1NM9A

Crystal structure of recombinant human salivary amylase mutant w58a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPAWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
publication title Human salivary alpha-amylase Trp58 situated at subsite -2 is critical for enzyme activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1nm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nm9A01
5A6BD 3PZMA 1UWTA 3WEOA 1C3FA 3CHEA 3EMQA 4BQ2A 2BVTA 1KWKA 3T08A 3ARZA 5CPQA 4KH2A 2E3ZA 1BFNA 1TQWA 4JFUA 5DFAA 1BYAA 4AISA 3GTNA 2VZVA 2J7CA 3VDHA 1GPFA 1MFVA 3W37A 1WZLA 4F66A 4GZIA 2XUCA 1JNDA 3EDKA 2IUZA 2J7FA 1V3JA 4GQQA 3FW6A 3ZJ8A 3L2MA 3VX0A 4BS0A 3M46A 4U3AA 3OZOA 2X8RA 1ZBVA 2DSZA 1M53A 8A3HA 4HA4A 2J62A 3CPUA 5A8MA 3BLBA 2FH8A 2ZUTA 1VFMA 2B31A 3AXIA 5LYRA 5CSUA 4NXKA 3GXDA 4J3WA 4GI9A 1VENA 3W27A 3D52A 1MXGA 1XCXA 3VMPA 5CLTA 1L0PA 2D3LA 1E6RA 2D0GA 3OGSA 5IXEA 4EE9A 4BZYA 3OIHA 2VX6A 3IK2A 4URIA 1OM0A 2VTFA 1C92A 2WBGA 3HZ3A 3BUBA 1GONA 1HIZA 3OLEA 2YA0A 4U33A 1FHLA 2IXUA 5AY7A 1B30A 1EOKA 1TA3B 2D2OA 2EJ1A 2EO7A 2EACA 4M24A 1UR8A 1RPKA 2XJ7A 4AEFA 3RPMA 4NRSA 3FNDA 5KEZA 1UD5A 2VZSA 1PPIA 4AZ6A 1SYTA 2V3FA 3K46A 1QBBA 1V0KA 4QFUA 1KGUA 4WSKA 5LA1A 1D7FA 3J7HA 5A6SA 1NP0A 4JFSA 1KR0A 2J74A 4PSPA 3MO4A 2XSAA 2BVYA 3FHAA 4P8WA 3WF3A 2GJRA 1O7AA 1BAGA 3HG5A 1KTBA 5CQ1A 1GCYA 1WDQA 1GOMA 1ISWA 4FNSA 1B3XA 2FHFA 3EJPA 4PMUA 5DT5A 3VIIA 4D71A 5A2AA 3F5JA 2ZE0A 2Q8XA 3UEQA 2J8GA 1XD1A 1FFRA 4PMRA 4JCMA 4NF7A 1LWHA 4GINA 5E09A 1GJWA 4ZE4A 3WH7A 4ACYA 4UZSA 3APGA 1K9TA 2PBOA 2DGAA 1PS3A 4FK9A 1D3CA 1XH0A 5I78A 1CLXA 3CUGA 5E6YA 3II1A 4GZJA 1I1WA 4W85A 2VQTA 4N0RA 3B9EA 2JEPA 4NZFA 2VZTA 4CGTA 6A3HA 1WKYA 2WZIA 4NZJA 3CC1A 1PX8A 3LPGA 2IXVA 4FNUA 4AW7A 2F7PA 4DO6A 5DMYA 2JIEA 4B3KA 1J10A 4CD5A 1XSJA 3EDJA 2FGLA 1WPCA 1GORA 3ZJ7A 1G0CA 2WSKA 3A23A 4DO5A 1V3KA 4FLRA 2JIWA 2OYKA 4CCCA 5IFPA 2WLZA 4PMVA 2WPGA 5FL1A 3ARSA 1SR0A 3VINA 2W5FA 4JKKA 3VNZA 3H54A 3LPFA 4AXNA 5BXTA 3A4AA 1BHGA 4W89A 1OD0A 4KRUA 1MFUA 4FNRA 1W9VA 1HTYA 4NSBA 3CZ8A 3MANA 2GDVA 3LPPA 3ARTA 3OZPA 2W62A 4HOZA 4X9YA 2O9TA 4FLQA 3W0KA 4UR9A 1HP5A 4JL1A 3D5HA 4Q7NA 1E1EA 2XIBA 4ZEPA 1MQRA 4IISA 1EQCA 3PN8A 5E0FA 4ACZA 1UH2A 3LRKA 3S5ZA 5JBDA 4PTWA 2Z1SA 3MUIA 3ZR6A 4FNQA 4JHOA 1P6WA 4TVUA 1UKTA 3WY3A 1E73M 2ZX6A 1K9DA 5GQBA 1XD0A 1E43A 2ZX7A 3CLWA 5A3HA 4IPLA 1LL7A 3IJ7A 1UD2A 2WMIB 3CH9A 4XX6A 1W1TA 2G41A 3M6DA 3BSHA 2JF6A 4MDPA 4CUCA 2ZXBA 4OOUA 1J01A 1J0YA 1JIBA 1US3A 2CERA 1I1XA 4E8DA 2FE0A 1GW1A 1HKKA 4MNLA 1HJXA 3LXCA 3ECQA 5A94A 2E8ZA 3VD9A 5EBAA 3A4WA 3AFBA 3AJ7A 4W86A 2NT0A 2CBVA 1B3ZA 1JFHA 1PZ3A 4PMNA 1C93A 4RE4A 2PWEA 1EA9C 3A4XA 3VDCA 4DM2A 2J7BA 5AC4A 3DC0A 2YKKA 1UWIA 2YDQA 1JG9A 1W3LA 3JUGA 2ZUVA 3L4VA 4WK9A 1MW3A 1ISXA 4MB4A 5ABFB 1C8YA 1FA2A 2XVPA 4UFLA 3WL0A 1JXKA 7CGTA 2CNCA 4MB1A 3WEMA 1E3ZA 3NIYA 3VOCA 2XVKA 4AD1A 3FY1A 2VCBA 2BY1A 2DEPA 1HNYA 1HXJA 1LL6A 1JZ4A 3UG4A 1CENA 1JI2A 1UH3A 1VBUA 3A6OA 1VFUA 3BC9A 2F8QA 2F2HA 4E8CA 4FNPA 1W2PA 1VEMA 3F5KA 4OGZA 3ALGA 4MJ2A 5E6ZA 3N12A 2J7EA 3GDBA 5I2UA 4ACZB 2VZUA 3BMWA 5DO8A 3DDFA 1SFSA 1GJUA 1IV8A 1QPKA 3OLGA 4JAWA 3AIBA 4DWSC 1C7SA 4TUFA 4ATLA 2OW6A 1H5VA 1WDRA 4P7NA 1BVZA 4GZEA 1MXDA 1UWRA 2UWFA 1E40A 4V27A 3WQ4A 1EQPA 1TVPA 2YL6A 3RJYA 4PMZA 3BGAA 4E2OA 4QP0A 1H0GA 5ABEA 4JFTA 4PMQA 1E6PA 2YL5A 3GXMA 5C70A 3OG2A 3OGRA 3VIKA 3AMGA 2WCAA 3AROA 2GUYA 5A8OA 3AIUA 4D6GA 1UOKA 1CGVA 4HMDA 1UQYA 5A69A 1KXTA 1UASA 2CXGA 1DEDA 4LYQA 4B15A 1E0XA 2VJXA 1F4AA 3POCA 4P7RA 2BHYA 1QNRA 2X2JA 3RMEA 1NOFA 2FYVA 1W3HA 4A4AA 1DWAM 4QLKA 3VD5A 1O7DC 2J78A 2W63A 1NWRA 3FAXA 1OINA 1VBRA 4H04A 1IT0A 3TV8A 3O6AA 3UETA 4CD6A 3UESA 1V3IA 5A8PA 1RP9A 3DX4A 4DM1A 2D0HA 3DX2A 2XSBA 4WF7A 3DYMA 1K6AA 3VM7A 3MUY1 3EDDA 4FNTA 1LG2A 1UZ1A 2DPEA 2F7OA 4F8XA 5LA0A 4PSRA 3QHOA 4UQCA 3SCWA 3GXFA 1DWGM 4HPHA 3BAXA 3M07A 4M80A 4S3JA 1CGXA 4U31A 1OGGA 3EJSA 3DX1A 4M82A 3I3BA 1W1PA 3IJ9A 3LXBA 3TTYA 1E5JA 2V3GA 3BCDA 2C7FA 1QBAA 1RD6A 3BVUA 2WKLA 1UR1A 3BVXA 1VIWA 3HJEA 5M03A 4CVWA 3VIFA 4LXFA 2GSJA 4OIFA 3RIKA 3AQUA 4Z2GA 3LX9A 1QI2A 3LRLA 1OSEA 4CN6A 1GHRA 2BV9A 4NXSA 3PZTA 2CEQA 2ZICA 2QV4A 3GNPA 5HDRA 4AZCB 5I77A 1KWGA 5AYBA 3VGDA 1HF6A 3AMCA 1HL8A 3CUHA 1JDCA 4CCDA 2A3BA 1AMYA 2Y5EA 1IZJA 3BUIA 5D8WA 1Q4NX 3SUVA 3VU2A 1CLVA 5CGMA 1WNOA 3WY1A 2ZUSA 1DTUA 1E55A 4P8VA 1V6XA 2BY0A 3MU7A 1KCKA 5ECUA 4Z2LA 3BAYA 3EJQA 3GZAA 2ZUWA 3QR3A 3W25A 3PZIA 2A3AA 3VGBA 1E6QM 3DHUA 5BROA 1WAWA 3SEPA 3BVVA 3CHDA 1LWJA 3MSDA 2VR4A 2GVYA 5D9OA 1BGAA 1RH9A 2A3HA 1GQIA 1JZ2A 2J7GA 3ZMRA 2E0PA 2VNCA 3SUUA 1JD7A 2JEQA 2XFYA 4JFVA 1XHGA 1KGXA 2WNWA 1GUVA 4PYSA 4Z2JA 1WB0A 3MUZ1 3CGTA 5A95A 4FF5A 1BF2A 4BF7A 1W9DM 4CU8A 4F9JA 2W91A 3L2LA 2Y24A 1Q6EA 4W88A 5I6SA 3U5YA 3POHA 4D1IA 2WK2A 4AZBA 3OA5A 3F5LA 1H49A 2CIPA 1UA3A 3UCQA 2YA2A 5E70A 2V5DA 1B0IA 1BPLB 5I5RA 1KXVA 4U5KA 2OW7A 3WY2A 4W5ZA 1X6LA 3DX0A 1BYBA 1ZBWA 1H1NA 3W4RA 1UA7A 4MADA 2F18A 3AS1A 1BQCA 3VD7A 3BLKA 3CO4A 3O2LA 3SUSA 4JHZA 4P7OA 1JD9A 2D24A 4PMDA 2G3MA 2ZX5A 4WSJA 1KQYA 1VEPA 3VSUA 1LQ0A 1QNPA 3W26A 3LMYA 3GBDA 1HJWA 3ARVA 1ZJBA 1QW9A 3L4WA 4XV0A 2VC9A 3UR8A 1ISZA 3VVGA 2QMJA 3OLIA 3NDZA 1HKMA 4B16A 3AMKA 4KGLA 1B1YA 4MTVA 1KCLA 5TD4A 2YA1A 4AD0A 2UY5A 3VIGA 1HWWA 2XN0A 2E9LA 1JFXA 3SIMA 4FMVA 1R86A 2QLYA 3EDFA 1QNOA 1V03A 4CD4A 4JKLA 1VJSA 2XWDA 1S46A 1CXHA 4MAZA 2WLYA 2J7DA 4DWSB 9CGTA 1EDQA 2ZX9A 2Y2WA 1UR0A 2CHOA 3LPOA 1WE5A 3KL5A 1E4MM 3L4XA 3GXIA 2WCSA 3D50A 2EXOA 1QI3A 1CXFA 4UQAA 3AXXA 2GK1A 3SCQA 5IHRA 5A8QA 3UR7A 2NSXA 4WKFA 4AD5A 2EBNA 3KLLA 4DWSD 1IZKA 3ARYA 3VMOA 4W7VA 3SCSA 1AQMA 2PWHA 3WDPP 2OSYA 4QAWA 1GQLA 4GO8A 1VFFA 1V02A 1V6UA 1W32A 3PZGA 4UFHA 5FD0A 4AMWA 4PMXA 3WNMA 1HJSA 2IGTA 1XC6A 3THCA 3AMDA 2C8NA 3ARQA 1J0ZA 3BH4A 5D8ZA 5JUVA 3M7SA 3BUQA 2O92A 1E6SM 2BHZA 2X0HA 4D1JA 4CD8A 2WBKA 3W81A 4UOQA 3T0AA 2DT0A 2J7HA 1W9UA 3WDIA 1FH9A 3BAKA 1CNVA 3L4TA 3AIQA 2FGZA 4D6DA 4PTXA 4W8AA 1CDGA 1R46A 2GJXA 2ZUUA 3EJUA 2VR5A 2CKRA 4C7GA 2ZXAA 1DWIM 2J79A 5AC5A 2X2IA 3GXTA 2W4XA 1E4IA 2WVSA 1CYGA 1UH4A 1WZMA 2CETA 4HZ7A 3EBVA 3OB8A 2DT2A 2F7RA 1EGZA 1US2A 1OD8A 2VQUA 2XM2A 4JZ5A 4JFWA 4R27A 5IHSA 3B9AA 3DYPA 5I3DA 1W91A 2V3EA 1EOMA 1KBKA 4AD3A 1K9FA 2GJPA 3WF0A 3D4ZA 4LPCA 2G4FA 4B9ZA 3EJRA 5GNZA 3K8MA 3DX3A 2WANA 4J3XA 4AZIA 3VILA 1G94A 3WUBA 3LRMA 4F79A 1OT1A 1NOWA 4RL3A 2GK1B 3MMDA 1I75A 3BUDA 2QPUA 1VFOA 1ODZA 1E70M 1UKSA 1QHPA 1GHSA 3WNLA 2DSKA 2CYGA 1J12A 4W84A 1O6IA 1HVQA 2YDRA 3RDKA 3CZSA 4CCEA 4HP5A 3E1F1 1R8LA 4CD7A 5HXMA 4QLLA 4YHGA 1ZS2A 2D1ZA 4GI6A 3VTRA 5A1AA 1F4HA 3WFLA 3L4ZA 1G01A 1GNXA 2XVLA 1W3JA 1Q6GA 2BVDA 4YPJA 1R75A 2WKGA 3DDGA 2ZUMA 2CCRA 4QCFA 4UFJA 3NDYA 1U2YA 1CXLA 1JYWA 4UCFA 3O9NA 1N82A 3DYOA 3NCOA 2D20A 3BAJA 3CZLA 3U5UA 3UG3A 4OUEA 4E4PA 4U5IA 3N04A 3WH9A 3MV11 2YDSA 2AMGA 2A3EA 5JIPA 1BG9A 4UQEA 4KWUA 3CZKA 3CZJA 2D23A 2VOTA 1CECA 2JFEX 5HBFA 1WO2A 3NUKA 1KB3A 2C0HA 4X0VA 1E0VA 1UR9A 3BMVA 3HMCA 3CBWA 3AS3A 1W1VA 3B9DA 3BVTA 2DQXA 4WKAA 1TVNA 4EK7A 2PBGA 3KZSA 3TTQA 1V6VA 2OYLA 3BAIA 2OWWA 1B90A 1EXPA 3EDEA 1NWUA 1HN1A 1J18A 2AAAA 1NP2A 3T2OA 1QWNA 4HA3A 1B3VA 1R87A 1QI4A 1TR1A 3AZRA 4YHEA 1TQVA 2DT3A 1VJZA 1XV8A 3IGUA 1D2KA 3AIRA 1H11A 3WQ8A 2XFRA 2RGLA 1HJVA 4DUWA 1E6XM 1QVBA 3AHYA 3BXWA 1TZ7A 3PZQA 3SCOA 5I0DA 1G1YA 1JYVA 2CITA 2WAGA 4W7UA 4AD2A 5D9MA 4HZ6A 1CXKA 2VX5A 3MMWA 1MQQA 3VDAA 2EPOA 4QLJA 3WH8A 1J0JA 3CV5A 1C91A 4CN4A 5A6KA 2HVMA 2WXDM 3N13A 1ZB5A 4TX6A 1JZ5A 3G6LA 1LG1A 2UY4A 1G9HA 2VZOA 4U3CA 4YN5A 4OBRA 1JF5A 4HMEA 1H41A 1UKOA 3AS0A 3VGHA 1JZ3A 1EIBA 1OB0A 2WVVA 3WDJA 3WD0A 5E0CA 1JZ7A 4XZWA 2VMFA 5HPCA 2WCGA 3VGFA 1X6NA 3A21A 2DSUA 4QCEA 1HKIA 4H2CA 1OT2A 1OWQA 4D6FA 2X1IA 1FFQA 2PB1A 3N9KA 2XGIA 1NM9A 3W6LA 1E5NA 1W2VA 1XYFA 2V5CA 2ZUNA 4HPGA 3K1DA 4ML4A 1CGYA 4HOXA 3WY4A 3IANA 1AVAA 3ALFA 2FH6A 3RCNA 2WZHA 3N18A 5IFTA 4AZ5A 5E1QA 2J77A 1VEOA 1A47A 1HL9A 4D6JA 4HU8A 3K8KA 2J75A 3GXNA 1ZU8A 2J4GA 3EYPA 3WFZA 4L4OA 1UQZA 1C8XA 3PTQA 3RM8A 1MW2A 3VNYA 1CGWA 3ARRA 2VVSA 3SCTA 2EPKX 4TOQA 1XGZA 4LQ1A 1NWSA 5BYWA 3WENA 3S5YA 3NSMA 2EPLX 4X0NA 3BVWA 3GM8A 3PZ9A 2WWCA 2GDUA 3HG2A 2WMHA 4UOZA 3N15A 4WKHA 2O9OA 3ZJ6A 1DP0A 5D4YA 4ZFMA 3WIJA 3K4AA 1H4PA 1BSIA 5A6BA 2BXYA 4UNIA 4U2ZA 2WB5A 2RGMA 1CBGA 1VB9A 1PEZA 2YLLA 1XH1A 3ZT6A 1CEOA 5DT7A 1FH7A 3PHAA 3G6MA 2EEXA 3N17A 3AISA 2X09A 3IAQA 3U7VA 1UWSA 4PMYA 3W53A 4AYGA 4P7QA 5JBEA 2YJQA 4C7DA 2DH2A 2BY3A 5BXPA 1MW0A 3A24A 1CXEA 1JDAA 3AHTA 3RJXA 2G3IA 1QNSA 4W7WA 4J3SA 2XFFA 2WVVB 3THDA 2PWGA 1E6ZA 1PZ2A 3GH5A 4BQ4A 1W9PA 3ARPA 1TQSA 3AZTA 5LA2A 3W38A 4Z2IA 2ZXQA 3WN6A 2W61A 2YL9A 4RE3A 4EKJA 5I79A 2CKSA 4AD4A 4UTFA 2OWCA 1R33A 1QX1A 2UY2A 1E4NA 1C7TA 1V6WA 1FP8A 4HU0A 3VIJA 4TX8A 3VGGA 4L4PA 1HP4A 1TCMA 3ZT7A 1JAKA 1MYRA 1KFWA 1WZKA 2FDMA 5HNNA 1BGGA 3UG5A 4ZXLA 1WZAA 3WH5A 2W66A 3WMBA 3TONA 4W8LA 4CU6A 4UZUA 2ZWZA 3CUFA 1ZL1A 2E9MA 1B31A 1V08A 3IJ8A 3AHVA 3CMGA 3GNOA 3NSNA 3WF2A 2XHYA 3CZNA 1JF6A 1PJ9A 4JKMA 1HJUA 4J28A 4LYPA 2HISA 1UR2A 1SMAA 5GNXA 2VX4A 5BCAA 2CPUA 3VO0A 1E0WA 1PIGA 3WMCA 5A6JA 1JL8A 4QDMA 3VPLA 3WBAA 1WP6A 1V6YA 2DSVA 2PC8A 2O9PA 4DUXA 1R34A 1XYZA 1V0MA 4JL2A 1UD3A 4M8UA 1KXQA 1JZ8A 3CHCA 2V38A 3VDBA 2ZXDA 2QHAA 4XB3A 3OBAA 1KGWA 1JGIA 4PCTA 3T0BA 3KL3A 2WVTA 1E15A 5BWFA 1OIMA 3W82A 5M3WA 5BXRA 1TG7A 3GBEA 4EAMA 4TVCA 4M1RA 2VT0A 3WD1A 3B8SA 1M03A 3QOKA 3SUTA 1OCQA 4P7LA 3AS2A 2F61A 4D6EA 5A2CA 4RE2A 2G3NA 3ZSTA 1ITCA 1WDSA 1ZJAA 2WW5A 1W9BM 4AY1A 4PBGA 3BAWA 3H55A 3KE0A 2EADA 4LYRA 5D9PA 1CWYA 3PZVA 1GOIA 1BTCA 2WC4A 4OJYA 3S2CA 5FCZA 2WMGA 3A5VA 5CXPA 1PAMA 2YBTA 3CZEA 2XG9A 1V3LA 3PZOA 4OZOA 4Q22A 5CZKA 3WNNA 2BHUA 1BLIA 7TAAA 4J3UA 2WWDA 3GH7A 3TTOA 2WC3A 3MV01 1OGSA 1W3KA 4AMCA 2YOCA 3U57A 3A3HA 5FL0A 2OLHA 2JALA 3I3DA 1H3GA 1QHZA 2A3CA 4NX0A 1R47A 2OWXA 3NYDA 2VX7A 4F9DA 1MVYA 1NOUA 1G5AA 3MI6A 6CGTA 1U33A 4B3LA 4MNKA 5C8BB 3VX1A 5A6MA 4ZXOA 1UKQA 1GVYA 1JYNA 2DIEA 5GNYA 1TQUA 4MB5A 1EH9A 2E40A 1HKJA 3SCPA 4MAVA 4PTVA 2XN1A 8CGTA 2ALWA 2YLAA 4KMQA 2XVNA 4H8UA 2ESCA 1XH2A 3DHPA 1BVNP 3VSVA 1LLOA 2WC7A 6TAAA 4WIWA 1GOKA 1H09A 3W6MA 3AIVA 4TXEA 3WMSA 5DF0A 4KGJA 1JDDA 5CG0A 1K9EA 1R85A 2VRJA 4GPNA 2WHMA 1EDGA 2XTKA 4HOWA 3RM4A 4MPKA 1V3HA 1UHVA 1J0IA 3VM5A 4UQ9A 3ZQ9A 3K4DA 3PZNA 3QHMA 5AYIA 3FAWA 1ZBKA 1YQ2A 1OIFA 1ITXA 3WQVA 4FLOA 2W67A 2Z1KA 4M81A 2GFTA 3EMZA 4AYSA 1QW8A 1KBBA 4AEEA 3TP4A 4MJ4A 5D9NA 3T09A 2F1BA 3AICA 4PCSA 5FIPA 3WF1A 2J47A 3CZGA 2E4TA 3GYCA 2DDXA 3VMNA 1PIFA 4D6CA 5ABGA 2WM0A 3ZIZA 2WMIA 4H8VA 3WQ6A 4XUYA 1UR4A 4AIUA 3VIHA 5M5DA 3AMLA 2QMKA 1ODUA 5HPOA 1JYXA 4LGXA 1UD8A 1UWQA 4PRWA 2EQDA 1PX3A 3KLKA 1ISVA 4V28A 2EAEA 3WUFA 1ECEA 4TTGA 1VAHA 1GVIA 1BYDA 1JAEA 2WMKA 3T2PA 1NH6A 2YFNA 7A3HA 2VRQA 3BUPA 2J8FA 3AOFA 1NWTA 1HXKA 3WNOA 5FOOA 1GOOA 4AIEA 1A3HA 2JF7A 1E56A 3VUPA 4W8BA 1OGBA 3MKKA 3W24A 5CLWA 5EFFA 5ABFA 4A3YA 2D0FA 3WQ5A 3AIEA 3AXHA 4B9YA 3CIVA 1WCGA 1Q6DA 4PUDA 2VO5A 1XSIA 4XZBA 1UWUA 4AZHA 1CGUA 5F7UA 3ZR5A 4J3VA 3WNKA 2OYMA 3MSGA 1M01A 2XGBA 1V0LA 2UY3A 5JIWA 1OBAA 4N42A 3SCRA 1M7XA 1AQHA 3CTTA 4J27A 1H0IA 4TTUA 2WSPA 1UD6A 2F1AA 3L4YA 1HX0A 1TFVA 4W5UA 4S3KA 2GJXB 3WELA 3BSGA 3OLDA 2EPMX 3N11A 5I23A 1KQZA 4M29A 1JZ6A 2DT1A 2BXZA 4OOZA 3WEZA 1FP9A 1UKPA 3GXPA 3QHNA 4LX4A 1E9LA 3ZT5A 3L4UA 3LXAA 1VF8A 4MB3A 1UUQA 3RO8A 1B3WA 1BG4A 1MWOA 4P8XA 2XIIA 3F4VA 1JNEA 3TA9A 4D72A 3ZJKA 1AQ0A 1W9XA 1C90A 1EO5A 1FOBA 2VI0A 4OBSA 4CN1A 3VD3A 3VIPA 2QPSA 1MW1A 1J11A 3FXYA 3HU7A 2PWDA 1T0OA 1DHKA 1QWUA 3ARUA 3PTKA 3WD3A 2PI6A 2XWEA 4UQBA 3AIWA 4AZ7A 3QGVA 1J0HA 1X1NA 4HA1A 3SURA 2FHCA 1UZ4A 3U7BA 1RP8A 4GQRA 2DIJA 1LJYA 2XN2A 3HN3A 4NZCA 4R5EA 2VVNA 3WL1A 1Z32X 3WKZA 5BRPA 3WD4A 3A22A 2X2HA 3HG4A 2VCAA 2ZIDA 2OSXA 3KEHA 4UFIA 3SCNA 1B9ZA 3WD2A 5HOSA 5C71A 2J25A 2D3NA 4UFKA 3BLPX 4H8HA 2W92A 4AMXA 5ABHA 2PWFA 4CU7A 1XRVA 1J9YA 4GO9A 4ATWA 2CHNA 4NRRA 2X2YA 1DWFM 1E71M 2VRKA 1EHNA 3SUWA 3OGVA 1GOQA 2ZOXA 1TQTA 4IM4A 3W28A 4Z2KA 3WSUA 2MANA 3EJTA 1ISYA 2G3JA 4UFMA 3MS8A 3WNPA 2X0YA 1R7OA 1GOWA 1ESWA 1R7AA 3T2QA 2QF8A 2YFOA 5A2BA 1TUXA 4JIEA 1NQ6A 1EHAA 2EABA 2VCCA 3HG3A 3AYRA 3EMCA 1YHTA 2VL4A 4V2XA 3KL0A 4HZ8A 3D3AA 3VIMA 4AZCA 3NJ3A 4D6HA 1E4LA 3WBEA 4H41A 1BYCA 4GKLA 2G8ZA 3PTMA 1GQJA 3D4YA 3AHXA 5DEZA 1M04A 3GH4A 3KWXA 1JXJA 1Q6CA 1GZJA 2E9BA 1ZBCA 1H2JA 2NW0A 4PUEA 2WVUA 5A8NA 2ZX8A 5A6AA 3ZSSA 3K8LA 3PBGA 3VSTA 1V0NA 3WQWA 3T0DA 3I3EA 1HT6A 3AYSA 2VURA 4C7FA 1C8QA 3RM9A 4PMOA 3AZSA 3WDHA 3BCFA 1Y7VA 3AI0A 3CUIA 3S6TA 5E9AA 1B3YA 3W29A 4PN2A 5CPTA 4D6IA 1TE1A 3CMJA 3ARWA 3N1AA 1E72M 3GNRA 4GIAA 1UG6A 1XCWA 3D51A 3AHZA 3WUGA 4GXPA 4BQ5A 2WZEA 1UD4A 3WUEA 1L8NA 3CHFA 1V3MA 2X05A 1QHOA 1SZNA 1QI5A 1E6NA 1J0KA 4J7RA 2WHKA 4FLSA 2AOSA 2OSWA 4IUGA 4BCEA 5M17A 1HVXA 2CESA 1WDPA 2O9RA 1PX4A 5A6LA 4W87A 2FHBA 5IDIA 1NARA 3UERA 1KR1A 3TOPA 1LL4A 3VD4A 1CTNA 2Y4SA 1EDTA 4A3HA 4AC1X 4AZGA 3ARXA 3QOMA 1DWHM 5I24A 1DWJM 2ZWYA 4ATDA 4BA0A 1CIUA 2EPNA 2XVGA 1GQKA 1U30A 2D22A 1B2YA 4UQDA 2D73A 4UOJA 5CPSA 3SCUA 4PTMA 3TTSA 2DSWA 2YIHA 4WJXA 2BNJA 1HJQA 2V3DA 4DO4A 4ZENA 3PZUA 2E8YA 5CGTA 5CSYA 5KZ6A 3NSXA 1EO7A 2JE8A 3DECA 4Y7EA 2CBUA 5EFDA 1XSKA 4DUVA 4AWEA 3FN9A 4MNJA 1TMQA 1KXHA 2NT1A 4AIOA 2WHJA 3FHQA 5JBFA 1QOXA 2YBUA 4MNMA 2VUYA 1QNQA 2DH3A 4U2YA 5CJ5A 4ZE5A 2PF0A 1W1YA 3ZOAA 1UYQA 2BS9A 1CZ1A 1VRXA 1KTCA 3VGEA 3VKKA 4CKQA 3RILA 4OKDA 3WF4A 2YL8A 1QI0A 3CUJA 1LF1A 3VIOA 4DWSA 1JI1A 1MQPA 4JCLA 5EB8A 4Z2HA 4HMCA 4J3TA 2Y8KA 3IAPA 3SCVA 1FH8A 5GPRA 4IPNB 1TA3A 2WMFA 4KRTA 4NI3A 4CVUA 1CXIA 2BY2A 3H53A 1V02E 5BRQA 1FHDA 2XPKA 3ZM8A 5BXSA 2XYLA 2WMJA 2Y8VA 3MUAA 4EANA 1CGTA 4WLCA 2WYSA 4H7VA 2BFGA 4TVDA 4HTYA 2F7QA 3MMUA 4PEEA 1PBGA 3WDQA 2XM1A 4MDOA 3WH6A 4K68A 4GI8A 5FKYA 3A47A 2CBJA 5EMYA 2CBIA 3WDRA 4M56A 1SMDA 1E3XA 3ZO9A 2WHLA 4W93A 1E1FA 4BQ3A 2TAAA 1Q6FA 1CPUA 4P8UA
chains in the Genus database with same CATH superfamily
3CHEA 3GMLA 4R97C 2EIBA 5ANME 4KXBA 2DZTA 3ARZA 4YFLF 2BSTA 5CPQA 4JFDB 1W6WA 3RY5A 1HCYA 3AGWA 4JRWA 4KO9A 1LQ2A 3OGCA 3QDJD 2OJEA 1CG9A 3QZLA 4OECA 3PJLA 1GK8A 4Y4HB 2Y23A 5CZVH 5IOBA 1OK8A 3TN0A 4APQC 4HHPA 3CPUA 3U83A 4QEEA 4ODXB 1TIUA 5REQB 5HHNB 2COQA 2PTZA 4K23L 1FRBA 4PJXE 1AGEB 4JCWA 5KVMC 5D7KE 4TPRL 3VTAA 5T1MB 2HJFA 2CBMA 1BZ8A 2VTFA 3CSYB 4N5ED 1BYNA 5IOPB 4OUIA 4NP7A 1I2RA 5JXED 4OI8A 4AUUA 1UR8A 4LVAA 2VDPH 3KDMA 2HS6A 3EYFB 1VPXA 1L0QA 5LDSA 3MLZL 1EHXA 3ES8A 4FX7A 3J7HA 4E5TA 4MJHA 1PKYA 3US1A 3V6BR 5A6IA 2PP7A 3FTWA 2GW5A 5D1ZB 2NUXA 2CPCA 4UTWA 2F54E 2XWXA 1CDUA 3TCXA 5IBTH 3WJXA 3CL7A 3NBNA 4XCYA 3B6SA 2CO1A 2PXYB 3UEQA 4CDHA 1XLKA 3O0LA 3CG8A 2CDFB 4PRTA 4LUYA 3LZPA 3GMPB 2QBWA 3WLOA 1D2OA 1LDPH 1MLBA 4UTHA 2WXNA 3KLHD 4TQEL 2UWEB 2NUTB 2ZXGA 4XTIA 3JV5A 2P9RA 4K8RC 1RERA 3GYRA 2W6RA 3IMWA 3PK7A 1K70A 4KFMA 35C8H 1NCGA 4MCMA 4LRTA 3YPIA 4MZ2A 3PP3K 2WSKA 4P3DB 1V3KA 3TKFA 3VYOA 2Z6JA 3O6LH 1F3XA 1LQAA 3A4AA 4ZX4A 1RZGA 5TDOB 4KFNA 3IDMA 5SWZB 5GJTH 5D7IA 4AZ8A 1N8ZB 3EOOA 4PTWA 4L48A 1HXMB 1XI3A 2VLMD 1UKTA 5GQBA 3P67A 1KBVA 3D0CA 4LU5H 1UD2A 4MDPA 5HHOE 3RQ3A 4YDJA 1J01A 2MNWA 1JDEA 4N6QA 4X60A 2KLSA 2DI9A 2ONEA 4DJDA 3LMJL 1LEKA 4OGXH 2AITA 1Z5LB 3B9OA 2BOLA 3BG3A 1IBYA 2FQIA 2Z31D 3S96B 4GMEA 3VDCA 3PP3H 2QCMA 2FJSA 3QJFB 3KWUA 4HJEA 2NYKA 4IFRA 4FXFA 4WK9A 4MB4A 4W4OA 3WL0A 4R96A 3RN6A 4RRPA 4M93B 3GRBA 3T3PF 3FT4A 1NKOA 4I7ZC 1HNYA 2OOGA 3VUAA 3IMUA 1X96A 1R5WB 4KERA 5GRUH 5MI0C 1FUNA 1F2QA 3G6JB 1KUMA 1TPVA 1VIZA 4EWND 2P5WB 1AANA 1IV8A 3WFBH 4HSQA 3KTSA 2GJ6E 3K30A 4P7NA 4LE8A 4GZEA 4YVUA 3PG9A 3F84A 1E8ZA 5K9QI 2XOTA 2RUSA 1NWPA 2Z2UA 1LO3H 3VIKA 2LAGB 2NZIA 4HG4K 2X7LB 4G9FA 4RISL 3HE7C 1XLCA 4JQVC 4NC1E 3FYPA 4FF7A 4KKRA 5HPMB 5F71A 1KLFB 4M7LT 2VKZG 3L5IA 3U79A 3A9BA 4MA1B 5LCVH 3DX4A 2NCEA 2XSBA 1J6PA 4WHTA 4ZFZA 3EDDA 1Q8MA 4PY8I 1QZNA 5CEXB 4FKEA 1VPOH 3OL2A 4WW2B 3QYQA 1HWGB 1ZHBA 3DX1A 4ZTPH 4N8VB 4FQLL 4WJ5B 4DN4L 2V3GA 1SLUA 2JKXA 5CHNA 4POZD 3TAKA 1QI2A 1OSEA 4L9LA 2BV9A 2PYEB 2CEQA 2C9VA 4XCFH 2QHLA 4DYKA 2Y7NA 5I77A 1X8FA 1KWGA 3CX5K 1A4JB 1GGOA 1JDCA 4M6NL 2IH3A 1UR3M 5DDHB 1VLXA 3KXFD 1ZLWH 6TIMA 4GABA 1CS6A 4JQAA 2YEZA 3UTTD 3MU7A 1AD0A 3BD4A 1LE5A 4OZHE 3KS0H 3APTA 1AYOA 4HHMA 2WNNA 4X5WA 5LN4A 2H6UA 3DHUA 5D4JA 3QQ4B 4LUTA 4MDIB 1RFDH 1KPVB 3P77B 1BGXH 5GIRA 2WNWA 4PYSA 2Q2LA 3MUZ1 4NBXB 3O6ML 3QUZA 4IMDA 4BF7A 4F2MA 5DCCA 2W91A 1MIMH 1ADQH 3VDGA 2FZBA 2XQ0A 4CVZB 4WK2B 1SXAA 4HS3A 1D2PA 5ADPL 5AG8A 12E8H 1U91B 2Z0BA 3GD6A 3N2JA 1GKOA 5DJ2A 2CLMA 2PDJA 4FF9A 1R3IL 4FYSA 3TBTA 3SUSA 3LTYA 4PR5B 3VXTB 4N6RB 2Q76A 3RPKA 1TRDA 5JHLA 1AKJD 3S5LG 3O8AA 4HKZB 3L4WA 1OC5A 2P5EB 3DGGB 4XNYH 4F7MB 2VLKB 4I3RH 1DZ0A 3TBWB 2IQ9H 5E2UL 3FQRB 1H0DA 1QNOA 4YYCA 3OP2A 3PWUB 4N4YB 3QC5X 9CGTA 2J4WH 2LT9A 5DBTA 4JTCA 2AZAA 2PFHA 4U1MB 4HU4A 1CUOA 1UM5H 4RNIA 2ZCZA 1IC0A 1V79A 3AXXA 1I1AC 2HJPA 3UW6A 2COVD 5LGJB 1T1YB 4F93B 4O1FA 4GQZA 3BD5A 5FHAH 2AKMA 2N59A 1AQMA 2MTPA 4P8QA 1QFWM 4PLJC 5JIDA 3SDXE 1WD9A 1V6UA 4V2BA 1KFCA 2YQGA 3HZMB 3N25A 4LASH 5AKSA 4AVJA 5HHPA 4YDKL 4IG2A 1LOLA 5EC2B 2HXTA 5HJLA 4MS6A 2GY7B 2VDKB 3O7UA 5GGSB 4PTXA 3DVNA 4KQ4H 2I9LA 1AZCA 2NY6D 3HB3C 3BW3A 3HPAA 2ALDA 4EPBC 1M57B 2CETA 1SO5A 1BWLA 4QR6A 2F7RA 2BSEA 2Q9OA 4ZPVA 1SDDA 5ICZB 3O3EB 3S2LA 1SUJA 4P04A 2VB5A 1IARB 2CZ5A 5LNSA 4RAHA 3QIUA 1VZGA 2X6CA 4QNPE 1NLDL 3ZMNA 5IVXF 3SGEH 5FA4A 3L1FA 5H8UA 3TV3L 3WOVA 2NLJA 5G4HC 2WLJA 1DVFA 5DSCA 2ZOOA 2QZRA 3QXAA 3P8IA 3W1NA 3KPPA 3CNYA 1MF2H 1Q8JA 1DUZB 2AK4B 3LKRB 5A1AA 5DD0H 3GSOB 3L0GA 4HLZH 2ZE3A 1YNTA 3Q6FA 2WCPA 3V5CA 1LO4L 5J9PA 4MZ3A 2GPTA 4XMTA 3LA4A 3N04A 5EC1A 2HVJB 4UTJA 5EULV 5TE7H 1OTTC 1R9ZA 4K3EH 1BLNB 3SDXF 3AW5A 3BESR 2IWFA 1RUAL 3BMVA 2F58L 4XMLL 4KKQA 3CX2A 1UCBL 1EVUA 1NWUA 1NP2A 1EUAA 1M65A 1B3VA 3G2GA 5IM51 3M8OL 1TQVA 1UP3A 3DGCR 2NQJA 3R1GH 3L5WA 3IS0X 2QJDA 3AIRA 2PO6A 5AB3A 1A3RL 4HUXA 1QVBA 1WS7A 3LQZB 4MAYD 5FM8A 1EEYB 2V9QA 4OLXH 4AD2A 2HRPL 3HRZC 2VN5A 2TSYA 4OD3H 4ZQRA 1DJQA 2B0MA 3BDYL 2QCEA 3KPTA 4YN5A 4F0SA 1JGDB 3VGHA 1BAFH 4IKLA 1JZIA 4HNTA 1VR6A 4O02H 2CDEA 1IQDB 1YDPA 1MCDA 4JIHA 3ZTEA 1CGYA 5D7LA 2WZHA 3R10A 5L0QB 1PLAA 1KBIA 4R9XA 1A47A 3IACA 3CEPA 4H26B 1XR8B 4D0BA 1XUZA 2FJGB 1OADA 3N9GH 1C8XA 1QLFA 3WAJA 4UTAA 3CK5A 4XP6H 1A14L 5BYWA 3S5YA 5JPNB 3WFCH 1D3GA 3BPOC 1AHWB 4AUJA 5HTSA 4YNYB 3C5ZA 3K4AA 4HUMB 3NCYS 4EI5B 2VWEC 2R14A 5FHBH 3ZBMA 4RGNB 4HULB 2QJJA 2PCPB 1ONRA 4N0YH 3FQUA 4HIIA 3SQRA 3MMEB 3L3OB 4G1MA 2AAVA 5L2JA 4LOCA 4Y8FA 5F7EL 5LAXA 3LTVA 2XJLA 4F3HA 1V6WA 1JHLH 3V4PL 3INUH 4QRUA 1C5DB 1TCMA 3ZT7A 2NQDA 4QGCA 2FGBA 4X0KA 1G4PA 1ES0A 5C0CA 2VAJA 3RUGB 4R0LC 3K0YA 4Y6GA 3VUSA 4O1CA 3RU8L 3EOLA 4PJDE 3QJTB 2NY2C 3PBUA 3CMGA 4TLKA 3EG9A 4HCFA 4GG9A 5M95B 3PWVA 1VZWA 4ZDHA 3WTXA 4JKMA 1UR2A 2R0LL 2DMKA 3M88A 2QJMA 4JTEA 2ARJB 1DN0B 2WIMA 2HTMA 4CW1A 4OZIA 1H6UA 3GM0A 2H2PC 3NZSA 2JIXD 3U4EA 5JZ7C 2VC2L 3OB0K 5EO0B 4B5EA 2IFFH 2K8QA 3BLEA 4CKVX 1UGKA 2JKAA 4PBGA 3BT2L 4JO3H 1PKOA 2BMBA 4WD0A 5GJNA 5IW6B 4Y5YC 2Z1WA 3P69A 1BTCA 4G7YL 4RGMB 4JRFA 2DQGH 4DP9X 5EEWA 3C75A 4Y9FA 4E68A 1MLCB 1H1YA 4MVBD 3RIFF 3BN9C 4PRIB 2XY2A 4HCGA 4OSUH 2YOCA 3VQ2C 2O7QA 4IUOA 1A50A 1OGTB 5HI5C 3LKOA 3QPQC 2OLAA 4QY8B 1GVYA 1FCGA 3UIZA 5JXQA 1RUKH 4EN3A 2OPJA 8CGTA 1W2KT 3DBXB 2B0SH 3TR9A 2Z24A 2OMWB 4PJGA 4CGUB 5DF0A 2FEDC 4LBSA 2DUAA 4JRXB 3FB5A 1ETA1 1WWBX 2PRHA 3OB0H 1RZ8A 3AUOA 4PD4K 4FQJL 1ZBKA 1AQ8A 1ITXA 1QDSA 4RVBA 2Z1KA 3BH8B 3TT1H 4Q89A 3IB4A 1I6NA 1DBBL 3QKZA 2E4TA 1K4GA 3VXMA 2O5XH 2JCCA 2LABA 1N19A 1LP9E 4UC5A 2XIMA 2R91A 3W02A 3GI9L 1SNRA 1F4WL 1PX3A 4LVHC 1WAAE 5JU6A 3OKKB 2H32B 2YFNA 1U8KA 2KZHA 5LNGA 4I6KA 4Z7UA 2I9EA 1IEQA 4JHBA 3N41B 4PJAE 1EJXC 3VUPA 4MBRA 4DEPB 2H3NB 1K03A 1MEXH 3O9WD 1H5BA 3G08A 3VFPA 3CIVA 2HVNA 4JQ3A 3BIAX 1NAMH 5KOVC 2GBVA 1DFBL 3QORD 3TDFA 1F4XH 1H0IA 3VNIA 1YN7A 1SN2A 3WELA 2E46A 1FVDB 5EBLB 5J06A 2Y0FA 4M29A 2GHZA 1S2AA 5HINA 1YUKB 3EGSB 2F6UA 3G5EA 1FP9A 2K6ZA 1Z69A 4LX4A 1E9LA 2G5UA 4DJMA 3IIXA 1E8WA 3L4UA 3OKEB 4NILA 1RZKC 1P6CA 1FGVL 5FJRA 3TA9A 1N10A 5D7SH 1MHCB 5L4JA 2XY1A 3TFBA 5CAYB 2VGIA 3V0SA 1VS1A 1A6TB 1DHKA 3C2VA 4HNLA 3OKMA 1RK5A 1V7ML 1I7UA 4I0PA 2KZBA 4AQ8C 2HZHA 2FHCA 5LQBH 3U7BA 1OC7A 3KPSB 4N4PA 1CFMA 4L3EA 4L4TB 2X2HA 3TYCA 1XLHA 2JB5L 1EXUA 3OMAB 1B9ZA 1P7HL 1ACXA 3HC0A 4F15B 3T0VA 3T2NL 1S7QA 5EHFA 2VGFA 3GKWL 4FI4A 1I7ZB 3QJZA 2PLJA 1MELA 2VXVH 4XNUL 1SFTA 1WAAF 2Y2YA 4YL4A 3QUXD 4V1DB 1CTMA 4ATWA 1DXFA 1T1ZB 1DWFM 1HNGA 4EOWH 3AUVA 1L9NA 3VXQA 4LS2A 3M41A 3AB0B 5XIMA 3IS1X 4Y5VB 4KVPA 5FLVA 4Z0JA 3MBEB 3V6OC 1UROA 2YFOA 1NEYA 3OVPA 4DUOA 3SPVB 3MNDA 2IEPA 4LOFA 1KJ3L 4V2XA 4XR8C 2J13A 3L3KB 3V0HA 1PZCA 5HMSA 3P5ZA 3CV2A 4PWKA 1TPB1 4H8WL 5C6WH 3E8UH 4Z3JA 1HEJC 1YX1A 4LLWA 3O41A 4OZGA 3QKEA 1OWRM 1FVEA 2HLAA 4HEME 3QR2A 3MLYH 2V2DA 2A2IA 3GSQA 4Y19A 5EEXA 1W6TA 4PTTA 3AWOA 3EYOA 2FO4B 4L4VD 1UG6A 1ACYL 1FF5A 3WUGA 2VITB 4O4YL 3GVGA 1QHOA 2AXJA 3W5NA 1XF1A 5EGRA 1XC4A 2DPKA 2Y06L 4PV9A 4AUBA 4Y16D 2AJXL 3OQ8A 1IBZA 1H7OA 5FM5M 3VD4A 1ZVHA 4QHKI 4DP1X 4Z76B 3DBSA 1W56A 3KR3L 1ZRUA 3VFVB 4DNMA 2E7LA 3NCFB 2VQ4A 2MPVA 2V3DA 4P4KA 4NM8L 2KERA 4FA3A 4ONHB 3GRGA 4LC6A 2VISB 5A2LH 4P2QA 5D37A 4K5PA 5C92A 2MRYA 4GMTH 5FI8A 2AQ3A 3PV6A 1J8VA 5EEZA 4PWIA 2HG0A 3ZTJG 2Q7YA 1L9QA 4LARL 1N59A 2XWJA 1AH4A 1B3JA 4EIUA 3QG6A 3ESVF 15C8L 4QXUL 5HDBF 3SPGA 2V0AA 4Z6AT 4JDYA 2YCKX 3T6WA 2KYIA 4ZMPA 2VL5A 3WFEL 3RR4A 3CK0H 4ZQTA 4JPIB 1OOAA 1DVXA 1COBA 1A1MA 1J7VR 4HGKC 3QV7A 4AC2A 4JG5A 2C5DC 4QHKJ 4OF8A 1GZGA 3L3HB 2AV7B 5JOFB 4Z7VB 5IVOA 1P1ZB 4NP9A 5DFAA 3UBXI 3GKAA 4UQ2A 2EXWC 2J7FA 4UNTA 4GQQA 1EUTA 4KVNH 2R2BB 5TE6H 2BW5A 1M53A 3M0KA 2LR4A 1TV5A 1VERA 2FH8A 4WNJA 4DK3A 1WUNT 4G43B 3WGVB 4PBDA 4G6AC 2A73A 5LYRA 3NCWA 4HALA 1NFIB 2AJ3A 3GXDA 4J3WA 2J88A 5E2JA 1J8KA 2OMUA 1LZOA 3N2BA 3OGSA 4EE9A 4D8PB 2VX6A 1U8IA 5D1XE 1C92A 1T2QH 2WBGA 3K2MC 4U33A 2EEDA 2YDAA 1FC1A 3QQ0A 1A9BA 1AO7B 3IYLW 1K8YA 3ITVA 3K2KA 5I0WA 4WSKA 3AU6A 2Y63A 1S9VB 2YZ5A 4QTIL 4H44C 1H9DA 2M1KA 2V5KA 2FVMA 5FF6B 1KEML 3W71A 2R2CA 1KSRA 4IOSA 2ISSA 3G5VA 1B3XA 2F53D 5DT5A 2WWKO 1W8GA 1E51A 2GYSA 1OCJA 4HN8A 1ZVSB 4RAVA 3GSNH 3SRFA 3ZMEA 3WE1A 3PBYA 4KOBA 3CQJA 5KSUA 2ZAHA 1D3CA 1CD8A 4Z3GA 1FWNA 2ZG3A 3RY6C 1GKQA 4M5YH 4LJ3A 2E27H 4QRTB 4IF2A 2DQFB 4KAQL 2XZQH 3EYSH 4MTMA 3S9IA 3U1QA 1FPTH 2KZWA 3C0LA 4HFUL 4FNUA 4DO6A 1SEBB 2FLRT 2DJLA 4B3KA 3QDAA 2YUXA 1QRND 1ZP3A 4QOKE 2ADJB 4PJEB 4HU2A 2X41A 2ZWLT 3C56A 3A67L 3UCRA 3VNZA 4NCC2 5GJSL 5I17A 3MV8D 2MSPA 2NRDA 1U8MA 4IP4A 4CJ1A 1O6VA 3CZ8A 4XO5A 2GDVA 4HWEL 2OT0A 3IUHA 5CD3B 2EDMA 1GS7A 4UIMB 3HR6A 3W0KA 5ISZE 4GNKB 1E5UI 4QXVA 3IVKA 1SO4A 1A0QH 3ATDA 1NUNB 3N4FA 2L5HA 2W81C 4FNQA 2WQRA 4RDQF 2ZX7A 4ELKA 4UUIA 2J9XA 1W1TA 1X5FA 3FH7A 1J0YA 4QXIA 4C90A 4P3CH 1US3A 1TNNA 1WFJA 4AYMC 2XDHA 1B0RB 4A2SA 2OZNA 3LRSB 1A1OA 2XTJD 3WK1A 5AB2A 3A4WA 3AFBA 4IM8A 5BV7B 1XH3A 2EO9A 3H7VA 4DW2H 4IZGA 2QL1A 2C14A 2V5SA 1WC7A 4G8TA 4RMTA 4F33A 2X87A 2J7BA 4TQ8A 4N8VG 3DC0A 4MHHI 3MUGB 1A25A 1S7TA 2HLFD 2JTYA 4AIZB 5ABFB 2CU9A 2F5BH 1AXSB 1Q9OB 3HA1A 1M56B 3BVNA 1C1EL 2O4QA 2PP0A 4LCYB 3UVAA 3P11H 2VEGA 1I8IB 1B88A 1JZ4A 3KAOA 1OF2A 3QCUL 3FONA 4FNPA 1SM3H 4IOTA 2EKGA 1XCFA 5E6ZA 2Z4TA 5CP7B 4PQXA 4HAGA 3EO9L 1GJUA 1MFCL 4F37F 5GS0L 2ED6A 1G4TA 4K7PY 4TUFA 1A6UL 4I3SH 2Z1PA 1WDRA 4MA7L 1F02I 4W1TA 3UTTA 5IV2B 1INEH 4XOCA 4V27A 4NOBA 3N2MA 4M03A 3SDAC 4AQAA 3HMXH 4U6HA 3OG2A 2X4PA 1G7JB 4S1FA 3B43A 2XGZA 3JV0A 1J8HE 4G8GE 3WX7A 4NRYA 3UBHA 1D7KA 3W1PA 3REVA 1QNRA 3B7SA 5CUSL 5FGSA 2OSLB 3FJLA 3GZKA 2G0LA 3RJDA 1FDZA 5EV7A 3VRJB 1ML0A 3IIZA 2BZNA 3PR2A 5ITBL 4IGBA 4KTEL 1TCRA 3MUY1 4Z8FH 4EVNA 3MTXA 3X1BA 1QR4A 4JR9H 4WY0B 4IHBA 4PSRA 3SCWA 4Q8MA 4S3JA 1E4WL 3OZKA 4B60A 1M2VB 4NQEE 2F08A 3UTQA 2PF8A 3PJXA 2PYFA 3BCDA 2AQ2A 2EC9U 2GITB 2YPLA 5E6ID 3SN6N 3HG0A 2LU5A 2CUMA 2Q8AH 2X1UA 4IMGA 3JYBA 4URTB 1DQLL 5HDRA 4AZCB 1LHZA 5JNYB 4A7SA 1Z66A 5T5FL 4AGPA 1AMYA 3QZMA 5D8WA 2IKGA 3TJIA 5G4EA 3MNWB 1WNOA 3WY1A 3IUIA 2P0IA 5DFWH 5ECUA 3VWKB 4I5RA 3T6VA 4KEVA 3EWDA 3VFGH 1WAWA 1O95A 1E4XL 2V2XB 2F8XC 2VR4A 1RHHA 1GGTA 4GG8B 3VWJB 2ZZ1A 3P0GB 3SE4C 2EZ0C 1HCFX 5HNRA 3R0DA 1EJFA 1AIFB 4H88L 1XCQA 5D2NC 4LBRA 3U1SL 1GL4B 3GUWA 3FK3A 3F3HA 4QR7A 4MIMA 2N1TE 7TIMA 1E27B 4QCIA 3CO4A 3O2LA 2G3MA 3RDTB 3U0TB 3SSGA 4GH7B 4B3VA 2OL3H 1VEPA 3W26A 1YN6B 4FQHB 3S9ZA 3EO1A 3FO9A 1B57A 2OMYB 4F7CB 1HKMA 2DQUL 1RCYA 1RURH 3PY2A 2WW8A 5IP4A 4ZNEE 2IALB 3EBIA 4I9TA 1E65A 2WLYA 4GUPB 4H4IA 1JTPA 4YQXH 3L4XA 4Q8UA 3WEXA 1N0XL 1XLEA 5CSRA 3RZCD 5L6YL 3TN5A 2JK2A 4Q3MA 4IRJB 3GYEA 5FJUA 1W5NA 1UXSB 4UMGA 3UXDA 4QT5A 5CCJA 2CH8A 4TNEA 5C97A 1I60A 3DHMA 2JLLA 2LLEA 3RWEB 3U6RA 5KVDE 1OSYA 4CSTA 2EP6A 3CQHA 2KT6A 5ALBL 3THCA 4NAMA 4F7PA 1SDYA 4O0KA 1UWEH 4MNQD 5AFAA 3LN4B 1UJQA 2LVEA 5DVMA 4G82A 4JFYB 2POZA 1NQKA 2DT0A 2QCNA 3HV8A 3V4VA 1TJ0A 3BKCH 3N6YA 3VFSA 1CGSL 1CNVA 4JZJB 1I1FA 4I9WE 1N2VA 3W1RA 4PTUA 5B38B 5AC5A 2XFGB 2ACSA 1I1YA 2OO0A 2QJGA 3KPRD 3VQLA 5F7FA 5CZTA 4FFWC 5T1LD 1PYWA 3U46A 4HDIB 1OP5H 2YD0A 1YYML 1HH6A 3IPFA 3S3CB 3CQ0A 4LSDA 4ZTXA 3G04B 5DMIH 3ABQA 3VILA 3URQA 1HI6A 4UTKA 1YEDB 1VFOA 3VOHA 2H1PL 5I1LA 5C0BB 4B3EA 5CAHA 4GKZA 2CYGA 5E1AB 4PU2A 2R8SH 4CD7A 5HXMA 3PL6C 3OHXB 1XKJA 1CLCA 2DV0A 4JUTA 4BHUI 2BMKB 4GI6A 1OFAA 4S3GA 3WFLA 3UAAA 1SPDA 1H51A 2VC2B 4F7TB 1N82A 2D20A 4BINA 4JKNA 4BHYA 3OQ3B 3WH9A 3VI4A 2AMGA 1U3JA 2ETWA 1FH5H 3VVVA 4WCYH 1KB9K 5DD5L 3LIUA 1OX4A 3MYJA 5FEXA 2WNGA 4REQB 1WO2A 3C5SB 4A7GA 5DJXB 4LKCB 4XAWL 3N6QA 2D7OA 4ZAKC 1I3GH 3GUGA 3EDEA 1KGIA 1KDJA 2EINB 5FYKU 1S38A 3TYEA 4JO1H 4HA3A 1OWWA 5B7FA 1T7YA 3NQBA 5F89A 2CALA 1LEIB 1VJZA 1D2KA 2O5ZH 4DPRA 3E0IA 5DJZA 2HE8A 2APSA 1ZP4A 1CXKA 5KN5B 1DUYA 3MJ8B 3ELAT 3QQ9D 4YFEA 2OMZB 2I5IA 3PANA 3PJSA 2HDJA 3QH2A 1P0NA 2YRBA 3U7WL 3HM7A 1ZB5A 3BKJH 4FTVA 4GG6A 3HC3L 3RWCA 1FHGA 3TO4D 3JU2A 3QNFA 5JR1H 1OOWA 4NI6A 4UR8A 3W11C 1YY9C 1GKPA 3HIZA 1UKOA 4LNYA 4ZA0A 4MUPA 1GGBL 4Z78A 3UY8A 1N68A 5HPCA 3PUUA 4XPFL 5LSMA 3EH5B 2NY1C 2WV3A 1HKIA 1JPSL 4H2CA 1TEYA 1IKFL 2D2HA 1OWQA 4H0LC 3M0XA 2RDXA 5F3HB 2PB1A 1BBJB 2EVGA 1NM9A 1W2VA 5EBWB 3WY4A 1AVAA 1FV1B 4IMAA 4U3XA 2OQLA 1LLZA 4XBEH 3KBEA 4ZUWB 3TFXA 4XZ9A 1P2CA 3EZ4A 1WFMA 5AKQA 3WFZA 3NRFA 4GVGA 3N40P 3ARRA 4AG4L 4MJID 4K8EA 2AEQH 2W27A 1XMEB 4Z95L 2BC4A 4LSTL 1DP0A 1H62A 4RV8A 4PE8A 3LKPA 2CO6A 3OHIA 1GZHC 3C08L 5LKNA 5A6BA 4UNIA 2DWEB 2XU9A 3Q44A 2Z4GA 2OBGA 4ZFGH 1XRTA 2FRGP 1L9OA 5KBKA 3U2CA 2XBDA 3IAQA 3PIQB 2RR3A 4GH1A 5JBEA 2YJQA 2ZQ0A 2P5PA 2VEPA 4TSBH 1S7XA 1XL4A 5IGXL 3RA7H 2PWGA 4G6MH 3ARPA 1TQSA 2ZJSH 4AKQA 2MEJB 5LA2A 3WE6A 1TE6A 3W38A 4Z2IA 3R5EA 3NJFA 3X14B 1A7NH 4AF0A 3DBPA 4CSZA 5KSAC 2ZCLL 5FA3A 4GGBA 2FWSA 3N3MA 3O11A 2IADB 4WUIA 1JGUH 4Q33A 3LV5A 2H6OA 5EU4A 4XTRC 5J57B 3UYRL 1FG2B 3QEUB 1PLCA 1OY3B 4BR1A 4C4KT 1MAML 2JQMA 4MWAB 2FSEB 3VO0A 4D0DB 4NX5A 3ILPB 5E6UB 2DSVA 1ZT4A 2BRRH 2X4NA 3KBSA 1CLZL 1FZKA 4PGCA 3KL3A 3EWUA 4Q9RL 3C8FA 2DL2A 2DEWX 2DAVA 4OCRL 5FECB 3MRKB 2NYYC 4M3HA 3RAJH 4HAFA 4KX9A 1OCQA 2F61A 3M5ZA 4M6OL 3MJ9L 3PWGA 1SOSA 4NS0A 2UVFA 5F2IA 1JFQL 3L3IA 2NXZB 4P46C 1F3DH 4U0RB 1IAIL 1Q72L 3GNDA 3WNNA 4H8PA 3VB8A 3UDWC 1OGSA 1RQEA 3HNSL 3IETA 1Q7QA 4WR3A 3TGXA 1H3GA 3ISRA 2OLSA 3KBJA 4KWWA 2UZIL 1ZT1A 3G24A 3EF4A 6CGTA 4B3LA 5IEHB 1MNUH 2J1YA 4JPVH 3QIBC 2WOYA 1WSST 3DSNB 2XN9D 2EDOA 2EH8L 1WIUA 3FU0A 2PDQA 1H09A 1WHPA 4C6MA 1MCPL 4KGJA 1K9EA 2VRJA 4PJBB 1BW8A 1WISA 1A6AB 3S1GA 5KSBE 1O68A 1S39A 1YQ2A 3V0VA 2VD8A 3MRCB 2VH5H 3PPHA 1QOKA 1EC9A 5C2BL 1W5OA 4RZ4A 2AGTA 3TP4A 4AYSA 2H90A 5FIPA 3HN5A 1CDBA 2BP5M 1EAQA 5M5DA 4U1SA 2ODOA 1OABA 3LGGA 3CLEL 2YCLA 2QELA 3RPDA 3G5ZA 2E5EA 5F4WA 8XIMA 2J8FA 4I4WA 5FOOA 1NFDE 1RZIA 32C2A 3QGAC 1FIGL 2VM9A 3D39B 4JY5L 4PV8B 3CFBA 1IGMH 4A3YA 3RU8X 2YZRA 4EACA 3EOBA 2XA3A 5E03A 4QRSB 5ICYB 3ZR5A 3NFSL 3OPSA 4R6UA 2UY3A 1OBAA 1P84J 4N42A 2YD2A 5IT2L 1JUKA 4PJXF 2NX5E 2JKPA 4FXGC 4AQEA 1V7NL 4FN0A 4GD0A 4ETQB 1HHIB 3ZPDA 3VKBA 2AS5M 1IEVA 3GMOA 5GISL 3NAAH 2RDUA 2NXYD 3V0WL 3FJNA 3SN4A 1MPAH 2FD6H 1MW1A 3UAJC 1J11A 3M86A 4HJSA 4X98B 1Z9NA 4U1KA 4LKXB 3DTDA 4JO4H 4YHNA 5KSBF 3TEZA 3FF7A 1NU5A 5EU5B 2IBZY 3VCRA 1TVHA 1VGEL 3V7MA 3KLAB 4HW6A 1WQ5A 3ZRCC 1S9YA 3TZVC 3PGCB 1IIKA 5DXWA 3PPEA 1RUQL 5TQ2H 1YEEL 4WRHA 1UXLA 4NQDA 3UOAB 3D18A 2ZIDA 1KYFA 3MRPB 4BQBA 3EYQC 1OTSC 2A9NH 4MQXC 3TCTA 2D3NA 4LVEA 1PD0A 2PGWA 5HBBA 4US5D 3BE1H 4JDZA 4HUUA 5MENA 4YVPA 1E71M 1JWSA 1GOQA 3H23A 3FQ2A 2ZRYA 1KCZA 2AL2A 3NP4A 5FYKL 3T2QA 3CFTA 3MRLB 4GRSA 4JK0D 2WBWB 1KCUL 1UVQB 1LMKA 3NJ3A 4D6HA 3B03A 3WBDA 2BLFA 4XMPL 4FAMA 2Z35B 4NC0B 3VAEA 4N2LA 3O2VH 1QR1B 1S9WA 2E9BA 3NQFA 2ODHA 4JN1L 1N7MH 3QXTA 1TJMA 5EPMB 1C8QA 5BOFA 1EWDA 4PMOA 3TH3T 3K6FA 2KS0A 4QYOB 3U0HA 1C16B 1U4FA 3ISYA 4D6IA 1FNGB 3TWCH 3NACL 4GXPA 4AQ1B 4BQ5A 4N24A 5T33L 1L8NA 4NN5B 1H3VA 2X05A 5L4MA 3WLNA 2YPKB 4U1HB 2C1GA 2DJSA 1A7QH 3SPIA 1KNOB 4ZUUA 1I9JH 2L7EA 4P5KA 1DWHM 3CFDA 5MERA 1GGIL 2EPNA 1UJTA 3HNVL 5CZJA 1RVFL 4NUMA 2EIMB 4BE5A 4XN5A 2VWEE 1QRKA 3QWRA 1YJDH 2B7NA 4PYGA 4JS3A 4WJXA 3VXUA 3GAYA 4ODUB 4I3GA 5CSYA 5KZ6A 3F5WB 1TTIA 1IGTB 4WKXA 2J9ZA 4H20L 3K71A 1K2DB 5AYTA 4L65A 1DDHB 2NT1A 3UGRA 1FN4B 5I3IA 3UZQB 3TLRA 2PF0A 3ZE1B 1U8NA 5G4OA 4BK9A 5I9QB 4NUQA 4TU1A 4P9MH 3JV6B 3I4KA 5HHME 4HHWA 2JLPA 1MQPA 1F4YL 4XD3A 1L5GA 2PDFA 4PV1C 2FDBP 5BXSA 4PY8J 2XPKA 3NL5A 2Y8VA 2BFGA 1P48A 2NY5H 2VWSA 1J1OH 3MOAH 2YCIX 1QG3A 3BVDB 3PZMA 1IGFL 3V7AG 3EMQA 4BQ2A 3EHBD 1FFPA 1JZFA 3CAVA 3Q8EA 2ICWI 1AI1H 1R3JA 3KOFA 1Z44A 2ZD0A 3UJEA 1MWAH 3L2MA 2R7EA 4UF7C 1N0LA 3AT0A 2AV1B 1VGKA 5A8MA 4A55A 1ASOA 4DGUA 1U58A 5CGBA 1SUXA 2NXGA 2CIIA 5IQMA 4H13C 1TTCA 1QRNA 2X6VA 4B9PA 4KK6D 1UWGH 3SYAA 3OIHA 4ZMYA 2FATL 5SWSD 1M05A 4PBXA 4XNZB 1TLMA 4YLCA 3MV8A 2X4TB 3OKNA 2TRSA 5BV7L 1KFBA 1MJUH 5AY7A 1TA3B 5D1QB 3H1ZA 4U6YA 4AZ6A 1NUDA 2V3FA 2XKSA 3A4JA 4K7PH 4ZQKA 1D7FA 5LNVA 3LS4L 3QDMA 6FABH 3KVJA 4RWYH 4RZ5A 1F5ZA 2W94A 1O5DT 2Y7DA 1EFZA 4OZHF 1GW9A 2MOGA 3TBYB 1PNCA 1SZEA 3MFFB 2QDVA 4G8EA 4GGHA 2Q8XA 1PTAA 4DIXA 4NF7A 2F74A 3W1UA 3MRJA 1MZYA 3VFTA 4WAFA 7PTDA 1DL3A 1PS3A 4FEZA 5FK9A 4QG6A 2DI7A 4TUOA 1FBIL 4UM8B 4IGSA 4GOAA 4PJ9A 4NZFA 2J8OA 4CGTA 2H9GB 4NZJA 5CILL 2FB4L 2A6JA 3LPGA 5ECVA 3VFNB 2CLKA 4UWMA 4UT9A 1VACB 1RAMA 4EBQL 5HWJA 4LSBA 2DB8A 1N12A 4FX5A 1NDVA 2V5BA 5HI3D 2BIOA 4J2MA 2Z6FA 5K2ZA 4A2FA 1W9VA 4FG6C 5T3XL 4WDTA 5INDA 1KIRB 3R12A 3GU1A 3ZYJA 3QJHB 4MCNA 4KCUA 1S7VA 1EFXA 4J4PC 3LIZH 4QTHB 1ZK9A 4NO0B 3WTUA 1AR1D 4O28A 3OC8A 4YSAA 4ELDA 5IEKB 3M43A 3M6DA 2G41A 2JF6A 1I7RA 5F0JB 5EU6E 3S48A 4F8QA 1CW2A 4CC1A 5DC4B 2CW6A 3KLQA 3ERXA 2FE0A 3Q3GB 3RURA 3T65B 3TEXA 1TYJA 2G4EA 5AAMC 3TA3C 1B3ZA 4NQCB 3QRHA 1U5HA 4QEHA 3UFYA 4JX6A 1E4KC 5K69A 1QEXA 1S3TC 4FG2A 1K3IA 2B4CL 4IQHA 3UPRB 3V5DB 2JJUA 3K4WA 2IPFA 1T03H 2QGBA 4Z1BA 1GCFA 3K72A 3O3DA 4F57L 2P47B 3QC6X 5HYFA 2VCBA 3NL2A 3SCMC 4JVUA 1I3RB 1UH3A 2F8QA 4OFQA 1N4XH 3MUHL 3QI9A 3RNKB 3T7VA 3GBNL 4XVJH 2FX8H 4QNPF 3I4EA 2IQ0A 1SFSA 4JAWA 4Y4KA 4HWBL 3AIBA 1R3WA 3ABKB 5FCSH 1YEHL 1MXDA 1CE1H 1RUML 4YOKA 2YL6A 3TXVA 5JMUA 3HAEH 5F3BA 4E4FA 2P53A 2XCMC 1VBHA 1HHHB 1GEHA 1K8DB 3ARDB 9PCYA 3FS2A 2WZ6A 1UB6B 1RPUA 3QF0A 1KXTA 4AEIH 3MO1B 5CJNA 4P7RA 4TQTA 4XOBA 3RMEA 3AAZA 1DBAL 3V6OE 4KDTC 2V17H 4PRHB 1D7CA 4P2RD 1XZWA 5KVEH 5AC8A 1ZAIA 4F58H 5A8PA 4ZTOH 5CBAA 2ZONA 3HR5A 4DN3H 1S5IH 4R2GC 5A2IH 2Y85A 3K4ZA 1FO0L 2GUOA 3QHOA 1IWBA 4V11A 4HPHA 1KXQE 1JWMA 4EXAA 1YBQA 1HC1A 1CGXA 1UC5A 1VBGA 3V5HA 4OCSL 5EA9A 3APNA 3IJ9A 1G6CA 1V5XA 2QV5A 5DJ6B 3BISA 2C6QA 1NGXA 3DOSA 1FNLA 3LX9A 4N02A 5BXFB 1T20A 3CCHA 3QG7H 4WGVB 1RALA 5HHQB 4KY2A 1NJJA 3WBXA 1IEBA 4XPGH 2E1WA 4WEBL 2NSQA 2I32A 1E55A 3AM8C 4UT6A 2ZRWA 2Q3ZA 1OQOA 2F19H 3PXJA 4UTCA 4PUMA 2P26A 3CHDA 4NZRL 3EBAA 2G75A 4UTTA 4LCSA 1ZGLM 3SGKC 2E0PA 2VNCA 3BOLA 3B3IA 1AD9B 3CGTA 4Q8NA 4JGDA 3W0WB 5GGVL 5T3ZH 1G84A 4E41A 5B38G 3LHPH 3QV6A 3L2NA 4ZSTA 3ULAB 1YYAA 5I76A 5PTDA 3R0KA 3H9SB 4RQQA 4OD1L 2X4SA 2PD9A 4M7JH 2D24A 4PMDA 4A2HA 1U8JB 4GYJA 5CAKA 3DGBA 2ZP0T 2GVJA 4MZRA 4FG4A 2VC9A 3UR8A 3CYVA 1A8ZA 2HSIA 4KGLA 4EP8C 2HROA 4XODA 2XN0A 4JTJA 3SIMA 3QWOA 3QIWC 5F1IA 3FCPA 1BZ7B 1XYAA 1U93A 4ML9A 5EEYA 2UZXB 1JRHI 4U7MA 4JFQB 1UOVA 3L3GB 3MN8A 1A65A 5DX7A 4NKDB 3EA1A 2NY4C 3UR7A 2NSXA 1MMFA 5E2VH 2ASHA 4DWSD 3I9IA 2ZUQB 3ZR4A 1S9XA 2OR8A 5J56B 5CEYA 4IMKA 4QGTA 1X39A 4V15A 4OGAD 3EB4A 1NCAL 3NGBC 3M7SA 2GJLA 1S2EA 5IOKA 4TSCL 3SYQA 2RJHA 1AFVL 3SPCA 4OM0L 1N8WA 3U25A 5BRZD 5FYJU 4PJDF 4W8AA 1DOSA 2P4AB 1URZA 4ELMA 4APXB 5BW7C 2GBTA 1FZOA 3H7LA 4O0ZA 5FWQA 3LSBA 4IHOB 5B1KA 1OD8A 4BF5A 4DAGL 4R27A 4DRSA 4E9YA 5DUPL 4R4ND 4BWLC 2BNQB 3EJRA 2AXFA 5DMMA 4HK5A 5GRXG 4AZIA 5GZND 1RJZA 1LRQA 5ETUB 6REQA 1S6NA 5K9XA 4LSVL 5CJOL 3RLVA 1HQ4A 5KYYA 1H7WA 5KBDA 1JPGA 3TWBA 4PRPE 2RMNA 1J12A 1DDTA 3RDKA 1RBLA 4H25B 3IJYA 2IFGA 1LK2B 2E25A 3MLVH 4GZ7A 4F1SA 3NDYA 2C9UA 4GIPD 1K8CA 4Z7IA 2AJYH 1XRFA 3U5UA 5ECGA 3CL8A 1UM6H 1YQVH 3THMH 5FKPA 3H2WA 4AGQA 2E6AA 1G7IA 4FXKC 1P5VA 1XF5A 3BZFA 2BOCB 1DORA 5HJGA 3E2HB 4JQ4A 3LVTA 3CBWA 1FL6B 3N85L 1W1VA 1VGAA 3FSZA 5DWUH 1TVNA 5C55A 1HTIA 3IFOA 1JGEB 3LVEA 1XEDA 2UYLA 4DWHA 4FFTA 4N0UE 1PWLA 1DQMH 1U6AH 3L3JB 2HKHL 3ZKND 1BG1A 1O4UA 1WUZA 4Z5RB 4PUBH 1MCOL 1TNMA 3VXSD 4Z7OE 3BXWA 5FCUL 4PUWA 4OF7A 2YAEA 1SW0A 4OI7A 1J1XH 3KXQA 5F0MB 3KVPA 2E68A 1LP9F 3REWB 4X4KA 2Z8VC 2HVMA 2X70B 4XCEA 2ZCKH 4QI3A 1D9KB 3DSFH 1LD9A 4JO8A 3QZWA 2EC8A 5IESH 1EMTH 3LLFA 5D71L 2R69A 1T0NB 2HWGA 5KVFL 1MRDL 4PJAF 3AXLB 2VFHA 4M3PA 3LSCA 4C56E 2IAMD 3RITA 5HYEA 3N9KA 5AVNA 4KJYB 5A2FA 2QSTA 4CA4A 3T5WA 4F0RA 1GOFA 4WFHD 4MD4B 3NA8A 1C9DA 1KYDA 4HOMA 1VH7A 5CPLA 4GNJA 3QEQD 4N0CD 5EF2A 1ZU8A 1IZCA 4ZUVA 3NCEB 5CIPB 3T8LA 1PCXA 4XT1C 5C08A 1BQLL 4I2XA 4LQ1A 2IKIA 4QJ1A 3REQA 3DXAB 4Y9OA 1TZAA 3U30C 4S1QH 5DQJA 5KYWB 3W2MA 4Z7NB 2O9OA 3ZJ6A 1MI5B 2NWRA 5BZDA 1BSIA 3P9MA 3RX8A 3DJTA 2RGMA 4MBOA 2X4RB 3RTLA 1CICD 4X4YB 3SB3A 4P23C 4EQ3A 1FH7A 3N17A 2UZPA 4JTFA 4M1GH 3MCMA 3SBQA 4QXGH 1HYSC 2YKLH 1QEWB 3P74A 3QDJA 1YMME 5K9OA 1ZSDA 2ENSA 1I0BA 2NVAA 4JFFB 2Y3NA 4PS4L 1WV7T 5AOZA 3ZFHA 2WXGA 3O8XC 3DG6A 3VIJA 2DQJH 5C0QA 3ZVHA 4ZBCA 4DBSA 4NO2B 4L3CB 4BUQA 3KYOA 3WJMB 1V55B 1VCBC 5ACMA 4A38A 4IMLA 2QPFA 4TNGA 2FIKB 4UDUB 5JXEA 4XBPA 1R19A 2E9MA 3MRHA 3SE6A 1KJ2A 2V7NA 3HZKA 4AQZA 3PCYA 4WO4D 4Y9BA 4LAQL 2F7FA 3DX9B 3GHBL 3ISWA 3ILEA 1T21B 1PCKA 3WXVH 2C9AA 3B2VL 2PC8A 4GBXD 2CXKA 5ABDE 5CEZH 1T4KB 4KO7A 4PGJA 2DWSA 3BSZL 3O6MH 4N28A 5AZEL 2VABB 5KAQG 1BVNT 5D5ME 5GJMA 2VT0A 1SJHB 2PP3A 1BQHB 4JYFA 4D6EA 5SX4I 3RCMA 5D2NE 4AY1A 1WBHA 2EADA 4HWNA 4PREA 4DQAA 1XGUA 5L8LB 5K7JA 1JCVA 4HXBH 1XIGA 2WMGA 3BH9B 1PAMA 4DJEC 1DR9A 3R4RA 4Q22A 4OLUL 3NABL 3OMIB 3KPNA 4ZS6D 1RY8A 1LBMA 4X2PA 4HJJH 4WU5A 4NBYB 4WHYH 2NY0D 4HCIA 3AY4A 2V5LA 5DEFB 4GY7A 1G5AA 4AXKA 4HQVA 1JPTH 3QNYA 4J6IA 4LANA 3CU7A 4MB5A 5E2TH 1A1NB 3U4AA 4ASTA 2YXVA 3NM3A 3MNMA 5JW5A 1JP5A 3KD4A 1XH2A 4LP5A 1PNDA 3FDGA 4JX5A 1LLOA 5I19H 5B1JA 4XMWA 3P4MB 4IHCA 3ZXWA 4OV5A 3W7QA 1R3LB 4KKCC 5FAGA 3NQCA 1AS7A 1P0KA 4MPKA 1RSYA 3IPEA 5C1MB 2C3VB 1OQFA 4YK4C 5BVPH 2VR9A 3WQVA 5EZLB 1WFNA 1F90L 2G2NA 2OCJA 3M0HA 4GEIA 2WZAA 1S7RA 3K1KC 3AICA 4MJ5A 1PIFA 2OZ0A 3QTGA 3EJZC 3BRGC 3EIFA 1BD2E 5F96L 2Z31A 2RH0A 3EYVB 4JDVA 3QUYD 4N8PA 4HKJA 1ET7A 1H3UA 1ODAA 5IBXC 3I84A 5KSVA 1UZ8B 4BKLA 1B3IA 5E9DE 2GAZB 4KHTH 5B4MC 4PRBA 5EUKA 1XP3A 4IPPA 1XIEA 2JF7A 5JUEH 1SHXA 2GOUA 4KFPA 4XE0A 5LXEA 4EJ1C 3P9LA 3NFPA 4DO7A 5FYJL 3TNBA 4LCUA 4LSRL 4RFEB 4JO5A 4OGYH 5HUPA 1WBXA 4X80H 1GSMA 4NAFA 3CPRA 2FX7H 1M7XA 3CVHH 4WTWA 3KLSA 3TYUA 1VZHA 5TFSH 1TFVA 4OKVB 3KPLA 5GSRB 3HQNA 3MKVA 5TDPA 3MLWH 1BDYA 5T1KD 3ZT5A 4AVFA 4XNXH 2YCJA 1SOXA 4G6KH 4MB3A 1UUQA 4HIHB 4IWWA 1IEAA 1EPXA 1CTOA 3O4LB 3OZLA 5HHVH 2CE6A 3HNTH 3HU7A 1I9IH 3MA8A 1BEUA 4LLMB 3W23A 3UR5A 2O26U 3F65A 3GMQB 1I3VA 3HN8A 8FABB 4B0MM 1Z32X 3S1WA 3BURA 1TU2B 3ZWSA 4IRZL 3DFHA 3ARFC 4N3UA 4MA3A 5DD6A 1KLZA 1K4DB 2IQDA 3X1GA 2JF1A 4PJCA 3C61A 2CHNA 4L1WA 5MEQA 4JFXB 2BZ7A 3WS6A 3CHRA 3WSUA 5FSDC 4FZ8L 3QCTH 3KXFA 2HPIA 3FT9A 4HIXL 4KZDL 1YNLH 1YMYA 4IEFB 43CAB 3P5YA 1CWVA 1YJDC 2DM7A 4IOIA 3F7VA 2ZADA 4DSYA 3UNDA 1U8CA 3SDYL 4I8YA 1A7RH 3S34H 4WOZA 1H6TA 3LXUX 4D9QD 1ZA3B 4PGZA 4F0KA 3FFCD 1CMOA 3VSTA 1V0NA 2WZPD 1PZUB 1KN4L 5HYJD 3FFSA 4LAKA 4MS8D 4PUNA 1GOXA 3W29A 2EEFA 4R53A 1OGAD 2GGHA 1DANU 2L7JA 2OR9L 1OLLA 1ECYA 4BKNA 1MI3A 3ZL2A 1IVLA 4HC1L 5GGRB 2DVUA 4E38A 5HY9A 4HSNA 1RMFL 3BOXA 1E4JA 2NY5C 1LRTA 4L8BB 2NV2A 2Y9RT 1TELA 2CO3A 4LLDA 1AKJA 3EZ8A 1IC4L 2ZYHA 3MLTB 4NUJA 3RL2B 3WUZA 1RJPA 3DIFB 3B7TA 2D73A 3PC0A 2JQXA 2ZFAA 3TR2A 3V0EA 5T3ZE 2ZZ7A 4L9ZA 4OLVL 2DSWA 5F2GA 5IKCB 1HJQA 3WQFA 3BE7A 1CFQA 2K78A 1RIHH 4MDJB 3QGKC 3H3BC 1IL1A 5EFDA 3W01A 3CEUA 4ORZC 3Q05A 1OF8A 1G7LA 2DH3A 2FL5B 2BS9A 1EJ8A 1TPDA 3U0WH 1CZ1A 1KTCA 3F7JA 1N5AB 3QAZC 1BBDL 3CV6A 1KPRB 1LF1A 3GJEA 1U3HC 3SSZA 4YFLI 4JQ2A 2OP4L 4GQ9L 5HVHC 1Y5XA 1JF1A 3VFMA 3FOLB 2BVOA 3EO0A 4EUPA 4RMWA 3GSWB 3F62A 1XBDA 3ZM8A 1NCWH 3UNTA 3VVWA 3NFNA 1VHPA 2YMTA 2CBIA 5EMYA 2W9DH 3OG3A 3BLLA 2ZRVA 5HDOA 4QTFA 4BQ3A 4MMXA 2TAAA 2YAMA 4ANWA 2X0WA 3WEOA 3AREC 3CLFH 2P8MB 4OLZL 2AXHA 1FXQA 3TXZA 5C0EB 5LNDA 3SECA 3L1OH 2BNRD 2B1OA 4M6ML 2OEMA 5HGDA 5I71B 1XGQA 5HDWA 4KQ0A 1BEYL 3EFOA 4ZXBC 4L1TA 1LNUB 3Q48A 1NIEA 3VMPA 1L0PA 1RU9H 3TA4D 4WU7A 4BZYA 5IMLB 3ZZQA 4KY1L 3B0UX 3NJVA 1LM8V 2QPDB 5ES4B 5DMNA 3HZ3A 2DWXA 1FO0B 1KBLA 1WICA 2IXUA 2H7WA 3SM0A 3OR6B 1K7XA 4DQOH 1A5OC 4K37A 3RWHA 3CXOA 4RX0A 3WKMH 4H9YA 4CADA 5FGBC 4NRZB 3KVKA 4U1IB 2XG4B 3MCYA 5F2MA 4C6BA 3H3PL 1CFSA 2P52A 1Y0EA 3FHAA 3ASNB 2ZSWA 2OXNA 3Q01A 3MOQA 4FQXB 1OYBA 3BJSA 3HHSA 2GJZA 1W1IE 2NZ9C 4GINA 5G5IA 2FVNA 1ADWA 5EIVA 1QHQA 3PNWA 3DKJA 3CUGA 4HYTB 2VQTA 3CHQA 3RHWK 3O6DA 4IIQA 2WTRB 2A6LA 1QUNB 4BDVA 4TF4A 3RGVC 3C60D 2VP8A 2XPZA 2DQEH 3EXJA 4JD4A 1FWAC 4MAYA 1W15A 2FEJA 2CKBH 3RKDC 3T0TA 4PB9H 3UTSD 4PMVA 5FFLA 3N6HA 5BOPA 1FNSH 3UXFA 3MXVH 3IKCB 2Q3AA 4XP5H 1I4NA 1O6SB 2R29H 3BZGA 3TN3A 1D7DA 1PTDA 1EANA 4NGHL 3S88H 1KEGH 1BXCA 5ELIA 2YUZA 1T7XA 3MROA 3S98A 5AOUA 1GOGA 1RJLA 2AW2A 3QFJD 4BIKA 5AC6A 2P8LB 1ZLDA 4Q58C 5DQDL 1LL7A 2WMIB 2MQ3A 1MUJA 1ZGLA 3L5XH 4ZJ9A 4JIIX 1I1XA 3UWZA 3R2GA 1HJXA 1UOZA 1EHKB 4M4RA 1OJXA 3HF3A 4NYUA 2WB7A 1F18A 2J8HA 2NT0A 4YHPA 3H7RA 2BCKB 4E0RB 4WWNA 2YXXA 2CMRH 2YKKA 2X88A 1RY0A 4Y5XA 3V10A 1FA2A 1WBYB 3WQDA 1H8SA 1RCXB 3KRBA 1Z2KA 2W07A 4NZ8A 3RB5A 2QKIC 3NIYA 2GWNA 3DLQR 1QWGA 1CI1A 3NEHA 3E80A 3VXPB 5I6NA 1XIBA 3II3A 3FRPA 5GGTA 2VDMH 2OFJA 4UU9B 4Q6IC 4ZMXA 4K6AA 4YCPA 1ZEAL 1IXPA 1P1XA 1LXMA 5BQ7B 5C7ZA 3GLDA 3HUJE 2G37A 3X2QB 4C91A 2FWUA 3BGAA 4QP0A 3P3YA 2VUNA 4JFEE 4K0OA 5DURB 1KELH 5A8OA 4BSWA 3K81A 1R2RA 3O1NA 2W95A 1X7IA 2KAUC 1DFXA 2A77L 3X11A 4F7EB 2FEEI 2NQ5A 3TVMD 3FBKA 4GRWH 3WFHB 4Z3TA 4O0QA 4YHOL 1IGYB 1HU8A 3NSCA 3FT3B 4H8WH 3STPA 4DZBB 3OKDB 3QUKB 2YB4A 4F8XA 5LA0A 1SJBA 1E5AA 3CV1A 1QNVA 4CVXA 2JIXA 3H21A 3H7BB 4FP8H 3LXBA 1CL7L 3ONCA 3MI3A 3TFCA 1F11A 2C7FA 3MLUH 5JOEA 4JY6A 1XIWD 3RIKA 3AQUA 4NQVB 3SRHA 5ID0B 2RD0A 1DVYA 1YE6A 3UMNA 2NW2A 2GSEA 2YGQA 1UXMA 2D2JA 1CE6B 3WJLC 2KX9A 5CEZE 5ITFB 4G7VH 1BJ1H 4ODSH 3ICJA 1D6EB 4R5VA 3ZTJH 2PDUA 3NAVA 5JHDD 5LNWA 4NKMA 3QHTC 5DHYA 3GZAA 4MJZA 3WBWA 3PHQA 3V5KB 1GPOL 5BROA 3I02B 2A79A 5C7XH 3OZMA 3G1AA 1HHJA 5HWMA 3HUJF 3RWJA 4TUKL 1WBJA 5D4HA 4JFVA 3G22A 2KI6A 1BF2A 1K5WA 3U9UA 1WCBA 2VLRE 7REQB 3ES7A 4AK2A 2K3HA 5IB5B 5BRZA 2DN7A 3QULA 1A80A 3AVEA 1OL0A 4MADA 4G80B 3UZEC 5J8LA 1L2UA 2O6DA 3O2WL 3T0ED 1P7QB 2NZ1A 2X28A 4E0CA 4QE5A 3UO1H 4AH2A 3H9ZA 2VAAA 2GIYA 1AZUA 3DMMD 4HIQA 3GBDA 1ONEA 1OVDA 3ESNA 1BQSA 3JVGA 5CLYA 1QW9A 1HKFA 5EBMA 3BRDA 2PAJA 2BWDA 2BP8B 5TD4A 5DRZA 1ZA6B 3R11A 2XX1A 3EWZA 4K3JH 4XO3A 1JFXA 1CLOH 4D94A 4Z0BH 4Q4MA 3HLAA 4W68A 4BFEA 1IAKB 3LG3A 2E6DA 3VFRB 3O9WA 4RFOL 1UZDA 2GK1A 4YDLC 4GVHA 4EIBA 4RMQA 3B2MA 2P28B 2J57A 5JO5B 1W72A 1J5DA 3QORA 4J1UB 4GRLD 1BFVL 3SJVD 1V02A 3PZGA 1W32A 3TUUA 1FI8C 3WNMA 3FTGB 1FFOB 1NCOA 2WYHA 1LE9B 3IDJA 4MNGE 4M43H 4D1JA 4I5BA 4KBXA 3LENA 1ZHAA 1KCSL 3GW3A 4XNDA 3KNBA 1RZJL 3W00A 2IANB 4PJ8C 5DCEA 4YHML 2Z7WA 2ZUUA 3FB8A 1DWIM 5C9RA 3HI1B 3FYYA 2YAQA 1OARH 1RAKA 1YY8B 1KEMH 3VJ6A 3KBNA 1KGJA 3INPA 4PC8A 4OBTA 4PBVC 3PWLA 1YEFL 2XM2A 2EIZA 1Q0XH 1XLDA 4PY7A 3QQWA 3MJMA 2X2UA 2EDHA 1LTDA 4LPCA 1YRKA 4Z0XA 1MFEL 4XNQB 4ZFOL 43C9B 1FDLL 1G94A 3PQYE 4UNKA 3F4DA 3LDBB 4AL8H 3UGXA 4M7KH 4PG9A 4ZMVA 3E0FA 2A99A 1K8ZA 1P9MA 4O53A 4L8SA 3ABMB 4GY1A 1NDWA 4CCEA 3QUXA 4LZKA 2WLLA 1MSPA 1R8LA 1G7QB 3MRMA 5JH1A 1A5NC 4KRMB 1G01A 3SGDI 3QR0A 1WT5A 4YPJA 2ACRA 1UIOA 1O5PA 1G69A 4JM2B 2ZOLB 3NCOA