2TPSA

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiamin biosynthesis
molecule keywords PROTEIN (THIAMIN PHOSPHATE SYNTHASE)
publication title Crystal structure of thiamin phosphate synthase from Bacillus subtilis at 1.25 A resolution.
pubmed doi rcsb
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 1999-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2tpsA00
1RPXA 4IQLA 3TJXA 1OYCA 5EYWA 2RHGA 1F76A 1OYAA 3O6CA 1EWDA 4LOCA 4MYAA 1TTJA 1VHCA 3SSJA 1X1ZA 1C29A 3C2VA 5CZ0A 1KBIA 3L21A 3HG3A 3CM4A 3SIZA 2EHHA 1LBLA 3MBFA 3NO5A 5FF7A 4ZQOA 4N9CA 1TV5A 2PCQA 1SO5A 2RDWA 3NQ7A 1I2QA 2VFHA 3G0SA 3WJZA 4E2DA 1QOPA 2ABAA 1TPC1 5D2YA 3T40A 1DQXA 1PVNA 3USBA 1S5VA 1JR1A 3GVGA 5AFDA 2NUYA 1PV8A 4N9BA 3GX9A 1KTBA 4AWSA 3VCRA 2VKZG 3BVJA 3LRMA 2E5DA 3MI3A 5I3IA 5D30A 3SJ3A 1EWEA 1EB3A 3MBDA 4RXFA 2R8WA 3R2GA 1THFD 2E6FA 2TMDA 3LTPA 2FQIA 5AHFA 1OFOA 1VLWA 4YXGA 1V5XA 2VC6A 3LBCA 3GNNA 1LLWA 3TV8A 4MY1A 5AOUA 3OVQA 1IGSA 1OF8A 1TQJA 4LW7A 3S42A 4DO5A 3NPVA 3STGA 4CLMA 1X8FA 3S0CA 1Q45A 1FWTA 4RK8A 1AK5A 4EVZA 5U4NA 2XN1A 4GUHA 1FDYA 4O50A 5A5WA 3TXVA 1F05A 3P8JA 5DCBA 3DENA 3RK8A 1R47A 1SO4A 5FEWA 4HKPA 3SGUA 1DVJA 1R46A 2B0MA 3W1TA 2J24A 4NX0A 4CQ8A 5KTLA 2WPBA 3DHDA 1GG0A 3W88A 4S2BA 1YTDA 1KM2A 4UC5A 4Z1BA 1SO3A 1H50A 1VYPX 2XFWA 2BTMA 4KWVA 3TDFA 1WYIA 3WJWA 1Q6OA 1ADOA 4FXSA 3H54A 3STEA 3BK0A 3GAYA 3NQDA 3NL5A 3MHFA 1H7XA 5CZSA 1MSSA 2C0AA 1L2UA 3VE9A 3KXQA 4M6QA 3N19B 3N34A 2QUVA 4BI7A 2FPVA 1I2NA 2Y61A 3GXPA 4KFNA 3DHFA 1AW5A 1KFKA 2C18A 3BLEA 2W6RA 5LSMA 1Y0EA 3NAVA 3CC1A 1VCGA 4RLIA 3W23A 3M44A 3O05A 2WKJA 4O19A 4AAJA 3TK7A 3W86A 1O94A 2TSYA 2B4GA 3DBPA 2VFIA 3WJXA 5T26A 4O4VA 2RH9A 2J9XA 1KFJA 3LHUA 4IMFA 2V0TA 5D2WA 5HUPA 3QQ0A 3R12A 3RMJA 2G95A 3S5YA 4Y9AA 3KVLA 1W5PA 2X1UA 3LCFA 1KW1A 2PRLA 2A21A 3T4CA 4JYFA 4GUFA 5K2ZA 5AC8A 1QO5A 3G3DA 3L66A 4HNTA 1H7WA 1SSGA 2VELA 3NYZA 3O6YX 3VNDA 4JTLA 4UFKA 4BWLC 4TU1A 4GUGA 5AYXA 3LCIA 3WK0A 5LNVA 4IXHA 2ZA3A 4HN4A 2GUUA 2ZDRA 3W1RA 3QFEA 1M6JA 5D33A 4G1KA 1ME9A 1EUAA 4AB4A 5I3FA 3PY2A 2GQAA 1W8SA 3LHYA 5H91A 3FS2A 3STFA 1NEYA 2C19A 3O6DA 4RZ6A 4AMAA 3TKFA 3CHVA 3PUEA 4JD4A 2QKFA 3FYPA 1GPWA 2X16A 4MPQA 3W84A 3NQAA 3TA6A 3G1AA 1KLYA 5D32A 4K7VA 2ZFAA 3MP4A 2Z1BA 5KMYA 3UWVA 2KZHA 4UTHA 1WAUA 3NA8A 1XBVA 1FXPA 3MYPA 1Q6RA 2AAMA 1IXOA 3UY7A 4JEQA 4Z1AA 4AEOA 3PG8A 3U8GA 3MYOA 4ONVA 3I6RA 4O16A 1G69A 3R89A 1G7UA 1H60A 4O14A 4ZVJA 4S1FA 3GDTA 1S3HA 2CLLA 1VPXA 3UWZA 5F4XA 1YDOA 2RDTA 3KAOA 1HUVA 1QPQA 3M6YA 2BSLA 3Q37A 1FXQA 1Z42A 3W72A 1TCDA 3S5NA 3UNDA 1Z48A 4L4LA 1ME7A 2ATSA 2ZZ2A 2GVGA 4JYEA 4K36A 1LP6A 5DY3A 1KV8A 4ZQCA 1TRDA 2WJZA 2CZFA 4P2VA 4R53A 4WD0A 4OWGA 1JUKA 2C14A 1TPH1 4UTIA 2WNZA 5F2MA 3TSMA 3ZS4A 1B3OA 3U6WA 4DPQA 2QDGA 5LNUA 4RXGA 1L6WA 3KRSA 2BZNA 1HTIA 3W75A 2NV1A 3QC3A 1TREA 4X3ZA 1LRQA 2GJLA 4FX7A 1K02A 1T96A 1A5CA 1EP1A 3QSTA 4IX0A 4BI5A 2ISVA 5D09A 2YYTA 5C55A 2ZYFA 4GXMA 4MY8A 3GK0A 3G18A 4HPJA 3LLDA 2GPTA 4PODA 1GVFA 1LROA 1VLIA 3EXRA 4FO4A 1QCWA 3W3OA 3S1WA 1IXPA 1B4KA 3RNDA 2Y7EA 1PE1A 2QCMA 3O8AA 3EEGA 1DOSA 1HO4A 4K8HA 3FLUA 5KINA 4GJ1A 1FX6A 2Q3RA 3W1MA 2H8XA 3WK3A 1D3HA 1KTCA 4IGHA 2R94A 5G2WA 3BG3A 2GJNA 1FCQA 1QWGA 3UWWA 2QCEA 3TCEA 3WJYA 4RKAA 2HS6A 2C13A 1XBZA 5F2LA 3L65A 4JGDA 1DKWA 4X2RA 3HGOA 1EX5A 3B0PA 4DBDA 2EAWA 2VENA 3MW7A 1EA0A 3LCXA 4TMCA 3AJXA 2C15A 4UTMA 2OCZA 3B03A 5TQLA 5HUOA 1SZGA 3EX3A 3NM3A 4JS3A 5C6MA 3AO0A 3LI1A 4UMCA 4UXDA 4A2RA 2PC4A 2X1RA 1SUXA 4XBKA 1RV8A 4CNNA 1RQHA 3F4NA 4CCDA 3L9CA 4E38A 3TAKA 1I2PA 2X1TA 4H4IA 4NXKA 1TV8A 3LHVA 2YR1A 1L9WA 3BLFA 6TIMA 1F74A 4NZJA 4JTJA 1GVRA 3O07A 3P7YA 3TE9A 1IXNA 2QR6A 4PL1A 4PTNA 1YXCA 3FYOA 1TTIA 4BR1A 1N7KA 2QCDA 2EPHA 1U5JA 2NWSA 3LLFA 5HR7A 1H7NA 5AHIA 5BMXA 1FDZA 3S1XA 4JTTA 3JRKA 4QAIA 4ORMA 2OT0A 5J5DA 4R34A 2P0OA 2ALDA 3QMRA 2QF7A 4LTSA 2GOUA 3M1ZA 5FEPA 3V75A 2ZZ3A 5TIMA 2X30A 1N55A 4ZL1A 3DAQA 1EEPA 1ALDA 3EXTA 4TX9A 4LS1A 2YPIA 2PE4A 4UFHA 3MHUA 1MEIA 4O1DA 1IXQA 1SR9A 4LS0A 3G22A 4TIMA 4JTUA 3NQGA 2RFGA 5CZJA 1WV2A 3M5ZA 5F2GA 3PAJA 3GB6A 4FB7A 5E93A 3P67A 1KM6A 1XXXA 2C16A 3PVFA 1GG1A 4ZQNA 3FKKA 3QPYA 2HMCA 4UIOA 1W56A 2OZ0A 3INPA 3JS3A 3PG9A 3TC7A 5LHFA 1IF2A 2ISSA 2P10A 3S6DA 4K6AA 5D38A 1YDVA 3TJLA 1JJKA 4LT9A 2G5WA 1SFJA 1H5YA 1I4NA 3BW2A 1JUBA 5SWUA 4GRSA 1DORA 3W1LA 3PBUA 3W7HA 1JVNA 1A5SA 1GYNA 4LVAA 5CG7A 1FCUA 4P61A 3NL2A 2ZA1A 1TPDA 1N8FA 1R2RA 1F6KA 1RD5A 3ZFHA 1ICSA 4WJEA 4JICA 3LCHA 5HQEA 1KM1A 4M7TA 2VXNA 1UB3A 1T99A 2ZZ5A 5HWMA 2WOQA 5G1YA 3I7SA 5HR6A 4M5PA 4CCCA 1P0NA 3UXDA 1MXSA 3PBVA 5FEXA 3BO9A 3E0IA 3EWUA 3CWOX 4NQ1A 3W1NA 4QJ1A 1KBJA 2A7NA 2E09A 4UUIA 5TBOA 5GVJA 4MJZA 1W31A 1I2OA 2QCDB 4JNMA 3B06A 2DZWA 3S5OA 1DHPA 2CLKA 2V30A 3NGJA 2LLEA 3ANYA 6ALDA 3PB0A 1H7PA 1JCJA 3R5EA 1TPFA 4FNUA 2W0UA 1PHWA 5LGZA 2Y7GA 1P4CA 1FCBA 4JTIA 4MLRA 3I7RA 3PC0A 5U7SA 1OFEA 4NXSA 4IOTA 1KA9F 3BARA 3VKJA 4ORIA 4AWUA 2H8ZA 3GAKA 1G4EA 1DQWA 2O7SA 4WXYA 3PR2A 5CGQA 4JDYA 1SQ7A 1LOLA 2BWGA 3HJZA 1RQBA 4A3UA 5K3VA 5LHEA 4PH6A 4HSNA 1XDMA 3NPWA 1BWKA 4CNPA 2WSRA 1T8XA 3NQCA 1SW7A 2OX1A 3UWUA 2QUUA 3W7MA 2TRSA 1HG3A 3S9YA 3S1VA 1I45A 2TPSA 3QJAA 3EB2A 1ZNNA 3S5ZA 1G4PA 3TXZA 4IWWA 1AG1O 1A50A 3NQVA 2QJIA 4IMCA 3M16A 2CFFA 5DLCA 3BGGA 4WOQA 3LV5A 3C2RA 3NOEA 3RLUA 4MZ1A 2PRMA 3P84A 1I2RA 4UTTC 3W7DA 3IVSA 3G3MA 4ADUA 1Q3NA 3HG2A 1S5TA 4RZ4A 5LZLA 3LHWA 4LNYA 4A2SA 2WO5A 5DBTA 1ZAIA 5MHBA 3PSWA 3G1FA 1QO2A 1NVMA 3IVTA 5EA9A 5A8GA 2QCNA 1H61A 3G8EA 5HWNA 3I7QA 3NZRA 1ONRA 3NR0A 4WQ6A 4O1BA 2YW3A 2I1OA 4FIRA 4PA8A 4TMBA 2ZBTA 4O15A 3UPBA 2A6LA 3IIOA 4N4PA 2AGKA 2ZCGA 4RCXA 1D3GA 2QEZA 3B0UX 3HF3A 2R91A 3WJSA 4ADSA 1HFBA 2DZPA 3FKRA 1SO6A 1P0KA 4LVDA 4O1CA 1E51A 5LNSA 2ABBA 5C5YA 2A5HA 4NNAA 1TPWA 2CLFA 4MY9A 1KM5A 3M5XA 5I3JA 5CZTA 3KRUA 4UNKA 2J88A 3TU9A 1TMHA 1FY6A 3FJ6A 3TQVA 3E49A 3HB9A 3DKLA 5E1QA 4MZ8A 1SSDA 1FWWA 4GWEA 4LV4A 3BV4A 3FEMA 1OF6A 4XTDA 5L9FA 5I3HA 2ZTKA 3W7CA 2JGYA 4FEZA 5F1VA 2C6QA 5BOOA 3L5AA 3L0GA 1LLZA 1WBJA 4GUJA 1QOQA 2FFCA 4NJKA 3MHGA 5EY5A 1H1ZA 4JXCA 1OFAA 2QCFA 2PURA 2WNQA 4JR5A 1XFBA 4M7SA 1YTKA 1K8ZA 3MI2A 4WXZA 3UYCA 1LYXA 1VCVA 1W1ZA 4Q4KA 4M6PA 4UTLA 1FCVA 1AW2A 5CPOA 4KFOA 4MUZA 2NXIA 1K8XA 1P5BA 3C2FA 1ZY9A 2V8ZA 1UUMA 4O52A 3V1PA 1VYRA 1XUUA 4H3DA 3KVMA 4LC8A 3PS7A 3TX9A 1QFEA 4QSHA 4ALDA 4O11A 1H1YA 1B57A 1WQ5A 2ZTJA 1A53A 3RF9A 2Y7FA 3DFTA 3OEXA 3GR8A 3MP3A 2V2CA 4IJBA 1LBFA 3KFTA 3W7JA 1OX6A 1WX0A 2OT1A 4UCGA 4FNRA 3HIJA 3SFKA 2WV8A 4NNBA 2V5BA 4NJJA 3KHJA 3N9SA 1OG0A 2H6RA 2QJHA 1TJPA 3A23A 3CIXA 1JULA 1K7XA 3KVJA 1VC4A 4AHPA 1K03A 3EWXA 2Y88A 4OU1A 2B7QA 4D2JA 3P62A 3VE7A 2A1YA 1OJXA 4AHOA 4BI6A 1G6CA 1MZHA 2W79A 3P60A 4HPXA 2J9ZA 5I3GA 1WXJA 2Q3OA 5AHMA 3PBYA 5DXYA 4ZQPA 3GDLA 1DJQA 3W1XA 3MP5A 5CPLA 3ATYA 3Q2DA 1LOQA 1G67A 2WSQA 4QQ3A 3EX4A 1F5ZA 3G24A 3NXFA 1VQTA 3IV3A 3P5YA 2Z0IA 3BLIA 4FF7A 3W71A 3GDRA 3LTSA 3LB0A 3GXTA 3IRDA 2B7PA 1O5KA 3QQ1A 3M43A 4NJHA 4FX8A 2F7FA 3GZ3A 3LGEA 3DFSA 3UD6A 2NX9A 1X1OA 4CQ9A 1CW2A 2FB2A 4KKXA 3EXSA 3FFSA 2G96A 3CU2A 3M41A 2PRHA 1HL2A 1L6YA 1OVDA 2A6NA 4NUWA 1F2JA 2CZ5A 4HHPA 3TFCA 4UMBA 1XL9A 3C0JA 2V82A 1NFBA 4DQWA 4A22A 3TFXA 3T7VA 3M9YA 1PCWA 3C8FA 3CIWA 3ABRA 3LX9A 5D04C 4Z1CA 3GNDA 3OBKA 1GQNA 4U28A 4JX4A 2FPTA 1BKSA 2YYUA 1LORA 3BW3A 1ZHAA 2Y62A 4CCEA 4FX6M 5G5IA 1W5MA 2V9DA 4WOZA 3QRHA 1LRTA 5K7JA 5AB3A 1NF0A 1M5WA 3W74A 4JN6A 3O16A 2ZRYA 3HGSA 3C61A 2FB3A 1LRNA 2ZZ7A 3TW6A 4O10A 2E77A 3JR2A 1ZAJA 3LXAA 3NNTA 1YADA 5D37A 2AQWA 2YDAA 1YTEA 2VFDA 1T0OA 3W2LA 1J4EA 1GJPA 3RU6A 4NVTA 3I65A 2O7QA 3NQMA 4LRTA 3UXAA 2GVLA 4NJIA 1RQEA 1YPIA 1TB3A 1SW0A 2YW4A 5EMUA 1JCLA 3W83A 3TQ0A 1RVGA 3EWBX 3OA3A 3LRKA 4FHAA 1OX4A 1ML1A 3CQ0A 3NG3A 5AYZA 4UFIA 4OV4A 3MO7A 3QPZA 3W70A 4PL2A 3M5VA 4B5NA 4DF2A 4UTUA 1GEQA 4N6EA 3ZR4A 3MUXA 5KSWA 5C54A 1TPB1 4PCFA 3W1UA 4OQVA 1K8YA 1GVSA 3D0CA 5DN1A 3G1YA 4MIMA 4JYDA 1O5XA 3TMLA 1LZOA 2QAPA 3W7PA 4E2BA 4MLJA 1B4EA 1UUOA 2X2GA 3TROA 1GYLA 2ZZ6A 5AC6A 3TC6A 1GTHA 4O18A 2NUXA 4S2CA 2A2IA 4O13A 1DV7A 3L5MA 5DBUA 4TR9A 4U4MA 1YPFA 3QSRA 4LVFA 4BWLA 4ML9A 4R7JA 3PF3A 1VCFA 2QUTA 3GR7A 4O0KA 4JDBA 3STCA 4AVFA 5F4SA 3GDMA 2NX1A 1W5OA 3BGJA 2RDUA 2Z2UA 3IGXA 3U2OA 4JTSA 1OFRA 3LOTA 3UWYA 1M7OA 4DO6A 5G2IA 2YSWA 3OHIA 2I9EA 3W7OA 5C2XA 5BMWA 3DFQA 2DZVA 5IBXC 3O63A 1UJPA 1OX5A 4UMAA 2B7OA 1GT8A 1ICQA 4OBTA 1OK6A 1Z44A 2ZZ4A 2ZQ0A 3RFAA 3S8HA 3B05A 3G8RA 3CPRA 4A29A 1DBTA 2P1FA 3IEBA 5AN7A 3TW7A 3P81A 5AC7A 1OFQA 5G1TA 4WY0F 3UPWA 1Q6LA 2Y6ZA 2BX7A 3EWZA 5BNKA 2QCCA 4FNSA 2FLIA 2CLHA 4BFAA 3NDOA 3C4UA 1OX4B 3TSBA 3W2NA 5K9CA 4DBEA 4NNCA 4NZFA 1XUZA 4QIUA 4O53A 4I7UA 3NVTA 3T44A 1H51A 4LY8A 2RKXA 2CLIA 1F73A 4Z0JA 3DFNA 3WK1A 2FPYA 3QW3A 4YL2A 1JQXA 1EP3A 1KM3A 1KV5A 2V5LA 4K37A 2BLEA 4XQ6A 3LXBA 4OV9A 3W7EA 1KLZA 1XBYA 5F2IA 1XKYA 2C1HA 4AHQA 4UTJA 4YMZA 2CZEA 3W2KA 3DXIA 3IIZA 1S5WA 4ZQMA 4MOZA 1TPEA 1ZAHA 3QEZA 3UWQA 1PCKA 3MJYA 4IPJA 3EWYA 1WOBA 3P82A 4LV9A 1EUNA 4HT3A 1JCMP 4IMGA 1PIIA 3LHZA 1LBMA 5EL1A 1GVOA 2CW6A 4MZYA 3DH7A 4EF9A 3VI2A 3E02A 2J6XA 1VS1A 2B7NA 1G4TA 3P74A 4RZ5A 2A7RA 3N14A 1WDWA 4LC6A 3CT7A 1YXDA 1SFLA 1VYSX 4C1LA 4JTKA 4XKYB 3UY8A 3LCWA 1W5NA 1GTEA 3CEPA 4A21A 3PSVA 3L5LA 4O0ZA 3W07A 3C2EA 3GKAA 3ZWSA 3DFOA 3NQFA 4RX0A 2VEPA 3N2XA 1W5QA 3C52A 3W87A 4N2YA 4IMDA 2VFGA 4AWTA 4NU7A 2XN2A 4FNQA 4GE8A 2JKEA 2EKCA 3ZWTA 1K7EA 1AW1A 4O12A 2NX3A 4R33A 5J5RA 4Q32A 1U83A 4DF0A 3K30A 4K38A 4Z1DA 1RZMA 5CPMA 2VEIA 4RR4A 4O57A 4GC4A 2J9YA 1YXYA 2NLIA 3WK2A 3G0UA 5BRBA 3LI0A 2QJGA 2E68A 1GVQA 2Z6JA 4UR8A 4MKNA 3SZ8A 1R2TA 3S1UA 2F84A 3HGRA 5AHNA 4HSOA 1TYGA 1I8JA 3HMJG 3SI9A 1MO0A 1H7RA 5FESA 1OYBA 4UFLA 3ATZA 2ZRVA 4QITA 1YDNA 5EPDA 1JUEA 4NX5A 1UCWA 1O95A 2H3BA 4JTGA 4I7WA 3VFLA 1VRDA 2E6AA 1H62A 2YCEA 2Q8LA 1QPOA 4DXVA 5LNRA 4YCPA 1CI1A 3GIYA 4WZHA 3L67A 1ZALA 1QDSA 4WUIA 2ATMA 3EKLA 1JCXA 4Z0SA 1A5AA 2JBMA 1JQVA 4YWIA 3DI1A 3HQ1A 3IIVA 4FNPA 4MFEA 5K4ZA 4LUJA 3QH2A 3DI0A 4UFJA 3PUDA 4TO8A 1Q6QA 4POCA 5G4EA 1LOSA 3UZ5A 1DL3A 1JRCA 1KTNA 3G0XA 2Q8ZA 5D2VA 2ZA2A 5CPNA 2JKAA 3GXNA 5FF3A 3TIMA 2IQTA 2CU0A 3TUUA 3OVPA 3IIPA 4EIVA 5DXXA 2VFFA 1YLVA 1SPQA 1H63A 3IVUA 4WY0A 2WSYA 1KFLA 5EKYA 3MI6A 3CWNA 3GLCA 5IBXA 1G4SA 1UBSA 5AYYA 5K9DA 3E9AA 3GDKA 3QF0A 4OE7A 4X22A 4DPPA 2Y70A 1LTDA 1TJRA 4XBSA 1RR2A 3B04A 3RLVA 3HOJA 3QM3A 4MJMA 4O4WA 5CSRA 1KFBA 1GOXA 2DU2A 3Q94A 1TO3A 2E5BA 4HNNA 3TH6A 4BF9A 1OABA 3HPZA 1FQ0A 4ICNA 1H7OA 3KOFA 1CX9A 3NL3A 3PBWA 3OIXA 3W7KA 3BW4A 5E0KA 3W76A 4PEKA 4LVBA 2FDSA 3N3MA 3L2IA 5KZDA 7TIMA 1MEHA 3DU0A 3BG5A 2QCHA 1OK4A 1O4UA 2DZXA 3TSDA 3PULA 5EBUA 1ZCOA 3M7WA 3DFPA 2YX0A 2GQ9A 4EWND 1FWSA 5IM51 4JY8A 4QNWA 3MWAA 3LCLA 3P80A 4AF0A 1JCYA 1QPRA 3O15A 4NJGA 5DELA 1VHNA 4FXRA 1X6UA 4DEFA 2V81A 4UTWC 3LDVA 5D02A 1W54A 3M5YA 3B4UA 2DZTA 3M47A 1ME8A 3W7RA 3LTYA 2E5CA 3QZEA 4O28A 4XZ9A 2WNNA 4X9SA 1SU5A 2QCLA 4JX6A 4HNVA 1ZFJA 3L68A 3NEVA 5FF0A 4I7VA 3QW4B 3LERA 3EX2A 4JTEA 4LRSA 5FI8A 3N73A 3QMTA 4XWUA 4WY0B 1UASA 1TPUA 3W2UA 2VEKA 1VH7A 3ABQA 3W7QA 4ZQRA 3L0KA 1QNVA 1R2SA 3THQA 1BEUA 3F1QA 4N4QA 4UNLA 5F1UA 4M6VA 1TRIA 3UQNA 4MVAA 1TTQA 4C1KA 5DY2A 3W7IA 1W37A 3O1NA 4GNJA 2H3DA 4OHQA 4K7YA 2JK2A 2ISWA 3IIXA 2C3ZA 1YYAA 4N9EA 3W1PA 3CLMA 3E96A 4KWWA 2FTPA 3A5FA 4FIQA 1AL7A 2VEMA 3BG9A 3B0VC 4HNUA 3EKZA 3W9ZA 4NT0A 4J9JA 1QMLA 1WA3A 3SR7A 5G4WA 1TSIA 3F03K 1W3IA 3A24A 3W22A 3O06A 4OT7A 3G1VA 1Z41A 3QYQA 3GKFA 2HS8A 1VZWA 1SZEA 1XI3A 1KM0A 3EX6A 4AF0B 4UTTA 4HIBA 2QCGA 2NXHA 3MMTA 3M0ZA 3DKJA 5AHLA 2A0NA 1QAPA 1AL8A 2CLEA 2FIQA 1IIHA 3C56A 4Q33A 5CKSA 1XM3A 5HJLA 1WOAA 5D05A 3H53A 4IX2A 5I3KA 5DCEA 1OHLA 4QISA 3F4WA 4H6KA 3SECA 3NPXA 3W7GA 1KFEA 1G7VA 1NSJA 1P1XA 2YZRA 1VR6A 1GZGA 3A5VA 3LV6A 3NM1A 3W1AA 3FIGA 8TIMA 2NUWA 4LVGA 4YLWA 2OMAA 2ZRZA 1HO1A 3E12A 1EIXA 4Y6GA 1PL9A 3P5ZA 1WBHA 2V2DA 4JTHA 3QMSA 1B9BA 3SY5A 4ADTA 3ABOA 1OFDA 4OGZA 3PWAA 2CLOA 2E6DA 4QM1A 3UZJA 4I9AA 5KZEA 2XN0A 3ABSA 3TAOA 5HULA 4AXKA 5KITA 4XUGA 4Z08A 3FOKA 3R8RA 5CSSA 5D2XA 1C9DA 2Y85A 3W6YA 4IUOA 3I68A 3W85A 1LM1A 1ZENA 3LBMA 1NAL1 1W3NA 1QR7A 1O60A 3GYEA 4Y8FA 2NZLA 1R30A 3KVKA 3C6CA 5FF2A 5F4WA 5LNWA 3W2MA 1FBAA 1TPVA 3W7LA 2DP3A 1XBXA 2BXVA 3EWWA 2A4AA 2A85A 3C3NA 1C8VA 2DJXA 4DELA 4Y96A 4DO4A 5FEZA 2NV2A 1L6SA 4FNTA 5G2HA 3TMQA 3OG3A 3W2JA 2X1SA 3SW6A 4JX5A 5LGXA 2FJKA 2YFNA 1FWNA 3LXCA 4N6FA 4AH7A 3L0NA 1TV7A 2ZRUA 1EPXA 3IGUA 3C2OA 1F6PA 1W0MA 2G97A 2UV8G 3PUOA 1XCFA 5HINA 5FF4A 4M19A 2HSAA 4PFMA 4K39A 3DGRA 3DZ1A 3IGSA 3THAA 3LRLA 3FA5A 3HPXA 4N02A 4UTWA 4E0CA 4YCOA 2E6YA 3W7NA 4Y90A 4O54A 2VOMA 3BPWA 2TYSA 4XKYA 4N9DA 3HGJA 4GFSA 3CB8A 2NXGA 2CWNA 4JY9A 2V2HA 4CNOA 5AHEA 3HO8A 1QPNA 1DJNA 1IIGA 1OFBA 1XC4A 4RV8A 3A22A 3NQ6A 2ZZ1A 1M7PA 3CTLA 1X7FA 3HG5A 3LHTA 1FDJA 2QDHA 2DJLA 3G1XA 3KRZA 4LWWA 3T55A 2J27A 4EF8A 5ABTA 2A7PA 4O1AA 5HMSA 2YGYA 3NQEA 3FJLA 2JGQA 3NZ1A 4ZZ9A 3LM7A 1VJIA 2Y63A 3NQ8A 3HBLA 3A9IA 3PB2A 3EX1A 4GBUA 4GUIA 3H55A 1EP2A 3P61A 3PM6A 4PC8A 1PS9A 2DORA 3N9RA 2EGZA 4IXXA 4O17A 4K8EA 4LUIA 2I14A 4LU0A 3OVRA 2HTMA 4CQAA 4UTKA 2ZRWA 3NQ2A 2E1DA 2YXGA 4XTIA 4EOUA 5HNRA 4JIPA 3HG4A 3G1HA 4MYXA 1SZFA 2CLMA 2Y7DA 3CEUA 1GWJA 1SZNA 3KX6A 1FWRA 5K4XA 5DCDA 2GVJA 2YFOA 5K9XA 5H2ZA 3LCGA 2D73A 3NPUA 1TIMA 5L6UA 3W73A 4IPIA 1MEWA 1NF7A 2R14A 3HPSA 1ICPA 5LKYA 2GQ8A 3B8DA 1XDLA 4BK9A 3N2MA 1J5TA 1FUYA 1J2WA 5BW6A 5D2TA 2QAFA 5KZMA 1A5BA 3TR2A 1TQXA 4JIQA 5HWJA 3ELFA 3YPIA 1SW3A 3P8IA 3A21A 4LS2A 3T78A 3R13A 1V7YA 4QNEA 4KFPA 1KM4A 2WQPA 1JRBA 1AMKA 1KFCA 3G1DA 1TTPA 2OJPA 2Z6IA 4L4MA 1K7FA 3NL6A 1OFPA 1D9EA 1W3TA 2DZUA 4RJEA 3W1QA 2EF9A 5D03A 1K3UA 2VFEA 3Q58A 1LDCA 3WFAA 1VGAA 3SGZA 2H90A 2ZRXA 2JKPA 3G1SA 4JTFA 1PHQA 4W9TA 3TNOA 4WX2A 1ZJIA 4O8RA 1BWLA 2NWRA 4DF1A 1F7BA 2DZSA 4ZMGA 4IMEA 4UR7A 4UFMA 2Y89A 1LCOA 3TQKA 1BTMA 2CZDA 1JCNA 4MFDA
chains in the Genus database with same CATH superfamily
1RPXA 4HNCA 2RHGA 3CYVA 4Q7NA 1LUCB 3O6CA 4LOCA 4YIWA 5I24A 5ECVA 1TTJA 1VHCA 1XIIA 3E2QA 5CZ0A 1KBIA 3HG3A 4Q4PA 4LBSA 3TP4A 2EHHA 4NASA 1F3TA 4GYKA 3WLSA 2OU4A 2QT3A 1E73M 4HU0A 1I2QA 2Q09A 3WJZA 1YHTA 2J47A 2VUYA 2ABAA 4JFUA 4PULA 3H2AA 3USBA 4BEUA 5AFDA 1JR1A 1C92A 2WMHA 4GQRA 2XVKA 1PV8A 3OHMB 3OO2A 1NWUA 4N9BA 3VCRA 2X8RA 3BVJA 2E5DA 3C0QA 4FF5A 4B92A 1EB3A 3MBDA 3R2GA 3VU2A 4DJDC 4L4OA 5AHFA 4YXGA 3GNNA 3VD5A 1QOXA 1LLWA 2Z25A 3A64A 1AZ1A 1QK0A 2AMGA 2WHKA 3NPVA 2F2KA 1FWTA 1AK5A 1SFSA 5U4NA 3L2LA 2R1MA 1RH9A 1V02A 1VB9A 2XN1A 3WH9A 2DFAA 3H4XA 3MVIA 4RW3A 3TXVA 1F05A 3BLOA 1Q63A 3W27A 1SO4A 4HZ8A 3UF9A 5FEWA 4HKPA 2DVTA 3M0LA 4S2BA 5IDZA 4YTSA 2VEFA 3QHOA 1K6WA 3HMCA 2QGHA 1SO3A 1HT6A 3T0CA 3R6IA 5HMDA 4TTUA 1SJBA 1FWEC 1CGTA 1OB0A 3WMSA 3AS0A 1I6NA 3MHFA 3T6CA 1MSSA 2DZBA 3S2LA 3N34A 2BGSA 2X41A 3C0SA 4PUJA 1UWTA 1K70A 2GGEA 2QUVA 4LUTA 1GVEA 4BI7A 2FPVA 4Y9MA 1VBUA 1O5RA 3QC0A 3AHYA 1W9DM 2XGIA 3KOWA 1TR9A 2WW5A 2E4TA 4AIUA 1P48A 3M44A 7A3HA 4OBSA 1ISWA 3TC3A 1YW1A 2ANUA 3GFXA 2J78A 4LY4A 1CLVA 2DIJA 2BASA 1Q8JA 4E8GA 3KLKA 5E6ZA 3QQ0A 4X9YA 3R12A 1A4LA 5LIYX 4TVDA 1KBLA 4Y8EA 3EOLA 3S5YA 4Y9AA 3JZUA 3T4CA 4JYFA 4X2PA 3L66A 3KWSA 4QJ3B 1SSGA 5C70A 2VELA 1A0EA 4BWLC 4YHEA 5AYXA 3LCIA 4R3UA 2HVNA 4LAKA 2ZA3A 4OBRA 4HMEA 3WNOA 3HM7A 5D33A 4AQLA 4G1KA 4DYKA 4AB4A 2Z24A 5CJMA 3QV8A 3FS2A 2C19A 3O6DA 3GW3A 1R86A 1JZ8A 4XVDA 4JN7A 3FYPA 1GPWA 1JPDX 3GIQA 1KLYA 1L2QA 2FHFA 5D32A 1EO7A 2ZFAA 2GLKA 5KMYA 1RAKA 1KKRA 4X0VA 1XBVA 2ZIDA 1FXPA 3UZWA 4L6HA 1IXOA 5T8GA 3UY7A 2I5QA 1KFWA 3PG8A 4FMVA 2EPOA 1UA3A 4D8LA 3MYOA 2VGBA 1XCWA 1AD1A 4ONVA 3I6RA 3AQUA 1G69A 3UG5A 2HISA 4S1FA 3M0MA 2DT1A 3OYXA 3IJ6A 2CLLA 5HNTA 4XAGA 1YDOA 2XH7A 2O55A 2BSLA 2E8YA 4JQ2A 3TYEA 1TCDA 1IYXA 3HTWA 3UNDA 1Z48A 4G7EA 5E70A 1XS2A 1UR0A 1KV8A 1RA0A 1PWMA 3VOIA 2WJZA 2PDJA 4PRRA 5A6SA 2VR4A 4I9TA 2Z1WA 1IV8A 4XSMA 2CKRA 3V0TA 3W25A 2G8ZA 2NV9A 4TX8A 5F2MA 3U6WA 1DP0A 2QYGA 1Q6EA 1F3XA 2HE8A 3S2NA 2Q71A 3QC3A 1TREA 3OZOA 3FK4A 2GWGA 5RUBA 2GJLA 4FX7A 2DH2A 5JBFA 2Y24A 2PUZA 1EP1A 4OIFA 1OADA 5D09A 4GXMA 3A6OA 3GK0A 2FZDA 1UC4A 3OGSA 4C7GA 1W1IE 3RR1A 4PODA 1U1UA 3L23A 3M0VA 4FO4A 3G2GA 3S1WA 3VKKA 1NFGA 3AU6A 3RNDA 4H8HA 3RM4A 2WZTA 4KETA 4D1IA 2Y7EA 3VGGA 4Z2JA 2QCMA 3VNZA 4HJFA 5KINA 1NDVA 1FX6A 2Q3RA 1E3XA 3FGCA 1UD8A 1KTCA 2R94A 3BG3A 2GJNA 4HJWA 3N12A 3GTIA 4GD0A 4RKAA 3FJNA 4TTGA 1US0A 1XYBA 1LQ2A 2P3ZA 3B0PA 5GPRA 1NJJA 2VENA 4UQDA 4MMWA 5ABFA 3S2CA 7CGTA 3D3FA 3VD9A 3O0KA 4UMCA 5A6BD 4A2RA 3H2CA 2BDQA 4IIBA 4BY3A 4ZGYA 1XINA 3QPEA 1XLFA 4Q3MA 4S3FA 4HMCA 3SB0A 3LHVA 3QKEA 3T05A 5C8BB 2YLAA 4JTJA 1VFSA 4QLKA 2GDQA 4PL1A 1YXCA 3FYOA 2NVDA 4D6DA 4Q22A 1X98A 2QCDA 4PZVA 2E9BA 4WGHA 2AGTA 1MUCA 3BUVA 2W5FA 3UETA 5J8LA 1E6PA 5BMXA 1GHSA 2V3DA 1AH3A 1YBQB 2A3CA 2OT0A 4ORMA 5J5DA 3GIPA 3LUTA 2QF7A 4MTVA 3CNYA 4WF7A 1B2YA 4ZL1A 4TX9A 3BJFA 3ARTA 1JZ2A 5J04A 2NQ5A 1MEIA 3F2CA 3QGAC 3GYCA 4H8VA 1ZZMA 3RXZA 1WV2A 4YTUA 1ZJBA 4KESA 4QS5A 4C6PA 2CIPA 3JUGA 3QV7A 5A2CA 1EGZA 1U1JA 3RYSA 5A1AA 1EX1A 3ZVHB 4GY7A 3FA4A 4QROA 3FKKA 3QPYA 3ZIZA 1W56A 2V5CA 3TYBA 5LHFA 1IF2A 1PX4A 4K6AA 4MNMA 3FAWA 1XIJA 2PSNA 3TJLA 4LT9A 1KC7A 4DI8A 2IS7A 2HCVA 2E0PA 1VFLA 4GRSA 4KCVA 3BANA 3W7HA 4P61A 3NL2A 1UWRA 3C0LA 1TPDA 4RDVA 3LPOA 5HQEA 2DVXA 4J35A 5C0QA 2HBXA 4QDWA 2WOQA 4X0NA 1P0NA 1EJUC 3UXDA 3DFHA 3PBVA 3VMPA 3CWOX 5BOFA 4QJ1A 2WMFA 4UUIA 4R9OA 5TBOA 4GOAA 4MJZA 1FWAC 1DXEA 4MGGA 3WNNA 3AU2A 4Q8VA 3NGJA 3C8NA 3HPAA 3QTPA 5JIPA 3UZYA 2LLEA 3KBNA 1TELA 1DWHM 2OVLA 1R3TA 1B3VA 4ZE4A 3VGFA 2RGLA 3SGGA 2YL6A 2Y7GA 2X40A 4MLRA 4NXSA 2BODX 3WF2A 2BOFX 1QNSA 1UWAA 2WVTA 1BSIA 3AXXA 1EOKA 4JTAA 3PR2A 5CGQA 3GFYA 4JDYA 4PRWA 1LOLA 3CAVA 3HJZA 1UD3A 2HK1A 2R1PA 2X2YA 3SADA 1YIXA 3RITA 1FHUA 4E3TA 1XDMA 1BWKA 3WQWA 4XISA 3GC2A 2OX1A 3WUGA 5CBJA 2GK1B 2TRSA 3WD0A 1AVAA 4CQCA 1I45A 3QJAA 4FXFA 3S5ZA 3WBEA 4GHRA 1A50A 2WCSA 3IS4A 1F61A 3H2FA 5M3WA 3CZJA 4YVPA 3RDKA 4WOQA 3AIQA 3LV5A 3C2RA 3NOEA 3RLUA 5CG0A 2PRMA 2PGWA 1JD7A 4AWEA 5KEZA 3W7DA 4RW5A 1Q3NA 5LZLA 3LHWA 4A2SA 3HURA 3K13A 1ZAIA 4NAEA 3PSWA 3G1FA 3SJNA 1NVMA 7REQB 1ZLPA 5EA9A 5FJTA 4KERA 3MU7A 3TLQA 1VP5A 3I7QA 3NZRA 3UZXA 4I5UA 3WQVA 4TMBA 3LYEA 4O15A 4GVGA 3IIOA 2AGKA 2ZCGA 4RCXA 1K77A 4IIGA 3O6AA 2QEZA 1DWAM 3VNYA 4ADSA 4BQ4A 4EPBC 1NP2A 2DZPA 3B9DA 3WD2A 3TVAA 4XZLX 1TPWA 1F4HA 2G3IA 1FP9A 4R85A 3WL1A 3IV8A 1AA1B 3KRUA 3TU9A 3AWNA 3DUGA 3FJ6A 1W3LA 3VFCA 3VDGA 3UXKA 1MZRA 3FEMA 2OPJA 3WQ4A 4XTDA 4R5EA 1AJ2A 1E72M 4HQVA 3W7CA 1UR3M 3UNTA 1JD9A 2JGYA 4FEZA 4MB4A 1DXIA 1WBJA 3EMCA 3BLDA 4W5ZA 1HP4A 2FMNA 1D2KA 3MI2A 3UYCA 1ESWA 4Q4KA 1JYNA 2W67A 3HFYA 4P5UA 5CPOA 3LK6A 4UQAA 4MUZA 1Q2RA 1RA5A 1ZY9A 3TYCA 1VAHA 3N2BA 1VYRA 4W7UA 3KVMA 4HK6A 4A6GA 5PTDA 5A94A 1WQ5A 4YHGA 4MJ2A 2XIJA 3KFTA 4XZIA 2OT1A 1LWJA 4NJJA 4OOUA 4TX6A 2H6RA 1ZBWA 3OLIA 4IGNA 3KVJA 1VC4A 4D9PA 1NFPA 2I5GA 4V1YA 4UOJA 2J75A 3EWXA 5E5CA 3P62A 3VE7A 1G6CA 1RK5A 3BAKA 3P60A 1GHRA 4J4KA 2Q3OA 5I00A 3LZ5A 1RCQA 1NQKA 3GDLA 2H9AA 5CLWA 3SBFA 5CPLA 3L4ZA 4Q4MA 1R7AA 1G67A 3BMWA 2DSVA 5C71A 4XIAA 3G24A 3NXFA 4NYYA 3T07A 4GI4A 1EL3A 1B0IA 4GVIA 1D3CA 3FVMA 2BHUA 3ES8A 3LEPA 4C6MA 1Q7ZA 3T0BA 5LIKX 1QUMA 1FRBA 2RDXA 4GI9A 1XYAA 1XSIA 2PI6A 4B9ZA 3MDWA 4U2YA 2NX9A 2XVLA 1JYVA 2O92A 1CW2A 1EJRC 1J0YA 3PJUA 4C6EA 2PPGA 1PZ0A 3EB4A 3C3UA 2CZ5A 3TFCA 4UMBA 1UKSA 1XL9A 2GQ3A 3TFXA 1A0DA 3SFWA 2IQDA 1XC6A 1GQNA 1LORA 2OSYA 4FX6M 5A3HA 1W5MA 3RRXA 1HXJA 3CLWA 3KRBA 4QTGA 2ZUVA 4H7VA 1F3WA 1YNPA 3MSGA 4F0SA 3MZ2A 4YVXA 3VKDA 2Q02A 4R7OA 2DEPA 4EPEC 2DQWA 2VDGA 2VFDA 3RU6A 2O56A 2FVLA 3GU2A 4NVTA 5FL1A 5BRPA 3I65A 4JL1A 2O7QA 5CCZA 3UXAA 3T0TA 4NRSA 7XIMA 2GVLA 1OIMA 4RNFA 1B3ZA 3BH4A 4Q8OA 2YW4A 5EMUA 4O0QA 1JCLA 3CL8A 3W83A 1BWVA 1U5HA 4WR3A 3EWBX 1H5VA 1KCKA 1OX4A 1FKXA 4IM4A 4TQTA 3SY1A 3PZUA 4DX3A 4OV4A 4B5NA 4DF2A 4UTUA 1GEQA 4N6EA 3GXIA 3CUZA 3F2BA 5E9XA 3WMCA 3IUHA 5A6JA 3EEZA 1S39A 4DWSA 3REQB 1XLGA 4EKJA 2A3BA 4JYDA 3TMLA 1LZOA 3ALFA 5FL0A 3W7PA 4GQQA 1AFSA 1M03A 1B4EA 1W2VA 5FAGA 1GYLA 3SSZA 1ITCA 4O18A 3CHDA 3IK2A 4PMRA 3EA2A 3K2GA 2A2IA 4JFSA 3EDDA 4F2UA 2NSXA 3VNLA 5I0DA 4X61A 1P1MA 4QJ5B 3AMDA 4TR9A 1U2YA 1WZMA 1PSCA 2IUZA 3N9KA 1VCFA 4O0KA 3GR7A 1EXPA 1JFHA 4IIEA 4MADA 5GJMA 1E9IA 4W88A 3G6MA 4I90A 4L1GA 1ZSXA 2YLLA 3EDKA 3LOTA 4DXKA 3TYAA 3OHIA 4QFUA 4GNVA 5C2CA 4GCAA 1IHIA 3GXMA 3WUBA 5IBXC 1OX5A 3N3TA 1XLBA 2D22A 1OK6A 1Z44A 2VZVA 3GTHA 3S4TA 4PCSA 1PIGA 3CPRA 3LMZA 2P1FA 4M1BA 3NSMA 5AN7A 3CL7A 3ARRA 4HTBA 2Y6ZA 4L1XA 3C4UA 1QXLA 4PMOA 4ZB0A 1I0BA 4NZFA 4WDXA 1XUZA 3KM8A 4LYKA 4OTKA 2E25A 3SRHA 3VIGA 3NVTA 3H2NA 3H6OA 3ONBA 3DFNA 2ZUWA 3A12A 4YL2A 4DYEA 1M7JA 1KLZA 1XBYA 4KWSA 2FJUB 1XKYA 4AHQA 2CZEA 4JTCA 1M65A 2HV5A 1FWHC 3ZXWA 5GQBA 2AOSA 1QPKA 1WOBA 3P82A 4K1WA 1TMQA 4ZSUA 1PIIA 4NZ5A 5EL1A 2WBGA 2D0GA 3E02A 2HRWA 2J6XA 2BY0A 3KCLA 1K9FA 4KBXA 3UA3A 3N14A 3VD3A 3ID7A 2VMFA 4LC6A 1YRRA 1UPMB 3CT7A 1YXDA 4PUWA 4XKYB 4QAWA 3V35A 2ZDSA 1POKA 3PSVA 3L5LA 4XZWA 3N2XA 3C52A 4N2YA 3MCMA 4GIYA 4NU7A 5DMLA 3BTNA 4FNQA 2JKEA 2EKCA 3QLLA 4NL1A 3N2TA 5HBFA 2W91A 4DXXA 4DJEC 1OG6A 1RZMA 3UZZA 5CPMA 3SUSA 2VEIA 2O4QA 4GC4A 1Q6GA 5T91A 4DJDD 4ZOEA 4IFRA 3WK2A 5BRBA 3LI0A 2F38A 2QJGA 2YCKX 2MANA 4JNZA 5DEZA 4YTRA 3SCPA 3TWBA 4CGTA 3M7SA 3VOCA 1PEZA 1TYGA 1I8JA 5FESA 4XD5A 4AD3A 3CQIA 1MQRA 3MUIA 1HL8A 1JUEA 3GUWA 3LA4A 1E9LA 1Q6FA 1OGGA 3NQBA 1O95A 3JW7A 2BB0A 1V3JA 3VFLA 1VRDA 2E6AA 1V3MA 1QPOA 1DWGM 3MMDA 4ZXOA 1CI1A 3GIYA 1H3GA 3ZSSA 4KWOA 1A5AA 3TZFA 3IIVA 5K4ZA 3FVDA 4LUJA 3CXOA 1JI1A 2FVMA 1UZDA 4POCA 3UZ5A 4BHYA 1DL3A 3GG0A 1W1A1 1Z69A 2EPLX 4A8RA 5D2VA 1J8VA 2ZA2A 3BICA 2JKAA 5FF3A 4DZIA 3TUUA 1JFXA 4BQ5A 2NQJA 1JXJA 3IVUA 4CD5A 4WY0A 2WSYA 3H70A 5EKYA 4XV0A 3GLCA 1WO2A 1IQ8A 2EG7A 4B91A 1TVPA 2EBNA 1LTDA 2JFEX 4LAMA 5A6BA 2J74A 4XBSA 2FZNA 4M3PA 3B04A 4FSAA 1S2WA 3T81A 1KQYA 1E1CA 5CSRA 2DU2A 2GDUA 3IJ7A 2BGQA 1TO3A 4HNNA 4GXWA 3URBA 3TH6A 1GJUA 4BF9A 1HKMA 3UT0A 3UVIA 5XIMA 4PTDA 1CCWB 3AMCA 4KMQA 3BW4A 3CV2A 4L61A 4LVBA 1S38A 3N3MA 3L2IA 3DU0A 3VYLA 3BZGA 1OK4A 1E5NA 1O4UA 2PF0A 1XQKA 5EBUA 5JUVA 2W92A 3AYTA 3URAA 3DFPA 2YX0A 5JBDA 3MWAA 1KO0A 4HNLA 1Q7QA 4NJGA 3O15A 4BF7A 3WQ5A 3UFYA 2BV9A 5I02A 5D02A 3UVAA 1AUSL 2DZTA 4M8UA 5D8WA 3GVQA 3FYYA 2F2HA 4GNKB 1T40A 4O28A 4LBUA 2XM2A 5LA1A 3P2VA 4XZ9A 2WNNA 1NTHA 4HNVA 1ZFJA 2OOGA 3A9BA 3CAWA 3QW4B 1US2A 1A3XA 4LRSA 4JTEA 5FI8A 5TAOA 1WB0A 3N73A 1C91A 4MKSA 1XGEA 3P6LA 2NW0A 2FTYA 1J2BA 1CEOA 2VEKA 1VH7A 3PTKA 3VGHA 4ZQRA 1V03A 1QNVA 2D3NA 3F1QA 4XZHA 4UNLA 5F1UA 4E4UA 3KOXA 2YB4A 4M51A 2G50A 4M6VA 3UQNA 1TTQA 1XSJA 2C71A 1W37A 3O1NA 3V36A 3FSTA 2G3JA 4OHQA 4K7YA 2ZOXA 5DMMA 2HVMA 3N6JA 2Q6ZA 1B90A 3IIXA 3W1PA 4N9EA 1VFUA 4NG3A 4WVXA 2ZE0A 1R3QA 3FXYA 1Q8AA 2VEMA 1GOWA 2WQDA 3OZPA 1SR0A 3G6LA 4JQ4A 4J9JA 2FZ9A 3SR7A 3NVDA 5REQB 3H23A 3GSMA 1ZB5A 4XX6A 1EBHA 2JF7A 1Z41A 3QYQA 1VZWA 1KM0A 1R3WA 1JGMA 2PWEA 2PGFA 3N29A 5AHLA 3WUEA 1BRLA 1MUWA 5AZ1A 1F07A 2PTYA 3W00A 1CGYA 3SN4A 4MM1A 1W91A 4H1ZA 1ZGDA 2OEMA 4PGLA 3F4WA 3WKZA 2DQXA 4GG9A 1P1XA 1FWIC 1BXNA 3W1AA 1EGMA 4EAMA 3NZQA 4EANA 1X6LA 4LVGA 4E2OA 2ZRZA 1HO1A 3JU2A 3R8HA 3RU8X 1WBHA 4J3VA 3PZOA 3TTOA 4FA3A 1NY1A 3QMSA 1B9BA 1EYWA 3BJTA 3SY5A 4ADTA 4C6NA 3ABOA 1AZ2A 1OFDA 1ELSA 2GVYA 3LM3A 2XVPA 3KL3A 1CXLA 2CXEA 2XH4A 5HULA 1O1ZA 4AXKA 5KITA 5CSSA 1TR1A 4GIEA 3H2EA 3I68A 3W85A 3L4TA 4DI9A 3R43A 5G1MA 1C7SA 1UP2A 1K9DA 1XIBA 1O60A 4Z2GA 2NZLA 4JHZA 2C0HA 1OCBA 3U7VA 3BOLA 1XYLA 4XG1A 5ENLA 3RCMA 4DO4A 3RAOA 2NV2A 4G7FA 5G2HA 4MB3A 3UG4A 2X1SA 3SW6A 1JL8A 1A3HA 3TOPA 4F9DA 3BAWA 5LGXA 1B54A 3WF1A 4C6QA 1E6RA 2ZADA 1FWNA 2IXUA 4XO6A 3EDJA 1TWWA 2ZRUA 4D6HA 4I8DA 1Y65A 4M19A 4PFMA 1QHPA 2VR2A 3TW9A 4HHLA 4Y90A 1DE5A 5CH9A 8XIAA 3HGJA 5IHRA 2QPXA 2WJFA 2CWNA 2XU2A 4AYGA 1Z32X 3T8QA 2OLSA 1REQB 1VBHA 3E2SA 4LEFA 1FWCC 4AC1X 4JTQA 3A22A 2Y0FA 4GKTA 3N6QA 1M7PA 2QDHA 2DJLA 4MB1A 3ZT6A 4DUXA 3G1XA 1LLOA 3WNLA 3AYSA 5HMSA 4AIOA 3FJLA 3NQ8A 3ABZA 1C93A 4QEHA 1P7TB 3DYOA 3H55A 1LUCA 1EP2A 3VD7A 3PM6A 4RE2A 2OYLA 2EGZA 1SJDA 1GOMA 4W7WA 4IXXA 2A3LA 4LUIA 3OVRA 1XH0A 2ZRWA 4AD0A 4EOUA 2XSAA 4I3GA 4MYXA 4YU1A 1BAGA 3VC5A 1NQ6A 3WH5A 4HN8A 3XIMA 3EDFA 3VOFA 1M3UA 4J40A 3HPSA 3UCDA 3O7UA 1FUYA 3VZXA 5HWJA 3POCA 1JXKA 2BHYA 1HJWA 2WQPA 1M41A 2ZXBA 1OFPA 4ZOAA 3WQOA 4RJEA 1IT8A 5D03A 1I9CB 2HJPA 3CJPA 4WDUA 5GNZA 3ZJ6A 3WFAA 3SN1A 4GK8A 5DMNA 5D9OA 1KXVA 3G1SA 4W9TA 5IHSA 1XJBA 4EPDC 1UC5A 1E4NA 4HMDA 4YVVA 2ONEA 3COTA 1IWBA 4LANA 4GI8A 4D6EA 1CXEA 4BJHA 4JAWA 3ZVIA 4US5D 4AZGA 1W2PA 2W3ZA 3W01A 1UPPA 3IAPA 3SSJA 4CD8A 3HQPA 1C29A 1OD8A 2A3HA 3L21A 3QR1A 5A6LA 5G4HC 1LBLA 4C7DA 4GVHA 3MBFA 1X97A 4B5XA 1J12A 1SO5A 3NQ7A 3VXGA 1RHCA 4E2DA 1QOPA 3AMKA 1JDCA 4E4FA 3Q4DA 9RUBA 1F3EA 1S5VA 5FAJA 2NUYA 4HZMA 3GX9A 2VKZG 3SJ3A 3AC0A 2W4XA 4RXFA 1WDSA 1KRCC 3NURA 1EH9A 3LTPA 1EC9A 2FQIA 2VGGA 3OGVA 1OFOA 2I7GA 1OT2A 4LGXA 1V5XA 2VC6A 4S3GA 3UCQA 3TV8A 4MY1A 1ZBKA 2WWCA 1IGSA 1FWFC 3FHAA 4CKQA 3S42A 4DO5A 1N8WA 3BLLA 2PP0A 1UR4A 3TWAA 4EVZA 1WUFA 3NDYA 4PMYA 3CHEA 2QUMA 5A5WA 4O50A 3AS1A 2PDCA 5TD4A 5DCBA 1AQFA 1AQ0A 3KWXA 4NZCA 1G5AA 2HQAA 1R46A 2WC3A 2WPBA 1GG0A 1ISXA 3W88A 4HYWA 4Z1BA 1DHKA 2EJ1A 1VYPX 2XFWA 2BTMA 3TDFA 7ODCA 1WYIA 2BVTA 4CN6A 5H6HA 1UG6A 4FXSA 3DHUA 2DGAA 2QMJA 1D8CA 4KRTA 3BK0A 4B5SA 1ISYA 3VE9A 1QBAA 5H8MA 2OFJA 4MF4A 1J01A 1TMLA 2Y61A 3DHFA 3DYPA 1XRFA 1EDQA 1I0DA 1KFKA 3IJQA 1DIKA 5LSMA 2W6RA 1W9VA 1Y0EA 4FR1A 3NAVA 3F5JA 2R6OA 2WKJA 4AAJA 5LIXX 3TK7A 4DWSC 1E9ZB 2TSYA 2B4GA 4DBWA 2YZ5A 2PWUA 5DRCA 1JNEA 3WSUA 1G0CA 1J93A 2RH9A 2QV4A 3O2LA 3IK4A 4IMFA 2FHCA 1J0IA 2OGYA 3AROA 2G95A 1OBAA 6PTDA 3KVLA 2ADAA 2X1UA 2PRLA 4LF2A 5K2ZA 3CQJA 3GR4A 1OSEA 3AZSA 3NYZA 4JTLA 4TU1A 4QQUA 2PDFA 4G2DA 3B4YA 5LNVA 3WLKX 1YKWA 4W89A 3ANVA 4IXHA 1TUFA 5A6KA 4CVWA 1M6JA 1QHZA 1PTGA 1EUAA 2PDGA 2J13A 1AQHA 3GTXA 3STFA 3LENA 1NEYA 1GOQA 1WZKA 2BXZA 3CHVA 3GH5A 2X16A 1A5OC 4DO7A 4MDOA 3QFWA 2FTWA 3NQAA 2GWNA 2GJXA 2PP1A 3TA6A 3LG3A 1XCXA 4WSHA 2PDHA 1HIZA 1B30A 3MP4A 3PZIA 2WCAA 4GO8A 2KZHA 2X0HA 1WAUA 3NA8A 3NTYA 1Q6RA 8XIMA 4F48A 2AAMA 1QNPA 2DUXA 3B0XA 4JEQA 4Z1AA 4BEQA 1GOKA 4LCSA 4O16A 3R89A 2GFTA 2VCBA 2PLJA 3S9ZA 1EXBA 3ARSA 1EJWC 4J2MA 1T5AA 3B9OA 3GNRA 1QPQA 4GZIA 5EFFA 3WF0A 1FXQA 5HDRA 2EPNA 5I2UA 4A8LA 1E4LA 4E8DA 4S3CA 1FWJC 1D7FA 1LP6A 3AHZA 2DUZA 2JQXA 4ZQCA 1GZJA 1VFOA 4MWAE 1ECQA 4KS0A 2QZRA 3CAKA 3OZMA 4DLMA 4PSRA 3AUJA 2XYLA 3LPFA 2WNZA 4DJDA 3ZS4A 4CU6A 3H2MA 1J11A 1F4AA 2QDGA 4RXGA 4AD5A 1L6WA 2VWSA 1XLMA 1TCMA 2C8NA 1K02A 3H26A 3EGJA 3QSTA 4QSFA 2HBVA 4IX0A 2NVCA 2ZYFA 4MY8A 4HPJA 3G18A 3M6DA 3LLDA 4RV3A 2XIOA 1IGWA 4NSBA 4IFKB 1ODUA 1ADDA 3BL3A 1WZAA 1BQGA 2OB3A 4L64A 1JI2A 2VQUA 1DOSA 1HO4A 2WKLA 3GVVA 4GJ1A 1BXBA 3KS6A 3W1MA 3WK3A 2J25A 5AYBA 4JIRA 5G2WA 1HP5A 2QCEA 3TCEA 3ZVHA 3H22A 2C13A 1RK6A 2O9TA 1LWHA 1VFHA 3PWIA 5F2LA 3L65A 4JGDA 4PBFA 3HGOA 5JVLA 2OELA 2WVVB 3LCXA 3QZAA 4TMCA 3QKZA 5I7GA 2VCAA 4F0HA 3SUVA 2AAAA 2OCZA 3B03A 5HUOA 3G1RA 3N4AA 4C6IA 3NM3A 4JS3A 1L8NA 3AO0A 4WLCA 1XLKA 3M0XA 1EC8A 4OOZA 2W66A 4CCDA 4HZ6A 5EMKA 5AVNA 2Y8KA 1TV8A 2P76A 4LB4A 2ZKMX 4Q8NA 2GGHA 1OGBA 3GU1A 4QGCA 1W9UA 4NZJA 3P7YA 2OQYA 4DJFD 1S3TC 1EJVC 3ZO9A 4HPNA 3LLFA 3MUY1 5HR7A 1XLIA 2BY1A 3PPGA 3PWGA 4PMXA 1TWIA 3S1XA 3DECA 4JTTA 4DUWA 5EBAA 2ALDA 4A3HA 2GOUA 1V3KA 4LYPA 2J8FA 3N6HA 3DAQA 1EEPA 1ALDA 3EXTA 3RO8A 4LS1A 2YPIA 3N4EA 1R8LA 5HMFA 3MHUA 5HQMA 4ES4A 4JTUA 2PWVA 5D4YA 2ASHA 4P8XA 4RE3A 2Z1VA 1E6QM 2WHLA 1PAMA 4FB7A 4NI8A 1KM6A 1K9TA 3CUIA 3MV11 2D69A 3ECQA 4ZQNA 4YS1A 1UMYA 4WRHA 4F2TA 2ISSA 2GK1A 1XD0A 2BBFA 5D38A 1JJKA 4GZ7A 2QNEA 2G5WA 4XAFA 3EMQA 3LGDA 3NEHA 2YDSA 1DORA 3PBUA 3OBAA 1D8WA 4LVAA 1FCUA 4DWSB 4DJED 4ENLA 1AH0A 3MV01 4C6FA 4ECLA 1F6KA 2WKGA 3CTTA 4WJEA 2DT0A 2HROA 3FAXA 1KM1A 2VXNA 1JYXA 2ZZ5A 3H12A 4M5PA 7REQA 2X05A 1ZP3A 4IMAA 5AYIA 1XIEA 5BXTA 1O5QA 1W31A 4MB5A 1V0MA 4JNMA 3B06A 2DZWA 3E2RA 2CLKA 3ZJKA 3GFZA 3RILA 4K68A 4IPPA 3ANYA 3FXGA 1FH7A 4JFTA 5JQ9A 4IQDA 4AMCA 4CUCA 1UROA 1YMYA 3R11A 1E0UA 5D9PA 1IEXA 1UQZA 5LGZA 1P4CA 4D72A 3V5CA 3I7RA 4B5UA 1EJXC 1Z9AA 4A3QA 3PPCA 4H6QA 4IOTA 1JEZA 3VKBA 2FZ8A 3WENA 4ORIA 3E0WA 4AWUA 3GAKA 1G4EA 3MA8A 3DYMA 2OKTA 1DQWA 2O9OA 3AOFA 2Z27A 3APGA 2CERA 2YIHA 3OTRA 4JIHA 4PTWA 1UD4A 5A8NA 3DESA 3E74A 3S5SA 3DG7A 3IUIA 4CNPA 2WSRA 1T8XA 1E1FA 2PTDA 1BVWA 1PIFA 1UKTA 3S9YA 3S1VA 1NELA 3EMZA 4LBRA 4DBUA 4IIHA 1ZNNA 1G4PA 2FGZA 3TXZA 4QLLA 1AG1O 3BOXA 3NQVA 1AD4A 3DCPA 2PBGA 1V3IA 1Q7MA 1MVYA 3KTSA 3P84A 5FSEC 1I2RA 5I79A 3DC0A 1XYMA 3IVSA 3N4FA 3TCSA 4EK7A 2ACUA 1S5TA 4GBDA 2WO5A 4RNHA 3IVTA 2QCNA 3OPSA 3BSHA 2DVUA 1ONRA 3GO2A 1ENUA 2YW3A 4PA8A 3ZZ1A 1EKOA 3ZJ8A 2A6LA 4I9JA 3B0UX 2GZXA 4AISA 3WJSA 1QRQA 3IANA 1SO6A 1E51A 5LNSA 2PDMA 4DIAA 2A5HA 3SUWA 4NNAA 1JZ3A 1UWUA 5A8MA 1MFUA 3SURA 1N2VA 5I3JA 2F8QA 2J88A 1TMHA 1FY6A 3TJIA 3PN8A 1TJ1A 3I4EA 4MZ8A 4H2HA 5IXEA 1SSDA 4GWEA 3BV4A 1SJCA 3OU8A 3WLOA 4JTDA 2EEXA 5F1VA 5BOOA 5XINA 3MHGA 2QPUA 5EY5A 4JXCA 3GNPA 5D8ZA 3C86A 2VC9A 1XFBA 3GG8A 5A2BA 1K8ZA 4WXZA 1VCVA 2WAGA 4M6PA 2IPGA 3WQCA 1FCVA 1FFQA 1R7OA 1G01A 3C2FA 3EOEA 1UUMA 4O52A 1ZBCA 4H3DA 2REQA 3PS7A 1XISA 5DX7A 3TX9A 1QFEA 4QSHA 4ALDA 1H1YA 4JKLA 2HNHA 2ZTJA 2XPKA 4HPHA 1VKFA 5I77A 3DFTA 3OEXA 3AIVA 2NQHA 2V2CA 5HPCA 3AWOA 1GORA 2VO5A 4UCGA 3HIJA 4NNBA 4XAPA 3S2MA 5FSDC 2QJHA 4AX6A 4AD4A 2R1NA 1PB0A 3A23A 3MJMA 1V6TA 5CQ1A 2VZTA 3MVTA 1P6BA 1XWYA 4JFWA 2Y88A 2B7QA 4ERIA 3H7VA 4IISA 1HJQA 2A1YA 3WLQA 2V5JA 1MZHA 2D2JA 1QBBA 2YOCA 4HPXA 2E3ZA 2J9ZA 5I3GA 4XUYA 1E5JA 1WAWA 2GOKA 1V02E 1ZP4A 1P6WA 2AQOA 4NILA 6TAAA 1VEPA 1V7AA 4IG2B 1DJWA 1LOQA 4QQ3A 3MSDA 4QE1A 3EX4A 5JXQA 1FWBC 2PDYA 2Z0IA 4FF7A 2HPMA 1DIEA 3LB0A 2NQZA 3L4WA 1E1CB 2R9RA 3M43A 4FX8A 3GZ3A 1GGOA 4H41A 1ECEA 3POHA 2DSWA 3N11A 4NAFB 2W9MA 3EXSA 3FFSA 3REQA 3CU2A 3RPDA 4HVXA 2PRHA 3SQSA 4A8IA 3Q45A 3SQLA 4UWMA 4HTYA 1EQCA 1HF6A 3BMVA 3GH4A 2V82A 1H49A 2JE8A 1NFBA 4DQWA 2CHNA 4A22A 3FCPA 3MO4A 1CXIA 2CNCA 3CIWA 3GNDA 3QZ6A 3OBKA 5E09A 5IFPA 1S1RA 4JX4A 2FPTA 1OCNA 4CCEA 5LYRA 2V9DA 4US5A 1GONA 4JPGA 1LRTA 5K7JA 3BLKA 3W74A 2ZRYA 4M1RA 2VX6A 3W0KA 4FPSA 1ZS2A 4V28A 3P14A 4EXBA 1ZAJA 2CHOA 1YADA 1S2TA 5D37A 3M64A 4KH2A 1CLKA 3W2LA 1J4EA 3U48A 1NOFA 2J8GA 5DFAA 1BYCA 1SZRA 4UR9A 4NJIA 4LCQA 2J7EA 1YPIA 1TB3A 2UZ9A 2F9RA 2PB1A 5CAKA 3SCSA 3TQ0A 1RVGA 1XYCA 3LRKA 3W38A 3CUXA 1XX1A 5H8UA 1UW9A 4L1WA 4UFIA 1IE7C 4HMNA 3CO8A 4PL2A 3IWPA 2TAAA 1A4MA 3ZR4A 3MUXA 5KSWA 5C54A 1TPB1 4PCFA 2BY3A 1VBRA 1K8YA 2X0SA 7ENLA 1UBPC 3WIJA 5DN1A 4CD4A 3G1YA 3BWWA 4V15A 2QAPA 4MAVA 3S47A 4E2BA 1PZ1A 4RZBA 2X2GA 3QOMA 2ZZ6A 2ZC8A 2CXGA 5AC6A 1K1DA 1GTHA 5EMLA 3L2MA 4P7RA 1GQIA 2WZIA 3SCRA 4JCMA 5LIWX 3RG6A 4A3YA 1HJXA 5CC3A 2WZEA 1YPFA 5C9RA 1GVIA 2QUTA 5EFDA 3STCA 4DNMA 2I57A 4PUKA 4WSJA 3G5EA 2RDUA 1U30A 2Z2UA 2J7HA 1MWOA 1Z7AA 3Q67A 1EZ2A 4JTSA 1ODZA 1ZU8A 3UWYA 5G2IA 3KUMA 2PA6A 1E43A 3RIKA 1B1YA 1EF3A 2I9EA 3W7OA 1O6IA 3DFQA 1YX1A 2B7OA 2BGNE 3GW0A 1GT8A 1ICQA 3ARUA 4OBTA 1E0XA 1LT7A 2CBVA 4CN4A 4PN2A 3EA1A 4A29A 1DBTA 3IEBA 4JKMA 1ONEA 1ZPTA 2AL2B 3WBAA 1OFQA 3QYSA 3UPWA 3F5LA 2BX7A 4LSBA 2QCCA 2FLIA 2I56A 4B3KA 5BROA 3BCFA 1NARA 3URQA 4DBEA 1WZLA 4QIUA 4O53A 2BVWA 2Y2WA 4I7UA 1PZ3A 2NT1A 1EIBA 1H51A 1M7XA 3T2OA 5JIWA 3BAYA 3A3WA 1PYFA 3GVWA 4KT2A 2CLIA 1F73A 4W84A 3WK1A 3QW3A 1KCLA 4Y2WA 1JQXA 1XR2A 1EP3A 1KBBA 2QUNA 2V5LA 3WX7A 2QJNA 3LXBA 1E6SM 4PCPA 1UKPA 2YDQA 5DANA 1Q65A 3N25A 3TJ4A 4F2BA 1OD0A 3PFRA 3W2KA 3PBMA 2Z2BA 2YA2A 1PYMA 4ZQMA 1TPEA 1ZUAX 3QEZA 4Z1YA 3UWQA 4IPJA 5B80A 3ANUA 3CIVA 3EWYA 1KGWA 1HVQA 3CPUA 3RLHA 4IMGA 3VD4A 1LBMA 3BJSA 4HK5A 4DYJA 4MZYA 3DH7A 4EF9A 3VI2A 5CBIA 1XLJA 4HOXA 3ME3A 3CZGA 2VCCA 3OLEA 1TV3A 2UY5A 2DIKA 3AALA 1TKKA 1WDWA 3B8SA 4O1FA 4RDZA 2D3LA 2QW5A 3NGFA 3W07A 1E0WA 4WK9A 1O1HA 1AODA 2VD9A 3K4WA 1VJSA 3W87A 5HQLA 3R7MA 4JHMA 2XZ9A 4O12A 4Q32A 1U83A 3K30A 1IR1A 5I78A 4RR4A 2WC7A 3G0UA 3E2VA 1PKMA 3B8VA 3WF3A 1EGVA 1R2TA 4HCDA 4MHBA 2J8TA 2QMKA 1WDDA 3DOPA 1H7RA 3ES7A 1XH1A 4ASTA 1AMYA 1TE6A 4QITA 4QS6A 1YDNA 1DEDA 3CMFA 5BCAA 3I6TA 3H7RA 2H3BA 2OQHA 1GJWA 3PPFA 2W61A 3UJRA 4B5WA 4YCPA 4F0RA 4UQBA 4KIRA 3WLNA 1ZALA 4WUIA 4HCHA 3OBEA 4Z0SA 1US3A 4IGSA 4YWIA 2A3AA 3HQ1A 4HA1A 4MFEA 4GJJA 3QH2A 3RN6A 4DM1A 3NCOA 1YNYA 2BS9A 4H8NA 3V18A 2D24A 2ZX8A 5G4EA 1LOSA 3T1GA 1JRCA 1IZJA 5FJOA 4MG4A 3G0XA 1WPCA 6REQB 3ARYA 3KBVA 5CPNA 1DJHA 4GFIA 3GXNA 1TV2A 4JIEA 5B7YA 3TIMA 2IQTA 2CU0A 3OVPA 4DWSD 3GC4A 2VFFA 4Q4SA 2VWTA 3MI6A 3RCYA 5IBXA 3SQMA 1G4SA 1HGWA 3E9AA 4OE7A 2GSHA 4QHRA 3SCWA 1VPQA 3HOJA 3AZRA 3GE7A 1UD6A 1KFBA 2XIQA 2CCRA 4J3ZA 2E5BA 4GY1A 5FCZA 1XG3A 1L8PA 2Z2AA 4ICNA 1H7OA 3KOFA 1EHAA 3WN6A 2GGJA 3VOJA 4WDTA 4DJFA 1XP3A 5MKGB 3W7KA 3W76A 4D8ZA 3R4IA 2FDSA 5HXMA 1J18A 3GHRA 2FZMA 4GYPC 3RHGA 7TIMA 4C5ZA 2J7BA 3BG5A 2QCHA 5REQA 3TR9A 4W87A 1S46A 2PD9A 1CB2A 2V68A 4EWND 2E9LA 1FWSA 3D46A 5IM51 4QNWA 3QY7A 3VMNA 3A47A 3WDHA 2PMQA 4NKCA 3LCLA 2Z7GA 2X42A 3GH7A 3FJ4A 3R0KA 3W02A 4KRUA 4ZOBA 1OWQA 2BFGA 4UTWC 1Y8BA 4HK7A 4XD6A 3B4UA 5LA0A 4JTRA 4PB5A 3W7RA 3LTYA 3VIIA 1Q6DA 3QZEA 3H4WA 3SUTA 2DW7A 2XFFA 4JX6A 4HU4A 1A5UA 3DG3A 3L68A 1NOUA 4I7VA 5M1TA 1RLDA 2YL9A 1CPUA 4PUNA 3BAJA 2VNCA 1R6WA 4G1NA 1UASA 1TPUA 3W2UA 1J0JA 4RDYA 1XICA 1L0PA 3CASA 1PX3A 3ABQA 3KZSA 4DJEA 2PTWA 3E38A 1GOOA 3WLPA 1FHLA 3IPWA 1TRIA 1NM9A 3WD3A 3O9NA 2EQDA 5DY2A 2DZAA 1V08A 2H3DA 3FX4A 1Q2SA 1U33A 2HNEA 4R88A 4W8BA 1BPLB 4HB7A 1YYAA 3VX0A 4Q7IA 3CLMA 2DSZA 2QIWA 4KWWA 2BP1A 2BNJA 4KQNA 3UG8A 1AL7A 3BG9A 3B0VC 4HNUA 1VEOA 3W9ZA 3FN9A 1RBLA 1NWSA 4AZHA 1HGYA 1QMLA 3EPNA 1FVPA 1TSIA 2VM8A 2WHMA 4UTFA 1KRMA 3PHAA 2E7FA 3A24A 5A6MA 4ERGA 3O06A 4OT7A 3G1VA 4ZOCA 4A8NA 3GKFA 1Y7VA 4H01A 4FOKA 4D71A 3MMTA 2YA1A 4A05A 2ZUMA 3VDAA 1K6AA 2A0NA 3M0HA 2WJEA 4ATWA 3C2YA 1CBGA 5CKSA 3TLLA 3FDKA 3A13A 4AXNA 3WD4A 1BXCA 2Z4GA 1GVYA 1HL9A 1CECA 4QISA 3W7GA 3SECA 4H6EA 3MSYA 3SY8A 3QOKA 1G7VA 3U2EA 1GZGA 1REQA 4CQDA 3NM1A 1DJYA 1OCJA 2NUWA 4DZHA 3PTMA 1JPMA 2V6AA 2OMAA 3E12A 1V0KA 3P5ZA 2OTDA 1E3ZA 3HFTA 3I6EA 4B9YA 1V6UA 3UZJA 1YE6A 5KZEA 2CESA 4LAZA 3BMXA 4HA4A 2GUBA 4Z08A 3FOKA 1P7TA 2GJXB 3W28A 3P93A 1CENA 1C9DA 2Y85A 3W6YA 3GXDA 4IUOA 4Z2IA 1LM1A 2CWXA 3K4AA 1K4GA 3LBMA 4S23A 4ZTYA 4QE4A 2DIEA 1QR7A 2D2OA 3F5KA 3UG3A 3RGTA 1RJPA 5FF2A 5F4WA 5LNWA 1WKEA 1FBAA 1XBXA 1X96A 3EWWA 2V63A 3QTGA 4D6JA 1C8YA 2DJXA 1NIUA 4Y96A 1XIHA 4N0RA 2POZA 1L6SA 3W2JA 2QXWA 3SAZA 2OZ8A 3LXCA 3L0NA 4ICMA 3IGUA 4LEQA 4AZBA 2VGFA 2XUCA 2G97A 2UV8G 5HINA 5FF4A 2HSAA 4BQ3A 3DGRA 3IGSA 4CCZA 3HPXA 1CGVA 1CIUA 4EX4A 3ZR5A 2TYSA 1MQQA 2INZA 1JNDA 3UR5A 4LJ3A 4HHHA 3CB8A 3UR8A 4D6FA 4MJ4A 5D9NA 4CNOA 2V2HA 5AHEA 3WH8A 3HO8A 3UERA 4FLRA 1OFBA 2NLYA 2YKKA 4DY1A 1XC4A 4RV8A 3D3AA 2ZE3A 3V1HA 4F4RA 3MY9A 2ZZ1A 4B16A 2YBTA 3KTXA 1SGJA 1IWAA 3HG5A 3VGEA 3U4AA 1IEWA 3AIUA 3WCZA 3KRZA 4IJRA 3T55A 2J27A 4XVEA 4EF8A 5ABTA 4O1AA 3NQEA 2JGQA 3L4UA 1VJIA 3CMGA 3HBLA 3KCOA 4A3RA 3PB2A 2KX9A 3EX1A 1OY0A 2WM1A 1UQYA 1KRAC 4UBPC 1PS9A 3N9RA 3ITGA 3ZLGA 4BS0A 1NP0A 3PUGA 5CGMA 4OECA 7TAAA 5FJPA 1L6FA 2GJPA 3ITOA 1W3HA 4J3XA 4LU0A 1PTDA 2HTMA 3OA5A 3BGAA 3NQ2A 2E1DA 4XTIA 1KR0A 3TEVA 5HNRA 1DTNA 3G1HA 4IZGA 1LQ0A 3CEUA 2WMIB 1GWJA 3R25A 4NHVA 5K4XA 3QR0A 5K9XA 4HOZA 3OODA 3NPUA 3W26A 4IJCA 1W6TA 4ERAA 4LCRA 4XZBA 4IPIA 3LQLA 1UH4A 2G0WA 1MEWA 1NF7A 2WXDM 1ICPA 5LKYA 1C3FA 3B8DA 4JFVA 1J2WA 5D2TA 2QAFA 5KZMA 3QQWA 1TG7A 3ELFA 3YPIA 1SW3A 3SCTA 3A21A 1LQAA 2OO6A 2J7GA 2J79A 3B3DA 1KM4A 3VIOA 1JRBA 1AMKA 1IR2A 1TTPA 2Z6IA 3UA4A 4L4MA 1HKVA 4IUGA 1W3TA 2FGLA 1YQ2A 4LNCA 1UYQA 1K3UA 3SGZA 3VKAA 2H90A 5DT5A 1PHQA 5LA2A 3TNOA 4WX2A 1ZJIA 3CGTA 3CUFA 4RNJA 3UGVA 1UZ1A 3MT1A 1F7BA 4PMUA 1TWZA 3KBJA 4IMEA 4UFMA 2CZVA 2CZDA 3N2OA 1JCNA 3SM0A 2IXVA 2VC5A 3TJXA 5AZ0A 1OYCA 2BVYA 5EYWA 1UHVA 3ITVA 1Q6CA 1X6NA 1IWPA 1F76A 1UR2A 1ONWA 3EB3A 5FIPA 4KGLA 3C2VA 3CM4A 3WQ8A 3QXBA 1VBJA 4B15A 3F7JA 3NO5A 3BAXA 5I23A 5FF7A 4N9CA 2VDIA 1TV5A 2PCQA 1W1PA 2RDWA 1EDGA 2VFHA 2E67A 1PKNA 4CU8A 2XGBA 1TPC1 9XIAA 3T40A 4NZ1A 4AY1A 1DQXA 2Y1HA 4Z2LA 3TTQA 1X39A 2AMXA 1KRBC 4DAFA 3LRMA 2Q01A 5I3IA 3A3HA 4A35A 3ORWA 2R8WA 1THFD 1RJQA 1BF6A 2E6FA 4CEXC 4FI4A 2IPWA 3JZEA 4J27A 1UMLA 1J79A 3N1AA 1VLWA 3LBCA 4HD5A 1GQLA 3OVQA 1S2CA 1TQJA 4GACA 2XIBA 3N15A 4K8GA 4CLMA 7PTDA 3UCCA 3WDIA 3S0CA 1QI5A 1Q45A 4AZ7A 3E0LA 4RK8A 3SEPA 2ZX5A 3MUCA 5I3DA 1J6OA 1FDYA 4JBRA 3U2ZA 3DENA 3RK8A 4JNYA 1R47A 3PJWA 3L4XA 3BCJA 3SGUA 3LPGA 3TZNA 2B0MA 3W1TA 5AY7A 4NX0A 5DO8A 3K5XA 4WHBA 3DHDA 4CQ8A 1H1NA 3ZR6A 3R94A 1H50A 4AZ5A 3CB3A 1M04A 4KWVA 3WJWA 2NT0A 1IEQA 5I03A 4R27A 1OZMA 4ACZB 3NL5A 5CZSA 5CXPA 4E6MA 3KXQA 3N19B 4V27A 2WPGA 2HWGA 1MNZA 4RPPA 3BZJA 1I2NA 3GXPA 1AW5A 3VIKA 4JQAA 2V67A 3CC1A 3KS5A 4QLJA 1E56A 3FV9A 4RLIA 1OM0A 3W23A 4AZCB 4AW7A 2VL4A 1QASA 3WD1A 4O19A 3VKCA 1O94A 2VFIA 3WJXA 3PTDA 5T26A 3FDGA 3LHUA 1RXOB 4A4AA 2V0TA 5D2WA 3T08A 4H9UA 1A5KC 3TA9A 1RBAA 3UU0A 4DZAA 3RMJA 3MCNA 3TOYA 3ERPA 4M82A 4H83A 4REQB 4GUFA 4HU8A 1QO5A 4HNTA 3O6YX 3VNDA 2PP3A 4GUGA 1QK2A 3WK0A 4V2XA 4GMEA 4HN4A 3VGDA 2ZDRA 2ZX9A 3W1RA 3QFEA 4L9XA 5HK4A 3IJDA 3WY1A 2VTFA 2UWFA 3ARWA 1W8SA 3VZYA 4B4FA 3KCJA 4P7NA 3TKFA 4IFKA 3B9AA 3PUEA 2QULA 2C79A 3GBEA 4MPQA 2F6KA 3E5BA 3W84A 3AIRA 3G1AA 1OGSA 3WLIA 2ZX6A 2QS8A 3A3XA 3AS2A 1JDDA 4XAYA 3KHDA 4LF1A 1H60A 3VOGA 4GGHA 2WVVA 1VPXA 3M0IA 3UWZA 3R0DA 3A4WA 3Q37A 2XVGA 3W72A 1GEHA 5T9CE 2GVGA 4JYEA 3SCUA 4CD7A 1E1EA 3GUGA 1EFZA 1MW1A 1FTXA 1XIGA 2REQB 4EP8C 4R53A 5HAOA 3GU9A 4WD0A 4LAOA 1JUKA 1G9HA 1TPH1 1B5TA 5LNUA 4NYUA 3VUSA 3GDBA 2BZNA 1VFTA 1HTIA 3W75A 2NV1A 1K8CA 1SVDA 1LRQA 2DUAA 3TYZA 3T42A 1T96A 1A5CA 4LB3A 4M0XA 4BI5A 5C55A 3D6NA 4IF2A 4H9ZA 2GPTA 3OB8A 4DWDA 3WNPA 1J9YA 1XRVA 1VLIA 1QCWA 1BYBA 2OKOA 3W3OA 1IXPA 1DWJM 3GY1A 3CH9A 1PE1A 3THDA 3KBSA 1WKFA 4QDPA 1W3JA 5I5RA 1R3RA 4DAIA 2H8XA 2VX7A 2X7WA 3AFBA 1D3HA 1S2UA 2ON3A 1FCQA 3UWWA 2PAJA 3WJYA 3MWCA 2HS6A 3B97A 4PB3A 3TN4A 1XBZA 4HHMA 3CUGA 1EX5A 4Q7BA 3S83A 2HE5A 3K1DA 3DG6A 2C15A 2OGJA 4UTMA 5HJYA 5TQLA 3WMLA 4LUSB 1UZ4A 3EX3A 4S3BA 4F0LA 1SYTA 3LI1A 2PC4A 2X1RA 1SUXA 1NU5A 3OJGA 1ZJHA 1UIPA 1RV8A 2BHZA 4GI6A 2G3FA 4H9VA 4CNNA 3F4NA 2V69A 4EE9A 4E38A 2EG6A 3LSCA 1AJZA 1I2PA 1XPYA 3I3EA 2PGEA 3J7HA 3KEHA 2YR1A 1L9WA 4OJYA 1R9XA 4AC7C 6TIMA 5FACA 1F74A 3CZKA 3O07A 1MDLA 1PUDA 3TE9A 4QRNA 2VC7A 4PTNA 2FFIA 2IQ0A 1U5JA 3KP1A 2NWSA 4YWSA 3CQHA 1P0EA 1XQLA 5AHIA 1FDZA 4QAIA 4R34A 5C7VA 3QMRA 4LTSA 3M1ZA 4FOUA 3L4YA 2DH3A 2NQ9A 1HJUA 2ZZ3A 5GJPA 1TJ2A 4TVCA 1UH3A 2X30A 1N55A 2CC0A 2OO0A 4IL0A 1CLXA 1TA3B 2J6VA 3S3GA 1IXQA 1SR9A 4TIMA 4XIMA 2RFGA 5CZJA 4ZO6A 3B8IA 4J1OA 1UKQA 3B40A 5F2GA 3S6OA 3PAJA 3VX1A 1VRXA 3CPGA 5E93A 4C1NB 1C7TA 4FLOA 1W32A 2C16A 1XXXA 1XV8A 3M0YA 1GG1A 1J0ZA 2ODOA 3PP7A 4AY7A 3VZZA 1UWQA 4KEZA 1XYFA 2OZ0A 3INPA 4XZMX 3JS3A 3PG9A 4U5KA 4DBSA 4MSSA 5E6YA 5A69A 2P10A 3S6DA 4DJFC 3CO4A 4J3TA 1Q85A 1YDVA 4GKLA 4DHGA 1H5YA 3ITXA 3BW2A 4KWUA 4XK2A 1WP6A 5SWUA 2JEQA 3W1LA 3EZ4A 3RR4A 1JVNA 2HVOA 3VDBA 5CG7A 2ZA1A 3GS6A 3PPHA 1N8FA 5CJ5A 1V79A 1ICSA 4M56A 4M7TA 5FD0A 1UB3A 5HWMA 4U3CA 2KAUC 3QN3A 3I7SA 5HR6A 1WCGA 2ZX7A 1MXSA 5FEXA 3BO9A 4L80A 2D20A 4FZIA 4LH8A 3UPMA 4GQ0A 4ZO8A 3GZAA 4D6IA 2V30A 5D9MA 3BQ6A 4S3JA 3PB0A 5DMYA 1H7PA 3ARXA 1JCJA 3R5EA 4FNUA 1FCBA 1EJTC 3DDMA 3KL0A 3PC0A 1OFEA 5FJJA 3VKJA 4YPJA 1X8CA 5C9ZA 2O7SA 2ZICA 1DQUA 2J62A 2R24A 4L65A 2BWGA 4F0KA 1RQBA 2GL5A 5K3VA 4PH6A 3WELA 3NPWA 1GKRA 3WQDA 2CEQA 3NQCA 3CT2A 1SW7A 3SUUA 4GO9A 5TF0A 2Q8XA 4D8AA 1P6CA 2XG9A 3KBWA 2YA0A 5FA5A 1TWDA 3M16A 5DLCA 1MDRA 4JHOA 4DB7A 4MZ1A 1JAEA 4ADUA 4RZ4A 5MHBA 2D0HA 3LNMA 1EPVA 2WVSA 5A8GA 1H61A 2PS2A 4QG6A 3UJEA 3G8EA 4MNJA 1QVBA 4WQ6A 2I1OA 4FIRA 3L7RA 4N4PA 3AXHA 1D3GA 2XWEA 4ZR8A 3SO7A 3HF3A 3QVQA 2UY3A 1P0KA 4LVDA 1V3LA 4O1CA 3CMJA 3WQ6A 2ABBA 5C5YA 4ROPA 4IG2A 3QGVA 1CXFA 1KM5A 3NIYA 3V7PA 1M01A 4WDWA 5AECA 3APYA 4UNKA 3HB9A 5E1QA 1WKDA 4WKFA 1FWWA 4PCTA 4PTXA 2ZWYA 5I3HA 3V0SA 2VD8A 2C6QA 3R58A 3GM8A 3CUHA 3L0GA 4EAYA 4H19A 4KCUA 3WDQA 1H1ZA 1S2VA 2VQTA 4NAFA 2QCFA 2WNQA 4S3KA 1LYXA 1W1ZA 3VO0A 4GJIA 4NP7A 4KFOA 2D0FA 5EMYA 1K8XA 2PFHA 4KGJA 4UB9A 2HDJA 3EWCA 3U7BA 2YCIX 2O9RA 3V1PA 1EJSC 2J7FA 3ARVA 1RPKA 2ZUNA 4AZIA 1B57A 1HVXA 1V93A 1XIMA 1A53A 4GVFA 3DBNA 1A5LC 1D7KA 3RF9A 1NDYA 1BD0A 4I6VA 3MP3A 1DJZA 4AIEA 4IJBA 1LBFA 1OT1A 3HQOA 2VDHA 1WX0A 1F8MA 2BMBA 3W4RA 3AIWA 2PWFA 3LZ3A 4AYSA 3EOSA 2WV8A 2DT3A 1B3WA 1H11A 3CIXA 4NF7A 1XGDA 1JIBA 3M07A 4OU1A 2VZSA 5HJXA 2WSPA 3OQEA 1HJVA 2O0TA 1R9ZA 4F0MA 2XVNA 1WXJA 3EKGA 5AHMA 2XSBA 3PBYA 1CGUA 1XKJA 1DJQA 5A8QA 3W1XA 3MP5A 4LX4A 4ICCX 3Q2DA 3DERA 4IP7A 3AYVA