2GK1A

X-ray crystal structure of ngt-bound hexa
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
total genus 8
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1A02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1A01
1H3GA 3N17A 2E9LA 1ZBWA 1LG2A 3L4XA 3W24A 2RGLA 3CZKA 4TXEA 5GNXA 3MUIA 5JUVA 3WNKA 3OG2A 3CZJA 5CSYA 2WZIA 1VEPA 2AMGA 1MFVA 1JGIA 4GZJA 3PTMA 4FK9A 4EANA 1G1YA 4UFHA 4F9JA 1FP8A 2HVMA 1B90A 1Y7VA 2F61A 4EKJA 4AZIA 1AQHA 1WZAA 3VINA 4H7VA 3WH8A 1TFVA 4D71A 3K4AA 1B3ZA 3OBAA 5D9NA 4DM1A 1U2YA 1HJXA 2O92A 1Z32X 1G94A 2VTFA 3CMGA 2OSWA 3W28A 1HP5A 4UZUA 3W27A 2X2YA 3CHFA 1V3HA 2WHLA 2Y5EA 3FHAA 4V28A 3DYPA 1GHSA 4ZXOA 3W0KA 3T08A 1B2YA 4HMCA 3EDDA 1UZ4A 2DH3A 2AAAA 2CIPA 2VMFA 1OT2A 4LYQA 4D6HA 4Y7EA 4HP5A 2GSJA 3VIFA 5A69A 1W91A 3NJ3A 2GJRA 2BY1A 1CYGA 1N82A 3VGBA 1GQJA 2EBNA 3VTRA 2CXGA 4S3JA 4C7GA 4AD1A 1EXPA 3L2LA 4JKLA 1MWOA 2NT0A 1UQZA 4X0NA 2GUYA 2VL4A 1FHDA 4PMVA 8A3HA 4WSJA 3BLPX 3OA5A 3UG5A 1C90A 4QAWA 1V03A 4GIAA 3ZOAA 2DIEA 4GZEA 1E43A 3APGA 2PWHA 1QNPA 1JYXA 4Z2GA 7A3HA 5DFAA 3ZM8A 3ZJ8A 1JZ8A 2WC3A 4CD8A 1CXHA 3DHPA 1BAGA 1QI0A 4JAWA 1BG9A 1OCQA 2VVNA 2GJXA 1WCGA 1UD3A 3CHDA 3THCA 3AIUA 2DSVA 1V6XA 1PZ3A 3QHMA 1LQ0A 4RL3A 5GNYA 2Y24A 4PMRA 3A47A 4LXFA 3DYMA 4J3VA 1Q6DA 2WMJA 4AEFA 3F5JA 4N42A 3CZGA 4D1JA 4E2OA 3SURA 2WBGA 7TAAA 1JZ2A 3B9EA 1FFQA 1HKIA 3W4RA 2VRKA 2CHNA 1V6YA 3WKZA 5A6SA 1E6NA 1UD6A 4PYSA 5FL1A 4MAVA 4UCFA 1I1XA 4CCDA 3NSXA 2BXZA 2ZUUA 3AICA 1GQIA 4LQ1A 5KZ6A 1BGAA 3VNZA 3NUKA 3L4ZA 3WL0A 5BRQA 2BHZA 3WH7A 1HJQA 3VD9A 1D7FA 3W37A 4HTYA 2G3JA 3ZIZA 2FHCA 4FLSA 5I5RA 1H0GA 3VD3A 1LL4A 1GHRA 1HKJA 3LPFA 1E1EA 1CLXA 2C8NA 3JUGA 4W7WA 1OWQA 3WQ6A 3AIBA 3N15A 3UG4A 2FDMA 4U31A 1QHOA 3CZLA 1B1YA 1NP2A 5A8QA 2VQTA 1HJVA 5CXPA 1VIWA 1QHPA 1VAHA 4OUEA 2ZUVA 1K9TA 3PZTA 2WC7A 2F8QA 4ZE4A 4UOZA 4UR9A 3VGEA 1W3KA 5AYBA 1BG4A 5ABEA 1VRXA 1R8LA 3EDKA 4JFTA 2DQXA 1OGSA 1B3YA 1GOWA 5A6LA 5LYRA 2EQDA 3DC0A 5A3HA 5CGTA 3N11A 2W62A 4ZE5A 1OGGA 2EO7A 5I78A 4PMUA 4QP0A 3AMGA 4J3UA 1WAWA 1M01A 5GNZA 2WBKA 1IZKA 1J0YA 1CLVA 5CG0A 3KL0A 2D1ZA 3VD5A 5M17A 5CSUA 2C0HA 2D0GA 2EPMX 2E9MA 4XX6A 3VUPA 1W9VA 5A2CA 2WKLA 3VD4A 2FHFA 5A8MA 4ML4A 2ZUTA 4GO8A 4B3KA 4CKQA 1HIZA 4JFSA 4TX8A 5FKYA 3ARRA 1UH4A 4GQQA 1L8NA 1NWUA 2XVKA 2JFEX 1BVZA 1DWFM 2ZX9A 2PBOA 3QHNA 3IAPA 2XWEA 3OIHA 3T0DA 2HISA 3VM5A 2XHYA 4P7NA 4E8DA 1NWTA 3T09A 4HU0A 4GPNA 4JCLA 2QMKA 3ARZA 3PZMA 3ARWA 1QW8A 1V0LA 1C8QA 4X9YA 1OSEA 3UETA 1E9LA 4AZ5A 3KE0A 2J74A 2WHMA 1MW3A 3PZIA 3WDPP 1K6AA 1B31A 1UKQA 1CNVA 4WIWA 3TP4A 4ZFMA 4A3YA 2OLHA 3ARQA 3EBVA 1BGGA 3AHVA 3W6LA 1E4IA 3SCVA 2BNJA 3K8MA 2NT1A 4D6EA 4GQRA 2DDXA 5A94A 1JI2A 4AZGA 3CUFA 4MNLA 3MMDA 3AIQA 5CLTA 2ZWYA 5CPTA 3U7BA 2VR5A 2XJ7A 2WANA 4W93A 4J3SA 1RP9A 1CGTA 1GW1A 1NM9A 3BC9A 1TG7A 4OBSA 3WBEA 2YL5A 3GDBA 4CN6A 1XHGA 5A2BA 3ZT6A 1TE1A 1E72M 2J7DA 1MW0A 4BA0A 4M1RA 4P7OA 2BY3A 3AMDA 1ISYA 2WC4A 5DT5A 1HL8A 2BV9A 2FGLA 3WELA 1TZ7A 1MFUA 4RE3A 3SUWA 4J3WA 3TOPA 4AZCB 3FXYA 5E70A 2W92A 4UTFA 1C3FA 1E4MM 3BSGA 3GH7A 5A1AA 1J18A 1W9UA 4EE9A 3ALFA 3RPMA 1GQLA 3WSUA 1ISXA 1IZJA 1TA3B 4PMDA 3VGDA 4B3LA 3BAWA 4NF7A 4MTVA 1JFHA 4AZHA 4CU8A 4DUVA 1K9DA 2OYKA 4ZEPA 1JD9A 3EDEA 4DUXA 1G0CA 3W29A 3AYRA 3VX1A 2XVNA 3EMCA 3RDKA 4NZCA 5D4YA 3ZT7A 2J7EA 4PTMA 1UWTA 2JEPA 2J7HA 1GNXA 3O2LA 3VMPA 1TCMA 2WVTA 3CLWA 1GVYA 4MNMA 4AIOA 1BPLB 2BXYA 2PWDA 3EMZA 1UR8A 1QOXA 4M24A 3VGGA 3RJYA 1MVYA 3AZTA 3VVGA 2UY2A 5D8ZA 3VDAA 1JL8A 1C91A 1V3IA 2D3LA 2VX4A 4D1IA 1ZL1A 2QF8A 1U33A 3AHZA 1UR0A 3FHQA 1GUVA 4CU6A 3SUUA 4KWUA 1J0HA 2WCAA 3N04A 2ZX6A 3MUY1 2EPLX 1KWGA 3FNDA 2J62A 3RMEA 1PIGA 4AIUA 3VDBA 1E4NA 3K1DA 3L4TA 4NSBA 3N12A 1Q6GA 4LYRA 3VDCA 4Q22A 2J47A 1W9DM 1HJSA 2J7CA 2A3EA 2NSXA 2DSKA 2DSZA 4OJYA 2WWDA 5DMYA 4Z2LA 2XM1A 2D0FA 4UQEA 4P7LA 1UH3A 5HBFA 5BWFA 2EPOA 3AXXA 4HZ8A 1GJWA 3CHEA 3FAXA 4JL2A 3PN8A 1BYAA 3GNOA 1NWRA 2ESCA 2VUYA 3UESA 3CIVA 3OLEA 4U2YA 5CPQA 3UCQA 1EO7A 4KRTA 1JZ6A 3AS2A 3GNRA 5A6KA 1QI3A 4UZSA 2YDRA 3IJ8A 2YDQA 4F8XA 2WMFA 3MUAA 2WVVB 5JBEA 3RM8A 2XTKA 4QFUA 4TX6A 1J9YA 2Y2WA 5FCZA 3D3AA 3KEHA 1KXQA 1OINA 4AYSA 2FGZA 4GI6A 3M7SA 3THDA 3AQUA 1GOMA 1UKPA 1UKSA 5A95A 2V38A 5I24A 1JZ7A 4HPGA 1PX8A 1V02E 4CD4A 3SUVA 3AIEA 3RJXA 1FH8A 2J8GA 2WMIA 2WLYA 1TA3A 4WK9A 3EDJA 3S2CA 1J0ZA 3GYCA 1V0MA 2YIHA 4Z2KA 5I0DA 2MANA 2WLZA 2X0YA 4DWSD 1UD2A 4B16A 1J11A 1VJSA 4XZBA 1AQMA 3K46A 2PC8A 4PMQA 1WDPA 5DEZA 2NW0A 1H41A 1BYBA 1UWSA 4KRUA 3BAIA 2WSKA 5EFDA 1TUXA 2BVYA 1E55A 3I3BA 3OGRA 3WQ8A 3WNPA 3U5UA 1QBAA 1OIFA 2O9PA 3N1AA 3WFZA 3AIRA 1DWIM 3K4DA 1TR1A 4CCCA 3AZSA 4W5UA 4KGJA 3FAWA 2XFRA 2XWDA 1UQYA 4IM4A 1KCLA 1F4HA 3L4YA 3AZRA 4AZBA 4UFMA 3DECA 4AD0A 5I6SA 2VCCA 2ZXBA 1PJ9A 4P8VA 2J25A 2WZHA 1OGBA 1QNOA 2XFYA 3WF1A 2A3HA 4MPKA 4AIEA 1US2A 2GJPA 4UFLA 4AD5A 1MQQA 3ARTA 3OZOA 1JAKA 5ECUA 2WWCA 1GONA 3T2PA 2BHUA 1JNEA 3CUIA 1V02A 1CDGA 3AHTA 3WEMA 5IHSA 2JE8A 1E5NA 5I77A 1JDCA 1R7OA 1ZB5A 5E9AA 2ZUMA 5D9PA 2OWXA 3L4VA 1NOWA 1HNYA 4FMVA 1WO2A 1ZJBA 4PMNA 1VBUA 1AMYA 1E71M 3CUGA 1VFOA 2JALA 5FIPA 3WF2A 3SCSA 2VQUA 4IPNB 1WKYA 1EGZA 3RIKA 1KGUA 1ECEA 1J0KA 5E0FA 3S6TA 2CHOA 3TTOA 1UG6A 1ITCA 5FL0A 2OWWA 1E40A 3I3DA 3AMKA 1JXKA 1UWIA 2WVVA 2ZIDA 2QMJA 5M3WA 4FLRA 5CQ1A 1X1NA 3L4WA 2G4FA 2W91A 3ARSA 3AS1A 3ZJ7A 1E73M 2Y8KA 4W86A 4MADA 4PMYA 3WMCA 3I3EA 1EH9A 2XSBA 2ZX8A 2QLYA 1MYRA 1V3JA 3LMYA 3U7VA 1AQ0A 4HOXA 4BQ4A 3D5HA 1Q6CA 4WF7A 3AS0A 1GORA 4BQ2A 1F4AA 1FH7A 1O7AA 1KGWA 3L4UA 1BSIA 1PEZA 4OIFA 2XIIA 5HNNA 3DYOA 3UR7A 2YDSA 1GJUA 5C71A 3PZQA 1OB0A 1HVQA 4HOWA 1JAEA 4PSPA 1CXIA 2DIJA 8CGTA 4UOQA 4CD6A 4XUYA 1LWHA 4CGTA 3TTQA 4PMZA 1V0KA 2PB1A 2PWGA 3U57A 1W2PA 3WDJA 5E0CA 5BXTA 3PTKA 3SIMA 1EDGA 1S46A 3W81A 3VGFA 1CECA 3WDHA 1UR4A 4UQCA 3RCNA 2YOCA 1W3JA 1DWAM 3BAJA 3VIOA 3U5YA 2CEQA 4HMEA 3F4VA 2J7FA 1K9EA 2QPUA 1E6RA 4A3HA 1KQZA 4AEEA 1EOKA 3AHYA 2DT0A 2UY5A 3CPUA 1QI4A 2CESA 1CBGA 4PRWA 4GKLA 3CMJA 3WQ4A 4DWSB 1OT1A 5I79A 1UWQA 2V5CA 5BCAA 2ZXDA 1BFNA 5HDRA 3SUTA 2WYSA 4W8LA 1HJUA 3VM7A 2XVPA 1W9PA 1H5VA 1BYCA 3WENA 3T2QA 3MANA 1B3XA 3F5KA 2DEPA 4HZ6A 3OB8A 4AW7A 4MDPA 4M80A 3BSHA 2PF0A 1OD0A 3POHA 1CPUA 4FLOA 4U5IA 2VZSA 3OLDA 4JFWA 4MNKA 4Z2HA 2WSPA 3WNNA 2CKSA 1EHAA 1SMDA 3NDZA 1XYFA 4H8HA 2UY4A 4MB3A 3ZO9A 3O6AA 3IJ9A 1JF5A 2V3GA 3MV11 2XGBA 5EFFA 3WUFA 1W2VA 2XPKA 1VF8A 1CXKA 3CZEA 5E6YA 2VNCA 2W67A 4HMDA 4QLJA 1JXJA 1EOMA 1EQCA 4NRSA 3IK2A 2WHJA 4J28A 3KWXA 4OOUA 5BROA 5I3DA 2C7FA 1WB0A 5M03A 3VOCA 1BQCA 3VX0A 3WNMA 3ZQ9A 2VZVA 4GXPA 2ZICA 3PZGA 4W85A 1E0XA 1E15A 4PMXA 4UOJA 1V08A 4AD3A 3J7HA 1PZ2A 1DEDA 3AIWA 3EMQA 1Q4NX 1CENA 2E9BA 2E3ZA 3CUJA 2CBIA 1UYQA 3AISA 1ZJAA 1FP9A 4LX4A 1H11A 4P7QA 4CN4A 1KXVA 1UWRA 2IXUA 4ZENA 2GDUA 3WD1A 2EJ1A 1CEOA 4RE2A 1C7SA 4U3CA 1B0IA 3WMSA 1V3LA 5ABFB 1V3KA 2JIEA 1LWJA 1UH2A 3GNPA 1ODUA 1ITXA 1FOBA 3VKKA 1LLOA 3BCFA 1UD8A 1G5AA 2OYMA 2FH6A 1U30A 3N18A 2VURA 2BS9A 2PWFA 1CXLA 2E4TA 4JHZA 5DT7A 2DT2A 4HA3A 4WLCA 5E6ZA 4H8UA 1H49A 1PBGA 4Q7NA 3WH5A 1CWYA 3LPPA 5DO8A 1E4LA 3A3HA 3QR3A 1JF6A 2VVSA 3POCA 1JYWA 1ISVA 4QLKA 4UQBA 1E6QM 1KXHA 1XH1A 4DWSA 2J78A 2YBUA 4WJXA 5GQBA 2J75A 4W8AA 1QVBA 4OKDA 4QLLA 4XZWA 3ZR6A 1OIMA 2X0HA 3WF4A 3GZAA 3CHCA 1WZMA 2DPEA 5BRPA 4TTUA 4DM2A 3UERA 2WMIB 4W8BA 5BXSA 4CUCA 3WMBA 1M7XA 4D6DA 1BF2A 1V6UA 4ACZA 4AISA 3ECQA 4YN5A 3WUEA 3KL5A 1VB9A 1E6ZA 2DSWA 3WY1A 2VRJA 1GZJA 3T0BA 3W38A 1UD5A 2JF7A 1NWSA 3WF0A 3AJ7A 4JIEA 1QNQA 2CPUA 1K9FA 1GOKA 4WSKA 4PMOA 2VX6A 5CPSA 3MMUA 4JHOA 4IPLA 2UY3A 4AXNA 1EHNA 1JYVA 4JKKA 4BZYA 1J01A 1B30A 1MQRA 4FLQA 1XYZA 2VO5A 2IUZA 2XM2A 2ZUNA 4C7FA 5AC4A 2WXDM 5D9OA 4BQ5A 4BCEA 1XSKA 1H0IA 4AZ7A 4K68A 3WDIA 1LG1A 3SCUA 4F9DA 5HXMA 2YJQA 1L0PA 3RO8A 5KEZA 4RE4A 2X8RA 3SCRA 2QV4A 1W1TA 1O6IA 2VZUA 1QBBA 3NCOA 3B8SA 1W9XA 4ZXLA 3A4WA 4W89A 3ZJ6A 1UR1A 2V5DA 2DSUA 2D20A 1ZBCA 3CO4A 4QCEA 3CZ8A 3OZPA 1H09A 2X1IA 4PCSA 2CBVA 4H2CA 1E0VA 2DH2A 3A6OA 1TVNA 1V3MA 2VI0A 1V6WA 4PN2A 5ABFA 1I1WA 3ZT5A 3BXWA 4CU7A 1QI2A 2WK2A 4MJ2A 3BAXA 2ZUSA 1HVXA 2D22A 4GINA 1R85A 1KWKA 1CGVA 1PAMA 1FHLA 3WBAA 1E56A 2WPGA 4P8XA 4X0VA 3W6MA 4E4PA 4F66A 4BS0A 2WNWA 3B9DA 1VBRA 2CITA 1OM0A 1E3XA 3VIPA 1SFSA 2VJXA 3K8LA 4WKFA 3SCPA 4MB4A 1E70M 4CD7A 4TOQA 1KQYA 3WEZA 2V3DA 2YL6A 3PTQA 5E09A 2RGMA 2WHKA 2WZEA 2BFGA 4V2XA 3FN9A 3AHXA 2VCBA 3MSGA 3W25A 4PBGA 3SCQA 2D2OA 5M5DA 3PHAA 1BVNP 4BQ3A 4HZ7A 1MXDA 3N13A 2BY0A 1Q6EA 3AXIA 3BMWA 1VFUA 1D2KA 1ZU8A 3TONA 3AI0A 4HOZA 4UFIA 1MW1A 2WMHA 4JKMA 3M46A 4GI8A 4P7RA 2OYLA 1HKKA 2XVLA 2YA0A 3QOKA 2EPKX 1ODZA 2W63A 4YHEA 3TTSA 1VFFA 3SCNA 2Z1KA 1C7TA 3OGVA 2YBTA 4MB5A 2VC9A 3DHUA 4UNIA 3ALGA 1UA7A 2F2HA 3OGSA 5C8BB 1GVIA 4MJ4A 5AY7A 3VIMA 3F5LA 3KL3A 3CTTA 2GK1A 3NSMA 3ZSTA 4Z2IA 1CXEA 3WN6A 3WIJA 4J27A 1ZBKA 1WDQA 4B9ZA 4R5EA 2VX7A 1YHTA 2X09A 3B9AA 1NARA 3ZJKA 1HN1A 3CBWA 1XSJA 3CUHA 3HN3A 1XSIA 5IHRA 2TAAA 3RILA 2BVTA 3VNYA 4UQ9A 3GH4A 2CKRA 4HA1A 1KR0A 2YA1A 3IANA 2D3NA 2A3CA 5ABGA 3CGTA 1FH9A 5EBAA 4IUGA 2VZTA 1GOIA 2EXOA 4CD5A 4H04A 5A6BD 2J79A 2WMKA 5JIWA 9CGTA 5IFTA 1Q6FA 2WVUA 3AIVA 3W26A 2V3EA 4U33A 1B3VA 1X6LA 2CNCA 2V3FA 3L2MA 1V6VA 4TVUA 4CN1A 3WQ5A 1RPKA 1XH0A 2D24A 3AS3A 1CGUA 1WZKA 3BCDA 1H4PA 1W1VA 1HP4A 1DWGM 1NOFA 3PZNA 4GO9A 3WF3A 1HJWA 4D6CA 3BMVA 2E8YA 4ATLA 2OSXA 5BYWA 4W84A 5C70A 1I75A 2YLAA 1R7AA 1BYDA 4L4OA 4LGXA 5JIPA 3WL1A 1EA9C 1PPIA 1JI1A 1PIFA 2BHYA 3BH4A 2G8ZA 3SEPA 4AZ6A 5LA1A 3GH5A 2G3NA 2JIWA 2OSYA 3SCWA 3GBDA 3SCTA 2ZE0A 3VILA 2CBJA 3ARPA 3ARXA 3VIGA 1ISZA 1W9BM 5EB8A 2WVSA 4TVCA 2J77A 1JIBA 2WMGA 5LA0A 1CGWA 1CZ1A 1LF1A 3M6DA 1RP8A 3WEOA 3NYDA 1W1YA 5A8PA 1KBBA 1BLIA 1FA2A 2BVDA 3EDFA 3GXDA 1JD7A 4PUDA 3ZR5A 4MAZA 5A8OA 2J7GA 3GXFA 4ACYA 5CJ5A 2QPSA 1B9ZA 2W61A 3VD7A 1KFWA 1QNRA 3GXIA 2O9RA 1V0NA 4PCTA 2J7BA 3N9KA 4CVWA 1VEOA 4DWSC 3KZSA 4D72A 1SMAA 1UKTA 3G6MA 3M07A 2WCGA 1HXJA 4N0RA 2D0HA 2JEQA 3VIKA 1E0WA 4YHGA 2ZUWA 1SYTA 3PZVA 1ZS2A 3EYPA 1CGXA 2AOSA 3CH9A 2DT3A 1GOOA 3G6LA 1EQPA 2E40A 1GCYA 3NSNA 4M56A 4QCFA 4CVUA 1M03A 4OOZA 3A4XA 1US3A 2BY2A 2PBGA 2VZOA 1VEMA 1XV8A 4TVDA 1XCXA 1W32A 1C8XA 1NQ6A 3UG3A 4P8WA 2Y4SA 3MKKA 1JZ3A 3HJEA 4J3TA 1CGYA 4UFKA 5JBDA 1M53A 3FW6A 4M29A 4PTWA 1HF6A 1H2JA 3GXMA 3WNOA 1E6PA 3PZUA 2FHBA 4V27A 1HT6A 5A6AA 4JFVA 1J12A 3VMNA 4U5KA 2B31A 5CGMA 1QHZA 2XG9A 1C92A 1DP0A 1UHVA 5A6JA 5F7UA 1YQ2A 3VDHA 3IJ7A 1KGXA 1GQKA 2CETA 3OLGA 4PUEA 3VMOA 4ACZB 5JBFA 1WZLA 1UZ1A 1HKMA 1G9HA 3VIHA 4URIA 5IDIA 3BLKA 5A8NA 3VIJA 3AROA 2XFFA 3VGHA 3WD0A 4JCMA 3AMCA 1KCKA 1D3CA 2CYGA 2VR4A 4D6FA 3AXHA 5I23A 4TUFA 3BAKA 3O9NA 1XRVA 3T0AA 3WQVA 1CTNA 2PWEA 3QOMA 3WNLA 4UQDA 1GOQA 3SCOA 2E0PA 3VIIA 3ZSSA 2XUCA 3E1F1 4YPJA 1XCWA 3GM8A 2J4GA 3MUZ1 5HOSA 4EK7A 4IISA 4R27A 4W5ZA 2VT0A 4CCEA 1MW2A 1QPKA 1C8YA 1WE5A 2Z1SA 4PTXA 1UKOA 5BXRA 5FD0A 1RD6A 1JZ4A 3WFLA 3K8KA 1XGZA 4C90A 3LPOA 5AC5A 3ARVA 4HU8A 5AYIA 4OBRA 2E8ZA 1UA3A 2G3MA 4H8VA 3ARYA 4E8CA 1IV8A 1E6XM 3MO4A 4M81A 1EDTA 2DGAA 2XYLA 3NIYA 1P6WA 5ABHA 3FY1A 4AD4A 1OBAA 1JYNA 1JG9A 1J0IA 2ZOXA 4MNJA 2A3AA 1LL6A 3PZ9A 2YLLA 4P8UA 1TMQA 1QW9A 1NOUA 4UQAA 1KB3A 1LL7A 4QDMA 1W3LA 2YL9A 2UWFA 4FF5A 4C7DA 4D6IA 3WD3A 3UR8A 3W53A 1UOKA 1DTUA 1FFRA 3RM9A 1E5JA 1KXTA 2VRQA 5GPRA 1A47A 3WH6A 1J0JA 1ESWA 4HA4A 2ZXAA 2EPNA 3W82A 4J3XA 4MDOA 1E3ZA 1PX4A 1VFMA 4U3AA 1R86A 2DT1A 3PBGA 2G3IA 2WKGA 2GDVA 4U2ZA 1JNDA 1VENA 2CCRA 1ISWA 2YA2A 3WUGA 4AC1X 3VPLA 3WH9A 4PSRA 1KBKA 2G41A 4W7VA 1IT0A 3MU7A 4ATWA 2WB5A 4F79A 4LYPA 1B3WA 4H41A 3UEQA 3MV01 2GVYA 2VCAA 5IXEA 3AMLA 4W88A 5A6MA 6A3HA 3WUBA 2WM0A 4AWEA 4J7RA 3QGVA 2GFTA 1QI5A 2O9TA 4HPHA 4AY1A 5LA2A 2ZXQA 1BTCA 3AOFA 4A4AA 2XSAA 3WQWA 3WD4A 4BF7A 2EEXA 1WNOA 2GK1B 2W66A 5A6BA 3BGAA 1E1FA 4B15A 1CIUA 1NP0A 3HMCA 5TD4A 1JDAA 1H1NA 3IAQA 5CZKA 2QHAA 7CGTA 1UD4A 4OZOA 1EO5A 3LPGA 1QNSA 2W4XA 5BXPA 2VOTA 2CERA 2WCSA 4EAMA 1MXGA 4WKAA 3WDQA 1GPFA 3AYSA 4XB3A 3MSDA 2OWCA 2YL8A 1SR0A 3AFBA 2ZWZA 4AMCA 3TA9A 1MQPA 5D8WA 1PX3A 2X05A 4AD2A 5CLWA 2ZX7A 2J8FA 2CBUA 2YKKA 3NDYA 1KR1A 3RM4A 3II1A 1E6SM 5HPOA 3MS8A 1JFXA 1XD0A 4XV0A 2Y8VA 3GTNA 4NI3A 4GI9A 1XC6A 1HL9A 1A3HA 3A4AA 2FH8A 2XIBA 5EMYA 3HU7A 6TAAA 1LJYA 1NH6A 1UWUA 4JZ5A 3VO0A 4KGLA 4KH2A 2D23A 2XGIA 5FOOA 4D6GA 1HX0A 3PZOA 1EIBA 4PTVA 5DF0A 1C93A 4L4PA 3GBEA 3OLIA 4M8UA 1UR9A 1TVPA 1R87A 2JF6A 4NRRA 2WW5A 4WKHA 4ATDA 1AVAA 1JDDA 1WDSA 1W1PA 1W3HA 1G01A 3QHOA 4M82A 4S3KA 3WD2A 1M04A 2A3BA 2WAGA 4TTGA 1BHGA 2Q8XA 3VU2A 2O9OA 3BAYA 4PEEA 1UR2A 4B9YA 1VJZA 3MMWA 4D6JA 5HPCA 1EDQA 1X6NA 2ZX5A 3ZMRA 2PI6A 1WP6A 1CXFA 2IXVA 1RH9A 5IFPA 1DWJM 2VX5A 4MB1A 1JZ5A 4LPCA 4UFJA 2W5FA 2GJXB 4JFUA 4DUWA 4KMQA 4Z2JA 5D9MA 1ZBVA 4JL1A 5I2UA 3ARUA 3TTYA 1DHKA 1J10A 1UUQA 3T2OA 4AZCA 2XVGA 4W7UA 1DWHM 4C91A 1WDRA 5A2AA 4GZIA 1WPCA 4W87A 6CGTA 3SUSA 1XD1A 1XH2A 1OD8A 3WDRA
chains in the Genus database with same CATH superfamily
4IIBA 1GVFA 3PNZA 3LRMA 4XTDA 3CZKA 1WXZA 4TXEA 1TPDA 3OG2A 4Q4SA 2QZRA 1VEPA 2I5QA 1SJBA 3GNXA 4F9JA 1XUZA 4EXQA 2ZRVA 4LTSA 1Y7VA 3MI3A 3E38A 3PG8A 3VINA 1TFVA 4QAIA 4UIOA 2XN0A 2OJPA 4D71A 2YYTA 1B3ZA 1U2YA 3KXQA 1HJXA 2J27A 2BODX 1G94A 5RUBA 3G3DA 1LQAA 4UZUA 2IMRA 1V3HA 2Y5EA 3SI9A 2DZUA 1W37A 1VPXA 3W7GA 3O3RA 1I2RA 3FYPA 1Z6KA 3BJTA 1UZ4A 2DH3A 1PTGA 4J5NA 1CYGA 1N82A 3VGBA 2QCFA 1XFCA 4KIRA 3N6HA 4IFOA 1RHCA 4E3VA 3UT0A 3LHYA 3WYZA 1PB0A 2O0TA 5DXYA 4AD1A 4I5XA 1MWOA 4IP5A 2VFEA 2GUYA 3BLPX 4JTRA 4F48A 4AUBA 4QAWA 1YTDA 4FR6A 4LUJA 1H7XA 3SN4A 1E43A 1P4CA 4E3TA 1KCXA 1RY8A 2F6KA 3EA1A 1JZ8A 2WC3A 3GR7A 1I4NA 1N8FA 1LWIA 1RBLA 1OCQA 2VVNA 5LGZA 1S3TC 2GJXA 1WCGA 3QZEA 3VKBA 1UD3A 4RNIA 1EJXC 4PUWA 4AG0A 1LQ0A 2Y24A 2X1SA 5LHFA 4MWAC 4JPGA 1Q6DA 4J3VA 2P8CA 3HTWA 1K4GA 2WMJA 4WQ6A 4C5ZA 4N42A 3CZGA 1S2TA 2WBGA 3GZ3A 1UP0A 2QUNA 3HPXA 2CHNA 1X7IA 3UGVA 4DO5A 4RDWA 5FL1A 3IJDA 3TQVA 2NZLA 1R30A 1K4HA 1SO4A 3NSXA 1FX6A 2GWNA 2DVUA 4WRHA 1H50A 4LQ1A 1EGVA 1XISA 3L4ZA 1LTDA 3TMLA 3EOEA 1J5TA 3TC7A 1HJQA 4HTYA 1W0MA 2P5NA 3ZIZA 5I5RA 3VD3A 1UP2A 4L56A 1BF6A 1JCYA 1NDYA 4E5TA 2EHHA 3KCLA 1JGMA 5BMXA 2O7QA 3KHJA 5J5RA 2FDMA 1QHOA 3CZLA 5A8QA 1JVNA 2WSYA 4A8NA 3HMJG 4OUEA 1K7XA 2ZUVA 1K9TA 3PZTA 3KS5A 4BKNA 4N9EA 4UR9A 1L2UA 1R8LA 3MPGA 3EDKA 2DQXA 3WQOA 1B3YA 3WLOA 4WHBA 4NYYA 3DC0A 1I8JA 4HSHA 2CW6A 2W62A 4HYVA 2QJHA 2A6NA 2WNZA 1WAWA 1XLBA 1M01A 1HTIA 3ZVHB 2X40A 4Q8PA 5JH2A 1DOSA 1L2QA 3TYAA 3G0SA 4H9YA 4HU4A 4O54A 3E9AA 5CSUA 2OKTA 1X8CA 3H23A 3VE7A 3NZPA 1L6FA 1MEWA 1XW8A 2QNEA 3ZVIA 3VD4A 2ZUTA 4E4UA 3S8HA 1HIZA 4JFSA 1R9ZA 4TX8A 1LOLA 4GQQA 1L8NA 2OEMA 1BVZA 1QDSA 1DWFM 4AF0B 3CNYA 5C9UA 1E9IA 3M0ZA 3OIHA 3T0DA 2IQDA 3TW6A 4CNSA 3P14A 4KWVA 3EX1A 1NWTA 4GPNA 3RX2A 5EL1A 4KCWA 3N4AA 1V0LA 3T8LA 3GG7A 1RZMA 4AZ5A 3UJRA 2J74A 1MW3A 2PZNA 2VDIA 1B31A 3MW7A 2OGJA 3BQ5A 3TP4A 1LROA 2ZFAA 3LHWA 2OLHA 2R24A 3PWAA 2PS2A 4IGMA 4BJHA 2NT1A 4GQRA 4WJ8A 3P3BA 3CUFA 3CJPA 2ONEA 2FTWA 4M0XA 1XWYA 2A7RA 1NM9A 4L9XA 3WBYA 3FYYA 2OZ0A 1TG7A 2FVLA 4OBSA 3WBEA 2YL5A 4CN6A 4Q32A 3G1DA 2V81A 1XHGA 2IW0A 1S5VA 3GVQA 4GQBA 4O1AA 3ES7A 2Y8UA 2WJDA 2J7DA 1MW0A 2CZDA 4BA0A 1FBAA 3NO1A 3GX9A 2BY3A 1W31A 1VD6A 4K7VA 3TXZA 1RV8A 4I8DA 3LRKA 3NQBA 2FGLA 4ASTA 2EKCA 3TOPA 3LCHA 1C3FA 5BOFA 2E6DA 1W17A 1A53A 2PFHA 1ISXA 3KRZA 4K39A 3QKZA 4NF7A 1JFHA 3FVMA 4FXSA 2YGYA 1H7PA 2FLIA 2PTZA 5FACA 3LB0A 3K13A 3NL5A 4LUTB 2WQDA 2B7NA 4N02A 2ZE3A 1SVDA 2QR6A 2KX9A 3EMCA 4N6FA 2VD8A 1QWKA 1XLKA 3ZT7A 2J7EA 1UWTA 1GNXA 3M41A 1VP5A 2HK0A 2NXHA 1QOXA 4C6FA 2NVAA 1EJ7L 4R7WA 1SZGA 3GAYA 4S3DA 2Y7GA 3VDAA 4PUKA 2VX4A 1U5HA 3W7HA 4WY0F 1TWSA 1ZL1A 4GKTA 1RJQA 4ILSA 1J93A 4J2MA 4S1FA 4KWUA 4XZIA 3PJXA 2ZX6A 2EG6A 3REQB 3ES8A 2PCQA 1VQTA 3RMEA 1PIGA 2YYUA 4GYPA 1KFKA 5REQB 3NPXA 1E4NA 3L4TA 4NSBA 2ZZ2A 1EYEA 4C6NA 1OC5A 3BQ6A 3QJAA 1W9DM 1C9WA 1Z9AA 2A3EA 4PCNA 4TO8A 1PYFA 2DSKA 3NL2A 1IXOA 2WWDA 1UC5A 2BB0A 3V1PA 4Z2LA 3BVJA 4LS0A 1Q3NA 5HBFA 1XLFA 3GIYA 2H90A 4HZ8A 4PB3A 3CHEA 2V69A 1HFBA 4GJJA 1NWRA 5CJNA 3NAVA 1VHNA 1XP3A 1EZWA 5HMEA 5CPQA 1NJJA 2DV0A 4KRTA 1A5SA 1JPMA 1OFEA 3T07A 4O57A 3GNRA 4DJDD 2PLJA 4LFYA 4PL2A 4F8XA 2GYIA 3MUAA 1R3QA 3MTWA 3EXTA 4UTTC 1OINA 1TWWA 3L5LA 1GOMA 1UKPA 1YXDA 1Q85A 5A95A 3DX5A 3WQPA 8TIMA 2WMIA 1YYAA 4JQ1A 3RO6A 4IT1A 1TMLA 3S2CA 2QVNA 2WLZA 5KETA 1UD2A 2Y89A 4XZBA 3DDMA 3CWNA 5BW6A 5AFDA 3P74A 3WG6A 2IQTA 1WDPA 2NW0A 4XAFA 1H41A 4DBEA 1UWSA 4KRUA 5JVLA 4PCFA 2QGHA 4GIYA 3SAZA 5EFDA 2BVYA 3I3BA 4RX0A 1AH3A 1QBAA 1OIFA 3S46A 2O9PA 3HQPA 2NLYA 1LRTA 4JYDA 2V2CA 4KWOA 3URBA 5LIXX 1KLZA 2BG5A 1DE6A 3AALA 3HF3A 5AVNA 2FPYA 4KS0A 3FAWA 4H4IA 1UQYA 2ZVRA 4IMEA 4IM4A 1F4HA 3FS2A 3GVRA 1J4EA 3Q2DA 3AZRA 4AZBA 3VKCA 2VCCA 1SUXA 3A23A 3U2ZA 1QNOA 2JGYA 2GJPA 2A1YA 4A05A 1MQQA 1G7UA 4HPJA 1DJYA 5REQA 3CUIA 1V02A 5IHSA 3CQIA 5CZ0A 3CL7A 3TYCA 3TJ4A 3NL3A 3BJFA 2DJXA 3G1YA 1RQEA 4YWIA 2ZVIA 5C54A 3LNPA 3HQ1A 4OGZA 3HJZA 2JKEA 2EG7A 1L6WA 1NSJA 1Q8JA 1VBUA 4TU1A 1GKRA 3GVVA 3PK7A 1K02A 3SCSA 4DB7A 1XC4A 3W1RA 1WKYA 1EGZA 4UBPC 2C1IA 1EEPA 1KGUA 3QGKC 5E0FA 4PODA 3A5VA 3HOJA 3I3DA 4UTJA 4HNTA 3KOFA 3N2OA 4JEJA 2CLOA 3W7IA 3AS1A 1E73M 2Y8KA 3UZZA 4PMYA 1XIDA 3RAOA 1EH9A 2XSBA 3HPFA 4O1EA 1OYAA 1R9XA 2PDKA 4LBRA 4Z17A 4KCTA 1AA1B 4IPJA 2CC0A 3ABZA 4LBSA 2AKZA 3LMYA 3U7VA 4BQ4A 3GHRA 3V75A 3BOXA 3PFRA 3W2LA 3JR2A 4BQ2A 1F4AA 3P62A 2PSNA 1PEZA 3DYOA 2YDSA 1Y65A 2X42A 1HO1A 4DQWA 1TV2A 4PSPA 1CXIA 3VNLA 8CGTA 5G1YA 4A8LA 2QJNA 3TTQA 4PMZA 3WDJA 2B81A 5EPDA 4IMCA 4J40A 1YXCA 1ZPTA 5FF7A 3WDHA 4UQCA 1EP2A 4C60A 1W3JA 3NURA 2YX0A 5DY2A 2QDDA 1V79A 1IGWA 3KOXA 4HMEA 4ZB0A 1KQZA 2B7QA 4I8YA 1UW9A 2ZKMX 3TQPA 1KRBC 3W2KA 3CT7A 3G24A 3ME3A 1OT1A 5I79A 2TSYA 4R85A 1TUFA 2ZXDA 5HDRA 1P5BA 1XJBA 3H22A 1EJVC 2QF7A 4MIMA 4EXAA 5DLCA 1SFLA 3OB8A 1GT8A 4PBFA 4Q8MA 4MDPA 2FTPA 2YZ5A 3FYOA 1GW9A 4U5IA 3WJSA 3GU9A 3AAMA 4MZ1A 3WNNA 2CKSA 4QSFA 3CTLA 4H8HA 2PRHA 4DY1A 1HZYA 1OQFA 2XGBA 2NLIA 4GYPC 4I9JA 3PS7A 2GSHA 1VF8A 1CXKA 3G1AA 2VNCA 4HMDA 3BV4A 3KOYA 4OOUA 4XZLX 5I3DA 1AH0A 5M03A 2FB2A 4GXPA 5BOEA 1M65A 5HA7A 1GOXA 1QOPA 4C6CA 1E0XA 3I68A 2Z1BA 4ZB2A 4UOJA 2OT1A 1V08A 1DEDA 4XUGA 4BF9A 4C6IA 3W72A 4CNUA 6XIMA 2E9BA 1F9CA 3CUJA 2CBIA 2QCEA 1A49A 4N9CA 1TPVA 1UYQA 3AISA 4XD3A 4LX4A 4P7QA 1UWRA 2IXUA 3LM7A 4ZENA 4HHMA 4Q8NA 1CEOA 1KO0A 3P60A 5K9XA 2CLHA 4RXGA 4C6PA 1TPWA 3EB4A 4WEVX 3WMSA 4FX8A 1XG4A 2AKMA 1V3KA 1YE4A 1WBJA 4B3ZA 2PDGA 3GNPA 4GVGA 3PAOA 4DJDA 1WA3A 2ICSA 1ITXA 5FEWA 4C6LA 4HIBA 2J9XA 3UPMA 1P0BA 2J9YA 3SRKA 2VDGA 2PWFA 5LZLA 3W9ZA 4HA3A 1LBFA 4R33A 3OTRA 3ITTA 2C3ZA 4OT7A 1Y5WA 4PGLA 2GQAA 3G1FA 2VC5A 4O4VA 3SADA 4KCUA 1JYWA 4G5DA 1KXHA 1XH1A 5GQBA 3WLTA 1ELSA 1QVBA 2J8TA 4XZWA 3R94A 3UNTA 2X0HA 4QIUA 3RRAA 3GZAA 3CHCA 4UTWC 5HQMA 1WZMA 1LBLA 5BRPA 4TTUA 4DM2A 5DMLA 1POKA 1XICA 4X60A 3UERA 2O4MA 2Y61A 4CUCA 4QNWA 1M7XA 1BF2A 1V6UA 4AWTA 1XDLA 2GSEA 3N9SA 1NELA 3ECQA 3B0YA 3S83A 3SECA 1VB9A 1E6ZA 1ICQA 2DSWA 4DXXA 2HCVA 2NVDA 3WF0A 1QNQA 3KAOA 1GOKA 4WSKA 2VX6A 1YDOA 5CPSA 1GVRA 1FCUA 1W1B1 3NXFA 4JHOA 4IPLA 4PB4A 4IG2A 1NTHA 1PS9A 4O19A 1HKWA 4BZYA 1TJPA 3G8RA 1B30A 4JIRA 2PTXA 2VO5A 2IUZA 1WXJA 4RDYA 3NPVA 3WLIA 2WXDM 5D9OA 3GUGA 4BQ5A 2VWTA 4BCEA 3R79A 3HV9A 4K68A 1MZRA 3SCUA 2RJGA 3MYPA 1E51A 3G0XA 3SCRA 1W1TA 3GNDA 4AX6A 3B8SA 1W9XA 1MXSA 1JPHA 3CMFA 3IK4A 3LI0A 4KFPA 1S2AA 4CQDA 4YCPA 3STPA 4H6RA 1DQWA 1ME7A 3CO4A 4GISA 1WKDA 3R12A 4R3UA 1H09A 3BG5A 2CBVA 1V3MA 2Z27A 2PURA 4PN2A 3ZT5A 2HNHA 2WK2A 4MJ2A 2D22A 3W7PA 3P84A 5C2GA 1CGVA 3WBAA 1ONWA 2XIOA 1E56A 1O68A 2DUAA 4X0VA 4IQEA 3W6MA 4F66A 1KBLA 1OM0A 4AHPA 1EF3A 1XL9A 3VIPA 1G4EA 3E96A 2FKPA 2JGQA 4WKFA 3TNOA 4PH6A 2FZ9A 2ALRA 4O17A 5E09A 2ZRZA 2VELA 4DO4A 2QS8A 1KTCA 2VCBA 3MSGA 3OHMB 4JX5A 3MT1A 4PBGA 3QV6A 4CNOA 5M5DA 4XD6A 4BQ3A 1XLMA 1E1CA 1PWMA 3VOFA 3LHZA 1XBVA 3PAJA 3Q94A 4G1NA 1Q6EA 1QK0A 3AXIA 1FCQA 4XAZA 1VFUA 1D2KA 1TELA 3ZLFA 1TTQA 3VDGA 4RZ5A 3GKFA 1IWAA 1W1IE 2C1GA 4S3EA 1XYBA 3W73A 2EPKX 1Z89A 4Q8OA 2W63A 1I0BA 5HINA 3TTSA 1G69A 2QJMA 4L1WA 2UV8G 2Z1KA 3OGVA 2YBTA 1SR9A 4H2HA 1AW2A 3DHUA 3CL6A 2FQIA 3KL3A 1SZRA 3NSMA 5KZEA 1CXEA 5BMWA 4H9TA 3WN6A 3WIJA 4J27A 1ZBKA 1J6OA 3COTA 1XG3A 2VX7A 3MCNA 4S23A 1YHTA 4NNBA 3ZJKA 3GO2A 3CBWA 3S5SA 4LCSA 3HN3A 1BXBA 5L9FA 1VFLA 3GH4A 3U2EA 3IANA 2O7SA 1FH9A 3DENA 3E49A 4CD5A 1BWLA 3UZJA 3AJXA 1LUCB 5IFTA 1Q6FA 1KM3A 2WVUA 1S1PA 2DW7A 3MWCA 3GDRA 1TPUA 4C6KA 1B3VA 1X6LA 2CNCA 1OYCA 3Q45A 1CGUA 3NPUA 5AHLA 1DWGM 1NOFA 1VJIA 3L5AA 4H9MA 2CLMA 3G0UA 4D6CA 1MUMA 5G2HA 2V2HA 1S2CA 5BYWA 2YLAA 1QOQA 4LGXA 3I7RA 1RJPA 1GG0A 4LAKA 1PCKA 3DC8A 3WQDA 3QY7A 3KOWA 5CKSA 7PTDA 3P81A 4L4MA 4GUIA 2G8ZA 5LA1A 4O52A 2G3NA 2TPSA 2CBJA 1HGWA 2INEA 3S42A 3P80A 5EKYA 1ISZA 1UC4A 2HVNA 5EJ1B 1E0TA 3B9NA 4LALA 5EB8A 2YR1A 2IPGA 2WVSA 3CQ0A 1JIBA 3CH0A 2DIKA 1CZ1A 3E6EA 1WX0A 3PTDA 1D3HA 1W1YA 3O0FA 2P88A 3EXRA 1M1BA 1YPIA 3TCSA 3C4UA 3KP0A 1NFBA 4DJFD 5CJ5A 4F0LA 3QSRA 4ZO8A 3GFXA 1KRCC 2PE4A 3VD7A 1TTJA 1DYSA 2OTDA 4ZA0A 3N9KA 3VA8A 4CVWA 3ONCA 3SSZA 2VUNA 4AAJA 3KZSA 3UZWA 1K70A 2J24A 1P1MA 1SMAA 4D72A 5I02A 5EMLA 3KVJA 1E0WA 4ZODA 4HK6A 1TPH1 1EC8A 1CGXA 3PBMA 3M5XA 4CVUA 1M03A 4OOZA 1US3A 2VZOA 3EA3A 4YIWA 4O4WA 5T26A 4K38A 3P5YA 1W1A1 1NQ6A 4YNGA 3T55A 1EC7A 1LUCA 1VFSA 1P7TB 2NX9A 4P8WA 3HJEA 3C2EA 4HD5A 3WJXA 1H2JA 4GMEA 3BLDA 2RFGA 1WYIA 4O12A 4EIVA 4LCRA 1F6PA 1T5AA 2B31A 4NHVA 2I56A 3SRFA 4JNYA 1FWHC 2OQHA 1GQKA 4XISA 2W6RA 3C2OA 1HG3A 3T78A 2ZRXA 1NAL1 5CSRA 4DNHA 1GEHA 3WK3A 1UZ1A 2PDUA 1TO3A 4RJEA 4IIEA 4OE7A 3BLEA 5CPLA 2PD5A 1RA0A 4Y8FA 2WZTA 2FB3A 4MWAE 4NL1A 5HNTA 3T0AA 2PWEA 3QM3A 4CNTA 3EWCA 4UQDA 2QAPA 3IUHA 3VIIA 5C0QA 5AZ0A 3ITYA 3UJFA 5AHFA 4QJ5B 2OOFA 2NQ5A 2H8ZA 2VT0A 4BEQA 1KC7A 1ZHAA 2FVMA 2Z4GA 5AN7A 1C8YA 4MHBA 4ERIA 3NQ6A 1SO5A 4C90A 4Q4KA 3QR0A 3LPOA 4AVNA 5AOUA 3ZXWA 2R9RA 3AYVA 5AYIA 3CAWA 1UA3A 4E8CA 3T0CA 1IV8A 5EY5A 3NIYA 2NV9A 1P6WA 3UWWA 1JYNA 1T8QA 1J0IA 2Q02A 4MLRA 4O8RA 4FNPA 1NOUA 4C7DA 2YL9A 3SY8A 3W53A 1R0MA 3B8WA 1KXTA 1SM9A 3WH6A 1P7TA 1D8WA 2EPNA 3VZXA 4MDOA 4M6PA 4AVFA 1QASA 5T8GA 1PX4A 1VFMA 2DZAA 2PTDA 4U3AA 4C6MA 1R86A 2WKGA 4EP8C 3WLKX 3MVIA 3LENA 3TR2A 1TZ9A 4JX6A 3DZ1A 2CCRA 3GTFA 3BSMA 5I3IA 1ISWA 2A21A 2A7NA 3WUGA 3WK1A 3WH9A 4PSRA 3A64A 3TFCA 3H4GA 1ONRA 4UWMA 1EX5A 5A6MA 4J35A 3WUBA 1FHUA 1WDWA 2WM0A 4OU1A 4J7RA 1BSLA 3KTXA 3QMTA 3T0TA 1FWFC 3UG8A 1BTCA 5T9BG 2CZ5A 2EEXA 4QDWA 2GK1B 1DXEA 1AZ1A 2GGHA 4B15A 1NVMA 1CIUA 3HMCA 1JDAA 3IAQA 3TAOA 5CZKA 2ACSA 3MP3A 2QHAA 7CGTA 5AYXA 2C79A 3LPGA 2WCSA 1XIHA 4EAMA 1OX4B 4O1DA 5HWJA 2V82A 1TJ0A 2MNRA 1RQHA 3M0HA 3MSDA 3VUSA 1IXPA 5HJYA 1SR0A 4GUGA 3AFBA 3WLJA 2ZWZA 4AMCA 1RPXA 5D8WA 1PX3A 2ZX7A 3QH2A 2DZXA 2CBUA 2YKKA 1QFEA 2P3ZA 1Z7AA 3NDYA 4CEUC 3KCJA 4IX0A 3II1A 2YFNA 2V30A 3S2NA 1V4YA 2Y8VA 2H8XA 4GI9A 4O8AA 1XC6A 3ZYZA 1IEIA 4FOKA 1OFBA 4ZR8A 1UASA 2ZBTA 3HU7A 1DE5A 1LJYA 4KERA 4IFRA 2INFA 3UYIA 4JN8A 1X98A 1VPQA 3LSCA 3CC1A 4GC4A 4LUYA 4XD5A 1C93A 3P2VA 2DU2A 3GBEA 4K3ZA 4F0SA 2GJLA 3C5QA 3QQWA 3G18A 2WM1A 5BOOA 1W3HA 4LF1A 4DJFA 3QHOA 4C65A 4S3KA 3WD2A 1M04A 5FF3A 4F0HA 2VEFA 2A3BA 3PF3A 1WQ5A 2PPGA 2O9OA 3BAYA 1R3YA 3MMWA 4D6JA 3IVSA 5HPCA 1EDQA 2D2GA 1P0KA 1X6NA 3V1HA 2WSQA 5KINA 2PI6A 4GBDA 5DBTA 4LSBA 1DWJM 4IIHA 1XRTA 4R7JA 1JZ5A 1S5NA 3FKRA 3BWWA 2RJHA 3RPDA 2W5FA 1SJDA 3MBDA 4MJMA 1FWDC 4Z2JA 4CEXC 3EOUA 3ARUA 3A9BA 4PB5A 2ZRUA 4C91A 5C9WA 1WDRA 2PP1A 4AHOA 1XD1A 4ROQA 1K7EA 1H62A 3WDRA 2VEIA 1H3GA 4WXZA 4V15A 3OODA 3W24A 2RGLA 2BTMA 4NJHA 4NASA 5GNXA 5DRCA 3MUIA 4TR9A 1YW1A 5HUPA 5CSYA 1OX4A 3UVAA 4BFAA 5I07A 3VOIA 2RKXA 4EANA 2QCCA 4EKJA 3MKVA 1V5XA 2GPTA 4HYRA 7ENLA 4H7VA 3PUDA 5HULA 3TCEA 1AFSA 1QO2A 4QEEA 3GXTA 3OBAA 2O92A 3LUTA 1HP5A 1M9HA 3NGJA 5DCBA 1QPRA 3DBPA 4G7FA 4ZXOA 3U9IA 3CLMA 2AAAA 2CIPA 1R3RA 4ZVJA 4L1XA 4D6HA 1AL8A 1LCOA 1R6WA 3EWZA 1W91A 3NJ3A 2GJRA 2BSLA 4XK2A 2BY1A 5EGRA 2CU0A 1YTKA 4XTIA 4IHCA 3ID7A 2V5KA 1XLCA 4I7WA 4IJCA 3AUOA 4C7GA 3VI2A 3MKCA 5CH9A 2Y6ZA 1R2RA 2NT0A 1VRDA 1UQZA 4JNZA 1ONXA 1FHDA 2IKJA 3OA5A 4MSSA 3C86A 3H12A 3V5CA 4GIAA 2A7PA 2DIEA 4GNJA 1V7YA 4GZEA 2A2IA 3VOHA 4X61A 5EU9A 3HIJA 3TJIA 4NZ3A 3U48A 5CGQA 3BJSA 1XFBA 5KTLA 3D6NA 3DHPA 6XIAA 1QI0A 3B0UX 3OG3A 1BG9A 1RQBA 4Y96A 3TNBA 2OX1A 2DSVA 1V6XA 1PZ3A 1HUVA 2GVLA 3LCLA 3QHMA 5F1UA 1EIXA 4LXFA 3DFQA 3DYMA 3QKEA 4F0MA 4DN1A 3B03A 4D1JA 7TAAA 3SURA 1JZ2A 2Y85A 1OK6A 3B9EA 3P67A 3L68A 2X2GA 1NF7A 4GD0A 3QFWA 4PBEA 3NNTA 2FZNA 4MAVA 4CCDA 2BXZA 2ZUUA 1FHVA 3OIXA 5KZ6A 3VNZA 3NDOA 4Q7IA 1W5MA 2GQ9A 3DOPA 2B4GA 2BHZA 2OEJA 3VD9A 1D7FA 1REQA 3P7YA 4G1KA 4FLSA 3TZFA 5AHEA 3E0LA 2B7OA 1GHRA 1UPPA 1E1EA 1CLXA 4W7WA 3KBSA 3AIBA 1B1YA 3H70A 1HJVA 3APYA 1VIWA 4W9TA 1PV8A 1OHLA 3TAKA 2WC7A 1A5BA 4JTKA 2EPHA 4JTEA 4S3BA 4CQBA 1YPXA 1MDLA 4G7EB 3UR2A 1GOWA 2X1TA 5LYRA 2EQDA 4FR1A 1WKFA 1R5YA 4ZOEA 4ZE5A 2EO7A 4XO7A 3FEMA 5I78A 4PMUA 4LS2A 3RCYA 2Y70A 4WX2A 2F9RA 3THAA 5KZDA 1NF0A 1AD4A 2VXNA 4YMZA 5H8MA 4IWWA 5GNZA 4IFKB 3VAVA 1J0YA 3KL0A 4R7OA 1CB7B 2D1ZA 5C55A 1TIWA 2FDSA 1Q7QA 4WY0B 2DUZA 2I1OA 3TYEA 4QISA 5AYYA 5A8MA 3GTXA 4GO8A 2PDCA 4WSHA 5AECA 1YDNA 3IRSA 1RBAA 4GCAA 1ALDA 3MP4A 3S0CA 1A4LA 3EWYA 1UH4A 3T44A 1NWUA 2XVKA 3DG6A 1XDJA 1ENUA 3QLDA 4KRZA 4PULA 3GW0A 1O5QA 3V7PA 1TJRA 5G2IA 1OYBA 4H83A 4S39A 2Z25A 3T09A 4HU0A 3A21A 3ARZA 3IGHX 3JRKA 4EACA 3ARWA 1QW8A 3W6YA 3OVGA 2ZDRA 3LLFA 5HR6A 3MSYA 3KE0A 2VGGA 2WHMA 3WDPP 1IE7C 3KBWA 4K7YA 1CNVA 4X2PA 4NX0A 2YDAA 3TA6A 4A3YA 2OCZA 3W02A 3EBVA 6REQA 2PRLA 4JTDA 4NX5A 1KCZA 2FMNA 3LU2A 1EC9A 3SCVA 4XIAA 3STGA 3LCFA 4L1GA 3N3TA 1JCLA 1JI2A 4F2BA 3TW7A 4MNLA 1IR2A 4A3QA 3OBEA 1H63A 5CPTA 1K03A 2VR5A 2XJ7A 4W93A 3UWQA 1FTXA 3LHVA 3HZ3A 4PFMA 2Z1XA 3QPYA 3K5XA 2C13A 4L65A 4LU0A 1VFHA 4NI8A 2NWSA 3E74A 2QV5A 2XH0A 4Y9PA 2ABAA 3GDBA 3MZNA 3BG9A 4AQLA 1WAUA 3W7LA 3R13A 4M1RA 4RDVA 3P0WA 3AMDA 3CV7A 3T05A 5DT5A 1HL8A 3HQOA 3C8NA 5K2ZA 4MF4A 3WELA 1TZ7A 1MFUA 4RE3A 5DELA 4AZCB 2W92A 4UTFA 1LLWA 3GH7A 3WLPA 4RE0A 3RPMA 1GQLA 1IZJA 4TMBA 3CO8A 3DGBA 3CS2A 3PPGA 3VYLA 1A3WA 3CT2A 2DZSA 2YCEA 4IFKA 3EDEA 1G0CA 2WZMA 2P53A 3VABA 3LBCA 1NY1A 4DPPA 2XVNA 3RDKA 3IS4A 5D4YA 4WY0A 4PTMA 3E0IA 1SSGA 2WVTA 3CLWA 3IIXA 1GVYA 4YL2A 1RD5A 3QZAA 1N7KA 4CCZA 3LX9A 3VGGA 3AZTA 3VVGA 2HEJA 3N6JA 1IQ8A 3URNA 3PULA 1IEVA 1BD0A 1N55A 5I00A 1PKNA 5AKQA 2D3LA 2NXGA 2GGGA 1TR9A 4PTNA 2QF8A 2AGTA 3W1NA 1Q6LA 1TZZA 2FTYA 3AHZA 3VCRA 1OG6A 2RAGA 4CU6A 3SUUA 4UR7A 1J0HA 2WCAA 3UU0A 1C29A 1KWGA 5D32A 1NIUA 4RNHA 1R3VA 1XQLA 3LOTA 4L7ZA 2OZTA 4YTTA 3EEZA 4AIUA 4LJ3A 2OGYA 2XINA 3VDBA 3MDWA 5D09A 3NVDA 3N12A 1Q6GA 3VDCA 4J2PA 3AU2A 4JYFA 3W2JA 2QJJA 1CI1A 2F6UA 1HJSA 2J7CA 3F7JA 3CAKA 2ISSA 3USZA 1U1UA 4P7LA 4CQ8A 1GJWA 3RPTA 3CPGA 3PN8A 3GNOA 4KWWA 3B4YA 1ADSA 2VUYA 3UESA 3CIVA 4MYXA 1JQXA 3OLEA 2CZFA 4G9PA 3UCQA 3AS2A 1T41A 1XM3A 1OCBA 2ADAA 4UZSA 1BKSA 2VC6A 3FJLA 1BQGA 2WVVB 5C6MA 5JBEA 3FX4A 3HB9A 3P8IA 2Y2WA 4PUJA 2TYSA 3KEHA 1KXQA 1Q7MA 2PU1A 2FGZA 4ERGA 1KM4A 5I24A 1Y5XA 4HPGA 2E67A 1PX8A 1V02E 2PGEA 3RJXA 1XIMA 2ZA1A 2J8GA 1VBGA 2QJIA 4WK9A 4DO7A 5F1VA 2YIHA 2MANA 4IXXA 4DWSD 1K8YA 1J11A 4LRSA 4NAEA 1DJHA 3RLGA 4H9ZA 4FXFA 4Q8TA 2ZZ6A 1BYBA 3D46A 1SW0A 3BAIA 1TE6A 4YTQA 2PCEA 4S2CA 1ONEA 3OGRA 3WNPA 2Y62A 3U5UA 1DV7A 4I5UA 3FJ6A 1TX0A 3C56A 2YCLA 1XBXA 3UPWA 1A0CA 3NQEA 2E77A 1H7RA 2XFRA 4ONVA 2XWDA 3IJQA 3L5MA 3DECA 4AD0A 2ZXBA 5HQEA 1PJ9A 4XKYB 1OGBA 4JXCA 4QE1A 2QUTA 2DQWA 4UFLA 4KEMA 2V63A 3LCWA 5ECUA 2WWCA 5FJUA 1GONA 4PUUA 5FJJA 4WDTA 2BHUA 2P0IA 1JNEA 3AHTA 1ZALA 2JE8A 3CUZA 5I77A 4NNCA 1KFBA 1VLWA 3TN5A 1A5LC 3LBOA 1R7OA 1ZB5A 5D9PA 1E9ZB 1NOWA 2AMXA 3SGUA 5GJPA 4RV8A 5CBBA 4PMNA 3GVWA 1AMYA 1VFOA 2JALA 3FA5A 4JD4A 3T8QA 1JCMP 3H6OA 3I10A 5FIPA 4H9VA 5E5CA 4FF7A 4DIAA 4IPNB 3RIKA 5FESA 2MUCA 3S6TA 1KFJA 2CHOA 3CYJA 3AMKA 1JXKA 1UWIA 2WVVA 3GHUA 4OV4A 4GG9A 2Y63A 5LSMA 2XH2A 2G4FA 4JIPA 4QS5A 4W86A 3TROA 3WMCA 1ICSA 3ATYA 3JW7A 4JR5A 1J6PA 2PU0A 1AQ0A 4L4LA 1Q6CA 4JHMA 3P5ZA 1FH7A 2PRMA 1YNQA 3L4UA 4ZL1A 4OIFA 2XIIA 5HNNA 3ELFA 3UR7A 5LIYX 1RCXB 3PZQA 3P61A 3GIPA 1ZNNA 3E0VA 4HOWA 2HQAA 1JAEA 4AY7A 4UOQA 3LRLA 4CD6A 3H4XA 4GY0A 3IUDA 1X39A 4JTSA 4DRSA 3I4EA 1V0KA 2PB1A 2PWGA 1O5RA 3U57A 2OX4A 4HTBA 4L9ZA 2E5CA 2HE8A 1EB3A 5E0CA 3W7EA 3S3GA 5BXTA 4OFCA 1EDGA 3W81A 2Y7DA 1UOZA 1EWDA 3BAJA 4H00A 3MDUA 3U5YA 3NQAA 2HNEA 3F4VA 1U5JA 4WDUA 1KM5A 3GLCA 2AAMA 4UTIA 3KLKA 4AEEA 4DAIA 4XKYA 3LDVA 1BXNA 2D2HA 3AHYA 3CQJA 2GUUA 2UY5A 4QX4A 3C3NA 4DZAA 1XLDA 1QI4A 4B90A 2CESA 4PRWA 4GKLA 4H9UA 3CMJA 3WQ4A 4DWSB 3DFYA 2CFFA 2V5CA 4MKVA 4KEVA 3VM7A 1W9PA 3KTSA 1H5VA 1BYCA 3N73A 1B3XA 3W1AA 1LRQA 5AYZA 2QUMA 3WCZA 4E8GA 2PF0A 3POHA 4FLOA 3IARA 3W70A 3ABRA 4JDYA 4JFWA 2YBVA 3C8FA 1SMDA 1XYFA 3O6AA 4QDPA 1X96A 3BO9A 1WXYA 3P93A 1Q2RA 1W2VA 1RXOB 3FJNA 3QY8A 3WLHA 5E6YA 2BWGA 3SFKA 2NQHA 1JXJA 3IK2A 5E0KA 2L5HA 3VOCA 3VX0A 4LWWA 3WNMA 3ZQ9A 2ZICA 3FDGA 1OABA 1E15A 2QDEA 3KBMA 3DESA 4JTFA 4UMCA 3DFPA 1I2NA 3J7HA 1PZ2A 1T7LA 1XRSA 3FLUA 1XIBA 2NXIA 2BOGX 5J8LA 2XFWA 1EL3A 2GDUA 5I09A 3WD1A 1KTNA 2F6XA 2EKGA 1TV5A 3KZPA 4U3CA 2R82A 1V3LA 5ABFB 2JIEA 2BP1A 3OZMA 1F3TA 2GL5A 2A4AA 3VKKA 4L61A 1LLOA 3F4DA 1LT7A 1F3EA 5EMUA 2OT0A 2QCMA 1G5AA 1U30A 2WJEA 2BS9A 2VEMA 4V33A 4XBJA 2VFDA 5FJIA 2E4TA 4DYEA 3D47A 4WLCA 5E6ZA 4G2DA 4X63A 4DF1A 1H49A 1RCOB 3E5PA 1G4PA 3LPPA 3KDOA 3UGRA 4QQ3A 4JQ3A 1FWIC 3QR3A 2HWGA 1JF6A 3LG3A 1F73A 2VVSA 2C15A 1VR6A 4P61A 3POCA 1POJA 4UQBA 1GTEA 4Q8UA 3FXGA 4DWSA 9XIMA 5JMUA 4ZOAA 2Z29A 2QULA 4FNUA 4QLLA 3ZR6A 1SZFA 4C6QA 3EPOA 3N25A 4RZBA 1OF8A 3UA4A 4F0RA 4XVEA 3S4TA 4ACZA 1EX1A 4LBUA 1TIMA 1X38A 2AQVA 1XIGA 2BZNA 2VRJA 3T0BA 1Q13A 3S6OA 2JF7A 3BW3A 3I7QA 1K9FA 2JKAA 3GE7A 2FGBA 4UMAA 2VFFA 3W1LA 5KSWA 5DMNA 1EHNA 6ALDA 1OK4A 1KV5A 5FEXA 1R3TA 4K8EA 5IBXA 1XCFA 2QQ6A 4F2TA 2Y5SA 2PDJA 1H0IA 3T1GA 1QAPA 3W7MA 4GI4A 2D2JA 4H3DA 3F2BA 3GAKA 3EXSA 3NOEA 1O6IA 3KM8A 3PBYA 4LNYA 2VZUA 1QBBA 3NCOA 1RCQA 3U6WA 4Y2WA 4DF2A 3ZJ6A 2V5DA 2ZQ0A 1JRCA 2DSUA 4LRTA 3H53A 2G4JA 5A8GA 1OZQA 1ZJHA 3N14A 2D73A 4QCEA 3CZ8A 3E2VA 3UJSA 3GHTA 3VE9A 1E0VA 2KZHA 5LIUX 4XVDA 4LB4A 3PJWA 2VI0A 5ABFA 1RVGA 3E12A 4S3FA 4E2BA 5M1TA 4FXJA 4E4PA 2BGNE 1PKMA 5MKGB 2VP8A 3LZ3A 2CITA 1PSCA 4A21A 4E2DA 2VJXA 4JY8A 3N2XA 4O15A 1E70M 3G22A 1XPYA 2BGQA 3QYSA 3PTQA 2WHKA 1G4TA 1A50A 3S1UA 3AHXA 4NZ5A 2BBFA 2D2OA 4NUWA 4A8RA 4RW5A 4HHPA 3BMWA 2H9AA 2WNQA 1TV7A 3V35A 3RFAA 2FVKA 3GNNA 4HU3A 4P7RA 2OYLA 3UCDA 3UXKA 3GW3A 2RDWA 3KFTA 4DEFA 3F03K 1VFFA 3SY5A 2XH7A 1SO6A 3SB0A 4UNIA 1Q4WA 2F2HA 3OGSA 5AY7A 3VIMA 2P1FA 4FA3A 3I6RA 3CV2A 4FNTA 1I2PA 1F7BA 4IIDA 3THUA 4GXMA 3EOSA 1NARA 4HNUA 3O1NA 4GVHA 1XSJA 1GVQA 4IF2A 4LAZA 1XSIA 5IHRA 3QGAC 3GXPA 3KDNA 3BOFA 3IIVA 2BVTA 2HXUA 5LKYA 1RR2A 1KR0A 2I7GA 2A3CA 4DBSA 2C14A 4UTUA 4INFA 5U4NA 2HDJA 3TEVA 3MI6A 1GOIA 3WLRA 3PFMA 4H04A 5A6BD 3B4UA 2ZA3A 4K6AA 3AIVA 1ITUA 3W26A 4JTGA 4POCA 4U33A 1EJRC 4TVUA 4CN1A 1RPKA 3KP1A 3R8GA 1HP4A 3L66A 3WLLA 1VYSX 3PZNA 5D03A 4QEHA 3RU6A 4CLMA 4IJRA 1TWIA 1SFTA 4I9TA 2E8YA 4ATLA 3NZQA 5DX7A 4FOUA 4DZHA 1I75A 3GVGA 1R7AA 4QJ4B 1A5OC 1BYDA 5JIPA 4G56A 3WL1A 2AQWA 5MKGA 3BH4A 3V0TA 4NXKA 3GH5A 3VNDA 5HQLA 1T96A 4DPQA 2HROA 1F6YA 1ZY9A 2QW5A 1PKLA 4GJ1A 3GDTA 1CGWA 1LF1A 3M6DA 4JTHA 1RP8A 3WEOA 2PD9A 2Z00A 4PRTA 3IRDA 2Q6ZA 4HCLA 1MSSA 3NZRA 1FA2A 3K2GA 3EDFA 4AWSA 2Z6IA 3GXDA 3UXLA 1JD7A 4LC8A 3ZR5A 3BW2A 3T4WA 3B05A 4LCQA 1M7JA 1OFPA 2G50A 3GXIA 1H5YA 3HGSA 1WV2A 4DWSC 4JX4A 3A9IA 3M07A 2WCGA 4ZTYA 1HXJA 5HK4A 2EJAA 4N0RA 2D0HA 2JEQA 5BU9A 1WOAA 4N7QA 1XBZA 3CAQA 3QPEA 4WGHA 3EYPA 3WJZA 3NOYA 2AL2B 1S38A 2WQPA 4Q4MA 1JUBA 1OF6A 2OB3A 1MI3A 2OO6A 2G96A 2Z7GA 1XDMA 1X8FA 4A8IA 1S3HA 3OYZA 1NDVA 1XCXA 2XSXA 3GC5A 1W32A 1C8XA 1R38A 2E6FA 1FDJA 5LGXA 4UTTA 3UG3A 4OUIA 4ZOCA 3WFAA 4PUMA 1FXQA 1QU4A 1JPIA 5G4EA 2YCKX 3RLHA 4J3TA 1CGYA 3WQCA 2VFHA 3FW6A 4M29A 3MUCA 3PPCA 5D02A 4B91A 2G97A 3CEPA 1HT6A 3QSTA 2I57A 4BK9A 5IBXC 3W7CA 1QHZA 1C92A 3M0MA 5F7UA 1AL7A 3AWNA 4REQB 3VDHA 5FSDC 3IJ7A 4YVXA 1NDZA 4D2JA 2W79A 1LT8A 3LCGA 1Y5VA 1WZLA 4DUOA 3ITVA 4NJGA 1HKMA 3VIHA 3R25A 3VIJA 4A22A 5HUOA 3VGHA 2Y7EA 3PBVA 1KCKA 1PCWA 2CYGA 2VR4A 4HCDA 5I23A 4QNEA 3BAKA 2NQZA 1XRVA 4RK8A 1DIDA 4PC8A 3UY7A 1ZLPA 1OFQA 4BWLC 3WNLA 4IIGA 1XYAA 3LQLA 5LNVA 4ZBCA 1GOQA 2E0PA 3E1F1 3G1SA 3GY1A 3NWRA 4YPJA 1XCWA 1SZNA 4P2VA 4IISA 4W5ZA 4CCEA 5EYWA 4XIMA 3C2YA 3V4BA 3W7JA 5IM51 3TXVA 2Z1SA 4PTXA 5BXRA 3MJYA 2REQB 3WFLA 4EPBC 3T7VA 2E25A 4WDWA 4LC6A 5J5DA 4XWUA 4I3GA 4OBRA 1YTEA 2G3MA 3RU8X 1O1ZA 2HVOA 3ARYA 2IKIA 4QITA 3U0HA 1N8WA 3V18A 2CZEA 3MO4A 4NP7A 3TJLA 1EDTA 2XYLA 3EKLA 5ABHA 5E1QA 4AD4A 3WLMA 3G2GA 4NU7A 3PC0A 3DFSA 4N4PA 2YW4A 1PYMA 4D6IA 3W2MA 3UR8A 1UOKA 4C6OA 1FFRA 1XX1A 1E5JA 3ABSA 3AC0A 5CG7A 1A47A 3CV6A 2ZDSA 2V5LA 3DFHA 3MMTA 1OZMA 2ZXAA 1OFOA 5TAOA 4GUJA 4AFYA 1PTAA 1EF2A 1MNZA 1HQTA 4GYKA 3PBGA 2XZ7A 1THFD 3KLLA 1VENA 3LTSA 2YA2A 4AC7C 4AC1X 3VPLA 3LLDA 5DCDA 2G41A 5JXQA 3MU7A 3UBPC 4F79A 2GOUA 5CC5A 1TVLA 3GWQA 6A3HA 1BTMA 4F2UA 3W76A 3SM0A 4M1BA 4M6UA 3B3DA 3QGVA 4HPHA 5T91A 4AY1A 1ZQ5A 4JIIX 3LZ5A 5F4SA 2PDBA 1UBPC 1MUCA 3BZJA 1PTDA 1H61A 3IEBA 4JTTA 3ERPA 1WNOA 2W66A 3E3HA 3MCMA 1N2VA 3DFTA 5A6BA 5TD4A 3H7UA 3ZVHA 4GGHA 2H3DA 3WLNA 1Y0EA 2VOTA 2XH4A 2CERA 4BHYA 3UFYA 1P0DA 4L6DA 4WKAA 1K6WA 3NYZA 3AYSA 2NVCA 4AEOA 1V6TA 3PUOA 4S3AA 4H9XA 3FOKA 1SQ7A 1MQPA 4AD2A 1JPKA 3SIZA 3EWBX 4AF0A 2REQA 4IP4A 2W0UA 4UTHA 1FXPA 1K8XA 1KR1A 3C52A 4HHLA 1JQVA 3FV9A 1PDYA 1UCWA 1A4MA 1JFXA 4XV0A 4G8TA 3I6EA 3GTNA 1HL9A 1IWPA 3UNDA 4K36A 2O55A 3CQHA 3PWGA 4NVTA 1TJ1A 1R47A 2XIBA 5EMYA 4QM1A 1MO0A 1UWUA 2E28A 4JZ5A 4KGLA 2XGIA 1SW7A 3EWWA 1NQKA 3P8JA 3RF9A 4D6GA 2ZYFA 1EIBA 3TJXA 7REQB 1UR9A 1TVPA 2QCHA 4MVAA 7XIMA 3W7RA 4IPIA 1A5CA 3TN6A 1I60A 1G01A 5CBJA 1RUSA 3MJMA 3OO2A 4XAGA 2OO0A 4BY3A 4JEQA 2BMBA 4TTGA 2E5BA 3VU2A 1XLEA 4K2SA 3CB8A 2GWGA 4MY1A 2PMQA 1VJZA 1T99A 4JTJA 3ZMRA 1WP6A 1CXFA 2IXVA 4BEUA 2WJFA 4IMDA 1RH9A 5EJZB 1VC4A 1SJAA 4GH1A 2VX5A 1KM0A 3TKFA 1AJ2A 4L6OA 4DF0A 1DIKA 3STEA 3NO5A 4NIRA 3URQA 2TMDA 2GJNA 1UR3M 4DUWA 3WLSA 3L0NA 3PG9A 1SGJA 4ML9A 1LZOA 5D9MA 4JL1A 2RDXA 4DI9A 1ML1A 4XZMX 1J10A 1ME9A 4W7UA 2WNNA 4W4QA 1WPCA 3O0KA 2ALDA 3W83A 1EP1A 4X2RA 4UNKA 5DRIA 3QN3A 1L6SA 4GFSA 4JTAA 2V2DA 1ZBWA 3IVUA 1LG2A 3BE7A 4FEZA 5DMMA 4LUTA 3CZJA 2WZIA 3GSMA 9XIAA 2R1NA 2AMGA 3GS6A 3GIQA 1JGIA 1CT5A 4GZJA 1LOSA 3PTMA 4FK9A 3TQKA 4N9DA 1G1YA 4UFHA 1FP8A 2PDXA 2R91A 1WZAA 4OV9A 2VEKA 3DEQA 3WH8A 1F3XA 3JVAA 4UTWA 4DM1A 2VTFA 3VNIA 1O1HA 3ORWA 2OSWA 1UZHA 4Q6JA 3O06A 5CC3A 2X2YA 3CHFA 5F4XA 4Q4RA 1M3UA 3WMLA 1GHSA 4AXKA 4ZMGA 3T08A 1FWRA 3DXIA 4U28A 4DBDA 4GE8A 1B2YA 1DHPA 3TR9A 2G95A 4GJIA 3EDDA 4HMCA 2VMFA 4IZGA 3REQA 4Y7EA 4ORIA 2GSJA 5A69A 1TWZA 1TPB1 5M2FX 3BMXA 3VKAA 5GJMA 2EBNA 3VTRA 4GCXA 4S3JA 4NAFB 3W85A 2EF9A 9RUBA 3S5ZA 4PMVA 1DKWA 3S9YA 1RALA 3BLOA 3KOZA 4WSJA 4H19A 3HM7A 4FPSA 4Z1YA 1C90A 3H7RA 1V03A 2VGFA 3ZOAA 1M7OA 3K4WA 4MLJA 1UB3A 2Y1HA 4Y9OA 2NUYA 3APGA 4QG8A 2OQLA 2X0SA 4S3CA 1XLIA 2P76A 7A3HA 4HN8A 3ZM8A 3ZJ8A 4LY4A 1CXHA 4TMCA 1BAGA 1VIZA 2Q3OA 3TLLA 4JAWA 2HTMA 5D2VA 2PDHA 3L67A 1Z44A 3CHDA 3THCA 3LXAA 4F3HA 2B7PA 2CLIA 2GZXA 5GNYA 5CBIA 4Z1DA 1YBQB 1F2JA 3STCA 4AEFA 2PDIA 4E2OA 4GZ7A 1FFQA 4IQLA 3PJUA 1V6YA 5A6SA 4JTUA 3ZFHA 4PYSA 3INPA 1X97A 4UCFA 5C9RA 2YCJA 1I1XA 1Q63A 2PAJA 2P0OA 3EGJA 1TRIA 4GC3A 1GQIA 5EBUA 3NUKA 1UJQA 5BRQA 4LNCA 3MUXA 2IQ0A 3PBWA 3H2MA 3W37A 3G1XA 3K30A 1RJRA 1LL4A 4JTQA 3E0FA 4B4FA 1HKJA 2J13A 1ZP4A 1OWQA 3WQ6A 4ZTXA 3UG4A 1AJ0A 4U31A 4KBXA 1NP2A 2VQTA 5CXPA 1MZHA 3C2FA 1QHPA 1VAHA 1RLCL 4GIRA 4E38A 1ADDA 2POZA 3C0SA 1AZ2A 4AYGA 3V16A 1EA0A 3R10A 1QUMA 3GU2A 3EB2A 4Q8WA 3HG5A 4UOZA 3VCCA 1TTIA 1MRAA 1W3KA 5AYBA 2HMCA 3L2IA 1VRXA 2Z2UA 3B8IA 4YTUA 1Z41A 3OU8A 3N3MA 5HMDA 3N11A 2FZBA 3PSVA 1OGGA 4UTLA 4NAFA 3UW6A 3CM4A 3AMGA 3CWHA 1P43A 4TV6A 3H2EA 5FAJA 3LGDA 3FA3A 3QXBA 2WBKA 2PDMA 1CLVA 4YU1A 3U8GA 4AH7A 1KTBA 4XQ6A 1Q66A 3UZYA 1XUUA 1UMLA 3EWDA 1QMLA 2D0GA 2EPMX 2E9MA 3RR1A 1BXCA 3VUPA 5K3VA 1W9VA 1LDCA 2WKLA 4BI7A 4EF8A 3HFYA 3QZ6A 4GFIA 1F6KA 4ML4A 4CKQA 4NT0A 4DX3A 2OZ8A 4B5SA 1F76A 1S5TA 3KVMA 1Z48A 5FKYA 4ZFCA 1YXYA 4H6KA 2JFEX 2O56A 2ZX9A 2PBOA 3IGSA 4GNKB 3IAPA 2PP0A 3QHNA 5H91A 2XWEA 1I6NA 3QYQA 2HISA 3IGXA 4I6VA 1ZJIA 1RSCA 2XHYA 4P7NA 2A3LA 2P3EA 4PL1A 3S2MA 4PE8A 4C5YA 4JCLA 1XIEA 4WUIA 5F2IA 2H6RA 3IACA 4X9YA 1OSEA 3UETA 1YADA 1E9LA 2DZWA 1EWEA 3PZIA 4QSHA 1K6AA 4DAFA 5AC6A 2YPIA 4Q8QA 1W5NA 5AZ1A 1X1ZA 4IL0A 3L7RA 2DVTA 3WJWA 4B2DD 3QR1A 2Y88A 4KF1A 3M7WA 5FF4A 3AHVA 4QROA 1IWBA 1E4IA 1W56A 3K8MA 1B4KA 1TQXA 2DDXA 5A94A 1O94A 1XQKA 4AZGA 4B5UA 1ZSXA 4FX6M 1S39A 5E9XA 1R2TA 3MMDA 3AIQA 4ZB5A 5CLTA 4HNCA 1YNPA 3EAUA 2WANA 4L80A 3T42A 1RP9A 1CGTA 1GW1A 3USBA 3QC3A 4A35A 3TYDA 1ITQA 5A2BA 1TE1A 1E72M 4GYJA 1R2SA 3NEHA 3FGCB 2HK1A 4P7OA 1U83A 1MDRA 5HJLA 3SJ3A 2BV9A 2F38A 3OVRA 3VFCA 3SUWA 4EWND 4J3WA 3FXYA 3M0IA 1KRAC 1E4MM 3B06A 3L65A 2P10A 3TSMA 5A1AA 1J18A 3EKZA 3ALFA 3WSUA 4PMDA 1TA3B 1KFEA 4MGGA 3BAWA 5HMSA 1T40A 5PTDA 3OQ8A 4ICCX 1XR2A 2OZ3A 3LK6A 3W1PA 4CU8A 4FALA 4YTSA 5HR7A 4DUVA 1K9DA 1JD9A 4DUXA 5JU6A 4OTKA 1XS2A 3Q67A 3V36A 1B9BA 2RDUA 2PLMA 3UWEA 3R0DA 1FWSA 1HGYA 1Q8AA 2J7HA 3A13A 1VGAA 3O2LA 4QG6A 1TCMA 4MNMA 4D9PA 3F4NA 4AIOA 5A5WA 1BPLB 3N2TA 2CLPA 2PWDA 2PUZA 4IMAA 3B40A 4FHAA 4M24A 3S1XA 3RJYA 3RCMA 1DJQA 3BW4A 4HJWA 1XGDA 1RBOB 3IV8A 3O05A 4D1IA 2QCGA 1LQ2A 1U33A 1UR0A 3FHQA 1GUVA 1H7WA 1ZGDA 4MZYA 3MUY1 2EPLX 3R5EA 1FKXA 3FNDA 2C16A 2HS6A 3SN1A 2J62A 4PTDA 2D69A 3JU2A 3PJTA 3W75A 4FNQA 1P6BA 4M6QA 4PZVA 3H7VA 4RZ4A 4Q22A 4LV4A 4DNMA 4D8AA 1F3WA 2NSXA 4PR4A 3WBXA 3RR4A 7ODCA 3WK2A 2DSZA 5DMYA 2XM1A 4UQEA 1UH3A 5BWFA 3AXXA 3U4AA 4HQVA 4JL2A 1BYAA 2ESCA 1FQ0A 4DYKA 5LIWX 4O1BA 2RUSA 3SQSA 3B0VC 4N9BA 3ICJA 4IJBA 3W23A 1GZ1A 4B5NA 1EO7A 1JZ6A 3WX7A 1PDZA 2FZDA 3SN0A 1YPFA 1QI3A 1F05A 1B3OA 2YDRA 3IJ8A 3FKKA 3RM8A 2XTKA 4QFUA 5FCZA 4AYSA 4NG3A 5LIKX 4GI6A 3THDA 3ATZA 1VCGA 2VC7A 3EPNA 4X9SA 4LVFA 3RG6A 3SUVA 3AIEA 2POTA 2WLYA 1TA3A 3EDJA 1J0ZA 5T9CE 4Z2KA 3OPSA 2VGIA 1JUEA 2X0YA 4EF9A 4B16A 3ANVA 1A0EA 2RHGA 2G37A 3H54A 1TCDA 1AQMA 1JR1A 2PC8A 1AW5A 1W5PA 4M7TA 5U7SA 2PODA 4BR1A 2WSKA 1QR7A 4QTGA 1VPYA 3BGJA 3R89A 4B5VA 1E55A 1WOBA 1DTNA 3N1AA 3WFZA 3AIRA 1DWIM 3K4DA 4LAOA 3SY1A 3GDMA 1IT8A 2HXTA 1FDZA 4MFDA 4WCJA 1AH4A 4KGJA 2EGZA 1V93A 3IUIA 3M5YA 7TIMA 3RX4A 4UFMA 5I6SA 5CC6A 4P8VA 2J25A 1J5SA 1K77A 3ANYA 3GG8A 1PHWA 4MPKA 1GVSA 4AD5A 2Y5JA 3HGRA 3OZOA 1JAKA 4Y9NA 4X3ZA 4HNOA 4ALDA 3H8AA 1IEQA 1OC7A 1CDGA 3WEMA 4JIQA 3IJ6A 4MPQA 3UJEA 3SRHA 3HO8A 3VZYA 2ZUMA 3RMJA 2J9ZA 5FEPA 3L4VA 1GG1A 4MY9A 2I9UA 1WO2A 1B54A 3SQLA 1E71M 4D8LA 5I06A 4M3PA 3WF2A 1OY0A 2VQUA 4IGSA 1ECEA 3N4EA 3TU9A 2HSAA 4H6EA 2I5IA 3TVAA 1ITCA 5FL0A 2OWWA 5HNRA 3LERA 4EOUA 4UUIA 3W00A 4XZNX 4FLRA 5CQ1A 3L4WA 1DJGA 2I17A 2W91A 3ARSA 4LS1A 4HVXA 3ZJ7A 3NM3A 4PEKA 3GQYA 4MADA 2QLYA 5XIAA 4B2DA 5I03A 1L6YA 1LBMA 1FWBC 4US5D 1EXBA 3RHGA 1QXLA 3D5HA 2X16A 3S47A 4WF7A 1GORA 2Z2BA 4NZFA 2V9DA 1GKQA 1O7AA 1VBHA 4FP1A 4OHQA 1GJUA 3AU6A 1OB0A 3G1VA 3V5FA 4DLFA 5G1MA 4DJED 1M68A 2NQJA 1KW1A 4R34A 3NGFA 1D8CA 3EOLA 5I7GA 4XAYA 1TV3A 4P02B 2OQYA 1IZCA 3LXCA 2YOCA 1DWAM 3H2OA 1O66A 3N4FA 4O50A 2CEQA 4Z0JA 4HNNA 2J7FA 4KFNA 1TPFA 1H7OA 2QPUA 4EPDC 1E6RA 2GUBA 4A3HA 2ISWA 3DCPA 1EOKA 3R7MA 3CPUA 2ACQA 4KW2A 4R88A 1V7AA 4C6BA 1UWQA 4HNLA 5BCAA 1BFNA 4W8LA 1IF2A 3WENA 3W07A 3MQTA 1Z8AA 3MANA 2DJLA 3NXLA 4WGXA 1IIGA 2DEPA 3VXGA 3W7QA 4AW7A 4XZHA 4KWSA 1G67A 1OD0A 1TX2A 2QPXA 1P48A 2DW6A 5D38A 1HW6A 1BRLB 3OLDA 4MNKA 4Z2HA 3UWYA 2E1DA 2WJZA 3A12A 3NDZA 3FEQA 3WZ0E 2UY4A 3TYUA 3IJ9A 1NDWA 2Z1WA 4J3ZA 3MV11 3GTIA 2V5JA 4R9XA 3WUFA 1JDEA 2XPKA 3CZEA 4O0QA 1Z42A 2W67A 3HGJA 3RXZA 1DJXA 3GUWA 4JQ4A 1EOMA 1EQCA 4NRSA 4UR8A 2WHJA 3KWXA 5BROA 4JNMA 3IIPA 4MZ8A 2E6YA 2VZVA 5CPNA 1Q7ZA 4ADTA 1WBHA 4PMXA 4JOMA 3AIWA 1Q4NX 4JN6A 3NQVA 1CENA 2E3ZA 3O6YX 3STFA 3FJ4A 1JRBA 3TSDA 4C1LA 1ZJAA 2H3BA 1H11A 1VZWA 1KXVA 5K4ZA 2NWRA 2QJGA 5CC7A 4RE2A 3BL3A 1B0IA 4YYCA 4KKXA 2TRSA 3R0UA 4QGCA 3OZYA 2NV2A 1FOBA 1O12A 1W8GA 3QF0A 5FAGA 3BCFA 4HGXA 3WQFA 1A5AA 2OYMA 2FH6A 4Q4QA 4JHZA 4J1OA 2ZADA 3RGTA 3LMZA 1TSIA 1PBGA 3MBFA 4RUBA 1CWYA 5DO8A 3UPBA 1E4LA 5HATA 3A3HA 4AVOA 1GVOA 2WO5A 1RAKA 1ISVA 4QLKA 2J78A 3M47A 1L6GA 3E0WA 4WJXA 4RKAA 2J75A 4IGNA 3QVQA 2QGYA 3R6IA 3E2QA 4OKDA 2R1KA 3OOQA 1DIEA 3XISA 1OIMA 1XLLA 3N9RA 3WF4A 1IEWA 4GQ0A 4Y8EA 2DZTA 2HPMA 2WMIB 4W8BA 4NYUA 5BXSA 3WMBA