 4DPPA 1ONWA 2DU2A 3T4WA 3L66A 3VKAA 3M6DA 1R85A 1QPNA 5IDZA 1RCQA 4HMDA 2PF0A 4FF7A 4DJEA 4WIWA 4OZOA 1W9XA 1B2YA 4DBDA 3QPZA 1WQ5A 2RH9A 3HPZA 3EXTA 3R4IA 4LAZA 1B31A 1HJXA 1WXJA 1Q6DA 5AVNA 3U4FA 4HPGA 4Z2KA 3NXFA 4HPNA 4DYJA 3OGSA 1XIBA 4LVGA 1E6RA 1HKVA 3GE7A 3GVGA 4WK9A 5E0FA 1S2TA 1J4EA 1K1DA 2ZA1A 1JF5A 3CUGA 2JE8A 3KCLA 4LAMA 1HKMA 5HA7A 4CEUC 3CHDA 5BXRA 4DJDA 4P2VA 4ORIA 4JN8A 4V33A 4FP1A 4RPPA 5EFFA 2OOGA 5F2MA 4OBRA 5CPOA 4M82A 3SGZA 4WXYA 6XIMA 3CIVA 1N55A 4GNVA 2CU0A 4NUWA 1XDLA 2I5GA 3TAKA 2CLHA 3UWUA 2QV5A 2PDLA 4AD4A 4GQ0A 4WF7A 4GJ1A 3GVRA 2PDUA 5EMUA 3WFAA 2YKKA 3M0ZA 2RFGA 3R8GA 3PN8A 4BI7A 3CZKA 4XIAA 1XYMA 2CLFA 2YZ5A 1M68A 5C9XA 3GR8A 4JTEA 2A79A 2ZIDA 1F6KA 1U5HA 3UFYA 4PUJA 1W1PA 3GIYA 4L5ZA 4IG2B 5TAOA 1Z42A 3SBFA 3ZWSA 4KRZA 2BGQA 4KT2A 1GZJA 2C71A 4QQUA 1LDCA 3CL7A 1R2RA 2BX7A 3OA3A 1V4YA 3LLFA 4IJRA 1FHUA 1JPHA 1LCOA 5FEWA 4QXIA 3IRSA 1BVWA 3UCDA 1M3UA 3KTSA 3LN3A 4CVUA 4AD2A 3W7PA 2WZEA 1UOZA 3O8AA 4PUMA 3LCIA 4PB5A 1VEMA 4PGLA 2GPTA 4L6HA 4V27A 5BU9A 3AZRA 4B15A 4WZHA 2WMFA 2XN0A 1BEUA 4MF4A 5D38A 4POCA 4H8UA 5XIMA 1E6QM 3GXDA 4NZFA 3HBLA 3CLWA 5I03A 2B7NA 1W3IA 4JBRA 1TVNA 3T8QA 4G7FA 3DFYA 1FTXA 4EF8A 4MWAA 3HU7A 4RJEA 1VPYA 3UR5A 4MG4A 1HJQA 5CSYA 2FGLA 3EA3A 3P5ZA 3CAQA 3VCCA 1QI2A 4WY0A 2EKGA 4JTGA 3HPSA 4H8NA 3VIJA 3M0VA 1HO4A 4WHBA 5I0DA 3KVKA 1XHGA 1CECA 1GG0A 4L9YA 4BR1A 3SDOA 3CJPA 5AOUA 1MVYA 4X61A 3J7HA 2QCGA 5DMYA 3WF3A 2DIEA 2AL1A 4EVZA 3H7RA 3SW6A 3L4YA 4C1LA 1UROA 3G0SA 4PCTA 4OT7A 4I3GA 4GHRA 3LBMA 2FFIA 3EX2A 2OZ8A 2W62A 4F2UA 3PNUA 4ICCX 2PD9A 1UKQA 5FEZA 2X1RA 2PFHA 3GH7A 3URAA 2NQLA 3TNOA 2HBVA 2FJUB 1VPQA 1NWRA 1ITQA 3BAJA 1L8NA 9CGTA 3RLHA 5EGRA 4D6FA 5ENLA 4Z0JA 1UKOA 3IGSA 4H3DA 5M3WA 2W63A 3DECA 2XGIA 5FACA 2UY2A 3DFPA 1AA1B 2A3EA 3S6TA 2VVSA 5JMUA 1VYRA 3AWOA 1FQ0A 3NG3A 3UXDA 3RCYA 3UGVA 4KIRA 4GABA 2OT1A 3E1F1 2Y7EA 3QZEA 4M51A 3GIQA 4UNIA 2VEKA 1D3GA 2KZHA 2QJIA 1B30A 5LA2A 2YBTA 2YFOA 3FYYA 2OSYA 3CASA 4O4WA 4UTWA 2ZUTA 4GO8A 4HK6A 4JEQA 5FEPA 1G69A 3E74A 5CZ0A 2GJXA 3K4DA 1NAL1 4EOUA 1FWWA 3S5YA 1M01A 1EGMA 3DHDA 1E1FA 3E12A 3LY0A 3SI9A 3FEQA 4ICMA 3DG6A 3TU9A 3QZAA 1HT6A 3RUBL 2VJXA 3T2QA 5K9CA 4DLFA 1XI3A 1OK6A 5K2ZA 3OIHA 2AGTA 1J8VA 3EX6A 4HBKA 1R5YA 3PG8A 4J40A 5HNNA 4JTIA 3N15A 4RK8A 2PGEA 2ZRXA 1OG6A 3WX7A 3VILA 1E6XM 4PMJA 3A22A 4XAYA 1TTPA 3DXIA 4NL1A 1JUEA 3PBYA 4PTXA 4UR7A 4JHOA 3CH9A 5A5WA 2NX9A 3E0LA 2PDQA 1IT0A 1G4SA 3KL0A 1R9ZA 4BF7A 5KZMA 5HJYA 1JCMP 2AOSA 4CU7A 1S1PA 5BWAA 1L2UA 1GYLA 5ABGA 3M0JA 3WLTA 3WK2A 1L2QA 1PHQA 1MQRA 3ARPA 2ZICA 2F38A 3VIOA 2YW3A 4FHAA 1KXQA 2UV8G 2Y89A 5AN7A 4ERGA 5EMYA 1HN1A 2ACRA 5HJXA 2E28A 1ZAIA 3C52A 1XW8A 4ZB0A 3KX6A 1RQHA 2DIKA 1XYFA 3EEGA 3R5EA 4QROA 2DIJA 1A5KC 1JFXA 4TX8A 4LBRA 3T81A 1P0BA 1EDTA 1W5OA 1YXYA 4KPLA 1W1TA 3VX1A 4M8UA 1ML1A 4PBFA 3H2FA 4GVGA 3LEPA 3TR2A 3T0DA 1DYSA 3V16A 4WUIA 1IT7A 2DH3A 3O6YX 4UCGA 4GYFA 1K4GA 4PODA 3LS9A 1XIMA 3LD5A 1XC6A 3TWBA 2CHOA 4JTLA 4OOZA 5LA0A 3F1QA 4IMEA 3P60A 4FOJA 3KRSA 5F4XA 1NDYA 3CT2A 3SCSA 1YPFA 2QQ6A 2YCKX 3L9CA 4TX9A 3BLFA 3UW6A 4NJJA 2ZX9A 5LIUX 3W7IA 2OOFA 1EA0A 3TTYA 2CBJA 2RAGA 1VFHA 4LYPA 2VFEA 4BQ3A 1GQNA 1GGOA 1BYCA 5F2GA 2HNEA 1UD8A 2GGGA 2EF9A 1W2PA 4R7JA 3W1XA 2YL8A 4QBXA 2FVMA 1FHVA 1XRFA 3ZLFA 3ZXWA 3DYPA 1TG7A 1GORA 4GFIA 3EDDA 3R13A 3LU2A 3QMTA 1QK0A 2WO5A 2NXHA 4A22A 2P3ZA 1XX1A 1V0NA 2HE8A 4B3ZA 3FSTA 2GQ3A 1PZ0A 3H53A 3KP0A 4J3TA 5F2LA 2Y8VA 1IWBA 5CPNA 4BK9A 3QN3A 3SCPA 1BYAA 1GEQA 2XSAA 5TNVA 1XRSA 3L4XA 1IR1A 3UJFA 4HSHA 3KWSA 1PYFA 1GZ1A 3PPCA 1FWFC 2B7PA 4BA0A 1GVEA 1S5VA 1W9DM 3TJXA 4DM2A 2J47A 1I2NA 4A05A 1M7XA 3O63A 1JYVA 1Z44A 1S2VA 3IEBA 4FX8A 3FJ4A 3DYOA 3LNMA 2D2HA 4U2YA 3G1XA 3D6NA 1A49A 3CQIA 2A3AA 3NQFA 3C8NA 4DAIA 2HV5A 2PURA 3DAQA 4JTDA 4PFHA 3R8HA 1YDVA 1PEZA 2AQVA 3SRKA 3U4AA 1OD8A 1NOWA 3U3HA 4L9XA 3WCZA 4BZYA 4HN4A 3QOMA 3HJZA 3U5UA 4E8DA 1FDZA 2R24A 5C7HA 1UUQA 3KCJA 4A6GA 4FXJA 4AYSA 5HOSA 5I09A 4MYXA 3M0XA 4ZQPA 3PY2A 3C0SA 1W17A 1XG3A 3WQOA 2W4XA 1LWHA 2YCEA 3CEUA 4WOZA 3NQEA 5KITA 1EQPA 2GUBA 5HWMA 2P10A 1D9EA 3B04A 4P61A 4EKJA 5ABFA 1UD5A 1MMFA 1YQ2A 2PP0A 4CN4A 1UASA 1ONRA 3HQPA 2BS9A 4S3GA 5EBAA 1TPH1 2V3GA 3APGA 1VD6A 4DWSA 4YTUA 4IISA 2ZA3A 3UNTA 3ONBA 5I3DA 2ABAA 3UJSA 1IIGA 3MCNA 1MXDA 2PDGA 1FXQA 3HPAA 4DEFA 3REQA 4V2XA 3LPFA 1XPGA 5CGMA 2J27A 2V2DA 3W26A 3V1PA 3II1A 3GG7A 2Z24A 5KSWA 1UJPA 1TPWA 1KM4A 4O15A 2WBGA 1SJBA 3MUIA 1J0KA 3LTSA 1OSEA 3GD6A 1Q6GA 1WZAA 4NF7A 3WUEA 3MUY1 3TYUA 3UP8A 3CZLA 3KOWA 1DIKA 4XSMA 1PX3A 1HGYA 3I7SA 1FWEC 1F61A 3UERA 1PIFA 1AQHA 1EC9A 4JTQA 3LCGA 3VUPA 3L0NA 2YFNA 4ZQRA 3QPYA 3KBVA 3MZNA 1GVIA 4PL1A 3TTEA 5H8PA 1O5KA 2J6VA 1F8IA 4AX7A 4MWAB 2VUNA 1VENA 5K4ZA 1HKJA 3QOKA 4QDMA 1TKKA 3CC1A 3CPUA 2E8YA 4WY0B 3HB9A 2WSYA 4RDYA 1V3IA 3RAOA 4RZ6A 1IQ8A 2ASHA 4IMDA 3A4WA 4H9UA 3W73A 8CGTA 4PCSA 3PG9A 3ATYA 4D71A 1UR9A 1CGXA 1R87A 1O95A 3VDAA 4QAWA 3GC2A 2XGBA 3QW3A 2CWNA 1WZMA 3P14A 4J28A 3ZO9A 2ISDA 3HG3A 2ZZ6A 1MRAA 2XISA 4AYGA 6ALDA 5A6SA 4XG1A 3RXZA 1VHCA 2F6KA 2TYSA 4KWUA 1TWDA 5H6HA 4LUTA 3RU6A 2A85A 2RGMA 3WQCA 1GVOA 3CYJA 3F4VA 3KS6A 4O8RA 4UFLA 1UP2A 4BEQA 2GLKA 2ISSA 4M6QA 2ZC1A 4AZHA 5EA9A 2W6RA 5F1VA 1J79A 4C1KA 2QDGA 1ITXA 4GC4A 1XLCA 2D2OA 1WAUA 4ZXLA 2PF8A 3VOJA 1ZTVA 1K9DA 2EAWA 1R38A 1Q4NX 3DFTA 3LX9A 4UCFA 1LRQA 2YXGA 4AZIA 5EY5A 4Z2GA 1FWHC 2VR2A 3B40A 4LB3A 2OLHA 4AVOA 3SFWA 1LP6A 1DJZA 3ENLA 2A3CA 1JZ6A 1A47A 2POZA 1TV4A 1B1YA 1W3KA 2Z7KA 1SJAA 1AMYA 1JG9A 4HNTA 2WMGA 1UH2A 2Q02A 4A29A 3L21A 4PMOA 1XCXA 5AC6A 2FTPA 5CGQA 3AYRA 4LB4A 3V3WA 3PBVA 4AC7C 1YHTA 4UOZA 1KBBA 5IM51 2VGGA 3LSBA 3FVDA 4GYJA 3KDOA 2EJ1A 1UMYA 4ATWA 1R46A 2YJQA 3GZAA 3WDQA 1OFPA 4A3UA 1SPQA 1OFQA 3OBEA 1TA3A 1QT1A 2F2KA 3P6LA 1HNYA 1BF6A 3GDRA 1MXSA 4Q8QA 2FMOA 3IANA 1V6UA 5IBXA 3C0QA 3C56A 4FLOA 2EPMX 3HZ3A 1JZ3A 4O57A 1GQKA 3I6RA 3TC7A 4ZQCA 2G3IA 4WVXA 2TMDA 1MWOA 4YVXA 7ENLA 3GU9A 1KB3A 3OYZA 3NQBA 4MAZA 5PTDA 5HNUA 4ZQMA 1RY8A 2O9OA 1E15A 4PTMA 3AXMA 2V5BA 3R58A 3ZOAA 1EA9C 4ZTXA 2EJAA 4GBUA 3PUGA 2EGZA 1F74A 4N2YA 1S46A 3AIQA 2FIQA 4GY7A 3QQ1A 4UTKA