1NM9A

Crystal structure of recombinant human salivary amylase mutant w58a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPAWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, salivary
publication title Human salivary alpha-amylase Trp58 situated at subsite -2 is critical for enzyme activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1nm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nm9A01
3PZUA 4WSKA 3VIPA 2WMIB 3VOCA 4EAMA 5I6SA 4F8XA 2J7HA 3WF4A 1X6NA 3WEZA 3EJPA 1TR1A 1TG7A 1F4HA 2EPKX 3FHAA 5E09A 3RCNA 1SZNA 4UCFA 1XC6A 1HL9A 1CGVA 1UR8A 3ZR6A 1JDCA 3ZIZA 1CENA 2DEPA 3K8LA 1EOKA 4CUCA 2PWGA 5I77A 5D9MA 4AW7A 4D72A 4JCLA 3SUVA 1HJXA 2D20A 1J11A 5E0FA 2YA2A 1ISXA 4CCDA 3VNZA 3CZEA 3B9EA 1TVNA 3VGBA 3T09A 3BUPA 1ZBKA 3NUKA 3AIVA 4WKHA 1FFRA 4A3HA 4AIUA 3QHOA 4YHGA 5HXMA 4HA1A 3BUDA 3EJRA 1HKMA 2D73A 5FL0A 3GXPA 1F4AA 2JF6A 4MNMA 1BG4A 1KR0A 2DIEA 4N0RA 1KXHA 3FAWA 1G0CA 4GO8A 3ZT7A 1GZJA 3KL3A 2EJ1A 1Q4NX 3VSUA 3N17A 4QLKA 2YDQA 5E0CA 4QAWA 2WLZA 4MAVA 4J7RA 4F66A 1K6AA 2VCBA 3ARXA 2FGZA 3WD2A 1CECA 5CZKA 3KE0A 1I1WA 1R8LA 1HJQA 3U5YA 4UFLA 1PZ2A 1DWIM 4C7FA 3OZPA 2FHBA 2WVUA 4QDMA 1BGGA 4UFIA 3A23A 5JBFA 2C8NA 1VEOA 3VGGA 3W6LA 1XYFA 4DO6A 5M3WA 1ZB5A 1JYVA 1NP0A 5CSUA 2J75A 5C70A 4QLLA 3WELA 3W37A 1QNSA 2O92A 5I3DA 3FXYA 1UZ4A 1WZLA 2CBIA 1J18A 2WKGA 3HZ3A 3CGTA 1V3IA 1ISYA 3VDAA 1JAEA 2WPGA 2DSUA 1J0ZA 5KZ6A 2D23A 1UA7A 2CKSA 4K68A 4N42A 1GQIA 1UWIA 3FHQA 3VGDA 4D6FA 4FLRA 1EOMA 3PBGA 4OOUA 3EBVA 4W8BA 2G3NA 1E6QM 4J3SA 1BPLB 3CMGA 2XIIA 1WE5A 2YL9A 3EJUA 3MUY1 1GQLA 2Y8KA 3CIVA 2UWFA 2VZSA 1LJYA 3CZNA 1GPFA 4U3AA 4H41A 2CITA 3GH4A 2RGLA 3K4DA 3BUIA 4UQEA 1US2A 3TTQA 3H54A 5A6AA 3BXWA 1OGBA 1WP6A 7CGTA 3AJ7A 4AZCB 5BXRA 2WANA 1V6YA 4ACZA 2UY5A 1J0KA 2BXZA 1VEMA 1US3A 1B30A 4MB5A 3M07A 2XFYA 4CCEA 4AXNA 5CGTA 1J0YA 1GORA 5LYRA 3FNDA 1HP4A 3W81A 3AI0A 4GZJA 3ARTA 4AISA 1I1XA 2V5DA 1QNOA 5CXPA 1D7FA 4BF7A 1JZ6A 5CQ1A 3QR3A 4V28A 3L4XA 1WKYA 3HMCA 5GNZA 1LLOA 4QLJA 3AIRA 4CVWA 3T0AA 2XYLA 1ISWA 3GH5A 3F5KA 4LX4A 3WH7A 3DYPA 1JGIA 1KQZA 4GZEA 3N15A 4J3VA 3BVXA 2ZE0A 4JFVA 2F1AA 4RL3A 4CD7A 4OZOA 2WKLA 1XYZA 3AMCA 4J3XA 1O6IA 1VJSA 2VMFA 1FHLA 2CKRA 1RH9A 2DT1A 3CUGA 3WF0A 1LG2A 4IISA 5C71A 2VRJA 4HZ7A 1GHSA 1UWQA 1UH3A 2VRKA 4CU7A 4D1JA 1CDGA 3L4TA 1BSIA 4AWEA 1W2PA 2PWDA 1UR0A 3UG4A 3VUPA 3WQVA 4PMQA 3RJXA 1B90A 3DX4A 1X6LA 2FHCA 2ZXDA 2GSJA 3VKKA 5A8PA 2EQDA 1KGWA 3EYPA 2EADA 2OYMA 2XPKA 1V0KA 1E6SM 1ESWA 3W38A 2OWWA 3PZMA 3DHUA 3ZMRA 4KRTA 3I3BA 3AOFA 1EGZA 4JKMA 1L8NA 4AZ7A 1JZ3A 1C3FA 1V03A 1R7AA 3E1F1 1E72M 2YFOA 4OUEA 3M46A 1JYNA 2PBGA 2EBNA 2WXDM 2J7EA 3PZIA 2DT0A 1G9HA 1BQCA 4HU0A 1UKQA 4P7NA 3PZ9A 5FL1A 1VFFA 3AS3A 3DC0A 1VBRA 5LA1A 4PUEA 2BVYA 4AMXA 3K8MA 3O2LA 2VCCA 5LA2A 1IZJA 2BVTA 3LPGA 2X2IA 2B31A 2E9MA 5CPSA 3HG5A 4FLQA 3D3AA 1OSEA 1XV8A 3WBEA 4PTXA 1C7SA 1K9TA 1WDQA 4NSBA 1CLVA 2YA1A 2ZX6A 5I5RA 3N04A 5I23A 3DYMA 4NZFA 4Y7EA 3AIQA 5A2AA 3N13A 2VT0A 4D6JA 2XGBA 1A47A 1CXIA 2YKKA 1ECEA 2BV9A 1GOQA 1OD8A 1FP8A 3TONA 4AEEA 1E5NA 1BFNA 2UY4A 2CXGA 4NRSA 3WDRA 3T08A 4HMDA 2YL5A 4MNLA 3CC1A 3EJSA 3U7BA 3AZTA 4MDPA 4P8UA 4J3TA 2AAAA 3A6OA 1CXFA 3MI6A 1EQCA 1V0NA 2EXOA 3CBWA 3GXIA 4FK9A 2WAGA 1W9PA 2V3GA 4GXPA 3CZ8A 1RP9A 1Q6DA 1WAWA 3RILA 1HL8A 3OA5A 2EO7A 4CD8A 1Q6EA 1GVIA 2ZX7A 3BCFA 2WVVA 5FIPA 2AOSA 4UFJA 4PMYA 3ZQ9A 2AMGA 1VJZA 2YBUA 2YIHA 4CD5A 2EPNA 1M03A 1UD8A 2CCRA 2X2JA 3L4VA 3WQWA 2DH2A 2J7GA 1GQJA 3L2LA 1H3GA 4U33A 1NWSA 3VGEA 4ZXOA 1UWUA 3MS8A 2D22A 2J7BA 4HU8A 3WUEA 1MW1A 2BFGA 1W1YA 1JZ7A 1WDSA 1BLIA 3BUQA 3WD3A 2WMFA 2F8QA 4J27A 4AD1A 2ZOXA 1W9VA 1JG9A 4W87A 5BXTA 1JZ5A 2WMHA 1VFUA 1JF6A 1QI2A 2J7FA 2DIJA 1GQKA 3LPOA 1R47A 1GJUA 2GJRA 1B2YA 2J47A 2EAEA 4GI9A 1V3HA 1PIGA 3T2OA 1UD6A 2W92A 2XG9A 1TZ7A 1R46A 1QWUA 3BCDA 1MQQA 4U2YA 4PMNA 3WUBA 3VIJA 3G6MA 3L4WA 4AZGA 3VM5A 3VM7A 5ABHA 1JZ2A 4TVUA 3ECQA 2FYVA 5A6SA 1A3HA 1QI3A 3AHTA 4P8VA 3OLGA 1E6XM 3BVVA 4URIA 2Y2WA 1GOWA 3ARQA 2J78A 2XTKA 1MW0A 4LYPA 4WKAA 5M5DA 3GDBA 3K4AA 4CGTA 2BHUA 5CJ5A 3SCOA 2BS9A 2WCGA 1Q6FA 2VZTA 4Z2JA 2IXUA 3KL5A 5A6BA 1IV8A 2XVLA 5GPRA 4HMCA 1JFHA 2A3HA 3L4UA 3MV01 4UOQA 3DDGA 3AMLA 4OJYA 2WWDA 2W67A 3CUJA 3CUIA 1E70M 1KGXA 4UQAA 3ARZA 2CHOA 3WFLA 1UWSA 4DO5A 2ZUNA 4UR9A 1CEOA 1O7AA 1R85A 5GQBA 2FH8A 4HOZA 2O9OA 3CZLA 1DWGM 2A3CA 3TV8A 3AQUA 4U5IA 5D9NA 2X1IA 1W9XA 3D52A 4FMVA 5EFFA 2F18A 9CGTA 3IK2A 4MB1A 2WMIA 2EEXA 3QOMA 1UKOA 2WHMA 1OM0A 2NW0A 2ZXBA 5IFTA 3LXAA 1QI4A 2XN0A 2EACA 4S3JA 4MPKA 1GOIA 2E9LA 3GYCA 3W27A 3BUBA 1AQ0A 1HXKA 1OD0A 1V6WA 3DHPA 3AROA 1JDAA 3JUGA 4C7GA 2Z1KA 1WO2A 4DUWA 3F4VA 3MKKA 2WSKA 3WEMA 2EPLX 4X9YA 1DP0A 4W93A 1PX4A 4EKJA 1FH7A 2ZUVA 1HX0A 2CYGA 3MMDA 1OGSA 3WH9A 1VRXA 1VAHA 3SCWA 3SCPA 4LYRA 4QFUA 4CCCA 4AD0A 3EDKA 1UUQA 2G4FA 5E1QA 2WW5A 3TTYA 1PS3A 1QHPA 1QW9A 1AQMA 1FA2A 1J10A 2V3EA 1KTCA 1J0IA 1C8YA 3QHNA 1MW2A 1HN1A 4ZENA 3MANA 1XGZA 5CLWA 3AIWA 1E3ZA 1K9EA 4NXKA 1LWHA 3CZGA 1UOKA 2F2HA 1PX3A 5CPTA 4UFHA 3HG3A 2FDMA 3M7SA 3AHZA 5E6YA 1NOWA 5GNXA 4H2CA 3OB8A 1NWRA 3VILA 5I78A 2BY1A 3EJQA 1W1TA 1PZ3A 1XRVA 1Z32X 3M6DA 3THCA 1BYCA 1MWOA 4IPNB 1UKTA 1B3VA 3WFZA 2F7QA 5AYIA 3ARYA 4MNJA 1E6NA 1J9YA 5DO8A 1W1VA 3DECA 4UZSA 2DT2A 3EMCA 4QP0A 1M01A 2WHLA 3AS1A 3WBAA 3QOKA 4PYSA 3W28A 3MMUA 3I3DA 2WZHA 5IXEA 1B0IA 4UQBA 4MNKA 5E6ZA 1MFUA 4JCMA 2XN2A 2WCSA 5FCZA 1SYTA 3SIMA 4E8CA 1XCWA 1XHGA 3GBDA 2BHZA 1MXDA 2A3BA 3HG2A 1JZ4A 1NQ6A 3IJ9A 2QMKA 1FH8A 4YN5A 3W29A 1CWYA 1HVXA 5TD4A 3ZJKA 1XSJA 5DT7A 3MSDA 4Z2IA 2Z1SA 1QNRA 4J3UA 2D2OA 2ZUUA 1BAGA 3S6TA 3ZO9A 3S5YA 1QVBA 2DSKA 3MUZ1 5BWFA 4IPLA 4AIEA 4GI6A 4GI8A 5M03A 1MVYA 4TUFA 2VUYA 3FAXA 1RD6A 2CIPA 5D8ZA 2BNJA 3LPFA 3ZJ6A 4F9JA 1KXQA 5D9OA 1TA3B 4GKLA 4P7RA 1QBAA 1TVPA 1OB0A 1ZBWA 2CNCA 3N12A 4AD5A 2DT3A 4AZCA 3VSTA 2O9TA 4PMZA 5JIWA 2OLHA 3BAXA 5JBEA 2GFTA 1ZU8A 4HA4A 1UKPA 3VIFA 1ITCA 4Z2LA 4MDOA 4GZIA 1HT6A 4TVCA 3AIEA 1E6RA 3UESA 3BGAA 3BMWA 1KQYA 2X0HA 4LGXA 1P6WA 3WY4A 1JYXA 4W7WA 5I0DA 3GXTA 2V3FA 1E55A 3G6LA 3OGSA 4JHZA 1XH2A 2J8FA 1V6VA 3PZNA 3WNMA 2NT1A 2DGAA 3PTMA 5I79A 4FLSA 3WNKA 3MUIA 2J25A 1BVZA 2QHAA 3TTOA 2IGTA 3LX9A 3NSNA 5E70A 4GINA 1H4PA 1C92A 1DWHM 2VQUA 3KZSA 1C93A 1G1YA 1H0GA 4JFUA 3II1A 1KB3A 2WLYA 1NWUA 1UHVA 5CG0A 4JIEA 1GOMA 1KFWA 2FH6A 4F79A 1EO7A 4HP5A 4X0NA 3VNYA 4V2XA 1UD3A 3LRLA 4DWSB 2WZEA 5I2UA 3OGRA 1B3ZA 3OIHA 3AMDA 3BVWA 1CBGA 2W4XA 1V3LA 3GTNA 1E0XA 4JKKA 3WNPA 3VMNA 4WLCA 2F61A 4PTWA 1DWFM 3LXCA 1R87A 1ISVA 3F5LA 4H8VA 1B3XA 4WK9A 5HPOA 2VZUA 4NXSA 1H0IA 4AMCA 4UZUA 2PI6A 1TFVA 1HJVA 3EMQA 1KTBA 3W53A 2QPUA 2J79A 5DEZA 3BAJA 1BVNP 1UQYA 4P7LA 3W0KA 4LYQA 1AMYA 2VURA 4NI3A 3WMSA 4S3KA 1FOBA 4HOWA 2DH3A 4OBSA 2UY2A 3DX1A 1CNVA 2DSWA 2V5CA 3SUUA 4C7DA 2Y5EA 4CU8A 1HIZA 3ZT5A 4B9YA 2ZWYA 3W26A 3MU7A 3CZKA 1QNPA 4U3CA 3KL0A 4CD4A 4B16A 1C90A 3SCSA 3HG4A 2W61A 4ATDA 3WUFA 2ZICA 3GBEA 2OSWA 5BXSA 2C7FA 3UG3A 3S5ZA 4PMUA 1JL8A 5BRPA 4UOZA 2D0HA 2ZUMA 4BZYA 5EB8A 2W62A 2OYKA 5ABFB 4LPCA 3QHMA 4W5UA 5HOSA 1YQ2A 3MUAA 4D6EA 3OBAA 4CU6A 3ZOAA 3AIUA 1XSKA 3A5VA 1JYWA 3D50A 4ZEPA 2WVTA 2OYLA 1VF8A 3VX0A 1MYRA 1XCXA 3L2MA 2O9PA 2OWXA 2E0PA 4D71A 1TQSA 2VO5A 4MTVA 4LQ1A 4Z2GA 2UY3A 1QWNA 2YFNA 3TOPA 1AVAA 2JIEA 4M29A 3L4ZA 2VVSA 5CPQA 3OZOA 2EPMX 4NX0A 4ACYA 3GXFA 4OBRA 5A6BD 1E56A 4U31A 3WUGA 1XH0A 1BG9A 1H41A 5A6MA 3KWXA 1VFOA 1JD9A 1UR9A 4PN2A 3VINA 4GO9A 4D6CA 2ZX9A 3BVUA 3ZT6A 1E4LA 3WNNA 1HJSA 4Z2KA 1CXEA 4UQ9A 1WZKA 1KWGA 2IXVA 3T0BA 3UERA 1OGGA 1CIUA 3OLIA 3F5JA 2YLAA 3ALGA 3BLKA 1VBUA 2XHYA 1B31A 1UKSA 1LF1A 1EDTA 3ARRA 4PTMA 4BQ2A 4GIAA 1UD4A 4YPJA 5A6LA 1KGUA 3S2CA 2DSZA 3WF1A 3U7VA 1JAKA 4AY1A 1BTCA 3UCQA 1XH1A 2G3IA 4AZ5A 5ABEA 3CHFA 2D3LA 1B9ZA 4JHOA 3VGFA 4RE4A 2ZIDA 4D1IA 1HP5A 1V0MA 3VIOA 2CHNA 1MQPA 3AXXA 4ZE5A 1HVQA 1V6UA 3A3HA 1FHDA 2OSXA 3GNRA 3NYDA 4M24A 2VVNA 1PPIA 2GJXA 3BH4A 1Q6CA 1EIBA 1W3HA 2F7OA 1E9LA 1HJUA 2ZXAA 2YL6A 1S46A 3WD0A 4BS0A 1MXGA 2VOTA 7TAAA 1CXLA 3CZSA 2X2HA 1NM9A 4H8HA 5BCAA 3DX2A 2VCAA 1G01A 1UD2A 5I24A 2QV4A 3ALFA 3RM9A 4GQQA 4M56A 1CPUA 4MADA 4HZ8A 2F7RA 4HZ6A 2D1ZA 4BQ3A 3SCVA 1SMDA 3APGA 3BC9A 4JFSA 3WNLA 1CLXA 1UD5A 3VIKA 4MJ4A 3VMOA 4ML4A 2D24A 1EHNA 1XSIA 1W1PA 5FOOA 4OKDA 1LL4A 3EDJA 2IUZA 3WL0A 5DT5A 3N1AA 4UTFA 1LL7A 3WDHA 3T0DA 1WNOA 2J74A 5FD0A 3B9AA 1V02A 3EDEA 3ZSSA 2GJXB 4AZ6A 5D4YA 5E9AA 1EH9A 3K8KA 3WIJA 1HNYA 3IAQA 1W3JA 2JEQA 3WMBA 1L0PA 4WJXA 4KGLA 5IDIA 4B3LA 3NIYA 2X05A 4U5KA 3N18A 2VX4A 1QI5A 1UYQA 2VQTA 1V6XA 3VVGA 3WY2A 3W24A 3WQ5A 3NSXA 2XVNA 4PMVA 1R33A 3AHYA 4B3KA 2ZX8A 4UOJA 3T2PA 1QW8A 5JBDA 1KBKA 5AYBA 5EMYA 3LXBA 5CGMA 3RMEA 3AXHA 2XFRA 1UQZA 3SUWA 1CGTA 1OT1A 1MQRA 4BQ5A 5A1AA 1YHTA 1BYAA 2Y4SA 4JFTA 1HXJA 4AIOA 1WB0A 5EFDA 5BYWA 2J62A 1FH9A 4B15A 1LL6A 3UR7A 5IFPA 4FNSA 3CPUA 2WNWA 2JALA 4PSPA 4AD3A 2JE8A 3SCUA 3IJ8A 5DMYA 4TTGA 3VSVA 4KGJA 3W82A 2FGLA 2VL4A 3ZJ7A 3WQ4A 4BQ4A 4AYGA 4GPNA 2XVKA 4D6HA 4E4PA 2CBVA 4OGZA 1E6ZA 1W9BM 1C8QA 1UASA 4KMQA 3PN8A 2XIBA 1DWJM 4JFWA 1QI0A 1R86A 4IM4A 4R27A 4DO4A 3AHVA 1UR1A 1V0LA 3CUHA 3RPMA 3DDFA 4M82A 1OIFA 4UQCA 1E1EA 5CSYA 4HPGA 4DWSD 3NDYA 4RE2A 3PZOA 3KLKA 3I3EA 3UG5A 2YJQA 2CBJA 4PMDA 1E15A 3WDIA 4OIFA 4IUGA 3N11A 1JF5A 2VR5A 2JIWA 4A3YA 1E40A 3WNOA 1H1NA 3O9NA 5D8WA 3WDQA 1Q6GA 2QF8A 1GCYA 2VC9A 3LPPA 4ATLA 2CEQA 3J7HA 2ESCA 1XD1A 1G94A 1PX8A 4M8UA 1ZJAA 3D5HA 3WH6A 1PAMA 1UR2A 3VMPA 4M1RA 4NZCA 4TX8A 4PTVA 1EHAA 3AIBA 2G8ZA 4H8UA 3VIMA 1GW1A 2ZUWA 4PSRA 1E43A 3BAWA 3WMCA 5IHRA 3WSUA 3WH8A 2V3DA 2OW6A 4WSJA 3H55A 3AICA 2VX5A 2JFEX 1UH2A 2WC3A 4ZE4A 1W9DM 1FFQA 2GDUA 3GZAA 4KH2A 4E2OA 2WMGA 5HNNA 4CVUA 3NJ3A 1DTUA 1QHOA 1VFMA 1EDQA 2YL8A 3DX3A 1WZAA 2NSXA 3RM4A 1J01A 5BXPA 1QPKA 3WDPP 4JKLA 1IZKA 2GK1B 3BAIA 1KWKA 1TA3A 4TTUA 3AZRA 4FNTA 2GUYA 1TMQA 4D6IA 2VX6A 1VENA 2BHYA 5HPCA 3HJEA 3A21A 5A6JA 3CLWA 3KEHA 2VR4A 1WDPA 2WMKA 3RM8A 1GJWA 1KCKA 1D3CA 5HDRA 1GVYA 2DQXA 3GXMA 3ZSTA 2ZWZA 5D9PA 1EXPA 6CGTA 2G41A 4DM1A 1CGYA 1HF6A 1R75A 5JUVA 3QGVA 4JL2A 3VD7A 1N82A 4KWUA 4OOZA 3WL1A 4TVDA 3VO0A 1RPKA 3UEQA 3VX1A 2ZXQA 2VRQA 1TQVA 1HTYA 2QMJA 3A4XA 1CTNA 3SUSA 4W85A 2QLYA 2WSPA 1KBBA 1QOXA 3HU7A 1TUXA 3H53A 3VIHA 2XJ7A 2WCAA 3IGUA 1KXTA 2Y8VA 3PTKA 3WY1A 3VU2A 2PWHA 1SR0A 2GVYA 2XWDA 1CZ1A 3GH7A 1E71M 2WMJA 3VTRA 4W8AA 4A4AA 4AYSA 4DWSA 1E6PA 3MMWA 1GNXA 2VJXA 3VD5A 3ARSA 4E8DA 1JD7A 3MSGA 3D4YA 1UWRA 3OLDA 4X0VA 1IT0A 1NOFA 1R7OA 3CZJA 2QPSA 4XUYA 3CUFA 2F1BA 2G3MA 2WK2A 4J3WA 1MFVA 1W9UA 3BSGA 3DX0A 1V08A 4MB4A 2CPUA 2YOCA 2RGMA 2CESA 5A8MA 1H5VA 1J0HA 1LWJA 3WKZA 2E4TA 1ODUA 3VDCA 2VTFA 3LRMA 4H04A 1U30A 4CKQA 2XSAA 3TP4A 4AZBA 1JDDA 2ZUSA 1W3KA 1X1NA 3GXNA 2VNCA 5A8QA 2WBGA 1HKJA 5DF0A 1PJ9A 3OLEA 4DM2A 2BY3A 4CN6A 4JL1A 4L4OA 1UR4A 3GNPA 1KCLA 2XM2A 4R5EA 3AYSA 4Q22A 1RP8A 1KXVA 1TQWA 3WN6A 2DDXA 1LQ0A 1TE1A 2V38A 1O7DC 5ABGA 4FNPA 2BY2A 4AD2A 1DEDA 2WWCA 1NWTA 2CERA 2DPEA 2WB5A 1WCGA 1EDGA 2J7CA 3W6MA 5ABFA 1NH6A 1C7TA 1GUVA 3EDDA 3BAYA 1E4NA 1BYBA 1NARA 2X0YA 5HBFA 1LG1A 1K9DA 4UFKA 2EPOA 4H7VA 2A3AA 2BVDA 3THDA 4W5ZA 1E73M 3AFBA 4WKFA 2XVPA 1JI2A 4PCTA 2WZIA 3AISA 3L4YA 3RDKA 3AS0A 2MANA 2JF7A 2NT0A 1KR1A 3PZQA 1TQTA 1C91A 3UETA 3TA9A 1JXJA 1OCQA 4W86A 5A3HA 3CTTA 1XD0A 4W88A 1E0VA 2FHFA 4ATWA 4DUXA 2YLLA 4B9ZA 5AY7A 3CHDA 4HOXA 1JIBA 1W91A 3B9DA 3CH9A 3PZTA 3RIKA 2E8ZA 1E0WA 1M53A 1OBAA 5BRQA 3VPLA 3VIIA 3EMZA 4ACZB 4PMRA 1V02E 3GNOA 1H49A 2YBTA 3SURA 3W4RA 3FW6A 1QBBA 3POCA 4QCFA 1R34A 3ARWA 1C8XA 2WBKA 3FY1A 2YDRA 2YA0A 2WM0A 2ALWA 4DUVA 3D4ZA 4HMEA 1HKKA 3NDZA 4YHEA 3WY3A 3BAKA 4NF7A 1SFSA 3RO8A 2D3NA 2XUCA 3IJ7A 1SMAA 3PHAA 1E5JA 6TAAA 4EANA 2XVGA 1GOOA 3AHXA 1K9FA 3K46A 1EO5A 1BHGA 1OWQA 1WDRA 1G5AA 4M81A 5FKYA 1OIMA 1BGAA 3VDBA 1E4MM 1QNQA 5GNYA 3WQ8A 1J0JA 1ZL1A 1B1YA 4KRUA 3WF2A 1GHRA 1CYGA 1W2VA 4EK7A 1OINA 1VB9A 5JIPA 2O9RA 3WF3A 1BF2A 3WENA 3BSHA 1B3YA 4PMXA 3TTSA 2FE0A 4FNUA 3WEOA 2J8GA 1CXHA 3FN9A 4XX6A 4AEFA 4PCSA 2WHJA 1J12A 1HKIA 2PF0A 1H2JA 4P8WA 4PRWA 4W84A 2D0GA 1DWAM 1M04A 3A4WA 3SCTA 1JNEA 4AZHA 2HVMA 5A2CA 1ZBVA 2VZVA 3B8SA 4RE3A 3PTQA 2WVSA 4Z2HA 1PIFA 1DHKA 5BROA 5ECUA 3PZVA 2E40A 5AC4A 3BVTA 3MO4A 3ARPA 2J4GA 4MJ2A 1ITXA 3U57A 8CGTA 2X09A 3VIGA 3ARUA 3AXIA 1TQUA 5A8OA 1JI1A 4W89A 4L4PA 1ISZA 1CGWA 2XGIA 3ARVA 3PZGA 4JAWA 1GONA 2PBOA 3SCQA 4P7OA 2X8RA 5A2BA 3GXDA 3ZR5A 3GM8A 2C0HA 4W7VA 3WD1A 3SUTA 3A47A 2G3JA 5M17A 4XZBA 4PUDA 4D6DA 4NZJA 4WIWA 2CBUA 1PBGA 2X2YA 5A8NA 5F7UA 1HWWA 1JZ8A 2PB1A 2PC8A 2E9BA 2VX7A 1ZS2A 2ZUTA 1V3MA 4HA3A 4NRRA 4D6GA 1FP9A 4AZIA 2XWEA 2BXYA 3NCOA 4M80A 2XSBA 3A4AA 1UA3A 1U2YA 1D2KA 3EJTA 4GQRA 3CO4A 2W63A 3SEPA 3OG2A 4FNRA 1NP2A 1UWTA 2WC7A 2GJPA 3ZJ8A 5IHSA 5A6KA 2Q8XA 5LA0A 3AZSA 1I75A 2VZOA 2PWEA 1Y7VA 2WVVB 3MV11 3VD9A 2YDSA 4PBGA 1U33A 2WHKA 3W25A 2BY0A 2D0FA 1H09A 3AYRA 2HISA 3T2QA 2OSYA 1E4IA 3WQ6A 5A95A 3VGHA 4AD4A 1GOKA 1V3JA 2EABA 4XZWA 3ZM8A 2E3ZA 3AS2A 4UFMA 4JZ5A 2W91A 3IANA 3BMVA 4P8XA 1V3KA 4J28A 1CGXA 2J7DA 1EQPA 3AMGA 3KLLA 1HJWA 1TCMA 4CD6A 3CMJA 1UH4A 1JXKA 1UZ1A 3WH5A 4TXEA 1UG6A 3N9KA 2ZX5A 1M7XA 1VIWA 3BLPX 4CN1A 1EA9C 3IAPA 3RJYA 3WD4A 3POHA 3BLBA 2TAAA 5EBAA 1WPCA 3A24A 4HTYA 6A3HA 3O6AA 3CV5A 2F7PA 4TOQA 3LRKA 4MAZA 2XFFA 4W7UA 4EE9A 3A22A 3HN3A 4P7QA 4U2ZA 2E8YA 4WF7A 2A3EA 3D51A 5A69A 4F9DA 1BYDA 1E3XA 2CETA 1W32A 1E1FA 4TX6A 3UR8A 1ZJBA 1QHZA 5DFAA 2WYSA 4LXFA 1ODZA 4MB3A 8A3HA 3K1DA 4FF5A 1ZBCA 2XM1A 1H11A 4BCEA 4ZFMA 2VI0A 3VD3A 4QCEA 2DSVA 2OWCA 3VD4A 3CHEA 3LMYA 4ZXLA 3SCRA 4FLOA 7A3HA 1JNDA 1NOUA 3OGVA 3SCNA 2OW7A 2GK1A 2Y24A 4CN4A 2W66A 3AMKA 1B3WA 1T0OA 2JEPA 1CXKA 4PEEA 3NSMA 2GDVA 2J77A 2W5FA 4W8LA 3U5UA 1OT2A 4BA0A 5KEZA 4PMOA 3CHCA 4AMWA 1PEZA 1AQHA 4V27A 1WZMA 5AC5A 2PWFA 1CGUA 4FNQA 4DWSC 5C8BB 4UQDA 4UNIA 4HPHA 5A94A 3WDJA 1MW3A 2WC4A 3EDFA 5CLTA 3VDHA 4Q7NA 1JFXA 3DYOA 2XN1A 4AC1X 1VEPA 4XV0A 4XB3A 1W3LA 1QX1A
chains in the Genus database with same CATH superfamily
4JVWA 3VOCA 4R2GB 2V7NA 1NCBH 4BEQA 5ETUB 3LCLA 3ARFD 2XZQH 3EWWA 1CENA 1LLZA 4TL5A 2ZOUA 2BMKA 3RJDA 3D69A 4AW7A 5C6TL 4JCLA 3GRWA 4GW1B 2YA2A 5LIKX 3VGAC 5TAOA 1O0VA 3NO3A 3P81A 3L0KA 5IRPA 4ZXBD 3CFJA 3AUWB 3NUKA 3ZHDA 3AXKA 4NRXA 2VSMB 2WSRA 2B39A 5HXMA 1EJSC 4DJDC 3WLWD 2D73A 3GXPA 4GG6E 3UWWA 3FAWA 4K3ZA 1KJVB 3VQLA 2YDQA 2WLZA 4W9DC 3UJTL 1VCVA 5DJ2A 1QR4A 1KEGH 1I1WA 4Z1CA 3E6FA 5C0AE 1HJQA 3T55A 3E9UA 2EH7H 1ZHBB 4DI9A 2BS8A 4ZI8A 4DO6A 1ZLUH 2NUPA 2UWEE 4HN8A 4JFXB 3OPZL 1GJPA 1NP0A 4F0LA 1LO0H 2ZXEB 3AQDA 1MCSA 4X60A 3I6RA 3QFJB 1U8HB 3HZ3A 4HVBA 2D23A 4NPYA 4GP8B 1KJ2A 3AUVA 1BQSA 3QJOA 4EUPG 4TTDC 4I2XB 3NJIA 5L2KA 3C8KA 1CQYA 2A6LA 1DFBL 3LZQA 3FB7B 3ETSA 4XO6A 3ZHLA 3LEVL 2B16A 3TTQA 4P4KA 1B4JH 1PZSA 3H54A 1WP6A 7CGTA 4F7EA 4HK3J 3XISA 4AZCB 3WUWA 5GS0L 2YD4A 1JCYA 3VFUA 2CDEB 1ZT7B 4RUBA 5AWNL 4X0KB 3VH8B 5LYRA 3LDVA 2NYKA 4KCTA 4Z7UB 4HIHB 1D7FA 1A3LH 4BFKA 2HMID 4Y2DA 4KEVA 2OMVA 1I9EA 3F5KA 4GZEA 1ZTMA 3MACL 4MY8A 1ME8A 4IKJA 3TC3A 5SWSB 1RH9A 4AH7A 5AC7A 1DVUA 2FWSA 4YO0B 1I85A 3I6GA 5CJMA 3OKNB 2VFHA 4X7SL 4UIKH 4XG1A 5CJBA 1BIIA 3VUPA 2WUBH 2Z0UA 4KDTA 3DX4A 4WGKA 1KGWA 3LHTA 4O8RA 4Y4KB 4B5UA 3UYRL 2UBPC 3DHUA 4L3EE 5FM8A 1QO3A 2H90A 5B1JC 4DSYA 2W60A 2PDJA 4XAYA 1JYNA 5K69A 5I1LA 1GZHC 1O6SA 5FL1A 2R29H 2HP4A 3K8MA 2O56A 4MXQC 4RV8A 4B60A 4FLQA 1XV8A 2YGPA 2PCXA 4LEQA 3V0AC 2PA6A 3L5WA 3N04A 2Q76A 1P6BA 4QRPD 4YBHA 4R0LC 4N6RB 1EK3A 2UY4A 2EXSA 3QWRA 4KZEL 1ZAHA 4EIGB 3T7VA 4B2DD 4QTFA 1ASOA 1CICC 4J3TA 1G7JB 1CC3A 4WI3A 3IFNH 2WAGA 3F03K 5FGCE 1RUQL 4L4MA 2CSPA 1I3RB 3BKYL 1Q6EA 3G6DL 1H8SA 2QFRA 3PHQA 3QULA 4FXKA 4CNIA 4WSHA 2Z1VA 4NYUA 2ESVB 3CUPB 2P5PA 4H1LA 3O2VH 1ICTA 5F1OB 4U33A 3NVQA 3IETB 2R83A 3LKPB 4LCVA 3DUHA 1YNLH 3RVTD 3R7QA 4AG4H 4E2DA 1R5WB 5F9JA 4J27A 3FKUS 5J12B 4YYCA 4P57B 5K9QG 1VFUA 1H8OA 3L17A 3HZVA 4CNUA 2DIJA 4A7VA 1B0WA 5F8RC 4R5XA 1YEYA 5MHSE 3N1MC 3T4YA 4O4VA 2ICEA 3FZUD 2W92A 4YHZH 5HWNA 4YFDB 3R8HA 5IF0A 2FX7L 1QNIA 2PYFA 3PGCA 3Q06A 3G6MA 2CZVA 2PC4A 1L0XA 3MLRL 2DVUA 5FECA 4Y16A 2OZTA 1PKQA 5IR1A 4FRWA 5E6IA 2XV2A 3WJXA 3C6LB 5CFAA 1FO0L 4G71B 3AWGA 1UXSA 3WIHA 4G43A 1MW0A 2CLKA 1H5YA 4HCLA 3IVKB 2WCGA 3HC3H 1UXWA 4UMBA 4MA3A 4X4ZA 2Y8UA 2ZOKA 3N3EA 1DL7H 2AXGA 1N2RA 2W67A 2P52A 1LOSA 1BFSA 3P54A 3HKZA 1YMMB 4XRCB 4KXZI 3TV8A 3P4NB 1MCHA 1R5YA 3MCG1 1WA2X 4YXHL 3MUHL 1UP0A 3HNVH 5AZ2H 3ATFA 3VRJA 1QI4A 2LLLA 1GY2A 1KIUA 2DMGA 3MP4A 5TQ2L 5K93A 5GZOD 3F4VA 2FRGP 4M4RA 2CYGA 4HLZH 2RIKA 3EAKA 4FFZL 2P5EA 4WDIB 4LB3A 3SCPA 1AG1O 5ABTA 4ZOEA 3ECWA 4X9BA 3EWBX 3AB0B 4QHMB 2BCMA 4JRXD 1ZV5A 1AZZC 4EEEA 3MRPB 1E3ZA 3UP6A 4G7EB 3IJSB 4I48B 3OZMA 4R6UA 4NP7A 3D6GA 4UFHA 1NDYA 2CO7B 4WUUE 1NOWA 1AD0A 1MCDA 1UM5H 5HAOA 4GIRA 1OB1B 3QISA 4NGHH 1ZP4A 3GHBH 1O68A 4XVTL 1UJTA 2ADFH 4P5KA 1NCAL 1L6FA 4UZSA 2DT2A 4KZEH 5DJ8A 1M01A 4MA1C 2A9CA 2ZZ2A 5C9KA 1ACZA 3QRFM 3MMUA 1TEYA 2F54D 2VMJA 4JCMA 1F45A 4H8PA 3KX6A 2GK0B 2VFGA 2F53A 1VPXA 3SE3A 2C9SA 1XIJA 2YWZA 3CFBB 2IH3B 4GFIA 5C0BD 2GPZA 3ZZSA 1P9MC 3BPOB 4MCYB 1KW1A 3MVIA 2YD7A 3LUTA 1LO4L 2H9GA 4FPSA 4QM1A 4LVBA 1RD6A 2BNJA 4GVIA 2F8XC 2YQGA 4XNYH 1CD1B 2HT2D 2CK2A 2EIZA 3NZ1A 3OKEA 4MWAC 5CSRA 1CT8B 3B4YA 5IOKA 1U1JA 1QOKA 4GQ9L 2ZKHH 3DFTA 3WY4A 4HK7A 3S96B 4W7WA 4JHZA 4XPGL 4N0UE 5JZ7D 3HFFA 3ENEA 2P8PB 5LGZA 4H19A 2BINA 1A5CA 3G2GA 3QUZC 3NSNA 5L9DL 3EUDA 5D7IB 5CG0A 3PS7A 4KJYA 4F79A 2E86A 4V2BA 3I74A 3MV7B 2LE9A 4YAQB 4NFBA 3STGA 3MKCA 1NFDB 3NPSC 3RNQB 5LNRA 1J7VR 3W39A 2AV7A 1V3LA 4WLCA 1R87A 1GVOA 4FA3A 4UZUA 2PI6A 4HWUA 1R3LA 5IESH 2PDXA 1ZFJA 1CD0A 1S5TA 2QQKH 1MRQA 1BZOA 3HQOA 3JZ7A 1USZA 2GSIB 5GS2H 4U1KA 4PLKD 1R5VB 1HKVA 4M7KL 1H63A 1TZAA 1R3JB 4XPFH 1JPTL 1TU2B 5CINH 3CZKA 4IIQA 3KL0A 3QW3A 3DMMB 4YL4A 4YLQT 3AREB 4PJAB 3S5ZA 4FC3E 2IPGA 4F8OA 4MCNA 4AWJC 2Z8RA 4IMKA 3MUAA 3LV3A 3U79A 5IW1A 3QZPA 4EI0A 3ET9F 4WOZA 1VF8A 5D7LA 3VOIA 1GYAA 2JV6A 4MQXD 4YC2B 3L9BA 1VKXB 4GUPB 2KC0A 2R6OA 1K7XA 4RRPG 2UWEA 3F1QA 2YUVA 4M1DL 2BJML 1LO3H 4XO5A 1VFOA 5JPNC 3S5NA 1WG3A 3E8VA 2X70A 4BEIA 1GIGH 3BVUA 1FO0A 2FLBT 1IGFL 5D4HA 6XIMA 4Q9RH 1XBYA 4ZCWA 2IFFH 3UERA 2HVJB 3TVMC 4A8LA 5EHFA 1O5KA 4ZPVB 3LB6D 1FG2B 3U4EA 4GIAA 1ONQA 2ZF8A 1BVWA 4N02A 1SJBA 3MT1A 3U0PA 5H2ZA 1FDLH 5IV2A 5E1AA 4PJ7E 4M4PA 2W0FA 2W27A 4HPYH 2N7AA 4JN1H 2N1KA 3IT8D 2ERJB 3CMFA 4ZE5A 3NYDA 3BH4A 2FECL 2I56A 3MBED 2Q10A 1GGOA 2XY1A 2VISA 4MD0B 3W70A 2AF2A 2WO5A 4XZ9A 3MCMA 4A8NA 4LCWE 1XZWA 4GRWF 1MHCB 3P9MB 3CDZA 4B90A 4FFZA 4HZ8A 2OP4L 3NPWA 4L9YA 1FFTB 1HOEA 2FNWA 1BRLA 5L6YL 4Q2ZB 2QDGA 3T8XB 1IWBA 1WBHA 1V02A 3EDEA 3UTSB 3F7PC 4MUPA 3D25A 5J8LA 4DPCX 4FG0A 2P8LB 2VQTA 4HAGA 2FSEB 5F0JB 5DVKA 1AKJA 3V0EA 1S2AA 1PL3A 4XX5A 4PV9B 1AIFB 3OP2A 4JG0H 3G6AA 3USBA 2HNHA 1HEZB 4DVRH 3CHOA 1TQCB 2IBZY 1B4TA 4B15A 3V7MA 3A4DA 2X6CA 2WNWA 4MJHA 5GRJH 1EEPA 3MPCA 5DMYA 2PPGA 1DKWA 3LS4L 1FWAC 4RWYL 3WQ4A 4POZC 4TKWA 5HD8C 5JMOC 2YAFA 3QO1B 3VJ6A 4NSKA 2A0LC 2JQXA 3AU6A 4XAZA 4IM4A 3TO2A 4W70A 1TDQA 1SF5A 2DWDB 4NUGL 5T1LB 4RE2A 5EU6B 2NZ9D 3KLKA 1AH1A 3GSXB 1KBJA 4X7TA 4QJ5B 2VC5A 2E47A 1AXTL 2GHWB 4Y89A 4KXAA 4NZUL 5C7HA 1Z5LB 3RFZC 1MRCH 5DMLA 1MVUB 1L8PA 3BP5B 1UR2A 3P30H 4NZCA 3QYNA 1H50A 3ZFHA 4B0MB 3L3KB 1KPVA 4OZIE 4M1DH 2BJMH 1Z9AA 4FZIA 4M7ZB 4LPUA 3HVDA 4MSWB 4OAWA 2ZKYA 2DEWX 1P1ZA 1TJHH 3LHVA 3BXNB 3S3JA 1R2TA 1MQKL 3VXQA 4GXUM 2MH4A 1F6KA 5BQ7A 3CLFL 3SKMA 3RGBA 5D2NB 3U7YL 5AUMA 3RWFB 2BHYA 2EUVA 5DMJB 2NZLA 5G1YA 3Q8AA 4NKMB 1WDPA 2IPTL 4KT2A 3KXFE 5TFSH 5D9PA 3OG6B 1F8TL 2XYCA 4C6NA 3FCGA 1KFBA 1L7TH 2B1AH 2Q6WA 1GZQB 5BU9A 4B3EA 2CZNA 3QWQB 3W0WA 5EEYA 2ZZ3A 2GOUA 2K9UA 3FRPG 4HX1B 4KKNA 1B4LA 4AK1A 4OCSL 1MCNA 2DD8L 4YL2A 3MRIB 4XVOA 1H62A 4ODSH 2F6UA 3T77A 1SR0A 4EAYA 4PMFA 1E71M 1LMIA 2WMJA 1TITA 5EO1B 2RMNA 3KBMA 3OLDA 1IT0A 5AVRB 2FTAA 4RQQA 2ED7A 4I18C 2C1PA 4DO7A 1E9QB 4Q32A 3DX0A 2R2BB 5KSVA 4PODA 5I9QC 5FEXA 3US0A 5F96L 3NZGA 2Q5BA 1U36A 2VB5A 3L9RB 3VOFA 2YBRB 3STBA 4QDGA 3BT0A 4GYPA 1NF0A 5K2ZA 1BKSA 2R1XB 4MMXB 1KXVA 3TU9A 4QDPA 5RUBA 1LQ0A 3APTA 1C08B 5LQBH 1VA9A 2WSDA 5CIPB 3W6MA 3CQQA 4QXWA 3SGDH 2JTDA 1NH6A 3A9IA 4AMAA 1GUVA 4EDXA 3BZ4A 4QCIB 5I3HA 1H6TA 3QCUH 2SEBB 2XVPA 1W8OA 3NZ8A 5GRUH 1WFOA 3TU6A 1RALA 4PJ5A 4QOKA 2E9WA 2E75C 1ORQA 5AKQA 1TQTA 2HLFC 4EPBC 3GLDA 4BR1A 2JK5A 4M5PA 3NZPA 4DZHA 2B1HL 3MJWA 3Q2VA 4OQVA 4F2FA 5J89A 3DRTA 5FUOH 3P02A 5DMMA 2NY2B 3FW6A 5DUBA 2PTTB 1QTPA 3RPKA 1N26A 1C8XA 2BIQA 2VZ1A 5JLZA 2J6XA 1XO8A 3HFTA 3UBPC 5L9FA 4WO4D 5TNVA 2HKFH 5F9WC 5EOCH 3BKML 1G5AA 2GJ6E 3QZBA 4XAFA 2Z26A 1IM3D 1E4MM 2W0UA 5GRWA 3QDGB 3WF2A 2WGNB 4HLEA 3WENA 1ZVYA 4B91A 3TTSA 2X1SA 2FBOJ 4O13A 3C2OA 4MRCA 4NOBA 2Y85A 1DHKA 1O1HA 3LTYA 3PZVA 4FG2A 4XZIA 8CGTA 2Z91B 4UINL 1AOHA 3ARUA 4IJBA 4I1NB 4QI3A 3KBEA 3UNDA 4GKSA 2BWDA 3CV7A 1OF2A 2CLVB 2VM3A 5HYQA 4BUHA 2G3JA 4NQCD 1J9QA 1TTAA 2XDHA 3B8IA 1VPYA 1A9BA 2EEDA 4NNBA 5EMKA 3WXVH 1FL5B 1V3MA 3NQVA 5DTFB 4BFFA 2CBOA 1SJCA 5HYJE 4XCCH 5MENA 3NCOA 3S3GA 4G2AA 2IKGA 2GBUA 4DCQB 3TYEA 3ZKND 2DP3A 3QHZL 1XIGA 1KDJA 4OV5A 4EIVA 2YUXA 1XS2A 3SEPA 1MFAH 2GWGA 1UCTA 1CS6A 2WC7A 3M43A 5DK3A 1R3TA 3ZTJH 3Q6GH 4UTAL 4HK3N 3HF3A 2XU2A 3AU1B 3GHPA 1Q8MA 2GGHA 3MSYA 5IVOA 4QQUA 3WFHA 1QABA 4KI5D 2R9RA 4ZSTA 1LEKB 3FHEA 1NFIB 3IANA 1DQLL 4J28A 2JLPA 1TJPA 4BWUA 1JXKA 1LO5A 2O5YL 1WFNA 3MDWA 1SZEA 4CN1A 4PGCB 1MJ8H 3LTSA 2YS4A 1TQJA 4ADIA 3CU7A 4JFDD 4YLCA 3H2FA 2FWOA 4MAZA 3OYZA 4I77L 3ZMEA 4MBRA 2BRRH 5HVGB 3D18B 3OXRB 3WD5H 1ADDA 1H9VA 2ZDRA 2BSSB 3EHBD 2OLDA 1JGVL 1N6VA 2FQEA 3K1DA 5T1MB 3G1VA 5AHEA 1HHIB 2VDHA 5F7BA 1W6TA 1H11A 3LGDA 4N8PA 1U3YA 3ALXA 3HUJE 3LH8A 4PJ7A 4HIEB 2JEPA 4AM0Q 1OT2A 2FT7A 3EFFA 4V27A 3VNMA 2E4FA 1AJ2A 5L0QB 1AQFA 1KT2B 5FPIA 1ZJHA 3SBPA 3L7RA 3BPWA 4PB4A 4C6QA 1LBMA 2BM3A 5DBUA 5E2UL 3QPEA 4HKPA 1TG7A 1MFBH 2X5PA 1K03A 4K9EL 3FA4A 3HURA 4BSWB 2EEAA 4CCDA 2OR8A 4QHUA 2Y7EA 2VXSL 3FSUA 1T66D 5D7JB 1IC7H 3KBWA 2GUBA 5EN2A 4PJIE 1MEIA 3IKCB 4JUSA 3REQA 1T3FB 1F4AA 5KW9L 1KXHA 1HQ4B 4UBDC 3C3UA 1RY0A 3N17A 3UABA 2DLTA 1N8WA 5BQDA 2QPXA 4G1EA 1F3DJ 3ARXA 4TUKH 3O07A 3WD2A 1KM0A 1R8LA 1EZ2A 2PAJA 3WTYA 3VRLF 1J5TA 3QHZH 2WGXA 4HFUH 2IH8A 2WZMA 4N1CA 1SVDA 1JRCA 2B4CH 4V1DE 1ZB5A 3ROOB 4OFQA 1VESA 5J0BA 4OLYH 3WELA 3FL7A 3SBWC 1QNSA 1OTTC 4ZUUA 4NQ1A 3JS3A 2CKSA 3LGGA 1MO0A 5G1TA 3VGDA 4GRMA 2VLKD 4AHPA 3P2DA 2YXGA 4Q97A 1F2XK 4JANB 3BOVA 4BFNA 3TWYA 1KFJA 3ZTNL 2O5YH 4KTEH 3IUIA 5D32A 1LWRA 3MVSA 1RUML 4FQQA 4C5ZA 4ACZA 5FUCE 4WWKD 3O6DA 5CGTA 2D03L 1F8IA 4MMZB 1FKWA 1TTQA 1I1XA 5F2LA 3SRDA 1WKYA 4JFOB 3ABMB 3T0AA 4WY7L 2A4EA 5J3HC 3QPXL 2V8LA 1YEJL 4ZOBA 3UAAA 2YKLH 3AMCA 4J3XA 3NPVA 1LDSA 4JPGA 4XC1L 5D1XE 3UWUA 4MYWB 4Y4FB 5FGBC 4XHJD 3ITYA 1UJ3A 4MWFA 3RKDC 3K3QA 4AWEA 2GJNA 3WK1A 3FCTA 5HY9A 1W2PA 4AWSA 4DGVH 5IM7A 3RJXA 2GSJA 5A8PA 5TK4A 4JYDA 1E6SM 3RWIA 4AH2B 2APFA 5B7MA 4UTAA 3FDGA 3HNTH 5FA3B 2PLCA 1I1YA 3QIUC 4YYFA 4HU0A 5EV7A 2DLIA 1ZEAL 1EFQA 2W9EH 4HFWA 4O14A 5AYUH 4X63A 5DMNA 3HG1B 4ZMOA 2KZKA 2H3XC 1JV2B 3LEYH 1LEIB 4Z7AA 3UWQA 3F05A 4Y9FA 3EX1A 4CMHC 1CLVA 4RFNC 1BZ7B 5ICUA 1A4JA 2HJLB 5A3IC 4DGWC 3HBLA 4PRIE 4C57C 5KSUA 2ADJA 3BAEL 3EYSH 3T08A 5KW9H 1WQVT 4DZBB 4UTCA 4R2GD 1VFHA 2HRLA 5EO0B 7FABL 4GXPA 4XPTL 4YDVB 3ZE0B 2P7TB 5REQB 4PGBA 5E2VL 1HL8A 2VXNA 3MCOA 3MJMA 4Y1AB 5ILTL 4LANA 1JK8B 3ZQ9A 1QPNA 5EIIG 1LVEA 4I90A 1GGIL 2WUCL 1S7TA 4N0UB 2DJMA 2H26A 1Y1UA 4NB7A 2OL3L 3CXHK 3FBKA 3VXNB 1L4IA 4J1OA 3EYFB 3WUEA 5I6NA 5T9CE 1U8PA 2ZPKL 2OJEA 3TA3B 2H0PA 1MJ7H 1PYFA 1ZENA 1IGYB 4Z7IA 4AD1A 3DI0A 2BFVH 2LT9A 1E6JL 4NM8H 1W0WB 2A7BA 3NA9H 5IHUH 2A9BA 2HX9A 2QGDA 1F56A 2B7QA 1V3HA 5IQLA 2HE8A 3ZDZE 2YZ1A 4L9XA 1QWUA 2E7FA 2CJSA 2ZZUT 1MQQA 2X4NA 5LGKA 2YZ8A 2WXKA 5EF0A 5B7EA 5B8CA 3DJ9A 4DBDA 1HESA 2QADC 3ARGD 3L7EB 3GUWA 4M9OA 4XNXL 1QI3A 1FZOB 2EIDA 2BSTA 4MJZA 3OC5A 3WV0A 2Y2WA 1EXBA 4PUWA 5CZXD 4PC8A 3QFJD 4XBGA 3P0YH 5A6BA 5K33A 3DUSA 4WGXA 4RETB 4UAHA 4OR1A 1FHVA 3I9GH 3OAYK 1KGXA 2C19A 3WFLA 5EOTB 4N4YB 1OT4A 4GUJA 1K7EA 3AQUA 1FC1A 2F18A 3RY6C 4JHWH 4R4BA 4MJIB 4S3JA 1ZV2A 3ZKSD 1FVEA 2FATL 4UMAA 5HVHB 3KPQB 1XQLA 3AROA 2ZC8A 4CQCA 1RBOB 5AL0A 3B0YA 1WO2A 3LK6A 5CJQL 3BWWA 2E25A 1DP0A 3VB9A 2X9YA 2DQFB 2A21A 5E1QA 3RZCA 4N2KA 4PWKA 3VYPA 3WLTA 4I3GA 4P2QB 1C8YA 5FFGA 4FQHB 5B39B 4IQDA 3TEZA 2EJAA 5SWSD 1G9NC 3FSVA 5AB1A 1JFQH 1FBIL 1LD9B 5HYJA 3LKQB 2YD2A 3L65A 1N8ZA 3M6DA 1FH2A 4PH8A 5FF6B 3IDJA 3MCNA 4C4KT 4RFOH 4YHNB 5DO8A 3S2NA 1VFLA 4Y4KD 2WINA 3FRUA 3LZFL 5DUPH 1QA9A 2NY4C 2XN9B 3SIMA 4YCPA 2GC7C 1XHGA 4OIBA 3HC2A 4DJED 4Q6JA 4MZ2A 2ABBA 3SSGA 4NENA 1MI5A 4XPHL 4LU0A 5CZRA 1AZNA 1XSJA 4N85A 1TQBB 1GGIH 1TTRA 4JLRA 2ZUUA 1BD2B 1BAGA 2Z31A 1CLYL 2A38A 2Y7GA 4IPLA 1FY6A 5M03A 3BEWA 5ELIA 3SO5A 4HJEA 3ZJ6A 3CUXA 3DGDA 2XSKA 2Y5JA 5BVJA 3DIFA 2XKSA 5DQ9A 3D0CA 3EBHA 4AD5A 4N2FA 4JUTA 1U8MB 2Z7ZA 1SQMA 3HLKA 5T3ZE 3IN0A 2F8OA 1BZ9A 1K3ZA 1IF2A 4JQXA 5TE4L 2Q02A 3NQDA 1E55A 3W75A 3F12A 4X98B 2ESVD 4U4IA 3C8NA 2J8UF 3WNKA 1S9VB 1FC2D 3RBSA 1HSBA 1HCVA 3UBXG 2ZXCA 3D0VB 4LV9A 3WFDL 2CJUH 1XMEB 4HHLA 1G1YA 4GYFA 5EU7E 2UY6A 2V5YA 3DV6B 3B97A 5CP7A 5T33L 5D4IA 1NCHA 3PHOA 4F37F 4GKNB 1Q85A 1G9ML 1HEJC 4GRLC 4QRQA 1UD3A 2JB6A 3GRWL 5I1KL 1AC0A 3OIHA 3V75A 4M0XA 2QW5A 3ATDA 4JGUA 1GG0A 2X87A 3IJYB 4H44C 2NXIA 2BSBA 3BVNB 5DK2A 2B0SH 3DBNA 4K7FA 2POTA 2Z9TA 2XT1B 4PB9H 2FATH 1M57B 4WHTA 3TBVA 1E8YA 2IQ0A 3C52A 1C12A 2I69A 5F0PB 3C6LD 1FOBA 2KDGA 3SUUA 1U3HB 3THML 4CU8A 5DCBA 1PD1A 3MU7A 4PJIA 2OL3A 1BX2A 2C7FA 4R5VA 5D7HA 3QQNA 2Y7LA 3NL3A 1YMMD 3EB3A 4MBOA 3SQSA 1SW3A 3N2XA 4ERGA 1PKQE 3BZEA 1BXCA 4R3SA 1IAIL 5J11C 3QYMA 2OWXA 5LCVA 4MTVA 1KJ2L 2YFNA 2ZUQC 1RZKL 3QIWC 3RTQB 2YBGA 3NJGA 1IGIH 1MQ8A 1ZE3H 2VMDA 4G9FA 1R9XA 5D72L 3UO1L 2MKLC 4Z2KA 1PY4A 1SW7A 2OR7A 1YNTB 4AM0B 3PWNB 3QUYB 2I1OA 4X6EB 3K6SA 5CC6A 5DVLA 5D93C 1SO4A 4LEOA 2Z7YA 1KLGA 2AV1A 2HMCA 1O12A 3FTXA 5LWYL 3Q8EA 2ZIDA 2HT3D 4DNHA 1XGYH 3F62A 1V0MA 4G11A 1MCPH 2P5EE 1AJZA 3Q0HA 1MQPA 3GNRA 3EOUA 2VVNA 2FEEI 3KYNA 3PV6A 2AJZB 5DANA 4RMWA 1TTBA 1S46A 3ZLQC 1CU4H 1QFWI 4Q6IC 2BC4B 5KMYA 3ULUD 5EFIB 4HC1H 4ZW3A 1URZA 2VCAA 4O28A 4TSAL 2F7RA 3HNSL 4OIAA 4X7FC 2D2CC 1LL4A 3MRCB 4ZMXA 1VERA 5IQNA 3TYGL 4FE9A 1WNOA 4AZ6A 1IKFH 4P5SA 1EH9A 5F6IC 1KEMH 5I3JA 1XT5A 3SN1A 4MG4A 3S5OA 2VX4A 3WFBH 3PB2A 1G9MH 5T3ZL 5I1DB 4EN3C 4HIXL 2E7CA 3W24A 3B2DC 5J04A 2ITDB 4L5FE 4ZMVA 1E28B 2ZX8A 3AT8A 2X40A 4ODBD 3GQYA 5BRZB 4TL4A 3DXAE 4C55A 3KCPA 4GKZB 1DSYA 3FB8A 4D0DB 4NHCH 1INEH 4UV4H 3ESNA 1WBXB 3ILDA 4NN5B 4QG9A 4PBDA 2IAAC 1IBHA 4FX8A 4FI4A 2OXHA 4RPQA 3IJ8A 3TBWA 3KTCA 1NFGA 4ES8A 3ZJ7A 1DDTA 5EORH 4GNJA 3THMH 1ZPLA 4D6HA 4U49A 1PKOA 3MOAL 3NYZA 1TJ2A 2AJVL 3MV7D 1YNKH 1EEQA 3PZOA 4C56B 3HPZA 2CBPA 3P9LA 4N2GA 2YMTA 2IWKA 4JCWA 1TF4A 2ESCA 2W3ZA 4LDEB 4WR3A 1SDDB 1BG1A 3O6KL 4X6CE 4UM9B 1ZANL 3CWNA 1E43A 4DESA 4IJ3C 2H8XA 2INEA 2ICCA 2JFEX 5E08L 3M41A 3DMMD 3TN0A 4XO3A 1QHOA 4Z1BA 2B2XL 2XA3A 1WZAA 3FQRB 4LAKA 1LQ2A 4AT6A 3WIHL 4XB8A 1ZTVA 2Z2AA 3BW9B 3WJLA 1HAWA 3ESOA 4ZFFB 1KCKA 3N44F 4PFHA 5HDRA 4QT5B 1LUCB 3SQRA 1NFKA 3CG8A 4IU3B 3ZRCC 1EXPA 3KCOA 3FFCB 2HSIA 4DNMA 3EBIA 1Z1WA 2VEGA 4KTDH 1N82A 2EDMA 3IFPA 3WCYA 2DLGA 2CCLA 5FYKD 4W85A 1I8JA 5IBTH 1XISA 1GJIA 3RFRA 3EOAB 3H6OA 2ED8A 5D7LE 3REVB 1BF8A 1CFNB 2G5WA 2GVJA 3E3QC 1PJWA 2YUZA 3GMRA 4IOIB 3BRGC 1F74A 1J8KA 4DJMA 1FI8C 3UYPB 3QORA 4KVNH 5A8MA 1P1VA 1A7RL 3DX7A 5JPMB 4ZMQA 1KTKE 5T3ZH 1DQJA 4HIXH 1G7PA 2DQEL 4YTSA 1UWEH 1W3KA 2YX0A 4HJTA 1U8IB 1EZWA 2BVUA 1FNHA 3S36X 3TYCA 3MRFA 3DAQA 3O3AB 4N25A 3GNPA 1KCLA 1T5XB 5DVNA 4WY0F 2QQNL 1T1YA 4GP4B 5HR7A 1A4CA 4G80B 2B4GA 4YK4C 1NWTA 5FKPB 1OGPA 4Q6YA 1Q9LB 5A7EA 3OGOE 3UTSD 2C3VB 3QNYA 4L5FL 5HGBB 1I7RA 2J71A 1F5ZA 1XLAA 5DXXA 3Q5OA 1E30A 5EGRA 4H1LH 4GAJH 3H7LA 1JRHI 2NT0A 1J05B 2YR1A 4MDIB 1TTGA 5F7EL 4XNUL 1W91A 2GAZB 3B9DA 4M6NH 4AVHA 3S88H 5AD0A 2VDKH 4K36A 1V02E 1F3EA 2Z35A 2IJ0C 3W9ZA 5H1WA 4M8QB 3MV9A 1R34A 3ARWA 3GHEL 1ZANH 5IQ9A 3N6JA 3FY1A 5J5RA 4NM4H 2B77A 1O5RA 4HMEA 2BRQA 5FACA 1OX4B 2V8ZA 4JX4A 3IJ7A 4RDWA 3RJOA 3VKAA 5T1LD 3FSOA 2O6FA 3LTVA 1UWFA 1RA0A 2BIHA 5EU6D 3IBOA 2DTSA 2C9VA 5C6TH 3ASNB 1K4GA 4JTCA 4WQ6A 4P5MA 5DY3A 5CCZA 3KBVA 5C2UB 4JBRA 5CAYB 1U8NB 1I9JL 3GRBA 3GI8L 4DP7X 2GEEA 5ENWB 1U8QA 1PZ5B 1BJ8A 1P7KA 2WZPA 3ZDYF 2AXWA 3RWCA 3FONA 1BQHB 4AL8L 1EWEA 1FLTX 4Y90A 1RMFL 4JY6A 3UTQA 4J8RA 3PJSA 3UJTH 2PRHA 3RAJL 2HLEB 2G4JA 3TUUA 5E56A 3W7QA 4WIWA 1RULL 4NQQA 2LLNA 4BH7A 2PC8A 2K6YA 1ANUA 2PZ0A 5MI0C 3OPZH 2B5IC 2XG4A 3C60C 3L5LA 1T40A 4L1SA 2P0IA 3A4AA 1G4PA 2RHGA 4MXWL 1T1WB 3OU8A 1LP6A 3G5WA 2DQEH 1Y18B 4M6QA 1EF2A 1W16A 5LA0A 1FWWA 2HN7B 1D7BA 1I75A 4AQ8C 3QPYA 1DFBH 5CN2A 2V2CA 3BTNA 4Y2NA 3O3DB 2AMUA 2BP8B 3T0EC 2BY0A 2D0FA 3LEVH 1X7IA 2HISA 1TIUA 5FKAA 1U92A 5IIEB 3QR2A 3VGHA 4KFNA 3SRHA 5GZNC 5ES4B 5GS0H 3BMVA 3T8VA 4IGSA 1CGXA 3LQZA 2RDXA 5ECJE 5AWNH 1OGAA 1IL1B 2QUUA 3W0WE 3UJ2A 2AXJA 1WPCA 3F65A 3OKKA 2F7PA 4LAUA 3NIDB 3UBXA 1X97A 3BOFA 3MACH 1EA0A 5KYWB 4TX6A 4MA8L 2DN7A 4F8LA 2C3XA 2GVEA 1EKOA 4I87A 5INDB 3QXAA 2H6UA 1T6WA 2A5HA 3E2QA 1XGUA 4XVSL 2IF7A 1ZBCA 1SBBA 4X7SH 2HWZL 2XM1A 3TYZA 4UDTA 3M6YA 1RBAA 3IGHX 5CGQA 3GHEH 3FN0L 2WWNA 4JXCA 4ZXLA 3ZTDC 4TNFA 3KWTA 2BMBA 4I0PC 3SCNA 4EDWL 1B3WA 5HJGA 4RVBA 1FZMA 3NSMA 2JVUA 3UYRH 3U5UA 2WB7A 3S2JA 2NCMA 1CI3M 4L8CA 1CGUA 4FNQA 3Q05A 3IS0X 1TUPA 5HYEA 1EHXA 2XXMB 4LNRB 4Z7NB 2BVWA 1ASQA 2ADAA 5LNSA 4EAMA 3GTVA 3IEBA 4RAHA 4FP8L 1HWGB 3SKJL 3BIKA 1VFBB 1T7VA 3FOLA 4APQC 4G6CA 4OUUA 4L8BA 2NY2D 3FXIC 3TW9A 2D20A 4XD3A 1LK3L 1WITA 3M0XA 4XKYA 3F4NA 5MERA 4PJ5E 4QOKE 1KJ3L 4EMZA 2OS7A 1JN6A 4AL8H 4FYQA 3DETD 4RMBA 3UA4A 2ISWA 1S2CA 1RUQH 1LDCA 2RAGA 2VDGA 4BWLC 3BVJA 3BKYH 3G6DH 2P24B 2V7NB 2QEZA 5EMUA 3KL3A 1Q4NX 2WLHA 3DXAA 2NVAA 1P4IL 3QDGD 4MAVA 3MRHB 2AL2A 3D69B 2JIXB 3OR6A 3RGHA 5DMGC 2QKFA 1IGCL 4UFLA 2NW3A 5HI3D 1GSMA 1K2DA 4WI0A 4ZDHB 1FFNA 4ZS6D 2RGSA 1I8KB 1L2UA 2CBIA 1TWSA 1I1AB 3FQYA 4V33A 1KB9K 3RZWA 4MS8D 4UZGA 2FX7H 4GY0A 1BZDA 3NTCL 1MUJB 4ZMYA 2FO1A 4JNZA 3MLRH 1KGCE 2F7FA 1LJYA 1FO0H 2RGLA 2CD0A 3UWVA 4OLZL 2DICA 4KIEA 4X6CA 1E5ZA 4P07A 5BXRA 1ZVSA 4RIRB 2BW4A 3OC8A 2P26A 3LMJL 4Y6GA 5E2WL 5C0FA 1I7ZA 4L29B 2N56A 4MB5A 1OF6A 5CCJA 5CPOA 4AVOA 4GBDA 4KW2A 2V63A 5GS2D 5L2KB 4YXHH 1VFSA 4JTRA 1XR8B 4F37K 3N15A 3VTTA 5MENE 4IKIA 4LUYA 4HJ0D 2VW6A 4LF3A 5TQ2H 1QK0A 4L80A 4F7EB 4X99B 1LG2A 2XZZA 4O4WA 1GHSA 5E6SB 3SBRA 1AD9B 1GVSA 4FFZH 3RVVC 3F7YA 2NNCA 3TPUB 3E8UL 1KNWA 4LUSA 4L4LA 3ZPDA 4ES9A 2X1OA 4KRTA 2OMVB 4XP4L 3K0YA 1CF8L 3C08L 3TQ0A 3L95A 3OB0K 4G1KA 4R83A 3PZ9A 5JNYA 4KJQC 4XVTH 1VFFA 3STFA 1KN4L 3DC0A 5K9KA 3KW3A 1YPZB 1NCAH 5IROA 4OLWL 3ZRSA 1E1CB 2B31A 3FO0L 4EVZA 3HOGA 1KRAC 4FQJL 2CIIA 2QR0A 4G7YL 1ETZA 3IJLA 3AIQA 2VT0A 3QK0A 3MYPA 4JFZL 3QF0A 2WQWA 1XLLA 1PYMA 4Y5YB 2NY0C 4KNTA 5G2NA 3CASA 4K2UL 3CX2A 1A6WL 2FZNA 3VAEA 3F00A 1RK1A 4NDMA 2CR0A 5BO1L 1RP9A 2F68X 4IRSC 1LO4H 3TN4A 1UVQB 1R4XA 1KGJA 4PGDA 2AOSA 4YQXL 2JKPA 5CSGA 2EPNA 4C1NA 4EF9A 3VD1A 2DH2A 4QE4A 3JTSA 1MHEB 5HNTA 1I1FB 5D7JD 1WDWA 2A4ZA 5IBUB 3L0NA 1JV5B 4PTTA 2YAMA 4XXCC 3ITTA 3MYJB 1AH3A 1PZUB 1Z9NA 4GQ9H 5D1ZC 3WQDA 4PJDF 2E28A 3SY0A 4E2VA 1DEEA 2E7LA 4XPGH 1XYLA 4H0IA 2ZCLL 4XN4A 4NZ5A 1EYEA 4L8SC 1IBZA 1N3NA 5L9DH 1UXMA 2JJVA 1R46A 3EO0A 5CZTA 4U2YA 3X1BA 3EYVA 3L4WA 5I75B 2V0TA 1QPOA 3LMJH 4S3DA 2Z4QA 1POKA 3J27A 3SECA 1YW1A 2CLMA 2VDKB 4OGAC 3TWAA 1IC0A 1NGYB 3GDBA 4CGTA 1CO1A 1CR9L 1AZVA 3GSWA 3KL5A 3HZVB 3DFQA 2PPCA 1XEUA 2H9AA 1WUEA 3ULSA 5AB9A 5PAZA 3CUIA 4EUPA 2YLKA 4F2MA 1W8SA 2Z92B 1LXMA 2FH8A 2PYFB 2XSXA 4M7KH 3D52A 4NQDB 4FMVA 5JMUA 2UXFA 1A7BA 3QOMA 3L68A 4Y16B 3QDJA 5IFTA 4HHPA 5E6IB 4ZSUA 1JPTH 3SDAB 4G8GB 3GYCA 1XWVA 1JZJA 2YPLA 4G43B 2PCYA 5I1GL 4NI8A 1BVOA 3A0OA 3E8UH 6ALDA 1UXWB 4IXHA 3OZ9L 3SPJA 2FJKA 5BO0D 1S5NA 4YPGB 3TTYA 1VZWA 1QW9A 5I0ZA 1LK2A 2DIAA 4PR5A 4H6QA 1IXQA 4FFWC 1XGZA 2P5WE 1HZLA 4JIQA 2IPUG 1UOKA 4ZVJA 3DSFL 3BDKA 4Y4FD 1IE4A 3C75A 5I1CL 2NY6C 4YIQA 3E6EA 4G7YH 2H0JA 4PV8A 1IGFH 1PCXA 4B9PA 3O6FC 5KVGE 3OSVA 4JPQA 3BT2L 3QOKA 3W28A 4K2UH 3R0KA 1A6WH 2WZHA 4LIQE 4PB5A 4AVNA 4QR6A 1S9WA 1N6QL 1WLHA 3L45A 3GHSA 2CLZA 2A3BA 2Z2UA 3R06B 4D0BB 3ZBMA 4I0CC 4LPVA 1FH8A 1P0BA 4IGBB 5AB3A 4YN5A 3NJXA 1M3IA 2PO6A 1THCA 4TLKA 3GLZA 4LBSA 3HG1D 4EXBA 3TN3A 4QLRA 1HIML 3QAQA 3X13B 4GH7B 2Y88A 3C2AL 3MRLB 3HRPA 3CAQA 5IMMA 2G2RA 1P48A 3PTDA 2VAJA 1YKWA 5DJ8B 2C5DC 4G5AA 4QJ4B 5LSMA 5D9OA 4POYA 2OP4H 5KSAC 3ME0B 5JBEA 3DK0A 1FWBC 5F1VA 2F53B 1R3WA 4MDOA 3R7RA 5L6YH 1SLUA 3DGGB 3U8GA 4FERA 3AVEA 4LGXA 1MZHA 3TXZA 4AUYA 2YQ2A 3BIBX 3OGSA 2HFFB 2NTFB 4HH8A 2DQHL 3M0YA 2IALB 1NSNL 3TBCA 2DQ6A 5KZEA 5E70A 4LBEA 4UANA 5DUJA 1NMBL 1EJXC 4JJ5A 1H0GA 1YXCA 4JFUA 3TA3D 4Q52A 2OAAA 5F6HI 1HQRA 1EO7A 3QUHA 4V15A 4U0QB 5TH2B 2W4XA 4HGWA 4PCYA 3BN3B 1IKNC 2KAUC 1DWFM 2CNYA 5B38B 2J8UA 3LS4H 2EYSB 4RWYH 4NC2B 4P5TA 3M7WA 1HJVA 4W6YB 1ROCA 5I1GH 4ZSOB 4KY1L 4N86A 4C83A 3HZYA 4NUGH 1VZHA 3RGVB 4QMEA 3ANYA 2X4QB 2R94A 1DVFB 4AOFA 3F4WA 4GA8A 1AXTH 4N28A 4AUUA 3GBEA 2FZ8A 4NZUH 5GGSA 4MJ6B 3CUZA 2W62A 1IR2A 2I9EA 4M6VA 3DGCR 3MTWA 1KO0A 4KETA 1A4KA 2WXQA 3AABA 1IWPA 3KOFA 3KVKA 3QQ9C 1N7KA 3CDYA 3CXHJ 4M61A 4DQOL 3VX0A 1KM5A 4MJID 1ZGLM 4HQVA 1AZRA 3CSGA 3OZOA 4Z1AA 2Q8AL 1MIEL 5AW8B 4X6FB 4IIQB 1ZGDA 1MQKH 3WUGA 2CE6A 4U3HA 2EEBA 1FVCA 1R0AL 4GG6B 3CLFH 4IFOA 3U7YH 1ZPUA 4P2QD 2BTMA 4JQAA 1N0XL 2ITFA 1OGGA 3LV3B 2IPUK 2IPTH 5KZMA 1OAXL 3KM2A 5DSCA 4O00A 2A1WL 1F8TH 5C0AB 1MHHA 2FDBP 5A6LA 3S2CA 2EC9U 1JAKA 5ABEA 2KERA 2X0WA 4PJ8B 1KBWA 4PR4A 2UWEB 2L7EA 3BD3A 5KVGL 4O2FB 2FZ3A 4B7LA 3A3HA 3GUTA 4LIQL 1A5BA 2X6VA 3B03A 1FO0B 5U7SA 4OCSH 3UYOD 1A3QA 2DD8H 2YEQA 5IVZB 5DT1L 3BYTA 2YMXL 2XN9D 2BZDA 3KRUA 1G6CA 3U4EB 4MADA 4R26L 4H2HA 3NL2A 4XN8A 1A8JH 4AENA 3U4KA 3BC9A 1CDUA 2MMXA 4NN7B 1OIOA 1AS6A 5F96H 1BD2D 2IUZA 1RL1A 3SPHA 4LKCB 3M7FB 3B9AA 3ECBB 1IT8A 7REQA 3G5ZB 5FX3A 4S2SA 4GQZA 1VBGA 4UIMA 3DG3A 2BP3A 3NJKA 4WENB 1T89A 3VVGA 3WEAA 3QFGA 3W83A 1R33A 3GNXA 4B3KA 2XTLA 1N64L 1MI5E 2FIKB 3CDZB 3MOBL 5JBDA 4OQTA 2FB4L 4Q4QA 4FEIA 1JZFA 1PHQA 4MRBA 3AU0A 4F3FB 3A13A 2FTPA 3V5HB 2OBGA 3IRSA 1OT1A 4ZO8A 4E0CA 3LB0A 2BGSA 3GK8L 4AIOA 2AGJL 4HXAL 2R1PA 4GEIA 1XGEA 3T40A 3OR7B 4PP2B 1ITQA 2AXFA 3D25B 2Q8LA 3P0WA 2ALRA 3B8UA 1GVEA 3TR9A 5DEFA 2OMAA 1A1MA 3FYIB 1BXUA 1XF2B 3VFNB 1V0LA 4L3EB 5A7BA 4WFHE 3PXLA 2B1HH 2FL5B 4XN5A 4R7LA 4NLAA 3AXMA 3G6AB 5D4JA 4MVAA 3AUJA 2FYYB 5IVNA 3O9NA 4JX5A 2D4DA 2VC9A 4MVBC 2ITCA 2PCFA 4X6DF 4O0ZA 4N2EA 2EG7A 2X9XA 5FO7A 5MF5A 2ILLA 3LQAL 1S1PA 1UWYA 4M1RA 5GXBB 1FP5A 2QT6A 1JK9A 3VJ6B 3MZNA 2NMSA 3BKMH 1X7FA 2EKCA 1U3HD 4P46C 1XFCA 3UW6A 1G5GA 3ID7A 3JWDL 1CDHA 4X7TB 5FGCB 3U30B 3WDPP 4JQIL 1OAXH 4M48L 5GGUA 3IE4A 3D05A 2ONEA 1ZNNA 3AZRA 2XETA 1T5KA 2A6DB 5DJ0A 3QVQA 5JUEL 2AJ3A 3VU1A 1IT7A 4JZNB 4V2CB 5ADOL 2CLRA 1GOHA 2BHFA 3S4SG 4UINH 1T6BX 3KYOA 4KC3B 1I4FB 5DLML 3EAUA 3RTQD 4OAWB 4FSAA 5AOZA 3H2AA 4RRPA 2G50A 4QHLA 3IDMB 1UM6L 4Z0BL 1OG0A 3WO4B 2QMJA 1UXLA 1TT6A 1UB5A 3K4WA 4BY3A 5HVFB 3B9KA 4R7XA 3HU7A 5BQ7B 3BEVB 3SKMB 4U6YA 3QUYD 3A3YB 3F7QA 4TULL 1KXTA 1GKPA 3OJMB 4G8FB 2PWHA 1TJ1A 3VG9B 1I31A 1RVGA 3MMWA 1FNGA 4UTAH 1IQ8A 3GR8A 4WU7A 3PP7A 4UOW1 3RX9A 4G9FE 3VXPA 4HYTB 2CPUA 1J5DA 3FUFA 1E9ZB 3JW7A 2KHAA 3GLEA 1ODUA 4FXLA 1TOXA 3INPA 1N64H 3NJMA 1X7SA 4LCRA 1JDDA 5FYLE 1HH9B 1X96A 1DQLH 1T22B 3SCMB 3T77B 8XIAA 5E9XA 2IQDA 3QYQA 2P5WA 5ABZA 2DUAA 4FNPA 1W3IA 3DBXB 4Y9OA 2HVBA 4I77H 1C7TA 1NCGA 1E4NA 2DMHA 2MTPA 1HO1A 3UL4A 2UV8G 3BWUF 3GMPA 4JTFA 2QXWA 3JWOL 3TBSA 1JGVH 3OAWA 3UZQA 2WZIA 1RPXA 2QCLA 1WV2A 4RX4D 4WY0A 1EAJA 3ETTA 5A3HA 5BRZD 1XRSA 4Y7OC 4KMLB 3CH9A 5KVDE 1ILSA 3EXSA 4LCCC 3GIPA 4DN4L 5JO5A 1NGZB 4WUUB 3W84A 3SKOB 3NEOA 1Z6KA 3BQUB 1K4CA 2YBTA 3SURA 6FABL 1SY6L 3AXLA 5JOPE 4B5SA 1XDLA 1TYGA 1UP3A 4QISA 4JDBA 4GRWE 5HI4D 1FWXA 1XGTB 4EVNB 2N7BA 5HVWA 1ORQB 3QG6A 1EFXA 5E2UH 4Y0GA 2BOCA 1H8LA 4UQIM 4FIQA 3AGVA 2FKPA 4K9EH 1EFZA 1K7FA 1A6AA 2LVEA 4C56D 4ZZ9A 4LEXL 3HMWL 3BDBA 3ZQXA 2NQDA 3MI3A 1Z48A 5F72S 2VXSH 4ZB5A 1DIEA 1CDJA 4HSQA 4PHZA 4QWWC 4S1DC 2CHRA 2WHJA 1DWAM 1IR1A 4UM9D 4AZUA 3TJIA 5F3FA 5I6XB 3SQBA 3LDBC 5ECUA 4FD0A 2BASA 4QBXA 3U57A 3VIGA 5BZWA 4JQ4A 2F5AL 4QJ3B 1ISZA 1AXIB 2PBOA 3JVFC 4R9XA 1GKQA 4TULH 3T65B 3ZR5A 5I8CA 3UAJC 5DHMC 4H9MA 4N8CL 4K94L 3W7EA 1G7HA 3ARDC 4GCXA 4D6GA 3QT2A 1LE5B 2BXYA 2QSQA 2CHWA 1EYWA 3TIMA 1Q38A 5DZAA 4GAAA 4L65A 4JY5L 3FFCD 2FVMA 2JH2A 5B1JA 1OCWL 1NP2A 4AGPA 3NQBA 1GZHA 4L6DA 4GKSB 3TIDA 1S7RA 2GY5A 3DO7A 5AFDA 3FRPA 3MV11 5LCVL 5E6RB 4C6JA 1U33A 4G6KL 1KIQB 4K1WA 2PXYC 1OEPA 3W25A 3AYRA 4FEZA 3ZTNH 1HK6A 1S9XA 4CQ8A 5SV4A 2K7PA 4HJSA 3LIUA 5IB1A 5CWSA 2JKWA 3AS2A 1RUMH 3TDFA 4ODUA 4R0LA 4JQIA 2J8TA 4NAEB 3DG7A 3D0AA 2VLLA 5BPPA 1UH4A 2R4SL 2BVQA 1W8NA 3QMTA 2D03H 5G5IA 2IQAA 3JWOH 5FYLL 5IEHB 3O6AA 4TQTA 4G1MB 3H7UA 4P61A 5AG8A 4WY7H 2PCPB 4OD1L 1JS4A 1KN2L 3A22A 3QPXH 4XTIA 5B3JF 1YEJH 4NRZB 4R97B 2NZ1A 2ZKWA 4XC1H 3KPMA 3HE7C 1XL4A 1V6TA 2VGFA 3K1GA 4PFEA 2LU3A 4DF1A 1RH8A 4PTDA 4NO0A 3OX8B 2XV3A 3A4EA 1A49A 1DZBA 3MR9A 3S42A 5C08E 3U2ZA 4XPBL 3VD4A 1QPQA 4A39A 2GK1A 3X1EA 2Y24A 3DI2B 4PP1C 2J77A 4WNQA 2FWOB 4HS6A 3EJYC 4AMWA 5LO7A 3CDGA 1NELA 5JQIB 4UQDA 3PUEA 2Y9RT 1TO5A 1O4UA 3EDFA 2YGOA 3STLB 2XN1A 3MRNB 5KVDL 1ZEAH 2Y8KA 3UCCA 1VFTA 1KLFB 4O51B 2OI9C 3WEZA 5D02A 3QARA 2F6AA 3HAEH 4O18A 4HCDA 3H9YA 1UR8A 5DD0L 2Z27A 5E0KA 1NDVA 4PJ7B 4GUCA 5C8JB 3STCA 5BS0A 3COTA 1B3JA 4WVXA 2V2WA 3BAEH 3IDGB 4AZ8B 4IUOA 2WJEA 1X5YA 4Y19E 7FABH 4XPTH 4Z9KB 1NEZB 2FMOA 5E2VH 2F08A 3EJRA 4HA1A 4LCWB 2RH9A 5ILTH 4LVDA 3GM0A 1JPEA 3IMVA 4JN2B 1KCBA 1EXHA 2WUCH 5LGYA 3MV8A 3MV9E 3SDOA 4M3HA 4X8JB 4WK4B 4ZQPA 2YAPA 2OL3H 5CZKA 3CNYA 1TPXC 4A63A 5EBWA 2IV8A 3LN5A 4AMKL 2ZPKH 2L8AA 3H9SA 5HYSG 1IBDA 3RX3A 2DUXA 1VBJA 5JBFA 1V10A 3AAZA 2JJSC 2X4UA 1E6JH 1SY6A 2F74B 4QLLA 5EKYA 3P77A 3KBFA 1TR9A 3O05A 1TTUA 3VDAA 2PODA 4P2OC 4MTMA 2WBJC 3PJLA 2WYIA 3K71A 1O6VA 4W8BA 3OHXB 4G1EB 4ZA0A 2YR3A 3FO9A 1ULVA 3PC0A 4XNXH 4FR1A 2VZSA 2P4AB 3KS5A 4ZMGA 3OZLA 4U0RC 3K4DA 4IP5A 3G22A 1FV1B 1FHNA 4J6RL 3BXWA 1QR1A 1OCJA 2B20A 2DJ4A 2NY1C 1CWVA 1I3GL 1OG6A 3TAOA 2QJDA 2P45B 4OD1H 1E8ZA 1XVSA 5L4IA 3WQPA 2A85A 1MFEL 4GZJA 2V5DA 4GRMB 3L3DB 1P9MA 1UZ6F 3L4XA 1Q6OA 5IHZA 3WTTA 4J3VA 4HZLB 5GISL 4FFVD 4A21A 5CJQH 3OWRA 5C71A 4MD4B 4OZIB 3U2IA 3RRXA 1HNFA 3GBML 1NL0L 4D1JA 4NBZB 3VC5A 2P46B 4GIEA 4E36A 4C4KO 3DOSA 3V0JA 1CYWA 4UQ3A 4N2DA 4N8VB 3W9EA 1JPIA 3G9AB 3QHTC 5E8PA 4B9CA 4K5OA 3QEGL 4FCHA 3GWQA 3GO1L 1FBIH 3ZVHA 3TEUA 3QUZA 5DD0H 3PZIA 5HJXA 4H01A 2JGQA 1OGAE 2A0NA 3C0QA 3KXFB 3RL2B 2BVYA 2HG0A 3IVTA 1UJ3B 2X4PA 4YNGA 4NHUA 1E90A 3TH3T 5I82A 3C6CA 5FWRA 4XKMA 4ECLA 2VR8A 1C7SA 5IM7B 1EAOA 4NSBA 3LZFH 3DYMA 5J6HB 5DQJA 3C6SB 2ZOLA 5EPMB 2PDGA 4NEHB 2JJTA 4FHAA 4R7DB 2CKNA 4XPHH 4WW2B 3GSVA 4Q7DA 2GUOA 3L3JB 1I1YB 3MFGB 1EQCA 3VZZA 2EXOA 5F9AC 1DVJA 1MPAL 4DZ8A 4AJ0A 2UZYA 1CLYH 4Z5RA 3TF7C 3ABSA 4GUGA 4MMYB 1SN2A 5D2YA 3I6LE 3NSYA 1HXYA 1NLBL 2VQ1A 3S83A 4HKXB 2YBUA 5FB8B 2B9BA 5KYNA 4CD5A 5XIAA 1M03A 3KLQA 3DV4A 4IX2A 3VGEA 3FU8A 5DJXB 3FYOA 4M5YL 5FSDC 5E4OA 2VD8A 4W9TA 3IJEA 4WRHA 3O1NA 4NYLB 2MNJB 3L48A 4PJGF 5FCSH 2WMFA 5TE4H 3RR1A 2MIZA 2E6AA 2W81C 1CD9B 4LLDB 5KBPA 5E4IA 1KBVA 4MDJA 4XN9A 5CSSA 4WJ5B 3V5FA 3MLZL 2JIXD 4ZUVA 4QE5A 4XK2A 3WFDH 1HINL 1VKFA 4YGAB 3VIJA 4RPPA 5IKCA 4FXGB 3GVRA 2FJSA 4AZGA 3VM7A 5T33H 3QPQC 1OGTA 1UGKA 2DLFL 1U8PB 5E8NB 3GRWH 5I1KH 4PJDA 3S8WA 3S9DB 2I24N 3TVMA 4WKAA 5KZDA 4CVXA 3K4AA 2BHUA 2OTUB 3SCOA 1I1AD 1MCLA 4OKVB 4JREC 2XZAL 4M5TA 3AMLA 3RPIA 5K4ZA 2EHHA 2AGKA 3MVTA 1P5UA 2EDTA 4JDEB 3GLCA 1FNSL 3D39A 3LRSA 1AL8A 3QUKA 5GISH 2LU7A 2NNRA 3KYMB 1AQKL 4MB1A 1YN6A 1OM0A 2ZXBA 1UUMA 4LCSA 4ERSL 2Z1KA 3HPLA 3EZ8A 3T44A 4XBGB 4GLRH 2FR4B 4W93A 2ZYSA 1PX4A 4BQCA 4JTAA 2ZUVA 3EJZD 5C54A 2VEIA 2GJ6B 4YNYA 4LYRA 5C3TA 1H7PA 3OSKA 3GO1H 5L2KD 1A50A 3HBGA 1FFOA 1IAIH 3OKDB 3QHNA 1IGJA 3OVQA 1RLCL 4PCKA 5HMEA 1KJ2H 1GXEA 1RZKH 3WLQA 4ETQA 3HPFA 3RDTC 3TH4T 3KPRA 1FVEB 1DQUA 1DORA 3VILA 1MJUL 2AQSA 3SQLA 2AJYL 4Y1TA 5D72H 3UO1H 2BH0A 1KB9J 4HJIA 3ARED 3K72B 3M88A 3M5ZA 3UIYA 4N4QA 5DVMA 3PUGA 1ERNA 3V95A 5FCZA 4N2IA 3IIVA 5DXYA 1HL5A 1RURL 1PZAA 5LWYH 4Z17A 3SD2A 3VFPA 5LZLA 5HYJB 2CDFA 2Z1SA 1QNRA 1N8ZB 4ZMZA 5EF1A 2ICWI 3M5YA 1XH3A 1F13A 3FUKA 4M5YH 4LLYB 3TSBA 3KDPB 4ZQMA 1E4HA 3MLXL 2WINB 5EZIL 2W9MA 1FUNA 4P7RA 4TSAH 1TVPA 4WVRA 2C4FT 2VMCA 1A6PA 1BA9A 1M3UA 4PMZA 3HNSH 3ITOA 2E27L 2APWA 1ITCA 1TVBB 3HB3C 2QYGA 2NRDA 1HT6A 3G3LA 2Y25A 2YXMA 3UESA 3TYGH 3UJJL 1P6WA 2V3FA 3QZLA 4E3VA 2FBJL 5C08A 5EIIA 3BEWB 3QEUA 4V1XA 1BVZA 4XX1G 3E2SA 3FCUB 3V4VA 3V4LA 2NSMA 1MDRA 4I9WD 1ZRUA 4LK4A 3NCJL 3FS9A