1NM9A

Crystal structure of recombinant human salivary amylase mutant w58a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPAWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human salivary alpha-amylase Trp58 situated at subsite -2 is critical for enzyme activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1nm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nm9A01
1CXEA 4FLOA 4RE4A 3NSNA 2JEPA 1KXVA 1PJ9A 4CN4A 2EAEA 2ZX9A 2EQDA 4AIEA 2RGMA 3WH7A 3CUJA 1AMYA 4X0NA 2TAAA 3RM4A 3W25A 2VURA 5D8ZA 4BZYA 4MAVA 1TMQA 2DIEA 4HTYA 4PMNA 1QWUA 5D9OA 1E43A 3VM5A 3QGVA 1HN1A 1ZBWA 1EQCA 4WIWA 5ABEA 2ZUSA 2PWFA 3ZR5A 4ACYA 2WHMA 4D6IA 3PTMA 1FP9A 4PMVA 2J47A 4NRSA 5HNNA 3T0BA 3GDBA 1R7AA 2DIJA 4EANA 3O6AA 1UKSA 2NSXA 4CKQA 1GHRA 3VDCA 1W3JA 1V02E 1JI1A 1G94A 1KXHA 3QHMA 3TTYA 4WK9A 4GIAA 2DT2A 4XZWA 3FW6A 3VD3A 4QCEA 1UR8A 3MUY1 1QI5A 2YA2A 1UKPA 1VFMA 1JI2A 3CC1A 2JIWA 1XV8A 3EDEA 2F8QA 1DWIM 3RJYA 3VIJA 2V3EA 2GVYA 3VPLA 3AXIA 5HXMA 3WF4A 4TUFA 4M1RA 4CU7A 1E4MM 2D73A 2DT0A 3NJ3A 1TVPA 4H8HA 3WY4A 3T09A 1NP0A 2YBTA 1B3WA 3AROA 4PUEA 3UG3A 2CXGA 1SYTA 1XH0A 2W61A 3H55A 2PC8A 1G9HA 4Z2GA 3BAKA 2VZSA 4B9ZA 2VCAA 1B3ZA 1HKKA 4QLKA 4OUEA 4PMOA 4AZ5A 4QLJA 1KGWA 1AQ0A 1GPFA 1H41A 2BFGA 3ZIZA 1CWYA 3VD9A 1JZ3A 1QOXA 4JFSA 4UFJA 2PWDA 3WNNA 2JALA 5CZKA 1D2KA 2G3JA 2UY3A 2VZVA 4MAZA 3UR7A 3CUIA 1EIBA 4AMWA 2WMIB 3MO4A 3VKKA 1HKJA 3GM8A 1GUVA 2E8YA 2XGIA 1BSIA 4AZ6A 2X2JA 4BQ4A 5A8OA 2Y2WA 3BCFA 2J78A 5IFTA 1V3HA 1JL8A 3T2PA 3L4VA 1MVYA 1KR1A 9CGTA 3SCUA 1BHGA 2YFNA 1L8NA 4QFUA 4BF7A 1J11A 1GOKA 1WAWA 3L4XA 1H0IA 1UD5A 1KXTA 2WAGA 2XTKA 1OD0A 2VI0A 2V3DA 1WNOA 5HBFA 2CCRA 3K46A 2A3CA 1QBAA 1ODUA 1UKTA 2YL8A 4ZXOA 3W6LA 3TV8A 5JUVA 2YL9A 3MV01 3WELA 3N12A 4W84A 2V38A 1JZ2A 4XX6A 1B3VA 3N11A 2QHAA 5CG0A 1R33A 1CGYA 4YN5A 4Z2HA 2ZXDA 1QI2A 1RD6A 1CLVA 3L2MA 1LG1A 4P7OA 4GQRA 4OBRA 4OIFA 3BAXA 4F9JA 4AD1A 3HG2A 3G6MA 3D52A 1FFRA 2D22A 4WKFA 4HA1A 1JAEA 3W28A 3BH4A 3VDAA 2XM1A 3HMCA 3RIKA 1CECA 4WKAA 5HDRA 2CBUA 5DT7A 1GOOA 5A2AA 2WMGA 4MNLA 1XSKA 2WLYA 2ZX6A 3AMCA 5IDIA 3QOMA 3CZNA 3ARYA 4QP0A 3PZ9A 1D3CA 3L4WA 3ARUA 4HZ8A 1XGZA 3S6TA 4W8LA 1OBAA 1TR1A 1JYXA 3SCPA 5FKYA 2GDVA 4OZOA 1JDCA 3RDKA 1JAKA 2WC4A 3WN6A 3RO8A 3S2CA 8A3HA 5BXRA 1IT0A 2G3MA 2BHYA 5A8NA 3GXIA 1MW1A 3D50A 5M3WA 1H09A 3CMGA 3VGBA 6TAAA 3VMNA 5I5RA 3AS2A 3EMZA 1J01A 2OSXA 1QNPA 5A8PA 4CD6A 2GUYA 3W82A 2BY2A 1XCWA 2WYSA 3F5KA 5DF0A 4DUXA 1XYZA 1HF6A 3WY2A 1RH9A 4HA3A 1KBBA 3VSUA 3ARQA 1QW8A 3WDJA 1GW1A 5IFPA 3BUBA 1CGWA 3GBEA 3WQVA 3T0AA 4PCSA 3WH8A 2DH3A 1W2VA 4PTXA 3AQUA 1TZ7A 5ECUA 1G1YA 3WMCA 2Y8VA 4JFUA 5EFDA 2HISA 3WIJA 3LPGA 4JKKA 1K6AA 3K8KA 3DHPA 1E6RA 1HJXA 4TVDA 2CEQA 3ZM8A 2EPLX 1W9BM 3AS0A 1OT2A 2X0HA 1HIZA 1UH4A 3VMPA 3H54A 3SCRA 3ARSA 5HPOA 2OSYA 3A23A 4AZ7A 4FLSA 2D20A 2Q8XA 1CXHA 3PZGA 4WF7A 1B2YA 1KQYA 1ISZA 3QR3A 1UD6A 1ESWA 1UWRA 3W53A 1Y7VA 1H3GA 1R47A 2WZEA 2XSAA 3W37A 5BWFA 3KZSA 2XVLA 1UWQA 3WF1A 4D6HA 2UY4A 1X1NA 1MFUA 2UY2A 4MTVA 1KTBA 4P8WA 4P7RA 2UWFA 2A3AA 2IXVA 1LJYA 4BS0A 5HOSA 3VIMA 3HZ3A 4LGXA 3CZEA 3ZQ9A 5BXTA 3EJQA 2XJ7A 4H04A 4J3WA 2J8FA 4DO5A 1E5NA 1GOQA 4HZ6A 1FH7A 1W1PA 2GJXB 3LMYA 2WK2A 4FMVA 4JIEA 2BNJA 2XN0A 3TTSA 3RM8A 4W7WA 2X2HA 5C8BB 2VUYA 4J3UA 4ZENA 1C90A 2WMIA 1M04A 4XV0A 2Y8KA 4U3CA 3PZTA 5BRPA 4UZUA 4B15A 3LX9A 2IUZA 3KLKA 4JCLA 2D1ZA 3WNOA 3LPOA 4AY1A 1K9EA 4KGJA 1PS3A 1OCQA 1QNRA 1UWIA 1RP8A 4AZCB 5A3HA 2G8ZA 2C8NA 1EDGA 1KFWA 3WEMA 3AHVA 1VEMA 2BXZA 3WQWA 3VX0A 2OYMA 5CSYA 2CIPA 3PZNA 3CTTA 1E56A 4M56A 1OINA 1WCGA 5GQBA 3UEQA 3D3AA 2YFOA 4A4AA 1EHAA 1V02A 4HMCA 4UZSA 1B0IA 4QLLA 3WF3A 2FHCA 4LYPA 3PZIA 5A6MA 5BYWA 4NX0A 1NWTA 3UCQA 2GFTA 2GSJA 5E9AA 3A4AA 3BVXA 5CPQA 5C70A 3WSUA 1JZ8A 2J4GA 4FNQA 2VRKA 1KWKA 2AAAA 1J10A 4D1JA 1L0PA 3ZR6A 1W2PA 2IXUA 4U3AA 3IANA 1NP2A 2WPGA 1JYNA 1E1EA 3AS3A 1LL6A 3LRLA 2YDRA 1K9DA 1V3MA 4GINA 4MB1A 3OZPA 3VIGA 4RE3A 4Z2LA 1TQWA 2D3NA 2VZOA 4FNTA 3W27A 3VIOA 2JF7A 3ZJ6A 4PCTA 3B9EA 1ZBKA 1ZU8A 2A3BA 4JKLA 3WNMA 2W91A 2ZE0A 4GPNA 2VRQA 2V3FA 4UQDA 2J8GA 3ARWA 1S46A 4NXSA 3GZAA 3EJTA 4U31A 2BY0A 4GZIA 2FH8A 2DPEA 2YJQA 3SCSA 1IZKA 4CU6A 1LWHA 1V0NA 2RGLA 2YOCA 1SR0A 4TVUA 4AYGA 4XB3A 4H41A 4KRUA 2W92A 4CN1A 3W4RA 1R87A 4AZIA 3LXBA 3WD0A 1J0KA 2QV4A 5A8QA 3SCNA 1C7SA 3ARPA 1V3KA 2ZXQA 4UOQA 3ZJ8A 2VNCA 5A2CA 2E3ZA 2X0YA 2CKRA 2E8ZA 3WD1A 3VGDA 1QI3A 1TUXA 3MV11 3T2OA 2FHFA 3CZGA 4PBGA 1BYBA 2J7EA 3PBGA 2ZUTA 3NIYA 3WUGA 1EXPA 1C8QA 4IPLA 3ALGA 1V6YA 1E4NA 5D4YA 2CHNA 2F7QA 1BG4A 3N15A 5I2UA 1MW2A 3DDFA 1ZS2A 1VIWA 4JL1A 3NSXA 3HJEA 3K4DA 4DWSC 3VSVA 2FH6A 1CBGA 2XFFA 1KGUA 2J7GA 4H7VA 2J62A 2OWCA 4CUCA 1DWFM 5BCAA 4PMZA 3UR8A 2VMFA 1E4IA 4HU8A 2X09A 1U30A 1UD4A 1ISWA 1UD8A 4PMYA 3CHFA 4CD8A 3AHTA 2G41A 1H11A 2FYVA 1E6QM 5I3DA 4AMXA 4GI9A 1UH2A 3FAWA 4A3YA 5CGTA 5A6SA 3S5YA 4UNIA 4BA0A 4W93A 1UWTA 4TVCA 5FD0A 4Y7EA 4P8XA 4V27A 3BC9A 3GXPA 1GORA 4M81A 3BAJA 1UYQA 1JZ5A 1WB0A 4DO6A 3WDPP 4HZ7A 4AZBA 3SCVA 5HPCA 3CUFA 1XRVA 4N42A 2WVVA 3JUGA 3VNYA 1V0LA 4HOWA 2WZHA 1W3HA 3WBAA 1VFUA 4B16A 2XM2A 3ECQA 3ZMRA 2ZX7A 1JF6A 1W1TA 3POCA 4IUGA 2BVTA 3ARXA 7A3HA 4LQ1A 1DP0A 1KQZA 3CHDA 5A6AA 1BYCA 3WEZA 3WMSA 1V6WA 4FNSA 4TXEA 1HVXA 4XZBA 3BXWA 4M29A 4NRRA 1W9UA 3ZT6A 5CLWA 5EFFA 3KL3A 1XSJA 3VGGA 3VNZA 2NT1A 1WDPA 2X2IA 1GQKA 1R46A 2VX4A 3CZSA 5CXPA 3KE0A 2VVSA 5FIPA 1FFQA 2AOSA 4UOZA 4W5ZA 1CZ1A 1JZ7A 3DC0A 1GOWA 3MUZ1 3UETA 4MADA 4U2YA 4P7NA 2WVUA 1TFVA 3AZSA 3CMJA 3VTRA 3K1DA 1PBGA 4KH2A 1UA3A 2YKKA 4WSKA 4PUDA 3PZVA 2JFEX 2WVVB 4OKDA 2VX6A 3L2LA 1W9DM 4CCCA 3GXMA 2VRJA 1W1VA 2VQUA 2WC7A 4UFMA 4QDMA 4PMDA 2D0GA 1V08A 4CCEA 5A1AA 4P7QA 1E0VA 1CYGA 4LX4A 3N9KA 1HT6A 1PZ2A 1XCXA 5A6BA 3K8LA 3IJ8A 4Z2IA 4P7LA 2OYLA 3VD4A 2XIIA 1KTCA 2O9RA 4R5EA 1XYFA 1K9TA 2PBGA 3MI6A 3BSGA 2G3IA 5A95A 4KGLA 1EA9C 3EJUA 1CPUA 4U5IA 3ZT7A 3MMUA 2XPKA 1SZNA 1UKQA 3AHYA 1US2A 2ZXAA 1KWGA 1HNYA 1JIBA 1ECEA 4KMQA 1GJWA 5TD4A 3WMBA 4GO9A 2D0HA 2W4XA 1ISVA 3U7BA 3ZSTA 3GNPA 3BUPA 1HJQA 5I23A 3CO4A 1F4HA 1UR0A 3VVGA 1G0CA 2D23A 1FH9A 1NWSA 3J7HA 2QPSA 1E72M 3K4AA 2Y24A 3H53A 4AZGA 2F18A 2CBIA 3N17A 3AHZA 1NWRA 1E40A 1O6IA 1EOMA 1MQQA 1JD7A 3GH5A 4TX8A 1H5VA 2XSBA 1WZKA 3WBEA 1UQZA 1MWOA 3HN3A 4AD0A 4GI6A 3N13A 2EPKX 3CIVA 4TOQA 1YHTA 3BVWA 4E4PA 1QHOA 1UHVA 3D51A 2YA0A 1LQ0A 4J7RA 2WWCA 2BXYA 3PZUA 4IPNB 4DUVA 1A47A 3A47A 4L4PA 1G5AA 4TTUA 4XUYA 5BROA 2ZIDA 1JD9A 1W9VA 3TA9A 4A3HA 4ZE4A 1NH6A 1M53A 2WVTA 1M7XA 3PTKA 5LA1A 1HJWA 5A6JA 3O9NA 3OG2A 1HL9A 3I3DA 3BLKA 3DX1A 3NDZA 2D24A 3VDBA 2ZXBA 1BG9A 2E9LA 2EACA 4P8UA 3KLLA 1UKOA 3CZ8A 3AHXA 3VINA 3OGVA 4F8XA 3OLIA 1X6NA 2BS9A 2JF6A 3VGFA 4D6EA 2Y4SA 4AZHA 3TONA 2GK1A 1KBKA 2BHUA 4BQ3A 3WF2A 3GNRA 1B90A 3CLWA 2WANA 3ZSSA 4W5UA 4HMEA 4PSRA 4M8UA 2C0HA 4D6FA 1B3XA 2X2YA 2HVMA 1PX4A 4PSPA 1E4LA 4PMUA 3WH6A 4EK7A 2XVKA 1MQRA 1CXIA 4CCDA 5LYRA 3L4UA 2GDUA 2E40A 3G6LA 4W85A 2XHYA 3ARTA 1JG9A 5KZ6A 5FOOA 3WY3A 2OLHA 3APGA 2WBKA 1T0OA 2EEXA 3VIPA 4F79A 3FN9A 3TTQA 2J79A 3AZTA 4AD2A 4UTFA 4MNKA 1ISXA 2W62A 1R85A 1GOMA 4NZFA 2PF0A 3VIIA 4DM1A 5M17A 5DFAA 1AQMA 3CPUA 2F2HA 3OGRA 5A69A 3A21A 1WDRA 1UQYA 2EO7A 5I79A 3BAWA 1MYRA 6A3HA 3SEPA 4CU8A 1JFXA 5EB8A 3L4TA 1J0IA 4MNJA 1GQLA 2GJRA 2YBUA 1JYVA 2QMKA 2D0FA 1BLIA 4MPKA 3MUIA 3MS8A 1CENA 4PMRA 1NM9A 3LXCA 1GONA 2PWGA 1V3IA 4NI3A 1H0GA 2YDSA 2WNWA 2JEQA 1DTUA 5CSUA 4JZ5A 2BY1A 3CUHA 4Z2KA 2DH2A 4BQ5A 1QWNA 4W88A 2ESCA 3RILA 2XFRA 2UY5A 1HP4A 3PZQA 2EABA 1U2YA 3U7VA 5LA2A 2EBNA 4OGZA 3THDA 5CGMA 1NOFA 1Q4NX 1K9FA 5A2BA 2EPOA 3FNDA 1CTNA 2W5FA 3IAPA 1MW0A 1E9LA 1EQPA 1GJUA 1D7FA 2XUCA 3DX4A 1WP6A 4UFHA 3ZO9A 3A6OA 2XIBA 3CV5A 1E3XA 2OWXA 3OBAA 1V6XA 3BSHA 3VX1A 4JL2A 4FNRA 1EOKA 1WDQA 4DUWA 3CHEA 4MB3A 4F66A 2PBOA 3S5ZA 2J7BA 3UESA 3M7SA 1VEOA 4HOXA 4W8BA 4PN2A 4E8CA 4KWUA 1WDSA 2J7CA 3QHNA 1EO5A 1W3LA 1XH2A 4FNUA 4D6CA 3VMOA 1VAHA 4AD4A 3CZKA 3AMDA 1H49A 3WD2A 1GVIA 1JZ6A 4EAMA 1HX0A 1QVBA 3WDQA 2VX7A 1A3HA 3B9AA 3WDRA 3AXHA 1E71M 3LPFA 3CZJA 2VL4A 4D71A 2G4FA 5ABHA 4X9YA 4U5KA 4UQAA 1VENA 1QI0A 4CVWA 1C8YA 4C7FA 3POHA 3O2LA 5JBDA 1R8LA 1I1XA 1UD3A 4W87A 1E5JA 3WENA 3HG4A 2YLLA 3N1AA 4Q7NA 3AJ7A 1BTCA 2WMJA 4CN6A 3AICA 1WZLA 3D4ZA 1PX3A 3M6DA 1OIMA 4PRWA 3VIKA 5M03A 3M46A 4NF7A 1NOUA 1OGGA 4UFIA 2E0PA 3ARVA 3AIRA 3MMDA 1YQ2A 4MDOA 4BQ2A 2WKGA 1N82A 3BVTA 1HXJA 1Q6GA 1I1WA 3VD5A 1CGVA 3GH4A 4CD7A 5E70A 1HKMA 5E0FA 3L4YA 4UFLA 2EPNA 3RMEA 1OWQA 3SUVA 5E6YA 4GZEA 3ARRA 3FAXA 1Q6EA 5F7UA 1VJSA 4AW7A 1CXKA 2EXOA 4W86A 1JFHA 5BXPA 3WD3A 2VX5A 1SMDA 1BF2A 1TG7A 3OGSA 1C92A 4H8VA 4V28A 2OYKA 2FHBA 3F5JA 1KGXA 4FK9A 2WMHA 4DM2A 5A6BD 6CGTA 1JXJA 3VSTA 4B9YA 1HJVA 4QCFA 5EBAA 3FXYA 2CKSA 1FH8A 4ACZB 2XWDA 1PEZA 1E70M 1GCYA 5JBEA 1IV8A 1PIGA 1W91A 1OT1A 1ZJBA 3BVVA 3SUUA 2VZTA 3SCQA 1W1YA 5I24A 1E6SM 2VCCA 1IZJA 1JF5A 3EMCA 4WJXA 1CIUA 3ZJKA 3BUDA 1E0XA 2YIHA 2VOTA 4EKJA 1XH1A 5D9PA 4E2OA 1OGBA 3II1A 4GI8A 3T0DA 1PPIA 5I0DA 2YDQA 4H8UA 2CERA 1NWUA 1UZ1A 2GK1B 4AYSA 4B3LA 2F7OA 3CBWA 1XD0A 3GTNA 2DSKA 2CYGA 2VR4A 5CLTA 2OSWA 1JDAA 5IHSA 2ZICA 3AIQA 2PWEA 1NQ6A 2ZUWA 3BLPX 1OB0A 1EDTA 4PMXA 3VOCA 4J3VA 5DO8A 2EADA 2BVYA 4WLCA 1NOWA 1QX1A 4OJYA 2FDMA 2WZIA 5CPSA 4PTWA 3BCDA 3VIFA 2BY3A 5IXEA 2NW0A 5EMYA 1HXKA 1M01A 1BVNP 3ZJ7A 3MKKA 1XHGA 3L4ZA 1MQPA 1NARA 1JNEA 3AZRA 1BAGA 1MXDA 1R75A 1FHDA 1OM0A 2DT3A 3MMWA 2B31A 1US3A 2PWHA 5IHRA 4AMCA 1ZB5A 3ALFA 5KEZA 1QNOA 4BCEA 3AIUA 2DDXA 4GO8A 4FF5A 4ML4A 3NCOA 4K68A 1LG2A 3NSMA 1HJSA 2Z1SA 1J0YA 3WQ5A 2Y5EA 3TTOA 3EJSA 1VJZA 1KB3A 3AMGA 1KXQA 3BVUA 1I75A 4R27A 4DWSB 4AZCA 3F4VA 2PB1A 4U2ZA 5FL1A 4WKHA 1E6PA 2ZWZA 2VO5A 1G01A 1LWJA 3EYPA 1J12A 2QF8A 1BPLB 1UASA 1UD2A 3WUEA 1WZMA 3HU7A 3SUSA 3EDDA 5JIWA 3DYOA 4KRTA 2ALWA 3GBDA 4JFWA 4ATWA 3F5LA 2F1AA 4DWSD 3THCA 1SFSA 3K8MA 2D2OA 2XWEA 5A94A 4LYRA 5A8MA 5CJ5A 5ABFA 4C7GA 2DSZA 1V3LA 1CNVA 2OWWA 4YPJA 1UWUA 4JAWA 4UR9A 1CXFA 3OZOA 4MJ4A 2YL5A 5GNZA 3AIVA 2Z1KA 4HU0A 4GKLA 3DHUA 2WHLA 3T08A 4JFVA 2WM0A 2FGLA 4DWSA 1V6UA 1Q6DA 1V0KA 1V6VA 3OLEA 5A6KA 3WY1A 1TVNA 2O9TA 4ZXLA 2XN1A 1UWSA 1BGAA 3RPMA 3MU7A 1MXGA 1TQUA 3W38A 1FOBA 3RM9A 2VVNA 4AC1X 1QI4A 2GJPA 2WKLA 2FE0A 4JCMA 1VFOA 3SIMA 2F7PA 3M07A 4V2XA 1UR1A 4ZFMA 1C3FA 3AOFA 3A3HA 3VGHA 1QNSA 3WH9A 4UCFA 3WL1A 4GQQA 3CGTA 1WPCA 1QHPA 4GZJA 1TCMA 2E9BA 1Z32X 1VF8A 3NDYA 3SUTA 1BQCA 1PX8A 3WEOA 3WNLA 4YHEA 1TQSA 1C8XA 1GHSA 1OD8A 3WQ8A 2YLAA 4HMDA 3BUIA 1JDDA 3GXNA 3CH9A 1E55A 1LF1A 3PTQA 4MB5A 2WCGA 5I77A 4HP5A 5D9NA 2W67A 4PEEA 1H4PA 4AEFA 1B31A 3WF0A 2J7DA 1WZAA 2D3LA 2FGZA 1OGSA 3VO0A 2X05A 3EBVA 3FY1A 2WHJA 3AFBA 2ZUUA 3VM7A 4MB4A 3AIWA 4C7DA 3W24A 1BVZA 3OLDA 1OSEA 2DSVA 4AWEA 2VTFA 3ZOAA 1VB9A 2IGTA 3W6MA 3PZOA 2ZUVA 2ZX5A 1VEPA 2ZUNA 1CGXA 2CETA 1ISYA 4AXNA 2WW5A 3SCTA 3MSDA 3GXDA 3RJXA 1E0WA 2ZX8A 3SURA 2WXDM 2EPMX 3W0KA 2OW7A 4ATDA 3LRKA 2BV9A 5GNXA 3I3EA 3VUPA 1ITCA 4MDPA 5E1QA 3I3BA 4MJ2A 4U33A 4NZCA 2J74A 1WE5A 1ODZA 3OB8A 2CNCA 2O9PA 3BMVA 3BAYA 4AIUA 5I6SA 1JXKA 1O7DC 2WCSA 1QNQA 2VC9A 3HG5A 3TP4A 3LPPA 3PZMA 4RL3A 1W9PA 2WBGA 1H2JA 1TQVA 2A3EA 4JHZA 2WB5A 3W26A 1EHNA 4ATLA 1C91A 3A4XA 5E09A 3W81A 3IJ9A 3EJPA 4P8VA 4AD5A 3IK2A 3PHAA 4CD5A 4Q22A 2WMKA 4J3XA 3MANA 2CITA 4CD4A 4AISA 2BHZA 1UR2A 4NSBA 1PAMA 1UG6A 1VFFA 1J18A 2WC3A 2PI6A 3WDIA 2XFYA 2JIEA 1QW9A 4UOJA 3AIEA 3CUGA 4OBSA 1DHKA 3MUAA 1VRXA 2ZWYA 3WD4A 1BGGA 5BXSA 3VD7A 2XG9A 1HWWA 1CGTA 1RPKA 5AYIA 2VCBA 4MNMA 1CGUA 1EO7A 4PTVA 2XVGA 3IGUA 3MSGA 1LL4A 4D72A 2F1BA 3VGEA 1PIFA 4W89A 4HPHA 4EE9A 2W63A 5AC5A 1E6ZA 1UUQA 1JZ4A 3B8SA 2WVSA 1OIFA 1JNDA 1ITXA 2XGBA 1U33A 1QBBA 2X1IA 2DSUA 3ARZA 4FNPA 4D1IA 5LA0A 3WUBA 5GNYA 5A6LA 4J3SA 4FLQA 3KEHA 5FL0A 3A22A 5ABGA 1VBUA 3EMQA 3A24A 3BMWA 4IM4A 4JKMA 3U5YA 2J7HA 4AD3A 3AYRA 4NZJA 4S3KA 1C93A 4TTGA 5CQ1A 1BFNA 1O7AA 2EJ1A 3T2QA 4M82A 1CXLA 3HG3A 1QHZA 4RE2A 4E8DA 2DT1A 3NUKA 1M03A 1P6WA 4HA4A 4CGTA 1GQIA 1WKYA 2A3HA 2C7FA 4WSJA 2ZUMA 4HPGA 7TAAA 1HP5A 2WLZA 5DT5A 1DWHM 1B9ZA 2DQXA 1DEDA 1XSIA 1B30A 3DYMA 5E0CA 3EDJA 2WWDA 5D8WA 3B9DA 1HL8A 1ZBVA 5ABFB 1MFVA 3WH5A 4HOZA 1HTYA 3A4WA 2VQTA 2XVPA 1V03A 2E9MA 3DX2A 5D9MA 3AS1A 4X0VA 3DDGA 4W7UA 1TE1A 2V5DA 2QPUA 3DYPA 5FCZA 2VJXA 4D6DA 3SCWA 1FHLA 4ZEPA 4AIOA 4LPCA 1TA3B 4UQBA 4YHGA 1BYDA 4UQEA 1R86A 1GNXA 3SUWA 1E6XM 1ZL1A 1CEOA 2QLYA 1W9XA 1F4AA 3OLGA 4OOZA 4F9DA 5AYBA 3VIHA 3QHOA 1JYWA 4S3JA 5DEZA 5JBFA 3KWXA 3WNPA 1LL7A 3GH7A 4JHOA 3KL0A 1UR9A 2J77A 2WCAA 1DWJM 1EDQA 4J28A 3TOPA 1E15A 4TX6A 4H2CA 3VDHA 3GYCA 1Q6FA 3AMKA 1CDGA 3GXFA 3N18A 1DWAM 2WSPA 2W66A 3EDFA 3OA5A 4PTMA 1J9YA 4PMQA 1GZJA 4PYSA 3PN8A 2ZOXA 1J0HA 1TQTA 2CPUA 2BVDA 2MANA 5CPTA 3DX0A 1PZ3A 3N04A 2QMJA 1UA7A 1E1FA 3LRMA 3AIBA 5BRQA 3CHCA 1J0JA 1HJUA 2WMFA 1W32A 3WQ6A 3VU2A 3IAQA 1GQJA 2V5CA 1UZ4A 4LYQA 1DWGM 5E6ZA 3WFLA 3IJ7A 4UFKA 3LXAA 1J0ZA 4FLRA 2YL6A 2CESA 4DO4A 3AISA 4GXPA 5GPRA 3AMLA 5DMYA 3GNOA 1BYAA 8CGTA 2AMGA 1ZJAA 4ACZA 4NXKA 1UOKA 2DSWA 1XD1A 5AC4A 5AY7A 2YA1A 1WO2A 2F61A 4QAWA 4Z2JA 3ZT5A 4L4OA 4UQ9A 1AVAA 3BLBA 3D4YA 3FHAA 4CVUA 1GVYA 4AEEA 2WHKA 3AYSA 1MW3A 4IISA 4D6GA 1R7OA 1HVQA 1RP9A 3OIHA 1AQHA 1TA3A 2DEPA 3FHQA 4JFTA 1E6NA 3WDHA 3CZLA 1CLXA 3WKZA 4W7VA 1VBRA 3BAIA 3U5UA 5M5DA 1ZBCA 3QOKA 2VR5A 3U57A 3UG4A 4OOUA 1EH9A 1XC6A 1GOIA 4N0RA 4ZE5A 3WNKA 2J25A 4J27A 2VZUA 4W8AA 2O9OA 3DECA 4LXFA 1EGZA 4B3KA 5JIPA 1R34A 4URIA 2J7FA 3VILA 3WL0A 1FA2A 1JGIA 3GXTA 3AI0A 3UG5A 1H1NA 2DGAA 1SMAA 3EDKA 7CGTA 2V3GA 2XVNA 5I78A 3SCOA 3E1F1 1KR0A 3WQ4A 1B1YA 1LLOA 1Q6CA 3A5VA 2XN2A 1UH3A 1C7TA 2XYLA 3D5HA 4UQCA 2CHOA 2G3NA 2E4TA 4J3TA 3BGAA 4M80A 1B3YA 2GJXA 4M24A 1E3ZA 2J75A 1V0MA 5C71A 2JE8A 2NT0A 3KL5A 1KCLA 2WSKA 3BUQA 3W29A 1E73M 2CBJA 1KCKA 2VT0A 1FP8A 1X6LA 1HKIA 1V3JA 3EJRA 3RCNA 3WUFA 3DX3A 3WFZA 1W3KA 3UERA 3AXXA 1QPKA 1UR4A 2CBVA 2OW6A 4D6JA 2F7RA 2O92A 3NYDA 2X8RA
chains in the Genus database with same CATH superfamily
3QNZA 3SZ8A 4NNYA 5KOVC 3VOJA 2PF6A 4MWAA 4LSQL 3SBQA 4H9YA 5LIUX 1KY7A 1P5VA 2D7OA 2EVJA 3NSNA 2NMSA 4ZUWB 4GJIA 1KXVA 1PJ9A 2ADIB 2D7PA 3ILQC 3ZKND 1O1HA 3M43A 2XPGA 4AXKA 1S7RA 4IOFD 1CD0A 2ZX9A 5KYWA 5F3HA 2GBUA 4AOFA 2YAMA 3HE6A 4ONOA 1KFBA 3WK3A 3CUJA 3V7MA 1M05B 5GJTL 2CKBH 4L5FH 3VC6A 3GUWA 2P1FA 4PRHA 3MCOA 4FOUA 4LEQA 3W1UA 1YMMB 5FR3A 1XO8A 1PKQE 2J24A 4FIRA 5D8ZA 3ECBA 1UM4H 2ZRZA 3G08A 5D7JA 4FFWD 2WXPA 2KZBA 4PJAA 4ZS6C 3UWVA 1IYXA 4X7DC 1F86A 4HTYA 1UC4A 2P5WD 5T33H 2B4CH 1N8IA 4O52A 1ZE3C 4X8XA 1X5MA 3SB3A 1FWIC 2YD8A 3KS0H 2ITCB 4Y5XB 2VAAA 4TULL 3VM5A 4FTVB 4AWTA 1QSEE 4DVBA 4KJYB 4EZMA 5KVDE 3P73A 5G1YA 1NM4A 2R0KL 1UCBL 5BOPA 3KXFD 3EGSB 4QUOA 1VRDA 2WHMA 1RUQH 5A2LH 5IBXC 4LLYA 3WJMB 4JM2C 3EKGA 3PTMA 4C6KA 4QHMB 2DTML 3IRZA 3UAEA 4N2BA 1ED3A 1T7YA 1KCXA 3SQLA 5ABAA 5EH1A 5B1JA 3FS2A 1Q9OA 5E8DL 5DYOA 4RDWA 5EO1B 1ECYA 3PWJB 3PWUA 5TPWH 5DD3H 1N6VA 3W74A 2EH8L 2MQCA 1QRND 3PNWA 5J4MA 3O6AA 4D6EA 1W3JA 4X8JA 2NUTB 4LL1A 1FAKT 1KXHA 3NQCA 1U8IB 3D0LA 2DT2A 2F0CA 4ZUWA 3FW6A 5CKSA 2WSQA 1J1PH 3MNWA 2XLLA 5E1AB 4YXHH 4PCNA 3CC1A 2VQ1B 2JIWA 3UJFA 2DQCL 4O00A 3K2GA 5IMMB 2D31A 1B6UA 3GRBA 4G3YL 4XVSL 4HETA 2V9RA 1KJVB 1HHKA 3VIJA 2ZYHA 3GMMB 4N0YL 3IGHX 2G2RB 4RZCB 4ZAKA 2QR6A 1PKQB 2W95A 1OOAA 2BBFA 2ORBH 2B7NA 2BNQB 2XYCA 3CPLB 2CDEB 1I9JH 3VPLA 2JK5B 5A7EA 1OCCB 3E8UH 2XSKA 1DFBH 4CVZA 3AXIA 2A7RA 4UTIA 4EPEC 3QNXA 4M1RA 1A7RH 3QWNA 2QQLH 2FEJA 4UT6A 5IK3A 5L9FA 3IMSA 3W2NA 4Y16C 3NJ3A 2B5IC 1TVPA 3B43A 3DSNB 4H8HA 5GIRB 3V4PB 3WY4A 4ALAH 4QE5A 2QEZA 1NP0A 4OVVA 3T0XA 3KPSA 1PW3A 2DB8A 4LPUA 4AJ0A 1UXMA 1EC7A 4YO0B 5DCEA 3SKOA 3QFJA 4KTDL 4N2MA 1BQLH 1Q1JH 3JXAA 4JM2B 1V7AA 3AROA 5E94B 3CLEL 3QH2A 3I9IA 3KBMA 3UG3A 4MMYB 2CXGA 3BO8A 4ECNA 3WEXA 1U8JB 3LNMA 4HHWA 2XRAL 1UUNA 5ACLA 2ZNWA 3DO7B 1TZ8A 2ZZ5A 3UTSD 1G9HA 3E2SA 5TTRA 3AC0A 5J11B 1KRMA 2BG5A 2IWFA 2F8OA 3MB9A 4OZHF 5I18H 5I9QC 2VCAA 2VL5B 2JH2A 3O6KH 1O75A 4GAYA 2XTJC 3IK4A 5D7LB 4F2BA 1Q2SA 3Q06A 4XX1E 1SJEA 3VI2A 1AQ0A 3H42L 4X99A 3WE6A 1AGEA 3TMQA 2DIKA 1W2KT 5C08D 3LKOB 2BNRB 2X1XR 1DQJA 3FU8A 1WAPA 4JFSA 1JULA 3VXSB 3B9KB 3WNNA 1Q45A 1NZRA 4OFKA 4IL2A 1AAJA 3FQ4A 3NRQA 1F3WA 1ZA3A 4QTIH 3JV6B 4WU7B 4JK0D 3EYVA 2Q0ZX 2ICWJ 3UZJA 2CC0A 2I7GA 1B2WH 3ZDYF 5AYYA 1VGEL 3HRPA 2P76A 1FWTA 3UR7A 5ABZA 5BMXA 4HPOH 5D9SB 2CO6A 3CUIA 4RCAA 2P88A 4NO0D 2XH7A 3WKNA 3V6BR 3EEZA 5I07A 1K8YA 4ANXA 5J5DA 4FHJA 4LDLB 2QAFA 1IKOP 4FYRA 2WMIB 2H7WA 2XH2A 3HPSA 1AGFB 1KB9J 4P5MA 2YR1A 3TU6A 3EFFB 5G55A 2ZCKH 3UP1A 5K7JA 2W0FA 3U36A 3NFUA 3WQDA 3GGWA 3IDMA 5F70A 2ZRWA 5J13C 2OMYA 4M7ZB 4M93C 3ARGC 4E5TA 1V3HA 3KPQA 3T2PA 5I6XB 4YNYA 5AVQB 2HH0H 1BHGA 4KCVA 3N34A 3BWUC 1S9YB 3QIBC 4KRMB 3GSUB 3ZVVA 2Y22A 4H9UA 3PBWA 2OM5A 1R3KA 2WLLB 2A73B 4H0IA 3ABOA 1QSFA 3RXZA 3CFJA 1E3FA 2VEIA 5DHXB 5I1EH 5CUSL 1RULH 3BJLA 5DRNB 3WFEL 1GOKA 3UZYA 3VXQB 3ZE2B 1LP9E 2CO1A 4RAUA 1C9DA 5KWYC 4Q6JA 4LRIC 5DANA 5G2HA 4JIIX 2JELH 1UD5A 1MHEA 2R0ZH 1KXTA 3RG1C 4DVRH 7FABH 1T96A 3PNUA 5J8LA 4LB8A 3IN2A 3DTXA 3F65A 1DE4A 3JVGA 5IY5B 1JEZA 3VGAC 4UMBA 4AVNA 3PV6A 1FFPA 3QFGA 5HBFA 1ZGLM 3RY4A 5D2LB 1G4PA 1MUCA 5DR5L 3T4AC 1XSOA 3E38A 4TV6A 3K46A 2MHAB 4Z76B 3ABRA 3IGSA 4DPBX 2YL8A 2DS4A 1HSBB 3T1WA 4ZXOA 5DVMA 3LD5A 3TV8A 3W6LA 2H3NA 1E6OL 3N91A 2BODX 3PCYA 3OQ3B 2YL9A 4PJDA 3W39B 3M1BA 4FI7A 3STZA 4I48A 4FYTA 5IVNA 1K4CB 2CM6A 5ITBH 2V38A 3INPA 1U6AH 3KS6A 1JOIA 3D39B 2N1KA 3PG9A 5DRIA 1KCSH 4Z7UF 5AYUL 15C8L 1CGYA 1YXCA 2GL5A 4G1EB 2ZXDA 2ALDA 1U8HB 1ES0A 2DQTH 3Q5YA 5M95B 4P5MB 1RD6A 3H12A 4URTB 2C1OA 3H85A 4Q2ZA 2Y36L 3VXGA 3PBUA 1U58B 4OBRA 2MCPL 5E5UB 3KVJA 1IX2A 4PY8J 2YQBA 1VLWA 3S8HA 1WK0A 5XIAA 1S5HA 5E6RB 1UJPA 1FFRA 4XZIA 2ZFAA 3OR6A 5FDYA 4G6KH 4MJ6A 2QAPA 3W28A 1SDDB 3UTZB 3BH4A 5FV2A 5GRVK 2Y7EA 4XCFH 4WKAA 3NZUA 1G6VK 5HDRA 4OV5A 3SE3C 5LWYL 2C79A 5DT7A 2WMGA 5GS0C 3OR7B 5GGSY 3AWNA 4ZPVA 3S0CA 3A13A 9PCYA 5JZ7C 3AU1B 4MNQA 3FGCA 3NIDF 3BQ5A 5HDOA 5I1AA 1Q0XL 3P4MB 3QISA 4BQCA 5E8DH 4QP0A 1NDVA 1E9YB 1D3CA 1OK8A 3T6VA 3FQRA 3VYPA 2BTMA 4GUGA 2L0DA 2Z4QA 3ARUA 1KZQA 3DX8B 5DMIH 5BRBA 1XGZA 1KC7A 4D3CH 3FX4A 1TEGA 4W8LA 1OBAA 4OTXL 5JIDA 3SCPA 4UINH 2FYYB 3REVA 3S37L 1SFTA 3A4FA 2TRYA 2OBGA 4LLMB 4JFXB 4XP6H 3WFHA 3SRFA 3MO1A 5LBSL 2J4WL 2WC4A 2Z27A 1HIML 3NJKA 5DT1H 1J5OH 3PUCA 5ALBL 1NFDA 2QZQA 3CFQA 4JFDB 4S0TD 2WOYA 4EUPA 4GYKA 4XZMX 1HTIA 4A37A 5C7VA 5A8NA 4CNIB 4G3YH 3GXIA 2BIOA 2YBRA 3CMGA 5CPNA 2B59B 3W0WE 2FVMA 6TAAA 3KZPA 3KR3L 1FO0H 5CLZA 3VMNA 2VXUL 5I5RA 3QQ9C 3EMZA 4R2GD 1J01A 3IPBA 4B3EA 4AX6A 4QSFA 3RR1A 4NQCA 4RGNE 2VDLL 1FPTH 2ENPA 1UW9A 1D8WA 1W54A 4CD6A 4WHTA 4FXKB 1I60A 2Q86B 4G8EB 3QEQA 4ODUB 4XNMB 1DPMA 1E7UA 5EORH 3PUEA 3DRTA 4EBQL 1LORA 3F7JA 1HOCB 5F2LA 4AK2A 1KA9F 1HSBA 4LEXH 4LALA 1GK8A 3W7HA 2WYSA 5FO2A 1OZUA 3MXVL 4QRSA 4XMKL 4GP5B 4XXDB 1UADC 3WY2A 1RH9A 5AYZA 1GQNA 1SQ7A 4ETQA 1SPDA 4R4ND 5IVXE 3QXAB 2ZCLL 1HEJC 1AGBA 2R1PA 2Y1YA 1HILA 4N2IA 4M8QB 3ISIX 4AHQA 3ARQA 4AXWA 1QW8A 2WD0A 2QSTA 1Z9LA 4IEFA 1AHWA 4XBEL 3WDJA 1GW1A 1H63A 3I7SA 2PCQA 4UTTA 1JPGB 4HZMA 4QRFA 4R0LB 1FORH 1R3SA 2YD6A 2O56A 3IV8A 4OV9A 1CD1B 1W8OA 1L6XA 3MJYA 5GZOD 1FLRH 1NC2A 2YQ2A 4KW2A 4I85A 5PTDA 1ZLDA 2QQ6A 2KT6A 5DZVA 4G8FB 5AG8A 3QC3A 4KC3B 4LP8A 3C4UA 1Q9LA 3C0QA 2NX1A 2TSBA 4XNUH 5AVYB 4W6XB 1ME7A 1R3VA 3L66A 3TQVA 4C5YA 3SBFA 1WC7B 1HKWA 3ZTDC 4ELKA 5KZCD 1WT5C 4JTTA 2DDQH 1CZ8H 3OQRA 2H41A 4AG4H 4HNUA 3H2NA 3GDTA 5D1QD 3IE9A 5HYQA 3CXFA 5DHVB 1NIEA 1E65A 4TLSA 1NAKH 5FS5A 3S34L 2YK1H 3T65A 4A7GF 4NM8H 2FJUB 2I9TA 3ATDA 1KJ2B 1TJ0A 1QKZL 3LV3A 4XI5D 5F7HA 5LXEA 1V4YA 4AUYA 3P93A 2FNWA 1XQLA 5ELIA 5I1AB 1NBZB 4P04A 1M7OA 3W9EB 2FMNA 3NQGA 4U28A 3SKMA 3KM2A 3K8KA 4FG6C 1LE5A 4TF4A 1VC4A 3MCKA 3W7GA 1E6RA 1VFAB 1C5DA 2Q9OA 5B3SB 3QJFA 1YXDA 5TE6L 3EYSH 4NBYB 1JZDC 3L23A 3G1RA 1W9BM 3U1QA 2YWYA 3QZNA 3KLHD 5GS0D 1HIZA 4CMHB 2PGWA 2NLIA 3SDCC 3NQVA 4DAFA 3FKUS 4PFMA 3GMMA 3RNQA 1KCUL 3JWDH 4P4RB 2P5WE 5D70H 1VA9A 4MMWA 2D20A 2X1PA 4IRZL 4MPQA 5HJYA 4A2RA 2PCPA 4UYPA 1ZHAA 3SO7A 5CEYB 2OL3B 4JTDA 1QYGH 5DQJB 5D93C 1J9CT 3RX2A 4AAJA 1K4DA 3LQGA 1LEIB 4FCHA 1ISZA 3BIKA 3QR3A 1UD6A 1F11A 1UMLA 4GKZA 4E9TA 2QDDA 2WXHA 5H94B 3GDMA 2IWEA 5KTEH 4P2QA 2CIIB 2WZEA 2C9UA 4Z5RB 1Y5VA 4AB4A 4RW3A 3WGVB 1RJLB 3DFQA 4GSRA 4XCNA 4GX9A 2QGEA 5BWFA 1JV2B 1PEWA 1ZHLA 4M03A 1T4KA 4YBLB 4LLYB 5DSCB 4MA7H 1FBIL 4MSWB 2UY4A 3WF1A 3CFCH 1CICB 5K9DA 1ED3B 2C1PA 5FEXA 2F54A 5F9OH 4OQVA 2UY2A 4JKNA 4P8WA 2K6WA 1RUKH 2AV7B 1JQVA 2I9TB 3GIZL 4G9FE 5FJOA 1TZIB 5HOSA 4W4NA 2QPEB 3VD2A 3VIMA 5LNRA 4LGXA 2R69L 3SOTA 3JTSA 3GG0A 3EGDB 4G7VL 3CZEA 2PTVA 4JFFE 4GMTH 3WS3B 5H35A 1UBPC 2BGNE 1QHQA 2TRSA 4PMFA 2AQWA 3BSMA 2O5XL 4H04A 1YG9A 4YZFE 2NW3A 3Q37A 1WGOA 1QWGA 1XF4A 3TCEA 5KN5A 3QIUC 3GHUA 4J2XA 3CE1A 1MFCL 2DLFL 3SHSA 3SJ3A 4L8DB 3O15A 3AJXA 1GOQA 3HPJB 3CHVA 3IJEB 2BWQA 1CLZL 4G8GB 3BJSA 1DQJB 3QJXA 4L9LC 2YXXA 2ZKHH 5SX5K 5FUCC 4K23L 1IBGL 5EZJB 4JIEA 2VN7A 2HFFA 2XN0A 2IALB 4IRSD 4XBPB 4AVJA 4C6IA 2I60H 2FWSA 5IHUL 4KO5A 4JAMA 3IIOA 2CO6B 2X2HA 4MWAC 4NAFA 3JZEA 3B0PA 4J3UA 3F2CA 1E7VA 1X5ZA 1OPGH 2WMIA 1TPFA 2Y8KA 4JZOB 3R58A 2ESVD 2OMUA 4FHBD 1GC1C 3LQAC 1BWKA 2ISFA 3RA7L 3KLKA 1F1DA 5EMJA 5CR1A 5E2TL 5FWQA 3WKPA 5GGTL 1CE1H 4AY1A 3L2IA 1PS3A 1VHNA 5D2LF 1UWIA 4IFKA 2Z00A 4JTRA 2G8ZA 1EDGA 3ES6A 4U6HA 3KPQB 4LCQA 1T5XB 2JVUA 2NX5D 1FFOB 2X9XA 2DQJL 1VEMA 5KVFE 3OKMB 5DI8B 4YHZL 3CDCA 5DEGA 3BFOA 2XWJB 3HLAB 4MA3A 2OYMA 1MCJA 4TMCA 1EV2E 3P3TA 6ALDA 1E56A 3MLUL 2VLRE 1OINA 4QHUB 2HVBA 3QI9B 1OSYA 2LLNA 4JM0A 2VDKB 1X7FA 4HMCA 2V2XA 4LCCB 1BPVA 2WZPD 3G1HA 2CGRH 2VMCA 2J27A 5CJBA 1G7IB 3LEPA 2VDOL 3PZIA 3PPSA 3D69A 2VERN 3PDGA 5F9WB 5BYWA 4AYMC 2FD6H 2MHAA 2BC4A 3HV9A 5DUJA 1KFKA 1EVTC 3FF7A 1FYTB 1IBHA 2EIDA 3MV7D 1OARH 4KQ3L 4L3EE 3WFDH 4AGLA 4C4BA 5I2IB 4NKOB 4R7XA 5CPQA 3UPBA 2YXGA 3MDJA 1HYSD 4Z7OE 2J4GA 3ERXA 4D0BA 2ZYFA 4NENA 3U2EA 4D1JA 1MIEL 4JFZH 1K4CA 3ZHLA 3WYZA 4J3BA 4U1JA 1ADDA 2IXUA 3CL7A 2XG4B 3TSMA 1GZHC 3CN0A 4ERSL 1GKQA 3QC5X 4WFED 3G9AB 3PB2A 3QDJA 1NP2A 2WPGA 1P4BL 3WJLC 3OKEA 1P48A 3NEOA 3RYSA 5I5JA 3QNYB 5CGYD 4ELDA 1LL6A 2WJEA 1A66A 2YDRA 5CC6A 3NCJH 1RH8A 4LLWA 1K9DA 2QPXA 3UQNA 4I2XE 4KNSA 4HX1B 3S3PA 1U21A 2IFFL 3HMXL 3N6JA 1MFDH 2X4OB 2XWCA 2PUZA 4GUIA 3GHSA 4WDXA 3L9YA 3D2UB 1PE1A 1VCGA 2X7VA 3BPCA 2ZOOA 3TN4A 3UGEA 3JBG7 4BJLA 2B15A 4JKLA 1PZDA 4HWNA 5F96L 1K02A 4GPNA 2VRQA 5A43C 1DSFH 5DRNA 5JHMA 1LD9A 3MRDB 4PJHE 1THFD 3UAJA 3CSTA 2IAMA 2ZA3A 3QEZA 3PHOB 3FCSA 2EEDA 2AJXH 1T5WA 2ZOUA 4WOZA 4YHLH 2HKFL 2Q02A 4CD7A 4DP4X 2CR3A 3S34H 3F01A 3QUMA 4POYA 3B9OA 4M1GH 3QXTA 5F44A 3GD6A 4DBDA 2R23B 1TQXA 4QO1A 2QUMA 4MVAA 5DK0B 2GCYA 3ESOA 3UVAA 2NUPA 1PHWA 5CJOH 1OQOA 1RCQA 4J4KA 3MUGB 4LJ3A 1J5HA 4ZSUA 5ENWB 5I6KA 2HRHA 2Y5TA 4RWYL 1IZKA 1MF2H 4F2ME 5TE6H 2K8QA 3V16A 1DUZA 4OD1H 3IDXH 3QYNA 4TVUA 3RBGA 4AYGA 1JGVH 1MCQA 2OTUA 4X4ZA 3QWRA 4XVDA 3KWVA 3VH8A 4DGYL 1SM3L 3QHFL 3TEYA 1C8PA 1RMFH 1SZRA 4A04A 2RDXA 3W4RA 4BJHA 2WBJB 1VGKA 5KITA 1KCUH 2KH2B 2I32A 4IK6A 4WKZB 5CP7A 5FCSH 2YYUA 4I0PA 5D03A 1OAUH 4UB0L 5DWUL 3OKEB 1C7SA 1T0NA 1V3KA 5B3JF 5ADOH 1HJCA 4KPLA 4LOVA 1G6RL 3LTYA 4OE7A 3DGGA 2YJLA 2HPMA 4LBEB 1HHJA 3ASWA 2JLLA 4NRXB 5D6CA 2GBTA 4GUCA 4LPTA 2VLJB 1YPIA 1U8QA 2V2WB 3FUMA 1YX1A 5C08E 1EXBA 1S7UA 3G3DA 1E5UI 5EU5B 4C47A 4YTQA 2CKRA 4JGDA 3CQQA 1VZWA 4PRTA 2MCPH 1KPRA 3WD1A 4X6FA 3HE7B 4JO3L 5AW5B 1XHHA 3MV11 4JY6A 3T2OA 2FHFA 4XAYA 4IPPA 4WI6A 3CZGA 4DBSA 2HZGA 3WKMH 3EYFA 3D0AA 5DEFA 1Z9AA 1IM9B 4OIIH 3D9AL 4QHNA 1URZA 2HT2D 3BD4A 4UANA 4KK8D 4BK5C 3LCGA 3WUGA 2C9AA 4QHLA 1EXPA 4JR9H 3V3WA 1C8QA 3B56A 4IHOA 1BFTA 3QQ4A 5IW3A 4G7VH 5C0BA 2LU4A 2PMZA 2PCYA 3B9KA 1KN4L 5IB4B 3GTVA 3P3SA 1DANT 1T99A 1D5ZB 4C6NA 5I2UA 3I7QA 5F3BA 2DUXA 2R2HB 4DOHE 1ZIBA 5F88A 5K39B 3K4DA 3PNZA 4MZ2A 2GKIA 3ILPA 3SOBH 2RJHA 3GT6A 2FH6A 1CGSL 3F7KA 2ICES 3HB3C 3ABKB 3SSGA 2WQXA 5I1GL 3H4WA 4CUCA 3PF2A 1SFDA 2AS5M 1NGQL 1TEYA 1LVEA 4HV8B 4IXHA 4OWGA 3U2OA 3GBNL 3PGCA 1R9ZA 3HM7A 2J4WH 2VMFA 3MOBL 2QJJA 1BXBA 2FLMA 2CDGB 1EGMA 2IAMD 1IT9H 4NZRH 4Z0BL 1EFXA 5I76B 3W26A 5IZ7A 1RURH 4ICMA 4Q7DA 1C5DB 2XQYK 3GEWB 1II4E 2A1YA 4IOTA 4CD8A 5EV7A 4DQWA 3V8OA 3AHTA 1S39A 3RY6A 3HE6D 5ALCH 3C61A 2MFNA 3KR3H 1G87A 2ABAA 4XPHL 3NG5A 3SGEH 4WR3A 1NBYB 2J1WA 1U8OA 1BTMA 1E5AA 1A6PA 4OLZH 1JGUH 2PCXA 4C6OA 4A3YA 1E2VA 1HKLH 3AFLA 3K80A 1Z89A 2VDMB 2D2JA 4UNIA 3VXQA 5EORL 4BA0A 4TVCA 1ONRA 2Y06H 5FD0A 5I3JA 4IKKA 3QRBA 3M5ZA 4LEXL 3K6DA 4F8PA 1BRLB 1R3IL 5B7ZA 4W9LC 2VLRD 3SJVE 3HC3L 4LHJB 1YNTA 3CN2A 4JTLA 3O6FB 4MDIA 3ISRA 4Z7WF 1JZ5A 1PG7W 2C18A 4Z1DA 3WDPP 3ALXA 1DBKL 2VDQB 4OUOA 2JBMA 5FEBA 2WQDA 3CUFA 4LNYA 1BJ8A 4DYJA 5I06A 2QW5A 4EI6A 2XIMA 5DUML 3UTTD 3WQFA 4MASA 2HWZL 2QTEA 3H21A 5HMFA 5ISZE 3OGOE 1W3HA 3WBAA 3I84A 1EK3A 1LM8V 1VFUA 4LUIA 4F5CA 3IDGA 4AENB 3TK7A 4NT6A 4ZZKA 5HPMB 3D39A 3H2WA 4OKVA 3DK0A 1LHZA 1K7FA 3B8UA 3TN0A 2AQNA 2ITFA 3K2MC 1UP0A 1MNSA 1DP0A 2H3BA 5A6AA 2OZ3A 3GSVB 4FNSA 1J87A 1HVXA 3GNML 4E41B 3BXWA 4XZBA 2OEMA 1HU8A 4BM7A 3GJFK 1OTSD 1EXGA 3AY4A 3QSKB 1MJ7L 3DUUB 2JKSA 4HIEB 4MZRA 1EL3A 3QXVA 3VGGA 4C56B 3GPSA 2CKNA 1D5ZA 2NT1A 3QSTA 3SQSA 4BQ9A 1RCYA 4GFSA 4IJRA 1H8OA 3G6JB 4BZ1H 1DANU 1U8OB 5CR8A 4DKEL 2YPVA 4KFNA 1AA1B 2R2BA 4Y4FC 1T83A 4MJID 2NY3B 4KY1L 4B9GA 4PD4J 3BESR 2JF1A 3LHYA 3OR7A 1JTTA 3QORB 4TQIA 5J6HB 3KE0A 5FIPA 3IF1A 3RITA 4EIGB 4G6ML 2ZWKA 2AJ3B 2PTWA 4W5ZA 3D7PA 1CZ1A 3DC0A 4QI3A 4XVJH 2Q71A 2OP4H 5HNRA 3WUWA 4C1LA 4U2YA 4M1DL 4ZUVB 2WVUA 4JDZA 3LG3A 2G0LA 1TFVA 5D6DA 3CMJA 3O8XD 1U9KA 3K1DA 4KH2A 1HGYA 2ICWI 1UA3A 4HCLA 5IR1A 1S7RB 2XXMB 3VFMA 2YKKA 4AHPA 3NO3A 5E6SB 3JV5A 5LSMA 3ELAT 3MJ8A 1U41A 1M6OB 2Y0SA 2E7HA 1P4UA 1ND0A 4Z08A 5A16A 3PFQA 5ABDE 5DI8A 2GSHA 3O05A 2ATKA 1YUHB 3V0JA 3QORC 3ZVIA 2PDWA 1ILUA 4Y4KD 1NWOA 4H0HB 1XH3A 4UFMA 4M5YL 5HI3D 3V95A 5FF6A 1TUFA 1R5VA 3H2PA 3PBYA 3S35X 2K70A 5FXCH 1BM7A 3RX7A 2V9QA 1IT8A 4HLZH 2CHDA 3AREA 4P7QA 1E0VA 4FL4B 3MRMB 5M7QA 2W9MA 3GDRA 3DGDA 1MUMA 1PCKA 1PZ2A 4KHTL 3TX9A 3G3LA 1ZANH 3IJ8A 3SDCB 3KXQA 3Q67A 3P73B 3QV7A 1G9NH 5U7SA 3QDMB 4LT9A 1TZZA 3N29A 4DJED 1GOGA 4YH6A 3S1VA 2FYMA 4KWOA 4F9LC 1KBVA 2X7LA 3MV7A 4D9QD 2HVOA 2WPBA 3G6JA 5ADPH 3RZCD 1MHCA 3G5XB 5BS0A 1VGAA 2O9RA 1RD5A 2PDBA 2JLPA 1G6RH 4KX7A 3MI6A 3CSGA 4I9WD 5EBLB 2XFXA 2A9DA 1O9ZA 2ID5A 3IFOA 5EZJA 1LLAA 1QFPA 1PQZA 3EJUA 4DGVH 1A53A 3KFTA 5J9PA 1OAKH 4KVCL 4OFQA 3ITTA 4OGXH 3ZT7A 3ZZQA 2Y1HA 2GJZA 2R39A 3RWHB 3L3OC 3UMTA 1BD2A 1KWGA 3UZ5A 1NUGA 1CD1A 1DJXA 4Y2DD 2ICCA 1NMBL 2BIHA 4PVNA 4ZMNA 2WOQA 4GO9A 2W4XA 2XICA 5G4NA 1E28B 3WAKA 3GNPA 4QT5A 4RZ6A 3MNWB 2H1XA 1A1NA 2J56A 3GJEA 4JPIA 1QSEB 5I1LA 1NCIA 3VVGA 3P2DA 1QTWA 4KXZI 4L4TA 1JGLL 4PJ6A 2D23A 3DIPA 4L7ZA 4RJEA 5F6HJ 5JR1L 1X5HA 1NWSA 2ITDB 4NQVA 3W83A 1KCWA 4IOSA 3L0KA 2QPSA 3BPCB 3UWZA 2VISA 3SIZA 3K4AA 3VTAA 4MZ3A 1MFAL 4XPAH 1UIOA 2OMNA 4XZUA 3RDJA 4Q9CA 1KFJA 4AZGA 3P4OB 4OZHA 4BINA 2CDEA 3KD4A 1HC1A 3N1FC 4TPRL 3ZX1A 4NAEB 1ZV2A 4IRSC 5FYJU 3W2DH 2HMIC 4H3DA 4Y4HA 3U4FA 1T5WB 5GGRY 3K6NA 2DWDA 1EOMA 4Q4SA 1MQQA 1JD7A 4UZGA 3EWCA 2XU2A 4YGVA 3OX8B 4UT6L 4JTSA 4QNWA 4TX8A 3CEUA 1AZUA 3HV8A 3OXSA 2V9UA 4NOFA 4F7EA 1UQZA 1ZZMA 4D9RD 1MNZA 2JK2A 1U1UA 1NGQH 3D3VB 4AD0A 3C8DA 3W73A 1FQ0A 1OP5H 5D71L 4NDMA 5K69A 1AZRA 4WHYG 5KUKA 2H6UA 3TYUA 1BWWA 2BC4B 3BN9D 2DQCH 3V9FA 1UHVA 4HGKC 2CU0A 4J7RA 4JPKL 3PZUA 3KCOA 4WUKL 1A4KB 4BKSC 3RWIA 4L5FE 4HFWB 5CN2A 3SODB 5J9PB 2G95A 1DTNA 1T03H 1HYSC 1HXYA 1W9VA 4XD5A 1JUFA 4TRPH 5CHNB 4M62L 4M5TA 2GJZB 4KETA 2ZAGA 4JMXA 3PTKA 1M7XA 4GKZB 1T1YB 4MWAE 4E0RA 1YEWA 3SDAA 2H6PB 4Y8DC 3PFUA 1W80A 3L95A 4KKZA 5JXED 5A6JA 3IKCB 4RGOH 3QDMA 5IOPB 3GSXA 4JTHA 3QG7H 1UGNA 3LBOA 5ICYA 3BLKA 1ZGDA 3NDZA 5GS0H 2WHVA 2D24A 5EMLA 3BH8B 3MBWA 2PO6D 5EU6B 2RAMA 2YXWA 3FCUB 1VBJA 3KW7A 4WCJA 2XNAA 3VA2C 1R38A 5DD1L 3VINA 2I7SA 2QSVA 4XZUB 4OLXL 1KPUB 2BS9A 1XZ0A 3OLIA 3ZMNA 3KOFA 4F8XA 1WG3A 4R7NB 2IFFH 1NSNL 1EUUA 2V37A 1F6AB 1QRKA 1FSKC 3HI5H 2Y4SA 1A5OC 1B4EA 1QPOA 4LS1A 3QZEA 2VITB 2Z31A 2XZCL 4LDEB 4ZMPA 1RR2A 1KBKA 4AYBA 1S9VA 3MA7A 3V7PA 3ZW3A 4G5ZH 3ZDZF 3RX4A 3SZKC 5KBMA 1I9RL 3CLWA 3B8WA 2D4FA 4OFPA 1IQDB 1ZPUA 2A5HA 1WT5A 3D3VA 3OD3A 4WUUE 3C3UA 1DJZA 1OW0A 2HPTA 2UXFA 4IRSA 1Y07A 2PRLA 2C3HA 4P46C 1UT1A 4HMEA 4I8DA 1DIOA 2EYTB 4PSRA 1FHNA 1ZK9A 5DYOB 3RCYA 5CBEB 1QQDB 4S2SB 5I19L 1S5TA 2DFAA 2I14A 3GSUA 1I8IB 4OGYL 2HVMA 4D6FA 4H25B 2Y7NA 2R4SL 3OWRA 3M5VA 4A6GA 3VXMD 2PDHA 2XZ7A 1VHCA 5A6IA 1S1RA 1X39A 4MUPA 4IRJB 4ZK8A 2XVKA 5C09A 4PMUA 1VGEH 1D6VH 1XG4A 2YPVL 3QEGH 3VQ2C 4IQDA 4JTIA 1VGKB 2GB2A 3EADA 1M7PA 4CCDA 4Z7QF 5C0ND 3CYJA 1ZHKB 3G5VB 2HS8A 3EWYA 3L54A 2E40A 1EEQA 4YN3A 3V4VH 4DN3L 2CE6A 3ZTNH 3G6LA 3PV6B 3ULVC 4BFBD 4W85A 2Q7NA 5DK2A 5D1QA 2BOFX 3W02A 1D7KA 1BBJB 3G1VA 1OTUC 4WWKC 5B21A 4GCXA 3ZE2F 3WY3A 2OVLA 3APGA 2Q6WA 1BFSA 1T0OA 4ZXBD 1BWMA 1QLEB 3G08B 5D7JB 4FDWA 3RPKA 1UACL 3T3PF 4HIQA 2I5IA 5HNTA 4UTAH 2CALA 3CAWA 2GEEA 2J6EH 4LUTA 2ZOTA 4PJAB 4HIXL 4N9CA 3ARED 5AB1A 1Y5WA 1F0LA 5CHNA 1CDBA 4A3QA 1AD9A 3BH9B 2EG6A 3I74A 4XNXL 1L5GB 2Z0IA 1AQMA 5GS1B 3G1AA 5D33A 3CPUA 2A0LC 1C8VA 3SBPA 2EE0A 1RK0A 4N87A 1I4NA 3OGRA 5C2XA 5A69A 4OCXH 2YZ5A 1UQYA 4WWID 4TNEA 1F61A 3IMVA 5DFTA 3UP8A 2OXHA 1EBAA 1E8WA 3W2MA 4DO7A 1J2WA 3R06B 1KULA 3ABSA 4HKZB 3E9UA 1V6VA 3D18A 4TULH 4EI6B 5CLYA 3AWOA 2IPKB 2ZOLA 4WO4A 5C6PB 4MD0B 1PCSA 3KPRD 3O3DA 4M6QA 1RZKC 2E74C 4RRPM 4JFDE 4JJOA 4UAOB 1GQLA 2CLOA 4PUWA 2C9SA 1Q9OB 1SDDA 4JZNB 3UTZA 4OUIA 5LKYA 4Q6XA 2QMKA 1G7MA 3O3EB 1G7JA 3FB7B 1CX9A 2RD0A 2RJGA 1OM9A 2W9DH 5LVEA 3KVLA 1AL8A 4YEEA 3V0AC 1CENA 4L23A 3SKMB 3CSBA 3MS8A 3F05A 5HGGS 1A4LA 1GONA 4QXUH 1MCSA 3FONA 1PCXA 2JEQA 3MRBA 1KM3A 1XGDA 5C8JB 1IXOA 2X2GA 2OMWB 2QDVA 4S2CA 1LT8A 1TCDA 4GXMA 4WNJA 1DTUA 1IQDA 3NSJA 1AZBA 4UDTA 3EPNA 1UXWA 1GRWA 3OZYA 3BEWA 1HHIB 2V63A 4TNVK 4FJ6A 2BY1A 2DZTA 5B7MA 1Z6JT 3RNQB 4CBPA 1YMYA 1NCAH 2Z91B 4UMCA 3AVEA 2WP3O 3RILA 4IBZA 4ZW5A 1IHIA 5HWJA 3MJ7B 3FU7A 1K3UA 2EECA 4ZO7A 3F6JA 1D5IL 4GP8B 5D1ZB 4QCIA 2FT7A 5HYIA 2CLMA 5D1QC 5LA2A 4DZBA 2ZP0T 2AANA 3BIKB 3T0EA 4I5BB 1IQWL 2FECL 2EBNA 3W7KA 3WHXB 3MRFB 2NUYA 4YL2A 4LHQB 3R1ZA 4TR9A 1CLOL 1OSPH 1T89C 5TDNA 3FNDA 4L1LA 3UT0A 4H13C 2EDEA 3M7OA 2C3VB 2O6EA 1ZFJA 1I31A 4MQSB 3L7FA 3INOA 1NUDA 1A6VH 3TLLA 3NZSA 1GVFA 2X12A 1YLBB 1ZKAA 3Q05A 3MUGA 3U46B 1AKJA 1QABA 5D7IF 4WGWB 1W0MA 4UIKH 3E0WA 3BG3A 3A6OA 3HC3H 3ENLA 1R3KB 2WLLA 5TDOA 3THUA 1TZHA 4CLMA 2OWXA 4Z3HA 1V6XA 1TTPA 2A6NA 5HHOB 4LASH 4RIRA 4YSEA 3O3EA 5JW3L 5CZRA 5HJGA 5KYYB 3ZBMA 3OPZL 1FHUA 5FSDC 1FKWA 4DUWA 5C2BH 1GGBL 3X17A 3S5ZA 2J7BA 4O12A 3UGRA 4F66A 3M7SA 1DE4B 4N6RA 3OKOB 3LPWA 5IJDC 2X30A 4MAUH 1H0DA 2R9HC 5FW8A 5AC8A 1B4TA 2Z28A 4UNLA 2XTSA 2GJNA 1FUNA 1O68A 4Z7OF 4JFFD 4NQXA 1VAHA 3VMOA 1HL4A 4OUUA 1HCZA 2OG9A 4AD4A 4AQLA 1IEWA 3LVTA 5FYLD 4FOJA 5FUOL 5BU6A 3FUHA 3S3JA 4UIOA 3FB8A 1P0NA 4EAMA 3QG7L 2QVKA 4OLWL 3QPYA 4U3XA 1QPQA 2BRRH 3QAZC 4TLTA 2C1HA 5C0NC 3G1FA 4PCFA 1I8KA 3NPSB 3IJSA 1QDSA 2F7FA 1WIOA 1CO1A 4YXGA 4NGHH 3FO2B 3QIUA 5C3LD 5FKPA 5F1KC 2UV8G 3OPUA 4RDBA 2R15A 3BT0A 3PQYB 4OLYH 1NGZB 1NEZG 3L65A 4NASA 2IOIA 4WI2A 2H5UA 3VFOB 2G4FA 4U5KA 1D5MB 1X7TA 2BW4A 4GMSL 1KM0A 1QI0A 2PETA 3HS9A 5C0BB 1RBLA 3IEBA 1JHKL 1H61A 1SDYA 4WFGD 5T5NF 2PYEA 1WGVA 1DQXA 1DQVA 3NZ8B 1X5LA 4C7FA 2K1MA 2Z6FA 5D09A 5JBDA 3O2WL 4ODTH 1CL7L 4YDLC 1UD3A 1K2DA 4GOAA 4MBRA 3WENA 1J5TA 1DQQB 5I5IA 3EHBD 1QBLL 5DRCA 3W71A 4O02A 2CJ3A 4U3SB 2EC9T 4ZOAA 1RIVH 2ACRA 5BW6A 4NZTL 1BTCA 1KIRA 3L5LA 1P7BA 2DL9A 4ELMB 1MY7A 5BPPA 1QK0A 1U3YA 4JQ4A 1WHPA 5T91A 4IKLA 1P43A 4XP5L 3U4AA 1UURA 3BJ91 2UYLB 3OKOA 2OGJA 3PB0A 1PX3A 1EJ7L 5IG7A 5SV4A 1SYVA 4K8HA 4HNOA 2A6IA 3WLWC 1TV7A 1DJYA 3X1FA 4GABA 1NUFA 3NR0A 2YC1B 2VC2B 1JNHB 1NBQA 2BVOA 3F84A 3HZMA 4UFIA 3CB3A 5KBPA 3MO1B 3CIXA 4FKKA 4HD5A 5GHWL 3TESA 4ONVA 1ZHLB 2EDOA 1JHLL 2MEJB 4PJ9A 3D5OF 2QADD 5FC9A 4GLRH 1YQ2A 1FGNH 4TNFA 3TVMA 3AT9A 4G80B 3OG6B 5DRXB 2IBGA 1ASPA 2WXRA 5FX3A 4MDOA 1HI6B 5HVHB 3SADA 3LSOA 1UATA 5EBLA 5FYKH 4JD4A 4N9EA 5JLZA 5CAKA 1HDMB 4LPVA 3C9NA 3IWUA 1UYWH 3BVTA 3MYZA 3NIDB 3C2OA 3KJ4C 2WKOF 3AG2B 3JUYA 3VD5A 1CGVA 2JIXB 4IRZH 1U8HA 1J93A 5LN4A 2VDLB 3I6LD 5E0FA 4M7SA 3T40A 2R2EB 4L48A 4NKIH 2EPNA 2G5UA 1FFTB 2AXGB 2HJLB 3B2VL 5DJ6B 4C56E 1OWQA 3FA4A 4U7SA 1RQEA 1O5PA 5E6YA 1IKFH 4EWJA 5C07B 3SDXF 3ARRA 4CADB 5EU3B 5BMFH 4MA8L 1TO3A 4G1NA 4PJEA 3RHWF 3ZKQD 1WAUA 3OHXA 4PBEA 3GDCA 4G8GA 4M7LH 4WFHD 2WQPA 3QJHA 1FRGH 3FTWA 3UGUA 1T1WA 5GJPA 3ULSA 4XMLL 4K6AA 2CM5A 4Y16D 4W86A 5I1CH 5JQ6H 1Z9MA 3E7JA 4OFDA 3SN6N 1HEZA 3TN0B 4FG2A 4EN2A 1UUOA 4XMPH 4NQDD 1BMGA 3B7UX 4Z7UB 1W5QA 2CLIA 2EDRA 3JQOB 4H1LB 3VXUB 3RZCA 1LE9B 2GGEA 1BF2A 4XTRD 1TG7A 1I9EA 3W7OA 1C92A 1U8IA 4KK9C 4H8VA 2CBTA 4ZPTA 3C8NA 4X6CA 4WDWA 1LO5B 5BUAA 2NY3D 4ABWA 3EOSA 2CR6A 4FK9A 4JQXC 2WMHA 1LQSR 1ETA1 2GK0B 2X5PA 2DZXA 4B96A 3WLSA 4X5WB 4IOIA 1FZJB 4MX7B 5AW4B 1FAIL 3L4CA 2FFIA 4PJ8C 2MUCA 1HJVA 3P60A 4JOMA 1SEQH 1T89A 2P47B 5L4IA 4E9VA 2GFBA 5I6MA 4HISA 4PRIA 3BPNC 3U1SL 4LQFL 4S2SA 4EI5D 1L9QA 1WSST 4Y19A 4KOCA 3S42A 2E27H 3B03A 4QRPE 1V8EA 1IBGH 4Q74A 4C6PA 1GCYA 2G2NA 1MHPL 4P2OD 4TVPD 5IROC 4L1DA 3A9IA 1W5PA 2VLLA 3W11D 2ZWNA 1FZKA 1NMCB 1BVLB 1F58L 4JNMA 4N3TA 1U4FA 3SIKA 1L9RA 2HUHA 4H88L 1Q3NA 4ERAA 2YAHA 5CZ0A 1NGPL 3V6OC 2CU9A 2FR4B 3DWTA 5AHEA 2J6EA 1M2VB 1Z5YD 1ETZA 2F54E 4KPHH 4U6VH 5D6CB 4KK9D 2J73A 4PJFE 4ANWA 2VCCA 5F0MB 3EMCA 2YD5A 3CDZB 4L4JA 1CIUA 3ES8A 4B90A 4F7PA 2V17H 4ZXBA 4JY9A 1Q5MA 3RN6A 3IGAA 2AV1B 5GGTH 2OZ0A 1JWMB 1UGKA 1XDMA 2AK4A 4QROA 2IH9A 1QSZA 4MLSA 4KKBC 2VOTA 3A67L 4M6OH 2C16A 5LZLA 4A2EA 3GC2A 3TC7A 3VCLA 4YSSA 2PTXA 3KWWA 4MKTA 3UJIH 3BGJA 4PRNB 5FYLH 3S35L 1TVLA 1E6JL 1IVTA 2GVEA 1PPIA 1PSKH 2L7UA 1ET8A 1MRDL 2CERA 4QE1A 1TITA 4JS3A 7REQA 2VITA 4HGWB 2GK1B 4H6RA 2CCVA 2HT4C 43C9B 1VH7A 4I18B 4UNTA 2BSDA 4KUZL 4AYSA 5D1XD 3BV4A 3F1QA 4ERIA 1MIML 1UFGA 3VTMA 1WC7A 1OEZW 3CAFA 4PJXA 1ZLWH 1Q9KA 4IOFC 5AAMA 4NUGH 1OFAA 3RRAA 2IPKA 2ZOLB 1XD0A 4WO4B 4F2MB 1NCDL 2D9QB 1QW7A 2CYGA 1FVEA 3DERA 3OJDA 4KKLC 4JNXA 4YLCA 3IFOB 4KTEH 4DRSA 3B0XA 4AMAA 5CBEA 2OK0H 4RQQB 2YLKA 2WINA 3DOSA 3B8DA 2L5HA 1H3XA 4YIWA 1DBML 1M9WA 3O4LD 2EDLA 2OSWA 1JDAA 1MCNA 1ZWIA 2WKOA 5DRWA 4BK5A 2ZICA 3RX5A 4LVNB 4JHUA 1CLYL 2NXGA 4GBUA 2CHZA 2J1YA 2ZUWA 3BLPX 5F9AC 5KVFL 1CT5A 1A5MC 1FY6A 1QOQA 3ITCA 2BINA 4FXSA 4E3TA 1QUPA 2C9XA 5DO8A 2CUAA 3FBKA 5EEZA 2EADA 1NOWA 1QX1A 4OJYA 3ZKXC 1A5FL 1S3KH 1OL0A 2XZQH 1YE6A 3HNTL 5MEND 2VXNA 3E2VA 4JTUA 1YN7A 4HF5H 4IGBA 5DMLA 4ERGA 1XXFC 4UNKA 4JQIL 2GUOB 3H9SB 3VIFA 4BR1A 3MNMA 4OZ4A 4O2CA 3EYSL 3VFGL 5HSFA 1NA8A 2NW0A 4XTDA 3CVHA 1YYMH 1PG7H 3N3TA 3LIZL 3ZJ7A 4PBDA 1F4XH 3TEWA 3PABA 4NT0A 3AWFA 1LDCA 3P30L 3IS1X 3TJXA 1BVKA 4LP4A 2O5NA 4JM2D 4X9GA 2VAAB 2J20A 5J13B 3CN4A 5G4MA 2J6EL 1CLCA 3O45A 3N43B 3DFYA 4NC2B 3UYPB 4D9PA 3DFTA 2B31A 3M0LA 1AZ2A 1DIDA 4PRHB 1UOVA 3W5MA 1YTEA 4AMCA 3ALFA 1M7DB 4R4BA 1DXFA 3Q1SH 4J8QA 3IJ6A 2PCFB 5DMKB 2X6AA 4U1KB 3DAQA 4NI8A 1CD9B 4PIRF 4IBQA 3AIUA 1BOGA 4FZEH 4G7YL 5GISH 4YMPA 2PDLA 3NPXA 1Y1DA 4QHUA 1W6LA 4RDZA 4ML4A 2G4EA 3VU1A 1XGEA 3NSMA 1FGNL 3TH4T 4UOW1 4X8JB 3OKYA 1JCYA 3VI4A 4GVHA 5EL1A 1J0YA 3WBYA 2Y5EA 3ESVF 3VFSA 3EJSA 3NZPA 2NLJA 3AMGA 1KXQA 1KEMH 3LNPA 2FT8A 1LNUB 3WXVH 3DFHA 1I75A 4JEGB 3RWFA 4DWSB 5M1TA 1P2CB 3NQAA 4CCZA 1S5HB 3BH8A 3I6KA 3DNKA 4BFGA 3KCJA 1TU2B 3PJNA 4JFHD 5GJTH 4DPRA 1U8KA 4F37K 4YTRA 5J04A 3RDTC 3FO0L 4V1DB 3LQZA 5EO0B 3LEYL 3PP4H 1R0AH 1NFDF 1E6PA 3U6RB 1F74A 3PDOA 4IMFA 3TA4D 1WOAA 3HG0A 2ZWZA 4ONHB 1FBAA 2OMBA 3V1PA 3BFQG 5CD3B 1KW1A 2K3TA 4NKDA 3NQMA 3MA7B 2WO5A 3V0UA 1BPLB 1QBMH 2YRZA 1XT5A 1UD2A 4KI5F 3W9DB 3MHFA 2Q5BA 3HU7A 2I60L 5IHUH 4ENEC 3GKAA 4QM1A 2TSAA 3DUSB 4NN6B 3R7RA 1U22A 3GBDA 5FYJE 2DMGA 3SQBB 3TBYA 1G6RA 4G6JH 1T7WA 2F1AA 4P23D 5E2VL 3THCA 3DENA 4J9JA 1R4XA 3DBXB 5JHAA 1KPVA 3PP3K 2PDXA 5A94A 3PQYE 2EYTA 2YS4A 2V2DA 4LYRA 3S2NA 1ZP4A 4JFEB 1JHTB 5EPDA 2DSZA 3C5JA 5BZDB 1UPMB 4UTHA 3NH7H 1JGEA 4HJJL 5E4EB 4YPJA 1W5MA 1PYMA 1TJXA 4QGTA 5MEOA 4HJEA 3QW3A 5I30H 4JAWA 4UR9A 2KC0A 4NNPL 4G43B 2VJ0A 5C9UA 2V30A 4YPGB 5BO1H 3NSYA 4RAVB 4PUNA 4PRAB 1A7QL 2VKWA 4QHKI 3MRQA 3MV9E 5D04C 3DHUA 1QFWI 3MGOA 4HC1H 3OTTA 3R7QA 2X1TA 4KO7A 3UZWA 4J3OH 1M71B 4G8EA 4PJAE 4P61A 2BOCB 3UJEA 2DMBA 5XINA 4FXGA 3RWFB 4DWSA 4HAGA 2J21A 4MZIA 1VIZA 2MRYA 1OVZA 3JVGC 3T5WA 1QRNE 4PP2A 2DMCA 3VXSE 3X1NA 4XRCA 3WY1A 3CC5B 4DAGL 3FK4A 3EO0B 4GNKB 4LAKA 4Y8FA 2CDFA 2YD2A 2XY1A 3RPMA 3MU7A 3B0VC 3HI1A 2YPLA 2QCNA 1M42A 2H6RA 1TQUA 3W38A 2WM1A 3VNDA 4QY8A 1QI4A 4LLDB 1FWGC 3B2UD 2W59A 2G0WA 3MRCB 5JW4M 1JGUL 1NDTA 4GUPA 3WFDL 2OX5A 4R9OA 2WKLA 2B7DT 3JWNH 3I6TA 4HCRH 2F7PA 1G0XA 2O5ZL 1EEYB 3VVVA 2PDMA 4ZFMA 3KPRB 5HAOA 2WAHA 3O9WD 3A3HA 4E0CA 3KP0A 2KYIA 3IDNA 3OJ2C 4X7TA 4IMKC 3C5QA 4NIRA 4RRPG 3AU2A 5TQLA 1M3JA 1FDLL 1YZZA 1Z5LB 3DVNB 4WU5B 2EVGA 1XUZA 1Z42A 2DZAA 5MI0B 3QUHA 1DBKH 5BRZB 1TCMA 2E9BA 3QV6A 1HO1A 1ICQA 1ICPA 3KOXA 1R1CA 2XA3A 2ZPKL 4Y2NA 1VKFA 3CQFA 3I75A 3HIJA 3RPTA 3LKPB 3DXAB 3MRIA 2OB3A 1DXEA 4Z8FH 1ET7A 1OALA 2Y70A 3NCBB 4NYLB 1I1YB 1PDKB 1PLCA 3APNA 4KVPA 5HD8C 3LMZA 4HNLA 2UZIL 3LIUA 1PVNA 1KJ2A 4Y5YC 4A39A 3BWSA 4A3RA 3JS3A 1NPUA 4QRQB 5AOZA 2QCFA 5C0JB 2QEJA 3BUIA 1Z69A 4ZB0A 3GXNA 4XVOA 5D5MF 4R5XA 4YR6B 3FTVA 4JGMA 1M6JA 3OZLA 2E9IA 3MACH 3AO0A 5FEWA 4DLMA 5I77A 4HP5A 4X6CE 1H4PA 5PCYA 2F5AL 4AEFA 3W1XA 4HA0A 3GI9L 3LN3A 1WZAA 5E5RB 3RK8A 2D3LA 2X05A 5DXYA 2Y2YA 5KSAD 1EC9A 5JMOC 4OM1H 2YPLB 1PVHA 3C5JB 2INFA 4P4RA 5DCCA 3UZVB 1NIUA 4KKXA 4Z3IA 1JCKA 4MB4A 3VM7A 4J4PC 3V0WL 2JSFA 4I5BA 1BVZA 3CMOH 3P69A 5DD5L 5T3XL 5I8KH 2EILB 1T1YA 5D4IA 5L9DH 3LK6A 3WEAA 3PXJA 3ZOAA 4MXQC 1KEGL 1Y6NR 4M7JL 1Q66A 3LSBA 2JQZA 3GM0A 4NJAL 3SJVA 4HZ1A 4GY0A 3AB0C 1E2WA 1NEZB 3NJXA 1ACZA 1LRNA 3NQBA 4CRPA 2XFWA 4OY9A 2YB4A 3RPBA 3TJLA 3LYEA 3X3GH 3JYCA 4NI6A 3C5XA 4JE0A 5GS1C 3A4EA 3WD5L 4ZNCD 2LFGA 1DZBA 4RSVA 4V2CB 3GXDA 3MSDA 4E4FA 3LI0A 4MQTB 2GSGA 2ZX8A 1VF5C 4HYTB 2IJ0C 2X6BA 5CJXA 5HHVH 1ZAIA 1YXYA 3T81A 2YWZA 2C1GA 3GU9A 4E8GA 3TEVA 1YNKL 2WXDM 4XNYH 5BZWB 4UILL 2OW7A 3GJFB 3LRKA 2X2UA 2BSSA 4M3HA 1XBRA 1U8NB 3I3EA 3L7EA 1ITCA 4JRYD 2Z31B 4TUOB 5E8NA 1LO0H 5E1QA 4H4NA 2VSKB 4MJ2A 3AWEA 4POZD 4ZW7A 1IWBA 3ZS4A 1VJIA 1Q6LA 4DVRL 3F12A 2A38A 4ODHL 7FABL 4NZCA 2YCLB 4G5DA 3DCPA 2H8ZA 1KCVL 4NUJB 1CF8L 4WFEE 2AJZA 5RUBA 2CNCA 3QBUA 4ZUSB 2FLBT 1IXNA 3PF3A 4QDPA 3IWVA 4GKSB 4KCWA 1DVFC 1Q8JA 4I9MA 4AIUA 3NJLA 1YYCA 5F3BB 5DQDL 3FZUC 5F71A 5GRJL 3LCLA 3KXFA 2WCSA 2MPVA 4PV1C 1XRTA 1YTDA 2CZ5A 2O7SA 4FOKA 4NNXA 2GK1A 4B7IA 1G6CA 1I2NA 3W1QA 2HFFB 4UNVA 2DJLA 4O2EA 5C0BD 3DU0A 4M6ML 2ZC1A 3CZUB 4JLRA 1NGXB 1A4CA 4I2XA 3FO2A 2A3EA 3S47A 4L9LA 2WB5A 4XAWH 1S2TA 2CUIA 3XISA 4E9QA 5HHQB 2VABB 1SEQL 2VN5A 5C09D 1Y65A 4E41A 2X3AA 5BZZA 3V4UL 5F1VA 5CSBA 4P23A 3WUZA 4O0ZA 4C5ZA 2OMUB 1C91A 2SEBA 3EUDA 3VXTB 4X80L 5EDSA 4FXKA 4YE0A 4QOKE 2Q8AH 3W81A 1I2QA 4R96A 3DRTB 2APVA 3EJPA 1LP9A 4MVBD 4A1RA 2QV5A 4AD5A 2R83A 2WXKA 2JQAA 1WOBA 3SECA 3WKQA 3TQ0A 3L17A 4HKBA 2WMKA 4XO3A 1MCOH 1RURL 4ODXA 3ZHNA 4BCYA 4NIYE 1P1XA 3N4EA 3RRXA 4N2GA 2Q10A 2WNZA 4CD4A 4Q8VA 2QUNA 1X5KA 3GS4A 2BHZA 2W38A 5TE7L 3C08L 2V5MA 2WTOA 4FEZA 5I3GA 1AD9B 4OLVL 2YBRB 2IV9A 1NEYA 4MKMA 2PGRA 4BFIA 1IC1A 3GZ3A 3T04D 2CGZA 4IT1A 3WDIA 2NXZC 2V5BA 1I1RA 1A0DA 3IIPA 4AX7A 1WKDA 3CUGA 2G75B 3HVNA 4CKVX 3U3HA 5F0JB 2NXHA 3H7RA 4FX6M 5FAJA 2AJSH 2Y06L 1FH5L 3AZUA 4WTZA 1PY0A 4LO9A 4ZDHA 3VD7A 3LN4B 5LGHH 1EAQA 3O45B 4C4UA 4KMTH 1A50A 2EDJA 4XGZB 2I9EA 2XG9A 1Y0LB 5E1GA 5AYIA 4AVFA 1FZOB 1CGUA 3HTWA 2YSSA 1KYAA 1XIDA 1KACB 2XVGA 2NY1C 1MG3C 3VWJC 4D0CB 4CJ1A 4LRSA 4LVGA 5FGSA 1S2CA 1JGDA 5DXXA 4YXKL 3VE7A 5T8IA 3ALWA 4RPPA 4GXUN 1JMZA 1T22B 4BSVB 4TOYL 4TUJA 2QFPA 2DP3A 2TPSA 1UUQA 4HWEL 4LWWA 2X1QA 3CU7A 5JU6A 1S7SB 3WSQH 3BP7A 4LCWA 4NJKA 3RVVC 1KLZA 1SFJA 4XO6A 4QWWD 5IVXF 1PZSA 2FAUA 1K85A 3W70A 5LGXA 4TRPL 5D96B 1RJYB 3P2TA 1VFAA 4KI5C 2GQAA 3FB5A 3F4WA 2XGBA 2Q3ZA 5KVGE 1QBBA 2YW3A 3TYFB 1LQ2A 3TN0D 3ARZA 2HLAB 2E6YA 1F5ZA 1BWVA 3HQPA 3OWEA 4LGRB 1BXAA 1E5BA 3VXUD 3KPOB 1EHKB 4J3SA 5E9DB 4IRSB 3J2PA 3QR0A 5HI3C 2AEPL 5E2WL 3KX6A 3FJ4A 2CRMA 3A22A 1FCBA 4NS0A 1VBUA 5HHMD 2N56A 1PL3A 2BW5A 1V5XA 4JKMA 3C09B 5EO0A 2RFXA 1PV8A 4IM4A 3U5YA 2C4FT 4F0KA 2IC2A 1UXSA 4DP5X 1LUCA 3VG0L 4LSSH 4PRID 1SN5A 1RZMA 4REQA 4N8VA 4CBZA 1I9IL 2IAAC 3FQXB 1BSLA 4S3KA 3U4KA 2BX5A 3ESNA 3IARA 3WLMA 3QFJE 1MQKH 1S7WB 3WTXA 3DFSA 3CASA 5CQ1A 3G04A 4ABUA 4G5AA 1BFNA 2WUBL 1O7AA 5KZDA 4M82A 1HHHA 2A6DB 2OMXA 4IDJL 3LHVA 2WB7A 4KRPC 2ATAA 2QL1A 2X28A 1M6OA 2FTYA 3IVSA 4I5XA 3NUKA 1M03A 4NC1C 2P8PA 3UYIA 3H4GA