2TPSA

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thiamin phosphate synthase from Bacillus subtilis at 1.25 A resolution.
pubmed doi rcsb
molecule tags Thiamin biosynthesis
molecule keywords PROTEIN (THIAMIN PHOSPHATE SYNTHASE)
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 1999-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2tpsA00
5IBXC 2C0AA 4Z0JA 1RR2A 2JGQA 4UNLA 1W5PA 3NR0A 5J5RA 3YPIA 3PULA 1SO5A 3T4CA 1DV7A 4O0KA 3G1XA 4FX7A 1JCMP 3AJXA 4NXKA 4RX0A 3S5ZA 4WOZA 2QCCA 1GOXA 4OWGA 2J6XA 2IQTA 1OFQA 3G1VA 1H51A 5I3IA 4ADUA 3S5YA 3TJXA 3LHVA 3F03K 3UXDA 3THQA 1YYAA 5CPNA 3KRSA 4ML9A 1B4EA 4Z1BA 3ZFHA 1J2WA 3CIWA 3CT7A 1VCFA 4NXSA 3O8AA 4JTUA 2DJLA 1DKWA 3EX4A 4NNAA 1W31A 1QFEA 3EKLA 3I65A 5KZDA 5K9CA 2E5DA 4JICA 3W07A 4Y9AA 4LVAA 2X1RA 3LBMA 4NX5A 4WOQA 1KFCA 1W37A 3NQFA 3G1FA 2NX9A 4S2CA 4JYDA 3P8JA 3MI3A 2E5CA 4IGHA 1K03A 1EB3A 1BWLA 4R53A 1VC4A 3C2OA 1VZWA 4DQWA 5HWJA 1R47A 3IEBA 3KHJA 5K9XA 3NPVA 5D2XA 1OFAA 2GQ9A 4IX0A 3P5YA 1CI1A 2VFIA 4QNWA 2QCNA 3W72A 3DHDA 2WNZA 1UCWA 3TSBA 3DGRA 5EL1A 3LHTA 4I7UA 3I7RA 3GVGA 5D2YA 1TV5A 1I45A 2DZSA 3LCIA 4HNNA 5DXXA 4M19A 3NVTA 4ZMGA 3W7GA 3GK0A 3M0ZA 4UTWC 4LRTA 4XQ6A 2NV1A 1XI3A 1YXYA 2Y89A 3WJXA 1TPEA 3N2XA 4M7TA 1IF2A 5C6MA 2X30A 4HKPA 4ZQPA 5LNWA 5DCBA 5F2GA 1H7NA 1X1ZA 2PE4A 3UYCA 5DY2A 4JTHA 2ABBA 3GYEA 3UD6A 1OHLA 2EGZA 3F1QA 2NV2A 2Q3OA 1LRTA 5CZSA 3W84A 3TAOA 1K7FA 3L0KA 2CLFA 1L6WA 2X1UA 3JS3A 3NZ1A 3G1AA 4JTJA 1U5JA 4E2BA 2QAFA 2ZZ2A 2PRMA 3LBCA 4WXYA 2Y7EA 4R34A 3PSVA 5AHLA 4BF9A 3NQGA 1LBFA 5J5DA 4RXGA 4QSHA 3LGEA 3GDKA 3STCA 3TSMA 4Y90A 2HS6A 2GJLA 3PS7A 4A22A 3UXAA 3RFAA 2QCHA 1KM2A 1T96A 1FQ0A 3B0UX 5LGXA 1I2RA 3CM4A 3IV3A 1IIGA 1XBZA 1DL3A 1Z41A 3LCGA 1RPXA 2VEMA 3EWBX 3HG3A 4IMFA 4BR1A 1PL9A 2DZVA 3BLFA 2WKJA 3RU6A 3DFSA 3NQ6A 1BWKA 1DQWA 4BWLA 2FPVA 2DZTA 2ZRXA 3SJ3A 5AFDA 3G3DA 4O1CA 3UWVA 4PEKA 1GVSA 3QF0A 3EX1A 2X2GA 3EWUA 5G2HA 1TRDA 1ICPA 4TX9A 4UC5A 1ICQA 2VKZG 1KV8A 2BWGA 3IGUA 4Z0SA 1TIMA 4KFOA 3W7OA 2B4GA 3L9CA 1WQ5A 3EWWA 4R33A 4HIBA 4MOZA 5HMSA 1PHWA 3LERA 1OF6A 2QJIA 4RZ6A 2ZRUA 1I2NA 3W7KA 4K38A 5E0KA 2WNNA 3PB0A 1RZMA 2RH9A 1C8VA 1XUUA 3EXRA 5FI8A 3JRKA 2A2IA 5LGZA 4DO4A 2A6NA 1ML1A 4CNNA 1BKSA 2YFNA 4HNTA 1O4UA 5IM51 2EKCA 4JEQA 4G1KA 1L9WA 3KOFA 3SECA 4O12A 1F74A 1H7PA 2ABAA 3G3MA 3KAOA 5CZJA 4RZ5A 4MPQA 1TPVA 2ISVA 4K7YA 4FX8A 4NJKA 4GNJA 3NA8A 4ZQMA 1WOBA 3S42A 3W1QA 3PSWA 1B4KA 1F2JA 3L2IA 4XTIA 3LLFA 3EEGA 3GR7A 4O4WA 1CW2A 4Y6GA 2RHGA 5AHIA 2VEIA 1OYCA 1QOPA 2VXNA 4TIMA 2FIQA 4HPJA 1IXNA 1YTEA 3GDTA 3PB2A 1H60A 3TC7A 1KM4A 2JKAA 5K7JA 3B04A 4NZFA 3N3MA 5EA9A 1W54A 1W5NA 4AWSA 5G1TA 3GKFA 5DELA 2YDAA 5KINA 1TPB1 3MHFA 3CEPA 4A21A 3HGJA 3L67A 5CSSA 3LB0A 2V82A 3PBUA 2ZA2A 2J24A 3BPWA 3TV8A 4DXVA 3DXIA 5HQEA 3A22A 3NO5A 3VI2A 3WK3A 3LV6A 3SR7A 3EKZA 3RK8A 4ADTA 1BEUA 5I3JA 3W7DA 3V1PA 2E6DA 2CFFA 4LV9A 3GX9A 3QEZA 1G6CA 5G1YA 1JRCA 5C55A 3CQ0A 1ZFJA 5KMYA 3GIYA 5HWNA 2C18A 3C4UA 4GE8A 1ADOA 4Q32A 1DJQA 2GQAA 3W7MA 3NL3A 2ZZ3A 1KFJA 2VEKA 3GLCA 3N9SA 2FPTA 1L6SA 4UMAA 3NNTA 1WBJA 1TREA 3C52A 2EAWA 3R2GA 1PV8A 1B9BA 2O7QA 2Y62A 2OT0A 3BW2A 2OJPA 3DI0A 3OVRA 4UR7A 3LXAA 4O1DA 2ZFAA 3O6YX 5AN7A 1QWGA 3M16A 5FF0A 3NOEA 4O15A 2WO5A 3E12A 3LCHA 5KZEA 3H53A 2CLOA 5HR6A 2A85A 4LUIA 1RVGA 5ABTA 1VRDA 1FDZA 1Q6LA 2GVGA 4IJBA 5L6UA 1MEIA 3CIXA 4DELA 2NUWA 2AQWA 5AB3A 3LHUA 2CLHA 1SUXA 5AHFA 4QJ1A 5A5WA 4ZZ9A 5E93A 3MWAA 3TIMA 1TO3A 3ATZA 4GUIA 3W2MA 2VEPA 3UY8A 3TE9A 1TRIA 3B05A 3INPA 3H55A 3HPZA 3BG9A 2XN1A 1SQ7A 4N4PA 1GTHA 1R2SA 1XDLA 2GVJA 2XN2A 3O05A 4FXRA 5FEWA 2YFOA 1F05A 1LBLA 2CZFA 1EP3A 1KTBA 1A50A 2QUVA 4XWUA 1VGAA 5D09A 3N9RA 4OGZA 1TPFA 2BLEA 1GVQA 4AAJA 3LRMA 4FF7A 2GJNA 1OYBA 4H6KA 2CLIA 3OHIA 5HULA 1Q6RA 3M5XA 3LCFA 3W83A 5DCDA 3B0VC 1KBIA 3NYZA 3G1SA 4JTSA 3NL2A 1DORA 5LNVA 2KZHA 2ZTJA 1HFBA 3EX3A 2Z0IA 1HO1A 1SSDA 1R2TA 3FYOA 3G0UA 3NQDA 5F4SA 3TW6A 2I9EA 3IVSA 1XKYA 5DN1A 3MP3A 3VFLA 3TDFA 1WA3A 2NWRA 4ORMA 1W1ZA 2EHHA 1P0NA 3KFTA 4DPPA 4M6VA 1TPC1 2YZRA 1LYXA 3E96A 4A2RA 4FNQA 1KFLA 2OT1A 2FTPA 5FESA 1O5KA 1YADA 2QCFA 1ALDA 2NXIA 3WK2A 5CSRA 4OU1A 1YDNA 4E38A 1KBJA 1X7FA 1OYAA 2G95A 3IIVA 2ISSA 1XBXA 3FJLA 4RK8A 4LV4A 1FY6A 3BW3A 4UTMA 4I9AA 3TA6A 1W5OA 4EVZA 2YR1A 5F2MA 1OX4A 4CQ9A 5DCEA 4GUJA 2JBMA 3O63A 3VE9A 3W6YA 5D30A 1FX6A 3BG5A 3UWYA 2FB2A 1TPDA 4XKYA 5U7SA 1M7OA 4LVDA 2V5BA 2A5HA 4IPJA 4C1LA 2VOMA 5FEZA 1FCBA 3O07A 1GVRA 3E0IA 3U6WA 1K8ZA 1M5WA 1KLYA 4IUOA 3UQNA 3E9AA 3L21A 3PG8A 3L5AA 4BI6A 4JD4A 2G97A 3G24A 1LTDA 1GTEA 3C0JA 1Z44A 1B3OA 4IWWA 3SSJA 3W7QA 3G8RA 1OABA 3O6CA 3BW4A 1MEHA 4CQ8A 1I4NA 3TNOA 4NNCA 3OA3A 3VE7A 4MY9A 2B0MA 4RV8A 5H2ZA 1LORA 3CWOX 3N2MA 4K39A 3ABRA 3TXZA 3S1XA 2I1OA 3TQVA 3LCWA 3LM7A 4OV4A 1VHCA 1QPQA 5F2IA 4EIVA 4Z1DA 3R12A 2Y85A 4JYFA 1NAL1 1GVOA 3W1MA 3WJSA 5F4XA 1GG0A 1WDWA 2FB3A 2QJHA 3W7LA 1VHNA 1UUMA 1EWEA 1K3UA 2ATMA 3HBLA 1GYLA 4HNVA 1PIIA 2QF7A 4FNSA 4NJGA 3S1UA 1YDVA 1H63A 1M7PA 2ZBTA 2C13A 3ZWTA 1TCDA 6TIMA 1TQXA 4ALDA 3TMQA 4JR5A 1OX5A 4AWUA 1W3TA 2DU2A 2OX1A 1X6UA 4LC8A 5HUPA 4N2YA 1S5VA 3MYOA 2CLKA 3W9ZA 3UPWA 4N9EA 3PBVA 4FIRA 3CU2A 4BI7A 3PBWA 5D05A 4AHQA 3IGSA 2V8ZA 1DOSA 2UV8G 1OFBA 5AYYA 3NEVA 1SZGA 3NZRA 4MLJA 3W22A 5TQLA 4Y96A 1JULA 3MHGA 4PODA 1EP2A 1P1XA 2CLEA 3HIJA 1KM0A 1XBVA 4AF0A 1ZAHA 2B7PA 3KX6A 3KVJA 3W2UA 3W73A 1LRQA 1H7OA 4O18A 4LC6A 2ZZ7A 3BO9A 3VKJA 5CPOA 3C2EA 1A53A 4RJEA 2YX0A 3TJLA 1QR7A 3GDRA 4MUZA 1T0OA 2NUXA 2Q8ZA 3NM3A 3QZEA 4O13A 4XZ9A 2ZZ4A 2YW3A 4WJEA 1VJIA 1Y0EA 2ZZ5A 3MBDA 4ZL1A 2ZRVA 3MBFA 1SSGA 4IMCA 2NX1A 1QDSA 2E6FA 4KFNA 4TU1A 3W1RA 3C61A 1PHQA 3WK0A 3O15A 2QDHA 1B57A 1VQTA 3DFPA 3M44A 2DZPA 3S6DA 4HPXA 4LW7A 5FF7A 3W7NA 2HTMA 4MY8A 3VNDA 1AK5A 4DO6A 5BOOA 5FF4A 4AEOA 1ZCOA 1PE1A 4Q4KA 2P1FA 5F2LA 2VFDA 2ZA1A 4X3ZA 2A6LA 3FLUA 3TR2A 2QUUA 1HL2A 1PCKA 4RKAA 2NWSA 2ALDA 4JX6A 4QAIA 1IXQA 2WOQA 3L0NA 3W86A 4HT3A 1JCLA 5K4ZA 3P62A 3QPYA 4WXZA 2Q8LA 2Z6IA 3NDOA 1A5CA 1P4CA 4UTLA 3L0GA 1TMHA 3OEXA 4JY8A 5FF3A 1SW7A 1HG3A 1NF7A 3PUEA 2Q3RA 1OK6A 1H1ZA 3S5NA 3C2RA 3L5MA 3W88A 3DAQA 4UTTC 2VFGA 2TPSA 3HB9A 2CZDA 4NVTA 1F6KA 3W2KA 1QPNA 3LV5A 4GUFA 4JTGA 3P5ZA 1YPFA 5AHNA 3P61A 1SW3A 1G4SA 3WJYA 1F73A 1VYPX 2ZQ0A 2Z6JA 2C19A 4MLRA 1F7BA 1JRBA 4MVAA 2F7FA 1VCGA 2GOUA 4DBDA 5GVJA 3W7HA 3N73A 3W3OA 3NQMA 3WK1A 4JTKA 3OG3A 4DF2A 4AMAA 1DVJA 3T44A 3PWAA 4GBUA 5AHMA 4CCCA 1AG1O 1CX9A 3MYPA 2GPTA 3EWXA 1Q45A 3EWZA 4NJJA 3P80A 3A9IA 3CEUA 4ORIA 4CLMA 3NQVA 1G7VA 3O06A 3DFQA 3I7SA 3M9YA 1SZNA 4UNKA 4I7VA 3ZR4A 3V75A 1XCFA 2J9XA 3EX2A 4LWWA 5D2VA 2YW4A 1SR9A 1SU5A 5D32A 2ZRWA 1G4PA 1OF8A 1OFDA 1FCUA 3GXNA 3QYQA 4Z1AA 3B4UA 4GXMA 4B5NA 1GG1A 2V2CA 3U8GA 3GAYA 2W79A 3Q94A 4XUGA 1UUOA 4N9DA 1KM1A 3GR8A 2E6YA 2A7PA 4FXSA 3CHVA 1RV8A 1FBAA 3ABQA 5F1VA 3UWWA 1FUYA 4UFKA 4K8EA 1W5MA 3C2FA 5D02A 2FDSA 4GRSA 1BTMA 2E6AA 3W7IA 1H1YA 4WX2A 4KKXA 5G2WA 2WSQA 5D37A 5FEXA 1EPXA 4BFAA 3LLDA 3HPXA 4JIPA 4UTWA 2B7NA 3HGRA 5K3VA 3LRKA 5E1QA 4N9CA 5KTLA 1QNVA 1H50A 1ZHAA 3GZ3A 5HJLA 1OFOA 4XTDA 1VS1A 4RR4A 3W1XA 3MP5A 1XXXA 3M5ZA 1YLVA 4UR8A 3W1UA 1AL8A 1LOQA 1TTQA 1DBTA 5C54A 4BK9A 2I14A 3K30A 1LBMA 3IIZA 3R13A 1L6YA 1SFJA 4O50A 4FNTA 1EA0A 4K8HA 4A2SA 1SW0A 1G67A 4M7SA 2PCQA 4P61A 1AW2A 1OVDA 4MYXA 4UFIA 2EPHA 3P74A 4TR9A 3W7EA 4AWTA 3W2NA 4UFLA 2VFEA 1H5YA 1K8XA 3Q2DA 1W3IA 3DFNA 4LS1A 4O8RA 5HR7A 5D04C 1TTIA 3GAKA 4QM1A 3W87A 2YSWA 3TROA 1IIHA 1YPIA 5TIMA 5LNRA 1EWDA 1TV7A 5I3KA 2E77A 5EBUA 2Y7GA 2BTMA 3Q58A 4O54A 2NXGA 2QAPA 2YXGA 1A5AA 2J9YA 4OQVA 2V81A 1KTCA 5BW6A 2TMDA 5DLCA 2WQPA 4RXFA 3GDLA 5AYZA 3PVFA 3P81A 3MJYA 3TCEA 4XKYB 3W7RA 1W8SA 3P67A 1XFBA 3W23A 4ZQOA 3DHFA 4Q33A 5DXYA 2WJZA 3HG2A 1P0KA 4JGDA 1Z42A 3MI6A 5I3GA 3GXTA 4AHOA 4Z1CA 8TIMA 3M6YA 3EX6A 4OV9A 3W1TA 1LOLA 3NQEA 1QPOA 2QR6A 1G4EA 5HWMA 4PCFA 5AC6A 3KVMA 3NQ2A 2CU0A 2QCMA 2QUTA 3TU9A 5FF2A 1GYNA 4HSNA 5LNUA 1JUEA 1LLWA 3QQ1A 5DBTA 3EB2A 3H54A 1FDJA 1GPWA 2PRHA 3SFKA 1KFEA 3M47A 3RMJA 1GVFA 1Z48A 3A5VA 3IVUA 3SI9A 1J5TA 5HUOA 4IMDA 4L4MA 2XFWA 3TAKA 3QRHA 1D3HA 4QITA 4RCXA 4E2DA 3B0PA 3QFEA 2JKPA 1FDYA 3LI1A 2Y7FA 2YYTA 4HSOA 5IBXA 3PUDA 3S0CA 4AB4A 1N7KA 3UNDA 3UWZA 1EIXA 2ZTKA 4FX6M 1NEYA 2FJKA 3NG3A 3T55A 2ZDRA 3KRZA 3LHYA 3G0XA 2J9ZA 2H3DA 3W75A 3E02A 4N6EA 2QCDB 3SW6A 2H8XA 2P0OA 1NF0A 1KV5A 2F84A 1W5QA 4LS0A 2E1DA 1ZY9A 2NUYA 4MZ8A 4DBEA 1SPQA 3DI1A 2BX7A 3DH7A 4OT7A 1O60A 1V7YA 4ICNA 1TPWA 2J27A 3MI2A 2Y61A 3MP4A 2TSYA 4JX5A 4QISA 1H61A 4ZQRA 2V9DA 3NQAA 1GT8A 3EXTA 3LDVA 4QQ3A 5U4NA 4JS3A 4O16A 1XDMA 3LI0A 4O1BA 3OIXA 5AYXA 3W7CA 4OHQA 2A7NA 1JCNA 3TW7A 4PL2A 3TC6A 3NPWA 3D0CA 3SGUA 5LHEA 2A0NA 1MZHA 4LNYA 1HUVA 3W7PA 3USBA 2LLEA 3TSDA 5CZTA 3ATYA 3GNNA 4EF9A 1W3NA 1KM5A 2OZ0A 2WSYA 1MEWA 1K7XA 1F76A 5BMWA 3G1YA 5LNSA 1N55A 3LXCA 4OE7A 3GNDA 4YCPA 2JK2A 3QMTA 3QH2A 2RFGA 1EEPA 1WBHA 1AW5A 3L68A 1LLZA 1AW1A 3GDMA 4NX0A 4GFSA 1EUAA 1QOQA 3NAVA 3QW4B 1IXOA 3BV4A 3KXQA 1A5BA 3C56A 4FNPA 4IMGA 4NT0A 5AHEA 4A3UA 4X9SA 5CGQA 2PRLA 3QPZA 2NX3A 4YMZA 1JR1A 2B7OA 4E0CA 4HNUA 3TFXA 2CW6A 3MO7A 5HNRA 1OX6A 4PL1A 1RQHA 3HGOA 5EMUA 4JTLA 4UUIA 3UWQA 2AGKA 5BMXA 2VELA 3IIPA 3BLIA 3BK0A 1LROA 3O1NA 3BGGA 3N19B 1LOSA 1MSSA 3CC1A 3DENA 3GXPA 3L66A 3M5YA 4O10A 1ME8A 3STEA 1AMKA 1ZJIA 2H6RA 1VCVA 5G5IA 3O6DA 1KFKA 1YXCA 3IIOA 3OVPA 4MFEA 4QNEA 2ZRYA 1YTDA 3M43A 3L5LA 3T40A 1JQVA 4HN4A 4N9BA 3OBKA 3THAA 2NLIA 4IPIA 2DZXA 1FWTA 4GJ1A 2AAMA 4JIQA 3BLEA 4UFJA 3STGA 4K6AA 5LSMA 4FNUA 1XBYA 3CLMA 2WNQA 4JTEA 4Y8FA 3DFTA 4O1AA 3IIXA 1SZEA 1EUNA 4UTHA 3KVLA 3CPRA 1TTPA 1LDCA 5D03A 3FEMA 3E49A 3W1NA 1C29A 5DBUA 7TIMA 2CLMA 3Q37A 1PVNA 1Q6QA 1NVMA 4BWLC 3A23A 3TMLA 1K7EA 2H8ZA 5FEPA 3NPXA 1QO2A 3TXVA 2X1TA 3HMJG 2E09A 4IQLA 4WY0F 1TJPA 2ZZ6A 4PTNA 4H3DA 4M6QA 4N6FA 4I7WA 1VH7A 2W0UA 3PR2A 5F4WA 4WY0A 3KRUA 4CCEA 4YL2A 2FFCA 2H90A 3SIZA 3ANYA 2WPBA 3PG9A 3R89A 1C9DA 2VFFA 3SZ8A 3M41A 4FNRA 4JX4A 1F6PA 5L9FA 1ZAJA 2C15A 3HPSA 1X8FA 5T26A 4CNPA 4AF0B 3I6RA 1VYSX 5KSWA 4JTIA 1EP1A 1TQJA 1O5XA 2H3BA 3G0SA 3TQ0A 1XM3A 1ZNNA 3EXSA 5D2TA 3I7QA 3UPBA 5LZLA 3HF3A 2RDWA 2FPYA 1LZOA 1H7WA 1THFD 3HGSA 3LX9A 3S8HA 3B03A 3MMTA 3TUUA 1NSJA 2CZ5A 4LU0A 1TJRA 5A8GA 3CB8A 4YLWA 1LRNA 1M6JA 2A7RA 4S2BA 3M7WA 2V0TA 4S1FA 2DZUA 4AH7A 1R30A 1XL9A 2J88A 3LOTA 4JDBA 4TMCA 3SGZA 1KFBA 1X1OA 1AL7A 1H7XA 3WJZA 1H62A 3NGJA 5MHBA 1IXPA 1YTKA 1UJPA 4CCDA 1H7RA 2QJGA 2PC4A 1IGSA 2YYUA 4JXCA 1WX0A 3PM6A 4O28A 3ELFA 4YWIA 5AOUA 1Q6OA 1QPRA 4FO4A 2Y6ZA 4U4MA 1OFRA 1GJPA 1JJKA 3BVJA 4GWEA 2C14A 3VCRA 3LTYA 1GZGA 1MXSA 4NUWA 3A21A 1FWRA 2DP3A 4O19A 4WZHA 3HG4A 1G7UA 1F5ZA 1VLIA 3P8IA 2QCDA 4UFMA 2E5BA 2FQIA 5C2XA 1K8YA 2RDTA 3C2VA 1LP6A 3NM1A 3F4WA 1JUBA 2NXHA 2HMCA 1TV8A 4O57A 3W7JA 3S1VA 3KVKA 1FXQA 4PFMA 2OMAA 3RLUA 2YCEA 3UY7A 4QIUA 3HJZA 2QEZA 3L65A 3F4NA 5LHFA 3OVQA 1W0MA 1WV2A 3BARA 4YXGA 1QO5A 4ZVJA 4UTJA 5EKYA 3G18A 2QCLA 2R8WA 3FJ6A 1QMLA 3EWYA 3PF3A 1MO0A 3LCXA 2TRSA 2ZCGA 5AC7A 1FXPA 1RD5A 4P2VA 2Z1BA 3DKJA 1OX4B 2ZYFA 3PBYA 1RQEA 2W6RA 3PUOA 3SY5A 2QCGA 2JKEA 3G22A 2R91A 2OCZA 5SWUA 2DZWA 4NJHA 3W76A 3W74A 4MJMA 3NXFA 3FKRA 2CLLA 3DZ1A 1YXDA 3GB6A 4UTTA 1KA9F 2Y70A 3W2LA 5I3FA 1NFBA 1RQBA 3O16A 1ME9A 1ZAIA 4BI5A 4N4QA 3ZS4A 1N8FA 3QC3A 1WXJA 1TYGA 4LTSA 1O95A 1JVNA 3QSRA 3W2JA 1QCWA 3C8FA 4NJIA 3QJAA 3P82A 1OFEA 4K37A 3QSTA 1KM6A 2RDUA 3IVTA 1S3HA 2A4AA 1J4EA 4O14A 3NL6A 1SO6A 4JNMA 3FA5A 4KWWA 3R8RA 1O94A 3M5VA 4L4LA 1R2RA 2C16A 4MY1A 1G69A 3LCLA 2GUUA 3RLVA 3PY2A 3W1LA 1EX5A 3UWUA 3FIGA 4ZQCA 4RLIA 5EY5A 4NU7A 2V5LA 2P10A 1JCXA 3RNDA 4UXDA 3I68A 2C3ZA 1TTJA 4M6PA 3S9YA 4CNOA 3ABOA 3WFAA 3W70A 3G1HA 5D38A 3S1WA 2HSAA 2ZZ1A 4DPQA 4WQ6A 1GEQA 2C6QA 1XC4A 5BRBA 1G4TA 2Z2UA 5EYWA 4LOCA 1S5WA 4NQ1A 2R14A 3LTPA 4ZQNA 2FLIA 2X16A 4O11A 2CZEA 1K02A 3IRDA 1T8XA 3AO0A 1W56A 2ZRZA 3DBPA 2XN0A 4DF0A 3TKFA 4OBTA 1ZENA 3STFA 2ISWA 3S5OA 1I8JA 3C3NA 3ABSA 1L2UA 2R94A 3LXBA 1E51A 3QMRA 3LRLA 4FEZA 5DY3A 4LVBA 2DJXA 1SO4A 4GUHA 1GQNA 1JQXA 1LM1A 3HG5A 1KLZA 1FWNA 1FWWA 3TFCA 1LCOA 1DJNA 4MIMA 1A5SA 1TPUA 2Y7DA 1VLWA 1HTIA 1I2PA 1TB3A 3HQ1A 4K7VA 4R7JA 2BZNA 4O53A 1ICSA 2WV8A 3HO8A 3JR2A 5G2IA 4EWND 4EOUA 4WY0B 2ATSA 1FCVA 3R5EA 1T99A 4X2RA 1KW1A 2QDGA 4JTTA 2TYSA 1HO4A 3NL5A 2VC6A 1FWSA 4UMCA 4MFDA 3N14A 5TBOA 4O17A 3BG3A 4TMBA 4RZ4A 4MYAA 4JYEA 5CG7A 1UASA 4LY8A 1JCJA 4U28A 5I3HA 5D33A 3NQ7A 5H91A 2NZLA 1OJXA 2GQ8A 4X22A 1V5XA 1SO3A 4XBKA 3ZWSA 2BXVA 4LUJA 4UTKA 2A1YA 4FHAA 5D2WA 3B06A 3FKKA 4ADSA 3QM3A 3QMSA 2V30A 1KTNA 1S5TA 3G1DA 5G4EA 2JGYA 5CKSA 2GVLA 1VYRA 3W71A 1FCQA 3G8EA 2ZA3A 2WSRA 4J9JA 3FOKA 5K2ZA 3CWNA 2Y63A 3NQ8A 4D2JA 1U83A 1DQXA 3T7VA 4FIQA 1JCYA 3A5FA 2VENA 3FFSA 3P7YA 2D73A 4JTFA 3TH6A 6ALDA 4IX2A 3P60A 5EPDA 1D9EA 3U2OA 4FB7A 4IXXA 2QKFA 4O52A 1WAUA 1D3GA 4AHPA 2CWNA 3B8DA 4MJZA 3QQ0A 4UIOA 4PA8A 1OFPA 1SFLA 3UZ5A 4TO8A 3MW7A 4C1KA 1TPH1 1PS9A 5CPLA 4YCOA 3FYPA 4AVFA 4MZYA 4NZJA 4H4IA 1PCWA 3BGJA 3P84A 3T78A 4KFPA 2RKXA 5K4XA 1XUZA 4PH6A 2BSLA 4WD0A 4PC8A 4DF1A 4POCA 1YDOA 1UBSA 4UMBA 3MHUA 3LHZA 4UTIA 4IMEA 5AC8A 1WYIA 3N34A 4A29A 1R46A 4JDYA 1ONRA 4LVFA 3CTLA 2O7SA 1WOAA 2G96A 2QCEA 3PC0A 2PURA 3TX9A 1VR6A 4WUIA 1I2QA 4AXKA 4K36A 5G4WA 4KWVA 3HOJA 4UFHA 4W9TA 1JUKA 3C6CA 5KITA 2E68A 3NQCA 1UB3A 2A21A 5KZMA 1VPXA 5CZ0A 3UZJA 3IGXA 4DEFA 3DFOA 5LKYA 1ME7A 1OK4A 4JY9A 1DHPA 3RF9A 2EF9A 1P5BA 1OG0A 3DKLA 4GUGA 1I2OA 4IOTA 4LT9A 4HHPA 2V2DA 4O4VA 3W1AA 3W85A 5CPMA 2G5WA 2Y88A 3TQKA 2YPIA 4N02A 5K9DA 4GC4A 2HS8A 3LTSA 2YGYA 4MKNA 4LS2A 1ZALA 5HINA 4LRSA 3DU0A 3QW3A 4Z08A 5F1UA 5BNKA 2VFHA 4DO5A 4XBSA 1KM3A 3NPUA 3TK7A 2X1SA 4NNBA 4M5PA 4O0ZA 3W1PA 5C5YA 1TSIA 3GKAA 3PAJA 3WJWA 2V2HA 1Q3NA 4IXHA 4ONVA 4MZ1A 4EF8A 3A24A 4JN6A 4LVGA 4UTUA 4CQAA 3M1ZA 2DORA 4UCGA 2B7QA 2C1HA 3MUXA 1QAPA 1SZFA 3FS2A 1GWJA 3LHWA
chains in the Genus database with same CATH superfamily
5AZ1A 5IBXC 2PDNA 4GYPA 1B9ZA 1RR2A 3TJ4A 1W5PA 4KMQA 1H0IA 3N18A 4ZSUA 1TMLA 3CYJA 3K4DA 2WC7A 1FH7A 3M64A 3G1XA 1A0EA 2QCCA 1BRLA 1R87A 2XINA 1OFQA 1T40A 3DYOA 1NFPA 5I3IA 4C6NA 1XLLA 1MDRA 3LHVA 3HTWA 1J2WA 3L12A 3SAZA 1A4MA 3ABZA 1QBBA 3CIWA 3CT7A 4L80A 1CXFA 3O8AA 1E0XA 1XIFA 4NNAA 1KGXA 1NOFA 5CLTA 1JDEA 3LBOA 2O9PA 4Q8VA 1NWRA 1XD0A 3E2SA 4GZJA 1W37A 1DE5A 1U2YA 3G1FA 5M2FX 4S2CA 2FHBA 4AIUA 2XM1A 1ISXA 4IGHA 2HK1A 4R53A 3C2OA 5CQ1A 4ZB0A 5K9XA 4N42A 3WEZA 3TYUA 4LANA 4M8UA 5D2XA 3GXIA 3MZ2A 2PLKA 3GU2A 4HPHA 1V3LA 4QNWA 4IICA 3KEHA 2QCNA 1FHDA 3W72A 4FI4A 4FXFA 4UQBA 3LLXA 3DGRA 4HPNA 1UR8A 2PDFA 3F4CA 3MC5A 1IR2A 3VIIA 4M19A 1S1RA 4DUXA 1KQYA 4MKSA 1J96A 4QRNA 4XQ6A 1XLCA 4HMNA 2NV1A 1BRLB 3T0DA 3WFZA 1YXYA 2Y89A 4E8DA 3FEQA 3W82A 3H8AA 3MTWA 3RRAA 3KDNA 1RSCA 5LNWA 5F2GA 3UYCA 4OOUA 3MVTA 4AXNA 2HDJA 2ZICA 3A3WA 3MUZ1 1OG6A 5CZSA 4E3VA 4GXPA 1K7FA 4TX8A 1L6WA 3JS3A 3QBUA 5HBFA 1XW8A 5A6LA 4JHMA 2XFYA 1X6NA 1U5JA 1TIWA 4IP7A 2MNRA 4RV3A 4LAKA 4OUEA 4IFOA 3GQYA 1DJXA 3NQGA 2DV0A 4A8IA 4RXGA 4KCUA 4HHHA 1F8IA 3STCA 5DF0A 3TSMA 5E9AA 2HS6A 3EDEA 5E09A 3PBGA 2Z00A 1RALA 5FJJA 2OWXA 2XPKA 3NOYA 3O9NA 3GFZA 1FKXA 1RH9A 4ZOCA 1RY0A 2NQHA 4TQTA 2OYMA 1DL3A 1EA9C 3LCGA 1RPXA 3EWBX 4YPJA 3T0TA 3WD3A 3BLFA 2WKJA 3AZRA 2BY2A 1EHNA 3DFSA 4IL0A 1M41A 1UROA 4NILA 4I5RA 2FPVA 4MAZA 3WLJA 3BANA 3QF0A 3EWUA 5G2HA 1TRDA 4FXJA 2D2JA 4UC5A 3AIQA 4P7OA 4J27A 3RG6A 3IGUA 4Z0SA 3NIYA 3SCSA 2B4GA 1WQ5A 3WLRA 2VTFA 2X41A 3E0WA 1Q7QA 1F3WA 5A6SA 2OSWA 1PZ0A 3LERA 4RZ6A 4UCFA 4K38A 9XIMA 3PBMA 1Q13A 1RZMA 3L4VA 1C8VA 5FI8A 1Q7MA 3G77A 2BGNE 2Y8KA 1WZMA 4HA4A 2J8GA 2GGHA 3Q45A 4HK5A 3F2CA 5IM51 3VMNA 4G1KA 3KOFA 4O12A 4NAEB 3KAOA 4PUUA 4RZ5A 1TPVA 2VO5A 2UBPC 2OELA 1OD8A 4J35A 1IYXA 5T9BG 5D9MA 1WOBA 1H3GA 3EEGA 4O4WA 1JPHA 1OYCA 2I5GA 3VZXA 2J7GA 4HPJA 1IXNA 1WKDA 2OEJA 3TYDA 1VFSA 4AD3A 5K7JA 4NZFA 2G3FA 3PJXA 4GI8A 1GVIA 5DELA 3D3AA 3UZWA 1TPB1 1KCKA 4JEJA 3VOHA 1KBLA 2E7FA 4A21A 4H04A 3HGJA 2V82A 3S9IA 3BPWA 2GJPA 4DXVA 4DRSA 4MJ2A 5HQEA 3BLOA 2DIEA 1AQFA 3RK8A 4ADTA 5I3JA 1L8NA 1AJ2A 1M53A 2DUZA 3QEZA 5G1YA 1JRCA 3VKAA 1ZFJA 1B3XA 5HWNA 1UJQA 1ZJHA 4JTAA 3C4UA 1ADOA 1ZBKA 3NL3A 1EZWA 3FA4A 3W4RA 2VEKA 3KLLA 2FPTA 3NNTA 3FNDA 1TREA 2EAWA 3RAOA 3I3BA 4PN2A 3OVRA 5AN7A 3LMZA 3S6TA 3GC2A 3ITTA 5FF0A 1HXJA 4AU0A 3KTSA 2WO5A 5I3DA 2WVTA 3MUIA 2FVKA 3LCHA 2PWVA 3TYAA 1VRDA 1BYBA 4IJBA 1RK6A 3RX4A 3CIXA 2ZXBA 1NQKA 4ILSA 2NQ5A 3DIPA 4ZXLA 4GY7A 2QT3A 3PK7A 1FTXA 3P3BA 3W2MA 2VEPA 3UY8A 3WQVA 1YMYA 3H55A 1E6XM 3BG9A 2XN1A 1POJA 1HGYA 4D8AA 4N4PA 1GTHA 3B4YA 2RDXA 4XD4A 2DZBA 2GVJA 3O05A 2GGEA 2D0HA 1EP3A 2CBJA 4DAFA 2AKZA 1I1XA 1K9DA 3WX7A 3LZ3A 3ISIX 4UOQA 4NIRA 1GQKA 3OTRA 1NH6A 2BLEA 3GU1A 1UWRA 4AAJA 3LRMA 4FF7A 4HSHA 4DVOA 2XDFA 2AMXA 3MO4A 2GDQA 2F9RA 3PZ9A 3OHIA 3EA2A 1W32A 4A8LA 3M5XA 2O56A 4C6OA 3MS8A 3ARXA 3G1SA 2JIWA 2CESA 1DORA 4ROQA 1OQFA 1M7JA 4IFKB 3EX3A 5M1TA 3FYOA 4J2MA 2GJXA 5F4SA 5FL0A 2I9EA 4HMEA 4CD4A 1PTAA 2NWRA 2EHHA 2G3IA 2YXXA 4DPPA 1LYXA 1P1MA 1O5KA 1O12A 1ALDA 4S3KA 1CECA 4OU1A 5FACA 1QK0A 1KBJA 3SN4A 1GOQA 1F3EA 1XBXA 3TP4A 3FJLA 3VD3A 4C6BA 4XIMA 1W5OA 4EVZA 1CEOA 5F2MA 1OX4A 3OJGA 2JBMA 3VE9A 4ZSTA 2XSXA 1UKPA 3W6YA 3BG5A 2FB2A 3DHUA 1M7OA 5FJPA 3OLIA 3H4GA 4HZMA 4IPJA 2PP0A 1J6PA 1FCBA 2VCCA 1GVRA 1M5WA 1KLYA 3L21A 2A3BA 3EBVA 1UMLA 2CETA 1J10A 4ERAA 1GTEA 3E5PA 3THCA 4XAPA 3M0JA 3CUZA 3WQWA 2DQXA 4JQ3A 2BB0A 3WDRA 1OABA 3QGKC 3GHUA 4CQ8A 2XSBA 4QDWA 4NNCA 3WD1A 2VRJA 4HZ7A 3H2AA 2B0MA 1BSLA 4RV8A 1LORA 4K39A 2NT1A 2P50A 3FY1A 3TXZA 4JIHA 1N8WA 1XG3A 2XH0A 3L4WA 5PTDA 3RO6A 3KS6A 3LM7A 4OV4A 4PB5A 1VHCA 3VD4A 1U1JA 3VX0A 4J1OA 1CXLA 3LY0A 3W1MA 2EPMX 3UCQA 2QJHA 1VHNA 4YIWA 1EWEA 3HBLA 4PTVA 4HNVA 1E4LA 2Y0FA 3VKBA 2I5QA 1YDVA 2ZBTA 3GO2A 3OA5A 1X38A 3G6MA 1TCDA 6TIMA 3CV2A 3TMQA 2Z1VA 2ZOXA 4AWUA 2OX1A 3JUGA 4QG8A 2CLKA 3W9ZA 4N9EA 1MW2A 2X09A 1R7AA 5AYYA 3WUBA 2PDKA 5JBFA 4MLJA 3W22A 1EF3A 2WANA 1BSIA 4M1RA 3MHGA 4D1IA 3H2FA 3VIJA 3J7HA 3UCCA 2YDQA 1PUDA 3KX6A 1ONEA 3VOJA 1LRQA 1H7OA 3L23A 3LPPA 4J3TA 4LC6A 2ZZ7A 4K68A 3NGFA 3DDMA 3R10A 5CPOA 3C2EA 5T91A 3DFHA 1XWYA 2OEMA 2ZRVA 1KC7A 3WBXA 3K8LA 2NX1A 3W1RA 4KFNA 3GTIA 1PHQA 2VEGA 3WK0A 3O15A 4HPXA 4B15A 1E9IA 2HTMA 2P5NA 1FHLA 5BOOA 4WGHA 4J3VA 1HJSA 1ZCOA 1NFGA 1PE1A 1JAEA 3VTRA 4K1GA 4MKVA 2PBGA 1EC8A 3VIPA 4X3ZA 3FLUA 2ZX9A 2QUUA 1PCKA 2PD5A 2NWSA 4F0MA 2ALDA 4QAIA 3NJ3A 2O9OA 1UZHA 4GH3A 1TMHA 4GZ7A 3CQHA 1BXBA 1LL4A 4REQA 3OEXA 3CB3A 3UR5A 2Y2WA 5ECVA 4H6RA 1W9XA 2ZKMX 4AYSA 2ALRA 1XKJA 2VC9A 3WBAA 4UTTC 4NVTA 4GUFA 4NG3A 3P5ZA 3JU2A 1KXHA 5A6AA 5CC7A 7A3HA 3WJYA 2G0WA 4Q7IA 5IDZA 2C19A 3HQPA 1UQYA 4MLRA 1JRBA 2PSNA 3R58A 2VZSA 1VCGA 1XLJA 3NQMA 4JTKA 3GG7A 3WF3A 4AMAA 1DVJA 3TJIA 3PWAA 4OECA 1C9WA 3LM3A 1AG1O 2J6VA 3MYPA 1VEOA 1DHKA 3OU8A 3ZVIA 3P80A 3LS9A 4V1XA 3SUWA 3TCSA 4XD5A 3F5KA 2VGGA 4UNKA 4PUJA 3V75A 2FZ8A 3EX2A 4NAFA 4FR6A 1SU5A 3TYZA 1OF8A 1OFDA 3AU2A 2GSJA 3GXNA 2YZ5A 3IJ6A 2DVXA 3ZVHA 4XISA 2A3LA 4XUGA 4N9DA 4FSAA 1KM1A 3GR8A 3ZQ9A 2A7PA 3CHVA 1FBAA 5A1AA 1CDGA 1GVYA 2YBVA 4UFKA 4K8EA 3TTYA 1E72M 2E0PA 4GGHA 4GYKA 3QQWA 3W7IA 4OZOA 5HMFA 4C6EA 5G2WA 1O68A 5D37A 4JOMA 4ZE5A 4GI9A 2B7NA 1ODZA 4GH1A 5KTLA 2Y5EA 4GGBA 5HJLA 4GQ0A 4W85A 1YPXA 4XTDA 4KW2A 4RR4A 2J7BA 1TV4A 3R8HA 3ONCA 2PTXA 3M5ZA 3MUCA 1UHVA 1YLVA 3AIEA 3W01A 5C54A 1SJDA 3R0UA 1Z69A 2I14A 4BK9A 3N13A 5M5DA 1LBMA 4FNTA 1EA0A 1SW0A 4PSRA 4GZIA 1JXJA 4EP8C 3RDKA 4A4AA 4ML4A 4C6LA 2Z1WA 3VNYA 1CTNA 3EEZA 4TR9A 1VBRA 3P0WA 4GIYA 3LUTA 1A0DA 4E5TA 4UFLA 3R43A 3VABA 3VCNA 1H5YA 1UP0A 4HA1A 2E9LA 4QQUA 1W3IA 4G1NA 1D3CA 5HR7A 1LT7A 1V3KA 4F9JA 4QM1A 4AY7A 2YSWA 2DW6A 5TIMA 2PCEA 2E77A 2EG6A 2YXGA 3ARUA 2PDMA 1BD0A 2J9YA 2V81A 4PGLA 5BW6A 3VC5A 3V35A 4DJEC 4RXFA 2H9AA 3GDLA 3P14A 2IMRA 3TCEA 4XKYB 3OGRA 4U2ZA 3W7RA 3WLNA 4F9DA 1XFBA 1E1EA 3DHFA 4DX3A 3CV7A 1P0KA 3E38A 1Z42A 1JYVA 3UJEA 3M6YA 3ZJ7A 4OV9A 1LOLA 1VBGA 3NQEA 2QR6A 3H21A 2CU0A 2QCMA 3R6IA 3COTA 4AY8A 1XLMA 1GYNA 4LPCA 3VM7A 4A3RA 4ZENA 1XQLA 3EB2A 3H2MA 1XGDA 1KFEA 3M47A 1OT1A 3RMJA 1J5TA 5HUOA 2XFWA 1DIDA 3AICA 3B0PA 4KCTA 2JKPA 1F4HA 1FDYA 1FWFC 3LI1A 2Y7FA 4HSOA 4PCNA 1JZ6A 2VYOA 3UWZA 1EIXA 3QN3A 1BG9A 3S46A 3P93A 1IWPA 2ZDRA 2QPSA 4RPPA 2VZUA 1ISWA 3MJMA 3OYZA 3W75A 1Q2SA 3M0KA 3E02A 4Q6JA 2QCDB 3SW6A 2H8XA 4I3GA 1NF0A 8XIMA 2AQVA 4DHGA 7REQB 1SPQA 1TFVA 3BAWA 3DH7A 3ITOA 4B9ZA 4JIIX 3AU6A 4JX5A 3QYSA 2TSYA 4MWAE 3VNZA 3T4WA 1E5NA 3NQAA 1GT8A 5U4NA 1MFVA 3GG0A 4O16A 4O1BA 4MAVA 3OIXA 5AYXA 1QW7A 3W7CA 3TW7A 4D6IA 4PL2A 2EPKX 3SGUA 4KT2A 1DTUA 3TOYA 2EXOA 1K70A 1WDPA 1NP2A 2WAGA 3TSDA 3GNNA 3CHFA 4GJIA 1KM5A 3SCNA 2E28A 3S2JA 2WSYA 1F76A 3AXHA 3WDHA 5FCZA 1K6AA 4B5TA 4WGXA 4JQ1A 3LXCA 4OE7A 3GNDA 3BC9A 2DGAA 4ICMA 2BODX 5GJMA 1RD6A 5CJNA 1LLZA 1AW1A 3GDMA 3XISA 4NX0A 4AZCB 4GFSA 1QOQA 1E43A 3WQPA 1IXOA 4XB3A 5LXXA 4HYRA 3H23A 4X9SA 5J04A 4UUIA 1YEYA 1UH2A 1WKYA 3IIPA 3CZKA 1J12A 2WLZA 4FPSA 4AG0A 3O1NA 3BGGA 4JKMA 1LOSA 2YL5A 1WKFA 3BICA 3R11A 3GXPA 3HFYA 1ME8A 3A4XA 3CTTA 3STEA 1O1ZA 4QDMA 1DQUA 1US3A 3OVPA 4QNEA 1I9CB 1GJUA 1RLCL 2ZUVA 1MW3A 3L4UA 3QV6A 4DI9A 2XVGA 4I5UA 3UR2A 3MA8A 3OBKA 5FJOA 2EKGA 4K6AA 4B3LA 2HJPA 3WQ4A 4EPBC 4FNUA 1XBYA 3S2NA 4OIFA 2OLAA 1SZEA 3G1RA 1LQAA 4WK9A 2W3ZA 2J47A 7TIMA 3A47A 2CLMA 3EOOA 1YNPA 3SCTA 1FOBA 1NVMA 5ABHA 4BWLC 2H8ZA 1MQPA 1WDSA 1ADDA 1M68A 1QO2A 3OG2A 3EGJA 4IQLA 3VKDA 4AD4A 5HQLA 1DEDA 2REQB 3RYSA 4UZSA 5JXQA 1VH7A 4QXIA 1XIDA 3KRUA 4RPQA 4YL2A 2FFCA 4J3XA 3GTFA 3BLLA 2PDIA 3PTMA 1C9DA 1UWIA 2FZMA 2NQ9A 4DJFA 3M0MA 1EH9A 4IH3A 4CNPA 3H22A 3IWPA 1EP1A 3G0SA 4HJFA 3LN3A 2DZAA 5BROA 3I7QA 3H7UA 2HBVA 3HF3A 5A6BD 1TUFA 4E4FA 3VGBA 3N6QA 1H7WA 2WB5A 3ABXA 1PYFA 3TLLA 3HGSA 2GK1B 3LX9A 2FTYA 3TUUA 1TJRA 5A8GA 2ACRA 1M6JA 1BVNP 1BF2A 3MMWA 3TA9A 1XL9A 4TMCA 4PUMA 3WJZA 1PKYA 3NGJA 2P8CA 4Q6XA 4DYEA 2PA6A 4CCDA 2QJGA 2IKGA 4H7ZA 2YL6A 4EWJA 2PC4A 2HISA 2YYUA 4JXCA 1WX0A 4O28A 3ELFA 1Q66A 4JTRA 1Q4NX 2WVUA 1P0EA 4U4MA 1NWTA 1GJPA 4CQCA 2C14A 3LTYA 4AEEA 2FMNA 2WMKA 4NUWA 3A21A 2DP3A 4AIOA 3A3HA 4UFMA 2C91A 8CGTA 4M29A 2OX4A 1UWQA 3KCLA 3C2VA 1LP6A 3NM1A 1X8CA 4E4PA 4ZEPA 3S1VA 2ONEA 3V3WA 5HANA 1V3HA 2XWDA 4PFMA 2WC3A 2BY3A 3HJZA 2QEZA 2XGIA 3W6LA 4K2SA 3BARA 5EKYA 2CXEA 1QMLA 3WKZA 2BOFX 4ATWA 3NSNA 4F2TA 1FXPA 1FH9A 4UZUA 2OG9A 4P2VA 5HXMA 2V63A 3DKJA 3TNBA 1EOMA 2WKLA 2W27A 2ZYFA 3PBYA 2WCGA 1RQEA 5AYIA 5C9UA 5G4HC 4ES4A 3KOZA 2ZUUA 5I00A 2R91A 2HXUA 4CQBA 3OQ8A 1JGMA 3NXFA 1PWLA 4J40A 4F0RA 3GB6A 3GRIA 4GQRA 5CCZA 1D7FA 4S3JA 5I3FA 4OVXA 1V6TA 3FHQA 1ME9A 1HJQA 3ERPA 3HN3A 5BXRA 1XS2A 3QSRA 1UR3M 1V02E 4I9TA 3QLDA 7XIMA 3TYEA 1VRXA 4K37A 3V1HA 1J0HA 1U22A 2QW5A 2A4AA 1J4EA 4CNUA 3NL6A 1SO6A 2OSXA 4WHBA 4U3AA 4QG6A 2C16A 4JFTA 3LCLA 1VFHA 3POHA 4XBJA 1E1CB 1JCXA 4PMDA 1TTJA 1K6WA 4A3HA 4CNOA 3ZR5A 3WFAA 1JPDX 1M7XA 4REQB 4NZ3A 3G1HA 4OUIA 2HSAA 4KERA 1S2VA 4P8XA 4WQ6A 1U33A 1HP4A 1QVBA 2L5HA 3CASA 2BS9A 1IEIA 4J2PA 4LOCA 4BY3A 4NQ1A 4ZOAA 4F66A 5BRQA 1BFNA 1XYAA 1GORA 3ZMRA 3IRSA 4X0VA 1V79A 1CGVA 3EMQA 3DBPA 3W00A 3AYRA 3GUGA 3AHZA 3TKFA 1HKWA 1XP3A 3C3NA 2UY4A 4XZMX 2YCLB 4F0KA 1E51A 3LRLA 1BHGA 4X2PA 5DY3A 2DJXA 3AIRA 4ATLA 3LNMA 1GQNA 2OB3A 3HG5A 4DNHA 1WNOA 4G8TA 3CYVA 2P3EA 3NDZA 2R1NA 3V18A 3L4YA 1ZRQA 2FFIA 2QVNA 3FDKA 3T08A 1RHCA 5B7ZA 4K7VA 4QP0A 2BZNA 4XAGA 3W38A 6CGTA 1W3KA 1TCMA 2FJUB 5G2IA 4RDWA 4LAOA 3RM9A 2ATSA 2X8RA 3IJ7A 1JNDA 2Y8UA 4I5XA 1T99A 1CLXA 4RNJA 2WVVA 3MDWA 3LMYA 2VC7A 2QDGA 4ZTXA 4FLRA 1LQ0A 4HU0A 3M0VA 5JIWA 4UR9A 1Q85A 2BXZA 4PE8A 4GQGA 4O17A 3ZJ6A 1S5NA 3SN1A 1E56A 5CG7A 4JYEA 3T09A 1UASA 1I75A 4Y9OA 4NI8A 4UTFA 4MG4A 2D1ZA 5DX7A 1ZLPA 3CV6A 1OJXA 4YJ5A 4W88A 4HA3A 4XBKA 1BPLB 3ZWSA 2XVNA 1Z6KA 2BXVA 4DI8A 3QV7A 5D2WA 2INZA 3B06A 4DO7A 4FP1A 3QMSA 1KTNA 4B16A 5G4EA 2QV4A 4CEUC 2GVLA 3A4WA 2Z2BA 2ZA3A 3S2CA 2WSRA 4GISA 3A5FA 3FFSA 4R9XA 4L5ZA 3NFUA 6ALDA 3SY1A 5D9NA 2DDXA 4AHPA 3B8DA 3N12A 4F0HA 1PKLA 4AVNA 4X9YA 2HE8A 1SFLA 1VIWA 3SO7A 2I56A 4TO8A 3MW7A 4C1KA 3UWEA 4C6QA 7TAAA 1PS9A 1IHIA 1XIBA 1XQKA 3FYPA 2WBKA 4H4IA 1PCWA 1R3RA 2GJRA 4YTUA 4NZ4A 1L8PA 2J4GA 1BQGA 1HVXA 2RKXA 2BSLA 4PC8A 3NO1A 4GG9A 1V0KA 3WLQA 3BQ6A 3ICJA 3P0XA 1FWJC 1O66A 4XSLA 1OC6A 2INEA 4MJ4A 1SFSA 3GH5A 1QASA 2F61A 4HGXA 2F6KA 1XYCA 3PC0A 4WUIA 4AXKA 4K36A 4CD8A 4KIEA 1JUKA 3C6CA 1KD0A 2E68A 4DJFD 1WXZA 2BMBA 3DERA 3WNLA 2HV5A 1WCGA 2FKPA 5LA0A 4JN7A 3CUIA 4Z2GA 1F8MA 1P5BA 4D8ZA 4GUGA 4FS9A 2V2DA 2G5WA 3V5CA 1CGWA 5T9CE 1TR9A 1O5RA 5KZ6A 4GC4A 4LS2A 4AC1X 4Z08A 3SRFA 4DO5A 1Z9AA 2PODA 1I0DA 5BOFA 4M5PA 4S3AA 3EDFA 4O0ZA 1XH0A 4HTBA 5ABFB 3GKAA 4MDOA 3WJWA 2V2HA 2A3CA 3A24A 2Z1XA 2WC4A 1AQMA 3MCNA 4C7DA 4UTUA 1R7OA 1PO9A 2C1GA 1AH3A 3D46A 4CNSA 2C1HA 1HF6A 1QAPA 1SZFA 5F7UA 1EJVC 2C0AA 4KCVA 4Q4PA 5CZKA 3NR0A 5J5RA 3YPIA 1R3VA 1W9BM 4QJ5B 2BDQA 3S5ZA 4FX7A 1JCMP 1GKPA 3ES7A 5A8QA 4WOZA 3NO3A 4OWGA 1QI5A 4Z2KA 1KXVA 1XCWA 1UKQA 3TJXA 1D8CA 4OFCA 2PZ0A 3F03K 3S2LA 4RW3A 1YYAA 1A80A 1XH2A 1B4EA 1XLAA 3FAWA 4DBSA 3BCJA 4J3UA 1CGXA 2Z2AA 1VCFA 1A5NC 3BSHA 4JTUA 1W31A 1C8XA 4GYJA 5K9CA 2VD8A 2E5DA 1Q4WA 2PTDA 3IV8A 1KRAC 4B3KA 4HTYA 3KP0A 4C65A 3VM5A 4GBDA 3N6HA 3LBMA 3CL8A 2Q8XA 2NX9A 3DECA 4JYDA 3KL3A 3P8JA 3SY8A 3CH9A 1K03A 1EB3A 1BWLA 4HB7A 2VEFA 4WR3A 1VC4A 2XU2A 3JVAA 1Y65A 1B0IA 4IISA 1R47A 4Q8WA 2VT0A 2GQ9A 4IX0A 3OGVA 4W7VA 2IKHA 1CI1A 1HGWA 5KETA 1K1DA 3B9OA 1VJZA 1YX1A 3U7VA 3M0YA 3TSBA 1TUXA 4I7UA 2J78A 3GVGA 3W24A 1AD1A 1I45A 3FYYA 1KWKA 5TNVA 3LCIA 1V4YA 4DBWA 3NVTA 3W7GA 1OZMA 3EZ4A 3WJXA 1TPEA 5AVHA 4M7TA 4XZBA 3PZQA 1XPGA 4ZQPA 1H7NA 3S3GA 4MTVA 2CHOA 3ZXWA 5IFPA 1HQTA 1X7IA 1R9XA 1EBHA 2NV2A 1LRTA 2Q3OA 3ITXA 3TAOA 4Q4SA 2X1UA 2DEPA 1TG7A 4E2BA 2ZZ2A 3LBCA 2PRMA 4W89A 2EBNA 3PSVA 4HU4A 4BF9A 2VOTA 5J5DA 1CGUA 3GDKA 3LGEA 3QY6A 4LUSB 1JEZA 1CNVA 3II1A 3ZJKA 3KE0A 3TN4A 5C2CA 2GJLA 2ZUMA 4BZYA 4LGXA 4A22A 3RFAA 2QCHA 2WCAA 3BL3A 1G5AA 2IPGA 2ON3A 3B0UX 3LPFA 1AFSA 3UT0A 3WMSA 3AS3A 1XBZA 2VEMA 4LF2A 2P76A 1PL9A 3GFYA 2WBGA 2NVDA 3NQ6A 3RU6A 8RUCA 5HPCA 1EF2A 2DZTA 2ZRXA 1XYMA 2CC0A 1H0GA 1ICPA 1JPKA 4TX9A 2J8FA 2VKZG 1T41A 3VIKA 3FSTA 3A3XA 3MCMA 2I5IA 1V03A 1X1NA 3EWWA 4R33A 3KWSA 1LUCB 4K1WA 2OU4A 1OEPA 1OF6A 2QJIA 1OD0A 1I2NA 3UG3A 1RJQA 1SGJA 1RP9A 2HXTA 1XUUA 3JRKA 3U48A 2A2IA 3WDIA 5ABEA 3WL0A 4CNNA 3MUAA 2VRKA 2YFNA 4JEQA 1UC5A 4LEQA 4GFIA 2DVTA 4JQ2A 1F74A 4H9VA 1VENA 4WIWA 1V08A 3ME3A 2YB4A 2QJNA 3WLIA 5CZJA 4CEXC 2ISVA 2OOFA 1CZ1A 2WHMA 2GWGA 3QHNA 4YTTA 3SCUA 3MMUA 4G7EA 3BH4A 3IAPA 1S3TC 5TAOA 3NZQA 1BGGA 1NDWA 3NA8A 2PLCA 1HX0A 4XTIA 2PU1A 3LLFA 1POKA 4LAUA 4Y6GA 3PZGA 3WF4A 1OADA 2VEIA 3C2YA 2FIQA 3GDTA 1H60A 1KM4A 1GOIA 2JKAA 3N3MA 1O7AA 3WLOA 1W5NA 2FZBA 4AWSA 5G1TA 2ZUTA 4RNFA 3GKFA 1KCLA 4C91A 3IANA 1JDFA 1SVDA 3WLMA 2PUZA 2HK0A 3NCOA 3PBUA 2ZA2A 1S2WA 4W93A 4Q8TA 3A22A 3WK3A 3LV6A 1T6MA 1LWHA 4ZA0A 3W7DA 2E6DA 4NYYA 2WPGA 3CQ0A 4UWMA 1KXTA 3VUPA 4GE8A 4B4FA 3N9SA 4PUKA 3VAVA 1L6SA 4D6DA 5REQA 2WVVB 1WBJA 1MRAA 3H12A 3AYSA 1B9BA 3WN6A 4PYSA 7CGTA 2OT0A 3BW2A 2OJPA 4I6VA 4ZO6A 1CB2A 1SMAA 3O0FA 2BHUA 1XX1A 4RE2A 1YNYA 3N2OA 4W7UA 3M16A 1C3FA 4O15A 3IJLA 5KZEA 2QQ6A 3EPNA 2CLOA 4LUIA 3HPFA 4F2BA 1FDZA 5L6UA 4JNYA 1MEIA 4DELA 4DN1A 2R1LA 2CEQA 3LHUA 1E4IA 2CLHA 2A3HA 5AHFA 4H01A 4BQ4A 4QJ1A 5A5WA 1A5UA 2QV5A 3IPWA 1PXGA 3SDOA 1JF6A 1XSKA 3UJRA 3ATZA 4HNCA 2G37A 3TE9A 1TRIA 4LFYA 1F3XA 3B05A 3INPA 3HPZA 3IK2A 4JKLA 2XH4A 3H7VA 5A6MA 1R2SA 3VOFA 1NDVA 2XN2A 1B54A 1UWTA 2YFOA 1F05A 1LBLA 3AMDA 4US5A 1A50A 3OZOA 2ISFA 3O3RA 4OGZA 1BYAA 4IQEA 1UIPA 1V0NA 2ZXQA 1GVQA 3EPMA 3EDJA 4XUYA 4H6KA 2YCIX 2CLIA 3VGGA 3QHMA 1QRQA 3T0BA 2DSZA 4GLEA 3B0YA 2CWXA 3LCFA 1ENUA 1KBIA 4WEVX 4JTSA 3NL2A 3TN5A 1HO1A 1SSDA 3G0UA 5DN1A 5A6JA 1V6VA 3WUFA 2RGMA 3CLWA 4ORMA 4F0SA 2F2HA 3LU2A 1TPC1 2YZRA 4A2RA 1SM9A 5IDIA 2FTPA 2R9RA 5FESA 4DYJA 2QCFA 2OPJA 4F79A 4GNVA 3QR1A 1AH4A 3VZYA 1X7FA 3HU7A 3K1DA 4ZO9A 3W26A 4C6IA 4DWSA 2PTWA 2IW0A 3H4XA 4PTWA 2P0IA 4LV4A 4IIGA 4U33A 1XLEA 4UTMA 2JEQA 1AVAA 2W67A 3REQA 4KQNA 4WRHA 2F8QA 2PB1A 4DUWA 3R94A 1P6BA 3ENLA 1OCQA 5C7HA 5D30A 3U3HA 3UWYA 4XKYA 2IPWA 4LVDA 2ZX7A 5CAKA 3H4WA 2A5HA 2ZDSA 5FKYA 2VOMA 3KL5A 3CUFA 3E0IA 1K8ZA 2CHRA 1JZ8A 2CLPA 2FH6A 4GX9A 2G97A 3N4AA 1Z44A 3AJ7A 3VMPA 4HOWA 3GNPA 3O6CA 1MEHA 1I4NA 4INFA 3TNOA 5A8MA 3VE7A 4MB1A 4MY9A 1H11A 2QULA 3CS2A 5H2ZA 3CWOX 3ABRA 4B9YA 1YBQA 4KGJA 1UOZA 1EJUC 1QPQA 1Y5VA 4LYRA 3R12A 3FVDA 4JYFA 1PPIA 1GVOA 4H19A 4LH8A 3RJXA 5F4XA 2FB3A 3BV7A 1DWIM 3OYXA 1UUMA 3REQB 4GJJA 1GYLA 1LL7A 1TZ7A 1PIIA 3ONBA 2C13A 3ZWTA 6REQB 5FJRA 1ZU8A 4LC8A 1B30A 1Y5XA 4L9ZA 4FIRA 4UB9A 4BI7A 3IUDA 4J4KA 5D05A 1QT1A 2V8ZA 1ZL1A 4GHRA 3ZIZA 4QBXA 1GOKA 1JULA 1AJ0A 2CLEA 1JI2A 1H5VA 2ZWYA 2B7PA 1TWDA 1TV3A 3W2UA 5DO8A 2TODA 5CC5A 4NRSA 5ECUA 1T7LA 3GH4A 2VQTA 3UG8A 2ZUWA 3G6LA 3BO9A 4J5NA 2FZ9A 2GVEA 4YU1A 3B40A 3V36A 3TJLA 4GVIA 1QR7A 3GDRA 4R7WA 4B3ZA 1T0OA 3QZEA 2Q8ZA 3NM3A 7ODCA 3WDJA 4AWEA 1FP9A 1W2VA 4TU1A 2OZTA 1FKWA 3S6DA 5HDRA 1XIIA 3VIFA 2D2GA 4LW7A 3SCVA 3W7NA 4MY8A 4A3YA 1AK5A 4AVOA 3IK4A 4NI3A 5FF4A 1UIOA 4H00A 3VILA 3GUWA 1TR1A 3L4XA 1Q2RA 2P1FA 3GTXA 5F2LA 3H2OA 3CPUA 3JW7A 3KW3A 2ZA1A 3WH9A 2IXUA 3TR2A 2NVCA 4RKAA 4PMOA 4GVFA 1IXQA 2ASHA 1PYMA 5K4ZA 5HAOA 2WZMA 4UTLA 2DSKA 1KFWA 1K8CA 1R3TA 3WF2A 4UQDA 1HG3A 3MWCA 3PUEA 2YBTA 3UZXA 1TKKA 3S5NA 2W91A 1RVKA 5BCAA 4B92A 1XRFA 1IEQA 1PKNA 2VFGA 2WYSA 2TPSA 3ZJ8A 3HB9A 4L64A 4RDZA 3W2KA 1XLFA 4GQQA 1YPFA 4TVUA 3HQOA 1IZCA 2BP1A 2ZQ0A 2IS7A 2Z6JA 2J62A 1YDYA 4DNMA 4MVAA 4KETA 4DBDA 3S9ZA 2C0HA 1DXIA 4GBUA 3NSMA 4JBRA 4CCCA 1M3UA 1ZBCA 1XLKA 3F5LA 2GPTA 5JIPA 3O06A 1H49A 4DXXA 4CVUA 4LWWA 5D2VA 3THUA 3IUHA 2YW4A 2INFA 5D32A 2ZRWA 2XG9A 4Z1AA 4W8LA 4B5NA 2V2CA 3VINA 2E6YA 2IQDA 3SURA 4FXSA 3ABQA 3CIVA 3UZZA 3VDGA 3DGBA 1W5MA 4KRTA 2J75A 3ZZ1A 3VK5A 4N0RA 4GRSA 1BTMA 4C7FA 4GCXA 2E6AA 1FHUA 4HOZA 2CKSA 3G5EA 4Q4RA 4LUSA 4GO9A 2GUBA 3HPXA 1X6LA 2HE5A 4JIPA 4UTWA 3VVGA 3LRKA 4ZOBA 4N9CA 1H50A 4LBRA 4BEUA 1T5AA 1ZHAA 3GZ3A 1OFOA 3VIHA 3KUMA 1NWSA 3W1XA 1VFOA 4UOZA 3LGDA 2DSWA 3B3DA 2Z24A 2MUCA 1DBTA 3N4EA 3K30A 2CBUA 3UXIA 1U1UA 3R13A 4K8HA 4J28A 4M7SA 4P61A 1AW2A 1OVDA 2CIPA 2IKJA 2YA2A 3PZVA 3RJYA 2ACUA 3P74A 1FWBC 4LAZA 4XO6A 3W7EA 2QJJA 3W2NA 2PP3A 2VFEA 1OC7A 1K8XA 4JFUA 2WXDM 3Q2DA 4XIAA 3DFNA 4LS1A 4NZ5A 1X98A 1I1WA 1TV7A 2X42A 2PDUA 3E74A 2Y7GA 3T42A 2QAPA 4PMNA 1UH3A 1F61A 4Z2JA 5DLCA 3U57A 1UP2A 3CAQA 1W8SA 4RE4A 2VP8A 3HG2A 2G50A 2GUYA 4JGDA 3MI6A 1EGMA 3GXTA 3FGCB 1IV8A 5ENLA 4Z1CA 4E6MA 4S3GA 3W1TA 4WKFA 4PB3A 1ZGDA 3UF9A 4PCFA 3TN3A 5CPTA 3KBSA 2BHYA 1XJBA 3DN5A 4WSHA 3B97A 1LLWA 4WDXA 3DX5A 3DCPA 4QJ4B 2PRHA 1Z48A 3A5VA 1LUCA 3VKKA 3HJEA 3PHAA 2HQAA 2E9BA 3TAKA 2X0HA 3QRHA 2VM8A 1WUFA 1Z3NA 1V6UA 1J8VA 2YYTA 4QLJA 3AS0A 3WENA 1SJCA 3CGTA 4AX6A 1BKHA 3VZZA 2AOSA 2YIHA 2ZTKA 4FX6M 4IFKA 2FJKA 4TVCA 3AZTA 4XO7A 3SRDA 4B4HA 1XRSA 3ALGA 4N6EA 1J0IA 2GDVA 4HJWA 1KV5A 1W5QA 4W5ZA 2OO0A 2E1DA 3HZ3A 4U10A 1BYCA 2BX7A 1O6IA 4OT7A 2CHNA 3GWQA 3OZMA 3MI2A 4JPGA 3UG4A 3U7BA 3BMXA 1H61A 4KESA 4ZQRA 1FA2A 4QQ3A 3LI0A 2PTZA 1UG6A 1R5YA 4OHQA 4YTSA 3OBAA 5DRCA 3TC6A 1IEXA 3D0CA 3PZNA 4CD5A 5LHEA 1TVNA 2A0NA 1WB0A 4M80A 1MZHA 2WW5A 3I4KA 2Z1KA 3QZ6A 3USBA 3FVMA 3L2LA 3IGHX 4EF9A 3CV1A 1K7XA 3OO2A 4PMYA 4JTDA 2E9MA 5C0QA 1KGUA 1LG1A 2JK2A 3HQNA 3CAVA 1EEPA 1AW5A 3EOSA 3T9PA 5HNNA 2F2KA 1JYNA 1XYBA 3BV4A 3TYCA 4FNPA 1XV8A 3C56A 4A3UA 5CGQA 4Q8MA 1JR1A 5JUVA 5CLWA 4J3SA 4HNUA 3TFXA 2QDDA 5M17A 1UWSA 5EMUA 3C86A 3UWQA 1JZ3A 2VELA 1BXCA 3PUGA 4P8VA 3N19B 4H2HA 3L66A 3DENA 4O10A 1XDJA 5A8NA 3O6DA 2VVSA 3N9KA 1YXCA 3RCNA 4JFWA 1RY8A 3G2GA 3I4EA 2DT1A 4UQ9A 3USZA 4C1NA 1E6NA 3W0KA 1E4NA 2ODOA 1E0TA 4GD0A 2NV9A 4QTGA 2NLIA 3CUXA 2DZXA 1V93A 1FWTA 4CGTA 1OWQA 4UFJA 2Y4SA 1UD2A 5LSMA 4Q8OA 3R79A 4Y8FA 1X96A 3SRKA 4UTHA 3BQ5A 2VCAA 3M6DA 3QR0A 3E49A 2OFJA 5CEWA 3GW3A 3KOYA 3GTNA 5FJIA 4PUNA 8XIAA 3A23A 3TMLA 5C70A 1R3YA 2WM1A 2XHYA 1TWZA 4FK9A 3TXVA 2X1TA 1UUQA 3HMJG 1Z32X 4WY0F 2PGFA 3V7PA 3D5HA 3N6JA 5CSUA 1JDDA 2VGFA 4PTNA 4H3DA 4M6QA 4PFHA 4N6FA 4I7WA 4TXEA 5F4WA 4WY0A 4EK7A 2AMGA 2BY1A 3ANYA 5ABFA 3M41A 1F6PA 1ZAJA 3DHPA 4LYPA 1ONXA 2C15A 3HPSA 4M51A 3I6RA 3M0XA 1T8QA 5KSWA 1MUCA 1U1HA 1ZNNA 3RU8X 3M4HA 1PX8A 2VX5A 2Y8VA 3UPBA 1LL6A 5LZLA 3A4AA 1QWKA 2J66A 1C8QA 1MYRA 4L6HA 4R3UA 1KRCC 2QZRA 1NOWA 3DFYA 4YLWA 2WZEA 2A7RA 1XINA 4IJCA 4S1FA 2DZUA 4AH7A 5BU6A 2J88A 4GYPC 1X1OA 5I0DA 4R5EA 1XCXA 4HU8A 1ITCA 3GC4A 3HV8A 3C8NA 1IE7C 3AHVA 1XSJA 2GQ3A 3R7MA 5I06A 2VD9A 5B7YA 3BLPX 1QI4A 3PM6A 4Z2HA 1UD6A 4YWIA 1CXEA 5AOUA 4H9ZA 1L6FA 1JJKA 1QNSA 1MXSA 5C2GA 1FWRA 1UA3A 1YNQA 4L1XA 3MV01 1G7UA 1F5ZA 1GCYA 1VLIA 5FSDC 3N4FA 2GDUA 2Q01A 4KRUA 5LA2A 1H4PA 1K8YA 1UP3A 2RDTA 1TJ0A 3E6EA 3F4WA 2HMCA 1TV8A 3W27A 2FH8A 4FA3A 1QK2A 3PJWA 3N2BA 4QIUA 3DC0A 3ZT5A 5C8BB 3OVQA 4S38A 1W0MA 1WV2A 4H8UA 1LJYA 4PMVA 3G18A 1IZKA 2QCLA 1VFMA 2R8WA 3FJ6A 4Z1YA 3GFXA 1MO0A 1J0KA 2WQDA 3AXXA 1WP6A 4A05A 2X40A 4I8YA 3FA3A 1OX4B 1R8LA 2W6RA 3SY5A 3V0SA 1YHTA 3G22A 2VZTA 4EXAA 4U2YA 3W74A 3WEOA 1HVQA 3MUY1 4MJMA 3LPOA 2A3EA 5EMLA 1RA0A 1KA9F 1EC7A 1RQBA 2CERA 2QYGA 4H1ZA 4D6JA 2PI6A 1HJXA 1ZAIA 4N4QA 1Q6GA 1WXJA 4FLOA 4ZB2A 1DIEA 3C8FA 3W53A 3QJAA 4C6MA 1KWGA 1GQLA 2RGLA 1ZSXA 4G7FA 3CPGA 4RNIA 3WH7A 1MQRA 3IVTA 6A3HA 5EMJA 1E55A 4JNMA 2VX7A 4PZVA 1Q5MA 2YA1A 3W1LA 1EX5A 3UWUA 4RLIA 5EY5A 3PFRA 2P10A 4QEEA 1F9CA 3KDOA 4HP5A 4M6PA 3BAKA 3S9YA 4ICCX 5LIWX 5EGRA 2Z4GA 1OCBA 2PWGA 4M3PA 3S1WA 4IMAA 4AYGA 2Z28A 2XH2A 2ZZ1A 4I9JA 2AAAA 4JHOA 1TWIA 1KNWA 3B0XA 2Z2UA 3A4JA 3NZGA 4QLLA 2VWSA 1S5WA 3SM0A 3O0KA 5M3WA 2R14A 2YLLA 4O11A 2CZEA 1G94A 1K02A 4RNHA 3W25A 1XHGA 1T8XA 3FAXA 4D9PA 2XN0A 1ZENA 3STFA 5A95A 2ISWA 1J79A 1TELA 3TZNA 3N11A 5T8GA 1L2UA 2R94A 5MKGB 3GXDA 4LVBA 4YVPA 1HNYA 4U31A 4GUHA 2OTDA 1JQXA 1ECQA 1LM1A 3AMCA 4B2DD 1FWNA 1E3ZA 1CWYA 3KBJA 1A5OC 1TA3B 1R85A 4MIMA 2FHCA 4FLQA 4R88A 1A5SA 1Q6DA 3RR4A 2J79A 4LBSA 4CKQA 1HTIA 1U5HA 3APYA 1I2PA 3VCCA 2SFPA 1FWHC 1M9HA 3GC5A 5AYBA 3EA1A 3WNPA 1ICSA 5E5CA 5CGTA 3JR2A 4EWND 2WSKA 1G9HA 3QXBA 1FCVA 3R5EA 3GZAA 2A3AA 2TYSA 3LK6A 4UMCA 1ONWA 4MFDA 5DMMA 3N14A 4NZ1A 5TBOA 3BG3A 4NYUA 4TMBA 4PRWA 4RZ4A 2FGLA 4LY4A 5D33A 1NOUA 9CGTA 5H91A 1CB7B 2NZLA 2W92A 2OVLA 2I16A 4CUCA 1XGZA 3VU2A 1CGTA 1V5XA 2V3FA 5IOBA 3BCDA 3OODA 4P7LA 4JQAA 4EX4A 2WHJA 1E9YB 2NLYA 1SJBA 3VNKA 2V30A 2ZC1A 1XIJA 4V33A 4EACA 5CKSA 3T2QA 5K2ZA 1GGOA 3CWNA 3NQ8A 4E8GA 2GK1A 1DQXA 2WCSA 3T7VA 1JCYA 4MB3A 1E0UA 3KS5A 3TH6A 3ZT7A 4HQVA 3AIBA 2XISA 5EPDA 2V68A 4JZ5A 1B3WA 4JFSA 1WAUA 3WQ5A 3AOFA 1OFPA 3U2CA 2PWFA 3UZ5A 4AC7C 1JFHA 1K9EA 3MKVA 1TPH1 2RUSA 5I6SA 1C8YA 4IG2A 5A8PA 1QNQA 5DEZA 5HNUA 2PDYA 2I57A 2UZ9A 4RL3A 3BGJA 3CMFA 3GY1A 9RUBA 1EPVA 2DT2A 4KEZA 5K4XA 4GC3A 4AZ7A 3CUHA 2PD9A 5GNXA 3LHZA 4WDUA 5AC8A 4FAMA 5EFDA 1J0ZA 1Y5WA 5J8LA 1R46A 3R0KA 4JDYA 4LVFA 1AA1B 1WOAA 2PURA 3RM4A 5G4WA 3HOJA 4KBXA 3TONA 1PX4A 4WKAA 2A21A 5KZMA 2QF8A 2C79A 1V6WA 5LKYA 1EYWA 3BZGA 3DKLA 2XVKA 4QX4A 4HHPA 1ZP3A 4O4VA 3W85A 5CPMA 1U30A 3UERA 2VMFA 2YGYA 4KS0A 1O1HA 5F1UA 2VFHA 5MF5A 2HVMA 1KM3A 3R0DA 4IL2A 1UOKA 3FHAA 4YS1A 3STPA 3PAJA 3WBYA 4IXHA 4ONVA 1US2A 4EF8A 1ZUAX 1UD5A 3ZSSA 1WDRA 1GVEA 2DORA 2PU0A 1FH8A 3EDKA 4ZCWA 3FS2A 3W1NA 5BXPA 5D2YA 2XUCA 1D7KA 4JTCA 4PBGA 3BDKA 1W91A 2YCKX 4GPNA 4NKCA 2JGQA 1GEHA 4UNLA 4H9MA 3U4FA 3ARWA 1MW1A 1SO5A 3N15A 3PJTA 1DV7A 4ATDA 4X0NA 2J7EA 4V2XA 4AD5A 3AJXA 1ELSA 1GOXA 5I77A 2IQTA 4XZLX 2FGZA 1CENA 1H51A 5LIYX 4EAYA 1BVZA 3UXDA 3LSBA 5CPNA 4QE4A 3KRSA 4DLFA 4XVDA 2NVAA 3WLSA 1RBAA 4Z1BA 1Y8BA 1NELA 2OOGA 1PBGA 2WSPA 4JKKA 1EYEA 3EKLA 4LF1A 1XISA 1W1VA 4ACZB 4JICA 1WZAA 2EJAA 3RR1A 4NX5A 4DM2A 1F3TA 3GHSA 3R8GA 1RJPA 2D24A 1W1TA 1A49A 1KBKA 4C5ZA 2E5CA 4I6KA 3DG7A 1G1YA 4JTQA 1VZWA 5HWJA 3WQDA 2ZUNA 3KHJA 1V02A 3TYBA 2W63A 1EC9A 4QS5A 3B8WA 4MWAB 4H9TA 2VR4A 3BGAA 2EPOA 1NQ6A 2HNHA 2VFIA 3CNYA 3KM8A 2WNZA 1H1NA 1UCWA 3T2PA 1R9ZA 4AZIA 1TV5A 2DZSA 4HD5A 4XAFA 4HNNA 5DXXA 1PJ9A 4ZMGA 3GK0A 2CNCA 3M0ZA 3H2EA 4GO8A 4UTWC 4M24A 4PB4A 2ISDA 1XI3A 1IF2A 5C6MA 2GGJA 2X30A 4ZO8A 1DIKA 5DCBA 1X1ZA 1E9LA 2PE4A 3E0FA 2WKGA 5DY2A 2POTA 1FFQA 2ABBA 3GYEA 2EGZA 3F1QA 3KP1A 5HJYA 4IHCA 3NEHA 3NZPA 3TWAA 4ERIA 5CC6A 1GKRA 3NZ1A 3KBVA 2JALA 2PWUA 3CZLA 5A2AA 1GUVA 1Q6CA 1S38A 4R34A 3EDDA 2G3NA 1N2VA 1Z7AA 5BXTA 3GBEA 3HURA 5H6HA 2Y24A 4QSHA 2VNCA 3PZMA 1HN1A 4PUWA 1MNZA 3ECQA 4GYFA 3H2CA 1MI3A 3HV9A 1PAMA 1GZ1A 2CKRA 3P6LA 4FOKA 4IIEA 4FMVA 3CM4A 1XIMA 2RJGA 1OC5A 1CIUA 3HG3A 4BR1A 4YTQA 2DZVA 4J7RA 1BWVA 2VDGA 1BWKA 1SYTA 3GIQA 4DM1A 3G3DA 3UWVA 1JD9A 4PEKA 1GVSA 2ZVRA 3EX1A 5I23A 2X2GA 4I90A 2EG8A 2BNJA 5FL1A 3EB4A 4PTXA 5AKQA 4KFOA 3W7OA 2Z29A 1KR1A 4HIBA 1EKOA 5HMSA 2ZRUA 4L6DA 2XM2A 1A0CA 1D2KA 3R1ZA 4ZO7A 3PB0A 1HW6A 1RUSA 2A6NA 4XG1A 1ML1A 1X39A 4RDVA 1O4UA 1WE5A 4IG2B 1L9WA 1H41A 3KZSA 2PDGA 1IZJA 2ABAA 1V3IA 1ITUA 2PDLA 4K7YA 4M56A 1EGVA 3AROA 2PGEA 4A8NA 4FX8A 4NJKA 4GNJA 2GLKA 4ZQMA 3S42A 3W1QA 3PSWA 3OLDA 3S2MA 3GR7A 2Q71A 2RHGA 3FW6A 5AHIA 4CN1A 2VXNA 4TIMA 2CZVA 1YTEA 2CXGA 1K77A 3PB2A 1ITXA 1J0YA 1ISVA 3BOFA 3EOLA 5CH9A 3B04A 2P53A 2Q09A 5EA9A 3C3UA 1NDYA 3WD4A 5E9XA 3OP2A 2FZNA 2P8BA 2ZX6A 3UA4A 5KINA 5H1WA 3EOUA 1IQ8A 3CEPA 4S3CA 2QUNA 3L67A 5CSSA 3LB0A 2J24A 4TTGA 3DXIA 1EO5A 1V6XA 4D71A 3NO5A 3VI2A 3WQ6A 3O6AA 1W17A 3EKZA 5E6ZA 1BEUA 3V1PA 4LV9A 4CVWA 3GX9A 3T2OA 1G6CA 1SZRA 5KMYA 2D23A 3GTHA 2C18A 1HKVA 4Q32A 1DJQA 2GQAA 3W7MA 1ITQA 3AMGA 1VIZA 3M0LA 2PLJA 2ZADA 3C52A 4XZIA 3R2GA 2O7QA 2Y62A 5EBAA 3DI0A 3LXAA 2R1PA 1W1PA 3PZIA 3O6YX 1HT6A 3I6EA 1QWGA 5EMKA 2YA0A 1IGWA 1J01A 3URBA 4PR4A 2C71A 1KR0A 3E12A 3WH6A 2A85A 1RVGA 2XYLA 5I2UA 1Q6LA 2GVGA 4HNOA 1LT8A 3UPMA 3VFCA 2NUWA 4DWSD 1JGIA 4NSBA 1Q65A 2V5DA 3VDAA 4NL1A 1DJYA 1OM0A 3UJSA 1XLGA 4ZZ9A 4PMUA 3MWAA 3PTQA 4XX6A 3TIMA 3V4BA 4GUIA 2E25A 4AX7A 2VUNA 2D22A 3SQSA 1E6PA 1R3SA 1SQ7A 1XDLA 5IFTA 4JHZA 1QTWA 5FEWA 5EB8A 4S3DA 1E73M 1VGAA 4BKNA 2MANA 3GNXA 2G4JA 2VVNA 4XSMA 2JE8A 3WG6A 1OYBA 1TMQA 3RUBL 1XGEA 4V27A 4PCPA 5CJ5A 5HULA 1Q6RA 3AXMA 2XIIA 2XSAA 3V5FA 3NYZA 1UWUA 5LNVA 2AKMA 4CCZA 1FHVA 1EFZA 3K8KA 3PZOA 2ZTJA 1JAKA 1UYQA 2Z0IA 3BJFA 1BVWA 1XYLA 4HMDA 3NQDA 5XINA 1KQZA 4P5UA 5JVLA 3TW6A 1E0WA 4KWOA 5BXSA 3IVSA 1XKYA 2BVYA 3MP3A 4L65A 1I6NA 3VFLA 2J7CA 3ALFA 4L1GA 1WA3A 3KFTA 3QGVA 1TVLA 3E96A 1AZ1A 1KFLA 2OT1A 3PPHA 2OWCA 4Y9MA 2NXIA 5CSRA 3ZVHB 4LCSA 1YDNA 4C90A 3ZLHA 4C5YA 3LPGA 2G95A 3IIVA 1UD8A 2FTWA 2ISSA 3IACA 4F0LA 1VAHA 2F6XA 2VGIA 3IS4A 4RK8A 4BQ5A 3QV9A 1FY6A 3BW3A 4I9AA 1VF8A 1GYMA 2YR1A 2OLHA 4MUPA 4GUJA 3O63A 1EIBA 4UQEA 4MHBA 1XF0A 3H2NA 2D0GA 4EE9A 2V5BA 1YE6A 4C1LA 5FEZA 3MDUA 4W84A 3TEVA 4YHEA 3UQNA 4IUOA 3E9AA 1A4LA 1E9ZB 3RPDA 2V5KA 3PG8A 4BI6A 2OSYA 4LQ1A 1LTDA 2PMQA 4FZIA 3C0JA 1VJSA 4H41A 3WZ0E 1B3OA 4WF7A 3SSJA 3G8RA 2O9RA 3VOGA 4BF5A 5M03A 1KO0A 3NSXA 3OA3A 4I8DA 4AZHA 3MANA 3N2MA 3S1XA 4IIFA 3TQVA 3LCWA 4D8LA 3LSCA 4QG9A 4EIVA 2VR2A 4Z1DA 1WDDA 3GM8A 1E6RA 1WZKA 1NAL1 3F2DA 3WJSA 4W8AA 4EPDC 3W7LA 1DTNA 4Q4QA 1JF5A 1Q6FA 1RCOB 1RK5A 4FNSA 2D69A 2OZ3A 3WD0A 1TQXA 4ALDA 3EA3A 4JR5A 1SMDA 3QTPA 2NQLA 4TTUA 3WF1A 1R9YA 4N2YA 1S5VA 1JDAA 3PBVA 2VL4A 3PBWA 4B2DA 3IGSA 2UV8G 4LXFA 2QIIA 3WQ8A 4Y96A 4PODA 2DIJA 4L6OA 4TX6A 1V0LA 1P1XA 3HIJA 1KM0A 1XBVA 4AF0A 2XVLA 3VDCA 2ZC8A 1DJZA 3AYVA 4O18A 2PP1A 4HYVA 3UW6A 3VKJA 5A94A 1VKFA 1DWJM 2D2OA 4RJEA 1JYWA 1W9VA 3BLKA 2NUXA 3I10A 3U5YA 4O13A 1EJXC 4WJEA 1VJIA 1Y0EA 3KRBA 4ZL1A 2VRQA 3EMZA 4IMCA 2E6FA 5H8UA 4H8HA 1B57A 1PZ2A 3DFPA 2DZPA 5AC5A 3K4AA 3VNDA 4R85A 5C9XA 4D6CA 4Q4KA 3E5BA 2YOCA 5GJNA 4MNKA 4G2DA 1HIZA 4GKTA 5E0CA 4JX6A 1UD4A 4HT3A 3NQBA 2GYIA 3P62A 4WXZA 2Z6IA 1A5CA 3MQTA 3TVAA 5FF3A 1SW7A 1A3HA 1ODUA 2G4FA 1MNSA 1H2JA 4K3ZA 2Q3RA 1OK6A 1P7TB 1H1ZA 4QHRA 3T8QA 3WBEA 3C2RA 3L5MA 1E1CA 3MKKA 4AIBA 2CZDA 1F6KA 1EQPA 2PDBA 4NAEA 3LV5A 4JTGA 3R25A 3B8VA 5AHNA 4M0XA 3SJNA 1F73A 2EO7A 4LB4A 2IPFA 5JQ9A 1XFCA 1F7BA 1B1YA 3URAA 1CXKA 4QCEA 2F7FA 4C7GA 5GVJA 2E4TA 4C6JA 3WK1A 2HEJA 2F38A 1XPYA 3T44A 5AHMA 2BBFA 3CBWA 2ZXAA 1CX9A 3VUSA 3EYPA 1QW8A 3EWXA 4MF4A 3EWZA 4XD6A 3A9IA 1M03A 3NQVA 1G7VA 3DFQA 3MSYA 3M9YA 2EQDA 3IAQA 3AS1A 1E6ZA 3ITLA 1S1PA 1SR9A 1G4PA 4LNCA 3GR4A 3T0CA 1GK8A 1VP5A 2D0FA 3QYQA 1NARA 1US0A 1GG1A 3ARYA 3GAYA 2W79A 3Q94A 1UUOA 5CG0A 3MSRA 4O1FA 3ARZA 3S1GA 4IQDA 4CQDA 1IR1A 2QPUA 5D02A 2ACQA 1OCJA 2FDSA 2P88A 4GMEA 1H1YA 4WX2A 4HNLA 2GJXB 4KKXA 2WSQA 3E0LA 3H70A 5LXEA 1BF6A 1GQJA 3HGRA 1C91A 2DH3A 4C6FA 2EG7A 1EX1A 2W4XA 1UKOA 3MVIA 3OHMB 1SR0A 1XLHA 3TN6A 4GNKB 4ERGA 4EXBA 1W9PA 1AL8A 4GIAA 3OZPA 1LOQA 1TTQA 2OQYA 2ZUSA 3N29A 3CK5A 3UXLA 1UPMB 2RJHA 1X97A 3IIZA