2GK1A

X-ray crystal structure of ngt-bound hexa
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase subunit alpha
total genus 8
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1A02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1A01
4HPGA 3ZJKA 2WBGA 1UR1A 3OGRA 4H8VA 3WUEA 1E70M 2XYLA 3PZ9A 3I3BA 1B9ZA 1DWGM 1AQ0A 4FLOA 1NWSA 3BAYA 3TA9A 4P8VA 1KR0A 1KWGA 1E43A 1HVQA 2O92A 1QI0A 4MPKA 4QFUA 1OM0A 1B3YA 1EIBA 3MSDA 3W25A 4AIUA 5I24A 1IT0A 3QOMA 2DEPA 5CQ1A 4JKKA 2DT3A 5E09A 3WQ8A 3DC0A 3JUGA 4AIEA 1GQLA 4W5UA 5CPSA 4B16A 1KFWA 5ABHA 4MB3A 2J7GA 1ITXA 5A95A 2ZIDA 4JCLA 3VNYA 2OWWA 1EOMA 1GHSA 3N04A 4KGLA 3AIRA 1KXHA 1B90A 1DWAM 4MDOA 4GI8A 1MFUA 4UFLA 3F5LA 1GQIA 3PZUA 2VZVA 2Y5EA 1JFHA 2PWGA 1LL7A 2AAAA 4CUCA 2Y2WA 2G3JA 1CLXA 4JFSA 5FD0A 1H11A 3ARUA 4AD5A 1FHLA 1NWUA 2XIBA 3ZSTA 4ZFMA 5BXRA 1ZBKA 6CGTA 1FFRA 4J3XA 4IPNB 5IFTA 4P8WA 5E9AA 1H0IA 4R5EA 3QGVA 1V3JA 2MANA 2YDSA 3EMCA 4JFTA 4D72A 4MTVA 1U2YA 2G8ZA 2XUCA 4X9YA 2BVDA 1ZJBA 3PBGA 4D6JA 3EYPA 3HU7A 1AQMA 1BHGA 3MSGA 4QLJA 3KWXA 2J75A 4GZEA 3A4WA 4AWEA 2EPMX 4M82A 1NARA 2FHBA 3NUKA 3FW6A 1KGXA 1NQ6A 3BSGA 2VURA 2WXDM 4TVUA 3PTKA 4FF5A 2WVTA 1VFFA 5HBFA 1QBBA 4PSRA 1LWJA 2EJ1A 3FHAA 4AC1X 4P7LA 2FH6A 3AHXA 2YOCA 4F66A 3TOPA 4ZXOA 2HVMA 1LL6A 1A47A 2W62A 1WE5A 2ZX6A 5DMYA 1JI2A 1P6WA 3RDKA 1I1XA 2GDVA 2J78A 1CXLA 1UHVA 3ZR6A 4HMDA 5D8WA 2GJPA 2VI0A 4V28A 2WM0A 1GOMA 1BAGA 1GONA 2BY2A 4WSKA 4ACZA 2WCSA 3OB8A 4W8LA 1OD8A 3LMYA 3MO4A 3W6MA 4BF7A 3WUBA 3K4AA 4X0VA 1CTNA 4PRWA 2W66A 4HU0A 2ZXBA 3L4YA 4N42A 4PUEA 4IPLA 1XYFA 2WVVB 1TZ7A 1V3LA 4U31A 3BAWA 4ACYA 4B15A 4PSPA 2UY3A 4F9JA 5BYWA 2XM2A 3WF4A 1UZ4A 1ZU8A 1JD9A 2J7EA 1MQQA 1G1YA 1FP9A 4ATWA 1BSIA 1MW1A 2PWHA 1W3KA 5KZ6A 2WWCA 1TCMA 1V3HA 2CBIA 3FNDA 3N18A 1VFOA 2E9BA 1JL8A 4PEEA 1JXKA 1JI1A 1YHTA 2JIWA 3UERA 4X0NA 2YKKA 3WH6A 2XTKA 1CECA 3NSXA 2F2HA 3RILA 3WQ5A 1DWHM 1VEMA 2DT2A 1QNOA 4JKLA 1AVAA 3KL3A 1TA3B 3AZSA 4V27A 4KRTA 1DHKA 3ZR5A 3UR8A 1HJQA 3UG4A 5CG0A 3O2LA 2EXOA 4XZBA 3IJ8A 4M80A 2YJQA 5DT7A 3GNRA 1V6YA 4V2XA 5FOOA 1MQRA 1HF6A 4D1IA 2A3BA 1ZJAA 1GJWA 1G01A 3ARVA 1CGWA 4OBRA 2XFYA 4DUVA 2AOSA 2BHYA 1PIFA 1HKMA 4OUEA 1H1NA 1HJXA 1HL9A 4JL1A 1CEOA 5A2AA 1TR1A 3GXDA 2QV4A 1OGBA 2CHNA 5IXEA 2ZUTA 1UQZA 4YN5A 3AS0A 4TUFA 3W37A 1JNDA 4OZOA 1QI2A 4MNKA 1W32A 3W4RA 2YL5A 2WKLA 2F61A 3OLDA 2DQXA 5AC5A 2VCBA 2FDMA 1JZ3A 1QNSA 2PWFA 4AEFA 5LYRA 5ABGA 3DYOA 4PBGA 3WBAA 2E3ZA 1OT2A 1VEPA 3AMKA 2XVKA 1MW0A 4ML4A 5E70A 1UKOA 1E0XA 3BMVA 2CBVA 3IJ9A 4ZENA 1EO5A 3FHQA 2WMJA 1EA9C 1JYWA 1UA3A 4PUDA 1LL4A 2BY1A 3AIVA 1PX8A 3PZIA 3WN6A 1EHAA 1UKTA 2DSVA 3T09A 1W2PA 4CD8A 3VNZA 4Q22A 4GQRA 4HZ6A 3CUJA 5C71A 3SCSA 3MUZ1 2UY4A 1DP0A 1PX3A 2DPEA 4W7UA 3VINA 1ISXA 5CPQA 2G4FA 4W84A 4AZ6A 1EQCA 5A6KA 4EKJA 3WNLA 4PMZA 3AHTA 2D0FA 1E6PA 4AW7A 3AYSA 3BCFA 2F8QA 3VDHA 2PF0A 3NIYA 5CZKA 2V5CA 4KMQA 1H09A 1FH9A 5C70A 4UQEA 1HKJA 1GQKA 4CU7A 3VIFA 1HVXA 2A3EA 2BV9A 1FH8A 2FGLA 4RE4A 4HOZA 3WL1A 3POHA 2J74A 4W5ZA 1E4LA 4DWSB 4RE3A 3CUFA 3AMCA 1JGIA 3QOKA 5JBEA 2RGLA 1E5NA 3VD4A 2VJXA 3VVGA 2VX7A 1GNXA 1M53A 4P7OA 3FAXA 5A8OA 3BC9A 3WDQA 2OSWA 4UTFA 2QHAA 4LYPA 1W3HA 3PZMA 3SUUA 1UG6A 2O9RA 3HN3A 4HMEA 1Z32X 1UH2A 3ARXA 1HP4A 1HXJA 2D24A 4HA4A 3MUAA 3VU2A 1D3CA 3F5KA 4UFHA 4C7DA 4YHGA 2D1ZA 1V6VA 4NRSA 1ZBWA 3WSUA 2FHFA 1EQPA 4J3UA 3WQ4A 1O6IA 2A3HA 1WKYA 1C91A 4BQ5A 3K1DA 5BXTA 4TXEA 4PYSA 2ZXAA 2XM1A 4N0RA 2J47A 1XD1A 3VIGA 3SIMA 1B1YA 3ARTA 1E15A 1V03A 4AY1A 1XH0A 3GDBA 4DUWA 2CEQA 4HZ8A 3VILA 1UR8A 4AZCA 3AIQA 4AD0A 4CKQA 3WEOA 4F8XA 3D5HA 3AIBA 4UFJA 1J9YA 1BTCA 3AZTA 3FXYA 4CN6A 4BQ3A 4AISA 2XG9A 4E8DA 1PJ9A 3WF0A 3AJ7A 3O9NA 2J7HA 3WNNA 3CZEA 2WVSA 4TTUA 2IUZA 1I75A 3PTQA 4MNLA 1VIWA 4PTWA 4WKAA 3UESA 4BA0A 4W89A 1Q6GA 4CVWA 1WZKA 5LA2A 3MMUA 1VJSA 4LYQA 4U33A 1SFSA 1UWRA 5DF0A 2JE8A 2QMJA 4XV0A 2BFGA 1NH6A 3T08A 2B31A 3RCNA 3MS8A 2XVNA 3HMCA 3RMEA 4TTGA 4KH2A 1UD2A 1UKQA 2E9MA 2EPKX 4MNJA 1VBRA 1WPCA 3CPUA 3WUFA 1QPKA 3VM5A 4C7GA 2J77A 1H49A 2WBKA 4H41A 3U7BA 3U5YA 2V3GA 2J79A 3SUSA 3WDJA 1SMAA 2EPLX 5CSYA 3VDBA 5A94A 4PN2A 2ZXDA 2JEQA 2NT1A 1V0NA 1BFNA 1GHRA 1QW8A 4C7FA 4TVDA 3S2CA 5C8BB 2E9LA 2DIJA 3II1A 3QHNA 2OYKA 3OBAA 1WDSA 5FL1A 1UKPA 2Z1KA 2VQTA 1KBBA 4ATLA 3WENA 3N1AA 1J0YA 4HA3A 3NDYA 4E4PA 1ZBCA 4J7RA 1CXFA 5I79A 1QHZA 3VGFA 1ISVA 1H2JA 3MU7A 4MJ4A 4K68A 1J01A 4MADA 1B0IA 3AOFA 2W5FA 3THCA 1GQJA 3WH8A 3IJ7A 1TUXA 1CPUA 1R86A 3VTRA 1W9XA 3ALGA 4TVCA 2NSXA 3AYRA 1OT1A 2WMFA 3U7VA 1BGAA 1XH1A 3WNPA 4CCCA 3GTNA 3SURA 2PB1A 4PTVA 1ZB5A 3RM8A 4CD7A 5IHSA 1UH4A 5A6MA 4HZ7A 4HPHA 2PI6A 1G0CA 2WW5A 3OG2A 3BMWA 1Q4NX 1E73M 4JHOA 4MNMA 5CSUA 1MFVA 2CBJA 1WDQA 3CIVA 1MW2A 4D6EA 1CDGA 2WMIA 3SCWA 1XD0A 1NWTA 5A6BA 3VD9A 1MW3A 4OOUA 3WH5A 1E6RA 1J18A 3TTYA 2QPSA 2D2OA 1ZL1A 4XZWA 3QHOA 5E0FA 1VFUA 5I0DA 4HOXA 3K8MA 4P8XA 4UOZA 5DT5A 5ABFA 2UY2A 2D22A 4M56A 3CBWA 3MV01 3N13A 3VPLA 1JDCA 1OWQA 2WHMA 5A6JA 2CNCA 3LPGA 1US3A 1V08A 3WH7A 1KXVA 1LLOA 5CGMA 3T0AA 3OLIA 4LQ1A 1GJUA 1DEDA 3ZM8A 3VX1A 3LPFA 1GORA 4YHEA 2J7FA 3T0DA 2WMIB 2X0HA 3MV11 2GK1B 1L0PA 1BYBA 4WLCA 1LF1A 1C7SA 1OGGA 1UYQA 4H2CA 1UOKA 3W26A 1CBGA 2J8GA 2EBNA 2DH3A 4E8CA 1UUQA 2J7CA 4DM1A 2WZIA 2OWXA 2JEPA 1IZJA 4Y7EA 2XSAA 3TTSA 4QLKA 3N9KA 3VIPA 3WD4A 1XRVA 1HX0A 1W2VA 1UWUA 2DH2A 3IK2A 4GZIA 5A8PA 3AXXA 4MAZA 4UCFA 1BPLB 1WZLA 1XSIA 5CPTA 1CXKA 1FHDA 1FA2A 1WZAA 3BAIA 1HP5A 4MJ2A 4M8UA 2YA2A 3VGDA 5GQBA 3IAQA 1J0IA 3ZT7A 1RD6A 4JHZA 2CKSA 1E55A 2OSXA 4JFUA 3W81A 2XVPA 2YDQA 2VZSA 1VFMA 1QW9A 2IXUA 2V3DA 2WLZA 5EFFA 2WHLA 2YBUA 1I1WA 1CGTA 4ACZB 3WFLA 5FIPA 1V6UA 1V6WA 5BWFA 2WK2A 3VMNA 3SCPA 2VMFA 1OINA 1KBKA 3ZJ6A 3A3HA 4U5KA 3AZRA 2WWDA 5DFAA 3WQWA 2FGZA 1UR2A 2WSPA 3PZOA 4UFMA 1JD7A 1V6XA 1V3KA 3DECA 4M29A 2XWEA 8CGTA 1BVZA 2WPGA 1FOBA 5HPOA 4UQDA 1OGSA 1VENA 4OIFA 2VT0A 3OLGA 1FFQA 2XGBA 3N11A 3AISA 3OGSA 4W88A 3ZJ8A 4AZ7A 1J0JA 2ZX8A 1HL8A 1N82A 1QHPA 1V0LA 2TAAA 4H8HA 3WMCA 2XVGA 1LQ0A 2G3MA 3L4ZA 4AD3A 4UR9A 1CZ1A 1JG9A 5AY7A 4OKDA 3I3DA 1JXJA 3EDEA 2VZOA 1GOIA 3GBDA 1MYRA 4EAMA 2J7DA 4J3WA 3W6LA 2GVYA 1B31A 1NOWA 1M7XA 4GI6A 1KWKA 3WH9A 3AS3A 4Z2GA 3L4WA 4C90A 1JF5A 5A2CA 1E40A 1C7TA 4OOZA 1O7AA 5A6LA 4ZE5A 3VMPA 3M46A 3FY1A 2XSBA 3N12A 3B9DA 4PMQA 1TE1A 4LXFA 4UQAA 3POCA 4W8AA 5A1AA 1R87A 3LPOA 4RE2A 1Q6EA 4PTMA 1NM9A 5D9OA 2ZUMA 1KR1A 1W1TA 3WFZA 3CUIA 3NSMA 1KQYA 4NSBA 1JDDA 5A3HA 3ECQA 1UR4A 4LX4A 5I2UA 5HNNA 2VX5A 3F5JA 1UR0A 4MB4A 4AZIA 3WQVA 2DSZA 2EQDA 1Q6DA 3EMZA 3VOCA 1PZ3A 1J10A 5BRPA 3SCQA 3L4UA 3T2PA 4LGXA 5E6YA 1ODZA 3VD5A 1WP6A 5D9PA 4P7QA 2J8FA 1E0VA 4HMCA 1OB0A 3W28A 3MKKA 3ARZA 3ZQ9A 3IAPA 3VO0A 3BXWA 3WF3A 4D6HA 1CGVA 5D8ZA 3SEPA 1ZBVA 4U2ZA 3AS1A 3PZVA 5JBFA 1M03A 1C8QA 1W9BM 3W0KA 8A3HA 1PX4A 2XVLA 2VR5A 1CNVA 3EBVA 1OSEA 2GJXA 3A47A 1WCGA 3K8KA 3VIIA 3O6AA 5F7UA 4JCMA 3MUIA 5FL0A 2GFTA 3ALFA 5CXPA 1TVPA 2WC7A 1S46A 1UZ1A 3CTTA 1NWRA 4W86A 1KB3A 1W3LA 3GNPA 1K9TA 2PWDA 4B9YA 1XGZA 2YLAA 4FLSA 3WELA 2PWEA 1G94A 2ZXQA 1Q6CA 1UR9A 2VVSA 1UD6A 5IFPA 2V5DA 3NJ3A 3AMLA 5M3WA 3AS2A 4W7WA 3OA5A 3ZO9A 2BXZA 5JIWA 5GNYA 1UD3A 4J3SA 1W1PA 1K6AA 2CBUA 1J0ZA 3K46A 4JIEA 3VGGA 3CZ8A 3SCUA 3WDHA 1PIGA 2YBTA 1BQCA 3VIHA 3CMJA 1E6NA 2GJRA 1HJVA 3KL0A 1XCWA 5I6SA 3NSNA 3AMDA 1QI4A 1KGUA 4BQ4A 2EEXA 2VL4A 1MWOA 1QNPA 2BY3A 4PTXA 2ZX9A 3ARRA 2OLHA 1SR0A 3TTQA 4KGJA 3ZIZA 1IV8A 4FMVA 3VIMA 3F4VA 1QI5A 2GUYA 2DIEA 2PBGA 3AMGA 3VGHA 1SYTA 1M01A 3OLEA 3VM7A 5A6AA 7CGTA 1SMDA 1HKIA 1MXGA 3GM8A 2W67A 1XC6A 3RIKA 4WF7A 2D3LA 1DWIM 1WZMA 3RJXA 4JL2A 4PMYA 4AEEA 4CCDA 4L4PA 1JAKA 2WMHA 5I23A 1Q6FA 4FLQA 2VX4A 4KWUA 3WNMA 3ARQA 1E71M 3UR7A 4NZCA 4OJYA 2ZE0A 3VIJA 1ISWA 3G6MA 3CHCA 4J27A 4D6FA 4D6CA 3NDZA 1US2A 1X1NA 4UQCA 2CERA 1B3XA 3GH4A 3TTOA 1JFXA 2A3CA 2FHCA 1EGZA 3CUGA 3WNOA 1XH2A 5I3DA 1JZ6A 1NOFA 1M04A 3GYCA 2OYLA 3AFBA 4U3CA 1AMYA 1BLIA 2IXVA 1VJZA 2VVNA 4XX6A 3VD3A 3GNOA 1V0KA 2BS9A 3APGA 3SCTA 3PZGA 2Y8VA 5BXSA 5EBAA 2VCAA 1CXEA 3ZOAA 3B8SA 7A3HA 2QMKA 4F79A 1E0WA 1QI3A 1GVIA 5TD4A 1H4PA 3VIKA 2EPOA 3E1F1 3N17A 4UQBA 4ZE4A 2CYGA 2C0HA 2ZOXA 1OCQA 3DYMA 2RGMA 1KXQA 4XUYA 3B9EA 1K9FA 3BLKA 1LWHA 1PEZA 9CGTA 5HXMA 1EH9A 3ARPA 1MQPA 4A3YA 4LPCA 3A4AA 2VRQA 4UNIA 3A4XA 2Y8KA 4Q7NA 2ZWZA 2JF7A 4AD4A 4BCEA 5ECUA 5HDRA 3OZPA 3SUTA 4CD5A 1E5JA 3CO4A 2GJXB 3RJYA 1HNYA 1R7OA 2XWDA 3CZGA 2WYSA 3IANA 2D0HA 5DO8A 3ARYA 2D20A 3SCOA 4EE9A 1GW1A 4UZUA 2ZICA 1E4NA 1CENA 2W63A 2J62A 1B3WA 1J11A 5KEZA 1EOKA 2X1IA 2E8ZA 4AYSA 1OIMA 1W9PA 1JNEA 2OSYA 3W82A 2WCGA 1EHNA 4W87A 3WF1A 4M81A 4BQ2A 1X6LA 5A6BD 1XSJA 2X05A 1JIBA 2VO5A 4Z2HA 4AZGA 2Q8XA 1LG2A 5ABFB 2QLYA 2JFEX 3UCQA 1C90A 2J7BA 1W1VA 2A3AA 1G9HA 3EDDA 1HKKA 2Y4SA 3AHYA 3WD1A 4MB1A 4S3KA 4UOJA 4J28A 3B9AA 5AYIA 1E3ZA 5M17A 5LA1A 1V3IA 3WL0A 1XHGA 4AZCB 4D1JA 3J7HA 1LG1A 1UWQA 2VRKA 3RM4A 4GQQA 1B3ZA 2E0PA 1CXHA 2VZUA 1CGYA 4D71A 3QHMA 2E8YA 2BVYA 5GNXA 4AD2A 2FH8A 1UH3A 4W85A 5BRQA 3K4DA 3OGVA 4M1RA 1UD4A 3S6TA 4UFIA 2UWFA 2VC9A 3PZTA 3K8LA 1W9VA 3EDJA 1V0MA 2GDUA 4IM4A 4PMVA 1PAMA 4QP0A 2YL9A 1GPFA 3RPMA 3AHVA 4MAVA 1JYXA 1TFVA 1XV8A 3BGAA 5EMYA 4GZJA 2XJ7A 1H3GA 2ZUVA 1RPKA 3BAKA 3M7SA 2YL8A 3AICA 1D2KA 1TA3A 4PMUA 1ODUA 4NI3A 1C92A 3GXFA 4U5IA 5EB8A 2VUYA 2WAGA 5I78A 1L8NA 4URIA 2WANA 2DDXA 3L4XA 1R85A 4PMNA 2ESCA 4ZEPA 5JUVA 1GZJA 2CKRA 2WMKA 3VDCA 7TAAA 4UFKA 2E4TA 1EDGA 3MUY1 5I5RA 3GZAA 1C8XA 4S3JA 5E6ZA 1OD0A 3GBEA 4UQ9A 1C3FA 2W4XA 3SUVA 2ZX7A 2BVTA 5CLWA 1GOQA 2GK1A 1V3MA 2X2YA 3RO8A 4C91A 1JF6A 2ZUNA 4WK9A 1E6ZA 4OBSA 3WIJA 1AQHA 1XYZA 3UETA 3UG5A 2WLYA 1C8YA 3NYDA 2XFRA 4CD4A 1E6SM 2QF8A 1H0GA 3FAWA 1QNRA 3BSHA 3VD7A 2O9TA 4PMRA 2BXYA 2WC4A 1FP8A 1QHOA 1J0HA 1PBGA 3SCRA 1W3JA 3LPPA 2X0YA 4F9DA 1VEOA 1JZ4A 4PMOA 4W7VA 4R27A 4A3HA 2VRJA 1KXTA 1TVNA 1FH7A 1ZS2A 3KE0A 1HIZA 2V3FA 4NRRA 1JZ2A 3N15A 5D9NA 2BY0A 4CN4A 1MXDA 3TONA 1GCYA 1C93A 1E1FA 2VX6A 3I3EA 2AMGA 2X8RA 2G41A 2W92A 3CUHA 4Z2LA 4GPNA 1YQ2A 1OBAA 4B9ZA 1V02A 3EMQA 1R7AA 3PN8A 2VOTA 1D7FA 4J3VA 3VX0A 1WDPA 1ISYA 4LYRA 1U30A 1QVBA 3WDRA 3RM9A 4CVUA 1PZ2A 4XB3A 1F4AA 3WD0A 2ZUUA 2CPUA 4GXPA 2G3IA 5LA0A 2JALA 5FCZA 5CLTA 3OIHA 2CXGA 5A8QA 3SCNA 1BVNP 5A8MA 3D3AA 3PZQA 1K9EA 3UG3A 2DGAA 1DWFM 4GO9A 4QCEA 1LJYA 2YA0A 4AZBA 1KCLA 4WIWA 2VR4A 1A3HA 3AQUA 4WJXA 4HP5A 1BYCA 3ZMRA 3SCVA 1UKSA 4BZYA 1E4IA 3WBEA 4PCTA 1VAHA 1CGXA 2EPNA 2G3NA 3WQ6A 6A3HA 1ISZA 4UOQA 4B3KA 1CGUA 3PTMA 3MMWA 1B3VA 3WMSA 1OIFA 5FKYA 2D23A 1JZ8A 2WHKA 1B2YA 3VUPA 3MANA 2D0GA 1W9DM 1E6XM 3AROA 2WMGA 3WEZA 3AIUA 4DUXA 3L2LA 4HA1A 1NP2A 2XPKA 1RH9A 2CHOA 4QCFA 3ZJ7A 4W8BA 4UZSA 3WNKA 1CIUA 1E4MM 1CXIA 4GINA 3CGTA 3ARSA 1CLVA 3W53A 4RL3A 3W29A 4FK9A 1WAWA 4BS0A 2WVUA 2NT0A 3CZKA 4L4OA 2DSUA 1UA7A 5A8NA 2Z1SA 1E72M 3WEMA 3VKKA 2BNJA 4DWSD 2BHUA 2BHZA 5IDIA 3KZSA 2CITA 4EANA 5E0CA 2EO7A 4GI9A 4D6DA 2UY5A 1VRXA 3W38A 3WDPP 3BCDA 2VCCA 3PHAA 4W93A 1MVYA 4DWSC 4ATDA 4E2OA 5ABEA 2VTFA 1BYAA 3WKZA 1E3XA 2WHJA 2W61A 3CHDA 6TAAA 3GXIA 1BYDA 2XGIA 4JAWA 2OWCA 4U2YA 4AZ5A 1E56A 1V02E 3DHPA 1BG9A 3CLWA 3BAJA 5GPRA 5JBDA 4H7VA 2J4GA 5D4YA 1TMQA 3BLPX 1X6NA 1HJWA 2VQUA 1GVYA 1GUVA 2CETA 3VGEA 4HOWA 1JZ5A 3AXHA 3NCOA 3VMOA 1GOOA 3BH4A 2WNWA 1RP9A 4AIOA 2DT0A 2NW0A 4MB5A 2JIEA 2D3NA 5BCAA 3CH9A 2WSKA 2YIHA 3T0BA 2JF6A 5AC4A 1W9UA 3W24A 3UEQA 5CJ5A 4PMDA 1WDRA 3DHUA 5GNZA 1CYGA 1HN1A 3T2QA 2ZWYA 4AMCA 2DSWA 4PCSA 4QLLA 2O9PA 2YA1A 3AIWA 2Y24A 4NF7A 1CWYA 1ITCA 3ZT6A 3VGBA 1QNQA 1JAEA 1EO7A 2OYMA 3OZOA 4CN1A 1H41A 3CHFA 4MDPA 3M07A 3HJEA 4HTYA 3CZLA 1W1YA 1W91A 2DT1A 1HT6A 2PC8A 1KGWA 1J0KA 1UWTA 1PPIA 1JYNA 4EK7A 1UWIA 4P8UA 4CD6A 3BAXA 2VZTA 1EDQA 2X09A 2YL6A 1U33A 1HJSA 4Z2JA 3WY1A 2ZX5A 1DWJM 1VB9A 5DEZA 2ZUSA 1KQZA 4FLRA 5BROA 3QR3A 3T2OA 3WD3A 1E1EA 4D6IA 1HJUA 2O9OA 3WMBA 2J25A 4J3TA 4WKFA 3ZT5A 5IHRA 3WD2A 3WDIA 5D9MA 4U3AA 2XHYA 3VIOA 4DWSA 2YDRA 5JIPA 1WB0A 1UQYA 1UWSA 2WZHA 5I77A 3EDFA 2XFFA 3GH7A 3GH5A 2WKGA 2WZEA 3MMDA 5CGTA 2QPUA 1JDAA 5HOSA 4CU8A 4Z2KA 1BF2A 4QAWA 3KL5A 3CZJA 3AIEA 1BG4A 4IUGA 5M03A 4CCEA 2V38A 1QBAA 4YPJA 5HPCA 3FN9A 1E6QM 2YLLA 4H04A 4A4AA 4JFWA 3DYPA 1GOWA 1Y7VA 4CU6A 4IISA 1VBUA 3CHEA 3CMGA 3L2MA 2V3EA 3L4VA 4PMXA 5A2BA 5BXPA 4D6GA 1JYVA 4P7NA 1EDTA 1G5AA 1IZKA 2VNCA 1WO2A 4CGTA 1K9DA 4GIAA 1F4HA 3U5UA 3WF2A 1TG7A 4GKLA 3TP4A 4WKHA 4JZ5A 4B3LA 2GSJA 5EFDA 4HU8A 3ARWA 4AD1A 2CIPA 2CCRA 1R8LA 1JZ7A 1UD5A 4TX6A 4H8UA 1RP8A 3WUGA 3ZSSA 3SUWA 4TX8A 2XIIA 4AZHA 3W27A 1GOKA 1WNOA 4GO8A 2WCAA 3AXIA 4Z2IA 1B30A 3AI0A 4JKMA 1ESWA 2ZUWA 1BGGA 3VDAA 2WVVA 3U57A 2CESA 3GXMA 2W91A 2C7FA 5M5DA 4TOQA 1KCKA 3L4TA 1UD8A 1E9LA 1J12A 1VF8A 4JFVA 3A6OA 2HISA 1DTUA 4WSJA 1EXPA 4P7RA 1QOXA 1XSKA 5A69A 1NP0A 2E40A 2PBOA 1NOUA 1ECEA 4M24A 5AYBA 1XCXA 5A6SA 3PZNA 3THDA 3M6DA 2WC3A 3EDKA 3G6LA 1H5VA 3KEHA 2WB5A 2C8NA 3AHZA 2DSKA 4KRUA 4DM2A 4AXNA 4ZXLA 4QDMA
chains in the Genus database with same CATH superfamily
1H7OA 4HPGA 4K2SA 3VFCA 2WBGA 3E5PA 3HG3A 1QMLA 9RUBA 2QAFA 1RCXB 1NWSA 3MJMA 4W4QA 1GYMA 4MPKA 1EIBA 3GVRA 1ZPTA 1A3WA 1IT0A 1ZUAX 3LBOA 4YVXA 1Q7QA 2HS6A 1JQXA 4JKKA 4LBSA 1XCFA 3BO9A 3WQ8A 1R5YA 4IIDA 3FJ6A 4AIEA 1GQLA 3H7VA 1KFWA 2OMAA 7ODCA 4GC3A 1DVJA 1ITXA 1IR1A 3VNYA 4JCLA 5FF0A 5RUBA 1VCFA 4KGLA 3FV9A 4DLMA 3K5XA 3TKFA 1XBYA 4PZVA 1GEHA 1R6WA 3HPXA 3W1AA 3QMSA 4NI8A 1XX1A 4GABA 3CH0A 1ZALA 1LL7A 3WFAA 4ZCWA 3M64A 2Y2WA 4JFSA 2FMNA 3ARUA 1FHLA 3B8IA 2XIBA 2ZZ5A 2CLPA 4GNKB 3W7MA 2PRMA 4J3XA 2HMCA 4MSSA 4ILSA 3UWUA 1XGDA 3NWRA 5C6MA 3QGVA 1PYFA 2PSNA 3LCWA 4MTVA 2R1KA 2C3ZA 1ZJBA 1WXZA 4D6JA 3EYPA 4DXKA 3L7RA 1GPWA 3W73A 1XW8A 4M51A 1UBSA 1Q8JA 3AXKA 4O8AA 4EX4A 4PA8A 4HSOA 4F4RA 3BSGA 2GVGA 2ON3A 2CU0A 2WXDM 2HEJA 2WVTA 4GUHA 5FJRA 4B5UA 2PMQA 5J5DA 3AHXA 4LAZA 3TOPA 3NEVA 2C13A 1W6TA 1OYCA 2W62A 1WE5A 2ZX6A 3GKFA 4K6AA 5DMYA 3I6TA 4WGXA 1NJJA 4ADUA 2QJIA 2GJPA 1EEPA 3GD6A 3NQMA 4LW7A 3MCOA 3O0FA 2BY2A 4ACZA 5JVLA 2HPIA 4HJFA 3BLEA 4K3ZA 2GWGA 1D7KA 4B5SA 5DELA 3UW6A 4NZ4A 5AHFA 3GFZA 1H7XA 3GE7A 3HG2A 3HB9A 3DG6A 1XRSA 4S3BA 4L65A 4PSPA 4FEZA 3PM6A 1PCKA 4L9YA 2NX1A 1J79A 1UZ4A 2WSRA 1ZU8A 1D8WA 2J7EA 1S2WA 3ZLHA 5CBBA 5TQLA 1BSIA 2PWHA 1W3KA 5LNUA 1V3HA 2PCEA 2Z1WA 2VEIA 3N18A 2E9BA 1QK0A 1YHTA 1RD5A 2JIWA 4DF2A 4UTJA 1YPFA 4X0NA 1F8MA 3IJDA 3VKJA 3F03K 2YKKA 5FJPA 3ZFHA 2C19A 2TODA 4XD5A 1FWHC 4JKLA 2H90A 4Q8VA 1TVLA 4EXAA 5CG0A 3UR8A 1HJQA 2Z2AA 4G56A 2ATMA 2YZRA 4NU7A 4US6A 3FKKA 2OQLA 5CJMA 5A6TC 4YYCA 4Q8QA 6XIAA 3BCJA 1G01A 3TSBA 3ARVA 4I7VA 1RPXA 1OZMA 2AOSA 3EWYA 1L6GA 1PIFA 3NPXA 3T8QA 4OUEA 1H1NA 1QAPA 1HL9A 4JL1A 3NL2A 4ROPA 5IXEA 1QCWA 3W37A 1JRCA 1JNDA 3QEZA 2FZMA 2QT3A 2Z29A 5FI8A 4LUIA 3CNYA 2VCBA 1JZ3A 1YTKA 4Z08A 3TW7A 2WKJA 5BOEA 1FWGC 4LUYA 1JDFA 1OX4B 1XUZA 5I00A 3STGA 1FTXA 2DZAA 5E70A 1WXJA 4NG3A 3VCCA 3RN6A 3BMVA 2CBVA 3QPZA 1EO5A 3CEPA 5A5WA 1EA9C 3BUVA 1JYWA 3S2MA 1KRCC 2BY1A 3BARA 4WY0B 4JTIA 4FX7A 2DSVA 3T09A 1GTEA 2IW0A 4LYKA 4CD8A 1CX9A 3VNZA 5HJXA 5I3FA 3CUJA 3SCSA 1F5ZA 1TJRA 2X7VA 1KKRA 3VINA 1NTHA 2G4FA 1V77A 2CXEA 3LHVA 4DXVA 1JPDX 2OPJA 3H55A 4XSLA 3BWWA 3BCFA 2Q71A 3NIYA 1R3WA 1KM3A 4M7SA 2FTWA 7TIMA 3MKCA 4RE4A 2OTDA 4GY0A 2YYUA 1E4LA 4DWSB 3H8AA 3WQPA 4EPDC 1UZDA 3CUFA 1R3VA 1U1JA 1EGVA 1AD1A 2VFDA 4I5UA 2VJXA 2VX7A 2WJEA 3I68A 4E5TA 4QS5A 4XZ9A 5AFDA 3MHGA 3P61A 3BC9A 5GJMA 4H9XA 4LYPA 1UG6A 3EEGA 3HN3A 3NM3A 2PTZA 3TJXA 1Z32X 3E2RA 1UH2A 3ARXA 3R1ZA 3MUAA 3W9ZA 4QNWA 1ONRA 4M1BA 4BI6A 5E0KA 3N9SA 1V6VA 5F4WA 5HR6A 4UBPC 1R38A 1LRNA 3EA2A 1O6IA 2A3HA 1C91A 4BQ5A 5BXTA 3L21A 3IJIA 1TE6A 2VFFA 4LBRA 3MPGA 4N0RA 2J47A 3H26A 1SGJA 2FQIA 1WDDA 4GNJA 1E15A 5GJNA 3UGVA 1V03A 4AY1A 4DUWA 3DFSA 2CEQA 4HZ8A 4AZCA 3AIQA 4AD0A 5EIYB 3D5HA 4UFJA 2DU2A 4Q3MA 3REQB 4E8DA 2YX0A 3WF0A 1YEYA 3WNNA 1O95A 3IK4A 2WVSA 4TTUA 3PTDA 2FVLA 2IUZA 4LS0A 3VZXA 3UXLA 3UESA 3ITTA 4W89A 5DRCA 3VNIA 3SQMA 1FCQA 4K7YA 4JIQA 4EPEC 4C6KA 3W7JA 2NQ9A 3PJUA 4MKNA 1KM4A 3RPTA 3MI6A 1E0UA 1KTNA 3GTXA 1NH6A 3E0WA 3WLHA 4YS1A 3U4AA 1H7PA 4JTGA 4E6MA 1DOSA 3QZEA 5HMSA 2H9AB 4TTGA 3PUOA 4GY7A 4KH2A 4IL0A 1Y8BA 5CC5A 1UD2A 2EPKX 1WPCA 3CPUA 3LNPA 3KRZA 1G4EA 1I2PA 2A21A 2J77A 2JQXA 2WBKA 4LTSA 1DXIA 1MDLA 3U5YA 2FKPA 3SFKA 3SUSA 4PH6A 4LVBA 5CSYA 4PRRA 5A94A 1Q4WA 1V0NA 1BFNA 3N2TA 4B5VA 1OZQA 4TVDA 3S2CA 5C8BB 4AX6A 3U8GA 1ME8A 3ITYA 3UFYA 2DIJA 3II1A 4E0CA 3GB6A 1ZAHA 1D9EA 1MXSA 4LUJA 2VQTA 4ATLA 3WENA 3N1AA 4A6GA 1OHLA 5AN7A 4J7RA 4GH3A 1LP6A 3R11A 2IKHA 1QHZA 1ISVA 3MU7A 2SFPA 1TPH1 1J01A 3TDFA 4H2HA 4AF0A 1VRDA 1GQJA 1YE6A 3IJ7A 4DN1A 2E68A 2VUNA 3VTRA 3S1UA 1MZRA 3AYRA 3VK5A 2G96A 1KRAC 3OJGA 4CCCA 4Q4SA 3UT0A 2OZ3A 4B91A 3TUUA 3MMTA 3W7KA 4CD7A 4QROA 3LY0A 3N19B 2ZZ7A 1G0CA 2PLMA 1XLKA 3C8FA 1KD0A 3LXAA 2CFFA 2I1OA 5DMLA 1S5MA 4CQ8A 5M2FX 4H7ZA 3HF3A 1MFVA 3H2NA 2GZXA 4H6EA 4DELA 1KTCA 4RJEA 4OTKA 2WNQA 4HGXA 3PBWA 1NWTA 2OEMA 3SO7A 3ONCA 1DL3A 3G0UA 1ADOA 3OVRA 1E6RA 1J18A 3QQ1A 2D2OA 1XBVA 3QHOA 4QM1A 4JQ1A 1RV8A 1U22A 3R79A 3W1NA 3FGCB 4HTBA 2QULA 4CNTA 5FJTA 1O12A 3GZ3A 1PXGA 3NVTA 1HL2A 2FIQA 3OQ8A 3H7RA 1KM6A 2QNEA 1YDVA 3ZM8A 3VX1A 4E38A 2ZVIA 2F6UA 1KFLA 1OX5A 1RUSA 2QCNA 2HE8A 4H2CA 1UOKA 1K4HA 3BZJA 1A5NC 2DH3A 1KBIA 3NQCA 2B4GA 4DM1A 2NQZA 2OWXA 4YTSA 2JEPA 4Y7EA 4ZB0A 2AQOA 3GTIA 4ORMA 3WD4A 1S2VA 1TX2A 1HX0A 3EXSA 4GI4A 2R9RA 3IK2A 1T6MA 3ANYA 3AXXA 1BPLB 3UNDA 4QHRA 1FX6A 4FOJA 1FHDA 2E28A 1HZYA 3KVJA 2XDFA 1WZAA 3DFPA 4QITA 4ZOCA 3A23A 5H1WA 1J0IA 4JICA 3WQDA 1X96A 1XGEA 1EFZA 1Q45A 5EFFA 2V3DA 3G18A 1CGTA 2E5CA 4RW3A 1HKWA 5FIPA 1V6WA 5BWFA 2WK2A 2Q02A 2WSQA 3VMNA 1OINA 3NEHA 1KBKA 2EPHA 3D46A 3AZRA 4GYPC 2ZZ6A 2OGYA 1EF3A 2WSPA 1V3KA 3L0KA 4LJ3A 4GJ1A 1BVZA 4NJGA 2A7RA 1PTDA 4AF0B 1J8VA 3ABQA 3W7DA 4LU0A 5T9BG 4OIFA 1EC7A 1ADDA 3N2MA 3QSRA 2OJPA 3ZJ8A 1OFDA 3GU9A 4O1DA 2BMBA 3RU8X 1HL8A 3LK6A 6TIMA 4FXSA 2XVGA 1R9YA 3PNUA 2BLEA 2G3MA 4XWUA 1VC4A 3RXZA 4F0LA 2QR6A 2QZRA 3LCHA 2VM8A 2BGQA 3MP5A 2V2CA 3COTA 2WPBA 1MYRA 1K3UA 2R82A 4UR8A 4XZIA 3UF9A 3W6LA 2BP1A 1B31A 2A7NA 3AS3A 4Z2GA 3L4WA 1JF5A 1JCMP 1C7TA 3VMPA 4XZMX 3M46A 3N4EA 4PBFA 4H4IA 2Y7EA 4LXFA 3GTHA 3ITXA 4XQ6A 3POCA 1XYLA 5LSMA 1R87A 2IKJA 2RDXA 3NFUA 3WLTA 3A13A 3T7VA 4N6FA 3CUXA 4ZQNA 2PDJA 3GU1A 3G3DA 4X9SA 1KR1A 4I90A 3MQTA 2P5NA 3WFZA 3NSMA 5A3HA 4US5D 1UR4A 3EWBX 4YXGA 5I2UA 5HNNA 4AAJA 1UR0A 4AZIA 3GC5A 3WZ0E 4J9JA 3M1ZA 2V69A 3OVGA 1PZ3A 4LGXA 1ODZA 2QJMA 3T44A 5D9PA 2J8FA 2VGIA 3E12A 2Y0FA 3WJZA 2WOQA 3H6OA 1OB0A 3MKKA 3ICJA 4FAMA 3ZQ9A 3GR4A 5D8ZA 3TAOA 3ZWSA 3BSMA 5JBFA 4EXQA 1M03A 1OG0A 3W0KA 3M6YA 4JTSA 4FXRA 2Z28A 2Q3RA 1P4CA 4XSMA 4YNGA 3EBVA 1WCGA 5FEXA 3MUIA 2YXXA 1DJXA 3H7UA 4I9MA 2WC7A 1S46A 2FPTA 2NX9A 4ZQPA 3W76A 3QV6A 1T8XA 1RVKA 3GRIA 4FLSA 3UR2A 1OF6A 3B8VA 3DXIA 3AYVA 4FNTA 2TRSA 2V5DA 3QRHA 3NJ3A 4J40A 5M3WA 4WDTA 3V5OA 3OA5A 5TAOA 2POZA 5K4ZA 4R7OA 1K6AA 2D69A 1J0ZA 1X7IA 3B8TA 1EP2A 4LOCA 3SCUA 5SWUA 3EPMA 3B05A 1PIGA 2YBTA 1ITQA 5AOUA 3CMJA 1TSIA 1JPIA 4KEZA 3OODA 1DJNA 4BQ4A 1YRRA 3BJSA 4GA8A 4CEXC 1QNPA 2BY3A 2YYTA 5H8PA 3NGFA 1SR0A 3EKLA 3GVQA 4AH7A 2GUYA 4DQWA 4DWDA 1M01A 1WAUA 3OLEA 3VM7A 5A6AA 7CGTA 5F1VA 3MCMA 3LZ3A 1RY8A 1OFEA 2Q01A 3NQFA 2OO6A 4PMYA 4CCDA 4YTRA 4L4PA 1Q6FA 3ID7A 1LROA 4KWUA 3R13A 5I3IA 2PD5A 4NZCA 3P8JA 2ZE0A 3B06A 3LHZA 3CHCA 1A3XA 4J27A 1Z44A 1ZY9A 4WVXA 4PB4A 2CERA 4FXFA 8RUCA 3GH4A 3TTOA 2FHCA 1EGZA 2JKAA 4HPNA 1KRMA 1ZRQA 5I3DA 3SM0A 3LG3A 2PRHA 1NOFA 4I9JA 3AFBA 4KPLA 1AMYA 1V5XA 3CWHA 3TYAA 2G37A 4XX6A 1XLGA 3VD3A 2W9MA 1V0KA 3FX4A 3OVQA 3WLOA 3PZGA 2Y8VA 3JW7A 4C60A 1UPMB 1XISA 1TV4A 2ISDA 1QI3A 3JR2A 2A3LA 4DZAA 4TV5A 1YBQB 3WG6A 4IG2A 2C1HA 2HE5A 4UQBA 4ZE4A 2C0HA 4O54A 1KXQA 2Z25A 1R9ZA 3IUDA 3RX4A 3EPNA 1TV3A 3ZYZA 4Z0JA 3MSYA 2JF7A 5D05A 3W87A 4CD5A 1E5JA 3RJYA 2XWDA 4IWWA 3LERA 2OZ8A 5DO8A 1F6YA 3FK4A 5CG7A 5MHBA 4UZUA 1E4NA 1JGMA 3P0XA 1MI3A 4Q8TA 4DX3A 5KEZA 2X1IA 5MKGA 2P8BA 2NUYA 2NXHA 4AYSA 2ZTKA 1JNEA 3S6DA 1VLIA 3E49A 3UGRA 4MWAD 1VCGA 4ZZ9A 3PUGA 5A6BD 2X05A 1XLJA 1LG2A 4XO7A 5ABFB 3MYOA 1XLIA 3IGSA 3UCQA 4I7UA 3UY8A 5IOBA 3GFYA 1W1VA 2A3AA 3STEA 1HKKA 3EDDA 5LIWX 3WD1A 4UTTC 1E3ZA 5LA1A 3KBSA 1JCXA 3AWNA 1F6KA 2Y63A 3ITCA 1XIHA 4D1JA 4P02B 3IVUA 3GVGA 3TJ4A 4ZMGA 2VRKA 4GQQA 5B7ZA 4ZTXA 3GXPA 2VZUA 2DZSA 4JTFA 3QHMA 4NZFA 2BVYA 1A5MC 4DEFA 1P43A 4W85A 5BRQA 6REQA 1XIIA 2FFCA 2PGFA 1UD4A 1K70A 3G24A 5FJUA 1XIGA 4C1KA 2ZRWA 3EDJA 2GDUA 4US5A 2OT0A 1IZCA 2V30A 2OOFA 2FTYA 2YL9A 1TUFA 3RPMA 3H70A 3MW7A 1JYXA 4LAUA 4FF7A 4PL2A 1QNVA 1KCZA 4GZJA 5D02A 1H3GA 5IDZA 1RPKA 4IMCA 3BAKA 3M7SA 1D2KA 1WYIA 4XUGA 5EB8A 5KITA 2IQDA 2VUYA 1SZEA 2WAGA 5I78A 1RLDA 1S1PA 1R85A 2ESCA 3H23A 5JUVA 4I5XA 3LM3A 4Q8NA 3FVDA 3E2SA 1HTIA 2E4TA 1W5QA 3CYVA 4LAKA 3QPEA 1FKXA 4LY8A 2W4XA 2BVTA 5CLWA 4IIGA 3W1QA 3FOKA 4C91A 4QE5A 4WK9A 5G2IA 4OBSA 1L2UA 1AQHA 1XYZA 3NYDA 2XFRA 4QE4A 1SW7A 4CD4A 1P6CA 2I56A 3BJFA 3VD7A 2O9TA 2PDQA 5EBUA 3NQGA 1WOAA 4HNOA 1PBGA 4S2CA 3SQLA 3SCRA 2X0YA 1M9HA 3OG3A 3TAKA 2VRJA 1KXTA 1ZS2A 1YXYA 1HIZA 5TF0A 5D9NA 3Q4DA 1GYNA 1MXDA 3TONA 3I65A 1R3YA 2QDEA 4G1NA 4S23A 3WLJA 2DVUA 1F7BA 1W5MA 1P0DA 3CUHA 4Z2LA 1MNZA 4PB5A 3REQA 1MUMA 4DYKA 1U1UA 2VOTA 4K8HA 1D7FA 1R2TA 4J3VA 4EXBA 3OTRA 1ISYA 4JIHA 1A0EA 4A3RA 1QVBA 3V1HA 3RM9A 5ABTA 3ORWA 1ZHAA 4PULA 2V5LA 1XBXA 2VEMA 2G3IA 4IJCA 5FCZA 2QUMA 5A8QA 2XGZA 3SCNA 3ZXWA 1H60A 3GQYA 1GVOA 1XFCA 3D3AA 5F4XA 3GAKA 3PZQA 1GKRA 2GDQA 2VYOA 1YNPA 4XISA 2OEJA 2UV8G 2H9AA 2YA0A 1IWAA 1O5XA 2VR4A 4FP1A 1N8WA 1A3HA 5F2LA 3BTNA 3AQUA 3CK5A 1BYCA 1XLCA 1BF6A 1LBLA 4NUWA 4Y8FA 2FVMA 2EPNA 2KX9A 3M47A 1LYXA 2F6KA 4FZIA 1K1DA 3PTMA 2YB4A 3S5ZA 1OIFA 3HPAA 4LWWA 4PRTA 3MANA 3KVKA 4GIYA 2QIIA 4G7FA 3QQ0A 2E6YA 1RH9A 3ZJ7A 5AZ0A 5D30A 3SRDA 4W8BA 3WNKA 4RCXA 3B4YA 3C0QA 1E4MM 3BZGA 4GINA 1CLVA 3W29A 3KBVA 1I2OA 3URAA 5I3JA 3GXNA 1FWBC 3GHUA 3ME3A 1THFD 4EWJA 2Z1SA 1XQLA 3W01A 1BVWA 2FB2A 4I6VA 1N8IA 3FSTA 4LALA 1XLDA 3KCOA 2BHZA 3QV9A 4C6CA 4ES4A 1TJ1A 4D6DA 1GZ1A 6ALDA 2QUNA 3OHMB 4W93A 1MVYA 4ZGYA 1GQNA 3OHIA 2QDGA 3GAYA 3WKZA 1DIDA 4EPBC 2W61A 3CHDA 6TAAA 1IWBA 1SFJA 4O19A 5L6UA 3L0GA 2NLYA 4JAWA 3KRSA 3WLRA 5AYXA 4C6IA 3EB2A 1O5KA 4K36A 1QFEA 1BG9A 5CSRA 5K3VA 1EJUC 4HNTA 1RBOB 3GW0A 4MFDA 2PC4A 2OEKA 1X6NA 1HJWA 1A50A 2PP1A 1Q66A 3R0UA 1GUVA 5EGRA 3WLPA 2CETA 4C6QA 3SY8A 3BW3A 4QE1A 1ITUA 2DT0A 1IXPA 4MB5A 4GK8A 2JIEA 3W7OA 3CH9A 1T41A 2YIHA 1S1RA 4B2DD 3NGJA 3T0BA 1IEXA 2YXOA 3CAQA 2CLFA 4NHVA 1T0OA 2GL5A 1SFTA 1HN1A 4N6EA 3UXDA 1AJ2A 2O9PA 2YA1A 2Y24A 5H6HA 1UIPA 2ZCGA 3H2CA 4JTTA 3Q45A 4CN1A 1YTEA 3CZLA 1A5SA 3UWWA 1W91A 4O8RA 1KGWA 1XBZA 2RDTA 4B4HA 1KBLA 1JYNA 4EK7A 3C0SA 3FJ4A 1SJCA 1T7LA 1VB9A 3QR3A 4C5ZA 2O9OA 2J25A 3B8WA 1FHUA 3JRKA 2POTA 1ML1A 2ATSA 3WDIA 5D9MA 3FDKA 2YDRA 4NNBA 4ROQA 2C79A 2WZHA 3EDFA 3GH5A 2WKGA 2G5WA 3T78A 3GSMA 3KBJA 2QPUA 3KXQA 2DUAA 3O1NA 4Z2KA 3MI2A 1VPYA 4QAWA 1S5NA 3CZJA 5T9CE 2V38A 4E2VA 4JHMA 2YLLA 4WRHA 1QJWA 4A4AA 3CV7A 4XD3A 5D2XA 1F3EA 1Y7VA 1O1HA 2D2GA 2ACSA 3LHUA 4HHMA 1PWLA 1SJBA 2AGKA 3FJNA 4MYAA 4P7NA 1BXNA 3S47A 3TR9A 1G5AA 4QQ3A 2V2HA 4JGDA 2VNCA 1WO2A 2HROA 3TE9A 3M41A 1KM0A 4H7CA 4OV9A 1TG7A 1EJRC 4B3LA 4JZ5A 3E9AA 3UA4A 3W71A 2H6RA 2HDJA 1JZ7A 4H8UA 3UJRA 3SUWA 2XIIA 4XKMA 4K8GA 4Y6GA 4E3TA 3AO0A 4GO8A 1PCWA 2PDUA 1PWMA 3AXIA 3M0YA 2QCHA 5CPLA 3VDAA 3MA8A 3RUBL 3U57A 2CESA 2W91A 3L4TA 1C9DA 3UBPC 1VF8A 4JFVA 4D8ZA 3VNKA 4WSJA 3WQFA 1QOXA 3SY1A 5I3KA 2HCVA 4HK7A 4QX4A 3INPA 2FDSA 1ECEA 3M6DA 4Y96A 2YR1A 4FR6A 2EG6A 4Q32A 3L5MA 3KVLA 3WLNA 4DM2A 1IE7C 4ZXLA 4MWAB 3OGRA 4H8VA 1E70M 3MUXA 2I5IA 3LEPA 1B9ZA 4X60A 4LAMA 3CHVA 3TQPA 1KR0A 4FOUA 1E43A 2R94A 3WBWA 4QFUA 5I24A 1B3YA 3MSDA 1DV7A 1YBQA 3LLDA 1XWYA 1VQTA 1LOLA 2FMOA 3TYCA 5CQ1A 1RXOB 4RW5A 4IICA 3JUGA 5EA9A 2BZNA 4NAEB 4LB4A 3MY9A 4B16A 3HFTA 4MB3A 2J7GA 5CAHA 4JTDA 3VOFA 5A95A 1SJDA 2OWWA 2V82A 3AUJA 1GHSA 3KLLA 4HN8A 3GNNA 2HRWA 4MDOA 2F7FA 4GI8A 3HFYA 1GQIA 2BG5A 4S39A 4GJJA 2WZTA 1JFHA 1OG6A 2L5HA 4PFHA 4CUCA 5FD0A 3QXBA 4Y9MA 1ZBKA 5LIYX 2Y89A 1K6WA 1FFRA 3IGXA 4IPNB 2V5JA 5E9AA 4NZ3A 1OCJA 1H0IA 3G1FA 4R5EA 4S3FA 4Z1AA 3EMCA 4D72A 3UXKA 1U2YA 3GXTA 2XH2A 4DXXA 3PBGA 5C7VA 1E1CA 1N7KA 1AQMA 4FALA 2FPVA 4ZL1A 2QV5A 2ZTJA 2YCIX 4IQDA 4AWEA 4B5TA 1W8GA 3CL6A 4DIAA 1ZGDA 1KGXA 4JNZA 2PS2A 1PTAA 3PTKA 1LQAA 2QDDA 1VFFA 3TC6A 3DI1A 3R8GA 4CQDA 4PSRA 2ZZ3A 4JDYA 2XIOA 2X42A 4AC1X 4WGHA 3EOSA 1NEYA 4BWLA 1RAKA 5C9RA 3W70A 1JI2A 1P6WA 2V5KA 1I1XA 3USBA 1CXLA 3ZR6A 2CW6A 1XLFA 5LNWA 4L61A 3MHUA 3UWVA 2WM0A 1FWWA 3S5OA 1YLVA 4MLRA 5KMYA 3S1VA 5D2YA 1OD8A 3LMYA 4P61A 3WQGA 3TC7A 4ICCX 4X0VA 2VDHA 4HU0A 4NYUA 3CS2A 1K7EA 3S2LA 1TRDA 1OYBA 5BWAA 4ADSA 1XYFA 5DY3A 3MZ2A 2WVVB 1TZ7A 4FR1A 1Z41A 4N9BA 3LX9A 3O05A 4CQCA 2UY3A 1FRBA 2OO0A 2Y5SA 4XTDA 3CV6A 5IBXA 3WJSA 1EJSC 2E67A 1FP9A 2DZPA 3M7WA 1BWLA 5KZ6A 2WWCA 1TCMA 3ISIX 2CBIA 3QSTA 1VFOA 5D37A 1JL8A 2QS8A 3BE7A 3UERA 2I17A 3M9YA 5C54A 2QDHA 2Y62A 2XTKA 3UG8A 3O16A 1RSCA 1CECA 1Q7MA 2F2HA 3P62A 3RILA 1DWHM 1VEMA 2DT2A 1L2QA 1UP0A 4KWOA 1TWZA 4V27A 4KRTA 1YIXA 1EYEA 1DHKA 5LZLA 2R91A 3EOUA 4RXGA 3QC0A 3IJ8A 3TZNA 4M80A 4FI4A 4LNYA 4DRSA 2OZ0A 3LB0A 1V6YA 4FNRA 5FOOA 1HF6A 4D1IA 3H2AA 4WDWA 1XLAA 1GJWA 1XG3A 4OBRA 5C0QA 2DZBA 1EX1A 2BHYA 4POCA 1CEOA 3RGTA 4QIUA 1TR1A 4KFNA 2QV4A 3WBYA 3VCRA 1OGBA 3STPA 2ZUTA 1UQZA 3TYZA 4YN5A 3D6NA 4OZOA 1WA3A 4NY2A 3P0WA 2R1LA 4HPJA 1W32A 3W4RA 2WKLA 3OLDA 4JTKA 4Q8PA 1QNSA 3S0CA 4GH1A 5ABGA 4PBGA 3AMKA 1Z6KA 2XVKA 1MW0A 4F0SA 3PF3A 1UKOA 1E0XA 3RYSA 3LHYA 3IJ9A 2PODA 2WMJA 1EJWC 1UA3A 3VI2A 3V7PA 3AIVA 1L6WA 1PX8A 3W7NA 1GKQA 1EHAA 3MBDA 1TCDA 1W2PA 4O52A 4EAYA 4HZ6A 3HPZA 3GC4A 5C71A 3T81A 3WCZA 5AKQA 2GOUA 3C4UA 2WO5A 1DP0A 3P7YA 3O7UA 1ISXA 1ZZMA 3TYBA 4LANA 3SAZA 2PLCA 3G1VA 3PULA 4EKJA 1XIDA 2J9XA 3MCNA 4PMZA 4FX6M 1UWAA 2CLKA 3AYSA 3U6WA 5FACA 1E9ZB 4KMQA 3P5ZA 2Y7FA 4UQEA 4LRTA 3T07A 4CU7A 1W8SA 3QBUA 1WOBA 1HVXA 3P6LA 2ASHA 2BV9A 1E51A 2HTMA 4RDWA 5FJJA 4WJEA 4W5ZA 4RE3A 3N25A 3STFA 2DZWA 1Q65A 5JBEA 5CPOA 3C0JA 4JBRA 2ZC8A 3G1XA 5DLCA 5F2GA 5AC7A 4IUOA 1SZNA 4LAOA 3IGUA 2OSWA 4UTFA 2QHAA 3MWAA 3E2VA 3SUUA 2GGGA 1VLWA 4ENLA 4HMEA 4CNNA 5PTDA 3WX7A 3KRUA 5AB3A 2BSLA 3NM1A 3I6EA 3WLQA 2HS8A 3F5KA 1G67A 4C7DA 3JVAA 4E3VA 3V16A 3WSUA 4J3UA 2RHGA 3CT7A 4JD4A 3L68A 3HV9A 2CLLA 2Z1VA 4LC6A 4H1ZA 1OK4A 3PY2A 5EL1A 1I4NA 1N55A 3K1DA 3CU2A 4NZJA 2HNEA 3O6DA 2OFJA 3S3GA 1EGMA 1KW1A 2XM1A 5EMLA 3KOXA 4EF8A 2QKFA 4GISA 1POKA 3FGCA 2BWGA 3URQA 1P1MA 1IGSA 1A80A 1WX0A 4IPJA 4MF4A 3IGHX 3GDBA 1P0EA 2HBVA 1TELA 3WEOA 2DZTA 4GZ7A 1HO4A 1S38A 1O5RA 2E6DA 3FXYA 4CN6A 3FFSA 1PJ9A 3AJ7A 2PWVA 5MF5A 1X8CA 3O9NA 4FNSA 2PDBA 4GBDA 1I75A 1RBLA 4MNLA 4PTWA 1IEQA 2C0AA 2QGYA 3MMUA 3QTGA 3WLMA 4U33A 1SFSA 2O0TA 4UTKA 1UWRA 2JE8A 1QPQA 4XVEA 4IMDA 5CH9A 3C5QA 3T08A 3CAKA 1AJZA 3MS8A 5HNUA 3HMCA 3N6JA 4L4MA 3H4WA 3E38A 3OZYA 1VBRA 3UA3A 3WUFA 1YPIA 3EB3A 3VC6A 3VM5A 3TN6A 4U28A 3OYZA 3GNXA 2J79A 3WDJA 2EPLX 1TTIA 1QR7A 2CZVA 2JEQA 4GUIA 4HCDA 1EP3A 1GHRA 1WDWA 1M65A 1XDLA 3H2OA 2R8WA 1SSDA 1OX4A 2DZVA 4IMAA 1UKPA 1U5JA 1KBBA 2BOEX 1EC9A 3HQ1A 4DNMA 1J0YA 1F6PA 1ZBCA 1CXFA 3N34A 1KA9F 4WY0A 2A2IA 2QW5A 4MVAA 7REQB 1B4KA 1B0IA 3S83A 3E02A 1JCLA 3WH8A 4JTRA 1DE5A 1SO4A 3UR5A 4TVCA 3G22A 3W2JA 2J24A 2NSXA 4K1GA 1YADA 1BGAA 2EHHA 2PF8A 4R9XA 4V15A 3GTNA 6PTDA 1FCUA 1EUAA 2PB1A 1ZB5A 3KOFA 2E09A 3VXGA 3N3MA 3AAMA 5A6MA 5GVJA 4HZ7A 4YVVA 2PI6A 3JU2A 3OG2A 3SIZA 1E73M 4IIFA 4UXDA 1SPQA 3FEMA 4MNMA 1UIOA 3QY7A 1TIWA 1WDQA 3KBNA 4OT7A 5HUOA 2Z26A 1YXCA 4D6EA 2E25A 3FEQA 3WYZA 1IIHA 3SCWA 5G1TA 3VD9A 4M3PA 1KM1A 3T05A 2J13A 1FVPA 1MW3A 4OOUA 3F4DA 3TTYA 2QPSA 3NL3A 5HNRA 4N2YA 5E0FA 1VFUA 5I0DA 3KTSA 3MHFA 2UY2A 2D22A 2Z1BA 4M56A 2VC5A 4ZO6A 1R30A 2FJUB 2ZRXA 1IIGA 2CNCA 4DF1A 6ENLA 3LPGA 2Y5JA 3RRXA 4RE0A 3BW4A 1B3OA 3T0AA 4LQ1A 1GJUA 1DEDA 1UASA 2KAUC 1RCQA 1GORA 4GQ0A 4YHEA 2J7FA 1VBGA 3T0DA 3R12A 3MV11 3L2IA 3PPCA 2YZ5A 1L0PA 4WLCA 2QPXA 4WOZA 1LF1A 3NQAA 2J8GA 4L6OA 2NVDA 1WBHA 2HK0A 2J7CA 3RAOA 2BGSA 1O4UA 1TWDA 4DPQA 3KDOA 1XIJA 3S42A 3TV8A 3KHDA 3BMXA 4JDBA 2PTDA 3PPFA 4H9ZA 5CJNA 3TK7A 2FZ9A 1M68A 1UWUA 3SGZA 3C2FA 5HMDA 4MAZA 1GVQA 1XPGA 5CPTA 3IRDA 2PFHA 3KBMA 4JY8A 5FAGA 4M8UA 5GQBA 1L8PA 4XKYA 1A5BA 3UQNA 2CKSA 3MSRA 3UXIA 4MHBA 4JFUA 4NASA 2IXUA 4RDYA 4IFKA 2B7QA 3V0UA 1ALDA 1V6UA 4FIRA 2VMFA 3ZJ6A 4GYJA 4U5KA 1E0TA 2WWDA 5DFAA 4LCQA 4UFMA 3B40A 3VNMA 1EZ2A 2OLSA 8CGTA 1XDJA 5CZ0A 3KRBA 1FOBA 2PDHA 4UQDA 1OGSA 2XN2A 3HMJG 4GYPA 4W88A 3AISA 3OGSA 4K1WA 1KFKA 1US0A 1N82A 1QHPA 2TAAA 4KWWA 3A21A 2WJFA 3G0XA 5AY7A 4FXJA 1XJBA 3I3DA 4OKDA 1JXJA 3EDEA 1Y5WA 4IJBA 4LRSA 1A4MA 5CPMA 3GBDA 1E1CB 2J7DA 3R10A 5K9DA 2GVYA 1NOWA 4GI6A 5CZJA 3CIWA 1KWKA 3SB0A 3WH9A 5HWMA 4UB9A 2HSAA 1R9XA 1O7AA 2V0TA 1TMLA 2XSBA 1K8YA 4HPXA 2P10A 1LQ2A 3B9DA 3GTFA 3M0JA 5A1AA 4RE2A 3C61A 1TPVA 1XIEA 3C2YA 2OKOA 4TMBA 3PFRA 4PTMA 4GVHA 4ZBCA 4IZGA 4BEUA 1W3IA 3LCXA 4E4FA 1W1TA 3DFTA 3CUIA 1W3NA 1FWDC 3F5JA 3KS6A 1IXNA 2C91A 3VOCA 2C1IA 1TZZA 3M0HA 4C6DA 5BRPA 3S8HA 3T2PA 4DBSA 5E6YA 3VD5A 1V79A 3N3TA 1H1ZA 3N14A 3ARZA 3UU0A 5LNVA 3VO0A 4D6HA 2XFWA 3CAWA 3SEPA 1ZBVA 1CB2A 3RITA 3BOLA 3PZVA 4PCFA 2ZZ4A 2ZA1A 1W9BM 5D33A 3BLOA 2AAMA 4O17A 4E8GA 8A3HA 1G4PA 1PX4A 4HCLA 2VR5A 3K8KA 1GW9A 3O6AA 1EJXC 5FL0A 2GFTA 3ALFA 1UZ1A 3PG8A 2QEZA 3E0LA 3W2NA 3PB0A 5G4WA 1FDZA 1KFCA 1NWRA 4W86A 1K9TA 4O1BA 1XGZA 3CPRA 1TX0A 1T99A 2XIQA 2PWEA 2ZXQA 1Q6CA 4W9TA 1F61A 1UD6A 5IFPA 4JTHA 3AMLA 2WM1A 3UJSA 4MY8A 1AH3A 2BXZA 5T91A 1I45A 4Q33A 1UD3A 3OOQA 2YCJA 3WLSA 3ELFA 1LOSA 2GGEA 4L64A 1MNSA 3LHTA 3WDHA 1UJQA 4AWUA 2GJRA 4DLFA 4DBUA 1XCWA 1VJIA 1PV8A 5I6SA 3NSNA 1KGUA 1IEIA 3HPFA 2EEXA 4RK8A 2VL4A 3MT1A 1MWOA 4PTXA 1MUWA 3M5VA 2ZX9A 4Q8MA 4S2BA 1W5PA 2OLHA 4PFMA 2Y6ZA 3H54A 2QAPA 2AL2B 4MUPA 1IV8A 4NP7A 2PBGA 3AMGA 1UR3M 3AUOA 1SYTA 1MUCA 4RNJA 3QMRA 4B4FA 1SMDA 1MXGA 3GM8A 2W67A 4WF7A 2D3LA 4RZBA 3I7SA 3OP2A 1WZMA 2DZUA 5F4SA 4AEEA 2PTYA 3ITOA 4H6QA 1SQ7A 7XIMA 3TW9A 1P7TB 4D6CA 3FVMA 3NDZA 2QJNA 4GY1A 4M6PA 2DP3A 2A3CA 3CUGA 3IIVA 5DCBA 2QF7A 3LSBA 4ZVJA 5BMXA 2J8TA 1H7NA 3NQVA 2HXUA 2V5BA 2A1YA 1M04A 3TQ0A 1BLIA 3C2OA 1VJZA 2VVNA 4PODA 3R25A 3HGOA 1OC7A 2ZC1A 3APGA 2A6LA 3TXVA 2VCAA 1VBJA 4IGMA 1IF2A 3ZOAA 1H61A 1SSGA 2E6AA 2E6FA 7A3HA 1EB3A 3QY8A 2WQDA 3A4JA 1QWGA 1EWEA 1H4PA 2EPOA 3E1F1 3N17A 1PVNA 4H6KA 3LI0A 2ZOXA 4BHYA 4FHAA 3ZR4A 4C6BA 3DYMA 3ZZ1A 1ZFJA 4AG0A 1D8CA 1OCNA 9CGTA 5HXMA 1EH9A 1PE1A 1QOPA 1MQPA 1UW9A 1NVMA 1VP5A 5HWJA 1BRLA 2PTWA 3QLDA 2VRQA 3WQCA 3T42A 4WY0F 4Q7NA 1ONEA 2ZWZA 4H6RA 4AD4A 3PJWA 5ECUA 4A22A 1OK6A 4JTCA 5JXQA 3SUTA 3EZ4A 4L1WA 3CZGA 4X61A 4HNLA 5IM51 1R2RA 2OXNA 3ARYA 2NUXA 1GW1A 4GG9A 1HG3A 2GPTA 1CENA 4FSAA 2J62A 3HGJA 5C9XA 4NT0A 3EWWA 3HM7A 2E8ZA 3MVIA 2PDPA 1OIMA 2GOKA 3CQKA 3W82A 1EHNA 3DFQA 3QR0A 5FSEC 1H5YA 3VFLA 4M81A 4BQ2A 2GYIA 3UNTA 2HVNA 1JIBA 4NJHA 4ZA0A 4AZGA 4YTUA 4LCRA 1KM2A 3DI0A 2I57A 4PTNA 4GUFA 4HB7A 2J7BA 5CCZA 3HPSA 4P2VA 5REQA 4RDZA 4NIRA 3UZWA 1G9HA 2YBVA 4UR7A 1XLBA 3S5SA 4MB1A 3N2CA 4DO7A 5AYIA 5M17A 2BOGX 1V3IA 3LCIA 1XHGA 3B0VC 5G4HC 1OVDA 3P80A 2P1FA 1S2UA 3IJ6A 4PGLA 1V7YA 1AD4A 3UYIA 4Q7IA 2E0PA 4IFKB 1KTBA 3W1PA 1FHVA 1V4YA 1FXPA 3FIGA 3L66A 5GNXA 4KEUA 1UH3A 4M6QA 4ZO9A 4JEQA 4M1RA 4FO4A 1POJA 4Q8WA 3AU2A 4S38A 1FXQA 3K8LA 1W9VA 3VOGA 1V0MA 4IM4A 1PAMA 4JQ4A 3M0MA 1GPFA 3Q94A 1DYSA 1TFVA 3THAA 3TZFA 1SO5A 3OBEA 4HKPA 2X40A 3R43A 1TA3A 1XR2A 2V68A 4RKAA 3LCGA 4NI3A 1C92A 4B5WA 3W2LA 2Y85A 4URIA 3EAUA 4PMNA 4ZEPA 3CLMA 1KM5A 4XO6A 5AVHA 2CKRA 5D04C 4GIRA 4TQTA 2V8ZA 3VDCA 3K1GA 3MUY1 5GJPA 3DHFA 1RJQA 3G1DA 4S3JA 3RO6A 1XLEA 3SR7A 1LRQA 5E6ZA 3PS7A 4UQ9A 1GYLA 1C3FA 3SUVA 2ZX7A 4N9EA 2GK1A 3GC2A 3BOXA 4BK9A 2VENA 2ZUNA 3HG4A 3A3WA 3UG5A 4YWSA 1E6SM 3K13A 5BZAA 1H0GA 4HQVA 2ADAA 4MZ1A 1TO3A 5HJLA 1G7UA 1QHOA 2Q09A 4IMFA 1JDEA 1JZ4A 1VEOA 1IGWA 4W7VA 1PS9A 1FH7A 4AY8A 3IRSA 2QCLA 4V1YA 4ZO7A 2BY0A 4CN4A 1T40A 4Q8OA 2ZYFA 1GCYA 1C93A 3TQVA 4GE8A 3I3EA 2FJKA 2X8RA 4YLWA 4GHRA 3DG7A 4ECLA 4ZO8A 4PUMA 4OFCA 1R7AA 3PN8A 3RPDA 1WDPA 2B0MA 4LYRA 3WQOA 4V1XA 4LV9A 4WDXA 1GVSA 1PZ2A 2ZUUA 1LLZA 4GXPA 1I2RA 3OIHA 3TJLA 2CXGA 3NQEA 3K4WA 1G7VA 1JRBA 4XTIA 2C1GA 4RX0A 2PDIA 2RUSA 2WSYA 3GDKA 1EKOA 1K9EA 1TPUA 3DN5A 4GO9A 1AK5A 1LJYA 4AZBA 1KCLA 2EF9A 2FTPA 1QRQA 1XYCA 2OGJA 1MEWA 4HIBA 3H2EA 4IX0A 2B7OA 4HMNA 1UKSA 3FSUA 4B2DA 1XS2A 5F2MA 4DI9A 1CGXA 1UMYA 1ENUA 3W1LA 5CPNA 5BW6A 1VHNA 3NZ1A 1ISZA 1CGUA 3MMWA 2D23A 1K02A 4NL1A 5EMKA 3W2KA 4O4VA 3VUPA 2D0GA 1E6XM 3T55A 4IPIA 1EBGA 2ACQA 3B0XA 2F6XA 3IV3A 4ZR8A 2XPKA 4I8DA 1SO6A 4QCFA 4UZSA 1CXIA 1X97A 4OU1A 4FK9A 1DTNA 2YXGA 4BS0A 4RZ6A 1M7PA 3EXRA 4BF5A 2RKXA 2ZZ2A 4FB7A 2DSUA 2A4AA 2HNHA 2XH7A 3H2MA 5EKYA 4ML9A 1YMYA 1UMLA 2Q6ZA 3KP1A 3T40A 3VNLA 3KZSA 2CITA 1K77A 1ZP4A 4Z1YA 1F74A 2X7WA 4EANA 5E0CA 2EO7A 1TR9A 4GI9A 1PKNA 3W1UA 3S9YA 3PHAA 4U10A 4IOTA 3CV1A 2V63A 5ABEA 4Q8UA 3EA1A 1BYAA 1GJPA 3S9IA 1E3XA 1M1BA 2WHJA 1VYRA 2J6VA 1GGOA 1JPHA 4CNSA 1PUDA 3LXBA 4U2YA 3W7IA 5GPRA 2VFIA 4H7VA 3PC0A 5D4YA 3C86A 1LTDA 3P74A 1CB7B 1UC5A 5K9XA 1KBJA 4NXSA 3VGEA 1JZ5A 3QFWA 2Z6JA 1GOOA 1LRTA 1E9YB 2WNWA 1L6YA 9XIAA 1H62A 3HOJA 3W7QA 2D3NA 3UPMA 3BDKA 1W9UA 5DXYA 1I6NA 3UEQA 4PMDA 3GS6A 3VDGA 1BKSA 3T2QA 4IIHA 4AMCA 3D3FA 1E9IA 1YXDA 4PCSA 1AL8A 3W7CA 1YKWA 1ITCA 3N4AA 2DQWA 4AC7C 4REQB 4GCXA 3LMZA 1QNQA 1F9CA 1EO7A 1Q13A 2A5HA 3LV5A 4O1EA 4LVGA 3FS2A 1QO2A 2PPGA 2QVNA 2DZXA 1TTPA 4G5DA 4RNFA 4IJRA 4MWAC 4B90A 5FESA 3GR8A 3BAXA 4UTMA 4KKXA 1BXCA 4JTAA 1PHQA 4F3HA 1XPYA 2QYGA 1WBJA 1VZWA 1DWJM 4G9PA 1L6FA 1E1EA 1Q7ZA 1O66A 4U3AA 3QY6A 3KHJA 5JIPA 2PDXA 5H8UA 2P3ZA 2EG8A 5I77A 3GH7A 4HNVA 3MMDA 5EY5A 5CGTA 3SECA 1JDAA 5HOSA 5KSWA 5IRPA 4GMEA 1BF2A 4ZSUA 3V0TA 9XIMA 1F3TA 4XAYA 1BG4A 5CKSA 3TFXA 3NQBA 1QBAA 4KCVA 4GYFA 4JTJA 3ABZA 1TTJA 4ZQOA 4GQGA 1F2JA 2XZ7A 4CU6A 5I3HA 1SM9A 1QOQA 2V3EA 5BXPA 4KRZA 2QXWA 4A8RA 4KF1A 3BURA 3WK0A 4B92A 3DBNA 4JYDA 1KFBA 2I7GA 2NQHA 4XAPA 1IZKA 3VYLA 1TQJA 2QCEA 1OADA 4CGTA 3NZPA 2VEFA 1F4HA 2I9UA 3C2RA 3O15A 2BB0A 3SRHA 3R8RA 3TYEA 4WKHA 4GGHA 1TPC1 2GSJA 5DY2A 5DXXA 4HU8A 4AD1A 2V67A 2GGHA 1UD5A 4E2DA 3WUGA 2PGRA 4V33A 4TX8A 2NVCA 4J3ZA 2E7FA 1RA0A 2Z0IA 1F3XA 4AZHA 3W27A 1GOKA 1W3TA 1R3SA 4DJEA 2PP0A 3ABRA 3P5YA 3QKEA 4JKMA 4MG4A 5C9ZA 1SR9A 5AHEA 3QM3A 2WVVA 1FWEC 3GXMA 2C7FA 4TOQA 3N2XA 4H9YA 1UD8A 1E9LA 5CZTA 3V3WA 1BTMA 1Q6LA 2QVHA 4HBKA 2X30A 3XIMA 3W7LA 5TNVA 5A69A 5DRIA 2PBOA 3GK0A 4TIMA 3TU9A 1XIFA 4M24A 5AYBA 4EIVA 1XCXA 3EDKA 3G6LA 1H5VA 4INFA 4O13A 4QDMA 1S3HA 1M6JA 3FKRA 3ZJKA 3LRLA 3WUEA 3I3BA 1XRFA 4A3QA 1FWNA 4FLOA 1HGYA 2UZ9A 4P8VA 1OM0A 1VFLA 4AIUA 4RNHA 3M0IA 3QOMA 2DEPA 3PWGA 3A24A 5BU6A 3P84A 2OZTA 2NV1A 3CPGA 5C2XA 4Q4OA 1AL7A 4MLJA 2NLIA 2HQAA 4W5UA 5ABHA 1AFSA 1TYGA 3AYTA 1BEUA 3AIRA 1KXHA 3QZAA 1MFUA 2MUCA 1N2VA 5EMJA 3PZUA 2VZVA 3TC3A 1ELSA 2Y5EA 3C56A 1J93A 2NSOA 3WLLA 4O10A 4A3UA 2AAAA 2G3JA 1X1OA 3WJXA 3SN4A 2W3ZA 2NWSA 3AJXA 3ZSTA 3PNZA 3IARA 4I6KA 1A5LC 1DKWA 1W1ZA 3ES8A 3CQJA 5IFTA 4H00A 3O6CA 2EG7A 2PTXA 2MANA 4JFTA 1LORA 2OX4A 4X9YA 4FOKA 4GRSA 1SUXA 3HU7A 1BHGA 4QLJA 1YX1A 3NPVA 1Q2RA 3E96A 4NZ5A 3A4WA 4FS9A 2EPMX 4M82A 5HA7A 1NARA 2FHBA 2YSWA 3B4UA 4H9TA 3NPUA 3VE7A 1XLMA 1QXLA 3CC1A 5HBFA 1XQKA 5FEZA 3FHAA 1S5VA 4D9PA 4O4WA 3S2JA 4G6CA 4G7EA 2Z24A 5U4NA 1TTQA 4P7LA 4F66A 3LD5A 4ZXOA 2HVMA 3CO8A 1AW2A 1UHVA 3PSVA 3KDNA 3FYPA 4V28A 3CL7A 2QCGA 3ITLA 4O1AA 3C2EA 4QEHA 1G4TA 2WJDA 1OX6A 4TR9A 2WCSA 3Q2DA 2R6OA 3GR7A 3K30A 1ZNNA 2FGBA 4BF7A 3WUBA 3BQ5A 3CXOA 3K4AA 1C29A 3UWZA 4C1NA 3U2ZA 3L4YA 1CCWB 4JQ3A 4N42A 1D3GA 2C14A 4IPLA 1R3RA 3VKCA 2PDKA 3BAWA 4ACYA 4B15A 2TSYA 4L7ZA 3NZQA 3USZA 4F9JA 3WF4A 5F2IA 1JD9A 2PA6A 1MQQA 3EKGA 1AH0A 2DY3A 4UNKA 1EC8A 3DKJA 4S3GA 3FXGA 3FNDA 3RLGA 4PEEA 1JI1A 1NDVA 2QCDA 4IIEA 4AEOA 4IG2B 3GDRA 1FWCC 1EIXA 1DBTA 5DN1A 4KIEA 3ZR5A 3UG4A 1F07A 2PGEA 3PWAA 4ZOEA 3O2LA 2YJQA 3NQ8A 4GX9A 3GNRA 4X22A 4V2XA 1MQRA 2IPWA 4ZSTA 1CGWA 2BOFX 2XFYA 1HKMA 4MYXA 2Y61A 2X41A 5A2AA 4GQBA 3GXDA 2CHNA 2G97A 3QF0A 5FSDC 3ABSA 3AS0A 2RDUA 4TUFA 3T4WA 1Z69A 3HURA 1QI2A 4MNKA 5CAKA 3RLUA 4C6FA 2YL5A 2F61A 1EJ7L 3H2FA 5AC5A 2FDMA 4AEFA 4IMGA 3DYOA 3MB9A 5REQB 3WBAA 2E3ZA 1OT2A 1VEPA 1ICSA 3CASA 2YCLA 5BNKA 5XIMA 3AWOA 1TWSA 3FHQA 3GG8A 2WZMA 3SGGA 4PUWA 1EWDA 1K8ZA 5HINA 5I3GA 4PUDA 4Z42C 1LL4A 1ICPA 4HYRA 4ICNA 3W85A 5HR7A 4L1GA 1DJYA 1F3WA 4F0RA 3WN6A 4Y90A 3MO7A 3FLUA 1F8IA 3N9RA 3MWCA 2IQ0A 4JX5A 3TR2A 3DG3A 2I9EA 2DPEA 4W7UA 5CPQA 1ADSA 4W84A 4G7EB 3C8NA 1EQCA 3JS3A 3OPSA 3WNLA 3V36A 4IGHA 2D0FA 5LHEA 1E6PA 1FDJA 4AW7A 4AHPA 2PF0A 4UTTA 2V5CA 1OFAA 1AW5A 1AJ0A 3UZ5A 3THUA 5C70A 5J8LA 1H7RA 3PJTA 3M44A 5LGZA 3W2UA 4AWTA 2A3EA 1FH8A 4HOZA 3WL1A 4QR6A 3POHA 1JULA 3LLXA 2PWUA 4QJ4B 3AMCA 2Z6IA 2RGLA 1E5NA 4QJ5B 3VVGA 1GNXA 5L9FA 1BXBA 4P7OA 4HA0A 3FAXA 3WDQA 4OVXA 3UJEA 3DU0A 5FEPA 3W7RA 1DIKA 1HP4A 3IPWA 2D24A 3B04A 4QS6A 1TREA 2ZQ0A 4HA4A 3BPWA 4Y2WA 1D3CA 4QEEA 4UFHA 1VGAA 3O6YX 3WMLA 2G4JA 1ZSXA 2D1ZA 4K37A 3O06A 1ZBWA 2PDGA 1A5CA 2G50A 2ISSA 1WKYA 2OG9A 2Y7GA 1B4EA 4TXEA 4PYSA 2ZXAA 4S3EA 3QYQA 3ZVHA 3TLLA 2YB1A 1XD1A 2RDWA 3VIGA 2ISWA 2Y7DA 3W7EA 5XINA 5KINA 5CC7A 3VILA 4CKQA 1UR8A 3AIBA 4BY3A 1J9YA 2G0WA 3AZTA 4AISA 1NDWA 1OFPA 3PBVA 1PIIA 5LNSA 3CZEA 4Q4KA 3N29A 3PTQA 4Z1CA 4ADTA 1VIWA 1VHCA 1WZKA 5LA2A 1VJSA 2J9YA 2JBMA 1OEPA 4LYQA 4K38A 3GG0A 4JN8A 3R2GA 3RR4A 3L65A 4NZ1A 3ENLA 1LCOA 4L6HA 2B31A 3RCNA 5JMUA 3U48A 1VBHA 3RRAA 2RJHA 3RMEA 3PP7A 1O68A 4GVIA 4XAZA 3M5YA 3ANVA 4UUIA 4MJZA 2E9MA 4MNJA 2BDQA 3RF9A 1UP3A 2P88A 5U7SA 1QPKA 4C6NA 1RZMA 4C7GA 1KV5A 5BRBA 1RQBA 3GO2A 4H41A 2IKGA 3U7BA 3TJIA 1PB0A 4GFIA 1SMAA 3IIXA 3VDBA 2ZXDA 3T9PA 2NT1A 2PDMA 4WQ6A 3EX1A 3MVTA 1QW8A 3TX9A 3TCSA 3W72A 3G2GA 2E9LA 1FWRA 2QCFA 1LUCA 5K4XA 4QG8A 3LDVA 3OBAA 1W0MA 5FL1A 4KFOA 1PZ0A 1V6TA 2Y88A 6XIMA 1R3TA 1GZGA 4HA3A 4GLEA 4PTDA 1PL9A 1ZTVA 1Q6OA 4PBEA 3S9ZA 2HPMA 3VGFA 2G95A 1H2JA 2H8XA 5AC6A 2CZ5A 4MJ4A 3TA6A 3AOFA 4UC5A 2W5FA 2AKMA 1OFRA 4A8LA 4M6UA 4UCGA 3A22A 4L80A 1CPUA 1R86A 3Q58A 3ALGA 1IWPA 3DAQA 4LFYA 2WMFA 1J4EA 3DFHA 2O55A 4HCHA 4PTVA 3RM8A 4HD5A 1W1IE 1TPFA 3PPHA 4ZTYA 3NR0A 4AVFA 3V5CA 4HPHA 5C9WA 1UP2A 3OBKA 2WW5A 4GNVA 3NO3A 3BMWA 1Q4NX 4N9CA 3GU2A 1Y5XA 3SFWA 4JHOA 2VWSA 4IPPA 4NNCA 3CIVA 4ZFCA 1CDGA 4DVOA 2WMIA 2J27A 3LV6A 1IEVA 5DMNA 4WUIA 4LH8A 1VPXA 3LENA 1NDYA 4XZWA 1UPPA 2W79A 1QTWA 5IBXC 4UOZA 2NZLA 5DT5A 4DZ5A 1O60A 1TJPA 5G1YA 3MV01 3N13A 3VPLA 3A12A 4NX5A 3DGRA 2GUBA 4M0XA 2A0NA 4TX9A 2HJPA 3O8AA 1LLOA 5D38A 5AHLA 3TN4A 4DJDC 3QMTA 4LUSA 3KTCA 3R0DA 3EX2A 3S1GA 2NXGA 4DJFC 3KAOA 2WMIB 2X1RA 4DUOA 3W07A 4RZ5A 3G1RA 1OGGA 1RK5A 3GIQA 4XIAA 2AQVA 2P0OA 1CBGA 4E8CA 1MSSA 2A7PA 4DJFA 2FPYA 3QR1A 2DORA 2XSAA 4QLKA 3N9KA 1XG4A 3NL5A 2GGJA 2PEVA 1W2VA 2DH2A 4GZIA 4FNPA 4PUUA 4UCFA 1K03A 4AIBA 4LVFA 1XSIA 3G1AA 2DJLA 1G69A 4JYEA 4PL1A 3P81A 3KCJA 1CXKA 5C2GA 2OVLA 1FA2A 3FJLA 3BAIA 1HP5A 3DZ1A 2YA2A 4ZQMA 3IAQA 1LM1A 3ZT7A 4EPKA 1Q5MA 4NVTA 1RD6A 5D2VA 1T96A 3W81A 2XVPA 2YDQA 3GUWA 2VZSA 3M0KA 3APYA 1F05A 1VFMA 4O0QA 2WLZA 3DEQA 3MKVA 4ACZB 4CEUC 3WFLA 1J6PA 4C6LA 1IYXA 4JN7A 3A3HA 3N2OA 3WQWA 3RLVA 2FGZA 4RLIA 3PZOA 1UROA 1JD7A 2QUUA 4UWMA 4Q6XA 2PGWA 4DI8A 3DECA 4M29A 2XWEA 2WNNA 3F4NA 1W54A 2WPGA 2X1SA 2DW6A 3IACA 1JR1A 2D2HA 3SN1A 5HPOA 2PDNA 4MWAE 1XP3A 1NIUA 1VENA 2XIJA 5HMFA 3OLGA 3A5FA 2UBPC 3CTLA 2C15A 2QIWA 3OU8A 2GSEA 1UUMA 1V0LA 4H8HA 4NAEA 3WMCA 3L4ZA 5E1QA 4Z17A 1SJAA 3EA3A 4UR9A 4JQAA 1JG9A 3APTA 4BKNA 2VZOA 4Q4QA 1WKFA 3CMFA 3NAVA 4EAMA 3ZS4A 3LGEA 4IX2A 3TQKA 1M7XA 2DFAA 3YPIA 1ZCOA 4C90A 5HATA 3OQEA 1EX5A 4L1XA 3E0FA 1VFHA 1I8JA 3BLLA 3F1QA 1VCVA 4Y9PA 4Z1DA 3QVQA 3F4CA 4ZE5A 3FY1A 3N12A 2B7PA 4DBDA 1HQTA 1M41A 4N4PA 3LQLA 1TE1A 1A0CA 4UQAA 4W8AA 2CLMA 3TLQA 3LPOA 4NJJA 2PU0A 1G6CA 1Q6EA 3T8LA 3URBA 1YDOA 1NM9A 5D9OA 3UZJA 4CQ9A 1KQYA 4NSBA 1JDDA 2YW4A 4QISA 3O07A 4LX4A 3G1HA 2VX5A 4XIMA 4F40A 5H8MA 4C5YA 1YDNA 2EKGA 2F38A 3DFYA 2DSZA 2EQDA 2AGTA 1Q6DA 3ABOA 4HU3A 3SCQA 1EP1A 2OLAA 3L4UA 3MYPA 2IPGA 3SDOA 4R7JA 1WP6A 3BV4A 1E0VA 5G2WA 3NOEA 2J6XA 1Z48A 3WF3A 1CGVA 2IPJA 5DBTA 4U2ZA 1U83A 5LIUX 3U2OA 4O11A 3EB4A 1HO1A 1SFLA 2D73A 2CLEA 3KOWA 3PK7A 3GDLA 3GLCA 1EEXA 4HYWA 3IEBA 4J4KA 4O0KA 4Q4PA 3B8DA 1OSEA 3MBFA 3A47A 1EYWA 3VIIA 5F7UA 1UBPC 4UTHA 3PG9A 5CXPA 3GW3A 3CTTA 2FVKA 1HUVA 1KB3A 2HVOA 2ZA2A 2PWDA 4GC4A 2YLAA 1G94A 2XH4A 1UR9A 5HQMA 1BWVA 1Q6RA 4LF1A 3TW6A 5AVNA 3T4CA 2ABBA 2KZHA 1R0MA 3ZO9A 3WQEA 3IIZA 4XG1A 4YL2A 5JIWA 5GNYA 1W5NA 1DIEA 3HIJA 2CBUA 3SGUA 3K46A 5EYWA