1HQTA

The crystal structure of an aldehyde reductase y50f mutant-nadp complex and its implications for substrate binding
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
324
Chain Sequence
AASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIFGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDEHYDE REDUCTASE
publication title The Crystal Structure of an Aldehyde Reductase Y50F Mutant-NADP Complex and its Implications for Substrate Binding
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 103
structure length 324
sequence length 324
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1hqtA00
4HMNA 4AUBA 3UGRA 2IKIA 3CAVA 4R9OA 1MI3A 4PRRA 3CASA 4G5DA 3ERPA 1QRQA 4WDUA 3WCZA 3LNMA 3R8HA 3RX2A 1PWMA 1RALA 3CV7A 4XZLX 4XZHA 2HE8A 3COTA 2PDMA 2IPJA 2HDJA 2R24A 1SM9A 3LQGA 2PEVA 3GUGA 1PZ1A 1MZRA 2IPWA 3LUTA 2BGQA 1J96A 4XZMX 2PDFA 5HNUA 2ALRA 1JEZA 3EAUA 3U2CA 2IPFA 1T40A 4H8NA 4XAPA 3M0IA 3EB4A 1UR3M 2F2KA 4YU1A 3LZ3A 3S3GA 2PDGA 4WDWA 3UWEA 2ISFA 1S2CA 4ICCX 1Q5MA 4WRHA 4RPQA 4Q7BA 4FAMA 4GQ0A 2FVLA 4JTDA 1MRQA 3RX4A 3H4GA 2R9RA 3V36A 2PZNA 4FALA 1S1PA 3UG8A 3LD5A 1ZUAX 2PFHA 3M4HA 4F40A 4XO7A 5LIWX 1LQAA 2VDGA 1PWLA 4LBRA 3LENA 2PDYA 3O3RA 3N6QA 2FZ9A 4YVXA 2AGTA 5AZ0A 1EL3A 2HEJA 1S2AA 3DN5A 3V0SA 1OG6A 4PRTA 3LEPA 4GQGA 1VP5A 2ACSA 5M2FX 5LIUX 3Q65A 2P5NA 4JTAA 3CAQA 1ZGDA 3BURA 3DOPA 4ZFCA 3GHRA 3BUVA 2PDXA 4YVPA 4DBWA 1AFSA 3O0KA 3R6IA 5JH1A 2HE5A 3WG6A 3B3DA 4LAZA 1XGDA 2PF8A 4YVVA 3GHTA 4HBKA 1PYFA 3UYIA 3F7JA 1AH3A 2F38A 2ACRA 4XVDA 2FZBA 2PDKA 4XZIA 1Z8AA 4JIHA 4JQ1A 3QKZA 3Q67A 4GIEA 2INZA 1FRBA 2IQ0A 5HA7A 1Z3NA 4XVEA 3UZZA 4GA8A 3GHUA 5LIXX 2QXWA 4PR4A 4WGHA 2PDWA 3ONBA 3RX3A 3R7MA 3ONCA 3R94A 4JTQA 2J8TA 4JQ2A 1A80A 3UFYA 1T41A 2IKGA 4PMJA 5C7HA 1AZ1A 1QWKA 1EKOA 1Z89A 1AH0A 4YS1A 3VXGA 3UP8A 4GACA 1R38A 2BP1A 3LZ5A 2I16A 1X96A 2WZTA 2FGBA 2PDNA 4I5XA 3WBWA 4IGSA 1PZ0A 1Q13A 2HVNA 2FZ8A 4QBXA 3BCJA 2IKJA 4FZIA 3G5EA 1VBJA 4DBUA 2BGSA 2IQDA 1ZSXA 4JIRA 1C9WA 2PDUA 4JTCA 4ASTA 3MB9A 5JH2A 3T42A 4LB4A 2PDLA 2IS7A 2WZMA 3V0UA 1GVEA 3N2TA 4L1WA 3H7RA 2INEA 1US0A 4OTKA 1HQTA 3EB3A 3NTYA 1EXBA 2ACUA 2HVOA 4QR6A 1LWIA 2FZDA 3UZWA 1IHIA 3R8GA 3D3FA 2DUXA 3UZXA 4WEVX 4H7CA 1RY0A 5LIYX 3LN3A 2PD5A 2PDIA 1YNQA 1S1RA 1ZQ5A 4EXBA 4PUUA 2C91A 2NVDA 2A79A 3LQLA 2IPGA 1IEIA 3G1RA 4QX4A 3M64A 4GCAA 2DUZA 2IKHA 4PUWA 2PDCA 4QXIA 2HV5A 3UZYA 1K8CA 3WBYA 2CLPA 1ADSA 4JQ4A 4LAUA 3H7UA 4DBSA 4XK2A 3GHSA 3FX4A 2PDJA 3V35A 1YNPA 1X97A 4IJCA 4XZNX 2DV0A 4XO6A 2NVCA 5KETA 1AZ2A 3LBOA 4NKCA 4FA3A 1XJBA 2PDQA 3P2VA 1X98A 5AZ1A 5HNTA 4JQ3A 1M9HA 1EF3A 4JIIX 4L1XA 3R43A 4WDTA 2ACQA 4MHBA 4DZ5A 3WBXA 3CV6A 1HW6A 3FJNA 3C3UA 5DANA 4LB3A 4EXAA 3V0TA 1Z9AA 2I17A 4Q3MA 4JQAA 4WDXA 4GABA 1YE4A 5LIKX 1RY8A 4IJRA 3CMFA 1YE6A 2PDHA 2PDBA 3R58A 1XF0A 4LBSA 2PDPA 1AH4A 4JTRA 3KRBA 3MC5A 2PD9A 3BV7A
chains in the Genus database with same CATH superfamily
2NSXA 1F7BA 1WUEA 1E71M 5FACA 1OX6A 1SO5A 3RRXA 3WD4A 3I10A 3NPWA 1S5TA 4Z0JA 4CGTA 1VB9A 1QRQA 2OGJA 1F2JA 3WDQA 4AWUA 4HNTA 1H50A 3DFYA 3E9AA 2Z24A 1ZLPA 4YMZA 4BQ3A 2WANA 3ZS4A 3TYUA 3SY5A 2W9MA 3AMLA 1LQ2A 2VFIA 2DFAA 3I68A 3ELFA 3GXPA 4JTIA 4NL1A 1C7TA 1JUBA 3ZVHB 1E73M 2W3ZA 1SU5A 1IEVA 2PRMA 3BTNA 1ZBWA 4C65A 4DO7A 4L6HA 1VENA 4ZQOA 3WQ6A 3VOGA 1Q6DA 3TK7A 2QGYA 1XIJA 4MB4A 3B05A 3E2SA 5A6SA 3CUFA 3PPCA 4J2PA 1YW1A 2NQ5A 2PA6A 1RCOB 4X2PA 2QR6A 3L23A 4G7EB 1IEQA 3TSMA 1KM2A 4UB9A 4W85A 3NOEA 2W91A 4B5SA 4Q7BA 4RXFA 1UZ1A 2YX0A 3FN9A 3NGFA 1FWCC 1HO1A 2UWFA 4LNYA 1E0UA 3C2FA 1OT2A 5AFDA 1RP8A 1OGBA 4H01A 3RLVA 1J6OA 4RE4A 2DJXA 3RLGA 3AIEA 4OKDA 5HPOA 2E9LA 4EF8A 2WHKA 2X1UA 3AIWA 4NZFA 4IIDA 5AZ0A 1UZHA 1BYCA 1ECEA 2QV5A 3NSXA 1BEUA 2G0WA 3B4UA 2PP3A 4UTTA 3ENLA 4JHMA 5JXQA 3FIGA 3AYTA 4E6MA 3SUWA 4CNTA 4Z2KA 3PK7A 3DU0A 3MP3A 1L6YA 3GSMA 2X0YA 4Q8OA 1I2QA 4WD0A 5DCDA 3T0CA 3STGA 4N9CA 2V82A 5JUVA 1K8XA 5CZKA 2Z2UA 3IUIA 3W7KA 1VIZA 3QTPA 2V2DA 4DELA 4FHAA 3LSBA 5GNZA 1TB3A 2REQA 3RN6A 4TR9A 5D9NA 4W88A 4IT1A 3WQFA 5I3DA 2CLKA 4X9SA 1AL8A 4FR6A 4S3BA 3VAVA 3KZPA 4TQTA 2YKKA 2OGYA 3AU2A 1XFBA 3NO1A 3ITCA 1UMYA 1QO5A 1TJRA 4M7SA 1EIXA 2OSWA 4FNRA 3NQ7A 3S9IA 2PC8A 4NXKA 4QFUA 2QUNA 4CQ8A 4ZQPA 3UXLA 1E6RA 3ABSA 2WVVB 5CC6A 1OFQA 4K2SA 3II1A 4LC6A 5CCZA 1UD5A 2PDWA 3M5YA 3TN4A 1WQ5A 1H49A 2O56A 3WDHA 4IICA 1V51A 4FO4A 3IJIA 3UPBA 4DNHA 3CJPA 2D2OA 3QR0A 1YPFA 1JD9A 1HGWA 1PUDA 1TV5A 4PMJA 4E5TA 3WLNA 1SW0A 3AO0A 1D8WA 3T0DA 4U10A 4C6EA 1WDDA 2YXGA 3VXGA 3LZ5A 4R7WA 4IMDA 4QROA 1TPFA 5FJUA 1C9DA 1Q13A 2HVNA 3B03A 2ZRXA 4WOZA 4FMVA 1Y8BA 3I4EA 4FX8A 2A7RA 1C91A 4JIRA 3TCEA 2D20A 4O4VA 2OX4A 2ZX5A 2PDUA 1UWQA 4Z1AA 3H4WA 5EL1A 4JTCA 1WDSA 4YN5A 4ASTA 1IE7C 4RX0A 1UJQA 1R5YA 4EF9A 4U28A 5FJIA 1GVEA 5CZJA 3DEQA 4TX9A 3N2CA 1RA5A 3TW7A 4J9JA 1GPWA 3EEZA 4R27A 1G9HA 3W2NA 4GJIA 2YL9A 4MSSA 3PZUA 3BL3A 3V1HA 4KWOA 3UZ5A 4ZXOA 2ISVA 2ZZ7A 1F9CA 2GSEA 3CHFA 3DZ1A 4JL1A 1E5NA 3W1QA 2QIWA 4GH1A 3CYJA 1EX5A 3B8TA 4HGXA 3NQCA 4OJYA 1IGWA 3TCSA 2X42A 4MWAC 1Q8JA 2WZHA 2OFJA 3VMNA 2X0HA 1ZQ5A 1M6JA 1WE5A 4Y9OA 3QQ0A 5XIAA 4JHZA 4DO4A 4EWJA 1HJSA 1WXJA 1TV7A 1XYFA 2DQXA 3FSTA 1YDNA 3U8GA 5C71A 4B92A 3LCXA 4H8VA 1IXNA 1CDGA 4AY7A 4DJDA 3PBWA 2R1NA 2P0OA 1N8IA 3QZAA 4CNPA 3P7YA 1E4LA 4JN7A 4DAFA 1LROA 4NKCA 4WY0F 1SO3A 1QI0A 1THFD 3TN3A 5HNTA 4Z2IA 1BXCA 1TV8A 1OD0A 3ARQA 4A6GA 2A7NA 1QDSA 1XIHA 1E0WA 4BEUA 3L4UA 3LNPA 2OPJA 2JQXA 1H4PA 4O0QA 1P0EA 3W26A 1P0DA 2HCVA 4W89A 4MGGA 3WMSA 5FOOA 2ANUA 1GVIA 4IXHA 4RLIA 3QM3A 1LUCB 1LOSA 4MY9A 2CETA 5LGXA 1JZ2A 1AJ2A 1B1YA 3GD6A 1M1BA 1SW7A 2OCZA 4ZQRA 2ATSA 1U5HA 1HVQA 1RK5A 3O6AA 4KFOA 2YXOA 1EP1A 4C6PA 1QI2A 1NP2A 1H1ZA 3HQPA 4RV3A 2XGBA 3VZZA 1RD6A 3GXNA 3TROA 3B40A 3UGVA 2XVKA 3ERPA 4WDUA 4E8CA 2VELA 1JDDA 3B9DA 1PYMA 2HDJA 1E4MM 3QC3A 4JGDA 1NOUA 3IJQA 4PUNA 4W9TA 1FVPA 4IP5A 2ZE0A 3NURA 3OHMB 1JPKA 1Q6FA 3WH7A 1IT0A 3GUGA 1A3HA 1WB0A 1QT1A 2OOFA 3FYOA 5HULA 4A29A 4HSNA 4DXVA 3D6NA 1UQYA 3VIOA 2PLKA 4JFVA 8A3HA 4XZMX 2TAAA 4GG9A 3S46A 2PC4A 4JTUA 4ICNA 1SGJA 2E28A 1R3VA 1HKWA 2QJHA 5T8GA 3VGFA 3NL2A 4JNMA 4Z2HA 3P81A 2P50A 2PDGA 3GXDA 4TMBA 2R8WA 3T8LA 1A5BA 1UQZA 1WZLA 2C1HA 4A05A 1FP9A 3W1RA 4AD3A 3LD5A 4UTTC 4NIRA 1VLWA 4V1XA 3WQGA 1OFBA 2Y88A 1UJPA 1W3KA 3WLRA 2OEMA 3IJ9A 5LIWX 1PX3A 2XH0A 3E12A 3LRLA 4AIBA 4DWSA 4FI4A 3GFYA 7PTDA 4E38A 1XW8A 4Z42C 1TV4A 1AK5A 3T09A 1YLVA 1D3CA 2VDIA 5BROA 2XUCA 3NZRA 4XZ9A 1LM1A 1UH3A 1V3MA 1OJXA 2Z1WA 2WJZA 1UB3A 1B54A 3QEZA 2WQDA 3KTSA 2PTXA 4GVGA 2WZEA 2CYGA 3WK0A 4NYYA 1XQKA 1VJIA 4NASA 5I78A 3VA8A 3KS6A 1BG9A 3QSTA 2YBVA 3EDJA 1GVOA 4MNKA 3ARPA 3WLSA 4JTHA 4JICA 4ZENA 4MJZA 1H0GA 1SSDA 3KHJA 3TA6A 1XLAA 5I0DA 1BD0A 1OSEA 1G4TA 3O7UA 3I7RA 3GHTA 3BLLA 3VKKA 4KIEA 2FHBA 1N2VA 4IM4A 1AH3A 4PMOA 1OF6A 5CH9A 5I3HA 5XIMA 3LMYA 2J24A 1QOXA 3C0SA 3W88A 2D2HA 4LVDA 1K7EA 1O7AA 3PJXA 5JIPA 1JNDA 1Z8AA 3S6OA 1MFVA 4GIEA 2JK2A 4AHPA 2XU2A 4RV8A 4OHQA 1MRAA 4CNUA 1P0BA 2GJRA 3LGDA 1R2TA 1NSJA 3ZXWA 4MDOA 3KCOA 4QDMA 1EX1A 3GC5A 1SO4A 3CUGA 3TJIA 3GC2A 4MM1A 4A3QA 1QJWA 2A85A 4JX5A 1NAL1 4XIAA 2E5DA 1YBQB 1MW0A 3HPXA 3ARSA 3GKFA 3ABZA 1FHDA 4E3TA 2RGLA 1FCVA 3L5AA 1BVWA 5BMXA 3NM3A 2GYIA 2JIEA 4IMGA 4EWND 1EKOA 2XN0A 3H22A 4WUIA 2X2GA 2X05A 2BP1A 4GY1A 2YDAA 8RUCA 1BF6A 4AF0A 3HF3A 1W9BM 2FTWA 2VX6A 3UA4A 2DW7A 1D2KA 2VUYA 4JX6A 1SZFA 3B9AA 4Y8EA 1BYDA 3RLUA 3H54A 2Y7FA 4MNMA 4DYJA 1T96A 2G96A 2W5FA 3GR8A 1XP3A 5AYIA 4L1WA 3MI2A 5LNUA 2J77A 4G8TA 4PA8A 3GK0A 1US0A 1MXSA 4IMEA 1S2VA 3KBSA 2BXVA 3BGAA 2CKRA 2OEKA 4QDPA 1YHTA 7XIMA 3NAVA 3N6JA 5EGRA 1LBMA 1MQQA 3S1GA 1EUAA 4GC4A 4WX2A 1PCKA 3MS8A 1PKMA 2HISA 4TVCA 3BLDA 3AHVA 2Q01A 3OVQA 1DPMA 1FP8A 3R11A 4IFOA 1ODUA 2OVLA 1IT7A 4IFKA 1EC7A 2G4FA 1FA2A 3HPZA 1O66A 2L5HA 3M64A 4UMAA 3S5NA 4B5NA 1G4PA 4TVDA 3TWAA 3UZYA 1DXEA 1OB0A 1WOAA 4LAUA 4DBSA 2V2HA 4E4UA 2OWXA 3KCLA 2J74A 3E0LA 1TWSA 3VKBA 2EPLX 2C13A 3ZLHA 1ZJBA 1IXPA 3EBVA 2OSYA 1S46A 1K02A 3GDRA 3ABRA 4NRSA 1K03A 2NVCA 4KKXA 3DG6A 1R3TA 4J5NA 3RFAA 2J7DA 3USZA 4C6QA 4PTNA 2QF8A 3ARZA 4S3GA 4MKSA 1KXQA 1DJHA 3JZUA 4AHOA 3TN6A 3UR2A 1E6XM 3KAOA 2JEPA 1DKWA 4L7ZA 3V5OA 3UBPC 2ZXAA 1QHPA 3WQOA 5A2AA 4NZ4A 2C71A 2GGEA 3RJYA 4RE0A 4PUJA 3IPWA 4KCUA 5FJJA 3ZR4A 4FNUA 1UKSA 4UNKA 4GYPA 3PS7A 3ID7A 2I1OA 1QO2A 4ZQNA 2Z25A 3Q45A 3OEXA 4XX6A 3THUA 4JFSA 4MZYA 1BXNA 3DYMA 4J28A 4Z2GA 1NFPA 1AVAA 3VIGA 1EPXA 3P0WA 4F4RA 4MWAD 3WBAA 1FX6A 1YDVA 2OJPA 4E8GA 4DJEA 1M03A 3VNDA 1S2UA 3NG3A 4HOWA 2V69A 4LW7A 2A3HA 4CQCA 2BY3A 4C1NA 4AVOA 2P8CA 4JKKA 3QR1A 3WMCA 4C6FA 4AF0B 2I5GA 2XPKA 1XLMA 3KOWA 3WNKA 1DEDA 1UZDA 4O15A 2BHZA 4AH7A 1MQRA 5AN7A 3MO7A 5AHNA 1HL2A 2W92A 3BCDA 4JR5A 1UH4A 4LUIA 3W85A 1R86A 4X9YA 4OZOA 4YJ5A 3LPPA 1V6TA 1ECQA 1RCQA 4O13A 2XIMA 4ZL1A 2F2KA 2I5QA 2WLYA 3BH4A 1A49A 4NZ3A 2VFGA 3UWEA 1NM9A 2ISFA 5DT7A 1W3LA 3KBMA 3T08A 3SY8A 4LALA 3G6LA 1P1MA 1VIWA 3GIPA 1MRQA 2O55A 4JHOA 1B2YA 1H7RA 3CZKA 2XZ9A 4P5UA 1OZQA 3UG8A 3MPGA 1MQPA 2QAFA 1JCJA 1QATA 5CXPA 3G1DA 4PBFA 2C7FA 3CB8A 3CUJA 3S2JA 2Z4GA 1XCXA 2Y61A 3F2DA 4K6AA 4BKNA 1K9FA 1V7AA 1H7XA 5A6TC 1E3XA 4OBTA 4FPSA 4C1KA 1V0NA 1SZNA 3OLIA 2QJGA 4IFKB 4B16A 1JRCA 2HEJA 1GK8A 1XPYA 1ICPA 3V0SA 4MLRA 1OG6A 4CVUA 3M5VA 4ZB5A 5EFFA 4DXKA 1Q4WA 4JBRA 1OFAA 4BI7A 5HINA 4P7QA 3KOFA 1TV2A 3I6RA 1NEYA 3W07A 1NDZA 4JKLA 3LBMA 1ITQA 5AHIA 4C6MA 3O0KA 3REQA 2VENA 3O16A 4CQ9A 1RQHA 4K8GA 3DYPA 5CQ1A 3NPXA 3K30A 1YNYA 2DT1A 1JCYA 4LF1A 1EEPA 1R7OA 3AFBA 5CPMA 2DZTA 1B4KA 1AD1A 3DFTA 2QUMA 3QGKC 5D9PA 1QU4A 3H2EA 4IPIA 3GUWA 3FVMA 4M19A 4RPPA 1S38A 1MVYA 5EB8A 1E70M 2TYSA 4KT2A 1S39A 4RNHA 3DAQA 4IL0A 5F4XA 3C2YA 4NILA 3H2AA 4AYGA 1Y5XA 2QXWA 2FDMA 2H9AA 2DPEA 4H6RA 5C9XA 3E2VA 5CSYA 1WP6A 4W84A 3RX3A 1O4UA 1JQVA 3RUBL 2NZLA 1FWSA 3DGRA 4HT3A 1UW9A 3WQWA 3STCA 2GSHA 1WBJA 3CZLA 5CJNA 3STPA 1L6SA 1O95A 3QPYA 2PTYA 4GACA 3BSHA 4C1NB 2Z7GA 3PZ9A 1PV8A 1H2JA 1X96A 3ZM8A 3R79A 1A3WA 1PTGA 1I2PA 5F2IA 5D2VA 4Q4PA 2EPKX 3RNDA 3M07A 5IRPA 3A22A 4HPHA 5TD4A 1EYWA 1ZSXA 3H2OA 5HMDA 3LLDA 3BICA 4IPPA 2PBGA 1BXBA 4AWSA 5FJOA 3K2GA 1H1YA 2R1PA 4CU6A 2J6XA 3QOMA 2DVXA 3BAYA 2WMGA 1HP5A 2CBVA 4XWUA 3IK4A 3EB3A 3TOYA 1O1HA 2Z1BA 5C8BB 1YTDA 1IEWA 2EG6A 1R2SA 1J01A 1E1EA 3C61A 3UCQA 1PEZA 1OX5A 2PWHA 3EX3A 3D3FA 3FY1A 4PBGA 3C56A 1UD2A 2NX1A 3WZ0E 2NWRA 1XH2A 3UXIA 3VNYA 3ITVA 5I3JA 2EG8A 3UCDA 3FKRA 4UR8A 3UW6A 3ISIX 3KZSA 4IQLA 3I3BA 4K38A 3CBWA 2NVDA 3S0CA 3G1YA 5E6YA 1XCWA 1IEIA 4I90A 3MO4A 2CCRA 2YL5A 3SCRA 3EOLA 2J78A 2XIBA 2HV5A 5BXPA 5D09A 3KL3A 2DT0A 2QCFA 1ALDA 1EOKA 4RW5A 1XX1A 1JDCA 1EC9A 3AMKA 1UIPA 1CZ1A 1U30A 3NL5A 3LBOA 3FVDA 3SJ3A 2VGIA 1H1NA 3PUOA 3M16A 3E5PA 4QE4A 4CUCA 4JQ3A 4Y9MA 1GEQA 2PWVA 3DECA 1C93A 5DMNA 4B4FA 3REQB 2PI6A 4OV9A 3TQ0A 5BRQA 1KGWA 3M44A 4D6JA 1EJXC 1KQZA 2AL2A 1HW6A 3TMLA 1TPDA 3HQOA 2V5CA 3MA8A 1KRMA 3XINA 4EE9A 3OVRA 3C8NA 1UCWA 1DQXA 4Y90A 4PL2A 3KOYA 2XZ7A 1TPWA 4KW2A 4MWAB 1R46A 1OD8A 3MSDA 4HNUA 1AUSL 1EJ7L 1EO7A 2ODOA 3OA3A 2Z0IA 4GQBA 1GVYA 2NQHA 1IGSA 3MC5A 5D30A 3W1UA 4GJJA 2HROA 3LCHA 3E38A 3C2RA 4AEOA 3HU7A 3LY0A 1V02A 4PRRA 3LOTA 3T8QA 4QE5A 3NQAA 2VD9A 3WELA 1UD3A 4HNLA 4Q4SA 3B0UX 3WN6A 1TZ7A 4GYJA 1NF0A 1DIKA 3IJDA 1CXLA 1XD0A 2PDMA 4QLKA 4DRSA 3QC0A 1WPCA 1KRCC 3IIVA 4AVNA 3FDKA 4YYFA 3WL1A 5DO8A 4EXQA 3YPIA 5HNRA 3W24A 4IL2A 1AL7A 4OUEA 4IG2B 1YRRA 1DP0A 4MG4A 3LUTA 3QVQA 2PB1A 5BXTA 1U22A 4H8UA 1BF2A 3VOIA 1NDVA 5GVJA 4LH8A 1QK0A 1GT8A 1EJUC 2I56A 1KFEA 1T40A 1R2RA 4F3HA 2QULA 3DHFA 4IQDA 2XH7A 4CEUC 2VOTA 5G1TA 2VM8A 1GKPA 5D2YA 2WHLA 1J0KA 5JBEA 1KQYA 3SFWA 2NV2A 1WKDA 2J7FA 1R3QA 2FVLA 5H8PA 3ZSTA 3V36A 1XG4A 4DEFA 3G1AA 4C5ZA 3N6HA 4ONVA 3VOJA 1VS1A 1MXGA 3OVPA 5KZDA 4D1JA 2FPTA 3KE0A 4A3RA 4F40A 3DXIA 3EKZA 3SRFA 2QGHA 1W5OA 3FCPA 3ZT5A 2AKMA 1PB0A 3W1PA 3M5ZA 3B8VA 1NTHA 5FEPA 4YXGA 2QUUA 3IGSA 2E6DA 3AU6A 3C0JA 1UROA 1CXKA 4AFYA 4PSPA 4CCEA 1H41A 2DH3A 1PIIA 3EXSA 3NQVA 4G1NA 4F0KA 1XBXA 2VRKA 4RK8A 4Y9AA 4ZZ9A 3MKCA 3GTXA 2R14A 3U7BA 4XD3A 3VM7A 3NDOA 3WNNA 3RJXA 3EX4A 1CECA 2Q3RA 1MWOA 5D05A 4M0XA 2ZDRA 4UMCA 5I3FA 4V33A 3CH9A 1QAPA 3BAXA 9CGTA 2R1KA 1KBJA 4HU8A 1I60A 1JJKA 3UJFA 4GFIA 5KTLA 2HE5A 7ENLA 4NX0A 2DIKA 1TCMA 3SGZA 5KMYA 2AL2B 2Y62A 1I2OA 3URQA 4MB5A 4JEJA 3QV7A 2FH8A 4EANA 3EA2A 2PDKA 1RLDA 3WJXA 1FUYA 1HKKA 2A3BA 1POJA 1RHCA 2QQ6A 2YL8A 1AJZA 3EPMA 3WD2A 3VOHA 3CT7A 1LOQA 2J8FA 3LM7A 4GK8A 3HQ1A 1VKFA 3P62A 3BLKA 4JTLA 4XSMA 2ZX7A 3TZFA 4R53A 5FCZA 1HFBA 4KBXA 4CCZA 5FEXA 2V38A 1BG4A 4J7RA 3ONBA 2YW4A 4N42A 4E2BA 4KF1A 1Y7VA 3BAWA 3L68A 3HPAA 1A80A 1T41A 5K4XA 4PEEA 1TSIA 2D1ZA 1XISA 1UWSA 1VFFA 2WWCA 4P8VA 2A21A 1OFOA 1QCWA 4BWLC 5D2XA 1G67A 1YXCA 2FVMA 2FGBA 2QKFA 5CEWA 3RRAA 1Y0EA 3AYVA 4QBXA 1JCTA 1R9YA 2QNEA 3IVSA 4M6UA 2VKZG 1Z6KA 3T05A 1C8YA 1C92A 3QPEA 3GTFA 2YFNA 3IGXA 3M0HA 3DGBA 3PZIA 3Q37A 2WMKA 2GDUA 1KCKA 2QJMA 4NZJA 5CBIA 4LVAA 4OGZA 4ORIA 3GTHA 4B90A 3EGJA 2C0AA 4S2BA 1GTEA 2NT0A 3H7RA 2WMHA 1WXZA 4Q6JA 5C5YA 2YLAA 4WCJA 3B8SA 1T6MA 1KGUA 4JTJA 1Z48A 2GVYA 4Q6XA 4NI3A 5D03A 2V9DA 3TXZA 4GH3A 1TVLA 2QAPA 2C14A 4ZQCA 3EMQA 1L0PA 1G4EA 2QMKA 5DX7A 3NQ6A 2YYUA 1KRAC 2XISA 1VHNA 1UWRA 1GPFA 1IF2A 1E40A 1X38A 4GIAA 1TMLA 3Q4DA 3WF2A 4J40A 4IFRA 4AZ7A 3FXGA 3G1RA 4JFWA 1VBUA 4MJ4A 5LA0A 2B7QA 2IKHA 2BASA 4AMAA 1A5LC 5FEWA 3B8DA 1OCJA 1ADSA 4XD5A 3STFA 1IQ8A 2ZA2A 3W87A 2VZVA 4BQ4A 4HKPA 3H21A 4RDVA 3MP4A 4RZ6A 2X1IA 3LBCA 1BRLB 4LUYA 4XZNX 3QMRA 4XO6A 3MDWA 1KBLA 2VEPA 5EU9A 2WMIA 1LL6A 4KQNA 3WLJA 1TE1A 4NAFA 1QTWA 2RJGA 3QOKA 5AZ1A 3LXAA 4MNLA 3CZ8A 4JIIX 3B9NA 4WDTA 4U33A 5CPSA 1K6WA 2ACQA 1VFSA 1GQKA 4QDWA 1W31A 1D7KA 3BGGA 1GGOA 3LXCA 2XYLA 2WVUA 3N11A 4MFDA 2DQWA 1DWIM 2Y7EA 4D72A 4IJRA 3U4AA 3VFLA 5REQA 3FGCA 3PZTA 3ABOA 4GZEA 1K6AA 1U1HA 4JDYA 1DTUA 1VYSX 3LPOA 3APYA 4J35A 1FHVA 1O5RA 3ICJA 1F05A 3NQ2A 3O15A 3BZJA 2QPXA 3TIMA 2F6XA 4Z2LA 4QIUA 2BWGA 3GFXA 4FXRA 4R88A 1JCNA 3LNMA 1EQPA 1OABA 5KZEA 5FL1A 1UUOA 3KHDA 2WSRA 1XSKA 1QUMA 2BOFX 3BQ5A 4DNMA 4LNCA 3T2PA 2WHMA 4DXXA 3KRUA 3W7CA 4K7YA 1QWGA 3L0KA 2YCIX 2VCBA 3HO8A 2PEVA 4IIBA 2E5CA 2DSZA 1PZ1A 4H2CA 1JD7A 2YB4A 4WY0B 3OYXA 2X1RA 3VD5A 4Y7EA 1K4GA 1TWDA 2P1FA 3M43A 3DHDA 1PKLA 3KM8A 3N3TA 3U7VA 2Z1VA 5XINA 2Y8VA 3OO2A 4NVTA 3O1NA 2IPFA 2J4GA 1CGUA 1B57A 4L6DA 1FQ0A 3WQDA 5DMLA 1XYMA 4O1EA 2G8ZA 3WLTA 1S2WA 4YU1A 3VE7A 3UWUA 4WK9A 2EAWA 3RF9A 1XBYA 4O1FA 3OBKA 4JYEA 3SCTA 1DJZA 4O52A 3N29A 4FEZA 1EGVA 3AICA 2ICSA 1DV7A 1WBHA 2YJQA 1H7WA 4CNSA 1CXFA 2TPSA 4LC8A 4Z1BA 3I3DA 2H90A 1EZWA 2XVPA 4BFAA 1A53A 1UIOA 1MZHA 1RP9A 2NX3A 1SO6A 4HN4A 3GU2A 3CUIA 5M5DA 3QJAA 2EKCA 1MEWA 3CNYA 3C2EA 2AOSA 5A1AA 3KEHA 1QPOA 4DZAA 1JF6A 4TTGA 3CAQA 4MADA 1ZGDA 3ES8A 2ABAA 2GJXA 3BUVA 1TPB1 2ON3A 1BKHA 2WMIB 2V30A 5FJTA 4NAFB 4QQUA 4DLMA 5JH1A 4KWUA 3MV11 3QTGA 3QY8A 2PP0A 4I7WA 5TNVA 2FFIA 3F5LA 1JYVA 1F76A 2JE8A 4WSHA 3RMEA 4RXGA 3U3HA 1OG0A 1J18A 2FZBA 1X6NA 2DZPA 3SCNA 4LANA 4S3AA 5AC5A 4QCEA 4GRSA 4JIHA 1Y5WA 2EG7A 4TUFA 3GNPA 4NJIA 2J13A 3CQHA 5KSWA 4LEQA 1UD6A 1VBGA 1VJSA 5HJYA 4XQ6A 4PR4A 4CLMA 1NARA 1FWDC 1RPXA 2WSQA 2BG5A 4M1RA 5BOFA 3W1TA 2PLCA 4GE8A 3ITLA 2PP1A 2XFYA 4HMCA 1F6KA 3QQWA 2J9ZA 5GJMA 3WD3A 1I9CB 1G7UA 2PAJA 5I24A 1I45A 3PPFA 2GK1A 4J3VA 4AY1A 1JPIA 2CZFA 3RO8A 3UP8A 1L8NA 1LLWA 2E1DA 2FZMA 4AYSA 2FZ8A 2E7FA 5HQMA 4FZIA 4CCCA 5FEZA 4OT7A 1SFJA 1EDGA 2Z2AA 1ODZA 3VGEA 2GVEA 6XIMA 3VU2A 3CV1A 4O50A 4W7UA 3PWAA 1ADDA 3W27A 4KGLA 2PGFA 3MT1A 3WNOA 5C9UA 2DZXA 1CGWA 2ACUA 4REQA 3UQNA 4QR6A 2PLJA 2FB2A 3L5MA 1P6CA 3NUKA 3UZXA 3GBEA 2VFDA 2E40A 2FPYA 5PTDA 1V08A 2WZIA 4B15A 4W4QA 3QH2A 1KC7A 1H7NA 3W72A 3EPNA 1M53A 3U9IA 3GS6A 5EMUA 4ZO6A 3WUEA 4C6CA 1MUMA 1AD4A 1EJWC 1E1FA 1LWJA 2VZTA 2V81A 4JTSA 1G5AA 5AHFA 1JVNA 1Q2RA 1CTNA 2WVTA 3NZGA 4UQAA 5C6MA 4PC8A 3WBYA 2A4AA 3KVKA 2DU2A 3LX9A 2C6QA 2BZNA 3TXVA 3OODA 2CIPA 3TQVA 2QCCA 4ADTA 1XLDA 3FOKA 3VZXA 3P0XA 1YNPA 3FFSA 4DI9A 3MU7A 2BHYA 4QLJA 3WK1A 4FR1A 3M7SA 1BVNP 4B5UA 2KZHA 3KXQA 4Q8VA 3QW3A 4A21A 3PZQA 2C19A 3RGTA 5E9XA 4GXPA 1XYZA 1LOLA 3A47A 2NQ9A 2EO7A 1UR9A 1AQ0A 3P14A 1U83A 3VUPA 3CWOX 4OIFA 1PTAA 3W01A 4GVHA 3IGHX 4Q3MA 5FSEC 2E25A 4O12A 3LPGA 3KBNA 1XIBA 2QUVA 1POKA 4GABA 4DM2A 1V3JA 2YCKX 2KAUC 3H2MA 3MKVA 4S2CA 2VHLA 3L67A 2EXOA 3W82A 1V3KA 4L5ZA 1DQWA 5B80A 4RNFA 5CGMA 2PDBA 3PPHA 3RM9A 3W73A 1KLZA 1PPIA 4W86A 3SDOA 1WZAA 2VR5A 4NI8A 2JGQA 5A2CA 1XC4A 3VDBA 7CGTA 2Y8KA 1JUEA 1MI3A 3LHWA 2Z00A 5HJLA 3RK8A 5HWNA 1Q85A 4AMCA 1DJGA 3RX2A 2XHYA 2O9RA 4BQ5A 3RU6A 1Q8AA 2JIWA 2V5KA 1QVBA 3M0MA 4INFA 3MUAA 2YB1A 2HE8A 5A6KA 3T7VA 2NUYA 2GK1B 4CD5A 1IR2A 4IPNB 3GAKA 5D37A 1US2A 6XIAA 1TFVA 1I75A 1SJCA 3VX1A 1AMYA 3MJMA 4M7TA 4A8LA 3HG3A 1FDYA 4ZGYA 3L65A 4DY1A 3E3HA 3NZPA 4XAPA 3WFZA 1OX4A 2WCGA 3THAA 1GOIA 2DSKA 3SW6A 1PIFA 3S3GA 3P5YA 2XSAA 5ENLA 3Q58A 3LXBA 1UR1A 3PB2A 3WQCA 1J10A 4QITA 4PL1A 1O12A 1K8YA 1ZP4A 3M1ZA 3LV5A 4KRTA 4Y2WA 4UR7A 2CHOA 3BG9A 1UWUA 5EFDA 1XRSA 2Q8ZA 1JZ6A 1FWNA 1QW8A 5D33A 3GDLA 1VQTA 3PSWA 4HZ6A 2YR1A 3PG9A 3NSNA 1ZENA 2VVSA 2FHFA 3BLOA 3N6QA 3VIJA 4G9PA 3EOOA 2VR4A 3IEBA 4US6A 4C6BA 2X1TA 1GW1A 2YA0A 1TTQA 3G0XA 2BODX 2CHRA 2R6OA 3LTYA 2XH2A 1VP5A 1LF1A 1SFLA 2EPNA 3IACA 1QPNA 4JTAA 4C7FA 1RBLA 2A0NA 5J5DA 3S5ZA 4FXJA 3T0AA 3VI2A 1ZJIA 1Z32X 2V0TA 3WY1A 2QCLA 4W8AA 1FBAA 1WOBA 2E8ZA 3DI1A 1H62A 5AC7A 1W9UA 3OVGA 4GGBA 4LS1A 3TU9A 4HZ8A 1IEXA 1TQXA 4QNEA 5H2ZA 3LS9A 3GIQA 1JAEA 4HNNA 1WZMA 4D8LA 4RL3A 5K9XA 4LT9A 4GPNA 3GC4A 4XVDA 3NO5A 3K4AA 1G6CA 2NXGA 4H9VA 2ZUNA 2J7GA 2JFEX 2PTZA 3CEPA 2GL5A 1JZ3A 3O8AA 2E6AA 3MI6A 1MEIA 2VC7A 4A2SA 4GA8A 1HG3A 3S6TA 4UCGA 4D6GA 1OQFA 4HNOA 4XBKA 1V77A 4TO8A 1B3XA 2GLKA 1ZAHA 4DJFD 3BG5A 3NZQA 4ZE4A 4I8DA 2UY4A 3ONCA 1OVDA 1NVMA 3K4DA 1AQHA 1W91A 3CH0A 1EIBA 1WDQA 5C7HA 2GGHA 1AZ1A 2QDDA 5I3IA 4W7WA 1PTDA 1W3IA 4FNTA 4AD5A 1UH2A 4S1FA 2R1MA 4O1AA 1VYPX 3LG3A 3Q94A 1PZ0A 3VOFA 3W7MA 1RLCL 1P1XA 3UERA 4LVGA 5LNRA 3UJEA 4KEVA 4HCHA 1ZU8A 1EHNA 3PUGA 1OF8A 3F4NA 3TYDA 2P10A 1GZGA 4MUZA 4RDWA 1DJQA 4ML4A 3EDKA 5FD0A 2W4XA 1NDWA 2C1GA 1NU5A 1W3JA 1OC6A 3B0PA 3PBMA 3TYZA 3VE9A 3S42A 3M0KA 2X7VA 1K9EA 4QJ3B 2O4MA 4RW3A 4GBDA 3VD7A 2FZDA 1Y65A 3CHVA 3M7WA 1Z44A 4J3ZA 5E9AA 4ADUA 3LRMA 3N34A 1WZKA 4M51A 3V5CA 3VIKA 4ERGA 5AC8A 3INPA 5ECVA 2NQLA 2WJFA 3LERA 4NX5A 4TMCA 4EXBA 4AZIA 3WLMA 3H55A 3PVFA 4IQJA 2BB0A 2WM0A 1YX1A 2DIEA 3MWCA 3SB0A 4YTSA 1DJWA 1L2UA 2EEXA 2V3DA 4PUEA 3MSRA 1XCFA 2JALA 5D38A 1LLZA 3OGRA 2ZZ3A 5CGQA 1ZNNA 4M81A 3QGVA 2AQOA 2UV8G 1Q3NA 4FIQA 4H04A 3P5ZA 3WEZA 2WYSA 5DBUA 1TIMA 3OA5A 2HQAA 3TYEA 3KUMA 3A21A 4I7UA 2Y63A 3W83A 5LKYA 2C1IA 1OK4A 5JVLA 4ZOEA 1MW1A 4GKTA 4H00A 4GLEA 4Q7NA 4YIWA 2AQVA 3RR4A 4AX7A 1VFMA 1JDAA 4MFEA 1VFHA 2OTDA 1P5BA 1VPYA 4IGHA 2RH9A 4LS2A 4GCXA 3IIPA 3CPRA 4IXXA 3TQKA 4DZ5A 3UG5A 4AB4A 1RBOB 2CWXA 5DANA 1QI5A 2IXUA 3CO4A 3TJLA 1QFEA 3OIHA 2DSUA 5IFTA 4JIQA 4UIOA 2RDXA 1QI3A 5G4HC 4HPGA 2B0MA 3W6YA 1A0EA 4LUTB 5MKGA 3K1DA 2GZXA 4H19A 3C0LA 4FX7A 3RMJA 1JR1A 2CEQA 4K36A 4UZSA 3QFWA 3EKGA 4WF7A 1F3TA 4D6HA 1AA1B 2Z2BA 3RLHA 3FAXA 2UY3A 3JVAA 4OFCA 3WLLA 2Y5JA 1MW3A 1OBAA 3AIUA 4GX8A 4CD8A 3UD6A 1A5SA 5A6BD 2POTA 1NIUA 3T4WA 1UKTA 2NLYA 4TV6A 1FWHC 1KA9F 2P3EA 4HA0A 2D22A 1PWMA 3TP4A 4UXDA 5JU6A 4EPEC 2XVNA 2ISSA 2A3CA 3I65A 1PSCA 4XZHA 3WQPA 3QW4B 3BMVA 1VHCA 4JNYA 1VCVA 3QV8A 3A24A 1Q66A 3HV9A 4FOUA 4BS0A 2WBGA 2BLEA 1FFRA 1XIEA 2A3LA 1W9XA 2IPWA 4PCNA 3MJYA 4GQRA 1LG2A 4IISA 4PMYA 1RSCA 4EIVA 1JEZA 1KV5A 3EAUA 4S3JA 1SR0A 1DL3A 2JEQA 2GWNA 2X16A 4HYWA 3CLMA 5B7ZA 4Z0SA 2XDFA 3NGJA 3GNOA 2VEGA 1E51A 4PTXA 4E3VA 3KDNA 1YIXA 4OBSA 2OQYA 2GQ3A 3L9CA 4OQVA 4LY8A 5F1UA 4XB3A 3S5OA 4ICCX 4RPQA 3BSGA 1UHVA 3N2XA 3SO7A 4FAMA 1DXIA 4NXSA 4LAKA 2PS2A 3WF0A 3D5HA 2PZNA 2QYGA 4M1BA 4YL2A 2ZBTA 5HNNA 4LV4A 5D9MA 1ZUAX 2PFHA 4JPGA 5D8ZA 1ML1A 3M0VA 1FCBA 4NZ1A 1GVSA 1TG7A 3EEGA 5CSUA 2G3IA 4B4HA 3AROA 3FK4A 2DT3A 3HIJA 2QT3A 1MXDA 2PCEA 3UWWA 4RCXA 1M01A 4BF9A 1XGEA 1OCBA 4EPBC 1RD5A 5JBFA 4H7VA 1P7TA 3WLKX 8XIAA 3SIZA 3HMJG 1LLOA 4N0RA 5DT5A 3FEQA 4BHYA 3GXFA 3BURA 4MWAE 5DFAA 2FKPA 3FW6A 4ZTXA 4G7EA 2PDXA 4MAVA 1JGMA 3LMZA 1F3WA 2DP3A 2D0GA 1TJ1A 2FGZA 1MDRA 1LL4A 3AALA 1VEOA 1NF7A 2ISWA 3HFYA 5JQ9A 4L9YA 1JDEA 3OBEA 1HO4A 1XGDA 2PWEA 1RK6A 2CU0A 5EMMA 1E4IA 3O06A 1IR1A 3UYIA 1R3YA 1NQ6A 1S5NA 3F7JA 1UR8A 3HPFA 3BE7A 1RVKA 1UUMA 2VX7A 2Y0FA 4CN4A 5T91A 1EJSC 1CGTA 5T26A 2B31A 3GE7A 3PUDA 4GQQA 1IXQA 4M8UA 3NEVA 3EOUA 3BOLA 1W1VA 5G2HA 2PF0A 1E6QM 3W2JA 3KRSA 3W02A 1CBGA 2WBKA 3B8UA 4XVEA 4AD1A 3ZZ1A 3NQ8A 3GHUA 4Q33A 5DBTA 1FWFC 3LCWA 2G4JA 3E5BA 4LCRA 3UJ2A 3HTWA 1LDCA 5EKYA 3KP1A 3VIHA 3UF9A 3N2OA 1XLIA 3V5FA 4D71A 4TIMA 4CEXC 4Z2JA 2Q02A 4Q8PA 4QTGA 4Q8TA 1L8PA 1OC7A 2GUBA 1B3OA 1QWKA 4H1ZA 4AXNA 3AQUA 1A5UA 3UPWA 3WD1A 4PB5A 4US5A 2G3FA 2FHCA 1R38A 3SSZA 3N3MA 2P76A 2VCCA 2I16A 2BGNE 3QGAC 4ORMA 1HL8A 1DWAM 3IJ8A 1LRQA 2Z6IA 1DIDA 1PZ2A 4DBUA 2NV9A 2ZRYA 5IHRA 2G41A 4Z1YA 2WCAA 3PJUA 4XKMA 1V79A 4LF2A 1NWTA 3NZ1A 2Z1KA 4HIBA 1LWHA 3TONA 1HJXA 3T42A 1BSLA 2BVWA 2YCEA 1A5NC 1GOOA 3UR5A 5LNVA 4QM1A 4A8IA 1A5AA 3CGTA 3G1SA 1FDJA 2BY1A 2WVVA 1V5XA 1HVXA 3ECQA 1HQTA 1PCWA 2WWDA 3A3WA 3EKLA 5C9WA 1T8QA 2X30A 2VD8A 3P67A 2GQ8A 3U2OA 1DE5A 1IWPA 5CJ5A 1XL9A 3KWSA 1NH6A 5G4WA 2OWCA 4W7VA 3LN3A 4IIFA 1J2WA 4JIPA 2ZRVA 2PDIA 8XIMA 2E3ZA 4LAOA 3M0YA 1XDMA 3NQFA 1ZJAA 4AIUA 2HJPA 3NOYA 3AJ7A 4HHHA 1ZCOA 4S3KA 1KM5A 4DI8A 5A8PA 4KMQA 1DWJM 3VMOA 1NELA 2PUZA 4U3CA 4GCAA 3QQ1A 3FSUA 3TA9A 4H4IA 1OK6A 5BNKA 4LSBA 3AOFA 4AG0A 2J7BA 3GG0A 1P7TB 1EDTA 2FMOA 4KCTA 2NW0A 1JXJA 1LBLA 1DBTA 3T44A 4TVUA 1DJYA 2BVTA 4I9AA 2QHAA 5JMUA 1CI1A 1WKFA 4TTUA 4Q22A 4GOAA 3GM8A 4AXKA 1FKWA 3RCYA 4BEQA 4XAFA 3ARWA 5TBOA 3F2BA 4QE1A 5FJPA 4L1XA 2QCNA 3G3MA 3S5YA 2PWFA 5T9CE 3CV6A 1T99A 4HA1A 4M82A 4P7RA 3IRDA 2DZAA 5D4YA 3P60A 3VX0A 4DUOA 3M0XA 4KWWA 3O2LA 3NYDA 4JOMA 1J79A 3SAZA 2IQTA 3RPMA 1XYAA 4C91A 4IIEA 2QW5A 4AZCA 2HXTA 3KLLA 1BSIA 4O16A 4LBSA 1KO0A 3KX6A 1V93A 5F2MA 3BLEA 4XD4A 3RXZA 2CLIA 1FHLA 5EMLA 2IKIA 8CGTA 3ME3A 5CZTA 5AYYA 3GTIA 4KETA 4J27A 4PBEA 2INFA 4O17A 4FF5A 4X60A 3BV4A 1UD8A 1H7OA 1FWGC 3PWIA 3FAWA 1G7VA 1MNSA 4MF4A 4A8NA 2J8GA 3GIYA 2WO5A 3T9PA 3TFXA 4UQ9A 4GKLA 4NSBA 3K46A 4J4KA 3OBAA 3B4YA 2WC4A 3W6MA 2BVDA 5IBXC 3GY1A 2BS9A 4PCSA 1J9YA 3SCOA 3WF4A 2WPGA 2R1LA 1FWIC 4LYQA 3S1UA 3ZFHA 4FNPA 1ZZMA 1LUCA 5DLCA 2G50A 3T1GA 4M6PA 4WJ8A 5D2WA 3T40A 4L61A 3UVIA 3A23A 3E0VA 3N15A 5AHMA 2XM1A 1XV8A 3VNZA 3NEHA 4G2DA 1MEHA 5FIPA 1UA7A 1XXXA 1RBAA 4HOXA 4NT0A 5C2XA 2PCQA 1XIIA 5EA9A 1PDZA 3DH7A 4S38A 4AU0A 3N14A 3VCRA 2D0HA 3O07A 4JTDA 1UUQA 3IK2A 2AMXA 4FALA 2VTFA 3GVGA 2DZSA 3DFNA 1C3FA 4AD0A 4PTVA 3KRZA 1J0YA 4O0ZA 1F5ZA 5L9FA 3LENA 3K8LA 3GG7A 2J7CA 2PDYA 1RV8A 1EQCA 1KFLA 1ZTVA 3E74A 2YA2A 1SMDA 6TAAA 5HBFA 2AGTA 3AIRA 4I3GA 3V16A 5HANA 2OX1A 3DN5A 4LUSA 3LGEA 1V0KA 2X09A 2WKGA 1HX0A 5AYZA 2WJDA 3VD9A 4Q32A 1LYXA 2O7SA 4GQGA 1PX8A 3GH7A 5HQEA 1HTIA 4C6LA 2SFPA 3F4VA 3RPTA 4J3WA 1JXKA 1V8EA 1AFSA 3KVJA 1VRDA 1KB3A 1EB3A 1J2BA 1ZRQA 2GDVA 3CL8A 1TQJA 3A13A 3EOEA 3FYYA 4GXWA 4QJ4B 4LAZA 2PF8A 5IDZA 4XAGA 5CAKA 1HF6A 1XSJA 1PAMA 2WW5A 1KXHA 1E0VA 3HFTA 3CHCA 2OWWA 3F5KA 2OLSA 1PE1A 1GTHA 3OLGA 3LA4A 1KWKA 4F2UA 4A2RA 4TV5A 5I3GA 2ZUVA 1O60A 3QKZA 1V6VA 3M41A 1A4LA 4CVWA 2R94A 4H7ZA 4AZCB 1B5TA 2CHNA 1FDZA 2E6FA 1N7KA 1XD1A 4HK5A 5I79A 5LIXX 1MFUA 3J7HA 4IH3A 2ZCGA 4TU1A 2ZZ1A 2ZVRA 1CW2A 3DC0A 1XLBA 4UTFA 2OKTA 3A4XA 4MVAA 1V6WA 2VGFA 5BRPA 3MSYA 2HTMA 3CZJA 3WJSA 3ZT7A 3AXMA 4O1CA 5I77A 1XLEA 2BDQA 2PBOA 3W2MA 3QZEA 2ZKMX 3ARTA 3SBFA 1J4EA 1M7PA 1A47A 1CPUA 2RDTA 3E0WA 5D04C 4B9YA 4JS3A 2JF7A 3N1AA 5CJMA 3OHIA 1JRBA 1OADA 4W93A 4IPLA 2OZTA 2YW3A 3PUEA 2H3BA 1HGYA 1C8VA 1GOQA 3OGVA 1QASA 4FXFA 1Q7QA 3VKCA 3NM1A 3NDZA 4L80A 5C9ZA 2YGYA 3BMXA 4HP5A 1EO5A 5B7YA 3EWCA 2YCLA 4U31A 2C3ZA 1WDPA 3TE9A 1G94A 4OOZA 3CHDA 2J25A 4RZ5A 1YBQA 2FDSA 2ZTKA 1GUVA 2P0IA 2OLAA 2V3FA 3UG4A 5F1VA 3LV6A 3MVTA 4ZBCA 1JZ5A 2DEPA 1CWYA 1KFJA 4UFJA 2GVJA 1JZ4A 1H60A 1EA0A 5AOUA 2EPOA 2QDGA 1EZ2A 1Q6RA 2WAGA 3KW3A 2VO5A 3S4TA 1JYXA 1RA0A 2OZ8A 3F4WA 4D2JA 4KRZA 1LORA 5IDIA 3O63A 1V6YA 2ZX8A 3NPUA 3URBA 4IHCA 4LUSB 3UWZA 1K8CA 5I02A 3LRKA 1G1YA 2DSWA 4IF2A 2PDJA 6REQA 3PG8A 1K3UA 3BANA 4GGHA 1C8XA 4IX0A 1UKOA 1XJBA 4GNKB 1R7AA 3AS0A 4GC3A 4GY7A 3U5UA 2W67A 3VDGA 1UKQA 1EF3A 2VZUA 2WV8A 4MTVA 4S3FA 4NYUA 3WH5A 4ZFMA 3L4WA 2HBVA 3QLDA 3DESA 1T7LA 2I17A 4O10A 2XWEA 3W84A 4AW7A 3DFHA 3NSMA 4NAEA 4PB4A 5TQLA 4C90A 3B0VC 1J8VA 3N25A 2PRHA 3DFOA 3EWYA 4PCFA 4NZCA 4CN1A 4DO5A 1CGVA 2D3NA 3KBWA 3R58A 3LHZA 1J6PA 1EFZA 3E1F1 3WO8A 3SURA 1F6PA 3B04A 3FS2A 1H7PA 2HXUA 4DN1A 3QPZA 4JNZA 3GX9A 5A69A 2B4GA 4YCOA 2W61A 5DF0A 3LM3A 4W8LA 2PRLA 2H8ZA 1UKPA 2Y5EA 1F73A 4DUWA 1BVZA 2HNHA 3EA1A 3PTDA 4RDZA 1ITCA 4YCPA 4KPLA 3B8IA 4QLLA 3MCMA 3EDDA 4V27A 1KW1A 4XAZA 2FH6A 4Y9PA 4IIGA 1J11A 3BO9A 5ECUA 4EP8C 5DELA 2VOMA 4IIHA 2CZVA 5KINA 1QMLA 4PEKA 3R8RA 2QCDB 4I9TA 2VGBA 3VINA 3WMLA 3FDGA 1DORA 4CQAA 4ZTYA 2DVUA 4U5KA 4S3EA 2EJAA 4NF7A 1SUXA 3QSRA 3QLLA 1SR9A 1QHOA 4RE2A 4PUKA 3WJWA 3N13A 1B9ZA 2AKZA 3CEUA 5AVNA 1ZJHA 3I6TA 1HL9A 1XLGA 1XG3A 4WRHA 2YCLB 1FTXA 2R82A 1R87A 4UR9A 7TAAA 3PANA 2OO0A 2TRSA 2QIIA 1YQ2A 4YYCA 3K1GA 1CCWB 2OQLA 4Z1DA 1Q6QA 1LCOA 3ES7A 3BWWA 5LA2A 3S1WA 4F9DA 2OMAA 2X41A 3W7JA 1TA3B 2Y5SA 3WNPA 3R0KA 4LWWA 1E56A 3DBNA 1B3YA 1LT7A 2HVMA 2O9TA 1B9BA 2GVGA 5BYWA 4ROQA 1XYLA 4IGNA 3ZR6A 2VX4A 4GISA 4K68A 5GNYA 2HMCA 1YDYA 5HMFA 5G5IA 4W87A 4QRNA 1B31A 1JL8A 4IMAA 3H4XA 6REQB 4PMNA 1OWQA 4UC5A 3DFQA 2GGGA 4Q4RA 3EMZA 2CLMA 1ADOA 3U2ZA 1CB2A 3OZMA 4AY8A 4MB3A 4GY0A 1FWAC 5U4NA 5DMYA 2OT1A 1TPH1 1W5PA 1XH1A 3GRIA 3H23A 3KTCA 4JTEA 4WIWA 2A3AA 5D32A 1VEMA 2Y7GA 5I07A 5FJRA 2PSNA 3AHXA 5GJNA 3PULA 4DQWA 4O28A 4FK9A 4NAEB 5D02A 3G22A 4HD5A 4H9XA 3C2VA 4H6QA 1KBKA 2DT2A 4GZ7A 1RAKA 4AIOA 3SQLA 3W23A 4DJDC 1CEOA 3W1LA 2ZUWA 3N9RA 3IS4A 4FXSA 4RE3A 4BF7A 3NWRA 2B7PA 2O92A 2YZ5A 1W1B1 1E9IA 4LU0A 2WNNA 1B4EA 2BOGX 1TTPA 1MDLA 9XIAA 3S2CA 5BOOA 1FH8A 1DJIA 5BWAA 4WGHA 2J6VA 3I6EA 4N9EA 1TVNA 1EWDA 3LLXA 3R13A 5DRCA 3PNZA 2WB5A 3BOFA 1PKNA 1XIMA 5G4EA 2OT0A 3UFYA 4XD6A 4NUWA 4FLSA 4F0HA 3H26A 1S2TA 2P8BA 1UC5A 3PFRA 3R1ZA 5AHEA 1QOQA 1H11A 1KFWA 3ZLGA 4PTMA 2X0SA 2YDSA 4PZVA 3SJNA 2BGSA 2WLZA 4JYDA 3RILA 4EACA 2Q09A 2NSOA 2ATMA 3SUTA 2CLFA 3VCCA 2B7NA 5ABFA 3MB9A 1S5VA 4LB4A 3THQA 1KR0A 4JCLA 1QI4A 3D47A 3LGGA 3TNBA 5GJPA 4V2XA 3LCFA 1YXYA 5HR6A 4GXMA 1W8SA 1Q2SA 1ISWA 1M04A 1O5QA 3R8GA 2NV1A 2DUXA 5CAHA 2CKSA 3V1PA 4ERAA 3W2LA 2PD5A 4KCVA 4NJGA 3M46A 3R12A 4PUUA 1TPC1 4U5IA 3TTYA 4F66A 4Y6GA 2Y89A 2VC9A 1AQMA 2E9BA 4YHGA 1DWHM 2BY0A 3UETA 3CAKA 5E93A 1UG6A 1W1A1 5LHEA 1BTCA 2V5DA 3H7UA 3UT0A 4XK2A 3GHSA 3S2LA 3CTTA 4GUHA 3FX4A 3GR7A 3KCJA 3W7LA 4B2DA 1V0LA 4M6VA 1OIFA 5EMYA 1M68A 3DKJA 4HSHA 4JY9A 4TX8A 3HM7A 3NVTA 5CLTA 3AMDA 3S1VA 5CKSA 3GKAA 4B3LA 4QISA 4E4FA 3C2OA 4DWSC 4X2RA 2OODA 1W8GA 3GDTA 2PWDA 4MY8A 3L7RA 1ZBVA 3NXFA 4R85A 3TOPA 4UFHA 5A8MA 4DBEA 5FAGA 3CWHA 1HKVA 3XIMA 3FYPA 3W6LA 1Q7MA 4E4PA 2CBUA 3O6DA 1UC4A 1XSIA 4JIEA 5ABGA 4S3DA 5LNSA 1UBSA 4BA0A 3CV2A 1X1OA 2F61A 3PFMA 3ZOAA 1Q6OA 3TDFA 1JQXA 3TN5A 4JTRA 1W2VA 1E9ZB 4L4OA 3TYAA 1CGXA 1GKRA 1F61A 2YSWA 5LYRA 4TXEA 1D3HA 1XRTA 3AXHA 1OGSA 2J9XA 3NCOA 2YYTA 3D46A 2E5BA 2PGWA 3TMQA 4EPDC 1KFKA 1FXPA 4ZO8A 4LCQA 4QQ3A 1RQBA 4O4WA 3GAYA 1EPVA 2ZYFA 3CV7A 1EEXA 3P82A 3I3EA 2MUCA 2J9YA 3TH6A 3IGUA 4UCFA 2I7GA 3W28A 3UESA 3RM8A 4ROPA 3FJLA 4ATDA 2ZUUA 4P7OA 3OG3A 5EYWA 3S9YA 3VK5A 4UFMA 2E67A 1GZ1A 2J27A 3NA8A 2W62A 3F4DA 3W76A 5C70A 3DERA 4H6EA 1MZRA 4R9XA 5FF7A 3OP2A 3WDIA 5CSSA 3ZT6A 3AXXA 5HNUA 4MWAA 3LCIA 1F3EA 1SPQA 2ZXQA 4PFMA 5ABFB 3N73A 3W0KA 3M0IA 3WF3A 3BZGA 3EB4A 4KEMA 3GFZA 1ONWA 1YKWA 1BWLA 2Y85A 3N4EA 1RJQA 2QDHA 3UNTA 1M3UA 3MI3A 3SI9A 2E6YA 1PO9A 3WK3A 4HJFA 1FKXA 3CO8A 3GVRA 3GQYA 3M5XA 3TUUA 3PN8A 3CQJA 4NNBA 3TC7A 3CHEA 4D8AA 4M56A 2Q71A 4HN8A 3SN1A 3BG3A 3NJ3A 3W7HA 2VDGA 5EMJA 3WLPA 2WHJA 4NU7A 1ISXA 3EX2A 3TAOA 1ESWA 2ZC8A 3HN3A 4UTMA 1QXLA 4XAYA 1LL7A 3A64A 5DXXA 4R7JA 4IG2A 1E9YB 3SR7A 3VVGA 3N12A 4JTKA 4HHMA 1K1DA 2ZA1A 2BX7A 2Z29A 3CM4A 3WF1A 3N2BA 3WQ8A 1WDRA 1EP2A 5LIUX 4DM1A 1UA3A 4GNJA 3DOPA 3GW0A 4NNCA 4WXYA 3EWBX 1K7XA 2QS8A 4X0VA 3DC8A 4DBWA 5LA1A 4CNOA 1JFHA 2QJNA 1GJUA 4GJ1A 4EX4A 2VT0A 3KP0A 3NXLA 4AX6A 4ACYA 4O54A 3KL0A 3BAJA 2KX9A 3ZJ7A 3TWBA 1VJZA 4S39A 4L9ZA 4W5ZA 4ZB0A 3I7QA 2UBPC 4AVFA 1BFNA 4F9JA 4UTUA 5HOSA 2HRWA 3AS1A 3L4TA 3O05A 3SEPA 2ACRA 1W9VA 3TFCA 3LCGA 4A35A 3B9OA 3CQKA 1K70A 4PMZA 4XZIA 3L2LA 2OQHA 3A9IA 5AKQA 4YTTA 3QR3A 3G2GA 4XBJA 3A4JA 2ZRUA 3UZZA 3EYPA 2V68A 5DCEA 4HTYA 4EOUA 4NZ5A 1EJTC 3PAJA 1QBBA 3Q2DA 4BZYA 1DHPA 5HJXA 1DOSA 4KFNA 1V02E 1IZJA 1S3TC 2A6NA 3G24A 4JTQA 1V6UA 1JAKA 3GNRA 3AZSA 1E3ZA 1DVJA 3HG5A 2WNZA 1MNZA 1JF5A 3GDKA 1AH0A 2VMFA 1SMAA 2JKEA 4WLCA 4F0RA 1G69A 4IP7A 1PHWA 5BMWA 2CESA 1EH9A 2RAGA 3O0FA 4C6NA 3ALFA 4GYPC 1MUWA 3IV8A 4FIRA 3OTRA 1VGAA 3AHZA 4R33A 3FV9A 4HPNA 3ANVA 4RNIA 3LHUA 4I7VA 4I9JA 1EJRC 1OHLA 2ZOXA 3AS3A 2GSJA 4KS0A 5CG0A 5JH2A 2IS7A 2G3MA 3W7IA 1PIGA 4DJEC 4MJ2A 1H51A 2JGYA 4EAMA 4JFTA 1J0ZA 1FH7A 4KEZA 1EXBA 3OW1A 3AUOA 1IZCA 4ZOBA 2HVOA 1XIGA 3PBGA 5IFPA 3URNA 2CLHA 5J5RA 2QF7A 4JY8A 2D0FA 3HG4A 3SN0A 1SJDA 1I8JA 3ZSSA 5HQLA 1MYRA 3VABA 4DJDD 3AMGA 5LIYX 6CGTA 5AB3A 2GJNA 2FMNA 3R0UA 4BI5A 3GH5A 1UR0A 3B8WA 4WQ6A 1EGZA 4NRRA 5EBAA 5A8OA 1JDFA 5FSDC 3W3OA 4QJ5B 3QV6A 1GVRA 4WSJA 3A12A 3PWGA 4NP7A 3BW3A 4NQ1A 1W54A 2CZEA 3G0SA 3NVDA 4HQVA 1HN1A 3MUZ1 4EVZA 4KEUA 1H5YA 1AG1O 3ITXA 4HU0A 3VD4A 2D73A 4FA3A 3T78A 5CPTA 1L2QA 2JBMA 3DYOA 2CBJA 5F7UA 4XZWA 5H8UA 4A4AA 1I1XA 2ASHA 3FJNA 4N4QA 4OV4A 3UXKA 4IWWA 3W7RA 4XTDA 5BW6A 2WVSA 4C1LA 2XJ7A 3HGJA 2PU1A 1TUFA 1WAWA 1YE4A 1WDWA 3ORWA 4UMBA 2QCEA 3EDFA 3S47A 4WKHA 4DF0A 2ZXBA 4H9YA 2PZ0A 1RJPA 1M7JA 3FA3A 2QV4A 3W74A 5E1QA 4H9MA 1QNVA 2GUYA 2PDPA 4E2DA 3SCPA 1EDQA 4CD6A 3LQLA 3PJWA 1U5JA 4LVFA 2GFTA 1MO0A 3CAVA 3WYZA 4L6OA 3BC9A 5M1TA 2NUXA 4MYXA 1FCQA 4DX3A 3MP5A 1GJPA 1BRLA 2DORA 1W2PA 1J93A 4Z17A 1W1PA 3KTXA 3HJZA 3VGDA 1XWYA 1OCNA 3W22A 4ZXLA 5AYXA 1OFEA 3MYOA 1AMKA 2XN1A 2Y70A 3GYEA 2F6UA 1SM9A 4QCFA 4WGXA 3A5FA 5C2CA 3MKKA 3H2FA 4V1YA 1RXOB 1OFPA 3ITGA 5F2GA 1KWGA 3N9KA 2VWSA 1F4HA 3H24A 4IGMA 1Z7AA 1GG0A 3W1AA 2ZTJA 2CXGA 5DEZA 1OFDA 1UPMB 2XSXA 2ALRA 2E1WA 1I4NA 2VX5A 4ALDA 3UNDA 3U5YA 3ATZA 2OLHA 1ONEA 3TNOA 1C8QA 1OINA 2YOCA 1BYAA 1T5AA 2YDQA 3LZ3A 3ZR5A 5K4ZA 4DWSD 3LDVA 4M3PA 3K8MA 4OOUA 1G4SA 5EBUA 5F4WA 2IW0A 4LYPA 2DZUA 2NLIA 2W63A 3QRHA 3S83A 1KM4A 1O68A 5HDRA 3E02A 4N2YA 4ZCWA 2REQB 4C5YA 4I5RA 1TE6A 4B3ZA 3V3WA 3PP7A 1PWLA 5DY2A 3VPLA 4J3UA 3RG6A 4FF7A 2PMQA 1G0CA 3GNDA 1W9DM 3MQTA 3N2MA 1W1IE 2FZ9A 1WXYA 4WY0A 4MIMA 3C6CA 1EWEA 4J3TA 3I7SA 4J3XA 1PX4A 3QBUA 4JFUA 4ZO7A 4PMXA 4G6CA 2ZX6A 3BOXA 1A5KC 1KBBA 3DDMA 4WKFA 1XS2A 3B06A 2ZWYA 3SY1A 4C7DA 3HV8A 4Q4KA 4YTRA 2NQZA 2POZA 4YVPA 2XFFA 1KBIA 5CZ0A 5HPCA 2A6LA 1XUZA 4HCLA 1P43A 3UJSA 2BNJA 2IMRA 4N6EA 3SUVA 5CPQA 4LFYA 1OYCA 5JIWA 2GGJA 3CK5A 3FLUA 3LI0A 1PYFA 3N9SA 2C8NA 1W56A 2VEIA 3L5LA 2EPHA 1CGYA 5FF2A 3WNLA 3SUSA 1EYEA 1XLCA 3DIPA 3B97A 4OUIA 4AQLA 2MANA 2A3EA 3SGGA 3WNMA 4QEEA 3SECA 4W8BA 3MUXA 4KERA 4LVBA 4B5VA 3RCMA 2XFWA 2AL1A 1YXDA 3HGRA 1N8FA 3UU0A 3MSGA 3VDAA 3AJXA 2EJ1A 4O11A 2OZ0A 4EK7A 3C4UA 2G37A 1VEPA 2BXZA 4A8RA 2DJLA 2FJKA 3WQVA 1AODA 3R94A 3ANUA 3MZNA 2J8TA 4GI9A 5I5RA 1U2YA 3F03K 4PYSA 1O1ZA 1E72M 4BQ2A 5M17A 1ELSA 4I6VA 3WQ4A 1CXEA 2PGEA 1WCGA 3SZ8A 1XDLA 3UR7A 4O0KA 4S23A 4HA3A 3QY7A 3C3NA 1JPDX 4K8HA 3G1HA 5SWUA 1C9WA 3P61A 1BGAA 1E9LA 3ITTA 8TIMA 3G8RA 1LZOA 2PDLA 4NHVA 3WK2A 2OYLA 2WZMA 4JTFA 1JPMA 1NY1A 1E6PA 3EWDA 3PTMA 2QVNA 3PPGA 2EGZA 3FXYA 1FWEC 5CZSA 2QMJA 4P8XA 1LP6A 4MZ8A 2V2CA 3H53A 1EGMA 3NTYA 4N7QA 2GJLA 2JKAA 3JU2A 1TRIA 3TR9A 3KVLA 5ABHA 5HWMA 1TX0A 4BR1A 4AZHA 4U3AA 2C18A 1I6NA 3W7NA 3HQNA 2ESCA 4Y9NA 3N17A 1ZBKA 2VFFA 2XG9A 2QLYA 3MTWA 1Z42A 2XIQA 5I03A 4GI8A 1WA3A 1XYBA 2A79A 2FGLA 2YCJA 4XUYA 2ZIDA 3L21A 3OQ8A 2J7EA 2DUZA 1VC4A 1ZP3A 3BAKA 5IM51 4LJ3A 1DE6A 1DJXA 2E0PA 3T0TA 2G97A 2Z27A 3L4ZA 1L6FA 3RYSA 4A3HA 3AAMA 3CMJA 4GFSA 3A3HA 7TIMA 2E09A 2QJJA 4IJBA 3VYLA 3MUCA 1DHKA 1LJYA 1TJ0A 4D8ZA 1SQ7A 1WX0A 2NWSA 4P7NA 1M9HA 1YDOA 1OYBA 3ARRA 3VOCA 3QHOA 3W53A 4IMCA 3TR2A 2WNWA 4PULA 1GYLA 3WFLA 1RUSA 1B3WA 4ZB2A 3HGSA 4PGLA 5FL0A 1IZKA 1HT6A 4MKVA 1OIMA 1DQUA 1Q6LA 4Z1CA 1C90A 1HUVA 1WV2A 1WKEA 4DJED 3WQEA 3BPWA 1KKRA 2YPIA 5KITA 2G5WA 2X40A 4JDBA 3W1MA 1NFBA 1OC5A 3USBA 3VGHA 2VWTA 4AUBA 1VYRA 1W37A 4B9ZA 4J2MA 2I5IA 3CASA 4G5DA 3O9NA 4LEFA 3WUGA 2HPMA 3XISA 5K9CA 4PMUA 5TF0A 1UR4A 3UJRA 1I0DA 3GYCA 1QOPA 1O5XA 1ZAJA 5FF0A 2Y24A 5C2GA 4B2DD 3W71A 1L6GA 3WDPP 5K3VA 2W0UA 2XSBA 4DWSB 1HJWA 1X7IA 1US3A 3VILA 2OXNA 2A7PA 4MPKA 3ZQ9A 3FA5A 5A6JA 3SUUA 1LBFA 4DZIA 3F5JA 3URAA 3IIXA 2F2HA 4Q4MA 3MBFA 3SRKA 4ERIA 2HPIA 1A0DA 4FSAA 1DIEA 5E0CA 3TTEA 6PTDA 5HAOA 3ZWTA 3ITOA 4NJJA 3SCUA 4O8RA 3AXIA 2I9EA 4HHLA 1G01A 4RJEA 2HK1A 1F3XA 3A6OA 1TJ2A 4F0MA 3OQEA 1TREA 2FIQA 3R5EA 2V5LA 3UWQA 2PLMA 1JULA 3AIQA 2NXIA 4JL2A 1J5TA 1QBAA 1U1UA 3H4GA 4MB1A 4ZOAA 9XIMA 4RZ4A 2DZBA 4S3CA 2V3GA 1GVQA 3PR2A 2E9MA 4XTIA 2EF9A 2PGRA 3GB6A 4MMWA 1TPEA 4J1OA 4DLFA 1J0JA 5M3WA 4C6JA 1H5VA 1FWRA 1HKMA 4MY1A 3CYVA 3S2MA 1UWIA 2DZVA 4GYFA 1GYMA 4YNGA 1S2AA 4F2BA 3FJ4A 4AZGA 1X8FA 2YBUA 3QHNA 1JIBA 3N18A 5LXEA 2CITA 3GXMA 2HS8A 1CNVA 1EA9C 1TWIA 2Z1XA 4H6KA 3MBDA 1VR6A 4WSKA 3BJTA 2CERA 4KESA 2P5NA 3UY7A 4JX4A 2Q8XA 4UOJA 1BPLB 2GOKA 4FP1A 3VZYA 2ZQ0A 4NNAA 1N82A 4JXCA 5G1YA 3SGUA 4O14A 5K2ZA 4P7LA 2OZ3A 4H9ZA 3ZO9A 4NJKA 3W86A 3FHQA 3OZPA 3T81A 1KCLA 3K4WA 2ZVIA 2W27A 4H3DA 3SQMA 3P8IA 1XHGA 2QCHA 3AUJA 2I57A 1XM3A 4UNIA 3BLIA 3PSVA 4GO8A 4XG1A 2AGKA 2O0TA 1HIZA 1AW5A 3CLWA 5T9BG 2XH4A 1JI2A 3Q67A 3U0HA 1I2NA 4DUXA 3PHAA 1W5QA 3BQ6A 4RR4A 1E5JA 3EWWA 4PFHA 3L2MA 2QDEA 2W6RA 3WX7A 4JN6A 3O6CA 4U4MA 3SCSA 4PTDA 1P4CA 4TOQA 4G1KA 4HSOA 3CXOA 1CYGA 3PBYA 4UOQA 3CIXA 4UQBA 1NOWA 1R30A 4R34A 3MHUA 3OG2A 1UP0A 1KR1A 3W7DA 3R2GA 1GQLA 3W70A 1KXVA 1IIHA 4H41A 3WLQA 1JFXA 1QPRA 1ZHAA 3CUXA 4GZJA 4I5XA 2OG9A 2F9RA 3VKAA 2Y4SA 2ZFAA 5HK4A 2ONEA 1PS9A 2FB3A 1UBPC 4PB3A 4EAYA 4GVIA 3GLCA 1O94A 1I1WA 2V67A 1IWBA 2Y6ZA 4YTQA 1X6LA 1V3IA 4ENLA 1LT8A 2CBIA 3C5QA 2BSLA 2DH2A 3BMWA 3WSUA 1RR2A 5DCBA 4M6QA 4LBUA 3IWPA 2J7HA 1QNPA 1BHGA 5HUOA 2QZRA 4ZEPA 3TEVA 2GGIA 3AHYA 4DBDA 1F8MA 4DIAA 3WJZA 2OELA 3M0ZA 1RY0A 3MMWA 2DSVA 1TR9A 4BI6A 4HK7A 3WUFA 3WLIA 3QHMA 4L4MA 5E0FA 5BRBA 1TIWA 5D9OA 3EWXA 1W3TA 1UR2A 1VZWA 3VNLA 1DYSA 2D2GA 2IPGA 4AZ5A 3R10A 3RITA 2O4QA 3GU9A 1KM3A 3QMTA 4LUJA 3D3AA 4IX2A 3TC6A 4N6FA 4CKQA 3S8HA 2D69A 5BWFA 3LI1A 4HVXA 1GZJA 4V28A 4GWEA 3OGSA 5KZMA 3V35A 3GZAA 1AQFA 2H8XA 3WLOA 4IJCA 4L65A 3DG3A 2XGIA 3AISA 1HJUA 4XSLA 5KETA 1S5WA 3H8AA 4MNJA 4AEFA 4X63A 4YPJA 1KTBA 1ICQA 1VBHA 1WAUA 3ARXA 4O57A 4UFLA 3CZGA 7REQA 3UR8A 4LB3A 5C55A 4D6FA 3AHTA 2QPSA 1PDYA 1Z9AA 1X8CA 3ZIZA 1TELA 2GOUA 4AC1X 5A6AA 3CUZA 4YWSA 4JQAA 1RCXB 2XIJA 4UWMA 3OZOA 4D1IA 2BFGA 3GNXA 4M5PA 2VEMA 1LRTA 1XBZA 4BWLA 3CMFA 1E15A 3W7QA 2VNCA 1E55A 1XF0A 1FXQA 5I23A 2EQDA 3E0IA 4CNNA 1KKOA 3HBLA 1OCQA 3TV8A 2BHUA 3CQ0A 5BOEA 3CT2A 3TTQA 3DI0A 1ZALA 3ZMRA 3WCZA 1EC8A 1NWUA 4KWVA 2TSYA 3P93A 4M24A 4HYRA 4RNJA 3T2OA 2X7WA 1DIOA 1E1CA 2NT1A 5RUBA 3V4BA 3QMSA 1DWGM 5E6ZA 3EOSA 3WENA 3JZEA 5FA5A 5HUPA 4E2OA 1YTEA 4O53A 4DVOA 1EHAA 1E0TA 4GI4A 1RPKA 3UA3A 2OOGA 3E49A 1V3LA 5A6LA 3WIJA 2F7FA 4LUTA 5A95A 1XLHA 5E70A 3ANYA 2D3LA 3NPVA 1J96A 1NWSA 2OKOA 3VDCA 3RCNA 4GIRA 1EBHA 1DXFA 4K1WA 2YIHA 4K1GA 2VFEA 1V3HA 4H8NA 4GZIA 3C0QA 3EZ4A 5CC3A 3UPMA 1TPUA 4QG9A 2B81A 1X1ZA 2PTWA 3KL5A 1Q5MA 1K9TA 3H2CA 4Q8NA 3AIVA 4IUGA 5BZAA 2Q8LA 3W2UA 1NDYA 4HCDA 2ZUSA 1SYTA 3NL6A 1XICA 3JUGA 1XRVA 1QNQA 1WYIA 3T07A 4ACZA 4XKYA 4XO7A 3MYPA 2J47A 3QZ6A 4DF1A 4NY2A 3NQEA 1KTCA 4CD4A 4EKJA 3OLEA 3KLKA 1XPGA 2E8YA 4YVXA 1GOKA 1JPHA 4FNQA 1QPKA 3RDKA 4P61A 2W79A 4HU3A 2A2IA 3SFKA 4IOTA 1SZEA 3NIYA 1XKJA 1VFUA 3ABQA 1GWJA 4ML9A 1ZCCA 3LEPA 4AHQA 3CTLA 2H9AB 1SZRA 3CS2A 1E43A 2NQJA 3Q65A 3NO3A 3L4VA 4MOZA 4F8XA 1EF2A 2VJXA 2Z1SA 5FF4A 9RUBA 5I06A 5FKYA 5J04A 2DDXA 1I0BA 4JTGA 1OZMA 3M47A 1VFOA 3NNTA 3R6IA 4PCPA 5CBBA 4CQDA 3B3DA 3IJ6A 5U7SA 4YVVA 4R5EA 3APGA 7REQB 1VFTA 2CLLA 4X0NA 1GOXA 3SN4A 3SM0A 5I7GA 3ARUA 4IPJA 2Z26A 2FTPA 1ISVA 2WC7A 2GPTA 5GQBA 3K8KA 3G1XA 4N02A 5DN1A 4I6KA 4GMEA 4P8WA 4RDYA 3L12A 2FYMA 4L9XA 2WK2A 1UYQA 2INZA 2GQ9A 5HA7A 3U4FA 2IUZA 1HNYA 3T0BA 2JKPA 3FA4A 3ZWSA 3S6DA 4J3SA 3DBPA 5HMEA 3EX1A 4LCSA 4HHPA 4UNLA 3BK0A 2F8QA 4GYKA 4LY4A 4QAIA 1GOWA 1Q6CA 1A5CA 2YFOA 3VUSA 5I09A 4ZSTA 4JYFA 3JW7A 4URIA 4UTKA 2V3EA 3GU1A 4DF2A 1E1CB 3KFTA 4JKMA 3LK6A 3WMBA 5BCAA 3VM5A 4HNCA 4LX4A 3S5SA 5AVHA 3QF0A 3ARYA 1PL9A 4YS1A 2WJEA 3GDBA 1CB7B 3W4RA 3VIFA 1H3GA 1W17A 4IGSA 1QPQA 1LTDA 3BCJA 2IKJA 2BBFA 2OB3A 3G5EA 1U33A 1V7YA 1VLIA 2PWGA 3AC0A 4N9DA 4DJFA 5ABTA 3WEOA 3R4IA 1VCGA 4HPXA 4X61A 3WUBA 2EPMX 2ZUMA 4P2VA 4XBSA 2XWDA 2OYMA 1Q6GA 5C9RA 2FLIA 3VGGA 2RDUA 3BXWA 3V0UA 1Q7ZA 3TW6A 1TJPA 3LSCA 3TSDA 3QN3A 5MF5A 1P48A 3TX9A 4IZGA 2Y7DA 4F0LA 4PMDA 2INEA 3W9ZA 4G7FA 1PVNA 3SCQA 4N9BA 4POCA 3W37A 2VRQA 5KZ6A 3IARA 2XIIA 4L1GA 1LWIA 3GZ3A 2ZC1A 3TKFA 3VIIA 3UY8A 2ZDSA 5J8LA 2G3JA 2PWUA 1N55A 4H9UA 2JF6A 4ACZB 1Z69A 4XKYB 5C7VA 4OE7A 3I4KA 1KCZA 4OECA 4I9MA 1PBGA 1YNQA 4B91A 3CPGA 4WVXA 1LRNA 5IOBA 1NJJA 3BJFA 5I00A 4AAJA 1W9PA 2V6AA 2WKJA 2Y2WA 4PUWA 3VNKA 4QXIA 1CIUA 3G0UA 1FH9A 3BCFA 3VIMA 3NQGA 5I2UA 3IUDA 3BAIA 2P3ZA 3G6MA 4CU7A 3SSJA 3EPOA 1TCDA 3L66A 4QS6A 1TVPA 2R91A 3C86A 2AMGA 2H6RA 2HK0A 1H61A 4UTHA 3R43A 4Q8UA 1RVGA 5DQPA 2NX9A 4OWGA 3VKJA 4DYEA 1VD6A 2E68A 1FHUA 3IANA 3H12A 4LYRA 2YZRA 3V0TA 3EWUA 2YA1A 1ZAIA 3RM4A 1NQKA 4HJWA 1H63A 2P53A 1XC6A 2XFRA 5CG7A 4ICMA 2LLEA 3GR4A 1XRFA 4HZMA 3DHUA 2NUWA 1BWKA 1RY8A 4H9TA 3CMGA 1YADA 4DWDA 1RQEA 3LPFA 2QEZA 5E09A 2V5JA 2OEJA 4UFKA 3ZJKA 3KRBA 3BV7A 4HMNA 4U2ZA 5AYBA 4UFIA 4XUGA 3KWXA 3JR2A 3MHFA 4GD0A 3QFEA 1VAHA 3AXKA 4KGJA 4YHEA 5MHBA 5H1WA 1KM1A 3E2RA 4PMQA 3W7PA 2HSAA 3NYZA 5AC6A 3MUIA 1I2RA 4EPKA 2VFHA 4H2HA 4UTWA 4O1DA 3W75A 3MANA 3MVIA 1W6TA 1FWWA 1W32A 4RUBA 3ZYZA 2HBXA 3SIMA 1F6YA 2R24A 3W7OA 1YTKA 1XR2A 2VRJA 5TIMA 2X8RA 1YMYA 3G1FA 5D8WA 4Z08A 3QXBA 4WXZA 1J0IA 3TQPA 1IIGA 5A6BA 4Q8MA 3KS5A 3HB9A 4LTSA 1OFRA 1RZMA 1UPPA 2ZA3A 2E77A 3P3BA 1R6WA 1UP2A 1WO2A 2PDFA 1MW2A 1TMQA 3IUHA 4H8HA 2YLLA 2VC5A 4Q8WA 1O5KA 2WSPA 4Y8FA 3UYCA 1ZFJA 4UBPC 1UMLA 3C52A 1M65A 2PTDA 5A6MA 1A0CA 4WDWA 3A3XA 4UTIA 3VTRA 5L6UA 2ZRWA 1MUCA 2RJHA 1SFSA 3GDMA 3DX5A 3GH4A 1HXJA 1K7FA 1IT8A 4OBRA 5A5WA 4B3KA 3VFCA 2R9RA 2ZWZA 4BCEA 3BGJA 1S1PA 1WKYA 3LYEA 3PF3A 5M03A 4AZBA 1TWWA 3EB2A 4QGCA 1LQAA 1RJRA 4LBRA 4JN8A 3UZJA 4PODA 5LHFA 3OPSA 1LG1A 5D2TA 1H0IA 4RZBA 3O3RA 2G3NA 1D7FA 3DUGA 2VQUA 4GX9A 4YLWA 1PXGA 1JCLA 3AYRA 3W25A 2Z6JA 5AC4A 3AZTA 4GHRA 2BOEX 1UOKA 2CLOA 3ALGA 4QSFA 3UXDA 3HMCA 1KFCA 3BLFA 3PZOA 4ZFCA 3GHRA 1W3HA 2ZUTA 5JBDA 1B3ZA 2DVTA 1GHRA 4D6DA 2VL4A 3PBUA 4IUOA 1J0HA 4H83A 2UY2A 5BXRA 1UD4A 3QY6A 3SADA 3WG6A 1E6NA 1TPVA 5G2WA 3N04A 5DXYA 1VBRA 4D6EA 5DMMA 1L6WA 3KOZA 1SSGA 1CX9A 1FWTA 3L4XA 4R3UA 3MDUA 5GPRA 3AYSA 4M29A 4CCDA 1IWAA 3MCNA 1W5NA 6TIMA 2YXXA 4XV0A 5IHSA 4X3ZA 3NDYA 4O8AA 2CXEA 4MAZA 1EUNA 3T55A 2QVHA 3RO6A 4JQ1A 1FRBA 1GJWA 3PZVA 2Y1HA 2J88A 1K4HA 1NP0A 3L0GA 1RH9A 5BXSA 3EX6A 4HA4A 2MNRA 3P74A 2VVNA 4UTLA 1VH7A 3AI0A 1V4YA 1L9WA 3TC3A 1TKKA 1Q6EA 2RGMA 1N8WA 1YPXA 1ZPTA 3TTSA 4AWEA 1V03A 3R7MA 3SQSA 2F6KA 4UOZA 1Q63A 3KBVA 2CW6A 3VC6A 2RUSA 2I14A 1UWTA 4DJFC 6ALDA 2QUTA 3S2NA 1Z89A 4E8DA 4L4PA 2GDQA 3SCWA 1XQLA 3CL6A 4ZSUA 3BDKA 1GVFA 3PNUA 3TSBA 1KNWA 3PY2A 2EHHA 4ZQMA 1OEPA 1P6BA 1VBJA 1ITXA 1ME8A 1JYNA 2BXYA 1A5OC 3GG1A 4L56A 5TAOA 4AZ6A 3AWOA 1KXTA 3HJEA 2Z28A 4DAIA 1XLJA 2CWNA 3WKZA 4P8UA 3TW9A 2X2YA 3IJLA 2RDWA 4ATWA 4AD2A 4PSRA 3E6EA 3CZEA 2TODA 3RPDA 2XM2A 1AW1A 1VPXA 1FWBC 2GVLA 3HA1A 4ZVJA 1BGGA 1BWVA 2DW6A 5CGTA 3UWYA 2XTKA 3UCCA 2PU0A 2QCGA 4UQCA 4AD4A 3SCVA 3UZWA 2VI0A 1BAGA 1OY0A 3F4CA 2ABBA 1A3XA 3LHTA 3F2CA 4PH6A 3QYQA 2WXDM 5H6HA 1PZ3A 3H2NA 3LTSA 4D9PA 3R0DA 4O1BA 2CNCA 5EY5A 1JGIA 4LV9A 1OGGA 4HMDA 2VZSA 5REQB 1SZGA 3FGCB 2A5HA 1PHQA 3BW2A 4CD7A 1C29A 3GVQA 1DJNA 4QX4A 3OJGA 5AECA 3CAWA 3HPSA 4HOZA 2OSXA 5LXXA 2E4TA 3K5XA 3PTQA 4JQ4A 2D24A 1XUUA 3W00A 2F84A 1XFCA 3N4FA 1R85A 1X97A 2UY5A 3TLQA 1R9XA 2ZZ4A 3GO2A 3EXRA 1V0MA 4HTBA 1IYXA 1U5VA 2EKGA 2OO6A 3ARVA 3MW7A 3PC0A 1NWRA 4YTUA 1M7OA 3AMCA 2PODA 1UOZA 2RKXA 5BU9A 4WDXA 4PUDA 2ADAA 4Q7IA 7ODCA 3NQMA 1OM0A 3R25A 1UP3A 1DTNA 1YE6A 4WKAA 3W2KA 2PDHA 3FKKA 2RHGA 3NQBA 4UTWC 5A8GA 1KLYA 1AH4A 3FJ6A 4IMFA 4XIMA 5BU6A 4K39A 2PPGA 3UGRA 4R9OA 4GNVA 1WNOA 2HNEA 4B5XA 1TYGA 4ATLA 1M41A 2CZDA 3KOXA 1KGXA 4LAMA 1SVDA 3UXAA 1XLLA 3E0FA 3R8HA 1GW9A 1A4MA 5CLWA