2GK1A

X-ray crystal structure of ngt-bound hexa
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
b'LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-hexosaminidase subunit alpha
publication title Crystallographic Structure of Human beta-Hexosaminidase A: Interpretation of Tay-Sachs Mutations and Loss of G(M2) Ganglioside Hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 8
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gk1A02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 2gk1A01
2C0HA 3A6OA 3GYCA 1BYAA 1CLXA 3MUY1 3NDZA 1HJXA 4PTMA 5ABEA 4PTWA 2J7HA 3ARUA 2Y5EA 1VFOA 3PZUA 1YHTA 3WL0A 4XZBA 1O7AA 1J0JA 4H8UA 1XD0A 2XUCA 1I1XA 3W27A 3GH4A 4HP5A 3PTKA 1E6NA 1UG6A 3AXIA 1UD4A 2YL8A 3WUFA 4Z2HA 1PX8A 4CUCA 2QLYA 2DT2A 1ESWA 4MPKA 1UA7A 2TAAA 4PMXA 2A3EA 3AS0A 3BSGA 4HTYA 1P6WA 4CD4A 4CCCA 5FOOA 2PBGA 1GHSA 2G8ZA 1OBAA 1W1TA 2BHYA 1PX4A 2PC8A 3RM4A 1PIFA 1R8LA 4HPGA 1VJZA 1CECA 2XFFA 1GOMA 3WY1A 3WH7A 3VDHA 2Y8KA 1JAKA 1XRVA 1JF6A 3ARRA 2WC7A 2JE8A 5EFFA 1B3YA 3ARTA 2XFRA 1W1PA 3B8SA 6A3HA 1GONA 1TVPA 1OM0A 3BAXA 4DM2A 2VT0A 4W7WA 4PUDA 1JXJA 2EPLX 4QCEA 5M3WA 2DH3A 1N82A 4V2XA 4M1RA 3VGGA 4QLKA 4GZEA 1WZLA 1HP5A 1U2YA 2WKLA 2IXUA 1A3HA 3OZPA 1J9YA 3AHZA 2YL9A 2JEPA 3FY1A 3CGTA 3BAWA 3CLWA 1E55A 2UY4A 2WHJA 2WHKA 5C71A 1LLOA 5CG0A 1CXKA 3VM5A 3GNOA 3WEOA 1E1EA 2E0PA 1DEDA 4GZJA 3ZMRA 3VNYA 1F4HA 3PZIA 4GINA 2WLZA 2XVNA 2ZX6A 3SCOA 1C91A 1UOKA 2HISA 3WNPA 3GZAA 1CTNA 3II1A 4PSPA 4M8UA 1FP9A 5EMYA 1KFWA 3A4AA 3CUGA 1EIBA 1XC6A 3TTSA 1V3IA 4PEEA 4UFHA 1CYGA 1I1WA 3PZNA 2CNCA 2JIWA 2VI0A 3AMLA 2NSXA 4UTFA 1TG7A 4M29A 3AIWA 3W26A 1GQKA 4XX6A 1W2VA 1QW9A 4FF5A 3VD5A 4YPJA 4E8CA 5BXSA 5IFPA 2YL6A 4Z2IA 3GH7A 2XIIA 3L4ZA 1LF1A 4DUVA 3CZKA 4J3SA 4DWSD 4DUWA 3OGRA 3CO4A 5I79A 1C3FA 1D7FA 2AMGA 2JALA 2VCAA 5E70A 2OWWA 2XVPA 1JAEA 3ZT7A 5A6AA 3K1DA 1V6YA 3WDIA 1J11A 4C7GA 4JKMA 1E70M 3QGVA 4BQ4A 3CUJA 5AC5A 3WENA 4UQBA 4HOWA 1EOKA 1VBRA 1WDSA 4HMDA 5BCAA 5D9NA 3WD3A 3AI0A 3S2CA 1ODUA 3B9AA 4PSRA 2W91A 2WHMA 1GVYA 1WNOA 1NWRA 4UFKA 1QNPA 1U30A 5LA2A 4P7OA 4HPHA 1QHZA 3WNOA 1O6IA 4UQDA 2WBKA 1E5NA 1LL6A 2Y24A 1LQ0A 3VIHA 4HA4A 3N9KA 2G3IA 4U3AA 4AWEA 1H49A 2OYKA 4B15A 1ISXA 1FFRA 5CQ1A 3AS1A 4GI6A 1GVIA 1QOXA 4GO9A 5D9OA 5JBDA 2J62A 3EDJA 1NWSA 3WQVA 4LGXA 3DC0A 4C90A 5GNXA 2YDQA 2WWCA 3W82A 3RM9A 4NF7A 2XM1A 2FH8A 4B9ZA 3VGEA 1UH4A 2WCAA 3F5LA 5CZKA 2B31A 4V27A 4FLSA 2PBOA 4HMCA 1PBGA 4KRUA 2WC3A 3QOKA 2E9BA 1C8QA 4D1JA 2J4GA 1SYTA 3ARQA 1K9FA 2D0HA 2Y4SA 4ACYA 2XWEA 4TTUA 4H2CA 2FHBA 1OIFA 4N0RA 2VZUA 2J7EA 4W8BA 4GIAA 4OZOA 5JIWA 2E8ZA 3CMJA 3BGAA 4PRWA 5F7UA 3AJ7A 5HPOA 3ZSSA 1DTUA 3RPMA 2WXDM 3WFZA 3OBAA 3QR3A 1W32A 3CH9A 1E9LA 4GKLA 4AMCA 4A4AA 3WH9A 4P8XA 3KL5A 3IANA 3PZVA 4ATWA 2RGMA 3DYPA 4W89A 3W53A 4PMZA 2WNWA 1JIBA 1EHAA 3CMGA 2F2HA 3AIUA 1KGUA 3VILA 3WD1A 1M53A 2EPOA 5M03A 1FH7A 1UH3A 2DSZA 2A3BA 4TUFA 1MXGA 4X0VA 3OG2A 3IAQA 4HOZA 4OOZA 2EEXA 3ARPA 1PJ9A 1GJUA 5HBFA 1HF6A 2E9LA 4QAWA 1E6XM 4H04A 2WYSA 5D9MA 3GH5A 4RE2A 4AZBA 3AMDA 3VNZA 1MVYA 1NP0A 3OA5A 3BAJA 5A6SA 1ZBWA 5AY7A 2WVTA 5GNZA 2V3FA 5C8BB 4UFJA 4WKHA 3PZGA 2ZXDA 3VIIA 4WKFA 1MXDA 3OZOA 2E3ZA 4ZEPA 3MS8A 1EQCA 2ZX5A 1D3CA 2VX4A 2DSVA 7CGTA 1CGWA 3KE0A 1R7AA 1WP6A 5BWFA 3FXYA 1B3WA 5AYIA 4WKAA 4WSKA 2XIBA 1UD5A 4MJ2A 5E0FA 3THDA 4CD8A 4PCTA 7A3HA 3EDEA 1KGWA 1WKYA 5I78A 3OLGA 4LYPA 4J28A 3WUGA 1UH2A 3EDFA 4W84A 4D6DA 3M6DA 1TCMA 2OSWA 1UWIA 1OT2A 4M81A 4EAMA 2J74A 5JIPA 1H11A 4N42A 4LX4A 1W9PA 3L4TA 4KGJA 5CPTA 4JHOA 3VO0A 3A4XA 3QHNA 2QF8A 4CCEA 1JYNA 2D1ZA 2NT1A 4FK9A 5BYWA 4MB5A 1UKPA 4X0NA 3B9DA 1E3XA 2BNJA 1WDPA 1ZU8A 3TOPA 1BG9A 3NUKA 1UA3A 5M5DA 3O9NA 5IFTA 3BAKA 3PTQA 2XVKA 4GQRA 4AIUA 2G3JA 2VX7A 4FLQA 4JFUA 4A3YA 1JFXA 3MMDA 1KXHA 1EDGA 3UG4A 1AQMA 3TTOA 4AZIA 5I6SA 4D1IA 3PZMA 3L4UA 2WVSA 1TMQA 3VX0A 4JIEA 4BF7A 4M80A 2BHUA 2ZUTA 1GNXA 1Q6GA 4PMYA 1CXFA 3CPUA 4FLOA 2Z1KA 4PMNA 3VMPA 3VVGA 5CLTA 4JL2A 4UOQA 5D4YA 1KCLA 2O9OA 1KBBA 1E0XA 4HOXA 4PMUA 1VFUA 3U7BA 8A3HA 1MFVA 3VD7A 2VR5A 1VEMA 4WSJA 3BCFA 1SR0A 3PN8A 2VCCA 5ABHA 2QPSA 4KH2A 4QCFA 1ECEA 1V6VA 2GUYA 3BSHA 1RD6A 1TE1A 1H3GA 2X09A 2J7FA 3AHXA 2DGAA 4MDOA 1BPLB 1XH0A 1UUQA 2GVYA 3ZM8A 3MKKA 3PHAA 1FP8A 3M7SA 2V3EA 2VX6A 2O9PA 3PZQA 1US3A 1ODZA 3WD2A 4V28A 1HT6A 3F5KA 3OGVA 4UFLA 4MTVA 3PBGA 2PWFA 4MNJA 2OWCA 4CN6A 1W9XA 3CHEA 4AD0A 2G3MA 1E40A 3WKZA 1HL9A 4NZCA 9CGTA 1JNDA 1L8NA 4XZWA 1V08A 4L4OA 4AZHA 4F9JA 2CBIA 2CBJA 1EGZA 2VURA 1QNOA 4P8VA 4TVDA 1B30A 2Y8VA 4AZ7A 1OT1A 1V02E 5D8ZA 2EJ1A 4W8AA 3WMSA 4CGTA 1JZ4A 5A8QA 1Z32X 2GFTA 3L2LA 5LA0A 3HJEA 3NYDA 1VAHA 1EXPA 3A4WA 2X05A 3WUEA 1UR0A 3AFBA 1KGXA 1LWJA 1J01A 2WPGA 2WMHA 4MNKA 3VTRA 4W86A 1G1YA 3AROA 2E8YA 2CBVA 4ACZB 4BQ2A 2PWHA 3W6MA 2OLHA 4GO8A 5CSUA 4CU8A 1AQHA 1PIGA 2BVYA 2XFYA 2GJPA 4BZYA 2V3GA 1GOWA 3SUWA 2E4TA 2YL5A 1D2KA 4MAZA 2BY3A 3GBEA 4PYSA 3UR7A 4MJ4A 4OUEA 3VOCA 3WMCA 1FHLA 1JDCA 2X0YA 4WIWA 1UWQA 1E6ZA 4UR9A 3CUHA 4ACZA 2PF0A 2D24A 2YLLA 1LG2A 1MYRA 4U2YA 1E6QM 1GUVA 4GQQA 1VBUA 4M24A 3TP4A 1QNRA 1KCKA 1G01A 3WL1A 3J7HA 1OSEA 5A6JA 2XSAA 4JZ5A 5DF0A 3WQ8A 5KZ6A 3MANA 2WVUA 3AISA 1BFNA 2V3DA 4UZUA 2J79A 4Z2JA 4Z2KA 1H09A 1JZ3A 5DEZA 4UCFA 2CHNA 3W28A 4FLRA 4UQEA 4CN4A 3EDKA 4QFUA 1E1FA 1J18A 3AMKA 3RO8A 2WM0A 1V03A 4Y7EA 1QNSA 4UQ9A 3T09A 3WF0A 4PMVA 3SCTA 1GORA 1WDQA 2WMIB 1G5AA 3WH6A 5CGTA 1FFQA 1PEZA 2YBUA 4TX6A 2ZUNA 4URIA 5A6BA 1HL8A 1GHRA 4D72A 4EANA 1H0IA 1BF2A 3WDRA 1LL7A 4X9YA 3AIVA 1HJVA 3DYOA 1HJQA 4LXFA 2CXGA 4J3WA 1JDAA 1W9UA 4R5EA 5BXPA 5A2BA 2Y2WA 2WMIA 5DFAA 4W5ZA 3HMCA 2EO7A 4QLLA 1NH6A 4QP0A 4TVCA 1XGZA 2BY2A 1QI2A 1K9DA 2Z1SA 2EPNA 3K4AA 2CESA 4HZ6A 4BCEA 2WWDA 1E15A 1VB9A 3BMVA 3CHDA 4U2ZA 4CCDA 2EPKX 1C7SA 1UWUA 2FH6A 2W5FA 2XJ7A 4AD3A 2FHFA 2NT0A 5CPSA 3N04A 3WEMA 5A69A 1E73M 1KWGA 4JFSA 1JYVA 4AIEA 4AY1A 4GZIA 2VR4A 3AS2A 1W91A 4E2OA 3TA9A 1XH1A 1US2A 4D6EA 5BRQA 1KXVA 3WQ5A 2VMFA 1YQ2A 3K8MA 3L2MA 1HKMA 3VIKA 1TR1A 2QMKA 3UR8A 2W67A 2VQTA 1H41A 1VIWA 2WW5A 3FAWA 3A3HA 4MAVA 1V0LA 1E3ZA 1BAGA 6TAAA 3OGSA 4AIOA 3AZTA 1V02A 1B90A 1UWSA 3S6TA 2WLYA 3GXFA 2VZOA 1DWGM 3MV01 5FD0A 5BRPA 2WMGA 1DWFM 3WN6A 1OGGA 3N11A 3NCOA 1LJYA 1ZBCA 4P8UA 1UR4A 2G3NA 4TVUA 2DIEA 2WMFA 1V3MA 3GNPA 1C8XA 5A8PA 4DUXA 4WLCA 3SCUA 4C7FA 5EBAA 1BYBA 2OWXA 2JIEA 1NP2A 1WB0A 4E4PA 2J77A 1TZ7A 3MSGA 3G6MA 5E0CA 5HNNA 4JCMA 2UY5A 1HP4A 3VINA 5GQBA 1JYXA 3IK2A 3AHVA 1QBBA 1IZJA 1ZJAA 3UETA 2ZE0A 1HKKA 1EQPA 3SEPA 4Z2GA 2ZWYA 2JEQA 3LMYA 3AHTA 1RP9A 1QHOA 4CD6A 2OYMA 4UOJA 2J7CA 3GDBA 4U3CA 5LA1A 1MW2A 5CLWA 1AQ0A 1UR9A 3QHOA 3WF1A 1V3JA 5DT5A 4AEFA 3QHMA 3NSMA 2VTFA 2IUZA 3ALGA 3CZJA 3DYMA 3BC9A 3KL0A 1UD3A 4JAWA 3WDJA 3WBEA 3IJ9A 4B9YA 3VD9A 4AD5A 3SCNA 4GI8A 1GZJA 4ZFMA 4LQ1A 2VZSA 3WDQA 3AIEA 3MMUA 4XV0A 3L4VA 4YN5A 5I23A 4Z2LA 2JF6A 2XTKA 3KEHA 3LPOA 3CHFA 1R87A 2VZVA 3WNNA 1AMYA 3EBVA 3VGBA 1F4AA 1ZS2A 2D3NA 3RM8A 1J0YA 3W29A 1LWHA 2GJRA 2XVGA 2ZXAA 3SCSA 3SCWA 3VIFA 1L0PA 4UQAA 5DO8A 4KMQA 3BLKA 1MFUA 1EO5A 3SCRA 2Q8XA 4UFMA 1KR1A 1UD8A 3VD3A 2WMKA 2AAAA 1QHPA 1BQCA 3W24A 3AICA 2DSKA 4WK9A 2XM2A 3TTYA 1VFMA 4CN1A 1FH9A 4UFIA 1TVNA 4JFWA 4W88A 1E5JA 1GQIA 2CKSA 3EDDA 4MNMA 2CITA 1CBGA 1PX3A 4CD5A 2XSBA 4QDMA 1E6RA 1CENA 4PUEA 2PB1A 5D8WA 1UKSA 2VUYA 2YLAA 4UZSA 1GOOA 1EO7A 3PTMA 2J75A 1RPKA 1E4NA 1BG4A 5ECUA 2G41A 3AIQA 1HN1A 3WH8A 2WCSA 2VX5A 1C90A 4UQCA 2DT3A 2VRQA 1JG9A 4D6JA 3G6LA 3ZOAA 3ZIZA 1X6NA 3W38A 1UHVA 2CIPA 3MUZ1 3RJXA 5A6KA 1CDGA 4HA1A 2A3CA 4AZCB 3WDHA 1ZBVA 5FIPA 1CGUA 2VNCA 2VQUA 4DWSC 2DT1A 5E6YA 4DWSB 1S46A 4HZ7A 3WFLA 1GOKA 1V0MA 2WCGA 2CKRA 5FL1A 1E6SM 2YBTA 3SCPA 1E0VA 2GK1B 2FGZA 2W61A 1HNYA 1QI5A 3L4XA 4OBSA 3T2OA 4AZCA 2OYLA 3VGHA 3WEZA 1J0ZA 4B3LA 3MO4A 1SMAA 2VRJA 2QPUA 3SCVA 4PMDA 4DWSA 5E6ZA 5D9PA 1GW1A 4BQ3A 1HKIA 3WQWA 1LL4A 1M7XA 1CXLA 3ZT5A 1KB3A 2GK1A 2ZX7A 3WF4A 4OJYA 4XB3A 3WNKA 3D3AA 4DM1A 3BAYA 5DT7A 2VZTA 3WNLA 1EDQA 4Q22A 1GCYA 1TFVA 2BHZA 2ZIDA 1KBKA 5GPRA 3GNRA 3W25A 1UD6A 1A47A 2CYGA 5TD4A 5ABFB 3T0BA 4AZ6A 1QI3A 1GPFA 1OCQA 4GI9A 5CXPA 4CKQA 1G0CA 3VDCA 1H1NA 1OD8A 1E4MM 1KQYA 4J3UA 1W9BM 3B9EA 5I0DA 3K8KA 1E4LA 5A2AA 5AC4A 1MW3A 4YHEA 2V5DA 4AYSA 1E71M 2ZX8A 2PWEA 1DWAM 1UQYA 2VC9A 3U5UA 2GDVA 3WF3A 5ABFA 5CJ5A 2F61A 4TTGA 2WVVB 3NIYA 3TTQA 2J25A 1BYDA 4P7RA 4ZE5A 2XWDA 3VMOA 2D23A 2ZXBA 2D3LA 1E6PA 5I3DA 5E09A 4AW7A 3NDYA 3ECQA 3I3DA 4IUGA 3CZGA 2WK2A 1Y7VA 3N1AA 3T08A 3MUIA 2XHYA 4ZE4A 1U33A 1BYCA 2ZWZA 1FOBA 2C8NA 2WVVA 4JFVA 1UYQA 1HX0A 3KWXA 1UZ4A 3CZLA 3WELA 4W8LA 2DSUA 4D6FA 5A1AA 1JL8A 4IPNB 1WDRA 3MV11 5JBFA 3WIJA 1HXJA 4S3JA 1DWIM 3NSXA 4QLJA 3SUVA 5A94A 2QMJA 2J7GA 2ZUVA 4MB4A 2XGBA 3O2LA 3AHYA 1QNQA 1JZ8A 2A3AA 1JFHA 1ISWA 4YHGA 1VJSA 2XYLA 4TOQA 2YA2A 4PCSA 3EMCA 2PI6A 1W3KA 2ZUSA 1ZBKA 2UWFA 2ZOXA 1GJWA 1Q4NX 4KRTA 3K8LA 1VRXA 4D6HA 3KZSA 5A8MA 3QOMA 3WBAA 3VUPA 1XD1A 3FNDA 3KL3A 2JFEX 1JZ5A 4LYQA 2CEQA 4AXNA 1UKQA 3SIMA 5CGMA 3WMBA 3WQ4A 4PMQA 4U31A 3VIOA 4TX8A 4HZ8A 4EKJA 1HVXA 5JUVA 1QW8A 1UD2A 1LG1A 2W62A 1XSJA 3PZTA 5A2CA 1JYWA 1H4PA 3VMNA 3WF2A 3AQUA 1H2JA 1IV8A 1XYZA 1CXHA 3I3BA 1HJSA 4H8HA 2W66A 3ARSA 1J0KA 1VF8A 1W3HA 1HJWA 1MQRA 4PTXA 3IAPA 3W6LA 1MW0A 3RMEA 1M01A 2MANA 4JCLA 5A8NA 1G94A 3W0KA 3ZO9A 4RL3A 1UQZA 2O92A 2VVNA 3RIKA 1B3XA 2QHAA 5HDRA 5AYBA 2EXOA 3M07A 1CGXA 1C93A 5FCZA 8CGTA 2XG9A 1FHDA 2D2OA 5C70A 3JUGA 1E56A 2XGIA 3ZJKA 4NRRA 4W87A 1UR1A 1BTCA 2GSJA 4IPLA 4ML4A 1EA9C 2BVTA 3ZR5A 1NARA 4AZGA 3AIBA 4F9DA 1CXIA 7TAAA 1OGBA 4W7VA 2W4XA 4J3XA 1CGVA 1CNVA 3BH4A 4U33A 2VJXA 2YDRA 3K46A 1NOWA 2DT0A 1G9HA 1VEPA 1ITXA 4M56A 1W1VA 1XCWA 1BSIA 3W37A 2YDSA 3M46A 2WAGA 2J8FA 4MADA 1OGSA 2WBGA 4CU7A 1XSKA 1OIMA 4B16A 1PAMA 1UWRA 4CU6A 1UWTA 2WC4A 3VGDA 1KWKA 2WZEA 2WMJA 3GXIA 1HIZA 4AZ5A 2O9RA 4ATLA 4JKLA 3N15A 2V5CA 1UZ1A 3NSNA 1KQZA 3T2QA 2ZX9A 1XHGA 1J10A 1K9EA 1ZB5A 3ZJ7A 3SCQA 3FW6A 3CZ8A 1K6AA 4D6IA 4E8DA 1BGGA 3E1F1 2BXYA 2EBNA 3OLDA 2BXZA 1ISZA 4MB3A 5CSYA 2OSYA 3MMWA 4W93A 1X6LA 3THCA 1QBAA 1OINA 3SUSA 3FHQA 3OLIA 1DWHM 2WZHA 1C92A 1UR2A 1E72M 5IDIA 4PBGA 3ARXA 4Q7NA 2CETA 4W85A 2D0GA 1WPCA 4PMOA 1OWQA 2DH2A 3U5YA 1NOUA 2W92A 4LYRA 5DMYA 1CIUA 1UR8A 1JI1A 2YA0A 2J7BA 3APGA 1E0WA 2PWDA 4CD7A 5I77A 3RILA 4IISA 1QVBA 2DDXA 3HU7A 5A6MA 1CGTA 4P8WA 1VFFA 3U57A 1X1NA 2ZXQA 2YA1A 3OLEA 1XV8A 1JZ7A 3SUTA 4KWUA 3AXHA 3K4DA 1KXTA 1V0KA 4K68A 1QPKA 1FH8A 2G4FA 1M04A 4W5UA 1JZ2A 3AYSA 3VU2A 3VGFA 3WD0A 2X1IA 2NW0A 1B2YA 4ZXOA 2F8QA 4S3KA 2ESCA 4JL1A 5M17A 3CUIA 2D20A 3VIMA 4B3KA 3VX1A 1GQLA 2VO5A 1VENA 3GXMA 1XSIA 5HOSA 2D22A 4AEEA 5HPCA 3O6AA 1R85A 1WO2A 2A3HA 4WF7A 5IHSA 3MU7A 1BHGA 2W63A 1B3VA 2RGLA 1H0GA 3F4VA 3ZSTA 1C7TA 2ZUUA 1ZJBA 5A95A 3VDAA 3HN3A 3OIHA 4AD2A 5I24A 4CVWA 5HXMA 1H5VA 5BROA 5LYRA 3ARYA 3AMCA 2YKKA 3L4YA 1SMDA 3N18A 2ZUMA 3GM8A 3WNMA 3ZQ9A 1B1YA 3EMQA 3CUFA 1R7OA 4M82A 2VL4A 1V3HA 3VDBA 3GBDA 2DIJA 4MNLA 3D5HA 2D0FA 1E43A 4GPNA 4OIFA 4NRSA 4UNIA 1JDDA 3AS3A 3ZJ8A 1CWYA 2WZIA 1CPUA 2X8RA 4R27A 4AD4A 1MQQA 3POCA 4PTVA 4HA3A 3RJYA 1JZ6A 4F79A 3WD4A 3DHUA 3AYRA 5E9AA 1J12A 3CHCA 4CVUA 3AZSA 4J7RA 2BVDA 3CIVA 2VRKA 2V38A 1FA2A 1R86A 1M03A 2QV4A 2DQXA 1VEOA 4U5KA 2E40A 1BLIA 4J27A 1B0IA 1CLVA 4ZENA 1HKJA 3IJ8A 5BXRA 1WZKA 5EB8A 2ZUWA 3WQ6A 4PMRA 1W2PA 2X0HA 4BQ5A 4P7QA 1WAWA 3VPLA 2FHCA 3AMGA 2GDUA 1XH2A 1AVAA 1MWOA 3POHA 3OB8A 4D6GA 4JHZA 3CZEA 2PWGA 2DEPA 2J78A 2GJXB 2WHLA 3N12A 3N13A 3NJ3A 1WE5A 3FN9A 1UKTA 4F8XA 4NI3A 1KR0A 5KEZA 2DPEA 3T0DA 1W9VA 2EQDA 2DSWA 1MQPA 4KGLA 1J0IA 1Q6CA 3TONA 3LPPA 3ZR6A 3FAXA 1BVNP 4RE4A 1CGYA 5A6LA 2BY1A 4XUYA 3SURA 3EYPA 1NWTA 5A3HA 3IJ7A 3VD4A 4BS0A 3W4RA 2GJXA 3AXXA 1TUXA 2YOCA 3UERA 5GNYA 2ZICA 4J3TA 1JD9A 1V0NA 3I3EA 5CPQA 4NSBA 1QI0A 4HMEA 3WDPP 2YJQA 4AISA 4D71A 4ZXLA 3VKKA 1DWJM 2VOTA 1OB0A 3VM7A 2WB5A 2UY3A 2YIHA 2CHOA 2XPKA 3WSUA 3VIPA 3BXWA 1GOIA 3ARWA 2JF7A 2J47A 3AIRA 1Q6FA 3ARVA 3ARZA 4AC1X 4JFTA 4UOZA 3CBWA 3FHAA 1WZMA 3DECA 1E4IA 3MUAA 4IM4A 4RE3A 2BY0A 1V6XA 2WSPA 1EOMA 1JD7A 4C91A 1J0HA 4ATDA 2VVSA 1WCGA 1PZ3A 3SUUA 3UG3A 1DP0A 4HU8A 1W1YA 3UG5A 3WH5A 2O9TA 5A6BD 4H41A 1EDTA 4BA0A 1HJUA 1WZAA 2WKGA 3F5JA 1I75A 2J8GA 4EE9A 5IHRA 4HU0A 3W81A 6CGTA 1NOFA 1ISYA 1TA3B 2C7FA 4JKKA 1GOQA 1EH9A 4P7LA 3RDKA 2BFGA 2FGLA 4TXEA 3DHPA 3ALFA 1MW1A 3BMWA 4L4PA 1JF5A 2BV9A 1K9TA 2CBUA 1C8YA 1ITCA 1GQJA 3LPGA 3PZOA 3RCNA 3UEQA 1JI2A 1JGIA 1PZ2A 5BXTA 2WSKA 4U5IA 3N17A 2E9MA 4W7UA 2X2YA 4FMVA 4GXPA 4D6CA 3ZJ6A 1TA3A 1QI4A 4H7VA 1B31A 1CEOA 2VCBA 3A47A 4PN2A 1BGAA 3PZ9A 4MDPA 3AOFA 5FKYA 2IXVA 2BS9A 4OKDA 1CZ1A 3U7VA 5IXEA 1SFSA 2XVLA 1KXQA 2CCRA 5JBEA 2EPMX 1JNEA 1B3ZA 1JXKA 3T2PA 3EMZA 3L4WA 4A3HA 1BVZA 1W9DM 1HVQA 2HVMA 4C7DA 1W3LA 1PPIA 1XCXA 2UY2A 3VIJA 4F66A 1RH9A 4AD1A 1ISVA 1NM9A 1CXEA 4MB1A 4H8VA 1NQ6A 4P7NA 1V3LA 1NWUA 1XYFA 3GTNA 5ABGA 1V6UA 1B9ZA 1EHNA 2CERA 1RP8A 1OD0A 3WUBA 3AZRA 2WANA 3BLPX 2AOSA 4J3VA 3MSDA 3BAIA 2CPUA 3GXDA 1DHKA 1W3JA 3UCQA 3LPFA 5I2UA 4OBRA 2FDMA 5FL0A 1IZKA 1IT0A 4OOUA 3ZT6A 3UESA 3CTTA 4WJXA 3T0AA 2J7DA 1V6WA 1V3KA 1UKOA 5A8OA 1Q6DA 1ZL1A 4EK7A 2OSXA 3BCDA 1Q6EA 5EFDA 3VIGA 5I5RA 4LPCA
chains in the Genus database with same CATH superfamily
1Y5WA 1S2WA 4H8NA 3NDZA 4HPJA 4S3FA 3UJRA 3IIOA 1H60A 4NT0A 3ARUA 2Y5EA 4RJEA 5BOOA 1VFOA 1YHTA 4TU1A 4N9DA 1KBLA 4H6EA 3OBEA 2VDIA 2XUCA 1QMLA 3W27A 1VD6A 2CWXA 1R2TA 3KVLA 4CUCA 1GKQA 5EBUA 1UA7A 2TAAA 1P6WA 4CCCA 5FJPA 1PKLA 2PBGA 1GHSA 1MUMA 4UUIA 1MZHA 3P74A 1BWVA 5FJJA 1DIDA 1BKHA 4N6EA 4DBUA 3TW9A 4HPGA 3ATYA 1TPH1 1K8XA 1CECA 2YZ5A 1QUMA 4G7FA 3EA3A 3PBUA 3UF9A 1YYAA 3OVQA 2JE8A 1B3YA 1FXQA 2FTYA 1Y5XA 3GR7A 5HAOA 2XFRA 1W1PA 4LB3A 3B8SA 5LGZA 3SRHA 3TMLA 5C9RA 1GONA 3NZPA 2RH9A 3KOXA 1EYWA 2QCDA 3BZGA 3KW3A 4MWAD 1Q2RA 2EPLX 3REQB 5M3WA 4QLKA 1OFEA 3CU2A 3NXLA 5AHIA 3OHIA 4K7YA 4NP7A 1U2YA 2AL1A 1C29A 3N9SA 1J9YA 2QJMA 3AHZA 1ZSXA 3BAWA 3W9ZA 4X3ZA 1CXKA 3TOYA 1Z9AA 3GNOA 1E1EA 4ADUA 3REQA 4BI7A 3EWZA 3LSBA 4CNNA 4MWAE 2HK1A 3SY1A 3DI1A 1VLIA 1IEIA 4LAOA 3UD6A 3SCOA 1C91A 1UOKA 2F6KA 2HISA 2X1RA 1DE6A 2OT0A 5EMYA 4QS6A 3CUGA 4N9CA 3QW3A 4GY7A 4UFHA 3PZNA 1I1WA 1Q5MA 2CNCA 3I6TA 2JIWA 2VI0A 5CAKA 2ZRZA 2VEIA 3AIWA 1O95A 2IPWA 3W26A 2HVOA 3LMZA 3S2LA 1QW9A 4FF5A 5CGQA 2P8BA 5IFPA 3HPZA 4Q4SA 2C1GA 4YVXA 2YCLA 3CV6A 1XLLA 2Z00A 3S9ZA 4JTSA 3V5FA 3CO4A 4HK5A 1IIHA 3E0FA 5I79A 5JQ9A 1D7FA 2AMGA 1H7PA 1AL7A 4GNJA 3S9YA 3TXZA 3N25A 1P7TB 1V6YA 2C71A 4C7GA 3UU0A 1E70M 4QSFA 5L9FA 4M5PA 5AC5A 1XLHA 1EGMA 1W37A 3EXSA 3W85A 3OVGA 2YSWA 5D9NA 3GDRA 2X16A 3B9AA 2W91A 1LRQA 2RJGA 4S2CA 1NWRA 1QNPA 1P7TA 2XIQA 3WNOA 2WBKA 1S2UA 5JH2A 1LL6A 7REQB 1E0UA 5C0QA 3IIZA 3VIHA 2INFA 1TX0A 4CEUC 3QC0A 4TMBA 4AWEA 3KBMA 4B15A 5D9OA 5I3GA 3MUXA 1NWSA 3WQVA 4LGXA 5CJNA 4LTSA 4MHBA 2YDQA 2WWCA 1PKMA 5CKSA 7REQA 3WBYA 2WCAA 3TSMA 2B31A 3UW6A 3MP3A 2PBOA 4WSHA 4HMCA 3MBDA 4HIBA 2RJHA 1NFPA 3W1QA 4D1JA 4OTKA 4RPQA 1AW5A 3V4BA 2Y4SA 1NELA 2EPHA 2X7VA 1FRBA 4H2CA 5BNKA 5CBBA 4KERA 3GX9A 2VZUA 3NQEA 2VKZG 4GIAA 4NZJA 4HJFA 1FHVA 4IFOA 4HHLA 5LGXA 1O5RA 1GG0A 1QTWA 4TO8A 3L65A 5HPOA 4GNKB 3RPMA 1UP3A 1T7LA 3HPFA 1KBJA 4GHRA 3U4AA 2VELA 3OEXA 3G8RA 4JTFA 4KCTA 4GKLA 2XIOA 4A4AA 2GSEA 4AYGA 2BASA 4GBUA 3M5ZA 3DYPA 4KFPA 3LXAA 2F2HA 3VILA 3WD1A 2WSRA 5M03A 1FH7A 2F84A 4KF1A 3M4HA 3NO5A 4X0VA 3OG2A 2C13A 3N2XA 4OOZA 5HANA 3BK0A 1PJ9A 1U1JA 1GJUA 3MSRA 1HF6A 3NG3A 4IIBA 3BURA 4H04A 4TR9A 4RE2A 4AWUA 4I6KA 4AZBA 5FJTA 1M6JA 3VNZA 3R1ZA 4IHCA 2J8TA 5GNZA 2V3FA 5C8BB 4ZMGA 3HG3A 2ZXDA 3EA1A 2ALDA 2MUCA 2ACRA 3OZOA 1JJKA 3B8IA 3GHUA 3RFAA 1GJPA 2ZX5A 4A05A 3PULA 1AMKA 2DV0A 1NIUA 7CGTA 3MI6A 4FO4A 4WKAA 4P2VA 2V5JA 3W7JA 3IUDA 4LNCA 3M0IA 1A0CA 2PMQA 1EIXA 7A3HA 2V0TA 4QS5A 1KGWA 2Y0FA 3V1HA 4J28A 8TIMA 4W84A 3TX9A 1A5SA 3ELFA 5G1YA 2OSWA 4GIYA 1OT2A 4WVXA 3SGGA 1WBJA 3MQTA 1H11A 1YTEA 4N42A 1A5KC 4JHOA 4LB4A 2QF8A 3TYBA 1JYNA 5D05A 2D1ZA 4WGXA 4MB5A 2E5CA 4LV4A 1OADA 2BNJA 3IRSA 3TOPA 1UA3A 3LRLA 5LNRA 1YADA 1XLKA 3PTQA 3BG9A 4HNTA 2A2IA 4Y96A 3THAA 3NZRA 4OU1A 3O7UA 4FLQA 4A3YA 1JFXA 3MMDA 2XN0A 2PTXA 1Z6KA 4M51A 3W1NA 5FEPA 1S2CA 3WFAA 3STPA 2QJJA 2WVSA 4BF7A 2Y5JA 3PPHA 5F2LA 4MY8A 1BF6A 2ZUTA 4KFNA 1IWBA 4WXYA 4Q4RA 3CPUA 3W7LA 4FLOA 2G96A 3R43A 5AVHA 3T1GA 1DQWA 3VVGA 5CLTA 1TV4A 4JL2A 3TNBA 4DQWA 1KCLA 1E0XA 4Z1YA 1U1UA 2WZMA 1VEMA 2QPSA 4OFCA 4UTHA 2VGFA 4KH2A 4QCFA 1RD6A 3AO0A 1V8EA 2BDQA 2HK0A 4G1KA 1E51A 1UUQA 4XIMA 2GVYA 3ZM8A 1O5XA 5FF0A 3MKKA 3KBNA 3HQ1A 3W7NA 1EJWC 3N2MA 4OWGA 4YS1A 1ODZA 3WD2A 3F5KA 1OG0A 4MTVA 3PBGA 1TWIA 4MNJA 1UPPA 1I2OA 2E09A 4G9PA 4NZCA 9CGTA 5FAGA 1L8NA 4HK6A 4L4OA 4AZHA 4R9OA 2CBJA 1EGZA 2VURA 4TVDA 2BGNE 2Y8VA 4AZ7A 3LV5A 4R7JA 4RZ6A 3PFRA 1MEHA 3S8HA 1XIGA 4QDPA 5A8QA 1Z32X 1AJ2A 2Z0IA 3HJEA 3MC5A 3RLHA 3I7QA 1S5NA 1J01A 5DCBA 3T7VA 1XIIA 2VWSA 4W86A 1GPWA 3AROA 2E8YA 3JU2A 2YXGA 4BQ2A 1IXOA 1NFGA 2GJPA 2RDTA 4DY1A 5AHLA 3KRSA 1D2KA 1TPB1 2Z2UA 4PYSA 3JW7A 3ZVHB 2FPYA 2Y8UA 4OUEA 4KCVA 2X0YA 4P02B 1ADOA 2FJKA 4UR9A 2PF0A 2D24A 1X7FA 3T8LA 1L6WA 1MYRA 3O6DA 1E6QM 1GUVA 3TP4A 2V2HA 4BJHA 3W70A 2XSAA 4AHOA 3ZVHA 5KZ6A 4QE4A 3AISA 3H7UA 2YCEA 5DEZA 4B5TA 4UCFA 3W28A 4AIBA 2ISVA 5D02A 3ABRA 4IMDA 4CN4A 3EDKA 4QFUA 1J18A 3AMKA 2ZTJA 3UR2A 3EAUA 2WM0A 1V03A 3WJWA 1FDJA 4Y7EA 3W07A 3OJGA 4JQ2A 4F3HA 2QIWA 6PTDA 3T09A 3SCTA 4R33A 3WH6A 5I09A 2AKZA 3RGTA 4DPQA 2OEMA 1TPDA 1NDYA 1H0IA 3E5PA 1BF2A 4H7ZA 1P48A 3WDRA 3TWBA 3AIVA 1HJVA 3H2AA 1JDAA 4JNZA 5C9ZA 4R5EA 5EY5A 4RE0A 5BXPA 4EWND 4O1BA 3B0PA 2V2CA 3BPWA 3RAOA 4OE7A 5KITA 4QLLA 4TVCA 1ZQ5A 4NX0A 1K9DA 2EPNA 4BCEA 2WWDA 4A8NA 3E0LA 1UWUA 4JQ1A 2OLAA 3LYEA 2FHFA 3RX2A 4XZMX 2NT0A 3N04A 3TYUA 2R1LA 5A69A 3LI1A 4IIFA 1QPNA 3F03K 1KWGA 1J2WA 4JFSA 4LVFA 2E5BA 4NNAA 1I6NA 5PTDA 3TA9A 4GX8A 1RY8A 1LOQA 4WDTA 4AY7A 1KXVA 4K6AA 3K8MA 1A0EA 4LV9A 3VIKA 1TR1A 2HNEA 4GYPC 1VIWA 1ZLPA 3FAWA 1E3ZA 1BAGA 3PWIA 2QAFA 2PU0A 1B90A 3G3DA 4YLWA 3S0CA 2EG7A 4ERAA 3CT7A 3SY5A 1NAL1 3LRKA 1DWGM 2NVDA 1DWFM 3CUXA 4YNGA 5T8GA 1ZBCA 6REQA 4P8UA 4GYKA 4TVUA 1BKSA 1V3MA 2IQDA 3DFQA 3XINA 2KX9A 1M1BA 4WCJA 3LTSA 3SCUA 2OWXA 2JIEA 1NP2A 1WB0A 3OYZA 1TZ7A 1XKYA 2FLIA 3ABZA 3G3MA 5M2FX 2E6FA 2OQLA 4LCQA 3L21A 1QBBA 1IZJA 2ZE0A 1HKKA 1EQPA 2YW4A 2ZWYA 2JEQA 3QQWA 4UMCA 1A53A 3GDBA 1MW2A 1HO4A 5CLWA 1KLYA 4DJDD 1V3JA 5DT5A 1ZAHA 4GCAA 2PAJA 5LNUA 3DYMA 4ICNA 1YPXA 3G1SA 3GNNA 5EMKA 4GI8A 2OJPA 1DJHA 2PSNA 3G1VA 4EAYA 3WDQA 1TPVA 1FHUA 3HIJA 1GYMA 3B3DA 3L4VA 3FFSA 1VLWA 3UT0A 4Z2LA 4DYKA 2HBXA 4WR3A 2X2GA 2B81A 2XTKA 3KEHA 4MFEA 3EX4A 1EPXA 3MZNA 3P14A 2PDKA 1AMYA 1RLDA 2NV1A 1VYPX 1H7NA 1RUSA 1L9WA 1F4AA 1ZS2A 2D3NA 3O0KA 3ZLFA 3L0KA 2ZZ4A 3E2SA 3M0HA 4KMQA 5A6TC 1EO5A 4HSHA 3SCRA 1I2PA 5EMMA 2V2DA 1UD8A 4JBRA 5C9UA 2CHRA 3VD3A 1OZMA 4I5UA 4ZQRA 2J13A 2XZ7A 3C8FA 4NZ1A 4JTHA 2AAAA 1QHPA 3W24A 1J2BA 3THUA 2NUWA 4WX2A 2DZXA 1FCBA 3NQ2A 4UFIA 5HMDA 4JFWA 3EDDA 4H9ZA 2CITA 2OOFA 1XS2A 1FKWA 3LM7A 4OV9A 3BCJA 5D8WA 1JUEA 1GK8A 1GOOA 3PTMA 4L6OA 3NZQA 3U8GA 4JN6A 1BG4A 3TN6A 1HN1A 1TWSA 4JTIA 1C90A 1TWWA 1S5TA 3ZOAA 3GE7A 3DCPA 2DZSA 2CIPA 3H2OA 3MUZ1 4K7VA 4S2BA 3T8QA 1R9XA 2C19A 4IPJA 2A3CA 3VOHA 2BGSA 4WJEA 3RYSA 1TUFA 3UCCA 3T55A 3R0KA 1LUCB 2NVAA 3GB6A 3SFKA 3WFLA 2ZYFA 3BV7A 1RCQA 3W01A 2WCGA 1LQ2A 4S3BA 1E6SM 3TA6A 3CAVA 4IIGA 4KETA 3MJMA 2FGZA 2GK1B 2ZA2A 1CW2A 2PTYA 3L4XA 3LS9A 3T2OA 4K38A 3URBA 1MNSA 3MO4A 4JN8A 4RPPA 1L2UA 1OX6A 1LUCA 5E6ZA 1GW1A 1PL9A 2X40A 4BQ3A 3WQWA 1LL4A 2ZZ3A 4MFDA 4JIHA 4UTTC 4ZB0A 1EWEA 4FI4A 3CEPA 3ZT5A 1KB3A 2GK1A 2A3LA 3WF4A 2J9YA 1WKDA 4DM1A 1EX5A 2VZTA 1EJXC 4Q22A 2V81A 4AVNA 5C2CA 3W83A 4R88A 3GNRA 3M0JA 1A5LC 1UD6A 3LERA 5LKYA 4Q8NA 1P0NA 4AZ6A 4GYJA 3MUCA 1G0CA 1X7IA 3PFMA 1KQYA 4J3UA 1W9BM 4GE8A 2D69A 3S2MA 2R6OA 5A2AA 3TR2A 1MW3A 4YHEA 4AYSA 4QGCA 5EU9A 4IIDA 3NPUA 1UQYA 3WF3A 2F61A 4TTGA 2WVVB 3TTQA 5F4XA 4HBKA 3LD5A 5KTLA 2CZDA 2XH7A 2O7SA 4P7RA 3CPRA 5AZ0A 2ZZ5A 4JR5A 1V6TA 2ZXBA 5E09A 4YVVA 7PTDA 3I3DA 3BANA 4IUGA 2F2KA 4GQBA 1XJBA 3B40A 3MUIA 3N29A 2XHYA 1XPYA 2FPTA 4ZE4A 3DFPA 6XIMA 2WVVA 4E0CA 2V5BA 1OG6A 2R1NA 3A5VA 3USZA 4HG6B 4UNLA 1RR2A 4AU0A 4BWLC 1VBHA 2PFHA 1QRQA 4JTAA 3WIJA 1H1YA 3LCWA 2A0NA 4QLJA 3GS6A 2QMJA 2ZUVA 5D2YA 2I56A 1T8QA 1V79A 1FWTA 3AXKA 1VRDA 2R91A 4JTLA 2XYLA 1ZENA 1Q2SA 3EMCA 2PDUA 3TXVA 3OPSA 2P8CA 1W3KA 1DV7A 2ZUSA 9RUBA 3BGJA 1GJWA 3NQDA 2NQLA 2ON3A 3BLFA 4UWMA 2PPGA 1ZJHA 4YXGA 1P6BA 4YJ5A 4D6HA 3A9BA 3KZSA 5A8MA 1UMLA 3UZ5A 1D7KA 2WNNA 3GYEA 3VUPA 1V7AA 4C6MA 3FNDA 1LOLA 1KC7A 1W5PA 3KUMA 3M16A 3RO6A 5CGMA 3KOFA 5F2GA 1QOPA 1IXQA 3DBNA 4Y90A 3EB4A 1G7VA 3A13A 3C5QA 3VIOA 3ZVIA 4EKJA 1X38A 4HT3A 5C6MA 3NQAA 1LG1A 1XSJA 1AZ1A 4YIWA 4HK7A 3E5BA 5IM51 4PRRA 3UA4A 1QO5A 3AQUA 1H2JA 1VHCA 1CXHA 3I3BA 1HJSA 1FUYA 2P53A 3ARSA 4A2SA 4I8YA 1HJWA 1MQRA 1O1HA 4PTXA 3IAPA 1F05A 1M01A 2C91A 3CL8A 4C6DA 3RK8A 3O6CA 1R3YA 4B92A 2I16A 4FIRA 3BLEA 4RL3A 2OXNA 4Y9PA 5E5CA 3ZZ1A 5FCZA 4RNHA 2XG9A 2FB2A 4PC8A 3C0LA 3JUGA 1E56A 1K6WA 2ACQA 2IKIA 1BTCA 3BARA 1LBMA 1JPIA 4OT7A 2GSJA 1AQFA 1R3WA 1ZGDA 4K39A 5DLCA 3GUWA 1NARA 3H24A 3DBPA 5K3VA 4DWDA 4W7VA 5EKYA 2W4XA 3LCXA 3THQA 5I7GA 3MDWA 1Z44A 2VJXA 4ZGYA 2DT0A 2R94A 3UZXA 1ITXA 3E38A 4M56A 1W1VA 4O0KA 2JGYA 1BSIA 3W37A 2YDSA 2DORA 4R3UA 1R3VA 1TREA 2WAGA 3WJYA 4CU7A 4UXDA 4CNTA 1XYLA 2I57A 3GZ3A 4MLRA 3FDGA 1UWTA 3VGDA 4GXMA 5E1QA 1ME9A 4GIRA 3MP5A 3MO7A 1XLDA 1IR1A 2V5CA 4FA3A 1JCYA 4ZODA 3W7MA 4L61A 1RQBA 3T2QA 1XHGA 3N2TA 1KRCC 3ZJ7A 3SCQA 2ZE3A 4D6IA 1FWHC 2PDQA 1BGGA 4YTRA 3E1F1 1KO0A 4DEFA 1F3EA 3KLKA 3QPZA 2BXZA 1YPFA 1NDZA 3MMWA 1X6LA 3VABA 4M6PA 1W1ZA 4PUNA 3H7RA 4H9XA 4CCZA 3F1QA 3LM3A 3AUJA 1NOUA 4RXGA 5DMYA 1UR8A 3QY8A 1EJ7L 2YA0A 4IQJA 1RD5A 2ZDRA 1RQEA 1E0WA 4IG2B 1QVBA 1FWBC 4LT9A 2J6VA 1SO3A 1PCKA 4L7ZA 2PLJA 2YA1A 1IT8A 3OLEA 4XZHA 1JZ7A 3W7RA 1OYAA 1V0KA 1H63A 4K68A 3S1UA 4TQTA 3S2NA 1UC5A 4NAFB 3EOOA 4WOQA 4PUWA 1VPXA 4Q4QA 3KBWA 4LJ3A 4IG2A 2FVLA 1BXNA 4ERGA 2X1IA 2DJLA 2NW0A 1B2YA 5D33A 4ZXOA 4S3KA 4B5XA 2ESCA 3CUIA 2D20A 3VX1A 2EAWA 5F4WA 4JDBA 1VENA 5TBOA 4L4LA 4NAFA 3MDUA 5HMSA 5BOEA 1EP2A 3PJUA 1R85A 3SQMA 1VJIA 4WF7A 3VI2A 4B4HA 2Z7KA 5FAJA 3NA8A 2UZ9A 3WO8A 4FX6M 4IGSA 1AH4A 2QDEA 2AMXA 3DI0A 4NJGA 4O8RA 3NQGA 4CVWA 5HXMA 3GAKA 3S6OA 3HMJG 2CLLA 4FNUA 1SMDA 3GM8A 3WNMA 3ZQ9A 1CX9A 4WRHA 2F9RA 1R7OA 1Z8AA 4M82A 3GW0A 3LU2A 3CH0A 3D5HA 4DNHA 4GPNA 4QG8A 4NRSA 4B5NA 4AX7A 4S3AA 4KRZA 3ZJ8A 2WZIA 4R27A 1MQQA 1Z3NA 1TTIA 5EA9A 3STGA 3AALA 3DHUA 3ANUA 3AZSA 3DUGA 3LX9A 2V38A 3RLGA 1EX1A 1M03A 3Q58A 2QV4A 3RU8X 1WDDA 4J27A 3FKKA 1B0IA 1CLVA 1HKJA 1WXJA 5BXRA 3NQMA 4H6RA 4HPXA 1P0DA 4UR8A 3AYTA 4PMRA 3WLKX 3WQOA 1XUUA 3HFTA 4LOCA 4P7QA 1MUCA 4JTEA 3UYCA 4S1FA 2ABAA 4K2SA 3MSYA 5HJXA 3VAVA 3E0WA 2GWGA 3H53A 3POHA 3OB8A 3CZEA 1E9IA 2ATSA 4AUBA 1U5JA 2ZA1A 3IVSA 3N12A 3NJ3A 1WE5A 5B7YA 2C6QA 1KR0A 5KEZA 3UXAA 3TSBA 2EQDA 4ZB5A 1J0IA 1Q6CA 3QZAA 3G22A 5LSMA 5CEWA 3ITTA 4L56A 1BVNP 5A6LA 4ZSTA 2BY1A 3AYVA 3EPMA 3EYPA 4O1FA 3R6IA 4NJKA 1F5ZA 4QHRA 4AY8A 4GRSA 5C9WA 1TUXA 2GUBA 2Z25A 1EXBA 2ZICA 4J3TA 1V0NA 3D0CA 1UZDA 4IPIA 5CPQA 3G1HA 4NSBA 1QI0A 4HMEA 4D71A 4ZXLA 3UQNA 3DFSA 3KOYA 2UY3A 2XPKA 4L9YA 3BXWA 1GOIA 8XIAA 4YYCA 4O12A 1JGMA 3NTYA 1XX1A 1KRAC 1RA5A 2FFCA 3IS4A 4UOZA 1LTDA 1UMYA 1XLGA 3FHAA 1F74A 1E4IA 3MUAA 3LNMA 2BY0A 4F0HA 2VFFA 2Z27A 5IBXA 3TC6A 2OKOA 3BJFA 1DP0A 3UG5A 3GVRA 3PVFA 3H6OA 3TJLA 5A6BD 1S38A 2G5WA 3F5JA 4X2PA 2Q02A 1ADDA 3CQIA 3DZ1A 3K13A 1JCNA 2IQ0A 3KRZA 5LIXX 1TA3B 2QGHA 1U1HA 2DVTA 3CJPA 4L4PA 1JF5A 4DJDA 1H61A 1GQJA 3LPGA 2QPXA 3RCNA 1TB3A 1JULA 1JGIA 2BVWA 4YTQA 5BXTA 1QJWA 1VQTA 1AD1A 3NVTA 3GC5A 4W7UA 3EKLA 4IFKB 3LK6A 4FXFA 4U10A 3ZJ6A 3RPDA 1TA3A 2QR6A 1RQHA 3H2NA 1SPQA 1BGAA 3NGFA 4TV6A 1ONEA 3AOFA 1CZ1A 3TSDA 3BICA 1KXQA 5HATA 1JNEA 2F38A 3T2PA 4NKCA 1XYCA 4A3HA 5BWAA 4IFKA 4C7DA 1PPIA 4M7SA 4E5TA 3S83A 4NI8A 2VUNA 4LS0A 3F4DA 1UJQA 3T42A 1CI1A 3VKCA 2PU1A 4MB1A 3S4TA 4F2TA 3WLNA 4Q7BA 3G1RA 3E9AA 1EHNA 1RP8A 1ME8A 2VFEA 2WANA 4HYRA 4POCA 1IEVA 2NQ9A 3MPGA 5CC7A 1QXLA 4FB7A 3GXDA 2GWNA 3GG7A 2DJXA 4B4FA 1I2RA 3PK7A 3OP2A 4OECA 5BMWA 4OBRA 5FL0A 2Z1BA 1FWWA 1BD0A 3D46A 1L8PA 4WJXA 2J7DA 2QW5A 1V3KA 4WHBA 2R1KA 1Q6DA 1ZL1A 3N6JA 1G6CA 5HR7A 2PDNA 2E77A 1RBOB 1VBGA 5I5RA 1MNZA 3R5EA 2C0HA 3QRHA 3CYVA 1BYAA 3MUY1 4PTMA 1HJXA 4QSHA 1S1PA 1C8VA 3CHVA 1EUNA 1J0JA 2WO5A 3A12A 3ES7A 3G18A 1I1XA 1A80A 1XFBA 1E6NA 3BLOA 1UD4A 2FZBA 4O54A 1PX8A 4MPKA 4PMXA 3IIPA 2B7OA 2GSHA 4CD4A 4GUJA 5FOOA 1GEQA 2IPFA 1KM0A 3HQNA 3PG8A 1RLCL 1XLMA 1W1TA 1K7FA 1NDWA 1YE6A 2CLFA 1WOBA 3ES8A 3I4EA 4MY9A 3RM4A 2GGHA 1PIFA 3VZYA 4JTJA 1R8LA 3MY9A 4G5DA 3G1FA 3P60A 3RX4A 4LEQA 3NEVA 1XRVA 4Q33A 4IGMA 4XVEA 1MMFA 1J4EA 1O66A 3ARTA 4GZ7A 4J5NA 3DXIA 1FCQA 1TVPA 3BAXA 3KTCA 4DM2A 1AW1A 1PXGA 4PUDA 2WJDA 2DH3A 1SR9A 4HNOA 1WZLA 3TVAA 1R2RA 2Q3RA 2ZVRA 4O52A 4KWOA 1OZQA 1AW2A 3URAA 4JIQA 3EPNA 5DMNA 3CGTA 1WXYA 3CLWA 3W02A 1DXEA 3O0FA 1NEYA 4DBWA 2P5NA 3ZMRA 1F4HA 3NR0A 3PZIA 2WLZA 4NZ3A 4GJIA 1GG1A 3WNPA 5CG7A 2OELA 3GZAA 1CTNA 1KBIA 3II1A 1QU4A 1F8IA 4M8UA 4PSPA 1TTJA 1EIBA 1XC6A 1UC4A 2X41A 1T8XA 4C65A 1Y5VA 1WUEA 4UTFA 2E6YA 1GQKA 4XX6A 1BTMA 3NAVA 1DJIA 4YPJA 2Y70A 5BXSA 2PDJA 2YL6A 4RV8A 4Z2IA 3FA4A 1HFBA 3RF9A 1LOSA 3PM6A 4UB9A 1BSLA 1YXDA 4FXSA 4ZTYA 2ISDA 3KWSA 4P5UA 4JIRA 3QYSA 3GXPA 1C3FA 2JALA 4NIRA 1CT5A 5HNTA 2VCAA 5T9BG 2ZRUA 4EPDC 4IF2A 1JAEA 3WJSA 4MKNA 2VHLA 2X1TA 5J8LA 4JKMA 4BQ4A 4HOWA 1EOKA 5BCAA 1R6WA 3WD3A 4XBJA 1ODUA 2YBVA 3S5YA 5D03A 2NUXA 4FIQA 1GVYA 2GVLA 4EF8A 1U30A 1GTEA 3M44A 1O6IA 1S5WA 3KCLA 4UQDA 2AGTA 2CZEA 3L5LA 1LQ0A 2ZC1A 2DUAA 2G3IA 1K3UA 1H49A 2OYKA 5I3JA 1GVIA 4MSSA 4GO9A 1DE5A 4Q8VA 1K8YA 3W86A 4ZQPA 3PP7A 1F6PA 5GNXA 2GGGA 2QJNA 2ZADA 4ZCWA 1GZ1A 3RM9A 2XM1A 2FH8A 4B9ZA 2OODA 4V27A 5AVNA 4MLJA 4KRUA 3QOKA 1PYFA 2PDFA 2ACUA 3ARQA 4MMWA 4AVOA 3LA4A 1PSCA 3UYIA 2XWEA 3S5NA 1TJPA 5EGRA 3N3MA 1OIFA 4NJIA 1UP2A 4M1BA 2Q09A 2PGWA 4MOZA 3M1ZA 5JIWA 4GH3A 3QPEA 3AJ7A 3ZSSA 2OZ8A 1DTUA 2H9AB 2QCFA 3FA5A 1M68A 4MWAC 4A3RA 1QW7A 3LLFA 4DJFC 1IEWA 3CPGA 4P8XA 2E68A 3KL5A 3ISIX 3IANA 1FX6A 3PZVA 2PC4A 2RGMA 3FYPA 3W53A 4PMZA 3MW7A 4GUGA 1RPXA 1PYMA 1GTHA 2GQ3A 3CMGA 3AIUA 4ENLA 2QS8A 1M53A 2H9AA 4X60A 4GLEA 3W2MA 2R82A 2A3BA 4ORMA 2Z2BA 1Q6QA 4AMAA 3IAQA 5FF4A 1ONRA 3LN3A 1EZWA 3ARPA 4XAYA 5HBFA 4R7OA 1DQUA 1KFEA 5DANA 1WKFA 3AMDA 1AK5A 4D8AA 3WLRA 2PDYA 1R3QA 1H1ZA 3S1GA 3OW1A 1ZBWA 3STCA 4ZQCA 4UFJA 4X9SA 4LAKA 1X39A 4Q7IA 1MXDA 4ZEPA 2E3ZA 3PTDA 3A3WA 1J5TA 1QATA 2VX4A 1TSIA 1TVLA 1CGWA 1R38A 3L7RA 3AUOA 3CAKA 4A8RA 3RN6A 5BWFA 4EXQA 1DOSA 3TQKA 1UD5A 1XIJA 3GG1A 4Z0JA 2V6AA 3A4JA 1GOXA 1UH2A 3EDFA 2PGFA 4D6DA 1TCMA 1UWIA 4JQAA 4M81A 1EJTC 3QTGA 1XRTA 4KGJA 4K1GA 3DFHA 3CASA 4NX5A 3BQ5A 3UZWA 2HPMA 5BYWA 4X0NA 1WDPA 4J9JA 4K3ZA 4OV4A 3GTIA 1HQTA 1F73A 2FZ8A 3O9NA 4L80A 5IFTA 7ENLA 3HURA 2YPIA 2G3JA 3UWUA 3TJXA 3OYXA 3QFEA 3QTPA 1KXHA 1AQMA 1W17A 4S3CA 4Q4OA 3TTOA 5C7HA 1ZCOA 4HN8A 3L4UA 4GC4A 3VX0A 4DRSA 5I3KA 4JS3A 1G69A 1CXFA 2VFDA 4PBFA 4YL2A 2Z1KA 4PMNA 3VMPA 1SZNA 2WJZA 4PEKA 3MCNA 3CV1A 4UOQA 1OFAA 3WCZA 4B5VA 4WUIA 2IKJA 2FIQA 3NQCA 4PMUA 3EWBX 1VFUA 1I9CB 1SZFA 1SR0A 3CAQA 3GVVA 1PWMA 2GUYA 3G5EA 1H3GA 3FJLA 1YXCA 1JUBA 2DGAA 4MDOA 1XH0A 2QCNA 4JHMA 3APTA 2J66A 1FP8A 4YU1A 4E3VA 3B8TA 1YNYA 5AKQA 2V3EA 3PZQA 1D8WA 1SJDA 5K4ZA 4M19A 4C6BA 4XG1A 3BOXA 4UFLA 2OWCA 2FMOA 2PWFA 4CN6A 4KCUA 3W2NA 1E40A 4MM1A 4ONVA 4LBRA 4QM1A 2TRSA 4XZWA 2XH4A 4EPKA 1QNOA 2OR2A 1B30A 4Y8FA 3TZNA 5KINA 1OY0A 3L2LA 5JU6A 1VAHA 4IIHA 1EXPA 2EKGA 3BE7A 3L5MA 2DUXA 2WPGA 1QR7A 2QNEA 3G1DA 5CPMA 3VTRA 4C6FA 4JQ3A 4F0KA 2OLHA 3NO1A 4GO8A 5DY3A 4XKYB 4Z08A 1PIGA 1OFDA 2RFGA 4GYFA 3NYZA 4AHQA 3O63A 4KWVA 2REQB 2BTMA 2AQWA 2V3GA 3SUWA 2E4TA 1UB3A 4NNCA 4XD5A 2CLEA 4B5SA 2BY3A 2F7FA 3GBEA 2OO0A 4MJ4A 4S3DA 3VOCA 3WMCA 4HA0A 4Z1AA 1JDCA 4WIWA 1UWQA 1E6ZA 3GNDA 3CUHA 3DENA 1JDFA 3NGJA 2YLLA 2PWUA 3U3HA 1LG2A 4XKYA 4KQNA 2REQA 3NFUA 4HNNA 2AQVA 1G01A 3J7HA 1OSEA 1E1CB 4B2DD 1M41A 4JZ5A 5DCDA 4ZSUA 2OTDA 3P67A 4UZUA 2C0AA 1H09A 1SVDA 2ICSA 4O13A 5EJ1B 1E9YB 3MWAA 4UQEA 2OVLA 3GFXA 4AC7C 1E1FA 3VNLA 3RO8A 4ZO8A 5DBUA 1E1CA 4NZFA 4BFAA 3LY0A 3QC3A 4OBTA 3RG6A 3IPWA 3WF0A 4PMVA 3W7KA 3INPA 1GORA 3FJ6A 1ONXA 4IL2A 2NWRA 5AHNA 5CGTA 1FFQA 4TX6A 2ZUNA 1OFBA 4URIA 5A6BA 4NVTA 4YWSA 3SRKA 5IRPA 2PGRA 3IVUA 4HGXA 2X7WA 4XK2A 4EANA 3UFYA 4GABA 2UV8G 3GK0A 5KMYA 2XFWA 3H26A 1B54A 5DFAA 1K4GA 4OVXA 4W5ZA 2Z6IA 3C4UA 2EO7A 3MZ2A 3QZ6A 2Z1SA 2BY2A 3KXQA 4GXWA 3B0VC 1LBLA 3BMVA 2JBMA 4U2ZA 3I6EA 1LYXA 2PUZA 2Y7GA 4AX6A 5CPSA 3WEMA 3D6NA 4PB3A 1E73M 3U2EA 3B9OA 3KDNA 4AY1A 4GZIA 2VR4A 1WYIA 3TEVA 3F2CA 1W91A 1US2A 3B04A 2OZ3A 3SW6A 3DKLA 1GYLA 1YQ2A 4XZLX 3EX6A 2VFGA 3ZYZA 2HXTA 3K2GA 1P1XA 3UR8A 2W67A 3GIPA 1XG4A 1IIGA 2TPSA 3VDGA 4KEUA 1L6SA 3AZTA 1V02A 3S6TA 1OQFA 4J1OA 3GXFA 2VZOA 2WMGA 3WN6A 3FK4A 1Q63A 2G3NA 2J88A 3H12A 4LNYA 5DY2A 3V0SA 1N8FA 3PC0A 4GX9A 3W1LA 1SFJA 4LRTA 2Z7GA 4WLCA 3NQ8A 3QY7A 4C7FA 5EBAA 4XUGA 4C1LA 3LXBA 3SFWA 3MSGA 3PUGA 1Y65A 1TELA 4JCMA 1FWCC 1FQ0A 1TTQA 1OFQA 1HP4A 3VINA 3R79A 5GQBA 3QQ0A 3IK2A 3GIQA 4RKAA 3C86A 3TC7A 2X0SA 5AHMA 5FESA 3SEPA 4Z2GA 3LMYA 5AC8A 4IL0A 4QXIA 2NQJA 3VZZA 3NDOA 1SW3A 2J7CA 3P84A 3NL5A 1AQ0A 1UR9A 3QHOA 4S23A 3QHMA 3SJNA 3WQFA 3CZJA 2O4QA 3IUIA 1OCBA 3WDJA 5ECVA 3IJ9A 3SCNA 1POKA 2H8XA 4ZFMA 4L9XA 1W1IE 4DZAA 3AIEA 1R9ZA 4XV0A 3Q37A 4LANA 4YTTA 5I23A 3ITOA 2JF6A 3LPOA 3CHFA 3TCEA 2VZVA 2ZZ6A 4C1NB 2NQZA 4AEOA 4Q3MA 1F2JA 3HQPA 3VGBA 4C6KA 3RM8A 1TKKA 4JX5A 1ZZMA 4F0SA 5EIYB 2B4GA 3CV2A 3ENLA 2GJRA 3W3OA 3SRDA 2RDXA 2P0IA 3SCSA 3VIFA 1L0PA 2C15A 3QH2A 2QZRA 3KBSA 2I5QA 2Q8XA 4C1NA 5BU6A 1FWSA 3P8IA 2P1FA 4WK9A 1VFTA 3P6LA 4CN1A 1N8IA 3F2DA 1TVNA 4W88A 2B7QA 3ITLA 1YXYA 1DJXA 2CKSA 1AH0A 3WQDA 3N19B 1HZYA 4QDMA 4PUEA 3KOZA 4UMAA 2YLAA 4UZSA 3MBFA 1JDEA 1LRNA 4J4KA 1JCLA 5ECUA 5CSSA 3AIQA 2XGZA 3WH8A 2NWSA 3TIMA 1FXPA 4UQCA 4S3EA 2ZZ1A 4GUHA 5EMLA 3ZIZA 3GG0A 1EJSC 5I06A 1X6NA 4QG9A 3W38A 1UHVA 3RRAA 3RJXA 4EACA 1XISA 4AZCB 3WDHA 1ZBVA 5FIPA 1CGUA 2VNCA 3FVMA 2EHHA 3V5CA 4GVFA 4DWSC 2DT1A 1ZTVA 3FCPA 2FJUB 2CLIA 2DY3A 1RK5A 1RZMA 4HZ7A 4W9TA 5FL1A 4ORIA 3FOKA 4K8HA 1AODA 1E0VA 4B91A 2A4AA 1KFBA 1SFTA 2IS7A 4AZCA 2OYLA 1GVRA 3VGHA 3WEZA 3PWGA 1J0ZA 1XLEA 2CU0A 3PWAA 1SMAA 4JNYA 2VRJA 2HBVA 2WQPA 3QW4B 1ITQA 1BWLA 2L5HA 3O1NA 3E2QA 4PULA 3GVGA 1XLAA 3BO9A 4CEXC 4I9TA 4OJYA 3UWZA 1PDZA 3WLMA 5DT7A 1DIOA 2OPJA 2PD5A 1TFVA 2BHZA 4UC5A 5DN1A 5GPRA 1NVMA 1LDCA 1GKPA 3MWCA 1KRBC 4WGHA 4WEVX 3W25A 3ITVA 5TD4A 1JUKA 4UTTA 3KAOA 3VDCA 1H1NA 5IOBA 2VGGA 3PANA 4GQ0A 2BWGA 3K8KA 3E49A 1E4LA 8XIMA 4ADTA 2NX9A 2V5DA 5F2IA 1CB2A 3JVAA 2WJEA 4FNQA 1RJQA 5K2ZA 3UZJA 5CJ5A 4N4PA 3NIYA 3L5AA 1EJUC 2J25A 2VXNA 3F4WA 3C0JA 2XWDA 4HU3A 4K8GA 2XH0A 4D9PA 1E6PA 1I60A 2ZQ0A 3CZGA 3N1AA 5HWNA 2FZDA 4JYDA 1V93A 3A24A 2IMRA 3EZ4A 4PUUA 4ZOAA 1QDSA 4JFVA 1XBYA 1UYQA 1UZ4A 1FWAC 3WELA 4Q6XA 4W8LA 2E28A 3GC4A 4XISA 4DI9A 3RLUA 3P82A 4O57A 4DAIA 3MV11 5JBFA 1GT8A 5LXEA 4LAZA 3L68A 2H90A 3SUVA 5A94A 3T0TA 1KCXA 3LTPA 3TR9A 1QNQA 3AXMA 1JZ8A 3I6RA 5H1WA 4ZZ9A 3A64A 4NYYA 4PCSA 3R7MA 2PZNA 4BWLA 4F0RA 1KM1A 4GFSA 4H9YA 3P80A 2UWFA 4QDWA 4CQCA 1AA1B 4DJED 2ZCGA 2CZ5A 3V0UA 3QM3A 3KL3A 5F1VA 2JFEX 3E2RA 2CEQA 3A9IA 3IVTA 4JPGA 3VFCA 3UVAA 3SIMA 3WQ4A 3PUOA 3UZZA 3ICJA 4EF9A 4HZ8A 1UW9A 4XIAA 2VDGA 1U22A 4AB4A 3KVMA 2R9RA 4ML9A 3SDOA 1QAPA 3GR8A 3RXZA 4M3PA 3L0GA 3M47A 1A0DA 3WF2A 3ONCA 4H8HA 2YFOA 1J0KA 3WK2A 4A3QA 1W3HA 3ZLGA 4XAFA 4KIRA 3FYOA 1M5WA 1MW0A 3BJSA 2QUVA 3RMEA 3QGKC 3P62A 1YDVA 1G94A 3BG3A 4L6DA 3SN0A 3ZO9A 2R14A 1UWAA 1EF3A 4CQ9A 1UQZA 1PB0A 1B3XA 3EWYA 4Q32A 2QHAA 3H22A 3W84A 1VCGA 1CGXA 4IZGA 5HUOA 2D2OA 2DZPA 4HJWA 2VEKA 2Y6ZA 1KTBA 4LY8A 4ML4A 3IGXA 4F4RA 3BZJA 1EA9C 2BVTA 1J93A 1S39A 3ZR5A 4AZGA 3ABQA 3AIBA 3AAMA 4O10A 1B4KA 4DBEA 7TAAA 4G6CA 4FNRA 3IV3A 1NU5A 4DLFA 1T40A 1CNVA 2O56A 5CPOA 2Z1WA 3W7DA 4NJHA 4C5YA 1EGVA 3GSMA 4HYWA 3M46A 1Y0EA 2J8FA 3RRXA 3IIVA 4Q8QA 1G67A 1SW0A 3DN5A 4Q4PA 2QUUA 4K1WA 1U5HA 3WLQA 3KP0A 1AZ2A 3H2CA 5HK4A 4DJFD 5HQEA 2WC4A 1EBHA 1D9EA 1FBAA 3TYZA 4ASTA 1HIZA 2OLSA 4ATLA 3P5ZA 3IGHX 1KQZA 3CQKA 2I7GA 4EPEC 1VGAA 2GVJA 4JNMA 1K9EA 1EF2A 3WBXA 1ZB5A 4N7QA 5CC6A 3CZ8A 4E8DA 3RX3A 3M0KA 5CH9A 2BXYA 3M64A 4IGHA 6ENLA 2EGZA 1XUZA 1YNQA 3IGUA 1DJNA 3LEPA 4ZOEA 2E1DA 2WZHA 3OLIA 1C92A 1E72M 5IDIA 3FV9A 4PBGA 3T4WA 3ARXA 2NXGA 2CETA 1SJAA 4Q7NA 4RNJA 3DFNA 3FSTA 3HG5A 1VFSA 1WPCA 4PMOA 1OWQA 3OHMB 2Y7DA 3I68A 3U5YA 4PBEA 1KM3A 5DMLA 4LYRA 2I5IA 2RDUA 4N9EA 4GC3A 1I45A 3APGA 3CB3A 3QZEA 1K03A 3FS2A 3RILA 3IRDA 3M6YA 3VCCA 4DAFA 5GVJA 3U57A 1X1NA 3QVQA 1XV8A 4GNVA 3VNMA 4NAEB 3P8JA 1FH8A 5D09A 4OQVA 4I9AA 3MJYA 2ZZ7A 4JYEA 1JZ2A 5DQPA 2PLMA 1KM6A 5G4WA 4GACA 3LOTA 4Q8MA 2A21A 4JL1A 5FF3A 4B3KA 4I90A 3QEZA 4NAEA 2VO5A 3H2MA 1NQKA 3W22A 3GXMA 4UNKA 3O6AA 1WO2A 5JVLA 4AG0A 1BHGA 1CB7B 2W63A 1B3VA 2RGLA 1H0GA 1C7TA 1P0EA 5HWMA 2ZUUA 3GTFA 4E3TA 4Q8PA 4O18A 4BY3A 5A95A 1ME7A 3HN3A 3OIHA 2YCJA 2XINA 2QGYA 3EX3A 5I24A 3R12A 4C6JA 5LYRA 1TQJA 4IPPA 3W7GA 3AMCA 3N18A 4ADSA 3RNDA 1U83A 3EMQA 3CUFA 2VL4A 3CV7A 3VDBA 2VEGA 3GBDA 5T26A 2PCEA 1BEUA 2DIJA 5C7VA 4MNLA 6ALDA 1LZOA 3EKZA 3HGRA 1E43A 5EL1A 1CWYA 2X8RA 4AD4A 3POCA 4O16A 4HA3A 3RJYA 1JZ6A 2WPBA 1J12A 3CHCA 4Y9AA 3P81A 4ZO7A 4DHGA 1Q8AA 2VRKA 1J6PA 2WNQA 4KT2A 2OKTA 3V35A 1VEOA 3K4WA 2E40A 3W76A 1ADSA 1BLIA 1GW9A 3RMJA 3S1XA 4LUYA 1DIKA 2HMCA 4J2PA 2CLOA 1EKOA 3M0LA 4R7WA 3UJFA 3G1YA 1OCJA 1XLIA 2HVNA 2ZUWA 4IQLA 3P93A 1YIXA 1R3TA 4KIEA 4BQ5A 3NOEA 3NQFA 3EXRA 3VPLA 1PKYA 2GDUA 1C9DA 4Q8WA 1XXXA 2GZXA 1MWOA 4ILSA 1JPKA 1UR3M 2PWGA 2DEPA 2GJXB 3ATZA 2JQXA 2JK2A 4DXVA 4F8XA 1H62A 1W5NA 5M1TA 1MQPA 1ZUAX 1IE7C 3ZR6A 1ELSA 3FAXA 2HSAA 2GUUA 3SURA 1TZZA 3DC8A 2FQIA 2GDQA 3VD4A 2DQWA 2GJXA 2GL5A 1PVNA 4A2RA 4NZ4A 3QMSA 1A5CA 1YNPA 4JOMA 3Q2DA 1QOQA 3WDPP 2Y7FA 4AISA 2O55A 3GHRA 4IP7A 3VKKA 1EZ2A 2OO6A 5CZSA 3ARWA 2JF7A 2J47A 3AIRA 1RCOB 3VKBA 4XWUA 1WZMA 3DECA 4C6NA 4A8IA 1WKEA 4G1NA 1F3XA 5U4NA 4YMZA 4RE3A 1V6XA 1JCTA 3CT2A 3SSZA 3DG7A 1EOMA 3CC1A 4ATDA 2NV9A 1PZ3A 3SUUA 2PLKA 5CPLA 4I5XA 5JMUA 4ZA0A 2QV5A 4H41A 1VYSX 1WZAA 4HNVA 3V7PA 3P3BA 1SW7A 2PTWA 2IW0A 1I75A 2J8GA 2Z26A 3QR1A 2HV5A 4KESA 1EUAA 2C7FA 4PR4A 4P7LA 2ANUA 3TYAA 2HXUA 2FGLA 4PFHA 4TXEA 4EP8C 3DX5A 1H7XA 4PTNA 5AZ1A 1ZP3A 1XF0A 2BV9A 3TN5A 1O1ZA 3UP8A 2PWVA 2HZGA 2CZFA 1O4UA 3U2CA 3VCRA 3OQ8A 4NASA 1PZ2A 4O28A 2WSKA 4PGLA 3N17A 2X2YA 4YCOA 1W5OA 1TV8A 1KV5A 2G50A 1CEOA 2VCBA 4DPPA 3CO8A 1ITUA 2Q8LA 3U7VA 4DVOA 5IXEA 1IEQA 4UTJA 4MJMA 4WQ6A 1I0BA 3L4WA 1BVZA 1W9DM 2HVMA 3GKAA 3P61A 2A7RA 2XISA 4PUJA 1O94A 5F4SA 5BRBA 2C1HA 3L12A 1H7WA 1VCFA 3HB9A 1V3LA 1NWUA 3GTNA 2Y88A 5I02A 1B9ZA 4UTIA 3WUBA 3ITCA 1XDJA 3W1PA 3BLPX 2AOSA 1IEXA 3BAIA 1G4EA 2IPJA 4IICA 2B0MA 3SN4A 3UCQA 4FHAA 5I2UA 2X30A 3VKDA 4QITA 1YMYA 3O16A 3FYYA 1Q8JA 1IZKA 5FSDC 1LLZA 3CTTA 3LQGA 5D32A 1F6YA 1V6WA 3DHFA 2ISFA 4O19A 4WD0A 3LHUA 2OSXA 3BCDA 1Q6EA 4E2DA 4V15A 5HINA 1XDMA 1X1ZA 3YPIA 1H51A 4HZMA 3GYCA 3E96A 1ENUA 4WXZA 5ABEA 1EEXA 3Q65A 2HS8A 3PZUA 2E1WA 2C79A 4Z1DA 1XD0A 2ODOA 5U7SA 3GH4A 3PTKA 4IP4A 1UG6A 3AXIA 4KEMA 1W54A 3ZWSA 1O12A 2QLYA 4M6UA 3SSJA 3UA3A 3W23A 3AS0A 2PDHA 1E9ZB 3UR5A 2YFNA 2PTDA 4I9MA 1J79A 2PP1A 1LRTA 2VGBA 2RKXA 3H21A 3HG2A 1R3SA 2PP3A 2BOEX 3F4NA 4I6VA 4DO7A 4X22A 2BXVA 2BHYA 1THFD 1UUOA 2F6XA 1LLWA 1PX4A 5TQLA 4JXCA 1JQXA 1VJZA 3HBLA 2XFFA 1GOMA 4O14A 3WY1A 1CLKA 4HU4A 3WH7A 3MHFA 3BOFA 1JF6A 1OK4A 3M7WA 4RX0A 5EFFA 3E2VA 3V18A 6A3HA 2OEKA 1TMHA 1BXBA 3P7YA 4JYFA 1FKXA 4U28A 4C5ZA 3PUDA 4LVBA 4UTWC 2VT0A 1JXJA 4MYAA 1BVWA 4V2XA 4M1RA 1DORA 3VGGA 1YLVA 5CJMA 5JXQA 3HTWA 5AHEA 5J5DA 1A3HA 3OBKA 3OZPA 3O15A 2JEPA 3FY1A 1E55A 2V63A 2FZ9A 1XR2A 3H4XA 2UY4A 2WHKA 5C71A 1LLOA 3TFCA 2Z6JA 5CG0A 1VCVA 1R46A 2VR2A 3UWYA 1IGSA 1RVGA 1JRCA 2P76A 2XVNA 4L65A 2WNZA 1OCNA 3R13A 3O6YX 1N55A 3PNZA 4IXXA 1FP9A 2HEJA 3LNPA 3TTSA 4LALA 2YGYA 1CYGA 3AMLA 2NSXA 2E6AA 2VOMA 2VEPA 5H8MA 2DZBA 2YDAA 1W2VA 2INZA 3VD5A 3B8DA 2R1PA 4E8CA 2BSLA 1TPWA 3GH7A 2XIIA 4DUVA 2Z28A 1R3RA 4NXKA 1HTIA 4DWSD 3OGRA 2WJFA 1EB3A 5LIKX 2KAUC 4GUFA 4JIPA 4H6KA 2OWWA 5KZDA 3ZT7A 5AC7A 5A6AA 3K1DA 1W3NA 2DVXA 2W79A 3TYEA 3WENA 4UQBA 1WDSA 3IACA 4HMDA 4FALA 1XIHA 3VOJA 3DKJA 3AI0A 4PSRA 5B80A 1F76A 4UFKA 4P7OA 4G7EB 1QHZA 1WV2A 2Y24A 4MZ1A 3GKFA 3N9KA 3AS1A 4GI6A 1QOXA 1IR2A 5JBDA 3EDJA 1GYNA 3VFLA 1OC7A 3TE9A 4HTBA 4G7EA 4WDUA 3W82A 2GQAA 1YPIA 3VGEA 2W0UA 4YCPA 3TN3A 3IV8A 4AWTA 4A8LA 2R24A 3U2OA 3CUZA 1KM4A 1VR6A 2E9BA 1C8QA 2DZWA 1SYTA 3MCMA 3PJXA 2GLKA 1K9FA 4B5UA 4ACYA 4ECLA 1KRMA 1PZ0A 4N0RA 1P43A 1BRLB 1B9BA 1UCWA 1SGJA 4OZOA 2E8ZA 1ZP4A 3TCSA 2GPTA 3CMJA 3W1AA 5F7UA 3LV6A 3RUBL 3LCIA 4LVAA 4GIEA 2AL2B 3WFZA 3XIMA 3QR3A 1W32A 3CH9A 3QPYA 1E9LA 4MWAB 3S46A 5F1UA 1BRLA 4L1WA 4ATWA 4W89A 4NNBA 1Q4WA 2P10A 1JIBA 1K8ZA 3XISA 3KRUA 5JH1A 2VENA 1KGUA 3SGZA 4BK9A 2Y89A 2EPOA 1UBSA 5HA7A 3FGCB 2AL2A 2DSZA 4Y2WA 1MXGA 4MWAA 4HOZA 4LW7A 4DJFA 4G2DA 2EEXA 1UIPA 4IMEA 4RK8A 3W7PA 4IJCA 4PL1A 3QKEA 1OABA 4QAWA 4XBSA 4O4WA 5D9MA 3OVPA 1AD4A 3FGCA 5MHBA 5HJYA 1MVYA 2Q01A 3BAJA 4L4MA 4Y9NA 4ZO6A 5DCEA 2ZBTA 5AY7A 1A50A 3KLLA 3MYPA 5CBJA 3PZGA 1QK2A 3VIIA 1WOAA 1EQCA 1D3CA 2DSVA 4EIVA 4FOJA 4JTRA 3WJXA 3FXYA 1B3WA 1JPHA 3S47A 4WSKA 1MDLA 2XIBA 4LEFA 4MJ2A 3KTSA 3THDA 3SB0A 4PCTA 3GVWA 4NJJA 1A5NC 5I78A 2FZNA 3OLGA 2PA6A 4CLMA 4R85A 4O1EA 3Q67A 3M5XA 4J2MA 1F07A 2EF9A 4EAMA 1PKNA 2J74A 1MDRA 5JIPA 3JR2A 3HV9A 3L4TA 5CPTA 1GZGA 2Q3OA 3KBJA 1DJWA 3VO0A 3W88A 4O0QA 3A4XA 1RAKA 3R94A 4MPQA 4FK9A 4BEQA 3WLOA 5LNWA 1WAUA 1E3XA 1XYMA 4HNLA 1QT1A 5F2MA 3DOPA 3BAKA 3OQEA 1W1B1 3ZLHA 4PZVA 4QJ5B 4BR1A 4B5WA 4JFUA 3UZYA 3UG4A 4AZIA 3FJNA 4FS9A 3CB8A 1TIMA 5I6SA 3UXKA 2AKMA 5DXXA 1I4NA 3D47A 1A5OC 3EGJA 4M80A 4M7TA 1GNXA 2V69A 3KCOA 1Q6GA 3KFTA 4PMYA 3VE9A 4FSAA 4QJ4B 2OQHA 2NQ5A 3PBWA 3PB2A 4IOTA 1PO9A 4EVZA 2JKPA 4R53A 4PRTA 5H8UA 1KBBA 2PDGA 1UROA 5KETA 3U7BA 8A3HA 4X63A 4ERIA 4WSJA 3BCFA 2OT1A 4ROQA 3H23A 5DBTA 1V6VA 3BSHA 1TE1A 2X09A 4QAIA 5A5WA 1TV3A 1DYSA 2J7FA 2VEFA 1RALA 3AHXA 4M0XA 1SUXA 4YYFA 4O50A 1ZCCA 3GIYA 1ICPA 3PHAA 3GTHA 2VX6A 1US3A 3OZYA 3GDLA 3NOYA 4CQ8A 3OGVA 1DXFA 2D2JA 2ZTKA 3CHEA 3IJ6A 2G3MA 3QXBA 1SJCA 3ZS4A 1WUFA 1JNDA 5AC6A 1V08A 1PCWA 3GAYA 1S2AA 2INEA 2X42A 4P8VA 1X6UA 3ABOA 3MP4A 4GD0A 5D8ZA 4W8AA 5TNVA 1QPQA 1SSGA 1W56A 3WMSA 3S2JA 1DJQA 2Y5SA 1TV7A 3M0YA 1DTNA 5A8GA 3M0ZA 2X05A 4AH7A 4PCPA 1UR0A 1LT8A 1KGXA 1LWJA 1JCXA 2Z24A 3D3FA 4XAPA 2EJAA 2WMHA 2I1OA 1XBZA 4GCXA 4MNKA 3MCOA 1G1YA 2RAGA 3TW7A 2CBVA 1LROA 4ACZB 4IQEA 3NQ7A 3CYJA 3TLQA 1A5UA 5CSUA 3B4UA 3N2OA 2XFYA 3EWUA 2V5KA 1GOWA 2VWTA 5HULA 2JKEA 4MAZA 5C2XA 2OCZA 3UR7A 4IMCA 1FHLA 1VFHA 1S1RA 2GOKA 4ACZA 3NNTA 3F7JA 4O53A 3WLLA 2BLEA 1EA0A 5TAOA 1VBUA 1VBJA 4MYXA 1GVFA 1QNRA 3PBMA 2CLPA 3ITGA 1KCKA 3WL1A 3KHJA 3AWOA 5A6JA 1GEHA 1XGDA 2P3ZA 3W7EA 3WQ8A 3MANA 2QCDB 2WVUA 4G56A 3TKFA 4KWSA 2WZTA 1EPVA 2QJIA 5MKGB 4S39A 4Z2JA 4Z2KA 1M7OA 3U6WA 2CHNA 3UG8A 4QJ1A 3OO2A 3LHWA 4FLRA 3MTWA 4WDXA 3EEZA 3EKGA 1YX1A 2QCCA 5J04A 1QNSA 3W2JA 2WKJA 2FGBA 1ZJIA 1M65A 1WDQA 2WMIB 5MKGA 4NILA 1TPUA 2PODA 3O8AA 1PEZA 4RZBA 2YBUA 1K8CA 2DIKA 3L2IA 5FACA 3DHDA 5FI8A 2D2HA 1IGWA 5LNVA 4LFYA 5AYYA 1LL7A 4X9YA 4KEZA 2BG5A 5AHFA 4QIUA 3DYOA 4O17A 2CXGA 4J3WA 5A2BA 2Y2WA 2WMIA 5KSWA 3MHUA 5G2WA 4OHQA 2OB3A 1XLJA 4HCHA 1HGYA 4HKPA 4S3GA 1QI2A 2NXHA 3K4AA 1L6GA 2R1MA 4HZ6A 3VK5A 1E15A 1VB9A 4IWWA 2DZAA 2XSXA 3TYCA 2EPKX 1EC9A 4JTUA 4MUZA 4AD3A 2YCLB 4R34A 3G1XA 1JYVA 1PIIA 4C1KA 3LLDA 4AIEA 4DLMA 3B03A 5KZMA 4HNUA 3KRBA 4E2OA 1XH1A 3CQ0A 1O5KA 1RA0A 1XP3A 1T0OA 4D6EA 5BRQA 2QUTA 2VMFA 4Q4KA 2Z2AA 3GFYA 2QMKA 3NZ1A 2VQTA 1H41A 2WW5A 1YDNA 3E0IA 1F3WA 3A3HA 4MAVA 1V0LA 3PPFA 5EMJA 3OGSA 3BVJA 4E38A 1UWSA 3SZ8A 4K37A 1UP0A 5FF7A 3B0XA 2Y85A 3MV01 4QRNA 5FD0A 5BRPA 3LDVA 3C2OA 1OGGA 1LJYA 3OZMA 1UR4A 1P0BA 1C8XA 4A29A 5FJRA 3PF3A 4DUXA 3HJZA 1X1OA 1ONWA 1BYBA 4EXBA 3VKAA 2J77A 5FEXA 3LCLA 3TNOA 3G6MA 3U9IA 5E0CA 3W00A 2HQAA 2UY5A 3LG3A 3SY8A 3E02A 1JYXA 1REQB 4GY0A 3AHVA 4MVAA 3UETA 2P88A 3W72A 3AU6A 3LCGA 1RP9A 1QHOA 1QASA 2CLHA 1XDLA 4DF2A 4U3CA 5LA1A 4A21A 5C55A 3WF1A 2X1SA 3JRKA 3NQBA 3NSMA 4JEJA 4I7VA 1REQA 3ALGA 4FOUA 1EP1A 1XBVA 3R11A 4HVXA 4HHMA 1UD3A 4JAWA 3AU2A 4X2RA 3WBEA 2Z29A 3VD9A 4AD5A 1DHPA 4LQ1A 6TIMA 3FDKA 3QV7A 2DZUA 3ITYA 4DB7A 4PB4A 3MMUA 3WJZA 4YN5A 4C6PA 1K77A 3JS3A 3WNNA 3EBVA 5RUBA 2HJPA 4QX4A 3W29A 4F48A 4H1ZA 2JGQA 2ZXAA 4UQAA 5DO8A 4LRSA 3TK7A 3S5OA 3M0MA 3BLKA 3NXFA 1MFUA 4O4VA 4DUOA 2QKFA 3P2VA 3N4EA 4UFMA 4MF4A 5C54A 3ONBA 3GHSA 2DP3A 2FKPA 1T41A 1LQAA 4DF0A 1RVKA 3UWEA 1BQCA 4DYJA 3AICA 4PTDA 2DSKA 2XM2A 3TTYA 4EXAA 2OZ0A 3V75A 1IQ8A 1DJYA 1FH9A 2GJNA 5H91A 3UPBA 4PUKA 2ISWA 4M6QA