1MWOA

Crystal structure analysis of the hyperthermostable pyrocoocus woesei alpha-amylase
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
434
structure length
434
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
total genus 158
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mwoA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mwoA01
1UWTA 3ALFA 4P7NA 1GQKA 3O6AA 2CBJA 1CBGA 2G3JA 4PTXA 2JIWA 5E0FA 4QDMA 3TP4A 3OG2A 3RO8A 3AS2A 1SMDA 1UKOA 3GYCA 1CXKA 1QVBA 5BWFA 3N9KA 4A4AA 2VNCA 8A3HA 5JIWA 4JZ5A 1KBKA 4J7RA 3ZQ9A 3ARTA 1I1XA 3ARYA 5GNXA 5JUVA 3VTRA 4M1RA 4D1JA 4M80A 4FK9A 3T2QA 1NQ6A 4FLOA 1U2YA 4UFJA 1JZ5A 1TUXA 3DHUA 4N42A 4B16A 1G01A 2XWDA 1EHNA 3LRMA 5A6BD 1M7XA 3OA5A 5A6KA 2YDSA 4W86A 1F4AA 4AZHA 2EAEA 3EDDA 4DUXA 4KWUA 3L2LA 1GOWA 1C8YA 2YLAA 1FH9A 1VB9A 4NF7A 3N18A 1O7DC 3LPFA 3POCA 5IHSA 1JZ4A 4CD7A 1DWHM 1GNXA 5D9NA 3WH9A 1R75A 2ZWYA 3UETA 4FMVA 4D6DA 1LJYA 2WVSA 3KLLA 1MQPA 1ECEA 3CZ8A 1ZS2A 2NT1A 3W29A 1W1VA 4PBGA 1JZ2A 3GM8A 4OJYA 1W3KA 3K4AA 3B8SA 5A6BA 2XVPA 1JNEA 4JFWA 3W81A 2ZICA 3DYPA 1JZ7A 4YPJA 3EYPA 5HBFA 3AIQA 2ZWZA 3VIGA 4AC1X 2WANA 3WBEA 4KRTA 1XH1A 1CYGA 1UR1A 5CSYA 3L4VA 4F9JA 3CV5A 3ARWA 5ABHA 4AD0A 5AYIA 2VX4A 3GZAA 4TX8A 3VDBA 2XG9A 3BMWA 1US2A 3NYDA 1HJXA 1V3MA 2BXZA 4NRSA 4OBSA 2DT1A 1HJQA 3VGGA 1U30A 3BC9A 5HXMA 2X1IA 1LWHA 4KH2A 1ZU8A 4AIUA 3EJSA 3ZSSA 3EJRA 4HMDA 2QPUA 1BVZA 1JI2A 1LG1A 2DIJA 1PPIA 1IZJA 2F61A 1J0HA 3I3DA 2J62A 4MTVA 1T0OA 3BVXA 3VIFA 1VIWA 4GO9A 2O9PA 3CZJA 4YHEA 4AYGA 2VRJA 2G4FA 3SCWA 1TCMA 4KMQA 2X2JA 1XSKA 2VC9A 4HZ6A 4ZENA 3FHQA 4CVUA 3BSGA 3AHVA 3VMOA 2IXUA 2DSWA 3VVGA 3K1DA 1OT1A 5D9PA 2CNCA 2XFRA 5A6SA 1VEMA 1HL8A 1DEDA 1HKIA 3LMYA 4V2XA 1GQIA 4K68A 3W6MA 1XSIA 3M07A 1DWAM 3ZO9A 3FY1A 3UCQA 2YL8A 4RE3A 2Z1KA 4JKKA 2EADA 1MFVA 1PX3A 5JBEA 5CJ5A 1C90A 2XUCA 3THDA 4V27A 4QCFA 2CHOA 1BGAA 3WFLA 5I2UA 3WD1A 4JIEA 4WSKA 4W85A 2JF6A 3VO0A 1KQZA 3VKKA 1JDCA 4W7UA 3TONA 2W92A 1W1PA 1CGUA 1TZ7A 4HOZA 2AMGA 2EBNA 1W3LA 5IHRA 4JCLA 1E6ZA 5CZKA 1U33A 2CHNA 5DT5A 3B9EA 3WDRA 1E6PA 1TQSA 4PYSA 5DEZA 4GQQA 4EK7A 3U5UA 4NI3A 2J77A 2F7QA 1BAGA 1GW1A 3A6OA 3CZNA 1J01A 1E6RA 4TX6A 1CGVA 3A21A 4AEFA 3SCOA 3RDKA 2PWDA 1JNDA 2WXDM 2WB5A 3VDHA 3D4YA 4OOZA 5A6JA 3TTYA 1J9YA 1A3HA 4A3HA 3N11A 1CXEA 1CLXA 3PZMA 3AZTA 2YIHA 4UZUA 2UY5A 3MMWA 3DDFA 3MSGA 1AMYA 2J7EA 2F7OA 3CHFA 2WAGA 2WMJA 2XN1A 1E9LA 1HVXA 3ALGA 4LYPA 3WQWA 3W0KA 3VPLA 4D6JA 3AIBA 4W8LA 2BFGA 3GXPA 3WNKA 1QI4A 4JL2A 2PWHA 1TVNA 4OIFA 1LL6A 4Z2KA 3ZMRA 1SZNA 1W2PA 2D0GA 1J0KA 4FF5A 4AZ7A 1PX8A 5D8ZA 1JZ3A 4CN1A 3KL5A 4UR9A 4DWSC 5TD4A 5I79A 1H3GA 2Q8XA 4Z2JA 2WVUA 1NP2A 3CZGA 1KR1A 1UR0A 1V02A 1DWFM 2ALWA 2OWWA 4LYQA 1E43A 2OLHA 3CMJA 2YFNA 4UQBA 1KXHA 2VMFA 4WIWA 4DWSB 4AIEA 2J7BA 1LQ0A 3DX3A 4ZXLA 3VSTA 1V3HA 3K8LA 4XUYA 3PHAA 1JYNA 1F4HA 2J47A 5BRQA 5CLTA 1UKQA 3AYSA 4HPGA 3AMKA 1EIBA 2D3LA 3ARPA 3S5ZA 1QPKA 4EAMA 3WDPP 1UWSA 2FGLA 2EXOA 2VX6A 4P8WA 1UYQA 2CBUA 1AQHA 2ZXQA 2YL9A 3KE0A 3VIPA 3WDQA 1NOFA 1UG6A 3QHOA 4PMRA 4ZE4A 1PBGA 3HU7A 4F9DA 1H5VA 2VCCA 5ABFA 3TOPA 4NXKA 2J8GA 1M01A 4D6CA 1MQQA 4MB5A 3AI0A 3WH7A 2CITA 2XM2A 1CGXA 1VFMA 1RD6A 1UD2A 3VD5A 4CD6A 1ITXA 1ODZA 1WKYA 1GCYA 4Y7EA 2VJXA 1H09A 4GZEA 4BS0A 1KTCA 1OSEA 4ZEPA 2HVMA 3A22A 1ISWA 3WD2A 3U7BA 1KCLA 3ZJ6A 2V3GA 1GHRA 3GH7A 1W9PA 3WD4A 1QX1A 5AYBA 1MW2A 4AMXA 3VX1A 2DSZA 3NIYA 4JHOA 1GPFA 2C0HA 2G8ZA 3SCSA 4GXPA 3DX0A 4QCEA 4PMZA 3VGBA 7TAAA 4MNMA 3SCQA 1NM9A 5EFDA 5E09A 4PMOA 3T2PA 2YFOA 3WNLA 4EE9A 4QLJA 3AZRA 1Y7VA 1TR1A 5C70A 3JUGA 3VGFA 5CGMA 3WQ6A 3WD3A 3SEPA 1CGTA 5LA0A 5CPQA 3SCVA 3RMEA 3EDJA 2E9LA 4UNIA 2J74A 2VO5A 2OWCA 2YJQA 4F66A 3RM4A 1UD8A 1UD4A 1G94A 3CZKA 4OKDA 3QR3A 1WZAA 1J0JA 3GDBA 1ITCA 2ZUNA 4P7RA 5FCZA 4ACZA 3VD7A 2ZX9A 1G1YA 1BFNA 3HG2A 2VUYA 2ZXDA 1E6SM 3PN8A 4M82A 2Y8KA 2EPLX 3BAXA 3SCRA 1TE1A 1K9FA 5FL1A 1W1TA 1AVAA 3MSDA 4HTYA 3AS3A 1MFUA 3HG4A 3VSVA 4AWEA 1QWNA 4B3KA 2YA0A 1JF5A 4Q7NA 1XHGA 4UQ9A 4OZOA 5GNYA 1HKKA 3ZM8A 2X0HA 1M03A 1JG9A 4HU8A 6TAAA 3EMCA 1MWOA 4RE4A 3PZGA 1R87A 3ARQA 5AC5A 2IXVA 4ATWA 4J3XA 1GORA 2O92A 2BY1A 4GPNA 2BXYA 1KB3A 3VD4A 2WNWA 1CNVA 2PC8A 1R47A 4HA4A 5A8MA 3WL0A 2VZTA 4PMQA 2WCSA 4AEEA 3VNZA 2YDRA 1EO7A 1JIBA 3OGSA 2RGMA 2CIPA 4N0RA 1L8NA 5A8PA 2YA2A 3WF2A 1B0IA 4JFSA 2F8QA 4B9YA 3W28A 1KTBA 1UR4A 5I5RA 2W91A 5D9MA 1UA3A 2OW7A 3GH4A 3WMCA 3BAWA 3RCNA 1VBRA 2J7GA 5HNNA 1TQWA 4CD4A 1M53A 2WSPA 2AAAA 3S6TA 1GOMA 2MANA 4AD1A 4CCEA 5E0CA 4UOZA 1HP5A 4ACZB 3MMUA 1WAWA 3H53A 2CKRA 4GINA 3GXDA 3AMDA 2PWGA 2E9MA 4E4PA 4D6HA 3EBVA 1B9ZA 2C7FA 3A47A 4KGLA 3VUPA 3W53A 3T08A 4P7OA 2YKKA 1FH8A 4DUVA 1WCGA 1CPUA 4AZCA 3WH6A 5E6ZA 3AMCA 1UKSA 3A23A 3VNYA 1VFUA 2WPGA 3K4DA 2Y24A 1ISVA 5JBFA 3D51A 1WPCA 4C7GA 4P8VA 3OZOA 1HVQA 3KEHA 1RP9A 1W1YA 2QPSA 2JEQA 1R46A 3WDHA 2F2HA 1CGWA 3IJ7A 3WMBA 4PCSA 1JFXA 3L4ZA 1EOMA 1V6UA 1GZJA 2JEPA 8CGTA 1N82A 2CETA 4MAVA 4UFIA 3THCA 4HMEA 1GVIA 3J7HA 4J3VA 1PX4A 1QI0A 2F7PA 3EDKA 5AY7A 3S5YA 3PZUA 3SCTA 2D23A 1V0KA 3BLKA 5KZ6A 1JDDA 5DO8A 4GKLA 2PWEA 3I3BA 2CPUA 5A6LA 5M3WA 3T0BA 5A6MA 4HA3A 3F5KA 1HKMA 5D9OA 3VIHA 1V0LA 3SUWA 1XYFA 4NRRA 5BYWA 1H4PA 1XD1A 4CD5A 3A5VA 1KWKA 2J7FA 4U3AA 5DT7A 2OYLA 1SFSA 3FAWA 4U5IA 1LLOA 3DDGA 3BMVA 2E3ZA 3FN9A 1JXKA 4FNSA 4TVCA 4S3KA 2UY4A 3MKKA 2QLYA 4D71A 1PAMA 3M46A 3VILA 1FHLA 3ZJ7A 4GI9A 4WKFA 1MYRA 5D4YA 1FOBA 2J7CA 1V02E 4RE2A 3BAJA 4QAWA 2WWCA 1K9EA 2ZX5A 3WH5A 3OIHA 3UG5A 4J27A 3PZQA 2WHMA 3VIIA 4W5UA 4IPNB 1E0WA 1J10A 1E73M 2G3MA 3ARVA 3W26A 7CGTA 4D6EA 3ARSA 2DSUA 1X6LA 1UR8A 1UZ1A 2C8NA 1W9DM 3VDCA 4PMXA 5I78A 4JHZA 1EOKA 1UZ4A 3BUQA 3BVVA 1R85A 2ZUMA 3IAPA 1JDAA 2O9OA 3WY4A 2D20A 1JZ6A 3CHCA 2EEXA 3LRLA 6CGTA 3ARUA 2EACA 2ZUUA 1H2JA 4QLKA 2VR4A 2ZIDA 3ZR5A 2FHBA 3G6LA 1LG2A 1UASA 1W32A 3LXBA 1H0GA 4W89A 1B3YA 4M56A 3PZOA 4MAZA 2GJXA 3GBDA 2WVTA 2F7RA 2XVLA 4M24A 3MI6A 2XIIA 1VRXA 2AOSA 1S46A 3EJPA 2FYVA 3U7VA 4C7DA 2ZUVA 3WDJA 3MANA 2FH6A 4CGTA 3CMGA 2DGAA 1OIMA 2DQXA 5IXEA 2D0FA 2GUYA 4AIOA 1E4MM 1Q6DA 4E8DA 3TTQA 4L4PA 1NWRA 3SUVA 3BCFA 3UESA 3O9NA 2OSYA 4D6FA 4ML4A 2E8YA 1OCQA 1UH2A 3SIMA 1E3ZA 4PMYA 5CQ1A 1QBAA 1BVNP 2GVYA 1E70M 2VVNA 2YL5A 3MUY1 4AZIA 4BQ3A 2WVVA 1BPLB 3FW6A 1EQCA 4IPLA 3UG3A 2WLZA 5E1QA 3LX9A 2WW5A 3BUDA 4BF7A 2HISA 2VR5A 4U2ZA 3CBWA 1UWRA 3AOFA 4CCDA 2NSXA 3CUHA 4MB4A 1HT6A 1OD8A 3VM7A 2BHYA 5A3HA 1EA9C 1Q6GA 1TA3A 3SCPA 2CESA 1E55A 3BLBA 2GJXB 1BSIA 3CUFA 4TXEA 1E71M 3VIMA 1ZJBA 1KQYA 2YLLA 4IISA 4OUEA 4DO6A 1WDSA 4Q22A 1XH0A 4CU6A 1UH3A 4LX4A 3WQ5A 1QHPA 3AXHA 3L2MA 1IV8A 1WDQA 1XYZA 1UKPA 2VCBA 5GNZA 4M8UA 5A2CA 1LL4A 3W27A 1VJSA 4LGXA 4DM2A 1ISYA 3AXIA 1TMQA 4CUCA 4HOXA 3HMCA 2G41A 2DSKA 2WCAA 1HXJA 1QOXA 2XGIA 3AISA 1TQTA 1E0VA 3ZT7A 1ISZA 2J78A 2YL6A 2VI0A 1PS3A 3L4UA 1ZBKA 1HL9A 3VGDA 1KXQA 2D3NA 1NOWA 3E1F1 2EPKX 4WLCA 1E6QM 4AD4A 5A94A 2WLYA 1DHKA 4UTFA 1G9HA 1WDPA 1PIGA 3BLPX 3T2OA 2J75A 4H8UA 5I23A 4NZCA 4ZE5A 1KGWA 4WKHA 3W82A 4AZGA 5BXRA 2DT2A 5F7UA 1HXKA 1QNSA 2DT3A 2W61A 2WC7A 3OGRA 3IK2A 3BUBA 2NW0A 1KGXA 1BF2A 3W38A 1ODUA 1B3ZA 1HNYA 1MVYA 2BVTA 1RH9A 4PN2A 2G3NA 1JI1A 2ZX8A 4E2OA 3D50A 1K6AA 1FHDA 2V5DA 1B30A 4OOUA 1LL7A 1TA3B 5GQBA 5HPCA 2E9BA 3NCOA 3AQUA 1ISXA 2YA1A 2GK1A 4TOQA 1EHAA 1HKJA 2BS9A 4X0VA 4P8UA 4H04A 1GOOA 3WH8A 4GZJA 3KLKA 1EDTA 4XX6A 2WM0A 5CPTA 2J8FA 4MB1A 1B2YA 4JL1A 2CERA 3VMNA 4X9YA 2A3HA 4PMDA 1WZMA 4HOWA 4PRWA 3OLIA 4DO5A 1J18A 1NARA 4CCCA 2UY2A 2WZIA 4F79A 4JKMA 4CN6A 3EMQA 2A3EA 2JF7A 4H7VA 2WHLA 4BCEA 1HJUA 4XB3A 3VM5A 3VD3A 2BV9A 4W8BA 1XCWA 3W37A 3VMPA 3PZNA 2W67A 2XSBA 3LXAA 3M7SA 1W9BM 3GXTA 4D6GA 5CPSA 2X2HA 1MXDA 2OYMA 2Y8VA 2VRKA 1XD0A 4HMCA 1R34A 2GJPA 1D2KA 2J4GA 3VIOA 1V0NA 4BA0A 1UHVA 5I0DA 3WUFA 1VAHA 4YHGA 1W9VA 3WUEA 2CYGA 2PB1A 2ZUTA 1OM0A 3CO4A 3NDYA 3ZJ8A 1JD9A 4KGJA 1H0IA 1KXTA 1R7OA 1XH2A 2DT0A 3PTMA 1IT0A 5I6SA 1SMAA 2EJ1A 1XGZA 5AC4A 3CUIA 4FLSA 2QHAA 2YDQA 2PWFA 2WMFA 3QGVA 1J0ZA 2WC4A 2BHUA 3RILA 4X0NA 5FIPA 1JYWA 3CZLA 1UWQA 3PZVA 4AISA 1ZJAA 3WF3A 1HWWA 4P8XA 1W2VA 4E8CA 3PZ9A 2BVYA 2X09A 4H2CA 4CVWA 2VCAA 1XRVA 3A3HA 1TFVA 2FHCA 2VOTA 3OBAA 4AD5A 3UERA 5GPRA 5CSUA 5IDIA 4HZ7A 4AZ5A 5E9AA 3DECA 1UA7A 4HPHA 1J0IA 3SUTA 3WN6A 3IJ8A 2ZXAA 3OLGA 1DWJM 3CZSA 2XFFA 3DYMA 3OGVA 3AYRA 3SCUA 5A8QA 4HA1A 1H11A 5ABFB 2WHKA 3MUZ1 4JFTA 1J12A 3OZPA 1NP0A 5ABGA 1BYCA 3GXFA 3F4VA 4QFUA 4CU8A 1TG7A 3WF4A 1QHOA 2FE0A 2ESCA 1C93A 4UCFA 1EXPA 2B31A 1V3JA 2QMKA 3AIUA 4W88A 1HN1A 3WEZA 1UR9A 3OLDA 1JAEA 5ECUA 3WNOA 3AJ7A 2XIBA 1OBAA 1UOKA 1R8LA 2ZX6A 3L4XA 2QF8A 1VBUA 4TVUA 3WUBA 2WHJA 1PZ3A 2WKGA 3WSUA 4J28A 1MQRA 1VFOA 3KL0A 1V3IA 3N1AA 1V6WA 4AD3A 1QNOA 4WSJA 1JD7A 3CIVA 1ZBVA 3LPGA 1FFQA 2WSKA 1BYDA 5LA2A 1CDGA 1CXLA 2BHZA 2JE8A 4M81A 3ZT6A 3WIJA 2WMHA 4WK9A 1UQYA 2PF0A 3WBAA 1W9XA 4PSPA 4ATLA 4CN4A 4UQDA 1CECA 2IGTA 3VSUA 4AY1A 3ARZA 2XSAA 1DTUA 1VF8A 3FXYA 2WC3A 3AZSA 1CLVA 4AMWA 4MNLA 1XV8A 3HN3A 1TQUA 3CGTA 4PEEA 1WZKA 1Q6CA 5I3DA 1E4LA 3QHNA 5E6YA 3A24A 3QHMA 3BUPA 1H1NA 3D52A 2X2IA 1HJSA 3M6DA 2D24A 3A4XA 1C7SA 3QOKA 1UUQA 1E0XA 2X8RA 1I1WA 2J7DA 4ATDA 4GZIA 4MNJA 1OIFA 1GJUA 1WDRA 3D3AA 5IFPA 3UEQA 5A1AA 4F8XA 3DX2A 3WY2A 4ACYA 1KGUA 1E15A 4BQ5A 2PBOA 1MW3A 3GNRA 3PTKA 1CIUA 3WFZA 1BYBA 1EQPA 3FNDA 3MV11 1XSJA 1GONA 2VZSA 4FNRA 3N12A 3BAYA 5A8OA 4U2YA 4AYSA 4C7FA 1Z32X 3EDEA 3NDZA 3K46A 2WCGA 2E8ZA 2VZVA 4JAWA 3EDFA 1XCXA 4IUGA 3SURA 4J3TA 1HIZA 4PMUA 4WF7A 3WD0A 1RP8A 3CLWA 1X6NA 5D8WA 4AW7A 3U57A 3MS8A 3TTSA 4GI6A 3WEOA 3GXIA 1KFWA 2QV4A 1R33A 1KR0A 1JYVA 2XWEA 1GQLA 3WUGA 2FH8A 1JYXA 3VX0A 1UWIA 1X1NA 3ECQA 2X05A 2OW6A 3KL3A 2XGBA 3OB8A 2DH3A 5CGTA 1QNQA 4LYRA 2V3FA 2GFTA 1V6XA 2BY3A 1R7AA 2XVKA 4UOJA 1QW8A 2Z1SA 1CEOA 1JFHA 3DX4A 3W4RA 3S2CA 5HPOA 2WK2A 3HG5A 4CD8A 2V3EA 4PCTA 3AROA 1EH9A 3VIJA 3EMZA 1HJWA 4MPKA 4URIA 2E0PA 1DWGM 3WY3A 3O2LA 4LPCA 3WQ8A 1B90A 1PEZA 3F5JA 3D4ZA 1FFRA 4AZCB 3HZ3A 3PBGA 3VDAA 1QNRA 1QBBA 3VGEA 5DF0A 4W87A 2WKLA 5KEZA 4PUEA 4ZXOA 1NWUA 3II1A 4P7QA 1WO2A 2OYKA 1UD3A 4EKJA 4L4OA 3NJ3A 4PTMA 2XJ7A 5C8BB 1WE5A 5DFAA 4NZJA 5BROA 1OT2A 3LXCA 5E70A 4MADA 3IJ9A 1NWSA 5A2BA 3K8KA 1QNPA 4D6IA 4MNKA 3HJEA 2D22A 1GOIA 1G0CA 2XN0A 1OGSA 3PZIA 1QHZA 1UD5A 1UD6A 2DIEA 4TUFA 3WDIA 3MO4A 1GJWA 4FNQA 3MUIA 3H55A 4UFKA 3CUGA 1J11A 5LA1A 1V0MA 1ZBWA 3WKZA 3BH4A 5BRPA 4WJXA 3A4AA 2GDVA 1E5JA 3DC0A 1E6XM 1WNOA 1EDQA 3IAQA 2F18A 3WNNA 3AHXA 3RJXA 2XPKA 4FNUA 1C91A 4UFMA 3CZEA 4IM4A 1ZL1A 3VGHA 1E1FA 2DEPA 1EGZA 1A47A 2XTKA 1V6YA 2DDXA 2GDUA 1VFFA 3U5YA 3BVUA 1O6IA 4P7LA 5FL0A 1PJ9A 4JFVA 4H8HA 1V08A 2FHFA 3AIEA 1B3WA 3VIKA 1HF6A 1KBBA 1P6WA 4W84A 3L4YA 3TA9A 3B9DA 2VQTA 1E6NA 3K8MA 3RJYA 3AFBA 1EDGA 1BTCA 1E1EA 1GOKA 3BGAA 3GH5A 3GXMA 2CCRA 3G6MA 5BXTA 3GXNA 1JXJA 3ZJKA 1DWIM 1W3JA 1JZ8A 4DWSD 2VURA 1US3A 2A3AA 1W91A 1LF1A 3ZOAA 2ZXBA 2D2OA 3SCNA 2J7HA 2Y4SA 3AXXA 3AHYA 5BXSA 3SUUA 5DMYA 1WZLA 4W93A 2X0YA 4GQRA 1PIFA 2V3DA 1OD0A 4U31A 1FH7A 2X2YA 5A6AA 3PZTA 4MDOA 3UR7A 1H41A 4V28A 3I3EA 1VJZA 1D3CA 1E3XA 1ZBCA 4J3UA 2XVNA 1E72M 1Q4NX 3ZR6A 4Z2GA 2CEQA 2F1BA 1VEOA 3NSMA 3BSHA 1CXFA 3NUKA 5FOOA 2D73A 2YBUA 4XZWA 1UWUA 4HP5A 3BCDA 1BGGA 4MB3A 4AMCA 3FHAA 3UR8A 1OGGA 4DWSA 4AZBA 2IUZA 4UFLA 4B3LA 3D5HA 4H8VA 2GJRA 1UQZA 3ZT5A 3VOCA 2CBVA 3CH9A 1GQJA 3WELA 4MJ2A 1C8XA 4PUDA 3TV8A 1VEPA 2WYSA 1H49A 3IANA 3WY1A 4TTUA 2Y5EA 2VT0A 4J3SA 2A3BA 4MJ4A 5HDRA 1B3VA 1Q6FA 2JALA 3T09A 1SYTA 3MV01 4S3JA 4BQ4A 2CXGA 2D0HA 2E4TA 1WP6A 2VRQA 2W66A 4AZ6A 1V3KA 1V03A 4Z2LA 2EPNA 3GBEA 2JIEA 1K9TA 2WVVB 1WB0A 2W63A 2EPOA 2FDMA 5EBAA 1GOQA 1R86A 3WF0A 2XVGA 3WF1A 4MDPA 4GO8A 1NH6A 1BHGA 2OWXA 3IGUA 4PTVA 2NT0A 4QP0A 1JAKA 5BXPA 3VU2A 3L4TA 3WMSA 3GNOA 1G5AA 3N17A 4NZFA 1D7FA 2VL4A 2Y2WA 1C3FA 4NX0A 2O9TA 1L0PA 5A95A 5EMYA 3CHDA 3AIWA 2XFYA 3BAKA 3GTNA 3AICA 4TTGA 2E40A 1AQ0A 3UG4A 3MU7A 5A69A 1I75A 1BLIA 4BQ2A 2O9RA 3OLEA 2V38A 4U33A 1KXVA 3AMGA 2XM1A 3EJUA 3A4WA 1KCKA 1QI5A 4W8AA 4OBRA 2ZUSA 2F1AA 3CC1A 4FLQA 3BUIA 4R5EA 1EO5A 1GHSA 2DPEA 3AMLA 4Z2IA 3GNPA 3ZIZA 5HOSA 2VZUA 1CTNA 4DUWA 2RGLA 3ARRA 3RM8A 2YBTA 5M03A 1NWTA 5BCAA 3N04A 3T0AA 2WMIA 2FGZA 7A3HA 1B1YA 3QOMA 1GUVA 2WBKA 3CHEA 1OB0A 3LPOA 4U5KA 1KWGA 2W62A 3L4WA 2VX7A 1MXGA 1W9UA 4LQ1A 1TVPA 2EO7A 3KZSA 3NSXA 3KWXA 4DO4A 1HP4A 2W5FA 3AS1A 1K9DA 1CENA 1DP0A 2J79A 2ZX7A 4HU0A 3APGA 5CLWA 2DSVA 4FNPA 4W5ZA 3W6LA 4UQCA 5I77A 1C8QA 3POHA 4D72A 1PZ2A 1CWYA 2XN2A 2BY0A 2A3CA 3VINA 4A3YA 3AS0A 3AHZA 2GK1B 1C92A 4Z2HA 4WKAA 1YQ2A 2WMKA 4LXFA 2WBGA 2VVSA 3TTOA 1VENA 1XC6A 5EFFA 2WWDA 6A3HA 2UWFA 3BVTA 4AD2A 3PTQA 2ZE0A 4CU7A 5CXPA 1E40A 1HX0A 5C71A 4UQAA 2J25A 1V3LA 2PBGA 4CKQA 4QLLA 3LRKA 2EQDA 2TAAA 2WZEA 4BZYA 3CUJA 1OWQA 2JFEX 2DH2A 1ESWA 1E56A 3WENA 3FAXA 1SR0A 3H54A 2G3IA 1HJVA 1OGBA 4GI8A 1OINA 1E5NA 3MUAA 4TVDA 9CGTA 4KRUA 4B15A 2WMIB 1FP9A 2ZUWA 2WZHA 5CG0A 4GIAA 1W3HA 1JF6A 1QI3A 3RIKA 2EPMX 1QW9A 3HG3A 3N13A 4HZ8A 4AXNA 1RPKA 5FKYA 1QWUA 3AHTA 4XZBA 2GSJA 4UFHA 2BNJA 2BY2A 3SUSA 4JFUA 5ABEA 4JKLA 1FA2A 4YN5A 1UH4A 3EJTA 3VD9A 1E4IA 1QI2A 1GVYA 4JCMA 4ZFMA 1B31A 3LPPA 3WNMA 1CXHA 4FNTA 2XHYA 4U3CA 4NSBA 1CXIA 2WMGA 3WL1A 2EABA 3NSNA 1MW0A 4H41A 4OGZA 4B9ZA 3F5LA 5JBDA 1BG9A 5A8NA 1UR2A 2PI6A 3N15A 1CZ1A 3W24A 1JL8A 4UOQA 2UY3A 1Q6EA 2V5CA 4J3WA 2XYLA 2CKSA 1BQCA 4W7WA 1M04A 1B3XA 3WNPA 3CPUA 4DM1A 4EANA 1V6VA 2D1ZA 1FP8A 3EJQA 1O7AA 1NOUA 3RM9A 4NXSA 2VQUA 4UQEA 5LYRA 1E4NA 2CBIA 4XV0A 5A2AA 1C7TA 3B9AA 3DYOA 1AQMA 3RPMA 3BAIA 2VZOA 4PSRA 1J0YA 3DX1A 1BG4A 2W4XA 4PMVA 3T0DA 1UKTA 3W25A 3ZSTA 2QMJA 4W7VA 5M5DA 2ZOXA 5M17A 4PMNA 3MMDA 3WQVA 3WQ4A 4RL3A 5IFTA 1IZKA 3DHPA 3BXWA 1ZB5A 2VX5A 4PTWA 3AIRA 5FD0A 1TQVA 4FLRA 3CTTA 1LWJA 2OSXA 1BYAA 4R27A 5EB8A 1CGYA 1YHTA 2BVDA 2YOCA 4M29A 5I24A 3ARXA 3WEMA 2OSWA 5JIPA 4UZSA 3BVWA 2VTFA 1JGIA 1HTYA 4D1IA 3AIVA 1MW1A
chains in the Genus database with same CATH superfamily
1UWTA 4O0KA 5E0FA 5JUEL 3HOJA 3RO8A 3KHJA 4W9CC 1NTDA 3A5FA 4MOZA 1ZSXA 3ZQ9A 1XFBA 3RNQA 3US1A 1X6UA 1DO5A 3W9DB 3T71A 4LIQL 3IDGB 1M56B 3GBLA 4RUBA 3WBDA 3DHUA 1XR9A 1UXSA 4Y1AA 4PS4H 3UIYA 3AG4B 4X6CA 1EFXD 2XWBA 4GYKA 5AZ2H 1OG6A 1A7NH 5FLVA 2G95A 1G7UA 4DJFC 4KJWD 3MV8D 2YCIX 3POCA 2F2KA 2NW3A 1XWVA 3DK0A 3C56A 3X11B 3K81A 4JQXA 5EN3A 5CD3A 2WVSA 2P3YA 3CX5J 3QUZA 1ZS2A 3CZ8A 4APQA 3WIHH 1W1VA 3RVXD 1JZ2A 4QRBA 5A6BA 4QQUA 3DYPA 4IXHA 1S7VA 2ZKHL 2CDEB 2VDNB 4OFVA 1AZVA 2QR6A 3CX2A 2F58L 2CIIB 3EA1A 1KB9J 4O1BA 1KTNA 2OELA 4XO9A 1FO0H 2I24N 3UZQA 2X4SB 2Z31C 3RJDA 3GAYA 3MCNA 4G80A 4Q9CA 1CE6A 1K3IA 2R2CA 1R9ZA 2Z64C 2I60H 3MLUH 4UOW0 1QNZL 1IZJA 3GO1L 5JQ6H 1D6VL 4MMYA 2WSRA 3H9SE 2G4EA 4UM8A 3AXKA 4NRXA 1G4EA 4KHXL 5KSBE 3O3UN 4W4NA 1OE3A 3I6EA 4I9WD 1FFNB 2GJ6E 3WSQL 3X3GL 1JGLL 1TF4A 3QZEA 3IFPB 3U1QA 1EZ2A 2H3NA 2HRHA 2X0VA 1EAOA 5CSZA 1G9NL 3NZQA 1XPGA 2WNZA 4NKIL 1LQBC 2DBLH 2H6UA 4R84A 2DY2A 1LROA 2K7PA 4EZLA 5DA4A 2XSKA 2WNGA 3RPDA 1T41A 3HO8A 1EBHA 5J13B 1POJA 3VWJB 5AHIA 4JN8A 3GX9A 4WI0B 1F6LL 2MNJB 1CFTB 4AUYA 3BWAA 1QFWI 3VG9C 4PYSA 1ES0A 1VGKA 2P28B 1WISA 3P4MA 2Z34A 3C86A 4DZHA 3B0UX 1J01A 1E6RA 1S1RA 1FQ0A 2A9NL 5C9JB 3S35H 5IBUG 3ZK0A 2PWDA 1Q6LA 3DJTA 3VDHA 4DI8A 4OOZA 4L4TA 1R3WA 5DVNA 2NLIA 4Z7UA 2G9HB 4D9LL 3EKZA 3D0VA 4X9GA 4F2TA 4JTHA 2R29A 2OTWB 4LYPA 3ULUC 3KPPB 3AIBA 2EE0A 4L0PB 3DFTA 1TJHL 2H5UA 4UYQA 4LKXB 4X8CA 1W2PA 2FO4B 2A83B 3IXTB 1K4HA 2KZWA 2WVUA 4DT2A 2IEPA 1LNUB 2ALWA 4LYQA 2XV6B 5AN7A 4AIEA 4O15A 2DQHL 1V3HA 1UGNA 4MWFB 2GUOA 3KVKA 4UINL 5LNEA 4B0MM 2P7TA 5F4SA 3T65A 3HZYB 4W6YB 2BODX 4P61A 1DQXA 1Q7ZA 4QY8A 1KYOJ 2XC8A 4G6CA 3IK4A 5L8KB 5AZ1A 1EYWA 4EQ2A 4KBXA 3QBUA 1DZ0A 3D48R 4F9DA 3WQOA 2IBGA 2K45A 1IEIA 2NW2A 2UUDK 2NY3D 5CP3A 2BIMA 4LPTA 2V82A 4JO3L 1FBIL 1NOAA 1IIGA 1U8MA 3R0MA 4DIXA 4Y9FA 1DFBH 1XF3A 1MCOH 3D18A 3H2WA 4NO2A 4A7QA 3PAOA 3PVFA 3OKNB 1L7TH 1D7DA 1KIQB 4YLBA 3ZWSA 2AK4A 3SDYL 4AEIL 4QCEA 4G2AA 1J9RA 3V4PL 3D25B 4O1EA 1CTMA 4PJHA 1EB3A 4PY7A 4AV4A 2ATKA 4XI5D 5KINA 2BSSA 3MLVL 2OR9L 4LVOB 4ZMWA 3RMEA 1L9NA 1C5CH 2HT2D 3JXAA 3V6OA 5MP6H 3F7VB 3PV6A 4ESKA 1YDPA 1LEGA 3CS2A 2DWTA 3MR9B 4W9EC 5HYJB 1FWXA 4EO5A 2P26A 1S2VA 1HILB 3QHFH 2ZXDA 5DJDB 1EBPA 3WEAA 3B43A 3MV8E 4JGJA 5GS0H 1OX6A 2V2DA 2I7OA 4NGHH 3ARBC 1G7IA 2Y9RT 3WFDL 2OFJA 4D9QD 3P77B 2FQGA 3ZM8A 1O60A 2X0HA 3SE4A 5MERB 3FSAA 5DK0A 1R87A 1QZ1A 4GH7B 1KB3A 3CIWA 2PC8A 1H7WA 5A8MA 2VZTA 4NX5A 3QUMH 4KKCC 3OGSA 2UWEA 2CIPA 1FDLH 4OZFA 4J8RA 4TNFA 5BZWA 4LHUB 3O2VL 3KFTA 1PKQE 1OX4B 3NABL 3WFEH 4MUZA 5HGBA 4HJEA 5FEXA 3LJ3A 1MKFA 4Z7WF 1D3HA 5FKPB 3T8XA 1O5XA 4IU2B 3B97A 2P8CA 4K9EL 4N2LA 5D7EA 1PSKH 4I9WE 4HWNA 1SXAA 4KNTA 3IS1X 1WAEA 3BOXA 1CICB 5TPWH 5KWYC 4LCUB 1B4RA 1PDYA 3FNKA 4OCSL 4FL4B 2K8QA 2CKBL 3QO0A 3IRCA 4JRXE 4Q9RL 4K3EH 3K4WA 4PBWD 5AALA 2YK1H 4ZI8A 1X9LA 4RSVA 4XH2B 2DORA 3ROLB 3IFLH 1P53A 4M7LH 5FEWA 1Q65A 2PWEA 2BRRL 1TZIB 3FOMB 2X4NA 4HA3A 1AZNA 1AA1B 1TV8A 3TWCH 2N7BA 5D5MF 1H4PA 4CD5A 3L3HA 3NZPA 2JJUA 1P9MA 3L68A 1G7MB 4K5OA 3Q7JA 1VACA 5JZ7C 3FO1A 4X7DC 3LKQB 1OSYA 4QXUL 5L2KD 3IXAA 1XWYA 3RHWF 5G5IA 4XO3A 1U95A 5I8EA 3L48A 3ABOA 4N8VA 3WH5A 2X3BA 3PUGA 3PZQA 2ICEC 1J10A 3QJRB 3DRTB 1YO4A 4NYLB 1UR8A 1G1KA 2ZZ7A 4PCKA 2ACUA 3BUQA 3PP4H 4RZKA 1RJLB 5DI8A 3SKMB 3OGOE 1JZ6A 3N85H 2RUSA 4GMTH 1TV7A 4JTJA 1BD2A 2MQ0A 4U1GC 2UY6B 1F3EA 1WHPA 5IVXB 5AVVB 1J1PH 4GBXA 3LEPA 3S3BB 3MO1B 5GS0C 2DQGL 4JNYA 3QDMA 1FYTB 2UXGA 2XVLA 5LNWA 2J66A 1ODAA 5AVRB 1ZIAA 1EZVY 2W9MA 4C6NA 3I9AA 4P2RA 5XINA 4CGTA 2DGAA 4JB9L 4RNRB 3W5MA 3KNBA 1B3JA 3C6LB 1YMMD 2NNAA 3S96B 1W72B 3FMGL 3QXVA 1PD6A 5KYWA 3LHYA 3HGJA 4B96A 4BQ3A 1ZNNA 1HCYA 4GX8A 1FYHB 2WLIB 4EN3A 4RGMB 4U2ZA 3VCRA 2OMBA 1QPNA 4E38A 2NSXA 3CUHA 4XWOC 2LT9A 2G3XA 1T89C 1N55A 1IEAA 3MRDA 2DYPB 2D31A 5AW6B 1QOKA 2FJUB 4YLCA 1IILE 1XYZA 4IS6B 1LM8V 2Q71A 3FFCD 4IGHA 4R4FL 3S37L 1NEZA 4AT6B 2AL2B 3CB3A 5IZ7A 4IW4C 1AH4A 4BIKA 4DM2A 2GSGA 2XWJA 4HOXA 1R5VA 4HOMA 2I07A 3FJTA 2WOYA 3EOBA 1ZBKA 5AFDA 1PD1A 2D3NA 4AQAA 3H4WA 2L0DA 4JDEA 5T1MA 1FNLA 1FCUA 3VXMD 4WKHA 1HXKA 4LTSA 2HH0H 4P3DB 5FCUL 1E6JL 4D9QE 1MVYA 3HLKA 4KKAD 4YHZH 3BP6B 1FHDA 1LL7A 2GSEA 5E2VL 2PDUA 3MCKA 2GQHA 2IPTH 2FCBA 2B5IB 4TOQA 3F6IA 4M6OH 3VD2A 4K36A 2GWNA 4DNHA 1LE9A 3E2HB 4POUB 2FTPA 4FTDA 3SPVA 2R2EA 3WIIL 3SRHA 3OLIA 4DO5A 1W1A1 4UTIA 3LNIA 3OQEA 4EVNA 5TE7H 3WO4B 1YN6A 1IWAA 1W9BM 4D6GA 2DQTH 2BNRA 2CLLA 1HQ4B 3FIGA 2K4WA 1V0NA 1UM5L 1MCWM 5GRXG 3IVTA 3V0GA 4BY3A 3P54A 4I9MA 4IH3A 1JV5A 3CUIA 2EDBA 4YL2A 3I9GL 5G1MA 2PXYD 3OR7A 2Y7SA 2Y0SA 1J05A 3CZLA 4W4OA 4N2GA 1CD8A 1W2VA 5LXXA 4Q6YA 3MNZA 1JP5A 3DJRA 5LUMA 3ZE1F 2BIQA 1TFVA 3SY8A 4MWAE 1X4XA 4WCYL 2WZMA 4L1HA 5GPRA 2C1OB 3QDGB 3UZVB 1UA7A 4L8SC 4QSHA 2Q86A 4AL8L 4JHAH 4HIXL 3QCUH 3W02A 4UU9A 1JS4A 1XX9C 1BW8A 3HMWH 2HKHL 3BP5A 3WNIA 2G5WA 2IOMA 3WBYA 3BQUC 3J8F7 4CC4C 3U79A 2J8UB 2QHRL 5L2KE 5SWQB 3WSUA 4XBPB 4IFKB 3EPNA 3LKRA 3KPLB 4H88L 4M1CC 4ZW5A 4DGIH 2WNQA 3ZZSA 4DPQA 2EIKB 4UQDA 1J79A 1XIFA 3OJDA 1VF8A 3QQWA 2B2XL 3PGCB 1S2CA 5BW6A 1U36A 3GTFA 3CGTA 2ICWI 7ODCA 3FV9A 1H3UA 4QRTB 2Z24A 4QT5A 2INEA 1WRFA 3CPLB 2XZZA 3FU5A 5G4HC 5DQ9A 1XX1A 3BGJA 4LK4A 3NZ1A 3AQXA 2X8RA 3N6YA 1E28B 2CJTA 4XNBA 3WY2A 4DBEA 1OCCB 2ADFH 4XN5A 3WFZA 4HK3J 3X12B 4FNRA 1OSZB 2EIDA 1AD0A 4Q9BA 4OCWH 1QLEB 5KVFH 4C6MA 2VXVL 2OZ4L 1HSBB 1U91A 3T8MA 4PG2A 1DYZA 4UTAL 1R38A 4XNUL 2VLKD 2V9UA 5KN5B 4LCIL 3H7RA 3LLFA 1H19A 3QAQA 3CH0A 4ZXBC 1R33A 3RGTA 2DDQL 2L7UA 2AEPL 5C9ZA 1PYMA 1RZJC 3ZO0A 2OW6A 1ZPTA 3QQDB 1CGSL 4E42A 3CYVA 1XDTT 4HG4K 2BP0B 3B3BA 1YA5A 3MRGB 4MHHG 4WU7A 1KT2A 1YMHA 2P45B 5DMGD 1O6SA 1TPH1 1WGVA 1C12A 4C6QA 2J88H 4BZ1H 1FZKB 4IMEA 3BKJH 4S1RL 5KVGL 3FFCE 2NY6D 4NZJA 2R15A 2OMYB 4Y2DD 5BPPA 3GLZA 2X0WA 2M8XA 3IJ9A 1NCBH 2D3JA 3MRQB 2WJEA 1XM3A 1LL1A 1QSED 3DFHA 2CHXA 4RDBA 4FNQA 2Q87A 2HVJB 3KJ6H 4PJ8A 4I4WA 4ZFOL 1OZMA 4LLUA 4G8GB 1BYNA 3SO5A 3WKZA 1IC7L 3W0WA 3A4AA 3SGEH 4NQXB 1E5JA 2RHGA 4L3FA 3DV4A 5D70H 5F8QC 4XD5A 3AAZA 2W9EL 5DJ8B 1ROWA 4WDUA 5JNYB 1RURL 2OL3H 3MROA 2XPKA 5AVXB 5AYZA 2HP4A 2ZOTA 3UU0A 3UYIA 1SUJA 3AREA 2ARWA 2V37A 2VXQH 1V6YA 3WMLA 1EJRC 3NDYE 1B2WL 4JFVA 1V08A 4BXVA 4HUKB 5I1HL 3I50H 4ES9A 5E7BA 3QZMA 3QXDA 1EDGA 3ES6B 3IGAB 4GQ0A 4XVJH 4F5CA 1M3JA 4ZUWB 4JFFA 1UZ6E 1MFBL 1OGAD 5H37H 2VURA 3NQ8A 1AW1A 3LM3A 2QIWA 2GVLA 2D2OA 3LENA 2H2PC 4ZMYA 4J2MA 1WYIA 1OD0A 1ZTXL 2P4AB 5C1MB 4Q4RA 4PEKA 1DE5A 1EIXA 5HANA 2XTJD 1Q85A 2QGEA 5DZOA 2OLDA 4HSQA 3MP4A 1E72M 3NWRA 4KU1A 1VEOA 3GSVB 4RIRA 4OCRL 4FERA 1BOYA 4WGHA 3WXWH 1IKNC 2O0TA 3ABLB 5JO5B 1D5BA 1MG2C 4X7FC 4P9HC 1XISA 2D2JA 1C9SA 3DKJA 3BKCL 3G6JF 1PNCA 5FM4A 1A6WL 3CSYB 3QR0A 3T4AA 2VKXA 1N5YL 3F65A 5G1TA 4LLWB 4I7UA 3L9EA 3MJGX 3D0AA 5D7JD 4EI5A 2PTWA 2W63A 4G83A 2BMBA 2P3ZA 4CQAA 1BHGA 3MP3A 3OB0H 2QTVA 1OAYL 4H6QA 2Z91B 4PJBF 1IFGA 4A8LA 4HUCA 4PWJA 2EG6A 2ZWKA 4N2AA 3R1ZA 3V0DA 1RU9L 4PJ9D 3MX0B 5AD0B 3IDYB 1OFAA 2QHLA 2PTTB 3HTWA 3BAKA 4BFGA 1G87A 4G1NA 3F7RA 3VD0A 3SCMC 1KLGA 4XP9L 5A6TC 1QI5A 3U4EA 2ZUSA 3G77A 3MFGB 5I6KA 1EO5A 1AMXA 5D02A 2V30A 3DURB 5AW1B 2WQAA 2F7IA 1VZWA 4ACPA 1ZS8B 2ZZ6A 3ZVHA 1T7YA 2ZTBA 5G1YA 4S1SH 2PWUA 1PLCA 3MQIA 1C29A 3WQGA 3TYEA 1KWGA 5ELIA 4L4LA 1P7KB 4GB9A 4F3FB 9PCYA 4E9WA 4DO4A 3UX9B 5AHNA 1YJDH 1K9DA 2ZRYA 1QTYT 2QCMA 1NDVA 4W5ZA 4WY0F 2YQBA 1KYFA 3IMRA 2BY0A 5ETUB 1N0LB 4XPTL 3C2AL 1QFUL 5CH9A 4TKWA 3QPYA 5DRWA 1UZHA 3QQ3A 2VLKE 4B41A 4GMSH 5TBOA 3LGDA 3NJFA 5I66A 5KSAA 4KEMA 5A5WA 2GGHA 5C2XA 1B0GB 4FX5A 4KTYA 2ZC8A 4NM8H 4QISA 3RDTD 3NSCA 3CZFB 5GSRB 3RWIA 3BRDA 1F41A 2F19H 3MUAA 3Q05A 3VFLA 2Y7DA 3N13A 3O11B 3IF1A 3MV7E 1ID2A 5DRNB 1W8OA 3FGCA 3LMJL 2ZJSL 1PDKB 1XTMA 5IW1A 4GYFA 1AG0A 1VYPX 3HUJE 1IXQA 2P50A 4H6KA 3WKQA 3OMAB 4MDJA 3L3OA 5CO1A 1X5KA 3FDGA 3I6KB 4XVDA 4K15A 5IWLC 1L0YA 5HJBA 3L3IA 1YYML 3OPSA 2L04A 3NNTA 1JL8A 1QSEE 3E6HB 2ZPKH 3HPJB 2D4DA 1GYVA 2WP3T 3Q6FA 4DM1A 2BLEA 2APXA 1AIZA 5DO2C 3RM9A 1C7TA 4X0KB 8PAZA 4LCWE 2XQBH 4KNQA 3TROA 4ZW3A 4ZMOA 4PSRA 4R3UA 1BG4A 1NGZB 2QVHA 2CLVB 4KAQH 1SVDA 1KTJA 5T9BG 3O9WD 2QF7A 1P4CA 5B38B 1OXYA 3TCLB 1I2NA 2YN3A 1ZB5A 3UYRH 2BIPA 3NCEB 3KAAA 3WEMA 5K39B 1BZ9B 5SWUA 2QPEB 3H3PH 4YVNA 2XX0A 3K91A 2A9CA 3SQMA 2XU2A 1H7NA 1SMDA 1I1AB 1L2QA 1HQRB 1Q66A 1OGAE 3EWDA 5C0RL 1GKOA 1X5ZA 2A0LC 4OCYL 1J5IA 4L9DA 3OKEA 5AYXA 3FU7B 4OY9A 2XTJE 4MCMA 1UXMA 4WK4B 5IQ9B 4R2GD 1C8YA 1FH9A 4Z0BL 3MVIA 4U1LA 1YJDC 4P2OC 2WOBA 2DJMA 2HAZA 2YEZB 2EEBA 2C9VA 3W11C 2GYSA 1S7WB 4AQ1B 2AGJH 2WO2B 4D0DA 1CFSA 4MM1A 4OD2B 4PBGA 4Z7WA 4QDWA 4RZ5A 3ABSA 3F7JA 1JNEA 1E9ZB 3HPLB 2WXOA 6XIMA 3G1YA 4ALAL 2DFAA 3SE8H 4PIBA 5FV2A 3U4FA 5EIIA 5HDOA 5FS5A 1ZLSH 3V0SA 3DCPA 3DROB 5I16B 1PY0A 3GSNB 5I18H 2ENJA 2JCCE 2V5KA 3OAUL 1ZU8A 1HKFA 3EYFB 1DN2A 1T2QL 3MJ7A 4L7ZA 4WWKC 3RURA 3REVB 2Y7OA 5KS9B 4MTVA 1T0OA 2P5EB 2VRJA 2IAMC 1ADWA 2FJHA 2Y06L 1AXTH 4RA3A 2A6LA 5EV7A 4HU2A 2LU5A 4HGWB 4MAYC 5I19H 4HCGA 5D5MA 3LMYA 1E4HA 4JREB 3LU2A 1KEMH 5MEOB 3PUOA 4HU3A 5KSUA 2D7TL 2VDHA 3UTTA 1BGAA 1RVFH 2ZXGA 3VO0A 2YPKB 3WQFA 3QW4B 4XO8A 3MGOB 3VFVB 3VFTA 4P4RA 5KSWA 4YVVA 4UNVA 3QT2A 2D7QA 4IMGA 3UWZA 3MDWA 4L1WA 3BUVA 1NDMA 3S3GA 4K73A 4XZNX 3TPKA 2BP8A 2MUCA 2H47C 3VXOA 1DEEA 4YUEL 3UPBA 3RVWC 3RVTD 2JQZA 3CX5K 2HA1A 3KBWA 3V4PB 4Q89A 3G9VA 2AGTA 1ZVSA 5AQ0A 4HDIA 3RFZA 3QIUD 3WIHA 2H45A 3U46B 3VPLA 5C7XL 4Y96A 1AS8A 5GVJA 1GTHA 3GT6A 5E99L 1QFHA 2DD8L 2QKIA 1JZ3A 3TZNA 1RZGA 1KB9K 4DWSC 1I9RH 5AUMB 4LVEA 2PETA 2ZCHH 3SPHA 3F03K 3GS4A 1FG2B 1YECH 1V02A 2WUBL 1R0AH 3GWJA 1FO0A 2RFXB 5FJPA 3QA3B 3IWPA 3K8LA 1XCTB 1GHFH 3INUH 5I73C 2NSMA 4HPGA 1MUCA 1TIWA 1DFXA 3ATFA 4N0CC 1A5FL 3IEBA 4LLDB 4P8WA 5KBKA 2VQ1A 1WAAE 4LVAA 4KY2A 1YBQB 2MJWA 1UT1A 2PTDA 4GBDA 4F27A 2UX6A 4NKQB 2O55A 4X6EB 4JY9A 5EU4A 3QFJB 2MHAB 4U1NA 5LN4A 2VM4A 1H09A 3UF9A 3JTSB 1OSEA 3XIMA 1WK0A 2XVBA 1S3TC 4HK0B 1F86A 1JHLH 4HJ0C 5CPOA 2K6WA 4P2AA 4ENLA 4DP2X 5ID0A 1GMEA 4L2YA 2F5BH 3GI9H 2VELA 1J7VR 2DQFA 2C0HA 1TNNA 5C7ZA 1H15B 5A3ID 2R0KL 3PTDA 4B92A 3T2PA 2ABBA 4TL5A 3OBEA 3SGKC 3O3DA 4X5WB 1OYAA 4P8QA 1CGTA 5KJRH 1FWJC 4M93C 4H1LG 3SE3C 2J74A 4FOJA 3A3WA 4LQFH 3K0WA 3UO1L 4DP9X 1UD8A 4LVNC 1L6ZA 1G9ML 3RPIA 1MCHA 2Q3RA 4UTWA 5C2UB 4NQCD 1AZCA 4Z5RB 5F2MA 4UM9A 1Q6RA 3RGVA 3SCRA 4B97A 5G2IA 3WFAA 4J4PD 1K9FA 3FN0L 4DHGA 5C0ND 4KQ3H 1FZJB 1KLZA 2MCPL 4M6NH 1J5OL 1XHGA 3QO1A 3LKOA 3LKNB 8RUCA 4MD0B 1XC4A 1CFBA 4RV3A 1CBJA 3ZTCC 1A0DA 2AJSH 3P8JA 5F88A 1EO7A 2DKUA 1ZSHA 4L5FL 3E8VA 5EU7C 3OAYK 4YBHA 1UR4A 1RJZB 4ABVA 2YBVA 3BD4A 1N64L 4BWUA 1KYOK 4ERSL 4XRCA 3G08B 1ZDQA 2COQA 2Q10A 4DGVL 1HGYA 4MMZB 4BKSC 2CLOA 5IROA 4K1GA 1EC9A 4RQQB 5F96L 1A5UA 2C7FA 3MLSL 1ADOA 3ESNA 3A23A 4DCQB 3I2CH 2LR4A 1LQ2A 2G4GA 2VE6A 4P4KA 5E8NB 3IVUA 4R97B 2OCZA 3MRLA 1DO6A 5IJBC 4LMQE 1N82A 2NVDA 1I1RA 4J3VA 1KENH 2ITDB 2QEZA 3EPOA 3HG0A 2F53E 3GIZH 5KZ6A 3FO9A 1UVQA 5HHMB 2KT6A 1XW8A 3HB9A 4L9XA 2YQGA 4CDGC 1QUMA 1Q1JL 5CEWA 5IHUH 4LP5A 5EBUA 3LS4L 2OYLA 1GTNA 1Y6NR 3RI5F 5HUOA 4U5IA 3DDGA 4TSAL 1GGUA 2MCMA 3EAUA 3U2CA 2OTUA 2G60H 4N90D 1L5GA 4RE2A 4Q8VA 3G1RA 4S38A 3UZJA 4LUYA 3OMZA 3LLDA 1QYGL 2OO6A 3ARSA 1K77A 4WZHA 3PWPE 2I25N 4MQXC 3ARGC 2CCWA 4BUHA 3QUMA 1ND0B 3CLFH 4C83A 3LHAA 2DOCA 5DWUH 2XDHA 3QUXA 4PRIA 3IAPA 1FDZA 3B9NA 1QG3A 4LBEB 1JGEB 1CDBA 4F48A 3MRRA 4EWJA 4ODUA 4GFIA 1QLEL 2Q02A 3PHOA 2R1PA 3KTCA 5FUCE 5HDBB 3TF7C 4I18C 1SJBA 3HE7D 3QFDB 4U7SA 1GL4B 4HIPA 1R3TA 2EAWA 1IEVA 1DJNA 4BKLB 4LCYB 3I6GB 3BPCA 2VKZG 2H2SD 1RK1B 2X9WA 3UESA 5G2NA 5HDWA 2E6FA 4QRRA 4JDZA 3SIMA 1QBAA 3NQAA 3FOKA 4HB7A 5KANG 4AZIA 2WV3A 4IPLA 4C6IA 5IB4B 5BZXA 2VR5A 3D33A 1JK9A 4HYRA 3CHPA 2Y36H 3PJSA 5B8CA 4B9KC 3GEFA 3SCPA 1N2RB 4EUPG 3T1FA 3HN5A 4MSWA 2BGNE 1DJSA 3GNDA 3PRZA 2PR4H 1E4WH 3DXAA 3P0VL 2JFCA 2C0AA 3O8XA 1SGKA 3W27A 1VJSA 5IB5B 1ISYA 3PP3H 4JG0L 3G8EA 4KIRA 4NQCE 3PHQB 3ZHDA 2B3RA 1XQKA 4XMZA 4D0BB 4JKPH 1UC5A 1W0VB 1OK4A 3DMMC 4XCNB 2H9AA 4EXPX 3BO8A 1KPVB 1BLNB 3PQYB 5D7SH 2WC7A 2J1WA 2YCLB 2EIBA 3HC4L 3L54A 1BQUA 4UIOA 5DFVD 2X4TA 1TA3B 3G24A 2E9BA 3URAA 2L3BA 5CC3A 3W2LA 5JW4R 1F6AA 2V9QA 3UABA 4AV5A 4XX6A 4MNHA 1ACYL 1R3HA 2IDCA 4F37K 1DQKA 4GAGL 3TO4D 5H8MA 3SKJH 2I9TB 4FQXB 2X89D 3VUSA 4OLYH 2EXWC 4XCFL 4G1EB 3O6CA 3K80A 4ETQA 3C60A 2PYFA 3DBXA 4R90L 1WOAA 4OT1L 2H0PA 3MPGA 1UQSB 4PB0H 3X2QB 2QHAA 2WC4A 5GS1C 5FYLL 1ZJAA 3ULVE 2XV0A 5HAOA 3L67A 5CJOL 4H2CA 5FKAB 5LQBH 4WUKH 4XODA 1BGXL 4Y9EA 4AZ5A 4PJBA 5E9AA 1G84A 4Z42C 3W07A 1ZV2A 2EXSA 2ZXAA 4U1JB 1KCXA 5C0CD 4AZ8A 3WJZA 5EUKA 2DW5A 4R4BA 2HX7A 1NAKL 2SEBB 2N3JA 3BVNA 4S2BA 4V1XA 2RAGA 4X2PA 1EJOH 2FJFB 3HG1D 3MA9H 1NL0H 4LKCB 2FB4L 3WEZA 4HWBA 3AJ7A 3K3QA 3S2JA 1OBAA 2A73B 2PDGA 5JH2A 2QZQA 4J28A 1T1YB 3UO8B 3APCA 3ZKQD 3KBHE 1YEJL 2NTFA 1YXCA 2XQYG 5J8OA 3OJGA 3ZT6A 5AZEH 1DVXA 4MQSB 5IR1A 3MJ9H 1RLDA 3VSUA 2R0WH 4WY0A 1VA9A 1ZANL 1A21A 3WLHA 1A7PH 2HFTA 4HJJL 4S2SB 2H8XA 2W07B 4MA7H 5CSBA 1DBKH 1VSCA 1RZ7H 3AUVA 4W68A 5HYIA 4ZFOB 1T5XB 1S9YA 1SBSH 2NX5D 1BEXA 4I1PA 2AVGA 3VAVA 3RX4A 4BFEA 3KPTA 3SIZA 4ICWA 4AKQA 2YO3A 4BQBA 1GONA 3KPNA 4X8XA 4LBUA 4W6XB 3HPXA 4C7FA 1EEYA 5F44A 4JAWA 1XRSA 4ELMF 3SURA 2K8MA 3CLWA 4C4UA 4F7PB 1XQLA 3TEZA 4OJFL 2G5BB 3PF2A 3ULUH 1XF2A 1U3ZA 3VX0A 4PPTA 3VI2A 1DBTA 3HVNA 4F2BA 1HG3A 5J0BA 2Q8BH 1T8QA 1DCEA 1JZFA 4YHKH 5GGQL 4NKCA 3O2LA 2PTZA 3O6FD 3ZE0F 4EZKA 1U1HA 5EU6A 2A1WH 4LCCB 3U1PA 2BNQA 4MKMA 3L5LA 2FLMA 4A2GA 4Y2NA 4ZO7A 2FSEA 4M61B 3LXCA 1ZWIA 1ZEAH 3C61A 2I7GA 4MADA 5BUPA 1PWMA 5FHAL 1DVFB 3K8KA 5PAZA 1KCRL 1UOVA 4YWIA 4Z0XA 4OI9A 1HDMB 5D2NB 3K6SA 3NQMA 5F1OB 4HUXB 3HI5L 3VKJA 3COOA 3R06A 2BB0A 1U4EA 1PEWA 1RL1A 5EZLB 4IRJD 3BCJA 3FQ1A 1EBAA 3ASNB 4IHOB 4WJXA 2K3TA 3FCBA 3PS7A 3CAFA 2E75C 4BH8B 3OODA 1MSPA 3D34A 1LOSA 1JPTH 2PE4A 4ODWA 4IM4A 3TL5A 1Z6KA 5BZZA 1ROCA 3WKMH 5L2JA 5CP7B 4KDVA 1VFFA 1YQVH 3BK0A 5D72H 3NGBB 4EI0A 1IKNA 3BOVA 3EB2A 1NIDA 1P6WA 4W84A 5E00B 3L4YA 4KO5A 1AMKA 3D6NA 4KT2A 2YEQA 3VXUD 3DGGA 3VVWA 3TM6A 2A3AA 2PYEE 1LF1A 4YSAA 2ZXBA 2C1PA 3IRDA 4W93A 3S5LG 1FH7A 1SW0A 4AZUA 5DJAB 1TJMA 3ZR6A 4O8RA 4Y4KB 2OK0L 3BWUF 4JTKA 3N2CA 1BXAA 1UWUA 4IWWA 4XVUD 4XXDB 3DVGB 3LN4A 1S8DB 4RMBA 1KC5H 2FDBP 2UVFA 3G9AB 5DLCA 3DOPA 5C0CE 4R4ND 4AXWB 2J88A 4BZ1A 3CFEA 1X5IA 2NXZD 1SVZA 3UAJC 3QTGA 3GSNL 4FALA 1KULA 1I3GL 3V3WA 4AZ6A 1UA6H 4OIBA 1ZHNB 3HG1E 5EBAA 1MLCA 1T66C 4ZS7H 4JGMA 3CLEL 1MUJA 2Z7KA 1T5WA 3HFYA 1CLYH 5D71H 3ELAT 4MJHA 4Y16B 3WLMA 5E6RB 3QCTL 1A7RL 1YE6A 5SWSB 3NCYP 1KN4L 1W80A 3GSQA 4GSXA 4ZUTA 2EF9A 3CHDA 4FJZA 5DYOB 3LGGA 1MCSA 3ESMA 2VL5B 2BS8A 3RIAF 2OL3A 3CHRA 1UJ3B 4NL1A 1EJXC 3D9AH 1SOKA 4WVRA 3UC0H 3BPOB 5I76A 2VXQA 4X5QA 3AMLA 5IEKA 4FHBD 4DUWA 4YSQA 2MIZA 3GYEA 3PFQA 4HYTB 1NFIB 3ZE2B 3EO9L 4OM1H 4O4YL 4OV4A 3NSXA 2NX5E 3MLZH 3CWOX 2W5FA 4NCDA 3S7GA 2KLSA 5H37A 4FQ2H 4RGNC 5F2FA 1KCUH 1IGCL 4LHUG 1EC8A 3N2XA 4NHUA 2BSRB 1O5DT 4ECNA 1S2AA 2AXWA 4IRSA 1S9WB 1Y0EA 1IJNA 3MP5A 3ZXAC 3C8DA 4CU7A 5CXPA 5AVYB 1WXJA 4JFDB 2GABA 3C09C 5CN3A 4YHML 1NLBH 3TYFA 5I1JH 3CT7A 4BZYA 4F33A 4LLYB 2NY7L 1SR0A 4B15A 3VI4A 2XA8L 1TLMA 1VHPA 2PGEA 2EPMX 1S7XA 1OTSC 1S7TB 3HZMB 4IHCA 5IT2H 3FQ2A 4XC1L 4JFUA 1NBYA 3VUAA 5ABEA 4JKLA 2NNXA 3TVMB 1NCCH 5D2VA 4BEIA 4AYEC 3QQXA 3W76A 2QDGA 3ZYJA 1NF0A 3WS3A 1Q0YH 3LNHA 1B0RB 3TX4A 1MW0A 4H41A 3UZ5A 1FNSH 1RA0A 3MUJA 2CG9X 2VN6A 2ZYFA 4TSBH 4JGNA 2ZF9A 5EC1B 5K9OB 5DJZA 3CPUA 1Z3GH 4JY6B 2A74C 2J2ZB 5C97A 2E1WA 4Z1YA 4NZRL 3H2NA 4POCA 1T3FB 4ZUVB 2VSDA 1E2WA 1J0YA 4L4JA 2ZSWA 1SQ7A 1LUCB 4QPEA 1P5BA 1IMHC 4X9IA 5IFTA 2XWRA 2WJZA 2VX5A 1REQB 1TQVA 5DXXA 1EO8L 3ZIMA 4KUZL 1FJ1B 2NQHA 3ILQC 1BF5A 1VRDA 2VTFA 4D1IA 3QRBA 2NLJA 3T78A 1A2YA 1JPEA 3WFHA 5D9SA 3AS2A 4QYOB 3GZOA 3PNZA 4Z7QF 1I7UB 2ISWA 3BH9A 4Y0GA 3TIEA 4QHUA 1INQA 3CWGA 1P5VB 1YLBB 3OHXB 1ITQA 1XLKA 4N42A 2V81A 4B16A 1WS8A 4NAFA 1XIJA 3B6SB 1EHNA 3LRMA 4FA6A 5JXQA 4KWUA 1N18A 4G8IA 3HI1A 4JX0A 1VB9A 3TNNA 2QSCH 3P4LA 3N18A 3UBXI 1AZ2A 1OTTD 5M7QA 4DF0A 1OEPA 3LDVA 4M0XA 2R1MA 4KTDL 3EX4A 4ZDHA 2QJNA 5I8OH 2E6YA 5E0QA 1NGWA 3JVFC 5J6SA 2VMJA 3WJMB 4JFWA 2BVEA 1M6JA 3ULUF 3EO1B 4KRPC 5FAJA 3Q06A 1P7QD 4PRHB 2WLLA 3VAEA 4AC1X 1S9VA 4MAYA 2BC4A 2XPGB 1JEZA 1VPOH 1YEWA 5E94B 3CV5A 3L95A 1KBGH 1KN2H 1US2A 1QJWA 4KBPA 3N40P 3M41A 3RTQB 3UJIH 3MODH 3GS6A 3WJJA 3A64A 1JRHI 4HAGA 4HMDA 4PJEF 5F7HA 3K5XA 2UZXB 1LG1A 4ZQMA 2OEJA 2FBRA 4ORGB 3WTVA 1NDZA 3EFDL 4X8JB 3CZJA 4YHEA 4AYGA 2A5HA 3CUZA 3NOEA 2ICWB 4NT0A 1OT1A 4GG8B 3TN0D 3F12A 2P76A 3PUCA 1TVBB 2BJML 1DWAM 2Z1KA 1KJMB 3GSWA 1N5AB 3V52H 4X4KA 2R7EA 1M9WA 4JZJB 4XNXH 4V27A 3PBWA 1A14L 3WFLA 1IGIL 3TYZA 4ZX3A 5J1TC 1KQZA 2HVKA 3TONA 3D4GA 2W92A 3KS0H 3FKUS 3ZFHA 3M45A 1AFSA 1HEZB 5IIEA 1E6OL 2DL9A 1J9TA 5BRZB 2H6PA 1M57B 4ES8A 4KO6A 4NAJA 4HHGA 2A79A 1XIIA 3TURA 4QDPA 3WE6B 4ZUSA 2PO6A 5EH1A 2W6RA 2XZQL 4M6UA 4PFEA 1NFDE 4HT1L 1RZ8B 4YR6A 5A2IH 2PMZA 3FT3A 3D05A 3WD5H 1GAFH 3MMWA 2H32H 2J7EA 2WAGA 1OHZA 3ALGA 2FYYB 4O02H 1FIEA 3WNKA 1QI4A 2B7NA 4DJEC 3QJXA 4C90A 5H91A 4OFYA 1VCGA 5EMUA 1YSOA 3WJXA 2ZZ2A 5FFOA 4YYCA 2A4AA 1ASPA 3QZOA 4EEEA 2XQ0A 1CR9L 1MFDH 1TVLA 4KKBC 5HYJD 3AMKA 4FFYL 4JFOA 3S5ZA 2IVFC 3WDPP 4KV5F 2CBUA 1T2XA 5E03A 3QN3A 3IU4L 5HHXH 2MKLC 4HTBA 2ATPA 4ZYKB 1RZJH 2J8GA 3AABA 1M01A 4MB5A 3ABRA 3QUKA 1EUUA 5H35B 2KH2B 2R1YA 3V9FA 1I2PA 4DFHA 1G6RA 4BKNA 3W00A 4LHUD 2A21A 3QPKA 3RU8L 3ZKXC 1ZV5A 1FWCC 4QRPB 1J96A 3NM3A 3MBED 4PP1D 3URNA 1AR1B 3CUXA 5EC2A 2NQ9A 5DGRA 3N1PC 4FZEH 4L6HA 4UOW1 3IPWA 2NMSA 3ZTNH 4DXKA 5F9OL 4WUUA 5J6GA 1SW3A 3M0HA 3RTLA 4I8DA 2VC5A 4C1KA 1CICD 3RM4A 4Q2ZB 3M7OA 3M5XA 5F9JA 1ITCA 4ACZA 1IKFH 3C5ZA 4ANVA 2QAPA 3SR7A 3QULA 1FXPA 5G55A 2W9DH 3ZDXF 5FGBC 3MJYA 1M03A 4WSHA 3PZGA 2NVCA 4HEME 2BY1A 5RUBA 4PV8B 4MJ6A 4JKNA 1TENA 4KMTL 1ZLVK 5ADPL 4DBSA 2VW7A 2MOVA 3G5XA 1C16A 3D4CA 1HO4A 1ED3B 2PDPA 5FSEC 5C07A 2Q6WA 3UBGA 2OMWA 1OZQA 5I5RA 5D9MA 1OLZA 5JHDD 3X1GA 1Q6OA 4PJ7B 3TZVB 1XI3A 2NY2B 1MRFH 4AD1A 5E0CA 1NCHA 2DV6A 1QVOB 4GAJL 2JKXA 3GMQB 5CJBA 2EVIA 2I7SA 3AYTA 3S8HA 3LZ3A 1YEYA 4P7OA 2H3BA 4WDIA 1QO3B 4KJQC 5LHFA 2Z92A 1OG0A 3SGJA 4KZDH 4U1MB 2AI0H 4URTB 4P9HH 3EYSL 1EP2A 4GGHA 4TOYL 1SMOA 2OOGA 1IB5A 1FORL 1JFXA 1WWBX 1Z89A 1IKOP 1EOMA 1A5LC 4HFWB 1BM3H 3J07A 1QFWL 1YMME 4O4VA 5I17A 5F71A 1XGYH 4IGSA 3DVNB 2ZKYA 5T33L 1ADQL 1ZXQA 3R4DA 3GBML 3MRJA 3JWOL 3R2GA 1PYWB 4OQVA 4HFUH 4NIYE 2OO0A 3A5VA 1KWKA 2VFDA 4HKBA 4XIMA 1SXBA 4RDWA 4GFSA 3M5ZA 2JBMA 4YK4C 1RZMA 3B4YA 4A2DA 5GIRA 2ZP9A 5AG9A 2E6DA 1CF1A 1HKVA 3BT2L 4K6AA 3GDKA 3D3VA 4S1QL 4YBQC 4GRWH 4X6DB 5E1AA 1QW7A 3NGJA 3COTA 4JLRB 2V4LA 4JYDA 2DQCL 4G71B 3TKFA 3H70A 3VXME 5LNRA 1FL6A 4BINA 3UXFA 5EU5A 1GZHA 3LN3A 3MFFB 4RWYL 4G7EB 2GSIA 4ELMA 4H26A 2Y5JA 3CHCA 3ARUA 3P73A 2R69L 2HVNA 5D4QA 2PDKA 4UDUB 4FFWC 3H23A 1JXFA 5HJLA 4H9ZA 3HS0A 1VERA 3GYRA 3EWBX 1EEZB 1S46A 2DQIL 1CYWA 2XNAA 3OX8A 4DYEA 3ZDWA 4BK4A 1LLWA 2DQXA 3QNXA 4M6PA 4UC5A 2D0FA 4MYAA 5G5DA 4QF1B 3R4RA 4HHHA 5CAYB 2E8YA 4OLUL 5I3GA 4P5TA 1RZFL 5HJGA 5HWJA 5DLML 4HALA 4DN1A 2QPXA 4ZQPA 1PG7L 3IN0A 4KITB 2DWDB 3KVDD 5CBEA 4QM1A 2BNUB 4G8EA 5EZIH 3TC6A 3QZWA 1EBGA 4BF7A 3SO7A 1A0CA 1MY7A 5CGYC 1OPGL 3TA3C 3EFOB 5A3HA 2PSNA 4KY1H 5EG6C 2AW2A 1RVKA 9RUBA 4OUEA 4XCCL 4CU6A 3WQ5A 2HK0A 4FR6A 4HSOA 2VC6A 4FQCH 3ZRFC 1TREA 1MH5B 3GQFA 2B0SL 3BT0A 4YZFF 3L3GB 1CI3M 4CUCA 2WCAA 4LEXH 3DTXB 5CILL 4ZD3L 5D30A 5IB2A 2AEOA 4HS8H 1NOWA 3E1F1 3K72A 4IKKA 1N8WA 4ERIA 3ZKND 1GYCA 4I48B 3T2OA 3O3AA 1JNNH 3DHFA 1LO2H 1LO3H 3SZ8A 5B21A 3AUWB 4NWUL 2REQA 1NMCB 1W8GA 1D9KA 2V5DA 4C6OA 7TIMA 2GY7B 3LQMA 3VQ1C 3PAVA 4MXWH 3MOAL 3WH8A 5L9DL 2Y6SD 3P9LA 1KPUB 4OZHB 5JQHC 5J7CC 3TT3L 3I84A 4PRWA 5JHDE 3SECA 4M7KH 3IIPA 4OGAC 3EOTH 3EMQA 3BW9B 2XIMA 2IMNA 2HUEA 3VD3A 1R3RA 1BYPA 3H2QA 1X5FA 2W67A 2XSBA 2MNRA 2VRKA 1UB6A 1TJGL 1AZRA 4YAQA 3RUGE 1TYJA 5I0DA 5DQDL 5I71C 1RJPA 1UB5A 3WUEA 3CDZB 3QJOA 5SWZB 3ZJ8A 1RJRA 2DUZA 3NFUA 4XZHA 1J0ZA 4QEGA 4C57C 2V9DA 1HWWA 3BD5A 4ADTA 2OB3A 1YHPA 1WUNT 1Z3NA 2OLSA 4M19A 3SY1A 3D47A 3HNSH 4PREB 5T1JA 1UIPA 2ED8A 2C18A 4N7QA 1NAMB 5ABDE 4KJPC 3KBMA 5B38G 4HN8A 1MCJA 1A4JA 2XFFA 1B4LA 5F3BB 3FT4B 2W0UA 1X7IA 2PPAA 2VSMB 3V6BR 4JS7A 5ABGA 1K72A 3P11L 4WXYA 1QU4A 4NI8A 3FLUA 2CBMA 4GZ7A 2N1KA 3GW0A 3VZYA 3IJQA 1JXGA 2Z0BA 4W88A 5IG7A 1LHZA 4B9JA 3T4YB 3WCZA 1GZPB 1HK6A 2QF8A 3UT0A 1MQRA 4AH2B 1YEGH 1KV7A 1PCXA 1NGPH 4Q52A 3X1FA 2FAUA 1ZBVA 3QV9A 1JRHL 1FFQA 1S38A 1BYDA 5LA2A 5IB1A 2CK0H 3VXSA 1CXLA 2BHZA 4IZGA 4EIUA 5D1ZC 2WMHA 3BHBA 3KP0A 2PDIA 3MLXH 5K4XA 4HIEB 3Q5OA 4AG4H 4DYKA 4YMZA 4E5XB 4ZQNA 2FT7A 2JKPA 5EN2B 3TJHD 4I90A 2ZUYA 3KWVA 4PEEA 2FBOJ 4ATTA 1Q6CA 4JRYB 4MKTA 4KO9A 2FD6L 5B1BB 5BMWA 1IWPA 4Q33A 1VZIA 5L6YH 4S2CA 1NUDA 1GJUA 1WDRA 5IFPA 4K7PY 4I9AA 1LT7A 3OKKA 1VKFA 2M1KA 2JKRM 3GSOA 4MCZB 3KXFB 1KRBC 1VBGA 4XMXA 4PRBA 1A65A 2B08A 4M5YH 2FFCA 4O0ZA 1EQPA 2YGOA 4RFOH 3TJXA 4U6VH 1BFVL 2OZ0A 4DJFA 4FFVD 3VI3F 1KTDB 3FFDA 4HISA 4K2UL 2F38A 3L5IA 3FTSA 3AT9A 1G7JA 4XPAH 3PL6D 4JX6A 4AQOA 1GJIA 3O4OC 5HINA 4HS6B 1JN6B 4A8NA 4LYRA 3FSTA 5T3ZH 4IIQB 3W4RA 5IOKA 4NG3A 4LC8A 1B6UA 5FGCE 5T1KA 3FB7A 1HJWA 1W16A 3GRWL 3NFNA 4URIA 4KTEH 2GTQA 4I0PC 3ZR4A 4AVJA 4Y2OA 3GMNB 4G8FA 4GP5B 4WHYG 1NWUA 3QI9B 4OD1L 3ZDZE 2BX5A 3IVKA 2Z31A 2WZPD 4EKJA 4KWWA 3NJ3A 2ICES 5EOCH 3M17A 1AOZA 3CQQA 2Z1PA 3C8NA 4BE6A 3DETC 1A64A 3P81A 5A2BA 4BH7A 3HJEA 2VM3A 4K3DH 4JQIH 4LGRB 4GOSA 3IMUA 4JFEB 4HIBA 2X1PA 2G75B 5E2WL 3LZFL 1VKXA 5ACLA 4XMKH 2D9QB 4UFKA 1J11A 1DKWA 3BLEA 4AYDC 1NVMA 2UYLA 1CFVL 3WFCL 3MJ9A 3QIBC 4HGKC 1WWCA 4KKPA 4ZQKA 1MCEA 4NI6A 3GKWH 1WNOA 3Q43A 3RO6A 1N9PA 4QYAA 3DI1A 4KFZC 4UFMA 1E1FA 4GUQA 2VDPH 4WEMB 3ML9A 4N0UA 3CVIH 1O6IA 1OP3H 2O30A 1FN4A 1G43A 4UILL 3ELQA 3SJVB 3QXBA 2NY1C 5T5NF 2R91A 4K9JA 3ZZ1A 1WEJH 2NXYD 5AKVA 3GXNA 1ZTVA 4UF7C 1C1EL 4POZC 4HKZB 1EEPA 5EF1A 5IKCA 4ZFGH 4GQRA 1TWIA 4U31A 4ZRGA 3UR7A 5AC6A 4LSRL 4J3UA 2MMXA 3QJTB 3MU3A 3W3BA 7PAZA 2F1BA 3TWAA 4FQLH 1CXFA 2G0WA 1QPRA 1XRTA 3OYZA 1BGGA 4LDCA 4I3RH 3ZTJG 1JGVH 4PRPA 4B3VA 1WDWA 1UQZA 4RW3A 3MA7A 3VTAA 5IHZB 4WTXA 3IANA 1ZKAA 3WY1A 4PJEA 3FQYA 1XGRB 3GB6A 4YXKL 4M5PA 1ZENA 3T09A 4G1KA 2DY3A 3NZSA 2JELL 2ARJA 4JFZH 3ZMNA 4ZTYA 3P62A 2QCEA 3FUKA 2E4TA 3SRDA 3KMDA 2V7NB 2O5XL 1TFPA 2EPOA 3IGUA 3L4TA 3HPZA 2ORBH 1OVZA 1INDL 4NZFA 3IU3A 4NX0A 3M0VA 1E5AA 2DV0A 3N06B 4YO0A 4JY4B 3HHSB 1PXGA 4J3OG 3FB6B 3LLXA 1YX1A 3KBJA 3VI4F 3CBRA 4DZIA 3HGSA 2QW5A 1MHEB 1KCKA 2P8BA 3A4JA 5MKGB 5HOSA 3B8TA 2Z2UA 1CB2A 1HCZA 5EO9B 3R89A 3U4BL 5JXAH 5JORB 4X2UA 2BOEX 2WMIA 4XZMX 7A3HA 1GUVA 5EGRA 1AK5A 3KS6A 4JEJA 2ZSVB 2HYMA 5JIHA 4IP7A 3QWOB 4NYUA 3QUHA 3FT2B 5C0BD 1DP0A 1U8QA 3CV1A 2HEJA 1DDHA 4A3UA 4L6DA 2A3CA 1RIHL 2Q3AA 1G0DA 1DBAH 5E5LA 4DERA 2HPMA 4M43H 2VXUL 2UWFA 3ARBA 2WN2A 1G7LB 1TZZA 4E0RA 3TCXA 1Q9OB 3NJKA 2AGKA 1Q13A 3E9UA 3RZCC 2QJGA 4KK6D 1P4IL 1I82A 5J57B 1U8HA 4V1DD 1J48A 5JXED 2XBZA 5FUCC 1OWQA 2F5AL 1OGPA 4K38A 3WENA 3FAXA 3FH7A 4YDNA 4Y8AA 5GISL 3N9GH 1OP5H 1EJ7L 4FQHA 4X22A 2CUIA 4K94C 3WL9B 3BISA 1I1AD 3RNKB 3L21A 4LT9A 3R19A 4XZBA 4NZ1A 4IBSA 2V5BA 5E8PB 2LHAA 2ACSA 2V6AA 2EO1A 4GG6E 3MHGA 3EJTA 3PWLB 3I68A 4ZFMA 4LUJA 1B31A 4EAEA 1CXHA 2XHYA 4XG1A 4IU3A 2AJZA 3MRCB 5GGRB 3BLIA 5GJTH 4FB7A 4P2YA 4UOQA 1R3IL 3I7RA 1BQCA 3QEHA 3Q1EA 1PVHA 4UIMB 5DJCA 4EACA 4IGBC 3P2VA 3V8CA 4NILA 2VDOH 4KXZH 5EPMB 1AO7A 4Y5XC 2J9ZA 3UPAA 5LGJB 2TSYA 4JTFA 4LHQB 3VG0L 3V0WH 3VQMA 1R3JA 4YS4A 1KLUA 4KS0A 1AC0A 4F40A 4YDJA 3JW7A 2NXIA 1G7VA 1PL3A 3B8YA 2AXGB 1EAPA 4ONFL 1FI8C 2YCEA 1CGYA 4FP8H 2I17A 3LDBC 4JE0A 4FG6C 3RMJA 4LP8A 1XLGA 2EIMB 3OG2A 4G5ZH 4GKZB 2TPSA 4S0SD 1HXYB 4A2EA 1F42A 1A6TA 3C8FA 3N9KA 4JZ5A 4J7RA 3SKOA 5D2XA 1I1XA 2ZCKH 4M1RA 1FLTX 1S7RB 3LCIA 3ARFD 2ICEA 1ICQA 4E9RA 4HULB 2XWDA 1CDUA 1P1VA 4PU2A 4XP4L 5IBXC 2DMCA 2CJ3A 5CHNB 1GOWA 3W56A 4OGYL 4KPHH 4XE5B 1A5SA 1OL0A 3U0HA 3GGWB 1JZ4A 4R8WH 1Z9LA 4FQ1H 1GNXA 4US5A 1OE2A 1R75A 4LRSA 4HCRH 4Y9CA 1LEIA 3UYOD 1R30A 4LLMB 3B8WA 3K2UH 2D2CC 3NL6A 2FWSA 1INEH 3TBSA 2XVPA 1H5BB 5MEND 3ULVC 4WI2A 5FF7A 4KRTA 3U6XS 1UR1A 2FJGA 2J5WA 2NUTB 2FYMA 2QS8A 1GVQA 1OFBA 4TX8A 2RDUA 4IJ3C 1QKZL 3RE0A 2QSVA 5I5IA 3JUZA 3R11A 2W0FB 2PNDA 1HJQA 3PSVA 3JU2A 3R0UA 5CWSB 5IFAL 1AGCB 1FKWA 3PUUA 5CCKH 1F4WL 4QI3A 4WAFA 4C6LA 5I1DB 2PURA 1K6WA 4X2RA 3BQ5A 2JLLA 2MEJB 1CT5A 1JPGA 4K8HA 3C5SB 1USQA 2G4FA 1R2SA 3DUSA 4HUWA 2AQSA 32C2B 3O45A 4LRNL 2Z8WC 4QOKB 2JCWA 1OARL 5ITBL 1PLAA 5L88H 1QR7A 5C7HA 1T89A 3MUGA 3LRSA 4V2XA 2X4PA 2DZXA 3JQOB 1FG9C 1TQXA 3ROOA 5L7XL 7FABH 1IAIM 2QQNH 3N1GC 4PB4A 3THDA 2NDGA 2DIBA 5CUSL 1A6AA 5DMIL 5AVZB 2MCAA 4A55A 1KIRA 5C0BE 1CT8B 1W1PA 4HOZA 2AP2A 2VABA 3T3MB 4E36A 4JCLA 1H3PL 5B1AB 4WO4B 3TWYA 4R7LA 3PUEA 2V5TA 1BX2B 3RY5A 5CF3A 2BSBA 1XBYA 2FO8A 4WW1B 3UA4A 4P3CL 1TO3A 1WD9A 1J88A 1XFPA 2QV2A 4AEFA 3GLCA 1GGOA 3NG5A 5JPNB 1LP9B 3G0SA 2X4UB 4O2EB 4V1DE 2HMCA 2JTYA 4KNUA 1Q72H 4YEEA 1VLWA 4PP2A 3ORJA 1G4RA 3QH3A 3OIXA 1KRCC 1TPXC 4C54A 3UGVA 2F7OA 3CHFA 4FXGB 3BE1H 1BJMA 1OAXH 2BFGA 1XQ4A 3A4DA 2IGFH 4WTZG 4OIFA 1PX8A 1GSKA 1NP2A 4PJXE 1DWFM 4L4VA 4MXQC 2OWWA 4HV8A 1E43A 2KZBA 5ANME 2GK0B 3RBSA 4J3OD 1LQ0A 3WI9A 2HB0A 5HMDA 1XTLA 2MH4A 2H1XA 2J47A 2J4WH 1XZ0A 2ZP0T 1ZLWK 2ALRA 4W70A 2WY3B 1OVDA 3OKLA 2EXOA 6PCYA 1UOZA 1VGEL 2XJLA 2FLRT 4GIRA 1AJ7H 3L0KA 2QADB 2IQ0A 2PUZA 1MNNA 3VIPA 4WZ9A 5J5DA 2G97A 1DLHB 4O1CA 2AJYL 4GT0A 4JO4H 1GVOA 4ZAKB 1SEQL 3GM0A 4NXKA 4RFEA 3C2OA 4L8SA 3C5QA 2BHFA 1CCWB 2ADIA 4YLQT 4HBQA 1WT5C 5IW6B 2HJFB 4NN5B 7REQA 1MCWW 5C09A 4L3EB 5LIKX 5KTLA 1MW2A 2IPGA 5C2BL 4XN7A 3PWNA 1P6BA 4Z9KB 2OJZL 3BQUA 4CC4A 5D93C 2E7MA 5KS9E 3FHEA 4ZMPA 3WQ6A 4BFOA 5LA0A 4CC0A 3MO7A 4KROC 1WWAX 1YEHL 5D8JH 4GRLC 2E25A 2XV2A 3RWDB 4LAZA 2Y7LA 3VXPB 2ZUNA 1HHHB 3CFNA 1AJ2A 4Z1DA 4TO8A 1JWSB 1C5BH 2NOYA 4Y89A 1CFNA 5FO2A 3NJLA 1WTLA 1ZLUH 1AY1H 5LNGA 2H32A 3C0QA 3EOLA 4NZUL 3MSDA 5BQ7B 4CNUA 1XKYA 4DQAA 2IKIA 3D0LA 3MRMB 5C9UA 5HHMD 1R0MA 3V75A 4N90E 1T20B 2DAVA 4HA4A 4PJIB 1SFJA 2WXNA 5MENE 3VNMA 4L9LB 1P4BL 3ITOA 2GIMA 4N0RA 2AS5M 3FTGB 4R26H 4AENA 2OW7A 3WMCA 3UP8A 3K0YA 3JV6B 1R9XA 2C16A 1F1AA 4CD4A 3DUUA 1BEUA 3GHBH 1GZQA 1EGMA 2OXHA 4ZXBA 2Y1VA 4M1DL 4L1TA 4A66A 3SRKA 1E9OB 4ZB0A 4A22A 2XXFA 4L64A 4YVPA 2EVJA 4F7EA 4UAOB 4YDVB 1NAML 4HK5A 1RP9A 4P2QA 2ALDA 2HE8A 1K85A 4IMKC 2IDFA 4RW5A 4FCHA 4MAVA 3DO4A 3THCA 2W95A 3HN8A 2OQJB 4HBCL 2AC0A 1TIMA 3VKAA 3OVRA 3EDKA 4IQDA 4WFGD 4FA7B 4GY0A 3CVHB 1DXIA 5D7LB 4LOCA 3QRGL 5LGYA 2QVIA 5FLUA 3GIVB 1XG3A 4HIJB 3L5XL 2ZA2A 3SSZA 3U6XA 1I8IA 4JFYA 1KBIA 4KOBA 1BRLA 1ME8A 3QG6A 3PG8A 4XN8A 2O4EA 5I1IL 4HQQL 1LBFA 1S5TA 1JRBA 3FCGA 1EANA 3PWGA 4DZ8A 1X96A 2CFFA 4Q4SA 1EJTC 2P5WA 3ECUA 1V79A 4FXKB 5DSCA 3CFTA 4G1MB 5CZSA 2HG5B 3HZVA