2GK1A

X-ray crystal structure of ngt-bound hexa
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Beta-hexosaminidase subunit alpha
total genus 8
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1A02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1A01
1E3ZA 3WMCA 4AIOA 5CPSA 1QNSA 3W28A 5JBFA 1W9UA 3IAPA 5A1AA 2XGBA 1PJ9A 4XV0A 1CTNA 3K4DA 2BVDA 2F61A 4GQQA 1PX4A 3EDDA 1E0VA 4M80A 3K8KA 5CPTA 3L4TA 4NZCA 2PF0A 3RJYA 1MXDA 5GNXA 1GZJA 1CIUA 3OLIA 2PWFA 2WNWA 3W26A 3PN8A 1VEMA 4D72A 3T0AA 1VFUA 5A8PA 5LA0A 4U3AA 2PWGA 5ABGA 3VGEA 3CZ8A 1K9TA 3PTQA 4W89A 5I79A 4GO8A 4JL2A 4EAMA 1CDGA 3WDHA 4PMUA 5A8MA 3RMEA 1B3XA 4P7QA 3A4XA 3AHXA 3T09A 3VIPA 1BSIA 4HOXA 3OBAA 2GVYA 2F2HA 2VURA 4AZ6A 1E0WA 1JF6A 4TX6A 3RDKA 4UFMA 3PHAA 3WNPA 1X1NA 1AVAA 4DWSA 3GXFA 2VO5A 3KL5A 1TMQA 2BY1A 5DFAA 3W0KA 2ZX8A 1W2VA 2XSBA 3LPOA 4R5EA 3D5HA 4AZ7A 1QVBA 4AZ5A 2J8GA 4PMRA 2CERA 3F5JA 1E1FA 1S46A 4Q22A 4UQ9A 2XVLA 3AJ7A 1W9PA 3VDHA 2JEQA 1FOBA 4GKLA 1JZ5A 4LXFA 2OYKA 1I75A 1W91A 4P7OA 1VFMA 2WW5A 4Y7EA 3DC0A 3WH7A 4JKLA 3BGAA 1C91A 2UY2A 3VIJA 1Q6EA 1B3WA 5AY7A 4BQ2A 4MJ4A 1OT2A 1DTUA 2DGAA 1J0ZA 4HU0A 5I78A 1QNOA 4D1IA 3MS8A 4QCFA 4XZWA 1U2YA 2F8QA 1UZ4A 2QMJA 3WH9A 4F66A 3N13A 4GQRA 2OYMA 4RL3A 1EDQA 2YL6A 1U30A 3BAKA 2J62A 1HNYA 4HTYA 1WP6A 2ZWYA 1BVZA 3EYPA 3KWXA 4X9YA 3ZQ9A 4GPNA 4U5KA 1JGIA 5ABFB 4C91A 1NOUA 1WPCA 2J47A 5JIPA 2QPUA 1V6XA 3PZ9A 3WEZA 3SCPA 3NJ3A 2XJ7A 3NUKA 2EPMX 4CD4A 2QHAA 4JKMA 4IM4A 3VIFA 1H0IA 2O9RA 1IT0A 4NSBA 2WAGA 4S3JA 3WBAA 2VX6A 1CLXA 3B9EA 1MXGA 1NOFA 1HF6A 2E9LA 4D71A 4HP5A 3TTQA 3VVGA 5DMYA 2XIIA 1GCYA 1WDRA 1XH1A 2EJ1A 4U31A 4YHEA 3W24A 3PZGA 3AXXA 3VOCA 4PMVA 2ZE0A 4PMQA 4CN4A 1HKKA 3W4RA 2DSKA 1DWGM 2J7HA 1JZ3A 1K6AA 2GSJA 1JZ4A 1TA3B 4UQEA 3CHCA 4V28A 2E3ZA 3APGA 2WCAA 1N82A 1LQ0A 1E5NA 2WSPA 5JUVA 2HISA 2FDMA 1E6XM 1PAMA 4CD7A 1JYNA 3IJ7A 1J18A 4AD3A 3VNZA 4UZSA 3VIKA 1W1VA 5DEZA 4E2OA 2WZEA 3TA9A 1P6WA 1ISWA 2J7CA 3GDBA 2BVYA 4J7RA 1OD0A 5C71A 4F79A 4JIEA 3QR3A 3BCDA 5DF0A 1HJVA 1W1TA 3MV11 2DH3A 1CGWA 3GH4A 1BLIA 1XC6A 4U2ZA 4J3WA 1W9DM 2ZX6A 5BYWA 1A3HA 3GZAA 3CUIA 3AS2A 2A3HA 3SUSA 3DHPA 2ZXDA 4UNIA 2AOSA 2FHCA 1AQ0A 1E6RA 3ZSTA 1CPUA 3GH5A 4MJ2A 3KEHA 4D1JA 2HVMA 5CJ5A 5FOOA 1E71M 4TOQA 1WAWA 1US3A 2YJQA 1LG1A 3WDQA 1Q6GA 3OG2A 3DYMA 4P7RA 2WMKA 2DT0A 3SCRA 1E1EA 3HN3A 1NWUA 3SCSA 3W53A 2B31A 5CGTA 2WKGA 3OIHA 4JFWA 4AMCA 1GOMA 3AS3A 5HPOA 4CD5A 3N17A 1UD2A 2VR5A 5EFDA 3FNDA 3SCUA 1XH2A 2VC9A 3WSUA 2XSAA 4B3LA 1CXKA 4AYSA 1UR0A 4PSRA 5IDIA 1UWQA 4XZBA 2RGMA 1GQLA 4U3CA 1PZ3A 2V3EA 2UY5A 4AEFA 3AIQA 2X05A 2ZUWA 2IXVA 4ACZA 4JHZA 5A6LA 1D7FA 2VT0A 4E8DA 4PMOA 1BYDA 8CGTA 2VZTA 5EMYA 4P7NA 1KGUA 1EXPA 1SFSA 5CSYA 3WENA 2WMFA 1ISVA 1EHAA 3CMJA 1CECA 5FKYA 1Q6DA 1EOKA 2X2YA 4ACYA 4PCTA 2YL9A 2OWXA 3WNLA 2DIEA 5A95A 2RGLA 5HPCA 1B3YA 1GVYA 2O9OA 1HJXA 2W92A 1EOMA 2E0PA 1QPKA 4TVUA 1UHVA 1R86A 1ODUA 3MSGA 4HZ6A 5I2UA 5DT7A 1UWSA 1CEOA 2BHUA 5I5RA 1H3GA 1B90A 1TE1A 1CXIA 4J3VA 4PCSA 5IXEA 2DSUA 2EO7A 5E9AA 2WC7A 4LPCA 1M7XA 1J9YA 2VCAA 4B3KA 2EXOA 4W7VA 4H2CA 1V3MA 3GNRA 2CESA 2E8ZA 1CXFA 1JD7A 1GHRA 1HVXA 2WB5A 3THCA 2EBNA 2QLYA 1E6ZA 1EO5A 3A3HA 2JIEA 3MV01 3U5UA 1WCGA 1C8QA 1E4IA 3S6TA 4AC1X 2PI6A 1BTCA 4DM1A 3AIWA 1VBUA 1HJSA 2OLHA 2XVKA 3NIYA 3TTYA 1W3KA 2D20A 3BCFA 3KE0A 4U2YA 3VMOA 1EQCA 3PTMA 2EEXA 1ITXA 4U5IA 3WH8A 1KBKA 3VNYA 1JD9A 4ZFMA 4BCEA 1WDQA 4HA4A 1KGXA 1GHSA 3BMVA 4LYPA 1DWJM 3WIJA 2EQDA 4MB5A 4HZ7A 1UWIA 3WDRA 2J7DA 5TD4A 1V3IA 5BXPA 2JEPA 1XSIA 3L4ZA 2EPOA 1UR4A 3VMPA 3UERA 2VX5A 2VRKA 5CXPA 3EMZA 2IUZA 4WKAA 1CYGA 4F9JA 2ZUTA 3BAYA 5ABHA 1MYRA 4BQ5A 4URIA 4D6JA 1JFXA 5KEZA 4DUVA 2XM2A 1MW2A 3WF0A 1V0NA 4B9ZA 1E43A 3OZOA 4PMXA 1CGTA 4FLRA 4AIUA 4MB4A 2WBKA 4P8UA 3NCOA 2FGLA 5M5DA 4ZEPA 3L4XA 2FHBA 4WKFA 2V38A 1ZBCA 1NQ6A 4QLKA 2J79A 3QHOA 4CCCA 5ECUA 4W88A 5BXRA 1V6UA 4NI3A 2JALA 4KWUA 4AW7A 2UWFA 1JXJA 1V6YA 4D6DA 2WVUA 4PMYA 1XD1A 1JIBA 1JZ6A 4LGXA 1JAKA 1H2JA 4WJXA 2WMGA 3VO0A 1GW1A 1WE5A 1QHPA 2ZOXA 1OSEA 2FHFA 1BYCA 1VENA 2BXZA 2WWDA 4K68A 1V0LA 4KGLA 1BQCA 4PBGA 1XHGA 3OLDA 1B9ZA 4GZJA 5HBFA 3N15A 3VUPA 1KWGA 2VRJA 3ARUA 1U33A 1K9DA 3SEPA 2JE8A 1UKQA 5D4YA 3RM4A 1HKIA 1UH3A 2Y5EA 1MQPA 2QPSA 3IJ8A 4PSPA 2PBOA 1DWHM 4S3KA 2VZSA 1J01A 3M46A 4PTMA 2DT2A 3FW6A 1QNRA 4XB3A 1JDAA 3SCWA 1J0HA 4ATWA 3VIGA 2YLLA 4TTUA 3ARWA 2BVTA 4GI9A 2VVNA 1GQIA 4DWSD 5A3HA 4M1RA 3PZNA 4MDPA 4CKQA 3ZM8A 1YQ2A 3D3AA 1F4AA 1LG2A 3O2LA 1JZ7A 3GXMA 5IFTA 1XSKA 1BAGA 1ZJAA 2E9MA 1HX0A 2J4GA 3AHZA 2DSVA 2GK1B 2XVNA 4W8BA 5E0CA 3EDKA 2X0HA 3W27A 4CU6A 1FP8A 3W6LA 4UFJA 2FH8A 3IJ9A 5CQ1A 4HPHA 1JZ2A 4M24A 3WNMA 3VIMA 3IAQA 5A2AA 3CMGA 3CGTA 1CBGA 1TVPA 4N0RA 4FMVA 1HP5A 2WVTA 3N11A 3W25A 2WZIA 1EDTA 2V3FA 3NYDA 2OWCA 4DM2A 4FF5A 3CLWA 2WVVB 4M81A 2C8NA 1AQMA 1OIMA 4CVWA 3RCNA 4PTVA 1KWKA 3A47A 4Z2KA 2CITA 1BG4A 3NSXA 4W8AA 1F4HA 3WH5A 3GXIA 4ZE4A 2BV9A 3AFBA 3POHA 4W85A 1OBAA 5C8BB 1XV8A 1ZBKA 2YLAA 1B0IA 1H49A 1GUVA 1NWRA 2D22A 3II1A 1TCMA 3N9KA 1SR0A 2ZUNA 3VD9A 3OB8A 2E4TA 4D6IA 4X0VA 1V3JA 1UA3A 2G3NA 2XWDA 3ZMRA 2ZXBA 5D9MA 1VBRA 3W29A 1FFRA 2CNCA 1SMAA 4AZGA 1O6IA 1QI5A 3L4VA 3K1DA 5DO8A 2G4FA 2NT1A 2O9PA 2VX4A 1CXHA 1KGWA 2J7BA 1BPLB 1KR1A 3BLPX 1W1PA 3WNOA 4AISA 1MFVA 1B1YA 3AZTA 1OT1A 3WEMA 1V08A 1M03A 3MMUA 2A3AA 1CXEA 2ZUVA 4TVCA 1FH7A 2QMKA 4D6HA 1J0JA 5CGMA 3CUJA 1EDGA 2GJPA 1J10A 2CPUA 2D0FA 5JBEA 3ALFA 1W2PA 1W3HA 3ALGA 3SUVA 5ABFA 1W3JA 3VGHA 1TG7A 4OZOA 3N12A 1XRVA 3SCNA 3UR7A 2XPKA 2ZXQA 3S2CA 1V3LA 2WVVA 1LLOA 2X09A 4QLJA 1UD5A 1JDCA 2GDVA 4WK9A 1G01A 1WZLA 1I1WA 2J74A 1C90A 4CN6A 2VR4A 3MU7A 3CIVA 1E73M 4KRTA 1QBAA 5CZKA 2X0YA 5IHSA 3K8LA 3VGDA 2C0HA 2DT3A 2XVGA 4BA0A 2WXDM 4UQAA 1PEZA 4M29A 4LX4A 1GVIA 4UQBA 2BHZA 2BXYA 1XSJA 2D3NA 1KBBA 4HMEA 2XVPA 1GJWA 2ESCA 1ODZA 4E4PA 1UD8A 3EDJA 1EO7A 2Z1KA 3MUZ1 3UESA 3WD2A 2ZX5A 1FH8A 1J12A 1KQZA 1BGAA 1E6PA 3OLEA 4UQDA 2VZUA 3QOMA 3O9NA 3BAXA 2D2OA 4A3HA 2BNJA 4OKDA 3PZVA 4JFUA 1NP0A 1J11A 2XIBA 3WNNA 1C8XA 4AIEA 3GTNA 1ZB5A 4YHGA 3CUFA 3BC9A 2ZX9A 2PC8A 1V02E 4UR9A 5BXSA 2CEQA 2JIWA 5HNNA 4MDOA 2VTFA 3THDA 3WDJA 4BQ4A 1HL8A 4AD5A 5BCAA 2VX7A 4TUFA 3OGVA 1JYXA 4W7UA 4UOZA 5I3DA 2W91A 3T0BA 2VI0A 3AYSA 3N04A 4ATDA 4MNJA 2DEPA 3W82A 3AHVA 3WL0A 2XGIA 4RE3A 2E8YA 2CBIA 3CTTA 3AS0A 3PBGA 1KQYA 1TUXA 3VX1A 1AQHA 1UKTA 4AEEA 3VD7A 1H09A 1KCKA 5HOSA 3WKZA 1C7SA 5A2BA 2Y8VA 2GK1A 4WF7A 2EPLX 2PWDA 4JL1A 1RPKA 3VX0A 3NSNA 2X1IA 1HL9A 1E6NA 1PBGA 3TOPA 4Z2LA 2MANA 3VGGA 2YOCA 4A4AA 3VD3A 3VTRA 1BGGA 1KR0A 1UKOA 3GBEA 3BSGA 5GQBA 2YA1A 5BROA 4PMZA 3L4UA 2CHOA 1DWFM 4NRSA 1OM0A 3CZKA 1G9HA 1V6WA 4CCEA 2WCGA 3MSDA 3VGFA 4AZCA 1ZBVA 5CLTA 3WDPP 1JXKA 2Y2WA 1UG6A 3WBEA 3SUUA 2W66A 3WEOA 3ARPA 1QI4A 3T0DA 3PZTA 1EH9A 4L4OA 1UR9A 2PB1A 2UY4A 4CU8A 2NT0A 3W37A 3WH6A 6TAAA 3ARVA 3VM5A 1L8NA 5BRQA 4H04A 4QLLA 4CU7A 4PMNA 5M17A 1Q4NX 4DUWA 2CBUA 3U5YA 2BY0A 3MANA 4GZIA 1FHLA 1E4NA 2WHMA 1OB0A 3AS1A 1QW8A 2DQXA 1SYTA 5D9NA 1ECEA 1UR1A 1V0KA 3AIEA 4W7WA 1XD0A 4P8VA 1M04A 3UCQA 1W9XA 1W9VA 3BLKA 2PWEA 4HMDA 1LL4A 1GQJA 4F9DA 5EB8A 4Z2IA 1QOXA 5F7UA 3ZR6A 1UUQA 4JFSA 1G94A 3TP4A 1KXQA 2VUYA 4W93A 7CGTA 5CSUA 3WDIA 3JUGA 3ARYA 2ZIDA 5IHRA 1UZ1A 3SUTA 1MWOA 1UD4A 2JF6A 2OSXA 1QI0A 4UZUA 4CCDA 1ISZA 1AMYA 3WFLA 4YN5A 3QHMA 1ZJBA 4PN2A 4UFLA 4P8XA 4UFHA 1UR2A 2BS9A 2BY3A 3BAWA 1IZKA 3WFZA 2WK2A 2OSWA 4BS0A 3AHYA 4W84A 1ISXA 1KFWA 2ZICA 2QF8A 3BMWA 4Z2JA 1H5VA 4WLCA 5CG0A 3AROA 4OBRA 2JFEX 2YDSA 2V3DA 4MPKA 3W81A 3MUY1 2TAAA 1GPFA 3W6MA 2GDUA 2WMHA 4JCMA 4H8HA 4E8CA 1VRXA 1M01A 3T08A 3ARZA 1LL7A 3W38A 1EHNA 5HXMA 3MO4A 1D3CA 5I77A 1EGZA 3O6AA 5I0DA 3WMSA 5FL1A 3BXWA 4HMCA 5A6KA 4FLQA 1NOWA 2GJXB 1NWSA 4PUDA 1E9LA 2J7FA 2YL8A 1VF8A 3K8MA 3ARQA 4MNLA 4MADA 2D23A 1QNQA 3GNPA 4KGJA 4ATLA 3CHFA 4JZ5A 3GH7A 3SURA 2VOTA 4IPNB 3TTOA 3GYCA 2Y4SA 3VINA 1E56A 1J0IA 1R85A 1V03A 1QBBA 1JI1A 3A4WA 4QAWA 4AD4A 4OUEA 4W8LA 5LA1A 3F4VA 2WCSA 4GINA 5IFPA 1NWTA 4D6GA 2CKRA 2D0GA 1CGUA 4D6EA 3CO4A 4AD0A 4HU8A 3FN9A 2WMJA 1ZS2A 1E72M 3AYRA 3WUEA 3AXIA 3PZQA 4ZXLA 3WY1A 4X0NA 1HJQA 4CD6A 3QOKA 5ABEA 1PX8A 1UWTA 2FGZA 3PTKA 2G3MA 2ZX7A 4KRUA 1HP4A 3AIUA 3WD1A 8A3HA 5KZ6A 4RE4A 2X8RA 1WZKA 3L4YA 4JKKA 4GZEA 3CZEA 4KMQA 4EKJA 1X6NA 4B16A 2YBTA 1E6SM 4C7GA 3VIHA 5AC4A 3K4AA 4R27A 4GO9A 1TZ7A 2GJXA 1UD6A 5E6ZA 3WQ5A 3RO8A 1TVNA 1HKMA 4MNKA 2WYSA 3B9AA 2XG9A 2XUCA 5LA2A 4TVDA 3MUAA 3GBDA 2OWWA 2BFGA 1KXHA 4P8WA 4GI6A 4AWEA 2XFFA 1K9EA 1DP0A 1OGSA 3FAXA 1GOOA 1FHDA 2Q8XA 2VRQA 1JYVA 1LWJA 4AD2A 5I24A 3ARSA 1GOWA 3CZLA 4J3UA 2ZUSA 1L0PA 3I3DA 4FLOA 3WD3A 4CD8A 2YDRA 2WHKA 1B31A 5LYRA 5C70A 1UD3A 4J27A 3GM8A 3VMNA 4HZ8A 4TXEA 1CGXA 2A3CA 3IANA 3WUFA 4TX8A 2G41A 1H41A 1SMDA 4IPLA 4OIFA 3AHTA 2DT1A 2WHJA 4MAZA 3WMBA 4LQ1A 1FP9A 4HA3A 4EANA 2JF7A 2CHNA 2CETA 1G1YA 3EDFA 3MMWA 1JFHA 5JIWA 4DWSC 3AMGA 5A94A 3CZGA 2VMFA 4UFKA 3SCOA 3PZIA 3I3BA 5D8WA 3VGBA 4IISA 1XH0A 3ZSSA 3WQ4A 2ZUMA 1C92A 1NARA 1GNXA 1BYAA 4Q7NA 1JF5A 3WD4A 1WDPA 1QNPA 3ZT6A 4BF7A 2CIPA 4UQCA 3VU2A 3K46A 1FH9A 4J3SA 4BZYA 4PYSA 2V3GA 2CCRA 2W63A 9CGTA 1W9BM 3WF4A 1H1NA 3WQVA 4GI8A 4ZENA 4H8VA 3DYOA 3AOFA 4RE2A 3VPLA 2ZXAA 1TR1A 1R7AA 5HDRA 3TONA 1E40A 1HXJA 3M07A 2VQTA 2FH6A 4CUCA 4MTVA 3BAIA 1GORA 3UG3A 1O7AA 2V5DA 4XX6A 3WN6A 1E70M 2PWHA 3J7HA 6CGTA 1E4MM 5AYIA 4MB3A 1VJZA 3AZSA 5A8QA 1R87A 2WSKA 4YPJA 3NDZA 1UH2A 3AQUA 4JAWA 3QHNA 4JCLA 1BHGA 3ZJ6A 5BWFA 1WZMA 2YKKA 1GOIA 2VJXA 4M82A 3WF2A 4PTXA 1CXLA 4CVUA 1OIFA 2BHYA 1OINA 2XM1A 3LMYA 1C8YA 1ISYA 1ZBWA 4HOZA 1Y7VA 2CKSA 4GXPA 4AZCB 4F8XA 1V6VA 2Y8KA 1GJUA 5GNZA 1NP2A 1UWRA 2D0HA 4C7DA 3L2LA 3F5KA 4CN1A 2BY2A 1E15A 3VD4A 1MW1A 1C3FA 5BRPA 1K9FA 2W61A 2YDQA 3AICA 5DT5A 1OD8A 2WM0A 1HT6A 4M56A 1VJSA 5CPQA 1HKJA 4W87A 4EK7A 3G6MA 1ESWA 1KCLA 4JFTA 3FHAA 1IV8A 3SUWA 2ZUUA 1EA9C 1V3KA 1LWHA 2J7EA 3AIBA 4J28A 3WUBA 2XYLA 1H11A 3AIVA 1CGYA 3ZJ8A 5A6BD 4PMDA 3NDYA 4WSJA 3KL0A 3N18A 4W86A 1MQQA 1PPIA 2DIJA 2WLYA 3OZPA 2DH2A 3ZT5A 1VB9A 1QI2A 3EDEA 3UG5A 1NM9A 4WSKA 2E9BA 4QP0A 4ZXOA 3VDAA 5EFFA 2AAAA 3PZOA 2O92A 1RP8A 3UETA 2CXGA 3AMKA 1EQPA 3FXYA 5A8OA 1G0CA 5E09A 1ZU8A 3OA5A 1OGBA 2O9TA 1CENA 3RPMA 2QV4A 4B9YA 5A8NA 1FFQA 3RIKA 1HJUA 3U57A 1V3HA 4M8UA 1C7TA 1BYBA 5FD0A 3KZSA 2UY3A 4DWSB 2CYGA 1HN1A 1B2YA 4AZBA 1R8LA 2Y24A 4AXNA 3AMCA 1R7OA 2EPNA 1PIGA 1VAHA 1V02A 1Z32X 4OOZA 1WB0A 3WF1A 4AY1A 2V5CA 1JAEA 3HJEA 3T2OA 1V0MA 3ARRA 3T2PA 2G8ZA 2WLZA 2G3IA 4PEEA 5GPRA 1NH6A 4LYQA 5E0FA 3CZJA 3SCVA 5A6AA 2NW0A 3CUGA 1VFOA 4UFIA 2OSYA 2A3BA 3WNKA 4Z2HA 2WWCA 2AMGA 3RM8A 3WUGA 2EPKX 1VEOA 1UR8A 5M3WA 2XTKA 3GNOA 1I1XA 4OBSA 2WKLA 1OWQA 1YHTA 4J3XA 1MVYA 4A3YA 3EBVA 2YL5A 3E1F1 5E6YA 3CH9A 3CHDA 4P7LA 1B3VA 4PRWA 4OJYA 4UOQA 3WQ8A 3FY1A 3B8SA 2YA2A 4W5UA 5FCZA 4MAVA 3ZT7A 3UR8A 5I6SA 2YA0A 2YBUA 1PIFA 1JNEA 3MUIA 1ITCA 1HIZA 3ECQA 1KXVA 5M03A 3ARXA 1GONA 1BFNA 1WKYA 1ZL1A 2WANA 4H7VA 4NF7A 4UCFA 2XHYA 4QDMA 1BG9A 3WD0A 4J3TA 1EIBA 1TFVA 3SCQA 1H0GA 3RILA 3ZR5A 1UA7A 3UEQA 1KB3A 3VIIA 2WMIA 1RD6A 1IZJA 2WC4A 1WDSA 1LL6A 2DSZA 3PZUA 1UKPA 1WO2A 3NSMA 1G5AA 4GIAA 1H4PA 4AZHA 4H8UA 3VKKA 1W32A 1JZ8A 1DHKA 2IXUA 4UOJA 3FAWA 4ACZB 1OCQA 1DEDA 3VDCA 2D1ZA 2D3LA 1FA2A 4JHOA 3A6OA 4QCEA 1OGGA 2E40A 3OLGA 3U7BA 2ZWZA 1JI2A 2J78A 3AISA 5A6MA 3POCA 3WL1A 1JYWA 1BVNP 2WZHA 2OYLA 1CGVA 1D2KA 1CNVA 1VFFA 4NRRA 1E0XA 3DECA 3M6DA 4AD1A 1TA3A 3CBWA 3ARTA 4D6CA 1BF2A 1HVQA 4MB1A 1JNDA 3OGSA 4CGTA 1E6QM 2W67A 4PUEA 2GFTA 2PBGA 1J0YA 4ZE5A 3BAJA 2VZVA 3VDBA 1MQRA 5BXTA 2VCBA 1GOKA 2XFRA 3L2MA 2J25A 4JFVA 3RJXA 4OOUA 4UTFA 5E70A 2WVSA 4FLSA 1B30A 4QFUA 1E55A 2YIHA 3L4WA 3UG4A 2DPEA 3LPPA 4TTGA 3AZRA 1WZAA 3CPUA 4HA1A 3HMCA 1GQKA 1UOKA 3KL3A 2J75A 4AZIA 5AC5A 1Q6CA 1MW0A 3ZJKA 3BH4A 1LJYA 3ZO9A 4MNMA 1B3ZA 3AXHA 1XYZA 3AIRA 5JBDA 3DYPA 1RP9A 3SCTA 7TAAA 2WHLA 2W5FA 1WNOA 4WKHA 5I23A 1UWUA 4IUGA 3GXDA 2G3JA 1QI3A 1US2A 3ZOAA 1CWYA 5CLWA 3BSHA 1JG9A 4HOWA 3G6LA 3EMQA 2VQUA 3F5LA 2J77A 4KH2A 1HJWA 4BQ3A 5D9OA 1CLVA 2D24A 4EE9A 2C7FA 2VVSA 2VL4A 1MFUA 2VCCA 3AMDA 3AI0A 2VZOA 1Q6FA 3EMCA 1QHOA 2WBGA 3DHUA 2J8FA 1E3XA 5GNYA 5EBAA 1QW9A 1UH4A 3ZIZA 4C90A 1DWAM 1E4LA 1JDDA 5FIPA 5D9PA 4WIWA 2NSXA 1XCWA 4XUYA 3IK2A 5D8ZA 3WELA 4Z2GA 1M53A 3HU7A 4D6FA 2WPGA 6A3HA 4PTWA 4V27A 1KXTA 1VIWA 3WF3A 4FK9A 3LPFA 5FL0A 1CZ1A 2Z1SA 3PZMA 2A3EA 1GOQA 2XWEA 1XYFA 4HPGA 5A6JA 1VEPA 3AMLA 3MMDA 3T2QA 4DUXA 5A69A 2GUYA 3I3EA 1PX3A 1W3LA 1E5JA 3VM7A 4N42A 3MKKA 5A6BA 4C7FA 5AYBA 1RH9A 3U7VA 5A2CA 7A3HA 4U33A 4H41A 3WQWA 5A6SA 2CBJA 4L4PA 3VILA 4W5ZA 1QHZA 2CBVA 4ML4A 1X6LA 2J7GA 2DDXA 1J0KA 1W1YA 1UYQA 3OGRA 1UQZA 3SIMA 3VD5A 3ZJ7A 3N1AA 2DSWA 3M7SA 1UKSA 2GJRA 3A4AA 4V2XA 1C93A 2WC3A 3CHEA 1XCXA 3FHQA 3WQ6A 1LF1A 2W4XA 1XGZA 2XFYA 3VIOA 1PZ2A 3TTSA 2VNCA 3CUHA 3RM9A 1JL8A 2WMIB 1MW3A 2W62A 1A47A 4LYRA 4B15A 3LPGA 3QGVA 1UQYA 3B9DA 1DWIM
chains in the Genus database with same CATH superfamily
4KERA 2DZVA 2PDKA 4DYKA 4O1AA 3TYDA 5A1AA 5DXXA 2WV8A 4XV0A 3I7QA 4QJ5B 4GQQA 4X61A 3QV7A 1GKPA 1E0TA 4YVPA 3EB2A 1H7OA 3HA1A 3N2CA 1KM6A 3L4TA 4NZCA 4L1GA 1MXDA 3NO5A 1CIUA 3OLIA 2C71A 3LV5A 5D30A 1VEMA 3USBA 4D72A 3W1PA 4JIHA 4ASTA 5A8PA 1LRTA 3KM8A 2Z7KA 1OX4A 1FUYA 5ABGA 3CZ8A 3DAQA 3T1GA 4W89A 1CDGA 2QJNA 1B3XA 3W1XA 4L6HA 4P7QA 3AHXA 4C1NA 3RLHA 3TKFA 3H54A 1MRAA 5CC5A 3M0JA 4TX6A 3PPGA 3PHAA 4AQLA 4DWSA 3UR2A 3W0KA 2ZX8A 1W2VA 2XSBA 2HXTA 3LPOA 3AXKA 4AZ7A 4RDZA 5TNVA 1TPC1 1KNWA 1H63A 5MKGB 4UQ9A 1W9PA 4QEHA 2GVGA 3SRFA 3LXBA 3QLDA 1U83A 4GKLA 1JZ5A 2OYKA 1I75A 1W91A 1VFMA 1FWDC 3DC0A 3BGAA 1C91A 3UT0A 2PTXA 2OELA 3B0PA 1N8FA 1H1ZA 3CT2A 4HN4A 1DTUA 1JCYA 2DGAA 1J0ZA 5H91A 1NTHA 1U2YA 3S5YA 2F8QA 4ICNA 1S5NA 6PTDA 1KBLA 1YXYA 2OYMA 3LZ5A 1GYLA 3GHUA 3W7JA 4DO6A 3B8IA 1XLIA 3B9NA 4HTYA 4UTMA 1MZHA 3S9IA 3EYPA 2IMRA 1XICA 1U5JA 1V6XA 3SW6A 4Q4OA 3W2NA 3RX3A 3NUKA 3KRUA 4HPJA 4CD4A 2QHAA 3IPWA 1KRMA 1WAUA 3GVVA 1AH0A 2ZADA 1UUOA 3VKJA 1H0IA 3LYEA 3NOYA 3MKVA 4M51A 2WAGA 2PLKA 2VX6A 3DBNA 4Q7IA 1GQNA 2QKFA 2XU2A 4C6CA 4S3BA 2CZEA 2WQPA 1EX1A 4MVAA 5DMYA 3VVGA 3ONCA 2PZNA 2FZMA 5D2VA 1K8YA 3URQA 3PZGA 3AXXA 3VOCA 1KFBA 4RV8A 3CQJA 1FWTA 3W4RA 2IQTA 1VIZA 1K6AA 2GSJA 1JZ4A 4Y9MA 1TA3B 1DQXA 3A5FA 4V28A 3E0FA 3APGA 2WSPA 5JUVA 2CC0A 4S38A 4MYXA 1H61A 3FX4A 1PAMA 4CD7A 3RPDA 3TW9A 1MO0A 3TH6A 1W1VA 5DEZA 1OG0A 1A4LA 4LU0A 4JIEA 3L9CA 1LOQA 4DJEA 2DU2A 3B04A 4DNMA 1V93A 3W86A 2A3HA 1K7EA 3DHPA 1OG6A 2ZXDA 2FHCA 1AQ0A 1Q2SA 1LYXA 4JS3A 3GH5A 2X16A 1O5KA 4D1JA 4IJCA 5T9CE 2Y6ZA 1KM4A 1LG1A 4LV4A 2W0UA 4H6EA 3R13A 2WMKA 2POZA 4FNRA 5FJRA 2HMCA 3EPMA 3F7JA 1XLDA 1GKRA 5CGTA 4MWAB 1EX5A 4NUWA 3PFRA 3W9ZA 3WK3A 4B5WA 2XSXA 1PKNA 2VR5A 3S8HA 5LHFA 1Q66A 5LGZA 3Q65A 3IIPA 4JX4A 2VFGA 1EEPA 2Z2UA 4L7ZA 4OQVA 2AKMA 4PSRA 4I7VA 4DEFA 2YDAA 4PRTA 2Q09A 4XZBA 2RGMA 5FEWA 2V5LA 4Q6XA 2ZUWA 4ACZA 3ATZA 1Y0EA 1XF0A 4PMOA 1BYDA 5J5DA 4HCLA 8TIMA 2DZAA 2JGYA 1BWKA 2AAMA 3WENA 3CMJA 5FKYA 1Q6DA 3NL2A 4ACYA 1EFZA 5HPCA 2DIEA 1GVYA 3LG3A 4X2PA 1MEWA 1HJXA 4IGHA 1J6PA 2L5HA 2NUXA 4IFKA 3GY1A 1UHVA 5G4EA 1RSCA 1ODUA 3MSGA 5I2UA 5DT7A 4O15A 4S3CA 2NLIA 2OG9A 4S2BA 1OFOA 5LNSA 2OZ3A 1M7XA 1YEYA 2VCAA 4B3KA 4KWVA 1AQFA 2IKIA 2O7SA 1RPXA 3LD5A 3MDUA 4W7VA 4AMAA 3N4EA 4H2CA 4PA8A 3GNRA 2CESA 4O0QA 4LNYA 3IJDA 1AL8A 2VDIA 2WB5A 1FY6A 1PTAA 3THCA 3GW0A 2QDDA 3E6EA 1FHUA 5CAHA 1EJUC 1Q8AA 4ILSA 3WK0A 4LEFA 2JKPA 2A7RA 4LAZA 1FTXA 1UR3M 1GVEA 2XZ9A 3S6TA 1SM9A 1TJPA 3RX4A 1K7XA 2QQ6A 4GG9A 4DM1A 3AIWA 4UXDA 2G37A 3CH0A 2XVKA 3NIYA 3TTYA 1J2BA 2WJFA 1W3KA 4HN8A 4E2DA 3M5ZA 1LWIA 1NF0A 2R8WA 3BQ6A 3PTMA 2X1UA 2E6FA 3WH8A 5XIAA 3EGJA 1JD9A 5LHEA 1FWEC 4JTIA 4HA4A 3BMVA 1FRBA 1DWJM 4I9MA 1R9ZA 3AWNA 1QK0A 2J7DA 1V3IA 4PB4A 3FGCB 4FXSA 3QV8A 5DCDA 1AZ2A 4N9CA 4A8RA 3HB9A 4ERIA 1EJRC 4JTKA 3EMZA 1W6TA 4WKAA 3PJUA 3KOYA 3LEPA 7XIMA 5DRIA 3BAYA 5ABHA 4C5YA 3SFWA 1BXBA 1TJ2A 5AHIA 5CZTA 1JFXA 3UA3A 4DUVA 4IF2A 2XM2A 4BI7A 4GY1A 4NJKA 3VOGA 1SUXA 3OZOA 1CGTA 3P6LA 2YXGA 5JH2A 1FCVA 1HTIA 4ES4A 4FOKA 3W7MA 3KVMA 4R7JA 4WKFA 4MGGA 4NKCA 1SO4A 1NQ6A 2AL1A 3HV8A 3QHOA 2V0TA 4NI3A 2JALA 1Q85A 3S3GA 1FXPA 3JRKA 1JIBA 4PEKA 1JZ6A 1JAKA 1H2JA 2YCJA 3BOFA 3UVAA 1MNZA 1VENA 2BXZA 4H83A 1V0LA 2YB4A 1BQCA 3B9OA 1XHGA 4GZJA 1B9ZA 5HBFA 1Z7AA 3N15A 2DORA 2C16A 1M6JA 1SSGA 2ZDSA 1K9DA 4LS0A 2JE8A 3LZ3A 5CC3A 1UH3A 1TPDA 5HQLA 2QPSA 5I3KA 1DWHM 4DO4A 4KPLA 3SCWA 1RJRA 3VIGA 1H50A 2WKJA 4GI9A 3B97A 1BEUA 4K38A 3W7GA 4DWSD 3GIPA 4FOUA 3T44A 9XIAA 5C6MA 2PDBA 1FWSA 3REQB 4B4HA 4MDPA 4OV4A 2VEFA 1YQ2A 1LG2A 3NPXA 3O2LA 1JZ7A 2R82A 3GXMA 3C8FA 1ZJAA 4NL1A 2DSVA 2GK1B 4W8BA 3W27A 1SJCA 3T81A 3W6LA 1DOSA 5EYWA 1XWYA 2FH8A 3IJ9A 1RCXB 4HPHA 3VIMA 1WOBA 4WGXA 1CBGA 4LUIA 1J96A 4FMVA 1J8VA 1SO5A 2WVTA 4KRZA 3DHDA 1A0DA 1C8VA 4QJ1A 4REQB 2V3FA 3C3NA 3W2UA 3L5LA 4GC4A 3OA3A 4FF5A 3CLWA 2WVVB 4GOAA 2FVLA 4M81A 2CZFA 3RCNA 4PTVA 2Y8UA 3TTEA 4S3FA 3R8GA 3KVKA 2R1PA 2TYSA 4LT9A 4Z1AA 2QUTA 3OQ8A 4MF4A 1VPYA 3KP1A 5K4XA 3K1GA 2D22A 1SR0A 2YZ5A 4QQUA 3CB8A 5H6HA 1M1BA 3SQLA 1W56A 3GU9A 2VDGA 2X42A 1UA3A 2G3NA 3FFSA 1BXNA 3FKRA 1UUMA 3E3HA 3CC1A 2PDWA 3L67A 3L4VA 3K1DA 5DO8A 2J7BA 2BXVA 2DY3A 4IWWA 5T9BG 4N6FA 1MFVA 2X41A 1OT1A 3BW2A 3WEMA 1V08A 4M7SA 3EB3A 4I5RA 4TVCA 4C6EA 3E2QA 2PCEA 2QMKA 1J0JA 2FJKA 3CUJA 5JBEA 1W2PA 3E9AA 3SUVA 1S39A 3SCNA 2ZXQA 2QF7A 1POKA 1V3LA 2X09A 4QLJA 4R9OA 1P6CA 1IXNA 4WK9A 1WZLA 3PPHA 1L6GA 4CN6A 1MEHA 1IE7C 2X0YA 3M5VA 3VABA 1S2UA 4POCA 5IHSA 4DAIA 3K8LA 2JBMA 1QFEA 3S5NA 1GVIA 3U2EA 2ISDA 1ONXA 3CPRA 2BXYA 2VOMA 4QR6A 1TPH1 4DO5A 1RR2A 2XN1A 4P5UA 4HMEA 4QNWA 4NILA 4F2UA 5LXXA 1T8XA 3SGZA 4QTGA 4QEEA 1MUCA 5LNUA 4XZMX 4UMBA 4NJIA 1W1IE 1BKHA 4GXWA 1TPB1 1FH8A 3H53A 1KQZA 4Z1CA 1BGAA 1Y8BA 3OLEA 5HNTA 5AKQA 3L23A 3QOMA 1WV2A 2D2OA 4IFRA 2BNJA 3MY9A 4YWSA 4A3RA 3PZVA 1SJAA 1J11A 2C3ZA 3S6DA 3WNNA 2I5QA 1XLGA 4YHGA 3L0GA 2Z1VA 3MBFA 3CUFA 2ZX9A 4BFAA 4LTSA 4XZIA 4NAFA 1VFTA 4UR9A 1TV4A 1EZWA 5HNNA 3PF3A 3EX4A 3O06A 1OCBA 3R2GA 5A6TC 3GR8A 3S2NA 1JYXA 4UOZA 4RXGA 3VNDA 2W91A 1OFAA 2J9XA 2DEPA 4BJHA 2E8YA 4Y96A 1YW1A 3SADA 4MKNA 3S6OA 1QTWA 1UKTA 2QNEA 2PRMA 1KCKA 3OU8A 4GE8A 5T26A 4GX8A 3VE9A 2B81A 3UXDA 1QOPA 4OGZA 5D05A 3WO8A 2EPLX 1C9WA 1XLHA 4IPJA 3VX0A 1TVLA 1HL9A 4G2DA 1E6NA 4KFPA 4YYCA 4MY9A 4Z2LA 4G5DA 4EF9A 3VTRA 4AXKA 4X60A 5GQBA 1JEZA 4PMZA 3MP5A 2CHOA 4E3TA 5C5YA 1MI3A 3CZKA 2HVOA 2PU1A 1TO3A 1ZBVA 4GXMA 4GABA 3U3HA 2Y2WA 3IGUA 4KEMA 1UG6A 3FDGA 3WBEA 3W7DA 1QI4A 3GTIA 3BQ5A 4XVEA 3BO9A 3NZGA 4CU8A 2NT0A 1RXOB 5EA9A 3NG3A 4H9XA 1MNSA 3ARVA 5EMJA 3QRHA 4QLLA 4CQBA 3APYA 4Q32A 1XBYA 5M17A 4R53A 1VYPX 3U5YA 2BY0A 5CPMA 2ACUA 4OVXA 3TN3A 3W7RA 3P74A 1OB0A 1V0KA 3AIEA 5FF2A 2PDFA 4P8VA 2KAUC 3BLKA 5XINA 3TUUA 4HMDA 3PBMA 5I3GA 3ZR6A 3O16A 4JFSA 3DOPA 4ZO7A 1PDZA 1K8ZA 4PCFA 1KXQA 2OPJA 2BBFA 3RLVA 2VUYA 2Y89A 5CSUA 5FF4A 3OVGA 3DFHA 2PDNA 1EZ2A 1MWOA 3EOOA 2JF6A 1GW9A 4IFOA 3I65A 2XDFA 4CNOA 1JPIA 1IT7A 4CCDA 5U7SA 1AMYA 5LNWA 4HCDA 4PN2A 3G5EA 5CG7A 4Y9PA 4L9XA 3BAWA 3REQA 1IZKA 1BRLB 2YCKX 2OSWA 3P93A 1KFWA 2QF8A 5CGQA 2A85A 3BMWA 2BASA 1H5VA 4E8GA 2Y61A 4GUGA 1PV8A 2V3DA 3LCLA 3CUXA 4MPKA 3JZEA 3KCOA 1XQKA 2TAAA 1OHLA 3GTHA 4H8HA 4UBPC 2FLIA 4E8CA 3L7RA 3QQ1A 1M01A 1ME7A 3QMTA 3TR9A 3W38A 1EHNA 4MLJA 4JTHA 4AEOA 2MUCA 2EG6A 3WMSA 5IBXA 2PCQA 3EAUA 4WX2A 4FLQA 4HYVA 2GJXB 3FSUA 4LVDA 4DRSA 1NU5A 1VF8A 4MADA 2OLSA 1CB2A 3GNPA 1LZOA 3RLGA 5LKYA 1XG4A 4JY9A 3VCNA 4N6EA 4LH8A 3WX7A 4PMJA 4GNKB 3WYZA 1YDOA 3MBDA 1G4PA 2IS7A 1E9IA 3IEBA 1VH7A 8RUCA 1XLMA 3CO4A 3DC8A 1F8MA 3WUEA 3V5OA 3WY1A 1VHCA 1VPXA 4CD6A 3QOKA 1PX8A 3KDOA 3PTKA 2GQ8A 4Q4PA 3LHTA 4PCPA 2V82A 4RE4A 3QH2A 1TPVA 2VGFA 1ZP3A 2HXUA 2F84A 3TX9A 3NQEA 3CL6A 3V36A 3E0IA 3K4AA 3O6CA 2GJXA 1QWKA 4IQEA 3T07A 1QU4A 3UXLA 2XG9A 2XUCA 5LA2A 3A23A 5GJNA 2F2KA 1YNYA 1ZFJA 4P8WA 4GI6A 1JDFA 2XFFA 1F5ZA 1SFTA 2NWSA 1DP0A 4LNCA 1TV2A 1G4SA 2GL5A 3VZZA 1F07A 1XR2A 3UZXA 4KW2A 3ZWTA 4HD5A 1MDLA 4K7YA 5LYRA 1WX0A 1UD3A 2V8ZA 1Z69A 5DMMA 5F1UA 2A3CA 4G56A 1QASA 3N29A 2G41A 1SMDA 3S1UA 3R11A 2WHJA 4MJMA 4AYGA 4KEVA 3KCJA 3WMBA 1UB3A 4QHRA 3U2ZA 4HA3A 4EANA 2CHNA 1OCJA 5DX7A 3PSVA 5JIWA 5A94A 5HMFA 3D47A 1DORA 3PZIA 3VGBA 3E74A 4QQ3A 1C92A 1GNXA 4Q7NA 1QNPA 4BF7A 2CIPA 3WQDA 3ZLHA 4L5ZA 1TREA 2YW4A 2W63A 1KTCA 4H7CA 3WBYA 3C0LA 4FXFA 4XKMA 3AOFA 4GC3A 2I56A 3VPLA 1M9HA 2ZXAA 1JQVA 3BLLA 3H2CA 1R7AA 5HDRA 1G6CA 3ZZ1A 1E40A 1YYAA 1EUAA 4GMEA 1LUCB 1OX6A 4KCUA 3OODA 1BRLA 1GORA 4LRTA 4AH7A 3VZXA 3RO6A 2V5DA 4U4MA 3SI9A 1ZTVA 1W54A 4JOMA 1VCVA 3OHIA 3LHUA 3BK0A 3TYZA 1LTDA 3IIVA 2H8ZA 3N9RA 1EYEA 3QHNA 1ZLPA 3G1YA 1BHGA 3QMRA 3TW7A 4YMZA 4RR4A 1XBXA 4O50A 2OQYA 1A5OC 5KITA 2OXNA 1CXLA 2EAWA 1PZ0A 1OK6A 4EXQA 4IQJA 2XM1A 1B3OA 1C8YA 4GNVA 3CT7A 1GVRA 3MP4A 3KOWA 1PE1A 3H4GA 4DZAA 4Q4MA 3HPFA 3ZVHA 1S2CA 3XIMA 3GHSA 6REQB 3LSCA 1MW1A 5H8UA 5BOFA 3P2VA 1C3FA 2HJPA 3G24A 3W83A 5BRPA 3MI2A 2W61A 1JCTA 1HT6A 4M56A 6ENLA 3FA3A 4XO7A 1KCLA 4JFTA 3LI0A 3GDTA 2V5KA 3NVDA 2ZUUA 3TZFA 4IUOA 4UC5A 2PMQA 1V3KA 5CC7A 1ZCCA 3S47A 2J7EA 1GYMA 4LS1A 1IGSA 3NQMA 4J28A 1H11A 5K9XA 2A7PA 4GFSA 2ALDA 3PC0A 3QY6A 5D38A 3UZWA 1XISA 4WSJA 3GU1A 3KL0A 3MTWA 4W86A 4I3GA 1MQQA 4EPBC 2WLYA 3ZT5A 4KCTA 1QI2A 4XG1A 3EDEA 3U6WA 1NM9A 3CUZA 1EIXA 2XGZA 4EPEC 3VDAA 3SSZA 1AL7A 1YIXA 2NUWA 2PODA 1RP8A 1EQPA 2OT1A 3UYCA 1CI1A 1OGBA 4L64A 2O9TA 2PDMA 2V5JA 1S2TA 3QKZA 1EJWC 4B9YA 2XIOA 4GUHA 4NJJA 3U57A 4M8UA 3COTA 2IPFA 1K03A 2D69A 2BZNA 1W5OA 4GRSA 1PKLA 3P82A 5K7JA 3B0UX 2CYGA 4XAPA 1R8LA 2Y24A 4ZQNA 4AXNA 4J1OA 2GPTA 1R7OA 3AMCA 4EPDC 2G96A 9RUBA 1V02A 1Z32X 3CYVA 4OOZA 3WF1A 5LSMA 2V5CA 3HJEA 1O1ZA 4I5XA 1JPHA 3NL6A 3KS6A 2Y7DA 3VKAA 3I68A 5HNRA 2A79A 3Q45A 3QQ0A 2G3IA 3OBKA 3SCVA 3W88A 4AF0B 5D32A 3ISIX 1JCNA 3WUGA 2EPKX 1VEOA 1TE6A 1PL9A 2XTKA 1I1XA 4GGHA 3RYSA 4J4KA 3AO0A 1J6OA 4J3XA 1MVYA 3TQKA 3NURA 1X7IA 4P7LA 2WO5A 1P5BA 3WQ8A 3N6HA 2QCCA 3UR8A 5I6SA 2VC5A 2YA0A 2Q6ZA 1JNEA 3GX9A 3HFYA 3LMZA 2VFFA 3ZR4A 1GONA 2ZA2A 4UCFA 1ZL1A 4NF7A 1S1RA 3L66A 1BG9A 3BARA 1XLLA 3THUA 3UWWA 1TFVA 5MF5A 4IXHA 4R3UA 1H0GA 1Q7QA 3VKDA 3THQA 1UA7A 1KB3A 1RA5A 3VIIA 4KQNA 4HA0A 4CNSA 4E2VA 1IZJA 3VC6A 1F61A 1WDSA 3M0XA 3A3WA 3U4FA 4PB5A 2FDSA 5DXYA 4Y8EA 1WO2A 3NSMA 1H4PA 2Z28A 1S5TA 2XFWA 3NPWA 1J2WA 4N4PA 2NX9A 3QBUA 4W4QA 4MUZA 1P6BA 3LU2A 2IKHA 2BOFX 1LP6A 2F6KA 3S1WA 4B5SA 1EP1A 3CWHA 1XG3A 4PRRA 1RQHA 5E9XA 4HT3A 4INFA 4IZGA 2J78A 3TC3A 3CM4A 2V69A 3GG7A 1X8FA 3FJ6A 1QJWA 1A5NC 5HUPA 3W7PA 2OYLA 4Z08A 2V81A 4J40A 1E0XA 3M6DA 4AD1A 3UG8A 3RU6A 1TV3A 3H2EA 4V33A 2RJHA 1XRTA 8XIAA 3WG6A 2PBGA 4DPQA 4LVFA 2VZVA 3BTNA 1GOKA 3L2MA 4HQVA 3NEHA 4MY8A 3DFQA 4XQ6A 1B30A 4W9TA 2INZA 3GR4A 1E55A 3L4WA 2DPEA 2QEZA 3LPPA 2DVTA 4HA1A 2OQLA 1UOKA 1A49A 2J75A 5I06A 1Q6CA 1DE5A 2NQ9A 3T4CA 4WGHA 1JUKA 2CLKA 3EWBX 1OF8A 1QXLA 5G1TA 3NOEA 1OFDA 5J5RA 3FKKA 5JBDA 3DYPA 1WXYA 3GE7A 7TAAA 3E0WA 4WKHA 2Z00A 3HQNA 1X98A 1UWUA 1VR6A 3GXDA 1E51A 1OYBA 3ZOAA 4WQ6A 4PBEA 1O95A 3M41A 3G6LA 4HB7A 3EMQA 2OGYA 3B8TA 3IWPA 3VCRA 3O63A 4ZMGA 3VYLA 2C7FA 3LB0A 2VVSA 3WQGA 3ID7A 4K1GA 4A3QA 3AMDA 4Z0SA 4C6JA 4K3ZA 3UGRA 1Q6FA 3R79A 1RBAA 2WBGA 3CAWA 2X40A 4U10A 1XFCA 3DHUA 2J8FA 5EBAA 2HS8A 1UH4A 3ZIZA 4C90A 1N7KA 3W71A 2QGHA 5D9PA 3DFTA 3ONBA 9XIMA 4XUYA 2ZRXA 4OECA 3NWRA 2OB3A 3EKLA 4RPPA 3UZYA 1KXTA 3OPSA 3N2TA 2P5NA 5HMEA 2Z1SA 2XIJA 1XYFA 1RY0A 2ZDRA 2WNQA 4GCXA 3T2QA 3L68A 4H1ZA 5A69A 4JTGA 5AHEA 4N42A 4F0RA 4AY7A 1H62A 1UW9A 2PGRA 5AC6A 2Z1WA 3WQWA 4O28A 4L4PA 1G67A 4UCGA 4O8RA 1QHZA 1TV5A 2CBVA 4LB3A 4O8AA 3M0IA 3LGGA 3DHFA 4NASA 1DVJA 2OO6A 5JU6A 3LSBA 4ENLA 1O66A 3LQLA 2HBXA 5TF0A 3AUOA 5AVNA 1LF1A 4K8EA 3BURA 2XFYA 1A5SA 4HTBA 1K3UA 2WMIB 3TN6A 4D8ZA 3EA1A 1NJJA 4EPKA 4B15A 2HK0A 1UQYA 4ZTYA 3B9DA 1E3ZA 3UWEA 3F2DA 1QCWA 3WMCA 4AIOA 4MOZA 4DF2A 1SO6A 5CPSA 2I5IA 5JBFA 1W9UA 2XGBA 3H2AA 1PJ9A 4WDTA 4WDWA 1PX4A 4PUJA 5I7GA 4NVTA 3ANUA 4M80A 3DI0A 1NDVA 1KV8A 2FMOA 1H51A 2ZYFA 4MLRA 1F6YA 4KCWA 3S5ZA 4IPPA 1GZJA 3E0VA 3OHMB 2PE4A 4X22A 1S5VA 3W26A 4CEXC 1VFUA 2ZBTA 2ZRVA 3QC0A 3WZ0E 1K9TA 1VGAA 5C9UA 3K2GA 2Z6JA 1GVSA 2OJPA 3D46A 2VEKA 4JL2A 2HSAA 3WDHA 4PMUA 4XIMA 4UR7A 3T09A 3O07A 1BSIA 1DJYA 4HOXA 3OBAA 1JRCA 2VURA 2FZ8A 1E0WA 3RDKA 1R5YA 3LCGA 3KBVA 4UFMA 3WNPA 3WLOA 4EIVA 3H21A 4EVZA 4AVFA 3KL5A 1TMQA 1FKXA 3CQIA 4Y9OA 1FCQA 3VOJA 2YBVA 1QVBA 1RJPA 2J8GA 3PB2A 4PMRA 4G7EB 5HNUA 3N6QA 3F5JA 1S46A 4Q22A 1JUBA 1TUFA 3AJ7A 1M5WA 3FS2A 4GI4A 3FSTA 2PPGA 4IMDA 3Q37A 4K37A 3KUMA 2RJGA 4B2DA 4JTJA 1PO9A 4Y7EA 4JQ4A 2GGGA 4JKLA 5B7ZA 5I3IA 5DBUA 1ITUA 3UU0A 2DZSA 2VD9A 4KWSA 3VIJA 5AY7A 4PUMA 2YPIA 4X9SA 4HU0A 5I78A 1QNOA 1TWWA 4M5PA 3MS8A 4M0XA 1OFBA 1GG0A 4DXXA 2QCMA 1XDJA 4ZZ9A 3N13A 4GQRA 4RL3A 1DJQA 1U30A 2J62A 4PTNA 1HNYA 4DJFA 2ZWYA 4OU1A 2PDLA 4H00A 1ZP4A 4WD0A 4GPNA 3UXIA 1JGIA 4C91A 1NOUA 4N4QA 2J47A 3E12A 3PB0A 2DFAA 2QPUA 2PDIA 3PZ9A 4GH3A 4Y6GA 4LF1A 2XJ7A 3QVQA 2EPMX 3JU2A 3DFYA 4K1WA 5MKGA 3U48A 4S3JA 3WBAA 1Q45A 1CLXA 3B9EA 1NOFA 2E9LA 1JCJA 1W3TA 1VZWA 3B05A 1XH1A 2Z1XA 3BPWA 3W24A 5DRCA 4NZJA 2DW6A 2QJGA 3R1ZA 4PMQA 3GC4A 3WJZA 1JZ3A 2QUNA 4Y9AA 3CHCA 4ZO9A 5B80A 1P0NA 2E5DA 4A8LA 1N82A 4QG9A 2HVNA 3LI1A 2HISA 2FDMA 3H23A 1HW6A 1F6KA 1JYNA 2ZZ2A 1SZFA 1K1DA 1J18A 6TIMA 3VIKA 1P48A 1XYLA 3HFTA 3RNDA 3EWDA 2OODA 4UMAA 2BVYA 1OD0A 2VGBA 2POTA 3FA5A 3G0XA 3QR3A 3BCDA 4ICCX 3TYAA 1CGWA 1BLIA 3G77A 1YDNA 1W9DM 3NGFA 4L9ZA 1A3HA 3ELFA 3HQPA 5CJMA 5HULA 4PL1A 2ZZ6A 3SUSA 3R43A 3SRKA 5K9DA 1JRBA 1FWRA 1E6RA 3ZSTA 3DENA 4DNHA 4H9TA 1IEXA 1KFJA 2HVMA 5CJ5A 1LM1A 1WAWA 1A5BA 3TW6A 1EGVA 3BICA 1Q6GA 3B0YA 3OG2A 4P7RA 3UY7A 2DT0A 3TLQA 1RBOB 4NP7A 1VBJA 1WDDA 4XO6A 1W5PA 2AQOA 3BCJA 3W53A 1PHWA 3GVWA 3UJRA 2B31A 4U28A 3P8JA 3NQCA 2ZKMX 2CHRA 4C1NB 3IJQA 3SN4A 4CD5A 1JQXA 1S2WA 5EFDA 2AGKA 1BF6A 5DN1A 1PYMA 4NY2A 1XH2A 3E2SA 4XKYA 2CXEA 5REQB 2PLCA 1F8IA 3C86A 1X1ZA 3QR1A 2UY5A 4AEFA 1XBZA 5L9FA 2X05A 2IXVA 4LUSA 5A6LA 4HK5A 2VT0A 3I10A 3M16A 2VZTA 5EMYA 3RHGA 4P7NA 4Q8PA 3PTDA 4S3AA 1BVWA 1DL3A 1ISVA 1CECA 1EOKA 2X2YA 3E2RA 4ZO8A 2PU0A 2YL9A 1LLZA 4X63A 1B3YA 5HJYA 4TU1A 4HU4A 3HZ3A 2W92A 4KT2A 4LAUA 2VENA 3FYYA 1F74A 1CEOA 2BHUA 4DPPA 3JR2A 3YPIA 4K8GA 1LORA 1CXIA 4JTTA 4J3VA 4PCSA 1D9EA 5IXEA 2DSUA 3S42A 2NQZA 2WC7A 2DVXA 2FZ9A 2OO0A 5I02A 4LCSA 1Z44A 1R47A 3UJEA 4L65A 1J93A 5B7YA 1JD7A 2CZDA 1HVXA 1FWCC 2NVCA 2Y5SA 1ME8A 3MV01 4HCHA 1WCGA 1KC7A 3F2CA 1NFPA 3B0XA 4F0MA 1XIIA 2PI6A 1BTCA 4IIDA 1VBUA 2HE5A 4J3ZA 1HJSA 1O94A 3R89A 3KE0A 4U2YA 1VBGA 3TFXA 3VMOA 1EQCA 3NPUA 3S2LA 3PPFA 4U5IA 5FA5A 1KBKA 3UJFA 3GRIA 1RQEA 1R3VA 4F0LA 3D6NA 3TXZA 1I2OA 2Y70A 1EJVC 1XLAA 5AYZA 4ZB0A 2EQDA 3KZPA 1SJBA 4HZ7A 4DJDD 1T40A 4NXKA 2HWGA 4XSLA 4FX6M 1F3EA 5D2WA 2F9RA 2EPOA 1UR4A 3VMPA 3UERA 2VX5A 2VRKA 2HEJA 3MHFA 2IUZA 1CYGA 4F9JA 1IR1A 2CZ5A 5AYXA 1T7LA 1FWWA 1T96A 4BQ5A 1IEQA 3VI2A 3QZ6A 4J5NA 5G1YA 1V0NA 1EP2A 2OEMA 4MZ1A 1E43A 2HQAA 2I7GA 1KRCC 4FLRA 4P8UA 3NCOA 1TRDA 3CNYA 1YXCA 3VCCA 2FKPA 1ZBCA 2BGSA 2I17A 4QLKA 5ECUA 5HQEA 1V6UA 1R2TA 5GJPA 4FAMA 4LCQA 4UTLA 3FYPA 1XD1A 2OQHA 1ZENA 4LGXA 2CWXA 1WE5A 1YX1A 4GD0A 1KM1A 3CV2A 4KGLA 1S2VA 1FDYA 1OY0A 1BXCA 4S23A 1US0A 3GO2A 3VUPA 1KWGA 4DBSA 1W37A 1VYSX 2BP1A 3UWZA 2Q02A 5D4YA 3RM4A 2Y5EA 3DX5A 2EGZA 4AG0A 4PSPA 4S3KA 1J01A 2DT2A 3FW6A 4O57A 5I3HA 2ZC8A 4BEUA 2VVNA 2X1SA 1GQIA 3O6DA 3P0XA 3Q2DA 3PZNA 5BMWA 2EJAA 4PULA 3C0JA 4FP1A 1XSKA 1BAGA 3TMQA 2E9MA 3G8RA 5CCZA 1U1UA 5E0CA 3EDKA 4GGBA 2YB1A 1W31A 3N4AA 3CV1A 3IRSA 1RCOB 5EMUA 4M24A 4O16A 3KBWA 1ZRQA 3S9YA 4LCRA 4QNEA 2PDXA 2WPBA 1HP5A 3GWQA 4M6VA 1D7KA 3W7HA 1PB0A 3N11A 2IW0A 2G0WA 3C3UA 4XBKA 5PTDA 3C56A 2CITA 2GGIA 4W8AA 1F4HA 1K70A 3GLCA 4ZE4A 4W85A 5LIKX 3WJXA 4RDYA 2GWGA 2E25A 2B7NA 5LIYX 4IIHA 4KF1A 4CEUC 1GUVA 1TCMA 3SO7A 2ZUNA 1IIGA 3VD9A 3DG6A 4A05A 4D6IA 5IBXC 1V3JA 5D9MA 2DP3A 1JDEA 3W29A 4HJFA 2CNCA 1RK6A 1PWLA 1EPVA 2NV2A 2XH4A 4JTRA 2O9PA 1CXHA 1BPLB 3BLPX 1W1PA 3ABRA 1QNVA 3HJZA 3LGEA 4J35A 1B1YA 1KA9F 2SFPA 2KZHA 2NWRA 3AZTA 1G4TA 2ZRZA 1M03A 3I6TA 2ZUVA 5I07A 1FH7A 1H5YA 4OT7A 4X2RA 2D0FA 3ALFA 4RX0A 4DBEA 3N2XA 1R46A 4IP7A 3GG8A 1DQUA 1IF2A 1TG7A 2CLFA 4JBRA 3N12A 3DZ1A 4FNTA 2VUNA 1HKVA 1S3TC 2NZLA 4O52A 4Q3MA 4WXYA 4GKTA 2DW7A 5K4ZA 1UD5A 5CZJA 2E09A 1JDCA 1A80A 3RXZA 1G01A 3K13A 4JN7A 1C90A 4ADSA 1BSLA 3CIVA 3MJMA 4H8NA 3NQVA 1QBAA 5CZKA 1RALA 2Z27A 3QN3A 3O15A 2XVGA 1N2VA 4UQAA 1PEZA 3BE7A 2PAJA 1QK2A 4LX4A 3GNNA 3MPGA 5HJXA 2BHZA 1QPRA 3BW4A 1XSJA 2YGYA 1T8QA 3MVIA 5EJ1B 3QSTA 2RKXA 4KCVA 2XVPA 1GJWA 1FVPA 4LUTB 1EJTC 1UD8A 8XIMA 4E0CA 4JTUA 4AFYA 4CQAA 2ZX5A 3NZPA 1E6PA 4UQDA 2RH9A 1PUDA 1V5XA 4WCJA 3BAXA 2HROA 3S1GA 5C7HA 1GPWA 3TYUA 5CPNA 1ZB5A 3VOIA 3HPXA 3S2JA 4C6LA 2CEQA 4QE4A 1IXOA 3SB0A 4R85A 4F2TA 2F6XA 3R58A 4BQ4A 4AD5A 2R1LA 4GUIA 3W2MA 4CQ8A 5BCAA 4TUFA 1P0KA 2R24A 3OGVA 3ITCA 5EPDA 3N04A 1V6TA 4ATDA 5IRPA 3WL0A 2YXXA 3CTTA 1N8IA 5HANA 1KQYA 4MWAC 3M6YA 4LUJA 1KV5A 4AEEA 3E0LA 4QJ4B 5HWJA 4GCAA 3FDKA 4WF7A 2ATSA 1FWJC 1U5VA 2A5HA 2PWDA 4CQ9A 1A5LC 1KFKA 3AU6A 4HGXA 3VGGA 1NY1A 1BGGA 4RZ6A 1KR0A 2DZWA 3GBEA 1WQ5A 2VC7A 1OM0A 1G9HA 1V6WA 2HS6A 5DMNA 4CCEA 4N7QA 3MSDA 3NFUA 2H9AB 3VGFA 1D3HA 4AZCA 5CLTA 4ROQA 1FXQA 2E68A 4JDYA 2BGNE 3FVMA 4YTQA 1OZMA 4Z1BA 1QPQA 4XZNX 3PZTA 1TTQA 4L4OA 3HBLA 1IYXA 3W37A 4ICMA 3LNMA 1KM5A 6TAAA 2TRSA 1AG1O 1R0MA 5BRQA 3V7PA 4CU7A 3H24A 3THAA 1FBAA 4IT1A 2GWNA 4JQ2A 3SFKA 2G3FA 4DUWA 1YMYA 3TLLA 5IM51 4AHOA 2J6XA 2NX1A 4S1FA 4UNKA 2QYGA 1FHLA 2WHMA 4EXAA 2PLMA 3TAOA 5D9NA 1AODA 1KM3A 3UCQA 3QTPA 1VP5A 2PWEA 4OE7A 5EB8A 3TYBA 1QOXA 2QCFA 3RR1A 1A5UA 5EBUA 4GIRA 3ZXWA 1SVDA 4HSOA 1UUQA 2RAGA 2OFJA 3NQ7A 1Q6OA 3TYCA 4W93A 4YTSA 1XJBA 2G4JA 1R3QA 2D2HA 2P10A 3ARYA 4R34A 5IHRA 4GUFA 4LJ3A 4N9EA 2O55A 2OSXA 1QI0A 4UZUA 3CO8A 4HNUA 3AXMA 1WXZA 3S1VA 3WFLA 3EEZA 1Z9AA 3W85A 4YN5A 1ZJBA 4P8XA 4UFHA 1JUEA 2WSQA 3VA8A 3AHYA 4IQDA 3W7IA 1FWFC 1OYAA 4WLCA 3W00A 3E96A 2ISWA 3AROA 4OBRA 2PZ0A 2YDSA 3ZS4A 4DJED 4GY7A 4S2CA 1ALDA 4IMFA 2GDUA 2WMHA 2Q01A 1VRXA 4LOCA 2OTDA 3FOKA 2NQHA 3NA8A 4IJBA 2GSHA 1LL7A 3W7OA 2JKEA 5HXMA 1D3CA 3LHZA 1MXSA 4AX7A 5FL1A 4HMCA 4KFNA 4Q7BA 2VGGA 1TPWA 4Q8UA 3VXGA 1NDYA 3HMJG 4C6KA 1E9LA 2J7FA 1LBFA 3STEA 4C65A 3KOFA 5C55A 1VD6A 5GVJA 1XIMA 2Z6IA 1PVNA 2BOEX 3GH7A 3MCMA 3DXIA 3OO2A 3EOUA 4NI8A 5D2XA 3SURA 4YCPA 5CPLA 3EOEA 1E56A 3VINA 1J0IA 1R85A 4QAWA 3LXCA 2JKAA 2TMDA 5KSWA 2WCSA 4GINA 3ABQA 1NWTA 1X6UA 1NEYA 3EX2A 3LBCA 1CGUA 3FN9A 2WMJA 3FV9A 3AYRA 2DIKA 3AXIA 3NDOA 2Z26A 1HJQA 4X0NA 4TR9A 4NAEB 3BOXA 4FI4A 2GGEA 4ZB5A 1I9CB 5AOUA 1I6NA 3BGJA 3EOLA 2GGHA 2G3MA 1HP4A 3WD1A 3DIPA 4YTUA 3QFWA 3TFCA 3JS3A 1XGEA 4M6PA 1Y65A 4JKKA 2Y63A 2H3DA 4GZEA 4KMQA 4GYKA 5ABTA 1CCWB 2EKGA 4DX3A 1E6SM 1HQTA 4C7GA 3ABSA 3VIHA 4C6BA 3GDRA 1TZ7A 1UD6A 4JYFA 3RO8A 1TVNA 2FTWA 1A5MC 3B9AA 3IUHA 4IGSA 5K3VA 3H55A 1KXHA 2NXGA 3RGTA 4QM1A 1YBQB 4L4MA 4P02B 1GOOA 1FHDA 2Q8XA 3Q67A 1LWJA 4AD2A 3H8AA 1GOWA 3C2OA 2FZNA 1L0PA 3L65A 5I3JA 4DZ5A 1VQTA 3M5XA 2WHKA 1PCKA 1SZRA 3GIQA 4JX5A 3VMNA 1I45A 3KHJA 4HZ8A 2XINA 2QIIA 4A35A 3O0FA 3WUFA 4L56A 3TROA 4OIFA 3MDWA 4UTHA 1UMYA 3UWQA 4Z1DA 3URAA 4GBUA 2CETA 1G1YA 5I3FA 3MMWA 4JD4A 4TIMA 5FI8A 3CZGA 2VMFA 3S1XA 1XLCA 2V2HA 1AFSA 1Y5VA 4UFKA 4A29A 3SCOA 2QJJA 2P8BA 4Z42C 1WBHA 4MZ8A 1ZJIA 1AZ1A 4DJDA 3WQ4A 3KX6A 1WDPA 1OFPA 3ZT6A 3BANA 3K46A 3CQHA 3STPA 4BZYA 1I0DA 3HO8A 2ATMA 5AN7A 4HYRA 5G4HC 1KM0A 3Q94A 1H1NA 3WQVA 4GI8A 4ZENA 3SY1A 5LNVA 4I7UA 4RE2A 2E6AA 2OT0A 3V4BA 2PURA 2X7WA 2F6UA 1PZ1A 3QLLA 2QCGA 3T0CA 2VQTA 3GC2A 1EC9A 2FH6A 3SJ3A 1VJIA 4MTVA 3BAIA 4FX7A 3H6OA 1NFGA 4BF5A 4IMEA 1F3WA 3MC5A 4C1LA 4XX6A 3V5CA 1E70M 2VFEA 3J7HA 3QFEA 3TC6A 3TEVA 3EWXA 1I0BA 1M41A 3NDZA 3OW1A 1UH2A 3AQUA 2INFA 1LCOA 4NZFA 1YADA 2C1IA 1E1CA 4NNBA 1WZMA 4OFCA 4QRNA 4IH3A 3JW7A 1L6SA 4PTXA 1OIFA 3ANYA 4E3VA 2IQ0A 4HOZA 4D2JA 2CKSA 4GXPA 1LLWA 1AK5A 2Y8KA 1GJUA 3W1NA 4QDPA 1UWRA 1K4GA 4F0SA 4C7DA 4QJ3B 1KW1A 3TR2A 4DELA 4DF0A 3BGGA 2ONEA 2PP1A 3ITOA 4NYYA 1YTKA 3GVQA 5G5IA 4DI8A 2BLEA 2V30A 4S3EA 2WM0A 1FKWA 3EWWA 1IR2A 3B8WA 4YS1A 3BG5A 2PDHA 3FHAA 2GVJA 3SUWA 3GVGA 2Y7EA 3DFSA 4WR3A 3RG6A 1SR9A 1XPGA 3CYJA 5EIYB 3DFPA 3S4TA 3DUGA 4KEZA 4TO8A 3TAKA 3NDYA 3N18A 2ISFA 1PPIA 1ZSXA 1Q2RA 3CXOA 4J2MA 4RV3A 3LTPA 4LYKA 2VWTA 2FPYA 1GKQA 1M7OA 5C7VA 1VKFA 2E9BA 3QV6A 4GHRA 5D2TA 1GTHA 2O92A 3M0MA 1OEPA 2CXGA 3M64A 4L6OA 5E09A 2VD8A 4H9YA 1ZU8A 3AC0A 3RPMA 2QV4A 1YPXA 2P3ZA 3FA4A 4O10A 3MSYA 3WLQA 5DBTA 1C7TA 3TNOA 1IQ8A 5FD0A 3GS6A 3M0KA 4FS9A 1THFD 3SSJA 1B2YA 4DN1A 1MRQA 4O17A 1VAHA 1WB0A 4AY1A 4QE5A 1JAEA 3VC5A 3TOYA 4CNUA 4UTJA 2WLZA 4HJWA 4PEEA 4LYQA 3W2KA 3CZJA 1NVMA 4JQ1A 3SM0A 4M1BA 1VFOA 4UFIA 2HTMA 2QCLA 1NAL1 4K6AA 4EXBA 2A3BA 3WNKA 4DB7A 3NXFA 5F4SA 6XIAA 5KZDA 4H9UA 2WKLA 1OWQA 3KVLA 3MJYA 1TR9A 4RLIA 2YL5A 3E1F1 1HG3A 3CH9A 5BOEA 3CHDA 1B5TA 4PRWA 3T0TA 2VFDA 3MVTA 1N55A 2V5BA 3FY1A 4IGNA 1CX9A 4W5UA 4MAVA 1PIFA 1ITCA 3ECQA 3W73A 1KXVA 5M03A 4FA3A 4DZHA 4H7VA 4MG4A 3BMXA 4QDMA 1W1ZA 1EC8A 3TV8A 4Q4RA 3MMTA 2WMIA 5H8MA 4QITA 4QX4A 1UKPA 4H01A 3MI6A 3QPZA 3AYTA 4GYJA 4Q6JA 2D1ZA 2D3LA 3AYVA 4JHOA 3P61A 4AF0A 2NXHA 4B91A 2E40A 4KIRA 2VP8A 3U7BA 2ZWZA 2GVEA 4J9JA 4MKVA 3AISA 3GW3A 3POCA 2XZ7A 3G1FA 1JYWA 1XQLA 2QV5A 3MCNA 5J8LA 1VFFA 4WUIA 4NRRA 2H90A 3KVJA 1LT8A 4CGTA 4LY4A 3W76A 1XLJA 4L1XA 5FJUA 1MMFA 2W67A 3DFOA 3MW7A 3OVPA 3Q4DA 4TMBA 2VEGA 3DH7A 1AD1A 1TKKA 3VDBA 1MQRA 3P81A 3VDGA 3RJXA 4UTFA 2O56A 5E70A 5MHBA 3M1ZA 4QFUA 1UP2A 4JN6A 1TIWA 3UG4A 1PHQA 4LFYA 3KW3A 1T99A 2GOKA 1XUUA 4PL2A 3VOHA 3HMCA 3CL7A 1PTGA 4FXRA 3PS7A 3GTXA 4YYFA 5SWUA 5CZ0A 3PP7A 3A12A 3DG7A 2FIQA 3MHGA 1XYZA 1FWGC 5HUOA 1QOQA 1IEIA 4GUJA 1WNOA 4JR5A 2G3JA 2VC6A 1US2A 2QCDB 1CWYA 1KBJA 3L0NA 1JG9A 2EKCA 4JTLA 1W17A 4HKPA 2J77A 4KH2A 4Y90A 2RFGA 1HFBA 4C6IA 3UCCA 1CLVA 4EE9A 3K30A 4ZB2A 3PBWA 1RK5A 3C2EA 1R30A 1WDWA 2VZOA 1JCXA 2FFCA 2P88A 4GIYA 3CQKA 3KWSA 1QW9A 5FIPA 3C0QA 1XCWA 2I9UA 3RFAA 3WELA 3NTYA 2C19A 3ERPA 5FJJA 5ECVA 4FALA 1I4NA 4YWIA 4PTWA 4V27A 4X3ZA 3CAVA 1CZ1A 4ZSUA 3GQYA 3PZMA 2XWEA 3MMDA 3CPGA 4DUXA 3WLKX 1Q6QA 1W3LA 2CW6A 1VBHA 1E5JA 3CB3A 3DFNA 2P0OA 5AYBA 4JPGA 3ITTA 3O3RA 1FWAC 3EX1A 3OVQA 3U7VA 3TN4A 1YKWA 5EJZB 4ML4A 3KRZA 4KEUA 2DDXA 2PRLA 3SIMA 1UQZA 2NLYA 4NT0A 1DXFA 3M7SA 3S46A 3HG5A 2GJRA 4V2XA 4AVOA 1C93A 4PCNA 4WY0A 3SGGA 3FHQA 3ZLFA 3WLNA 3DKJA 1GG1A 3VIOA 3TTSA 3EPNA 2ZE3A 1KKOA 2QS8A 2VNCA 3RM9A 2PF8A 4O12A 1Y5WA 2GQ9A 1ZAHA 1QPOA 1ADSA 3QY7A 2HK1A 3UF9A 2OGJA 1DJNA 1QNSA 3W28A 3IAPA 1ZJHA 1CTNA 4JTEA 3SGUA 1DJWA 2BVDA 1ZHAA 2F61A 3V16A 4DLFA 3EDDA 4FHAA 1ZQ5A 3SN0A 1F73A 5C9WA 3RJYA 1E9YB 5GNXA 3MWCA 2VM8A 2WNWA 3PN8A 3T0AA 3GSMA 3V75A 3BLIA 3PAOA 2PWGA 3WBWA 5AB3A 2QJHA 4NZ4A 3M43A 3DEQA 5I79A 1B9BA 2J88A 1TWSA 4EAMA 2JK2A 3RMEA 5DY3A 2PWUA 3W1UA 4JIPA 3VIPA 1UASA 3BG9A 2GVYA 2F2HA 4AZ6A 3BW3A 1VC4A 3OQEA 3KCLA 5FF0A 2Z4GA 1AVAA 3GXFA 4Q8TA 5DFAA 1HKWA 4R5EA 1XDMA 3GD6A 4AZ5A 2OX4A 2CERA 4E4FA 4RKAA 1W8GA 2XVLA 4XTDA 3R7MA 3VDHA 4P7OA 4Q8NA 4YTRA 1TX0A 3BJSA 3WH7A 1GZGA 2ZRUA 2YCLB 2RDXA 4NXSA 4H7ZA 2PGFA 4BQ2A 1OT2A 4HSHA 1UC5A 4QCFA 1SO3A 2PTDA 5KTLA 2QMJA 4Z17A 1VRDA 2YSWA 2BDQA 5FAJA 4QXIA 2FB3A 3WLJA 2PTZA 4UWMA 1NQKA 5AHMA 3EWZA 3BAKA 1OABA 1H1YA 4GJ1A 4HPNA 2E6YA 5ABFB 4U5KA 1WPCA 3E49A 1K4HA 3SCPA 1XGDA 1IT8A 3PAJA 1QO2A 1REQB 1K6WA 5LNRA 4JKMA 4LAOA 4IM4A 1F7BA 3R8RA 3KLLA 1IT0A 4QG6A 4YXGA 3LN3A 2BG5A 1HF6A 3OOQA 3PNUA 4HP5A 3GK0A 4AIBA 2XIIA 1GCYA 4LF2A 4RNIA 4QISA 4K2SA 1DTNA 1TYGA 2RDUA 3W07A 3UFYA 1DWGM 1R9XA 2J7HA 2X2GA 4UQEA 4XBJA 2E3ZA 2WCAA 1LQ0A 2OZ8A 1PIIA 2QXWA 2EF9A 4MWAA 3EXTA 4ZOCA 2PFHA 3VNZA 1IEWA 2OKTA 1A5AA 2WZEA 1P6WA 2VXNA 5H2ZA 3GDBA 5HAOA 2NXIA 1IHIA 1P1XA 4B5NA 3G3MA 4XVDA 3JVAA 5C71A 1DJGA 1W1TA 3MV11 2DH3A 3GIYA 2GJNA 3DI1A 4H9ZA 4GNJA 4J3WA 2ZX6A 2JGQA 3CUIA 3AS2A 1A50A 2G5WA 2AKZA 2O0TA 4UNIA 4RZ5A 1LOSA 4O13A 2F7FA 3EA2A 1CPUA 1K8XA 3FXGA 4ECLA 3PJXA 1XKYA 2QGYA 2Q3OA 3CIXA 4XUGA 4XIAA 4Z0JA 4TOQA 1US3A 2YJQA 3PUGA 4IPIA 3DYMA 1UJQA 1LROA 3N9SA 1C9DA 3HN3A 3H7RA 3UGVA 1NWUA 3SCSA 1XS2A 3DBPA 3SY5A 1AW2A 2WKGA 3OIHA 3N2OA 4H6QA 4I9AA 4AMCA 2PS2A 1GOMA 3N17A 3H22A 1UD2A 3TQPA 5FJTA 3SCUA 4LUYA 4A2SA 2VC9A 4E4UA 2XSAA 4B3LA 3N34A 3AUJA 4AYSA 1UR0A 3CEPA 1YE4A 3OZMA 3W6YA 4IXXA 2IPGA 1PZ3A 2E5BA 1XM3A 1AMKA 2ALRA 1OZQA 2FTYA 4E8DA 8CGTA 1KGUA 1NDWA 1EXPA 4FR1A 1EHAA 4UB9A 4OWGA 4ZFCA 4PCTA 2OWXA 3JZUA 5A95A 2RGLA 4IMGA 4QROA 1UPPA 2O9OA 1IEVA 3UCDA 3WQFA 1VFHA 1EOMA 2E0PA 1QPKA 4TVUA 5G2IA 5AHFA 4C60A 1MUWA 1POJA 3HPAA 3TC7A 1H3GA 1B90A 1TE1A 4KIEA 4HVXA 2V2CA 2NV1A 1NSJA 2EO7A 3VNKA 4XTIA 1TELA 3DDMA 1KM2A 1CW2A 3NM3A 5U4NA 4FNQA 1V3MA 3H4XA 4V15A 2E8ZA 1CXFA 5CZSA 1GHRA 1REQA 3C2FA 2W3ZA 1ZCOA 1EO5A 3A3HA 4HSNA 2UZ9A 2JIEA 1YPIA 4JIRA 1UMLA 3U5UA 4DAFA 1C8QA 3P5YA 2HNEA 3SBFA 4AC1X 1SSDA 4E2BA 4KWOA 1UC4A 1D3GA 4Q8WA 3UYIA 2D20A 3BCFA 3R25A 5FF3A 3PSWA 2EEXA 1ADDA 3VNYA 4FR6A 2HV5A 3MUCA 4ZFMA 4HG6B 2NUYA 4JEQA 4BCEA 1WDQA 2Z2BA 4GQ0A 1GHSA 4LYPA 3PJTA 2ACQA 4YVVA 1OQFA 1XLBA 3WDRA 3G0SA 4B5VA 4IMCA 4PBFA 3M7WA 4C6OA 2E77A 3W7NA 1XSIA 3L21A 3V1PA 1TWDA 5J04A 3VE7A 3KP0A 3MZ2A 4MWAD 3CV7A 4JTQA 3TCSA 4FF7A 4YVXA 1QWGA 2OKOA 5CXPA 3CMFA 3ES7A 3W1LA 2ZUTA 4DZIA 5K9CA 1KRBC 3D3FA 3B06A 2ZZ3A 2OLAA 3TXVA 4URIA 4IIEA 4D6JA 5KEZA 4JEJA 1T0OA 4EWND 1MW2A 2HZGA 1R2SA 4B9ZA 4AIUA 4MB4A 1G69A 1Z89A 5M5DA 3CASA 3S9ZA 2FMNA 2FHBA 2PRHA 4KETA 1RZMA 4GYFA 2YFNA 4AW7A 1IXPA 1V6YA 4D6DA 3M5YA 3QKEA 2WVUA 3EXSA 3F4WA 5AFDA 2ZOXA 1OSEA 2FHFA 4FNSA 2WWDA 2A6LA 4HHLA 2E6DA 3IRDA 4PBGA 1XKJA 4C1KA 4NNCA 3TQVA 2BX7A 4JY8A 2VRJA 4O14A 1OC7A 3KBNA 1U33A 3SEPA 1I8JA 1QRQA 1HKIA 3O05A 3LHWA 1ZGDA 3KTSA 3IJ8A 2BB0A 3M46A 1QNRA 4PH6A 4XB3A 4PC8A 1LBLA 4ATWA 4DVOA 3ARWA 2FB2A 4QSHA 2BVTA 3VFLA 4EF8A 2Q3RA 1JCLA 1AA1B 2Y7GA 4UMCA 4DJDC 2ICSA 1L2QA 4M1RA 3BVJA 5T8GA 2YYTA 4CKQA 3D3AA 5HWMA 1F4AA 3T05A 1KTBA 2EHHA 3QC3A 5IFTA 3TJXA 4I9JA 3U8GA 4EP8C 5A8GA 2QDEA 1M65A 2J4GA 3C6CA 2XVNA 4BEQA 2X0HA 1FP8A 2NQ5A 3EPOA 3LBMA 3QGAC 4IICA 4UFJA 4IX2A 1Q4WA 4AHQA 5CQ1A 4IIGA 1JZ2A 3WNMA 5A2AA 2XISA 3CMGA 3IIXA 3TWBA 3C2YA 2XIMA 3W25A 4GVFA 4GA8A 1EDTA 1BTMA 3NYDA 1GVQA 2OWCA 1YTEA 1YNPA 1M7JA 1XIGA 4H6RA 1AQMA 1OIMA 5C9RA 4A6GA 4CVWA 3A47A 1ZNNA 3NSXA 3WH5A 4AX6A 2ODOA 3POHA 3KBJA 1IIHA 3WBXA 1OBAA 4K7VA 1B0IA 1H49A 2Y0FA 3RU8X 4YU1A 3NVTA 2WJZA 3M9YA 1MSSA 3B8UA 1UPMB 2E4TA 4M7TA 3LDVA 4X0VA 2WNNA 3W1RA 5TAOA 1LT7A 2ZXBA 1VBRA 3EXRA 1FCUA 3ME3A 1LBMA 5C9XA 3MQTA 1R38A 1GJPA 4AISA 2J27A 4MZYA 3MMUA 7ODCA 1HZYA 1CXEA 3WJYA 1VPQA 5TQLA 2C14A 4D6HA 5CGMA 1EDGA 1BD0A 2GJPA 1WOAA 2CPUA 2B7QA 1DE6A 1W3HA 3N25A 3ABOA 3CTLA 3GYEA 2FTPA 4OZOA 5H8PA 1RD5A 4WJEA 3S2CA 2WVVA 1LLOA 5CAKA 3TMLA 4ORMA 2VWSA 2GDVA 1O68A 3ZWSA 1GGOA 1UP0A 2VHLA 3AWOA 1I1WA 2J74A 2P76A 3LA4A 1WKFA 3MU7A 4ONVA 1E73M 4KRTA 2PUZA 3WQOA 1O60A 4YCOA 1XIEA 4B4FA 3VGDA 3WMLA 2DT3A 3R10A 3N6JA 3C61A 1TJ0A 4MWAE 4UQBA 2V63A 5BZAA 4G1NA 4FO4A 1KBBA 3VUSA 4IX0A 4JN8A 2ZFAA 2ESCA 4LC8A 1ODZA 4E4PA 1LOLA 3B40A 4PFHA 3E2VA 4NYUA 4WOZA 3NZ1A 3EDJA 3UESA 3ITYA 1RY8A 3WD2A 1Z41A 1TJRA 1GYNA 3IGSA 4DJFC 3O9NA 1XLKA 4JFUA 3LM3A 1NP0A 2XIBA 2ZC1A 1C8XA 3GTNA 3A9BA 2ABAA 4WDUA 4ZOEA 3QEZA 3LRMA 3BC9A 5LXEA 3GXNA 4GZ7A 2EPHA 1NDZA 4UUIA 5BXSA 1SPQA 3DGRA 3TCEA 3THDA 1HL8A 1IZCA 2HBVA 2VX7A 2DV0A 5JQ9A 5E93A 4MPQA 2J66A 4W7UA 4ROPA 4HNOA 3T0BA 3AYSA 4ZQMA 4MNJA 3AHVA 4ZO6A 2BGQA 3PBGA 3N2BA 3TZNA 1F05A 3BZGA 3H2NA 1AQHA 3VD7A 1H09A 4M19A 4Q8MA 1A5KC 5HOSA 2GK1A 4AC7C 1PWMA 3VNJA 4FEZA 3CU2A 4NZ5A 4JL1A 3W74A 1UROA 4A22A 3NSNA 2X1IA 1PBGA 2R91A 3LV6A 4P61A 2G97A 3R0KA 4I90A 2MANA 3MA8A 4TX9A 3G1VA 1UKOA 1X39A 4XD6A 3BSGA 3W7QA 3LGDA 5BROA 3L4UA 1DWFM 2WCGA 1H7RA 1F6PA 2YCEA 3WDPP 1DJXA 1JXKA 4QDWA 3ORWA 5F4XA 4YL2A 1FHVA 1CT5A 3URBA 2W66A 3ARPA 3KTXA 3T0DA 4E6MA 1UR9A 2PB1A 3NEVA 3E5PA 5HQMA 1DQWA 2ACSA 1TQJA 3C0SA 3WQEA 4O1FA 3BV4A 4DBDA 4H04A 4WRHA 3STCA 3W72A 3KXQA 1XYMA 1Q4NX 2INEA 4L4LA 1S1PA 2CBUA 5AHLA 1V8EA 3IACA 3MANA 3W1AA 2A0NA 3W1MA 3TWAA 1TWZA 5EMLA 2PA6A 3AS1A 1QW8A 4PUNA 1ECEA 3KOZA 3KHDA 4W7WA 1XD0A 3G3DA 4O4WA 3RLUA 3RMJA 4C6DA 3IGHX 3RR4A 1LQ2A 1PXGA 3UZJA 1DHPA 3RRAA 4Z2IA 3LLFA 5F7UA 3P80A 3G1XA 2R94A 1G94A 2NV9A 1IWAA 1QMLA 7CGTA 1OX5A 3WDIA 4RNFA 2GGJA 4L80A 2ZIDA 3SUTA 3CLMA 1JPDX 1UD4A 3QTGA 3T7VA 4WDXA 3QW3A 3RN6A 2Y7FA 4O0KA 2RDWA 2C1HA 3P7YA 1TX2A 2BS9A 4ORIA 1I2RA 2AL2A 1UIPA 3WFZA 4BS0A 1ISXA 3UWYA 2OVLA 2XN0A 4Z2JA 3G0UA 2JFEX 3HIJA 3R8HA 3MUY1 5JMUA 5DMLA 5HINA 1GPFA 3W6MA 5F2MA 5F2IA 2XH0A