1NM9A

Crystal structure of recombinant human salivary amylase mutant w58a
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPAWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human salivary alpha-amylase Trp58 situated at subsite -2 is critical for enzyme activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, salivary
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1nm9A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nm9A01
3TTYA 3W26A 4AIOA 2ZUMA 5CJ5A 3WEOA 2VC9A 3VILA 3WH6A 3VGGA 1E6RA 3W6LA 3WL0A 3DX0A 3AMKA 4NZFA 1L0PA 4UFKA 1V6UA 1PX3A 1XCXA 2ZXQA 4AYGA 4C7FA 5C70A 2YDQA 4J3UA 3OIHA 2WVSA 3W82A 2PF0A 4NZCA 2F1AA 3A23A 1F4AA 1C7SA 3ARSA 5D8WA 1XD0A 1CENA 3RO8A 2WK2A 1X6NA 3ZT7A 4LQ1A 3B9EA 5FKYA 1US3A 3ARTA 3VINA 2HISA 5BCAA 4BQ3A 4E8CA 1E5NA 2CCRA 2G3MA 4QP0A 4W85A 2XJ7A 2EPNA 2X2HA 4NXSA 1SYTA 2WMFA 5EB8A 3ZR6A 4HOWA 3K1DA 1O6IA 4CD6A 3H54A 3KWXA 2A3HA 1ZB5A 2YA1A 4J3TA 2CBJA 2YFNA 3O2LA 1I1XA 1FHDA 1NQ6A 3BXWA 2G4FA 1H5VA 3RPMA 3NSXA 4QLJA 3ZJ7A 4AMCA 1SFSA 2E40A 4FNPA 4P8UA 5GNXA 4FNQA 3PZGA 4TVCA 2V3FA 1E55A 4B16A 1JXKA 2OWCA 2EPLX 4MPKA 2VTFA 5HPCA 4P7NA 3CHFA 3DYOA 4AMWA 5E0CA 3T2OA 4U33A 3HN3A 3ZJ8A 3MI6A 3S5YA 2AAAA 5CPTA 4FLRA 1Q6EA 3HG2A 1QNRA 3A21A 1HJWA 3GZAA 3AHXA 4CKQA 4EKJA 3PTKA 1HKIA 3T2QA 4EAMA 1KWGA 2CITA 3B8SA 1E15A 1MW1A 1EDQA 2D1ZA 1TQTA 3CUHA 1S46A 1B2YA 3II1A 5AY7A 2YA0A 2XN0A 5C8BB 3AMLA 1NM9A 3U7BA 3VX1A 1HJSA 1J0JA 3IJ7A 1EOKA 4MB4A 1UWIA 1BGGA 2WZEA 1U2YA 1CGUA 2WKLA 1OB0A 3BLBA 2J7GA 2XG9A 2GDVA 1HVXA 4P8WA 2DSZA 5LA1A 3EMQA 1W9BM 2X09A 2IUZA 1QNOA 3D4YA 1UH2A 3PZVA 4CN4A 4C7GA 2J75A 3SCQA 1UH3A 3NSNA 4XB3A 2QHAA 2AOSA 2W63A 1IV8A 1MFUA 4GI8A 2VRJA 2V5DA 5A6BD 2OLHA 2NW0A 1OWQA 5BYWA 1TA3A 2YOCA 2J47A 4AZGA 2Z1KA 4W88A 2B31A 2UY2A 2PWEA 1V0LA 2XIBA 3ZSSA 2AMGA 2QF8A 3GBDA 3W25A 3VMOA 3PTQA 4Z2GA 3EJTA 4JFVA 4IUGA 4UTFA 3OLGA 4KRUA 3SCSA 1PX8A 3AIVA 3BVWA 2V38A 1LJYA 3AFBA 5A1AA 2X05A 4DUVA 3AIQA 2WC3A 5D9NA 3VDCA 2YFOA 5BRQA 4AC1X 2PBGA 3WEZA 1JD9A 2FHBA 2G3NA 4HOZA 4PMOA 1K9DA 1ODUA 1E4NA 1ZBVA 3ZO9A 2VURA 2D0GA 3SCRA 4JZ5A 4FNUA 4DO4A 4OUEA 3KLLA 1BGAA 2JALA 3PZIA 2ZUUA 1WE5A 4TVDA 3WY1A 5M03A 3W0KA 1B9ZA 3KL3A 2OYLA 4FLSA 2FH6A 3APGA 2W91A 4W8LA 3DX3A 2XVLA 2VO5A 1E4LA 2D3LA 1NOWA 1QWUA 3OLDA 2WHKA 3AYSA 4XX6A 4DWSB 3W37A 3W27A 3G6LA 1A47A 1BFNA 1OT1A 1B30A 1TVPA 4DWSD 4W86A 3O6AA 2A3BA 3GH7A 2E9BA 4JHZA 3LRKA 4U5IA 5DEZA 1V0MA 4HPGA 5ABFA 3WQ4A 4HPHA 2PWDA 3OZOA 1QPKA 4B3LA 2PB1A 1RD6A 2DEPA 3EMCA 3U7VA 2ZX7A 2VCCA 5M17A 1M7XA 1PEZA 2WCGA 1MW2A 2XTKA 4M80A 4H7VA 3VIFA 1QHOA 5AC5A 3UESA 1B3XA 4AZ7A 1CGVA 2YJQA 1FP9A 3CZSA 1CEOA 3UR7A 1HJVA 3A4XA 4FLQA 1C8XA 4IPNB 1WNOA 1E40A 3DDGA 2OSYA 2O9PA 2PC8A 3FW6A 3WQVA 4D1IA 1G5AA 2XWDA 4Z2LA 4QAWA 1NWTA 1PJ9A 4P7QA 3ARRA 5IHRA 1Q6DA 3ECQA 1NOFA 4Z2IA 1GHRA 3SUTA 2OYKA 4UQAA 4Y7EA 3L4XA 1XSKA 2GK1B 1WB0A 3A3HA 2C7FA 4UQBA 1DWIM 1NP2A 4U3AA 3VIJA 1GQJA 1UHVA 1E0XA 1I75A 3W29A 3QGVA 3D51A 4E8DA 3CZLA 2DH2A 1JFHA 2RGLA 1CLXA 2W92A 7CGTA 1JDCA 1VIWA 1P6WA 3VMPA 2Y8VA 5DO8A 5I5RA 3OG2A 4JCMA 3WFZA 3BAYA 1HVQA 2J8GA 4GZEA 1MQQA 1BYDA 3LPGA 3T2PA 3CUJA 1QHZA 4GI9A 4NZJA 1GORA 1JXJA 3BAXA 2W4XA 1E1FA 3CLWA 3NDZA 1OINA 1W32A 1HN1A 1PZ2A 1E0VA 1H09A 4TX8A 3WMCA 4ZXLA 1H1NA 1W1YA 4F9DA 4PMUA 4A3YA 4PUEA 5CPQA 2VJXA 2VL4A 4BA0A 1QI3A 3AZSA 5I77A 2YL6A 4DO6A 1UR2A 1CZ1A 4MB3A 3M46A 4B3KA 4V27A 5JIWA 3EJSA 3DX1A 2JFEX 1GVYA 1LL4A 3N9KA 4AD2A 3VMNA 1SMAA 1R85A 4MNMA 3QOMA 1R75A 4HA1A 3VGEA 2CBIA 1HXKA 5CLWA 4NRSA 3FXYA 5A6MA 2J7HA 2GK1A 1UKPA 2J7BA 2F7PA 1VBRA 4NX0A 3VGFA 4CD8A 2X0HA 2VQUA 3FHAA 4UFLA 3GTNA 1UASA 1J9YA 1OGBA 5I3DA 3EDKA 2J4GA 1TA3B 4UZSA 2YA2A 3VM7A 1JZ7A 4ZXOA 1HIZA 2VRKA 1C8QA 1D7FA 3RM8A 5LA2A 3CC1A 1EGZA 3WD0A 3AZTA 1PIGA 1EDGA 1KCKA 5E1QA 3O9NA 2X2IA 4PTVA 1NOUA 4JKMA 3VGDA 3WELA 2D24A 2IXVA 2VZTA 1WDPA 2YIHA 2YL9A 2A3CA 2FHCA 2ZXBA 4UNIA 3LPPA 2X2YA 2WZHA 4NF7A 3U5YA 4CN1A 3ARXA 5FOOA 3ARZA 1JFXA 1BPLB 1W9DM 3VDBA 3VD7A 1V08A 1QI4A 1ZJBA 5CZKA 2XN1A 3BLKA 1PX4A 3CO4A 4J3VA 5CQ1A 4UZUA 4TXEA 2JF6A 3D3AA 1Q6FA 1QI2A 3PBGA 3I3DA 3LX9A 3A4WA 3VNZA 2WWCA 2CKRA 3B9AA 1HX0A 3ZJ6A 1UKQA 1LWJA 1R8LA 4QCEA 2X2JA 2VCAA 1C93A 2PBOA 1D3CA 1SZNA 4M24A 3N15A 5A8PA 3BCFA 4X0NA 3AMGA 1ISVA 3N17A 3CZ8A 3L2MA 4W7VA 4AD0A 3VU2A 4DWSA 3B9DA 2BXZA 3AS0A 2XN2A 1FHLA 1RPKA 5AYBA 1PIFA 2OSXA 1F4HA 1JL8A 4HZ7A 4Z2JA 4R27A 3AIUA 5EMYA 4AISA 5CGMA 3MMWA 3CGTA 2WHJA 1UD4A 2WAGA 3T0BA 3WF0A 1J0ZA 2ZX6A 1MXGA 2VCBA 1JDAA 2D73A 3W24A 3H53A 2FDMA 1ZBWA 5HBFA 4JKLA 2GUYA 4PMZA 4W8BA 1UA7A 2ZUTA 2ESCA 3UG3A 5A6BA 1JG9A 2FE0A 3T0DA 3RM4A 2VZSA 2WANA 4JKKA 3ZQ9A 2WLYA 3ZJKA 1DHKA 1MXDA 4RE3A 5CLTA 1GUVA 1WDRA 5HDRA 2EACA 2W66A 3CPUA 5D9MA 2BVTA 3IGUA 1JAKA 5I2UA 1VFFA 2XYLA 1UD3A 4OKDA 5DF0A 2WXDM 2YDRA 3MUY1 3A47A 4E2OA 2XSBA 5A2CA 3VUPA 3FN9A 3A4AA 2VX6A 2WM0A 4D6DA 1XH2A 1VENA 1J18A 1B0IA 3GXFA 4CU8A 4ACYA 2XIIA 3POCA 3FY1A 1C8YA 5A8MA 5M3WA 1T0OA 1E6PA 3WF3A 3AIRA 3HU7A 4PUDA 2XVPA 1J01A 5BROA 5A8OA 1C90A 2FHFA 1GJUA 4CCEA 5JBDA 4H8VA 4JFSA 3POHA 1K9FA 1HJXA 5D4YA 3AHZA 3DC0A 4D6HA 4ATWA 2VMFA 2QPSA 1OIFA 3AISA 3NCOA 5E0FA 2W67A 5CSUA 2DT2A 1E56A 3BVTA 1TCMA 4JFUA 4HTYA 2EEXA 4V28A 3ZM8A 4UQCA 5BRPA 1B90A 3AIEA 4URIA 3NSMA 1VAHA 2J8FA 4PMDA 2VQTA 1HL8A 4EK7A 1KR1A 3MSDA 3AOFA 1US2A 1EA9C 3CHEA 3PZTA 3FAWA 3EYPA 3SCOA 1FH9A 2XPKA 1XCWA 1GOQA 5E6YA 3GXIA 4LXFA 5CSYA 2EPMX 1W3LA 3ZT5A 1IZKA 3AICA 4PMVA 3PTMA 3HG4A 4M8UA 2O9TA 1JF5A 2DQXA 2ZICA 5IFPA 1WP6A 3WEMA 3THCA 1KBBA 3W6MA 3K8MA 4U2ZA 3IAPA 3MSGA 5AC4A 3KL5A 1BG9A 1V6WA 1CDGA 4HOXA 1H11A 1W2VA 2ZUSA 1GCYA 5FL0A 3FNDA 2D2OA 3CUGA 2DT1A 4M29A 1GHSA 2X8RA 5FCZA 1GJWA 2QPUA 4W93A 5E6ZA 1XSJA 3PZOA 1SR0A 4P8XA 1WKYA 4PTMA 2OW6A 4W87A 1KXHA 3H55A 2J78A 5CGTA 1E4MM 3ALGA 1R33A 2EQDA 1JZ2A 2YBTA 4KGLA 3F5JA 1CGYA 2ALWA 2XVKA 4QFUA 4B9YA 4AY1A 1VEPA 5JBEA 4GIAA 1JZ8A 1UKSA 2F61A 2DDXA 4ML4A 1PS3A 3SCPA 2EADA 3E1F1 1JNDA 1DTUA 3CZEA 2UWFA 2FGZA 3PN8A 3CHDA 3L4UA 4PCSA 3WBEA 2ZUNA 2ZXDA 2VT0A 4GQRA 1ZJAA 1L8NA 4D71A 3QHOA 3WF2A 1JAEA 5HXMA 1DEDA 1Q4NX 2GJRA 1BLIA 4AZHA 3VTRA 4BF7A 1VJZA 4UFIA 3EDJA 2DSKA 2YLLA 3WNPA 4WSJA 4IISA 2Y2WA 4NRRA 1JZ3A 2WNWA 1V6YA 3AHVA 3WD1A 3CUFA 3WQ8A 2ZXAA 1N82A 3CV5A 4AZCB 1E43A 3WY2A 1QBBA 1RP8A 1UYQA 1V6VA 1ZU8A 2FYVA 1IZJA 4MB1A 2W61A 1UD6A 1E6XM 3EMZA 1W91A 3DHUA 4UCFA 3ZT6A 4LPCA 4CD4A 4WKAA 3S5ZA 2O9RA 2XM1A 3LPFA 2VRQA 2RGMA 3RCNA 3W81A 4H04A 4PTXA 1E3ZA 1GQKA 4S3KA 4ZE5A 1UQZA 1BYCA 3WQWA 4J27A 4MNJA 1H0IA 1UZ4A 5A94A 3TP4A 3VIMA 1U33A 1UR4A 2J74A 1QHPA 4AZCA 3CUIA 3VGBA 1UKOA 1EO7A 3WENA 1J0HA 3NUKA 3DECA 3AXHA 2J77A 3BAKA 3TTSA 1CIUA 2XGBA 4D6JA 4W89A 1UOKA 3MMDA 5GNZA 2WBGA 4MJ4A 4PN2A 3AXIA 1JZ5A 4MTVA 3D52A 3BMVA 3WH9A 1ISYA 2GJXA 1JGIA 4TUFA 4MDOA 4E4PA 3W53A 1YQ2A 1JZ4A 1HL9A 3WH8A 5ECUA 1W9PA 2VR5A 4JHOA 1VFUA 2ZX9A 5DFAA 1E5JA 2XUCA 1QX1A 2IGTA 2JIWA 1UZ1A 4DM1A 1E6QM 3WNMA 2WLZA 5JBFA 3L4WA 3AJ7A 3GBEA 2DIJA 3AZRA 2WW5A 2F2HA 5A2BA 2Y24A 1TQSA 2D3NA 2ZX8A 9CGTA 2DT3A 3OGRA 4HMDA 1D2KA 4UQEA 2VR4A 2D20A 2WZIA 1OCQA 6A3HA 1QI5A 3TONA 4LYPA 1GONA 1DWGM 2CYGA 4CD5A 3LRLA 2TAAA 2ZE0A 1CXLA 2WVUA 2XHYA 1OGSA 1UG6A 3CZNA 3EJPA 4NXKA 4XV0A 1R86A 1E6NA 3GH4A 2CEQA 3ZSTA 2J7EA 1QNPA 1AQ0A 4MJ2A 2WMHA 1PZ3A 2GSJA 4WIWA 5D9PA 3SUVA 5A2AA 3VSVA 2WVVA 3FAXA 4D6CA 3BSHA 1XRVA 1PPIA 2WYSA 4LYQA 2VOTA 3ALFA 3T08A 3BMWA 4UFHA 3AS1A 2XGIA 1TZ7A 1RP9A 1C3FA 1VEMA 1JDDA 4UOZA 5D8ZA 3G6MA 4RE4A 2CETA 3UCQA 2X0YA 5A8QA 5A6KA 3IJ8A 3VSUA 3WUFA 1E6SM 3UERA 3GH5A 2J25A 1MWOA 1PAMA 1Z32X 3EDFA 4BQ4A 3DX4A 3WNKA 1XYFA 2WMJA 1JYXA 3I3EA 1TQWA 2CPUA 3CTTA 4K68A 1NWSA 2O92A 2MANA 4TOQA 1WO2A 2V3DA 1VBUA 2BVYA 2YKKA 2QLYA 2W5FA 2ZWYA 3OGVA 3WF4A 3JUGA 2BY2A 4AEFA 3UG5A 3NJ3A 1V3KA 2GJPA 3RJYA 1LQ0A 3EDEA 5FIPA 4BS0A 3VX0A 3WF1A 5KEZA 4XZBA 2A3EA 3SUSA 1V02A 2Y5EA 1J0YA 3MU7A 3HJEA 3HG3A 4IPLA 2CNCA 4GO9A 3AROA 5GNYA 1WPCA 7TAAA 1ISXA 3K46A 1UH4A 3BH4A 1XSIA 2EAEA 2BY0A 3MUZ1 1C92A 2E9MA 5JIPA 3VOCA 1GOIA 4QCFA 3BGAA 1R87A 1XH0A 4OBRA 1GOMA 5I23A 3VM5A 1UR9A 1TQUA 1YHTA 1TQVA 3CZJA 4DWSC 1EHAA 1EHNA 1FH8A 3AHYA 5LA0A 1AMYA 1X6LA 5A6JA 1JI1A 1VJSA 2ZIDA 4PCTA 2XM2A 3GM8A 3OZPA 3ARPA 4GPNA 2BXYA 4J28A 2YBUA 4DO5A 2UY4A 3T0AA 5M5DA 3CZKA 2E4TA 1B3ZA 4W8AA 1OD8A 4BQ2A 1C91A 4RE2A 3VGHA 3WDRA 3J7HA 1EOMA 4F9JA 8A3HA 3L4TA 3WNLA 1LG1A 3TOPA 3KZSA 1UWSA 1CECA 3AI0A 5E9AA 1A3HA 3GNOA 1ECEA 3AMDA 4HA4A 2J7FA 2F1BA 1RH9A 3WSUA 1VEOA 3AS2A 3RIKA 4YHGA 1CNVA 3AYRA 1WZMA 5DT5A 2VVNA 1R7OA 2D0HA 4NI3A 2BVDA 1C7TA 4OGZA 1UWRA 2OYMA 3LXAA 4M56A 1EQPA 4HZ6A 4CVUA 4AWEA 6CGTA 3NYDA 5KZ6A 1CXKA 1MQRA 2J7CA 2JEPA 1QWNA 1B3VA 1KCLA 1ESWA 1G1YA 1AVAA 1H3GA 2XFRA 1CXIA 4OBSA 4GKLA 5AYIA 3L4YA 3N12A 1FH7A 3ARUA 2VZUA 3BUQA 4GINA 1E0WA 1TG7A 1UWQA 1W3KA 1ZBCA 2WPGA 1AQHA 4ACZB 4YHEA 1JYNA 3S6TA 4BZYA 1CPUA 1CLVA 4XZWA 1ISWA 4ATDA 3WDPP 1FP8A 1UD2A 3AHTA 2EXOA 4HMCA 3CBWA 4ACZA 4U31A 1HT6A 1XV8A 2BY1A 2WVVB 1BHGA 1W9UA 3TTQA 1XH1A 4J3SA 3VDHA 2ZUVA 3OBAA 4DM2A 4AIUA 4WLCA 3K8KA 1ITCA 3K4DA 2ZOXA 1MW0A 2WWDA 4AZIA 1HXJA 3BUBA 4JCLA 3I3BA 4AYSA 5BXSA 1TE1A 4X0VA 1JYWA 4PMRA 3AMCA 1G9HA 1J12A 3D4ZA 3WDHA 5FL1A 2WC4A 2F8QA 4J3WA 3KE0A 1LG2A 2D0FA 2XSAA 4EANA 1E3XA 2WCSA 2EPOA 3K4AA 5A6LA 3CMGA 2CHOA 3VD4A 3MS8A 1MYRA 3BAIA 2FGLA 3MV01 5BXPA 3NIYA 1HKKA 3VD5A 3WKZA 1OGGA 3MO4A 3K8LA 1G01A 1V3HA 1KQZA 3WD2A 3OA5A 2JF7A 5DT7A 2E8ZA 1XC6A 1CYGA 3KEHA 2GFTA 4GZIA 3ZIZA 5CG0A 1HTYA 3ARQA 3AXXA 3GNPA 4CCCA 1BF2A 1VB9A 3BVXA 4QLLA 3WDIA 3L4ZA 3RDKA 3EJRA 1LLOA 4ZFMA 4JL1A 1HNYA 4AZBA 2ZX5A 1JNEA 3N13A 2DSVA 1WAWA 5IFTA 1WZKA 1J10A 4W7WA 4B15A 3MMUA 4W5UA 2DIEA 2EJ1A 2BV9A 3VIHA 2YLAA 3PHAA 3VNYA 2XVGA 1DWFM 2DSWA 2NT0A 5D9OA 2G8ZA 2CBVA 4XUYA 4F8XA 4F79A 1W9XA 1M04A 4FNTA 1UQYA 3EJQA 1W9VA 3SCVA 3QR3A 5EFFA 4P7LA 4AXNA 5A69A 1WDQA 2EPKX 8CGTA 3MV11 3DYPA 2E9LA 3IK2A 3ZOAA 3ZR5A 3LMYA 1CTNA 1OIMA 3W4RA 5BXRA 3VIOA 1CWYA 3WN6A 1ZBKA 2CBUA 4MADA 2JE8A 5TD4A 4H2CA 1M03A 1JZ6A 1BG4A 1HP4A 2VI0A 4MDPA 4Q7NA 3SCUA 5A6AA 4GI6A 1MW3A 2Y4SA 1NWRA 3BUPA 1KBKA 4LGXA 4AEEA 3GNRA 1KTCA 1IT0A 1FA2A 1E1EA 5I79A 2JIEA 1LL6A 4MNKA 1JD7A 4N0RA 1BVNP 3F5KA 3WBAA 1V0NA 3WIJA 3WUGA 4WKHA 3WDQA 3N1AA 4PMNA 4CD7A 4M81A 3KL0A 2NT1A 2EO7A 4D6GA 1J0KA 5A8NA 1UA3A 4MAVA 3IAQA 3MKKA 2YL8A 2DSUA 4JL2A 3THDA 5ABEA 3PZMA 3BC9A 3OGSA 4AZ5A 1HKMA 1GOOA 4PMYA 1FFRA 4UOJA 1JIBA 1OSEA 1OM0A 3SCNA 4OOZA 2E8YA 3LXBA 5JUVA 5EFDA 1VRXA 1HF6A 4TTGA 1TUXA 1OD0A 3VIPA 4ZE4A 4UQDA 1NP0A 5F7UA 1KFWA 1V3MA 4TVUA 4CU6A 5HOSA 4PMXA 2X1IA 1GPFA 3W28A 3N04A 4FLOA 1V3JA 3UR8A 1XHGA 1V3LA 4PSRA 2VUYA 4U2YA 4W5ZA 3WUBA 3A6OA 5HPOA 2UY5A 3CZGA 3VSTA 4H8UA 2OWXA 3WQ5A 1WZLA 2F7QA 3WMSA 2J7DA 1LF1A 2VZVA 1BSIA 4KH2A 1KXTA 2QMKA 1H41A 5CPSA 4F66A 2W62A 2CKSA 2WC7A 5HNNA 6TAAA 4PMQA 3F4VA 3HMCA 1KGWA 3RMEA 4DUWA 3D50A 1E72M 3BUDA 1HP5A 5ABFB 4MAZA 2O9OA 1QVBA 3ARWA 1Y7VA 1HKJA 3U57A 1B3WA 1Q6GA 2ZUWA 1BTCA 1J11A 2CIPA 4P8VA 4TX6A 3GYCA 4A3HA 4QLKA 4HZ8A 1HJQA 3ARYA 3VIIA 1JF6A 3EJUA 1K6AA 4OOUA 3DYMA 3VDAA 2F7OA 3GXTA 3SIMA 3GXDA 3UETA 4FNSA 1H4PA 4N42A 4Q22A 7A3HA 4GZJA 4QDMA 4U5KA 4Z2KA 1NARA 2Y8KA 2C8NA 1W1VA 2HVMA 1KXVA 4PSPA 1XGZA 4LYRA 4IM4A 2WHLA 3PZ9A 2VX4A 3WNNA 2WMIB 1UR8A 3SCWA 4MB5A 4D6IA 1BAGA 3SUUA 4X9YA 1W1PA 2FH8A 2DT0A 3CHCA 4M82A 5BWFA 4CVWA 3UG4A 4PTWA 1GW1A 4W84A 5I78A 3TV8A 3SUWA 3WDJA 4KMQA 3T09A 3L4VA 1KQYA 2GVYA 5CXPA 1K9TA 4HU0A 1V3IA 2EBNA 2D23A 2VX5A 3GXNA 5ABHA 1G94A 2Q8XA 1SMDA 1CGWA 1KGXA 3A22A 4CN6A 2OW7A 4FK9A 4FMVA 1GQLA 3GXMA 1V02E 2WMGA 3WUEA 4BQ5A 2BFGA 4C7DA 1B1YA 2PWHA 2A3AA 1LWHA 1QW8A 2ZWZA 4HP5A 2YDSA 1NWUA 4D72A 2XVNA 2OWWA 5A6SA 1KR0A 2DH3A 3WD3A 4DUXA 1CXEA 4EE9A 1EIBA 3DX2A 4BCEA 2QMJA 3BSGA 3FHQA 2WSKA 1ISZA 3N11A 2QV4A 2CESA 4KRTA 1EQCA 5E09A 1R46A 2OSWA 4L4OA 2G3JA 4GO8A 4PRWA 1HJUA 1OT2A 1GOWA 4OIFA 1UR0A 2WHMA 1BYAA 3SEPA 3QHMA 2CHNA 2PWGA 2WSPA 2D22A 4AD5A 2WMIA 4ZENA 3D5HA 2C0HA 1UD8A 5BXTA 1KGUA 2J62A 1FFQA 3PZNA 5IDIA 2V3GA 3AIBA 5A95A 1OBAA 3L2LA 3OLIA 1EO5A 2YL5A 1CBGA 3BVVA 1O7AA 2UY3A 2XFYA 1QW9A 2E3ZA 1KTBA 4H41A 4J3XA 2WBKA 3SURA 3WH7A 3IJ9A 1W3JA 3RILA 2DGAA 1CGTA 1H49A 1GOKA 4V2XA 4TTUA 1W2PA 3VPLA 1TMQA 3CMJA 3VKKA 4AZ6A 3AQUA 1JYVA 3BAWA 1VF8A 3VD9A 1AQMA 4YN5A 4UQ9A 2J79A 4Z2HA 4AD3A 1CGXA 1U30A 3VVGA 3VIGA 1BVZA 3CH9A 3PZUA 1UWUA 4MNLA 4HMEA 1ODZA 1KWKA 1Q6CA 3TTOA 4UOQA 5I24A 1QI0A 4JIEA 3WMBA 4H8HA 1H2JA 1QNSA 4PYSA 2BHYA 2VZOA 2DPEA 1UUQA 1R47A 3BVUA 1J0IA 4AIEA 1QOXA 4P7RA 4D6EA 4JFTA 4NSBA 4ZEPA 3NDYA 1GQIA 3WL1A 1MFVA 3N18A 1M01A 4AMXA 1UR1A 2WB5A 3RJXA 2BY3A 1FOBA 5DMYA 4WSKA 3WD4A 2VNCA 1E9LA 4JAWA 2GDUA 4WK9A 2VX7A 1E4IA 3U5UA 3ZMRA 3MUAA 2JEQA 1NH6A 4RL3A 4HA3A 3LPOA 2WMKA 2BHZA 2XFFA 4JFWA 1KB3A 3AIWA 3SCTA 1MVYA 2IXUA 4CCDA 3F5LA 5EBAA 3A24A 1I1WA 1BYBA 3MUIA 1CXHA 4CU7A 2WCAA 3WY3A 3WH5A 1ZL1A 3QHNA 4UFMA 1R34A 3HG5A 3MANA 1EH9A 4OZOA 3W38A 4GXPA 3EBVA 1GZJA 1WZAA 4S3JA 1TR1A 3OLEA 1E70M 3WFLA 4UR9A 3S2CA 3KLKA 5ABGA 1V6XA 1M53A 3LXCA 4OJYA 1JI2A 1HWWA 5IXEA 1LL7A 4UFJA 2BNJA 3WQ6A 2E0PA 3CIVA 3BCDA 4YPJA 1UKTA 2PI6A 4CGTA 2WVTA 1CXFA 1W3HA 4FF5A 1DWJM 3GXPA 4PEEA 1WDSA 3VIKA 3M6DA 3A5VA 1DWAM 2GJXB 1MQPA 1G0CA 4U3CA 4LX4A 1K9EA 1O7DC 5FD0A 5A3HA 4GQQA 5E70A 4ATLA 5GPRA 4A4AA 1X1NA 2V5CA 3UEQA 5IHSA 4D1JA 3HZ3A 1PBGA 4KGJA 1XYZA 3VD3A 4WJXA 5GQBA 3IANA 1WCGA 4L4PA 2G41A 1V0KA 2F7RA 2BS9A 1KXQA 4M1RA 4HU8A 1UD5A 1GVIA 4CUCA 5C71A 3DDFA 4AW7A 4R5EA 1E73M 1TFVA 3BAJA 2F18A 3M07A 1DP0A 1EDTA 1ITXA 3ARVA 3RM9A 4D6FA 3WY4A 1W1TA 3EDDA 3GDBA 5LYRA 2BHUA 2PWFA 2EABA 1TVNA 4J7RA 4B9ZA 1R7AA 2NSXA 1E71M 3AS3A 1VFOA 4AD4A 1ZS2A 2CXGA 1H0GA 4FNRA 4WF7A 1B3YA 1QBAA 1E6ZA 4P7OA 1DWHM 5I6SA 1B31A 4KWUA 3TA9A 4W7UA 1UWTA 2V3EA 3BLPX 1EXPA 3VO0A 1V03A 2Z1SA 2VVSA 3WNOA 4PBGA 2CERA 2XWEA 3M7SA 3OB8A 3QOKA 2G3IA 3PZQA 3BUIA 4AD1A 1BQCA 2WKGA 4WKFA 3LRMA 5I0DA 1XD1A 1QNQA 1VFMA 1GNXA 3DHPA
chains in the Genus database with same CATH superfamily
3P2TA 5CEYB 1DQWA 5E5RB 3LJ3A 5E8PA 4G42B 4AIOA 1AY1H 1TRIA 3U1QA 5JZ7C 3H2AA 3W26A 2PDWA 4UYQA 3VXGA 4CSPA 3OMIB 3GW0A 3I6TA 3GKZA 3QDGB 3GKWH 1MRAA 2B1HH 4KKRA 1EXGA 3HI6L 4QRFA 4QQUA 4JBRA 1TYRA 1J88A 3C4UA 1F13A 5KSVB 4NQ1A 1T2QH 4R0LC 2XN9A 3DX0A 3SADA 1T1YA 4XO8A 1B4TA 5DJ8B 5K59F 2B81A 2CJUH 1VRSA 2R1YA 4GW4B 2CO2A 1LP9A 4P4KB 3PWPB 5DC4B 3QE5A 3KGTA 3RDTB 5D5ME 4Y8EA 3S35H 3O6KL 3SPIA 1TJ0A 2AQ2A 3DX6B 2KZBA 4KIEA 2GSMB 2Q3XA 1RZIA 1CC3A 4XTRC 3W82A 5K9XA 2F1AA 1F4AA 1QAWA 2W07B 1AR1B 5F4SA 4OCYH 1IX2A 3PL6B 5DJDB 4AOFA 5JYLA 3BCJA 3C5JB 4G7QB 1SM9A 1M1XB 3A3WA 4YNGA 3RO8A 4EOUA 3NDZE 3HMWH 4XBKA 4PLJD 4X8GA 1X6NA 3GMRB 4AH2B 3FDWA 4LQ1A 4YGVA 5CJQL 2HISA 2Q87A 1BD2E 4LKCB 2NQDA 4POUB 2MNRA 2PURA 1K6QH 1QOKA 5JVLA 1RZ7L 1SR9A 3MV7E 4JTEA 4LLUA 4P3DB 1GW0A 1YPZF 1HC1A 1GHFH 1NPNA 1RIHH 2VR6A 3CVIH 3ZDXF 2QULA 1E5NA 5AVHA 1VADB 1IC5H 4FYRA 2BODX 4RCAA 4O2EA 2XJ7A 5CGBA 3N0PB 3ERXA 5GISL 3IS0X 5CGYD 2H26B 3PWIA 3IJYB 1S7QB 2AXHA 1ZLWH 3CN1A 5KVFE 4BV1A 5EB8A 3R06B 1C08B 2WUBL 4PJ5A 4BE6A 1JMZA 1EXUB 4BZ2L 1O6IA 4AL8L 3VG9B 4DSYA 4JHUA 3EJYD 5MEQA 4O53A 2WOBA 3BQVA 3A6BH 4PRPE 1KJMA 1F4XH 5K9QG 2CBJA 3O16A 4I5BB 1I1XA 3NIGE 5FGBC 5IROD 5E9DA 3IGKA 5B7MA 2R56L 2E7LC 3HNSH 1DJQA 3IRSA 1KG0A 3MJYA 3LV3B 2PYFA 4A8IA 1X7QB 3CCHA 1CT8A 4XH2B 1ZLDA 4YL9A 4A7GA 4DN4H 1ZGDA 5CZTA 3ZJ7A 3ALWA 4FNPA 3MYJB 1T5XA 5IJVA 2VD9A 3PZGA 4QM1A 1B0RB 2AEQH 2LAAA 5EMUA 4P2YA 5EIIA 3RZWA 5D6CB 3O45A 1EGJL 5C8JB 1AZ2A 2XOTA 3ARGC 4E42B 2XKSA 1FWCC 4LHUB 3BL3A 4AMKH 3B4UA 1B0WA 2P5WD 2RMNA 2VLLB 1ADQH 2P8CA 1EEUA 3MI6A 1KM2A 4YX2L 5ADPH 4GGHA 4RW3A 3DETD 1H7NA 4FLRA 1Q6EA 1QNRA 1CFSB 4N2FA 4DK3A 1HJWA 1FE8L 5HMSA 2LTQC 3NPSB 4IHCA 4QSFA 1YECH 4FULA 2ZKWA 4RK8A 3MJ8A 2DBJA 2PR4L 3DSNA 4M4RA 1HKIA 1IEQA 2CSPA 3GVQA 2A6IA 4C56E 2CO3A 3TIEA 3PK7A 1H3XA 3N1FC 4EAMA 2EH7H 4L3CB 1E4KA 4MNQD 2CITA 3RIFK 3B8SA 4WUUE 1OFDA 3FYEB 1E15A 4LPTA 1UGKA 3D05A 1GJIA 5IQNA 2WB7A 3CUHA 4BFRA 1KRCC 4LUSA 2IALA 2JKJA 4XCYB 3RYMA 1OANA 5DQDH 4NNYB 4ANKA 1FWNA 2ZVIA 1K85A 2HX8A 1P9MA 2XN0A 5I8EA 5IHBA 4ORMA 1A5CA 4XVEA 1YEDB 1Z0NA 4OF5A 1GS6X 3ZGIA 3VCCA 1HO1A 1FZKB 4FZEH 1O12A 1J0JA 3B3IA 3IJ7A 4YU1A 5CJNA 2WZEA 5JHDD 3U4BL 1U2YA 4UB9A 2WKLA 4K7VA 1OB0A 4QCIA 3TA3D 3WXWL 4QDGA 5IFHL 2QQKH 1HNGA 4IDJH 3GHBH 2XG9A 2QQLH 1WAAA 4H20H 4JTUA 3O8AA 4J6RL 1U4FA 3BESR 5EORH 2JKAA 3U9UA 3EMQA 2FX9L 3H2NA 3JZEA 4F0RA 3QWOB 5EV7A 15C8H 4JEQA 3ECUA 4R97B 1R5VB 2CR0A 4MZYA 9XIMA 3FH5A 3HHSA 4HC1L 1JRHI 2BOGX 3SCQA 4K3EH 4ZAKB 3QBTB 3QUKB 1UH3A 4IJCA 4XI5D 2J55A 5D2WA 4FZ8L 3QXAB 5BZDB 1CICC 1IV8A 4P49A 1XUZA 2QHAA 4Z77A 3UWVA 3QG6A 4LP5A 5FA3A 1CBVH 4GAGL 1WG3A 3ROOA 3SE8H 1AYRA 3DO7A 2OLHA 3F12A 5A6BD 3Q2CA 2QAFA 4XX5A 4WW1A 3MUXA 1TA3A 4PREB 2OL3A 2AGJH 5HHQA 5HGAA 1A6ZA 1EAOA 1KBWA 1YJDH 1F74A 2F5BH 2FZ3A 1CK0H 2EIKB 2HKFL 3HE6B 4PV9B 1ND0A 1OP3H 5BS0A 1QR7A 5E6RB 5GZNA 3T9WA 1S3KH 1LBMA 4YFLI 2IAMD 1VACB 3FB8A 1R9XA 4YTSA 1MY5A 2D8KA 3TWCL 1U2CA 5J6GB 1G7MA 1HINL 2VEIA 3HKZA 2C4XA 3VOJA 5KW9H 5JW4R 5D1XD 3TA3C 5BNKA 4PJ6A 3MRDA 2UY6B 3PYCA 2QF8A 3NJKA 4LT7A 2UWEF 4IRZL 3PWNB 1AACA 2PDLA 3MJWA 4NKIL 5F1IB 3PTQA 4Z2GA 4E41D 2PO6C 2O5ZH 3W2UA 4HS3A 3MUGB 4ZJ9A 3UZVA 4FQCL 1YPZE 4JKPH 4KC3B 4UTFA 4ZYKB 1EFXB 5AKVA 5C0FA 3L3DA 3D0LA 1XF3A 3AIVA 5I3HA 1TJHL 5H35B 1LJYA 1XDMA 3SBWA 4AVHA 1BWKA 3V5HA 1JGVL 4CVXA 4XZUB 4DUVA 1RCXB 2QIWA 5MEPB 3KLDA 3RA7H 2XACC 4ZX3A 3RBSA 4JS7A 3EH2A 4XXWA 2YC1B 5LLIC 1AS7A 2Y36H 1AXTL 1NWPA 5BRQA 4LBAA 4AC1X 3UP8A 1ZHKA 3DZ1A 5FB8B 1DE4A 1K9DA 2QUTA 1KLZA 5LCVA 4MBRA 1M68A 4L18A 4M1DH 1P5VB 3CLFH 1UA6H 4JHWH 3T8VA 3V0VA 4HHMA 3WQFA 5IXEA 3QNYB 3IFNH 2XTJB 4F20A 4YSAA 3JYBA 3KPNA 4LCUB 4W6XB 1YEEH 2WV8A 1A80A 2VURA 3CQIA 3L5WA 4FNUA 2D2CC 3VE9A 1PYWA 4NFBA 4OUEA 3SCMC 2HT3D 3KLLA 1H50A 1BGAA 3E96A 4MMYA 2V5YA 3UO1H 5HHNB 3H8AA 2CUIA 4GG9A 3C60B 4Y2OB 3EGXA 1B3OA 1PW3A 3OXRB 4WFFD 4Y2OA 4DQAA 1JPDX 2NY5C 2X4TA 1BBDH 4LLVA 1WKEA 3KP1A 4HGKC 4IXXA 1LK2A 5D2LB 1V5JA 3LEPA 2FWSA 3V52L 4K2UH 4AKOA 4XAPA 4AAJA 4Q6YA 4KZDH 4JMNA 3FUNA 4Z0JA 4NN6B 4E9VA 1YMMB 2G9KA 2B7NA 1LNUA 2R0ZH 4FQHB 1CLCA 2OMTA 3OG6B 3GIYA 4AVFA 1Z3GL 5BJTB 3V0VB 3R5EA 3R1GL 5A16B 4I4WB 4O54A 1SJMA 4ODTH 3UA3A 2BOCB 4GQ9L 4H19A 4JXCA 2W91A 4PWGA 2XVLA 2VO5A 3DTUB 1U8IA 2D3LA 5IB5A 2BGQA 1MIMH 1I3RA 1PCKA 2VFDA 2WHKA 2B4CC 4XBMA 5F7YC 3PGFL 3WFHB 3SDXE 5ERWB 1NJ9B 1BFNA 1LORA 1OT1A 2VC2L 5EU4A 1D5MB 4Z1YA 4ZUSA 2Y7GA 2JJVA 5DK0B 1AHKA 1KENL 3TEZA 5GGRY 4DWSD 4LOCA 1AAJA 4W86A 4KQ3L 5D4JA 4YWSA 1SN5A 2VITB 3F7YA 3I6GA 2UZ9A 3QZOA 3MHGA 1EHKB 2AXGB 2AXWA 2DMHA 4OGQC 5I71C 1V55B 1OJXA 1KW1A 1J9SA 1V0MA 1DUYB 5EA0H 4I2XE 3TEUA 2PWDA 3MGTA 2I07B 3FNKA 4UAOB 2AQPA 1IQDA 4NRXB 3BN9C 5IG7B 1RD6A 2DEPA 3EMCA 2AJYL 4PZVA 2VLJE 2GBUA 3U7VA 1FYTA 1JF1B 1MJ7L 3HS0C 2VCCA 3V4BA 3ZGHA 1MW2A 5EU6D 3CXFA 5I6PA 3MCLL 4MNHA 4O14A 4H7VA 4MXQC 4N2BA 2UYLB 5F89B 4HFUH 5CGQA 3UESA 1BDYA 1B3XA 2A9CA 1KN2H 5B8CB 1T7XA 2X1WL 2YJQA 2QQ6A 5LXXA 3ILPA 4YHYB 4X99B 3W1ZA 1QSFB 3CZSA 4MHHI 2GSIB 5ALBH 4HNUA 3L9YA 5AAWA 3PWVB 2YPLD 2EYRA 2Q7YA 4S1SH 3SDAB 1T2JA 5DGRA 4MZ3A 1VKXA 4ERAA 1RUPL 4QITA 2R7EB 4BQ8A 3A4XA 1WNOA 1E40A 1BVKA 3DDGA 2WGXA 1WQVT 2X53A 4PIBA 3ROOB 3RVXC 1U8JA 3TT3L 4U1NB 5CEZH 2JMRA 3B8DA 4KX7A 2PC8A 3DPBB 3T0XA 1G5AA 4RAUA 1OSZB 2AV7B 1KJ3L 4QAWA 3BUYB 1NWTA 2QSVA 4G1NA 4A2LA 4XC1L 2H8ZA 3D1MC 4W9CC 4PJFF 4PC8A 4A38A 5FUCE 3SPCA 1OCRB 1VP5A 1JHKH 3ZRCC 5G4EA 5I75B 1ZDSA 1P43A 4UFMA 4P2RA 2K0RA 1VCAA 3MLUL 3ULUH 3EA1A 4Y7EA 1KFLA 2GIYA 4OJEH 1TVLA 1Y6NR 4GCXA 3WZ0E 1NBZA 1QP1A 3L4XA 3U9UB 2E67A 4K3HA 3U2CA 2J8UE 2OMZA 4U7KA 4RAHA 4UQBA 1LZOA 1TX0A 2BCKB 2XZAL 3VXSD 3CDYA 3WS3A 3W9EA 4GSXA 1PD0A 1WEJH 3MLTB 3DI0A 2XA8L 1AJ7H 3B3IB 3JXAA 2AHIA 3NQGA 3MACL 4WEBL 5KVFL 3CZLA 4WTQA 3RWEB 1CLXA 1KJVB 2W92A 3K4WA 3ZWSA 1BQRA 1W54A 1IL1B 1XDTT 5JXAH 1CURA 3NZGA 1LTDA 4OY9A 3WLQA 1YE4A 3MNDA 4HNCA 3SDCB 1JCVA 1QBLL 4OVXA 1NCWL 1I9JL 5DO8A 5IT2L 3GKFA 1EVUA 3G0UA 1U0QA 2QTEA 1XYLA 3OPSA 1JZHA 4MWAC 3WFZA 1IM3B 1Q38A 3W7NA 2MCMA 1BYOA 1DQDL 3AREB 2J8GA 1RBOB 5DANA 5E9DE 2AQWA 2OZ4H 2QKIA 4JN1H 3QHZL 1P4LB 3LPGA 2GI0A 3T2PA 1ACCA 2Y5SA 3EX4A 3M86A 3NTCL 3QJVB 4GI9A 5DJ6A 3GVRA 1E9IA 3NR0A 1IILE 2Y2TA 1MRCH 4LSSH 1QZNA 1HHIA 2V6AA 4OLYL 4Q6IC 1GORA 3NK3A 5E7FA 4WY0F 4HPOH 4L1LA 1JXJA 2CCVA 4AG4H 4I0PD 2W0LA 2NUTA 1E1FA 3BH9B 4LHUA 1OINA 1RLWA 1HN1A 4AVOA 4LOEA 3CB8A 1ID5I 2ZFAA 4GBXB 2HRPL 2OCJA 4Y88A 3DBPA 4YDVB 1LK3L 3VWJC 2BVPB 5ACZA 3HC0B 3ZTCC 2UZYA 4BEIA 3DJRA 4Y8DC 4NJGA 4MKMA 1CT8B 4A3YA 4OLUH 2VSDA 5F3HB 2V2TA 4PUMA 3BKMH 1KG0B 2ITFA 5EBLA 2NY2C 3V7MA 1XCFA 3NFSL 5DYFA 1JZGA 5E9DB 3ZYOA 3KLAA 5CEWA 5CILH 4LAQH 1TIWA 5JW3H 4BQ9A 2TSBA 2YL6A 2FFCA 3UWYA 1J5DA 5GRYA 3WGUB 5DC9B 4Q9CA 4MB3A 1KELL 1ZNNA 2PP0A 3B05A 1ZTMA 5EEXA 4W9LC 4LC6A 4BF5A 1GMIA 3S35L 2H26A 3O6KH 1LBFA 3GJEB 4V27A 5JH2A 5JIWA 5I06A 3DX1A 3VCLA 3NFUA 3K30A 3TFBA 5AYUL 3IS4A 3DFPA 3BQUC 1MELA 3D34A 4E9QA 3Q2NA 1U21A 4HGWB 1OHLA 2ZDRA 4FF7A 2ZKXA 2GIXA 5C0CA 5C6WH 1DXEA 2DQDL 4X4XB 2ZBTA 3DVGA 1HXKA 4WTWA 5CLWA 3MYOA 3PFMA 3LI1A 4JX6A 2JK5A 2JELL 2GK1A 4AB4A 3HMXA 1I1AB 3A9IA 4LW7A 4JIIX 4JYDA 2BSBA 1XBRA 1FFPB 3PIQA 2YZ1A 2NNAB 4R96A 4UTCA 2CO7A 4GLRH 5K4ZA 4BK5A 4P9MH 4F37K 3KLHC 1IM3A 1T66C 2PNDA 1KGCD 1MMFA 1VBRA 3QULB 2MPAL 5I3JA 2BDNH 4CD8A 2X0HA 4NG3A 3K6NA 3OWEA 2ZSWB 2XV6B 2HT2C 3BKYL 4WI9A 1CQKA 3GTNA 2C3ZA 2FIQA 4UFLA 1M5WA 2HV5A 1OGBA 3QF0A 3BIKB 1JHLH 3OX8A 5FUCC 3IARA 5CPNA 2G5RA 1FQ9C 3DX6A 2GITB 4JEGB 3KWWA 4X7TA 3KYOA 5GISH 5I17A 1JZ7A 4ZXOA 1OSPL 3ARGD 3IVSA 3ISIX 4BZ2H 1EX1A 4LCWD 3S3DB 3RM8A 1T1YB 4AL8H 2OMXB 2YPLE 2VDLH 4XBPA 1VF5C 3CC1A 1EGZA 3ABOA 2FWUA 3AB0B 4DN3H 2O56A 3B8WA 4ISVA 3ZTNL 3UTQB 4N28A 4GY4A 3LNGA 5KYUB 1ZLUK 4G8IB 3US0A 2R1XB 3VFVA 3C86A 3BZEB 3H21A 3LLXA 4Y4FB 1UEMA 4AZHA 1NMCC 1XC6A 2GGEA 1UM4H 2LU7A 2WZTA 1ET5A 2NX5E 1NBZB 1RAKA 2IXVA 3EOSA 1WDPA 2QGHA 1XR9A 2ZXBA 2IBBA 3MNVB 3P4MB 5BPPA 2OXGA 4JD4A 3I4EA 3O6YX 2FECI 4CN1A 4AFYA 1HU8A 3MO1B 5D70L 5TDOB 2B39A 2B20A 3SODB 3VXSE 4B9IA 3K13A 3VU1A 4S39A 2OK0L 1ADQL 2NXYB 2Y6SC 2MUCA 4YX2H 5ADPL 1ZAGA 2EZ0C 1FNLA 4R4BB 2XN1A 2QDVA 3QS2A 3BLKA 2Z4QB 3PC0A 1M2VA 4U6HB 4UZUA 2KH2B 2EKSB 3SKMB 3D3AA 3FA3A 4JNYA 2WQXA 4AW4A 3JWDL 1XLLA 1M7IB 1SMOA 3ESUF 5KOMC 3M41A 3H7BA 3I3DA 5G1YA 4EBQH 1PTZA 4Q4EA 1P2CB 3GINA 4GAYA 3VNZA 5J11C 2WWCA 2O5NA 5D8JH 1JTOA 1JK8A 4RMTA 1JPMA 3IIOA 4JIHA 3KR3H 4LRTA 1FO0A 1JUEA 3JV4B 3B2UD 2LLLA 1T6BX 3GK0A 3VGAC 1U8OB 4M03A 2MOVA 3X1FA 2XFXA 5GZOD 4JFYA 4L2LA 2HKHL 1FYHB 4RV8A 5C0IA 2TMDA 4KRNA 4B7LA 5I3KA 2E25A 7REQA 4AZ8A 5DZJA 4ADGA 2YK1H 1OAQL 3D2TA 1D3CA 1DUYA 1SZNA 1OB1B 4BSWA 3KGRA 4ORZC 4UDTA 2X28A 1EWHA 4B9GA 3BPOB 2QKSA 3NCWA 4N1CA 2X7LB 3BCFA 4NQCE 3LGGA 3N15A 4GYPC 3WK1A 5TFSH 4XAGA 1F6LL 3LRGA 1DJXA 1Q72L 2HFEA 4BR1A 4GMSL 1UUNA 2PXYD 1R5YA 2ZRUA 3SGEI 4GB9A 4H8WL 5ERWA 1IAIM 4N2DA 3GIZH 1Z7AA 3IRZA 3S3PA 1M4KA 3OQ8A 4ONGH 1QFWM 1U8IB 5EO1B 1NELA 1BZ7B 4XNYL 3FU6A 4FDWA 3CAFA 4PJHB 1RPKA 4MRCA 1F4HA 2CBPA 5CUSH 3FXGA 3MOAL 3PUOA 4JN8A 1YUKB 3KBHE 3P0GB 3N41F 3QAZC 5FJTA 4LSQL 3OOQA 4UIMB 4Q74A 4IMLB 2DYPB 4KCVA 1XLFA 2X4OA 5HJLA 5TE4L 4JTJA 4JO5A 5CH9A 3PV7A 1DVFA 1Y6MR 2E3VA 4S1RH 3WJJA 1PCSA 4BK8A 3LQGA 3M7WA 2H32H 3MMWA 1KLFB 4KI5E 4PRID 2I32A 3EX6A 1CD1B 1UD4A 2BZCA 4RA3A 5D1ZB 3R8BB 1YXDA 2AJ3A 3T0BA 3L54A 2EG7A 2VEFA 1AD0A 4XVSH 4ZL1A 5AECA 4DNMA 1HH6A 4NGHH 1MXGA 2MCAA 4LDCA 2YR3A 2E27L 3B9VA 2FDMA 4JRYD 4ORIA 4NYLA 2CGYA 5C9KA 1EKOA 3IJDA 5HI3D 4DBDA 4PMZA 4GBXD 5IEHB 4W8BA 1AXSA 4OE7A 3W1RA 1DO5A 5M17A 5DVKA 3EPMA 4GXVL 4ORGA 1P5VA 4WUIA 3T3MB 5A6BA 3FRPB 1EAQA 2FB3A 1TPVA 2ATKA 2ABAA 5L2KB 2J2ZB 2K70A 1AQKH 4WJ5A 5EIQA 1UURA 2VZSA 4HCRA 2LV4A 3FO1A 4NKIH 5M94B 1D8CA 1F11B 1KTDB 3DVIA 4JKKA 3G5XB 4LEOB 4A6YB 5HD8D 1X9LA 3FN0H 3ZJKA 1ASOA 3IRCA 3VI3A 4N86A 4GS7C 1BFVH 4P5SA 4QPEA 2W95A 2VLMD 4XCFL 2I9UA 3MJ9H 3LHUA 4L4LA 3CPUA 3DIFB 4G1EA 2BVTA 2AKRA 2BP0B 2DLFL 1RZ8A 3HR5B 4JUTA 4XO5A 4YHYC 1JAKA 4HSHA 5B1JC 5FYJL 2R8SH 2PSNA 1TPWA 4ZYKA 3M5YA 3LEVL 2VC5A 2YDRA 2NXZC 3DGCR 3UYPB 5IRPA 3BW4A 1JPTH 3QCUH 5A2CA 3A4AA 4B41A 2WM0A 4L4VB 5RUBA 4ES9A 3F4NA 5SWZA 1U5HA 4HIXL 2G5BA 4LUJA 4OGYL 1UIOA 5IZ7A 1LT8A 2NQ3A 2OAAA 1D6VL 3WFCL 1JQXA 1FNAA 2GJ6D 2MPVA 2CWNA 3S9ZA 2XIIA 3POCA 3FY1A 5T26A 4RISH 2WLJA 5CWSB 3IPEA 4PV9A 1F3XA 4Q6KA 1IYXA 2J9XA 1CIDA 1I1FB 4W4OC 1RZJL 3SKOA 1YC7A 3CDGB 2QCMA 4XHQA 4PUDA 4PQXA 4QRQA 4RUBA 4NO5B 5F6IB 1P53A 4WI4A 3F12B 4JDTH 5F7WC 4TLUA 1VPOL 4HK3N 3GZOA 1C90A 4PR5B 4U1SB 5IWLA 3CLMA 4M6QA 4ZGYA 3QEUB 4OZGF 3G1XA 4QKXB 5IMOB 1AG0A 3POHA 5BZDA 4Q7IA 4FRWA 1BZQK 1FC1A 4N2KA 1QBMH 4FQ2H 3KPRD 1KBPA 5D4YA 3TR2A 2PCPB 2EDMA 3T71A 2IKGA 3DC0A 2CNZA 1KBIA 4ZQRA 5I1KH 4JG9A 1EJSC 4GQ9H 5HSFA 1ZFJA 2F9RA 3H2MA 5C3LD 3AUOA 1E8YA 3QWOA 4JJ5A 4AQOA 1HHJA 5DURD 4ZFZA 3AU2A 2YD5A 1A8JH 3HZYA 4QHKJ 5F7HA 1A14H 3PG9A 2IO5A 1BD2A 3PGFH 1QSFD 3NIDE 1NFIA 1ZHBB 3BVTA 2CD0A 3DOSA 1R3SA 4CCZA 3PQYE 4JFUA 3F84A 5AVUB 1RJYB 4V1DD 1H15A 4WWKC 4GK8A 3DRQB 4KQ3H 4UQCA 4WFGE 1E4WH 4XBGA 3G6JA 4JDVB 4XMTA 3BFOA 2L0DA 1AJZA 1UC4A 3NSMA 1VAHA 2J8FA 3K5XA 4XX1E 4PMDA 4A21A 5EU3B 4LSTL 2VQTA 4GUHA 3JZUA 3K2KA 3AOFA 4E38A 5D09A 1EA9C 3VYOA 1M41A 2I57A 4NHUB 3D09A 5I9QC 3FAWA 5KSBB 1TZGL 4YNYA 3GIPA 3H6OA 4C4KO 3SCOA 4GKNB 4YXHL 1LOSA 2ZOTA 1GYCA 3W7GA 4PN6A 4Q6XA 3AC0A 2IAAC 1OZMA 3IACA 4XN4A 4DZBA 3U48A 4HG4J 5BZWA 1VBGA 1NAKL 2X4QB 3THML 3OD3A 3HBPA 1XDLA 2BERA 4Y5YB 4IIBA 3ZE0E 2ONEA 3PP3H 4LU5H 4W9DC 1FL3B 5E51A 1KTRL 5A6IA 4B7IA 1N19A 2J20A 3QEGL 2H6PA 4FI6A 2CJ3A 2JKSA 5AVYB 2GFBB 3PTMA 1I4FA 3QP3A 4R7VA 3HG4A 5E8NB 5GGSB 4XVJL 4CBZA 1ZWIA 1P1ZB 4XOEA 4D0CA 1I3GL 4G3YL 2LTQB 5IFPA 1H5BB 4F8QA 5I16B 4I77L 1NGPL 5T5FH 3EZJB 1DHPA 1WP6A 3ZVHB 4Y4KD 5D6CA 1DZ0A 2PU0A 4UM9A 3WLIA 3E6HB 3FJ6A 3D33A 5DDHA 1JHKL 3UTPE 4F7PB 3THCA 1FWRA 1AGDA 3S3CB 1JPSL 3KOWA 3W01A 8FABA 4GY0A 3O3AB 3HGRA 2Z7ZA 4FQXD 2NV1A 3V5OA 1FVEA 2DD8H 3DRTB 5EOTB 1NAMB 2X2UA 5CC5A 1QTYT 4UDUB 3WTWA 3IAPA 3H3KA 2XZAH 5CSGA 3MSGA 2HRHA 3GMLA 2HH0L 3IDIB 1MJ8L 4H8WC 1Z5LA 4LVHB 4XCCH 3KVDD 2RALA 4WY7L 4IU3A 1F41A 2OMUB 3SDXF 1WSST 4OD3H 1TTAA 3KW7A 3MACH 4K9JA 4WEBH 3QRGH 2ZUSA 4YSCA 5FO7B 2P0OA 1HHHA 2X0UA 2RQEA 2DI9A 3T4YA 1MEXL 3IFLH 1VZWA 4H4IA 2IPUK 1HO4A 1OD9A 3CUPB 5JXAL 5D72H 2AMXA 4QOKD 5FCZA 1A7BA 4DT2A 2QPUA 3HI1A 4NEHB 1M9WA 5CEZE 5E6ZA 4UTWC 2E86A 3IBOA 4Y19B 5D2NC 5LB1A 3TX4A 2NY1B 2Z91B 5IT2H 1UC6A 3HHMA 3VXUA 1SR0A 3PZOA 4P8XA 2OP4L 4MMXC 2VJ8A 2Y3AA 3TURA 5C0BA 1I8MA 1KXHA 3FO9B 3W76A 3KJ4B 3CH1B 3CSYB 4MTMA 3FL7A 4X80L 4AH2A 5L9DL 2WZ0A 3QUYD 1YEKL 5E9DD 1EANA 3IDUA 3L17A 5HPMB 2OJZL 4R7DA 4KGLA 5K39B 1JZ2A 4PJCB 2E6AA 1CGYA 2ALWA 1AL8A 3C5JA 3H2CA 4JFPB 5AVVB 5HGBB 1BJ1H 3DBSA 2INZA 3NQDA 3JV6A 1YIXA 3J8F7 3GG1A 1U8PB 1O4UA 3KM8A 3LI0A 5C09A 2RHGA 4OIIH 1PLAA 4NQEE 3RTQD 1V93A 1E0OB 1U8HB 3BPWA 5CJOL 3BGFB 4WHDA 3ZYZA 4ODHL 4F0KA 2Q9OA 5DRZA 4QLRA 2F61A 4AG4L 4MX7B 1EC9A 1LQAA 1LTXA 3ASOB 3CMOH 2DDXA 2Z2UA 3UTZA 2V0AA 3QK0A 4MX7A 3Q4DA 4ZSTA 1JZJA 4N6RA 1PS3A 3RPBA 1IU1A 5ALCH 2ZPKH 5HYJD 3CT2A 3ITOA 4LCQA 1NGQL 3RZCB 4TNWF 2FGZA 3L4UA 1RK0B 1TNMA 3C75A 3QQ4B 2OV0A 3UTSD 2LQRA 1N55A 2VT0A 1ZJAA 3H8NA 3H7LA 1A7PH 3HB3D 1OX5A 4NN7C 3H12A 3SFKA 2AXJA 5A2IH 3DJSA 1QNVA 3BKML 3I6SA 3O3EA 1HK6A 4G8TA 4O4VA 2AQRA 2N56A 2A74A 1Y8BA 1ZLEA 2QGCA 4OAWB 2J1WA 5CG7A 4P5TB 4MNQA 2ED8A 4V2BA 5PTDA 1VQTA 1PL3A 2Z31B 5I15H 4M6ML 1EV2E 4K7PX 5JLZA 1N6QH 3N4FA 3U2JA 5DD1L 4OLWL 1F90H 3T0EA 2ICCA 2FJHB 2W9EL 4AWUA 4ROQA 2V5JA 1CTOA 4DWDA 2ZCZA 4IISA 3L7EB 2HLAB 2C1IA 1OK0A 1J5HA 4L80A 4NRRA 1YY9D 3OKLB 2P5ED 3BP6A 3QDGD 2LFEA 4YXKL 3U79A 4F33B 5LXVA 3QYMA 3Q06A 1FNHA 1RPXA 1G5GA 2XN9E 3KHOA 3MSYA 1KYOJ 1PKQA 3MV9D 1IKFL 1I7ZA 1E43A 2B16A 3BVNA 3QIUA 3WO4B 4CSSA 3DRTA 1RP8A 5EPMA 3ZE1B 3ZKXB 3UP1A 1V6VA 3VFPB 2Y85A 4P9ML 3A6CH 3F62A 3QMRA 1I2RA 1NUDA 4X6FA 4YVPA 5JQIB 3KDPB 1E42A 4Z76B 5JHMA 4XAFA 3HB3C 5DDHB 4HJWA 5FOBA 4JTQA 4EOWL 5HNUA 1W91A 3GI8L 3ZE0F 1G9MH 3TSBA 5CJXA 1I9CB 4LPCA 3HW7A 3R94A 1W1B1 3TOYA 3O3BA 1ZT4B 4WKAA 3ZO0A 3N2OA 5AVQB 1ZZMA 1VERA 1P1ZA 3DIDA 3OKEA 3NCMA 5CIPB 1TZ8A 3G5EA 5F97E 4Y4KA 2DUZA 2AVGA 3PRZA 3V5KA 3TA6A 4M43H 5GJNA 4ZE5A 1B0GB 4YAQA 1S5VA 3DV6B 1FYTE 2R2HA 1UQZA 4XXDB 5FO2A 4U1IA 2EKGA 4KESA 4MNJA 4Y9MA 5C9XA 1LO4L 3KJ6H 1R3LA 1AZNA 4NO2B 3S4SG 3PJSA 3NK4A 4C1NB 4PULA 1U33A 4EPBC 2X4QA 1TENA 4QF1A 4PY7A 1NMAL 4HLZG 3AG1B 1EMTH 3RB5A 1H9VA 4L8CA 1Q9OA 4AZCA 3CUIA 4AVNA 3A4EA 3WENA 3LNFA 1YHPA 2FD6L 2RCSH 4M93B 1MZHA 3BE7A 3AXHA 3EWDA 5D70H 3ZKMD 2NNFA 5DHMC 1BJ8A 1BMZA 1QSEB 3O2VH 4OLXL 1TJIH 4KTEH 1GAFL 3BAKA 3E2HB 1QLRB 2AK4B 4P2CG 5CIPH 5TDNB 4QISA 5KSAA 1UB5A 1F8IA 1RZFH 2X89A 2E7DA 4TQEL 3O9WB 1GVQA 4KO5A 3NAAL 2BVQA 2DLHA 1UOKA 2EIZA 4Z95L 4OD1H 3RUGA 1JCXA 3MMDA 4W89A 3TYCA 5DXYA 5L6UA 4AHOA 3IPWA 2FT7A 4OTXL 5AFDA 3F00A 3FKUS 4MTVA 2RGSA 4DGYH 1BJ1J 4YPGB 1KFKA 3WHE0 2GJXA 2M83A 1E6JL 2KT6A 1DVJA 1CFQB 4HIQA 4FG6C 3QR1A 2ZADA 2YAMA 1A9EA 1F18A 4D3CL 1JZ4A 2XA3A 4LCIL 4PRIB 4ZRGA 3K3QA 5J6SA 3HHRB 1HAWA 1B4RA 1FBAA 2X2GA 4LALA 3ATFA 3EZ4A 4C6FA 3D2UB 5F0JB 2ZX9A 25C8H 4P2AA 3DCPA 5DFAA 3QRHA 5A6TC 4A3QA 1OARL 5I6KA 5AKRA 2JLLA 4OLZH 4M7ZB 4X63A 4DJFC 4AC4A 5LWYL 4JGMA 2XUCA 2IGTA 4OLVH 4ELKB 5IEKA 1DIEA 1UZ1A 4DM1A 2IDUA 3C6LB 3WNMA 5HYSA 1P6AB 2ZSVA 3GBML 4Y9PA 3NJMA 3R8HA 4PRPB 1Y5VA 4Y5VC 4ZT1A 3W83A 2OLDA 2ISVA 2L7UA 5ABZA 1HI6A 2ZA1A 1JCMP 3SKOB 4UT9H 1QRNA 2WYIA 1PCXA 2YXGA 2ZRZA 1NTDA 5I75C 2OR2A 5DZPA 2WW5A 2N7BA 5DQ9B 2E6YA 3U8GA 1DEEA 3KHDA 3G2GA 3RLSA 2GSGA 1MFEH 3T44A 1W3NA 1EEXA 3CVDA 3BISA 3QPYA 1Q8JA 2CRMA 1LDPH 3AU1B 2ZX8A 9CGTA 4KDWA 3MLZL 4G80A 1J8VA 4PG9B 3ZDYB 3CQKA 5MENE 4HETA 3IKCA 3UYRH 2H5UA 5FJIA 2ZCLL 4MIMA 5CUSL 3TYUA 2QLVB 3MV9A 5AL8A 5TF0A 2PPFA 5C2BL 1WFTA 3MA7A 2VDQB 3UFYA 1DEEB 3IIXA 4XAWL 4F9PC 2WWMC 3N85H 2ZG1A 1XGRB 3TONA 1AP2A 4MD4A 4LYPA 3FQUA 3H9HA 1A6AA 3QMTA 2CYGA 1MKFA 3I6LD 3C2OA 3AVEA 2H9GA 3LRLA 1IGCL 3KPPB 3FSVA 3CAQA 3DX5A 3O07A 2VXQL 1CXLA 5MEOA 2RR3A 2YQ3A 1FX6A 5B21A 1T96A 1OGSA 4GW5B 3QDJD 3U0TA 3VQLA 3WLKX 4RGNC 3LY0A 1KCVH 4YHOH 5DMIL 3ISWA 1ZPLA 1T83A 1E6NA 4TX9A 2NR6C 3G5XA 3W0WD 5J9PB 4AY7A 1EZUA 3M88A 5L4JA 3FCSB 4EJ1C 2A6KB 2DN7A 4QRUA 4GXVH 2GSJA 1FDLL 3SUVA 2WVVA 4PRIA 1AL7A 4N4PA 2DM3A 1U4EA 5D7EA 1AQKL 2AERT 4I18B 1CLZH 1AXSB 1V7NH 3WOVA 4ZK8A 2ACQA 3BP5A 1YPZB 1PPIA 1ZXKA 4US5D 3IJEA 1U9KA 4G6JH 1HYSD 3ZDXB 2EILB 5TF1H 3HUJE 2XSXA 4YHZH 1UWEL 3CFBA 2X30A 4UFHA 2FNBA 2Q86A 2YS4A 3VYPA 5BRZB 1XR2A 1ODZA 3GSNL 2R8SL 4HUXB 3G6MA 4LSRL 2WWMD 1G69A 5E9NA 3ONCA 2GYSA 4RE4A 4BFAA 2AK4A 3PDDA 5TDNA 5A6KA 2X9WA 3VSUA 5E23A 2XIQA 3DJZA 5T8IA 5TE6H 1TYJA 3WTTA 1TEFA 5DXWA 3T8LA 5C08E 5KBKA 1T89C 4KROD 3N1PC 4V1DB 3KYKH 5FGSA 2FVNA 1LE5A 5FUOL 1XYFA 2HPMA 4NS0A 4PY7B 1OPGH 4AV4A 3L12A 4JTGA 2YPIA 4RESB 1EX5A 3I3EA 1Q63A 1NZRA 2XIMA 4FXFA 4I8YA 1FGNH 4KO6A 4PJAE 5J6HA 1SY6A 4JPWH 2W6RA 2IQAA 3W23A 5EEUA 2O92A 3G18A 2F53D 4TOQA 4WUUA 1RZJH 3U4EB 3UQNA 2V3DA 5EU6A 1WHOA 2JJTA 1SXNA 4AYID 3W84A 2K9UA 1MEHA 1KPRA 1GKOA 1ECYA 4JDTL 4RBPK 5CIPA 2EXTA 3ZQWA 1KULA 3AACA 3WFDL 3V4PL 2R91A 2W5FA 3W7RA 1WFIA 2P5WE 3QO1B 3JUGA 2D2JA 4K5OA 4YSRA 4AEFA 4D8OA 2VDIA 5K69A 1SZGA 4FQ2L 4KY1L 7REQB 1MWAH 2C5DC 1AZ1A 1X5ZA 1PKNA 3RY6A 1S9XA 3HFTA 1LQ0A 3EDEA 4HK3J 2PW2A 3LS4H 1NVMA 4BZ1A 3CV2A 2H9AB 3ELFA 4FG6D 4S1QH 4XZBA 4ELME 1OALA 2P5PA 2HZHA 3GSXB 5GRUL 1OKEA 3N2BA 1X5GA 5KJRH 1OEPA 4NHVA 1IIGA 3HJEA 4S1FA 1PKQB 4H88L 2GABA 1F6AA 5IB4A 4DP2X 5JIQA 5GNYA 3BDYH 1QWGA 3EO0A 2DQIL 1ISXA 3BH4A 3B9OA 3CHXA 3PGCA 1YMMD 1E4WL 1RJLB 1TIUA 2EXYC 3N3TA 2IANB 4L3AA 3MDUA 2Z4QA 4QXGH 3V6ZA 2A7PA 4LSTH 3VOCA 3NG5A 5DMKB 1DQVA 4OZ4A 3C5ZD 4KQ4L 3M0HA 1GOMA 4K7PY 3BWUC 4PB0L 3KM1A 4XNMB 1UR9A 1OCWL 1TQVA 3PLYA 3QWRA 1UPPA 4U6VL 2EDFA 2AQNA 1EHNA 1FWFC 3VXQB 3FPXA 3MNVA 4G2DA 4N2CA 2BS71 3N9RA 2X0WA 4LAKA 1IJ9A 3E3QE 5KN5A 1CFVL 4RGMB 5HGDA 3MZNA 4HS8H 3WG6A 3W7HA 5DJXA 3N6JA 4QIUA 1T2XA 1R2SA 2YBUA 3V6OA 5HY9B 1GGIL 4JRLA 1BF5A 3NQ8A 2X42A 4PRHA 1B3ZA 2ZZ7A 4W8AA 2YB1A 1EX0A 3SKJH 4AJWA 2Y5JA 5IV2B 3J27A 4F57H 3G9AB 1UCWA 4X7TB 2NXGA 3BWAA 3GSWB 3O11B 2WXFA 2PRLA 3NL2A 1DLHB 5EBWA 3W0WA 4RFNB 2LT9A 3REVA 5F8QC 4OI9A 4L8BA 4PHXA 4GSUA 3E2SA 1KCBA 1SOSA 4JKWA 4LLQB 3QDHA 5BQDA 3W2LA 4PAZA 3M7FB 3SO3C 1MH5B 2OLAA 1IB5A 3RIKA 2X70A 3SBRA 3AYRA 3WLTA 4FXRA 4NJHA 2LVCA 2OKMA 5J11B 1OFOA 4C6PA 1ZTXH 2HH0H 2JKNA 3H9SD 4PRAB 4C59B 3IAGC 3EPOA 2B0SL 3VFWB 1IBGL 1T21A 2DZTA 4M6UA 4FAMA 2FPYA 7FABH 4HGWA 4Y5XC 2F8IA 3LXAA 4MA7L 2FQGA 1B57A 3V5DB 2O4MA 2QT6A 4DJDD 5H8MA 3QW4B 4IF2A 5IQ9B 1K5WA 4AWEA 3DUGA 3NYDA 4NQEB 2J8HA 4YXLH 3GK8H 1NFPA 4L9ZA 5KZ6A 4PB3A 2JEPA 4PTUA 3I50H 1PXGA 5D72L 1ZLWK 5FO7A 5F2FA 1PTDA 2OQLA 3LHZA 4TNWK 4KEZA 1MCIA 4B5WA 1ZA6A 4G7VL 3KG5A 1E1CB 5FCUL 4BHYA 2Y7QA 1ZVYA 4I3GA 3UJIH 4S23A 1CI3M 1E3FA 3L4YA 4GRWF 5IB4B 5LIKX 3IDIA 4HQQH 1SBSL 5IBXC 1KNWA 2WUCL 1E0WA 4A05A 3DK0A 4P46D 4QJ5B 1UWQA 3W2MA 2AJSH 1R5IB 5TGBA 1W3KA 4YIWA 3RCMA 3OB0K 5G5DA 1LEIB 1URIA 2A99A 2BBFA 1SJDA 3WQPA 2P49B 3THAA 1Z6KA 4E9XA 2PYEB 2SODB 5DD5L 4J3OC 4K37A 1DVZA 4EQ2A 1P4CA 2X6MA 3QI9B 3KOFA 1XZ0A 3B9KA 4ODHH 5DD6A 1FN4A 1YLVA 2CALA 2NZ9C 1PO9A 3AREC 3SDYL 1LQBC 1IM3D 3BEWA 4V15A 5D2LF 3T81A 1T0PB 1ZWIB 5FYKL 5C0JB 1GGCL 1PBYA 1KPRB 1A4LA 4XZWA 4X98B 2Q8LA 2Q01A 1AIFB 3MZTA 4FD0A 3WLJA 2R9HD 4TUOA 2QSCL 5FGCE 1DJHA 4ATDA 4D0BB 1A1MA 1MDLA 1A7NL 3G6JE 1OLZA 3HS8A 3RWJB 1XLKA 3CH8A 2ADFL 2ITCA 5JW5B 2EXOA 3GNDA 1S7WB 4MWAE 3G5ZB 4MYAA 3TWBA 1KLGA 2BY1A 2JKTM 2DJMA 3TBYB 3JWOL 3O4LA 3ARDC 2VM3A 3BTNA 3ZUNC 4K36A 5IJKC 1XIBA 1XH1A 2KLSA 1X9RA 2BC4A 4J3SA 1CE6A 3U9PL 5J4MA 4JHAL 1RU9H 1YYMH 3ARDB 3RX7A 3VRJB 1SJAA 1ETZA 1OO2A 5DRNB 5E4OA 2NWRA 1GGUA 4PJDF 2RFGA 4KCTA 5IOPA 1SSGA 1F90L 3K4DA 4KI5F 4KZ0A 4ANXA 3UWUA 2XT1B 3MJ7B 4WI8A 4AQEA 4M9OA 1BREA 1AR1D 4XODA 1MEIA 2WWDA 3DFTA 4LRSA 3TW6A 4AZIA 4UILH 2AANA 4J3OG 3BJLA 3HG1B 4O02A 5GSRB 3E6EA 2VAJA 4X0VA 3HN8A 2ZTJA 3K6FA 2NUYA 3QPEA 1XPGA 4HNNA 3DIPA 3WDHA 3XIMA 5FL1A 1TZAA 4QRRD 3KYMA 1LP9F 4WEVX 1D9KD 2X87A 4OQTA 1XLGA 2Z28A 3P11H 4PBWD 3OMNB 3R0MA 4PYGA 5D7IB 4IWWA 1I9EA 4ABQA 1WT5A 3ARBC 2D0FA 2IPFA 3A6CL 5DX7A 4EANA 3S46A 3D3VA 1E3XA 3K4AA 4Q2ZA 1P5BA 3SE9H 2EPOA 3MODL 3L81A 3GT6A 1E0UA 3FO2B 4EOWH 3QKEA 1FP5A 1G9ML 5HWNA 1QSED 1ZTXE 1WWCA 4CMHB 1NGXA 2IWKA 4R3SB 4Z5RA 1JV2B 1RQBA 3HPZA 4RZ6A 5D37A 2FLRT 3BAIA 1J8SA 3QEUA 1LD9A 2EVJA 1JV5B 1D9EA 1TJ1A 2QCEA 1KB5B 3ANYA 1KNOA 2XXCB 1AGCA 4PP2A 2DVTA 2WM1A 1RMFL 4EUPH 1G01A 4I0PC 3M6YA 1I53A 3CDGA 3FTXA 4LASL 1VKXB 1V3HA 5BOOA 4HNTA 3EGJA 3A0OA 1SJHA 1QPNA 3KVJA 3NAVA 2JF7A 1MCSA 4G7EB 1B6DA 4ZNCD 2E8ZA 2ZAGA 4KRPD 2YN3A 1O5KA 1KB5L 2NX5B 3KJ6L 4JZNB 3SD2A 1RCOB 1VHCA 1XXDC 3D6GA 4OJFH 3AXXA 1XX1A 3VFSA 2IADA 1INEL 1MCPH 4GVGA 4QLLA 1KYOK 4OCXL 5LNWA 3L4ZA 1EMTL 3EJRA 5HGHA 3EOYG 2Z6IA 3SECA 3CXDL 4M3HA 1D9KC 4PG9A 4RMVA 1FYTB 5I1GH 1NCAH 4ZFMA 1MREL 4KUCD 4ZMZA 4KEMA 3B0UX 3MA9L 4U1LA 1DO6A 3VQMA 2E7FA 2AJZA 2ZX5A 1MPAH 3NSJA 3IK4A 2VDKH 5DHVA 2CJTA 4PYHA 4QRSB 1N8WA 4MUZA 4PUBH 5IFTA 3FUFA 1XKYA 4KK6D 1QRQA 5LSMA 2VXVL 3TJIA 4W5UA 4TRPH 2DIEA 1ACZA 4P2OB 1EEYB 3SDDB 1NEYA 2HFGH 4K5MA 4QHLA 5T1LA 3QXBA 4JGJA 4OTXH 4AGPA 4RNIA 1AXIB 4QD2E 4BCYA 5EU4B 4OQTL 4KNQA 4LEXH 5T1JA 4D8LA 3TJHC 1XGUA 3BARA 5SWSA 4LEOA 4A6YA 3WK3A 4IRSD 1FZOB 4NJ9L 4R7NA 5CPOA 1MCJA 4L05A 4XUYA 1WBXA 1M7PA 4PWFA 2XPGA 4LCIH 3WLWD 3VOIA 2C9AA 2PWUA 3E74A 3SY8A 4LQFH 5HHME 2DJLA 3HOJA 1BP3B 4HEPA 5BJTA 4HJUA 3V0SA 3VDGA 4FQHA 4TUKL 3FB7B 2XG4A 1I7UB 1W9XA 1BQGA 1MFBH 4KKZA 1M04A 1GPOL 3F6IA 3T77A 1O68A 3SDCC 4GUQA 5HMEA 4L1TA 2OPJA 3U9IA 1W9VA 4LMQI 3SCVA 5EFFA 5D1ZA 3GGWB 4F7MB 4AXNA 3LKQA 4DKEL 4HU3A 5A69A 4H26A 4UT9L 3T2NH 3MV11 1YSOA 4XIAA 1TMCB 3DVFA 3SYOA 3DYPA 1GTHA 4DHLA 4IP4A 4IOFD 2C13A 2OT1A 3EOTL 2YXWA 4LVOB 1QUMA 4IYKA 3LMYA 3CWOX 4AF0B 4UIMA 3FB7A 2LR4A 4LCYB 3W4RA 5BXRA 1CDUA 1H5BC 1UWXK 4WI3A 1CWYA 3IPBA 1ZBKA 3BO8A 4FQQA 3DGBA 3TH6A 2JE8A 2LVEA 4E2BA 4ZQOA 2AJUH 4H2CA 2LW3A 2H6OA 1NCBH 5DI8A 2EVIA 1RJRA 2CK0H 3DA0A 4W6WB 2I7OA 3NVQA 4XAWH 1JEZA 1NC2D 3MBEB 3M17B 3AWFA 3N85L 4GLRI 4H7CA 3SCUA 5B1BB 4KKCC 1V5XA 1WBJA 4CVXB 3GTIA 3MVIA 3W7PA 3QUXC 4PGCA 1MW3A 3MHFA 3H0TB 4LESA 4QT5B 5F9OL 1W2KT 1PZDA 1KBKA 4F7CA 1QJWA 1T40A 3CB3A 1JNNL 3NJHA 3QUXB 3I6LE 2IAMB 1EWDA 2I5IA 1A4JB 3BOVA 3AJXA 1ID2A 3PUEA 5CZSA 4A22A 1KTLB 5C0EB 1KCVL 4YHOL 4XB8A 5F71A 2XRAL 4HLZH 2VMCA 1ZSDA 3VXOB 1MJJB 5L8JB 1FA2A 4K3ZA 2WJ5A 4DNHA 2GY7B 2HDJA 2J73A 1LL6A 5L4FA 4MNKA 3NURA 4EEEA 4N0RA 1SW7A 3ZTEA 4XPHL 4FOUA 4RX4A 5LVEA 3F5KA 2CPCA 4O10A 1YDNA 3WBAA 1JCNA 2XSKA 5AW6B 5HHXL 1N5YL 3WUGA 1G6RA 5JOPE 1CLZL 1V7NL 4FGMA 2WBXA 2FIKA 3SDXB 3N1AA 3MDWA 5I1AA 3KL0A 1NDMB 3GEFA 1DLFL 1F4WL 1USZA 2EO7A 2NX5A 5TTRA 3SGKA 2HFFB 5BS0B 3WQCA 3OZ9L 1UA3A 4MAVA 1ONQB 3IJHB 1XIMA 4PJGB 3OVQA 5JIKA 4X4KA 2O55A 4NC2B 2EUXA 2DSUA 1M2VB 3GSNH 4U6HA 4JL2A 3JQOB 2NR6A 5KZCD 4G8GB 4ODSH 3I9IA 1IGYB 2ICEC 3CSTA 3K81A 4HEMA 4XP6H 2V5MA 4XXCC 1LD9B 3OAUL 3PZMA 2BINA 3TYZA 1EEZA 4KJWD 4X9GA 5DO2C 2YR1A 2WMPA 3OGSA 4NT6B 1P7KB 3F7VA 4O8AA 2V7HA 1GOOA 4PMYA 3BP4B 1CVSC 1FFRA 4PRHE 2FEDC 5FUOH 1WTLA 1JIBA 1HUVA 3GRGA 1OM0A 2VFEA 3SCNA 4K6AA 4OOZA 1QLFA 4JTRA 2F84A 4WHTA 4HBCH 5I1DB 1BV8A 3EFDH 3GU2A 2D03L 4LK4A 1XRTA 4HT3A 3RPKA 3KYMB 3QR0A 5HYIA 5K3VA 4G56A 3JTSA 2WKJA 2MWCA 1WWAX 4QKTA 4TTGA 1TUXA 1OD0A 3VIPA 1XB8A 5KTLA 3GMOA 3WEXA 2BG5A 3IDXL 1V3MA 2DI8A 4HYTB 5JIHA 3EFFA 1Q66A 2WLNA 2DF3A 1OM3H 4KX9A 3M0VA 4PJCE 2XV3A 3JT0A 3KYOB 1FIEA 3MJ7A 3AUWB 1QR4A 4AQEB 1SO5A 3W28A 2Y06L 3EOAA 1M2OA 5G1TA 1RJZB 4Z7UF 3VI4F 1AQFA 2NPLX 2DZBA 3UR8A 1QRNE 5EEZA 1U8PA 1XHGA 4TOYH 5BU9A 1V3LA 2C3GA 2VUYA 4HW6A 4KEUA 5HPOA 2UY5A 3K1KC 3UWQA 3ZXAC 1G6CA 1XIIA 4AEOA 1J5IA 5GRUH 4GWEA 3QRBA 2VZVA 5K39A 4OUIA 3ARGA 4P5KA 1KLGB 5D4IA 3R25A 1KPUA 1J5CA 3S3GA 2FAUA 2N0MA 3F58L 2ENJA 4Q0XH 2Y23A 5EH1A 1H7OA 1OFQA 4LOUD 1MF2L 4HTBA 3GLCA 1L0YA 4JTSA 1W3TA 6TAAA 3RMEA 1CMOA 2C3WA 5C0CB 3HMCA 4S3AA 5PAZA 4DUWA 1A9VA 2NQZA 3BUDA 3ZE2F 1HP5A 3NGJA 5KVDL 1X7SA 4ECNA 2ZD0A 4KQ4H 4XNBA 1A6WH 2PFHA 3CIAA 3T4YB 3FRUB 1P4IH 2NSQA 1EBHA 4M1GH 3U0HA 3FTGA 4RNJA 4GPVA 4XNUL 3SDDD 4FADA 2CRYA 3OV6A 4QHKI 1BTCA 3QI9A 4TX6A 4L29B 4Z42C 4OCSH 3I84A 1KLUB 3ARYA 1JF6A 4OOUA 1B0RA 4G6AC 5IW1A 1GZ1A 1O6VA 2V0TA 1BEXA 3OQRA 5LXEA 3DTXB 1ZIBA 1ZA3B 1S8DA 2G9HB 5EOTA 2V2TB 3CCHB 1LEKB 1LO5A 1NGZB 1RK1B 1YN6A 3SIMA 3UETA 1T1ZB 4AQZA 3BMXA 2NTFA 4DP1X 3HC0A 3TV3L 1KJMB 4MNGE 5D03A 4GZJA 1XSOA 2DLEA 4M48L 2NW3A 1XRFA 4GRLB 5JH1A 1OW0C 4X7SH 1MFDL 3R06A 2FDSA 2NTSP 3QJAA 3R12A 2Y8KA 2YLKA 2AKMA 4G5ZL 4GUFA 3BPLC 4P57A 5CJXC 4ES8A 1UUMA 4MCYB 1O6SA 1MJUH 5IF0A 2ZYIA 1VADA 3TJEH 2VUOA 4IM4A 2OGYA 5E5MA 4ZMAT 2WMIB 2H6PB 4XB7A 2R29L 4M7KL 1UR8A 2C16A 2DKMA 2D2GA 2X7WA 3ZKSD 2VDPL 3ZHFA 5CEZD 2GT9B 3T1WA 1MLBA 2P76A 4HF5L 4BM7A 1FL3A 2WXLA 3OKNB 4IBYA 4PHZA 4PFEA 3R43A 1MAKA 4ZO9A 5D96C 3VXPA 1XGPA 3HE6C 5DS8A 5BWFA 3ARGB 4P5KB 4P4KC 2YUXA 4BQ6A 2BOLA 4FTVE 5SX4I 2DQGH 1IAOB 1LJMA 1L9MA 5KBDA 1GEQA 5DLMH 3TMLA 5I78A 1IBGH 3FB5B 4KFNA 2P26A 2WW8A 2R0WH 2H32B 6XIMA 4UOW0 1JVLA 3T09A 4FLHA 4MWFB 2GB2A 1K9TA 3CVCA 2BRRH 4LLYA 3SYPA 3VFGH 1V3IA 4OZOA 3QJTB 3N41B 2D23A 2Y7EA 3PWPA 5ABHA 1A4BA 4LEFA 4L65A 4F2FA 2NYYC 4H4NA 4XBGB 2CAKA 1T7ZA 4WVXA 3ARED 5EBMB 2WXJA 1CGWA 3B7UX 1E2WA 1NBVL 5KSVA 4MQ7A 1SBSH 5ENWA 1TMHA 3WBDA 2A2IA 3PNRB 2VAAA 3QXUA 4Q4OA 3T3PF 1V02E 2UY7B 2L04A 4NRYA 2FTAA 2WMGA 5HJXA 2PWHA 4JQ3A 4NBYB 1LWHA 3HI6H 2P45B 2DW7A 3E7JA 2YDSA 3J2PA 4NAFA 1NWUA 3BQUB 1G9EA 4Z18A 2OWWA 5A6SA 4LUYA 2B5IB 4AYMC 2YCKX 1GY2A 4DJEA 2CA3A 1ENUA 1FV1A 2EDXA 4LSUH 1EEZB 4IS6A 1TTBA 4ZO6A 4L61A 4UQIM 3SDYH 4BCEA 1HHKA 2QMJA 3BSGA 3FHQA 2K1MA 3GNML 5LXGH 1GGCH 1ISZA 4AQLA 2QV4A 4M1CC 4ALDA 4I7VA 4N68A 1EQCA 2BVOA 5G2WA 4NHCL 2OR7A 2BXVA 2EDQA 5GS2H 1S78C 1TIMA 4F40A 4WJEA 4RMQA 3D3FA 3BZ4B 1ONQA 4NZ5A 4A7SA 3D3VE 5KUKA 3PCYA 4GO8A 1I6NA 3O4OC 3TN6A 1LWRA 3WKYA 4RPQA 3FJNA 4C6OA 2I7GA 4K8HA 3O3UN 3ULUE 1NUFA 1FTXA 3JWOH 1CL7L 4JAMA 4YBHA 4QBXA 4DQWA 1UR0A 1K1DA 1PG7L 3NPSC 3MXWH 1PKLA 4MJID 1Q6RA 2HVNA 2J66A 3Q1SL 1JWUA 4YDMA 1XKJA 4KY2A 5KJ4A 3SEPA 5JIMA 3QQNA 1CCWB 3RPTA 4MD0A 4Z7VE 3BLIA 4A39A 4O15A 2K3TA 5BZXA 2VWEE 2B7DT 2IS7A 4LNCA 2R1WA 2EXWC 4ZENA 2OMVA 3D5HA 4WOQA 5C0EA 3QFWA 1FGVH 3NGBC 3QO1A 5DHVH 3DG6A 5BXTA 4GAAA 5ES4B 3MOBL 4P2QD 2MKLC 4A7VA 1FFQA 3G6DH 4L9LA 2J62A 3NPWA 4DIAA 2PRMA 3WQEA 4I0KA 1JDEA 3IJIA 3K2UH 1GW6A 1EO5A 1U42A 3H2QA 1KJ2L 3BVVA 4PI0A 2Z0BA 4PVLA 4Q56A 2IF7A 3F6LA 4JO1L 3BRDA 1INQA 1UZHA 5IJKA 1KEML 4MQXC 4JTLA 3G0SA 3S37L 1F11A 1KTDA 1KTBA 2Y22A 1CO1A 2WBKA 4JMXA 3IJ9A 3GMMA 2O5XH