4AX6A

Hypocrea jecorina cel6a d221a mutant soaked with 6-chloro-4- phenylumbelliferyl-beta-cellobioside
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPASLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXOGLUCANASE 2
publication title Rational Design, Synthesis, Evaluation and Enzyme-Substrate Structures of Improved Fluorogenic Substrates for Family 6 Glycoside Hydrolases.
pubmed doi rcsb
source organism Trichoderma reesei
total genus 127
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4ax6A00
2BODX 1QK0A 2BOEX 4AU0A 1HGYA 4I5UA 1UP2A 4AX7A 1OC7A 2BOGX 1OCNA 1DYSA 1HGWA 4I5RA 3VOHA 4B4HA 1OC6A 1OCBA 1UP0A 1OCJA 3ABXA 3VOFA 1QK2A 3VOJA 4B4FA 1BVWA 4AVOA 4AX6A 3VOGA 3A64A 3A9BA 4AVNA 3VOIA 3RPTA 1CB2A 2BVWA 3RU8X 2BOFX 1QJWA 1UOZA 4A05A 1UP3A 1TMLA 1GZ1A 1OC5A
chains in the Genus database with same CATH superfamily
5AHLA 1JRBA 1IXPA 1VBHA 3IRSA 4XZIA 3EX1A 4HQVA 3FV9A 1CLVA 4GD0A 4HVXA 1QHPA 4H7VA 1NDYA 5HXMA 1Q7QA 2TAAA 4TUFA 4JIEA 3P60A 3JZUA 4MZ8A 3WMLA 3GG0A 1BRLA 3TTYA 1HKVA 1KRBC 4ECLA 5AFDA 5CPQA 3BAXA 2EPKX 3ZLHA 5I07A 2D2GA 2REQB 1OF6A 1KCXA 4UTJA 3GNXA 3LCWA 7PTDA 5F4XA 3BG5A 3W3OA 5HULA 1L6FA 4HZ6A 1RBOB 1A3WA 2J7FA 1FCBA 2FVKA 1YMYA 4KMQA 1JGIA 1IWBA 1Q4WA 4WJ8A 2J77A 3ZZ1A 1E3ZA 1CZ1A 2XSXA 5TAOA 4DXVA 3WQ4A 1GJWA 1LWHA 3SCUA 4M81A 3V3WA 1P1XA 2AL2B 3DERA 1AJZA 3HQ1A 3CC1A 2VR4A 1V0MA 5T9BG 1SFSA 3PSWA 3TZNA 1TTQA 3B9AA 4QJ4B 1JUKA 3W82A 2ABAA 1HP5A 1QCWA 5RUBA 5D9OA 3B9NA 2ISFA 5LZLA 3GTXA 2J47A 3MWCA 1E0VA 7REQA 2OSYA 4J3ZA 2X8RA 1CIUA 2GQAA 1XSIA 1DJNA 4LV4A 3W2JA 2OVLA 4DZIA 4YHEA 1PZ1A 9XIMA 3QJAA 5ABEA 4PFMA 3UERA 1QPNA 4MJ4A 4LAMA 3OPSA 3SSZA 4ZSUA 2TSYA 3NIYA 5I78A 2VDGA 5E1QA 1Q2RA 3W4RA 1M5WA 4HYWA 3GLCA 1P6WA 3L0NA 3K46A 2XTKA 1SFTA 2FYMA 4EPKA 2ZA3A 1NWTA 2YYUA 3D0CA 3RLUA 3GS6A 1MQPA 3CLMA 1BYBA 1NY1A 2PC8A 5LSMA 3IAQA 4F0HA 5KEZA 1J0KA 1K3UA 1G4EA 3RILA 1QW7A 5AC6A 3VYLA 1IXNA 2WC7A 3EAUA 4GYJA 1PTDA 3P3BA 3E5PA 4AHOA 3AHTA 1BG9A 4EPBC 3AO0A 4K7YA 1TB3A 4YCOA 1DJGA 4J28A 6ALDA 3EA2A 4WLCA 1IXQA 3UCQA 3L65A 2NV1A 3SGGA 4Y96A 3UPMA 2AAMA 4Q4RA 1SO5A 2C3ZA 1V3HA 1JCJA 2PWHA 2WPGA 4DQWA 3N3MA 3ZJ8A 3QTPA 2WNWA 2D22A 2IXUA 1PZ0A 1VBJA 4TVUA 4DWSB 4AG0A 1OC7A 2R82A 3OG3A 3WUGA 1XRSA 3GG8A 1V03A 2NV2A 1I60A 3W38A 4X0VA 1E6ZA 3EPOA 5K4XA 4EF9A 4WF7A 1DJWA 3HMJG 1UMYA 1OYBA 4IXXA 3U7VA 5FJUA 1E9ZB 3WD3A 2H3DA 4A3UA 4RNJA 3QSTA 2FZ9A 4DXXA 2GVLA 1UD3A 1VPYA 3AIUA 2WZHA 3SI9A 4MM1A 2CXGA 4GZ7A 1YADA 2RDXA 5GPRA 4UMAA 3W85A 4DLMA 4CNOA 2V38A 2GDVA 1HKMA 3KHDA 5FL1A 1NFPA 3M5VA 1YW1A 4HU4A 2GJXA 1TPB1 1BWLA 2A21A 5A6KA 1EQCA 3K4AA 3G6LA 2NXHA 1EZ2A 4H9VA 5LNUA 3HZ3A 2YFOA 3BLPX 1FWWA 4JIHA 8TIMA 3JS3A 2GVJA 3LK6A 4G1KA 3KUMA 2V81A 2P50A 3USZA 3LMYA 1YX1A 4JHMA 1ADOA 1EWDA 1W1YA 3BLEA 1VYSX 1ELSA 3NEVA 4ZEPA 1AVAA 2YBUA 7A3HA 1AW2A 3I7RA 3FN9A 2ZUTA 1S1RA 3H55A 2BGQA 3M6DA 3NGFA 4B3KA 4O11A 3TLLA 2PD5A 4AW7A 2Z28A 1JL8A 1S2CA 2Y7FA 4D6GA 4BWLC 3ABSA 4XAPA 3EDFA 3D46A 4IFKB 4A8LA 4G7EA 5I0DA 1Z48A 4ZQRA 1XJBA 1H7OA 5LIUX 1DHKA 1R30A 4N9CA 1EO7A 2WQDA 3VNIA 3WY1A 4O1BA 3MDUA 5LNWA 3E5BA 6CGTA 4IISA 1TV5A 5EBAA 4WSKA 5CJ5A 4U10A 1F5ZA 2BDQA 4Q8UA 2E6FA 5G2WA 3CHEA 1TE6A 1UKPA 3IV8A 5DCBA 4GHRA 2OMAA 3N2OA 2VJXA 1UUOA 4H6KA 4UFMA 5C7HA 4IGHA 1OY0A 3VNKA 5LGXA 4GQGA 3W9ZA 1PDZA 1GJPA 2NVAA 3DFPA 1W1PA 2PDQA 3B8WA 1CX9A 4NYUA 2ZICA 1KC7A 3WQ8A 4AZ6A 1QNVA 1F7BA 1H0GA 3PC0A 4HPGA 4MZ1A 5C9XA 2Y6ZA 4GNJA 3IJQA 1O66A 5F2GA 1P43A 4HPHA 1TYGA 3CH9A 2PRHA 3WMBA 3BTNA 4AZGA 3NEHA 3VOFA 1EWEA 4MTVA 4QJ3B 1MFVA 3DFQA 3VI2A 1XLDA 2DUZA 1OD8A 8CGTA 1B1YA 5E0KA 3KLLA 1RXOB 4DB7A 3EOOA 2XINA 4O19A 2RGLA 4JHZA 4UFKA 3WNOA 2OYLA 4FXJA 1UD6A 3ABRA 4JCMA 4RUBA 4H9YA 1I2OA 1KXVA 3VOGA 1PXGA 5CJMA 3ENLA 4I8YA 2GVYA 3BW2A 2PD9A 4JL2A 5EMJA 1B30A 4KERA 4LUSA 4CD5A 2ZA2A 1CLKA 1W5MA 1RK6A 4QROA 1GOQA 3KDOA 3QM3A 1MDRA 1P48A 4GVHA 1BPLB 3UR7A 3LS9A 1JD9A 2J75A 1JCTA 3VOIA 1ZNNA 5B7YA 2VT0A 2PDIA 2XIIA 1CBGA 1V6WA 2F2KA 4GC3A 8XIMA 4PL2A 4W8BA 3AXMA 1W3LA 1TPVA 3NJ3A 3ORWA 4NJIA 4W85A 1OB0A 3VNZA 2ZC8A 3BAKA 4H9TA 3GVVA 4K1WA 2VQUA 4CVUA 2VGIA 3V5OA 3W23A 4PCFA 3G2GA 1DQWA 3E02A 4Q4KA 5AN7A 3E1F1 4DRSA 4YTTA 1UROA 3W7EA 1VIZA 1WDWA 1FH8A 4OJYA 3UNTA 4XBJA 4NASA 4IL0A 2Q71A 3PTQA 2WM1A 3A22A 2YA1A 5AC5A 3C2EA 1IIHA 3E2VA 3DECA 1VFSA 3L21A 1JZ6A 3R58A 3F7JA 3K4DA 4D72A 4K3ZA 2XVNA 1XW8A 4M8UA 1W54A 3AUOA 2R94A 3H22A 3L4VA 3UR5A 2WZTA 3QLDA 1BVNP 2WC3A 1RY0A 3BO9A 3S9IA 4ZCWA 2JK2A 4KCUA 2E25A 1L6SA 3ZR6A 5FJPA 3D5HA 4GUJA 1H41A 2QCFA 4G9PA 1A0CA 4M6PA 1RVGA 1ZAIA 2YZRA 4JTHA 3TN6A 3IJ6A 4ACYA 4Q33A 4NHVA 4XO6A 2POTA 1S2UA 4NZFA 4UQDA 3VDCA 4AVOA 3B9OA 1LL4A 2NXIA 2Y8KA 3GW3A 3W1MA 2QR6A 3W1NA 1Q6OA 4H8NA 2JKEA 4IUGA 4Y9AA 4F2BA 5AHEA 1SJAA 1TV3A 3CYJA 5FOOA 4BI6A 1GW1A 3Q67A 2VM8A 3RHGA 2PF8A 1F6KA 5L9FA 1GTEA 5I03A 3DC0A 2XFYA 3RDKA 2YDRA 1DE6A 2ZYFA 2BY1A 5EMYA 3B06A 4F0MA 1B90A 3LA4A 3QY8A 4KEZA 1LTDA 3ZWSA 4R7OA 3PPHA 2WCSA 4CNUA 1UR8A 3URAA 2YSWA 3WFAA 2W66A 3TVAA 5CAKA 4AWEA 1KA9F 3H12A 1MO0A 3SIMA 3RMJA 2WKLA 4DN1A 1CENA 1OFEA 1ZJHA 3VKDA 1GYLA 3IVSA 5A2AA 1DVJA 1KRCC 3GXPA 4EXAA 4ZO9A 3UCCA 4GUHA 1GWJA 3CJPA 3FKKA 1JNDA 1TV4A 3LM3A 4EF8A 2A79A 1CCWB 1FWFC 1NIUA 2NX3A 3W2NA 1ONEA 2J79A 3RLHA 4FP1A 4WDWA 3H4GA 1MFUA 5FACA 3EB2A 4FHAA 3O6AA 1A5KC 5HAOA 1K7FA 1CXIA 5U4NA 5EFDA 3N1AA 1FFRA 2FTYA 3A4XA 3SUWA 3LXCA 1I8JA 3SADA 2UWFA 5CLWA 2CLIA 3GDRA 4KIEA 1TPEA 3ARPA 1K6AA 3UR2A 4JNYA 5G5IA 4WK9A 1G4SA 1WUFA 3BW3A 3EEZA 4W9TA 5D9MA 1VBRA 4JIRA 3W2UA 2RUSA 4PTXA 4W7WA 2HMCA 4J3UA 2BVTA 3W29A 7ODCA 4AF0A 3PJWA 5G1MA 4JKMA 4H1ZA 4HYVA 3VM5A 4OECA 1C93A 2ZZ4A 4JEJA 2XWDA 3KBNA 1JYXA 5C7VA 2C1IA 1PHWA 4MNKA 3VGDA 3E0VA 2CERA 3W6LA 3SDOA 3UG5A 1J10A 2FMNA 3T05A 2GFTA 3AC0A 1JEZA 3PZUA 2ICSA 5LA0A 2E09A 5HWJA 4KWUA 2WZEA 1OGGA 3H70A 2WKJA 4HA4A 3PB2A 3WH7A 5HMSA 4UXDA 4JX5A 3CV7A 3N2XA 2WSRA 1EP2A 4HP5A 4E4UA 2XFFA 3FW6A 3R5EA 3TJLA 4AHPA 3HPXA 3P74A 1ESWA 1JVNA 2PCEA 1OBAA 2PC4A 3C0LA 4AEFA 3IAPA 4MWAA 4XZWA 1TTIA 3WQOA 4IM4A 3LCFA 4NAEB 1TFVA 1XKJA 1EJVC 4PODA 3TWAA 5MKGB 1Q85A 4AZHA 3SN0A 4ZB5A 4O16A 3QHMA 3GHTA 5FKYA 4KWOA 2ZRUA 3WELA 1R3WA 2WZIA 3ZLFA 5CAHA 3VUPA 3TA6A 1GG1A 2CZVA 2J9XA 1Q4NX 1XIEA 1X8CA 2V3DA 4FNSA 4IG2B 2FZMA 3WLOA 5IFTA 5IFPA 2X1IA 2Y88A 3FFSA 3NDOA 4ZE4A 3RCMA 3CQJA 3PZVA 2BXVA 1XLEA 1W3KA 1A0DA 5LNSA 4S39A 1TVPA 3CZ8A 2E8YA 3AXHA 3I7QA 3W75A 1L2UA 3LDVA 3NL5A 1PE1A 4ZFCA 3PUGA 1NVMA 2VEFA 5T8GA 3RM8A 1J0ZA 3M7SA 3LM7A 2ZRVA 2OG9A 1Q6QA 4B5XA 1JCLA 4P7QA 1E6RA 1IIGA 3MSDA 2Y1HA 1DWJM 1C8VA 4KPLA 2VTFA 5I6SA 2PLMA 4CU6A 4M3PA 3HOJA 1Z89A 2YLLA 1VF8A 3HQNA 1PKNA 1TR9A 4UQCA 4XKMA 3GIQA 3E2RA 1XIDA 5KITA 3VDHA 4JY9A 2YW4A 4HU3A 3VDBA 1XC6A 4QFUA 3KAOA 3JR2A 3W37A 2F6UA 4RE2A 3C2OA 1HUVA 5JVLA 4GQ0A 3WLIA 2X41A 3QLLA 2DSWA 2EKGA 2GGIA 1V79A 1V3KA 2DH3A 4W89A 1VLWA 3EEGA 4HNNA 3A12A 5LXXA 3RCYA 3VIGA 3N11A 4I6KA 3I3DA 5EYWA 3P61A 2EG7A 4I9JA 4LUTA 2CBIA 3FK4A 3QR1A 4ZOAA 3BURA 3LPFA 1OABA 2PS2A 3DI1A 3INPA 3N19B 5AYYA 2G4FA 4AZ5A 3B04A 4L4LA 4DYEA 1EZWA 1J11A 4JYFA 3U7BA 3OHMB 1PX4A 2EKCA 2H9AA 2YCLA 1N55A 2D0FA 2TMDA 4GFIA 3RFAA 4FX6M 1RQEA 3FOKA 3CAWA 1W5NA 2GJPA 1ISXA 4M51A 2PDBA 3LXAA 4LY8A 4IMFA 3T78A 3BJTA 3PG8A 4NY2A 1GT8A 3WJYA 5IHSA 3AWOA 2TODA 3AIQA 3CEPA 4DPQA 4Q3MA 2JE8A 3L7RA 1EUNA 1R3VA 3F2CA 4Q7IA 3IUDA 3QV7A 5D02A 4GXMA 1S3TC 1GONA 3W7QA 5BXSA 4HSNA 3FGCB 3WF1A 3OEXA 1QNSA 4XX6A 1H51A 3CH0A 3U3HA 3QPZA 1LG1A 4JIPA 4IFRA 4F4RA 4L1XA 2ZADA 4M1RA 1I75A 3B03A 4Q4SA 5EA9A 6REQB 1QMLA 1QNQA 3ARQA 3W00A 3ZVHA 3EBVA 3MU7A 2NSXA 4N4QA 4MWAE 5AYXA 1LG2A 4PC8A 2DW7A 4FLQA 4HBKA 5BWFA 3AIWA 3AAMA 1QUMA 3WZ0E 3KBVA 4H7CA 1HJWA 1E0WA 3P6LA 2OYKA 3PBUA 4KRUA 3AISA 1EDQA 3AXIA 2Z2UA 3B0XA 1GYMA 3KOZA 3S8HA 4ORMA 3AIEA 3LY0A 3DAQA 4KRTA 3L0KA 3S5OA 2FFCA 1XYLA 2YLAA 1XD1A 2VEKA 2E4TA 3P80A 5J04A 4IXHA 5A8NA 3CUJA 1HX0A 4A35A 4GYFA 3W6YA 4BQ3A 2PZNA 4XVDA 4GYKA 3CM4A 1NEYA 1RJQA 4QDPA 5HNRA 1C9WA 3T7VA 3C56A 2X1SA 1H49A 2OSXA 4IPJA 1DJHA 4GNVA 1W1TA 4M7TA 1E5NA 4ALDA 5DF0A 2E9LA 2OX1A 4LH8A 4LAZA 2TYSA 3CWHA 5CJNA 4MPQA 4L9YA 4CN6A 1LQ0A 2Y2WA 1AA1B 1AL7A 3AHZA 4ZFMA 4FLOA 1OIMA 3ARTA 5CZ0A 5MHBA 4PMNA 2EBNA 3O7UA 4CGTA 4MIMA 3LPOA 4M5PA 3W7IA 3NSNA 3VFCA 3W2MA 1H7XA 2R1LA 2D23A 2KX9A 4DXKA 3O63A 4JNZA 1XL9A 2ZBTA 1QBAA 4B5SA 2VKZG 2OLAA 4YN5A 4JTIA 4I5RA 4HPNA 3UJEA 4HMNA 4GLEA 1F3EA 3P62A 4LC8A 2NT0A 1XLJA 1E3XA 4L6DA 3W25A 2B7OA 1YNYA 2QV5A 3URQA 2AKMA 2BY3A 2O4QA 2IKJA 1C92A 2OOGA 4OV4A 2XVPA 5I09A 1P0NA 3T40A 2HJPA 1U22A 5HPOA 3TP4A 1BGAA 3GC4A 3VKKA 3QGVA 2F8QA 1HF6A 3BLLA 4S3BA 4MKNA 4QXIA 7ENLA 4BHYA 3WKZA 3IIXA 1FH9A 3ANUA 1FWAC 3W1TA 4CEUC 4BS0A 1H4PA 3G1YA 4WSHA 4DO6A 4AD4A 3O15A 2PRLA 5JMUA 1R7OA 2YR1A 1WX0A 1DKWA 1TIWA 2QAPA 2HSAA 3CAVA 2BVDA 3P14A 3U0HA 4DO7A 1E0UA 1Q6RA 4UNIA 4FXFA 4PB3A 3W1RA 4U5IA 3VNMA 3GHRA 5DT5A 2FPTA 4K1GA 1O5QA 1TSIA 1E73M 4LOCA 4ADUA 1TWIA 3RXZA 1RVKA 2OODA 2QJIA 5C5YA 1P6CA 3PF3A 5LYRA 3VD3A 2ZC1A 2VMFA 4JQ1A 5GNZA 2VO5A 4LB3A 3M5ZA 1FHUA 3C6CA 3GD6A 2NVCA 1X7IA 4WCJA 5HWNA 4O54A 4PMXA 2D69A 2RJHA 3TDFA 3PB0A 2WVVB 1PZ3A 2CWXA 1X1NA 2VWTA 2C1HA 1XCXA 7REQB 3DG7A 3GFXA 3PAOA 2VFFA 4LBUA 1W3JA 1V6UA 3DDMA 2C7FA 3HB9A 3VOHA 2QUNA 3NURA 1CXHA 4AC7C 1JYVA 2C0AA 3NOYA 3VGGA 2I17A 2P3ZA 3AZRA 1WQ5A 5G1TA 1EPXA 2J6XA 3GYCA 4JDYA 5A2CA 4W5UA 1QT1A 2E9MA 4A3YA 1XSJA 3RO6A 4YYCA 4HSHA 3WJZA 4EWND 4DJDD 3G77A 2WWCA 4HHHA 3Q45A 2OCZA 1A5NC 4LVBA 4ZENA 1UBPC 1NJJA 4DUVA 2QF7A 4UTLA 1QWGA 5FA5A 3T44A 1L2QA 3V1HA 2HE8A 2J66A 1XIGA 3B8TA 2XVKA 3ATZA 2WC4A 1OCJA 3IK4A 2PDFA 1V6TA 3LHTA 3KFTA 2WB5A 2YDSA 3KBJA 5C54A 3RU8X 1DQUA 1U30A 4JTFA 5HOSA 3A4JA 4G5DA 3GXTA 1GVQA 4H9ZA 2CYGA 2QVNA 2WOQA 1QW9A 1ME9A 5CPTA 3VDAA 4MKSA 5EPDA 3W7GA 2VUYA 2X1TA 1XR2A 3ZMRA 2GJRA 3TN5A 2EEXA 3V4BA 5JUVA 3WLLA 2V3EA 3CT2A 5M3WA 3NVTA 1XQKA 3L4TA 4YTRA 3M4HA 5FJJA 4MWAC 1BTMA 1U2YA 3CV1A 4A2RA 1V4YA 1OZQA 1MW0A 1EA0A 3IJLA 1QOXA 3MKKA 3DI0A 1YEYA 3O3RA 3IVTA 4GY0A 4WKHA 2VC7A 3R0UA 2JIEA 2YZ5A 1MVYA 3TXVA 5A6SA 2Z2BA 2C14A 4B9ZA 3KZSA 4XD5A 4PUUA 4YYFA 2A2IA 1MNSA 3ABXA 1JUBA 3TROA 1BWKA 1Q8JA 4GQRA 4IIEA 2FLIA 3F5LA 2GUBA 3QY7A 4PMDA 3GM8A 3KRZA 3DCPA 1TV7A 3GY1A 4IZGA 3T8LA 5HMFA 3B8DA 3THAA 4X61A 1MRAA 3WD2A 4DI8A 2QCGA 1KKOA 4HNOA 3CHCA 2WHJA 1UKSA 1V6XA 3DEQA 1TX2A 1Q6DA 2VL4A 4GXWA 1D2KA 1AFSA 4M6UA 4UR8A 3MI6A 2V8ZA 2OEJA 2UZ9A 3QH2A 4ROQA 4BK9A 1XDJA 4MSSA 4UTWC 3O9NA 1V6VA 3CB3A 1OCBA 4L65A 3PUEA 2J7EA 3GU1A 1ZY9A 4KWSA 3TYZA 3IIVA 1THFD 1XLHA 1H62A 4JX4A 1ZS2A 3CEUA 2GDQA 3AZSA 2OXNA 4MLJA 1E0TA 1B4EA 4C6OA 3L2MA 3QR0A 2P1FA 4YXGA 4JN8A 4ICNA 4G7EB 3VNLA 1M7JA 3W1AA 2XVGA 3DOPA 1F4AA 1XBYA 5GQBA 2H8ZA 5JXQA 3ITVA 4MB4A 4EANA 5CGQA 2WXDM 4N7QA 4D6JA 3H2AA 1BLIA 1YXCA 1KM2A 1Q6FA 3S6OA 5H8PA 3LLFA 2A7PA 2Z4GA 1KGWA 2DU2A 3IK2A 4LRTA 3KBWA 5E93A 2ISSA 1VB9A 2P88A 1L6YA 5FAJA 3CL7A 5KMYA 4KW2A 2ZZ3A 8XIAA 3N9RA 2HE5A 3USBA 3C52A 2NVDA 5D2YA 4PCPA 2EJ1A 3MKCA 2GVGA 3RLVA 4PSRA 3TW6A 1V0KA 1AK5A 3LNMA 4OU1A 3EMQA 1V51A 1YQ2A 2CWNA 3U2CA 3TU9A 1MW2A 5FL0A 4JD4A 1NDVA 2QUUA 4H7ZA 4KESA 4GH1A 4E3VA 2CKRA 3DFYA 1XYMA 3BK0A 1VQTA 2F38A 1PO9A 3IJ7A 1P1MA 4C6CA 4FOUA 2DH2A 1NSJA 1QI5A 2VGFA 1HT6A 4K8EA 3LERA 3U2OA 1QOPA 3A5FA 4S3JA 1Z9AA 3PY2A 4EKJA 1HGYA 3T0CA 1EEPA 4GCXA 3GRIA 3CMFA 3PWAA 2G41A 1WUEA 1OFRA 5LKYA 2ZXAA 2HQAA 3ZM8A 4HPJA 1U1JA 4GVIA 4BI5A 4LF2A 2Q8XA 1KQYA 3SJNA 2DQWA 1W8SA 2CLLA 3KCJA 2RKXA 3EWYA 4Q22A 1VZWA 4Q32A 1SSGA 4IIBA 4AZIA 5D9NA 1M7XA 3CPRA 3GHUA 2V5CA 5M2FX 1VKFA 3B0YA 2XM2A 4S2BA 5CZSA 1H60A 1LBMA 1B9BA 3C0QA 5I3HA 3S2CA 4OBSA 4D6IA 3R10A 4WXZA 4HHMA 4XAYA 4HOZA 4QIUA 7XIMA 5D8WA 1UIOA 4GY1A 2BB0A 4RZBA 4NZJA 2W9MA 2INZA 4AZ7A 3WH8A 3R4IA 2OQYA 2PFHA 1MYRA 2GGGA 4C6JA 2BBFA 1I4NA 1TRDA 3BUVA 1A5CA 2GVEA 3VIIA 4MNJA 4DF2A 3LCIA 3VIFA 4EP8C 4D71A 4BZYA 1H09A 5AC8A 2QGHA 2E9BA 4KCTA 3ITYA 3GBEA 1QI0A 2F6KA 4GG9A 3K8LA 5EMKA 3O6YX 4F2TA 4XZLX 2QCDA 4MB1A 3TZFA 3B0UX 4JTGA 5CPNA 1TCMA 1CXLA 4DJFD 2DZUA 1BD0A 1UOZA 2V30A 5FF7A 1X6LA 3QEZA 4J27A 4GABA 3GIPA 1W17A 2PDGA 1ITCA 3H8AA 4GZJA 1E1FA 1B54A 4U3AA 3S9ZA 4RDWA 3R2GA 2J88A 4TIMA 3ALGA 5H6HA 2J7BA 4E6MA 3LV5A 4MZYA 3BLOA 3AI0A 3SW6A 4MGGA 3N3TA 1GVEA 4G6CA 4US5A 4LEFA 3E0WA 3GXMA 3LG3A 4Q7BA 2PTXA 1P5BA 1FDYA 4AD0A 2OZ8A 5M17A 3ITLA 3LU2A 1W3IA 1TZ7A 3SY8A 3BV4A 1R8LA 2XVLA 3FAXA 1E0XA 1BYAA 3VABA 2DP3A 3MSGA 1H3GA 1J93A 1OX6A 2BODX 4LV9A 5A8OA 1U5HA 3ZS4A 4GACA 3G1FA 5K4ZA 1V7YA 2NLIA 3C2FA 3HN3A 3OYZA 4HMCA 5EGRA 2ZIDA 3L0GA 3VNDA 1RJPA 4EXQA 1J8VA 2J7GA 2CHRA 4LWWA 3QMSA 1E4NA 9CGTA 4IT1A 2PUZA 1JR1A 5G4EA 1LBLA 1QW8A 3SN1A 3S9YA 4GGHA 4AH7A 1M7OA 4PMRA 4GI9A 2Y63A 3KVLA 1QATA 1RJRA 2IMRA 4IP4A 3H26A 4YJ5A 3CU2A 3BGAA 2GWGA 3AMGA 4P5UA 3AS3A 3VKAA 5CXPA 4NX0A 1QNOA 1NDWA 2VC5A 1IV8A 5FJTA 2VX6A 5HANA 4R53A 4MAVA 4LCQA 5LHEA 1CDGA 1ECQA 1LORA 1DTNA 3E2QA 4P8UA 3GTHA 3UGRA 2RDTA 1XCFA 2WJFA 1LZOA 2J6VA 5GVJA 2D0GA 2OGJA 2EPOA 4Y9OA 4QR6A 2INEA 4H01A 3M07A 4W84A 3EWWA 5F2LA 1QBBA 2OKOA 2VEMA 3FLUA 4JBRA 1KFLA 2YL5A 1C91A 1ZENA 4WVXA 2ACSA 5A6BA 2Z0IA 5EFFA 4S3GA 4JICA 4JKKA 1Y5VA 4IJCA 1E5JA 4BFAA 1KWKA 4ZMGA 3H2NA 3WDIA 1I45A 4P8WA 2D2HA 4W4QA 4INFA 3L4XA 4AY7A 5JBDA 2YXXA 5CZKA 1WZMA 1JJKA 3QV6A 3QN3A 3AHXA 3K1GA 4PRWA 1PTAA 3EWUA 3KTXA 4PB4A 2VC9A 3EXTA 4JFUA 5EMUA 1WV2A 2DW6A 4W87A 4HMEA 1KXTA 1AQMA 2D0HA 4GE8A 1P7TA 1G4PA 4IF2A 3UCDA 2WVSA 3KVKA 1YLVA 3PZNA 1UZHA 3SM0A 3FA5A 1FA2A 1MW1A 4J3XA 3KOWA 4LS2A 1Q6LA 3IUHA 5DO8A 4RXFA 3CQHA 3GB6A 2VCBA 2Y8VA 4IQLA 2RGMA 3W1PA 3V1PA 3E38A 1A5UA 2VCAA 2XG9A 3CT7A 2PDLA 1UUMA 1MNZA 4YTSA 2V3FA 4N42A 1JCNA 4JTRA 2PRMA 2P0OA 3BPWA 1GTHA 2WSYA 3MUZ1 3WK0A 1Q63A 1EF3A 3W7PA 1EH9A 2CNCA 1LP6A 1TO3A 5FSEC 1OFQA 3CUFA 3FY1A 3QSRA 1P0BA 5EY5A 1OX4B 2XFRA 3HG5A 4A8NA 1RALA 2XN1A 3V75A 3K8KA 1XYBA 4CUCA 3WNNA 1R87A 3M9YA 1KBIA 2PTYA 1RPKA 2HWGA 1W32A 1YRRA 4KCWA 1ZZMA 2PDYA 4QEHA 3RJXA 1UA3A 3A23A 1XLIA 3TA9A 1LL7A 1DWGM 1REQA 3VDGA 2HXUA 4HN8A 2GGHA 2EJAA 2G3IA 2AGTA 4OQVA 3G18A 4L6HA 4FIQA 4WZHA 4P7LA 1PDYA 2E77A 3QVQA 2XWEA 2QDGA 3UP8A 4AFYA 5BOFA 1QPOA 2J8TA 2YL8A 1G94A 3EX3A 2ZX5A 2DSUA 5AHNA 1EGZA 3CPGA 3MP3A 4D6DA 3H4WA 3Q94A 1NOFA 3ZYZA 1QI3A 2BOEX 4XB3A 4QE5A 2PP3A 3W70A 3UD6A 4LBRA 2IUZA 1JYNA 1H50A 1SFLA 1UKTA 3C61A 3S2NA 1P0DA 3RPTA 2NQLA 4M1BA 5A69A 1Q2SA 5HNNA 1GYNA 1XH2A 2RAGA 3UG3A 1FP8A 4PUWA 1E1EA 4E4PA 2XH2A 4Q4OA 1Z3NA 2VHLA 1IR1A 4AMCA 3AUJA 4AYSA 4E38A 1E72M 3MMWA 1DXFA 4H8VA 3MP5A 3FDGA 4MYXA 1FKWA 1R2TA 1OX5A 4X22A 3GIYA 4XWUA 1V3JA 3W7OA 3BDKA 3SUSA 4Y90A 1HGWA 3EZ4A 3S42A 3TOPA 2VD8A 5JQ9A 1KBKA 3UYIA 1JPKA 3PZIA 4LUTB 1QHOA 4TMCA 4RZ5A 5C9WA 1XXXA 4GBDA 4L6OA 3VC5A 1OSEA 4CLMA 4QX4A 2BY0A 4UQEA 4LTSA 4FF7A 1YBQB 4UFJA 1QU4A 2YCLB 4IICA 3RITA 4QISA 1W9UA 2FKPA 4NVTA 4KEMA 1J0JA 4TV5A 3WBYA 1S39A 3STFA 4IFOA 4JEQA 3HGRA 1SU5A 1GEQA 2BHZA 2W27A 1S1PA 3TFCA 4XD4A 4IQJA 4PB5A 3ITXA 3P8JA 3VUSA 2V69A 2ZX8A 5E09A 1H63A 3PNZA 1BSIA 1FY6A 1N82A 3UEQA 2FHFA 1OF8A 3FDKA 1A4MA 4QDWA 1W2PA 4UTKA 4A6GA 3WQEA 5HQMA 4UQAA 3U48A 3H2OA 1M03A 2QVHA 1WE5A 1JXJA 4XBKA 3VMPA 3GR7A 4TMBA 1BGGA 5K2ZA 4XZHA 4NQ1A 1A3HA 2YCKX 3IANA 4N4PA 1XLCA 3STPA 1OINA 3B0VC 4S3KA 1I2PA 1QPQA 1TUXA 4REQB 5E70A 3I4KA 3EKGA 2HBVA 3HIJA 4PEKA 3W7JA 1UR1A 4U2ZA 4OOUA 4B4HA 1KCLA 4GI8A 3R25A 1JULA 4UOQA 1VFOA 3EMZA 4PN2A 1K77A 1UD4A 1A53A 2IW0A 2ZX9A 1DV7A 1XLMA 3EDDA 3BMWA 2X05A 1FDJA 4CCEA 4LAUA 1EX1A 5DRCA 3WUEA 3TNBA 4AX7A 3FKRA 3NZQA 1HJXA 1E1CB 5CZTA 1E71M 2NLYA 4DVOA 3G1DA 5C9ZA 2OWWA 3EOUA 1CGTA 1BXBA 3A64A 4AHQA 3QR3A 3CZLA 2R91A 1VCFA 2PTZA 3SCPA 1J18A 2B7PA 2ZZ5A 2PE4A 3UNDA 3H21A 3R8HA 4TU1A 4AVNA 1LQ2A 4FO4A 3T1GA 3VZZA 1OEPA 4Z1YA 2VP8A 2BOGX 3U57A 1DYSA 4HK6A 4YVXA 2G3NA 4QDMA 4TV6A 3AU2A 3A9BA 2X2GA 5MF5A 2CKSA 4JOMA 3W7DA 5LNVA 4GJIA 2YJQA 4QJ5B 2XH7A 5CCZA 1F61A 2DJLA 1HG3A 3WH5A 3Q65A 4RX0A 4OTKA 3BLIA 4ZO8A 5AHIA 2QIIA 1RD6A 2GGEA 1ZJAA 4MKVA 3NQ7A 4O28A 4YMZA 2ADAA 1E9YB 4GBUA 3LRMA 4MDOA 4BEQA 2V67A 3N2MA 2DUAA 1UKOA 3SCNA 4C1NB 3RAOA 2BG5A 1VRXA 5KZ6A 4G1NA 1H0IA 1QO5A 3HTWA 1EXPA 4L4OA 4DHGA 1SFJA 1GVYA 5DY2A 4PBEA 3W26A 4AMAA 5FEZA 1R3RA 4LU0A 2YB1A 4BY3A 1DWIM 3MCOA 2PLJA 4YTUA 4IJRA 4L5ZA 1TPDA 3S4TA 1VR6A 1JF5A 1UD5A 5CPSA 5D30A 2HZGA 4ZODA 4NNAA 2C13A 1B3XA 3MA8A 4MAZA 1I2NA 3L5MA 1UR3M 1CYGA 4FNTA 1EQPA 4J3WA 4D6HA 1MZHA 2YXGA 1M04A 1GVIA 5D2XA 3VE9A 2DT2A 2X40A 3BJSA 4JR5A 3E49A 3SUTA 2HCVA 1GEHA 4NYYA 3PTKA 3UWUA 2Y61A 1FUYA 4L4MA 4O12A 3WFLA 3WNPA 1IR2A 4UBPC 3S47A 1G5AA 3ABQA 2Y62A 4ZQMA 5CSYA 2OLSA 3IVUA 2P8CA 2J74A 3CTTA 4CEXC 3ES8A 3W01A 3BMXA 4IP5A 1ZLPA 3TYBA 4TTGA 4M7SA 2O9RA 5CLTA 2XGZA 3N2BA 4PYSA 1EOKA 4Z2KA 3AOFA 3MCMA 4ZB2A 4KQNA 1X97A 1NF7A 4AEEA 1DIKA 2DZXA 4NF7A 4MNLA 3QHOA 4NAFA 4QAWA 4Q6XA 4WJXA 3VKCA 2CITA 2Y5JA 3ZFHA 3VCRA 1PCWA 3AIRA 4KETA 1KCKA 4ZQCA 1AW5A 3I3BA 4RDZA 3AYTA 3UG8A 1E40A 3NGJA 4YCPA 3R8RA 5I2UA 2QCCA 3HV9A 5E0FA 3NQBA 1OVDA 2NXGA 2EPHA 3VGHA 2J24A 4FNQA 2DT0A 3Q2DA 5A94A 5GJPA 3HQPA 4GIAA 4Q8TA 4QGCA 2R9RA 2IPJA 2QMJA 1AODA 4HN4A 2C16A 4URIA 4DUXA 2Q02A 1GW9A 4GO9A 1FCUA 2DQXA 1VPXA 4C6KA 4E4FA 4LVFA 3LD5A 3VX1A 5C2GA 1L8NA 1RA5A 5JIWA 3TR2A 5F1UA 2I56A 1W1VA 3R79A 2OTDA 1KTCA 4A8RA 4WJEA 3TK7A 3MDWA 4UFIA 2AKZA 3ABOA 4D6CA 1B3ZA 4GFSA 1UR2A 2HK0A 3DU0A 4JTEA 2ZE3A 3RO8A 1OIFA 3TTQA 4AIBA 4CNTA 1KB3A 4PR4A 3PZTA 2HPMA 2QJJA 4DO4A 2WMGA 2R1KA 1K4GA 3FJLA 5TBOA 3GU9A 4OBTA 4XV0A 3CHVA 3QC0A 3UJRA 3GNRA 2VEIA 2QKFA 2P10A 1XIMA 1J2WA 2WANA 1KFKA 5BYWA 2C18A 4MNMA 2VVNA 1OGBA 3DHUA 4ENLA 2ABBA 4H41A 4QP0A 1EGVA 1JZ7A 3CUHA 3RM4A 3M0IA 1F73A 2YBTA 1B4KA 1Z6KA 4AAJA 1D9EA 4I6VA 2OZ3A 5L6UA 4KKXA 4X60A 3W81A 4NL1A 3S46A 2QCEA 1NWUA 1LJYA 1X8FA 1KFEA 3C0JA 3CTLA 3F03K 1VFTA 2Z27A 2OELA 3BZJA 2I14A 1UJQA 3MB9A 3EWDA 3FA3A 1OFDA 2XU2A 3MHFA 5D8ZA 3UZYA 3ITOA 2FDSA 5REQB 5TD4A 3L66A 3I10A 2Y70A 5A6LA 1HZYA 4IIHA 3GE7A 1J5TA 4W93A 3DH7A 5CZJA 1UR4A 3KX6A 3LENA 3FJ6A 2FVMA 1EUAA 4QE1A 2Y5SA 2D73A 1KD0A 3EDKA 2E1DA 4RPQA 3WLMA 2DGAA 5D2WA 3HG3A 5G4WA 2XH4A 1U5JA 1X38A 2CBUA 2GLKA 2WVTA 4OFCA 2G95A 5C70A 4PUMA 3PAJA 3BICA 5ECVA 4GIEA 3LHWA 1ME8A 1LUCA 1ZAJA 4Q8MA 1M53A 2ACRA 1WBHA 1WDPA 4H00A 5D04C 1XYCA 3K13A 3CUXA 3CL8A 1RAKA 1A5AA 3NZRA 3W6MA 4HYRA 3FYPA 3GC5A 4ZGYA 1WKEA 3QGKC 5TNVA 1HJSA 3OZYA 4F79A 1RLCL 5CH9A 4S1FA 3FVDA 1IWPA 3AROA 4JHOA 1LRQA 6ENLA 4BI7A 3TX9A 2PWGA 4HA3A 3FJNA 5I79A 4YS1A 2PWEA 1FWHC 3KDNA 3WQWA 1Q45A 1M01A 4PTWA 2ZRXA 2ZXQA 2OPJA 1XSKA 5CC6A 5BMXA 1GQKA 1UD8A 3PZ9A 3RRXA 3LTYA 1JFHA 4HOXA 4KCVA 5A6MA 4LRSA 2QF8A 1BKHA 3FCPA 5BU9A 3BV7A 3WX7A 4F0SA 2FH8A 3ERPA 2REQA 3CPUA 1S5NA 4J35A 4MVAA 2I1OA 1UOKA 5DCEA 2PWFA 4UIOA 3RU6A 4E8CA 5HQLA 3N4AA 1GOXA 2X1UA 4GA8A 4I9TA 2Q3RA 1HJUA 5F2IA 4I7UA 4U3CA 4EAYA 3CIXA 4JS3A 3PTDA 3G1VA 2XHYA 4B15A 1IYXA 2C0HA 4RV8A 2AL2A 2YOCA 1PJ9A 2VFIA 3GG7A 4O13A 1LLWA 2BX7A 3NPWA 3WJSA 1JIBA 3SUUA 1O1HA 3F4WA 3G0XA 2R1PA 4RE3A 3TYEA 2G3JA 3GZAA 2EPMX 3L4YA 3S3GA 4Y9NA 4XO7A 4B2DA 4RK8A 3DKLA 3LPPA 1CTNA 3UZWA 1DIEA 4FX7A 1FH7A 4JPGA 1SZRA 4Z0JA 3IEBA 3STGA 2YBVA 3MUY1 4A8IA 2CLHA 4UNKA 4L4PA 3NQ6A 3FHAA 3NG3A 5FSDC 3L4WA 2ZUVA 3RK8A 3HJZA 1GQJA 3NSXA 3T55A 4JFSA 2WNQA 1O12A 1UH2A 3PP7A 1DIDA 4TX8A 4K37A 4GQQA 1Q13A 1UQYA 2ZZ6A 4PMYA 4NNCA 2KAUC 4KEUA 3I6TA 4Q4PA 3WLRA 3GNOA 3MANA 1RLDA 4Z2JA 2QULA 3W53A 5FJRA 4R34A 2HROA 2QXWA 1BYCA 3LHZA 4BA0A 2ZXDA 1VGAA 1YXYA 1MMFA 4U2YA 4EAMA 2UBPC 3SQSA 5D4YA 3T4CA 3N12A 2EQDA 4EPEC 2FIQA 5AY7A 1EDGA 3PBMA 4ASTA 5CGTA 4D8LA 3GH7A 1ZAHA 2CLEA 1KBJA 1XDLA 2VXNA 4O4VA 4DWSA 4RNHA 4UC5A 5ABFB 4W8LA 3LGGA 2DVXA 2VDIA 4GXPA 3U2ZA 1Y5XA 5HNTA 3WYZA 1EXBA 3APTA 1C7SA 4J2PA 1XLBA 5T91A 3FNDA 4MY8A 4POCA 3PZMA 1ZL1A 3TSBA 1H7WA 1UR9A 4C65A 1PCKA 2G96A 4BCEA 3QV9A 4LC6A 4H2HA 3H23A 5H8UA 1U83A 3CUIA 3WL0A 3WLPA 4LW7A 4Y8EA 3BE7A 2PDJA 4EWJA 2DIJA 3NQEA 3CB8A 2TPSA 5GJMA 4QQ3A 4KF1A 4L64A 3LUTA 1LL6A 4F9JA 3TV8A 3SURA 1ITQA 2HV5A 5EMMA 3W7RA 3EOEA 3ARSA 4DBDA 2VRQA 4O1EA 4Q4MA 1W3TA 4ZVJA 4N0RA 3GW0A 2CHNA 3WQDA 4AZCA 2VD9A 2ISDA 5E5CA 1AMKA 1FWCC 3EKZA 1L8PA 3KP0A 5ABTA 3H4XA 2DZPA 3UF9A 1F6PA 4GQBA 2JF6A 4MB5A 1TPWA 1H7RA 1MEIA 3NQ2A 1S5VA 4JQAA 4Q8QA 2VYOA 2FZNA 3EA3A 2ZDRA 5D38A 3A47A 2J9ZA 1FWBC 5HR7A 3LCLA 3K1DA 4IFKA 3TAKA 3O1NA 2VEGA 1UH4A 3OP2A 5HJLA 4UTMA 4O52A 2YW3A 5LNRA 1FX6A 4BJHA 3RYSA 5A95A 1ONWA 2IQ0A 3KW3A 4AIEA 4V1XA 2WNZA 2WLYA 3LQGA 4HPXA 1KFJA 2GOUA 1EJSC 1HKJA 3XIMA 1E9LA 3N2CA 1P0KA 1QI4A 3GTFA 1XIHA 2J62A 1NARA 2A3LA 3D6NA 4QQUA 4RW3A 5EL1A 2GK1A 3M16A 3STCA 3MCNA 5F4WA 2Z6IA 3TUUA 4PUEA 3FS2A 1K1DA 1TIMA 3O0FA 1UQZA 1K7XA 2WHMA 1C3FA 1F8IA 3ZIZA 3WEMA 4OWGA 1K7EA 1DBTA 4X2PA 4L56A 4M19A 4Z2LA 1VBGA 3VD7A 3ITCA 4O17A 4ZL1A 3MHUA 3PBWA 1DTUA 3HPFA 1ZALA 3WQCA 4FALA 4GYPC 3F5KA 4KWWA 1Q6CA 1DJIA 3WBXA 3LI0A 1X39A 3B8IA 4HNLA 1OCQA 4I3GA 3LMZA 1UC5A 1GCYA 2BVYA 5BXTA 1OC6A 1KLZA 1HTIA 2XM1A 1P7TB 4IMCA 1GUVA 3RIKA 3C2VA 3GHSA 2Z1KA 3N6HA 4LUYA 4MHBA 3TYCA 3UBPC 3QQWA 2V68A 1OWQA 2ZVIA 1EJXC 2WVUA 2E1WA 1RQBA 3M5XA 1FWGC 2G37A 1BVZA 2Q3OA 3DG3A 1N8FA 3AJ7A 3M0LA 3N9SA 4R33A 1KRMA 1XG4A 1OD0A 3M64A 3EX2A 3NPXA 3KS5A 3E2SA 3RPDA 2Z29A 3OLDA 5DX7A 2UY2A 2VZTA 1EFZA 4HKPA 3OVGA 1XIJA 3LEPA 2XGBA 4H6RA 4S3DA 3R13A 1EIBA 4QS5A 2UY4A 4H6EA 5BMWA 3GYEA 1B9ZA 3MV01 1BFNA 4LS1A 4IGSA 3W22A 1QOQA 1XIIA 4HJFA 1LF1A 2NX9A 4DBUA 1HW6A 1XIFA 4O1FA 3WD4A 1PPIA 3QOKA 3LV6A 4JQ4A 3FIGA 3QQ0A 3QOMA 1UZ1A 1I2QA 2NX1A 1R9XA 3ARRA 4AXNA 3FVMA 1BWVA 2E28A 4PMJA 3AHYA 4GZEA 4K8HA 5CBJA 3AS2A 2YYTA 4YNGA 2DV0A 3L4UA 1ZBKA 1GOIA 3LN3A 1DWFM 2OU4A 1UW9A 4AY8A 3BAIA 4F0RA 4A22A 2J27A 4ZTYA 2FB3A 1AQ0A 1VIWA 4J9JA 2DEPA 1YYAA 3WDHA 1Z32X 3CBWA 3VFLA 3W87A 3QKZA 1Z41A 4Q8VA 2VZVA 2VOTA 2YKKA 3WQFA 6PTDA 2ZUMA 4FXSA 4GI4A 2Z1VA 3F4CA 1XRVA 3N9KA 2FH6A 1TWWA 4NU7A 3KLKA 1TPFA 1EX5A 3MTWA 1HXJA 6A3HA 3BLFA 1JAKA 3CXOA 4HA1A 2R1MA 4I9AA 1JRCA 1EDTA 1T7LA 1JZ3A 4UZUA 5BNKA 3PR2A 5GNYA 1CW2A 2WWDA 3V5CA 4ZB0A 5C8BB 3CMJA 3EX4A 3S83A 1EBGA 1TJ0A 3A4AA 4ZA0A 4MY9A 2QJMA 2C1GA 3PBYA 3N6JA 3IPWA 1ISYA 1JYWA 3OLGA 4AC1X 1AZ2A 3MMDA 2Y5EA 2VELA 3CO8A 4QG6A 1O5RA 2E5DA 2QT3A 3K8MA 1E55A 2W62A 2QCMA 2G97A 1S5MA 4CQDA 1A4LA 5GNXA 4ZZ9A 1XLAA 2XZ9A 4GPNA 2QQ6A 2YB4A 1FWJC 2LLEA 4K2SA 1KM3A 3KOYA 1RBLA 1GVOA 3TOYA 3TJXA 4I90A 4ZQOA 1TPC1 1PB0A 2DJXA 4UZSA 3EPMA 1B3OA 3LBOA 3N17A 3MZ2A 1R0MA 2XIOA 2Y7EA 2WZMA 1DJZA 3UWVA 4JY8A 3A9IA 1YHTA 3XISA 2GUYA 1B2YA 4WQ6A 3QBUA 3DHFA 1VFLA 4C6MA 2J7HA 2CZFA 1SMAA 4QSFA 3GTIA 3OW1A 1JI1A 6TAAA 3I4EA 4DAIA 2PAJA 5J5DA 4CD6A 4BF9A 1HJQA 2CZEA 1N8IA 4A3HA 3HA1A 4EOUA 4GUIA 3PBVA 5LIWX 2VNCA 3PG9A 1P0EA 4GX9A 3UJFA 4XQ6A 4O14A 2Y85A 3UY7A 3TE9A 3W84A 4R9XA 2E5CA 3AYSA 2PODA 4DNHA 4RLIA 4XIAA 1KBLA 3I6EA 3RN6A 1WDRA 4H9XA 4R27A 3TXZA 4PRTA 1D3CA 4YHGA 3GNDA 1G01A 4E2VA 4Z2IA 3TC6A 1SZGA 3NYZA 2FDMA 4PMVA 2I5GA 3IRDA 2QUTA 1V93A 3PM6A 4U31A 3T2OA 1A49A 2R14A 3Q58A 4C1KA 2B31A 4ES4A 4C6FA 5AOUA 5C6MA 2BHUA 1CXFA 3I7SA 2PPGA 3EWXA 3WMCA 1VHNA 4E8DA 3MJMA 3IUIA 4BF7A 2VR2A 1BTCA 4Z1DA 3AMKA 4C6EA 2RFGA 4E0CA 2V6AA 2OFJA 1CECA 2PDCA 3LTSA 2Q09A 4HCLA 3AICA 4Z1CA 1D7KA 4YPJA 1W9DM 3VGFA 1YTEA 3UT0A 2A6NA 3K2GA 5I5RA 2A5HA 3FSUA 1B5TA 5K3VA 3E6EA 1TTPA 5H8MA 2V5DA 4Z1AA 4N2YA 3FJ4A 3WQVA 1YNQA 3VU2A 3QC3A 1DWAM 1FRBA 2XZ7A 4HGXA 3KCLA 3EOSA 3THUA 2Z1WA 4L9ZA 2J7DA 4LVAA 5FF3A 3UYCA 3SCRA 1JQVA 1W1B1 1KM1A 2AQWA 2V2HA 2PZ0A 3VIOA 3IGHX 1E4IA 4GGBA 4IH3A 3GXIA 1TX0A 1C8YA 2C6QA 2O9OA 2X7VA 3RNDA 1BXNA 1BHGA 1CT5A 5I00A 1DL3A 4GNKB 4DWSC 3Q4DA 1GKRA 1KTNA 4NAEA 1C29A 2QAFA 3KVMA 1ISVA 2FB2A 3UWZA 5EMLA 1W1A1 4DAFA 2CFFA 1TA3A 2I57A 5JU6A 2G5WA 4XAFA 5E6ZA 4XTIA 5DELA 4RXGA 2ON3A 1LT7A 3FSTA 4P2VA 4MYAA 2XGIA 3QTGA 3GO2A 1SO3A 3URBA 1S38A 4IG2A 4Q6JA 2V2DA 4CQBA 3GSMA 3OU8A 4DUOA 4HB7A 3RJYA 4EXBA 3NXFA 3BMVA 1JZ5A 2QYGA 3JRKA 2Z7GA 4GMEA 3ANYA 1AW1A 4LAKA 4WR3A 5E0CA 1TPH1 3FAWA 4LGXA 4WSJA 4BQ4A 1JPHA 1VFMA 5ABGA 3ARVA 3NQAA 3LLDA 3V7PA 1VRDA 4Y6GA 3GAYA 1PYFA 1UD2A 3BOXA 4AIOA 3M43A 5HJYA 3BSMA 4AD3A 2NUXA 3DFSA 4F0KA 4PFHA 1KQZA 3ITGA 1F05A 1UWTA 4FX8A 1JXKA 1TJPA 3LOTA 3MVIA 4RNIA 2P8BA 1K03A 4A3RA 5HINA 4HJWA 3WJXA 4GUGA 3Q37A 2YDQA 3R94A 2CBJA 1PYMA 4DBSA 1OK4A 1ZCCA 2HS6A 1FWNA 3CAKA 1QDSA 3NZ1A 2YCIX 3M0VA 4QNWA 5DY3A 3PZOA 4GVGA 4NAFB 3P5YA 4FZIA 4JKLA 1IGWA 1S2AA 1XLLA 1QO2A 1PL9A 1PKLA 1R46A 3PJUA 2W91A 1R3YA 2IKHA 3QW4B 3WENA 1S2VA 2VX5A 5I3KA 4UTUA 1LLOA 3AALA 1UASA 2QJNA 3SZ8A 1SSDA 2X42A 2PGWA 1AH3A 3W83A 3MMTA 2XIQA 1UJPA 2ZUWA 5A5WA 4BKNA 5I3DA 1W2VA 4WY0F 4HMDA 1D8WA 3G1HA 4UTWA 5DT7A 2Z24A 4C90A 2CW6A 1GHRA 2H3BA 1OQFA 4FLRA 3H7RA 1B3YA 1S3HA 2OWXA 4DNMA 4LNCA 2ZX6A 4FLSA 3C8NA 4D1IA 1DORA 1R86A 3U6WA 3L9CA 3HPZA 3OBKA 4C91A 1XI3A 2OSWA 1UWUA 4GOAA 1WKDA 4CCCA 5AHFA 3T0DA 4EPDC 3PVFA 5E9AA 2WO5A 3RCNA 4C6IA 1O95A 1LT8A 1N2VA 2WV8A 3UXLA 3NWRA 3W28A 1DEDA 4AISA 3WSUA 2WK2A 4HSOA 3VXGA 1C7TA 3AQUA 4YIWA 3UVIA 3MW7A 1A47A 1ZTVA 3QYSA 5D09A 2Z26A 2PDKA 4QAIA 2VGGA 1NWRA 1FWIC 2PGEA 3WBWA 3ZXWA 3NQMA 4AD2A 3DGBA 3VGBA 5FJOA 2VDHA 1XG3A 1XD0A 4RV3A 4D6FA 1NDZA 4IIDA 4MOZA 3T2QA 3KE0A 2HS8A 4J3VA 2ALDA 3VIKA 1I6NA 1GOWA 4H83A 2VZSA 4JTSA 3UXDA 2DZWA 1OJXA 3VILA 4DJEC 4B90A 4HCDA 4ADTA 3N4EA 4Z08A 3ITTA 4EIVA 2CCRA 2FMOA 3B3DA 1W37A 4WOQA 1K9DA 5IDIA 3E3HA 3NAVA 2D1ZA 4HZMA 3IJIA 4UWMA 2JEQA 3SGZA 3L5LA 1XQLA 4KFOA 5ABHA 1UWQA 4DZAA 2HISA 3QPEA 2WMKA 2QGYA 1XPYA 2VFGA 2W63A 2V0TA 2GQ3A 4UR7A 3NXLA 2F6XA 4FAMA 4ZO6A 5FF4A 4PRRA 4PUJA 4WKFA 1B0IA 3M47A 1ZQ5A 4NZCA 4CCZA 4H9MA 4U4MA 1KTBA 3QFWA 4IJBA 2WQPA 1AD4A 3IACA 5CPMA 1M65A 3VE7A 3UJ2A 4CN1A 3TFXA 4US6A 3MP4A 2O56A 4MB3A 2PGRA 1W5QA 3OQEA 1O94A 4NP7A 3VIPA 2I9EA 5HWMA 1TZZA 4FMVA 4QLJA 2PURA 1TJ1A 1JUEA 3S0CA 4HCHA 5CQ1A 3TAOA 2FHCA 2C19A 4LNYA 3VMNA 1UKQA 3SFWA 1XYFA 5HBFA 2W4XA 4AZBA 7TAAA 4CNPA 1U1UA 3IV3A 1BAGA 3REQB 4XZ9A 4UTFA 4B9YA 3W73A 5AC4A 4XKYA 2INFA 3HGJA 4C7DA 1ODZA 1V0LA 3RG6A 5DMNA 5JH1A 1SQ7A 4PMQA 4ACZB 3WK2A 1X96A 4FI4A 3AIBA 1R2RA 4H2CA 4F48A 2EG6A 5FJIA 3RX3A 3G3MA 1NF0A 3EPNA 4DM1A 4ZO7A 5AVNA 5I02A 4E8GA 1U5VA 1W56A 5JBFA 3WUFA 1H7NA 5AZ0A 5K7JA 4O8RA 4G56A 3TN3A 3MUAA 1PWMA 3IJDA 3E0IA 2PWDA 1PIGA 3FHQA 3GDKA 1WXZA 1HKKA 3EWCA 3QZAA 2XYLA 3G6MA 1UP3A 3S5NA 4UCGA 1E15A 1OADA 2FJUB 1NM9A 3HGOA 3EA1A 5DXXA 2CC0A 3A13A 4PSPA 4B4FA 1VAHA 2H8XA 3M0HA 4M0XA 1X1ZA 5CSSA 4OGZA 1QI2A 3WQ5A 4LF1A 3U5UA 4AWUA 4WIWA 3WH6A 1CXKA 2Z6JA 3KOXA 2QPXA 5DRIA 1E6PA 1I1WA 2E7FA 4FPSA 3TLQA 2QCLA 4IP7A 1T5AA 3ONCA 3S2LA 2GJNA 3CWOX 4XZMX 2W0UA 3F1QA 4JIQA 1DHPA 1OFPA 3MSYA 4HZ8A 2WSQA 3EB3A 3VNJA 4XSLA 4DPPA 1BSLA 2WVVA 4E2OA 5D05A 3GR8A 1A5SA 1XFCA 5AKQA 2PA6A 5C0QA 4QITA 2OB3A 2P76A 1S5TA 3W74A 3KRBA 1FKXA 1XFBA 3WFZA 1IE7C 4LYKA 4M24A 1SW0A 2C71A 3W7LA 1BRLB 1J96A 4MADA 3TQPA 1G69A 5D37A 1GQLA 3SCVA 1BG4A 5EBUA 4TVCA 1GVSA 3VCCA 4XG1A 1G0CA 4Z1BA 4JTUA 2G8ZA 2VCCA 2QIWA 3APGA 3CQIA 3EKLA 3TQKA 3BW4A 2J4GA 4Q8PA 5PTDA 1ZBCA 1FXPA 4MWAD 3GR4A 4JNMA 2PBOA 4PE8A 2HVNA 4HU8A 2QW5A 4B5UA 1QHZA 4GZIA 3F2BA 2CBVA 2J7CA 4UQ9A 3G1AA 3WD0A 1Q8AA 5CGMA 1T96A 3BVJA 3TYDA 1XGDA 2UY3A 4GKTA 4UTTA 1P4CA 4GCAA 2E0PA 3GDBA 4HNTA 3SRDA 4IPNB 2A85A 2YL9A 1NOWA 1GKPA 4I5XA 4GX8A 4MFDA 3GXDA 2ASHA 4N9BA 3A3HA 2YGYA 4NKCA 3BG3A 2BZNA 1FP9A 2PDXA 3L68A 1DPMA 3CL6A 4W7VA 2W5FA 2ZTKA 4RCXA 1L0PA 2Q01A 3E96A 1WAWA 1VYRA 2WJZA 1FWTA 4WXYA 2NW0A 2PI6A 1X1OA 3C2RA 3UPBA 3VA8A 1LOQA 2NQ9A 2VWSA 3BGJA 1POJA 3D47A 3QQ1A 4DY1A 3RMEA 1PZ2A 3COTA 2E68A 3VIMA 2ZX7A 2DVTA 1ZHAA 2BWGA 2V82A 1J12A 1T40A 1KFWA 2NUWA 1NH6A 3N73A 2P3EA 1H61A 3EXSA 3CZKA 3LCHA 1M68A 3UQNA 2HRWA 4V2XA 4PCTA 4JL1A 1ZUAX 4CQ8A 2I16A 3O2LA 1BF2A 4A3QA 3RR4A 9RUBA 3TC3A 1R6WA 1W3HA 1MXSA 4FEZA 5I3JA 2R6OA 4X9SA 1SO6A 3RRAA 5IDZA 4B5NA 1ADSA 3DFOA 1I1XA 1L6WA 1SUXA 3WO8A 4H04A 2JIWA 4XAZA 4ZR8A 2X2YA 2D3LA 1F2JA 1UUQA 4AZCB 3DG6A 2C15A 2VQTA 1HJVA 2X1RA 2IPFA 4UOJA 2DFAA 1EP3A 4IOTA 3GQYA 4DO5A 4LANA 1SZFA 1VP5A 3GH4A 1IZCA 3T81A 1J0IA 1OZMA 4K8GA 5XINA 4IQEA 1C90A 4O1DA 3WL1A 1QPKA 1DJQA 3VNYA 2V5BA 1CI1A 3VD5A 1PBGA 3NL2A 4D1JA 1W1IE 5AYZA 3DIPA 4LYQA 1Z44A 1SW3A 3HO8A 4J3SA 4WRHA 5TIMA 3G22A 1SGJA 2GPTA 2ZVRA 3IIOA 2FZBA 4X63A 3POHA 4KH2A 4R3UA 2GJXB 1UC4A 4HU0A 1W91A 5CC3A 2VZUA 1NTHA 2JGYA 3WK3A 2EF9A 4ZQNA 4Z17A 3M41A 1RCXB 2VC6A 2GK1B 3MC5A 4YTQA 1W6TA 1PUDA 2POZA 5CSRA 3OBAA 1IEVA 4I9MA 4R7WA 3QZEA 2WMIA 3I68A 4M56A 5CBBA 1UHVA 3W1LA 1OM0A 2BFGA 1IEXA 1XLFA 2F2HA 3BARA 3QYQA 3LBMA 1WNOA 1EHNA 4TQTA 1DQXA 2QPSA 4I7VA 2HTMA 1EHAA 3T8QA 3G1XA 1NAL1 4ROPA 1UWSA 5XIAA 4WGHA 4LCRA 4E5TA 3NA8A 3WF2A 3R43A 4QTGA 2Z1SA 1DE5A 4XZNX 1Z69A 1RQHA 4A29A 1EJRC 4NXKA 1VC4A 3ZO9A 1D3GA 1O68A 3QPYA 2VGBA 4O53A 3VZXA 3WH9A 3NM1A 1DIOA 4WY0A 1SPQA 1K4HA 1R9ZA 1KV5A 3B4YA 3GAKA 4BQ5A 1F3TA 1RH9A 3GG1A 3T0BA 3WLHA 2OT0A 1TQJA 4W5ZA 3E0FA 1OC5A 1QWKA 4QCEA 4CD7A 1GGOA 1I2RA 3WIJA 2JEPA 4RL3A 2QDEA 2PEVA 4R7JA 2DSZA 2IXVA 3JZEA 3L12A 2EG8A 3GDLA 3APYA 4IX2A 4NJHA 2Y7DA 1UH3A 5FCZA 1E6SM 4W86A 1Q7ZA 5A6JA 3P0WA 3S2JA 1H7PA 1XLKA 4TX9A 3LLXA 4PMZA 1EF2A 3DFNA 3PFMA 5I3GA 5IOBA 4O15A 1EJ7L 3VOCA 3NO3A 7CGTA 1AQFA 1QAPA 4OVXA 2QLYA 4JTTA 4QM1A 1KXHA 3BOLA 1TCDA 4PBFA 4JTQA 2AMXA 1UZDA 3E74A 3V0UA 1E43A 2XUCA 2WHKA 1A0EA 5A8PA 4KFPA 2ZQ0A 3CZJA 3KVJA 1EKOA 4C7GA 2D24A 4P61A 1Q66A 1CPUA 4WOZA 3DENA 1IT0A 3CQ0A 1W9VA 3EX6A 5AB3A 4N6FA 2W6RA 1K9TA 3GC2A 4I8DA 2WCAA 3VKBA 1XGEA 3ARYA 3PK7A 3MI3A 4B3LA 1F9CA 4FA3A 4PA8A 4A05A 3OODA 2XN2A 5DQPA 4JTDA 3BAWA 3CYVA 1XCWA 1RP8A 3HU7A 4LUSB 2XDFA 1MRQA 4LCSA 3MY9A 3HFYA 1R85A 5D9PA 2V9DA 5IM51 3S5YA 4DBEA 5FF2A 1EIXA 2FZ8A 5D03A 2OEMA 1RUSA 3W86A 3JUGA 1LBFA 4Q7NA 1ZP3A 5BRBA 3GFZA 4HHLA 4J40A 5A8GA 1GG0A 1UWAA 5IXEA 1V8EA 1OG0A 1B31A 5ENLA 2BY2A 1XKYA 2XFWA 4IWWA 3VMOA 4UR9A 3NL6A 4R9OA 4EX4A 1N7KA 2DORA 1Y5WA 3MYOA 1LM1A 1BXCA 4AUBA 1J2BA 2OEKA 2CEQA 2FJKA 3BLKA 2WSKA 1E6NA 1WCGA 3RX4A 2HNHA 2QHAA 1PTGA 3TC7A 2WBGA 3H54A 4JTCA 1JQXA 2DT3A 3THQA 2ZE0A 3E12A 1E70M 4CNSA 1VEPA 3THDA 5HQEA 1FHLA 1B3WA 4JFWA 3W7MA 3QRHA 2PLKA 3DBNA 1VCVA 4FOKA 4MJZA 3RX2A 4PGLA 1TVNA 5HK4A 1H5VA 4FNPA 1QJWA 3U2EA 3T0TA 3ARUA 5HMDA 1T99A 3SGUA 1ITXA 4ML4A 4LY4A 1J01A 1OYAA 4LUIA 1CGYA 3QFEA 2F7FA 4DIAA 1JDAA 4WGXA 3KTSA 3C2YA 4JTJA 2B7NA 2VUNA 5LXEA 2HDJA 3PPFA 4FK9A 3DESA 4HOWA 5DCDA 4XUYA 5G1YA 5HUPA 4GC4A 2GSEA 4ICCX 2FTWA 1ZB5A 1WDDA 1QVBA 5M03A 3ZLGA 3ZT6A 1RA0A 5KZMA 3WLTA 4IMDA 1GORA 1A5MC 3EYPA 3NQVA 1SW7A 3CUGA 3N6QA 2A3CA 3PTMA 3YPIA 1ZSXA 3DZ1A 3T6CA 2XIMA 3OA5A 3G0UA 1BQCA 3B05A 3UU0A 1TKKA 2JBMA 3NDYA 2ZRZA 4JFVA 3ARXA 3UZ5A 3ZWTA 3W72A 3ZR5A 3EWBX 3VD9A 1YIXA 1LROA 1ZCOA 5DEZA 1J0YA 5CBIA 1K8YA 4JYDA 1EC8A 4MMWA 3O8AA 4LPCA 3C3NA 4RDYA 4I5UA 1NELA 1QASA 1GKQA 4QS6A 3SFKA 4ZTXA 2B0MA 3SRHA 1PHQA 3VK5A 1PKMA 3RGTA 4LYPA 1AH4A 3A3XA 4FNUA 3OZMA 1LLZA 4K6AA 4IL2A 1WYIA 1FOBA 1R9YA 4BQ2A 3I6RA 4WDUA 3C0SA 1NFGA 4V15A 4AXKA 4GIYA 2BVWA 4QLKA 2HBXA 3ELFA 4MPKA 3MYPA 3VOJA 3ZOAA 4GO8A 1WDSA 4QEEA 3KOFA 2KZHA 2P5NA 5LIYX 1M41A 3ZR4A 3L2LA 1KW1A 4FOJA 1D3HA 2O0TA 4UTTC 1HVXA 3TTEA 4Q8OA 2NT1A 3CUZA 2SFPA 3OHIA 5FAGA 1KCZA 2O7QA 1MQRA 4NILA 3TCEA 2O7SA 4GKLA 1EPVA 1KGUA 3KWSA 1OX4A 4KEVA 1TR1A 3V0SA 4DI9A 3NYDA 4C5ZA 1BYDA 1T41A 3I65A 1TA3B 3TH6A 4AF0B 5FEXA 1FQ0A 2VFHA 1IHIA 1HKIA 2MNRA 2V2CA 4V1YA 3W7KA 1A5OC 1QNRA 4OKDA 5T26A 1Y0EA 2A3HA 1RHCA 3ZSTA 3WBAA 1O7AA 2BXYA 1VS1A 3AU6A 1XISA 2PCQA 1HO4A 3SY5A 2J78A 4RE4A 1EEXA 3NR0A 4CVWA 1XWYA 3T9PA 2Z00A 4LFYA 3A4WA 4MUPA 2AQOA 1XDMA 3GNPA 1F8MA 3AXKA 3N25A 4JGDA 4CD4A 1FHVA 3NOEA 1C8XA 3N29A 3MUIA 3WBEA 3UGVA 4KS0A 1RSCA 1F74A 2IPWA 1H1ZA 1Q3NA 3W2LA 3EGJA 1UMLA 4MWAB 4DJDA 2JKPA 3BQ6A 1RD5A 3LHUA 5J5RA 1LRTA 1IF2A 3C86A 4ZOEA 1GOMA 3KBMA 2WJEA 3GUWA 1LWIA 3ID7A 3NUKA 1FBAA 4M80A 4ZBCA 3MZNA 1EO5A 3DKJA 4IHCA 5FF0A 3UW6A 2X0SA 5LA1A 1ONRA 3A6OA 3KEHA 3HJEA 3VTRA 2FQIA 1QXLA 3AYRA 3V18A 3RPMA 3O0KA 3S5ZA 3B9DA 1TTJA 3OOQA 1JNEA 5I3IA 4HNCA 3W07A 4B92A 4QE4A 2FGZA 2V3GA 2DSKA 3UETA 1XLGA 3GK0A 3VKJA 1QK2A 4ERAA 1A5LC 2PF0A 5FIPA 3WDQA 4IUOA 1QRQA 4QCFA 3CV6A 4L7ZA 5BRQA 4PTVA 3ZVIA 1YBQA 3MUCA 1H11A 4GIRA 3GKFA 1S5WA 4XK2A 3OVPA 2CLPA 4WDXA 5DBTA 1YDOA 1ZP4A 3H53A 1W0MA 3MO7A 6XIAA 1KBBA 1D7FA 1FCQA 1VPQA 2DT1A 4HTBA 4L80A 3DX5A 1X7FA 1IT7A 3N15A 3BXWA 4MY1A 2WSPA 2FPVA 4AU0A 3AIVA 4KT2A 1S2TA 3KL0A 2CESA 2H6RA 5M5DA 5C2XA 3ZQ9A 4LEQA 2XIBA 4XTDA 4GISA 1ML1A 4B91A 6TIMA 4OOZA 1JZ2A 1GZ1A 3T42A 2RH9A 1RP9A 4KRZA 3P84A 1PAMA 4A21A 1PV8A 3A3WA 5AVHA 2BLEA 1IQ8A 3LCGA 5LA2A 1BKSA 3NM3A 4REQA 5LHFA 2DSVA 3G1RA 1IWAA 4P7RA 2QUVA 1L9WA 1G4TA 3SIZA 4GI6A 2JF7A 4PUDA 4Z0SA 4N9DA 3QHNA 4B16A 1PVNA 3O6DA 2BHYA 4UOZA 2H9AB 2QJHA 1LYXA 1Z8AA 3GUGA 2ZOXA 3HV8A 1QTWA 4IPIA 2A3BA 3NVDA 4H4IA 1OGSA 1ZPTA 4HA0A 4K68A 3QMRA 4DX3A 4UB9A 2OR2A 3PPGA 2O55A 2BOFX 4CD8A 1E1CA 1RY8A 3B8VA 3GVQA 3GU2A 3EB4A 1UA7A 3SECA 1T6MA 2WBKA 3P2VA 1V08A 5IHRA 4LUJA 5XIMA 2O9PA 4UTHA 3UWQA 3H6OA 1HL2A 3DYMA 4IIGA 4D2JA 3VGEA 5A6AA 3U9IA 5IRPA 2IS7A 3IWPA 4IMGA 1EYEA 4NRRA 3ALFA 3B8UA 2GSHA 1QFEA 1MQQA 2AQVA 3MV11 5FEWA 3QW3A 2CZ5A 4ZQPA 2OYMA 3QXBA 4Y8FA 1MEHA 3BSHA 3BANA 3DYPA 1XINA 3DGRA 1NQKA 3M0JA 5BXPA 3U8GA 3HBLA 1KM0A 3M46A 3CHFA 3SCSA 1I0BA 2AOSA 4US5D 4NSBA 1ZU8A 3ZVHB 3K4WA 2BGNE 2DIEA 5AECA 2E6DA 4N6EA 4O18A 3VVGA 8RUCA 1S2WA 1Y7VA 3OZPA 4K38A 1TVLA 2GUUA 4XISA 1XBVA 3C5QA 4C1NA 1JDFA 1KO0A 1H1NA 4B5VA 4MJ2A 4XD6A 4E2DA 2WW5A 1ME7A 4PTDA 5H2ZA 1TE1A 1EC7A 1TJ2A 1MI3A 3UWYA 1ZFJA 3ANVA 3UXKA 4HK7A 2NV9A 3F4DA 3WDPP 4KIRA 4XKYB 1SJCA 2P0IA 1D8CA 1R3QA 3LGDA 1J9YA 4OV9A 4DWDA 3TYUA 1EC9A 2IQTA 4PUKA 1UZ4A 1H5YA 2L5HA 1L6GA 1FVPA 3TQVA 3HG4A 1M3UA 2Z1XA 3VIJA 4NZ4A 3MKVA 2OQLA 4C7FA 3NQ8A 2Y7GA 3POCA 4R85A 1MXGA 5AYBA 1R47A 1KFBA 4JZ5A 2YDAA 5HATA 3RM9A 4OT7A 3QF0A 5A8MA 1U33A 4UFHA 4ATDA 3GXNA 3EXRA 4G7FA 3P8IA 5HA7A 5CKSA 3F4VA 1PSCA 1HN1A 4E2BA 1TELA 3RF9A 4W88A 4YL2A 1O6IA 1V7AA 1RR2A 2DVUA 2E8ZA 3DFHA 2A0NA 5A6BD 4O1CA 4I7WA 2IQDA 2XSAA 5DLCA 4O10A 1ALDA 3TMQA 3P67A 3BC9A 1XC4A 5BOOA 5CG0A 1HIZA 4C60A 4MUZA 4H6QA 3LZ3A 3S2MA 2ZUNA 1G6CA 2ZFAA 4L9XA 3WF4A 1KR1A 1VYPX 4Z42C 5C2CA 4AIUA 3ME3A 3WQPA 4XUGA 4HZ7A 3GBDA 4RNFA 2QDDA 4PZVA 5I24A 1M6JA 5GJNA 4DJFA 3IJ9A 3TW9A 2PWUA 4X3ZA 3UXAA 5KTLA 3FEQA 1GQNA 3CAQA 4C6LA 1JPMA 1GOKA 2YCEA 5CG7A 1IEWA 1JAEA 2ZUUA 3P0XA 3PJXA 5FEPA 1AQHA 5C55A 4C5YA 1M9HA 3T4WA 1AMYA 2CLFA 4F0LA 4HHPA 1RBAA 3MHGA 1PIFA 2Y4SA 1AH0A 5DMLA 5HJXA 3WLQA 1YDNA 1AD1A 2G3FA 4P7OA 3PHAA 2DZTA 2VR5A 1V0NA 5C71A 1OCNA 1MWOA 3JVAA 1TZ9A 3C4UA 5FESA 3D3FA 1SMDA 5G2IA 3R11A 4FB7A 5KSWA 1F4HA 4NRSA 2CIPA 2NWSA 1H2JA 3PUOA 4DLFA 3W1XA 4H9UA 2WYSA 3A21A 2J9YA 3GH5A 2B7QA 5B7ZA 3AYVA 4QBXA 1TUFA 3I3EA 5M1TA 2QZRA 1RK5A 2NQJA 4F66A 2QNEA 4LBSA 2YPIA 1ENUA 4WUIA 1XUUA 1EB3A 1R5YA 1EOMA 2RJGA 3LB0A 3LHYA 1X6UA 3S1VA 4C6DA 1J0HA 4IMAA 1O4UA 1CEOA 2ZWZA 5H1WA 1US0A 1AL8A 1V5XA 2FTPA 4CU7A 1V02A 3NQDA 3O06A 4GYPA 3URNA 1VFUA 2CLMA 3PSVA 1K8ZA 3LYEA 4CQAA 5JIPA 4E3TA 1PIIA 1PKYA 1ADDA 3R6IA 1TRIA 3DYOA 5DMYA 1DJYA 2VOMA 1JZ4A 3AZTA 2A4AA 3VM7A 4WHBA 3T09A 2D2JA 3G5EA 1MUMA 1LOSA 1JCMP 3IGSA 3LTPA 4B3ZA 3H7VA 2NSOA 3HGSA 3W0KA 3T0AA 4JXCA 4RKAA 2ATMA 2O92A 3CASA 1ISZA 1UP0A 1NU5A 1GPFA 3TTSA 5CEWA 3LHVA 4Y9MA 1TMQA 4O4WA 3CWNA 1XYAA 2XH0A 4LALA 5REQA 3G8RA 2ISWA 1IZKA 1EGMA 3II1A 2OQHA 3MI2A 2VFEA 3NZGA 1LOLA 2W61A 4A4AA 3GVGA 5DMMA 1EL3A 3RR1A 5EKYA 1Y65A 4J2MA 1A50A 3NTYA 2JQXA 3TONA 1E56A 1X6NA 1PX8A 2I5IA 2ZZ7A 3OYXA 3W2KA 2ANUA 3GWQA 4JFTA 5KZEA 4J3TA 3WLJA 2D3NA 3PPCA 4XZBA 3AWNA 1B3VA 4LJ3A 2WMHA 2ZRWA 3LSCA 2G3MA 2RDUA 4DJDC 5CC5A 1TPUA 4QJ1A 1J6PA 2J13A 4V33A 3G1SA 2DIKA 3ONBA 4XIMA 1YKWA 1XH1A 3ZJKA 1VJZA 1SM9A 4CCDA 5AHMA 2FVLA 2WCGA 4U28A 3WNMA 1XIBA 4BR1A 2ZA1A 1SR0A 1RCQA 2Y89A 1AUSL 1DWHM 1HL8A 1TMLA 1JDEA 1RCOB 1WOAA 1JFXA 4CQCA 4TX6A 4OUIA 3PUDA 4JTKA 4NJJA 1UWIA 3ZJ6A 4DELA 3FYYA 3PANA 3A24A 4RE0A 2Y0FA 3ARZA 3GX9A 3VIHA 3O05A 1QR7A 1TQXA 4GWEA 1FWSA 3WLNA 4D6EA 3OZOA 4HT3A 2WMIB 1KM6A 1NQ6A 3WCZA 2OWCA 2PDMA 5IBXA 3S1XA 2CXEA 3M0YA 3B8SA 2XSBA 1JDCA 4MFEA 2ZZ1A 4LXFA 3UZZA 1UB3A 3ATYA 2W3ZA 1T0OA 1TWDA 1WKFA 3HPSA 3UWWA 4EE9A 2JALA 2RDWA 5HUOA 4O8AA 2O4MA 3NL3A 2W67A 2PMQA 2Q8LA 1DJXA 2E6YA 2Z7KA 3A5VA 4DZ5A 1HQTA 4YVPA 4HNUA 3MUXA 1JGMA 4WY0B 1UWRA 1IZJA 1YE6A 2WNNA 2GZXA 1VJIA 2QV4A 2GDUA 2MUCA 4F8XA 4B5WA 4NT0A 1V3IA 2EO7A 4HK5A 4MG4A 3C8FA 1MZRA 2G0WA 1V02E 3SO7A 3KBSA 3E0LA 4S38A 3SRFA 5CPOA 4JN7A 1XICA 2DZAA 2IKIA 5BU6A 4WEVX 1ODUA 3EMCA 2V5KA 4QG8A 3PN8A 3M0XA 1PEZA 4D9PA 3K5XA 1HFBA 3TKFA 3BCFA 1XRFA 2WHLA 3TW7A 4Y9PA 4PCNA 4NG3A 2I9UA 1VEOA 1R3TA 5D33A 3VC6A 5A3HA 4H19A 4ZXOA 4OUEA 4F40A 2NZLA 3F2DA 4A2SA 3NQFA 1RPXA 3OGSA 5DXYA 3AXXA 2PDUA 5A2BA 1N8WA 2HNEA 4K39A 2A7RA 2JKAA 1OHLA 2WPBA 1KM5A 4ATLA 3G3DA 2F9RA 1XBZA 5A1AA 3CV2A 3TEVA 1GJUA 1UYQA 2MANA 2QPUA 4MJMA 2C8NA 3SQMA 2YXOA 3FYOA 2X0YA 1VEMA 4QSHA 4UMCA 1G7UA 3CK5A 2WAGA 1ECEA 1O5KA 4JDBA 4ZXLA 5HNUA 4UCFA 2E3ZA 3G0SA 1IT8A 3OVQA 2VI0A 2QEZA 1WBJA 2Y8UA 1SR9A 2X30A 2CLKA 5SWUA 2CETA 3IS4A 2WMJA 3ZJ7A 3GVWA 4IPPA 5ABFA 2GGJA 3FEMA 3W71A 2BXZA 3L2IA 1WOBA 1A3XA 2OZTA 2Z2AA 3ZT7A 2G4JA 3WLSA 4MLRA 4TVDA 2YL6A 1DXEA 4NUWA 4X9YA 1NP2A 1CB7B 2W92A 3JW7A 1UIPA 5BW6A 2NWRA 2VVSA 3ABZA 1R7AA 3LNPA 2P53A 3HMCA 3R89A 2NUYA 1XP3A 4M82A 3ECQA 2BP1A 4GJJA 3NO1A 3H2EA 3IGXA 2OX4A 3TIMA 3UWEA 3VX0A 3V0TA 2ZDSA 2ZCGA 1A5BA 3CNYA 3QZ6A 5AC7A 2G50A 2PDHA 3IARA 4LT9A 1JCXA 1K8CA 3W7CA 4YWIA 2TRSA 1PX3A 3SSJA 1GZJA 5AZ1A 4IIFA 4CKQA 3BZGA 4RZ4A 2B4GA 3OGVA 2BV9A 1HL9A 3CZEA 1SJBA 4GVFA 5HR6A 1Z7AA 4FIRA 2QCDB 4JQ2A 4EACA 3M44A 3TWBA 2PTWA 3HM7A 5E6YA 3P81A 3BGGA 1DP0A 1ICSA 2X16A 2QS8A 1JDDA 1WAUA 1XUZA 2PDNA 4J5NA 4ADSA 3V5FA 3PULA 1XV8A 2OJPA 4RPPA 5I7GA 2UV8G 2IKGA 3M0KA 1EYWA 2CLOA 2OGYA 3TR9A 2PWVA 1M1BA 1JI2A 3D3AA 1GVFA 3OJGA 4D8ZA 3SCQA 4FR1A 2QDHA 3H2FA 4K36A 4ML9A 3LI1A 4JCLA 3MVTA 3L67A 2ACUA 4NI3A 4HNVA 3U4AA 3WNKA 5EB8A 3SCTA 3WN6A 5T9CE 3NFUA 4YWSA 3NZPA 4JX6A 1WKYA 1F76A 4IGNA 4LAOA 4U33A 2E5BA 3ICJA 1K8XA 1QPRA 3BJFA 3WG6A 2WM0A 2GWNA 1CGVA 5CC7A 4YLWA 3W24A 4DJFC 4AYGA 4L1WA 2A1YA 3N14A 4M6QA 3WQ6A 1K02A 3B40A 5BCAA 3FX4A 3HQOA 1AZ1A 4TR9A 3VPLA 4S2CA 1OFBA 4GRSA 4O0KA 3K30A 4Q8WA 2CU0A 5G4HC 4DF0A 3MWAA 2BASA 3MSRA 3WNLA 3ARWA 1W3NA 2DY3A 3IJ8A 1ITUA 3PFRA 1US2A 2RHGA 3E9AA 4B5TA 5BWAA 5K9DA 3OB8A 5JBEA 3WMSA 1LQAA 4O0ZA 5CSUA 2ODOA 2DDXA 3AHVA 1KKRA 3LZ5A 3VAVA 2XIJA 3N13A 3W1QA 2JFEX 3M6YA 2UY5A 3LSBA 3UPWA 4Z2GA 3UA3A 3N2TA 1CGUA 4ZOBA 2C79A 4IX0A 8A3HA 3PJTA 1W31A 4L1GA 2OT1A 4PBGA 3N34A 4O50A 4LVGA 3SRKA 5F2MA 1GQIA 3FXYA 1I0DA 5I77A 3S5SA 4G2DA 3M0ZA 3PZGA 4GJ1A 4LVDA 2FPYA 4JYEA 1X98A 1VD6A 1YPFA 1JD7A 2IPGA 1C9DA 3VINA 1WPCA 3T2PA 1WP6A 3S1UA 3ZSSA 1U1HA 3PWGA 3OA3A 1SYTA 4ORIA 1FWRA 3GVRA 3OG2A 1T8XA 1CB2A 3AMDA 1BF6A 2QJGA 4PMOA 3ZT5A 4OZOA 1YTKA 3KP1A 1TMHA 4N9EA 2AL1A 3N18A 1K9FA 3NQCA 3U4FA 1O5XA 3DHDA 3PBGA 4UUIA 1SZNA 3MBDA 2ZTJA 1A80A 2W79A 1Q7MA 3TMLA 5DBUA 3T08A 1KXQA 4RJEA 4TO8A 4AQLA 3BWWA 1QK0A 4XAGA 4FS9A 6XIMA 3KM8A 3BOFA 3UXIA 1OYCA 2ZKMX 4DJEA 3LPGA 3CS2A 4F9DA 2DZSA 1GHSA 4X0NA 1J79A 3CZGA 1LRNA 4RW5A 1MEWA 4OE7A 2X7WA 1F07A 1SZEA 3THCA 3HPAA 3LRKA 4NX5A 4HD5A 2OLHA 1EJWC 1JZ8A 1JPIA 1UCWA 3MBFA 5H91A 2ESCA 1LCOA 1XRTA 2WMFA 3DBPA 4DEFA 3N4FA 4O57A 3BCJA 4QNEA 4GK8A 1YDYA 1GK8A 2EXOA 1HP4A 3L4ZA 1REQB 3CGTA 3B4UA 3AJXA 2ZXBA 3OBEA 2V5LA 3KXQA 4IMEA 2AGKA 1WZAA 1O1ZA 3UG4A 5D2VA 3OLEA 4Y7EA 4CNNA 1UBSA 2PGFA 1FCVA 1ZRQA 3NQGA 1PWLA 1YXDA 4NZ5A 4TOQA 2VZOA 1W9XA 4JQ3A 1CGWA 1XH0A 2BGSA 2J8GA 2A6LA 3NO5A 2YA2A 3UJSA 5BROA 5BRPA 1DXIA 4ZOCA 3HF3A 3XINA 2V63A 3RLGA 2HK1A 3UZJA 2A3AA 2A7NA 1CXEA 1ICPA 3AS0A 3NPVA 2ZZ2A 1UPMB 2PDPA 1V77A 1M7PA 3LBCA 1FXQA 3AMLA 1V3LA 4NZ3A 1VBUA 2FFIA 4B2DD 4NJGA 5IBXC 4F2UA 4NZ1A 4RR4A 3SAZA 3W27A 4AEOA 3M0MA 1W5PA 1UPPA 1ZGDA 1MXDA 5I23A 1OK6A 3GDTA 2WJDA 4KGJA 4WD0A 3MPGA 2YCJA 2CZDA 2NQ5A 3R12A 2OO0A 1NP0A 4CN4A 3LGEA 3EOLA 1GZGA 4CQ9A 3OTRA 3DUGA 3OQ8A 1CLXA 3NNTA 3KRUA 2F84A 4H8HA 2DZBA 3KL5A 2EPLX 3QGAC 3OO2A 5TF0A 1VH7A 3LCXA 1VJSA 1POKA 3C3UA 3GZ3A 1R2SA 4FSAA 1YNPA 1VENA 2EPNA 4TXEA 1J5SA 4LSBA 4XD3A 4C6PA 5DANA 1BQGA 1ZJBA 1TG7A 5DFAA 3V16A 4OHQA 3S6DA 4XBSA 1VCGA 1G9HA 2VRKA 2VEPA 1BEUA 1OFOA 1KFCA 3R0KA 3N04A 1B57A 3PNUA 3S1WA 2XJ7A 3DXIA 4MF4A 1CGXA 2PU1A 3PWIA 2E67A 2F61A 3J7HA 3P5ZA 5KINA 1KV8A 2BMBA 4MDPA 3CQKA 4DWSD 5F7UA 1F3WA 1Q65A 2VFDA 3FA4A 1E51A 5HDRA 5D32A 4O0QA 2FZDA 1VFFA 4LYRA 1MSSA 4JTLA 3WEZA 1KWGA 3R1ZA 2PLCA 1YE4A 4QRNA 1XF0A 1XPGA 3TTOA 3O6CA 1Q6GA 1G67A 1WXYA 4UFLA 5BOEA 2WLZA 1UR0A 3MT1A 2GJLA 1V3MA 4Z2HA 4AWTA 4S3FA 1XYZA 1TV2A 2VENA 3V36A 1H1YA 1P6BA 2YIHA 4Q8NA 2YX0A 1GNXA 3O07A 5K9XA 4JAWA 1Q6EA 2ATSA 1MW3A 5B80A 3UR8A 4ICMA 1BVWA 1J4EA 2H90A 1EJTC 3B0PA 3SQLA 4YVVA 3P93A 1HVQA 2WKGA 4NXSA 2PP0A 3G8EA 4ILSA 1WZLA