4AX6A

Hypocrea jecorina cel6a d221a mutant soaked with 6-chloro-4- phenylumbelliferyl-beta-cellobioside
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOGLUCANASE 2
publication title Rational Design, Synthesis, Evaluation and Enzyme-Substrate Structures of Improved Fluorogenic Substrates for Family 6 Glycoside Hydrolases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 127
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4ax6A00
3ABXA 4AVOA 3A64A 1OC6A 1OC7A 3RU8X 3VOJA 1OCNA 4B4HA 1TMLA 1CB2A 1OCBA 2BODX 1QJWA 2BOGX 1HGYA 1QK0A 1QK2A 3VOIA 2BOEX 1UP3A 4AX6A 4AVNA 4A05A 3VOGA 1OCJA 3RPTA 2BOFX 4AU0A 4B4FA 1UOZA 1OC5A 4I5UA 1UP0A 1GZ1A 1UP2A 4I5RA 2BVWA 3A9BA 3VOHA 1DYSA 1BVWA 3VOFA 1HGWA 4AX7A
chains in the Genus database with same CATH superfamily
1DIEA 4IPPA 4IOTA 3FSTA 4ZB2A 1KW1A 2VFEA 1LOSA 1UD8A 1W3KA 4G9PA 5AHEA 2FDSA 1C9WA 3CHDA 1US2A 5DMYA 2YL9A 3D3FA 3E02A 2Z0IA 3LHTA 1FDYA 3N2MA 4KWVA 5FJUA 5DN1A 3TXZA 3L4VA 1W9DM 2PDHA 1LORA 6XIMA 3RX4A 5BRPA 4PCSA 4Q7BA 1E6QM 1J12A 1LCOA 3VGHA 1UR0A 1JAKA 3SSJA 1OFOA 4HOWA 3BTNA 1EHNA 5D9OA 3W0KA 2OXNA 2Y2WA 1HW6A 1O4UA 3RJXA 1ZNNA 4HCHA 2PDBA 3T9PA 1T0OA 1JYNA 3OVRA 3PPGA 3VC5A 4LQ1A 4ZB5A 1W91A 2WK2A 3TC6A 1FCVA 2VFHA 6REQB 3RM4A 4KGJA 2PMQA 4L6OA 4AEFA 1OT1A 4C5ZA 5B7YA 2R9RA 5CSRA 1R2SA 1RP9A 2BZNA 2ALRA 4NJJA 2I7GA 4HU0A 4HA0A 4XZBA 3KRZA 4REQA 5K2ZA 3TJIA 5ABEA 2NT1A 4WVXA 3H70A 2E1WA 1F8MA 1ML1A 3B0PA 1QW9A 3KUMA 3PTKA 2KZHA 1Q3NA 2RJHA 4QQUA 1GVIA 2ZZ4A 3CT2A 4J40A 1GEQA 1Q8JA 1JL8A 3NQGA 1W5PA 4JN8A 1KWKA 1JG9A 3SO7A 1NP2A 2QJNA 4H3DA 3WL0A 3DH7A 1IWAA 3LPPA 4FS9A 2E4TA 2P0IA 4S3BA 1UR9A 2KAUC 3T8QA 5TD4A 4AD2A 3M0IA 3WENA 4ZGYA 2E09A 3WELA 1A5MC 3GC2A 4D1IA 3IVTA 3VD5A 3N2BA 2W4XA 3MB9A 1F7BA 4OBTA 3R25A 4RUBA 3NSXA 1JULA 1QFEA 1NP0A 5AB3A 4IIFA 1TX0A 1BAGA 4RPPA 1DJIA 5AECA 2QGHA 2QUMA 3TJLA 1QAPA 3LXBA 1ZBCA 4HKPA 2O55A 2WNWA 1GORA 4EXBA 3H4WA 3EMQA 4JKKA 2WWDA 3WEMA 4NHVA 3NM1A 1I0DA 4UFJA 2PWGA 4XAPA 2DZVA 4C6KA 2FGZA 1EDGA 2AMGA 4WJXA 3CIWA 4LUYA 1DIOA 3B0UX 3TROA 2Z6JA 3QKZA 3UCQA 3MCMA 4J9JA 4KW2A 5FJTA 5D9MA 1F61A 4OE7A 2X2GA 4KWWA 3RLHA 1PEZA 3I68A 3A23A 1N7KA 4NXSA 2J6XA 4M6PA 1TO3A 4H9ZA 1H1YA 1TV7A 3OG2A 1S5VA 2IKIA 4XVEA 3GNPA 4JKMA 2J24A 1TPC1 5A6BD 2I57A 3S9IA 4JTJA 4Y8FA 3IIZA 1VD6A 2EJAA 4C1NA 2E6DA 2NLIA 3A4XA 1EF2A 3R13A 2OYMA 2CLMA 5LNUA 5FAJA 1YYAA 3LHZA 1CLKA 3DCPA 3VNKA 4JTAA 3LV6A 1OZQA 3LBOA 3IARA 4AZ5A 4DM1A 1V03A 3I4EA 2O9RA 3PWAA 4JXCA 4XZLX 4Q22A 2F6UA 2ZZ7A 1EC8A 4XWUA 2VMFA 3P5YA 4OWGA 2XSAA 4ZTXA 3M41A 4JAWA 5I23A 3KBSA 2ZRZA 1LOLA 1Q6LA 3C0SA 1SW0A 3KBMA 4TMBA 1CEOA 3T81A 1QUMA 2QR6A 1QOXA 2HPIA 2ZZ3A 4WK9A 2BVTA 5I07A 3E12A 3OA3A 1TA3A 3NVTA 3GNNA 1IZJA 1EDTA 4QFUA 1EZ2A 3BW3A 3NZ1A 5AZ0A 1Z7AA 3L66A 1CW2A 4S38A 3CAWA 1SMAA 3BLOA 3ZO9A 3E1F1 3N3MA 1FWTA 1TTQA 4K37A 2CPUA 5IHRA 1DJQA 3UZWA 1GHSA 2ZX5A 4MB1A 4GZEA 3H21A 1ITUA 1HVXA 3WQFA 1E40A 3TN6A 2FTYA 1Y0EA 2YZRA 3HPAA 1L0PA 3M0KA 3QMSA 3FKKA 4I5UA 3SR7A 4IZGA 4HYVA 2Y4SA 1ECEA 3BOFA 4WY0F 1RBOB 3CV6A 3SCPA 2OEMA 3K4WA 1YNQA 4DBEA 1JJKA 1AW2A 4MM1A 1E0UA 1M68A 3GXFA 1XFCA 2RUSA 3WLPA 2R91A 1KM0A 2QPUA 3KBJA 3K1DA 1H51A 1OFDA 2PBOA 2BBFA 4F9JA 1SW7A 3RU6A 4PUWA 1R0MA 3WUFA 1OIMA 3K4AA 1IR2A 2CYGA 3KP1A 4G7EB 4D6JA 5A1AA 2VC7A 1GTEA 1RP8A 1W1ZA 3QHMA 4GQ0A 4YXGA 4M6QA 1DJHA 1UWQA 1EJWC 3V5OA 2J88A 3PNUA 1BSIA 1ZP4A 4JTDA 2YXXA 3WQWA 3SCVA 3XISA 3AALA 4FALA 5FACA 2C3ZA 5H8PA 4XK2A 1E5NA 3N4EA 2ZDSA 3V35A 1AH0A 4JTGA 4XZMX 3QFWA 4CVWA 4TR9A 3ALGA 4PB4A 1B4KA 7CGTA 1BKSA 3O6DA 4JTIA 1UIPA 5ABFB 3UFYA 1ZB5A 5KZEA 3I4KA 1XYFA 2CZFA 5FF3A 3BGJA 5G5IA 5CLTA 5AY7A 1E9ZB 1ZJBA 4HOXA 5AHNA 1JYWA 4QIUA 1B3XA 3EPMA 3I7QA 4CEUC 3JUGA 4FPSA 4I5RA 1LM1A 1QTWA 1UMLA 1FQ0A 4JOMA 1SYTA 1KA9F 1X38A 1SO6A 2XVPA 3DAQA 4I9AA 3IRSA 2XH0A 4MZ8A 4FHAA 1W3IA 1M3UA 3LTYA 3CL8A 3TZNA 3ERPA 2OX4A 2FQIA 4O52A 2Z24A 4JEJA 1E9LA 2DQXA 3NTYA 3QC0A 3KX6A 5BWFA 1P6WA 4D6HA 5C6MA 3FS2A 3VI2A 2DZWA 2VD9A 3UXIA 2ZA3A 1OCBA 3PNZA 2X2YA 4O18A 1JXKA 4HP5A 1S5NA 1XUZA 4MPQA 1VCGA 1LTDA 1Q7QA 1CPUA 1EGVA 4J3WA 5I2UA 1UZ4A 2CLPA 5CC7A 5LA2A 2TAAA 3ARPA 5I3GA 2FH6A 5LIUX 4QDPA 4QEEA 1F3WA 3R94A 3AHYA 3EPOA 4PR4A 3KXQA 1MQQA 1F6YA 4XKYB 2J62A 2Q6ZA 4YIWA 4IG2B 1E56A 3GXNA 1KR1A 4TO8A 2QAFA 4XIAA 3ZYZA 3L0NA 2OZTA 2BB0A 1ZU8A 3EKGA 5CLWA 1QXLA 3IUDA 4PTDA 4UZUA 2NVDA 1EBHA 1TJ0A 3GSMA 3IJLA 4NNCA 3LRMA 3GXMA 5CPOA 4ADUA 4B5NA 1XH2A 5FD0A 3TYEA 3B8DA 3QGKC 1UOZA 2F2KA 1WXYA 2FZBA 3L2MA 2PDNA 3HMJG 1KCKA 3LN3A 3LXCA 2X8RA 2VCBA 3D5HA 2CKSA 3VGEA 1GPWA 3AWNA 3T7VA 3UZ5A 3GVVA 3AQUA 3PZUA 3DFSA 1EPXA 1Y65A 3WK1A 3VD4A 1OYAA 2CHNA 3U5UA 4W88A 3VOJA 2CW6A 3AFBA 3ZFHA 2ZX8A 1TPFA 2IPFA 3LGEA 3O3RA 2B4GA 2J8GA 3STGA 4FLRA 3T0DA 5GNZA 3MV11 5HJLA 4WSHA 3G8RA 3ATZA 3IJ9A 2CBVA 1Q6QA 3PS7A 3KVMA 3JS3A 1HJUA 1DL3A 3M46A 3GG1A 3CB8A 2D73A 5JUVA 1VJZA 2EG7A 2FDMA 2CIPA 4DUXA 4GXPA 4YNGA 1XISA 4G6CA 5FSEC 3OU8A 2EPKX 5KTLA 3FKRA 3M0LA 2D2HA 4FXRA 3RHGA 3MS8A 5H91A 4ZOAA 5HINA 1X39A 1YIXA 5AVHA 5DMMA 2UBPC 2WVSA 3W7JA 3G1VA 1RH9A 1D8CA 1GW9A 3SCUA 1CXKA 1IV8A 4JTLA 5C9XA 1B3WA 1W9PA 4OGZA 3QV6A 1NDWA 1ZUAX 3BURA 1SJDA 4JDYA 3DECA 3NQDA 4NZ4A 1R2RA 3NQVA 2NUYA 2DVUA 3AYTA 3KTSA 4YVVA 4GUHA 1PL9A 4S2CA 1FOBA 1ISYA 4WKHA 4OOZA 2DZAA 3ABSA 1Q6RA 4ZSUA 1MFVA 3PB2A 1G4EA 1EJVC 3EAUA 3NQ2A 5GNYA 4R9XA 1QU4A 3MUZ1 1T5AA 4O4VA 5BMXA 3BW4A 1A3HA 4IPIA 3UYIA 3C2YA 3DFQA 2Q8ZA 2V0TA 3E5PA 1ZP3A 1RVGA 5CZTA 4CVUA 5IDIA 2J77A 4A2SA 2BASA 3KZSA 3CZJA 1TMQA 2NV2A 5A6LA 2ZE0A 4GGBA 3GB6A 3RCNA 5CC5A 1QBBA 3PWIA 3CEUA 4GNKB 3SM0A 3H7UA 2CBJA 3LV5A 4AWUA 1FWGC 2DFAA 4JYDA 3Q65A 1SO3A 3LPFA 3GDRA 1ZZMA 4WKAA 4M6UA 4C7DA 1S2AA 2BLEA 3SFWA 5EMLA 2FMNA 1OSEA 2ON3A 3KL5A 3FVMA 4GGHA 3L4UA 4U5IA 3CUGA 4PN2A 1T6MA 3SGGA 5AOUA 1Q85A 3M7SA 2ICSA 5EPDA 1UR3M 2BNJA 5E9AA 5FJRA 3KHDA 3PF3A 3WNPA 1W54A 2PWFA 3VYLA 5AN7A 5LNRA 2NXIA 1XD1A 1LRQA 2WBKA 4HHMA 3UCDA 1GJUA 4UNKA 4FP1A 1O60A 1VCVA 2FTPA 4LCRA 4EAMA 3O0FA 2G5WA 4JD4A 3NQCA 6CGTA 3PUEA 1BQGA 3BAKA 2PDGA 4C6CA 2XFWA 3N1AA 4GRSA 3T6CA 1S3HA 4NG3A 3TH6A 2A21A 3COTA 2QDHA 5LHFA 2GQ3A 1JI1A 3PFMA 3UWZA 3B9OA 2R94A 3LQGA 5DXYA 1HIZA 2BODX 3DKLA 1JZ2A 1N82A 3MI2A 4G1KA 4TXEA 1FCQA 4KCTA 1B3VA 1TR9A 4L7ZA 1L6GA 4NAFB 1CZ1A 1BG4A 1TG7A 4UR9A 1E0TA 1H63A 2EBNA 1SFSA 1JQXA 3OVQA 2VEIA 1VLWA 4LXFA 2WZIA 1J5SA 5JH2A 3CPRA 3LK6A 4E8CA 1GVQA 3UA3A 3QZ6A 1OADA 3TYBA 4Z1YA 3BJFA 3Q2DA 4XX6A 3DFTA 4MKNA 4LB3A 5T9CE 4MMWA 3LY0A 3L4TA 3PBVA 4AIEA 5FF0A 1QNRA 5L6UA 4PULA 1HX0A 2YGYA 3W9ZA 2GVEA 3AXIA 5REQB 3QLLA 2WCAA 1XIEA 4I9MA 3IS4A 3J7HA 1M7JA 3CWNA 5LSMA 3S2MA 2XDFA 5BXTA 2XSBA 3GYCA 1S1RA 1OCQA 2WHLA 2HS6A 1A0DA 1GW1A 3RILA 2HDJA 1FH8A 3VCCA 2GJLA 1VGAA 1S1PA 2MANA 1ISXA 4IQEA 2DSKA 3RNDA 4KS0A 1A4MA 4NX0A 3TC7A 3R8HA 1QPQA 2VDIA 4ROQA 3GRIA 1TV8A 2IXUA 2XU2A 1XYCA 4DUWA 3GTXA 2G3JA 4N6EA 1KBKA 1R46A 3CQJA 4GACA 4Z08A 4MSSA 4K7VA 1XPYA 2D0HA 2ZX7A 4KGLA 1GG0A 3PJUA 3ITCA 5EBUA 3O06A 2PDUA 1PX3A 3QEZA 4I8YA 1CECA 3M6YA 2W0UA 1Q6EA 3DU0A 3TW9A 4C7FA 1PS9A 1KRAC 3O6YX 3LSCA 1GOIA 2DDXA 2YPIA 4K1WA 3WH8A 4C6IA 4DAIA 2HVMA 2WSQA 4F0SA 4IGNA 1TV5A 1C7SA 2X7WA 4JQAA 4L65A 4S23A 4YJ5A 2INEA 4A3QA 3PUDA 2VC9A 3WMCA 1B90A 3W1AA 4DZAA 3O7UA 3NO5A 1FUYA 3KL3A 4I9JA 1EUAA 2ALDA 3W07A 4ORMA 4CD8A 3N9SA 4UFHA 4IMGA 2XM2A 3UGVA 1S5WA 1HZYA 4XZWA 2J74A 3UXLA 2J13A 2J8FA 2IKJA 3ANYA 1H4PA 3GR8A 4YWIA 3W83A 1TV4A 2FMOA 1C90A 3G1XA 4HMDA 4DUVA 4DXVA 4A8RA 1K6AA 4HJWA 3ARQA 3BLLA 3OJGA 2QCMA 1UR1A 4KFOA 1OX4B 2QJIA 4NXKA 3EMZA 4IFOA 2XH7A 3ABXA 3B0XA 4IP7A 1K8CA 3GDKA 2QULA 5AYIA 4DF1A 2TRSA 1S38A 2ZTKA 5A95A 5FJPA 2PDJA 2HCVA 4AC7C 2FKPA 2Z2AA 3MHGA 4DX3A 1GKPA 2P76A 2Q71A 3TEVA 1XC4A 2H3BA 2FPYA 1LG2A 3UBPC 1VFFA 3AIRA 3OYXA 2EPHA 2QMJA 4WDXA 3EA1A 1HNYA 5EA9A 4YLWA 3TYUA 4Y8EA 1SVDA 2OEKA 3G3MA 3GVRA 3F5KA 3SCSA 3TCSA 1GWJA 1GVOA 1E3ZA 2OQLA 1VJIA 4L6DA 4FAMA 1Q6CA 5M1TA 4E8GA 5EMJA 4M29A 3JVAA 4ECLA 4DNMA 4DB7A 3Q94A 1TVNA 1DTNA 3SW6A 4PUDA 4LNYA 1JNDA 2BX7A 3AWOA 5FL1A 1JGIA 5HNRA 1XIJA 2PRHA 1MZRA 5CH9A 5FF4A 4J3SA 4GK8A 2Q3RA 3ZJKA 2C14A 4I7VA 1K7XA 3S6OA 3C61A 1P0KA 2QUUA 3W2NA 3EX2A 1UOKA 4I9TA 2WZEA 1HL9A 1AVAA 3ARXA 5DCDA 3KBNA 2EO7A 3H7VA 4V28A 3ARRA 1DTUA 3A21A 1O94A 1B2YA 2J7HA 1XI3A 3GYEA 1NWTA 3N25A 4JS3A 4GC3A 3VGFA 1NDZA 1MSSA 3GFYA 4U3CA 3I3EA 3O6CA 2QEZA 4UOQA 3EXSA 4IMFA 1SZEA 3HQ1A 3CWOX 4MLJA 3INPA 3HG3A 2AQWA 5CSYA 2RAGA 4GBUA 3O2LA 1K9FA 3ENLA 5DY2A 2VYOA 3M43A 3CV2A 3IIPA 3NOYA 1S5MA 3CL7A 1WCGA 2XG9A 4IPNB 3B8TA 2FTWA 1DQUA 2ISVA 3MMWA 2Y5SA 1SGJA 2RJGA 5HUPA 1G6CA 1HVQA 3LMZA 5D33A 3NQBA 1DJWA 1JZ6A 1WDSA 1HFBA 3MUXA 1O66A 3MDUA 4GY0A 2Y0FA 7ODCA 2W27A 1FWBC 3EWUA 4RNJA 1YXCA 2X1SA 2DVXA 4NJGA 1FWAC 3BG5A 3OLIA 3QZEA 4NYYA 2WMHA 5DRCA 3W00A 3KCJA 5TIMA 3NURA 3DG6A 1EYEA 5I3KA 4DBUA 4HMCA 4DO7A 4NZ1A 4AZGA 1W31A 2IS7A 3C2OA 3MY9A 3SCOA 4E8DA 4JY8A 1V0NA 3UJSA 4NJHA 5A6MA 1UD3A 2HWGA 3S2LA 4AD3A 4LVFA 1Q5MA 6ALDA 4N7QA 4GUIA 1EP1A 4RV3A 2X0HA 3PG8A 4MJZA 5I78A 3BAXA 3DEQA 5F1UA 2GJXA 1RJPA 5E0CA 5LIWX 4F0MA 4W8AA 4F79A 1GYLA 3SUVA 3WD4A 2XH4A 5A2BA 3WMLA 4BHYA 1XRSA 2PE4A 3F7JA 3UWVA 2XWEA 4MJ4A 3W7IA 1K77A 1GPFA 5HNUA 4NAEA 4B16A 1QWKA 4BK9A 1PKMA 5D30A 4O57A 3FDGA 3AC0A 3ABQA 4GZJA 4MWAE 4Q8QA 1S3TC 1LLOA 4P7LA 5F4WA 3VO0A 2WQPA 1IIGA 1DIDA 2CXGA 3MYPA 3CTTA 4IMCA 4WJEA 5C0QA 1CYGA 5A2CA 1XSKA 3HJZA 1T41A 2QS8A 4QBXA 4AZBA 1BRLB 2DORA 3W7QA 2DUXA 5MHBA 1OGBA 3NL2A 3RR1A 4MAVA 5A3HA 4MFEA 5FJIA 3WNNA 4J7RA 2X0SA 1C8VA 3W7MA 2PC8A 3IAPA 3AAMA 3FHQA 1Q45A 3IANA 3FYOA 5T26A 2J7DA 1XLBA 1DP0A 2Z2BA 1M41A 1XBYA 3PPFA 3HGSA 1UD6A 2H8XA 4AHOA 3WCZA 2CZEA 4MTVA 4D6EA 3ZT5A 3ZJ8A 1O1HA 1A49A 4X9SA 1VIWA 1NF0A 2F6KA 5C55A 6XIAA 4B5UA 3NL3A 4LEQA 3CYVA 4TV5A 2CLKA 4RE4A 2Y8UA 1RJQA 5E93A 2YZ5A 3DBNA 2DUZA 3S5SA 3LHYA 4O15A 3S1XA 1GOMA 1JZ8A 2YXGA 2G0WA 3UA4A 2VR5A 3IV3A 1XLCA 1VC4A 3W7CA 1F6KA 4IP4A 2BVWA 4O11A 4A3UA 1A53A 1VEPA 3LU2A 4US6A 4YWSA 1RQEA 3ZT7A 4QHRA 3APGA 2C13A 1W8GA 2ISDA 1R3YA 3WDHA 4GI8A 1CIUA 3S9ZA 2QF7A 1M04A 4D71A 3KOYA 1VR6A 3AUJA 3WDPP 2WWCA 1N2VA 2MNRA 4IJBA 3M07A 2NV9A 1ZTVA 1R3SA 4QP0A 3LGDA 4UMCA 3VIPA 2Q8XA 2WVUA 2UY4A 2NXGA 3LM3A 5LXXA 2TYSA 3PSWA 4W5UA 3CLWA 4QCEA 3MW7A 1HJXA 4O53A 1D3CA 3CAVA 4E3TA 2J9ZA 3A22A 5C7HA 1CDGA 4D6CA 4HPXA 3V18A 4BCEA 4UTIA 3CHCA 4CU8A 2E9LA 3W1XA 4PUEA 4OOUA 3I6TA 2Y7GA 3PPHA 3CAQA 3H2FA 5IBXC 1P0NA 1GQLA 3IJ8A 1XUUA 4AD0A 1NELA 2E6YA 1JUEA 4E2OA 3CO8A 1G5AA 1QPKA 5EU9A 5LZLA 1Z9AA 4RV8A 5CBIA 4AZCA 2Z1KA 1XGDA 3H2CA 1RCOB 1K6WA 4ILSA 4FNTA 3GM8A 1HXJA 2WM1A 5M03A 1WA3A 3B0VC 1IXOA 1MW3A 1TQXA 1XKJA 3U2ZA 4PMXA 1NOUA 4NI3A 4W8BA 3HGRA 4CN1A 2JF7A 2ABAA 1DEDA 4WOZA 1R9ZA 4WCJA 2WVVB 1FWNA 1UBSA 4IQJA 2E5BA 1VPXA 2PDLA 6ENLA 3VIOA 1MWOA 1Q13A 3N4AA 1ZJHA 1ZL1A 2F38A 1JVNA 2QMKA 3TQKA 4D6DA 4IX2A 3ATYA 2QUNA 1Q2SA 2D2JA 3NIYA 3WK3A 4AMAA 5EL1A 5G2WA 3QPZA 1OEPA 3STPA 2DSZA 3EZ4A 1X6UA 1SJCA 4OBRA 3SCQA 3W4RA 4H04A 3IWPA 1W1IE 2OKTA 1I2QA 1E73M 4YPJA 5I5RA 3NSMA 4P8UA 4K3ZA 2P88A 2DSVA 3WH9A 3B03A 2J75A 2DU2A 3USBA 3BCFA 4LUTB 2BY0A 5DEZA 1EJSC 4QG8A 3BMWA 4H9TA 3TJ4A 2PF0A 3HGJA 1VENA 1GTHA 3W2UA 4DBWA 1ZBWA 4RX0A 3DYPA 1XCWA 3N9KA 2HSAA 1S2WA 3W3OA 1IHIA 2EKGA 3DG3A 4C1KA 1CLVA 4DXXA 5CJMA 1SO5A 1Q6OA 2E6AA 1UKOA 2I9EA 4CKQA 1SFTA 3EB4A 3ARYA 1GZ1A 5EGRA 1HJSA 4WHBA 5EKYA 5JBDA 4P61A 2YYUA 4DI8A 1OC6A 2QIWA 4CQCA 4LS1A 1E6NA 4XVDA 4UFMA 1CLXA 1P5BA 1H09A 4EF8A 2Z2UA 1E70M 2BXZA 4CQ9A 1TWSA 3VKBA 3NQ6A 1QHOA 2REQA 1A5UA 3T78A 1UKSA 4H6EA 2QNEA 4AXKA 3EB2A 3PZQA 4PL2A 2Z1WA 3E96A 4J3UA 3U9IA 2ZRVA 3ELFA 3M0VA 1J9YA 3UWQA 3DG7A 3DENA 2IPGA 1CTNA 3MQTA 3KRUA 1J6OA 1XL9A 5E6ZA 3G1AA 1POJA 2NQZA 4GY7A 1K1DA 1TJ1A 1MI3A 1LDCA 1K7EA 4FX7A 3A47A 3N9RA 3WJZA 1THFD 5E09A 1H7RA 5M5DA 4ZOCA 4Z2JA 2TODA 2CEQA 1KCXA 3GZ3A 1KQYA 3AOFA 3TLQA 2UY2A 4AZ6A 3E49A 3BUVA 3NR0A 1DVJA 1TTIA 2GDUA 1US0A 3AHVA 4UTWA 1GVEA 4UXDA 2OLHA 4K6AA 3REQB 3I7SA 1BTMA 1JCLA 3NZQA 3VKAA 1RQBA 1WXJA 3NFUA 3WD2A 1YADA 4UQCA 5IRPA 2WNZA 3TYAA 3PBMA 3BC9A 1GVRA 2FYMA 4IF2A 2V69A 1IE7C 5CAKA 1LRNA 1CCWB 1FY6A 3QF0A 1U5VA 4PMRA 1RV8A 3G0XA 2DSWA 1GVYA 1VKFA 2DV0A 3VNYA 1FWEC 3QQWA 3QR1A 1E3XA 4RXFA 3FA3A 9RUBA 3AYRA 2D20A 1QNOA 3THAA 1I75A 3S2NA 4OV4A 4JQ2A 5AYZA 1QNVA 2HTMA 4HU3A 1OY0A 5IOBA 3AS2A 2ACSA 4XD6A 4UTJA 2IMRA 1AODA 2GWNA 2VR2A 4YL2A 1XM3A 4QJ3B 2E8ZA 4P7QA 1UD2A 5HAOA 5JIPA 1MXSA 4FI4A 3WNMA 4S1FA 3ZR6A 3H22A 4AIUA 4R53A 1OF6A 4TVUA 4ASTA 3OHMB 5BOFA 4QDMA 3UG4A 3EWYA 1UKPA 3CEPA 4E2BA 5GPRA 1NH6A 3EA3A 5KZ6A 3PJWA 7REQB 2UY5A 1V8EA 2PF8A 3JZEA 4Z1BA 3ZT6A 3R10A 4HA3A 4JFTA 2OOFA 4IP5A 4C6FA 5I79A 3UJ2A 1A5LC 1MRQA 3PZ9A 4QNWA 3AHZA 4PBGA 4LEFA 2C15A 1J10A 4M7TA 1TR1A 2OWXA 4AY7A 2DIEA 4LV9A 2VEPA 3VKDA 1W3NA 1JXJA 1LL4A 1ZAJA 3VIKA 3M0HA 1DIKA 2FB3A 4ERAA 1TZZA 2OZ0A 4Z2IA 4LF1A 5GQBA 4L9XA 4JTRA 3W25A 3WUBA 3M0XA 3XINA 3WDRA 4HD5A 1OABA 2HZGA 5A5WA 1W17A 3M64A 1PKLA 1TUXA 2DZBA 4LRTA 1YBQA 1J0HA 4US5D 2Y85A 3BLDA 2W61A 3W7OA 3SGZA 2WNQA 1A5AA 2CETA 2CU0A 1HT6A 3CMGA 2PWEA 3W27A 1QI0A 3AXXA 4QISA 2Y89A 4FXJA 3PTMA 3RR4A 4HPGA 4QITA 3EEZA 3NNTA 3BW2A 1YPIA 4QJ5B 3AXKA 2P50A 2ZX6A 3B3DA 3TWBA 2Y24A 4IIEA 4DJFC 5G2HA 4ZA0A 3TQVA 1OFBA 1CXEA 4LWWA 1WP6A 3CB3A 4YU1A 3MUCA 4BI5A 2X1RA 1AJZA 1S2CA 5I3JA 4HTBA 4IGMA 4LFYA 1UCWA 3RRAA 5XIAA 5HPOA 3M5XA 3SUTA 2FPVA 3W1MA 5IDZA 3K4DA 8TIMA 4ZR8A 1RPKA 2A6LA 5EFFA 1QDSA 1VFOA 3I10A 3GVWA 4DO6A 4GJJA 5LGXA 3VKKA 4O8RA 4LGXA 1ZS2A 4N9DA 3MYOA 1OM0A 2BGNE 3IUHA 4J5NA 4RCXA 1TCMA 6REQA 1BVWA 3QY6A 5FF2A 3WEOA 1I8JA 5C9RA 5LXEA 5BCAA 2G96A 1ISVA 2VRKA 4YTRA 4GO8A 3ZSTA 1QATA 3CIXA 3W76A 1HN1A 2DT0A 2FJUB 1LLWA 1ONEA 3E6EA 2VM8A 3E0VA 3LG3A 4LYQA 4JTUA 4NQ1A 1ITQA 3JU2A 4ZO9A 4MJ2A 4M81A 4TU1A 3WNLA 3T55A 4Y9AA 2ZC8A 1JD7A 4C6JA 1JZ5A 4C6BA 4JCMA 1ZPTA 3DZ1A 2OT1A 3NYDA 4JQ4A 3ZLFA 1IEVA 4JL1A 3QM3A 3TSDA 4OECA 4I90A 2YXOA 4GVGA 3PZIA 3BLPX 2G3FA 3IRDA 1LT8A 3CT7A 5EMYA 1VPYA 4AFYA 3WJWA 2ZZ5A 2VL4A 2WO5A 4GIYA 1A5OC 2B81A 3KW3A 4GBDA 3NZGA 4JNYA 3BWWA 4DVOA 2FHFA 1IQ8A 5CPSA 3VNDA 4ROPA 1Q7MA 1S2TA 1BD0A 1AFSA 1AQHA 2SFPA 1PVNA 3GIPA 1FCBA 4UTFA 3W29A 1KFBA 5FEZA 3PTQA 4Z2GA 2P1FA 2PCQA 4ML4A 1T96A 3WLSA 2ESCA 4IT1A 1MRAA 4FX6M 3MUY1 8A3HA 2J7FA 3YPIA 4ZQRA 4O16A 4LAMA 2A6NA 2PZNA 5JIWA 4LRSA 1FWDC 4B3KA 3S47A 1G1YA 4GVIA 1KNWA 3PVFA 3ZXWA 5EB8A 3M6DA 1DPMA 3PZNA 3BXWA 2PP1A 3G1YA 3GAYA 3LTSA 4LAZA 1AL8A 4DIAA 4KWUA 1KTBA 3HOJA 1ZLPA 5E6YA 1UASA 4W7VA 5A94A 1TIWA 1C93A 4X22A 3QOKA 8XIAA 3NM3A 1FKXA 4GINA 1TREA 3KVLA 1HKIA 1PHWA 4O0ZA 3GXPA 3WQGA 3EDEA 2E7FA 2JIWA 1KGXA 1OGSA 1QPNA 4RDVA 3AYVA 3L5AA 3R89A 2ZZ1A 3CQHA 3T4WA 4NX5A 2WSKA 4ICNA 1CXHA 1ADDA 3Q67A 2V3GA 4BKNA 4HU4A 3CUZA 3ES8A 1JNEA 2CCRA 1WPCA 3DIPA 3WNKA 3S0CA 1JFHA 1SM9A 1I45A 1BWLA 2ZXAA 2JKAA 1JPHA 4QE4A 1ITCA 3HTWA 4XSMA 2H9AB 4B2DD 1X1NA 2P0OA 2GOKA 2J79A 1AD1A 2HRWA 1XG4A 1E1CB 3BG3A 2X05A 1WKDA 2VZOA 2JQXA 3C8NA 3VIGA 1PJ9A 3GZAA 3N15A 5HR6A 3N2TA 1AH3A 1PUDA 1VB9A 2CHRA 3LCXA 5C7VA 3BV7A 4X2PA 3RG6A 4F0LA 4LC6A 5K4ZA 3W1QA 2VWSA 3I65A 1C8YA 3LCWA 2ONEA 3W7PA 2XVNA 4X63A 3QPEA 1DJGA 1F3TA 1EB3A 2HEJA 4FF5A 1KKOA 4Q8PA 4E4FA 4WX2A 1G0CA 4O54A 1NQKA 1D3HA 4JNMA 3RMJA 3VFCA 2VGFA 1U30A 2V6AA 5GJNA 4MDPA 1EC9A 1TPH1 4EVZA 4ACZB 5KZDA 2R1MA 3TCEA 4TMCA 4QXIA 1KTCA 1DQWA 3N2XA 4LYPA 4Q4OA 4C1NB 3GKFA 3UVIA 1XICA 2OWCA 3KS6A 4AF0B 1HKWA 4XIMA 2EKCA 1WOBA 3BOLA 3WQEA 1YNPA 4JIHA 1R8LA 4JTQA 4LYKA 3TTOA 2J47A 3WF3A 3VIJA 2VXNA 4G7EA 1SJAA 4FNQA 4JQ1A 5LNVA 3STFA 1AW1A 1E6ZA 3EBVA 4F4RA 3L5MA 4ZZ9A 5D2TA 4XZNX 1KFLA 1FDJA 1Y5WA 4PRWA 1TELA 2WOQA 1WUEA 2ATSA 3VCNA 1A0CA 4YTQA 2NQJA 1V7AA 1AZ2A 1KD0A 4OV9A 1N8FA 2W62A 3OQEA 4AYGA 1XS2A 4J2MA 2J6VA 4PMUA 4HNLA 5C2CA 4ZXOA 1FX6A 4RJEA 2F7FA 3V3WA 3QR3A 1DBTA 2YCLB 4B15A 3TP4A 5H6HA 5ABFA 1KXHA 4HMNA 4MPKA 3IPWA 1F4AA 3UY8A 4DJEC 5BWAA 2BV9A 3SI9A 1L6FA 1KR0A 1FHLA 1MZHA 1KCZA 3UNDA 4ERGA 4HZMA 2E40A 4FNRA 5K9DA 2ZBTA 1E43A 2QVHA 4HK5A 1EXBA 2JIEA 3KLLA 4LJ3A 4AEEA 4A05A 5T91A 1V79A 1OC5A 1U5JA 3B8WA 3GH4A 4CD6A 3SJNA 4PA8A 3GU9A 1U1HA 1AQFA 4AX7A 2WHMA 4QX4A 3TE9A 1HG3A 3EOLA 4GXWA 3N18A 3SN0A 4CN4A 3OHIA 5DO8A 1YQ2A 5LIXX 1TJPA 4EPBC 3BL3A 4EANA 4MADA 1RCXB 1TYGA 3PJTA 3WJSA 3RM9A 3WLTA 5CG0A 1JRBA 2R14A 3A64A 2PDWA 4KCUA 1V6VA 1H2JA 1H7NA 2Y5EA 1MW2A 1J93A 4GQBA 3TLLA 1WDDA 3BICA 4A8IA 4XKYA 2A3EA 3LD5A 4QTGA 1MNZA 4IG2A 4K38A 2QGYA 4ZTYA 1OCNA 3UWWA 1SSDA 1REQB 2PRLA 3PK7A 1S2UA 1R7AA 3W88A 2WSYA 2HQAA 1CXFA 4A2RA 3RMEA 1TX2A 2VEMA 7XIMA 3LGGA 5CGTA 2A7PA 4PCPA 1I2OA 3ME3A 4ZE5A 4N9EA 1Q63A 2OSYA 4O1FA 1W3JA 4PODA 3WF0A 5AC7A 1G7UA 5D2YA 2VGIA 3CH0A 3WDIA 2ZE3A 3PJXA 2HJPA 1GOWA 2DW6A 2CLLA 2PP0A 4NP7A 5I02A 4Q8VA 2VCAA 4GYPA 3OZOA 3CZLA 1KFJA 3OLEA 4AVOA 4MNLA 2ZUTA 4LX4A 5A69A 3I3DA 4S3DA 4A8NA 3UZXA 2CC0A 2DZXA 2X30A 4AZIA 1L8PA 1UZDA 1RD6A 3NL5A 5AKQA 5F2MA 1O12A 4UIOA 2PDXA 3V0TA 5FIPA 4Z42C 1OWQA 3R0UA 1OC7A 3GR7A 1ICQA 3WF4A 1XINA 1A0EA 3DFPA 4L4LA 3CZGA 1Z3NA 1UC4A 2DGAA 2CHOA 1TWWA 4AYSA 2RGMA 2V38A 4JKLA 4ADTA 5CJ5A 1VRDA 3W26A 2WPBA 2XN0A 4IIHA 1UR8A 2OX1A 5AYBA 2YW3A 1W1PA 1B31A 2HNEA 3TUUA 4J28A 1W5NA 4D1JA 3DESA 3WLOA 3MTWA 4J27A 3IGSA 2IQDA 1L6YA 4KRTA 3G2GA 2QDGA 1OX6A 1WE5A 2YX0A 5IFTA 2BTMA 1OIFA 3UT0A 4IM4A 1PXGA 4N4PA 1EYWA 4HU8A 4KIEA 4PRTA 3GVGA 3LRLA 2YB1A 4AX6A 3D3AA 3G1SA 4Y9MA 4NF7A 1VJSA 2JGYA 4MY1A 1TTPA 2B7PA 2DH3A 1RJRA 3OGVA 2ZOXA 1IEXA 3TFXA 1SZRA 3BJSA 1GJWA 1VFHA 1R3VA 1VBGA 3BSGA 3A24A 1GOQA 3MVIA 1YE4A 1PKYA 1UW9A 5JBEA 3MKCA 1LQ0A 1O1ZA 5JBFA 4X9YA 3WLJA 2V2HA 5HOSA 4QLLA 3B9AA 2NQ9A 3H2OA 3SN4A 4GO9A 5A8OA 4NJKA 4NU7A 2OO6A 3SN1A 1A5BA 1AQMA 2WM0A 4IFKB 4EWND 3W2KA 4AAJA 1YEYA 1R9YA 1XIFA 1QT1A 1RZMA 1HO4A 3HG5A 4H6QA 2W79A 3RU8X 3NPXA 3KFTA 4DI9A 3BJTA 2NSXA 3WLRA 1OFEA 4AD1A 1F2JA 2VT0A 4Q4SA 4J3XA 3DFNA 1M01A 1JUBA 4J2PA 3XIMA 3IVSA 1MEIA 3TMQA 1Q4NX 4IH3A 3FEMA 2YR1A 4UBPC 4BY3A 4GUGA 4PTXA 3EWDA 1XJBA 2VRJA 4UNLA 3G1FA 3MBDA 1E1FA 3PZTA 3QKEA 3L0GA 2VKZG 4FO4A 4MG4A 1B30A 3C0QA 4QJ1A 4U10A 5BW6A 2GJPA 1QCWA 4FLSA 4DPPA 2DT3A 4KWSA 2ATMA 4PMJA 4HTYA 4N9CA 4BQ5A 4GJ1A 3FJ4A 3MT1A 2YDAA 3KM8A 1EJXC 4QLKA 1XDLA 1IT0A 4LNCA 3AI0A 4V27A 1PKNA 1XCFA 1WQ5A 2AAMA 3M16A 3R1ZA 3DHUA 3NQAA 3P74A 3VGGA 4HMEA 2V30A 5CPMA 5DBTA 2QDDA 1UHVA 4Z2KA 3OA5A 1JEZA 2YFOA 2Z1SA 4IIBA 2W9MA 3W85A 1HO1A 4J1OA 3VZZA 3KCOA 1KXTA 1IEWA 3A3XA 4XD5A 1EGMA 3MBFA 3QY8A 4E2VA 3PHAA 1J11A 3VOFA 2DIJA 5F4XA 3GTIA 1XRFA 1ODZA 1XDJA 4RE3A 1A47A 4O0KA 5JU6A 1FWJC 3WQDA 1N8WA 4JYFA 1DJZA 3C0LA 3SDOA 4MB3A 4WKFA 5DBUA 3IV8A 3V5CA 5AVNA 3GUGA 1UG6A 5EMKA 1CGTA 4EAYA 3RO8A 9XIMA 3O9NA 1W3LA 2ZZ2A 2FGLA 4BI7A 1X6LA 1GKRA 2WHJA 4K36A 4NAFA 3SCNA 2B31A 1PZ0A 4AXNA 3UY7A 1BWKA 3W75A 4ONVA 1A50A 4K7YA 1FWIC 3GX9A 3VCRA 4M1BA 1M9HA 4TV6A 1M65A 1ODUA 2EGZA 4CNUA 3TONA 4DHGA 1VYRA 3QYSA 4F2BA 3DYMA 5TQLA 3OBKA 3BE7A 2J66A 3A9BA 1V0LA 3BMVA 4IISA 3H2AA 5REQA 4RE0A 5BU6A 2PEVA 1XRVA 4EP8C 2VRQA 1EP2A 4KETA 3KBWA 4HCLA 2V81A 3TYDA 2BDQA 3A4JA 3TSMA 2V5KA 2R1LA 3EWXA 1BF6A 3TQPA 1ENUA 4H2HA 1UUQA 4OT7A 3HGOA 4C6LA 2FH8A 1FH7A 5D8ZA 4AY1A 4TUFA 1KBBA 3W2JA 3L4XA 1R9XA 4JHMA 3SFKA 3C2FA 3QXBA 3H26A 3KOWA 1I60A 4AMCA 1E6PA 3MZ2A 5D4YA 1BWVA 3P8JA 1I2RA 4H7ZA 3SRFA 5TAOA 1XYAA 1QI3A 4QE1A 5H2ZA 3D6NA 4GYKA 1Y7VA 1Z42A 2Z28A 5DT7A 1W9XA 2HNHA 4RNHA 1G4TA 2RKXA 3W7DA 1VPQA 4OKDA 4JYEA 3QTGA 2XWDA 3FFSA 5DY3A 1HUVA 3GH5A 3GXTA 1E9IA 4QCFA 4L1GA 2WZTA 1B3YA 3EOUA 3WLKX 3D46A 1WNOA 2GSHA 3E0FA 5KMYA 2JF6A 3ES7A 2XVLA 3LCGA 7TAAA 3BSMA 3SB0A 3GG7A 4UTWC 3BARA 4J3VA 5HMEA 1FRBA 5HNTA 3UCCA 5HXMA 3WL1A 4F66A 1FP9A 3HBLA 4B3LA 4PMZA 4BS0A 3NJ3A 4HZ8A 2XIBA 2PU1A 4IIDA 1H50A 5HQEA 4NT0A 3GFZA 1HKKA 2GK1A 1NWUA 2G3NA 4DBDA 1CXIA 4Q3MA 1BPLB 3RXZA 1Z48A 4Y90A 3ISIX 3KRBA 2CZ5A 1OX4A 4ALDA 2NX9A 1G4PA 3W82A 3WDQA 2PGWA 4UQEA 4P7NA 4PB3A 4PC8A 3P60A 4PMOA 3RFAA 3ID7A 1JRCA 3L67A 4FR1A 1H61A 3WUEA 4BEUA 1FWFC 3R0KA 1J0IA 5E70A 1F74A 4HOZA 3S1UA 3B40A 3M5YA 4PTNA 3C6CA 4ZVJA 4U33A 1EZWA 4RKAA 3R79A 4O13A 3NEHA 5FOOA 4NRRA 2NWSA 3T08A 3S5ZA 5KZMA 2Y70A 3QJAA 1CB2A 4LUSB 4Q33A 2C79A 3A5FA 4DAFA 3ZJ7A 2FVLA 2ZVRA 3AYSA 3ITTA 3RK8A 2NV1A 2QV4A 3VGBA 3PBGA 1G7VA 2WANA 3THUA 2WSRA 1JF5A 3GFXA 2Z1BA 1V3MA 5D38A 2JALA 1DYSA 3V36A 2QXWA 2YBTA 3APYA 3KHJA 3R5EA 4RNIA 4H8NA 4LU0A 2WKGA 3GHUA 1MVYA 1F5ZA 5FESA 3CXOA 2BFGA 2HV5A 4PTWA 3OODA 3UG3A 2V3DA 1UPPA 1B4EA 1NTHA 5H1WA 1O5KA 3L21A 4CU6A 1OJXA 4BWLC 3P62A 1R47A 2WJZA 3TW7A 1R3WA 1DXEA 1ZENA 1UWTA 3A12A 3NQFA 2F8QA 3ITLA 1BEUA 1G9HA 4PTVA 2XFRA 3CZKA 1DXIA 2ISWA 1YX1A 4RL3A 5CGQA 5DX7A 2OQYA 4XUGA 1VQTA 4FOKA 1OCJA 1KKRA 1LZOA 5A8QA 3F2CA 1TJ2A 2V5DA 3ZMRA 1SJBA 2DP3A 3W01A 2I17A 1GQJA 3EB3A 3MHUA 3F4DA 1NWRA 4PMDA 4KT2A 4E4PA 2GGGA 1KCLA 1S2VA 4C1LA 3UG8A 1D7KA 1JCMP 4XO6A 3IGHX 3A3WA 2ABBA 3PY2A 3PULA 1GVSA 4XAGA 2H3DA 1OT2A 4XBKA 2V67A 2QPSA 2CNCA 1T40A 1AMYA 4TTGA 4HCDA 4AZ7A 5FCZA 1CGYA 1PIGA 3T4CA 3AJ7A 1M7OA 4H8HA 2Y1HA 4JFUA 5LNWA 3E2RA 5IBXA 3T0CA 2C6QA 3NYZA 2WMKA 3ITVA 4DYEA 1TCDA 4HPNA 1TQJA 4IPLA 4CNSA 4CQDA 3SUUA 2XSXA 5GNXA 4NASA 3SIZA 2ZUMA 2NQLA 2GYIA 1Z89A 4PUMA 4XZ9A 2AL2B 4DJFD 1AMKA 3A4AA 4GISA 4PMQA 3E2QA 4XTIA 4GQQA 1US3A 3QV7A 1V5XA 4XG1A 3UXKA 2VR4A 3OIXA 4LC8A 5HR7A 2Y5JA 2G3IA 5C5YA 4WY0B 1EC7A 3HFTA 3DHFA 3TMLA 4Z2HA 4WUIA 3GXIA 4LYRA 4WDWA 3VKJA 3AMDA 4BEQA 1B54A 4U3AA 1M1BA 1NU5A 5XINA 3LBCA 3NVDA 1TE6A 3VXGA 3DKJA 4ICMA 1XH1A 4L4OA 2O0TA 4PSRA 4EXAA 1Z69A 4FMVA 1FHUA 4QS6A 4XKMA 6TAAA 3HMCA 1YXDA 2QPXA 1JCNA 2HXTA 1VEMA 3GIYA 3ZOAA 5HMDA 4CD7A 4FNUA 2QV5A 1NIUA 3WY1A 1EJUC 2VI0A 5J5DA 3NEVA 2J7GA 2HVNA 4NZJA 2CITA 1XLIA 3WD1A 2XIIA 1BFNA 4OIFA 4DM2A 1PX4A 3W1LA 2EEXA 1J0JA 1E4LA 1PSCA 3HPZA 2ZADA 5BXPA 3K5XA 4R5EA 3C4UA 1ZCCA 5AYXA 2JKPA 1V02A 2PTXA 1SFJA 4JCLA 2FZNA 3CGTA 3FGCB 1MDLA 1BTCA 1TE1A 1CGWA 1BRLA 3CM4A 3OZPA 2NLYA 3B0YA 2B0MA 3P14A 2C7FA 3GU2A 4OJYA 2IPWA 4H8VA 1XQLA 3NDYA 4ZO8A 1UKQA 4LANA 2AL1A 1XCXA 1A80A 1J4EA 3PN8A 2EPMX 5DELA 4FLQA 3PWGA 3BGGA 4IQDA 4GE8A 1GYNA 1UWIA 4NJIA 1ONXA 2V68A 4DF2A 3W6MA 2O7SA 4C6PA 2ADAA 4A3YA 3R8GA 1RQHA 1PB0A 4XTDA 4DPQA 2D2GA 2DQWA 2GJRA 3TR9A 2V5BA 3BAJA 4LY4A 4W4QA 4UOZA 3STCA 3OIHA 1V6WA 1CT5A 3LCLA 2WJFA 3EWBX 1TWIA 3B06A 4UOJA 2EJ1A 2FPTA 1TMHA 1J2WA 3VDGA 2HMCA 3WLNA 2QZRA 3KAOA 4KEMA 5HWJA 4JY9A 3G1DA 3WLMA 3S6DA 2GVJA 5D32A 1SPQA 1EOKA 4CQ8A 2DVTA 3BZGA 5HMSA 2XHYA 4C6QA 3LCIA 1W5OA 3N13A 9CGTA 3PP7A 1OK6A 3U2CA 1TKKA 5DQPA 3W02A 3ZWTA 4D2JA 5I3HA 1JPIA 5BRBA 2AGTA 3DFOA 3U2OA 1AQ0A 2E6FA 1GGOA 2VP8A 4C6OA 5HA7A 3AICA 2BXVA 2YIHA 4XQ6A 3ZS4A 4LOCA 1UBPC 4XV0A 4BQ2A 3V0SA 5B80A 3ICJA 1LBFA 5G4WA 3WQPA 2QVNA 1JZ4A 3DOPA 1EO5A 4JTSA 3NQEA 4W8LA 4KCVA 4TVCA 1JD9A 4FA3A 4DLFA 1MW1A 3SUSA 1GZGA 2V5CA 1L9WA 5CPLA 2YCIX 1ZBKA 1L2UA 1XSJA 3L0KA 2J27A 3BCJA 2XN1A 1FA2A 3GR4A 4LAKA 1B9ZA 2OJPA 1UJPA 3VU2A 1V0KA 2X09A 4Q8MA 1RXOB 5ABTA 3W1TA 4GCAA 4OUEA 3M5VA 4CCCA 4XSLA 1JYXA 3LYEA 3CBWA 2FZ8A 3GC4A 1NQ6A 3TQ0A 2WVVA 4JTHA 5E1QA 3DI1A 3MO4A 3PFRA 4RR4A 3IGUA 2VURA 4NI8A 4M1RA 2ZFAA 1X7FA 2BY3A 3RCMA 4UTTA 1HJWA 1OX5A 3APTA 1VFSA 1IEIA 3BMXA 3QY7A 4Q8OA 1DWJM 3W2LA 3VNMA 2CERA 1H7XA 3F03K 4F9DA 3UWEA 5HWMA 1XIBA 4YYCA 3MUAA 4JNZA 3AZRA 3FNDA 3VOHA 1EFZA 4H1ZA 4LB4A 3CMFA 4GYFA 3VVGA 4N6FA 2F84A 4RDYA 1JIBA 3WQCA 3T42A 3OVPA 2CXEA 1JR1A 2A3HA 1VF8A 4B5SA 4LUTA 3O15A 3MPGA 2R82A 1V6TA 3SCTA 3HQNA 3SJ3A 1ADSA 1ADOA 2PFHA 2ACUA 3K46A 1J6PA 1UWAA 4R88A 1PYMA 4UFLA 2A2IA 1X96A 1R7OA 3QHNA 1V3LA 2HISA 3HN3A 2G50A 2WKJA 4DJFA 1YRRA 1EGZA 2GWGA 5CSSA 4AY8A 2H8ZA 2NWRA 3W38A 1WAWA 1C29A 3FYPA 4E0CA 1C7TA 1OFAA 1XGEA 1TMLA 3E3HA 3ARVA 1I9CB 5PTDA 3SCWA 4W5ZA 1N55A 4Z1DA 1JPKA 3RX3A 2XIMA 4S2BA 1WUFA 2C8NA 2YLLA 1QW8A 3UR2A 4DJED 5G2IA 4RZ6A 2W3ZA 2QJHA 2A7RA 5A8PA 4ZQOA 3V1PA 4GABA 2OVLA 3P7YA 2G3MA 2E9MA 3S4TA 1XLDA 3AMGA 4FXSA 1QPOA 3IJDA 1U83A 4N9BA 5DF0A 2NVAA 3G3DA 4AG0A 4QQ3A 2CFFA 1NFBA 2AQVA 3FN9A 4Q4KA 5DANA 4DYJA 1K70A 1PV8A 2D22A 1FWSA 1P6CA 3QH2A 5EY5A 1QK2A 4JFSA 1NVMA 3U6WA 5J5RA 2GJNA 1TPB1 2RDWA 3N3TA 4E3VA 2VZUA 4AQLA 4OTKA 1HJVA 1UUOA 1XKYA 3N2CA 1VZWA 3UWUA 3URAA 1HQTA 1W0MA 2CBUA 5MF5A 3REQA 2PODA 2RFGA 4FB7A 3WG6A 1W1TA 3T8LA 3C56A 2PC4A 4UTLA 2R1PA 4I3GA 2YL5A 4L6HA 2WV8A 4GYPC 4IMAA 3GQYA 3VUPA 2WVTA 4HHPA 5DCEA 3LA4A 2PAJA 4GWEA 5HPCA 3OQ8A 3Q4DA 4XAFA 4FK9A 3CYJA 3TN4A 4P7RA 1C91A 3UPBA 3CUJA 5AZ1A 1H60A 3O16A 2JK2A 2ISSA 4IL0A 4A3RA 5CPTA 1X8FA 4J35A 4C6DA 1RVKA 2YDRA 2RDTA 4WD0A 5E0FA 1OBAA 2PDPA 4IGHA 3SRDA 4D9PA 4MUZA 4PYSA 3FSUA 3LZ3A 3LXAA 4Q6XA 4IFRA 3NXLA 3ORWA 4S3CA 4ZOBA 4WQ6A 1KM2A 1HGYA 7TIMA 1IYXA 4R34A 1TPEA 1SSGA 1QWGA 1TV2A 4ATWA 7REQA 3F2BA 4ML9A 3VZYA 4DRSA 4RW5A 3W74A 5AHFA 1GZJA 4Z1AA 3R11A 1GUVA 4MDOA 5F2LA 2IQTA 1GHRA 1H49A 4DEFA 4N2YA 3KWXA 3IAQA 4C6EA 4DWSB 1U1UA 4DELA 3GH7A 3LCHA 4F0KA 3LHWA 2CLFA 1KFKA 3WLIA 1YTDA 2D69A 1P48A 3W53A 2J9YA 3W7EA 1P6BA 5A8MA 4YTUA 3MCOA 4FOJA 3M47A 4O12A 1UP0A 2VOMA 1ZRQA 2O9OA 1QOPA 3ZSSA 1KB3A 1LWJA 1KBLA 3TN3A 3KEHA 4Q4MA 1JI2A 4G7FA 4GKLA 4ZL1A 3WX7A 3MWAA 3VILA 1NOFA 1XV8A 3BOXA 4FNSA 1YPXA 2C71A 3UPMA 2Z6IA 1YW1A 1PBGA 1XWYA 2YSWA 1V3JA 1ZAHA 4QS5A 3WK0A 4WLCA 3TAOA 4X3ZA 4N42A 4GIEA 3VINA 2E5DA 6PTDA 3NSNA 3OG3A 4HGXA 3DXIA 4JX6A 2ANUA 2ZIDA 3N17A 1WX0A 4AD5A 3II1A 2QLYA 4F0HA 1QNPA 2ZA1A 4GZ7A 1JPDX 3C2EA 4HNUA 2QCFA 1GNXA 2HROA 3RCYA 3L4WA 3NZRA 2G4JA 3ZIZA 2E5CA 4S3FA 3KRSA 1BVNP 4ZB0A 2XM1A 5D03A 1VBJA 1O5QA 5CXPA 3QBUA 1W37A 1XYBA 4R7OA 4HZ6A 2NQ5A 1CNVA 3ARUA 5C9WA 3NG3A 1VHNA 5I6SA 1QJWA 1MUWA 1WKEA 1VFMA 1F3EA 1JZ3A 1E4IA 2WJDA 5DFAA 1W2VA 3BLEA 3FOKA 1IXPA 1J8VA 1UQZA 1VAHA 1DHPA 4FX8A 4UTKA 4IWWA 1BF2A 3QOMA 4DXKA 3AIBA 4NYUA 3W72A 1I4NA 2WAGA 4WJ8A 2GDQA 1D8WA 2WW5A 4EK7A 1W1B1 3H7RA 3LI1A 3WFZA 1IZKA 4LF2A 3FJLA 1ZJIA 3U57A 1MQPA 4KCWA 3RGTA 3LPOA 3FK4A 3TTYA 4UMBA 4XBJA 4AWEA 2ACQA 3ABOA 1UJQA 3R43A 1PTGA 4UC5A 1MFUA 2ZYFA 3CUFA 4OFCA 3GVQA 4PUNA 1EJRC 4AVNA 1XBVA 3TK7A 1OHLA 1GONA 1SW3A 4Z17A 1ZQ5A 4MZYA 4RE2A 4V1XA 2VUNA 3TYZA 2J9XA 4D6IA 3B05A 3LOTA 2ZQ0A 5JXQA 2PU0A 1RR2A 1VRXA 4DJEA 3TZFA 2QCGA 3R4IA 4KPLA 4IQLA 4U31A 3LBMA 1TZ9A 1O7AA 3AZSA 3TU9A 1NM9A 3SBFA 1RUSA 2ACRA 3LLDA 1IXQA 2WMIB 3QYQA 4C91A 1JDAA 4RZ4A 5CZSA 4JX4A 4GX8A 3GS6A 4YVPA 3S1VA 4QEHA 3CV1A 1BVZA 1QO5A 4H7CA 4PZVA 3M44A 4WDUA 4O1EA 1JFXA 1WBHA 3BLFA 4F2UA 2VFDA 1AD4A 3HZ3A 4TVDA 3PAOA 5TNVA 5SWUA 1OFRA 4WGHA 1YNYA 5LIYX 1NOWA 3ARTA 2YBVA 2VCCA 3OBEA 3QMTA 3VFLA 4IJCA 4R33A 4HSNA 2WZHA 4KEVA 5FKYA 4AIBA 3WQ4A 4JBRA 4UWMA 2ISFA 1BQCA 5EBAA 1W56A 4E6MA 2VOTA 2G41A 2XVGA 1EX1A 3UXAA 3RAOA 4GKTA 4K39A 1PO9A 4DWSC 1DHKA 4UFIA 3CL6A 2OB3A 2ZXBA 3FA5A 4KF1A 1SZFA 5KETA 2BWGA 1HL8A 4PRRA 1TIMA 4QROA 4JN6A 1V3KA 1A4LA 3SAZA 3JRKA 4UMAA 3SIMA 7PTDA 4LH8A 1AW5A 3O05A 5K3VA 2GPTA 1F3XA 1LBMA 2C0HA 3QFEA 3WK2A 1PZ3A 4LSBA 4LPCA 3VMNA 3C86A 2XZ9A 3EGJA 3DC8A 2H9AA 4GH3A 1R3RA 2PRMA 3AMLA 1P0BA 1Y5XA 5LA1A 1QI4A 1W8SA 2VVNA 4H6RA 1E1CA 3WDJA 3THQA 1KWGA 4UR8A 5FL0A 1K02A 2XFFA 2J25A 3NWRA 1DE5A 4ICCX 4JIRA 2Y7FA 2X42A 2JGQA 4NKCA 4IHCA 4Q4QA 3PUGA 2O56A 4YTSA 3W22A 3GDMA 3RLVA 5A6TC 5FI8A 1CX9A 5HQLA 4AC1X 2UWFA 3MVTA 2DZPA 3Q58A 5JQ9A 3ITOA 2PWDA 1V7YA 4ACYA 3SSZA 3SADA 4P5UA 3GNXA 4BZYA 4YMZA 5LHEA 4YCPA 4QLJA 1KFEA 1J2BA 1I6NA 3M7WA 4ACZA 2A4AA 3ZVIA 2Z26A 4XBSA 3E0LA 4UQDA 1LUCA 1VFUA 3WSUA 2Y62A 2ZRWA 4AF0A 1RY8A 4YS1A 3T2PA 5JH1A 3HB9A 2GZXA 1DE6A 8XIMA 1EX5A 3IIOA 1RLDA 4U4MA 4K8GA 3W7HA 3NUKA 1HL2A 2BHZA 5MKGB 3AIEA 2POZA 3PBWA 2V3EA 1VFTA 3UVAA 1YMYA 3VK5A 3LMYA 3GG8A 4QAIA 5HANA 5D37A 1C9DA 1W5MA 1WZAA 1KM4A 3TW6A 4K8HA 3SECA 1CB7B 2OPJA 3FX4A 3NA8A 1OQFA 1IT8A 3FV9A 3PZMA 3AIUA 2GVLA 1J0KA 1W6TA 2A1YA 1Z6KA 4RNFA 1P7TA 3T07A 1EKOA 1A5KC 5DT5A 2VDGA 5TF0A 2JKEA 3RX2A 1H5VA 1E51A 1TWZA 2YCLA 3VOCA 4PEEA 3WQOA 4UQ9A 4HNTA 1H7PA 4OUIA 4F40A 3EOOA 1L6SA 1XRTA 3ANVA 1R86A 4CU7A 3EXRA 1YXYA 1HKVA 2PTWA 2GGHA 2TSYA 1QRQA 2XPKA 3VM5A 3WF1A 3G1RA 1X97A 3AIVA 3FW6A 3UG5A 5F1VA 4LCQA 3GDBA 1DWFM 1CI1A 1QI5A 3LLFA 4Y2WA 2AGKA 4GI6A 3VD9A 2DT2A 4L61A 2HE5A 1DJNA 4G56A 4EF9A 3QGAC 5F4SA 4KFPA 1GJPA 4GC4A 4L5ZA 3MCNA 4W89A 3W37A 3JZUA 3VDCA 1ME9A 4PE8A 4GX9A 3FAWA 2CWXA 3GHRA 3ECQA 4HYRA 1JPMA 1VS1A 2GGJA 5I7GA 2EPNA 3CS2A 1KV5A 2H6RA 1FP8A 4B4HA 5KITA 1UUMA 4HZ7A 4HB7A 2DJXA 3PB0A 2CLIA 4KEZA 4N02A 4H83A 1RAKA 4UFKA 3W87A 3TOPA 1E6SM 4KBXA 3RF9A 1WAUA 4A8LA 3AS3A 4A21A 4FIQA 4CEXC 1REQA 4W93A 3THDA 4V15A 2VVSA 3ZZ1A 3VAVA 1RA0A 2QT3A 3FJNA 1Z44A 2XJ7A 2Q01A 3GUWA 2OMAA 2XFYA 3M9YA 3UJFA 2OEJA 1SFLA 4K1GA 3CK5A 2C18A 3L12A 2UV8G 2ODOA 4HNVA 1NFPA 2YJQA 1L6WA 3AJXA 3WBXA 4WF7A 1WZMA 3W1RA 1GOXA 2DSUA 1PZ1A 4LS2A 1MO0A 3OZMA 2GLKA 2IQ0A 1NSJA 4Y9NA 4HNCA 2OCZA 3KZPA 2Z29A 1UROA 4AW7A 3ZVHB 4H4IA 2NX3A 1P1MA 3W6YA 3NZPA 2RGLA 3WLHA 2B7QA 4DN1A 1RD5A 3VGDA 3EKZA 2Z27A 4NNBA 4R7JA 4JIPA 1KLYA 4CCEA 2YA2A 3QW4B 2ZWZA 1HJQA 3DBPA 3LNMA 1EJTC 3CQ0A 3IK2A 5U7SA 3P3BA 2ZVIA 1IGSA 3BVJA 2XGIA 2A3LA 1EIBA 2L5HA 3UEQA 1PTAA 4MWAB 4K2SA 3VDBA 3PZVA 1NDYA 2A3BA 2V9DA 3P81A 1EBGA 2INZA 3B8VA 3FDKA 5I77A 4UTUA 4YYFA 5EMMA 5C2GA 3W7GA 5BZAA 4UTMA 2MUCA 6A3HA 1YTEA 1LROA 1UMYA 4FIRA 1AJ2A 2R1KA 3UZJA 2ZWYA 1UWUA 3MI3A 4GD0A 4DJDC 3WQVA 4B3ZA 2J78A 1Z41A 2I5QA 2WPGA 4G1NA 2OT0A 2OSXA 4LUJA 5JMUA 2EF9A 4EX4A 1AUSL 1V4YA 3NAVA 3VNLA 3W1NA 1GYMA 5M17A 3HA1A 3MSGA 1R3TA 3MP4A 3TVAA 3F5JA 2VQTA 1V51A 1UD4A 3ARWA 3N6QA 4BR1A 2OU4A 2PGFA 3ALFA 3KOXA 2V63A 2DT1A 2PLKA 4BFAA 1ZBVA 1UH2A 4PFMA 1HP5A 4C7GA 3PAJA 2WC3A 1A3XA 2ZRYA 4CCZA 1MQRA 2FZDA 2P53A 2AKMA 3R8RA 2PTYA 2F9RA 3VMPA 5CBBA 3L68A 3W81A 3BG9A 5C9UA 3VA8A 4CD5A 3WD3A 1S39A 4HN4A 3TYCA 2PDMA 4IFKA 3URBA 5A6BA 2OKOA 1E72M 5IXEA 2PD5A 2G4FA 1H5YA 3CZEA 3I3BA 1TV3A 4B9ZA 3G5EA 3AS0A 4S3AA 3OOQA 1EF3A 1XIIA 4R3UA 3TTSA 1LBLA 4GUFA 5HUOA 1RK5A 3H24A 1TRDA 3V7PA 3O63A 3QV9A 2EG6A 4OZOA 4BF5A 4ES4A 1Q65A 1E5JA 1Q6GA 3FXYA 3MMTA 4HNOA 1PHQA 1EO7A 2VFIA 2VEGA 3TTQA 3KVKA 2OOGA 3GLCA 4W9TA 2PLMA 1P43A 3C52A 3KLKA 1AK5A 3QPYA 4FNPA 3S5OA 5T9BG 5M3WA 5C54A 5AHLA 3ZM8A 3URQA 4CCDA 3SEPA 1XFBA 4IMDA 2YBUA 1VH7A 1MMFA 2D3NA 3MMUA 4G5DA 2O4MA 4YVXA 1H41A 2A85A 3RITA 1V6XA 4EOUA 3S42A 3IUIA 3GNOA 4LBUA 4IL2A 1XDMA 3QQ0A 2VC5A 4MNMA 4PBEA 3TXVA 4POCA 4IJRA 4QNEA 1AZ1A 2VC6A 3G0UA 4CUCA 1A3WA 5HULA 3PPCA 2PCEA 2JBMA 5FEWA 1BHGA 4S3JA 2PDQA 3W71A 1QNQA 1D2KA 3MWCA 1Y8BA 4EIVA 3HU7A 5LGZA 4L80A 4Q4PA 2Z1VA 2F61A 1ISWA 3S5YA 3LHUA 1DQXA 1R3QA 2PWHA 4GMEA 3UJRA 3N19B 4HNNA 5LA0A 3CTLA 4ZBCA 5EFDA 4DQWA 3HG2A 5XIMA 2WLZA 3WFLA 1H0GA 4R27A 4BWLA 3EDKA 2Y8VA 4IX0A 3UZZA 2CLEA 2CWNA 4UTTC 1UA7A 2YDSA 2JEQA 3G22A 1M6JA 5CEWA 2PLJA 1Q6FA 4HA4A 3SQSA 4P7OA 4D6GA 3HURA 4C6MA 5LNSA 4NILA 2GQAA 4NSBA 3OBAA 4M0XA 3RLUA 1JCTA 5BU9A 4QG6A 3VOGA 4DO5A 2ZUVA 4MWAC 5DXXA 2WYSA 1XD0A 4HA1A 4GA8A 3GKAA 3EXTA 1ME7A 3CASA 3CHEA 2C91A 4LW7A 2DH2A 2EQDA 4K8EA 2Y6ZA 4GFIA 1KM6A 1PE1A 2WB5A 3U3HA 3RUBL 3ONBA 3LS9A 2W91A 4O1AA 2WQDA 4EPEC 5H8MA 2PDFA 2VENA 2GL5A 1KRMA 4W84A 5HBFA 2P8BA 2PTDA 1TVLA 5CJNA 5M2FX 4XD4A 2HK1A 1M53A 5EYWA 1H1ZA 1IXNA 3GXDA 4IUGA 2G37A 2D2OA 4GIAA 3NPWA 3FCPA 5A6AA 4PBFA 1OG6A 1VBUA 4B5VA 2QCDB 1XIHA 2BHUA 2XZ7A 5T8GA 3EDDA 4ORIA 5I0DA 2WHKA 1RCQA 2EXOA 1RPXA 3IK4A 1YE6A 3P80A 1PYFA 3UGRA 4O1CA 4ZXLA 5HJYA 3S2CA 1KXQA 3CJPA 4GG9A 3QR0A 3VZXA 4QR6A 2C19A 4BI6A 4EWJA 1MEHA 4DUOA 4TX9A 3NGJA 2VDHA 2FVKA 4FSAA 2PBGA 4TIMA 2QYGA 3N12A 4NUWA 1XLFA 3EWCA 4H7VA 5CC6A 3TJXA 1UWSA 2V2CA 3EPNA 3A4WA 4PUJA 3IACA 2EG8A 1W2PA 1FHVA 3GK0A 3M0MA 2O92A 1TVPA 3TTEA 1W9BM 3H2EA 3T09A 2WKLA 3TNBA 1BXCA 4GVFA 4Q6JA 4QSHA 4YHGA 1K9TA 3WMBA 3PANA 4GQRA 1EEXA 1VBHA 4H9MA 4AZHA 1KQZA 2QKFA 4B4FA 3KP0A 3BQ6A 1J5TA 1V77A 2A3AA 2NUXA 4QAWA 2BXYA 3RJYA 2I16A 1TZ7A 2VFGA 3T40A 3CMJA 2ZCGA 4UB9A 1WYIA 2QDEA 5I09A 4ZODA 5I03A 4KERA 3UD6A 1ZFJA 4JX5A 3F4WA 4L4PA 4P8XA 4I6VA 1TSIA 4O8AA 1TUFA 4LVGA 2Z25A 4R9OA 3W28A 1NWSA 2VHLA 4X0NA 3B9NA 4KKXA 3PSVA 5FAGA 1F07A 2WLYA 4OHQA 4JQ3A 4W7UA 4LALA 3D47A 1BLIA 4DF0A 4MHBA 4DZ5A 3VDHA 4REQB 4LUSA 3EOSA 2VNCA 3CAKA 1E1EA 2HPMA 4Q7NA 3OB8A 3TA6A 2W63A 1ZCOA 1F9CA 1E6RA 1RSCA 3B8IA 4WRHA 5C70A 1I1XA 5CZJA 1IGWA 5CZKA 2IW0A 5E9XA 1T7LA 1SR9A 1NEYA 2TMDA 3WN6A 1LLZA 2VJXA 3U4AA 4ZQNA 4ZQPA 1XQKA 4H9YA 1EPVA 2D23A 4FXFA 2Y8KA 4MKSA 2C1GA 2GK1B 4PTMA 1PWLA 2GUUA 2RH9A 5A2AA 6TIMA 1NAL1 3K8KA 5BROA 1K7FA 4GJIA 4I7UA 4AUBA 4M56A 3VIMA 3M0YA 1LL7A 1OB0A 3RDKA 5BOOA 2XN2A 3GIQA 3QQ1A 1M7XA 4EE9A 3T2QA 1UR2A 3MDWA 3NQMA 2OYLA 3QMRA 2W67A 1GT8A 2R1NA 2PTZA 1WZKA 2C0AA 3WMSA 3AXHA 1JDEA 2D1ZA 2I56A 5GJPA 2NW0A 3CIVA 3HF3A 5DMNA 3IIVA 4MUPA 2IXVA 3EEGA 2E68A 1FWHC 3MHFA 1R5YA 1FTXA 3UWYA 4CNPA 2HBVA 4JTFA 4NZ5A 3MP5A 3Q37A 2OFJA 1V08A 2DZUA 1WBJA 1MXDA 1GOOA 3HQOA 1V02E 3AHTA 1G69A 3NGFA 1IEQA 3IIXA 5D2WA 4Q8WA 1FWCC 2OZ3A 4KRUA 2WMGA 3SGUA 4UTHA 2WMJA 1WXZA 3ZQ9A 4F2TA 2QQ6A 3MP3A 1XX1A 1UR4A 4S39A 4LTSA 1UYQA 3ZLGA 5AC6A 4LT9A 4M51A 4R7WA 3UESA 5CGMA 3PC0A 4EPKA 3DGRA 1V3IA 3LHVA 4A22A 4O4WA 5CAHA 4Y9OA 3S3GA 5AHIA 2Q02A 3TR2A 4PFHA 1O5RA 3MZNA 1YHTA 1NJJA 1R6WA 2FVMA 1WKFA 3L23A 3VABA 1G67A 2I5IA 2ASHA 4AWTA 3E38A 2VELA 2AL2A 3N4FA 2CZVA 4HHLA 3AHXA 5HWNA 5KEZA 2OG9A 5H8UA 4D8LA 1KC7A 2YOCA 2GUYA 1BYBA 4BQ4A 4WGXA 2WZMA 1H62A 1WDPA 3RN6A 3DYOA 4JR5A 3FEQA 1B5TA 1Q6DA 4Z0SA 3WH7A 1QNSA 1JCJA 4WY0A 2YCJA 5CKSA 3RM8A 5HJXA 3U5YA 2YA1A 3FYYA 2OWWA 4M3PA 3GO2A 4LUIA 1FVPA 5RUBA 4M19A 1RY0A 2VZSA 1BG9A 2WXDM 3GHSA 1W1A1 1TA3B 4NY2A 5FJOA 4O17A 4PUKA 5A6KA 1QI2A 5LIKX 3GDTA 2OTDA 4JN7A 1R30A 4WR3A 2AOSA 2FB2A 2OO0A 3NQ8A 4PEKA 3P82A 4A35A 3U2EA 2X40A 3WH6A 1YPFA 1K03A 3BAWA 1PCKA 3VD7A 1LQ2A 3V16A 1JCXA 1XGZA 2BS9A 3RLGA 3GU1A 3ZR5A 3G6MA 4RLIA 4RK8A 2ZRXA 1Q66A 1JCYA 4MIMA 2GUBA 3VC6A 2W92A 1KLZA 4J3TA 2XTKA 2VFFA 3CLMA 1V93A 5FA5A 1FBAA 1BXNA 3FGCA 4PUUA 1XLKA 2XGZA 1RHCA 8CGTA 1KM3A 1J0YA 4GCXA 4XB3A 4MZ1A 1ZHAA 1B3OA 4JFWA 2AKZA 3AMCA 4Z1CA 3K13A 1NDVA 2G95A 4NZ3A 2NT0A 3HFYA 4F48A 4ERIA 1LRTA 4LVDA 2V82A 3MANA 1X6NA 3C5QA 1SO4A 2FIQA 4PSPA 1UD5A 2WBGA 2PD9A 3SQLA 3TIMA 3OZYA 3W70A 1B57A 2CZDA 4RZ5A 4ADSA 2QJMA 1TPUA 2QCNA 2PPGA 4HIBA 2XH2A 3EWWA 4Q8TA 3N11A 3PUOA 3K30A 3BLKA 3OGSA 3T0BA 4EPDC 5I00A 4NL1A 3FJ6A 4AWSA 3HPFA 3AIWA 4INFA 1CBGA 1JYVA 1SU5A 4NNAA 1UH4A 1JZ7A 4HVXA 1MDRA 1J0ZA 2NZLA 1JF6A 1X1OA 2EPOA 3PBYA 1LWHA 3KCLA 2Z7GA 2ZDRA 3B8UA 3SQMA 4J3ZA 3QLDA 2GDVA 4ZOEA 4PCFA 2PP3A 3WBWA 4RDWA 1ICPA 3MO7A 4G8TA 4U2ZA 3H2NA 3VMOA 2DZSA 3O8AA 4DWSD 5ENLA 4MLRA 1EQPA 2CESA 2W5FA 4GNJA 3FLUA 3FAXA 2PURA 3G1HA 3WIJA 1ISZA 3K1GA 4ATLA 3TWAA 4B91A 1T8QA 3TDFA 2FZMA 2O9PA 1YDOA 4DWDA 4V2XA 3SY5A 3QZAA 3D0CA 2X41A 3E2SA 4O19A 1K4HA 1KM1A 3MV01 4JTKA 3SY8A 1OYCA 4AEOA 3DX5A 2XISA 3HG4A 4I7WA 1ME8A 3DERA 1E6XM 3LB0A 3GDLA 1Q7ZA 4H00A 4JTTA 1BGAA 3BQ5A 3OTRA 4MYAA 2B7OA 1IWBA 1KTNA 4XD3A 3UERA 4HSOA 1KBJA 3UNTA 1XR2A 1DOSA 2UY3A 1UB3A 2JEPA 3EOEA 3E5BA 4NRSA 2JE8A 3H2MA 4L1XA 3L2IA 1TPDA 1E0VA 3MI6A 1WV2A 3G0SA 2DIKA 3H54A 1Q4WA 1SZNA 3C2RA 4Y96A 3SRKA 3VPLA 3LPGA 4AVFA 2QW5A 3G24A 4Q4RA 1BXBA 3K8LA 5I24A 5F2IA 3IGXA 4L9YA 3VX1A 2YCEA 3F2DA 4JHZA 2A3CA 1GVFA 3ITYA 3QC3A 3TA9A 4AHQA 2YLAA 3GTNA 4LAOA 3LDVA 3WJXA 1PAMA 3DI0A 3KTCA 1GOKA 3S46A 3GWQA 3HQPA 3MSDA 4WXYA 1EWDA 2Z7KA 3OGRA 4YCOA 1TFVA 1H7WA 4Z2LA 2PA6A 1UQYA 4CNTA 2J7BA 3KTXA 3BZJA 2Z1XA 1ICSA 3OPSA 4PCTA 2FGBA 1DWAM 3GW0A 1KV8A 4S3GA 1WB0A 5C71A 1QPRA 1RK6A 1K8YA 1FXQA 4H9VA 3VE7A 3CWHA 3ABRA 1X7IA 3MJMA 3UPWA 1IT7A 5BNKA 4IPJA 1FXPA 2HXUA 2FJKA 1QBAA 4O1BA 1W3TA 3R6IA 4E38A 4HK7A 1CGVA 3TAKA 1YTKA 1HTIA 1OFQA 1YLVA 2QUTA 1XBZA 2QF8A 4JHOA 3KWSA 2D24A 4KMQA 1K8ZA 3T0TA 1EP3A 1UP3A 4D8AA 2Z00A 5U4NA 3QSRA 4GI9A 2DEPA 3BAIA 3STEA 1BYAA 4XISA 2GQ9A 3GG0A 4FR6A 3OLDA 5KINA 3S2JA 4D6FA 1UPMB 2NX1A 3U0HA 1B3ZA 3C0JA 4GZIA 2VQUA 4N4QA 3VNIA 2A5HA 3BANA 4EACA 4QSFA 4FEZA 2X1TA 3PBUA 3WJYA 1NFGA 2F6XA 4IXHA 2C1IA 3SURA 4MKVA 5G4HC 3LENA 4CNNA 5FF7A 2VGBA 3VX0A 5G1MA 2ZXQA 2OELA 5F2GA 2C16A 3W7KA 3ZR4A 4UCGA 2CLOA 4GY1A 3L2LA 4ZQMA 1AJ0A 3N6HA 4M7SA 5DCBA 3VUSA 2Q09A 3KVJA 3N73A 1UZ1A 5AFDA 1KFCA 3G8EA 4MY8A 2QAPA 1ONRA 3W7RA 2RHGA 3EX6A 3WLLA 1EA0A 3P84A 1E4MM 3K8MA 4TX6A 3MSRA 3VM7A 1PDYA 1ALDA 3EX1A 1WO2A 1B1YA 3WF2A 3KS5A 4IUOA 4WZHA 1A5NC 3WQ8A 3BH4A 3TX9A 1L2QA 2W6RA 4ZEPA 2D3LA 3MC5A 1LG1A 1WDWA 3OEXA 4LCSA 3MU7A 3WYZA 1K8XA 1QHPA 1HKMA 2X0YA 4BJHA 1SQ7A 4ZSTA 5CPQA 3H55A 1UZHA 3NOEA 2OODA 1PCWA 2B7NA 2PS2A 1E0XA 4O14A 5LKYA 1XLHA 3LSBA 1XLMA 1I2NA 1OD0A 2VX5A 5CSUA 3CO4A 1BSLA 3N34A 3KBVA 1EA9C 1EUNA 1FHDA 4L1WA 1PTDA 3MMDA 3AS1A 4H9XA 1XC6A 3OVGA 3MSYA 2PDYA 3WEZA 4YN5A 5D9PA 4WDTA 2ZA2A 1P1XA 1OGGA 3G6LA 3M0ZA 3MJYA 4O50A 3FA4A 2ZXDA 1AA1B 3V0UA 1EH9A 1A5CA 2PWUA 3K2GA 1UA3A 1C8QA 1XYZA 2IKHA 3A13A 3RIKA 3CV7A 4V33A 4L4MA 2WCGA 3GC5A 4B9YA 4IIGA 1LJYA 4D8ZA 3T44A 1DWHM 1FFRA 2X16A 2AAAA 1VYSX 1AL7A 3S5NA 4S3KA 4U5KA 1T99A 2E9BA 4ZFCA 2QUVA 3TSBA 3LLXA 3CUHA 2NQHA 1EXPA 3F4CA 1WZLA 3ZLHA 3DDMA 2J4GA 1WKYA 3EA2A 3AZTA 4LV4A 4DWSA 1F4HA 2PB1A 3LRKA 2YFNA 1QK0A 2CKRA 4GPNA 3AU2A 3GY1A 4AIOA 3IVUA 5E0KA 2GGIA 2QCCA 3E74A 2DJLA 2XYLA 1JGMA 1YKWA 7A3HA 3EDJA 1LT7A 2OLAA 4HQVA 2GQ8A 4Y7EA 2Z4GA 3OYZA 3GBDA 4DJDD 3MKKA 4I6KA 4UCFA 5C8BB 1FWRA 1F76A 1S46A 2Q3OA 2G97A 4ZQCA 4JDBA 3CH9A 1I2PA 4FLOA 2BY1A 3OLGA 3CNYA 1QHZA 1FCUA 4JEQA 3ANUA 2GVYA 1XP3A 3B9EA 3RPDA 1XH0A 5D04C 4K68A 4BF7A 4NIRA 2YW4A 5I3DA 3NCOA 3H4XA 3R0DA 2XGBA 3A9IA 3BSHA 2D0GA 1DJYA 2HBXA 4RZBA 4MFDA 1QASA 3N14A 2ZRUA 1OD8A 4WSKA 1KGUA 2PDCA 2R8WA 3PG9A 5ECUA 3W7LA 3S6TA 1DWIM 3TOYA 3AUOA 4GQGA 4FF7A 4I8DA 3NO1A 3PR2A 4V1YA 4O1DA 2V8ZA 3TKFA 3C3UA 2XIOA 3UR5A 2V5LA 3UR7A 1IR1A 1X8CA 5D02A 4X2RA 3LEPA 3T0AA 2PGEA 4JICA 1P0DA 4HBKA 2BVDA 2V5JA 3USZA 3EDFA 1GG1A 1FH9A 1MEWA 1O5XA 4QG9A 1XPGA 3P93A 1B9BA 3S83A 3CPUA 3KL0A 3H23A 4JGDA 4EXQA 1JDDA 1PPIA 4JL2A 1DKWA 5J04A 3VDAA 4PMVA 1JQVA 4H9UA 2AMXA 3U8GA 3CHFA 5FJJA 2QHAA 3F4NA 4KQNA 2VZTA 3A6OA 4X61A 3HV8A 5EMUA 1V6YA 2QJGA 1DJXA 4O0QA 2NXHA 2E77A 4CNOA 4LVBA 5D8WA 1VHCA 1QW7A 3BV4A 4TTUA 4A4AA 3N2OA 3LNPA 3G77A 4B90A 4UUIA 4GLEA 1U5HA 1V3HA 1XHGA 4IICA 2VWTA 4JIQA 3NL6A 2ZKMX 1X98A 3W23A 3W1UA 4CGTA 2PDKA 3FVDA 3IJIA 4JIIX 2QJJA 3U7VA 4QE5A 5AC5A 3N29A 4M24A 4L9ZA 3V4BA 4BA0A 3L5LA 3RO6A 3S1GA 2FLIA 2NVCA 1XW8A 3WQ5A 4ZE4A 3AISA 2DUAA 1VP5A 3FHAA 2FHBA 1LYXA 3I7RA 1UIOA 4YTTA 4HT3A 4H2CA 3B9DA 2EHHA 4TX8A 4EKJA 2VTFA 3GW3A 3UU0A 5D2XA 3LX9A 3P0XA 1MYRA 1E55A 3T05A 3POHA 3EWZA 2WMIA 3AU6A 1ZSXA 2X1IA 3RRXA 3B97A 3QV8A 2YB4A 3A3HA 3LERA 3I6RA 1XG3A 3WBEA 3JW7A 2FHCA 1CENA 1KM5A 1JDCA 3M0JA 1W9UA 4UR7A 3LTPA 4U28A 2BOFX 4JIEA 4GFSA 1WDRA 2GFTA 3QRHA 4HSHA 5HDRA 3N04A 4MY9A 4PMYA 5A8NA 3SUWA 5AHMA 4Z0JA 1W1VA 2JFEX 1O68A 4YHEA 2INFA 2Y88A 1U22A 1K3UA 2I5GA 1LQAA 2WC7A 3PZGA 1KBIA 1R85A 3IJQA 4GNVA 4MWAD 3UETA 1CGUA 1G4SA 3H53A 4AH7A 4HPHA 2WC4A 1J18A 3P2VA 1TB3A 4JPGA 2FFCA 1NF7A 4HN8A 1JUKA 3PZOA 4W85A 1EWEA 1YDVA 2HK0A 4IXXA 1LOQA 3BO9A 5LYRA 5HATA 1HF6A 3CC1A 2WSPA 2ZX9A 2OR2A 4C65A 4H41A 5JVLA 3B8SA 3RPTA 4B5TA 3W24A 1K9DA 2VO5A 1FKWA 5CG7A 4LY8A 1H11A 1VYPX 3JR2A 3C2VA 4C90A 2I14A 2QCHA 1L8NA 4CLMA 3UQNA 1QR7A 4Q8NA 1PWMA 5J8LA 1XXXA 1BGGA 1VLIA 4MB4A 3WQ6A 2TPSA 1XBXA 4KEUA 1CXLA 2XIQA 4F0RA 4GUJA 1DXFA 3EX4A 1H7OA 3UZYA 2Y7DA 4MGGA 1I1WA 2PWVA 2YCKX 3KE0A 1B0IA 1IWPA 5D2VA 3VNZA 2OSWA 3O0KA 3WFAA 3POCA 4KIRA 4LBRA 4Q32A 1GQKA 2BP1A 1FWWA 4Q8UA 1LP6A 1H1NA 2WMFA 1SUXA 3VOIA 1E15A 5C2XA 2ZC1A 3O07A 3FXGA 1F8IA 3UR8A 1EIXA 5G4EA 4RPQA 2P5NA 3BK0A 1E71M 1F05A 3QTPA 2O9TA 3NQ7A 2WNNA 3L65A 3WBAA 3VIHA 4PB5A 4MYXA 4HK6A 4MVAA 2XINA 3LI0A 1GQIA 1LWIA 1M03A 3T1GA 1KRBC 5E5CA 4OBSA 3C8FA 4M6VA 3R2GA 2E25A 1Z32X 2OLSA 4M82A 3R12A 3TN5A 4DJDA 1EDQA 2FFIA 3W73A 1M5WA 2VD8A 3RPMA 3URNA 1TJRA 3S8HA 1X1ZA 3N6JA 4QGCA 3CUXA 2GSJA 3QSTA 2BVYA 4C5YA 3W2MA 4A6GA 2RDXA 3ABZA 1GQNA 4B92A 1DV7A 5MKGA 5A6JA 3HJEA 3CQIA 1J01A 1ZY9A 5FEPA 1AG1O 5CC3A 4Y6GA 3TC3A 4R85A 5IHSA 4DNHA 2HS8A 2LLEA 3IJ7A 1Q2RA 3NPUA 2W66A 2P3ZA 5D09A 5DRIA 4D72A 4QM1A 3V75A 3WLQA 2E8YA 4QRNA 4ENLA 1RALA 3BLIA 2GJXB 4Y9PA 5DMLA 3R58A 4I5XA 5D9NA 1ELSA 3P0WA 4DLMA 4WOQA 1J96A 3OO2A 4KESA 4XAYA 2NUWA 5F7UA 3WUGA 1XIGA 3UW6A 4NAEB 2A79A 2BG5A 1EL3A 7ENLA 3GHTA 3DC0A 3CPGA 3MKVA 4H8UA 2GOUA 3FY1A 1UWRA 1NY1A 4OVXA 3UYCA 1O6IA 1LUCB 4J4KA 2ZICA 5G1TA 1H0IA 1I0BA 5BXSA 1JDFA 3V1HA 4UQBA 1W5QA 1PIFA 2V3FA 1RA5A 3ONCA 4US5A 3P8IA 2PGRA 1E9YB 3CHVA 3P6LA 3W1PA 4GYJA 2CBIA 4PMNA 1UH3A 2BHYA 4NZFA 5I06A 5D05A 4IGSA 3KDNA 2Y61A 3QHOA 4F3HA 3HPSA 3RYSA 3L4YA 4JTCA 3THCA 5C9ZA 3S1WA 3NDZA 3ZJ6A 4LAUA 3W6LA 1XIMA 3U7BA 4AB4A 1MXGA 4P8WA 4HJFA 5L9FA 5K9XA 4C6NA 4DY1A 4O28A 1K9EA 4TQTA 3PTDA 5BMWA 1XIDA 2Q8LA 2D0FA 3KDOA 4ZO6A 2C1HA 1U2YA 2KX9A 1P7TB 3TFCA 3IEBA 1D3GA 3VKCA 1WDQA 3GNDA