1NM9A

Crystal structure of recombinant human salivary amylase mutant w58a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPAWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, salivary
publication title Human salivary alpha-amylase Trp58 situated at subsite -2 is critical for enzyme activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1nm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nm9A01
3A4WA 3AI0A 2BHUA 3ARTA 1PIGA 7CGTA 1H5VA 1M53A 3VNYA 3OGSA 4TX8A 1J9YA 3SCOA 3MMUA 3EJUA 3SUVA 4B3KA 1JXJA 3ARPA 4W5ZA 4W88A 4AZ5A 3EJRA 2Y2WA 4YHGA 1VFMA 1KXQA 2WCSA 1UWSA 2WMHA 1D2KA 4AZ6A 4TUFA 4X0VA 3HMCA 1B3VA 3HG5A 1GUVA 2E4TA 2PWHA 1ZBKA 3WD3A 3WH5A 1K9DA 1J0ZA 3CMJA 3PHAA 4MAZA 2FH6A 2DEPA 1ODZA 2F2HA 1MQRA 1R8LA 2ZUWA 2X2IA 3ARRA 2J7HA 2VRKA 1H09A 3SIMA 1EDTA 1BLIA 4J3WA 5CLWA 3CZEA 1ZJBA 2X0YA 5IFPA 4ATWA 4FNQA 2CEQA 3D50A 4PMXA 2CERA 3EJTA 1QI0A 3RO8A 5D9MA 1FH9A 2ZXQA 3GH7A 2G3NA 1UR9A 3CUFA 4CD8A 1CECA 3VMPA 4ZXOA 1PIFA 1TVNA 3AQUA 1UOKA 3W25A 2BY1A 1H4PA 3EJPA 3WNMA 1AMYA 1UASA 2EPLX 2YFOA 4QCEA 2VZOA 1WZAA 1AVAA 2ZUTA 2CHOA 3VIHA 1CGYA 1JZ4A 2YDRA 3CZ8A 4ZEPA 3H54A 3BC9A 4A4AA 3M07A 2JF6A 2PI6A 3HG4A 1PX3A 2WM0A 2VX7A 1XSIA 2EPOA 2FH8A 3J7HA 3WF4A 3ZR6A 2WBGA 3PZGA 3WDRA 4CD4A 2ZX6A 1R33A 4W89A 2A3BA 3SUUA 1R47A 3UG3A 3GXFA 2BVTA 2VZVA 4YHEA 4MPKA 2WVVB 3AIQA 1BFNA 3IJ7A 2EPKX 1BYDA 2FDMA 2VTFA 5EB8A 3EYPA 3AHYA 2XIBA 3N11A 2YBUA 2ZUMA 4ATDA 2D20A 4D6DA 5DEZA 1VF8A 3AMLA 4IISA 4JFTA 3K4DA 1I75A 4W7UA 1R86A 1XRVA 1W2VA 1JAEA 4UFJA 3W28A 5C70A 1PX8A 2WC3A 1NOUA 4CD7A 4DWSA 3AMDA 1ZL1A 2PBGA 1H0GA 3W29A 2GDVA 2J47A 3EMCA 2DQXA 1NP2A 2GVYA 2WHJA 3CHCA 4OUEA 1BYAA 3WNOA 3GYCA 5IHRA 1VFOA 4M80A 4U3AA 1GORA 2DGAA 1WCGA 4W85A 1E5JA 3WH7A 2OYLA 1C7SA 3WF1A 3WD1A 3CMGA 3A5VA 5F7UA 2ZE0A 3L4XA 4URIA 3ARVA 1UR8A 1GZJA 1KWKA 4UFHA 1DWJM 2GJXA 5ABFB 2CKRA 4NXSA 1EOMA 3WH9A 2ZUNA 3CUIA 1OINA 4S3KA 2HISA 1WB0A 4Z2LA 3L4TA 2VT0A 4W8LA 4JFUA 2YBTA 1KXVA 2WMIB 5FL1A 5LA0A 4GI9A 5AYBA 2YL8A 4CUCA 2DSVA 2J7GA 2YA2A 3EJSA 1XD1A 2F7OA 3VD9A 2YJQA 1E15A 1E43A 2YL6A 3WQ8A 1K9FA 3OZPA 1EO5A 5E6ZA 1CENA 5A95A 1HNYA 4UFKA 1NH6A 3A47A 4FK9A 5DF0A 1UD3A 4FNRA 3BUDA 3ZM8A 4AC1X 1UWUA 3CV5A 4CN6A 1DTUA 2E8ZA 4J7RA 4PEEA 1QX1A 1UD2A 2V5DA 4AY1A 3ZQ9A 1X1NA 4HZ6A 3MS8A 1VBRA 4Q22A 1GW1A 2X09A 2W62A 3L4ZA 2VURA 1V6VA 3WMCA 1KWGA 4D72A 1QI2A 2WZHA 1JYWA 1EIBA 3ZJKA 3VIPA 4J3TA 3NSXA 1J12A 2J7EA 1NWTA 2VL4A 3AHZA 4W93A 1E56A 2J74A 3PZMA 4HMDA 1BSIA 5A6MA 1WZKA 1GOMA 3MSDA 3L4WA 3SUTA 2D3LA 2VR4A 2YFNA 2J4GA 3AIWA 3N04A 3RM8A 4DM2A 4AMWA 1PX4A 3LX9A 3NSMA 3ZT5A 3AZTA 3LXBA 2ESCA 3AROA 1V3IA 1CXFA 3M6DA 1P6WA 3WMBA 1C90A 5FIPA 4TOQA 2A3CA 2XVGA 1UWIA 4OOZA 1JAKA 4BS0A 1RP9A 4E4PA 3K8KA 1ODUA 1HKKA 3KWXA 3WQWA 4C7DA 3L4VA 1AQMA 1B0IA 3W27A 3VDHA 2WSKA 4Z2GA 3D52A 2D3NA 3WIJA 4F9JA 1TQWA 2FE0A 2WSPA 3VX0A 5BCAA 2WCGA 5A69A 2FYVA 3VKKA 5CPSA 3VIIA 3WEZA 1R7OA 2VX6A 1SYTA 4YPJA 1Q6GA 3A3HA 1CLVA 1GQIA 4MJ4A 3SCTA 3EMQA 3WNPA 4AEEA 3TA9A 3RDKA 2BVDA 4GZEA 4UNIA 2WAGA 2WZIA 2BY3A 4K68A 2JIWA 2WMGA 1OGBA 2QHAA 3FY1A 1E6SM 2F7RA 4M1RA 1JI2A 3KLKA 3KLLA 3OBAA 4HOZA 4CU6A 2J8FA 1UKTA 4FLRA 1MW2A 4S3JA 1W9PA 3MV01 2XFFA 3EMZA 1J0IA 1CZ1A 1JNDA 3AIUA 2EO7A 1A47A 2ZXBA 3WEOA 3ZSSA 4WIWA 5D9NA 1JZ7A 3OLGA 4HU0A 3T2OA 5E0FA 1JL8A 3SCUA 3S5ZA 1GVIA 1G1YA 2J78A 3WKZA 1C3FA 1J0KA 2VC9A 1OB0A 1E73M 3FN9A 3ZT7A 1V6XA 3AZSA 3WDPP 4ACZB 3ZJ8A 3DECA 2BHZA 3GNOA 3BVVA 3ECQA 1W9BM 2ZOXA 2VZUA 3EDJA 3VMOA 4PN2A 3AZRA 4AD1A 5A94A 1XHGA 3WY2A 3VNZA 3QOKA 4KWUA 1B30A 1R7AA 1GQKA 5I0DA 4PCTA 2W61A 1KFWA 3AJ7A 1EHNA 5E9AA 2O9PA 4GO9A 1L8NA 3GH4A 4GKLA 3UETA 1BYCA 1E6PA 3CC1A 1VEOA 5I2UA 1EQPA 1BPLB 4AZBA 3WUGA 4GZJA 2WVUA 4XV0A 3RCNA 2IXVA 3VIFA 1RP8A 3DX3A 1GPFA 4KH2A 3UERA 5ABGA 3D51A 4EK7A 4ATLA 1C8QA 2J7CA 4UOJA 1C7TA 5M3WA 1UQYA 1MQPA 3PZTA 4HMEA 1UH4A 3AXXA 5A3HA 1UR4A 1QW8A 1HN1A 3W4RA 1WDQA 1W9VA 2XVKA 3L4UA 3WH6A 3W37A 3WQVA 1XH2A 3MANA 5CLTA 2O9TA 3SCSA 1E3ZA 1UHVA 1C8YA 3ARSA 7A3HA 5IDIA 3ARXA 3SCPA 1HT6A 1E0VA 1MW0A 4EKJA 3WF3A 2W4XA 4P7RA 4CU8A 4NI3A 1ZJAA 4UZUA 1E1FA 2VX5A 4MAVA 1TQTA 2W91A 4BQ2A 4FF5A 2WZEA 3O6AA 4M8UA 5ECUA 4KMQA 1QW9A 3BLBA 3I3BA 5E6YA 2XM2A 4L4OA 5DFAA 3AS2A 1I1WA 3EDDA 1OGGA 3D4ZA 3U7BA 3BUQA 2UY2A 3VSVA 4A3YA 4R27A 3CUHA 4LXFA 4CVWA 4P7NA 4IM4A 3BSHA 3ZOAA 2ZX9A 2Y4SA 2DIEA 1MXGA 5FKYA 2PBOA 1LWJA 4BF7A 3WBAA 1OD0A 1VB9A 2DIJA 5IXEA 3CO4A 1V6WA 4F79A 5BWFA 3AHTA 4NZCA 1PJ9A 1EQCA 3MKKA 2AMGA 1E4NA 4AW7A 4JFVA 3W81A 3BLPX 3DDFA 1LL6A 4DWSB 3BUPA 4TVUA 4UCFA 4PMDA 4IUGA 3FAXA 4JCMA 3VGEA 4AIOA 5A6BA 4HOXA 4AIUA 3AS0A 4F8XA 4AWEA 4BQ3A 1CWYA 1CPUA 3SCNA 2VCAA 2X2JA 3KL5A 1NWUA 5D9PA 1K9EA 1TFVA 3WN6A 4PMQA 2Y5EA 1NWSA 1JXKA 2BXZA 1TMQA 3VM5A 1W2PA 4MB4A 1GONA 2AAAA 2VNCA 1B3YA 4LYRA 2BS9A 4H8VA 1EDGA 1XGZA 3K46A 5I78A 1S46A 2GJXB 4Q7NA 2OSYA 3I3EA 3G6MA 4HA3A 3A24A 2RGLA 2EACA 3UCQA 9CGTA 1Q6FA 4X9YA 5GNXA 2X2HA 1JF6A 1QHZA 3WD0A 4U31A 2GSJA 1E1EA 1XV8A 4QDMA 4EE9A 2NW0A 2YA0A 2F1AA 4JZ5A 1TA3B 2BVYA 1JDCA 1QNRA 4DWSC 4U2YA 2WMFA 2J79A 1AQHA 3CPUA 4PMVA 1V3MA 1R75A 1BG4A 1TCMA 1Y7VA 3BVTA 3DYOA 3MV11 3ZR5A 5EBAA 1XCXA 3VIMA 1Z32X 2WPGA 1JDAA 1KXTA 2NSXA 3RILA 4P8VA 1BYBA 5GQBA 4AZHA 3KE0A 3BCFA 5CSUA 4PMZA 4OOUA 1VAHA 4WSJA 2PF0A 2YLAA 1EXPA 4AD5A 3EDKA 1J18A 1BVNP 4NRSA 1DWGM 4LQ1A 1C8XA 4AEFA 2W63A 3MUAA 1GOQA 2F18A 3LPOA 4AD4A 4BQ5A 2EJ1A 1UKOA 4UQAA 2OW6A 1ECEA 2DT1A 1UD6A 1HKIA 4PTMA 3W26A 1ISXA 5HBFA 4WK9A 1JZ8A 2JF7A 1QPKA 5KZ6A 5M5DA 3II1A 2VZTA 2WWDA 4XZWA 3H53A 2WANA 2ZUSA 1CTNA 2UY5A 4W8BA 2WK2A 1V0LA 3UG4A 4MDPA 1E9LA 2V3DA 5HNNA 1MQQA 2XWEA 1PPIA 3D5HA 3WUBA 4AD3A 2ZXAA 2G4FA 3VU2A 3T2PA 5JUVA 1EDQA 3MSGA 3RIKA 4V27A 3EBVA 3SURA 4AISA 2J7FA 2VOTA 1B2YA 3GTNA 3LPPA 5FL0A 1HJXA 3OA5A 4E8DA 5I77A 3T0BA 4JCLA 1VRXA 2CHNA 3PZVA 3RM4A 1KCKA 3PZUA 5HDRA 4PTXA 4UFIA 1JZ2A 3VD3A 3N18A 5A6KA 3FNDA 3AICA 2VQTA 1B3WA 3NYDA 2VRJA 5GNZA 2YKKA 1GQJA 4FNSA 1QWUA 2XN1A 2BV9A 2RGMA 4UZSA 3WY4A 1FOBA 1OWQA 1HJUA 4WKFA 5BRQA 1M7XA 4P7QA 1OBAA 1B1YA 2E9LA 2BY0A 2Z1SA 4ML4A 3W0KA 3T0DA 3G6LA 4KGJA 5E1QA 3ARZA 2CIPA 2XJ7A 1HX0A 1G0CA 4F66A 1GJWA 2F7PA 2YIHA 3LRMA 3WMSA 4FLQA 8CGTA 3QHMA 2EQDA 2DT0A 4DUWA 2QMKA 3VIKA 4W5UA 2Q8XA 3VD7A 4PBGA 3VINA 5A8QA 3OGRA 5C8BB 4B16A 1CXLA 5I3DA 3DX1A 1BTCA 1NWRA 3W24A 2C7FA 4GZIA 4MTVA 4QFUA 5A8OA 1VJZA 3LPGA 2XYLA 1M01A 1W3HA 4MJ2A 2VI0A 1G01A 5A6SA 1ITXA 1J10A 4UQ9A 3BH4A 2W66A 1HJVA 1HVQA 1VENA 3WDJA 1NQ6A 2CITA 3VO0A 1KQYA 3GZAA 1JFHA 3UR8A 2ZWYA 1CIUA 4AZIA 1OIMA 1US2A 4LX4A 2E9MA 4UQCA 4JL2A 5EFDA 4OZOA 1UH2A 4LGXA 2V38A 2YL9A 3DYMA 1TZ7A 4MNLA 4UOQA 4JIEA 4FLOA 3DX2A 2OW7A 1IZKA 1U2YA 3RJXA 4P8WA 2EAEA 2DDXA 3BSGA 3OLEA 3WENA 1WKYA 4W86A 3GXMA 1DWHM 4MB3A 1B90A 3PTQA 1UD4A 3MU7A 1W91A 4UQEA 3OLIA 1QHPA 5A8NA 4AXNA 2CETA 3FHQA 2YL5A 1H3GA 1EO7A 1VBUA 3IK2A 2W92A 4HP5A 4PSPA 1SZNA 3APGA 1LJYA 1BHGA 1UG6A 4D6HA 2ZUUA 2E3ZA 4HA4A 4XB3A 4H04A 4HPGA 1DP0A 2JE8A 4DM1A 3NCOA 3IJ9A 5CG0A 2VZSA 3T0AA 2WNWA 1W9UA 3EDEA 3KEHA 1HKMA 2IUZA 2WVVA 1HP5A 2PB1A 2XVPA 3THDA 3GXPA 1F4HA 3UEQA 3PZQA 2XSBA 4V2XA 5I24A 3TONA 2CKSA 2VVNA 1J0HA 3NUKA 5A6JA 2CBJA 2VQUA 3WD2A 5FD0A 3EJQA 2YDSA 1KTCA 4MDOA 1KB3A 3OLDA 5A2CA 2VX4A 1E70M 4DO6A 4UFMA 2OWCA 5D8ZA 3T08A 2D1ZA 3M7SA 3BUIA 2XIIA 4UOZA 3WNLA 5M17A 3WQ4A 3UG5A 2A3HA 4Z2KA 2FHCA 2GK1A 2E40A 3CZNA 3CH9A 1UZ1A 2WC7A 4M24A 1V08A 1W3LA 1LWHA 1W9DM 5CQ1A 3AIRA 5JIWA 5ABHA 2DT2A 1CGXA 5BXPA 3L2LA 3ARWA 3CZJA 2GJRA 1KXHA 4XX6A 2QPSA 1ZBVA 2D22A 1EHAA 3GXTA 1H1NA 2BHYA 5GNYA 3VD4A 1NM9A 1B31A 1HL9A 4GIAA 1GOOA 3CHFA 1O7DC 4P8XA 4GQRA 4JL1A 2WW5A 3WY1A 5ABFA 5JIPA 3SEPA 2X1IA 2QF8A 3VGBA 4CCCA 1GHRA 4DO5A 3RJYA 4D6GA 3EDFA 4E2OA 1MFVA 2CXGA 3WUEA 4GINA 2EPMX 2OWWA 3SUWA 4W7VA 3MUIA 4CD5A 2XGIA 3M46A 2CYGA 4HZ8A 3AMCA 4UTFA 1PBGA 4MADA 4OIFA 4P8UA 3GXDA 3AIEA 1UH3A 2DT3A 1OD8A 2J7BA 4HPHA 3AXHA 3WDHA 2ZUVA 7TAAA 1X6NA 1MW3A 1PS3A 3T2QA 1TR1A 5A8PA 1HJSA 2EXOA 3B9AA 2AOSA 1Q6CA 3W6MA 1V03A 2EADA 3HU7A 1JIBA 3VIGA 1FHLA 3W6LA 1E6NA 3WFZA 1JNEA 1JF5A 3CBWA 5BXRA 4PSRA 5JBDA 4A3HA 3BVXA 3BAKA 1JI1A 2PWEA 3N12A 1GOIA 2Y8KA 1E6XM 5DMYA 2GFTA 3F4VA 1QVBA 1CXIA 1TG7A 1WE5A 2VRQA 3BVWA 4DWSD 3A21A 4M82A 4LYQA 3K8LA 4TTGA 5GPRA 1W1TA 1Q6DA 2YDQA 1WNOA 3FHAA 3A6OA 1QBAA 2OSWA 1ZU8A 1FP9A 5D8WA 3VSUA 2XN2A 4NZFA 2DPEA 2XUCA 1ZBCA 2GUYA 2V3EA 4AD2A 4N0RA 1ESWA 3LXAA 3VM7A 1EH9A 3GNPA 2X05A 2BFGA 2O9OA 5A1AA 5A2BA 1E6ZA 3THCA 4J27A 4U3CA 4ZFMA 2XFYA 3GXNA 2D0FA 2EPNA 5AC4A 1U33A 1MVYA 3IJ8A 1R34A 2ZX7A 4Z2IA 1G9HA 1MXDA 1C92A 4TVDA 3QOMA 1GOWA 3GNRA 2TAAA 1IZJA 3NSNA 1BF2A 3U5UA 3WDIA 2X2YA 4CVUA 3AHXA 1TQVA 1ZBWA 3WF0A 3K8MA 2QV4A 5A8MA 3IGUA 5TD4A 3PZIA 1JYNA 1G94A 4M81A 1FH8A 2J8GA 4B15A 3QGVA 1WO2A 1UKQA 4WKHA 1KR1A 3A4AA 1HL8A 1FP8A 5JBFA 5E70A 1D7FA 4D6JA 4AZCA 3AISA 4UQBA 3WSUA 1C93A 1PEZA 4NF7A 3QHNA 4JKMA 3N9KA 3GM8A 3K4AA 3LXCA 4MB1A 2WMKA 1V3LA 2WVTA 3D3AA 3S2CA 1R46A 3WL0A 4B3LA 2W67A 2WHKA 1HF6A 3POHA 3IAPA 1VEPA 3BGAA 1GNXA 4P7OA 3NDYA 3UR7A 3VD5A 3ALGA 1Q6EA 2X0HA 1JD7A 4BQ4A 5CPQA 5DT5A 1GOKA 3IANA 5I5RA 3HZ3A 3CUGA 3WFLA 1QBBA 4D71A 3WDQA 1CGVA 4OBSA 1E55A 1R85A 2ZIDA 1MFUA 2WB5A 1IV8A 4HMCA 4FNTA 3WBEA 1H0IA 4KRUA 2ZWZA 4PYSA 1CGUA 1UA7A 2ALWA 1CXHA 5HXMA 1J0YA 2PWGA 2VVSA 5ABEA 1J0JA 2C0HA 5AYIA 3FXYA 1YHTA 2V5CA 3NJ3A 2F8QA 1VFUA 1E72M 4QLJA 1HP4A 3PTKA 4ZE4A 1XYZA 3PZNA 2JALA 1V0KA 2PWFA 4WF7A 3N15A 1BQCA 1ITCA 4EAMA 3VOCA 1XYFA 1EA9C 4Z2JA 1JG9A 4UQDA 3CUJA 1CXEA 2XTKA 1KBBA 2ZICA 1DWIM 1QHOA 8A3HA 5DO8A 3WELA 2XWDA 2JEPA 4PTWA 1UWQA 1H2JA 3DX0A 5CSYA 5FOOA 1KR0A 4AZGA 4OGZA 1I1XA 1JFXA 1QNSA 4ACYA 4NXKA 3LRKA 3LRLA 3L4YA 4J3SA 1XC6A 3TP4A 5BYWA 1W3JA 1JGIA 1W32A 1YQ2A 4Z2HA 2DH3A 1RPKA 4H7VA 2D2OA 4C7FA 4PCSA 5LA1A 2OWXA 2PC8A 2WHLA 3F5KA 4JHZA 1GJUA 3N17A 4CCDA 4DUVA 3DHUA 3AHVA 1TVPA 1US3A 3GXIA 1BGAA 2YLLA 2V3FA 3WQ5A 2XG9A 4OKDA 1QNOA 3L2MA 4W7WA 3VGDA 4MB5A 1CGTA 3VPLA 2XN0A 1LF1A 4GI8A 2E9BA 1XSKA 1BGGA 3WUFA 1DHKA 2OYMA 1UA3A 4LPCA 3BXWA 1H11A 1VFFA 1L0PA 2E8YA 1WDSA 2NT1A 3SCWA 1A3HA 3AXIA 5E0CA 1TE1A 4E8CA 5M03A 4KRTA 3NIYA 4PUDA 1FFQA 1W9XA 3AIVA 2VMFA 1HIZA 3K1DA 4AYSA 2CESA 1M03A 5I23A 4IPNB 3DX4A 3PN8A 4PRWA 1QI4A 4XUYA 2WVSA 3PBGA 2D73A 3D4YA 4PMYA 1HXKA 3N1AA 3W82A 4P7LA 5FCZA 1FH7A 2G3JA 3SCVA 1XCWA 4EANA 1F4AA 1OGSA 2WXDM 1FFRA 2FHFA 3POCA 2GJPA 3VMNA 4DUXA 1E5NA 1W1VA 1KQZA 1OCQA 1UWTA 5I79A 2CBUA 2UY3A 2WLYA 4QP0A 3VDBA 2D0HA 3HN3A 1OT1A 3LMYA 4AIEA 3VGHA 3BAYA 1HVXA 2GK1B 1GVYA 3GH5A 1KTBA 5CZKA 2VCCA 4CD6A 2FGLA 1UKPA 3ZSTA 4OBRA 3AMKA 1QNPA 3H55A 1TUXA 3S5YA 1NOFA 1UZ4A 4FNPA 1LG1A 4HOWA 3PZ9A 1PZ2A 1XH1A 3T09A 1BVZA 1PZ3A 4D6FA 5DT7A 2VCBA 4AD0A 1IT0A 3MMDA 1WDRA 3QR3A 1B3ZA 2O9RA 4QCFA 1E0WA 5HPCA 5E09A 1JZ5A 4TTUA 1VIWA 6TAAA 4AMXA 3O9NA 5A2AA 2FGZA 1E4MM 4IPLA 3DC0A 1HJQA 2MANA 2VJXA 2XM1A 2Y24A 2X8RA 3RM9A 2WKGA 6CGTA 3AMGA 4FMVA 3VVGA 2ZXDA 2Z1KA 3MUY1 2HVMA 3F5LA 1Q4NX 1TA3A 1NARA 4JAWA 4U2ZA 1RH9A 1XH0A 2WWCA 3MMWA 1OM0A 3HG2A 3OB8A 3A22A 2OYKA 5EFFA 3GDBA 2WBKA 4CN1A 2ZX8A 3B9EA 4J3XA 2DSZA 4MNMA 2IGTA 4WSKA 4PMUA 1QI3A 3TTQA 1O6IA 3OG2A 1VEMA 2WMJA 2JEQA 4L4PA 4V28A 2XFRA 1UD5A 3CZGA 1E0XA 4DO4A 3U5YA 3BAXA 4WJXA 1WDPA 2JFEX 1R87A 3DDGA 3KL0A 4OJYA 5I6SA 2DSKA 2G3IA 5CJ5A 1W3KA 3ZMRA 1EGZA 2PWDA 2DSWA 3VIJA 4GI6A 4M56A 3VSTA 1CNVA 5A6BD 2UY4A 3AIBA 1WP6A 2YOCA 1B9ZA 4MNKA 1VJSA 1UWRA 3U7VA 2XHYA 3O2LA 4D1IA 4PTVA 1WAWA 2E0PA 5IFTA 2VUYA 4CKQA 4FNUA 3WL1A 3W38A 5HOSA 1UUQA 3B9DA 2NT0A 3CLWA 1SFSA 2WLZA 4D6IA 4YN5A 4PMRA 3AFBA 3DHPA 3VIOA 3VDCA 3ALFA 3GBEA 5CGTA 4PMOA 3BAWA 1O7AA 1EOKA 1CEOA 2QPUA 1GQLA 2CBIA 2XGBA 3AS1A 1JD9A 4D1JA 1DEDA 2Y8VA 1V3HA 5CPTA 4H2CA 4QLLA 3WY3A 1FHDA 1KCLA 1E3XA 2BY2A 3MUZ1 1RD6A 2BNJA 3AYRA 4JHOA 2J7DA 2CBVA 3BCDA 5D4YA 3RMEA 4U5KA 4B9YA 1HXJA 1JYXA 4PMNA 2O92A 3PZOA 2ZX5A 4AZCB 3AS3A 4GO8A 3GBDA 1K6AA 2CPUA 3VTRA 3NDZA 4D6CA 1ISWA 1UKSA 1X6LA 4CGTA 2XVNA 2WCAA 4NSBA 4J28A 1HTYA 1XD0A 4RE4A 1OIFA 4W87A 3OZOA 5CGMA 5BROA 3WQ6A 3VGGA 2V3GA 5BXTA 4R5EA 3WF2A 4H41A 3TOPA 1H49A 3A4XA 3DYPA 4C7GA 1MWOA 2J75A 3ZJ6A 5AY7A 1HWWA 3BMVA 3BAIA 1NOWA 1U30A 5LA2A 2WC4A 3BLKA 2WMIA 4WKAA 5HPOA 2EBNA 2J25A 3BUBA 4U33A 4CU7A 2B31A 1ISYA 2D24A 2BXYA 2A3EA 3W53A 3ZO9A 3B8SA 3FAWA 1HKJA 3CZLA 3WNKA 4N42A 1V02E 5BRPA 2F61A 3QHOA 1TQSA 1V0NA 1E40A 3ZT6A 2G8ZA 1ISZA 1E4IA 3WH8A 6A3HA 4X0NA 4ZXLA 4FLSA 4GPNA 3E1F1 1DWFM 1V6YA 3CZKA 3VX1A 2WHMA 5CXPA 3BVUA 1G5AA 1ISVA 3CTTA 2J62A 3U57A 1CDGA 1ZB5A 3I3DA 3VUPA 3WD4A 1DWAM 2G41A 4GQQA 4AMCA 1KGXA 1JDDA 3HG3A 3ARUA 1E6QM 5C71A 4HZ7A 4JFSA 4PUEA 1E71M 1V0MA 4JFWA 3VILA 3AYSA 4NRRA 1GCYA 2D23A 4CN4A 4TXEA 4H8HA 1GHSA 1B3XA 2CCRA 4QAWA 4QLKA 2VR5A 3MO4A 1AQ0A 1UQZA 4GXPA 1JZ3A 3VDAA 3SCQA 4WLCA 3CZSA 1TQUA 3KL3A 2G3MA 3TV8A 1LG2A 4UR9A 4NZJA 4KGLA 2OSXA 3SCRA 2J77A 5IHSA 4ZE5A 1QI5A 3JUGA 4JKLA 1E6RA 5A6AA 3TTSA 2CNCA 1KGUA 4BZYA 3WEMA 3VGFA 3S6TA 1OT2A 1SMAA 3WNNA 4BCEA 3IAQA 1QWNA 1V02A 1T0OA 3AOFA 3BMWA 1V6UA 4HTYA 2DSUA 1BG9A 4RE2A 1LLOA 4F9DA 1WPCA 4W84A 2DH2A 1D3CA 2VO5A 3PTMA 2EABA 4TX6A 1UD8A 1PAMA 3CGTA 4MNJA 1W1PA 2F7QA 4HA1A 4Y7EA 1KGWA 1UYQA 4XZBA 2C8NA 2QMJA 4JKKA 3ZJ7A 1WZMA 3BAJA 3ARYA 1M04A 4NX0A 4LYPA 4J3VA 1OSEA 4HU8A 1CXKA 2QLYA 2XVLA 2XSAA 1N82A 4RE3A 5KEZA 3TTOA 3OGVA 3F5JA 3UESA 1JYVA 1CBGA 1UR0A 3HJEA 1K9TA 1BAGA 1UR2A 4U5IA 3CHEA 1E4LA 5LYRA 4AYGA 2A3AA 2FHBA 1CGWA 2WKLA 1LQ0A 4M29A 3MI6A 4J3UA 1LL4A 1NP0A 5EMYA 1KBKA 1ZS2A 2YA1A 3CIVA 2UWFA 4B9ZA 1HJWA 1JZ6A 1W1YA 3RPMA 3N13A 4CCEA 4RL3A 3ARQA 3LPFA 2OLHA 4ZENA 5JBEA 1WZLA 1V3JA 1UR1A 1V3KA 1QOXA 1H41A 4UFLA 2EEXA 2XPKA 3FW6A 2JIEA 3OIHA 4TVCA 5AC5A 1SMDA 1XSJA 3TTYA 4W8AA 3CHDA 5A6LA 1CYGA 1LL7A 3KZSA 4BA0A 3ZIZA 5BXSA 3SUSA 4H8UA 4ACZA 4AZ7A 1QNQA 1J11A 4D6EA 2GDUA 3A23A 1SR0A 2WYSA 5D9OA 1CLXA 1FA2A 2F1BA 1MW1A 2IXUA 1C91A 1MYRA 1J01A 2D0GA 2W5FA
chains in the Genus database with same CATH superfamily
4KEVA 2D8KA 1IX2A 3E5PA 2X4NA 4HC1H 1ONRA 4I9XA 2Y2WA 3UTSD 1V55B 1MHHB 1SY6A 4JPVH 4KETA 4WTWA 3PAZA 3Q2VA 2WV3A 3N1PC 2NQDA 3TFKC 4WR3A 4MAZA 5FGRA 3O0KA 3VXSD 3QO1B 1CVRA 1OKEA 1XH3A 3TYEA 2DJ4A 1F4WH 3FF8A 3NEOA 1TVNA 4LCSA 4OF7A 3CHVA 3DGCR 3W2LA 3AB0C 3L3JA 2WZPA 2NY6D 3MA7A 5IMOA 4QRSB 2JKTM 3EYSH 2NXIA 5CBEA 4JTTA 4NPYA 1QDSA 1HCYA 2VX7A 3C87A 3F2LA 1R33A 1AE6H 2VLRA 2VZVA 3V6OE 4OFYD 3O0FA 3EW3B 4R26H 4X7FC 3SGEI 1RBAA 2KL6A 4P2CG 1IEQA 2PXYD 3MSRA 1R86A 1AK5A 1S7XA 4M48L 5I73B 3G9AB 4FTVB 3PWUA 4S2SB 4NJHA 3CFBB 3T6CA 4DWSA 5CZVH 2PBGA 1FRGL 2UVFA 2GDVA 2GCYA 1B2WH 1T1ZB 1MREH 5E7BA 3RXZA 1IZCA 4RGNE 1YDPB 1FGVL 1HE8A 1NGZA 1C7SA 1SDYA 2Q8AH 3WL9A 3TBSB 3D2TA 3PUUA 4KNTA 3O8XA 1KB5H 3MA9H 2QUMA 4MRCA 1L6XA 5IG7B 5C2XA 1RV6X 5HGDB 4HHAA 1EOMA 3WH9A 2MQ0A 2DYSB 2OLSA 1UZ8A 5D1ZB 4H1LA 2WMIB 1OGPA 3AXLB 4LT9A 3HZMB 1PB0A 1I3GL 5AYBA 3E0GA 3QIWD 4IRSD 2WZ6A 3SKJH 2YJQA 2R15A 1XG4A 3WQ8A 3OZPA 4U3SB 4KRPD 4CC4C 3H9YA 4FK9A 3BQ6A 1A14L 1IJ9A 4ZTYA 2ETWA 3GMQA 2MCAA 3CV5A 3KLQA 4JRXA 4FXRA 4P5MA 4DTGH 4EXKA 5DCBA 3HGRA 4N0UE 4HZ6A 4NX5A 1LZOA 2BNQD 2OJZH 2PN5A 5EU7C 5IFAH 5KN5B 3LGGA 25C8L 2FCBA 1GKQA 3HRZC 3IU3A 3ZJKA 4WNJA 1BG1A 4G6KH 1MF2L 3KJ6L 3NSXA 1FWNA 2QR0B 5D8JH 2CLOA 3B06A 1F3EA 4M43L 1UVQB 4L4VE 4QRNA 3TVMB 3TC7A 1Q45A 1U8QB 3NVQA 4BS0A 4MA3B 2NXZB 4E4PA 3IVKB 4O1FA 1Z2KA 2C4FT 3UDWC 4QQ3A 3ZYJA 2P4AB 4N2NA 2CXEA 2V8LA 1CDJA 5KSAB 4F9JA 2FE0A 3BUYA 4BFEA 3H1ZA 4Z95L 1K5NA 4HK0A 1OGTB 3VIIA 1T1WA 4Y9CA 5LIKX 2FWSA 3Q01A 1JHLH 3MLTB 3C0JA 1SJHB 2HA1A 3D4CA 4KKBD 3K4WA 3NFSL 5DWUH 4N3UA 3TROA 2UV8G 1MIEH 3K7UA 1JRHH 5DQDL 4DJEC 3SY5A 5HI5D 4JTJA 5M94B 3G1HA 2NLJB 4PWKA 5D9NA 2XOTA 3CQPA 2HB0A 2RJMA 4JFZL 4Z7QF 2DZAA 3TFCA 2CMRL 5KVMC 1GVIA 3FN9A 5F9AC 2BHZA 1YN6B 4S3GA 4ZO6A 3W7HA 2ESVD 5B1JC 3BT2H 2DQMA 1LLZA 2UWEE 4PRIA 4ONFH 3V5DB 3MJ9H 4D8ZA 4JZOA 2DQEL 2DLTA 4Z0XA 5B1BB 4M4RB 2J8HA 2YPKA 2WVUA 5DHDA 3NEXA 4JTRA 4P9HC 2A0LC 4H9UA 4LOFA 2JJSA 3UERA 1SHSA 4BDVA 1O95A 4O16A 4Y8EA 1AZ2A 1P0BA 1EF2A 4G5DA 2ZG3A 1UH4A 3GMPA 2YZ8A 5ICYB 5B4MD 1NDMA 3MI3A 4MCNA 5ITBH 2V5JA 1E0TA 3MLUH 1C8YA 3KOFA 1VP5A 1GIGL 1E1FA 4HGWB 1SDDA 3B04A 5DFTA 3FT2B 3I3BA 4R7XA 4Y4KD 4X99A 1QA9A 2J1YA 4X5XA 4H20L 2CSPA 3QLDA 1LROA 1XCQA 1DO6A 3CUHA 2BVPA 2UXFA 1EO8H 5EIQA 3M8OL 1SO3A 2Y0SA 3SYOA 4AQAA 2Z92A 3QH2A 2GY5A 4JRXD 5T3XL 2YPLB 4DETA 5AHIA 4GNJA 4XO3A 4N2LA 2P8BA 4K71B 4WWKB 3MSPA 2VFDA 1HHGB 2R1KA 2J6WA 2IPFA 3TLLA 3ONCA 1JUKA 3FKKA 1VHCA 3GZ3A 2ZZ6A 3QO0A 1Z9LA 2R56L 1RBOB 2Z31A 2BS9A 3GKFA 3K46A 1KLUA 3IDYC 4O2FA 3P84A 1W8SA 3OKEA 1XF4B 1XGPB 4XXWC 1RZMA 4E5XB 3KVQA 4HW6A 5I5IA 3FONA 4PJAF 5DK0A 2IH1A 2F1AA 1TA3B 1JDCA 5JH1A 4DZ8A 2PU1A 5BW7A 1MZZA 3TBBA 1HL2A 4FR1A 1NKGA 4TQ8A 1DQQA 4XBKA 4IMEA 4P9HL 4F0RA 1TXKA 3BCFA 3KPLB 5MEQA 1FNHA 1N8ZB 4NKOA 1MRFL 2FL5B 3VXOA 4TNFA 4OM1L 1IE7C 1QU4A 1Z5LA 1XLAA 2YXMA 3QV6A 3E7JA 1WDAA 3WMQA 2IFFL 1KXVC 3U36A 2YGNA 3EJZC 1S7UB 3CHSA 2WANA 4ETQB 4IQEA 3W76A 5AYUH 4H40A 3PSVA 1PPIA 5AENA 5HP5A 2NYZA 4OI9A 3K6FA 1FWCC 2EDDA 5DY3A 3WJMA 3SURA 1BKHA 1SHWA 5K9KA 3CBJB 3KYNA 1I1AC 3GTNA 3QORC 1A1OA 1OTSD 2R2CA 1BZDA 3DVNB 3SN4A 1I7ZB 1WBJA 3Q9PA 3QDMA 3IDJB 2PTTB 3DTDA 5A6KA 2VFHA 3KP0A 1H8NA 4PBVC 1MRCL 5F70A 2XN1A 5JHLA 4LKCA 4XNMB 2NWSA 4Q7IA 5E4OA 2OCFD 1DQJA 4MDIB 3V6ZA 2OZ4L 4L2YA 4L4VB 3S8FB 2EJAA 3UAJC 1A0QL 12E8H 3U82B 2XJ7A 4YSEA 4MWAC 4Y6GA 4OZHA 2F7PA 3UA4A 4PYHA 4QR7A 1HNFA 1J6PA 3VD7A 3C6EA 1K8ZA 1NWRA 2CHRA 4GZIA 1R9YA 4TQIA 5FB8A 5H94A 4WU7B 3FTGA 2J4WL 4EN3D 1G01A 2OI9B 3BH4A 4KQ0A 3BRFA 4IRZL 4XZUB 3ORWA 1JMXA 3CV2A 4WQ6A 1RZ8A 3BP6B 3BK0A 1IKFL 1HAWA 3KPQB 2WQ8A 3W1AA 2IDCA 3GG1A 5ESVA 2YL9A 4XGZB 1Z7AA 4V1DD 4JIEA 3VCCA 2JCWA 1SOQA 3G3LA 3MKGA 4I85A 1WF5A 4JO3L 35C8L 4AENA 1DWHM 4FSAA 5HHQA 1MCOH 5E6IB 5JPNA 4GLRI 2ERJC 4K8RL 5CEZL 4MLRA 3V8CA 3NQIA 1R5IB 1F4YH 1ZDQA 5JW4Q 4PSPA 1SQMA 3APGA 3O06A 4NZUL 5JHDE 5B22A 5B39B 1OW0A 4DM1A 3IJ9A 1FZOB 2PTVA 4ZAKB 3MRMB 2MRYA 3QHZL 2YN5A 1T5XA 2UWEB 3BPLC 1W8OA 4M02A 5DUJA 3GFUA 2DL2A 3F05A 1RSCA 5MKGB 4OZIA 1W37A 3TYFB 5K33A 5ECJE 3RVXC 2VZ3A 3N43B 3SY0A 4C60A 4M7LH 3TN6A 5CMAA 5SX4H 3I68A 5CILH 4PJCE 1CD1A 5IBTH 3W7RA 4PJBA 3O15A 4WI0B 4YHPA 1V08A 1P0EA 4O19A 4BUQA 4GQZA 2YXFA 2Q3XA 4P2QE 5BXPA 3RVVD 3LNDA 3K6SB 1P1ZB 5FUZL 5F2MA 3MJWA 4TN9A 4HIHB 4BK5A 4IIQB 3DFOA 4F15B 1QUNB 4J35A 5FFGA 2VDRL 4L3ED 4Q7BA 3DO7A 5G5IA 2LAGB 4D6GA 3EDFA 2NDFA 1W3NA 4M7JH 4FADA 4W7VA 3GLEA 3CPRA 3CVHA 4KK5C 2ADAA 5FCUH 1CTMA 4G7YL 2VELA 1P9MC 1NLDL 1NCHA 2BVOB 2CK2A 1GTHA 3P1VA 2J7BA 4XVJL 4HWZB 3WKML 3O45A 5I1CH 3HE6B 3OJMB 2YYTA 3OWEA 4DEFA 2EADA 2X9YA 3DOSA 3UTZB 1CICC 3RGVD 3OVUB 32C2B 4I7ZC 1IFHL 3VOIA 1H19A 3A21A 1ANUA 1W1ZA 4GSDL 4NQEA 2J8UB 3ME0A 5D4JA 1FFNA 4QE4A 4E0CA 1G4TA 2HVJA 1J05B 4KZCA 3WV0A 2Z8WC 1S7WB 5FECA 4QRQA 2WTOA 4HHMA 3G04A 5FI8A 1NLBL 4U3CA 2EXWC 2GJJA 3GXNA 3AU0A 2OPJA 1X4ZA 1ADDA 3GNRA 4HCRA 2AANA 2R2BB 3HPXA 2QV4A 3ARDB 1G4SA 6REQB 1QUPA 3OKYA 3DSNA 2BCKB 2ADIB 4OQTL 4X6EB 2OFQA 3A4AA 3SAZA 1XLKA 5T1KA 5H4ZA 3GM8A 2OMUA 5JZ7C 4J1UA 2ITEA 2EIBA 4M5ZL 1HF6A 4KXAA 3GO1L 4F1ZA 1GNXA 4P7OA 2XYBA 2A6JB 1YEKH 3UR7A 4MS8D 4MMXB 1BVOA 4GMSH 4UV7L 5B1CA 1QBBA 1KBWA 3L5WB 3TBYA 3FCGA 1J4EA 5DQJB 4LMQI 3FUEA 3NFNA 1F6KA 4I77H 4PGDA 5DDHB 2O5ZH 1KFAH 3BLIA 1YHTA 3G6AB 5DLLA 2D4DA 5J11B 1XKYA 2DN7A 2Y61A 1A7PH 4ZE4A 4YVNA 1P5VB 4G8FA 4M1DL 2GPTA 3PZNA 2FT6A 4KOBA 2PDIA 4JD4A 2OTDA 3B8DA 3NJXA 3GWJA 3MOBH 4P2YA 4WHYH 4WSHA 4DKFH 4G7VH 4FQCH 4JGJA 1CUOA 2VFGA 3RX7A 1LEIA 2JEPA 2E9JA 1CD9B 2PKDA 2BWDA 4HK7A 3NQDA 4FJZA 1WTLA 2K7PA 1ECQA 1H8SA 2HVKB 2OR9L 4RZ5A 1O6VA 2WM1A 5DZ9A 2F74B 5LA1A 4RISL 3D0VA 2PC8A 4OD1H 5LQBH 2H9AA 1AQFA 3LYRA 1E28B 1W6WA 4IBWA 1BAFL 2P88A 1MY5A 3CSYA 4TL5A 1RH8A 3W5MA 2JKJA 3WUFA 1VFFA 1NFIA 4FS9A 3EA2A 2YD7A 5E94A 5H37G 3PL6C 1U5JA 2EINB 4JPIB 3TAKA 2HXAA 3F3HA 3GXUB 2YD9A 3WE6A 3QUYD 2CIIA 3CFQA 1E90A 4XUYA 5TFSH 4RBPH 4NZDA 3HBQA 2DRUA 3G5ZB 2OTUB 2V9UA 3SCVA 2ZKWA 3MT1A 5F4SA 1HWGB 1X5GA 4MY1A 2DD8H 1XWVA 4LRTA 5DVKA 3T8MA 4KJQC 4EAEA 1ESOA 2ZADA 4X6FB 3DO4A 3ULUL 4FX6M 2P7TB 3SDAD 4AH2B 3FQNA 3O07A 3QK0A 1J5OH 2H1XA 4NN6C 1UKPA 3ATBA 3JVFC 4FNPA 3PG8A 3EJCA 1U93B 1UC6A 2R1XA 1PZ3A 3EYQC 4TL4A 1AHWC 3SE3A 3ILPB 1YJDH 5JHDB 1B3ZA 1XL4A 1E0WA 2VQ1A 3B6SB 3O9NA 3BVNB 5EU4B 1IBGL 4AC2A 1FZKA 4YHNB 3D3VE 3P0VH 4PW3A 5FW7A 4OLYH 2CWRA 1G9NC 3W7QA 4EDWL 1DBJL 1YPZE 2PDGA 3OSKA 1KJ2A 4GYPC 4KO5A 2VDMB 1PZ0A 4PJCB 3HAEB 3QZBA 3HC2A 3KZPA 4Z3EA 2WBKA 2RDUA 1PLGH 2IGTA 5DS1A 3FCBA 4MNQE 1L6GA 5F21B 4JFXB 4P2QB 4QHUB 1MJ7H 3ECUA 2JEQA 4KX7A 3CSTA 5DA4A 1L6YA 3KL0A 2GBTA 1CLZL 3W2DL 2OMZA 3KX6A 4S1RL 4M56A 4DW2H 3PNUA 1A2YB 2Z6FA 4O2CA 3FT3A 3W75A 1BVKB 5F1NA 4D1IA 1XGUB 4QHPA 3D69A 4L8SB 3GSWB 5FEPA 2LVCA 1ZXKA 4NUGL 3QEGL 1BQRA 1ORQB 2IQ9H 1UUQA 3V0AC 1OC5A 4N2MA 3W11D 4HGXA 4YDIH 3TYAA 5H8UA 4L5FL 2IPKB 1WXZA 3N5AA 2A74C 3T40A 4H44C 2Q86B 4WO4B 5E4EC 1KV5A 3NIFF 4R7VA 5I5MA 4K9EC 1RD6A 1EWHA 4KZEL 2WQWA 2CBVA 4Q8OA 3ULSA 1RURL 1H5BB 2HFGL 1YNTF 5FJUA 3DETC 4MD4A 1X6LA 2V5BA 4CMMA 4KQ3H 3HBZA 4MCYB 3LKNB 4W87A 1LMIA 2APTA 5BXTA 2YZ1A 2GB2A 4M3KB 5BVJA 2G5WA 1BFSA 5D7LE 2J75A 4HHWA 4OFPA 3DOHA 1RVKA 1S5TA 3CPLB 1E9QB 4PVBA 1BVLB 3PV6B 4CU7A 1P7QA 1IIKA 2VHLA 2ZZ1A 2E3VA 3STLB 4JO2H 5HDOA 2ZOLB 5I3FA 2V2XA 4GP8B 3LK6A 1M9WA 4B4HA 4KESA 5FLVA 4KVCL 1WWBX 4HU4A 5GHWL 3ESPA 4RNJA 2E6AA 1EYEA 1F1GA 1G9NL 4X7CC 1VBGA 3WD4A 2BGQA 2G41A 1C5DB 2BWGA 4YSTA 1JDDA 4ELKB 2V8ZA 3WXVL 3AYSA 3BWAB 3OAZH 4CN4A 3WN5B 3UBHA 1ZT4A 3ANUA 4XBMA 4WLCA 2Z0UA 2XH7A 1TYRA 4UR9A 5REQA 4F37F 2HWZH 1KCRL 3FUFA 3H26A 3E0IA 1NEPA 3O41B 4UC5A 2IXQB 3U6WA 1GHFH 1RK6A 4RE2A 2ISVA 4NO0B 1AGFA 4O14A 5GRUH 2R29L 1D5ZA 5IRPA 2X6AA 1UYQA 4L8DB 1WZMA 4OY9A 3AVEA 3V0UA 4NIYE 3OX8B 3SDOA 2IV8A 4LVOC 3TTOA 4OIIH 4L29A 4E5XG 4UTBA 3J2PA 3QEQD 1DBML 1A7QL 4EDXA 2BNRE 4KJPC 1BAGA 2DI7A 1OARL 1U8OB 4P4KD 3OKLA 4HWNA 3D30A 3PY9A 4BIKA 4K3EL 1AD1A 2NLYA 1QOKA 1ONXA 4ISVB 3SPIA 3UXAA 1XIJA 3IRPX 1SW0A 3MJ8B 3JWNC 4RV3A 2FX9L 3B4NA 1INDH 4Y2NA 4N0FB 3T4AB 1TJRA 2XQ0A 3ARTA 3WLLA 1XGYL 5F97E 4OGYH 5TE4H 2CU9A 3EJUA 1FO0A 4AZ5A 3GI8H 3QHFH 4WXZA 3UXKA 3ECBB 4AZ6A 4KJYB 1IGJA 1ZBKA 2H32A 4WRHA 4TNVF 2ZE3A 2F19L 5BJTB 2FEDC 1PYWA 4IUOA 3BFQG 2ZSVA 3WK2A 1B88A 1DYZA 5J1AA 5CZJA 3UR5A 4GISA 2BIPA 2V2WA 4MVAA 2CERA 3FZUC 3H6AA 2DM4A 4ESKA 5FWRA 3I65A 4F5CA 5I18H 1UASA 3C3NA 2YFOA 3T71A 2NY3B 1JZ4A 5GZNA 2YDRA 1L9MA 4PY7A 4C54A 3D3VB 1GAFH 4JAMA 4HCGA 4KI5F 1QLFA 5I28A 1MAMH 3PABA 3WDRA 1KJMB 1YPZB 3V0WH 2V5LA 3DX6A 2XWCA 3HHSB 4MNQB 5L9DL 1L7TH 4LF3B 4KAQL 1GOGA 3L3DA 1ZGLA 4RBPK 3D5OF 4UT9L 1CLYL 1YMMA 4R7DA 4NO2B 3WGUB 3JZYA 3C2OA 1EJ6A 1ZA6B 1LQ2A 3FYYA 1T66D 1Y5WA 2CJUH 5F7UA 1RLWA 4FFVD 3SB3A 1UR8A 4K23H 4LHUG 4FX5A 2XG5A 1A1MB 4XO4A 3G5VA 5B39G 2PABA 5LAXB 1NC2D 1YNKL 2NX9A 1V7AA 3F01A 4WK2B 3S1GA 4RFNC 2YL8A 3SPVB 3HPFA 2F7OA 2R4SH 5DX7A 2C6QA 3W7JA 4FQHA 1U58B 5DJZB 1K9FA 4GJTB 3MGOB 2AEPL 2GGHA 5F1SA 4C90A 1DVJA 1MFEH 3UVAA 1H5YA 4HLZH 4Z3FA 1UXWA 5D32A 4M03A 2CBQA 1GKRA 4LOUD 2YSWA 4Q22A 5KS9F 2ZDSA 5DJ2A 1A4LA 5BRZE 3C61A 5D7LB 4Z1CA 2NDGA 5EMUA 4XP5L 3AHZA 5DD0L 4G43A 3TJHD 2ZQ0A 2UYLB 1P6FA 5E2WH 1WZKA 3UA3A 2J4GA 4K6AA 4G1NA 1GY1A 1QLRA 2EE3A 2KC0A 1UB5B 2PDQA 1PMYA 3EKCA 3LQZB 4RFOH 5KG9B 3BL3A 1PDKB 4OOZA 3THAA 3HE7B 1ODUA 2R94A 3C8DA 4PRRA 3M1OA 4Y2DA 2Z1WA 2IF7A 2I9EA 2VFIA 1AXSA 4UDTA 4C56D 4NRZA 4AEHL 1T80A 5ALCH 1KFCA 5FESA 4JICA 1AGDA 4PJ9B 2WNZA 3U0TB 4Q8PA 1K7XA 1LCOA 2ZG1A 4KHTL 3S97C 2P3EA 3OMAB 5CIPA 1IAOA 2H3NB 1DDTA 4HOZA 5G2WA 1FFTB 1LUCA 1M7IA 3EGXB 4ZK8A 5KVDH 3VKJA 3SDDA 3O6CA 3RTLA 3LOTA 5HNRA 1TV2A 4QNEA 2UUDH 1IO4C 1TTPA 5KZCB 5I1AB 2EYTB 5JDSB 1EXBA 4ZZFA 4IXXA 3FQ1A 1I4NA 3KM8A 4M6UA 2KI6A 3JWOH 3GSQB 1GQKA 4MZRA 3AG3B 5I0DA 5SWQB 4Q8BA 5I8CB 4BI7A 1AGBB 2QADC 4G59C 4YDMA 1EQPA 1U8JA 4ANKA 4JZJC 2R7EB 2QDEA 5E1IA 1VLWA 3WJJA 3I7SA 4KH2A 4ZUUB 1KTDB 3VQ2C 4OVUA 4NZRH 3FOMB 3AC0A 3KYMA 1MQPA 4FFZL 3KZ8A 4WWNA 2V9TA 3SJ3A 4HHPA 2OG9A 3O3DB 5JW4N 3RF9A 3X3FL 2CDGB 4J2PA 2IWEA 4MGGA 2PFHA 5C3LD 1N8FA 3GUGA 4EKJA 4I13B 1QFPA 3FFCD 3HMXH 1TQTA 3GKAA 2W91A 4GW5A 4H3DA 4GQ9H 5DFAA 5DS8A 2QUUA 4HWEL 4A3YA 2BW4A 4Y19A 2ACRA 4ZG1A 4P3CL 4FKHA 5BU6A 5AC8A 3ZOAA 1MSSA 2WWKO 1D5MB 4UOW1 5MEPA 1J5SA 3TEZA 2O5YL 1S7VA 3C6CA 4Y16B 3O9WB 2H3BA 1L9SA 4FQLH 4XMVA 1G1OA 3I2CH 3C8NA 2OTWB 5IBXC 3HI6H 3B0VC 4LAMA 2CLZB 5K9JH 5HAOA 2YLKA 4KV5E 3KL5A 3ASNB 3PAYA 4UINH 3X1BA 2BHFA 2BXZA 2OEKA 3QGKC 2YS4A 3HQ1A 1HILB 1GC1C 2HT4D 1Z9NA 3MV9D 3O7UA 2OSYA 3A24A 1SQ7A 3OAUH 4TUJA 3LBOA 2IDUA 3Q9QA 1FBAA 3FO2B 4X9BA 1E1EA 1OLLA 3E0WA 4B92A 2FX8H 3RBGA 3CPUA 3GU9A 5KTEL 2NR6C 5IV2A 4W9CC 1KIPB 1Z32X 4YNYA 2AJSH 4Z23A 1A5FH 3GJEA 5SWZE 4EAYA 1ZTXE 1H9VA 4K36A 2BVUA 2DJXA 1AHKA 3CNKA 1GOQA 4Y9EA 4M1CD 2X4PB 3QV8A 4KEUA 4YJZL 3AT0A 5KZ6A 3UTTA 3WXWL 3GS6A 3TSDA 1IGTB 5GRVL 3MRKA 1D5BB 3A4DA 3QXAA 4FQXC 5HGBA 2R0KH 3AAZB 4DLFA 5DRNA 5HVHB 2R0WH 3VFPB 1BZ7A 3WUBA 3IVTA 4EACA 1IC4H 4ZFCA 2POTA 5DVNA 3GG8A 1NDVA 3RLVA 3QWQB 3HAEG 1OD9A 1RJQA 4F27A 2Q6ZA 5I77A 3L21A 4FXKA 4JTSA 4PGBB 1R2RA 3AICA 1DEEA 1Q9KB 2HX7A 5BRZB 2ZZ7A 3Q2LA 3KOYA 2RGMA 2I26N 2C9AA 1OYCA 2J57A 2OXGA 1LM1A 4F57L 1OBAA 5KJ7E 3QJTB 2UZYA 2BY0A 5DD5H 2WXMA 3WHXA 1QRND 4LFYA 4F58H 4I18A 2EDOA 4H5SB 1NPUA 3UZJA 2XQBH 4X80H 4NQCD 1KNWA 4O5LL 5ILTL 4N6RA 4FAMA 1FI8C 1GOHA 1SY6H 2HRPH 1EJ7L 1K8XA 3UO1L 1LBFA 1DE4A 5FDWA 3LPGA 4A68A 4YDLC 5I8OH 1GC1L 5EU9A 3QYNA 2K6ZA 4G7EB 1EP3A 4WEEA 1NGYA 1XI3A 3TL5A 3WDJA 1JFHA 5L8LB 1TQBB 2IBZX 3DURB 2P3YA 1JPDX 3TH4T 4QRUB 1Z3NA 2OULB 4M6OH 4HJGA 3LZOA 4LFHG 4DXKA 4PW9A 2LLEA 3DX2A 3KM1A 1MDLA 4AG4L 1YBQA 1R3KB 3WENA 2BMKA 4W86A 3GXMA 4YMPA 4JTCA 3LLFA 1EEZA 4K4KA 1IJNA 4CSZA 1QFUL 1PZSA 4UQEA 2ZRZA 5C0DA 2CETA 3DX8B 4TOYL 1EO7A 2ZF9A 4NJ9L 3LKQB 2GDQA 1ONQB 1ULVA 4QLRA 2ZUUA 3GGWA 4XB3A 4R4FH 3VFUB 1HYSD 1PQZB 3GBMH 3H9SA 5GZOD 3U7WL 1R4XA 1F6FB 4F91B 4MKNA 4EI5C 3FU7B 3I6KA 1EGVA 1T1YA 3UTSA 2ARJQ 2PR9A 3ZVHB 3ML9A 3KH3A 1SXAA 3TN0C 2VSMB 3WD2A 4MJ6A 2YDSA 3C0QA 3VXSA 2F8IA 4GAJH 1ZSHA 2X70A 3BZGA 2WC7A 2J73A 2DBJA 3CJPA 4WV1A 2DQJH 5K9DA 2XU2A 3DBPA 3PB2A 4BH7A 1S7TB 3DV4B 4ZO8A 4CW1B 4TIMA 3QXTA 4HKJB 3RPKA 3K5RA 4XX6A 2W3ZA 2C16A 3E9UA 4H1LH 2YAHA 2F2KA 3OC5A 1DJIA 2B4CC 1VQTA 1DJYA 4GUGA 3ZKXB 3AFLA 1GHRA 3S3BB 4LVHB 4Q0XH 3RHWF 4MHBA 1DIEA 4X7DC 1O7VA 2AEIT 2HK0A 2Q02A 3NGFA 4GIRA 4IHCA 5DFVC 1ZT1A 3LIZA 4FP8H 4RMVA 4OFYA 4OHQA 2WHVA 3SZKC 3NM3A 1X97A 5IWLA 5FHBL 3WEXA 1GVRA 1Q2SA 4DELA 5D38A 3C60B 2UUDK 2PXYA 1M7DA 1OY3B 3CFUA 3LKOB 3M1CA 1ZGDA 1XYAA 2UWEF 4A7UA 2X7LB 1OP5H 3GEFA 1T3FB 3N43F 1AKPA 3Q8FA 2OL3A 2EKSA 1WNOA 2DQDL 5IB2B 1FP9A 1VESA 3D0CA 4OCWH 1LOQA 5GRJL 3B3IB 2V3EA 1R3IH 4ZQKA 3H9HB 4J40A 1JV5B 5HYJD 4KBXA 2DW6A 2CZFA 3ABZA 2E27L 3FNKA 1U92B 2NZ9C 3CC5A 3N1GC 5AW1B 4YHLL 4AQLA 1V4YA 2BRRL 3K2UL 1F58H 3QIWA 4J5NA 4IRSA 1EPXA 2GSIA 5HI4D 4HETA 2NRDA 2G96A 4KEZA 1A9BA 2E6YA 3TX9A 3LZRA 3OKDA 3LTVA 2H8ZA 2QDVA 1FP8A 4HJ1A 3KYKH 3HI5L 3P2TA 5ADOL 3VXTA 5F1IA 3D3AA 2BNQA 5AAWA 3BP4A 3S2CA 1R46A 5SWZB 3GUTB 2P8MB 2R0LH 1NFBA 2PDPA 3ZDYE 1O5KA 5CJOH 4YAQB 1XT5A 5I5RA 1DOSA 3CUGA 4R97B 1NMAH 1V7YA 5I09A 5E8OA 3VWKC 5J6SA 1NMBH 3AJXA 4ODTH 1Y18A 1CI1A 4FNTA 2F68X 1CGUA 3CN2A 2D7TL 2H1PH 5FUOL 2HNHA 3LMZA 4C8XA 3MBDA 1M7JA 3QRGH 1XYZA 4WF7A 4X4KA 2A2QT 2VEFA 1EA9C 2X40A 4AVOA 3KOWA 2DWDB 1TRDA 1OWWA 4RDBA 5CN3A 7PAZA 2Q10A 5I1EL 1KLFA 5FO9A 1DN2A 3UWUA 1VFLA 3M0ZA 3U0WL 1REQA 4BRJA 4ACYA 1XC6A 1NBVL 4N0YH 3ESNA 1TLKA 2K9UA 2YCIX 5EUOA 4JQAA 4PJGE 1XIWC 3FOLB 4AX7A 4PCSA 4TR9A 1B4RA 3KBJA 1DBAL 2NY4B 4XD6A 2YPLE 3KBNA 1TDQA 4FFWC 4YOKA 2Q76A 5HMFA 4N0CD 4AYFB 3VGDA 4BKLB 2GG1A 3FVDA 2PU0A 4DNHA 4GD0A 4LPCA 1L0PA 2ZXCA 1WDDA 2FRGP 5DJCB 2BTMA 2V17L 5D5MA 2YMOA 1TT6A 4PUDA 1ZV5A 4X6BA 5HJGA 2ESVA 1RZKL 4N2HA 1X7SA 4EQ2A 1KPUA 5I23A 2AAMA 5BZDA 4IPNB 4JMXA 4RGNC 4AY7A 1I7TA 3V6FA 2OSLB 1EJXC 1TNNA 3UT0A 3ZGIA 1FKXA 4GX9A 1OGSA 2X1RA 1J9CT 1FFRA 4A7QA 2KHAA 1TTJA 4AIBA 5IOKA 4HIIA 5A2LH 4YXKL 1ZHKB 3P14A 2N0MA 3PANA 1A4MA 2P10A 3WIHL 4XD3A 3F6JA 3TZVC 5KZDA 2FR4B 1LE9A 2A6DA 4ORIA 3O2VL 1UP0A 3OBKA 2G4EA 4I5BB 4UTIA 2LU4A 2PZNA 2FX7H 3V5KA 3T8XB 1WC7B 3NXLA 3PG9A 5EF1A 3M86A 1TCRA 5AQ0A 3KTCA 2I5IA 2R1WA 2O1AA 4Y4KA 4HH9A 2YXWA 3I75B 4MLJA 3GRWA 4ZUTA 2NXHA 4XWOC 3GTHA 4OZ4A 5KITA 1FSKC 1P43A 2HG5A 4Q52A 2DMHA 4A7TA 5I8KH 5EHFA 1X5HA 1D6EB 1TZHB 1FYTE 4JREC 4BF5A 5CP7A 4U1GC 3H12A 4D3CL 2DKUA 1XGRB 4J3XA 2DSZA 1UEYA 3MI2A 4XTDA 1OFQA 4K3GA 1KCZA 3R58A 4L4PA 1KIUA 2INFA 2QYGA 4FN0A 2VXQA 4NHCH 2H4EA 3PY2A 4S1FA 1DXFA 3KRBA 1KBGL 1LDSA 1TITA 1EJOL 3ZMRA 1TJ2A 3W7PA 3NDZE 4PJIE 5C0IB 3VIJA 4QE5A 2XFXB 1KPRB 1MJUL 1TLMA 4AEIH 3S1UA 5DXXA 2FJUB 1T0NA 4ZOBA 4M3HA 4YDVA 1KTNA 3O2LA 3PWJA 3EIFA 2HKFH 1VR6A 1X7QA 4FI7A 4HIXH 4W9ZA 2J55A 1IQWH 3KH4A 4YN5A 2O4EA 4DP1X 5CWSA 3E8UL 4PODA 5CGTA 3S37L 2E7LA 3QAZB 3OGOE 3TYBA 4QITA 3CT7A 3WO3B 5JHLH 5TQ2L 4REQA 1E3XA 1DR9A 2VERA 3GTTA 1F86A 1LO5A 4NHUB 5IR1A 1U3HD 3FJ4A 2QCNA 3NZQA 5DJDB 1CWVA 3U2IA 1A49A 3MZGB 2X2GA 4HEPA 5A2JH 3NQAA 5AZ2H 1OIFA 2VJ8A 4NNYA 3ECWA 3QEZA 5XIMA 4IL0A 1BA9A 3LXUX 3P9LA 4LSVH 4U4BA 3DYPA 4IIEA 2FJGB 4JDTL 1HWWA 1CFMA 3BAIA 4FI8A 3I6RA 3SI9A 2IFGA 5ABTA 1CC3A 1RZFH 4A63A 2AZUA 2A1WH 4WFGD 2YBVA 1TZIB 5AOLA 2DLFH 3ZO9A 1U3YA 1TQSA 2Y8UA 1F73A 1M9SA 3LZLA 3SGJA 5D2LA 1AY1L 4QHNA 4WNSA 3CZKA 4W9HC 4QRBA 2J62A 1R5VB 1TQJA 2Q9OA 4BV1A 3VUPA 1IKOP 5CCZA 3E96A 1N4XH 2QVNA 4N20A 5EZOH 3UPBA 3GZPA 2K4AA 4GRMA 1G4RA 2LW3A 5B8CA 1W16A 2D23A 1LO3L 2G60L 4ROPA 3REWA 3ZDYB 3QCUL 3STZB 4GXPA 1NSNL 4UM9B 1DJHA 2OSXA 4BZYA 1AW5A 3IAQA 4JZNB 5EU6E 4TV6A 2CGYA 4JFED 4QHMB 2B16A 4F9DA 4L4JA 1WPCA 2AQWA 2YRBA 2Y1YA 5ELIA 2MCG1 3AU6A 5E5UB 1FNAA 1AP2B 2GK2A 4EN3A 4C83A 4HU8A 2KUTA 2BSRA 2CR6A 1F6AA 2VN3A 1E0OB 4X8GA 4V2CB 1ZALA 1MZYA 1OLZA 1BWKA 4GMEA 3F7YB 5LYRA 4XKMA 5G2NA 2K0RA 4LV9A 4F7TB 3ES6B 4XMZA 4V1DA 5EMYA 1KBKA 3H0TB 2I60L 4PJGB 1EEQA 1WYIA 4NJAL 4BUHA 2LE9A 4BZ1L 1WZLA 2J8UE 3CVHH 5AC5A 1UMLA 4Y5YC 2ICEC 1W1A1 1UT2A 5BOPA 3LN4B 3REQA 1CLXA 1NAMA 3D34A 3FO1B 3PWNB 4NQQA 3MTWA 3RX2A 2DQUL 1M53A 3C2EA 1LT8A 2YCLA 5D70H 3HFML 3EWYA 2DZXA 3VNIA 2VDHA 4D8OA 3KPNA 1VPQA 2D7MA 3WH5A 1GGOA 3PGCB 5DRWA 5GIRA 3N2TA 3C6SA 3OR6A 3S47A 3NGJA 4X6CE 2FEEL 4PMXA 4G70B 3CH1A 3EJTA 1CB7B 3DZ1A 3O4LD 1UR9A 4GC3A 3A6CL 5JIDA 5I15H 4G1MB 2DQIH 1ZK9A 1RQHA 4PGEA 2WWNA 3H42H 4L3EA 2R23B 2ATSA 4O8AA 4DOHE 2QKIB 4OSUL 1A3RH 3FTWA 3QUMA 5I0ZA 1ITUA 3IN2A 3B7YA 3W7NA 4DKAA 3QQ9D 2IDQA 3AHYA 1FYTB 1ZSDA 4XN9A 3L3HA 3RGVA 4D6DA 3AMLA 1ZHNA 2OCCB 4PP1D 5IHUL 3NTCH 1CDUA 1JAEA 4MQ7B 4IHOB 2E6QA 3P3UA 4HUCA 1E4WH 2OGYA 2DQXA 3ZY7A 4M93C 3HURA 3SZ8A 2XN9D 5C0BE 3U9UB 3KGRA 4PJIB 3UBFA 4QBXA 3E2VA 3LKRB 4YR6A 2O6CA 1O5DT 5B21A 4AYMC 3CMGA 1KJ3H 4M7KL 3GUWA 3WUWA 5AYYA 1OINA 3OGCB 3FB7B 1YNQA 5FJIA 4LLDA 2DSVA 1G6RH 2JB5H 2MH4A 4JHUA 4C6EA 4X7SL 5DJ6B 3LKPB 5IJKC 1YQVL 1IVTA 3CCHB 3IKCB 3MAWA 1XDJA 3TF4A 3T3ME 5AYTA 5IHWA 2V2TB 1DTUA 1VERA 1YPZF 3LH9A 3VVVA 1YXDA 1EEYB 3IS0X 3D0AA 3AO0A 1QR7A 5D7KE 1TVLA 2VAAB 1VBRA 3G5XA 3QQDA 2MCMA 2KDGA 3CMOL 2VGGA 3IIXA 3DMMB 4QYAA 2VL4A 3NZHH 5JOFB 3PZMA 5EC1B 4XVUC 4LNYA 1NEYA 2D2CC 2H0EA 5F6IC 1XIDA 2GL5A 3REVA 3X14A 1KCSH 4AMWA 5DMIL 3RA7H 3ZT5A 4LHUB 5GGTH 4H9VA 3MVIA 1SM3H 5EBWA 5JVLA 2OGJA 4LGRB 1QNIA 4TQTA 2WSKA 4FMFA 4FL4C 3SE4C 1ME8A 3QMTA 5BCAA 3BDXA 2PLTA 2OYPA 2H3KA 1YO4A 5CN1A 2VX6A 4EIBA 1NMCB 1NDZA 1RZJC 4MJ4A 3DFTA 4AEEA 3O6LH 3D0LA 2J56A 4P46B 3VRJA 2WKOF 5E8PA 3HCVB 4XCEB 4NASA 4S38A 4JDVB 1T21A 2G75A 3NTYA 5EU6B 1X6UA 1UKTA 4MWFA 4NAEA 2XWTA 4EIGB 1DSFL 1PL3A 3CK0L 3VYNA 2VL5A 1G7MB 3WE1A 4ZOAA 3WKZA 1EK3A 1QBLH 1OB0A 4RAUA 4PJDA 4AL8C 3BZ4B 5CGBA 3FTSA 4D9RE 5IUSA 2R9HD 3QUYA 5LG1A 5I1LA 4MNHA 3V6BR 4AD1A 1XYBA 2WSDA 4KQ4L 5T91A 4HQQL 2FJSA 3L1OL 2WBXA 3TR9A 1VEOA 5C54A 2J6EH 1SQ2N 4XV0A 1ZPUA 2VN4A 3DX3A 1Y0LA 5I3IA 5ABGA 1BW8A 3BAEH 1ASQA 2A4ZA 5TJWK 3SDAA 5AW4B 3MCNA 5CZXC 4WIQA 4IFRA 1QW8A 1W9VA 3PQYE 3WH6A 1T7XA 5CEWA 1SVBA 4DZBA 3M7FB 3ARXA 1JEZA 1RFDH 4NKIH 3FJNA 3WS3B 3N19B 3VCLB 2CKBH 4RX4D 4U6YA 3QSTA 1D5IL 1MFAH 3BLBA 4D9PA 1CFVH 1MEXH 3BUQA 1BX2A 1NCWL 2X89D 1JWUB 3R06A 4APXB 1RIVL 2DIEA 4G8AC 3C2RA 1RUAH 2YRPA 4LASL 3WBAA 3PWPE 2EKJA 4EF8A 3EYVB 1PJ9A 2XNAA 1JGDB 2CDFB 4X6CB 4JPKH 2HPOA 1ZAHA 2EICA 4FZEH 1EYWA 1LL6A 1UJTA 2EDHA 2ICWI 2D2GA 2WAHA 4RX0A 3VGEA 4FHJA 3K13A 1YTEA 3MC0A 4AIUA 2P5ED 3ZWSA 1CWYA 1ZHBA 3WBWA 1QASA 4DOHB 4R3UA 2W59A 4O02A 1J5DA 2PO6C 1VZWA 2EDRA 4NKMB 3NURA 1ZLVH 1PKLA 3KXQA 4HX1A 1GONA 4LYRA 4DN4H 3D9AL 2WOBA 3HOGA 2MHAA 3RJQB 2VMDA 4O4YL 5MP6L 4XNYL 1R3RA 1YRRA 3UCQA 1QHZA 3AM8C 1QFOA 2B08A 1U42A 5IGXH 5IFHH 5C3IA 5MENE 2ADGB 3G6DH 4ZXBD 2AJUH 1I9JL 1V3MA 1K5WA 4MX7B 4GUQA 2V2HA 3VIMA 3CDGA 4TO8A 2WPGA 3SE8L 3TA3D 4PBWD 5C0BB 2LGNA 5D2NC 4LSTL 4PMZA 4Q6IA 1JZFA 2W9DH 1AH1A 5KUKA 2DQGL 1S7RB 4BQ5A 5E2VH 2ITCB 2VC2B 2CALA 5CZRA 4OV5B 2W0UA 2V5RA 2JF7A 1AR1B 4BINA 4UTBH 4PGLA 1UZHA 4RNHA 5EWIL 1UROA 4AM0Q 3BQUB 5EBLB 4LDCA 3UG4A 3W3BA 3CDZB 4D9QD 2AL1A 4URKA 1X38A 3CIWA 3B9KB 3ZXAC 4KKLC 2X2UA 2XZZA 3T3MB 1SJDA 5BW6A 1BV8A 1MQKH 4GOAA 4BFJA 5FA5A 2EUZA 2EEBA 1MVFA 5IJDC 3RM4A 4XAWH 2OR8A 4LSPL 1JBJA 1LTDA 4FULA 3VD3A 2A5HA 5TDPB 2VQTA 5FGBC 3EH2A 3N6YA 3WKPA 2VRJA 3WLMA 1CR9L 4BHYA 2NWRA 1BD0A 4IRJC 1E4XL 3DSFL 1M42A 4YPGB 3IDMB 3KHDA 3OKMA 3QVAA 4WKFA 5BRQA 1TJHH 3VCNA 5LLIC 4G5ZH 3S1XA 2R1NA 1QRKA 3T0DA 4X5RA 4UOW0 4D2JA 2Q7AA 4HJIA 2TSBA 2VGIA 4Y5VB 4F66A 1AD4A 3CU1A 3ETTA 3P30H 3CXHK 3VIKA 2BP8B 4WTXA 3GEWB 2Y1HA 2WTRB 5I3DA 1OYAA 4QFUA 1VJZA 3QEQA 5F0PB 1D2PA 3UP8A 4TULH 4U1SA 2ZA2A 5AOZA 1HVQA 3F4DA 2YBGA 4KWSA 2ZKHL 3IJHA 1KQYA 4MBRA 4P4KA 5EG6C 3Q44A 2XSXA 1AQKL 1LO0L 1US2A 4NNAA 2VDOB 4OZOA 1KGCE 3RFZA 3W07A 4GBXC 5AVHA 3MGAA 1WBYA 4M6ML 3QPYA 1F56A 5FJRA 2RCSH 2ZAHA 4KKPA 1MCSA 3PJUA 4OCXL 5SX5H 2HLAA 3PTQA 2IWGA 1W91A 3FBQA 1U4FA 2CLHA 4L6HA 2XQYK 1YDOA 1JN6A 4EIVA 1KFJA 4WFHD 3QFJA 5CUSH 2QJDA 2HE5A 3TBTB 2V69A 1CFSB 2WNWA 2UY6B 3B2XA 3VXNA 1DQWA 3D85A 4UT6A 5KINA 1FWEC 4QF1A 3BKYH 4H13C 4JLRA 5FD0A 2NX5D 4UFMA 4ALDA 4I5UA 3M17A 3NCWA 2VN6A 5EORL 4TPRL 1A6UH 1YUHA 1W9DM 5CJQH 2DT2A 3GJFB 3O2DL 3TYZA 1U9KA 1KT2B 3PQYB 2E9IA 5D04C 1R24B 2EHHA 3CQFA 5C0AE 4O8RA 2QGCA 4Y9AA 5F7BA 2WW5A 4NDMA 2FUTA 4HJTA 1F7BA 4DFIA 5ECVA 3MOQA 5FW6A 3WCYA 4ATTA 3WUEA 1UBPC 3RUBL 4HJJL 5F1VA 3QA3B 2O72A 4P3WA 5IW1B 1NOAA 5AZ1A 4PJ9C 2ZUVA 4GUPA 4PW4A 1NDTA 2MPAL 3T2QA 1HJSA 3PUDA 2EXOA 2OQJA 4UBDD 1KFKA 3MREB 1BQGA 2QGDA 3B5GA 5DHVA 4JO8A 3PWPB 3PAJA 2YAOA 1BRLA 2WQUA 3BAKA 1IEBB 1QVBA 2BK8A 2FEEI 3AW5A 2WN3A 1XTLA 1WE5A 4U0RB 2QSQA 4ZPTA 3GF8A 4EWJA 1ED3A 4K2UH 5D6DA 2ENPA 5E03A 4BM7A 4B4FA 2CWXA 3NP3A 3GS7A 1QEWB 3WO8A 1M7OA 3L6FA 4QISA 3GNPA 3WIFB 1NC2A 5JYMA 4IK7A 2ORBL 1UENA 2JKLA 4PWJA 3LCIA 1SBBA 3VQ1C 2AHIA 4P99A 4XG1A 3PZIA 1JYNA 1FBIL 3T65B 5MENB 4I3SH 1CVSC 3PULA 1ETB1 5CIPH 4G3YL 1PLBA 3OZMA 3K4AA 2IBGA 4XCCH 5DLML 4X98B 4B3LA 3V4VL 4YDZA 4B9FA 3K6DA 5BZWA 1HQRA 2OK0H 1TZGL 4K9EL 4XNAA 3SGDH 2G2NA 2A73A 3WDQA 1KPVB 4OU3A 5I19L 4QMEA 4QT5B 3IXTA 1GWJA 1H0IA 3NABH 2DWSA 4G8GD 3LZFH 3GT6A 5FOJA 1MCWW 3NJ3A 1JPGB 2GGIA 4ZB2A 1E5CA 4S2BA 2ZZ2A 3QFJD 4KV5F 1ZAGA 3FQWA 4R7NA 1U8CA 1ZLVK 1NBZB 4LUSB 2DBLH 4MVBC 4Y16C 1U8IA 3CUJA 3GK8L 4RSYA 3D85D 4WO0A 4C56A 4E42B 4KJWC 3QUKA 3PVFA 3NNTA 5E99H 4LANA 3ZTCC 3VD1A 1Z6KA 5AL0A 2VITB 4UANA 4NCDA 4M7ZB 3F2DA 1W32A 4IGSA 3WIAA 4IIFA 5FJPA 1JCLA 5FYJL 8XIMA 4C7FA 2GJ6D 1L5GB 5D09A 3N17A 1YEGL 4PWFA 2J1KA 4KCWA 4XOCA 1J8VA 2XWXA 4QGTA 1JGVH 1K03A 1QNOA 2X1TA 5D7SL 4RVBA 1CG9A 1E30A 1W8NA 3MBXH 4ERSH 1HHIA 2FMOA 3AXIA 5KZEA 1RK0A 3CTLA 4W9TA 4IGBB 2NNXA 2EH8H 2IGFL 4YHOH 1QLEH 3WEBA 4FHAA 1GS7A 3PWVA 3F7QA 3ZDWA 3PPFA 1FL3B 4M62L 1M03A 3UY7A 1A4AA 4NQXB 4HBKA 3KPMA 3LV5A 3R13A 1FH7A 2L7UA 2NXYB 3W0WE 1LP6A 2QSCL 2XPYA 2WWMD 3BLOA 1IHIA 4J3ZA 4RESB 2WYHA 3HR6A 5AVRB 2PLJA 1OK6A 3K0WA 4TSBH 4N2YA 2XYCA 5DHEA 4GH7B 2Y6TE 3O4OC 4QEGA 3TS8A 4OD3L 1X44A 3WIIH 1TUXA 3KLHD 2W79A 2X4QA 1F3JA 1UZ4A 1HW6A 4RZBA 1LG1A 3M47A 3APCA 3PZ9A 2XBDA 3H3BC 2ZCHL 4KUZL 3T09A 1G4EA 2KYIA 1IT0A 3FFCA 1NDGB 1QSVA 3RLHA 4IPLA 5EEWA 1HJQA 2XM1A 2X8RA 4OIBA 5FYKD 4FMVA 5LO7A 2I9TA 1Z41A 1GKPA 5EOCH 1PY4A 5JIIA 2VM3A 4YX2H 3NYZA 2ZCKH 5T3ZH 3MCKA 3B8VA 3LNPA 3GDBA 1Q5MA 3L65A 3FT1A 4MNMA 5KBPA 1KGIA 5C07B 3N44B 2M8XA 1PYFA 1J5HA 4D8LA 4QRPA 4U6VL 2VLJE 1L3WA 3P4OA 1KKRA 5EMJA 5FF2A 4LSUH 3L5XL 5I6SA 5C0AB 1BQ5A 5L8JB 4WHBA 3LB6D 4NM4H 1VF5C 2DSWA 1GYWA 2AK4A 3BGFB 3NESA 2PTXA 4XIMA 2PW2A 5JORB 3QRBA 3QFDB 5I02A 3QFGA 3MV9A 3RWCB 3W38A 2UV3A 4S0SD 2AITA 1JHKH 4IPIA 2AEOA 2BOFX 3KW8A 4YTRA 2W81C 1FG2B 1XS2A 2H5UA 4AGNA 1OSZB 1KCLA 5FYKU 5IMMB 3APMA 3T2NL 5HGAB 4IKIA 4WCJA 5FKPB 4PMNA 3HC3L 4K5OA 2C3VA 4NBXB 3ZKNC 4D6CA 4NFBA 5JYLA 1SEQL 3EYUH 1CURA 3W1UA 1I1FA 2NW3B 5AZEL 1P4LA 3OZOA 5BROA 1XGQB 4R5EA 1ERNA 4PJEA 1LEKA 5IOPB 4D94A 2JI2A 3ZJAA 2IDTA 4JYFA 2IAMB 4BEQA 1KTRL 2W0FA 3LQLA 3LV3A 2WC4A 2FECI 2Z0BA 5A16B 3CQIA 1SYVA 1H3XA 1MVUA 3BHBA 1GOFA 3SPCA 1KCXA 4I9TA 3WQFA 4ZR8A 3ZT6A 5PTDA 4BFGA 1HDMB 4BHUA 3AU1A 4WK4B 5DC0A 1TTFA 3ARBB 1RXOB 1B4EA 3UC0H 1XYCA 4I7WA 3VGAB 1RVGA 2ENSA 3TC3A 1S3HA 2AJ3A 4M6QA 2NTSP 1GCYA 2UZXA 2QCGA 3VNJA 3VTAA 1UQZA 1JZ3A 3UQNA 1LBLA 3TX4A 2Z8RA 5HY9A 3TNMA 4ZW7A 1QRNA 4XMKH 3OAZK 4BWWA 2DZVA 2QJIA 2DSUA 4NQCA 2ISWA 3HPLB 4A8IA 3M0XA 1UWGL 1QRQA 4MMZA 2WNNA 5F89B 4XZBA 1X5FA 2FGBA 3ZJ7A 2E9WA 3E2HB 2W65A 2XVLA 1S7SB 5KEZA 4JDZB 5CJ8A 1UR0A 4FFYH 3H6OA 3EHBC 4HUXA 4KMLB 3MRDB 2JKIS 4OCSH 1L9PA 4MDJA 2QULA 1E4LA 1IFGA 1MSPA 1USQA 1JK9A 1C16B 4EEEA 4YE0A 1ZS2A 1E4XI 2XA8H 5C6PB 4RL3A 4OTXH 3QI9D 2OLHA 1VGKA 4QRPD 4OJAA 1H41A 3IPWA 1BLNA 4Y5XB 3S5SA 3NCYP 3LIZH 1B4LA 3ZDYF 3HFYA 3KZSA 4LIQL 5BXSA 2XRAL 3L81A 5GZOA 2I9LA 2AK4D 1X5IA 2D0GA 5BXFA 3FU6A 3MOAH 2R1YB 1CBJA 2CO6B 5JW3H 2ACUA 2WMHA 4LNRA 1TWDA 4WOQA 3W0WB 4EUPG 1K9DA 4PIRF 2WCPA 3W9DB 5DEFA 5AN7A 1ML0A 4KI5C 3QJQB 4NZTL 3HI1A 4HPYL 4FZ8H 1H09A 4R8WL 3CZEA 3B7TA 3WMPA 3CB8A 4GRLD 5DC2A 5F93C 2ZXQA 3E3HA 3S4SB 4J8QA 3T81A 1T2QL 4YGVA 3RUGA 3RX9A 4PJGF 3K72B 4JN1H 3RDTB 4QJ5B 4G7SB 2DICA 2Q3AA 1A5AA 4G6CA 2WLIB 1QR4A 1XBRA 5C7ZA 3FQXA 4R2GB 2AABL 2EPOA 2FH8A 3URBA 1Z5HA 1X39A 1MAKA 1V5JA 2HJPA 5E6UB 4KMTL 1UA6L 4C5YA 1SLXA 4XPAL 2XIBA 3ZO0A 1BBDH 1WIOA 3FO0L 3K4DA 2JKAA 3WD5L 4NLHA 2ZOKB 2H2SD 2DZUA 3CWOX 1P5UB 4PJ8B 3STGA 4CD7A 4HAFA 2VLJB 5DYOB 4YUEL 2HN7A 4Q2ZA 1NP2A 2IG2H 2B8OT 4LK4A 4UDUB 1VFOA 5BV7H 4XXDA 3QMSA 2FVKA 1WCGA 5FCSH 4A3UA 2ZJSH 1Q94B 4DKDC 2YW4A 5HYJA 4DAGH 1A5MC 1LDPL 3TGXA 2WIIB 4URIA 2WMPA 3VFGL 1UFUA 3JTTB 2CLVA 1I9IL 1H7OA 2NY5C 3UTPE 4W8LA 1IGCL 5I1GL 1A5OC 5I73C 4W4OC 5IHBA 1MFCL 1OJXA 4RA3A 1CENA 1WBXB 5JXQA 3A47A 3MLWH 1MCPH 1QTYT 3VZZA 3MO1A 4NBZB 2E8ZA 3IFLH 5CC5A 2VKXA 2XZAH 1A6PA 3LLXA 3FVMA 3WMCA 2HS8A 1Z66A 2B7QA 3QG7H 2N59A 4ALAH 1UB6B 2H26B 1LQAA 5BVPH 3QR2A 5D1ZC 5DS2A 1MELA 4U1IB 5F7HA 1CT8A 1IBZA 2LFEA 3QJHB 3KNBB 4KKAD 5I2IA 3SOBH 4DM2A 4PJIF 5IP4A 1R5YA 4CC0A 1RUPL 3F83A 3MMEB 4KK6D 4QM1A 3G1XA 1W0VB 2NY2B 1TENA 4DESA 2RJHA 3QDGD 4JFQA 3RR1A 3M1BB 3NO5A 3MFFA 3LPWA 4Z2GA 1ZCRA 4JDEB 4M5PA 4IMFA 5CPSA 4ZNEE 3I50H 4QAIA 4FA6A 4JMNA 4N3TA 4HV8A 4IQDA 1XF1A 1POJA 2IADA 4HK3J 3HNSL 3LN5A 1IR2A 3TVMC 4K68A 5AKSA 1WWWX 3CEPA 4C6JA 4WEVX 2GOKA 3UGUA 3VFWA 1LM8V 1W3TA 3GRWH 2VH5L 4Q58C 1CZ1A 2NXZC 4JO4H 3KW3A 3OLGA 4HU0A 2ZRWA 4H9ZA 1QZ1A 4HFUL 2AMUA 3NVTA 3EOUA 4XISA 2H45A 1YEFH 1H15B 1AOZA 5KSAC 3UAAA 3F65A 4P4RB 2E5DA 3MCOA 4HD9A 2I32A 3BX7C 2OMTB 4PN2A 3XIMA 1IT8A 4HDIA 4NJKA 5TDNB 3BVJA 1SLVA 2GIMA 4EBQH 5HMSA 3PIQB 2NY1D 2HMID 2VXQH 5DGRA 1BPLB 4KHXL 3CPGA 4DP9X 4BXVA 2IDFA 1UUOA 3I6LD 4ZQNA 1SXBA 4IU2B 4JFYA 3NQMA 1C7TA 2FGWL 1QSFD 2WZ0A 2QVIA 2WJ7A 1EX5A 2ZSWB 4B60A 3Q43A 2F84A 1EZ2A 4ODWA 4JPQA 5K9OA 3FA3A 7A3HA 3EYFA 5C6TL 4NUPA 1EJ8A 2ISFA 1G7VA 3B2VL 3HC4H 3LS5H 4M7TA 5EZLB 1I8JA 2WZEA 5IOBA 4KMQA 1AD0A 1VZIA 4MLSA 1EAOA 4XPTL 5E6YA 5KVGE 3NQVA 4IX0A 4GZ7A 1I1WA 3K2KA 3LTYA 3RQ3A 4EIZC 3UXFA 4PHXA 3U0PA 4XH2B 3BYTA 3DROB 3NEHA 1LWJA 5HHVL 1U83A 1ZJIA 1ZTMA 2EKCA 5IXEA 1ZRUA 3DBXA 4GMTH 1X3DA 3MKKA 3QNZA 1XCTA 5EF3A 2JCCB 1YEDA 4JY4A 4HWBA 3CSBA 5L6YH 3QY7A 4DPBX 4IUGA 4JCMA 1R2SA 4MHHI 4XWUA 3LY0A 3LEYL 1TTGA 3I6SA 4Q33A 4AWEA 2NQLA 3HJZA 2EH7H 5FYLL 2DKSA 3EO9L 5IHZA 4HXBL 1FL5B 1K9EA 2J8UF 4U1HB 4F9PA 2Y5EA 4EOWH 2B4CL 1AYOA 5IEKA 2HJFA 5I78A 2Y07L 2J2ZB 3HPJB 3ZN6A 1B3OA 3FU9A 4AIXA 4TNWK 1W15A 1TJGH 1USZA 1N0XH 5M2FX 1OF8A 1NCJA 1JGEB 4AK2A 4EX4A 5JOPD 4EE9A 4WGVB 4LCYB 5E9DD 4U4IA 1F3DJ 1A6WH 5K39B 1U3HA 2JI1A 3U2EA 1FFOB 3G5WA 4K71C 3FKRA 4WWKC 4NS0A 1A6VH 1RHHA 3ZR5A 3MRPB 1DJNA 4FO4A 3U4BL 1ZLUH 1V7NH