1MWOA

Crystal structure analysis of the hyperthermostable pyrocoocus woesei alpha-amylase
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
434
structure length
434
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
total genus 158
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mwoA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mwoA01
4W93A 4OOZA 4QFUA 2WB5A 2CHOA 3F5KA 4ZFMA 4LPCA 4XZWA 4J3UA 4AIEA 5EFDA 2D0HA 1QI2A 4W5UA 4EK7A 5GPRA 2AMGA 2CITA 4UNIA 5I0DA 2CESA 2DT3A 3RDKA 5A94A 4CD8A 1B0IA 3L4TA 1QI0A 1LJYA 2DSVA 4FLQA 2XFFA 5EBAA 1OBAA 1E0XA 1DWHM 3SCTA 1AMYA 3DYPA 2HVMA 1AQ0A 4H8VA 2F1AA 3WELA 4PTXA 4U3CA 3WL1A 3EJUA 3VNZA 4NRRA 1H49A 1H09A 2V3GA 1XSKA 4JFTA 3WH5A 4CN4A 2G3JA 1O6IA 1P6WA 3AIBA 2VCAA 2J8GA 5KEZA 3CZ8A 2YBTA 1VEOA 1WAWA 2V3DA 1HKMA 4WK9A 2O9PA 1J0HA 1JG9A 4RE2A 3BLBA 1MYRA 1M7XA 3CGTA 2VZTA 2VZSA 5IDIA 4UTFA 1G5AA 2J75A 4ML4A 1TQUA 2BHZA 2PWGA 4KRUA 1R87A 2WHMA 4NZCA 2WBKA 5CLTA 3BVTA 1W2VA 1W1VA 2GDVA 4MPKA 1FFQA 3BAWA 2WW5A 3VDCA 3W37A 3MO4A 3K4DA 3OLIA 1GZJA 1KR1A 3HG2A 3VIKA 1PBGA 1KCKA 1OWQA 2XTKA 3VO0A 3I3BA 1KBKA 1JNDA 2X0HA 4PEEA 2X1IA 4E2OA 1AQMA 3D3AA 1OIMA 1C8XA 1UZ1A 1K9FA 1CDGA 3UCQA 2XSBA 1LL6A 4W5ZA 2EABA 3CZLA 4FLSA 1E6PA 3THCA 4W8AA 3TTQA 1B3YA 2BVDA 4H8HA 3AIWA 5IFPA 1SMDA 4F79A 3ARQA 2GJXA 3NYDA 1BGGA 3ARTA 2J77A 5IXEA 1ISXA 3EMZA 2J4GA 2A3EA 3RCNA 4NZJA 3WBEA 1VRXA 3W6MA 3W29A 4W7UA 5A6BD 3BSGA 3HZ3A 4A4AA 3CZEA 5E6YA 1QW8A 1QHPA 4UR9A 1HKJA 3UERA 1R86A 3UG3A 1WZLA 1Q6FA 5KZ6A 2D73A 4P7NA 1V6WA 1L8NA 2OSXA 4JIEA 1W3KA 5A2BA 2DT1A 1J0JA 1HN1A 4U2YA 2WC3A 5BWFA 1BVNP 1MFVA 3WD0A 2VOTA 4A3YA 1E1FA 1CXKA 4M8UA 3KL0A 3A5VA 3IGUA 3DECA 4U31A 2JE8A 2J79A 1OINA 1UZ4A 1QNQA 1E9LA 3PZQA 3DDGA 4UOJA 4ATDA 3A47A 4X0NA 1JZ4A 1WO2A 1W9XA 2WAGA 3GH7A 4KGJA 3ZO9A 5CJ5A 3VPLA 2OSYA 4V27A 4OIFA 2CIPA 4GQQA 3LXCA 1UWUA 1Z32X 4Y7EA 2GJRA 5DT7A 3GDBA 3TOPA 1V3LA 1W3LA 2WSKA 3VIHA 4CUCA 5LA2A 1E15A 1WDPA 4UFKA 3PBGA 3SCQA 4KWUA 4JKKA 4F9JA 4DM2A 2VX5A 1E55A 3VDHA 2Y5EA 3AMLA 3VIOA 3CHFA 1ESWA 1UKQA 2XYLA 4EE9A 2Y8KA 1BG9A 2DSKA 1ZS2A 2A3CA 1UKTA 1US2A 1UWSA 2BY0A 5DMYA 1RPKA 3VM7A 3II1A 4UOZA 1FH9A 4OGZA 4UZSA 4C7FA 5I6SA 1GNXA 4BA0A 3MSGA 1KQZA 3RMEA 3WY2A 2UY2A 3VGHA 1JYVA 1CGUA 4CN6A 5FIPA 1K9TA 4W85A 2XUCA 2EACA 4J3VA 4MADA 3VTRA 1EGZA 5E09A 1XCWA 4M1RA 1D2KA 1HL8A 4JL1A 2JEQA 1FH7A 3MMWA 3VD9A 3WDQA 3T2QA 3AMGA 4UCFA 2D0FA 2C7FA 5HDRA 4DO4A 5I77A 4KMQA 3SCSA 2QHAA 2J74A 1RP8A 1QNOA 1R34A 2VT0A 3AQUA 2YA1A 2PC8A 6TAAA 1UD3A 1OGSA 3A6OA 2ALWA 1V08A 3GBEA 1CGXA 1E4NA 1CEOA 2J7DA 2V5CA 3D51A 4MNLA 4HP5A 1HJSA 1NOWA 1GOOA 1Q6GA 3RILA 1M53A 2BXYA 1BHGA 3HG5A 4AD1A 2AAAA 4D1IA 1RD6A 2CETA 2XFYA 4JCLA 5FKYA 1WNOA 3FY1A 3VIMA 1CGYA 4AWEA 4D6JA 1JAEA 3SCPA 1Q6DA 2BHUA 1UR0A 1GQIA 1R7OA 1CGVA 4PCSA 2ZWZA 3APGA 1GQLA 4GQRA 4CCCA 4PYSA 2E0PA 2FHFA 3AIUA 4J3SA 3WH7A 2VO5A 3VSVA 3WNLA 3WF1A 2O92A 1J9YA 1HJVA 4AISA 1FP9A 1W91A 1M04A 5D4YA 1JNEA 1TA3B 4FNRA 1JD9A 1WCGA 4P7RA 3EJPA 3FHQA 4IPLA 1PX3A 3U5YA 3WUEA 2WSPA 3A4XA 3CUFA 3ZSTA 1GORA 1IZKA 4PCTA 1JI1A 1E43A 2XIBA 1JDCA 4JFVA 1ODZA 1QWNA 1HIZA 1N82A 3WQWA 2X2IA 2VQUA 1EDTA 3ARZA 3JUGA 1Q6EA 3L2LA 3NDYA 3HN3A 3MI6A 1VJZA 4HU8A 5CZKA 4X9YA 2QLYA 4J3TA 1S46A 3M07A 2DIEA 2YKKA 3MV01 4IPNB 5ABEA 5E1QA 1KBBA 1V0NA 1PX8A 2FH8A 3DHPA 4OJYA 4Q22A 3RO8A 2GVYA 3CC1A 2O9OA 1C3FA 3CZJA 1GOQA 4M82A 3ZJ6A 3HG4A 1E4LA 4MNKA 5FL1A 3CTTA 3L4YA 3GXFA 2O9RA 1R75A 9CGTA 2GK1A 2D0GA 4LQ1A 3PZMA 4KH2A 3KLKA 3DX0A 1UD4A 2Y24A 3ZR6A 1W9PA 2CERA 1ZBVA 5M03A 3ZIZA 1XYZA 4OOUA 3WSUA 2DQXA 1C8QA 3MUAA 2VX6A 4TTUA 3W28A 3T2PA 2YFOA 3HMCA 3VNYA 4BF7A 1W32A 1MW1A 3ARYA 1DWGM 3S2CA 2JALA 1UG6A 3WNMA 1E6RA 2EXOA 4F9DA 5JIPA 4FMVA 4HZ6A 5AYBA 2E4TA 2V3EA 2E8ZA 1IV8A 1E5NA 1W1PA 1DWAM 3BAJA 1WB0A 1QWUA 3MUY1 2XSAA 3W4RA 2C0HA 1TMQA 2YDSA 5A6LA 3UG5A 1NH6A 2A3BA 1GJWA 1TQTA 3VMPA 4H2CA 3IAPA 5BCAA 3NJ3A 3VSTA 2VCCA 1H2JA 3KEHA 3WQVA 1BGAA 1KXHA 1UHVA 4ATLA 3N1AA 3DX4A 1UD5A 2WVVA 3SCWA 1XC6A 3WNPA 4HMEA 1B30A 3HJEA 2W92A 1TQVA 1R47A 3WDPP 4P7OA 3PTKA 4CD7A 3VIPA 4Z2HA 5I23A 2XM2A 4RL3A 3TA9A 1QBAA 1B31A 3M6DA 5D8WA 1XSIA 2ZE0A 1B3VA 2NW0A 3AICA 3AMDA 1G9HA 1VEPA 4FNPA 1U33A 3MMUA 2W66A 2EQDA 1JYNA 3WN6A 1XRVA 4YHGA 4PMVA 1UH2A 3CPUA 5A8OA 3WQ8A 1UA7A 4ZE4A 3T2OA 3CZSA 3LX9A 1E56A 1V6UA 2E3ZA 3N13A 4PMZA 3B9EA 3TTSA 3POHA 4AD4A 2QMKA 2YA0A 1QPKA 1SYTA 1OCQA 4XB3A 4H7VA 2DPEA 1OT2A 4J7RA 3GNOA 1CXHA 3GXTA 4DWSA 1MFUA 2OWCA 1QI3A 1C8YA 2DGAA 4D1JA 2DT0A 2YL5A 3AJ7A 2W62A 3ARRA 5LYRA 4FLOA 1W1YA 1RH9A 1W1TA 1UR9A 3MANA 5ABFA 2WK2A 5IFTA 2CBUA 4GKLA 2YIHA 3U57A 2VRJA 3UR7A 4D6FA 5A95A 4AXNA 2OW6A 5IHRA 2BHYA 1UH3A 3WBAA 4TUFA 3GBDA 1FA2A 3GNPA 3UEQA 5C8BB 2Y2WA 1BYBA 3W53A 2G41A 3TONA 1OGBA 2JF6A 4DUVA 2GJXB 3WKZA 5A8NA 2DT2A 4J28A 2VX7A 1ISYA 1CIUA 2B31A 3AMCA 3BXWA 1VBUA 1HXJA 2VJXA 1X1NA 1B9ZA 2YLAA 2G3IA 3AS2A 1KXTA 1H41A 2XHYA 3T09A 1M01A 5BXRA 3BCDA 5CSUA 3OZPA 2J7FA 1HVXA 4U3AA 2Z1SA 3A4AA 2DH2A 1UUQA 3M46A 3WNOA 4E4PA 3K8MA 2YDRA 5A6KA 3PTMA 3FW6A 2BY2A 1MW2A 1J10A 3VIJA 4FLRA 1CGTA 2F7OA 4P8UA 2J78A 4JHOA 1MWOA 1EH9A 2VR4A 3N17A 2W5FA 2CNCA 4FNSA 5A2AA 4LXFA 3VX0A 2WKGA 2FGLA 3CMJA 1UKSA 4AZGA 2PWFA 1CYGA 1GOMA 4B3LA 1QHOA 2QPUA 1UR1A 1HTYA 1FOBA 2JFEX 1PIFA 3AIRA 3LPGA 3UETA 3ARUA 2D20A 3B9DA 1HJUA 3L4WA 2ZX7A 1ODUA 1E3XA 1BTCA 4HMCA 5A6JA 1GQJA 1GVYA 3GYCA 4Z2KA 4HMDA 5I78A 4PBGA 2VURA 2BS9A 4AMXA 4HZ7A 4QLJA 2XN2A 2ZIDA 3IJ9A 3MV11 2E9MA 2J47A 2EPOA 4N42A 4PTMA 4GO9A 4MB1A 2ZUTA 4B9ZA 3NSNA 3AHVA 1E3ZA 3OA5A 5BXPA 4WKAA 1HP4A 4GI8A 3RJYA 1TCMA 3AXHA 4DO5A 4J27A 5DO8A 2XVGA 1W9BM 4GIAA 1Q6CA 1JYWA 3VSUA 1UR2A 3AXXA 4ZXOA 3ZJKA 3WIJA 3D4ZA 2DH3A 2MANA 1VJSA 3WH8A 4ATWA 4WJXA 3AZRA 3K8KA 2Y8VA 2F1BA 3NUKA 1HKIA 1V0LA 4FF5A 3IJ7A 4AEFA 3PZTA 3ZR5A 4AIOA 3NCOA 3RM9A 3DC0A 2ZXAA 1CWYA 3WD4A 1QI5A 3BUPA 1TZ7A 3MSDA 1X6LA 5FCZA 4XUYA 1XSJA 4QP0A 2WMIB 4UQDA 3RJXA 1VAHA 1XD0A 2WZHA 4H41A 1B3WA 4PMOA 1I1XA 3N11A 5A1AA 5EMYA 3AS1A 3LMYA 2WM0A 2ZUNA 2WPGA 1WE5A 4HPHA 1JZ8A 1CXIA 4WSKA 1KWKA 4BZYA 3ARPA 2XM1A 4F66A 1LF1A 2YA2A 3MMDA 4MJ2A 4X0VA 3ZT5A 3F5JA 3GXIA 3A21A 3W0KA 3DX3A 1UWTA 1EO5A 2XN0A 3OGVA 3N15A 4V2XA 1CXFA 4UOQA 2PF0A 3WF4A 1KXVA 1E6NA 3GTNA 4U2ZA 1JI2A 3PZNA 3W26A 2EADA 2BVTA 2BY3A 1J18A 4IUGA 1CENA 5A3HA 5I3DA 5F7UA 1LWJA 3FXYA 3L2MA 1ITCA 3GXNA 3WMBA 1EXPA 2OYKA 1PIGA 1GJUA 2X0YA 4BQ4A 4ACZB 1DWJM 4PRWA 3WF0A 3T08A 4JFSA 5BYWA 2W91A 1HP5A 1NOFA 1KGWA 3VD3A 1B1YA 3W81A 1TE1A 3G6MA 3M7SA 1GHSA 3BVWA 2CYGA 4UQAA 2ZOXA 3WNNA 2WWDA 3VGDA 4L4OA 4MB4A 1BVZA 1JZ7A 3SCOA 3AHZA 3LXAA 4CCEA 4NSBA 4AW7A 3D5HA 3FAWA 1DP0A 2F61A 4KGLA 3WEOA 2XGIA 1KCLA 1EO7A 1FFRA 3CO4A 2DIJA 3WQ5A 3BGAA 1AQHA 3CHDA 4LX4A 3EBVA 1QNPA 3BH4A 1G1YA 2GJPA 5JBDA 3VIFA 3B9AA 2JIWA 4PMYA 5EB8A 2IUZA 2OW7A 3BMVA 3WNKA 1G0CA 4PTVA 4NXSA 2VNCA 3E1F1 3WDHA 2QF8A 2GK1B 3ZJ8A 2VCBA 2IXUA 2BFGA 1NARA 3NIYA 4DWSC 4DUXA 3KL5A 2GFTA 3WDJA 2XVPA 1KTBA 2D3NA 2Z1KA 1EOMA 1NM9A 4AD3A 2WBGA 3WEMA 3UR8A 5M5DA 1EHAA 4PMXA 4PMNA 1E73M 5E0CA 3VKKA 1WDQA 3A22A 3ZM8A 3BVVA 1GQKA 3ALGA 2IXVA 3SCNA 3VX1A 3OLDA 5CGMA 5I5RA 3ZOAA 1VIWA 2PWHA 1H11A 1TUXA 3VM5A 3ZT6A 4W88A 2W4XA 1HL9A 3D52A 1HJWA 1JGIA 4B9YA 1HKKA 1KWGA 4W8LA 1HNYA 2YBUA 2XJ7A 4IISA 1FHDA 1V0KA 2GSJA 3DHUA 1UOKA 2ZUWA 4UZUA 3TTOA 1Q4NX 1C90A 2BY1A 2G8ZA 5C71A 2WVVB 3IK2A 4P8XA 2ZUVA 1JFHA 1EHNA 3QOKA 4QLLA 4JKMA 3WH6A 5HOSA 4TOQA 3U5UA 1DWIM 2CBJA 5ABHA 2J7GA 5CQ1A 4CKQA 3VUPA 1G94A 1C7TA 2CKSA 1J01A 3N12A 1NOUA 2X8RA 2GUYA 5A2CA 1DWFM 3VMOA 3ZMRA 4XZBA 2FH6A 2YJQA 3VINA 3BLKA 4AMWA 2OYLA 3WEZA 3KL3A 1JFXA 4P7QA 4MDOA 3AS0A 1UASA 4NRSA 2Q8XA 4ZENA 3S6TA 2QPSA 4GI9A 3WY4A 1QNRA 4H04A 1MXDA 2WWCA 4AZ5A 1TQWA 4DWSB 3LRKA 3WL0A 1LWHA 1WZMA 3S5ZA 2JIEA 1LQ0A 3DX1A 4YPJA 3EDDA 1BAGA 4WKFA 4FNUA 1ISWA 8CGTA 2YDQA 3IJ8A 2VX4A 2XWEA 2WCGA 5BRQA 3GXPA 3TTYA 1GUVA 1VF8A 4D6GA 2XVLA 1HXKA 4UFJA 3LXBA 2ZICA 1B90A 3HG3A 1OIFA 3O6AA 3PZUA 4GZIA 5CSYA 5HPOA 3FHAA 1JDDA 3BAYA 2X05A 5ABFB 2XG9A 4U33A 1KFWA 4WKHA 2G4FA 3LRLA 4AD2A 2WMKA 2XN1A 1JZ6A 1UWIA 5AC5A 4AC1X 2CEQA 1BYCA 4GPNA 1JZ3A 4GZEA 4AZCB 2VR5A 3BAXA 2NT1A 1XV8A 2O9TA 1H1NA 3OGRA 1AVAA 2WNWA 3QGVA 1ECEA 5CPTA 2WHLA 3BSHA 2NSXA 3WUFA 1E6ZA 3AIQA 1CECA 4W84A 3VDAA 2E9LA 2ZXDA 2X2YA 4E8CA 1CLVA 4UQBA 1GOKA 1W9UA 3WF3A 2D24A 1E40A 3WD1A 1TFVA 1YHTA 2WXDM 5BRPA 2DEPA 3EMQA 3DDFA 1MQQA 3RM8A 4A3HA 4HTYA 3BMWA 3ECQA 4EANA 2J62A 5AC4A 4FK9A 2ZXQA 4HU0A 3ZT7A 2FHCA 3LPFA 1MQPA 4GXPA 5ABGA 1OD8A 2FE0A 1OT1A 2WLYA 1EIBA 3W27A 3PZOA 2WHKA 4FNTA 2OYMA 4HOWA 4F8XA 3W82A 3K8LA 1UYQA 3W38A 3N9KA 1TQSA 1QW9A 5CPSA 3SUSA 3OZOA 3VU2A 5HNNA 4AZHA 1H4PA 1KGXA 4WSJA 3SURA 1ZJBA 3EJTA 5A6MA 2QV4A 2F7PA 2EPKX 1MXGA 1V3KA 2F8QA 2UY4A 1W3HA 1H3GA 3MS8A 1WZAA 3EYPA 4MAVA 4CU7A 1XCXA 1SFSA 2F7RA 4CVWA 1QHZA 1V6YA 2XVNA 1GOIA 2GDUA 2J7EA 2FDMA 5E70A 1HT6A 1V6XA 3CUHA 3HU7A 3PZ9A 1KGUA 5GNXA 1H5VA 1KB3A 1QOXA 4CD5A 2X2HA 3RM4A 1H0IA 2G3NA 3RPMA 1E4IA 3BVXA 4MNJA 1JD7A 4GINA 1OD0A 4PSPA 1I75A 2WVUA 5AY7A 4ZE5A 2EEXA 4PMDA 3ZSSA 3PHAA 1K9EA 1HJXA 3BUQA 4AYGA 3EJSA 5D9NA 2QMJA 2PBGA 3MUIA 1GW1A 4BQ5A 3PTQA 2VQTA 1IT0A 3BCFA 4OBSA 1X6NA 3GZAA 5AYIA 4E8DA 2ZX8A 4Z2IA 3T0DA 2WANA 3H54A 4D6EA 4D6HA 2VVSA 2PB1A 1US3A 5D9PA 1WZKA 3CLWA 4PN2A 3SCUA 4URIA 2ZWYA 1V0MA 4LYQA 7CGTA 1CBGA 1CNVA 2D3LA 3OGSA 4P8VA 3T0BA 1WDRA 1BLIA 4HA1A 4CU6A 5A8QA 3GM8A 2CBVA 2EAEA 1E6QM 1EQCA 1XH0A 1PAMA 2J25A 1K6AA 4DUWA 1UR8A 1E6SM 2UY3A 3AROA 1EQPA 1QNSA 4HZ8A 3CUJA 4HOZA 1UD6A 1BPLB 5M17A 1BYAA 3LPPA 4TVDA 2EPMX 1PEZA 1VFUA 1TVPA 3WD3A 2WKLA 3DX2A 2E8YA 1E0WA 1PJ9A 4UQ9A 1BSIA 3WUBA 4JL2A 3N18A 4L4PA 1J11A 3WY1A 4W87A 2E9BA 3K1DA 3EDEA 2J7HA 1LL7A 4UQCA 4W7VA 2OWXA 3BLPX 5I24A 2ESCA 1XGZA 1F4HA 4ACYA 1V02E 5DEZA 2CPUA 1G01A 4N0RA 1UKPA 3QOMA 2VVNA 1ZJAA 4W7WA 4Z2LA 6A3HA 1W3JA 1LL4A 5EFFA 4UFHA 4XX6A 5HPCA 2PWDA 4PMUA 2ZUUA 4W86A 1TG7A 1GOWA 4MNMA 1LG2A 5IHSA 4CD6A 4OUEA 4W89A 1KXQA 4D72A 3AIEA 2V38A 5JBEA 1K9DA 1E6XM 4H8UA 2YLLA 3WDIA 1JIBA 3CMGA 1GONA 3EDJA 1GHRA 4B3KA 3L4XA 2Y4SA 1DHKA 3D50A 5E6ZA 1BQCA 2ZXBA 4JKLA 2A3HA 4MB3A 2F7QA 3CZGA 1V3JA 5JUVA 1UQYA 3DYMA 2D23A 1W2PA 1NWRA 2OSWA 1ZU8A 3ARWA 2WCSA 3AI0A 3WENA 2WZEA 7TAAA 3QHMA 5E0FA 5BXSA 3F5LA 2BNJA 1UQZA 1UR4A 1ISVA 4JAWA 4PTWA 3GNRA 5HBFA 3PZGA 1V3MA 3VOCA 4AZ7A 1ZBKA 2YL6A 3WFLA 2NT0A 4D6IA 4Z2JA 4JFUA 1UKOA 1JL8A 5CXPA 5FD0A 3L4VA 1R46A 4ZEPA 4U5KA 2W63A 1O7AA 1KTCA 3WFZA 4B16A 1XHGA 1UWQA 3AISA 1JDAA 1E72M 1QI4A 4GZJA 1NWUA 4GI6A 1RP9A 3CUIA 4PUEA 1XYFA 3WD2A 3A24A 1TR1A 4WIWA 7A3HA 1MQRA 3KWXA 3AHYA 4HOXA 1H0GA 1QBBA 5A8PA 3ZQ9A 4QAWA 1ZL1A 1ZBCA 3OB8A 2CCRA 1MW0A 1HWWA 1VB9A 2VZUA 1GPFA 5JBFA 3EJQA 3CZKA 3SUWA 4LYPA 3EDFA 2BVYA 1CPUA 3QHNA 1V3HA 2VMFA 1L0PA 4PSRA 3GH4A 2YFNA 4ZXLA 4QDMA 3SUTA 3L4UA 4M56A 3SIMA 1MW3A 1JAKA 4QCEA 4GO8A 4S3JA 4UFMA 2ZX5A 1FHLA 3WH9A 1MVYA 4B15A 1V03A 4YHEA 3VD4A 3CHCA 5I79A 5D9OA 3CBWA 3MKKA 5DF0A 5A6AA 2W61A 3AZSA 5ECUA 2CHNA 3THDA 4R5EA 4JFWA 4NXKA 1E5JA 5DT5A 4AEEA 4KRTA 1R33A 2WHJA 3AOFA 4OZOA 3AFBA 2CXGA 3UESA 1NQ6A 3EMCA 4AZIA 4M29A 2IGTA 5CLWA 4BCEA 3FAXA 1E70M 3CZNA 1C92A 1YQ2A 5A6SA 4UQEA 2V5DA 3SEPA 3G6LA 3PN8A 2V3FA 3S5YA 5E9AA 1JXKA 4EAMA 3WQ4A 3D4YA 2WMHA 1NWTA 2JF7A 1A3HA 3SUUA 1BYDA 4HPGA 1ISZA 1FH8A 2XPKA 3GH5A 1J12A 2J8FA 2EPNA 4LYRA 1T0OA 5CPQA 3MU7A 2WMIA 4AY1A 1HF6A 4DWSD 3MUZ1 5TD4A 1JZ5A 1HJQA 2X09A 3WF2A 2CBIA 1PS3A 2WMGA 5LA0A 2WVTA 1U2YA 3VILA 3CUGA 1WKYA 4AYSA 4TX8A 4TXEA 1JYXA 3OLEA 1F4AA 4U5IA 2UWFA 1C91A 4NF7A 5I2UA 3LRMA 5HXMA 3ARSA 4TX6A 4BS0A 3WUGA 1JF5A 3IANA 3VGFA 3PZVA 5M3WA 2WCAA 1UA3A 1D3CA 4QCFA 3CHEA 2X2JA 2J7BA 4TTGA 3A23A 4JHZA 2EPLX 1XD1A 1E4MM 4AMCA 3W24A 2DSZA 2WMJA 1UWRA 1EDGA 4FNQA 3POCA 4CN1A 1ZB5A 2VTFA 2J7CA 2PI6A 1VFFA 1DEDA 1R8LA 2A3AA 2OLHA 4WLCA 3VDBA 3OLGA 1HVQA 3QR3A 2ZUSA 4PUDA 5GQBA 3FN9A 2WLZA 5GNZA 4ACZA 4CGTA 4CCDA 4TVCA 2VZOA 3OG2A 3O2LA 1ITXA 4PMQA 3AS3A 2WMFA 1DTUA 3I3DA 4P7LA 3NSMA 3RIKA 1V02A 2UY5A 3BAIA 1OB0A 1CXLA 1JXJA 3PZIA 1R7AA 4MTVA 2FYVA 1NP2A 1SZNA 3SCRA 2VRQA 5A8MA 3BVUA 1E0VA 4BQ3A 1NWSA 3AZTA 1D7FA 3K46A 2WYSA 1TVNA 2AOSA 1V6VA 3J7HA 1IZJA 3ARXA 2EBNA 2EJ1A 1LG1A 3VD7A 2HISA 1LLOA 4M80A 2WZIA 2DSWA 4JCMA 3VIIA 3W25A 1B2YA 3AYSA 1U30A 4D6CA 4NX0A 1O7DC 5A6BA 2RGLA 1EOKA 4D6DA 2YL9A 1VENA 2VC9A 3U7BA 3VVGA 1OSEA 4C7DA 3AHXA 3I3EA 3W6LA 1J0YA 3H53A 1BF2A 4R27A 3IAQA 3SCVA 2ZX9A 1WDSA 3U7VA 1QX1A 3KZSA 4PMRA 3SUVA 1KR0A 4JZ5A 1E1EA 1W9DM 1UD8A 1VFOA 3BUDA 2XIIA 1V3IA 3ALFA 2WVSA 4W8BA 4LGXA 4M81A 4AZ6A 1C7SA 3ZJ7A 5CGTA 5D8ZA 1HX0A 1I1WA 3FNDA 2XVKA 1GCYA 3BUIA 4XV0A 3WQ6A 3AHTA 2XGBA 2D2OA 1CLXA 1R85A 2WC7A 3H55A 1BG4A 2FGZA 2D22A 3NDZA 4UFLA 3GXDA 5GNYA 3KE0A 2G3MA 1NP0A 5FOOA 3BUBA 6CGTA 3UG4A 3N04A 3OIHA 3BAKA 4RE4A 1FP8A 3AYRA 2E40A 1WPCA 2TAAA 3EDKA 2OWWA 3VIGA 3CV5A 1E71M 3L4ZA 3O9NA 3VGGA 5D9MA 3F4VA 4NZFA 3GXMA 8A3HA 2VUYA 1CTNA 3NSXA 1TA3A 2F18A 2ZUMA 3QHOA 1CGWA 2YOCA 4OBRA 1CXEA 1SMAA 3AMKA 2EO7A 5LA1A 4DO6A 2VI0A 2VRKA 5C70A 1SR0A 5BXTA 5CG0A 3VMNA 4TVUA 2XWDA 4BQ2A 3K4AA 3WMCA 1PPIA 1B3XA 4CD4A 1UD2A 4CVUA 2ZX6A 4AD5A 1PX4A 1W9VA 2XFRA 3EJRA 4QLKA 3WMSA 4CU8A 1QVBA 3KLLA 4HA3A 2DSUA 3VGEA 3TV8A 2F2HA 3LPOA 3TP4A 3WY3A 1PZ3A 4C7GA 4AIUA 2W67A 4MAZA 3WDRA 4RE3A 1VBRA 3T0AA 1JZ2A 3ARVA 1ZBWA 2BV9A 1OM0A 2VZVA 4S3KA 1BFNA 2BXZA 4NI3A 1B3ZA 1VEMA 2VL4A 5BROA 1C93A 2CKRA 4AZBA 4Z2GA 2JEPA 5A69A 1JF6A 4MDPA 5DFAA 1VFMA 2WC4A 3AXIA 4YN5A 1A47A 1J0IA 1J0KA 1J0ZA 1EA9C 4J3WA 1WP6A 3CH9A 4MJ4A 1M03A 3B8SA 1CZ1A 2RGMA 4J3XA 4DM1A 2DDXA 3VGBA 1UH4A 4MB5A 3BC9A 3VD5A 2FHBA 3A3HA 4P8WA 4OKDA 5FL0A 1XH2A 1PZ2A 4K68A 1OGGA 4WF7A 4HA4A 4AD0A 1GVIA 1KQYA 3DYOA 4IM4A 2PWEA 1XH1A 3CIVA 4M24A 3OBAA 4Q7NA 5JIWA 2C8NA 3AIVA 4EKJA 2YL8A 1EDQA 4AZCA 4D71A 2D1ZA 1Y7VA 4UFIA 3A4WA 4V28A 2PBOA
chains in the Genus database with same CATH superfamily
2CLPA 4QGCA 2A9AA 4FR6A 5GPRA 4GOSA 2GQ3A 1L0QA 3QGAC 3RWGB 4JJ5A 3DO3A 1Q0XL 4D0CB 2H0PA 3DHJA 2MPAH 2I26N 1QPXA 3IJEA 3PJSB 4NQ1A 3MBEB 1U3NA 3DUSA 7ENLA 4OLYL 1QLFB 2Y62A 4OLUH 3FYYA 3N2XA 2IAMC 1G5AA 5EOTB 2C0AA 3OHXB 3K3QA 4IS6A 1EVUA 3MRJB 1QFWL 1PO9A 3GMMA 1EJ6A 5CGYC 3K4DA 3LNFA 3IGFA 4EAYA 3NJXA 1JHTA 3VO0A 1A4AA 1F4XH 1C12A 1AQMA 3CPGA 1OIMA 5E6SB 1KRAC 5B38A 3KPPB 4QG8A 1XL4A 3UCQA 4IQEA 2X4QA 3UGUA 1NAMH 3RU6A 1OP3K 1DXIA 3TPKA 5CILL 5IXEA 3ZZQA 1TREA 4NLHA 3NQFA 3DFQA 4HC1L 4NZJA 3ALPA 3U83A 5A6BD 5CP3H 3LHPH 4NJ9L 3TYCA 1UURA 3V5FA 4DIAA 3D2UD 3W9DB 2CLRA 3F84A 4UMSA 2CGYA 3UTPE 4DP1X 4NM4L 3IUHA 5EU7E 3WTSA 2HT4C 4HYVA 4L9LC 4RDWA 4M7LL 4PRBA 1J8SA 4J1UB 3UGEA 3IGUA 3DECA 2JE8A 4A3QA 4QRBA 3NYZA 4ATDA 5LGXA 3TH3T 1EHLH 4JO3L 3ZO9A 4RDYA 1FLRL 4OIFA 3GSOB 1I8LC 1C1EH 4AVKA 3L5LA 4GAJH 1KFEA 3PPHA 2XWBA 4BDVA 3D9AL 4NQCA 3GC2A 3KPSE 4OFKA 4PB5A 3W2LA 3P2TA 2EDWA 4PB0H 3VDHA 4CILA 3AMLA 4U28A 3WK1A 3S83A 3QJZA 4QTGA 1TPDA 4GG6A 5AN7A 5D93C 3F4CA 1F2QA 5DMYA 4S10A 1RPKA 3II1A 4K1GA 4OGZA 4LLQA 4BA0A 4L2YA 3MSGA 3WY2A 3VGHA 3WN5C 1B57A 4AJVA 1E9IA 4F0KA 2M8XA 5KUKA 4Q4KA 2YX0A 3CVHA 3QQ3B 4J6IA 4JFFE 3FT4A 2ZF9A 4M1RA 1YXDA 2MUCA 5LXXA 1T7ZA 4LT7A 2C7FA 5HDRA 3WEXA 2X10A 1JPTH 4MUPA 3V0DA 4LCCB 4P5SA 3QA3A 1ZHBA 4JTIA 2D7OA 3ZO0A 3FB5B 2MSPA 4PGZA 3F7PC 3N5AA 1O9ZA 3HG5A 5K9KB 1HL2A 4CRPA 1SQMA 1YUKB 1DVQA 1KFKA 2KQMA 4AWEA 2AAMA 1RUMH 4L23A 2Q6WB 1F3XA 1H3WM 3QDMB 4U6YA 1CBVH 2ZWZA 4X7SL 4N24A 4LEOA 3QDGE 2QVIA 3REVA 2BRRH 1IQDB 5K9JH 3VSVA 1FHNA 4K38A 1XX9C 5F1KC 3RFAA 1IM9D 3NFSL 2H6OA 2DL2A 1EX5A 3NPZB 1JI1A 3ROLB 1R0MA 3FSWA 3IFNL 4JY6A 3MRIB 1Q2SA 3TA6A 4JY9A 5AYXA 1J1XL 4N2YA 3JUGA 3E0FA 3MV7A 2NNAA 1P84K 1ZNNA 4DXVA 4UIKH 4S3FA 5KSUB 1CE6B 2YXFA 3B43A 1S46A 3M07A 1GVEA 4P2YA 1PDKB 4UAOB 2QCDA 3MLVH 5DZPA 3LV3A 3RWIA 4LEFA 4DYJA 2RHEA 3BZ4A 4QIUA 1GHFL 3W1ZA 2VLJB 1UD4A 2Y24A 2KI6A 2O6EA 2CERA 5I9QB 3PP4H 2ESVA 1YYCA 5ABZA 1NGQL 4PJCF 2P80A 3QXBA 3LLDA 4BF7A 4LSDA 5FIEA 3UYPA 3BGMA 2IDCA 3UXIA 2V3EA 1IV8A 2BSTB 1DWAM 1PSKH 2OLAA 4NQDA 3B5GA 3AQDA 3M0MA 3CLEH 3HURA 1MNUH 3S4SA 1KM5A 3N3EA 4P5TB 3SY0B 1CGSH 3HKFA 1X4YA 1E8WA 1QSFE 3QI9B 4LLDA 4PGJA 1XGPB 3M6DA 5IP4A 2DLFL 2ZE0A 2JGYA 4WUKH 4BI6A 4PJ5D 4MNQE 4ES4A 4BQCA 3N2BA 1MCIA 2FWLB 2AJZA 4A6YB 3T8XA 2VLLA 4G82A 1MMFA 5TE6H 1OP3H 3UC0H 1W80A 1SYTA 3QYSA 3TBSB 1FL3A 4UWMA 1FIGH 4EO5A 2CJTA 4DWSA 1XIMA 3HE6B 2VERN 1PZSA 4IRZL 3P40A 1DN0A 5AG9A 3EBAA 2E5DA 3T6VA 5ECJE 1W1YA 4V1DE 5TE7H 2CALA 3M0IA 2APWA 1OGAB 3K0WA 1CICD 3V6FB 3IMSA 1UQSA 3UR7A 3W5NA 4NI8A 1H5BA 5EULV 2QKIA 3X11A 4NCDA 5C7XL 4FD0A 4Y5VC 3IFLH 4YHNB 1Y18B 3FGCB 1QPOA 3EHBC 3IMBA 4POZC 4JM4L 3TONA 4AT6B 3QJUB 3BXWA 3AMCA 4XT1C 5ID1B 3S1XA 5IW1B 1HWGB 4JZJA 4ODHL 4DKTA 4MJID 1A4KA 4DBDA 3D25A 3KCLA 3A4AA 3EOYG 3B05A 2VFHA 3ZPDA 3K30A 5A6KA 3VIJA 4N2MA 3SQLA 4LL1A 5KN5A 2F7OA 2AVGA 2GITA 2ZYSA 3KD4A 5ES4B 3A4DA 4W9HC 1S2EA 4HPXA 2IMMA 4QGYA 5JOFB 3UETA 2PYEB 5HYSA 1O5RA 4CQ8A 4H8WH 4F9PA 2WKJA 1W6LA 5H1WA 2QSCL 2BS9A 3MREA 2XN2A 1QFHA 3DTXA 4OU3A 5D1QC 3WIFB 2DAVA 3OJDB 1M4KA 4NN7B 4BSWB 1DVFC 4PJAB 1KN4L 1KV7A 4E2DA 3AXHA 4UYQA 2Q0ZX 4E5XA 4N0UB 2UWEF 1FP5A 2XVGA 4L48A 1RLDA 3MODL 4KHTL 1U8QA 3BN3B 1LZOA 3UMNA 4Q4RA 5T33L 4LU5L 5IVXB 1KM4A 2PXYD 1HL5A 3MV8D 4FF5A 1LDCA 1I1YA 1MFAH 4YE4L 5DUPH 1R9XA 4JAMA 2CR6A 5EMYA 4Y9AA 1HI6A 5LCVL 4E38A 1Z9SA 1G5GA 4AVHA 4F93B 5C0AD 4X0VA 2QSVA 3BG9A 3GIZH 4BF5A 1XBRA 2R1MA 3C08H 1UATA 4RMVA 4UT9L 1Z1WA 1Q6OA 4EI5D 3HCVA 1MCDA 1H6EA 4XGZB 3VWKC 2PF0A 3UZZA 2GCYB 2ZUQB 4WCYL 2VOMA 3N1QC 3SR7A 3UY8A 1TU2A 3MSRA 2XETA 4IU2B 5E2UH 2ZP8A 5E8OA 1BLNB 5L7XH 1IGIL 1VGKB 3MJWA 4R84A 3P0GB 4OVXA 1NQBA 3SIZA 3ZDYF 3G6MA 4BZ1H 2H2SC 4YE0A 4FF7A 3C6LA 4MB4A 3SCOA 3LMZA 2PURA 4NSBA 5DQPA 4AQ1A 4KGLA 4PJ8C 1OJXA 5IROC 3LN4A 4OQTH 4A6YH 2G96A 4GYJA 4E0RA 1LP9E 4YTUA 4PLJD 4XNQB 1XUUA 4IBZA 2OCCB 3B7SA 4RNIA 1X5KA 3B9AA 1A6ZB 2PN5A 1QSED 1RSFA 4HPYH 2ENYA 1G7HB 2SODB 4YSPA 3P73A 5LQBL 1VGEH 2XV2A 1EHKB 1EOMA 4JN1L 2JXMA 4KDTC 3FQRA 5FUCE 4OGYL 1E73M 1F76A 3NQCA 3I50L 3H3PH 1IWBA 1UJPA 3K5XA 1MI5A 5F1OB 2IXVA 1RLBA 4Z77A 1ULVA 4YVNA 2YPVH 5I8OH 3ZZLA 3V0AC 1XIHA 4W88A 3JZUA 3VTMA 1U83A 4HKXA 4MA1B 1R3LB 2A9ML 3RNKA 1R3JA 3NEHA 1DL7H 1KIUA 5HI5C 4PCPA 1FHDA 5LXEA 5FW7A 2HVOA 3BPOC 3S88H 3RL2A 4P8XA 3WSQL 4WI4A 3LKOA 4RK8A 1DWIM 1CI5A 5ABHA 2J7GA 4K94L 4KRMB 1E7UA 2OBGA 3K6DA 4M6ML 1YYLH 4RMSA 3ZMRA 3CWNA 2Q86A 1G7MB 2VL5B 4FNLL 3MLUH 1ZSDB 3WFEL 2HPIA 1MCKA 4ZD3H 4MDOA 4HK0A 4PRHD 2ZCHH 3WY4A 1T5KA 5B39B 2YGYA 4AZ5A 1BFOA 3SCMB 3TN0C 1U1HA 1AHWA 3AREC 1JF1B 3COTA 4M4PA 8CGTA 2WCGA 1YMHB 4M8VA 3B9KB 1KDJA 5LHDA 3BPNB 5ICYA 2OP4L 3B5HA 5JHLH 4ODUB 1UWIA 4GPNA 3IVTA 4HH9A 3FUNA 4LLYB 1A9EB 1QZ1A 3G6DL 1IXQA 1MCOL 3EO0B 3EKZA 1NC4B 2FSEB 3QRBA 1TE6A 4UQBA 3WF3A 2XKUA 5F6IB 3W1AA 2GK0B 2XIDA 1BQ5A 4P4KA 4G5AA 3PGCB 5KVGE 2KC0A 1TZGL 4ZO8A 4LRSA 2BJMH 4NQVB 3U9PH 1IFGA 1AL8A 3FB6B 3PZOA 3FO9B 4FNTA 1QW9A 5FOJA 3ID7A 5T5NG 2QPXA 1YEFL 5FHAH 3L1OL 3PFRA 2R56H 4UU9B 2Q09A 5C09A 1W3HA 5BS0A 4IMAA 1D7DA 4GAYB 1F6PA 1FY6A 2E67A 3W1NA 1HOCB 4N6RA 2Y07L 3AUWB 3CUHA 4EEEA 2QCGA 4FQIL 3IFPA 3R2GA 2O4EA 3PNZA 3TSBA 4LAKA 4L5ZA 4H3DA 3RIAK 3L5XH 2O5YL 2VFEA 2GQ8A 1UJTA 2WNQA 1YUHB 3V0UA 1FYTA 5K9QI 2ODIA 3KXFE 3C0SA 5KS9A 4FDWA 2F54B 5I1CL 4PRTA 3MFGB 4F7EB 3GUTA 2A9BA 1E51A 1PIIA 3VTTA 2GWNA 4OZ4B 4BYHA 5L2JA 3O6FD 7CGTA 1H7XA 5HHNA 3VQ1C 4XUGA 4ML9A 4Y2NA 2OMVA 3F5WB 1JWUA 3TT1H 4JOMA 4DK5A 5ITBL 3EWDA 3SGDI 3WHXB 4YHML 4U4MA 1OFRA 2ZOOA 2KZHA 2C1PA 1E6SM 2OK0H 4G1NA 1R4XA 1AKJB 3CUJA 5IMOA 5CAYB 1FV1B 4WEBL 5M17A 4TTDC 2EPMX 2X42A 5D7IA 1SZGA 4GXUM 5CJMA 2E74C 1E5AA 1K5NB 2XWTA 1G6RL 3RU8X 5I24A 1QP1A 3GVRA 2W94A 4PJHF 3C2OA 3GRWA 2IQAA 2FSDA 5CAHA 2XYBA 4B5TA 3ZVIA 3KOZA 2EDTA 5CBAA 2OPCA 4XAWH 1FAKT 5FYKL 4WJ5B 4XD4A 2PTZA 4D72A 3MKCA 4RISH 3UCCA 4FIQA 5E6ZA 4CQBA 2XG5A 3CHVA 5L4IA 4LH8A 4X0KB 3QIWA 1GJIA 3MRRB 5H35A 2OSWA 2YJLA 5FACA 7TAAA 3QXAB 4PJCE 3AQYA 3NM1A 1UQZA 4HUXB 1UR4A 2NUXA 1U8MB 4R7VA 4HWBL 2CD0A 1PCSA 4PTTA 1ZAIA 4Z8FH 3CPLA 3PUGA 3FJ6A 4UB0L 1TMLA 1RIUH 2Z1BA 1POJA 1EJSC 3TBWA 3KWXA 3AHYA 2CRMA 4OU1A 4FXKA 1H61A 1ZL1A 5E94A 4Z7QB 2BOCA 2XN9A 1N70A 3GPSA 4RGNC 4XSLA 4XTDA 1DL3A 3QCUH 2QJDA 3DO7B 1XICA 3FYOA 3CSYA 1PS9A 3SIMA 1OB1B 1EBAA 3CAFA 2YK1H 3I9GL 3VCLB 2XGZA 1IAKA 4IMKC 1FHLA 4IDJL 1CK0L 1GC1L 1EYWA 4HKBB 3UYOD 1EJVC 2DZPA 4LHUG 1YBQB 3P4MA 1YEHL 5F7YC 1NEYA 1UACH 4AZIA 1H9VA 2DTMH 3MJ9L 4I85A 2EVJA 4R5XA 1C5DA 2WN2A 2A85A 3CH1A 2EKSB 3PGDB 4M7JL 4IGBA 2JF7A 1CFTA 2J13A 1O95A 2WGXA 4E36A 1XCTA 3L9RA 2WYTA 3MBFA 2F58L 1PYWA 2EPNA 4AC7C 2Z35A 1WQVT 3HZYB 1UIPA 3ZWSA 1BYOA 4K3HA 4AYSA 2EZ0C 5MERB 4U5IA 5JDJA 1NIBA 1SHMA 3D3VB 4MNHB 2KPWA 3ARSA 3FVDA 5M3WA 2WZAA 1SXZA 4QCFA 2PD9A 4G8EB 5DY3A 3FO0L 1N9PA 4NO0A 3NJVA 1F42A 3W24A 4L5FE 2AERT 2NY3B 3NT0A 4AVFA 1I60A 1KIPA 3UAJA 2VLKA 2IBZX 3AXKA 2DMCA 3MRPA 2XZ7A 1FC1A 4HNTA 4QXTB 3N73A 4HK3N 2JKAA 3CQHA 3BQ6A 1JXJA 4PVBA 3PL6D 2WWKT 4BQ3A 4W6YB 3KPNB 1A7RH 3DFPA 5I5JA 1GYMA 2UWEE 1XINA 2EBNA 2M2DA 3HPZA 3PNWA 2HISA 1RSYA 3N0AA 1O7DC 2E6JA 2E28A 2OKMA 3FO1B 1G6VK 1ZTXH 2XY1A 3P30L 2EKJA 2QADB 2ZX9A 3QEGH 3QR1A 2XICA 3VW3H 4PYHA 3G2GA 1YO4A 2R59A 3W2JA 4PS8A 2CUMA 4AZ6A 5TDOB 3FTWA 3F83A 4WJG3 2JGQA 1CLXA 4N2KA 1NL0H 1CDYA 4IFOA 4M4RA 4R7OA 4GQBA 5FOOA 6CGTA 2UBPC 4LFHD 1YNQA 4RE4A 2YSSB 1RZGB 1T80A 3PG2A 3UAEA 2OWWA 43CAB 3VIGA 1YNKH 5BVPH 4OQ1A 5DDHB 3KHDA 1M1XA 2AJVL 1XWVA 5DRXA 5D9MA 1THCA 1F3JA 5J11C 3QTPA 2ONEA 3VI2A 5I19L 3AMKA 4GG8A 2UV3A 1SUHA 4M6QA 3UZQB 3MCKB 2IWFA 1WCQA 2V2XA 3KWSA 4WK4B 1KFCA 1H50A 4IT1A 4YXHH 4P2RB 2IMRA 4PJIE 4HXBL 3TV8A 2PUZA 4GUQA 5ITFA 2YD2A 3QN3A 5KYXB 4NUQA 5F2MA 5C8JB 1WIUA 4B3VA 1IC4H 5KSBB 4Y19E 2KUTA 4NRXB 1GPWA 1VEMA 4Z2GA 2BVPA 1UR3M 2OJEA 5DVOA 2VDPB 3IMRA 1J0IA 2BDQA 3CH9A 4O16A 4PJEA 3UJTL 2RGMA 4MCZB 1EF3A 4WO4D 4O14A 4MB5A 2YWZA 1F90H 5D7JA 5E99L 5KW9H 3AG3B 5H8UA 1MRQA 2AK4B 4A29A 2Y7QA 4GBDA 4RGOH 2WW8A 4M1GH 2PDQA 3A4WA 1LYXA 4FQLH 5EG6C 5E6IC 4JM2A 2D0HA 5E51A 4XPHL 2K3HA 4G6ML 2V33A 4K7VA 2XQYA 2INZA 4POUB 4G8IB 2GSHA 1G7LB 4DGIL 3TNNB 4HH8A 3KBSA 4GXWA 4UOW0 1AR1C 1PG7X 2V3GA 4QOKE 1P6FA 2G3JA 5KEZA 3ASOB 1DBBL 2JJWA 4Z7NE 6PCYA 2BVEA 2YMXL 4AYID 1UUMA 3K4ZA 2XIQA 2GJ6E 4QRRB 1P0KA 2J8TA 3GSRB 2PYFA 2X6UA 4DBSA 2AKRA 3K2IA 3S35X 2ATMA 4PG2C 4ADTA 3FQUA 5F9OL 1IKNC 3IPEA 3VOHA 2W0PA 5AAPA 3MO4A 4WO0A 1NMAH 1YDPA 2QVTA 1F3WA 4NVTA 1U93A 1HWHB 3D3AA 5IW6B 3QFJE 2XPGB 1P5UA 3A4EA 3PTDA 1MF2L 2CGRL 3DOHA 1A7NL 2OKTA 4X22A 5J3HC 2BVDA 5KBKA 2NZ9D 2CO7A 4KPHH 4MD0A 2J4GA 2BNUA 1Q6LA 5ECVA 2HJLA 3QY6A 3NG3A 1TPEA 2P42B 1QT1A 4XPTH 2D73A 3BARA 2ATPB 1WBHA 4KK9C 3FKRA 2BG5A 3W7PA 1J5IA 5B4MC 4R4BA 1OTSC 1MFVA 4MY8A 5FXCH 4JVWA 3K2UL 5JHDE 3SBRA 3LEPA 5C0JB 1WBJA 4DJEA 1ZCOA 3GUWA 1UWUA 3CN0A 1TG8A 4C56E 2WSKA 1IEIA 4LOCA 4MMXB 4ABVA 2PCPA 2P5ED 1I7UA 2QT6A 4U49A 1PD0A 3P0VL 5I74B 4JPVH 2XYLA 1TJGL 3GFZA 4J3ZA 3IKCA 1DYZA 2XTJE 4OUOA 3DNKA 3S37L 2COQA 4IIQB 5E09A 4B92A 3QZBA 5HYQB 3D2UB 4UCFA 2VDPH 1GQNA 5I77A 3FT0A 2EH7H 2LTQC 4HB7A 5ABTA 2Z2UA 4OJFL 1YC7A 2KZKA 1U5HA 3CDYA 3NQAA 2PLKA 4Z7OF 4AZ8A 1JV5A 4DRSA 2AEQH 3V10A 4KUZH 1XG4A 2NUPA 1ZPTA 4HGKC 4LC6A 5F9JA 2HZHA 3HZVB 2Y61A 4GYBA 3P3UA 1T22B 4GQRA 2B7NA 4CCCA 4PYSA 3JS3A 2FHFA 3RP1A 3D08A 1G7VA 1WS8A 2O92A 1MEIA 4OLZL 4FA6A 1JGDA 4I7WA 1BD2D 1LK3H 4WQ6A 4ODVL 2AV1A 5C07D 1GIGH 4EIGB 5FB8A 2X2IA 3HHSA 4Q9CA 3ZE2F 3DX7B 1WDWA 3KVJA 5DZJA 2BNQB 3I02A 4Q8MA 4N4QA 2VUKA 5EEUA 3ZUNC 3MI6A 3O8AA 4MXQC 4YR6B 2WZMA 2EVGA 2RGSA 3TO2A 4R4FL 3QUKB 5AW7B 5BQ7B 4RMWA 2NZLA 1A3RH 4IPNB 1IBHA 5JOPD 1S7TB 2VDHA 5IB4B 1YPZE 5BO1H 3E2SA 2O9OA 3QZ6A 5E8NA 1C3FA 2Y6ZA 3NQ8A 3MGTA 4YSDA 1ML1A 3V5DB 2GI7A 5IESH 3CYVA 1N26A 5GISH 4PBVC 3V0GA 3B6SA 5M03A 4HKJB 4IICA 4PJXE 4F3FA 3C5ZD 4Q6KA 4GY1A 4X4ZA 3W28A 5D2VA 2XRAH 5FYJD 1UZGA 1LBMA 1W32A 5BU9A 2IKGA 4XN9A 1W1ZA 1P1XA 3GXUB 2PDKA 4YQXH 5BW7C 1IM9B 5E08H 5EUOB 3VXME 1G1KA 2NXYD 1I8JA 2VCCA 5D2TA 3NJMA 3JWNH 2BS8A 3WXWL 2Q7YA 5E00B 2MCAA 2CLKA 3WNPA 1KFJA 4Z7UB 4HMEA 4IIDA 2H2PD 2A3TA 3U1SH 3MV9B 4MA3B 1EBGA 4AEOA 3U4FA 5GRZA 2NW0A 3DCPA 1BQKA 2ZRXA 4LOUD 4RFNB 1OCJA 3MLSH 1X9QA 3LX9A 2E3ZA 1V6UA 3VRJB 4ZMAT 4Z3HA 2QMKA 3LN5B 3VFLA 1XYAA 2VFDA 5D72L 5I66B 5DXYA 3NJFA 3GR8A 2DGAA 2Z00A 4OLWH 4JDYA 1TJMA 4Q9RH 3ARRA 2WZPA 4LVNC 3NA9H 2GJZB 1QNZH 2GOUA 2DF3A 4GUHA 1KY6A 4HMNA 2Q3ZA 3NSJA 2W3ZA 3H9SB 3WFCH 4AGOA 3DG7A 3I4EA 4RAHA 5LAXA 2D7MA 4QHUB 3LA4A 4S1QL 3GNMH 4IW4C 4F5CE 1T1YA 4EDXB 1MLBA 2G41A 2BSSA 3W1QA 4Y16D 4HNUA 5EDXA 4L3EE 4KRNA 3LIUA 1D9KC 3LCGA 1MN4A 5IJKA 4M3KB 4JO4H 4PJ5B 5LNDA 4E4PA 5FO8B 1RZIB 3I65A 4YTTA 5CZXC 3SQRA 4LLMA 3GSWA 2XFXB 4LXFA 4QWWC 2BM3A 3HPAA 1VFLA 3IJ6A 3MJ7B 4X5RA 2P3YA 4LVAA 1UFUA 4ZFZA 2UXGA 1BTCA 3O11B 2OMWB 2AJUH 1XB3A 1TO5A 3LH2H 4WHTA 2X53A 4GO9A 4IRZA 3F3HA 2FVKA 3KJ4B 2QHRL 3IDGB 4C60A 3KW7A 2R27A 5BUAA 4XMUA 1E1CA 1JYWA 2AJXL 1UR2A 4HSAC 2I57A 5D7KD 4JUSA 1XLKA 1MJ8L 1CZ8H 5CPMA 1PZ0A 3MJGX 3ZR5A 1JPMA 3RM9A 5DJZB 1G0XA 1ZANH 4AIBA 3SE4C 1QATA 4GX8A 3SOTA 1XSJA 1QLRA 2FZ3B 4UQDA 4PWEA 3N11A 5A1AA 4YFLI 1MVFA 4FKHA 1TTQA 4KK5D 1K2DB 3VRIA 4JQVA 3D8MA 1AQ8A 4WSKA 1JRHI 1OW0A 3ZT5A 4RR4A 4B9FA 1XLGA 3DUGA 3O3AB 2HXTA 2W9EL 3O2DL 1DYSA 2BY3A 2V5YA 5EY5A 5I73C 1GMEA 3TYEA 3RPKA 3QQWA 1M2OA 4NKOA 3FB7B 2HN7B 4PRID 1KJ2L 5HHVH 1NDMB 5SWZA 2ZD0A 3IVSA 4IJRA 4I3RH 1KT2B 3R8QA 3JVGA 4ZS7H 4L4OA 3TK7A 5CJ8A 2H8PA 2PXYB 3MV8B 4M6PA 2A6JB 2DLEA 2X9YA 4GG6F 1YLBB 3FT2B 3WEOA 4GRWF 5IVZB 1KCLA 1ZS8A 2Y7DA 1AQHA 1EB3A 1DKWA 2GJPA 2N0MA 1PZAA 2H9AB 1GGTA 2VQ4A 5C0AB 1AYOA 5LCVA 2P24B 3MYJB 3E1F1 4GUFA 3FL7A 2GK1B 4EI5B 2IXUA 3TL5A 4WY7L 2L7JA 4UT9A 2ZYFA 4NNPH 2FDSA 2MH4A 4BFBD 4LJ3A 4H1LA 4WFEE 1HU8A 4PBWD 3WLNA 3A6CH 1KYOK 3QYNA 5D70H 2QULA 4HLZH 1C5BL 4YPGB 2GL5A 1HKKA 1P43A 1W31A 1O6SA 1SZEA 1Z9OA 1XQLA 2P9RA 4LPYA 3BIAX 4U6VL 4J3OF 1GKOA 2GYIA 1CDJA 1A5SA 2P1YA 2C7UA 4LRIC 3GNDA 5JW4R 4CLMA 4JPKL 3ISYA 1ORQB 3BTNA 1DE6A 2JKNA 2XINA 3LOTA 1TF4A 1QSEB 1ES0B 3E12A 1MXDA 2G9KA 4B7IA 1DUYB 2YUWA 4NN6B 1TQWA 4PGEA 4PB3A 3TQPA 1YEYA 4U3HA 2QGDA 3ATBA 1ZT1B 4M48H 3OJVC 3UPWA 2YDQA 1ERNA 1NBYA 3Q7JA 3BP4B 1GUVA 3WNIA 3ARDB 4GRLB 4QRAA 5I1LB 5F7DB 3GJFA 3O6AA 4JDZA 3OKEB 3V6ZB 5D2LA 3ARFA 3W2DH 4IYKA 3CNYA 3QYMA 2HE8A 2AEIT 1NAKH 1WBYB 2RBLA 4NT6A 4GZEA 5LHFA 3HS8A 4L4MA 4MKNA 3FT3B 5ICUA 4Y9BA 3HMJG 1XL9A 3UPCA 1DJNA 2HK1A 3FQXA 3MLXH 2DLTA 1U91B 3ZGIA 3WJSA 3DSNB 3H9HA 2NY5H 3CVDA 3A67L 2AL2B 1TFVA 1X8FA 1DANU 5B7ZA 1KUMA 5DC4B 4QHPA 4K1WA 3OR6B 2ZXQA 3WUWG 5H94A 2VXTH 3GQYA 1MHPH 2NYYD 1TEYA 4JMNA 4L1SA 4MHHG 2WWKO 2OTDA 2RCSL 5FKAB 2FJFB 5AL8A 4B95C 1CN4A 2PTUA 4PRHB 2H41A 3UJIH 1A02N 2FLIA 1UC6A 3EJTA 2VITA 2Q02A 4K7PH 1H3GA 3ABGA 4MAVA 2ED9A 3QUYA 5JNYA 4GCXA 4W9JC 3PDGA 2MCG1 3FYPA 4O2FB 2K3TA 1KGUA 1H5VA 1KB3A 2G5RA 1KN2H 4CNOA 3STZB 4WNQA 4MNJA 4J2XA 1I75A 3SM0A 2APBA 3FF8A 1OTUC 3HZKA 3PHAA 1K9EA 5L9DH 4AU0A 1GYVA 2H3XC 1Q9WB 1AJZA 3IPWA 2QMJA 4BQ5A 4J8RA 3BCFA 4JFDE 3GZAA 1W5QA 5EEVA 4Z2IA 3B3BA 4LOFA 4Z7OE 4PWIA 4LASL 3ETBJ 2WZTA 3WQGA 1F4WL 4BFGA 2JFCA 2XPZA 1V0MA 4QXGH 4Q4PA 5C0GA 1J5OH 2X7LB 1LEIA 4MFHA 4GKNA 4OI8A 1F13A 2VJ0A 3QO1A 4LPXA 1OQFA 1XXXA 5L6UA 3HS0C 1FORH 4OD1H 1KC7A 2JKJA 4PV9A 3O0RL 5JLZA 3WD3A 4XIMA 1FH5H 2J9XA 1AQDB 2AGJL 1QRNE 2PTVA 1PLCA 1VA9A 3ARGD 1XGZA 5DVPA 4O1BA 4M7KL 3AO0A 4LKCA 4N0RA 1NPJA 3FCTA 2XDFA 4RRPG 4X9FA 3WCYA 2Y7SA 4UFHA 2PNDA 1OX6A 1MFDL 3V0VA 3GIPA 5GJSL 4QTHB 1U95A 5EO1A 1DQXA 2V38A 1AGDA 3GB7B 3WQEA 1E6XM 4YSUA 2I56A 3MSPA 3M47A 4P49A 5I2IA 3LKNB 4QRSB 3G9AB 1L6WA 3C4UA 1FL6A 4X5XB 1U8KA 1U1JA 2RJGA 4KVCL 4JQ4A 5C0BE 3TX4A 3UTQB 3O6FB 4FP1A 5IQ9A 1OAXL 2ZCKH 5EN3A 3F5LA 3IJSA 1ISVA 5E7FA 1ORSB 2BASA 5CWSA 4S3EA 3MUCA 5EF2A 1CTMA 3GMPB 3WKNA 3KCPA 4Y2DD 4LDCA 3BLIA 4WGHA 1JK8B 4LVGA 3UXKA 1XYFA 3TZVD 3U0HA 3OKLA 3H21A 3CU1A 4MJ5B 4BFFA 2YKLH 1KG0B 3SQOL 2BX5A 4UM8A 3S3JA 2P7TB 1G6RA 3MHGA 3U0TB 1FNSL 2F15A 4S1DC 3NSYA 4AQLA 1KYOJ 2OMYA 5IF0A 1ONQA 2J44A 1OADA 3SUTA 4JTGA 1LO2H 4BQ6A 2B4GA 3ES6A 2P8BA 4LNVA 1AOZA 1KKRA 2PWVA 4RZ5A 3NFUA 4MSWA 4RFEA 3WLWD 1S2CA 4OZGE 3MRLA 4PRPD 1E5JA 3L45A 3H12A 4RNHA 3AOFA 1HK6A 4ZAKD 3FAXA 5JTWA 3CUPB 3C60D 3CZNA 5K59E 1CFQB 1BOGA 4GKZA 2EXWD 4K9EC 3O8XC 1SJBA 3GU1A 2BWQA 1B0RB 5EOCL 2VAJA 1QKZH 1T7VA 1GVFA 4KO6A 4HWBA 4P5MA 4FFZH 4MQSB 1M3JA 1DE5A 3SZ6A 4OCXL 2WMGA 4MAUH 4NI6A 1R2RA 3Q5TA 4DESA 1IVLA 1FGVH 5A6IA 1BZQK 1YADA 5FGBA 1O66A 3A0OA 2KH2B 3IANA 5JORB 4FTDA 3T0EB 1CD9B 2Z29A 3DROA 4J35A 1XD1A 3OHMB 2Z4GA 2DSZA 4KWOA 1Q1JH 4TSCH 2NQ3A 4BK5C 1ZB5A 3OBEA 1JVNA 1YMMD 4MSSA 3ZLGA 2ADIA 3T65B 4H20L 3ILPB 4JE0A 2P4AB 2NDFA 2X1OA 3HNVL 4CL7A 2Q2EB 4TVCA 4S38A 5DD3L 2FPVA 1DTUA 3HZMB 1ACYL 2UY5A 5D03A 3BZ5A 3KVLA 5I1EL 4WSGA 3ZKXB 5FPIA 2COVD 3W39A 4N3TA 3CIWA 5T3ZE 3PPCA 1BTMA 1RUPL 2VELA 1I2QA 3MJ9A 2IH3B 2GSGA 5A16A 3OC8A 4QY8A 4X99B 5JPNC 3E49A 1OSEA 4PFEA 3S5LB 2X4TA 1KTDA 7PAZA 3ERXA 1S9XA 3T07A 5HYJA 3QJXA 1VFOA 1DVJA 3BUDA 3MYZA 4KFOA 1HH6B 3QUXA 1G87A 2AXGB 3QJAA 1WDAA 3QUZA 2D22A 3GXDA 3SDCB 3T3PB 2OZ8A 4HNNA 1YNTB 4XMPH 3WL9A 4M93B 2WB7A 5ABAA 2A1WL 3RWCA 3M16A 4DHLA 1EC7A 2P44B 5CN2A 4E6MA 4K71B 1XPGA 1PZDA 4WW2B 1R3IL 5D05A 3VVVA 1AD9A 4JQXC 4XP1L 2EO1A 1UCTA 3IIPA 3PF2A 5EEXA 5CPLA 4X9IA 2Z31C 4WJ8A 3PL6B 3F62A 5K1JA 4UV7H 3WMCA 1VFSA 4Q8QA 3UFIA 2ZPKL 3GI9L 3OF6D 3EJRA 4K7FB 5J89A 4UCGA 3UTTB 1KACB 4CA4A 4DJFD 1I3VA 5KVEH 4NUJA 1FBIL 3LPOA 1KJVA 2W67A 4MAZA 3IXAB 3GO2A 4F1ZA 1OM0A 5LAPA 3SAZA 4NI3A 2K6WA 1B3ZA 1EZLA 2Z1XA 5ADOL 4FQPA 1SJHB 4Q74A 1PWLA 1OM3L 1RPQA 32C2A 1EA9C 3ESUF 4XP5L 3P02A 2FTAA 2ZAHA 3B8SA 1CZ1A 4ECLA 3SDXA 4FAAB 1V7AA 1X6UA 1IILE 3RWFB 2HTKD 3BVNB 1DQWA 1Q85A 2X16A 5L88H 3O07A 1PNCA 4IM4A 3QEHA 1XH1A 1X7QB 3WS3B 2GUOB 3TYGL 4C1NB 5KS9F 1DBML 1T2QH 3OZYA 1R3RA 1QFEA 5AD0B 3GEFA 1SZRA 2O5XL 4W93A 2WB5A 2NXZD 4EUPA 4MMZB 3QZOA 4P3DA 1QI2A 3O6MH 2CITA 4E9SA 2DT3A 3H4XA 2WXRA 1OIOA 4REQA 3QEQA 3P82A 2XWXA 2MJWA 4H8VA 5E5MA 1XR8B 1DBJL 2I9LB 3BZJA 4NC2B 1NLBL 2EC9T 2FJHB 1ZTVA 3RZCB 3K71B 4GMSL 3HC3H 5ENLA 5EB9A 5ADPL 5L4MA 5CMAB 3S4TA 1HKMA 3LH9A 3I6RA 3RHWF 1TWZA 5D7IF 3PWPA 3CGTA 3JV0A 4V2CB 4UTFA 4Q9QH 3CH0A 2A5HA 4UTBL 1OAYH 1TQUA 1E4KA 4R9HA 4S39A 5MENB 2WNXA 4DY1A 5G55A 2YYTA 4WO4B 3W37A 3MV7E 5MEOB 3YPIA 4ZMLA 7PCYA 1P0NA 1N2VA 1PY4A 1O60A 4ODXB 1B0GB 2Y25A 3O0LA 1V8HA 3ULUE 1RJZA 1YEGH 1KGCE 1JPST 4H6QA 4YVVA 4NKQB 1E6PA 2F08A 5FCUH 4KRZA 1AYRA 1SMDA 4XVTH 5IOPA 4FXGA 1RJYB 4FXRA 2ESVE 3Q3GB 2A3EA 4M7SA 3INUH 3MW7A 4LC8A 4BIKA 2Y6SD 2W79A 3TN6A 1L8NA 2OSXA 2PA6A 1W3KA 2DT1A 4I8DA 4Z7IA 1LQAA 1JSYA 3OAUH 4A3YA 4ONFH 2C16A 1DQTA 1OINA 2PU1A 3DSFH 1JZ4A 3PQYD 3EYOB 5CJ5A 3APTA 4BFKA 3G8RA 2VR6A 5IHZB 3P67A 4EXAA 2EAWA 1S3KH 3UGXA 4UTMA 4Y4KD 2DQWA 2XZAH 5DMMA 3EH3B 1CLOH 2A3CA 4KJYA 1XBXA 4AVJA 5IB3A 4MKTA 3EA3A 1II4E 1NKOA 5KJRH 1CYXA 2B3RA 3NIDF 3T44A 2R4SH 1P84J 3KDMA 4A2DA 4RAUA 2BZDA 2Y2YA 1A9VA 2H45A 1FH7A 2G37A 1BZ7A 3VYLA 4G7EA 4Y9EA 2HKAA 3L3HA 3WLBA 1AO7D 4X4XB 2PDCA 3MO1A 3KPMB 3QPQD 3SBQA 1GPOH 1EGJH 5HY9A 1CG9B 4KZ0A 4C58B 4MNLA 5CBBA 2P8MA 4U10A 3AY4C 6XIMA 4ZOCA 1MCHA 3UTSA 3L3DB 3X1BA 4MWAD 4KFNA 4HIQA 1RV8A 3SCPA 5HQMA 1MCBA 3Q2VA 4PCSA 1WWBX 3T0CA 4A35A 3PBVA 2NLJA 2D03H 4FYTA 2P5EB 4OV5A 3LKPB 4P2OC 2VDQL 4L56A 3DOSA 4PD4K 3PIQA 1GK8A 1N4XL 3MY9A 1IGTA 1N2RA 3GTVA 5CP7B 2QDHA 1QWNA 2NYZA 3AT0A 2IPKA 1R5YA 1W0MA 1LILA 4HXAH 1Q6EA 4IQHA 3PHOA 4GKTA 4TVPL 3GI8L 35C8L 3TTEA 3RNQB 3RGVA 2YKKA 2M83A 3MV01 1D5BB 2R0WH 1PX8A 1I6NA 5HQEA 2FH8A 3RO8A 3CC1A 3U8GA 4Y1AE 4O2EB 3KBHE 3CTTA 1DBKL 2J1WA 3V18A 5HDBB 3V6OA 4ZFOB 2DQXA 4ELKA 2VX6A 3L9EA 3ABLB 4FMKA 2BSED 3VFOA 4LEEA 4HN4A 4WI8A 4OF8A 2HTLC 3UJJL 4F9DA 1O1HA 3G22A 5AYBA 3CSGA 1MJJA 4A63A 3MTRA 4WENB 4Z5RA 3C5JA 1BD2B 2C5DC 3MFFA 1V7ML 4ZXBB 4WI5A 3SCWA 4N1EA 1XIWC 4Z0BL 3PTKA 4IUOA 4R7NA 4B9GA 1NSJA 3EYQD 1US0A 5D8WA 1BDYA 1JCNA 1B3VA 4I18A 4OZHB 3RX4A 1T66C 4BKLA 1ZHLB 4Y9PA 1VEPA 3EOAB 5EC1A 3I9AA 4XD3A 4HGWA 2VLRA 5C0EB 3NRFA 3FUDA 3CPUA 3N13A 5L6YL 1JUKA 1NANI 4QQ3A 4EVZA 3PHQB 4QEHA 3KPOA 2HT3D 4UNTA 1R5VB 4PHZA 3BESR 4FP8L 4KVPA 2Q2LA 3L68A 5C6TH 1OAUH 2ZAIA 2H4EA 3LCHA 4PJEF 1M7DB 4DPPA 2C91A 2PFHA 4Y4FA 4AM0Q 1OC7A 1S78D 1OF2A 4XP9H 5DUBB 1OARH 4C6CA 4S2SB 3GW0A 1TCRB 2WBJB 2V7HB 4AE0A 4F9LA 5DVNA 1VACA 2QCCA 4G9FA 3TQKA 1TV2A 3PREA 3QORC 1YN6A 4M6UA 3FU8A 1HHKB 1UOLA 1NIDA 4WEMB 3T09A 2BSRB 1YX1A 4JM2F 1W5NA 4GQ9H 1R3QA 3O1NA 1ZK9A 4IP4A 1CCZA 3M46A 3QRGH 1GG0A 3GKWL 2CLZA 1L6XA 3E6FA 5CF3A 4FNSA 4M5YH 4PUNA 3AJXA 1L6GA 2CCVA 2AQOA 1RY7B 4XWOD 3L4WA 5KOVC 4XQ6A 4H9YA 4X60A 4H7CA 2DLHA 2V30A 5AECA 3QHTC 4HZ7A 2DQTL 2NWSA 2E9MA 1YW1A 2Q7AA 5IQNA 5L8KB 2ZZ2A 2W07B 2ZRUA 3UJEA 4C4UA 4R3SB 4WTZG 4KKXA 3W2UA 5I6OA 1P6BA 4TNVF 3M8OL 1FCVA 4ECNA 3B7RL 1A5OC 1F11B 4G80B 2P5WD 5GGUB 3UDWA 1QLEL 3U4BH 1HKIA 4AIOA 3WLKX 5F7EH 3EX6A 4HVXA 4YAQB 1XGEA 1ETJA 2G4EA 1VFBA 4BJLA 4OLEA 3AS1A 3HA1A 4L80A 3LMYA 4HCRH 1WE5A 4I9AA 9PCYA 4FI6A 1D7CA 4QX4A 1TKWA 2OXHA 4KJWD 3NURA 3CFEA 3EWXA 5DK0A 1TPFA 2CK0L 4XVUC 1ZP4A 3GR7A 1J9RA 4AHQA 1REQB 1N5AA 1JI2A 5EBWA 5EO9B 5A3HA 5EIQA 4KZDH 5DJXA 2ED8A 1NKGA 1ZVNA 1Z42A 3T08A 3MCOA 4F2FA 2XIMA 5JUEH 5JXEA 2GYSA 4JY4A 3PVFA 3AADB 2QPDB 1SHWA 4XNDA 4FGMA 2WWDA 3EG9A 4LCRA 5C09E 4YHKL 1NEZB 1GZQB 4OGXL 1SJMA 3CZFB 2N7BA 1EIXA 5GGSB 4XB7A 4EF9A 1KBLA 4DBEA 1FFRA 3Q0HA 3SE8L 3UWQA 3MCG1 1MJ7H 4E41E 5GRJL 3OVQA 1GZPA 3KM2A 1SVZA 3AT9A 1TZAA 1FYTE 2X38A 1R3HA 3BQUC 3W07A 2IDUA 4XZUA 2HSAA 4GB9A 5AVVB 2OOFA 5FYJH 3BRGC 3VZXA 3KL5A 2Z1KA 3HBQA 4MAYC 3X13A 3AWNA 2B2XL 1E4WH 2BC4B 3I7RA 2OMNA 1T5WB 1E8XA 3O2DA 3HE7D 3R8BB 3O6CA 1ICTA 4HSOA 3A22A 3HI1B 4WWOA 4EQ2A 3IIVA 4PRIB 3MNVB 5GS3A 1Z89A 1SM3L 4I6KA 1YG9A 1VCAA 1KJ2A 3UVAA 1KWGA 3GBML 4CDGC 2X4RB 5FSEC 2D9QB 3NQIA 2ZUWA 4BFJA 2NNRA 4HZAA 1QPRA 2HZGA 4GQZA 2WVVB 2CZ5A 3MUHL 1OALA 7REQB 3LQZB 3U5UA 1EXUA 3RYMA 1JFQH 2H32A 4L9DA 2REQB 4LY4A 5J13C 4R0LA 2VXSH 1KCSL 2DEXX 5KZDA 4QXUL 4RWYH 4C1KA 2ICCA 1JFXA 3IGHX 2OGJA 5JQ6H 5H4ZA 4H04A 4CVXA 3C9NA 3PWAA 2DP3A 3TURA 3R0KA 3VWKA 3GC3A 4QE4A 4LP8A 2F8XC 3KYOB 5B3SB 1HINH 4UFJA 3M1BA 1AXSA 4ZUWA 3FHAA 5HPOA 4TV5A 5ABFB 3Q9PA 1MUJA 1F3EA 2WMKA 5GRVK 3KM8A 3AQXA 5E8EA 1KJ3L 2K8QA 4OAWA 3O4LA 1H51A 2CUIA 3FRUA 2KZWA 2JELL 3W1LA 2F74B 4BWLC 1MRFL 3VI4A 2NCEA 3B04A 1NGZA 2IKHA 2JTDA 3BJLA 3L95A 1AJ2A 1AGBB 1BFSA 5IROA 3QS3A 4HIBA 4X6FA 5EU6B 3K2KA 4NRYA 1FVDA 4GXPA 3VG0L 3F65A 4EN3C 1GVSA 2CLHA 2RFXA 4BQ9A 3H2PA 3WGVB 1X5JA 1IQWL 3AZUA 4XNAA 4BCYA 3VU2A 3W1RA 3ZDYE 1QR1B 3SURA 4ONGL 3AWFA 2EPKX 1V3KA 3GZOA 3NQDA 1Z3GH 1BPVA 2ERJC 4DYKA 2EDLA 2F7RA 7FABL 1NCCL 3KLAA 1UP3A 2OLDA 2J7EA 2EUVA 3NIDE 3PZ9A 4W9DC 5CSZB 3IYLW 1IUZA 3IDYC 1EJRC 3VFVA 4H26A 3S35H 3N6JA 1GTHA 2Z64C 3EJSA 4IHOA 3W9EA 1OF6A 2A74C 4MMYA 1L0XA 1QG3A 3GSMA 5JYMA 3OKDB 4OBSA 3C8NA 4LAOA 5C9ZA 3H54A 3WEBA 4BFAA 4PVMA 5BZDA 4PR5A 3D2TA 4MD4B 1FDJA 3OSKA 4X2UA 4C1LA 4ICCX 2ZWYA 4KXCA 3LZRA 1JDEA 4OZIB 4CC4A 3TPUA 5IUSA 4AY0A 5DLCA 4AH2B 3AY2A 3CN3A 2W0FA 3THML 3B40A 4LHUD 1NGYB 1U58B 2WTRA 2YAFA 4XX5A 5HHXL 1MXSA 2J25A 3L2NA 4UQ2A 3VGAC 4FQXD 3QMTA 4JANB 5KBMA 3AREA 1OP4A 3LY6A 2F5BL 2ENPA 2VLKE 1O75A 1J11A 3RMJA 1W54A 3NTCH 3RCMA 3QAZB 5SWSB 4F27A 4XXWA 4Y8AA 1RJQA 4YEEA 1DZBA 1OTTD 3MMEA 1WKDA 2DQUH 4R2GC 1XCQA 3DMMB 3Q06A 3U30C 1W3JA 3FBQA 4WAFA 2DDQL 1ADSA 1GOWA 2N0KA 5EBGA 3PJWA 4G9DA 2DQHL 3WLIA 3AIEA 4MHHI 1H8LA 4H8UA 1W2KT 5AHFA 5AOIA 4NKIL 5J0BA 3I7QA 2Y0SA 2E4FA 4YMPA 3E2HC 3SE9H 4NP4L 1XW8A 1A3ZA 2ZOKA 1JUEA 1TJHH 4JO2H 4NILA 5AQ0A 2FYYB 4GS7C 1DSYA 4DEPB 2P76A 5H2BA 4JPQA 1PWMA 3TJHC 4DN4L 2AQTA 3RX5A 1MVUB 1R46A 3QIBC 3FKKA 4BGLA 1XZ0B 1BYPA 2VXUL 3CFBA 2AABL 1NWUA 3WD5L 1IIHA 4GVHA 3CUIA 1RP9A 4C59B 1ZJHA 3W22A 3ARGB 3WJLA 5HDOA 1M71A 2A79A 1F07A 2OB3A 2HRPL 3X17A 1UZ6F 4AKQA 3VXUA 5C0NC 1V3HA 3WLJA 2J2ZB 4G1EB 3PE9A 3CHOA 4M56A 1KY7A 2BOFX 3OZMA 5E5UB 4JHUA 3LZFL 2C34A 3BJSA 2VDOL 3H2WA 2GUUA 2XV6B 5I79A 4XCYB 1N3NA 1JGVL 3TJEH 4YH6A 4JFWA 1O5KA 2VQ1A 4GP4B 3BG3A 1NQ6A 2VXQL 3GK8L 4X80H 3IFOA 4IKKA 2G60H 1T1ZB 2D7PA 2Z65C 3BXNB 1MG3C 4OFYA 3ULVD 4RCAA 3D4YA 1I4FA 4M9OA 4F2EA 1WEJH 2WQWA 2DWYA 1V5JA 1IBBA 4J4PA 1XRFA 4Y2DB 1WXYA 3ZK0A 1HF6A 1MCEA 4HC1A 3SFKA 4OTXH 1ILSA 5DMGC 4OJAA 1EMTL 1JWMA 1NMBL 1YY9D 4YGAB 5I2UA 1QHQA 5BRBA 3WUGA 1ZLSL 1P7TA 2X2JA 4RX4A 3SN0A 3T4AC 4C91A 4AQAB 1XLDA 2I5QA 2FX9H 4LVEA 2RAGA 3VFMB 2R69H 1CFSA 1J9QA 2VTFA 3DTDA 1R8LA 4AWUA 3R4DA 1WV7T 5E2TH 5IBUB 1P0SE 1E4XI 1HVQA 2OTWB 5DC0A 1Y1UA 3TVMD 4PUDA 3OEXA 3M1ZA 4N8VB 2JSFA 2R0KL 3M0HA 5TDNA 4N86A 1U8LA 3NSFA 3V5KA 3MGAA 4PJHE 1OB0A 3UTZA 4F33B 4ZAKB 3PZIA 1IXNA 1DVYA 2HVKA 1WFMA 4X5WB 3G5ZA 2FTYA 4IPPA 4NZ1A 3TCLA 5AHEA 5C0DB 4TL5A 5AYUL 2F7IA 1KTLB 3AYSA 5D9SB 4UF7C 3VVGA 2R9HC 5DCCA 1AHMA 3BANA 4R27A 4XMTA 5TFSL 4WOZA 4D9RE 2FB4L 4ZUTB 3DC8A 4JZ5A 1M68A 5K9OB 4FHAA 1U92A 2XIIA 3IACA 3FNDA 1L7IH 1P1ZB 2D7NA 3MVTA 4HLJA 5D2LF 5DLLA 3UX9B 2VJ8A 3BK0A 1ZAJA 5D2WA 1YMMB 4LBAA 1TPVA 3MLRL 4JKPL 2FZ8A 3AYRA 1TXKA 1O68A 4MVBD 3EWWA 4WY0A 1GKEA 1OEZW 3EH4B 1TA3A 2V63A 2ZUMA 3CHQA 3ITCA 5E0KA 1T4KB 3WE6B 4QHMB 5E8DH 4DO6A 1ZRQA 5C70A 2XIOA 2PLTA 4R85A 4BQ2A 3SB0A 2J8OA 5ISZA 1UC4A 4X9HA 1HDMA 4HT1L 3HRZA 1EXBA 3H85A 3KLLA 1XISA 2F2HA 4NDMA 2VP8A 4JHAL 5DZLA 5JZ7D 4NPJA 3T78A 4IJ3B 3Q2DA 2ILLA 2UVEA 3B7YA 1QO2A 5DRZB 2Q8LA 3SRFA 2WNZA 2C6QA 1ED3B 2WPBA 1MCPH 4L8DB 4J3WA 2CH8A 1JPGA 4OUUB 4Q32A 4F58L 1LORA 3P8IA 2HKFH 3MROA 5DHDA 1AA1B 3GUGA 1UWFA 3MR9A 2KZ1B 4UC5A 1S9KC 4HA4A 3PR2A 3DYOA 2EDMA 1M9WA 5DJYB 3OBAA 1NIAA 3IDUA 1BG1A 5HJGA 4EKJA 3UP6A 2Y85A 1GTFA 1EAPA 1Y7VA 4PLKD 2V5MA 4NIRA 5FM4A 1NA8A 1WS7A 4RQQB 4ZFMA 4ENLA 4XZWA 3P77B 3NZQA 4HYWA 4Y7MA 2DYPD 3TX9A 4KKCD 2QJHA 1AQ0A 1OAZL 1FWXA 3CB8A 2BTMA 3QFDB 4ZMXA 1KYUA 3V6BR 2J8HA 5FF4A 2R2HB 5HPMA 2D3JA 3RBGA 2WUBL 1X7IA 1LD9B 3ZX1A 5LNWA 2YO3A 4KK6D 4IX2A 4G9PA 5GS0D 3PG9A 4TULH 1GGBH 3IV8A 3DHMA 2NY1D 3UTOA 1NGXB 4NBXB 4UQ3B 5REQA 2CHZA 5HR6A 3VIKA 4BI5A 4G7RB 1D2PA 5EU5A 3VI3A 5LXVA 3PP7A 1CICB 3EXTA 2X1IA 4E2OA 3QNZB 3P5YA 4ZQTA 5J7CC 3FONB 4G5ZH 4GSDL 3FRPG 4DGYL 2VUOA 4OCWL 4HS8H 3OMIB 4H88H 5IFPA 5I28A 1K70A 5D1XA 1R3WA 2W59A 1CVRA 1I9IH 3GO1L 2ZDRA 1LQ2A 4Q6IA 3W29A 4MJIB 1V4YA 3MRKA 3N2OA 3ZR4A 2HFFA 3V9EA 5E9DD 1QW8A 3NVTA 3LDBB 2HJFB 3M1OA 4QDPA 2Y1YA 1S9VA 4UB9A 3RDTD 1MQ8A 3O45B 1I8MA 1U8HB 1BRLB 3OKYA 3HQOA 4I90A 1SJCA 4OD2B 1JZHA 2NV2A 2XYCA 3NABH 4XP6L 3U7AA 3QWRD 5F3FA 3LH8A 1N19A 1QNQA 4FQ1L 4LQFL 4WHYG 1J8VA 4X0NA 5K1NA 3EGSB 3C8KB 4CC0A 1VR6A 2C14A 1BAFH 3TF4A 2YHGA 1G0DA 4UTBA 3B9NA 1VCGA 3FF7A 3RVWC 3ESPA 4Y7EA 2GJRA 2NOYA 1N5YL 3M9YA 2HH0H 3BEVA 4FZIA 5JHDD 2M26A 5IFHH 2Y5EA 3CHFA 4F7MB 1U3YA 2Z0UA 1UWGL 1DQVA 4TOYL 4C7FA 1HKFA 4GQGA 1RFDL 3K6FA 5HHPB 5IIEA 5G5DA 3QULB 2VDLB 5DBTA 1K9TA 4L3CB 2NXHA 1E27A 3RWDA 5D96C 2OT1A 4ZPTA 4JL1A 1FWAC 2FJGA 1FNEB 3T2QA 3VXRA 1IGYB 2HX8A 4PTDA 3TO4C 4CQAA 1NIFA 5KZMA 5CEZL 3R0DA 4LESA 1A5UA 4WV1A 3SY1A 4PG2A 4C8XA 1QW7A 2NY2C 3QSRA 3MRHB 5FK9B 4EDWL 1PKQE 1BHGA 2AAAA 4HEPA 2YAQA 2CETA 1WNOA 3DX6A 2BLEA 1H5YA 2D7QA 5FV2A 4WU7A 3HOGA 3HTWA 1I3GH 2WXOA 4PRRA 3O3DB 4YMZA 3WF1A 3WUZA 1J9YA 3N9GL 1W91A 2PLJA 4Y4KB 2QDWA 1JD9A 1AIZA 2WSPA 5DMJB 3EH2A 2G9HB 1OY0A 4UBDD 1LLAA 4QRNA 4LUTA 4LKXB 1IIKA 5HMDA 3IF1B 1W72B 3DO4A 5LXGH 2X89D 2BP0A 4NUGH 5AKQA 2GTWB 4YXLL 4ZPVB 1TETH 4EVNB 1FJ1A 5CZKA 4NO5B 4U1LB 3NCFB 3V0WL 4FQJL 5F1NB 1V0NA 3MRCA 4EI6A 2FX8H 2Z0BA 4GJ1A 4HBKA 2VXVL 4S1SH 4MNKA 3RVTC 1HCZA 4BGDA 2FQIA 4M5PA 5EO0A 3ATFA 4C4BA 5INCA 3HNSL 2A5UA 5G1TA 1ANUA 3IDNA 4MWAB 3OKNA 3OVUB 1IVTA 4G6KL 4FZ8H 1J1OH 1I2RA 4KZEH 4Y4HA 5CCKL 4S1FA 4B5EA 4D94A 3VC6A 3QYQA 1ZVSA 5DN1A 4QTIH 4XBKA 4IOSA 2DQGL 2A0LD 4IFKB 1P48A 3CEPA 1KBVA 4KROD 3L66A 1UZ6E 2BSLA 3S5SA 3ZYJA 3TIEB 1FE8H 2XVBA 4WWKC 4FZEL 2PCEA 2W38A 3DUUA 3KNBA 1NFPA 4INFA 1MEWA 2CKBB 3OZ9H 3W0WD 1QDSA 3STLA 5DBUA 5SWZE 4F0SA 4JNZA 1XRVA 4KQ4H 1E9QA 3S96A 5EMJA 3N4AA 3LENA 5CR8A 2CK2A 2DU2A 5AC6A 3TTSA 3A6BL 4QUOA 3SGKC 1G69A 4LVHC 3DZ1A 3II3A 4FQHB 2OWCA 4ONHA 4G8GA 3KWTA 5I09A 1BXNA 4PCYA 4DPCX 3GBLA 5LYRA 4G2DA 3OPSA 4HJUA 3V8CA 3WFHA 1JV2A 5D7SH 3IGKA 5DA4A 1D5MB 3SDXF 4BD4A 1JNLL 3V2AR 5A95A 4DVBA 3NGJA 2F8OA 4XH2A 3ZVVA 4YLWA 3OA3A 3WZ0E 3Q1SL 2VDLH 2NX3A 4BA8A 4P9ML 2JF6A 2J73A 3AXLB 3ZZ1A 1E50A 4PJFB 4KI5C 1M2VB 2VJXA 3PU7A 5BXRA 1PU0A 3IJIA 2EVIA 2QCEA 4YHZL 2DTSA 4R7DB 4IL2A 3RWEB 3LVEA 5HSFA 4LUJA 2HVJB 5DRNA 1MW2A 3UBXA 1BF8A 1OF8A 4PU2A 3G08A 2ICWB 2PR4H 3DTUB 2VR4A 1BBDH 1EGMA 3G0SA 2O5ZH 1J86A 4G6JL 3CMJA 5ANMB 4P23D 3LQAC 3S2LA 4ERGA 5TH2A 2R91A 4C83A 1DQDL 3CHRA 4PJ7B 2F1EA 4KT2A 1PKNA 4YZFF 1D5RA 4Z2KA 3SBWC 4AYFB 1I9JL 3ZE2E 2VE6A