2GK1A

X-ray crystal structure of ngt-bound hexa
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 8
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1A02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1A01
2QPUA 4CGTA 1B3XA 1TFVA 3CZGA 5A6JA 3AXHA 1LWJA 3QHNA 2PB1A 3WQWA 3N04A 1JAEA 1W1TA 2J4GA 2W4XA 4CN1A 4NRRA 3ARRA 2CYGA 1GZJA 5D8ZA 1Q6DA 1VFFA 3U7BA 3QGVA 1HKJA 5I3DA 3O6AA 1UR2A 4AZ5A 2DT3A 1WAWA 1W9VA 2WSPA 3B9AA 2J7HA 3VGEA 1B3ZA 3BAWA 3PZTA 3RDKA 2E4TA 3MMDA 3MS8A 1ODUA 4GPNA 1WP6A 1HXJA 5CGTA 1B31A 1E4LA 3VIIA 3WD2A 2O9OA 2ZUMA 5BRPA 1WNOA 1FHLA 3WNPA 1PX3A 4H8HA 3VPLA 3AS3A 1H09A 2EPKX 3VD9A 2WVVA 4P8UA 1VEOA 1WO2A 3EYPA 1XH1A 1JZ3A 2ZICA 1LG2A 2DIJA 3AJ7A 5LA0A 4HTYA 4AIUA 8A3HA 4QP0A 3HN3A 5HNNA 3VIJA 1KCLA 2DSZA 2GJRA 2NW0A 2A3HA 2GUYA 1TZ7A 3ARSA 2OYMA 5IHSA 4W85A 1JYWA 4E2OA 2UY2A 3SUSA 1E71M 4AD0A 1CEOA 1MW2A 3BC9A 2HISA 3IJ9A 2IXVA 1VFUA 4MAVA 3VKKA 2ZUSA 4OOUA 4DWSD 1R86A 2DH3A 3KZSA 4JAWA 1V02A 2WZHA 1RH9A 1UHVA 3THCA 3POHA 1TG7A 4B3LA 3L4YA 3CZLA 1JDAA 3I3DA 2CERA 4HU0A 4HOZA 4E8CA 1JD9A 1WZKA 1ZS2A 2ZUNA 1CGVA 2WYSA 2WLYA 3EBVA 1JZ6A 2Y2WA 4GO8A 1OD0A 4J3TA 4H8UA 1CNVA 1QW8A 1UUQA 5A69A 3NUKA 1WPCA 1US2A 1MVYA 1EHAA 1KR0A 1QW9A 4EKJA 3CUGA 4C7GA 3A6OA 3GBEA 1NP2A 2YDSA 2JEQA 2WM0A 4ATDA 3U5UA 5D9NA 3AZRA 1OIFA 1ITXA 3OLDA 4IPNB 2E9BA 4JFWA 3KL3A 3PZQA 3UETA 3A47A 3QOMA 4UFMA 1K6AA 3WQ4A 2X09A 3GYCA 2F2HA 1E70M 3VGHA 5DFAA 2J79A 1KWKA 2NT0A 1GHRA 1ISVA 1AQ0A 2WBGA 3W25A 1JXKA 2WVVB 1EOMA 2WPGA 4W8AA 5GQBA 2ZOXA 1B9ZA 3SCQA 4NRSA 2WBKA 1FFRA 2E3ZA 1NM9A 1E4NA 1QI5A 2G3MA 3VM5A 3NSNA 1V6VA 4TVUA 2VT0A 5IHRA 1J0ZA 3CMJA 2BVTA 1E6RA 5E6ZA 4HOWA 5GNYA 2CBUA 2VX4A 3PZ9A 1J12A 4W5ZA 3IJ8A 4X9YA 3WFZA 4KRUA 3EDKA 3S2CA 2W61A 1UKSA 1KR1A 2O9TA 3WUGA 3MO4A 2E9MA 4F9DA 3UCQA 3FNDA 1VFMA 1XCXA 2XGBA 2WHLA 3U5YA 4CN6A 2FH6A 1J18A 4GQQA 3UR8A 2EPNA 4LX4A 5A8OA 1XSJA 5A2BA 4DUWA 1NARA 3FN9A 2VJXA 3CZEA 3G6LA 1DWHM 2A3BA 1E6QM 6A3HA 3VIPA 5JIPA 4W8BA 1JAKA 2IUZA 3WDHA 3N12A 1V0LA 2ZX8A 2QHAA 3GBDA 3AHTA 2J8GA 3II1A 1KGWA 1V3LA 4JHOA 1E9LA 1M03A 2GDVA 1E15A 3SCUA 1V6WA 2VCCA 5JUVA 1H2JA 1HP4A 2ZXBA 2X05A 1WKYA 3WD3A 2YL5A 3SIMA 5A6AA 2QMJA 2VTFA 4MJ4A 2GDUA 2CHNA 4PTVA 1US3A 2W62A 4FF5A 2E40A 2VRQA 3ZJ6A 3CZJA 1EIBA 3PZUA 1VBRA 4AZCA 1V3HA 2VNCA 1V08A 3CUJA 1QNPA 2VZTA 2BVDA 2UY3A 3IAPA 4GIAA 3L2LA 2WLZA 2JIWA 5EMYA 4KH2A 3VTRA 3TTOA 4U2YA 1HNYA 4LXFA 1CTNA 4CD5A 4MNMA 4JKMA 3ZJ7A 1FOBA 1K9TA 3WEMA 4U5KA 4D6EA 3VM7A 1H11A 2X8RA 3O2LA 4RE2A 5M3WA 2D1ZA 5I23A 4Q7NA 4AZ7A 3K4DA 4JFUA 1GOWA 1CXHA 1XH2A 4P7OA 1W3JA 1UKOA 2FGZA 4LGXA 2EXOA 2CBVA 4JCLA 4AZIA 1HJXA 4PTMA 5CPQA 3GZAA 5EB8A 2ZXDA 2DSUA 1IZKA 1X6LA 4W7UA 4D1JA 1C7TA 2CPUA 5E9AA 2OSYA 4OZOA 3AQUA 3AYRA 2WHKA 3MUZ1 1JFHA 2DDXA 3AIVA 3WF2A 1V6UA 1G5AA 3BMWA 2PI6A 2WCAA 5FCZA 3E1F1 2EPLX 1NOUA 2XYLA 3OBAA 1V3KA 1GONA 3LPPA 3OGRA 5AYBA 3QHOA 1P6WA 5CSYA 5A2AA 4ZEPA 5A6BD 2XWEA 3QR3A 4W8LA 1WDRA 2HVMA 2WWCA 1BQCA 1SYTA 2BFGA 1MQPA 1B30A 1RD6A 4HMCA 3DHUA 1G0CA 4UQAA 4TVDA 5BCAA 2BHZA 3RJYA 1EHNA 3KEHA 3BSGA 1TE1A 1KXVA 1V3MA 3M7SA 1TR1A 4PMRA 2PWHA 4AZCB 4UOJA 4TVCA 4TTUA 2ZXAA 4FK9A 4ACZB 3T0AA 1VJZA 4AIOA 2YBUA 2YDRA 4BQ5A 4D71A 1JI2A 3SCVA 3VMNA 1R85A 4CU7A 3VD5A 4HA4A 1CBGA 4JL2A 1B1YA 2ZX5A 1JZ2A 2OWCA 4QCFA 3WL1A 3BAXA 4Y7EA 3AROA 3MKKA 4M80A 3ZSTA 4AD4A 1GHSA 2EO7A 3WNLA 4J3VA 1KQYA 3CHCA 2WZIA 1VEMA 5CGMA 1VFOA 4AD5A 1E72M 3RO8A 3VIFA 1UKPA 2BY1A 3ALFA 3VD4A 3OIHA 1HL8A 3OGSA 1UZ4A 2YL8A 1JYVA 2JEPA 1EQPA 1MW3A 3W4RA 1K9DA 4GZJA 5ABHA 1KXQA 4J28A 3AIQA 5AC4A 3W53A 2O92A 1VJSA 2VURA 3K4AA 4YN5A 5CPSA 2X0YA 4UFLA 1CZ1A 3ZR6A 1B2YA 3T09A 1B3VA 2XJ7A 3QHMA 3AYSA 1PBGA 4JFTA 1JD7A 3RM8A 4DWSA 1B0IA 1SFSA 3SCOA 3SCTA 4UTFA 1C8XA 4PSRA 2MANA 3SEPA 2FHFA 3N11A 3AMLA 3GNOA 2O9PA 3BLKA 3WELA 4FLRA 4XUYA 3CUIA 3MSGA 1CGWA 4GZEA 4HZ8A 2PWGA 3WDIA 2FGLA 4OBRA 1E56A 2D23A 1LLOA 3K46A 3W29A 2WNWA 3KL5A 2PBOA 2W91A 4L4OA 2V5DA 2EBNA 1IZJA 5A3HA 3AIRA 2XIIA 2WB5A 1H5VA 2D0FA 3AHYA 2WMFA 2AAAA 4V2XA 1B90A 3OLEA 3WMCA 1OT2A 5A8MA 5HBFA 4UQEA 3MSDA 3VMOA 1VAHA 4P8XA 2ZX6A 4FLQA 3ZR5A 1UQYA 3TTSA 4F66A 4UFIA 3B9DA 1NWSA 4JL1A 1CXKA 3D3AA 4AY1A 2VZUA 3M6DA 4S3KA 2FDMA 4PMDA 1A3HA 3MU7A 1E73M 2IXUA 1E5NA 2Y4SA 4EAMA 4AXNA 5DMYA 3UERA 3A3HA 3CUHA 2VX5A 2RGLA 2VC9A 2J8FA 4ZENA 1ZBKA 1VF8A 1ISWA 2Y5EA 3AMCA 3POCA 4ZXLA 3AISA 1V03A 3WFLA 3WUEA 1GOOA 1BSIA 1HIZA 3WBEA 4M56A 1OCQA 1U2YA 1NWUA 3WQ8A 1UH4A 1FH8A 1QBBA 3OZOA 2ZX7A 1LWHA 1KXTA 1C91A 2DEPA 1XV8A 1S46A 1XC6A 4XB3A 2OSWA 3SCNA 3WEZA 2G3NA 1M04A 2CNCA 1QI4A 1XD0A 4DWSB 1DHKA 4MADA 4DM2A 4M29A 3CZ8A 3PTQA 3T08A 1XSKA 4XZBA 2ESCA 1BTCA 3W6MA 2YL6A 4P8VA 2BY2A 4CU8A 1BVZA 1LL6A 3GXFA 3SCWA 4MB3A 1GQLA 2YIHA 4H7VA 1KQZA 3APGA 2V3GA 3L4VA 1D3CA 3GDBA 2XG9A 1EA9C 3WF0A 4OIFA 1E6NA 1BVNP 1KXHA 1Q6CA 5DEZA 3AIEA 4WKFA 1GOQA 1UWUA 1XGZA 3TP4A 2VQTA 3TONA 1H3GA 1W1YA 2XVPA 1L8NA 3G6MA 3ZMRA 1VB9A 1FH9A 3O9NA 4MNKA 1QHPA 3PTMA 4BQ2A 1W3HA 3BAKA 3VOCA 3NSXA 4E4PA 4AD2A 1HKIA 1I1XA 1UWSA 4CD7A 2VMFA 2CCRA 5HDRA 5I77A 4AZBA 2J78A 3AZTA 1W91A 4CVUA 4HZ7A 1JZ8A 4OUEA 1E40A 3BXWA 3ARYA 3GTNA 3FHQA 4EK7A 2W67A 3ZJKA 1PEZA 2J7GA 4M81A 4U5IA 1E3ZA 1RP9A 2D3NA 2XM2A 3RIKA 3HMCA 3GM8A 5FOOA 1CXLA 3PBGA 2VI0A 5I24A 4C91A 4CD6A 1CWYA 1SMDA 3UG5A 1BF2A 3F4VA 2BXYA 3IK2A 4KWUA 4FLSA 2EEXA 3UR7A 2JIEA 4B9YA 1CXEA 3WMBA 4PRWA 4PBGA 3WL0A 1QNRA 2WVTA 2FH8A 2PWFA 1Q6EA 1J0HA 3VINA 3FXYA 1ZJBA 4BZYA 3W37A 2WKGA 3PTKA 5AYIA 2ZWYA 5IXEA 1CPUA 2J25A 1DWJM 2Q8XA 3EMZA 3NSMA 3ZOAA 4MTVA 3U7VA 1V3IA 2PBGA 1F4HA 4N42A 1MXDA 2EQDA 4AMCA 1IV8A 3MV01 1XYFA 2CKRA 2G8ZA 1D2KA 2XSBA 3VIGA 1AQMA 3N15A 4WSJA 2XPKA 5I78A 1E1FA 2D22A 3U57A 1QI3A 3ARTA 2ZX9A 3K8MA 5A6BA 4H41A 1XRVA 1JF6A 3A4AA 4HMEA 1V0NA 1XHGA 1U30A 1J0IA 3EDJA 4WJXA 3WUFA 2XVLA 3UG4A 1E6XM 5AY7A 4W86A 4TUFA 2BHYA 3GH5A 2OSXA 5CG0A 1E0XA 3RM4A 4F9JA 3W24A 5DT5A 5I5RA 1DTUA 2FHBA 4D6JA 2A3AA 3WD4A 1BPLB 1W9DM 1V02E 5GNXA 1JYXA 1AVAA 2C8NA 1J9YA 4GI6A 5EFFA 1UWRA 3W28A 4M1RA 4ZXOA 1OWQA 2WC7A 1KBBA 3CHEA 5DT7A 1QVBA 4NF7A 4BF7A 4HA1A 2OLHA 2WC3A 4WSKA 3NJ3A 3PZNA 1JGIA 2CEQA 3ZSSA 3ARQA 7CGTA 3IJ7A 1UD5A 1UKTA 2YOCA 1C90A 4BS0A 5A1AA 3VUPA 8CGTA 3GH7A 2XFRA 3UG3A 5LYRA 2WW5A 2UWFA 5ECUA 4ACZA 3L4ZA 4WK9A 1JIBA 3L4XA 2XVGA 1CENA 4GINA 1HX0A 4QLLA 3TTQA 1DEDA 4UQ9A 5C70A 4AIEA 1C8QA 1ODZA 4OJYA 2WMKA 3ARUA 5CPTA 1D7FA 1W9UA 3A4XA 2F61A 2J75A 4W87A 4DUXA 2JF6A 4PYSA 2DGAA 1CXFA 4PTXA 1QPKA 4YHGA 1L0PA 1OD8A 4D72A 1JYNA 2W5FA 3BCDA 3W27A 2J7DA 2XSAA 2VCAA 3ALGA 3OZPA 2BV9A 4J3UA 1HJQA 2GK1B 3HJEA 3BAYA 5I0DA 4PSPA 4PMUA 4PN2A 1G94A 1QHOA 3FW6A 1J0KA 1WDQA 3AS0A 5BXRA 3PZIA 3RILA 3T2OA 4U31A 3AZSA 2XUCA 2C7FA 2W63A 1C93A 2QMKA 5LA2A 1EO7A 3WQVA 4M8UA 3SCRA 3CIVA 2XM1A 3K8KA 1W1VA 4B3KA 2YLLA 2WMGA 1ZL1A 5CSUA 1YHTA 3VDCA 4W89A 4A4AA 1J10A 2Z1SA 3GXIA 4CD4A 2YL9A 4MJ2A 4P7RA 2QLYA 5BWFA 1Z32X 3CPUA 5EFDA 1VRXA 1W9XA 1K9EA 2GSJA 4ZE4A 1GCYA 1R8LA 3JUGA 2JFEX 3WD1A 2D20A 5FL1A 4IPLA 5BXSA 1BYDA 1YQ2A 3AHXA 5E0FA 1UR4A 5DF0A 1UKQA 3AIBA 3WH9A 1JZ7A 2BHUA 1JXJA 3WH8A 3AMGA 3CZKA 1FP9A 4W88A 1BG4A 5M03A 4PMVA 3FHAA 1M01A 2C0HA 4TX6A 5BXTA 1ECEA 4PUEA 4ZE5A 4GI9A 1UD3A 4EANA 3WDJA 2CETA 1H0IA 5IFPA 4BCEA 3EDDA 4EE9A 3RJXA 2DH2A 5HOSA 2OWWA 4DM1A 4JZ5A 5D4YA 4AW7A 1QNOA 4F8XA 4IM4A 4GXPA 2GJPA 3N13A 2WCSA 2YBTA 3OLIA 2CIPA 5A6KA 3VD7A 3RCNA 4UOQA 4OBSA 1KWGA 1E4IA 4GI8A 1UYQA 4D6GA 3NDZA 9CGTA 4D6IA 4R5EA 3VGFA 1ISXA 1FHDA 2CBIA 1BYBA 1HJWA 2UY4A 1WB0A 1WCGA 2UY5A 2TAAA 1JL8A 1TCMA 3N1AA 4LYQA 3K8LA 2OYKA 3ECQA 5E0CA 1WE5A 4PMOA 2DT2A 5EBAA 4JFSA 3CH9A 5A94A 1W9BM 1UG6A 3PZGA 4GKLA 4D6CA 2GVYA 2VVNA 4P7QA 1UA3A 4URIA 2VR4A 1BGAA 2D3LA 1HN1A 2YLAA 3FAWA 2J62A 1R7AA 4HMDA 3I3BA 3VDHA 1NWRA 1FH7A 3CHDA 1TUXA 4QDMA 2WSKA 4ACYA 5D9MA 1UA7A 4HZ6A 1PX4A 2WMJA 1V0KA 3N17A 4RL3A 3WBAA 1OB0A 2J7BA 1GJWA 3ARXA 2ZXQA 4W93A 2DIEA 5BROA 1UOKA 4UFHA 3BH4A 3W82A 1JNEA 1XYZA 1AMYA 3TA9A 4X0VA 1E1EA 4YPJA 1FFQA 2XFFA 3KWXA 2J77A 4LQ1A 2AMGA 4IUGA 3CMGA 3UEQA 3B8SA 2JF7A 1QNQA 3AXXA 3WH5A 1GQKA 4D6FA 2D0GA 3AHZA 4BQ4A 4UR9A 1HT6A 1CYGA 3MMWA 1CECA 1W9PA 1QBAA 3F5JA 3VDBA 2GJXA 4HP5A 3ZT7A 3MUIA 1BG9A 2E9LA 3WH6A 7A3HA 1Q6FA 1W2VA 5A8PA 2WKLA 5ABFA 1QHZA 5I79A 3BSHA 4RE4A 4FMVA 2VOTA 5IDIA 1A47A 1MFUA 1I1WA 4P8WA 1JDCA 1LQ0A 3SCPA 4N0RA 4JHZA 4M24A 2WWDA 1UR8A 3NDYA 3RMEA 3I3EA 4MNLA 3SURA 1HKKA 5CZKA 3ARZA 3W0KA 2DPEA 4U2ZA 2Y24A 3WY1A 4AYSA 1HJUA 5A6LA 1OBAA 3AS1A 4KGLA 4Q22A 4X0NA 2NSXA 1H4PA 1J11A 1GOKA 1XD1A 2X1IA 2DSKA 4MAZA 1UH2A 1ESWA 2XVNA 3EDFA 1TVPA 3EMCA 3AI0A 1UD6A 1WZLA 1H49A 4OKDA 1DWAM 4MB4A 3WUBA 4CVWA 1X1NA 1NOFA 2CITA 1GQJA 3DHPA 3W38A 3IAQA 1UQZA 1X6NA 2VCBA 2XGIA 1E6PA 5CLWA 4PCSA 1CGYA 4Z2KA 4GQRA 1MYRA 4PTWA 2YJQA 4PEEA 2J7EA 4UCFA 3VO0A 1V3JA 5JIWA 2PF0A 1HL9A 3VU2A 3OG2A 3T2QA 4LYRA 3FY1A 1BGGA 4JFVA 4PMQA 3WQ5A 1GJUA 2OWXA 5FL0A 3S6TA 3WKZA 2G4FA 3W26A 2Z1KA 5D9OA 1PX8A 3WF4A 4AWEA 4H8VA 4D1IA 2J7CA 1MQRA 3OLGA 4AZ6A 3SUWA 3BAJA 4D6HA 2E8ZA 5A6MA 2GJXB 1OGSA 4UNIA 3AXIA 5HPCA 3BLPX 3PZVA 4NI3A 1W3KA 1IT0A 4GO9A 5CJ5A 1Q4NX 1HVQA 1CDGA 1KCKA 1LL4A 4XZWA 5D8WA 2ZWZA 5ABFB 3WD0A 4HU8A 5E70A 4CCDA 4MNJA 4TTGA 1CLXA 1UD8A 5ABGA 2VX6A 2Y8VA 1ZBCA 3THDA 2JALA 1C3FA 1E0VA 4NSBA 1TMQA 2V3DA 4ZFMA 1V6YA 4UFKA 2XVKA 5BRQA 3CHFA 1V6XA 3WNOA 1SR0A 1U33A 1EDTA 3CBWA 5DO8A 3CO4A 3DC0A 4PMYA 1GORA 2VVSA 1RPKA 1J01A 4JKKA 2V5CA 2WVUA 4WF7A 4UQCA 1DWFM 4JKLA 1EGZA 3WENA 2Y8KA 1CGTA 3T0BA 4J3WA 4J3XA 5KEZA 1E5JA 2VR5A 4QAWA 1W3LA 1G1YA 1NOWA 5GPRA 5M5DA 3SCSA 4S3JA 3VILA 3VNYA 1BHGA 2A3EA 1PZ3A 2V3FA 1E0WA 2W66A 1Q6GA 3VD3A 4TX8A 1JFXA 4W7VA 1C7SA 4Z2HA 1KBKA 3D5HA 2ZUUA 3VNZA 4WKAA 4WIWA 3VIMA 4NZCA 1KB3A 3F5KA 2WAGA 3WDRA 3GNPA 1HJVA 3M07A 2V38A 3WH7A 2YA0A 4MB1A 1XCWA 3L4WA 2FHCA 3GNRA 4MDPA 2WHJA 2A3CA 4HA3A 2GK1A 1DWGM 1ZB5A 1B3YA 2PC8A 1I75A 1WZAA 5CQ1A 1H0GA 5AC5A 1LL7A 1DWIM 3N9KA 4QFUA 3ZT6A 2D2OA 3LMYA 4AC1X 1BAGA 2OYLA 4R27A 1UR9A 3ZT5A 1G01A 1EOKA 1RP8A 1OGGA 3WMSA 3DYMA 3NYDA 4UZUA 1C8YA 1CIUA 2AOSA 4UFJA 2RGMA 3DECA 4AZGA 4B9ZA 2E8YA 3CGTA 3SUVA 5IFTA 2BY0A 4AEEA 5C71A 4RE3A 4P7LA 4PMNA 2EPMX 1HP5A 4AISA 2G3IA 2VZOA 1BYCA 2XFYA 1K9FA 5TD4A 1KGUA 2WC4A 3T0DA 1EDQA 1UR1A 1N82A 3VVGA 3PHAA 5I6SA 3DYPA 2PWEA 3EMQA 1GQIA 3MV11 2XTKA 2JE8A 1UR0A 1ZJAA 3NCOA 2VRJA 2WK2A 3VGDA 4CCCA 1ZBWA 4K68A 3VMPA 1EO5A 1MWOA 4H04A 1BYAA 3MANA 2ZUVA 2E0PA 2VX7A 3B9EA 3LPGA 1LF1A 2CHOA 2YDQA 2WMIA 4H2CA 1AQHA 1NH6A 5A6SA 3BCFA 3SUUA 4AD1A 1ITCA 2W92A 4QLKA 3VIHA 2VRKA 3L4TA 2EPOA 4UQBA 4W7WA 1QI2A 2VZSA 3AICA 2O9RA 4HPGA 5JBFA 5A8QA 1SMAA 2BY3A 2WZEA 4QCEA 1GPFA 2ZIDA 1UWIA 4BQ3A 3GXMA 4CUCA 4WLCA 2ZUWA 3N18A 3J7HA 2GFTA 4E8DA 1QI0A 2YA1A 3VGGA 2BVYA 3CUFA 3WEOA 2VO5A 3VX0A 2XIBA 2BS9A 4Z2JA 2VL4A 3KE0A 3GXDA 3AFBA 4D6DA 4UZSA 4Z2GA 3RM9A 3ARVA 4P7NA 1CLVA 4F79A 2G3JA 3AMKA 4J7RA 1TVNA 4C90A 1UD2A 4ATLA 3PN8A 1JDDA 1E4MM 1PAMA 3PZOA 4TOQA 2D24A 1QOXA 1PIFA 2DQXA 4XV0A 1OM0A 1C92A 4ATWA 4CKQA 4M82A 4KMQA 2YA2A 2WMHA 4DWSC 1EH9A 4A3YA 1E43A 2QPSA 5FIPA 1O6IA 1TA3A 1MFVA 1M53A 3CLWA 4CCEA 1ZU8A 6TAAA 4U3CA 1H41A 4MB5A 1M7XA 2BXZA 2X2YA 3AMDA 1KGXA 1MW0A 3AIWA 1PIGA 2WCGA 5A8NA 2VZVA 1UD4A 4Z2LA 4MPKA 5A95A 1CXIA 4LPCA 1GOIA 4OOZA 4LYPA 1OSEA 2XHYA 5HXMA 1ZBVA 5FD0A 4FLOA 1H1NA 1MQQA 4QLJA 1GVIA 4HOXA 4JCMA 3MUAA 3ZJ8A 3PZMA 5LA1A 2QV4A 1ISYA 1UZ1A 1NQ6A 4W5UA 2CKSA 3MMUA 4V28A 2WMIB 1WDPA 1EXPA 1E6ZA 1HF6A 1G9HA 5CXPA 3ZM8A 3AHVA 5JBEA 5C8BB 1HVXA 4CN4A 4PUDA 4KGJA 3AOFA 4C7FA 1JG9A 1JZ5A 4U33A 1ISZA 1E6SM 1NWTA 4AD3A 1MXGA 5M17A 3WQ6A 3WF1A 5GNZA 1FA2A 4IISA 2J47A 3LPFA 3KL0A 3WNKA 1LJYA 2F8QA 3VIKA 3VDAA 2WVSA 3A4WA 2WXDM 4HPHA 2J74A 3F5LA 2B31A 2VUYA 3AIUA 2CXGA 3BAIA 1CGUA 5KZ6A 1GOMA 1EDGA 5CLTA 4JIEA 3RPMA 1GW1A 4L4PA 3UESA 1J0YA 3WSUA 1KFWA 4PMZA 3OB8A 3W6LA 1E3XA 1QNSA 3VIOA 3M46A 1R87A 3WDPP 2CBJA 3ZO9A 3ARPA 1OGBA 2V3EA 4J27A 2WANA 4DUVA 5ABEA 3LPOA 5I2UA 3HU7A 5F7UA 4BA0A 2PWDA 3NIYA 3CTTA 1R7OA 1NP0A 3VX1A 3ARWA 4CU6A 1VENA 3DYOA 4PMXA 3BMVA 4KRTA 2YKKA 1W1PA 3BGAA 3EDEA 3VGBA 3TOPA 4A3HA 1V0MA 3SUTA 5A2CA 1XH0A 1OIMA 1FP8A 1PPIA 4J3SA 1BLIA 1TA3B 2ZUTA 1JF5A 3QOKA 1PZ2A 2VQUA 4AZHA 1JZ4A 2J7FA 6CGTA 3WNNA 4UQDA 2BNJA 3AS2A 1UH3A 2DSWA 2G41A 3TTYA 4U3AA 1W2PA 1WDSA 5D9PA 1OINA 1HJSA 5BXPA 4GZIA 1GNXA 4MDOA 2WHMA 1OT1A 3T2PA 3W81A 5JBDA 1MW1A 3WF3A 5BYWA 1VBUA 2X0HA 1DP0A 3WDQA 1UWTA 1JI1A 5HPOA 1GVYA 4WKHA 4CD8A 3ZQ9A 4V27A 1F4AA 1O7AA 1B3WA 1Y7VA 3ZIZA 3WIJA 4XX6A 3L2MA 2ZE0A 2EJ1A 1JNDA 1E55A 3IANA 3OGVA 2CESA 7TAAA 1XSIA 3FAXA 1VIWA 4TXEA 1CGXA 1GUVA 1LG1A 4C7DA 1BFNA 2DT0A 2XWDA 2DT1A 1EQCA 2D0HA 3WN6A 1J0JA 4YHEA 5E09A 4W84A 4B16A 2NT1A 4B15A 1UWQA 1WZMA 4UOZA 3WNMA 1W32A 1HKMA 2DSVA 2QF8A 4Z2IA 4ML4A 3GH4A 4PCTA 1PJ9A 3K1DA 5FKYA 4AEFA 5E6YA 3MUY1 3OA5A 1VEPA 3L4UA
chains in the Genus database with same CATH superfamily
1F61A 2Z1VA 1F2JA 3PTDA 1P6BA 1JAEA 1W1TA 2J4GA 4RKAA 1FHUA 3ARRA 3N2CA 3THUA 1VYRA 2WSYA 3QGVA 1ECQA 4E2VA 5I3DA 1UP3A 4AZ5A 3VOJA 3WLKX 2DT3A 3UU0A 2WSPA 2ZBTA 4MZYA 1M41A 3MVIA 4DJED 2E4TA 5G1TA 1UJPA 1PKMA 1ODUA 3PWAA 2H8ZA 1QT1A 3BJFA 3QPZA 1IEIA 1MUWA 4G1NA 4RZ6A 4WVXA 4JN8A 1E4LA 5BRPA 1BF6A 1KV8A 3WNPA 1PX3A 4H8HA 1SZNA 1X39A 2F2KA 2WVVA 2MUCA 4JNYA 5DCEA 5CJNA 4NJGA 3EYPA 2H9AA 1KO0A 1XH1A 4H00A 1UMLA 5LA0A 1MO0A 8A3HA 4X9SA 1WAUA 2V63A 3S6OA 4DNHA 3UXAA 3VKDA 4QNEA 3W3OA 1DQXA 1S1RA 4LUYA 3OHMB 1QWGA 4W85A 4LS1A 3WFAA 4LCRA 4AD0A 1IGSA 1MW2A 2ZQ0A 4HHHA 2IXVA 3DI0A 1H60A 3QQ0A 4OOUA 4DO4A 4C6LA 5LIYX 2O7QA 2WZHA 2BZNA 3NQ2A 1YKWA 1DXIA 3L67A 2C14A 4JX4A 3BLEA 3UXDA 3P62A 2NXGA 4Q4KA 4XZ9A 3B03A 4E8CA 3VOGA 4AU0A 1ZS2A 1GVRA 3M5VA 1EGMA 3M9YA 4AX6A 2NXHA 4AAJA 4J3TA 4RV3A 4JIIX 4H8UA 4RDWA 3KS5A 4N9CA 5A69A 3URNA 3LCLA 1Y5XA 1FWIC 4G9PA 4C7GA 2BGNE 1EJXC 3PNZA 5H8MA 4NJJA 1XW8A 4NP7A 4UFMA 2XH7A 2FYMA 3WQ4A 2ASHA 3GYCA 1E70M 2OLAA 5DFAA 3FOKA 1KWKA 1XIEA 3LGGA 1GHRA 1XIDA 2WBGA 1TV3A 3M16A 2E3ZA 3WO8A 4LEQA 2NLYA 4CNPA 4XKYB 5DMMA 4Q8MA 1DHPA 1OK4A 4M6PA 4BFAA 1TPDA 1E6RA 5GNYA 2Z2BA 4HNLA 2NZLA 3PZ9A 4G6CA 3U2OA 3BW2A 3V18A 4W5ZA 5E9XA 4C5YA 3GC2A 1R9YA 3RPTA 1SSGA 3VZYA 2Z7GA 4IOTA 4N2YA 3MO4A 2E9MA 3QY7A 4Z42C 2PURA 2WHLA 3U5YA 2GQ8A 3LCXA 2Q6ZA 1ZFJA 1XSJA 4NAFA 4S2CA 1R3WA 3CS2A 3KOWA 4QDWA 3PM6A 4TV6A 1DWHM 5CGQA 5HUOA 3F4CA 4JYFA 1O12A 2P10A 3H22A 6A3HA 1UC5A 4LC8A 1XBXA 3N12A 1V0LA 4Z1BA 5DQPA 2ZX8A 3GBDA 3V7PA 1FX6A 2G4JA 2FQIA 3II1A 1S2VA 5FEPA 1V3LA 1VFTA 2D2JA 5JUVA 1H2JA 2X05A 2ZXBA 2BOEX 1V93A 3A21A 3SIMA 1JUEA 2VTFA 3LX9A 2GDUA 4PTVA 5CG7A 2VRQA 1I2OA 1XICA 3ZJ6A 1EIBA 1ENUA 4P61A 4AZCA 4Q4SA 1V3HA 4JQ3A 1X1OA 1YDNA 3V4BA 3IAPA 1TV5A 1F9CA 1ZTVA 4LEFA 5T9BG 1QPQA 1IXOA 1SGJA 3OZMA 2PC4A 4U2YA 3BLLA 1VJIA 1DYSA 2ATSA 3DX5A 4CD5A 3BARA 4H9VA 3ZJ7A 2C0AA 1FOBA 1K9TA 4BF5A 3O2LA 1AG1O 5I23A 3NM3A 3LA4A 3TZNA 2CZ5A 3LLXA 1ONRA 2DQWA 2ICSA 1W3JA 3CWOX 3LI0A 4IPIA 4BK9A 2CBVA 2ZXDA 1IZKA 1X6LA 2GQ3A 1YYAA 3NVTA 4AB4A 1GKPA 2CPUA 3DERA 5E9AA 2J8TA 1V79A 3AQUA 3N4AA 3GVQA 3AYRA 2WHKA 3QW4B 2NV9A 4O57A 3WF2A 2V0TA 3OVQA 1G5AA 2X1RA 4PA8A 1SFJA 4HNUA 5AVHA 2WCAA 4HK7A 4Q8TA 1YLVA 1V8EA 2XYLA 1U1UA 2V82A 1ONEA 1V3KA 1ZUAX 1TWZA 5AYBA 3QHOA 1RLCL 4ZEPA 2XWEA 3W1UA 2QCCA 2VHLA 2VDIA 1RD6A 5TBOA 1YIXA 4UQAA 2J9YA 2PP1A 2V2DA 3KEHA 3BSGA 3M7SA 1GYMA 1L2QA 1TQJA 4FK9A 2VP8A 2WV8A 1QOQA 3G22A 1ME9A 3BLFA 4WD0A 4EWND 1S2CA 4DJEA 1R85A 4LAOA 4CU7A 1DTNA 4HA4A 5AYZA 2PTWA 2L5HA 3VKBA 1F3EA 1B1YA 4QG6A 3ZVHB 4Y7EA 3MKKA 6TIMA 3Q58A 2EPHA 3ZXWA 1GT8A 4O0ZA 5DMNA 3TYDA 1VEMA 2ACUA 4AMAA 5CBIA 3FLUA 4AD5A 1GG1A 3G2GA 3U2EA 2NV2A 2R14A 5AB3A 2GGEA 3ALFA 3GG7A 3QYQA 3VD4A 5FJIA 2XIMA 1ZP4A 2YL8A 3VNMA 2ZZ2A 4KPLA 2TPSA 4GZJA 4RNJA 4PZVA 2ZKMX 1WXZA 1SJBA 2J66A 2VURA 4ERIA 4UB9A 3CEUA 1DPMA 4X63A 3G5EA 2X0YA 3H8AA 4O19A 3LHVA 4M51A 1XPGA 1B3VA 4O28A 4JIPA 3AYSA 1W5PA 4JTSA 3B0VC 3WK2A 1B0IA 3H7VA 3I6RA 3R0DA 3SCTA 1JUBA 1Z44A 4PSRA 2PDHA 4UTFA 1XYCA 1Q6RA 3GE7A 3AMLA 4FXRA 2O9PA 4P00B 2P8BA 4FLRA 4XUYA 4HZ8A 2PWGA 2FGLA 3STPA 1SJAA 1S5MA 4OBRA 1SO4A 3PPCA 2EAWA 3UZ5A 4O10A 1LBLA 3C0SA 2HCVA 1T96A 3N9SA 4H9XA 1AD1A 4YYFA 1FWGC 3HQPA 4ZQCA 1NDYA 5BRBA 4MLJA 3LRKA 5I00A 2ISFA 4E3TA 1K7XA 2WMFA 1IIGA 3DCPA 4V2XA 3PSVA 1KFJA 4V33A 1CI1A 1I2QA 1Z6KA 3UF9A 2UV8G 3CHVA 5RUBA 3GAYA 3SGGA 5HBFA 2HS6A 3MSDA 3VMOA 1AH0A 2DZUA 4FLQA 2PRMA 3O16A 3B9DA 4AY1A 3H70A 1WBHA 1MEIA 5K9XA 4L9XA 4I9MA 1A3HA 2IXUA 1XRSA 4EAMA 3UERA 4B5VA 5AECA 3MKVA 1WDDA 3NO5A 4YTQA 3WLPA 2RGLA 2J8FA 1XF0A 3GNNA 2P53A 4S38A 1ISWA 3MBDA 2PTZA 3L5LA 4I90A 3WFLA 3WUEA 1GOOA 3RNDA 4RNFA 3OQEA 1TYGA 4ILSA 1UH4A 2ZX7A 1LWHA 4A35A 1I8JA 1XLDA 1M04A 2CNCA 1W1A1 3Q2DA 4MADA 4PBFA 4M29A 3CZ8A 3T08A 1VFHA 1XSKA 3LM3A 1TZZA 4XKYA 3NO1A 4AHOA 4AY7A 5HJXA 3SN1A 4CU8A 3GUWA 1BVZA 4AF0A 4LS2A 3SCWA 1I2RA 4LRSA 4CNNA 2ANUA 2FFIA 3R11A 3GDBA 2XG9A 4YJ5A 1BVNP 5DEZA 1UWUA 2ALRA 3TP4A 1AODA 3QFEA 3TONA 4EF8A 4B5NA 5GJNA 2V69A 4JQ4A 3G6MA 4MJMA 3S0CA 2XDFA 4E0CA 1QW7A 3WLJA 1WQ5A 3LCWA 4JX6A 4Y2WA 2AL2B 3T9PA 1HKIA 3T07A 1I1XA 1UWSA 2ABAA 4WDTA 4Y6GA 4XAFA 1XM3A 2ISWA 5HDRA 1F3WA 2DZTA 1F7BA 3E2VA 3RGTA 3FFSA 3H2NA 1JZ8A 1S39A 3BXWA 3M5YA 1XGDA 3FHQA 4EK7A 2W67A 3ZJKA 4WDUA 4M81A 1RP9A 4GXMA 4Q4PA 3IWPA 2P1FA 4UIOA 1KM4A 1CXLA 4CD6A 1MZRA 1SMDA 1N2VA 2HTMA 3E5BA 2PCQA 1BF2A 3SR7A 2GUUA 3H7UA 1NFPA 3BE7A 4PRWA 4NZJA 4PBGA 1I9CB 2R1MA 4F2TA 1IWBA 2FH8A 5TF0A 2P8CA 1EPVA 1Q6EA 3VINA 2ACQA 1ZJBA 1DWJM 3EMZA 3NSMA 3ZOAA 2P76A 5LGXA 3GKFA 1RALA 5CC6A 3CV6A 1V3IA 1F4HA 2QAFA 4N42A 1MXDA 4RZ4A 3M47A 1JCXA 3C52A 1XLKA 2A6NA 1IV8A 1X97A 4PODA 2ZADA 3PJWA 2ZA1A 4GFIA 3REQB 5CBBA 4IJCA 2XSBA 3VIGA 5EMMA 4C6IA 4GCXA 3MDWA 2AAMA 1H7OA 3WQCA 2QCFA 1E1FA 2D22A 3G1RA 3GZ3A 1DJZA 3U57A 4CQ8A 3ARTA 4H41A 1XRVA 1JF6A 2DY3A 4LRTA 4UR8A 1EUNA 4GY0A 4Z08A 1RA5A 3WUFA 3RHGA 4RK8A 1EEPA 4W86A 1VLWA 1TQXA 4XD5A 4GE8A 2FKPA 3B06A 5CG0A 4KKXA 3VYLA 2Z1BA 4XSLA 3RM4A 1GVOA 1EUAA 3HGJA 4BI5A 1DIEA 4GBDA 1O66A 5F4SA 4DJDD 1VFLA 1AVAA 2RDTA 4U10A 2C8NA 2A7PA 1J9YA 2IW0A 3HFTA 2JGQA 1TUFA 4M1RA 3N2MA 3MZ2A 4PE8A 1BWVA 2WC7A 1HZYA 1QVBA 1H61A 4JS3A 2E68A 4MKVA 1FHVA 1JGIA 3AUOA 3RG6A 2PU0A 1TE6A 3OW1A 4HD5A 3TLLA 4BS0A 2HPMA 3KTXA 5A1AA 2NQ5A 3GH7A 2VFDA 2BGSA 5D38A 3UG3A 3W88A 4PL1A 3NURA 1MRQA 5LYRA 1TV4A 3NYZA 4BJHA 1W3IA 3L4XA 4QLLA 3UT0A 5HNUA 4JTEA 2QULA 1VCGA 1G67A 4GGBA 3ARUA 4O1CA 4GYJA 5CPTA 3VXGA 9RUBA 2PUZA 3HBLA 2Q3RA 3W2MA 1TV2A 2F61A 4IIDA 3H54A 5HK4A 3SIZA 3PK7A 3S1VA 4PYSA 4C6OA 2DGAA 4H9TA 3BOFA 4FXSA 1P7TA 1O1ZA 2FB2A 3BCDA 4K1GA 3EWXA 2J7DA 4CLMA 4C1NA 2BV9A 4EXQA 3UXKA 1HJQA 3W7CA 3HJEA 5JMUA 1PTGA 4PN2A 3W70A 4L61A 2GVGA 4M0XA 3PZIA 4QGCA 1EJSC 4U31A 2QJNA 5H91A 4I6VA 2P0IA 2W63A 3GS6A 1C93A 1E0TA 5AHEA 3I6TA 5CSRA 3SCRA 5CZ0A 3QPYA 1ZL1A 2IMRA 4LF2A 1W3TA 5CSUA 2ABBA 5CPMA 4JPGA 3URQA 1JCJA 1ITUA 3FA3A 3BV4A 4NL1A 4P7RA 5BWFA 3T8LA 1H1ZA 2X7VA 3RX4A 1TMLA 1K9EA 2WNZA 2XN0A 5G2HA 1QUMA 3B9OA 3B8UA 2IPGA 1K4GA 3HIJA 1TRIA 1YBQB 3LHUA 5K4XA 4A29A 4AWSA 2G50A 3AHXA 3OIXA 3IVSA 3PWGA 3ERPA 1YE6A 5CCZA 2V68A 3GG1A 3S2LA 4O14A 2YB4A 1RJQA 4Q8UA 1JXJA 3WH8A 5CAHA 3GY1A 3FHAA 1M01A 4TX6A 4PGLA 4PUEA 3SB0A 4HK6A 2I5IA 4EANA 3WDJA 4RW3A 4H3DA 4H6QA 1XLGA 2YCKX 2ZDRA 5HOSA 4JZ5A 4LOCA 4IM4A 5LGZA 4B5XA 2WCSA 3NGJA 1LROA 3LOTA 2QCMA 1XIFA 1UZDA 3GHRA 1KWGA 5DCDA 1OFDA 4X3ZA 4D6GA 4JTHA 1TPFA 1W8SA 1U83A 4M3PA 1N55A 3R89A 1US0A 9CGTA 5JXQA 2OPJA 2OU4A 1DJXA 1WB0A 3W7HA 1U22A 1JL8A 3K8LA 2OYKA 3B0PA 3PFRA 1JRCA 4OGZA 3CH9A 5A94A 1W9BM 3GTFA 2SFPA 3R8GA 3PZGA 4JTGA 4GKLA 1ZLPA 3JW7A 3ENLA 3K2GA 2VVNA 1Q63A 2D3LA 3FVDA 2YLAA 2Z24A 3L7RA 4HMDA 3BW3A 3VDHA 3FX4A 1XRTA 3Q94A 1FH7A 3CHDA 2GJNA 2A7RA 2WSKA 3SGZA 5D9MA 3BGJA 2C18A 5TNVA 2FVLA 2WMJA 1V0KA 3VOIA 1OB0A 3O0FA 3GTHA 4NJIA 1UOKA 1LORA 4NT0A 4UFHA 5BMXA 1KNWA 1JNEA 3P2VA 3QMRA 1AMYA 3HG3A 1E1EA 2OEKA 2J77A 2AMGA 4IUGA 3UYCA 3ZZ1A 4O15A 1SUXA 3UEQA 1KM0A 1XYBA 3C2RA 1XGEA 3U6WA 1R3TA 3PPGA 3RU8X 3WJXA 1QBAA 1S3TC 3LTPA 1B9BA 3KLKA 4C6QA 1QXLA 2GJXA 4HP5A 3GR4A 2PMQA 3ZT7A 2QKFA 1W2VA 2A2IA 4A3RA 5I79A 3ES7A 4US6A 2VOTA 4AEOA 1MFUA 4H8NA 3IIPA 4UTWA 3SCPA 4MWAD 4JHZA 3NDYA 1R3VA 1JPMA 2OZ0A 1FWCC 3EB2A 5H8PA 1HKKA 3W0KA 4U2ZA 4DUOA 2YX0A 4O0KA 2ZVRA 5K7JA 2V8ZA 4BHYA 4GWEA 4ZQNA 3QSTA 4MAZA 4YTRA 1UH2A 2D2HA 2XVNA 3CEPA 3EMCA 3CWHA 3T4CA 4CQBA 3KOYA 1P6CA 1H49A 3EOOA 4IPJA 5L6UA 1NOFA 3K5XA 1HG3A 1GQJA 3DHPA 3UY7A 4N9BA 3IAQA 2PU1A 3MI2A 2VCBA 5CLWA 4I9AA 4PCSA 2Z26A 1UASA 2YJQA 2HNHA 2J7EA 1JCNA 1WKDA 1V3JA 2PF0A 4YTTA 1OADA 4GLEA 3SDOA 1R5YA 3TCSA 5HAOA 1WV2A 2ZE3A 3G8EA 1BRLB 3CPRA 4AHQA 4DJDA 3GHUA 3EXTA 1XXXA 5DBUA 3UFYA 4JFVA 2GOUA 2OZ8A 2OWXA 5FL0A 4GRSA 3WKZA 1Y65A 2G4FA 3W26A 3NL5A 2Z1KA 1PX8A 3WF4A 3D0CA 4H8VA 3W1LA 3R10A 2Q8LA 4D6HA 5A8GA 4IJBA 3CIWA 3HPFA 5A6MA 2ZZ4A 3E0FA 1KRMA 4Z1AA 1IT0A 1H7NA 2NQZA 3HOJA 1CDGA 1XJBA 5I03A 2C6QA 1LL4A 5D8WA 2ZWZA 5ABFB 3DG6A 3WD0A 4EXAA 4XZIA 2NV1A 3CH0A 1REQA 3W7RA 1ZPTA 2V5BA 1C3FA 2J9XA 1TMQA 1V6YA 5BRQA 3WNOA 1Z48A 1U33A 3R0KA 5DO8A 4ICMA 1G4PA 3N29A 1GORA 3WLOA 1TCDA 1J01A 1SW0A 3PBWA 3AC0A 1DWFM 3DG7A 2Y8KA 3AALA 2VUNA 4J3XA 2Z29A 3P3BA 4OWGA 1G1YA 2GYIA 1S2TA 3VILA 3VNYA 1E0WA 3C6CA 1Q6GA 4WSHA 5JU6A 2C1IA 4TX8A 4Y8EA 1YE4A 3D5HA 1K8YA 1EF2A 2FZ9A 2PSNA 3WDRA 3GNPA 3UZWA 3VKAA 1S5NA 4MB1A 1XCWA 3WLMA 3HB9A 1D3HA 4MDPA 1PSCA 2WHJA 3EEGA 3M7WA 2A3CA 4M7SA 1DWGM 2QXWA 3ONCA 1B3YA 1H62A 5E0KA 1FWWA 3GXTA 1Y5WA 5CQ1A 2IPWA 3O6YX 1TREA 3W76A 3N9KA 4QFUA 1N8FA 3BL3A 3EGJA 1R2RA 2PDGA 4Q8NA 1EOKA 3SY1A 3NYDA 3M5ZA 3TNOA 4UFJA 1A50A 2RGMA 4FNUA 1FWBC 4DX3A 4AZGA 2E8YA 3SUVA 5IFTA 7REQA 3N9RA 4AEEA 3RCMA 1XG4A 4AISA 4JY8A 1BYCA 1LT7A 1I60A 5TD4A 1LDCA 5CPLA 1Q7MA 3T0DA 1EDQA 3U2CA 3PHAA 3BQ6A 2PWEA 3MV11 2XTKA 3W7MA 1ZJAA 5D2WA 2WK2A 3B4YA 5DANA 1IQ8A 4IMGA 4K68A 4H04A 4GNJA 2CHOA 2PZ0A 1RCOB 3R94A 2VENA 3BURA 3TC3A 1NH6A 1AMKA 3BCFA 3M0YA 1QO5A 4QQUA 3L4TA 4MKSA 3A4JA 4FIQA 2Y1HA 3OTRA 4EX4A 1F07A 1RCXB 4FR6A 5FJOA 1V5XA 4NQ1A 1GPFA 2ZIDA 1UWIA 4Z0SA 3A3WA 4ZQPA 3J7HA 1PE1A 2Y8UA 4TIMA 2GFTA 5CKSA 5D05A 4HU3A 4IFOA 1JPIA 3WEOA 2VO5A 5MF5A 4AVNA 3B8DA 4Z2JA 4IP5A 3G3DA 1YNQA 2HK1A 3PBUA 3RM9A 1PKNA 3O63A 3CAKA 2X16A 2CW6A 1BTMA 1F76A 3TDFA 4LFYA 3AMKA 4J7RA 4WX2A 1EPXA 1TVNA 2DFAA 3M0HA 3HGRA 1E4MM 4TOQA 1NJJA 2DQXA 5I3JA 1OM0A 1JDFA 5XIMA 4ATWA 3VCCA 2FJUB 2EG8A 4RNIA 2DJXA 1EH9A 2Y89A 1TA3A 1M53A 3CMFA 4J2MA 1FDZA 3EX6A 4G2DA 2BXZA 5L9FA 1OG0A 1MW0A 5A8NA 1PIGA 2VZVA 5FJTA 1SFTA 1OEPA 4MLRA 5HXMA 2HJPA 1XLMA 4MWAA 1OCJA 5AZ0A 3TYBA 1MQQA 2O4MA 4R7JA 3QTGA 3BANA 3ZJ8A 3PZMA 2VEGA 4XZNX 2QV4A 1UZ1A 3TYAA 1NQ6A 3GVVA 2CKSA 2OGJA 4V28A 5FF4A 2WMIB 3LCHA 1EXPA 3H12A 1LUCA 4MIMA 5JBEA 5I02A 4Q4MA 3AOFA 1JZ5A 1JG9A 3DC8A 4AD3A 1NWTA 1O5KA 5M17A 3F2BA 2NUYA 3WQ6A 2YR1A 4JICA 2Z2UA 3QQWA 1XFCA 5EMKA 2OFJA 1FWSA 3LPFA 3WNKA 3A9BA 3TAOA 1TIWA 1UBSA 3DGRA 3VIKA 3ME3A 1NDWA 4DJFA 2DUZA 2J74A 4XO6A 4K7YA 2CXGA 1HO1A 1ZAHA 4QE4A 1L2UA 3G1FA 1EDGA 4JIEA 3EPMA 3RX3A 1KFWA 4PMZA 5KZDA 3TN4A 1E3XA 3FDKA 5T91A 4LAKA 2B7PA 2F9RA 1R87A 2ISSA 1VPQA 4RDYA 3BW4A 1AJZA 3UJEA 1TPC1 1S2UA 2WANA 1T8QA 3Q4DA 1IT8A 4I7VA 2PWDA 3BUVA 1TX2A 4XVEA 2JKPA 3FJ4A 4CU6A 4NUWA 3HQNA 3W1NA 3EDEA 4Y9PA 1QJWA 2ACSA 1PXGA 5A2CA 1PPIA 3RAOA 4J3SA 1JF5A 1PZ2A 2VGBA 3WNNA 2DZSA 2BNJA 3TTYA 3S9ZA 1EKOA 2JK2A 4H7ZA 4J3ZA 1V51A 4DAIA 1W2PA 5D9PA 1OINA 2GVLA 4FNQA 2WHMA 4GH3A 4R3UA 1MW1A 3PR2A 1UWTA 5HPOA 4MF4A 1O5QA 4NJHA 3GW0A 3ZIZA 5AC6A 3WIJA 4XX6A 2ZE0A 2EJ1A 4WR3A 3CK5A 4PULA 4GABA 1E55A 1H7PA 1U5JA 7TAAA 2BB0A 1U5VA 3NXFA 1BFNA 2ZRVA 1ZJHA 4UXDA 2XWDA 4YNGA 3TE9A 4YHEA 5E09A 4W84A 3QM3A 1R9XA 3UCCA 4GYPC 1G7UA 4PCFA 3BTNA 4PCTA 5FKYA 4Q8QA 1C29A 3MUY1 1VEPA 3STGA 3DFNA 4NXSA 2QPUA 3LLDA 2DVTA 2DIKA 1B3XA 3HMJG 3LHZA 3LUTA 3CZGA 3QHNA 4RPPA 5C2GA 2W4XA 1AJ0A 1KM2A 3LDVA 3APYA 5HWJA 1GZJA 1VFFA 3JZEA 3WQPA 2D2GA 1UR2A 3DN5A 4AG0A 1W9VA 5AN7A 3VGEA 3DU0A 3MS8A 4R34A 3LS9A 4K8GA 3H2AA 1AW5A 1HXJA 1B31A 3BO9A 3VIIA 1IGWA 2ZUMA 2OEJA 3GDKA 1FHLA 4KCWA 1PB0A 4Q6JA 3TFCA 4JTAA 1YX1A 1YMYA 4GUHA 3BG9A 3F1QA 2VXNA 3UNTA 3NG3A 1JZ3A 2H6RA 2NVCA 2DIJA 3AJ7A 3L12A 4O1DA 1Z41A 3PJTA 4AIUA 1DJQA 1KCLA 2GJRA 3ES8A 1SZRA 1IZCA 2GUYA 2XZ7A 1TZ7A 2Y88A 3DFSA 3QLLA 4IWWA 5IHSA 3UWQA 5T8GA 4XG1A 5KITA 1JYWA 2FLIA 1K4HA 2V6AA 3BC9A 4W4QA 2HISA 3DKJA 3VKKA 5I06A 2XIJA 4DWSD 1XCFA 5FF2A 2V2HA 4NX5A 3ANUA 5AOUA 3FS2A 1V02A 4ZA0A 3E2SA 3POHA 3M0ZA 1KD0A 4B3LA 3CC1A 3DH7A 3WLLA 1WXYA 3N3TA 1JDAA 1Q4WA 2WZMA 2REQB 1WZKA 2ZUNA 3M1ZA 5FJPA 3GXPA 2WLYA 1JZ6A 2Y2WA 4ASTA 3QKZA 3SGUA 3B4UA 1X8FA 3KBSA 1UUQA 3NUKA 4JOMA 2PFHA 4E6MA 2ADAA 2TYSA 1QW9A 1GTEA 4ZTYA 4H6KA 3A6OA 2YDSA 2JEQA 2WM0A 1LRTA 1LLZA 4C5ZA 3ATYA 3AZRA 1OIFA 1ITXA 3FGCB 4JFWA 3UA3A 3PZQA 1J96A 2PDLA 4JTIA 4BKNA 5M2FX 3QR0A 3W74A 3A24A 2NT0A 4LH8A 1ISVA 4W8AA 1EOMA 5FJJA 3PS7A 1S5VA 3SRHA 5CZSA 3PP7A 5FEXA 4NRSA 2WBKA 1FFRA 3OODA 2FPTA 2PDUA 3VM5A 3NSNA 5HQMA 2VT0A 4M7TA 3WLQA 3CMJA 2CBUA 2VX4A 5AC7A 1MRAA 3KCJA 2XH4A 3EX2A 3GU2A 3S2CA 1KR1A 3DFPA 5REQB 1HFBA 4PUJA 1LWIA 1UP2A 4KBXA 2GVEA 3UCQA 3FNDA 1XCXA 2IKJA 2WQPA 2EPNA 1H7XA 2V9DA 3KBVA 1X7IA 1DKWA 3HM7A 2VJXA 3G6LA 3TQKA 3NOEA 4REQB 1Y0EA 3BGGA 3OVGA 1JAKA 2IUZA 3ABOA 3MHUA 3T7VA 2J8GA 5FACA 2FB3A 5KINA 4LY8A 3CAVA 1E9LA 4IP7A 1E15A 4I9TA 2VCCA 1HP4A 3GHSA 2YL5A 3SQSA 2OVLA 5A6AA 4MJ4A 3WBXA 2CHNA 3H23A 4UTMA 4A3QA 1ADSA 2W62A 4O8RA 3CZJA 4HCHA 1XKJA 4NXKA 3TX9A 3NQDA 2HE5A 3W7NA 2VZTA 2GWNA 3MCOA 3L2LA 2WLZA 2JIWA 1U1JA 4KH2A 4UR7A 4QISA 1QRQA 3QV8A 3TMLA 4N6FA 3VNJA 1EB3A 3R79A 2ISVA 3TWAA 4MNMA 2NQ9A 3QY6A 3E0LA 4D6EA 2AQVA 3QZEA 4O11A 4J4KA 1YNYA 2E67A 3LTYA 4RE2A 4Q7NA 4IMEA 1XH2A 3WLHA 3L66A 5C9XA 4AZIA 1HJXA 1I4NA 3GZAA 5CPQA 3NQVA 2DSUA 3UWVA 3LZ5A 4W7UA 2EG6A 5CC5A 3U8GA 5G2WA 2JKEA 2OSYA 5HA7A 1OX6A 3N4FA 3BVJA 1TTJA 1Q2SA 1JFHA 1V6UA 2Y85A 2PI6A 3PANA 1EP2A 5XIAA 1R46A 5CSSA 5FCZA 4IIBA 2EPLX 1NOUA 4WJEA 1GONA 4INFA 3DENA 3PC0A 2DW6A 5CSYA 3QEZA 1GEQA 2VOMA 3IJ6A 3QR3A 4KIRA 1B5TA 1TX0A 2WWCA 1LOSA 4IX2A 4JD4A 1XKYA 2BFGA 4UC5A 4C6BA 3NL2A 4PFHA 2C16A 3MCNA 4LUSB 2INEA 3K30A 3G0UA 2Y62A 4TVDA 1NTHA 5BCAA 3TJ4A 1TPH1 3IPWA 3P6LA 1EXBA 4TVCA 4TTUA 4CQ9A 3RN6A 4KFPA 2R1KA 3RMJA 4K38A 4ACZB 1VJZA 2YDRA 1JI2A 3VMNA 1K70A 2OQLA 4HU4A 4S3FA 3VD5A 4TMBA 1CBGA 2C13A 4JL2A 3C86A 4QCFA 4M6UA 4GQ0A 3WL1A 2P50A 2QUTA 5F1UA 4M80A 3B8IA 4FOJA 3GO2A 4AD4A 1GHSA 5HJLA 3WNLA 2VEKA 2HBXA 1HTIA 5CGMA 5DBTA 1Z8AA 4DN1A 3RO8A 3VIFA 1UKPA 2BY1A 3BJTA 1EQPA 3WJSA 4NASA 4JR5A 5AC4A 3W53A 2O92A 3S2MA 5K3VA 1CZ1A 1FUYA 4JTDA 2TSYA 3T09A 3QLDA 3WLTA 1WDWA 3RYSA 4JFTA 5G2IA 4C65A 1JD7A 4M19A 4UTLA 4DWSA 5AKQA 2DP3A 2V5LA 4H19A 4C1KA 1KM3A 3TSBA 4PB3A 3S9IA 4GQBA 5LXEA 3CUIA 1UR3M 1CGWA 4GZEA 3WDIA 1E56A 1QWKA 4R7WA 2G96A 2YZ5A 3K46A 3PBVA 3KL5A 2PBOA 5I3FA 4XBSA 3IUDA 2EBNA 4N4PA 3DFHA 1SO5A 1F3TA 1T8XA 4KT2A 2WB5A 4UTHA 1VBGA 5C2XA 4ZQRA 1BQGA 1PHQA 1EYEA 2TMDA 5CEWA 5CJMA 3WMCA 5ENLA 3L9CA 1I2NA 3W1QA 3BJSA 1VAHA 2ZX6A 4K39A 3S5SA 1XLFA 5FAGA 2WJDA 3L5MA 2E25A 1CXKA 3M41A 3D3AA 3IARA 4S3KA 1O1HA 1OHLA 4Z1CA 1E5NA 3TN5A 2XGZA 2ZFAA 1CB2A 1IEXA 1P0DA 2EKGA 1MI3A 3CUHA 2VX5A 2O0TA 2VC9A 3NQBA 3R43A 1ZBKA 1VF8A 1XS2A 2Y5EA 3AISA 3UVIA 1BSIA 1HIZA 4M56A 1JUKA 1NWUA 3WQ8A 4E38A 1KXTA 2YCJA 2INZA 1XC6A 3WEZA 3MJMA 3R1ZA 1FCQA 1DHKA 4DM2A 1K7EA 2JQXA 4XZBA 5BWAA 2FIQA 1BTCA 1XLCA 2YL6A 4ERAA 4P8VA 4DLMA 3H4GA 4ADSA 4FP1A 2YDAA 2I14A 4XWUA 4MGGA 4O17A 1Z89A 1LBMA 4MB3A 1GQLA 1QNVA 1KQZA 3APGA 4HN8A 4ECLA 1F8MA 5I3HA 4O16A 1AD4A 4KRZA 1EA9C 2QGHA 1E6NA 3BQ5A 4LTSA 4WKFA 1NY1A 2CLLA 4CQAA 1XLAA 3B8VA 4UMAA 3IGXA 4JNMA 3KOXA 3AWOA 3L5AA 1VB9A 3K4WA 3O9NA 1QHPA 4LAZA 2BOGX 4EF9A 3W02A 2YCLB 1KRAC 4E4UA 2DJLA 3STFA 3D47A 4E4PA 4REQA 4OV4A 2HSAA 5EY5A 1RR2A 2I1OA 3WK3A 3LHYA 4MPQA 3O0KA 2H8XA 3V1PA 4AZBA 3KX6A 1YTEA 1XBVA 4FPSA 2B7OA 3O6DA 3AZTA 4HZ7A 2QUMA 3GTNA 3UWZA 1Q85A 5AHNA 2J7GA 3INPA 4KERA 4U5IA 1E3ZA 3T4WA 5DN1A 3GM8A 2VI0A 3ATZA 5CH9A 4G7EA 3PB0A 4XZHA 1AW1A 3F4VA 2AKMA 3W85A 3IK2A 4FLSA 2EEXA 4LB4A 1GQNA 4GY1A 4GUGA 3NWRA 2CZFA 3TC7A 3VCRA 3A3XA 1QNRA 2WVTA 1P1MA 2PWFA 4S3EA 4H1ZA 3PUDA 1OY0A 3CYJA 5LNSA 3PTKA 4IUOA 2J25A 6XIAA 2Q8XA 2X40A 1OC7A 4L56A 3U7VA 4LUTB 4NZ5A 5AHFA 2HQAA 2EQDA 1EEXA 1Z7AA 1XP3A 5EPDA 1XYFA 4YVVA 1EZWA 1D2KA 4DIAA 4F4RA 1AQMA 4WSJA 3T44A 2Y7EA 1O60A 3M4HA 2Z2AA 8XIMA 4DZAA 3KDNA 2BMBA 5EKYA 3GHTA 3W72A 4LWWA 4I5UA 2XVLA 3PWIA 5T9CE 3UG4A 1E6XM 1ICQA 2QF7A 3JVAA 4TUFA 1XQLA 1E0XA 3GK0A 3W24A 5DT5A 1OCNA 1WBJA 3WCZA 2A3AA 3WD4A 1BPLB 3OHIA 1A5BA 4J5NA 4AUBA 3COTA 4NVTA 1B54A 1O94A 4GI6A 5EFFA 1ZGDA 3W28A 4ZXOA 3ITOA 4V15A 2QCNA 2X41A 2EHHA 3HPXA 3KS6A 4NF7A 1A53A 2B7QA 3MHFA 5C9ZA 3NJ3A 2CEQA 1AH4A 3ZSSA 2VD8A 1RJRA 3KFTA 3IJ7A 4NNCA 1C90A 3MZNA 8CGTA 3EZ4A 2QDEA 4IHCA 2WW5A 4S1FA 3C2OA 3NPUA 4ACZA 3GTXA 3L4ZA 4WK9A 4B5UA 3W00A 3TTQA 1DEDA 3UP8A 5C70A 1C8QA 3NFUA 4OJYA 1Y5VA 3W7JA 4GYKA 5FJUA 5C9RA 3ABSA 1D7FA 5FF7A 4R88A 3WQOA 8TIMA 3A4XA 3CV1A 3TW6A 2FFCA 5HINA 4S39A 2J75A 2B7NA 3CT7A 2KZHA 4PTXA 3STEA 5U4NA 1J2WA 3IV8A 4D72A 3F03K 5LNRA 2XSAA 2VCAA 4KCTA 3PNUA 4MUPA 4YWIA 4WY0A 4HVXA 4HKPA 3BAYA 3BMXA 4JX5A 1QPNA 4PSPA 4PMUA 1K3UA 4QE1A 2A79A 1G94A 1JCLA 3FDGA 1POJA 4PR4A 1RUSA 4JNZA 4HQVA 3RILA 4QS5A 3AZSA 1ICSA 4J1OA 3GDRA 2E28A 4FA3A 3K8KA 3S1GA 1W1VA 5HANA 4RCXA 1R2TA 1E9ZB 2D69A 2WMGA 2RAGA 4MFEA 1TWIA 1OYAA 2AQWA 2CC0A 1J10A 2Z1SA 3GXIA 2YL9A 1J8VA 4JIHA 1O4UA 3TFXA 3CPUA 1NEYA 1YTKA 4Q3MA 1U5HA 3LN3A 1PZ0A 3BPWA 2JFEX 3WD1A 2D20A 1BYDA 1YQ2A 5D32A 4UMBA 3GQYA 1SQ7A 5E0FA 1UR4A 2ZRWA 4O1AA 3AIBA 5E93A 2ISDA 3KBMA 2OT0A 4MY9A 5C54A 4W88A 2WNQA 5BXTA 1RQHA 3KM8A 4GFSA 4ZE5A 3EX1A 2P3ZA 3H2MA 1XIHA 1PZ1A 1TR9A 3EDDA 1GTHA 4DM1A 5D4YA 1Q7QA 2RUSA 2GJPA 3N13A 3CV7A 2YBTA 4I7UA 2CIPA 4US5D 3VD7A 5A6KA 4UOQA 4OBSA 2PDMA 1HO4A 3JR2A 2YB1A 3I7RA 4R5EA 1ISXA 1HJWA 2UY4A 2UY5A 1TCMA 3N1AA 4XQ6A 5FESA 1TIMA 4PMOA 1OFRA 8RUCA 2E6YA 5EBAA 3EA3A 1Z42A 3KBJA 4P7QA 1UA3A 1BGAA 3P93A 3M64A 3T78A 3O6CA 3I3BA 4JYEA 2DVXA 1TUXA 1VYSX 2IPFA 4ACYA 1UA7A 2TRSA 4RE0A 1PX4A 3TYUA 1M1BA 1W31A 4RL3A 4GHRA 5TAOA 1KM5A 2BVWA 3MO7A 4QJ3B 4S2BA 5BROA 2ZTJA 3L0KA 4AWUA 3BH4A 4L64A 3OVRA 4IFKA 1XYZA 3VABA 3PG9A 3TA9A 4BR1A 4X0VA 2XFFA 1M68A 1GVQA 5IRPA 3ZYZA 2FPVA 4DWDA 3I6EA 2VD9A 3WQEA 1WUFA 5T26A 3EB4A 2PD5A 3AUJA 1VCVA 1GQKA 2D0GA 3E6EA 3SJNA 2R24A 4BQ4A 2E5CA 4UR9A 1CYGA 2FDSA 1OZQA 2C19A 3UWWA 2I9UA 3VDBA 2NVDA 4UBPC 2YCLA 1FCVA 1SJCA 1YDOA 3MUIA 2E9LA 1MDLA 1OCBA 3EA2A 5DLCA 3BSHA 5DY2A 5IDIA 2NWRA 1I1WA 3L2IA 4A05A 4N0RA 2R1NA 3I3EA 4E2DA 1XLBA 3SURA 4IMDA 1DV7A 2F6UA 4KCVA 3QC3A 3G0SA 4R33A 2YPIA 2V67A 3WY1A 4AYSA 5EIYB 2RDXA 3AS1A 2X7WA 5D33A 2GGJA 1A80A 3KTCA 3PAOA 3IIVA 3OBKA 4B2DD 2NSXA 2PDBA 2V5KA 1E1CB 3V0TA 1J4EA 4GVHA 3TA6A 5D02A 4KFOA 2G95A 3AI0A 3VUSA 1UD6A 1I45A 4ES4A 1KFLA 1PTDA 2E6FA 5AFDA 3W71A 3AWNA 4E4FA 1J2BA 3WUBA 1P1XA 4Q33A 2GGIA 1X6NA 3WLIA 1E6PA 4GQRA 4G7FA 4AXKA 1PL9A 1W5QA 4TX9A 3KHJA 1Q6LA 3ABRA 3CAQA 4JYDA 3VO0A 4NYYA 4F0SA 3VU2A 3XINA 2C79A 4LYRA 1OQFA 3FY1A 3UBPC 4FF7A 3VZXA 5G4WA 4PMQA 5IBXA 1TPEA 1KKRA 3P7YA 4NZFA 3UPMA 3QN3A 4GACA 3S6TA 3UJ2A 3O06A 1DE5A 4IG2B 1F8IA 3ZVIA 1SO6A 3OLGA 4A8NA 4CNUA 3GC5A 2X1TA 1MUCA 2OR2A 1A5CA 3B05A 1OGSA 4UNIA 1W3KA 3E74A 4Q32A 5CJ5A 2ZC1A 3CASA 4EPBC 1KCKA 3PFMA 3H24A 4N02A 3LCIA 3KVMA 3WJZA 5BOOA 3MDUA 4WXZA 4PH6A 2PA6A 2Y8VA 5HR6A 2PDYA 3THDA 4ZCWA 3QPEA 1KFEA 1ONWA 1E0VA 4NSBA 4IL2A 4ZFMA 2XVKA 1V6XA 2F7FA 4HNNA 4RPQA 3G1DA 3CBWA 3PY2A 2GUBA 5DRIA 4AVOA 1W6TA 3CL8A 3DC0A 3RLVA 3P8JA 2VVSA 1RPKA 3MP3A 3OYZA 3GTIA 3WENA 3MHGA 1QAPA 3CU2A 2VR5A 5GPRA 3PUEA 1XLJA 4HNCA 3SCSA 4S3JA 3A13A 4NAEB 3RCYA 1PZ3A 2WO5A 2W66A 4CQDA 3S9YA 3VD3A 4B5TA 3DDMA 2X0SA 1GK8A 4W7VA 4Z2HA 1KBKA 2PGWA 1K7FA 2ZUUA 4WKAA 1UIOA 1B3OA 4NZCA 4PUWA 4L4LA 5E5CA 4F3HA 3PF3A 3VNIA 4Z17A 4GUJA 2V38A 4QSHA 3C0LA 4Z0JA 3L4WA 4S3GA 3AAMA 1GW9A 2HDJA 4HA3A 1VHNA 4L1WA 2QDGA 3XISA 2XN1A 1I75A 2I9EA 1O95A 4LUJA 3GX9A 4N6EA 2D2OA 6REQA 3NEHA 1ZSXA 4IGMA 5CBJA 2ZZ6A 5IOBA 3DYMA 3LBCA 1C8YA 1J5SA 2AOSA 1V7AA 3GD6A 4WJ8A 3P14A 3DECA 4B9ZA 3CGTA 1QK2A 1QFEA 2OMAA 1JULA 4HPJA 5C71A 4DXXA 4P7LA 2PTDA 4PL2A 2EPMX 3TROA 5I3KA 2XU2A 4QBXA 2VZOA 3LZ3A 1KGUA 3HA1A 3RRAA 1A4MA 3G3MA 1IWPA 3WK0A 3EMQA 3OVPA 4US5A 1NF0A 3NCOA 2VRJA 1T40A 5MKGB 4CCCA 3SQMA 4ZB2A 2OZ3A 3VMPA 1MWOA 1A5AA 2Q01A 4JIRA 3TVAA 4QE5A 1BYAA 3UQNA 2G3FA 1L6GA 3HG2A 4ZOAA 3C3UA 2ODOA 4OVXA 3B9EA 3WQDA 4H2CA 1TELA 2VRKA 4O53A 2EPOA 3BWWA 1OX4A 4DJEC 3FA5A 4W7WA 1QI2A 2Q09A 3E38A 1A5KC 5A8QA 1SMAA 1DE6A 4RZ5A 3PUOA 4BQ3A 3GXMA 3N18A 5FSEC 4E8DA 3W23A 1QI0A 2YA1A 2XN2A 3O3RA 2IS7A 2QS8A 3CUFA 4KFNA 3G1VA 2XIBA 1DVJA 3IRSA 2VL4A 3KE0A 1G4SA 5FAJA 3KW3A 3F2CA 2GWGA 1WOAA 3ARVA 3QVQA 3EPNA 4P7NA 1RK6A 2W9MA 3M0MA 4FS9A 4O1BA 3WBYA 1XBZA 2DUAA 4FOKA 1PIFA 4XV0A 2GPTA 4IZGA 3NA8A 1C92A 1W5OA 4KMQA 5D2VA 1EC7A 1I2PA 3MSYA 4PMJA 1KM6A 2QPSA 2A85A 1O6IA 3MY9A 4CCEA 2QCEA 1ONXA 1VPXA 3KUMA 1LRNA 4U3CA 3W2LA 1H41A 1M7XA 2X2YA 3AMDA 3AIWA 2WCGA 4Z2LA 5I09A 3A5VA 3CL6A 4LYPA 4MJZA 3MI6A 1AZ2A 5B7YA 2XHYA 3VKCA 5FD0A 4FLOA 4TQTA 5EGRA 3RO6A 5F4WA 5K2ZA 3R8RA 1H1NA 4ZGYA 4QLJA 1VFSA 3GG8A 3NQEA 4JCMA 3GWQA 3MUAA 1TZ9A 4BEUA 4QXIA 4W5UA 3E02A 3MMUA 4JQ1A 1WDPA 1LOQA 2AQOA 2EG7A 3LCFA 4NNAA 1YXDA 3S83A 1KLYA 4O4VA 1R38A 2HPIA 3ZM8A 4B2DA 5C8BB 3S1WA 4CN4A 3SN4A 4KGJA 4U33A 1ISZA 1MXGA 3E0WA 4JQ2A 4I3GA 3GIQA 1FA2A 1NELA 3UR2A 4IPPA 5LHFA 4NYUA 4FO4A 2QVHA 4NHVA 2F8QA 1IHIA 3DXIA 2WVSA 2DV0A 4HPHA 5CC7A 3NGFA 1R47A 4D2JA 4D8AA 2OLSA 4HK5A 2NVAA 3BAIA 1GOMA 1VHCA 3ZWTA 2O4QA 1XINA 3TWBA 3WSUA 1FTXA 3A9IA 3OB8A 3W6LA 3W2JA 5ABTA 2CU0A 3ANVA 3LV6A 2YCIX 3HFYA 4L1GA 1XC4A 1OGBA 1TRDA 5J5RA 4EIVA 2PTYA 3LPOA 4RNHA 3ZFHA 1KM1A 1TPWA 3PUGA 3W7PA 1SPQA 4QNWA 1R7OA 2PF8A 2PS2A 4F2UA 3LSBA 4QJ5B 3BMVA 1W1PA 4XTIA 1OYCA 3SUTA 1FP8A 1TV8A 1IE7C 4IX0A 1HUVA 3QOKA 4KEVA 2VQUA 4Q4RA 2VR2A 3PJXA 2J7FA 5HUPA 6CGTA 1JZ4A 1ZNNA 1UH3A 2DSWA 1ADOA 3KBNA 2YFOA 2E6AA 4U3AA 3GFXA 4JHMA 1WDSA 4NILA 5I3IA 3QF0A 4GZIA 1X96A 1GNXA 3QV7A 4Y9AA 1OT1A 5BU9A 3W81A 3VAVA 3WBWA 4AX7A 4Y9NA 4WKHA 1XYLA 4V27A 3CB3A 5AHMA 1JNDA 1EP3A 1XSIA 3FAXA 4TXEA 4K2SA 2Q3OA 4WOZA 4MYXA 1SZGA 2DT1A 3NM1A 4UUIA 3E2RA 1AL8A 1EQCA 3WN6A 1J0JA 1WZMA 2VC7A 3WNMA 1HKMA 4ML4A 4QM1A 1VBJA 1UW9A 2QCDB 3K1DA 1RA0A 5J04A 5E6YA 3G18A 2ZZ3A 1QMLA 3LB0A 1R30A 3C2FA 1TFVA 4CGTA 3HJZA 5A6JA 3AXHA 3WQWA 3N04A 4X2RA 5U7SA 4CN1A 4NRRA 5AC8A 5KZEA 3ITXA 5D8ZA 4FAMA 1Q6DA 3U7BA 1O5XA 1ZRQA 4XBJA 4RDVA 3O6AA 1WAWA 1JPKA 4J35A 1VCFA 2ZVIA 1B3ZA 4PBEA 1PWLA 2Q02A 3PZTA 3U9IA 4HB7A 1XR2A 2PWVA 3E49A 2INFA 4GC3A 2ZTKA 4GPNA 1WP6A 1QTWA 1TPUA 2R8WA 4J2PA 3WD2A 1VBHA 2O9OA 4KWOA 4POCA 2DZWA 4GKTA 3O7UA 2EPKX 4YMZA 5FEZA 5EJZB 2ALDA 4PB5A 5G5IA 3T05A 4O50A 4ZO7A 1Z3NA 3LYEA 1JVNA 2ZICA 2OT1A 3RU6A 1GKQA 3MCMA 4HTYA 3HN3A 4FXJA 2DSZA 2A3HA 1UIPA 4GJ1A 1YNPA 3ARSA 2OYMA 1HKVA 3C2EA 4JGDA 3F2DA 4FHAA 3TR9A 4NZ4A 1ZAJA 4DVOA 2UY2A 3UG8A 2YYUA 1E71M 1CEOA 1XRFA 4ZL1A 2UBPC 3W84A 3FSUA 3IJ9A 5LNWA 3W1MA 4IQJA 4CEXC 4C1LA 1Q6OA 2J88A 4MHBA 5F2MA 1UB3A 1OABA 3F4WA 3QRHA 3LNMA 5JQ9A 1RH9A 1UHVA 4KWSA 3THCA 5C9WA 1XDMA 4IMCA 3VC6A 1TG7A 3L4YA 1OVDA 4IGHA 2EGZA 3I3DA 2CERA 1TTIA 4JTFA 3A64A 1XWYA 2JBMA 2Y7FA 3L0NA 1FWTA 4Q7IA 3MQTA 1WOBA 5LNUA 2WYSA 3EBVA 3TU9A 1E51A 1R3QA 4WXYA 4JBRA 4LVBA 3H2FA 1US2A 1MVYA 3GG0A 2PDCA 4EKJA 1RVGA 3GBEA 1NP2A 4I9JA 1CX9A 3KP1A 4ATDA 3U5UA 3QMTA 2KX9A 3KTSA 1R3RA 2FJKA 2E9BA 3LBOA 4HYWA 1KV5A 3KL3A 3QTPA 4QRNA 3GC4A 1XUUA 3QOMA 1K6AA 2AKZA 2BOFX 2VFEA 3QV9A 2J79A 1RBAA 3GDMA 3I7QA 3G1SA 3W25A 1BSLA 2WVVB 2WPGA 5GQBA 1XLLA 1B9ZA 2Q71A 3SCQA 4DQWA 2H9AB 1E4NA 3GR8A 2ZC8A 2G3MA 4TVUA 3I4EA 5IHRA 1J0ZA 4QSFA 3IJQA 4C6NA 5E6ZA 3AYTA 4HOWA 4L5ZA 4KEUA 3AXMA 4PTNA 3A22A 2OXNA 1J12A 3MWAA 3IJ8A 5FSDC 3BZGA 3MTWA 3TH6A 1UKSA 4AIBA 3K13A 3WUGA 3W7LA 5CZJA 1XIMA 3NPWA 3UW6A 3S8HA 4HZMA 4F9DA 1DJGA 1DJIA 1FCBA 1XX1A 1VFMA 3NL6A 2XGBA 3W73A 2E6DA 2P0OA 1VC4A 2FH6A 4GQQA 3UR8A 1GKRA 3QH2A 1B4EA 5A8OA 5A2BA 4DUWA 3R58A 1NARA 3FN9A 1D7KA 3L23A 1L8PA 3DESA 4YS1A 4XD6A 1XG3A 5BMWA 2G0WA 2BP1A 1PS9A 5B80A 3WDHA 5IM51 1T99A 2QHAA 1KFKA 3G1HA 3IRDA 4AQLA 3JS3A 3AHTA 4GUIA 1KGWA 4F0HA 4JHOA 2GDVA 1EIXA 2VM8A 4BWLA 4DI8A 2QJIA 2F84A 3QYSA 1Z69A 2GLKA 3TN6A 1PUDA 1M65A 3S1XA 2AGKA 4IMAA 3GVGA 2Y70A 3V5OA 2QJMA 4NNBA 3C61A 2E40A 3N6JA 3PZUA 4PRTA 1VBRA 3KZPA 2CLHA 1V08A 3NQ8A 4AYGA 1RD5A 5LIXX 5DMLA 3OYXA 1X98A 2Q8ZA 3S42A 1Q8JA 3ZVHA 1CTNA 4NKCA 3UXIA 4JKMA 4B91A 4KIEA 1IWAA 1BKHA 1S5WA 4U5KA 3VM7A 1J6PA 4O52A 4O13A 2X8RA 3UJSA 5M3WA 2D1ZA 3T40A 5ECVA 3QC0A 4AZ7A 2EKCA 4JFUA 1CXHA 3F7JA 4YVXA 3P81A 2FGZA 3EX3A 1H7RA 1MMFA 2EXOA 4IIEA 3TSDA 4LALA 3B3DA 3SADA 1XIBA 4D1JA 1C7TA 4PRRA 7XIMA 4IQDA 3MP5A 5C5YA 4OZOA 2ZYFA 3BLIA 3CQJA 3GR7A 2W27A 2DDXA 5H1WA 3QBUA 4HPXA 2PRHA 2ONEA 3S6DA 4HSNA 4NAFB 4Q4OA 4DBUA 1T7LA 3QQ1A 3DFQA 2OEMA 3GSMA 3MMTA 3D3FA 3L68A 4OBTA 4ZOBA 1P6WA 3QV6A 4CNTA 5A2AA 2IQ0A 2FZMA 3R7MA 4TO8A 4W8LA 1WDRA 5LSMA 3LXAA 1B30A 4UWMA 2LLEA 4GD0A 4HMCA 3DHUA 4N9DA 1G0CA 2XFWA 3RRXA 3EWWA 2BHZA 3RJYA 1EHNA 2ZZ7A 5LIWX 4LBRA 3LQLA 1TE1A 1AZ1A 2PWHA 4AZCB 1ALDA 4A8IA 2ZXAA 3T0AA 4K7VA 1W17A 2YBUA 4BQ5A 3SCVA 2FMOA 1K1DA 1RBLA 1MEWA 3VI2A 2QCDA 2ZX5A 1JZ2A 3NQMA 4UTWC 3E0IA 3FK4A 3BAXA 1FWDC 3AROA 1K77A 1PO9A 2MNRA 4GCAA 3MUCA 3LY0A 2VDHA 2EO7A 1XDLA 4UTIA 2R1LA 1KQYA 3BLOA 3TEVA 3CHCA 3AXKA 5A6TC 1E72M 1N8IA 3ZS4A 3EOSA 3OIHA 4ZO6A 1ELSA 2JEPA 1YW1A 8XIAA 1SZFA 1S3HA 4ZSUA 1KXQA 3B9NA 3AIQA 4BY3A 4IQEA 5AYYA 4XAYA 1YRRA 1W0MA 5CPSA 1OG6A 3IV3A 4EACA 3CQKA 1OZMA 3CNYA 2G5WA 3DFOA 3QHMA 2XSXA 3IUIA 1WUEA 4P5UA 1SFSA 3VDGA 2MANA 2OO0A 3MB9A 1IYXA 5DCBA 2ZZ1A 3GNOA 3EWDA 3GFZA 1RBOB 3KRUA 1V7YA 4KEZA 4O1FA 3P0WA 3DHFA 3MSGA 3QGAC 3H53A 4X22A 4TR9A 1MSSA 1SZEA 1A3WA 1OYBA 4PCPA 2D23A 1LLOA 4MZ8A 4JN7A 1PTAA 1RVKA 2WNWA 4BF9A 3N2OA 4L4OA 2V5DA 1IZJA 5A3HA 3SJ3A 4DELA 5FF3A 1OFPA 1MUMA 1A49A 2I5QA 3W2KA 1TVLA 3OLEA 3MBFA 4TMCA 2AL2A 1OT2A 5HQEA 4R85A 4XKMA 5A8MA 4UQEA 4RXFA 1VZWA 1EJVC 3DBPA 4MYAA 3W7QA 3TTSA 4F66A 4UFIA 2FZBA 4FNPA 1NWSA 4JL1A 3IACA 2C1HA 4PMDA 3JZUA 4XSMA 1PV8A 3MU7A 2Y4SA 2EJAA 5DMYA 4I5RA 3M44A 4F2BA 1RHCA 3P67A 3N2XA 1QASA 4BI6A 1XUZA 3PBYA 3BOXA 3UPBA 3POCA 2BX7A 4RZBA 5LXXA 3MYPA 3IUHA 3OZYA 1U2YA 1W1ZA 2WJZA 4WHBA 1QBBA 3OZOA 2PD9A 1C91A 2DEPA 1IT7A 1XV8A 4XB3A 2OSWA 3SCNA 3EPOA 2QZRA 1XD0A 1SSDA 4JN6A 2O55A 2ESCA 4LT9A 4OT7A 1JRBA 1M5WA 3REQA 4F0RA 3GXFA 1TJRA 5CPNA 4L1XA 3VZZA 3N25A 5D2TA 4KCUA 4G56A 3WF0A 1W8GA 1Q6CA 4YCOA 3AIEA 1DL3A 2VWTA 1GOQA 5BZAA 4LCQA 3DZ1A 7ENLA 1H3GA 1W1YA 1L8NA 1P48A 3B8TA 1FH9A 3W86A 2QCHA 2ZCGA 4MMWA 4QROA 3PTMA 4BQ2A 1W3HA 3OG3A 3VOCA 3W2NA 4CEUC 3NSXA 1NSJA 3I4KA 4AD2A 1A0CA 1H1YA 3SFWA 4CD7A 2VMFA 4FXFA 2R1PA 1EYWA 4YVPA 4FX6M 2J78A 3M0KA 1XI3A 3NZQA 1E40A 3BDKA 4DXVA 1OF8A 1PEZA 3RLGA 4YTSA 2FTWA 5C7HA 3Q37A 4XUGA 3PBGA 5I24A 1JQVA 2VELA 1CWYA 1J93A 1KKOA 3BICA 1V6TA 4QQ3A 4KWUA 3UR7A 2JIEA 7PTDA 4B9YA 4HT3A 1CXEA 1TPB1 1ZJIA 2NX1A 1FWJC 3DG3A 3TJLA 4X61A 4DBWA 1RK5A 3RR4A 3GFYA 1TWSA 1J0HA 2OOFA 3HO8A 3ANYA 4BZYA 2WKGA 5AYIA 1EJTC 1RY8A 2PDJA 1KBIA 1CCWB 3OA3A 2WM1A 3W2UA 2R9RA 3H2EA 1BXNA 5HULA 2VFHA 4AMCA 2QV5A 3MV01 2CKRA 4AWTA 4AF0B 5C2CA 4GISA 3HPZA 4XD3A 3IJIA 1J6OA 4H9UA 1KA9F 3N15A 4XD4A 3ID7A 4FR1A 2QUVA 1EX1A 4K37A 1QI3A 2ZX9A 1ZALA 5H2ZA 3A4AA 2CZEA 3MPGA 4HMEA 4LVFA 1XHGA 1U30A 4WJXA 2ZZ5A 3OJGA 1W37A 4IL0A 5AY7A 2CXEA 4Y96A 2W79A 3EWUA 3LG3A 2OSXA 1LP6A 1TJ0A 4ZODA 1PIIA 3T1GA 2Z25A 4OQVA 5I5RA 1L6YA 5K9CA 1QU4A 2QJGA 2ACRA 4L9YA 1X7FA 5GNXA 1JYXA 3LQGA 4C6CA 3TKFA 4MWAC 1OWQA 4GI4A 4PTDA 4IXHA 1KBBA 3CHEA 3UVAA 3GIYA 3KRBA 4GX9A 4XO7A 1YBQA 1NF7A 3SFKA 2GOKA 4BF7A 4HA1A 2OLHA 2WC3A 4AY8A 4WSKA 1XQKA 1P0EA 3PZNA 5HJYA 3ARQA 7CGTA 4IFRA 3WJYA 1UKTA 2PLKA 1DJHA 3W87A 1C8VA 3OU8A 3TZFA 6XIMA 2UWFA 1Q8AA 4DYKA 4DB7A 4MZ1A 1CENA 3CUZA 4GINA 1J79A 1RJPA 3E5PA 4AIEA 1GG0A 1NFGA 2UZ9A 3KVLA 2ZDSA 4DJFC 1W9UA 4E5TA 1IIHA 2PDFA 5JH2A 3R2GA 4DUXA 3G1AA 1CXFA 3HG5A 1GZ1A 2I57A 4YHGA 4FNTA 3RF9A 3W27A 4EPEC 1GWJA 3AJXA 3ALGA 1LRQA 4R9OA 3OZPA 2QEZA 4FX7A 4QIUA 5G1YA 3SN0A 3CB8A 5I0DA 2Z6JA 4XVDA 1WYIA 1FCUA 4DO5A 1AK5A 4H6EA 1QHOA 3FW6A 1J0KA 1WDQA 3AS0A 5BXRA 4YWSA 3AU2A 4KQNA 5DELA 5JH1A 2XUCA 2C7FA 1KFCA 4L4MA 4LS0A 5K4ZA 4GBUA 3C2YA 4M8UA 2RH9A 3CIVA 2XM1A 4E2BA 3QY8A 1R6WA 1K03A 3W7IA 3CXOA 4W89A 4FNSA 3W22A 4CD4A 3KXQA 2GZXA 2QLYA 1JGMA 2X30A 1Z32X 1VRXA 4GMEA 2R6OA 1JDEA 2OQYA