1HQTA

The crystal structure of an aldehyde reductase y50f mutant-nadp complex and its implications for substrate binding
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
324
Chain Sequence
AASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIFGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDEHYDE REDUCTASE
publication title The Crystal Structure of an Aldehyde Reductase Y50F Mutant-NADP Complex and its Implications for Substrate Binding
pubmed doi rcsb
source organism Sus scrofa
total genus 103
structure length 324
sequence length 324
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hqtA00
4DBWA 2IPWA 4PRRA 3B3DA 3CASA 2FGBA 4GIEA 4HBKA 4XO6A 1HQTA 4FAMA 4G5DA 4YU1A 4HMNA 3V35A 3EB3A 3UP8A 2PDWA 4IJCA 3GHUA 4EXBA 2BGSA 2PDQA 2INEA 3O3RA 2C91A 2IKIA 5LIKX 3UZZA 1AZ2A 1ZSXA 2DUXA 4JQ1A 3S3GA 3ONBA 3WBYA 4WDUA 4YVVA 1X98A 3LZ3A 1AH0A 4EXAA 2PDHA 3WG6A 3R6IA 1J96A 2PDCA 3FJNA 4H7CA 1YNQA 4XVEA 4XZMX 4YS1A 2R24A 5AZ1A 3N6QA 5AZ0A 2PEVA 3Q65A 2IPJA 3H7UA 1S2AA 4WEVX 3G1RA 1PWLA 2IKJA 4PUUA 3UG8A 3V0SA 4Q7BA 4XO7A 4JQAA 2AGTA 4LB4A 4WRHA 4FALA 4JIRA 3R8HA 3MB9A 2PD5A 2PDJA 3R43A 5C7HA 3KRBA 5M2FX 3LEPA 2ACSA 2HVOA 2NVCA 4IJRA 1LWIA 4GQGA 1ZGDA 3CAVA 3LUTA 2PFHA 3LENA 2IQ0A 4XZNX 3LQGA 4L1XA 1JEZA 3UGRA 2J8TA 4PR4A 1RALA 3R94A 3G5EA 1XF0A 4JTAA 3VXGA 1C9WA 4JIIX 2IQDA 3WBWA 5LIYX 3BV7A 2PDLA 4ICCX 3RX2A 2ISFA 2FZBA 3GHSA 1FRBA 1T40A 1X97A 1XJBA 5HA7A 4WGHA 2IPGA 4XZLX 2PZNA 1XGDA 4GACA 4YVPA 3EAUA 3P2VA 1AFSA 2I17A 1EL3A 3GHRA 3UWEA 2CLPA 1RY8A 1EF3A 2FZ9A 1Z9AA 4XK2A 3CV6A 3M4HA 4GA8A 4NKCA 3D3FA 4GQ0A 1S1RA 3ERPA 1YE4A 1Z3NA 1QRQA 3UYIA 3COTA 2PF8A 5HNUA 2HE8A 1VP5A 3CAQA 4YVXA 5DANA 2PDPA 1PZ1A 2FZ8A 2HVNA 4JQ4A 2PDMA 5JH1A 1MI3A 4JQ3A 3ONCA 3GUGA 3NTYA 2FZDA 3V0TA 4WDTA 5LIWX 4H8NA 4DZ5A 4JTRA 1UR3M 2DV0A 3LNMA 4LAZA 2HDJA 2DUZA 1RY0A 4IGSA 4ZFCA 3MC5A 1ZUAX 4FA3A 1EXBA 3CV7A 1QWKA 4R9OA 1S2CA 3Q67A 4QR6A 2NVDA 1S1PA 3WBXA 1EKOA 3RX3A 3EB4A 1PYFA 4JIHA 3O0KA 5HNTA 1X96A 2R9RA 5KETA 1Z89A 1MZRA 4F40A 3BCJA 1VBJA 2PD9A 4WDXA 1YE6A 4QBXA 3M64A 4JTDA 2HEJA 3LQLA 4GABA 5JH2A 4LAUA 2QXWA 2BGQA 2WZTA 3R58A 4XVDA 3LBOA 1US0A 2F2KA 2PDYA 2ACUA 3R7MA 2A79A 4ASTA 3V0UA 1R38A 4QXIA 3H4GA 2PDXA 2ACRA 3R8GA 2WZMA 2PDBA 3DN5A 3N2TA 4JTQA 3RX4A 4AUBA 1YNPA 1IHIA 4DBSA 3BUVA 1Z8AA 1MRQA 2IPFA 1AH4A 3DOPA 2PDGA 1PZ0A 4JTCA 1IEIA 3CMFA 4FZIA 1SM9A 2IKGA 1Q5MA 2ALRA 4PMJA 3T42A 2FVLA 4L1WA 4OTKA 4DBUA 3GHTA 2PDIA 3BURA 3F7JA 4RPQA 3WCZA 4QX4A 3QKZA 4XZHA 5LIUX 3UZWA 1A80A 2I16A 1LQAA 2HV5A 2IKHA 3LN3A 1M9HA 2ACQA 3LZ5A 4XAPA 4JQ2A 2VDGA 4GCAA 1ZQ5A 2BP1A 3M0IA 3U2CA 4LBRA 4Q3MA 4WDWA 5LIXX 2PDFA 4MHBA 2HE5A 4I5XA 2F38A 3V36A 3UZYA 1T41A 2IS7A 1GVEA 2PDUA 4XZIA 4LB3A 3FX4A 1AZ1A 1PWMA 2INZA 3LD5A 3H7RA 4PUWA 1OG6A 2P5NA 1K8CA 3UFYA 1Q13A 4LBSA 1AH3A 3C3UA 2PDKA 2PDNA 3UZXA 4PRTA 1HW6A 1ADSA
chains in the Genus database with same CATH superfamily
1PHQA 1XLDA 2KZHA 1JIBA 1QFEA 1DXIA 4XO6A 3DFNA 3BL3A 4FAMA 8XIMA 2C1IA 1P6WA 3IVTA 4PL2A 2VGIA 1V6VA 3UA4A 5TBOA 1V4YA 3E2RA 1XD0A 3QHOA 3V3WA 1AQ0A 1P48A 2INEA 2BS9A 2OXNA 3CXOA 1PEZA 1ZJIA 4IQJA 1AA1B 2G3NA 5GNXA 3BJFA 1N7KA 5D2TA 1VFTA 3MUCA 3M43A 2QKFA 1YMYA 1E0TA 2Z1SA 4ZGYA 2PCEA 6XIMA 3R6IA 2PDCA 2HTMA 3FJNA 3JUGA 2OWWA 4HHPA 3FS2A 3OHIA 1R3TA 1EH9A 2CLFA 1TPFA 3SAZA 3LRMA 1H62A 3H24A 1ISYA 1M68A 3LHUA 5EGRA 1UJPA 3WLSA 1Q3NA 3BDKA 3U7BA 2IKJA 1LLWA 3N4FA 5DMLA 3M07A 3TU9A 1FKWA 1MQQA 4HKPA 4CUCA 5M5DA 1ODZA 5CCZA 3B8VA 3FHQA 4NVTA 3MZNA 3UXDA 4BJHA 5D9NA 2ACSA 1WKYA 5A6MA 4PFHA 3ECQA 3OIHA 2DEPA 2WMIB 1J9YA 3SCWA 1XLJA 4L1GA 1C93A 3TJ4A 1HX0A 4LS2A 1DE5A 4DO4A 4FX8A 1HJWA 4GGBA 1QNPA 1EP2A 3O0FA 3PB0A 4AY1A 1MYRA 1ZL1A 2GJRA 1WZAA 4E3VA 4DQWA 4IFRA 4EANA 1JNEA 3P14A 4CD5A 2PDLA 4S39A 1OINA 3TTSA 4GRSA 1S46A 5HWJA 1OWQA 1XIIA 1FRBA 3MDUA 2V5BA 2GLKA 3IAQA 1CXFA 1WX0A 4JNMA 4LW7A 1MFVA 1MQRA 1O5RA 1PIIA 4IP7A 4NU7A 3S1UA 5JMUA 3QKEA 2QGHA 1KCXA 4HNCA 3GTFA 4GQRA 1QNRA 1OK6A 2VHLA 1ENUA 1OYBA 4LS1A 3TYEA 4GIRA 2Y6ZA 3QZEA 3VIMA 1YDVA 2E9LA 3CV6A 2V30A 4IGMA 2Z2AA 3N2XA 2JGYA 4W7UA 4J35A 1J0JA 2CHRA 1OSEA 2DU2A 3RK8A 1YE4A 3BCFA 5FF7A 3H2EA 3RRAA 2HE8A 3WYZA 3HIJA 3NDYA 2PDPA 5E6ZA 3WQ6A 2BY2A 1QHZA 2X42A 2F6KA 2F6UA 2PWHA 2W63A 1V51A 1ZALA 3LA4A 4GCXA 5TD4A 4FXSA 4MWAE 4GUIA 4D6IA 2ZCGA 2HROA 4R85A 2DV0A 5FAGA 3IK4A 3L4WA 3KZPA 3DBPA 3QVQA 3DUGA 1QI5A 1B31A 5FL1A 1PPIA 2E6YA 4MUPA 4QRNA 4S3KA 2WNZA 4TU1A 3STFA 4NIRA 1VCGA 1L2QA 4GX9A 4JN6A 3H4XA 4BQ5A 1NQKA 3WQVA 3GTIA 5EB8A 4B4FA 2GUBA 1W37A 3RCMA 1K8YA 3C0QA 1J10A 4IMGA 1OF8A 2VTFA 3SEPA 1A5NC 3W83A 4WDXA 3TDFA 3IRSA 4M1RA 3HG3A 4QBXA 5LA2A 1PCKA 3KX6A 1W3HA 2XVLA 3R58A 3KVMA 3OA5A 2QEZA 4JN7A 3DGRA 1OX4A 5HPCA 4ALDA 4PB4A 2XVPA 1OT1A 2FZNA 4PC8A 3H4GA 1U5JA 3JW7A 3G2GA 2PDBA 1SO3A 1IT0A 2E5CA 3HBLA 5GJMA 1SFSA 3BQ6A 2HXTA 2QW5A 4H9YA 1C8YA 4H8UA 3EA2A 2FTWA 4DWSB 2VL4A 1BVZA 2NX9A 1X1ZA 3GDRA 2VXNA 3ABZA 4FZIA 3QW4B 3SQMA 4S1FA 2HK0A 1K9EA 3KVJA 2QCDB 2E25A 3FXYA 3G1SA 3KRSA 3R0UA 4M6QA 1EDTA 3F4DA 1IV8A 2J13A 3TTQA 1N8WA 4LUYA 4Z1CA 1B3YA 3W88A 3TWBA 2BV9A 1SO4A 1UC5A 1I1XA 1OIFA 4UQAA 1E1CA 3AHZA 3UY7A 3QZ6A 1YBQA 1M01A 5CPSA 2QCHA 2IKHA 4LVFA 1QW8A 3WDPP 2BWGA 2C1HA 2QV4A 3LI1A 3FFSA 4K1GA 1Z7AA 4JQ2A 1E4IA 4TMCA 3EYPA 4OE7A 3UESA 5C54A 3U2CA 1AK5A 2QJGA 2CC0A 1XYLA 2B7OA 2OO0A 5A6LA 4GZEA 4DJED 3FYOA 3T44A 2HE5A 5CJMA 4ZMGA 1NDVA 3PTMA 1AW2A 1A4LA 1C7SA 2BVYA 2ATSA 1ZU8A 2H8XA 4S3FA 1EYWA 1H51A 1O5XA 4J2PA 2EPMX 3LNPA 2TPSA 3ZSTA 4EOUA 1H7XA 2RAGA 1RZMA 1BYCA 3CWHA 4LVBA 2CBJA 5H8MA 2INZA 3B97A 4H9VA 2EQDA 4LYPA 2Y1HA 5BROA 3OGVA 1ME8A 3J7HA 1TR1A 4W88A 3OLDA 1JJKA 2UWFA 1MXDA 2PDNA 5I0DA 2X2GA 2DIKA 3TZFA 1MO0A 4C1LA 2IPWA 1W1ZA 2NUYA 5I3JA 3DH7A 3EX2A 5LXEA 3UJEA 2FH8A 3PJTA 1BQGA 2VEMA 1GEQA 2W4XA 3W02A 4JBRA 1EP1A 4IISA 3B9AA 3FAXA 1XL9A 1F61A 5D9PA 1ITXA 4PTVA 4QJ4B 4MYAA 4X9SA 2A21A 1OD8A 4ZQNA 5LIKX 4D6HA 3ARZA 2NZLA 3NWRA 3ABXA 5CGMA 4XSLA 5BOFA 3W22A 5CJ5A 2PDHA 5F4SA 4UTTA 3T0TA 3M5ZA 1E9IA 2YCJA 3CJPA 1PUDA 1BWKA 2GSHA 1GJUA 3ZJ7A 1G9HA 4EF8A 3L12A 1LORA 1GYLA 4L80A 1IXPA 2DW7A 1WV2A 4QG6A 5K9XA 5AHIA 1M7PA 2VRQA 3TVAA 3W7OA 1FWTA 2X1IA 2XFYA 5CPMA 3V0SA 1K1DA 4O4VA 1BPLB 1GOWA 3SUVA 3R4IA 2RDTA 4I9JA 3MB9A 3WQWA 1YXCA 5A95A 2CHNA 3A64A 4GZJA 3LK6A 2GDVA 2ZZ2A 1FA2A 1RVGA 1I2QA 3V7PA 4Q4SA 2GJXA 1J93A 5IXEA 1UD4A 2IQ0A 3OYZA 3H6OA 3EXRA 1FTXA 3BQ5A 2WMKA 3LI0A 3DGBA 1JVNA 3EXSA 3L4TA 3BG3A 4OV9A 2V69A 3G5EA 4DNMA 1U83A 1QUMA 1VC4A 2BXZA 3AWOA 1XYBA 3U7VA 4D6JA 5XIAA 3RF9A 2C7FA 3O7UA 2ZRYA 4AC7C 3ZVIA 2YDRA 3OZPA 4ZB2A 4XZLX 1Q7MA 3I6EA 2VELA 5DQPA 5AOUA 3GVVA 3QH2A 1A5OC 1P7TA 1BF2A 1EL3A 1A5SA 3F4CA 4ZQMA 2DZTA 2WHLA 4PTMA 4H2HA 3UNTA 3P62A 2Z4GA 4RE4A 3OBKA 3A3WA 4XIAA 1M7OA 4CU8A 2EKGA 2XIIA 4NKCA 4INFA 2EXOA 3M0VA 3CO8A 1V3KA 1ONEA 4L9YA 1JDCA 4OBTA 3DFOA 1KD0A 4M19A 1ZFJA 3GLCA 4I7WA 1TV5A 5MKGA 3UR8A 3NTYA 1NH6A 3T8LA 2YCLA 4D2JA 2ZUMA 1H7RA 1VYRA 2XUCA 1KXHA 3CM4A 1UA7A 4O19A 5H1WA 3ZS4A 1W9UA 5C71A 3EDKA 4UCGA 3WEMA 2FPVA 1G4EA 3BAKA 3ZR4A 1ZUAX 3E12A 3QJAA 4QCEA 3VABA 3WD0A 3VIHA 4O4WA 1A5CA 4H19A 1EKOA 5MHBA 3M0YA 4FPSA 1KGUA 5LSMA 7REQA 5BRBA 2Y7EA 2QUNA 1MQPA 3QR3A 4X63A 2FJUB 1CENA 4LALA 1TPWA 3DC0A 1I45A 1L0PA 1XPYA 2OPJA 3KOYA 2QJHA 2WNNA 2R8WA 4PTXA 2REQA 4HPHA 3RLVA 4Y90A 4I90A 1V03A 3GAYA 2D24A 4GABA 3A3HA 4HCLA 1AJZA 3P82A 4AIEA 4N2YA 2QDDA 2AQWA 2QMKA 2DJXA 3LBOA 1QASA 1Z41A 2CKSA 1PIGA 3KE0A 1NFPA 3V5FA 5CAKA 3E74A 4NAEA 4C6CA 2BX7A 3MDWA 4BWLC 2GJPA 4S2BA 3SRHA 4AB4A 4O1EA 3WEZA 2VDHA 4IIBA 3MO4A 3EWYA 1J0ZA 5I06A 4WY0A 4ONVA 3SSZA 1M53A 3A22A 4IP4A 3DU0A 3HQ1A 3B04A 3RX4A 4UTKA 3WK0A 3GRIA 4IPNB 2Z2UA 1EO7A 1YHTA 2FHCA 1O95A 2YA2A 3CQJA 1IWAA 1CGWA 1PIFA 3IVUA 4IWWA 2C18A 4LUTB 4TIMA 3UWZA 3PZVA 3LM3A 3PTKA 3SFWA 3MCMA 4CCDA 3MTWA 3VIGA 3L5MA 3MMUA 2NXHA 5LHFA 2ALRA 1TPUA 5CQ1A 1B30A 2D2HA 2W92A 2EG6A 4JY9A 5C9XA 4C6NA 4U4MA 1CIUA 4ATDA 4X2PA 4JNYA 4DELA 3PTDA 3N2CA 1XSJA 2W3ZA 1UKOA 1KWKA 1IIGA 1IWPA 2VMFA 1OYCA 1W91A 1DJXA 2HV5A 1FXQA 1J11A 3WQPA 3O6AA 1NWSA 5FF3A 3H22A 2F7FA 4MZ1A 3FEQA 5JVLA 1JYNA 3TYAA 4HA1A 3W7MA 3SJNA 3NR0A 4LBRA 4Q4MA 1DIEA 3PWGA 2FPTA 1HXJA 3HPFA 3MI3A 4UFJA 3URBA 4YYCA 4H00A 2XIQA 2GVJA 4C7FA 4HA4A 1XFCA 3A9IA 4GJIA 1EUNA 4JFVA 5I3GA 2KX9A 1ESWA 3S1XA 3B9NA 3LPGA 2AGKA 3AIRA 3WD4A 4GUGA 5CPQA 2NQ5A 4F0KA 2PBOA 3H7RA 5KTLA 2WHJA 1RQBA 3OPSA 3S6TA 4M82A 5FI8A 1NF7A 1JZ7A 3GY1A 1B4KA 3M0ZA 4AHOA 4XD4A 2D20A 2BNJA 1A4MA 4IIEA 3I4KA 3RJYA 1B57A 4U3AA 4TOQA 1EHAA 1V3HA 4N7QA 1PB0A 5LNSA 3WKZA 5CG0A 1REQB 3P3BA 4QS6A 4DBWA 3B9OA 1JRCA 1EA0A 3KLLA 3CLWA 2J79A 4D6GA 1K8XA 4NNAA 3G18A 4RKAA 1JQVA 3M0XA 2WQPA 4GY7A 4AVNA 3GXPA 3WBAA 1UD6A 4YTSA 4L9XA 4MB5A 1E3XA 4X0VA 5KINA 3T09A 2VEKA 3L23A 1NOWA 3BO9A 1OFOA 3ORWA 2HK1A 2YXOA 2JKPA 1GT8A 1P5BA 3VUPA 2PTZA 1FCVA 4RXFA 1HT6A 4P7NA 3F5JA 2XVGA 1D9EA 4L4LA 1ZSXA 3AMCA 2FGZA 2YBVA 2ZRWA 4B3LA 4AZ5A 4S38A 1FFRA 2V5KA 1XP3A 2CEQA 1LUCB 4WDUA 1E0XA 5H8UA 4OJYA 1BSLA 2W0UA 4IMAA 4ILSA 4GYPA 2YOCA 3TA6A 4A8IA 1JF5A 4ZQPA 3OVQA 2WJFA 4OKDA 4O15A 1ZAJA 4LFYA 3FKRA 4JTUA 2Y88A 3L68A 1UBPC 2G5WA 2DT1A 4Q32A 1ZB5A 2FVMA 5K7JA 3SB0A 3WJXA 4ZXOA 3LCHA 2QF8A 4EP8C 3ZJ8A 4FB7A 1XYZA 3EEZA 4MM1A 3LTPA 1GZGA 4JQAA 3UPBA 4FALA 4XAFA 3CH9A 4I6VA 5C7HA 4DUWA 1VPXA 5ABEA 3DFTA 3CL7A 2PRHA 4F48A 3TC7A 1IZCA 9CGTA 3WNPA 2ZOXA 4IFKA 2B81A 1X6NA 3AROA 3MPGA 3W7IA 1FWRA 3CB8A 2Q8LA 1S2UA 1MEIA 2D69A 5EMKA 3VKJA 4B5VA 1QR7A 4KIRA 1NU5A 1IXOA 1LOSA 1YRRA 1ZBCA 2VKZG 1QOPA 4IUOA 5F1VA 1ICQA 2WCAA 2ZXDA 3URNA 1OFAA 1EFZA 2ZX7A 4ACZB 1C8QA 1OB0A 3T9PA 4P5UA 4AD3A 4U3CA 3WQ5A 4ZZ9A 2BFGA 3PBYA 1E51A 1VPYA 1QCWA 4RZ6A 4RUBA 3NG3A 1C8XA 3XINA 5HA7A 4D6DA 2ISDA 1UZHA 4GI4A 2FMNA 3KLKA 3OG3A 1OHLA 5A6AA 1FDYA 3BSMA 5FEPA 2VX7A 1FUYA 5DT7A 2VFGA 2J88A 3ZFHA 4C90A 3AUOA 2O55A 1VEOA 4U5KA 4NZ5A 4NT0A 1LRQA 2BY0A 1QI4A 3O6YX 4GA8A 3IJDA 3UCCA 2WSKA 3GB6A 3IV8A 1HP5A 3OBEA 3EZ4A 3H2NA 3LLDA 3ERPA 5T91A 3W00A 4Q4RA 3CAQA 2GQ9A 1S2TA 1U1JA 2FZ8A 3DERA 3G3MA 4E2OA 4DWSD 3MWCA 4A2RA 4EF9A 3GG8A 1H3GA 4UTJA 3ZJ6A 4OOUA 4QLKA 1TWWA 3BOFA 4LVGA 1XBXA 2WAGA 5REQB 3MBFA 1GNXA 1EX1A 4DUVA 4HOWA 1IR2A 5C9ZA 1TMQA 1GOMA 1MDRA 3W71A 4LT9A 1GW9A 1XKYA 1XIMA 3WZ0E 4B4HA 5FIPA 3ARYA 2DZXA 1TG7A 1UKPA 1QI0A 1M65A 5HMSA 1FWIC 1WDPA 1YW1A 1DWHM 3FK4A 3W29A 1YXYA 4FF7A 4MJ2A 3TN4A 2PD9A 2OKTA 4AHQA 2R1PA 3N15A 3BOLA 1VJZA 3URAA 1M6JA 3FGCA 4AWSA 4LAUA 1L6WA 3N4AA 3JZUA 5U7SA 3G1FA 4XVDA 3GXNA 2R94A 5KEZA 2OMAA 3KS5A 3TJXA 4EPKA 3R7MA 4D71A 1KLYA 1HIZA 3EKLA 2Y8VA 3NOYA 2Z1KA 4DJFD 1CXHA 3K8LA 4JN8A 1ZAHA 4GKTA 1TSIA 4A6GA 5AVHA 1IGWA 1TE1A 1HJVA 3KUMA 2Z00A 4XD6A 3W2MA 1DWAM 3VMOA 3ES8A 3RITA 4B5TA 1UP3A 1YTKA 3E1F1 2YBTA 4MWAC 1TVNA 4M81A 2J4GA 4B9YA 1LL6A 2OQLA 3KXQA 1I2RA 2YGYA 1SM9A 1XLFA 1KCKA 4MPKA 2C16A 3W1LA 2H3BA 2FYMA 3ARPA 4NJKA 4X2RA 3NEHA 2WZIA 2WSPA 3CAWA 3O6DA 4QDMA 2NSXA 4QSHA 5BOEA 1E6RA 2HPIA 3SN1A 4QG9A 4XD3A 5GJNA 1YEYA 2R1LA 5T9CE 1M9HA 4QEHA 2WMGA 4KQNA 4D1IA 1HL9A 3HG2A 2V38A 1UIOA 4GCAA 4BQ2A 4LUSB 3F4VA 3AMLA 3NZGA 4HZ8A 4WY0F 2HBXA 3NL3A 5E9AA 3PBUA 1ZBWA 5GQBA 2FVKA 4JICA 5JU6A 1IWBA 3NQGA 1OCJA 1VIWA 3N18A 1C91A 1V7YA 3MHGA 1EJWC 5IM51 3MUXA 1T41A 2RUSA 1GVEA 1UWUA 1VH7A 2I1OA 4HTYA 2VZTA 3TYCA 4QE5A 3SCTA 1UWQA 1SZGA 3W2LA 1E40A 3FX4A 4OBRA 2A5HA 3NYDA 4A8RA 4V15A 1FP8A 2MNRA 2V67A 3MUIA 4BS0A 3KVLA 5DXXA 4UZSA 1FH8A 2BY1A 1E55A 3SJ3A 5EMYA 3BAIA 3V5OA 3VM5A 2PWFA 3JS3A 2I5GA 3S9YA 1FWAC 3L2LA 3SQSA 1SZFA 4MNJA 4Z2KA 3OGSA 2EPLX 2OCZA 1EJUC 5CXPA 2BXVA 2JGQA 2O0TA 1N8IA 4MAVA 4YU1A 5E0KA 4R5EA 1GPFA 4L65A 2X09A 1PZ3A 1UZ1A 3R79A 2O92A 3W53A 3APTA 3S5OA 4R7OA 3EBVA 2ZZ7A 4IFOA 4FEZA 4K8HA 1DJWA 1T5AA 1QW7A 4NQ1A 2NWRA 3H55A 3CQHA 4B5UA 4YPJA 3BJSA 3PB2A 4AX6A 3VINA 3K8KA 1UR9A 4F2UA 2QULA 4GKLA 1WBJA 2WO5A 2QDGA 1XH1A 3SCPA 3WH8A 1CXLA 2WLYA 3CUIA 1OEPA 3GTNA 3S1WA 3RILA 2WXDM 3W7EA 3GD6A 1OX4B 2TMDA 2YDSA 2WMJA 4LXFA 2Y70A 2V63A 1FWFC 2ZTJA 3PF3A 1SPQA 3VKKA 4IXHA 2XSAA 2DZWA 2C13A 2ZZ4A 2ZZ6A 1ZY9A 3BWWA 1ITCA 2B7NA 1YDOA 3W6YA 3WENA 4IJRA 3IGSA 3JU2A 3C3NA 1M7XA 3QMTA 1LYXA 5BWAA 4D6EA 3BLLA 4NI3A 1K9DA 2J8TA 2GDUA 3T6CA 3MSYA 3W1UA 4BZYA 4C6KA 4Y2WA 3H2AA 3ZLFA 3VNIA 4YXGA 5DX7A 3R0DA 1IF2A 1OVDA 4O54A 3VCCA 3PHAA 2J6VA 3ZO9A 4KWVA 4LF1A 1JCYA 2V0TA 4OU1A 2WCGA 4R3UA 4Z0SA 3GNRA 4G6CA 1C3FA 2BTMA 5TNVA 4FR1A 2YX0A 1E1CB 2RGMA 2IMRA 1XJBA 1XM3A 1MNZA 4WGHA 3B0UX 4ADTA 3W7RA 3A24A 3WJWA 5EL1A 1IXQA 3HQPA 3D46A 4AWTA 4BKNA 1SUXA 4DAFA 4UWMA 3WLMA 4PMOA 4AD0A 2FTYA 1OFEA 4HZ7A 4KGJA 1SR0A 4P61A 2P1FA 4ACYA 2E8ZA 2GVEA 3SGZA 1SW0A 3WL1A 5BU9A 1RBLA 3MUAA 3GU2A 4J27A 4MADA 4R53A 1R7AA 4H9UA 1XRTA 2ZE0A 3LMYA 4PMZA 4AEEA 5IRPA 4REQB 2XFWA 1GEHA 4EXQA 3DKJA 2VC9A 1TE6A 4WIWA 2PDMA 3CTLA 1KKOA 3GUGA 4J7RA 1AD4A 1QW9A 4RW3A 1AODA 4HOZA 1FCUA 3IIVA 3N3TA 3DYMA 1TJ0A 3VYLA 4CN6A 4J3WA 3HV9A 3ABSA 1VFUA 3SN4A 3LPOA 1RQEA 3NVDA 5FF2A 1FP9A 4GINA 3GFYA 1AJ2A 5JBDA 5FKYA 3GXIA 1QHPA 5F2IA 1D8CA 3LCXA 4Q6JA 5AECA 2NQLA 1TREA 2R9RA 3PG9A 3A12A 4OT7A 3MVTA 4Z0JA 3EWDA 1VBJA 1H0GA 4C6PA 1HJSA 2J24A 1QHOA 1FXPA 2VQUA 1P43A 3TC6A 1I2NA 4GX8A 2DVXA 4W9TA 4A8LA 3VPLA 3BMWA 5A8NA 1C9DA 3BE7A 1I6NA 1EA9C 2QAFA 4IP5A 1PKYA 1X39A 4ASTA 1TPEA 1VHNA 1R38A 3N34A 3HJEA 5I3IA 4OOZA 1D8WA 4H6EA 3WH9A 4NRSA 1MUWA 1RBOB 4IGHA 2Q3OA 3PFMA 2YLLA 4RE3A 1KWGA 3IJQA 4O10A 1K77A 4LCRA 1TTQA 1QOQA 1W2PA 1P0KA 1Z8AA 4CN1A 3TXVA 1AQHA 4PMRA 4JTKA 2WSQA 4AWEA 4JTCA 2BY3A 3B4YA 2RDXA 3AIEA 4C6DA 3S2MA 3QRHA 4GQBA 2EO7A 1H50A 1RAKA 1GZ1A 2YFNA 4PGLA 2GJXB 2E3ZA 5D33A 3L5LA 1T8QA 3OVGA 3GS6A 1MRAA 2PLMA 4JHZA 4UR8A 4LEFA 5C2GA 2XIOA 5HANA 3M0KA 4MKNA 2BGNE 1NFBA 1LBMA 5A6BD 1PTGA 1PKNA 2OX4A 4BI6A 3PUOA 3VDAA 4FF5A 3E9AA 3W27A 1JI1A 2A6LA 1JPDX 4KFPA 4U28A 1VBUA 3SN0A 5G4HC 4F0HA 2PDFA 4LVDA 3C2VA 3M5VA 4DI9A 4MJZA 3GVWA 4HHLA 1P7TB 3UZYA 1DIDA 2E6FA 1NDWA 3LHTA 4YLWA 3E96A 3NO3A 2IXUA 1TJRA 1FDZA 2ZC8A 2DQXA 2NLYA 2P5NA 1HJUA 2GOKA 1B9BA 2IUZA 3UFYA 3IGUA 3B8UA 1E43A 1E0WA 3MI6A 4C6OA 3G77A 5JBEA 4NJHA 1O94A 4EWND 5LA0A 3R0KA 1K70A 2V2CA 1W54A 2QCLA 3VCRA 3FKKA 1ADSA 2DUAA 1OFBA 1OFQA 2GQ8A 2QIWA 1LWHA 1XLMA 2ZVRA 2CXEA 2VENA 4WOQA 4GIEA 2YCLB 3IANA 1VQTA 3MCNA 2PRLA 2JFEX 3H53A 4KRTA 4AZ7A 1W5MA 2F6XA 2I57A 4M3PA 2VM8A 4CNUA 3I7QA 2UY5A 1RHCA 2YA0A 1GOQA 2YLAA 1NQ6A 1DL3A 1HF6A 2OGJA 4CD6A 3TFXA 3H2MA 3HGOA 2PP3A 5C2XA 4AY8A 3EOOA 2DUXA 2P53A 3RNDA 5JIWA 3LXBA 4HU4A 1JCTA 4FSAA 1R9YA 2FDMA 3NQCA 3SRFA 1R3YA 4AC1X 5A2AA 3VD4A 4EKJA 5CC3A 3DFYA 4EXAA 1DQXA 3MV11 2REQB 3QLDA 1UWAA 4UMCA 3L21A 2GUUA 5KITA 4PUMA 4KKXA 4WD0A 5AFDA 1KXTA 1BYAA 4NAEB 3UGVA 3W3OA 3USBA 3OB8A 3LPPA 4GUHA 3ALGA 1SJCA 1W3LA 3GDMA 4LPCA 1BRLA 2WZEA 3WQEA 4XO7A 2D23A 4WRHA 1ODUA 4LWWA 3MY9A 4Q4KA 3GIQA 3R8HA 1OBAA 5HPOA 2ZKMX 1HGWA 1OZQA 2HCVA 3F2CA 1RA0A 3NO1A 2Z0IA 1ZLPA 3W1QA 3C86A 1WAWA 2EJAA 2QPSA 4DF1A 5I09A 2A2IA 2PP0A 3LGDA 4WKHA 4ZVJA 2X1SA 1RALA 1LTDA 5AHFA 1XIJA 4DBEA 3AIQA 4J3SA 3UJSA 3N2BA 1TV3A 4JEJA 4FR6A 4JIIX 3U2OA 3TSMA 3OO2A 1UZDA 1Q7ZA 4MKSA 4PMQA 1HL2A 3OJGA 4HPNA 3ANUA 3VI2A 4PUNA 3R11A 2BZNA 1T40A 4UTFA 2VR2A 1LOQA 1JUKA 1H1YA 5DCEA 2OWCA 3P81A 5HUPA 5A94A 1VRXA 1BEUA 3ABRA 3W1XA 1LG1A 3B8TA 3M47A 4HCHA 3T7VA 3T4WA 1OCBA 4N9CA 1UIPA 4XK2A 3QQ0A 4NJJA 1Q6RA 2YFOA 3ITTA 2CESA 3UXKA 4XIMA 5AC4A 1WDDA 4GXWA 1TZ7A 4E4FA 1V6WA 1Q6EA 8TIMA 3R13A 3HU7A 2YZRA 3ALFA 4C6IA 3KS6A 4GH1A 3MYOA 2AL2B 3GFZA 2QGYA 5DANA 3T81A 3NUKA 1Q66A 1ME7A 4GIYA 5IOBA 4PMUA 1KFLA 1VBHA 1ISVA 1JD7A 3BLPX 2PWVA 1NIUA 4WJXA 3S5ZA 3E2VA 3UXLA 9RUBA 3G3DA 2A7PA 1ML1A 1Q6OA 1E4LA 2YA1A 1P6BA 2PGEA 1FWNA 3GK0A 3NNTA 3AYVA 1UC4A 4AZBA 5LXXA 3OW1A 3SM0A 3EPOA 1QK2A 1XHGA 1Q2SA 4IQEA 4M1BA 2VUYA 1U1HA 1PYFA 1WZKA 2YIHA 4ZO7A 3IUHA 1DHKA 5A8OA 2HS6A 3GE7A 2DT0A 3BCJA 3GW0A 3LV5A 1KTBA 3NAVA 3PZGA 4P2VA 2V3FA 1NOUA 2HNEA 3L2MA 1YTDA 1JNDA 1DJGA 3CHCA 4NZ4A 3N4EA 4HYRA 2ZRXA 4H8HA 1S3TC 1TPH1 4L4OA 3UA3A 2BB0A 1JYXA 4JDBA 3AMGA 1WKDA 3L7RA 5LGXA 5AHNA 1RBAA 5C70A 2FFIA 3TTEA 1ZPTA 3N2TA 2Z6JA 1KFEA 1YNPA 1BG4A 2DQWA 5AYIA 2IPFA 4PCTA 1VR6A 3SIZA 1AH4A 5KZDA 3KCJA 4UNIA 5EKYA 8CGTA 5LNRA 1XLLA 2XU2A 3MQTA 1E4MM 3HQOA 4UFLA 2VX6A 4XAZA 4GJJA 4K37A 4IFKB 1V0MA 1L8NA 1X7FA 1FX6A 3G1DA 1JGIA 4H01A 1GHRA 3QPZA 4OVXA 4FK9A 1KQZA 4IQLA 1B2YA 5G4WA 2CLIA 4QNEA 1RJRA 4AXKA 4R27A 4O1BA 3GDLA 1A80A 3LU2A 5AHLA 1C8VA 1S5TA 3PUDA 4ZTXA 3NO5A 3ATYA 1R47A 3EDJA 2OTDA 4QLJA 1UKQA 1IEQA 1J4EA 5D9MA 3GZ3A 1CWYA 2F61A 1X6UA 2Z24A 3DECA 4HVXA 3TWAA 3BARA 3RIKA 1A3XA 3UXAA 2Y7DA 3U4AA 5A3HA 4E4PA 3S1GA 4O8RA 3UCDA 4DO7A 4FS9A 3ARSA 3MSGA 2E9MA 1L2UA 3AYTA 3PBVA 1DWFM 1JI2A 1E0VA 1XIBA 4FOKA 1S5NA 4GH3A 2AQVA 1PWMA 3ZR6A 4TVCA 4DJEC 3C0LA 4K7VA 3ATZA 4F0LA 4UUIA 3EDFA 1M41A 2FGLA 2SFPA 3WUEA 2XYLA 2X7VA 3ZVHA 2Z7KA 4IM4A 2ZRUA 4Q8MA 4TX6A 3MP4A 4I9AA 5CZJA 2NX1A 2V68A 3APGA 2GFTA 3UW6A 3W7GA 1MZHA 3AFBA 4AD2A 4V1XA 3PG8A 4MTVA 5K4XA 1PE1A 1IE7C 4F0SA 1MMFA 1RH9A 1ECQA 4F0RA 2G37A 1DPMA 1RQHA 3T1GA 2PURA 5FOOA 3A5FA 7ODCA 4AISA 1X98A 3SCSA 3FYYA 5F2GA 3ITXA 2PZ0A 2QS8A 3PWAA 3RM4A 1EOKA 4IQDA 4H7CA 4W8BA 4H7VA 3QQWA 5LZLA 4HCDA 2VT0A 5J04A 3FGCB 4C6MA 2R24A 5LNUA 3D3AA 1HZYA 1KM2A 2WHMA 3P67A 1XDJA 5BNKA 5HNRA 4B5NA 2FH6A 1S2AA 4PUUA 1GCYA 3C0SA 5FJTA 5C6MA 1RCXB 4UFMA 3F2BA 3RLHA 3FJ6A 3TTYA 3TTOA 4A05A 3IPWA 1UP2A 3QPYA 3H2CA 3VOFA 3O1NA 4D6FA 3LUTA 4O50A 2BHYA 1LBFA 4FXRA 2ZYFA 1D7FA 3W2KA 4KEUA 3GC2A 2P0IA 4Z17A 1WUFA 5DEZA 4ZB5A 3C61A 4I8YA 3CNYA 2D0FA 4NXSA 3TIMA 2WOQA 3TYDA 4Q4OA 3RR4A 4PUKA 3ITGA 5EFFA 3HMJG 5DMMA 3K4WA 3THAA 4FLOA 1G4PA 1XLBA 2FJKA 1QNOA 3WQ8A 2V5JA 2VRJA 2QUTA 4MNLA 2OODA 1K02A 1VGAA 2HNHA 1J0KA 4GACA 4GG9A 2XSXA 3MHFA 4HK6A 5HQEA 3NFUA 5E9XA 2OZ0A 1SFJA 3CU2A 2CITA 2I17A 4IT1A 1HNYA 2J9XA 3EWWA 3H7VA 1TB3A 5DMYA 2CLPA 3CQ0A 1O1HA 3EKZA 2KAUC 1IZKA 3BANA 1GGOA 3SCNA 2G97A 5GJPA 5I2UA 1E6QM 4GQ0A 1W8SA 2FHBA 2WNQA 2BVTA 1TV7A 2X1UA 3QV6A 1GW1A 1UZ4A 4EPEC 1UD2A 1WDSA 4YVXA 3EA1A 4CQAA 2GUYA 3O16A 4YWIA 1MWOA 1MI3A 3U57A 5DY2A 2FZDA 1XLGA 3E0LA 3EWXA 5EMUA 1BTMA 2P10A 5CSUA 3DX5A 2E9BA 1EJXC 1O7AA 1SJBA 1OCQA 1F76A 3EOUA 3EX4A 2TAAA 4JZ5A 1S2CA 1X8FA 4PULA 3AIBA 5EU9A 3G0SA 5A8QA 2CFFA 3CZKA 1TZZA 1YPXA 3TH6A 2W27A 2XGIA 4XKYA 3TFCA 1LWJA 3GR7A 4GO8A 4GUFA 5KZMA 3SBFA 4WSKA 1MZRA 2CZEA 3B8SA 1IXNA 1B4EA 1CEOA 2YW4A 5CH9A 3NPXA 2QXWA 4GBDA 4J2MA 4LC6A 3ARWA 4WJEA 1WZLA 4UC5A 3WK3A 3B8WA 2PLJA 3V0UA 2NVAA 3AHTA 1RLCL 1YADA 4WZHA 2OYMA 4P8UA 3M0HA 1CCWB 4NI8A 2D2JA 3V1PA 4Q8NA 4FP1A 1E1FA 1GG0A 2HJPA 4TTUA 4HPXA 3NURA 1G0CA 3PC0A 4AUBA 4XB3A 2PWGA 3P7YA 1BFNA 3QC0A 3NOEA 1MRQA 2WJEA 1XS2A 3O05A 4GC4A 4ZL1A 3Q45A 4DZHA 3WQCA 1MXSA 2PDGA 4GY1A 4IH3A 1HP4A 5I03A 3LTSA 2G8ZA 5CJNA 4FXFA 2OZ3A 4QTGA 3TMQA 1I0BA 2CBUA 3HN3A 3MCOA 4IIFA 3LXCA 3T42A 1XLCA 5C9UA 4U33A 2FVLA 1JRBA 1SZEA 4WXZA 1SW3A 3TCSA 2A3AA 1LOLA 3T40A 1W3NA 3U5UA 1EGZA 1I9CB 4XAYA 4F4RA 2OYKA 3M5XA 3O06A 5I3FA 4Y9AA 5MF5A 5D4YA 4Q8UA 4JKMA 2WJZA 3ITYA 4O1CA 2HSAA 4JOMA 3LZ5A 5F4WA 4GGHA 5HINA 5B80A 2XN0A 1XYCA 4W93A 3V1HA 5M3WA 4G8TA 4LJ3A 4PSPA 3BW2A 4A35A 3DG6A 3CHEA 1XBVA 1E5NA 2QJIA 2OVLA 3ZT7A 3ZT6A 1U5VA 5CC6A 3QLLA 4YNGA 1B3XA 1WKFA 4KWSA 1VHCA 1G4SA 3IIXA 4A3UA 1F8MA 4MG4A 3AWNA 3VMNA 4IMDA 3F5LA 3K46A 1XX1A 3S9IA 4DB7A 1DYSA 1EB3A 2E8YA 1J01A 3KM8A 2ZTKA 4R34A 4PUWA 1OG6A 5H8PA 4JX4A 4H9TA 4C1NA 4PUJA 3JZEA 3PBWA 1Q13A 3WSUA 2VZUA 4TX9A 2VD9A 3THCA 1EJTC 1KRMA 1WZMA 1VLIA 3BSGA 1CZ1A 3L9CA 4EIVA 1FH7A 1BD0A 4PMVA 3WUGA 2G50A 1O4UA 5E6YA 5I3KA 5BU6A 3SADA 4LX4A 5JIPA 2ONEA 4IIHA 3F4WA 1E9ZB 4B2DA 1KRCC 4V1YA 4FNTA 3TYUA 3CQIA 2VNCA 2EBNA 3ITCA 4UOQA 3EB3A 1POKA 4LYQA 1OQFA 1YPFA 5ABGA 5FEZA 3W74A 1Y65A 2EKCA 1Q6GA 5HBFA 1V3JA 4ES4A 2DDXA 1U5HA 4AZ6A 4Q8QA 1R3VA 4YVVA 1AH0A 2OLSA 3IIOA 1WPCA 2E77A 1R3SA 1UWTA 1UKSA 1KM3A 3LCWA 4YS1A 3ZIZA 4O1FA 3AIUA 2PGRA 4PCFA 4G1KA 1JCNA 2XZ7A 3CPRA 1B3OA 1TPB1 1RD6A 3NQVA 1K4GA 1K7FA 4MWAB 1N2VA 4XISA 3T8QA 2DSZA 1HJQA 1NAL1 1V93A 3P6LA 2YL8A 3GXTA 1OX6A 2A6NA 4JXCA 2W6RA 1RPKA 3RFAA 3CAVA 5D38A 3LENA 3EX1A 1KR1A 2J74A 3AXKA 4HMDA 4OQVA 2EG8A 3W1RA 4AH7A 3PBGA 1RVKA 2RGLA 4B92A 2DT2A 1Z6KA 1PO9A 1UA3A 1WOBA 1QPNA 4ERGA 1H09A 2GSEA 2ZZ5A 1X7IA 5EBAA 4KMQA 3UQNA 5CLTA 4PMNA 4PZVA 1R30A 2OSYA 4Z08A 1W9BM 2QMJA 3W70A 4S3GA 4LNYA 3NQFA 5LHEA 7PTDA 2EPNA 1WXJA 4MY9A 1BLIA 3BC9A 1X97A 3IS4A 2ZWYA 4FO4A 3TAOA 4BI5A 4FOUA 2V2DA 2DFAA 3UXIA 1ITQA 1A47A 3KTXA 1TV2A 3QMSA 3STPA 1BXBA 1E0UA 3IJ8A 3O15A 4H4IA 4E2VA 3RCYA 6ENLA 1QO2A 5EMLA 1TJ2A 3NQ6A 1A5MC 2DSVA 2IQTA 2QJJA 4GLEA 4C60A 3OODA 3RGTA 4DX3A 1Z3NA 4UNLA 1MEHA 4XQ6A 2QVNA 1V3MA 1K4HA 4GISA 3EDDA 4G9PA 1VFSA 3I4EA 1LL7A 1QWGA 3R2GA 2C15A 2OT0A 5CPNA 1JPHA 1F7BA 3GKFA 4C6EA 3ME3A 4DYKA 4LAKA 4F66A 3LNMA 1T99A 3LTYA 2PODA 3D5HA 4LU0A 4QS5A 4CD7A 2VFFA 3NVTA 4X9YA 2G41A 3A23A 2AAMA 3IV3A 1AL8A 4XZBA 3QSTA 4PTNA 4CCCA 2ZE3A 5G1YA 3B0PA 3STCA 1RK6A 4TMBA 1N82A 4E2DA 3CV7A 1QWKA 4UR7A 5A69A 1DTNA 3S47A 3NSXA 4B91A 3Q67A 4DWSC 4AZCA 3PPCA 4A22A 2JEPA 5FACA 4WSHA 3T78A 3EGJA 5AYXA 1XH0A 4JIHA 2G4FA 3ITOA 3BK0A 6TIMA 2PGFA 3CPGA 1QAPA 2VC7A 3HO8A 3BAJA 4P7RA 4M8UA 1TQJA 1R2RA 4JTJA 5CGTA 2GJNA 2GSJA 4XBSA 4JL2A 1GKPA 2WVVA 1K6AA 4HNNA 2Z28A 2HZGA 4JTFA 5CZKA 1VBGA 9XIAA 4ZSUA 2WC4A 3NL2A 2Y63A 4GO9A 3T0BA 3U5YA 1TMHA 5BMWA 2JE8A 3O63A 4GI9A 1XV8A 2PWEA 3L0GA 3RDKA 3E2SA 3VDHA 1RCOB 1PX8A 1V77A 1BRLB 2OQHA 3K30A 4RW5A 4DJFC 3FCPA 1IEIA 4ADUA 1UCWA 3W26A 1N55A 1UHVA 3EWZA 4ERIA 3BMXA 3HMCA 1R46A 2PSNA 3UPWA 1Q8AA 3KL5A 4OIFA 1GVQA 2QR6A 4RZBA 3EA3A 3TUUA 2WANA 2I14A 3T0DA 1E5JA 1K9TA 4HK7A 1CGXA 3FV9A 3GHTA 3R25A 2CLLA 1QT1A 1CB2A 5ABHA 1XGEA 4ROQA 2YYTA 3MS8A 2Y2WA 2OU4A 3UY8A 2RDUA 4O16A 1DQWA 4IUGA 3IJLA 2CCRA 4LH8A 3WN6A 1DJQA 3EMZA 3T0AA 8RUCA 1EC7A 2OEJA 3FN9A 4NHVA 3WF4A 2X0SA 4GJ1A 1JZ8A 3GQYA 4C6LA 1D2KA 3WELA 1XYFA 3IAPA 4CCEA 3IK2A 3VIFA 3WLPA 1G4TA 4O13A 4CQCA 4XBKA 2BDQA 1DWIM 2PGWA 4GBUA 4CU6A 3UEQA 1FH9A 3N9RA 1S39A 2WMHA 2P3ZA 4FLSA 1EBHA 3HF3A 2WBGA 2GVGA 4K8EA 4CNOA 4C6QA 1DXFA 3UPMA 1MSSA 3CZGA 3CMJA 4UQCA 2YCIX 3AQUA 3R12A 4RDZA 3FXGA 3C3UA 4H1ZA 2PDKA 1FWJC 4K3ZA 4PFMA 1WCGA 3UZXA 2QQ6A 3FIGA 1IIHA 4N9BA 1LLZA 4DXVA 1UR0A 2C1GA 4D72A 4K36A 4GNVA 3GU9A 2LLEA 4LUSA 3WF0A 3W1NA 4KWOA 3WMCA 1C29A 3N6HA 4UCFA 3ZOAA 5AKQA 5AYZA 1UW9A 1KBIA 3VC6A 2XH2A 3W7CA 4YTRA 4CQBA 1J0IA 2OX1A 2QLYA 3LSCA 3WX7A 1UWRA 4HJFA 1Y5XA 4IJCA 2Y8KA 1F74A 3H26A 1ZBKA 4JX5A 3G8RA 3SRDA 3F03K 2C8NA 2V82A 2UY3A 5H2ZA 1V5XA 1QPOA 1KLZA 2UV8G 3PVFA 4BEUA 2CW6A 5FJIA 2XWEA 3B9DA 3OOQA 3PK7A 3VNMA 2J7HA 4BI7A 2NQZA 1YNQA 2AMXA 3QYSA 3NQ2A 2XPKA 1GQKA 4C6JA 3W6LA 3Q65A 3TQKA 3E6EA 4JL1A 1W3TA 1I1WA 4W7WA 3UVIA 3OZYA 3MKVA 2BHUA 2CKRA 2OGYA 1PZ2A 4R7JA 3PPHA 3VTRA 2PD5A 4FOJA 1JXKA 4HMCA 1CGVA 3W0KA 4RNJA 5LKYA 3KRUA 3L4XA 1OC5A 2QNEA 3I3EA 1XIDA 4MIMA 1SR9A 1JEZA 3OG2A 4NZJA 1E6NA 3BV4A 3GIYA 2W91A 1F8IA 2PAJA 1F3EA 2V5DA 3F5KA 3HPAA 5HK4A 3KFTA 2ZXQA 2ZDRA 3NDOA 4ORIA 1K3UA 5ENLA 1OC7A 2ZQ0A 1CI1A 4AD1A 2CWXA 3EOSA 5LIYX 4GK8A 1TUXA 2J9ZA 2EGZA 1RV8A 2VGBA 4BY3A 3ITVA 4LTSA 4FNSA 4QDPA 3CT2A 4UTLA 1YYAA 2DSUA 2BVDA 2HRWA 1NEYA 1SQ7A 4ZBCA 4DHGA 2JIEA 1U1UA 5BRQA 5G1TA 1NTHA 2F8QA 1XGDA 4A8NA 1VFFA 3CK5A 4GZIA 1EF2A 2QUUA 4FIRA 3O07A 1SSDA 1L6YA 2OR2A 1S2WA 4CQ8A 1A49A 2VWTA 4HK5A 5XIMA 1DJZA 1NOFA 2JF6A 2PUZA 2CZFA 4CNNA 1O1ZA 2Y24A 4GHRA 1SJAA 3R10A 1R2TA 4HJWA 3ZLGA 4L4MA 2RKXA 1US2A 2A3LA 4BCEA 3BLDA 3FEMA 4RPPA 4DNHA 3I3DA 1QRQA 1HO4A 4OWGA 3RYSA 1TJ1A 2XFRA 4LV4A 1KRBC 1K6WA 3WUFA 4KCUA 2P0OA 3STGA 4H6QA 3K2GA 3W7KA 2YKKA 4XZ9A 2ZXAA 1IEVA 5GPRA 5AC6A 3ANVA 4LAZA 2EPOA 3ZVHB 3CUFA 1WE5A 3VO0A 2B31A 1H11A 4CEUC 3VGEA 2PRMA 3I6TA 2TRSA 2FPYA 4PYSA 4QDWA 3ZWSA 2ZADA 4M7SA 4R9OA 3WNNA 2E5BA 2HMCA 1LQ0A 3OYXA 1AMYA 4F2BA 1H2JA 4HU8A 1AW5A 2UZ9A 3PZMA 1KBBA 4NYYA 1M7JA 1LROA 2HVMA 3BAYA 4E3TA 4XX6A 1Q8JA 1UOKA 4MAZA 3K4DA 2D3NA 4REQA 2BGQA 1HVQA 2DVUA 3W2NA 3PSWA 4PBEA 3VD3A 4DLFA 1TA3A 4AD5A 4KCVA 2P3EA 3ZT5A 2HXUA 2A79A 4M6UA 1TWDA 3CMGA 4YJ5A 2ZDSA 2I7GA 3CUGA 3BG5A 1R0MA 2B7QA 1G7VA 2ACRA 3R8GA 3PWIA 1GYNA 3E5PA 4MLJA 1XUUA 4DBSA 4Q4PA 2OSWA 3SUUA 3BUVA 2R1MA 3WO8A 3SY5A 3W1PA 4E5TA 4OFCA 3DOPA 1PZ0A 4MSSA 4U2ZA 3C8NA 3A3XA 3GG7A 2GK1A 7A3HA 1I0DA 3VNZA 1PVNA 3WLOA 3RCNA 3G1XA 5HJXA 1D3CA 4PCNA 1K03A 1FKXA 1IQ8A 1I2PA 2VX4A 5F1UA 1FWSA 2AQOA 4CVUA 2H3DA 4US5D 1QMLA 1F6YA 5AHEA 3CZEA 2JK2A 3NL5A 4Q8PA 1LCOA 1QPRA 1GQNA 1KFBA 2P8BA 1W5QA 3EMCA 3GXDA 2BG5A 3S9ZA 2D22A 3W2UA 3B9EA 5K4ZA 1MEWA 3LHVA 3LHYA 1F2JA 5FA5A 4MZYA 4HNUA 2E6AA 4H41A 2BMBA 1L6GA 5LIXX 2CZVA 4LAOA 3LB0A 1ZCOA 1PKMA 4D1JA 4JTHA 4JTTA 3GVGA 3FDGA 2PA6A 3LLXA 4CLMA 3S6DA 2EPHA 3RXZA 3DHFA 4J3UA 3RM8A 4ZEPA 3WDQA 4MWAD 1UUMA 4O53A 1ICSA 3L0NA 1PAMA 4JNZA 3G6MA 3LBCA 4ZR8A 4P8XA 2Z27A 1WUEA 3DG3A 1D3GA 4QG8A 4AU0A 4WQ6A 5I24A 4TTGA 1W3IA 1UJQA 4IICA 4L7ZA 2DZVA 3L67A 5K3VA 5AVNA 1HQTA 1W0MA 1UPPA 4O14A 1FVPA 1W1A1 1CYGA 5A6KA 3GKAA 1KFKA 2XM2A 4H9XA 3BGAA 4EXBA 2V81A 5H6HA 2WVTA 4A21A 2A3HA 2E6DA 5GVJA 1BGAA 1V6YA 3TONA 2DORA 2ISVA 3C52A 1TR9A 2WK2A 1AZ2A 2G96A 3QXBA 3N29A 5CPLA 3TCEA 3RUBL 3R8RA 1XWYA 2FB2A 4XKYB 2ZUUA 4NZCA 1FWWA 1P4CA 4XAGA 4UMAA 4GOAA 4DO6A 2POTA 3TQPA 2PEVA 1BSIA 3SGGA 2IPJA 3ZMRA 5EYWA 3GTXA 3S2NA 4RX0A 2X8RA 3PY2A 2J27A 2QIIA 1EYEA 4EPDC 1M04A 4JIRA 3NQMA 5M2FX 3TZNA 3C8FA 2GVLA 2XGZA 4N4PA 4S3BA 2NV9A 1LDCA 3PUEA 4JPGA 4HN4A 3UJ2A 4IPJA 3NQBA 4JIPA 3JR2A 2Y7FA 2X40A 4GFSA 3RHGA 4XG1A 1NP0A 3AC0A 3S46A 3H21A 1BXCA 2CYGA 1EC9A 1KTCA 1GUVA 3UR7A 3CTTA 5C2CA 4XUYA 2VD8A 2O7SA 4WKFA 5D32A 3TXZA 3DZ1A 1FCBA 3KOWA 4KGLA 3LM7A 3A13A 3MU7A 1ISXA 2FZBA 3MMTA 3UU0A 1JZ6A 1EIBA 4W87A 5CZ0A 1FQ0A 5D8ZA 4NASA 3CV2A 2FKPA 3M6YA 3WNOA 3WJYA 2D2GA 4GE8A 1ZJAA 3VGDA 1NDYA 3MO7A 2WBKA 3CUHA 1RY8A 1V3IA 1ZCCA 1FOBA 1EJ7L 3CL8A 1A3WA 3HPXA 1XICA 1HKMA 1B90A 5DELA 4PMDA 2PWDA 3WF1A 2Q8XA 1OABA 2WMFA 3RMEA 4QJ3B 2E4TA 4AQLA 3CEUA 1TIWA 4W85A 4C5YA 3LCLA 1TTJA 1E73M 4DXKA 3E3HA 1L6FA 1NARA 1TRDA 4NY2A 4ADSA 2OSXA 5SWUA 2P76A 1V7AA 3M41A 5TIMA 4IX0A 1XSKA 4HSOA 2C0AA 4UZUA 3INPA 4C1NB 5TAOA 5E09A 2WB5A 3T08A 1FHDA 5LIWX 3VK5A 3AU2A 4DZ5A 5EMMA 4UFIA 4I6KA 4GMEA 3BZJA 1XLAA 3CH0A 1D3HA 3WLTA 2ABAA 3C0JA 2ODOA 3QEZA 1Q2RA 1XINA 5KZ6A 2AKMA 1S1PA 5CZTA 2YB4A 1XCFA 4CNSA 2X16A 1F05A 1VYPX 4WOZA 1XBZA 4O52A 4WHBA 3TR9A 1Z89A 5D05A 3WLKX 4RLIA 3UWWA 3VILA 2ZZ3A 4JFWA 2YBUA 1PS9A 2Q8ZA 5AYYA 4KESA 2AL2A 4RCXA 3MMDA 1SO5A 1TKKA 1JFHA 6ALDA 4LF2A 4LVAA 4GYKA 4FNUA 1JGMA 2ACUA 2DP3A 2R6OA 1KCZA 1H7OA 5I3HA 4EX4A 3AHYA 3ZYZA 1KA9F 3KW3A 3U9IA 4MNMA 4JTQA 2XG9A 4JFTA 3VAVA 5HUOA 4PMXA 3LLFA 3VIOA 3SUTA 4AXNA 1JF6A 2JKEA 1ICPA 1ZTVA 1ONWA 3TJIA 1U30A 2DGAA 3TN3A 4JEQA 2NQ9A 3LGGA 4O28A 3DHUA 3NSMA 2OEMA 1FHLA 3P93A 1OFPA 3WH7A 2Y85A 3N19B 8XIAA 2D3LA 4CCZA 2XVNA 1J0HA 3DYPA 4A29A 3HPSA 1W9DM 3WJSA 3EWUA 1ZJHA 2O4QA 3DFHA 4XZHA 1XCWA 3UZ5A 2J62A 1R85A 4C91A 2DJLA 1DJHA 2ZRZA 3GDKA 1A5UA 5I79A 5A1AA 1E56A 4JY8A 1O60A 3AXMA 1Y8BA 4HNOA 2PPGA 1JXJA 2QT3A 3FJLA 4NJIA 1TV4A 1F3TA 2BP1A 3U48A 1JCMP 2Y89A 1WP6A 1KRAC 2O4MA 1G69A 3SUSA 3VGFA 1FCQA 3UD6A 4MHBA 1JDEA 3L5AA 1XC4A 1YDYA 5LNVA 2RDWA 3R89A 4MNKA 1SU5A 4ORMA 3LCFA 4XZIA 1GOKA 5BXTA 2V9DA 3KOZA 3BGJA 1MW0A 6A3HA 3E38A 1DKWA 3EOLA 4P7QA 1FWDC 3HFYA 3UF9A 1MUCA 2XIMA 3QOMA 1QXLA 5FEXA 1R3QA 2X41A 3CASA 2ZC1A 5D9OA 4LV9A 4ZQOA 4QAIA 1GVFA 3QY8A 4C7GA 4CEXC 4O17A 4NSBA 4Z1BA 3AYRA 3QOKA 4YN5A 5U4NA 1UD8A 4YMZA 3NCOA 5IDZA 2TYSA 4ZOAA 3UP8A 2JIWA 4C1KA 3VKDA 1LRNA 5PTDA 1RP9A 3VX1A 1PL9A 2PDQA 2X05A 2X2YA 4AZCB 1F6PA 4UIOA 2XIBA 3VNLA 1RK5A 2AKZA 4JQ1A 4HOXA 1UR1A 2CZ5A 5CEWA 3CYJA 4M6PA 4UOZA 1U22A 2QYGA 3MVIA 3ZZ1A 1TFVA 1W9PA 4KT2A 4UBPC 3E49A 4H6RA 1BG9A 2C6QA 3AUJA 1JZ4A 4XVEA 4RJEA 2HS8A 2P8CA 1CLXA 3BVJA 3PZUA 4P8VA 2NLIA 2Q01A 2NQJA 4G2DA 3H7UA 3KHJA 2O9PA 1FWBC 3GIPA 4PCSA 1XIFA 3IUDA 2WVVB 4J3TA 3HQNA 4YHGA 1KV5A 3PZQA 2PTXA 3URQA 4LB4A 4LANA 4OBSA 3S2JA 5AYBA 3DCPA 3KRBA 3LDVA 5CGQA 1BVWA 1VEMA 4MLRA 4GC3A 3P8IA 3HJZA 3W7HA 5BRPA 1UROA 4F9JA 1VJIA 3T4CA 5E1QA 5GNZA 3W72A 1RXOB 3SCUA 2DZSA 3RLGA 4HTBA 1M5WA 3P0WA 5A8MA 2OQYA 3QGKC 4BEQA 4HPJA 3ARTA 4MF4A 4BWLA 5DT5A 1EPVA 3A4XA 5LYRA 4DPPA 3VXGA 4W5ZA 1V0LA 5AC8A 5CBIA 3EDEA 4KETA 1H7NA 4JIEA 4J4KA 5JBFA 3GFXA 1OIMA 3C2YA 4NNCA 3OEXA 5FEWA 2B0MA 3POCA 3O2LA 2ICSA 4UR9A 3VE9A 4MKVA 2PF0A 5M17A 3I65A 4KFOA 4UXDA 3EAUA 4UTHA 3P2VA 1GJWA 2E5DA 1Z48A 4B90A 4AEFA 3KEHA 1MVYA 3QBUA 4OZOA 5I78A 1TYGA 1EF3A 4Z2JA 2ANUA 3G0UA 1DWGM 3WF3A 3WUBA 4KFNA 3DFPA 3UZJA 1E6PA 2XFFA 3KTCA 1Y5WA 1LT7A 1G7UA 1ZS2A 2I5QA 2PF8A 5I07A 3VD9A 4XKMA 1VP5A 5L9FA 5CSSA 3M0MA 4IPIA 1UG6A 1HG3A 4ROPA 4AHPA 1UKTA 1A0CA 2YCEA 3TMLA 3QFWA 3CS2A 4UTTC 4QHRA 3UCQA 1H0IA 5FSDC 1EIXA 5D03A 4AW7A 4UNKA 2PC8A 1Q6FA 2EAWA 2OOGA 3N13A 2IW0A 3UWQA 4HD5A 4OUIA 1GWJA 1JL8A 3WNLA 2HDJA 4P8WA 3HFTA 5L6UA 4UQDA 1AQMA 2OZTA 2BSLA 3DENA 1ADOA 4B9ZA 2XGBA 3B0YA 3CPUA 2XN2A 2ZRVA 2NVDA 3O9NA 4CU7A 4UQ9A 3VFLA 1UD3A 4I5UA 1KO0A 1Y5VA 3S6OA 1W9VA 3KCOA 4NZ3A 1JZ3A 3VGBA 1JYWA 1ONRA 3GU1A 1O5KA 1LZOA 4JTDA 3TN6A 2BHZA 1VBRA 1EEPA 4LRSA 4AIUA 4I9TA 1QDSA 1MDLA 3GDBA 4ZE5A 1W3KA 2HBVA 2QCMA 6XIAA 5JXQA 1GTHA 5FJRA 4Z1DA 1KBJA 2PDXA 4S2CA 3LX9A 4MJ4A 2Q71A 3MV01 3HM7A 3M7WA 1VS1A 4LCQA 3SZ8A 4B3KA 2ZUVA 4ICMA 2YJQA 3EEGA 3AJ7A 1VKFA 2C3ZA 3MJYA 5ABTA 4UB9A 4M29A 4QGCA 4S3JA 2CLEA 4LCSA 2BVWA 1CLVA 3OZOA 4JX6A 1GZJA 2QHAA 1XDLA 3TLLA 3NQAA 4FIQA 1B54A 4PODA 3WL0A 2EF9A 4AZGA 2WLZA 3VKBA 1K7XA 2XINA 1OX5A 3PPFA 4DI8A 4AYGA 3ABOA 2Y61A 3WLQA 4HN8A 4E0CA 1GQJA 1EGVA 3KL3A 4RPQA 3SECA 4QIUA 4EAMA 4TXEA 2FHFA 5DCBA 3TYZA 1W3JA 3IACA 2H8ZA 2FB3A 1S5MA 3LN3A 4U10A 4AZHA 3W24A 3TV8A 4RNFA 1L6SA 4Z2IA 3TROA 1XYAA 2VGGA 1E71M 1A5AA 1ZRQA 3TOYA 4CKQA 3PANA 4WDWA 4F8XA 4E2BA 5CSYA 4L64A 3CV1A 1R2SA 2OLHA 4RK8A 4TVUA 3H54A 2FMOA 4QITA 4BF5A 4PE8A 1BKSA 1EJSC 5J8LA 3BAWA 1ZZMA 2E68A 4IHCA 3TAKA 3ANYA 1PDYA 1TO3A 4AVFA 3K4AA 3FSTA 2ISSA 3ID7A 4X22A 2R1NA 3MSRA 3LSBA 3K1DA 3AMDA 3PNUA 5FF4A 5KZEA 1KKRA 4MB1A 1EDGA 2OT1A 2I9EA 2P50A 5RUBA 4FNRA 1HKIA 1KM0A 3REQA 5IBXC 2QCNA 1EHNA 3RU8X 3W1MA 1VFOA 4PRRA 2I56A 4K7YA 3EKGA 1I60A 4NAFA 1V02E 2WKLA 1Y7VA 4FLRA 4AF0A 1QBAA 1KM4A 1KFWA 1XD1A 2DH2A 4LS0A 4UMBA 3RO6A 1V6UA 4LUIA 3UG3A 3HA1A 4MUZA 3UZZA 1DJIA 3S0CA 1BYBA 4JTIA 2WSYA 4J3XA 1EQPA 1ALDA 2QCEA 1ZBVA 3CQKA 4DJDC 1DORA 3M5YA 5JQ9A 3WG6A 2GGHA 3L4ZA 1J96A 1VLWA 1VPQA 3AS2A 3D47A 3NZQA 1JCLA 1NWUA 3TKFA 4IG2A 3DEQA 1F9CA 2CLOA 4ZFMA 4HGXA 2CZDA 2FLIA 4E6MA 1I75A 4MOZA 3VD7A 1TA3B 4WKAA 4JAWA 1A5LC 4WEVX 3AZRA 1KCLA 3PJXA 4US5A 4K8GA 3EX6A 1B5TA 1PX3A 4HNLA 3A4WA 3PN8A 4BA0A 5D02A 2CBIA 4RZ4A 3RU6A 4JCLA 3LEPA 3Q4DA 4K6AA 1OD0A 4XV0A 1KB3A 3VNKA 4E8GA 3KL0A 1OYAA 3SFKA 2CU0A 4K2SA 4JTGA 3WFZA 2WPBA 1H5YA 1LG2A 5C0QA 1R3RA 4NL1A 3P84A 2VYOA 2GK1B 4F3HA 1AJ0A 4IIDA 3LPFA 4QISA 4U5IA 1VF8A 2A0NA 1CBGA 1TV8A 4P7OA 1C9WA 2QDEA 3B0XA 4PRWA 1QATA 4KPLA 3MJMA 1DEDA 3PTQA 3WIJA 5D37A 2YL9A 4ENLA 4EAYA 4JTLA 1GG1A 1NWRA 4B2DD 2Y8UA 3QZAA 4MWAA 1LT8A 3GTHA 1H63A 1YXDA 2DPEA 3P74A 2NUXA 1N8FA 2VOTA 2GL5A 4GPNA 4G7FA 3N73A 1PX4A 3DYOA 4DF2A 3W7NA 1YKWA 1OGBA 3WQFA 2Y5JA 1KGXA 1TWIA 1W1IE 3WNMA 4QQ3A 1RLDA 1UPMB 2WZHA 1US3A 2PP1A 3CZJA 4UTIA 3M4HA 1H1ZA 1R8LA 2ZBTA 4DIAA 1A50A 4WXYA 3AMKA 3C2FA 5DRCA 3OA3A 5I02A 4M80A 5CG7A 3OLIA 3GH4A 3MT1A 1LP6A 1FWEC 4WDTA 4GYPC 1EWEA 2X30A 2VFEA 1KBLA 3W01A 5DN1A 4IMEA 5BMXA 3GC5A 3AAMA 1SJDA 3TOPA 2WV8A 2Z1XA 4DRSA 3U3HA 4FA3A 1OJXA 1PKLA 3U6WA 4MVAA 2PLKA 3VZXA 2J7CA 3BH4A 4N0RA 3HURA 1T96A 1CX9A 3EB4A 3CEPA 2GWGA 1XRSA 2XZ9A 1HN1A 1EBGA 1YPIA 4I9MA 3G1VA 3H4WA 2CHOA 1P0EA 4NX5A 1TX0A 1R5YA 5HNNA 3ARQA 4GI8A 3ICJA 2HEJA 3W75A 2ABBA 1XYMA 3UYCA 1LL4A 3BJTA 3P80A 4X0NA 2PDYA 5FF0A 2BODX 4O11A 1PSCA 3W1TA 4RE2A 3UG5A 1VCFA 1OY0A 4IX2A 2G3FA 3VKAA 1NVMA 4L56A 3QR1A 3A21A 1SW7A 2VRKA 1WBHA 3DXIA 3NQ8A 5FSEC 5M03A 3TK7A 1J2WA 3GM8A 2WM0A 3NJ3A 1IR1A 2W62A 1QJWA 4ZQCA 4NXKA 3SY8A 1LM1A 2E09A 2ZUNA 3ELFA 1XDMA 3BLEA 3ARXA 2GDQA 3AI0A 1SVDA 1HUVA 1DOSA 1V08A 2IKGA 3GDTA 4DAIA 5ECVA 4HP5A 1VCVA 3FSUA 3GW3A 3LMZA 2PWUA 5D2VA 3WEOA 1OZMA 1ZP4A 4OTKA 1QNVA 3NZPA 1XGZA 2IXVA 3BURA 2DW6A 4HSNA 2A4AA 4FMVA 1KC7A 3I7SA 4BHYA 4QX4A 1IEWA 3QKZA 1UASA 1TCMA 5D2XA 2Y7GA 1TIMA 2J47A 4M56A 1LQAA 1VB9A 1NELA 3TW7A 4AIBA 3LBMA 4GVFA 4WSJA 2OELA 3WY1A 4A3RA 4GD0A 3NGFA 4JCMA 5LNWA 4KBXA 1ZQ5A 1JG9A 3L4VA 1XG4A 4O0ZA 1S2VA 4CQDA 1TWZA 4GVIA 3ZJKA 1UB3A 4KW2A 2O9TA 3GG1A 4DUXA 1KNWA 1LQ2A 1UH2A 4W84A 2VCAA 1FFQA 4N6FA 3KOFA 3FVMA 1V8EA 3KHDA 3V36A 1H61A 3NDZA 4UQEA 5AY7A 2VFDA 4R9XA 1J8VA 1J5SA 4Y9OA 3RPTA 1ZHAA 2GOUA 3RM9A 4W8AA 1EPXA 1XRVA 1AZ1A 5IBXA 3IWPA 4OECA 4Z2HA 4KERA 1R9ZA 3DAQA 1E6ZA 1HW6A 1GVIA 4JKLA 1CXEA 1Q7QA 3NXLA 1SZNA 4QLLA 1YTEA 5D8WA 1EJVC 3PS7A 4EPBC 4EWJA 5C55A 2ZA3A 4HBKA 4GYJA 1HTIA 2VGFA 1XISA 1BVNP 3GVRA 2VFIA 4W86A 1TELA 3A4JA 5HJLA 4DBDA 3C2EA 1UBSA 3VU2A 1B0IA 2XSBA 3TC3A 2PDWA 3THDA 4DJDA 2BGSA 5I23A 3LCIA 4A2SA 2L5HA 4JYEA 3P5ZA 5DLCA 3H2FA 1A53A 4UTUA 2QDHA 4DN1A 4H3DA 4NILA 2A7NA 1LBLA 5D2WA 3W87A 5IHSA 4JYDA 3D6NA 2X0HA 3D0CA 3QY6A 3GUWA 4KIEA 5B7ZA 3GSMA 5AZ1A 5AZ0A 1IYXA 2A3BA 1TZ9A 1W5PA 5HMEA 3NIYA 3I10A 1PTDA 3L4UA 3AIWA 1AD1A 3G1RA 2CLKA 4Q7BA 1VAHA 3AHXA 1U2YA 3ZSSA 1CGUA 2QF7A 4JFUA 1KFJA 3BOXA 1J12A 3R43A 3B06A 3C5QA 3UJRA 1UQZA 5IFTA 3DI1A 1W9XA 3QHMA 1G1YA 5T9BG 4NUWA 1Q4WA 2ATMA 3GNPA 3IIPA 4KRZA 4L1XA 6TAAA 4YTQA 4Q8OA 4PUDA 4ZOEA 1XI3A 3C4UA 1KGWA 5BWFA 4TQTA 4I5RA 4TUFA 3BXWA 1HFBA 1JFXA 3A9BA 2FIQA 2PTYA 4PL1A 3UWUA 1GPWA 3F4NA 4H7ZA 3UR5A 2RHGA 3AYSA 4MFDA 3V4BA 4G7EA 2WKJA 4D9PA 1PTAA 1H7PA 2Q3RA 1V3LA 4QFUA 4DPQA 1A5KC 2A85A 4ZXLA 2GPTA 3TEVA 1W5NA 2OZ8A 3AO0A 4UQBA 4H9MA 3VA8A 1LJYA 3FLUA 1O5QA 7TIMA 5G4EA 1HJXA 1DTUA 3GHRA 5T26A 3GWQA 1PYMA 3UNDA 1Z9AA 1TMLA 3ZM8A 1QVBA 4UFHA 2H9AA 4H9ZA 3RG6A 3CHFA 1G67A 4LEQA 2PU1A 5I5RA 1XC6A 3B4UA 2CBVA 4ZB0A 1DE6A 2DVTA 3UYIA 4RV3A 2YZ5A 3L0KA 3GYCA 1E9LA 3H23A 3LS9A 4HU3A 3BMVA 4IJBA 2H90A 2MANA 3MHUA 1H5VA 4IL0A 2O9OA 1JDAA 3WLIA 3LGEA 3W76A 3WLLA 4H8NA 1DJYA 3GX9A 4JHMA 2VEIA 4S3DA 2QJMA 3LXAA 1MW1A 2V3DA 1XLEA 3PM6A 1EX5A 3PP7A 1XLIA 5DO8A 2OO6A 3GBDA 4DXXA 4AX7A 3W81A 5HWNA 4BF9A 3TSDA 3W4RA 3MC5A 1EXBA 2NW0A 3B0VC 1T7LA 4WF7A 4F79A 5KMYA 1JDDA 2ZUSA 4KRUA 2VR5A 3KWXA 3SIMA 1AQFA 4ZQRA 3CC1A 3M0LA 3VM7A 3O0KA 5HNTA 3UBPC 2VWSA 3GH7A 3N17A 4W7VA 3E0IA 4HYVA 3QR0A 4KF1A 4WUIA 2D0HA 4TV6A 3TJLA 4RDWA 4GWEA 4NZFA 4QJ1A 3B8DA 2ALDA 3NA8A 2TODA 1EO5A 3CZ8A 2F2KA 1XR2A 4JTEA 4QQUA 3BG9A 4QXIA 4XUGA 5FD0A 1PV8A 1TJPA 3EMQA 3N3MA 3ZLHA 2VX5A 2E1WA 4GUJA 2WZMA 5DBUA 1TUFA 3KP0A 1JUEA 4Z1AA 3WDJA 2VP8A 4MGGA 3VX0A 1Q6LA 2NX3A 3CGTA 3T07A 4LUJA 5A2BA 4GZ7A 3VOIA 3CHDA 4PMYA 3S2CA 4UTWC 1M03A 3NGJA 1SMAA 5DF0A 4HZ6A 3HGRA 2ISWA 3KVKA 4IZGA 3N1AA 4L1WA 1OG0A 3VNJA 1OM0A 1CLKA 3W7LA 5A6SA 2YYUA 1P1XA 1ISWA 1AW1A 3W07A 3WCZA 4DUOA 1B1YA 5ABFA 1T0OA 5BZAA 1F4HA 5F2MA 4CQ9A 1D7KA 4FX6M 2XVKA 3ZR5A 1TX2A 1UP0A 2X1RA 5ECUA 2VZSA 2WSRA 3HV8A 1WDQA 2CERA 1RR2A 4NNBA 1E72M 3U2EA 2ZICA 3HTWA 2CPUA 2AOSA 2A3EA 2J7BA 2GYIA 2QV5A 4DVOA 3TW9A 4S3CA 4B16A 1O66A 2YL5A 2PDUA 3KRZA 2YPIA 5HQLA 2FQIA 2W5FA 3DESA 3BICA 4HA3A 2OJPA 3PZNA 3CUZA 4J28A 3IVSA 1XLHA 4EE9A 3I7RA 1TTPA 3NYZA 3TSBA 5LGZA 1POJA 3UT0A 5HJYA 4V33A 2C71A 3B05A 1AMKA 2Z26A 2Z1VA 3AICA 3W9ZA 2VEPA 5G2HA 3B3DA 1HKVA 5CBBA 4AWUA 3E0WA 3RRXA 1FHUA 2ZIDA 3HG4A 3KDOA 2FGBA 7ENLA 2J6XA 5DBTA 2DY3A 3NPVA 1RJPA 2P88A 4ZOBA 1GJPA 1K7EA 3T2PA 1W31A 5CAHA 1TPDA 3NXFA 5C7VA 5HULA 3A5VA 4X60A 1XLKA 3VE7A 3MA8A 2YDAA 5JUVA 4QNWA 4RZ5A 3OGRA 2J8FA 3BLIA 4CD4A 1KXQA 1NP2A 1SFLA 2C91A 3VNYA 5EFDA 4Y7EA 3I68A 4Y9PA 4MY8A 1E15A 2VC5A 4PTWA 4BR1A 4XZWA 3QMRA 3PUGA 1TWSA 3PPGA 4M7TA 5IFPA 3YPIA 1OGSA 3LV6A 4WK9A 4W8LA 3UWVA 3VGGA 2VVNA 5E93A 3W1AA 2VFHA 3VOGA 1XBYA 3A4AA 6CGTA 3TNBA 2PB1A 1H1NA 1M3UA 1QTWA 1F4AA 1C92A 1PWLA 2QUVA 3N6JA 1S38A 1XQKA 4C5ZA 3WF2A 4N6EA 3W23A 3HPZA 4RNHA 4TX8A 1PBGA 2VR4A 1SFTA 2PDJA 2D0GA 3SI9A 4AG0A 4EVZA 2PU0A 4LRTA 3H8AA 4GQGA 2ZA2A 4D8LA 2PFHA 1OK4A 1ECEA 3LQGA 3UGRA 4KEVA 4NF7A 4X3ZA 1JCXA 3IGXA 4AAJA 1HKWA 3FVDA 2VI0A 2VVSA 2QCGA 2BOGX 2J7DA 3DDMA 3S4TA 5AN7A 2R82A 3OU8A 1W1TA 3GAKA 4UTMA 1XF0A 1MW3A 4JTAA 1XXXA 3VIJA 1Q6DA 3VIIA 2WWCA 3BV7A 3SDOA 4O57A 1PXGA 2Z7GA 1JUBA 3WMLA 1HL8A 4KS0A 2G3IA 4ICCX 2E67A 2JALA 4B5XA 3VVGA 2WHKA 1I8JA 3QYQA 3CUJA 2PZNA 4CNPA 9XIMA 4M5PA 3ARVA 5BW6A 3N9SA 7CGTA 1GORA 2G4JA 4E38A 1XQLA 5IDIA 3QQ1A 4FXJA 2BLEA 4LOCA 4S3EA 2G3MA 2YXGA 3M7SA 4WVXA 1J6PA 2O7QA 3EPNA 3VNDA 4JFSA 5FJUA 3WD1A 3M0JA 3S1VA 1TQXA 1QO5A 3D3FA 4Z2GA 4DZAA 2J25A 3M44A 2YCKX 3MP5A 3RAOA 4GNJA 1UOZA 3STEA 1JDFA 5HWMA 2WCSA 2PTWA 4Q7NA 1BYDA 7XIMA 1UWSA 3V0TA 3AS0A 4Z2LA 3VDBA 2CXGA 3SRKA 4BQ3A 4JTRA 1TVLA 3MI2A 2EG7A 4IPPA 4TO8A 3REQB 3TP4A 1QNQA 3DKLA 3CT7A 4QSFA 4IGSA 4V28A 5K9CA 1R9XA 3B40A 4J40A 2C19A 3S83A 3DC8A 4ECLA 1F3WA 2DZAA 2VDIA 4NAFB 4LYKA 5BCAA 4AF0B 1YQ2A 3ZXWA 3RX3A 2JKAA 5T8GA 1KQYA 2FDSA 1QBBA 5HOSA 4RV8A 4DJEA 5BXSA 1GK8A 2E7FA 4L6OA 1EP3A 3V75A 1V6TA 2UY2A 2ZUWA 4HHMA 1AVAA 3W84A 1J2BA 2TSYA 3BZGA 2X0YA 3QC3A 3W7QA 1Y0EA 3HOJA 3OQ8A 6PTDA 2WZTA 3AZTA 4XBJA 1QK0A 3LRLA 2W67A 1Q4NX 3M9YA 4ZSTA 1HVXA 5G5IA 4M51A 1E1EA 1BHGA 2V3GA 1HO1A 3FA5A 1MUMA 3RN6A 1C7TA 3GR8A 3EB2A 1GKRA 5G1MA 3T55A 4IG2B 1YBQB 3GYEA 4O1DA 4B5WA 2JEQA 4UTWA 2AL1A 3A6OA 3G6LA 4KCTA 4HPGA 4PB5A 3CAKA 4R88A 1BTCA 2XH7A 3MKCA 3ARUA 1W2VA 3SY1A 3CLMA 3QN3A 4LAMA 3K1GA 2OEKA 2O9RA 5CSRA 4F0MA 3PR2A 1S3HA 5TF0A 1XCXA 1XUZA 2OB3A 1JPKA 2GJLA 3EXTA 1J0YA 3TLQA 1X1NA 2GQAA 1W56A 3WQOA 2ASHA 5B7YA 1JZ2A 2XH4A 4DZIA 4ML4A 4C7DA 1E70M 4TVDA 2YSWA 3OTRA 3PZOA 1IT7A 4AZIA 3WQGA 4PBFA 4QCFA 3G24A 2QZRA 4PUEA 2WQDA 8A3HA 4L5ZA 5CKSA 1VZWA 3QPEA 5LIUX 4LBUA 2ZXBA 1QU4A 4JGDA 3W6MA 2I16A 1RCQA 1W5OA 5LA1A 1SO6A 3CO4A 1UR4A 4HIBA 2J75A 3TA9A 3GNDA 3KP1A 1QI2A 2F84A 4YCOA 3NSNA 3WNKA 2ACQA 2D2OA 4J3VA 1Q63A 4M6VA 3ITLA 1QOXA 5CZSA 1EC8A 2F2HA 1DQUA 3CIVA 4Q3MA 1TPVA 1S5WA 5D09A 5HR7A 2W9MA 1G6CA 5G2IA 3IJ6A 1BGGA 3FDKA 3UWYA 2HISA 3BGGA 3WH6A 2F38A 2DSWA 2J77A 4OGZA 2YL6A 1FWGC 3MW7A 1RPXA 4PEEA 4N9EA 3VGHA 5DRIA 4URIA 5I77A 1AH3A 2YB1A 5AB3A 3MKKA 4PRTA 5DCDA 1JPIA 1Q45A 4NZ1A 3VDCA 1CNVA 1VEPA 2Z29A 3ISIX 3WD3A 3NQEA 3GVQA 2Y5EA 1X1OA 2PS2A 4ATWA 1YLVA 5EPDA 4HMNA 4IPLA 1GVOA 4HZMA 4DY1A 4AMAA 3FOKA 1MW2A 3TX9A 3CIWA 5XINA 3L65A 4US6A 4R33A 3XISA 3L66A 1HKJA 1YX1A 3WFAA 3HZ3A 2BASA 3Q58A 3PZTA 1FY6A 2INFA 4C65A 2QPUA 2IKIA 4QAWA 3QFEA 3BW4A 5F7UA 3S42A 3W82A 2NV1A 3EWCA 3ONBA 3WBYA 1UR8A 1R86A 4LY8A 3DG7A 2XN1A 1ME9A 3QM3A 3CL6A 1K9FA 4ICNA 1JULA 2Z6IA 2C14A 2NT1A 3IGHX 3N6QA 4H6KA 3N11A 3VOHA 2VUNA 1VD6A 3NQ7A 3HGJA 3APYA 1P0BA 4NJGA 2VC6A 4K39A 1HKKA 3N9KA 3VIPA 1V02A 2AGTA 1P6CA 5I3DA 2B7PA 1TTIA 3NPUA 4J9JA 5C9WA 4OUEA 2GGEA 1OC6A 2HVOA 2NVCA 4BQ4A 1KV8A 1LWIA 2WW5A 1JR1A 2XJ7A 4YYFA 4O1AA 5I7GA 4WGXA 2B4GA 6REQA 5DY3A 5F4XA 1ZJBA 1CECA 1GOIA 4DEFA 3R94A 1TCDA 1FWCC 1JAKA 1EXPA 3QV9A 1GQIA 4YL2A 3CIXA 2DZUA 3V16A 4X61A 4UFKA 2V6AA 1BKHA 4GY0A 5MKGB 2Y4SA 2UBPC 1SMDA 3OLEA 3GHSA 1CXKA 4UOJA 4H04A 3AS3A 1F6KA 2E1DA 3W38A 3AXHA 3S2LA 2DT3A 2Y0FA 3H2OA 2IPGA 2OFJA 1J6OA 2WKGA 3W7DA 4IMCA 1WAUA 4WCJA 2GZXA 3LHWA 3WDIA 2G0WA 1RJQA 3H12A 5FJOA 1M1BA 2FZ9A 2NWSA 4J5NA 3WJZA 5BOOA 1YDNA 1UQYA 7REQB 3ZWTA 3NZ1A 1NDZA 2WYSA 2R91A 3VCNA 1EQCA 1T6MA 3KBJA 3KBSA 2PTDA 1JZ5A 4GXPA 1S1RA 3DI0A 3PJWA 1BAGA 3GO2A 3QSRA 4ZOCA 3V5CA 4JIQA 3W37A 5HNUA 3IJ9A 3P8JA 4RE0A 2VURA 5M1TA 3MUY1 1PZ1A 3SCQA 2HVNA 3CWOX 1OGGA 2YXXA 1W1YA 3FAWA 4L9ZA 1VYSX 1P0NA 3IRDA 1IEXA 3AXXA 2E28A 4WY0B 1RD5A 2WJDA 1JYVA 2CIPA 2CWNA 3MZ2A 4BK9A 1GONA 3OHMB 2DUZA 1KFCA 1G5AA 3HGSA 1R3WA 4W4QA 1VJSA 4H2CA 2ZX9A 4Q8WA 2CLHA 2QCFA 1EZ2A 1A3HA 4DF0A 3WBXA 1A5BA 3PSVA 4NYUA 2ADAA 2YW3A 3OVRA 3W7PA 4MPQA 3AISA 4ZO8A 3VD5A 3T2OA 5AC5A 4ZO6A 4H8VA 1P0DA 2YR1A 3RPDA 4CVWA 4ML9A 4WJ8A 5D04C 3LQLA 2QCCA 2GGJA 1LLOA 4RL3A 3NM1A 5FCZA 1E6SM 3LOTA 3QW3A 4ERAA 4OV4A 3SCOA 1THFD 1GOOA 3WD2A 3BW3A 4QM1A 4LNCA 3RO8A 4E4UA 3SUWA 3QV8A 3TQ0A 3W85A 3W2JA 5C9RA 1DHPA 4LGXA 3DN5A 3FHAA 1R87A 3MSDA 3AU6A 2NV2A 2VJXA 3WLNA 1IHIA 2WMIA 4IMFA 2V5CA 4XWUA 2UY4A 1B3WA 2J78A 3NPWA 4NG3A 4MB3A 4HA0A 2ZX6A 3WH5A 4Y9MA 3CMFA 1WO2A 2W79A 4RR4A 2HWGA 2Z2BA 2ZZ1A 4ZE4A 4NX0A 3P0XA 2POZA 5FL0A 4O0QA 4JS3A 1K8ZA 1VFMA 2I9UA 3HG5A 4DBUA 3OZMA 5FJJA 3F1QA 3SGUA 2PDIA 4PCPA 3TYBA 4BFAA 2WC7A 1WYIA 4AIOA 3G8EA 3S5NA 1G01A 4HSHA 4QEEA 3U4FA 4I7UA 3THQA 4G7EB 4C6FA 4AEOA 4POCA 1SSGA 3GR4A 1B3ZA 2VDGA 2DIJA 4K68A 1DBTA 3VDGA 4FNQA 1E4NA 1UH3A 3II1A 1ONXA 1W8GA 2ZX5A 4O18A 2OG9A 4IOTA 1KBKA 4MB4A 2HQAA 4U2YA 1BWLA 2FZMA 2PI6A 2X1TA 5I00A 4LSBA 1FBAA 3U8GA 2VCCA 1CB7B 4DYEA 2Z1BA 1QNSA 4I3GA 2FTPA 2BOEX 2QPXA 1FWHC 4LB3A 2V3EA 2H9AB 3IIZA 4FHAA 2C79A 1TVPA 3VMPA 3MP3A 5CLWA 5HMDA 3LG3A 4LBSA 4DO5A 1E9YB 1MFUA 5DMNA 4IGNA 1W1VA 3BTNA 2J8GA 4DLMA 2A7RA 2BXYA