5EKYA

Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
248
structure length
248
Chain Sequence
DLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARETLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAWGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Mechanism-based inhibition of an aldolase at high concentrations of its natural substrate acetaldehyde: structural insights and protective strategies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 106
structure length 248
sequence length 248
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ekyA00
3NM1A 3EWYA 1FQ0A 3HG3A 4XZ9A 5F4SA 1IXQA 1F6KA 4I9AA 1W37A 2OMAA 2GQAA 3N2MA 3NL3A 1OX4B 1PIIA 4RX0A 5I3JA 2TSYA 1CI1A 2CFFA 2JGQA 2FDSA 2Q3RA 5L9FA 4PA8A 3KRZA 5LKYA 1W31A 2E6YA 4JTJA 4LVGA 1NAL1 4N6FA 2RDUA 5BOOA 4UTHA 1UJPA 1FUYA 1KFJA 3CWOX 3KVKA 1DL3A 1XM3A 3KRUA 4A2RA 3CWNA 2G96A 1U83A 2DZTA 8TIMA 1C8VA 4KKXA 4U28A 1W5QA 3M47A 3QMTA 3G0SA 1W3TA 4N4QA 5DN1A 1NSJA 3QJAA 2CWNA 4UTUA 2J6XA 1TV7A 3ZWTA 4UUIA 1V5XA 2TRSA 4GUGA 3TE9A 1LYXA 1WDWA 4WQ6A 2VFHA 4NT0A 4DPQA 3WJWA 1MEHA 3QC3A 2H3DA 1P0NA 3VCRA 4GUIA 1GOXA 3I6RA 4IMCA 4XWUA 3NG3A 1QPOA 4OHQA 1HO1A 2ATMA 3LX9A 1OK4A 3DENA 5FF7A 4O57A 4JD4A 4XBSA 5D32A 3TK7A 1FCVA 1RV8A 2OT1A 3LI1A 4FNRA 1VHCA 4JY8A 4PTNA 4LV4A 2YSWA 5F1UA 1XI3A 1W8SA 1G4EA 5FI8A 5EYWA 4ZL1A 2GVJA 1SR9A 3LHVA 4K7YA 2VEMA 3PG9A 1ME9A 3LCGA 3WK3A 5AYXA 5K9CA 3W83A 3NYZA 2OX1A 4IXHA 5AHLA 4TU1A 2NWSA 4LTSA 3P82A 3BW3A 3S0CA 2B7NA 3DI1A 4EIVA 3IIVA 3G1XA 4MY9A 4X3ZA 3W7EA 1G4PA 4N9DA 3C2OA 1GQNA 5AN7A 1B4KA 2EF9A 5H2ZA 3WJSA 4UIOA 2EGZA 4JYDA 1EIXA 5DY3A 4AWSA 4RZ5A 2ISSA 4FO4A 1TPUA 3DGRA 2HS6A 2VOMA 3NPXA 1G6CA 3MI6A 3W84A 2Y7EA 1QO2A 3MI2A 2FB2A 1A5AA 1YYAA 4OBTA 2BX7A 4O1CA 4LS1A 3W6YA 3PUDA 1LOQA 3N19B 4NZJA 1K3UA 1LCOA 1SO3A 5F4WA 5K4ZA 3LRLA 3BVJA 4UR8A 4JICA 3CPRA 5KZMA 3PF3A 4PEKA 3QMSA 1TPWA 3B06A 3TJXA 3QW4B 3UPBA 4NZFA 1QPNA 1JRBA 3HG2A 4YCPA 4WY0F 1Y0EA 3TROA 4FEZA 2BZNA 2G95A 5K4XA 2JBMA 4O50A 1L6SA 3B4UA 2D73A 2ISVA 5LSMA 4WXYA 1H51A 3HG4A 4AWTA 4O13A 2NZLA 3LXAA 5DXXA 4PFMA 3FJLA 3HGSA 3L5MA 3E96A 4LT9A 3AJXA 3TNOA 2QDHA 4MY1A 1VYSX 1YLVA 4S2BA 1OK6A 4N9EA 4LS0A 4YMZA 3S5ZA 4FNUA 4RR4A 3TJLA 6ALDA 3UZ5A 5DY2A 4P2VA 1K7FA 3N14A 1RQEA 3S42A 3IIPA 4QM1A 3L0KA 2RKXA 1D9EA 2XN0A 1LDCA 1EA0A 1KFBA 2YYUA 4QAIA 1H61A 5K3VA 5CZJA 3IVUA 5F1VA 1OJXA 3QF0A 4ZZ9A 1ICPA 1LLWA 4NQ1A 1H50A 3UZJA 4JNMA 3ZWSA 5AC7A 3HOJA 3OA3A 3VKJA 4EVZA 2Y89A 1OABA 3DKLA 3O15A 3KOFA 1YXDA 2X1UA 4AHOA 4NVTA 4OU1A 4O1BA 3GNDA 1W5NA 1SO5A 4IMEA 5C2XA 1LZOA 1QO5A 2IQTA 2Q8LA 2DZSA 1FXQA 4CCEA 2Y85A 4GNJA 1KV5A 2FQIA 3C6CA 1N55A 1T0OA 2JKAA 5C6MA 2C19A 3MW7A 1EX5A 3EX3A 1D3GA 5I3IA 1TRDA 1LORA 1KTBA 3SW6A 1QOPA 1QPRA 5HJLA 1YPFA 5AC8A 1P0KA 3LCFA 4LUIA 2AGKA 4UTIA 1W5OA 2X2GA 3RF9A 4J9JA 4UTJA 3C2VA 1XDLA 4O4VA 3OBKA 3RNDA 4BWLC 4ZQMA 3W2KA 2NXGA 5C55A 3R89A 3IGUA 4OGZA 1MO0A 1K7EA 3UPWA 5CSSA 3R8RA 2I9EA 4X2RA 5G2WA 4CNOA 3P81A 3C61A 4M5PA 1JUKA 2X1RA 2WOQA 1XBYA 2ZA3A 3A5VA 1T8XA 3OVRA 4XQ6A 5HQEA 1ADOA 3PB0A 2BWGA 3NO5A 1RZMA 1ZHAA 3A5FA 3L9CA 4HKPA 4Y6GA 4LOCA 1DORA 1PS9A 3LCWA 2B0MA 2FPYA 2GPTA 3FKRA 3W3OA 4NJHA 5J5RA 1JR1A 1UASA 5AB3A 1JJKA 4XTIA 3ABSA 4MLJA 3T44A 1G7VA 3CU2A 3UQNA 5FF3A 1KM1A 5DLCA 3V75A 3IGXA 2ZYFA 3B0VC 4YL2A 2Y7GA 2QCNA 4Z1BA 4BR1A 3O8AA 4Y9AA 2XFWA 1JCJA 4C1LA 3Q37A 2ZRVA 3TIMA 3W7QA 3PM6A 4FIQA 1GTEA 3GKAA 4MUZA 1L2UA 1Q6QA 4AEOA 1TTJA 2WJZA 4LRSA 4OV4A 3CIWA 3VFLA 2H3BA 4XKYB 3NQEA 4FX8A 4HSNA 4DF0A 5BW6A 5U4NA 3EXRA 2P1FA 3EX1A 4I7WA 3W9ZA 1TPFA 3F4WA 2ZRYA 5BRBA 3ELFA 4L4MA 5ABTA 4OQVA 1TPH1 3NOEA 1H7RA 4JX4A 2C18A 1FWRA 4LC6A 4MYAA 3H55A 1L6WA 1PE1A 3TSBA 2J9ZA 4AVFA 4E38A 4EF8A 1QNVA 3MJYA 4PL2A 4HT3A 2C13A 3KAOA 3W1AA 4JDBA 5LHFA 2DP3A 4RZ6A 2DZUA 3IV3A 2QCLA 3SECA 1DJQA 1O5XA 3TH6A 2RH9A 2NWRA 3T55A 3SY5A 5D38A 1IXNA 3T7VA 3I65A 4K7VA 1LTDA 2A6LA 4DXVA 2ATSA 4Z0SA 3JS3A 3LGEA 2Q8ZA 1T96A 5G2HA 3S5NA 4N9BA 1VCVA 1KA9F 4R53A 3RU6A 2GQ9A 1I4NA 3E02A 1DHPA 1K8YA 5EBUA 5LGZA 1W5PA 4JTFA 4GJ1A 3UY8A 3C2FA 2TYSA 4AF0B 3NA8A 3RLVA 4MY8A 1LRNA 5LHEA 1JQXA 1GPWA 4DO5A 3MYOA 1AW2A 4JTTA 3HGRA 2QF7A 4YCOA 2NUWA 4UFIA 3BLFA 3EWWA 1TPC1 1EB3A 2HMCA 2TMDA 4YXGA 3UXDA 1ZAIA 2VFIA 3QYQA 3TC6A 4KWVA 3MWAA 5FEXA 1H7WA 4XKYA 4NX0A 1SZGA 2I1OA 1XKYA 3DKJA 4QITA 2ZTJA 1F6PA 1YXYA 3TKFA 2JGYA 2XN1A 4LV9A 4JTUA 4UFJA 3OVPA 4QNWA 4L4LA 4E0CA 1W54A 3TX9A 1HUVA 4K8HA 1ZCOA 1QDSA 1HTIA 1K03A 5F2MA 1HO4A 1LBFA 1GJPA 3WJYA 2GQ8A 3EKLA 4OV9A 1ME8A 1AW1A 4NX5A 4FX6M 4Z1DA 4UTTA 1ZFJA 4WUIA 2YYTA 4EWND 3M9YA 3C3NA 5D2XA 1PHQA 3P74A 2E6DA 3QQ0A 1S5VA 3W73A 1N7KA 3RMJA 1AMKA 3INPA 3TAOA 5L6UA 1TPB1 3W1PA 3TFXA 4HN4A 4ONVA 1DQWA 3DFTA 1VS1A 3QPZA 1YPIA 5CGQA 4FXSA 1KFKA 4MJMA 4BF9A 2NLIA 5F4XA 3TV8A 3P8IA 1LROA 4MZ8A 3SI9A 4AF0A 3F03K 2DZWA 3EWBX 3DFPA 1QCWA 1VLWA 5DBTA 1EP3A 3W74A 2HTMA 3ATYA 3NL6A 4BI7A 3W2MA 3RLUA 4UTMA 4CNNA 3PSVA 4AWUA 1OFAA 1K02A 1KLYA 3FA5A 2B4GA 3G1SA 3K30A 1TREA 4LS2A 2ZZ1A 1F05A 3KX6A 2Y61A 3PBWA 1J5TA 3BG3A 3LHYA 2C3ZA 3C2RA 3PG8A 4Y96A 3SFKA 4IX0A 3UWVA 1KFCA 1EUNA 2DU2A 1QAPA 1TTPA 4UC5A 2QDGA 1FWWA 1SPQA 2JK2A 3IEBA 4FHAA 3W1NA 3QH2A 3OHIA 5I3GA 1FDZA 5AHIA 3W7NA 1JCLA 1QMLA 4AHPA 1NEYA 5FEWA 4MLRA 3TC7A 1DV7A 4S2CA 1OYAA 1OFEA 3LXCA 1WQ5A 1AL8A 1ZAHA 1OFQA 3E9AA 4RLIA 2WSRA 4PC8A 5K7JA 4WXZA 2Z6JA 1LBLA 1G7UA 2ZRUA 3ANYA 3IVTA 3T78A 2EPHA 4AAJA 1O95A 4MPQA 4UMCA 5K9DA 2TPSA 5CZSA 1P4CA 4OT7A 3W7OA 5HMSA 2VENA 3KFTA 3O6DA 1GVQA 1H1ZA 3G1FA 4O4WA 1RD5A 2E5DA 4Z1CA 3HBLA 4ZQNA 4A21A 3N2XA 4IMGA 2QEZA 1TCDA 1W56A 2QAFA 3W1RA 5TBOA 4O1DA 5EL1A 3CQ0A 5HWNA 5HUPA 3NQ6A 1KTNA 3IGSA 5TIMA 3USBA 3P61A 4DPPA 3SZ8A 2GVGA 3W1MA 1XBZA 3VE7A 2FB3A 5DBUA 4A2SA 1F73A 3LLDA 2H90A 5AHEA 3P5ZA 2Y88A 4JX5A 3LB0A 4N2YA 4E2DA 5K2ZA 2X1TA 3NL2A 1XL9A 1KFLA 3HG5A 5D05A 4IMDA 3HGOA 3LTPA 4MJZA 4N02A 4LWWA 1W3IA 2NX3A 3CB8A 1XC4A 3IVSA 1OX4A 4XTDA 2VKZG 3M6YA 1H1YA 3SJ3A 5G5IA 4IWWA 1BTMA 4DEFA 5EA9A 3DHDA 5LGXA 4UFKA 1SW3A 1TTIA 3HPSA 4O11A 1OX5A 2EKCA 4OWGA 5CKSA 1SSDA 2A1YA 3UY7A 1A53A 2WKJA 5D33A 1VH7A 4MVAA 3S5OA 4MIMA 5K9XA 4WY0B 4FNQA 2QCMA 3ZFHA 3PR2A 2ISWA 3GDTA 2ZBTA 3NQ8A 1BWKA 3UXAA 1SFJA 4PH6A 1Q6RA 4N9CA 1LOLA 5F2LA 2PURA 4UMAA 3W1UA 4CCCA 2V5LA 5FF4A 2BXVA 3G3MA 4O15A 4IGHA 2CZFA 2R14A 1O60A 3G1DA 3G8RA 2QAPA 1HG3A 2V2CA 1QR7A 2WNNA 4ORMA 1FCBA 1VLIA 4NXKA 2YPIA 3A23A 3LHTA 4LW7A 2YDAA 3GDLA 2CLKA 3KXQA 4LNYA 3EX2A 1V7YA 5DCDA 1FX6A 3P80A 3EXSA 5IM51 2Z6IA 4UTKA 4PCFA 3OVQA 2BLEA 3WJZA 3UWWA 1F76A 1ICQA 3S5YA 5I3FA 3LCHA 5IBXC 3GAYA 1UCWA 7TIMA 2WSYA 3LHUA 1AG1O 4GBUA 4HSOA 5TQLA 4O52A 3GNNA 1VZWA 4R7JA 4ZMGA 1ZY9A 3SGZA 1Q45A 3S9YA 1YXCA 1GVRA 4TX9A 3GXPA 1SU5A 2C0AA 3DFQA 1QFEA 1XBVA 1X1OA 3M16A 4WY0A 1X8FA 2H8XA 3NPVA 1G4SA 1ZJIA 3BW4A 3M41A 5D2TA 4R34A 2GVLA 5A8GA 1R2SA 2ZCGA 3STGA 1X6UA 2QUTA 3MYPA 4ADTA 1ZENA 3M5XA 1TO3A 5D37A 4PL1A 3JRKA 2UV8G 3WK0A 1OFRA 1BEUA 1VHNA 2NXHA 3VNDA 5AYYA 2YCEA 1I2PA 4FNTA 1AW5A 4DELA 3FIGA 1Z44A 1IXPA 5CPLA 4IPIA 1PHWA 1LOSA 3U8GA 2RDWA 5D09A 3W07A 3CEPA 1O4UA 4FF7A 3THAA 2ZFAA 1JULA 2EAWA 3E0IA 2NV1A 5KZEA 2O7QA 5I3HA 3N73A 3L5AA 2C14A 3PS7A 3H54A 4Z0JA 4BFAA 3UNDA 2E6AA 2NUYA 1BWLA 3ATZA 5CZTA 2Y63A 3ZS4A 1QPQA 3DAQA 1DOSA 4CQ9A 1EWDA 4B5NA 4K6AA 4WOQA 2J88A 3RFAA 1R46A 4NXSA 1EUAA 2GJLA 5EPDA 1OYBA 4M6VA 5G4EA 4NNCA 1OF6A 3P5YA 5LZLA 2HS8A 3IRDA 3MO7A 1IF2A 5HWMA 4X9SA 1R2RA 3MP4A 2PRMA 2A7NA 2ZRZA 1G67A 4ML9A 5FEZA 2Y70A 4DO6A 1SO4A 1OYCA 3PBYA 4Q33A 1ZAJA 4RKAA 2VC6A 3I7SA 4GWEA 1RPXA 3EWUA 2VFEA 3B05A 5LNVA 1NVMA 1JVNA 2PRHA 4MFDA 1H7NA 2HSAA 1B57A 1MZHA 3BGJA 3TQKA 3LBCA 3LLFA 2DJLA 3MHFA 3O05A 4YLWA 4HPJA 5FF0A 4QSHA 4LRTA 1DBTA 4KFPA 1YDOA 3V1PA 4UTLA 2QR6A 1X1ZA 1S5WA 1Q6LA 1DJNA 2PRLA 3SR7A 3HQ1A 5D02A 3DFSA 4UNKA 5DCBA 4AB4A 2Y6ZA 3MP3A 3N9RA 3UYCA 1T99A 3R5EA 2F7FA 4JX6A 3HPZA 3U6WA 3QPYA 1I2OA 2J9YA 3L0NA 3QEZA 1TQJA 3BW2A 3NQCA 1DQXA 3W7PA 1F5ZA 5T26A 4DF2A 3NAVA 1QOQA 3G1VA 1FXPA 2E5BA 3LOTA 5KINA 1TPDA 3MI3A 4MZ1A 2WO5A 4OE7A 4DBEA 1J4EA 3BK0A 3FEMA 2OCZA 3NL5A 2CLEA 5FF2A 3DI0A 2FTPA 3L67A 1TJRA 2A7PA 2WSQA 5LNWA 3KRSA 3GIYA 1YTDA 2E09A 1OFOA 1EP1A 3S1VA 3M5VA 4Q4KA 1XDMA 1H5YA 4M7SA 2AAMA 2RFGA 1Z42A 1PVNA 3PWAA 5D03A 3C56A 5D2WA 2CLHA 3LTSA 3WJXA 1MEIA 1AK5A 3AO0A 3G0XA 3P62A 3CC1A 5HNRA 4WOZA 3WK2A 3E49A 5D2VA 2CLIA 3GXTA 3LCIA 4DF1A 2YR1A 1N8FA 1H7PA 1SUXA 3OIXA 2ZA1A 3NM3A 5G4WA 3W71A 3W7IA 2A4AA 3CM4A 3PBVA 1W0MA 3LRKA 3GDMA 3EX4A 1P1XA 4NNAA 2QCGA 3IIXA 2X16A 4Y8FA 3O06A 2E6FA 4BWLA 3MBDA 2DJXA 2E77A 3UWZA 4A29A 3I68A 1E51A 1R47A 3M43A 3TAKA 2WV8A 2B7QA 1JCNA 4A22A 1BKSA 1ZNNA 2PE4A 2V8ZA 5KMYA 3W87A 3FFSA 4Q32A 1MSSA 1RQBA 1K8XA 1ME7A 2NXIA 4QJ1A 4S1FA 4YWIA 3HGJA 1Z48A 1JRCA 4RV8A 3DFNA 5EKYA 5H91A 3C4UA 2CU0A 4O28A 2VFFA 3W76A 3L0GA 4LUJA 1SZFA 4ICNA 3W75A 2OJPA 3U2OA 4JTEA 2ZQ0A 1OHLA 4NU7A 2CLMA 1W1ZA 3LBMA 3MBFA 1VCGA 4KWWA 3TFCA 3QM3A 1GYNA 4ZVJA 3W7MA 1A5SA 3B0PA 2RDTA 2LLEA 3DHFA 3NPUA 2Y7FA 5DELA 4O16A 3W2LA 3BG5A 3LHZA 1LM1A 3D0CA 3GR7A 1C9DA 4IXXA 1AL7A 3B0UX 5EY5A 1FCUA 2QUVA 1I2NA 2ZZ3A 3W7GA 3NQDA 1M5WA 2GUUA 4WX2A 4NJKA 1XUZA 3W7RA 3S8HA 1OG0A 2ZZ2A 3TMLA 1VQTA 3NGJA 4TMCA 2W79A 3LV5A 1IGSA 2CZDA 1FY6A 2QCDB 4JGDA 1B9BA 4RXFA 4JIQA 3MHGA 3W2JA 2YFOA 3NQ7A 1KFEA 1GYLA 4BI5A 3QFEA 3ABRA 1VCFA 1TJPA 3W7JA 2H8ZA 4N4PA 2DZVA 2VFGA 4ADSA 1OFPA 1KM5A 2VEKA 3TSDA 4HNUA 4LU0A 4IOTA 2Z0IA 5G1TA 1EEPA 2Y62A 4D2JA 5KITA 1JCYA 4IPJA 1PCWA 2CLFA 5E0KA 5AYZA 2QCFA 5LNSA 1K8ZA 1CW2A 3I7QA 3BLIA 5HR7A 2V2DA 4IX2A 1H62A 3C0JA 1JUEA 4W9TA 1TQXA 4O19A 3QMRA 3DZ1A 1VPXA 2YX0A 3EWZA 1ICSA 4IQLA 4MKNA 4DBDA 3F4NA 3SSJA 2P10A 4EF9A 2A0NA 2GOUA 2I14A 5CG7A 1TV5A 3MMTA 3NQMA 3M0ZA 4O17A 3ABQA 2C16A 3GAKA 4K37A 1JQVA 3C2EA 4O0KA 3LRMA 5LNRA 4M7TA 1OFBA 5F2IA 2ALDA 2CZEA 1FDYA 3HB9A 3TDFA 1WAUA 4O18A 1U5JA 1Q6OA 2KZHA 3NQFA 1GVFA 1SFLA 3TXZA 3GKFA 1GG0A 3EEGA 4O14A 3G22A 4KFOA 4IMFA 3LCLA 3B04A 4ALDA 2FPVA 3JR2A 4LC8A 5C5YA 1XCFA 3FOKA 4IUOA 1O94A 2XN2A 3LI0A 2ZRXA 2JKPA 2V81A 1B3OA 4H6KA 4JTKA 1O5KA 3M7WA 3GDKA 1R30A 2QCDA 3FS2A 3P60A 3NEVA 1VGAA 4JY9A 1NFBA 1WXJA 3NZ1A 1FBAA 2QJIA 2A85A 1SZNA 1KLZA 4CQ8A 1YDVA 4UXDA 1MXSA 4TMBA 5G1YA 4FXRA 2QCHA 2ZZ4A 2NX9A 2ZA2A 3FYPA 3QRHA 4FNPA 1FCQA 2ZZ5A 3P7YA 3TW6A 3DXIA 3UWUA 2ZZ6A 1I2RA 1TRIA 1Z41A 1K7XA 4O12A 1IIHA 4WZHA 3HJZA 2FLIA 4O10A 3G18A 3P8JA 3LV6A 3BLEA 3LERA 2Z1BA 5E93A 2B7OA 3KVJA 1RR2A 4JTHA 4UR7A 4K38A 1WOAA 1GVOA 1G4TA 3THQA 3BG9A 2A5HA 3A21A 2C6QA 1SZEA 1TB3A 2Q3OA 3UD6A 5F2GA 5HR6A 3EXTA 3FKKA 4NNBA 3NQAA 4JTSA 1RQHA 2QCEA 1TIMA 1OF8A 2AQWA 4O54A 2OT0A 3R2GA 3FYOA 5J5DA 3W2NA 4AH7A 1TPEA 3Q58A 5GVJA 1WBHA 1QWGA 2O7SA 1JUBA 3FJ6A 4TIMA 3NZRA 1M6JA 3L2IA 3QSRA 2CLLA 4CQAA 4ZQPA 1UB3A 3W1XA 3G24A 1F2JA 3NXFA 1FWNA 5DCEA 3M5ZA 5CSRA 4JEQA 4UTWA 1GZGA 4HNNA 1I2QA 3EB2A 4RZ4A 5G2IA 3QQ1A 2DZXA 1JCXA 1PV8A 3VI2A 4G1KA 2J9XA 1C29A 3STEA 4UFLA 2ABAA 1TMHA 3DU0A 3KVLA 3OG3A 4M6PA 3HMJG 2R8WA 5U7SA 4JXCA 3R12A 3W1TA 2QJGA 3TA6A 3GB6A 4RK8A 3BPWA 3DFOA 1LBMA 3CTLA 4O8RA 1R2TA 1VR6A 4X22A 1WYIA 6TIMA 4GE8A 1A50A 2E1DA 5CZ0A 5EMUA 4HNTA 1W5MA 3W72A 3A24A 3ABOA 5AHMA 1GTHA 2X30A 3PVFA 1TV8A 3P84A 4HHPA 5MHBA 4JTIA 1KM0A 3UWYA 1M7OA 3W85A 1YTEA 4P61A 3Q2DA 3GXNA 4FIRA 1UBSA 1GT8A 4JR5A 4ZQCA 4MOZA 1FWTA 1VJIA 2J27A 3GK0A 3RK8A 2E68A 3W7DA 2H6RA 3W86A 1XUUA 1H7XA 3QW3A 3A22A 4K39A 1FDJA 2WNZA 3G8EA 2DORA 3DH7A 4IJBA 1CX9A 2YGYA 3GYEA 3W7LA 3KHJA 3BO9A 4FX7A 2YW3A 3W70A 4Y90A 2YFNA 3S6DA 1XFBA 1SW7A 5CPOA 4JIPA 1IIGA 3B03A 1KM3A 3O6YX 3PY2A 4CNPA 2Z2UA 5KTLA 1J2WA 3STCA 2Y7DA 3W1QA 4FNSA 5A5WA 3O63A 3PUEA 1H60A 3S1UA 3TW7A 2YZRA 4JYEA 3HIJA 2G97A 1ZALA 2FJKA 3ZR4A 4QIUA 1VRDA 2VEIA 2WPBA 3G3DA 4JS3A 2CW6A 2OZ0A 1H63A 3W7KA 3O16A 1KBIA 3PB2A 4LVAA 3H53A 2ZDRA 4XUGA 4K8EA 2R94A 3NDOA 1I8JA 3MUXA 3TQ0A 3BARA 4PODA 4ADUA 4LVBA 1NF0A 1P5BA 3G1HA 5CPNA 2ZRWA 1DVJA 2A7RA 4WJEA 2V2HA 1PCKA 5KZDA 5D04C 1YTKA 3VE9A 5SWUA 4MYXA 3KVMA 2ZZ7A 2EHHA 3N34A 4LY8A 3YPIA 2VELA 3T40A 3N3MA 2C1HA 3SIZA 4XBKA 1IXOA 3G1YA 1HL2A 3W7CA 2A6NA 1A5BA 1VC4A 1A5CA 3CEUA 5HWJA 1HFBA 1WX0A 1PL9A 3DBPA 3L68A 1LP6A 2FPTA 2FIQA 3PBUA 2QKFA 1KTCA 1LRTA 2V0TA 3EKZA 4LVFA 4WD0A 4O0ZA 4BI6A 4RCXA 1TSIA 4JTGA 4M6QA 4CCDA 2J24A 1X7FA 4E2BA 3PSWA 2DZPA 1EWEA 2BSLA 1TYGA 2V5BA 3NQVA 4NJIA 2QJHA 3O1NA 1SQ7A 4I7VA 2RHGA 5HINA 4UTTC 1MEWA 2JKEA 2NUXA 3O07A 3LCXA 4I7UA 3QZEA 3STFA 4AMAA 1EP2A 2PCQA 1YADA 4NJGA 4TO8A 3W88A 1Q3NA 5IBXA 3GZ3A 5D2YA 5I3KA 1KM6A 5DXYA 1SSGA 3EWXA 3HPXA 4U4MA 4LVDA 3M44A 1D3HA 1F74A 2QCCA 4DO4A 4QISA 3TU9A 1XXXA 1KW1A 3MHUA 3NR0A 1GEQA 4O1AA 2B7PA 2A2IA 2F84A 3FLUA 3LM7A 3HO8A 2BTMA 4ZQOA 3TQVA 1WV2A 2A21A 5AOUA 3CHVA 3S1XA 3QSTA 1GVSA 4JDYA 4K36A 1W3NA 1KBJA 2E5CA 2W0UA 4HNVA 4HPXA 5AFDA 1ONRA 2G5WA 1VYPX 3GR8A 5BMXA 3NNTA 3PAJA 4UMBA 5FESA 4GUFA 4AXKA 3W1LA 3IIOA 1OFDA 3LHWA 3Q94A 3LTYA 4QNEA 3NQGA 1M7PA 2VEPA 2X1SA 1GG1A 3GLCA 3M5YA 3PULA 3W23A 4ZQRA 2CLOA 4RXGA 2WQPA 2V30A 3GDRA 1UUMA 3I7RA 3G0UA 1G69A 1OVDA 1OX6A 1L6YA 3BGGA 3T4CA 5LNUA 2NV2A 2W6RA 4GFSA 1WBJA 4GRSA 4UFHA 2FFCA 5E1QA 1I45A 3WK1A 2P0OA 4MZYA 1TTQA 2R91A 1NF7A 5BNKA 4UCGA 1DKWA 5KSWA 3CIXA 1KM4A 2VXNA 2ZTKA 3NQ2A 5AHNA 3C8FA 1UUOA 1EPXA 3TMQA 3GVGA 3CLMA 1L9WA 4GC4A 4UFMA 4UNLA 3TR2A 1GWJA 3N9SA 3L65A 2YXGA 5AHFA 5C54A 4CLMA 4A3UA 4GUJA 4GUHA 1B4EA 4Z1AA 4JYFA 1S5TA 4GXMA 4JN6A 1LLZA 4POCA 3UWQA 1F7BA 3L5LA 1XBXA 4H4IA 1SW0A 4N6EA 3TXVA 2QUUA 4DQWA 4Z08A 2C15A 1WOBA 3W22A 4ORIA 1SO6A 2NX1A 3EX6A 2VFDA 4JTLA 3L66A 4EOUA 3LXBA 2CZ5A 2WNQA 3C52A 1S3HA 3GX9A 1ALDA 2V82A 4NUWA 4AHQA 3IIZA 4TR9A 5CPMA 1RVGA 4H3DA 2V9DA 1VYRA 2PC4A 1ML1A 3S1WA 1WA3A 1THFD 3MP5A 1KM2A 3PUOA 4KFNA 4M19A 1H7OA 3SGUA 3CT7A 1FWSA 3WFAA 4RJEA 3NPWA 3L21A 1KV8A 3HF3A 1TPVA 2YW4A 3BV4A 3PC0A 3B8DA 2ABBA 4R33A 2GJNA 5D30A 3M1ZA 4BK9A 5BMWA 5HUOA 3TSMA 3G1AA 4O53A 3OEXA 5HULA 3W2UA 5AC6A 5FEPA 4C1KA 4FB7A 4MFEA 3O6CA 3W7HA 3TUUA 3A9IA 4QQ3A 3F1QA 3LDVA 3NVTA 3E12A 3P67A 1JCMP 1YDNA 3R13A 4HIBA 4NJJA 3TCEA 1LRQA 4UTWC
chains in the Genus database with same CATH superfamily
3BH4A 1FQ0A 4DJDC 3STPA 1ITCA 1JD7A 3VOHA 1IXQA 5FAGA 4H9XA 2ADAA 1PKNA 2OMAA 2QVNA 3N2MA 5IDZA 1UZDA 1YE4A 4PFHA 1PIIA 4B91A 5I3JA 3FK4A 3ANVA 1DPMA 2FDSA 2ZADA 4HU4A 3H7RA 2D22A 1ZBWA 4AW7A 3VOCA 2VZTA 2OTDA 3BV7A 1R38A 3MUAA 3CPGA 2AGTA 4H01A 1FUYA 2BHYA 2VC9A 4US5D 4A2RA 3CWNA 2DZTA 2CHRA 2VC7A 4IM4A 3BL3A 3W82A 3QJAA 2CWNA 2ACQA 2J6XA 3ZJKA 1AMYA 1TV7A 3ZWTA 1XLKA 4JBRA 3WF2A 1RVKA 2VZUA 2NVAA 1BGAA 2QDEA 3TTYA 2WW5A 1BXNA 1MEHA 3QC3A 5E9AA 3LPGA 4ZB2A 3VCRA 1CLKA 1AQHA 3CAWA 1UPMB 4DZ5A 3RCNA 3SADA 4XWUA 4GO9A 1LWJA 1C9WA 2ATMA 3LX9A 4PTDA 1OK4A 3DENA 5FF7A 3CZLA 2OQYA 5D32A 1E9LA 4HK7A 4L56A 2WZMA 3LI1A 3TR9A 3HV8A 4PTNA 1DQUA 4QROA 4XAYA 4JQ2A 3RLHA 1VAHA 3BMXA 5EYWA 4ZL1A 1YQ2A 2ISDA 2C1GA 2WZHA 4K7YA 5JXQA 4MM1A 4YWSA 3GIQA 3WK3A 3V5CA 2G41A 4KRTA 2NSXA 4IXHA 5AHLA 4L61A 3I4KA 2NWSA 3V0UA 3WBEA 1NWTA 4PUKA 5DX7A 4G2DA 2DIEA 4KRZA 4N9DA 4CD7A 1E4NA 1UKTA 5AN7A 1B4KA 3WJSA 3GTFA 5DY3A 4GYPC 4WSHA 1TPUA 3DGRA 2HS6A 3W84A 1M01A 1QO2A 5CLTA 3MI2A 4HMEA 2BX7A 1D3CA 3T2QA 4XAZA 3KL5A 4GINA 3N19B 1UD3A 4ZOCA 3RIKA 3BVJA 1HVXA 4JICA 4IP7A 1Z3NA 3CPRA 2XH4A 3MMWA 1TPWA 4PMOA 1QPNA 1JRBA 1WB0A 1V0NA 3TROA 2BZNA 2PP1A 3ABXA 3QBUA 3UBPC 2Y8UA 1W9BM 2PU0A 4XBJA 2YA0A 1J01A 2NZLA 1W9VA 2HE8A 5DXXA 4XX6A 3HGSA 3E96A 3AJXA 3A3HA 3S5ZA 4FNUA 3ZXWA 5TF0A 1IZKA 1HKWA 1JNDA 2X0SA 5I3DA 2RKXA 1LDCA 3UXLA 1H61A 4JL2A 2D3NA 5F1VA 3QF0A 4Z17A 1LLWA 4NQ1A 4JNMA 5AC7A 1TIWA 3GQYA 4EVZA 3TEVA 3O15A 3MY9A 3SBFA 3KOFA 1YXDA 2X1UA 3IK2A 2VCBA 4MPKA 2VT0A 2DUAA 2OO0A 2PI6A 3VM7A 1HT6A 4GIAA 4W7VA 1LZOA 2IQTA 3WF0A 3B8UA 3LU2A 4GNJA 3FEQA 4UWMA 1KV5A 3P93A 4X0VA 2FQIA 1IYXA 3TC3A 2C19A 3MW7A 1XSJA 1EX5A 1D3GA 4IH3A 1KTBA 4G9PA 4YVVA 1W1A1 4A6GA 1P0KA 3WUFA 3AQUA 3RF9A 4BWLC 4ERGA 2ZX5A 4ZQMA 5DRIA 3W81A 1K7EA 1TG7A 2DFAA 5G2WA 3SUUA 1RSCA 4M80A 4BHYA 1JUKA 2X1RA 1XBYA 3A5VA 1T8XA 2W4XA 2PWHA 2YCJA 4HKPA 4LOCA 3W3OA 2GPTA 1ZBCA 4NJHA 1JR1A 2CESA 1UASA 5T8GA 4H6RA 2YBTA 1BYAA 3WLMA 5BXSA 3ABSA 3T44A 1EHNA 1BPLB 4WJ8A 1TE6A 3CU2A 1PPIA 1KM1A 4I90A 5DLCA 2BY0A 4AZBA 4ZGYA 1YDYA 2QCNA 3FHAA 4Y9AA 1HP5A 1S2VA 3G5EA 4I5RA 4MWAB 3PZQA 3E5PA 1Q65A 3TIMA 2CETA 4YTSA 3VGGA 3ZM8A 1M1BA 1EJSC 1TTJA 2WJZA 2W3ZA 1PIFA 1G5AA 1WKFA 4XKYB 4FX8A 1P7TB 2XUCA 2OPJA 4I7WA 1JYXA 5BRBA 2ZE3A 4ZTYA 4OQVA 3WQCA 1TPH1 3NOEA 3GU1A 1J93A 3PJTA 4N7QA 1V02A 4E38A 4F79A 3MJYA 4PL2A 4HT3A 1VFFA 3W1AA 1B0IA 1TA3B 1KWKA 1TZ7A 4HVXA 1D7KA 1F61A 1VJSA 3WH5A 4G8TA 2QJNA 1O5XA 3T09A 3T55A 4QDWA 5D38A 1LTDA 1F4HA 4RDWA 2GGEA 4Z0SA 3CMFA 3JS3A 1RUSA 4TVCA 4B3KA 4N9BA 4R53A 3ES8A 3B0XA 1DHPA 5EBUA 1CB2A 3WY1A 5LGZA 5JU6A 1U30A 4GJ1A 4HZ8A 3C2FA 1UA3A 2NQHA 1W3HA 3RLVA 3PZIA 1JQXA 1KKOA 3SCWA 3AMCA 2Z25A 4XKMA 4JTTA 2XVNA 2PS2A 2VOTA 2GL5A 2NUWA 3BLFA 4MWAA 4Y2WA 1EB3A 4XAGA 3CQJA 4YXGA 4C90A 1B3YA 2CCRA 4XKYA 3TTQA 3AMLA 1SZGA 1XKYA 1P7TA 3CZGA 4QITA 2IKHA 4CEUC 2HPIA 3AIVA 3TKFA 4F0HA 4YN5A 2XN1A 4JTUA 2WZTA 4UFJA 1C8QA 4E0CA 4Z1YA 4K8HA 1ZCOA 2O56A 4TUFA 1K03A 1HO4A 3T0TA 1TA3A 2GQ8A 4Z42C 1OQFA 1TUFA 3WMLA 2WWCA 4DX3A 3C3NA 3H4XA 5D2XA 1A49A 4CU7A 1NARA 3P74A 3QQ0A 2E67A 3UZXA 5HNTA 4B5VA 4GQGA 1TPB1 1PAMA 4FXSA 4AWEA 1EXPA 3P8IA 3ARSA 1LROA 3BQ5A 4MZ8A 2EO7A 3F03K 4JFSA 1JF6A 4LAUA 3KL3A 3DFPA 4M82A 4MKSA 1E4LA 1EP3A 2HTMA 4BI7A 4AG0A 1R0MA 1XH0A 3CQKA 4JKMA 4UTMA 1FHUA 1FP8A 5CLWA 4AWUA 3U7BA 2VC5A 3FA5A 5I6SA 2B4GA 3MVTA 4H9UA 4YPJA 2RJGA 3K30A 2OEJA 1W17A 3LZ3A 4GX8A 1NWUA 1F3TA 1E6ZA 4AC7C 2C3ZA 2BG5A 2OX4A 1XQLA 4WK9A 2Y8KA 3CV2A 1KGUA 1FWWA 3S46A 1SPQA 4J35A 2R9RA 3BTNA 4AUBA 3QH2A 3OHIA 1FDZA 3G2GA 2W67A 3PZVA 3O3RA 1QMLA 4AHPA 1OYAA 3VUSA 1C7SA 3QN3A 2E9MA 2HZGA 4F0SA 4Q8MA 3E9AA 4WXZA 1V3JA 1MXGA 2IXVA 4ZEPA 1WDDA 3AYRA 4UMCA 1NOWA 5K9DA 4CNUA 1P4CA 4OT7A 2AAAA 3KFTA 3VGDA 4O4WA 1XG4A 2C0HA 3HBLA 1P0BA 4A21A 2OOFA 1TCDA 4FLSA 3CUIA 2HISA 4O1DA 5EL1A 5HWNA 1A3WA 1KTNA 3N18A 4K2SA 4DPPA 4QX4A 1XBZA 3W24A 1F73A 2H90A 4U2YA 1TV4A 3VDBA 3G6LA 3ZLHA 4H7CA 5FKYA 3UA4A 1G94A 3NL2A 4AD0A 4NRSA 4EPDC 3ITCA 4MJZA 4LWWA 2NX3A 1XC4A 3UZZA 2ACUA 5GNXA 2VKZG 3KW3A 4XZHA 2PDXA 5EA9A 3DHDA 3TNBA 4KMQA 3QLDA 2FZDA 2WXDM 4FK9A 2CITA 1S1PA 1TTIA 3GVWA 4O11A 1EYEA 3TTOA 3OO2A 3ZLGA 4M3PA 2WKJA 2VD8A 4HGXA 5CC3A 3SRDA 4MIMA 2EJAA 2VGIA 1EOKA 1H09A 1AH0A 3PZGA 3ZFHA 1BWKA 2Q01A 4U2ZA 2WB5A 7TAAA 3SCTA 4UMAA 1V3MA 1E43A 3UCDA 3H70A 3KBWA 2V38A 3G3MA 3NDYA 4LBUA 2NQLA 1Q85A 1JZ4A 4DJDA 5I0DA 2ACSA 3MO4A 5M2FX 4NG3A 4QAWA 4HYWA 1VLIA 4NXKA 2YPIA 2PZ0A 2YDAA 1B90A 5GJMA 3LK6A 2OGYA 1V7YA 1FX6A 3P80A 1BYCA 4IJRA 3WJZA 3SCQA 1F76A 3S5YA 1ISXA 3LCHA 5IBXC 1J96A 1YMYA 3GAYA 3SFWA 2QNEA 1DYSA 3ARZA 4JQ1A 2X7WA 3RGTA 3GC5A 3WBWA 1RK6A 3FSTA 3WBAA 4RPQA 3FSUA 4PUMA 3CHFA 3MT1A 4R7JA 4ZMGA 1V02E 3GHUA 3SGZA 2V6AA 4TX9A 1KR1A 3GXPA 1HGYA 3DFQA 3FNDA 4PMNA 2H8XA 2GGJA 1UR1A 3BW4A 3R0KA 3OQ8A 1NY1A 4OUIA 2VWTA 4F0LA 1MNZA 5TAOA 2BP1A 1UKPA 5D37A 3K8KA 3WK0A 1OFRA 4JTRA 5ENLA 3V36A 1VHNA 2XVPA 4KEUA 3VK5A 1UIPA 4TOQA 4PULA 3CNYA 2P5NA 1AW5A 4DELA 1Z44A 2DVXA 4HK6A 4MG4A 3WBXA 4XB3A 3GWQA 1LOSA 3U8GA 1VENA 4LGXA 3W07A 4LQ1A 1O4UA 1R5YA 3E0IA 3GG0A 5I3HA 2PTWA 5JIPA 3L5AA 2C14A 3PS7A 4E3VA 4MWAE 4BFAA 2NUYA 1A0DA 2Y63A 1EKOA 2PA6A 4R5EA 1WAWA 3MS8A 4CQ9A 2WYSA 3UCCA 1FHVA 5D9NA 1A4LA 4B5NA 3SCVA 3PZMA 3VX1A 3E0LA 4GYPA 5IRPA 3KTSA 3V7PA 2INFA 2GJLA 3UA3A 3UGVA 4NNCA 2X40A 1IF2A 3G1RA 4X9SA 2A7NA 5FEZA 5J04A 4LJ3A 4DO6A 2WMGA 2P8BA 3GS6A 1HGWA 3I7SA 1BVNP 4GWEA 1RPXA 2FHBA 2VFEA 2WSKA 2IKIA 1GPFA 2PRHA 4MFDA 1H7NA 3ID7A 4FOKA 5JBFA 4M29A 3VVGA 4W7WA 2E4TA 4YLWA 4QSHA 4RV3A 1W3JA 2IQ0A 2QR6A 1Q6LA 1LQAA 3UP8A 3WL0A 2PRLA 3HQ1A 3DFSA 4AB4A 1KRAC 2F7FA 4RW5A 3QOKA 3HPZA 4PSRA 1XHGA 1E1FA 2FYMA 3L0NA 3QEZA 3VILA 1XYFA 3B97A 4BS0A 4D8LA 1E5NA 1ZS2A 2W91A 2AKMA 5T26A 5C71A 3S4TA 3SGGA 1QOQA 3GBEA 1R9YA 1ZLPA 4DBEA 2OCZA 5FF2A 3V1HA 2R24A 1GOMA 4J3XA 2WSQA 4DBWA 1AVAA 1B3XA 3GIYA 3KRSA 4JN8A 1OFOA 3AS3A 4URIA 3S1VA 1AH3A 3S5SA 1H5YA 3AYSA 1B30A 4FZIA 1PVNA 1SFSA 3PWAA 3OZMA 1XCXA 3BQ6A 4XVEA 3CUXA 3WJXA 5TNVA 3EA3A 2QMKA 3AO0A 3G0XA 5A6JA 3SJNA 4MHBA 5HNRA 4HSHA 5M03A 2TAAA 1GNXA 4GMEA 3E49A 2CLIA 3GXTA 4QGCA 1SMDA 4TX8A 4NI8A 1EYWA 3CO4A 1DTUA 3GYCA 3VIIA 3OIXA 4QLJA 1MYRA 1XH2A 4JCMA 3WNKA 2A4AA 2WZEA 3GDMA 1XSIA 2QPSA 3IIXA 2X16A 1BYBA 3JU2A 4BWLA 2W62A 3MBDA 5AZ1A 1PBGA 1V77A 3TAKA 2WMIB 2B7QA 2VX5A 1BVZA 4NI3A 2V8ZA 4A22A 3GC2A 4XUYA 1ME7A 3A12A 4YWIA 4RV8A 5H91A 4AD3A 1C93A 2XVKA 1MUMA 1XG3A 2VFFA 3CUZA 1SZFA 5C2CA 3W75A 5CJ5A 3CHEA 2VCAA 4FP1A 1OM0A 4NU7A 3S2JA 3MBFA 3VDGA 1GYNA 3W7MA 2PTXA 2RDTA 3CK5A 4J3WA 4ZSTA 3WD2A 3KHDA 1V6UA 3KTXA 4WKFA 1WZKA 3GR7A 4S3JA 4JPGA 2XU2A 3B0UX 3BSMA 1I2NA 3QGAC 3W6MA 3W7GA 5I79A 1M5WA 2ZVIA 2GUUA 4XD5A 1EFZA 3D3AA 1OG0A 2ZZ2A 4ROQA 1JZ3A 2BASA 4DWSD 3GNPA 5A8QA 2XINA 1IGSA 2CZDA 1FY6A 2QCDB 5XIAA 1B9BA 1XYCA 4RXFA 4JIQA 3T07A 3MHGA 1GK8A 3EBVA 1KFEA 1GYLA 4BI5A 4V1YA 3ABRA 1VCFA 3IUDA 3QR1A 2BGQA 4GYJA 4B5SA 4N4PA 5FSDC 2VFGA 1RLDA 1UROA 1FH9A 1KM5A 1OFPA 2XH0A 3T8LA 3MUZ1 1RA5A 2Y62A 5AYZA 1K8ZA 3W0KA 2WAGA 3BLIA 5HR7A 1H62A 1KKRA 2Z2AA 1TWZA 1DP0A 2OELA 1K9EA 2ZVRA 1YPXA 3MUIA 4L4PA 2YX0A 3EWZA 2CBJA 1B31A 4DBDA 3F4NA 3SSJA 4EF9A 2QIIA 2OSYA 3KTCA 3MDUA 4O17A 3GW3A 3ABQA 1NWRA 2G3NA 4O0KA 5BXPA 3VNMA 2ZDSA 2C1IA 4M7TA 5F2IA 2XSBA 4CQCA 3VMNA 5IOBA 3PZOA 4JKKA 5A8PA 1BLIA 1ITUA 1WAUA 3T8QA 2WKLA 2PDFA 2WANA 1U5JA 1Q6OA 4GI4A 2KZHA 4Q4RA 3TXZA 3HZ3A 4B15A 4O14A 4KFOA 3B04A 4ALDA 1R3SA 3PTDA 1XCFA 4IUOA 1DXFA 2ZRXA 4PMQA 2VRKA 4GH3A 3ITVA 3M7WA 2QCDA 1VGAA 5A3HA 4JY9A 3P0WA 2A85A 2FZ8A 2UY5A 4D6EA 2GUYA 2C91A 3ZT5A 3QGVA 3LN3A 1DIDA 4KT2A 3WLIA 4TMBA 8XIMA 5JVLA 4L6OA 4FNPA 2VYOA 2ZZ5A 3P7YA 3EKGA 5A2AA 2QV4A 1K7XA 2PPGA 3A6OA 6ENLA 4ILSA 3HPFA 1VEOA 1W1PA 3G18A 4WVXA 1VFUA 2VJXA 2XIJA 3LV6A 3WEZA 3WX7A 3ITTA 3N3TA 4DYJA 4XZWA 4YHEA 2A3AA 3F5KA 4K38A 1DJGA 2XGBA 1WOAA 1G4TA 5D8ZA 4KCUA 2A5HA 2FGLA 5F2GA 4NNBA 4PR4A 3ZJ8A 3NQAA 1OF8A 3AZSA 4GX9A 4O54A 4MB3A 2XTKA 4QE1A 1TPEA 2YCLB 1QWGA 1J12A 3FJ6A 2FZNA 4TIMA 4C6CA 2NLYA 5CJMA 1Q2RA 4PEEA 4PMDA 3B9EA 3BURA 4LY4A 3XISA 3M5ZA 2TODA 2QDDA 2ZXQA 4JEQA 1E9IA 3M0XA 4KEVA 4YIWA 1GZGA 9CGTA 3EB2A 3P2VA 2EG7A 1ODZA 2WLYA 3HA1A 3QVQA 3VI2A 3WLRA 2J9XA 1KRCC 3FA3A 4A3HA 1HKIA 3FXYA 4HA3A 4UFLA 2ABAA 3I4EA 3QYSA 3UCQA 2Y0FA 3BJTA 2IMRA 1S2CA 2Y5JA 1AA1B 2Q8XA 3UG8A 3ARRA 3VC5A 1KRBC 4JXCA 3ME3A 3TA6A 3GB6A 2GWGA 3BPWA 1TVNA 4HA0A 2ODOA 3GG1A 4PUUA 2W63A 4WDXA 1OADA 3FJ4A 4O8RA 1VR6A 5GQBA 1MDLA 4DAFA 3GHSA 6TIMA 4MB1A 1UD2A 1VP5A 3PPFA 1W1VA 2GLKA 1X7IA 2GOKA 4TVUA 1JGMA 1GTHA 2X30A 1UZ4A 4IIFA 2V69A 1M7OA 1YTEA 1UBSA 1GT8A 2G4JA 2WSPA 3WEMA 2YCLA 3DHUA 1BF2A 1VJIA 3RK8A 4MADA 1KBBA 4AIUA 3QW3A 4K39A 2WNZA 1V3LA 4PUJA 3IUHA 3ARVA 3UFYA 3GYEA 3MCOA 2PDMA 3SM0A 2YFNA 1XFBA 2C71A 5CPOA 3N4AA 1IIGA 1KM3A 2XM2A 4Y8EA 4MGGA 1O12A 4CD5A 3NXLA 4DBSA 3AIQA 3AS0A 4FNSA 5A5WA 4MNMA 2YZRA 4QIUA 2VEIA 1MW1A 4XZMX 1KBIA 1MI3A 1MMFA 4ZE4A 5I02A 5MF5A 1PWMA 1S2WA 3MUXA 1IE7C 3SY8A 3FYYA 4GXPA 5CPNA 1JPMA 1DVJA 4A3YA 4YVXA 5KZDA 1XLLA 4KBXA 1EC8A 1LQ2A 3KVMA 3N34A 2ICSA 4P8VA 5I07A 1V6YA 4QE4A 4HMDA 1HL2A 2Y5EA 1A5CA 1QK0A 3CEUA 5HWJA 5A8NA 5JMUA 8RUCA 3EKZA 3T05A 4IJCA 4O0ZA 1JXJA 4FPSA 4BI6A 1K1DA 3M7SA 1TSIA 2VR5A 4XAFA 3GZAA 5HPCA 3PSWA 2DZPA 2BSLA 1TYGA 3NQVA 4GYKA 2BVWA 2JKEA 3CXOA 4H41A 1BGGA 3W26A 1TZ9A 3RDKA 3STFA 3R11A 4NJGA 1TMQA 4W8BA 2PGRA 4TO8A 5IBXA 2BY1A 2PLMA 5I3KA 4KW2A 1SSGA 1T6MA 3EWXA 5KZ6A 3CZ8A 1XKJA 1F74A 3BWWA 3OGVA 4GIEA 3ABZA 1GEQA 3ZYZA 1FVPA 2BTMA 3H7VA 3CHVA 1FTXA 1GOIA 2V68A 4JNYA 3U5YA 5FD0A 4IG2A 4GVHA 4HNVA 2WNWA 2I57A 2XSXA 5FJRA 1MQRA 1Q6FA 1VYPX 4X60A 5BMXA 2PDHA 3NNTA 2PTDA 4UMBA 3S9ZA 4L6HA 3WL1A 4DO7A 1OFDA 4TV6A 1TR9A 2Z24A 2VEPA 3EDEA 1GG1A 4KQNA 2P8CA 3GLCA 4B2DA 1W2VA 4U3CA 1L8PA 2VDGA 1Q4NX 4AZIA 3GG8A 1UUMA 3JVAA 1OVDA 2PDQA 1L6YA 3FV9A 3QY7A 5LNUA 2D69A 3QV8A 4UFHA 3S2MA 1XYBA 4Q4OA 1TTQA 4NZ4A 5A94A 4O8AA 4KCTA 2EBNA 2CERA 3BJSA 2ZTKA 4GA8A 5AHNA 2O0TA 3CUHA 1L8NA 4GC4A 1TMLA 1SFTA 4UFMA 4RDVA 3TR2A 3WF4A 4QXIA 3CMJA 5AHFA 4H6QA 3B0YA 4GUJA 2GGHA 4GC3A 3CUGA 4GXMA 4JN6A 4POCA 1JPHA 1LLZA 4IL2A 2C7FA 3WIJA 4DQWA 4AFYA 4HD5A 2Z26A 2EG6A 1JNEA 3POCA 3W22A 3EX6A 4GH1A 4Q7IA 4GO8A 1DE6A 3LXBA 3TYZA 2WC3A 3C52A 1OBAA 1ALDA 2VURA 5DF0A 3Q4DA 4AHQA 2R6OA 4H3DA 2V9DA 3IJ8A 1THFD 2O9PA 2QGHA 1YKWA 3CV1A 4KFNA 3SGUA 1QTWA 4V15A 3D5HA 4A05A 3ZO9A 3WFAA 3NCOA 4RJEA 3L21A 4CCZA 3F5JA 3HF3A 4DLFA 4JAWA 3ITGA 1FWEC 1E6XM 2AMGA 1EBGA 1F8IA 3THCA 1YBQA 1RAKA 1FWBC 1QI0A 1TV3A 1ZPTA 2WCSA 1DE5A 4US5A 3HU7A 3SQSA 4UQCA 4RE2A 2DIJA 3QY8A 5FL0A 3V3WA 1OGSA 5HULA 3W2UA 5FEPA 1XIMA 1WDRA 5HQLA 4QQ3A 3LDVA 3MZNA 1GCYA 1OC7A 3P67A 2NQ9A 4DM2A 4FR6A 1KBLA 3ARWA 3TJIA 4UTWC 4JKLA 4C5YA 3U4FA 5F4SA 4A8IA 1UA7A 4PRWA 1F6KA 2DSVA 4CEXC 4R27A 3TLLA 3M0HA 3TJ4A 4RX0A 1JZ7A 2JQXA 2PD5A 2DT3A 2XIMA 1XFCA 5L9FA 5CJNA 4MKVA 3KRZA 1TJ0A 2P0IA 4LVGA 3ZVHB 2NVCA 4W5UA 1YRRA 3QQWA 1KFJA 3EPOA 3KVKA 3REQB 1XM3A 3IJ7A 3VDAA 1BTCA 5I06A 2OWWA 3L23A 1V3KA 1XD1A 2V5CA 4U28A 1W5QA 3M47A 4WEVX 1W3TA 1HX0A 3DG7A 4UTUA 4QJ4B 5FJIA 4IISA 4NAEB 1TWSA 1XYZA 4UUIA 4GIYA 1DTNA 3TE9A 1LYXA 4WQ6A 2VFHA 4DPQA 5A6MA 1A0CA 1QHPA 2PDIA 3NG3A 2DUZA 1LWHA 4K1WA 3H21A 4IFKB 4JD4A 4NZ5A 1FCVA 1CXIA 1VHCA 2PFHA 1U22A 1XI3A 1YEYA 2X0HA 5FIPA 1X98A 3TN4A 1W2PA 2GVJA 1SR9A 3WH8A 4DXXA 4MAZA 2IQDA 3VGFA 5AYXA 5K9CA 3W83A 3NYZA 2OX1A 1DXIA 3KCLA 4LTSA 1IEQA 1ZZMA 4YVPA 3G1XA 4MY9A 4U10A 1UKOA 1VKFA 3ZVHA 1G4PA 3D47A 3NYDA 4HU3A 1GQNA 1XLIA 3F2DA 2FJUB 4HNOA 1EIXA 3O9NA 4RZ5A 3NPXA 1V8EA 1MFUA 3L4VA 3GFXA 2FB2A 1A5AA 1RCOB 1QBAA 4OBTA 3ZQ9A 3KS6A 4LS1A 7A3HA 4IUGA 3HFTA 3N25A 3RCMA 3RN6A 4I9MA 1SO3A 5F4WA 5K4ZA 3LRLA 2YXOA 5KZMA 3PF3A 2Q09A 1XIEA 3TJXA 3QW4B 4NZFA 1IV8A 4PCPA 3HG2A 4LYQA 3T42A 1JFXA 4R9OA 3VOJA 1Y0EA 4GQBA 1X6NA 4AXNA 3U57A 5K4XA 2DSKA 5AKQA 4O50A 1L6SA 4IFKA 2Z1VA 4JQ3A 3LEPA 3WFLA 5LSMA 4TXEA 1H51A 3T0DA 1VF8A 1US2A 3HG4A 4AWTA 2ZWZA 4IIEA 1EF3A 3WQGA 1XLBA 5CC6A 3E74A 3L5MA 4LT9A 2I56A 4MY1A 4X61A 4S2BA 5HMFA 1HNYA 4N9EA 4IT1A 2W66A 1K9TA 4RR4A 4C7FA 4K3ZA 5DY2A 1XLAA 1K7FA 5G1MA 3S42A 2P88A 1EC9A 3IIPA 3L0KA 1IEXA 1D9EA 1KFBA 2YYUA 4QAIA 5K3VA 1UG6A 1OJXA 3VDCA 4ZZ9A 1ICPA 1OD8A 1H50A 4PCSA 3WQOA 3TLQA 4DJFD 4D6FA 2Y89A 2YZ5A 2OEKA 4EK7A 4QS5A 4AHOA 4NVTA 4OU1A 5D9MA 3GNDA 1W5NA 3KBVA 4F8XA 5A6BD 1FKXA 4M6UA 1ZUAX 1UR9A 2DZSA 1RCQA 3GTHA 4NP7A 4NASA 2Y85A 4DI9A 3BLOA 5BU9A 4L1GA 1KNWA 1N55A 5CBBA 1NFGA 5I3IA 1XIBA 3SW6A 1CLVA 1QPRA 5D9OA 3HTWA 2PWEA 4Q4QA 2X2GA 1XDLA 3OBKA 4DWSC 5C55A 4OGZA 1H2JA 1M65A 1R8LA 3EWCA 3WLHA 4D71A 3R8RA 3M4HA 2D0GA 3V0SA 4M5PA 2YL5A 2DVUA 3AXXA 1TX0A 3H8AA 3OVRA 4XQ6A 3SCUA 4D8ZA 5HQEA 3PB0A 1ZHAA 4MB5A 4FOJA 4AEFA 4AD1A 4Q8WA 1DORA 4DNMA 3LCWA 3FKRA 3N11A 3GDBA 2SFPA 1MUCA 4KWUA 3QZAA 5AB3A 5BWFA 4XTIA 3TTEA 1W1YA 1TCMA 4Y9OA 3W25A 1H1NA 4Q22A 2Y8VA 5IFPA 3IGXA 3K8LA 3B0VC 5DT7A 2WJEA 2XFWA 3W02A 2VVSA 1WDSA 1KFWA 2ZRVA 4RPPA 5DO8A 4IIDA 3PM6A 4FIQA 3KBNA 4MUZA 1SZRA 4P7NA 3CAVA 5AYBA 3VFLA 2H3BA 3E3HA 4DF0A 5U4NA 3M0MA 3EXRA 3EX1A 3MVIA 2IPFA 4W7UA 1NTHA 2ZRYA 1AQ0A 4MJ2A 5F7UA 3ELFA 5ABTA 2QT3A 1B3VA 7ENLA 1BQGA 2C18A 1U5HA 1BSLA 5REQA 1R3TA 1PE1A 3TSBA 2J9ZA 2DZBA 4E5TA 1QNVA 1DJIA 2PZNA 2QPUA 3NGFA 3R25A 3WYZA 2C13A 3KAOA 3WLJA 3TZFA 3IV3A 3VNYA 4IF2A 4GG9A 3SECA 2RH9A 2NWRA 1A0EA 1ZJAA 3POHA 3T7VA 1IXNA 4J27A 3N2OA 1QXLA 2H9AA 5I24A 3HJEA 3N13A 4E8CA 3E5BA 2E8YA 1I4NA 2WVVB 3EDFA 1LUCB 3NA8A 1OG6A 4MY8A 3RU8X 1LRNA 5AVHA 5CC7A 3L4YA 1RY8A 3QGKC 3FVDA 4EANA 1NELA 4YCOA 4RL3A 4UFIA 3EWWA 1IR2A 3BSGA 3UXDA 1ZAIA 4I9TA 3QYQA 4D6JA 3TC6A 1H7WA 4CQBA 3M6DA 3W00A 4NX0A 3PANA 3GXFA 3AMKA 4LV9A 1S2AA 2IW0A 4RNFA 4QNWA 7REQB 4L4LA 1IT0A 1W54A 4B3ZA 3FHQA 3WMBA 3GXDA 1U5VA 5F2MA 1LBFA 3EKLA 1ME8A 1AW1A 3FCPA 4FX6M 1J0YA 2QVHA 3UERA 2NQZA 3WH6A 2GVEA 2JF6A 3ZOAA 3IACA 3DESA 3K8MA 1GVEA 2YIHA 2ZUSA 1PHQA 1S5VA 3S2LA 1H3GA 3ISIX 1U1JA 4XV0A 3RMJA 1AMKA 5GNZA 4C6FA 2VGBA 1DQWA 2DDXA 1VS1A 3CGTA 3QPZA 1O68A 2VX6A 5EBAA 1QOXA 4DN1A 5FOOA 3AXIA 3AHXA 3A3WA 5HATA 1C90A 2BB0A 2DZWA 3EWBX 4MNKA 1QCWA 3A4JA 5I03A 1F07A 2PB1A 3RXZA 6XIMA 4EAMA 1UQZA 1KLYA 5TD4A 3WFZA 1L6FA 2YLLA 2UZ9A 3GC4A 3UJFA 1F05A 1O6IA 3KX6A 3OYXA 2HROA 3PBWA 1J5TA 1M7JA 3VIFA 4CKQA 2OFJA 3LHYA 4PUWA 2D2HA 2GFTA 2OU4A 3O6AA 3SFKA 3UWVA 2V3EA 4DNHA 1I60A 1TTPA 2QDGA 3JZUA 2P53A 3BGAA 2JK2A 3W1NA 5I3GA 3AHTA 5AHIA 2Z7KA 3TN6A 3FY1A 4IPNB 1ISWA 2YJQA 2NQ5A 4I8DA 3RCYA 3RPTA 3M0VA 3LXCA 5FJOA 1ZAHA 2G50A 2J7BA 4B5WA 2MUCA 4PC8A 5AYIA 3VKBA 2DY3A 2YBUA 1XIHA 2PDGA 3T78A 3F7JA 1O95A 3F4CA 1HJVA 4MPQA 3AFBA 2TPSA 1BQCA 3W7OA 4AZCB 1MNSA 1TJ1A 4KGLA 4W4QA 1PSCA 4C7DA 3WCZA 1W56A 1H5VA 3UXIA 4JL1A 1HIZA 5TBOA 1QWKA 3C8NA 4IFOA 3NQ6A 3IGSA 4UR9A 3VE7A 2FB3A 1FFRA 5AHEA 3P5ZA 4QHRA 4JX5A 2A3HA 3CT2A 1RBLA 1K8CA 2PDYA 5I09A 2X1TA 3OYZA 3CHCA 4IMDA 3HGOA 3LTPA 1W3IA 3CB8A 3FVMA 1OX4A 1H1YA 1OIFA 5E70A 4IWWA 4DEFA 1KR0A 3ITYA 1AZ2A 5HDRA 3HPSA 2EKCA 5AVNA 1SSDA 4ZXOA 3UY7A 5A2CA 1EDTA 1CYGA 2XG9A 1UWUA 2VMFA 1CGTA 2FVMA 3SRKA 3AAMA 4YTRA 4WY0B 4FNQA 1G01A 1E1CB 1GOKA 2ISWA 3GDTA 2ZBTA 1O66A 4KRUA 1Q6RA 4N9CA 2HEJA 1JG9A 2XIOA 1EC7A 4AZCA 2PWFA 2XVGA 5FF4A 1V6TA 3VIMA 4O15A 1IGWA 3G8RA 1HG3A 2V2CA 4GGHA 3T2PA 4ORMA 1Q6GA 2ZICA 3CQIA 4NRRA 5EU9A 1FWAC 3UYIA 3GDLA 3KXQA 4LNYA 1V0MA 3A4AA 3VPLA 3EXSA 4JIHA 3WQ4A 1XIGA 3NWRA 3DYPA 2Z00A 2FHFA 4LYRA 1JDFA 4HNCA 4UQBA 3UWWA 3T08A 1KC7A 4BKNA 4X63A 3VFCA 1UCWA 2QV5A 2JEPA 1AFSA 3AZTA 3SUTA 6A3HA 4J3UA 1R9ZA 4HSOA 3EZ4A 4AY1A 1CTNA 2HVMA 3K4DA 4U5KA 1S5MA 1JYNA 1Q45A 3S9YA 3GIPA 3LUTA 3MB9A 3M64A 1QFEA 1XBVA 1X1OA 4WY0A 1FWHC 5LIKX 1Y5WA 1G4SA 4INFA 3M41A 5D2TA 1EJUC 3B9AA 4C6OA 5A8GA 1UP3A 3VCNA 2V67A 3MYPA 2VQUA 1M9HA 3R43A 4PL1A 2CKSA 1K4GA 3WMCA 3LM3A 2P3ZA 3U7VA 3MWCA 2YCEA 4PCTA 2XZ7A 2FVKA 4W93A 1IXPA 3VOFA 4IPIA 3AYVA 3L4TA 4OOZA 1JZ5A 1V3IA 3THAA 9RUBA 2O7QA 1KXVA 3H54A 3CAQA 2E6AA 1BWLA 2R1PA 2MANA 3UT0A 4XD6A 3DAQA 4E4FA 2VQTA 3I10A 3PPGA 1W91A 2CEQA 4NZ3A 5HAOA 2BMBA 2J88A 2QZRA 4MWAC 1OZMA 3S2CA 4IIBA 1W3LA 1EUAA 3SURA 4FMVA 4M6VA 2VVNA 1OF6A 2AL2B 4GZEA 2HS8A 3MO7A 1R2RA 4H04A 1UR0A 1G67A 2Y70A 3R1ZA 1E6SM 1OYCA 3PBYA 1ZAJA 4RKAA 2VC6A 3EWUA 4YNGA 5LNVA 3TYBA 2A3CA 1TZZA 1Q6EA 2DQXA 4IL0A 3TQKA 1LLOA 4QSFA 2DJLA 4LPCA 4UTLA 3QKZA 1DJNA 1MUWA 2ZX7A 3SR7A 4QG8A 5D02A 3IJ6A 5DCBA 1LQ0A 5HK4A 4WDTA 4HTYA 3ONCA 2VNCA 1MW0A 3N9RA 1T99A 4DWSB 4K1GA 3AJ7A 3QPYA 1AZ1A 3CJPA 1JIBA 1TQJA 3FGCB 4G5DA 5I23A 2X42A 3QC0A 2R1KA 3HPAA 3W7PA 5C70A 3ALGA 2RAGA 4RNIA 2XIQA 4TV5A 3ARPA 4QLLA 1EJXC 1DHKA 2D0HA 3G1VA 1KCXA 1S2TA 3MI3A 3NL5A 2CLEA 8CGTA 4H8VA 4BEQA 3L67A 1Z7AA 2A7PA 4PRTA 4G6CA 4UB9A 3SCRA 1KQZA 2AL2A 4NKCA 2VZVA 1GKRA 2E09A 2J62A 2PDCA 3M5VA 2HV5A 1OT1A 3K5XA 4M7SA 2UY2A 2RFGA 3CWHA 1J18A 3SUVA 2EPLX 5D2WA 1MEIA 3CC1A 5AECA 4F66A 3CASA 3WK2A 2J13A 3C86A 3N6JA 5D9PA 3AMGA 2PUZA 1QHOA 1HVQA 5G4WA 2FKPA 1W0MA 3EX4A 2Y2WA 3HM7A 2QCGA 2X7VA 3TTSA 4DWSA 2PAJA 4A29A 4R3UA 3I68A 5C8BB 3M43A 1OC5A 1JCNA 1BKSA 3MSDA 3GTIA 2XISA 3BICA 4QJ1A 1KB3A 2J79A 4C6JA 3IV8A 3URAA 1Z48A 1JRCA 3C4UA 2HK0A 4O28A 5CEWA 2OB3A 3VUPA 4ICNA 1AJZA 1V6WA 4S3CA 4CNSA 4MTVA 4GVGA 1RJRA 3LBMA 3MV01 3TFCA 1HW6A 3KBSA 2O9OA 4QEEA 2LLEA 2WMFA 3BE7A 3NPUA 1SJCA 4C6LA 1JYWA 4OKDA 3B8VA 3W2LA 3BG5A 3URQA 4IXXA 1AL7A 2E9LA 4ZSUA 4RDYA 5EY5A 1PZ0A 3LNMA 1ZL1A 2G8ZA 3T1GA 3UJEA 1FKWA 3NQDA 4MDPA 4C91A 4WX2A 1XUZA 4PB5A 2OO6A 3TMLA 2QJJA 1VQTA 4W88A 5BOEA 2W79A 4J3SA 4UOQA 3W28A 1WZMA 1RJQA 1UMLA 1XS2A 4KEZA 2AL1A 3W2JA 2J66A 3QFEA 1TJPA 2H8ZA 4BQ5A 4WIWA 1P0EA 3N6HA 3TSDA 3K4WA 3VZXA 4LNCA 1TVLA 1TWWA 3R0DA 1XDJA 5G1TA 1EEPA 3PFRA 5KITA 1RJPA 4JN7A 3T81A 1ONEA 5CPQA 3C2YA 4PMXA 1TVPA 3FDKA 3RM8A 5LNSA 3I7QA 4ZB0A 1QHZA 3KOYA 4IX2A 4HK5A 3C0JA 3NSMA 1JUEA 4GY0A 1TQXA 4O19A 1VPYA 2WCAA 3QMRA 1R7AA 3DZ1A 1EQPA 3C5QA 3LY0A 4MKNA 1QPKA 3ORWA 2Y1HA 4PTWA 3MPGA 2A0NA 3NEHA 1UD4A 1WDPA 1J10A 4DY1A 4JFWA 3M0ZA 3DC8A 4L9XA 3GAKA 4JFTA 4K37A 3C2EA 3OJGA 3LRMA 1N82A 1PX4A 1OFBA 2ALDA 2CZEA 4H2CA 1FDYA 1XYMA 3HB9A 4NZ1A 4O18A 3NQFA 2FZBA 1SFLA 5A6KA 1GG0A 3EEGA 3G22A 3LCLA 3JR2A 4B9YA 4LC8A 4EXBA 2JKPA 2V81A 1B3OA 4H6KA 5DMNA 3NEVA 1NFBA 4GNVA 3B8TA 2NVDA 1KLZA 1E0UA 1CEOA 4BF7A 2QCHA 3V16A 2ZZ4A 5A6SA 4H6EA 3QRHA 2VR4A 3H2OA 4QG6A 4AYGA 1TRIA 5EMLA 4O12A 1IIHA 3LGDA 4H83A 5PTDA 3P8JA 1SMAA 3N12A 2L5HA 3LERA 1UH2A 5GJPA 5E93A 3VABA 4JTHA 4Q4SA 1QW8A 2ZC1A 4ERIA 3A21A 2C6QA 4JFVA 1TB3A 2Q3OA 5E09A 4HPHA 5HR6A 4RDZA 4G7EA 2ESCA 1BRLA 3WD1A 1RQHA 1TIMA 3HMCA 2AQWA 2OT0A 3IARA 2PBOA 1HKMA 3WD3A 3FYOA 4F4RA 5J5DA 2D23A 2QUNA 3PZ9A 3UR8A 1QRQA 2X2YA 5GVJA 3WH9A 1RP8A 3L2IA 1NP2A 4XG1A 3LPFA 4HPNA 4ZQPA 1WKDA 3M46A 4H8UA 4IZGA 3FX4A 4CN1A 4GGBA 1AUSL 4WRHA 2VX7A 5DCEA 3H4GA 1HKKA 3RM4A 3N29A 1VIZA 1SGJA 5G2IA 3WG6A 1JCXA 4LAZA 1GVYA 3STEA 3R94A 1P6BA 4TVDA 2J78A 3OG3A 1E56A 3S3GA 1SJDA 4RW3A 2I5IA 3R12A 5FJPA 2QJGA 3W1TA 1W1IE 4RK8A 1FWCC 4WGXA 3OHMB 3DG6A 3T0BA 4F2UA 2HPMA 4X22A 2Q6ZA 1V0LA 1LL4A 4GI6A 3VKDA 4J5NA 3WQ5A 4HNTA 3AISA 1W5MA 4Q8UA 2X09A 4Q8NA 4ZO6A 3PVFA 4UQDA 1TV8A 1E0XA 2YDQA 2BHUA 3TYCA 2DW6A 3UG5A 4ZQCA 3RG6A 2PMQA 4MOZA 4GZIA 2DSUA 3W7DA 1M68A 2PLJA 1PTAA 1H7XA 3IJIA 3A22A 1EHAA 1U1HA 1Z89A 1FDJA 2F2KA 1JDDA 1RD6A 3QR0A 4O1EA 1CX9A 4ZA0A 3RO8A 1UZHA 3MQTA 3ERPA 1XLCA 1NM9A 3W4RA 2CPUA 2VRJA 3W70A 4R9XA 1S5NA 3CV6A 1BG4A 1SW7A 4JIPA 4CNPA 1G1YA 4M51A 5KTLA 1J2WA 4HQVA 3W1QA 4FXJA 3S1UA 3TW7A 1ZALA 2FJKA 1R86A 3MC5A 4JS3A 4GIRA 2CW6A 1GQKA 3B8SA 3N6QA 3W7KA 1GUVA 3PB2A 1US0A 1HZYA 4GQRA 3KLKA 5BRPA 3BZGA 1V0KA 3D3FA 1I8JA 2F8QA 3RPMA 2IS7A 2ZOXA 3BARA 4WSKA 1K70A 5BRQA 1Z8AA 3KCJA 2ZRWA 4H1ZA 2A7RA 4WJEA 2V2HA 1PCKA 1QI5A 4GJIA 1XD0A 5D04C 3IJLA 3S6OA 3IJDA 5FJUA 1WE5A 3YPIA 2R1LA 3FW6A 4CQDA 2VZOA 3KDNA 2C1HA 3NVDA 3SIZA 2OG9A 4LCQA 1IXOA 2J47A 3RX3A 2A6NA 4D1IA 1VC4A 1WX0A 1W9PA 1LP6A 2FIQA 2GSEA 4EPKA 3PBUA 1KTCA 1LRTA 4LVFA 4RCXA 2D20A 2V3DA 3LPPA 2PDUA 2A79A 5I7GA 1X7FA 2QJHA 1UJQA 4UTTC 2HNEA 1QU4A 5H6HA 4I7UA 4U3AA 3QZEA 2I17A 1CCWB 2E28A 1EP2A 3GD6A 4AMAA 2CHNA 1Q3NA 3GZ3A 4G56A 9XIMA 3MKCA 1KM6A 3ARQA 5I78A 1C7TA 3OGRA 2OVLA 1WDQA 1QI4A 1O1HA 1UC4A 1WO2A 4QISA 4JQAA 1XXXA 3MHUA 4O1AA 4Q8VA 3CH0A 3GFZA 2F84A 3UJRA 3LM7A 3HO8A 1OCBA 1WV2A 5AOUA 3LG3A 4GD0A 3OGSA 1W3NA 5C0QA 1KBJA 5AC5A 3JW7A 1ODUA 3K46A 3VKCA 2D2GA 4KWSA 3GR8A 1HJSA 1EZWA 4K68A 1NJJA 1N8WA 4GUFA 4AXKA 3VGBA 2VD9A 2BHZA 3VD9A 5BWAA 1QNOA 4L64A 1D8CA 3M5YA 4JCLA 3MTWA 1PIGA 2GK1A 3GUGA 3PULA 3A64A 2EJ1A 4ZQRA 2CLOA 5IHSA 2WQPA 2V30A 1G69A 4QP0A 2NV2A 4ZE5A 2W6RA 3NDZA 4GFSA 2EKGA 4GRSA 4B9ZA 1CNVA 2VX4A 2I9UA 4I8YA 2P0OA 1R6WA 3WMSA 1TELA 2G3IA 2OLAA 5KSWA 3PTMA 1KM4A 2VXNA 5C9ZA 3C8FA 1UUOA 1JZ8A 1XLJA 4YTQA 1L9WA 2Z1KA 4UNLA 1EGZA 5HQMA 3APYA 3L4ZA 1MFVA 1UP0A 2O4MA 5C54A 1BWVA 4JZ5A 4I6VA 1V3HA 2CHOA 4GUHA 3SCNA 1B4EA 4Z1AA 3KP0A 1W8GA 1IEIA 1VIWA 3KOWA 1XBXA 2HVNA 4Z08A 4D8AA 2C15A 4KCWA 1WNOA 1HKJA 2VFDA 4JTLA 3WNPA 3GX9A 1JI2A 3IIZA 2QHAA 1RVGA 3QXBA 4FS9A 1ML1A 4NYUA 3T9PA 3S1WA 4GVFA 1FOBA 4M19A 2PWGA 1XWYA 2O9RA 3CT7A 1FWSA 4WJXA 4Y7EA 3AUOA 1DWAM 4LYKA 3NPWA 2DH3A 2V5KA 1NIUA 3AWNA 1F3EA 4DLMA 2GJNA 5D30A 1ZP4A 5FACA 5BMWA 3TSMA 4GKLA 1CXHA 1C92A 1XPYA 4KCVA 3A9IA 3SSZA 1DJWA 2PU1A 5DRCA 1XGZA 4S3AA 3E12A 4TQTA 1YDNA 4HIBA 3TCEA 2B31A 1ENUA 3NM1A 3EWYA 3H2FA 3HG3A 4HU0A 3EOEA 3ARXA 4I9AA 1W37A 2GQAA 4B5XA 2VWSA 3NL3A 4IGSA 3UVIA 3RMEA 1I9CB 4ZFMA 1X6LA 2CFFA 3M0KA 4ACZA 2PLKA 4EWJA 2CNCA 1W31A 4AVNA 1ISYA 1NAL1 4N6FA 3WD0A 5BOOA 1F4AA 1XCWA 3VKAA 2E9BA 3BLKA 3ECQA 3WN6A 5FL1A 1J5SA 3CWOX 4XO6A 1DL3A 3VM5A 3GE7A 3KRUA 2G96A 4KKXA 3G0SA 4N4QA 4F2TA 5DN1A 1NSJA 1P6CA 5CXPA 4JHOA 3BCJA 4D6GA 1O7AA 3UETA 4GUGA 1F6YA 3M0IA 1M04A 3G6MA 4NT0A 4EACA 1VFHA 2H3DA 5A1AA 1Z9AA 3AU2A 6TAAA 3I6RA 4S3FA 1EF2A 4NHVA 4IMCA 1RALA 1XW8A 3PNUA 3BCFA 2OYMA 3FXGA 2D0FA 1TV2A 4O57A 1X38A 2PD9A 4XBSA 2F61A 4W89A 2OT1A 4PMRA 3UR2A 4D72A 4Y9MA 2YSWA 3OBEA 1G4EA 3PP7A 5FI8A 3QHOA 2ZIDA 6PTDA 3BOLA 3EB4A 3N2BA 1EZ2A 1NU5A 3LHVA 3F5LA 4IIHA 2BXZA 1ME9A 4NL1A 3XIMA 1EEXA 3TYAA 4TU1A 3P82A 3BW3A 1CT5A 5LXEA 1Q63A 5CQ1A 2B7NA 3RR1A 2MNRA 1UOZA 4X3ZA 3W7EA 3LLXA 1XJBA 4NY2A 2EF9A 5H2ZA 4P8XA 4UIOA 3APGA 5FJTA 3LA4A 2VOMA 1G6CA 3MI6A 2Y7EA 1R9XA 4O1CA 1RK5A 1JAEA 4BQ4A 5M1TA 1ADDA 1KCKA 2HXTA 1LOQA 2QUMA 3GVVA 1K3UA 1LCOA 4UR8A 2YDSA 5H8UA 1XIDA 4PEKA 2PTYA 1BSIA 4TX6A 3TVAA 4IQJA 3UPBA 4DJFA 4YCPA 4WY0F 2INEA 3LMYA 1QK2A 1DIOA 3S1GA 4HB7A 1E9ZB 3I6EA 1T8QA 2JBMA 1TX2A 1A80A 3V35A 2D73A 2YL8A 5A6BA 2ISVA 1Q2SA 4WXYA 2XFFA 2CXGA 4AD4A 3LXAA 4PFMA 3FJLA 1XLDA 4CNTA 3TNOA 2QDHA 1VYSX 4EX4A 1SM9A 1YLVA 3TZNA 2RGMA 5EB8A 4E8DA 2CWXA 1JI1A 3CPUA 3TJLA 4LEQA 2X1IA 2AQOA 3N14A 1RQEA 3N2TA 3AZRA 4QM1A 2OXNA 3N9KA 3RPDA 3AC0A 2XN0A 4H19A 3WDHA 1EA0A 5CZJA 3IVUA 4ZO8A 2XSAA 3UZJA 3ZWSA 3HOJA 3OA3A 4HCDA 3VKJA 1K4HA 1Q5MA 2FHCA 1RBAA 1OABA 1UZ1A 3PK7A 1JDCA 4C65A 4LAMA 4HYRA 4KESA 4O1BA 2XGIA 4IMEA 5C2XA 3OQEA 1QO5A 4GI9A 4JOMA 4IIGA 4CCEA 3GM8A 4KIEA 4ATLA 1EJTC 3KM8A 5C6MA 4HHHA 4A8LA 4IMAA 2IXUA 3ZT6A 2O9TA 1LORA 4GABA 4H2HA 2HVOA 5CGTA 3U9IA 1X1NA 1YPFA 4DAIA 3LCFA 2WVTA 2AGKA 4UTIA 4J9JA 4R85A 4UTJA 3C2VA 3RNDA 3VNIA 3W2KA 1IZJA 2NXGA 3R89A 3IGUA 1K6AA 3CH9A 2WHMA 5CSSA 1FWJC 1KCLA 3TONA 3MMDA 2I9EA 4X2RA 3Q45A 5ECUA 4CNOA 1PKMA 3C61A 4OBRA 2WOQA 2ZA3A 1KXHA 4WR3A 4F48A 2J8GA 4AY7A 2GDVA 2BWGA 4HOWA 1TE1A 1PTDA 1VRXA 1A5LC 3A5FA 3L9CA 1PS9A 3PJWA 1FFQA 2GZXA 1JJKA 6REQB 4MLJA 2POTA 3UQNA 5FF3A 3C0QA 4Y9NA 1J9YA 1IEWA 4XISA 4XIMA 2Q02A 2ZYFA 1N2VA 2VHLA 4V28A 4YL2A 4H8NA 2B81A 3WUGA 1XIFA 4BR1A 3O8AA 2OLSA 2W27A 1JCJA 4C1LA 3W7QA 1TKKA 3GKAA 1Q6QA 2ZUTA 4AEOA 2ACRA 1ELSA 4LRSA 4QCEA 3CIWA 3N2CA 1ITQA 2WQDA 5BW6A 2VCCA 3VNZA 5H1WA 1L2QA 2P1FA 3RJYA 3W9ZA 1TPFA 1EPVA 2GJRA 1FWRA 3WQDA 4MYAA 3JUGA 1G0CA 1L6WA 2XGZA 4KERA 4EF8A 2DQWA 3V18A 3WF3A 4C6IA 4JDBA 3OODA 2EPNA 4RZ6A 2DZUA 3MKKA 3TH6A 3DYOA 3GR4A 3SY5A 4K7VA 1J0IA 3VD4A 2A6LA 4C6BA 3AALA 3T6CA 4DXVA 3DHPA 4W85A 2Q8ZA 1T96A 3S5NA 1S38A 1VCVA 1JCTA 2GQ9A 2D1ZA 2NQJA 1DWGM 4JTFA 3UY8A 2XFRA 6REQA 4AMCA 5LHEA 4HYVA 1GPWA 3VKKA 3R79A 4DO5A 1AW2A 3LQGA 3P14A 2ANUA 2DV0A 2FH8A 1TPC1 2HMCA 1UWAA 2OZTA 3SUSA 4CN4A 3KUMA 3OPSA 3GNRA 4KWVA 1LWIA 2F2HA 3R6IA 3R4IA 1EO5A 4Y9PA 3GVRA 2INZA 1YXYA 3BAYA 2JGYA 4CU8A 5LIYX 4RE4A 4ACYA 1OEPA 4Q7NA 1HUVA 1QDSA 2Z28A 3H6OA 1GJPA 1UWTA 2Z1SA 3MJMA 4NX5A 2EPKX 4Z1DA 4JHMA 3VOGA 1POKA 4UTTA 3GU9A 1ZFJA 2E3ZA 4WUIA 4EWND 3NQBA 2J77A 3CS2A 2EPOA 3PPHA 3MMUA 3ZT7A 3W73A 1N7KA 4W87A 3TAOA 3OLIA 3TFXA 4GCXA 3DFTA 2VRQA 1KFKA 1V51A 2NLIA 5F4XA 3MANA 3TV8A 1Q7QA 2CLPA 5BCAA 3WNMA 1OGGA 2OQLA 1E1EA 3W53A 2BBFA 6CGTA 1VLWA 5DBTA 1MDRA 3II1A 3W74A 1Z32X 2RJHA 3ATYA 3NL6A 1MZRA 3W2MA 3DIPA 3KEHA 2GGIA 4NSBA 3V5OA 2ISFA 1DIKA 1XX1A 3VIKA 3G1SA 1TREA 4MJ4A 3WEOA 1MRAA 3M07A 4A3QA 3EMCA 2Y61A 4OBSA 2HQAA 1WKYA 4NAFB 4AVOA 4IX0A 5G4HC 1EUNA 2DU2A 1M03A 2WC4A 3HN3A 3TOYA 3VC6A 1LL7A 3IEBA 4WHBA 3L2MA 5A69A 1EXBA 1RH9A 4IICA 1JCLA 5EMMA 4PTXA 5FJJA 4LX4A 4S2CA 4XIAA 3KBMA 1WQ5A 1T41A 1LBLA 1G7UA 5LYRA 3TP4A 2ZRUA 4UBPC 1PXGA 3IVTA 2C79A 3HV9A 1VFMA 4A4AA 2VENA 3O6DA 2REQA 1H1ZA 3G1FA 1JGIA 1RD5A 3EOSA 3RM9A 1ZSXA 4Z1CA 2ZUWA 4IGMA 4BEUA 2QEZA 2C8NA 3H23A 5B7YA 3W1RA 1JEZA 3A3XA 3BAIA 1ECQA 3CQ0A 5HXMA 5TIMA 4LALA 3ARYA 3SCPA 3CAKA 2GVGA 1UD5A 2XJ7A 4QFUA 4A2SA 5DBUA 4S3KA 2EEXA 1J11A 2Y88A 4N2YA 4E2DA 1U33A 1DJZA 3CO8A 1KFLA 3AS2A 3HG5A 1OIMA 2IPWA 1KBKA 3H2CA 4NAFA 4NYYA 2FDMA 3IVSA 2XWDA 4XTDA 3USZA 3M6YA 3SJ3A 3MUY1 4GACA 5G5IA 5BU6A 5LGXA 4FI4A 1SW3A 4BA0A 5JIWA 2JIEA 1LL6A 2E7FA 4OWGA 2G3JA 3V5FA 3AWOA 5D33A 2ZUUA 4I5XA 4MVAA 1ADSA 3S5OA 1M3UA 4US6A 2O55A 3SAZA 5K9XA 3OG2A 1HJQA 6XIAA 1VJZA 3PR2A 3QOMA 1SFJA 3IUIA 1AD1A 1LOLA 2DSWA 1GGOA 2PURA 2V5LA 3WQPA 2JF7A 3WO8A 4Q3MA 2OSXA 3NO3A 2CZFA 4ZXLA 1GZ1A 1RLCL 1X96A 4AYSA 1UP2A 1QR7A 1EJ7L 3MKVA 1FCBA 3HQOA 3LHTA 4DYKA 3CHDA 2CLKA 2QPXA 5C7HA 3EX2A 5DCDA 4OJYA 4Q7BA 2Z6IA 3NIYA 4UTKA 4PCFA 4IP5A 3A4XA 4GY1A 3OVQA 4I6KA 3UPMA 1ICQA 3BDKA 3SQLA 5KEZA 3WH7A 1XLHA 3UZWA 3N4FA 3ITXA 4TTGA 2FFIA 4LUYA 7TIMA 1ZGDA 4J7RA 4S3BA 3N15A 2XH2A 3TA9A 1J79A 5BXTA 1E3XA 2PC8A 1W6TA 3GNNA 5M5DA 2OSWA 4B16A 4ML4A 1ZY9A 1IR1A 1PKYA 4W8LA 1GQIA 1YXCA 1GVRA 3T0AA 3VD3A 2C0AA 1UQYA 3M16A 2Z4GA 4QEHA 3AS1A 4Q6XA 5D8WA 1LT7A 2J7FA 1ZJIA 1QNRA 5FAJA 4R34A 1R2SA 3RHGA 3STGA 3UGRA 2QUTA 1P43A 1WZLA 4ASTA 4HU8A 4ADTA 4H00A 3M5XA 1TO3A 2PDBA 3TQPA 3H26A 3OIHA 2WM1A 3MSYA 5AYYA 3VNDA 4DM1A 4FNTA 3FIGA 5XINA 4F3HA 5CPLA 1L6GA 3SO7A 1ZTVA 2RGLA 5D09A 3CEPA 4FF7A 2ZFAA 1JULA 1QASA 4S38A 3TYUA 5KZEA 1XRVA 4OUEA 3N73A 4HZ6A 1UWIA 1E70M 1A5NC 3GXMA 3L12A 4UQEA 4U5IA 3MA8A 4P8WA 3ATZA 1H4PA 5CZTA 3RRXA 5ABGA