1MWOA

Crystal structure analysis of the hyperthermostable pyrocoocus woesei alpha-amylase
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
434
structure length
434
Chain Sequence
b'AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
total genus 158
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mwoA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mwoA01
5D9OA 3EDDA 5HNNA 3VM7A 5A6JA 4UFHA 4AZCB 4P7RA 4PCTA 1V6VA 1B3ZA 4JFWA 1IT0A 1MFUA 4NZFA 2BS9A 1E43A 1IV8A 2O9PA 3W38A 1BGGA 2WSPA 3VX1A 4ZE4A 2ZUNA 1N82A 3AISA 4LPCA 3ARSA 2ZWYA 1MW0A 3AMCA 2XYLA 2JFEX 1BFNA 3WQ5A 3UEQA 1OIMA 3L4WA 2DH3A 3AQUA 3HU7A 2CYGA 4D6IA 2YJQA 4UQCA 4AEEA 5JIPA 1CBGA 1ISYA 5EBAA 4ZXLA 1VJZA 4W89A 1JFXA 2WZIA 4L4PA 3H53A 3WH5A 4D1JA 1VFUA 1JG9A 4NSBA 5FOOA 1HT6A 4GZIA 3S5YA 1M03A 3U57A 2ZOXA 1F4HA 1DWFM 4NXKA 3PTMA 3WY3A 2WSKA 4X9YA 3RDKA 1EA9C 1KXTA 1WZKA 2CBVA 3CUIA 1VEOA 4ATLA 2BY2A 4W84A 2BHYA 1ODUA 2GJRA 5I3DA 2WW5A 2C7FA 3N04A 7TAAA 3AS2A 1H0IA 1CXFA 3CMJA 1E9LA 4IPNB 2GDUA 4IM4A 2YA0A 1UA7A 2XJ7A 3KE0A 3CTTA 3AS0A 1TQVA 5CLTA 4LQ1A 5A1AA 4AD1A 2DPEA 3ZJ7A 4DWSB 2E0PA 2ZICA 4IUGA 4GINA 3CPUA 3GNOA 4KGJA 4UR9A 3AMGA 3PBGA 3VIMA 1QI4A 1W2VA 1ZL1A 4XZBA 3EJUA 1JF5A 1HKJA 4AD5A 4UQ9A 4QCEA 1UQZA 3SCRA 1TR1A 3WY1A 2D1ZA 1JF6A 3ZR5A 4PMZA 1PIGA 2ESCA 2C8NA 1EXPA 3M07A 1Q6GA 1UWSA 2J7FA 4UZSA 1BSIA 5GNZA 1QWNA 1NP0A 1OB0A 1NH6A 4CCDA 3M46A 2WLYA 3WEMA 5IDIA 4AZCA 4WKHA 1J11A 4B9YA 2XVNA 3AHVA 3EMCA 3WBEA 1ZBVA 1R7AA 1C8YA 3WDJA 5CXPA 2O9OA 4PMQA 3VU2A 2GDVA 1GHSA 1CDGA 3WFLA 2X09A 2XN0A 3DYOA 3CHDA 2WCSA 1WDSA 5A2CA 2DDXA 2V3FA 1EIBA 2X2HA 3VD3A 4J3SA 3VDCA 4BQ5A 5C8BB 2HISA 3WDRA 1OT1A 2F7QA 5A6BA 3MANA 2WBGA 1K9EA 3L4VA 3L4XA 3AHXA 2W91A 4F8XA 3BUPA 1NOFA 2A3BA 4F66A 3BAXA 1M04A 3W26A 4HMCA 5A6LA 3WELA 3VTRA 3EJTA 1JDAA 4TUFA 4QLKA 2A3EA 2A3CA 1VF8A 4W7WA 4CVWA 3VSVA 3DX4A 4CCEA 1CGVA 5AYBA 3EDEA 1XSJA 2WCGA 3DYMA 4KWUA 1Q6FA 3OZPA 2ZX5A 3DX1A 3WNOA 4Z2LA 2CETA 1H11A 2FH6A 4AY1A 4BS0A 1QHOA 4WKFA 2XG9A 2CEQA 5JBFA 1EH9A 1OBAA 1H3GA 3T09A 4C7GA 1CGWA 3W81A 4OBRA 1FH8A 3OGRA 5A8NA 1BYDA 4RE4A 3A5VA 4GKLA 1ZBCA 3TP4A 3VIOA 3OGVA 4XB3A 3B9AA 1TCMA 4AD2A 4AXNA 4E4PA 1LL7A 3WFZA 1UD5A 2WCAA 3ALGA 2BVTA 5CG0A 1UASA 2QV4A 3BC9A 3PZIA 2QF8A 1UD4A 1BVNP 3SUSA 2OSWA 5E9AA 2ZXAA 3UERA 3L4TA 1HTYA 3WDQA 1KTCA 3CMGA 4ATDA 1G5AA 5D9PA 4U5IA 1FP9A 4MNJA 4PMRA 4KH2A 1JXJA 1UWQA 3WD1A 1OCQA 4CU8A 3AS1A 3SCOA 5DT5A 4P8UA 3WQVA 4J27A 4QFUA 4CD4A 2VI0A 4MNMA 3BAJA 1WAWA 3WEZA 1V08A 4MDPA 1EDTA 3RIKA 1WKYA 3N9KA 4GI6A 3S6TA 1WDQA 2ZUVA 4AZGA 5CSYA 2D24A 3BAKA 2VQUA 3FW6A 2VCBA 5LA2A 1KWGA 5LA0A 2EAEA 4MJ2A 3SUVA 3L4UA 1ZJBA 2Y2WA 3UR7A 5C70A 3HMCA 2W62A 1NARA 1OGSA 3EJRA 3CLWA 1BTCA 4CVUA 2QMKA 1W9XA 2J79A 3WD0A 1NWUA 3AIQA 1JZ6A 3AXHA 2WLZA 2ZIDA 4UFMA 2WMIB 3OG2A 1V02E 3AZRA 1I75A 5ABHA 2VVNA 1JYVA 1FH9A 1DP0A 2WK2A 3BUIA 3GM8A 5A94A 1E4MM 1VJSA 4PTXA 1EOKA 2DEPA 3N12A 3GXFA 3MU7A 4QP0A 3PHAA 2CCRA 4DM2A 2VX4A 6CGTA 1WZAA 2XTKA 4Z2KA 2VVSA 4TVCA 4W85A 4NZJA 5I5RA 2OLHA 2CBUA 3VD9A 2XN2A 4UQAA 2E8YA 3BCDA 1EO7A 4MTVA 2QPSA 4Z2HA 2WC3A 1E6RA 3AIUA 2WKGA 2J8GA 1ZU8A 4U33A 4UFJA 4B3LA 1GCYA 4LYQA 3PZQA 3AROA 3W4RA 4ZENA 2ZXDA 2YA2A 3FHQA 4JCMA 3WY2A 3MUY1 4JL2A 4A3HA 4U3AA 2WWDA 2GVYA 3L2LA 1T0OA 2J8FA 2ZWZA 2RGMA 5EFFA 4AMCA 1OT2A 3N1AA 3PZOA 1HKKA 3KWXA 4JHOA 1UA3A 4WF7A 1QI0A 5EFDA 4A4AA 4MNLA 1GJWA 1TVPA 1G1YA 1R85A 4AD4A 5I78A 1J18A 2FDMA 1P6WA 1UWTA 5LA1A 1CGYA 1DWHM 3ARYA 4W86A 3WBAA 3ZJ8A 4XUYA 2J25A 4UNIA 1E71M 4AIEA 3AYRA 2X2YA 2OSXA 5E70A 1FFQA 3VSTA 4MAVA 1WB0A 4YHGA 3HG2A 4JKMA 1ITCA 4B16A 2VZTA 4OGZA 1QVBA 2VL4A 4XV0A 5I24A 4PTVA 5DF0A 3U7BA 2WXDM 3OLEA 1EGZA 4GXPA 1G94A 4PMVA 4JFSA 4ACZA 4YPJA 3BXWA 4F9DA 5FL0A 2BHUA 3WEOA 5A95A 2WMIA 6TAAA 3CZSA 2PWEA 3VVGA 2WVTA 2WAGA 1I1WA 3VD4A 2IXUA 3QHOA 1JZ7A 5D8ZA 1ZS2A 2HVMA 1NOUA 1XH1A 4GIAA 3LPFA 4AZ7A 1U30A 2VT0A 4UOZA 5KZ6A 1E1FA 3WF4A 2Z1SA 3AMDA 5A3HA 2VX5A 2UY2A 1CGTA 1HWWA 1AQ0A 7A3HA 3BSHA 3CZNA 1KGUA 2DSKA 3WUFA 3BCFA 4KGLA 3RMEA 1DTUA 3NYDA 4M81A 3RO8A 4MB1A 3WNPA 1Q4NX 4P7NA 3MMUA 1FOBA 1JZ4A 3O2LA 5EB8A 5IFPA 2XIBA 2NSXA 1V02A 3GDBA 1GHRA 3NSXA 2CXGA 4Y7EA 1HJUA 3LMYA 3WNKA 4W87A 2Y4SA 1W9DM 1JZ2A 4MPKA 1W3HA 1GOOA 3J7HA 1BHGA 2WVVB 4M8UA 2OYLA 1G9HA 3PTQA 1XH2A 1ZBKA 3NSMA 1UKPA 1WDRA 4D1IA 4WJXA 1RD6A 3POCA 2X05A 4DUVA 2V3EA 3W53A 3ALFA 2Y5EA 4WIWA 1UG6A 4KRTA 5A69A 2FE0A 3ARQA 2BXZA 4ATWA 2GFTA 2CIPA 3SCWA 1KB3A 4OUEA 4AZHA 4EANA 1MW1A 4X0NA 3DYPA 1J0KA 2XVKA 1LL6A 1JGIA 3SCSA 4WLCA 1KFWA 1AQHA 4CD5A 1XD0A 3LXAA 3VMOA 2DT0A 3WD3A 1MWOA 4V2XA 1QNRA 5KEZA 1CXLA 4FLRA 1EHAA 3MMWA 3SCUA 4AYSA 2ZUWA 3A47A 3LRMA 2G3JA 3CH9A 2JE8A 3VGGA 2FHFA 2WYSA 3M6DA 1AQMA 3DHPA 3A22A 3BMVA 4CKQA 5IFTA 3LX9A 4PRWA 1KQZA 3NDZA 2W61A 5IXEA 4P7OA 2VCAA 2WHMA 1JYWA 1XRVA 1HJVA 3VGEA 5BXPA 1J0ZA 3B9EA 2FGLA 3L4ZA 1V3IA 4S3JA 3CZGA 3OLGA 4BA0A 3DX0A 3SCTA 2DT2A 2EPLX 2YBUA 1W9UA 1SMDA 3AMLA 5TD4A 1M7XA 3GNRA 3GXTA 2YFNA 5CPSA 2YKKA 3A4WA 4FLOA 2W92A 5F7UA 2EBNA 3AHZA 5E6YA 3WENA 2V3DA 2F7RA 3N17A 1TQUA 3BVVA 3GBEA 4J7RA 1NWSA 1D7FA 3GH5A 3BUQA 2OSYA 1AMYA 2CBJA 2CKSA 3WUEA 4E8CA 3WN6A 4LYPA 4AEFA 3WF0A 3U7VA 5JIWA 4BF7A 5A2BA 2J78A 4DM1A 5A8QA 4J3WA 4C7DA 1B9ZA 1KXQA 4IPLA 5A8MA 1PIFA 4AISA 2VCCA 3A3HA 1E6XM 1JAEA 4QCFA 2TAAA 3I3EA 1ZJAA 4GO8A 1QI2A 1V0KA 2G4FA 3W0KA 3ARTA 1WCGA 4IISA 1ISXA 1XYFA 4B9ZA 2CERA 2PBOA 4TX6A 3EDKA 3A21A 1BYBA 1XSKA 4PMUA 1JIBA 2QLYA 3DHUA 2YLLA 4HPHA 4M56A 1V3HA 3THDA 4D6EA 3OBAA 3GXNA 3VNYA 1XGZA 1CXEA 3VX0A 1PX4A 3L4YA 3VDAA 2W5FA 2ZUTA 1C8XA 1G0CA 1R75A 2FHCA 3RJXA 5FL1A 2C0HA 2UY3A 3D5HA 3UG4A 1GVIA 2J74A 3AIEA 1GQLA 2D0GA 3DX3A 1W1YA 3UG3A 5GNYA 3MV01 3BAIA 2NW0A 4MB5A 2F7PA 1FHDA 1QHZA 2WVSA 1EQCA 2IGTA 2WPGA 4EKJA 4XX6A 4HA3A 2E4TA 3ZT6A 1EDQA 4AZIA 1LJYA 1E4IA 1E3XA 1MQQA 3KL3A 3VSUA 8A3HA 4JFTA 5ABFB 1VENA 1UR9A 1FHLA 4J28A 1MXGA 2Q8XA 3ECQA 3RCNA 1TQTA 3CC1A 4N42A 2NT0A 3EJSA 5M5DA 3AYSA 4W8AA 1E4NA 3LPPA 5CGMA 5FCZA 1Y7VA 1R8LA 2IUZA 3FXYA 5BXSA 3WNLA 2G3IA 3WIJA 2DSVA 4CD6A 2E9BA 3FN9A 3AOFA 3VUPA 4YN5A 1QI3A 4PTWA 3O6AA 3TTYA 1C93A 1W9VA 1HKIA 3K4AA 4R5EA 4AIUA 5GQBA 2WNWA 4NF7A 1E0VA 3MS8A 1V0NA 3AIBA 4MB4A 5IHRA 4MJ4A 3BH4A 3LXCA 1V6WA 1HP4A 4P8XA 3KL0A 2QMJA 1UUQA 3VGHA 4AMXA 3BLKA 2JF7A 1YQ2A 3IANA 3SUWA 4J3VA 3JUGA 3D51A 1NQ6A 3CHFA 4HMDA 1UZ1A 2WKLA 2AMGA 5CSUA 5BWFA 2ZX7A 2W63A 4PSRA 4ML4A 1PPIA 4DWSA 3AJ7A 4D72A 5I77A 1QW9A 3OA5A 1H41A 3WUGA 3HG4A 2A3HA 2ZXQA 1HN1A 3U5YA 4UFKA 4FLQA 5BCAA 1FFRA 2PB1A 2F7OA 2BVDA 4BQ2A 1RPKA 2EJ1A 3AMKA 1TQWA 1HJWA 3VIKA 4Q7NA 1MW2A 5E0CA 4GI9A 2XFRA 3TONA 4PCSA 3W6LA 1PEZA 3MSGA 4FF5A 3SUUA 3WH6A 1E3ZA 2F18A 1US3A 3WF1A 1KR1A 4WK9A 1UWIA 2CBIA 1NM9A 4AC1X 2OWWA 2X0YA 1C90A 1GOMA 2O9RA 2DSWA 4URIA 5HPOA 3D52A 2F8QA 1E0XA 3SCNA 1E0WA 3F5JA 3HG3A 1KBKA 1GPFA 1O7AA 5ABFA 5BYWA 4MADA 4W7VA 4Z2IA 5ABEA 1JDCA 1HX0A 4H8VA 2E40A 2Z1KA 5AC4A 3AICA 4JKLA 4D71A 1UR2A 1PBGA 1CXIA 3WUBA 3CZKA 1CEOA 3EYPA 3UCQA 1LF1A 9CGTA 5ABGA 3ZOAA 2J7GA 2ALWA 1DWAM 3OZOA 5FIPA 4TTUA 4BQ3A 5JBDA 4PN2A 3VM5A 3VGDA 3W37A 4CD8A 3BUDA 1UR4A 7CGTA 3WH7A 4H8UA 2D20A 2VUYA 1W1TA 3CO4A 3FAWA 1JI2A 2VQTA 5BRPA 4FNSA 3DDFA 1V03A 2FH8A 2FYVA 1GOKA 4ZEPA 5A8OA 2G3MA 2YOCA 1DEDA 3T2OA 3EDFA 1QNSA 3THCA 4BCEA 1KBBA 1BYAA 3WL0A 5CGTA 1LLOA 1ZB5A 3FAXA 5BRQA 3AS3A 1OINA 1OD8A 4NRRA 3SCQA 4PMNA 3K1DA 4AZ6A 5BXRA 1NWTA 1L8NA 5ECUA 1R7OA 3BVTA 1QNQA 3CUHA 2O92A 3QHNA 1FP8A 1QWUA 3A6OA 3OLIA 1UKOA 2XWEA 3VIHA 1ZBWA 4H8HA 3EMQA 3KEHA 2OYKA 3VIJA 3PZ9A 1UKSA 1HJSA 5GPRA 5DT7A 2VTFA 5A6MA 3DX2A 1JAKA 2VMFA 5D9MA 4OKDA 3NJ3A 1HJXA 1V6XA 3ZM8A 1MXDA 1MFVA 3K8MA 1TG7A 1CENA 1KCKA 1UZ4A 4OOUA 2YL8A 1CPUA 3UESA 3H55A 1R46A 3GNPA 4M29A 1H2JA 2XSAA 3WF3A 1DHKA 3POHA 1JNEA 5AY7A 2BXYA 1F4AA 1C7SA 2CESA 1MVYA 1NOWA 1CGXA 1VBUA 2ZE0A 2ZX6A 3UG5A 3ZQ9A 1GNXA 5A6SA 4PMDA 1OSEA 2VRQA 3AXIA 3WQ8A 1GOQA 4JAWA 3GXDA 4OJYA 2JEPA 1J9YA 3BLBA 2J77A 3LXBA 4Z2JA 2W66A 1BG9A 3WL1A 4U5KA 5GNXA 4AZBA 1C3FA 3ZSSA 4UTFA 4U2ZA 4U31A 4DO5A 2XGBA 5FKYA 3VIPA 1BPLB 1GONA 3WD2A 1J0HA 1K6AA 4JFUA 2GSJA 2Y24A 1SFSA 4DUXA 3RPMA 4WSJA 4EAMA 3SIMA 3CUJA 1VFOA 4D6FA 4TXEA 3EJPA 4F79A 3IK2A 1X1NA 1HXJA 1SR0A 4YHEA 3D50A 3VDHA 4ZE5A 4BQ4A 5CLWA 3CHCA 1W3LA 1EOMA 3IJ8A 1CLXA 1C92A 4FNTA 4AIOA 3N18A 4S3KA 1GOIA 2WC4A 1GW1A 3IAPA 2E3ZA 4MDOA 4P7LA 5CZKA 1B2YA 2GJXB 3GXIA 1UR8A 3PN8A 3KL5A 3ZSTA 3K8LA 4NXSA 4LX4A 2YDQA 4AMWA 3NSNA 3EBVA 1RP8A 3B9DA 3ZIZA 2WHKA 5DFAA 1V3MA 1KTBA 2GJPA 2WBKA 3LPOA 1VBRA 1JFHA 2XVGA 2WHJA 2XFYA 3GXPA 3WMSA 1E40A 4OZOA 4H2CA 1ISVA 4HOXA 2YFOA 5JUVA 5M3WA 3AHTA 4NI3A 1PAMA 1E6NA 4M1RA 4PTMA 3FHAA 2DT3A 3W24A 4PSPA 5HBFA 4HU8A 2G3NA 2OW7A 3RJYA 1O7DC 2YL6A 2E9MA 4CD7A 1HNYA 1Q6CA 4JIEA 3T0BA 5BROA 5D4YA 3VINA 4D6CA 2J7EA 1XYZA 1GQJA 1A47A 4HPGA 2WMHA 3WNNA 3GH7A 2WVUA 4UQDA 2CNCA 3WSUA 3GYCA 1K9TA 2VC9A 4LGXA 2DIJA 2FGZA 3GXMA 1E1EA 1UWRA 1JZ3A 2PF0A 3LRLA 1VIWA 5EMYA 1UH2A 3EJQA 4PUEA 1XHGA 3RM9A 3ZT5A 5HOSA 2XN1A 3FY1A 4ZXOA 4V27A 1CTNA 4ACYA 4DUWA 4MAZA 1JNDA 1PX3A 1OGBA 4GO9A 4H41A 1UKTA 4KRUA 4QDMA 3DDGA 3OB8A 3WF2A 2D3NA 3B8SA 3I3BA 4UOJA 1I1XA 5CPQA 2WMGA 1E4LA 2EEXA 4PMXA 3MUZ1 3W29A 2XM1A 3QR3A 1TMQA 1E6QM 4CU6A 1W2PA 1QHPA 2PI6A 5I79A 4Q22A 4PUDA 4HZ8A 1E15A 3A4XA 2D0HA 1C8QA 4D6DA 5A2AA 1B0IA 1XD1A 3CGTA 4GPNA 1CWYA 2IXVA 4MB3A 3WDPP 2XVLA 1G01A 4TTGA 3TOPA 3MV11 1TA3B 3MI6A 3WMCA 1KXVA 4X0VA 3VO0A 1WZLA 3QHMA 3K4DA 3VGFA 3VD5A 3BAYA 4CN4A 2DIEA 1VFFA 4AZ5A 3UETA 1W1VA 2CITA 2VZUA 1HVQA 3W27A 1M53A 3MMDA 4KMQA 1VEMA 4P8WA 1MW3A 1E6SM 1QX1A 3BGAA 3GTNA 1FA2A 1UR1A 3VNZA 1CNVA 2WVVA 3RILA 1GOWA 2F2HA 2EPNA 3PZMA 1UQYA 2XGIA 4RE3A 4RL3A 1MQPA 2J47A 1U2YA 3PZNA 1DWJM 2YL5A 2WMKA 3G6MA 1MQRA 1FH7A 4BZYA 3WDIA 1AVAA 2JIEA 3MKKA 2V5DA 1PS3A 3ARRA 2EXOA 1H09A 4FMVA 1WZMA 4ZFMA 5AYIA 4UQBA 2Y8VA 1HKMA 1XCWA 3CBWA 3EDJA 2UY4A 3TTQA 4U2YA 4CCCA 3DC0A 2ZX8A 1KWKA 1O6IA 2J7DA 1W91A 1ECEA 4AW7A 1J0JA 2J7HA 2WHLA 3A23A 3WQ6A 3T08A 3PZUA 3E1F1 3CV5A 3FNDA 3F5KA 1D3CA 1J12A 4EK7A 3D4YA 3N11A 1B90A 1V3JA 2J75A 2UWFA 2XFFA 3IJ7A 1LWHA 3TA9A 4FK9A 2X0HA 2X2JA 3LRKA 2VOTA 1HP5A 3QGVA 3OIHA 3ZMRA 3N13A 1GQIA 5LYRA 3CZEA 4M24A 6A3HA 2VJXA 4TX8A 1CLVA 4QLLA 1B30A 4B15A 4CU7A 3OLDA 1EO5A 3MO4A 2VRKA 1E72M 4LYRA 1GVYA 1OD0A 3CHEA 4D6HA 4AYGA 1BAGA 4DWSC 5HDRA 1NP2A 2YBTA 1LQ0A 1HF6A 4DO6A 4CN1A 1TA3A 3QOKA 3ZJKA 3WDHA 1ITXA 1KGWA 3IAQA 1LG2A 1B3XA 4AWEA 4WSKA 3PZGA 1SZNA 3AIVA 4P8VA 2D0FA 3NIYA 1PZ2A 2WZHA 4W7UA 5A6AA 3ZR6A 5CPTA 4U3CA 1HL8A 3RM4A 3RM8A 5I0DA 3QOMA 2ZUUA 1WPCA 3L2MA 2YL9A 1QBBA 4PBGA 1EHNA 4AD3A 1CYGA 4UCFA 1UHVA 1B31A 2DGAA 1TQSA 4H7VA 3NDYA 1PZ3A 4CN6A 1RH9A 4HOZA 1BGAA 4OOZA 2VZVA 4C7FA 5E1QA 3EMZA 1KQYA 5FD0A 1E6ZA 1GZJA 3W82A 1US2A 3SURA 2VR4A 4N0RA 1LWJA 1XV8A 1HXKA 3K46A 1GUVA 4WKAA 1UD6A 3N15A 1R86A 2D23A 1W32A 5D8WA 1OGGA 5I6SA 1BLIA 2W67A 1XC6A 4P7QA 3SCVA 1BVZA 1ISWA 4GQQA 2DSZA 2CHNA 1GORA 1ODZA 2YDSA 5E09A 2BHZA 1B3WA 4J3UA 2XWDA 3ARXA 2JALA 3A4AA 3ZT7A 1V3LA 5E0FA 1KXHA 1TZ7A 3ARWA 3F5LA 3GBDA 1UD8A 3MSDA 1VB9A 2J7BA 2F61A 4GQRA 4UZUA 1CZ1A 3T0DA 2YA1A 3K8KA 3VDBA 3WQ4A 3WH9A 3AZTA 1CECA 4QLJA 3D4ZA 1JD7A 4HTYA 4W5ZA 4UFIA 2ZUSA 1JXKA 3S5ZA 1VRXA 2JIWA 3VKKA 2YLAA 2XUCA 2YIHA 4OIFA 1KCLA 3F4VA 3TV8A 4GZJA 1V3KA 2XSBA 3GH4A 3CUGA 1R47A 3GZAA 3ARPA 1JZ8A 4EE9A 2JF6A 2VZSA 4M80A 1J0YA 1H49A 3T0AA 4B3KA 3PZTA 4D6JA 2E9LA 2EQDA 1R34A 4M82A 2YDRA 4A3YA 4UOQA 3KLLA 1HIZA 2VURA 3A24A 2GUYA 1QPKA 4JCLA 4MNKA 4K68A 4W8LA 1BF2A 3VIGA 4PEEA 3VMPA 1UD3A 4LXFA 3SEPA 1Z32X 3SUTA 1M01A 2VR5A 1JD9A 4JZ5A 2Y8KA 5I2UA 2F1BA 1UYQA 1WDPA 3VD7A 1PJ9A 3ZO9A 5HXMA 1TUXA 2GK1B 1E55A 2WC7A 3S2CA 3AFBA 4HU0A 1TE1A 4ACZB 2EADA 3D3AA 1ISZA 4OBSA 1HVXA 4AD0A 1E70M 2JEQA 3BSGA 3M7SA 2MANA 2X2IA 4FNUA 2BNJA 2VNCA 4TOQA 2DQXA 3PZVA 4FLSA 3CZJA 3T2QA 2VX6A 1LL4A 2BVYA 3APGA 3VPLA 3WKZA 1R33A 4E8DA 2XPKA 1GJUA 5C71A 1DWGM 1H4PA 4PYSA 4UFLA 1UH4A 1R87A 3NUKA 4HZ6A 4HA1A 2QPUA 2ZUMA 1UKQA 5HPCA 2D3LA 4HA4A 4QAWA 2X1IA 3I3DA 2O9TA 2BY3A 3BVXA 5M17A 2BY1A 3BUBA 1UOKA 1KGXA 1QI5A 1E5JA 1V6UA 2V38A 1B1YA 1V0MA 2G41A 5IHSA 4RE2A 3II1A 3AIRA 4R27A 1OM0A 3T2PA 4FNRA 3BVUA 3BAWA 1DWIM 2UY5A 1XSIA 3AHYA 3MUAA 5DMYA 1QW8A 1HL9A 1A3HA 2PWHA 1K9DA 3WD4A 1XH0A 1JL8A 2EO7A 3KZSA 4HMEA 2D22A 1LG1A 3AIWA 2W4XA 1SMAA 1H1NA 1W3KA 3W6MA 3W25A 2XIIA 2OWXA 5DEZA 1W9PA 2CKRA 4W93A 1OWQA 4NZCA 1QOXA 1SYTA 1EQPA 1TFVA 3AXXA 3NCOA 2DH2A 1EDGA 2ZXBA 3G6LA 2WMFA 4E2OA 4D6GA 1E6PA 3WMBA 1QNOA 5AC5A 1Q6EA 2VZOA 1X6NA 3ARUA 4CUCA 5DO8A 4H04A 1VAHA 2OW6A 1WO2A 3BLPX 2GK1A 2PBGA 3AZSA 3UR8A 1RP9A 4Z2GA 1JI1A 1L0PA 2PWGA 4J3TA 3IGUA 4TVUA 4FNPA 2RGLA 2XVPA 2D73A 4GI8A 3TTOA 1QNPA 4V28A 1KR0A 8CGTA 1B3YA 1CGUA 1V6YA 5A6BD 1UR0A 1B3VA 1H0GA 2ZX9A 3IJ9A 5CJ5A 1S46A 1YHTA 3MUIA 4W88A 2EPMX 4CGTA 2B31A 2PC8A 1PX8A 2WM0A 1WE5A 3O9NA 2WANA 1GQKA 5D9NA 4FNQA 2V3GA 3VIIA 2QHAA 2XM2A 3VILA 3OGSA 1J0IA 3WY4A 2A3AA 1X6LA 4HOWA 3HG5A 3DECA 3H54A 1VEPA 1IZKA 3PTKA 3VMNA 4W8BA 4F9JA 2X8RA 2EACA 1CXHA 3KLKA 2OYMA 4DO4A 3CIVA 1JDDA 2OWCA 2J62A 2VO5A 1W1PA 4W5UA 1D2KA 1IZJA 2DT1A 4J3XA 2EPOA 4JFVA 2NT1A 3WH8A 4DWSD 1C7TA 2PWFA 1C91A 1H5VA 2XHYA 2G8ZA 2WB5A 2VX7A 3TTSA 2WMJA 3ARZA 1UD2A 5E6ZA 2AAAA 1J01A 1UH3A 3WQWA 4XZWA 1E56A 2J4GA 5I23A 1J10A 2V5CA 2WZEA 4HP5A 1CIUA 3HJEA 1WNOA 4JL1A 1BQCA 4NRSA 5A6KA 1CXKA 1XCXA 2CPUA 2FHBA 3ARVA 1VFMA 4HZ7A 3VGBA 3VIFA 1Q6DA 5JBEA 4NX0A 2D2OA 1MYRA 5A8PA 2F1AA 1BG4A 3U5UA 1JYXA 1K9FA 4TVDA 5M03A 1V0LA 2BFGA 1W3JA 1ESWA 1UWUA 2J7CA 2VRJA 3LPGA 3HN3A 4L4OA 2BV9A 3BMWA 4JHZA 2DSUA 2E8ZA 1OIFA 4PMYA 1BYCA 3CZLA 4GZEA 4PMOA 2PWDA 3CUFA 3SCPA 1TVNA 1QBAA 2EABA 3ZJ6A 1U33A 2AOSA 5CQ1A 4UQEA 2CHOA 1JYNA 3BVWA 1JZ5A 2WWCA 1NWRA 3HZ3A 1W9BM 2BY0A 3W28A 3WNMA 1WP6A 5BXTA 2GJXA 1E5NA 3CZ8A 1E73M 4JKKA 1HJQA 3AI0A 2EPKX 3VOCA
chains in the Genus database with same CATH superfamily
3KBHE 4OU1A 4WY7H 4NOBA 2WZMA 1IJNA 3E02A 2DYPA 4ZTPL 2VXVL 2YBRA 2WQDA 4TUUA 4R4ND 3IARA 2WSPA 1FNHA 3JYCA 5EA9A 4WW1B 1N82A 4L0PB 3SD2A 4LHQB 4O58H 2J57A 3LRHA 2BG5A 1BFOB 5JXQA 1NIEA 4KPHH 3WXVH 5C6TH 3CUIA 3DKJA 3DK2A 1VCFA 2XLLA 3GK8H 3BL3A 5F1VA 1QQDB 3ANYA 3UJTH 2XQBH 2MSPA 3ISRA 3OVQA 2XWJA 3C8KB 3ZDZF 3QI9D 2Q76B 5D1ZD 5M95B 2ESVA 2B2XH 3MRNA 4BQ8A 4DWSB 1MY7A 1N5AB 3PBGA 3UAJD 1R3YA 3CPRA 4PJAA 4FXLA 1F58L 4PQXA 4X6FB 3GSRA 3LNIA 4C1KA 4ZFOL 4XHJD 3RFAA 3KVQA 1WWWX 4HGKC 3ZHKA 5I1CH 1SGJA 4RIRA 2O5ZH 2XVBA 1DPMA 1XGQA 2WO2B 3LKNB 1N67A 4KXBA 4UB0L 4X42A 2AQVA 3S46A 4B9YA 3EA3A 3P6LA 5JW3L 4ONFH 2O9OA 3DTXB 1JE6A 4K2SA 4M61A 4MJIA 5DEFB 1OL0A 3CHDA 4LSPH 4PCNA 4CNNA 4LBAA 1UWXK 2EICA 4MY1A 3KAAA 2VWEE 1BVLA 2WWMC 4BQ5A 3DRTB 4RNJA 1L9RA 4ZMYA 1R6VA 4Z8FL 2DFAA 4FF9A 1C12A 1JN6B 5HQMA 3PDDA 1HDMB 1Q72H 3NIGE 4UNLA 1DEEA 2F68X 1IFRA 5ALBL 2C9QA 1GZHC 3G2GA 2AJ3A 1I4FA 4JO4H 1QHOA 3HC4L 4MBOA 5JBFA 4PTDA 2EKCA 2NSOA 2MFNA 3MBEB 4C6FA 5A8NA 5L4JA 1ADWA 4D8PA 1XWVA 2NXZC 5FF6A 3TO4D 4RDZA 5T33L 3F64A 4Z7VA 1OF2A 3UYPB 5B38G 1NUNB 4UAOC 1W8SA 2QV4A 3R0UA 3DV6B 3BPNB 3TZVB 1WD8A 4M4RB 4QNWA 3N42F 2VGLM 1AHKA 5IMOA 4XP4L 2GI7A 5KAQF 2VLJD 3V75A 1C08B 1FF5A 3CEPA 2NY5H 2RDXA 4CU8A 5ALCL 3AS1A 1NFDA 4IIDA 1XLGA 4Q9RH 4TS6A 2BBFA 3BX7C 4DH2A 2V37A 3HI5L 3NT0A 1SOXA 4Q6IC 4Y4KB 5JXAH 3DOPA 5LA2A 6PTDA 3K5XA 2VZ1A 4WI0B 4U05A 5T1MA 1DDHB 4NZ5A 4ACPA 3GXUB 5E6IB 3SO3C 5DXXA 3S35H 5DD1H 4GKSB 4LRSA 3UTSB 2VW6A 1V02E 2P8PA 4H0HB 1I75A 2NXGA 3BJTA 2VVNA 3BUIA 4L8BA 3GXFA 4X6EB 1BFVL 3NIFB 1X6UA 3SSGA 1QSEA 3LBCA 2XTKA 5FUCC 3WX7A 2LHAA 2G2NA 4UV4L 4W85A 2BSCA 4TUJB 4YSQA 3GIYA 4KV5E 4KKQA 1GPOH 4UFJA 4LYQA 2ALDA 3GI9L 4NNXB 1F3JA 4OQTH 3RFZC 5HHVH 4IX2A 1HEZA 4XMLL 1AY1L 4LKCB 2X4PA 1SOKA 2VLJE 1TELA 2A5HA 1RZKC 1JVKA 7FABL 4O1AA 1QI0A 5ECVA 3NCJH 3VWJA 4A4AA 1NC4D 4F57H 4A8NA 1YHPA 4XE0A 4K9EL 4O51A 5DMKB 3ERXA 3CIWA 1RERA 4ZQTA 3SJNA 1SVCP 1T1XA 2ADFL 1X9QA 3OHMB 4B2DD 7PCYA 2EVGA 2VEMA 2WBJA 2FJHA 5F9OH 1L6XA 1Y8BA 1QUMA 2WAGA 3PIQB 4MA8L 3MAWA 5JPNA 4F0HA 5CSZA 2HVNA 5FHBH 4JO1L 4WWKD 4JGDA 2UV3A 1NMAH 1SDDB 3GTVA 4ZVJA 3TEYA 4L5FL 3QH3B 1FHGA 4YAQA 1PFOA 4GP8B 4UBDD 4CGUB 8RUCA 1QEWB 1KGUA 5I3KA 3BCFA 4FQXA 3IMSA 5DO2C 5JO5A 2WYZA 2Q86A 2QVIA 3EPMA 4IIQB 3VG0L 3C0JA 1TFHA 5ANMA 1NPJA 2QADB 4OLUH 3R4IA 3J7HA 2XKUA 3DARA 3LCIA 4Y4FD 1NMBL 2QJGA 4ZMOA 1F6LL 3TZNA 4NSKA 3MSYA 1I6NA 1DN0A 2HN7B 3ALFA 2Y06H 5KZMA 4WIWA 3SI9A 2YARA 2GFTA 4KEZA 5KETA 4PCPA 3PXLA 4U1HA 5IB3B 4I5BA 1A6AB 4JE0A 4KFMA 4WWID 3WD3A 3IXAA 4I8DA 5HULA 4YGVB 4HU3A 2FT7A 3NZ8A 1TJHH 5BW7A 1QTYT 3LRMA 2EF9A 4G1KA 5DYFA 3OW1A 4YK4C 3BEVB 1G4SA 3F2LA 4Q8TA 4IMLA 5IXEA 3VU1A 2Y1AA 5HJYA 1TYJA 1AS7A 1HQRB 5BXPA 2KS0A 4WO4B 1RCQA 4I6KA 3MHUA 4DF0A 2NZ9D 3CZGA 4Z7OB 4S1RL 1NCWH 5XIAA 3WJWA 1EHKB 1A7BA 1QPOA 3ZX1A 2YKKA 1UXWA 5IESH 3ORWA 5HAOA 4KTEH 1R24A 3OMIB 3QXBA 1GGIH 3UPMA 2A2IA 1JPFB 3T9PA 5JIWA 5A8QA 5CN1A 1B9ZA 3P60A 2XIQA 4EPBC 5DRNB 2VCCA 4P5TD 3VFLA 1XIDA 4ANXA 2WIIA 5ITFB 3GVWA 1JFQL 2RTTA 4IISA 1KTRL 3NCEB 4MCZA 4F15B 1J5IA 1E5BA 3OBAA 4OZFA 3IUIA 3GSXA 5T1KB 2QFPA 5D04C 3Q43A 4AUUA 2IQ9H 3N2TA 1OM3L 3VXUB 5C2XA 3KXQA 1UGNA 1T66C 5J0BA 3FQNB 4JFDB 1ACYH 5GGQH 2HCVA 1ZAHA 2WVSA 3HJZA 4MJ5B 4Y9BA 4KJWC 4ZB5A 4M9OA 4H8WL 4EDXA 2EUXA 2C3VA 1CGSH 5AAWA 2X1TA 1U8OB 4DW2H 2QCDA 1MQKH 1TV8A 1O5KA 3GSQA 3W02A 3GSVB 5HHMD 4X7EC 3WNLA 4Y5VC 1M7DB 2WWKT 4N2OA 1B4JL 4P4KA 1KIRB 3U0PA 4PRIA 1BEYH 1S1PA 4B3ZA 3RBSA 1WUEA 5EBMB 3EX1A 3IACA 5GJTL 4XO7A 1XIBA 4JY4B 1OF0A 1RZQA 3B2XA 4QG6A 3RFRA 1CURA 1DE4A 6PCYA 3V5CA 2FR4A 3I2CH 3MJ6A 4PBFA 3HG4A 3B56A 3LEYH 4FQ2H 1QR4A 2F7OA 3B37A 1A4BA 2P5WA 3M1CA 3GLAA 2PDLA 4J4PD 2CLKA 1PEZA 3V0AC 4XCNA 1S7SA 3FOLA 3G8EA 1NM9A 3FSZA 4BZ1H 2FFIA 5I1JH 1KYFA 2MCPH 4XMKL 3ZZLA 5K4ZA 4JY5L 3F5JA 3HG3A 1GPFA 1O7AA 1N68A 4DKEH 4MADA 3IWUA 3LN9A 2BWIA 5EORH 5I19L 3SGUA 3KPPB 3ZTNH 3EYPA 1QRND 1S7TB 3QVAA 2BSRA 4QYAA 3TZVC 1M1SA 5KJRL 3E0FA 1U42A 4H8UA 4GNVA 1W1TA 3QORB 2FYVA 3CK0L 1V5JA 3C5ZB 5GZOA 1AQDA 4ODUA 2V5KA 3H4WA 4DJEA 2FEEI 3DJSA 5KJ4A 4Y9FA 4A35A 3VNLA 2X40A 2AERT 2Z26A 1VESA 2NOYA 2X4RA 3U1SL 5CEXA 5BXRA 4RPQA 5CIPB 2HP4A 3ABXA 5CAKA 3RPBA 3KPOA 1JPMA 4N8VG 4J1UA 4B9KC 5EUKB 3NJ3A 4Y9NA 4F9LA 1AGCB 1I1YB 3ZJAA 3VFTA 1DXIA 1W0VA 4XXWC 3APMA 5E6SB 4LBUA 1QRQA 2YRBA 4MDIB 1SXSA 3IDIA 3TSMA 4ZSOE 1QRNE 2RD0A 3C2RA 4XPTL 4OJYA 1U3HB 5EC2B 3Q1EA 1FBAA 4TF4A 3DOSB 1KM5A 4HUXB 4WNQA 1BPLB 1JOIA 4GI4A 5IIEB 2D7TL 1C16A 4Y19A 3STZB 4UMGA 3QY6A 3ZTJG 5H6HA 2H9GB 4TXVB 3RGVB 1N0XH 3KHQA 4XO5A 5CGYD 5CBBA 4Q14A 3D39A 4K5PA 1M7UA 1XBZA 4JM4H 3JZYA 2MCAA 5K69A 5H37H 3MZTA 4HJUA 3AY4C 2QSVA 1MUCA 2XWXA 2WHKA 1BVNT 1T7VA 3BKJH 2WBKA 1JFHA 4HG4J 3HRZC 3WMSA 1YJDC 2ZVRA 4F4RA 4L3FA 1NDTA 3AHTA 3VFRA 3UXIA 4L4VB 1CB7B 2HJFB 2FX7H 4B7LA 1YO4A 4F5CE 5EZJB 1FBIL 5BVJA 1Q6CA 2R94A 1QSFA 1DJYA 4IGNA 4IHOA 4Z0XA 4BRJA 1KCWA 3VFSA 3SPIA 4PUMA 1D2OA 4IIQC 5D2NA 4N2CA 1K9TA 3HZMB 5E9DA 4F37K 5D2XA 1UWRA 1RMFL 3R1GL 4JY6B 5T3ZL 3FRPB 3FZUC 3O0RL 3FY1A 3F7YB 1WFUA 1CTNA 5AB3A 3LLXA 3AU1A 1CN4A 3MOAL 4TV5A 3MJYA 4R26L 4N4YB 3ZKXB 4Y5XA 3IPFA 3QDMB 3D8MA 2ISWA 2Q6ZA 2RBLA 3DXIA 4M5ZL 1CD9B 1YE6A 3II3A 4D8LA 4O2CB 1YDPA 1JTTA 1Z9SA 3ARDB 4UIMA 1GYUA 4GIPD 1R5WA 5KANI 3EB2A 2BP3A 4V1YA 3CGTA 5C09A 4MB3A 3THMH 3MV11 2EEDA 2IPKB 32C2B 3VD5A 4WTQA 4R9OA 1VZIA 3HF3A 2D4DA 2CDGB 1U22A 4KMQA 3GS0A 2QSCL 3EYQC 1FA2A 1EPFA 2EPNA 3DROB 1TPDA 4Z7QB 4DVRL 5CP3A 1PZDA 4OB5H 3N2JA 2F8VA 1FH7A 2JIEA 1R3HB 2EXOA 3LQZB 1LOLA 1ZLUH 4PBDA 1F6PA 3L7FA 4HV8B 4PM1A 1F56A 5DZJA 4IQEA 1FCVA 3WQ6A 3ONBA 1JGMA 1KM3A 3FNDA 3MO1A 1KFLA 2DBJA 3P62A 1MJUH 1J12A 2AEPL 4LBEA 4OZIF 1B90A 4X4ZA 1JTPA 1EJXC 3SRDA 1N8OE 4FXSA 4C59B 4APQB 4DBDA 1YEDB 4PRHB 4M24A 4TX8A 1UB3A 1VRDA 5C9WA 1KEMH 1PTGA 3GU9A 3KLAA 2H3BA 2I5QA 5CJXA 2YRZA 3RE0A 2V5LA 4WVXA 4HSQA 2W0UA 2XC8A 3WDHA 2MTPA 4Q8OA 1Y5XA 4WI5A 3VXSA 1HH6B 2VAJA 2QR0B 3I9AA 1A7OL 4WGKA 3E9UA 4CC1A 1KLFA 5AALA 2ZTJA 4KRZA 5B7MA 5DS8A 2AABL 3LPWA 4H7VA 3NDYA 2PTTA 3CNYA 4L9XA 1SJBA 1GJIA 2D7MA 2CO7B 5IMMA 1R3LB 3EMZA 1KGCE 3TH3T 1ID2A 2D03L 1I7RA 4QO1B 3UH8A 4K7VA 1EEUA 1L7IL 1US2A 4PJ9B 2JIXA 1W32A 5JHDB 2V2TB 2Q20A 1BVZA 1H7PA 4H4IA 2HE5A 4YWSA 4F2TA 2XWDA 5DUPH 3ARXA 5FUZL 1CG9B 3ZT7A 1TMHA 1FVEA 2XZQL 3ABZA 3KX6A 2EIZA 2F61A 4DETA 3PGDA 4UZUA 1DN2A 3HFMH 1XUUA 2B7OA 3K8KA 3WQ4A 1OE2A 3TTEA 3D4ZA 1MHEA 5I1GL 2QKIB 3IMUA 4XMPL 2ICEA 2FZDA 3GKWL 5J8OA 2JJSA 3SDAC 3T2LA 4C83A 4B5VA 2PCPA 1IQWL 2A21A 1VFSA 1FQ0A 4GAJL 1QUNA 2YDRA 5GJMA 4JPSA 5G1TA 1F42A 2HAZA 4JZNB 2G97A 3GC5A 3NPSB 4MMXA 5JORA 4XBPB 5AOJA 4WOZA 3S1GA 2GCYB 4DT2A 5BOFA 2IVFC 5F2FA 3KXFA 3DIFA 1RJLA 2QPEB 1TWIA 5IR1A 3FNKA 5EN2A 4Z9KB 4OCWH 4PRAA 2NW3A 1E5CA 5BV7L 2XV3A 1JP5A 4Z95H 3T2QA 1SM3H 5LXEA 5B3JF 1EJ6A 4G8GB 1H4PA 2CBQA 6PAZA 1IUZA 1SXBA 2B4CC 3BVXA 4XRCA 3C5ZC 1WGOA 1RUML 4NO2A 4NJIA 1UOKA 4ELME 3F2DA 3BISA 2CFFA 5EF3A 3QPEA 3L1GA 5JXED 3TYUA 3O16A 1UT1A 1J1PL 3QYMA 4RDWA 3SKNB 2D22A 4AQOA 3AIWA 4NIRA 1BQHB 1W3KA 3QQ1A 3E80A 1XMEB 2NQDA 4G8FB 4NAEB 1SYTA 3TW6A 1J48A 1TFVA 1JV2B 3NCOA 2DQCL 4HW6A 5IWLC 4PJXA 4CUCA 3FSUA 4ZX3A 4PGCA 3BW2A 4JGNA 3UMNA 3E96A 4U6YB 4WGWB 2BLFA 3DX8B 4NC2B 2VZ3A 1SY6L 1AODA 2RCSH 3IJ9A 3KRZA 2B9BA 4J40A 3RZCA 3CDZB 5CZVH 1T1WB 1YECL 2A6DA 4NRXB 1ZVSA 3VIIA 3H9SE 2WKOF 2OJ1A 5DC4B 3DECA 2FIQA 2Y6ZA 5REQB 1NGPL 2AKRA 4HUVA 4ESKA 3VFOA 2COVD 4U3HA 3WLLA 4W5UA 4L3EB 4ORMA 1IAII 4UT6L 4Z3HA 1R3SA 4P2VA 2YUWA 3KOYA 4E2BA 5E4OA 2QQNH 2AEQL 4NAQA 1YY8B 4HN8A 5BRBA 1IC7L 3QPZA 1BQCA 2ZZ2A 1XCXA 1YG9A 4TN9A 4PRDA 3ARVA 4UIKH 5E51A 5D7JB 3VIFA 4JVWA 3QP3A 2F1AA 1JYXA 4L3CB 4PRPE 4M7LL 3HZYB 2E7FA 2Y1VA 1CLZH 2VRJA 4XAWL 4U1IB 5FAJA 1D5IH 2ED6A 5CCHE 3CFBB 4RZ4A 1RY7B 3UGXA 4I0KA 3CZLA 4PMOA 4PA8A 4IOTA 1LQAA 4XBGB 3NRPA 3MODH 4A2LA 3VKBA 1Q0XL 3VRJA 5CQ1A 4HYVA 1VYRA 4OF0A 1LEIB 4W6XB 4DJFC 4DGVH 3W28A 2YXXA 2X4OA 4MLJA 3IFOB 1YYMH 4NNYA 3M86A 4GY7A 4UT9A 2ATKA 5LGHL 4YNGA 3ZKXC 5K9KB 1ZT7B 3PWLB 4WUUB 4IRZH 4ZE4A 5IFAH 4JN7A 1FZJA 4MMYB 3SGDI 2Z29A 1AXTL 3C0LA 3SN6N 2NXIA 1AHWA 5MF5A 1WFNA 2C1IA 3F4NA 1BYOA 1U8NB 4HUKB 2X6BA 5DUML 5F9DC 5E8NB 4MFEA 2CGYA 1RBOB 1QUPA 1QNZH 1OYAA 4FI8A 4IM4A 1P4BL 1FWRA 1AAJA 2YKLL 4NUPA 3KS5A 4JO3H 1UCBH 4WEMB 4OV5B 4HWBH 1YPXA 1F90L 2CJUH 2O5XL 1BYNA 1HHIB 3VCCA 7REQA 4QRRA 4KWVA 3WJLA 1TCDA 4XZ9A 5LNWA 1I9EA 2OZTA 2VDPB 2OMZA 3HB3B 1Q6GA 4N0CC 1J6OA 2BSTB 3M46A 2Z1PA 5EU6A 4J8RA 3SQLA 2DB8A 1KB9J 3WBEA 1V7ML 1PG7X 2VWSA 3WI9A 5DRZA 2QQLH 4FXJA 2RDWA 1ZVYA 5HYFA 2CKNA 2KAUC 5C8BB 1O66A 4MSWA 4RZ6A 4FDWA 4DZ5A 1WC7A 5LO7A 3B2VL 4B90A 5F9WB 4LHJB 4KK5D 4W7WA 1EC9A 4MYXA 4YN3A 3WZ0E 3DENA 3DX4A 1B3JA 3UROR 3SQBA 4CCEA 2IKIA 3OZPA 2V9QA 3M0IA 4KRPD 4NNPL 5HA7A 3T09A 3OGVA 3P9LB 4AXNA 4U6VH 4AG0A 3V6OA 1NANI 1A5NC 3NP4A 2CK2A 1SHXA 5D71L 3L4TA 3TA4D 1A1OA 2FQDA 3BXNB 1DLHA 1F45A 3GIPA 1WWCA 3K6NA 4M3KB 4HBCH 5DQPA 1IM9B 1OPGL 2HH0L 5L2KA 2YW3A 1GMEA 2VQUA 1NEZA 4A7TA 9XIAA 2CJSA 3NM3A 4GLRI 3HMCA 3KBJA 3KH4A 1O6TA 4X2PA 4CVUA 1LO4H 5F6HJ 3V4VB 3HM7A 5EA0L 4PC8A 5F44A 4PVNA 2QZ5A 5IT2L 1S5MA 4Q32A 2QFRA 1KB5L 3RX8A 3F8UB 4ZW7A 3NA4A 1VJSA 4KROB 4A6YL 2XXGA 1MCOH 1L9MA 4Q4SA 4HIBA 3SBPA 4G56A 3IWVA 3NPSC 1F3WA 4EACA 3U4FA 4LSDA 4YXLL 4Y16C 4XUGA 4Z7UF 1YYLL 3MRCA 1KGYE 3EZ4A 5EFIA 2O6PA 4K39A 2C9SA 2CDFA 2EXYD 1L9QA 2BGSA 2R29L 4QKTA 4XBSA 4A68A 1XF5B 1CDIA 4FFVD 2NVAA 4G9DB 1LLWA 2CXKA 3EWWA 4X3ZA 1HKKA 1FC2D 4JHOA 3W7MA 1RXLA 5MERA 2B1HL 3VYPA 3OZYA 1CGYA 2PPEA 5F3HA 4AL8L 4S2CA 3CE1A 4FS0A 1A3RL 3P4OB 1ONXA 1XM3A 3HUJA 3ZUNC 4PJ5D 1ONRA 3HJ0A 5AD0B 1QVBA 2R1YB 1BBJB 5I24A 6FABL 4PTVA 5HP5A 2Y7DA 4JAMB 3S7GA 1BV8A 4GBXD 4O16A 3SE4A 3CS2A 5FL0A 4BFIA 1O6SA 3S3JA 2ON3A 3LNHA 3V6FA 2W8CA 1TWDA 5G2HA 2PMZA 2UWEF 3KNBA 1B0GA 3HCVB 4LSUL 3RWIB 4L8CB 3E0IA 3QYNA 1UQSB 1KO0A 2IOIA 3RY6C 1O9VA 2DTSA 1F4WL 4KKBD 3V5HA 2CIKA 3KAOA 1IE5A 2X7LA 5TE4H 1OCNA 5KVFH 5DJCB 3MP5A 1A6UL 1EHXA 1E2ZA 4B0MM 5H2ZA 4JQAA 3MTWA 3CHSA 4M8UA 1S2UA 1ZBKA 3NSMA 4HWZB 3JWDH 3PWPB 5AB2A 1XF2A 1AH4A 2VDNH 4PJEA 4PG2C 2XGZA 5H2BB 4NKIL 3IETA 2F15A 4ATWA 1K7XA 4EUPA 4OUEA 3FK3A 3WQDA 2CMRH 2J72A 1ACXA 2CM5A 4PJ5E 4GW5B 2DI8A 3ULSB 2ZKHH 2Q87A 4WLCA 4N85A 2OP4L 1QNRA 1AS6A 4U1MB 5DI8A 3OU8A 2Q8LA 3NOEA 2REQB 1H6TA 3UTZA 5DYOA 3B2DC 3M6DA 2Z8VC 4PRWA 4FXFA 4H4NA 2W61A 3WLTA 5CZXC 2X70B 4L23A 2FZNA 1EDHA 4MQXD 2ZA1A 3HBLA 2N01B 1W72H 1EZSA 5KZEA 5HI3C 2JFCA 1UENA 3PUDA 4MA3B 1HCFX 2EBNA 5RUBA 4FXGB 3WENA 5GXBB 2NQ9A 4BFEA 3RI5F 3A67L 2YXMA 4XC3L 4JX5A 2ZRVA 5BWAA 4Z0BH 1E1CA 2R91A 3MCYA 5KVFE 4DK5A 1AD0A 1RZFH 3R0DA 1QG3A 1R17A 4K15A 5FECA 4IIZA 4C1LA 3H2CA 4HCFA 4E42B 2R27A 3QZNA 5AKQA 4Q8PA 3TWCL 4LLQA 4AMAA 5EZIL 5BRZD 1XYFA 5FLVA 3EDKA 3FQWB 5T1LA 2BNQA 2BP1A 5LNSA 2VERN 3LB0A 1VGKA 3VDAA 2DVUA 4WU7B 1Q6QA 4AH7A 3ERPA 1GXEA 1ZPTA 3S0CA 2E6JA 3MQIA 3MW7A 1VCBC 5AWNH 3HZVB 3MPGA 2W5PA 5K3VA 1FO0H 2VISA 3B8IA 2A6LA 1A5LC 4WJ5B 1XGTB 4NYLB 4ZMVA 1LJYA 1DL7L 1T22A 1CD1B 2C3ZA 2AFNA 3P8JA 1JMXA 1X7SA 2CSPA 3CC1A 4Z7OF 4AIZB 4R33A 3O6FA 4YLQT 1X9RA 3VAVA 1R8LA 2BNRB 3TYZA 3HB3C 3SGKA 5ENWA 2EZ0C 3CQKA 1V51A 4ZODA 3FT3B 3HNVH 2NY2C 5EF2A 5F0JB 2HJLA 4JRXD 2I26N 4Z7WB 5HJ3A 2X4SB 4UAOB 3OG4B 5KSBF 1OAXH 3X14B 3TUUA 1C5DA 4MWFA 2AMGA 3V7AE 2CU9A 1RLCL 1HKFA 2EAWA 1NDZA 4L8DB 1QW9A 2NY0C 3OA5A 4KKNA 1JCTA 1EQWA 3A6CH 5HBBA 5CS7A 2QPDB 1TQWA 3RL1B 2DQMA 3TBBA 2RH0A 4MNGB 2HPMA 1DJIA 2X9WA 3TWYA 2XZZA 3MV8A 3NIGB 3FRPG 5IFJA 5TDNA 1U92A 2X0YA 5D03A 2NSQA 1GOMA 4PWHA 2DSWA 4O12A 2Z8SA 2DZBA 2F8QA 4EE2A 3VOIA 3SO3B 5FW8A 4AAJA 1ERNA 4ETQB 4D71A 1UR2A 4GRWH 4GD0A 1IHIA 9CGTA 1OFBA 3OZOA 2CDEB 5EZPA 4GAYB 1MNUL 3JZ7A 5DMNA 3U7WL 1EKOA 2E1WA 1JNLL 1ZHLB 4NNAA 3M16A 3GMRA 3AWGA 4JRXE 1ETB1 3MLWL 3GMMA 1SDYA 2FPYA 1JCLA 2WSQA 3EGSB 1GK8A 5KBLA 2DQTH 1TEGA 3M5VA 2A4EA 1I9IL 2R8SH 1A6VL 3DFHA 3T77B 3V9CA 1ZB5A 3HHSB 4BKLB 3J8F7 4QT5B 1IWPA 5FCUH 4J3ZA 4M5SA 1FWJC 2QL1A 1YNKL 3QJFB 1QHQA 3ABRA 1IGSA 3FJTA 2PAJA 2W65A 5BZDA 2GIXA 1S7RB 1WTLA 4JQXC 5I17B 3LHUA 1QASA 4P5KA 3TC6A 1Q8AA 5D9MA 1EPVA 4KRLB 2X0WA 2X41A 1OY0A 4B5EA 3R0NA 3UESA 3GNPA 3T4YA 1IT8A 1AJ0A 1PSKL 3WQFA 3TPUB 3O3UN 2KH2B 1CGXA 3PTDA 3B8DA 3MVTA 1XZWA 2OZ0A 4LLDA 3S5LB 1NCHA 3MRQB 1OCCB 1XGDA 2DV6A 2J77A 3FYPA 4JR9L 1KV5A 1IM3A 3TYGH 1C3FA 5K2ZA 3I7QA 3ZSSA 4GRWE 4ZFZA 4AJVA 3QUZD 2XGBA 4RMQA 5K9DA 1M65A 2YGYA 1G4RA 4JZOB 3NO5A 4D6FA 2MNUA 3QUMA 3PAYA 3CMOH 4N2AA 3I75A 2BHFA 4CMMB 1M2OA 4AIOA 1EZVY 3NJMA 4RMTA 4P7LA 2IBGA 1YNLL 4GFSA 1KTKE 1JBJA 4LAZA 4Y8AA 4GQ0A 3F7PC 3EO0A 2H0FA 2BSSA 1ZP3A 1KBVA 1S5WA 1OQOA 5DJZA 4HIHB 5SV4A 2D2HA 3Q2DA 3TN5A 1DYZA 4M1CC 1PAMA 3NTYA 3EKLA 1KFGA 2BFVH 1DUYA 4YSTA 3FPYA 1H60A 3HC3L 3FOMB 1SN5A 3VNDA 2FYMA 2AXFA 1VFTA 1D5MA 4XNYL 4GKNA 1IGWA 4F7PB 2A3LA 4KY1H 3I10A 3L1OH 5PAZA 5G2WA 3IJIA 4YK4B 5DK2A 2VC9A 4LGXA 2NY6D 4PMJA 1G7IA 1E1EA 4KZCA 3NCYS 4L5ZA 2QDEA 4MAZA 5HYSB 1N8ZA 4KTDL 2QVTA 3TF7C 2Z93A 3KM1A 5CPQA 2D3JA 5JIHA 2K45A 4CU6A 4PWEA 4GUJA 1D6EA 1BM3H 5HGBA 4OTKA 1U5VA 3MYOA 1BP3B 2EXWD 2D0HA 2E6QA 3PGCA 2NNXA 5T5NG 3IGKA 1S2TA 5F7MC 5MHBA 1S38A 1XD1A 2IXVA 3WDPP 4GT0A 5TH2A 1ZS8B 5GGRA 4I48A 4FFYA 4KU1A 1WZLA 4DEWA 3RU8X 5C0GA 4CN4A 2QXWA 3IRPX 2VXUL 4P3DA 1MCHA 4LPUA 3NAAH 4H2AA 4A6GA 4O2EA 4QXGL 2P50A 3G6DH 4A66A 1U91A 4Q8NA 5AVNA 1DFBH 2NY3C 4PY7A 3H12A 1QABA 3U6XS 1PZSA 4TMPA 1WZMA 3DJZA 4PJHA 4FXGC 2VDKH 3N85L 2HK0A 1PF3A 5BMWA 3GBML 3RWDB 3IJYA 2J7HA 3WIHA 4N9GB 1M05B 3CV5A 5J56B 1HWGB 2HTKC 1D3CA 1A5FH 1IF2A 5ESAA 4ZX4A 3AXLB 1BQHG 4UANA 2J75A 5CUSH 1Q0YL 3G9AB 2NUWA 3OAYH 3X11A 4GW1A 3KP0A 7ENLA 3CDGA 4JG1L 2HG0A 3ZGIA 3ZQWA 5MKGA 1OAZH 3MUHL 1QTWA 3OLDA 3MO4A 1AOZA 4Y5VB 5IEHA 5GS3A 1RUKL 4IIEA 1I1CA 4PS4L 1LQ0A 3NVDA 3STEA 4RX0A 4WSKA 5EO1B 2ZSVA 1F6YA 5HGDB 3VXOB 4Z7IA 3C75A 3TXVA 3V5OA 4WV1C 4AENB 3GTXA 1H5BC 5DQJA 4DJDC 3V4PB 5LGXA 3SN0A 4G59C 5M2FX 3G1RA 2XSKA 4Z7QF 3V7MA 1E6ZA 3FTYA 4MJ6A 3QEQB 4HZMA 1NUFA 1QACA 1R5IA 1WFOA 1EB3A 1KBGH 2A6KB 5D8WA 3NSYA 4YHNA 1ZE3C 3EO1A 4NM8L 4FABH 2HT3D 2DQFA 3NOYA 3VYNA 4NRYA 5EZLA 4N6RB 4OT7A 3GBDA 4P5TB 1Z3NA 4R4NC 3H3PH 1XBYA 2YMOA 3BARA 4C8XA 3JS3A 1YE4A 4O19A 2C16A 2JIWA 1USZA 4JQIL 2BP5M 5E2JA 4MKSA 4NGHL 3Q8FA 2VWEC 2XSBA 3TXAA 1JZ8A 3MA9L 2X1OA 2YAOA 4WVRA 3BDKA 1R5VA 2NUPB 3I9PA 3B97A 4A3YA 3LZQA 3P0VH 2VURA 3OR6A 4RGOH 5F8QC 4OLZH 1YPFA 1MQ8A 1YUHB 4S39A 3VMPA 5GIRA 3CFEB 3SUTA 1JD9A 3QI9C 4NUGL 1DO6A 3U4BL 5D1ZC 1DQQB 4YSDA 3QHZH 1XYCA 3D2TA 1YZZA 5HXMA 1TUXA 1U8IA 4PJBE 1YRKA 4W70A 1U8HA 3UAJC 1PZ1A 2XHNA 5HHMB 3S48A 4BYHA 3IJEA 1A4JA 1MFDL 4UTAH 2KI6A 2FIRT 4GC3A 5FYKU 1QJWA 4KRNA 1E6OH 4M6NL 2OZNA 1GKQA 3UC0H 2FQFA 4NHCH 4L3AA 1DVYA 1KCSH 4HHAA 4TOYL 4U1JB 3CSBA 2D7PA 4RE2A 5E08L 4A55A 3LKRB 2VAAB 4QG9A 3HE7D 4PJGB 1CCZA 3ELAT 4HAGA 1JL8A 4W9FC 3O41A 3S88H 3G5VB 1LM1A 4TSAL 5LHFA 2GW5A 2VGGA 2VJ0A 4W9LC 2R4SH 3EBIA 3OJGA 5FJIA 2EDFA 2ZXBA 4Z3JA 5D72L 3MNVB 1NQBA 4FMKA 4ELKA 2ZRYA 3LHTA 4D0BA 1RJZB 2QW5A 4HUMB 3T8XA 2Z92B 5EPDA 4KFNA 4UTBH 3TO4C 3IS1X 2TPSA 1KR0A 5AEAA 3HRZB 4ZSOB 1YHTA 4CGTA 5I18L 1IGTB 3QYQA 2EH8H 1UZDA 1EMTH 5C55A 1U8MA 4L1BA 3BKCH 3MLSH 1X8CA 3I6RA 2R1WB 1JZJA 3UZZA 4KBXA 2NY5C 1N0LB 3D2UD 3WHE1 5AOMA 5IMKB 2ZYHA 4YDNA 3T04D 3W7OA 2LW3A 4LOUD 1RCXB 3QV9A 4GNJA 5AVVB 5EC1B 3MJ9A 3KBNA 4ISVA 4F33B 3ROLB 1H51A 2HWZL 2OMWA 1TYEB 4NPYA 3BIAX 3MLVL 2ZZ7A 3DGRA 3QAZC 2NQCA 1A0DA 1LO3L 2PW1B 4E36A 3BMWA 3ZWTA 4GMSH 2DD8L 3DSNA 3X1EA 1S2VA 2HFGL 3MGOA 2HUHA 4L2YA 2B7DT 2BVOB 3REWA 1U58A 2Q6WB 1A0EA 3CVHA 4JX4A 4S3DA 1F3RB 1P7QB 2WWCA 4M7JL 4FCHA 3O2DA 3ITVA 5B39B 2SEBB 5CC5A 2VDRB 4UZGA 4B3VA 4PCTA 2VLKA 2BS9A 3N40F 1CK0H 4APXA 4MHHI 4EQ3A 3E2VA 3MI2A 3OL2A 4YVVA 3C5SA 5K1VA 5LBSH 1O1ZA 2ZCHL 4K5LA 3L4WA 4EI6B 4BZ2H 2G2PA 4NO3B 4X50A 4DP1X 5LIXX 5FSEC 4BHUA 4I85A 3ZVHA 1EP3A 4IRSD 3WTXA 1B0RA 1JV5B 2BHYA 5KSVB 3LJ3A 4LP8A 1E9QB 1OTUD 3EX3A 4JTFA 4OZIA 2IXQA 4HB7A 3W11D 3CFUA 1SLXA 2F54D 1R9ZA 4O9HH 4O4YL 2VB5A 4YDJA 4WWKC 1QFWM 1A5SA 2ZICA 2HMIC 4NIKB 3GSNA 1W6WA 4FA3A 1HKJA 1GTNA 2Y3AA 4UBDC 1UQZA 3VFWB 2X2UA 3NFSL 1F2QA 1PIGA 2WQ8A 1L5GA 4KUCD 3CLEH 3GQFA 4GXVH 4X5WB 1YEJH 2OEJA 1V8EA 1P5VB 1H8NA 3ZDYE 4YSEA 4Y4FC 4PMFA 3PDOA 2Y7NA 4L9YA 4YHKH 1CDGA 3MJ8B 2ASHA 5IVXF 2PRLA 4J12A 4EIVA 3HE6A 5AYQA 1ZPUA 1W80A 3ZKQD 2FVKA 1W31A 3AYTA 5FI8A 2H3KA 2PF8A 3LERA 2MQGA 3REQA 1F9CA 4HCRH 1IWBA 3EJTA 3S6CA 3LMJH 1NAMH 4LVBA 2WZPA 5AYBA 4HJSA 2F54E 3H7UA 3RVWD 3MUGA 4YH6A 1RXOB 2C1PB 3O3DA 4HC1L 1EH9A 1MWAH 1JSYA 4NZTL 3SDAB 4J2PA 2FLMA 3CXDH 2P1FA 3N5AA 1IZCA 5LAXB 4TMBA 4TULL 2OSWA 3FFSA 3UERA 1Q94B 1R9YA 2JCWA 5DFVD 1HOCA 3SRHA 1JZDC 4KFZC 4HXBH 3ZZ1A 4DPBX 2ADAA 4P8UA 2H1PH 4A2DA 4P5TC 3BD3A 4XPGL 3KPSD 3V8OA 5TJWK 3LH2L 1OAKH 2DU2A 4GJIA 4A3QA 4LSRL 5EEUA 2BSDA 3BAKA 4ONGL 1K7EA 5TAOA 5I9QC 4WX2A 3L4UA 3UCDA 2W62A 3CLWA 5E8OA 3R8GA 4JHWL 4XSLA 4K7YA 1I2RA 4ZTEA 2J12B 1ZV5A 4NBZB 4R4BB 4AWUA 1QEXA 3N12A 1ULVA 3MU7A 4AUBA 1OK4A 2B0SH 5I8CA 1UYWH 5DZOA 4TVCA 3KS6A 3V5KA 4Q8MA 2XN2A 1JNJA 4O17A 3N9GL 4PJDA 3HVDA 4MTVA 1K5NA 3S8FB 3LM3A 4TNWF 4ZENA 3N3TA 3QEUA 1SUHA 2WWDA 1LBLA 1T6MA 3TBYA 1JWMA 5KZCB 3CDYA 3WFEH 1LDSA 4XVTH 1E4KC 4WF7A 1DLFL 12E8L 1P4LB 1O68A 3KPSE 3ZJ8A 4XUYA 2J25A 1IGYA 3P0GB 1F07A 4UNIA 3N43B 3MCKB 1CQYA 3CHQA 3HO8A 1HHJA 1FFQA 3VSTA 4MAVA 3QR0A 4IQLA 3E0LA 3U2OA 3AUWB 3ZZQA 2IDQA 1N64L 1QVOA 4JFHD 2FZ8A 1KIPB 4R8WH 3OLEA 1JWSA 2D8KA 4GXPA 4M1DL 4YPJA 1ITUA 5AVHA 3TQKA 2GFBB 1XLKA 3BXWA 3WLSA 3G18A 1RK0A 2PWEA 4KKAD 1WAAF 1QBML 3VD4A 3OZKA 4PU2A 4ZNCD 2HVJB 2I9TB 1VYPX 2IFFH 1ZS2A 1OCZB 2WKOA 3G3LA 4J4PC 4RXFA 3BPLB 3SPHA 2ICWB 4MLSA 1V5XA 2VLRA 3I9IA 4UWMA 2OODA 5D5MB 4O1DA 3KW8A 5IKCA 4LUIA 2WOYA 2X4NA 1BRLA 3AITA 1VLXA 3VTTA 3BSHA 1FFOB 3WJZA 4HETA 3LTVA 3QG7H 4JFEE 3THQA 4AOFA 1WCBA 4XMUA 3GRWL 3W7CA 1FOBA 1JZ4A 4YCPA 2E6AA 3I7RA 1NCBH 5IW1B 4LVGA 1JZ2A 2YZ8A 3OQ3B 4NWUH 3LQAL 4JDZA 3PTQA 2G75B 4AQEA 5ESVA 1LYQA 2Y5EA 3FO9A 3H3BC 4KRTA 4K5NA 2GGHA 4MLIA 1OSYA 5F71A 3W85A 1KB3A 3O9WA 1FNFA 4AHQA 5D7LA 1PTZA 2UY6A 4JFHE 1SF3A 1XD0A 2QR6A 3FB5A 4K8RL 5AYUH 5EU4B 3C60D 2CKBL 4F0KA 3T0CA 3SCUA 3PL6D 1N59B 4JANA 4QBXA 1FYTB 3TIDA 1FI8C 3VGGA 2WYSA 3CWGA 4HK6A 1XRVA 5EIIB 3RDTA 3GDTA 3SPVA 4O0ZA 4PIBA 5DVOA 2X0VA 4ABVA 2DN7A 2ZFAA 4WZHA 2E6DA 5F7UA 3ZTDC 1TJ1A 2GDQA 1L0XA 2FUQA 3P11H 2BX5A 5HHPA 1XLAA 5DJ8A 2BGQA 4AH2A 4ML9A 3LNFA 3V5DB 1EBGA 1UM6H 25C8H 4N0YL 3RVUD 1V0KA 5H35A 4BD4A 3FB6B 2NYZA 4OI7A 1IBYA 1KDJA 1CDHA 1KGCD 4M43L 2ZRUA 1F6KA 5IEKB 3GFUA 3SODB 3AG3B 5BQ7B 5CGYC 5BNKA 5CLYA 1EYEA 3THDA 2X6VA 4NT6A 1PG7H 3VI2A 3QEGH 5HHQA 4LEXL 4F2MB 5HYJA 5CEYB 3HG0A 3L2NA 3QDJE 2DI9A 5FFLA 1J93A 3MLZL 4I77H 1S6NA 3LSOA 2NY7H 2WUCL 5CCKL 3QHFH 3DX3A 2DIKA 5I15L 4QCIA 5EBLB 2GSGB 3MV7A 4XX6A 3ZLGA 4FQHB 1E3XA 5AHEA 2D9QB 3VSUA 9XIMA 3BE1L 1DXFA 3IPWA 1FN4A 2IAMD 4YHLL 5LN4A 3CHVA 3T0ED 1Z3GL 1QI3A 1CUOA 1ZRUA 4FALA 3VD1A 4AYFB 5AC7A 2HSAA 2W9LA 4JN1H 3MS8A 5AVYB 3KL0A 4PWKA 4QXVA 1N2RA 2Q76A 1NQ6A 1EK3A 3GUFA 1I0DA 4ZT1A 3NJIA 4DWSA 2XWZA 3ZE0F 4S0SD 1N5AA 3IRZA 3SFKA 1YMMD 3P4LA 5FW7A 1H41A 2AK1H 2WSRA 4NQCB 2BVDA 4X6FA 1TX0A 3QQ9D 1XLLA 3M45A 2Z91B 1EFXA 3SE6A 4AEHL 3FO0L 1Z5HA 1H8LA 1DJQA 3U9PL 5HYSG 2OOGA 4HDIA 2CALA 3CL7A 5ABFA 1CI3M 4KKCD 2H8XA 2J8UA 2Y5QA 1R3JB 3QYCA 1T4WA 1HAUA 3T78A 2XNAB 2N1TE 2BOCB 2FK9A 1R2SA 3ISYA 1XIFA 3K1GA 4PHZA 4ROQA 3T0EE 1FRBA 2Y7EA 4WI7A 1XGPA 2UX7A 2XU2A 4Y16B 1JN6A 1WVZA 2C3XA 5DDHA 2YOCA 1SO3A 3R94A 2A83A 2GQAA 5K5YA 4Z7UA 1LLOA 5KSWA 3Q3GB 5GGUB 2R7EB 1YMME 4OFQA 3IS0X 3SE9H 3LTYA 2BJML 4HALA 4KJYB 3PBVA 1BPVA 1MO0A 4BF5A 3H9SD 4W9JC 3DV6A 1B9BA 3BZGA 4M4RA 1JGDA 1LQBC 2KDGA 1EEZB 3O6MH 4KRPB 4YTUA 1KCKA 1W8OA 4UNVA 1SR9A 1XAKA 1NFIB 2BXYA 3LQLA 4EOUA 4MVAA 4ZXBD 3RBGA 4XVJH 4Y4KA 4ZUTB 1XTMA 3WFBH 3HHMA 2GEEA 5DR5H 2V5BA 3CWHA 5BMFH 1DDHA 4AGMA 5I16B 2UWEA 1GJPA 3O2VL 1YVLA 4GKSA 4C1NB 4PRPD 5FKYA 4NAMA 3QIBD 1GONA 2BVUA 3C0SA 5IUSA 4FFWD 5I6KA 5G4HC 3KRUA 2IOOA 4BK5C 3EJPA 3PYCA 4GJJA 1C5BH 4MCYA 1NA8A 4X6EA 4W6YB 1UFGA 2AQ3A 3SY8A 4OIAA 4UXDA 1Q3NA 4PJFE 3N18A 3BH9A 4BCZA 1MCLA 3TVMA 1BZQK 2ZPKL 4TUJA 2H45A 4YXHH 3KL5A 2YDQA 1TTRA 3NSNA 5C9XA 3EBVA 5DCDA 3FTGB 1KTBA 3GJFA 3LPOA 2XVGA 3OXRB 4RWYL 5CJQL 3TM6A 3SGJC 3WGVB 3D85D 3MV9D 3KMDA 4IZGA 3TO2B 2BRQA 3BPLC 1MJ7H 4PTMA 2DT3A 2UY7A 3ARED 4CD7A 4HXAH 4CC4C 3H42H 3CIAA 3VWKD 5I06A 4RDBA 3Q2NA 5CG7A 4MVBD 1Q7MA 3GH7A 3WSUA 4G1NA 3GYCA 1G6RA 1XINA 4P61A 4R4FH 1FSKC 2FEEL 1EX5A 4UQ2B 2PF0A 4P23A 3EYSL 1FH5H 1HIML 5ACLA 5GJPA 5AAMA 3W00A 4H41A 3VFNB 3WF2A 3COOA 4P5MB 1W2PA 3HOGA 2A74A 2GTWB 3IM1A 3SQSA 3G5WA 4GX8A 3L3IA 5CHNA 3NA9L 3IXTB 4A22A 3GGWB 1SDDA 5JXEC 4PJ5B 4IRJB 4FJZA 1N4XH 2XVLA 2IDUA 2NVCA 4PBEA 1TA3B 1YDYA 4GBXB 5IG7B 2CUHA 5F1IA 1W1VA 3NFUA 1OFRA 3MV9E 4Q0XH 4GQ9H 5KN5B 4PJ6A 2FDSA 2ZG1A 2EVFA 1SLWA 1RUQH 2OAAA 1WS8A 5KVDH 2V5DA 3F2BA 1FFNA 2W38A 4QM1A 3IJHB 1A6AA 1O6IA 3HI6L 1J0JA 1DTNA 1IGML 5AHLA 2VITB 4ZDHA 3IV8A 5I0VA 1FHUA 3D30A 4K73A 4XN1A 1IB5A 2FJSA 1KYOK 5LYRA 4OLXL 2VC2H 3VSQA 4RLDA 3HHRB 4BR1A 3WAKA 1PHWA 4MS8D 5IV2B 4AYGA 3FU9A 5DMIH 5I00A 4LEOA 3TBVA 4DO6A 4LF3A 3ASNB 2NY2B 3PNRB 3WIIH 3BAEL 1GVQA 4GXUM 4OJFH 3BG3A 2EUVA 2E76C 3ZR6A 5CPTA 1S5HA 1RJYB 3GU2A 4YUEH 3RM8A 3RVTD 2B15A 5EDXA 2YDAA 2ZRXA 2X10A 5EWIL 1EZLA 2CO3A 4LL1A 1RAKA 5KSBA 2NY0B 3MRPB 4DLMA 3KDOA 2H90A 5E1QA 3B43A 5CJNA 4PWJA 1NSJA 5J4MA 5KVDE 3K46A 1MFEH 1UD6A 3OAZH 1RPQA 3OD3A 4JFPB 2DSZA 2NX1A 3SZKC 5E09A 2BHZA 4PG9B 4ZOBA 1BLNB 5TDOA 4GK8A 2TYSA 2W0PA 1U3JA 3VFGL 4GX9A 2WN2A 2O4MA 4KO9A 2B1AH 3AZTA 3FQNA 5BRZB 4C65A 1N6UA 1O0VA 1S7VB 4GC4A 2LLLA 4QTIL 2ZA2A 3W7KA 3CZFA 1I7UB 3L6FB 2VZSA 4CJ0A 4C6JA 3QFJA 4OZGE 4WHYG 2OLSA 4LLAA 3QC0A 5F1OB 2WXHA 2CO2A 4GY0A 4GGBA 1A3QA 1QPKA 5B39G 2CLEA 4YWGH 1W37A 3SDXE 1O6VA 1BF2A 2XZ9A 1AGFA 2VR5A 2OM5A 2UZPA 2ISSA 5E7FA 2VR9A 2HJKB 3KWWA 3WFHA 4U28A 4BFFA 1TE1A 2Z27A 4HPOL 3S4TA 5EBMA 1HVXA 5C07A 1X39A 1FWSA 2V7NB 4HISA 4HLZH 2I5IA 4JY4A 4N2GA 3NO3A 1N7ML 1KCUH 3QW9A 3W0WD 4HZ6A 3OMAB 1UKQA 2IO5A 3B2MA 1RY0A 1QXLA 4JRXB 2AQTA 3M17B 1V6UA 4PTUA 3AIRA 2E86A 3IVKA 3REVA 3L7EB 1YEYA 2YCEA 4HIIB 5TGBA 3GSUB 4O15A 3PFMA 4I7UA 1KM6A 4MMWA 1DJZA 1KJ2B 3BW9A 2MTAA 3H6OA 1X7IA 4KK5C 2VR7A 1S7TA 4BH8A 5I26A 4JBRA 1DVUA 4HN4A 2DH2A 1EDGA 1SJHA 1CR9H 3P54A 4KRPC 3QORA 2ZVIA 4YQXL 2ZA3A 1JI1A 1EAJA 3FMGH 4QR7A 3CVBA 3QDGA 1NC2B 1AC6A 1GYWA 2A2QT 4UM8B 3OM3B 1E8WA 4LCVA 4I3RH 2F5AH 1FYHB 3W0WE 1X3DA 4Q4EA 4IK6A 5CIPA 4FZIA 2WANA 1ZLEA 4FNQA 4GRWB 4Y4HD 1RULL 3DFQA 1I1RA 2GQHA 4HOWA 1GH7A 3U1PA 3TMQA 3NIFF 3MRHB 2JKNA 4YYCA 1BBDL 4QYOB 3D3VA 4IFKA 5EUKA 3CIVA 4QRFA 4F7CA 1UZ6E 5F7EH 2VO5A 1D2KA 1PKQA 4C54A 2EDWA 1I1YA 2EPOA 2QHLA 4XN2A 4LOEA 2JQZA 1H5VA 2G8ZA 2QSTA 3QO1A 2VX7A 3CSTA 4DF1A 1F7BA 4MDIA 1KXTB 4EJ1C 2XA8H 3IB4A 5EUOB 2CPUA 3T6ZA 4I3SL 3ARBA 3FFCD 3QW4B 1R2TA 1MYRA 1AFVL 4GWEA 4FTVD 1KENH 3DOSA 4HUXA 5FA3B 3H85A 1YN6B 4O00A 3OKOB 4TO8A 4AM0B 1RIUL 4IPJA 4KDWA 3OTRA 3ARGD 4ZD3H 2Q3OA 4QXWA 4H9TA 2H9GA 4JUSA 3RGVA 1VFHA 3T1WA 1XW8A 4FOJA 2EXYC 1W9BM 4G82A 4LPWA 4FFVC 3AU2A 1PSCA 3QUZB 4JGUA 1KC5L 2Z31D 1OAUH 2NY3B 1JRHI 3N1GC 1TWWA 4LF2A 4LPCA 3PWGA 5GGSA 4LLYB 3TF4A 4D2NA 2PEVA 3QUXD 1XFBA 2G2RB 5EZJA 1IFHH 4IRJC 3Q65A 4W89A 2WZIA 4L4PA 1W5MA 2ROYA 1HT6A 3INUH 1HXMB 4O54A 3PTMA 2PYED 4GBXC 1WQVT 3P2TA 2BY2A 5KYYA 3WKNA 4O14A 2I27N 1CE1H 4X7SH 4JNMA 4HF5L 4ADUA 4OCSH 2HZGA 3FFCE 3TYEA 4AK1A 3G5XA 4FTVE 1UB5B 1T6VN 3KW7A 3F7YA 5AW6B 3AS0A 2D2CC 2FECI 1EA0A 1HKLL 2E0PA 5FEXA 3OZ9H 3QDMA 4XZBA 3QCTL 4KKBC 3EJUA 4K8EA 4Y9CA 4MGGA 3SCRA 5JDSA 4RR4A 1YAZA 1FFPA 2H2PD 2Q2LA 1RJRA 2F84A 1S9XB 1J9QA 4UZSA 5EULV 2IALB 2WLYA 4WV1B 3QLLA 1YY9D 2IPKA 4AZCA 4WKHA 1H5BB 3GHTA 1L3WA 4OIIH 2DWEA 1KY6A 5CSRA 1G4MA 1U8QA 3W7RA 5D2WA 4JQ3A 1C8YA 3WDJA 4NKDA 5FO7A 1MAML 3JR2A 4UMSA 4GG6E 1REQB 2MNRA 1XDJA 3DROA 1MCNA 3CU1A 2FD6L 5A6BA 4NG3A 3B3IB 4F8XA 2A3BA 2PYEE 1K3ZA 5AW8B 3GMPB 2X1WL 3R25A 4NO0D 1CGVA 3ZDWA 5FF0A 4UDTB 2W88A 3BICA 1H11A 3PHQA 4BS0A 4PB0H 3K1KC 2P80A 4V1DD 1MDLA 4MQXC 4OFPA 4F2BA 3NIDE 1M5WA 2HQAA 2W60B 3B9AA 4K71C 2Z7KA 2I14A 1UD5A 4JY9A 1JZHA 4Q4PA 4HAFA 2QF8A 3MC0A 2EKJA 2LE9A 4X9BA 1YTEA 4U5IA 2EEAA 4Z5RB 3QI9B 2O7SA 4BSWA 5D1ZB 3A5FA 2AEWA 2BOEX 1V08A 5HANA 3RPKA 3HW7A 1FL5B 2INFA 3S6TA 5EIIG 1Q9OA 3SDYH 1K4CA 1MI5D 1KWGA 3NEXA 2ZADA 3M4HA 4AYEC 5I1HH 2F8XC 2Y2WA 5ID1B 4PR5B 3H2WA 1XLEA 1HZKA 4YEFA 1JZ6A 3C6SA 3VXPA 2CO7A 3KZ8A 4QO1A 4NC1E 2WQXA 3R79A 3I74A 4A8LA 5JHDA 2V2TA 2CCRA 2VJ8A 1WZAA 4V1DE 1CG9A 4YIQA 4NZ3A 5I5RA 2CBUA 4UQAA 4WRLA 3CFKB 1MJ8L 2ZOOA 4Y0GA 2QPSA 2IPFA 1GMIA 1GCYA 2PR9A 5E2WH 5IFHL 2C9PA 4JQ2A 3UAFA 2YA2A 1I9JH 3MUY1 3DSFL 3FDGA 4ODHL 4YMPA 2RGMA 4LLUA 2PABA 2CK0L 4XPHL 3S34H 2WMPB 3QTGA 3I6TA 4BHUI 5IQ9A 3VK5A 4OLWH 1MI5E 3TO4B 1SYVA 3CHPA 3T81A 4Q4KA 4DPAX 1ITCA 1OHZA 4NKMA 5GRVL 4NZ4A 3LDBC 1G1CA 2QELA 3GIZL 2VLJB 5HMDA 3GHUA 1CFBA 3H8NA 1KLUA 1MFCL 4F37F 4JMXA 3G1SA 2UZIL 3HPJB 4P2YA 4G8GA 2NX9A 2W59A 3GNXA 2Z1SA 4URKA 3LGDA 4HFUL 5I30L 4N1CA 1NEUA 1XLHA 4HSNA 4G9FD 3PNWB 5E00A 1BWVA 2Z2AA 3RO8A 4G6ML 4PGEB 1IKFL 5I6NA 3QAZB 1VD6A 4W87A 1K8DB 1AA1B 3AUOA 4KX8A 5KYXB 1L9PA 4XCCL 3GG0A 1BQHA 4QAIA 2X05A 5E8DL 4FFZL 1I1AD 5C0BA 4G8FA 3PV6A 3MRMB 2NCEA 3X3FH 4XX1G 5DCBA 2FGWL 4OCXL 4P49A 5H91A 3W3BA 3UTTA 3BZJA 3HE7B 3CFCH 3N43F 2DW7A 2GBAA 2ZUXA 4FLRA 1MEXH 3MMWA 4GQGA 4K5OA 4OF5A 4U6YA 3ZUCA 3UTOA 4HBQA 1NC4B 3DX8A 3X3GL 4PW4A 3J27A 1Q6RA 3O6KH 4O5LL 4N0FB 2VCAA 4IWWA 3S3PA 4YDVB 4WDUA 2WINB 2I60H 3PABB 4TTDD 1XF4B 4GG9A 4WKXA 1HK6A 2YBUA 4NZ1A 4NN7B 5ICYA 4H26B 1T0PB 3GXTA 4G9FE 3N2MA 2NV1A 4MA1B 4BFBD 3HMWH 3V4UL 3CN3A 1I2PA 5D5MF 3D25A 4I7ZC 4OVVA 1S7UB 3VKJA 1LROA 2P8LA 3F1QA 4AEFA 1KCRH 1KPRA 4WWKB 1KXQA 1KJMB 3QUZC 4S10A 2TAAA 4NCDA 4YVPA 1AK5A 5D7JA 4NQED 2C9VA 4KJQD 4N90D 3AADB 5B38A 2OMBA 3LZNA 3EPNA 2HFEB 2FEJA 4PD4K 2IBZY 1YDNA 5IVNA 1R75A 1GGBH 4Y4FB 3RJXA 1I8UA 4LF1A 1E7UA 3UG4A 2MNJB 1EZVX 4OZHE 1YW1A 4HYWA 1OVZA 3SY6A 3KZPA 1UP3A 3URQA 4EKJA 4UT7H 2E4TA 3ZT6A 5IVXA 1ZWIA 3O3AB 2IDSA 3NTCH 1ZT7A 1MLBB 4FQQB 1S1RA 4GOAA 3A9BA 2P4AB 1E4HA 2K78A 1MVUB 3P81A 1YEFL 5ICXB 3CXHK 2IUZA 4S3CA 3DUGA 4W9GC 4OAWB 1IRAY 4CD6A 1XTLA 3CN2A 2NY6C 3JTSB 4YN5A 1XYAA 5AZ2L 4EI5D 2PUQT 1GEHA 5E8NA 1G9ML 4QRPD 5GQBA 4NQEE 1U21A 2ANUA 4N90E 1TX2A 3T42A 3P67A 4U3XA 3H7LA 3HMXA 2EXWC 5DRWA 3LEPA 3PE9A 2PR4H 4XVSL 4ML4A 4PSRA 5CCZA 4D72A 3LKQB 1S3KL 3BUTA 4I6VA 2P7TA 4M6OH 2X7WA 2H3XC 2A3HA 1HN1A 3HGOA 4IRSB 3VIKA 2X3CA 3ZRFC 3M88A 4L2LA 3EJYD 1TQBC 3CFTA 3C86A 5LSMA 4DCQB 2L0DA 4AXKA 4YC2C 2BSTA 2F54B 3OPSA 1S4IA 5I9QB 4PTTB 4XD4A 3R06B 1JRCA 4LCCB 3D52A 3KHDA 1CIDA 5GRXG 1XBDA 2R2HB 1DO5A 1KM2A 1ECYA 4M6AA 2E40A 1IE4A 2C34A 2BIMA 5HVGB