4AX6A

Hypocrea jecorina cel6a d221a mutant soaked with 6-chloro-4- phenylumbelliferyl-beta-cellobioside
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
363
structure length
363
Chain Sequence
b'TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOGLUCANASE 2
publication title Rational Design, Synthesis, Evaluation and Enzyme-Substrate Structures of Improved Fluorogenic Substrates for Family 6 Glycoside Hydrolases.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
total genus 127
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4ax6A00
2BOGX 1TMLA 3RU8X 1HGWA 1OCNA 1UP0A 4AU0A 1QK0A 1GZ1A 4B4HA 1OC5A 2BOFX 3ABXA 1UP2A 4AVNA 1OC6A 4AX6A 1CB2A 3VOGA 3VOFA 2BVWA 1QJWA 1OCJA 3RPTA 1QK2A 1BVWA 4I5RA 3VOJA 1UOZA 1OCBA 3A9BA 3VOIA 4A05A 2BOEX 4AVOA 2BODX 4B4FA 1HGYA 1DYSA 1UP3A 4I5UA 1OC7A 3A64A 4AX7A 3VOHA
chains in the Genus database with same CATH superfamily
1Y5WA 1S2WA 4H8NA 3NDZA 4HPJA 4S3FA 3UJRA 3IIOA 1H60A 4NT0A 3ARUA 2Y5EA 4RJEA 5BOOA 1VFOA 1YHTA 4TU1A 4N9DA 1KBLA 4H6EA 3OBEA 2VDIA 2XUCA 1QMLA 3W27A 1VD6A 2CWXA 1R2TA 3KVLA 4CUCA 1GKQA 5EBUA 1UA7A 2TAAA 1P6WA 4CCCA 5FJPA 1PKLA 2PBGA 1GHSA 1MUMA 4UUIA 1MZHA 3P74A 1BWVA 5FJJA 1DIDA 1BKHA 4N6EA 4DBUA 3TW9A 4HPGA 3ATYA 1TPH1 1K8XA 1CECA 2YZ5A 1QUMA 4G7FA 3EA3A 3PBUA 3UF9A 1YYAA 3OVQA 2JE8A 1B3YA 1FXQA 2FTYA 1Y5XA 3GR7A 5HAOA 2XFRA 1W1PA 4LB3A 3B8SA 5LGZA 3SRHA 3TMLA 5C9RA 1GONA 3NZPA 2RH9A 3KOXA 1EYWA 2QCDA 3BZGA 3KW3A 4MWAD 1Q2RA 2EPLX 3REQB 5M3WA 4QLKA 1OFEA 3CU2A 3NXLA 5AHIA 3OHIA 4K7YA 4NP7A 1U2YA 2AL1A 1C29A 3N9SA 1J9YA 2QJMA 3AHZA 1ZSXA 3BAWA 3W9ZA 4X3ZA 1CXKA 3TOYA 1Z9AA 3GNOA 1E1EA 4ADUA 3REQA 4BI7A 3EWZA 3LSBA 4CNNA 4MWAE 2HK1A 3SY1A 3DI1A 1VLIA 1IEIA 4LAOA 3UD6A 3SCOA 1C91A 1UOKA 2F6KA 2HISA 2X1RA 1DE6A 2OT0A 5EMYA 4QS6A 3CUGA 4N9CA 3QW3A 4GY7A 4UFHA 3PZNA 1I1WA 1Q5MA 2CNCA 3I6TA 2JIWA 2VI0A 5CAKA 2ZRZA 2VEIA 3AIWA 1O95A 2IPWA 3W26A 2HVOA 3LMZA 3S2LA 1QW9A 4FF5A 5CGQA 2P8BA 5IFPA 3HPZA 4Q4SA 2C1GA 4YVXA 2YCLA 3CV6A 1XLLA 2Z00A 3S9ZA 4JTSA 3V5FA 3CO4A 4HK5A 1IIHA 3E0FA 5I79A 5JQ9A 1D7FA 2AMGA 1H7PA 1AL7A 4GNJA 3S9YA 3TXZA 3N25A 1P7TB 1V6YA 2C71A 4C7GA 3UU0A 1E70M 4QSFA 5L9FA 4M5PA 5AC5A 1XLHA 1EGMA 1W37A 3EXSA 3W85A 3OVGA 2YSWA 5D9NA 3GDRA 2X16A 3B9AA 2W91A 1LRQA 2RJGA 4S2CA 1NWRA 1QNPA 1P7TA 2XIQA 3WNOA 2WBKA 1S2UA 5JH2A 1LL6A 7REQB 1E0UA 5C0QA 3IIZA 3VIHA 2INFA 1TX0A 4CEUC 3QC0A 4TMBA 4AWEA 3KBMA 4B15A 5D9OA 5I3GA 3MUXA 1NWSA 3WQVA 4LGXA 5CJNA 4LTSA 4MHBA 2YDQA 2WWCA 1PKMA 5CKSA 7REQA 3WBYA 2WCAA 3TSMA 2B31A 3UW6A 3MP3A 2PBOA 4WSHA 4HMCA 3MBDA 4HIBA 2RJHA 1NFPA 3W1QA 4D1JA 4OTKA 4RPQA 1AW5A 3V4BA 2Y4SA 1NELA 2EPHA 2X7VA 1FRBA 4H2CA 5BNKA 5CBBA 4KERA 3GX9A 2VZUA 3NQEA 2VKZG 4GIAA 4NZJA 4HJFA 1FHVA 4IFOA 4HHLA 5LGXA 1O5RA 1GG0A 1QTWA 4TO8A 3L65A 5HPOA 4GNKB 3RPMA 1UP3A 1T7LA 3HPFA 1KBJA 4GHRA 3U4AA 2VELA 3OEXA 3G8RA 4JTFA 4KCTA 4GKLA 2XIOA 4A4AA 2GSEA 4AYGA 2BASA 4GBUA 3M5ZA 3DYPA 4KFPA 3LXAA 2F2HA 3VILA 3WD1A 2WSRA 5M03A 1FH7A 2F84A 4KF1A 3M4HA 3NO5A 4X0VA 3OG2A 2C13A 3N2XA 4OOZA 5HANA 3BK0A 1PJ9A 1U1JA 1GJUA 3MSRA 1HF6A 3NG3A 4IIBA 3BURA 4H04A 4TR9A 4RE2A 4AWUA 4I6KA 4AZBA 5FJTA 1M6JA 3VNZA 3R1ZA 4IHCA 2J8TA 5GNZA 2V3FA 5C8BB 4ZMGA 3HG3A 2ZXDA 3EA1A 2ALDA 2MUCA 2ACRA 3OZOA 1JJKA 3B8IA 3GHUA 3RFAA 1GJPA 2ZX5A 4A05A 3PULA 1AMKA 2DV0A 1NIUA 7CGTA 3MI6A 4FO4A 4WKAA 4P2VA 2V5JA 3W7JA 3IUDA 4LNCA 3M0IA 1A0CA 2PMQA 1EIXA 7A3HA 2V0TA 4QS5A 1KGWA 2Y0FA 3V1HA 4J28A 8TIMA 4W84A 3TX9A 1A5SA 3ELFA 5G1YA 2OSWA 4GIYA 1OT2A 4WVXA 3SGGA 1WBJA 3MQTA 1H11A 1YTEA 4N42A 1A5KC 4JHOA 4LB4A 2QF8A 3TYBA 1JYNA 5D05A 2D1ZA 4WGXA 4MB5A 2E5CA 4LV4A 1OADA 2BNJA 3IRSA 3TOPA 1UA3A 3LRLA 5LNRA 1YADA 1XLKA 3PTQA 3BG9A 4HNTA 2A2IA 4Y96A 3THAA 3NZRA 4OU1A 3O7UA 4FLQA 4A3YA 1JFXA 3MMDA 2XN0A 2PTXA 1Z6KA 4M51A 3W1NA 5FEPA 1S2CA 3WFAA 3STPA 2QJJA 2WVSA 4BF7A 2Y5JA 3PPHA 5F2LA 4MY8A 1BF6A 2ZUTA 4KFNA 1IWBA 4WXYA 4Q4RA 3CPUA 3W7LA 4FLOA 2G96A 3R43A 5AVHA 3T1GA 1DQWA 3VVGA 5CLTA 1TV4A 4JL2A 3TNBA 4DQWA 1KCLA 1E0XA 4Z1YA 1U1UA 2WZMA 1VEMA 2QPSA 4OFCA 4UTHA 2VGFA 4KH2A 4QCFA 1RD6A 3AO0A 1V8EA 2BDQA 2HK0A 4G1KA 1E51A 1UUQA 4XIMA 2GVYA 3ZM8A 1O5XA 5FF0A 3MKKA 3KBNA 3HQ1A 3W7NA 1EJWC 3N2MA 4OWGA 4YS1A 1ODZA 3WD2A 3F5KA 1OG0A 4MTVA 3PBGA 1TWIA 4MNJA 1UPPA 1I2OA 2E09A 4G9PA 4NZCA 9CGTA 5FAGA 1L8NA 4HK6A 4L4OA 4AZHA 4R9OA 2CBJA 1EGZA 2VURA 4TVDA 2BGNE 2Y8VA 4AZ7A 3LV5A 4R7JA 4RZ6A 3PFRA 1MEHA 3S8HA 1XIGA 4QDPA 5A8QA 1Z32X 1AJ2A 2Z0IA 3HJEA 3MC5A 3RLHA 3I7QA 1S5NA 1J01A 5DCBA 3T7VA 1XIIA 2VWSA 4W86A 1GPWA 3AROA 2E8YA 3JU2A 2YXGA 4BQ2A 1IXOA 1NFGA 2GJPA 2RDTA 4DY1A 5AHLA 3KRSA 1D2KA 1TPB1 2Z2UA 4PYSA 3JW7A 3ZVHB 2FPYA 2Y8UA 4OUEA 4KCVA 2X0YA 1ADOA 2FJKA 4UR9A 2PF0A 2D24A 1X7FA 3T8LA 1L6WA 1MYRA 3O6DA 1E6QM 1GUVA 3TP4A 2V2HA 4BJHA 3W70A 2XSAA 4AHOA 3ZVHA 5KZ6A 4QE4A 3AISA 3H7UA 2YCEA 5DEZA 4B5TA 4UCFA 3W28A 4AIBA 2ISVA 5D02A 3ABRA 4IMDA 4CN4A 3EDKA 4QFUA 1J18A 3AMKA 2ZTJA 3UR2A 3EAUA 2WM0A 1V03A 3WJWA 1FDJA 4Y7EA 3W07A 3OJGA 4JQ2A 4F3HA 2QIWA 6PTDA 3T09A 3SCTA 4R33A 3WH6A 5I09A 2AKZA 3RGTA 4DPQA 2OEMA 1TPDA 1NDYA 1H0IA 3E5PA 1BF2A 4H7ZA 1P48A 3WDRA 3TWBA 3AIVA 1HJVA 3H2AA 1JDAA 4JNZA 5C9ZA 4R5EA 5EY5A 4RE0A 5BXPA 4EWND 4O1BA 3B0PA 2V2CA 3BPWA 3RAOA 4OE7A 5KITA 4QLLA 4TVCA 1ZQ5A 4NX0A 1K9DA 2EPNA 4BCEA 2WWDA 4A8NA 3E0LA 1UWUA 4JQ1A 2OLAA 3LYEA 2FHFA 3RX2A 4XZMX 2NT0A 3N04A 3TYUA 2R1LA 5A69A 3LI1A 4IIFA 1QPNA 3F03K 1KWGA 1J2WA 4JFSA 4LVFA 2E5BA 4NNAA 1I6NA 5PTDA 3TA9A 4GX8A 1RY8A 1LOQA 4WDTA 4AY7A 1KXVA 4K6AA 3K8MA 1A0EA 4LV9A 3VIKA 1TR1A 2HNEA 4GYPC 1VIWA 1ZLPA 3FAWA 1E3ZA 1BAGA 3PWIA 2QAFA 2PU0A 1B90A 3G3DA 4YLWA 3S0CA 2EG7A 4ERAA 3CT7A 3SY5A 1NAL1 3LRKA 1DWGM 2NVDA 1DWFM 3CUXA 4YNGA 5T8GA 1ZBCA 6REQA 4P8UA 4GYKA 4TVUA 1BKSA 1V3MA 2IQDA 3DFQA 3XINA 2KX9A 1M1BA 4WCJA 3LTSA 3SCUA 2OWXA 2JIEA 1NP2A 1WB0A 3OYZA 1TZ7A 1XKYA 2FLIA 3ABZA 3G3MA 5M2FX 2E6FA 2OQLA 4LCQA 3L21A 1QBBA 1IZJA 2ZE0A 1HKKA 1EQPA 2YW4A 2ZWYA 2JEQA 3QQWA 4UMCA 1A53A 3GDBA 1MW2A 1HO4A 5CLWA 1KLYA 4DJDD 1V3JA 5DT5A 1ZAHA 4GCAA 2PAJA 5LNUA 3DYMA 4ICNA 1YPXA 3G1SA 3GNNA 5EMKA 4GI8A 2OJPA 1DJHA 2PSNA 3G1VA 4EAYA 3WDQA 1TPVA 1FHUA 3HIJA 1GYMA 3B3DA 3L4VA 3FFSA 1VLWA 3UT0A 4Z2LA 4DYKA 2HBXA 4WR3A 2X2GA 2B81A 2XTKA 3KEHA 4MFEA 3EX4A 1EPXA 3MZNA 3P14A 2PDKA 1AMYA 1RLDA 2NV1A 1VYPX 1H7NA 1RUSA 1L9WA 1F4AA 1ZS2A 2D3NA 3O0KA 3ZLFA 3L0KA 2ZZ4A 3E2SA 3M0HA 4KMQA 5A6TC 1EO5A 4HSHA 3SCRA 1I2PA 5EMMA 2V2DA 1UD8A 4JBRA 5C9UA 2CHRA 3VD3A 1OZMA 4I5UA 4ZQRA 2J13A 2XZ7A 3C8FA 4NZ1A 4JTHA 2AAAA 1QHPA 3W24A 1J2BA 3THUA 2NUWA 4WX2A 2DZXA 1FCBA 3NQ2A 4UFIA 5HMDA 4JFWA 3EDDA 4H9ZA 2CITA 2OOFA 1XS2A 1FKWA 3LM7A 4OV9A 3BCJA 5D8WA 1JUEA 1GK8A 1GOOA 3PTMA 4L6OA 3NZQA 3U8GA 4JN6A 1BG4A 3TN6A 1HN1A 1TWSA 4JTIA 1C90A 1TWWA 1S5TA 3ZOAA 3GE7A 3DCPA 2DZSA 2CIPA 3H2OA 3MUZ1 4K7VA 4S2BA 3T8QA 1R9XA 2C19A 4IPJA 2A3CA 3VOHA 2BGSA 4WJEA 3RYSA 1TUFA 3UCCA 3T55A 3R0KA 1LUCB 2NVAA 3GB6A 3SFKA 3WFLA 2ZYFA 3BV7A 1RCQA 3W01A 2WCGA 1LQ2A 4S3BA 1E6SM 3TA6A 3CAVA 4IIGA 4KETA 3MJMA 2FGZA 2GK1B 2ZA2A 1CW2A 2PTYA 3L4XA 3LS9A 3T2OA 4K38A 3URBA 1MNSA 3MO4A 4JN8A 4RPPA 1L2UA 1OX6A 1LUCA 5E6ZA 1GW1A 1PL9A 2X40A 4BQ3A 3WQWA 1LL4A 2ZZ3A 4MFDA 4JIHA 4UTTC 4ZB0A 1EWEA 4FI4A 3CEPA 3ZT5A 1KB3A 2GK1A 2A3LA 3WF4A 2J9YA 1WKDA 4DM1A 1EX5A 2VZTA 1EJXC 4Q22A 2V81A 4AVNA 5C2CA 3W83A 4R88A 3GNRA 3M0JA 1A5LC 1UD6A 3LERA 5LKYA 4Q8NA 1P0NA 4AZ6A 4GYJA 3MUCA 1G0CA 1X7IA 3PFMA 1KQYA 4J3UA 1W9BM 4GE8A 2D69A 3S2MA 2R6OA 5A2AA 3TR2A 1MW3A 4YHEA 4AYSA 4QGCA 5EU9A 4IIDA 3NPUA 1UQYA 3WF3A 2F61A 4TTGA 2WVVB 3TTQA 5F4XA 4HBKA 3LD5A 5KTLA 2CZDA 2XH7A 2O7SA 4P7RA 3CPRA 5AZ0A 2ZZ5A 4JR5A 1V6TA 2ZXBA 5E09A 4YVVA 7PTDA 3I3DA 3BANA 4IUGA 2F2KA 4GQBA 1XJBA 3B40A 3MUIA 3N29A 2XHYA 1XPYA 2FPTA 4ZE4A 3DFPA 6XIMA 2WVVA 4E0CA 2V5BA 1OG6A 2R1NA 3A5VA 3USZA 4UNLA 1RR2A 4AU0A 4BWLC 1VBHA 2PFHA 1QRQA 4JTAA 3WIJA 1H1YA 3LCWA 2A0NA 4QLJA 3GS6A 2QMJA 2ZUVA 5D2YA 2I56A 1T8QA 1V79A 1FWTA 3AXKA 1VRDA 2R91A 4JTLA 2XYLA 1ZENA 1Q2SA 3EMCA 2PDUA 3TXVA 3OPSA 2P8CA 1W3KA 1DV7A 2ZUSA 9RUBA 3BGJA 1GJWA 3NQDA 2NQLA 2ON3A 3BLFA 4UWMA 2PPGA 1ZJHA 4YXGA 1P6BA 4YJ5A 4D6HA 3A9BA 3KZSA 5A8MA 1UMLA 3UZ5A 1D7KA 2WNNA 3GYEA 3VUPA 1V7AA 4C6MA 3FNDA 1LOLA 1KC7A 1W5PA 3KUMA 3M16A 3RO6A 5CGMA 3KOFA 5F2GA 1QOPA 1IXQA 3DBNA 4Y90A 3EB4A 1G7VA 3A13A 3C5QA 3VIOA 3ZVIA 4EKJA 1X38A 4HT3A 5C6MA 3NQAA 1LG1A 1XSJA 1AZ1A 4YIWA 4HK7A 3E5BA 5IM51 4PRRA 3UA4A 1QO5A 3AQUA 1H2JA 1VHCA 1CXHA 3I3BA 1HJSA 1FUYA 2P53A 3ARSA 4A2SA 4I8YA 1HJWA 1MQRA 1O1HA 4PTXA 3IAPA 1F05A 1M01A 2C91A 3CL8A 4C6DA 3RK8A 3O6CA 1R3YA 4B92A 2I16A 4FIRA 3BLEA 4RL3A 2OXNA 4Y9PA 5E5CA 3ZZ1A 5FCZA 4RNHA 2XG9A 2FB2A 4PC8A 3C0LA 3JUGA 1E56A 1K6WA 2ACQA 2IKIA 1BTCA 3BARA 1LBMA 1JPIA 4OT7A 2GSJA 1AQFA 1R3WA 1ZGDA 4K39A 5DLCA 3GUWA 1NARA 3H24A 3DBPA 5K3VA 4DWDA 4W7VA 5EKYA 2W4XA 3LCXA 3THQA 5I7GA 3MDWA 1Z44A 2VJXA 4ZGYA 2DT0A 2R94A 3UZXA 1ITXA 3E38A 4M56A 1W1VA 4O0KA 2JGYA 1BSIA 3W37A 2YDSA 2DORA 4R3UA 1R3VA 1TREA 2WAGA 3WJYA 4CU7A 4UXDA 4CNTA 1XYLA 2I57A 3GZ3A 4MLRA 3FDGA 1UWTA 3VGDA 4GXMA 5E1QA 1ME9A 4GIRA 3MP5A 3MO7A 1XLDA 1IR1A 2V5CA 4FA3A 1JCYA 4ZODA 3W7MA 4L61A 1RQBA 3T2QA 1XHGA 3N2TA 1KRCC 3ZJ7A 3SCQA 2ZE3A 4D6IA 1FWHC 2PDQA 1BGGA 4YTRA 3E1F1 1KO0A 4DEFA 1F3EA 3KLKA 3QPZA 2BXZA 1YPFA 1NDZA 3MMWA 1X6LA 3VABA 4M6PA 1W1ZA 4PUNA 3H7RA 4H9XA 4CCZA 3F1QA 3LM3A 3AUJA 1NOUA 4RXGA 5DMYA 1UR8A 3QY8A 1EJ7L 2YA0A 4IQJA 1RD5A 2ZDRA 1RQEA 1E0WA 4IG2B 1QVBA 1FWBC 4LT9A 2J6VA 1SO3A 1PCKA 4L7ZA 2PLJA 2YA1A 1IT8A 3OLEA 4XZHA 1JZ7A 3W7RA 1OYAA 1V0KA 1H63A 4K68A 3S1UA 4TQTA 3S2NA 1UC5A 4NAFB 3EOOA 4WOQA 4PUWA 1VPXA 4Q4QA 3KBWA 4LJ3A 4IG2A 2FVLA 1BXNA 4ERGA 2X1IA 2DJLA 2NW0A 1B2YA 5D33A 4ZXOA 4S3KA 4B5XA 2ESCA 3CUIA 2D20A 3VX1A 2EAWA 5F4WA 4JDBA 1VENA 5TBOA 4L4LA 4NAFA 3MDUA 5HMSA 5BOEA 1EP2A 3PJUA 1R85A 3SQMA 1VJIA 4WF7A 3VI2A 4B4HA 2Z7KA 5FAJA 3NA8A 2UZ9A 3WO8A 4FX6M 4IGSA 1AH4A 2QDEA 2AMXA 3DI0A 4NJGA 4O8RA 3NQGA 4CVWA 5HXMA 3GAKA 3S6OA 3HMJG 2CLLA 4FNUA 1SMDA 3GM8A 3WNMA 3ZQ9A 1CX9A 4WRHA 2F9RA 1R7OA 1Z8AA 4M82A 3GW0A 3LU2A 3CH0A 3D5HA 4DNHA 4GPNA 4QG8A 4NRSA 4B5NA 4AX7A 4S3AA 4KRZA 3ZJ8A 2WZIA 4R27A 1MQQA 1Z3NA 1TTIA 5EA9A 3STGA 3AALA 3DHUA 3ANUA 3AZSA 3DUGA 3LX9A 2V38A 3RLGA 1EX1A 1M03A 3Q58A 2QV4A 3RU8X 1WDDA 4J27A 3FKKA 1B0IA 1CLVA 1HKJA 1WXJA 5BXRA 3NQMA 4H6RA 4HPXA 1P0DA 4UR8A 3AYTA 4PMRA 3WLKX 3WQOA 1XUUA 3HFTA 4LOCA 4P7QA 1MUCA 4JTEA 3UYCA 4S1FA 2ABAA 4K2SA 3MSYA 5HJXA 3VAVA 3E0WA 2GWGA 3H53A 3POHA 3OB8A 3CZEA 1E9IA 2ATSA 4AUBA 1U5JA 2ZA1A 3IVSA 3N12A 3NJ3A 1WE5A 5B7YA 2C6QA 1KR0A 5KEZA 3UXAA 3TSBA 2EQDA 4ZB5A 1J0IA 1Q6CA 3QZAA 3G22A 5LSMA 5CEWA 3ITTA 4L56A 1BVNP 5A6LA 4ZSTA 2BY1A 3AYVA 3EPMA 3EYPA 4O1FA 3R6IA 4NJKA 1F5ZA 4QHRA 4AY8A 4GRSA 5C9WA 1TUXA 2GUBA 2Z25A 1EXBA 2ZICA 4J3TA 1V0NA 3D0CA 1UZDA 4IPIA 5CPQA 3G1HA 4NSBA 1QI0A 4HMEA 4D71A 4ZXLA 3UQNA 3DFSA 3KOYA 2UY3A 2XPKA 4L9YA 3BXWA 1GOIA 8XIAA 4YYCA 4O12A 1JGMA 3NTYA 1XX1A 1KRAC 1RA5A 2FFCA 3IS4A 4UOZA 1LTDA 1UMYA 1XLGA 3FHAA 1F74A 1E4IA 3MUAA 3LNMA 2BY0A 4F0HA 2VFFA 2Z27A 5IBXA 3TC6A 2OKOA 3BJFA 1DP0A 3UG5A 3GVRA 3PVFA 3H6OA 3TJLA 5A6BD 1S38A 2G5WA 3F5JA 4X2PA 2Q02A 1ADDA 3CQIA 3DZ1A 3K13A 1JCNA 2IQ0A 3KRZA 5LIXX 1TA3B 2QGHA 1U1HA 2DVTA 3CJPA 4L4PA 1JF5A 4DJDA 1H61A 1GQJA 3LPGA 2QPXA 3RCNA 1TB3A 1JULA 1JGIA 2BVWA 4YTQA 5BXTA 1QJWA 1VQTA 1AD1A 3NVTA 3GC5A 4W7UA 3EKLA 4IFKB 3LK6A 4FXFA 4U10A 3ZJ6A 3RPDA 1TA3A 2QR6A 1RQHA 3H2NA 1SPQA 1BGAA 3NGFA 4TV6A 1ONEA 3AOFA 1CZ1A 3TSDA 3BICA 1KXQA 5HATA 1JNEA 2F38A 3T2PA 4NKCA 1XYCA 4A3HA 5BWAA 4IFKA 4C7DA 1PPIA 4M7SA 4E5TA 3S83A 4NI8A 2VUNA 4LS0A 3F4DA 1UJQA 3T42A 1CI1A 3VKCA 2PU1A 4MB1A 3S4TA 4F2TA 3WLNA 4Q7BA 3G1RA 3E9AA 1EHNA 1RP8A 1ME8A 2VFEA 2WANA 4HYRA 4POCA 1IEVA 2NQ9A 3MPGA 5CC7A 1QXLA 4FB7A 3GXDA 2GWNA 3GG7A 2DJXA 4B4FA 1I2RA 3PK7A 3OP2A 4OECA 5BMWA 4OBRA 5FL0A 2Z1BA 1FWWA 1BD0A 3D46A 1L8PA 4WJXA 2J7DA 2QW5A 1V3KA 4WHBA 2R1KA 1Q6DA 1ZL1A 3N6JA 1G6CA 5HR7A 2PDNA 2E77A 1RBOB 1VBGA 5I5RA 1MNZA 3R5EA 2C0HA 3QRHA 3CYVA 1BYAA 3MUY1 4PTMA 1HJXA 4QSHA 1S1PA 1C8VA 3CHVA 1EUNA 1J0JA 2WO5A 3A12A 3ES7A 3G18A 1I1XA 1A80A 1XFBA 1E6NA 3BLOA 1UD4A 2FZBA 4O54A 1PX8A 4MPKA 4PMXA 3IIPA 2B7OA 2GSHA 4CD4A 4GUJA 5FOOA 1GEQA 2IPFA 1KM0A 3HQNA 3PG8A 1RLCL 1XLMA 1W1TA 1K7FA 1NDWA 1YE6A 2CLFA 1WOBA 3ES8A 3I4EA 4MY9A 3RM4A 2GGHA 1PIFA 3VZYA 4JTJA 1R8LA 3MY9A 4G5DA 3G1FA 3P60A 3RX4A 4LEQA 3NEVA 1XRVA 4Q33A 4IGMA 4XVEA 1MMFA 1J4EA 1O66A 3ARTA 4GZ7A 4J5NA 3DXIA 1FCQA 1TVPA 3BAXA 3KTCA 4DM2A 1AW1A 1PXGA 4PUDA 2WJDA 2DH3A 1SR9A 4HNOA 1WZLA 3TVAA 1R2RA 2Q3RA 2ZVRA 4O52A 4KWOA 1OZQA 1AW2A 3URAA 4JIQA 3EPNA 5DMNA 3CGTA 1WXYA 3CLWA 3W02A 1DXEA 3O0FA 1NEYA 4DBWA 2P5NA 3ZMRA 1F4HA 3NR0A 3PZIA 2WLZA 4NZ3A 4GJIA 1GG1A 3WNPA 5CG7A 2OELA 3GZAA 1CTNA 1KBIA 3II1A 1QU4A 1F8IA 4M8UA 4PSPA 1TTJA 1EIBA 1XC6A 1UC4A 2X41A 1T8XA 4C65A 1Y5VA 1WUEA 4UTFA 2E6YA 1GQKA 4XX6A 1BTMA 3NAVA 1DJIA 4YPJA 2Y70A 5BXSA 2PDJA 2YL6A 4RV8A 4Z2IA 3FA4A 1HFBA 3RF9A 1LOSA 3PM6A 4UB9A 1BSLA 1YXDA 4FXSA 4ZTYA 2ISDA 3KWSA 4P5UA 4JIRA 3QYSA 3GXPA 1C3FA 2JALA 4NIRA 1CT5A 5HNTA 2VCAA 5T9BG 2ZRUA 4EPDC 4IF2A 1JAEA 3WJSA 4MKNA 2VHLA 2X1TA 5J8LA 4JKMA 4BQ4A 4HOWA 1EOKA 5BCAA 1R6WA 3WD3A 4XBJA 1ODUA 2YBVA 3S5YA 5D03A 2NUXA 4FIQA 1GVYA 2GVLA 4EF8A 1U30A 1GTEA 3M44A 1O6IA 1S5WA 3KCLA 4UQDA 2AGTA 2CZEA 3L5LA 1LQ0A 2ZC1A 2DUAA 2G3IA 1K3UA 1H49A 2OYKA 5I3JA 1GVIA 4MSSA 4GO9A 1DE5A 4Q8VA 1K8YA 3W86A 4ZQPA 3PP7A 1F6PA 5GNXA 2GGGA 2QJNA 2ZADA 4ZCWA 1GZ1A 3RM9A 2XM1A 2FH8A 4B9ZA 2OODA 4V27A 5AVNA 4MLJA 4KRUA 3QOKA 1PYFA 2PDFA 2ACUA 3ARQA 4MMWA 4AVOA 3LA4A 1PSCA 3UYIA 2XWEA 3S5NA 1TJPA 5EGRA 3N3MA 1OIFA 4NJIA 1UP2A 4M1BA 2Q09A 2PGWA 4MOZA 3M1ZA 5JIWA 4GH3A 3QPEA 3AJ7A 3ZSSA 2OZ8A 1DTUA 2H9AB 2QCFA 3FA5A 1M68A 4MWAC 4A3RA 1QW7A 3LLFA 4DJFC 1IEWA 3CPGA 4P8XA 2E68A 3KL5A 3ISIX 3IANA 1FX6A 3PZVA 2PC4A 2RGMA 3FYPA 3W53A 4PMZA 3MW7A 4GUGA 1RPXA 1PYMA 1GTHA 2GQ3A 3CMGA 3AIUA 4ENLA 2QS8A 1M53A 2H9AA 4X60A 4GLEA 3W2MA 2R82A 2A3BA 4ORMA 2Z2BA 1Q6QA 4AMAA 3IAQA 5FF4A 1ONRA 3LN3A 1EZWA 3ARPA 4XAYA 5HBFA 4R7OA 1DQUA 1KFEA 5DANA 1WKFA 3AMDA 1AK5A 4D8AA 3WLRA 2PDYA 1R3QA 1H1ZA 3S1GA 3OW1A 1ZBWA 3STCA 4ZQCA 4UFJA 4X9SA 4LAKA 1X39A 4Q7IA 1MXDA 4ZEPA 2E3ZA 3PTDA 3A3WA 1J5TA 1QATA 2VX4A 1TSIA 1TVLA 1CGWA 1R38A 3L7RA 3AUOA 3CAKA 4A8RA 3RN6A 5BWFA 4EXQA 1DOSA 3TQKA 1UD5A 1XIJA 3GG1A 4Z0JA 2V6AA 3A4JA 1GOXA 1UH2A 3EDFA 2PGFA 4D6DA 1TCMA 1UWIA 4JQAA 4M81A 1EJTC 3QTGA 1XRTA 4KGJA 4K1GA 3DFHA 3CASA 4NX5A 3BQ5A 3UZWA 2HPMA 5BYWA 4X0NA 1WDPA 4J9JA 4K3ZA 4OV4A 3GTIA 1HQTA 1F73A 2FZ8A 3O9NA 4L80A 5IFTA 7ENLA 3HURA 2YPIA 2G3JA 3UWUA 3TJXA 3OYXA 3QFEA 3QTPA 1KXHA 1AQMA 1W17A 4S3CA 4Q4OA 3TTOA 5C7HA 1ZCOA 4HN8A 3L4UA 4GC4A 3VX0A 4DRSA 5I3KA 4JS3A 1G69A 1CXFA 2VFDA 4PBFA 4YL2A 2Z1KA 4PMNA 3VMPA 1SZNA 2WJZA 4PEKA 3MCNA 3CV1A 4UOQA 1OFAA 3WCZA 4B5VA 4WUIA 2IKJA 2FIQA 3NQCA 4PMUA 3EWBX 1VFUA 1I9CB 1SZFA 1SR0A 3CAQA 3GVVA 1PWMA 2GUYA 3G5EA 1H3GA 3FJLA 1YXCA 1JUBA 2DGAA 4MDOA 1XH0A 2QCNA 4JHMA 3APTA 2J66A 1FP8A 4YU1A 4E3VA 3B8TA 1YNYA 5AKQA 2V3EA 3PZQA 1D8WA 1SJDA 5K4ZA 4M19A 4C6BA 4XG1A 3BOXA 4UFLA 2OWCA 2FMOA 2PWFA 4CN6A 4KCUA 3W2NA 1E40A 4MM1A 4ONVA 4LBRA 4QM1A 2TRSA 4XZWA 2XH4A 4EPKA 1QNOA 2OR2A 1B30A 4Y8FA 3TZNA 5KINA 1OY0A 3L2LA 5JU6A 1VAHA 4IIHA 1EXPA 2EKGA 3BE7A 3L5MA 2DUXA 2WPGA 1QR7A 2QNEA 3G1DA 5CPMA 3VTRA 4C6FA 4JQ3A 4F0KA 2OLHA 3NO1A 4GO8A 5DY3A 4XKYB 4Z08A 1PIGA 1OFDA 2RFGA 4GYFA 3NYZA 4AHQA 3O63A 4KWVA 2REQB 2BTMA 2AQWA 2V3GA 3SUWA 2E4TA 1UB3A 4NNCA 4XD5A 2CLEA 4B5SA 2BY3A 2F7FA 3GBEA 2OO0A 4MJ4A 4S3DA 3VOCA 3WMCA 4HA0A 4Z1AA 1JDCA 4WIWA 1UWQA 1E6ZA 3GNDA 3CUHA 3DENA 1JDFA 3NGJA 2YLLA 2PWUA 3U3HA 1LG2A 4XKYA 4KQNA 2REQA 3NFUA 4HNNA 2AQVA 1G01A 3J7HA 1OSEA 1E1CB 4B2DD 1M41A 4JZ5A 5DCDA 4ZSUA 2OTDA 3P67A 4UZUA 2C0AA 1H09A 1SVDA 2ICSA 4O13A 1E9YB 3MWAA 4UQEA 2OVLA 3GFXA 4AC7C 1E1FA 3VNLA 3RO8A 4ZO8A 5DBUA 1E1CA 4NZFA 4BFAA 3LY0A 3QC3A 4OBTA 3RG6A 3IPWA 3WF0A 4PMVA 3W7KA 3INPA 1GORA 3FJ6A 1ONXA 4IL2A 2NWRA 5AHNA 5CGTA 1FFQA 4TX6A 2ZUNA 1OFBA 4URIA 5A6BA 4NVTA 4YWSA 3SRKA 5IRPA 2PGRA 3IVUA 4HGXA 2X7WA 4XK2A 4EANA 3UFYA 4GABA 2UV8G 3GK0A 5KMYA 2XFWA 3H26A 1B54A 5DFAA 1K4GA 4OVXA 4W5ZA 2Z6IA 3C4UA 2EO7A 3MZ2A 3QZ6A 2Z1SA 2BY2A 3KXQA 4GXWA 3B0VC 1LBLA 3BMVA 2JBMA 4U2ZA 3I6EA 1LYXA 2PUZA 2Y7GA 4AX6A 5CPSA 3WEMA 3D6NA 4PB3A 1E73M 3U2EA 3B9OA 3KDNA 4AY1A 4GZIA 2VR4A 1WYIA 3TEVA 3F2CA 1W91A 1US2A 3B04A 2OZ3A 3SW6A 3DKLA 1GYLA 1YQ2A 4XZLX 3EX6A 2VFGA 3ZYZA 2HXTA 3K2GA 1P1XA 3UR8A 2W67A 3GIPA 1XG4A 1IIGA 2TPSA 3VDGA 4KEUA 1L6SA 3AZTA 1V02A 3S6TA 1OQFA 4J1OA 3GXFA 2VZOA 2WMGA 3WN6A 3FK4A 1Q63A 2G3NA 2J88A 3H12A 4LNYA 5DY2A 3V0SA 1N8FA 3PC0A 4GX9A 3W1LA 1SFJA 4LRTA 2Z7GA 4WLCA 3NQ8A 3QY7A 4C7FA 5EBAA 4XUGA 4C1LA 3LXBA 3SFWA 3MSGA 3PUGA 1Y65A 1TELA 4JCMA 1FWCC 1FQ0A 1TTQA 1OFQA 1HP4A 3VINA 3R79A 5GQBA 3QQ0A 3IK2A 3GIQA 4RKAA 3C86A 3TC7A 2X0SA 5AHMA 5FESA 3SEPA 4Z2GA 3LMYA 5AC8A 4IL0A 4QXIA 2NQJA 3VZZA 3NDOA 1SW3A 2J7CA 3P84A 3NL5A 1AQ0A 1UR9A 3QHOA 4S23A 3QHMA 3SJNA 3WQFA 3CZJA 2O4QA 3IUIA 1OCBA 3WDJA 5ECVA 3IJ9A 3SCNA 1POKA 2H8XA 4ZFMA 4L9XA 1W1IE 4DZAA 3AIEA 1R9ZA 4XV0A 3Q37A 4LANA 4YTTA 5I23A 3ITOA 2JF6A 3LPOA 3CHFA 3TCEA 2VZVA 2ZZ6A 4C1NB 2NQZA 4AEOA 4Q3MA 1F2JA 3HQPA 3VGBA 4C6KA 3RM8A 1TKKA 4JX5A 1ZZMA 4F0SA 2B4GA 3CV2A 3ENLA 2GJRA 3W3OA 3SRDA 2RDXA 2P0IA 3SCSA 3VIFA 1L0PA 2C15A 3QH2A 2QZRA 3KBSA 2I5QA 2Q8XA 4C1NA 5BU6A 1FWSA 3P8IA 2P1FA 4WK9A 1VFTA 3P6LA 4CN1A 1N8IA 3F2DA 1TVNA 4W88A 2B7QA 3ITLA 1YXYA 1DJXA 2CKSA 1AH0A 3WQDA 3N19B 1HZYA 4QDMA 4PUEA 3KOZA 4UMAA 2YLAA 4UZSA 3MBFA 1JDEA 1LRNA 4J4KA 1JCLA 5ECUA 5CSSA 3AIQA 2XGZA 3WH8A 2NWSA 3TIMA 1FXPA 4UQCA 4S3EA 2ZZ1A 4GUHA 5EMLA 3ZIZA 3GG0A 1EJSC 5I06A 1X6NA 4QG9A 3W38A 1UHVA 3RRAA 3RJXA 4EACA 1XISA 4AZCB 3WDHA 1ZBVA 5FIPA 1CGUA 2VNCA 3FVMA 2EHHA 3V5CA 4GVFA 4DWSC 2DT1A 1ZTVA 3FCPA 2FJUB 2CLIA 2DY3A 1RK5A 1RZMA 4HZ7A 4W9TA 5FL1A 4ORIA 3FOKA 4K8HA 1AODA 1E0VA 4B91A 2A4AA 1KFBA 1SFTA 2IS7A 4AZCA 2OYLA 1GVRA 3VGHA 3WEZA 3PWGA 1J0ZA 1XLEA 2CU0A 3PWAA 1SMAA 4JNYA 2VRJA 2HBVA 2WQPA 3QW4B 1ITQA 1BWLA 2L5HA 3O1NA 3E2QA 4PULA 3GVGA 1XLAA 3BO9A 4CEXC 4I9TA 4OJYA 3UWZA 1PDZA 3WLMA 5DT7A 1DIOA 2OPJA 2PD5A 1TFVA 2BHZA 4UC5A 5DN1A 5GPRA 1NVMA 1LDCA 1GKPA 3MWCA 1KRBC 4WGHA 4WEVX 3W25A 3ITVA 5TD4A 1JUKA 4UTTA 3KAOA 3VDCA 1H1NA 5IOBA 2VGGA 3PANA 4GQ0A 2BWGA 3K8KA 3E49A 1E4LA 8XIMA 4ADTA 2NX9A 2V5DA 5F2IA 1CB2A 3JVAA 2WJEA 4FNQA 1RJQA 5K2ZA 3UZJA 5CJ5A 4N4PA 3NIYA 3L5AA 1EJUC 2J25A 2VXNA 3F4WA 3C0JA 2XWDA 4HU3A 4K8GA 2XH0A 4D9PA 1E6PA 1I60A 2ZQ0A 3CZGA 3N1AA 5HWNA 2FZDA 4JYDA 1V93A 3A24A 2IMRA 3EZ4A 4PUUA 4ZOAA 1QDSA 4JFVA 1XBYA 1UYQA 1UZ4A 1FWAC 3WELA 4Q6XA 4W8LA 2E28A 3GC4A 4XISA 4DI9A 3RLUA 3P82A 4O57A 4DAIA 3MV11 5JBFA 1GT8A 5LXEA 4LAZA 3L68A 2H90A 3SUVA 5A94A 3T0TA 1KCXA 3LTPA 3TR9A 1QNQA 3AXMA 1JZ8A 3I6RA 5H1WA 4ZZ9A 3A64A 4NYYA 4PCSA 3R7MA 2PZNA 4BWLA 4F0RA 1KM1A 4GFSA 4H9YA 3P80A 2UWFA 4QDWA 4CQCA 1AA1B 4DJED 2ZCGA 2CZ5A 3V0UA 3QM3A 3KL3A 5F1VA 2JFEX 3E2RA 2CEQA 3A9IA 3IVTA 4JPGA 3VFCA 3UVAA 3SIMA 3WQ4A 3PUOA 3UZZA 3ICJA 4EF9A 4HZ8A 1UW9A 4XIAA 2VDGA 1U22A 4AB4A 3KVMA 2R9RA 4ML9A 3SDOA 1QAPA 3GR8A 3RXZA 4M3PA 3L0GA 3M47A 1A0DA 3WF2A 3ONCA 4H8HA 2YFOA 1J0KA 3WK2A 4A3QA 1W3HA 3ZLGA 4XAFA 4KIRA 3FYOA 1M5WA 1MW0A 3BJSA 2QUVA 3RMEA 3QGKC 3P62A 1YDVA 1G94A 3BG3A 4L6DA 3SN0A 3ZO9A 2R14A 1UWAA 1EF3A 4CQ9A 1UQZA 1PB0A 1B3XA 3EWYA 4Q32A 2QHAA 3H22A 3W84A 1VCGA 1CGXA 4IZGA 5HUOA 2D2OA 2DZPA 4HJWA 2VEKA 2Y6ZA 1KTBA 4LY8A 4ML4A 3IGXA 4F4RA 3BZJA 1EA9C 2BVTA 1J93A 1S39A 3ZR5A 4AZGA 3ABQA 3AIBA 3AAMA 4O10A 1B4KA 4DBEA 7TAAA 4G6CA 4FNRA 3IV3A 1NU5A 4DLFA 1T40A 1CNVA 2O56A 5CPOA 2Z1WA 3W7DA 4NJHA 4C5YA 1EGVA 3GSMA 4HYWA 3M46A 1Y0EA 2J8FA 3RRXA 3IIVA 4Q8QA 1G67A 1SW0A 3DN5A 4Q4PA 2QUUA 4K1WA 1U5HA 3WLQA 3KP0A 1AZ2A 3H2CA 5HK4A 4DJFD 5HQEA 2WC4A 1EBHA 1D9EA 1FBAA 3TYZA 4ASTA 1HIZA 2OLSA 4ATLA 3P5ZA 3IGHX 1KQZA 3CQKA 2I7GA 4EPEC 1VGAA 2GVJA 4JNMA 1K9EA 1EF2A 3WBXA 1ZB5A 4N7QA 5CC6A 3CZ8A 4E8DA 3RX3A 3M0KA 5CH9A 2BXYA 3M64A 4IGHA 6ENLA 2EGZA 1XUZA 1YNQA 3IGUA 1DJNA 3LEPA 4ZOEA 2E1DA 2WZHA 3OLIA 1C92A 1E72M 5IDIA 3FV9A 4PBGA 3T4WA 3ARXA 2NXGA 2CETA 1SJAA 4Q7NA 4RNJA 3DFNA 3FSTA 3HG5A 1VFSA 1WPCA 4PMOA 1OWQA 3OHMB 2Y7DA 3I68A 3U5YA 4PBEA 1KM3A 5DMLA 4LYRA 2I5IA 2RDUA 4N9EA 4GC3A 1I45A 3APGA 3CB3A 3QZEA 1K03A 3FS2A 3RILA 3IRDA 3M6YA 3VCCA 4DAFA 5GVJA 3U57A 1X1NA 3QVQA 1XV8A 4GNVA 3VNMA 4NAEB 3P8JA 1FH8A 5D09A 4OQVA 4I9AA 3MJYA 2ZZ7A 4JYEA 1JZ2A 5DQPA 2PLMA 1KM6A 5G4WA 4GACA 3LOTA 4Q8MA 2A21A 4JL1A 5FF3A 4B3KA 4I90A 3QEZA 4NAEA 2VO5A 3H2MA 1NQKA 3W22A 3GXMA 4UNKA 3O6AA 1WO2A 5JVLA 4AG0A 1BHGA 1CB7B 2W63A 1B3VA 2RGLA 1H0GA 1C7TA 1P0EA 5HWMA 2ZUUA 3GTFA 4E3TA 4Q8PA 4O18A 4BY3A 5A95A 1ME7A 3HN3A 3OIHA 2YCJA 2XINA 2QGYA 3EX3A 5I24A 3R12A 4C6JA 5LYRA 1TQJA 4IPPA 3W7GA 3AMCA 3N18A 4ADSA 3RNDA 1U83A 3EMQA 3CUFA 2VL4A 3CV7A 3VDBA 2VEGA 3GBDA 5T26A 2PCEA 1BEUA 2DIJA 5C7VA 4MNLA 6ALDA 1LZOA 3EKZA 3HGRA 1E43A 5EL1A 1CWYA 2X8RA 4AD4A 3POCA 4O16A 4HA3A 3RJYA 1JZ6A 2WPBA 1J12A 3CHCA 4Y9AA 3P81A 4ZO7A 4DHGA 1Q8AA 2VRKA 1J6PA 2WNQA 4KT2A 2OKTA 3V35A 1VEOA 3K4WA 2E40A 3W76A 1ADSA 1BLIA 1GW9A 3RMJA 3S1XA 4LUYA 1DIKA 2HMCA 4J2PA 2CLOA 1EKOA 3M0LA 4R7WA 3UJFA 3G1YA 1OCJA 1XLIA 2HVNA 2ZUWA 4IQLA 3P93A 1YIXA 1R3TA 4KIEA 4BQ5A 3NOEA 3NQFA 3EXRA 3VPLA 1PKYA 2GDUA 1C9DA 4Q8WA 1XXXA 2GZXA 1MWOA 4ILSA 1JPKA 1UR3M 2PWGA 2DEPA 2GJXB 3ATZA 2JQXA 2JK2A 4DXVA 4F8XA 1H62A 1W5NA 5M1TA 1MQPA 1ZUAX 1IE7C 3ZR6A 1ELSA 3FAXA 2HSAA 2GUUA 3SURA 1TZZA 3DC8A 2FQIA 2GDQA 3VD4A 2DQWA 2GJXA 2GL5A 1PVNA 4A2RA 4NZ4A 3QMSA 1A5CA 1YNPA 4JOMA 3Q2DA 1QOQA 3WDPP 2Y7FA 4AISA 2O55A 3GHRA 4IP7A 3VKKA 1EZ2A 2OO6A 5CZSA 3ARWA 2JF7A 2J47A 3AIRA 1RCOB 3VKBA 4XWUA 1WZMA 3DECA 4C6NA 4A8IA 1WKEA 4G1NA 1F3XA 5U4NA 4YMZA 4RE3A 1V6XA 1JCTA 3CT2A 3SSZA 3DG7A 1EOMA 3CC1A 4ATDA 2NV9A 1PZ3A 3SUUA 2PLKA 5CPLA 4I5XA 5JMUA 4ZA0A 2QV5A 4H41A 1VYSX 1WZAA 4HNVA 3V7PA 3P3BA 1SW7A 2PTWA 2IW0A 1I75A 2J8GA 2Z26A 3QR1A 2HV5A 4KESA 1EUAA 2C7FA 4PR4A 4P7LA 2ANUA 3TYAA 2HXUA 2FGLA 4PFHA 4TXEA 4EP8C 3DX5A 1H7XA 4PTNA 5AZ1A 1ZP3A 1XF0A 2BV9A 3TN5A 1O1ZA 3UP8A 2PWVA 2HZGA 2CZFA 1O4UA 3U2CA 3VCRA 3OQ8A 4NASA 1PZ2A 4O28A 2WSKA 4PGLA 3N17A 2X2YA 4YCOA 1W5OA 1TV8A 1KV5A 2G50A 1CEOA 2VCBA 4DPPA 3CO8A 1ITUA 2Q8LA 3U7VA 4DVOA 5IXEA 1IEQA 4UTJA 4MJMA 4WQ6A 1I0BA 3L4WA 1BVZA 1W9DM 2HVMA 3GKAA 3P61A 2A7RA 2XISA 4PUJA 1O94A 5F4SA 5BRBA 2C1HA 3L12A 1H7WA 1VCFA 3HB9A 1V3LA 1NWUA 3GTNA 2Y88A 5I02A 1B9ZA 4UTIA 3WUBA 3ITCA 1XDJA 3W1PA 3BLPX 2AOSA 1IEXA 3BAIA 1G4EA 2IPJA 4IICA 2B0MA 3SN4A 3UCQA 4FHAA 5I2UA 2X30A 3VKDA 4QITA 1YMYA 3O16A 3FYYA 1Q8JA 1IZKA 5FSDC 1LLZA 3CTTA 3LQGA 5D32A 1F6YA 1V6WA 3DHFA 2ISFA 4O19A 4WD0A 3LHUA 2OSXA 3BCDA 1Q6EA 4E2DA 4V15A 5HINA 1XDMA 1X1ZA 3YPIA 1H51A 4HZMA 3GYCA 3E96A 1ENUA 4WXZA 5ABEA 1EEXA 3Q65A 2HS8A 3PZUA 2E1WA 2C79A 4Z1DA 1XD0A 2ODOA 5U7SA 3GH4A 3PTKA 4IP4A 1UG6A 3AXIA 4KEMA 1W54A 3ZWSA 1O12A 2QLYA 4M6UA 3SSJA 3UA3A 3W23A 3AS0A 2PDHA 1E9ZB 3UR5A 2YFNA 2PTDA 4I9MA 1J79A 2PP1A 1LRTA 2VGBA 2RKXA 3H21A 3HG2A 1R3SA 2PP3A 2BOEX 3F4NA 4I6VA 4DO7A 4X22A 2BXVA 2BHYA 1THFD 1UUOA 2F6XA 1LLWA 1PX4A 5TQLA 4JXCA 1JQXA 1VJZA 3HBLA 2XFFA 1GOMA 4O14A 3WY1A 1CLKA 4HU4A 3WH7A 3MHFA 3BOFA 1JF6A 1OK4A 3M7WA 4RX0A 5EFFA 3E2VA 3V18A 6A3HA 2OEKA 1TMHA 1BXBA 3P7YA 4JYFA 1FKXA 4U28A 4C5ZA 3PUDA 4LVBA 4UTWC 2VT0A 1JXJA 4MYAA 1BVWA 4V2XA 4M1RA 1DORA 3VGGA 1YLVA 5CJMA 5JXQA 3HTWA 5AHEA 5J5DA 1A3HA 3OBKA 3OZPA 3O15A 2JEPA 3FY1A 1E55A 2V63A 2FZ9A 1XR2A 3H4XA 2UY4A 2WHKA 5C71A 1LLOA 3TFCA 2Z6JA 5CG0A 1VCVA 1R46A 2VR2A 3UWYA 1IGSA 1RVGA 1JRCA 2P76A 2XVNA 4L65A 2WNZA 1OCNA 3R13A 3O6YX 1N55A 3PNZA 4IXXA 1FP9A 2HEJA 3LNPA 3TTSA 4LALA 2YGYA 1CYGA 3AMLA 2NSXA 2E6AA 2VOMA 2VEPA 5H8MA 2DZBA 2YDAA 1W2VA 2INZA 3VD5A 3B8DA 2R1PA 4E8CA 2BSLA 1TPWA 3GH7A 2XIIA 4DUVA 2Z28A 1R3RA 4NXKA 1HTIA 4DWSD 3OGRA 2WJFA 1EB3A 5LIKX 2KAUC 4GUFA 4JIPA 4H6KA 2OWWA 5KZDA 3ZT7A 5AC7A 5A6AA 3K1DA 1W3NA 2DVXA 2W79A 3TYEA 3WENA 4UQBA 1WDSA 3IACA 4HMDA 4FALA 1XIHA 3VOJA 3DKJA 3AI0A 4PSRA 5B80A 1F76A 4UFKA 4P7OA 4G7EB 1QHZA 1WV2A 2Y24A 4MZ1A 3GKFA 3N9KA 3AS1A 4GI6A 1QOXA 1IR2A 5JBDA 3EDJA 1GYNA 3VFLA 1OC7A 3TE9A 4HTBA 4G7EA 4WDUA 3W82A 2GQAA 1YPIA 3VGEA 2W0UA 4YCPA 3TN3A 3IV8A 4AWTA 4A8LA 2R24A 3U2OA 3CUZA 1KM4A 1VR6A 2E9BA 1C8QA 2DZWA 1SYTA 3MCMA 3PJXA 2GLKA 1K9FA 4B5UA 4ACYA 4ECLA 1KRMA 1PZ0A 4N0RA 1P43A 1BRLB 1B9BA 1UCWA 1SGJA 4OZOA 2E8ZA 1ZP4A 3TCSA 2GPTA 3CMJA 3W1AA 5F7UA 3LV6A 3RUBL 3LCIA 4LVAA 4GIEA 2AL2B 3WFZA 3XIMA 3QR3A 1W32A 3CH9A 3QPYA 1E9LA 4MWAB 3S46A 5F1UA 1BRLA 4L1WA 4ATWA 4W89A 4NNBA 1Q4WA 2P10A 1JIBA 1K8ZA 3XISA 3KRUA 5JH1A 2VENA 1KGUA 3SGZA 4BK9A 2Y89A 2EPOA 1UBSA 5HA7A 3FGCB 2AL2A 2DSZA 4Y2WA 1MXGA 4MWAA 4HOZA 4LW7A 4DJFA 4G2DA 2EEXA 1UIPA 4IMEA 4RK8A 3W7PA 4IJCA 4PL1A 3QKEA 1OABA 4QAWA 4XBSA 4O4WA 5D9MA 3OVPA 1AD4A 3FGCA 5MHBA 5HJYA 1MVYA 2Q01A 3BAJA 4L4MA 4Y9NA 4ZO6A 5DCEA 2ZBTA 5AY7A 1A50A 3KLLA 3MYPA 5CBJA 3PZGA 1QK2A 3VIIA 1WOAA 1EQCA 1D3CA 2DSVA 4EIVA 4FOJA 4JTRA 3WJXA 3FXYA 1B3WA 1JPHA 3S47A 4WSKA 1MDLA 2XIBA 4LEFA 4MJ2A 3KTSA 3THDA 3SB0A 4PCTA 3GVWA 4NJJA 1A5NC 5I78A 2FZNA 3OLGA 2PA6A 4CLMA 4R85A 4O1EA 3Q67A 3M5XA 4J2MA 1F07A 2EF9A 4EAMA 1PKNA 2J74A 1MDRA 5JIPA 3JR2A 3HV9A 3L4TA 5CPTA 1GZGA 2Q3OA 3KBJA 1DJWA 3VO0A 3W88A 4O0QA 3A4XA 1RAKA 3R94A 4MPQA 4FK9A 4BEQA 3WLOA 5LNWA 1WAUA 1E3XA 1XYMA 4HNLA 1QT1A 5F2MA 3DOPA 3BAKA 3OQEA 1W1B1 3ZLHA 4PZVA 4QJ5B 4BR1A 4B5WA 4JFUA 3UZYA 3UG4A 4AZIA 3FJNA 4FS9A 3CB8A 1TIMA 5I6SA 3UXKA 2AKMA 5DXXA 1I4NA 3D47A 1A5OC 3EGJA 4M80A 4M7TA 1GNXA 2V69A 3KCOA 1Q6GA 3KFTA 4PMYA 3VE9A 4FSAA 4QJ4B 2OQHA 2NQ5A 3PBWA 3PB2A 4IOTA 1PO9A 4EVZA 2JKPA 4R53A 4PRTA 5H8UA 1KBBA 2PDGA 1UROA 5KETA 3U7BA 8A3HA 4X63A 4ERIA 4WSJA 3BCFA 2OT1A 4ROQA 3H23A 5DBTA 1V6VA 3BSHA 1TE1A 2X09A 4QAIA 5A5WA 1TV3A 1DYSA 2J7FA 2VEFA 1RALA 3AHXA 4M0XA 1SUXA 4YYFA 4O50A 1ZCCA 3GIYA 1ICPA 3PHAA 3GTHA 2VX6A 1US3A 3OZYA 3GDLA 3NOYA 4CQ8A 3OGVA 1DXFA 2D2JA 2ZTKA 3CHEA 3IJ6A 2G3MA 3QXBA 1SJCA 3ZS4A 1WUFA 1JNDA 5AC6A 1V08A 1PCWA 3GAYA 1S2AA 2INEA 2X42A 4P8VA 1X6UA 3ABOA 3MP4A 4GD0A 5D8ZA 4W8AA 5TNVA 1QPQA 1SSGA 1W56A 3WMSA 3S2JA 1DJQA 2Y5SA 1TV7A 3M0YA 1DTNA 5A8GA 3M0ZA 2X05A 4AH7A 4PCPA 1UR0A 1LT8A 1KGXA 1LWJA 1JCXA 2Z24A 3D3FA 4XAPA 2EJAA 2WMHA 2I1OA 1XBZA 4GCXA 4MNKA 3MCOA 1G1YA 2RAGA 3TW7A 2CBVA 1LROA 4ACZB 4IQEA 3NQ7A 3CYJA 3TLQA 1A5UA 5CSUA 3B4UA 3N2OA 2XFYA 3EWUA 2V5KA 1GOWA 2VWTA 5HULA 2JKEA 4MAZA 5C2XA 2OCZA 3UR7A 4IMCA 1FHLA 1VFHA 1S1RA 2GOKA 4ACZA 3NNTA 3F7JA 4O53A 3WLLA 2BLEA 1EA0A 5TAOA 1VBUA 1VBJA 4MYXA 1GVFA 1QNRA 3PBMA 2CLPA 3ITGA 1KCKA 3WL1A 3KHJA 3AWOA 5A6JA 1GEHA 1XGDA 2P3ZA 3W7EA 3WQ8A 3MANA 2QCDB 2WVUA 4G56A 3TKFA 4KWSA 2WZTA 1EPVA 2QJIA 5MKGB 4S39A 4Z2JA 4Z2KA 1M7OA 3U6WA 2CHNA 3UG8A 4QJ1A 3OO2A 3LHWA 4FLRA 3MTWA 4WDXA 3EEZA 3EKGA 1YX1A 2QCCA 5J04A 1QNSA 3W2JA 2WKJA 2FGBA 1ZJIA 1M65A 1WDQA 2WMIB 5MKGA 4NILA 1TPUA 2PODA 3O8AA 1PEZA 4RZBA 2YBUA 1K8CA 2DIKA 3L2IA 5FACA 3DHDA 5FI8A 2D2HA 1IGWA 5LNVA 4LFYA 5AYYA 1LL7A 4X9YA 4KEZA 2BG5A 5AHFA 4QIUA 3DYOA 4O17A 2CXGA 4J3WA 5A2BA 2Y2WA 2WMIA 5KSWA 3MHUA 5G2WA 4OHQA 2OB3A 1XLJA 4HCHA 1HGYA 4HKPA 4S3GA 1QI2A 2NXHA 3K4AA 1L6GA 2R1MA 4HZ6A 3VK5A 1E15A 1VB9A 4IWWA 2DZAA 2XSXA 3TYCA 2EPKX 1EC9A 4JTUA 4MUZA 4AD3A 2YCLB 4R34A 3G1XA 1JYVA 1PIIA 4C1KA 3LLDA 4AIEA 4DLMA 3B03A 5KZMA 4HNUA 3KRBA 4E2OA 1XH1A 3CQ0A 1O5KA 1RA0A 1XP3A 1T0OA 4D6EA 5BRQA 2QUTA 2VMFA 4Q4KA 2Z2AA 3GFYA 2QMKA 3NZ1A 2VQTA 1H41A 2WW5A 1YDNA 3E0IA 1F3WA 3A3HA 4MAVA 1V0LA 3PPFA 5EMJA 3OGSA 3BVJA 4E38A 1UWSA 3SZ8A 4K37A 1UP0A 5FF7A 3B0XA 2Y85A 3MV01 4QRNA 5FD0A 5BRPA 3LDVA 3C2OA 1OGGA 1LJYA 3OZMA 1UR4A 1P0BA 1C8XA 4A29A 5FJRA 3PF3A 4DUXA 3HJZA 1X1OA 1ONWA 1BYBA 4EXBA 3VKAA 2J77A 5FEXA 3LCLA 3TNOA 3G6MA 3U9IA 5E0CA 3W00A 2HQAA 2UY5A 3LG3A 3SY8A 3E02A 1JYXA 1REQB 4GY0A 3AHVA 4MVAA 3UETA 2P88A 3W72A 3AU6A 3LCGA 1RP9A 1QHOA 1QASA 2CLHA 1XDLA 4DF2A 4U3CA 5LA1A 4A21A 5C55A 3WF1A 2X1SA 3JRKA 3NQBA 3NSMA 4JEJA 4I7VA 1REQA 3ALGA 4FOUA 1EP1A 1XBVA 3R11A 4HVXA 4HHMA 1UD3A 4JAWA 3AU2A 4X2RA 3WBEA 2Z29A 3VD9A 4AD5A 1DHPA 4LQ1A 6TIMA 3FDKA 3QV7A 2DZUA 3ITYA 4DB7A 4PB4A 3MMUA 3WJZA 4YN5A 4C6PA 1K77A 3JS3A 3WNNA 3EBVA 5RUBA 2HJPA 4QX4A 3W29A 4F48A 4H1ZA 2JGQA 2ZXAA 4UQAA 5DO8A 4LRSA 3TK7A 3S5OA 3M0MA 3BLKA 3NXFA 1MFUA 4O4VA 4DUOA 2QKFA 3P2VA 3N4EA 4UFMA 4MF4A 5C54A 3ONBA 3GHSA 2DP3A 2FKPA 1T41A 1LQAA 4DF0A 1RVKA 3UWEA 1BQCA 4DYJA 3AICA 4PTDA 2DSKA 2XM2A 3TTYA 4EXAA 2OZ0A 3V75A 1IQ8A 1DJYA 1FH9A 2GJNA 5H91A 3UPBA 4PUKA 2ISWA 4M6QA 1E5JA 3DFYA 3BOLA 3LB0A 2G0WA 1PX3A 1KW1A 2XSBA 1E6RA 2BX7A 2PB1A 3JZEA 3W1XA 3DG3A 1SFLA 5G4HC 3R10A 2J75A 3NQVA 3G77A 5D30A 2HDJA 1RPKA 1J5SA 1QNVA 2G41A 3W1UA 2WCSA 2VX5A 2VRQA 1JG9A 1PZ1A 3PR2A 2IKGA 1RJPA 1W5MA 4RW5A 4HA1A 1VH7A 1Q65A 3UVIA 3TAKA 4GMEA 3WMLA 4NHVA 1M9HA 5E6YA 4DWSB 4IXHA 2I5GA 1S46A 2D2GA 1GOKA 1V0MA 2CKRA 3RPTA 3NZGA 2PDBA 1XW8A 3SCPA 2W61A 2NSOA 1HNYA 1QI5A 1SZRA 2BODX 3QYQA 4OBSA 3SR7A 5CZJA 4GH1A 1US0A 1TJRA 2PDCA 2ALRA 3UCDA 2QPUA 3SCVA 2WSYA 1VPQA 4DWSA 5D9PA 4H9MA 3BWWA 4QBXA 2A79A 4O15A 3TFXA 2HTMA 3T40A 4XB3A 3WNKA 2ZRXA 3GU9A 2BOGX 4IFRA 5BW6A 5AFDA 3G0SA 3UXDA 4Z42C 1GCYA 2ZIDA 4ALDA 2YCIX 4DBDA 1X96A 4IUOA 2CYGA 5ABFB 3GFZA 2FTPA 4CKQA 3ZXWA 4CNOA 1E4MM 2FYMA 5HQMA 4PL2A 5HNUA 3B9EA 5I0DA 3TJIA 2PRHA 2R8WA 4UTKA 5AC4A 2X1UA 3CWNA 2FFIA 3PPCA 2ZX8A 4EPBC 1XI3A 2PWEA 1DWAM 2VC9A 2IPGA 3U5UA 2Y63A 2ZKMX 4IX0A 5ABFA 3O06A 3VXGA 4L64A 5AYZA 2D23A 3NDYA 2ATMA 2YB1A 3ORWA 1Y7VA 1J6OA 3R25A 1BYCA 1W3IA 3QN3A 5G1MA 1HX0A 3CZLA 3B9NA 2CLKA 3L9CA 2DSUA 4D6FA 1WDRA 4YWIA 4QEEA 1HXJA 4S3JA 1DWIM 2B7PA 3R0DA 3DAQA 1XIMA 4MB4A 4FP1A 1XGEA 4PUMA 1OYCA 1EFZA 1ISWA 2C14A 4YHGA 1WA3A 1T5AA 2A1YA 2I9UA 2PI6A 2G3FA 2PD9A 2PLCA 4WJ8A 3PAJA 2OEJA 3GXNA 3ME3A 1ZBKA 2ZOXA 1OFPA 1Q4NX 3K30A 4FXJA 3S6DA 3UWWA 2FVKA 1S2TA 1YW1A 1TJ2A 1VRXA 1WX0A 3S5ZA 4GVHA 3QOMA 3WBAA 1XIEA 3B05A 3A3XA 4LYQA 1JZ5A 2GGIA 4Z1BA 2AQOA 3FXGA 2P0OA 3WMBA 3TW6A 1W31A 4PMQA 1JCJA 4DO6A 4BKNA 2QXWA 4BI5A 5A2CA 1QPRA 4ICMA 1GVQA 3VMNA 4H6QA 3CTLA 2ZRWA 1IV8A 1XYZA 2OOGA 4RZ5A 1K4HA 4V33A 2W66A 2OU4A 2B7NA 4GWEA 4W4QA 5CBIA 3W6LA 4JX4A 5LIWX 3PNUA 5HMEA 5A8NA 4IGNA 3ERPA 3W0KA 4AFYA 3W6YA 4E8GA 2CWNA 5LIUX 2PRLA 2VVNA 3RIKA 2GGEA 5AYBA 1XBXA 1KFCA 2EXOA 3M07A 1C93A 3PY2A 5D37A 3LI0A 3IGSA 2XGIA 1NJJA 1UR1A 4LU0A 3I7SA 4IPLA 1G4TA 2C18A 4XVDA 1BXCA 1OGBA 4JTTA 4HNCA 3BH4A 1AJZA 4U33A 3GLCA 1H5YA 4B3ZA 3K46A 1NOWA 3N9RA 4LF1A 1VEPA 5REQB 1XCWA 1XPGA 1H50A 4K8EA 4MADA 2DFAA 3LENA 3CL6A 5K4XA 1XSKA 4B16A 1PAMA 2GJLA 1XRFA 1CCWB 1TJ0A 3BW4A 5REQA 3SQLA 2DU2A 2O9RA 1XINA 4CNSA 3N15A 4I3GA 1UZ1A 3NSNA 4ES4A 5HNRA 2ZX9A 3GC2A 5D2XA 1J10A 2A5HA 1K6AA 2ISSA 3HGJA 1GQNA 3OLDA 2EBNA 3R89A 3HPXA 1ISZA 1MEIA 3ZR4A 1OINA 4ZFCA 3SUSA 3FHQA 2DUZA 2O4MA 1HKVA 5IDZA 3VNJA 6XIAA 1OC6A 2BP1A 3LRMA 6REQB 1FCUA 3HM7A 3KS5A 4JQ4A 1LORA 1LWIA 4E2VA 3HF3A 3R58A 1CIUA 1JI1A 2J7BA 3QJAA 1MEWA 4US6A 3VUSA 4ICCX 1TPEA 5A6MA 1O60A 1CGTA 3O3RA 4P8WA 3C0QA 3V36A 4DJEC 1TX2A 2QCLA 3AXHA 1KXTA 2PGEA 4K36A 2GQ8A 1QFEA 1QPKA 3V0TA 2H6RA 1M04A 4W5UA 1H7RA 3Q4DA 4TV5A 3AYSA 3VU2A 3M5VA 3GUGA 4TIMA 3NVDA 3WD0A 5G4EA 3TU9A 2NVCA 4UMBA 3V16A 1GQLA 1VP5A 3U0HA 1XSIA 4NZ5A 2D22A 1JR1A 3T6CA 1N2VA 1YEYA 4O1CA 3PBYA 3F4VA 3UNTA 3VKJA 1ZJBA 4B90A 3VDAA 3W7QA 3ARYA 1F8MA 1DVJA 2YXOA 2ZUMA 3KM8A 3RITA 4MJZA 1FWGC 1V3HA 2PURA 1V5XA 3FX4A 4DZ5A 3LGDA 3S3GA 4OIFA 5D38A 4PA8A 1MI3A 1FWNA 1NF7A 4UNIA 1JDDA 3FJ4A 3AS3A 1M7PA 5EYWA 4PTVA 5E9XA 4XTDA 1UASA 1RCXB 5E9AA 3G8EA 1YRRA 4CVUA 2V8ZA 3GG8A 4JD4A 1LT7A 3CIVA 4BI6A 3W1RA 3I7RA 3N14A 2NX1A 3PJTA 1FDZA 2DQXA 4U5KA 4RDZA 4Q6JA 3VOFA 4AWSA 1FCVA 4BF9A 3I65A 4KS0A 3U2ZA 2VYOA 3AMGA 1PHWA 1NSJA 1XH2A 1AVAA 3N6HA 4HD5A 3IARA 4D6GA 9XIAA 3TROA 1RBLA 3T81A 3SQSA 4Q4MA 4QROA 2WHLA 4E6MA 3NL6A 4NI3A 2DPEA 3T0DA 1IYXA 2DSWA 4O1AA 4KGLA 2YYTA 4IMAA 3S42A 1XLBA 1XYAA 1FWFC 1XQLA 4KCWA 1CGYA 3B8VA 2V82A 2I14A 5A3HA 1GVSA 3IJ7A 3W4RA 2PE4A 4I5RA 5I03A 3AXXA 4ROPA 2YOCA 4DELA 5C9XA 5GNYA 4FNSA 3N2CA 4KWWA 1XFCA 1YKWA 2YJQA 1RV8A 1DWJM 2VOTA 3VM7A 2VDHA 3WLIA 3ITXA 1UPMB 2YIHA 2E6DA 2VFIA 3LZ5A 2OGJA 9XIMA 3UJSA 1Q6FA 3ARVA 4AC1X 2ONEA 2QJHA 3GU2A 5DRIA 1UJPA 1I2NA 3N4FA 4N2YA 4N02A 4AHPA 4DIAA 1JD7A 4C91A 1PUDA 5H2ZA 1T99A 4DO5A 1WCGA 3UG3A 4HU8A 1W1YA 4DYEA 3GD6A 2G37A 4GVGA 2O9TA 4LS1A 4BA0A 3QY6A 1HJUA 2E67A 3WLSA 3IK4A 2GYIA 1QO2A 1OC5A 3HGSA 2UBPC 5IHRA 4HU0A 3W81A 1UUMA 1L2QA 1NOFA 3GNXA 4GBDA 1TPC1 4F0MA 2PDPA 4QISA 4JKKA 1Q13A 1GOQA 1EH9A 2NXIA 4GGBA 2BFGA 2A6LA 4ZB2A 2HCVA 3CEUA 3ALFA 1K02A 2W9MA 3BMWA 3B4YA 1GKRA 3DFOA 1K9TA 2CBUA 1C8YA 1ITCA 3UEQA 1JI2A 2WV8A 2WM1A 2E9MA 3TQ0A 1HO1A 2EG6A 4FMVA 4D6CA 1H7OA 4YTSA 4H7VA 3WLJA 1B31A 3QLDA 1SO5A 3VA8A 3H4WA 1B57A 4IX2A 2IXVA 4OKDA 5MF5A 3LQLA 1SFSA 3SO7A 5JBEA 2EPMX 4RR4A 1B3ZA 3EMZA 2I9EA 3KZPA 1KTCA 1W3LA 1V51A 3WLHA 3TJ4A 3VIJA 4F66A 2DZVA 1KM2A 1UBPC 1NM9A 1KTNA 1CXEA 1VKFA 2YX0A 4A3UA 1NQ6A 4P7NA 1XYFA 5ABGA 2CERA 1OD0A 4J3VA 3MSDA 1GVEA 4GJJA 1W3JA 2ZFAA 4JX6A 2FDMA 4HPNA 1QK0A 5AB3A 2QAPA 1IT0A 2V30A 3ZT6A 2HPIA 2NX3A 3TC3A 1PTDA 5A8OA 1EC8A 1A4LA 3DERA 1WBHA 4LPCA 3A6OA 2XDFA 1VZWA 1TWDA 4AAJA 1CLXA 1OEPA 3IJQA 4PTWA 2J7HA 3H2EA 4LAUA 4YTUA 3C56A 3WL0A 4XZBA 1O7AA 1OYBA 1OJXA 4Z0SA 4H8UA 4FXRA 3CQHA 4HMNA 4GGHA 4HP5A 3W1TA 2POTA 2J6XA 2YL8A 3WUFA 4Z2HA 2BGQA 1ZHAA 2CZVA 1ESWA 2DT2A 4DXKA 4LUIA 2A3EA 3H2FA 3BSGA 2OG9A 4HTYA 1AJ0A 1G4SA 1XLFA 4CQAA 1LBFA 4D8ZA 4PODA 2G8ZA 1OBAA 3NPXA 3CM4A 2Z4GA 4FNTA 4IMFA 3B8UA 4E4FA 4IJBA 3H8AA 4LC6A 2PC8A 4XZ9A 3CNYA 3QMTA 4EX4A 4H3DA 3VDHA 2Y8KA 1JAKA 1YTKA 3ARRA 1IWPA 2WC7A 3UY7A 4KPLA 4H83A 4BF5A 4IP5A 1OM0A 1RBAA 1J96A 1Q7MA 4IIEA 2I17A 3SIZA 1KFKA 4UCGA 1R0MA 1KLZA 4W7WA 3UJ2A 4QCEA 1N82A 1BWKA 4U4MA 3WK0A 3RLVA 5J5RA 4GZEA 1KA9F 1HP5A 1U5VA 1WXZA 1KV8A 3UJEA 3CS2A 2WKLA 1JQVA 2IXUA 4QNEA 2YL9A 4WDWA 2WHJA 3GO2A 1E0TA 1VPYA 3MI3A 3U48A 3VM5A 3WEOA 2E0PA 4MY1A 4UTWA 1DEDA 4LS2A 1MZRA 1SO6A 4GZJA 3VNYA 3KTXA 3C3NA 4GINA 2ZX6A 2XU2A 4MUPA 5DRCA 3MMTA 2GVEA 1KFWA 3A4AA 1V3IA 4XD6A 4PEEA 2OX4A 3SI9A 1TG7A 4M29A 5HR6A 1IT7A 4Z1CA 4BEUA 2HNHA 2VEMA 4ZOBA 4O0ZA 3N6QA 3TH6A 4JDYA 1XRSA 4Y9MA 3L4ZA 1LF1A 4RNFA 4F2BA 3CZKA 3Q94A 3TWAA 4J3SA 4DUWA 4O1DA 4UR7A 4INFA 2NLYA 5FEWA 2PDMA 3UNDA 1WQ5A 4A22A 5E70A 2ABBA 3QFWA 5CSRA 2XVPA 3WDIA 3DIPA 2H8ZA 1J11A 4NL1A 1X98A 3QGVA 4MZYA 3CUJA 1A4MA 1P5BA 1VBRA 5FA5A 1DXIA 3S2CA 2J27A 4GOAA 2WHMA 1WNOA 4L5ZA 1YTDA 2VD8A 5LA2A 1IXNA 4HPHA 1NY1A 3FVDA 5ABTA 1E5NA 3RR1A 2ZVIA 3COTA 4HA4A 2BBFA 1DPMA 1TO3A 4JTDA 4U3AA 1ISXA 1FFRA 5CQ1A 4H4IA 2J62A 2RUSA 2DW6A 1OF6A 3AC0A 1FWJC 3DC0A 4C90A 2QDHA 3S5SA 1VC4A 3TQVA 3HA1A 3W7OA 4NF7A 4PMJA 1SZGA 1UH4A 3F5LA 5CZKA 4FLSA 3KHDA 5AECA 1PBGA 2WQDA 3TDFA 2WC3A 3IUHA 1DIEA 2J4GA 4LVDA 3W2UA 4HCLA 1AG1O 3E12A 2D0HA 3EOLA 4AXKA 2J9ZA 1POJA 4TTUA 2FHBA 1A5AA 2QEZA 1MO0A 1JRBA 2J7EA 4RV3A 4H9UA 4W8BA 3WQGA 1PHQA 2PEVA 3KOWA 3BGAA 4PRWA 4RNIA 4MGGA 2ZA3A 1BQGA 2WXDM 2C16A 2CC0A 3OBAA 2YYUA 3PAOA 4JTQA 3RCMA 4RZ4A 2Y62A 4IH3A 4AMCA 3WH9A 1Q7ZA 1QCWA 3TQPA 2YZRA 2WNWA 4KFOA 3STEA 1EHAA 3NO3A 4XBKA 5K7JA 2QF7A 3QQ1A 4RDWA 1XL9A 4PCFA 1UH3A 4TUFA 1TCDA 4US5D 3BW3A 2HE8A 5D04C 4DNMA 3GDMA 2ASHA 4UTUA 3K1GA 2E9LA 1NF0A 3R8HA 3T9PA 1E6XM 1RY0A 2WYSA 3KS6A 2G95A 3GH5A 2BMBA 3QKZA 1P6CA 3KCJA 3E6EA 1NP0A 3OA5A 5A6SA 2MNRA 4ZQOA 2WVTA 3DU0A 4ZQMA 1ZALA 4LVGA 1EWDA 4WKHA 1K1DA 3VC5A 3A23A 4WKFA 3NQ6A 3IJLA 3MS8A 4XZIA 3P0WA 3B97A 1XWYA 5FJIA 2GVGA 4N9BA 4LH8A 3KE0A 5DMMA 4IT1A 1R7AA 1WP6A 5AYIA 1L6YA 2QCGA 5T91A 4XSMA 2QYGA 3W1MA 4DN1A 5E0FA 4CD8A 2OMAA 1JEZA 1F7BA 3EDEA 3C52A 1WKYA 3EPOA 3OVRA 3DGRA 4LYPA 4C6OA 3LZ3A 3UWVA 3WUGA 4GUIA 3IEBA 3HZ3A 3M6DA 2IQTA 1TRDA 3CLMA 4LX4A 1W9PA 3PUEA 3ABSA 2PCQA 3H55A 3QHNA 1UOZA 4CCEA 4GK8A 2NT1A 4F40A 1UKPA 3B9DA 1ZU8A 1BG9A 4LUTB 3NUKA 5M5DA 5CC3A 4V1YA 1Q6RA 1XC4A 2XVKA 4GQRA 3WLPA 4AIUA 3BLLA 4QTGA 2VX7A 1SJBA 2YR1A 5C5YA 1DKWA 1EDGA 4N4QA 1ALDA 3W75A 4H9VA 3G1AA 4TMCA 3A5FA 4I7UA 4ZR8A 1VHNA 5BMXA 4D1IA 3PZMA 1PWLA 1TMQA 4JIEA 3GR4A 4LUTA 4TX9A 2BHUA 4MG4A 1XM3A 3H54A 1KM5A 3BL3A 2A7PA 5H8PA 1KCZA 3EXTA 3WQCA 1Y8BA 2TSYA 5LHEA 3UXLA 3C61A 1TMLA 4FAMA 3WX7A 3G0XA 2FVMA 5D4YA 2O9OA 3G0UA 1XCFA 4HOXA 3TN4A 1MFVA 5DX7A 2VR5A 3UPWA 3VD7A 1EEPA 3STFA 3PN8A 5ABHA 2VCCA 1DJZA 4L6HA 3WYZA 4ZVJA 1ECEA 2W27A 1TQXA 3AJXA 3BJTA 4QJ3B 4ZTXA 1Q66A 3LSCA 4IQDA 1BPLB 4MIMA 3UGRA 3S9IA 3FKRA 3M7SA 2P50A 2O9PA 3VZXA 1WDWA 5G2HA 4V28A 1HT6A 1Q6OA 1FDYA 3B0UX 1W9XA 3S1VA 1TWZA 3VOIA 4AD0A 2E7FA 3EEGA 1XIFA 4A35A 3WKZA 1HL9A 1TTPA 2RHGA 1QWKA 1EBGA 1JVNA 3FIGA 1VYRA 4F9JA 2CBIA 1SU5A 3C0SA 3UBPC 3KVKA 1OT1A 1V02E 2EJ1A 4PE8A 3SADA 4CGTA 1JZ4A 1S3HA 2EKCA 2GFTA 3SJ3A 4H19A 5LA0A 3NYDA 3A4WA 3WUEA 3SGUA 3AFBA 3UXIA 2FTWA 1D3HA 1XKJA 4A6GA 3C2EA 3T05A 4UBPC 3QF0A 3HQOA 2PWHA 3W6MA 2E25A 4CU8A 1AQHA 2BVYA 1X97A 1EL3A 4BZYA 4LUSB 3M5YA 4E4UA 2QDGA 1ZRQA 2YL5A 3OOQA 3CAWA 2IKHA 3FA3A 4JGDA 3PB0A 5L6UA 2YW3A 4H00A 1ZY9A 4L9ZA 3APYA 3NM1A 2HRWA 5H6HA 4U2YA 3NWRA 4LUSA 1SZEA 3UGVA 1A5MC 4GQQA 3HGOA 4M24A 4XO6A 3K5XA 5K9DA 4FOKA 3LBCA 5DF0A 3UPMA 1O68A 4JY9A 2ZC8A 1TIWA 1BFNA 2V3DA 8RUCA 2G4JA 2J79A 4L1XA 2VGIA 5FJUA 1JZ3A 3LHVA 1S5MA 3C3UA 4C6QA 3BUVA 2PS2A 4FPSA 4ZO9A 3N2BA 2C3ZA 4UQ9A 2GOUA 2QDDA 1EC7A 4CQDA 2HROA 1G5AA 2KZHA 4MKSA 3GDTA 5I3FA 4Z17A 4CQBA 4UTLA 1T6MA 1W0MA 1HL8A 4JN7A 4J3ZA 3P0XA 1GHRA 4D72A 1VFLA 3C2FA 5E93A 4J35A 4XKMA 1HJQA 4LXFA 1NDVA 1W9UA 4I7WA 1XICA 1JPDX 2ZZ2A 3IWPA 1XG3A 5HUPA 2V67A 3HOJA 1LP6A 3HMCA 1NH6A 4PB5A 4QP0A 5EPDA 1XGZA 1S5VA 3BV4A 2CESA 1HGWA 4DXXA 3KDOA 3CHDA 4CCDA 1C7SA 3HV8A 4E2BA 2FH6A 2FPVA 2W5FA 2XJ7A 1IWAA 4NG3A 4GI4A 4JTGA 1OX4B 3AS2A 1W8SA 3SM0A 1ZAIA 1R9YA 1SO4A 3WQ5A 3WQEA 3CIWA 3L2MA 1W3TA 1HKMA 1TRIA 4LAMA 4RCXA 1S3TC 2Z1XA 3N73A 4GJ1A 6TAAA 1OX4A 2FMNA 1Z48A 3LUTA 4AIOA 3W71A 3GVQA 2GQ9A 3MHGA 2WLYA 2JKAA 3N11A 3NCOA 1EYEA 2DIEA 2WMFA 3GNPA 4IMGA 5A8PA 1OFRA 4YVPA 3TZFA 1F6KA 4XAGA 1TR9A 2VC5A 3QV9A 3T07A 1TZ9A 4O8AA 4E4PA 3QLLA 2CFFA 5HNNA 3L67A 3TV8A 4WY0B 3R4IA 4DF1A 2PTZA 3USBA 1G7UA 1R47A 4KEVA 1ZJAA 5FJOA 1UIOA 3WZ0E 1V4YA 1FTXA 3AHTA 4XAZA 2OZTA 4CD6A 2OYMA 1M7JA 4UOJA 7XIMA 3EWWA 4UIOA 2SFPA 4H2HA 3C2YA 1YBQB 4AEFA 2VTFA 2IUZA 3M43A 4WY0A 5LNSA 4LUJA 3BC9A 4H7CA 3KL0A 1B5TA 3TAOA 1S2VA 5E0KA 1Q3NA 4B9YA 3TUUA 1GZJA 4D8LA 4NUWA 3LGEA 2VZSA 3R8RA 2ACSA 1G4PA 4JY8A 1YBQA 3F4CA 4GY1A 3DDMA 5D2TA 5I3IA 4PH6A 1R87A 5CPNA 1N8WA 1KKRA 1MXSA 4HB7A 4LY4A 2QJGA 3EA2A 3A21A 3P5YA 3GDKA 2CXEA 2GGJA 4B2DA 4LBUA 1SM9A 4DO4A 1J0YA 3PS7A 1LWHA 1Q85A 5HMFA 3FEMA 3B0YA 2DZTA 1PV8A 2XVGA 3CL7A 1X8CA 2WSQA 3SCWA 2NLIA 1A49A 1KR1A 3IJIA 3LBOA 2F6UA 2WMKA 3TTEA 4Q8OA 2NZLA 4LCSA 1FWRA 3OA3A 3T78A 2W6RA 1DJGA 3RHGA 2XZ9A 3NL3A 3QV6A 1VFMA 1IXPA 1D3GA 3MVTA 3OODA 3RCYA 4ZBCA 3M41A 1GQIA 4MNMA 3RU6A 1XIBA 1CBGA 4QEHA 1VIZA 4XZNX 4CD5A 1CENA 3QSRA 1UKSA 2H3BA 2VUYA 1GWJA 3W2LA 1PDYA 1EO7A 2YB4A 1TYGA 1TE6A 3BMXA 3H4GA 4Y9OA 1E4NA 5G2IA 3C2RA 3RR4A 3I4KA 3LHZA 1DL3A 4KW2A 3URQA 2OQYA 3C6CA 3MKCA 4MKVA 2DT3A 3PSWA 4RW3A 5BOFA 5D2WA 2A85A 4D6JA 1P0KA 1MRAA 3G6LA 3T44A 3VNIA 4RLIA 4C6IA 4F2UA 3CXOA 3BLDA 1MRQA 5A6KA 1CDGA 3L23A 3AWNA 1TV5A 1KFJA 3QSTA 1TV2A 4JIIX 2VQUA 4FR6A 3EB2A 5CZ0A 5I3HA 4PCNA 3NPWA 2YBTA 1RXOB 5D2VA 3DG6A 2QUNA 2QVNA 4XQ6A 4B3LA 4JTKA 1TJ1A 4PMDA 5B7ZA 2HE5A 4MZ8A 5FEZA 3I10A 3L66A 1HKIA 1ZAJA 3GWQA 3MT1A 1M7XA 3W7HA 5K9CA 3GQYA 1CXLA 1NTHA 3DESA 5EMUA 2ZX7A 3QMRA 3D3AA 3BAYA 3M9YA 2O7QA 3WNLA 3V3WA 1EDQA 4DX3A 3R0UA 3GU1A 1KBKA 3MYOA 4LC8A 3W7IA 3VNKA 1A47A 1I0DA 5LIYX 3T0BA 3G24A 2QCHA 1QI3A 1GPFA 1OCQA 3OIXA 4GI9A 5CXPA 3C8NA 1OD8A 3O05A 3QV8A 3SRFA 4C6CA 3R8GA 1FVPA 3LBMA 3E0VA 2PDIA 4FZIA 5LXXA 3W74A 1E71M 4QR6A 4I9JA 5GJNA 5XINA 2GDVA 3UWQA 1FWEC 5HQLA 3NPVA 3MI2A 5LHFA 7ODCA 1BYDA 3PPGA 4ZE5A 3VMOA 4J40A 2D3LA 2Q6ZA 5I3DA 3NURA 1F61A 4AW7A 3ECQA 2WK2A 4DZIA 3T08A 1HG3A 2QCEA 3O07A 1U33A 1AH3A 2ZWZA 4KBXA 3UY8A 5CCZA 3QGAC 4XD4A 1FOBA 2C8NA 5CAHA 3KWXA 4QNWA 3URNA 5A1AA 3NM3A 1JL8A 4IPNB 3U4FA 1F9CA 3WQPA 2XH2A 3LTYA 4QG6A 4D2JA 3NSXA 2FZMA 2J7GA 4H01A 2XGBA 3O2LA 3AHYA 2A3AA 5GJMA 1JFHA 4QQUA 3SAZA 1W1A1 1W5QA 1VJSA 3G2GA 4TOQA 2YA2A 1B3OA 2G97A 5AOUA 3BSMA 1KKOA 4QE1A 3LCFA 3E3HA 4KRTA 1EJVC 3IIXA 3K8LA 4US5A 1XD1A 3GRIA 5KZEA 4AXNA 1UKQA 3EX1A 4DI8A 2PDWA 3VNDA 4U31A 1K70A 1HUVA 1YE4A 1TPFA 4TX8A 1C9WA 1HVXA 3WBWA 1JCMP 5JUVA 1QW8A 3KP1A 3NL2A 5DELA 1UD2A 2W62A 3PZTA 5G1TA 4HYVA 2TMDA 3N4AA 1JYWA 1H4PA 2DVUA 3CWOX 4AQLA 1IHIA 1MUWA 1Q7QA 1VF8A 1AUSL 2V9DA 3FLUA 3WLTA 2MANA 4JCLA 5I07A 2PRMA 2W3ZA 3GW3A 4HHHA 2DW7A 2TYSA 4F0LA 4AF0B 3LHTA 2O92A 1SQ7A 3EOUA 4N6FA 3OTRA 5HDRA 2AAMA 3WK3A 3CMFA 5G5IA 8CGTA 1RSCA 1ICQA 1FHDA 5C70A 3H7VA 3ZJKA 4NRRA 4W87A 3VE7A 4LBSA 1R30A 4R9XA 2PF8A 4C6L<