5EKYA

Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
248
structure length
248
Chain Sequence
DLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARETLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAWGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Mechanism-based inhibition of an aldolase at high concentrations of its natural substrate acetaldehyde: structural insights and protective strategies.
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 248
sequence length 248
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ekyA00
3CLMA 1F7BA 5I3JA 3DFSA 4U28A 1CW2A 3O6YX 3RLUA 4RK8A 1BWKA 2H8ZA 2B7OA 1SO5A 4JYEA 3GKFA 3UPWA 2CWNA 1LM1A 1VS1A 3TH6A 2Y7DA 3ANYA 4UFIA 4Y8FA 1Q6OA 3RK8A 3LHYA 3NQ8A 2YX0A 1TPH1 5I3GA 3GKAA 4X9SA 3W7LA 1TSIA 3TAOA 3OA3A 4IUOA 4MY8A 3DBPA 3B04A 1WOBA 4DBDA 3C3NA 2EAWA 4IPJA 5AC7A 4UTJA 4O50A 1DHPA 3I65A 3B0VC 2E5CA 4HNVA 3BG3A 3DKLA 1RPXA 4FNRA 1A5BA 2FDSA 2NX9A 2DZUA 1QWGA 4G1KA 5CZSA 1A5AA 3EX2A 1WOAA 1ME8A 2ZCGA 1PL9A 1H63A 4UTIA 2YW4A 3DXIA 4JDYA 4L4LA 3YPIA 4O13A 3CU2A 2YGYA 2R94A 2VEKA 5D33A 1LLZA 3G8EA 3O16A 3LXAA 4RXGA 1OFBA 2CLIA 2H8XA 5AC6A 4N9CA 3QYQA 4O15A 3H54A 3QEZA 1RQEA 5K4ZA 2ZRUA 4WY0F 1YTKA 4LVBA 4O12A 3BK0A 1EB3A 3I7QA 3DH7A 1K3UA 1TREA 1QMLA 4W9TA 3WJXA 1N55A 2ZRZA 2QKFA 1P5BA 5F2MA 1OVDA 1HTIA 3KXQA 4I7WA 3TSMA 4MJZA 2FPVA 3LB0A 4WZHA 4N02A 1FY6A 3HIJA 1TTIA 4FX6M 1JCNA 1VJIA 2OX1A 3TKFA 5K7JA 4KFNA 3L5LA 3NGJA 4JTFA 4N9BA 2W79A 4AMAA 3ABQA 4YCOA 5TQLA 3ZWSA 3P8IA 3VI2A 3O6CA 4LY8A 3BARA 1XUZA 2ABAA 4QISA 4K8HA 1TMHA 3E02A 3BLFA 5LNVA 2NWSA 2H3BA 1KM1A 1EUAA 3MYOA 3FJLA 3TV8A 4MY9A 2WJZA 1ZNNA 3ABSA 5LGZA 2VFFA 3TCEA 3M9YA 2EF9A 2YCEA 4KFPA 3MI6A 5IBXA 3USBA 3NAVA 1TQJA 2DZSA 2OT1A 3OVQA 4NNBA 3NL6A 4N6EA 5G4EA 2V82A 1MZHA 4GUGA 5E93A 1FWSA 4UXDA 3UWWA 2G97A 4ALDA 5FF2A 3BG9A 1IXOA 4L4MA 3PBUA 4JYDA 3HOJA 2QAFA 1WAUA 4K36A 1JRBA 3HF3A 5AYXA 1H1ZA 2FIQA 1ALDA 2CFFA 1ZAHA 1OFDA 3PAJA 2GVLA 1SPQA 2NZLA 5HQEA 2X1SA 3BW2A 3C52A 4MUZA 4GFSA 1WBJA 4PFMA 1I8JA 3L5MA 3W70A 4YLWA 1X1OA 2TSYA 4HPJA 5DBTA 3W2JA 3W75A 3C8FA 4MIMA 1GEQA 4M6QA 5HJLA 5BMXA 1TV8A 4O11A 3G0SA 1FWTA 3ZR4A 1AMKA 3GVGA 1UASA 2ZBTA 2WSRA 1E51A 1WV2A 2OZ0A 3LCIA 5K9DA 1W54A 3TXZA 1QO5A 3IEBA 1EP2A 3MBFA 2JGYA 3LCGA 1JQXA 3DZ1A 2Y7GA 1AL7A 4M6PA 2QCNA 4WQ6A 3HPSA 1LRQA 4IGHA 1YLVA 4X22A 5EPDA 2GUUA 5EBUA 5H2ZA 4AVFA 4MJMA 1FXQA 3N3MA 2CLOA 4X3ZA 1UBSA 4XKYB 4ORIA 5D03A 4K6AA 4MYAA 4OQVA 3VFLA 3ZWTA 4WD0A 3S0CA 4KFOA 1SUXA 2O7SA 1YPFA 2Y61A 4C1KA 4RCXA 4QITA 4M6VA 1OF6A 3M6YA 3MUXA 5AN7A 5BMWA 2NX1A 1Z44A 1VPXA 3W76A 4BI5A 1OFRA 3R89A 3STEA 1KBIA 2LLEA 3F4WA 2XN0A 5KZMA 4O54A 1DBTA 5CG7A 2QUUA 1KFKA 2J9YA 4O1DA 1EX5A 2D73A 3MYPA 4O28A 3RLVA 1G7UA 1IXNA 1RV8A 4PTNA 3GYEA 1WQ5A 2ZZ3A 3NQFA 2Z0IA 2WPBA 1YPIA 1J5TA 1F76A 2ZQ0A 5KZEA 2CLEA 3BW4A 3C6CA 4O4VA 2OJPA 3TC7A 2Q8LA 3LOTA 3IVSA 2QR6A 1THFD 5F1VA 4IX2A 1KM3A 5J5DA 4O0KA 2TYSA 4FIQA 4P2VA 1R2SA 3L21A 4LS1A 2GVJA 5KINA 1VCFA 2OT0A 1OK6A 1BWLA 1ZAJA 3MJYA 4NJJA 1IF2A 3KAOA 4A2RA 3P8JA 3HG5A 1MXSA 4LRTA 2F84A 2GJLA 3ZFHA 4EF8A 3P61A 3C2RA 1QAPA 1GZGA 7TIMA 4GRSA 3GDTA 3R2GA 1XC4A 1OJXA 3M44A 4UNLA 2CLKA 1SZNA 2ZA3A 1W56A 4O1CA 2JBMA 3TAKA 3C4UA 4MKNA 1GG0A 4IOTA 2A5HA 3S1XA 4E38A 2WNQA 2V5LA 4OV9A 4RJEA 5HR7A 2QCGA 3V1PA 3TU9A 1C29A 1DKWA 2JKPA 4XWUA 5DY3A 4ZMGA 5AOUA 4HKPA 3TNOA 5C54A 3MHFA 3O06A 1YXCA 3LRLA 5AB3A 4HIBA 4ONVA 3QJAA 1H61A 3W1TA 3LTSA 1NSJA 3IRDA 2ZRXA 3LRMA 3G0XA 2HMCA 4DF1A 3RNDA 2C19A 4XBKA 4DO6A 2F7FA 3HG4A 3DI1A 3N19B 1W5OA 3G1DA 2CZEA 1FCBA 4NT0A 5AHLA 1OX6A 4ZQOA 3S8HA 4CLMA 3A5VA 1NEYA 3HB9A 1OFQA 1JULA 2DP3A 3MHUA 3GX9A 2VFGA 1NF0A 1FWWA 3M43A 5BNKA 5KTLA 2PE4A 4B5NA 2RDTA 3H55A 3PSVA 3LV6A 5G1YA 1XI3A 1KTNA 4FNUA 4M5PA 3DHDA 1V5XA 3P74A 1VGAA 3LDVA 4JYFA 5F1UA 4FNTA 1KFCA 4AF0B 3SW6A 2H3DA 3PULA 2A0NA 3Q37A 4O57A 4NZJA 1TPWA 3W7EA 1PE1A 3W88A 4UTHA 2PRHA 3W1RA 3W7MA 3G24A 3L65A 1WBHA 4OU1A 5AYZA 1W3TA 1VZWA 5FI8A 1FXPA 1W5NA 5DN1A 3W2MA 3QZEA 1GYLA 2ZYFA 3KFTA 5DBUA 4A22A 4YCPA 1LLWA 4LOCA 5I3HA 4XKYA 1T0OA 1VR6A 2E77A 3BLEA 1GVFA 3MHGA 1W5MA 1P4CA 1J4EA 1GQNA 1JCJA 4EOUA 2XN2A 1LDCA 3LLFA 1LOQA 4UUIA 4UTLA 4AHOA 3PUEA 4MVAA 3DKJA 2CW6A 5FF0A 3G22A 2Q8ZA 3HO8A 1I2PA 1LP6A 4OV4A 3NQCA 4TMCA 4Y6GA 2DJXA 3W1LA 4UTTC 4MYXA 3WJSA 1XCFA 2CLLA 3TA6A 2X1TA 1BKSA 1AG1O 3FLUA 3W3OA 1SU5A 1VHNA 1ICQA 3LCXA 3PB2A 3MI3A 1QPRA 2ZZ7A 1IIGA 2GVGA 1KW1A 2G5WA 2RDWA 3I68A 3NQAA 3NQVA 4LS0A 2V2CA 3TQVA 1XBXA 4RX0A 4CQAA 4H6KA 2WOQA 5D2VA 3TQ0A 4CNOA 1GPWA 1J2WA 3ABRA 3NOEA 3S5ZA 1R30A 2X30A 5F4XA 4EVZA 3PWAA 2ALDA 1SW0A 2DU2A 2DZWA 3DI0A 5E0KA 4UTTA 4IMEA 2ZDRA 1ONRA 3NQGA 2CZFA 4PCFA 3L0NA 1YYAA 3KVKA 1OYAA 3G1HA 1QNVA 1TO3A 1I2NA 1VYRA 2P0OA 2BTMA 3T55A 3MWAA 3SGZA 1VCVA 3FFSA 4JXCA 3NQMA 1Q6RA 3B06A 3HGJA 3HGOA 4NU7A 3FKKA 1I45A 1LOLA 1WYIA 5FF7A 2QCFA 4BF9A 2Y6ZA 4JGDA 4ADUA 4FEZA 3IIZA 1G6CA 4AXKA 2VENA 4UTWC 5KMYA 2VELA 2X16A 3LM7A 2V81A 4GXMA 1KLZA 2H6RA 1V7YA 3KRUA 4Y96A 5EMUA 4UC5A 3W6YA 4S2CA 2Q3RA 3BGGA 4Z0SA 5ABTA 4AHQA 1F5ZA 5FESA 1LBLA 5U4NA 5AHIA 3LI1A 5LZLA 2IQTA 3LHZA 3OHIA 3QC3A 4YXGA 4LU0A 5FEWA 3PVFA 3IIPA 2CLHA 4JD4A 3GAKA 4NQ1A 1GTHA 4UTKA 1AW5A 3G1VA 3NO5A 3G3DA 2QEZA 1QFEA 4N9EA 4CQ8A 3M41A 1RVGA 3EX1A 4AHPA 5G4WA 1R2TA 4IJBA 1U5JA 1BTMA 3LERA 4UTWA 4OWGA 1N7KA 4XUGA 5EKYA 3G1XA 4MFDA 5BRBA 1C8VA 4S1FA 5D05A 3C2VA 3NPVA 1IIHA 1W3NA 3NYZA 1QDSA 3VE9A 5DCBA 1SR9A 2EHHA 2B7NA 3GK0A 8TIMA 5A8GA 3IIXA 3CB8A 2A7PA 3O07A 3VCRA 3E0IA 3QPZA 1K03A 1TPFA 1XDLA 3N9SA 2GQAA 1KM0A 4DELA 1ML1A 4NJKA 2BXVA 4O16A 3S1VA 3SIZA 2X2GA 5G2IA 2QCMA 3P80A 2OMAA 3VE7A 3W2UA 2BX7A 3UYCA 4UMAA 3WJYA 2PURA 2HS8A 3QSTA 3W7OA 4PL2A 1KM5A 2J6XA 4NVTA 4PODA 4N4PA 4A3UA 4IXXA 1Q6LA 4JTTA 4TO8A 1GTEA 1TB3A 3GXTA 4H4IA 1PVNA 2XFWA 4RXFA 1R47A 4JEQA 4HHPA 1MEWA 3TDFA 1EUNA 2WKJA 3G18A 1XBVA 4FB7A 1QPNA 4UMBA 3W2NA 3W7HA 2WO5A 2PRLA 1TTJA 4D2JA 4GUFA 3W07A 3G1FA 2ZFAA 1UB3A 3TIMA 2E5BA 3HG3A 1W37A 1OYCA 1TPVA 2AQWA 4A2SA 2ZZ6A 3T40A 4NZFA 3V75A 2OCZA 4Z1CA 2V0TA 2QJHA 3W83A 5IBXC 3I6RA 2Z2UA 3O15A 4JTSA 1Q6QA 3TX9A 1I4NA 2QJIA 3A22A 5D2WA 3HGSA 2Z6IA 1KTCA 3ATZA 3SFKA 3EWBX 1G4EA 1H62A 2W0UA 4K37A 2E6AA 1M7PA 1XKYA 3UY8A 3O05A 4R53A 2NV1A 1TPC1 2NXHA 1TYGA 2I9EA 3NZ1A 4CCCA 1EWEA 2QCDB 1HO4A 1TCDA 1U83A 5D30A 4QSHA 3P5YA 1MSSA 3DGRA 2FB2A 1L6WA 3QRHA 4Q4KA 2FB3A 3QH2A 3C0JA 3UWVA 2DORA 3QMTA 3CT7A 3HPXA 1AW2A 3TR2A 1UUMA 2C14A 5EL1A 3MP4A 4MY1A 1XL9A 3JRKA 3OVRA 4QQ3A 1H7OA 1XFBA 4YL2A 4R33A 4A29A 3W87A 5D38A 5FF4A 2I1OA 1S3HA 2ZZ4A 3HG2A 1SFJA 1LRNA 3EKLA 2BWGA 1ZJIA 5DY2A 2WNZA 3KVJA 4TR9A 1KA9F 3W1MA 5LSMA 3RU6A 1JR1A 1WXJA 3NQ2A 5KZDA 4WXYA 5DCDA 3G1AA 4JS3A 2CLFA 2DZXA 3SGUA 5LNWA 3HPZA 4HT3A 5U7SA 1KFBA 4Q33A 4I7UA 3VNDA 3P7YA 3EX3A 4LNYA 4WXZA 3QSRA 3PG8A 1F74A 1Q3NA 4IMDA 3UWYA 3SJ3A 5HMSA 2FPTA 1TPEA 1Y0EA 1JUEA 3IGXA 2VFEA 4RZ6A 3LTPA 1H51A 3W73A 1SZEA 1KFEA 2E6YA 2AAMA 2GQ9A 4UFLA 2E09A 2CLMA 4LRSA 3S1WA 4HSOA 4JTJA 3W84A 2TMDA 3GNNA 3TW6A 3TSDA 3KX6A 1EP3A 3CEUA 4NJGA 3N14A 4O53A 4QAIA 4E2DA 3EEGA 1H50A 3EWYA 4FIRA 5H91A 1OFAA 5C6MA 2ZZ5A 3I7SA 2C15A 2PRMA 5CSRA 1I2OA 5LGXA 1GWJA 3RF9A 3N9RA 1GT8A 3KRZA 4LV9A 4MLJA 1W31A 3CHVA 4KKXA 1S5VA 3C2EA 1Q45A 4UFJA 4JTEA 2V5BA 1OFPA 3BGJA 4OE7A 2BZNA 2QUTA 1OG0A 1TJPA 3M5VA 3MP5A 3O8AA 4K7YA 3QF0A 4QM1A 1S5WA 2QDGA 2YPIA 4FNSA 3EWXA 1VHCA 5K2ZA 4GBUA 4LWWA 5CZ0A 4NXKA 2QJGA 3M5YA 3JS3A 1K7XA 1R46A 3W1PA 3PG9A 4UNKA 3Q2DA 3W9ZA 1Z48A 5K4XA 4JTKA 1LRTA 2A4AA 4ZQNA 4LVFA 2YW3A 1MO0A 3TK7A 1L6SA 2FLIA 5DCEA 3BO9A 1KTBA 2R91A 4U4MA 3OEXA 1PHWA 3GXNA 3ATYA 4PL1A 1DQWA 4O10A 3UD6A 1SW3A 4HSNA 3A24A 3S6DA 1DJNA 4NJIA 1LCOA 2E5DA 2Y88A 2QCDA 2ZZ1A 3L0GA 1B4KA 1VLIA 4E0CA 2J88A 1KLYA 1MEIA 3E12A 4ADSA 5MHBA 1XUUA 3NL3A 3LLDA 4AB4A 4HPXA 1O94A 1B4EA 1LTDA 3BG5A 3TSBA 1JUBA 3U6WA 1I2RA 1ICPA 3UXDA 1YXYA 2NV2A 2UV8G 2J27A 4JIPA 3M47A 3W7NA 3W7CA 1L2UA 2R8WA 1NF7A 3W85A 1GJPA 3P67A 3W74A 4BFAA 2Q3OA 3QMSA 3UPBA 1XBYA 2Y89A 3LBCA 3DAQA 3PF3A 4Z1DA 1G67A 3A21A 3T4CA 4Z1BA 2V9DA 5TIMA 4GWEA 5AC8A 1YDNA 2C6QA 1GYNA 2YYTA 5TBOA 5DXYA 2VFIA 1M6JA 4MZ1A 2I14A 3O63A 4K39A 3W7PA 1IGSA 2VKZG 1JRCA 3N2MA 3WK0A 1UCWA 3QFEA 1SO6A 4DF2A 3HMJG 3W71A 4UMCA 4WUIA 2FTPA 3NA8A 3A9IA 1X6UA 1FWNA 3W7RA 4RLIA 1NAL1 1A5SA 2Y70A 1GVOA 3ELFA 4OBTA 2P10A 2QCLA 5HULA 4AWTA 3DFQA 3QW4B 2ATMA 2QCEA 3NVTA 3LHWA 1OX4B 4BK9A 2GQ8A 3P81A 1N8FA 5G5IA 4JX6A 1ZENA 1KV5A 5GVJA 1VC4A 3LHTA 4TMBA 1TJRA 2H90A 1F6KA 3E9AA 3T7VA 5FF3A 4JDBA 3N73A 5AHEA 4O4WA 3R12A 3TROA 3MBDA 5LKYA 3INPA 5IM51 4MLRA 5DELA 4KWWA 2C1HA 3TFXA 5G1TA 3QQ0A 3NQEA 3FS2A 4XBSA 1ZCOA 3D0CA 4IQLA 4RV8A 4X2RA 1ME7A 1H5YA 4O1BA 3L5AA 5HUOA 4ORMA 2XN1A 1CX9A 3WJWA 5AHMA 3DFPA 1EWDA 2YZRA 3UNDA 1TIMA 2WSQA 4Y90A 3GDMA 3MMTA 3K30A 3STCA 2J9ZA 4BI7A 5KSWA 1FBAA 4FXSA 1SO4A 5HUPA 4IPIA 2G96A 1IXPA 4CNPA 2QAPA 3ABOA 4O1AA 4R34A 5LNUA 3THQA 1FDYA 1P0NA 2C3ZA 1QPOA 3DU0A 3WK2A 3GNDA 4FNPA 4FX7A 2NUYA 3CIXA 5CGQA 4WX2A 5LHEA 1RZMA 1XXXA 3C61A 4CCEA 3G1SA 3STGA 3B05A 3DHFA 3LI0A 4RZ4A 3GAYA 1FCQA 1DOSA 3M1ZA 2VXNA 2QF7A 4NJHA 3C2OA 2A1YA 4ZL1A 4N6FA 4O19A 2X1RA 3EWWA 3L66A 3EB2A 2A2IA 3EWUA 4QNEA 1QCWA 1QOPA 3AO0A 3QW3A 4AWUA 1TTPA 1WA3A 2YR1A 1L6YA 3W1UA 4TIMA 3THAA 3IVTA 4BWLC 3CTLA 1KBJA 3NL5A 6ALDA 3FYPA 1AK5A 4UCGA 3QMRA 4GNJA 3QPYA 2VOMA 1OHLA 4PC8A 4O17A 1T99A 5HWNA 5I3KA 3GR7A 3CQ0A 4DPQA 5T26A 1UJPA 1PIIA 3MO7A 1B3OA 1B57A 5F2LA 1H1YA 1KFLA 1D3GA 3Q94A 5D2XA 2NXGA 4NNAA 1TTQA 5C5YA 4UR7A 4BWLA 1W1ZA 1ME9A 1JQVA 1O5KA 1I2QA 1SW7A 3MI2A 3KVLA 3A5FA 1KM4A 3EWZA 1VRDA 2JGQA 1D3HA 1F6PA 4OHQA 1OFOA 4N9DA 2FQIA 4AF0A 1VYSX 3P84A 1OX4A 1GG1A 4AAJA 2VEIA 3L9CA 3DENA 3TFCA 4JR5A 1PCWA 3SZ8A 3HGRA 3W1QA 3JR2A 3PC0A 4S2BA 1HO1A 2YFOA 3W7DA 1QO2A 1R2RA 3CWOX 3L67A 2DJLA 1KFJA 4BR1A 4JNMA 2CU0A 4AEOA 5L9FA 4ZQMA 2YXGA 4GUHA 4ZZ9A 3GR8A 4ML9A 1SZGA 1WX0A 1YDVA 5F4SA 3GDRA 2ZZ2A 5HWMA 1GOXA 3CC1A 4IX0A 4LC8A 1CI1A 4JTGA 3O6DA 2EPHA 3CIWA 3EXRA 3S1UA 4Z08A 3U2OA 3FYOA 4DXVA 1T96A 1FQ0A 1M7OA 4IMCA 3B8DA 3LTYA 5BOOA 4LV4A 3SSJA 1FCVA 5AYYA 1GVQA 2Z1BA 1XBZA 1EEPA 2WSYA 4DBEA 5DXXA 4LVDA 2B7QA 3PS7A 4LC6A 3LXBA 1P1XA 4LVAA 1M5WA 1TPUA 1JJKA 4JTHA 4GUJA 1G4SA 5C55A 1TV7A 2GOUA 3QQ1A 2HSAA 2G95A 1BEUA 2YDAA 1A5CA 3HBLA 4DO5A 1DQXA 3F03K 4M7TA 4O52A 5CZJA 4C1LA 1H7NA 4J9JA 2A7NA 4RZ5A 1K8YA 1RQBA 1DL3A 1OABA 4CCDA 1TRIA 3OVPA 1SO3A 3NQDA 2DZTA 3NEVA 2QUVA 3PR2A 3W86A 4A21A 3FOKA 3OBKA 1DORA 2C18A 2V8ZA 2Y63A 3PBWA 3F1QA 5D09A 3NG3A 2ZA1A 1JCYA 2Y62A 4JX5A 1ADOA 3P5ZA 2ZA2A 3W72A 1O5XA 2DZVA 3EX6A 2O7QA 3IIOA 1FUYA 1MEHA 3WJZA 3NPUA 3GLCA 3T78A 4FHAA 1O60A 3UXAA 2RH9A 1LROA 1W3IA 1ICSA 5LNRA 1VQTA 3C2FA 3RFAA 1KV8A 3FEMA 5BW6A 2V2DA 3G8RA 1H7XA 3B4UA 3A23A 3LCWA 5DLCA 3M7WA 1D9EA 2GJNA 3BVJA 4YWIA 5KITA 3WFAA 1DV7A 4IWWA 4O14A 4GUIA 3LGEA 2Z6JA 2A6LA 1LBFA 6TIMA 1H7RA 3GDLA 3NXFA 3EXSA 1KM6A 2CZDA 3MP3A 4UR8A 3IGUA 1A53A 3LHUA 4OT7A 1SFLA 1SQ7A 3NDOA 3P62A 3NQ7A 4M7SA 4Y9AA 4ADTA 4MZYA 2EGZA 1TRDA 4IMGA 5EYWA 2ZRWA 4TX9A 1K02A 4QIUA 4Q32A 4NXSA 3TE9A 5J5RA 1XM3A 2WQPA 3QM3A 2A7RA 3PB0A 4ZVJA 3T44A 3PUDA 4JICA 3S5YA 4GE8A 4JTLA 3UQNA 4JY8A 3TW7A 3TJXA 4M19A 1DVJA 2RHGA 3FA5A 4UFHA 3PBVA 2E1DA 2YFNA 1VCGA 4AWSA 3BLIA 1K7FA 1K8XA 4DO4A 5F4WA 4WY0B 5LHFA 1TV5A 3UY7A 3M5XA 4QJ1A 1YDOA 5CPNA 3UWQA 4LTSA 1HUVA 1G4TA 2AGKA 2KZHA 4P61A 1SSGA 4WOQA 3LXCA 2EKCA 2NXIA 3W2KA 2B0MA 3W7QA 3NPXA 2ZRYA 1G69A 3UWZA 3KHJA 1P0KA 3CPRA 3GDKA 2NUWA 2Y7EA 4Z1AA 3LRKA 3W7IA 2FFCA 3HJZA 4UIOA 5CSSA 1HG3A 1OFEA 3R13A 1F73A 3LBMA 3SY5A 3LCLA 1O95A 4ICNA 3I7RA 4E2BA 3KRSA 1VH7A 4FNQA 3W1XA 1EA0A 2A6NA 3C56A 3PSWA 3MW7A 3E96A 1TPB1 1ZAIA 3LCHA 1VLWA 4O18A 1LORA 3W1NA 4OGZA 4DPPA 1T8XA 4MZ8A 4K38A 3W7JA 3M0ZA 5I3FA 1OF8A 1FDJA 4IXHA 1W0MA 3EX4A 5F2IA 3U8GA 4LVGA 3PY2A 1QOQA 1KM2A 2HS6A 5CPMA 1W5PA 3VKJA 3UZJA 5HR6A 4JX4A 5D04C 1JVNA 5G2WA 2W6RA 4DEFA 1ZALA 3BPWA 4LUIA 3L68A 2PC4A 1VYPX 2V2HA 3L0KA 1JCLA 4JN6A 1PCKA 2BLEA 5FEZA 2VEMA 2V30A 4N2YA 4MFEA 1X1ZA 1K8ZA 2ISVA 2P1FA 4H3DA 4LUJA 3W1AA 5LNSA 1ZY9A 1LZOA 1ZHAA 2BSLA 4UTMA 2ISSA 3SR7A 3SI9A 1YTEA 2B7PA 3S9YA 3IGSA 2JK2A 4PA8A 3F4NA 2GPTA 4FO4A 3TMLA 1JCMP 3PUOA 1JUKA 3FKRA 3NQ6A 3W7KA 3EKZA 2RKXA 3B0UX 5AFDA 1TPDA 4CNNA 4ZQPA 4AH7A 4HNUA 4WJEA 3PM6A 4NNCA 5G2HA 1X7FA 4HN4A 4O8RA 3G3MA 4POCA 4NUWA 3NPWA 3R8RA 4R7JA 2X1UA 3M16A 2CZ5A 3UZ5A 3LCFA 3W22A 3P82A 3M5ZA 3OG3A 1RD5A 2NUXA 1FX6A 4KWVA 4XQ6A 3TJLA 5FEPA 3ZS4A 3GB6A 4O0ZA 3BV4A 1LBMA 3TXVA 3S5OA 3IIVA 4DF0A 4ZQRA 5HWJA 2C0AA 5SWUA 4JY9A 1G7VA 4JTUA 2VFDA 1QPQA 3G1YA 4K7VA 1B9BA 1DJQA 1FCUA 4GJ1A 1PV8A 4QNWA 2JKEA 3NM3A 4NX5A 4UFMA 5F2GA 4LW7A 2Y85A 1RQHA 2C16A 1JCXA 3RMJA 2E68A 3AJXA 3DFOA 4XTIA 1AL8A 3NZRA 5HINA 4NX0A 2QDHA 4CQ9A 3LV5A 1EP1A 1FWRA 3E49A 3G0UA 4WY0A 5FEXA 2NLIA 3NNTA 4HNTA 1S5TA 3BW3A 2ATSA 1GVRA 2PCQA 2TRSA 3B0PA 4Z0JA 1O4UA 2WV8A 2FPYA 1EIXA 5D32A 2B4GA 3GZ3A 1Z42A 1HFBA 3H53A 5CPLA 4WOZA 1C9DA 3OIXA 3GXPA 5E1QA 3N2XA 3FJ6A 4RKAA 1SZFA 1Z41A 2QCHA 2E6FA 3IV3A 5A5WA 3FIGA 1K7EA 3SECA 4JIQA 2YYUA 2VEPA 5AHFA 5CZTA 5K9XA 3WK3A 1FDZA 2ZTJA 3WK1A 1UUOA 3L2IA 5HNRA 3LX9A 4EWND 1EPXA 3NR0A 5CPOA 3TMQA 2A85A 4PEKA 4JTIA 3CWNA 2WNNA 1X8FA 4EF9A 2ABBA 3STFA 4RR4A 1OK4A 5EA9A 3TUUA 2ZTKA 3PBYA 4FX8A 3TQKA 1H7PA 3W7GA 5D2YA 2C13A 4MOZA 1XDMA 1H7WA 2YSWA 1F05A 2FJKA 2QCCA 1SSDA 5K9CA 4IMFA 3TC6A 4HNNA 1A50A 1OX5A 3DFNA 4XZ9A 4XTDA 1L9WA 2JKAA 3UWUA 3DFTA 3S5NA 4EIVA 1LYXA 2Y7FA 3B03A 5AHNA 3W2LA 3GIYA 2ZRVA 1H60A 4GC4A 1NFBA 5CKSA 3NM1A 1HL2A 1W5QA 1YXDA 3KVMA 2TPSA 4FF7A 2A21A 1ZFJA 2RDUA 4K8EA 2E6DA 3Q58A 4LT9A 1AW1A 2NX3A 3KOFA 2DZPA 4I7VA 4TU1A 3W23A 5K3VA 1LOSA 4BI6A 3O1NA 5D37A 4UTUA 5C2XA 4YMZA 5L6UA 1W8SA 4FXRA 4MPQA 1G4PA 4N4QA 2ISWA 1QR7A 4DQWA 1NVMA 4ZQCA 4LS2A 5I3IA 2VC6A 3LHVA 1PS9A 1YADA 1F2JA 1GVSA 1OYBA 2RFGA 3N34A 1YTDA 5D2TA 2VFHA 4UFKA 3P60A 1IXQA 5D02A 3CEPA 4I9AA 2NWRA 1PHQA 2J24A 4PH6A 3EXTA 3CM4A 3NL2A 3R5EA 2J9XA 5EY5A 2HTMA 3S42A 3IVUA 1TQXA 1RR2A 1WDWA 3HQ1A 2R14A
chains in the Genus database with same CATH superfamily
4XSMA 2V5JA 2W5FA 2XDFA 1CNVA 1FHDA 1CXIA 2GSJA 4U28A 1MXDA 3AOFA 1BWKA 1NOUA 3GKFA 1AH0A 1TFVA 3BOFA 3UPWA 4U5KA 4Y8FA 1Q6OA 3LHYA 3NQ8A 3ITVA 3LQGA 1RBAA 3GKAA 1QW8A 2PGFA 4QLLA 2FFIA 3OA3A 2Z7GA 4J40A 5DMNA 4GBDA 3ZOAA 4GQGA 2QF8A 4DBDA 1E6QM 1XLAA 4XV0A 3NZGA 3B0VC 4BA0A 1HP5A 3DKLA 2YDRA 1A5BA 2XH4A 1WP6A 2V3FA 2NX9A 4G1KA 1QWGA 4F40A 3EX2A 3OU8A 1EPVA 4CN4A 1GVIA 1CXEA 1H63A 4UTIA 2YW4A 4MJ2A 4JDYA 4JFSA 4PTMA 3HFYA 5AC6A 2G41A 2DQWA 1UKPA 3CMGA 5TNVA 3AYVA 3OTRA 5K4ZA 3SCNA 4GH1A 4WY0F 3QC0A 1QI5A 1CEOA 1MFVA 4JIIX 1QMLA 4W9TA 3VC5A 1L2QA 1ZS2A 1N55A 5HAOA 4C6MA 5EMLA 2Y2WA 2W61A 3MMDA 2FPVA 4N02A 2HBXA 3IACA 2HQAA 3CUJA 4FX6M 1JCNA 4V15A 3BAIA 3UJFA 1ENUA 1TVLA 3N12A 4KFNA 1PWLA 5TQLA 1M7XA 3O6CA 3CHCA 2X0HA 3M0HA 4B16A 4QISA 3L4XA 3T42A 2NWSA 3CO8A 2H3BA 3SN1A 3MYOA 1Y5XA 2WJZA 1Y5WA 4R3UA 4H8HA 1BAGA 3ABSA 2VFFA 4AVOA 4US5D 3VKKA 2EF9A 3QHOA 4BQ3A 1B2YA 3USBA 2BY2A 4NAEB 4I8DA 1MUMA 3UJEA 3UWWA 2G97A 4ALDA 5FF2A 4UQ9A 3PBUA 3FGCA 3W25A 3HF3A 3I4EA 5AYXA 2FKPA 1A0EA 4C5ZA 4F9DA 2BDQA 1SPQA 3H2EA 1IZCA 3HPAA 5B7ZA 4Y7EA 1CXFA 5A6BD 4CEUC 5ABFB 1YBQB 1T8QA 1R3SA 1XYCA 2TSYA 4HPJA 4S3EA 4DLFA 4X61A 1J0KA 1EJ7L 4MWAD 1FH7A 1DIOA 1AMKA 1QK0A 5C71A 2W66A 2WSRA 2OZ0A 2VHLA 2GGHA 3LCIA 1Z89A 1X38A 1UW9A 3SQMA 1QO5A 1JDAA 3CIVA 2ZUTA 1EP2A 6A3HA 1Q8JA 1JQXA 2YB1A 1UR9A 3DZ1A 4M6PA 3CL6A 4WQ6A 1MQQA 4PTDA 5LYRA 4IGHA 2GUUA 4AZHA 4DNMA 3H4XA 1JPIA 4ZTYA 4B4FA 2GGIA 1K9FA 4DJDA 4J35A 2CLOA 4ROPA 2E28A 3MC5A 4ORIA 4NYYA 1SMAA 4IQJA 4KFOA 3HV8A 3MUXA 4FOUA 2NX1A 3GNOA 1Z44A 1X39A 3N04A 3W76A 1OFRA 3RPMA 3F4WA 4M51A 1QHZA 1DBTA 2J9YA 3KOZA 1M68A 4O1DA 2D73A 3MYPA 1G7UA 1UOZA 3GYEA 4B5UA 1W9VA 2OEKA 3RPDA 5KZEA 5AYIA 3JZEA 3BW4A 1QI4A 3LPFA 4DM2A 3IVSA 3SRFA 2QMKA 2EKGA 4IX2A 2DW6A 1C91A 1JIBA 1PO9A 2TYSA 1R2SA 2UZ9A 3L21A 2X0SA 3T9PA 4Q8UA 1M7JA 3MJYA 3MY9A 2FTWA 3MUY1 2B31A 1YX1A 1T6MA 3WLTA 3WQFA 1QAPA 4GRSA 2PS2A 2OWXA 1Q66A 4B5XA 2X2YA 4ASTA 2WBGA 1U30A 1N8IA 2Z1VA 2ZA3A 1W56A 2FVMA 4K1WA 4RE2A 2OYMA 1U1JA 4B5WA 2A5HA 4BCEA 2V5LA 5HR7A 1C29A 1FWDC 3TNOA 1XIMA 2PWGA 2PDFA 3O06A 3GH4A 5M3WA 3LRLA 5AB3A 3UZYA 3H23A 4REQB 1NSJA 1FWAC 3KBJA 4DF1A 4ZO6A 1KGXA 2C1IA 2YCLA 2GSEA 4RNJA 2CZEA 2ZVIA 4F2TA 1LF1A 4U2ZA 4NT0A 3OLDA 2ZVRA 1OX6A 4GGBA 3ZQ9A 4ZQOA 4CLMA 1NEYA 2DZBA 1OCNA 1MW2A 1OFQA 5BNKA 3NUKA 1NF0A 2VCBA 3EA2A 1TE1A 1E3ZA 3IARA 2F2HA 5G1YA 1KTNA 2GUYA 4FNUA 3RCMA 4M5PA 4DY1A 3DHDA 4XSLA 5G1MA 4UCFA 1VGAA 5FJTA 3LDVA 5BWFA 3U2CA 1XLCA 3POCA 4AF0B 3SW6A 5CLWA 4NZJA 1F8IA 3GTFA 3PJTA 5M03A 4QGCA 3DEQA 4TTGA 2BVYA 3M0MA 2PRHA 3MDWA 4UTHA 5DEZA 5JH1A 3KBNA 1GYLA 4A22A 3KCOA 1PZ2A 5I3HA 3IJ6A 2VGIA 2E77A 3BLEA 3QV9A 5T9BG 1REQB 1GVFA 3MHGA 4HTBA 4GJIA 4YTSA 2XHYA 2RUSA 3LLFA 3MCNA 1I0BA 3WG6A 5C0QA 1DP0A 1UD6A 4AHOA 1S2WA 4MVAA 2CW6A 2GDVA 3NQCA 4Y6GA 2VM8A 3EB3A 3W1LA 3LPPA 2XGIA 3TA6A 4IFKB 3W3OA 1ICQA 1S2TA 1XYFA 3GXMA 1M04A 1IZJA 4J27A 1R3VA 4W86A 5E6YA 2QMJA 2REQB 4D72A 3CZKA 3R11A 2WOQA 5D2VA 4L5ZA 1V0LA 4CNOA 1F4HA 1XG3A 2EBNA 3NOEA 5DT7A 2J7GA 1JAEA 3CAQA 3OVGA 3EBVA 5E0KA 1ONRA 4NAFB 4PTXA 2CZFA 4AW7A 4PCFA 3L0NA 4P8WA 1DXFA 3G1HA 1LL6A 4EAMA 5LXEA 4J3ZA 4EACA 1A3WA 2OFJA 4YTQA 3CS2A 3CUFA 4FR1A 3B06A 3HGJA 3KBVA 4YU1A 1VENA 2ACUA 4U33A 4EXBA 5FF7A 4HMEA 5CLTA 2ACSA 2QCFA 2Y6ZA 4JGDA 3STPA 3I10A 1G6CA 4GABA 4PRTA 2VELA 4GXMA 3JZUA 4Y96A 3CH9A 4UC5A 3FK4A 3S3GA 4Q8WA 1CWYA 2W92A 1R85A 5FESA 5U4NA 5LZLA 2IQTA 3O3RA 2FZMA 3QC3A 4LU0A 2DV0A 1J0YA 3OZPA 4KRZA 2CBUA 4W87A 5FJIA 4IGSA 3KWXA 3B0XA 1QFEA 4CQ8A 1R2TA 5C7HA 3LERA 5EKYA 3TR9A 5DRIA 1QT1A 4WJXA 4WDTA 2DVTA 4U5IA 3LGGA 3RU8X 5A2CA 1BPLB 1XCWA 4L6HA 4G56A 5EBAA 4UWMA 3KW3A 3O07A 3TYUA 4DAFA 2VGFA 4M81A 4F48A 3E38A 1HJXA 3QPZA 1K03A 3R8HA 3N9SA 1HQTA 3RILA 1FH9A 1JZ8A 3KM8A 1ZLPA 2X2GA 5D8WA 4D8ZA 2DT1A 2QCMA 2OMAA 1ODZA 1UR0A 2Z1SA 4AZ6A 4B90A 3WJYA 3WZ0E 4ACZB 3WQPA 1UZ1A 2R6OA 3ANVA 3QR1A 3WUGA 2IPJA 1J0JA 4JTTA 4G7FA 4BY3A 4A8NA 3VIMA 1Z3NA 1MNSA 1QPNA 5E9AA 4Q8MA 3W2NA 5G4HC 2WO5A 4D2JA 1E6SM 4UBPC 3W07A 5BYWA 1UB3A 2E5BA 2WSPA 1OYCA 2AQWA 3T40A 1VP5A 1PIGA 2V0TA 3V5FA 1B31A 3W83A 4ZR8A 3RXZA 2NSXA 1BSLA 2WZMA 3DX5A 3BXWA 4KRUA 3S46A 2Z6IA 4BQ4A 4H9TA 4CQCA 2W0UA 2BGQA 4TV6A 3O05A 3PBMA 2Q71A 2XM2A 4JEJA 2DT0A 3NZ1A 4OOZA 2J13A 1HO4A 3WH7A 3H7RA 5CJ5A 3QRHA 4Q4KA 3QH2A 2WANA 3A6OA 1K9DA 3VIFA 3HPXA 3GE7A 4GYFA 1ESWA 4JL1A 3ZJKA 3MP4A 4MY1A 3FEQA 1H7OA 4R33A 4A29A 3W87A 4JNZA 5D38A 5FF4A 1YE6A 4D1IA 1QXLA 5CJNA 3T8QA 1SFJA 3ZIZA 1CB2A 3EKLA 3GBEA 2EQDA 1X7IA 1ZJIA 3WF0A 5JBDA 1J01A 5IRPA 3O0KA 3GNRA 2WXDM 5LSMA 3RU6A 1WXJA 3QYSA 5DCDA 1MYRA 3B8UA 4G2DA 1K8CA 1W9UA 4DWSA 4AC1X 3VNDA 4IIBA 2FVLA 1GK8A 4QE5A 4LQ1A 3FA4A 2E4TA 4PBGA 2FPTA 3S2NA 1J0HA 2AQVA 3GG1A 1QBAA 3LTPA 1HVQA 3N4AA 4B5TA 1CCWB 1KFEA 2AAMA 1HJVA 4JTJA 1CBGA 3GNNA 4BEQA 4KWOA 3TSDA 1ITUA 2WYSA 4NI3A 1PKLA 4QAIA 3EWYA 3BANA 4FIRA 5H91A 1W1PA 3WQ8A 4HGXA 1GWJA 4S3GA 1EDGA 4JCMA 2XISA 3CHVA 1S5VA 3CQKA 3UR8A 2V5BA 2EPNA 4H83A 2WBKA 5HQLA 2HRWA 5E09A 1ZBKA 1R3WA 1NDWA 3M5VA 3O8AA 2HJPA 4LCRA 2YPIA 4FNSA 3LLXA 1F9CA 5I0DA 1CXHA 2XSBA 1GKQA 3BAJA 2QJGA 3JS3A 3FX4A 2PZNA 4MPKA 3Q2DA 5K4XA 3IUHA 1GOMA 2YW3A 2VZUA 1L6SA 6REQA 3N11A 1KD0A 1VJSA 3OLEA 1HN1A 3KCLA 3ATYA 3U9IA 4PL1A 3WKZA 3O9NA 1DQWA 4MWAE 1DJNA 3OGSA 4O1EA 3MUIA 2ZZ1A 3E5BA 2J7EA 1B4KA 1W9BM 4E0CA 3EDKA 2QNEA 1XUUA 2VRJA 2O9TA 4RL3A 3I3EA 5PTDA 2YBVA 1UC4A 4HPXA 4W8BA 3VMPA 4HHLA 3U6WA 4KWSA 2PGWA 4CNSA 3M47A 4HPNA 1BKHA 3W7CA 2XINA 2PB1A 3W74A 5A3HA 3L23A 4BFAA 3UPBA 1PKMA 1XBYA 2Y89A 3LBCA 3DAQA 1JFXA 4Z1BA 4L4OA 5AC8A 1YDNA 4ZEPA 1DXEA 1GYNA 3PZMA 5DXYA 2XVGA 3WNNA 4QQUA 2I14A 3O63A 2VKZG 1YPXA 2Q09A 1JRCA 3VDCA 1UCWA 5FA5A 1HIZA 4URIA 2WKGA 3QFEA 4NHVA 4DF2A 4AIOA 3D47A 3MA8A 2FTPA 3NA8A 2HPIA 3A3HA 5I24A 1FWNA 3W7RA 2PLJA 2Y70A 1S38A 5LA1A 1SJAA 3CH0A 2QCLA 1R3YA 2XSAA 3SRKA 3QW4B 1Q5MA 2ATMA 2QCEA 3NVTA 4TQTA 1ZENA 4M0XA 4LBSA 4IP7A 2DIJA 3LHTA 4TMBA 1TJRA 3QV7A 4K3ZA 3SN0A 3RX4A 3AHZA 2INFA 4JDBA 5AHEA 3H6OA 5D4YA 3N17A 4R9OA 4LEQA 2NW0A 2G37A 4MLRA 3TFXA 4JKLA 3ARWA 5I09A 3QQ0A 2NQHA 4XBSA 3D0CA 3H4WA 3V36A 1JPKA 3ITYA 8CGTA 3L5AA 4IFRA 4ORMA 2ZDSA 3VXGA 4PMQA 5DFAA 4IJCA 2QW5A 3UNDA 1WAWA 1L6GA 4ZBCA 3K30A 3T2OA 2J9ZA 4US6A 4FXSA 4J3WA 1SO4A 4W4QA 3ZVIA 3CUIA 4CNPA 2QAPA 1JDEA 3UEQA 5LNUA 4NYUA 4XKMA 2E8YA 1UA7A 3DU0A 3WK2A 4AD3A 3APGA 3T05A 4FNPA 2NUYA 4JKMA 4KCWA 1OCJA 1BYCA 5LHEA 1RZMA 2FMNA 3C61A 4WIWA 2BY0A 5GQBA 1W1VA 4H6QA 4ZODA 4E3VA 3ZJ8A 2A1YA 1RPKA 4ZL1A 1RBOB 1V3MA 3EB2A 2A2IA 1DQUA 3EWUA 1QCWA 1M1BA 1QOPA 3QW3A 1R7OA 4Q4MA 1VD6A 1WA3A 1L6YA 2OXNA 1EO7A 4DIAA 3W28A 3W1UA 2IQDA 4GXPA 3ECQA 4WSKA 3CTLA 1KBJA 3FYPA 1K1DA 4GNJA 4Q4QA 3QPYA 2Z00A 1OHLA 4PC8A 2FYMA 5HOSA 5I3KA 3GR7A 5C9XA 1UJPA 1XSJA 3GIQA 3ZMRA 3N4EA 5F2LA 3VOFA 2POTA 2YDQA 3KHDA 2UY2A 3OJGA 4QE4A 1OC7A 4IUGA 1XYBA 1OQFA 1IWPA 4WSJA 4UR7A 4DWDA 3S4TA 4LFYA 4JN7A 1JQVA 2GDQA 1SW7A 2ACQA 3F7JA 3L12A 3P3BA 1DWGM 1OFOA 4Q3MA 2FQIA 3P84A 2PLMA 3THCA 5FL0A 3L9CA 3MVTA 1W91A 2IS7A 3SZ8A 3HGRA 3W1QA 5CH9A 4Z2HA 3BJTA 4UQAA 3W29A 1QO2A 1R2RA 1X6NA 3CWOX 3OGVA 1R7AA 4BR1A 5H8PA 5M5DA 3UG8A 2YXGA 3IK4A 3GR8A 4ML9A 5FOOA 1WCGA 1SZGA 5F4SA 2NQLA 2QUMA 4QJ3B 1UR3M 2ZZ2A 1H1NA 1CI1A 1PDYA 3O6DA 2EPHA 3CIWA 3EXRA 1F6YA 4Z08A 5REQA 2D0GA 1FQ0A 2ANUA 1V93A 2YB4A 4ZB5A 1J6PA 4V2XA 1BLIA 4J7RA 3SSJA 4L9ZA 1L0PA 1GORA 2WHMA 3GUGA 4AZ7A 3TYZA 4D6CA 4LC6A 1M5WA 4JTHA 2Q01A 4P8VA 1K9EA 1KB3A 3RUBL 3T07A 5CC5A 4M1RA 3E0VA 4MKSA 3AZSA 3M07A 1FOBA 3APYA 1A5CA 3WNPA 1DQXA 3F03K 1LQ2A 4M7TA 1I9CB 2A7NA 4DUVA 1W1A1 5A6LA 1K8YA 3GG8A 2D69A 2O9PA 2TAAA 4CCDA 1RALA 3ZT5A 8RUCA 1SO3A 3UCCA 3AHTA 3NQDA 4C6BA 3TJ4A 1RXOB 1QJWA 2QUVA 3PWGA 3TVAA 5D9NA 3MUAA 2Y62A 3P5ZA 4PTVA 3W72A 1C7SA 4OTKA 4HU4A 2O7QA 3IIOA 1GW9A 2V3EA 1PB0A 4JQ4A 1TUFA 4JFTA 3EKGA 1ICSA 1GW1A 1XLFA 5JMUA 4LYPA 1A3HA 3DG6A 1I6NA 3F5JA 2DDXA 2DEPA 3C2FA 4MMWA 2IKGA 4W5UA 1KV8A 3FEMA 3RFAA 3FXGA 1H7XA 3RCNA 2GJNA 2ZUMA 1DV7A 1IEQA 4U3CA 4OUEA 1XG4A 3BMVA 3CTTA 3BZJA 1LBFA 3GDLA 3EXSA 2CZDA 2PWFA 2KX9A 3IGUA 1A53A 1UHVA 3KBWA 3GH7A 3I3DA 2PA6A 3P62A 4BS0A 4PFHA 4MZYA 2EGZA 2QUNA 1IEXA 3A12A 4TX9A 3QFWA 2ZX5A 5J5RA 3PUDA 1KQYA 5IFTA 3TW7A 4M19A 1Z8AA 4UZSA 1EJXC 4ZO7A 1ZPTA 1UD3A 1AJ2A 4DO4A 4PCSA 2DSVA 4IIHA 5CXPA 2CESA 1TV5A 3M5XA 4QJ1A 3UWQA 1AJ0A 2R1PA 1G4TA 2AGKA 4P61A 3WLMA 1E40A 1EBGA 3IJ7A 2EKCA 5BROA 2QJJA 2BV9A 4ZA0A 3NPXA 3PTMA 2ZRYA 3B9EA 3L7RA 4DJEC 1P0KA 4TVDA 3CPRA 4PCTA 1UKOA 5M1TA 4B9YA 3BAXA 3HJZA 2CLPA 3ALGA 1RAKA 5CSSA 5CPQA 1OFEA 3R13A 4CN6A 3O2LA 4G7EA 2HVNA 1GNXA 1GHRA 1DHKA 2OQHA 3GRIA 3BLDA 3LCHA 3OG2A 4IFOA 3ARTA 1LORA 2MUCA 4C1NA 1SMDA 3QHNA 1UZ4A 1NH6A 5I3FA 4H7VA 1W0MA 4ZO8A 4RE4A 4LVGA 1KM2A 2HS6A 3HMCA 2H9AB 3H70A 3R0UA 5CPMA 3WL1A 4JX4A 2W6RA 5KETA 4PYSA 3BPWA 4ERGA 4J3UA 3UCDA 4QG6A 1DWAM 1VYPX 2V2HA 4JN6A 2BLEA 1QNSA 2OEMA 2V30A 1PYFA 4MFEA 4LCSA 2P1FA 1K8ZA 1N2VA 1E0TA 1LZOA 1ZHAA 3SR7A 3WH6A 1WE5A 1Z9AA 2GPTA 1C9WA 3QOMA 1JCMP 3E5PA 4AC7C 3NQ6A 1E4MM 1HL8A 3EKZA 5AFDA 1TG7A 2WVSA 4ZQPA 3MUZ1 4B91A 4HNUA 4GY1A 4NNCA 1ODUA 1X7FA 3G3MA 4POCA 1TE6A 3N4FA 3WLJA 3RG6A 3UZ5A 2DZAA 2NUXA 3ITCA 4J28A 4JTCA 3RO8A 5FEPA 3E2SA 4KIRA 3VAVA 4Z42C 1OGBA 3BV4A 1E1CA 3KLKA 3IIVA 2EG6A 1H41A 4HCLA 3RLGA 3G1YA 4UOQA 3VOGA 1KCZA 1NP2A 2JKEA 1VEPA 3BQ6A 3PFMA 4NX5A 3XINA 1RQHA 2YCKX 3SBFA 3VMOA 3SEPA 2DUXA 3DFOA 4XTIA 3NZRA 2WC3A 4JOMA 4NX0A 3TA9A 3LV5A 4PMRA 4BQ5A 4AD0A 1CLKA 4AZGA 3MJMA 2NLIA 1OCQA 2J8GA 3V0SA 1S5TA 3CYJA 3SSZA 8XIMA 2RDXA 1ZP4A 4KEVA 4LAUA 1O4UA 2WV8A 1EIXA 2GK1A 1RH9A 2B4GA 4WDXA 4GI4A 1Z42A 2CERA 5CPLA 4YHEA 1MZRA 1C9DA 5E1QA 2O55A 4P5UA 1Z41A 3W53A 3IV3A 1CXKA 3FIGA 1K7EA 2VR2A 4JIQA 2PDJA 4MTVA 2PDKA 4FI4A 4HCHA 4ECLA 1ONWA 1JXJA 5CZTA 4B5VA 3EPNA 2QVHA 1FDZA 5CAKA 3CZ8A 4DBUA 1Q4NX 3AC0A 4V28A 1JGMA 4EWND 1YDYA 4XX6A 2FGBA 4GPNA 1KXHA 1UWSA 3NR0A 3TMQA 4US5A 3V7PA 4IGNA 2BHUA 2ABBA 4WGHA 4HZ7A 3VKDA 3PBYA 3VABA 4MOZA 3IJIA 1HL9A 2C91A 3LMYA 5GJPA 4L4PA 3VOHA 5K9CA 5HQMA 3DFNA 4XTDA 4A3RA 3DFTA 4IMAA 4MWAC 5MKGB 3S5NA 4EIVA 3B03A 5AHNA 1AMYA 2GOKA 1A47A 4D6GA 1HL2A 4ZSUA 1VBJA 4A4AA 5BXSA 3WF3A 1IYXA 2QYGA 2TPSA 6ENLA 1M9HA 1ZFJA 2PC8A 2RDUA 2E6DA 1AW1A 2OEJA 1RCOB 5CBIA 3WMLA 2XVNA 1LOSA 2VX6A 4YIWA 3O1NA 3S47A 4MWAA 2VD8A 4UTUA 4M29A 4YMZA 5L6UA 1XD1A 4FXRA 4MPQA 1QR7A 2WK2A 4GVFA 4X9YA 3VOIA 4H19A 3NSNA 1GVSA 4ZB0A 1V6WA 1QNPA 3BLKA 3P60A 2XVKA 1GKPA 1PSCA 3M0VA 4PMVA 1VEOA 3CEPA 3DYMA 1GOKA 2J24A 3CM4A 3R5EA 5EY5A 2FMOA 3IVUA 1TQXA 2WVVA 3SY8A 2I9UA 3H7VA 4C65A 3U4FA 2G8ZA 2Z4GA 3CLMA 1ISZA 3PP7A 2VZTA 3ITTA 3QKZA 4XD3A 3RLUA 2BNJA 4RK8A 2H8ZA 4JYEA 1XR2A 4QRNA 2VWTA 4XUYA 2DH3A 2CWNA 4XVEA 3TH6A 4HOZA 4K1GA 1V3KA 1Z7AA 1J2BA 1HKKA 2YX0A 1TPH1 3URBA 4S38A 3AMGA 4X9SA 3EAUA 2E0PA 3ZLGA 1PTGA 4MY8A 3FSTA 2PDLA 5BXRA 1RK5A 1WOBA 2OU4A 1YW1A 4ENLA 3ZYZA 3C3NA 4IPJA 5AC7A 4MNJA 1IE7C 3I65A 2E5CA 3BG3A 1L6FA 1V7AA 4NZ4A 4FNRA 2PZ0A 2E1WA 2DZUA 2QJMA 4QFUA 2ZICA 3UFYA 2ZCGA 1JZ5A 4QJ4B 4L4LA 1UWQA 2PDMA 2NVCA 4O13A 2R94A 1O6IA 4WEVX 5D33A 2YL5A 4RXGA 1OEPA 1X97A 3B3DA 3VDGA 3QYQA 3H54A 2OZ3A 5I78A 1RQEA 3LS9A 2ZRUA 4XAPA 4MB3A 4LVBA 3F5KA 4HYRA 4O12A 2XH0A 3I7QA 3PZGA 2X7WA 1TREA 1E72M 3ERPA 3BICA 3CUGA 4GVIA 3RM4A 1P5BA 2PCEA 1EQPA 4LAZA 3RGTA 4I7WA 3VU2A 1ZGDA 4MJZA 3ARXA 3LB0A 4ATWA 5A8OA 2CITA 3BOXA 1TTIA 1LWHA 1XHGA 4E4FA 1D2KA 2OX1A 3VZYA 2QLYA 3TKFA 3L5LA 4AMAA 2W79A 1D8WA 4GHRA 2VRKA 3ABQA 2QVNA 3ZWSA 3VI2A 1E43A 4MGGA 2VR5A 4AD4A 4WDWA 5LNVA 1B3XA 3VDHA 4ZE4A 5C9RA 2G4FA 4QBXA 3CZGA 1TMLA 1E55A 1Y8BA 3GVQA 3TCEA 3M9YA 5A1AA 4S39A 3RYSA 3H2NA 3QBUA 3VVGA 1VBGA 1BD0A 2CHRA 1TQJA 3OVQA 2OT1A 2YDSA 3NL6A 3M0KA 1UIOA 1NJJA 2Z2BA 3H4GA 5E93A 1EIBA 1MW1A 4H1ZA 3MVIA 1UQYA 2E9LA 3BG9A 4M80A 3F2CA 1XQLA 3AJ7A 4K2SA 2DVXA 4DYEA 3T2PA 2QAFA 1XIHA 1JRBA 4IG2B 2R1LA 2CFFA 3DFYA 3KDOA 4RE3A 2GVLA 4RDYA 1XIDA 2YBUA 3BW2A 1J11A 1YNPA 3LPOA 3NFUA 1I8JA 3L5MA 4MSSA 3CL7A 3W70A 4Q8TA 5CGTA 3W2JA 1GGOA 2Q02A 3VNKA 4C6QA 5HJLA 5BMXA 3WENA 4O11A 1QI2A 4FMVA 4AG0A 2D23A 3HM7A 2IUZA 4HNCA 1E51A 1WV2A 1E1FA 1QUMA 4EK7A 3WFZA 4JHMA 3TXZA 1BGAA 4R88A 1UWAA 2UY5A 4DB7A 3IEBA 3LCGA 4XZNX 1DJZA 4DX3A 4ICMA 1XP3A 3HPSA 1RUSA 1LRQA 1YLVA 2HVOA 1HX0A 4LUTA 2HVMA 1R9XA 4MJMA 3N3MA 4X3ZA 3ENLA 2E9MA 4XKYB 3UYIA 3BUVA 3II1A 5FIPA 2PBOA 4GVHA 1RCXB 1O7AA 3S0CA 3QZ6A 1SUXA 1UUQA 1YHTA 2PLKA 1E3XA 1KRAC 2Y61A 1SJDA 3MSGA 3TYCA 5BMWA 3SUTA 4BI5A 5EU9A 1XPGA 3RLHA 1KBIA 4PEEA 5KZMA 5CG7A 2BY3A 2QHAA 1LUCA 1KFKA 2VVSA 4O28A 4J1OA 1IXNA 1W2PA 1RV8A 1GHSA 4HVXA 1WQ5A 3KOYA 3NQFA 2WPBA 1JFHA 1JXKA 1OD8A 1UROA 3C6CA 4O4VA 2OJPA 1EXPA 4LH8A 2Q8LA 3DGBA 5F1VA 5JIPA 1VFSA 1KM3A 4O0KA 4GI6A 4Y9MA 3LNMA 2GVJA 3NCOA 1XF0A 1BSIA 1VCFA 3GXDA 1OK6A 1ZAJA 3MCOA 4NJJA 1IF2A 3P8JA 4PUJA 4LRTA 4EF8A 3C2RA 1TX2A 1GZGA 4Q6JA 2GVEA 3GDTA 4ML4A 4GA8A 3WBXA 1OJXA 2PSNA 2G3MA 2CLKA 2DT2A 4NAEA 3N6JA 4ZGYA 4MKNA 2ZWYA 4IOTA 3EEZA 4E38A 4LB3A 4OV9A 2QCGA 1QVBA 3W01A 4D6FA 2D1ZA 5DY3A 1R86A 3R1ZA 1ELSA 3QJAA 2OGJA 2ZRXA 4XG1A 3U5YA 3G0XA 1V02E 4DBWA 3RAOA 3U57A 2OVLA 2F7FA 4OIFA 5ABFA 3DI1A 4QCFA 3WF1A 3N19B 3FAWA 1R3RA 4F4RA 1KBKA 2FHBA 3S8HA 4O8AA 4C60A 4GX9A 2D3LA 5DQPA 1NY1A 1BRLB 1JULA 3V16A 3GX9A 1JG9A 3WDHA 1WKYA 2PGEA 2J47A 3WLPA 4OJYA 4W7UA 2XFRA 3WMSA 1V5XA 5EMMA 5F1UA 4FNTA 2I5IA 1EYWA 2H3DA 3Q37A 4AEEA 4DHGA 1P48A 4A8RA 4ZXLA 2POZA 3W88A 3W1RA 3W7MA 5I06A 1E4LA 1VZWA 5FI8A 5DN1A 1OIFA 3W2MA 4RZBA 2ONEA 3QZEA 5DBUA 4N42A 3V3WA 1VR6A 2F9RA 3MQTA 4L1GA 3KS6A 1TV2A 3BQ5A 1J4EA 1VFFA 2XN2A 3ARSA 1Q65A 1LDCA 1LOQA 3N2BA 4S3FA 4UUIA 4UTLA 3PUEA 4GY7A 4GNVA 3DKJA 3P93A 4FAMA 1LP6A 4TMCA 3HURA 2D0HA 2OGYA 4AD2A 6XIAA 2PWUA 5LA2A 1AD1A 3WJSA 1E6PA 1NWSA 1OC5A 1XCFA 2CLLA 3ORWA 1BKSA 4JTQA 4L61A 3FLUA 2FH8A 2WPGA 1ISVA 1IEVA 4JKKA 2ZZ7A 4H2CA 2RDWA 3V18A 2PDUA 7ODCA 1R3TA 3TCSA 1ZUAX 3K1DA 3TQVA 3JVAA 3TQ0A 3ABRA 3CHEA 4C6EA 4BHYA 3B4YA 1I0DA 3WNOA 3WLNA 4EVZA 1SW0A 2DZWA 2ZDRA 3NQGA 4MNKA 1EF2A 3KVKA 1HKJA 4CVUA 2D2OA 1TWDA 4W7VA 1VYRA 2P0OA 1ISXA 3GVRA 3MWAA 3MV01 2PTWA 4OVXA 2YIHA 4JXCA 4QS6A 4YVXA 3NTYA 3FKKA 2HXUA 4JTAA 1LOLA 1VPQA 4H04A 4JPGA 1XYAA 2FDMA 1ZL1A 4FEZA 4XAGA 4XAYA 2BOGX 4REQA 3TTEA 5KMYA 4XAFA 2CHNA 3LM7A 2V81A 4LYKA 4WJ8A 1JYXA 3KRUA 4NILA 5EMUA 3U2EA 2VX5A 2ZX8A 4LY4A 2DFAA 4S2CA 4S3KA 2Q3RA 4Z0SA 3ITXA 5ABTA 4NZ1A 3URQA 4JIEA 3LHZA 2XH2A 4YXGA 4GC3A 5FEWA 1M65A 3PVFA 2CLHA 1BQGA 3AIUA 1GTHA 3G1VA 3T0DA 1EOKA 5JH2A 3M41A 2OYKA 3IJ8A 5A95A 3FJNA 3G1XA 4YHGA 4B3KA 1HJQA 3NPVA 2O0TA 3OODA 1YQ2A 5DCBA 1OT2A 1SR9A 1E4NA 5TAOA 5A8GA 3IIXA 3VCRA 3ZT6A 1TPFA 3N13A 1EA9C 1KM0A 1ML1A 2BXVA 1PBGA 4H8NA 2YA1A 3VKAA 4HBKA 4LF2A 3QGAC 2BVDA 3NZQA 3T0AA 1REQA 3DDMA 2HS8A 2QIWA 4ZO9A 4B2DD 3WQOA 2I5GA 4NVTA 4J3SA 1EDTA 3C0LA 4N4PA 1Q6LA 2VZVA 5ABEA 4TO8A 3IANA 1KBLA 1PVNA 1K4HA 3J7HA 4X0NA 2YXXA 3OLIA 4HHPA 1MEWA 2HBVA 1EUNA 2WKJA 3G1RA 1XBVA 1XKJA 3AIWA 4IFKA 2PRLA 4G7EB 1TTJA 4GUFA 3G1FA 3AWOA 1RSCA 3HG3A 1W37A 4H6RA 4HU3A 3U4AA 3TTYA 1TPVA 3ABXA 4ES4A 4QSFA 4Q4PA 3V75A 5IBXC 2REQA 2IXVA 2NQJA 2Z2UA 4JTSA 1WB0A 2VX4A 1LT8A 1C93A 3ATZA 1XCXA 2E6AA 3UY8A 3GXIA 3QTPA 3H7UA 2NV1A 4NAFA 2NXHA 1KKOA 4AZBA 2QCDB 5I02A 2J4GA 1TCDA 1JPDX 5CQ1A 4I5XA 3DGRA 1V6VA 4KEMA 1S5MA 3C0JA 1EJWC 2DORA 2Y0FA 1U33A 2GGGA 1TMQA 1UUMA 3T4WA 1XL9A 4QQ3A 3OVRA 1XFBA 1J79A 3SO7A 2ZZ4A 3TYDA 3HG2A 4DLMA 3TTSA 1XICA 2BWGA 4XVDA 2DY3A 5DY2A 3MKKA 2J62A 1KA9F 1IT0A 3W1MA 3NQ2A 5KZDA 4WXYA 4JS3A 3BE7A 2DZXA 3HPZA 1KFBA 4Q33A 4I7UA 3P7YA 4BJHA 3W24A 4H7CA 1QASA 1Q3NA 2GVYA 3UWYA 1XIBA 3CB3A 5HMSA 5JXQA 1TPEA 1Y0EA 3VIGA 1VRXA 3POHA 1H51A 4PCNA 3W73A 1XV8A 1DIDA 3TZNA 5FAJA 3OZOA 3W84A 1XW8A 1M3UA 3FN9A 3TW6A 1O5QA 3KX6A 3N14A 4O53A 3CUXA 2UY3A 3EEGA 4E2DA 1PKNA 1OFAA 5C6MA 3TYEA 5B80A 1ZCCA 5LGXA 3RF9A 3W81A 4L1WA 3AIQA 1M03A 4MLJA 3SUUA 3NQBA 3C2EA 4UFJA 4ACZA 4GO9A 3AXMA 1OFPA 3K8MA 3BGJA 3M7SA 3CAWA 5CG0A 2BZNA 4YYFA 3QF0A 3EWXA 5CSUA 2WKLA 1VHCA 5K2ZA 4LWWA 5CZ0A 4LNCA 4RUBA 4NXKA 3M5YA 2VZSA 1R46A 2GDUA 3PG9A 4ERIA 4UNKA 2XGBA 1NWTA 2PUZA 4LAOA 2WM0A 2HDJA 2YCJA 5BWAA 2YXOA 4ZQNA 2GGEA 2L5HA 5DCEA 3ONBA 4NY2A 2VX7A 4O10A 1SW3A 1T41A 3MANA 1S2VA 5C9ZA 4NJIA 3ARVA 4HA3A 2Y88A 4EANA 1VLIA 4M82A 5EB8A 3UCQA 1W32A 4RPPA 3AICA 1UWIA 5T8GA 2KAUC 2FGLA 4HPGA 1LTDA 2WMKA 1JUBA 1I2RA 2Z1KA 2NV2A 1X96A 3CBWA 3W7NA 2QXWA 2VCCA 4IIGA 1L2UA 2R8WA 1E4IA 1NF7A 3M0XA 1GJPA 3W85A 3P67A 2Q3OA 4GFIA 1Q2SA 3WDPP 4HTYA 1UD4A 3T4CA 3KL0A 2V9DA 4C6CA 3HPFA 5AZ0A 3W38A 1S1PA 1QHPA 5TBOA 2NT1A 1M6JA 3BSGA 4MZ1A 2Z7KA 4OFCA 3XISA 2ZC1A 3GDBA 3PZNA 3JU2A 4JIHA 4EWJA 4GI9A 3V5CA 1J96A 3WF2A 3CL8A 1SO6A 3PZOA 3L2MA 1U2YA 1X6LA 2PWEA 1DPMA 1X6UA 4U3AA 1NAL1 1GVOA 5EFFA 4FA3A 2GLKA 3DOPA 3MS8A 3A4WA 4L56A 1RJPA 3ABZA 5HULA 3VUPA 4AWTA 3A9BA 1E0UA 3DFQA 3ZLFA 2AL2B 2YLAA 2GFTA 3ARRA 1OX4B 4BK9A 1F3TA 5G5IA 4JX6A 3WD3A 1KV5A 2V38A 2R82A 2H90A 1F6KA 3AFBA 3E9AA 4ZTXA 1B30A 5FF3A 3E0WA 3N73A 4W8AA 3INPA 1JYWA 4FZIA 2G50A 3QY6A 2ZIDA 3VC6A 4PMNA 4HYWA 4IQLA 4LF1A 4X2RA 3ID7A 3WUBA 1ME7A 1H5YA 4O1BA 3CV7A 4A35A 2CC0A 5GNXA 1ZBVA 1G01A 2GJRA 2YZRA 4DYJA 2G3IA 2WSQA 3WEMA 4Y90A 1A0DA 1FBAA 3N6HA 5HUPA 4H01A 4IPIA 2G96A 1IXPA 3R6IA 5HXMA 3ABOA 3UZWA 4EX4A 1A49A 3MB9A 3THQA 3ZZ1A 3SUVA 3K1GA 1UPMB 1UIPA 2ZX9A 3GNDA 4MG4A 2W63A 3CIXA 3D5HA 2F38A 4HMDA 1V6UA 4DUWA 3PHAA 4CCEA 3G1SA 3RDKA 4GH3A 1UKQA 4NJHA 3I4KA 1GJWA 4J2MA 4PN2A 3C2OA 3V4BA 3UGRA 4PRRA 5LIXX 1WO2A 4H9MA 4N6FA 3EWWA 2NVAA 1HXJA 3O6AA 3EYPA 4PUNA 4QNEA 1CGYA 4GCAA 2GSHA 1XDJA 1WDSA 1XLHA 4AWUA 1QBBA 4D6HA 2YR1A 4XIAA 3THAA 3IVTA 4S3JA 2PDHA 3K4DA 2XIOA 4DJED 3QMRA 3UNTA 3B8VA 4JTDA 2OOFA 2CKRA 1T99A 3AXHA 3CQ0A 1JAKA 1PIIA 2YJQA 3MO7A 1IT8A 1H1YA 3OIHA 3SUSA 1KFLA 1UBPC 1TVPA 3NXLA 1ZJHA 3VDBA 3B0YA 1IQ8A 1TTQA 3PAOA 3L4TA 2ON3A 3H21A 4TX8A 1CB7B 1V6TA 2NT0A 5CC3A 3KVLA 3A5FA 1KM4A 1VRDA 4HYVA 1NWUA 3AUOA 3WLRA 1GG1A 2AAAA 3LMZA 4AAJA 1V02A 3GO2A 4F3HA 2XU2A 1XJBA 1PCWA 2GJXB 2WMIB 4XZWA 3N2TA 1HO1A 2YFOA 3AIVA 4LUYA 3DYOA 4QLJA 1DE6A 5AC4A 5C9UA 3L67A 2CU0A 3AISA 2VWSA 4XZIA 3GDRA 3FYYA 4QDMA 1GOXA 4IX0A 2HNEA 2ZADA 4JCLA 4NZCA 4Q22A 2YKKA 3S1UA 3FCPA 5B7YA 3FYOA 3V0TA 4LUTB 4Z2LA 4MB1A 5AYYA 2CBIA 1XBZA 1EEPA 3S2JA 4KQNA 5DXXA 3AI0A 1G5AA 1GUVA 4LVAA 1XGDA 1JJKA 3M0JA 2D22A 4GUJA 1HW6A 1OT1A 3L4ZA 2GOUA 4LXFA 1E73M 3QQ1A 4DO5A 4DXXA 4O52A 1LUCB 2ZE3A 4YYCA 1H7NA 3KE0A 2D2JA 3MV11 5ABHA 1LQ0A 4MAZA 1EZ2A 1Q63A 4ILSA 3WUEA 3NEVA 4J4KA 3IAPA 1TZZA 1VIWA 4FLSA 1TR1A 1NQ6A 3OBKA 1DORA 3PBWA 3F1QA 7A3HA 3UXIA 4G8TA 2F6XA 3LK6A 2ZA1A 1RHCA 4PR4A 2DSKA 4H9UA 2XYLA 1O5XA 1XLJA 5HK4A 3RR4A 3EX6A 4QDWA 3AAMA 3WJZA 3KCJA 3NPUA 1AQ0A 2RH9A 4PB5A 1LROA 8A3HA 5LNRA 1VQTA 3K46A 4MAVA 1DEDA 3SQLA 2CXEA 5I77A 3W00A 3G77A 3VMNA 2V2DA 5DLCA 1HP4A 3A23A 3M7WA 3EA3A 3BVJA 4YWIA 5KITA 1UR4A 4HPHA 3U48A 1NM9A 2Z6JA 3TEVA 2GGJA 3SN4A 4UR8A 4P7QA 3AZRA 3W4RA 4GI8A 4OT7A 2Z1WA 1SFLA 5H6HA 3NQ7A 4M7SA 4GIEA 2XIMA 4IMGA 3TNBA 3UXLA 2ZRWA 3H2FA 4QIUA 1PUDA 1XM3A 3QM3A 4ZOBA 3VTRA 3SCTA 4JICA 3VOJA 1B54A 4GE8A 4EPKA 4JTLA 3UQNA 4M56A 1H49A 3ZT7A 4R5EA 1E6ZA 1DVJA 1S2CA 3CV1A 4UFHA 3W6MA 4CCZA 1WKEA 3RM9A 2OWWA 3BLIA 5F4WA 1CZ1A 1XINA 2ESCA 1C8YA 1FRBA 4MB5A 4XD5A 1YDOA 3AYSA 1HUVA 4PB4A 2WLZA 4RNFA 1W2VA 2KZHA 4S3AA 1I75A 1SSGA 3QN3A 1ONEA 1NOWA 2XJ7A 2BB0A 1A5KC 3EOUA 1BF2A 1PZ0A 1C8QA 1QW7A 2VUNA 4Q7NA 5E70A 3W7IA 1I1WA 3VIPA 4JFWA 4X63A 1POJA 1KFWA 1N8WA 4E2BA 5ECVA 4F0HA 3W1XA 1EA0A 4B15A 2A6NA 4UOZA 2OLHA 3W0KA 4XZMX 4YTTA 5CJMA 1TPB1 4GK8A 1E9IA 3OYZA 4OGZA 4DPPA 1T8XA 4IIDA 1OF8A 1FDJA 2DUZA 4ZENA 3EX4A 4Q7IA 5IFPA 1JVNA 1GYMA 4E2OA 1ZALA 3Q45A 1EXBA 3MU7A 1OC6A 1XLLA 3L68A 3L0KA 3AUJA 3WD1A 2DSUA 1S3TC 4PZVA 1TZ9A 1X1ZA 3ITLA 4LUJA 4L6DA 3W1AA 4NRSA 4UTMA 2ISSA 3EMQA 3SI9A 2B7PA 3S9YA 2AOSA 5AKQA 1E71M 2WZTA 2HISA 4YPJA 3W7KA 3CAKA 1CPUA 2RKXA 1PX3A 3GW0A 3VNJA 1GQKA 1W8GA 1E9ZB 4GIRA 4PSRA 3PZIA 3PM6A 1NARA 1JGIA 1BXCA 4L7ZA 1S39A 1M53A 4NUWA 1XLDA 3A3WA 1J0IA 2J66A 1A4LA 4FR6A 1A80A 2CZ5A 3M5ZA 1V6YA 1FX6A 1MDLA 4XQ6A 1UH3A 3L4YA 1VBUA 3ZS4A 2PD9A 4O0ZA 2BP1A 4JN8A 1XLIA 3S5OA 3UR7A 4DF0A 2G3JA 4ZQRA 5HWJA 2C0AA 3OA5A 7CGTA 4JTUA 3VOCA 1DJQA 3A3XA 3RMJA 2E68A 2OQYA 4PUMA 2QDHA 1GPFA 4CQ9A 3APTA 3WLSA 1JZ4A 3E49A 2CPUA 2WVTA 4UTFA 3DERA 4KCUA 4B5SA 3BW3A 5HA7A 2F6UA 1GVRA 1KBBA 3B0PA 5D32A 3XIMA 4H8UA 2J77A 3GXPA 3N2XA 4LGXA 2VGGA 1SZFA 1ZBWA 4V1XA 5FJPA 2OSXA 5CBJA 1AH4A 4C6PA 4LUSB 3GHUA 3BLPX 4U2YA 3AS0A 3RJXA 2V67A 3LSCA 4J3TA 1EPXA 2BXYA 3TC3A 4JTIA 4AZIA 3SAZA 3LY0A 3CWNA 2WNNA 3S2LA 4EF9A 3STFA 3TUUA 2ZTKA 2H9AA 3W7GA 1DWJM 2C13A 4XZBA 4RV3A 3UPMA 3KP0A 4HCDA 2FJKA 2QCCA 4GISA 2VEFA 1SSDA 4IMFA 1ZP3A 3C2YA 1V3IA 3UWUA 3CV2A 4GZIA 4DZ5A 1F8MA 2Y7FA 1TVNA 1H0IA 4GC4A 3T0BA 1VFUA 2OZ8A 1YRRA 2P5NA 3SADA 1NFBA 4AYSA 1IWBA 5KEZA 1KGUA 1YXDA 1EQCA 4JQAA 1BTCA 3KRBA 4GOAA 3KVMA 3TJIA 4PE8A 2A21A 3HV9A 3H2OA 1OADA 4K8EA 5A8PA 4LT9A 1GQLA 3KOFA 2DZPA 3AMCA 5K3VA 3W23A 3MWCA 4IPPA 1HKIA 4X0VA 2C0HA 3WQ6A 4N4QA 4E2VA 2FZ8A 1NVMA 4QLKA 4ZQCA 5HJYA 4AZ5A 1F2JA 4RNHA 1JPMA 4JL2A 5A6TC 4YVVA 2FHCA 4UFKA 1IXQA 1X98A 3IJLA 5D02A 5BRQA 3R0DA 3CPUA 4I9AA 1DJGA 4PH6A 4XO7A 5C9WA 4RDWA 3TONA 4HU8A 3S42A 4E8DA 3LNPA 1W3HA 1XRTA 1VB9A 5CZKA 1QTWA 3V5OA 4PMUA 1FKWA 4CNTA 5I3JA 1U1UA 2GL5A 3O6YX 4GYPC 2PTDA 2B7OA 1XLKA 4XK2A 3OW1A 2Y7DA 3ANYA 5A6MA 3PTDA 4NL1A 3CUHA 1XIJA 3WQ4A 1LG2A 1TSIA 3DBPA 3E0LA 3B04A 1V08A 4BF5A 3LU2A 3ICJA 5ECUA 1VF8A 3MCMA 1UOKA 1UH2A 4UTJA 4O50A 1DHPA 4GYPA 4HNVA 1EGMA 1L8NA 4F79A 1XLGA 2FDSA 3QR3A 3IAQA 1ME8A 1PL9A 3DXIA 4C6KA 3YPIA 3DC8A 2XIIA 3G8EA 3LXAA 2CLIA 4GIYA 2H8XA 2V63A 1E70M 4NG3A 4LSBA 2DT3A 3QEZA 2RGMA 3T08A 1MFUA 4FLOA 1YTKA 3BK0A 2YOCA 1K3UA 4PUWA 3WJXA 2QPSA 3PK7A 2QKFA 4YJ5A 2VRQA 5F2MA 1V4YA 1HTIA 3GC2A 5J8LA 3TSMA 3VX0A 4WZHA 5MKGA 1FY6A 4OBSA 3ME3A 1NDYA 1VJIA 3EPMA 1IT7A 2WZEA 1VBRA 4JTFA 3KP1A 4PMYA 4YCOA 4IQDA 2QV4A 1CECA 5J04A 4H41A 3BARA 3R25A 2Y4SA 1WZAA 2ABAA 2VZOA 4K8HA 1TMHA 3E02A 4N7QA 3TYAA 3BLFA 2YL9A 4CN1A 4DJFC 4O1FA 4BKNA 1EUAA 1WPCA 2VQUA 4JQ2A 1GKRA 4F0MA 5LGZA 3QLLA 3V35A 4KFPA 3KL3A 3MI6A 1HT6A 5FJRA 1G94A 4LBRA 3PZTA 2V5DA 1BXNA 1WZLA 4NNBA 4IIFA 1P6WA 1MUWA 3CO4A 1OCBA 1MZHA 3VD3A 4YTUA 4GUGA 1FWSA 2VVNA 1D3CA 4DJFA 5CCZA 1IXOA 3HOJA 1WAUA 4K36A 4B3LA 3WQDA 1H1ZA 1J8VA 2FIQA 2GYIA 3GVVA 4MNMA 4WHBA 3PZVA 4AX6A 2GWNA 4D6EA 1CGVA 4GJJA 1OFDA 3VNMA 3PAJA 3PJXA 4KRTA 2WJDA 3IJQA 1US2A 2XUCA 2Y8VA 4FP1A 2W91A 3C52A 2PAJA 4MUZA 4GFSA 2EJAA 1WBJA 3VYLA 3WH8A 4PFMA 2XVPA 4YLWA 2WB5A 3UR5A 2OO0A 5GNYA 1E0WA 1TCMA 4AU0A 4RPQA 5DBTA 3C8FA 3E2VA 2EJ1A 1RJRA 1GOIA 4MUPA 3G0SA 1BVZA 1FWTA 1PWMA 3D3AA 3GVGA 1UASA 2A3HA 2ZBTA 3CASA 3SFWA 3MSYA 2PDQA 1W54A 1O66A 1AL7A 4HNLA 2QCNA 1MUCA 2W9MA 1BGGA 3N29A 4ZXOA 1SYTA 5EPDA 4X22A 3PFRA 5EBUA 1KXQA 5H2ZA 3DECA 1KNWA 4IF2A 1G1YA 4MJ4A 3W26A 1KGWA 4C5YA 4WKAA 2E7FA 3P0WA 4K6AA 1DJWA 1VFLA 4MYAA 3VFLA 3GUWA 4EP8C 2WNWA 4D6DA 2J7HA 4I9TA 4TV5A 4C7DA 1YPFA 4C1KA 4H6EA 4QITA 4DN1A 1YE4A 3OPSA 3SJNA 1S46A 1VPXA 1W1YA 3VNIA 4C6DA 1EZWA 1RLCL 1LQAA 3STEA 2LLEA 3PN8A 3LG3A 4O54A 5H8MA 4EAYA 2QUUA 5I00A 3RLVA 4PTNA 2OX4A 5A6SA 3M4HA 3EPOA 5I6SA 2Z0IA 2VURA 5I23A 1YPIA 1J5TA 2ZQ0A 4BQ2A 2CLEA 3MZ2A 4PMJA 3UG3A 1Y65A 2QR6A 2WMFA 1CLXA 4BZYA 9CGTA 3ITOA 3HN3A 4GKLA 4C6NA 4P2VA 4LS1A 5KINA 3DFHA 1BQCA 1BWLA 2PFHA 3WQVA 1LWIA 1RD6A 1Q7QA 3QR0A 5IHSA 3VIKA 1MXSA 2F84A 2GJLA 3ZFHA 3CZEA 3CZLA 3CHFA 3P61A 2GZXA 7TIMA 3MKVA 1FHLA 2HPMA 3M44A 4XD6A 2V68A 1SJCA 4Q8PA 2JBMA 4S3BA 2O9RA 2P3ZA 1GG0A 1EOMA 4YN5A 3S1XA 2YA0A 4RJEA 3UJ2A 3RO6A 3TU9A 2JKPA 4XWUA 4ZMGA 4HKPA 5C54A 3MHFA 1YXCA 4LAKA 4QG8A 4IG2A 4ONVA 3W1TA 3DIPA 1V77A 3IRDA 4CU6A 1NTHA 2HXTA 3LRMA 3TLQA 1WDQA 3K8KA 2OWCA 3RNDA 5DMYA 3KOWA 3PNZA 4C7FA 2UWFA 4DO6A 1FCBA 4B2DA 3KTCA 4IPNB 1CGUA 1UZDA 2Y5EA 3KWSA 4AMCA 1OGSA 3HB9A 2AQOA 3PPGA 3MHUA 5KTLA 3M43A 4KPLA 4CQBA 2PE4A 2RDTA 3H55A 1PX8A 3PSVA 3EA1A 3LV6A 1HJUA 1XI3A 4J5NA 4H2HA 1SZRA 1JZ3A 2FH6A 1JCTA 4MF4A 4JYFA 4E4PA 1TUXA 3PULA 1E15A 2A0NA 1TPWA 2O56A 4FK9A 1XH1A 2WZIA 1AVAA 3G24A 3L65A 1WBHA 4PUUA 1FXPA 1W5NA 1MXGA 2O92A 4YCPA 2JEPA 5AC5A 4XKYA 2UY4A 3WELA 1T0OA 2BBFA 2P3EA 1UWRA 1W5MA 1TJ0A 5FL1A 1AH3A 3ZJ7A 4GVGA 4EOUA 1UPPA 1GOWA 2DIKA 4GKTA 4Z2KA 3GM8A 1WUFA 3NO3A 2Q8ZA 3HO8A 1I2PA 4OV4A 2W27A 1AA1B 3TOYA 1V03A 3AS3A 3AHXA 4MHBA 2C79A 4HQVA 4MYXA 1DJXA 2X1TA 1VHNA 3FW6A 1IZKA 3PB2A 3MI3A 1CLVA 4QROA 1QPRA 2EXOA 1V8EA 1IIGA 2GVGA 4KBXA 1KW1A 2G5WA 3NQVA 1XLBA 2V2CA 1XBXA 5E0CA 4CQAA 3SB0A 4H6KA 3M0YA 3SCRA 1JYNA 4WK9A 3M64A 1GPWA 1J2WA 4ZOCA 1FFRA 1TELA 1R30A 2X30A 5F4XA 5AY7A 2ALDA 3DI0A 3WLQA 4S3DA 3IUIA 1EL3A 1E6NA 4AQLA 1Z32X 1TO3A 2WVUA 2PBGA 3SGZA 1VCVA 4PBEA 3HGOA 2HROA 2WQDA 1UMYA 1BG9A 4P7RA 1WYIA 1V0MA 4JFVA 2WAGA 3P14A 4IPLA 3F2BA 4L65A 3BAWA 5LIYX 4H9YA 4ADUA 3EWDA 3IIZA 4HD5A 4LYQA 3QZAA 2VENA 5H1WA 3K13A 1TIWA 2X16A 1OY0A 2H6RA 3B8SA 1P6CA 4AHQA 1F5ZA 5AHIA 5EMYA 4DYKA 3OHIA 3PNUA 1TWSA 5JBFA 4UTKA 1AW5A 1FTXA 5E0FA 3H12A 1BRLA 3NO5A 3G3DA 4GYJA 2QEZA 4N9EA 3AZTA 3WCZA 1RVGA 3EX1A 4WLCA 4AHPA 4LANA 5E5CA 1B9ZA 4IJBA 5BOEA 1BTMA 1N7KA 3WN6A 4MFDA 5BRBA 4ATLA 1C8VA 4S1FA 3UVIA 1ZBCA 3C2VA 1W3NA 3NYZA 4LAMA 1OZMA 1HKVA 1ZQ5A 2FZBA 3VE9A 5CEWA 1QOXA 1B3VA 2B7NA 3GK0A 4PUKA 3THDA 8TIMA 4PB3A 3CB8A 5BOFA 5HMEA 4FOJA 2BOEX 4Q8QA 4EKJA 4DELA 4NJKA 5CPTA 3N9KA 5M17A 1E9YB 2YL8A 5G2IA 1P43A 2WMGA 4HMNA 3VE7A 2FZNA 3UYCA 2VO5A 1EGVA 3QSTA 3JUGA 4PL2A 2J6XA 3N6QA 3KZSA 4PODA 4IXXA 1QI0A 3KUMA 1TB3A 3IRSA 3AHYA 3C86A 4H4IA 2XFWA 3SCUA 3BJSA 4RXFA 1R47A 3S2CA 3AROA 3B8TA 3AXKA 3BURA 4UMBA 2PEVA 3RHGA 3FJ4A 4C7GA 3BH4A 1ZSXA 3NDZA 2ZFAA 4H8VA 3TIMA 4I9JA 3SCQA 4A2SA 2ZZ6A 4Z1CA 4HMCA 2QJHA 2AKZA 3UGVA 4FXFA 2WLYA 3TX9A 1I4NA 3GU1A 2QJIA 3HGSA 3LENA 2W62A 4K37A 2J6VA 1BYBA 1XKYA 2JFEX 3WO8A 3T0CA 5BXTA 1TPC1 3TOPA 1TYGA 1BG4A 2I9EA 5FJJA 5FACA 2BGNE 4XD4A 1U83A 5D30A 2F8QA 2CYGA 3P5YA 1MSSA 2FB2A 1L6WA 1X8CA 2FB3A 2X09A 2IPWA 2P76A 3QMTA 3SY1A 4ZE5A 3TR2A 4M24A 2C14A 3PJWA 3AXXA 3ARYA 2OPJA 4YL2A 1MQRA 4RW3A 1S3HA 3A64A 1A5MC 5AVHA 3UWEA 1RLDA 3REQB 4P8XA 1SR0A 2ZOXA 1AFSA 2A3BA 3CPGA 3R58A 5C2CA 3UW6A 1LWJA 2WHLA 2ZXQA 3GHSA 3SGUA 3T2QA 2G0WA 5U7SA 4JZ5A 3EX3A 4LNYA 4W85A 5BZAA 4WXZA 1M41A 4IMDA 5FKYA 3SJ3A 4CUCA 1XIFA 4DJDC 5XIMA 3IGXA 1X1NA 4RZ6A 5E9XA 2E6YA 3RIKA 1WNOA 2E09A 4CQDA 2CLMA 2WCGA 5CGMA 1J18A 1TA3B 2AL1A 4KEUA 2TMDA 1DYSA 1OZQA 1UMLA 3CEUA 4NJGA 1VFTA 3AYRA 2NSOA 3LQLA 2C15A 1Q7MA 1I2OA 2WWCA 3OB8A 2VC7A 3NWRA 3GC5A 3UT0A 3ES8A 1GT8A 4LV9A 2IKJA 4NSBA 1W31A 2QJNA 2PDYA 3LUTA 1PTDA 3VGEA 1Q45A 3RJYA 3G6MA 5I79A 3WNLA 4IISA 3WDJA 1W3JA 1DJYA 3CYVA 1QPKA 1QK2A 2QUTA 2BS9A 3IJDA 2QDGA 4OOUA 4ROQA 4AY7A 2JQXA 4GBUA 1OSEA 1C90A