2VEPA

Crystal structure of the full length bifunctional enzyme pria
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
MSKLELLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHGDKIAVGLDVRGTTLRGRGWTRDGGDLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEEALEATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title The Structure/Function Relationship of a Dual Substrate (Betaalpha)(8)-Isomerase
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
total genus 86
structure length 240
sequence length 240
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vepA00
5BMXA 1I2RA 2W6RA 2OMAA 5BMWA 5FF3A 4LY8A 4LT9A 2XN1A 3PUDA 5G4WA 1EPXA 3S1XA 5F2IA 3B04A 3LHTA 1QDSA 1RD5A 5DBTA 3UXDA 1VYRA 4DBDA 3TCEA 3O1NA 4RXGA 5K9CA 4LUJA 3ZWTA 5CSRA 3A23A 2FPTA 4FNSA 3ELFA 1VS1A 3U2OA 2PURA 3O07A 1RQEA 2HMCA 1GWJA 1RR2A 3GDTA 3QFEA 3QSRA 4WXYA 3SIZA 1W54A 4MYXA 1HTIA 3FJ6A 2X1TA 3PG9A 3W1TA 1TPC1 5E1QA 3PF3A 2Y70A 3W6YA 3NL6A 2V82A 1LBFA 2E1DA 4CCCA 3W74A 1Q3NA 4ADUA 3P5ZA 4MUZA 1ME8A 2E09A 2EKCA 4LVGA 2Y88A 3KXQA 1X8FA 1SO5A 2R8WA 5DXYA 5D38A 1LZOA 1XXXA 1SPQA 1PV8A 1D3GA 3TROA 1DOSA 1TQJA 2VENA 4KWVA 1Z41A 1PVNA 3OG3A 3RLVA 3T78A 2EGZA 5D03A 4Z1DA 4JX5A 3UWWA 4B5NA 1ZJIA 2E6AA 1JCMP 4QNEA 5SWUA 1K8XA 3O15A 1WX0A 1PHWA 4FO4A 4O54A 2CWNA 1JUEA 2Y7GA 3FJLA 5HNRA 2OX1A 1WOAA 4JY8A 3MI3A 2C15A 5L9FA 2QUVA 3OA3A 2X1UA 3HGRA 3CIWA 3IIPA 4LV4A 4GWEA 4JXCA 1TSIA 1KBIA 4LTSA 4S2BA 1HG3A 4I9AA 5G2IA 1TRIA 3LCHA 4IPJA 1SR9A 5DELA 4PCFA 4IUOA 4UFIA 4PL2A 1SW7A 1RV8A 4UNLA 3R5EA 3MYOA 2QAPA 3SR7A 4UTHA 4LRSA 1U5JA 1H61A 1M7PA 4I7VA 2DZUA 5K2ZA 5LGXA 3WJZA 3ABOA 4AHOA 3NA8A 1W3NA 4O12A 4MKNA 3VE7A 1GVRA 4G1KA 4TU1A 4BI6A 5F2MA 1X7FA 4O28A 1Z42A 1SO4A 1SSDA 5D33A 3CWOX 3B05A 3HGJA 1KA9F 3S1VA 4YCPA 4JX6A 4LRTA 4KKXA 3C2RA 5KZEA 4IX0A 4N2YA 3WJSA 3BG9A 2PC4A 1HO4A 1P0KA 1EEPA 2V2DA 3BK0A 3M16A 3DFSA 5CKSA 3W1AA 5H2ZA 1YTEA 4RX0A 4Z08A 1XUZA 1KM1A 3N2XA 2C16A 3S5OA 4AVFA 3C6CA 3GXPA 2E6FA 3LRMA 1KW1A 3N34A 1H62A 4MVAA 1QO2A 3FOKA 1WA3A 3TU9A 2GVGA 1VZWA 3M5ZA 4QAIA 3W2MA 2A6LA 4DPPA 2OZ0A 2XFWA 3TE9A 2TYSA 2R91A 1M7OA 3L0NA 4LVDA 3GZ3A 4RKAA 5I3JA 3A5VA 1RZMA 2D73A 1PE1A 4IMFA 3W3OA 1W5NA 3LTSA 4LVFA 4IWWA 4JGDA 3STEA 3F4WA 2YYUA 1ZNNA 4OV9A 3KVKA 1GJPA 1SFJA 1KLYA 1NFBA 3W1MA 3N3MA 3V75A 4QNWA 4WD0A 1EA0A 2V30A 3I6RA 1LROA 3NQFA 4WY0B 1NEYA 3WK3A 3R2GA 3FA5A 1TCDA 2ZZ3A 4BWLA 1M6JA 3LM7A 5HWJA 2CZFA 5FI8A 1H7RA 1K03A 1Q6OA 1S5TA 3W7RA 2ATMA 3TAKA 4MFEA 4PEKA 1LBLA 3HPSA 2X16A 3TK7A 3KAOA 1MO0A 4AH7A 3NL5A 1N7KA 3P5YA 1K02A 1W37A 1OK6A 2GJNA 2VFIA 4FIRA 2B7QA 2BZNA 1EWEA 1TPWA 2NZLA 3STFA 1IXOA 1JQVA 2OCZA 1ZENA 2QCDB 4WY0A 3O6DA 3UXAA 3EX1A 1FWSA 3UWQA 3S1UA 4O8RA 4UTKA 2DU2A 1QPRA 3O8AA 4ORIA 2HS8A 1JCYA 5G1YA 1O94A 4ZQPA 1ZALA 3GIYA 2VXNA 4ZZ9A 1QFEA 1F73A 5CPOA 1I2OA 2Y62A 3KVJA 2ZBTA 4A21A 3EWWA 3SZ8A 3C52A 3CT7A 4XZ9A 3GXNA 3PVFA 1OX4A 1AMKA 1F05A 1DQXA 1QWGA 2QJHA 3C56A 1JCLA 3LV5A 2QCDA 1YYAA 3T44A 2H3DA 4ORMA 3GR7A 4JNMA 4LUIA 4NNAA 3P67A 2QUTA 1C29A 1F76A 4HSOA 1Q45A 4Z1AA 1CI1A 4EF9A 1NSJA 3ZFHA 3W7IA 3NQCA 4OT7A 1GVSA 3PUEA 4GUFA 5E93A 1ONRA 1XCFA 3ATYA 1G4EA 3NQ2A 5LNSA 4M7TA 3G18A 1UUMA 3OBKA 5CSSA 3EXRA 1G69A 3W2UA 3W83A 1VYSX 4NJJA 3H55A 4FNPA 1DJQA 1B9BA 1KFEA 1LRTA 3M41A 3CPRA 2VFDA 4AWSA 2P1FA 2WSYA 5U4NA 3NQMA 3CTLA 1AW2A 4I7WA 4JTFA 4O17A 3CHVA 3LTYA 1ML1A 1B3OA 2E5DA 4E38A 4XWUA 4JS3A 5D2VA 1FWTA 4MY8A 2NWRA 2VOMA 3B06A 4JR5A 3PR2A 3W7MA 2JGQA 1JUKA 4NZJA 1TPVA 1WBJA 3A5FA 4LU0A 1HUVA 1Q6QA 1GOXA 2HTMA 5IBXA 1SZGA 2X30A 1YDVA 2TPSA 1ADOA 2CLLA 3BW3A 3W2NA 4MZ8A 3CIXA 3GAYA 1DL3A 4L4MA 4NUWA 1K8YA 4HNUA 4OHQA 3CEPA 3IGUA 2B4GA 3TW6A 3MBDA 1QAPA 1W5OA 1VC4A 4YMZA 4MLJA 1P5BA 1BKSA 4Q4KA 4O1CA 4IXHA 3HG5A 1TQXA 1R2TA 1H5YA 1FCVA 3ABRA 3HGOA 3TQKA 4LW7A 3QPZA 4IMDA 2VEIA 2F7FA 4K6AA 5DCEA 1BEUA 3UY8A 4JIPA 1OFEA 1O95A 2AQWA 4CCDA 4UTMA 1C9DA 5CG7A 1F6KA 4O50A 2X1SA 2VFFA 4K37A 2UV8G 1GQNA 2DZTA 2WSRA 1G6CA 2NV1A 4IXXA 1IXNA 3NQAA 2OT1A 3RK8A 5KMYA 4GNJA 1SZFA 4FNRA 2E5BA 1RQHA 3FKKA 4CQ9A 1G4SA 1N55A 4E0CA 3MP4A 4UIOA 5LHFA 4PL1A 1C8VA 5DY2A 1GVQA 3Q2DA 1Q6LA 2FB2A 4O1DA 4DO6A 3IIOA 5I3IA 1GTEA 5KSWA 1B4EA 3IGXA 3PULA 4JTGA 1OJXA 2CLOA 5HINA 4OBTA 3G22A 5G2HA 3C2OA 4TO8A 1OF8A 2R14A 2ZA1A 4O10A 2DZXA 4UFMA 3NQVA 1O60A 1XUUA 4JTJA 3UD6A 3V1PA 3CWNA 3L65A 1GZGA 1WBHA 5C5YA 1SO6A 5DN1A 4YL2A 1A53A 3P80A 1O4UA 4DF2A 1IF2A 1ICPA 3PAJA 3G1VA 2A5HA 4RCXA 2WKJA 2DZSA 2QAFA 4K8HA 4NXSA 4OU1A 1ZHAA 5D2TA 3VNDA 4RJEA 3NQ8A 2Y7DA 4IPIA 2WO5A 4A22A 4K7YA 4HN4A 4AMAA 1W56A 2QCMA 5DXXA 2GUUA 4A2SA 5HULA 1H50A 3M5YA 3KX6A 3BW4A 3W70A 3WK0A 3HGSA 1IXQA 4S1FA 4UTTA 1U83A 3NM1A 5AHIA 3W1PA 3TMLA 4UTUA 5FESA 3MHFA 4IGHA 3LCIA 2J9YA 2OJPA 3I7QA 3O6YX 3IIXA 5EBUA 3EB2A 4ZQMA 2Y61A 2ZZ4A 1R30A 1YPIA 4UTWA 3HO8A 4XBSA 2Z6JA 3NL3A 5C55A 5HUPA 3GAKA 3E02A 4N4PA 2QJIA 1YTDA 4RR4A 1AK5A 3NR0A 1FWNA 2V2HA 1DBTA 1TRDA 3EEGA 3BARA 1MEIA 4WUIA 4UNKA 2RDTA 1TTJA 1KM5A 3W07A 4J9JA 5F2GA 3A22A 2RKXA 3OVQA 5T26A 1OX5A 3G24A 2QCCA 1FDYA 3DU0A 3ABQA 5F1VA 3THAA 3MW7A 2CLMA 1HFBA 1PCKA 1B4KA 4NX0A 4M6QA 4GJ1A 1JRCA 3C2VA 2Y85A 5HR7A 2J88A 1TMHA 4IMEA 4K38A 3IGSA 3A9IA 3OVPA 1VCFA 1E51A 5AFDA 4NJIA 1PHQA 1H7WA 3N9SA 2A85A 2NXGA 1OFDA 1YXCA 2JBMA 4OWGA 3H53A 4CQ8A 5D05A 1LLWA 2QCNA 2IQTA 1IIHA 2VC6A 1TPFA 4JY9A 3PB2A 2ZCGA 3OVRA 1D9EA 3TSMA 3L5MA 4LWWA 4TMBA 2AGKA 2ZA3A 5AYZA 3WJWA 4EOUA 3QPYA 4YWIA 2ZZ1A 3W1RA 3LTPA 3L5AA 3SSJA 2DZPA 3C8FA 1VHCA 2NV2A 4BI7A 1KM2A 4GUHA 4BFAA 3E96A 5H91A 3LHYA 4DEFA 2NUXA 5C6MA 4DBEA 2G95A 4AXKA 4TX9A 1OG0A 2A7RA 3G0XA 4UMBA 2BXVA 2Y89A 2Y7EA 2TRSA 1ICQA 2V2CA 3N19B 4A3UA 3HJZA 4GUIA 3EWZA 4NU7A 4UTJA 3DHDA 3LCLA 2ZTKA 4WQ6A 2G96A 4A2RA 3OHIA 1L9WA 4DXVA 1W1ZA 5AHFA 3N9RA 3O05A 1FWRA 2X2GA 2YX0A 2W79A 2G5WA 1SO3A 3W7CA 4XUGA 3C0JA 3INPA 2FPYA 4ZQRA 1XKYA 5I3KA 4RLIA 1XDLA 1OFBA 1KLZA 3G1HA 1QOPA 3W1XA 5HJLA 3B03A 4HT3A 4UFKA 3NVTA 1H7XA 1I4NA 5LHEA 4S2CA 2YZRA 4JYFA 4HNTA 3KHJA 4U4MA 3EWYA 4AHQA 2WSQA 3QSTA 3UWYA 3UZJA 1DKWA 4HPXA 3T55A 1DQWA 1Z48A 4RZ6A 4UTIA 1EUNA 1SSGA 3PG8A 1UUOA 3G1SA 3HF3A 1XC4A 5D32A 2VELA 3F1QA 1KV8A 3KVMA 3SJ3A 3M44A 2PE4A 3TUUA 3W1UA 4FXSA 4UR7A 4ZVJA 4XTDA 1QCWA 3FYOA 4HIBA 1FCBA 1GEQA 3N73A 1TV7A 5HR6A 3CU2A 4RXFA 5D2WA 3LX9A 3RU6A 1X6UA 3MJYA 4H3DA 3N2MA 1JCNA 2YCEA 3DI1A 1AL8A 4MFDA 5G1TA 1I8JA 3G8RA 3I68A 1FCUA 1KFKA 1ZAJA 3GVGA 1OYBA 3B0PA 5A5WA 3B0VC 1JRBA 3VKJA 3HMJG 4BI5A 3LCXA 1OYCA 1ZY9A 2E68A 2FTPA 3TQVA 3W7HA 4P61A 5KITA 4O52A 5F4SA 5MHBA 3P82A 3QRHA 1EUAA 1CX9A 1KFLA 3PBYA 1TPH1 2CLKA 1TPB1 3W75A 3QEZA 3SECA 2WJZA 1KTNA 4WOQA 4GFSA 1OFPA 2DZVA 3M9YA 4RK8A 3LB0A 3B8DA 1FY6A 3CC1A 4M6VA 2FFCA 1KBJA 4KFOA 2V9DA 5I3GA 3ZWSA 5LSMA 3FFSA 5G4EA 2YPIA 5K3VA 5FF2A 4YXGA 4O1AA 2V5BA 1OF6A 1VRDA 4H4IA 4RV8A 3IRDA 3MBFA 4O0ZA 3QQ0A 4QIUA 3TC7A 1HL2A 2WNNA 4LOCA 1I45A 4NJGA 1DJNA 3L21A 2RDWA 4NQ1A 3WFAA 4BWLC 1TV5A 2ISWA 2TSYA 2DORA 2ZRXA 4O0KA 1THFD 4PTNA 3W84A 3W7PA 3O06A 1J4EA 3L66A 2ZQ0A 3TJXA 3S9YA 4MY9A 4N6EA 1S5WA 4X3ZA 2YW3A 3G0SA 3TNOA 1G4TA 2V0TA 4C1LA 1JULA 3MYPA 3LHZA 3W76A 1OFRA 3S42A 4OGZA 1DV7A 3O6CA 1IGSA 1H7NA 3R8RA 3KOFA 4UR8A 1ALDA 1TYGA 4ONVA 1LM1A 2RHGA 2ZRUA 3LRKA 3SI9A 3LV6A 3B0UX 4FX8A 4P2VA 4N9DA 3NQ7A 1FDZA 3DZ1A 5J5RA 1KTCA 4N9EA 3K30A 4OE7A 1GPWA 2JKAA 1WDWA 3FS2A 3TJLA 1ZFJA 2XN2A 1DORA 3PBVA 4FX6M 1H7OA 2BX7A 2C1HA 3T7VA 3M7WA 3HBLA 1KFCA 3A24A 2YYTA 4R53A 8TIMA 5HWNA 2BTMA 5FF7A 4PODA 3W72A 4O18A 1N8FA 3LI0A 3WK1A 1LOQA 3NZ1A 4JTHA 3W9ZA 3WJYA 4HNNA 4MZYA 3GNDA 4GUGA 3EXTA 4CNNA 4ZL1A 2XN0A 1BWLA 3GDMA 3NXFA 3Q94A 5GVJA 3W7LA 3DKJA 3N14A 1F5ZA 4O57A 4BR1A 4AHPA 4FIQA 1VCVA 2EF9A 3MI6A 3UY7A 3H54A 3G3DA 3NG3A 2BLEA 1VHNA 5LNWA 4JDBA 5LKYA 1T8XA 3BO9A 1FBAA 3DFOA 4H6KA 1W0MA 2B7PA 4O15A 3G8EA 5CPLA 3P7YA 4LC8A 1FX6A 1K8ZA 2ISSA 1UCWA 2WQPA 2GQ9A 4CLMA 3NDOA 2I14A 1LRNA 3GX9A 1VPXA 1R46A 1H1ZA 2DJLA 3AO0A 4Z1CA 2P10A 3RF9A 3G0UA 3HPZA 3UWUA 2CU0A 4XBKA 3G1XA 4ZQOA 2YFOA 1OX6A 3FKRA 4JDYA 2OT0A 3DAQA 1KM3A 1QPOA 3ABSA 1Q6RA 1XBZA 4M19A 5IBXC 1WAUA 1EP1A 4DPQA 4NJKA 2NUYA 2Z2UA 3OIXA 3ZS4A 3DFTA 4JN6A 3ZR4A 2BSLA 1AL7A 4ZQCA 2ZDRA 4LC6A 3HG4A 1V5XA 4Y96A 5K9XA 4EWND 3GXTA 2QEZA 3FYPA 4MLRA 1F6PA 4LS0A 1TTIA 5HMSA 2ZZ5A 1OK4A 2ZZ6A 3LDVA 4MY1A 2NX3A 3G1YA 4O11A 4HPJA 3P60A 1HO1A 4UFLA 3T40A 3UNDA 3UQNA 1SQ7A 2V5LA 2G97A 2V81A 3R13A 4DQWA 3EX2A 2Q8ZA 1FXQA 4JTSA 2RH9A 2CZDA 1EX5A 2EPHA 1SUXA 4UC5A 2C0AA 1OFQA 3W22A 1DVJA 2H3BA 1LTDA 4JYDA 4X9SA 5HQEA 4XKYB 3KRUA 3QQ1A 3GNNA 3TR2A 3TSDA 1FUYA 1W8SA 5TIMA 1QOQA 1A50A 1ZAIA 4JIQA 3D0CA 3W1NA 3JR2A 5F4XA 3W2JA 2F84A 4FB7A 4AAJA 2Q3OA 3SGUA 5EMUA 4EF8A 1YXDA 1JCXA 2GVLA 1T99A 2E5CA 1GTHA 1IIGA 2DJXA 2FIQA 3NAVA 4QM1A 2JK2A 3E9AA 5U7SA 3SGZA 3DENA 4Y90A 2O7QA 3LBCA 4K7VA 1W5QA 1YLVA 1L2UA 3W71A 5KZMA 4QQ3A 2GQ8A 1I2NA 2VFGA 3TIMA 1W5PA 1JR1A 4MIMA 5CPNA 4UXDA 5DCDA 3I7RA 3B4UA 3NQDA 3LXCA 1LRQA 1YDOA 2QF7A 3KRSA 3NNTA 1QMLA 3LXAA 3CB8A 3GDLA 3I65A 5CGQA 3UWZA 4UTTC 2JKPA 2WPBA 2QCLA 4WJEA 1RPXA 2NUWA 4JD4A 3HG2A 3GB6A 5BRBA 3G1FA 2A4AA 5EY5A 3QC3A 3EKZA 1F74A 4WOZA 3S8HA 3E49A 1A5CA 3VE9A 4AEOA 3QF0A 1YXYA 4KFNA 1OABA 4RZ4A 1OHLA 1VH7A 3BV4A 5KZDA 4DELA 1LP6A 2Z0IA 1H51A 2ZTJA 4XTIA 3VCRA 3E0IA 2H90A 5AC6A 3TFXA 4A29A 5F2LA 3M6YA 4UUIA 1W3TA 5I3HA 5AHEA 3UPBA 4NVTA 5G2WA 3NM3A 2A7NA 1GYNA 4FF7A 1LOSA 3FEMA 1PCWA 2AAMA 1EIXA 1TREA 1XL9A 1SU5A 3RNDA 3TW7A 2ZRVA 5HUOA 3Q58A 2QUUA 3PWAA 1G7UA 4IOTA 2FB3A 1UB3A 1R2RA 2E6DA 2QCEA 1ICSA 1JQXA 5F4WA 1A5BA 1L6WA 4UMAA 5EL1A 3BW2A 3G1AA 4FX7A 1D3HA 1W31A 3TH6A 1P1XA 2GPTA 3SW6A 4Z0JA 2J9XA 4DF0A 4WX2A 3KVLA 4MJZA 4GUJA 3P81A 3STCA 3CQ0A 3M0ZA 1GVFA 1KTBA 5FEPA 1NF0A 3TQ0A 6TIMA 3W7GA 2YXGA 2Q8LA 3A21A 1XBVA 5TQLA 3LI1A 3FLUA 3UYCA 1OYAA 4POCA 2A2IA 3IVSA 5DLCA 5CPMA 3LHWA 3W7KA 3NEVA 3R12A 2TMDA 4FNTA 1I2QA 2YDAA 4O13A 4X2RA 1TJRA 4BF9A 1YPFA 1TB3A 2J24A 3GKFA 3KFTA 2I9EA 1GG1A 3LERA 5F1UA 5LGZA 3S6DA 3C2EA 2B7NA 4CQAA 3O16A 3GYEA 4N02A 2C18A 1EWDA 1VLIA 3PB0A 3NZRA 5KTLA 4AWTA 3W7JA 4JTIA 5HWMA 3LCGA 2YFNA 4CCEA 4ALDA 5DBUA 4E2DA 2EAWA 2VKZG 3NPXA 4I7UA 3P61A 2O7SA 1NVMA 5EKYA 3LCWA 1TV8A 2W0UA 4PH6A 4Z0SA 1WOBA 1J5TA 3S0CA 2C13A 1QR7A 3DI0A 1FWWA 1H60A 4HHPA 4Z1BA 4QSHA 2RFGA 4O53A 1X1ZA 3MHGA 4QITA 3BLIA 4PA8A 1KM4A 3CM4A 5AC8A 1TO3A 3EKLA 2YR1A 4FNQA 1TIMA 3DXIA 4O4WA 5A8GA 1I2PA 4HKPA 1LOLA 5DY3A 1RVGA 1ME7A 3MP5A 3R89A 3PY2A 5LNRA 1K7EA 4IMGA 3HOJA 3L0KA 4ML9A 1TTPA 2JGYA 2ZZ2A 5AHNA 5EPDA 1QNVA 3DGRA 4CNPA 3M1ZA 5ABTA 2QDHA 2C6QA 6ALDA 1H1YA 3TXZA 2VFEA 1GYLA 3HIJA 1L6YA 1XFBA 2C19A 1S3HA 3P74A 1MXSA 1KFJA 5LNVA 2YGYA 1MEHA 2A0NA 4FHAA 4L4LA 1XDMA 2EHHA 1XBXA 4ADTA 2H8ZA 1UJPA 3P84A 5G5IA 1S5VA 4EIVA 3PSVA 2ZZ7A 4LV9A 3UPWA 1K7XA 5BNKA 4MJMA 3EX4A 4KFPA 2RDUA 3YPIA 4R33A 3DH7A 5DCBA 2ZRZA 3G3MA 1JUBA 4WY0F 2QCGA 1PIIA 1VR6A 5D04C 4TMCA 2Y6ZA 1WXJA 4GXMA 1JCJA 3VFLA 1EP2A 3HPXA 3MP3A 3MI2A 3U8GA 2ALDA 4NZFA 2QJGA 4MOZA 1FQ0A 4JX4A 1YADA 4DO5A 3ATZA 1MSSA 3NPUA 4JICA 3TA6A 4JTKA 4UMCA 3NPWA 3TV8A 4M7SA 4IX2A 2VEKA 1OVDA 2QR6A 3QMTA 3TSBA 1LLZA 4Y6GA 5LNUA 1IXPA 4O1BA 3NQ6A 4O4VA 1RQBA 5BOOA 2J9ZA 3QJAA 4MZ1A 2CLFA 3UWVA 2J6XA 3LOTA 4Y9AA 4TIMA 3GLCA 3USBA 5D02A 3W1LA 3PBUA 4PFMA 3QM3A 4DO4A 1QO5A 1LYXA 1LCOA 3PS7A 3NPVA 3CEUA 5FEXA 1EB3A 5AYYA 3HB9A 1KV5A 2WNQA 2Z1BA 1J2WA 3HG3A 3W1QA 3DFNA 5K7JA 3W85A 1T96A 2NWSA 2Y7FA 4C1KA 5K4ZA 1O5XA 3W2KA 4E2BA 3EWUA 2HS6A 2YSWA 3C2FA 1OX4B 4ICNA 4UFHA 1K7FA 2GOUA 1MEWA 1G4PA 1KM6A 1LBMA 1QPQA 5FEWA 3BG5A 2GJLA 5D2YA 2CLEA 3DFPA 5EYWA 4UCGA 5CZTA 3LHUA 3L2IA 3NYZA 5IM51 1G67A 2NXIA 4AB4A 3W7EA 5TBOA 5AN7A 5CZSA 2DZWA 3FIGA 3M47A 3W86A 3GR8A 3L9CA 1P4CA 1R2SA 1M5WA 2QCFA 2E77A 2CW6A 2R94A 3CLMA 3M5XA 4R34A 1GT8A 4FNUA 5LZLA 2GVJA 1H63A 3EWBX 4O19A 5E0KA 4NX5A 1TTQA 3TXVA 3IIZA 3STGA 3NO5A 3EX3A 4N9CA 3LCFA 1LDCA 1XBYA 3RLUA 1FXPA 3OEXA 1KM0A 3C4UA 1PL9A 2DP3A 5BW6A 3UZ5A 2JKEA 3QW3A 5AC7A 2X1RA 1W3IA 1OFAA 3PC0A 3MO7A 1PS9A 3LXBA 3TMQA 2ATSA 3C61A 5AYXA 1BWKA 4NNCA 3TAOA 1VLWA 3P8IA 4K8EA 5FF0A 1O5KA 5K4XA 1VJIA 3PSWA 2YW4A 7TIMA 3W7OA 3TX9A 3E12A 3QMRA 1GVOA 1SW3A 2ZYFA 2CZEA 4IMCA 3MHUA 1VCGA 4XQ6A 4NJHA 3PM6A 4UFJA 4Q33A 3AJXA 3G1DA 1EP3A 4UTLA 3F03K 2LLEA 2Z6IA 4O14A 1AW1A 4LS1A 4LVAA 2WOQA 2FQIA 2P0OA 1V7YA 2QDGA 3IVUA 1ZCOA 1SW0A 4FXRA 1UBSA 1MZHA 2HSAA 4JTUA 5D37A 3BPWA 1WYIA 3S5YA 3PUOA 4YLWA 1OFOA 4PC8A 5CZJA 3T4CA 4CNOA 1XI3A 2ZRWA 3L5LA 4NT0A 3RMJA 4BK9A 4ZMGA 2C3ZA 3IVTA 3TC6A 4R7JA 5AOUA 3WJXA 1R47A 4ADSA 2B0MA 3TDFA 3QW4B 1ZAHA 2QCHA 3C3NA 3W7NA 3L68A 5I3FA 4JTEA 4NNBA 3QZEA 4OV4A 5AHMA 2PRLA 3HQ1A 4EVZA 2BWGA 3P8JA 3NQGA 2J27A 3BG3A 2CLIA 3W73A 4OQVA 1SFLA 1UASA 4IQLA 2GQAA 3LLDA 4RZ5A 4LNYA 3EX6A 4GRSA 2NX9A 2PCQA 2VFHA 1SZNA 3WK2A 3W23A 3MWAA 3NQEA 2FJKA 2ZRYA 3I7SA 3BVJA 2A6NA 1NF7A 1TPEA 1F2JA 1XM3A 5EA9A 5D09A 5AHLA 4W9TA 4GC4A 1A5SA 3DKLA 4GBUA 5C2XA 2I1OA 3Q37A 4D2JA 1X1OA 3W88A 4M6PA 2NLIA 3M5VA 5FEZA 3EXSA 1JVNA 1KFBA 4HSNA 3DHFA 3DFQA 2NXHA 3L67A 3DBPA 2CFFA 2FLIA 2H6RA 1JJKA 4MYAA 1TPDA 1FCQA 2ABBA 1VGAA 2VEMA 5KINA 4Q32A 3M43A 2Q3RA 4AF0B 1GG0A 2Y63A 1AW5A 3SY5A 3GDKA 3IV3A 4AWUA 1G7VA 4LVBA 1AG1O 3RFAA 2H8XA 4JTTA 3IIVA 3NL2A 2NX1A 2KZHA 2FPVA 3QMSA 3PBWA 4WZHA 4Y8FA 3THQA 1Z44A 4HNVA 2VEPA 4JYEA 4DF1A 4XKYA 3EWXA 4K39A 3W7DA 4U28A 2A1YA 2CLHA 4O16A 1BTMA 5FF4A 2V8ZA 3LHVA 3IEBA 5J5DA 2QKFA 4K36A 3LRLA 3JS3A 4N6FA 4QISA 1A5AA 3LLFA 5D2XA 4JTLA 4AF0A 2C14A 4X22A 2ABAA 4QJ1A 3TKFA 2ZA2A 3GK0A 3VI2A 2PRMA 3BGGA 2A21A 3S5NA 3TFCA 3BLFA 3QH2A 1W5MA 4ZQNA 4LS2A 1DHPA 3S1WA 1H7PA 4TR9A 1F7BA 3O63A 4KWWA 1VQTA 5C54A 1LORA 3LBMA 1TJPA 5K9DA 3MUXA 4GE8A 3JRKA 2WV8A 3SFKA 4N9BA 4UTWC 3P62A 3KRZA 4MPQA 1TPUA 1SZEA 4FEZA 3U6WA 3W87A 1K3UA 3NGJA 1Y0EA 1YTKA 1VYPX 2A7PA 2B7OA 1ME9A 1WV2A 3NOEA 3GKAA 2WNZA 5L6UA 4N4QA 3BGJA 5AB3A 1B57A 1L6SA 3W7QA 3W2LA 1P0NA 1WQ5A 3BLEA 1T0OA 4JEQA 1FDJA 1QPNA 3L0GA 3MMTA 3F4NA 2ISVA 2ZFAA 3ANYA 3S5ZA 2CZ5A 5CZ0A 3LGEA 4YCOA 1YDNA 4M5PA 2FDSA 3QYQA 4WXZA 4NXKA 2PRHA 3GDRA 1NAL1 2E6YA 5D30A 4IJBA 1CW2A
chains in the Genus database with same CATH superfamily
5BMXA 3S6OA 2XSXA 3LUTA 3MMDA 5HPCA 3N12A 2OMAA 3G5EA 4JBRA 3LA4A 4C6BA 1MQRA 3OIHA 2XN1A 2YKKA 5DANA 5G4WA 1EPXA 3S1XA 1QDSA 1RD5A 4DBDA 3TCEA 4YTTA 5ABEA 3ZWTA 4HMNA 3A23A 3ELFA 2PURA 4KT2A 3OB8A 3QLDA 1GWJA 3QFEA 3SIZA 4KETA 4PMZA 3ITOA 3E5BA 3AI0A 2X1TA 3K1DA 3PG9A 1YIXA 3COTA 4M6UA 5E1QA 4DX3A 2HNEA 1LT8A 4AVOA 5ABFB 2V82A 1AMYA 1LBFA 4CCCA 3W74A 4YYFA 4A8IA 1Q3NA 1XLAA 3P5ZA 4MUZA 4NP7A 3TZFA 2Y88A 3BSHA 1SO5A 4C1NA 5D38A 2PP0A 4EPKA 4UQCA 4WRHA 3OZYA 3D46A 3ZJ7A 1R85A 4AD1A 4ERAA 1CXKA 1GQIA 1KO0A 4JX5A 4B5NA 4KGJA 4QNEA 3S46A 3O15A 4BCEA 4FO4A 1Z3NA 4O54A 2VYOA 4HHHA 2CWNA 4WCJA 5HNRA 2F2KA 1WOAA 1FWGC 4JY8A 3MI3A 4DWDA 2X1UA 2PI6A 3NQBA 4HSHA 4LV4A 3WDPP 4GWEA 3AFBA 1KCZA 4JXCA 4D71A 1HG3A 3MB9A 4E6MA 3PPFA 1SR9A 3KEHA 5DELA 2ZADA 3WD4A 4F3HA 2VC7A 4IUOA 5CC7A 4PL2A 1RV8A 1W9VA 4UNLA 4KWSA 1XH0A 1UA7A 4Z42C 4C6NA 3UF9A 4C7FA 2YA0A 1A0DA 1ITXA 1PWLA 3ARUA 4R3UA 5K2ZA 5LGXA 1V02E 3WLNA 1JGIA 3VGHA 1YBQB 1W3NA 4O12A 3RJXA 2WJFA 2TAAA 4XG1A 1V3LA 4QE5A 1HP4A 1SJAA 1X7FA 3GTNA 1Z42A 3C0QA 2GK1B 2VMFA 5HNNA 1KA9F 3S1VA 5KZEA 4IX0A 4N2YA 2PS2A 4HZ8A 1SMDA 3ANUA 3WJSA 1P0BA 3ZIZA 4RE0A 4F9JA 5IHRA 2W5FA 3BK0A 3M16A 5CKSA 5EFDA 1VFFA 3GTHA 1Q8AA 2O9OA 4CUCA 2BGQA 3N2XA 4DYKA 1EX1A 3OLEA 4R9OA 3S5OA 3BWWA 1UR4A 3RCNA 3VC6A 3ARXA 4QAIA 2A6LA 1E4NA 1L0PA 3GC4A 2TYSA 4ZOAA 1KWKA 3GVVA 4LVDA 3GZ3A 4RKAA 5BXTA 3W53A 2E1WA 3SRFA 1TCMA 3LTSA 4JGDA 1XLDA 2YYUA 3EDFA 4OV9A 1GJPA 2WXDM 3W1MA 3V75A 4TVUA 2Y5SA 5CCZA 4WD0A 3L2LA 1PJ9A 2V30A 2WZTA 5HPOA 2CZFA 3VIJA 1H7RA 2DV0A 3AYRA 4MFEA 3HPSA 1HKMA 3NL5A 1N7KA 1K02A 1E6XM 2QXWA 1WZMA 4XO6A 4H01A 2GJNA 3TWAA 5BROA 4Q22A 1IZJA 2VC5A 3GC5A 1TPWA 4PN2A 2VR4A 1XF0A 5JBDA 1IXOA 1JQVA 2PGWA 2OCZA 2P76A 5HAOA 1R3WA 4UTKA 1QASA 3O8AA 4ORIA 3CJPA 1J79A 2UY4A 3WKZA 1F6YA 4JL2A 1IWPA 4ZZ9A 1F73A 3WQEA 3KVJA 3MWCA 4A21A 3U48A 1U5HA 3SZ8A 3CT7A 1S5NA 4XZ9A 1GOIA 4LCQA 4LAOA 4Y9PA 2EKGA 4D6HA 2PDCA 4Q4MA 2JF7A 3T44A 2H3DA 4ORMA 5HJXA 4HPGA 2AMXA 3THCA 1TMQA 2NQ9A 1C29A 1F76A 2VWTA 4GG9A 3VNMA 1A3XA 4HSOA 4LJ3A 3A3HA 2KX9A 3VOIA 1UC4A 1NSJA 1KFWA 3A3XA 5FJOA 1TWIA 4IIFA 3W7IA 1S2VA 1PYMA 3ZR6A 3PUEA 2PWEA 4NI3A 3IJ8A 1ONRA 4GPNA 4KEUA 1UD2A 1UUMA 4Y9OA 3OBKA 1B90A 2BOEX 1G69A 1V3KA 1UD4A 4FNPA 1LRTA 2DSUA 1Z89A 2P1FA 4PMDA 2WSYA 3RILA 4I7WA 4DZIA 3UEQA 1UWUA 2J7GA 3L23A 4D8LA 4GMEA 1AH4A 1XYBA 4QEHA 1EHNA 4QXIA 1O12A 4GQGA 3OHMB 4J3XA 2VOMA 3PR2A 4AZBA 3W7MA 2JGQA 5H8PA 1JUKA 1TPVA 4H8NA 2Y8VA 1SZGA 1ZBVA 2EPKX 3KOWA 5A2AA 1G1YA 3DESA 3GAYA 2ZUSA 4LX4A 4JPGA 1BVWA 3NSMA 3TW6A 3MBDA 1XYLA 4MLJA 3WQOA 4M8UA 1P5BA 4Q4KA 4H8UA 1C92A 4IXHA 3HG5A 3GH4A 4PMQA 3ABRA 1FCVA 4FZIA 3ZMRA 3J7HA 3EWDA 1VEMA 2DQXA 4IMDA 3NFUA 1Y5XA 4K8GA 2XINA 2E28A 2CHRA 1UIOA 3CUGA 4K6AA 1KCXA 4KPLA 3ITTA 4JIPA 2AQWA 1O95A 1F6KA 1BXNA 1XIBA 2X1SA 4AD5A 3QKEA 1G6CA 2BP1A 3EMCA 4RE2A 3VDHA 2NV1A 4IXXA 2Z1XA 2OT1A 5KMYA 4LNCA 4URIA 4M0XA 1D3CA 1CT5A 1JZ2A 1PTAA 4NKCA 4ROPA 4E0CA 1SJDA 1V6UA 5LHFA 3IK4A 1C8VA 1V3MA 5DY2A 3ONBA 3GVWA 3U7VA 1FWAC 1GTEA 3EEZA 4JTGA 5DRIA 3VIMA 2CLOA 4OBTA 4E8CA 3C2OA 4QLJA 4J27A 1YEYA 3EPMA 1VFLA 2DZXA 4BEUA 4UFMA 2GGEA 1VBRA 1XUUA 3V1PA 3UD6A 3CWNA 3N9KA 3UJFA 1RJQA 2NVDA 5DN1A 1A53A 1IEQA 2AMGA 3PAJA 2VGIA 2A5HA 2QAFA 4NXSA 4WDTA 3VKDA 1OINA 3VNDA 3L12A 2NVAA 5CZKA 4CD6A 3UG5A 3P0XA 1S39A 2PAJA 1GJUA 5CBJA 4K7YA 3MUIA 1C3FA 1W56A 4RDZA 1BVNP 1PTGA 4RE3A 2XIBA 4S1FA 4UTTA 3NM1A 5AHIA 3W1PA 4UTUA 4MB5A 1C91A 2P5NA 3UG3A 3O6YX 3WEOA 4JHZA 1MUCA 2HVMA 4AQLA 5EBUA 2GSHA 4GKLA 2ZZ4A 2YL9A 1MXDA 2HEJA 3GFXA 4UTWA 2Z6JA 1W1TA 4NHVA 3FEQA 5C55A 1US0A 4IF2A 5HUPA 3GAKA 2ZX7A 3E02A 3KDNA 1XH2A 2PTZA 3FHQA 4N4PA 1AK5A 4RDYA 4B3KA 5GPRA 2EG6A 1X96A 4INFA 1KXTA 1HF6A 3VZXA 4BQ5A 3A22A 1K70A 1OX5A 3THAA 2CLMA 1PCKA 3ZJ6A 1B4KA 4LCRA 4M6QA 4RDWA 1JRCA 2W3ZA 4BZYA 3LN3A 2Y85A 3Q4DA 5FJRA 4S3FA 3SCRA 1EOKA 3BAIA 1LWJA 4IMEA 2RJHA 3IGSA 1VCFA 2OELA 2W9MA 2D2HA 3VMPA 1F3WA 1YXCA 4Q4RA 3DUGA 1TJ0A 5LIUX 1W3LA 4CQ8A 5D05A 1LLWA 4EXBA 1IIHA 1W1VA 5GJPA 4FF5A 4JY9A 1TPFA 4XIAA 3TSMA 5LA1A 4H41A 4RZBA 2PWDA 5AYZA 5I5RA 3SSJA 3AMDA 3PZQA 1PXGA 1FH8A 5M5DA 3E96A 4DEFA 3LHYA 4DBEA 1GPFA 4AXKA 5GNYA 1NWTA 3W82A 2YL6A 1PDZA 3WBEA 2Y7EA 3SY8A 3N19B 1TELA 3EWZA 4NAFA 4W8BA 2ONEA 4WQ6A 4A2RA 2Z29A 2SFPA 3OHIA 4YYCA 1W1ZA 2AKZA 1I9CB 2VT0A 4FALA 3AWOA 2PTDA 2YX0A 5BOFA 2A79A 4XUGA 1AH0A 4LEQA 4RW3A 3DGBA 1XDLA 3TN6A 3VABA 4JKLA 1WDSA 3SRDA 3B03A 4XIMA 4MB4A 2XWEA 4UFKA 1OD0A 5LHEA 2YZRA 2DGAA 4AHQA 4Q7NA 3H21A 3MZ2A 2GJRA 2GDUA 4M29A 3SEPA 3T55A 3O0FA 1Z48A 5ENLA 1UUOA 3TLQA 1IV8A 3HF3A 1FH7A 3F1QA 3M44A 1LUCB 4ZVJA 4DLFA 3LPPA 3W28A 3ZR5A 3EOSA 3N73A 5D2WA 1W2VA 4X60A 4CU7A 3T0TA 3MJYA 2BVWA 4ZSTA 1TA3B 2XVLA 1I0BA 1JCNA 1ZRQA 1AL8A 4MFDA 5G1TA 3I68A 4ACZB 1ZAJA 3GVGA 4PTWA 1E0UA 1JRBA 1UD3A 3LCXA 1JDAA 1ZY9A 2PDJA 3W7HA 4RNFA 3U7BA 4FLQA 3ME3A 3MJMA 1EZWA 5F4SA 5MHBA 4DJFC 1HJXA 3FV9A 1EUAA 3W75A 4WOQA 2WWCA 1OFPA 3M9YA 4HCDA 2OYMA 2FFCA 3T9PA 1UOKA 3PZIA 5G4EA 2FZDA 2PD5A 2GJPA 1XG3A 3E2RA 3ECQA 5D8WA 4RV3A 1HL2A 4H6RA 3VA8A 5A8NA 1UQZA 2RDWA 4BWLC 2PCEA 3R0UA 5EBAA 1EF3A 1LL4A 1F3EA 2QLYA 1THFD 2NQHA 4GC3A 4GACA 3SQSA 3WNMA 3M0YA 2FZBA 1ITQA 3O06A 1J4EA 1UKSA 3GUGA 3MSGA 3NZGA 3TJXA 1Q6GA 4MY9A 1W9PA 2J13A 1S5WA 3CK5A 4FS9A 2W66A 4OGZA 1DV7A 2YA1A 4L7ZA 1O1HA 1IGSA 4JTQA 3KOFA 1LM1A 2ZRUA 3LRKA 3LV6A 3I3DA 2E8YA 3G77A 3IJ7A 1UR9A 4AD2A 1K77A 3GYCA 4QHRA 1US2A 2FVLA 3K30A 1IZKA 1WDWA 2PEVA 3M0XA 4AEEA 2PZ0A 3CMFA 4PTDA 2XN2A 3PK7A 5A6AA 1FP9A 3PBVA 4G6CA 2C1HA 3EWCA 2DIJA 1HKWA 1R3SA 3GG1A 2PDLA 8TIMA 3LPOA 3TOYA 2CLPA 4PCSA 4WSHA 2G3JA 1NQKA 3LI0A 5TAOA 1Q6EA 2EXOA 2IKIA 4HNNA 3WUFA 4U3CA 2ODOA 1JF6A 1BWLA 3GDMA 1QRQA 3N14A 5E9AA 4YJ5A 4AHPA 2G50A 4DVOA 4Z1YA 5CQ1A 4FIQA 1VCVA 4GYJA 4ICMA 1B3ZA 3H54A 3G3DA 1CTNA 5LNWA 3UCCA 4JDBA 5LKYA 2R1LA 4C6LA 4Y9NA 3BMXA 1DQUA 1EEXA 3CBWA 1W0MA 2GOKA 1LQ0A 2B7PA 2C7FA 1QNOA 3EDEA 2DDXA 3P7YA 3H4XA 3R0DA 2ISSA 1JPHA 2WQPA 4CLMA 3TONA 3GX9A 4CQCA 1R46A 1XIIA 2DJLA 1A4LA 3RF9A 2E9LA 2VR2A 3UWUA 2CU0A 2VVNA 4KEVA 3G6MA 3RLHA 3L4UA 4PMYA 4B5XA 1Y5VA 4JDYA 2DVXA 4LAZA 3ABSA 3LMYA 3MMUA 4XSLA 4HCHA 4ZB0A 3GXMA 5IBXC 1VIZA 1EP1A 4NJKA 2Z2UA 1GQKA 3DFTA 4IIEA 3MQTA 3ZR4A 4I9MA 1POJA 1UH2A 4S3EA 1HJQA 1V5XA 4Y96A 4KCTA 3FYPA 1F6PA 2ALRA 1NM9A 4XAYA 3LEPA 4IFOA 2PU1A 4HB7A 3LDVA 4M1BA 3DFHA 2OO0A 1FH9A 1S5MA 2E8ZA 1N8WA 3T40A 3DDMA 3ITVA 3UQNA 3PBMA 2QVNA 1U1UA 1NWSA 1FXQA 3CAWA 2CBJA 5A8MA 1SUXA 4UC5A 1XR2A 3MVIA 1DVJA 4JYDA 3GNNA 2HE8A 4EXQA 1FUYA 1W8SA 2DT0A 5TIMA 3SCSA 4A05A 4I8DA 3D0CA 3IUIA 2DT1A 5F4XA 1XLGA 2F84A 2HPMA 4FB7A 5T91A 3IUHA 1YXDA 2F9RA 2GVLA 3ARTA 3N3TA 3T2QA 3V1HA 2WMGA 1DXIA 2FVKA 2JK2A 3E9AA 3PANA 3LBCA 2O56A 2VCBA 4Q4PA 4QQ3A 3AXMA 2ZXDA 2VFGA 4DXXA 2FZNA 5BOEA 1P6CA 3CHFA 1MRQA 3CYVA 4C6DA 3DG3A 1XYCA 3LXCA 1LRQA 4DM2A 1VRXA 3ARWA 1YDOA 3POCA 2QF7A 3KRSA 3WF1A 4Y2WA 2NSXA 3EDJA 1QMLA 3LXAA 1H0IA 1ZJBA 4PCPA 4Q8PA 1VEOA 1JDCA 3CL7A 1TVNA 4WGHA 1UC5A 3URQA 2A4AA 1IEWA 4JZ5A 2PGFA 2MUCA 4WOZA 3S8HA 1C93A 3E49A 1A5CA 3VE9A 1U33A 4JTDA 3PFRA 2GGIA 3BV4A 5KZDA 2X7WA 2VGFA 4JN8A 1UG6A 2H90A 3TFXA 4A29A 5D4YA 3P6LA 3B9DA 4BQ4A 3M6YA 4UUIA 1W3TA 3UPBA 3NM3A 2A7NA 5LXXA 4H8HA 3SAZA 5KETA 1SU5A 3TW7A 3Q58A 3VOHA 2QUUA 3IJ6A 1LQAA 2X41A 3VGDA 2FB3A 1UB3A 3HV9A 5REQB 1ICSA 4I9TA 1X6LA 3WFLA 3BW2A 3S9IA 5A2BA 4FX7A 1E5NA 4PBGA 1DHKA 3SW6A 1ZGDA 3M4HA 3UJEA 1HXJA 3IAPA 3KVLA 4GUJA 4QG6A 3QTGA 3KOYA 4QG8A 1RLCL 4EPEC 3LS9A 4K68A 5FSEC 3FLUA 2GVYA 4I5XA 3N2OA 5B7YA 2D2JA 3AICA 2Z24A 5CPMA 3W7KA 3K4WA 4B5UA 3QN3A 3T0AA 4C91A 4X2RA 1TJRA 1HP5A 3SN4A 3EMQA 1AZ2A 3CO8A 4S3KA 5F1UA 3S6DA 2B7NA 4LUSB 3O16A 1EWDA 3PB0A 3RPDA 3NZRA 3PHAA 4AWTA 1Q13A 3W7JA 4DNHA 2GZXA 3WNPA 1TWDA 2BHYA 1F3TA 4ALDA 5DBUA 2EAWA 3NPXA 4LCSA 2O7SA 1PWMA 3S2MA 4HNCA 2R1KA 1NDWA 2WVSA 5EKYA 3U2EA 3LCWA 3UCDA 3VNKA 1TV8A 3H7VA 4GYPC 4Z0SA 1AQ0A 1WOBA 3S0CA 1QR7A 1H60A 4FSAA 4UB9A 3FDKA 3TN3A 4Z1BA 3QLLA 2OR2A 3QZAA 3BLIA 5AC8A 3EKLA 4NZ5A 4FNQA 3WUBA 4ILSA 4O4WA 5DY3A 1H1NA 2QZRA 3MP5A 5A6MA 2HVOA 3L4ZA 1AQFA 4IMGA 1CXFA 1MFUA 3KS6A 1R8LA 1XSIA 5DMYA 3ENLA 1FA2A 2HXUA 3CUXA 4ML9A 3W00A 5AHNA 5EPDA 1QNVA 3BICA 3GG7A 3FJ4A 1EA9C 3BLLA 2ZUWA 3TXZA 4WLCA 3HIJA 1L6YA 1XFBA 1S3HA 3P74A 1KCLA 3RMEA 3VNLA 1OCNA 4IZGA 2XDFA 4FHAA 3BMVA 4GQ0A 3P84A 4AZ6A 7XIMA 5CEWA 3F2DA 4F0MA 1UROA 4MJMA 4KFPA 4S3BA 3PP7A 1E3XA 3VOJA 2QMJA 3KE0A 3WBAA 3G3MA 4S38A 4DJFD 2QCGA 2XH4A 4LBUA 2BBFA 3PPCA 3WL0A 5I77A 2I5GA 4EE9A 4GI4A 4H8VA 4W88A 3HPXA 1VBGA 4PMNA 4MOZA 4JX4A 1YADA 1MDLA 1F07A 2YDSA 3AIBA 4H7CA 3NPWA 3AHTA 1M3UA 4JNYA 4REQB 3QC0A 4GVHA 1LLZA 4C60A 5HJYA 5BOOA 4C6MA 2ACRA 4LAMA 3QJAA 2CLFA 1HNYA 4TIMA 3QHMA 3CL8A 4W89A 3FGCB 3QZ6A 3THUA 4DN1A 3VGFA 3TJIA 3QM3A 2QV5A 3VDAA 1QO5A 1NARA 3N17A 4A3HA 3W37A 1EB3A 3WO8A 3CMGA 1Q7ZA 1KV5A 4KEZA 3ARVA 5M03A 3DFNA 1A3HA 1XFCA 2WWDA 3R25A 4LH8A 2Y7FA 2FZ9A 2WVTA 5HBFA 3MTWA 2HS6A 4D6FA 2YSWA 2I5IA 3SDOA 2YB4A 1G4PA 4NZ4A 3V5CA 5ECUA 4JFVA 5CLTA 2GDVA 5FEWA 1GOQA 4W87A 1EJXC 2JEPA 3AHVA 1UMLA 3L2IA 4RNHA 1VBUA 2XUCA 4AB4A 3W7EA 2INZA 2DZWA 1WE5A 3M47A 3V0TA 4AY7A 2Z1KA 3W86A 3GR8A 5IRPA 1E15A 3VZYA 2E77A 3M5XA 3MKVA 5H6HA 4CU6A 4XD5A 4R34A 3ZVIA 5DQPA 3EWBX 1WXZA 1R3VA 3NO1A 4ZGYA 1LDCA 5D9NA 1REQA 3O2LA 1FXPA 1K9DA 3MY9A 5DF0A 1ISYA 5HATA 5FD0A 1GUVA 4H83A 1HN1A 4U5IA 3WQCA 1CCWB 3AWNA 3C61A 4NNCA 1FHVA 1FP8A 3BGAA 4K8EA 3M0VA 2HV5A 7TIMA 2V5JA 3W7OA 2FTYA 2R1NA 2CZEA 3MHUA 3DC8A 2IMRA 4XQ6A 4NJHA 1PTDA 4UFJA 4Q33A 3BLOA 4UTLA 3F03K 5HQMA 4O1EA 3XISA 1QOXA 4LS1A 4LVAA 4S23A 4H9VA 2OVLA 2D3LA 4JTUA 3CUIA 3S4TA 1VFMA 4YLWA 1XG4A 4XZWA 1EC9A 2ZRWA 4BK9A 3MU7A 4ZMGA 3TC6A 1R47A 2WVVA 1EO5A 1XLBA 1F61A 2EPMX 3VUSA 1V03A 2DH2A 1XRTA 4JTEA 1JI2A 2XM1A 1J96A 5AHMA 5AZ0A 3P0WA 2BWGA 3P8JA 2PFHA 2J47A 4K1GA 1SFLA 1UASA 4IQLA 4RZ5A 4LNYA 4ZOBA 4PMJA 2PDUA 1RXOB 4KEMA 3WK2A 4DUXA 3W23A 2POTA 3GUWA 2REQB 3MWAA 4XZMX 5CPSA 1TPEA 2VO5A 4FR6A 6A3HA 2W92A 5IHSA 2YL8A 1UKQA 2IPWA 4FA3A 3WIJA 1QATA 3O3RA 3A6OA 1XICA 4M51A 2I1OA 3GXIA 3Q37A 3S47A 1XQKA 3W88A 5FEZA 3EXSA 2F38A 4L1XA 3DFQA 3V3WA 2W63A 1CXHA 2C8NA 3DBPA 3B9AA 4QQUA 1K8CA 3QOMA 1TPDA 2IPJA 2XFYA 2BS9A 3TTSA 2WZEA 3RO8A 1OQFA 2OLSA 4AF0B 1AH3A 4DAIA 1IT8A 2Y63A 1AW5A 4QJ5B 4Z2IA 2AQOA 4AWUA 1G7VA 1AG1O 3RFAA 3IIVA 3NL2A 3B8UA 4HNVA 4JKMA 1Q6FA 1XLMA 4EXAA 2Z28A 3QFWA 1LF1A 3W7DA 2NSOA 4U28A 1M68A 1TWSA 4LANA 1KBKA 1BTMA 2IKGA 2OLAA 1TG7A 4EANA 2JQXA 4I5RA 4AC7C 4GKTA 3JS3A 1M53A 4N6FA 5E6YA 1JDEA 4E8DA 4RPQA 5AC5A 2ABAA 2ZA2A 2OZ3A 3GK0A 3NDYA 4ZA0A 3BGGA 5CJ5A 2PDHA 5FJUA 1XX1A 1W5MA 1TV4A 1BHGA 5AYIA 1TWWA 1X7IA 4HU8A 2CZVA 5EFFA 4TR9A 3O63A 4L4OA 3VGEA 1DJZA 5K9DA 3VIHA 3SFKA 4PMXA 2G37A 3P62A 1WDPA 2ZX8A 1NWRA 2IXVA 4FEZA 3VIKA 3S2NA 3W87A 1R0MA 1K3UA 3NGJA 4DBWA 1YTKA 1VYPX 1ME9A 1WV2A 1DE5A 3NOEA 1E4IA 4GJJA 4ERIA 4H9YA 4H9XA 7CGTA 4B9ZA 4D8ZA 1P0NA 1WDQA 4C6QA 2OG9A 4Y9MA 3L0GA 3F4NA 2ZFAA 4IGMA 3S5ZA 2WKLA 1Q6DA 3SCUA 4NXKA 1GQJA 1HVXA 1UMYA 4CQBA 2YBUA 3N13A 3AS0A 2W6RA 3RU8X 5FF3A 1XLLA 4LY8A 3WZ0E 4Q4OA 4PGLA 5F2IA 3C3UA 1V6XA 2RJGA 3AZSA 1E0WA 1VYRA 4ZODA 4HZMA 3GG0A 4RXGA 5K9CA 4LUJA 5JU6A 1ESWA 1XLJA 2FPTA 3DN5A 2J8TA 1VS1A 2W91A 1FHLA 3B3DA 1POKA 3AS2A 3WMBA 6TAAA 2VX7A 1RR2A 3POHA 3GDTA 1EJVC 3QSRA 5HNTA 4C6KA 1E73M 3HM7A 1HTIA 3FJ6A 1OGBA 4MWAE 3M0LA 2C0HA 4B5SA 4C6PA 2Y70A 3W6YA 3NL6A 2QPUA 3H2FA 3REQB 4NILA 5EMLA 3ALGA 1HX0A 3AHZA 1UPMB 3P93A 4MM1A 3VD7A 2DUXA 2W62A 1FWFC 3UXLA 3EOEA 4XBJA 5FL0A 1D3GA 1DOSA 1TQJA 3ABXA 3OG3A 3MUCA 1UWRA 5D03A 1ZJIA 1J11A 1PKMA 1JUEA 2E67A 2PF0A 3HGRA 4PSRA 3IIPA 3LPGA 4A8LA 4LTSA 4S3CA 5G2IA 2D2OA 1TRIA 4HGXA 3OA5A 1RA5A 1Y7VA 3RPMA 4UFIA 1SW7A 3R5EA 1UOZA 5GNZA 3AMKA 2GSEA 2QAPA 2IXUA 4KBXA 4LRSA 1H61A 3CASA 3AQUA 2AL2A 4AZHA 3RITA 1B30A 2GJXA 4PCTA 4EACA 4AHOA 3NA8A 3STPA 2PF8A 1XISA 3VE7A 1GVRA 2OTDA 5F2MA 4O28A 2PZNA 3CLWA 2J62A 3HGJA 4CD5A 3C2RA 1MQQA 4N42A 3T2OA 1O68A 3DFSA 3W1AA 2FHCA 4DJFA 1YTEA 4R9XA 1XUZA 3W27A 3IANA 3N2TA 1KM1A 1GJWA 1EZ2A 2C16A 4AVFA 4O0QA 1M04A 4PBFA 1H62A 1CLKA 3FOKA 1WA3A 1VZWA 1J0YA 3M5ZA 4PR4A 3RHGA 2R91A 3CUHA 1M7OA 3L0NA 1AJ2A 1L8NA 4WK9A 1NQ6A 1WP6A 4IMFA 4PUKA 3W3OA 4LVFA 3QHNA 4IWWA 1XGZA 1XIMA 1NFPA 2GLKA 4UR9A 3GIPA 1MW0A 3I6RA 4DUWA 3NQFA 1NEYA 3DHUA 3QBUA 3FA5A 1TCDA 4BWLA 4D6CA 5HWJA 5FI8A 3EBVA 3SUWA 1K03A 1Q6OA 1S5TA 2ATMA 3TAKA 2ON3A 3MPGA 4Q8UA 1LBLA 4UTFA 1AVAA 3TK7A 1MO0A 3P5YA 4H00A 3OG2A 3R0KA 4UBPC 4FIRA 1E3ZA 1XIJA 4PB4A 3G1RA 2PTXA 1W17A 3VPLA 4RL3A 1ZENA 4WY0A 4PCNA 3UXAA 3N29A 3EX1A 1FWSA 3ONCA 4O8RA 2L5HA 1E40A 1JCYA 4US5D 4ZQPA 1EOMA 1O66A 4GZJA 3GIYA 2WB5A 4AFYA 2VXNA 4NRRA 1QFEA 5EMKA 1H11A 2D0GA 5CPOA 2X0SA 3TP4A 1QJWA 4IQJA 1CGYA 3PTQA 3C52A 1R7AA 4W84A 3GXNA 4UOQA 4MNLA 1A5MC 1F05A 3VGBA 1QWGA 1JCLA 4HHLA 3LV5A 1IR2A 1YYAA 1VP5A 4NNAA 3P67A 1XIEA 1Q45A 4Z1AA 5C7HA 1A0EA 1G01A 1HW6A 3TZNA 4EF9A 3ZLGA 4RNIA 3ZFHA 2BVYA 5DMNA 5HANA 1YRRA 3TN4A 1E6NA 2BY1A 4GUFA 1XCFA 1FVPA 1K6WA 5XIMA 3NJ3A 2XGZA 1DIEA 3B0XA 1I0DA 2Q71A 3IRSA 1J9YA 2AOSA 4GA8A 4BQ3A 3L4YA 3BAWA 3EA3A 3H55A 3GW0A 5CBIA 1DJQA 1A49A 4F0HA 1WKFA 3M41A 3CPRA 4PTMA 4HPHA 3A3WA 5U4NA 2DSVA 3NQMA 3WMLA 3SADA 3LTYA 1ML1A 4E38A 1GHRA 3AXHA 5CGMA 2GQ3A 3BUVA 1C9WA 5D2VA 3BQ6A 4MY8A 3GD6A 3B06A 3SRHA 1QBBA 3OZMA 3A5FA 5BRPA 1HUVA 1Q6QA 1GOXA 3CAKA 5IBXA 2OWXA 4QAWA 2BNJA 2TPSA 4OTKA 3H2EA 3CIXA 1DL3A 4HNUA 4S39A 2CXEA 4OHQA 1HVQA 1U5VA 4ASTA 3IGUA 2QQ6A 2B4GA 3AXXA 4V27A 5MKGA 5A94A 5A95A 1PSCA 1QW8A 1B2YA 2VX5A 3LGDA 1NWUA 3RO6A 4EPBC 3ES8A 1T6MA 4LW7A 1M7JA 3QPZA 2QDDA 3NURA 2VEIA 3CHEA 3WD2A 3ITLA 5DCEA 4A3YA 4O50A 3VU2A 1PAMA 1ZU8A 2Q6ZA 1V6VA 4TUFA 1IXNA 2V3DA 3QY6A 4RDVA 1YMYA 1B3WA 4XAGA 1AZ1A 1SZFA 5XINA 1RQHA 2P53A 4FI4A 2OWWA 2PA6A 1Q7QA 4HU0A 1G4SA 2WCSA 1IGWA 3MP4A 3WBYA 4UIOA 3LU2A 1CB2A 2D69A 2DZAA 3N1AA 1I6NA 4IL0A 1B4EA 1WAWA 4IJRA 3LM3A 5HINA 4GX9A 3VZZA 4L6DA 3VD5A 3RXZA 2ZA1A 5TD4A 4O10A 4OUIA 5C2CA 1O60A 4G5DA 4WSJA 4U2ZA 3QV8A 4IJCA 5A2CA 1P43A 3P80A 1ICPA 4L5ZA 2WKJA 2DZSA 4K8HA 4HOWA 3NQ8A 3ARSA 1R9YA 4Q7BA 4HN4A 4AMAA 1MDRA 1HIZA 2GUUA 3BW4A 3APGA 1PZ2A 2C71A 3WK0A 1JZ6A 1IXQA 1XD0A 3VYLA 3B8IA 1U83A 3W6MA 1TUXA 5EMJA 3EB2A 3SUTA 1R30A 1OT1A 4P7LA 4J4KA 3NL3A 1NELA 4DHGA 3AXKA 2QJJA 3KP0A 5FACA 1KXHA 4NL1A 1W1A1 1FWNA 2V2HA 3R10A 1TRDA 5CXPA 1CNVA 9RUBA 1UHVA 4WUIA 2RDTA 3W07A 1KM5A 5F2GA 3BURA 2HJPA 5T26A 2PLJA 4P5UA 1GYMA 3ABQA 2VQUA 1F4AA 1EF2A 1HFBA 4LBRA 3FCPA 3FK4A 3USZA 4B4HA 2WSKA 4J3VA 3WF2A 4HA3A 3W4RA 1UYQA 1TMHA 4K38A 5AFDA 4NJIA 1PHQA 4DO7A 3H12A 2NXGA 1XLHA 2JBMA 4OWGA 2QCNA 2IQTA 2VC6A 1PX3A 1TMLA 3L5MA 4TMBA 5FA5A 2ZA3A 4QDMA 1L6GA 1C7SA 4EOUA 2XZ7A 1FHUA 3W1RA 3LTPA 4WIWA 4I6VA 1KM2A 4WKHA 2Q02A 4GUHA 5FOOA 4BFAA 4J7RA 5C6MA 3P2VA 4C90A 3UZYA 4UMBA 3IWPA 4HMEA 2BXVA 2E3ZA 3NUKA 4A3UA 3W24A 4JFWA 2D24A 1P7TB 3VX0A 3SCTA 2CETA 3PZGA 2OZ8A 1QNSA 2QJNA 3LCLA 4QTGA 1WPCA 3WNOA 4DXVA 1B54A 5AHFA 1BSLA 1XGEA 3ZQ9A 3O05A 2X2GA 3NIYA 2W79A 3W7CA 3FXGA 4ZQRA 1KR1A 4RLIA 1OFBA 1KLZA 4GH3A 5ABFA 4GYPA 3UT0A 3W1XA 1I4NA 1OB0A 1V0MA 3N6QA 2VM8A 4JYFA 3CV2A 3KHJA 3B9OA 2WSQA 4GVGA 2J79A 4GH1A 4EAMA 3VIFA 1JFXA 4UTIA 1EUNA 1SSGA 3PG8A 1DEDA 2MNRA 3V4BA 1XC4A 2PU0A 1DWFM 3KS5A 3KVMA 1KV8A 2PE4A 3W1UA 4C6FA 3WQFA 4DJEC 1HKVA 3NYDA 1QCWA 2YA2A 4HA1A 1F8IA 3WFZA 1VIWA 2BB0A 3MUY1 1LJYA 3VNZA 1X6UA 4Q7IA 4F40A 3TVAA 1BXBA 3I3BA 4FXFA 1I8JA 5D9PA 1FCUA 1QNPA 3B0PA 4P7RA 3VKJA 3HMJG 2E68A 2ZUUA 4P61A 4M56A 4O52A 2HWGA 4BA0A 3IJQA 5RUBA 3WQWA 3WELA 2HBXA 3NVDA 1J0HA 1CX9A 1KFLA 2CLKA 1YBQA 1IT0A 2V38A 1XPYA 2H9AB 1KTNA 2DZVA 1UJQA 1FY6A 4HOXA 1QI5A 2QS8A 4TOQA 5DT5A 3MANA 1IEIA 2JFEX 1ZBKA 4W85A 2YPIA 5K3VA 5FF2A 4L9ZA 3VAVA 1UZ4A 1EGVA 4YXGA 3R6IA 1UUQA 4RV8A 3MBFA 1W1PA 3O6AA 3QQ0A 3AROA 2CEQA 3MA8A 3V7PA 3W81A 3B9NA 1DJNA 4GZ7A 3L21A 3XIMA 3C86A 3WFAA 1DJIA 1TV5A 3V5OA 2ISWA 1NOWA 2DORA 3EB3A 1ZB5A 3KZSA 3A4JA 3H24A 1WB0A 2OLHA 3C8NA 1YKWA 2OOFA 3W84A 3CO4A 4HU4A 3W7PA 4RNJA 2FGBA 1T5AA 2QNEA 2ISDA 3S2CA 1XSJA 3S9YA 3KL0A 2V3GA 4N6EA 4AIEA 2RUSA 2YW3A 1RJRA 2WMIA 3G0SA 1G4TA 4C1LA 2CPUA 4ZO8A 3W01A 3W76A 1OFRA 3SIMA 2OYLA 2WPGA 3VD3A 3O6CA 2ZWYA 2FGZA 5M17A 3UFYA 3R8RA 1ECEA 3D5HA 3SI9A 4US5A 3SCQA 3UGVA 4FX8A 1S2TA 5DX7A 4EPDC 3FS2A 4Q8TA 1CGUA 4A6GA 2BX7A 5DRCA 2RDXA 3SUVA 2G3IA 2AGTA 1KFCA 3A24A 5HWNA 5AVNA 2BTMA 5FF7A 4PODA 3LSCA 1LOQA 1FWJC 1XRVA 1RK5A 3WJYA 2VWSA 3GNDA 4GUGA 2UY5A 1W9DM 4ZL1A 5KZ6A 5LIWX 4AMCA 4KERA 3NXFA 5C2GA 1BG9A 4J2MA 1F5ZA 4NG3A 1E6RA 1P6BA 2EF9A 3NG3A 4AZGA 8A3HA 4MTVA 1GOMA 3BJSA 4FPSA 3BO9A 1FBAA 3HTWA 1WNOA 1FWDC 4LC8A 1GW9A 1FX6A 4L61A 1K8ZA 5IDZA 1UCWA 2GQ9A 3TC3A 3MMWA 2I14A 1VPXA 3VMOA 2P10A 3HPZA 3K2GA 3M0IA 4PMVA 4HYWA 4XBKA 1LLOA 2E4TA 4QRNA 2PD9A 2ZVRA 4W8LA 3MKCA 4ZQOA 2DT3A 2VEFA 2XVKA 1AFSA 3FKRA 1DWIM 3BCDA 1J0KA 2X42A 2DSKA 4WR3A 1XBZA 1WAUA 4DPQA 2OSYA 2NUYA 3OIXA 3ZS4A 1TVPA 3UYIA 4ZQCA 3HFTA 3RG6A 3U0HA 2ZDRA 4WHBA 2V5KA 3ARRA 5CC3A 3EYPA 2XWDA 5K9XA 3TJ4A 3IPWA 3E74A 4EWND 5JH1A 1OIFA 4MLRA 4ZTYA 4Y7EA 5A6KA 1JAKA 3KBNA 2ZZ5A 4E2OA 1W8GA 2R24A 4ROQA 4MY1A 8RUCA 3G1YA 3LZ5A 2WVUA 2WJDA 1P0EA 2E7FA 3UNDA 2VNCA 3DYPA 4DQWA 5FIPA 4IIGA 1IWAA 2IKHA 4Z17A 1HGYA 2CZDA 2YCJA 4DM1A 2PWVA 4C6CA 1ZBCA 6XIMA 2EPHA 1GKQA 4OVXA 1OFQA 2H3BA 3H2AA 4X9SA 2VOTA 1A50A 3LQGA 1WKYA 2Q3OA 2HDJA 4WDXA 3SGUA 5M2FX 4EF8A 1T99A 2E5CA 3R58A 4QE4A 1RHCA 1GTHA 2DJXA 2NT1A 2FIQA 2XHYA 3UXIA 4AD4A 3SCPA 1BRLA 3SGZA 5I09A 4XD4A 6XIAA 5A8PA 2O7QA 3VIIA 2IPGA 3WL1A 6REQA 4IIDA 1HJWA 1L2UA 3W71A 1GNXA 3CZ8A 2GQ8A 3PPGA 3HU7A 1I2NA 5J8LA 3GNOA 9CGTA 3FSTA 4GISA 3RN6A 5DCDA 4GGHA 4K1WA 5C8BB 1AD1A 4IICA 1GORA 4D9PA 1Q6CA 2ZICA 3DYMA 4Q8WA 3GDLA 3T1GA 1XYMA 3MUAA 2F6XA 3UWZA 4FR1A 4WJEA 3KTSA 1RPXA 2NUWA 3HG2A 3GB6A 5EY5A 1T7LA 3NTYA 1SJCA 5T9BG 5A6SA 3KWSA 3SCVA 4AEOA 1YXYA 3HJEA 2QYGA 4KFNA 4HBKA 1RALA 3PTDA 4L1GA 1DWHM 4R85A 2XIIA 3BOXA 3CZLA 5AC6A 1GOWA 5F2LA 2FHFA 2CBUA 5I3HA 5FSDC 5AHEA 4BJHA 4NVTA 5G2WA 4A35A 4FF7A 1LOSA 3UU0A 1KBLA 1PCWA 4QSFA 3OLIA 2IPFA 3RNDA 1TFVA 3E0VA 3FDGA 1XQLA 1M41A 3B8TA 3FHAA 3MSYA 4B92A 4H7VA 2VGBA 1A5OC 3E1F1 2RGLA 3AIEA 3BE7A 3EA2A 3WX7A 1D3HA 1W31A 1TVLA 3UR7A 3TH6A 3WLSA 1AA1B 3LZ3A 1UQYA 4Z0JA 3F4DA 4DF0A 4IGSA 4BEQA 2BY3A 4MJZA 3P81A 3OVGA 2ZUTA 1V0LA 3M0ZA 1PEZA 5LA0A 1KTBA 3W7GA 2DSWA 2QGYA 3BAXA 2JIWA 2YXGA 3FVMA 1RK6A 3TQPA 1OYAA 4POCA 3IVSA 1Q65A 3LHWA 5LA2A 2AAAA 2YDAA 4O13A 4A3QA 3WH5A 2I9EA 4V1YA 1DIKA 3LERA 3C2EA 4E5TA 5GQBA 1BF2A 3ZZ1A 4X0VA 2GWNA 4N02A 4EAYA 5JUVA 1Z6KA 5KTLA 1AUSL 2WC3A 3OYXA 1UR1A 4EK7A 4CCEA 1W3HA 1E1CB 4E2DA 3N4FA 3GU1A 4I7UA 3P61A 4NZ1A 1C8XA 3GE7A 4H6QA 1ZP3A 4B91A 3EPNA 2W0UA 1JYWA 1J5TA 4P7NA 4AYSA 5EU9A 3BV7A 3S3GA 3VM5A 4HHPA 4MNKA 4JN7A 2RFGA 1X1ZA 3MHGA 1B3YA 1V3JA 2YR1A 3H2MA 1TIMA 4WVXA 4J3UA 4GYFA 1I2PA 5TNVA 1LOLA 2CKRA 2OKOA 1OGGA 1EJWC 3PJWA 5CG0A 1ME7A 2CIPA 4AWEA 3R89A 3PY2A 3RR1A 3E0LA 1K7EA 1W3KA 2X2YA 2JGYA 4XAPA 1V79A 3OQ8A 4XD6A 1QUMA 5ABTA 4XZHA 4DJED 2QDHA 6ALDA 4IPNB 2PDYA 3U9IA 2VFEA 3A4AA 2AL1A 3UG4A 4V15A 5LNVA 2YGYA 2A0NA 1XDMA 2EHHA 4ATDA 2AQVA 2ZZ7A 1LUCA 4V1XA 2YZ5A 3UPWA 3VMNA 1K7XA 2POZA 5D8ZA 4C7DA 3YPIA 1KXVA 3DH7A 1U30A 1MNSA 3JU2A 3GBDA 1JUBA 3LD5A 1QK2A 3WLKX 1TX0A 1VR6A 5JBFA 3GG8A 4R88A 2WZHA 3U5YA 2Y6ZA 1WXJA 4ACZA 3W29A 1QWKA 2R1PA 3MP3A 1WUEA 3KDOA 3ATZA 4V28A 1MSSA 3NPUA 3TA6A 1DPMA 4C5YA 3K8KA 2V3EA 4XO7A 1JD7A 1GZ1A 2VEKA 1OVDA 2QR6A 3QMTA 3WQ8A 2XYLA 3TSBA 4Y6GA 3R8GA 1A47A 1RQBA 3HQNA 4LUTA 3UWVA 3O0KA 4Y9AA 5FL1A 3USBA 2OKTA 4PFMA 4EP8C 1CGWA 1Z8AA 1O1ZA 3PS7A 1IE7C 3L4TA 5FEXA 5C9ZA 1HGWA 1GHSA 3HB9A 3TTYA 1J2WA 3OZOA 3ES7A 3W1QA 2NWSA 1E9YB 4LF1A 5K4ZA 1ZJHA 1ISVA 2J7DA 3W2KA 4E2BA 1ISWA 3QTPA 2BFGA 1OX4B 2GOUA 2J7BA 1LBMA 4RPPA 3T42A 4C6OA 3UR5A 4JFUA 2VGGA 3BG5A 1EGMA 3SUUA 1S38A 3FY1A 1Q5MA 2O55A 3LHUA 2D0FA 3KWXA 4JQ1A 1MI3A 1G67A 4KMQA 2NXIA 3APTA 5H8UA 2ICSA 2OB3A 3N25A 3XINA 1XS2A 5AN7A 1ZP4A 2OQHA 5I2UA 4G1NA 3QR3A 5I00A 3AZTA 3WYZA 3KP1A 3L9CA 4WSKA 1R2SA 2WSPA 2HK1A 2CW6A 2R94A 2VQTA 3CLMA 1GT8A 1J6PA 4FNUA 1E9IA 1EFZA 4S3AA 5LZLA 4O19A 2EPOA 3TXVA 4NX5A 1CLVA 1X98A 3STGA 6ENLA 3W38A 4GIAA 1KRAC 2DH3A 1XBYA 2Y1HA 4XV0A 3OEXA 3C4UA 3KLLA 2DP3A 2EG8A 1KBBA 4MUPA 2YDRA 3OO2A 2JKEA 1YW1A 2FZ8A 4HTYA 1PS9A 2CBIA 4KF1A 1CEOA 1VLWA 3P8IA 5FF0A 1O5KA 1RVKA 4H19A 1FWHC 2YW4A 1JGMA 2WVVB 3IJIA 1GVOA 1SW3A 2VTFA 2YB1A 2ZYFA 4H1ZA 1BKHA 1OZQA 3DG6A 2WLZA 5C9WA 2XH2A 3QPEA 3VVGA 1K9TA 4G7EA 2PWGA 5HK4A 4AEFA 4OUEA 2Z6IA 4O14A 1AW1A 2P0OA 3IVUA 4D1JA 3WQ4A 2HSAA 5D37A 4A4AA 1WYIA 3S5YA 1XI3A 2DUAA 2PDIA 4I3GA 1HJVA 4NF7A 2C3ZA 5C0QA 3WJXA 5A8OA 2R6OA 3MKKA 3SUSA 2NVCA 4ADSA 1W9XA 3ARZA 3QW4B 1ZAHA 5IFPA 2A3CA 3L68A 4W93A 5I3FA 4ZBCA 3H2CA 3F7JA 3GVQA 4NNBA 3QZEA 4C6EA 2PRLA 3HQ1A 3HPFA 2J27A 3CZJA 3W73A 1G0CA 2OQLA 1PB0A 3E3HA 1JNEA 4DJDA 4GZEA 1MUMA 4IT1A 1QNRA 1PO9A 2A6NA 2VX6A 1NF7A 3KOZA 1XM3A 3GHTA 4J5NA 4OFCA 3H2NA 3E5PA 4W9TA 3RAOA 4JHMA 1TE1A 1QI4A 1UP0A 1X1OA 2QPXA 3NXLA 2NLIA 4M6PA 3VTRA 2DVUA 5T8GA 1JVNA 1W32A 1KFBA 4XZBA 2DT2A 1DJYA 2NXHA 3AIRA 2BXYA 4F0LA 2CFFA 2DUZA 1JAEA 4ZR8A 4MYAA 1TV3A 2E9BA 1FCQA 2ABBA 1PKYA 4ES4A 2XVGA 2VEMA 3RRAA 1E6PA 1GG0A 2G0WA 4CNUA 3U57A 3SY5A 3GDKA 3TR9A 2ESCA 3WDRA 4DBUA 2Y8UA 4LVBA 4JTTA 2NX1A 3VD9A 3QMSA 1EQCA 4Y8FA 4MADA 5FJJA 5A69A 3VIGA 3OYZA 2BHUA 3QGKC 1XINA 2QHAA 3EKGA 2A1YA 4QFUA 2OODA 4YS1A 4QCEA 1V0NA 3PNUA 4FLSA 3VC5A 2ASHA 1DYSA 4KQNA 1D2KA 4K36A 3LRLA 1EJRC 1ZTVA 2HZGA 5D2XA 4ZB2A 4M24A 4X22A 4QJ1A 2QGHA 2A21A 3S5NA 2A3BA 1K9EA 3DBNA 3TLLA 3S1WA 4ZO9A 3MSRA 1XIGA 5I7GA 1OC6A 3EOLA 5C54A 1TJPA 3JRKA 3FYYA 4PRRA 3QVQA 4C5ZA 4UTWC 1VFHA 5HMFA 2OQYA 1R3TA 5FJTA 3U6WA 1Y0EA 1DIDA 4QLKA 1Y65A 1OCJA 2V5DA 3E0FA 5IOBA 5AB3A 2PB1A 1WQ5A 1T0OA 3NZPA 1QPNA 2D1ZA 2PDPA 3MMTA 4AY8A 1KR0A 4L6HA 5I24A 2Z4GA 3VKAA 4YCOA 4MB1A 3QYQA 1CLXA 2XIJA 1TIWA 2KAUC 1E5JA 2E6YA 2PDKA 5D30A 1CW2A 3CWHA 2UWFA 4IM4A 1I2RA 2Y24A 5G4HC 3RM8A 5BMWA 1ENUA 1BWVA 2A3EA 3BANA 4GLEA 4LT9A 3AU2A 3EGJA 4PUDA 1V8EA 4QDWA 4KWUA 5LXEA 1AQMA 4AG0A 4GK8A 3O1NA 2HPIA 5CSRA 2VDGA 5CSUA 2QIIA 1XRFA 1WUFA 3U2OA 2HMCA 5REQA 3DECA 4WXYA 1H49A 4JHOA 4MYXA 5GJNA 4ZEPA 3PF3A 3K5XA 2F6UA 4NZ3A 4IH3A 1Z7AA 4UOJA 5AYBA 1OC5A 3N4AA 1D7FA 4ADUA 4Z2GA 4D6GA 3TTEA 1E0VA 1ME8A 2EKCA 3CHDA 3OJGA 3KXQA 5BWAA 1X8FA 3GFYA 3CIVA 1XXXA 1SPQA 4Y8EA 1HT6A 1PV8A 4X63A 3Q65A 4KWVA 4MWAB 1Z41A 3RLVA 3JW7A 4YHEA 2EGZA 4LAUA 3PN8A 3UWWA 2E6AA 1JCMP 2AL2B 4LUYA 2WC4A 1PHWA 2GJXB 2Y7GA 3ABZA 3GNXA 4CVUA 2C15A 4IQEA 1XYFA 2HE5A 7REQB 2FFIA 3O9NA 3P3BA 4S2BA 3N18A 4HA4A 2V68A 2BY0A 4GHRA 3LCHA 5AKQA 4IPJA 3ZJKA 1ZBWA 4PCFA 4NAEA 3WDQA 1BPLB 3MYOA 3SR7A 4UTHA 4PUEA 1M7PA 4I7VA 3NOYA 4HHMA 2DZUA 3WJZA 4ACYA 2WMHA 3EMZA 1RY8A 4MKNA 4G1KA 4AC1X 4F79A 1UWSA 1SO4A 1XYZA 1VBJA 2GUYA 5DEZA 4JX6A 4LRTA 2XIOA 2NQ5A 1WZLA 4GI8A 3GFZA 3BG9A 3B40A 3DIPA 1EEPA 4C65A 1YHTA 2YXXA 4TQTA 3AISA 1CBGA 3C6CA 3GXPA 1MUWA 1KW1A 4MVAA 1QO2A 1XC6A 4J3ZA 2J75A 3TU9A 2GVGA 1RCXB 2WM0A 4B90A 3W2MA 2XFWA 8XIMA 1OGSA 5C7VA 3TE9A 2Z7KA 2DQWA 3RJYA 2VI0A 4F9DA 4LYPA 5I3JA 4RE4A 3A5VA 1PE1A 1W5NA 4XAFA 1QHZA 3DC0A 3F4WA 1V6TA 1ZNNA 4MJ2A 3KVKA 4ZB5A 4Q8OA 5AY7A 1SFJA 3JZEA 3N3MA 1LROA 4WY0B 4L4PA 3WK3A 2J7EA 3R2GA 3ID7A 8XIAA 1DJWA 3ZYZA 1I75A 4GXPA 3LM7A 4C6IA 3W7RA 1S2AA 4LF2A 4PEKA 3KBSA 2C1IA 4REQA 3MCNA 4AH7A 2QDEA 4IHCA 1RH9A 5HQLA 1W37A 2FTWA 2VFIA 4E4UA 2XG9A 4CEUC 5JBEA 5CBBA 2BZNA 2NZLA 1ZZMA 3L4XA 1RAKA 1HKJA 2VL4A 3FGCA 4MKSA 3IACA 3O6DA 3UWQA 3S1UA 4FLOA 4KIEA 1QPRA 2HS8A 1H0GA 5G1YA 1ZALA 4KH2A 4AIOA 4S3JA 2ZBTA 2VHLA 1JFHA 2PDGA 4N0RA 3WENA 1LWIA 1DWGM 1Q4NX 3PVFA 3S5SA 1BF6A 1DQXA 5G1MA 4CD7A 4K3ZA 2QCDA 1XLEA 3KBWA 3I6EA 3GR7A 4LUIA 2XH0A 4GI9A 3PZOA 2QUTA 4US6A 7ODCA 3ZSSA 1CI1A 2J8FA 5FCZA 3TNBA 1J0IA 1TZ7A 3L7RA 2BGNE 1GVSA 3I4KA 5E93A 4AVNA 5E0FA 1OM0A 1G4EA 3NQ2A 5LNSA 3H7RA 1PYFA 2JF6A 2PMQA 1ELSA 1XIFA 2E25A 5CSSA 3W2UA 2OEMA 3EA1A 3W83A 1VYSX 4NJJA 5CLWA 1KFEA 4CGTA 3T0CA 4FOUA 4DB7A 4WEVX 5MKGB 2ZX6A 3CTLA 1DTNA 4O17A 1JYVA 1B3OA 2E5DA 4L65A 3UA3A 3UA4A 3N04A 1H3GA 1B3XA 2WAGA 2NWRA 4E2VA 3ZT5A 4NZJA 1WBJA 3S2LA 1VBHA 3V18A 3RM4A 3WLJA 4LU0A 1XW8A 3PZNA 4IISA 4CVWA 1ADOA 2CLLA 3RRXA 1E4MM 3BW3A 3CQIA 3W2NA 2P0IA 4MZ8A 2ZE0A 3RX2A 5BU9A 1K8YA 4R5EA 1TWZA 3C0LA 3CEPA 4EX4A 4GVFA 3MV11 1K6AA 1QAPA 1W5OA 1VC4A 4YMZA 3VKBA 2VRKA 3AHYA 5MF5A 2XIMA 1BKSA 1XLKA 4O1CA 1TQXA 5C9RA 1UZ1A 1R2TA 3HGOA 3BDKA 3TQKA 4E4FA 4MAZA 4YIWA 3TYUA 1BEUA 3BCJA 5EGRA 1OFEA 1MZRA 1C9DA 2HBVA 1GK8A 3M46A 4K37A 4MMWA 5BRQA 1KXQA 2DZTA 2P50A 2GGJA 3NQAA 3CUZA 4GNJA 2E5BA 4W4QA 2ACQA 2YOCA 3UZZA 3A47A 1N55A 5D9MA 3HMCA 3U5UA 4DY1A 4MDPA 4ZOCA 4IIHA 4GOAA 3BQ5A 3Q2DA 1Q6LA 1V77A 5EMYA 4HZ6A 1WKDA 3IIOA 5I3IA 2I7GA 3VKCA 1OJXA 4LYQA 3WEZA 3U3HA 3G22A 5G2HA 4TO8A 4KRUA 3M6DA 2OEJA 2OZTA 4Z2KA 4DBSA 1JZ8A 1X1NA 4HNOA 2CWXA 2ZC1A 3NQVA 3CXOA 3WLQA 2BOGX 2VP8A 4JTJA 1S3TC 1RBOB 3F2CA 1CYGA 1R6WA 3AYSA 1SO6A 1J0ZA 1F8MA 4YL2A 1Q4WA 1O4UA 2FJUB 4CN6A 1NDVA 3G1VA 3SM0A 4RCXA 4OU1A 1AJ0A 3UR2A 2WO5A 3WF3A 4A22A 2VDHA 1XCXA 5JIWA 4WJ8A 3UNTA 2QCMA 5DXXA 1L2QA 2J66A 5HULA 1H50A 2DW7A 4DWSC 1UZDA 1QHOA 3LBOA 1JNDA 3W70A 1XWYA 1Q2SA 3HGSA 3M0HA 1S2WA 3TMLA 5FESA 3CV6A 3MHFA 2WMJA 4WF7A 4DNMA 5I6SA 3LCIA 1M01A 4IG2B 2J9YA 4BKNA 2OJPA 2ZKMX 2OGJA 3EB4A 3SQLA 4ZQMA 1RA0A 5FKYA 1YPIA 3HO8A 4XBSA 1QI3A 1RBAA 4JL1A 1U1HA 1G94A 3PZ9A 1RBLA 4KGLA 4CN1A 1XHGA 1YTDA 4RR4A 3NR0A 3UJSA 1MNZA 2DSZA 1MEIA 4UNKA 4LY4A 4P8UA 3KOXA 1TTJA 3T09A 3UESA 3G24A 2QCCA 1FOBA 3URAA 4YVPA 4GJ1A 2WQDA 3UBPC 2QV4A 2GWGA 4X61A 1EL3A 3R1ZA 2FGLA 1E9ZB 3RM9A 3A9IA 3VFCA 1JIBA 3OVPA 4HPNA 1E51A 2HISA 3N9SA 3H53A 3SCWA 1SZRA 4OECA 2G41A 3PB2A 3V5FA 3OVRA 4LWWA 3KTXA 2WLYA 5CSYA 3AMLA 2Z1WA 1OZMA 2TODA 3CQJA 1GZJA 2ZZ1A 3L5AA 4PB5A 1IWBA 3GTIA 1VHCA 3IARA 4BI7A 4HZ7A 2CCRA 3VM7A 5H91A 2NUXA 1OC7A 2G95A 4TX9A 3A9BA 3CPGA 3ZT6A 3G0XA 2Y89A 4R7WA 1ICQA 2V2CA 4OJYA 1TX2A 1LWHA 4GD0A 1XSKA 2WK2A 4UTJA 1VFSA 1V6WA 3DHDA 1NY1A 1EQPA 2G96A 4LB4A 2Z1VA 5EB8A 1ITCA 4QP0A 1L9WA 3OGVA 1WDRA 3WH8A 2J74A 1KGWA 4LFYA 5GNXA 2F61A 2G5WA 3U4FA 1NJJA 3VK5A 1XKYA 5I3KA 1YQ2A 3GS6A 3G1HA 4L1WA 1QOPA 3REQA 3F5KA 3PPHA 2PUZA 4ZO6A 2QVHA 3NVTA 4S2CA 3CV7A 2PDWA 3EWYA 4GY7A 4X2PA 3H70A 1HL9A 3UWYA 3UZJA 4HPXA 2WYSA 1DQWA 3G1SA 1QI0A 2XSBA 2VELA 3N6HA 3SJ3A 4V2XA 4X0NA 1LT7A 5I06A 3TUUA 4FXSA 4UR7A 3FYOA 2Z00A 1YPXA 1GEQA 4RXFA 2VZVA 1O7AA 3LX9A 3RU6A 4M3PA 3APYA 4GABA 3RX3A 4NZCA 4GJIA 2XISA 2YCEA 2A3LA 3N2MA 3DI1A 3UXKA 3CZEA 1KFKA 1OYBA 1LL7A 2XVNA 5A5WA 2XU2A 2VUYA 3B0VC 1GCYA 4BI5A 1OYCA 4AISA 2FTPA 4OBSA 1W1B1 5KITA 3SGGA 2WMKA 1C8QA 3P82A 4Q8NA 3U4AA 2F8QA 3QRHA 3PBYA 1P6WA 3N4EA 1B31A 3MDUA 5TF0A 3NDZA 4RK8A 3LB0A