1HQTA

The crystal structure of an aldehyde reductase y50f mutant-nadp complex and its implications for substrate binding
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
324
Chain Sequence
AASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIFGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDEHYDE REDUCTASE
publication title The Crystal Structure of an Aldehyde Reductase Y50F Mutant-NADP Complex and its Implications for Substrate Binding
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 103
structure length 324
sequence length 324
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hqtA00
3MB9A 2PDMA 3LQLA 1PWMA 1LWIA 1Z3NA 3V0UA 2PDKA 1HQTA 5M2FX 4DBSA 2FGBA 3V35A 4MHBA 3UGRA 2FZBA 4GA8A 2HVOA 2FZDA 3COTA 1EL3A 3CAQA 2IKIA 4QXIA 3GHUA 4LBSA 4JQ1A 4YU1A 4JQAA 1XGDA 2CLPA 1C9WA 2AGTA 1GVEA 4L1XA 1AZ2A 1US0A 1LQAA 3EAUA 3G1RA 3M64A 1AZ1A 3WBWA 2IKHA 3N2TA 1YE4A 4L1WA 2PD5A 4IJCA 3BCJA 4H7CA 3UP8A 4GIEA 5KETA 2C91A 1EXBA 4GQ0A 3R7MA 2PDFA 2IPGA 4FZIA 2PDLA 1QRQA 4XZLX 1UR3M 2INZA 3NTYA 3DN5A 4JQ4A 4R9OA 4DBWA 4WDUA 4WDTA 1AH4A 4NKCA 3O0KA 3FX4A 3U2CA 3R58A 3LUTA 5HA7A 3M0IA 2IKGA 4ICCX 1PZ0A 3B3DA 3LD5A 4RPQA 3LBOA 3CMFA 3FJNA 5DANA 4XK2A 2DV0A 3Q65A 2FZ9A 3WBYA 3RX4A 3CV6A 1EKOA 1ADSA 3C3UA 4ASTA 1T41A 2HEJA 2PDNA 1Z8AA 4FALA 2PDCA 5LIKX 5JH2A 2HE8A 4XAPA 2DUZA 2BGQA 1PZ1A 1YE6A 3LNMA 3LENA 1R38A 1IEIA 4AUBA 2I17A 2ACUA 3R8HA 3CV7A 1HW6A 2PDYA 2BP1A 3LQGA 1X97A 4JTCA 3LZ3A 4JTQA 3QKZA 3H4GA 2ISFA 2IQ0A 3LEPA 1PYFA 2PDQA 2PDHA 5C7HA 1FRBA 3WCZA 2HE5A 1T40A 4WEVX 1X98A 2IS7A 2NVCA 4LAUA 1VBJA 1Z9AA 1XF0A 2FVLA 4IJRA 4QX4A 4GQGA 3WBXA 3BV7A 5HNUA 3O3RA 4QR6A 4Q7BA 2HDJA 4PUWA 4JIRA 5AZ0A 4GCAA 1MZRA 3V36A 2F2KA 3EB4A 3ERPA 4IGSA 3CASA 3EB3A 3RX2A 3UG8A 1S1PA 2R24A 2PF8A 1VP5A 1X96A 3KRBA 3V0TA 1ZQ5A 2PDBA 4XZMX 4JQ2A 3UZXA 3VXGA 2HV5A 2PDIA 3ONCA 1A80A 2PDWA 3UZWA 3UWEA 5LIYX 4JTDA 4H8NA 4XVEA 1AFSA 4JIIX 3M4HA 1RY8A 5AZ1A 4DZ5A 3BUVA 2J8TA 2PZNA 5HNTA 3WG6A 5LIXX 5JH1A 3MC5A 1Z89A 3F7JA 4LB3A 1RY0A 2PFHA 3UZZA 3LZ5A 4YS1A 2F38A 1S1RA 1Q13A 2IPWA 1IHIA 2PDPA 5LIWX 4JTAA 2IKJA 1MRQA 3G5EA 3GHRA 3GHSA 4XO6A 2PDGA 4DBUA 3RX3A 4XVDA 4JQ3A 4G5DA 2IQDA 3CAVA 2VDGA 1MI3A 2R9RA 4Q3MA 1YNPA 3S3GA 3V0SA 3T42A 3N6QA 2QXWA 2PDUA 4JIHA 4ZFCA 4I5XA 3GUGA 1AH3A 3LN3A 2IPFA 4FA3A 1OG6A 3UFYA 1SM9A 1PWLA 3Q67A 4XZHA 2ACRA 2ALRA 2PEVA 4LAZA 1JEZA 3P2VA 3DOPA 5LIUX 2IPJA 3R43A 2BGSA 4EXAA 4XZIA 3R8GA 2A79A 2ACQA 3R94A 1J96A 4WDXA 4JTRA 1Q5MA 4QBXA 3GHTA 4GABA 2I16A 1S2CA 4WGHA 1QWKA 4XO7A 1RALA 4PUUA 1EF3A 4HMNA 4HBKA 3R6IA 4EXBA 2PDJA 3UZYA 1K8CA 1YNQA 4YVPA 2ACSA 4FAMA 1ZUAX 4PMJA 2FZ8A 4LB4A 1ZGDA 2DUXA 2INEA 4F40A 4PRTA 2WZMA 2WZTA 1M9HA 1ZSXA 1AH0A 4LBRA 2P5NA 2PD9A 3H7UA 3D3FA 1S2AA 4GACA 3UYIA 1XJBA 2HVNA 3ONBA 4WRHA 4YVVA 4YVXA 3BURA 3H7RA 4PR4A 4XZNX 4PRRA 4OTKA 4WDWA 2NVDA 2PDXA
chains in the Genus database with same CATH superfamily
4DRSA 4US5D 4Z1CA 3A9BA 4E3VA 2JK2A 4K1WA 3ARPA 1NWTA 4OOZA 4J3WA 1M68A 4MB4A 5HBFA 1Q7ZA 2VD8A 3VM7A 4KGJA 7CGTA 3E38A 4CNUA 4PTDA 2VEPA 4PTWA 2FIQA 4BEQA 1B1YA 4NUWA 2J66A 4FNTA 3C2EA 1W91A 1VRXA 2FDMA 2Y0FA 4AZCB 4GK8A 1PB0A 4K68A 1FCVA 1FWHC 3VAVA 4LUSB 2E7FA 2VELA 1MVYA 1EA9C 1TELA 2XVGA 2Q01A 3A5VA 3PTKA 3GKFA 2DSWA 2ZXBA 4XKYA 3AZSA 1L6GA 3BCJA 4H7CA 3W7IA 2C0HA 3W01A 2CLKA 1W31A 5KETA 1W32A 2C91A 4UTMA 4WR3A 1ZJHA 3NWRA 1W1ZA 1S5MA 3R7MA 2DT3A 4ZE4A 1U5HA 3MVIA 4WJEA 1EWEA 2MUCA 1NF7A 2WSRA 3S5NA 4H01A 2XSXA 4JFUA 4FNQA 5HNRA 1AH4A 3FHQA 3AS1A 1Q2SA 2ESCA 4K36A 4E8CA 1TX0A 1QI5A 3LBOA 3M9YA 2X09A 3UEQA 4ACZB 1EDGA 3BE7A 3Q65A 1JGMA 2FZ9A 3ABXA 2OU4A 1EKOA 4JS3A 4G7EB 4A8RA 5I3JA 1CB2A 4M82A 1VBGA 3SZ8A 1JF6A 2ZBTA 1G9HA 3CZGA 3EOEA 4Q8VA 4TR9A 2WVTA 1OX4A 1E6ZA 2V5BA 1TZZA 2PWGA 3KBVA 3R8HA 1IIGA 2FYMA 3KOFA 4U33A 5RUBA 3UWQA 4US6A 2ZE0A 3NQAA 3QKZA 1A5SA 3FDKA 3RUBL 3T0TA 3DBPA 1DL3A 2Z6JA 2EPMX 4C7FA 1EJ7L 2VC5A 2Y70A 1C8QA 3JUGA 4D6FA 1Z32X 4WZHA 3S1UA 3MY9A 2BTMA 1G4SA 3VX0A 3ITOA 2R1PA 1MO0A 4WEVX 2V81A 3KP0A 3P8IA 4L9XA 5KEZA 3S0CA 4CQCA 1HJUA 3OG2A 1LT8A 3TIMA 1HJWA 2PGFA 3QYQA 2IMRA 4GFIA 4LCQA 3CQKA 3RGTA 2CESA 3ZWTA 2C0AA 5HNUA 3KDNA 4Q7BA 4UQCA 2WHKA 3FOKA 4QM1A 3EEGA 4KKXA 5C9UA 1P1MA 3RCMA 5I78A 2WWCA 1Q8JA 2BVDA 2DJLA 1UR4A 3UG8A 1ME8A 1D3CA 4KS0A 2E4TA 2AMXA 1XIHA 3ELFA 1TX2A 1LCOA 4K39A 1BWLA 1X8CA 3SCWA 1WCGA 4Y9MA 3XINA 2BX7A 4DHGA 2C15A 3GK0A 1EJRC 4GJIA 1DOSA 4O10A 1ZPTA 2I7GA 3N12A 2JGQA 1FUYA 1UP0A 5LIXX 3EDJA 3FEQA 1ONXA 3I3EA 3C86A 1GGOA 3QC0A 4LB3A 4KEZA 4MGGA 3ZR5A 5A6JA 4PTXA 4YS1A 4PMNA 3W7QA 4DWDA 1E9IA 1V02E 3UG3A 4AF0B 3WDQA 1NFBA 4RKAA 2CLOA 1V0KA 4ZOCA 3QFEA 4XO6A 3DX5A 1JUEA 3TR2A 2OO6A 3CXOA 1G69A 3SY8A 4GXPA 4OHQA 5M3WA 4B5TA 3OVPA 2R6OA 1KCLA 3N9SA 4REQB 1XPGA 1O6IA 3CUXA 2XTKA 1VIZA 2D23A 3ID7A 3A9IA 4QROA 3HM7A 2PDUA 4DWSB 3NJ3A 1FWTA 2IPFA 1A4MA 3QV7A 1OG6A 3E2SA 3VFCA 5K9CA 4GJ1A 4W4QA 4A05A 1RD5A 4H8UA 3E0WA 3W1NA 3WQGA 4HPGA 3MCOA 2XUCA 5ECVA 1LBLA 2CIPA 1YDVA 4R27A 3U2EA 3SIZA 4AYGA 4WOQA 4K8EA 2PGWA 3PUDA 3LCWA 4HYWA 1OF6A 4DYKA 3NO5A 4I9AA 1POKA 3PZQA 4MAVA 1PCKA 3WLPA 3BLEA 3G0XA 1DXEA 1QO5A 1J6PA 1JYXA 1F7BA 2O9PA 9XIMA 5F2GA 2OZ3A 3SCUA 4XD5A 3W37A 2V67A 4B15A 3CLWA 4E38A 3OW1A 3VPLA 1FHLA 4F0HA 3BMXA 2ZUTA 5CPSA 1RALA 3OLIA 3QF0A 1HF6A 4HB7A 3L5MA 1IZJA 3CAWA 1Q6OA 1HUVA 1V6XA 3AIVA 4FS9A 5FF3A 2VT0A 3N1AA 1IR2A 4XQ6A 3CMJA 4LB4A 4UBPC 1KFCA 1XM3A 1M7OA 5IBXA 4IP5A 2GLKA 1M9HA 2DW6A 3UWWA 3TQVA 1QI4A 1GVSA 2GVLA 1WUEA 2PD9A 5B7ZA 4HN8A 2VC7A 4HPNA 1LQ0A 1JR1A 1NARA 4FR1A 3RLGA 1RPKA 3ITYA 1UB3A 2WCSA 3T55A 3ZS4A 4XWUA 4GVIA 1HX0A 2AQWA 4S3AA 4LANA 3GRIA 4KIEA 4DI9A 2J9XA 5MHBA 4V15A 3MJMA 4TXEA 5EU9A 1IT8A 4DLFA 4IQJA 3CZJA 2GK1B 3E12A 4LUSA 3MZ2A 3A12A 3LCIA 4QXIA 3SI9A 5AKQA 1XFCA 4LYPA 4AW7A 4PUEA 3AIRA 5C70A 1C9WA 5D37A 2AGTA 2EGZA 4TOQA 1XUZA 2ZC8A 3EAUA 1I1XA 3WDPP 3CT2A 1EP3A 4KMQA 2FFIA 1VCFA 5AHMA 4UTIA 3OZOA 2QJHA 3GDTA 1UASA 1GEHA 3VNLA 4ZFMA 2RGLA 3TN6A 1RHCA 1UKOA 5D03A 6TAAA 1K03A 4AWEA 1V3IA 2DZPA 1CENA 1XI3A 4A3HA 5AHFA 3WIJA 4GQ0A 3P0WA 4YYCA 4DBEA 5FF2A 1R2SA 1JPMA 2INZA 3DN5A 3K8LA 3M07A 2E8YA 3PBMA 3E0IA 3C5QA 4Z0SA 5BCAA 4WDTA 5IBXC 3AYSA 5AHIA 4GI8A 4RZBA 2ZVRA 2W79A 1C8YA 1OGSA 4JFSA 4LBUA 1TYGA 3FXGA 2QJMA 1GOQA 4YTRA 3C2YA 1CT5A 3VKDA 1GW9A 2OFJA 4L9YA 2VRKA 2DV0A 3H2MA 4MY8A 4NX5A 1FVPA 2VC6A 4EACA 3ZYZA 2VR4A 2WSPA 4MWAC 4HHMA 3S5YA 3HG2A 2PDNA 1Z8AA 4IIGA 2FPVA 5JH2A 1AA1B 3MCMA 4H9YA 1EOKA 3S46A 1UWTA 3DFQA 4CD6A 3HPXA 3VOFA 4JTIA 1DV7A 3TW9A 2ASHA 2CERA 2NLYA 2I17A 2DVXA 2D69A 3TE9A 1TV4A 4GIAA 4GVFA 2O7SA 2BP1A 4XB3A 1E9ZB 5LA0A 1W3TA 4WQ6A 4Q6XA 2ZE3A 1PYFA 1WXZA 1IXQA 3AS2A 1MW2A 1WAWA 1QUMA 3WNKA 3RO6A 3TVAA 1NWSA 1D8CA 1UHVA 3ES7A 3GKAA 1U1HA 3N9RA 1XRSA 1S3HA 3MHUA 4X3ZA 2NXGA 4LAUA 1YW1A 3URAA 1TCMA 1B9BA 4MNMA 2QCEA 4LUIA 3BJTA 2EO7A 3C56A 4IICA 4UR7A 4H6QA 2VZVA 3H22A 1YBQA 2V6AA 2V5KA 4B4HA 4I5RA 4H04A 1PTGA 3IPWA 4LRSA 4R88A 3WL1A 4QR6A 4OOUA 3A4AA 3UJEA 4J2MA 5AZ0A 4BEUA 2FZMA 6ALDA 3AU2A 3WQ4A 2HRWA 4NT0A 5DCEA 4KFPA 3UPWA 3GNRA 2WWDA 3MCNA 4HD5A 3BICA 1DQXA 4DJFC 3V5FA 3N34A 3DZ1A 4R34A 2PP3A 4I7WA 3BGGA 2XZ7A 2WMGA 1FCBA 4IG2B 2NQ5A 2J8FA 1EJWC 1GTHA 3DU0A 2I56A 3POHA 4EANA 3N29A 4GZEA 4AF0A 5JU6A 3VIJA 2EHHA 5CBJA 1IZKA 1SJAA 4GIYA 5AYZA 4YTUA 1UZDA 1P0DA 1R8LA 3OBKA 2IPWA 2W9MA 4M1RA 1M3UA 1M65A 1PL9A 3PBWA 2PDPA 4D6DA 3UA3A 2BVWA 4S3EA 1DE5A 1VHCA 2EF9A 1VFLA 3BOFA 1B54A 1NDVA 3D46A 1TPVA 4Q4MA 3KLKA 5IOBA 4DJED 3URBA 2V3DA 1ZBCA 5XINA 2QDDA 1RBAA 1ZL1A 2OWWA 4O53A 4OV9A 2YBTA 3F1QA 4Z2HA 2XN0A 3EWDA 2V3GA 2PLJA 3T42A 1XPYA 4H6RA 4JDYA 3HQNA 1UKPA 1ZP4A 4I5XA 4QCFA 4DVOA 4M0XA 1XLKA 2VQTA 1F07A 4NZJA 2OSWA 4B3LA 5HWNA 3FSTA 1JRCA 1DJZA 1DKWA 3BPWA 3EMZA 5D30A 1W3JA 2XIIA 3EXSA 4QSFA 4AX6A 3WLQA 3IJIA 1DIOA 4Q8QA 5E93A 4N4PA 1MUCA 2P3ZA 1G4PA 1HZYA 1WX0A 3MKKA 4AIUA 4J3VA 2VKZG 2BXZA 3B9EA 3G8RA 4N2YA 2JEQA 1CGWA 2MANA 1R2TA 1A5AA 3NZQA 2WMJA 4XTIA 1OD8A 4NG3A 1BTCA 3TLLA 1NIUA 3NSNA 4Q8UA 3CEPA 2WKGA 5FJJA 1UA7A 5AYIA 4M6VA 3TP4A 4OUIA 4JX6A 2Z24A 1ODUA 4YHEA 4B91A 2HNHA 4R7WA 1B9ZA 4CCZA 2PPGA 1L8NA 4QS5A 1H11A 2FZ8A 3B9DA 5A6MA 1H50A 5JIWA 4XIAA 3UPBA 4M56A 2CU0A 4I7UA 1O5RA 3SDOA 4L7ZA 3OYZA 2BY2A 3MDWA 3CV2A 4CNOA 4GOAA 5K4ZA 4OQVA 2QYGA 2RDTA 1IXNA 5K4XA 3EOSA 3WELA 3HN3A 1X8FA 3ZJ8A 4TU1A 2CZDA 4JNZA 1VJSA 1FFQA 1KBJA 3D3FA 3LNPA 1ZHAA 2UV8G 4RNIA 4YVXA 3NQDA 1ECEA 4D6IA 3W6MA 4JIEA 3GZAA 4PRRA 6TIMA 1UMYA 3QPEA 5D9OA 1BXCA 3L4ZA 3H21A 4ZTYA 2BFGA 3LQLA 2GK1A 5I6SA 4RE0A 3SIMA 4GI6A 2E5DA 4PA8A 1PZ3A 1M7PA 4C5YA 2NX1A 2QCGA 1OFPA 1K4GA 4DELA 1UJPA 2GYIA 1FH9A 3GHUA 4ZZ9A 3MU7A 4CNNA 5ABTA 5JQ9A 3L67A 4QJ1A 3AS3A 4O1CA 4IL2A 2HBXA 1GVEA 3WD1A 1BTMA 1R3TA 3G1RA 1VPXA 3PULA 3HMCA 2W66A 5AVNA 2WVVA 4HHPA 1DWFM 2PD5A 2WOQA 1QPRA 3PG8A 1FDYA 4GIEA 3H2AA 3SUTA 5G4EA 4XBJA 4CNSA 1RBOB 3QRHA 2CW6A 3QPZA 1JRBA 3EA3A 1KLYA 1DTUA 4U3AA 1XLAA 4YTQA 1SW3A 2EG6A 3DCPA 4H2CA 1H7WA 1RBLA 3M6YA 2HXTA 3UA4A 2ANUA 3T0BA 2WZHA 5J5RA 3PWIA 5G4HC 1P43A 2GOUA 3KFTA 2PWFA 4Q4PA 3VKAA 3SCQA 1NOUA 3BTNA 1RJRA 3FJNA 4BI7A 4G8TA 2VFIA 3J7HA 3CV6A 3TYUA 3K46A 5G2IA 2X05A 4FALA 3S9IA 1AJZA 1LQ2A 3B06A 1Q6DA 4LUJA 4NIRA 3IVSA 4W8LA 4J3TA 4H7ZA 4HMDA 1PZ1A 4QCEA 1RVGA 4G1NA 1WKFA 3E74A 3VIFA 4O4VA 4UTKA 3RNDA 1X38A 1V77A 4H9XA 1PPIA 3PUOA 3UR2A 3GFYA 4E8DA 3FAXA 3NL3A 2FH6A 2CZVA 3HGOA 3NVDA 4J3UA 3VYLA 1JZ5A 3HZ3A 3W7NA 4GHRA 5DY3A 3ABRA 2FQIA 3QV9A 4QTGA 2QUMA 2YYTA 1WBHA 4DJDD 2V0TA 1G4EA 1QNRA 4B5NA 4AWUA 3SEPA 3STEA 2NZLA 3PZ9A 1XDLA 3V3WA 1CXEA 4O8RA 5HAOA 1KRCC 3H26A 4O0QA 4IPIA 4B2DD 2OWCA 4ES4A 1QNSA 4CD8A 5EGRA 3ICJA 1A3HA 4UTWC 2FH8A 3VDHA 4GLEA 4YJ5A 1E1CA 2BMBA 1US3A 3PB2A 5TNVA 4RW3A 1LLZA 4S3JA 1XW8A 3GVGA 4MLRA 4RDVA 2RDWA 3MA8A 3WENA 1OD0A 1H1ZA 1H60A 3WDJA 3AROA 3B0YA 1VEPA 2BVYA 4D9PA 3DYMA 1BD0A 1OCQA 4JL1A 1JYNA 2Y88A 4Z1YA 3MSRA 1EYEA 1VGAA 1Q66A 4GISA 5CLTA 1K9TA 2VDIA 7TAAA 3ITCA 1MUWA 4US5A 1GHSA 3LTPA 4L65A 1SPQA 3C0JA 3KM8A 3A5FA 1V7YA 3GZ3A 3APYA 2DSUA 4RK8A 3KBSA 4JTKA 4QHRA 3WBAA 3MVTA 2PFHA 3SUVA 1AVAA 1S1RA 1RAKA 1IHIA 4MWAB 3BMWA 3LA4A 4E4PA 2QVNA 3A47A 3VD3A 4R9XA 3KCLA 3GHRA 4OZOA 3RHGA 4DXXA 3V1HA 3GHSA 3B8SA 1A0EA 2D3NA 3GW3A 5DEZA 1VBRA 2WZIA 2ISVA 2AGKA 3SCVA 1NP0A 4GGBA 5TBOA 2AL2A 4Q3MA 1OF8A 2O9OA 3W27A 4EE9A 1TV2A 3T0CA 3GXDA 1U30A 3HG4A 3RG6A 3PZOA 1K77A 1FH7A 2A3BA 2I1OA 4U31A 3M46A 4DXVA 2JFEX 3O6AA 2UBPC 1QW7A 3GDBA 1TZ9A 4GCXA 1UOKA 4B5SA 1QI3A 6ENLA 3DYPA 1YRRA 4MKVA 3RFAA 2YX0A 2DZTA 3CZLA 2GSHA 4QG6A 3SJ3A 3K1GA 4BR1A 3A3WA 5TAOA 4HSHA 3VOHA 2XIMA 1UR9A 3VDGA 5FSDC 1KTBA 1HG3A 1YMYA 2XM2A 3GHTA 2WB5A 5CCZA 3SY1A 1H7RA 3DG3A 4XO7A 2PTXA 1QNOA 1NM9A 1KM2A 2G96A 2Z1BA 3HFYA 3R6IA 4X61A 3UZYA 1K8CA 2YCJA 1OGBA 4B5UA 3OA3A 3ORWA 3W23A 3P74A 8XIMA 2QV5A 1IWBA 3MHGA 3OO2A 3AIWA 4PMJA 2RGMA 4DNHA 2ZUWA 3UJSA 1ZGDA 3GR7A 1XLGA 3Q4DA 1OC7A 4R53A 1MXGA 3DFTA 3FV9A 1GQJA 4F79A 4CEUC 2NWSA 1CBGA 3TR9A 1GONA 2GL5A 1S2VA 4QGCA 4XAYA 2E0PA 4UTTA 2GFTA 5DMMA 2ZRUA 3FJ4A 1XICA 1ADOA 1P6BA 2R8WA 4FB7A 1R9XA 2REQB 2QNEA 3B4UA 3B40A 3BQ5A 4Z42C 2TMDA 4XAGA 2X1UA 4OTKA 5EB8A 1J9YA 3WUFA 3PR2A 5CAKA 3TNOA 3BAXA 4JX5A 4RDZA 3TTSA 2ZA3A 4KF1A 1O5QA 4UMCA 1BGGA 3SW6A 4C90A 2CXGA 3FJLA 1B30A 1W9BM 3MYOA 4UXDA 1ZS2A 1NTHA 4HPXA 2E77A 5CQ1A 4DY1A 8RUCA 3WD4A 1TG7A 2DQWA 4O1DA 3WQWA 4LW7A 3ZVHA 4Z2LA 1E1FA 1TV7A 2VUYA 5FIPA 4L1XA 4PBGA 5FAJA 5K3VA 3M64A 5J04A 3BSGA 1TJRA 3C52A 3ZSSA 1WZKA 4BK9A 3LY0A 1UWIA 1O1HA 3GG0A 4J3XA 4P7NA 4XZ9A 2ZOXA 3TCSA 2VFDA 4ENLA 1W1VA 3K4WA 1JXKA 1NH6A 5A69A 1P7TB 3GBEA 3UWZA 2Y89A 3SRDA 2W5FA 4GQRA 4TVUA 3KS5A 1QK2A 4W89A 4KCVA 3W1MA 4OBTA 1AK5A 3K1DA 4L80A 4E2BA 2LLEA 4YYFA 2NQJA 1GKPA 3BG5A 4UTTC 4LV4A 5E70A 4DUWA 2QAFA 4GGHA 3RX4A 1BEUA 4BQ4A 4EVZA 4MZ8A 2PSNA 3CZKA 2PDCA 1B90A 2ISDA 5LIKX 2ZZ4A 5JBDA 3WLTA 2OKOA 2Y8UA 4J28A 1X6UA 2IW0A 1C92A 2OELA 2H6RA 3CIXA 4AD0A 2J4GA 2Z29A 3L66A 1LL4A 2QCHA 3M0HA 5HR7A 1L2UA 4KCTA 4CCEA 3SUSA 2GUBA 3HQPA 4BF9A 1XRTA 4A4AA 3GTXA 3AMGA 3T8LA 1IWAA 3W29A 5B80A 1SVDA 3W74A 3WCZA 1TPWA 2QULA 2BSLA 2OOGA 3QW4B 3CHFA 3DERA 4QDMA 3QJAA 1AL8A 8XIAA 4Y9OA 1EH9A 4HQVA 5CGMA 3V1PA 3BCFA 2YOCA 2ZZ3A 1GZJA 3W1XA 3ARSA 5F2MA 2FVLA 3L4YA 5JIPA 4ZB0A 3S2JA 3U48A 5C2CA 3IJ9A 1W1B1 2Z1VA 2A85A 2E67A 4PMVA 3W1UA 1RV8A 1F3TA 3VNMA 3QY7A 5BWFA 3M7WA 2HJPA 2WKJA 1P1XA 4A3YA 5I2UA 3KZPA 3P84A 4JD4A 3WDHA 1CDGA 2PS2A 3TAKA 5CC6A 3P5ZA 5CH9A 3Q2DA 3W84A 1QI0A 5DXXA 4M1BA 2YXGA 5G2WA 4LY8A 3LXBA 2HS6A 1HN1A 2HV5A 3P80A 3NYZA 1S5NA 1NFPA 1FXQA 4IXXA 3VGBA 2A6LA 1BQCA 4GI4A 5AZ1A 1SO3A 1J0HA 2GJPA 3BV4A 1ME7A 4CVUA 3BUVA 1E6RA 2J8TA 2Y6ZA 3L4TA 4ZQCA 3EDDA 4RE2A 4M19A 1VBUA 3R0KA 3S4TA 1TVNA 5E9XA 1SMAA 1E0VA 5DMLA 4URIA 3VO0A 1R0MA 4F0KA 3FKRA 1H61A 1KR0A 4G1KA 3NL6A 3NM3A 3VZZA 4HKPA 3WFZA 3SQMA 3NGJA 3QH2A 2Q71A 5HMFA 2R91A 2GVYA 3WLMA 4O18A 1H7OA 2ZUUA 4BWLA 1GQKA 1AW2A 2J74A 1M1BA 3RX3A 4XVDA 3GWQA 3K8KA 3WLIA 2IQDA 1UYQA 4KEUA 1WPCA 2R9RA 3H8AA 1U5VA 1JUBA 3G8EA 3REQA 4PFMA 3F03K 2P10A 2OQHA 7ENLA 1QJWA 4X0VA 3W87A 3CT7A 5LGXA 3T4WA 4WF7A 4NILA 5IFPA 4ZB2A 4O19A 4XZWA 4V27A 1K4HA 3RR4A 5DMNA 2VJXA 2QCFA 5BMXA 3P82A 2F7FA 2JBMA 1H41A 3QZ6A 3UXKA 4FMVA 1A5MC 1KFJA 3WKZA 1V02A 1NSJA 2OJPA 3JVAA 4Y90A 1XQKA 1Q85A 2ZTJA 4AAJA 1YDOA 2NT0A 3AIBA 1YHTA 3GVWA 1E5JA 1DYSA 1XV8A 2J78A 4D6HA 1GUVA 3N13A 1C8VA 2A21A 1GVFA 2ZX9A 5LKYA 4AD5A 4QNWA 3TONA 1WV2A 3TN4A 3M16A 1EJVC 3OPSA 3GVQA 4JYEA 3EDFA 4YCOA 5CJNA 3SRHA 3B03A 4G7FA 5EFDA 1RCOB 4E0CA 1H62A 2XVPA 4I3GA 3CO4A 3PPCA 4IM4A 3WD0A 1ONWA 2REQA 2YL8A 3T0DA 1X6NA 4MDPA 3QTPA 2YJQA 4O4WA 5D2WA 2P5NA 1OT1A 1IXOA 1AJ0A 1ECQA 2P8BA 3RR1A 1C91A 3TWAA 1XWYA 4L6DA 4GACA 2HVNA 2YL6A 1QDSA 1FP8A 4PBFA 4DYJA 4HZ8A 5EMUA 2ATMA 4I9MA 4DF0A 3LOTA 1HL8A 1LBMA 3LMZA 4WOZA 3V0UA 2V5CA 2PDKA 5HQMA 4JY8A 3TTYA 4OWGA 3CZ8A 4MHBA 3CQHA 2J7BA 7A3HA 2YA1A 5H91A 1D7KA 1WXYA 3GDRA 3KOYA 3ABOA 1M5WA 3T2OA 3WH5A 3N14A 4C6MA 1TKKA 1BG4A 2WVUA 1K1DA 2ZRYA 5LNWA 1O7AA 2VRQA 3PPHA 3ARWA 4H3DA 4JTUA 5I23A 2W92A 2AQVA 1G67A 4PN2A 2VFFA 3NOYA 1F6YA 1AZ1A 3PTQA 4CNPA 2PRHA 2IKHA 3N2TA 4UFHA 1YE4A 2YLLA 1EGMA 3PZTA 3DUGA 3IGHX 3WNPA 4IJCA 4HU3A 3KRSA 3TKFA 3FW6A 2ZXAA 3OU8A 4NY2A 4UC5A 1YX1A 2QAPA 4MIMA 4MSSA 1BG9A 2X2YA 3GC5A 3NYDA 4ECLA 3PWAA 5L9FA 2P1FA 3W7PA 4CCDA 1CXHA 3AXKA 4WDUA 3H54A 3T4CA 1C90A 1DJWA 2OLAA 1D3HA 1EDTA 3ZMRA 3FVDA 2GVEA 2DZVA 2XIBA 2J62A 1UBSA 2VCCA 4DJEA 2QLYA 2V63A 2KX9A 1SSGA 5AOUA 1TO3A 1JPHA 5FF7A 2YL5A 4FK9A 1REQA 3W2NA 1ADSA 3C3UA 1UZ1A 1T41A 2OSYA 4PCNA 3PVFA 3P3BA 4GNKB 4ROPA 1DJHA 2W61A 3GG7A 4CVWA 4U5IA 1LF1A 4JN7A 1MW1A 3B8VA 4NAFB 1K9DA 1M7XA 2X0SA 3WNNA 1N8FA 4DX3A 1BKSA 4HU8A 1QATA 4ZL1A 9RUBA 1CW2A 2PDYA 1F8IA 3QLLA 3SN4A 1EP2A 4JTTA 4MADA 2JF6A 3NNTA 4HMEA 4NZFA 2G3JA 2A0NA 5HQLA 1EGZA 3RRXA 5DQPA 2BZNA 1J4EA 1RUSA 2OX4A 3KOWA 1XLBA 2Z28A 1F9CA 1CGUA 3IARA 1BAGA 4JR5A 3H2FA 5IM51 4QX4A 3OLGA 2DP3A 1GTEA 1W37A 3KW3A 1FQ0A 3TYDA 2PLCA 2DIKA 1EYWA 2X7WA 3GVRA 3N73A 3VE9A 2ZYFA 3MJYA 1ZCOA 3SQLA 2HK0A 4JYFA 1R3WA 3AAMA 4NJIA 4W86A 4MTVA 4IIHA 5BNKA 3E02A 3LRMA 3EX6A 1XIGA 1R3QA 4XG1A 1WO2A 3U57A 1JCXA 3IGUA 1PBGA 3BH4A 3LPGA 4QQUA 4DJEC 4YPJA 4YMZA 7XIMA 1I1WA 1RPXA 2RHGA 3FGCB 4GWEA 4GD0A 2AQOA 2RH9A 3DI1A 2J6VA 3BO9A 3QQ1A 3UESA 1HGWA 1ITUA 5A5WA 3WYZA 3KRUA 5JH1A 2WMHA 4QS6A 1OVDA 1J0ZA 2QCLA 3G22A 3UZZA 3P5YA 2I5IA 2F38A 4HCLA 3IGSA 4LQ1A 4RZ5A 4HTBA 1TUXA 1E56A 4HA1A 3VOGA 1MRQA 1DORA 1XIEA 5EBAA 2E5CA 4AHQA 2RDXA 4S3KA 1KCZA 3GTFA 4PB5A 5HJYA 3AO0A 3CLMA 4V2XA 1EIXA 3PPFA 3NZ1A 4EWJA 4ZCWA 1O1ZA 2PGEA 4M6QA 4JIHA 4WJXA 3LSBA 1UD2A 3AICA 3GAYA 3VGDA 3DENA 3LXCA 1AH3A 4D72A 1W3LA 3APGA 2Y7GA 1V0MA 4L4PA 4IFOA 2JKEA 5C2XA 1VH7A 3B9OA 5BXPA 4TV6A 2PEVA 4KCWA 1E0WA 3IIZA 1D9EA 2UY4A 3JRKA 3IIPA 1KB3A 4UR9A 2C8NA 3AHYA 3T07A 4FR6A 3IACA 4TV5A 2GQ9A 2NXHA 4ZXLA 1JDFA 3SSZA 1UQYA 4C1NB 3VDCA 2NUXA 4JTRA 4QBXA 5FAGA 5EL1A 3MI2A 5C9ZA 4YLWA 1HGYA 3KOZA 1XLFA 3MPGA 2CHNA 2J27A 4A2SA 3MO4A 1AQ0A 3FY1A 1FWGC 3DESA 4IT1A 4YVPA 2OGJA 4AEFA 4PTVA 3VGFA 5I02A 1ZP3A 4AXKA 1AW1A 2ZX7A 1B2YA 3TOPA 2V3EA 4A8LA 3H12A 3TW6A 2QJIA 1KC7A 5GJMA 4XD3A 1AH0A 6REQB 1RK5A 3KP1A 1EBHA 2GGEA 4YWIA 4O8AA 2BGNE 4DJDA 3GY1A 3TUUA 1VEOA 3AWOA 3PNZA 2J7FA 3TXVA 2DZBA 1IEVA 4N42A 4R3UA 3QV8A 2WPGA 3VK5A 1UOZA 4B2DA 1F73A 1MXSA 4Y6GA 3HFTA 3PZNA 1H1YA 1O68A 4I90A 4Y8EA 1HQTA 1DJIA 2E6AA 1DWHM 3V35A 2W0UA 4B90A 2YCKX 1Q6GA 2Y7EA 3VOCA 2FZBA 2ZA1A 4LH8A 2XFFA 4PULA 2ZDSA 3GIPA 3MKCA 3STCA 5A8OA 4LBSA 3LCGA 1XIBA 3HPAA 5I3DA 5HINA 2ZIDA 1Z6KA 4GZIA 1LQAA 2Q8XA 3ARRA 4O0KA 4HIBA 1WDDA 2GDVA 4FLOA 1ZZMA 3I3BA 4HA0A 5BZAA 3I6TA 4KRZA 1BYBA 3BZGA 2ZX5A 1K3UA 1VYSX 3EX4A 1XD1A 2PDFA 4AEOA 4AISA 1XIIA 2OR2A 3GLCA 4AU0A 4LC8A 3W26A 1GVOA 3FA4A 3FVMA 4UFLA 1UUOA 3FFSA 2G3NA 3VILA 3EDEA 1RD6A 1M01A 5HA7A 4H9MA 4ZEPA 3S1VA 3E6EA 3CL8A 4XISA 1AQHA 2GQAA 1P5BA 5I00A 2YFOA 5D9NA 4C6PA 1TVLA 4NAFA 4IWWA 3R11A 2QCCA 1T6MA 2PTWA 1FOBA 3W1AA 1OY0A 4GG9A 4HZ7A 2VEGA 3LENA 5FSEC 3TTQA 4UTHA 4EX4A 4A2RA 4JIQA 3MZNA 1SW0A 2Q3OA 5LXXA 4AZGA 4ERGA 1BRLA 4MKNA 3LQGA 3E2QA 2XSAA 3LZ3A 6XIAA 1KNWA 2NV2A 2QUTA 3B8WA 1Y5WA 3P60A 2G3IA 2ZZ1A 4HK7A 4V1YA 2D73A 1TUFA 4K7VA 5I3KA 4J4KA 1XLJA 1E73M 1KV5A 1T40A 3L65A 5H8MA 5AECA 5G1YA 3PPGA 2WPBA 2BLEA 2WJFA 3P14A 4XUGA 3IV8A 4WVXA 1KRBC 3WEMA 1GZGA 3A3XA 2ALDA 2CITA 1WKDA 5D2YA 2WQPA 1V5XA 4UCGA 1QPOA 1J5TA 2YLAA 5AC8A 4HNUA 3N4AA 3W7KA 1S5VA 3FYYA 1JL8A 4C65A 1UH4A 4WUIA 3EB4A 3K5XA 4JTFA 3TSBA 1BPLB 2CLMA 4IGSA 4O28A 1HJQA 4PUKA 3M5XA 5HUOA 3TJXA 3M5VA 1ISWA 2FDSA 2YW4A 4WY0B 2BY0A 1X1OA 1BVWA 4P8WA 1H7NA 2PF8A 1RSCA 3APTA 4ZGYA 1QHPA 3BLPX 4AEEA 3GX9A 3E96A 3EBVA 3RITA 3UZXA 3U3HA 2BNJA 3AYTA 3WK1A 1WOBA 2AMGA 4M51A 3KOXA 4NZ1A 3IK2A 3PWGA 4BI6A 4S1FA 4ZO6A 1JDDA 2OKTA 1V0NA 4FO4A 3S47A 3H4WA 3CUFA 3A22A 5HNTA 3AHZA 4MZ1A 3JZEA 4I8YA 3RMJA 1BFNA 1RY0A 1PJ9A 2PRLA 3R0UA 1QAPA 4FSAA 1ZCCA 3STPA 3W71A 3ZR4A 1HTIA 3G6LA 3G5EA 4M24A 3LPOA 2G4JA 5CZKA 4LAMA 1G6CA 2C6QA 3LLDA 3TROA 4UNLA 3ZIZA 1TWDA 4ICNA 3S3GA 3G3MA 1A3XA 2YZ5A 3N17A 2A6NA 3CWNA 9CGTA 3EWBX 4LVFA 4WSJA 4GMEA 3N6QA 3PM6A 4UZSA 3EXRA 1W1A1 3MUXA 5F7UA 4CN1A 4HHHA 3VIKA 2ABAA 3PUGA 1SZFA 1E1EA 1AMYA 2Z25A 2F8QA 3G1DA 4ADTA 2ALRA 2VD9A 3OQEA 1UCWA 3ABZA 4B92A 3CJPA 2GZXA 4MVAA 3DOPA 3OGSA 1JPIA 4PEKA 3WF4A 2RKXA 4DWSD 2DY3A 2HK1A 5CC3A 4RZ4A 3OGRA 3PBGA 2DDXA 3GFXA 5EY5A 2A7PA 5M17A 1MEIA 3LBCA 4IIBA 4YWSA 7TIMA 1V3LA 2A3EA 1V0LA 3WLJA 2CYGA 1PX8A 2XN2A 4O1EA 1I2PA 5HK4A 1I4NA 5E9AA 1E72M 4X60A 3B0PA 1J2BA 1I2NA 1OYAA 1W3IA 3RAOA 5HNNA 2G50A 3MYPA 2F61A 1N8WA 3BW3A 1IV8A 3WJZA 2WAGA 1QMLA 4GFSA 1E4LA 6REQA 1TZ7A 4FAMA 1JPDX 2D0HA 4FLQA 3W70A 4ERIA 5IHSA 3MKVA 1BQGA 3A4JA 2RJHA 2WZMA 2BG5A 1DJYA 2XH7A 4B4FA 1B3OA 2PI6A 1B31A 5LGZA 1XDMA 4GIRA 3HJEA 1F4AA 3BLOA 1IQ8A 1KR1A 5C0QA 3IJDA 1W6TA 4LBRA 3R2GA 3R0DA 4U2YA 4IIDA 1VF8A 4KWSA 1EOMA 2VQUA 2F6UA 5HOSA 4D6JA 3H7UA 3NM1A 1FHDA 4MJ2A 3SCRA 1P6CA 1EBGA 4LX4A 3GYCA 1JXJA 3VGHA 4EAYA 1W8GA 4C7DA 4XZNX 3M47A 1H51A 4B16A 3S42A 3WO8A 3M0ZA 3WJWA 1OZMA 2DJXA 4FIRA 4BZYA 5AYXA 5M1TA 1A5LC 1PKYA 2YDQA 4L64A 2C13A 5T91A 1J12A 1PWMA 1XP3A 4O11A 3R1ZA 2FGBA 4OKDA 1SUXA 5T26A 4UB9A 3VNIA 3PK7A 1FWJC 2O4QA 3ES8A 1QASA 1EX1A 4W9TA 3ZSTA 4IGMA 4DIAA 5FEZA 1HKKA 1KFWA 2ZZ2A 3W73A 3W9ZA 2DEPA 4YU1A 2CLPA 1RCQA 4PFHA 4HVXA 3KVMA 3PFRA 2OQYA 4K7YA 3ABSA 1DBTA 2Q3RA 1OSEA 1XIJA 5DELA 3AOFA 3RPMA 3F4CA 3UD6A 2ZICA 5D05A 4AVOA 1V3HA 1AUSL 1MXDA 2V5LA 4XZLX 2G0WA 3NOEA 4WSHA 2GGIA 4N9CA 4F3HA 3BAJA 1MQPA 1LG2A 3O0KA 2VZUA 2XISA 3LUTA 3S8HA 3OGVA 1KGUA 1O5KA 2EPHA 4HPHA 4A6GA 4W7WA 3O8AA 1QPNA 2WSKA 4ACYA 2VZTA 4I6KA 2PWUA 2WLZA 3UJFA 1F74A 4B5XA 3R89A 1WDRA 2H9AB 5K9XA 1ML1A 5I77A 2X0YA 1N2VA 1QVBA 5HDRA 2VFGA 1ITCA 1SO4A 1YE6A 5E1QA 3DDMA 1XYBA 4F4RA 3VINA 3ZT7A 3ITTA 3OIXA 2XU2A 2WSQA 4PMUA 3I4KA 1FWRA 3CUGA 3RXZA 4JTCA 4JTQA 1XRFA 3MMTA 3E2VA 2V30A 2PDQA 1O60A 2V2CA 1HKVA 3CEUA 1XC6A 5CZJA 1KM0A 1GHRA 1LTDA 3T7VA 1UIOA 3FA3A 3LERA 5C7HA 1Q6EA 3CQIA 4R7JA 2WNNA 3K4DA 3T08A 7ODCA 3TCEA 1J18A 1WZLA 3U5YA 3E1F1 4QISA 5SWUA 1W2PA 1JZ4A 4F9JA 1UPPA 2D2JA 2NVCA 1XS2A 1A5KC 3NFUA 2RDUA 1Z69A 3WQCA 3BJSA 1UA3A 1G5AA 1PV8A 3WBXA 4C6BA 2EPLX 2JKAA 4IF2A 3V75A 2VGIA 5HJLA 1FA2A 3VUPA 3EPNA 3CZEA 4ZXOA 3I68A 4X22A 4AVNA 4L1GA 4DN1A 4QLKA 4WKHA 1VCVA 5LSMA 1EJXC 3TC6A 4AG0A 4ALDA 1PO9A 1XC4A 2WHMA 3VIGA 3CL6A 3HA1A 1VP5A 4KWUA 3O2LA 4AWSA 2VEIA 3LLFA 2CLLA 2G97A 3VXGA 1FWIC 4MYXA 3LXAA 1KBBA 1A80A 2PDWA 2E6YA 3M4HA 2QR6A 1RY8A 5A2BA 1NDYA 3L4UA 3A21A 4PSPA 4GINA 4DZ5A 1PTDA 1H49A 2VUNA 2PRMA 4Q8PA 3BG3A 4I9JA 2L5HA 3VMPA 1ONEA 5E6YA 1UH2A 2DSKA 3GXIA 4CQBA 1KW1A 1UC5A 3MC5A 1UR8A 4MFEA 1R3SA 2CPUA 3KVKA 1VRDA 4A35A 1PIGA 4Q8NA 3ZJKA 1O66A 3PTMA 1ESWA 3W85A 1FY6A 1ZBWA 4ZTXA 3D0CA 2VEMA 1MWOA 3CTLA 1W5QA 4PMRA 3NDYA 3NQFA 1PXGA 2WSYA 4MUZA 5EMYA 2Z2UA 4S39A 1WUFA 4G5DA 5KZDA 4C6DA 2Z1XA 3W6YA 1DXIA 3A4XA 2VRJA 4Z2IA 5HANA 1JCYA 4TVDA 4H83A 3G1FA 3N2XA 2GPTA 3W7MA 3EGJA 1E6SM 1ZAHA 1M7JA 1XLMA 3O6DA 4GUJA 4AC1X 3ITVA 5G5IA 2EBNA 3BWWA 1GT8A 1SO5A 3GC2A 1WQ5A 3QFWA 1YQ2A 3BLFA 3TEVA 1ZBVA 5BU6A 4LAZA 3L2MA 3N3MA 4RE4A 1PSCA 5C9RA 4KWVA 3TK7A 2QUUA 3L21A 2GUUA 4XZIA 1F8MA 2Y24A 2QPUA 2D24A 5CAHA 4A21A 3UWVA 1GOXA 2PTDA 3BLLA 4EPDC 4DEFA 4INFA 1RQBA 3GUWA 1UJQA 4H9UA 4F2BA 1V6WA 4QE5A 5HATA 3FK4A 4PUUA 3KTSA 3KAOA 1EF3A 3VCNA 3IJ8A 2CBVA 1RK6A 5FF4A 4W5UA 4PTMA 2FPTA 1ISXA 4OFCA 2Q6ZA 5DFAA 4Z1AA 1ICPA 3OVRA 4PL1A 2XFWA 3PJTA 1Q3NA 2PTYA 1W9VA 4LYKA 5KSWA 5HMEA 4Q8TA 3KCOA 5AHEA 1A5UA 5DX7A 3LS9A 5XIAA 4ERAA 4KEMA 3VIHA 3EWWA 1LOQA 3MO7A 3EOOA 1S2AA 3G1SA 3EWUA 5HMDA 5DXYA 1E3ZA 4X9SA 2WZEA 3EPMA 2DT1A 1E51A 3FEMA 5C6MA 3VIMA 5I3HA 1OBAA 3VIIA 4FX6M 4UZUA 2VOMA 4XZBA 4RLIA 1OB0A 2OZ8A 2QV4A 4GUIA 1DJGA 3T0AA 5JVLA 4W87A 3ZJ6A 3AIEA 3URNA 2WO5A 3VX1A 3O15A 4K2SA 2FZDA 1EL3A 3CAQA 4A8IA 1E4IA 3EWZA 4BQ2A 1IEQA 1HT6A 2ZRVA 4XBSA 2J47A 2VGGA 1KWGA 3LRLA 2ZFAA 4ML4A 1JPKA 3GR4A 1R9YA 1XGDA 3CWHA 4P8XA 5HWJA 1TV5A 3TYAA 4MWAE 3E0LA 1R9ZA 1V93A 1MFUA 3WBEA 3KHDA 4EPKA 4F2TA 3EDKA 4PBEA 3SB0A 3WY1A 4ZENA 1H5YA 3TA9A 3EMCA 7PTDA 1PUDA 3OODA 2XJ7A 3H53A 2Z26A 2J7DA 5U7SA 2WMIB 5C7VA 1JDAA 4KRUA 2HZGA 4UIOA 4D8ZA 2OOFA 3L12A 3TFCA 2IPGA 5KZEA 2PDLA 5GVJA 2TRSA 3MANA 1TWWA 2A1YA 1AW5A 4JQ4A 2E9LA 1TPB1 1J2WA 1IF2A 1AL7A 2VI0A 3UG5A 3UGVA 4PGLA 3ECQA 1NAL1 4FPSA 1JZ6A 4ZQRA 1I0DA 3GR8A 3B3DA 5EKYA 1CYGA 4MPKA 2H9AA 2E5BA 1VPYA 5DCBA 5A6LA 3EA1A 2C1IA 3NXLA 2Y61A 5ECUA 4JTHA 5ABFB 4E2OA 1F61A 4ASTA 3QHMA 1T99A 2HEJA 1FWNA 3RYSA 3C2RA 3NDOA 1DHPA 1KXHA 3USZA 2GWGA 3RILA 2C7FA 3U6WA 4FNUA 4OT7A 3KWSA 1KRMA 1JIBA 3CK5A 1R38A 1V6UA 4FXJA 3AC0A 3FHAA 2OTDA 3IWPA 4DUVA 4DF1A 4JFVA 3TJLA 1V3MA 1BVZA 4WGXA 5FEXA 3P0XA 1ZTVA 2PP0A 3I65A 3CPUA 1B3ZA 1ICQA 1U5JA 3G6MA 1OINA 1DHKA 3NUKA 4H1ZA 2W62A 4ZSTA 2Y2WA 1BYDA 2YCLB 2ZWYA 3ENLA 1XLIA 4WSKA 1BXNA 2WKLA 2Y8VA 1Z9AA 3ARQA 3CUIA 4MOZA 2Z27A 3HG5A 1EC7A 3N6HA 3UPMA 1IGWA 4HZ6A 4IJRA 3LX9A 3ARTA 3CMGA 2PA6A 3O3RA 2VZOA 1NFGA 1NQKA 2HDJA 4F9DA 3T8QA 5BRPA 4DUXA 2WK2A 4LOCA 4CQDA 3M43A 4HTYA 3R25A 5DBTA 2E40A 2B7QA 4JAWA 3CASA 2Q09A 1W54A 4GXMA 3LRKA 1X7FA 3V16A 1S1PA 1OFRA 5CZSA 1LLWA 1YYAA 3G3DA 4M7SA 1ONRA 2ABBA 4HP5A 2NV9A 2X2GA 3BAKA 3B8DA 1KFBA 2G4FA 3WQEA 1JDEA 4DPPA 4LF1A 3BAWA 4PUMA 4R7OA 2PDIA 4CU6A 3V7PA 3W0KA 3PZVA 4TTUA 5LIYX 1TRIA 3SAZA 1DJNA 3TQ0A 1E15A 3GNDA 3G1HA 3U2OA 3WEZA 1NEYA 4QITA 1A3WA 4P2VA 3W02A 4FXFA 3UG4A 3WG6A 3SRKA 4NAEB 1Z89A 4PCTA 4YHGA 2OLSA 3NR0A 5MKGB 4IPJA 1TFVA 5LIWX 3DKLA 3GW0A 4NXKA 2J6XA 4Y9PA 1RXOB 2OEMA 4WY0F 5G4WA 5CLWA 1S2UA 1VAHA 2IQTA 2W63A 1ZAJA 3CAVA 2DZAA 1E9LA 2PLKA 1GJUA 1G0CA 4MWAD 3SN1A 5AFDA 4PE8A 4QLJA 3MDUA 1EC9A 4RV3A 2R1MA 1XBYA 4U28A 1EIBA 4JTJA 4W84A 4AZCA 4LEQA 2ADAA 2YR1A 3RF9A 5XIMA 5I3FA 5LXEA 4AIOA 1EZWA 4I8DA 2V5JA 5LHFA 4RW5A 3CUJA 2DT0A 1UWUA 1GQLA 4FP1A 4LJ3A 4NL1A 1K9EA 3R43A 4HSOA 4Y9AA 2ZADA 2QS8A 5D38A 3MSDA 2R82A 1SW7A 1UUQA 4UUIA 3AWNA 4S2BA 1H4PA 3M0MA 4S3BA 1GWJA 1ZRQA 2X41A 3C3NA 2Z7KA 2V68A 2WCGA 1T5AA 1XISA 1TWZA 2NQZA 1NDZA 1SSDA 2PBOA 1FCQA 1MZHA 1O95A 5A2CA 4H2HA 1SZGA 1U33A 5CGTA 1ODZA 2XH0A 2ACSA 4TX8A 1W8SA 4ACZA 5BRBA 1TCDA 2DUXA 3OZMA 2INEA 4G7EA 4RZ6A 2VDHA 4F0MA 3LV5A 1B4EA 4ZSUA 2UWFA 2VM8A 5M03A 2Z7GA 3UY8A 2CHRA 3THCA 3SADA 1YADA 3L0GA 1K02A 1VFTA 3SBFA 2XIJA 4GYJA 3PJWA 3HF3A 3NQEA 3UXLA 1BVNP 2F6KA 4KFOA 4DJFD 3R13A 3LHWA 4PR4A 3E0VA 1WAUA 4AY1A 3CPGA 4DZIA 3UETA 4MMWA 3KHJA 4FLRA 1QNQA 2Y5SA 5F2LA 3TQPA 3TQKA 5KITA 4GNJA 1YTKA 1L6SA 1Z3NA 2NXIA 2W3ZA 1SJDA 3TSDA 4OBSA 4M7TA 4UQEA 4LCRA 1FDZA 2OPJA 4JFWA 2ZRXA 1EPVA 4AD4A 4N9EA 3JS3A 3F4VA 2WJDA 1Z44A 1BHGA 3VNYA 1RQHA 1TA3B 1US0A 4TQTA 1L6YA 5BRQA 3GVVA 1XSKA 3TXZA 1S5WA 1E6NA 3CUZA 1KFKA 1W5MA 3GH4A 1TQJA 4D71A 1ZAIA 4B3KA 3EA2A 4AWTA 3VGGA 4NZCA 4DO5A 1VHNA 5HWMA 3OBEA 3QGKC 3W75A 1FWBC 1S5TA 2A5HA 3L4XA 4BS0A 1FX6A 2IXVA 1K8ZA 3IRDA 1W9PA 1JCNA 4L6OA 1G7VA 3W1QA 3POCA 4P7RA 2VTFA 4UTUA 3TTOA 3WH7A 3WF2A 2ZZ6A 3QMTA 4CD5A 3U4FA 2OYMA 1VKFA 3VC5A 1W1YA 5IHRA 1FWWA 3WUEA 4HOXA 3H2CA 3W53A 9XIAA 4X2RA 2CETA 2OQLA 4MYAA 1P0KA 3INPA 3ANUA 1UG6A 1EEPA 4AZBA 3TYZA 4JTEA 3WLLA 1R3RA 1KQYA 4QFUA 1TR1A 3O1NA 2CKRA 2VYOA 4GY7A 4H9TA 2DGAA 3R5EA 4NXSA 4GXWA 3LNMA 1B57A 2VXNA 1FWSA 1IWPA 2DPEA 4LFYA 4MPQA 4EPBC 1R5YA 3ARYA 4REQA 1DTNA 1L6FA 4ZMGA 3WD3A 3D6NA 2C18A 1KKOA 1Q65A 1GYLA 4ONVA 3JR2A 2WQDA 3IUIA 1JULA 3PSWA 4Q8WA 1E55A 3LLXA 4J40A 4C1KA 5CG0A 3GG1A 3W1TA 1OQFA 2YCLA 4DWSA 1YKWA 1HL2A 3CH9A 4JICA 4RR4A 3GXFA 5A8PA 1CZ1A 3QPYA 3AFBA 1GOMA 1D2KA 4J3ZA 4HA3A 4HYRA 1A5NC 5A8MA 4CLMA 1VBJA 3W7HA 3TW7A 3OOQA 1YPIA 1MRAA 4F48A 1CXIA 1Y65A 2PAJA 4Y8FA 4LVBA 2VP8A 3NDZA 1R46A 1V6VA 1J8VA 2XIQA 1WZAA 3SUUA 4ATWA 1BKHA 2E9BA 4LPCA 2XVKA 2WM1A 2YB4A 1S3TC 3K30A 1SYTA 3KZSA 3CAKA 4LUTB 3NEVA 2DT2A 1V79A 3P62A 5F1VA 2X42A 3O63A 1Q6RA 3IRSA 2VFHA 3WLOA 1LL7A 4HA4A 1F3EA 4AMCA 2HMCA 3V0TA 4WIWA 1T8XA 4P8VA 2QIWA 1CI1A 3F4DA 1I8JA 3ONCA 1G01A 4S3DA 2HSAA 2WNWA 3UT0A 4JTDA 1N55A 3HTWA 3WQ6A 1XYLA 4A3QA 1FTXA 4ZO8A 3VE7A 1UH3A 1XLHA 4OU1A 3TYBA 4B9YA 4FX7A 1KCKA 3CGTA 3UQNA 2PZNA 4L61A 3SECA 3TMLA 2PWVA 4DM2A 5B7YA 3G1AA 1QOQA 3F7JA 1TMLA 4KW2A 5KTLA 3W1RA 4MB5A 5I07A 2J75A 4UNIA 4LTSA 3AU6A 5DF0A 1M04A 4UOZA 5A6AA 2IKJA 1WBJA 3W7EA 2X16A 4MAZA 4JTSA 4IX2A 2DFAA 2OZTA 3FA5A 2GJNA 3W7JA 3GXTA 4U3CA 2TPSA 1OX4B 3HMJG 2E09A 1B3VA 2B7PA 4EK7A 1HXJA 3N4EA 3T2PA 3DFPA 1C8XA 4PMQA 3O0FA 4EIVA 3QM3A 4QLLA 4AY8A 3UXIA 4UFIA 3THUA 1OFAA 2OVLA 1GW1A 5CPTA 4W7UA 3EOUA 1LORA 3CHVA 3OP2A 3KL0A 2ACRA 4XZHA 3NZRA 3O6YX 2UY2A 2QJJA 3ZT6A 3DC0A 1JEZA 1Y5VA 1UR0A 2X1RA 2D0GA 5LHEA 1FH8A 4GO8A 2IPJA 3EXTA 1RQEA 3WJXA 2A79A 1JD9A 3EMQA 4LRTA 2PC8A 3KCJA 4NX0A 2BHZA 2ACQA 3GG8A 3DFHA 5D2VA 3R94A 3THDA 3O05A 2W27A 3AIUA 2EG8A 2P3EA 1F5ZA 3GDLA 4P7LA 2OZ0A 2VX5A 4NHVA 3SCNA 1X6LA 1JFXA 2HNEA 3CM4A 2YKKA 3S83A 3AJ7A 1OFBA 3HQ1A 4TMCA 4PMYA 5HPOA 3P93A 4IQEA 1PDYA 3S2CA 4DYEA 4R85A 2PC4A 2YDRA 3KEHA 2OSXA 1TPDA 1JVNA 4GH3A 2WC7A 3THQA 3QQWA 1TMQA 1ZUAX 1H1NA 1UUMA 2CZ5A 1PZ2A 2O0TA 3M0LA 2C14A 3AI0A 2P88A 2VX7A 4Q7IA 3HV9A 3O9NA 1TTIA 1YPXA 1NWRA 3BZJA 2H8ZA 4D1IA 1IEWA 3UR8A 4IGNA 2GQ8A 1FWDC 4Q32A 2CWXA 1IIHA 1SQ7A 1UW9A 1GOWA 4HK5A 5IRPA 2WHJA 2QJNA 4GYPA 3VCCA 3ONBA 4WRHA 4C6NA 1UQZA 1MQRA 3ZLGA 3AHVA 2QVHA 4Q7NA 1BWVA 3CHDA 1J0KA 1CNVA 4HCHA 1TTQA 3PSVA 3VABA 3STGA 1UWRA 5AYBA 2G5WA 5K2ZA 2C71A 2FPYA 2PDMA 4D8AA 4W5ZA 3CV1A 4P8UA 2YBVA 5DY2A 3NPUA 1BGAA 3IIOA 3KUMA 2OMAA 3QLDA 1OT2A 3MWCA 2PCEA 4DNMA 3PNUA 1O94A 3A6OA 3SRFA 2TSYA 4JN8A 4LNYA 2V82A 1DIKA 3G0SA 4UFMA 5D02A 5DCDA 5CC7A 3DG7A 4BCEA 2O9RA 3VVGA 1MNZA 3DXIA 3QR0A 2JIEA 5EMKA 4RXGA 3ZWSA 4PB3A 1TPUA 5H8UA 4Z0JA 4GO9A 2Z6IA 4CN4A 4YIWA 4UOJA 1X39A 1GG0A 3WQFA 2WNQA 2VR5A 3UP8A 1K6WA 1XYZA 2GOKA 3EZ4A 4BY3A 3UWYA 5CG7A 4G9PA 3ZO9A 4AZ7A 3HOJA 4QG8A 1D3GA 2V2HA 4O50A 5G1TA 3AZRA 4IG2A 4NKCA 5DLCA 4QJ5B 1ICSA 4Z2JA 3R58A 1JCTA 4Q22A 4GZJA 1OWQA 4PH6A 3NSXA 3RJYA 4BHYA 2Y62A 4I7VA 3GIQA 3LD5A 5E09A 1I60A 4HU0A 1CEOA 5FA5A 1B4KA 4XK2A 1CCWB 2E28A 4RPPA 1TJ1A 2ZDRA 4D8LA 3QR3A 2A7NA 3Q58A 3RO8A 1TQXA 3DIPA 2A4AA 3N9KA 4MUPA 3U7VA 1H0GA 1OHLA 1VR6A 5I09A 3U9IA 4XAPA 2A3AA 3KTCA 3S6TA 1LYXA 4MZYA 4RNFA 1W1TA 2Y5JA 2YSWA 5BXRA 1MW3A 4AZHA 3CYJA 4MLJA 1QOPA 3G2GA 3U5UA 2OLHA 4YTTA 1RVKA 1MQQA 3GB6A 3M0XA 3KVJA 2PBGA 1ISYA 1TSIA 1RA0A 1TTPA 3GH7A 3W86A 2HE5A 3BXWA 3W82A 3EWYA 4LGXA 4E2VA 4FX8A 3UERA 1X98A 3VUSA 3PC0A 3HURA 1TV8A 2E25A 1VEMA 4LUTA 2VR2A 3LDVA 1J93A 1XF0A 4R5EA 1ISZA 1RA5A 5AB3A 4KCUA 1AG1O 4TTGA 4GQGA 2QKFA 1MEHA 2H3DA 5A95A 3DKJA 1VLWA 3MUCA 1RR2A 4TX6A 2GJXB 1KM4A 7REQB 3VD4A 3NA8A 3FYPA 3PZMA 3P8JA 1HP5A 3L0KA 2C3ZA 1XBZA 1US2A 1CGXA 1H63A 3N2MA 2ZXQA 3ALGA 3ERPA 1GG1A 1E4MM 1UD5A 1I2OA 1KTCA 4C6JA 1JF5A 4GNVA 3UXAA 1GZ1A 4N9DA 2YDAA 1KTNA 3KX6A 5C8BB 1TMHA 1ZQ5A 3QZAA 3S2NA 2YIHA 5C55A 4AFYA 2BDQA 2P0IA 3C61A 5FJRA 4NSBA 1YDYA 4GY0A 4W85A 4FF5A 4H8NA 5CGQA 3WDRA 1RP8A 1XFBA 2VMFA 2XGBA 2V5DA 4CQ8A 2O4MA 4PL2A 1HKJA 3WF0A 4MJZA 4X0NA 3IAQA 2VVSA 2YYUA 4AD1A 1OFOA 2FTWA 3ABQA 3AXIA 3TYEA 2X40A 2BHUA 3IJ7A 4GI9A 4DI8A 2YDSA 3MQTA 1IR1A 3SFWA 4UMBA 1T7LA 5HXMA 2ZA2A 5L6UA 5CZ0A 1A0DA 2HS8A 3T2QA 4ADSA 3NVTA 5KMYA 3ZLHA 4EP8C 1QWGA 2V69A 3LHZA 1E0XA 1RCXB 3LCXA 2G3MA 4JQ3A 5A8NA 3P81A 3N19B 2CLIA 3FNDA 1GQIA 5H1WA 3YPIA 3W7CA 1GNXA 1KFLA 4Z17A 1C29A 1GYNA 4B3ZA 5FEWA 2R14A 2Z1WA 3WH8A 4JZ5A 4EPEC 1UZHA 3WDIA 4FA3A 1TE6A 5C9WA 3LSCA 1YPFA 2C79A 4Q4KA 2XHYA 2J8GA 3SGZA 2Z4GA 4AZ5A 4C6EA 3G77A 2YFNA 1I75A 2FTPA 4GRSA 4QNEA 3A4WA 4CN6A 3XIMA 2W91A 5LIUX 1YBQB 1Q2RA 3CQJA 3WJSA 4WCJA 4D1JA 2PUZA 5HULA 1MNSA 5LA2A 1NY1A 3RJXA 1X1NA 3HO8A 1S2CA 3O07A 5DMYA 1E0TA 2ZUMA 3BDKA 3BGAA 3OQ8A 3PB0A 5FCZA 5AHLA 3HGJA 2P8CA 1HVXA 1PVNA 1YNQA 4IPNB 5I3IA 4HOZA 5FL0A 1S2TA 3VDAA 5FJIA 1WOAA 3T6CA 4OE7A 1VFSA 2WZTA 2QDEA 5D32A 1M41A 2NX9A 1XBXA 3NZGA 3N18A 4Q33A 4LALA 4NI3A 4C6LA 1G7UA 1JNEA 1YXDA 2H3BA 3SCTA 2CLEA 2JGYA 3UZ5A 3UYIA 1ITQA 1Q7QA 4MJ4A 3KBJA 3H7RA 3OHIA 4G6CA 3DG6A 4H6EA 1E5NA 4XUYA 1GOIA 3PJXA 3VOIA 3E5PA 4WDWA 3GDMA 2RUSA 2H8XA 1RH9A 2VEKA 4KWOA 3S5SA 4M81A 4OJYA 4XKMA 1PX4A 4OECA 2VWTA 1LWIA 2NUYA 2YA2A 2YCEA 4GX8A 2JF7A 4IMFA 5M2FX 2VCAA 1KFEA 3AALA 5TF0A 2YPIA 2J9YA 4GA8A 1VLIA 2HVOA 2QQ6A 1N82A 4DF2A 2D22A 3KDOA 4DPQA 4NF7A 5CPLA 3AMLA 3H2EA 4HN4A 3ANYA 1XGZA 3S6OA 4JOMA 3FXYA 4JNMA 2DQXA 2CBJA 2QIIA 1KM3A 4JYDA 3GAKA 1VENA 3PZIA 5F4SA 3N25A 3USBA 3GXMA 3NAVA 1B0IA 3LCLA 4EOUA 2DUAA 1Z41A 4IZGA 2QCMA 3CL7A 4Q8MA 5BWAA 1KGWA 3H2NA 3AHXA 4LYRA 3HG3A 3ZM8A 4UQBA 4CKQA 5CEWA 4GBDA 4H4IA 3GTNA 3ARVA 1L2QA 4PTNA 3F5JA 3NTYA 1EHNA 1ZLPA 4ILSA 4W88A 2C16A 5HR6A 1QHOA 1FKWA 2DSZA 1H0IA 4ZBCA 3U2CA 1UP2A 5D4YA 2XIOA 2V2DA 5D04C 4E8GA 2HQAA 3MUY1 4KETA 3B97A 3LTYA 3NPWA 3QZEA 3HPSA 1X7IA 3FN9A 3HQOA 4J27A 2RAGA 4MWAA 2CHOA 3M0KA 4S2CA 1DQUA 3TSMA 2DUZA 5JUVA 2CBIA 2Z1SA 4F0LA 1EEXA 1A47A 4C7GA 4HNVA 3WLNA 3OB8A 2PCQA 3TA6A 1QFEA 1W9DM 3C8FA 3CB3A 1LDCA 3QGVA 2IQ0A 3IVTA 2FHBA 1LWJA 4Q4SA 4CCCA 1PDZA 2E1WA 1XL9A 1QNPA 2A3LA 3H7VA 3UJ2A 3ZLFA 2XH4A 2GJXA 7REQA 3PBUA 1GOKA 2WM0A 5A8GA 4M29A 3DHFA 2FTYA 3L23A 2OX1A 5CSSA 4NJHA 1R30A 2V8ZA 1H7PA 3TYCA 4M6UA 3MP4A 2TODA 4QG9A 5T9BG 1XYFA 1Z7AA 3QBUA 3U4AA 2DH2A 4OUEA 2X7VA 3U0HA 2F2KA 1TJ0A 3RM8A 3EX3A 3UJRA 2WVVB 4C60A 1J5SA 2W6RA 4E2DA 3GC4A 1F6PA 1WXJA 1YTEA 3RX2A 1ISVA 1Q6CA 4L4OA 3TAOA 5EYWA 1SFJA 3OLDA 4DZHA 1EJTC 3F4NA 4FLSA 1A5BA 2G41A 4XD4A 4DJFA 3G1XA 1MUMA 1IXPA 4O1BA 3UZWA 1YNYA 4JY9A 4IFRA 4ZO7A 4POCA 2Y8KA 3ZR6A 3OTRA 2XFRA 4Z08A 1V6YA 2QPSA 2INFA 5FJOA 3S1GA 2CKSA 4O15A 3SO7A 4C6FA 1R85A 2VCBA 1HKIA 3MP5A 3R79A 1U1UA 4BKNA 3OA5A 3EKLA 4HT3A 1I0BA 1Q13A 4HCDA 2XVNA 1M53A 2CC0A 3L9CA 4C6OA 2WV8A 4BWLC 3E3HA 2RJGA 4GX9A 2QMKA 3GE7A 2E3ZA 2JE8A 3VKBA 3EX1A 1YLVA 2EKCA 4YL2A 1DEDA 2JALA 2YB1A 3MBDA 2WBKA 1R87A 3SR7A 2CCRA 5CPQA 2GUYA 4JL2A 1GORA 3VCRA 4B9ZA 4Y9NA 4WJ8A 3FDGA 3H70A 1VJIA 3GUGA 3AMCA 4JHZA 4FNSA 5A1AA 3MHFA 3MSGA 1KM5A 2A2IA 3DC8A 3WJYA 4N9BA 3C4UA 2NSXA 3B8TA 5GNYA 2R1LA 1P0BA 6CGTA 2GSEA 1UKSA 2CXEA 5DRCA 3P2VA 1UKTA 2FB2A 4QRNA 4KEVA 3E5BA 2B0MA 1TIWA 4PUDA 2ZQ0A 1P7TA 4WDXA 1CPUA 2TAAA 3EWXA 1E1CB 1A49A 1OYBA 4WHBA 3OYXA 3QEZA 1YEYA 4K38A 1K8XA 4LSBA 1GPFA 3MI3A 5CPNA 3OVQA 1JYWA 3W81A 5I3GA 3SM0A 3N4FA 4YN5A 4Q4OA 4UCFA 5J8LA 3KRZA 5EBUA 2FVKA 4RE3A 5HPCA 2EQDA 4O0ZA 3IK4A 4PMDA 4NYUA 5FD0A 2QPXA 4U5KA 5C9XA 1QTWA 3B9NA 1XKYA 2HBVA 3JU2A 5AC7A 2YZRA 2CWNA 3RMEA 4GUHA 4M6PA 2WYSA 2DW7A 3TV8A 3SY5A 1U2YA 3RIKA 2GDQA 3I6RA 3F4WA 1JD7A 4LEFA 2QF7A 2ZXDA 3VM5A 1XJBA 1V4YA 3NL5A 4IUOA 2I57A 3AS0A 1EXPA 3VIPA 1VC4A 1NP2A 2EG7A 1HVQA 3K4AA 3DFNA 1ZENA 3E0FA 4N0RA 3H24A 2ZUVA 3KTXA 3PHAA 3VNDA 3B8IA 3NG3A 1KXVA 4DBSA 3WFLA 5I03A 3IS4A 2AL2B 4PUNA 1JCLA 1H7XA 1Q6LA 1WE5A 4AHOA 3UGRA 5LNVA 1XLDA 1MW0A 2J7EA 4U4MA 4KPLA 3C0LA 4A29A 2C1HA 4DUOA 4UTJA 4PMOA 4HPJA 4IH3A 3ARZA 5EPDA 2CLHA 1O4UA 4UMAA 2E9MA 4IIEA 4HJFA 5DBUA 4YCPA 3MT1A 1UD8A 1W2VA 3O06A 3SN0A 3OHMB 5D8ZA 1DWAM 3MW7A 3T78A 4K8GA 2O7QA 3TWBA 3MUZ1 1W1PA 4GQBA 4GC4A 1JZ8A 3W4RA 3BARA 3CYVA 3PJUA 4JXCA 4MKSA 4AIBA 3P6LA 4BA0A 3THAA 3L4WA 4H8HA 1UWQA 2BWGA 1KBLA 1XH1A 4GVHA 3W25A 3U7BA 2OEJA 3FX4A 1F2JA 3V5CA 1V3JA 1PZ0A 4ZO9A 3IUDA 2Y85A 5AC4A 3N04A 5CJMA 4ZE5A 3CMFA 2EPNA 4D6CA 3UF9A 1QOXA 3UCCA 1W5NA 1JNDA 4GYFA 3TN5A 4GUGA 4C91A 4QDPA 3RCYA 3BAYA 1C3FA 2GGJA 3RLHA 1DWJM 1EHAA 4LNCA 1UROA 4J1OA 3QR1A 4GE8A 1JYVA 1Y5XA 4UOQA 1GYMA 2YCIX 3ATZA 3W24A 3D5HA 3SCSA 4MM1A 2Q8ZA 1LP6A 3CUHA 4J7RA 2FFCA 3LEPA 3ZOAA 2OXNA 4N6EA 3RK8A 1E4NA 2VEFA 3I7SA 4MNKA 2PLMA 4UTLA 3S6DA 1EZ2A 4IISA 4C6KA 1HIZA 4V33A 3E49A 1DQWA 3CHEA 3WLRA 4A22A 5ENLA 4CU8A 4ATLA 1S46A 4F2UA 2EXOA 2J79A 1ITXA 3UY7A 2JIWA 4I5UA 2QDHA 4HNTA 2MNRA 4KWWA 3WNMA 5A6KA 3VTRA 1XSJA 2XGIA 1QT1A 1SZRA 3LI1A 5I79A 1S39A 5D09A 3UNDA 3WL0A 1UD6A 2GQ3A 3O16A 1EDQA 3ZVHB 1LUCB 5I24A 2J9ZA 1XINA 1GK8A 1TB3A 1PKNA 1MZRA 2NLIA 4UTWA 1TIMA 3TJ4A 2GSJA 5C5YA 3P67A 4IJBA 4ZQPA 4EAMA 4Y96A 1PHQA 1R47A 4WKFA 4DM1A 1Q6QA 3L0NA 2HXUA 5CZTA 5LZLA 3T1GA 5CSUA 3FYOA 3GYEA 3LGDA 3GNNA 1BF2A 1SMDA 2ZVIA 2EAWA 4XZMX 4HYVA 8TIMA 1DIEA 3M0VA 2XPKA 4RV8A 3QYSA 3EX2A 4O12A 3UWEA 2GJLA 1AFSA 1VB9A 4JIIX 4L56A 2OYKA 2DZUA 4O1AA 1CLKA 4JDBA 2AAAA 3S9YA 3UNTA 2WMFA 1LG1A 1SR9A 4BQ5A 2ZX8A 3MUAA 5BXTA 4FXRA 5IDZA 3G18A 2R1NA 1CECA 1H09A 4ORMA 3RU6A 1N8IA 4E5TA 1WA3A 3ANVA 1DVJA 1GJWA 1UWAA 3TJIA 3CPRA 4AMAA 1KWKA 4CU7A 1QO2A 3UWUA 1G1YA 1XYMA 3KL5A 3ALFA 2VHLA 2VX4A 2XWDA 1JFHA 3VFLA 4O17A 2I9EA 2VDGA 2TYSA 1MI3A 1WYIA 4ZB5A 1DPMA 1YNPA 1LRTA 2CNCA 4NP7A 4PEEA 1UP3A 3GNXA 3QOKA 1OGGA 3OLEA 2QXWA 4HSNA 3RPTA 1SFTA 4B5WA 3WLHA 4NYYA 4BFAA 4NJJA 1A5OC 2CZFA 1Q4WA 2J7CA 4GJJA 3VZXA 3HU7A 1ZJBA 4P61A 1IEXA 5TD4A 4JEJA 4HNLA 4IMEA 2PODA 1EUNA 3DECA 3IVUA 4ZVJA 4D6EA 1BLIA 1XSIA 3II1A 2CFFA 4F66A 3PN8A 5EMLA 2NVAA 2J25A 3M5YA 3EKZA 2D2HA 2I16A 3OVGA 3Q94A 5LYRA 1FWFC 2Y5EA 3DH7A 4EWND 3NEHA 1VYPX 3O7UA 3BAIA 4EXBA 3DBNA 4LVGA 3WMLA 3F2DA 4XD6A 3U2ZA 4O14A 1GPWA 3B05A 2Y7DA 2NSOA 2QUNA 4JTGA 4D2JA 4AXNA 4XV0A 4LVDA 3WMCA 4NASA 1WDWA 4JFTA 1S2WA 3SQSA 3HPZA 1R7AA 4QJ4B 3PBYA 3NQ6A 3WK2A 4AHPA 4DJDC 4V28A 3B4YA 4GZ7A 3VDBA 3LCHA 5EMMA 1UD3A 3TNBA 4K8HA 3FKKA 3W6LA 1C7TA 1FHUA 3OBAA 1OZQA 4E4UA 2SFPA 1C9DA 2HISA 3W2JA 1OEPA 3WFAA 1EA0A 2NUWA 4JBRA 2POZA 1KBKA 1OCJA 1OADA 1BSIA 3BQ6A 4X9YA 1JZ3A 1Y8BA 3CIVA 4PMZA 4MF4A 4KRTA 3VZYA 3ITXA 5FJTA 4A8NA 1ZB5A 4HU4A 1P4CA 3REQB 4DXKA 2V38A 4BF5A 5A6BD 4K1GA 1CWYA 3L5AA 3SJNA 3CB8A 2DIJA 1OG0A 1QI2A 3EB2A 2OT1A 4L9ZA 1KCXA 3H23A 5H6HA 1VZWA 1KRAC 4HNCA 2XYLA 4HMCA 4RCXA 5HUPA 2CZEA 4HHLA 4HZMA 4FHAA 4ZQOA 4C5ZA 4W8BA 2X0HA 4L1WA 4DAIA 1V8EA 1HJXA 3NIYA 1B3YA 4QJ3B 1P6WA 3EPOA 4M80A 1EXBA 1L0PA 3OJGA 1NOFA 1K8YA 2PWEA 1QCWA 1UR3M 3G1YA 3SCPA 4R9OA 3FGCA 3R4IA 5KINA 3WQ5A 3LBMA 4XSLA 1FWEC 2XINA 3TH6A 1E3XA 3B0VC 2FB3A 4ICCX 5I06A 5JXQA 3GXPA 1JZ7A 3AQUA 3VNZA 2ZX6A 2Y4SA 4IIFA 4IQDA 4XBKA 3NCOA 1YXCA 8CGTA 4O13A 3AHTA 3M44A 4ZODA 4S3FA 1R7OA 1HKWA 3W7LA 4RNHA 1TE1A 4QSHA 3W72A 2QEZA 2WW5A 1ZNNA 4NRRA 3AMDA 4LS1A 5F4WA 4PCSA 1TV3A 1J0YA 3GD6A 4NRSA 5HJXA 3LYEA 3ZFHA 1AQFA 4PSRA 2ZZ7A 2ACUA 1BSLA 3CV7A 3NZPA 2PGRA 4ZQNA 2JKPA 2VX6A 4JEQA 3ZVIA 2VGBA 1OFEA 3BC9A 1B3WA 1JQVA 3H4GA 1FWCC 3CQ0A 4DQWA 1CXLA 2QZRA 2OO0A 3NQ7A 1OX5A 1J01A 1SGJA 2BVTA 2QF8A 4KBXA 3C6CA 3G1VA 1LT7A 2PF0A 1EQCA 1ALDA 3T44A 3NO1A 3L68A 1Q63A 2G3FA 1LUCA 1TJ2A 4S3GA 3NQCA 3Q37A 5REQB 3UVIA 2ZRZA 1MFVA 1P0EA 4PODA 3RRAA 3ZJ7A 3K13A 3UW6A 1DWGM 3W7OA 3RM4A 4CD7A 3S2MA 3IJ6A 3S2LA 3U8GA 4C1NA 2GGHA 4PUWA 4JHMA 2GJRA 4NNBA 4LC6A 3VOJA 4IFKB 3PFMA 3BW2A 3LPPA 3TOYA 2GWNA 3IJLA 4IPLA 4ZA0A 3EB3A 1R86A 3KWXA 2FHCA 3BMVA 3FCPA 5A2AA 2GVJA 1ZFJA 3N2OA 4X2PA 1F6KA 1J0JA 4S3CA 4JQ2A 5D9PA 1JUKA 1CTNA 4FIQA 2FZNA 2WJEA 4FXSA 3VMOA 3N2CA 3FIGA 5H8PA 4ADUA 2WVSA 3KL3A 4MY9A 2FJUB 1QXLA 4TO8A 4QIUA 1PX3A 1W1IE 1PYMA 2ICSA 3BSMA 5DT7A 1M03A 4LCSA 3M7SA 3LV6A 2I14A 4CQ9A 1SO6A 4CD4A 4CGTA 5KZMA 1KXTA 2XSBA 1REQB 3LZ5A 4LS2A 5CBBA 3W00A 1JAKA 3FS2A 3JW7A 4O57A 3WX7A 4AB4A 3ARXA 3RDKA 3A23A 1Q4NX 1UR1A 2QGYA 4JPGA 3MP3A 4E3TA 1I45A 1ENUA 1FBAA 3WMSA 4LS0A 3UZJA 1PTAA 4X63A 1E0UA 3QSRA 3TZFA 1W9UA 2ISSA 2XN1A 3UYCA 3WQ8A 5FI8A 3QHOA 4EF9A 1TPFA 3MTWA 3M5ZA 3CIWA 1ZALA 5G2HA 2ISWA 4TX9A 1GVRA 1N7KA 4MNLA 2Z1KA 4NQ1A 3DHPA 1KGXA 3LN3A 3E9AA 2WC4A 2HTMA 1SM9A 4DO6A 4UR8A 3BLIA 3B0XA 5A8QA 4EF8A 3Q67A 5DO8A 1KM6A 1MDRA 1O12A 1UPMB 1XG3A 1Y7VA 4RUBA 3AXMA 2FGZA 3OG3A 1QU4A 4ICMA 3GU9A 4J35A 3A13A 3A24A 1QR7A 3B04A 4GUFA 3W22A 2FJKA 1GKRA 3S1WA 5A6TC 3NQ2A 2E68A 1KV8A 1Q5MA 3VIOA 4B5VA 4N4QA 1RLCL 1XIDA 4Y7EA 3QY6A 1W3KA 3BW4A 1EPXA 4AD3A 1AMKA 5HMSA 1WDSA 4DZAA 1Q7MA 3PAOA 2AL1A 4F0RA 2BXVA 5IXEA 1CGVA 1IZCA 5DT5A 4N7QA 4RJEA 4JCMA 5K9DA 3L5LA 4YTSA 4DO4A 4PRTA 3B8UA 3TN3A 5HQEA 1W5PA 1XRVA 1T8QA 2VGFA 3VKKA 3AUJA 3S5OA 4NNAA 4HJWA 1MSSA 3MV01 3RN6A 5U4NA 4O54A 4J3SA 3N6JA 2PURA 3KBNA 4DBDA 5C2GA 3BJFA 2XH2A 1RJQA 1TPH1 1XGEA 2W67A 4C6CA 4H00A 1NWUA 1TTJA 3WSUA 1HL9A 3PUEA 3QV6A 3PANA 4QE1A 3ISIX 1K7FA 1KBIA 1GEQA 1CGYA 4XX6A 5AN7A 1TPEA 5GNXA 5BU9A 1SR0A 1ZU8A 5BXSA 3S1XA 2Q8LA 1UD4A 3QSTA 4I9TA 3BG9A 2QDGA 4DO7A 3VU2A 2NQLA 5PTDA 3QXBA 1H5VA 1IYXA 1XDJA 3VA8A 2Y7FA 4FF7A 4LVAA 2IKIA 2OT0A 3WK3A 4GKTA 3GBDA 1U1JA 1CLVA 4MNJA 4JQAA 2PE4A 2BBFA 3KS6A 3B0UX 3M1ZA 4A3RA 3VNJA 1TVPA 2PP1A 3FJ6A 4IPPA 4PC8A 5F4XA 3TC7A 4WY0A 3P61A 4IGHA 1Q6FA 4XSMA 5CKSA 2ZRWA 2BS9A 4JKMA 1XCXA 2PB1A 1EUAA 3D3AA 1WDPA 4FZIA 4FI4A 5FJPA 2I9UA 3GIYA 2J7HA 1QRQA 2O92A 5CBIA 1OCBA 3AIQA 4WX2A 1A4LA 1FFRA 4LF2A 1OK4A 2ZZ5A 1HFBA 2QMJA 1AJ2A 3M0JA 4EXQA 2R94A 2IKGA 3A64A 4AQLA 1W3HA 5CSRA 5A6SA 2BOFX 1CLXA 1OK6A 1SU5A 1EP1A 3ZZ1A 2VOTA 2JQXA 5DANA 4GYKA 3MBFA 3WBYA 2FMOA 3RCNA 2Z0IA 1CXKA 2DIEA 4QE4A 3UCQA 3ITGA 2ODOA 4V1XA 2VFEA 2CEQA 2QW5A 2HE8A 4WXZA 1UC4A 4FOUA 1DXFA 3T9PA 1JJKA 1ZJAA 3QGAC 3UU0A 2F9RA 1TR9A 4HNNA 3M41A 1K6AA 4WXYA 2WXDM 2Y63A 5J5DA 3QMRA 3QTGA 2B7OA 5I7GA 2C1GA 3AMKA 5ABGA 1VJZA 2ISFA 3N2BA 1ZJIA 1OFDA 2X1TA 1VCGA 1SJBA 5BOFA 1LBFA 1JI1A 5LA1A 4UTFA 3L2IA 3WK0A 1QBAA 5REQA 1E40A 1WKEA 1RJPA 4BQ3A 2QJGA 3F2CA 3DEQA 4M8UA 2C19A 2NQ9A 1XLEA 3NPVA 2HPIA 2DSVA 3ZQ9A 3UR7A 1I6NA 1L6WA 3W7DA 5I0DA 3P7YA 3PBVA 3W76A 1D8WA 1OJXA 2X1IA 4IFKA 1LOLA 4YXGA 1DE6A 1BYCA 1PAMA 6XIMA 2XZ9A 1ELSA 4IQLA 3LHVA 5GQBA 4JX4A 1KM1A 1U22A 3GU1A 4S38A 3PS7A 2PZ0A 1WKYA 5AC5A 3V5OA 2DORA 2YL9A 2D1ZA 3GU2A 1PKLA 1A5CA 3C2OA 3CTTA 1VPQA 3KRBA 4MY1A 3GO2A 1YIXA 4F8XA 5K7JA 3QN3A 3BK0A 2QCDB 3UBPC 4Z2KA 2POTA 4E6MA 2ZTKA 2B81A 1T0OA 3NQGA 4GVGA 3MMUA 3M6DA 3WNOA 2VNCA 1HO4A 3WF3A 1TJPA 4LY4A 3OZYA 3IJQA 4M3PA 4H19A 1CXFA 1XLCA 3QMSA 3GM8A 3H6OA 2VL4A 4J5NA 4PMXA 5T9CE 4KT2A 5CPOA 4KFNA 4JTAA 4AC7C 5TQLA 2A7RA 3BSHA 4KIRA 1YXYA 3IUHA 1EFZA 2OCZA 2PDGA 5BW6A 3AXXA 2YBUA 4Q4QA 3W1LA 2I5QA 4LXFA 1W9XA 3H4XA 2J88A 1C7SA 5CSYA 4Q4RA 3VNKA 1BRLB 1OIFA 1MYRA 3UCDA 3AZTA 1VS1A 5C54A 1A50A 5CPMA 4EKJA 1GOOA 2QCNA 4R33A 3KBMA 4NJGA 4NVTA 1L8PA 3UFYA 5E0KA 3PZGA 5BYWA 1UKQA 2G95A 1XYCA 5M5DA 2D2OA 4N6FA 2A3CA 3WNLA 4NZ3A 2GVGA 3GTHA 1LWHA 1K7EA 2EJ1A 5EFFA 1QNVA 3BLDA 2AKZA 4JCLA 1V6TA 2E8ZA 2BGSA 1EQPA 4ATDA 3FAWA 3T09A 1XD0A 2WHLA 2I5GA 1OM0A 4JKKA 4LWWA 5ABHA 1J96A 4FEZA 2DZWA 1XXXA 3W1PA 1ZBKA 2DVTA 2XVLA 4ZQMA 1QWKA 1PKMA 3LCFA 1LRQA 3I7QA 1H2JA 2WJZA 1RP9A 2J24A 4QQ3A 1CIUA 3UVAA 1HJVA 1QPKA 3M0YA 5AY7A 3PAJA 3ARUA 5AVHA 3WLSA 4XTDA 3LG3A 3NQVA 3MSYA 4F40A 1XKJA 1IT7A 5BMWA 3L7RA 2YW3A 2EKGA 2BOEX 3CBWA 2ON3A 3HGRA 4GBUA 1XUUA 2H90A 2Z2BA 4IMCA 1NF0A 4NZ5A 4KESA 5A94A 2IXUA 2E6FA 4AVFA 1JQXA 3F5KA 1E71M 3B9AA 1R2RA 3EYPA 3SGGA 4IXHA 3NQ8A 1AD1A 1JGIA 1YTDA 3AJXA 2KZHA 3I4EA 1EGVA 1NDWA 2PDXA 3C2VA 3VD9A 3MB9A 3OEXA 4H9VA 1FWAC 1I9CB 4O16A 1LZOA 3GDKA 5EA9A 3WZ0E 1X1ZA 2HVMA 3GTIA 1UIPA 2D0FA 1OFQA 3TFXA 3G0UA 2YGYA 4KH2A 5AYYA